1VRDA

Crystal structure of inosine-5'-monophosphate dehydrogenase (tm1347) from thermotoga maritima at 2.18 a resolution
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
457
structure length
321
Chain Sequence
b'MKEALTFDDVLLVPQYSEVLPKDVKIDTRLTRQIRINIPLVSAAMDTVTEAALAKALAREGGIGIIHKNLTPDEQARQVSIVKKTIMSVIEHPNAARDEKGRLLVGAAVGTSPETMERVEKLVKAGVDVIVIDTAHGHSRRVIETLEMIKADYPDLPVVAGNVATPEGTEALIKAGADAVKVGVGPGSICTTRVVAGVGVPQLTAVMECSEVARKYDVPIIADGGIRYSGDIVKALAAGAESVMVGSIFAGTEEAPGETILYQGRKYKAYRGMGIEGMVPYKGTVKDVVHQLVGGLRSGMGYIGARTIKELQEKAVFVKIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inosine-5'-monophosphate dehydrogenase
publication title Crystal structure of Inosine-5'-monophosphate dehydrogenase (TM1347) from THERMOTOGA MARITIMA at 2.18 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 102
structure length 321
sequence length 457
chains with identical sequence B
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vrdA00
1C29A 3ZR4A 4N2YA 3E49A 4FIRA 5H2ZA 1QPRA 5LGZA 1XBXA 4MPQA 3U6WA 4UTJA 3BGJA 3O06A 2NX1A 3TJXA 3HF3A 1R46A 3G1XA 3HGRA 1AL7A 2NWRA 4UFMA 4K6AA 3EB2A 5BMXA 4XUGA 2ZZ3A 2QCEA 1QOQA 2EHHA 3I65A 4K37A 4O14A 3C2VA 5EPDA 3AO0A 3W88A 4UTTA 5FESA 3WFAA 4PEKA 4IQLA 5HJLA 4CQ8A 1KBJA 1SO6A 4CNOA 5AHEA 1G7UA 3SI9A 1H1YA 3FOKA 1UBSA 3EKZA 1RQHA 1LP6A 1TTJA 5A8GA 3SW6A 3I7QA 2J24A 5E1QA 4AHQA 2X1SA 4ORMA 3QMRA 3M5VA 2PRLA 1X1OA 2QUVA 3EX1A 4ZQOA 4DF2A 1OABA 2PCQA 2X1UA 3DFPA 2ZZ1A 4IMFA 2QCGA 1RVGA 3PF3A 1SW7A 3V75A 3LLDA 4UNLA 3UWUA 3FJLA 3MHUA 4O28A 1EPXA 5MHBA 1H50A 4CNPA 4LC6A 3WJXA 2Q3OA 3GXPA 1AW5A 5G2WA 1LRQA 3RLUA 5LNUA 2CLMA 1S5WA 4L4LA 3NQ8A 3SY5A 1RD5A 2C13A 3W2LA 3L5LA 2P0OA 4LS2A 1FUYA 1K3UA 3BV4A 2QJHA 3DXIA 3W86A 4JTKA 3W7GA 3QZEA 1SZNA 4DQWA 1EA0A 2B7OA 2C3ZA 5DXXA 1YPIA 3M5XA 2BWGA 4O1AA 3P8JA 5F2MA 2CLKA 2CLOA 3B8DA 2I14A 1S5TA 1JULA 3N2XA 4O17A 2Y89A 3G1FA 3NGJA 2W79A 3WK2A 3ATZA 5KMYA 5K4ZA 1W5QA 3USBA 4K8HA 5AHLA 1TRIA 4UNKA 4LY8A 2FB3A 2I1OA 1XKYA 3KVLA 4GUFA 4JYFA 3TK7A 2BLEA 3JR2A 1ALDA 4HNTA 1P4CA 1A53A 5CGQA 1I2OA 5CZSA 3W7KA 1QAPA 3RF9A 2WOQA 1ICQA 1KFJA 4MJMA 3FKRA 4HNUA 2V81A 2OCZA 3SFKA 2RH9A 3EWXA 4I9AA 3STCA 1NEYA 2RHGA 1VCGA 3KFTA 5C55A 5F2LA 5FEWA 4NU7A 4AWTA 1Q6RA 3LCLA 4GNJA 3PAJA 4LS1A 4NNAA 4JX6A 3LCHA 3LB0A 3H53A 3NVTA 3HGSA 5AYYA 2OT0A 2VEIA 3NG3A 1NSJA 5D04C 4QIUA 3GZ3A 4JYDA 3BG3A 4JEQA 3NM3A 4RXGA 1GWJA 1DOSA 3IVTA 1PVNA 4XKYA 1SUXA 4RR4A 3QPYA 3QSRA 3UQNA 3NQ6A 5G4WA 1FCQA 5EKYA 3NZ1A 1QFEA 2BZNA 2QJIA 3PY2A 3KOFA 1L6YA 4FX7A 3NQFA 5TBOA 2PC4A 3GAYA 1I8JA 1GTHA 2V82A 3QQ1A 1OX4B 4ZVJA 3P67A 2E5BA 3HIJA 3M6YA 2Y7EA 4GC4A 4OHQA 4PL1A 5K4XA 1H51A 2V5BA 2FB2A 5IBXA 3GB6A 1WV2A 3W70A 5CSRA 3G1YA 4JX4A 4M19A 3FYPA 4PL2A 1U83A 1KM4A 1KM5A 2NUXA 3EX2A 1J5TA 1IXOA 2QUTA 3WJYA 5HUOA 3QMSA 4M7SA 1UCWA 1PCWA 2Z2UA 1SW3A 4JTHA 1RQBA 5DCDA 4TMCA 2YSWA 2QCMA 5TQLA 1JCMP 4GJ1A 1HFBA 4MZ1A 2ZDRA 1LDCA 1JCXA 2YGYA 4QITA 3KRSA 1FWRA 4BI7A 1F05A 3HJZA 1GYNA 1TPWA 3OHIA 4MFEA 1EP3A 3UWQA 2GJLA 4LV4A 2ZRVA 3EXSA 2GVGA 1VCVA 4MY8A 2HMCA 3FKKA 3NPVA 4AB4A 2VFGA 4ZQNA 2G97A 1SPQA 4JNMA 1YLVA 1Z44A 3H55A 5KZEA 3EWYA 4Z1BA 1KLYA 4RV8A 3TU9A 3MBFA 1JUBA 3L5MA 5DY2A 2CLLA 3W7NA 2E68A 3W71A 3AJXA 2C18A 4UTHA 3TROA 4RX0A 1DHPA 4RLIA 1IXNA 2V2CA 1SO3A 1TPDA 1ZAIA 1HO1A 1FWNA 3M41A 3DFSA 3MO7A 4GFSA 3TXZA 5EL1A 3P5YA 2Q8LA 1I45A 3GNDA 3IVSA 2E1DA 1N8FA 2ZZ4A 3T7VA 2CLHA 2BXVA 3G1DA 3T78A 3B05A 4BR1A 2FPVA 3BW2A 4DEFA 3W1PA 2YFOA 3FLUA 3W1TA 4M5PA 5D2YA 2NUYA 2F7FA 1NVMA 3NQDA 5BW6A 2RKXA 4QNWA 4ADUA 1TV5A 1HG3A 5DELA 4S2BA 1K8YA 4NZJA 4R34A 4QJ1A 3BVJA 1WXJA 2J9XA 3L67A 1DBTA 1P1XA 2ISWA 2V8ZA 2AGKA 3UY8A 3NQ2A 3W07A 4WXYA 1SR9A 5AFDA 3C3NA 4GBUA 1KM2A 2JGQA 4AF0B 1RR2A 5LNVA 1TB3A 4FF7A 4KFNA 4CCEA 4CQAA 1VS1A 4O53A 3NO5A 2QDGA 5K9DA 5LSMA 1SO5A 3L9CA 3KXQA 4RXFA 1U5JA 2E5DA 4O1CA 4E2BA 3MUXA 3R89A 3QJAA 1PIIA 3ABSA 3O07A 3M1ZA 1B4KA 2VENA 3QQ0A 4EOUA 2X30A 1GZGA 3C52A 2CWNA 4JYEA 2ZFAA 1AK5A 1BTMA 3CC1A 3GR7A 1Q45A 2QCCA 1AL8A 4O0KA 1OHLA 2JGYA 4H6KA 1PV8A 4TX9A 1LOQA 1ZHAA 1WOAA 1GVFA 1UUMA 3C4UA 3NM1A 3LBMA 3W7EA 2H8XA 1QPOA 4CCCA 1R2TA 5C54A 2NLIA 3Q58A 3M9YA 2QCNA 4N9BA 4X22A 4IXXA 1W8SA 4YL2A 3HG3A 1PL9A 3KX6A 3W85A 1KTNA 2V9DA 4UTWC 5I3IA 4O0ZA 4UR7A 3IIPA 4HKPA 3LTYA 4NJKA 3BGGA 5D02A 2YR1A 3QM3A 3LHUA 3VNDA 1WOBA 5FEZA 1V5XA 3TSDA 4N6FA 2Z0IA 4UFLA 1KA9F 1N7KA 3HPZA 3QPZA 5I3GA 5CKSA 2DZTA 4BWLA 3LLFA 3NR0A 2B7PA 2UV8G 3MMTA 5DY3A 1WQ5A 3W2JA 1WBHA 3HB9A 2ISVA 4DF0A 2R8WA 4A22A 2VEKA 3Q94A 5HNRA 3LV6A 5TIMA 1XBYA 3NPUA 1A5AA 4JN6A 3W83A 3C2OA 3M47A 4TMBA 1FQ0A 2CZ5A 3WJZA 2ATSA 1ME8A 4K38A 2JKEA 4UMCA 5FEPA 2YXGA 3TSMA 4M6PA 3CWNA 3P80A 4KWVA 2AAMA 3ZFHA 5AB3A 5J5RA 1YTKA 3OVPA 2GQAA 2IQTA 4UFJA 1DORA 2J6XA 2YDAA 3Q37A 4K39A 2YYUA 3HG2A 4DO5A 1EWDA 4PA8A 1ZAHA 3G0SA 4E0CA 3DFOA 3PG9A 1G69A 3CPRA 4XBSA 2C1HA 3LCFA 2YYTA 3LHVA 4RCXA 2NXGA 1SZFA 1XBVA 3BLFA 1W5PA 1F6PA 2Q8ZA 2A0NA 3LRLA 3TW6A 3G0XA 2XN1A 4WY0B 3T4CA 1GVQA 3BK0A 5HUPA 3EWWA 1JRCA 3C56A 4JIQA 2HSAA 3OIXA 4M6VA 1GG0A 5FF7A 4N4QA 5A5WA 4IJBA 3L2IA 3O16A 3GXNA 3C8FA 3HG4A 2I9EA 1H7OA 