3LCWA

L-kdo aldolase complexed with hydroxypyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
NLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERAQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRHGFDAVSAVTPFYYPFSLEEHCDHYRAIIDSADGLPMVVYNIPALSGVKLTLGQIYTLVTLPGVGALKQTSGDLYQMEQIRREHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECNKVIDLLIKTGIFRGLKTVLHYMDVISVPLCRKPFGPVDEKCLPELKALAQQLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-acetylneuraminate lyase
publication title Modulation of substrate specificities of D-sialic acid aldolase through single mutations of Val251
rcsb
source organism Escherichia coli
total genus 111
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lcwA00
2HS6A 2QDHA 3DFNA 2X1UA 5HWJA 1K7FA 3NZ1A 4A2RA 3HG4A 3PBWA 3TAKA 2VC6A 2GVJA 3PR2A 5E1QA 1G69A 3O1NA 3W88A 3LI0A 1N7KA 4IJBA 1SSGA 5HR7A 4JEQA 1W31A 4XBSA 2I14A 2XN2A 4WZHA 2I1OA 5D2WA 1S3HA 2YXGA 2Y7DA 4QITA 5AB3A 5LNUA 1W8SA 1TMHA 2R94A 1PS9A 4X22A 1PE1A 1VCFA 4PL1A 1V7YA 1FWSA 3IVSA 4IX2A 1KM5A 4TR9A 1I45A 3OVQA 1C9DA 2ABBA 1VRDA 1VHNA 3O6DA 4EOUA 4H4IA 1Z42A 5DXYA 1ZNNA 3DFQA 3O8AA 4JTHA 3TC6A 2Q3OA 3BPWA 3G3DA 1F74A 4LVDA 4QM1A 3PUDA 1F6KA 1VCVA 5I3JA 4MYAA 1B4EA 2ISWA 3HPXA 2RH9A 1THFD 2YDAA 3UWYA 4PA8A 1T8XA 3B03A 3P7YA 4QSHA 2ALDA 3KVLA 2CLIA 5CPMA 3SGUA 3W73A 4UMBA 2YW4A 4O15A 4LU0A 5K2ZA 4ML9A 2Y62A 1NF0A 3HGOA 3GXPA 1H7NA 4BI5A 5KTLA 1JCLA 1MXSA 2NX9A 1HG3A 3KX6A 3MYOA 1TV5A 1QO5A 5LSMA 5C55A 1TPUA 1MEIA 3FKKA 4MZ1A 1TB3A 5F4XA 2V81A 4MY1A 3MWAA 3OVPA 3W1TA 5I3HA 4ONVA 1S5WA 4RR4A 3MHUA 2UV8G 4FB7A 3MI6A 3FJ6A 4FNTA 1KM6A 2ZBTA 1YXCA 3NQVA 1NEYA 3TE9A 1JULA 1BWKA 2QCNA 5FF0A 4IXHA 1FBAA 3PB2A 5CKSA 3S1VA 5F2MA 3NQDA 1KFCA 3PC0A 1ALDA 4CQ8A 2B7NA 4QNEA 3BLIA 3NM1A 3BLFA 3FOKA 4LT9A 2ZTJA 1RVGA 1ICPA 5K3VA 4GUHA 1O5XA 3LERA 4S2BA 3M41A 2CLMA 3TAOA 3GAYA 2QCCA 2X30A 1NF7A 1SSDA 1YXDA 2QJHA 4WOZA 1FQ0A 1NVMA 1TSIA 4H3DA 4UTWA 2VOMA 2FPTA 2PURA 1JUKA 5AYYA 5I3GA 2A1YA 2WV8A 5AOUA 3LGEA 3LV6A 3WK0A 4NNAA 1L2UA 1KM3A 3SECA 2BSLA 6TIMA 5EY5A 1J4EA 2WSQA 1I2PA 3MJYA 4R7JA 1JRCA 2QKFA 2F84A 1O94A 1EEPA 1TPDA 2WJZA 4K38A 4O18A 1Z44A 4PEKA 3GK0A 1KFBA 1M7OA 5DBTA 1NSJA 3WFAA 1BWLA 1OFBA 3LTSA 3C8FA 1EP2A 3R89A 2JKEA 3PY2A 2QUVA 4NVTA 1JVNA 2FLIA 3C6CA 3HIJA 3QQ0A 5F1VA 2WNNA 2WOQA 2QUTA 4MVAA 2FQIA 4AEOA 2C1HA 1LOQA 3UPBA 4LVAA 3W87A 3W2JA 4RXFA 4PFMA 1BTMA 3PUOA 3W83A 4LRSA 2CLEA 4MY8A 3W7GA 5SWUA 2ABAA 1OF6A 4K7VA 3P84A 3CEUA 1L6WA 1PHQA 3UWVA 1OFDA 4EIVA 1RZMA 1QPRA 3STCA 2CLFA 5F2GA 1YADA 3TQ0A 4GRSA 1FY6A 2QJGA 4I7WA 2J9YA 1MSSA 4RXGA 5H2ZA 2YCEA 4NXKA 3QZEA 3GZ3A 1DJNA 5FEWA 4WOQA 3W7IA 3TX9A 3DI0A 4O4VA 3STEA 4AHOA 2V2CA 5BMWA 2Y63A 2B7PA 1DJQA 4OWGA 4S2CA 3HGRA 1E51A 2TYSA 4MLJA 3TCEA 2RHGA 3MUXA 2Y85A 4FNSA 3UQNA 3U2OA 4C1KA 3W3OA 1Q6LA 2BXVA 5FF4A 2HSAA 3TFXA 1OHLA 1VHCA 4DO5A 2E1DA 1EB3A 4UTMA 1ME9A 3UZJA 3IIXA 3R5EA 1EUNA 4BWLC 3GYEA 4FNQA 1FCVA 1UJPA 1R46A 5HUOA 3EKLA 1TPFA 4HNUA 4NJHA 1NAL1 1XDMA 2PRMA 3EEGA 4RZ4A 4U28A 3W75A 5AFDA 4LNYA 2XN1A 2R8WA 3GR7A 3CWOX 5D30A 4XKYB 4UTKA 1H60A 2DJXA 3NNTA 4K8EA 1PHWA 5TQLA 1ICSA 1OFAA 3CWNA 4WD0A 3BV4A 1JQVA 2QUUA 1BEUA 3LTPA 1G7UA 4X3ZA 4DF1A 2ZA2A 1TTQA 3O15A 2O7SA 4FX8A 1GVRA 4YCOA 4TIMA 3W7KA 4UTUA 1QWGA 1GQNA 1R30A 3G24A 3TK7A 5DY3A 2AGKA 3DH7A 4A2SA 4RX0A 1QPNA 3G22A 1QOQA 3NOEA 4GWEA 1A5AA 1RPXA 4O1DA 3E02A 2JKAA 4NT0A 4W9TA 3P5ZA 3W7LA 1XC4A 3QMSA 4DPQA 4JDBA 5G2HA 5FEXA 2EPHA 4NNBA 1HFBA 4LS2A 4P2VA 3DFOA 4JN6A 3NGJA 3LHTA 3PS7A 1TPC1 2TRSA 3TW7A 2X16A 3DGRA 3TNOA 4JX6A 4Q4KA 1X7FA 2ZRUA 1I2RA 1IIGA 4JX4A 2QEZA 3L5MA 4UTTA 1IIHA 3CHVA 5LKYA 1H50A 1W5MA 2Y70A 6ALDA 2NV2A 3EX1A 5HR6A 1LBMA 2H8XA 4Y96A 2ZCGA 3QSTA 2DZTA 1ME8A 4N9DA 3WK1A 2V2HA 1A5SA 4TX9A 2OT1A 3LHVA 1R2TA 3BARA 3O16A 2DJLA 4PH6A 3RU6A 2QCLA 3A9IA 3TXZA 3STFA 2DZVA 1DQXA 2C14A 3DHDA 4LVBA 1AMKA 4AAJA 1KV5A 1XFBA 4ZQMA 4UFJA 1T99A 4BR1A 3IV3A 2QAPA 2C3ZA 1H5YA 3TQVA 1VR6A 3G1AA 1TV7A 1QMLA 3LCIA 3R8RA 4YMZA 3LCLA 5AC6A 1GEQA 2ZRXA 1OFQA 3O05A 2VEMA 5D2XA 3M7WA 2FTPA 1G67A 2J27A 2V8ZA 3BVJA 3V75A 4DO4A 3IIPA 1OABA 2YSWA 1QDSA 2H3BA 4PTNA 5EBUA 4KWVA 2ZZ5A 1W3NA 2A5HA 2E5DA 5A8GA 1B9BA 4LV4A 1W3TA 4YCPA 2YFNA 3LCGA 4BWLA 3CEPA 2BWGA 1P5BA 4M7SA 2YZRA 3DU0A 1IXQA 3QYQA 3S5ZA 3QM3A 3HB9A 4GNJA 4DPPA 2ATMA 2FB3A 5DXXA 4WXYA 1GPWA 1SW3A 4NU7A 3NEVA 4AWSA 2P0OA 3M16A 1X1ZA 3Q2DA 1W5OA 1C8VA 3U8GA 3S5NA 5C54A 3OEXA 3C52A 2CWNA 3EWXA 1J2WA 1A5BA 5C5YA 5D02A 1EWDA 2V2DA 5DN1A 1L6YA 3I7QA 3NQCA 2NXGA 5EKYA 3KFTA 1W5PA 4FNRA 4MFDA 3QSRA 1PV8A 3HO8A 4P61A 2VKZG 1AK5A 2YGYA 5G1TA 5ABTA 4RV8A 4UMAA 1JCXA 1UUOA 2H8ZA 4GXMA 1YTDA 3L2IA 2EAWA 5DCBA 4N4QA 1JJKA 4XZ9A 3QPYA 4AF0B 1FDZA 1Z41A 1SZNA 2V82A 4H6KA 4N4PA 3TR2A 2HMCA 1TO3A 2CLLA 4FIQA 4GUIA 4LTSA 3LCWA 5HUPA 1OF8A 4UXDA 1TTJA 4BFAA 3OBKA 2W0UA 1SW0A 1RQBA 4A3UA 1WOBA 1XBVA 1X6UA 3CPRA 3N2MA 4KFOA 3K30A 1JCYA 4MPQA 3BLEA 1EX5A 3A22A 2GJLA 1P0KA 1Q3NA 4GUFA 5AHFA 4GC4A 3RLVA 4WY0F 5D03A 1OYAA 3W2UA 1SFLA 4HNNA 1VQTA 5MHBA 3MP5A 1ZCOA 2VFHA 1QR7A 3IIOA 3TQKA 3W1NA 5U7SA 3MI2A 4JIQA 4C1LA 