3LCWA

L-kdo aldolase complexed with hydroxypyruvate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
NLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERAQVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRHGFDAVSAVTPFYYPFSLEEHCDHYRAIIDSADGLPMVVYNIPALSGVKLTLGQIYTLVTLPGVGALKQTSGDLYQMEQIRREHPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECNKVIDLLIKTGIFRGLKTVLHYMDVISVPLCRKPFGPVDEKCLPELKALAQQLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate lyase
publication title Modulation of substrate specificities of D-sialic acid aldolase through single mutations of Val251
rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 111
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3lcwA00
3NO5A 3EWWA 2JKEA 2A5HA 5DXYA 2ZRYA 5CKSA 5DN1A 5I3HA 3MW7A 4A2SA 1LRNA 2AAMA 3BGGA 1QPQA 3H55A 4H6KA 4O0ZA 5C2XA 4HNTA 4UFJA 3R2GA 2VFDA 1N55A 4GUFA 1B4KA 1W5MA 3UNDA 2B4GA 3W86A 4RZ6A 3ZR4A 1X7FA 3P62A 2A2IA 4GUGA 4M6QA 2F7FA 3AJXA 2O7SA 1YXDA 1TCDA 1PL9A 2Y89A 4LWWA 1RR2A 2V0TA 4PFMA 3T4CA 4POCA 3W1PA 3WJYA 1AW2A 1ZJIA 3W7LA 4GUJA 2J88A 1BWLA 1XUZA 3B06A 5F2IA 2Y7FA 4DF2A 3LBMA 4N4QA 4O14A 3W1XA 2NX9A 3NPVA 3W85A 2O7QA 4LUIA 5LSMA 2VXNA 1H61A 4BK9A 1GTHA 4QQ3A 3JR2A 2WSYA 3C2VA 1X1OA 1JCNA 1WOBA 3SY5A 1N8FA 1TPUA 2RDTA 4AB4A 1FCBA 4ADTA 2QCMA 3DFOA 1IIGA 1LBLA 1H63A 1FY6A 4QNWA 1OFOA 3CC1A 5AHIA 1ICPA 1T0OA 2YXGA 2RH9A 2ZA1A 4GNJA 3GNDA 3LI0A 3NQDA 2E6DA 1LLZA 2TMDA 3O05A 5BW6A 1KFJA 5EKYA 1OHLA 2C3ZA 3HBLA 4UFLA 3TE9A 4IMDA 2WPBA 5A8GA 4Y6GA 2EPHA 5D02A 5E0KA 3HG4A 4E0CA 3WK0A 5TQLA 1N7KA 3DI1A 3TSBA 3M5XA 3P5ZA 5CZJA 1EEPA 1LOSA 3C6CA 2F84A 2WJZA 4UIOA 1BEUA 3E12A 4UCGA 4TMBA 1H50A 2FB2A 3LOTA 3EWUA 5D03A 2PURA 2B7PA 3BLFA 5FF0A 3TQKA 1DORA 3UY7A 2FTPA 4ORMA 5J5DA 3LM7A 4GWEA 4YWIA 2VOMA 3GK0A 1TPDA 5LNSA 1SUXA 5AC8A 3DKLA 4QIUA 2GPTA 2CZFA 3NPXA 2RDWA 1I2QA 6ALDA 1SO5A 5LGZA 2GUUA 4NXKA 3O07A 4GFSA 5IBXA 5IM51 4HKPA 2VFGA 3NM3A 4J9JA 1O94A 5CSRA 1SFJA 1C29A 3JRKA 1VYSX 1AG1O 2NX3A 3QH2A 4HIBA 4CCEA 4MY8A 4Z0JA 1W5OA 1L6YA 4NJHA 3E02A 1GWJA 3GDTA 3CT7A 5CPMA 4FHAA 1PHWA 1ME9A 3EKLA 3LCLA 4IQLA 3TW6A 2WSRA 1GVQA 4H3DA 3MUXA 3T7VA 1I2RA 3A9IA 3PR2A 2QDHA 4Z08A 1M6JA 4FB7A 3W1UA 1ALDA 2V81A 3W6YA 2NV2A 4JD4A 5FF7A 3QC3A 3SGZA 2XN0A 1AL7A 1EWDA 2VEPA 3GKFA 4NXSA 1ZALA 3PS7A 3B05A 1DOSA 4JYDA 3A23A 1L2UA 4AF0B 3NZ1A 3R8RA 3W87A 5A5WA 2Z0IA 1A53A 1K02A 1XBVA 1CW2A 2R91A 3NQ2A 3W1LA 4I7UA 2GVLA 4U28A 2J9ZA 1K7EA 1TTIA 3C2EA 4DO5A 3FKKA 3L66A 3NXFA 3QMRA 2QUTA 3UPBA 1YPIA 4YXGA 4MZ8A 4IMFA 1TSIA 2B7NA 4NNAA 2I14A 1IGSA 3RMJA 3PBVA 1TO3A 1I2OA 1XKYA 3IGSA 2QDGA 3HPSA 1XUUA 1DQXA 2C16A 4R53A 2Y61A 1OX5A 1SZEA 5DCDA 1NFBA 3QW4B 3BGJA 3GDRA 3M5YA 3W1QA 4IJBA 1R2RA 2IQTA 3OHIA 3S5OA 2XN2A 1FWNA 2C14A 5K4XA 4DELA 3ABSA 2ZRVA 1LOQA 1MEWA 1KM5A 1JRCA 4BI6A 1OFPA 4CNOA 1NEYA 1GG0A 3UZ5A 4RX0A 2GVJA 4IPIA 3BLIA 3L67A 2GOUA 3P61A 3TAOA 2JK2A 1OYBA 3MYPA 3UWYA 3LCGA 3BW3A 3LTYA 3VE9A 1H7RA 2V5BA 5C6MA 3EWZA 2C0AA 3W7CA 3KRZA 3S5YA 4ADUA 1PE1A 5EPDA 3LCHA 2YW4A 3DXIA 2E5DA 3L5LA 5BRBA 1FX6A 3HIJA 3W75A 4EF8A 4NQ1A 1G7VA 3PB0A 3W7PA 1VQTA 3W1AA 2H8XA 2NLIA 3HPZA 3KVKA 5AYXA 4IXXA 1G7UA 3GYEA 3G0XA 4ZQRA 3FJLA 3RK8A 3TW7A 5L6UA 1GQNA 5K2ZA 4D2JA 2V2CA 4AVFA 1HFBA 3NG3A 5I3IA 2OJPA 3OVQA 4MKNA 3L5AA 1ME7A 4MFDA 1TRIA 1B57A 4NJIA 3N34A 4UNKA 1Q3NA 2YSWA 2QUUA 4AHOA 4S1FA 1YXCA 2E77A 3EX3A 1FCQA 4QISA 4JTKA 4HN4A 4MYXA 3W1MA 3NPUA 3PM6A 3M44A 2QKFA 2X16A 5KSWA 3KHJA 5KINA 4JYEA 2CU0A 3P5YA 3TA6A 3L9CA 3PG8A 2ZCGA 3E9AA 1AW1A 1THFD 1GOXA 2A7NA 1PHQA 2GQ8A 1U83A 3UWQA 1SSGA 2ZZ6A 1I2NA 4N9EA 1CI1A 5DCBA 4Z1CA 1TV5A 3TMLA 3N73A 1T96A 4ZQPA 3THQA 4OV9A 1WQ5A 2ZZ1A 2PE4A 5AHEA 3TJLA 2BWGA 4FNSA 4KWVA 3PY2A 4Z1DA 1NVMA 5AHNA 3H54A 1OK6A 3GAKA 3PUOA 1VCVA 3W2MA 2OMAA 2B7OA 4LC8A 5AHLA 3WFAA 1K7FA 3N2MA 3HO8A 1JULA 1B3OA 2WV8A 2E09A 5J5RA 1TV8A 4ML9A 3GDKA 3C0JA 2YZRA 3DFSA 2CLEA 2VENA 1SFLA 1YDVA 3Q58A 3S1XA 5G4EA 5D2TA 5D2VA 5C54A 3TC6A 3NGJA 3W23A 3QPZA 3NL5A 4K8HA 2ZFAA 3O1NA 1PV8A 3MBFA 5F2LA 4G1KA 3I68A 1FXPA 1XCFA 2BX7A 2E1DA 1SQ7A 4XTIA 3BG5A 3W2KA 2TRSA 2BLEA 2ZTJA 4JIPA 5EYWA 1KM3A 4UTWA 1XI3A 2OT1A 3LHZA 2P1FA 1YLVA 2R94A 2FFCA 4FX7A 3M41A 2VFEA 3IIXA 4Y9AA 3BPWA 3LHVA 3MP5A 3W7GA 5E93A 2NZLA 3QMTA 4K6AA 1GTEA 2V2DA 3TR2A 1YXYA 1LBMA 3IEBA 1XDMA 3DBPA 4KFNA 3E96A 4DEFA 3LDVA 3O6YX 1FWTA 4WOQA 2OT0A 2BZNA 1U5JA 2C15A 3BLEA 4YCOA 3LCFA 1SZFA 1DV7A 2Y7DA 2C19A 3PF3A 3W2NA 4MJZA 4N9CA 5FEWA 4MUZA 1OK4A 2OZ0A 5HWNA 2WNNA 3WJZA 3RFAA 1EP2A 1OF8A 1Z42A 1VCGA 4YCPA 3THAA 3U2OA 4A22A 1SZNA 3UY8A 1OFAA 3EX6A 1I8JA 3R13A 4N4PA 1LTDA 4WZHA 4C1LA 3C3NA 4LVGA 4MOZA 1FUYA 3HGRA 2QR6A 3OBKA 1WV2A 2ZZ5A 1Q6OA 1VHCA 1FCVA 1QPNA 3W1RA 3S8HA 2QJHA 1XBYA 4WQ6A 4K38A 3KVLA 4LS2A 3S1WA 3NQ8A 5H2ZA 2OX1A 4O1CA 5BMWA 3W1TA 4ONVA 2WKJA 5AFDA 3R12A 4UR7A 3W7JA 1QFEA 1EUNA 3GVGA 4RZ4A 3BG9A 5U7SA 5D38A 3TK7A 1S5WA 3BK0A 4GC4A 5LNVA 1L6WA 2JGQA 1GYLA 4O1AA 1A5CA 2XN1A 2WSQA 2AQWA 3M7WA 1EWEA 1KM0A 1VLWA 3NQ7A 1B9BA 5L9FA 1R2SA 2QUVA 3I7SA 4FIRA 1VCFA 2CLFA 3QZEA 1A50A 2QJGA 2VFIA 2Z6IA 3NL6A 3IIOA 