3LCWA

L-kdo aldolase complexed with hydroxypyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'NLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERAQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRHGFDAVSAVTPFYYPFSLEEHCDHYRAIIDSADGLPMVVYNIPALSGVKLTLGQIYTLVTLPGVGALKQTSGDLYQMEQIRREHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECNKVIDLLIKTGIFRGLKTVLHYMDVISVPLCRKPFGPVDEKCLPELKALAQQLMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Modulation of substrate specificities of D-sialic acid aldolase through single mutations of Val251
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 111
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lcwA00
4JTUA 3QSTA 3S0CA 1JCLA 4A22A 4FX7A 4CCCA 4LNYA 3BARA 3L5MA 3B8DA 5DCDA 1W31A 1ICQA 1LBFA 4ALDA 4EF8A 4HSOA 3W1MA 1QPOA 5AC6A 4Y90A 3W7JA 3G22A 2FB3A 1FY6A 1O94A 4L4LA 1QDSA 4MY9A 2EAWA 4S2BA 3FYOA 4O52A 4YWIA 1QFEA 1DBTA 3D0CA 1LOLA 1SFJA 5CPOA 2Q8LA 1YDVA 3PBUA 4AF0B 4RV8A 4K8EA 4PA8A 4HPXA 1TCDA 3N9SA 4LUIA 1AL7A 3FEMA 4BWLC 3STEA 2VC6A 4KWVA 1KLYA 3DI1A 2YPIA 4QIUA 1PHQA 5F4XA 3MI2A 5AC8A 3HIJA 4JS3A 4ORIA 3W2UA 5LSMA 3L2IA 3W1RA 1N55A 3WJSA 1EA0A 4PL1A 3PB2A 2V8ZA 2J27A 2HSAA 3E9AA 5K9XA 1SZFA 4UUIA 1FCBA 1GEQA 4JYFA 1R46A 2TPSA 3BG3A 4K36A 3F4WA 4UTIA 3HOJA 3W7PA 2Y70A 3QMSA 4O1CA 4MZYA 2DJLA 2YGYA 3G3MA 1K8YA 1LORA 1Y0EA 3B4UA 1BWLA 3ZWTA 2C15A 5EY5A 2ZRVA 2C3ZA 4Y8FA 4ZQRA 3LHYA 3R5EA 1IF2A 4O19A 5GVJA 5F4SA 1EWEA 5C5YA 1BKSA 5G2HA 4DO6A 4AAJA 3NPUA 2V9DA 2Y89A 5D37A 5AN7A 4IWWA 3CIWA 5J5RA 4KFNA 3LHWA 1ADOA 4MKNA 3KVKA 1YXCA 3P5YA 4CCDA 5LKYA 1KM5A 5L9FA 3A5FA 2PRHA 1H63A 1W8SA 4NNBA 1Q3NA 4MZ8A 3B03A 3PG8A 3PULA 4D2JA 3M5ZA 2YFNA 4O4WA 3N34A 1VCVA 4R7JA 1JCXA 1QPRA 5FEPA 2NXIA 3ABRA 3M43A 4WX2A 1YDOA 2WKJA 2GVLA 2YFOA 1V5XA 1UB3A 4NU7A 3MHUA 4CQ8A 4UTUA 5U7SA 3HO8A 3N2MA 2QEZA 2H8ZA 2E6YA 3BV4A 1UUOA 3TSDA 1O5XA 4GWEA 4DF0A 3W7MA 5G1TA 1AW1A 3KFTA 5D2WA 4AB4A 1MO0A 3IGUA 3TNOA 4AVFA 2WJZA 4N02A 2Z0IA 4YXGA 1R47A 3P7YA 5IM51 2RDUA 3K30A 1FDJA 1UASA 3RK8A 2DORA 5TQLA 1DV7A 3SI9A 4AH7A 3HF3A 3BGGA 3DFPA 3IIPA 3CWOX 3IVUA 3W7RA 4QAIA 5FEWA 3TJXA 5C54A 1WOBA 1P1XA 1OVDA 4GBUA 1QOQA 3Q2DA 1J5TA 1H60A 1Z42A 3NQEA 4PFMA 1ALDA 1W5QA 1KM1A 4RX0A 2Z6IA 3O05A 2YDAA 2ZRXA 4IJBA 2PCQA 2FJKA 4K7YA 2NWRA 2PC4A 2Y61A 3GKAA 2QUTA 1AW5A 3P67A 1XL9A 3LERA 1W3TA 1SPQA 3OIXA 3W1QA 1GT8A 4I7VA 4WXYA 1OFOA 1DVJA 3GB6A 1U5JA 1PIIA 3PBVA 4RLIA 5CPLA 3LOTA 3PF3A 3S9YA 3N73A 1YADA 4LWWA 4U4MA 2J9ZA 1Q6OA 4TIMA 2QCMA 3LB0A 2CLHA 1D3GA 4WY0F 4CQAA 4AF0A 1PVNA 3LCLA 3HG4A 3LV6A 3PWAA 5AHMA 3CEPA 1W54A 4DBDA 1EP1A 3EWWA 4UXDA 4AWTA 5EMUA 4UC5A 4LC6A 5FF0A 3TFXA 3BPWA 1YYAA 3DI0A 3NQ2A 3C52A 3DGRA 1BEUA 3EKZA 3S1WA 1T0OA 4E0CA 4FF7A 4A3UA 1VS1A 3JR2A 4WOZA 1H1ZA 1H50A 1X1OA 2G97A 4GXMA 5LNRA 3TU9A 3SGZA 2YYUA 3GR7A 1FBAA 4ZVJA 4PEKA 4JGDA 1GYLA 3W87A 2H3DA 2ZZ6A 1FDZA 4KWWA 1I2OA 4Z1AA 3LTPA 2A7PA 1W56A 4HIBA 1RD5A 3O6CA 1XXXA 1KV8A 2BX7A 1QMLA 2C19A 5FI8A 2GPTA 3IVTA 3NM3A 2QDGA 1TTIA 3M5VA 1VYRA 3E0IA 4FNRA 1R2RA 1VYPX 5KTLA 4LVGA 3FOKA 3GVGA 3INPA 4TR9A 2P1FA 3FLUA 3YPIA 3O6DA 3SIZA 3W1UA 1QNVA 1K8XA 1X7FA 3STCA 4O28A 4Y96A 3T55A 3MYPA 3L66A 4JEQA 1HL2A 2VXNA 4UMCA 2Z1BA 3NZ1A 2QCEA 5AHIA 1K02A 3BG5A 3LCIA 3NQAA 5HR7A 3ZS4A 4FXSA 2WOQA 4QITA 3TFCA 1I2QA 5K2ZA 1TV7A 1D3HA 2ZZ2A 4N9CA 4GUHA 4CNNA 1RQEA 1AL8A 2J9YA 3FA5A 3DKJA 3NL2A 5U4NA 1QAPA 3N14A 4NJKA 3VCRA 1ZCOA 4PC8A 1K8ZA 1H1YA 3H54A 2F84A 5D38A 1Q6LA 3G0SA 2ZBTA 4UR7A 2JKEA 3GAYA 1Z44A 1MXSA 1W3IA 3CTLA 1B3OA 2X30A 4JICA 3TXZA 3IIZA 1XDLA 2TMDA 2RH9A 2B4GA 3M16A 3BVJA 5TIMA 4RKAA 1XDMA 2ZZ3A 2E6AA 3NQGA 4A29A 3IIXA 3HG2A 3P8JA 1ME9A 3NQVA 3KRZA 5D32A 1AK5A 1DKWA 3M7WA 2DZSA 1PV8A 1KM0A 2UV8G 3G1HA 1B4EA 1ZAIA 3E96A 2FB2A 4CNPA 3HB9A 4MPQA 1JCMP 4O8RA 1HFBA 1TPUA 1RQBA 3HGRA 3N3MA 5D02A 2D73A 5KINA 4NJGA 1A5CA 4M7SA 3R89A 4RK8A 3W7LA 2QCDA 1AG1O 2DZXA 3FYPA 3W1LA 1GG0A 4LW7A 4AHOA 5KZEA 1TQJA 5AC7A 3M5XA 1Q6RA 2A1YA 3EX4A 2G5WA 1H5YA 3CHVA 1XKYA 1YTDA 5FEZA 2BSLA 2GQ8A 1OFEA 3M47A 1MSSA 4IXXA 1N8FA 1LRTA 3QM3A 4FXRA 1LCOA 2LLEA 5KZMA 2X2GA 4RR4A 1WDWA 3W1AA 2BWGA 3ATYA 5ABTA 1EEPA 1G67A 3QW4B 2V0TA 4DQWA 3KAOA 3MBFA 2O7SA 4UFKA 5K4XA 5G4EA 2GOUA 2A85A 1OG0A 4FB7A 1IIHA 5AHLA 1ZENA 2GQ9A 3LHVA 4JDYA 1SSGA 5LZLA 5I3IA 2CFFA 1DJQA 3ZWSA 3LXAA 2V5BA 3TIMA 4O53A 2F7FA 3W1NA 1G7UA 2CZ5A 4UTMA 2V82A 3AO0A 5F2GA 1J2WA 2CLFA 4H3DA 2C14A 4O11A 3QC3A 4QJ1A 4LVBA 5IBXA 3RNDA 2FLIA 4MY8A 1VCGA 3A21A 1S5TA 3NOEA 3L0NA 4RXGA 2Q8ZA 1DOSA 1XFBA 2WQPA 3NPXA 3V1PA 3O06A 3W7DA 1TO3A 2B7QA 1I4NA 2VOMA 4GC4A 4UIOA 3WK2A 4M5PA 3N9RA 4W9TA 4OV9A 4LVFA 2E5BA 2QJHA 1H62A 4IX0A 3T78A 3LXCA 2R94A 1VJIA 1MEHA 4AWSA 4Y6GA 2WV8A 4B5NA 3TJLA 1LRQA 4X3ZA 4K38A 1XUZA 2B7PA 4JTIA 3QF0A 1F73A 5EYWA 2I9EA 3KX6A 4I7WA 3GLCA 4E2BA 2E1DA 2RHGA 2YSWA 5CKSA 2FDSA 4UCGA 3BO9A 3UWZA 1MEWA 3LM7A 1LOQA 3NL5A 2X16A 4X2RA 5D2XA 1Q6QA 3PUEA 3R8RA 3GDKA 1TPVA 1GWJA 3W23A 3NQFA 1EP2A 3G1DA 5DCEA 4HNNA 1MEIA 2Y63A 3W70A 1XC4A 2Y88A 3F4NA 5E0KA 3UWYA 4JTGA 3TW7A 4PTNA 4MJZA 3BGJA 1M7OA 1SFLA 1DJNA 