5J8LA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy l-tagatose, using a crystal grown in microgravity
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 116
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 5j8lA00
1I60A 3U0HA 3AAMA 3KBNA 4HHLA 4GQBA 1XLGA 2XISA 4YTTA 3FVMA 1BXBA 1XLBA 3C0SA 4XSLA 3P14A 5TNVA 1XIHA 1XLEA 5XIMA 3AYTA 3U3HA 2G4JA 1XYLA 4ZB0A 3BWWA 1XICA 3ITXA 1XIBA 3ITVA 2QW5A 3ITLA 3GNXA 3M0XA 3M0LA 4QEEA 1A0DA 1BXCA 4J4KA 3JU2A 3UVAA 4Q7IA 4QDPA 4A8IA 9XIMA 3TVAA 3P6LA 2NQJA 1XIMA 4X61A 3CQHA 2OU4A 4QEHA 2GUBA 3IUIA 5XINA 2GYIA 1XIJA 1XIGA 4YTQA 3VNIA 2GVEA 4PFHA 3N4AA 4QE1A 4X63A 4XSMA 4A8LA 5I7GA 1XLDA 5B80A 5XIAA 2HCVA 2J6VA 3KCOA 4QE5A 3C0LA 1XINA 3AYVA 4US6A 6XIAA 1I6NA 3KBVA 3UA3A 5EMKA 3C0QA 2X7WA 1D8WA 1XLMA 3UA4A 8XIAA 4YTSA 1XYBA 4YTUA 1XP3A 3DX5A 1DE5A 4LNCA 3VNLA 4DVOA 9XIAA 1XLLA 4GJJA 3CQIA 4XISA 3LMZA 4XKMA 1XYMA 1QUMA 3XIMA 3ITYA 3KWSA 4ZBCA 3VNJA 4E3VA 4X60A 4HNOA 4EACA 3ITTA 1TZ9A 2QUMA 1A0CA 4A8RA 5AVHA 4HGXA 4GJIA 1XLJA 5EMJA 3BZGA 1MNZA 1XLAA 3KTCA 3UXIA 5H1WA 3NGFA 2NQ9A 4K3ZA 2X7VA 4ZB2A 4QE4A 1A0EA 8XIMA 3WQOA 2I57A 2QULA 5EMLA 2ZVRA 2XIMA 3OBEA 3BANA 3CNYA 1XIIA 1QTWA 1XLCA 1OADA 2ZDSA 3UU0A 1DXIA 4DUOA 1MUWA 2HK1A 1S5NA 5FA5A 4YTRA 5AVNA 3ITOA 3IUHA 1S5MA 2NQHA 4W4QA 1YX1A 1XIDA 2Q02A 1XYAA 2GLKA 3KBWA 3M0HA 3AALA 3QZAA 3KCLA 1XLKA 2QUNA 3IUDA 4ZB5A 1GW9A 3CWHA 3M0MA 3TC3A 4QDWA 4K1GA 4A8NA 3BDKA 3L23A 4G56A 1XLIA 3KCJA 1CLKA 1DE6A 1O1HA 1XLFA 3DBNA 4XIMA 1DIDA 3VNKA 2HK0A 4HHMA 3XINA 3M0VA 1XLHA 2I56A 3KBJA 5C9ZA 3M0YA 3VYLA 5H6HA 3KBSA 3BZJA 4PGLA 3CQKA 4KW2A 3QC0A 1XIEA 5EMMA 3XISA 4OVXA 3KBMA 4XIAA 3QYSA 7XIMA 1XYCA 1XISA 2XINA 1DIEA 1QT1A 3QXBA 5B7ZA 4GLEA 1XIFA 2G0WA 3CQJA 5J8LA 6XIMA 4EAYA 1K77A 5B7YA 3VNMA
chains in the Genus database with same CATH superfamily
1IR2A 3AAMA 1W1ZA 1JAEA 2OO6A 3MZNA 2XIBA 4IGHA 1HKKA 3U5UA 2VFDA 3KVKA 1JZ4A 3OU8A 4O28A 1EUNA 5IFPA 1M3UA 4MHBA 1WO2A 3VIJA 2RGMA 1GKPA 4KWVA 4L5ZA 4EPKA 2FVKA 3REQA 2YCJA 3DC0A 4U10A 4LANA 4RXFA 2VX7A 1OBAA 3AXMA 4GFSA 3WUEA 4C6OA 3P0WA 2ZXAA 3KS6A 4U5IA 1UR9A 4HA1A 1QATA 1GWJA 1ODUA 1SFLA 2R24A 3WQCA 4QITA 5L6UA 3AOFA 4DLFA 2Q3RA 2UY3A 4WUIA 3NPUA 3BE7A 3CL7A 4GXPA 3C2EA 4KMQA 2Q09A 3WFZA 4UTKA 4GC3A 1EXPA 4XAZA 1GGOA 3GAYA 4NILA 3P8IA 1V8EA 5DT5A 3NUKA 2I14A 4R34A 3QH2A 4AIEA 1YXCA 1RLCL 2VCAA 4K38A 1XRTA 1WDRA 3W7EA 3USZA 2BWGA 1TJ0A 2R94A 3HG4A 2W4XA 1VLWA 1KXTA 2B0MA 1W6TA 1I2QA 1DBTA 1XC4A 3TSBA 1LBLA 3EWZA 1PEZA 5MKGB 1MRAA 1XYLA 2BHZA 3G1HA 5DRIA 1ISXA 1YLVA 2PGRA 3B9AA 3E2VA 2W79A 5REQA 2YR1A 4WVXA 1XIMA 1HQTA 2HE8A 2WVVB 1DP0A 2PBGA 3H2NA 3V3WA 1GQLA 3UZYA 3AQUA 4YIWA 1SO4A 1EF2A 1MDLA 4ZFCA 1K6WA 4B92A 4FPSA 2HVMA 2Q71A 4O4VA 3ZR5A 3W1XA 2X1SA 3H54A 1NM9A 1MRQA 5GJMA 4NRRA 1CGXA 4HB7A 3IVTA 4HTBA 3H70A 2AOSA 2NXIA 3M44A 1H1NA 1XLAA 2FB3A 3GTFA 1IXPA 4AD3A 3P0XA 1W3TA 1XIIA 3EWUA 3TC6A 4EANA 4WKAA 2ZA1A 3I7SA 4S3EA 5CZKA 1XDJA 1S5MA 1RK6A 5JUVA 1R2TA 1XYZA 1C9DA 1F4AA 3DKJA 3MUAA 3VIMA 1V79A 2FZNA 4HZ6A 1LM1A 3TJXA 4UR8A 2D2OA 4J5NA 3B9NA 2WMHA 1B90A 4JKKA 3BMXA 3G22A 1GOOA 2VQUA 4Q33A 3R94A 3VIOA 3V35A 5CLTA 4ZVJA 1W1A1 2RDWA 3OOQA 3NSNA 1BVWA 5DY2A 1YE6A 3AIBA 1B3WA 3HN3A 3UEQA 3MU7A 2RDTA 4PMDA 4TV6A 4FIRA 4JYDA 1EJVC 3FJLA 3W25A 4XD5A 2PGFA 3L66A 2GYIA 2E25A 4J35A 1G4TA 3WKZA 4WZHA 2ZBTA 1LLWA 3MO7A 4LAUA 2WMKA 1VZWA 4M1BA 1S2UA 2PTDA 3RUBL 1FBAA 1KNWA 4LGXA 3FW6A 1YNYA 1BYAA 4DWSC 4FI4A 4XZ9A 3ZYZA 1E4NA 4KIEA 4PCPA 3LU2A 2W5FA 1W1YA 3BSMA 3SCPA 1F76A 1E56A 5C2GA 2AQVA 2C18A 2QV4A 1TZZA 1AJ0A 3GE7A 3AXXA 2WSRA 5HUPA 1RJQA 1HGWA 3VD7A 3VD4A 3MUXA 4RW3A 6TIMA 5EA9A 1RPXA 2AGKA 4C1LA 1GG0A 4UTWA 3HO8A 1H7RA 2RAGA 5BROA 4CCEA 1WKEA 1FCVA 5CC5A 1VEPA 2WMGA 2FVMA 3STCA 3WLSA 1D3HA 1UASA 1X8FA 4AVOA 4MM1A 2WBKA 3EB2A 4WR3A 3K30A 2XPKA 2QJJA 1OFPA 4ERGA 2XHYA 1UUMA 1E73M 1ICPA 1TPFA 4H1ZA 2W91A 2I5IA 3U2CA 2DZAA 4HVXA 4LAKA 2NLIA 7REQA 1UKPA 3E0FA 2ZKMX 1WXZA 1MXDA 3ZMRA 1F8MA 4OV4A 5FSEC 4OU1A 3V1HA 1H4PA 2QR6A 1R3RA 4GG9A 4ICMA 3W1MA 3BAIA 2GJNA 3NOEA 3RHGA 2AL2B 3UPWA 3PZTA 1TV3A 1Z7AA 3M7SA 3NZRA 4JFTA 5DEZA 3V75A 1MQPA 4S3KA 3TJLA 2VC7A 2OOGA 3LPGA 4KQNA 2E28A 4A2SA 4M5PA 1KV5A 4KEUA 3OGRA 1PZ2A 3CHDA 3VA8A 1YNPA 3N2MA 1JDCA 1PCKA 3EX2A 5J5RA 1SGJA 1OADA 2R6OA 3WQDA 1TSIA 2ACQA 3PZMA 1EQPA 3H2MA 4CVUA 4LYKA 3OO2A 2ANUA 2Z00A 2EKGA 4I3GA 1W37A 2XVNA 5CSSA 4H7ZA 3DHPA 2D2HA 3WX7A 1JZ2A 4UFLA 1NELA 4L6HA 1ZRQA 1Q8AA 1BVZA 1TV8A 1SZEA 3AS1A 4JD4A 2FKPA 3POHA 4QJ3B 5LXEA 2XG9A 4O1AA 5A94A 3WMSA 1FWFC 1E9YB 2NUXA 2WSQA 3GU1A 1IV8A 5A69A 5DX7A 4AX6A 1ZY9A 1TUFA 4WDWA 1SW0A 3OIHA 3P61A 2G95A 3W7JA 3VKBA 4GVFA 2VNCA 3LZ3A 3WJYA 2OLHA 1BGAA 2O9TA 4GWEA 1XINA 3PP7A 2IW0A 3PJXA 2ISWA 5F4SA 2X1TA 3TN3A 2OOFA 4GHRA 3O0KA 3B0UX 3UXKA 1C8VA 1TTPA 3E74A 3TOYA 3W26A 4CD4A 5BOEA 5HMFA 2OT0A 3G1AA 1J2BA 1AZ1A 5T26A 4BQ5A 1DQUA 5BW6A 3LXAA 3B0PA 3KWXA 2Y8KA 3DXIA 6CGTA 3BV4A 1YXYA 1RA0A 2FVLA 3B8SA 3K2GA 3MTWA 1V08A 2ZUUA 1KXHA 2EO7A 4GC4A 4D6DA 2BFGA 3DZ1A 4HSHA 1E9ZB 