1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
4IXXA 5K2ZA 5AHNA 1XI3A 3LCFA 4O1DA 2ABAA 3T4CA 3S1WA 4K7YA 3P7YA 5LZLA 4GNJA 2C19A 1OX6A 1JQVA 4X2RA 3MWAA 3GXNA 4GE8A 1SW7A 1LTDA 2VFGA 4J9JA 4XQ6A 3NQFA 4NX5A 3O07A 4ZL1A 3LV5A 2J9XA 4GFSA 5KINA 3NGJA 2ZZ6A 4MZYA 1TPFA 4M6PA 3PG8A 4JTKA 3LTSA 3NPUA 1OFDA 4QIUA 2ZTJA 2H8XA 3UWYA 2CZDA 3C0JA 3S1XA 1DBTA 3G1YA 3WJSA 3EKLA 1XXXA 1PIIA 5AYYA 5I3JA 4JTFA 3S5ZA 1KV5A 3THQA 3PWAA 3FLUA 1RPXA 1ML1A 2ISSA 3LRKA 3L21A 4FXRA 2GVLA 4KFPA 1AW2A 3QPYA 2C0AA 3QJAA 5D2TA 3GXPA 3EB2A 3NNTA 4A29A 4AWTA 4PCFA 3BW2A 1D3GA 3PSVA 3NQCA 1DV7A 4FX8A 1SSDA 2DORA 1KTCA 3O1NA 3C6CA 1UASA 3R12A 2JBMA 2V2DA 3VE9A 3TC7A 2WPBA 5J5DA 2DP3A 1A5CA 1SO6A 3W1RA 3L2IA 4RKAA 4H6KA 2QAFA 2NXGA 4DO5A 3DHDA 2VEMA 4Q4KA 4OWGA 1TB3A 3UWQA 4K8EA 4PEKA 4LNYA 1PCKA 2OMAA 4K36A 1IGSA 1IXNA 1G6CA 5CPNA 4PFMA 2DJXA 3STEA 1F5ZA 3NL5A 4XBSA 4HNTA 4N02A 4I7UA 4AXKA 3NR0A 3LXAA 4EVZA 1H7XA 3BARA 4O15A 4X9SA 3EWXA 4WXYA 1TV7A 4UFMA 4AEOA 4TU1A 1SW0A 4O11A 2GQAA 2CLEA 4Y90A 4CNOA 1GOXA 3TW7A 1FXPA 5LHEA 5F2LA 1QPOA 4DF2A 1F73A 3TR2A 4AAJA 4JXCA 4JY8A 1AW1A 1KFKA 3M44A 5BMWA 4Z1DA 3B06A 2NV1A 3G8EA 3R5EA 2ISVA 3IVUA 3KRUA 3S1UA 3I7QA 2BLEA 5BNKA 4NXKA 2G5WA 1XUZA 1ALDA 4XZ9A 4MFEA 1ZHAA 3SI9A 2CFFA 3W2LA 3NVTA 4LWWA 1PL9A 1YDVA 3W9ZA 4D2JA 3RNDA 5F2GA 4MLJA 1EWDA 2FJKA 3QMRA 1W5MA 3R8RA 4FNSA 2PE4A 1JUBA 3ABSA 1RZMA 2GUUA 2ZRUA 3CIWA 4WY0B 3B0PA 4UTLA 1FBAA 5D30A 1O5XA 3IIPA 4HPJA 5AHEA 2VFIA 3O6DA 1K03A 4WY0A 4PL2A 1N7KA 4CQ9A 1SZFA 4NVTA 2FPYA 3IIZA 2CU0A 1L6WA 2YPIA 4JGDA 3CEPA 1VR6A 4Z08A 3W2NA 1VRDA 5LNRA 3DI0A 3FIGA 1ME7A 3I6RA 1ZAJA 3UQNA 5E1QA 1FDJA 4ML9A 1MEWA 2JKAA 5AYZA 3KHJA 3TV8A 2G96A 5KSWA 2LLEA 5CSSA 1E51A 3A5FA 5MHBA 3DBPA 4DPPA 5FI8A 3NO5A 1J2WA 4LVAA 1JCYA 3RFAA 4DQWA 2GPTA 5C2XA 1KM4A 3DI1A 5FEXA 4BWLA 5DY2A 3R13A 4N4QA 3LHWA 3W74A 5I3HA 2EPHA 3S42A 5LKYA 1KFBA 1YXYA 3L68A 1KM2A 1MO0A 4WD0A 3QFEA 3TQ0A 4IXHA 3CC1A 1PCWA 1YXDA 3S5OA 3O15A 3W7MA 3W7RA 4CQAA 2H3DA 2YR1A 4JTHA 3UPWA 1R2SA 1LLZA 1NSJA 3B03A 2DZPA 1K8ZA 3VNDA 3STGA 2ZFAA 3OA3A 4FNRA 1HO1A 1YDOA 1PVNA 4JTIA 4N9BA 2JKPA 1FCQA 5HUPA 4BF9A 4LUIA 5HINA 3PG9A 3N9SA 4MIMA 4JY9A 4BFAA 2VELA 3DU0A 5EYWA 3MW7A 2V0TA 2AGKA 4A2SA 4QAIA 5LHFA 3THAA 1G4TA 3TROA 1ICPA 1F6KA 1GYLA 4NJHA 3QSRA 3PBUA 3LRLA 3TE9A 1DHPA 2Y62A 2GOUA 1T96A 3W7JA 3SFKA 1NF7A 3AJXA 4HKPA 4UTWA 3W1XA 2EAWA 4JN6A 1UB3A 3O06A 3UYCA 1C9DA 1SR9A 2VENA 1GWJA 5D2YA 4C1KA 1JJKA 5CZSA 4O57A 3PBVA 3SJ3A 1NFBA 5D38A 2NLIA 3ABRA 2TPSA 1T99A 4JX6A 1KV8A 1X1OA 1GZGA 1OFOA 1PS9A 1WXJA 1EX5A 3JS3A 3SW6A 3WJWA 1H62A 2YX0A 3DFTA 3JR2A 5CZJA 4GBUA 4MFDA 2V5BA 4OT7A 6TIMA 2Y7EA 5D37A 2W6RA 4CCDA 1DVJA 4OGZA 4UFKA 3CQ0A 1JR1A 2V9DA 3MHUA 1L6SA 1XM3A 2QCMA 3TUUA 3LCHA 4LVBA 5DBUA 2VFFA 1X8FA 3MP5A 1TTJA 3MJYA 4ALDA 4CCCA 2GVJA 1QPRA 4HSNA 4TO8A 2ABBA 4E38A 3HG5A 2J9ZA 2QCCA 1LM1A 4UR7A 5I3GA 4UTUA 3IEBA 3HGSA 2OCZA 2JKEA 1FWSA 4ORIA 3SR7A 4Y96A 2E77A 3NXFA 4OQVA 3SZ8A 3HJZA 2HS6A 4ZQCA 1EB3A 1OF6A 4N6EA 4UMCA 3W72A 3LHYA 3NZ1A 4LW7A 2BSLA 2XN2A 2B7PA 2R8WA 2W79A 2F84A 4A3UA 4JTLA 1WA3A 2A6LA 3P62A 2WKJA 1MZHA 1LBMA 1SFLA 1WDWA 3NQEA 4MUZA 4HNUA 3PUDA 3BK0A 4H4IA 2B7NA 3QW3A 3DFPA 4MY9A 3TSMA 4CNPA 2CLIA 4JR5A 3MMTA 1T8XA 2HS8A 1XDMA 1TO3A 3TMLA 1FWWA 4NJGA 3HPXA 1ICSA 1GT8A 3LCWA 1EPXA 4JD4A 1I2OA 2VXNA 4UNLA 3W7IA 3QRHA 3GB6A 3FYPA 5G5IA 4HT3A 1TPH1 1M5WA 4TMBA 3TFXA 3W76A 1OYBA 4E2DA 4OBTA 2NXIA 2CLMA 4A22A 4WQ6A 2A6NA 3CLMA 2EGZA 4O18A 2X1TA 4R7JA 1MSSA 3NM3A 1DKWA 2B7QA 5F1VA 5BOOA 1LCOA 3GZ3A 5AN7A 2G95A 3FOKA 2YCEA 4MPQA 3EX3A 1FXQA 1KTBA 3KX6A 1RD5A 1H50A 1H7PA 3DXIA 4O1AA 4BWLC 4IMCA 2JGQA 3LCLA 2RFGA 3LXBA 1M6JA 1HFBA 2GJNA 4FHAA 4NZFA 2AQWA 2O7SA 1S5VA 4LC6A 3P74A 3KOFA 2DZVA 3O16A 3G3MA 1HL2A 5H91A 3SIZA 1WOAA 3IGXA 4IMEA 3TAKA 4FEZA 1TIMA 2E5CA 4HIBA 1H7OA 2GQ9A 2V82A 2Z1BA 4HHPA 5I3KA 1V5XA 2DZXA 3NQ6A 3R89A 3RLUA 1VQTA 3W75A 5KZMA 4IGHA 1TV5A 2VFDA 4JTEA 1TRDA 5D2WA 1FY6A 3TAOA 1ZAIA 3TXZA 3NL6A 1WAUA 1AL7A 4AHQA 2NV2A 4RX0A 1WV2A 4UTKA 4AWSA 3W83A 2ZRYA 5K3VA 4RR4A 3WK3A 4XBKA 1O94A 1YPIA 2E6DA 2QCLA 1WBJA 1GVSA 2F7FA 3HGJA 2QJHA 4O8RA 3NA8A 1FDZA 1Q6RA 3LTPA 1TPVA 3GXTA 3NPVA 3LERA 5DELA 1ICQA 3GDTA 3L0NA 1VH7A 4UTWC 5FF7A 3I7SA 3A9IA 4JYDA 2E09A 2WNZA 1R30A 1XBXA 3W7NA 4IX0A 1DL3A 1S3HA 5AC6A 2QJGA 2ZDRA 4OU1A 4S1FA 1OFEA 2NX1A 2ZZ3A 3F03K 3C2EA 3FKKA 1F7BA 4ZZ9A 1PE1A 4TIMA 2XFWA 1CI1A 3H53A 3PY2A 4LS2A 1FWRA 2WV8A 5DBTA 4I9AA 3GIYA 1VJIA 5CPLA 1YXCA 1OFAA 1YADA 3W1NA 5KTLA 2ZBTA 1IIHA 5ABTA 2QCEA 1LBLA 4NJIA 2Y7GA 1J5TA 4M5PA 3W1QA 3L0GA 3RK8A 4K7VA 2QEZA 1OVDA 3EWYA 4RXGA 1UUMA 4EWND 4JTJA 5DCBA 4ADUA 3MUXA 1LRQA 5EY5A 3O8AA 3PF3A 2P0OA 3GDMA 3GDRA 5DXYA 1BWLA 3EXRA 3W7PA 3S5NA 1SZEA 4CLMA 4DF0A 1KFLA 3I7RA 1Z48A 1OJXA 1W56A 4LVDA 3QH2A 3UXAA 2ISWA 3WJZA 5C5YA 1A50A 1EP2A 2E6FA 3G1FA 1EEPA 3PSWA 3W1AA 1TPUA 3LHVA 4JICA 2E5DA 1VYPX 1QWGA 1DJQA 1XDLA 4KKXA 2OX1A 3O6YX 5HWMA 1CX9A 3L67A 4EF8A 5J5RA 5AC8A 5EMUA 2EHHA 2ZZ2A 3TH6A 