1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
b'MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
molecule tags Lyase
source organism Escherichia coli
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
3PF3A 3STCA 2NX9A 5FEZA 2CLFA 1VRDA 1JULA 2Z0IA 1TSIA 1J5TA 1D3HA 4LV4A 3UNDA 2CZFA 1GVOA 2VOMA 4C1KA 2F7FA 1IGSA 3ABRA 5AYXA 1Z44A 5EL1A 5FF2A 1JCJA 3R12A 1K7EA 5DBUA 1O60A 1ICPA 4A21A 3WJZA 3C6CA 3M0ZA 4NU7A 1XC4A 4JTJA 2VXNA 4R34A 3M44A 3RK8A 2HMCA 2BTMA 3DI1A 1A5AA 3BW2A 3M43A 1H1YA 1BWLA 3RFAA 2E6YA 3DFTA 1BKSA 1TPC1 3GIYA 1JCXA 4X2RA 4AF0B 2FIQA 3EWWA 1BTMA 2B7QA 4XKYA 3TQKA 1H7XA 2H8ZA 4JIQA 3N34A 1R2RA 4KFOA 3L66A 3UZ5A 2X16A 2X1UA 3NQFA 1EP1A 1YTDA 4TIMA 2W0UA 1OFAA 3NQAA 4Q32A 4N4QA 4LVAA 4MUZA 3IIZA 4QNWA 2PE4A 2PCQA 1QO5A 4YWIA 3UY7A 3UPBA 4ZMGA 3KRSA 3T55A 2QCGA 4K38A 3LCIA 1IIGA 1KFCA 1P5BA 1TO3A 4RLIA 1TB3A 3W2UA 3EKZA 4O14A 3WJSA 3MBDA 4IPIA 3GR7A 1F6KA 2VFHA 3GNDA 3PULA 3HG2A 2ISWA 1H1ZA 1NFBA 1OFQA 2GVJA 2WSRA 3E02A 4MY9A 4O10A 3SY5A 4MLRA 4AWUA 1ZAJA 1RPXA 3QPYA 1YXCA 1JR1A 2EF9A 3IIOA 2JKEA 5AC7A 2FPVA 2IQTA 1EEPA 2VEMA 3G0UA 4ML9A 3CIXA 2V2HA 2VFIA 2OZ0A 5BOOA 3G8EA 4LW7A 1W5PA 2VFEA 1DQXA 4PEKA 2H3DA 1R47A 3W72A 2ZTJA 3QM3A 3T44A 3A24A 3G3MA 2I14A 3KVKA 1ZHAA 4DF0A 3HGRA 1L6YA 3OG3A 4FNQA 3W7EA 2DJLA 1O4UA 2HS8A 3MMTA 4LTSA 3VE9A 3IIPA 4M6VA 2Y88A 4N9EA 3SECA 4NXKA 2A7RA 3LCLA 5T26A 1OABA 4J9JA 4TMBA 3PSVA 4HKPA 1GTHA 4WXYA 4A29A 3S42A 3TC6A 1W5NA 1XBYA 1EWEA 2ZA1A 4JTFA 3TSDA 2G5WA 5LNVA 1OFBA 3M7WA 4UTUA 3W84A 2QCEA 4Y96A 1KFLA 2CZ5A 4WX2A 5D03A 4UMAA 5I3KA 2GJLA 4N02A 5CG7A 2YYTA 4Z0SA 1H51A 1FWRA 4AHOA 2GQAA 1XUUA 3ELFA 1PCKA 1TQJA 3M9YA 3SGUA 1KFJA 4JTGA 3T4CA 3N14A 4DPPA 1X1OA 3QH2A 4MOZA 2QF7A 1GVFA 3THQA 2JK2A 4YCPA 1I2OA 3UWZA 3GKAA 4K8HA 4LC8A 1SW3A 1F7BA 2BZNA 4IGHA 3EX4A 3W1MA 3O05A 5HUOA 4I7WA 3EX6A 3S5ZA 1FDJA 1VH7A 3R13A 2XN1A 2P0OA 4OQVA 3L5LA 2C18A 4GNJA 1X1ZA 4EOUA 4CNNA 1ZY9A 3MP3A 4NJKA 3Q94A 3W2LA 5FF3A 2YGYA 5AC8A 5AHIA 3INPA 3IGSA 3NQGA 3TW6A 4NZFA 3CT7A 3TAKA 3QJAA 2V5BA 2Z1BA 1SO5A 2YW3A 3G24A 3B0PA 3MJYA 5G4WA 1AW1A 3LRKA 3G1AA 4UTMA 2OT1A 4HHPA 1AL7A 2NWRA 4HN4A 3TFCA 2Q8ZA 1QO2A 3QMTA 4NXSA 5C54A 2CU0A 2ZYFA 2QUTA 3VE7A 2Y7EA 1X7FA 5K9DA 3C4UA 3TJLA 1RVGA 3B04A 1RV8A 5D37A 3WK1A 3GNNA 1OJXA 2NXGA 2GVLA 1KM3A 5FF7A 3R8RA 3VFLA 2V81A 4ZQCA 1FUYA 2I9EA 3HPZA 1S3HA 2A4AA 1LOLA 4EF9A 1W3NA 3IVSA 4BWLC 3PWAA 2E5BA 2TSYA 3M5YA 1KBIA 3DBPA 5BNKA 1PE1A 1P0KA 5AHNA 1PHQA 4ORMA 1JVNA 3LM7A 4CCCA 3VKJA 1FWTA 4M7SA 3TA6A 4UXDA 3QRHA 5D2WA 4ZQNA 3NL5A 3W74A 3OHIA 1MEIA 1SUXA 2X2GA 2ZZ1A 2V2DA 3QSRA 2YR1A 1HG3A 1S5VA 2J9ZA 5I3GA 4OV9A 3TJXA 4O11A 2GQ8A 4LC6A 5TBOA 4O18A 4HNTA 3W9ZA 1VCVA 3TNOA 2TMDA 5HULA 4DEFA 3KVLA 1NF0A 1TV5A 1OF6A 3C2FA 1H7RA 3MYOA 4LY8A 3PBWA 1Z41A 2WNNA 1JCNA 3L21A 2YZRA 3PUDA 3DFPA 3NPXA 1XBVA 2ZRVA 4JEQA 5LKYA 1E51A 4WD0A 3GZ3A 3W86A 4LVDA 2YX0A 1W8SA 3NR0A 1UJPA 1VC4A 3SZ8A 3HIJA 1F05A 4FX7A 3GKFA 4UCGA 3LBMA 5HJLA 2FPTA 4QISA 2DP3A 1EUNA 1QNVA 4RV8A 4O13A 3FEMA 3O1NA 5LGZA 4FB7A 2BX7A 3KAOA 3P8JA 3F4NA 1OYCA 4KWVA 2RDTA 3LHTA 4LVFA 4XTDA 2PURA 3QYQA 4G1KA 3CU2A 2TYSA 1OFOA 5D2VA 3VNDA 2ZRYA 4RZ5A 5FESA 1FQ0A 4PFMA 1K7XA 1ZCOA 3NEVA 1AK5A 3BVJA 2QCMA 2Y89A 4JTKA 1SO3A 4WOZA 1GYNA 5F4SA 1B57A 1UB3A 3OVRA 4QQ3A 3C3NA 2VEPA 5F4WA 3W75A 3C61A 4A2RA 2CZDA 3NG3A 3HGSA 2CLKA 5CPNA 3MWAA 2NUXA 3MW7A 2XN0A 4O0KA 3QFEA 1AW2A 4AVFA 2ALDA 4L4MA 4BFAA 3Q58A 1N7KA 4KWWA 5D2XA 2WV8A 4UR7A 1WDWA 3C0JA 4PCFA 4GC4A 1NF7A 1VCGA 5CZTA 4LRSA 3W7CA 2Y7DA 4CNOA 1WOAA 3B8DA 2C14A 1B3OA 3S1UA 1H62A 1FXPA 2ISSA 4UFJA 3G1FA 2XFWA 4XTIA 1FY6A 1KM4A 2YFNA 3G22A 1Q6RA 3P74A 5AB3A 8TIMA 4O19A 2VC6A 4B5NA 2JBMA 1FWSA 2HTMA 3W22A 1OK6A 1I2NA 3GDLA 3PG8A 1A50A 3N2MA 1LBLA 5CGQA 2PRHA 4NX5A 5MHBA 3KRUA 3QMRA 3GDKA 3W85A 3M6YA 2V30A 4MYAA 4MFEA 5D30A 3GK0A 3A5FA 3G1VA 2DJXA 4NT0A 1CI1A 3G1SA 1TRIA 3QQ0A 3F4WA 1YLVA 5HR6A 2Y7FA 2XN2A 5J5DA 4Y6GA 2J88A 2RKXA 4W9TA 1GVSA 1TPDA 3TROA 1H5YA 1B4EA 1XBXA 3BK0A 3EEGA 4TU1A 1MZHA 2QDHA 4Z1CA 3SFKA 1OX4A 3N9SA 3UD6A 1JJKA 5EPDA 1DHPA 4DO4A 2RDWA 3A22A 1KFBA 2Y63A 3MO7A 2Q8LA 4BI7A 1KFKA 2EHHA 5AHEA 5I3JA 3TAOA 6TIMA 2O7QA 2VELA 5AC6A 3DH7A 3DXIA 4UTTA 1C8VA 3FYPA 3W7QA 4HNVA 3I68A 3OVPA 3A21A 3S5OA 1QWGA 3LI1A 2E68A 4JD4A 3LHWA 4XKYB 5HMSA 5BRBA 1LP6A 2W79A 1IXPA 1H50A 4U28A 4O17A 1DOSA 1W1ZA 2QJHA 4ZQPA 3UYCA 1QPNA 1EP3A 1PL9A 4DPQA 2ZA3A 5AHFA 4ADSA 3PG9A 1SR9A 3DI0A 3PBUA 4UMCA 3S1WA 4LOCA 4NNCA 3C2RA 3UY8A 5DCEA 1RQEA 2Y85A 3PBYA 4DXVA 4JN6A 3M1ZA 4JY9A 3BV4A 4PH6A 4ALDA 5G2WA 4R53A 3W76A 2GPTA 1XDLA 4JNMA 1QPQA 4UTIA 3NPUA 2Z6JA 2H90A 4R33A 2WOQA 4JX4A 5K4ZA 1J4EA 2ZDRA 3KVMA 5DY3A 1SW0A 1I8JA 3DZ1A 3P8IA 5D04C 2C6QA 5CZSA 5LGXA 4QITA 1L2UA 1O94A 1OHLA 2WKJA 1JCMP 1X6UA 4FNUA 5EA9A 2QAPA 4O4VA 1F76A 2Y7GA 3GXTA 3M16A 1IXOA 1KLZA 3QEZA 2C19A 4GUIA 5H2ZA 1DORA 1QAPA 3NA8A 5U7SA 1G4TA 1UUMA 3E49A 1XFBA 4IMCA 4MY1A 1TCDA 1DL3A 2P1FA 3O6DA 3I7RA 1A5BA 1FWWA 3TX9A 4AAJA 3P67A 3BG9A 3P82A 1KM2A 2FTPA 3L68A 