3GNNA 2B0MA 1PCWA 1XI3A 4JTFA 2H6RA 5LGZA 5BRBA 3EWXA 4IXHA 3A23A 4ZQOA 1DQXA 1SQ7A 2CZEA 4BWLA 4O12A 2WSYA 2WSRA 3B0UX 2QKFA 4ADSA 5FF7A 3G8RA 3FKRA 3P82A 3OHIA 4XBSA 2ZA3A 3LCGA 3PAJA 3W7OA 1JCYA 2H3BA 3GNDA 1LROA 3L0KA 1ONRA 3ABOA 3QYQA 2ZRZA 3M6YA 3MMTA 1FWRA 2EF9A 4WQ6A 3NGJA 4GE8A 3A9IA 1W1ZA 1KV5A 1SW3A 1GG1A 1LOSA 4R53A 3MO7A 3C2RA 3VNDA 3NQMA 4HNUA 2OCZA 3OG3A 2DZUA 1JR1A 5TBOA 1TPC1 3G1AA 3MHFA 4GJ1A 1FCVA 2E09A 1QR7A 2A2IA 2H8XA 3UWUA 2Y7FA 3G24A 2C18A 1A5BA 4QNEA 4AXKA 3O15A 1GTHA 3M5YA 2NV2A 4PCFA 2VENA 3C2EA 4N4QA 1PE1A 3PM6A 3Q58A 5CZJA 4H4IA 5LHFA 3UPBA 3IIVA 2ZQ0A 2V81A 5H91A 3WJXA 3NQCA 4OGZA 1J4EA 1OK6A 3NPVA 4LRSA 2FIQA 2Y85A 1NSJA 3B04A 1B9BA 2KZHA 2ABAA 3O1NA 1KFBA 3SFKA 1VPXA 3L9CA 1TPH1 4RCXA 4HNTA 3RLVA 4ADUA 3TQKA 2HS6A 3UQNA 4WD0A 3W71A 3W7CA 1SO4A 1Z48A 3NQDA 3TH6A 4ORMA 4DO5A 1K7EA 4QQ3A 5HQEA 4OBTA 5AYXA 4UFJA 3PBWA 4LVDA 4M19A 1JUBA 5D33A 1ZALA 3PG9A 4S2CA 3DFOA 1WX0A 2CLEA 1KM3A 4YL2A 5D2YA 4EF9A 2JKPA 1TTQA 1JRBA 3IVSA 4OHQA 5BMWA 4Z1BA 1TPDA 1CW2A 5I3FA 4UTWC 1TRDA 3UY8A 3MP3A 3EWBX 3LI1A 3MP5A 5KITA 2CLMA 1SR9A 2YW3A 2XN1A 4DEFA 2ZZ7A 5LGXA 3HJZA 2G95A 5CSRA 3P5ZA 4LS0A 4NXSA 3TAKA 3NL3A 5E93A 3M9YA 4I7UA 4RZ6A 4MFEA 2QJGA 3L21A 1GPWA 4IMEA 1WQ5A 2X1SA 5SWUA 2E77A 3LCWA 5LHEA 3T40A 4PODA 4R34A 3E02A 3P84A 1NEYA 4O4VA 4PH6A 3NPWA 4IGHA 3C4UA 3QRHA 5G1YA 4YMZA 3CEUA 2NZLA 2QDHA 4O17A 5A8GA 1UUMA 4Z1CA 1OYAA 5I3JA 3NQ8A 1VQTA 3O16A 3A24A 1IIGA 3KRSA 3NAVA 4FNQA 1L9WA 4WUIA 3QEZA 2ZRYA 3P61A 3NDOA 1H51A 4LOCA 3W84A 1YTEA 4N9DA 3Q94A 4JYEA 1Z41A 3UXAA 3WJWA 3RFAA 2W6RA 4IMCA 2QCDB 1P0NA 1OHLA 1D9EA 4MLJA 4FIRA 2A0NA 2BLEA 1IXQA 1IXPA 4M6QA 3CQ0A 3P8IA 1F05A 3B06A 5HWJA 3KVJA 1P5BA 3QH2A 1K7FA 2VEMA 1QPNA 2DZTA 3ABSA 5BOOA 3MYOA 4JYDA 1KFLA 1TRIA 2PE4A 1HG3A 1OYCA 5MHBA 4MY1A 3IV3A 6TIMA 1F5ZA 3GR8A 2XFWA 4IPJA 2VEIA 5F1VA 4Z0JA 4XTIA 4BI5A 4TMBA 4NX5A 5KSWA 1QO5A 1QWGA 2J9XA 4O1AA 3DXIA 4EWND 1LRNA 3VKJA 1W5MA 3C56A 4FNSA 1LYXA 3IRDA 4LY8A 3U6WA 3TUUA 2VFHA 4O13A 5CZ0A 3DFTA 4LTSA 5AYYA 4POCA 2H90A 3I6RA 1H7RA 4DPQA 1B4KA 2V2CA 4RJEA 1WV2A 4TO8A 3RF9A 1HO4A 5AHNA 4JIQA 1XBVA 4ML9A 2ZCGA 3Q37A 1EB3A 3W85A 3A22A 2FTPA 4IUOA 3QW3A 4KFOA 2GUUA 1GVOA 3QPZA 3CLMA 1EIXA 3SW6A 1KM2A 2NXHA 2GJLA 2PRLA 5F2IA 3VFLA 4MUZA 3IIOA 4LT9A 4NVTA 4IMDA 3GDRA 5C55A 3ANYA 2ISVA 4MYAA 1FDYA 3C3NA 4FIQA 4UTLA 1R30A 3DFSA 2CW6A 3M41A 3S5NA 2QAPA 1KM4A 1T96A 3GZ3A 4RZ4A 4O0KA 4P61A 1TIMA 2CWNA 3F03K 3LBCA 4ZQPA 4Z08A 1KM6A 4AEOA 2E5DA 4GRSA 2E5CA 3EB2A 3DBPA 3UWWA 4LV4A 1K03A 3PS7A 4WXZA 4XUGA 1FXPA 2OMAA 2E6DA 3W07A 2Q3OA 4O18A 3S42A 1P4CA 4FNUA 1ZFJA 4X22A 4GUFA 4UTHA 3ABQA 2I1OA 2W0UA 3HG3A 1O95A 1H7OA 3PVFA 3S1XA 1W3NA 3HPSA 5EA9A 1TV5A 1EX5A 3W22A 1FX6A 3M1ZA 3RU6A 5LNVA 1HUVA 3PUDA 1OX4A 3FJLA 6ALDA 3M44A 4BI6A 1SW0A 3DHFA 3BLFA 3IGXA 1VYSX 2ZTKA 3VI2A 3S5OA 2ZRWA 5D03A 1W0MA 5HUPA 1A53A 2YW4A 3W3OA 1F76A 5FF2A 4GFSA 5D2TA 4MOZA 1TMHA 4LS2A 3TR2A 1WBHA 2A21A 1DQWA 5KMYA 4C1KA 4JIPA 3EWYA 1ICSA 4NX0A 3KXQA 4NZJA 4JX4A 3MI3A 4O50A 3TMQA 1SO6A 3W7HA 3GDLA 3GDMA 5I3KA 2Y7GA 4N9BA 3BW3A 4JTTA 1H61A 5E1QA 1H7WA 4Q33A 4CNOA 4HHPA 3W75A 3STFA 4UFHA 4BF9A 2R8WA 1KTBA 1PL9A 3W72A 3HMJG 4UTKA 3EX2A 2C6QA 3LX9A 4DF2A 1JUKA 3DFNA 4AHQA 3P81A 4MZ1A 2Y7DA 4BI7A 2CZDA 3W7GA 5G4WA 4K37A 5FF4A 2Y6ZA 4JTEA 3OVRA 5AB3A 4ADTA 5CPMA 1LP6A 4Z1DA 1W5NA 1LZOA 3P80A 2P0OA 1FWSA 1KBJA 2J24A 3O07A 4R33A 4M7TA 4NZFA 1F7BA 3DHDA 3GXTA 4DXVA 3W7EA 5CG7A 1OFDA 4JR5A 4BK9A 3A5VA 4UNLA 1O5KA 1F2JA 1QO2A 4O15A 4JD4A 3QMRA 1PS9A 3BG9A 3C2VA 1PHWA 3LRKA 1H7PA 1TB3A 5A5WA 1OFBA 5D04C 3O6YX 3V75A 3TAOA 1L6YA 3G1SA 3HBLA 3CIXA 3BLEA 1I45A 4K7VA 4MVAA 3W1XA 1TYGA 4NT0A 4EOUA 4ONVA 5HULA 2E68A 3KVMA 4FX8A 1TSIA 5AYZA 1JCNA 2QF7A 1PCKA 3N2XA 1UJPA 4IMGA 2QR6A 2GVGA 3G18A 3TSBA 4A2SA 4JDBA 1TPFA 3PBYA 4E2DA 3SECA 3TQ0A 4QM1A 4KFPA 4GUJA 1FQ0A 2NLIA 1RPXA 2FPYA 3B05A 3HQ1A 3OVPA 1SZNA 4KKXA 1ZAJA 2BTMA 2NX9A 2QAFA 4N9EA 5DBTA 3CC1A 3UXDA 3GXNA 4ZQMA 3G1VA 1F74A 4FNPA 4CLMA 1LBMA 5CZSA 3MP4A 3THAA 1EP3A 1G4PA 2RDWA 2TSYA 1KW1A 4HN4A 5D30A 1RV8A 3OBKA 5J5DA 4WZHA 1BTMA 2DZPA 3CB8A 4O0ZA 4IMFA 5AOUA 1O60A 3W88A 3G0XA 3W74A 2WPBA 3TV8A 2A4AA 4LU0A 1V7YA 4NNCA 3LTYA 5EKYA 1WAUA 4HSNA 4MYXA 3G1FA 1NAL1 1C29A 3TK7A 2DU2A 3OVQA 4XWUA 5FF3A 3EX6A 2QCGA 3W1TA 2WNNA 5EL1A 1TPEA 1JRCA 3UWVA 4NJJA 4QSHA 1TTPA 3GYEA 5I3HA 3TDFA 1E51A 2Z6JA 3R12A 3S5ZA 5DBUA 2Y7EA 4O14A 4MLRA 3LCHA 5K4ZA 3GX9A 1CX9A 3LI0A 1WXJA 4O10A 3NZRA 1F6PA 5H2ZA 3I7RA 3UWQA 3JS3A 2PURA 1OABA 3THQA 3N19B 1KFEA 4GUGA 2G96A 2ATSA 4RXFA 1RVGA 2ZZ5A 4OT7A 3NYZA 2X1UA 3S5YA 2QCLA 1VGAA 1I2PA 1TJRA 3QPYA 2OX1A 4GUIA 1VRDA 4JY9A 5DN1A 3W76A 2ZFAA 3L0GA 4IOTA 1XBXA 1VCFA 3G1YA 2EKCA 3BLIA 2YCEA 2VKZG 3LRLA 1G4SA 1LDCA 1NVMA 3LV5A 3DU0A 1H7XA 5DCBA 2X1RA 1Q45A 1TPWA 1KTNA 4BR1A 3KHJA 1VR6A 5D09A 1EUNA 1W37A 4JTHA 4I9AA 1B57A 1SO5A 2FQIA 1X1ZA 4Y9AA 4UR8A 3SZ8A 4LC8A 1WBJA 1YPFA 3VE7A 3SJ3A 2ZDRA 2JK2A 4OE7A 2XN2A 3W2NA 3S6DA 1ML1A 4LVAA 2VEKA 3ATZA 1OFQA 2B7OA 2ISSA 3G8EA 3UNDA 2CLLA 4A21A 5HWMA 5EPDA 1XM3A 1ME8A 3NVTA 2ZA2A 4UTWA 