5J8LA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose, using a crystal grown in microgravity
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 116
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5j8lA00
1XLDA 2G4JA 3JU2A 3CQIA 3KCLA 1XIGA 1XLGA 2GUBA 3OBEA 1XLLA 1A0DA 1XIIA 1YX1A 1XIJA 3AYTA 3KBNA 2I56A 4ZB5A 5XIMA 1XLCA 1XIMA 4QEEA 2XINA 4X60A 4KW2A 1XINA 3TVAA 1XYBA 5XIAA 1XYMA 3VNKA 4HGXA 3FVMA 1XLFA 2XISA 4QE1A 3WQOA 3IUHA 3C0LA 1XLEA 4DVOA 6XIAA 1XLIA 2XIMA 1XIHA 3IUIA 3KTCA 3VYLA 6XIMA 1QUMA 2ZDSA 3VNIA 5B7YA 3VNLA 4HHMA 4XKMA 1XIDA 9XIMA 3KCJA 3UVAA 4A8RA 5XINA 3CQHA 3U0HA 4W4QA 4XIMA 3QZAA 4X63A 3AAMA 3XISA 1A0EA 3CWHA 4K3ZA 4A8NA 4DUOA 1XLKA 5I7GA 3U3HA 3KBJA 3C0QA 3VNJA 3BANA 3CNYA 3N4AA 3XINA 2NQHA 1TZ9A 2OU4A 5H1WA 1XIBA 3BZGA 4XIAA 3ITLA 5FA5A 1K77A 5H6HA 2NQJA 1D8WA 3UA3A 5EMMA 4PFHA 1DE5A 2QULA 5C9ZA 2HK1A 3ITTA 3CQJA 4HNOA 3P14A 3QYSA 5EMKA 1MUWA 1S5NA 3UA4A 4GLEA 3TC3A 2G0WA 3C0SA 1XIEA 7XIMA 1GW9A 3M0MA 4QE4A 5TNVA 3VNMA 3ITVA 4K1GA 2GLKA 1XYLA 3DBNA 3QXBA 4EACA 4XISA 1XIFA 3P6LA 3M0VA 3GNXA 4YTTA 5B7ZA 8XIAA 2NQ9A 3L23A 4J4KA 2ZVRA 3KCOA 1CLKA 1XLBA 1XICA 4US6A 4QEHA 2QW5A 4QDWA 1XLHA 1XYAA 4GQBA 5EMJA 2HK0A 4XSMA 4X61A 3M0YA 4LNCA 1S5MA 4A8LA 1DXIA 1I6NA 3M0HA 3NGFA 2X7WA 5EMLA 8XIMA 4HHLA 4YTQA 1QT1A 1XLAA 1OADA 5AVHA 4A8IA 3DX5A 5J8LA 1XLJA 1BXBA 2Q02A 2I57A 1DIEA 3IUDA 3M0LA 1XYCA 4E3VA 3AYVA 3KBMA 3UXIA 3XIMA 3ITXA 1BXCA 4G56A 3LMZA 4QE5A 5B80A 3ITOA 4YTUA 4YTRA 1DIDA 1DE6A 2X7VA 3KBWA 2GVEA 3CQKA 4XSLA 4EAYA 2QUNA 1O1HA 3BDKA 4GJIA 4ZBCA 4ZB0A 2GYIA 3UU0A 3M0XA 2HCVA 3BWWA 1QTWA 3QC0A 1MNZA 2J6VA 4OVXA 4Q7IA 4YTSA 9XIAA 3AALA 1XP3A 3ITYA 3KBSA 1A0CA 3KWSA 4GJJA 4ZB2A 3KBVA 1I60A 4QDPA 4PGLA 2QUMA 5AVNA 1XISA 3BZJA 1XLMA
chains in the Genus database with same CATH superfamily
2FPYA 3WUFA 3BV7A 1G67A 2IQ0A 1U5VA 3H2NA 1TG7A 1E0TA 2ZRXA 1AJZA 5GPRA 3VM7A 3WDJA 2ZIDA 3HIJA 4LYRA 1BWKA 1W1VA 4ZOBA 1HJXA 5EU9A 2PDWA 4X22A 1ZHAA 4GA8A 2C1GA 1I2RA 1A0EA 3NQAA 3PUEA 3CV2A 3CUHA 2VVSA 2CLKA 2ODOA 4Q4PA 1UWQA 3CYVA 5JQ9A 1OX6A 2X09A 2DH2A 3P93A 2QLYA 5EY5A 3ISIX 4MGGA 2OEKA 4GG9A 1E4MM 1VFSA 4PYSA 3LG3A 3FYYA 1F61A 4HPHA 4H9UA 1GJWA 2AQOA 2ATSA 3TYEA 1QO2A 3GNOA 2BVTA 3RX2A 3LXAA 3F5KA 1XLAA 3SY5A 1GTEA 4CUCA 2DZSA 3V18A 4UTFA 1DXEA 4LVDA 1GK8A 1OJXA 4Z2LA 5A6KA 1IT8A 5B80A 2BY0A 3LX9A 3PBUA 3QR1A 4KCTA 3WD0A 4XD4A 1E6NA 2HSAA 3B0UX 3FJLA 3P80A 1GQKA 5FAGA 3ITYA 4GUGA 2DUAA 1H1ZA 1TV3A 1UP3A 3UEQA 3KOZA 3OBEA 3KWXA 1R38A 3F2BA 1XSKA 2HE5A 3L4ZA 2YBVA 4ZSUA 4ERAA 4XAZA 3WMSA 3VNDA 2NQ5A 2HS6A 2R1PA 4Z0JA 2VGFA 2FHCA 9XIMA 5FESA 1MRQA 3C61A 1OK4A 1R8LA 3W2NA 2Z29A 1EL3A 4GYJA 4FX8A 3ELFA 4NJIA 2VDIA 3P5YA 1NOUA 5K9CA 3UA4A 1Y5WA 5H8MA 2AMXA 1E15A 5PTDA 4PCNA 4HCHA 2D73A 4WY0A 1FWGC 1TQJA 5AN7A 1PVNA 1JDCA 2WSYA 4QDWA 1W37A 4O1DA 3OLIA 3IAPA 1FWIC 1F73A 2QKFA 3HQ1A 2GJRA 1H7PA 4D8ZA 1DEDA 1Q7MA 3AIBA 2WJFA 4I9JA 4R33A 1B4KA 5CXPA 3W76A 2FLIA 1LLOA 3L4TA 1EC8A 4PSPA 2ICSA 1PUDA 3QN3A 1EGVA 2ZICA 1H5YA 4S3EA 4LXFA 3N2OA 2VEGA 1K9FA 3W7OA 3UU0A 1DOSA 1I1WA 1QW7A 3W1TA 3FA5A 1O12A 4PMQA 1KWGA 3KBVA 3G1FA 3LTPA 2R94A 4ATWA 4DM2A 4WDTA 1KGUA 4GIYA 1TJ1A 3RPMA 1SO6A 1YX1A 3HPZA 3H7RA 2WC7A 1E72M 2VR2A 1EB3A 3W75A 4AQLA 3HPAA 4JYFA 1PWLA 3MVTA 3CS2A 3MYOA 1TPUA 3QHOA 2HQAA 2QV4A 1QR7A 1NH6A 4AY7A 3H4XA 3C8FA 4RDZA 3VOCA 4QCEA 3LGDA 2VEMA 5EL1A 4E4FA 2F7FA 1NU5A 3UZJA 1HKKA 3W25A 2E9BA 1OINA 2FMNA 1Q4WA 2HZGA 2QR6A 3ZVHB 1LZOA 4B15A 1WKEA 4UQCA 3BLPX 3VD9A 2PZ0A 3UJ2A 5T91A 4C6NA 1E71M 3W85A 5A5WA 3ALFA 3S5ZA 4FALA 1KCKA 2ZRUA 4PB3A 4RE0A 3A64A 5CPLA 4BCEA 4H9ZA 1J9YA 2DUZA 1V02A 1WUEA 1W1YA 2E28A 1R7AA 1H61A 1JG9A 3PF3A 3TLLA 1C29A 3BOXA 3NTYA 2INEA 1WXZA 5DBTA 3PZIA 2YA1A 1AD1A 3MBFA 5I06A 2YDRA 3UWVA 1KR0A 1UKSA 3L0GA 2QGHA 1UR4A 3B06A 5EPDA 3LD5A 2TAAA 3ZFHA 4LALA 7REQA 1R3RA 2WBGA 4ZB2A 4C6DA 1UPPA 5DMLA 4NUWA 1S1RA 4WDXA 1GUVA 4ZTYA 1WAWA 4AWSA 3C2OA 4CU6A 4DNHA 4HGXA 1KBLA 2DSVA 5D32A 3TE9A 3TYDA 1E3XA 1CGXA 3QR0A 4IPIA 4IUOA 5I3JA 3C0JA 1GOIA 1M7XA 2DSZA 3CWHA 3FIGA 2PAJA 4B3KA 4HSHA 3MO7A 1DKWA 3BZGA 1Q7QA 4ONVA 1POJA 1YLVA 1QNVA 4Z17A 3ZR6A 4IGMA 3WIJA 3S42A 3MUAA 3DECA 4IUGA 4QG9A 3VGFA 1W5NA 4FNSA 5C9WA 4O54A 4NJJA 1EFZA 1QOQA 5HA7A 3QFWA 1ECQA 1J0YA 1H0IA 1BQGA 4TR9A 1VFLA 2EPHA 2PMQA 1HP4A 4GQGA 3WFZA 3KEHA 5I79A 2PDYA 1GQNA 3XIMA 3EOLA 2WM1A 4DO4A 4UTJA 1B0IA 3R13A 1BAGA 4MLRA 2WSQA 1PWMA 2Y7EA 4H9XA 5CG7A 4XD5A 2HCVA 2ZX6A 3GKFA 1UKOA 3CBWA 4PB4A 4CVWA 3FHQA 4IXXA 4F66A 4V2XA 4FNQA 1XYZA 3H2FA 4UMBA 3T9PA 1V93A 4JFUA 1LQ2A 2VENA 1FFQA 3QRHA 2PC4A 4JNZA 3WLQA 3ZQ9A 3NQCA 3DFYA 4RUBA 2YPIA 1TX0A 1W1ZA 3CHDA 4R53A 5A8PA 1H49A 2A7PA 3SAZA 5EFDA 1L6WA 4HNUA 2XG9A 1G6CA 3TSMA 5I7GA 2PWDA 3VU2A 1SFJA 5CKSA 3VNYA 3IWPA 1Z3NA 1WDPA 1MW0A 3COTA 3WMBA 1Z44A 4PMVA 4Q4KA 4MHBA 2DQWA 1C92A 1BF6A 2O7SA 3LCWA 4EF9A 2YKKA 3CIXA 4OWGA 2V69A 6TAAA 3L23A 4L80A 4A6GA 1IZJA 3HF3A 3KX6A 3MMUA 1T5AA 3THUA 4KF1A 1JCNA 4K7YA 4PBGA 5CJMA 2Y5SA 1TZ7A 1PJ9A 3O6CA 4KPLA 3BSMA 1B2YA 