3KVMA 4ADTA 1W1ZA 1QDSA 3M6YA 1YTKA 3QPZA 3DH7A 3W2KA 1DORA 2H8ZA 3P84A 5AB3A 1OX4B 3S1VA 1H61A 3HO8A 5F4SA 5HNRA 3HOJA 1A5AA 4QJ1A 4GC4A 4UTIA 3L65A 1EP1A 2ZTKA 3AO0A 3LV6A 3M16A 4ZQOA 4ZMGA 2ZRXA 3QMSA 1EIXA 4LS1A 2R91A 1OFRA 1F74A 1OX4A 3MBFA 2ATSA 1TRIA 4W9TA 3P82A 2O7QA 4MKNA 4UTJA 1EA0A 1YYAA 1BKSA 3H55A 3GKAA 3SGZA 4DBEA 3CB8A 1B9BA 1Q6LA 3W1TA 5KITA 1X7FA 2CLFA 5FEPA 4GUHA 3JRKA 2A7PA 1AG1O 3BLEA 2H3BA 4QSHA 1T0OA 4LVGA 3VE7A 4UFHA 4GUGA 3S5YA 1KM5A 3C52A 4R34A 1FUYA 3BGJA 1L6YA 2ZA1A 3CHVA 5KMYA 4YMZA 4K39A 3PULA 4MZ8A 1TJPA 4LS0A 1W5NA 2WSRA 3GAYA 2ZRZA 4Z1BA 3LCIA 1OFQA 1I2RA 1GPWA 1TPDA 4IX2A 1O95A 4NX0A 2Q8LA 1QO5A 1JRBA 1G7UA 2QCGA 2NXHA 4JIQA 1P1XA 1VC4A 1ZCOA 4TR9A 4UR8A 3T40A 4WX2A 1D3HA 2XN0A 3PAJA 1M7PA 1VS1A 3W7DA 3OHIA 3W70A 2PRLA 1B57A 3ABQA 3P81A 1R47A 3PBYA 3LBMA 1SFJA 1WQ5A 4LTSA 2QAPA 3FJ6A 2HMCA 1ME8A 4Y9AA 3BG5A 1EUAA 5CSRA 2C13A 4UFJA 3A22A 3CIXA 3QF0A 4BI6A 1RQEA 3UWUA 3GNDA 2QUTA 1K7EA 1LYXA 3MI3A 3W6YA 3L5MA 2QCHA 1ONRA 4UC5A 2I14A 4NJKA 3M0ZA 3STFA 1KA9F 1TSIA 2WOQA 1FCUA 4DO6A 4Z1AA 1JUEA 1KM6A 3W22A 3M1ZA 1KTNA 4JYEA 2BXVA 1W3IA 3CTLA 3DHFA 3NQ8A 4N9CA 4AHOA 3W3OA 3B0UX 1LDCA 2A7RA 1YTDA 3GDLA 4DBDA 2Z0IA 1YPFA 3SSJA 4LRSA 1FDYA 4YCPA 1B4KA 3IIOA 4XKYB 3TQKA 2Y89A 3NQDA 2YYUA 5K7JA 3U2OA 5K4XA 2ZRVA 3PBWA 1G67A 1SUXA 3OVRA 5FF0A 3HMJG 1O4UA 3W7GA 3LOTA 5LGZA 3GDKA 1P0NA 3STCA 1OX5A 2I9EA 4LU0A 3BLIA 5C6MA 2I1OA 4O28A 5HMSA 4XKYA 1SPQA 3EX2A 2Y70A 3O6CA 4XUGA 4XTIA 1W3TA 3QZEA 5AHLA 1P4CA 5G2WA 4QNWA 1X6UA 3WK1A 2Z6JA 3NQ7A 3TSBA 5F1UA 3N9RA 2GJLA 4LRTA 4HSOA 4N9EA 3QEZA 3UD6A 3A21A 4BK9A 4YCOA 3W85A 3CU2A 2Y85A 4A2RA 5D09A 3W23A 3P80A 3WJXA 3DFNA 3G1VA 3BLFA 1U5JA 2DZTA 3OVPA 3P60A 3GLCA 3LCGA 4JEQA 1Q6QA 3UPBA 4QM1A 3B0VC 3DENA 2QCFA 5CGQA 2RDUA 1H7RA 3PB0A 1IXOA 1N55A 3EWUA 3UXDA 1I8JA 4N2YA 2TMDA 5HR6A 2ZCGA 4UFLA 3DGRA 1GG1A 1JCJA 2YW4A 4NUWA 3QYQA 1LORA 2C15A 5LNVA 2NX9A 1C8VA 1K8YA 4WY0F 1Z41A 1JRCA 4DPQA 3PC0A 2J24A 4GUIA 4L4MA 2CZFA 3INPA 3KVLA 3LTYA 4EF9A 1H60A 1S5WA 4S2BA 2QCDA 3C56A 3FJLA 3LXCA 2X1UA 3LHTA 5I3FA 1FCBA 2OT1A 4NNCA 3K30A 3F4WA 2NUYA 3QM3A 2J88A 4AH7A 4JX5A 3DFSA 2NWRA 3IVTA 3M5YA 3LGEA 1HUVA 3WK0A 1TPC1 4XTDA 2EF9A 3L5LA 3IIVA 4CCEA 3FYOA 4X3ZA 2V2HA 5EPDA 2Y88A 3UY8A 2C1HA 1KFCA 3TX9A 1IXPA 3QMTA 3T44A 1SU5A 3LLFA 3TCEA 4RK8A 3B8DA 5F2IA 1F76A 4FB7A 1O5KA 4ICNA 3BPWA 3IGSA 4POCA 5G4WA 1UJPA 2B4GA 3E9AA 2H6RA 5HR7A 3G1DA 1LROA 4L4LA 4UTHA 4OHQA 4UMBA 2CLHA 3HGRA 2OZ0A 4MJMA 2PURA 3EXTA 3LX9A 2P1FA 3MYPA 5AFDA 2CZEA 3EEGA 1QNVA 4JYFA 4QQ3A 4R33A 4UTMA 1QOPA 3E0IA 4I7VA 4JX4A 2TSYA 3OIXA 3FKRA 3KVJA 1I2QA 5TIMA 1TTQA 4YL2A 5LNSA 5BMXA 1H7WA 5HQEA 1G7VA 1SO3A 5DCDA 1QMLA 1KBJA 5HWJA 3ZS4A 2X1RA 1UBSA 4S2CA 4ZVJA 3NYZA 1ZALA 2BX7A 1H1YA 2QF7A 1SW3A 3DKJA 5SWUA 1OFPA 3Q37A 3ZR4A 1ZAHA 5K9XA 1TMHA 3V1PA 4DELA 3UZJA 4LOCA 4WOQA 1TPWA 5DCEA 1Z42A 3USBA 3WFAA 2Z2UA 1QCWA 4GUJA 4O17A 2PRHA 4E2BA 4AMAA 1XCFA 1ZFJA 3W7LA 2ZA2A 2C6QA 2CW6A 5E93A 5CPMA 5U4NA 1V7YA 2VEPA 3DFQA 2JGYA 2BWGA 5L6UA 1AW5A 4O52A 2BTMA 3G18A 3G1XA 1KM1A 3TNOA 4O16A 4RLIA 3F4NA 4BI5A 1CW2A 4LY8A 1JCMP 1H5YA 2VFEA 3B05A 3W7EA 2YXGA 4O14A 2BZNA 3B4UA 3L9CA 4JDBA 1TPEA 3LM7A 3G3DA 3IVSA 4QITA 1W3NA 4ZQRA 5FF4A 1GG0A 2Q3OA 4MVAA 3OVQA 2QUVA 2V5LA 1LBFA 4GXMA 1ME9A 5A8GA 3TW6A 1AK5A 1IXQA 5LGXA 4UNKA 3W86A 2HTMA 1TPB1 2P10A 1QR7A 2CLOA 2YGYA 3TMQA 5F4WA 1DQXA 2ZZ4A 2VEIA 1FQ0A 1OG0A 2NUXA 4NQ1A 4Q33A 1MEHA 3HG2A 4O0KA 3BGGA 4RV8A 2NZLA 3OBKA 4GUFA 2A85A 1RVGA 1SZNA 1K7XA 2X16A 2ZZ1A 2C16A 1ZNNA 4ZQMA 1FCVA 4FIRA 3LI1A 2RHGA 5CZ0A 3N2XA 3G22A 1NAL1 3M47A 1GQNA 5H2ZA 4M19A 3NQVA 1PHWA 5I3IA 2B7OA 3IIXA 1XBYA 1JCLA 3NQMA 5E0KA 2WJZA 4WXZA 2FDSA 5IBXA 3DFOA 1LP6A 3FEMA 4G1KA 3EWWA 3M5ZA 3ELFA 1QO2A 3C61A 1I2PA 4NT0A 3ZFHA 5K9DA 3CWOX 5CKSA 1KBIA 4NJJA 4HNNA 1FWTA 3TQVA 3BO9A 3O63A 2A1YA 4LUJA 5F2MA 3OG3A 2PCQA 5FEWA 1DQWA 3NM1A 1ZY9A 2W0UA 1H63A 1Z44A 4WZHA 1VGAA 2E6YA 3U8GA 3HF3A 1G69A 4LVFA 4K38A 5C55A 1JCNA 2E1DA 1KM3A 1RQBA 3MP3A 5KZEA 5DN1A 4LT9A 5LNWA 3FFSA 3S9YA 4O0ZA 2QDHA 1GJPA 4FNUA 1TJRA 1KLZA 3ANYA 1SSGA 1OF8A 3G1AA 5HWNA 3GVGA 3KRSA 3A5VA 2H90A 2PRMA 3TA6A 3PUOA 4BI7A 1UCWA 2YZRA 3MP4A 4O4WA 4TX9A 2V30A 1GVRA 2WNQA 1LOQA 1JUKA 2ATMA 3VKJA 3M43A 5G1YA 2RDWA 3VCRA 3Q58A 4NZJA 1KFEA 1G4EA 1OYCA 4LC8A 4LV4A 1IF2A 4FNPA 1I45A 4K8HA 3QW4B 1U83A 4FNTA 3EX4A 2Q8ZA 2RDTA 1GVOA 4PA8A 3BV4A 1H1ZA 1H7NA 3HG4A 1N8FA 3HG3A 3SY5A 2A4AA 2C3ZA 1W5QA 3A23A 2OT0A 2NX3A 3EWBX 5EA9A 1EUNA 2WNNA 3GAKA 3VI2A 3C2RA 3S8HA 4N6FA 2QJIA 3T7VA 4FXSA 4MYAA 2FLIA 2DZUA 4R53A 3G1SA 5KZDA 4OV4A 5AC7A 1HO4A 3ZWTA 4A21A 1F05A 1P0KA 5D2VA 2TYSA 3GKFA 3PB2A 3G1HA 3IV3A 2AAMA 4O19A 1LRTA 5GVJA 3CPRA 4PC8A 3NG3A 1LRNA 3EKZA 3PR2A 2JK2A 3MHGA 4HNVA 4NNBA 4O1BA 2KZHA 5LNUA 3M5VA 4ADSA 4XWUA 5G1TA 5G2HA 2FFCA 2PC4A 4LV9A 4UCGA 3LDVA 2ZYFA 5T26A 2FQIA 4K6AA 5F4XA 2CLKA 4IOTA 4DEFA 1KLYA 3LBCA 3PS7A 3HBLA 3YPIA 3QQ0A 3CWNA 3W7OA 2VEKA 3W88A 1W31A 3N34A 5D02A 2B0MA 1BEUA 3C2OA 3NPWA 1XL9A 