3HGJA 1O4UA 1OK4A 2QUVA 2QCCA 1GOXA 3B0PA 1YPIA 1LM1A 3W7QA 1IXOA 4Q4KA 4UTJA 1GQNA 3HGOA 1ZJIA 1KBIA 2Y62A 4PL2A 3RLUA 3L67A 1WYIA 1UBSA 1YXYA 3EWUA 1EPXA 5K9CA 3M0ZA 2BZNA 2DZWA 4BFAA 2ZZ4A 3NO5A 1ZNNA 2HTMA 1SZGA 5G2WA 3TE9A 3P74A 1H7NA 4M6VA 3USBA 3LHUA 4UMBA 4UFMA 5FEXA 3LHZA 1AW2A 3C2OA 2OT1A 3W83A 3I7SA 1JCJA 3FS2A 1JUEA 3C6CA 3LXBA 3MHGA 4GNJA 3LRMA 4TMCA 2ZA1A 4YCOA 3PB0A 2NXGA 1NF7A 3NXFA 3RMJA 2W79A 4WJEA 3HPXA 1QCWA 3NNTA 1F6KA 1OFRA 3LCFA 2V5LA 4LS1A 1R2SA 3C61A 2VFFA 2WNQA 3JRKA 3PUOA 4N6FA 3LHTA 3G0UA 5LNSA 3C8FA 3CT7A 3T44A 3UZ5A 3QQ1A 2FPTA 3QQ0A 1OX4B 1OYBA 5K7JA 4NJIA 3P60A 1IGSA 5DY2A 3TX9A 4ZZ9A 4DPPA 4JX6A 3TMLA 4N6EA 1L6SA 3H53A 3BW2A 5G2IA 5C2XA 3WK0A 1S5WA 1A50A 4ZL1A 1G7VA 2NX3A 2WSQA 3ZFHA 4OV4A 3L68A 1JJKA 4O1DA 4A2RA 5F1UA 2XN0A 4JY8A 3G3DA 3SY5A 3EXRA 3I68A 4K39A 1S5VA 3IEBA 1OX6A 3PC0A 1OFPA 1G69A 3TC6A 3WK3A 1GVSA 4EIVA 1VH7A 4UFIA 4UNKA 3NG3A 2ZYFA 3TKFA 4RZ5A 8TIMA 3DH7A 2EPHA 1M7PA 4LV9A 2J88A 3LLFA 4IPIA 4QNWA 3MUXA 1LLWA 1TJPA 2A6NA 3GDTA 4HPJA 3UY7A 3H55A 3UPWA 3LCXA 4JTLA 3NR0A 5HR6A 4WOQA 2J6XA 4JN6A 1GTEA 1NF0A 2BXVA 1BWKA 2GJNA 1GVRA 5CZTA 3W7KA 3HGSA 5K9DA 4K8HA 3W7IA 1GZGA 3W9ZA 4ZQNA 2HS8A 3LGEA 2QCFA 1G4TA 3NL6A 2FPVA 5CPNA 3C0JA 4NQ1A 2TYSA 1G4EA 4YLWA 4XZ9A 5AHFA 1QPQA 3WK1A 3E12A 3E49A 1TPB1 1NFBA 3NQ6A 3FJ6A 1EWDA 1ICPA 3R2GA 3DAQA 5T26A 3SR7A 4LRTA 5AHEA 4XKYB 2ZZ1A 4DF1A 1GVFA 1N7KA 2NV1A 2R91A 1L6WA 4WY0B 4TU1A 5KZDA 4XBKA 3MI6A 3STGA 3GAKA 3ZR4A 3WJYA 3W73A 2DJXA 4FO4A 1WA3A 2A7NA 2YYTA 3O63A 4HT3A 4P2VA 5D2VA 1DL3A 1XBZA 3DENA 2C0AA 1A5SA 5L6UA 2ZRUA 2V30A 3VE9A 3I7QA 4FEZA 4C1LA 2AGKA 2VELA 5DLCA 5K3VA 4Z0SA 1OJXA 1W5OA 2CZFA 3MW7A 3SGUA 1P0KA 4S1FA 3T7VA 4FHAA 2RFGA 1SO3A 3QZEA 2JGQA 2B7NA 3EX1A 3FKKA 3W2KA 3PSVA 4DELA 2YR1A 2WNZA 2NUYA 1HO1A 3KRUA 4JTKA 4K6AA 4OU1A 4JTJA 3EX3A 2Q3RA 1RR2A 1JULA 3QFEA 3S1VA 5F4WA 2O7QA 2VFGA 3U2OA 1X6UA 2YXGA 3W2LA 7TIMA 5I3GA 5HMSA 1VLWA 4AWUA 2CLKA 3PR2A 3W1PA 1FUYA 1FWWA 4J9JA 1SUXA 2NWSA 3U8GA 3KOFA 1FWNA 2VFDA 2CU0A 5HUOA 1SZEA 3C2FA 3TW6A 4FX6M 5HNRA 4LUJA 3MWAA 1DORA 2QJIA 4JTSA 5BMXA 3QJAA 3PSWA 3NQ7A 5HWNA 1M5WA 4JXCA 4O57A 1JQVA 1G6CA 4OWGA 3G1XA 4YCPA 1S3HA 3TC7A 2DP3A 3AJXA 3LTSA 5BNKA 5F2MA 2V2DA 1KTCA 3GK0A 4N2YA 2E6FA 3QSRA 4FNTA 5CGQA 3LBMA 4EVZA 2C16A 2YX0A 4NUWA 4NNAA 5DY3A 2ISWA 2AAMA 3F1QA 1GYNA 3B0VC 5C6MA 4O16A 3CWNA 4UMAA 3HG5A 3NA8A 1TREA 1FCUA 3GIYA 3MBDA 1I2NA 1K7XA 3EEGA 1UCWA 3L65A 5EBUA 3BW4A 1RQHA 2X1TA 5F2LA 3FIGA 3HPZA 4CCEA 2A7RA 1VHNA 1I8JA 1AMKA 1HTIA 1KFCA 1GJPA 1WOAA 3ELFA 4IQLA 1LLZA 2HMCA 3MJYA 1FWTA 3DFQA 1VZWA 3P62A 4MFDA 5LNUA 2QUUA 1KA9F 1ZAHA 1EUAA 4M6PA 1THFD 2NUXA 3KVLA 1I2RA 1FXQA 4ICNA 1OF6A 2OJPA 4Q32A 4XQ6A 1OFAA 3PY2A 4NXKA 3S1UA 3CPRA 3OA3A 3T4CA 1A5AA 2IQTA 2NUWA 3W7NA 2VEPA 4O1BA 3TQVA 2ZTJA 4CQ9A 3WFAA 2TRSA 5DXYA 1KFJA 2GQAA 5CSSA 4XKYA 2VFIA 2Z2UA 4DBEA 1CI1A 1JVNA 5HINA 1FCQA 3UZJA 2ABBA 4AHPA 4WY0A 1T99A 3EXSA 4X9SA 1OX5A 3TROA 1QOPA 4HKPA 2RKXA 4G1KA 1LTDA 3W2MA 3O8AA 3LLDA 3EWZA 2CLOA 1SW7A 2OZ0A 1XCFA 3W86A 2ALDA 3W2JA 4JNMA 1T8XA 1IXNA 1X8FA 4MJMA 1MZHA 2JKAA 5G5IA 5AFDA 1JQXA 3UD6A 3CU2A 3W6YA 2FFCA 4AMAA 1VHCA 1ME7A 2GVJA 1XUUA 5DXXA 2JGYA 1LBLA 1RZMA 2DZVA 4E38A 3OEXA 1C8VA 3CM4A 3EKLA 4UTTA 4DO4A 1YTKA 2PRMA 2R14A 2QCHA 1YLVA 1W5PA 4OQVA 2NX1A 1YXDA 1DHPA 1TTJA 3L5AA 1R2TA 4L4MA 3UYCA 3WJZA 2WO5A 3I65A 1TQXA 1GVQA 2CLIA 3GKFA 4ZMGA 4NJHA 1KLZA 4N4PA 2QCNA 1SU5A 3NEVA 2YZRA 4XTDA 3IGSA 1OF8A 3DZ1A 1VC4A 4QISA 1ZY9A 2P10A 2C13A 3TCEA 3R13A 4JX5A 5IBXC 2AQWA 4UFLA 5HJLA 4IX2A 4UTTC 2EGZA 1SSDA 2I14A 5DELA 1M6JA 3LDVA 1C9DA 1K3UA 1TV8A 5FESA 1VLIA 2RDTA 2V2HA 3BK0A 1KFKA 3NM1A 1XBYA 5LNWA 2ATMA 1ZHAA 4U28A 2A6LA 4ZQCA 3S8HA 3SSJA 5D05A 2OT0A 3L5LA 2C1HA 3TSMA 4HNVA 3GXPA 4O54A 4H6KA 3TA6A 3TXVA 1YDNA 2JBMA 4MIMA 3FFSA 4TX9A 3DKLA 2A5HA 1L2UA 2EHHA 3QMTA 3EXTA 1U83A 5BW6A 2VFEA
chains in the Genus database with same CATH superfamily
1E9IA 1JCLA 1N2VA 5T9CE 3RLHA 4Q8NA 4UQCA 3L5MA 1UG6A 4BKNA 1KO0A 4XV0A 1JI2A 1LBFA 1QPOA 3BUVA 3R10A 3W7JA 3H7VA 1L8PA 4L4LA 2VO5A 3B9DA 4MY9A 3PNZA 3FYOA 1WDSA 4O52A 1QFEA 4YWIA 2X40A 3QOKA 4MWAE 5GJPA 4RNFA 1X8CA 1U1JA 3UU0A 4H83A 1UMLA 3N4EA 1MW0A 3VM7A 4PMUA 1SFJA 1MI3A 5CPOA 1YDVA 3PBUA 4AF0B 4K8EA 1Z69A 1ZCCA 4G7EA 4FZIA 3PJXA 3N15A 3N9SA 1Q6GA 4LUIA 1VFSA 2OPJA 1CGXA 3DI1A 3VKBA 4NZ1A 4XD6A 1KKOA 5I02A 1EA0A 4PL1A 1ZP4A 2E7FA 2YB1A 3GHTA 4JPGA 1GEQA 1WDDA 4K36A 1YW1A 2PFHA 2PU0A 3POCA 3F4WA 3W7PA 2Y70A 4MZYA 2DJLA 3IAPA 4I3GA 1Y0EA 3B4UA 4CD6A 3ZWTA 4YJ5A 3BAXA 2C3ZA 4Y8FA 4CU6A 1FP8A 1IT8A 3HMCA 4O19A 3D3FA 1HF6A 4F8XA 5C5YA 1BKSA 3F5JA 4TQTA 5G2HA 4MB4A 2V9DA 2EG6A 1W9VA 3CIWA 5FJTA 3WD2A 1JZ3A 3PPGA 4IFKB 4WVXA 3A5FA 5B7ZA 1Q3NA 1M04A 3IJIA 2IPFA 2J7HA 3BAYA 3N34A 5FEPA 2NXIA 4C7DA 1B30A 1PYFA 2VX7A 1UB3A 4NAFA 4CQ8A 1K6WA 4GWEA 4H8HA 3W7MA 1AW1A 4Q22A 3ZT7A 4XD3A 4GIYA 3U4FA 5ABFA 3TNOA 1XD0A 4AVFA 2WJZA 4YXGA 1IZCA 2Z0IA 3P7YA 5IM51 3GHSA 4MADA 1J2BA 4GA8A 3RK8A 3NEHA 4HMDA 5HANA 3SI9A 4AH7A 4ZFCA 4C6PA 4IT1A 1Q7MA 3IIPA 4QAIA 3TJXA 1WOBA 1P1XA 4GBUA 