2Y24A 1VIZA 4US5A 2W61A 1XYCA 4XX6A 5DXYA 4HB7A 3ZR4A 2J6XA 1KQZA 4DEFA 2QUUA 4H6RA 3S4TA 4FOJA 2CC0A 2GGIA 1UD6A 4EXAA 2XVPA 4MIMA 4GWEA 2BLEA 2J6VA 2Y70A 2IKHA 1XP3A 2P76A 3QY6A 3UPMA 2VQTA 3RNDA 3HU7A 3GVRA 3IJLA 3EX2A 3T42A 4UCGA 2Z2AA 3QTPA 1BYDA 2E77A 2WCAA 5C5YA 5ABTA 3T81A 1EUNA 4NAEA 1KM1A 4H6EA 2ZTJA 2PTXA 2VRJA 4GIAA 1TTQA 4PTNA 3KOFA 3HG5A 4O0KA 1QOXA 2WQDA 1XS2A 3WFLA 2QJGA 5I3HA 1ZALA 4JHZA 2BS9A 4MMWA 3NL6A 3OA3A 3V5OA 5BW6A 3WFAA 4B4FA 2FJUB 2GQ9A 4OQVA 3T8LA 2I5IA 5CAHA 2C3ZA 3KDNA 3QXBA 4QDMA 2PWFA 4JTIA 4QM1A 1LL6A 3HO8A 4RXGA 4DJEC 5I23A 1ZUAX 3ZSTA 3B4UA 1OT2A 3CT2A 3PBMA 2QPSA 2XUCA 4IQLA 2ZE3A 2Y1HA 2CHNA 1OADA 1IWAA 4M82A 2WMGA 5D9OA 4LBUA 1Q7ZA 2GOKA 3UXIA 4FO4A 2FTYA 1V8EA 3WDPP 3ABZA 3SCTA 1Q8AA 4R7OA 3N6JA 1WQ5A 1B3OA 1OFBA 3MT1A 3LCXA 1OG6A 1OC5A 2WCGA 1ME9A 1FOBA 1ML1A 3W72A 3F03K 2P88A 3EXTA 5DCEA 3G3MA 1PIFA 4HCDA 2UBPC 3OZMA 1E6QM 1F07A 5A8OA 4C6QA 4AAJA 3GHRA 4QLKA 2OQHA 2WNQA 2V5JA 1DIKA 1XV8A 3C86A 1FWTA 2VRQA 4JFTA 4LAOA 3AUOA 3TDFA 3KBJA 1JF5A 2XZ9A 1QW8A 2Q8ZA 1GKPA 3T2QA 3M9YA 3LZ5A 3NO5A 1S5NA 4QAWA 1KXTA 4L6HA 4YS1A 3LB0A 1POKA 1EJRC 5CLWA 1QI4A 4DYKA 1K3UA 1GVOA 3WQ8A 2OQLA 1EC9A 4I8YA 1VBRA 5FJUA 4R7WA 1XYAA 2WVVA 4HPGA 5HR7A 2J7FA 2QJHA 4C6OA 1JFXA 2EO7A 4IMFA 1B4EA 4HOZA 1FRBA 4E38A 1MFUA 4E6MA 3FJNA 2Y0FA 3M0LA 5BOEA 2BFGA 3RMEA 5T9BG 5HXMA 2NQZA 3TJLA 3DZ1A 3LV6A 4WOQA 1CGTA 1AD4A 4GBUA 5LNSA 1L2QA 3VVGA 3G8RA 2ZZ7A 3BQ6A 2TYSA 3LPGA 3VXGA 2OYMA 3W7IA 3KVLA 3BMWA 2OWXA 1IGWA 3N34A 3GKAA 4GXPA 4S3KA 3CPGA 2XDFA 3PSVA 4IISA 5A6SA 1RBOB 4ZQMA 4WD0A 3W2JA 1GTHA 1PTAA 2XISA 3OVPA 4DWSA 4H9VA 5G4HC 5A6JA 3CEUA 2OZTA 2B7NA 3WLMA 3E0IA 4HD5A 3HJEA 4J5NA 2ZRZA 5A6BD 4DUOA 2Z1WA 3W24A 3BL3A 1NDZA 3GH5A 1KRCC 1D8WA 3R43A 3MHUA 2D23A 3WEMA 2PC8A 4OE7A 3F4NA 3QYQA 1M5WA 1H3GA 2VC9A 3GVQA 1HP5A 5E0FA 2LLEA 1IXOA 3BGAA 2C15A 4CD4A 2QUTA 4ZXOA 1C8QA 2ZXQA 3DFTA 4PBFA 5LHFA 1S5MA 2Z1BA 3W37A 1E1CA 3L66A 3QV7A 4M6QA 2ABBA 3QMSA 4HNLA 4MJMA 2WMKA 4RZ4A 1FDYA 1CI1A 4B91A 1X7IA 4ACZB 2HROA 2VO5A 3GM8A 2PSNA 1VFFA 3WL1A 1JULA 3GYEA 4Q7IA 1HKIA 3DYPA 1DQUA 4LSBA 4LUSB 2F38A 1LL4A 4NI3A 1W1A1 3G3DA 3MBDA 4AIBA 3NXFA 1F2JA 3QPEA 4OV9A 2GVGA 1L6SA 3R89A 3APGA 1U22A 2NXIA 2VNCA 2ZDSA 2VEPA 2WVTA 3TJ4A 1EQPA 2Z27A 4MAZA 4I7UA 1NF7A 1FWJC 3ENLA 3ME3A 1P48A 3I65A 3H4GA 1VGAA 4PTVA 3HBLA 3NPXA 3VMOA 4Q22A 4U2ZA 3PFMA 5ECUA 5FF0A 3CWOX 5DT7A 4IPJA 3ZS4A 2X41A 1A3XA 3MWAA 4YPJA 3EDFA 8XIAA 3DG6A 2GGGA 4AMAA 1REQA 4O19A 3E02A 4ZFCA 5AYZA 3QW4B 4X9SA 3W1QA 1TJ0A 3GHTA 1OF8A 3C56A 4GI8A 2IKIA 2Y8VA 5U4NA 1MI3A 4L1WA 4W87A 1ONRA 3VIIA 4TXEA 3CEPA 2WANA 1HT6A 1IGSA 3NWRA 4YN5A 2QAPA 2PS2A 3BJSA 1P6BA 4DB7A 4H19A 4NAFB 3BAXA 4K68A 3GHSA 2G96A 1X1NA 2YW3A 5E9XA 1WNOA 1H51A 1YHTA 2R1LA 4YNGA 4QEEA 1NF0A 2ZE0A 3G0UA 2O0TA 5I07A 1K8YA 2VC6A 5CSYA 3F7JA 4W9TA 4G2DA 3UFYA 5M5DA 3GLCA 1ZRQA 4S3AA 1K77A 4QSFA 1H50A 1W2VA 1PDYA 4W8BA 1K4GA 3IIVA 3O16A 2PLKA 4C60A 3N9KA 2F61A 1R0MA 1TV7A 4EF8A 4ZZ9A 2OQYA 2C6QA 2BOEX 2ZA2A 1S3HA 2GGHA 1S2AA 3L4YA 1GORA 3W7EA 1KLZA 3BV4A 1LL7A 1YQ2A 4B2DA 2AL2A 2P50A 1VHNA 4GJ1A 4L4LA 2ZWZA 1OFAA 1OX4B 1JQXA 1A3HA 2YCLA 1W9XA 3F2DA 1JPKA 1SZFA 2OJPA 3NO3A 5C70A 2QJJA 4A21A 1BRLB 1F3EA 4ZO9A 3O6AA 1TWIA 2D24A 4PUEA 4H4IA 4KWSA 4RE3A 4PGLA 1FBAA 1TUFA 1KFBA 4Q8PA 4C90A 3R4IA 4KRTA 1UD8A 1KBIA 1OCJA 4B5NA 4E4PA 1P5BA 4QE1A 2AMGA 4PMXA 3W4RA 5DRIA 3UR7A 1A3WA 1QUMA 3QSRA 1H09A 2ZUTA 1FXQA 1QK2A 2VD9A 4YWSA 5HNTA 4RKAA 1LF1A 2ATMA 3WNMA 1NDWA 2OU4A 1OCNA 4W7UA 2Y8KA 3T78A 4GY0A 3EKGA 1RALA 2HK1A 2VZVA 2H3BA 4QX4A 3TZFA 4BWLA 2FGBA 3AZSA 3FXYA 3EPNA 4JTJA 3ITVA 4FF7A 4MFEA 3F2CA 3TWAA 4D6JA 3N3TA 4GH3A 4HMCA 3H2EA 1EUAA 3T4WA 3FAXA 3S2MA 2J24A 3MSYA 5CZJA 2R1MA 4WSHA 4OV4A 3S83A 1TPH1 1DJZA 2NLIA 3PG9A 3FX4A 2CLLA 2WAGA 3RUBL 4GVFA 3PS7A 4JX6A 2YB1A 4JIEA 2J88A 3E96A 1BG9A 3HG2A 5HK4A 5M03A 2GPTA 1VFHA 1EH9A 4ZB0A 4PC8A 4MY9A 3PULA 8CGTA 2VP8A 4CNUA 2X40A 1ONWA 3K13A 1IT7A 4MKVA 4H2HA 1EXPA 4PODA 5DLCA 2BY2A 3LCHA 5IXEA 1H2JA 4MTVA 3CU2A 3G1AA 1V51A 4ZE5A 5KETA 3U5YA 2HDJA 1OC6A 4C6JA 1H7RA 1TQXA 3GUGA 1U83A 3WNOA 2YA0A 2FIQA 3FSTA 4UTTA 2GL5A 3G6LA 1UD4A 2F8QA 4Y9PA 4J27A 3EOOA 4EWND 1YPFA 4Y90A 3CZGA 3UWZA 2CKSA 1AQHA 4IPNB 4G7EA 4A35A 3BAIA 4UOZA 2QEZA 2Y6ZA 3VPLA 3PTMA 3WCZA 3WQ5A 3H2OA 5AC7A 2VOMA 1QMLA 2Y2WA 3GNRA 3KLKA 3FHAA 1R9YA 1ADOA 3AISA 1T96A 3QHMA 3T4CA 4RDYA 4E3VA 4I9AA 4BHYA 2E6AA 3LSCA 3FEQA 3I4EA 1QPQA 3LPFA 1DE6A 4OU1A 4O13A 5EMUA 4OHQA 2HBVA 1GCYA 2J75A 2PDXA 1WPCA 5E09A 4O11A 2PWHA 3W7KA 4DF0A 1L6FA 2W92A 4TMCA 2DJLA 1UW9A 3PJUA 5HQLA 1IE7C 1KXVA 4UR7A 2I56A 2ZADA 3AJXA 1NEYA 3C5QA 5CJ5A 1XIMA 1JZ8A 2FKPA 5FKYA 3UT0A 1PIGA 1B1YA 4FX6M 3STFA 2D2GA 3F4CA 1AA1B 3QPZA 2WZEA 5H2ZA 4Y8EA 2OSXA 4I9MA 3BCFA 2PB1A 3AMKA 1LUCB 2OB3A 3MUXA 1FCQA 2OO0A 3AXHA 3WH8A 3PP7A 5L9FA 5JBDA 4U31A 4GLEA 3BOFA 3O6DA 3WQDA 1RK5A 2BTMA 4KFNA 3AS0A 4NZJA 5AOUA 3UXDA 4CCDA 1K9TA 4DJDD 3I4KA 2WM0A 4D6HA 1XR2A 4BQ3A 4GUIA 3OA5A 2W4XA 4DUVA 1UZ4A 3DHDA 2VC5A 1KFKA 4HK5A 