1OYAA 5DN1A 3G18A 3NQDA 3P81A 3LV5A 1LOSA 5I3IA 4LT9A 1V7YA 4O12A 1W5QA 3C2VA 3NGJA 5D2TA 1FCUA 2Z2UA 5EKYA 5F4XA 4BR1A 3G1YA 3U6WA 3LLDA 4UTKA 1LLZA 3LERA 1TJPA 4I9AA 1RQBA 4XZ9A 1TV7A 2CLIA 2ZRWA 4NJIA 1SFLA 2VFFA 3NPVA 3LCHA 3WFAA 4AXKA 4AH7A 1J2WA 1K8YA 1LLWA 3W7MA 3HGOA 2B7NA 1SFJA 3NYZA 2ABAA 2NUYA 2JKAA 1RZMA 3HMJG 4LS1A 3S0CA 4O1AA 4RJEA 2P10A 4U4MA 3W6YA 3HJZA 1ZAIA 3MP4A 3LCGA 1SZEA 2NX3A 2RH9A 3O16A 3VCRA 3W1PA 2F84A 3CWNA 1L6SA 4O52A 3SJ3A 3LCWA 1H61A 1ME7A 4M5PA 2G95A 1TTQA 3C56A 1QOQA 1ME8A 1ZENA 4JDYA 1KTBA 5K3VA 3NQ7A 1ICSA 1ALDA 3NZRA 5CPLA 1XCFA 1Z42A 3UPWA 7TIMA 2VEKA 4H4IA 3CM4A 5CSRA 4NNAA 3CC1A 2JGYA 4LS0A 2QAFA 3TQ0A 2EKCA 1KTNA 3W2JA 1PHWA 2E77A 1W37A 3DFQA 4MY8A 2JGQA 4MPQA 3UWQA 5BMXA 4RKAA 2NV2A 1TPH1 3L5MA 3EWUA 3NQCA 4QJ1A 4XQ6A 3I65A 3O06A 4P2VA 5EBUA 2WSQA 1Q6LA 4Z1BA 1HFBA 2Q3OA 4FIRA 5LNRA 3DENA 1R2SA 3NQMA 1BWKA 2C1HA 3MUXA 1KFEA 1T8XA 5D33A 1VS1A 5D2YA 1GWJA 2A7NA 4OU1A 1GPWA 2OJPA 1UASA 1D9EA 1MEHA 3BPWA 4IMFA 1SO4A 4BK9A 1XI3A 1XKYA 1DV7A 5F2IA 4OGZA 2PRMA 3STGA 4AHQA 4QNEA 3RNDA 4ADUA 4BI6A 2OMAA 4UMBA 4NQ1A 3S1XA 4UTTC 3S8HA 5HQEA 2GVGA 5F2GA 1LDCA 2A1YA 4ONVA 3P62A 4MVAA 3ZWSA 4MLJA 2YPIA 4N2YA 3M5XA 3UWYA 2Y61A 2WNQA 4GWEA 1G69A 1YTEA 3B0UX 1OX6A 3EWXA 2ZZ7A 2ZRUA 3P84A 3EKLA 1F73A 4LNYA 1GT8A 5D32A 2C3ZA 1AMKA 2WPBA 2BWGA 1T96A 1TV8A 3ZS4A 4CQ8A 3WJWA 3EB2A 4FNSA 2A6LA 2KZHA 1UBSA 4N9CA 3OEXA 4NZJA 4CCEA 4HNNA 5BW6A 3H53A 2A7PA 3LBCA 3BARA 4FO4A 3TFXA 3P60A 4EIVA 5C2XA 3S5YA 3TC7A 4A3UA 5HNRA 4YXGA 4FNTA 5HWJA 3P5YA 3B4UA 3S6DA 3LXAA 3W2MA 4Y90A 5FF0A 3O6YX 2WNZA 1EB3A 2ATSA 4PA8A 4OT7A 4CCDA 3MBFA 3SSJA 1LTDA 3G1HA 4S2BA 1SZNA 1P1XA 3TIMA 5G1YA 4PL2A 2B7PA 4O53A 2ZBTA 5HUPA 1XDMA 3L2IA 4NNBA 1VGAA 4UNKA 1ICQA 1UUOA 4EVZA 2R94A 5DY2A 2YXGA 1I2QA 1XL9A 2H3BA 2RHGA 3W7NA 3KRZA 2CWNA 1Z48A 1YDVA 3T40A 3GR8A 5K9CA 3UZJA 4XUGA 2DZSA 3VI2A 4TO8A 1TPFA 3HG3A 4GJ1A 4ZL1A 3M47A 1QFEA 2R8WA 5AFDA 3CTLA 4K36A 4D2JA 4E0CA 1IXNA 4M6PA 1VYSX 4EF8A 1ZNNA 3KVJA 3UWUA 1K7FA 1TIMA 2DZVA 3NQ2A 2QUUA 2Y70A 1TYGA 4JS3A 1WBHA 1A5SA 1SO6A 1LBFA 1WA3A 3TCEA 2VEIA 1KV8A 2WO5A 3RLVA 4ZZ9A 4WUIA 1YXYA 1WYIA 1OG0A 3BLIA 1G7UA 3TMLA 4GBUA 1W0MA 3RLUA 4CQAA 3W1AA 3MYPA 3B05A 1T0OA 3HBLA 3FKRA 2QJIA 3GXNA 2OCZA 4JYFA 2R91A 4ZVJA 4BWLA 2X1RA 2BLEA 2X30A 3B0VC 3W7OA 2CLLA 2QCDA 2QCHA 4O1DA 2LLEA 2AAMA 4N4PA 5C55A 2PRLA 2ZZ6A 1V5XA 3QC3A 1TPB1 3O07A 4FNPA 1JCYA 1KTCA 3WJXA 6ALDA 3GDTA 2DZTA 2H6RA 4LV9A 3H54A 3CB8A 3N3MA 1UCWA 4K39A 4NX0A 5DXXA 1S5WA 4OHQA 2C0AA 4ORIA 3OVQA 1OK4A 3NQ6A 4JTSA 3O6CA 4R7JA 3I7SA 5A8GA 4O28A 3A5VA 1D3GA 4GUJA 1AG1O 5AHLA 1U5JA 2VFDA 3N2XA 3A9IA 3RF9A 1OFPA 2CLMA 3CEPA 4OV4A 3FLUA 3TXVA 4YCOA 1TPVA 2ZZ5A 1R2TA 4UFLA 3ABOA 2DZPA 3DFSA 5H91A 4NUWA 2QJGA 3EXRA 2YSWA 4XBSA 3CWOX 3EWBX 4O1CA 5F2MA 2J6XA 1Q6OA 1WBJA 1HL2A 4K8EA 1QPRA 1FX6A 4PTNA 4AWTA 4JR5A 4K7VA 2ZTKA 5DCBA 3FKKA 3PR2A 2YCEA 1RQHA 2EAWA 3W1LA 2B4GA 2NX1A 2QCNA 3QSTA 4LVGA 1FXQA 3W83A 5G2IA 1OYBA 3KHJA 2B0MA 3NNTA 3LCXA 3T78A 4C1LA 4Z1AA 1EA0A 4IMEA 4GE8A 1DQWA 3STFA 3DHDA 3UXAA 4KFNA 1KM5A 3R5EA 4RK8A 4Z0JA 4HIBA 4WQ6A 1W54A 4O50A 3PAJA 2GUUA 1F5ZA 1LRNA 5F1UA 3W1RA 3WJYA 3L0NA 2V8ZA 2PC4A 2VFGA 3FIGA 4QM1A 3W7KA 4IPJA 2A6NA 2ZQ0A 3W71A 4NJGA 3DU0A 3QW3A 1P0NA 3LHVA 2C16A 2FLIA 3PVFA 4X9SA 5K7JA 4O16A 2CZEA 2E6AA 5CPOA 1G67A 4E38A 1OX5A 5G1TA 3HG5A 4O57A 3JS3A 3SIZA 4IQLA 4IX2A 5G5IA 3P80A 4HNUA 3IEBA 5D05A 1G4SA 1VYRA 3LXBA 3GDMA 4RXFA 3CEUA 4KKXA 2WSYA 5CSSA 1FBAA 4L4LA 5SWUA 3PB0A 2FQIA 2X1TA 5F2LA 5FF4A 3MHFA 1JUEA 2QKFA 5AN7A 4A2SA 3IIXA 1MSSA 2FPYA 4DO6A 3GDRA 3UXDA 2GQ9A 3L5AA 4MJZA 1R46A 3MHGA 5HWMA 3GB6A 3DGRA 2V9DA 3C2EA 3NPWA 4JYDA 3IRDA 5A5WA 2EPHA 5DELA 3W7RA 3LHYA 3QZEA 3ZFHA 3L65A 1ONRA 4OWGA 1LM1A 3O8AA 2B7OA 4MYXA 3LB0A 3LDVA 4GRSA 2H8XA 2FB3A 3M41A 4WY0B 3EX3A 3QW4B 5HWNA 1DVJA 3JR2A 3N73A 5FEPA 5D02A 4GUGA 4POCA 1H63A 4O54A 1WOBA 3LHUA 3PUOA 1MEWA 2NUWA 3W7PA 1I2RA 1F2JA 3SGZA 1TPWA 4DF2A 5LNWA 2FJKA 5D09A 1B9BA 1Q3NA 3UWWA 3W88A 3ZWTA 1TRDA 3PSWA 1NEYA 1OFEA 2FFCA 2O7SA 4UTWA 3UQNA 4UFKA 3G3DA 5K9XA 2OT0A 1LRQA 1VLWA 3LGEA 1QOPA 4LS2A 5L6UA 1SW7A 3FOKA 4XBKA 2GJNA 2ABBA 3QQ1A 1L6WA 3N19B 2C15A 1K3UA 2YFOA 4E2BA 4EWND 5TQLA 1LYXA 1C9DA 3STEA 4S2CA 1QR7A 3GVGA 4UTLA 2HSAA 1YPIA 1FCVA 1JRBA 5KSWA 2J9XA 5EMUA 4M7TA 2CFFA 1GTEA 2ZRXA 4MZYA 4IMGA 3W2NA 3KFTA 1Q6QA 3PBVA 3QPZA 5CKSA 4FF7A 3A23A 2NXHA 1DBTA 2E1DA 1EIXA 1VHCA 2CLEA 4LU0A 3IGUA 5U4NA 5ABTA 4NJHA 3NVTA 1WX0A 1TTPA 2YW4A 1NAL1 3LCFA 4CNPA 1I45A 1LBMA 4MKNA 3W3OA 1K02A 1NSJA 3CIWA 3FA5A 3LLFA 4H6KA 3V1PA 3LTSA 5KINA 3HF3A 4AF0A 1X8FA 4FXRA 2RDUA 1TJRA 4WZHA 4FXSA 4FX6M 3ABSA 2V0TA 5LHFA 4CLMA 4JGDA 1QPOA 3WK2A 1GZGA 2R14A 2Y6ZA 4ZQRA 1M6JA 5K2ZA 1KA9F 2OX1A 1JUBA 3G0XA 4UR8A 4TR9A 3EWYA 4JY8A 1OFDA 5KZDA 2E5CA 1L9WA 3L0GA 3DKJA 4X22A 1YADA 3W1XA 3E9AA 3IV3A 1SSDA 4QIUA 1JQVA 1N55A 5I3FA 4WY0A 2DZUA 1W5MA 4LVBA 4NVTA 3RMJA 5AOUA 3MI6A 4LRTA 4S1FA 3S1VA 3LOTA 3BG5A 2ZCGA 5CZJA 5E1QA 1I2PA 1O5XA 4ICNA 2E5DA 3ZR4A 3NXFA 