1WBJA 2EKCA 5J5DA 4QNWA 4GUJA 1B3OA 3L68A 4MJZA 3TDFA 3C56A 3T44A 1N8FA 1FWWA 1YPFA 3W7EA 3GB6A 4EWND 4OGZA 1TRDA 1DHPA 5CZTA 1IXOA 3TW6A 3P8JA 1JCMP 2ZRWA 3JR2A 3WK2A 3ABSA 1FX6A 1SO5A 1LCOA 2CLHA 1SQ7A 1TCDA 5D38A 3CT7A 4NUWA 2RKXA 3UY7A 1DKWA 1NFBA 2A21A 5CGQA 2CZ5A 1JUEA 4IX0A 5L9FA 2DZSA 3HF3A 3HGSA 5A5WA 4BI6A 5KZMA 4Q33A 3G3MA 1H7WA 4M7TA 1Q6QA 4Z0SA 3W7DA 3PVFA 3DZ1A 3HPZA 3W7MA 2CLOA 4UNKA 3I68A 2JGQA 5DELA 2X1SA 1XI3A 1WXJA 3QEZA 3SJ3A 3IVTA 4LVGA 1TJPA 3D0CA 1K7EA 3LXAA 3UYCA 2NX3A 3NQ7A 3Q37A 1RR2A 3T78A 3S1XA 1GTEA 4A22A 4PL2A 1GVOA 1OX6A 4LC8A 1LLZA 3IGSA 2J88A 5HWNA 2NUXA 5BW6A 3LCFA 3HBLA 5D2TA 4DQWA 4O53A 3W86A 3ZWTA 3QF0A 1LM1A 1XM3A 2WKJA 3BGGA 3L0GA 3E96A 4E0CA 3ZFHA 3NPXA 3GDRA 4N02A 2A85A 3LXCA 4LUJA 4HHPA 1H7RA 3QPZA 1K8ZA 3LV5A 3LRMA 3GX9A 2ZRZA 4JIPA 2PCQA 2PC4A 2C15A 4TO8A 1H7PA 5KMYA 5U4NA 3PB0A 4IMFA 3W84A 1A50A 3LTYA 3W7HA 2ZQ0A 4QAIA 1TREA 3KVKA 2HTMA 4O1AA 5AYZA 5AC8A 1DORA 3KRSA 3ANYA 4FX6M 3VI2A 3P74A 3W7OA 1HO1A 2C13A 4WUIA 2OT0A 3IRDA 5DCDA 5G2WA 3OA3A 4FX7A 3MO7A 3F4WA 3NQAA 1EPXA 2NXHA 3PG9A 5EPDA 1O4UA 3UPWA 3CIXA 3DFTA 2NLIA 2QCFA 2P10A 4JTFA 1XKYA 1Q6RA 1IXNA 2GQAA 3T40A 2ZZ6A 3O63A 4IWWA 1MEWA 3N9SA 4FO4A 3LBMA 4JTSA 3GDLA 5CPLA 3IGXA 3TV8A 1PL9A 3R12A 4O4WA 3S1UA 3RLUA 4JYDA 4UFHA 3LDVA 4CNNA 1M5WA 2EF9A 3DFSA 1G4SA 2ZYFA 2Y7GA 4ADTA 1PCWA 1ZALA 3EXRA 2J9XA 4PCFA 3DENA 4Z1DA 3W2KA 4JTKA 4TMCA 4GJ1A 2A2IA 4WY0A 2ATSA 2ZTKA 1GWJA 5BRBA 1TYGA 4GBUA 3NZRA 3TJXA 4KWWA 3W1QA 3DXIA 4UTIA 3LRLA 2WNZA 1YTEA 1H7OA 3M5XA 3HJZA 5AC7A 4CCEA 3BG3A 3WJXA 5G1YA 3G8EA 4FNPA 3MHFA 3SR7A 1WX0A 1XBYA 3NL3A 3DFPA 2GUUA 4AWTA 3VCRA 3G0SA 3RNDA 3C0JA 4CQAA 2J6XA 1TQXA 3VNDA 1F2JA 1KTBA 3DI1A 3QH2A 3BW4A 3S8HA 3LLFA 4KFNA 4JTGA 2FB2A 3TUUA 5HMSA 3C2FA 3BG5A 1WQ5A 1Q45A 5EA9A 1F6PA 2GVLA 1K03A 1XCFA 5GVJA 3NQ6A 3N34A 5TBOA 3NA8A 4JYEA 4X9SA 1F05A 2A0NA 2QDGA 3S9YA 1KM4A 5F1UA 1ZY9A 1EP3A 3H54A 3BO9A 1MO0A 5IBXC 5LZLA 5BOOA 1X1OA 5KITA 4IQLA 5FESA 2NX1A 1DL3A 1VLIA 2V5LA 4IUOA 2VENA 4IMEA 1TTIA 1OJXA 2Y7FA 4UC5A 1LORA 2H6RA 1YDOA 4DBDA 3KVJA 2DZWA 3LLDA 3STGA 3UWUA 3C2OA 3NQGA 4JS3A 2OZ0A 3TC7A 2EHHA 1FCBA 3M43A 3EX4A 4AMAA 3FIGA 1S5VA 4MY9A 3PG8A 3IIVA 3NR0A 3F4NA 3ZS4A 1H1YA 3EXSA 4ICNA 2OX1A 1EIXA 1QFEA 4RZ6A 1T0OA 5LNRA 3TSMA 1F5ZA 1I2QA 1W3IA 1ZAHA 1VLWA 2C19A 4UFMA 4YLWA 4D2JA 4JXCA 2VEIA 2ZZ1A 3M47A 5F2IA 2VEKA 3H55A 2E5BA 2NXIA 3U6WA 1A53A 3W1LA 3W74A 4ZQRA 1TRIA 3UWZA 3NQMA 1GT8A 2E09A 3I7RA 3E49A 1LRNA 4O11A 3UD6A 4EF9A 4ZZ9A 1OX4A 1JQXA 1VPXA 3P80A 4X2RA 3DBPA 4ORMA 3UWQA 1XUUA 3B0VC 3I65A 2ISVA 3F1QA 4TU1A 4IMCA 1DBTA 1VZWA 5I3IA 1K8YA 1O5KA 5KZDA 2FJKA 3KRUA 3TMLA 5F2LA 2VELA 1N55A 3LCHA 2V30A 4UTJA 5G2IA 2A7NA 4FEZA 4A21A 1SUXA 4CLMA 4R53A 1H7XA 4NJIA 3SW6A 3MYPA 4Y90A 5EL1A 2QCDA 5K9XA 4LWWA 1AL8A 2FIQA 2F7FA 1W37A 1K8XA 5AHEA 4R34A 3WJZA 3A5VA 2FDSA 4TMBA 4Q32A 3VFLA 1KFEA 4DBEA 4NJKA 2A6LA 1CX9A 2BX7A 1OX5A 4UTLA 1Z48A 1LOSA 2OCZA 1FCQA 1HO4A 3GVGA 3M5YA 4OU1A 3NYZA 4K37A 2G95A 2NWSA 3H53A 4EVZA 3TROA 2G96A 2CU0A 3CLMA 2R14A 4GUGA 3DKJA 3O6YX 5DCEA 3S6DA 3M5ZA 4OBTA 4XTDA 3QQ1A 4DF2A 1WA3A 5LNVA 4A29A 5K9CA 3EWWA 2HS8A 2OMAA 2ZRYA 4UR8A 4HIBA 1GZGA 3FFSA 3EX2A 4JY8A 3S1WA 2DU2A 4Y9AA 2E5CA 1T96A 1KFJA 2A7RA 3SIZA 3GNNA 3E0IA 2QAFA 1WAUA 4MZ8A 4NXSA 3P5YA 4XWUA 5CG7A 4WQ6A 1GYLA 3FS2A 1KM1A 3SI9A 3T4CA 3EWUA 3UXAA 1D3HA 3W1UA 2B7QA 3GXTA 4OV9A 1KLZA 2TSYA 3FA5A 4KFPA 4XTIA 2E6AA 4ORIA 3B06A 4XBKA 5DLCA 4GE8A 4UMCA 3W07A 3GKAA 4JTLA 4MOZA 3TSDA 4IPJA 1YPIA 3N73A 4UUIA 5CZSA 4QJ1A 5AHMA 4NZFA 2Y61A 3W1PA 3ABQA 4AH7A 1OYBA 4JD4A 2B4GA 4NJGA 4LS1A 3NQ2A 2RDWA 3FKRA 3LHUA 4IXXA 1WOAA 5K7JA 2QF7A 1HUVA 1W54A 4I9AA 4CCDA 5DY2A 3CB8A 2VFEA 1UASA 1SZEA 2W6RA 3G1FA 3EB2A 1K02A 5FF3A 4JTUA 3B0PA 4J9JA 4CCCA 2V0TA 1V5XA 1YDVA 4K36A 4YXGA 3GIYA 1HTIA 3L67A 2RDUA 1H51A 3L0KA 3B4UA 5D37A 2ZZ7A 5AN7A 2Z0IA 5D09A 3SFKA 1A5CA 5HJLA 3L5LA 2BLEA 5E0KA 1LZOA 3EWBX 1OG0A 4ZQPA 5HQEA 3B8DA 1KTNA 5FEZA 3O6CA 5EYWA 3L21A 4YL2A 2EGZA 5D04C 2VXNA 3SZ8A 1XXXA 8TIMA 4ALDA 2C18A 3C2VA 1VGAA 3NL2A 1KBIA 3QFEA 5G4WA 4YWIA 1L9WA 2X1RA 3L66A 2FPVA 4JTEA 1EWEA 3WK3A 3G8RA 3NQFA 3A21A 4BK9A 4HSNA 1ZAJA 4LY8A 2Y7EA 3GDMA 3PWAA 4L4LA 3CTLA 3CQ0A 1QAPA 3OIXA 2QCEA 2AQWA 1VYPX 5IM51 1ZAIA 2VFFA 3W70A 1ZENA 5KINA 1TPB1 2GPTA 1JCJA 3S42A 3EX3A 2VFIA 2J24A 1JR1A 3L9CA 1SW7A 1S5TA 5C2XA 1LOLA 1G4PA 2QJIA 3S5OA 4DXVA 2ZA1A 1OK6A 3HG5A 5BNKA 2YX0A 1J5TA 3UZ5A 4Z1CA 2W79A 3LXBA 4ZL1A 3W1AA 2CFFA 4UFLA 2CZFA 5TIMA 1W0MA 2A4AA 3O07A 3TKFA 3I7SA 3A23A 3BK0A 3TH6A 3LHZA 1JCNA 1ML1A 4LUIA 4N2YA 3W1MA 3MP4A 4E2DA 4ZMGA 3M0ZA 4ADSA 3W2NA 5CSRA 4UTWC 1LP6A 1W5NA 2H3DA 3N2XA 3NQEA 1O95A 1GJPA 2WNQA 4LS0A 3FLUA 4JY9A 3P82A 3MW7A 3UWWA 4FHAA 5HNRA 4O17A 1VC4A 2NUWA 3A24A 3B04A 1GVSA 3W85A 3R13A 3L65A 1M7PA 3M44A 1P0NA 1MEHA 4NNCA 3NDOA 2NV1A 4OHQA 4QISA 4JNMA 4M5PA 3DAQA 1SZFA 4MFEA 3GAKA 1ZFJA 3L5AA 4JYFA 2YW3A 4RKAA 1RV8A 2B0MA 1RD5A 3ZR4A 4QQ3A 1H62A 3P67A 3SSJA 2V9DA 1OYCA 4MKNA 4E2BA 5I3FA 4FNUA 3NL5A 3KAOA 3W7RA 3RK8A 4JTIA 4N6EA 4M19A 3PULA 3WJYA 4MLRA 3W7CA 3WJWA 