4LVAA 4UNLA 2NLYA 4MSSA 2JEQA 1GONA 3IARA 1E9IA 1QVBA 3M0ZA 5C54A 2VURA 3D47A 2PP3A 3M0XA 4KQNA 3H54A 1DTNA 3VZXA 3ZT7A 1TWZA 4OUIA 5E5CA 1T0OA 3SURA 5G4WA 1SM9A 4IPLA 4WK9A 4JTLA 3QMTA 3ARVA 3OHIA 3A5VA 2PBGA 3P3BA 4NP7A 4UTIA 1HGWA 2PD9A 4AZ5A 4IFRA 1UBSA 4N4QA 2A7RA 3VNLA 3WLRA 5LA0A 4FIRA 4NNAA 2WZTA 3ZZ1A 1VF8A 2DJXA 3TSBA 4GNKB 2YLAA 1T8QA 3U3HA 3TTEA 3CTLA 1AW5A 1SZNA 3GE7A 3CMGA 2IXVA 1HL9A 4EPKA 2HVOA 5I3IA 2BOGX 1R9XA 5REQB 1PKMA 3W6LA 4LBRA 5K4ZA 3BG3A 4MPQA 3R1ZA 1QOPA 3HQNA 3PFRA 2ZVRA 5CCZA 4K39A 1TTPA 3PB2A 1D7FA 3B9DA 2WOQA 3C2EA 4UR8A 4XD6A 4WOZA 1S38A 4HHLA 4J7RA 2WMIB 3RJXA 3G18A 3CL6A 1P0NA 3AMGA 4N4PA 4LQ1A 3OZYA 3B9NA 2C1HA 1IEIA 4Q32A 1QCWA 4XZIA 4WGXA 4JTUA 4IP4A 4IFOA 1JDFA 4PL2A 3NZGA 3PY2A 5D4YA 4YVPA 2EJ1A 4DZAA 2VEIA 3NAVA 3KCLA 3RN6A 3ZM8A 1XIGA 3LYEA 1MZRA 1KM5A 5F4SA 2QMKA 3AYTA 1SFSA 1XC6A 1LYXA 1ISYA 3TXVA 2E6FA 1ZAJA 3B0VC 2XIIA 1AQFA 3HMJG 5GJPA 4AY1A 5JXQA 1R3SA 3KZSA 4L6OA 5BCAA 2BP1A 5BU6A 1V6WA 4F48A 1R3YA 4GVIA 3POHA 2WC3A 5DX7A 4YHEA 4K36A 1JFHA 1ICQA 1DQWA 1W3TA 4JTSA 2A5HA 4LC8A 3DXIA 4GYPC 4MWAD 4CD8A 1KM2A 4AD1A 2FB3A 3KOXA 1J0ZA 1SQ7A 2QDDA 3N2BA 4HZ6A 5HANA 2BODX 4EE9A 4JDYA 1R2RA 3FKRA 3VE7A 1GHSA 4KEZA 3IJ9A 3HA1A 4AZGA 3JUGA 1ZQ5A 4WRHA 4UR9A 1XBVA 4HU3A 5EMJA 2HK0A 1UMYA 3S9IA 4IPPA 3ATYA 3GFXA 1VEOA 1F4AA 3W1UA 4J3UA 1VC4A 1MEIA 1PTDA 5JIPA 2QF8A 4IIDA 3V1HA 1GYNA 2BVYA 3WYZA 1XGDA 3NEVA 4CQBA 3CQKA 3A9BA 5CPQA 2PDMA 2QCEA 4S39A 3VDHA 2EG8A 3UWYA 4J28A 4GISA 4MZ1A 3SN4A 4E2DA 1P6WA 3HG3A 1FP9A 3WH6A 2R9RA 2R1NA 3W87A 3TAOA 1SO3A 1W0MA 3DFOA 3PZUA 4FHAA 1JDAA 1ZP4A 1C93A 3RILA 5FSDC 4RLIA 2CLFA 3QKZA 2PDFA 5FF7A 1EA9C 1W9DM 4DBWA 1PHWA 2J8FA 2EPOA 3W1AA 1PZ3A 3GW0A 1R3WA 1UZDA 4GOAA 4NJHA 3A24A 5HMFA 2PGRA 4LUYA 4YCOA 3E1F1 1ISZA 4WHBA 1QBAA 2NQHA 4NXKA 4DJEA 1D3CA 3EB2A 1HJSA 1R3QA 2VUYA 3G1VA 3M64A 4L64A 3PAOA 1E5NA 5AC4A 1KFCA 5E0KA 3WSUA 2VTFA 5HQMA 1P7TB 3W1MA 3SCOA 4GXMA 2H9AA 3W7QA 4NZ4A 1R30A 4GQBA 4AZCB 3LHUA 4UQDA 2X1RA 2X0HA 4XBKA 3UJSA 5JU6A 4YTQA 1M68A 2GGEA 4K7VA 5CEWA 1FDZA 1H4PA 5HR6A 2W0UA 3FXGA 1YW1A 1X97A 3WJWA 4LUJA 1FKXA 3W7GA 3WD2A 3CUJA 3LRLA 3BDKA 4AHQA 3GDTA 4O8RA 2QNEA 3CUZA 3LI0A 2A3BA 3PHAA 2B7QA 2BHZA 1FWWA 4ZSTA 1CECA 4H01A 2CEQA 1YBQB 3NZRA 1XM3A 2ASHA 1XLGA 4ZR8A 2PBOA 3WJYA 5BRPA 5IOBA 1UUMA 4B4HA 1UWIA 2EEXA 3CXOA 5HINA 2A3AA 3VFCA 3MDUA 4N9CA 1P0KA 3L5LA 2XU2A 3QV9A 1GJUA 2WHKA 4FXSA 2EPLX 2H3DA 4AC7C 4M6UA 1K4HA 2DT2A 3A47A 2JALA 3LHWA 2CZVA 1VENA 2VDHA 2DSUA 1KKRA 3WQ6A 4K1WA 2WK2A 1XPGA 3IJ8A 3A22A 3M07A 3W2LA 1K03A 4J35A 1QXLA 4F40A 2B31A 4XZNX 2PTYA 2FH8A 2ISDA 1E55A 3B9OA 3W07A 2MANA 4AU0A 4X61A 2ZFAA 2QVHA 4IICA 3B03A 1YTEA 5ABFA 4UOJA 2YL8A 1PB0A 1ECEA 5KZDA 4DJFD 4O8AA 2HPMA 5CPMA 4LU0A 3LDVA 4C5YA 1NWTA 1U30A 1W31A 2VWTA 3MMDA 1G94A 3HG4A 3K1DA 3G1HA 4LEQA 3EXSA 4UFLA 2HPIA 4XV0A 4UFKA 3SCQA 1ONEA 1JGIA 3CB8A 4U3AA 3WK3A 1QI5A 4GHRA 3GR4A 5FJJA 3U2OA 4AIOA 4HA3A 1UASA 2ADAA 1TMQA 1XG3A 2XN1A 4NYYA 4YHGA 2R6OA 1W56A 2VX6A 1FY6A 3V7PA 6PTDA 3W2MA 3EPOA 4UTHA 2F2HA 4IIFA 1A5SA 1OB0A 4E3TA 3GUWA 4LVBA 3TN4A 3WQVA 1EBHA 1OHLA 2OKOA 3TV8A 2V5KA 1VEMA 3AXIA 1EO5A 1HTIA 4E2OA 1RPKA 2QJMA 4A29A 4D8AA 1F76A 2A0NA 1V6UA 1GT8A 5D09A 2QS8A 1ZJBA 1US2A 1JXJA 3DFQA 5HAOA 4Z1YA 2A3EA 1TPDA 5LIUX 3FN9A 2NVCA 4JTRA 4R3UA 3MSRA 4MZYA 3IRSA 2INFA 2NX1A 1Q2SA 1FXPA 5LYRA 4S23A 3G2GA 4GI6A 2JFEX 2YL6A 3GZ3A 2PRMA 1GOMA 4AB4A 3L12A 4KGJA 2V3EA 3KWSA 1WKYA 3BLFA 4IFKB 1K8ZA 2O92A 1Z7AA 3N4EA 2GJPA 4M1BA 4IHCA 1DWGM 4GYFA 4NRSA 2V67A 1JZ2A 3SN0A 1YDYA 1X8CA 3RAOA 1R3TA 4I6VA 1OWQA 4KWOA 4MOZA 4N02A 1JYWA 1H60A 3AAMA 1RV8A 3N11A 1D9EA 2CLHA 3RR4A 2Z2UA 3IIZA 2RDTA 1LM1A 1S2CA 3UNDA 8RUCA 1TVPA 2XIBA 1M65A 3TXZA 4MG4A 4NU7A 3IIXA 4HNNA 4TIMA 4AF0B 2GJLA 2ISFA 2ZCGA 3C2FA 3L65A 1CXKA 3RU8X 3W00A 3QTGA 4GNJA 4U33A 5JBFA 4QCFA 4ATLA 1KFEA 3N4FA 4M24A 3WNPA 2TSYA 1BTMA 3SUUA 5FJTA 2DZWA 3VC6A 3STCA 1GOQA 1KCLA 1YXDA 3WQCA 5CPOA 5JMUA 4Q8TA 2E67A 3SGZA 4DZHA 3EDEA 4PL1A 1RVKA 3A9IA 1KD0A 3PZNA 4X0NA 1QHPA 4H9TA 1G4TA 3U7BA 3V0UA 3LI1A 3WK2A 5FEWA 2QHAA 3KBWA 4AVFA 3E3HA 3REQB 3ABXA 2FTPA 2E5BA 4MADA 2O9TA 4D6FA 4E8GA 2MNRA 1E1EA 1EJWC 4C7GA 5A1AA 1Y5VA 1M01A 5GQBA 1P1MA 3WEZA 2F9RA 3NM1A 1VQTA 2JIEA 4B3LA 1D3GA 2Y5JA 3G0SA 3TX9A 3MHGA 1NDVA 1SU5A 3C8NA 4RW5A 3K4AA 3NPVA 4BKNA 4NI8A 4C6CA 3WMCA 3TAKA 1EQCA 2RJHA 1UUQA 2DEPA 5F1UA 1JD7A 3K8MA 2BHUA 3VIJA 1BKHA 1A47A 4HPJA 5G1YA 1IV8A 3EX6A 1JDEA 3ID7A 3GNDA 1FHLA 1F8MA 1T99A 1WO2A 3ITCA 2ZX9A 3KM8A 4UTMA 3GXIA 3GW3A 3AHZA 5D2YA 3GG0A 2QW5A 4BFAA 3TQPA 3WBEA 2J7BA 3PAJA 4JTDA 4GZ7A 4ROPA 5FF2A 1VLWA 4IOTA 3TC6A 1I0DA 3FGCA 3LTYA 2CBIA 1H7NA 1JYXA 3OHMB 3B8DA 3IGSA 2F84A 4O4WA 2X1TA 3U2ZA 1H7WA 4EWJA 4IX2A 2ZUUA 3TTYA 4REQA 2J9ZA 4KFOA 4NZCA 3BTNA 1HJQA 5HMSA 4Y9AA 4CD5A 1JAKA 3NOYA 5HJYA 4DJDC 4UWMA 4J40A 3AZTA 5CBBA 3UP8A 1H7XA 3L2MA 1E9YB 3R79A 3AFBA 4I5UA 3NZ1A 5HDRA 5IFPA 3RCMA 1ISXA 2R24A 3EXRA 2VCAA 4B9YA 1WE5A 4NNCA 2V3DA 3VIKA 1ZU8A 2YDAA 3DEQA 4D1IA 4XZHA 1G9HA 4QG8A 