4FXRA 2EKCA 3S0CA 1FDYA 2V0TA 5K9CA 4K36A 1K8ZA 2GPTA 2GVJA 1A50A 1H60A 3M0ZA 3UD6A 3OBKA 1B4EA 1OFAA 4FIQA 1O5XA 3L68A 3TSBA 1R2SA 2B4GA 4J9JA 1F74A 5D03A 2VFHA 1LOSA 5L9FA 1C9DA 4WUIA 2WJZA 1CW2A 1T96A 3RU6A 3CIXA 1W1ZA 3G22A 5LKYA 1ZAJA 4AAJA 1LRNA 1SZGA 2FDSA 3EXTA 1I4NA 4UUIA 1FXQA 5KSWA 4TR9A 4OV9A 3FA5A 4R7JA 2HS6A 3GYEA 4LVFA 3NNTA 1L6WA 1OFQA 1VC4A 1SSDA 3W2UA 4JTJA 3LHYA 4RZ4A 3NAVA 2TSYA 3PUOA 2B7NA 1PHQA 4WJEA 4I7UA 1HTIA 2Z1BA 4M6QA 3P81A 5CZTA 2P10A 3GKAA 4Q4KA 4WY0F 2NUWA 4QISA 1NF7A 3GKFA 2DU2A 3L21A 2DZPA 4FNSA 4HT3A 1O5KA 4DXVA 3I7SA 1GJPA 1VHNA 3ZS4A 4A21A 1G4EA 4UFIA 1ME7A 1JQXA 3PVFA 3W23A 2HTMA 1H7RA 3M44A 4FNQA 3L66A 3GAKA 1M7PA 4JDYA 4X2RA 4KFOA 3LHTA 3W2NA 3W1LA 1TPC1 3CHVA 2HS8A 3BW4A 4KKXA 1XDMA 1SW0A 1W5NA 1TPFA 2X1TA 4POCA 4UMAA 4YWIA 1WYIA 3O6CA 3UYCA 5F2IA 3VFLA 2ISSA 1AMKA 2NWSA 1OYCA 3PS7A 3S8HA 3LM7A 4X3ZA 4JTSA 2F84A 4DELA 3SIZA 5KINA 1XM3A 5BNKA 4UTLA 4R53A 1YTEA 1G67A 5I3KA 1G7VA 5LGXA 2J88A 4NQ1A 5HWMA 2BTMA 4BFAA 1FCVA 3DZ1A 3NA8A 4P61A 3BARA 2FTPA 1TPVA 3B4UA 1K7EA 3GDLA 5AC6A 3LHWA 3I68A 5GVJA 5AYXA 1TTIA 3A22A 3E0IA 2H3DA 5D2XA 3NYZA 1J2WA 4JS3A 2JKAA 3DKLA 3N14A 3A5VA 5K3VA 1XC4A 5KITA 3UXAA 4Q32A 4RK8A 4OWGA 3E9AA 1Q6QA 3OG3A 1LORA 5LHFA 1TQXA 5I3JA 3DFNA 4NXKA 5G2IA 1LRTA 3L0KA 4AHPA 3NL3A 1G4TA 1MXSA 3N19B 1PCKA 2A6NA 1JUEA 1CX9A 4DO4A 1IXPA 3KVJA 4LNYA 1YTDA 4KFPA 3GDTA 5KTLA 4O10A 2C6QA 4OV4A 3P61A 7TIMA 4AWSA 4C1LA 3F03K 4TU1A 5DBUA 2Q3RA 1F2JA 1H62A 2WSYA 3NQEA 1S3HA 3LOTA 4Z08A 3B06A 5D37A 3W1NA 3QFEA 4ZQMA 1LYXA 3CIWA 3A24A 1X6UA 3W7MA 2RDWA 2A85A 4Z0JA 3C2EA 3S5OA 4GUGA 1GG1A 3N9RA 1VJIA 5LNSA 1DVJA 1QDSA 4LV9A 4NX5A 4N4PA 3PUEA 3S1XA 4IX0A 4ADSA 4WD0A 2ZTJA 4Y90A 1ZJIA 4HSOA 2W0UA 1QNVA 4MVAA 1JJKA 2H3BA 2H8ZA 3TNOA 2FIQA 1GPWA 4O15A 1OX6A 3W74A 2V2DA 2WQPA 2V2HA 1B9BA 3LRKA 1N55A 3ANYA 1I2RA 3G1VA 4YXGA 3RMJA 1YXCA 4PCFA 1DL3A 3MP5A 3MP3A 4RJEA 1BWKA 2QCDA 1JR1A 5E0KA 4O18A 5AOUA 3HG5A 3V1PA 4JTEA 5EBUA 4EF9A 3GDMA 1KFLA 2GUUA 5CZ0A 2ZRZA 1TYGA 2QKFA 4A2RA 2CU0A 3R2GA 1YDVA 5I3FA 2WO5A 1MEHA 2A7NA 4GXMA 2JKPA 3PBVA 4JR5A 4XWUA 3PR2A 1ICSA 2ZA2A 2D73A 3WJSA 3BW3A 1YDNA 1XFBA 1HO4A 2PRHA 3NL5A 3GX9A 4MUZA 4QNEA 4E2DA 2OT1A 2XN0A 1V7YA 1PHWA 1RV8A 1PS9A 2VC6A 4Y9AA 3MI3A 3T44A 4MFDA 4IMEA 4UR8A 5CPOA 3CLMA 3WJWA 4JXCA 4A2SA 4JDBA 3FIGA 2Y88A 1QPNA 4UIOA 3MI2A 4NJGA 4BF9A 3O63A 3QW3A 3FFSA 1W3IA 3G3MA 4PFMA 3HGOA 4ML9A 1DQXA 3G8RA 2FPTA 2TMDA 4U4MA 3OEXA 1PE1A 2H6RA 3EEGA 3IIXA 3SGUA 1A5BA 1KV8A 1YDOA 1TTPA 2DP3A 4GE8A 1L2UA 3CTLA 3QH2A 3IIOA 3JS3A 4UCGA 2ALDA 3B0VC 1KFKA 3GXTA 4JD4A 5DCBA 3SR7A 4MJZA 3L0GA 3NQVA 3W7RA 3EX3A 1ME9A 2DZXA 2C14A 2YX0A 3LV5A 3TUUA 4QQ3A 3G1AA 3W22A 3R13A 1JCJA 5LNRA 1YADA 2H90A 5K2ZA 2G95A 1ZNNA 3TCEA 3TFCA 3CWOX 2ZYFA 1BKSA 3PSVA 5FF4A 4UTIA 5F4WA 3O1NA 2VELA 5AHMA 4AWUA 1JQVA 1QPQA 1OJXA 2ZCGA 3MYPA 5DXYA 4XKYB 1WX0A 1D9EA 4N6EA 4CNNA 4UTTC 3TQ0A 4ALDA 3UXDA 4N9DA 5G4EA 3DI0A 4GWEA 3M5ZA 3NZRA 2NXHA 3L0NA 3UNDA 5D05A 3IGSA 4LS0A 1IIHA 4RZ5A 2C16A 1LM1A 4Z0SA 4HNVA 1H7XA 3DFTA 2RDTA 4YCOA 4LTSA 5F1UA 2QAPA 4DPQA 1EUAA 3NQCA 1KM6A 4GUJA 2RDUA 2ABAA 3STFA 1K02A 4N9EA 3DHDA 4OBTA 3SJ3A 1O4UA 4WZHA 5EMUA 3F1QA 4HSNA 4QM1A 1GVSA 3ABRA 1LLZA 2PE4A 3CQ0A 4LRSA 3LDVA 1ZCOA 3KVKA 1SO4A 1TQJA 1VLWA 3EXRA 4O4WA 3G18A 3O8AA 1O60A 1KLZA 1RQEA 3MWAA 4O11A 1EP2A 1J4EA 3E96A 3HPXA 4IOTA 2ZZ6A 3BG9A 3EWZA 3QC3A 2ZZ2A 4AXKA 1JRBA 1TIMA 3M16A 1FCBA 3LHZA 4JICA 4KWWA 3TJLA 1VQTA 2P1FA 3TX9A 4BI6A 4MIMA 1A5CA 1IF2A 2TPSA 4PODA 3TC7A 1AW1A 2E6YA 1YXDA 4N02A 1XDLA 3W7DA 3SSJA 3ZWSA 3MHFA 1JCLA 1D3HA 4JTTA 1W56A 4TO8A 1OK6A 3HOJA 3I7RA 4GUHA 4HHPA 4XTDA 2GQ8A 3UPBA 1GYLA 1NF0A 2EGZA 4CQ9A 3GR8A 4M7TA 1KFBA 3B0UX 2QCHA 3I6RA 3TA6A 3LCWA 2E09A 4S2CA 1TPEA 1LTDA 2W6RA 5FI8A 4B5NA 3GK0A 3LCGA 5HR7A 4NJIA 3EWBX 1JCYA 2EF9A 1KTBA 4S1FA 1WDWA 1GOXA 1H7WA 1W5OA 3HPSA 4NT0A 4G1KA 4EWND 4P2VA 1XUZA 3B0PA 1XCFA 5C6MA 5D32A 3PBUA 5CPMA 2VFEA 5AN7A 3F4NA 2VFDA 3P60A 4LU0A 3TKFA 1OFBA 2CZEA 2QDHA 3P82A 3CB8A 2YCEA 2CLEA 4IX2A 1AW2A 1XBZA 3GNNA 3LXAA 3LTSA 3NQGA 1ZENA 5ABTA 1ADOA 5CPNA 2Y85A 1S5VA 4JTGA 3C2RA 3ABQA 4O12A 2QCLA 2C19A 2DJXA 2A5HA 2ZZ5A 2Y62A 1I2QA 2R94A 2QF7A 2YZRA 5G1YA 1TPUA 3MBDA 3HBLA 2A6LA 5BRBA 2A2IA 1MEWA 1TMHA 2WNQA 1GVOA 3LCXA 5HMSA 3S42A 5IBXC 1FBAA 1IIGA 1SFJA 4MYXA 1XXXA 4FX8A 4IMGA 2J27A 3CEPA 3NEVA 1WBJA 1FWWA 3GIYA 1OVDA 2B7QA 1OFDA 3WK0A 4Z1AA 3CT7A 3TQVA 4IMCA 3FYOA 4RKAA 2WV8A 2GJNA 3MHGA 3W87A 2NX3A 1XL9A 4FNTA 1YYAA 4IMDA 4LVAA 1QR7A 4O1BA 3DH7A 2VKZG 4MZ8A 3IRDA 2QR6A 5CSSA 3W75A 3BG5A 3IV3A 5H91A 3A9IA 4JGDA 2YFNA 1VZWA 4WQ6A 1GEQA 1M6JA 1LOLA 2V30A 1ML1A 1OFPA 3BLEA 4OGZA 1ONRA 1TREA 2G96A 3G1HA 1KM0A 3LXBA 3P7YA 4IPIA 3RK8A 3PM6A 1E51A 1ZALA 5E93A 3SZ8A 1UASA 1W5MA 1Q6LA 4NZFA 1LZOA 4LVBA 2WSRA 4HPXA 4XTIA 2VEMA 4UTMA 2ZQ0A 4HNNA 3BO9A 3OA3A 4BK9A 3H54A 1VGAA 1O95A 1QWGA 4NX0A 1MEIA 4ORIA 2A1YA 4O19A 4IXHA 4UC5A 3TXVA 1YPFA 4NVTA 4FNUA 4YLWA 2O7QA 1G6CA 4IWWA 2GVLA 1OK4A 1EUNA 4LC8A 4MY1A 1W37A 3MJYA 4TIMA 3N3MA 3W7LA 3WK1A 2Z6JA 5KZDA 1OFOA 3S5ZA 3O05A 3PC0A 2VFIA 5G5IA 4OT7A 3ABOA 1VCFA 1ICPA 