4DBEA 5LZLA 4DQWA 1YTKA 3KX6A 1O5KA 4IWWA 1GG1A 1W5OA 3LRLA 4O4WA 1GEQA 3FYOA 3W7JA 1LOQA 1SQ7A 1KW1A 3TH6A 3IGXA 3HQ1A 1DJNA 1IIHA 4KFPA 3Q2DA 5AHMA 3G1DA 3NZ1A 1O95A 3N9RA 4JXCA 4P61A 3LX9A 1I4NA 4LUIA 3TV8A 1GOXA 3ATYA 1A53A 2JKPA 1T99A 5K4XA 3LTPA 4DELA 2QCCA 4N6FA 2NZLA 3NQEA 1VPXA 5GVJA 4WOQA 3HG4A 1VQTA 1FDZA 1ZJIA 2BXVA 1LCOA 4AB4A 1TMHA 4GXMA 5DCDA 1HO4A 4RZ6A 4JTIA 5L9FA 2TPSA 1ZAHA 2YDAA 2Q3RA 3DFNA 4UTJA 5FEXA 3BW3A 5KZMA 3AJXA 3SR7A 4O0ZA 5EY5A 4TMCA 4O15A 4LWWA 3U2OA 3W07A 4PL1A 1HUVA 1PV8A 4UIOA 3RU6A 4YLWA 5F1VA 4JDBA 3BGGA 2ISVA 4GFSA 5CZ0A 5G2HA 2J24A 1TPEA 4PODA 1M7OA 1JCLA 3CLMA 2BSLA 4CQ9A 5KTLA 1ADOA 3HO8A 3DKLA 2V2CA 1W31A 3TU9A 4FIQA 1RR2A 4WJEA 1OFRA 2YYUA 4K7YA 1FWNA 1PS9A 3SI9A 4E2DA 3PS7A 4FHAA 1U83A 3W23A 1H7NA 1VCFA 3CQ0A 1PIIA 1QMLA 3G8RA 2QCLA 3OA3A 2E09A 3W7LA 3L67A 4HT3A 3TW7A 1WV2A 2GOUA 5LNSA 1M5WA 2CLOA 1A5CA 3P5ZA 3W7GA 3C8FA 2G96A 1LROA 3EXTA 3PM6A 5IM51 3F03K 4RXGA 1THFD 1H60A 1XUZA 1KM6A 3BW4A 3LV6A 4IXXA 5LHEA 4JTTA 3O63A 1Q45A 3BG3A 4I7VA 4A22A 2NWSA 1DJQA 3LHZA 1VR6A 3U8GA 1ZALA 1XXXA 3TMQA 3PB2A 1VJIA 1HO1A 3CHVA 4FX8A 1EP2A 1G4PA 4O8RA 3EXSA 2DZXA 1WAUA 3FJ6A 1KBJA 3MHUA 3TDFA 1MXSA 1WXJA 3IVUA 2NXIA 1EX5A 3EX2A 4UUIA 1Y0EA 4UFHA 5D38A 2WQPA 1WQ5A 3W2KA 1K03A 3LXCA 2ZRZA 3W70A 3TXZA 1RD5A 3OBKA 1PVNA 2ZFAA 1VHNA 2C13A 1H7WA 4K37A 5DLCA 3M5VA 5C5YA 2D73A 2A21A 1XM3A 4O1BA 4JTLA 3V75A 4Y8FA 3TKFA 2A5HA 4M6QA 1VZWA 4RR4A 2VENA 5I3HA 1N8FA 1C29A 4BF9A 5KITA 1GYLA 3TQVA 1EUAA 1G7VA 3F1QA 3QMSA 4FNRA 4Q4KA 4HSNA 1HTIA 1SPQA 1TPUA 5E0KA 1FDYA 1B4KA 4JIPA 5KMYA 4IX0A 3USBA 3Q37A 1KV5A 2J27A 4MZ8A 3TR2A 3E12A 1VYPX 5C6MA 2QDGA 4PC8A 4JYEA 4Z08A 3K30A 3W7DA 4NJJA 4WY0F 1K8ZA 3E96A 2V5LA 3NL2A 3E0IA 4IUOA 4TX9A 5BMWA 2NV1A 4UTHA 3PY2A 2VKZG 3G0SA 1KM0A 4M19A 4N6EA 3THAA 2QUVA 3S5NA 4AMAA 1TREA 5DBTA 3B06A 4H3DA 1EPXA 1MO0A 3NO5A 4IJBA 1M7PA 4UC5A 4N9DA 4IMDA 1YYAA 5IBXA 3YPIA 2UV8G 1JQXA 3MI3A 3BLEA 1QCWA 1LORA 4JX6A 4AEOA 1IF2A 1ME9A 5DXYA 4HPXA 1OVDA 1FCQA 3L9CA 3IVTA 3QF0A 3PC0A 3EX1A 3NOEA 4Y9AA 2Y62A 2AGKA 4QSHA 5J5RA 1NVMA 2X1SA 4BI5A 3KOFA 4RCXA 2Z6IA 3W1QA 3FS2A 1H7OA 4UNLA 2RFGA 5FEWA 1CX9A 1SZFA 3HGJA 3LRMA 3DAQA 4DF1A 3TK7A 4MFDA 4YMZA 5E93A 1GVRA 3WK3A 1P4CA 4YL2A 3KXQA 1TTIA 4AWSA 1YDOA 3R2GA 3W7HA 3HPXA 4X3ZA 3UWVA 2ZZ3A 2G97A 3HOJA 1SU5A 3C52A 3B03A 2J9YA 2WJZA 4K6AA 3PUEA 2QR6A 2V82A 3DHFA 5HR7A 4OE7A 4JTHA 1PCWA 3NL6A 1YPFA 3GAKA 4JTUA 3L0KA 3WK0A 3IIVA 1G4EA 1EWDA 2W6RA 1XBZA 4Q33A 3TSBA 1IXQA 4GUFA 2CW6A 3ATZA 3TUUA 4GUHA 2DU2A 3W73A 3I7QA 4HSOA 1AL8A 3OIXA 4WXZA 3NM3A 4UFIA 2A2IA 2EGZA 5G4EA 4DO5A 1K8XA 1S5TA 1YXDA 3NL3A 5CPMA 3W1TA 3W1UA 3O15A 3AO0A 1GJPA 2ZZ2A 2HS6A 4ZQOA 1H7PA 3S9YA 4UFMA 1W3TA 1TTJA 5TIMA 1R30A 1AW5A 2DORA 5LSMA 2DZWA 3FFSA 3D0CA 1GVQA 3NQ8A 1OX4B 4ZQMA 1OF8A 4FEZA 4HPJA 1G6CA 3ABQA 3MI2A 3EWZA 5LNUA 4I7UA 2FB2A 4IOTA 2NLIA 3BGJA 4ADTA 1F6PA 1KM1A 5HINA 3TE9A 4RZ4A 3LI0A 3W7IA 4OBTA 1DKWA 2TRSA 3BLFA 5KZEA 1SSGA 3DFOA 2AQWA 4JICA 1JRCA 3TSMA 1W3IA 3ANYA 4Z1DA 3I6RA 5IBXC 4MIMA 3C2OA 1QDSA 2ZA2A 4MZ1A 3HB9A 3W1NA 4QAIA 3HPSA 3FJLA 4RX0A 3BO9A 4N9BA 3W87A 3GXPA 3NM1A 3NAVA 3LTYA 1BEUA 3R89A 1LZOA 2E6DA 1KLYA 2QCDB 2FDSA 1F74A 1JUKA 1FCBA 1ZFJA 1TQXA 2ZZ4A 4XWUA 1YDNA 5EYWA 3H55A 3NDOA 4MJMA 4JTEA 5AYYA 3MP5A 1LRTA 3JRKA 4LUJA 3G1XA 2I1OA 2A0NA 3GYEA 3M5ZA 2CLHA 5FI8A 4JX5A 3NQVA 1GQNA 1VLIA 1W56A 4UTWC 2E6FA 1CW2A 3GX9A 1ML1A 3GAYA 4DBDA 2ATMA 5AYZA 2QCFA 4IXHA 1GG0A 2QEZA 1SZGA 3P7YA 3P61A 3CPRA 4AHPA 2A85A 3GLCA 3T7VA 3SW6A
chains in the Genus database with same CATH superfamily
4HD5A 4U3CA 2NX9A 4XO7A 4JTCA 2Z0IA 3WDQA 1TSIA 1J5TA 1D3HA 2R1KA 2J7DA 3UNDA 1H41A 2PTDA 3UP8A 4DYEA 4H9VA 4TX8A 1R3QA 1W1B1 4Z1YA 4GVHA 2QDDA 2WHJA 3IUIA 1E0TA 3GNOA 1Z44A 2PDXA 3FXGA 2OO6A 1TWIA 4BQ2A 2VC7A 1VPQA 1O60A 3R7MA 3ZT7A 1P6CA 3NCOA 2VGGA 3WJZA 3M0ZA 4A21A 1E6RA 1US3A 4R34A 2VXNA 3QLDA 3N6QA 1XGZA 1S2CA 2HMCA 2BTMA 3DI1A 3HU7A 3M43A 1BWLA 4S39A 3VKDA 2ADAA 2DPEA 3KBWA 6CGTA 4QS6A 1JCXA 4X2RA 4AF0B 3MKVA 2B7QA 3OU8A 3UG5A 2H8ZA 2OVLA 3N34A 4KFOA 1E3ZA 1EL3A 1QT1A 2Z28A 2G8ZA 4WKFA 4DUVA 1H11A 4Q32A 4Q3MA 3IJLA 1V4YA 4LVAA 1JIBA 2PWHA 3IIZA 4QG9A 3QLLA 3EAUA 3EZ4A 4IFRA 1W32A 4YWIA 3UY7A 5EGRA 5JH1A 3KRSA 1WKFA 2NQZA 5HPCA 3QTGA 1AUSL 4I9TA 1U5HA 1LQ0A 2DIKA 1F6KA 2VFHA 4B2DD 3SUVA 2WZIA 3RX3A 1H1ZA 2WSRA 1BWVA 4KCVA 4V1YA 4KIRA 3SY5A 2XFRA 3KCLA 3QPYA 4HA0A 1YXCA 2OG9A 2BGNE 2EF9A 2WHMA 1S2TA 3TYUA 3VU2A 4DZHA 1ZBCA 2WPGA 1FP8A 2IKIA 2OZ0A 1MFVA 2VFEA 2RJHA 4PEKA 4H6RA 1C8XA 3U48A 1XIHA 4BF5A 4KCWA 4DF0A 2WZTA 4PMQA 3C0QA 1Z3NA 4LTSA 3IIPA 5AC4A 4N9EA 5DMLA 2A7RA 2G3MA 1A49A 1OABA 1R7OA 3NUKA 3FA3A 3PSVA 4HKPA 2HVNA 3S42A 1W5NA 3LBOA 4AYSA 1K9DA 3WQOA 2QCEA 4Y96A 1NP2A 4RDYA 3TZFA 5B7ZA 5I3KA 1EBGA 2GJLA 4XAZA 3RXZA 2YYTA 4Z0SA 2XZ9A 4AHOA 1XUUA 3SCPA 1NOUA 2HK0A 3L4ZA 3GBDA 3QR0A 3M9YA 3WNOA 3N2TA 1NOWA 3T4CA 1GJUA 3QH2A 1NARA 2VO5A 2A3HA 5CPQA 4FLQA 1I2OA 3UWZA 1E1FA 3SADA 4IGHA 2QIWA 1GQKA 3LNPA 2UY3A 4J3WA 2V68A 5T9BG 1Q6FA 