2HSAA 3T78A 5HULA 1S5TA 3G8RA 3M5XA 3ATYA 4PTNA 3MBDA 3C2FA 2QUUA 6ALDA 3A24A 4B5NA 1FX6A 4M6VA 4Z1CA 1RV8A 4IPIA 3S6DA 2Y7DA 4BR1A 4MZ1A 2DZSA 3UWZA 1RR2A 3LHUA 3HB9A 5FF3A 4EIVA 3P61A 3R2GA 5FEZA 1NVMA 4JS3A 3UWWA 3W1LA 2YW3A 3KAOA 1XBZA 4QNEA 1HG3A 3Q2DA 4GJ1A 3N73A 1M7OA 1NEYA 2FPTA 1Q3NA 4O54A 3W1UA 3W1MA 3TSDA 1DOSA 2FB2A 4HN4A 4IPJA 3GK0A 1OABA 2VFHA 4AF0B 4Z0JA 5IBXC 5LSMA 4FO4A 3PUEA 2C14A 3TKFA 1VHNA 1YLVA 2FPVA 2VC6A 4AF0A 1GVQA 1JULA 1QOQA 1PHQA 3BW3A 4JTSA 1O60A 4KWWA 5AHFA 2X1SA 3BG3A 3NAVA 1GTEA 4M7TA 1GYNA 1PV8A 2Y61A 3CEUA 3VFLA 3W1PA 2C18A 4MOZA 3TC6A 3B04A 3V75A 1QFEA 4IMGA 2XN1A 5EBUA 4IMFA 3UZ5A 2FTPA 2R94A 3HQ1A 5DXXA 1TQJA 5TBOA 3NL3A 1YDNA 1D9EA 3UY7A 4N9DA 3N3MA 3UWVA 1QAPA 8TIMA 4AVFA 4ONVA 2Z6IA 2Y63A 1QPNA 3C8FA 4Y8FA 2Y6ZA 3M41A 4GWEA 3DZ1A 4KFNA 5D03A 2VKZG 3NPXA 4PL1A 3IRDA 2V2CA 3W2UA 2QCNA 4IJBA 1XKYA 1OK6A 1WYIA 1R2RA 3D0CA 2NUWA 5K9CA 1VYRA 5AYXA 4O50A 3LRMA 5EKYA 1SQ7A 3RLVA 1B3OA 1Q45A 3MO7A 4FF7A 3TIMA 3PVFA 2IQTA 2R14A 1WOBA 1VCFA 2YFNA 1RQHA 3FA5A 2D73A 3W7KA 1KFJA 5FF2A 7TIMA 3HGOA 3N2MA 4JNMA 5IM51 4K37A 2ZRWA 3TXVA 1VYSX 5AHIA 3P5ZA 1K3UA 3ATZA 4UMAA 1EP3A 3CM4A 4RZ6A 4O4VA 1OK4A 2E68A 1VHCA 5L9FA 1G4PA 2QCDB 1DJNA 4Q32A 1P5BA 4IWWA 2E5BA 4O53A 1TREA 3P8IA 1GEQA 1XC4A 4AHPA 3I68A 1Q6OA 3HIJA 3NQAA 3E02A 2NWSA 5D05A 3T55A 1A53A 4U28A 3CT7A 3TU9A 3QQ1A 4FNQA 1L2UA 1XBVA 1W54A 2A5HA 3P67A 4QISA 2OJPA 4H3DA 3S0CA 3U6WA 1LLWA 1I2NA 3IGUA 2X30A 2A21A 3MYOA 4O1CA 5HUOA 2DU2A 4UTTA 4WOZA 1R46A 3KRZA 1WBHA 2ALDA 1C29A 4OE7A 1Y0EA 1A5SA 4PODA 2YYTA 3LCXA 3QC3A 1VPXA 5HJLA 3RMJA 4GRSA 1XFBA 3BW4A 5DLCA 3E96A 3KXQA 1LOSA 4DXVA 3W07A 1ZENA 2CZ5A 4TMCA 2J27A 2YDAA 5K4ZA 4AWUA 2DJLA 3I65A 4HPXA 3GYEA 1F2JA 2V81A 1BTMA 4I7WA 2Q3RA 1ADOA 3LB0A 4IMDA 4MJZA 2GVGA 2ZQ0A 1K7FA 3GX9A 3C4UA 3EX1A 3EXSA 1ZJIA 4JIPA 1HTIA 1MXSA 1X1ZA 3G0XA 1JVNA 3SECA 3WJYA 2A2IA 4RCXA 4UIOA 1UUOA 4M7SA 1VLWA 4FX7A 4JTUA 3E49A 3M9YA 3GR8A 3Q94A 4JTGA 1K8XA 4P61A 4DO4A 3OEXA 1SO5A 1XUUA 3BVJA 2CLLA 1GTHA 4O12A 3RU6A 1WX0A 1TQXA 3UNDA 3L5AA 2YSWA 3W73A 4PH6A 2FB3A 4IQLA 1IIGA 4RZ4A 3W2JA 5C54A 3RF9A 2V8ZA 4YLWA 1BWKA 1JCXA 4ZQNA 4O13A 4MY1A 1QPQA 1NF0A 4FX6M 5D32A 3EWZA 1KW1A 1LOLA 1OFBA 3LLDA 1W8SA 1MEIA 3F1QA 4DF1A 3C2VA 5CG7A 3TDFA 3GR7A 3L66A 4WJEA 3QSTA 3GNNA 3NQGA 1G4SA 1VCVA 4E0CA 3NQ2A 3MHFA 3WK2A 4FIQA 3HPSA 5G4EA 5CZTA 1YTEA 4NNAA 3FS2A 3DAQA 4EOUA 3G0SA 5EL1A 3MI2A 3O05A 3W84A 2J9YA 2RKXA 3ABOA 3G24A 1FWNA 1OYAA 3KFTA 3NL2A 2RH9A 2QKFA 2WSYA 5AHMA 3P8JA 5CPOA 2WQPA 4NU7A 3LHZA 3NZRA 3ZWSA 3L0KA 5D2XA 4KWVA 4N4PA 4P2VA 1TCDA 4CQ8A 3DKLA 1VCGA 1KM0A 3N14A 1THFD 4ORMA 1JQXA 5D33A 2E6AA 3W7HA 4U4MA 2TRSA 4RXFA 1VZWA 2A7NA 4MY8A 3H54A 1A5BA 3BG9A 4NXSA 3N19B 2J6XA 1I4NA 2YFOA 1VLIA 3NEVA 4UUIA 3W2MA 1L9WA 2G97A 3W87A 1TV8A 4YXGA 4MYXA 1SZGA 3P5YA 1SO4A 4WUIA 1W5OA 1W0MA 3NOEA 4JTTA 2WO5A 5TQLA 1AMKA 3LI0A 3MI6A 5FESA 4RZ5A 3G0UA 2CWNA 3TK7A 1TTIA 5AOUA 3EX6A 3W7CA 1OHLA 5D04C 4X22A 3TJXA 1J4EA 2DZWA 2FIQA 1R2TA 1B4EA 2QDGA 5U7SA 2Y7FA 4RJEA 3W7QA 1LZOA 2ZZ7A 4CNNA 2GQ8A 2UV8G 3TFCA 4KFOA 4OV9A 4UXDA 5BRBA 4IUOA 2EKCA 4UTTC 4Y6GA 2VOMA 1GVFA 2X2GA 1TTPA 5A5WA 5G2IA 4AB4A 3W71A 4Z0SA 3C3NA 1TYGA 5DY3A 1F6PA 4JDYA 4C1LA 3M7WA 2A0NA 4UFIA 1K02A 5BW6A 4ZQPA 3SGUA 2ZZ5A 4M6QA 4YWIA 2ZA3A 4O10A 4MLRA 1EWEA 2QR6A 2WSQA 1H51A 3HPZA 3E12A 3NDOA 1W37A 3KVKA 3PM6A 1AL8A 1W5PA 3TJLA
chains in the Genus database with same CATH superfamily
4R7WA 5M17A 2OKTA 3PJUA 4G5DA 1EHNA 4O1DA 2D0GA 1MYRA 3AICA 3S2MA 2XUCA 1FHVA 1P6WA 4K7YA 2BY0A 2QPUA 3P7YA 2FGBA 4KGJA 2C19A 3U48A 1W91A 1JQVA 3MWAA 4Q4PA 1SW7A 2DEPA 2ZXAA 2PSNA 1Q63A 1E4MM 3QPEA 4P8VA 4ZSTA 3EGJA 4IPPA 2RGLA 3NQFA 4Q6XA 4NX5A 2ADAA 3O07A 4H1ZA 1IEWA 4J4KA 1RK5A 4MZYA 2DV0A 7ENLA 1K1DA 1E9YB 3E1F1 2H8XA 5I06A 3C0JA 3SQMA 3EKLA 1XXXA 2NLYA 1PIIA 2JF6A 3FLUA 1YNPA 3WDHA 5I00A 1AW2A 2OZ3A 3QJAA 5D2TA 3GXPA 2QV5A 3NNTA 3A3WA 4IL0A 1VBGA 2YXXA 3NQCA 4PSRA 1DV7A 3LUTA 2PTZA 1SSDA 2DORA 2XINA 3C6CA 3VE9A 4XZIA 3TC7A 5J5DA 3WF4A 1A5CA 2W66A 5ABFB 1V02E 3L2IA 4H6KA 3ITLA 2VEMA 4OWGA 5HMFA 1RA5A 4GMEA 1IEVA 4PEKA 1SJBA 1IGSA 1G6CA 2VEFA 5CPNA 3MMUA 3B0YA 1CXLA 1FKXA 2YXOA 4LXFA 4MB1A 1F5ZA 2IS7A 2PS2A 3GFXA 4IMAA 5CC7A 5HQMA 4ILSA 3TTSA 1H7XA 2XFRA 4IP7A 1HXJA 3S9ZA 4D6EA 4O15A 1X96A 4QG6A 3TWAA 2DH2A 3XINA 4TU1A 1SW0A 3N1AA 2E8YA 2GQAA 4W8BA 3VC6A 4B2DA 2PLKA 4DF2A 3TR2A 4G8TA 4AAJA 3AS0A 1E9IA 3CL7A 4Z1DA 3B06A 1MMFA 1POKA 3BCFA 3PZOA 3R5EA 2ISVA 3E2SA 3KRUA 4F48A 4KPLA 4F0SA 4NXKA 1OINA 2VM8A 1XUZA 4XZ9A 2H9AA 3NVTA 4LWWA 4PN2A 1PL9A 3EB4A 3W9ZA 3ORWA 3N6QA 1EXBA 1QJWA 2X7WA 4XIAA 1EWDA 3QMRA 1D2KA 3HM7A 4HB7A 3B8UA 1UD2A 1PZ2A 3GHSA 1AJ2A 1RZMA 2GUUA 3CIWA 3UZWA 1LG2A 2PWVA 4W87A 1FBAA 1XINA 1NWRA 4F9DA 3AHXA 2VFIA 2Z7GA 2GJRA 4CQ9A 1SZFA 4IPLA 4NVTA 3OBEA 5BCAA 3GSMA 4H7VA 3F5LA 2W67A 3H2AA 1TX2A 2VC5A 1AH0A 2PDBA 1ME7A 3SCWA 3WNMA 2GJPA 4YNGA 2PODA 2D23A 3KHJA 4ERGA 2LLEA 4XD4A 5CSSA 2OWXA 1WKDA 2FVKA 3DBPA 4CU6A 2CCRA 4LY4A 