2FPYA 3TU9A 3G1SA 2VFGA 3ABRA 1RQHA 1LTDA 5HULA 3S0CA 2CLKA 4AVFA 1DQWA 5FF7A 3E9AA 3M9YA 3OG3A 3P81A 1K7XA 3CC1A 3HG2A 3EXTA 4O1CA 4HPJA 5AYXA 4I7UA 4JR5A 3N9RA 1IF2A 3THQA 3UNDA 2CW6A 3QJAA 3P62A 3QRHA 4RCXA 1AL7A 5L6UA 4HKPA 1VH7A 4IMGA 3LOTA 1CI1A 4MUZA 1XUZA 3GDTA 3BW3A 4HSOA 4WXZA 3T55A 5D2VA 1YTKA 3I6RA 1LYXA 4O57A 2OJPA 1I8JA 3DHFA 4GFSA 4AHQA 1SFJA 3PM6A 3W1XA 3FYPA 1UUMA 1SR9A 2B7OA 3BGJA 3QW3A 1YYAA 5AHNA 3EWYA 5D32A 1XL9A 4O14A 4IPIA 3KOFA 1XBXA 4RZ5A 1VJIA 1TV8A 3P61A 1FWRA 3EX6A 3HGJA 3NG3A 3JRKA 2O7QA 1KV8A 1JUBA 3V1PA 1EP1A 2ZZ2A 1LRQA 5FI8A 3PAJA 5EMUA 5LHFA 5KSWA 1FCUA 3UXDA 1EA0A 1VYRA 2ZDRA 1QCWA 1KW1A 3MHGA 1P1XA 1FWTA 1DOSA 2WQPA 1GVQA 2J9ZA 3W6YA 4WX2A 3CU2A 3M5VA 1PIIA 2Q8ZA 3NM3A 3SY5A 3TIMA 1FWNA 3TJLA 1ADOA 2IQTA 3ABOA 4O19A 2E6YA 4AHPA 2Z6JA 4HN4A 5K4XA 1G6CA 2E6DA 4ZQOA 3C4UA 3PBUA 1KFKA 3IIZA 4RLIA 4M6PA 3G1XA 5D2YA 3PUEA 4LRTA 3USBA 3M6YA 3YPIA 3OHIA 3NPVA 4XUGA 3NVTA 3GKFA 1BKSA 1AG1O 1YDNA 3NXFA 4UFIA 4CNOA 3QMRA 5T26A 1LDCA 4UTHA 4XKYA 2JBMA 2JK2A 2Y88A 2BTMA 1GOXA 2E77A 1Q6OA 3EKZA 2TMDA 1QPQA 3ATYA 3NL6A 1H1ZA 1AW1A 1TPVA 1H63A 3P8IA 3PBVA 1YLVA 1OFRA 4Y8FA 2G5WA 1AW2A 2YFOA 4M6VA 1IGSA 1D9EA 1YXYA 2YYTA 4Z0JA 4UFKA 3HOJA 4UTTC 4EF8A 2V5BA 3L0NA 4RJEA 4ZQNA 5H91A 3W22A 2GQ8A 3LHYA 4JDYA 3W71A 4IGHA 4UIOA 1Y0EA 5CPNA 3FEMA 1EUAA 3OVRA 3W7JA 2G97A 1GYNA 1QOPA 3A5FA 3E12A 4O50A 3LI1A 1I2NA 4HPXA 1I4NA 3KXQA 2X2GA 3QMTA 2GOUA 1FUYA 3BW2A 4B5NA 1FDJA 2C0AA 4JX5A 2XFWA 2XN0A 3GNDA 1SO4A 1TPH1 3GLCA 2CZEA 3MI3A 4HNTA 5DBUA 3RMJA 3CIWA 4N9CA 1OFOA 4N6FA 2JKPA 2RDTA 4K39A 1O60A 3SGZA 4WY0B 4PODA 5D33A 2DZUA 1OK4A 2NUYA 1PCKA 4HNVA 5AHIA 3FYOA 1FDYA 3TSBA 2D73A 1F7BA 1VS1A 2A6NA 4JTTA 4DEFA 3QW4B 2Q8LA 4POCA 1PVNA 3Q58A 3ZWSA 5KZEA 1XDLA 1I2OA 4JGDA 3W1RA 1KM0A 2YPIA 7TIMA 1L6SA 2WPBA 4FF7A 4E38A 1W56A 4ADUA 3NQ8A 3INPA 3HG3A 3MMTA 2R91A 4UR7A 3W7QA 4MJMA 4AXKA 1SO3A 1OFPA 3R2GA 1GG0A 3N3MA 4OT7A 4R33A 1R2RA 3N19B 1LBLA 3IVUA 3JS3A 1SU5A 1FXQA 4K8HA 2BZNA 3HQ1A 3O06A 2DZPA 1TJRA 2GVGA 3TMQA 2PRLA 3PF3A 3LB0A 2DZXA 1KTCA 3KVMA 4NQ1A 4OV4A 2H90A 3GR8A 4NX0A 2Z2UA 3PSWA 3HPSA 3HMJG 3CM4A 4O52A 3C61A 3DKLA 3NPWA 2GJNA 4DO6A 3GDKA 3P60A 3UY8A 5CPOA 4NZJA 3W23A 1F76A 3NAVA 1VYSX 2ZFAA 3AO0A 4ZVJA 1KBJA 2WO5A 4DELA 3ATZA 1W1ZA 4S1FA 4O12A 4LC6A 1TTPA 4OE7A 1H61A 1SPQA 1LROA 1VCGA 3TFCA 1HL2A 1CW2A 1D3GA 4O1BA 1UB3A 1B4KA 3LM7A 3B05A 1U5JA 1ME7A 3RF9A 3FJLA 3EWZA 5LGXA 3LCXA 2WSYA 4UCGA 3C3NA 3MBFA 4PC8A 5K4ZA 1OVDA 1IXPA 4O10A 3MBDA 3PSVA 1F73A 1M6JA 1R47A 1SO6A 3G0XA 2ZZ3A 1LLWA 2YYUA 4MZYA 3LRKA 4N9BA 5IBXA 1QPOA 3N14A 2PRHA 1OFEA 1TPEA 5LNWA 1ONRA 4JTJA 1ZHAA 3KHJA 1G7VA 5C6MA 1P4CA 5CSSA 4K6AA 3G1DA 3W9ZA 3W76A 3BG9A 3VKJA 4MYXA 4AF0A 4BF9A 3WJSA 1KA9F 2GQ9A 5G4EA 4UNLA 4IMDA 2ISSA 3ELFA 3THAA 1OX4B 1KLYA 3W2MA 2ZZ4A 2I9EA 3G18A 2P1FA 2C16A 1QNVA 1KFLA 1C29A 4NJJA 2FFCA 3IEBA 4MIMA 2Q3RA 1WDWA 4U4MA 2LLEA 4BI7A 1DV7A 1SZGA 4Z08A 2CZDA 1W5QA 5CZJA 4FIRA 3G1YA 2PE4A 2YR1A 4FXRA 4IOTA 5I3KA 1GG1A 4Y6GA 2QCHA 2Z6IA 4LW7A 2QCDB 3TXVA 4N9EA 1MZHA 3T7VA 3W7PA 3S5YA 1WBHA 4LV9A 3GXNA 4CNPA 3LBCA 4RK8A 1B57A 4Z1AA 3W7NA 1ICQA 1JRBA 2Y89A 2QCGA 2QCMA 3W2LA 3LX9A 5FEPA 4KKXA 3NPUA 3AJXA 4NX5A 1DVJA 3IGUA 2QR6A 3QC3A 2E68A 4L4MA 3G0UA 3MP3A 4ZQCA 5F4SA 3W72A 5LHEA 1LBFA 1UCWA 3G1HA 4HT3A 5CZ0A 2ZRVA 3C2RA 1AW5A 1WYIA 4FXSA 2NWRA 1X8FA 1TIMA 2ZA3A 5K9DA 2DORA 5AHLA 3F03K 4CQ9A 5J5RA 3PBYA 4JICA 5HWMA 1QO2A 2JGYA 1G4EA 2VEPA 3Q94A 4O8RA 4O16A 3NO5A 2X1TA 3VE7A 3M1ZA 2VFDA 1UBSA 4LVFA 3KRZA 4DF0A 1G4TA 5F4WA 5BMXA 2E6FA 5G5IA 4OQVA 5HINA 5LGZA 4M6QA 1GTHA 4O28A 2TPSA 4QIUA 4XQ6A 1TQJA 3LHWA 2NZLA 4I7VA 1U83A 2A7PA 3C2EA 4G1KA 4O13A 2RFGA 1K3UA 1ZJIA 1R2SA 1GVFA 1RQEA 3G1VA 3VE9A 5E93A 2Y6ZA 2KZHA 2AAMA 4O0KA 4AWUA 4LOCA 5FF2A 4Z1BA 1XBZA 3B0UX 1LRTA 3TA6A 1KM2A 4O0ZA 2C6QA 1TPWA 5LNSA 4O54A 3RFAA 4WJEA 5D05A 1WV2A 4K7YA 2DP3A 1FXPA 2WSRA 4AB4A 2Z1BA
chains in the Genus database with same CATH superfamily
4RDYA 2QIWA 2X1UA 4PRRA 3FVMA 1UR2A 3GFZA 3NZ1A 3WMCA 4FI4A 3TAKA 4U5IA 1OINA 1QHOA 1NOWA 4MDOA 3AC0A 3W29A 3FJNA 1W31A 4C7GA 4WZHA 3WLQA 1M3UA 2Y7DA 2XUCA 1TMHA 3ZMRA 4HA1A 4X22A 4QEEA 3ZVHA 1FA2A 4PL1A 4GQQA 1KM5A 5JIWA 2ABBA 3O6DA 4EOUA 2DUXA 1E6ZA 4HMEA 4FZIA 1Z42A 1MXGA 1VFLA 4OZOA 3IUHA 4CQBA 3U4AA 2WMIB 3V0UA 3TC6A 2Q3OA 3IK2A 3U2CA 4M3PA 3T05A 2GWNA 4A3HA 2REQB 2ISWA 1A3HA 1M7XA 2RH9A 1BPLB 1IYXA 3ZZ1A 1R3RA 3P7YA 4XSLA 4QSHA 4H19A 2CLIA 1XPGA 4UMBA 4LU0A 1RCQA 3GXPA 2VP8A 3PPFA 4BI5A 4QDWA 5KTLA 4KEMA 1MXSA 3WLJA 1HG3A 3MYOA 4HSHA 1KXVA 1Q7QA 1QO5A 5C55A 3VDAA 4NP7A 4JTQA 1GHRA 1XSJA 3CB3A 3KOXA 2V81A 3K4WA 5HNUA 2SFPA 5GJMA 1S5WA 1CTNA 4UQCA 3UESA 1BD0A 3WL1A 5EMLA 1BQGA 2ZUNA 1YXCA 3BGAA 1NEYA 3TE9A 4X9YA 4F9JA 1JULA 3OQEA 3CO4A 1NP0A 1DJIA 1IWPA 4YNGA 3NQDA 1V51A 1ALDA 3N6JA 1QUMA 4PN2A 3BLFA 5JH1A 1KD0A 1R38A 1PX8A 4GUHA 5D8ZA 3LERA 5HJXA 1E6SM 3M41A 2C0HA 3W81A 4Y2WA 3MUCA 4MNKA 1UQZA 1EF2A 2DVXA 1XG4A 1CGTA 2X30A 4CKQA 1NF7A 1NVMA 4W8AA 2QMJA 4DJDC 4FR1A 1XGZA 2VOMA 3BCDA 1EQCA 3CHCA 2FPTA 5AYYA 3LGEA 4IH3A 3LV6A 2XHYA 1XGDA 