2XN1A 4PSPA 3MKKA 4ZSUA 4XQ6A 1MXSA 4WKFA 5FOOA 1HW6A 2G3FA 3GG0A 2NUWA 2YL9A 2CWXA 5FF3A 5EGRA 3VGBA 5F4XA 1VFSA 2GVGA 1MW1A 1M68A 1E6RA 4DJFC 4A4AA 2PCEA 3EAUA 1DV7A 1YBQB 5C7HA 4IZGA 4UIOA 2V5CA 3AIWA 5LKYA 2PLMA 5K4XA 4PRTA 3K8LA 4AMAA 3TAOA 1MI3A 3A4WA 4RDWA 3VU2A 4FR6A 1XCFA 3T55A 3THCA 3RN6A 2XZ9A 5AECA 4PR4A 4ROQA 4MYAA 3N29A 3WK1A 4DVOA 1LJYA 1F6PA 4RV8A 1A50A 1YE4A 3VUSA 3R0KA 2J74A 3QW3A 1TZ9A 3P60A 3DESA 2Z24A 3F2BA 4RLIA 2GL5A 2FGBA 1KB3A 2D0GA 4KEVA 4QR6A 2DUZA 2Z1KA 1EWDA 2CBUA 1TJ2A 2ZDSA 5CCZA 3AXIA 1EHAA 1RBLA 4Z08A 5LHFA 3VGGA 4BKNA 3O2LA 1R5YA 2NQHA 2ESCA 1XYAA 4MKSA 3S8HA 2XJ7A 1MQRA 3A64A 3KRSA 2G8ZA 3VO0A 5LIXX 3BAXA 3KHDA 3LV5A 1UWQA 3VMOA 3PM6A 1PAMA 2VFFA 3JZUA 4AYSA 1SJCA 1SQ7A 3P2VA 3A12A 4Z1AA 1PIGA 2ZC8A 4PCSA 4UQCA 4Y7EA 4KBXA 2CETA 1I8JA 2WJZA 4F40A 1OGBA 1ME8A 1ME7A 1BSIA 1CB2A 3PBYA 1WQ5A 4QDPA 4U28A 4OECA 2ZWZA 3FJ4A 1AJZA 3RU6A 3RIKA 1V6VA 1OJXA 1H50A 1FHUA 4DO5A 5I7GA 3A3WA 1UD3A 2VUNA 2QEZA 1Y5VA 3RPTA 5CZJA 1S3TC 5FJRA 5AYZA 3NZPA 4BHYA 2XH4A 2E1WA 3H7RA 1HKWA 3N9KA 1L2QA 1MUCA 5D02A 1JAKA 5E6ZA 2CIPA 3NQ2A 4IX2A 4K3ZA 3MWCA 4PUUA 3DH7A 3GFZA 3WJWA 4AHQA 3HPSA 2XVGA 4O18A 4ZQNA 1NY1A 1SJBA 3W1NA 1FWSA 3A24A 1GOIA 2QHAA 3UZWA 5DF0A 4AB4A 3TC3A 1AJ2A 5LA1A 1YMYA 1SPQA 2OXNA 4PTXA 5G4EA 3QOKA 1HT6A 1S1PA 3GKAA 1CI1A 2W66A 2J7EA 1V3MA 4OE7A 4FXRA 2GSEA 4JPGA 3CC1A 3GTIA 4N2YA 1GVQA 4G7EB 4G1KA 4GCAA 3VCCA 2EHHA 1XH2A 2O7SA 3GH4A 1QHPA 1NEYA 4IP7A 3IJDA 2OSXA 5CLWA 3TU9A 4B5VA 3EDDA 2OZ8A 1ZALA 3WH9A 1YPXA 3UWYA 1GVOA 2H90A 3N12A 3R8HA 4AX7A 1BFNA 1M53A 3M43A 3SCVA 4QAWA 2OPJA 2ABBA 7PTDA 3FYOA 4W7VA 4DJDD 1J79A 2QVNA 1VIZA 2Y63A 4JYFA 9XIAA 1UPPA 2GSHA 4DM1A 5BCAA 5FESA 1FHLA 3TR2A 4W8AA 3G0SA 1ITUA 4D8ZA 1BG4A 1VCFA 4ZOCA 2DU2A 3UR2A 2QCDA 1BHGA 2VFGA 4L6OA 1C8XA 1R3SA 2ZE3A 3R89A 3WNNA 1V77A 5C6MA 3A21A 3BLDA 3WDPP 5CGQA 4PUWA 3RM9A 4HTYA 3L23A 2YL8A 1DWJM 3DHDA 1EP3A 1W9PA 1OFAA 2BY1A 4HHMA 1K7EA 5JIPA 4KW2A 3XISA 1RY8A 3FK4A 3KBMA 1KBBA 3EMZA 5CQ1A 3MPGA 3WK0A 5I03A 3H4GA 1WA3A 4J3SA 2VZUA 3P84A 2PDKA 1KGWA 2XISA 2CERA 2PDQA 5EPDA 3WUFA 3TUUA 4RL3A 1BWVA 2WNNA 3WQVA 3NPWA 1HKJA 5LIKX 1E40A 2IKGA 3UT0A 1HL2A 2DT3A 4X22A 3PFMA 1F3XA 1DJHA 2A3HA 2PTZA 4PCTA 3DN5A 2ZQ0A 3WIJA 1IWAA 5CPSA 2GVEA 1LT8A 1N8FA 1QHZA 5I2UA 2FH6A 3WNOA 4DO6A 5E09A 2GQAA 2V2CA 4DZHA 4NNAA 1LL6A 5A5WA 1NJJA 2JKPA 4K8HA 4K1WA 2YW3A 1N8IA 3R8GA 3CV1A 3TW7A 1CW2A 1ZJIA 3VNLA 2E67A 1DQWA 3TYUA 2V68A 5DBUA 5I3FA 3I7RA 1JR1A 4X60A 2VVSA 1WXJA 3AS0A 4D1JA 2QXWA 4MFDA 4LY8A 4AUBA 1QPQA 2QMKA 1QO5A 3QV6A 2Z4GA 1TE6A 2C19A 3FV9A 1KKOA 3HGOA 3B97A 3KRZA 2ISSA 3EOSA 2Y7EA 2WM1A 2AQWA 1B3OA 1HKMA 4F0MA 3IV8A 4N4PA 2P50A 2FFCA 2BY2A 1X6LA 2W6RA 3OA5A 3C2YA 4AAJA 2FPTA 4DO7A 4YL2A 4Y8EA 5I3HA 3KLKA 3MUZ1 5CJNA 3SGGA 4XG1A 1XIFA 2G0WA 2XGIA 2BY3A 1HGYA 3ZO9A 2GWNA 9RUBA 5TNVA 2WMIB 3NYDA 1REQA 1Q5MA 1U1HA 3ABOA 4H2CA 4Q4PA 4DYEA 1JCLA 4L9ZA 4IFOA 2LLEA 4JTFA 3CYVA 5LIUX 4O4WA 5XIAA 3MP3A 3WNKA 3LV6A 4JIPA 4QG6A 1QMLA 5FF4A 3AMGA 2E7FA 4LY4A 3WBXA 2OX1A 1H51A 5G1TA 3PBWA 5GJPA 1OK6A 2A85A 4OJYA 4IIFA 1C8YA 3IVSA 3NDOA 5DCDA 1JCMP 3M0IA 4GUFA 2J62A 4XUYA 1PTAA 3AUOA 3OHIA 3SDOA 5A2CA 5C7VA 2P0OA 5F1VA 1HP4A 4Q4OA 3UXAA 4LRTA 5K4ZA 4WEVX 2GGGA 4XZIA 2NQLA 4NAEB 4XZLX 3SRFA 2QGHA 1M03A 1XKJA 2PF0A 3FJ6A 3R6IA 3EB4A 2IKJA 4DZ5A 4BS0A 3ZVIA 3O6YX 3MHGA 2VGBA 3CUJA 1ONXA 3V0UA 4QJ1A 1YRRA 1NARA 1HJVA 1FFRA 5E0CA 4GLEA 3NURA 2DSVA 1UJQA 4AIOA 3U0HA 1SM9A 1SO6A 3MUIA 3V7PA 3LM7A 1GQIA 3WUBA 3W7DA 3R43A 4CQBA 2WNZA 1A0DA 2IKIA 1RSCA 2E9BA 3LUTA 3DFNA 5M03A 3DUGA 3ZR4A 2B4GA 3EEZA 1J6OA 1LRQA 4Q8UA 1M7OA 4XD4A 2GZXA 1QOPA 2E6YA 3W7PA 1OFEA 3UWUA 3MBDA 3TYBA 2G97A 2HTMA 1EJTC 1VKFA 3F03K 3WFAA 3OLEA 2BDQA 2YA2A 3QGVA 4I6VA 4A22A 1QUMA 3UESA 4DXXA 4CKQA 2VX4A 4C6KA 4LYPA 1V4YA 5HMSA 1LORA 3B8WA 4DF2A 3ABSA 3E2SA 3BZGA 4ZL1A 1ZBKA 3WL1A 1S39A 3WQ5A 1CENA 4PMXA 1KWKA 1W9BM 1C90A 1Q7ZA 2F2HA 2X8RA 3HPXA 3AMKA 3NZGA 5D2TA 1NIUA 2CLLA 3QLLA 1P6BA 3CUIA 4AQLA 5KITA 1WB0A 1L0PA 4WSHA 2QQ6A 3NO5A 1ZENA 1S2VA 5ECUA 4QAIA 2ZRZA 9CGTA 2WHKA 1QR7A 1NDYA 4QJ5B 5HR7A 4CD7A 1XM3A 1VJIA 5ABHA 3JS3A 4IGNA 3L21A 4IPIA 3UZ5A 4YWIA 1M5WA 4LS0A 1V03A 5LYRA 1AH0A 1B3YA 4HNLA 1E4LA 3GTNA 3MQTA 4LV9A 4JKLA 2INFA 1FP9A 3ZSTA 1VPYA 1A5NC 3LB0A 2QPXA 1MW2A 3W7NA 3SGUA 2W62A 3F4CA 4H9ZA 4QRNA 3UVAA 3EX6A 1D9EA 2YYUA 4PCNA 1F6YA 2FIQA 3IUIA 2R14A 1E4MM 3O05A 3K5XA 4V15A 1WDSA 3RR4A 4HSNA 2GJXB 1OABA 3DC8A 3VM5A 4YXGA 5EBUA 1XPGA 2D69A 3PUGA 3ME3A 1WDDA 4FXJA 3U6WA 3T7VA 3T0DA 1F07A 1KRBC 3NDYA 3BW3A 3O6CA 3N11A 1J0KA 3WDIA 1QXLA 2WM0A 3KVMA 3KOWA 1LROA 1W56A 3H53A 2IQTA 4PUDA 1B3ZA 2VQTA 2ZX7A 2HNEA 3RJXA 1US3A 5CPNA 3OGVA 5JQ9A 1X6NA 2R1PA 4DZAA 1SYTA 1S2AA 1H61A 2VHLA 1R3WA 3T8LA 1D7FA 1P1MA 1UD5A 4HIBA 3NG3A 3MYOA 2NSOA 4TVUA 3VOIA 3QJAA 4MPQA 2F6UA 4C6LA 2WMJA 3CZGA 4ML4A 1DKWA 1EF3A 3OEXA 4E2VA 3UGRA 1GVYA 4BQ2A 3FEMA 3WK3A 3P81A 4J28A 1FFQA 1OCQA 1W1TA 3NA8A 1P7TB 5CPLA 1IGSA 2V5BA 1ONRA 4OWGA 4N7QA 1C92A 1F7BA 2WSYA 3K4DA 5DMLA 