3S5ZA 5CC5A 3HPFA 2P0OA 4AZIA 4OQVA 2FZBA 4HCDA 4B2DA 3SRDA 4NZFA 4AFYA 1GQJA 5AKQA 2Z1BA 5ECUA 1SO5A 3G24A 7ODCA 3G1AA 2IPJA 3UR7A 5D8ZA 4UQDA 2F2KA 3TVAA 4HHPA 3WDPP 1UR1A 1QO2A 4GQQA 4NXSA 3T07A 3HQNA 3K5XA 2Y7EA 4IISA 1X7FA 3T05A 1QNPA 4PTVA 4HP5A 4Q4QA 1HJUA 1CEOA 4JKMA 1RV8A 5D37A 2Z00A 4JNZA 1EJ7L 5DT7A 1J0YA 3WLNA 3H22A 3B8WA 4H7VA 3VPLA 4CGTA 1S3HA 1LOLA 3GR4A 2BOEX 1ITUA 3EB4A 4QLJA 5AHNA 3LM7A 4QLKA 3H24A 3VKJA 3MT1A 3K2GA 3EDEA 1P7TA 1A0DA 4M7SA 1M9HA 4UXDA 4PSRA 1PDZA 3GTXA 1SUXA 2X2GA 8CGTA 2VEFA 1XRFA 1VEPA 1S5VA 2J9ZA 1DWFM 4OV9A 4O11A 4DZ5A 3HTWA 1US0A 3UZZA 4HK5A 3TNOA 4A3YA 5HULA 4DEFA 2BS9A 3KVLA 3OGRA 5BOEA 1K77A 1OF6A 1BXNA 3R0KA 4LCQA 4YN5A 1IR1A 3MYOA 3RU8X 3PBWA 2WNNA 3L21A 3NWRA 1HP5A 2YZRA 3PUDA 2CYGA 3RPDA 3IJ9A 4U5IA 2XM2A 3NPXA 1RP9A 3MKCA 4JEQA 5LKYA 2PDUA 3QFWA 3W86A 3BAIA 2VVNA 4LVDA 3VOJA 1W8SA 1D7KA 1VC4A 2IXVA 2D1ZA 3RM4A 3HIJA 1KRMA 3CS2A 3E3HA 3WN6A 2FPTA 1EUNA 1V6UA 5LGZA 2VZTA 4O1FA 2BX7A 4I9MA 3KAOA 1XYMA 4GOAA 1PBGA 1QW8A 3LHTA 4XTDA 3WH9A 4G1KA 1GHRA 4I6VA 3ZM8A 1E55A 3L4UA 1DIDA 1FQ0A 4PFMA 1ZCOA 3NEVA 1AK5A 5ECVA 3KP0A 1VJZA 3OW1A 3O0KA 3OVRA 2WSPA 4QQ3A 1QHPA 3MC5A 3W75A 4R3UA 2XN0A 4PB5A 2ALDA 4BFAA 3RLGA 2GWGA 1N7KA 1A4MA 1FH8A 2PWGA 1X97A 3EPMA 4I5RA 4EPDC 3E0VA 4AC7C 4ZOAA 4R7WA 3C0JA 4PCFA 3BE7A 3TQPA 4D6JA 1NF7A 2NQLA 1VCGA 4PMZA 3ECQA 4GYPC 4LRSA 4GQRA 4WGXA 3T08A 3W7CA 9XIMA 4LEFA 3VXGA 2C14A 3S1UA 1FXPA 3WNPA 3NURA 4XTIA 2XFWA 3G22A 3RCYA 1Q6RA 3JVAA 4LB4A 3BLOA 2HVMA 4KQNA 4B5NA 2R1LA 1FWSA 2HTMA 3W00A 3GDLA 3M0JA 2VDHA 3N2MA 3O3RA 1LBLA 1B3YA 3GDBA 4H1ZA 2GQ3A 1OGGA 4IMAA 4NX5A 3IV8A 4TTGA 4QCEA 4Z2GA 3GK0A 4M0XA 2CNCA 3M0IA 3F4WA 3CPGA 3M0MA 4PB4A 1IHIA 4ZXLA 2NSXA 2J88A 4WDXA 2CPUA 2IQDA 4C6CA 2WC3A 3IAQA 3CL6A 3PPCA 3BK0A 8RUCA 5I24A 4Z1CA 3N9SA 3S6TA 4XB3A 1IQ8A 1OWQA 5I3JA 1G9HA 4GKTA 4JN8A 4AZCA 1VB9A 3DH7A 3DXIA 3IJIA 4ZB2A 1C8VA 1POKA 3I68A 5E6YA 3A21A 3ARZA 3S5OA 3FJNA 1QWGA 2DIEA 5HMSA 4PMYA 1MUWA 1CLXA 1F3TA 3PK7A 1W1ZA 2ZVRA 3SUUA 2OGJA 4DPQA 1LQAA 3BQ6A 5REQA 2VZUA 2V67A 1Q63A 1E70M 4DM1A 3B8SA 1E6SM 3V0SA 4AD1A 4LOCA 4WEVX 3VIFA 1RQEA 5FIPA 3DDMA 3PBYA 5M3WA 4MWAD 1EOKA 1ONXA 5AECA 3M1ZA 3BV4A 1VRXA 5C2CA 1JL8A 3CZ8A 4TVDA 5ABFB 1QPQA 3LQLA 3CV6A 3CUXA 2Z6JA 4R33A 2DSKA 3BANA 5FL1A 1JF6A 2VURA 5DY3A 4HZMA 4HOZA 1I8JA 5I78A 3E0LA 1OG6A 3S1GA 5CZSA 3WF3A 1L2UA 1O94A 4URIA 4MNJA 1B54A 3CV1A 5EA9A 4FNUA 6XIMA 3MJMA 3WL1A 3CK5A 5A2BA 2Y7GA 1A5MC 4XAGA 4C6NA 3VD4A 5H2ZA 1E9YB 4W87A 3H26A 3NA8A 2NV9A 3WO8A 1UUMA 1EYWA 1BRLA 2PDIA 2BXZA 5HANA 3L2LA 3P82A 2FTPA 4GZ7A 5DN1A 1CECA 4Y7EA 5I3IA 1GKQA 3LM3A 3NGJA 4IGSA 4DM2A 3VUPA 3WQEA 4BR1A 3LLDA 4UTKA 1Q6GA 3LERA 4I9AA 3UJ2A 2ZRWA 5LIWX 4NJIA 3CUHA 4NAEB 2QQ6A 2FMNA 3JW7A 3LCHA 1J2WA 1MMFA 3VCNA 3WSUA 3W7MA 3HGOA 4MWAA 1A3XA 2B7NA 3RLHA 4DWSA 2NUYA 4JTDA 3HMJG 2C1GA 2AOSA 1JZ5A 3AMGA 5CGTA 4O1AA 4U4MA 1PPIA 3MP4A 4YHGA 1R0MA 3FJ4A 4V27A 2G4FA 3QXBA 2RH9A 2DZBA 2F84A 1HKVA 1L6SA 4GYPA 1AD4A 2GL5A 1BG9A 1EXPA 4M5PA 3RM9A 4N0RA 1QOQA 1ME8A 1ZENA 4JDYA 2HXTA 1ALDA 2QULA 1XCFA 3UPWA 7TIMA 3OBEA 1QI0A 2CZVA 3CM4A 1OC7A 1OY0A 3GIPA 5HAOA 4H7ZA 1KTNA 1REQA 3QV8A 1PHWA 4RUBA 3RN6A 1YW1A 1XPGA 2Q09A 3P2VA 4LSBA 4QP0A 1F8MA 4QJ1A 1XDJA 3JU2A 3LPGA 3K1DA 5EBUA 2WSQA 1PX3A 4HQVA 4Z1BA 4H2HA 3TP4A 2V5JA 4MSSA 1TKKA 3MPGA 3NQMA 5HXMA 2C1HA 3BV7A 2VUNA 2PDQA 5D33A 1W2VA 3CUIA 3KTXA 3S2NA 1Z8AA 1GPWA 3W29A 1MEHA 1Y5XA 4S3FA 1QTWA 1XQKA 1XKYA 4Q8UA 5F2IA 2PRMA 3OZPA 1KXQA 1IZKA 2E67A 2PWVA 4UMBA 4NQ1A 3S1XA 4BF7A 5F2GA 1LDCA 1W1IE 2A1YA 4ONVA 5CGMA 4MLJA 1KQYA 3UWYA 1V6TA 1C9WA 2J7FA 2ZZ7A 4H8NA 2PZ0A 2Z26A 4AIUA 2O9PA 2BWGA 1TV8A 3GTNA 5CC7A 3V7PA 4FNSA 4Z2HA 4NZJA 4HNNA 1MDLA 4D8LA 2Y8KA 3TFXA 3P60A 4EIVA 4R27A 4GFIA 5C2XA 2X0YA 4A3UA 4KERA 2ONEA 3W27A 1UWUA 2B31A 1L8NA 4KT2A 4PUWA 3W4RA 3P5YA 1JYWA 2CBIA 5D9PA 1XINA 3W2MA 4Y90A 5I2UA 5FF0A 5AYBA 2WNZA 3SSJA 3G1HA 2BY0A 4S2BA 3TR9A 1VFHA 1PYFA 5EMJA 2ZBTA 4EANA 1J0JA 1XDMA 3VM5A 4NNBA 2XVLA 1VGAA 3UW6A 5M17A 4ZCWA 4EVZA 4J2MA 3WF2A 4JN7A 3WX7A 3WLMA 1FWFC 1YDVA 3GR8A 4XD3A 4P7QA 3BJSA 4XUGA 3QY8A 1VFFA 3BDKA 1TPFA 3HG3A 3M47A 2R8WA 4PTDA 1JG9A 4GACA 4UQAA 2OEKA 3ITYA 1VYSX 3UWUA 1K7FA 4HZ7A 3NQ2A 1TYGA 2VWSA 1QW7A 3F4VA 1SZRA 4YTTA 4GD0A 4M8UA 1KV8A 2WO5A 3FHQA 3ITLA 3PZGA 2GGGA 4WUIA 4JZ5A 4LY4A 3RJYA 1OG0A 2W67A 4YS1A 1G7UA 1BG4A 2XH4A 3TMLA 4XO6A 4B9ZA 4GBUA 1W0MA 3RLUA 4W4QA 1TR9A 3B05A 3VGGA 3MTWA 5FACA 4JYFA 4BWLA 2BLEA 4W8LA 1OCJA 1QJWA 3TN4A 3M0XA 1UA3A 1MNSA 5C55A 2GZXA 2PEVA 1HKMA 1RY0A 1V0NA 1BSLA 4D6FA 1KTCA 2WM1A 3KP1A 2Z1XA 3ANUA 3H54A 3GU1A 3CB8A 5E6ZA 3K8LA 3L2MA 4NX0A 4H8UA 4L4OA 1S5WA 2C0AA 4C6JA 3OVQA 1OGBA 3O6CA 3VZXA 4OUIA 2PTXA 3ARRA 4C1NA 5AHLA 4GX9A 4OV4A 4M6UA 3TXVA 2ZZ5A 1M53A 2J7HA 1DXFA 4QCFA 4UFLA 2BMBA 3DFSA 3SCVA 3CWOX 3EWBX 1XICA 3QQWA 2VM8A 2X1IA 1ITQA 2OOGA 2J6XA 1Q6OA 4K8EA 2Z29A 1QPRA 1FX6A 4AWTA 5C9WA 2D0FA 3TJ4A 3FKKA 3PR2A 4G1NA 1B1YA 2OYLA 4ZB5A 2NX1A 3GNXA 2QCNA 3ARXA 1FXQA 3THCA 3KHJA 2G3NA 4C1LA 2O4QA 