1NDZA 1QOQA 1J5TA 4M1BA 3LPGA 1D7KA 4KMQA 3G6LA 4B15A 2YDAA 4GVHA 5I78A 2ZRXA 3ITTA 2CBJA 4K7YA 2XIOA 5CAKA 3W01A 5KEZA 4HHHA 5A6KA 1XL9A 2Y1HA 3LERA 3P6LA 4DLFA 3RJYA 1SPQA 2J8GA 3FGCB 3NQBA 1GT8A 5ABEA 3GB6A 1AUSL 2HBXA 1YADA 3BJTA 4PTDA 2ZUSA 4DRSA 2WANA 1UP2A 4TIMA 2DEPA 2QCMA 3LB0A 3E3HA 4B91A 1E4LA 3ONCA 4ZXOA 4FS9A 1V6UA 4DBDA 3OU8A 2J47A 1P7TA 3SRFA 4UC5A 1ZS2A 3GC4A 2VZVA 1DJHA 1F8IA 3R25A 4LUSB 3V35A 3GH4A 2CITA 1PUDA 3S1WA 4A3UA 2C91A 2GWNA 2XZ7A 4GI9A 1W9DM 3JR2A 1R3VA 1X1OA 2OU4A 2PWUA 4GXMA 1BLIA 4JQ1A 4ZVJA 3QYSA 1OGGA 3W87A 2ZZ6A 4KWWA 4Z1AA 4FLOA 4GYPA 3MDUA 2XSXA 1W56A 4HIBA 2E0PA 5FI8A 3M07A 9RUBA 4XK2A 3RX2A 5CJNA 3AIWA 1S1PA 1A47A 2I57A 1VYPX 2XIQA 3FOKA 2XU2A 1V6WA 3FLUA 3R1ZA 5H8UA 3WNPA 1ONEA 1QNVA 2G3JA 3STCA 4GIRA 4AVOA 3BWWA 1XYZA 4W7WA 4UMCA 3H2MA 3NZ1A 4C60A 3N25A 5HR7A 3NQAA 3ZVHB 3ZS4A 3LENA 1PYMA 2V67A 4ZR8A 4QITA 4KEZA 1I2QA 3EDDA 4F48A 2XSAA 4CNNA 3W25A 3F5LA 1RQEA 2J9YA 5U4NA 1QAPA 4OFCA 3VCRA 1XINA 2YBUA 2Q09A 1ECEA 4WIWA 5A8MA 4AYGA 1EGMA 3CTLA 4JICA 3TXZA 1JDCA 2TMDA 3B40A 1KR1A 1XDMA 3TVAA 2ZZ3A 4LB3A 1FFRA 1ME9A 5D32A 3ZJ8A 1SJBA 4AU0A 1C7SA 1DKWA 3M7WA 3WEOA 2DZSA 5HNUA 1KM0A 4FMVA 4TVCA 3G1HA 5CSYA 1V6YA 4MPQA 1JCMP 1HFBA 3N3MA 3QQWA 4NJGA 5KETA 4M7SA 2FHCA 3W7LA 2DZXA 3FYPA 5JIPA 1XICA 4AHOA 3K4WA 1TWIA 4MNKA 1SGJA 2A1YA 3EX4A 1JG9A 1Q63A 1H5YA 1MXGA 1XKYA 4HZMA 4MKSA 2E25A 3PPCA 2GQ8A 3M47A 2OOGA 3O0KA 2FJUB 5CBBA 2QW5A 1N8FA 1LJYA 1TIWA 2AL2A 4PE8A 2BV9A 5FJRA 1LCOA 2LLEA 2BB0A 5KZMA 2X2GA 1HL9A 4RR4A 1UWIA 2BWGA 3FJ4A 4J7RA 2X05A 4XZLX 3UGRA 4HA3A 2WC7A 1QXLA 2WYSA 1EL3A 4IP5A 1Q6DA 2GOUA 1OG0A 1GOMA 1IIHA 5AHLA 3T0DA 2QUMA 1PX4A 5LZLA 5I3IA 2CFFA 3C2YA 3T0TA 4CD8A 2V5BA 3TIMA 1ZSXA 2F7FA 4R85A 2WMIB 3QLLA 2V82A 5HATA 5MF5A 2P8CA 1Z3NA 2C14A 4UTFA 1U22A 3QC3A 4QJ1A 3WH6A 4KERA 3RNDA 2R82A 3A21A 1S5TA 4M24A 2FTYA 2O4QA 1KGWA 4GVFA 1DOSA 1REQA 1WB0A 1IT7A 2PWEA 4JQ4A 2WZEA 3WK2A 4W9TA 6REQB 2QJHA 4IX0A 1HQTA 1HP5A 1VJIA 4A3YA 7REQA 2J8TA 2D0FA 4MDOA 4Y6GA 4AD1A 4P5UA 4B5NA 1PO9A 4X3ZA 2WZIA 5I06A 4AZ7A 4L80A 1RALA 1GEHA 4NAEA 3KX6A 2F6KA 4I9JA 2GDQA 1QPKA 4C5YA 1ISZA 3GLCA 5HBFA 1G1YA 1LWHA 2YSWA 5CKSA 2FDSA 4UCGA 1RVKA 3BO9A 3H2FA 2YLAA 2ZC1A 1IEWA 1LOQA 4Q3MA 3IJ7A 3T07A 2X16A 3W02A 3CO8A 1PZ0A 2PLKA 1XW8A 3PUEA 1KCZA 1GWJA 3WQDA 2Y4SA 3B8IA 3KCOA 5HQLA 3NQFA 5DCEA 4HNNA 1R9YA 2ZC8A 3C0QA 1EDQA 4QXIA 3UWYA 1Y5XA 3TW7A 5CLWA 1O7AA 1S2TA 3GNNA 1UPPA 3HU7A 1PWLA 1BWVA 1X96A 1PCWA 2OFJA 5A6AA 3K8KA 4AG0A 4IXHA 3A23A 4ZQOA 3DN5A 1DQXA 1QNRA 3T9PA 3HV9A 1EX1A 3SUSA 1VPQA 3ECQA 5FF7A 1AJ0A 1OCQA 3P82A 3OHIA 1MRAA 3PAJA 3P0WA 3GNDA 1LROA 4S3BA 3C8NA 3VDCA 4YN5A 1Q5MA 3PWGA 4CD5A 3A9IA 5BRPA 3RCNA 4JTAA 4NRRA 2QDEA 4DJFD 1I75A 4IICA 4ERAA 2NLYA 2DZUA 1JR1A 2ZUUA 1TPC1 3SQLA 3UCDA 3OYZA 3AOFA 4W8BA 1XS2A 1MW3A 2VQUA 3U2ZA 2NV2A 3M5YA 3RHGA 3Q58A 4H4IA 3U3HA 5LHFA 3UPBA 4GI6A 1GYMA 1KXVA 4H9TA 1UW9A 3ARQA 3SRHA 1J4EA 3QXBA 1DJXA 1E9ZB 2YCKX 3DBNA 2RGMA 4HNCA 3KBSA 3SFKA 5D9MA 4ADUA 1V3MA 3TQKA 3PJWA 3UQNA 3W71A 4UOQA 1Z48A 1F3TA 2DQWA 2W67A 4DO5A 1K7EA 1X39A 3BC9A 1UC4A 1JUBA 5D33A 1ZALA 1FH9A 4IPNB 1MUMA 1R38A 5AYBA 4M1RA 4MPKA 1QVBA 2ISDA 4REQA 3N11A 1AJ2A 1NDWA 2QPSA 4S2CA 3KTXA 1H0GA 3ARSA 4JFWA 1KM3A 4YL2A 1AODA 2R1NA 4K2SA 1JRBA 4MAVA 4DAIA 4NZ4A 4IFRA 1CW2A 4QE1A 5I3FA 4UTWC 4QRNA 4DJED 3UY8A 1X6LA 4PSPA 5KITA 3QGAC 2DH3A 2ZZ7A 1F07A 3HJZA 3BQ6A 3UVIA 1HGWA 1TE6A 1MUCA 3GVRA 4WGXA 5EU9A 5CSRA 2PMQA 4QS6A 1M1BA 3P5ZA 1POJA 4MNLA 4NXSA 4Z42C 5E93A 4RZ6A 5SWUA 3W24A 3CL8A 4R34A 3S3GA 4L56A 4GI8A 5A3HA 2PU1A 3QPEA 4PH6A 4JN8A 2GUYA 3NPWA 4IGHA 3CEUA 2DZBA 1UA3A 3UCQA 4DB7A 3NQ8A 4L9ZA 3A3XA 1QBBA 3KRSA 3EYPA 3TWBA 5KZ6A 2D22A 3EPOA 3GG1A 6TAAA 1JGIA 2WHMA 3KEHA 3NDOA 2VOTA 4MWAD 2GGGA 4F0RA 3UXAA 2W6RA 4IMCA 4MLJA 4JN7A 4ZGYA 3AHVA 3MT1A 2A0NA 1CNVA 3N6JA 3RR4A 5IFPA 3NSNA 5GJNA 3P8IA 5HNNA 3B06A 3PFMA 1EGZA 3NIYA 4OOUA 1QPNA 3ABSA 2QF8A 3GUWA 6PTDA 3KOWA 1KFLA 4N42A 1EHAA 2PE4A 4A6GA 3UJ2A 2WZTA 1HG3A 1T40A 3AMGA 4I9MA 3REQA 3XINA 6TIMA 3UESA 4RZBA 5I7GA 1DTUA 1G5AA 1UZDA 3E5PA 3HM7A 4XO6A 2PSNA 3LNPA 4I6VA 4FLQA 3DXIA 1IWPA 2AQVA 4FNSA 1WAWA 3TC3A 1SJCA 4CN4A 2HZGA 2Y8VA 1RAKA 4DPQA 1B4KA 3QR0A 1WV2A 1NTHA 5AHNA 2WB5A 1VD6A 2J6VA 3VNZA 3ORWA 1OC7A 2Y5JA 3QW3A 1GVOA 1W32A 2QXWA 3H6OA 3B3DA 1RP9A 1S2WA 3VUPA 3IIOA 4LT9A 4PUKA 4IMDA 3TLLA 3ANYA 3OYXA 4XISA 1GJWA 3M41A 3FCPA 1E6XM 1KQYA 3S5NA 4PMRA 1JPKA 1DTNA 2PP1A 1W9UA 1GNXA 5BYWA 4U3AA 3LBCA 3W82A 3NDYA 3VMPA 3WF0A 3UWWA 4LV4A 3PS7A 2VDHA 3V1HA 2E6DA 4PMVA 4FNUA 3N3TA 3PZNA 5M3WA 1KRAC 3DGBA 3GXIA 4L9YA 4UOZA 1H7OA 3HPSA 4F0MA 1RK5A 3GXDA 2YDQA 3S83A 1HUVA 3P93A 3AI0A 3M44A 3WQCA 1CBGA 4XD4A 3V36A 1V6XA 2FGBA 3K1GA 2ZRWA 1W0MA 5EBAA 2YW4A 3W3OA 1F76A 4JHOA 5FF2A 4MOZA 2V69A 4LS2A 4H9UA 3WL0A 3EPMA 2Q6ZA 2QMJA 1WXZA 3R0KA 5H8MA 1JF6A 1CTNA 3MI3A 3APGA 5I3KA 2Y7GA 4S3GA 3FN9A 3AXXA 3RUBL 1WP6A 3AXHA 2ACSA 4Q33A 3W75A 3VGGA 1PKNA 2R8WA 3W72A 2XGBA 2OYMA 1JFXA 3MY9A 2HQAA 4MAZA 1W1PA 3I4EA 4AHQA 3P81A 1NWTA 2CWXA 3OIHA 4BI7A 1Q7ZA 2CZDA 3WLLA 4ZEPA 1XIGA 5G4WA 