2XN2A 2Z6IA 1K7XA 2O7SA 3W1RA 1P0NA 4MY9A 5AC8A 5LZLA 3DAQA 4JY8A 3R12A 3DKJA 4A29A 4X9SA 3L5AA 1KFEA 4Z1DA 3W1UA 4FEZA 4ZL1A 1W3TA 3C0JA 3P74A 1JVNA 1W0MA 5AYZA 2QCFA 3G24A 5AC7A 5L6UA 4MYAA 1Y0EA 3LXCA 2QEZA 1DQWA 2WKJA 1TPH1 2BX7A 2YW4A 3VKJA 3N9SA 4NXSA 1M7OA 3DGRA 4O57A 1TSIA 1OX4A 1R47A 2BSLA 3U8GA 3E02A 3TW7A 3NDOA 2E77A 1KM3A 5F4SA 4NNBA 2WNNA 4JTIA 5D09A 1QO2A 3BLIA 2A7RA 3W7JA 3UZJA 2AQWA 1X1ZA 1B57A 1MSSA 1KW1A 2ZRWA 3TQKA 1VR6A 2J9ZA 3W1MA 3S1WA 3VI2A 3W9ZA 2CW6A 4O13A 5AHIA 5EA9A 1C8VA 1H5YA 5DBTA 4FB7A 2J9YA 1MO0A 1QO5A 2KZHA 1X8FA 3TE9A 3B04A 4O8RA 1LBLA 4LUIA 4FX6M 4NJHA 3P84A 3K30A 1NAL1 1SQ7A 5C5YA 4O1DA 2WSQA 1T99A 5HWJA 1IGSA 3QEZA 3TDFA 2VXNA 1OF6A 1FDZA 4LVGA 3QSTA 4GUIA 3TAOA 2ZRYA 5LHEA 4JTUA 3P62A 1H63A 1O94A 3ELFA 3KRUA 2X1RA 3HMJG 3TH6A 1UB3A 1FDJA 1F76A 3MW7A 3PBYA 3C61A 4UTWA 3LTPA 2XFWA 4EIVA 1LBFA 3GDKA 8TIMA 2JBMA 4D2JA 4LT9A 3IEBA 4UFKA 3W6YA 1K7FA 4O54A 1T8XA 3L65A 2Y61A 3PUDA 4K7YA 3GLCA 3QW4B 1DKWA 4FNRA 1VYRA 4UXDA 3NPXA 1TV8A 5DLCA 1GTEA 2NV2A 3UWZA 4DF1A 1Z42A 2PURA 4OE7A 4QAIA 2OX1A 4PTNA 1G4SA 1VYSX 5IM51 1OFRA 4Z1CA 3DI1A 1LCOA 4BWLC 3CEUA 3VE7A 1W3NA 2LLEA 1HUVA 3RFAA 3TAKA 5EY5A 3QF0A 4NJJA 3PWAA 5AHNA 5FF0A 3S5NA 5FF2A 5D2TA 2GOUA 3A5FA 3W84A 4DPPA 4C1KA 5G2HA 3F4WA 1YXYA 5FF3A 5J5DA 2Y6ZA 4O16A 4ZZ9A 4YMZA 6TIMA 4JTFA 4O52A 3SECA 3OVQA 4UTKA 3WK3A 1FWTA 4AH7A 1H1ZA 3STGA 4MOZA 3S6DA 3W7OA 4L4MA 3THAA 3W7PA 1DV7A 2ZBTA 3W1QA 2OJPA 4E38A 4WOZA 4RZ6A 4FO4A 3PB2A 3S1UA 4DO6A 5C2XA 1SSGA 1Z48A 3TC6A 1RZMA 3W7CA 3HQ1A 4JY9A 2QJGA 4MKNA 3STEA 1KFCA 2VEPA 5CG7A 5T26A 4OQVA 3LERA 3LI0A 4AF0A 3DBPA 3QYQA 2EPHA 1K8XA 2DZUA 2ZRXA 3N2MA 1G4PA 2DZVA 1F5ZA 4FHAA 1OYBA 1TRDA 1VRDA 3RNDA 5CPLA 3KHJA 1FXPA 4ONVA 3A21A 1P0KA 2QAFA 1EEPA 2A21A 2CZFA 4OU1A 3MP4A 1UUOA 3RLVA 3UWWA 4DBEA 4Y8FA 4N9CA 2V5LA 2WPBA 4LRTA 3C2FA 4UMBA 3UZ5A 3UY7A 3PULA 3GDRA 2NZLA 3O6YX 3KRZA 3EX6A 4MLJA 4CCDA 2DORA 3NL6A 3DENA 1JCNA 1NFBA 1GVRA 1TTQA 5HR6A 3EWUA 1B3OA 5DCEA 1XI3A 1KV5A 2ZA1A 4Q33A 4LOCA 4AVFA 4EVZA 2QUUA 2X16A 4LUJA 4H3DA 5D33A 3TV8A 3PBWA 4WX2A 4LWWA 3ATYA 2PRMA 1A5SA 2NV1A 4Y6GA 3KVMA 2R14A 2CLIA 1H61A 1Q3NA 3LRMA 5F1VA 2Y7FA 3MI6A 4LW7A 4R33A 1OX5A 3S1VA 3W1AA 3W3OA 5BOOA 4JIPA 3M5YA 5EYWA 3NQ7A 5HINA 4AMAA 3LBCA 1Z41A 1WAUA 2QCDB 2DZSA 2FLIA 2NXIA 2FPYA 4BI5A 3ZWTA 1BWLA 4NNCA 5SWUA 1EWEA 4ZQCA 4PH6A 3W73A 4O4VA 4AEOA 1AG1O 1LROA 1CI1A 1LBMA 3UPWA 1QMLA 2A4AA 2Y70A 5D30A 2ZTKA 3VE9A 4MZYA 1UJPA 3M43A 2CFFA 3R5EA 3TIMA 3IGXA 1XUUA 4ICNA 3LX9A 3THQA 1TO3A 6ALDA 3U2OA 3QRHA 4FNPA 1M5WA 4JX5A 1HL2A 1ZFJA 3TR2A 1QCWA 4DBDA 3NPWA 1TJPA 2B0MA 4IGHA 1BEUA 2DZWA 1FY6A 5BMWA 1VPXA 3PB0A 4LVDA 3W7IA 3UWYA 3W2KA 4WY0A 2G5WA 3INPA 4HPJA 2CZDA 4MLRA 4ADTA 3GVGA 1DJNA 5CZJA 3T40A 4O50A 2FQIA 2Y7DA 1EIXA 3NQAA 2ABBA 1EB3A 4I7VA 4EF8A 3PSWA 3W2MA 4QSHA 4WXZA 1OG0A 3B03A 5K7JA 3G1SA 2RFGA 2ZA3A 3EKLA 5DN1A 1H7PA 5HQEA 1L9WA 4W9TA 1D3GA 3LCIA 2WNZA 3SGZA 1SFLA 1ZY9A 3YPIA 1OFEA 1TJRA 1RPXA 2EAWA 4WOQA 2ATMA 4HN4A 3UWVA 2C0AA 3TMQA 2JK2A 3TMLA 1F73A 1FCUA 3G8EA 3VCRA 1OYAA 1VH7A 1VHCA 3A23A 3P5ZA 2R91A 1QOPA 1GQNA 3NXFA 1VYPX 3G3DA 1WA3A 1W54A 1KBIA 1K03A 4PC8A 3TFXA 2VOMA 4ZMGA 4XQ6A 4Y96A 2TYSA 5AHFA 3G0UA 2CLFA 2ZRUA 2YPIA 3HO8A 2FJKA 4I7WA 2Y63A 2OZ0A 1L6SA 1P5BA 3N34A 3O15A 2Y7GA 3C6CA 4U28A 1MZHA 3FS2A 1GT8A 1Q6OA 3N73A 3W1XA 4ZQPA 5D2WA 5FEXA 3HGJA 3W76A 5HULA 4XZ9A 3S9YA 3W7HA 1X7FA 1TV7A 3CM4A 3IIZA 5U4NA 4K7VA 1FX6A 1F6KA 3E12A 2TRSA 1R30A 3NL2A 3T55A 1EX5A 2DJLA 1EP1A 4HIBA 4K8EA 3W7QA 3D0CA 2E5CA 3P8IA 2FFCA 4H4IA 3S5YA 1JUKA 1W31A 4UTUA 4AHOA 3FJ6A 2E6FA 5LNWA 4IPJA 5U7SA 2OMAA 5G1TA 3LI1A 4GRSA 1SZEA 4XBKA 1I2NA 5D38A 1LLWA 1KTCA 3BPWA 1FWSA 1THFD 2YW3A 5I3HA 3DFQA 3LGEA 1SU5A 5F2GA 3JRKA 3DHFA 4FXSA 1TCDA 3KAOA 4A3UA 1F7BA 3FEMA 1H7NA 3EX4A 2E6AA 1KM1A 1VLIA 2C15A 3R8RA 1TPB1 3M7WA 1I2PA 1IXQA 2A7PA 4IUOA 2E6DA 3O6DA 5D2VA 3Q2DA 5HWNA 4UFHA 4ZQRA 4JTLA 3IVUA 1OF8A 5F4XA 2GQ9A 2NX9A 3DU0A 2VFFA 3NOEA 4YCPA 4NUWA 2X2GA 3PG8A 1R2RA 3IGUA 3CU2A 5K9XA 3OVRA 3W72A 3QMTA 1T0OA 1DJQA 3IIVA 3MYOA 3NQMA 4CLMA 5KZMA 2ZZ7A
chains in the Genus database with same CATH superfamily
9XIAA 1JYXA 4FIRA 1CGYA 2DDXA 3S6OA 4ZSUA 2NX1A 3TJXA 1R9YA 4F2TA 3CO4A 1K9DA 1V6YA 2J78A 1LWHA 3AMKA 1QW9A 4UFMA 2G3MA 4K6AA 2QCEA 3D47A 2WAGA 4UZSA 4PMUA 4F0RA 3PPFA 3UVIA 3S2LA 5FESA 3VZZA 4EACA 5HJLA 1QRQA 1GZJA 3N4EA 3BAKA 2I17A 1KBJA 1FWBC 5AHEA 1G7UA 3SI9A 2ISDA 5DQPA 5TF0A 3FOKA 1UBSA 4GG9A 2J24A 5E1QA 1T8QA 1NJJA 4AHQA 4L64A 2X1SA 4ORMA 6ENLA 3QMRA 2PGEA 1QI2A 2OOGA 3A13A 3TYBA 3OLIA 1HVXA 1XPGA 4ZQOA 1E4NA 4ZTXA 1OABA 1EZ2A 2X1UA 1NH6A 4CD4A 1WKFA 3BICA 5EMKA 1BVZA 2GUYA 3PF3A 3WLMA 4XZNX 5A95A 1SW7A 3U7VA 3V75A 1JF6A 1P0BA 1M01A 4NAFA 2YDQA 3UWUA 2GVEA 4UQCA 3UWEA 5DRIA 1EPXA 3H4WA 4PN2A 5MHBA 2Z26A 4GINA 5H8PA 3WJXA 4WRHA 4E5TA 2IKJA 4V1YA 2EXOA 2XU2A 5G2WA 2CLMA 4L4LA 3U48A 1U5HA 1QHOA 3AYVA 5CJMA 2P0OA 4LS2A 4L65A 3BV4A 3ONCA 1PIGA 1HKVA 4JTKA 1KR0A 3QZEA 1V93A 1OZMA 1EA0A 2C3ZA 2CHRA 3CUHA 4MAVA 4GIYA 2I14A 1UJQA 1E6PA 1JULA 2Y89A 3G1FA 1PKMA 2W79A 2ZX6A 2DH2A 4GO8A 2Z1KA 5BOFA 