3NEVA 2VEGA 3L4UA 3BLEA 4Q8TA 1EJ7L 3NL2A 1JCTA 1ICSA 1Q65A 3AYSA 3BICA 1H0GA 1YDNA 1TJPA 4J1OA 3AYVA 1TA3B 5LSMA 3SUSA 2GOKA 3F4VA 4PULA 2DSZA 4NI3A 3SGZA 1RVKA 2REQA 4YS1A 4JNZA 5LIWX 3K4WA 4C90A 4Q8NA 4Z2IA 3NPVA 2V0TA 3W73A 5AC8A 3PK7A 4I5UA 3SUVA 5D38A 4IJRA 4YHEA 4HKPA 2V6AA 4HP5A 3ZJ6A 5K7JA 2OGJA 4QJ4B 1QPRA 3KTSA 1O5QA 1OFBA 4CCCA 4F2TA 5BMWA 2D73A 3P8JA 2CCRA 4B5SA 1LBMA 1ECEA 4ZQCA 3W82A 2EPNA 3DI1A 2BOEX 3EOUA 5A2BA 4IMAA 3B8TA 4LUSA 4P7LA 1DWIM 1GORA 4XAYA 2DEPA 3GIYA 1G7UA 4P8UA 3I6TA 4WCJA 4DLMA 3W1RA 3B40A 4FP1A 5XIMA 5M17A 4NJIA 1QASA 4X2PA 1VFFA 4HZ8A 4DUVA 2PDIA 3P82A 2NXHA 4Q4SA 4MNMA 4I9TA 5DCBA 1K03A 3W76A 1TVLA 5HQLA 3F4DA 1KCKA 1Y5XA 1IT7A 4GCXA 4TTUA 3WG6A 1DWAM 1JDFA 1ZBWA 1SR9A 4ZO7A 4GVGA 3HQPA 3SUTA 2MUCA 3RRXA 1UH3A 3OTRA 3O6AA 1DWHM 1AW5A 1KRAC 4HGXA 4IL0A 5KZ6A 5EMJA 4D8LA 2SFPA 1K3UA 4EPBC 4QS5A 4PBFA 3IRSA 2I57A 2PWGA 4IOTA 2WW5A 4KWWA 2I7GA 5C70A 4GGBA 3NM1A 4M29A 2JALA 3R8RA 3DYPA 1X1OA 1UCWA 4C60A 3VNDA 2UZ9A 1PXGA 2NX3A 3S4TA 1VHNA 4L4LA 4LBSA 1AH3A 4QDWA 2HROA 2JQXA 4G56A 1KFCA 4Q7BA 2OZ0A 3IIZA 4S3JA 4U2ZA 4L1WA 4OVXA 2QJNA 4E5TA 4LVGA 3PG9A 2WCSA 4GYPC 1Y0EA 4ADSA 1K9EA 1A5BA 4LOCA 2BODX 4WJEA 3T09A 1ZTVA 4F0LA 4OFCA 3LCFA 3TVAA 2VR4A 4HN4A 4I9JA 4NX0A 2XSBA 4GX8A 2A2IA 1J8VA 4F0KA 5IXEA 3B3DA 1S5WA 1RPKA 4IMGA 2P3EA 3AXHA 3LQGA 3H4WA 3NQFA 3WH8A 1XYBA 1W9UA 1K7FA 3KVLA 1EDGA 1GYNA 1IIHA 2VEFA 3GC2A 2XU2A 4QDMA 1DJQA 4JDBA 2IQ0A 4Z2JA 1JQXA 5A6KA 4QQ3A 1Q4NX 1YHTA 1TRDA 1E71M 4MB3A 3V1PA 3ANUA 4R88A 3UR5A 3FLUA 1FDZA 2CZVA 4JX5A 2XFWA 1ZGDA 4FIQA 1PHWA 3EA2A 2YX0A 1KV8A 4XB3A 1VRXA 3R11A 1YBQA 2BNJA 3IUDA 1BPLB 1CZ1A 3FAXA 3KHJA 3S2JA 5FEWA 1OYBA 3H12A 4IGMA 2V30A 1UZHA 1FH7A 2VUYA 1SO5A 1ECQA 5CZ0A 3QHOA 1OFQA 1NWTA 3G1SA 1J4EA 2DY3A 1BEUA 1E0WA 2ZXBA 4H9YA 4PTWA 5DY3A 4M6QA 2V5JA 3O15A 4LVBA 4HA0A 4BI7A 2RHGA 3WMBA 1E1CB 2ACSA 3CTTA 3TW9A 3H26A 2QCGA 1CXIA 1THFD 5HAOA 3BUVA 5IBXC 2Y61A 1V0MA 1RQEA 1TPUA 3IVUA 2ZDRA 4NAFB 1E9LA 3L12A 3SB0A 4D8AA 1UH2A 3FGCB 3I4KA 3C6CA 2XUCA 3BSGA 3IGXA 4QG9A 1CNVA 2PC8A 5DRCA 3WLNA 1J18A 2QGYA 3T0TA 1V6WA 2OWXA 3AIQA 4IUOA 3S42A 2PUZA 2VRQA 3I3DA 1KC7A 1JNDA 4A8RA 2CW6A 1OX4A 1XLJA 1IT8A 4U31A 4JL1A 3QRHA 3DOPA 1XBXA 1ML1A 3N17A 1YTEA 2OO0A 1KBJA 1PWLA 2VGFA 3MMDA 3ISIX 3LTPA 4YTRA 1A5LC 3EDEA 4GY7A 1JPMA 2C1GA 3WL0A 3VABA 1A5UA 2I9UA 4HT3A 4OV9A 3LPPA 3BQ5A 3GHSA 2YA1A 3RM8A 1V3HA 3WZ0E 4Z2KA 1P4CA 2OYLA 4G8TA 1BG9A 1EO5A 5B7YA 1MWOA 4UQBA 5HNTA 4GQRA 3R1ZA 4LAOA 4UFMA 1A5CA 1JRBA 2TODA 3KZPA 4K7VA 1FH8A 3ARTA 3JU2A 4YN5A 3FEQA 4JTGA 1GQKA 1NDVA 1XRFA 1ZJAA 2FQIA 1SFSA 1HJQA 4FLOA 2ZTKA 5G1MA 4JX6A 5C5YA 3NQAA 1KR0A 4AZCB 3PNZA 1RCXB 1X1NA 2PE4A 4LV4A 3CU2A 4HHPA 1TPVA 3B05A 4ACZA 1F3EA 3BOFA 4I5RA 2A3AA 5A8OA 2Z1WA 1KTNA 3KWSA 1OIMA 5LGXA 4ZQOA 2VOTA 4HCLA 3B9DA 4QM1A 5J04A 1UWSA 2PDXA 3NZ1A 4IH3A 5CPMA 1ISYA 2A3CA 1U33A 1RLDA 2VD8A 3NGFA 2GDVA 2VRKA 3VNYA 3UU0A 3IIXA 1MMFA 3KFTA 4JY8A 5FIPA 1TJRA 3MCMA 1W2PA 2VDHA 1HZYA 1R8LA 2G3MA 3RJYA 2PDJA 1O5XA 1W5QA 1XLIA 3FNDA 4EIVA 4L9YA 3PSWA 2QCMA 1DJWA 1EFZA 1HIZA 2DZTA 3HPZA 2DV0A 1IZKA 3G18A 5B7ZA 3CQJA 3V5FA 2C71A 2R8WA 3EKGA 3GVRA 4IISA 5IDIA 1XH0A 2QJMA 3S2NA 3PWGA 4WD0A 3CASA 4I8YA 3W7LA 2X0SA 4WIWA 1IXOA 3MMUA 3ZOAA 5BRQA 2VZOA 2GUBA 4JX4A 5TF0A 2X1IA 2Y7DA 4J3UA 4C91A 2CHRA 4M0XA 1EPXA 5IOBA 3QV8A 1EGMA 3N2TA 3NNTA 3UD6A 3QTGA 2DIKA 1XR2A 2BVTA 3CL8A 3EPOA 3REQB 2Z28A 2PDMA 5A6JA 4C6MA 2XH7A 5DFAA 3WK2A 1HX0A 3QMTA 3TNBA 4HNUA 2G50A 2ACRA 4ZBCA 1OGSA 2CXGA 3NOYA 5I00A 4QBXA 2YCKX 1E6XM 4K2SA 4FXFA 4WGHA 1E0VA 8XIMA 5DMNA 3VZYA 3N6HA 2C0AA 4R7JA 1B9BA 5G2WA 3PNUA 3UQNA 4W4QA 3L7RA 3C2VA 3AISA 4FNSA 3PPHA 1JL8A 5JBEA 1UC4A 3RGTA 4PMJA 3M0YA 3M0KA 3MT1A 3WDQA 2D24A 3TYZA 4RE4A 5FEZA 4IWWA 5C8BB 3O63A 3Q65A 4OQVA 4QCFA 3N2BA 1FWHC 3ES7A 3LCLA 5HNNA 1V02A 2ZRYA 1YDYA 3T78A 3U8GA 5JH1A 3LHYA 1ZFJA 1D8CA 4AD1A 1E15A 1XIHA 1ZSXA 1OG6A 1FKWA 3ZVHA 3G0XA 1J5TA 1SSDA 3AWNA 1HF6A 4LH8A 4UNKA 2B81A 4UTLA 1QI3A 1EYWA 3SQSA 5TQLA 3OLGA 1X1ZA 1CECA 1I2PA 3GXTA 4DIAA 2YB4A 1OC5A 2ZUMA 4JN7A 2J8GA 1EQCA 4PL1A 2VCBA 4UMAA 3CH0A 4NJKA 1AQ0A 3FYYA 5HUOA 3G1YA 1XF0A 3GXPA 3BAYA 2GPTA 3UWWA 4DWDA 1OCNA 2FZ8A 4HNVA 3MSDA 4IP5A 2P8BA 3W3OA 1PYFA 3VX0A 2Z6JA 2OLSA 1V5XA 1O6IA 3PF3A 1M7PA 1HP5A 4EE9A 1POJA 2HK1A 3L2LA 2NVCA 4BQ3A 1JCJA 4HCDA 3UVIA 1DJIA 2WOQA 3L4WA 1XUUA 4KCTA 4IIDA 5CEWA 1VIWA 2PFHA 3ARQA 1WBHA 2R1KA 3H2EA 4O1CA 2V2DA 2J75A 2I17A 1NSJA 4EAMA 1L6YA 3C5QA 1TB3A 3PB2A 3UXLA 5LXXA 3EOOA 1W3NA 4WF7A 2OEKA 3W02A 4EVZA 3QEZA 4GZ7A 3P5ZA 3FA3A 3N9SA 4E4PA 1UBSA 2B31A 4B5NA 2HEJA 2E5CA 4NNBA 4H9UA 2NQ5A 3VD3A 1X7IA 4JFSA 2QCEA 2PEVA 1TWZA 5A6AA 1Q2SA 3TSDA 3G1FA 3ALGA 3CAKA 4PMNA 1YDVA 3B8UA 4MUZA 2QDGA 4PB5A 2ZUVA 4CU8A 4RX0A 1YXDA 1WP6A 4HZ7A 2GQ3A 3S9IA 1SZNA 3ZFHA 4EPDC 5A6BD 4ROPA 4KCVA 4O11A 5LZLA 2Z1BA 4IXXA 1H41A 3A47A 3MJMA 5CAHA 1KTBA 1ISWA 3T0CA 1LWJA 2Y24A 1VLIA 5TAOA 1O12A 3VI2A 4LALA 3HOJA 3RLUA 2XIMA 1YTKA 3WD2A 3PBUA 2BSLA 2Y5JA 1AD4A 1RBAA 3CUXA 4Q3MA 1HUVA 2VELA 