3OGSA 4C6FA 2B81A 3N9SA 3G1DA 1YPXA 4QJ3B 4E2VA 1VLIA 1UWUA 4A3HA 7A3HA 5A2BA 3IJQA 5MKGA 3WF4A 2QCCA 3WD3A 1C3FA 1MXSA 4UQAA 5LHEA 3QYSA 4UZUA 1BLIA 3CPRA 2Z7KA 4CEUC 1DJHA 4HU8A 4JQ2A 3VKKA 5BZAA 2YIHA 2UZ9A 1HGYA 4LAKA 3GVGA 1FWDC 4HP5A 3LS9A 4E5TA 3S1UA 1BXBA 1PAMA 4D2JA 5AZ1A 2XJ7A 3EPMA 3NQEA 6REQA 3WX7A 3PN8A 3SSZA 4LT9A 2C8NA 3OZPA 3W73A 3HMCA 4ICCX 3BOLA 1OYBA 4L7ZA 2XFRA 5FJPA 1KV5A 4GJJA 1NOFA 1FWNA 5LNRA 4PMZA 1XD1A 4QQ3A 2ACSA 3VABA 3JVAA 1YRRA 4MWAB 2J9XA 4S3JA 1MEWA 2PDHA 3DESA 3CZJA 4JKKA 4V33A 4J3VA 3G1XA 3PWIA 2BVDA 3IACA 2GDQA 3SSJA 3RPTA 3FKKA 4AWEA 2GDUA 4YMZA 1GW1A 4CU8A 1MXDA 4ORIA 4OTKA 4PTXA 4CN4A 4XVDA 4R27A 3TC7A 1AVAA 2WHLA 2BXVA 4JKMA 4YVXA 3OYZA 2ZZ3A 4O28A 2V2HA 4NZ5A 1J01A 5AYBA 4QS6A 4N9EA 2DIKA 1GEQA 3B8SA 1EWEA 1CEOA 3LU2A 3GU2A 2CNCA 4YJ5A 3SRDA 2WSPA 1M7OA 1H5VA 3IANA 2AQVA 4EXQA 2W62A 5AHFA 3GS6A 3A4AA 2HBXA 4GCXA 5BOOA 1B3VA 3EA1A 3IPWA 2H90A 2WNZA 4FNRA 1ONXA 1TIMA 2HMCA 1K7FA 4MWAC 4MNKA 3MHFA 4IIGA 4Z08A 3AU2A 2FZ9A 1SR9A 4G56A 3H2MA 4S3CA 1KM3A 5I2UA 3Q67A 1CIUA 1UB3A 1NDYA 3U2CA 4WX2A 1ODUA 4TX8A 1KBBA 3PBVA 4XZMX 1TYGA 3BWWA 1H7OA 1ZFJA 1QTWA 2E0PA 3E2RA 2QCDA 1QNPA 2QPXA 3NQ6A 2KX9A 3GTFA 3BCJA 1CBGA 2H8XA 1G5AA 1ITQA 4DLMA 4CN1A 4YCPA 3C3UA 4EPEC 4D72A 5CJNA 4XBSA 4MNLA 4NHVA 1CGVA 3WLKX 4Q6JA 3F5LA 2WKLA 1K8CA 3G1YA 4GINA 3GAYA 3UG5A 2BGSA 4U5KA 3VCRA 3A3XA 4D71A 3RFAA 3VGBA 1VBHA 2FZMA 3PPCA 4HYVA 4LF2A 1EEPA 4ZO8A 3VAVA 4X3ZA 4XZ9A 1UC4A 1UZ1A 3M5YA 3LBMA 1N7KA 5D33A 4PTMA 3AZRA 1JZ5A 3CZEA 4US6A 3N2XA 1EEXA 3GIPA 4GQRA 4QEHA 3FJ6A 1H11A 2Z6JA 1W3IA 4Y6GA 4DPPA 2ALRA 2Q6ZA 3ZR5A 4A8LA 4QLJA 1HG3A 5K4XA 3WKZA 1DWIM 4PTWA 3KL5A 2WW5A 2PPGA 3TUUA 2OLAA 1KM4A 5CC6A 5LA2A 3JS3A 2YB4A 4MY1A 4O52A 2WJZA 4UXDA 3WNNA 4OFCA 3GG1A 1Q6GA 5AYYA 4FXJA 5JVLA 2C16A 2QDEA 3N14A 2FVKA 4IMGA 3OBKA 3LQLA 5C0QA 3A12A 4MYAA 3FV9A 1UR2A 2YGYA 1FWRA 1DHKA 4JFVA 1HFBA 1SW7A 4X9YA 3VGGA 4JQAA 5DFAA 4LF1A 3TJIA 1MQPA 4LH8A 2G97A 5ABHA 1ZCCA 3IUIA 4P8UA 3I68A 2DIJA 2ZRYA 4QHRA 2FZBA 4JHOA 5XINA 1UCWA 3FFSA 1WZAA 2BGQA 3B9AA 1TB3A 3WD4A 7TAAA 1TA3A 3PSWA 1PYMA 3U6WA 1RXOB 3S6DA 1C7TA 4JN7A 3OGRA 4UZSA 1LRTA 3VCNA 1O4UA 4JOMA 4Z0SA 3UCCA 2G95A 2NUXA 2YYTA 3WLTA 3AXMA 3M0VA 1W9PA 1JCJA 2XGZA 4IG2B 8A3HA 1F3TA 4GUJA 2GJXB 2OYLA 3ZT6A 4LVGA 2PLMA 2XSBA 2V5LA 5CZTA 1AJ0A 2ZZ4A 7ODCA 3FA3A 1KM0A 4LX4A 2PF8A 9RUBA 4D8LA 4FR1A 1JDDA 3EB4A 5TD4A 4UMCA 1IYXA 3H26A 3C3NA 5D03A 3VIGA 1MQQA 3K46A 5FEZA 2QJNA 1UG6A 4FLRA 2BASA 2XWEA 2JQXA 3AS2A 4H8HA 3QOKA 1A0CA 5BWFA 1JJKA 1HL2A 3MYPA 4LYQA 3LCLA 3EWYA 5F1VA 1SMAA 3N25A 2C18A 4WCJA 1DPMA 2HXTA 3OQ8A 1ME8A 3LRMA 4O1EA 4Z2JA 3L0NA 1CWYA 4DJFC 1YEYA 5A6MA 2ZZ2A 5M1TA 1I2PA 1J0HA 2V2CA 2YA2A 1A5MC 2V6AA 3UYCA 1KBKA 3QLDA 2F2KA 3GFYA 3A5FA 4INFA 1G69A 4XIAA 2FGLA 5DCDA 4AZ7A 1WKFA 1EPXA 3W2UA 4XKYB 2YCIX 3R58A 1ZNNA 3G0XA 1Q4NX 5J04A 1BWLA 2EHHA 2BY3A 3HFTA 5F2IA 1YE6A 1DJNA 1JPIA 2Z2BA 2G5WA 1OSEA 1J0KA 2OLHA 3RRAA 3GXDA 3EDDA 4A3QA 1S39A 1W3JA 3EA2A 4MWAE 3RLUA 1UR9A 3ARTA 1ENUA 3KVJA 1YDVA 2Q02A 1DIEA 2XH4A 3AMCA 3AYSA 4OT7A 1QNSA 3CT7A 3UG3A 2SFPA 1SFTA 1F6PA 2OTDA 3FVDA 3OVQA 2RGLA 2JIWA 3A3HA 4AWTA 3U4AA 1YIXA 3PZOA 4Q4QA 2GSHA 4IP7A 2PEVA 4TVCA 3SUWA 1E0XA 3B8WA 4Z2HA 1ISVA 2XSXA 3VOIA 4FNTA 3TEVA 1QU4A 2NXGA 4HPNA 4F3HA 4F2BA 4OOUA 2FTWA 4PUKA 2WJEA 2CZDA 4EX4A 1O7AA 3EX1A 1AJ2A 3OGVA 4O10A 4E8CA 1XYBA 4JD4A 2OLSA 1C7SA 2A6LA 1I8JA 4Z1DA 4BEUA 1JIBA 4CNOA 1MNSA 4ILSA 3SB0A 3DFSA 3QOMA 5D8ZA 2NSOA 5KZMA 1CX9A 1W3HA 3H7UA 3QW3A 3PJWA 1YMYA 1FWFC 3SCNA 1QK0A 3I7RA 3WL0A 2F6XA 3OU8A 1RY8A 3TYUA 1XYLA 3OLEA 3P74A 4XISA 1CXLA 3LMYA 3I6RA 4O4VA 1ELSA 4LCRA 5CPSA 1K8XA 4JPGA 2YJQA 4MB1A 1GKQA 1OQFA 3CAQA 1WP6A 3NSMA 4EIVA 1QI0A 3VGEA 5AC5A 1QNRA 2AKMA 3L5AA 5ENLA 2VGIA 3WJZA 2REQA 2YSWA 4JIRA 1EF3A 3RM9A 2BB0A 5F2MA 5CPTA 3EZ4A 2BBFA 3ANYA 1KM6A 1OCQA 3VKBA 1GPWA 4XG1A 4HJWA 3W1PA 5IRPA 5BYWA 3ZOAA 3FNDA 2ZC1A 2QGYA 3OVRA 1L2UA 4F79A 2WPGA 3NIYA 1E70M 1J0JA 2OKTA 4PN2A 4HVXA 2CCRA 3DC0A 3H8AA 2GFTA 1PXGA 1VB9A 3UVAA 5IDZA 1O5XA 3DOPA 3NR0A 4G9PA 3C0QA 3R5EA 4Q4OA 4ZOCA 1T41A 4NIRA 4DBSA 3ITLA 3WH9A 2P3ZA 2GK1A 7CGTA 3N3MA 2D0HA 5RUBA 3BICA 1V3IA 1XIEA 1WDDA 4AZBA 3QKEA 2JGYA 2GLKA 3C6CA 4OIFA 1DHPA 3V4BA 1XIFA 4L65A 3KXQA 4H04A 1TCDA 1AW1A 3VD7A 2J74A 3PUDA 4RJEA 3BURA 3CYJA 3IS4A 4S3GA 4QRNA 3IEBA 2UY3A 4N6FA 1XGEA 4YWIA 4H1ZA 4JY8A 4Z2GA 3NQ7A 2HVNA 1QI2A 3ITXA 4KIEA 1SSDA 1WKDA 3KVKA 3LHYA 2I5QA 3GTXA 3R12A 1OM0A 5CG0A 1UKQA 3LGEA 4HJFA 4UTUA 1ZENA 1HJUA 4XK2A 1YXCA 1UJQA 4YTSA 1IEWA 1PL9A 3GAKA 3T07A 4LS1A 9CGTA 4G5DA 3TU9A 2CETA 2G3JA 3DYOA 2GUBA 3EAUA 4GD0A 3SCSA 3E6EA 1VYPX 1DIOA 1LCOA 1A5OC 2X0YA 4J3SA 3W0KA 3PZQA 3JZUA 3M0KA 5K9DA 3NYZA 3AHYA 3OVGA 3SM0A 4DF1A 2FH6A 1SUXA 2VYOA 5HBFA 3HPSA 3TNOA 1R85A 4IL0A 3L67A 3MQTA 1TTJA 4RDVA 3GXNA 2PTWA 5FL0A 4DO6A 4Q8MA 4M5PA 1BVWA 3MJMA 5JH2A 3MCMA 4Z2KA 3R10A 1KCZA 4XZWA 2ZZ6A 2GSEA 1VRXA 4MUZA 3B97A 4Z1BA 5CZKA 1X39A 2PGFA 4YIWA 2X42A 3GY1A 4DBDA 4AD3A 4H83A 5GJMA 1ZBCA 4RW3A 