1VRDA

Crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
457
structure length
321
Chain Sequence
MKEALTFDDVLLVPQYSEVLPKDVKIDTRLTRQIRINIPLVSAAMDTVTEAALAKALAREGGIGIIHKNLTPDEQARQVSIVKKTIMSVIEHPNAARDEKGRLLVGAAVGTSPETMERVEKLVKAGVDVIVIDTAHGHSRRVIETLEMIKADYPDLPVVAGNVATPEGTEALIKAGADAVKVGVGPGSICTTRVVAGVGVPQLTAVMECSEVARKYDVPIIADGGIRYSGDIVKALAAGAESVMVGSIFAGTEEAPGETILYQGRKYKAYRGMGIEGMVPYKGTVKDVVHQLVGGLRSGMGYIGARTIKELQEKAVFVKIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords inosine-5'-monophosphate dehydrogenase
publication title Crystal structure of Inosine-5'-monophosphate dehydrogenase (TM1347) from THERMOTOGA MARITIMA at 2.18 A resolution
rcsb
source organism Thermotoga maritima
total genus 102
structure length 321
sequence length 457
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vrdA00
1G69A 1ZENA 3L5LA 1VYSX 3PULA 2J9XA 3S1XA 1GVRA 1G7VA 1XBVA 3QFEA 2ZZ4A 5L9FA 1R30A 4ML9A 1AW5A 4ZQNA 3FYPA 3SY5A 1YTEA 3NQDA 4EIVA 1OF8A 2ZYFA 4JTIA 4RV8A 1SU5A 4C1LA 3MW7A 3BK0A 3B03A 4OE7A 1OFOA 3BG5A 4RK8A 3G1XA 1O5KA 3SI9A 4JYEA 2DJLA 3T4CA 4JIQA 1TYGA 5EL1A 4OGZA 3W84A 3S1VA 3W7RA 1N55A 3GDRA 1RQHA 1ZCOA 4HSOA 1Z41A 3N19B 3NDOA 5LNRA 3FJLA 3TXZA 3LHWA 3I65A 3MO7A 1JQVA 1KV8A 2QCEA 3TSBA 1LBLA 4UMCA 5CSRA 2FJKA 4K7VA 3P62A 4UFJA 2ZZ1A 3AJXA 3QW4B 2GPTA 4A21A 1H61A 3PM6A 4DF0A 3C0JA 4Q4KA 4JTKA 3I7SA 1U83A 4MPQA 1F2JA 4JS3A 1QO5A 1Q45A 1OFRA 5MHBA 3WJWA 3GNNA 2CW6A 3W1RA 1P1XA 4O1CA 3GLCA 3IVUA 2C18A 2E6DA 3IIOA 1P4CA 5E93A 3W2UA 1J4EA 1JCNA 3N34A 1XL9A 5F4XA 4YXGA 3C3NA 3W73A 1KTBA 3UD6A 2V30A 2OMAA 4LC8A 4BWLA 2A1YA 2Z6JA 3KOFA 2ISSA 3OA3A 1LCOA 2Z0IA 3FJ6A 4CNPA 4Z1AA 2H3BA 1OFAA 1PS9A 2RHGA 4FIQA 3W7PA 4JX4A 2V2CA 3M41A 3TR2A 3W7KA 5CPNA 1BWLA 3L0NA 2CLLA 3QMTA 2E6AA 4DPPA 4K37A 3MUXA 2E5CA 2ISWA 4OT7A 4ZL1A 1H5YA 4EF9A 5D05A 3A9IA 5K4XA 5AYZA 4FXRA 1JVNA 3LV6A 3KHJA 2Z2UA 1UUMA 3BGGA 3EX2A 4CCCA 1YDNA 3LHTA 5K2ZA 1EP1A 1ICQA 2KZHA 3NZRA 5J5DA 1WA3A 3AO0A 1W0MA 2VFHA 3ELFA 3HQ1A 1B4EA 1EUNA 3W2LA 4JTEA 2B0MA 3R13A 4KFNA 1WAUA 5HUOA 3W1UA 1YYAA 5I3FA 1EB3A 2AGKA 3UPBA 1FDZA 4NX0A 5AHNA 4ALDA 2A0NA 2VOMA 1YXDA 4EWND 1OVDA 2OT1A 2I14A 4MIMA 4XQ6A 3P61A 1TPWA 2QJHA 4GFSA 2DZUA 2DP3A 3GXTA 1TB3A 1A5BA 1TMHA 1KV5A 1XBZA 2CZ5A 3ABSA 4FO4A 4RXFA 1JCYA 1TQJA 2RH9A 1YADA 2XN1A 5KZEA 1TREA 2V5LA 1H51A 1ZFJA 4NX5A 3W76A 4ZQOA 4QSHA 1RQEA 5L6UA 3HPXA 1Y0EA 2ALDA 4CCEA 4XKYA 2CLEA 4QISA 4XBKA 3CWOX 3I68A 2WSQA 3PS7A 2Q8ZA 1IIGA 3EX6A 1WOAA 1OFDA 3O8AA 1T8XA 3HG4A 5D38A 2W6RA 1DJQA 3DHFA 3O6CA 3VE9A 5C54A 2VELA 4DO5A 4WJEA 1IF2A 1MEHA 2A6NA 4K7YA 1QCWA 5F2MA 2J24A 2V5BA 2Y88A 1K8XA 5HWNA 2DZTA 1R2RA 1AW2A 2ZZ6A 3EKZA 4GWEA 2PURA 5K4ZA 2OX1A 5C6MA 3M5XA 2OZ0A 4UUIA 1H1YA 4OV4A 1MZHA 3NVTA 3GKFA 4LS2A 2D73A 4LC6A 1TRDA 2J9ZA 4AVFA 3TAOA 4UFLA 2GUUA 3NO5A 4M6VA 2Q3OA 3GR8A 2AAMA 5FI8A 2YX0A 4IMCA 1NSJA 4NVTA 5K9CA 3PB2A 2CU0A 1ADOA 1W5PA 4O18A 1NF7A 4R33A 4XTIA 5HUPA 2VFGA 2Y63A 4UTTC 3TH6A 1B57A 3P74A 3GAYA 4G1KA 1TPEA 2YDAA 3RNDA 3HOJA 3LCLA 4R7JA 3SIZA 2P1FA 3LCIA 3KAOA 2ZRYA 1OHLA 4OWGA 3W87A 4MZ1A 1PCWA 4LVFA 4JY9A 4M6PA 2Y61A 2EPHA 4XBSA 1LDCA 3NQEA 3ZWTA 4HT3A 4CQ8A 1DKWA 1K7XA 5TQLA 1KM4A 3EWBX 4ORIA 1YTKA 4MFEA 3CM4A 3C6CA 5F2GA 3L65A 3Q2DA 5U7SA 2GOUA 4LWWA 4R53A 1L2UA 3C56A 1H7XA 3SECA 3A22A 4NNBA 3MI3A 1FWNA 3GXPA 6TIMA 3RMJA 3NM3A 4FNSA 3USBA 3TROA 4FF7A 2ZZ3A 2NXIA 2QCMA 1S3HA 4BI7A 3P5YA 1XBXA 4N2YA 3U2OA 1HO1A 2FB2A 4UTLA 3HPZA 1QWGA 3E49A 3TE9A 4HNTA 1K7FA 2B4GA 1TIMA 2DU2A 4WQ6A 1W8SA 5HMSA 3B05A 1XBYA 3CWNA 3SSJA 2BX7A 5LGXA 5D33A 3WFAA 3ABRA 3IVSA 1TQXA 3A5VA 2NLIA 3DFPA 4J9JA 1K7EA 3CIWA 2JGYA 2R94A 3I6RA 3GX9A 2WO5A 1DHPA 4MUZA 3IV3A 5AC7A 2E1DA 5CPLA 4LVAA 5D04C 1G4SA 4AXKA 1GVSA 2PRHA 3LTPA 3TSDA 4N9BA 3QPYA 3EX3A 2NV2A 1LOSA 4JIPA 4AHQA 2ZRVA 3PUEA 1I4NA 2TSYA 3CB8A 1JR1A 3SR7A 3MYPA 2H90A 1AW1A 4N9EA 3PAJA 3RFAA 4UTWA 3W2NA 2A5HA 1DOSA 3B0PA 1G4TA 4NJIA 2Y89A 1JRBA 3DKLA 1KBJA 2H8XA 4FNQA 4ZQCA 4FEZA 3I7QA 5D02A 2VFDA 2R14A 3WK3A 5FESA 3TFCA 3NEVA 1FCVA 1W3IA 4IUOA 4N9DA 2J9YA 1NFBA 7TIMA 3CC1A 1VCGA 3TUUA 2GQAA 5BMWA 3V1PA 3W86A 3G3MA 4MZYA 3TX9A 3HGJA 1JULA 3G1SA 4JY8A 1IGSA 3UWYA 3R8RA 4S2BA 5A5WA 3THQA 1JUKA 4Y6GA 3LI0A 2GVGA 4L4LA 2OCZA 1EWEA 5G2HA 3LHUA 2EHHA 3UWUA 5C5YA 4IGHA 1ML1A 4FNPA 2CLFA 2OT0A 5CZSA 1LRNA 3DFNA 3TSMA 3EWZA 5AYXA 5KINA 2Y7FA 1OFEA 4XWUA 3L9CA 1E51A 1ZALA 4JD4A 2J6XA 2VC6A 2FPYA 1OF6A 2A7PA 4FNUA 4NNAA 1F73A 1YLVA 4LRTA 5AOUA 2BWGA 3PSVA 2WSRA 4GUIA 2EF9A 2WNQA 5DELA 2OJPA 2NWRA 2HS8A 4O19A 4JTJA 2V81A 1VCVA 2YGYA 2Z6IA 3KVKA 1R47A 2BTMA 2CZDA 3Q37A 4LVDA 3HIJA 2FB3A 4RZ5A 2B7PA 2C19A 3NR0A 1DL3A 3G8RA 1KM3A 4GUJA 2TMDA 4LUJA 2NZLA 4RJEA 3F4WA 1B3OA 4NJJA 5DBUA 4DEFA 1EP2A 3O05A 2R91A 1X7FA 3VCRA 3KRZA 5E0KA 4A2SA 4PEKA 1JJKA 4NZJA 3G1YA 4WX2A 4BK9A 3CIXA 3DZ1A 4E2DA 3W1LA 4UNLA 4LV4A 4CNNA 2WKJA 3L66A 3LCGA 1DBTA 5D09A 2V9DA 1T0OA 1M5WA 3CT7A 3SW6A 3UY8A 3W1MA 5SWUA 3EWXA 2ZZ2A 3NQCA 2A6LA 4RLIA 3QPZA 1PCKA 1X1OA 4K8HA 1DQXA 4LT9A 1TRIA 3N73A 2C16A 4UTTA 1HTIA 4CNOA 1ICPA 3MHFA 1SW3A 1JQXA 4AWUA 1JCLA 1VH7A 1GPWA 3IIVA 