3TN4A 5GPRA 3WD0A 4JQAA 1I2RA 2PD9A 2QYGA 3MVTA 2I5QA 3OZYA 2W9MA 2FTPA 3LSCA 3NM3A 1M1BA 3DG6A 4A05A 3O07A 3LTSA 3CMFA 4CEUC 4QS6A 4LEQA 3TMLA 1EHNA 3B4UA 1JEZA 2WQDA 1R46A 1SZRA 2PDWA 5AHMA 1DIOA 3JR2A 3HF3A 3GC5A 3QV7A 4HNCA 4AWEA 4HBKA 3WNPA 4Y9MA 3HBLA 2QPSA 1WAWA 1VPXA 4PMUA 1RQBA 2QUVA 3UZXA 4WKHA 2XDFA 1TPDA 3QHMA 1Q6EA 2CU0A 5GNZA 3B04A 1E43A 3BGGA 3KEHA 7REQB 4E3TA 1WDQA 3MYPA 2NXGA 1OFOA 4XZHA 3OW1A 1PE1A 3VGEA 3TZNA 4BK9A 4KGLA 3VOCA 3LI1A 1T5AA 5ABEA 3QPYA 4MWAC 1QHOA 3KX6A 1J0JA 1EZ2A 1C8QA 4L9XA 2R91A 5HPOA 4O8RA 1JZ5A 3EB3A 4TVCA 2CPUA 1R87A 4NY2A 4UBPC 3OQ8A 5BU6A 3WQPA 4NJJA 1J0ZA 3PZVA 1UR2A 5HPCA 3VD9A 3BLKA 3KDNA 2YSWA 1UBPC 4DB7A 2ATMA 4DI8A 5GQBA 3QSRA 1F61A 3S2LA 3N4FA 1BTMA 2YOCA 1B54A 3I7QA 5E9AA 3CHCA 3AIRA 2WKLA 1V0NA 1IIGA 1WZKA 1KFEA 3IIVA 3VD5A 1JCYA 2OQLA 4B3ZA 4Z1YA 4FX8A 2G3IA 4CNTA 3HG3A 1VBGA 2JF6A 3HMCA 1OIFA 4JS3A 3KL3A 5MHBA 4BEUA 3N15A 2JEQA 2W27A 3EOLA 5BYWA 3M0LA 5EYWA 4RNHA 3T9PA 2NQJA 1T7LA 2J9XA 4X61A 2PDYA 4QCEA 1K8YA 4PSRA 4B5WA 2TYSA 4L4OA 4QLLA 3L4ZA 3CL6A 3WF3A 3AICA 5BU9A 3THDA 4Y90A 3RCMA 3CGTA 2E8YA 3M64A 5HMDA 4AU0A 1XX1A 4S1FA 4HU3A 3FAWA 3G1DA 2H9AA 1GVFA 4IPNB 3DERA 2CFFA 4D9PA 3MHFA 2ALDA 4NT0A 3T0AA 3E0VA 4OTKA 3AROA 2GSJA 3EKLA 2QF7A 1GPFA 3ARUA 4RW5A 3E38A 3DENA 2C16A 2ZADA 2J9ZA 3E2QA 2Z1VA 4H8HA 2XIJA 3U5YA 4NZCA 2V8ZA 3H7UA 2D0FA 2HJPA 3GYEA 4FF5A 4MZ8A 4MB1A 1G9HA 1J2WA 4ZQRA 4PL2A 3TQKA 4A3HA 2HE5A 4M19A 4ECLA 3N34A 1O7AA 3CT2A 2YCLA 3N3TA 1TA3A 3AIEA 5H2ZA 3QQWA 4V33A 4JHMA 5AY7A 4NG3A 1IQ8A 2CZFA 3W1AA 2NZLA 4AC7C 3G6MA 1NWUA 3CMGA 3PUOA 4IIBA 1KGXA 1TYGA 5F2IA 5FI8A 4GA8A 3W23A 2D0HA 5A3HA 4YNGA 4C6FA 3IANA 4LYRA 4UQAA 1OY0A 4RUBA 1V6UA 5BXTA 4TV5A 3WQ4A 5AFDA 3P80A 3LEPA 4NASA 1W8GA 3A6OA 2PTYA 3ZS4A 2CLHA 4D6GA 3GO2A 4DBEA 3WBYA 5A8MA 3U57A 1MUMA 3WUGA 2PZNA 2VXNA 2Y8VA 1KLZA 3THAA 3GUWA 3M5VA 2VYOA 3M5ZA 2F9RA 1SW7A 3MUY1 4J27A 2OQYA 5E93A 4LT9A 5DBTA 3EWBX 1QI4A 2WBGA 4I9AA 4POCA 1UR1A 3M41A 3O7UA 1UZ4A 1KCZA 1A5MC 3W27A 4AHPA 3NCOA 5BWAA 3HIJA 4C6QA 3VDBA 3E0WA 5DELA 1PKNA 2B7PA 3KBWA 4H9MA 3SECA 3GDKA 4P61A 2P53A 5CJMA 4FO4A 1FWTA 4H9XA 3KTXA 4KWSA 3IACA 4L56A 5G5IA 4PGLA 3L2IA 2FDMA 5EMMA 3ZXWA 1M65A 3W81A 4MAZA 1AL7A 3EKZA 1B3VA 1R7AA 2YCEA 5A8PA 2Z7GA 3E49A 4JFUA 2EPOA 3DFQA 1VCGA 1HVQA 3T2PA 2VD9A 4HN8A 3RX4A 3RK8A 2OB3A 2WZEA 2A3LA 3RAOA 4LW7A 2V9DA 5DLCA 3AJ7A 3VNIA 1FP8A 4PFHA 3ZJ7A 2TRSA 4P8VA 3N4EA 4A35A 3UYIA 2J4GA 3DEQA 4A3QA 3VPLA 1R2SA 4ZO8A 3TYEA 4IL2A 4FR1A 1O66A 2OKTA 2EKCA 1XBZA 2XVPA 4JTUA 5HJLA 3BW4A 1LG1A 1DHKA 7A3HA 3R12A 2OYKA 4XBKA 1GJWA 4RDYA 3AI0A 3R7MA 4C6DA 3M0ZA 5H1WA 4NUWA 4LFYA 4XX6A 3T05A 2PS2A 4NL1A 4JXCA 4M82A 1XRVA 2PDUA 1HJXA 2BVWA 3UETA 1OC7A 4IMEA 3TW6A 1YX1A 2X1RA 4F2BA 3NJ3A 1Q85A 5L9FA 1GOKA 2EJ1A 4Q6XA 3O16A 2ON3A 1KM6A 4H7VA 2OR2A 2F6XA 2C13A 3SEPA 3PN8A 1QO2A 3Q58A 3OVGA 1TKKA 2CLIA 3TFCA 2OT1A 1OYCA 1XLGA 4TMCA 3ALFA 4BJHA 2GQ9A 2HZGA 2JGQA 2NSXA 1DORA 2FMOA 3VKDA 3ITVA 4Z1BA 4RKAA 3MP5A 2ZZ7A 1W0MA 4ML9A 5FJOA 4I8DA 5CZSA 5F4WA 3TAKA 2G4FA 5HWMA 1RQHA 1FOBA 1M01A 2OYMA 3PZOA 4D72A 3EX4A 2J7BA 2NW0A 2F38A 1XPYA 2GK1B 1NTHA 3SY8A 1OC6A 1Q6OA 3CZLA 4JCMA 2YIHA 3T4CA 1VYSX 4AD5A 4GZEA 3WBEA 4L61A 4PMOA 4M24A 1ZP4A 3CUFA 1LRNA 4LXFA 4JDYA 5E9XA 2Z0IA 3P62A 3CBWA 2X16A 4XK2A 2QUMA 1EOKA 3AS3A 4UWMA 3PUDA 1ZJHA 3URBA 1OT2A 3KOXA 3IK4A 4QNWA 3TA9A 2YCIX 1XGZA 2YW4A 3BAWA 1XWYA 3ICJA 1O5KA 3GIPA 3F5KA 4US5A 1GTEA 3SJ3A 6A3HA 5CBIA 1EC7A 1EX5A 2QCDB 3S5OA 1XH1A 3QVQA 1RAKA 4HU8A 4UQDA 1UR3M 5HWJA 1C3FA 1GZGA 2PF8A 1LG2A 3OG3A 2VGGA 4DRSA 1P5BA 2I56A 4ZODA 4NAFA 2AQOA 1UQZA 3NSXA 4M81A 4RPPA 2J78A 2YDRA 3C2OA 1FDJA 3OGSA 4LPCA 1UA7A 3QR0A 1FVPA 5LHEA 3KRUA 1MFUA 3V4BA 4N9BA 1E6NA 4PB3A 3ONCA 3LTYA 4AF0A 1C29A 4OGZA 4P2VA 2D1ZA 1OT1A 2FZMA 1JYXA 4E2OA 5FJTA 5C0QA 1ISZA 3VMPA 4PCFA 3C56A 5CC7A 3STGA 2J79A 3TX9A 4LCQA 1GYLA 1CXFA 1L9WA 4PYSA 1KQYA 4AY8A 1B30A 3NEHA 1CXEA 1B2YA 3PULA 4DBSA 4MJMA 5AVHA 4OUIA 3AHTA 4GBUA 4DF1A 3W87A 4FAMA 3LBCA 1E0XA 4RE0A 1O4UA 2VC9A 2E6DA 1PX4A 3L68A 3PJWA 3ATYA 1FKXA 5H8PA 2GDQA 4DUXA 3I10A 1GOQA 1CLXA 2G96A 2WZIA 4GNKB 3KCLA 3NPXA 1JRCA 3CWHA 2QCNA 1UZDA 4ZENA 1YEYA 1QW8A 1R9XA 4UTTC 1XKYA 3KBJA 3E5BA 2PDGA 4AZCA 2CKRA 4DX3A 3WEZA 4B4FA 3W28A 2ZZ2A 3EA3A 1L2UA 1QJWA 5G2HA 4DWSB 4YTTA 3B03A 3W7GA 4L1XA 1UKQA 3BAKA 3TNOA 3BJSA 4B2DA 1XRSA 1BQGA 4R9OA 3ONBA 2X0HA 2VRJA 3HG5A 4K7YA 4UCGA 3QFWA 4U3CA 5T9BG 3U2EA 3UCCA 1CB7B 1BD0A 5BXPA 2J6VA 4ZFMA 2CLKA 2VR2A 3O0FA 3UA3A 3FY1A 1F3WA 4FB7A 3QQ0A 1W3HA 3VIGA 3CEUA 1W17A 3F1QA 4D6EA 5ENLA 3HZ3A 2E3ZA 1X7FA 4OKDA 4XVDA 4HMNA 4OIFA 5TIMA 1VGAA 2QAFA 1SSGA 3RMEA 1EJUC 1NDZA 3ZQ9A 2WK2A 2E9LA 1PBGA 3HFTA 4Q22A 4JBRA 1X38A 4ADUA 2IUZA 1ZU8A 4LF2A 1I1XA 4Q8QA 2CYGA 1O95A 1O60A 3GTHA 4FLQA 2PRHA 4S39A 4R27A 4FOUA 1A4MA 4NRSA 3V36A 5H8MA 4IGSA 1J01A 3VAVA 2I1OA 3W74A 5GNXA 1FWGC 4I9MA 2PP3A 4DJEC 3V18A 1XG4A 2Y0FA 1EEPA 1F9CA 2PPGA 3BG9A 5AC6A 2VEPA 1BKHA 3RDKA 3KOYA 1I45A 1HL8A 5JIWA 5C9UA 4CD8A 1NOUA 2R1LA 4JEJA 