3UG5A 1BD0A 1E6QM 2FKPA 3DG7A 3OVRA 5AB3A 4ADTA 1LP6A 1TUXA 3TEVA 4DY1A 4Z1DA 1W5NA 3MB9A 2D3LA 2VL4A 3CHCA 2MANA 2B81A 2P0OA 1FWSA 3L4TA 3WDPP 3EMZA 3WQOA 3BQ5A 3O07A 4IMAA 3HPFA 1F7BA 4MTVA 3GXTA 3VIMA 3NYDA 5A6BA 1QO2A 4MF4A 1PS9A 5A8PA 3R11A 3BG9A 3QV8A 2WBGA 3C2VA 3P2VA 1XYCA 3IARA 1OFBA 4JKLA 5D04C 1J6PA 3O6YX 4GZ7A 3OJGA 5CC5A 2VR5A 4F9JA 1L6YA 3R6IA 2CHOA 4K7VA 4MVAA 4EOUA 5HULA 4QQUA 2E68A 4WGHA 5AYZA 5ECVA 2QF7A 4GXWA 3V0SA 2QR6A 3G18A 3TSBA 1GZ1A 4D6JA 1GOOA 4E2DA 4EPDC 4HB7A 2INZA 1V0LA 4GUJA 1FQ0A 4TVDA 3OVPA 2VRKA 3HQ1A 2D2HA 1JDFA 1ZAJA 4G6CA 1QATA 4TX8A 2BTMA 2NX9A 1AD1A 4N9EA 2E28A 5DBTA 4AC1X 2Z2AA 4CLMA 4FNPA 2W66A 5CCZA 5CZSA 4HU3A 1F9CA 2TSYA 1KW1A 5C7HA 3U7BA 5J5DA 3DEQA 4WZHA 3ARVA 1DXEA 4A8LA 1PDYA 3CB8A 4O0ZA 4IMFA 3BOFA 2PP3A 2WPBA 4UWMA 4AZHA 1V7YA 2QV5A 3WLNA 1JZ5A 2FH8A 4MYXA 3LUTA 2AMXA 2DU2A 3A13A 6XIAA 2YDSA 5A8NA 3MA8A 1P0BA 1H09A 3EA2A 1N8IA 4NJJA 4QSHA 2HVNA 2VP8A 1Y5VA 1TTPA 5LIXX 4S39A 5I3HA 2OOFA 2E9MA 3TDFA 5D8ZA 3R12A 1VJZA 2Y7EA 3HQNA 1A5OC 4E8GA 3HZ3A 1UWUA 4NI8A 1CX9A 4O10A 3NZRA 2OX4A 1F6PA 3NXLA 3I7RA 2XM2A 1OABA 4F2UA 1GKPA 1E1EA 3THQA 3TN3A 3JW7A 3NTYA 4GUGA 2G96A 2ATSA 1V3LA 8XIMA 4LBSA 2X1UA 1PTDA 3S5YA 2QCLA 3MC5A 1VGAA 1W3JA 1TJRA 4B2DA 3WF2A 3ITLA 3C0LA 5DN1A 4YPJA 4A3HA 1DWFM 1BXBA 2OR2A 4GKTA 2X1IA 3TTOA 4J3SA 3S1GA 1XR2A 4B9YA 2VKZG 4GY1A 1Q13A 3LRLA 3BLPX 1OWQA 1LDCA 1V0NA 3LV5A 3UZZA 4HPHA 1Q45A 1KTNA 1XIBA 4H6EA 5F7UA 2O92A 1CLKA 2HRWA 2FQIA 2QT3A 2HNEA 1RA5A 1QI0A 4MB1A 3BGAA 2YCLB 3VE7A 2ZDRA 2XN2A 4V28A 1JNEA 3ARRA 1PKYA 3ATZA 1UZHA 1CYGA 1C8QA 1MRQA 2Y0FA 4RNIA 3R4IA 4UCFA 4QCEA 3K13A 1UR8A 3B8UA 4LF2A 4K8GA 5HWMA 4H7CA 5EPDA 1TR9A 1ISYA 4UTWA 1V02A 3MQTA 2GUBA 3E0VA 2XIMA 2I5GA 2E8YA 1QW9A 2FDMA 4YHEA 3HGOA 4Q7NA 3THUA 2WCGA 4B5SA 3EWUA 1EPXA 3E6EA 3ITXA 3SFWA 3NO5A 1XLFA 5G2WA 3LPPA 3P74A 3USBA 5I24A 1JD9A 1E4IA 3AC0A 2O56A 4ZOBA 1V8EA 5FEXA 3P3BA 3DESA 2OT1A 1D8WA 1JCJA 3MHGA 4H2CA 4KCUA 4TMCA 3BJFA 4F2BA 2CHNA 1XPGA 3RMJA 4G2DA 4C91A 3WYZA 3LMYA 4XZNX 1R2SA 5AVHA 3LHTA 3WUFA 3G0UA 3UG4A 5LNSA 4EACA 4KEVA 3QHNA 1OX4B 3A3HA 1SZRA 4NJIA 3BH4A 1IGSA 1SJDA 4ZZ9A 2PI6A 5AYIA 4HYRA 1S5WA 3WFLA 3VFCA 1JZ7A 1G7VA 2WSQA 1MNZA 3SN0A 4PTXA 1GQLA 1ZL1A 4O1DA 5AZ0A 4HBKA 2VD8A 4E4PA 2X09A 1LL4A 4QLJA 3WG6A 3A4XA 3I68A 1OX6A 2BASA 3WK3A 1GVSA 4IFOA 2X0HA 3UVAA 4UFIA 3T1GA 1LUCB 2ZYFA 4HPNA 3RAOA 5CEWA 2F6XA 4LV9A 2J88A 4IPIA 1G0CA 3KS5A 5IRPA 3MUXA 3ARPA 3TWAA 2A6NA 1DIOA 1PIFA 3M0JA 3LCXA 4AEEA 2WW5A 3NR0A 3UA3A 4WOQA 1GTEA 1VFMA 2OLSA 4C6NA 2VD9A 5D9PA 2GJNA 3W7KA 4K8HA 3W7IA 1JPMA 1GZGA 2INFA 4HTBA 1CWYA 4ZQNA 3VGBA 3H7RA 2FH6A 2FPVA 1B5TA 2TYSA 3VZZA 1G4EA 5G4HC 2KAUC 2DSWA 1HP4A 2IKGA 3TTEA 1NFBA 3WNMA 4GKLA 1QNSA 3M46A 4G1NA 4HA1A 3RMEA 4LRTA 3CB3A 2ZZ1A 4F0SA 3IACA 1FH8A 2D3NA 4V27A 4CU7A 3CASA 4ENLA 4WY0B 4ACYA 4TU1A 1V3KA 3STGA 4GCXA 3ZR4A 3WJYA 4I5XA 3CHFA 2DJXA 3WQFA 3Q45A 3N1AA 5D2VA 3KDOA 3VIPA 4AQLA 1XBZA 4WKHA 2C0AA 1A5SA 5L6UA 2ESCA 3VE9A 4IQEA 5DLCA 2HPMA 4X2PA 3VOJA 3UF9A 3ALGA 1C93A 2DSVA 4V15A 3CIVA 4S1FA 3T7VA 3TN4A 3AUJA 3QZEA 3U0HA 4DWSC 3EX1A 1XIHA 3W2KA 3N29A 2ZIDA 4NZ5A 1Q8AA 4IP4A 1UKPA 4Q4SA 2G3FA 2WNZA 4I8YA 2NUYA 4E3TA 3I3DA 4IUGA 3GBEA 4MJ4A 3WCZA 1Z89A 3VA8A 3RM4A 4JTKA 4DZIA 3IUIA 4AY1A 1M9HA 4ZO7A 4J27A 3VIOA 3N2OA 1KRMA 1WZLA 3PJUA 2XHYA 4IFKA 3QV6A 3L4XA 2CLKA 3W1PA 1FUYA 4RE0A 4OBRA 5TD4A 1SUXA 3U8GA 3WFZA 1KCLA 2VFDA 1I60A 1IEXA 4O1FA 2GVEA 4IPPA 4LUJA 3MWAA 5DMNA 3QJAA 4O57A 3LGGA 1UOKA 2OQHA 1S3HA 3AXKA 1O5QA 2WVVB 3R58A 2AGTA 4PTWA 3F2DA 3GK0A 1RH9A 4XAYA 3WBYA 2HJPA 2GZXA 4J3VA 4GPNA 5CGQA 1JZ4A 5C71A 2DZAA 2C16A 2YX0A 1ITXA 3WD0A 1P6WA 1H4PA 4GYFA 3KM8A 1CLXA 3B0VC 4J3WA 3TR9A 3F4DA 4KGJA 3CWNA 2YCJA 4UMAA 1JDAA 1Z6KA 1TREA 2BODX 3OVGA 3IK2A 1K7XA 5E6YA 3EEGA 3UEQA 2X1TA 1MW2A 1GJPA 1LWIA 1LLZA 3WO8A 4L4PA 3RILA 2QUUA 4M6PA 2EPMX 3PHAA 2PTDA 4JNZA 3W7NA 3BURA 3GVVA 1TWZA 2VEPA 2TRSA 4G7EB 1KFJA 3A9BA 1BXNA 4XKYA 2DV0A 2GOKA 4WLCA 3UZJA 4G5DA 1RBAA 1R8LA 2ABBA 2F6UA 2WCAA 4X9SA 1QOPA 3IJ6A 1U5VA 4LUSA 3W2MA 3CUHA 2EO7A 3L12A 3S2JA 1TZZA 1CEOA 3WLKX 1XH0A 4XZWA 1BG4A 3AU2A 3O8AA 3EWZA 2GGJA 3ZR5A 1KRBC 1XCFA 3VGEA 2QMKA 3GG7A 1IXNA 1X8FA 3HQOA 2JEQA 2JKAA 1JQXA 2VZSA 3TTSA 1BQGA 4NSBA 2WNWA 1ME7A 1RZMA 2DZVA 5BCAA 4E38A 3OEXA 4DO4A 5FJUA 2WZHA 1YTKA 2QCHA 1YLVA 1HJWA 1R3WA 1YXDA 1DHPA 1R2TA 3VKAA 1MDRA 4JTCA 1TMLA 3UYCA 1TQXA 3ANUA 4D6IA 1KB3A 2Q02A 4U5KA 4LQ1A 4A8NA 2Y5EA 1HT6A 4N4PA 5E6ZA 2QCNA 1SU5A 3NEVA 4GNKB 4B5VA 1IGWA 3DZ1A 4QISA 4PMOA 2VYOA 3KE0A 3MV01 2ONEA 5IBXC 2C1IA 1NJJA 3E1F1 2CC0A 5DFAA 4WSJA 3OGSA 1M6JA 1C9DA 1K3UA 5ABFB 3IGHX 4TXEA 1B1YA 2A6LA 3CYVA 3RG6A 1O68A 2OT0A 1H3GA 2C1HA 1MQQA 2A3LA 2UZ9A 4H6KA 3GSMA 3NO1A 1NOWA 4D72A 2JBMA 5GPRA 1JYNA 3NZGA 1L2UA 1A49A 2EHHA 3BTNA 3QMTA 1W1VA 1UHVA 1A80A 2VFEA 4JTUA 4AZ5A 3MVIA 1UWAA 2PPGA 4FX7A 1K77A 3AS3A 1UIPA 4DIAA 3LBOA 2EQDA 3B8DA 5DCDA 2NV9A 1ICQA 1PPIA 1W1YA 4GY0A 5AC6A 2VCCA 4S3AA 3G22A 4GQBA 1QDSA 3QBUA 2EAWA 5LIKX 2CKSA 1IEQA 3PPHA 3T2OA 1YDYA 3VZXA 1FWCC 4GX9A 3L4ZA 2HVOA 4WK9A 3E5BA 