4DPPA 4GD0A 1E0UA 2GPTA 1KM4A 2G3IA 5FEXA 4BWLA 4N4QA 3LHWA 2EPHA 1KFBA 1K4GA 4EPDC 3BXWA 4J2MA 1J96A 3L68A 1KM2A 1JXJA 1WUFA 1JI1A 3SUSA 4EE9A 4IXHA 1YXDA 3W7RA 2H3DA 2YR1A 3BLKA 1BHGA 3RPMA 5ABGA 3W0KA 3UPWA 3KEHA 1R2SA 1EA9C 1LLZA 4M3PA 4XSMA 2DZPA 1K8ZA 3VNDA 4B92A 4NY2A 2WANA 4FAMA 5CQ1A 5GQBA 2JKPA 4LUIA 4NYUA 4WEVX 3N9SA 2PMQA 5AECA 3TLLA 1MI3A 1FRBA 2AGKA 4A2SA 1UG6A 4MB5A 2YDRA 5LHFA 2PB1A 1F6KA 1GYLA 3LGGA 4NJHA 5XIMA 3LZ3A 2IW0A 2HVNA 3MS8A 1FHDA 1WXYA 1UYQA 1DHPA 4CD7A 3CUJA 3SFKA 4GIAA 3AJXA 4HKPA 3W1XA 5T91A 4E4UA 3CJPA 1UB3A 3O06A 3UYCA 1C9DA 1SR9A 1GWJA 2V5JA 1A80A 3PBVA 3VZXA 2YL8A 3ONBA 2TPSA 3GIPA 1KV8A 1X1OA 1OFOA 1ITUA 3UP8A 1EX5A 3JS3A 4XO6A 3SW6A 1EOMA 1H62A 2QVHA 4IIFA 3WF2A 4PUNA 2V5DA 2GK1B 5CZJA 2WHJA 4HPNA 2V5BA 4OT7A 1DVJA 1AFSA 1PX4A 2X0SA 4GGBA 1LUCB 3LQLA 2V9DA 4GVHA 2B31A 2GGHA 4HMCA 4W88A 1XKJA 1DJWA 2G4JA 4Z2IA 1E6QM 2DPEA 1E3XA 2VJXA 1QPRA 4YVXA 4TO8A 3N3TA 5JBEA 2EPLX 3MVIA 3HG5A 2J9ZA 1FWDC 4H2HA 4IZGA 2QCCA 2ZUSA 1LM1A 4UR7A 4DWSA 3HPAA 1SMDA 4Q8QA 3SR7A 3LMYA 3SZ8A 3AJ7A 3HJZA 3W72A 4X9YA 4LW7A 1GYMA 3E0FA 2R8WA 1JI2A 2W79A 3KZPA 4O0QA 1DTUA 1W9XA 1LBMA 1SFLA 1WDWA 2E1WA 4H4IA 1KWGA 3TSMA 2CLIA 1J0IA 6TAAA 1FFQA 4MWAC 1T8XA 2IKHA 1M7XA 3T09A 5I02A 3JZEA 4NJGA 2PDPA 3TEVA 4IT1A 1XLLA 2P53A 1GT8A 1J2BA 2CKRA 1I75A 1CGTA 3LCWA 4D6JA 4JD4A 1A5MC 1I2OA 4RNHA 2VXNA 2YKKA 3KHDA 1H41A 4HN8A 1TKKA 3GB6A 3UJEA 3H2CA 4WGHA 4WIWA 3W76A 1VENA 4OBTA 3VAVA 2EGZA 4R7JA 1DKWA 2B7QA 1EJXC 4YTSA 3JZUA 5AN7A 3GZ3A 2YCEA 3GHUA 3PUGA 3H26A 3BAKA 3LCLA 1KCKA 2BVWA 2RFGA 1M6JA 2DZBA 1GZ1A 1X39A 1AQMA 3TN5A 4NZFA 1XIHA 1JXKA 1PWMA 2O7SA 3BANA 1CB2A 3MB9A 3CQIA 1E71M 1H3GA 1H5VA 3G3MA 5H91A 2YBUA 4F66A 3SIZA 4FEZA 1TIMA 5GJMA 3WKZA 2GQ9A 4XZBA 2ON3A 1CEOA 4CN6A 4HHPA 2OWCA 1DXEA 1FFRA 3FY1A 3W38A 1TELA 5ABHA 3W75A 4JTEA 3TAOA 1NWUA 3ANVA 2FH8A 4LYPA 3CUIA 5HMEA 4AHQA 4J27A 1MZRA 2AMGA 3F2BA 1ONEA 4PUJA 2F7FA 3OW1A 4O8RA 3NA8A 4X60A 3KDOA 1Q6RA 3LTPA 1Z3NA 3ARRA 3MCNA 1E9ZB 1VH7A 4UTWC 3I7SA 5DO8A 3A9IA 4JYDA 4PBGA 3WMSA 1XBXA 1DL3A 1E6RA 2QJGA 4YWSA 3WH8A 1XLAA 8CGTA 1OFEA 4GCXA 2NX1A 4LUSB 3EPMA 3RM9A 1R5YA 3ITTA 4TIMA 4JIHA 3H53A 3PY2A 1DWAM 3AHZA 1EDGA 1VF8A 1FWRA 4XUYA 5DBTA 1TA3B 2WZTA 1OFAA 1DP0A 2Y7GA 3RK8A 1KRCC 2PDWA 1HJSA 1OVDA 3EWYA 4JTJA 5EY5A 1BGGA 2V63A 3GDRA 1F3TA 4BQ5A 3UR5A 1EF2A 1US0A 2UBPC 1J79A 3S5NA 1KWKA 1KFLA 3I7RA 1W56A 2QPXA 4KWOA 2OEKA 4AX7A 4REQA 3UXAA 1EQPA 3KRBA 1UD8A 9CGTA 3SY8A 1A50A 2DVTA 1NJJA 1TPUA 1WZAA 4V33A 4V1YA 3ARZA 3DN5A 4JBRA 4WDXA 3V35A 5HK4A 3L67A 3EPOA 3WLKX 4E4PA 5EMUA 5C70A 2A3EA 5FACA 3UVAA 4ADTA 3WLPA 3W2KA 3M6YA 3QPZA 1DORA 3M0MA 3P84A 3IWPA 4CU7A 1PIFA 3HO8A 1V93A 5HNRA 2INFA 2Z1VA 3ES7A 4QJ1A 4JAWA 4ASTA 4PTXA 1U33A 4ZMGA 3WIJA 2ZRXA 1KRBC 1OFRA 5A6BD 1OX4A 6CGTA 1PAMA 3FXGA 3UU0A 1J0JA 1LWHA 4QG9A 1YYAA 4HSHA 4Q8MA 2J7CA 4AEFA 3GKAA 3WX7A 1AA1B 4D71A 1B9BA 3N6JA 4GNVA 3W1TA 1EBGA 4HYWA 1YBQA 5M2FX 3MMWA 3WFLA 4C7FA 4IFKB 1OSEA 1AG1O 2H3BA 1E1EA 3ERPA 3V18A 3VE7A 4FK9A 4UFHA 3W00A 3N2BA 1KM5A 3C52A 4NZ5A 1Q4NX 5DF0A 2ZX9A 3FSTA 4K39A 3PULA 4AC7C 5A8NA 3KBNA 3BUVA 1W5NA 4YTRA 3GAYA 1NOUA 4NX0A 1RBLA 4EP8C 4N0RA 3VZYA 2FDMA 5EMMA 4EAMA 4GCAA 5CXPA 3KLLA 4S3CA 2D69A 1VC4A 2YBVA 3T40A 4WX2A 3AYSA 1GEHA 2ESCA 4PCNA 3W70A 4DIAA 1R47A 1KD0A 2UY2A 4AC1X 3LBMA 1SFJA 1D8WA 2QAPA 2CERA 5CGMA 3VKAA 3WD4A 1UMLA 4KWSA 1M1BA 1JAKA 1AVAA 3MWCA 2RUSA 3CYJA 5FCZA 3W6YA 1ONRA 3FSUA 4UC5A 4QBXA 4CCZA 1XG3A 4QAWA 2WOQA 1FCUA 2V67A 4DO6A 1JUEA 1A3WA 3VDGA 3W22A 4Z1AA 2FTWA 4L4OA 5EB8A 3S4TA 1W3IA 3OJGA 3NQ8A 4N9CA 4LQ1A 3W3OA 1UR0A 3UG4A 1YPFA 4C7GA 1WO2A 5D9OA 5K4XA 1G67A 1SUXA 3OVRA 3HMJG 3R79A 1O4UA 4NRSA 2I1OA 1ADSA 4PCSA 2Y70A 4XUGA 1SYTA 1XF0A 1W3TA 5CCZA 1P4CA 5G2WA 1X6UA 1QNPA 3NQ7A 3GXDA 4BEQA 4GX8A 2PWDA 3DG6A 2GJLA 4QCFA 1PX3A 4X0NA 1CXIA 3RPTA 4YCOA 4KBXA 1GNXA 2HK1A 4BF7A 3WJXA 3G1VA 3II1A 3P60A 3CGTA 1Q6QA 3QV7A 1N8IA 5TD4A 3UPBA 3DENA 2NV9A 4XB3A 3SFWA 4J35A 1I8JA 1BF2A 4Q7IA 4UFLA 3DGRA 3ZVHB 2AKMA 3QLLA 1EJUC 3QYQA 1AQFA 3WDRA 4DM2A 5BZAA 3OYXA 4WY0F 2P88A 1YDYA 3QZ6A 4DPQA 3PC0A 2J24A 3SUTA 4L4MA 2CZFA 1AZ1A 4EF9A 2CXEA 4I5RA 3AU6A 1FCBA 4FLOA 4NNCA 4J3XA 2NUYA 3VDCA 3QM3A 1AH4A 4JX5A 1WAWA 5EBAA 3IVTA 4AY7A 4ZE4A 4C65A 4QDWA 3L5LA 3IIVA 1OZMA 4CCEA 3FYOA 4ZO7A 2V2HA 1ZGDA 1F4AA 4DUXA 2Y88A 3UY8A 4UBPC 2O9TA 1EDQA 1UH3A 3MSYA 3T44A 2BVYA 4GH1A 1WUEA 1KXQA 3S6TA 5F2IA 5FJRA 1CXEA 1JPDX 2ZVIA 3IGSA 5G4WA 1UJPA 3I6TA 2B4GA 1GW1A 1T7LA 4UMBA 5CPQA 2WK2A 3HGRA 3BOLA 4MJMA 3RX4A 1HKVA 2CZEA 3EEGA 5CBJA 4QQ3A 4UTMA 5DT7A 1Y65A 3WQFA 2TSYA 3OIXA 2YL9A 3VNIA 2E0PA 5TIMA 3UEQA 4YL2A 1BVNP 5LNSA 5BMXA 4H2CA 3CHFA 4W89A 2X1RA 3FXYA 4N42A 4S2CA 3CQHA 3DECA 1L8PA 3Q37A 4DELA 4WOQA 1Z42A 1T41A 3WFAA 1A0EA 2J4GA 4AMAA 1FWFC 4H9MA 1UWTA 1H1NA 3THDA 3EMCA 1QI0A 4EXQA 3VGBA 3WLTA 2CHOA 4Z2KA 1QVBA 2JGYA 4DJDC 4LBSA 5L6UA 1AW5A 4O52A 1UPMB 3IANA 1KM1A 2V3EA 1C8YA 3TNOA 1CW2A 3RN6A 5IDIA 1JCMP 5GNXA 4H41A 8XIAA 3AXIA 3B4UA 3L9CA 