3UCDA 3M07A 3TH6A 3N4AA 4Z1CA 3KW3A 4Q7NA 2WQPA 4ALDA 5HA7A 2FB2A 1KM1A 1R2RA 3CUGA 3F4WA 1TR9A 3SR7A 4JQ2A 2QAPA 3C0JA 5BXSA 2DSKA 3FFSA 3C4UA 4NZ1A 2EEXA 4JHZA 3CUHA 4HNNA 4H00A 1TV2A 2C15A 1L6WA 3ARXA 2C14A 5CG7A 1EP1A 4AH7A 1L6SA 1GEQA 4MADA 1WYIA 1N7KA 1A0EA 1UUOA 3FN9A 4S3CA 2J7HA 2FTYA 4DUOA 2DT2A 3NQVA 5SWUA 3GG1A 3MHUA 4DNMA 4ICNA 3OHMB 2Y70A 1JVNA 3BOXA 3NQBA 4L4MA 4B5TA 1AUSL 4H83A 3GFYA 1XQLA 4GO8A 3E2RA 3WCZA 1JF6A 2PP0A 1EA0A 3A3XA 3HG2A 3OYZA 3LM3A 1NVMA 4RXGA 5FAGA 2HQAA 3IGHX 3COTA 1XD0A 1K7XA 4FS9A 4Z1DA 2G4JA 4RNFA 4TX9A 1VBRA 1JJKA 4EF8A 3UWQA 3T8QA 4X2RA 3MW7A 3CPRA 1RUSA 1UUQA 2HVOA 2WPGA 3CH9A 2QUTA 2RDXA 3EWYA 1TTJA 1C7SA 1K9DA 4H4IA 2DZXA 1M41A 3ZJKA 1EXBA 2ADAA 5KSWA 1JGMA 4MAVA 5AHIA 4FF7A 4O53A 1QBAA 3SCQA 3PWAA 1H5VA 3TROA 4QG8A 2IXUA 4NF7A 2A7RA 1QNVA 1U1JA 2XFRA 5CXPA 1Q6CA 4KFNA 4DYKA 1LF1A 4PFMA 4CNPA 3RX2A 4KRTA 2ZFAA 2OZ3A 1TE1A 4LNYA 3OBEA 5CGTA 2F8QA 5FF2A 3K1GA 5FA5A 4NZ3A 4DBUA 2OWWA 2FGLA 1TMHA 5D30A 4H6QA 3AMDA 4MNLA 2GLKA 7TIMA 5HINA 2INZA 3NO1A 1TWWA 4IG2B 3PVFA 4WDTA 4HPHA 1UJPA 4O0ZA 2GWGA 3AZRA 3NGJA 1B0IA 5C9ZA 3NWRA 1PWMA 1OVDA 1DHPA 1W3LA 2CESA 2WYSA 4YVPA 1XYCA 1ZAHA 3S9ZA 2J8FA 4LBUA 3VK5A 1IGWA 3VNMA 2J13A 3ABZA 1KFLA 3RNDA 1UIPA 2CLPA 3BV7A 3CIVA 1PKLA 2QDDA 2YXXA 1EPVA 1GUVA 4Y96A 2QDHA 4AZHA 1RHCA 4C7DA 2A0NA 4IMCA 1BTCA 1TPWA 3ENLA 4J4KA 5LNUA 3M6YA 1ZCCA 1QDSA 1VHCA 2F6KA 2WCAA 4FOKA 1I2NA 3IV3A 1WZAA 1TUXA 3VZZA 6XIAA 3VM7A 1J5SA 4BA0A 2D2JA 3LCHA 3QGAC 1MSSA 1EO7A 2ZX5A 4ACYA 2MANA 5H91A 3STEA 2A7PA 3O6DA 2CWNA 4RNIA 3PY2A 4C6JA 5FL0A 5AHFA 1XXXA 2REQB 5IDZA 2DZPA 1QI5A 4C6BA 1QPOA 4W93A 5D9PA 4S3AA 1S46A 1BRLB 1UKTA 4ZEPA 3CNYA 2PDHA 4PUMA 5LA2A 3AMCA 3H6OA 2DQXA 1OGGA 4Y9OA 4BF5A 1CGWA 2DSUA 4UB9A 4RDZA 1XLKA 3F5LA 1N82A 4FNTA 1GW1A 2DJLA 1JNEA 2Z2UA 3M0VA 4PUJA 4UFIA 3NQ8A 4A3YA 4JIHA 2WHMA 2PDBA 2OELA 1EX1A 2XINA 3T44A 3QY7A 1ALDA 3PWIA 2ZWYA 4W5UA 1KM4A 4IXHA 5A8GA 4ATWA 3BOLA 4AYGA 1EA9C 2JIWA 3MMWA 4F79A 4LUSB 3GNPA 5AB3A 3PSVA 2PDNA 4HZMA 4N0RA 2XIOA 5DXXA 3UPBA 3W6LA 1E3ZA 1UR8A 3N13A 4QSFA 3VNZA 3SQLA 1R0MA 4MLRA 3QZEA 1QPNA 3EDKA 5CPTA 4L1GA 4O57A 2A6LA 2DZBA 3CB3A 1B3XA 1TJ1A 2GGHA 3DX5A 3QY6A 4J2PA 1SMAA 4XBJA 3BGAA 5T9CE 3CB8A 4H8NA 3IJ6A 3XIMA 1AA1B 3S47A 3BCFA 2PDLA 3L4TA 4IQDA 1OB0A 3FS2A 3PBVA 4NQ1A 2PLCA 1FXPA 3CHVA 3LLDA 3BPWA 3WFLA 1BYCA 5CZTA 2ACUA 3DFHA 1VQTA 2DH2A 1E9IA 3P7YA 4XD6A 1KKRA 6REQA 1W3KA 1YW1A 4H9TA 3GSMA 5U4NA 4MTVA 5D33A 4LX4A 4LQ1A 4ORMA 3BDKA 4Q6JA 4JTEA 3LNMA 1UR4A 1XLFA 1UMYA 1VR6A 3I3EA 2QNEA 5DANA 3QHNA 1CGTA 4L64A 1LQAA 4M51A 1TO3A 3GZAA 2XVKA 1VPQA 3F5JA 5EBAA 1AH4A 3LBOA 5DMMA 3GNXA 3ARZA 2HMCA 2PZ0A 1KRCC 1UP3A 2I5GA 1EC8A 5FJPA 4BWLA 3N1AA 4QEHA 3PS7A 6ALDA 1LL7A 1A80A 3RPDA 1XW8A 3R58A 2ZRWA 4QX4A 3WMCA 2ZICA 3MV01 3SURA 1JI1A 4P8WA 1UG6A 3FDKA 3OLDA 3M9YA 3CWNA 2JEPA 4CQ8A 4FLRA 4E3VA 4DPQA 3T81A 3WLHA 4PUEA 2ZUWA 3CEPA 2DFAA 3UXIA 3W6MA 1I2OA 3RO6A 3Q45A 1J9YA 5FKYA 3W2MA 1KGUA 3TN6A 1MQQA 2V69A 4TO8A 5M3WA 1PJ9A 2VVNA 3C3NA 4L6DA 3RYSA 3IJ8A 4J2MA 2D22A 1FQ0A 4AZBA 1KLYA 3V0TA 4KFOA 3N18A 3TSMA 4PN2A 4WDUA 3BCJA 2AMXA 2Q3OA 1UYQA 4QROA 3ATZA 5AN7A 4HK5A 5AYYA 1CWYA 2XIIA 4E6MA 4FNPA 2WKJA 3D46A 5CSUA 3T2OA 2YL6A 2O0TA 5EU9A 3BJFA 1EJWC 3N14A 4MB4A 1FWBC 4Y9PA 4HCHA 2Z27A 2OU4A 3N6QA 3BG5A 3P5YA 2VZSA 3GU9A 4UTHA 5K9XA 3MC5A 1BGGA 1VJSA 4NYYA 5M5DA 3ZWTA 3AWOA 2DZUA 2W67A 3HGRA 4IFRA 3DFTA 1IEWA 1LYXA 1XGDA 4JQ3A 2QCCA 5LNWA 4F0SA 1DEDA 1JF5A 3LGDA 2FTWA 3UCQA 4AD0A 2NWRA 3ARYA 1W9XA 3CO4A 1MFVA 3VIFA 4JN8A 2BXYA 3R25A 1UOKA 1RALA 4KEMA 1OX4B 2ASHA 3SAZA 2QKFA 3G3DA 4NP7A 2YL5A 3AO0A 4FEZA 4WJXA 4PBGA 2Y7FA 2BASA 3IUHA 1ZBVA 3SN4A 1GZJA 4PTDA 5HJYA 1E51A 1W1IE 1KTCA 1EJSC 1VBJA 4Y8FA 3VDHA 4LS2A 3S1VA 4GD0A 3A23A 1OQFA 4N6EA 1EIXA 1DIEA 4F48A 5G4WA 3DYMA 4M3PA 3B0XA 1ZUAX 1WUFA 1LOSA 3E5PA 3IIOA 5HWNA 1DJXA 4E0CA 1HO1A 2F84A 2V5LA 1GTHA 1OCBA 2DZVA 2TPSA 3TYDA 5DQPA 4GX9A 4MY9A 4HNTA 1P43A 2V5DA 2WHLA 2EPHA 1XBYA 5B80A 1IEVA 3GR7A 4P7NA 3VIPA 2ZA3A 1SJAA 1NOWA 1IHIA 1SW3A 3WF0A 1SUXA 3QY8A 4GNJA 3V16A 3EX3A 1QI2A 4Q8WA 2Z7KA 3OVRA 3RCYA 2BHUA 1ISVA 4ACZB 5IFTA 2XSAA 2RGLA 2POTA 2DIJA 3NL6A 3S9YA 4DJEA 3WQ8A 5BOFA 3MBFA 2F2KA 2JK2A 4IHCA 1OZMA 1QNSA 3D3FA 3LQLA 2WJFA 2PGWA 1MZRA 1XGEA 3M5YA 3LPOA 5U7SA 3DGRA 5KZEA 1A5OC 3L0GA 1MW3A 3NXLA 4AD2A 3DBNA 2R82A 2GUUA 3AZSA 1V02E 2PLKA 3V5CA 4DXKA 4ZOEA 2O55A 4NYUA 2GK1A 2FDSA 4HK6A 2DPEA 4BQ4A 5F2MA 2J27A 4GKTA 3LPFA 1H1YA 3LLXA 1NFPA 2UY2A 3NQ7A 3KE0A 1QFEA 3AHZA 3MZ2A 3WLJA 4FNQA 3LBMA 3SADA 4TVDA 2WSKA 5FSDC 2EXOA 1GHSA 5HBFA 4K36A 1GYMA 4JL2A 2XM1A 4AWUA 5XINA 1UIOA 3FA5A 3VOHA 1YDOA 4WY0A 5H8UA 4FZIA 1I6NA 1E5JA 1FTXA 1HJSA 3H2OA 1BLIA 4R3UA 4ZTXA 4EPEC 3WQEA 2WV8A 1RY0A 4W9TA 5A6BA 2OKOA 1JD9A 2AGTA 2E68A 4UR7A 4F0HA 4JZ5A 1EP2A 3E3HA 4FX6M 2GQ8A 3SUUA 2W3ZA 3GYCA 2FZDA 2CKSA 3UG5A 3IJ9A 3ARSA 2EBNA 3GHRA 4C6EA 1TCDA 1PYMA 1Q13A 3D6NA 4ZGYA 1S2CA 4JTKA 4DI9A 2QUNA 5CJ5A 1XFCA 1LT7A 3TOPA 2Z26A 2PI6A 1FWRA 2E40A 3GVVA 3DFYA 1LTDA 