1GJPA 3STEA 5LNUA 1P5BA 3T78A 1HTIA 3NZRA 2GQAA 2NV1A 1OFEA 4KKXA 3HQ1A 5AYZA 4CCDA 3W73A 1JQXA 1WX0A 3TCEA 4OT7A 3GR8A 1OX4A 1LM1A 3ATZA 4OHQA 2YFOA 3M6YA 1X6UA 2QCNA 2Y62A 4XZ9A 3WK2A 1F2JA 1I4NA 3C56A 1GZGA 3D0CA 4A29A 5EA9A 3QJAA 2A21A 1ZNNA 5D33A 4UFKA 5DY3A 1F6PA 2C18A 3S42A 3CWOX 1A5SA 1RZMA 1LRQA 4XKYA 4UR8A 3NYZA 1O95A 4JS3A 1X1ZA 4AHQA 1W5NA 1QCWA 2DU2A 5HJLA 2X2GA 1GVSA 3P7YA 5C55A 5AHMA 1R46A 5LNRA 3IVUA 1M5WA 2Y6ZA 3PULA 3OA3A 4FNQA 2WO5A 2W0UA 1PS9A 3RLUA 4M19A 1ZFJA 5CG7A 2I9EA 2VKZG 1XM3A 4X2RA 5D09A 1R30A 1G6CA 2GJNA 5IBXC 1LP6A 4OBTA 1OYCA 2I1OA 1R47A 4EWND 1GEQA 4YLWA 2PRHA 2V5LA 4BFAA 3WJXA 3CHVA 4MFEA 4O28A 1SZGA 4O4WA 4RLIA 3L0NA 3PB2A 3M43A 3G0SA 4JN6A 1SO6A 4O1BA 3LB0A 4IXHA 3TMQA 3W83A 3STGA 4AHPA 3GAYA 1W54A 3FA5A 4O16A 4KFPA 1I45A 1SO3A 2E6AA 3SFKA 2PRLA 1EP3A 3NEVA 5I3JA 3ABOA 1ME8A 3HGOA 3UWZA 3DU0A 1GT8A 4MYAA 3ZFHA 5K9CA 2GVGA 3A21A 5FF3A 4ZZ9A 1J4EA 3A22A 6TIMA 3EXSA 4K7VA 3TQ0A 1F74A 3WK1A 2FQIA 2ATSA 4DBEA 1LCOA 1JCJA 3QYQA 3C61A 4I9AA 2PRMA 1KFLA 3Q94A 3S6DA 2HTMA 4AWSA 3DHDA 2RHGA 3W88A 3MP3A 3V75A 4O57A 5C5YA 1BWKA 1OX6A 1VLIA 4PODA 1Q6LA 1G69A 2FPTA 3G1DA 1JUBA 2FPYA 2G5WA 2V30A 1Z44A 1KLZA 2X30A 1JVNA 2H90A 5D05A 3F4NA 3KOFA 3VI2A 1MZHA 3EWBX 5G2WA 2A0NA 5KZMA 1TYGA 3LHTA 5F1VA 2VEIA 3L68A 1BTMA 2V9DA 3O06A 3SZ8A 4JTGA 4MVAA 4JDBA 3A5VA 4QJ1A 2V8ZA 3STFA 5AC6A 3LCIA 1TTPA 7TIMA 1WYIA 4LRSA 2DORA 1EX5A 4HPJA 3VCRA 4DPPA 4FX6M 1F73A 4BWLA 5AOUA 3EEGA 1WOAA 2ZBTA 4OWGA 4O11A 1G4TA 2EKCA 1TMHA 4N02A 1QO2A 1H7XA 1FQ0A 5F4SA 3F03K 4O12A 4UFMA 4FXSA 4UMAA 3P84A 4AEOA 2Z6JA 3NQFA 3BG3A 3DKJA 4RZ5A 3W84A 3HGSA 3E0IA 3NQVA 4BR1A 2ZQ0A 5K9DA 4DO6A 4FEZA 3CQ0A 2J9YA 4O52A 1P0NA 2DZPA 3UWVA 1W5QA 1QOPA 1YTDA 3FLUA 5I3KA 5FESA 1WAUA 2HS6A 3GR7A 4HSNA 2JBMA 2QCLA 4MPQA 3G1SA 4EF9A 3ANYA 3NQCA 5HULA 1KA9F 1TJPA 2B0MA 1TJRA 1FBAA 1ZAJA 2YR1A 2Z1BA 3CLMA 4AAJA 4Z1AA 1IXNA 4N6FA 5U4NA 2Y7GA 3WJWA 1DHPA 2CLMA 5KZEA 1W1ZA 1QMLA 2UV8G 4JXCA 2EF9A 3G24A 1YTKA 4Z1BA 4DF0A 3CEPA 4NZJA 3TQVA 1MEIA 3Q37A 2DZXA 2C1HA 3W7MA 3GDMA 3RU6A 2QAPA 1TRDA 3W2UA 2NUYA 1RD5A 4RJEA 3NQ6A 2W6RA 5AYYA 1HO4A 5HUOA 2CZ5A 3UYCA 3W1NA 1UCWA 4GXMA 4IMGA 1F5ZA 1YPFA 1H7OA 4X22A 1QOQA 1ICSA 3GXTA 3R89A 3W72A 1GG1A 1WBHA 4RK8A 1TPVA 5DBUA 1MSSA 2C6QA 4ORIA 4ZMGA 4KWWA 3PVFA 2KZHA 3GZ3A 4Y96A 1WA3A 4OGZA 1C9DA 1K03A 5HUPA 3UD6A 3W7IA 4XTDA 3YPIA 2ISSA 3O16A 3W7KA 4TIMA 1GVOA 2CLOA 3ABQA 3F4WA 4NVTA 1ZAIA 5I3FA 3NNTA 3CU2A 3NL2A 4UTJA 3TU9A 3W7HA 1ZAHA 4BF9A 1YTEA 4RV8A 3LV5A 3IGXA 1LYXA 1PCKA 2QCEA 1W0MA 2JKPA 4C1KA 3NOEA 4M6PA 4UTLA 2E5CA 1OFQA 1DQWA 3K30A 1OG0A 4M7TA 4NX0A 3NQAA 3LRLA 5FF2A 3ZWSA 3O6CA 3NQGA 4Q33A 3S5NA 2DZTA 4U4MA 3DENA 1VRDA 1SW7A 4OV4A 1PVNA 3BO9A 2NWRA 4R33A 4UTWC 1KM1A 3W70A 4PEKA 3P8JA 1B4EA 4IGHA 4NUWA 1Q6RA 2HSAA 3LXCA 1R2TA 5FEZA 4FNPA 3C2FA 4XQ6A 4O10A 4CQAA 3V1PA 1JJKA 1VS1A 3P80A 4M6VA 2E6FA 4CNNA 3FFSA 3LCXA 3LTPA 4WY0A 3PSVA 5H91A 1S3HA 1AL8A 2A6NA 4I7WA 4BI5A 5FI8A 1H60A 4NT0A 2VC6A 1SU5A 3EXTA 4UXDA 4FX8A 3BW4A 1KLYA 3LI1A 3C2OA 3A24A 4GUIA 1VYPX 1EIXA 1TTJA 3M9YA 5LHEA 2TSYA 5LHFA 2Y70A 4PH6A 4OU1A 1SW0A 3G8EA 3DH7A 1ICQA 3O63A 1OFBA 3QMSA 1FWRA 5SWUA 5DELA 1E51A 3O8AA 4LY8A 4MZYA 2ZZ3A 3PC0A 3B4UA 4GBUA 1RQHA 2ISWA 1H51A 2QAFA 4RXGA 1JUEA 1RV8A 4JTSA 3UWWA 3LHUA 3EWYA 3QRHA 4PTNA 3RNDA 5EL1A 5D32A 5HWJA 4FXRA 4K8EA 3T44A 3MI2A 3RF9A 1OFRA 2X1UA 1F76A 1QR7A 4JX4A 4AXKA 1FDZA 4ALDA 1XL9A 5G2IA 4LS0A 1H1ZA 5AHFA 5K4ZA 4JDYA 5BNKA 3WJSA 5HR6A 2ZA2A 1TPH1 1O60A 3B0PA 3T55A 4JTFA 3LV6A 3MP4A 1BKSA 2QF7A 4TR9A 3VKJA 1FDJA 4Y90A 1OYAA 3QEZA 4ZQNA 4TO8A 2A7RA 3PUEA 4HHPA 4UTTC 3LGEA 3LLFA 3Q2DA 5CSSA 3HG3A 5DLCA 4X3ZA 3N19B 1W37A 1D3GA 4M7SA 5ABTA 4XWUA 4CQ9A 1ADOA 2P0OA 3NM1A 3N3MA 3W22A 4RCXA 3QPYA 3ATYA 2ALDA 4JTEA 3G1FA 5HWMA 3HGJA 1FWWA 4O53A 1F7BA 3OIXA 3MHFA 4IX2A 3GKAA 3TH6A 2NUXA 1K8XA 4HNUA 2CZEA 3GLCA 1IXOA 2JGYA 3T40A 2AGKA 2V2HA 1EB3A 1QWGA 2FDSA 4GE8A 2ZZ4A 4FNTA 4WD0A 1GYNA 4QITA 1P4CA 3CEUA 1K3UA 4E38A 1FDYA 3SR7A 3GNNA 3MHGA 3UPWA 2WQPA 4JTLA 3DFPA 3HG2A 4FIQA 3FYPA 4K37A 4MY1A 2QCGA 1UUMA 2WNZA 1DBTA 3I7RA 1XBZA 3I65A 5CPNA 1TPFA 5KMYA 4JTUA 1MO0A 3NPWA 3I6RA 3W3OA 2FB3A 4PA8A 4ZQCA 1MEHA 1Q6QA 1KFEA 2XFWA 4WX2A 1OX4B 4PL2A 1UJPA 3TFXA 4CCCA 4FF7A 5F2MA 4GJ1A 1XDLA 3DFNA 2VEMA 2Y63A 3SIZA 3W7QA 3DZ1A 3L0GA 5CGQA 3TAKA 4EVZA 1K8ZA 1H5YA 3W07A 4LRTA 1LLWA 1GVFA 4LV9A 4WY0F 1VPXA 2ZRUA 3LLDA 4N2YA 2OCZA 2YDAA 3JS3A 2ATMA 4N9BA 4XKYB 3UXAA 1J5TA 1XFBA 2X1RA 3CM4A 2Q8ZA 2LLEA 3HPXA 3N2XA 3GXNA 4LNYA 3C52A 5DBTA 1VH7A 3FYOA 3B8DA 3P82A 1LBFA 5T26A 1H7PA 4ZQOA 5DXXA 4O54A 4WOZA 4L4MA 3P60A 2ABBA 3TUUA 1JCXA 2H3DA 2DZUA 1RQEA 2EAWA 1K8YA 2QCCA 2NXIA 2RFGA 1TTQA 2ISVA 1T99A 3KRSA 4JR5A 4EIVA 2VELA 1G4EA 2A7PA 4LVAA 1KV8A 3NAVA 4E2BA 1OFDA 3PAJA 1EPXA 4NJKA 1W3IA 5AB3A 3W76A 4R34A 1X8FA 5EBUA 4FNRA 3G1YA 3GB6A 2BXVA 2WOQA 3G0UA 3SGUA 1NF7A 2ZYFA 1Z41A 3G3MA 1EP1A 1SPQA 2YGYA 1Q45A 2E5BA 5DY2A 3DI0A 2DZWA 4AMAA 1TPEA 3PBWA 4H4IA 1DL3A 3M0ZA 3P8IA 3C2RA 4O15A 2YFNA 3G3DA 1KV5A 3IGUA 4NX5A 2DP3A 3FOKA 3EX2A 1GVRA 5HMSA 3VE7A 