4QQ3A 5HULA 4AAJA 3BGJA 3ZWSA 3TQ0A 5KZMA 4O0ZA 1R2TA 2ZRXA 1AMKA 2QEZA 5D2VA 1F05A 4O12A 2Y7GA 1OJXA 3ZFHA 3M1ZA 1EA0A 2GJNA 3QQ1A 4IPJA 1LOQA 5CZJA 3E0IA 1J5TA 1GZGA 1SZFA 3PG9A 2JKPA 1ZAHA 2DZSA 3MMTA 3L67A 4P61A 1N8FA 5AHEA 4N6EA 1A50A 3QQ0A 4JN6A 4NUWA 2VEMA 3RF9A 4DPQA 3W1AA 3W71A 2E5DA 4UR8A 5DBTA 3C2RA 1QR7A 3L2IA 3L5AA 4IQLA 4GRSA 1JRCA 1IXQA 4A22A 3OEXA 3TMQA 1SZNA 1OX4A 3TCEA 5K3VA 3TV8A 4XUGA 3M5ZA 3STEA 5F1VA 3G22A 1VR6A 5K9DA 5LNUA 1SUXA 1C9DA 3HB9A 4UXDA 4NT0A 1NVMA 5G2WA 1GEQA 4RXGA 1AK5A 4UC5A 1FDJA 3S42A 1LYXA 3BO9A 2B7QA 1OYCA 5CGQA 2J27A 4M7SA 3W2JA 3W85A 1MO0A 3G1DA 3FS2A 1DJNA 3NPVA 1TCDA 5KTLA 4LU0A 2A7RA 2ABBA 4N6FA 3QSRA 4Z0SA 4LOCA 5AYYA 2IQTA 3IVTA 5DY2A 1S5VA 3LBMA 5G1TA 4M5PA 4O1DA 1RQBA 5HWJA 3GNDA 3TDFA 3VNDA 2ZTKA 3QC3A 2C0AA 4OQVA 5CKSA 3GDTA 3A24A 2FIQA 3CPRA 4AF0A 2E77A 3P84A 3DFSA 4JTFA 3HBLA 4QNEA 1KFJA 5AHFA 1O5XA 1YXCA 3FEMA 3MP3A 2EKCA 1JCXA 1MEIA 3M9YA 3BLEA 1WBJA 2G5WA 4RZ4A 3VE7A 4YCOA 3T7VA 4O17A 3TQVA 1W1ZA 1LM1A 1ZY9A 4GUGA 1TPUA 4PFMA 4KKXA 5AHMA 3W70A 5HJLA 3BW2A 2GVJA 5H91A 2NXGA 4FX6M 3PSWA 4LTSA 1X6UA 4HPXA 4JTTA 4GBUA 4HIBA 4PL2A 4AH7A 3QSTA 3DGRA 3STGA 4JTLA 3M0ZA 4OBTA 1PL9A 3JS3A 3QF0A 3PWAA 3P82A 4IPIA 1OYAA 3UZJA 4AWSA 1FXPA 1GT8A 1KM2A 4K36A 2P0OA 4LV9A 1SFJA 1QO2A 3PC0A 4CQAA 1W5MA 1BWKA 4FB7A 2DJXA 1CX9A 4RZ6A 2X30A 4YL2A 5BNKA 4IMDA 1LOLA 3W88A 2EAWA 2X1SA 4O1BA 2YYUA 3STFA 4N9CA 3N3MA 3NQVA 3G1HA 2V0TA 2QKFA 3R12A 4JEQA 1FXQA 2YCEA 2ZRWA 4Z1DA 5C55A 3NA8A 4K6AA 3LCWA 4UCGA 2HSAA 5EYWA 2ZTJA 3S0CA 3Q58A 4NJKA 4U28A 3NQ7A 4I7UA 1Q6OA 1Q6LA 1QNVA 3EWWA 4UFKA 4LVBA 4ADUA 3W7IA 4UTMA 4ZMGA 5DLCA 3STCA 1FWTA 1KLZA 3OG3A 3VKJA 3M7WA 4DELA 4TIMA 3G0UA 5AHLA 3B0VC 4HKPA 3W7GA 2QCGA 1D3HA 2V82A 3PBYA 3L0GA 1H62A 1ME7A 1H7NA 5IBXC 2O7SA 4N02A 1VCFA 5CZ0A 5AC6A 3L0KA 4UFMA 1GYNA 3NGJA 1L6WA 1H1ZA 1OFQA 1OX6A 3DFTA 1HG3A 1O95A 3NQAA 1TPDA 1SO3A 1BEUA 3SGZA 3NNTA 3S9YA 1Q3NA 4IXXA 4O13A 4GC4A 3MHGA 3S5YA 1VS1A 3GDMA 4QIUA 1U5JA 3EXRA 4JTSA 3HG3A 2V2DA 4S2CA 1EEPA 1XUUA 1XKYA 1ME8A 5FF4A 3QRHA 1H50A 4K8EA 3M5YA 1UUOA 5LKYA 5I3KA 5G2IA 1G6CA 1GG0A 3PUOA 3UWZA 5D32A 4WXZA 3S1WA 4WZHA 5EKYA 3P8JA 3EX4A 2C6QA 2QCHA 1FQ0A 4DBDA 2ZZ5A 5C2XA 3W23A 3UY7A 2QDHA 4ICNA 4PA8A 3FFSA 5AHIA 3ABOA 8TIMA 2WV8A 2JKEA 4XTDA 3C61A 5FEXA 4KFOA 3BG9A 2GVLA 2CLHA 3W1NA 3SZ8A 1IXOA 3W72A 3HMJG 1M7PA 2RDTA 3OVRA 5FF2A 2WJZA 1N7KA 5EA9A 1EIXA 3W74A 1B9BA 4Z1CA 4OU1A 4AHOA 1Q6QA 4M7TA 1ZAIA 4AB4A 2F7FA 4Z08A 3DFQA 3MI6A 4AMAA 1NEYA 1I45A 4MLRA 3TJLA 3PR2A 4FNTA 1SPQA 1CW2A 2UV8G 5CZTA 3IGXA 3NOEA 3LCFA 1DORA 4DO4A 3IRDA 2X16A 3G8EA 3C4UA 3M47A 1L6YA 3EB2A 1SO6A 3PB0A 2ZDRA 3KX6A 5EY5A 1Z48A 1XI3A 3PBWA 4MYAA 4LW7A 3C2VA 3DAQA 5F2LA 3LI1A 1F7BA 3VI2A 5HQEA 3W83A 1KBIA 2V2HA 3EX1A 2ZZ7A 3NPUA 2H3DA 4O4VA 2A21A 3B04A 1GJPA 1O4UA 3FLUA 5GVJA 3P67A 4JNMA 4KFPA 4GNJA 3EWUA 4MVAA 1DQWA 3LBCA 3M43A 5A8GA 3QEZA 5I3IA 5TIMA 3G3DA 3O6YX 3BPWA 2YPIA 1OYBA 1QPRA 3E96A 2NWSA 1LBMA 2E6FA 4Y9AA 1VLIA 2E09A 2QCCA 5CG7A 1F6PA 3GB6A 5BW6A 3LLDA 3MYOA 4FIRA 2G97A 4A3UA 3E02A 2VXNA 1I8JA 2ZBTA 1JUEA 3KVJA 1ICSA 3TFXA 1X1ZA 3SGUA 1VZWA 1NF0A 1SW0A 4O52A 2FPTA 1PHQA 4HNVA 1G4EA 3FKKA 3BVJA 2Z1BA 3RLUA 3MP4A 3GDKA 3INPA 2HMCA 2E68A 1TPC1 5HWMA 1FWSA 2W79A 3HO8A 5BRBA 2FLIA 2QCNA 4JYFA 2QCDA 4ZZ9A 3GYEA 5AFDA 2ZA3A 1XFBA 4O1AA 3WK2A 3C52A 1LP6A 3N14A 1TO3A 2TYSA 2QF7A 2FQIA 5I3GA 5BMXA 3LGEA 3R5EA 4O10A 1KM1A 3HGRA 2CWNA 5KMYA 1K03A 4IWWA 5HINA 3N9SA 3MBFA 3NL3A 3NQMA 4DXVA 4K38A 1F76A 3TXVA 5DN1A 1SO4A 4XKYB 3DFOA 4UTIA 1KM6A 1VQTA 4UTKA 1UJPA 3LHVA 1QOPA 1TV5A 4JGDA 4MY9A 2ZFAA 5FF3A 1A53A 2A85A 4IOTA 4BI6A 2PCQA 3UPWA 4HHPA 2Y70A 4ZVJA 4XZ9A 1W3NA 1L9WA 1KTCA 1SZGA 5K7JA 3LHZA 4UR7A 3BV4A 1HFBA 3O06A 5CSSA 3NAVA 4FHAA 4QAIA 3PG8A 4PTNA 3W1QA 1FWWA 5IBXA 3ATZA 3GKAA 3UWQA 3HG5A 4UTUA 3PF3A 4ORMA 2BSLA 3G24A 4X3ZA 5G1YA 3FA5A 1KM5A 3CU2A 3DI0A 1AL7A 1DV7A 1TSIA 1EP3A 3F4NA 1GTHA 1VHCA 5HNRA 1RV8A 3LDVA 4BF9A 3TA6A 4H6KA 1YDOA 3GK0A 3GZ3A 3LOTA 5G5IA 2VEIA 5AN7A 3NG3A 1KM0A 3CEPA 4O50A 3BLFA 1GQNA 1D9EA 3H55A 5EBUA 4JDYA 5BOOA 5CPOA 3EEGA 3B06A 4HN4A 3PBVA 4YLWA 5I3HA 1K02A 2E5BA 1GWJA 4LNYA 3GIYA 2QR6A 4KWWA 1NAL1 1OX5A 3TMLA 1GVFA 2Q8LA 3O16A 1LRTA 1VC4A 3F1QA 2H8ZA 4ZQRA 1LBFA 1KLYA 2TPSA 3QMSA 3QH2A 1LTDA 4OHQA 1YPFA 2C14A 3O15A 3PVFA 3LRMA 1KA9F 3JRKA 1HL2A 3FIGA 5F4WA 2VENA 2CZEA 3H53A 3WJSA 4ADTA 2H6RA 4GJ1A 1QPQA 2DZVA 4O14A 3NZ1A 1QAPA 3E12A 1TV8A 1TPH1 3G1VA 2RDUA 3W7MA 1ZHAA 3L68A 1VLWA 3DKJA 1YTDA 3N2XA 2P10A 3RU6A 2R8WA 3T40A 3DH7A 1QDSA 4ADSA 4TX9A 4NJHA 4TR9A 1QOQA 1QMLA 4GXMA 1JCMP 3N2MA 3TK7A 3W7QA 2ZA2A 4TMBA 1WQ5A 4IMFA 5LZLA 2B7NA 3UXDA 4O11A 4TMCA 5FEWA 4Y96A 1JCJA 4X9SA 3M44A 4BI5A 1S5TA 2NXHA 1D3GA 3WJXA 3QW3A 3DHDA 4UMAA 4FXSA 3I7RA 3R89A 3MWAA 4JDBA 3THAA 5H2ZA 4HNUA 5D2YA 3W3OA 3QYQA 2DZPA 5AC8A 3RK8A 3TIMA 3S1UA 3DI1A 4C1KA 1SFLA 3TW7A 4U4MA 3NM1A 5LNSA 1XDLA 1TV7A 1EWDA 1YDVA 3EKLA 2VFFA 4WOQA 2GQ8A 5KITA 5LNWA 4DQWA 1OK6A 2RFGA 3VFLA 1SSGA 1W37A 4B5NA 1RVGA 4L4MA 2JK2A 1XUZA 2J88A 4D2JA 4UTHA 1VRDA 3LLFA 3A21A 4DF2A 3LXCA 1RD5A 3KXQA 