2REQA 1TRIA 4UNKA 3TLQA 3RRAA 2F38A 1JEZA 4JYFA 1XLGA 2BLEA 3FSUA 2VWTA 3AC0A 5HJXA 3RF9A 2WOQA 5CJ5A 5E0FA 1PKLA 4US5D 2XM2A 1ICQA 3FKRA 4P8VA 4QEHA 1YHTA 4QDWA 5CAHA 2RH9A 1XLIA 3I6TA 3IRSA 2RHGA 3VGDA 4FLRA 4C6NA 5C55A 4C6QA 4RDVA 5FEWA 4NU7A 4H6EA 1Q6RA 1NOFA 2WB5A 4D71A 5D9OA 4LS1A 3VPLA 1UR2A 4CN1A 1TR9A 1QI4A 3H53A 1Q63A 2VGBA 3VYLA 2OT0A 4IIEA 3U9IA 2VX7A 4ECLA 4JYDA 4JEQA 1K9TA 1GWJA 2GUBA 3IVTA 4RR4A 4WGHA 4MNKA 3GU1A 4U2ZA 1FCQA 4LUTB 1IEXA 4AMCA 1GJWA 1VBGA 3CUZA 4BQ5A 3EOUA 3NVDA 4FX7A 2PC4A 3GAYA 1OX4B 4ZVJA 2OLAA 2Y7EA 4C6CA 3PFMA 1J12A 1XLAA 3CAKA 1EO5A 1X8CA 2YDRA 2FB2A 3AJ7A 3P0XA 5CSRA 4XK2A 4I9TA 3G1YA 1RCQA 4M19A 3I3EA 3EYPA 4PB3A 2QJNA 3VDHA 1LT7A 3RDKA 1OGBA 2TAAA 5A8QA 2QUTA 4M1BA 2ZX5A 1UCWA 1PCWA 4TMCA 1I0BA 1SJBA 1GW1A 4DJEC 2JEQA 3WN6A 3QKZA 4HYRA 4XAFA 5EMLA 4GJ1A 1LDCA 1M65A 2UBPC 2F8QA 1UZ1A 3KRSA 4H2HA 1LQ0A 3HJZA 2J6VA 1GYNA 4LV4A 2ZRVA 2A3BA 2GVGA 4LALA 1ZPTA 4C6OA 4KESA 4ICCX 3NSXA 1OC6A 4D8LA 2RGLA 3GTHA 1JL8A 3ANVA 1MQQA 3N2TA 3L5MA 1DXIA 3GU2A 3SJNA 3WNNA 3W7NA 5REQB 2PTWA 1OCNA 1OT2A 5XIAA 2C18A 4UTHA 3UZWA 4RLIA 1SO3A 3BDKA 3KRBA 1YBQB 1FWNA 3H2CA 2EEXA 3KBVA 3Q65A 3R94A 3VC6A 3A4XA 3B9OA 4D6EA 1B54A 1E6NA 1F6YA 3KL3A 4W88A 4JQ4A 4PYSA 2WBKA 3WLPA 4S3GA 1K9FA 3B05A 3KCLA 2FPVA 3BW2A 4X2PA 2ZDSA 2BNJA 2P8BA 2PWEA 4YS1A 1NOWA 3CV1A 3RM8A 4PUWA 4AIEA 3U4AA 3ZJ6A 3RITA 3BAXA 1R3WA 5D2YA 4RW3A 2F7FA 1NVMA 3NQDA 3LQLA 2J75A 2ZIDA 4S2BA 4AYGA 4NZJA 3ITCA 3UA4A 2XH7A 1KCLA 3H2NA 1YNYA 4J3ZA 4Y9PA 2Y4SA 5AFDA 3GWQA 1TB3A 4CCEA 4NRSA 3BZJA 3VGGA 7REQA 4O53A 3NO5A 5K9DA 1E0TA 5LSMA 4WEVX 1B0IA 1S1RA 4DBSA 5T9CE 3L9CA 2GSJA 3MUXA 1D8WA 1OC7A 3ABSA 5LIYX 3CPGA 2CWNA 4JYEA 1U22A 2ZFAA 4AIOA 2OLSA 1A47A 3GG0A 4QROA 4ZO6A 2JGYA 3LK6A 1R8LA 4AZ7A 1VEMA 1ZHAA 1HF6A 2BB0A 3NM1A 4ROQA 4IP5A 3W7EA 3GC2A 1ONEA 4CN6A 4CCCA 5AKQA 1L6GA 3AIVA 1GQJA 4NZCA 3M9YA 4CCZA 4Q4QA 4MNMA 2DSKA 4IXXA 1FWHC 2OOFA 1PL9A 3SEPA 1M41A 4PMZA 3GXDA 3MJMA 4Q4PA 4O0ZA 3U57A 3LTYA 3GYCA 4NJKA 2OLHA 3AIRA 1AJ2A 2V3FA 3V7PA 4L1WA 3GTXA 1WOBA 2IQ0A 1V5XA 3EPNA 2FTWA 8XIAA 1N7KA 3AHTA 3QOMA 5CKSA 2DZTA 3LLFA 4DJED 3MMTA 1WQ5A 3WNKA 1WBHA 4DF0A 2R8WA 4WCJA 4A22A 2VEKA 2QGHA 3LV6A 4US6A 1WDRA 3XISA 3W83A 4R27A 3DOPA 5H8UA 1ME8A 1H0GA 1YQ2A 1WDDA 3POHA 4MB4A 2VRQA 3TSMA 3W24A 4M6PA 2GLKA 1E4IA 3CWNA 1P0EA 4HCHA 1GJUA 5J5RA 2FHBA 4MB5A 2YDAA 4KRUA 1LL4A 3HG2A 4XV0A 4DY1A 4AG0A 4ZO7A 1EA9C 2F6UA 2YYTA 1XISA 4WSHA 3LHVA 3WLSA 4GD0A 1SZFA 1TJ0A 1KWKA 1LLOA 1W5PA 1F6PA 2Q8ZA 3LRLA 1OCJA 1LUCA 3G0XA 4NZ4A 2PDFA 4WY0B 1GVQA 5CAKA 3OW1A 2Z4GA 4RZBA 3C56A 2FGLA 3L4TA 3L2IA 2JFEX 3WFZA 2V3EA 4QG6A 3TJ4A 3WNLA 1Z6KA 3GVVA 3VAVA 3HG4A 5JBEA 2I9EA 1H7OA 4FXRA 3CK5A 4PZVA 4NHVA 2V0TA 4P7LA 5K9CA 2GVJA 5LA2A 1UH4A 2E8YA 4ZO9A 3UD6A 1B4EA 1O5XA 3L68A 3TSBA 2XZ7A 4J9JA 2QDDA 3WFLA 1CW2A 2J7EA 3GVWA 4E2OA 1E3ZA 1PZ0A 3GH7A 1ZAJA 4RDYA 4JOMA 4JIIX 4PRRA 3EXTA 2NSOA 1FXQA 4OV9A 4F0KA 1A0CA 3NNTA 1L6WA 3AAMA 3KP1A 1VC4A 2EO7A 1WZAA 1TWIA 5BXTA 3LHYA 3A3XA 2BG5A 3HA1A 2TSYA 1HTIA 3S4TA 3TN6A 3VMOA 5BXPA 3P81A 5CZTA 4PMJA 4WY0F 1NF7A 7A3HA 2DU2A 4BQ4A 3RLGA 3KBSA 4U3CA 4C6JA 1Q4WA 1QW8A 1VHNA 1G4EA 3BOFA 2Z7GA 1UWRA 1I1WA 1RJPA 4F0SA 3ARWA 4AIUA 1H7RA 4D8ZA 3L66A 3PBGA 1ZBKA 4KEUA 3CHVA 3BW4A 4AU0A 3AS1A 2JF6A 1DWHM 4B5SA 1BYCA 2ISSA 1K6AA 1UOZA 3RLHA 3UZZA 2GJPA 3PS7A 3S8HA 4KF1A 2F84A 4RNFA 2PLJA 4AD4A 1G67A 4GIEA 2PDBA 5LGXA 3NSMA 2PTYA 2DT2A 1Q6FA 1HZYA 3UJFA 2CCRA 3AICA 3SCVA 1M53A 4BFAA 3DZ1A 3RCMA 2QYGA 1K7EA 4WDWA 4HSHA 4B5XA 2XJ7A 1OGSA 3I68A 5GVJA 5AYXA 2PD9A 2H3DA 4X61A 2ASHA 2NVCA 4Z17A 1WZLA 4XO6A 1PWMA 3AALA 3LEPA 3UXAA 1W2VA 1MDRA 3OG3A 3PZVA 1JZ2A 5GJNA 5I3JA 1VPYA 4LCQA 3CZEA 5G2IA 3UR7A 4AHPA 2CNCA 4FI4A 4L5ZA 1MXSA 2A6NA 1J10A 1HT6A 2OELA 4LNYA 3HV8A 1TFVA 5JUVA 1RY8A 3N2CA 4S3BA 1EF2A 3VGBA 4KWUA 1BXNA 1HX0A 3ARXA 3NOYA 3QKEA 2FZBA 4AWSA 4C1LA 2EG7A 4GCAA 3VGFA 2YJQA 3LOTA 3B06A 3DEQA 4NAEB 3QFEA 1UD6A 4FLQA 3RGTA 1X6UA 1AA1B 4KMQA 3T08A 4ES4A 3S83A 4EXQA 3QHMA 4GUGA 1DVJA 2X42A 5A2CA 1I6NA 1QDSA 4NX5A 4N4PA 3PUEA 4IX0A 1ZJIA 3ZZ1A 1JJKA 2IXUA 4C5YA 3RO6A 2H8ZA 3I3DA 3L23A 3TNOA 4O15A 1OX6A 4LUYA 4UR9A 1R0MA 3ANYA 1PYFA 4FALA 1CEOA 3RMJA 1YXCA 3KLKA 1CB2A 3EBVA 3E3HA 4GGBA 4RJEA 4ASTA 1JR1A 2D2GA 1CT5A 5E0KA 4GH3A 3HG5A 5EBUA 1RY0A 1KFLA 5CZ0A 4V28A 1TZ9A 2E4TA 2Y5JA 2E40A 3B8TA 1PYMA 2VP8A 5D9PA 2PP1A 4W93A 3AS3A 3VGHA 2ZA2A 1OD8A 3WJSA 3BWWA 3GX9A 4HPNA 2OT1A 2XN0A 1RV8A 2VO5A 1PS9A 3GDBA 2YL9A 1XS2A 3BMXA 3MI3A 4MFDA 4IMEA 2VZSA 4WSJA 1M7JA 4A3HA 4A2SA 3FIGA 4ZB2A 3EWDA 1TVNA 4W8AA 3UG8A 3G3MA 3HGOA 1DQXA 3OEXA 1PE1A 3SGUA 1A5BA 1SM9A 1KV8A 3GU9A 1XLFA 4P8XA 3IIOA 2ALDA 3ITGA 3NQVA 3PHAA 3RX2A 3EX3A 1ME9A 3ITTA 3EZ4A 4H41A 3EOLA 2DZXA 5DANA 2HQAA 2PDPA 2QF8A 1E1EA 3THCA 3W22A 1E72M 1Y7VA 1NTHA 4HPHA 2PDMA 4U31A 3TFCA 2ZYFA 4GVIA 1BKSA 2C0HA 4U5IA 5DMMA 5F4WA 4UQAA 4D6DA 3GE7A 1QPQA 3EMCA 5A6KA 3MYPA 1TUXA 1TV4A 3TTYA 4R3UA 1D9EA 1PJ9A 4N6EA 1OQFA 1R5YA 3QTGA 3QR1A 3TQ0A 4N9DA 3NZRA 4M56A 3UNDA 5D05A 3SRDA 6XIAA 2NV9A 2WPGA 3DFTA 4YCOA 2DPEA 4QE1A 4C6MA 3GH5A 4F9DA 4RW5A 4AUBA 3NQCA 4GUJA 