1OCBA 3AXKA 4FLSA 3WQ4A 4AEFA 3THDA 1I2PA 3MJYA 1REQA 3H21A 4R7JA 4Q8TA 1JRCA 1R6WA 4GXPA 2F84A 5FAGA 2DUZA 3TR9A 4CUCA 3GK0A 1NSJA 1R0MA 3LTSA 5CAKA 4Q4QA 1EP2A 2X1IA 4R7OA 2QUVA 4NVTA 4ZGYA 3HIJA 3RXZA 1KXHA 2YXXA 2WNNA 1AZ1A 1VBHA 2DDXA 3CMJA 2X05A 3MSDA 1O68A 3UPBA 1QHPA 5H1WA 1P6BA 1FRBA 4TX8A 3CBWA 4PRWA 1R3TA 1WXYA 1XLFA 3P14A 4KWOA 4K7VA 4PULA 4BEQA 2YDSA 3APTA 4XB3A 5F2GA 4QS6A 4E3TA 4GRSA 1QASA 4W4QA 3MANA 1OT1A 1DJNA 3OYXA 3LPOA 1UR4A 4WOQA 2Q6ZA 4G7FA 3CMFA 2PA6A 1LQ2A 1E51A 4CNUA 3GXIA 5BWFA 2J47A 4NAEA 1A80A 4C5ZA 2BXVA 1SFTA 2E1DA 2E25A 4KEVA 1EUNA 5HANA 3MKKA 4FNQA 2CBUA 1DIEA 1F07A 1NAL1 3MPGA 4U28A 3DG7A 4UOZA 1B5TA 2VGFA 2NSOA 2PUZA 3CWOX 3S2LA 4UTKA 1H60A 3NNTA 1D8CA 3HURA 1PHWA 4HMNA 2VX4A 1LWHA 1UUQA 2QLYA 4H9TA 4WCJA 3H2NA 4L7ZA 3KW3A 1E55A 5HMDA 4TIMA 1D7FA 1GQNA 3GNOA 2XSXA 1JDFA 4P7LA 1FWFC 3VDHA 1QPNA 1QWKA 2OFJA 2E8ZA 2AKZA 3FA4A 1A5AA 1CXKA 2HE5A 1XC4A 3QMSA 3U57A 1A49A 4UCFA 1J11A 2EPHA 4NNBA 4LS2A 3DFOA 1F4HA 3NGJA 4Q8NA 1W1TA 4BCEA 1W3JA 4MUPA 3QV9A 4WGXA 3V7PA 3CV1A 3E6EA 1IIHA 2WKGA 3CHVA 4DN1A 3N18A 1W5MA 2Y70A 6ALDA 3EX1A 4ZEPA 1LBMA 2YIHA 3QSTA 3WK1A 1ME8A 3SUTA 4TTGA 2V2HA 2X09A 3A4XA 4D9PA 4DJEC 3VDCA 1LG2A 2R1PA 1ZSXA 3SCVA 3RU6A 3A9IA 1GKPA 1FP9A 4REQB 3STFA 2YL9A 4YTQA 3JUGA 2C14A 4LALA 7PTDA 3CO8A 3IV3A 2QAPA 3GSMA 1H5YA 3TQVA 2Y4SA 3VOJA 4JKLA 1TUFA 4TXEA 1UIOA 4YMZA 5CBJA 2ZRXA 1OFQA 3LBOA 1XYAA 3SN1A 2FTPA 4DO4A 3E2VA 4RV3A 3SB0A 3OU8A 2H3BA 3WX7A 3GVVA 3T0CA 2ZZ5A 3WDPP 3BL3A 3KWXA 4NG3A 4RPQA 4YCPA 2YFNA 1S2CA 3WEOA 4FA3A 4WIWA 4DNHA 4MWAB 2J8TA 1S46A 3W38A 3GC4A 1HVXA 3N11A 1N8WA 3HB9A 4B9YA 1ISXA 2ATMA 2FB3A 4DAIA 1OQFA 1C3FA 2PLJA 3ZJ7A 2P0OA 5BXPA 1HNYA 4S3FA 4GIYA 5E9XA 1ZRQA 3U8GA 3S5NA 2DSWA 3EWXA 2EXOA 3WF4A 1PXGA 5DN1A 3HV8A 5M03A 3BAIA 4GY0A 4AZGA 5C9UA 5EMKA 3KFTA 3HO8A 5DMNA 1JEZA 1KXQA 5G1TA 1GUVA 3B0YA 3IAQA 1XPYA 4UMAA 1JCXA 4ZCWA 4PUMA 1UUOA 2H8ZA 4GXMA 2QNEA 1O5QA 2WHKA 1YTDA 5EB8A 2XVPA 2ACSA 5C7HA 1BXNA 3Q65A 3QPYA 1W17A 1FDZA 1JG9A 1SZNA 4H6KA 3Q67A 1TO3A 2CLLA 1V4YA 4LTSA 3AAMA 1RH9A 2PWDA 3GUGA 4IGSA 1KC7A 3KS5A 5CJMA 2PWGA 4BFAA 4IGNA 1QI4A 3GE7A 3A13A 4IICA 1WUFA 5A6LA 2QJJA 3PJTA 1EX5A 2GJLA 4GC4A 2CERA 3ICJA 2MANA 4WY0F 3RLVA 3T0AA 1JYXA 4MWAD 1CGVA 4KETA 1PX4A 1VFHA 2WCGA 3OJGA 5EMJA 2HROA 3W1NA 1XYBA 5T8GA 4YHEA 4HOWA 2DV0A 4QNWA 3LPPA 2VHLA 2HBXA 4GUJA 1JPIA 3MQTA 2Z7GA 5FJRA 3O7UA 4DX3A 4GA8A 4OGZA 5IHSA 3H7VA 1AJ0A 4HJFA 3MSRA 1DHPA 1MRAA 3TW6A 1UC5A 2JE8A 4FLRA 2Y8VA 3BANA 1LCOA 3ZLHA 1CBGA 1RJPA 4FP1A 4ICCX 5G1MA 3ZT5A 4NUWA 3RDKA 1DKWA 4PUJA 4E4UA 1DIOA 4XD4A 5XIAA 4IX0A 6REQB 2DZSA 3HGSA 4PTXA 1FWHC 3WMBA 5ABFA 3DZ1A 3I68A 5DELA 3WDRA 1NWSA 2QYGA 2GSEA 4DZIA 3SJ3A 1UKOA 3KDNA 4KT2A 4I8YA 1FHUA 3VM7A 4FF5A 2O9TA 4PL2A 2OQLA 4H9MA 5BW6A 5BXSA 5HPOA 3LCFA 2VT0A 4ACZB 3XISA 3QF0A 3VINA 3WELA 4IFKB 3TW9A 3F4CA 1FTXA 4HCLA 3SIMA 4A6GA 4HHPA 3QPZA 4TTUA 4JIPA 3AHXA 5KMYA 2DQXA 3PB0A 1JYWA 4PB3A 2I57A 3LTYA 2G50A 5I7GA 4QAIA 1RD6A 1ELSA 1GZJA 4L64A 1PSCA 1OG6A 4O1AA 5AC8A 4WHBA 3W7OA 5FL1A 4WUIA 4IP4A 2OT0A 1PKNA 1TZ9A 4GI9A 1LT8A 4KESA 4Z2KA 4YU1A 1XX1A 4RNFA 2YDQA 4US6A 4JIEA 1XHGA 1O4UA 2W4XA 3DFTA 4NILA 2NLIA 2PGRA 4QBXA 1XKYA 1Q6RA 3VGEA 4U33A 4DJFC 6ENLA 2PTXA 4FOJA 4JTSA 4PBGA 3L23A 2ZXDA 4F0RA 1PL9A 3RMEA 3S1UA 3RLUA 3DG6A 4JYDA 2PLMA 1ITQA 2VGBA 1TVNA 4HMCA 2ZYFA 4K2SA 4ADTA 1PCWA 3EXRA 3GHUA 3WUGA 5B7YA 2P5NA 1XJBA 5E6YA 3EA2A 1CLXA 4GJ1A 3QR0A 3ES8A 5BRBA 5BU9A 4GBUA 3H6OA 3VMOA 4LUTA 1UWIA 1GKQA 2O55A 3PZNA 3VIOA 3DXIA 2E4TA 2VZOA 1H7OA 3D3FA 3AHZA 2ZXQA 2I5IA 5AC7A 1VF8A 3BG3A 3GH5A 2RJHA 3K8LA 3MHFA 4J3UA 1WX0A 2XM2A 3TYAA 3DFPA 5I78A 4H7CA 3DYPA 3C0JA 3RX3A 1F2JA 1KTBA 3DI1A 3B40A 3TTSA 4JCLA 1DYSA 3H4XA 1OBAA 4PGLA 2JIWA 4H01A 2FB2A 3LD5A 1W3KA 1EC9A 4PUKA 1XH0A 4PYSA 4MAVA 3WKZA 4HMDA 1VFSA 3KCOA 4MPKA 3EDJA 4X9SA 1OC7A 2A0NA 2BBFA 2QDGA 1XLMA 4Q4RA 1KM4A 5F1UA 1ZY9A 3HA1A 1EP3A 2QT3A 3H54A 2F8QA 3DECA 3H23A 4AMCA 1DWHM 3FXYA 1FHLA 4W84A 2H6RA 1YDOA 3KVJA 3ARQA 3A3WA 3OQ8A 3NQGA 4AZCA 3KL3A 4LEQA 4J2PA 1HL8A 1UR9A 1IT8A 4CD4A 2PWUA 4OBSA 3EX4A 2F9RA 3URAA 1S5VA 1WKDA 5CQ1A 3F4NA 1HVQA 3DEQA 2O92A 1EIXA 2VZUA 2G4JA 1UW9A 2FVLA 4IM4A 2PD9A 1R85A 4GABA 1NU5A 2QS8A 5F2IA 3L4VA 5A2AA 1E9YB 1A53A 3K4AA 3VZZA 2BP1A 3UWZA 3L4XA 1GT8A 3WQVA 4IF2A 3E49A 4O11A 3N04A 3AXMA 3DBPA 1XLGA 4ORMA 1L6FA 3PBMA 3I65A 3F1QA 1JXJA 1QW9A 4QCEA 1Y5WA 4TU1A 4IMCA 1DBTA 3VGHA 2QV5A 1K8YA 4JKKA 2FJKA 2Y1HA 1IEWA 2VELA 1Q6EA 2FVKA 2ONEA 1US3A 4PCSA 1P0EA 3LCHA 4NI3A 3H2MA 1PZ0A 1RLDA 2A7NA 4FEZA 1YX1A 4CLMA 4F2BA 4OBRA 4R53A 5I09A 1H7XA 3SW6A 4Y90A 4DVOA 1ZU8A 4BZYA 5AHEA 4R34A 3ES7A 1NWTA 2DW6A 3DC8A 1ISWA 1KFEA 4NJKA 2A6LA 3WNMA 4PUEA 1Z48A 3LM3A 2OCZA 5CC7A 1FCQA 1S39A 3GVGA 3ZXWA 1HQTA 2Z26A 1M65A 3SGGA 3FYYA 2Y24A 2YXOA 2IXVA 4FPSA 2GVYA 1J10A 2CC0A 3H53A 1CPUA 1E3ZA 2IKHA 1XINA 4XK2A 2R14A 3N3TA 3T0DA 3M5ZA 4OBTA 4XTDA 4A29A 5IRPA 3EWWA 4AIOA 2OMAA 2XH4A 4PUWA 2QDDA 2HNEA 3CUJA 3FFSA 4H6RA 3S1WA 2DU2A 1MWOA 2E5CA 3GNNA 3SRFA 4MZ8A 4XWUA 3SJNA 3B97A 3UG8A 1H3GA 1KM1A 3EMCA 4A8RA 4JTRA 