1FCUA 3QSTA 2G97A 3W9ZA 1TREA 4YL2A 3IV3A 2E6YA 4MLRA 4JY9A 4EOUA 4JX5A 3MWAA 1W3NA 1O5XA 3LRMA 4UFIA 5K7JA 1DJQA 3TSMA 1AMKA 1KFCA 2ZZ7A 2ABAA 2CLIA 1LZOA 4MY9A 1W8SA 1C8VA 1PCWA 3M5ZA 3S1UA 1YDNA 5E1QA 4DXVA 1SO4A 4LOCA 4BWLC 3PSWA 5HQEA 3ABRA 4RR4A 2PCQA 2QCDB 1D9EA 1IIHA 2NX1A 3NA8A 3QQ1A 4IWWA 1LROA 4NNCA 4DQWA 2CZDA 2X1SA 1XXXA 3G8RA 1JUKA 3MO7A 4ZVJA 3TXVA 4BI7A 2NXHA 3C4UA 1H1YA 3GX9A 3PUDA 3S0CA 1ZHAA 1P0KA 2QCDA 1ONRA 4TX9A 1W56A 4QSHA 2R8WA 1S5VA 2NXGA 1L6SA 3GIYA 2Q3RA 3TROA 4O17A 4CLMA 3LRKA 4UMBA 3HG5A 1AW5A 1OF6A 2ZRXA 4N9DA 3MI3A 5K3VA 3P81A 2ZRZA 3DFTA 1TV7A 1H7WA 1PIIA 3G1XA 2H6RA 4MLJA 1KW1A 5D30A 4JTHA 4RKAA 3HB9A 4FNUA 5CPOA 5KZDA 2CLLA 4UTHA 4A21A 4M5PA 3KVMA 5AC7A 3UQNA 1JCLA 3LTSA 1EUAA 4JYFA 3NR0A 3FJ6A 2C13A 1VR6A 3CIWA 2BTMA 3LX9A 4HSOA 4OE7A 4AWUA 5D2XA 3SJ3A 1SR9A 4WXYA 4K7YA 3LXAA 3IVTA 8TIMA 4S2BA 4NU7A 2H3BA 2ZTKA 4ZQMA 2CW6A 3M16A 1MXSA 2Y88A 1TIMA 3L2IA 2NWSA 5CZ0A 3L5MA 5F4WA 4WUIA 3N14A 3HF3A 3ZS4A 4UFHA 4CNPA 3P67A 3NVTA 1J2WA 1G67A 4JY8A 1TPC1 4MZ1A 2HMCA 3CWNA 4R7JA 2FPVA 3MJYA 3QQ0A 3ZWTA 1QDSA 1LDCA 1ML1A 3VNDA 1WDWA 1KFKA 4AF0A 3W7DA 1IXPA 2QCFA 1S5TA 3W71A 4P61A 4JTJA 1SSDA 4NZFA 3R5EA 4Y8FA 2HS8A 1TPB1 1VGAA 3PWAA 5G5IA 3WK3A 5LNWA 4ICNA 5CZSA 1WXJA 2CLHA 2YCEA 5G4WA 1ZCOA 5G1YA 4PC8A 3DFQA 5FEXA 5EMUA 3IIZA 3MYOA 4ZL1A 1HL2A 3CB8A 2ZA3A 2B7QA 5EY5A 4IPJA 3G18A 4O19A 4O13A 2A85A 1GPWA 3G1HA 4XBSA 2QJIA 1LOLA 4WXZA 4HPXA 4YMZA 3EWXA 3NL3A 3OVRA 4JEQA 2DJXA 1HO1A 1QAPA 3BARA 3INPA 1VHNA 3KAOA 3W7NA 4QNEA 1RPXA 1XC4A 4DBDA 1Y0EA 4PCFA 4K36A 3EB2A 4K39A 1G4SA 4O8RA 3FS2A 3IIVA 4QM1A 1V7YA 1JCYA 3LERA 1W3TA 3DHFA 4UTUA 4ADSA 3PBUA 3QW3A 5CPLA 4PL1A 1JQVA 3TFCA 5G2HA 4WJEA 4Q32A 2Q3OA 2W79A 1H7NA 2G96A 3W74A 3SSJA 1LORA 3TIMA 3O6DA 1H62A 3CTLA 3L0KA 3B03A 1HUVA 4JTTA 1NAL1 4L4LA 1I2PA 3P74A 2Y85A 1DVJA 1SW3A 2GJLA 2J6XA 3NQEA 2CWNA 4O50A 2J9XA 3W7OA 4QAIA 5KTLA 1QPRA 1RQBA 3OEXA 4Z0SA 4JNMA 1F05A 1Z48A 4B5NA 3B0VC 3STCA 4HNVA 5LZLA 3QF0A 4UUIA 3UZJA 5F1UA 3TKFA 1TPWA 3MBDA 4XBKA 3BV4A 4MIMA 3O15A 3MI6A 3QM3A 1T8XA 2Q8LA 3SW6A 5CZTA 1JCMP 4KFOA 1FWSA 4LT9A 4P2VA 3S9YA 5G1TA 4JTIA 1IXQA 3QSRA 4LW7A 1V5XA 3SI9A 1AK5A 1YADA 2RDUA 3KVJA 2NUWA 4TMCA 2YPIA 5FEPA 3L65A 1KBIA 4O4VA 3G1AA 3W2LA 4O0KA 1OABA 5LKYA 2D73A 1NSJA 2VFHA 5LGXA 3SECA 3U8GA 4LC6A 4IOTA 1K7XA 3S5ZA 4DPQA 4LVFA 1O4UA 5MHBA 4WY0B 2DZSA 2G95A 1W31A 2J27A 1IF2A 2ZZ2A 3HMJG 1A5AA 5DCEA 4UTIA 2YX0A 1VC4A 4E2DA 4LU0A 1L9WA 1OVDA 2J24A 2YYTA 1A5BA 3W2JA 4Q4KA 3W7RA 1UBSA 1XBXA 4FO4A 2VFFA 1ZY9A 3HJZA 2QCHA 1TQXA 3CIXA 1P1XA 4X9SA 1LRTA 2FIQA 4AWTA 3LHYA 4DF1A 1WBJA 3KFTA 2Y7EA 3B0UX 1D3HA 3UWUA 1W5PA 2FJKA 2X1TA 4NJGA 1NF0A 3EX4A 2A4AA 3M1ZA 1DKWA 1JRBA 3RLVA 3M47A 3N9RA 3LCWA 2Z2UA 5HNRA 3B04A 5F4XA 1EA0A 3TC7A 4LS1A 3QFEA 3BVJA 5K9XA 4S2CA 1JR1A 2YYUA 3MMTA 2E68A 4IUOA 5BMXA 2DZVA 1M7OA 3KXQA 4XUGA 4UTMA 3FIGA 4CQ8A 5GVJA 3TV8A 3F1QA 4LVBA 3W7EA 4UMCA 3OVPA 3G22A 5I3GA 3LXBA 1KTBA 5HINA 2YW3A 1ZENA 4GUHA 2EHHA 3N9SA 4TU1A 3KX6A 2V82A 5KITA 2H8ZA 1KM2A 4IMCA 4NJJA 4O18A 1YYAA 3IVSA 3IIPA 4I7VA 5BOOA 4GRSA 3TXZA 2JKAA 2P10A 5D2WA 3CPRA 4W9TA 4LTSA 5HR7A 3DAQA 3TX9A 1UUOA 3E49A 3H53A 1VJIA 4UC5A 1UASA 3PG9A 1UB3A 2VEKA 2BSLA 3PBYA 3U6WA 2RKXA 4AH7A 4OQVA 1QPOA 2ZDRA 4DO4A 2A6LA 1HG3A 3KRUA 1OJXA 3M5VA 1KFBA 3NDOA 3LBCA 2GQ9A 4LV4A 2ZRWA 2WNQA 3BW2A 3TNOA 1F6KA 3EX1A 3L21A 3NQMA 1CX9A 3TSDA 1TQJA 4NNBA 1DJNA 3EXRA 4O1DA 2TPSA 1QO5A 1VYRA 5AN7A 5D2YA 4UNLA 1O5KA 3FKRA 3LHWA 4HNNA 1KTNA 5F2GA 2CFFA 1KTCA 4LUJA 4MJMA 4IX0A 5TIMA 5FF4A 3VFLA 2FLIA 4JGDA 2R14A 5D37A 4HT3A 1RVGA 2TYSA 1KM4A 3UXDA 1TB3A 2PC4A 3A5FA 1VZWA 2DJLA 4JX6A 3S1VA 4A3UA 3GXPA 4JIQA 3G1VA 3ELFA 3DGRA 5D04C 1G4PA 3IRDA 3C8FA 3AO0A 4IMEA 1KBJA 3OG3A 4JICA 2QEZA 4UTTA 4LVDA 1QNVA 4N6EA 2CLKA 2A1YA 4A2RA 3TDFA 3I7QA 3TJXA 4UTKA 1M7PA 1KM6A 3MHUA 3USBA 1FXQA 4RXFA 3EKZA 2EGZA 3FEMA 3HOJA 5TBOA 1YDOA 3GDLA
chains in the Genus database with same CATH superfamily
3NO5A 2OSXA 2ZDSA 5DN1A 1IZJA 1ZGDA 2AAMA 3H55A 1KD0A 5BXSA 3U7VA 1DWIM 2VR4A 3DYPA 1HJXA 1N55A 4GUFA 5EFDA 2OOGA 3N15A 4JOMA 1IEQA 2KAUC 4EXQA 1A47A 4WDUA 2GK1A 3GO2A 2A2IA 1GK8A 1QNQA 1PL9A 3AS3A 3G2GA 2Y89A 2HVOA 4LWWA 3T4CA 4BA0A 2E67A 4BCEA 1IT7A 3W7LA 2QF8A 1V0KA 2OYLA 2Y7FA 2Y2WA 4AYSA 2O7QA 1SFTA 8CGTA 3W27A 2WZEA 1H49A 4LUSA 1UMLA 2XDFA 4PRRA 3SY5A 4Q8VA 1LWHA 1X6LA 1LQ0A 4AB4A 4ADTA 2DQXA 1DXFA 4DUVA 1IIGA 1H63A 1FY6A 1ZQ5A 4KGJA 1H0GA 1W1TA 1FWFC 3CC1A 3FN9A 2YXGA 4R3UA 2ZA1A 3NSMA 2EG6A 4C6KA 3TN5A 1LJYA 3LI0A 3EWDA 2TMDA 1KFJA 3D3AA 2C3ZA 4UFLA 4QE1A 1ZP3A 3J7HA 5BOEA 4LNCA 3HG4A 1X39A 1UPPA 3GG8A 3WK0A 5TQLA 1EA9C 5CZJA 1AQFA 4XD6A 2F84A 3L4ZA 2D2OA 1Q6CA 3GVVA 4TMBA 4XAGA 2FB2A 3AHVA 1Q85A 2E7FA 3CAKA 4NRRA 4C7FA 4E3TA 2E8ZA 3S4TA 3WQCA 4ORMA 5J5DA 3GK0A 1TPDA 4YVXA 5LNSA 4WLCA 4LQ1A 3VKDA 2DPEA 1KCLA 2VZTA 3GNOA 3NPXA 2QHAA 2XVNA 4JTQA 5G4HC 3B40A 2P88A 2J7CA 1W9XA 4G56A 3O07A 3SQMA 2ZX7A 2VFGA 3NM3A 3MCMA 2TODA 3NZGA 4GVFA 4J9JA 4AZ5A 4GH1A 1AG1O 1UQZA 3S2CA 2IQDA 3GTNA 4JQAA 4LAMA 2C0HA 1NTHA 4D6GA 2POTA 4NJHA 3E02A 2BODX 