5E09A 4D6DA 4A8NA 1S39A 2Q3OA 2QLYA 3GNOA 3OVQA 1CZ1A 5A6BA 4GXMA 1ME9A 2X0HA 3GFZA 3NDZA 1T6MA 1A3HA 1H11A 1P0BA 4UNKA 3WD0A 3F5JA 4XSLA 1V3HA 4EACA 2P10A 4LAKA 1OT1A 3TMQA 5F4WA 5CAHA 3T6CA 4L5ZA 3RX3A 2VEIA 1OG0A 3GWQA 3HG2A 4JHOA 4CD6A 4O0KA 3TWBA 1W1B1 1RP9A 3BJFA 4XZMX 3KP1A 2AMXA 5H1WA 3VD5A 4JIRA 4M6UA 1W8GA 4Q8PA 1PIGA 1Q6CA 3CQKA 4P7RA 1W9PA 3WLNA 2C16A 1ZNNA 5E0FA 2PDUA 3VINA 4FIRA 2RHGA 3GIQA 1ZPTA 1TMLA 4XVEA 2W63A 4QX4A 3U4FA 1PHWA 3HQPA 1B54A 3IIXA 3WDQA 1XBYA 2XYLA 5FJPA 1BAGA 7PTDA 4DNMA 3EWWA 3DOPA 1FWCC 3BE7A 1QO2A 3E0VA 3PZQA 5E5CA 3CWOX 5JUVA 4WKHA 4NJJA 4JKLA 4HNNA 5XIAA 1D7FA 1FWTA 3TQVA 2Z27A 4AW7A 2A1YA 4B3ZA 3OGVA 3CL6A 5F2MA 2PCQA 3NM1A 3ANUA 1H63A 1Z44A 4V28A 5BU6A 3HF3A 2YCJA 1NDWA 4J3TA 4LVFA 1AZ2A 1L0PA 2E1DA 1RQBA 3MP3A 5KZEA 4S3AA 3OVGA 1F8MA 4MKSA 1GJPA 1Z9AA 4FNUA 1QUMA 1TJRA 1BLIA 3HA1A 5H8MA 2GVEA 3PTQA 3A5VA 1C9WA 4IIDA 4TVDA 3KM8A 4BI7A 4GQRA 4TOQA 3RMEA 1C90A 4JFWA 1PUDA 3P6LA 3M0LA 2ANUA 4YTUA 3UPMA 1QPKA 1GVRA 3ONCA 1VPYA 1LOQA 3AIWA 1HN1A 5B7ZA 2FZ8A 2ATMA 1VEMA 4CQDA 4QHRA 2HISA 4NZJA 1KFEA 1G4EA 3LQGA 1IF2A 4K8HA 1B3YA 5REQB 1U83A 5J04A 3EX4A 3MQTA 3OGSA 1XYLA 2DT3A 3HG4A 1CB7B 3SY5A 3FGCB 3PFRA 1UC5A 3A23A 2PGFA 3GAKA 1NFPA 3ALGA 1B3VA 4LFYA 1CIUA 2QJIA 3T7VA 3WBWA 3PBGA 2FLIA 1F3XA 2D0HA 3GFYA 1HO4A 2Y2WA 4YU1A 2QS8A 5D2VA 3IV3A 3ZJKA 3BURA 3CPRA 4PC8A 3NG3A 1LRNA 2I7GA 2JK2A 4HNVA 4ADSA 3VIOA 5G1TA 5G2HA 4LV9A 1JZ2A 4BZYA 2CPUA 4K6AA 5F4XA 2E67A 2VDHA 2R1KA 5FJTA 3QQ0A 1V8EA 1REQA 3CWNA 1DIKA 4P8UA 2GGEA 2CESA 3TTEA 3WL0A 2VEKA 4HOWA 3N34A 5D02A 1B9ZA 2QGYA 2DT2A 3WF0A 3NPWA 1E1CB 1MQRA 5HULA 1S5TA 4G9PA 3MKVA 3LA4A 4HNCA 3U4AA 5EFDA 3A24A 4B5NA 3G5EA 2V6AA 3TR9A 3U7VA 2Y7DA 1ZQ5A 4TTUA 3LHUA 2EXOA 3AU2A 1E4LA 3P61A 3PZIA 3AIQA 1NVMA 4ICCX 1CLXA 1TX0A 2G41A 3UWWA 3VPLA 1JPHA 1HKWA 4KEVA 2YW3A 3D3AA 3WLMA 3E3HA 4QXIA 1DJXA 5AC5A 4QNEA 2ZDSA 1US2A 3OGRA 3OLIA 2I57A 3VXGA 3W29A 4O54A 3W1MA 3K1DA 3CYVA 3QN3A 5C9UA 2Z2AA 1OABA 4AF0B 1CXHA 3PPHA 3SY1A 4QJ5B 3POHA 5LSMA 2VD9A 3GVVA 4GI6A 3TKFA 1QOXA 2B81A 1XYBA 1YLVA 2VC6A 3E2VA 1ELSA 3PN8A 5A6SA 3H7UA 4BCEA 1JULA 5BOEA 1PHQA 4XZHA 4MNJA 1O60A 3OG2A 4PBFA 1G01A 3BG3A 2BVDA 4M7TA 1EXPA 3TC6A 3B04A 3V75A 4IMGA 8RUCA 2YJQA 4IMFA 3HQ1A 3SCRA 3I4EA 3NL3A 3RO6A 1D9EA 4AD0A 3F5KA 1BKHA 3QTGA 2AAAA 1NQKA 1BGAA 2XISA 5A8OA 2A79A 3DZ1A 5D03A 3SJNA 2XGIA 2VKZG 4PL1A 4M8UA 2ZVRA 4IJBA 3B8IA 1A47A 3G6LA 2GGIA 1XLJA 4HK6A 1H0GA 2WLZA 5AYXA 5EKYA 1SQ7A 1KXVA 2VQUA 4B16A 2NW0A 1EDTA 3MO7A 4L9ZA 2DIKA 3RYSA 3TIMA 4D6IA 5HJYA 2D2OA 2IQTA 2R14A 2XZ9A 5MKGA 1W2PA 3EOOA 1H09A 4QROA 1KFJA 5FF2A 7TIMA 4JNMA 1RCXB 4R9XA 1C7SA 3W53A 1YKWA 1WKYA 1VYSX 2X09A 4X0VA 5AHIA 5KEZA 2YLLA 3ITCA 4WR3A 1OK4A 5L9FA 2BY2A 1RSCA 3CT2A 1XYZA 3SCPA 1UIOA 4Q32A 2ZE0A 3W26A 4QCEA 4ZOAA 1TREA 3P8IA 2J7BA 1XP3A 4JHMA 1E6ZA 4C6JA 4ZBCA 4B5UA 4LJ3A 3WLRA 2P8CA 1RPKA 3W81A 3TU9A 1E56A 4ERAA 1W54A 1XISA 1CDGA 2QT3A 3AISA 4X61A 2DU2A 1Q5MA 3KRZA 1WBHA 4NASA 1P7TA 1TMQA 1C29A 4OE7A 2PDCA 1Y0EA 2NT1A 4GLEA 1A5SA 4FLQA 3RMJA 4GRSA 4KGLA 1XH1A 4KT2A 4DXVA 4TMCA 2J27A 3WQCA 5AZ1A 1WPCA 4IH3A 3RCMA 3ZMRA 2V81A 4WSJA 2Q3RA 3GM8A 3VMOA 1ADOA 3LB0A 2QIWA 3EX1A 2FZ9A 1ZLPA 4MJ4A 1VEOA 3WEZA 1UP0A 3SECA 2IKJA 4RCXA 1HW6A 3IUIA 4UIOA 1MW1A 4EPBC 4JTUA 3OHMB 4GY7A 2QXWA 4LALA 4P61A 1RA0A 2RDXA 3ZQ9A 3OEXA 2Z1KA 4HZ8A 2EG8A 4EAYA 3VIGA 4J3UA 2YSWA 3W73A 4PH6A 4EK7A 1EOKA 2R1PA 5GJNA 2W4XA 1S2UA 4RZ4A 5C2CA 3W2JA 2EPNA 3MVTA 4O13A 3R6IA 4IP4A 3EWZA 2BOGX 1WDSA 1OFBA 3TYDA 3F1QA 1MEIA 1TJ2A 2NQHA 3SQLA 4PMNA 4WJEA 3REQB 3QSTA 3NQGA 1G4SA 3CUHA 4C6BA 3PZMA 3WUEA 3R94A 1EC9A 1WB0A 5G4EA 1KC7A 3UVIA 4PMOA 2W62A 3W84A 3WQOA 2J9YA 3MZNA 4QRNA 1V03A 3APGA 4U33A 3KFTA 1OYAA 5BRPA 2RH9A 3K4WA 4R88A 3ZO9A 2PTWA 4RPPA 2I56A 4DB7A 1IZCA 2OOFA 1U5VA 1TCDA 2J7EA 4LANA 4CVUA 4CQ8A 5AZ0A 4TTGA 3N11A 4M0XA 3VDBA 2EG7A 1RVKA 4KEZA 4HCLA 1PZ0A 5BRQA 3PPFA 4HZMA 2E6AA 4D8ZA 3L7RA 1H2JA 4RXFA 2FTYA 1D8CA 3RXZA 1OQFA 3BOFA 3W2MA 1VLIA 3EA1A 1LJYA 2O55A 3W87A 2JQXA 4YXGA 4S3DA 3P5YA 1XFCA 1M7JA 2AL2A 2ZWYA 1SO4A 3I3DA 3QR1A 4WUIA 4OUIA 5DT5A 5BU9A 2YCIX 1V6WA 1QT1A 4RZ5A 3PJTA 3IUDA 1C3FA 3ZT5A 3TJXA 4X22A 5HANA 2FIQA 4QE4A 2QDDA 3QYSA 2BHYA 4PTMA 2ZZ7A 2GQ8A 3HPFA 2VGBA 4DI9A 3TFCA 1R3YA 4DLFA 1W17A 3VYLA 2QW5A 3NGFA 3AAMA 2IPWA 3W71A 4Z0SA 3VOCA 2V38A 5A95A 1C7TA 2A0NA 1K02A 4GG9A 5BW6A 3SGUA 4D6FA 1O1ZA 1UD5A 3PFMA 4O10A 2IXUA 2Y8VA 1H51A 1RBOB 3NDOA 1AL8A 4QJ4B 4D1IA 4V15A 1BYBA 3KOYA 4IXXA 1W9UA 1XI3A 4KEMA 4PRWA 3BSMA 2HRWA 3T4CA 3S1WA 1JDFA 2XM2A 4MJ2A 4GNJA 4LAUA 4X2RA 1Y8BA 4ZGYA 1OCNA 4DVOA 3VGHA 3K13A 4I8YA 2J47A 4DJFD 2PDKA 1FHUA 2EPMX 3FN9A 2ZTJA 1KGXA 3S1XA 1DBTA 1J6OA 4NZ3A 3H4XA 3MC5A 4IFRA 5A2BA 4S3EA 4JTFA 1KV5A 3EPNA 4NKCA 2WHMA 3THQA 3W28A 3IJ6A 2QVNA 4IG2A 4BQ2A 1ML1A 3L21A 4FXRA 1IQ8A 1EYEA 3SCOA 1W1VA 3EB2A 5MF5A 4A29A 4WCJA 4AWTA 4PCFA 4ZO8A 1OM0A 5G1MA 2IKIA 1EJWC 4JTDA 4FMVA 3H2FA 4FX8A 1FVPA 1KTCA 1C8XA 2P0IA 4A3HA 4I9JA 2JBMA 3GHRA 