3W1UA 2I7GA 3MV01 3IS4A 1KLZA 2TSYA 4KFPA 2DT0A 1R9ZA 5T9BG 4ECLA 1X7IA 4QE5A 5DLCA 4D8ZA 1OC6A 3GO2A 1UD4A 3MV11 3TSDA 3AU2A 3T2QA 2D3NA 3N73A 5CZSA 5DO8A 4NZFA 2Y61A 3ABQA 1JD9A 1B3ZA 4AH7A 2B4GA 3NQ2A 4QLKA 1GK8A 2J13A 3UU0A 4IIEA 4CCDA 1XLDA 4Z2HA 4Q6JA 3DIPA 2W5FA 2W6RA 3G1FA 1W9VA 1RCXB 2Z1XA 3SADA 1ADDA 4B3KA 2V0TA 1TE6A 1YDVA 4YXGA 1HTIA 1DWFM 1JL8A 3CV2A 1H51A 3B4UA 3IACA 2ZZ7A 3ZJKA 3SFKA 5HJLA 4ES4A 2BLEA 3VKKA 2YL6A 1RCOB 2HDJA 5EYWA 4QE1A 4YL2A 5BU6A 4HU3A 3SZ8A 3WEMA 4ALDA 4ATDA 5GQBA 2KX9A 3QFEA 4E8GA 2X1RA 3L66A 2FPVA 3EGJA 3AZRA 1XRSA 4Q7NA 2VOTA 4IIDA 3OIXA 2WWDA 3NDYA 3TNBA 3IJ6A 1VYPX 1ZAIA 4JZ5A 5KINA 3SBFA 1KQYA 2X40A 5D9OA 3EX3A 2VFIA 7A3HA 4LAUA 3PUGA 5JBDA 1XDJA 3AICA 3SQLA 1E72M 4Z1CA 2WNWA 3RM9A 3W1AA 2CFFA 4M1RA 2XSBA 4FSAA 2V5CA 1EO5A 1W0MA 2IMRA 4BQ5A 3TKFA 3PPCA 2EPMX 1S5MA 4J28A 2F2HA 1CEOA 1JCNA 5CSUA 1KRCC 4N2YA 1HP4A 4ZFMA 1EEXA 2GGGA 3W2NA 4GKLA 2GDVA 3DUGA 2GGIA 2H3DA 1W5NA 2QUMA 2WNQA 4LS0A 2GGHA 3GG8A 1DIKA 4GJIA 3QY6A 3MW7A 2VI0A 1MQRA 4QG9A 1A5MC 3PJWA 3UR2A 4L1GA 1VC4A 1GVSA 1ZPTA 2FMNA 1UKPA 5EMMA 1P0NA 4QISA 1OWQA 4JNMA 3QTGA 2OTDA 1SZFA 3FAXA 2B81A 1JNDA 1GQIA 3WG6A 3WD2A 3GM8A 1KNWA 2B0MA 3S1GA 3P67A 3SSJA 2V9DA 4CD7A 1JYNA 4E2BA 3NL5A 2J8GA 4Q8UA 1YHTA 3PULA 4XO6A 4ZR8A 1TE1A 3W7CA 1QATA 2FPYA 3EZ4A 5M2FX 3HMCA 3WQPA 1LTDA 4XZMX 4AVFA 3VGFA 2FJUB 4GXWA 3HG2A 5EFFA 1A4MA 5AYXA 4GI4A 2E40A 4JR5A 3N9RA 4XX6A 2WJDA 2VWTA 5H8MA 3AS0A 1CNVA 1X1NA 2BG5A 1RVKA 5A2BA 1BG4A 2PGWA 1X8CA 4HN8A 1XUZA 3GDTA 1JPHA 2EPNA 2QULA 4WXZA 3T55A 3I6RA 2Z1WA 4GFSA 3T6CA 1HKVA 4AHQA 4JTDA 3W1XA 3MVTA 1SR9A 1TZ7A 1TJ2A 3QW3A 1EGVA 1YYAA 5D32A 3D46A 2BVTA 1CLKA 4LUSA 3KOFA 4KRUA 3IJ9A 2OYMA 4H8HA 4Q8MA 1KV8A 3LNMA 2XH2A 1VIZA 1LRQA 5FI8A 5EMUA 1PAMA 9CGTA 2ZDRA 2Y0FA 3WH5A 1KW1A 3MHGA 4ZBCA 4J3XA 1DOSA 6CGTA 1WAWA 5CBBA 3CU2A 3ARRA 3CUIA 1QPKA 2W63A 4GNKB 3T42A 2G3JA 4LPCA 1ONXA 4ZXLA 3AIBA 2ZC8A 1IGWA 4HN4A 2E6DA 5K4XA 1LUCB 4RLIA 1MZRA 3P93A 4MJ4A 1XIBA 1VFMA 4LH8A 1OGSA 1R3VA 3PUEA 5AYIA 4S3GA 3USBA 3OHIA 2QIIA 1M41A 4G6CA 4MWAC 2GDUA 4KEZA 3NXFA 2PTDA 1HKJA 3LN3A 4UFIA 1XIMA 3QMRA 4US5A 5T26A 4W93A 4F4RA 1AJZA 1Q7ZA 4XKYA 2Y88A 2JF6A 2BTMA 2XGZA 2O0TA 1Q6OA 5REQA 4QEHA 4JQ2A 1S38A 2OB3A 1A5UA 1H63A 2Q09A 1NDWA 1ECEA 2G5WA 1AW2A 3H2OA 5M17A 3GS6A 3FX4A 2IPJA 4V15A 5FA5A 2FZNA 3AMGA 2ZE3A 5CJNA 4EF8A 3MDWA 3NDZA 2GQ8A 1TUXA 3WNNA 1EUAA 3USZA 3OVRA 1KKRA 3M0HA 3NSMA 1QOPA 4GLEA 3MMUA 4AX6A 2C0AA 2CESA 4Q8WA 2CZEA 3RCNA 1FFRA 4JBRA 4HNTA 4LF2A 1OFOA 4N6FA 1DEDA 5LIXX 3SCQA 4K39A 2ISFA 5D33A 2XFRA 1FDYA 5A6BD 4DJFA 3OLEA 2A6NA 1YBQB 4S3JA 1EHNA 2F6UA 1PVNA 1PB0A 1KCXA 2OGJA 1J12A 3N9KA 4XUYA 7TIMA 3DFYA 2HRWA 1XIDA 2OYKA 2YCKX 1AD1A 3V0TA 1WDPA 1W2VA 1GG0A 4Q7IA 3N3MA 1XLBA 4RDZA 1P0DA 1VFTA 4J3WA 4HZMA 3FGCB 1FXQA 4K8HA 4OUIA 1YQ2A 1Q5MA 2DZPA 3VIHA 1TJRA 2GVGA 3GXMA 4NQ1A 3GR8A 2J8FA 1HKKA 4NX0A 2J79A 3PSWA 2YCLA 1HW6A 1GVYA 3HPSA 5ABHA 3HMJG 2E67A 2OEKA 3NZPA 1NJJA 3K8MA 3C8NA 3P60A 2NQZA 1E73M 1JNEA 3VOCA 1KBJA 1BGGA 4BJHA 3VDBA 4XD3A 5CC3A 4S1FA 4O12A 3BAWA 1TTPA 4OE7A 3FN9A 2A3CA 3P0XA 4JEJA 3RF9A 3FJLA 3BZJA 4CNTA 4UCGA 1UD6A 4PC8A 1NY1A 4O10A 1HJUA 1M6JA 1SO6A 4L6DA 3TJ4A 3CYVA 1LLWA 3LRKA 1G0CA 2BHYA 1ISYA 2HNHA 1C92A 1R9XA 4GY1A 3T0BA 3ZIZA 2Z7KA 3KHJA 4WR3A 3PZOA 3S2JA 2YBVA 4HVXA 1EJUC 4PUDA 3QLDA 4H9VA 4CD8A 2FTYA 1JGMA 2WLZA 5H8UA 3WQOA 5CC6A 3T08A 1XRVA 4MHBA 3A3XA 1CENA 5HK4A 1UP0A 2P1FA 4QX4A 4K1GA 3L4WA 3IEBA 2XPKA 4MIMA 3FDGA 1ZGDA 4L56A 4BI7A 2AKMA 1YDYA 1SZGA 1Y65A 3RJYA 3UP8A 3GDBA 1V0KA 3PN8A 4EK7A 2G41A 3FK4A 5FJPA 4AD0A 2PE4A 1E0VA 2C8NA 2QCHA 5B80A 3AWOA 2QCDB 1LJYA 4HYRA 1MZHA 3T7VA 3W7PA 3S5YA 4J3ZA 1ZP3A 3KBVA 3R79A 3GXNA 4J3TA 4GG9A 2PGFA 2PWFA 2DZBA 1EOMA 4AQLA 4HHLA 1AQHA 1TWDA 2QCGA 2DZAA 3KOYA 2BODX 1CB2A 2QR6A 3MP3A 2PB1A 5LHEA 4NYUA 1A4LA 1UCWA 2INZA 1XW8A 1QNSA 4TOQA 4MNJA 1ISVA 3ABZA 4E4PA 3ALGA 4CQ9A 1CLVA 3PBYA 2E0PA 4XO7A 3CQKA 3NURA 2JGYA 4O8RA 3Q94A 3VZYA 3SURA 2VFDA 1QBBA 4DF0A 3RILA 1G4TA 5F4WA 4TUFA 2XIJA 2PBOA 4OQVA 5HINA 3OLDA 4O28A 1KCZA 1CDGA 1TQJA 3LHWA 2NZLA 2PDHA 3AUJA 4I7VA 1U83A 2RFGA 1K3UA 1EHAA 1EFZA 3VE9A 2NT0A 3MMDA 5E93A 2Y6ZA 2AAMA 4OOUA 4C6PA 1OCJA 3AHYA 3B0UX 1DXFA 4F0SA 5LYRA 4M80A 1F6YA 1KM2A 4O0ZA 2XZ9A 4O54A 5PTDA 4WJEA 1GORA 1DJGA 4MKSA 5GJNA 3BLLA 4HU0A 1FXPA 1A5LC 2HS6A 4EACA 1K7FA 4A2RA 3HG4A 4JQ3A 1Q2SA 3ARSA 5CLWA 4XZLX 5CGMA 2VC6A 4XZIA 2XWDA 1AD4A 3PR2A 3ARYA 4GI6A 3O1NA 3LI0A 3K13A 4LNCA 1OD0A 4WDTA 4JEQA 3UXIA 5C9WA 5A69A 4J35A 4XBSA 3UZXA 4L9XA 4DUOA 2YXGA 4QITA 1JCTA 3UR8A 4WDXA 3MZ2A 3RRAA 4HD5A 3OA5A 1I45A 4L9YA 2X2YA 4H2CA 2WWCA 3MCMA 1UA3A 1EJVC 3G1RA 1ZNNA 3TTEA 4DLFA 5A95A 2AL2B 3BPWA 2WM0A 3P6LA 1F74A 4LVDA 4QM1A 2YA0A 2FZBA 4MYAA 4PMUA 1EZWA 3SY1A 1EJSC 1S2WA 4AY8A 3VD4A 4PA8A 4QR6A 3AUOA 3KVLA 3ZO9A 5BOEA 4GC3A 4B2DD 1K1DA 1MW3A 5A3HA 2GFTA 3AYSA 4HPHA 4YWSA 4S3EA 3OG2A 3KX6A 1Q6GA 4MAZA 5FD0A 4GVIA 1TV5A 5LSMA 4LYKA 3CUGA 3FKKA 4AYSA 3GHTA 4AYGA 2EQDA 3M0MA 5F4XA 4MY1A 3MWAA 3OVPA 4IPPA 4DXKA 4FB7A 3MI6A 4FNTA 3NQVA 4NZCA 4XAPA 3BJFA 2CETA 