2VFEA 1A5CA 3P81A 4YCPA 4NZFA 4O57A 2BXVA 2Y85A 2YR1A 1LLWA 5F2IA 3C2EA 1SSDA 1WV2A 4HNNA 3SFKA 5G4EA 3CTLA 1Z44A 1OG0A 4NXSA 3DBPA 5K9XA 2QCDB 3G0XA 4MJMA 1O60A 3S5OA 5LNVA 4M6QA 1OFPA 5D30A 1I2RA 1P0KA 4AWTA 5DXYA 1A5AA 3EXSA 3LTSA 3WJZA 2CFFA 4IX0A 4GUFA 1H7WA 3G18A 1W56A 3DU0A 3A5FA 1AG1O 1QFEA 1TJPA 3S5NA 4UTWC 4WXYA 5DCBA 2C3ZA 3W1XA 1Q6RA 4PH6A 1MEWA 2ATSA 3YPIA 1LROA 1WX0A 3W7HA 2WNZA 4CCDA 3S6DA 1LLZA 3L5MA 3S5ZA 4JICA 3F03K 3QM3A 3NL2A 3MI2A 5U4NA 1XDMA 4UFHA 4O28A 1FCBA 2ISVA 5IM51 3UYCA 1B4KA 1UBSA 1V7YA 4JTHA 2JKAA 1FY6A 2QJIA 3WK1A 4ZQPA 1ZNNA 4RR4A 4MZ8A 5ABTA 4HSNA 2NX9A 2WPBA 4E0CA 3IEBA 1ONRA 3V75A 4QM1A 2PE4A 3D0CA 3PBUA 1ALDA 3ABQA 3LCHA 4GUHA 4PC8A 3DXIA 4UTJA 4MKNA 3UNDA 4M19A 3NXFA 4MY8A 2NUYA 1I2PA 1FDYA 3H54A 3E9AA 2XN0A 2FFCA 3RLVA 4MY1A 5KSWA 4LY8A 4OV9A 1KFLA 4Y8FA 4Z0JA 2AQWA 4JYDA 1THFD 3W7LA 1ME9A 3CQ0A 5EMUA 3FYOA 4I9AA 5F1UA 4FX7A 4EVZA 1F74A 1SO5A 3LX9A 1VJIA 3NQGA 2NUXA 1LRQA 1QPOA 2YZRA 4TO8A 3WJYA 4MOZA 5DCDA 4WOZA 4X22A 3BARA 4NQ1A 3W1TA 1K8YA 4QITA 3GDLA 3PUDA 3LXAA 4S1FA 3Q94A 2CLKA 3TNOA 2YW3A 3IGSA 1LORA 4H4IA 4BR1A 1M6JA 2QUUA 4ONVA 3QJAA 3KVMA 3W1PA 3MBDA 1W54A 4UFIA 3B0UX 1WOBA 1HUVA 3G0SA 5AB3A 3W7JA 2ZCGA 2A7NA 2FTPA 3KRUA 2ZQ0A 1G67A 1T99A 4NU7A 2FPVA 3ATYA 1XC4A 1PHWA 4FNRA 2PRMA 2YW4A 3OHIA 4O15A 3GAKA 2PRLA 3BW3A 4IXHA 1KTNA 1P0NA 4O16A 1YPIA 4X2RA 1UCWA 1OX4B 5LGZA 1TTJA 2YXGA 1SW7A 4LVGA 1KW1A 5I3JA 2WSYA 3P8IA 4N4QA 4LRSA 1F6KA 2ZRZA 2XFWA 3OIXA 2YFNA 4RCXA 5D2WA 5FF7A 1O94A 1GVQA 3GR7A 5EPDA 1F5ZA 2E6YA 3FOKA 4MJZA 5J5RA 1PIIA 1W5NA 2DZXA 1FBAA 3ZS4A 3KFTA 3W2KA 2I1OA 4O53A 4YWIA 3CEUA 4QNWA 2YFOA 4Z1BA 4O8RA 4WUIA 1C8VA 1TTQA 1I2QA 3SJ3A 1V5XA 2YYTA 3W9ZA 3U6WA 1IIHA 3W22A 3GXNA 4POCA 2PC4A 3CHVA 3O1NA 4CQ9A 4Q32A 3W2MA 3UWVA 4H3DA 5D2XA 5TBOA 4A29A 1ZJIA 2ZA1A 3NPWA 1PV8A 1TTPA 1C29A 1YXYA 4AF0B 4TU1A 4RX0A 1A5SA 3HG2A 1K3UA 3P60A 2QAPA 5HR7A 3CLMA 2CZFA 1QPNA 3TU9A 1KFCA 3BG3A 3W75A 2C13A 5LHEA 1TPB1 4WY0A 1PVNA 2JBMA 2Q3RA 1GOXA 1CI1A 1KFBA 4NNCA 2X2GA 4JR5A 3TJXA 1WXJA 3LERA 1OFBA 3HGSA 1MXSA 2ZRUA 2C1HA 2QUTA 1K8ZA 2VEKA 3LCXA 3ANYA 4O0KA 4DF1A 1IXNA 2VFIA 1WBHA 1EPXA 3C2FA 1GYLA 2QJGA 3OVQA 2Y6ZA 1H60A 4IX2A 1H63A 3B4UA 3T78A 1I2NA 2VEPA 3NPXA 4Y90A 5D03A 4Q33A 3TC6A 2YSWA 3OBKA 4IJBA 2NUWA 4AHPA 3W7DA 6ALDA 1SZEA 1PE1A 2DZWA 4MLJA 3BLIA 1WYIA 4E2BA 1FCUA 4NJGA 3NYZA 2G96A 3UQNA 4LS1A 2HTMA 3T55A 1SR9A 1EX5A 4WD0A 1MSSA 4NXKA 1DVJA 3MHUA 4JTGA 1IXPA 4FX8A 3S8HA 2FDSA 1TPVA 2QDGA 3FKRA 4I7WA 1JUBA 1X8FA 4BFAA 3TQKA 3NQ2A 1GVOA 4LS0A 2A4AA 3TW6A 2A2IA 4BWLC 1HO4A 4UMBA 2TRSA 2F84A 1GG1A 1SQ7A 3N9RA 2Y7DA 2Y62A 1W5OA 3EXTA 1FCQA 3HJZA 1ZAJA 2G95A 1RPXA 2QUVA 4IMGA 1AL8A 3W7EA 4QJ1A 2GJLA 3UZ5A 4MFDA 3NL5A 4YMZA 4JX5A 4O54A 3KRSA 3O07A 4GE8A 1VPXA 1TTIA 3P7YA 5T26A 4ZQMA 1UB3A 4PODA 3UXAA 1OK4A 3LHYA 4P2VA 2LLEA 3W7OA 1W5QA 1G4PA 3TAKA 4DBEA 5LHFA 3T44A 3O6DA 3LTYA 3UWWA 5D2TA 2O7QA 3NQ8A 2JGQA 2XN2A 2HS6A 2NV1A 2ABAA 3MJYA 4PL1A 3QZEA 2QCFA 3B8DA 2QAFA 2DORA 3PY2A 1VHNA 1H7OA 2CLIA 3LXBA 3G1FA 2C15A 3OVPA 3LB0A 1R2SA 1BTMA 1GTEA 1XXXA 3ZR4A 4EF8A 4IMEA 4DO6A 4JXCA 3IIZA 2CLMA 2X1UA 3NQ6A 5DCEA 4A2RA 1KFKA 2GQ9A 3M5VA 4K39A 3HGOA 1TJRA 4WY0F 2Y7EA 3A23A 1FWRA 3NQFA 2QCLA 1KFEA 3M16A 1H7PA 1TPFA 5DY3A 5HR6A 1Z42A 1EUAA 2X1TA 3R2GA 4RKAA 3M6YA 5KZDA 2WQPA 2V8ZA 3W7CA 2RKXA 1M7OA 3W6YA 3C2OA 1S5WA 3HF3A 4HPJA 1FUYA 1W31A 3LRKA 3U8GA 5DXXA 2RDWA 4JTUA 3IIXA 4LUIA 2B7OA 1XM3A 5G4WA 4W9TA 2VKZG 1P5BA 3GVGA 2CLOA 3KVLA 1H7RA 5LSMA 1UASA 3O63A 1RZMA 2NX3A 2X1RA 1J2WA 4JX6A 3MP5A 2BLEA 3IIPA 2BZNA 3LRLA 4CLMA 5FF0A 1BKSA 1VGAA 3TKFA 1G7UA 1OABA 3TC7A 1L6SA 5CPMA 1I2OA 3P80A 2EGZA 1XCFA 4UNKA 4O4WA 3L21A 3NL6A 4PCFA 2WNNA 3G1AA 2W0UA 1VYRA 1FX6A 3HPSA 1VYPX 4UIOA 4AEOA 3BW4A 5F4SA 3QMRA 5E1QA 3JR2A 1LZOA 5D37A 3LV5A 4R34A 4E38A 3EWYA 3LM7A 4I7VA 5FEZA 3WK0A 3W07A 2I9EA 1WDWA 4KWVA 2WOQA 1R46A 3C8FA 3DENA 2ATMA 1RR2A 2NX1A 3IGUA 4N4PA 5FEPA 1T96A 3P5ZA 4WY0B 1W3TA 3W7NA 3K30A 4MYXA 4EOUA
chains in the Genus database with same CATH superfamily
1G69A 1YE4A 3PULA 1JF6A 3LD5A 1G7VA 4IFKB 1GGOA 3WQCA 1AW5A 4ZQNA 4ZOBA 7XIMA 1NP0A 1SU5A 4C1LA 1UPMB 3BK0A 2GDQA 1AZ1A 4LPCA 3VGGA 2RJGA 1OEPA 4RK8A 5CEWA 1O5KA 1RK5A 3ARXA 3T4CA 4JL1A 4OGZA 3W84A 4JKMA 1IEWA 1ZS2A 1EZ2A 2J8GA 3MCOA 1AQFA 5A95A 3N19B 2WC7A 1DJIA 4WJXA 3MO7A 4IIGA 3UNTA 2VTFA 1Z6KA 5A2BA 4UQ9A 1FHDA 3B9OA 1JZ7A 1ZUAX 3P62A 2VO5A 3J7HA 3QV6A 3RCYA 2Z28A 4A21A 1M04A 3PM6A 1NDVA 4HK5A 4XO6A 4JTKA 3S46A 1J2BA 4RNHA 4C6PA 1K1DA 1F2JA 4AX6A 4JS3A 1Q45A 3R0DA 5A6BA 3WJWA 3W1RA 4UZSA 1OADA 1H1NA 1UWSA 1J5SA 3U4AA 5E93A 1WKDA 3N3TA 2UZ9A 1WZLA 4CNSA 1TMQA 3CH9A 3CO8A 3UD6A 1JZ2A 2AAAA 4LC8A 2OMAA 1KWGA 1XH2A 2Z6JA 1CDGA 4PR4A 5IOBA 3FJ6A 2WW5A 1L6GA 2HPMA 3R0KA 4FIQA 5A2AA 2Y2WA 4JX4A 5CBBA 1PSCA 2FVLA 1UMLA 3GFZA 5BXTA 3QMTA 3IJIA 1XX1A 2ISWA 1ZP3A 3OIHA 4ZL1A 4GYFA 2D2OA 2BOFX 4LEQA 1T6MA 1PXGA 4JHOA 5AYZA 3BGGA 4F48A 1ITQA 1GOWA 4IHCA 2VFHA 3HQ1A 4B3KA 2Z2AA 3W2LA 4JTEA 4ZO6A 1WAUA 1YYAA 1WKYA 2DFAA 5I3FA 2XM2A 3UPBA 4NX0A 1ZPTA 2A0NA 4B16A 1AJ0A 4EWND 1C8YA 3MCMA 