1EA0A 2WMIA 1ODUA 3STFA 3DHDA 3UXAA 3VOHA 4YIWA 4RK8A 4Z0JA 4GZIA 1W54A 4AWEA 9RUBA 1BQGA 3PP7A 4JEJA 1UKOA 4NHVA 1HJQA 3SFWA 1H09A 3W1RA 2QS8A 5BXSA 2D2OA 2VFGA 3LMYA 3W7KA 4AISA 3WD1A 1GZ1A 1RHCA 1L8PA 1IR2A 1O5QA 4CEXC 1ISWA 1JNEA 2E6AA 5H8PA 3SIZA 4HNUA 1G4SA 3USZA 3HN3A 3LXBA 1EGZA 4ILSA 1DHKA 1ZZMA 1RLDA 1CNVA 4BZYA 5SWUA 3FNDA 2QKFA 5AN7A 3LENA 2PGWA 3PUGA 1GOQA 3BAYA 4UQ9A 3IANA 1E3XA 3SB0A 3EEZA 1AH4A 4F0RA 1UH3A 3C2EA 3B8VA 3WKZA 3N17A 4J3TA 2CITA 5C70A 3T9PA 2ZICA 3PFRA 4WHBA 5FJTA 4GINA 2B7OA 2QUNA 1PAMA 3LB0A 3M41A 2GLKA 4UQBA 2XVKA 1M04A 1A5NC 5D02A 1GNXA 4O54A 4DWSD 1OCBA 1I2RA 2RDXA 2CERA 4L64A 2PDMA 3UWWA 1S2WA 1AH0A 3PZQA 3OO2A 2P88A 1A3WA 1XLAA 1NEYA 1VBUA 1OFEA 3ARPA 2FFCA 3I4KA 2VRQA 4UFKA 2QPSA 5K9XA 3KRBA 4C65A 2OT0A 1WP6A 3WH7A 3DX5A 3LGEA 1QOPA 5L6UA 3FOKA 3KCJA 2QNEA 2GJNA 3QQ1A 3WQ5A 3M0LA 1AVAA 1K3UA 1QU4A 4E2BA 1OIFA 2YBVA 2WQDA 2WMGA 3STEA 1QR7A 2OFJA 5A6AA 2J9XA 5EMUA 3N4AA 1CWYA 4IMGA 3W2NA 5H6HA 2YOCA 3ARVA 1DBTA 2E7FA 4DWDA 3UXLA 3BAJA 2CLEA 4AW7A 5C9RA 1E6ZA 1TX2A 2VC5A 1XIJA 4M1RA 1JDEA 2VI0A 4HJWA 4ML4A 1CGWA 5T8GA 7XIMA 4AF0A 3ISIX 2VEGA 1X8FA 2RDUA 3F4DA 5FA5A 3GG1A 1BVWA 2P8BA 3CNYA 1Q4NX 5LHFA 4HYVA 3NZGA 4FSAA 4MJ2A 5JXQA 2Y6ZA 4ZQRA 5HQMA 4AX7A 3ARWA 4RZBA 2PTZA 2OX1A 1G0CA 1JUBA 2XTKA 3KBJA 1K9FA 3K8MA 3AI0A 1GOKA 3L0GA 3FYYA 1XRSA 2PDNA 1FA2A 3W28A 1IT8A 1RH9A 3BOFA 3E0FA 2V63A 2ON3A 3E9AA 3IRSA 1E6NA 4F9JA 5BYWA 1AH3A 1JQVA 1JDFA 3RMJA 2D0HA 4S1FA 3NZPA 4CNUA 3ONBA 3LOTA 1QVBA 3BG5A 4AD0A 5E1QA 1TA3B 3WELA 3KWXA 4ZSUA 3NXFA 4DBEA 2ANUA 5LZLA 3V5CA 3KX6A 3H12A 5A2CA 1GG1A 3WNLA 1LOQA 1KW1A 2XH7A 3IGXA 3QGVA 3FCPA 1DJNA 3APYA 5DANA 5ABGA 3FXYA 1O95A 3SAZA 3VC6A 5HA7A 3BL3A 5FSDC 3ATYA 2JKPA 1T99A 3LTPA 4DELA 2QCCA 2NT1A 4N6FA 3WF1A 2NZLA 4DJFA 3WFLA 1VQTA 4XZMX 2V5DA 5LA0A 1TMHA 4J3UA 1UKQA 4RZ6A 1A5LC 1C8QA 3WG6A 1TWWA 4QLLA 3VZZA 3UG3A 4HA4A 4KGJA 5FEXA 3LD5A 3SR7A 4TMCA 4GYFA 4O15A 3CUZA 3K1GA 3VOGA 1Q6EA 2JEPA 2FTWA 2EQDA 4PL1A 1I75A 4GVFA 1XGEA 2OGYA 4JDBA 4PUKA 3BGGA 1XJBA 5EMKA 1AQMA 4I9JA 1DWHM 2WM0A 1R3RA 3BMXA 2BSLA 4H9TA 3GH4A 5KTLA 1E9IA 1U1UA 2QV4A 1PKYA 1RR2A 4WJEA 4QG8A 1UBPC 1PS9A 4JAWA 1DJGA 3VTRA 4FHAA 1P0BA 1U83A 2DW7A 4FS9A 1U5VA 3PTQA 5M03A 3OODA 2OXNA 2VYOA 2FGLA 3OA3A 3UJFA 3GH7A 4HU4A 2P8CA 3CUJA 1WV2A 5LNSA 3K4DA 2PFHA 4KEMA 1ZLPA 4PZVA 5CJMA 4AQLA 1LROA 1CCWB 1B0IA 4TV5A 5IHRA 4L9YA 4RXGA 1THFD 4C6KA 1XUZA 1KM6A 5LHEA 1E0WA 4UOQA 1Q45A 4I7VA 1DYSA 1WZMA 3LHZA 3KM8A 4U5KA 3TEVA 3VIKA 1ZALA 1XXXA 3PB2A 3UETA 1VJIA 3CHVA 2W91A 3EXSA 2ZADA 2BVYA 2WMFA 1UA7A 4X61A 2TAAA 4W7UA 1Y0EA 3W2KA 3QY6A 5FAJA 1FHVA 1H3GA 3V0TA 3GFXA 3W70A 3TXZA 4GH3A 4R9OA 4Q4OA 2ZFAA 1VHNA 3H2EA 4BEUA 3DG6A 5C5YA 4LF2A 4JTLA 4B5XA 2A5HA 4MKSA 4XSMA 5TF0A 1NQ6A 4QX4A 4LBRA 2W63A 5I3HA 3SM0A 3N3TA 4QG6A 1LG2A 1GYLA 5CC3A 4FNRA 3GXMA 4CEUC 2YB4A 1HGWA 1CENA 4WVXA 4UOZA 5A94A 3USBA 3VKCA 2ZC1A 3CMJA 3TYZA 1HQTA 1HVXA 4LUTA 2PZNA 4C5ZA 4H04A 4IIFA 4PC8A 4JYEA 4W93A 3AAMA 5BMWA 2VKZG 3RJXA 4M19A 3PZNA 4BKNA 1AQFA 1FH9A 3SUWA 1GQLA 2WXDM 4H3DA 1EPXA 4RE4A 2NVAA 3VDCA 1UP3A 3BH4A 3NFUA 4N9DA 4IMDA 5MKGB 3YPIA 5FSEC 2G3JA 2VC9A 3N2CA 4AEOA 1ME9A 1TWZA 3IVTA 1KNWA 2V5KA 3PC0A 3EX1A 4Y9AA 1FRBA 2AGKA 3WENA 4DY1A 1ZL1A 1Y5VA 1P6BA 4HOWA 2ISDA 2BVDA 4LJ3A 1CX9A 4ACZB 3LRMA 4DF1A 4YMZA 1J11A 2WBGA 4B92A 1GVRA 3WK3A 1P4CA 3KXQA 3HPXA 3THUA 3AISA 4L1XA 1QK2A 5C0QA 2G97A 1SU5A 1FWDC 5HMFA 2WJZA 4K6AA 3L4TA 3PUEA 3N18A 2RGMA 4E8CA 3GVRA 1E1CB 3AJ7A 3QGKC 4JTHA 1K4HA 2YLLA 1PCWA 2CESA 1YPFA 4UWMA 3GAKA 2NT0A 4ROQA 3PANA 1G4EA 4CD7A 2W6RA 3FGCB 4AIBA 3ZT6A 4OOUA 1IXQA 4GUFA 4RE2A 4V33A 3WUGA 2XIJA 3I7QA 2AMXA 1B5TA 2A2IA 4OTKA 1TUFA 1EZWA 1DIEA 2BOFX 1YXDA 3T2PA 4CUCA 1GJPA 3H4WA 4XIMA 2ZZ2A 3CL8A 1H7PA 3DG3A 1W3TA 5CZKA 1TTJA 4L6OA 2IKGA 5LSMA 2DZWA 4QBXA 1GVQA 1V6XA 2DT2A 1OF8A 2Z2BA 3ABQA 4YJ5A 2G3FA 4WLCA 3VDAA 3WD4A 4IOTA 3BGJA 4ADTA 1TVLA 1TV2A 3T4WA 3W7IA 3S9IA 4OBTA 5KZEA 2TRSA 1SSGA 3BJTA 1W3IA 3A12A 1E56A 1C90A 4TVUA 1QDSA 2ZUMA 3QR3A 2ASHA 1PX4A 1HIZA 4IPNB 4H00A 3ZJ6A 1CBGA 3NAVA 2V5CA 3R89A 2E6DA 5J04A 2PLKA 2E3ZA 4M82A 5G4HC 1KLYA 2QCDB 2FDSA 3UCQA 3B40A 1E43A 1JUKA 3QY7A 5LYRA 2ZZ4A 2CHRA 2ZUTA 5IOBA 5EYWA 3H55A 3TTYA 1DJWA 4JTEA 3GRIA 2OPJA 1H2JA 3MP5A 4P8UA 2VT0A 2XHYA 4Z2LA 1J79A 4YTRA 2X42A 1JYXA 3OIHA 1CGTA 3GYEA 4AZCB 3M5ZA 3AS1A 3ZSSA 1ML1A 1NM9A 1S2AA 2ATMA 2QXWA 3P7YA 2EPMX 4ZE4A 5DX7A 2HQAA 3GM8A 2WK2A 4C6QA 4AHPA 4TX6A 3IACA 1SMAA 3STCA 2KAUC 3PFMA 2PDWA 2CLFA 3L7RA 3BXWA 4OFCA 2YLAA 4LV4A 3KS6A 2FGZA 1GVOA 3WMLA 5AYXA 1E5NA 5EL1A 5FF2A 3W37A 3R12A 4JIRA 5E09A 3W6MA 1IWPA 3C6CA 3CHDA 2W62A 1XC4A 4B91A 4JTJA 1OM0A 3P3BA 1H1YA 4W86A 2E6YA 1VFUA 2J25A 3DFTA 2J8FA 3AROA 1Z9AA 3FN9A 4X2PA 3EWWA 2DH3A 1H7XA 4JIQA 3N25A 5IXEA 3L66A 3UZ5A 2XYLA 3VDGA 1RLCL 3N6JA 2X1UA 2F38A 4WSJA 4H8HA 1J9YA 1XLBA 2W0UA 1CT5A 2PCQA 1UWIA 2QV5A 1QO5A 3UPBA 1ITXA 1LQ2A 4ZMGA 5CAHA 4OECA 2XFFA 2YXXA 3IUDA 3CL7A 1WCGA 4K38A 3HJEA 7REQB 1KFCA 4OUEA 4AZHA 3ZVHB 3EKZA 1R8LA 