2AOSA 3MV11 4FHAA 1ME9A 1HJUA 3GD6A 3CJPA 2AKMA 3MUXA 2PLJA 4Q8QA 3PR2A 4DJDC 5D9NA 1J01A 1M6JA 3CV1A 1UOKA 2NV2A 4GG9A 4JD4A 1AL7A 1TX2A 2GLKA 1YMYA 1QT1A 4W85A 1RP9A 3GKFA 1NWUA 3AWNA 4GYKA 3V36A 1S39A 1GOWA 1LL4A 1K02A 1RXOB 3PZNA 3ITOA 1RA5A 3DIPA 1VFMA 2JQXA 4W7WA 1VFSA 3AAMA 2UY4A 2P8BA 3UPBA 2Q02A 3LG3A 3N2OA 4HK6A 3APYA 1XSJA 3ARXA 2WXDM 2Y0FA 4A8IA 4IGNA 1NY1A 4GGBA 1CEOA 1TO3A 1XKYA 3IGSA 4IHCA 3MS8A 1ONWA 4Q7NA 1NFBA 3BQ5A 1M53A 1EGVA 4IJBA 3FVMA 1FWNA 2W63A 2C14A 3K4AA 5BRQA 3UJEA 3TTOA 1KC7A 4DZIA 1LOQA 2WMKA 5GQBA 3MSGA 1A5UA 4NASA 3WD4A 1P6CA 9CGTA 1F8IA 2GOUA 2W61A 4Q7IA 4PTWA 1AA1B 2JK2A 1HKKA 3MYPA 4GIYA 3W6MA 3VKAA 4KCVA 1EJRC 4D6CA 4Q6XA 1J11A 1UIOA 1PTGA 3L5LA 1F3XA 4GHRA 1FX6A 1JZ6A 2WWDA 3W75A 4HU0A 4K1GA 2DY3A 4Q3MA 1VQTA 3L23A 2H8XA 3EPOA 4YTRA 3G0XA 4ZQRA 3FJLA 1HFBA 2YA1A 5I3IA 2OJPA 4MWAB 1ME7A 3CH0A 1B1YA 1EZ2A 3SCVA 1TRIA 3EKGA 1BGAA 3PWGA 5ECVA 1XISA 1Q3NA 1UWQA 2QUUA 4QISA 1DJGA 3N4FA 2C71A 4MYXA 3NPUA 3PM6A 3KBMA 1IEXA 2X16A 5KINA 1I9CB 4P7LA 2GQ8A 1SSGA 3R43A 2ZZ6A 2BS9A 1I2NA 3BDKA 1IQ8A 3DGBA 4JKKA 5LIWX 1UKOA 2INZA 5C7HA 1CI1A 3IARA 3MVIA 2VEGA 1DXEA 1TV5A 3PZUA 4U3AA 3N73A 4QLLA 4D6HA 1CGWA 2BNJA 4QHRA 1WQ5A 2EPNA 4MAZA 2BWGA 3WLQA 4GCXA 4KWVA 1OD0A 3SY8A 1LG2A 3PUOA 3N1AA 1C93A 2VNCA 5TAOA 2AQOA 3W01A 5FJRA 1JULA 2WV8A 4GFIA 3GVRA 1US2A 3GDKA 4DI8A 3LPGA 2CLEA 2BG5A 3S1XA 5G4EA 3VD9A 5D2VA 3TC6A 3W23A 3DDMA 3NURA 5FJIA 3FGCA 2G3FA 2ZFAA 4FF5A 2OWCA 1PV8A 5F2LA 1K4GA 2O56A 1FXPA 4NHVA 2BX7A 1SQ7A 4YNGA 3W2KA 3AOFA 2QULA 1EL3A 1KCKA 1KM3A 4GQGA 1XI3A 1WP6A 3LHZA 4JCLA 4LUTB 3CYJA 3T8LA 3GG7A 5AKQA 2Y24A 2FFCA 3V0UA 2YA2A 2XYLA 2E9BA 4B5XA 5HOSA 5H8PA 1GZ1A 4I5RA 3BPWA 3GU1A 2C8NA 5E93A 3AIUA 3QMTA 2G3IA 1GTEA 2ACSA 3NDYA 3TR2A 1YXYA 3AWOA 4KFNA 4XIAA 1HGYA 5HK4A 1HXJA 3UR2A 2C15A 4FLOA 4PZVA 2F8QA 3VM7A 4PTDA 7TAAA 4MJZA 4N9CA 2XSXA 1XH2A 5CC3A 2DSKA 1Z8AA 4S3CA 5I02A 3WJZA 1AH4A 4PMUA 3UVAA 3THAA 3U2OA 2BY1A 1TIWA 1OFAA 5CEWA 4DX3A 4WZHA 4C1LA 3C3NA 4LVGA 2RGLA 1FUYA 2NVAA 2R1LA 1WV2A 2ZZ5A 3MCNA 3B8VA 3W1RA 3NVDA 1ZPTA 1QNRA 3KBSA 4TX8A 4AYGA 3WH9A 4D8AA 5H2ZA 1AFSA 2OX1A 4O1CA 3GYCA 2WKJA 3WEMA 1CXHA 2ZE0A 3WN6A 3GVGA 3IUHA 4E2OA 1SMAA 4GJJA 3F2DA 2W92A 5D38A 2NW0A 2O9PA 3PNZA 1X96A 1PTDA 2JGQA 4XKMA 2BGSA 2XVPA 4EWJA 1VLWA 4GO9A 2PDMA 3QV9A 4MJ2A 2PGRA 1S2WA 3GXFA 1VCFA 2Z28A 2GK1B 2QMKA 4JTRA 4MB1A 2DQWA 4HHHA 3AHYA 3STEA 4F9JA 3NZRA 1Q2SA 1DJHA 3PZTA 3H22A 1WX0A 3N6HA 4C6IA 1V51A 3GR8A 4GBDA 1OX4A 3M6YA 2Y62A 3WK2A 1M7XA 2WK2A 3AYRA 3KOWA 4HHMA 3D0CA 4KMQA 2GWGA 4A29A 3GHSA 4Z2JA 3KZPA 2A21A 5M17A 2PDKA 3UBPC 3MUZ1 2D1ZA 3CWOX 3VOIA 1RZMA 4XKYA 2FKPA 5EU9A 3NYZA 1M41A 5E5CA 1DYSA 3ZJKA 5HJLA 5C55A 2FYMA 1R46A 3ZOAA 1Q6FA 4UQEA 1M5WA 3NTYA 4PBFA 3PULA 2D3NA 2WO5A 3H12A 5ENLA 1FA2A 1MNSA 1EHNA 4M81A 2I9EA 2VKZG 2WKLA 4E8CA 1G6CA 1NOFA 5A6LA 4YN5A 5IBXC 4LCSA 1OYCA 1XGEA 4EWND 4MNLA 1QOXA 4MFEA 1TR1A 1UWTA 4O28A 1KB3A 5IFPA 3RDKA 3HMCA 4I5UA 3TMQA 1LT8A 1RLCL 1UH3A 2CXGA 2E6AA 1DIKA 4GVHA 4KETA 1J10A 2ZUWA 1EHAA 4H6RA 2NQLA 3NEVA 3CXOA 3ABOA 2HCVA 3M0IA 4A05A 5K9CA 5FF3A 1HP5A 1ODZA 6TIMA 4K7VA 3TQ0A 2FQIA 2BMBA 3GFYA 4KRUA 3C61A 2PRMA 2ZXAA 3A4JA 2HTMA 3W88A 4GQRA 4G5DA 4O57A 3WD3A 2FPTA 2FPYA 2G5WA 4HU4A 3F4NA 2NVDA 4CQDA 4IISA 3BLLA 2ZICA 3LHTA 3KP0A 1UPMB 4JHZA 1CBGA 3L68A 1VB9A 1EJ7L 4JTGA 3U4FA 5C0QA 3IJQA 4GMEA 2O4MA 1ZLPA 3EBVA 3IJ8A 1LG1A 1WYIA 4K1WA 2H9AB 4H8HA 4DUOA 2GGGA 4B5SA 1E73M 3VCRA 4FX6M 4L56A 4BWLA 1UKSA 1WOAA 1Q5MA 2PLCA 1G4TA 2EKCA 1CWYA 1Q6GA 1TMHA 3WL0A 1H7XA 1FQ0A 4A35A 4UFMA 2CLPA 2IKGA 3P84A 4M80A 1RK6A 3E0IA 5LXEA 3CYVA 4BR1A 4Q4OA 4FEZA 2DZPA 1YTDA 3AZRA 3BMVA 5I3KA 5FESA 1E0XA 4F0LA 1UG6A 2QCLA 1A5MC 3V4BA 2XH2A 4EF9A 3NQCA 2B0MA 3ARTA 4M1RA 1HZYA 4TXEA 3WNLA 1TJRA 3TTSA 2YR1A 1IXNA 1TWSA 1DHPA 2CBIA 1JD9A 2BGQA 1W1ZA 1QVBA 2EF9A 3AS1A 1XHGA 2W5FA 1S2VA 3P3BA 1VF8A 4PFHA 1J0IA 3TZFA 3APGA 3BJFA 4KWUA 1VBUA 3DG7A 5FACA 3GDMA 2QAPA 1AJZA 3FXGA 3W2UA 1RD5A 3T08A 4GYFA 2VI0A 2VR2A 3W1NA 1F5ZA 2D23A 1H7OA 4FALA 4IFKB 3GXTA 3OGVA 4NKCA 3W72A 4JFVA 1WBHA 4RK8A 1TPVA 1XYZA 4ORIA 1V77A 3GZ3A 4OGZA 1C9DA 1J93A 3E2SA 1A4MA 5CSYA 3UD6A 4K2SA 1WDRA 3H4XA 5LIXX 2DV0A 3QKEA 4ZODA 3SSZA 3KBJA 2PDFA 4DB7A 1GVOA 1E1CA 1IEVA 4DUXA 1H4PA 2Y5EA 4XVDA 3BWWA 4QEHA 4BF9A 3WD2A 3FSUA 1LYXA 1ZP4A 2OEKA 4ZSUA 2XIBA 2W62A 1H1NA 4M6PA 4A3YA 3ZT6A 2E5CA 3K30A 4M7TA 2PZ0A 3GIQA 1OIMA 4W88A 3LRLA 1XYLA 1WCGA 3NQGA 3VD7A 1V6XA 3S5NA 4QDWA 2Y8KA 3CUXA 3DENA 3UZYA 3WQOA 3RG6A 1JPIA 4R33A 2PUZA 1V3MA 4YVVA 1FWBC 2DDXA 4IGHA 1SYTA 1Q6RA 3P93A 3LXCA 5FEZA 4FNPA 3CZKA 3VDGA 3V1PA 3A3WA 1JJKA 2YDQA 4V27A 2X09A 5H8UA 4L6DA 4DXKA 3LCXA 1OT2A 4XZHA 2XIIA 1PZ3A 2DT3A 2VDIA 2VC6A 1SU5A 3EXTA 4UXDA 4FX8A 1KLYA 4AIEA 7ENLA 4WHBA 3A24A 1C92A 1TTJA 3E6EA 2FHCA 1YPXA 2CERA 2TSYA 5LHFA 4OU1A 2VDGA 1ICQA 3O63A 3RM9A 1OFBA 4KRZA 1FWIC 3IGHX 1FWRA 2J8FA 1E51A 4LY8A 1XX1A 4WJ8A 3L2MA 3B4UA 3GHTA 2CKRA 3RM4A 1W1A1 4RXGA 1JUEA 1JPMA 1DE5A 4IH3A 4L9ZA 3LHUA 4HOZA 2V3DA 4PTNA 3OVGA 4K8EA 2DUZA 3TYEA 3WF4A 1IT8A 1J6OA 4X63A 4JX4A 4AXKA 5PTDA 