2WM0A 4XQ6A 4LYKA 2QYGA 4CKQA 3GXTA 2DP3A 4XB3A 2AQVA 1TB3A 4Z2KA 2OR2A 4L64A 1XBZA 3ABSA 2EXOA 5C7VA 4J40A 1DJWA 4PB3A 1ZFJA 4NX5A 1CB7B 4ZQOA 3N2TA 4QSHA 1UR0A 4GOAA 5AKQA 5L6UA 3HPXA 3WBXA 4QTGA 4BCEA 2I5GA 1FWJC 3G1RA 3TQPA 4GINA 3TYZA 4CCEA 4ZB2A 1CXLA 5B80A 4PMJA 1J0KA 3I68A 4IGSA 2WSQA 3EX6A 3O8AA 1T8XA 3C5QA 1HJVA 2W6RA 1D2KA 3DHFA 3UA4A 3O6CA 3RO6A 3WEZA 3ANVA 3MCNA 1ZRQA 3ZR6A 2J24A 4UOJA 1TA3B 1NQKA 1O1HA 2DZTA 2P8CA 1AW2A 2PURA 2QGHA 2D22A 3GKFA 1LT8A 1UJQA 4U10A 4JIIX 1YNYA 3TAOA 4R85A 2YL9A 2RDXA 4JN7A 4LFYA 3MPGA 2Q3OA 4MMWA 1XD0A 1WE5A 1NSJA 4NVTA 2AMGA 4IIEA 1W5PA 4O18A 3BAYA 3GXIA 4B4HA 4XTIA 2OOFA 1A3WA 4H83A 4UTTC 3P74A 3AHZA 3GAYA 2YDAA 2ZE0A 2YB4A 4R7JA 4R3UA 3SIZA 3LYEA 1K9DA 2ZRYA 1M53A 4BQ2A 2PDBA 4QDMA 3R6IA 1I1WA 3H4WA 2CWXA 3ZOAA 1SGJA 4JFVA 3ITXA 1NDZA 2ZDSA 1F3TA 4MFEA 1R3QA 4J3TA 3CM4A 4AD0A 3PN8A 5U7SA 2GOUA 4R53A 3WLNA 3WNLA 1H7XA 2BY2A 1RBOB 2G3FA 1BQGA 4HN8A 3RMJA 3NM3A 4A4AA 3H26A 4M81A 1KBKA 2XH0A 9RUBA 1KNWA 4BI7A 4LALA 1A5LC 1EQCA 1HO1A 1E6NA 3LSBA 1HJWA 1S2TA 3HPZA 3COTA 1MI3A 1X38A 4PUUA 9XIAA 2DU2A 4WQ6A 3DG6A 3VNYA 4FAMA 3NEHA 2PDWA 3CWNA 1XBYA 1ODUA 5D33A 5FSEC 3P0WA 3ES7A 3IVSA 4JQ4A 4YHGA 1KGXA 4C6FA 3M6DA 2ZUMA 3A5VA 3CZLA 2NLIA 2VZVA 4EAYA 2VQUA 3GDBA 2R94A 2WO5A 2O9OA 1Q7MA 4LVAA 2WZIA 1GVSA 3LTPA 3PPCA 3QPYA 2WVVB 3A9BA 4YTRA 3OZMA 1I4NA 3CB8A 2O9TA 3SR7A 3LK6A 4GY0A 1ZJBA 1XD1A 3RFAA 3W2NA 1DIEA 3LQGA 2X0SA 2V3EA 5HMEA 4OBSA 4S39A 3MKKA 1WXYA 3ZO9A 4HYVA 4DJED 3AHVA 1IEXA 3E3HA 3I7QA 5D02A 2VT0A 4W86A 4HMEA 4U3CA 3NEVA 2WJEA 5E70A 7TIMA 3CC1A 1FWEC 3TUUA 2GQAA 4FXFA 1MQQA 4MZYA 2YA0A 1AODA 1JULA 3G1SA 5C9UA 3S6OA 4S2BA 5A5WA 1JUKA 2X7WA 4Y6GA 1L6FA 2GVGA 2OCZA 3SCNA 3UCCA 2YCJA 1EQPA 5C5YA 3WSUA 2UY2A 2OT0A 3TSMA 3EWZA 5KINA 3VVGA 1OFEA 1V02E 1ZALA 2J6XA 5H8PA 4IH3A 3QQWA 4PBEA 5AOUA 3PSVA 4DZAA 2EF9A 2WNQA 4AUBA 4GQBA 2HS8A 2YIHA 4AX7A 2PDFA 2Z6IA 5C7HA 3VDGA 2BTMA 1E43A 3Q45A 3Q37A 4LVDA 1ADDA 4NHVA 3UT0A 1Q7QA 3WDPP 1R9YA 4C7FA 3VOCA 4LUJA 1HVQA 3F4WA 4WSHA 1B3OA 4DEFA 5DBUA 1EP2A 4U2ZA 3U9IA 4US6A 4A2SA 4PEKA 4WX2A 4GC3A 4NY2A 5HDRA 4JFUA 4BK9A 3CIXA 3ITOA 4E2DA 3W29A 4LV4A 3BLKA 3L66A 1DBTA 3KBSA 5D09A 3AALA 4QDWA 1T0OA 1BYAA 3ITCA 3UY8A 2QT3A 5SWUA 3KBNA 2WMFA 2ZZ2A 1DPMA 1P7TA 2A6LA 3GY1A 1QI3A 3N2BA 2NT0A 1FP8A 1G01A 1KO0A 1VH7A 3E2VA 1ISXA 4GJJA 3C0QA 4EPDC 3MU7A 3ARSA 5KZMA 2WK2A 4H1ZA 3KUMA 1R2TA 2ZRXA 3IK2A 2EPLX 5DRCA 2QEZA 5DRIA 1UKQA 3NSNA 1F05A 1F3XA 4DZHA 1OCJA 3MV01 1OJXA 1IYXA 4ZOAA 2DZAA 3GRIA 5CZJA 3E0IA 4JQ3A 3VDHA 1FWHC 2H9AA 3UPMA 4P61A 2QPSA 4NUWA 4JN6A 3QZ6A 4QE1A 3W1AA 4UNIA 3W71A 2E5DA 2R1MA 1JRCA 1IXQA 2OGYA 3GWQA 1A4MA 4FR6A 1BXNA 4NASA 3M5ZA 1VR6A 4I8YA 1PX4A 1YRRA 2VJXA 3K4WA 1E1CA 1LYXA 4C6QA 2PFHA 1OYCA 1U33A 3SSZA 2RGMA 3RM8A 4HHLA 4X60A 2ZWYA 2DIEA 5KTLA 4LU0A 2A7RA 3OU8A 3WENA 4XISA 3AWOA 2QPUA 4LOCA 2FVKA 4C6EA 1E0XA 1YBQA 5AYYA 2IQTA 1J12A 5DY2A 4GY7A 3VU2A 4F66A 1UZHA 5G1TA 4GI4A 1TE6A 1RQBA 2HVNA 1UKPA 3UESA 3VK5A 3QC3A 5CKSA 4PULA 4C60A 4E2VA 1JAEA 3P84A 4IPNB 3DFSA 4QNEA 3HBLA 1L0PA 1ZCCA 3ZLHA 3VDBA 2DV0A 2ESCA 3OBAA 3WH9A 3ZJ8A 4RW5A 4V2XA 1UR3M 1XYZA 4O17A 4A6GA 1C7TA 1W1ZA 3TVAA 1TWSA 1WDRA 1GW1A 5AHMA 3W70A 1E0UA 3V4BA 2GVJA 2NXGA 4CNTA 3U2ZA 4AZGA 2E67A 2PDLA 2V5JA 3WDQA 4AH7A 1ZU8A 3DGRA 3W24A 3STGA 1FWFC 2REQB 3QF0A 3E0LA 3KTCA 4PCPA 4LB3A 2F38A 3MTWA 4OOZA 3W38A 1GT8A 2XDFA 1S1PA 3EOSA 1DJXA 3PC0A 4CQAA 2NQ9A 1JYNA 1BWKA 1SJBA 1DXFA 4HCLA 4RZ6A 3L2MA 5BNKA 1H41A 1LOLA 3W88A 3KL3A 4LAOA 5E0FA 4XD6A 2EAWA 4N9CA 3ANUA 3N3MA 3OP2A 2V0TA 1M68A 2QKFA 1V6YA 5CJ5A 4JEQA 2WB5A 1HQTA 2YCEA 3UF9A 4RL3A 4Z1DA 2QXWA 5EYWA 4AZ5A 1KR0A 1QNVA 3EWWA 2DUXA 1V6XA 1EJXC 3WO8A 3STCA 2EO7A 2FYMA 4DZIA 1QNPA 4CD5A 1WNOA 4ENLA 2R1KA 3G0UA 1D3HA 4KMQA 3GTFA 2ANUA 3SCUA 2AKZA 4G7FA 3KOYA 1VCFA 3H24A 3L4ZA 3FHQA 3NGJA 4AY8A 1H1ZA 3B9EA 3T42A 2W92A 1XLLA 2OQYA 1XLCA 2YA2A 4Z2HA 3S9YA 4WSJA 3ARUA 4O13A 4GC4A 1R85A 4W87A 3S5YA 2XVLA 1MRQA 4C6IA 1QNQA 3AS3A 4H6EA 3M5YA 1EJUC 3LLXA 4HMCA 1UUOA 3F4VA 1MRAA 5G2IA 4AQLA 1LUCA 1LWHA 3ZVHB 3W0KA 1DWIM 2DQWA 2YCIX 4QLJA 1HIZA 1TG7A 1K70A 4DM1A 3S1WA 3S2LA 1S2AA 3EX4A 4B3LA 2QCHA 2ZZ5A 4LH8A 5C2XA 1XRVA 3VNJA 1D7FA 2WV8A 3LZ5A 4Z1YA 2GVLA 1QI2A 2CLHA 3W1NA 3GNPA 4DBWA 3SZ8A 1BYCA 4GXWA 1HKWA 3WLRA 3OVRA 2FMOA 2PUZA 2WJZA 4Y8EA 1N7KA 2GJXB 1CLKA 4M7TA 2PF8A 1ZAIA 4AB4A 4HCDA 3DHUA 3OW1A 1UC5A 4Y9NA 1FKXA 2J6VA 4PGLA 3DFQA 4Q7NA 3GSMA 2PAJA 5XIMA 4DJFC 3T0BA 5TF0A 4FNTA 8RUCA 2YKKA 3TTQA 4ZB5A 3TN3A 4LUSA 3EB2A 1SO6A 1UZ4A 3R4IA 1Z48A 1TMLA 2C1IA 3PBWA 4MYAA 3N4AA 3NSMA 3GBDA 4H9YA 2CHRA 2V2HA 1AJZA 4CQCA 3EX1A 3NPUA 4DWSD 1O4UA 4QBXA 1A3XA 1D8WA 4GNJA 1FHLA 1C8QA 2D0FA 3M43A 4IFKA 5TNVA 4CUCA 1R38A 2DY3A 3PBGA 2W61A 5I3IA 3O6YX 1E3ZA 3VX0A 4XD5A 1Z69A 4ZTYA 2NW0A 5H8MA 3WQ4A 4NZCA 4Y9AA 2QCCA 2XSXA 3T05A 4P5UA 1F6PA 3CUXA 3LLDA 4AC7C 4FIRA 5FCZA 2FZMA 2QJNA 2VC9A 3VOIA 2VXNA 3LBOA 1DWAM 3SGUA 1VZWA 3E0VA 2WSPA 3KWXA 4HNVA 1G4EA 2Z1BA 5CPQA 1KGUA 3LENA 4ZE4A 2HMCA 2WPGA 1IT0A 3KZSA 4H04A 4GK8A 3URNA 3N29A 3A13A 3GBEA 4MSSA 3WK2A 4B92A 1S2CA 1TO3A 