1AL7A 3GO2A 1TMQA 4ZBCA 4KWVA 1CGUA 4QIUA 1PHQA 4XB3A 3HIJA 1ONWA 4ORIA 1J10A 3KBNA 4GIEA 4MB5A 3W1RA 1FWEC 5A8OA 3WKZA 1RPKA 2XH2A 2YA0A 1XLDA 4KWOA 3K8MA 4L65A 2J27A 1PX8A 4UQBA 1QWKA 3OZPA 3E9AA 5K9XA 1FCBA 2XH4A 5AC4A 3M0LA 1R86A 3CUIA 3B9AA 4YHGA 4O1CA 2YGYA 3LEPA 1AMYA 1DYSA 1OC6A 1LORA 1H1NA 1V6VA 3A3WA 9CGTA 3EOSA 4FALA 3AWOA 5FA5A 1WUFA 5EY5A 1XIMA 4ZQRA 2E67A 3R5EA 5GVJA 4GINA 1QHPA 5JBFA 5AN7A 4KFNA 6REQA 4WJ8A 1ADOA 4OVXA 3KVKA 1YXCA 3P5YA 3QV9A 3KTCA 1BVWA 3FHAA 5LKYA 3AZTA 1J0IA 2HNHA 1US0A 3KL0A 4NNBA 1IZKA 3B03A 1P48A 1A3XA 3AHTA 3IANA 5ECUA 3K1DA 1VCVA 4AWEA 1W3LA 1QPRA 1CB7B 4WX2A 2OQYA 5U7SA 1E70M 4OZOA 1KXTA 3AWNA 6A3HA 1UUOA 2RDXA 3E2VA 4LAUA 5B80A 3TLQA 1YRRA 3W0KA 3IGUA 2I16A 2TAAA 4N02A 1R47A 3K30A 3BJSA 5XINA 2PGWA 2PS2A 1DV7A 4PMYA 3HF3A 4NYUA 3BGGA 4ATLA 1EXBA 3BLKA 3DFPA 3CWOX 3IVUA 5C54A 4Z17A 3NQEA 3CZGA 4DJDA 4PFMA 1ALDA 1W5QA 5IOBA 2Z6IA 1R3YA 2D23A 4WSKA 4PUNA 1MW1A 4IJBA 3NZPA 4LCSA 4XIMA 2NWRA 4HU0A 2PC4A 1GVYA 3VD3A 2QUTA 3PTKA 3LA4A 1E0UA 2OZ3A 1XYFA 5AC5A 1HKJA 4I7VA 3OODA 3N73A 3AYSA 2AL2B 4QFUA 4LWWA 3GNRA 4CQCA 5BXRA 3OHMB 2C7FA 1Q6OA 2PTZA 2QNEA 2BXZA 2CLHA 1M3UA 4CQAA 1HIZA 3CEPA 3CHDA 3GH7A 4D71A 5FL0A 3EWWA 4H9ZA 1BSIA 5EMUA 1UQYA 4BF5A 5H6HA 4LC6A 5FF0A 2J4GA 3TFXA 3SO7A 1YYAA 3NQ2A 2H9AA 5IXEA 1LG2A 2J7BA 1SVDA 4AY7A 3EKZA 3XISA 3WBXA 3S4TA 3TU9A 1WZAA 1GVEA 3SGZA 1FBAA 2A79A 3S6OA 1WDPA 2CEQA 1XLMA 5D8WA 3BAJA 1FDZA 1WZKA 2FTWA 2QIIA 3BOXA 3DCPA 2GK1A 3LTPA 1CLVA 3R0UA 5JH1A 1XXXA 3DC8A 1QMLA 2GPTA 3NM3A 3ZO9A 3M5VA 4BHYA 1VYRA 2XM1A 3GS6A 4YWSA 1FWHC 1D3CA 5KTLA 4A4AA 1V3HA 4LVGA 2XIJA 3B8WA 3O6DA 2PD5A 1XQLA 3WLQA 4Q8TA 1K8XA 4D6HA 4O28A 2Q8XA 3ZLFA 3L66A 1GJUA 3KOYA 3H8AA 2VXNA 3CQIA 3WMBA 1UROA 2QCEA 4I6KA 1GZJA 3LCIA 1K1DA 1Q2SA 3AHZA 3ITYA 4FXSA 4DYEA 2XVKA 4GZIA 3TZNA 9XIAA 4S3EA 5K2ZA 2CZVA 3TYDA 4RV3A 3DKJA 4HGXA 5GQBA 1ZCOA 2D2JA 7ODCA 2NQ5A 4M0XA 2F84A 1TWDA 1Q6LA 3G0SA 4UR7A 4HPGA 2JKEA 3GAYA 3RCYA 2X30A 1EC8A 7A3HA 2XYLA 1XDLA 2QV4A 2UBPC 3QTGA 2J13A 3E2QA 4A29A 3AIBA 1PTAA 1EDTA 3KRZA 1RBOB 3UG3A 4KBXA 1V02E 1PV8A 2UV8G 1I9CB 3PZTA 1P6CA 5CZKA 4KRUA 4O8RA 4PYSA 1RQBA 1UR3M 2D73A 4ECLA 4YTSA 3CUGA 5BXSA 3PUGA 3VILA 4LW7A 4JEJA 5KZEA 1HN1A 3EDFA 3T08A 3EOOA 4B4FA 1V4YA 5FEZA 1OFEA 4H41A 1MSSA 4S38A 1QNPA 5IDIA 3QM3A 3ZIZA 3T2QA 3AMDA 3H26A 1G67A 3WQ6A 2NQLA 1RD6A 1R87A 3MSDA 2V0TA 4DQWA 3MBFA 1E5JA 4CNTA 5K4XA 2QHAA 4GZEA 1HXJA 3T8QA 4FB7A 3WLSA 1ZENA 2GQ9A 1RLCL 1SSGA 1US2A 4K1GA 3N6QA 2WSKA 4JIIX 2OG9A 3FA4A 4O53A 4GMEA 3RPDA 3R7MA 1B54A 4AZGA 3FVMA 2WJFA 1A5KC 1TV4A 4JIRA 4XD5A 1FA2A 1HKMA 1V3IA 1JYWA 1J2WA 2CLFA 2PDIA 2F9RA 3CL6A 4O11A 3VNMA 4UQDA 5IBXA 3CZLA 2FLIA 3LPOA 3L0NA 1I6NA 4PBGA 3LD5A 4X9YA 3NPXA 1QHZA 1C92A 3W7DA 5LXEA 4REQB 4GC4A 1I4NA 2VOMA 4M5PA 1H0IA 3EGJA 4H9YA 5HA7A 1H62A 3T78A 1QBAA 2R94A 1UYQA 3DG3A 1ZQ5A 4W93A 1UKTA 5JH2A 1HGYA 3RU8X 1E15A 1XUZA 3QF0A 5EYWA 2WKGA 3VIIA 4J2PA 2I9EA 2YA1A 2FZ9A 3SGGA 1XF0A 3H7UA 3J7HA 1EOKA 2D1ZA 1XGEA 2NW0A 3WLOA 3NL5A 5D2XA 3I3BA 4FR1A 2GDUA 3GDKA 1TPVA 3TYAA 3VU2A 3VOFA 2XFFA 1EP2A 3G1DA 3W70A 4R5EA 2Y88A 1E0VA 4AFYA 2Q71A 3F4CA 4FXFA 1M7OA 3MSRA 3WNOA 3QZ6A 2H6RA 4F0KA 5BRBA 3EWXA 1TV2A 1ZB5A 2PWHA 4RUBA 1SYTA 2CZEA 4O12A 2WSYA 3UR2A 3FKRA 4DN1A 1T41A 1JCYA 4LCQA 1GOQA 3L0KA 3QYQA 1CXLA 4DI9A 1NQKA 2GGIA 1FWRA 3NGJA 1W2PA 4GE8A 1W1ZA 1SW3A 4ZO8A 1GG1A 3FSTA 3CMFA 1E40A 3ZJ6A 1QT1A 5TBOA 3MHFA 3TOPA 3AFBA 3VD4A 4XSMA 4R9OA 2H8XA 4DYJA 5DRCA 2Y7FA 1NU5A 2C18A 4EAYA 4AXKA 1YKWA 2D24A 3C2EA 4N4QA 1PE1A 4FAMA 2V81A 2VVNA 1B3WA 1ODZA 1OK6A 1CGYA 9XIMA 4XAPA 2KZHA 2ABAA 1EJUC 4XZHA 4CCZA 4QR6A 1TPH1 2HK1A 1XJBA 4DNHA 3SQMA 4C6FA 2HS6A 4M56A 1OCNA 3VO0A 1XRVA 3W7CA 3NQDA 3TH6A 4ORMA 1XLIA 4QQ3A 3SCVA 4OBTA 5AYXA 3GIPA 3B9NA 2O0TA 2TODA 1J93A 3SUVA 4NILA 3PG9A 4GK8A 5BOFA 3GE7A 3KL5A 1TUFA 1WX0A 2PAJA 4EF9A 1TTQA 3LMZA 3GHRA 5BMWA 3VDAA 4Z1BA 1TRDA 1UBPC 2E1WA 3LI1A 5C9UA 1SR9A 4BA0A 5C9ZA 3Q65A 1OGSA 1IR2A 1VEOA 4LS0A 2DSKA 3NL3A 3WENA 4LGXA 4I7UA 4MFEA 3L21A 1GPWA 2V68A 5BXTA 4IMEA 3CUZA 2E77A 3LCWA 3VKCA 2VUNA 1DJGA 1OBAA 1EO5A 2VHLA 3C4UA 1Q66A 4FOKA 1RY8A 1UD4A 5C7VA 1KWGA 4PMZA 5A8GA 2Z7GA 3CAKA 3O16A 1KRCC 3FAWA 4D6EA 5IHRA 4WUIA 3SCWA 1H51A 4LOCA 3GTFA 1YTEA 3BAWA 1WZMA 4JYEA 1IEVA 2VX5A 1UR0A 3QHOA 1P0NA 1L0PA 1ZBVA 2BLEA 1IXQA 4UQAA 5C70A 5HWJA 4F79A 1K7FA 2VEMA 4JFVA 2DVUA 4E8DA 3S9IA 4D6DA 4DJFC 4LUTA 4H2HA 2R24A 1OYCA 1WDRA 1VBGA 1KXQA 5JBDA 4V1YA 3N18A 1B3YA 3T2PA 3GR8A 4J3UA 3AZRA 2VX4A 4Z0JA 4XTIA 4CEXC 4KIEA 2J9XA 4O1AA 1DJYA 1LRNA 2NVDA 1W5MA 4KEUA 1EBGA 2MUCA 1IEIA 2VFHA 4O13A 1B3VA 4XX6A 5CZ0A 2E4TA 5AYYA 2H90A 3WQ8A 2V2CA 3CAQA 4RJEA 2E40A 2VJXA 4OIFA 4JIQA 2EPKX 1VB9A 1IE7C 1EB3A 3A22A 2FTPA 4IUOA 4RW5A 3EB3A 1JDDA 3URNA 3QPZA 1BTCA 1JZ8A 2GJLA 3PANA 3CUFA 3BLLA 4MUZA 3TONA 4EAMA 1FDYA 4UTLA 1R30A 1QTWA 2CW6A 3EWCA 2QAPA 1KM4A 4O1EA 5A8QA 3GZ3A 3CZKA 4O0KA 4P61A 1UPMB 4DJEC 3ITGA 3F03K 2EPOA 2C0HA 5EFDA 3K2GA 4ZQPA 4AEOA 2Z26A 4GRSA 5HJXA 2E5CA 3DBPA 2IKJA 4WXZA 4XUGA 2WWDA 2OMAA 2Q3OA 5DEZA 1P4CA 1TZ7A 3E0LA 