3VOFA 3AFBA 4IXHA 3PB2A 4GYKA 4G7EB 4ZOCA 3KS6A 1H0GA 4WK9A 2E3ZA 3B9EA 3PHAA 4AWEA 3ARUA 3ZLGA 3HFYA 4QNEA 4P7RA 1Q8JA 3NM1A 2FGZA 5DMMA 4KCTA 4L9ZA 2ZTJA 5GJPA 4BQ3A 2G3NA 1D2KA 1H5VA 4CD5A 4S3BA 2JIEA 1IHIA 1SSDA 3N25A 4J27A 1YXDA 2PP3A 3L2LA 4WOZA 3IANA 4H3DA 1B0IA 3E0LA 3ZJ8A 1PPIA 3A6OA 1JDCA 2A1YA 2WV8A 4HA3A 3RJXA 3VX1A 1KM3A 4QCFA 1V6XA 2BSLA 3COTA 1YPXA 6TIMA 5FIPA 2DIKA 5EY5A 1J4EA 4FS9A 1WDSA 2QKFA 1O94A 1ZCCA 1EDGA 2ZUUA 3BSMA 4K38A 3ARZA 4CVWA 4DI9A 1UD8A 5DBTA 1KFBA 3P2VA 4HP5A 3KP1A 4LJ3A 3GZAA 4C6OA 1QRQA 3IUIA 4GQ0A 3PY2A 3WUBA 2FLIA 1DJXA 3KOZA 3QQ0A 5F1VA 3I4KA 1HL9A 1UA7A 4HHHA 4OIFA 3WLNA 2FQIA 1V3JA 4XZHA 3SUWA 3E5PA 4KQNA 1XH2A 1LQ0A 3RPMA 4V28A 3RRXA 3QLLA 4RXFA 4PFMA 3W83A 2OWXA 3VX0A 4QDPA 9XIAA 4Y9PA 4ZO9A 3CEUA 1IZKA 4EIVA 2OZ8A 1RZMA 4AY7A 3OBAA 4LSBA 2CLFA 3ZVIA 1E4LA 1YADA 1BLIA 3ITYA 3TQ0A 4AD5A 3VKCA 2QJGA 3W24A 3QZ6A 1XSIA 1VIWA 2J9YA 1CYGA 3WBXA 1E6XM 4DRSA 2YCEA 1XLCA 3QZEA 4NXKA 2R6OA 3GHRA 3MY9A 1G1YA 1JDDA 1RALA 5CGTA 3DI0A 1L8NA 2CYGA 3NVDA 1SJBA 2V3FA 3CQJA 1VBUA 2B7PA 4OWGA 3HGRA 4KCWA 4YHGA 4MLJA 2RJGA 3APYA 3RG6A 2RHGA 1T8QA 1F3TA 3EWDA 3C2YA 3MO4A 4NIRA 5FJIA 4JQ4A 1OHLA 1CGWA 4DO5A 4UTMA 4UQ9A 3EOEA 1GJWA 2VCBA 2FHBA 4FR6A 4BWLC 3GYEA 3S4TA 1FCVA 4ROPA 1BHGA 1R46A 4NJHA 4CD6A 2PRMA 3EEGA 5CBIA 1A5NC 4RZ4A 4LNYA 2EG7A 3RLHA 3APGA 3GR7A 1I1XA 1KWKA 1XGEA 1IQ8A 2V6AA 3PZGA 4WD0A 3BV4A 5C8BB 1JQVA 1VAHA 3MUIA 2QUUA 5E5CA 1E6PA 3F4VA 3LTPA 1G7UA 1EIBA 3AIEA 2CCRA 2GSJA 3IV8A 3M07A 2ZA2A 4AVNA 1DXIA 2O7SA 3MKCA 4UTUA 3LYEA 4I5RA 3G24A 3VOIA 3DH7A 4A2SA 1GOIA 2ADAA 4MWAA 4XD6A 3G6LA 4UOJA 2WZTA 4GWEA 1Q4WA 3E02A 2JKAA 1V0MA 4H04A 4DPQA 3DYMA 4JDBA 5G2HA 5FEXA 4GYFA 2ASHA 3CZLA 3LPFA 3KDOA 2J4GA 4HGXA 4JN6A 3FCPA 3LHTA 4H41A 3TW7A 2X16A 1N82A 3DGRA 4JX6A 3PP7A 4EXQA 1C9WA 2QPXA 1X7FA 1IIGA 2VEGA 2IKIA 4JX4A 1N2VA 1TWZA 3B8WA 1GHSA 3MWCA 2QXWA 2H8XA 4U3CA 1O1ZA 2ZCGA 1A5SA 5A6KA 1V03A 3CZ8A 1Z32X 3LZ5A 1YE4A 4NAFB 2X42A 3DHDA 4AAJA 2J7HA 3GXFA 1KV5A 1XFBA 4UFJA 4BR1A 2IUZA 4D6HA 1NELA 1VR6A 1IEXA 3G1AA 1UWTA 1QMLA 1SVDA 3QTPA 2NLYA 3QY8A 4Q4SA 2J27A 3IIPA 4B4HA 2YSWA 1IWBA 3BCJA 4ILSA 4KWVA 4C1NB 2IPGA 2PD5A 5A8GA 1X98A 3LCGA 1XCWA 1O6IA 3V1HA 4M7SA 3VOGA 1DPMA 1Y8BA 3C5QA 4LBSA 4W86A 4GY7A 4W5UA 3S5ZA 3QM3A 2MNRA 4DPPA 5DXXA 3NUKA 3V36A 1SW3A 1PJ9A 4EANA 1RP8A 3TTQA 1UKQA 2Y2WA 3PTMA 5C54A 4CEUC 3MKVA 1VEPA 4OECA 3KZSA 4AZIA 2V2DA 3UFYA 4DIAA 1TJ0A 4RNIA 3I7QA 4D6IA 2NXGA 1W5PA 3THCA 3QSRA 1U1UA 1PV8A 4LAOA 1AK5A 2YGYA 2WMJA 5ABTA 3TN3A 3TN6A 1WDQA 3SUVA 3KL0A 3L2IA 2EAWA 2EG8A 5A6SA 5DCBA 4N4QA 1KRMA 5HAOA 1JJKA 3WMLA 4XZ9A 1SMAA 4AF0B 1VRXA 2V82A 3TR2A 4F9DA 4GUIA 1OF8A 2YZ5A 2VZTA 3RO8A 3OBKA 2W0UA 1RQBA 4A3UA 2XIQA 1XBVA 2E28A 2OXNA 4X63A 4MPQA 3BLEA 3A22A 2XG9A 4GUFA 1Q3NA 4DWSB 5D9NA 4DYKA 3S9IA 5MKGB 1MMFA 3WH7A 3W2UA 1SFLA 2NVCA 4LAZA 1VQTA 3MCNA 3MP5A 2QGHA 3IIOA 3MI2A 4JIQA 4NZ5A 4CNSA 3KLKA 5LXEA 1HJSA 4PSRA 5HBFA 1J6OA 4C90A 1N8FA 1YPFA 3W7EA 5I03A 5H6HA 9XIMA 1TRDA 2PZNA 3R43A 5CZTA 1IXOA 1FWCC 1FX6A 1QI5A 2CLHA 1TCDA 5D38A 3CT7A 3A4JA 2VRJA 1NFBA 3N2BA 4BY3A 1JUEA 5L9FA 5A5WA 1JDEA 4JHOA 2WMKA 3E2RA 4Q33A 5DX7A 3W7DA 3PVFA 3HPZA 2CLOA 1PBGA 1ZTVA 2X1SA 3LK6A 3M0JA 3PPGA 4JL2A 4LVGA 1TJPA 2OOGA 1K7EA 3NQ7A 3Q37A 4HOZA 1GTEA 1W1B1 3SCTA 5C71A 1LLZA 3IGSA 3VIMA 3BE7A 2BY3A 3TTYA 2CBVA 5IOBA 4O53A 3W86A 4I5XA 1XM3A 4DWSD 4CU8A 3L0GA 3MCOA 1TX2A 3HZ3A 3E96A 3VDGA 3ZFHA 3U2ZA 1WB0A 3GDRA 2A85A 4EPKA 4CU6A 5JUVA 3E38A 3LV5A 3GX9A 2ZRZA 3A64A 4G1NA 4TO8A 5BZAA 4H6QA 1WE5A 4H8NA 3W7HA 2ZQ0A 3G77A 3ARTA 2HTMA 5AYZA 3KRSA 3ANYA 2C13A 5HXMA 2HE8A 4GH1A 2D24A 1PKMA 3OA3A 3F4WA 2OO6A 1F61A 1EPXA 4YIWA 2NXHA 3PG9A 2FVMA 1BYCA 4JPGA 4Z42C 4MWAE 4A3QA 1E56A 1IXNA 2WCSA 3CWHA 3ZVHB 4F66A 3O63A 1MEWA 3BMVA 5CPSA 3M0VA 1TJ1A 1V02A 5FACA 3R12A 4O4WA 4UFHA 3TC3A 3LDVA 4CNNA 3OPSA 4C6FA 3DFSA 4F48A 2Y7GA 4CEXC 1ZALA 1PX3A 1OZMA 4TMCA 5I2UA 4WY0A 4QROA 4JFVA 1GWJA 1AH3A 3AXXA 3TJXA 3OGRA 2WC7A 3W1QA 4L61A 2NQ9A 4FOUA 3BAYA 1W1VA 3TTOA 3EDEA 2JF7A 2VR4A 5LIWX 1UWAA 2NW0A 1YTEA 3UVIA 4DJED 4JFSA 1RBLA 4PB5A 1V6WA 1MW2A 1W8GA 4CCEA 2Q02A 2QDEA 3EOOA 3NL3A 2GUUA 4PSPA 4CQAA 1TQXA 3VKAA 3VNDA 4P7QA 4Q22A 3T1GA 3A12A 3BW4A 3S8HA 3UG3A 4KFNA 2FHFA 4KRZA 4HCDA 2E8YA 2VEFA 1YMYA 1LLOA 1V3MA 2Y8KA 2GVLA 3F5KA 4YTTA 2P3EA 1XCFA 1IT0A 5GVJA 4EPDC 5CH9A 3NA8A 4JYEA 1FH8A 3OGSA 3WBYA 4A4AA 3B9OA 1MO0A 3BURA 4JN8A 5FESA 2VC9A 1VLIA 4XSMA 1XIIA 2BMBA 5I0DA 1FOBA 2R1KA 1LORA 3SM0A 1YNPA 1U5HA 3SCPA 1K77A 3UWUA 4KBXA 3SCWA 2ZX7A 2PLCA 2XGIA 3PZUA 4H9UA 2OZ0A 5DQPA 4C6IA 4E6MA 5EBAA 3FIGA 1CECA 4HOXA 3KEHA 1PWLA 2ZUTA 3ZS4A 3EXSA 4ICNA 2OX1A 1QFEA 2X7VA 1XIGA 4RZ6A 1T0OA 5LNRA 3TSMA 1BSLA 4GQRA 1I2QA 1W3IA 4QG8A 3UG5A 2H9AA 1VLWA 2C19A 4H8VA 3PZIA 3PZTA 2VEIA 3SO7A 2ZZ1A 3N4FA 1JF6A 4GPNA 2E5BA 1UZ4A 4AUBA 4I8DA 1TRIA 2HJPA 3NQMA 1MQQA 5HJYA 2G4FA 3UJRA 4EXAA 4L1WA 3L4TA 1VPXA 3P80A 4X2RA 2ISVA 2FFIA 4GQBA 1VZWA 4R3UA 1S1RA 5I3IA 1O5KA 4ZOEA 4DHGA 3SQSA 4JHZA 2GJPA 5F2LA 4UTJA 5G2IA 2ZVRA 4A21A 3GU1A 3VZXA 2C7FA 3QV6A 4NJIA 3KRBA 4JQAA 5A8NA 