1VAHA 4RDYA 4MB3A 5CPTA 3R5EA 4O10A 4M29A 2CWNA 4LJ3A 2NQ5A 4DAFA 3NL3A 1QI4A 3R8GA 4TTGA 2I9UA 4UTIA 1KM6A 1UJPA 2ZFAA 4LBUA 1BQCA 2BMBA 5FF3A 1A53A 2A85A 2C0HA 3H70A 3TWBA 2PCQA 1RY0A 3UPWA 1E6ZA 1XLDA 1DHKA 4HHPA 1QXLA 3W00A 4ASTA 1L9WA 1KTCA 1SZGA 3H4GA 5K7JA 1YW1A 1UMYA 5A6AA 2HCVA 2QS8A 4QAIA 2E4TA 3U5UA 1UD5A 3GTXA 3UWQA 3APGA 3HG5A 3PF3A 4X3ZA 3ARYA 4B91A 1DE5A 1KM5A 3U5YA 3CU2A 3DI0A 1WP6A 1DV7A 4G8TA 4YPJA 1RUSA 5DEZA 1VHCA 4Q8PA 1RV8A 3RJYA 3T2QA 3TA6A 1C92A 1YDOA 2GK1B 2X7VA 4G6CA 3CNYA 1MNZA 3GZ3A 5G5IA 2PI6A 1KXTA 3CLWA 3FXGA 1KM0A 4XD4A 2XINA 1GQNA 5EBUA 4J4KA 3FW6A 4RE3A 5BOOA 2WSKA 1U1UA 3RPTA 4JQAA 1XIGA 1KCKA 1CXKA 4DWSB 1E3XA 1V0MA 3IS4A 1K02A 2E5BA 3HTWA 4EXBA 1QNSA 4C6MA 4F4RA 3GIYA 1GVFA 2Q8LA 3CV7A 1KCZA 1UD3A 3F1QA 3CQKA 1VBJA 1BWVA 4LEFA 2PDIA 1YPFA 3BAJA 2IXVA 3CK5A 3LRMA 1KA9F 4H7VA 3FIGA 5F4WA 3WJSA 3H53A 3CASA 2H6RA 1BG4A 2EKGA 3TN4A 1V3IA 4ZSUA 3TYCA 3SQSA 2HXTA 1TPH1 3NYDA 2PWGA 1ZHAA 3DKJA 1YTDA 3B4YA 1F8IA 3VD3A 1HKJA 2ADAA 3ITLA 2PC8A 5HATA 3RU6A 3MVTA 1TV2A 1BRLA 3DH7A 1EJTC 1C8XA 3MY9A 4NJHA 5C2GA 4GGHA 3EA2A 5IRPA 3N6JA 2YL5A 2BFGA 1JCMP 4WSKA 3VC5A 3A4XA 2PDUA 4IMFA 3AMKA 3M44A 2F2KA 1OD0A 3BJTA 3BMXA 3DHDA 3Q67A 5CBJA 4ZA0A 1US2A 5EMJA 3THAA 1E73M 5H2ZA 4QJ5B 4HNUA 3BZGA 3W3OA 4P8WA 1OIMA 5CSUA 1VFUA 3S1UA 5IHSA 2WC3A 2DSZA 4U4MA 1XDLA 1TV7A 5DFAA 2O4QA 3N1AA 1YDVA 2ZUSA 2GQ8A 5KITA 3UA3A 4B5NA 2VI0A 5DT5A 1XUZA 4D2JA 3AIUA 1VRDA 4DF2A 4D6CA 1A5NC 3P81A 4R9XA 1XLFA 4YCPA 3CUIA 2ODOA 4O57A 1EO5A 2BXVA 2Y85A 3GZAA 4HPNA 5DMLA 3C2EA 3JZUA 1K77A 5G4EA 4NXSA 2MANA 4LAZA 3G0XA 4QG9A 4A3HA 3UJFA 3W26A 1TVPA 3CL8A 1A5AA 5JVLA 4F40A 2QHAA 1J0ZA 1H7WA 3CUFA 1XS2A 3S9IA 2D0GA 1YKWA 5BCAA 5HNNA 4YTTA 2ZUNA 4AVOA 4UTWC 2WHLA 2WVVA 4PMDA 1WKFA 2C3ZA 2OZ3A 3MZ2A 3W1XA 4E4FA 4MM1A 3P6LA 2QVHA 3TZFA 1W1IE 3WLOA 2QGYA 4CCDA 4I3GA 2PWFA 3JUGA 3QZAA 3F03K 4IF2A 3QM3A 3OB8A 5U4NA 5CGMA 4UFHA 1FCBA 3KRBA 1V7YA 1DIOA 2W62A 3TA9A 2ALRA 2DGAA 2JKAA 4DAIA 3AXIA 1W1YA 3UYIA 4MZ8A 4HSNA 2WPBA 3V75A 4QSFA 2PE4A 3D0CA 3ICJA 3EMCA 1NWUA 4UTJA 4MKNA 4JTDA 3NXFA 3POHA 3T8LA 1Y65A 1JL8A 1FDYA 3H54A 4INFA 3E9AA 2FFCA 4IP4A 4KETA 5I78A 3N11A 2Y8VA 1H0GA 2BOEX 3ZSTA 1KFLA 4H8VA 3GVWA 4Y8FA 3RUBL 3BV7A 2AQWA 4JYDA 6XIAA 3GVQA 1PTDA 1ME9A 3CQ0A 3ES8A 1Q63A 4FX7A 4DJDD 1AVAA 3LQLA 4C65A 1BAGA 1GPFA 1VJIA 1LRQA 1O66A 4NZ4A 2YZRA 5D9OA 3WJYA 5C0QA 3GDLA 3MDUA 3TNBA 3TNOA 1WUFA 3IGSA 2ACQA 3F2DA 1M6JA 2QUUA 4QAWA 3D46A 3W1PA 3VOFA 5XINA 4QHRA 5HOSA 1CBGA 1IWAA 3G0SA 5AB3A 4L61A 1B9ZA 1G67A 1T99A 3T09A 1UP0A 4PTVA 3WCZA 1XC4A 4ZTXA 3ABXA 3EDDA 3PPGA 1BLIA 3ZJ7A 3BW3A 3QV8A 3CO4A 4DYJA 4P7OA 3S9ZA 3GXMA 2GDVA 1OX4B 5D9MA 1M9HA 4IJRA 1GQIA 4J2MA 2PS2A 1KW1A 4N4QA 4QGCA 5DO8A 4LRSA 3VIKA 1YNQA 4WVXA 2YFNA 5D2WA 1O94A 1GVQA 4AYGA 3GR7A 5EPDA 4J7RA 3FX4A 4AZHA 3VNZA 4MJZA 1U1HA 3KFTA 1EJRC 4FA3A 4PE8A 4HA0A 2JF6A 1W1B1 1Q65A 4IFOA 3CEUA 4S3AA 4Z1BA 1F3WA 3PHAA 1TTQA 3BANA 1I2QA 4C6LA 6PTDA 4RE4A 3W22A 4XIAA 4POCA 3CHVA 3EA1A 4A8IA 3O1NA 3C0SA 3P2VA 4CQ9A 5A6SA 5ECVA 5CC6A 1JXKA 2J66A 2Y5JA 2OEJA 4A29A 1ZJIA 1X98A 2XSBA 2ASHA 1TTPA 1C29A 4AF0B 3U7VA 2XHYA 1TWIA 1I0BA 1K3UA 3WLTA 1W1TA 3I6TA 4Q8MA 1QHPA 4L5ZA 4J3SA 4WK9A 3W75A 3IRSA 1XH1A 1PVNA 2JBMA 3MMDA 1GOXA 3WL0A 3MA8A 3DEQA 4JR5A 4TUFA 4BF7A 4UQCA 4AU0A 2GUBA 4KWSA 3L4WA 3ANYA 4KWUA 1WBHA 3MSRA 3C2FA 2PD5A 1GYLA 2QJGA 3OVQA 1P0DA 2Y6ZA 3GIPA 1H60A 4IX2A 4NAFB 1I2NA 3NPXA 4ECLA 5A8NA 2E25A 4IG2B 5I0DA 3FNDA 3WH5A 3GHRA 2Y5EA 1XYCA 1SZEA 1GNXA 3QTGA 3B40A 3DG3A 9XIMA 2PDYA 4E2BA 1E4NA 1FCUA 2BDQA 3QFWA 3PZTA 4OUIA 4LS1A 2HE5A 2IQDA 3S2NA 4XBJA 2QUNA 1PUDA 3F7JA 3TWAA 3MHUA 4JTGA 1GKRA 1AH0A 1XGZA 1TPVA 4X0NA 4I7WA 1JUBA 3FGCB 1E1FA 1GYMA 5DMYA 2HK0A 2DSVA 1I6NA 4XVDA 1CB2A 1GG1A 2RGLA 1KCLA 1IV8A 2VD8A 1R9ZA 2G37A 3EMQA 4GQGA 3RIKA 4IMGA 1AL8A 3QC0A 3W7EA 2GJLA 2OZTA 2IPJA 1VFHA 3VUPA 5GJMA 4AZIA 4MFDA 3NL5A 3K5XA 1KKRA 2QVNA 4YMZA 2J7EA 4O54A 2B31A 2XGZA 3WQFA 3O07A 7TAAA 5T26A 3UXAA 4KGLA 1OK4A 2DEPA 3ZM8A 2P0IA 3W7OA 3AJ7A 3SCSA 1O1ZA 2GJPA 2REQA 3O6DA 3UWWA 4WGXA 5C9RA 5TAOA 3NQ8A 2HS6A 3L4VA 4GYKA 2ABAA 3PY2A 1RSCA 3HQOA 1H7OA 1CECA 2C15A 3LB0A 1R2SA 3ZR4A 4IMEA 4Q8NA 5HPCA 3IIZA 2CLMA 1W2PA 5DCEA 4DIAA 2VR4A 2Z1XA 4QEHA 1NFGA 2PP3A 1VFLA 3HA1A 3HGOA 4XZMX 3EB4A 1TJRA 4WY0F 2Y7EA 3WN6A 3GUWA 2VRJA 1KFEA 4QS5A 3M16A 3FSTA 4R9OA 5HR6A 1Z42A 1EUAA 4U3AA 3TZNA 3R2GA 4HB7A 5KZDA 2V8ZA 3BQ6A 4ROPA 1M7OA 2EG7A 1E9IA 1JGIA 1W31A 3U8GA 4L7ZA 4GGBA 1RALA 2B7OA 1XM3A 4WDUA 4HOWA 4MTVA 1P5BA 2CITA 3KVLA 1H7RA 3M64A 4CVWA 1E6SM 3ABZA 2FVMA 2J7CA 3V18A 2NX3A 3HN3A 4WGHA 1J2WA 4JX6A 3RJXA 3XISA 2DW6A 5FF0A 3BURA 4C6NA 1VGAA 2GJRA 3TC7A 4HA3A 4TXEA 2BBFA 1XCFA 4JTQA 4RW3A 3I4EA 4O4WA 3PZNA 4PCFA 1WDSA 1UYQA 4HP5A 2W0UA 1VYRA 1FX6A 1WO2A 2BVWA 4KIRA 1XLEA 4ACZB 4PUKA 4R34A 3A6OA 4W8LA 4I7VA 4QLKA 1XSKA 4IPLA 5E9AA 3W07A 5FJTA 1V03A 5ABHA 3TN5A 4N4PA 4PRRA 3NFUA 1YEYA 4MDPA 3ZVHA 2VR5A 1U30A 3K30A 5DMNA 3PANA 4EOUA 2IXUA 4PYSA 4J3ZA 3NO1A 3FV9A 4H9ZA 1GVRA 2Y8KA 3QFEA 2ZZ4A 1E0TA 2PZNA 1YTEA 5EMKA 4H9MA 1OF8A 2ZYFA 4RV8A 5FA5A 