4GYJA 5LNSA 3FSUA 3HB9A 3ZR6A 1JGIA 4QISA 4ORIA 2ZZ6A 2QIWA 1V7AA 7TAAA 2V63A 4KCWA 4PMVA 1KBKA 1SMDA 1PZ1A 4HJFA 1WE5A 2C0HA 3GAKA 1AQFA 3WLKX 3PZGA 2NWSA 3R79A 2PRMA 3SSZA 3ZVHB 1H2JA 3WN6A 5JBDA 2CLMA 4TXEA 4DBDA 4JIIX 2IS7A 2GGEA 4YHGA 3RO8A 5C54A 1FHVA 4Q4KA 1MVYA 4BEQA 3B06A 3SRDA 2PTWA 1CEOA 5EKYA 3A9IA 3MCOA 3PANA 3OB8A 3W88A 4KIRA 2NV1A 1PCWA 3L0NA 4R33A 1NAL1 2Y5SA 3UY8A 3SIMA 2X7VA 2PU1A 4DAIA 3W7KA 2OG9A 4O54A 2JFEX 1QOXA 4DWSA 4ZO9A 3JW7A 1O5RA 4GQGA 1A4LA 1NQ6A 1K70A 1YKWA 2TAAA 2X1UA 1EOMA 3BC9A 3EDJA 3HM7A 5HJXA 1TR1A 5K9CA 1YTDA 5EL1A 2HXUA 1SZFA 4IJCA 2PWUA 4ZTYA 3B0YA 2C79A 2Y62A 1TG7A 3QLDA 1HXJA 3ITGA 4CN4A 4H01A 1B57A 3ID7A 1WKYA 3ARPA 2I9EA 1HKIA 2EPKX 4LC8A 4F3HA 5D8WA 2DW7A 2Y2WA 4MDOA 7XIMA 3W1QA 4QP0A 1QT1A 3LXBA 1C91A 1ZNNA 4EXAA 1L6FA 4Q32A 4GACA 4HPNA 4OT7A 1RR2A 5DCEA 3GW3A 1G67A 1RVGA 3A4JA 3WLLA 1G4PA 2IPFA 2OEJA 2BX7A 3EYPA 5AYXA 2WLZA 1PS9A 3C8NA 2ZRXA 2AL1A 1XDLA 3L5MA 3T4WA 1LUCB 1UWRA 1DWFM 5HNUA 4B15A 1DL3A 1NWRA 1R86A 1JYVA 3GW0A 4US5D 3W84A 2PLJA 2D23A 4LNCA 1JYNA 1DTNA 3KOZA 1JI2A 3UG3A 3A4AA 4XKMA 4ES4A 3WF4A 5A1AA 2D3LA 1K9FA 1Q66A 3FA4A 4QLJA 3OVQA 3YPIA 3OZPA 4RNJA 1MNSA 2QPUA 1XBVA 4AFYA 2FLIA 4J9JA 5KMYA 4GRSA 1HTIA 3S3GA 7ODCA 1JXJA 1XD1A 3W01A 4GIRA 4R7OA 1C7TA 2XIQA 3KL0A 4KWOA 3ITCA 3BG3A 3FHAA 3TC7A 4KERA 3IGSA 4TX8A 3KBSA 3GKFA 1HJWA 4W5ZA 1Z32X 4DPPA 5EFDA 3HV8A 4IF2A 3IJIA 5K9DA 5I0DA 2PA6A 4UQEA 5M1TA 1JUEA 4W7WA 5A6LA 1TQJA 2RH9A 3AYTA 3VIIA 1ONWA 4UFKA 1SJDA 2DQWA 1ICQA 3U9IA 3ITLA 1U5VA 1F4HA 3G0UA 4HA4A 1OYAA 4C6CA 4J3ZA 1UMLA 2HS6A 3OODA 5JMUA 1H49A 2YZ5A 2NT0A 1CGVA 2XH2A 3M1ZA 2INEA 4AW7A 1GOXA 4MB5A 4QNEA 3INPA 4GUGA 1XHGA 1KWGA 3SCUA 2JE8A 3O06A 2D20A 5CSYA 2XN0A 3J7HA 1FH9A 1JXKA 4TIMA 1IF2A 3M16A 2IQDA 4S23A 1AQMA 5EMYA 2IMRA 3IEBA 1J10A 1U1UA 3CMJA 5I78A 1VYPX 1K9TA 3K8KA 2VFIA 1N55A 2Y8UA 2YDAA 3GNRA 2WB5A 4M56A 1UKOA 4MNKA 2QULA 3AIVA 3G3MA 1GT8A 1S2TA 5AZ0A 1RA5A 1NFGA 4O8AA 1ELSA 2E6FA 2ZZ4A 1WZLA 1YNQA 2ZX9A 2J88A 3W7QA 4LCSA 1U5HA 1TREA 3AHXA 3MB9A 1VFHA 4B2DD 4K1GA 1VD6A 4ZOAA 3A3HA 1FWCC 3KCJA 1CPUA 1CLKA 1QNQA 1Q6RA 3UBPC 3PZ9A 4M7SA 5I07A 1I4NA 3QPEA 3AHYA 1NF7A 5CPQA 2ZZ1A 3LGGA 1Z69A 5E70A 1MDRA 3H2AA 4WLCA 4DM2A 3LY0A 2G37A 1AD1A 3L4XA 3WH7A 4S3GA 4HHLA 3IIPA 2F7FA 2H3DA 4PTVA 4B90A 1V3LA 4QEEA 3TYCA 1BF2A 2DGAA 2H6RA 4GI9A 3H2FA 3W1PA 1CDGA 3G5EA 4GMEA 2VJXA 2OWCA 4A8LA 4I7VA 4AZ5A 2X41A 4UR9A 4D6HA 3NVTA 4DJFA 3EGJA 2NQZA 3APGA 5EY5A 5EMKA 5I3JA 2FHCA 4J3XA 2C1HA 4B16A 2V3DA 1IWPA 3R10A 2W63A 4IG2A 2PWFA 2XH0A 2CHNA 3LRMA 1R38A 2NV2A 4WHBA 4ENLA 3LRKA 3EOEA 5JH2A 1ADSA 3PFRA 3WEOA 3PPFA 3Q37A 3QM3A 4LU0A 4WXYA 2H9AB 2ONEA 4CU7A 2PRLA 3W86A 3MSRA 1QK0A 4O10A 2WO5A 5AC7A 4MWAD 8TIMA 1YPIA 1J0YA 4PB4A 4M80A 3LSBA 4IFKA 1EC9A 1P0EA 4AHOA 3WQFA 4B9YA 1BQCA 5D4YA 1PDZA 1WNOA 3VKAA 1W9DM 4O19A 3VMNA 3Q94A 3F4NA 4GXWA 3II1A 1UQYA 4URIA 3PUEA 4HPXA 2NUYA 1M7XA 4ASTA 1RP8A 4L4PA 1RBOB 1VFOA 1FWNA 1QVBA 4MFEA 2BOFX 5J8LA 2ICSA 2CZEA 1T0OA 1OHLA 2YCLB 3MUCA 2YA0A 2GJPA 2GJLA 1KQZA 4CEXC 1KBLA 4KEZA 2PODA 2O56A 4FLSA 3S5ZA 1BRLA 1XIGA 2HBVA 3MI2A 4A3RA 3VC6A 4KT2A 4PUNA 3W71A 4HOWA 2J47A 2ISVA 2PWVA 2PWEA 1GEHA 4FSAA 4UTFA 4UUIA 3DHFA 5BOOA 2UV8G 6ENLA 2NLYA 1I9CB 4IPJA 2FHBA 4HNOA 4O1BA 2A1YA 3C8FA 5C9XA 4MVAA 4CNNA 2XM2A 4HOXA 4LEFA 2ZVRA 4JTLA 3C86A 5E6YA 1ADDA 2X2YA 2ABAA 3SCOA 4C6IA 1BXNA 4LCRA 2DORA 2QDEA 1YYAA 4XAPA 3TDFA 1XSKA 4D6CA 5TD4A 1CXLA 5KINA 4JTAA 1EDTA 3NSMA 3MSGA 2PU0A 3OBKA 4ATDA 4ZCWA 4PTMA 1XCXA 1QAPA 1KW1A 1W8SA 3QXBA 1KA9F 1JPHA 2WC3A 3WJZA 4RV3A 3LI0A 4LS1A 2YB1A 2BOGX 3E9AA 1QNRA 1Y8BA 3ABXA 5BRBA 2VX5A 4M7TA 3GRIA 5C71A 4GUHA 3DECA 3P6LA 4MZYA 2EG8A 2J6XA 4IUGA 1LZOA 1EKOA 4PZVA 3DG7A 1AK5A 4OOZA 2FPVA 3GU2A 2VMFA 4PA8A 4QE5A 2QMJA 3KBVA 2ZUSA 4HYVA 1BWLA 1ZAJA 4MY1A 4UOQA 1H62A 4LYQA 4UNLA 2VI0A 3G24A 1M6JA 3CT7A 2PSNA 1QI0A 1DYSA 3L5AA 1VS1A 4YPJA 2WC4A 3UR7A 1W1PA 4JEQA 3BMVA 3HMJG 1LWIA 1B4EA 3BMWA 6TAAA 3BSHA 3M46A 4QXIA 4LUJA 1UWAA 1GVEA 1LOQA 3MANA 4ZE5A 1FCUA 2WVSA 3RFAA 3URNA 3MS8A 2VEMA 3M0HA 3TQVA 3DG3A 1AVAA 2Q8XA 3D0CA 1SFJA 1W5MA 4IPLA 3KS5A 3NVDA 3W2LA 5D2YA 1W31A 2C91A 3HQNA 3TCSA 3UWVA 4LVAA 3USBA 3EBVA 2ZA2A 3NZQA 3PB0A 3STPA 3GDLA 3QC3A 5CBBA 1JQVA 2Z25A 1J0IA 2G5WA 4F9DA 3ZJ8A 3SCRA 2A5HA 3W1UA 2YLAA 5E5CA 5F1UA 4XZWA 2QJHA 2VT0A 4C6PA 4E4UA 1XIJA 3PC0A 1U83A 3GH7A 3IS4A 5JVLA 4UTJA 4TX6A 4X63A 1X96A 3SY5A 3NYZA 1A49A 2H3BA 2XTKA 2OJPA 1U2YA 3H24A 1XQKA 1WCGA 2X7WA 2Y85A 3SIZA 1H5YA 1DE5A 4YU1A 1F6KA 1KFBA 4HYRA 3QR1A 1FWWA 1ITCA 1LWHA 1UWTA 1XV8A 1BKSA 3VKKA 3GVWA 2XFFA 1TPC1 3OYXA 5KTLA 3BL3A 1FWIC 4TTGA 4PMRA 5HK4A 3UP8A 3ORWA 2ALRA 1GPWA 1IEXA 4X9SA 1P0NA 3TV8A 5FCZA 1P48A 4HOZA 1TV7A 4PH6A 3TQPA 2WAGA 4PEEA 5A8QA 2OQHA 3W2NA 1QWKA 1J12A 2HISA 1XG3A 4WY0F 3TQ0A 1YIXA 5ECVA 2DVUA 2EPLX 3LD5A 1VFUA 3XINA 2V3FA 3AHVA 4CLMA 4EXBA 3SCTA 3LCIA 5D9MA 2EAWA 1IWBA 1N2VA 4A29A 4XAFA 3ZLFA 2VP8A 3WEMA 3P3BA 2WZMA 3R0DA 4KCUA 4LF1A 4PMZA 1E4IA 4GQBA 2X0YA 1XLEA 1G01A 4ZB0A 3ITXA 