5D37A 3S0CA 2A3CA 2PZNA 3HM7A 1A4MA 4UCFA 1VFTA 1OYAA 3EWXA 8TIMA 2VQUA 3AXKA 3RM8A 4NF7A 1ISWA 2QIIA 3NA8A 4HCLA 1NY1A 2XVGA 1V7AA 4PEEA 4JEQA 4LRSA 3WZ0E 4QE5A 2D20A 2Y5EA 1O5RA 1SJCA 4PZVA 5H8UA 3WLJA 1Y5XA 3W84A 1XRFA 4MVAA 3NM3A 1TJRA 3LSBA 1O95A 4CN6A 1CXEA 1VPYA 4IX0A 3AO0A 3AALA 2EQDA 4NKCA 2HTMA 4O17A 4V27A 3AMDA 2J9YA 2G4JA 1QWGA 2NX3A 3VKDA 1OFRA 1M1BA 3MKCA 2WO5A 3A3WA 2CZEA 1EGZA 2RHGA 4N2YA 3TOPA 1LBFA 2JEPA 3O06A 3M44A 3VK5A 4GE8A 5JUVA 4XBJA 1J6OA 2IW0A 2ZRWA 3PZTA 5CSSA 4GO8A 5HJLA 3BW2A 1WBHA 4JNYA 4WY0B 3D5HA 2VFHA 1K9DA 2CXGA 3I10A 4C5ZA 1VCFA 2EPMX 2FGZA 3WJSA 1F7BA 1B3YA 1ADDA 2XFYA 2NQ9A 2FQIA 5T9CE 1BD0A 1JZ3A 3NQDA 1THFD 1VYRA 3B04A 4LEFA 2D3NA 3VGDA 4F0SA 2YXOA 2Z6IA 1HVQA 3UGRA 3LQGA 3N2TA 4RZ6A 5DY2A 2VX5A 3ONCA 4J2PA 4AD5A 1Q6DA 1DIDA 3GIQA 5HQEA 3WNLA 1TPWA 2OR2A 4I5XA 1O1HA 4IGSA 1U1JA 4GUHA 3HFYA 1NSJA 1SVDA 3WJXA 4JS3A 2XPKA 1K9EA 1PE1A 3PZGA 1E40A 4UFHA 4UB9A 3VGHA 1UOZA 1FWSA 5FJIA 1W1IE 2Y7DA 3S5YA 4E0CA 3VMNA 4U3CA 2R91A 5I02A 5IBXA 1OC7A 1ITUA 2VUNA 1YE4A 1F9CA 4L9YA 3TIMA 4Q8QA 1VAHA 3GRIA 3V5FA 3L68A 5A6LA 3AI0A 4DM1A 4Q4RA 3MP3A 1CT5A 1RLCL 3R0KA 5K7JA 3REQA 1HKJA 1J4EA 4F0HA 2PDNA 2NWSA 3IJIA 3OYXA 3UZYA 5HWMA 1V03A 3VUPA 4AVNA 1J8VA 4AFYA 5IHSA 5DO8A 4YYCA 3QV8A 4F0RA 4EACA 1M6JA 3IGHX 2OZ0A 4UBPC 2ON3A 4DXVA 4B5WA 2ZQ0A 4GABA 2NV1A 4W85A 1FP8A 3C2RA 1LWIA 3URQA 1UHVA 2J47A 1Z69A 3DENA 4F0MA 2AAMA 2EF9A 2BSLA 4GGHA 3W1XA 2WXDM 1IF2A 3IRDA 1N8IA 1A5UA 3EWZA 4DQWA 2IPWA 1Q6FA 2VZOA 3R6IA 4HMEA 1FHDA 4UQEA 4GNVA 1R3VA 5LIKX 2PDLA 4MY8A 3OODA 4GC4A 1IQ8A 1H62A 2FJKA 1V77A 2E9MA 3GVVA 4JTKA 4D9PA 3MO4A 3BJTA 1LBMA 2ZXDA 1EJSC 5GVJA 1A5AA 1A49A 3P8IA 4PMRA 4WSKA 1VHCA 2OVLA 3ES8A 3TN6A 1C8YA 1MFVA 1YTKA 1FA2A 2ZC8A 5A2CA 1P1XA 4NQ1A 3W23A 4KBXA 1DTUA 4PUUA 3LM7A 4IGHA 3K8KA 3O07A 3AHVA 4PUDA 2J79A 5FJRA 4X2PA 4GQ0A 1PX8A 2J7EA 4RDWA 1SSGA 1DE5A 3KRUA 5I24A 5DT5A 5D02A 3H23A 5BXRA 1WDRA 3EOSA 1YNQA 2IQTA 3CM4A 3O7UA 3TROA 3OOQA 1SO4A 3GNXA 3L5MA 1XH2A 3MKKA 3BPWA 2G3FA 3JW7A 2P10A 3L2LA 4X0VA 2Z0IA 5I77A 1DXIA 2QT3A 1UWAA 3E5BA 1MEHA 5D2VA 1XW8A 5KINA 4DZIA 3ONBA 1F6YA 2R14A 1EYWA 2QF7A 3EKLA 2QAFA 2DUXA 1TV8A 1BGGA 4MYXA 1XDMA 1Q6EA 4N0RA 2E7FA 2WNWA 2OWCA 4MKNA 3IVSA 4IIHA 4AZIA 4J3XA 2OFJA 4M6VA 3ZJ6A 3EBVA 1RCXB 1OVDA 2FHBA 4M81A 1E6SM 3ANVA 4J9JA 1JPMA 2A3LA 3ZO9A 4EANA 1R86A 4CLMA 3THAA 3K30A 4X60A 1XINA 4FIQA 1XDLA 1EZWA 2X0SA 2G50A 4FLSA 4GX9A 5ABGA 2OEJA 3W7MA 1E6ZA 3GHUA 2XN2A 3F5JA 3LUTA 5D2TA 3B9EA 3PR2A 3QLLA 2W66A 5FEXA 3V35A 2G41A 1EDQA 1CLVA 3OW1A 3M5ZA 2D0GA 4O57A 2AL1A 3I6EA 3UA3A 4R5EA 4FXRA 2WLYA 5DN1A 3R8GA 2Z25A 4AC1X 3NL5A 5A8NA 1PSCA 3SUSA 3E0VA 2V68A 2Z1VA 3O0FA 3UETA 1LP6A 1ZJHA 2BHYA 1NWSA 4UTLA 6ENLA 5CH9A 4GZJA 2G3IA 2CPUA 2X30A 5DANA 5FI8A 4X2RA 4C6KA 1C9WA 1HW6A 3DGRA 3CL7A 3GSMA 4DX3A 4IMDA 1E4IA 3STEA 3CV1A 2YBUA 1HIZA 3BLKA 4Y9NA 2C0HA 1MW1A 1C9DA 1O66A 3AS1A 2WSRA 3QC0A 1FWBC 1DYSA 4NAEB 3SQSA 1L6YA 5HNRA 2FB2A 4B5VA 1PS9A 1R87A 4WKFA 1EXBA 4W7WA 1UJPA 2CU0A 3P82A 4ZQCA 2ZA1A 3PBYA 3QZ6A 2R8WA 3GXPA 3M6YA 3CAWA 4GVHA 1TRIA 3P0WA 4GYKA 1KCXA 2FVLA 3NL3A 2YDQA 1JXKA 2VWSA 3WF3A 3AQUA 3V5CA 3CQHA 4AIEA 1UBPC 4DYEA 3BMXA 3MI2A 1VS1A 1W3KA 3W38A 4UNKA 4KCVA 5K3VA 5H1WA 1XIBA 4TV5A 1JCYA 3KS5A 3SUTA 4GGBA 1FDJA 5AKQA 4ZQNA 1M53A 3L4WA 4KIRA 3H21A 1TFVA 3STGA 1GVYA 1PDZA 4QE4A 1RA0A 1W9UA 1B9BA 2Z24A 3MI3A 4JTAA 4GX8A 4AISA 1XF0A 4K38A 4P8WA 3TFXA 5C2XA 2CWXA 3F4WA 4PMUA 1XCFA 4QP0A 4JR5A 2Z7GA 1BYAA 1NFBA 2PA6A 1R47A 3B8IA 1L6GA 3WQWA 3EX3A 2X05A 2C79A 3LV5A 2WWDA 1JPHA 4LY4A 2CLMA 4JL1A 1GVQA 5I3GA 2PGEA 3TYAA 3W7JA 3GDLA 4MPKA 3PTDA 4WUIA 4RV3A 5IDIA 1I60A 1AMYA 1XISA 3A23A 1A0DA 3LXBA 3W7NA 1V02E 6TIMA 5A8GA 1AZ1A 3TNBA 2XINA 3VI2A 3BUVA 1MUMA 4C1NA 1UUOA 2E1DA 3VDAA 2JE8A 3NQBA 1QHZA 1QNQA 1AL7A 4FNUA 3NZQA 3P81A 2PP1A 3LGGA 1A5BA 1EJUC 4JGDA 3SRKA 3QZAA 2QXWA 2RH9A 3NDYA 3W53A 2VFIA 2XM2A 3VD5A 5FA5A 5TQLA 3UZXA 1EPVA 2FPTA 3CPUA 2YXXA 1UR1A 2WVVB 2IQDA 5HUPA 1M03A 2G0WA 3AYRA 2IXUA 5TNVA 2ESCA 3AIEA 4G8TA 4LVFA 3N6HA 1Q66A 4P7OA 4IJCA 4QIUA 5CGQA 5EBUA 4WF7A 5CZ0A 3WY1A 1XBZA 2PDCA 2IPFA 3A4JA 3EWWA 3CWNA 1V6XA 4D6DA 1GYMA 3H2AA 3QY7A 2EG6A 4YL2A 4BK9A 5ECVA 5LIYX 3B40A 3EDKA 1RZMA 4YYFA 3SJ3A 3RR1A 3M7SA 3M46A 2XH0A 1WZKA 5I3FA 2J25A 1B30A 4LWWA 1EF2A 2CXEA 4DJFA 2NW0A 1J11A 3APYA 3RCNA 1X98A 4DWSB 1XCXA 3HN3A 1LDCA 4JEJA 1E51A 3M5VA 2PDBA 1XLLA 4JIIX 4BF5A 4KEVA 3O15A 5XIAA 1T6MA 3OTRA 2Z1SA 1W1B1 3MMTA 3EKZA 1VEPA 3WQGA 3Q65A 3CUXA 4PMYA 1NFPA 4HSNA 3RG6A 3UG8A 1GJPA 3SCUA 7PTDA 3EWDA 4XIMA 3L9CA 4IZGA 3DKLA 1PTGA 2QCHA 4FK9A 4RE2A 4WXYA 3MI6A 5E0CA 3WBXA 1TVLA 3BK0A 5C9ZA 5DMMA 1VKFA 2E6YA 1CENA 1JD9A 3TC3A 4KS0A 4TU1A 1OFEA 1TIWA 2E4TA 4GRSA 1E1CB 3KL3A 5FSEC 1KRMA 4PULA 3FEMA 4W5ZA 5B7ZA 3S2CA 4DBEA 2OWWA 1XRTA 2ZUVA 1OX5A 3CAKA 1WUFA 3VINA 3KUMA 4U4MA 4DWSC 2TMDA 2ZZ1A 2UV8G 4LJ3A 3ZWSA 3ANUA 3PWGA 3LCGA 2J7GA 5TAOA 4OJYA 1Q6QA 3N17A 1X8FA 2NUWA 4F4RA 1P6CA 1KRAC 1TX2A 3B8UA 3EGJA 4L4OA 3IIPA 1VJSA 2C71A 3HGJA 