2EQDA 2RDUA 5AC4A 3T9PA 1TX0A 1IHIA 1YPXA 3DHDA 3SJ3A 5M3WA 2Q71A 5EMUA 1CCWB 4L7ZA 3CBWA 4HSNA 1DXEA 2Z1XA 2W3ZA 1UWAA 4LRSA 5DX7A 3KVKA 1HVQA 1SO4A 3WMLA 4GVGA 4PTDA 3WF0A 2I5GA 2XSAA 3MWAA 3OGRA 1EHAA 3HPXA 2ZZ6A 3SSZA 4R5EA 3EWZA 4AXKA 1JRBA 2C7FA 1E43A 5M03A 1TIMA 2BY0A 2AL1A 3SCSA 3TJLA 1ADDA 2IS7A 3TC7A 1AW1A 1F4HA 1YXDA 3GSMA 1UC5A 2V3DA 3EPOA 3SSJA 3ZWSA 4GJIA 1JCLA 4JTTA 4UTFA 3UG5A 3IS4A 4YTTA 4XD4A 2GYIA 3DC0A 4GMEA 1TVLA 3URNA 1NF0A 5EB8A 4CQ9A 3GR8A 3OYXA 4IQEA 3OGSA 4DWSB 5BOEA 4JFWA 3G6LA 2I57A 3WH6A 1PDYA 5FI8A 4B5NA 4FXFA 3GNOA 5D9NA 2ANUA 3IK4A 3CO8A 1GOXA 1KQYA 5I0DA 1XUZA 3B0PA 2XIOA 5CPMA 4MKVA 4A6GA 4IUGA 4XUYA 2ZOXA 3WQEA 3CJPA 3KDOA 4GLEA 3EDKA 1US2A 4ZENA 3AWOA 4LEFA 4EAYA 3BLDA 1ZS2A 1OSEA 3BLOA 1W9BM 2WM1A 4HU8A 3DFHA 1FWGC 4IX2A 1KXQA 3CV6A 1IZCA 3ZLHA 1BGAA 3LXAA 1VAHA 1ZENA 1ADOA 2Y85A 2C19A 1I2QA 3CQHA 2EPMX 1UWIA 1QBBA 2OQLA 3DG6A 3EAUA 3VNYA 3ZQ9A 3LCXA 2ACUA 5C9XA 1GVEA 1FBAA 2YKKA 4OIFA 4BS0A 1EJSC 1Z9AA 4PBGA 1FWWA 3GIYA 2WZIA 4MWAB 4F4RA 1I1XA 3CT7A 3TN5A 2O0TA 3TQVA 1KD0A 4RKAA 2GJNA 3V0UA 3EA1A 1U1HA 1V51A 3W87A 2UY3A 3N04A 1XL9A 4IMDA 1C92A 5CSSA 1CGWA 3BG5A 2Z27A 4ZXOA 1VZWA 5A6BA 1LOLA 3BLEA 1ML1A 2BP1A 1KM0A 2OGJA 2GJXB 1O1ZA 2VZTA 1KXHA 4PTWA 1BAGA 4NZFA 1TJ1A 4C6LA 2VEMA 3BO9A 4B91A 3OA3A 4BK9A 1VGAA 5H1WA 4B2DA 2XGIA 4ORIA 4UC5A 3QLLA 3UJRA 1ZJHA 1G6CA 1HKKA 2FZDA 1AQFA 2GVLA 2DT3A 5TD4A 3W7LA 2Z6JA 2YXOA 2G41A 3S5ZA 3O05A 5FJRA 2OO6A 4S3JA 4Q4RA 3ABOA 1ICPA 2XN2A 2DIEA 3W1RA 3OB8A 5B80A 4MY9A 2HNEA 1X97A 5AC8A 5HMEA 4DZ5A 3DAQA 5LZLA 3WG6A 3DKJA 1KBBA 3SURA 4M0XA 2AQOA 4GI6A 1LL6A 5A6MA 3C0JA 4A3YA 5AYZA 5JIWA 4LUTA 3UESA 3LPPA 2E3ZA 5L6UA 1Y0EA 1QU4A 4GYPA 2QEZA 2WKJA 4J3SA 1TPH1 3ZSSA 4EPBC 2Z1SA 1OX4A 4KH2A 3NDOA 2E77A 1XIHA 4NNBA 2WNNA 1XH2A 3WF3A 3N4AA 1EIBA 5C2CA 1REQB 1QNPA 1GPFA 4JNYA 4KRZA 2VI0A 1TZZA 2ZRWA 4H7VA 4FK9A 2QZRA 1M3UA 2W4XA 1C8VA 2PZNA 1DEDA 3MCMA 1GQLA 2GDQA 1JZ5A 5DRCA 1JD7A 4HOZA 2XSXA 4IGMA 1KCZA 4GVFA 4PUUA 4HP5A 4UCFA 4EPKA 5I23A 1QTWA 4FX6M 4NJHA 1SQ7A 3QZAA 4O1DA 1TR1A 2WSQA 5C9WA 3OLDA 1OG6A 4TTUA 1B3WA 3SUSA 3BSGA 1K9EA 4LVGA 3QSTA 4GUIA 3TAOA 3N2BA 5LHEA 3KS6A 4FSAA 1SGJA 5GNXA 3ELFA 3SRFA 1G0CA 4I8YA 3K4WA 4PB4A 1UC4A 1FDJA 1QVBA 1F76A 3VDCA 4DIAA 3C61A 5A69A 1LBFA 4EXBA 1GQIA 1HJSA 1TA3B 2JBMA 3EB3A 4D2JA 3ALFA 3W6YA 2VD8A 1K7FA 4HMNA 3L65A 3TJIA 1F4AA 2Y61A 3PUDA 4K7YA 3T8QA 2JALA 1R3RA 3VOIA 4FNRA 1EJWC 2J74A 2VD9A 1YBQA 1EJVC 4UXDA 1TV8A 3STPA 2PURA 4OE7A 4DJDA 1UZDA 3VE7A 1W3NA 3WX7A 4FAMA 4EK7A 5EY5A 3MO4A 4NJJA 1E0VA 2BGSA 4L6DA 5DT7A 4HOXA 4A35A 2WMGA 1XINA 5G2HA 3VX0A 1S1PA 5FF3A 1QT1A 2PDLA 3QHNA 3BJSA 4Q6XA 2E7FA 2WWDA 4GY7A 4YMZA 4Q6JA 2IPFA 3RXZA 3VDGA 1HKWA 2QNEA 1EEXA 3KDNA 1UUQA 3F5KA 4WK9A 1UHVA 1IEWA 3BLLA 2NQZA 4RZ6A 4JZ5A 4GQQA 1SSGA 2WJFA 1Z3NA 5HJYA 1P7TB 1TG7A 1XIMA 5CG7A 1JDFA 1NU5A 4CEUC 3R4IA 1WAWA 3GW3A 2EPHA 2ZRXA 3DYMA 2DZVA 1F5ZA 2DUAA 1VRDA 1FXPA 1GONA 1K4HA 3T8LA 2ZICA 4DWDA 1EC7A 1XYFA 2FMOA 3PZIA 1PEZA 3MP4A 1UUOA 3BSHA 2V5LA 3C2FA 1XH0A 2W27A 3KRZA 1JNEA 3FXGA 2DORA 1RK6A 1NARA 5DCEA 2ZA1A 1A49A 5JBDA 4AVFA 4EVZA 5D33A 3TV8A 3UCCA 3H26A 3ATYA 1XYMA 3BSMA 3V35A 3RM4A 3KVMA 3H21A 4I5RA 1QI5A 3MA8A 3NZPA 1H61A 3WDJA 1VFMA 2XINA 1C3FA 3CAQA 1EDGA 2Y7FA 4E8CA 4LAKA 4M1RA 3S1VA 2CXGA 1RP9A 1KBLA 4ZR8A 3WH7A 4PFHA 3RX3A 5GQBA 5HINA 1P6WA 2QVNA 2QCDB 3BXWA 4RNJA 2GSEA 2PTXA 2Z25A 4ZBCA 5AZ1A 3EOOA 3ONBA 5SWUA 3V5CA 1A5UA 4ZQCA 1XFCA 3W73A 2YA1A 1TWWA 5ABGA 1CI1A 2AL2A 3EDJA 4LX4A 2Z28A 1QMLA 1EOKA 3CH0A 5D30A 3UP8A 1LF1A 1YX1A 5LXXA 3WQVA 5IHRA 2CFFA 1FHLA 2PDKA 3R5EA 3K4AA 2PBOA 3LX9A 1CECA 3U2OA 3CQIA 3QRHA 3SBFA 4JX5A 5BU6A 1HL2A 1ZFJA 1MWOA 4KWOA 1TJPA 4IGHA 3TYEA 4D6HA 2DZWA 3W7IA 1WUEA 4PGLA 4WY0A 2W61A 5BYWA 4YNGA 2PWDA 4LAOA 2XYLA 4XBJA 3AMLA 3CXOA 1M7XA 5CZJA 2HXUA 3PZTA 1E4MM 2ABBA 3KL0A 2XFRA 1PX4A 3A9BA 1E73M 3DHPA 2QV4A 1L9WA 4W9TA 3H2EA 2WNZA 4IIBA 2A3AA 2EAWA 4HN4A 2HK1A 5LA0A 1FCUA 1XJBA 3AHXA 1VH7A 3VO0A 4TX8A 1GQNA 1J18A 2VC9A 2VRJA 3C0LA 3IUIA 1H1NA 2GJRA 2PDCA 1WA3A 1KBIA 1H5VA 3TFXA 5BRQA 4L9XA 3RRXA 3GH4A 2DSZA 5AHFA 1V08A 2Y63A 2HDJA 4IJCA 3T0TA 1L6SA 5MKGB 3S9IA 2D69A 1WE5A 3DX5A 4U28A 3D3FA 1BFNA 1RSCA 3RO8A 2W5FA 3W1XA 1UQZA 1B5TA 1X7FA 1VP5A 2ZXAA 3ECQA 4K7VA 4B9ZA 1QUMA 1FX6A 3S2MA 4MUPA 1GKPA 3NL2A 1E5NA 1RD6A 1VB9A 1QW7A 3PK7A 2NLYA 4D8AA 1Q7MA 4H4IA 3S5YA 1JDDA 2E6FA 1V02A 1DPMA 1ONXA 2VNCA 3QFWA 3VNIA 1OBAA 3LBOA 5D38A 1THFD 3BPWA 2YW3A 2ZX9A 1CXFA 3FEMA 3EX4A 5HNUA 2PD5A 3R8RA 3T2PA 3GZAA 3BMVA 1IXQA 2XZ9A 3F5LA 2E9MA 1ZP4A 5HWNA 4ZQRA 1X38A 2AMGA 3A4JA 1V77A 3WEZA 4NUWA 5C8BB 4B5TA 2OR2A 2Y0FA 4MSSA 1W17A 3CPUA 3IGUA 1J6OA 1BGGA 4IL2A 4LCRA 2D0GA 3W72A 4PUDA 3QMTA 1DJQA 3QPEA 2WZTA 3N2OA 2PSNA 4PTMA 1CXLA 5JIPA 1DJGA 4QSFA 3ZR4A 5H2ZA 5LGZA 3HPFA 1XBXA 1POJA 4MPQA 2J25A 3U6WA 4UTJA 4B4FA 2Z2AA 1XD0A 3O06A 1WDQA 3HF3A 3WD3A 3AUOA 1AL7A 2I5QA 2ZUVA 2BOGX 3EB2A 2OKOA 2ZZ3A 3MZ2A 3E0VA 3L12A 2WCGA 2R24A 3I65A 3E38A 3C2VA 4Y9NA 4MF4A 4GVHA 1R9ZA 1JD9A 2POTA 5IDIA 4GYJA 3AS0A 2J79A 3CZJA 2WQDA 1V3HA 2D2OA 4NIRA 5A8GA 1LP6A 1VENA 3M7SA 1QK2A 