5G2IA 5BNKA 3WJSA 2ZA2A 1O60A 4JTFA 3R4IA 3MP4A 3MKCA 1XLIA 4TR9A 4AEFA 1B30A 2IPWA 3CMGA 2A7RA 1GCYA 3SGGA 4GI4A 3LLFA 3ITVA 4HA4A 3RPDA 1G94A 2BVYA 4ZOEA 3RJYA 4MTVA 3VZYA 1EH9A 1XCXA 4H83A 4HZMA 4F3HA 3QPYA 4MB5A 5HWMA 1AMYA 3EDEA 3WQFA 2BP1A 1F7BA 4XSMA 4G7EA 4GXWA 4IX2A 4L1WA 1MDRA 3GKAA 1X7IA 3ZVIA 4HNUA 4CNUA 1IXOA 1Z6KA 2JGYA 3T40A 1C8QA 2WLYA 4PB3A 2ZZ4A 3GBEA 3KOYA 4QITA 5A6BD 3CEUA 1K3UA 2WZTA 1PZ1A 3ECQA 2Z2BA 3GNNA 1HKJA 2WQPA 3DFPA 3HG2A 4FIQA 1I6NA 4B92A 2WNZA 1DBTA 3I7RA 1M65A 3GM8A 3N04A 5AZ0A 4Y9NA 5KMYA 3NPWA 4OIFA 4KEZA 4ZQCA 1OX4B 2J4GA 3TFXA 4CCCA 4GJ1A 1V0NA 3DFNA 3ALGA 3L0GA 4DBSA 5CGQA 4AIUA 5I00A 4BKNA 4NG3A 1H5YA 3LLXA 4HB7A 1VAHA 4CN4A 1MWOA 4WY0F 2PDWA 3IJ7A 2OPJA 4N2YA 1OM0A 2OCZA 2YDAA 4N9BA 4GZJA 4GZ7A 4XKYB 1XFBA 2X1RA 4C6CA 4QG9A 3GXNA 1O1ZA 3C52A 1XRTA 2IMRA 4HK7A 2DT1A 3FYOA 1LBFA 4XO6A 4LGXA 1Z9AA 1HF6A 1R3RA 4CD7A 5AECA 3P60A 2ABBA 2DZUA 1PPIA 4ZO7A 1K8YA 4GISA 3N25A 1FWDC 1T99A 3KRSA 4PRTA 2BXZA 5HAOA 1G4EA 2A7PA 3VMNA 1W3IA 3GW3A 3W76A 4B9ZA 3FXYA 6TAAA 3UA3A 3KLLA 1NF7A 3G3MA 5CH9A 1EP1A 1Q45A 4QG6A 4KIRA 2QJMA 3GVQA 4XG1A 3CUJA 4C1NB 4XZWA 4O15A 3H2OA 1XINA 4J3WA 4UB9A 4NX5A 1MQPA 4HNCA 3VKCA 3SO7A 3A9BA 2ZUVA 3FOKA 1KRCC 1KRAC 2VC9A 5A6JA 2WSKA 2XIJA 2PPGA 4H9YA 1MXDA 4MLRA 3MWAA 3LRMA 3UZZA 1RUSA 4R9XA 4HTBA 2EJAA 3ZLFA 3QZAA 3WFZA 5FJOA 4YTUA 1UD4A 1HW6A 3S1UA 5C8BB 3H8AA 2DVTA 4F79A 4ICMA 4AMCA 4DXXA 1P48A 3PSWA 4C60A 4XSLA 3BLDA 2PTZA 4MAVA 3GIPA 4DAIA 2NX1A 3ZJ8A 1LROA 4RDYA 4DYKA 3OB8A 1XXXA 1E40A 3CL8A 2QT3A 4Q8PA 1A0DA 4OUEA 3PUDA 2ZKMX 1W56A 1L6SA 3GIYA 2F38A 6ENLA 2F6KA 1Q13A 2Q3RA 5HJYA 3KTSA 1G0CA 4KEUA 1Z69A 1AW5A 2VC5A 1OF6A 4N9DA 3MI3A 3P81A 1PIIA 1IHIA 1KQYA 4ZO8A 5D30A 1RLDA 3TWAA 3TA9A 2D0HA 3CQJA 2CLLA 4AEEA 3KBVA 4DBUA 5AC7A 3UQNA 1JCLA 4IIBA 1F4HA 3E5PA 4V1XA 1VR6A 3CIWA 2BTMA 1EOMA 3LX9A 1XICA 4HSOA 4M82A 3T8QA 1R85A 2PLMA 4U5IA 1YNYA 3LXAA 5DT5A 3B3DA 2QGHA 4H04A 1PX3A 1UP2A 3A47A 3VD5A 3M16A 1DEDA 2NWSA 4QFUA 3L5MA 2NQZA 3A3XA 3DYOA 3HQOA 5EMYA 4IPNB 1J2WA 3PNUA 4MZ1A 2VC7A 2PSNA 1V4YA 1FHVA 3QC0A 1QDSA 1OB0A 1ML1A 1KFKA 3W7DA 2WJDA 1EIBA 2QGYA 1SSDA 3R5EA 4B15A 4HBKA 2HS8A 1ZL1A 1TPB1 3PWAA 3GH5A 5FEXA 2PA6A 4UZSA 2A3HA 4JQ4A 5EMUA 1M03A 4R27A 3WMLA 3WKZA 3VC5A 2PAJA 5EY5A 3G18A 4HQVA 4O0QA 1GEHA 3FA4A 1GPWA 1V6TA 3QKZA 2QJIA 3MV01 1LOLA 2FHBA 4K8GA 1V02E 4GACA 1WNOA 3EWXA 4KBXA 4Z2GA 4A8NA 4MPKA 2PP3A 2ZWYA 2WHJA 4QNEA 1XC4A 4K36A 1W9BM 4NZ1A 4QM1A 3QW3A 1UW9A 5JMUA 3BL3A 3NZPA 2Q3OA 1H7NA 3W74A 4NL1A 3PJTA 1N8WA 3VIPA 1WO2A 5IOBA 3B03A 3IS4A 1UROA 4Q8MA 5BXRA 1SW3A 2GSJA 1AJ0A 4WGHA 5C2GA 1ITCA 2RDXA 4QAIA 3BAIA 4Z0SA 1HKVA 3ZT7A 3UG5A 4H8NA 1Z48A 4B5NA 4M29A 5LZLA 3QF0A 3ONCA 4EAMA 3MBDA 4DJFD 3MI6A 1E9YB 2HQAA 1JCMP 1N82A 1TZ7A 5BXTA 4LT9A 4FP1A 2YLAA 1KXQA 2OZ3A 9RUBA 1FKWA 3FCPA 4Q4PA 5G1TA 1IXQA 1AK5A 2W9MA 3KVJA 1MFVA 4TMCA 2Y8VA 4IQDA 2CHRA 3SQLA 3L4XA 1MXGA 4LANA 1OABA 5LKYA 2D73A 1DP0A 3U8GA 4RE2A 1W31A 4ML4A 5CGMA 3LS9A 1DWHM 4UTIA 1VC4A 3THUA 4LU0A 5GNXA 3FA3A 1A5BA 3L4UA 4ZXOA 3UG8A 4FO4A 2OWWA 1UWIA 3MU7A 5C71A 1YW1A 4P5UA 1BYBA 1P1XA 3AROA 3GXIA 3LHYA 1UA7A 3AIBA 4JNYA 2C1IA 5GJPA 1WBJA 2AKZA 2WC7A 4Z2KA 1D3HA 4NJGA 5A8NA 3W02A 2A4AA 1JRBA 3RLVA 4F66A 2EPMX 1FWEC 2Z2UA 2G8ZA 3B04A 3WG6A 3JZUA 5F4XA 5FKYA 1RBAA 1L8NA 3TC7A 3QFEA 4S2CA 1JR1A 2E68A 5BMXA 3KXQA 3SCNA 4NI8A 2PI6A 1RBOB 1TWIA 4CD5A 1QI2A 2G37A 4HCLA 2ICSA 3TV8A 2HPMA 3PTMA 4CU6A 3OVPA 4H7CA 4AZIA 3WF2A 3ID7A 5I3GA 1US0A 2PP0A 4ENLA 3N9SA 4LBSA 4KWSA 4IFRA 3BZJA 2R9RA 1UZHA 1YYAA 1B90A 2HEJA 3IIPA 5BOOA 2CESA 4GRSA 3TXZA 3CZJA 3CPRA 1B3ZA 1W17A 3IJLA 4KIEA 3GC5A 3TX9A 1UUOA 3TOYA 1A5OC 1VJIA 4UC5A 3PG9A 2J7BA 2VEKA 3PBYA 5GPRA 3VKBA 4AH7A 4DO4A 3SN1A 4AC7C 1HG3A 3KRUA 1AD1A 3NDOA 4XIMA 2Z00A 2XGBA 1SGJA 4U2YA 2ZRWA 1E5JA 2G3MA 3R0UA 3L21A 4AZCB 1E4LA 4P8WA 2J66A 3LHWA 4O8AA 1KTNA 4IIEA 4LUJA 2PWUA 3M0VA 3P0WA 3XIMA 4DO7A 4JGDA 3CZEA 1FKXA 2R14A 1RVGA 2TYSA 4JFTA 3JUGA 3F2BA 3M64A 1YRRA 1VBGA 2ZUMA 3G1VA 3ELFA 3FY1A 3IRDA 3C8FA 4IPPA 4IMEA 4JFSA 1Z32X 2QEZA 1L2QA 3TDFA 1PJ9A 1VP5A 3KUMA 3WD1A 4UTKA 4AIBA 3ANVA 2QIWA 1YDOA 2W66A 4WKAA 1K9DA 5B80A 2ZRYA 5CKSA 4I8DA 1TG7A 4IG2A 4JN7A 1A0EA 4S3FA 5LIYX 2WANA 4HJFA 1LRNA 2XVLA 1QPQA 3BANA 5C2XA 2XM1A 3VGHA 3QQWA 1NOUA 3MMWA 1B4KA 3BOFA 1W5MA 1U1HA 3UNDA 1ZB5A 4PB5A 2B4GA 5I23A 1PXGA 4RZ6A 4W8BA 2J13A 1X7FA 2DH2A 1A5KC 4GUGA 4PSRA 3AJXA 3OW1A 4F0KA 2F2KA 3SCRA 4I6VA 2VWSA 1RR2A 2V0TA 2ACUA 4C7DA 3ORWA 2O55A 1AW2A 4LAUA 3SURA 3L7RA 2J88A 1XUZA 5GNYA 5HQLA 1VFHA 4DF2A 2JF7A 2NX9A 4JTCA 3W85A 4HYWA 3VNIA 3W4RA 4BK9A 4FLQA 4HP5A 5DMLA 1GVEA 3JR2A 3M46A 1BRLA 3C2VA 4LB3A 2WC4A 1TPUA 2RDTA 1FCBA 3ZR5A 1C91A 1A5LC 3DFOA 4FA3A 2V63A 5CQ1A 1ICPA 4HNOA 1XLEA 4GNJA 2Q71A 3NQDA 4NILA 4F4RA 3UA4A 3O05A 3OPSA 2AMXA 4KT2A 1TV3A 2YB4A 5A8GA 4Y6GA 2EPHA 4OJYA 1HX0A 4JTDA 4E0CA 3QHMA 4CNSA 4V15A 1V3LA 1BYAA 2R24A 5HATA 3KZSA 1W2VA 4UCGA 2DSZA 3V0SA 4N42A 4CN1A 3ES8A 2OKTA 3W28A 3B0YA 5D03A 2UY3A 1E15A 1WPCA 5E9AA 1DORA 3UY7A 1RBLA 2FTPA 4GWEA 1ITUA 3RO8A 3BLPX 3QYSA 2PZNA 1XG3A 