3QOMA 4OE7A 2VOTA 4CD4A 1J6OA 4J3XA 4GYPA 3G1XA 4AEFA 3FJNA 4JYEA 2DJLA 1N8WA 2XVKA 2GJXA 3L4UA 1BYDA 3GDRA 1RQHA 4HMDA 3TR9A 5LNRA 5RUBA 3TXZA 3UG3A 3B8SA 1JQVA 1KV8A 3ARQA 7CGTA 3NZGA 3EOLA 1DXEA 2ZZ1A 3AJXA 3PJUA 3CUZA 1H61A 1SJDA 4IIHA 1POJA 4CD7A 3DYPA 4MPQA 1OFRA 2VX5A 5MHBA 5JU6A 2FH8A 2HRWA 2ZXDA 2C18A 3TLLA 3W2UA 1CGTA 3B9DA 1J4EA 1EEXA 4YXGA 4E4UA 2QDDA 3WDJA 4BWLA 5G4HC 2WBKA 1LCOA 4CNPA 2H3BA 1MW3A 1R5YA 2DSWA 3QGAC 2QF8A 3V0TA 5BXSA 3M41A 1RJPA 1QW9A 5CPNA 1BWLA 2CLLA 1ZBKA 3CV1A 2QQ6A 4XAYA 4K37A 4OT7A 1MW2A 2INZA 4XKMA 1JI1A 4EF9A 3KBMA 3AMLA 4P8XA 8XIAA 2CIPA 3EX2A 1YDNA 2CBIA 1FFQA 2KZHA 5J5DA 1WA3A 4RPPA 3S1GA 4PFHA 3ELFA 1B4EA 1DJHA 1EUNA 2B0MA 4KFNA 3VOHA 3IUDA 4LF2A 2OWXA 1JD9A 2OLHA 3W81A 4C6JA 1EB3A 1OVDA 3KW3A 2OT1A 2I14A 4MIMA 5LA0A 2P3ZA 1TPWA 3GQYA 3EA3A 2DZUA 2GGHA 3BC9A 3W27A 1KV5A 2XGIA 1WZAA 2CZ5A 3GG0A 1SYTA 1YPXA 2XN1A 5C8BB 3W76A 1RQEA 2V63A 1F8MA 1Y0EA 2ALDA 2VGBA 1JDEA 2J77A 1POKA 2CLEA 4QISA 5LIYX 4TX8A 4I5RA 2VGIA 3STPA 3PS7A 2JF7A 5T9BG 1WOAA 1OFDA 3HG4A 2OOGA 2EPNA 1DJQA 3UGVA 1UOZA 1IZKA 3B8TA 3FHAA 4WJEA 1IF2A 5F2MA 1CGXA 5M5DA 1Q6FA 5G1MA 1P43A 4GWEA 1UD4A 2OZ0A 1UC4A 4PUNA 3NQBA 4OV4A 3NVTA 3CT2A 4R27A 1C90A 4GD0A 2FZ9A 2GGJA 4LC6A 5M2FX 1UWAA 2XSAA 3CGTA 3T2OA 3MT1A 4UFLA 2X09A 3QY7A 2GK1A 2GUUA 4R5EA 4J1OA 5KEZA 4M6VA 2UWFA 3FVMA 4PEEA 3GR8A 4F0LA 1F9CA 5DQPA 2YX0A 4IMCA 4OFCA 3L4TA 5K9CA 2CU0A 2YDRA 5EB8A 3AC0A 2QZRA 4DI9A 4R33A 5HUPA 2Y63A 1B57A 3MUAA 3VD7A 3LCLA 4DWSA 1JFXA 4FI4A 4AISA 1AH4A 2P1FA 3OZYA 2HJPA 4XIMA 3W87A 4PTDA 4L9ZA 2D2GA 1JPIA 3SRKA 3L7RA 3NQEA 3ZWTA 3O9NA 3VMOA 1DKWA 2PLKA 4DRSA 5TQLA 1KRMA 1KM4A 1JYWA 1CCWB 1YTKA 2DSUA 3L65A 4LWWA 3UJSA 1FWNA 1V3LA 3VFCA 2VZUA 3TROA 4B5UA 4FF7A 2QCMA 1QT1A 2F2HA 1XBXA 4AZCA 4Q4OA 4Q8TA 3QYSA 3WNOA 5J8LA 4UTLA 3SQLA 3E0WA 3M46A 3PZIA 3IAQA 1W8SA 5HMSA 3U3HA 3SSJA 2BX7A 5LGXA 1L8NA 3WFAA 3ABRA 5MKGB 3ID7A 4MDOA 5LA1A 4DXXA 1IEIA 2VEGA 2VZTA 5FJRA 2QNEA 3K46A 1EDTA 3V5FA 3N13A 3GX9A 1DHPA 4CGTA 1UWIA 1JD7A 4MWAE 5CPLA 5D04C 1G4SA 3WQOA 3TSDA 4AWEA 1N8IA 4IQEA 5A1AA 3ARWA 3BJSA 1KXVA 3NIYA 1LOSA 4WCJA 3PK7A 2V5DA 2ZRVA 2TSYA 1VFTA 5GQBA 2PWEA 2YDSA 4XZIA 3MYPA 1AW1A 2A5HA 5EMYA 3B0PA 1ENUA 5FJOA 1JZ5A 1LQAA 3VKDA 3VOJA 3WF4A 1JAKA 3VILA 2H8XA 4MNJA 2VFDA 3WK3A 4H8UA 4S3EA 1NFBA 2X1IA 3V1PA 1UR4A 4EACA 3W86A 1WUEA 3R8HA 1ELSA 4EPBC 1KR1A 1BKHA 3HGJA 4DN1A 3GO2A 2OU4A 2UY5A 3E2RA 1NWSA 3VIGA 1GW9A 2YL6A 4KRZA 1EJ7L 3F4CA 3LI0A 4AIBA 1EWEA 5G2HA 3D6NA 3LHUA 3TYBA 1ITUA 2ICSA 3W25A 5LXEA 1ZJAA 4IGHA 4NG3A 1UWQA 4FNPA 2CLFA 5CZSA 3G6MA 1LRNA 5AYXA 2DW7A 2A3HA 3AHYA 1MFVA 4RNJA 2VC6A 2FPYA 1OF6A 2NQLA 4FNUA 4MAVA 1F73A 1DP0A 1YLVA 4ATWA 2PA6A 2WXDM 3GYCA 2C7FA 2ZX6A 3WLMA 4L65A 3SADA 2OJPA 4WR3A 1JPMA 1E71M 4JTJA 5HNTA 1VCVA 2YGYA 3KVKA 4H9UA 1UA7A 4RZ5A 1UZDA 2B7PA 2C19A 3KBWA 3NR0A 3G8RA 1KM3A 1M01A 4GUJA 5A8QA 2NZLA 3GNOA 3ZSSA 2AL1A 4EANA 1N2VA 4D6JA 1DJZA 3VAVA 2YLLA 1X7FA 5E0KA 1QTWA 1JJKA 4B5XA 2BASA 1XV8A 3G1YA 3A47A 1V0LA 3DZ1A 2GWNA 2XISA 1PIGA 3UW6A 1BFNA 2WKJA 2AGTA 1YE6A 1M5WA 5I03A 2Y24A 4MUPA 1TJ0A 3RMEA 3QPZA 4DVOA 4B9ZA 4F3HA 1PCKA 1UR8A 1WPCA 2DUZA 4K8HA 4LT9A 1TRIA 3E0FA 1JPDX 1ICPA 1SW3A 3TC3A 2VDIA 1JCLA 1LT7A 4QG8A 4QQ3A 4AAJA 3BGJA 3SIMA 3KL5A 1AMKA 4I6VA 4MNLA 5HJYA 1XRSA 2PDNA 1EL3A 4GH3A 4O12A 3ZFHA 1DIDA 5D4YA 3CQHA 1EA0A 2FGBA 2Z25A 4UQEA 2CPUA 3BMVA 1SZFA 1V8EA 3PG9A 2DZSA 3MMUA 3EOUA 3QQ0A 4HA4A 2BGNE 3WD3A 1EGMA 3BL3A 4UR8A 4P8VA 2JE8A 3GVVA 1W1PA 1DIKA 3D47A 4S3BA 2PTXA 1OX4A 5K3VA 3TV8A 4XUGA 1SMDA 2PSNA 3N6QA 3G22A 4N42A 1SUXA 3HB9A 4NT0A 1NVMA 1AK5A 3S42A 4D8ZA 2VD9A 1OB0A 3BO9A 2J27A 3W85A 1MO0A 4DB7A 3FS2A 1DJNA 3N4EA 3CZGA 4J35A 2ABBA 4Z0SA 1XLAA 4N0RA 3SUTA 3REQB 3LMYA 4W88A 4IQJA 1LQ2A 3TDFA 3VKAA 3OA5A 2ZTKA 2QMKA 1E0VA 2FIQA 4AF0A 3H8AA 1C9WA 2E77A 1KFJA 2X2YA 3UXKA 2JIWA 1V4YA 1YXCA 2CBUA 5CQ1A 5I24A 4PTWA 3ARVA 1MEIA 3M4HA 1XWYA 2O9RA 1A3HA 2G5WA 4RZ4A 4YCOA 3VE7A 3OBEA 3SDOA 1MMFA 1LM1A 4GUGA 4MHBA 4ZE5A 2PGFA 3GM8A 3IGHX 1DJGA 3UWEA 4HPXA 5LYRA 4JTTA 1EHAA 4GBUA 1W9BM 1UKTA 3WNNA 1T40A 3ZT7A 4RE0A 4DJDA 4IG2A 4JTLA 4PUEA 4TVDA 2ZIDA 1XIBA 1PL9A 3PWAA 2CESA 3UCQA 1VJZA 1JYXA 3DYMA 3UZJA 1JFHA 1EBGA 3G2GA 4D6DA 5AECA 3AIVA 4FB7A 3WUFA 3L2LA 4W85A 1IZCA 2OZ8A 4LYPA 2OELA 5M1TA 1QJWA 3FA3A 4XAGA 1CENA 2XH4A 3GTHA 2YYUA 4O1BA 2Z1SA 2FHCA 3RX4A 3NQVA 4UBPC 2PDPA 4MNMA 3FGCA 1PB0A 3MUIA 2C1GA 2XH2A 3AHTA 4F0RA 4Z2GA 4F2UA 4U28A 4I7UA 1Q6OA 3AROA 2WHKA 5M03A 1MZRA 3TJ4A 2PB1A 2E9BA 2JQXA 5DX7A 4UFKA 4PMQA 4ADUA 4UTMA 4G9PA 4ZMGA 3AISA 3N04A 5REQB 4BQ4A 1A5MC 1FH7A 4TIMA 1P7TB 3B0VC 4O1FA 1YDYA 3GH4A 5BOFA 1HXJA 5D9PA 3PBYA 5GNYA 4GIEA 1H7NA 2WCGA 4GQRA 5CZ0A 3RITA 3L0KA 4UFMA 2D69A 2I5IA 1IR1A 1TELA 4PUDA 1OX6A 3CTTA 4MWAD 2NQJA 4EXAA 1XGEA 3WH7A 4QROA 5C2CA 4CN4A 2ACUA 1TPDA 1SO3A 1BEUA 3S6TA 3PZOA 4IXXA 4NI3A 3S3GA 3BGAA 1K9EA 1VS1A 1PKMA 4Y9PA 3IJ9A 2CXGA 3HG3A 4S2CA 1XG3A 1S46A 1KRAC 4ZODA 5FF4A 2H9AB 4DNHA 3I3EA 4HJFA 3OTRA 1JG9A 2GOKA 5LKYA 1QPKA 3II1A 3N17A 2D2HA 4XZWA 3P8JA 3O0FA 1ONEA 2GSJA 2C6QA 1FQ0A 4DBDA 3WG6A 3W23A 