1GHRA 3ABQA 4C5ZA 2DIKA 2XJ7A 1NELA 1UR4A 5LIUX 2ZX5A 5EA9A 3W22A 1O1HA 1XG4A 3RU6A 1OX4A 2Q01A 4BI6A 3RM9A 1SW0A 1XC6A 1GQKA 4CN6A 3W4RA 4GY7A 1E0XA 3APTA 4WKFA 4EPBC 3HA1A 1A4LA 4MWAC 5D2TA 3TR2A 3WX7A 1FWIC 1SFTA 1H41A 1PKMA 2A21A 2GLKA 2PGEA 5KMYA 1VBUA 4NX0A 1ZP3A 1ZBCA 2QGHA 3S9ZA 2WJEA 3KXQA 3IJDA 5FIPA 3TMQA 3E38A 2ZWYA 3VOIA 3BW3A 4JTTA 1K8CA 2VEGA 4BQ3A 1LUCA 4KT2A 3W6MA 2Z2BA 4BF9A 3EX2A 2BHZA 1S39A 1VFUA 3FV9A 1VFOA 4C7FA 2C6QA 3OGVA 3T05A 3DFNA 2Z1KA 4ZTYA 2PLJA 5FF4A 5I09A 3H2NA 3M0MA 4DLMA 2R1MA 4JNYA 1Q7QA 4ZE5A 3ZVIA 1Y65A 2YIHA 3Q4DA 3EOEA 3LM3A 3ITOA 2PDCA 4PCNA 3P80A 3AXMA 4R33A 4M7TA 1XH1A 4J4KA 1AQFA 3W7EA 2YJQA 1CECA 4BK9A 3SN1A 4B4HA 4Q6XA 1KR0A 1A5NC 3MANA 4ICCX 2G41A 4B5WA 4QLLA 4RE3A 2BGNE 1FKWA 3HFYA 5EMLA 1B3XA 4Z2LA 4B2DD 2XISA 3TAOA 1UOZA 3APYA 3LZ5A 3CIXA 4UQEA 1I45A 3W1XA 3MV11 3VNJA 1JCNA 4DZAA 1PCKA 1UJPA 2WPGA 4GOAA 3FAXA 3M0HA 1F4HA 3COTA 3SECA 3TQ0A 5C0QA 1A4MA 4KFPA 3QLDA 4Q7IA 2NLIA 3B05A 4L4OA 1SZNA 2CBUA 2WMFA 1MZRA 4IGSA 4EE9A 2QAFA 4QTGA 3CC1A 3G1VA 1F74A 5FKYA 3GZAA 1LBMA 2VWTA 1EP3A 1G4PA 2O9TA 3SQSA 1BTMA 1PKLA 1CXIA 3H4WA 3HN3A 1O60A 1DEDA 3DG6A 3QR3A 2A4AA 2BY2A 3PZQA 3U48A 5E0FA 3MCNA 2OTDA 1F4AA 4AZIA 3LTYA 5EKYA 4HSNA 3U57A 1C29A 3TK7A 4JIEA 1QJWA 4XWUA 5FF3A 3WNKA 5XIMA 2JQXA 3RX4A 3ERPA 1TPEA 1JRCA 1W17A 3URQA 3UWVA 2FHBA 3VMNA 5DMLA 4HSHA 3UWEA 1V51A 4DZHA 2VZOA 4V33A 4HZ7A 4QEHA 5D4YA 3S5ZA 3NSXA 3EA3A 2IPJA 4UOJA 2B31A 2EPNA 5H2ZA 2V6AA 3JS3A 1E72M 4GH1A 2J78A 2ZUMA 3GXFA 4LYPA 1RVGA 4BF7A 1G01A 2VC9A 4DVOA 1HW6A 3RITA 3QPYA 3OP2A 2OX1A 4GUIA 1VRDA 4JY9A 1J9YA 1XSIA 2ZFAA 4IOTA 1XBXA 5RUBA 1MDLA 3CMJA 4AC7C 4X60A 2EKCA 1ZPTA 2YCEA 1A3WA 5A95A 1ISXA 4HN8A 1UD8A 3UPMA 3ZYZA 3KHJA 3RDKA 1Z32X 1VR6A 3SIMA 4JQAA 4F66A 1SO5A 1EOMA 4LC8A 1DQUA 1XYBA 3UR8A 2AMGA 1NFPA 3TTQA 3S6DA 2PDXA 4HOZA 4OTKA 1DWHM 3UNDA 3PJTA 3PK7A 1XM3A 1ME8A 3SRKA 2ZA2A 1JZ6A 5CG0A 1O4UA 1OK4A 2QUVA 1XGZA 1SM9A 1GQNA 2Y62A 1KBIA 3CQHA 4PL2A 3RLUA 2DGAA 1EIBA 1UBSA 3PZVA 5CC6A 3A6OA 3M0ZA 2F8QA 4TUFA 3A64A 4BFAA 4W87A 4FPSA 3TE9A 3RM8A 1JYXA 2Z25A 1UP3A 1JPDX 4UFMA 3VNYA 4HU4A 3F4VA 1XCWA 1S2CA 3I7SA 3FS2A 2DSZA 4GNJA 2ZA1A 3N4AA 3S5SA 3NGFA 3PB0A 3KWSA 2NXGA 3NXFA 1PDZA 1TELA 1F6KA 1RCQA 1T5AA 4E4UA 4LS1A 2WNQA 1Q2RA 4N6FA 3KBVA 2IMRA 3C8FA 3CT7A 5CQ1A 3QQ0A 2BFGA 3P60A 2GGEA 5DY2A 3TX9A 4DPPA 3MZ2A 4H9VA 3TMLA 1TFVA 4N6EA 4NYYA 3UR5A 4H01A 5I79A 1A50A 3THDA 2DPEA 4OV4A 1JJKA 4NKCA 4H04A 2YL6A 2ZX8A 5F1UA 2ASHA 3OLIA 2PEVA 1AZ1A 5GNYA 4KF1A 4K39A 3PC0A 4EIVA 1VH7A 2CKRA 4EXAA 1QW8A 2JIWA 3MKKA 3TKFA 1YIXA 8TIMA 2EPHA 1BYDA 3TN5A 3LLFA 5JIWA 4HZ8A 2VMFA 1LLWA 2DW6A 3GDTA 3UY7A 3H55A 3UP8A 2GL5A 4LJ3A 1BWKA 3VDHA 1Q6FA 5TAOA 1GVRA 2J75A 3HGSA 1P1MA 4IP7A 1ITQA 3ARXA 3VGFA 1G4TA 4ZXLA 1BRLA 3WQVA 3OO2A 5AVNA 4XZ9A 2OGYA 1QPQA 3WK1A 2NQHA 2XVNA 4XZIA 1EXPA 2FZ8A 4ZB2A 1PAMA 3AQUA 3FJ6A 5FJPA 3R8GA 3ZXWA 4J3TA 4PUDA 1NDVA 2PDUA 3H24A 4FA3A 1ICPA 1U1UA 5AHEA 4AD0A 1QK2A 4XKYB 1M53A 4DF1A 1GVFA 1DIEA 2OSYA 2UY2A 3KUMA 3RRAA 4E8CA 1C8XA 1R3QA 3U4AA 4XBKA 4AIBA 3MI6A 3OZMA 1E6RA 3GAKA 4TV6A 4QEEA 2JIEA 1DJIA 4U33A 4AIOA 1NP0A 4QG8A 4PRRA 1WA3A 2YYTA 3O63A 1I1WA 1J79A 2V30A 1HKWA 4C1LA 1YHTA 2ADAA 1X38A 4Z0SA 1OJXA 5ABGA 5I5RA 3MW7A 4CNUA 2J7GA 1J5SA 1W91A 1CGTA 2QVNA 4WDTA 1D2KA 3KTSA 3UA4A 2HBVA 4PUWA 1HO1A 4K6AA 3AIUA 3GFYA 2GVYA 2HV5A 3T81A 1RR2A 3QKZA 3EOLA 3QFEA 1QUMA 5A6MA 2O7QA 3AS2A 1PBGA 3AUOA 5H8PA 1HKKA 1VLWA 4L1XA 3HQPA 4W84A 1RJQA 4ML4A 3ZSSA 3WSUA 5J8LA 5CC7A 2ZXAA 3IJ8A 1R9XA 5HUOA 1SZEA 4B5TA 4FX6M 5HNRA 1AZ2A 3KCLA 4PRWA 3D3AA 1DORA 5BMXA 2DT0A 2WVSA 3MUAA 3PSWA 2XTKA 1JQVA 3GU2A 1B0IA 4QDPA 4OWGA 1EGVA 3L2MA 3TC7A 1F8MA 1OADA 1TV3A 4M29A 3O6AA 3AJXA 2WHLA 1G94A 2X0SA 5BNKA 1CXEA 1JIBA 2Y24A 3BAIA 4N2YA 4LH8A 4ZO9A 3QSRA 4ZB5A 4PULA 3IJLA 1E56A 1JCTA 1VIWA 3WQEA 1FWJC 5M1TA 3HJEA 3T09A 3OZYA 2AAMA 2NQ9A 3HG5A 1MWOA 3ONBA 1FCUA 1YBQA 3KOXA 4H8UA 2ZDSA 1RQHA 4NZ3A 3FIGA 4US6A 3K5XA 1HTIA 2HE5A 3MJYA 1FWTA 1VZWA 4MFDA 5LNUA 3EZ4A 4YTRA 2NUXA 3KVLA 1JXKA 1OF6A 3I10A 4NXKA 3C86A 3CPRA 3T4CA 2NUWA 2BY0A 2ZTJA 5DXYA 4G9PA 5CSSA 1JVNA 5HINA 1FCQA 3ISIX 3R79A 4AHPA 1OX5A 4XSLA 2RKXA 1KFWA 1LL7A 3O0FA 4C6IA 1LTDA 3NVDA 2EJAA 1FHLA 3DFHA 2AQOA 2P50A 3LLDA 4ZO6A 1U2YA 1CXHA 1T8XA 4MJMA 1MZHA 2PF8A 5AFDA 4PMDA 5JU6A 1EQCA 3EA1A 4C90A 3RR1A 1VHCA 3CS2A 1CZ1A 4LXFA 2AKZA 5DXXA 2JGYA 1I0BA 3BDKA 3H23A 1PJ9A 3SJNA 1C8VA 1DHKA 3EKLA 1ZBWA 2R14A 1ZU8A 4DM1A 4B3KA 1WKEA 1GOWA 4D6CA 4E2OA 5CBJA 2WO5A 4BS0A 3GKFA 3AS1A 4ZMGA 3GUGA 4FLSA 4XTDA 3IGSA 1UWSA 1O6IA 3R13A 5HJLA 4UTTC 3WDRA 5MKGB 1HJVA 2EGZA 5XIAA 2VQTA 1V93A 2I14A 5DELA 1TKKA 4GZJA 4ERIA 4GISA 1I0DA 4U2ZA 3BOLA 2V2HA 2WC3A 2ANUA 1XBYA 2ATMA 2BOEX 1GW1A 2FVMA 1CT5A 2WWCA 1L2QA 3GXPA 2WAGA 4RNJA 1D8CA 3TA6A 3U2EA 2DUXA 3TXVA 3VK5A 4XZBA 1OCBA 2HCVA 3CPGA 5EFFA 2CPUA 4D8AA 2HROA 4YYCA 1U83A 3F2BA 3G77A 4EXQA 4FP1A 2V63A 4PZVA 2XVGA 4WJXA 2CETA 4A22A 4CCCA 3IS4A 4LNYA 2IUZA 3WBEA 4S3FA 1IV8A 3FX4A 4EF8A 4HSOA 1L6GA 4J28A 2FB3A 1EPVA 1O94A 3AROA 4B90A 3PZIA 4S2BA 5LYRA 4AZ6A 3QTPA 