4P5UA 1VFTA 2PTDA 3M5VA 2RDXA 2P8CA 1MQPA 3VNZA 2PCQA 1WNOA 3N18A 3WD2A 1JFHA 3ALGA 2CHOA 3PZOA 2QCGA 4QLJA 4LXFA 1XIBA 3FY1A 3RILA 3S3GA 2FZ9A 4A8LA 3LLDA 3RPTA 3I6EA 4UNLA 4AY7A 2R82A 2YXXA 3K8MA 2P5NA 3MHUA 1W1VA 4M81A 1TWDA 3VINA 4LC6A 3SCNA 4CNPA 2Q3OA 3M6DA 3GXPA 3CLWA 2FTYA 3RLUA 4E3TA 2QDEA 3RYSA 3SY5A 1ZZMA 1U2YA 3W2LA 3KWXA 4I5UA 1UP3A 4IISA 2ZWYA 2VMFA 3R10A 1SZNA 1Z69A 1TIWA 3WSUA 3BURA 5DXXA 1FWIC 4O1AA 3BGAA 4HCLA 1N82A 2CLKA 3ARTA 4OUIA 2R1PA 3E2VA 4IT1A 4O17A 3NGJA 3WK2A 1DQUA 4AX6A 1RXOB 5HPCA 4F3HA 5K4ZA 1HXJA 3ITLA 4L6HA 3USBA 4LY8A 9XIMA 4GUFA 4HNTA 3JR2A 2IKIA 5A6SA 5CZSA 4C6EA 1PKNA 2HPIA 5DT5A 1HKJA 4ZCWA 3GM8A 3GHSA 1B3VA 6CGTA 3RM9A 2G0WA 2OCZA 4CQBA 3MQTA 4A8IA 3EWXA 2GL5A 3Q4DA 3TLLA 3VUPA 3VXGA 3MV11 2WHJA 3AIQA 5HOSA 3UXKA 3LNMA 2PU1A 3LCLA 4GNJA 2EG8A 3PAJA 4Q8VA 4X63A 4GI4A 2PA6A 1O66A 3NVTA 3N12A 2VR5A 4X9YA 2VEIA 1NSJA 2X41A 4QJ3B 2Y8UA 3BG3A 3C5QA 1PX3A 3TWAA 3SY8A 1CWYA 4ZE4A 1SUXA 1D7FA 5EFDA 3NQ6A 5G4WA 2V6AA 2WMJA 3MPGA 2QJIA 3WLRA 3G2GA 3KOFA 4FOJA 4S3DA 5TBOA 1AZ2A 2CBUA 1GTHA 4J4KA 3QQ1A 1FFRA 1AD1A 4AX7A 3BV7A 2E5BA 3NDZA 3QTPA 4E3VA 1KGXA 1H51A 2V5BA 5IBXA 4PMYA 1WV2A 3W70A 4JX4A 1U83A 1KM4A 1IXOA 3E2QA 3WJYA 1CLVA 5HUOA 3QMSA 4M7SA 5LXEA 4BJHA 1G9HA 1RQBA 5DCDA 4AY8A 3MVIA 1UKOA 4GJJA 4MZ1A 1GUVA 1W1B1 3EOSA 1VFSA 3WH9A 2HVOA 4NP7A 4R9OA 1Q2RA 3VOGA 4BI7A 5HANA 3OHIA 3V36A 3SUWA 2GJLA 1ZBVA 4YTRA 2J7FA 3EXSA 4DYKA 4MY8A 2I56A 1CGTA 1SPQA 2REQB 1XLKA 1L8NA 4Y7EA 2DIKA 1Z44A 5KZEA 1NQ6A 1TWZA 2INZA 1KLYA 3HMCA 3MBFA 3ITYA 1PB0A 5DY2A 3R8GA 3FJ4A 3VOFA 3WDQA 4RX0A 5KZ6A 2V5DA 1IXNA 3B4YA 4XAPA 2NQ9A 1XX1A 3UZXA 3M41A 2OSXA 1A4MA 2OO0A 1XYLA 2VVNA 4Z2LA 9CGTA 1N8FA 3N15A 4L9ZA 3T7VA 3CUJA 2DVXA 3G1DA 4G6CA 4IQDA 1GK8A 4GOAA 1N8WA 2EJ1A 2QXWA 1Q13A 5HQMA 3FLUA 1TELA 3MMDA 2IPWA 4FOKA 4JQ3A 3M0HA 1C7TA 2IKGA 2CXEA 4LF2A 4M5PA 1UIPA 2VWSA 3ABZA 2RKXA 2WVVB 1TV5A 5DELA 3WQ8A 4GYPC 4GFIA 3L67A 3HFTA 3WY1A 1P1XA 1DIKA 2ISWA 2AGKA 3UY8A 5HBFA 4WJ8A 1XLBA 2VQUA 3IJDA 3W07A 3N17A 3U5UA 1KM2A 2ACRA 3RU8X 1JYNA 1RR2A 4GQRA 4CQAA 5LNVA 3FVMA 1VS1A 3F7JA 4MWAA 1C93A 1JI2A 1SO5A 4RXFA 3PBMA 5EGRA 1XR2A 1XLCA 4E2BA 3O07A 2HVMA 4KT2A 1GZGA 3SUVA 1A5KC 5TAOA 4QBXA 4YTUA 3CC1A 2DW6A 2XH0A 4O0KA 4H6KA 4PCPA 1PV8A 4V33A 1W3LA 3SQSA 2PODA 1LL7A 2J4GA 4MGGA 1UUMA 1B31A 3AYTA 2NLIA 3LN3A 1IEIA 1ADSA 4N9BA 3WD0A 4AC1X 1W8SA 4YL2A 1CBGA 1O6IA 2O56A 3KX6A 2FKPA 4HU4A 1XRTA 2V9DA 2D0FA 4Q7IA 3GG8A 4ZOEA 2VR4A 1EL3A 3BGGA 5D02A 1G5AA 4HHLA 4H9ZA 3H6OA 4H9VA 3V18A 2PGRA 5DF0A 2ISFA 5E5CA 2QMJA 3SCRA 3FHAA 2Z0IA 1KA9F 5I3GA 1EJXC 4DJDC 4PBEA 3W2JA 2ZXBA 2XSBA 1I9CB 4DM2A 5HNRA 2W62A 1XC6A 1XBYA 3KLLA 3NPUA 3DERA 3DFYA 1A5AA 4JN6A 3C2OA 3PUGA 3M47A 3S1GA 1FQ0A 4HJWA 2ATSA 4X0NA 1WDSA 4H9XA 1B1YA 5FEPA 3KTXA 1EPVA 4W86A 2PWGA 3ZFHA 4I5XA 5C9UA 5AB3A 4ZOCA 3FNDA 4B2DD 3Q37A 4K39A 1E1CA 5I24A 4U2YA 4FXJA 3N4FA 1EWDA 1UKTA 4E0CA 2ZX8A 3CPRA 4XBSA 4DNHA 4XG1A 4CEXC 2NXGA 1XBVA 2PFHA 3BLFA 2DT1A 5CPTA 5HXMA 4CUCA 3TW6A 3VCCA 4AZHA 1FHVA 3KOYA 1A5OC 3BK0A 5HUPA 3EWWA 1VJSA 4N4QA 1ISYA 1EGZA 1BD0A 1FFQA 2W67A 4F0LA 3S0CA 1K8ZA 1W3HA 4L56A 1JZ6A 1A50A 1H60A 3M0ZA 2FVLA 4AD2A 4FIQA 4HA3A 2B4GA 1F74A 3NO1A 2WW5A 2X0YA 2WJZA 1T96A 4EANA 3RU6A 1W1ZA 3G22A 4QRNA 1LRNA 1I4NA 3HQOA 5KSWA 3FA5A 3UJ2A 1S3TC 5HA7A 4DAIA 4KWSA 4LVFA 1O68A 3E2SA 1C9WA 3EEZA 3BAYA 3PUOA 1R3TA 1TA3A 4MNJA 4M6QA 2P10A 3GKAA 1W9VA 4O0QA 3GKFA 4QCFA 3L21A 4FNSA 2FYMA 5A6JA 3WH8A 3I7SA 1GJPA 4LBSA 4P7NA 2FVKA 4J7RA 2HTMA 2PZ0A 3N6HA 1P6CA 1TMLA 3F4DA 4FNQA 3PJUA 3W37A 1GYMA 3GAKA 3C3UA 3LHTA 3W2NA 2HS8A 1JG9A 1SW0A 2X1TA 4W5ZA 4YWIA 3O6CA 2XFYA 3UYCA 4DLMA 3VFLA 5GPRA 1AMKA 3POCA 1OYCA 4ENLA 3UYIA 4BZYA 3U5YA 2R1MA 3SIZA 5KINA 4UTLA 5FCZA 5BCAA 2FZNA 2BTMA 4J2MA 1OIFA 4QR6A 2ZADA 3WLLA 2PDQA 3IPWA 2FTPA 2YLAA 3B4UA 4C5ZA 3JZEA 2AKMA 4AIBA 1Q8JA 4WGXA 5D2XA 3TNBA 1E3XA 3DKLA 1P7TA 2BS9A 3LNPA 4S38A 1XH1A 1K1DA 3K13A 3PAOA 1IT0A 1JI1A 1KRCC 2NQ5A 2HWGA 2ZE3A 1TQXA 5BWFA 3L0KA 1E6SM 2ZVRA 1EX1A 1OY0A 1CB7B 3DCPA 3GG1A 3IJ6A 1IXPA 1S2VA 4Z2HA 4KFPA 1A0EA 2F2HA 3PJXA 4WJXA 2DEPA 5JXQA 3R58A 1CGVA 1H62A 4Z08A 5AC5A 4QDMA 1M9HA 1ZBCA 3CIWA 2DSWA 3A24A 1Q65A 3W7MA 4AEEA 2RDWA 1OB0A 2A85A 3RAOA 5LNSA 1UOKA 3WQPA 2CETA 3FX4A 3H7RA 4PMOA 4Y90A 2W0UA 3V16A 3CL6A 3DECA 1ZCCA 3UGRA 1GPWA 3ITVA 3W74A 2V2DA 5TNVA 2V2HA 4I6VA 3LRKA 1IYXA 5FSDC 7XIMA 4F8XA 3FA4A 2PAJA 5BXRA 5JH2A 4P7RA 2QCDA 1GVYA 4MNLA 3H22A 4JTEA 3GDMA 2P76A 2GUUA 2ZRZA 1XIGA 5FJTA 4A2RA 1BVWA 1A5LC 3GNRA 2HPMA 3R2GA 4L1XA 4LYRA 1E40A 1MEHA 1QNRA 3PBVA 4JR5A 3UEQA 4XWUA 3PR2A 1F9CA 4ICMA 2QIIA 4AD0A 3RCYA 3BW3A 4P7OA 1YDNA 2ZUTA 3NL5A 4MUZA 4E2DA 3GIQA 4JKLA 1C8YA 3D3AA 3L4VA 3G6MA 3T44A 3VKDA 1BXCA 4UR8A 3E6EA 2YCKX 3B97A 2GFTA 2Y88A 1ECQA 4HMEA 4JTAA 1EOMA 3WBXA 4UIOA 3MI2A 3O63A 3QW3A 3FCPA 3H2FA 1W1IE 3OJGA 2FPTA 3G8RA 2H6RA 2DP3A 4GE8A 1L2UA 3AIUA 1S2CA 3CTLA 4C6PA 1XYZA 3JS3A 1OGGA 4HZ8A 3GXTA 5DCBA 1SVDA 3SR7A 3MUCA 1C8QA 1US3A 5E0CA 2CIPA 1PPIA 3FW6A 2TODA 1LG2A 3M0JA 3IACA 5LNRA 1YADA 2X40A 5FF4A 1A3WA 1GOMA 1FWAC 4KQNA 2VELA 1JQVA 1E9LA 3U7BA 1XG3A 