1OEPA 2WPBA 2GDUA 2DFAA 1SO6A 4RKAA 3OOQA 5B7YA 5IXEA 4Q4KA 2QGHA 4E3VA 4K8EA 1PCKA 1F61A 2HE5A 5ABFA 3VD7A 3N4FA 4D72A 1RBAA 2D0FA 3KTCA 2DW6A 3CMFA 4I9TA 1V3JA 3LXAA 2PTYA 4EVZA 1U1HA 5HJXA 3BARA 4X9SA 3F4VA 4RPQA 1IT7A 1HKKA 4GYFA 1ZS2A 1ZJHA 2CLEA 1KO0A 3QGVA 1BQGA 4F2TA 4PTVA 1F73A 3OU8A 4JXCA 4JY8A 4F0HA 1KFKA 3KOZA 1R9ZA 3QY8A 3V3WA 1AD1A 2NV1A 4GI8A 1XCWA 3F4CA 1V6YA 4AD4A 2AOSA 4KCUA 2GSHA 2PC8A 2BLEA 1V3LA 2G5WA 3QV9A 1PKLA 1ZHAA 2CFFA 5H8PA 3M0HA 1YDVA 4B3KA 4WF7A 4PUUA 4YHGA 3MZ2A 3S83A 2D1ZA 4HK7A 3CQJA 2VCCA 4URIA 1BYCA 2PE4A 3UJRA 1JUBA 3ABSA 1UA3A 1U1JA 4HJWA 4NP7A 3IIPA 1SVDA 4C6QA 2I17A 3RU8X 1PZ1A 3W02A 4EPKA 1XV8A 1UOKA 2WXDM 2CU0A 1UR1A 2YPIA 3UG3A 3EOEA 1N82A 1VR6A 2F2KA 2FZMA 4ACZA 1WE5A 3WNLA 3RUBL 2O9OA 3I6RA 1VJSA 1ZAJA 3UQNA 4C1NB 3SQSA 5E1QA 3ZIZA 4NZCA 1IT8A 3GS6A 4H9VA 3ENLA 4L6DA 2V3GA 3A5FA 3WBYA 3GNXA 3P2VA 4PGLA 5FI8A 2CETA 1J2WA 4LVAA 1JCYA 3RFAA 1V3MA 3H2OA 5C2XA 1OT2A 1R3SA 2KAUC 5B80A 3WH9A 5EU9A 3S42A 1YXYA 3UWEA 1MO0A 4WD0A 5A94A 3SBFA 3CC1A 3VOIA 3HQOA 4RZBA 1J18A 4DO7A 1ZSXA 6ENLA 2CIPA 3HMCA 4AIEA 1YQ2A 3PPGA 3FDGA 4ZA0A 3W6MA 4JTIA 1FCQA 5HUPA 4BF9A 3NO1A 1OG6A 2ONEA 5HINA 3PG9A 1EKOA 3B8VA 4MIMA 1A4LA 1J10A 4BFAA 5EYWA 4IIGA 1IE7C 3TROA 1G4TA 3BLOA 4MADA 2FHFA 2HNHA 3QSRA 3PBUA 3FDKA 1MNZA 4PUKA 4F0MA 1XIJA 2GOUA 3VMNA 1NF7A 2VENA 3RM8A 3C0QA 1JJKA 4NZ1A 4O57A 1B0IA 1J11A 3UGVA 2DSVA 3SJ3A 1LL6A 3CPGA 5D38A 5IHRA 3ABRA 1KR0A 4Z2HA 3O3RA 3OQEA 3TJ4A 1GKPA 1BPLB 4V1XA 4G1NA 1YEYA 3VZZA 2Y7EA 2PBOA 2W6RA 4B5WA 4OGZA 3RDKA 4W93A 5C2GA 1AD4A 3MHUA 3OB8A 1L6SA 1XM3A 5A6KA 4JN7A 3LCHA 4DXXA 5M3WA 4UQBA 3OPSA 4NSBA 3MJYA 3M0JA 2GVJA 4B90A 1JZ4A 4HSNA 4Y9PA 1E0TA 1SGJA 3COTA 4Q4RA 1E43A 1FWIC 4S38A 2FHCA 2VCAA 3IEBA 4WDTA 3TTOA 4Y96A 2E77A 2E8ZA 1IWBA 3NXFA 4L4PA 2HS6A 4DJFA 5HXMA 2HDJA 5BWFA 3LHYA 3NZ1A 2EJ1A 2XN2A 3V36A 3WLJA 4F9JA 5CJMA 4HBKA 2B7PA 1JDDA 3UBPC 2VX5A 3NIYA 3XIMA 3UG8A 1RJRA 4JTLA 5DQPA 4OVXA 2WCAA 2WKJA 1MZHA 3NQEA 4MUZA 1KQZA 3BK0A 2QDEA 3QW3A 4J1OA 3N4EA 2RJGA 3R58A 4GBDA 5FKYA 2WW5A 3GU9A 3AHYA 2PF8A 2HS8A 4GOAA 2XH7A 1XDMA 2OLHA 3PP7A 1TO3A 3HPXA 2XVGA 2OSWA 2QUNA 1EPXA 3UCCA 3W7IA 4Q8UA 3BMWA 3BV7A 3NSXA 4GVGA 4I9MA 2WLYA 4S3GA 2PP3A 1RJQA 3QRHA 2ZUUA 3CAVA 3KBMA 3FYPA 4WSKA 3AHTA 3Q4DA 1OYBA 5HNTA 5CC6A 4A22A 5E6YA 2A6NA 3CLMA 3MY9A 4XO7A 5F1VA 4AUBA 2XIIA 5CPTA 3L4YA 1KXHA 3EB3A 2YZ5A 3EX3A 4FZIA 3S2CA 1H50A 1H7PA 3DXIA 4O1AA 4IMCA 5JIWA 3LXBA 1MW3A 2V69A 1HFBA 1E5JA 1ODUA 2X0YA 3B0XA 2X40A 3VIPA 3RJXA 1I1XA 4LC6A 2DZVA 4HCDA 3O16A 1TJ0A 1HL2A 3E6EA 4LYQA 3GU2A 3KW3A 1XRFA 1WOAA 2WHLA 4HIBA 1H7OA 3URBA 2V82A 2Z1BA 3QV8A 5FJIA 3R89A 4M1RA 2O9RA 3EA2A 3BAXA 3ARVA 1DQUA 3OLEA 2VRJA 2J77A 4GHRA 1ZAIA 2A3BA 3TXZA 4GGHA 3NL6A 1AL7A 4MTVA 2NV2A 1WV2A 4UTKA 3EOSA 4DNHA 1XCXA 5K3VA 1ZCCA 4RR4A 3WK3A 1O94A 2E6DA 4GI9A 3VNZA 3APYA 3SCSA 3VOGA 3FYYA 3LERA 4ZFCA 3M7SA 4UQDA 5FF7A 4B91A 2E09A 2WNZA 3W7NA 3ARXA 3GH4A 4IX0A 2D3NA 3B9NA 4OU1A 4GKTA 2FZBA 1EJTC 4S1FA 3U2ZA 4INFA 3M0XA 4PRTA 1EZ2A 4AG0A 1O1HA 1F7BA 4DHGA 4ZODA 2ACUA 2XFWA 4IL2A 6REQA 5TF0A 4B4HA 3A47A 3NUKA 4PFHA 2E25A 5CPLA 5CEWA 3BAWA 5KTLA 2ZBTA 3GRIA 5ABTA 2QCEA 3VM7A 1EC7A 4M5PA 3W1QA 3JW7A 4K7VA 2QEZA 1JGMA 1UUMA 4AYSA 4EWND 1LRQA 2P0OA 5BOFA 4EXBA 4NAEA 2QJMA 3EXRA 3W7PA 4KRTA 1SZEA 4CLMA 1BXBA 3NJ3A 1UD3A 3P93A 3C3UA 5C5YA 4U10A 4WKAA 1GGOA 3W82A 1EEPA 1K77A 1NU5A 4CNUA 4FI4A 1XDLA 2XH4A 3VIJA 3O6YX 3PAOA 1UKQA 3AMKA 1J6PA 2G50A 3DGBA 4H83A 2EHHA 3QVQA 2WVUA 5AB3A 1H61A 2DSWA 2Y8UA 3N2TA 2P5NA 3HOJA 4KCVA 4GC4A 3L65A 3AO0A 1G5AA 3LV6A 2WMJA 1AJ0A 3ABZA 3WUFA 4ECLA 4LS1A 3ZR6A 3B9OA 2ATSA 3C0LA 3P82A 2O7QA 3B8WA 2Q71A 1EA0A 1E3ZA 4KMQA 1MXDA 4K1WA 3KOXA 4DBEA 3CB8A 2WB5A 1FH8A 5KITA 4NL1A 3TLQA 1J93A 3JRKA 3EDDA 2OGYA 4PRRA 1UH2A 2OSYA 1V6TA 4QSHA 1MNSA 3DHUA 1W1YA 3N29A 4R34A 3UR7A 1K9TA 2ZA1A 5KMYA 2CXGA 2WBKA 4YMZA 5A8PA 4MZ8A 1UR2A 4LS0A 4IIEA 2WSRA 4E2VA 4AZGA 3LCIA 1OFQA 1GPWA 5I78A 1O95A 4JNZA 5GNYA 3SRKA 2Y5JA 2H9AB 1JRBA 2BY1A 4GJJA 3EMZA 4BHYA 3KBJA 3RRAA 3QC0A 2XN0A 3EKGA 3PAJA 4LYRA 3OHIA 3ABQA 3P81A 1F07A 3PBYA 4M51A 1DJHA 1WQ5A 4LTSA 3FJ6A 3CB3A 3VTRA 4Y9AA 1EUAA 3BAYA 3NOYA 2ZX6A 3KL5A 5CSRA 2C13A 2D24A 3QF0A 1JD9A 2ZUVA 1RQEA 2HROA 1D7KA 3MI3A 4ZOCA 2E9MA 3NSMA 1TSIA 3CV2A 1ECQA 1PYFA 4PUWA 1KM6A 3M1ZA 4TV5A 2X41A 4JYEA 3UXKA 3PANA 4CVWA 4LUTA 1LDCA 1YTDA 3GDLA 2UY3A 2Z0IA 3SSJA 2XHYA 3SCQA 4YCPA 1XQKA 3IIOA 5JH2A 4XKYB 2Y89A 3NQDA 3PBWA 3WBXA 2OEJA 4P8WA 1NM9A 1KCLA 2IQDA 2I9EA 3BLIA 5C6MA 3WLIA 1DJZA 3HURA 4CNSA 3E38A 2HE8A 4J3VA 2Z4GA 5AHLA 1MDRA 3T42A 3WK1A 5IRPA 4MPKA 3NQBA 1M3UA 4HSOA 3UCQA 2PPGA 4QE1A 5FJJA 4BK9A 2YA2A 3CU2A 2Y85A 4A2RA 3W23A 1TZ7A 3VGFA 3TN6A 2DZTA 2W61A 3GLCA 1ONWA 3LCGA 4JEQA 1TE6A 1FA2A 3BCDA 2QCFA 1PX8A 5JQ9A 1W1IE 4XKMA 3ZLFA 1GOQA 1Q7QA 2ZCGA 1GG1A 1JCJA 1YX1A 4M1BA 3V0SA 2C15A 1U30A 5LNVA 1Z41A 5H6HA 1YW1A 1NWSA 3GG0A 1MQQA 3SN0A 1PJ9A 4IQJA 4GUIA 3LTYA 4HD5A 2Z24A 4S2BA 2QCDA 4LAZA 4AZCA 5FSEC 2BOFX 4RE2A 