2QVHA 3RMJA 2WZTA 3A4XA 1R3QA 1PKMA 3T07A 4AY1A 2AKZA 3BJTA 4BF7A 1FWEC 3CK5A 3PHAA 4AF0B 3MCNA 2WXDM 1US0A 3OVPA 3WD4A 1A5SA 4LBRA 3AS2A 2WNWA 3UWEA 3VCNA 1M04A 3IAPA 3T2QA 4JNYA 3FSTA 3MSYA 4FMVA 4GVIA 4Q4RA 2BBFA 4AEOA 2WMFA 3PTKA 1UR0A 3RG6A 4H7CA 1J93A 1IE7C 1UD4A 4EF9A 4W88A 1V93A 1TTIA 2BVDA 4P7RA 1Z6KA 3L4YA 4JGDA 1WPCA 4JQ1A 2ZX8A 1B4KA 2EPMX 4WJ8A 4PMQA 3TYAA 5KZMA 5EMLA 4GIAA 4CNSA 2FJUB 1W3JA 1KCXA 4S3DA 3PPCA 2Z29A 3BLLA 3G2GA 1GCYA 1EWEA 1FWDC 2VM8A 3W9ZA 4LAZA 4A8NA 4MWAE 4OOUA 2O4MA 4BI6A 1CTNA 1DIDA 2P3ZA 3C2FA 3GXFA 4C65A 3I6EA 4IX0A 2VEKA 1F74A 3CAVA 3BARA 3QBUA 1P0KA 4EAYA 1DXEA 5GNYA 1JD7A 3CV2A 2FZBA 3VDAA 3EXRA 3MVIA 2CZ5A 4AZIA 3R2GA 3SCNA 4O1DA 4OBRA 3VIHA 1DPMA 3GH5A 4EP8C 2C6QA 2GUYA 4HJWA 4W8LA 1UZ1A 2H8ZA 3H21A 4HPGA 3VC5A 2J8TA 2DJXA 2OSYA 2ISDA 1OSEA 1XLDA 5G2IA 2WVTA 4US6A 4Q8VA 1D2KA 2VEIA 3JVAA 4A2RA 1XP3A 2PWDA 3WLQA 4DY1A 3L5LA 3CZEA 3OA3A 2ZTJA 5BZAA 4GJ1A 3BAJA 4WSJA 5FEPA 3P67A 4GJIA 4FXSA 1KM2A 4Q4QA 1BWKA 1N8WA 1DJZA 2DZSA 4GABA 5D9NA 2O4QA 3N2OA 4V28A 1FCQA 1G0CA 2X40A 1MEIA 2O92A 1H7XA 2J24A 1IXQA 3CV7A 4HMDA 4ICCX 3VKCA 2HDJA 4X9YA 3AALA 3S1UA 3PTMA 1DTUA 4IIHA 1F05A 1QK2A 3VNKA 2VO5A 3ZLGA 1K1DA 4YVXA 2Z6IA 3HPAA 2KZHA 2FJKA 4MYXA 4W89A 1V0KA 4JTQA 1TWDA 2BS9A 1NFBA 1R7OA 5E0FA 4GBDA 3UG8A 3IWPA 2HBXA 4MWAB 3P14A 1T8QA 1W3IA 4AZGA 2O9OA 3WBAA 1E1EA 4H19A 1H7WA 1XICA 3OPSA 3S6DA 5CPOA 1XIBA 2E5BA 4R53A 1T6MA 5I3GA 2G41A 1B31A 3NQGA 7CGTA 2Y7GA 4KWUA 3GK0A 5D03A 3AC0A 4BCEA 3VUPA 4AIBA 3KM8A 1KBIA 1TWSA 3S46A 5KZDA 3SRHA 1XLMA 2HSAA 3WNLA 1X98A 3UJRA 4H6KA 2DUAA 3W00A 1YADA 4U3AA 2MNRA 3BQ6A 4DBWA 4AWTA 2XWDA 1NOFA 4YYCA 1T96A 1ZLPA 4QE4A 4H6RA 4AG0A 3W2JA 2G3JA 4GY0A 4F0RA 2W92A 3BANA 4U2YA 3LHVA 1K8ZA 2OCZA 5K2ZA 4O16A 2BTMA 4F9JA 5LNRA 2E5DA 3VINA 2YFOA 3H23A 3S6TA 3EXSA 3OZMA 3C3UA 1E70M 4DXVA 2HK0A 4M6PA 1GVSA 4QFUA 2WNQA 3QYSA 3SQMA 1G4EA 2XVLA 2E4TA 1FUYA 1JYWA 4KGJA 3F2DA 1Q6GA 1HKVA 4O12A 5IHSA 3WQ6A 3QW4B 3ZT7A 4DNHA 8CGTA 3ELFA 3PZNA 9XIMA 2BXZA 4HQVA 1Q6LA 1NH6A 2FHFA 2J7DA 3D5HA 3SZ8A 1D7KA 1UROA 3MKCA 4RPQA 4DJED 3SN0A 2NVAA 2IPGA 4I90A 5A6MA 3UA4A 5JXQA 3UY7A 4JFVA 1TV5A 2DW6A 5G4HC 3VNJA 4YJ5A 2CNCA 1GK8A 1SVDA 5KEZA 1MYRA 3TE9A 3O8AA 4CNUA 2P8CA 3NDZA 3CAQA 3W24A 3WD3A 3CXOA 1OK4A 1KFKA 1GZ1A 3VDCA 3GFXA 3L0KA 4KPLA 4KRZA 1ZQ5A 4H6EA 3THQA 2NV9A 3D47A 3GLCA 3FHQA 3B9EA 2JIEA 2DSWA 3PAJA 4GINA 2VCCA 8A3HA 3S2CA 3L9CA 3VX1A 3AUJA 4BZYA 4J7RA 3H7VA 3THUA 1W54A 3W7OA 1JULA 1TIMA 1TVNA 1LUCA 3TTOA 3B9OA 3BLOA 5LA0A 1DJYA 1L8NA 4JOMA 2VFHA 3GQYA 3MDUA 4PODA 3U2ZA 4CCZA 4C1KA 3A22A 3DHUA 1TPB1 4GI8A 3EWCA 1O1ZA 2IXVA 3QSTA 4Y9AA 2JGYA 3TJIA 1PZ0A 4IICA 4BR1A 2VZVA 3L65A 2A3EA 5GVJA 4B4HA 4KRUA 5D9OA 4F8XA 1TZ7A 3FJNA 4Z17A 4ZXLA 3DYOA 4OUEA 2WLYA 3HGJA 1OX5A 2UBPC 3LERA 1W9VA 4O0QA 3DU0A 1ODZA 1YQ2A 4WRHA 5D04C 1KFJA 1ITQA 3N04A 1FHDA 3BTNA 4INFA 2GOUA 4XKYB 3O3RA 2OLAA 3GB6A 1TQXA 3DCPA 4K39A 3WLTA 1UHVA 2PDPA 3T08A 5I3DA 2OMAA 3EPMA 1MUWA 4JCLA 1RP9A 3SBFA 1JDEA 4B9ZA 1NF0A 4JTDA 3W4RA 3VFLA 1HFBA 3SCSA 3TMQA 1MEHA 4NZ4A 2HNHA 4I7WA 2FH8A 3UJSA 3WJSA 4E8DA 1T41A 3LCGA 2QCFA 1NP0A 4QIUA 1OF6A 2QCHA 4AXNA 3QC0A 4PTNA 4XIAA 3G1XA 2QIIA 3GDMA 5C2CA 4WQ6A 4UTIA 1CGUA 4OBTA 3BCDA 1W32A 1ENUA 5BRPA 2JKAA 4PEKA 2YDSA 2J66A 4AISA 1G6CA 1H1ZA 2CLOA 1UWUA 3GVGA 1YPFA 3BLIA 2D3NA 4PC8A 2AAMA 4GYPA 3TCEA 3VFCA 3S83A 2PCQA 1VP5A 3GXNA 4DWSD 1QOQA 4LUYA 4DUWA 1XSIA 3U48A 4YTSA 4P5UA 1DOSA 1PO9A 2BLEA 3TEVA 3G8RA 1AW1A 4GH1A 1ZJBA 1R3YA 3ZSSA 4RZ4A 5CKSA 4W8BA 3TXVA 3SRKA 1XCWA 3B8DA 5F2LA 3GR4A 4MOZA 1V6YA 3RLHA 5FL1A 1US2A 1PTGA 2WJDA 3LHWA 3CLMA 5D2WA 3LMYA 1UD6A 4IJBA 1WZMA 3FDGA 1R85A 3RRAA 2A21A 1DE6A 3TTQA 6REQB 1KRMA 5PTDA 2BGQA 4S3BA 4MUPA 2VKZG 4TU1A 2V82A 3G6LA 3CLWA 5MKGA 1TX0A 3PTDA 1EIBA 3N3MA 2VGIA 3LDVA 5A2AA 3S0CA 5BXRA 1EGZA 4W86A 3UWZA 4AZ7A 1PHQA 3GXMA 2X30A 3RM4A 3WH5A 2XYLA 1GHRA 3DIPA 2WVVA 4XV0A 1I75A 5J5DA 5CGMA 3LA4A 4Q7IA 5C9RA 3DFOA 2B7NA 5GJNA 5ABGA 1E6ZA 4HHHA 2BV9A 3VE7A 3WQGA 1K4GA 2Y4SA 4U5KA 2DUXA 4AXKA 2VDIA 2RFGA 5JU6A 1K8CA 4IM4A 1CLVA 1P6WA 8XIAA 2Z1SA 3GXIA 3HQOA 2DVXA 4XZBA 1PL9A 1WOBA 1LLOA 1H11A 2V3EA 3UG4A 5FACA 1XYMA 5IBXA 3SM0A 1GVIA 2YZRA 2EQDA 1E0UA 1BYBA 3M7WA 4DN1A 1PSCA 2GDUA 4JHOA 4EX4A 3KL5A 1LRTA 4YMZA 2OTDA 2Z2AA 3WELA 1QTWA 1FXQA 3HV9A 3A5FA 4D6FA 3WLMA 1D3GA 3ITOA 1H3GA 2OGYA 4NJHA 2X42A 4HMEA 3EA1A 2A6NA 2BVYA 3JUGA 1XLHA 2HPMA 4OHQA 3QN3A 3VOGA 4CD5A 3H4XA 3TWAA 2ZX6A 2V3GA 3T6CA 1LBFA 5LNVA 4UOZA 2P10A 3W75A 3EWWA 5HULA 4CQAA 1DIKA 2WCGA 3EPNA 2B7OA 4N4QA 3GX9A 1Z89A 3H55A 1BF6A 2ZYFA 4GY1A 1KCLA 5DT7A 4MY8A 3ABRA 5MF5A 4YTQA 1E72M 1R3TA 5HXMA 2RJHA 1KM0A 1W91A 1XJBA 1QW7A 1EB3A 3B8IA 5FD0A 4YWSA 5D2VA 5EMUA 4PE8A 4FALA 3UXDA 1ZPTA 4UCFA 1E5NA 3KVJA 1V6TA 5AC5A 2QS8A 4XISA 2EG6A 4XVEA 2Y89A 3FIGA 4RK8A 5HNRA 3A9BA 3CZJA 4YCOA 1AODA 4GKLA 1OCJA 4G5DA 3W6YA 2RDUA 1VC4A 5HQMA 1MNZA 5IRPA 1MEWA 1FWAC 3PBGA 4XBSA 4M6UA 3RU8X 4ATLA 4UMCA 2J7GA 4NZFA 1UA3A 1UOZA 4JR5A 4DO4A 1Q3NA 3R4IA 4NVTA 1EYEA 