1SUXA 3C0SA 3RPTA 4G9PA 1XIFA 3DKLA 3KLKA 4QIUA 3CWHA 2GPTA 4K68A 1I2QA 6ALDA 1B3XA 4FSAA 4L1GA 3N2TA 5IBXA 3S6TA 1J0HA 5IM51 1CLKA 3H23A 1SM9A 3BAYA 3VZZA 2CIPA 1HQTA 1C29A 1JYNA 3GC4A 1PZ0A 2NX3A 1Q6DA 5EMKA 4HIBA 3H7RA 4Z0JA 3RR1A 3W0KA 5A1AA 3CT7A 5CPMA 1PHWA 4IICA 3EKLA 3LCLA 4AVOA 3CQHA 4LBRA 4MWAD 1RCOB 4X9YA 2QDHA 3WO8A 3VIFA 3T42A 1W1PA 5FJJA 2XN0A 2BVWA 1J96A 4GH3A 3WYZA 1DOSA 4HA3A 4NRSA 4JYDA 1A53A 1XBVA 2PDJA 1CW2A 4DNHA 1D7FA 1JEZA 1U1UA 2YBVA 1K7EA 4H00A 1TTIA 1JZ2A 3VX1A 1C8XA 3FKKA 3NXFA 3POHA 1TWZA 2QUTA 2WMJA 3OBEA 3M0JA 1TSIA 1ONXA 3QZ6A 1IGSA 3RMJA 1I2OA 1UR2A 1DQXA 3DFYA 4TV5A 2Q09A 1XIBA 2BASA 4R53A 2Y61A 1OX5A 1ZS2A 4RNFA 2WCSA 1SZEA 4H9ZA 3CAWA 1R2RA 2IQTA 3OHIA 3S5OA 2XN2A 4JFWA 3FJNA 5IDZA 3ARQA 2VX5A 4ZTXA 2ZRVA 1MEWA 2IXUA 2W3ZA 3NCOA 4XAYA 1QASA 3S83A 4RX0A 4IPIA 3RO6A 3L67A 3BSGA 5MF5A 3TYZA 1XLGA 3AHZA 3LTYA 3N2CA 3BAXA 7REQB 5RUBA 2C0AA 1XLCA 2OEMA 4REQB 1JIBA 2XTKA 5AVNA 5EPDA 5HDRA 3ES7A 3DXIA 3XISA 4YTSA 1CB2A 1F8MA 3WF1A 1L8PA 4QP0A 1R9ZA 4NQ1A 1G7VA 3VMPA 4DYJA 3PB0A 2ZXQA 4IXXA 4Q4MA 1G7UA 3MPGA 1GQNA 4D2JA 4RE3A 4AVFA 4C6DA 2XSBA 1E6QM 3ALFA 1TVNA 1CXFA 1K9FA 3N34A 4JIEA 3SY1A 3T07A 4AHOA 3KRBA 3EX3A 3OQ8A 4JL1A 4HOXA 3RR4A 3STPA 1ZJBA 2AL2A 4HN4A 6A3HA 2F6UA 3M44A 4C6LA 1E71M 2CU0A 1CCWB 3P5YA 3TA6A 3L9CA 4QE5A 3VVGA 2ZCGA 3E9AA 1J9YA 1U83A 1CXIA 4GVIA 1W2PA 3EZ4A 4DWDA 4N9EA 4MNJA 1XYAA 3ME3A 2OR2A 5DCBA 1Y5VA 3DEQA 4WKFA 4OV9A 3LGGA 3VOGA 2ZZ1A 3TJLA 4GIRA 5I6SA 1VBRA 5M3WA 4Z1DA 1BGGA 4R85A 4Y2WA 3GAKA 1CTNA 2B7OA 4DM2A 2QZRA 3WFAA 1K7FA 3E2VA 5ABGA 1XGDA 5LA1A 2YZRA 1YDVA 3CNYA 3QY7A 2P3EA 3NGJA 2VX6A 3NL5A 2ADAA 1B5TA 3O1NA 1BXBA 3UCDA 4XBJA 3FAWA 4DJFC 1UD3A 3CAQA 3BG5A 2TRSA 2HV5A 2YCLB 4A3QA 4B3ZA 1MUMA 4HHLA 3F2CA 3IWPA 3LUTA 3KOXA 1PYFA 4QSFA 1S5MA 1CNVA 4FX7A 5C2CA 2X0HA 5I0DA 2XGZA 3IIXA 4Y9AA 1TWWA 5EMMA 2IPGA 2G50A 1E6ZA 4K6AA 1R6WA 1UZ4A 4LJ3A 2HBVA 4WSHA 3SUWA 5EFFA 2BZNA 1RA0A 3BLEA 1EQPA 1EJTC 2Y7DA 4S3GA 4RW3A 3PF3A 3GG0A 3SADA 5HNNA 1T6MA 2BOFX 4PUJA 5HWNA 4NZ4A 1B3YA 2ISFA 2WNNA 3NO1A 1EF3A 1EP2A 1EKOA 1R5YA 1OF8A 3M4HA 3H2MA 4S3AA 4A22A 3IAQA 1I8JA 4N4PA 4YYFA 4NZ3A 1LTDA 4C6FA 1FWGC 3PJUA 4F9DA 2QR6A 2P50A 1Q6OA 1XYMA 4ATLA 1VHCA 3UG3A 1FCVA 3N29A 4TTUA 2QJHA 1XBYA 3OOQA 2B31A 2F9RA 5CCZA 4PMDA 4TUFA 3DFHA 5I79A 3S1WA 3VDBA 2DSWA 3W1TA 2BVTA 3THDA 1RP8A 4UR7A 2I16A 3PP7A 4QLKA 5M2FX 4O1FA 4RZ4A 3BG9A 3TK7A 4GC4A 1M68A 5A95A 1BXNA 1Q66A 3DN5A 3DUGA 4O1AA 2XN1A 2WSQA 4C6BA 3M7WA 3WEZA 2J77A 1EWEA 1O7AA 1KM0A 3AALA 3NJ3A 1MQQA 3WUFA 5L9FA 2OQLA 1POKA 1AQMA 4TVUA 2EEXA 2Z6IA 3IIOA 5LNUA 4JPGA 3T78A 6XIMA 1HTIA 1GORA 1NELA 2NV1A 5CAHA 4KKXA 5FD0A 3EGJA 3VXGA 4GC3A 2NSXA 2FH8A 4E3VA 3EB3A 4HMCA 3TN3A 1X6UA 2QCNA 4A3RA 2I9UA 4GGHA 1I4NA 3C56A 4JQ2A 1NP2A 4QAWA 1EJXC 3UFYA 3QJAA 3S9ZA 1TJ2A 5C7VA 1PWMA 5DY3A 2C18A 4DZHA 3NO3A 3S42A 1BRLB 1NARA 1A5SA 2KX9A 4FR1A 2WBGA 4UR8A 3EPNA 1VFFA 2WLZA 3IUIA 1O12A 4GX9A 4HMDA 2X2GA 1UHVA 3BCDA 3R11A 4WK9A 2Y6ZA 1UKPA 1H11A 3RLUA 1PS9A 3RYSA 4L7ZA 4UZUA 5CG7A 5I24A 5D09A 4L5ZA 4AW7A 4RE4A 2XISA 3SRHA 4AD0A 1B31A 4OBTA 2I1OA 1GEQA 4XUYA 2V5LA 4Z2LA 3CHVA 4A8LA 3S9IA 4JN6A 2D3LA 3DC0A 4O1BA 4H6QA 1EC9A 4TVCA 3GAYA 1H5VA 4YVPA 3FA5A 3W37A 4KFPA 1W3HA 1SO3A 3SFKA 4AISA 4URIA 2DIEA 3TYDA 1EP3A 3N6QA 1NDWA 3FHQA 3HGOA 1ME8A 3CHEA 4MYAA 4ZR8A 5I78A 2GVGA 1P0BA 3EXSA 1F74A 5E6YA 1DJIA 2R6OA 3MQTA 3QYQA 5IHRA 2YDRA 1HGWA 1R7AA 1EJWC 4AWSA 3UCQA 3V75A 1OX6A 3OA5A 3G1DA 2V30A 4Q8NA 2H90A 2YXXA 1SJCA 1T8QA 1AVAA 2PD9A 1BVWA 4L1XA 1MZHA 3EWBX 4J3XA 2A0NA 1BF2A 1TYGA 4DRSA 1GOOA 4W8LA 1HT6A 2XIMA 2VEIA 1VBHA 3O06A 4KF1A 3SZ8A 5I3DA 2QJNA 1VRXA 3VD4A 4QJ1A 3VTRA 5EGRA 3LCIA 1TTPA 4HJWA 7TIMA 1XRFA 4L6HA 5D9MA 2DORA 1UR9A 1SVDA 3UWEA 3DESA 5HNUA 1W3KA 4JCMA 3GHUA 1UYQA 4O11A 3MMDA 1TJ1A 2X40A 3MDWA 5IXEA 4FXSA 3H6OA 4C91A 5MKGA 5HPCA 3BG3A 1I0BA 3H2AA 3DKJA 2FFIA 3HGSA 1CENA 4KERA 2BY2A 5K9DA 4DO6A 3KCLA 3CQ0A 2J9YA 1AODA 1P0NA 4MKVA 3CLWA 1WKFA 1W5QA 1R38A 3PZIA 1XIHA 1W1YA 3FLUA 3Q4DA 3WNNA 3T6CA 1WAUA 1GZJA 2HS6A 3OYZA 4HSNA 2JBMA 3DERA 3QFWA 5CJ5A 2XWEA 1TJPA 2JE8A 4U31A 3R7MA 1ZAJA 4AAJA 4Z1AA 2P5NA 3WLPA 4N0RA 4J3ZA 1CB7B 2PDXA 5IDIA 1A3WA 5C9UA 1FWHC 2VZSA 1E0UA 3TQVA 1GW1A 4GI6A 3CV6A 4CKQA 2C1HA 4QG8A 3RU6A 1K4HA 2XWDA 1LL6A 3R8GA 2W6RA 1V3HA 3G77A 2CZ5A 2ESCA 3UYCA 3VYLA 1UCWA 4MKSA 2CNCA 3WX7A 3BLKA 3CV2A 3T0DA 3R89A 3PZ9A 2X8RA 5DBUA 2A79A 4KWWA 4Q8UA 3PANA 5LA0A 5CPTA 2VUYA 4E2VA 5HUPA 1R9XA 4HZ8A 1XLKA 3YPIA 3QOKA 2ISSA 3VILA 2AL2B 1MW1A 1KBBA 4BEQA 5A2CA 3O16A 1ZZMA 4BEUA 3W7KA 4TIMA 4ACYA 4XD3A 1W9UA 3ABQA 4NVTA 1ZAIA 3E0LA 1RPKA 3TOPA 1LWIA 4DI9A 4WCJA 4IPLA 1QNSA 4G1NA 3W7HA 3TU9A 1TWDA 5IRPA 3ITTA 4GY7A 3WQEA 2PU0A 2W67A 3WELA 3IGXA 1PCKA 3RITA 3V0TA 4CVUA 2DT0A 4C1KA 1TZZA 4UTLA 3SUUA 1OG0A 4JAWA 4NX0A 5FAGA 1VFTA 4D8ZA 4Q33A 3TVAA 2DZTA 3RRAA 3VCNA 4BS0A 1VRDA 3WLTA 3KWXA 1Y65A 1O66A 4UOJA 1KM1A 1Q65A 3G6MA 2FTYA 1B4EA 4NUWA 4HNLA 1XW8A 2Q01A 2HSAA 2XZ9A 3ABXA 1WZMA 3TNBA 2FTWA 1VS1A 3AXMA 2RJGA 2E6FA 4CNNA 4AG0A 1CGXA 2W27A 1O5RA 3CL6A 3UJSA 2XIOA 1AL8A 