1AH3A 4AH7A 3G8EA 4GKTA 2PDJA 4HOWA 1EZ2A 2E8YA 3CIWA 2P8CA 2ZVIA 4LANA 3PNZA 4Z1AA 1A50A 6ALDA 1Q65A 1WDQA 1CLXA 1Z32X 1L8PA 1FQ0A 1G0CA 4MB4A 4IL2A 3BAWA 2ISWA 3CTTA 3UNTA 1CGWA 4JL2A 3PZVA 5J5RA 1LQ0A 3RF9A 3MB9A 2GOUA 3FOKA 1OIFA 1DJYA 3H12A 3R7MA 3VNJA 4LAUA 1A53A 1Q63A 3GZAA 1REQB 1JRCA 3NQFA 4M8UA 4CQDA 2VR4A 1UA3A 3IVTA 2J4GA 4GKLA 1IEVA 3VO0A 4EKJA 1KTBA 3THCA 4FR6A 2OELA 4DAFA 2E6DA 2O55A 2PI6A 4MB5A 1AQ0A 4QISA 4D6IA 3O63A 4XO7A 1KGWA 1GOWA 4DXKA 1PKNA 3EOEA 1VD6A 3B8VA 1JUBA 3E12A 1TJPA 5FD0A 4PCSA 2X1IA 1N82A 1CPUA 2V81A 3Q58A 4J3ZA 1X6LA 3TW7A 4AUBA 2FZDA 3HGSA 3LTSA 3DFNA 5AC8A 4WR3A 3W9ZA 1A5KC 4GQQA 4JKLA 1I9CB 3NQVA 4WKHA 3ARPA 1ZL1A 4F0KA 1GQLA 3TQVA 3TVAA 1JL8A 4BI5A 1DQXA 1MO0A 1F05A 4DUXA 4DVOA 2DW7A 2RDWA 2YCJA 3LCIA 2XIQA 4C1KA 1UH2A 2E3ZA 3KCJA 4NX0A 1G1YA 1Y0EA 5SWUA 1MW2A 3RU6A 1SW0A 1E3ZA 4WZHA 4O1CA 1ZPTA 4GMEA 4AY8A 1UKTA 3UQNA 4M0XA 4PUNA 3UBPC 4WJEA 4D6CA 1GW9A 4EVZA 2CKRA 4NSBA 1XCWA 3SUVA 2AL2B 2PLCA 2VM8A 1UD3A 4AD0A 2GZXA 2YCLB 3NL2A 2OSWA 3WQ4A 3FAWA 2VJXA 3EOUA 5BWAA 2AKZA 1HNYA 2EBNA 3VKAA 1F5ZA 3OBAA 1NOWA 3LEPA 2E09A 2PU0A 1TPC1 1RP8A 4MAVA 1Y8BA 3QPYA 3LMZA 1Q45A 3ARUA 2PDQA 2YR1A 3UJFA 2WQPA 4WEVX 5T26A 5BMXA 1S3TC 3W7HA 3CC1A 1X96A 3KTXA 3S6TA 1SJBA 5CC5A 3CUFA 1FUYA 3U4FA 2X8RA 3R8RA 1Q85A 1W54A 3E2QA 2WLZA 4HKPA 4PCFA 3BSGA 2OX4A 4ZMGA 5KMYA 1JCTA 2BDQA 4N9DA 5E1QA 2PP0A 1SPQA 1EGMA 2F6KA 3VTRA 4PTDA 3WUGA 2RGMA 2Y63A 4KCUA 2QUVA 2AGTA 1F6KA 1J18A 3WF1A 2WZMA 4MFDA 1K7XA 1XQKA 3E9AA 1M3UA 2DU2A 4AIUA 4NILA 1VJIA 3RM4A 3GXMA 3DI0A 2EG7A 1B31A 1TE6A 3VFLA 2I14A 3PM6A 1UR8A 3TA6A 2ZX5A 3MZ2A 4CQAA 4ZO6A 1FFRA 3A21A 2QV5A 2B7PA 3OQEA 3STPA 4C91A 3IVUA 3KVMA 4W89A 1BHGA 1A5CA 1HVXA 4CCCA 3TYCA 3H4WA 1UD5A 3TTOA 1CXHA 1M7PA 3RO6A 3AMLA 5FEPA 3MC5A 4DN1A 3VDBA 2OPJA 1ME7A 2I9UA 3OG3A 3IJ7A 4F2TA 4HSOA 1V0MA 1X38A 5DBUA 3THDA 1RCOB 4AWUA 4QFUA 2HISA 1GVRA 3PBGA 4ZBCA 5G1TA 1KLYA 3TWBA 3W81A 4BWLC 3ARXA 1XL9A 2I17A 4LBSA 1O6IA 2VZUA 1VR6A 3DC8A 5A2AA 4DXXA 1XLMA 1HKWA 3UWQA 2PDUA 4QR6A 1TMLA 3GVWA 3N1AA 4TTUA 3E2VA 3FYPA 4JICA 3CLMA 3P62A 4P5UA 1SFLA 1UIPA 5AC6A 1RSCA 1Z9AA 3GTIA 1NWUA 1V0KA 3T2OA 1SJAA 3V36A 3VCCA 5CLTA 2A79A 3XISA 1MDLA 3U48A 3A4WA 4EAMA 3VDCA 3ZJ8A 4H7ZA 1T40A 2BGNE 1JUEA 1XFCA 2DT0A 3S47A 2QULA 3D46A 4G7EB 5EFFA 3QV6A 4HZ8A 1I1XA 1KW1A 2CITA 1DJXA 1LWHA 4UQBA 4D6EA 1R2TA 1RJPA 3DUGA 1H1NA 4JFWA 5A8MA 5JBEA 4F8XA 4M19A 1W8GA 2CWNA 2A3HA 3KS6A 4GZEA 4IQDA 3PG8A 4NZFA 1IEQA 1NTHA 1KR1A 4ACYA 1JEZA 2P3EA 4ZA0A 4WIWA 3TKFA 3WO8A 2H6RA 3T09A 2J7DA 4PR4A 1RA5A 3G1RA 2E8ZA 3S9ZA 1R2SA 1B9ZA 3ALGA 1R5YA 3M1ZA 2QZRA 4RV8A 3KZPA 4UTTC 1UQYA 1AODA 1OD0A 2VCCA 1BXNA 2V5DA 4ZENA 1EHAA 1K6WA 4LNYA 3VD4A 5AYIA 2BWGA 4HU0A 3THQA 3V75A 3PANA 1ZJAA 3LCFA 3NQMA 2G37A 4RNJA 2C14A 3IUHA 3L2IA 4HQVA 4L4MA 4PCTA 2QCGA 1SJDA 3RX4A 2WZHA 5CC3A 4A8RA 1G7UA 2D0FA 4XZBA 4B90A 3N15A 4JTEA 3AIRA 3C4UA 3CJPA 1ZP3A 1SZGA 3WENA 3RK8A 1E0UA 1XQLA 3PTKA 5D9MA 3CZLA 1UWSA 2QVNA 1S46A 1MQRA 2QCMA 5AB3A 2GQAA 1EOKA 3TW9A 3BO9A 4FOKA 4A3YA 4B5XA 2PU1A 2YFOA 2DVTA 4YLWA 2WCSA 4LAMA 1C90A 2IKJA 4M3PA 3QFEA 2PDKA 1F74A 3ZVHA 4GI4A 3WH7A 1ZTVA 4Q8WA 5JIWA 3WNKA 2GVYA 5C7HA 3QHNA 1G4SA 3SRHA 2PD5A 4OBTA 5I5RA 3SO7A 4NY2A 1UD2A 4UIOA 4V1XA 4FI4A 3UR8A 2NWRA 4HHPA 5D30A 1JF6A 1N2VA 2XWDA 4L9ZA 1EO7A 1M41A 4GJIA 2O9RA 4ADSA 5LNVA 5BXPA 3KBSA 3R0DA 4KKXA 1ZAHA 3NPWA 4M6PA 3R94A 4UC5A 4WVXA 4EOUA 5I6SA 3WMLA 4AW7A 2PUZA 4LPCA 3LHVA 1LTDA 4PE8A 2V0TA 1LLWA 3OP2A 4E2BA 1XI3A 3AROA 2WWCA 1PO9A 3N2CA 4HK7A 3M43A 5GNYA 3I3BA 3ZYZA 3NNTA 1DL3A 3FDKA 4C6EA 4K3ZA 4S3BA 2Y7GA 3RCYA 2W5FA 5E9AA 4TUFA 3I3DA 2IMRA 3EA3A 2VXNA 1JZ4A 2RDUA 1A5NC 3DERA 2C7FA 5A94A 3KW3A 3MV11 4LUTB 3SN1A 3UWEA 4AZ6A 3KDOA 1GWJA 4ERGA 4DO5A 1W8SA 2QCNA 1GKRA 5AHMA 5LGZA 4K1GA 4K8HA 1RD5A 4POCA 3FYOA 6A3HA 1VBUA 4XD3A 3O8AA 2CBVA 3W02A 1IT0A 1K6AA 4M29A 2E9LA 1E1FA 1TPEA 4GVGA 3KOWA 4DUWA 3AYVA 3E74A 1TTIA 4Q33A 3J7HA 3KHDA 2ALDA 3Q45A 1JAEA 5CQ1A 5A8QA 3K2GA 1FWEC 1UH4A 4B3ZA 3MV01 1U5JA 1MYRA 1JQVA 4HU4A 3LZ3A 2DT1A 4XO6A 3CGTA 3H7VA 5HOSA 2FMOA 2V9DA 3AC0A 4HMNA 2V63A 1X7FA 5DCBA 1C8VA 3ZSSA 3BW3A 1Z42A 3B0XA 3WBAA 2F6UA 1CYGA 3W29A 4NG3A 3HB9A 2YW4A 3W7LA 4PA8A 1Q13A 3VDGA 1G7VA 1P0EA 3BQ5A 3TCEA 2VDGA 5F2LA 4NASA 3V3WA 1BSLA 3BANA 2TODA 4CVUA 3SEPA 4V1YA 4DAIA 1US0A 2DT3A 1LOSA 3DHFA 3SGUA 3QM3A 3LY0A 3VIOA 1IXNA 2UWFA 1ESWA 1J5TA 4P7NA 3M4HA 1Q6LA 4B92A 4FMVA 1YDNA 2DZTA 4Q7NA 1UROA 4XQ6A 3S9YA 1OY0A 1QNOA 5C7VA 3FA4A 3KBMA 4PRTA 2WVUA 4L9XA 3SCRA 3BW4A 4ROQA 1XJBA 3EYPA 1J2WA 3QVQA 1SZRA 3KE0A 3T0AA 3LA4A 1MW3A 4PUWA 2XIJA 4FOUA 1NARA 2V8ZA 4RX0A 1V7YA 1CZ1A 3CK5A 2QQ6A 3BZJA 3KHJA 2DVXA 5DXXA 2W6RA 3QH2A 1IXPA 4HYRA 4QNWA 3DH7A 2XVKA 1G4PA 3QJAA 3QGVA 2QJIA 4JHMA 1RK6A 2GSJA 1VPXA 5LIWX 1V08A 4RPQA 1EJVC 1N55A 4MJ4A 2Z1KA 2G3NA 2WSKA 2O56A 2EKCA 1V4YA 3XINA 3YPIA 1W1TA 3GR8A 3L4VA 2H9AB 2DZPA 3O0KA 3WK1A 4R34A 1HO1A 4FX7A 1QPOA 4Z2IA 3GTHA 1XXXA 3M0MA 1Q6OA 2WV8A 3DBNA 1W6TA 3W3OA 3P6LA 2Y88A 1U33A 3N9RA 