4PMUA 4O14A 1SM9A 5BZAA 4KCUA 4XZIA 1XG3A 3OP2A 1XH0A 4ICMA 4A4AA 3HG2A 2ISWA 1NFBA 2GVJA 3E02A 4MY9A 4MLRA 1YHTA 3CXOA 1UG6A 1RPXA 4CU6A 5AC7A 4QXIA 4MKVA 1YIXA 5LIYX 3DGBA 4ML9A 3CIXA 1BD0A 2V2HA 5CAKA 1QK0A 3W0KA 2VHLA 5I7GA 4DYKA 2H3DA 3U57A 4H9ZA 3W72A 3O2LA 3T6CA 2ZTJA 1GVEA 1QI4A 2ISFA 4PUEA 3T44A 2EG8A 1E4LA 2I14A 3ZQ9A 1ZHAA 1GOIA 2I5IA 3HGRA 2VGBA 3W7EA 3MU7A 2HS8A 4JIIX 4ATLA 3XIMA 1JD9A 5A8OA 3BMWA 4M6VA 1S39A 4XD4A 2Y88A 2PUZA 1NWSA 4KCTA 1PTGA 3R10A 3SECA 3AUOA 3PHAA 4NXKA 4KESA 4J9JA 4GNKB 4TMBA 4CU8A 4WXYA 4A29A 1ZBVA 3C0LA 3RRAA 3TSDA 1XIIA 3PTKA 2CZ5A 4C91A 4PRWA 4UMAA 1PZ1A 5CG7A 2X7WA 2DVUA 3K4AA 5T91A 4YYCA 3VIPA 1EPVA 2VD8A 3VZYA 4IPPA 4KRUA 1ENUA 2FHCA 3G1RA 3AHYA 3P0WA 5HK4A 2BG5A 4MDPA 3PBMA 4JCLA 1GVFA 1SFSA 3THQA 3H7UA 4YCPA 3HFTA 4LC8A 3UR2A 1YBQA 1F7BA 5BROA 3GSMA 5DO8A 4DJDC 4GVGA 4HOXA 1UPPA 5HUOA 5JMUA 4I7WA 3R13A 4LYQA 1XC6A 2YA1A 1X6LA 4EOUA 4CNNA 3OZOA 1LF1A 1ZY9A 4NJKA 3Q94A 2V38A 2ODOA 3W2LA 3INPA 3TN3A 3CT7A 4HA1A 3WMBA 3UA4A 3AHVA 1Y7VA 2YW3A 4A05A 5G4WA 1CGXA 2GK1A 3LRKA 4LAUA 1D7FA 5I06A 4UTMA 2OT1A 4CQDA 4Z2IA 4EE9A 2ZE3A 3OG2A 4XAPA 4IFKB 2Q8ZA 2HISA 4A3HA 4Y9PA 3QMTA 2Z1WA 5C54A 2QMJA 4E8GA 3Q4DA 3C4UA 1T8QA 3TJLA 1RVGA 5CBJA 2PP1A 3GNNA 4F48A 2NXGA 1NFGA 3R8RA 3VFLA 1W9XA 2V81A 3AIRA 4ZQCA 4EF9A 3IVSA 1QWKA 3V3WA 3VD5A 3PWAA 2XVGA 3VVGA 1KBIA 3URAA 2REQA 2OKTA 1ZUAX 3ENLA 4IICA 1Y5WA 1SR0A 3OYXA 1CGVA 3A4JA 3DOPA 3QRHA 2EG6A 3NL5A 3URQA 1RCXB 4Q7NA 1V7AA 2ZZ1A 4ZTYA 1HG3A 3I6EA 1JEZA 3TJXA 2GQ8A 2VX5A 1UR2A 4O18A 4HNTA 3B9NA 3CAQA 1NF0A 2BDQA 3DG7A 3B9DA 4LY8A 5C8BB 3WUBA 1J12A 3REQB 2OLHA 4YWSA 3WQFA 4C1NB 4AMCA 3VAVA 4LF1A 1E0UA 2ZRVA 4U3AA 3CZEA 3BWWA 2XPKA 2J47A 4MG4A 1XQLA 1EZ2A 2BODX 1R3SA 4JFTA 3GKFA 4UCGA 4CNTA 4QISA 5CCZA 3L23A 1C7SA 2XSXA 7CGTA 4GY1A 3ES8A 1KXHA 4LVFA 4CU7A 2TYSA 1AJ0A 1OFOA 3BZJA 2ZRYA 3R8HA 1VBJA 3BVJA 2C79A 2QCMA 4JTKA 4FOKA 2FH6A 1O12A 1GYNA 1RJPA 4X0VA 1V03A 3T09A 3OLEA 1B57A 1FKWA 3C3NA 3CWHA 3NG3A 3H4GA 4KRZA 5CPNA 3MWAA 2NUXA 3CQIA 4JTAA 1UP0A 3QFEA 1AW2A 1BTCA 4L4MA 4L9XA 3S2JA 2HEJA 4ZXOA 3SQLA 1CGYA 1PIGA 3KBNA 2XU2A 2OYMA 4UR7A 6A3HA 4ZFMA 4O1EA 3WL0A 2Q6ZA 5CZTA 3EA3A 3GXDA 2Y7DA 2X8RA 3FX4A 1B3OA 1H62A 1UR8A 5CBBA 3AIEA 1CXHA 2ISSA 4NZ1A 4UFJA 1P7TB 1FY6A 3BAXA 5AB3A 1DXIA 3AU6A 2JBMA 4LX4A 3W22A 3PG8A 1FWCC 4Q4SA 3ZO9A 1E4MM 4HU8A 3QMRA 4XAYA 1PTAA 3W85A 4S23A 3KTSA 3A5FA 3G1VA 2IW0A 3NOYA 1YLVA 2NSOA 2RKXA 4W9TA 1GVSA 1V8EA 4E5TA 1TELA 1MZHA 1KBKA 1OX4A 3UD6A 1JJKA 5EPDA 1BVNP 3HQOA 3A22A 4I8DA 1OQFA 2Q8XA 4BI7A 1VBGA 3MCMA 3TAOA 4QE4A 3WEZA 4IL2A 5AC6A 3W7QA 1J2BA 1W17A 4HNVA 2VJXA 3FY1A 1M3UA 3LI1A 4K68A 4JD4A 4XKYB 4NI3A 2W79A 4U28A 2ESCA 1GEHA 4O17A 2QJHA 1EP3A 3VNIA 4LQ1A 4JTRA 4ADSA 3PG9A 1SR9A 3DI0A 2F6KA 4R85A 1XISA 3UY8A 1F3XA 5DCEA 2Y85A 1KWGA 1VFTA 5HNUA 4DXVA 4JN6A 4ALDA 4Z17A 3ARYA 5G2WA 1IT7A 4X0NA 2WOQA 4JX4A 1NQKA 1MXDA 2FVLA 5K4ZA 1UKPA 2WJEA 2ZDRA 3LY0A 1SW0A 3DFYA 3RYSA 2C6QA 2HV5A 4QITA 4FAMA 2YXOA 1ZP4A 2HRWA 2QAPA 2ZWZA 4O4VA 1IZCA 2E28A 4D72A 3RM8A 1F76A 3EOOA 3FK4A 3RDKA 3TNBA 3E6EA 4GUIA 1DORA 1QAPA 4AZGA 1EQPA 1XLGA 3VMOA 1DL3A 3KL5A 2XH0A 2O9OA 1D2KA 3TX9A 3BG9A 1KM2A 4JQ2A 3L68A 1OYAA 1UZ1A 3SIMA 1IEXA 2AL2A 4W8AA 2OSYA 1JGIA 3BSHA 1V7YA 1PKLA 4BQ5A 1NTHA 2HXUA 1W5QA 1XYZA 5D2TA 1FCUA 6ENLA 3ITOA 2DFAA 4WSKA 2CCRA 1OEPA 3U6WA 4JHZA 4MAVA 3GU2A 1RQBA 3GVWA 1TV7A 2POZA 1JD7A 3NPVA 3AMLA 4AH7A 3WH5A 4B4FA 3ID7A 3NYZA 2BHZA 3UU0A 4RE0A 1GPFA 1W3LA 3PNZA 6REQA 1KCLA 3Q65A 3WLPA 4I6KA 2EJAA 2P10A 4RJEA 1WDSA 3LGDA 1SZEA 5A95A 1LT8A 4P7OA 2NX3A 3O16A 3VCRA 3W1PA 1DTNA 1VBHA 3CWNA 1GGOA 4EX4A 1DQUA 3SJ3A 1DJZA 4GC3A 2ZUNA 3T2QA 1TTQA 1OT2A 2A3CA 5K3VA 4YTUA 1ICSA 3PNUA 1UMYA 4REQB 4L4PA 5IDIA 2YIHA 3OVGA 4NSBA 4GCAA 1WDPA 4H4IA 5CSRA 3CC1A 2JGYA 1CXEA 2QAFA 4LS0A 1PZ3A 2EKCA 4C60A 3VGHA 2DSUA 3W2JA 3AIBA 1W37A 2JALA 3DFQA 4MPQA 1UYQA 1E4NA 3UWQA 5BMXA 1WNOA 1TPH1 2VNCA 3QV6A 4R9XA 4FI4A 5ABEA 3O06A 3K8KA 1DP0A 1Q6LA 4IG2A 2Q3OA 2VOTA 1EDTA 4U2ZA 1XX1A 1F9CA 1R2SA 1BWKA 1S1PA 3GU9A 4NYUA 1KFEA 3DIPA 4S3EA 2A7NA 2CBUA 4OU1A 2OJPA 4S3KA 5IFTA 1B90A 1XI3A 1DV7A 2PDHA 3WF4A 3DYMA 4ADUA 1FHUA 1UPMB 2OMAA 4DRSA 1R9ZA 3S8HA 3II1A 2ZUUA 2E9MA 4RNJA 4N2YA 3M5XA 1OZQA 3T0BA 5EB8A 1ZCCA 3ZLFA 1G69A 2AMGA 3EWCA 3B0UX 1MI3A 3P84A 5M2FX 3EKLA 3O9NA 1F73A 3TA9A 1GT8A 2SFPA 1DWIM 1MYRA 1T96A 3TYDA 1W9PA 3O7UA 2X0HA 4PCPA 2A6LA 2KZHA 3CV7A 2NQ9A 2CKRA 2PDGA 3H53A 1XLLA 3BARA 4FO4A 3W53A 1H5VA 1NP0A 1MZRA 3UNTA 3TC7A 4HNLA 1I60A 1CXIA 1CIUA 4FNTA 3KS5A 4IPLA 3S6DA 1A0CA 2WVTA 2ZVIA 1VIZA 4HJFA 3VGEA 5D9MA 3O6YX 5AC5A 2W27A 4C7DA 2ATSA 4PA8A 3VGBA 3AXMA 3CMFA 1LTDA 3C8NA 1ISXA 4CCZA 1GK8A 3DC0A 1R3YA 5G1YA 4O53A 3LUTA 1HJWA 3E1F1 3WQ8A 2VTFA 3L2IA 3U4AA 2YDSA 1UUOA 1OC6A 5DY2A 2R94A 1SJBA 3F2BA 3KRZA 2CWNA 1Z48A 2YBUA 3M7SA 5EBAA 4DJDD 3EKGA 5K9CA 4GJIA 4C6PA 4PEEA 3EPOA 3BLPX 2AQVA 4I5UA 5LXXA 2XIIA 4ZL1A 1QFEA 1NIUA 1CB2A 4E0CA 1IXNA 2XIOA 4F9DA 4M6PA 1UMLA 1ZNNA 4V15A 3GW3A 2J7EA 1TIMA 5KEZA 2JF7A 