1W1IE 4BI5A 1H60A 4DJEA 1HP4A 4M1BA 3FYYA 3LI1A 4V28A 4WR3A 4LB4A 4E4UA 5JBDA 3RCNA 3VIGA 4EK7A 1SW0A 3G8EA 4WDTA 3AIWA 3WLNA 1RJQA 1LL7A 2IKJA 3O8AA 2OXNA 3PC0A 4GBUA 1RQHA 2QAFA 4B2DA 3U7BA 1MW0A 4JL2A 4JTSA 2WSPA 1KXTA 4H9VA 4Z42C 5CPQA 4FXRA 1E56A 4R9OA 1S2CA 3H26A 3N12A 3RF9A 2X1UA 1F76A 4A4AA 2CCRA 1T40A 2REQA 1E9ZB 1XL9A 5HR6A 4LS0A 4DWSA 4BJHA 3B0PA 1FDJA 1BAGA 1QI0A 2DZBA 3QEZA 4HHPA 2QDDA 3BSHA 5JIWA 4AZBA 3SRDA 3HG3A 1OEPA 1UMYA 2PD5A 4LEFA 4J3VA 5DLCA 1W37A 1D3GA 4M7SA 4I3GA 1ADOA 3NM1A 3R79A 1N8IA 3SJNA 1R3WA 1U2YA 2ALDA 3EA1A 2PDGA 1UA3A 2J78A 1FWWA 4HU3A 2FGZA 4O53A 1SJAA 3WF3A 3MHFA 3TH6A 4RZBA 4KGLA 1F9CA 1K8XA 3H2FA 2AGKA 2PDQA 3CS2A 1EB3A 1QWGA 4DHGA 2FDSA 4GE8A 4WD0A 3EOSA 1VEOA 2HK0A 3H7VA 2NV9A 3SR7A 4DUWA 2Z4GA 3ITYA 4JTLA 4F40A 1NFGA 5DMNA 4K37A 2QCGA 5AC4A 4HYRA 5LIKX 1FWAC 4B4HA 3E1F1 4YJ5A 5CPNA 1TPFA 1DXIA 1MO0A 2V69A 4JTUA 1XDJA 3I6RA 3W3OA 1DE6A 1MEHA 3PPHA 1KXHA 4WX2A 2V5JA 1UJPA 2PTDA 4YPJA 3UVIA 2GQ3A 3GZAA 1DWAM 3VDCA 4B16A 2J7FA 3RRXA 4EVZA 4FAMA 1XWYA 4IIDA 4GI9A 1W32A 2VEFA 4LRTA 2L5HA 3WENA 1LLWA 2X7VA 1VPXA 2WM1A 2ZRUA 3OLEA 3S46A 2EJ1A 1V3JA 3UXAA 1RK5A 3CHCA 2FZNA 2LLEA 1KKRA 2HNHA 4CEXC 1BKHA 4ZQOA 5DXXA 1UJQA 4L4MA 3TUUA 4RUBA 4WDWA 1RQEA 3FEQA 2YCIX 2NXIA 5D9OA 4LVAA 3W26A 3NAVA 4E2BA 3PZGA 5BCAA 3MZNA 4R34A 3GNRA 3AIRA 4FNRA 3GB6A 2WOQA 3G0UA 3TJ4A 3WBAA 3T2QA 1DPMA 2PC8A 1M1BA 2YGYA 1UKQA 2E5BA 4AMAA 2VRQA 1TPEA 1DQUA 1UD8A 3PBWA 3P8IA 4ZSTA 1JCTA 2OOFA 3P2VA 2YFNA 2ZC8A 4GYJA 1OZMA 1P7TA 2CWXA 2DP3A 3REQA 1GVRA 1OC6A 4L4PA 1XR2A 5JBEA 2G97A 3EA3A 2YL8A 4ZEPA 3W81A 3MWCA 1IWPA 2E6YA 2WZMA 4IJRA 4JY9A 4EOUA 1W6TA 2BFGA 1W3NA 1O5XA 1OGBA 3TYBA 1DJQA 1DIDA 3RLGA 2CLIA 2IPJA 5A69A 2DVUA 2EPKX 3AXIA 1XGZA 4MY9A 3VMOA 1PCWA 2DFAA 1LF1A 3TEVA 1SO4A 4LOCA 3L4WA 4WDXA 2X05A 4RR4A 2PCQA 1F61A 4NZCA 4IWWA 4WSJA 3K8KA 4M3PA 2CZDA 3SN4A 3G8RA 2BB0A 2I5IA 2PGEA 3GX9A 1P0KA 2QCDA 4QSHA 2R8WA 2NXGA 4J27A 3IJDA 1UWUA 6REQA 1EFZA 1MZRA 1REQA 2PDCA 4ZOCA 3LRKA 2HISA 3UJFA 5I06A 2ZRXA 3AYVA 5BWAA 2ZRZA 3S2NA 3G1XA 1MYRA 2H6RA 3VKKA 5JQ9A 1KW1A 2HROA 1GOKA 5JIPA 4RKAA 3U2EA 4FNUA 3ZR6A 5CPOA 5KZDA 5T9BG 3BAWA 5MKGB 1EUAA 1CLXA 4EACA 1HN1A 3FJ6A 2C13A 4PCNA 4JBRA 4ATDA 1XCWA 1SR9A 1WAWA 4YWSA 3VIIA 4K7YA 5A8MA 1Q8JA 2QV4A 2FH6A 2OGYA 4NU7A 3FNDA 2H3BA 3H2CA 5JXQA 1MFUA 1XLLA 3L2IA 1TIMA 3QPEA 4OECA 4Q4SA 4XZNX 1ZCCA 4ZOAA 4H01A 4CNPA 3P67A 1OD8A 4ROQA 1G67A 4JY8A 4CVWA 2O92A 1MRAA 1D7KA 4R7JA 2FPVA 4P7OA 2Z7GA 3MJYA 1S2TA 2E28A 3ZWTA 4XX6A 4NI3A 3SUSA 3E38A 2DIJA 4AF0A 1XLHA 5TF0A 3W71A 2O9RA 2FZBA 2INEA 3CTTA 1GJUA 3U2ZA 4NZFA 3C0QA 4Y8FA 5EMJA 3E3HA 1VGAA 1F07A 3WK3A 4ICNA 5CZSA 2YCEA 5G4WA 4PC8A 4EPKA 5H6HA 1M04A 4HPNA 4R88A 1HL2A 3CB8A 1G01A 4D1JA 2CBVA 3BMXA 4JKMA 3U2CA 4M6UA 4HMNA 1JNEA 4O13A 4AD3A 1XYCA 4XBSA 3MC5A 1E6PA 4ERGA 2VJXA 4WXZA 1JG9A 1WKDA 1TUFA 1E6XM 3NL3A 1QAPA 3F4VA 4U2ZA 3TR9A 1VHNA 3KAOA 5BYWA 1GQIA 4PCFA 5DRCA 3EB2A 4K39A 4O8RA 3FS2A 3IIVA 4ZXLA 2WZIA 1V7YA 3DHFA 3IV8A 5CAKA 4ADSA 2X0SA 2EQDA 5CPLA 3E5BA 3TTYA 1PAMA 5E6ZA 3CV7A 3ONBA 5HPOA 4HPGA 1OWQA 4C7GA 2YL6A 3OG2A 1LORA 2QVNA 4JHMA 3KM8A 3O6DA 3P74A 3MT1A 1DVJA 2G41A 1C7SA 3W7OA 1EDQA 1RQBA 3AS2A 3WBYA 3CK5A 1QI5A 4JNMA 1F05A 4KCUA 3F5JA 1TPWA 4B91A 1AZ1A 1S5NA 4XBKA 2Z25A 2OODA 3BV4A 4MIMA 1HJVA 3QM3A 1T8XA 4MUPA 3WLOA 5C70A 4JTAA 1MVYA 5JUVA 3WDJA 4KFOA 1FWSA 2IS7A 2JALA 4P2VA 1R0MA 1XJBA 4BQ2A 4JTIA 4F2BA 3QLDA 1YDYA 1V5XA 3SI9A 1YADA 2VGBA 2BOGX 1XIIA 2RDUA 5HNTA 4P7RA 1KBIA 4O4VA 2W91A 3W2LA 3I10A 4W89A 4M0XA 4KEVA 1NSJA 5LGXA 1BVNP 3N9KA 3SECA 3S5ZA 4IOTA 1K7XA 5AZ1A 2ODOA 4ACZB 2VGIA 4DPQA 4LVFA 1XRVA 2G95A 2ZX9A 1PEZA 2DSVA 3HMJG 1TVLA 2FMNA 5CLWA 3WLHA 4S3KA 2YX0A 4E2DA 1L9WA 3KL3A 3LK6A 4F0SA 3W7RA 4RPQA 1OC7A 2VFFA 3HJZA 3GW0A 3CIXA 1ISXA 4GX8A 5DMMA 3B9DA 1X8CA 2YB1A 2FZ9A 4MF4A 4HK5A 1XD1A 2FJKA 2X1TA 2P53A 1NF0A 4MDPA 3EX4A 1YNPA 2V6AA 2A3CA 1YQ2A 3N9RA 3LCWA 4W5ZA 1JF6A 1EA0A 3U4AA 8A3HA 2PTYA 3AIVA 4R7OA 3ZT5A 4DWSB 3I3DA 2DZVA 3ZIZA 4XUGA 3FIGA 2VM8A 5ABFB 3F1QA 3W7EA 4UMCA 2XZ7A 4TOQA 3CO4A 3V5OA 3QN3A 2WCAA 3MDUA 2HZGA 1KTBA 2PWHA 2WJFA 2YW3A 3OU8A 2V82A 5KITA 4NJJA 4O18A 3IVSA 3ZVHA 2D2JA 3DG3A 1MMFA 1KGWA 1UR3M 2V68A 1OY0A 2P10A 5D2WA 4AIOA 3WDRA 3GXMA 4P8VA 1XPYA 1EO7A 1UWRA 3PAOA 3AS0A 3RXZA 6XIAA 4GOAA 3AMLA 5T9CE 2YJQA 2QW5A 2RKXA 4TV6A 1LT7A 4OQVA 3SCUA 2EPLX 4AD1A 2ZDRA 1XFCA 1BG9A 4JHOA 3IUDA 1HNYA 1OJXA 1GKPA 2E25A 3ZJ7A 4LV4A 4GJIA 2WNQA 3GBDA 1NDYA 4RDVA 5HMEA 3EX1A 3NQMA 5FOOA 1DJNA 4O1DA 4F0HA 1HJWA 1ZSXA 2PFHA 1O5KA 3GVWA 1UH4A 5F2GA 2CFFA 3TN6A 4MJMA 3CUZA 5FF4A 2WZHA 3TJIA 1SZRA 2ZX6A 4L9YA 4HT3A 2XUCA 1KM4A 1JZ5A 3UXDA 3PJWA 1U30A 1IT0A 2PC4A 1VZWA 2DJLA 1P43A 2XJ7A 4A3UA 5J04A 3GG1A 2J7HA 3GXPA 4ZOBA 4AY7A 5T91A 2HDJA 2YLLA 1KBJA 4UTTA 2CLKA 4A2RA 1BSLA 2OX4A 2GJRA 1FXQA 4RXFA 2PWVA 3HOJA 4NP7A 2WQDA 3V7PA 3EAUA 1GGOA 3EWWA 2JKEA 3B8UA 3MW7A 3BGGA 4O0ZA 4HNTA 3VIMA 1Q63A 3KL5A 3OLIA 4UFJA 3R2GA 3CPGA 3PJXA 1XRSA 3H70A 5FL1A 2FVKA 3ZR4A 3RJXA 4B5VA 3P62A 2GGEA 4R5EA 2A3BA 1TCDA 4GKTA 3ZLHA 2FZDA 1UBPC 3W1PA 