1DBTA 2J7CA 3D0CA 2VDIA 8CGTA 4CD7A 3KP0A 4PEEA 1ONXA 2PWDA 2Q8LA 5HJYA 3SADA 2ZXQA 3H4XA 2FZNA 1QI3A 3WD1A 4PA8A 1TCDA 3FEMA 4BWLC 2OZ8A 4DJDD 4H7ZA 3ZR6A 1OD8A 5F4XA 3MI2A 5AC8A 1NWSA 2H9AB 1FP9A 4ZA0A 3WQ5A 1UR9A 5LSMA 1ADDA 2YXXA 1K4GA 3WJSA 1P0DA 4HCHA 3PB2A 4JL2A 2YDRA 2V8ZA 1SZFA 4UUIA 4FSAA 1KBBA 3CLWA 4UTIA 1AQHA 3HOJA 3U7VA 2GK1B 4LEFA 4AUBA 4QJ3B 2OELA 1K8YA 3DOPA 4MUPA 2PUZA 4JQ3A 1OSEA 3LHYA 1EWEA 3IPWA 4GBDA 1EF3A 4B9ZA 4HK7A 4AAJA 3NPUA 2Y89A 2ZVRA 1FWDC 1B3ZA 1EH9A 4PMNA 1KM5A 5L9FA 3QGKC 1QHOA 2VCAA 1CCWB 4C6BA 2IPWA 3PULA 1DIDA 3KBJA 2YCIX 4R7JA 6ENLA 3M43A 3QFWA 2WKJA 3ZOAA 2GVLA 2YFOA 4PMXA 1V5XA 2ISFA 3E0FA 3MHUA 4MMWA 3IV8A 1A5MC 3HO8A 3N2MA 2QEZA 1TVPA 3BV4A 4C6EA 2CIPA 3V5FA 5CPQA 4HK5A 4HNOA 4XVEA 2V3FA 5D2WA 2F2HA 1E6NA 2VRJA 4W8AA 1MO0A 2BG5A 4NHVA 1O12A 2BOGX 1XX1A 4FF5A 4X0VA 2RDUA 3FSUA 1OGBA 1FDJA 1UASA 3UGVA 1UD3A 3TQPA 3M6DA 5TQLA 3TTYA 3W28A 2OKTA 1HJUA 1N82A 4H7VA 1UIOA 5FEWA 5A6JA 1OVDA 2HISA 2YA2A 4KRTA 1H60A 1EO7A 2UY5A 2OYLA 3V7PA 2QYGA 5HMDA 4UR9A 4AZCB 2Y61A 3GKAA 3QN3A 1AW5A 3AISA 1W3TA 3S46A 3HV8A 4GO8A 3SN4A 1DIKA 3OIXA 4UBPC 3UJEA 4B3LA 1XLBA 4WXYA 1OFOA 1DVJA 2V3GA 1PIIA 4RLIA 3LOTA 4ZOEA 3UBPC 2X41A 5A2CA 1DE5A 1MNSA 5DT5A 4ZTXA 1E43A 2J9ZA 5AY7A 4WY0F 2XZ9A 2SFPA 3DHPA 3HG4A 3PWAA 5AHMA 4EKJA 1R6WA 3RCMA 4UXDA 4QP0A 4IQDA 1F3WA 3RGTA 4GXPA 1GHSA 1VFLA 1R7OA 3DI0A 4TVUA 3ITVA 3QR1A 1BEUA 1G9HA 1T0OA 3MMUA 1VS1A 3SAZA 4PGLA 4WOZA 2ZADA 3FDKA 1H50A 4RDVA 1RY0A 4J3ZA 3KHDA 3GR7A 1MQPA 4PEKA 5EB8A 2BVDA 4JGDA 2Y5SA 1GYLA 4KETA 1LG1A 1GQJA 2H3DA 1Q6CA 2A7PA 1RD5A 4ICMA 3O6CA 1KV8A 2C19A 3IVTA 1TTIA 1DPMA 3E0IA 4FNRA 3GTIA 2V3DA 8XIAA 4TR9A 4R27A 3YPIA 2UWFA 2E9BA 4A05A 3SIZA 3W1UA 4WDXA 5PTDA 4Q8VA 3E0WA 3WLRA 4M81A 1X7FA 3T55A 3MU7A 1SJAA 4JEQA 1N8WA 2HDJA 3PZOA 1C90A 2CXGA 2G0WA 2Z1BA 1WUEA 3BG5A 5AHIA 3SRDA 3CBWA 1IHIA 4J35A 4LF1A 1J0YA 2BMBA 1IQ8A 4GYPC 4M80A 5M2FX 1TV7A 4C6LA 1D3HA 2BGQA 4N9CA 4GUHA 4GVIA 1E6PA 1K70A 3WL1A 3N14A 4TTGA 4PC8A 4LCRA 3RO8A 3C0SA 1OIFA 2JEPA 5D38A 1EBHA 2Z28A 5FJIA 4Q4PA 2GJXA 1MXSA 4ZFMA 4YVXA 1B3OA 1B2YA 3DX5A 4M8UA 3GW3A 4URIA 1IZJA 2RH9A 1FOBA 3UXKA 1A3HA 4RKAA 2ZUTA 3T4WA 3JZEA 2E6AA 4GFIA 3IIXA 3HG2A 2WLYA 3B0YA 1V6TA 4OBSA 4AIUA 1KBKA 3LG3A 3IJ9A 1B4EA 3E96A 2FB2A 4LSBA 3HB9A 4PCTA 1V0KA 3ZJKA 3GD6A 4HCLA 2Z29A 4LB4A 1A5CA 3MCMA 2OB3A 2P0IA 3KL3A 4RK8A 1JL8A 3BSMA 3W1LA 1CGWA 5FJOA 5TF0A 5AC7A 1EJTC 2WVTA 4EANA 3M5XA 1Q6RA 2G5WA 3SY8A 4DXXA 3RIKA 3CHVA 1DJZA 4HYVA 1YTDA 3BSGA 1PZ2A 5EMJA 4KQNA 1RJPA 2QVHA 4EK7A 4PFHA 4IXXA 1LRTA 4HMEA 2VURA 4JL1A 3O2LA 3MPGA 5ABTA 3VX1A 1RLDA 7TAAA 2PDYA 3QW4B 3QOMA 3VM5A 5BWFA 4MNJA 1V0MA 1OZQA 3AICA 3KAOA 4CUCA 2O7SA 1O66A 5G4EA 4L7ZA 1DWAM 1POKA 3U2CA 4F2TA 3GTHA 5REQA 3CQJA 1GCYA 4ATWA 1EC9A 2KX9A 3ZWSA 1BVNP 3GDBA 3KWXA 1X97A 3W1NA 4Q6JA 2CZ5A 1YNYA 4UTMA 4Q8UA 3M7SA 1E73M 4H3DA 2ZOXA 3MCOA 5JUVA 3S2NA 4B5XA 3UXIA 1OB0A 3MUCA 4MY8A 3NOEA 2OZTA 1VFTA 1XFBA 3V1PA 1GORA 3O06A 4HHMA 4WRHA 4UIOA 4PBFA 1QRQA 4QG6A 2W92A 1XCXA 1XLLA 4LAMA 4IHCA 1VBRA 2WV8A 1VF8A 3TJLA 3VC6A 4H00A 4JTIA 4L1WA 1F73A 2GSJA 1J0ZA 3DERA 4I7WA 4IIDA 3R94A 2IXVA 3MS8A 1MEWA 3LM7A 2WXDM 4GH3A 4AYSA 4X2RA 4LAZA 2BVYA 3R8RA 3ICJA 3W23A 4GQ0A 2Y63A 1VEMA 5E0KA 4JTGA 4MJZA 1XP3A 5A69A 2NVCA 1QI4A 1XI3A 4UZUA 2NSOA 2Y8KA 2PZNA 1SQ7A 2QS8A 4BWLA 4BZYA 3ZJ7A 3B0UX 2QKFA 1R3TA 2HXTA 3URBA 3G8RA 3PBMA 1EKOA 1K4HA 4KCWA 4XBSA 2ZA3A 3LCGA 4ACZB 4KRZA 2H3BA 4LUTB 3ABOA 2ZRZA 3M6YA 3MMTA 1FHDA 2EF9A 4WQ6A 5JBEA 1KV5A 4R53A 3MO7A 5EGRA 3L2LA 4JBRA 1BYCA 4A8IA 4HCDA 5DANA 4GJ1A 1QR7A 2A2IA 3CV7A 1IR1A 3SSZA 2W3ZA 4Q8OA 3N12A 1A5BA 4QNEA 3PM6A 1Y7VA 3IIVA 4RDWA 3DFYA 2ZQ0A 2ZICA 4AX7A 2OGJA 2OQLA 3NPVA 1R7AA 4LRSA 3BE7A 3B9OA 1NSJA 1S38A 1B9BA 3O1NA 2VRQA 2XG9A 5CJMA 1OIMA 3L9CA 3SB0A 4HNTA 1O1ZA 4R88A 3RLVA 2VX6A 1WE5A 5GJMA 3UETA 2NQJA 3AXIA 3GQYA 4IJCA 4S3DA 1K6AA 3IUDA 4ZB0A 3SBFA 3GC5A 3VKKA 3W6LA 2CLEA 2A3EA 5D2YA 2JKPA 2AKMA 4OHQA 4IISA 1TPDA 5HNTA 3EWBX 4KCVA 2PDHA 4PCPA 1GONA 2XN1A 1XV8A 4DEFA 1SR0A 2RJHA 5LGXA 2QJMA 1A0CA 2EKGA 2G95A 1DWGM 5E09A 3VD7A 2X1SA 3T40A 4KIRA 4PODA 1BYAA 1GPFA 3KW3A 1GOIA 4Y7EA 3W38A 3QRHA 5G1YA 4YMZA 3T0AA 2NZLA 2RUSA 1EYEA 3CH9A 1OM0A 3NWRA 1W2VA 2PZ0A 1W1B1 1VQTA 2QJNA 3LLXA 2AOSA 3A24A 1IIGA 4WHBA 3I6TA 3NAVA 4YTTA 1L9WA 3QEZA 1TX2A 3P61A 1UQZA 3MVTA 1X6NA 3WJWA 3RRXA 1D7FA 3HPAA 2WBKA 2QCDB 1A0DA 1OHLA 1VBHA 4FIRA 3M4HA 4M6QA 3CQ0A 1VKFA 4YNGA 5D9NA 1F05A 2EEXA 2I5IA 6CGTA 5BOOA 3AHYA 1TRIA 4Y9NA 5E9AA 5MHBA 2PDBA 1XLCA 1SMAA 3K46A 2GWGA 4ZSUA 1V03A 1MQRA 3LY0A 2XFWA 3QGVA 4GABA 2VEIA 3W37A 4XAZA 1W3KA 4U3CA 4NX5A 4LAKA 1QWGA 2P3EA 4EWND 4NF7A 4HZ6A 4LY8A 3U6WA 4CVUA 3TUUA 4M3PA 1WO2A 2Z24A 3OTRA 3ZLHA 1MVYA 4POCA 3FJNA 3D47A 4Z1YA 2GFTA 1V3JA 1H7RA 3AHXA 4TO8A 3RF9A 2OSWA 2OO0A 3Q37A 1T7LA 3W85A 2FFIA 1UUQA 3PNUA 4KFOA 1LQ2A 1C91A 2W4XA 2GUUA 1E3XA 3HURA 4GNVA 2G3MA 3PFRA 1ZBKA 4ZCWA 1KM2A 3VNKA 2NXHA 1XH2A 3OLGA 5F2IA 3VFLA 5CPTA 3QY8A 3N9KA 3GDRA 5C55A 4P7OA 4CNSA 1OT2A 3SURA 3C3NA 4FIQA 3KP1A 4E4FA 1Y5WA 3WIJA 1T96A 2YBVA 4JCLA