1UWQA 2E9LA 3ZT5A 4H01A 3DI0A 3D5HA 1H49A 2AKZA 2Z24A 3JU2A 3RJXA 3IGSA 2E67A 1Q7QA 4RZ5A 3UXLA 2D20A 4Z0SA 1A3HA 3E0WA 4HNVA 1XG4A 1V0MA 4IHCA 2RDTA 2R9RA 1J5SA 3VGEA 4S3EA 5MKGA 4CQDA 3WQOA 3ZMRA 2OFJA 4ERIA 3W29A 4OBTA 3KZPA 4HU0A 4TTGA 3VIIA 1O4UA 4UOJA 5LIKX 2OB3A 4GZEA 3OP2A 1WP6A 3M0IA 4KERA 3USZA 2O9PA 4YPJA 3CQJA 3CWHA 4QM1A 1GVSA 5BWAA 1LLZA 2PE4A 3CGTA 3AS2A 1ZCOA 3GTNA 3ZYZA 1PZ1A 1VLWA 3EXRA 2PF0A 4G7FA 4PULA 3H2OA 4LNCA 1UH2A 4NI3A 1JCTA 2ZWZA 4DUOA 4O11A 4Q4MA 1EP2A 1J4EA 1Q6EA 3BG9A 4WKFA 5FJPA 3M16A 4JICA 4KWWA 1VRXA 1HP4A 2P1FA 3A4AA 4E8DA 1CXKA 1TUFA 4RNIA 4CD7A 1A5CA 4LB3A 2E6YA 2OG9A 4YTQA 3WMSA 1W1A1 4IG2B 1ODUA 4HYWA 2W63A 1S2UA 4IL0A 3S47A 1UROA 2BVTA 3HOJA 4CGTA 1PWLA 3KL5A 4IP7A 3B0XA 2GQ8A 3UPBA 1GYLA 3W0KA 3I4KA 4M7TA 2QCHA 1LTDA 4QDPA 2W6RA 2PDHA 3PTDA 2PMQA 3UR2A 2V63A 4R85A 5HR7A 2DQWA 4NJIA 2WMFA 3SN0A 4AY1A 5FOOA 4L61A 1EH9A 1KTBA 4S1FA 5IFTA 4J40A 4MG4A 7TAAA 4G1KA 3ZLFA 3F5JA 1W2PA 2Z29A 5C6MA 4BY3A 4IJRA 5AN7A 3F4NA 2VFDA 5CLWA 3QYSA 1R87A 2HVNA 4LU0A 3TKFA 1J0HA 2OSYA 2CZEA 2JIEA 3PZMA 3AXMA 2YCEA 1WPCA 4PUJA 3WEOA 1AW2A 3F4CA 1NELA 3URBA 2GWNA 3E74A 3KBNA 2RJGA 2I7GA 5ABTA 1KGUA 3C2RA 3LYEA 1IGWA 3ABQA 4O12A 2DJXA 1V6TA 3ZO9A 2YZRA 1SYTA 1Y8BA 5FKYA 1TMHA 3D46A 5HMSA 1VEPA 5IBXC 1UYQA 3DHUA 1SFJA 1XXXA 4FX8A 1WBJA 3RHGA 4EE9A 5HK4A 4AZ6A 2B7QA 2OWXA 1XIIA 4GQGA 3H8AA 2G50A 3LUTA 3FYOA 2YCIX 1W6TA 2WV8A 1HNYA 3CTTA 5HNNA 2GGJA 3DBNA 3AMGA 4KCVA 2NX3A 4PB5A 1YYAA 4O1BA 5ECVA 3IRDA 4HTBA 4CVUA 3A9IA 1AFSA 2DZAA 3H2MA 4WQ6A 3EPMA 1GEQA 3PPCA 1Y5VA 2G96A 4HN8A 3G1HA 1KRAC 3RK8A 4O1EA 1V02E 1UASA 1Q6LA 3IUHA 5I03A 4HNNA 5T9BG 1WO2A 1E6QM 3O3RA 3M0VA 1MEIA 2QMKA 3APTA 4O19A 3TEVA 1YPFA 2VZVA 1E5JA 2OEMA 2O7QA 4ZOBA 4Q8UA 4DWSC 3CAWA 3BLPX 2ZKMX 3VMNA 1E6RA 4LC8A 2Y8VA 2ON3A 1W37A 4GXPA 3LPOA 1XYCA 3N3MA 4BEQA 1H09A 3WK1A 5KZDA 1OFOA 4JBRA 1K6WA 1E9ZB 3KTCA 2PGWA 1P0NA 3B3DA 3LS9A 4DJFA 1FWCC 5A8PA 2J8TA 3TOYA 4A3QA 5EMJA 3R12A 4A29A 5I5RA 4AYSA 3W1UA 4ZL1A 3P74A 4ZSTA 4JFSA 1W0MA 5AC7A 1YRRA 1GZ1A 1UR0A 2PC8A 1XLHA 1XLEA 2HISA 3GFZA 4XZBA 2YW4A 3UJSA 1M7OA 2F9RA 1X1NA 4O57A 2ACQA 2BSLA 2EPNA 3MSDA 3GFXA 3GD6A 4WLCA 4JTIA 1HKMA 1QO2A 3PTQA 3ARYA 2POZA 3IJIA 3W7JA 5C9ZA 1UD3A 4K2SA 1KW1A 5ABEA 4IICA 4MWAC 3AHZA 1VR6A 2J9ZA 3VIMA 1JZ4A 3S1WA 4ZO8A 4Y8EA 2CPUA 3W9ZA 4O13A 5EA9A 1J0KA 4FB7A 1FTXA 1SJAA 2C8NA 1MYRA 1QO5A 2KZHA 1X8FA 2X05A 3B04A 4AW7A 3SCUA 2PGFA 4FMVA 1T99A 5HWJA 3TDFA 1IT8A 2XUCA 4RPQA 3VFCA 1JPKA 1QHZA 2QUMA 4GBDA 1GNXA 3L4UA 4B9YA 1UB3A 4Q3MA 1CGUA 3MW7A 3PBYA 1W9PA 2HXTA 1T8XA 4O54A 1ZBWA 2P88A 2WZMA 1V3LA 4NKCA 1GHSA 5FSEC 2OSWA 1G01A 2NQJA 3NEHA 1DWFM 3NPXA 1GTEA 4F0MA 3UWZA 1C7SA 1JPDX 1G4SA 5IM51 3FDKA 1LCOA 3WNOA 3WL0A 3TAKA 1H0IA 2CBJA 4EPEC 5D2TA 5KETA 3OZOA 3W84A 4DPPA 4C1KA 3F4WA 4AISA 1YXYA 5DMYA 2Y6ZA 5T8GA 2V5KA 4C7FA 4KIRA 6TIMA 4JTFA 4GYKA 4JL2A 2Y5SA 2QJMA 3WBYA 1FWTA 1UPMB 2WVVA 3STGA 1QK0A 4LSBA 1ITUA 1GW9A 3TN4A 3W7PA 4AZGA 4GISA 1Q85A 1JF5A 4DWSD 3WKZA 1K4GA 4FO4A 3S1UA 4DO6A 1RZMA 5IDZA 1XWYA 3HQ1A 3KBWA 4JY9A 5H8MA 2J7GA 2VEPA 2QQ6A 2AOSA 1RBOB 3LI0A 3O0FA 5BXSA 3DBPA 4GNVA 4OTKA 1D2KA 7CGTA 1G4PA 3O6AA 5CC3A 4FHAA 4ZEPA 3QGKC 5DEZA 1TRDA 3VC5A 4XD6A 2NT1A 5CPLA 3ARPA 1P0KA 2RGMA 4J1OA 4IIHA 5XIMA 3W53A 2CZFA 3RLVA 3UWWA 1C8XA 2WPBA 4GO9A 1R38A 3UY7A 1H41A 3GDRA 2NZLA 2WJDA 3M0XA 3GTIA 4GGHA 4CCDA 4B4HA 1TV3A 4PTVA 1CGXA 3EKGA 3B8WA 4DI8A 1IWAA 1NFBA 5HR6A 4KRTA 3EOEA 3GQYA 4YTSA 1Q8AA 1BYBA 1IV8A 1XI3A 3QR0A 3GS6A 3VMPA 2QUUA 4H3DA 3PBWA 2IPGA 4LWWA 3OO2A 3KW3A 2QUNA 1Q7ZA 4TOQA 4EWJA 2R14A 4QLKA 2PDIA 1Q3NA 3GVRA 2G3NA 3LRMA 1HJQA 4MWAD 4GNKB 4LCSA 3VIFA 5EYWA 3NQ7A 1Z41A 3GXFA 2PDXA 5J8LA 4C1NA 1CXIA 2DGAA 4XVDA 3AISA 2PWUA 3AHVA 4NRRA 3AZSA 1UBPC 5HDRA 1FOBA 4PH6A 4WKAA 4O4VA 2HE8A 3T6CA 4AEOA 5F7UA 2HCVA 5CZKA 4IM4A 1LBMA 3R7MA 4G2DA 1XQLA 3OZPA 5ECUA 4MZYA 5D8ZA 6XIMA 2Z00A 1QNOA 2XIJA 5CPQA 3KP0A 4ZFCA 4OUEA 4KS0A 4PCSA 2DH3A 2PCEA 2XIBA 3QV6A 3TIMA 3CASA 1BKHA 1XUUA 4ICNA 3R25A 2EPOA 2DV0A 1TX2A 3TR2A 2VJXA 4DBDA 3TYDA 2B0MA 3BZGA 1VPXA 3PB0A 4Z42C 2G5WA 4RUBA 1LJYA 5FL0A 2CZDA 3AXIA 4MLRA 4ADTA 5B7ZA 1MXGA 4O50A 6REQB 2HEJA 2FQIA 2Y7DA 1EIXA 3LLXA 4P8WA 4YYFA 5DO8A 4AVNA 2ZXDA 3W2MA 4CNSA 1DJZA 1RUSA 3ZIZA 2PS2A 5A6LA 1OG0A 3B03A 4DRSA 1XP3A 1UMLA 2ZA3A 5DN1A 3VKCA 3KS5A 3EDDA 4FR6A 3RCNA 1D3GA 1GORA 4MWAE 1SFLA 1ZY9A 3KBJA 3YPIA 1TJRA 3VIJA 3TMQA 5LA1A 2JK2A 3TMLA 3A6OA 1OYAA 1UR1A 3A23A 1MW2A 1QOPA 5C9RA 1WB0A 1PTAA 3G3DA 1BYAA 1W54A 5GJMA 4PC8A 3AXKA 2JIWA 2PPGA 3OQEA 3WBAA 3SCWA 1MNZA 2JEPA 4OFCA 3ISIX 2XVPA 1JPMA 3B8IA 4YVPA 3E5BA 4PCTA 3WO8A 2Y7GA 4AZ5A 1FWDC 1MZHA 1GT8A 1Q6OA 3GVQA 3N73A 2VR2A 3W81A 5D2WA 5FEXA 2OQYA 3HGJA 4LYPA 3W76A 5HULA 4XZ9A 5IHSA 2YIHA 1XRVA 4KEZA 1OIMA 4XSMA 3IIZA 3CM4A 2J77A 2AL2B 4D6FA 3E12A 3OBAA 1R30A 1EX5A 1RK5A 3FAWA 1EXPA 4MDOA 2E5CA 3P8IA 4G8TA 1JUKA 1W31A 4AHOA 2UWFA 3L7RA 3MCNA 3QY7A 1F3WA 4HK7A 4C90A 4GRSA 1V6XA 2AQVA 1I2NA 1U30A 1KTCA 1FWSA 5I3HA 1V0LA 1JIBA 3DFQA 3LGEA 1SU5A 5F2GA 1QJWA 1N2VA 1TCDA 4FXSA 1KKRA 1F7BA 2E6AA 1KM1A 1UD4A 1T6MA 1TPB1 2XDFA 3M7WA 