3UY7A 2WMHA 3ABOA 1KRCC 5GPRA 4XTDA 3SM0A 3T8QA 3F2CA 1E1CB 1JDFA 2P3EA 2INFA 1X8CA 2NVAA 1G0CA 1WDQA 3VIOA 2RDTA 3RXZA 5FF2A 2OTDA 4PUMA 1CT5A 3BXWA 4QCFA 1UP2A 1YBQB 4Q7IA 2WWCA 4OU1A 5HNUA 4W4QA 3UBPC 1QWKA 4Z08A 4LXFA 3MI6A 1RP8A 1TZ7A 1Q2RA 4ACZA 1NEYA 1I45A 1FWAC 3TYAA 1PJ9A 2NV9A 2R6OA 3ITTA 2PGWA 3OLDA 1SPQA 3DIPA 5CZTA 1PAMA 3AMDA 3IGXA 3LCFA 8A3HA 3IRDA 1FWIC 2J47A 3C4UA 1L6YA 2DVUA 5JBFA 3LUTA 5AVNA 2J74A 4D6FA 3VI2A 5HQEA 3SQMA 3CYVA 2D20A 4O4VA 4PUJA 3AYTA 5C9XA 2G50A 4JNMA 4KFPA 3IPWA 1KXQA 2PWVA 1Z7AA 3VNLA 3LBCA 4GQQA 2IMRA 5A8GA 3GW3A 2E40A 2X42A 5I5RA 4BEUA 4D6EA 3BLPX 1OYBA 1QPRA 3E96A 2NWSA 1VLIA 2E09A 3SY8A 3W6MA 3NWRA 5BW6A 2V3GA 4A3UA 4HK6A 3KP1A 1I8JA 4Z2LA 4MWAB 1JUEA 1ICSA 2WMGA 1X1ZA 2BB0A 1PHQA 3FKKA 3SO7A 3WMCA 3INPA 4YWSA 4ERAA 4LF1A 5T91A 3PFMA 5HWMA 2CNCA 5BU6A 1FWSA 1VJSA 2HZGA 2QCDA 3ALFA 3RHGA 4PMOA 1PIFA 1H09A 1MUCA 5D8WA 2CETA 3SUSA 4LQ1A 2Y4SA 2QULA 3N14A 3N4FA 2QJJA 2FQIA 5I3GA 3LU2A 5BMXA 2CHOA 3MUY1 1TIWA 4GISA 1K03A 5I00A 2QLYA 2ONEA 1RJQA 1MDRA 1F76A 1VEMA 1RA0A 4XKYB 4GBDA 1R7AA 3LHVA 4JGDA 4MY9A 4PSPA 1W3HA 1XJBA 1IWBA 3ITGA 5HQMA 4OECA 1A0CA 4HHHA 4LUTB 2EG6A 3QLLA 3LHZA 3WIJA 2YBVA 1B3XA 3LY0A 5CSSA 3O06A 4PTNA 4GHRA 3W1QA 1FWWA 1K9FA 4GVIA 5IBXA 3ATZA 3GKAA 4UTUA 1DTUA 1ESWA 1OWQA 2BSLA 5G1YA 3O3RA 4J3WA 3VXGA 3UXIA 2OPJA 1EP3A 3F4NA 1GTHA 5HNRA 1ECEA 3LDVA 3FSUA 1E4MM 1IT7A 1QASA 1UIPA 1UIOA 2VEIA 3C3UA 1X96A 3CEPA 3H55A 4NZ3A 5CPOA 3VMNA 1I75A 2XH7A 3PZMA 1R3SA 1OT1A 4P7QA 1V6WA 1J8VA 5ABEA 4MG4A 1GWJA 3VKBA 7ODCA 3AUOA 2QR6A 1E5JA 1NAL1 3RDKA 1BXBA 2FKPA 4ZCWA 3T4WA 1LRTA 1VC4A 4Q8VA 1LBFA 1CIUA 2HISA 1LTDA 4OHQA 4PCTA 4B5SA 1EGZA 2VENA 2CZEA 3VPLA 2W4XA 1QPQA 2OSYA 1S39A 3LGDA 3AS0A 2D1ZA 3RO8A 2PDJA 3WD4A 3GFYA 2CBVA 1QAPA 3E12A 3WYZA 3N15A 1PZ1A 3L68A 1NU5A 3KE0A 4H6RA 1J10A 4HSHA 2P10A 3L23A 3KP0A 4PCNA 3SUVA 1QDSA 4ADSA 6A3HA 5BRPA 3B97A 4JHMA 1JGMA 1QOQA 4O0QA 2R1PA 4GXMA 1R86A 3TK7A 1JIBA 3W7QA 1Q5MA 4US5D 2ZA2A 4URIA 3RM4A 1W2VA 4TMBA 5LZLA 5FEWA 4Y96A 1K4HA 2BXZA 3ZXWA 1JPKA 1GK8A 1XINA 4XG1A 5BXPA 2G3NA 4FXSA 2OQLA 1O6IA 2WWDA 4DJEC 1VP5A 4JDBA 1KD0A 3S5SA 3QYQA 2DZPA 5AC8A 4NP7A 3TIMA 2IS7A 5I77A 3C0LA 3TW7A 3VINA 1UWTA 5IDZA 4AZ7A 1HW6A 3UG5A 4ERIA 2J7HA 3AHXA 3MV11 1VPQA 2A3EA 2RFGA 3DG7A 2VFEA 4RE2A 3WLHA 2Z29A 3IJ7A 5F2IA 1SSDA 1VFFA 5K9XA 4UWMA 4HPHA 4MJMA 5MKGA 3S5OA 1CGYA 1P0KA 5AZ1A 3TTEA 5DXYA 1M7XA 1UBPC 1W56A 1V3KA 3VIMA 4F8XA 1TJPA 3R11A 2UY4A 3FCPA 4LAMA 4PH6A 1MEWA 4U33A 3YPIA 2HDJA 1WX0A 4GH1A 4GNKB 5IHRA 2PWHA 2VVNA 2XFFA 3W7HA 3KOWA 1P0EA 3K1GA 4LX4A 1YIXA 4JICA 2CYGA 3MI2A 5XIAA 2YZ5A 1B4KA 1UBSA 1IEQA 1GZJA 4YN5A 2QJIA 3CUHA 3OHMB 4RR4A 5LXXA 3E1F1 3VZYA 1ONRA 1UR2A 4QM1A 3TN6A 4GI6A 2VMFA 3PBUA 1ALDA 2J7GA 1ZZMA 3T07A 2NSOA 3DXIA 4YVXA 1XR2A 3L4YA 1RBAA 1P1MA 4EP8C 3RILA 3THCA 4MY1A 5KSWA 3DESA 4LY8A 3HMCA 2QUMA 4OV9A 2Z00A 1EC9A 3AZSA 5MF5A 3R94A 3SN0A 2BOGX 2DT2A 3FYOA 3HU7A 1EIBA 4EVZA 6CGTA 3LX9A 5EFDA 4MOZA 3NXLA 4X22A 4NQ1A 3W1TA 1K8YA 3LXAA 3Q94A 2CLKA 1UHVA 1MW1A 3OYZA 4NKCA 2PTDA 3VZXA 4BR1A 4KF1A 8XIMA 2BODX 4L4PA 4M56A 1GZ1A 3OGVA 1W3JA 3RR1A 4QR6A 3MBDA 2PDXA 3B0UX 1IT8A 1WOBA 1OY0A 1OC6A 3NGFA 1CGWA 4C6OA 4E8DA 4PB5A 4C7GA 2CLPA 2GQ3A 4DO7A 2NVCA 3ATYA 4QRNA 2I7GA 3URBA 4YYCA 3CS2A 3GAKA 1AUSL 2PRLA 3IJLA 4IXHA 3WH8A 1BVNP 1BRLB 1KTNA 4C6KA 4O16A 1YPIA 4X2RA 1TTJA 3ME3A 3CHEA 3P8IA 4XD3A 2ZRZA 1E6RA 1LQ0A 2BHYA 4F9JA 4Q3MA 1XH0A 1F5ZA 4TTUA 2VYOA 1W5NA 3W6LA 1EA9C 1TVNA 1W91A 3DBNA 4LY4A 1RLCL 4YWIA 3CHDA 1XKJA 2YFOA 4BS0A 3SJ3A 2FHFA 1V5XA 1O68A 3AICA 3BDKA 2V68A 1JYVA 3GXNA 1GORA 2E28A 1YMYA 5LA2A 3TW9A 3WELA 2WMIB 5CGTA 2Z7GA 1WAWA 1VPYA 1YXYA 4RX0A 3CAVA 1A5SA 1CXFA 1QRQA 3CLMA 2CZFA 1OT2A 1XLMA 4BQ3A 3FY1A 1KFCA 1IE7C 2C13A 5I2UA 2OSWA 1CI1A 1UR9A 3TJXA 3LERA 5GJNA 3HGSA 1MXSA 4HU8A 2C1HA 2PF0A 4OUEA 1ZL1A 3LCXA 1RVKA 3D5HA 1IXNA 3CUJA 1EPXA 4WRHA 3IUHA 1VBRA 3B4UA 4GYPC 1J0IA 1MFUA 3T78A 3NZPA 1S2VA 5D03A 1W1A1 4GZ7A 1VF8A 4IUGA 3V36A 4K68A 3W7DA 1NOUA 4H00A 1Q66A 2DZWA 4MLJA 3BLIA 3MKCA 1OCBA 4H19A 1W17A 1K8CA 5E0CA 4NJGA 3NYZA 3REQA 3UQNA 3VIIA 3A64A 4D72A 3T55A 1SR9A 2QJMA 2D3LA 3NDYA 4PMYA 3CZJA 1IWPA 1GVOA 3RYSA 5A3HA 3TW6A 2A2IA 4BWLC 1HO4A 4UMBA 3WUBA 1SQ7A 2Y7DA 3EXTA 3RRAA 3B9AA 3HJZA 1W9DM 3VKKA 3QY6A 2G95A 4HNLA 1RPXA 3N18A 4CU7A 3UZ5A 3MQTA 4KCVA 5B7ZA 1EF3A 2Y1HA 4EAMA 1IEVA 3R7MA 3HV8A 4TVUA 4MF4A 3IUIA 2AQOA 3K8MA 8CGTA 5IXEA 1VPXA 3DERA 2OLAA 3DYOA 4PODA 2DSKA 4P2VA 2GL5A 3T44A 4HHMA 4KRUA 3MDWA 3M0VA 3W53A 3MJYA 4PL1A 3QZEA 2QCFA 4IFRA 1Z9AA 1B3WA 4R7WA 2DZBA 4J5NA 3OVPA 5A8PA 1XXXA 1GTEA 2WNWA 4AG0A 1TWWA 3M5VA 4K39A 2XVNA 3NTYA 4RNFA 4ZFCA 2OQHA 2J62A 4QJ4B 3NURA 3OO2A 4RKAA 3M6YA 3RRXA 3W6YA 3HF3A 2VCBA 4QE4A 4JTUA 3GTIA 3IIXA 1R0MA 5G4WA 2IPFA 3K8KA 1P6WA 2F6KA 1GHRA 4M3PA 4EE9A 3PUGA 3SCPA 3OZPA 3PZUA 4HOZA 5REQA 1UASA 2YA1A 3O63A 3LMZA 1J96A 2A3BA 1VEPA 3TEVA 3MP5A 3SRHA 4HGXA 4LGXA 1G7UA 1OABA 3SN1A 3CAKA 1E6QM 3H7RA 3NOYA 1KRBC 3KZPA 3KDOA 4UNKA 4JOMA 3NL6A 1EOMA 5M3WA 3G1AA 4DUXA 2PZ0A 2G8ZA 4F0HA 1RK6A 4WIWA 2WMKA 3QHMA 4AEOA 3BW4A 3CAWA 