1SR0A 5EYWA 2CERA 1ZZMA 4IP5A 5GNZA 1NWRA 5A6TC 1BKSA 3PZMA 3ZLFA 4F9JA 5TBOA 1SYTA 2WMHA 2WB5A 3ARRA 3GDRA 3CO8A 1BYCA 3E2SA 3OB8A 2C19A 3NG3A 4KFPA 4LC6A 3V0TA 3H6OA 1RAKA 3CZ8A 5G2HA 3UESA 1TV5A 2RDXA 3CHFA 4JTGA 4EPBC 4JFSA 4OOZA 4BF9A 2E5DA 4PRWA 4L1GA 1J0IA 1RY0A 4OKDA 1EJTC 2PWVA 2HEJA 3WLLA 4AEFA 4H3DA 1LRNA 4W84A 4U28A 5C71A 2C13A 4K6AA 2W79A 1TRDA 1WAUA 1W32A 2H8ZA 3BH4A 4ZQOA 3B05A 3MSGA 4ZO7A 1XIHA 6XIMA 1IR2A 1EX1A 4ML9A 2INZA 3IAQA 1WYIA 1DWFM 3UXKA 4BA0A 3VA8A 4OZOA 4PMJA 4WQ6A 2E40A 2OCZA 4WDUA 3IJDA 1SZEA 1WA3A 2VFDA 1RBAA 3BGGA 4O14A 1PBGA 4DI9A 3N6QA 2FVMA 3IK2A 5ABFB 3VIMA 1XLBA 4W86A 5BXSA 1L9WA 4KCWA 5D2WA 1VRDA 4ICMA 1QT1A 3MJYA 2Q3OA 4JNMA 3T55A 4HN8A 4ZODA 4R9XA 2YOCA 1K7EA 3T1GA 4YTRA 2X7VA 1X6NA 2GVEA 2VC7A 3NGJA 1H0GA 3PBWA 2ISSA 1OF6A 5LA1A 1QATA 3ZXWA 1JI2A 1UZHA 1ZBWA 2PRLA 3QGKC 4QJ5B 3AIQA 4JTQA 5M17A 5GNXA 3RMJA 4PH6A 2PDPA 1EKOA 2D22A 3DIPA 1LQAA 3WLIA 5BMWA 1JYVA 1JYNA 3OLDA 3QQWA 3RJYA 3P67A 3A4XA 4JBRA 1B3XA 1TUXA 4WJ8A 1BF2A 1SMDA 1KXHA 1TWDA 2OZ8A 3T05A 4GACA 1IZCA 4S3FA 1CTNA 4NT0A 2NX9A 4P7RA 5F4WA 3OEXA 3N12A 1QO5A 3P61A 4HHHA 4J3WA 2GVJA 4UFIA 4QQUA 4HIBA 2PLJA 4DI8A 3I7SA 2WHJA 1I2NA 3TTSA 4MUPA 4LGXA 2X2YA 1XDJA 4CNNA 3OIHA 4M1RA 1EDTA 1A4LA 3PC0A 4DRSA 3QBUA 5KSWA 4HA4A 3CQ0A 3M0HA 4IQEA 4LTSA 5HJXA 1BPLB 3AHXA 1LJYA 1F4HA 1N8WA 4H9MA 1CXFA 5FOOA 1MUCA 4KH2A 4L4PA 2PURA 3INPA 3NPUA 4A3RA 4DBUA 1XYFA 4U2YA 5HATA 3M0IA 5AHNA 3SCWA 1H1YA 5G5IA 2I16A 4ACZA 2J66A 2JKAA 4RPPA 1PZ2A 2QYGA 3DFHA 1TELA 3RX3A 4J3TA 2V5CA 2J13A 3ICJA 1Q6RA 4BI6A 5D2XA 4LUSA 5B7YA 3K8LA 4IJRA 4TQTA 2W3ZA 3O05A 2CZ5A 4KESA 3DBPA 3BJFA 1WOBA 1GVEA 5H91A 3CHEA 3GG7A 1RP9A 4GY7A 1AQMA 1NAL1 1FHUA 4C7FA 5HUOA 1GPFA 1QPKA 3PPHA 4XUGA 4FEZA 3T40A 3LK6A 3HQOA 1FTXA 3UCQA 5C9XA 3TTQA 3W01A 5FL1A 5BROA 4ECLA 5LKYA 2CESA 5D38A 1OFPA 3T0BA 1GQJA 2XN0A 3S46A 1BFNA 3BGJA 1E43A 1XLJA 2CBUA 1UP0A 2I1OA 4DO7A 2FZNA 1KB3A 1JNDA 3O1NA 4MDPA 3S6OA 1AG1O 5IM51 3S2NA 2HS8A 1JZ7A 4WGHA 3K4DA 2DZXA 3B0PA 4Z1CA 1CGYA 1JR1A 2VT0A 3G1SA 5DF0A 1CNVA 1TCMA 2DY3A 3NJ3A 2HV5A 4BI7A 3S5NA 2BXZA 3CASA 1GOOA 3TN5A 2DZVA 3PVFA 2PCEA 3W86A 1DWAM 3O2LA 2YYUA 3CO4A 3NSNA 1WXJA 2PFHA 1UOKA 1XYMA 4NAFA 3ZMRA 2DV0A 2CLIA 3WQOA 4B5TA 1L8NA 1DP0A 1XHGA 3S5SA 3DG7A 1OK6A 2OSYA 4IMEA 3KRBA 4PSRA 4C1LA 1LT7A 1ICSA 3W26A 2I7GA 2OGJA 4PBEA 2XZ7A 3LBCA 2HVMA 3H70A 3WF2A 2NQJA 4GIRA 5BNKA 2DSKA 2PDIA 4QBXA 1TREA 4KETA 1J79A 1CB2A 1T7LA 4ZXLA 1ZSXA 3LOTA 3GBEA 3OIXA 3HPXA 4RNHA 1FKWA 4QAIA 3GR7A 3FGCB 3U8GA 3WLOA 2PCQA 4NXSA 5DELA 2WC4A 1DV7A 3P60A 3KCOA 4XTIA 1RJRA 4JIHA 2ZYFA 4REQB 2A2IA 4ZL1A 4N9BA 1AZ2A 1OEPA 3GDBA 1AUSL 3NEHA 3EWCA 5E70A 2YFNA 3CH0A 5LZLA 2XGBA 3C2YA 3VIPA 2HRWA 3MANA 4OBSA 2ZUWA 4FZIA 1RUSA 2A7NA 4HTYA 3MKVA 1O60A 1KQYA 3CLWA 4NVTA 1RCQA 3GBDA 4IT1A 1H41A 3PJXA 4GBDA 5C2CA 3I6TA 1VJZA 1OX4A 1YPIA 1AMKA 3MPGA 4B9ZA 2ACQA 1KA9F 3BLEA 1BVZA 4S3DA 3TK7A 3QEZA 4JY9A 3MDWA 4Q6XA 4LW7A 5HWJA 1BRLA 2EPKX 2G3MA 4Y7EA 1WDWA 4EPDC 3N29A 3ARWA 1LBLA 1DJQA 2QIWA 3HV8A 1EJXC 1NJJA 3OLGA 4NL1A 3T0CA 3EMQA 4QXIA 5MKGB 3WBWA 4ZE4A 1ZJIA 4RXFA 3BMVA 1CB7B 4WJXA 2BG5A 1VFOA 4DYJA 1BVNP 2IUZA 1FX6A 1EBGA 3H24A 5H6HA 3W28A 1VPQA 3GDKA 3ABRA 1V3MA 2QCFA 2VMFA 3EMCA 4JN6A 3SJNA 1UMLA 1MUWA 3TONA 1IWBA 1GVSA 3ABOA 3U2EA 4LRTA 3CV6A 5KZEA 6REQB 5EKYA 1PCKA 4ZFMA 4GZIA 4HYWA 2ZTKA 2IPJA 2HE8A 3VX0A 2D2OA 1XGZA 4I9TA 3UXAA 2Q09A 1VBGA 4GPNA 1DWHM 3LBOA 1EC7A 1F3XA 4QG6A 3DKJA 5M2FX 4P7LA 2JKPA 1B5TA 4TV6A 1JCXA 3SR7A 3D0CA 4QGCA 4NNBA 4GO9A 2J27A 1AW2A 4E4UA 4AD2A 1FWCC 3G22A 1XH1A 2VX7A 4S2CA 1FHVA 2P1FA 2VOTA 2P0OA 2DGAA 3VKJA 3JU2A 3OG2A 2UY4A 3AJ7A 3DU0A 1J5SA 2J8GA 5AFDA 3LLXA 1W5OA 3ABSA 2E5CA 4ADUA 5BXTA 1CGUA 3MVIA 3KTCA 3BAKA 5A6AA 4F0LA 2UY5A 1DXFA 3P7YA 1SO5A 1UWRA 2QCLA 3SFKA 2VR5A 1OABA 3USZA 5TF0A 1RHCA 4D1JA 3ZWTA 1S5VA 2VCBA 3QZEA 5I00A 3WDQA 2V38A 3W1LA 4I7VA 1QASA 1JNEA 1XSIA 2ZZ5A 1TPB1 4DPQA 3BSHA 2ZXBA 3M41A 4FF5A 4GXWA 1LT8A 2ACRA 3QMRA 2DH3A 3CMFA 4LB4A 4ZOAA 4WY0F 5EMYA 2Z28A 3BG9A 1VP5A 1EIXA 2X1UA 2QCDB 3IV8A 2Y62A 1KFJA 1TSIA 1PZ0A 2CIPA 3KRSA 3UG4A 1XD0A 1X1ZA 4XSLA 2VRKA 5MHBA 4I5RA 4W7VA 3VM5A 2PE4A 2Q8XA 3UR5A 2EXOA 4DNMA 1QI3A 5KITA 3WQPA 3S3GA 2CYGA 3BLLA 3GWQA 4HA1A 4ZQRA 2NV9A 2VVNA 2FDSA 3HURA 3UWUA 4AXNA 1YYAA 1IIGA 2A85A 4O0ZA 1PCWA 1EA0A 3TSDA 1U2YA 1YNPA 1M7JA 2ONEA 4AVOA 3LPOA 2I5GA 2J77A 4JCLA 5D05A 1K1DA 1OD8A 4JQ3A 4W4QA 1WZLA 1M04A 3LN3A 3MW7A 2DVUA 3JR2A 4LAZA 3AIUA 4TX6A 1XSJA 2EPNA 3N04A 4XAPA 3M5XA 1BSIA 5CBJA 1QPNA 2VEKA 1V3HA 1LUCA 1EJ7L 3C2VA 4RL3A 1NVMA 1OYCA 2FYMA 3UXLA 3DCPA 2P0IA 1DWJM 4DIAA 2BZNA 5A3HA 4KEMA 5H8PA 1SW3A 3BCDA 1OCBA 3GH4A 2JF6A 3RHGA 1HF6A 3R11A 3D3AA 4QS5A 3DDMA 4F9DA 3GNPA 4BEQA 2Q8LA 4RZBA 3UYIA 3VKCA 1E4LA 4A2SA 2OODA 1GGOA 2VKZG 1KKOA 4AX6A 4D6GA 1XUUA 2E1WA 2J7CA 1HXJA 3EX4A 1XPYA 3GYCA 4H7CA 5FAJA 1EX5A 1Q5MA 2VD8A 4LYKA 3W1NA 4G6CA 1AFSA 3DAQA 2VFEA 4GH1A 1IZKA 4I3GA 1V6TA 1E56A 3M6DA 3S1WA 4XWUA 4CGTA 4LV4A 3C52A 1TA3B 1MMFA 3C0LA 1GG0A 3VX1A 