3MUAA 1OD0A 3M0LA 4GQBA 3O6DA 1QWKA 4I90A 4JTLA 1IQ8A 1OF8A 3ARRA 5F4XA 4NY2A 3ARSA 1YIXA 3FSTA 5FJIA 2VFFA 3NOEA 4QLLA 3VDAA 1DJWA 5C2GA 1MVYA 1DWAM 4OJYA 5BROA 2GGEA 1X96A 3LY0A 3CU2A 4JFUA 5K9XA 1RVKA 3OVRA 4PR4A 3MYOA 3IIVA 5A2AA 4CLMA 3TOPA 2XG9A 3Q67A 5KZMA 3WL1A 3FJNA 4A05A 3BGJA 2JQXA 4KPLA 3GRIA 1ZTVA 3SM0A 1J79A 3HGRA 2WYSA 3OOQA 3LENA 1XHGA 5BMXA 4XUGA 3SCTA 1U33A 2DFAA 3KOWA 1EZWA 4O14A 3F4VA 5EPDA 2YBTA 3W88A 4UTTA 5CPSA 3COTA 1SO6A 2Q09A 4B5UA 1ZQ5A 2OZ8A 3A4WA 3EKZA 1RQHA 3I7QA 1XGZA 4PSRA 3CHFA 3OZYA 1X1OA 1S2TA 2D1ZA 5IRPA 2QUVA 4S23A 3EX1A 4DF2A 4O1FA 3DFPA 4PUKA 1MZRA 3ZLGA 4QE5A 3V4BA 4IMFA 2PDNA 4I9MA 1K77A 5CLTA 4HK5A 4HK6A 4YU1A 4DN1A 5CH9A 5XINA 3FJLA 3CHCA 1JFXA 4O28A 2J7BA 1GKRA 5PTDA 2CEQA 8XIMA 4B5VA 4U10A 4WVXA 1AW5A 3R0DA 3UCDA 3NQ8A 1RD5A 2C13A 4IQJA 3BE7A 1FUYA 3DXIA 2WXDM 2B7OA 1DE6A 1NDWA 2RAGA 3P8JA 5F2MA 3EA2A 2CLOA 2VOTA 3B8DA 1C91A 1S5TA 5FAJA 1FWEC 4JL1A 2O4MA 3GIPA 1RCXB 2IXVA 4M3PA 2VC5A 1F07A 3GUGA 3LM3A 1W5QA 1XSIA 4EPDC 2FB3A 4UQDA 3TK7A 1ALDA 2Z7KA 1P4CA 1A53A 2WKLA 5B7YA 3VM7A 4UQBA 1UD8A 5ABFB 1JNDA 1KFJA 4MJMA 4M29A 4BF7A 3CL8A 4S3AA 2V81A 5CGTA 1T5AA 3SFKA 2WZHA 1PBGA 3W82A 2ZUSA 1NEYA 2A3EA 1VCGA 1RALA 1DWJM 3V3WA 5F2LA 1DIEA 4UBPC 3KM8A 4QP0A 1DP0A 1GKQA 4NNAA 3LCHA 4AZCA 5ABHA 4C6IA 3U3HA 3EMZA 3GZ3A 4GQ0A 2XVKA 3NM3A 3PTKA 4XB3A 3SO7A 1UD5A 3IAPA 1DOSA 1PVNA 1V79A 5EKYA 3MT1A 2R1NA 3PY2A 3UNTA 4IFOA 5EU9A 2OWCA 3U2EA 1I8JA 3CYVA 3P67A 3F2CA 3HIJA 1EQPA 4QFUA 4OHQA 4PL1A 5K4XA 4LB4A 3CNYA 1MFVA 4KGLA 4AFYA 3GB6A 3OODA 1BF2A 4B3KA 4H9MA 2EPKX 2XIIA 3SB0A 4PL2A 1JAEA 3AZTA 2NUXA 3EX2A 1J5TA 1R9XA 4IMAA 2Z2UA 4LH8A 3KTSA 4JTHA 2PU0A 3V1HA 2QCMA 1OM0A 2J47A 5I6SA 4JIEA 3C0QA 3MS8A 3RPDA 1J9YA 2CC0A 4KIEA 2FZMA 2A3CA 3WEMA 5DMLA 1E70M 4QITA 1I0DA 1JXJA 4CU7A 4U33A 3C2YA 1TPWA 4AEFA 4RE3A 1VCVA 4HNCA 2HMCA 3NPVA 1IZJA 2G97A 1R3YA 2V5JA 1VFFA 4JIHA 4IG2A 1YLVA 1AJZA 3H55A 1EBHA 2PP3A 4ATLA 3QZ6A 4Z1BA 4RV8A 2YB1A 3BCJA 3VTRA 2X8RA 2CLLA 2E68A 2F2KA 3FV9A 3TROA 3ZT7A 3EDEA 1ZAIA 1HO1A 2WBGA 2NQHA 4JQ2A 3MO7A 3DESA 1MW3A 3L4YA 3MMWA 3P5YA 2Q8LA 3F2BA 2P3EA 3GNDA 1AH4A 3TA9A 2ZZ4A 2CLHA 1B30A 2BXVA 3VCNA 3T78A 3THUA 2ADAA 1V3MA 4E6MA 4EP8C 2YFOA 1OADA 5E9AA 4DJFC 1WKEA 4QJ5B 4PRWA 3TZFA 3R0UA 1Q66A 3T09A 2NUYA 2VX4A 3E0FA 3SCPA 4QNWA 1HG3A 2I5IA 3QGVA 4JTQA 1K8YA 2WANA 4QJ1A 3BVJA 1PX8A 1WXJA 4XKMA 5CBBA 4O8AA 1DBTA 1TE6A 1EJ7L 2WC3A 3JW7A 1QNSA 3NQ2A 4HHHA 4HB7A 4DXKA 1SR9A 4GX8A 4H1ZA 1EJTC 2X0HA 4GBUA 3HPAA 1NDZA 4AC7C 1WUFA 2YLLA 4MJ4A 3C86A 4AF0B 4FF7A 4RNHA 2ZX7A 3CYJA 2CHNA 2WSPA 3KXQA 4YIWA 1U5JA 2E5DA 1YE4A 4O1CA 1XSKA 4LFYA 3WYZA 3R89A 1D8CA 1G94A 1B4KA 2VENA 3M1ZA 3QQ0A 2X30A 4REQB 2ZUNA 1BRLB 3GR7A 1Q45A 2QCCA 4HD5A 1OHLA 1UKSA 3LBMA 4X60A 2DIJA 2H8XA 1VBJA 4C6DA 5MF5A 1QPOA 1R2TA 5C54A 3GTFA 2QCNA 4X22A 3M0KA 2G4FA 5BZAA 2G8ZA 3JUGA 3GNXA 4IFKB 3NYDA 1WDPA 1KTNA 1U1JA 2QS8A 5FACA 1NQKA 3IIPA 3UG3A 4Y9MA 1TMQA 5HAOA 2ICSA 1P48A 3WF2A 3LHUA 3VNDA 3RJYA 3PPGA 5FEZA 1MRAA 4UFLA 3QPZA 4W7UA 4BWLA 3NR0A 2B7PA 5DY3A 1HL8A 3HB9A 2WC4A 1QASA 3T42A 4URIA 3MDUA 5TIMA 4H9UA 4ACZB 4BQ2A 4MMWA 2EJAA 3QVQA 4A3RA 1POKA 4TMBA 4NYYA 3WLIA 1HGWA 2JKEA 3BCFA 3GHTA 4UMCA 3DC8A 3U4FA 3CZLA 4B90A 2YXGA 1KRBC 3NFUA 2VX5A 1QATA 4G7EB 3WQCA 1GOWA 5FJOA 1HP5A 2QLYA 2GQAA 2IQTA 1XPYA 4UFJA 2J6XA 1IR2A 2YYUA 4DO5A 1FHDA 3LMZA 4PA8A 3G0SA 1PIFA 1RA5A 3DFOA 4P7QA 1U5VA 3VM5A 2C1HA 3CS2A 4RCXA 1KCXA 5AZ0A 3N29A 4DI9A 4OBRA 3WLTA 4HBKA 2HSAA 3OIXA 4M6VA 5FF7A 3MVTA 5M5DA 4H8VA 4JFTA 1FDYA 1XGEA 1VFOA 2WC7A 2GPTA 3WQ5A 1K70A 4DJFD 1OFAA 1KBKA 1ISWA 5D03A 2VFHA 4MADA 1LOSA 3K1GA 3GNPA 4UQ9A 3WQ4A 1MRQA 2YB4A 5CBJA 2GGGA 5LIUX 1XV8A 4MHBA 5LKYA 4AAJA 2FDSA 4UUIA 1H4PA 3ZOAA 1SR0A 1SSDA 2WVSA 3AIBA 3HFYA 3UERA 4JTJA 4IGSA 1NP0A 3VIPA 4K1GA 1QBAA 2HZGA 3PNZA 2VUYA 2Z1BA 1NDYA 2UY2A 4LANA 2NUWA 1HJXA 2DZPA 5DFAA 3EA3A 4CN4A 1O5KA 3QBUA 4XIMA 5RUBA 1ME7A 4I9JA 1JQXA 3PVFA 4ZFMA 2C1GA 2ESCA 1MUMA 1M7PA 4JDYA 4X2RA 3W1LA 1TPC1 1MXDA 4KKXA 1XDMA 2CITA 1W5NA 1TPFA 4UMAA 1WZKA 1EGMA 5F2IA 5I7GA 3L4ZA 4WDXA 1E1CB 4DELA 1MW1A 1RP8A 3AMCA 3MDWA 1G7VA 2J88A 3R43A 2YA2A 4NQ1A 5HWMA 4PMXA 3TTQA 4P61A 2PP0A 2PTZA 1EDQA 5I79A 3GDLA 5AC6A 1IZKA 4D72A 2BDQA 1VJZA 1HL9A 2F61A 4C65A 4N7QA 1TTIA 3WD1A 4UB9A 1F8IA 3E0IA 3ZJ7A 2VYOA 4JPGA 3N14A 3A5VA 5CXPA 5KITA 1YE6A 2HBVA 4Q32A 4RK8A 3GC4A 3K5XA 5LHFA 3CZKA 3KE0A 4IIFA 3ZVIA 1LRTA 1HJVA 4J28A 3NZQA 1G4TA 1L0PA 1PCKA 2RJHA 1JUEA 4V15A 3BJTA 2HJPA 1CXEA 2YDSA 4KEVA 4O10A 5I02A 3MZNA 3KBMA 3CUGA 5DBUA 2XTKA 1S3HA 4MB1A 4PMQA 3IARA 3W1NA 4D6CA 1BXBA 1V4YA 1LYXA 3OYZA 1BHGA 3VVGA 4W8BA 2C79A 3C2EA 3QXBA 1GG1A 2GDVA 3SQMA 2XPKA 3NQBA 2W66A 1S46A 2O4QA 1H2JA 1QNVA 4MVAA 1Q6DA 2H3BA 1F3XA 2FIQA 7ODCA 2BXYA 4YYCA 4MKSA 4TUFA 3HQNA 2WQPA 1B9BA 4YXGA 3IWPA 4PCFA 1JPIA 1AH0A 1DL3A 3OBEA 3MP3A 1BWKA 2XH2A 1GVIA 4O18A 5AOUA 4E2VA 2BODX 3OLEA 2GZXA 4D6GA 1TYGA 1AUSL 1KCKA 2X1IA 1W1TA 2CU0A 1YDVA 5I3FA 4PUNA 5AVHA 4GXMA 3N9KA 2D73A 1DJXA 1XFBA 2VGGA 1CZ1A 3RR4A 4QNEA 2KX9A 4ATDA 3QGAC 1V7YA 1FHUA 2VC6A 1EKOA 5CPOA 3CLMA 4HHMA 4AD5A 2Y2WA 3VILA