4M8UA 2FIQA 2PDLA 1K9EA 3C0QA 4EAMA 4H83A 3A5VA 3POHA 2V5DA 4Q32A 3M7SA 4QE4A 4DBEA 4HU4A 2YKKA 1Q66A 1FKXA 1CX9A 2BX7A 4UTLA 2D2HA 3FVDA 1LOSA 1I6NA 3E5BA 1S5NA 4OU1A 5TNVA 4TV6A 4K37A 3UXKA 4PMVA 1V77A 5D8WA 5A8MA 2NWSA 2G96A 2CU0A 3CLMA 3O6YX 2BOFX 2CPUA 3S6DA 3UJ2A 4M1BA 5LNVA 4TVCA 2ZUVA 4UR8A 4RUBA 3LNPA 3WQCA 2XVNA 2A3HA 1T96A 1W9BM 1KFJA 4L65A 3SIZA 3SUSA 1A3XA 1UMYA 4H9ZA 4DI8A 4YYCA 1MNZA 1GYLA 4TQTA 1DE6A 2YOCA 1IZJA 3CQHA 5KEZA 1OGGA 1CZ1A 4XTIA 1V0NA 3KBSA 5CCZA 4DO7A 1JPMA 4GE8A 3TN5A 4I9JA 1J5SA 4UMCA 2XIIA 1YPIA 3SCSA 4QJ1A 4UQDA 3WH9A 3W1PA 3UPMA 2PTWA 3FKRA 1BGAA 1TV4A 3LHUA 4IXXA 1WOAA 5AZ1A 3QHNA 3WENA 1U22A 5IDIA 2J7CA 3CYJA 1KXTA 2FGBA 1SZEA 1CXLA 3EB2A 1K02A 5FF3A 4JTUA 5AECA 1GOOA 1O5RA 1HZYA 1G9HA 3W00A 1QVBA 2PF0A 4AZ7A 3REQA 1A5CA 1WZKA 4YTSA 5E0KA 3ITVA 2OR2A 3B8DA 1KTNA 5FEZA 3BQ5A 2FKPA 2QZRA 4MJ2A 3L21A 5D04C 2VXNA 2AQOA 1XXXA 4D1JA 2O4QA 4IP7A 2C18A 3C2VA 1T5AA 3NTYA 5BROA 2OPJA 2WMGA 4B4FA 4EAYA 1PIGA 3G8RA 3WQWA 3NQFA 3A21A 3H2CA 1JD7A 4L4LA 3KWSA 3D6NA 3DC0A 1V79A 2UY2A 2D0GA 5IHRA 1ZL1A 4NYYA 2JFEX 4GKTA 1A0CA 1JCJA 1JZ2A 2W62A 3EPNA 2J24A 1JR1A 1CT5A 3FNDA 4WKAA 5M5DA 5C2XA 4LANA 3HG5A 3MJMA 3E0FA 3C86A 3PAOA 3QPEA 1XP3A 3CPUA 3LXBA 1X39A 3BDKA 3NWRA 3TOPA 3HFTA 4XIMA 1TVPA 1UG6A 3I7SA 3A23A 1EJXC 3LGGA 3O2LA 1V3IA 1R3YA 4LUIA 2A3LA 2WKLA 3MP4A 1XYMA 4E2DA 3II1A 4ZMGA 1HJVA 3M0ZA 4ADSA 5G4HC 5CSRA 1LP6A 3NQEA 3N2XA 1X97A 1O95A 4NZ3A 2QPUA 3ZLFA 1PIFA 3S2CA 1GPFA 1Z3NA 3WFZA 5A94A 5HNRA 4RE3A 1ITXA 4C65A 1AFSA 4U5KA 2NUWA 5LA1A 3M0KA 4E8CA 3W85A 3L65A 2E9LA 4D8AA 4PUNA 3H8AA 3M44A 4G9PA 3OLIA 3VGBA 1P48A 1MQPA 1PTGA 4BKNA 4UBPC 1DP0A 2W3ZA 2WQDA 1KGWA 3DAQA 6XIAA 3OZYA 3L5AA 3CJPA 3K5XA 3QR3A 4IIGA 2DGAA 4QQ3A 1H62A 4QRNA 1C93A 4HZ6A 5XINA 4CCZA 3E0WA 1VEOA 4FNUA 5CZKA 4MB4A 4QTGA 4MLRA 4FXJA 3WJWA 3GVWA 2VYOA 4HNCA 4R7WA 3SCOA 2WK2A 3TU9A 5A6BA 3ABRA 5HULA 3S0CA 3O0KA 2CLKA 3OGVA 4GX8A 5FF7A 3E9AA 3W82A 3P81A 3CC1A 3CIVA 4WKHA 3AZTA 3AIRA 1ZP4A 1IF2A 5LIKX 3UNDA 2CW6A 2GSHA 1BKHA 2VDHA 4BQ2A 4IMGA 2UY3A 3LOTA 3U7VA 1EJ7L 1CI1A 4PRTA 5BOFA 5D2VA 1YTKA 4O57A 2OJPA 2OO0A 2OEJA 1ZS2A 4JOMA 1XRFA 2B7OA 2KAUC 3SN4A 2J7DA 3S3GA 3U48A 1AMYA 4O14A 4IPIA 4C6NA 1VJIA 2HXTA 3KCJA 1TV8A 3V3WA 3SRHA 1VENA 2HZGA 2D0FA 3DESA 3HGJA 4S3AA 1GJUA 2O7QA 1SJDA 2CKSA 1UR0A 3V1PA 4MKVA 1XCXA 5BXTA 1FCUA 3UXDA 3T8QA 2PDUA 4H9YA 1I1WA 4BA0A 1Q6DA 3THUA 3MVIA 1XH1A 1VD6A 3NM3A 3AISA 3SY5A 1Z6KA 3TIMA 1UYQA 1H09A 1H1NA 2IQTA 3DDMA 1R9YA 1FVPA 1VFFA 2HVMA 1YBQA 1HGYA 3B9DA 3IIZA 4N42A 3ANUA 3TCSA 1PWMA 4A3YA 3G1XA 5M1TA 3HPAA 5GPRA 3EB4A 4XUGA 4B3ZA 3NVTA 1YDNA 4DUVA 3VIPA 5EGRA 4ML4A 3WMSA 4D8LA 4FAMA 1LDCA 4W7VA 1W9PA 4IIHA 2RDXA 2JK2A 4LAKA 1GOXA 2E77A 1DJHA 1IE7C 3U7BA 2PODA 3EKZA 1XIFA 3GR4A 2J77A 1QBAA 4D71A 3NL6A 4GYPA 4AX7A 4HU8A 1H1ZA 1AW1A 1TPVA 3P8IA 1OFRA 4AISA 1E70M 6A3HA 3JU2A 2WM1A 3BUVA 4M6VA 2WYSA 1YXYA 1WCGA 1XQKA 4OKDA 3OOQA 1WP6A 2A3BA 4UTTC 4HB7A 2PWVA 1K6WA 3BQ6A 3LG3A 4RJEA 5H91A 4WDWA 3W71A 2DY3A 1Y0EA 3AI0A 3AJ7A 3NJ3A 4LB3A 1GNXA 2G97A 4O50A 4LCRA 1KQZA 3PWIA 3GTIA 2PZ0A 2PDIA 3CL7A 2CIPA 3KXQA 1CGYA 4AVOA 2X2GA 2GOUA 4HBKA 3BW2A 4U2YA 3UERA 6XIMA 3D3AA 4KIEA 1FH9A 2WZHA 2WVSA 3BLKA 1C8QA 4LBUA 1TPH1 1QK0A 3MI3A 2ZUMA 4MMWA 3V18A 3CIWA 3E0VA 3CT2A 2PI6A 4UZSA 3SGZA 1Q65A 3CUZA 1J8VA 1OK4A 2NUYA 1MUWA 4YYFA 3FYOA 2ACRA 2PWHA 2VGGA 4DWSC 4X61A 3N6QA 2W61A 4PTDA 4HNLA 1XIHA 3GH4A 4DEFA 4YS1A 3QW4B 1KGUA 1H11A 2UBPC 4LUTB 3Q58A 4POCA 4H2HA 1XDLA 2WC4A 2ZWYA 4JGDA 5EMYA 3W1RA 1KM0A 3MS8A 3UZWA 1L6SA 2WPBA 4E38A 1W56A 1H49A 2WB5A 1K70A 5A6TC 1DTNA 2CBJA 4MJMA 3H2AA 4HK6A 4DAFA 3FDKA 1SO3A 1OFPA 1EA9C 2IPFA 3GBEA 3IVUA 3JS3A 3XIMA 3I3BA 2JEQA 3O06A 1MXDA 3EA1A 2PRLA 1KTCA 2HV5A 4GZEA 2H90A 3S46A 4J1OA 1R3WA 4WJXA 1IV8A 3CM4A 4ZENA 4ENLA 4O52A 4U10A 3DKLA 3F7JA 3NPWA 4CVUA 4QLLA 1JZ4A 2VDGA 2POZA 4H8UA 5CPOA 4NZJA 2VC7A 4R85A 3GWQA 1VYSX 3AO0A 1WKEA 4DYEA 4ZVJA 2WO5A 4ZODA 3KL5A 4V1YA 2PSNA 4I3GA 5A6JA 4LC6A 1LROA 1HL2A 1CW2A 4NL1A 4AZCB 4KPLA 3LM7A 4HNOA 1TCMA 1OADA 1KR1A 1BF6A 1B3XA 1U5JA 3LCXA 2WSYA 4WVXA 3C3NA 3TWAA 1SGJA 1F73A 1R47A 2ZZ3A 2VJXA 1EJTC 1OY0A 2PRHA 2ZX5A 2IW0A 1TPEA 1POKA 5LNWA 3N13A 3AZSA 4JTJA 2ZE0A 3L7RA 5T91A 1G7VA 5A6MA 3TLLA 5CSSA 4K6AA 4KH2A 3W76A 3BG9A 4ZO8A 2R1MA 4MYXA 3GIPA 3WJSA 1IWAA 1J0YA 1TWWA 3THAA 4HZ7A 3W2MA 2ZZ4A 1SZRA 2I9EA 3G18A 4B2DA 1LWJA 1ONWA 2MUCA 4NJJA 1E1CA 2O56A 3KBNA 2Q3RA 1WDWA 4U4MA 3S6TA 2LLEA 3M0IA 3GNRA 4Z08A 1A0DA 4XAFA 4FIRA 4LX4A 2OGYA 2J75A 4Y6GA 3B8IA 2PDGA 4CNPA 1QI2A 4UB9A 4D72A 2Z2AA 3A47A 4S23A 4IG2B 4RK8A 1E1FA 3W7NA 1GOQA 5FJOA 5LIUX 1ICQA 2BGQA 2DT2A 4Z2GA 3SQMA 2CEQA 4GNVA 2Z00A 3R58A 3LX9A 3AJXA 3FW6A 1YIXA 1DVJA 3QC3A 2E68A 3VKBA 3W72A 4HT3A 5CZ0A 2VDIA 2ZRVA 4PEEA 3C2RA 3TN4A 1AW5A 1MW1A 2PLKA 1HJXA 3D5HA 1E0XA 1XIEA 2NWRA 4NHVA 1PO9A 3GTNA 2AL2A 3PFRA 3F5LA 3NZGA 1QO2A 4YVPA 5LA0A 2VEPA 1M7JA 1UKSA 2PP1A 4MTVA 4GHRA 2XISA 1R87A 4LVFA 3STPA 1MW0A 2PDJA 5LGZA 1V8EA 3GTXA 2PF8A 3BLOA 5C9RA 1RJQA 3RM4A 3CV6A 1E3XA 2A7PA 3UCCA 4G1KA 3B9AA 1ZJIA 1RPKA 1GVFA 