2PF0A 1R46A 1C8XA 2J78A 4HZ7A 3Q37A 1YXYA 3SY8A 2BX7A 4LS0A 4ORMA 2GQ3A 5D8WA 4L6DA 4MNJA 1JUKA 1O1ZA 3PNUA 2A4AA 3BARA 4ZOEA 5CBIA 1PHQA 3TA9A 3LM3A 3WK0A 1PIIA 4KRZA 1ZCOA 2ZUNA 5IHRA 1UR3M 1WOAA 1OGBA 3UGVA 4C6MA 1KTNA 2E25A 3L4XA 2CFFA 4PMDA 1S2UA 4ML4A 1JZ6A 4L56A 4B5UA 1UYQA 3BLIA 3VZYA 4UTWC 1Z41A 1P43A 2WKGA 5REQA 4ZEPA 1UR0A 1RR2A 1OFDA 1HO4A 1GZGA 4H6KA 1AK5A 3TCSA 4H6QA 1EWDA 3W6YA 1T8XA 3WLHA 5BRBA 4M7TA 1K02A 4I90A 1NQ6A 5I3KA 1J10A 1LG2A 3A13A 1U1HA 4LUTA 5I09A 2WMIA 5LIXX 3MCOA 4JX5A 4GYPA 1UC5A 3NSXA 1RVGA 2IKGA 1GG1A 1O68A 1TE1A 4JZ5A 1KV8A 1D7KA 1KTCA 3L21A 3PTQA 1D8CA 4O1AA 2I9EA 3GU9A 2POZA 4U10A 3TW6A 2YL5A 4PB5A 5A6BA 4ATDA 4HT3A 3W22A 3S2JA 5FCZA 1FCUA 3TLQA 3K1GA 4C7DA 1BGAA 2ZXAA 1VFMA 3ARZA 1E0VA 3CHVA 2XVNA 1QBBA 3CNYA 3ZVIA 3CL8A 4P8VA 4WLCA 1G4EA 4KGLA 3NO1A 1W17A 3M16A 2ACUA 4HNOA 2V30A 3E49A 5HNNA 2VFFA 3KLLA 4ZGYA 1U5HA 2R1KA 4UQ9A 4C6BA 3AICA 1Z89A 3O6YX 1QW9A 2XH2A 3WLPA 2BMBA 4XZLX 3FLUA 2Z00A 1XLHA 4I7WA 3QSTA 4O1FA 2E68A 3UZZA 3M0YA 4US5D 2A21A 3BE7A 1Q8JA 4NZ3A 3G5EA 3WH5A 2XVLA 3URBA 3MUZ1 5D9PA 3NVTA 2PRHA 2VZTA 4PMOA 3N13A 1MZHA 4CEXC 1I75A 5C9RA 2QMJA 1CW2A 4ZTXA 3AOFA 1FH9A 2QUNA 3U9IA 3GQYA 3UF9A 1P0DA 1QPRA 3Q94A 1LOLA 4KMQA 3SFWA 4HOXA 4QDPA 2VI0A 4JDBA 1EOMA 3BC9A 3NDOA 2EAWA 5AHIA 4H9YA 1IHIA 4RCXA 1VBJA 5D9NA 2XFWA 2A1YA 5HMEA 2NT0A 6XIAA 5ABEA 1F3WA 1FWHC 4DLFA 3QF0A 3H53A 3SQMA 2ZDRA 3GB6A 4H8UA 3CUIA 1EDGA 3BVJA 3DI1A 1GQIA 1LG1A 2RUSA 2G8ZA 4X63A 5DMNA 1V3LA 1RJQA 4AXKA 1ZAIA 2NT1A 4MLJA 3HGOA 4XAGA 2V82A 4Q7BA 2DIEA 1TWWA 2Z4GA 4K37A 4H8NA 4AEOA 3E0LA 4KEUA 4TO8A 2DFAA 3HTWA 4K2SA 2UY2A 2D2JA 1UH3A 3H22A 1PYFA 2REQB 3RLVA 1XICA 3QQ0A 3Q2DA 3LENA 2GDVA 4JXCA 3VD3A 1W5QA 4CU7A 3K5XA 3W1RA 2DP3A 3EWUA 3TQKA 5K2ZA 3UCDA 1P7TA 3UERA 1RD6A 1KFWA 3DFPA 4JYEA 4BJHA 1JCLA 1BXCA 3PUOA 4QITA 4AZCA 3BLDA 4BQ4A 3VE9A 4ENLA 3MWCA 4LV9A 4MDOA 4PEKA 4JQ4A 4I6KA 5EA9A 3RPDA 3WG6A 4EXBA 1IR1A 5G4EA 3LRKA 3W7RA 1OIMA 3F4VA 1G01A 1TVNA 1LORA 5LSMA 4NJKA 1B57A 2P8BA 3OO2A 3CQIA 3WDIA 4YU1A 4QROA 3ZT5A 3B0YA 1W91A 5KTLA 3T0TA 3MUY1 4PRRA 2BNJA 1QJWA 4AG0A 3MP4A 2Y61A 3W70A 3VNKA 4CCEA 4IJBA 3CUGA 1GOXA 2OXNA 4RR4A 1YBQA 1GVFA 2GK1B 2XIMA 1TR1A 1XRSA 4W8AA 4Q4SA 2PTZA 2ZOXA 2J8TA 1DJWA 3TQ0A 4AHOA 3GC5A 3HV9A 1PZ1A 4PUMA 4S1FA 1Q2RA 1DORA 4FSAA 5D04C 4MM1A 5EMMA 2GVLA 4JYDA 4O18A 1WZMA 4OECA 3UJEA 3N2MA 3N18A 1XBXA 4JTTA 3HZ3A 3VNMA 2DDXA 2CW6A 3TR2A 3SW6A 2JK2A 2DW6A 1A5LC 2OEMA 2ZUMA 3DGBA 3APTA 2XTKA 4RZ5A 4RNFA 2ZA3A 3ERPA 1S5TA 2D69A 3NFUA 2X2GA 5AVHA 1GZJA 2IS7A 3HOJA 4ALDA 1Z48A 4TX9A 5CGTA 1JI1A 3MUIA 1QAPA 3TJXA 3S2LA 5CGMA 2FFIA 2WYSA 1VIWA 4G1KA 3KRZA 3S5OA 4Y9OA 2PTDA 5DMYA 5AHLA 2P53A 3RGTA 3WLNA 5HNUA 3TOYA 4IGNA 5AVNA 3AWOA 3FJ4A 1V3JA 1E6RA 1KXQA 1O5KA 2YCKX 4W8LA 4LS2A 4DWSD 5KEZA 4ZB5A 5XIMA 3VC5A 2HNEA 2HXUA 3MP5A 3GO2A 3WDRA 3K4WA 3PPFA 4I8DA 4NX5A 3FVMA 1XLFA 4IXHA 3FCPA 1AH4A 1XLIA 4FAMA 4IQJA 4HHMA 3IK4A 4TVUA 1KFLA 1TV2A 1E9ZB 1TZ9A 1TO3A 1HX0A 4PFHA 3DN5A 3VMPA 1PKLA 4DELA 5A95A 1BEUA 5EBAA 5EMKA 1FCBA 3VIFA 3W88A 1UA7A 4DHGA 1MSSA 4JIQA 1NELA 3CH9A 2V3GA 4S38A 3WBYA 3IGUA 3LERA 1GZ1A 1W1PA 1Q3NA 1VFUA 1ZGDA 4XSMA 3GC2A 4A2RA 1HJVA 4Q8VA 1B54A 1U1UA 4Q8NA 2L5HA 3AS3A 4A8IA 3AIWA 1XFBA 4JQ1A 3ITOA 5BRQA 3ZLHA 2WNNA 2DORA 3TMQA 3BAJA 3GFZA 3M0JA 5A69A 5EGRA 4LCQA 3GD6A 3P0XA 2G4FA 3RITA 1XH0A 3ARSA 3ZIZA 1HQTA 3W74A 5E6YA 2HNHA 2NSXA 3HQPA 2QUMA 3BAYA 5T8GA 1UKPA 3DX5A 2A6NA 4CNPA 3F1QA 2RFGA 1E6XM 1OBAA 1WB0A 4HNCA 3UPBA 4N7QA 1XKYA 1WBJA 1XLCA 3PJTA 2DZUA 1AL8A 1WV2A 4PCPA 4CKQA 5E6ZA 4IFKA 4CD7A 3PUGA 2BXYA 2OO6A 3MU7A 1VCGA 2NV2A 4H00A 1KC7A 4B16A 3VNIA 3WN6A 4XKMA 5CSUA 5M3WA 2BY1A 5IFTA 1XLKA 3WDHA 3HGRA 3QR3A 1XX1A 4AYGA 3SGGA 1QDSA 2WMFA 1UQZA 3ITTA 4IMCA 3W27A 3P14A 3QC3A 4BQ5A 4DZ5A 3WQFA 1OZQA 4B5SA 3ES7A 2JBMA 4IWWA 3GNNA 1HKVA 3PZ9A 4BS0A 4E8DA 4PUJA 3VOFA 3W7PA 1LWJA 1XKJA 4KERA 4AF0A 5AY7A 3B3DA 3POCA 3LLFA 5FACA 3WUBA 4QLLA 5BU9A 3NQ8A 2I57A 3TH6A 3P8JA 3AU6A 1OFOA 4JTHA 1OGSA 3VOHA 1NM9A 3ZLGA 5DQPA 3NQGA 3UPWA 1J93A 3SY1A 4AEEA 4H7VA 1I45A 4HNVA 1J2BA 4U5IA 4PMNA 3WLSA 2D1ZA 9XIAA 1V6YA 1ITCA 5HPCA 1P4CA 1V3KA 2ZBTA 1MRAA 2OT1A 3EEZA 1DJGA 2WKJA 4J1OA 3IV3A 4MNMA 4KW2A 4P7QA 1UP2A 4LUIA 5MF5A 4P8XA 2W9MA 3Q4DA 3S1XA 3RRXA 3CIVA 4O50A 4HTBA 1JCMP 4C6LA 3ZJKA 3KP0A 4HMDA 1E73M 1BWVA 4XVEA 5U7SA 5FF4A 3OJGA 1V0LA 4G1NA 3RIKA 1V6VA 5FJOA 3NXLA 5G2WA 4DJDA 4GCAA 4GY1A 1J6PA 2CHRA 2X1SA 3AWNA 4HPXA 4FA3A 7REQB 4JX4A 3B4YA 1VH7A 3E0WA 1R6WA 3FSUA 3TYZA 5IBXC 2XH7A 1D3HA 4B2DD 2EKGA 1L0PA 4M51A 1XG4A 4JIPA 2CLOA 2X7WA 2HWGA 4O53A 4HNTA 2OX1A 5E93A 2VEFA 2OGYA 1RQBA 3P2VA 1ODZA 3BLOA 2OG9A 1KNWA 3B8TA 3GK0A 3T2PA 1X1OA 1EP1A 4LFYA 3SQLA 3NZPA 5DY3A 2O4MA 1EP3A 4RE4A 2Y4SA 4CNTA 2Z1XA 1BQCA 4LCSA 3T44A 3URAA 4XUYA 4H8VA 3F4DA 1UPMB 4XAFA 3P84A 4AD4A 4MJ2A 2XSAA 4KWUA 4TOQA 3WEOA 1OFQA 2FDMA 4G7FA 1MXGA 2RKXA 2PWGA 3T6CA 5CAKA 3HJZA 2ZX8A 3SI9A 3JRKA 1GEHA 2QDGA 4IMAA 1W2PA 4A8NA 3D3FA 1TZZA 3KTSA 5I0DA 3LNPA 4UOQA 3VOJA 3E38A