5F4SA 1I0DA 2AMXA 3LV5A 1H4PA 2W67A 1Y5VA 2HBVA 4KCUA 3LM7A 1TV4A 5FEZA 3WK0A 4CU6A 2Q71A 1R46A 1HVXA 3DENA 2ATMA 3I3BA 4DWSC 3IGUA 3R79A 1T96A 1US0A 1W3TA 2J13A 2A3AA 4CVUA 2C91A 4CQBA 4MYXA 4O8AA 2FFIA 2BV9A 1ZENA 1QW7A 2J9XA 5AC5A 5L9FA 4XO7A 1E9YB 1TJ1A 1R30A 4ML9A 4V28A 3EPMA 1ITXA 3SY5A 2X0YA 3NQDA 9CGTA 1MW0A 4AD1A 4XZHA 4EIVA 4H41A 4XSMA 1OFOA 3VGEA 1XPGA 3SI9A 3CL6A 4JIQA 1TYGA 5EL1A 3I3DA 3A12A 5ECUA 1PWLA 1Q4NX 1ZCOA 2FHBA 1XF0A 3NDOA 2WJDA 4H2CA 2X41A 4HZ6A 5CSRA 3TSBA 1LBLA 4UMCA 5A6LA 1UKOA 1B90A 2VEFA 4NF7A 1AQ0A 2XIJA 4V1YA 4UFJA 3WMBA 2IQ0A 3QW4B 4KW2A 4PMVA 2WANA 4DF0A 3M0HA 4Q4KA 4Q4SA 3E5PA 3OQ8A 2EG8A 1U83A 5CLWA 2EJAA 4IP5A 3MB9A 2DT3A 4H9TA 1QO5A 3S47A 2CW6A 1PPIA 3GLCA 3QR1A 3BAKA 3IIOA 1P4CA 1JCNA 2OYKA 3KOXA 3N34A 5F4XA 2OEMA 3WKZA 3W73A 2YBUA 1KTBA 1AJ2A 1V3HA 2HNHA 2A1YA 4BHYA 2EPOA 2FTWA 3PTKA 3KOFA 4C6CA 1TWDA 1PEZA 4QQUA 2Q02A 1X6LA 3U2EA 2RHGA 5DANA 1FWBC 3W7PA 2V2CA 3W7KA 2E6AA 4DPPA 3VM7A 4A3RA 4MB4A 3MUXA 2E5CA 2HE8A 3TONA 4BA0A 4UB9A 5K4XA 1LWIA 2BNJA 2VM8A 4MWAA 4FXRA 1JVNA 3KHJA 3KCLA 1UUMA 4CCCA 1SR0A 3LHTA 3WDRA 1ICQA 3NZRA 1W0MA 3K4DA 4Y9MA 3PJXA 1XIFA 3THUA 4PSRA 1GVEA 3VZZA 1NQ6A 3KLLA 1XQKA 1FDZA 5AHNA 4ALDA 3TYEA 2VOMA 4C5ZA 3P3BA 3P61A 2F9RA 2QJHA 1D8CA 4I9MA 3N2OA 1KFWA 3RU8X 3GU1A 1TMHA 1R3TA 4E3TA 3KWSA 3U0HA 1YADA 5KZEA 2V5LA 2QMJA 2OO0A 5FAGA 5E09A 3EKGA 3H2CA 2WLZA 1TR9A 4FP1A 2ZADA 4XKYA 1OC7A 1J0JA 4ILSA 4A3QA 4ML4A 1XLBA 4W5ZA 1IIGA 2VC5A 3VOGA 1F6YA 2QW5A 5D38A 5CSYA 3VE9A 2X0HA 3A4WA 2VELA 3HURA 4PUWA 4LUTA 3WD2A 1MEHA 1FH8A 1K8XA 4WLCA 1HN1A 2PLJA 5HWNA 4GCXA 1MUWA 4IGMA 4ZOEA 1R2RA 2ZZ6A 2BGSA 5K4ZA 3M5XA 5C70A 3C86A 3F5JA 4UUIA 1MZHA 4LS2A 3M0LA 5C9WA 3W02A 2J9ZA 4YTUA 4AVFA 2I5QA 1H11A 3NO5A 1RAKA 1JDAA 4IGNA 4L6OA 2AAMA 1X39A 5JIPA 4Z17A 4UOZA 3PB2A 3WMLA 1NF7A 3CPGA 4PCSA 1OQFA 2XZ7A 3LPOA 5BZAA 1FP9A 2PLMA 2VFGA 2VGFA 4G1KA 1TPEA 1HKKA 3RNDA 1OHLA 1ZBWA 4OWGA 4MZ1A 2O9PA 2PU1A 3ZMRA 3HQNA 3DFYA 4JY9A 4LVFA 2E3ZA 4AY7A 5TD4A 4XBSA 4GZIA 1LDCA 4HT3A 4CQ8A 3I4KA 2ACRA 4EK7A 4Q8OA 4ORIA 3SN4A 2FDMA 3C6CA 3PAOA 3Q2DA 1MWOA 3GH7A 1L2UA 3SECA 4TV5A 1C3FA 3WLPA 4YTQA 3ARTA 4U31A 1WDDA 2YXXA 3M0KA 4K1GA 3USBA 3PBMA 3CWHA 3UJ2A 2NXIA 2ZX5A 1S3HA 1GOMA 1BGGA 2CXEA 4N2YA 4G5DA 1GOOA 3U2OA 4DZ5A 2FB2A 1EC7A 1VBGA 2Y5SA 3E49A 3BUVA 3TTYA 3TE9A 4HNTA 1K7FA 3IJQA 1TIMA 4ZBCA 4MB5A 4A8NA 2WJFA 3A4AA 3RX3A 1SM9A 2OXNA 2Q8XA 2ZXQA 5BRQA 1J18A 2FZNA 1UD6A 2GUYA 3WQEA 4J9JA 2OWWA 3CIWA 2JGYA 5IFTA 1CLXA 1W32A 3MMWA 3PTQA 3IV3A 3TTOA 4F0MA 4MJ2A 2MNRA 2PRHA 1H5VA 2G3JA 1EH9A 3UP8A 4N9BA 4AY1A 3SURA 3KM8A 3EX3A 1TR1A 1B30A 2NV2A 4JIPA 4AHQA 5CC7A 3PUEA 2HVOA 2EEXA 1OCQA 4WEVX 4XX6A 2H90A 4JN8A 4K2SA 3PAJA 4UTWA 1DOSA 4JNYA 3AXMA 1G4TA 2D3NA 4NJIA 3WLSA 2BVTA 3LZ3A 4JTRA 3DKLA 2A3LA 3F5LA 2E7FA 4FEZA 4ZQCA 4HPGA 3TFCA 4LCSA 1FCVA 1W3IA 4IUOA 3WLIA 2J9YA 1L2QA 5BMWA 3V5CA 1T41A 2BHZA 5H6HA 3FAXA 3G3MA 4OZOA 1V79A 4IIBA 2JEQA 1TKKA 4AIEA 3JZEA 4UZUA 4JY8A 3R8RA 5KETA 2WZMA 3THQA 2GVEA 1KBBA 2CERA 2I57A 1FHVA 4V27A 1HNYA 2EHHA 2XIQA 1FHUA 3QGKC 1ISVA 1B5TA 3ZLGA 4DJDC 3DFNA 1GVYA 3RGTA 2W63A 2Y7FA 2WMJA 3IACA 4XWUA 3AIWA 4HU4A 3L9CA 4JD4A 2G41A 3IV8A 3H7VA 1UR1A 2WSRA 4GUIA 1Z32X 1CXEA 4B90A 3VA8A 3TOYA 2PPGA 4X63A 3SCTA 2GVYA 1BGAA 4G1NA 4REQB 2IPWA 3HIJA 2FB3A 2WZHA 4KEMA 1DL3A 2XUCA 3GH5A 2TMDA 4F9DA 2HEJA 3CBWA 4RJEA 1GONA 4PMUA 4TV6A 4NJJA 5CC5A 1BF6A 3WQ5A 1AMYA 2R91A 3CB3A 3KRZA 1W8GA 1IZJA 2VX6A 3H2NA 4G56A 1XG4A 3RR4A 3TYUA 4CNNA 3KS6A 3NDZA 4G7EB 3P14A 4GLEA 4US5A 3CT7A 5A94A 3A3XA 5GNZA 3EWXA 4NIRA 4RLIA 4Q4MA 5H8UA 3WQVA 3UG4A 3CIVA 1QBBA 4MB1A 4OVXA 4BJHA 1HJUA 3N73A 5C71A 5JXQA 3MHFA 4IT1A 5A69A 2ZICA 2IKHA 2JIEA 1QUMA 4FOJA 2ZC1A 7REQB 1GPWA 1G1YA 3BE7A 2FMNA 1US3A 3TQ0A 4KH2A 4Q22A 2Q01A 2YB1A 5D2VA 3GIQA 2Y7GA 4AEEA 3M1ZA 1GJUA 2YCKX 3DX5A 4AZCB 2X8RA 1NY1A 3W28A 5BXRA 3MMTA 1SJAA 1N8FA 2WKGA 4KCTA 2VEMA 1EOKA 3WQ6A 1CGUA 1SJCA 3C2RA 1QR7A 4Y2WA 3L5AA 4IQLA 4GRSA 4E4PA 2VGGA 3TMQA 1DWJM 4B5TA 1DE6A 3TCEA 3ZLFA 3MUCA 3WQWA 3EPNA 3STEA 5F1VA 1EDGA 5K9DA 1ZGDA 5LNUA 1C9DA 4KEUA 5FL1A 1PO9A 1FDJA 5HMFA 4NZ5A 2B7QA 5E9XA 1U5VA 2MUCA 2P8BA 3W2JA 3G1DA 4L6DA 3TLQA 3NPVA 4NZ1A 1TCDA 3W82A 1M3UA 4N6FA 1OC5A 2PU0A 3QSRA 4TQTA 5I09A 3BAWA 3IVTA 2DVTA 1XYBA 4ERGA 3LBMA 4YS1A 4O1DA 5HWJA 2VDGA 3EGJA 4Y7EA 4KGJA 3UR8A 4D9PA 5A6MA 5AVHA 2OEKA 4GIYA 2WMIA 3KHDA 2HBXA 2DUAA 3HQPA 4OQVA 3A24A 3CPRA 2HNEA 5AHFA 3SBFA 1O5XA 2JEPA 5I06A 5FJJA 2GDUA 1Q6EA 4B2DA 3AYSA 3GG7A 2P76A 3M9YA 3BLEA 1Q6DA 1WBJA 3VIJA 3FAWA 1M03A 1TPUA 1A0EA 4FLOA 1ZP4A 5HJLA 1OZQA 1R6WA 1DQUA 3ZQ9A 4FX6M 3EOEA 3PSWA 4HOXA 3K13A 1X6UA 2WM1A 1J93A 4JIHA 4HIBA 3IARA 2UY3A 3QSTA 4ZO7A 4Z2IA 2SFPA 2P53A 3MS8A 1VB9A 3JS3A 2WHJA 3L4XA 2OYMA 4IPIA 1XYLA 3EWCA 6REQB 1FXPA 1KM2A 4K36A 3BICA 2Y0FA 2ZUVA 3H2OA 1MVYA 3VCNA 4F79A 3ERPA 1ZBCA 1V6UA 2XM1A 1E9LA 2J79A 4FOKA 2X30A 4YL2A 4IM4A 2PTYA 4IMDA 2INEA 2X1SA 1XIEA 4JCLA 3STFA 3G1HA 2F6XA 3EOOA 3R12A 2ZRWA 3NA8A 4K6AA 4QX4A 4S3FA 1SVDA 2YJQA 2HSAA 2AOSA 3S0CA 4PN2A 3NQ7A 1W3LA 3TJIA 2EQDA 1E6XM 1QI5A 1FWTA 1ZB5A