1A5SA 4ES4A 1SO6A 1WA3A 3HPAA 1G01A 3SRFA 2HE5A 2E8YA 1OZMA 1JPMA 4CQAA 2YA0A 3N04A 1W3KA 1T0OA 3ALFA 2QJIA 4HSHA 2J7CA 2OCZA 3ARUA 3BOXA 4QQUA 4JNYA 5B80A 3B0VC 4IJCA 3U7VA 2XSBA 2ZZ6A 4L80A 3CLWA 3C2YA 4FNPA 1R87A 6ALDA 1VP5A 2H6RA 1CGUA 3MV11 2P50A 1UCWA 4OHQA 4ORIA 5CC6A 2HPMA 4FXJA 1VPYA 3I7SA 4O28A 4FALA 1D3GA 4GUJA 1U5JA 3A9IA 3VIJA 4MWAC 1XYBA 2YCLB 3FLUA 4RDWA 4YCOA 1NDWA 3T0TA 2C8NA 5H91A 2DUZA 2YSWA 4XBSA 5H8UA 3EDFA 5F2MA 3UG4A 5GNZA 1UWAA 4JR5A 1YDYA 5ENLA 4WGHA 2YCEA 1P48A 2EAWA 4DNHA 5A8QA 3WQWA 4W89A 2H9AA 3QSTA 1V0KA 2QF8A 4XIAA 3ABXA 3VDBA 1WAWA 1OYBA 3DUGA 3AXHA 3FSUA 4Z1AA 1FHLA 4F66A 2GSEA 1BYDA 1AFSA 3KE0A 1DQWA 2VCAA 3B4YA 2OSXA 2X2YA 1E6QM 4KFNA 5CJ5A 1KM5A 1X1NA 3R5EA 1VFOA 4GA8A 2NW0A 4HIBA 1O6IA 4S3AA 3ZZ1A 1KFWA 1R86A 2PD9A 3CUFA 4XSLA 4DUWA 4UNIA 5GJNA 2FTYA 1F5ZA 3VCCA 2A79A 2GJRA 1YRRA 1PKMA 2INZA 2GDUA 3B9AA 4C6IA 4PFHA 3SDOA 3W71A 4Z2KA 4GYKA 1MNZA 3DU0A 4CVUA 3AIUA 1P0NA 1ZBKA 2C16A 3VIHA 2WBKA 1EBHA 5K7JA 3TJIA 4O16A 1DJXA 3S4TA 1IT0A 5CPOA 4E38A 1OX5A 4O57A 3C0SA 3P80A 5D05A 3BZGA 1CB7B 4R7OA 1BRLB 4H9UA 2WSYA 3M07A 4LPCA 5FF4A 1J96A 3IIXA 1Z89A 2HK1A 3GDRA 3UXDA 1GVYA 4RL3A 4MJZA 3WNMA 5HWMA 4QDWA 3DGRA 5EFFA 4KEZA 2V9DA 4JYDA 5GNXA 3VX1A 2CLPA 2EPHA 4D6GA 3NXLA 3W7RA 1GJWA 5CLWA 2XFYA 4KGLA 4IJRA 5A6BA 3O0FA 4G7EB 3ZFHA 4OWGA 2PBOA 3BSGA 4MYXA 4HHLA 5I03A 2H8XA 4WY0B 4NP7A 1O7AA 1DVJA 1V93A 2I16A 4NZCA 1J01A 4GUGA 4POCA 1H63A 3LHUA 2MUCA 2J77A 3SGZA 5LNWA 4DF2A 2FJKA 1B9BA 1Q3NA 1KCZA 3W88A 3WDJA 2V3FA 3ZWTA 2WHLA 5FJUA 1TWDA 4AX6A 3AS0A 3KL3A 2MANA 1RJQA 2PC8A 1BYBA 1T7LA 5HOSA 3RIKA 3P14A 4LS2A 4E2OA 2ABBA 3M0KA 2C15A 3S5SA 3WQ6A 5TQLA 1LYXA 4J5NA 3VD7A 4C6DA 3MB9A 2J4GA 1I1XA 1YPIA 2DW6A 1FCVA 1CLKA 3R11A 1JRBA 3CAVA 1PZ0A 2CFFA 4MZYA 4L1GA 3KFTA 3PBVA 5CKSA 3A23A 3BAKA 1ESWA 3QC0A 1OD0A 5U4NA 5ABTA 1JFXA 3NVTA 4NJHA 2YL8A 1NAL1 2WW5A 3PN8A 2ZE0A 3WMSA 4CNPA 4D1IA 3HURA 4UOJA 1R38A 3CIWA 3FA5A 3LLFA 2R1PA 3V5OA 1LUCB 4LCRA 2WZHA 4UTFA 1TJRA 4X60A 1YKWA 2XVNA 3EDDA 1PXGA 1GZGA 5I02A 1M6JA 4PMXA 4PUJA 3WQCA 4S3BA 1FWIC 4TR9A 3AXXA 3SCNA 4JY8A 2E5CA 4ASTA 4PUDA 4MUPA 1DXEA 3DKJA 1QHZA 2CEQA 5ABHA 4C7FA 2J13A 1S38A 3IV3A 5PTDA 4PTMA 4LAOA 1N55A 1J10A 4LVBA 2DT0A 4RNIA 2W5FA 3S1VA 1QI5A 3WQPA 1Q2RA 5CZJA 2ZCGA 1I2PA 1O5XA 4GKLA 2E5DA 2GUBA 4KBXA 4DQWA 1YTKA 3SN0A 3OZYA 1W5OA 4I3GA 3FYOA 1EDGA 2QVNA 4MJ4A 1MW3A 1W6TA 2I57A 1KCXA 2XDFA 3HQ1A 4F0HA 2YL9A 2OKOA 2OQHA 3G1DA 4EAMA 3N9RA 1DJYA 4P61A 2O9TA 2R1MA 1OBAA 3LX9A 4LUIA 1LWJA 3VD9A 1KD0A 5K4XA 4TOQA 4ZO8A 2BOGX 2AL1A 3NQEA 4WOQA 3HG4A 1FDZA 2JFEX 1LCOA 5DCDA 3QN3A 1HO4A 2HVOA 3SY8A 2TPSA 1V3HA 1ZAHA 7TAAA 1W9UA 3DFNA 2OYKA 4PMOA 5E5CA 4MHBA 4X9YA 2Y1HA 3N2BA 5KZMA 2EG7A 5EY5A 2GDVA 1FHDA 3KUMA 4IIEA 1BGGA 1PV8A 4MAZA 3RU6A 1ISYA 4J35A 3EOEA 2Y8UA 1EGMA 2J24A 3EMQA 3PPFA 4FK9A 4F8XA 3H2NA 1ADOA 3HO8A 1W31A 3TWAA 1TVPA 4DWSB 3B0XA 2AAAA 1MDRA 4FIQA 2YYUA 2PLCA 3H2OA 1TV3A 3FAWA 1VCFA 3PJTA 1Q13A 1FH7A 4XISA 1BAGA 2QCLA 3W26A 1GQIA 1W3JA 2Z1SA 3CHCA 1WDDA 3FDKA 3W7LA 3TW7A 2CLOA 1DPMA 4HYRA 2G96A 3B8TA 3EXTA 3NYDA 5DF0A 1KXTA 3MA8A 2BGSA 5CJNA 1OGSA 5F7UA 4JTTA 3BSMA 3BG3A 2Z4GA 1DJQA 5JBDA 5HPOA 4H6EA 4WR3A 1HNYA 4NAEA 1EP2A 1JNDA 2Z25A 1ITCA 2YKKA 4B3LA 1KBJA 2VGIA 3UZWA 3MHUA 1WXJA 3WBEA 3IVUA 2NXIA 3TLQA 1M7JA 4YHEA 3ZJ8A 1RCQA 4DJFD 3LXCA 2ZRZA 1ISVA 1UD8A 2C13A 1ZRQA 1H7WA 5DLCA 4HPGA 3V75A 1OIMA 3MZ2A 1A0EA 5BOFA 4S38A 4RR4A 1HN1A 4W5UA 4JQ4A 4US5D 3GVQA 3CUGA 5A1AA 3O6AA 4YVPA 1T5AA 3GBEA 3GH5A 4ZODA 5BU6A 1FOBA 2AQOA 5DRIA 4HSNA 1EHAA 3LYEA 4AG0A 1SPQA 1XH2A 2WKLA 3NSMA 2XVPA 5E0KA 1B4KA 1FP9A 1XS2A 5KMYA 1PTDA 3Q37A 4MZ8A 2J27A 3E12A 5CSYA 4GK8A 1VYPX 4OJYA 4Z08A 3W7DA 1K8ZA 5HMDA 3NL2A 4TX9A 3DYPA 2ZIDA 4BHYA 1HF6A 1XLHA 3GHTA 3GZAA 4JQAA 1JI2A 3G0SA 4AMAA 1R3WA 3V0UA 2ACUA 2IPFA 5DBTA 4HK6A 2I9UA 1MO0A 4D71A 1RXOB 4F0SA 1S46A 1UD2A 1UD4A 3AYTA 4B16A 4UC5A 2IS7A 1UR0A 1YYAA 2UV8G 2OO0A 4JX6A 3ZIZA 3H2MA 4DBUA 5DXYA 4HPXA 4RPQA 3UCDA 3KHDA 3NOEA 2Y62A 3PZTA 4QGCA 1R6WA 3UCCA 1OC5A 1ECQA 4BI5A 5D9OA 3VABA 2Z6IA 3FS2A 3COTA 3MSRA 4UNLA 4J2PA 1P0DA 3WCZA 3LEPA 5FEWA 1SZFA 4AZ5A 2PD5A 3DAQA 3TK7A 4MFDA 4ZOBA 2IKHA 5E93A 1D8CA 1YDOA 3W7HA 3HM7A 2YZ5A 4X3ZA 5HBFA 4L9ZA 3UWVA 3PPHA 4B3KA 5CG0A 4YU1A 1CXKA 3B03A 4QJ3B 2C7FA 2FZ9A 2QPUA 3PZIA 3DHFA 5HR7A 3KBVA 1GCYA 1VD6A 1XCXA 2WJDA 4JTUA 2DQXA 2WCSA 1Q4WA 1EWDA 1XBZA 2QJJA 1OCNA 2CW6A 3TUUA 2CWXA 1UWTA 1E6PA 3WF0A 4WXZA 4UFIA 4F3HA 3NVDA 2EGZA 2ICSA 3U5UA 4DO5A 5FD0A 3W1TA 3O15A 2JQXA 2OZTA 4ZQOA 3S9YA 4UFMA 3GXIA 4MGGA 4LUSB 3FFSA 1A3HA 3PPGA 4XZHA 1VFLA 3NQ8A 3PZ9A 3GE7A 4ZQMA 1YNQA 1LL7A 2O4MA 7A3HA 2D24A 4UQCA 5GJMA 3TZNA 3W01A 1ODZA 4I7UA 5A6LA 2UY4A 1F6PA 3H21A 1KM1A 5HINA 3LI0A 1DKWA 4QE5A 4UZUA 3DFOA 1QI3A 4JL2A 3WLOA 4Z1DA 1JGMA 4MIMA 5JQ9A 4PTWA 3A64A 4QAIA 3KOZA 3AS3A 3UJRA 4WCJA 2O0TA 1O66A 3ZVIA 3FJLA 4RX0A 3ZOAA 1XW8A 3W87A 4PRTA 2QUMA 4J1OA 3GXPA 4MWAB 2PU1A 4HCLA 2DUAA 2CC0A 1FCBA 1UD5A 4HVXA 2YCKX 1TQXA 3RITA 2I17A 1YDNA 2QYGA 3NDOA 