2KZHA 4O0KA 1EF3A 3S6OA 4H6EA 3TOYA 1LRTA 2C6QA 1BAGA 1TPWA 3RFAA 3HN3A 1UP2A 7REQA 1J93A 3DFNA 5HWJA 4WGHA 1AVAA 3PBWA 1OT2A 4PCNA 2GVJA 4KGJA 1G69A 3WEZA 1ZBCA 5FSEC 5HR7A 3N15A 1H2JA 3OZMA 2I1OA 5D2WA 5LNUA 2R94A 1PS9A 1V7YA 1FWSA 3IVSA 2NQLA 2YCJA 3V35A 3OLGA 2VX6A 3DFQA 3RR1A 3XINA 3N6HA 4JTHA 3ARXA 1NFGA 4G56A 4IPNB 3G3DA 2O9PA 1HX0A 1F6KA 1VCVA 4IJRA 1MYRA 3CNYA 4B5XA 3HPXA 3QQWA 2YDAA 1POJA 4PTVA 1T8XA 3B03A 1CWYA 1ZJBA 2ALDA 5CPMA 3SGUA 3W73A 1UJQA 4O15A 5K2ZA 2Y62A 1NF0A 3HGOA 4X2PA 4GVFA 1DXEA 2A3EA 3IJ8A 3BJSA 2XDFA 2G3FA 4H00A 4ZSUA 1MEIA 3T81A 4XVEA 4MZ1A 4AEEA 2J6VA 1TB3A 3WD0A 2WCAA 5I3HA 5HMEA 3SAZA 1MDLA 5C9XA 4RR4A 4PE8A 1I75A 2ZBTA 5FF0A 4ZOBA 5F2MA 4XKMA 4LYRA 3EMZA 3GW3A 3PWGA 2W27A 2B7NA 2V63A 3JVAA 3BLIA 4HHMA 3FOKA 4LT9A 3O3RA 3I3DA 1ICPA 5K3VA 1RA0A 3G5EA 3EKGA 4GYJA 3H4GA 4DUWA 2CLMA 4LQ1A 1R86A 1V6VA 1AZ2A 2ZOXA 3E1F1 1O12A 2L5HA 3M0LA 2QJHA 1Q13A 1FQ0A 1TSIA 3H2EA 4JIIX 3H7RA 1QNPA 4RE4A 2E9BA 1JUKA 2VD9A 1V6TA 3K8KA 4NNAA 1L2UA 4ZTXA 1E71M 2ZIDA 3IARA 4HZ8A 1MRQA 4P5UA 3CV7A 3M0XA 4I90A 1EEPA 1TPDA 2WJZA 2AMXA 4NASA 2ZWZA 2DQWA 4PEKA 3WFAA 2YLAA 1BWLA 1OFBA 1W1YA 3BLDA 3BWWA 2D1ZA 1RJRA 3VD5A 1BG9A 3GU2A 2CXGA 1JVNA 2FH8A 1RUSA 4A35A 4E2VA 2CWXA 2Q71A 3KUMA 3LEPA 1E4MM 1LOQA 1V6YA 1RXOB 3AIVA 3GTHA 5JBFA 4AD1A 4KW2A 2UY4A 1BTMA 5CXPA 4MY8A 3I10A 3UZZA 1KGXA 3WD4A 2ABAA 1OF6A 1XLKA 2VO5A 1XLEA 4DBWA 3AXHA 1QHZA 3FA3A 3E2SA 4LUSB 4L6OA 3HV9A 5D4YA 1QPRA 3STCA 3F2DA 1EQPA 1GGOA 2HBVA 2YB4A 3CXOA 1MSSA 4RXGA 3EYPA 5KZ6A 3GZ3A 4UQEA 4GISA 3CK5A 5FEWA 1JZ6A 3KTSA 2F61A 3VYLA 4O4VA 4AHOA 1ZBVA 2ESCA 4QXIA 1DJQA 3QV8A 2TYSA 4GZIA 3TCEA 2I5QA 1L6GA 4Q8VA 3MUXA 2NT1A 2DW7A 1H4PA 2CNCA 1W2PA 1GW9A 4R9XA 1BYDA 3W3OA 4C6KA 1Q6LA 4C7DA 2D2OA 4UNIA 4O0QA 3TFXA 1VHCA 1EZ2A 2C71A 3JZEA 1ADSA 1F3EA 1ME9A 3H12A 3IIXA 1WO2A 3SRKA 3UZJA 2Z1VA 4WF7A 2PBGA 3R5EA 1UJPA 3EAUA 4HNUA 4PMRA 3PTQA 5AFDA 3KLLA 2R8WA 4LYQA 5D30A 4X60A 4XKYB 3N12A 3TYEA 3T09A 3WD1A 3ZT6A 2DJXA 4K8EA 4DJDA 2DH3A 3CWNA 4ROQA 5CAHA 2E9MA 4CGTA 4OVXA 1LL7A 1K9FA 2V68A 3T07A 3WLLA 2R9RA 2PEVA 4C1NA 1TTQA 1DWIM 3TYUA 4F2TA 1GVRA 3FJ4A 4M0XA 5E70A 3WQ6A 1T40A 4AZBA 1UD3A 3TK7A 2V3EA 1UH2A 2AGKA 3E3HA 3G22A 1QOQA 1FHVA 1JYVA 2R1NA 3WZ0E 4O1DA 4NT0A 4W9TA 2FMOA 3IUDA 3P5ZA 1ZBKA 3EPOA 1E0UA 3HJEA 2ZDSA 2XVLA 1W6TA 2CHOA 3F4DA 1JAKA 1QJWA 3TONA 1HFBA 1A0EA 3NO1A 3KBWA 3AIQA 4DYJA 1TPC1 2ACUA 4JAWA 3TNOA 4ERGA 3Q4DA 4Q4KA 2Y8UA 5CG0A 1ITCA 4RDVA 3VC6A 4F2UA 2ZUSA 1I2RA 1GOWA 1ODUA 2QEZA 1NWRA 2V3GA 4UTTA 5LKYA 3TYBA 4DWDA 5CPQA 3SUUA 2DZTA 3R6IA 1BTCA 4AD3A 2BB0A 3LHVA 3WH6A 4JQ1A 2DT1A 2QCLA 3KTXA 3EDDA 4IZGA 3W28A 4LB4A 4J5NA 1SR0A 2DZVA 4K1WA 4CU7A 1DQXA 2XH0A 4LVBA 1AMKA 3K1GA 1B9ZA 3L4YA 4KS0A 1RBOB 4XV0A 1TV7A 4N0RA 5AC6A 1XLLA 2VEMA 3M7WA 1G67A 2V8ZA 3V75A 3BVJA 3PK7A 2VD8A 1OABA 4DWSA 4IFRA 1QDSA 4PTNA 5EBUA 2AAAA 1W3NA 3CL8A 2A5HA 5ENLA 2E5DA 4O1FA 1B9BA 2IXUA 4FOKA 4LV4A 3BSHA 5BXRA 3VNJA 2YCLB 2W92A 3CEPA 4Y9MA 4B5UA 1CXHA 1P5BA 2GYIA 1B30A 1IXQA 2P88A 3RITA 2GVEA 1E40A 3GVQA 4GNJA 1HJWA 1BFNA 1GPWA 3UEQA 1MUCA 4ICMA 3NEVA 4AWSA 4GVGA 4K8GA 1PTAA 3M16A 5TF0A 3AIUA 4QDMA 1X1ZA 1ZZMA 3B4YA 4W7WA 3C52A 4E3VA 1J2WA 5C5YA 4B92A 5D02A 3OZPA 2DEPA 3NQCA 5EKYA 5HOSA 4MFDA 2O9RA 3LMYA 3H7UA 2ICSA 3KE0A 5A1AA 1RHCA 5HATA 1S2TA 4U3AA 3VFCA 3TA9A 2ZVIA 3PFMA 1VPQA 1Z9AA 5B7ZA 2QUNA 4C6QA 1Z41A 3NEHA 3NO3A 4MNLA 2PGEA 4FIQA 2IKJA 1C91A 1N8IA 3BAJA 5HUPA 3WF2A 4UXDA 1Y7VA 3LENA 4HA0A 1SW0A 1VFOA 1WOBA 3WF0A 3CPRA 2WMFA 3N2MA 1Q85A 1NH6A 3T9PA 3L4UA 5AHFA 1NTHA 3ISIX 5D03A 4DJEA 3O6AA 1OYAA 3MB9A 3VD9A 5MHBA 3NFUA 1ZCOA 4Q3MA 4PBFA 1QR7A 4L80A 3TQKA 1FWIC 1JDAA 3SN0A 4C1LA 4B15A 3L68A 5DF0A 1X96A 3IJIA 1TIWA 1UH3A 4IP5A 1FH7A 3TDFA 4J4KA 3C56A 3T44A 2YL8A 3N2CA 1YEYA 3GB6A 1QK2A 8CGTA 1W9UA 1O1HA 1UWQA 1VBRA 3P8JA 1JCMP 5JU6A 3ECQA 3ABSA 1E4IA 1SO5A 1ZB5A 1SQ7A 4MB3A 3WFLA 5A8OA 8A3HA 4M82A 1P7TB 1V0LA 3T4WA 3RO6A 2A21A 4RNJA 5CGQA 2DSZA 2EPOA 1UZ1A 3HF3A 2Q01A 3NQBA 4BI6A 3VMNA 5KZMA 1VKFA 3G3MA 1H7WA 4M7TA 3VPLA 3BCFA 4Z0SA 3TQPA 2V67A 3W7MA 3UETA 4UNKA 2PDWA 4ZSTA 1XI3A 1WXJA 3VIGA 3QEZA 1X6NA 3IVTA 1WKYA 1TV3A 3LXAA 3UYCA 2NX3A 5BRQA 2ZUWA 1RR2A 2GL5A 3MTWA 4LC8A 4PCPA 3GNPA 5HWNA 2NUXA 4C60A 3ZM8A 4LCQA 1EJWC 5D2TA 6PTDA 3ANVA 3H2FA 1L8PA 2WKJA 3BGGA 1TMQA 1HIZA 2I16A 1B90A 3QGKC 1J0IA 3H24A 1UROA 4QGCA 5MF5A 3TEVA 3L4ZA 4N02A 4LUJA 5XIMA 1H7RA 1K8ZA 1IEIA 5LXXA 3LRMA 2D22A 2C15A 1H7PA 4IMFA 3VNYA 1A50A 4XD5A 3KVKA 4W87A 1E0WA 4FX6M 3P74A 1HO1A 3CH9A 3RPDA 1EH9A 3R8HA 2PFHA 3WLPA 2G8ZA 3UPWA 3WUFA 3CIXA 1FWEC 4JTFA 1P0BA 1E5JA 1SYTA 3T40A 3UJSA 3S9ZA 1F3WA 4IWWA 3N9SA 4FO4A 5CPLA 3IGXA 1VJZA 3B9NA 3W01A 3WL0A 2VL4A 1TV2A 2AMGA 1BWVA 1M5WA 2EF9A 1G4SA 4BF5A 4W88A 3WO8A 3QBUA 1A3WA 5AY7A 2J9XA 2GJRA 4PCFA 3PZMA 5KETA 4JTKA 1G94A 1WNOA 2A2IA 5J04A 3DG3A 2ATSA 4M24A 4GO9A 1HN1A 1WZAA 4GBDA 3BV7A 4KEUA 3I6EA 4KWWA 2VMFA 1P43A 3LRLA 2WNZA 2X0HA 4HYWA 3M5XA 4JNYA 5G1YA 1EDQA 4J7RA 1D3CA 2V3DA 2V69A 2X7WA 3SY8A 4AWTA 1EO7A 3G0SA 1ZJAA 2NVDA 4QJ4B 3MUZ1 3LLFA 4LF1A 3BH4A 4QQUA 4UR9A 4ZO6A