1CYGA 2PWEA 3WJYA 2O4QA 1ZJIA 2X2YA 1XSIA 1AQ0A 4LUSB 4FLRA 2FVLA 1XLFA 1BWLA 5F2IA 4UQ9A 3LBMA 4O14A 3W1XA 3NPVA 4ZGYA 4LUIA 3R94A 4J2MA 2VXNA 3NOYA 1KCZA 1H61A 3M0YA 1GTHA 4DM1A 4QJ3B 4W5UA 1P7TB 1X1OA 8XIMA 2QCMA 3ITCA 1CECA 5CLTA 1LBLA 1OFOA 3KCJA 1W1VA 3GFXA 1LLZA 4Q8OA 1OHLA 2HJPA 3SN0A 4D8LA 2FDMA 4FS9A 1Y5WA 3BZGA 2GGIA 5E0KA 1N7KA 3P5ZA 3OQEA 1EEPA 4YU1A 3C6CA 4UIOA 1PO9A 4KCTA 1BEUA 3E12A 3LOTA 4PSPA 4AZ6A 2PURA 2B7PA 3TQKA 3SBFA 4WKHA 3MMUA 2D69A 3WUEA 2PTXA 4YWIA 6REQB 1REQB 1PX4A 4D72A 5AC8A 2GFTA 2CZFA 3A4WA 2QIIA 3ZXWA 2J79A 1I1WA 1SO5A 3GH7A 3M0HA 4NXKA 2YCJA 3CGTA 1JDAA 4HYVA 3FK4A 3D47A 4XZBA 1FP9A 4C90A 1O94A 4GK8A 1SFJA 3JRKA 1VYSX 1UQYA 3QH2A 4CCEA 1K6AA 4MY8A 3VGEA 1ESWA 1NJJA 1W5OA 1L6YA 2GYIA 1GWJA 3KS5A 1TFVA 3EB4A 1E70M 4PEEA 3TW6A 1XH1A 2HVNA 2WSRA 4TQTA 1WE5A 3T7VA 1I2RA 1CLVA 4Z08A 3C3UA 1F6YA 1MI3A 3W6YA 2V67A 4WRHA 4GNKB 3SGZA 2OO6A 2F6XA 3WQVA 1EWDA 4B3LA 2VEPA 1EZWA 3PBGA 2AAAA 4NXSA 4KS0A 3ABZA 4PULA 2WB5A 2GDUA 4AF0B 3NZ1A 3W87A 2OB3A 2R91A 3ZM8A 4PGLA 3W1LA 4PBEA 2GVLA 4IT1A 1M01A 2J9ZA 4U28A 4MNKA 4DO5A 4G6CA 4QCEA 3KL0A 1C3FA 1XIDA 4HA0A 4IMFA 2B7NA 1LWJA 4AQLA 1GONA 2I14A 1EYEA 1QTWA 4NIRA 3BQ6A 4H6EA 1ECQA 4WIWA 3EMQA 1XUUA 1DJWA 2E3ZA 2C16A 1CGUA 4M56A 5DCDA 2Z27A 3QW4B 3BGJA 3GE7A 3T05A 1J6PA 3O2LA 2VVNA 4OUIA 3K46A 5K4XA 2E1WA 5TNVA 3B0XA 4MM1A 3ABSA 1KM5A 1KKOA 1JRCA 3K13A 1B54A 1OFPA 1NEYA 2V5CA 3M0KA 3MY9A 5CC6A 3UZ5A 3VINA 1C9WA 3P61A 1DWGM 2Z24A 3N4EA 3TAOA 1JXKA 1OYBA 3CASA 4C6PA 3UWYA 3LCGA 5XINA 3WCZA 3VE9A 4IM4A 2JEQA 1H7RA 3EMZA 5DEZA 5C6MA 3EWZA 3W7CA 3S5YA 1PE1A 3BV7A 1BTCA 3LCHA 1G1YA 1NM9A 3QV8A 4PCTA 7XIMA 4L64A 3O9NA 3TONA 4EF8A 4YHEA 1J0KA 2FZMA 5XIMA 3W7PA 2NLIA 3HPZA 5AYXA 3T0TA 3RK8A 5L6UA 3TYUA 3ICJA 5K2ZA 3AHTA 4J4KA 2V2CA 2Y4SA 4GVGA 2IW0A 3P14A 3OVQA 3L5AA 4MFDA 1B57A 4NJIA 4D6EA 2YSWA 1YXCA 4UTFA 2A3AA 2WMHA 1FCQA 2EO7A 2X0YA 3W1MA 5CJNA 2BVDA 3EEZA 2QKFA 5KSWA 2VZOA 1EGMA 3KHJA 3GXDA 3B8SA 3PG8A 2PBOA 1AW1A 1WZLA 2WYSA 1GOXA 1JZ7A 2A7NA 1PHQA 5IFTA 1GYMA 3UWQA 2CXEA 1WKEA 1W1B1 2UBPC 3PTDA 3VDHA 3W38A 1EC8A 4Z1CA 4Q4RA 2HXUA 1IR1A 3TMLA 4JKLA 4ZQPA 1TELA 3THQA 4X0NA 3ANUA 3RN6A 4AZ7A 1S46A 1E6RA 2PE4A 1Z7AA 4CN6A 1B9ZA 3UPMA 3ZO9A 4OKDA 3UXIA 3OGSA 3VUSA 1Q4NX 1NVMA 2FZ8A 4H9TA 4FXFA 1OK6A 1VCVA 2OMAA 3NZQA 1GUVA 4E5TA 3E0WA 3N2MA 3FGCB 1B3OA 1WB0A 4I9TA 1PSCA 1O6IA 2C7FA 1ONEA 3KW3A 2VENA 1SFLA 3Q58A 5D2TA 5C54A 3GY1A 3UXLA 4J7RA 1NP0A 3MBFA 4U33A 1ISVA 4G1KA 3I68A 1XCFA 4PRWA 4XTIA 4IQEA 1ECEA 4KH2A 2BLEA 2ZTJA 3B8TA 4JIPA 2YXOA 1W9PA 5EYWA 3GWQA 1KR0A 3ZVHB 1OINA 1P0EA 2V3GA 1M3UA 1G9HA 2PDBA 2GJXA 1YLVA 2R94A 3SB0A 2GGJA 3CMFA 3M41A 1RH9A 3DOPA 3W7GA 3TZNA 2NZLA 3VOHA 3MZ2A 1LBMA 2PGFA 3IEBA 4EXBA 1XDMA 1UIPA 3E96A 4DEFA 3LDVA 2VL4A 3O6YX 4WOQA 3LA4A 5A2AA 4YCOA 3LCFA 2A3LA 2OG9A 1FVPA 2OZ8A 2OELA 4FOUA 5FEWA 4MUZA 5FSDC 1J5SA 5FJTA 3RFAA 4AVNA 2WCGA 2OVLA 1Z42A 4WJXA 1OCNA 2VR5A 3EX6A 3R13A 3CBWA 2PWFA 5BU6A 3HGRA 5GNZA 2EXOA 1UD2A 2C1GA 4XAPA 2Y1HA 1OCJA 1P0DA 3O0FA 3U0HA 4WQ6A 4I5XA 4K38A 1TUXA 9XIAA 3R0KA 3SUTA 4LS2A 3NQ8A 5AC5A 1UR8A 5BMWA 3VFCA 2TAAA 5AFDA 3W7JA 1QFEA 1EUNA 1HJSA 2YBUA 4PUEA 1CDGA 1JDCA 4J35A 2D2HA 4B5WA 3D6NA 5CC5A 1I75A 1L6WA 1GYLA 3QGVA 1A5CA 1UP3A 2Z1VA 2J7EA 1UP0A 3NQ7A 5BU9A 1B9BA 4ASTA 4IL2A 1R2SA 2QUVA 3I7SA 4FIRA 4GYPA 2CLFA 4RPPA 3CL7A 2E9MA 4ICCX 1VIWA 1A50A 1DTUA 3NL6A 1GQLA 4PYSA 4QJ5B 4XZIA 2GQAA 1OFEA 4F0MA 1IE7C 1JQXA 3HFTA 3TCEA 1LM1A 3OHMB 3I3EA 5HQMA 4OHQA 3GU2A 4OFCA 2YFOA 3SDOA 3VGFA 4EX4A 4LBUA 1KFWA 5D8WA 5EA9A 2PDPA 1TKKA 2I56A 3FHAA 1ZNNA 4IP4A 1BQGA 1BPLB 3QR0A 4UFKA 1F6PA 1C8YA 1MUCA 3N18A 3VK5A 4H2CA 1LRQA 4AZHA 2C79A 4JS3A 4AHQA 2Y5JA 1QCWA 3OO2A 3T1GA 5GJNA 4YTTA 2EPOA 3P7YA 4X61A 2ACRA 5AHMA 3ZYZA 2V38A 2GL5A 4B9YA 4CQCA 3ENLA 4M19A 3WQ6A 3ARSA 2BY0A 4TX6A 5HBFA 1XM3A 3LGDA 4X2RA 2QUMA 4QROA 1ADSA 1R30A 2WHKA 4EKJA 4GCAA 3AYSA 3BTNA 2GWNA 2GJNA 1LP6A 4Q8TA 2PRHA 3TTQA 3OTRA 2V3EA 4C6QA 2J74A 3G5EA 4RLIA 3L0NA 1VD6A 3W83A 4IXHA 3STGA 4AHPA 5I2UA 2WMIA 4GPNA 1WUFA 4O16A 5I5RA 3S47A 1I45A 3WLMA 2PF8A 3SCQA 3CMJA 2PRLA 5KEZA 4XAZA 3UWZA 4BZYA 3DU0A 4W7VA 2SFPA 4X2PA 4BF7A 3A21A 3WH5A 4UCFA 3WK1A 2ATSA 4DBEA 4C5ZA 4ZB5A 1L6GA 1JCJA 4I9AA 3DHUA 4E8DA 2DW7A 3AMGA 3DHDA 3FDGA 5JU6A 5C5YA 1BWKA 4PODA 3LU2A 1G69A 2WC3A 1J12A 2X30A 3LYEA 1Z44A 4F8XA 5D05A 3KOFA 3VI2A 3ARRA 3KHDA 3HURA 3O7UA 1F3WA 3VGGA 5BXPA 2V9DA 4MVAA 4JDBA 1V7AA 5I03A 3VM5A 3LEPA 1TJ0A 3EDJA 4Z17A 2CZVA 4LSBA 1EX5A 4HPJA 2O0TA 1GKRA 3EEGA 3UU0A 2ZBTA 4GI8A 5BOFA 2OSYA 1A3XA 1TA3A 4YTQA 3S2LA 4PMOA 2H9AA 4N02A 5F4SA 3F03K 3GNPA 1Q7QA 4LF1A 4O12A 2D0GA 1A0CA 5DX7A 2Z6JA 3NQFA 1LLOA 2HXTA 1E0VA 1PZ2A 3W84A 3RAOA 4Q22A 3UERA 2ZQ0A 2QUNA 3LMYA 4EPDC 3PPCA 1NU5A 1B0IA 1QOPA 1J0JA 1I1XA 2YBTA 3G1SA 3L4VA 3S3GA 1BLIA 1V6VA 2QS8A 4PMZA 1R9YA 1FBAA 3VUPA 1T41A 3D46A 4DJDA 5U4NA 2Y7GA 1O5QA 1RJPA 5CBIA 2CLMA 4RDZA 5KZEA 4DY1A 4Y7EA 3K1DA 4U3CA 3OIHA 4XAFA 3A6OA 4F2UA 5A94A 1YBQA 4NZJA 3WNPA 1A4LA 1RD6A 3E2RA 3RX4A 4QTGA 2RAGA 5DT7A 3W7MA 4RL3A 2V5KA 3DYMA 4RJEA 3NQ6A 1JPHA 1DWJM