1Z42A 4PRRA 1E6PA 1JPDX 1A5AA 1G1YA 2YYTA 4UOJA 2NX9A 4MDPA 1R9YA 4NKCA 4XAGA 1AMKA 2QLYA 4B5XA 1WBJA 1CT5A 3UZZA 4JTRA 2PDCA 2YBVA 3DFSA 4R5EA 2ZVIA 4DJFD 4CD6A 4LJ3A 3LOTA 3R13A 3WH6A 5D09A 1S38A 3N2XA 3U3HA 3DFPA 2GFTA 1EZWA 1VBHA 3M0XA 1AFSA 4K37A 3OQEA 4CN6A 2AL2A 2TSYA 5ABFB 4MNJA 3FYPA 4PMYA 4IIEA 4NJGA 1P1XA 4OZOA 3C0LA 4CQCA 3K8MA 1AZ2A 3NTYA 4MKVA 3GS6A 1XFBA 1XLLA 4GJJA 3WDJA 4Y2WA 2V5KA 3E96A 4JICA 4WSKA 1HN1A 1JG9A 3GDBA 4UC5A 4AWSA 2VTFA 1UW9A 4A3UA 3O9NA 1VF8A 1A0CA 5AHLA 4JTJA 1KXVA 4Q8OA 3TLLA 2QF8A 1GOWA 1PX8A 3N6JA 1KFWA 5HMEA 2VENA 3HTWA 1H63A 3T40A 1RXOB 3WY1A 4ZZ9A 2Q8ZA 3POCA 1Q4WA 3BLFA 1CIUA 4KKXA 5I79A 3K4AA 2DT0A 2X2GA 3DI0A 4GIEA 4JTIA 1DJGA 2BG5A 3GG7A 3EX1A 1B9ZA 1ZP3A 2CC0A 4OBSA 1DVJA 5FJIA 1VCVA 4XWUA 4XZMX 3C61A 1GJUA 1EGVA 4S3FA 1U22A 4O50A 5T8GA 1OD8A 1VBUA 1EEXA 1BXBA 3VDGA 1ZAIA 1UP0A 3PZUA 4ZE4A 3BVJA 1GJPA 2BY0A 3FX4A 4ERAA 3CIWA 1EL3A 2E1DA 4A8IA 5D2XA 2XFYA 2EF9A 1JUBA 3FXYA 3H2CA 3W1LA 1JPKA 3S5NA 4Z0JA 2ZZ3A 4JTSA 2HCVA 3KCOA 1FA2A 3GVQA 3HQ1A 3M47A 3W07A 4BF9A 1Z44A 4E38A 5CH9A 4L7ZA 3CIXA 3WO8A 4W7UA 4GI4A 4WY0B 3EZ4A 3KDOA 3UR8A 3L2MA 3VIKA 3GD6A 1FRBA 4TQTA 1CYGA 3UERA 1T99A 5FJJA 1TELA 2FFIA 3TN5A 3AU6A 4TUFA 2Y5EA 4Y6GA 1ZCOA 4LVFA 4ONVA 3WQOA 4XO7A 3NFUA 1XLCA 4EXQA 2EJAA 2Q6ZA 2YBTA 4EOUA 5AZ1A 2C1IA 4IQLA 3W2KA 1E0TA 4Q8PA 2XSXA 1OEPA 3ZIZA 2VX6A 4RCXA 1OX6A 1QNOA 3ARVA 4LVDA 2E09A 1O1HA 2E77A 5I24A 3PG8A 3EWXA 4ERIA 3T1GA 1A3HA 3AYRA 3G8EA 1XIEA 2XN2A 1TTQA 4LB3A 3RXZA 1OM0A 6XIMA 3ZM8A 5M2FX 3NXFA 3SI9A 3I6RA 4RDVA 3UNTA 2Q8LA 1XYFA 5C55A 5I02A 3LENA 3M5XA 1JZ8A 1UWIA 1HG3A 3GBEA 2A4AA 5CAKA 5JBFA 1DWGM 4QLKA 5D8ZA 4QE1A 2PTXA 1Q2RA 3LS9A 5E0KA 2P1FA 3I65A 1CBGA 1VYRA 1OFDA 1W1VA 3GG8A 1WDPA 2WJEA 2OSWA 3WF2A 3WD1A 2JBMA 2J7CA 4LUTB 6PTDA 1WXYA 1PIIA 1VEOA 1IT0A 1CXHA 2WHJA 1LDCA 3CAWA 3URQA 1NWSA 1MZHA 2HS8A 4GUIA 1DJNA 1QCWA 4YYFA 3HFYA 5AC4A 1WV2A 4GZIA 4LSBA 5DO8A 4AY7A 4HU0A 5A6TC 4Y9NA 1J6PA 2X09A 4I5XA 4D2JA 3OZOA 3MP4A 3K13A 5K3VA 3KXQA 4GOAA 8RUCA 3JZEA 5I09A 3E12A 4FOJA 1VH7A 1TFVA 4DF0A 1GVRA 3HPFA 1H60A 1X39A 1GKRA 4H41A 3C2RA 2OVLA 4JIEA 4CQDA 5F2GA 3WLIA 1Q6FA 2J9YA 3NQMA 1JZ6A 4W87A 2BB0A 3LCWA 3JRKA 4JTHA 3TZFA 3W29A 1BXCA 2YLLA 3DDMA 1AG1O 4DJDC 5I3IA 3HJEA 1NQKA 4ZQMA 3CM4A 3ZWSA 3QF0A 4W85A 1H7NA 5IHRA 4REQB 1FCBA 4DAFA 4V1YA 3SSJA 2A3BA 5LIYX 3GR8A 4GYKA 4Q4MA 4WDXA 1W2VA 3BW2A 1WOAA 3NQCA 2Y88A 3W2UA 3V0SA 2HVNA 1RCOB 1IXNA 4PRWA 4GUJA 3MDWA 1R6WA 4GI6A 2YXOA 3GDTA 5I06A 1HL9A 2G3NA 1H09A 2Y6ZA 3WF1A 4ZQPA 1E55A 4PBEA 1GNXA 2I16A 4GE8A 1QW9A 4MWAA 3KRBA 4KFPA 5DXYA 1RJPA 3ZLHA 2V81A 2RJGA 4CN1A 3PTQA 4ZOBA 3KUMA 2Q02A 1IEQA 1VFLA 3AFBA 3EDFA 4HYWA 4C1NB 3WLOA 4M8UA 3PJTA 1ADOA 3WQWA 3U2OA 5H6HA 2YFNA 4FX7A 1PVNA 1I0DA 4KS0A 2PDFA 2DZWA 4G7EA 4TR9A 2BZNA 1H7OA 3IPWA 4GZJA 3SFKA 2FMNA 1TCMA 3ARWA 2BMBA 4ILSA 2VFEA 1GG1A 3EMQA 3I4EA 5BNKA 3W70A 3PJUA 1PV8A 1QPKA 2E9MA 3WSUA 4EWJA 4LRSA 4MMWA 3I3BA 1PB0A 3CZKA 4C6NA 3MV11 5D37A 3GNNA 4J3VA 2PAJA 3SN1A 1JZ3A 1BAGA 4G6CA 3TXZA 3WLRA 3CQ0A 4MLJA 1VEMA 4GH3A 2P5NA 4O1EA 3TA6A 1PIFA 3ITYA 3FVDA 4XO6A 3W85A 3CWOX 4ZMGA 1LL4A 2C3ZA 3QR3A 3B0VC 4A21A 3BO9A 3GXDA 4V1XA 3MI3A 1FY6A 3CHFA 2O7QA 2YXGA 3MY9A 1TIWA 3S1GA 1PPIA 4D71A 1WKDA 3S1XA 1E1FA 4GQQA 4MJ2A 4RE2A 1AL8A 2XWEA 4B5UA 1CGYA 3MWAA 4UQ9A 2AMGA 1J0HA 3WDHA 1RCQA 4IT1A 4H8UA 3P74A 4K8EA 1PKYA 1P0DA 2ZXDA 3CYJA 4U4MA 1K6AA 4H3DA 4E8CA 4IMFA 2WKGA 4S2BA 3RX3A 2GVJA 1Z8AA 2ODOA 4DZIA 1ME9A 2PWHA 3HU7A 2BXVA 5I77A 3A5VA 3IARA 2NX1A 3C0SA 1VB9A 1WDWA 4NZJA 3MI6A 3DKLA 3DGBA 4EWND 2CEQA 2BGSA 2HXTA 3IRDA 3ERPA 1NDWA 1PX3A 2QJGA 2ZXQA 3PPGA 1B5TA 1FX6A 4C5YA 4NI8A 1LQ0A 3HURA 2FGZA 3NAVA 7ENLA 1E6QM 3SCWA 3SO7A 5BMXA 1ZBCA 5AHEA 3LG3A 2VC5A 5E1QA 4H2HA 3CUZA 3IGUA 4EK7A 4QGCA 3CZ8A 2VOMA 1CCWB 3LRLA 2V38A 2P88A 3M6DA 2TMDA 3EXTA 2CLEA 1R3VA 4JQ4A 5I5RA 4NHVA 5REQB 2DIEA 4LWWA 2BHYA 4LUIA 3OJGA 4P7OA 3VVGA 1S5VA 1Y65A 3APTA 2CLFA 4P7QA 4ADTA 4O0KA 1VAHA 1X8CA 1I0BA 2B7QA 3TWBA 4DQWA 4JFWA 3VZXA 3LN3A 3C52A 4IFKB 3WYZA 1XI3A 3BLPX 3RCNA 3WNMA 2VZTA 3W83A 3WENA 2GGJA 4D1IA 4GXMA 1RZMA 1C9WA 1G5AA 2WMIA 1XISA 3G77A 4MSSA 1Q45A 1SU5A 4JTTA 2WZHA 4Z0SA 4DHGA 1XLBA 2YBUA 4JKMA 4NXKA 4Z2LA 1UB3A 3S5SA 4WX2A 3SUWA 4XKYA 3VCRA 2Z2BA 1R9ZA 1Q63A 3AMLA 2J25A 3W0KA 2PGEA 5EFFA 3QQ1A 3TJ4A 3CQHA 1OFRA 3MO4A 3LLFA 5AKQA 3AU2A 3ANVA 2ZUTA 5C2XA 3LHZA 2ZRUA 2OEMA 3FKRA 3TLQA 4V27A 4I6KA 2PURA 3C0QA 1PZ3A 4Z2HA 4R7WA 4WGXA 2ZE0A 3PR2A 5I6SA 2BP1A 2HV5A 1ITXA 3RF9A 4V2XA 3MKVA 4G9PA 3VOFA 1V3JA 5HANA 1RD5A 2Z1XA 5CC6A 4EACA 1F2JA 1H0IA 1E3XA 2VWSA 2ZUNA 3ZT5A 4NAEA 4IPPA 3LCXA 3NQDA 4K6AA 2NT1A 4ZO6A 1S5TA 4G7FA 1EDQA 4XUGA 3WMLA 1C93A 5AVNA 3BURA 1K8XA 2GVLA 4O14A 3W7MA 5T91A 2PBOA 3D3AA 1V3KA 3W7IA 1Z41A 3GDRA 3QZAA 3VKJA 2ATSA 3IJLA 2OODA 3QKEA 2FYMA 2VR5A 5FF0A 3ABQA 1D3CA 1V51A 4AVFA 1JFXA 1FWJC 1W1B1 2OFJA 4C7FA 3MJYA 4MJ4A 3IJQA 4UZSA 3P93A 3DBPA 2ZOXA 4UXDA 2YKKA 3BWWA 3RILA 4E2BA 5CSRA 4UTUA 1UD8A 1GQNA 4AMCA 3HJZA 1RV8A 1WAUA 1A5KC