3LPOA 1E4IA 2J88A 2NWRA 3M5YA 4C60A 3LGEA 4F4RA 1Q2SA 3N15A 1TPC1 1GUVA 4XTDA 4FSAA 3STPA 1M65A 7CGTA 4X3ZA 1KXTA 3RPDA 3RITA 2HV5A 1IXPA 2FJUB 4IIHA 1OC7A 2IMRA 1UWUA 3FAXA 4F0RA 5FA5A 4W7WA 3U5UA 4C6DA 3U57A 1FP8A 1UQZA 4IHCA 4QS5A 1E15A 3GYCA 4ICNA 4POCA 3VILA 3GUWA 3E9AA 2H6RA 4TVUA 2OZ0A 1E5NA 2WMGA 3M0KA 3EXTA 1GK8A 1HJVA 3GTFA 2P1FA 3LX9A 5AFDA 3WF3A 1QASA 3QZAA 1UIPA 4R33A 4HCHA 2C0HA 4DWSB 1QOPA 4H7CA 1DJGA 2P3ZA 2QNEA 4JX4A 3FKRA 1PB0A 4W4QA 1I2QA 1H7WA 5HQEA 5E70A 5DCDA 1QXLA 3CAQA 1POJA 1GW9A 3ZXWA 1UBSA 3CMGA 4L1XA 4A8RA 4QQUA 2DVUA 2JFEX 2BX7A 3VDHA 4LSBA 1A3XA 1W3JA 4B5XA 3CV6A 4DX3A 2NQZA 3ZR4A 5SWUA 5BXTA 1PPIA 1DWJM 3V1PA 3UZJA 1KCXA 4XISA 4S3BA 1GVEA 2GGJA 1QCWA 4O17A 5DRCA 2PRHA 4U2YA 3CHEA 1B30A 3W7LA 1O66A 4ZSUA 2CW6A 1SJDA 5CC3A 5CPMA 4CEUC 3SN1A 3LPPA 2VEPA 3DFQA 3ARWA 1LQ0A 4XAYA 1FWAC 2BTMA 2WWCA 3XISA 3N6HA 1EGMA 3VOHA 3F4NA 4BI5A 1H5YA 3BJSA 1JZ3A 3W7EA 1LT8A 4O14A 4ZEPA 4L6HA 1VFMA 1CENA 3LM7A 4NI3A 4IF2A 4QITA 4KETA 1V4YA 1S5NA 1W3NA 2G3MA 4ZQRA 1HKIA 1XLBA 3VABA 2Y24A 4MVAA 2PEVA 5IFPA 1E0XA 1JPIA 1OD0A 4KESA 2POTA 3QBUA 2HTMA 1TPB1 3P3BA 6XIAA 2YGYA 1FQ0A 4NQ1A 4ZO6A 2BMBA 2WZHA 2QIIA 3R0DA 4RV8A 1IR2A 2OYKA 3CAKA 3L2LA 1VRXA 4HU4A 2A85A 4QTGA 1K7XA 2X16A 2XSBA 4HTBA 2RAGA 5H2ZA 2QHAA 4W86A 5I3IA 1WZLA 2WJZA 5IBXA 3DFOA 2RGMA 3KP0A 3K5XA 1LP6A 4GQBA 4G1KA 4KWUA 1UOZA 3M5ZA 3ELFA 1HGWA 4NT0A 3ZFHA 5K9DA 3ITOA 4IICA 5CKSA 4B9YA 1KBIA 5FJOA 2PDMA 1ESWA 1K9DA 4YTTA 4LUJA 4HJFA 1CXKA 1HJXA 1ZY9A 2W0UA 2WZIA 3UZZA 4GX9A 1VGAA 4WZHA 2UY4A 5JU6A 2OELA 3W27A 5C55A 3QY6A 3A9BA 4NIRA 2WMIA 5LNWA 3T2OA 2XG9A 3S9YA 1KLZA 2J7HA 3ANYA 1SSGA 1X7IA 3G1AA 3MSGA 2IPFA 2H90A 4R85A 2YZRA 4O4WA 3GC4A 3AUJA 4PUMA 4H04A 4TUFA 4REQB 3VKJA 3M43A 2OFJA 1QWKA 3C86A 2VDIA 2RDWA 3R43A 4FPSA 4LV4A 4ZTYA 1I45A 3T8QA 4DWSD 3PHAA 5IHSA 2FMOA 3H6OA 1WNOA 4FNTA 3IARA 4PA8A 2C8NA 1M41A 4I90A 3W25A 4MF4A 4WJXA 1W3HA 4HHMA 4AVOA 4UZUA 2OT0A 3GXIA 3EWBX 3LN3A 3E2RA 1PKYA 3WENA 3VI2A 3OODA 1XSKA 1EEXA 3CUZA 4MYAA 4HK5A 4JFSA 3HFYA 5KZDA 4OV4A 3VD9A 4A21A 1XYMA 1J12A 1VPQA 2TYSA 1LRTA 2OYMA 3AIUA 5GVJA 3ZJ8A 1XD1A 5A6LA 4UOJA 1N2VA 3MHGA 2YCKX 4NNBA 4O1BA 3J7HA 1AODA 3M5VA 4U5KA 4EANA 4UCGA 3VCNA 1BYAA 1FWJC 1YBQB 1KBLA 3WLOA 4U3AA 2CLKA 2G4FA 4AY8A 4WDWA 3YPIA 3LK6A 1TV4A 1MQPA 3W7OA 2OB3A 3AXMA 3WQ5A 3W88A 1X98A 3U9IA 1ONXA 1K9FA 3C2OA 7TAAA 3EWDA 5JXQA 4E6MA 1JFXA 3GH7A 3M5XA 3C2FA 4AD5A 1DWIM 1S2AA 6ALDA 1FX6A 4C6NA 4DBWA 4Z1CA 2X42A 3AMCA 2DZSA 5A8QA 1RR2A 2XM1A 1KCZA 3HB9A 5FF3A 2PP0A 2O92A 4JS3A 5CJNA 3W1LA 2BG5A 4QJ3B 3KAOA 5HATA 3I10A 3T08A 1AQHA 1W32A 2QJNA 3SUUA 2ZUMA 3PWGA 3EYPA 1M7OA 1NEYA 2FPTA 3W1UA 3MPGA 3WQ8A 1DOSA 4HN4A 3UYIA 3GK0A 1K4HA 5DMLA 2VFHA 2ZOXA 3PWIA 4Z0JA 3ZJ6A 4C91A 3LD5A 1V6UA 1WDPA 4Q4QA 1XYFA 2PDLA 3BCJA 4AF0A 4H00A 5DFAA 3F2DA 3DCPA 4KWWA 3L2MA 2EPOA 3NAVA 1Q8AA 3CEUA 3VFLA 1XRVA 3W1PA 1YE4A 1NELA 2XN1A 1LWIA 3HZ3A 2FTPA 2R94A 1IV8A 2W5FA 1YNQA 3MKKA 3UWVA 3R11A 1DE5A 2IKGA 3HFTA 4GA8A 1K8CA 2Y6ZA 3FVMA 4GZ7A 2PDHA 1QNRA 4JKMA 4KFNA 4KW2A 3MCOA 4Z1YA 3IRDA 1GOIA 1XKYA 3O9NA 1MWOA 1OK6A 1WYIA 1HP5A 2NUWA 5K9CA 1XG4A 4FLSA 1JZ8A 4O50A 3NWRA 3RLVA 1B3OA 1VBJA 3AMLA 3LPFA 1KBBA 3SCNA 2VEGA 2VO5A 2OOGA 4D6HA 4P7LA 3FA5A 4XK2A 2PGWA 3N2MA 5IM51 4H6EA 4K37A 3P5ZA 1K3UA 3UGRA 3GVWA 4U3CA 4O4VA 2E68A 5AVNA 1VHCA 3TJIA 2VZUA 4IWWA 2E5BA 4AIUA 4I5UA 4XVDA 1EIBA 3GHTA 3KLKA 3KCOA 5LA1A 3MSRA 3PTDA 3I68A 3A12A 4QDMA 3Q45A 4YYCA 1A53A 2WC7A 2OXNA 3AXKA 2VOTA 3B3DA 2ISDA 4NRRA 3IS4A 3P67A 5HMDA 2O4QA 3WBAA 2OJPA 3S0CA 4L1GA 1LLWA 1MRQA 3MYOA 4O1CA 1EGVA 4UTTA 4WOZA 3L4ZA 3RCNA 3TTQA 3LCXA 3QC3A 3THUA 5HJLA 1IEXA 1XFBA 1YMYA 3BW4A 5A3HA 3CASA 4YJ5A 4LAOA 5JH1A 3KXQA 1I1WA 2DW7A 2F61A 1ZENA 2CZ5A 2YDAA 4HOXA 2DJLA 3KBSA 1JNDA 4HPXA 3OLGA 3TYZA 4I7WA 2VR2A 4MJZA 2ZQ0A 3C4UA 3EXSA 1ZJIA 4JIPA 1HTIA 5D9PA 3G0XA 1JVNA 3MTWA 1JIBA 4B5TA 2YOCA 4M7SA 1VLWA 4HYRA 2PLJA 3VIKA 3B9DA 3K4DA 3A6OA 1K8XA 1TJ1A 3T0CA 1HIZA 4DZAA 1XUUA 3BVJA 1EHAA 4W84A 3T9PA 2UY5A 3RU6A 1UZ1A 1WX0A 3UNDA 3L5AA 2D3LA 1J0KA 2FB3A 1BTCA 2OGJA 3AYVA 4LF1A 4F40A 1V79A 1QW9A 3GE7A 1V6XA 1KRMA 3AS3A 4MWAD 2QV4A 1A5NC 1QW7A 1KW1A 1UUQA 1VFSA 1LOLA 1AJZA 3CL8A 4G2DA 3MA8A 3TYUA 1W8SA 4BEUA 5CG7A 3TDFA 3GR7A 3L66A 3GTXA 4N7QA 1ZJBA 4KERA 1Q85A 4OUEA 3NQ2A 4AZIA 4DZHA 1UD4A 3MHFA 1R3WA 4H01A 5AVHA 5HNNA 9XIMA 5CZTA 4NNAA 1HNYA 1B1YA 3G0SA 4EOUA 1VFHA 3MI2A 3LG3A 1UROA 3O05A 7REQA 4ZFMA 2J8TA 5DX7A 4K1GA 2RKXA 2ACRA 3ABOA 4GY0A 4JQ2A 2I16A 3NL2A 2QKFA 5AHMA 3VX0A 2WQPA 4NU7A 4LEFA 4TQTA 4IP5A 3PJXA 1S5MA 3ARUA 3L0KA 4Q8NA 2QUMA 4P2VA 5XINA 3DUGA 3DKLA 1CBGA 4RV3A 2EBNA 4C6CA 1IHIA 3N14A 4RDYA 4ORMA 4L64A 1R9YA 4HMNA 1K9EA 1VFTA 3H54A 1A5BA 3BG9A 3KWSA 4JIIX 3DG3A 2DVXA 4PMUA 2VQTA 7ODCA 3BAIA 1LG1A 1TCMA 2Y5EA 3ZLHA 2YB1A 3WNNA 4G7EA 3MI6A 3LI0A 4QR6A 3VKCA 4XV0A 3DFYA 3G0UA 2CWNA 4HQVA 1EO7A 5AOUA 3VIHA 3W7CA 2J62A 3SUWA 1OHLA 2PWFA 2A3CA 3LSCA 1TWSA 2QDGA 4M29A 5U7SA 5A1AA 1LZOA 4FOKA 4OV9A 3N2CA 