4MJMA 3RG6A 2P76A 5AYYA 1CPUA 1W1A1 4RV3A 3QR1A 3G6LA 1LRTA 2CKSA 4WJ8A 4H9XA 3G1XA 2I1OA 2A0NA 4PBGA 1K9EA 2CLHA 5BRQA 2VZSA 4B9YA 1V77A 1J8VA 1W56A 2UBPC 1P43A 4PULA 2E6FA 5CXPA 3GX9A 5A69A 1DJHA 4GISA 2QCFA 1TE1A 1GVIA 4Q8VA 4M80A 3LSCA 3P61A 3I4EA 4WF7A 5IDZA 3WD0A 2BXYA 3PF3A 2J8GA 3HV9A 2Y5JA 4U31A 4NRRA 2IPGA 5I07A 1JULA 4GZEA 2YB1A 1MQQA 1JDCA 2FHBA 4JTQA 5CSUA 4IT1A 4XK2A 2F7FA 1IGSA 3T8QA 3EOSA 2A3BA 1JCJA 1K7EA 5DBUA 3LGGA 1KXVA 3MSYA 4RPPA 2BY3A 4QTGA 3M44A 3RK8A 3E5BA 3BW2A 1XYLA 2DY3A 3A3HA 3SUSA 3RFAA 2EJ1A 1TPC1 4J3SA 1BTMA 3HA1A 3B9EA 3LMZA 3PZMA 4MB3A 1WUFA 1WZAA 2PAJA 2TODA 4JOMA 2X16A 2WAGA 1ZU8A 4HU0A 1EP1A 5EMYA 3V36A 4AIOA 4AZ7A 3T42A 1OFAA 1SJAA 4L1WA 4N4QA 4AD2A 4MUZA 1LLOA 1QRQA 2OWCA 4G5DA 3DC8A 2D2GA 3ARSA 4BQ4A 1QBAA 3T55A 3DBNA 3LCIA 1H4PA 1IIGA 3FDGA 4TXEA 1BXBA 1TO3A 4L5ZA 2D0GA 1TB3A 3W2UA 1REQB 3WJSA 2F61A 4IPIA 3WDHA 3GR7A 4Z42C 3CH0A 5C2GA 5CBIA 3VINA 3SCSA 3R0UA 1YNYA 2QIIA 1S3TC 3EMZA 4DI8A 4AWUA 4OZOA 2WLZA 3IIOA 2JKEA 3A4XA 2FPVA 4EXQA 1QOXA 1EEPA 3OPSA 2VFIA 5BOOA 1QNSA 4LW7A 2A3LA 2D3LA 1R47A 4LAKA 4L6HA 3QM3A 4HMNA 4TV6A 5D9NA 3G3MA 3DFHA 3FAXA 1EA9C 4ZB0A 1L6YA 4NZ4A 2BV9A 1ZJAA 1BHGA 2BVWA 1F8IA 1O4UA 3MMTA 1IWAA 3VE9A 3OQEA 2I7GA 3LCLA 5E9XA 3ORWA 2BHUA 3TC6A 1EO5A 1EWEA 2ZA1A 3M7WA 4UTUA 4UCFA 1MWOA 4NYYA 4G56A 4KWSA 4N02A 3R6IA 4W88A 1H51A 1W8GA 2GQAA 3WLTA 5I0DA 1PCKA 3GXFA 1TQJA 3QOKA 2PF0A 4HN8A 2INEA 1KFJA 3MCNA 4JTGA 3N14A 4DPPA 4P8WA 3H2AA 1JXJA 4MOZA 2ZUVA 2JK2A 4QFUA 4C90A 3GKAA 4K8HA 4S3CA 3U5YA 1UR9A 1O1ZA 1VEMA 1Q6CA 3O05A 5EMMA 4ZOEA 1YNPA 3EX6A 1VH7A 2UY5A 2XN1A 2D2JA 2AGTA 4GNJA 1X1ZA 3QHMA 4XKMA 3EOLA 3VILA 3CB3A 4R88A 3MP3A 1C92A 3A3XA 2YGYA 5AHIA 3UVIA 1GKRA 3TW6A 4V2XA 3TAKA 1FFQA 3QJAA 1UWSA 2V5BA 3TYAA 1V6VA 4D6EA 3TTSA 1MW2A 3ZR6A 1MFUA 4HPNA 3B0PA 3RO8A 3AYSA 1AW1A 3UBPC 2WMJA 2E1WA 2J7BA 1AL7A 1LT7A 4UZSA 3NEHA 2CU0A 1HXJA 2ZYFA 4IQEA 1LWHA 1TWSA 1W1TA 8XIAA 1Z6KA 5K9DA 3B04A 3S46A 2CHOA 1ZJBA 3EPNA 2WVVB 4HMEA 4NASA 1KM3A 5FF7A 3BICA 1FUYA 4BWLC 1YX1A 9XIAA 2E5BA 3M5YA 4PSPA 3N2OA 4W85A 1PE1A 3UERA 5DFAA 3TWBA 1P0KA 4MB1A 1RY8A 2F2HA 1JVNA 4CCCA 1FWTA 4RNHA 4G2DA 4ZQNA 1K70A 3OHIA 1HL8A 2V2DA 2YR1A 4DZAA 1MXGA 5I3GA 3JUGA 4LC6A 5TBOA 3W9ZA 2NQHA 2TMDA 1VENA 4Q8MA 3IPWA 3SGGA 3IUHA 1EC7A 3C2FA 1H7RA 3E2QA 1NWTA 1XYCA 4DJEA 4YVVA 4GJJA 1JCNA 3SCTA 3E74A 1C8YA 2PWFA 5JBEA 1SGJA 4ERAA 2QZRA 3DFPA 4EPEC 1J0HA 3C86A 3UESA 1E51A 2G37A 1EQCA 3GQYA 2YX0A 3CGTA 3NR0A 1UJPA 1F4AA 4R5EA 3RILA 4FX7A 5GQBA 5HJLA 2DP3A 1AA1B 3AUJA 2WCAA 4TUFA 3FEMA 4EP8C 4FB7A 3P8JA 1M41A 4KWVA 1OYCA 3TTEA 2RDTA 3WD3A 3SRHA 2PURA 3NIYA 3QYQA 3GC5A 2PGFA 3CU2A 4DNMA 1QNOA 1B9ZA 4JFUA 5D2VA 4DHGA 4GO9A 5FESA 1K7XA 2AKMA 4IIDA 3IJ6A 4XD6A 2FHFA 4TQTA 2VEPA 3C61A 3CHEA 1UKTA 4IZGA 1KKRA 4YPJA 3KWSA 2CLKA 1EGVA 2X40A 4O0KA 4AVFA 1ZSXA 2NQJA 3U2CA 4CN1A 3AXKA 2W9MA 3RGTA 3U7BA 5D2XA 4LH8A 2WV8A 1PDYA 3OJGA 1W9BM 1WDWA 5HMEA 2PWEA 1UQZA 4HBKA 3VIGA 4J7RA 4CNOA 1UH4A 1WOAA 3B8DA 3BAWA 5DMNA 1TE6A 4Y9MA 2UY2A 3G1FA 1MUMA 4GLEA 1E73M 2YFNA 8TIMA 1IGWA 1KRBC 3PJUA 1OK6A 3SJNA 1I2NA 1TG7A 1A50A 1Q7MA 3RO6A 5CGQA 2VCCA 4XAFA 4DWSC 2HZGA 4B90A 4O8AA 2PGRA 1GOWA 3GDKA 1PZ2A 3VNZA 2V30A 4MFEA 1RA0A 1KR0A 4NT0A 2DJXA 3G1SA 4QSFA 1C3FA 4B5SA 3HQPA 2O55A 4Y6GA 2FYMA 3PJWA 1XBXA 3AC0A 3EEGA 4TU1A 3A47A 2QDHA 2VDIA 1EF3A 1K9TA 1JDAA 1NH6A 9CGTA 1DHPA 2RDWA 3W38A 1KFBA 2Y63A 4M29A 3BLDA 3MO7A 2Q8LA 1KFKA 2EHHA 4ZR8A 3M64A 1I0BA 4EAYA 3VUSA 3PWGA 3FYPA 3IARA 1V3MA 2E68A 2BFGA 4F0LA 1LP6A 2VZOA 1IXPA 1H50A 3CPUA 3GG7A 2P53A 2Y8VA 4ZQPA 3CJPA 1PL9A 3D46A 1W9DM 3CASA 5AYIA 3PBUA 1M03A 4UMCA 5FOOA 4UR9A 4NNCA 3C2RA 1UR3M 3M0VA 4INFA 4KW2A 2Z1KA 2WHKA 2QJNA 4JY9A 4MTVA 4PH6A 3VDHA 4Q6JA 3GC2A 4R53A 4JNMA 4A6GA 7REQA 2C71A 2H90A 2OSWA 3TC3A 1J4EA 2V6AA 4ROPA 2G3IA 3KVMA 3F7JA 2P3ZA 3DZ1A 3PAOA 5D04C 3TONA 1F6YA 2YA2A 1B30A 5LGXA 3FV9A 4K3ZA 1R7AA 3AICA 4F2TA 3EBVA 2D69A 1V51A 3ERPA 1X6UA 1XIEA 1UROA 4KF1A 4JCMA 3GXTA 3SN4A 3M16A 1IXOA 1KLZA 3H7RA 2PLJA 2C19A 3CMGA 5FJOA 5HQLA 1R3VA 3WZ0E 2HNEA 1G4TA 3E49A 2P1FA 3O6DA 1BKHA 2YCIX 3I7RA 4B5WA 3LN3A 4AAJA 1H0GA 2GWNA 3NQDA 2NVDA 3P81A 4Q8WA 1LOSA 1X39A 4O12A 5FJPA 3C2VA 2R24A 1XD0A 1HP4A 4QEEA 5F4XA 4NY2A 3QGAC 1LLZA 3N12A 2OTDA 3WFAA 2JIWA 4AXKA 1WPCA 1OADA 5G1MA 1K8YA 4F79A 3SCWA 1NDZA 2ABAA 2INFA 5LIUX 2JKAA 1J6OA 1RZMA 4XZLX 1UZHA 4LS1A 4F2UA 1ZJHA 1GHSA 3CQHA 4ZO6A 3S0CA 3H2FA 4N7QA 3QZAA 3UJSA 3HJZA 5A8NA 3KZSA 3LCGA 1V02E 3LG3A 1JPKA 4XVEA 3UVAA 3CO4A 3LCWA 1H61A 1HX0A 1ME7A 1SJDA 3C56A 1E15A 3ZR5A 4KRTA 4Q8OA 2CXEA 5CPLA 3OTRA 4DAIA 2H9AB 1Z42A 3FSTA 3KW3A 5LA2A 4ZE5A 4NNAA 1V3KA 2JIEA 1RSCA 4HNOA 3KBSA 4PUMA 4PMNA 2Y4SA 1QASA 3K46A 5CPSA 4MY8A 2JGQA 1JF5A 3VC5A 3L5MA 4W7WA 3EWUA 3TN5A 3NQCA 2Y5EA 4XQ6A 3R58A 2GK1B 4PMJA 2YCJA 3GG8A 1GORA 2QHAA 3WMCA 4WIWA 1HFBA 4RW3A 3GHUA 3DENA 1BYAA 2GGJA 3MUXA 1UZDA 1T8XA 5D2YA 4F0KA 1GWJA 2DZAA 3AXIA 4XZNX 1A5KC 1HT6A 1UASA 4RDZA 5BXPA 2ZWYA 3EDKA 3ZJKA 4KIEA 4BK9A 3VNLA 4Y8EA 1EFZA