5BRBA 1ZBCA 3N9KA 2JEQA 1E1FA 2ZUNA 3GTNA 2VOMA 1Z6KA 1GVFA 1UWRA 5A5WA 6A3HA 1MUCA 5DY3A 1GPFA 1KGWA 4C1LA 4UFIA 2CEQA 3DC8A 1DHKA 3PZVA 4ZQPA 4PTDA 4QEEA 3TN3A 3T0TA 5TAOA 2PUZA 4H9YA 3DIPA 3PM6A 2F6XA 1UP3A 1Z89A 2NVAA 5K2ZA 1LT7A 2BGSA 4I8DA 5AHNA 4HHLA 3NZQA 1FHLA 2RJHA 4PCTA 4WGXA 3BC9A 1GOMA 3L4VA 1DIEA 2ZC1A 3RLHA 2W92A 1ZB5A 1I0DA 2XFFA 4GE8A 4WRHA 1LTDA 1VP5A 3WL1A 2EJAA 2PCEA 2VFGA 1YRRA 3FCPA 3I3EA 3URNA 3QOKA 3VMPA 3O6AA 3IK2A 1XLHA 4ZL1A 2J9XA 4GFSA 4LB3A 5KINA 1FWEC 1TPFA 1TVLA 3PG8A 4JTKA 3DFHA 3NPUA 4QIUA 5A2AA 3P0WA 1Z69A 4BS0A 3UWYA 2CZDA 1JF5A 3WJSA 2AKZA 4GKLA 2TAAA 2VWSA 3LM3A 3S5ZA 3PWAA 1R9XA 1PTGA 3LGDA 2GYIA 2VC7A 2GVLA 4KFPA 3CUGA 3QPYA 2C0AA 2A3AA 2XSXA 1HVQA 3ECQA 3WNKA 1UZ4A 4CD8A 3CZGA 3PSVA 2XFYA 3AWNA 1GVYA 3UZYA 2VUNA 5JMUA 1CLVA 3IGHX 1XIIA 3IK4A 3PTMA 2VR5A 3VCCA 5IDZA 3K8MA 3L4TA 3W1RA 1FWGC 4DO5A 3UWQA 4J2PA 1TVNA 1DEDA 9XIAA 4GYPC 1ISYA 4LNYA 2OMAA 3M0YA 2INEA 1K6AA 4PFMA 3AROA 3STEA 4I5XA 5C0QA 3NL5A 3V1HA 3NYDA 2VDGA 4GIRA 3NEHA 3NTYA 4I7UA 3SRFA 1HL9A 3A64A 3NR0A 4PMXA 3D6NA 5LA2A 4WXYA 3H4WA 1OGBA 2GOKA 1XLIA 3ID7A 1UZDA 3VOJA 5HOSA 3R7MA 1XH0A 2VURA 4DJEC 1HX0A 3WD3A 3ALFA 1JNEA 3TOPA 3GNRA 1O5QA 3TW7A 1FXPA 3TONA 4QSFA 2J74A 4I6KA 2Q8XA 1GQIA 3PNUA 3BTNA 1R7OA 3M44A 4M56A 3B9EA 4GZJA 3FJNA 2ALRA 3S1UA 3IVUA 3KUMA 4YTQA 4NAFA 3VGDA 1YHTA 4HNLA 5A6TC 3VVGA 3WH5A 1ALDA 3W2LA 5F2GA 1MUMA 4MLJA 4DXKA 3WLQA 3R8RA 3BLDA 3OP2A 4WY0B 3B0PA 3B8SA 4ICMA 4IIBA 4UTLA 4A3RA 3WQVA 4MWAA 2J7DA 5AHEA 1QATA 1H4PA 4PL2A 1N7KA 2OZTA 3VNLA 1EL3A 2FPYA 2Z1XA 3O0KA 1PSCA 3AUOA 1L6WA 4CU8A 2G0WA 4Z08A 3H2EA 5LNRA 3DI0A 4PMZA 3FIGA 1XSIA 2Z28A 1FDJA 2WVVA 4ML9A 2JKAA 1NIUA 1BSIA 3ITVA 3TV8A 2G96A 5KSWA 5MKGB 2CC0A 5FD0A 3QXBA 2Z7KA 1E51A 5HPOA 4IGNA 5MHBA 3WMLA 2YA0A 3TOYA 3NO5A 1RXOB 3QR3A 6PTDA 3DI1A 5DY2A 3R13A 3W74A 4J3WA 3WSUA 3TQ0A 4L9YA 1PCWA 3B4YA 3S5OA 3O15A 3W7MA 4R5EA 1CT5A 4Q7BA 5JVLA 4RL3A 4JTHA 3GVQA 2XGBA 1OZQA 1GQKA 3B03A 4NF7A 1OB0A 3STGA 2KX9A 2ZFAA 3SB0A 4N9BA 4F79A 1DIDA 2C7FA 4ZB0A 1P7TB 4JY9A 5AYIA 3U7BA 3DU0A 3UCDA 3MW7A 4CD4A 1CGWA 4DBUA 3THAA 3OQ8A 1ICPA 3KBVA 5C9WA 3DBNA 1WZMA 2PDYA 3MU7A 2Y62A 2VTFA 1T96A 3W7JA 1Q4WA 3T0AA 4UTWA 4AFYA 2EAWA 3B40A 1CNVA 3RILA 2OODA 4C1KA 4IISA 4DUOA 3WO8A 4YS1A 1NFBA 4P5UA 4LAMA 1T99A 3TCSA 4JX6A 4UOQA 1MW0A 1A49A 1GZGA 1WXJA 1UC4A 5AY7A 3WJWA 2YX0A 1UQYA 3JR2A 3IPWA 5EFFA 4MFDA 3NURA 5D37A 3CXOA 1NP2A 2PWGA 2BBFA 4UFKA 1K6WA 4CQBA 3WQ4A 1NOFA 3CZ8A 4IPNB 4JL2A 5DBUA 3L23A 4H8UA 1Q65A 3ARTA 1TTJA 1JYNA 4CCCA 5LYRA 2ZX7A 2J66A 3Q67A 2PWUA 4JKKA 3V4BA 4JQ4A 4RDWA 3KL0A 1FH9A 4AY1A 3E74A 3LY0A 3HGSA 2OCZA 2JKEA 1FWSA 4ORIA 2EG6A 4ZB2A 5CBIA 4LBRA 3P14A 1BG4A 1DWFM 3DG7A 1EB3A 2IQ0A 4N6EA 4DJDD 2BFGA 2NSOA 4A3UA 2D2HA 2VZVA 2A6LA 3VK5A 2ASHA 3FHQA 1QI2A 3G77A 2B7NA 1RD6A 3DFPA 1OC6A 4MY9A 4QFUA 4JR5A 1XGZA 3I6EA 5I0DA 3TMLA 2GDVA 1FWWA 1NY1A 3GW3A 3GVRA 3TYBA 4UNLA 2WWDA 3HJEA 1NH6A 2CNCA 2BV9A 5G5IA 3UXIA 3WQ6A 1XSJA 4TMBA 2CKSA 3LYEA 3D47A 3EZ4A 3NM3A 4XG1A 3F7JA 5BOOA 2YCLA 2PDNA 2G95A 3SN4A 4PB4A 4JQ3A 1FXQA 1KTBA 3KX6A 1ISVA 1RD5A 4LGXA 4PB3A 1FKWA 1BWVA 4BWLC 2JGQA 2W27A 1WXZA 1CWYA 2GJNA 4FHAA 2BHUA 1RCQA 4ACYA 2AQWA 2VMFA 2WJFA 2G3FA 1S2WA 5IOBA 2PP1A 3IGXA 3TAKA 2E5CA 3LENA 2Q09A 1R7AA 1T5AA 1B3XA 2DZXA 3NQ6A 3VKKA 3RLUA 1VQTA 3WYZA 5KZMA 4IGHA 3M46A 2VFDA 2NQ9A 3QOMA 1FH7A 5D2WA 1FY6A 3NVDA 5LIWX 1WAUA 3RGTA 1VFFA 4UB9A 4AWSA 2HVOA 4KCTA 5FL0A 3FA4A 2F2HA 1YPIA 2QCLA 1GVSA 3K8KA 3HGJA 5CLTA 4W85A 1FDZA 1EQCA 4S39A 3N18A 3BLPX 4HTYA 3NPVA 5DELA 3CLWA 3L0NA 1N8WA 3GDTA 3GBEA 1PWLA 1U5HA 3DEQA 3AMGA 1R30A 4DYEA 4TVCA 1S3HA 5AC6A 3MUIA 2ZDRA 1CYGA 2VD8A 2WAGA 1IEQA 3W6LA 2CWXA 4WLCA 4ZZ9A 2VX7A 2EQDA 3ARPA 1G9HA 5T9CE 1TV2A 4CD5A 4LS2A 2WV8A 1UJQA 2VZSA 3K4AA 1MW2A 1YXCA 5FOOA 1YADA 4NJIA 1LBLA 3LSBA 3L0GA 1TZ9A 2BB0A 3CMJA 4MUPA 4RXGA 4JTAA 4ADUA 3MUXA 3PF3A 2FGLA 4ENLA 5DXYA 1XPGA 1BWLA 4MKVA 3MUY1 4IG2B 2E9LA 4JN8A 3U5YA 1E73M 3AOFA 1OJXA 1I0BA 4DWSC 2I5QA 1OBAA 3WUBA 1E0VA 4AZBA 3U2EA 2ISWA 3WJZA 5EMKA 4GNKB 4GACA 4PYSA 5E9XA 2PGEA 1EP2A 1SR0A 1S46A 3AS1A 4V2XA 2E6FA 1Q66A 3G1FA 3PSWA 3W1AA 4JICA 2E5DA 4LB4A 1VYPX 2FMNA 1QI3A 3DC0A 3ICJA 2OX1A 4HMEA 5HWMA 5DMYA 4DAIA 1CX9A 5J5RA 5AC8A 4F2UA 2WM0A 3TH6A 3PZ9A 1HP4A 4PMRA 1NFGA 2H8ZA 3S1VA 1EP1A 2HBVA 2ZTKA 4JFUA 5PTDA 3M16A 4PMJA 4JL1A 3VKBA 3TTYA 2R91A 5CZKA 2PD5A 4BA0A 3V0UA 4ATWA 4W9TA 4UTJA 1GJWA 3LZ5A 2FVMA 1XRTA 3UXLA 5E6ZA 1OY0A 3PK7A 3R10A 1TR9A 3FX4A 2CLFA 5FEPA 3FV9A 1GKQA 1XDJA 2XVKA 2HJPA 1T0OA 4LVGA 4GUGA 3S5YA 1LF1A 5CBBA 1L6YA 1CGXA 1TWZA 1ZRQA 3CHVA 3RG6A 2DQWA 3SRHA 1TJPA 2VVNA 3PBMA 3FVDA 4MDPA 4AVNA 4IGSA 2ZRZA 2JALA 3TYEA 3S6OA 2XIJA 2J78A 3AIBA 4GY1A 3RR1A 2Q8LA 1QO5A 4CQCA 1G7UA 3B97A 1SFTA 2QCGA 4Q4SA 1EJSC 2NXHA 4JIQA 4UR8A 1D3HA 4ML4A 1M7PA 1VS1A 2ACQA 3PZGA 5M1TA 2WVSA 3UR8A 1XGEA 4BQ4A 3QGKC 1ZBKA 2HQAA 2PRLA 1ODZA 2VGIA 1F9CA 3E2QA 1F3EA 2HMCA 1ME8A 1LLOA 2UZ9A 3BQ6A 3A22A 3CIXA 2CBJA 2CHNA 3UWUA 3CH9A 3GNDA