1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
1RZMA 3G1YA 4K36A 5HWNA 3ZWTA 2DZUA 3NQ7A 2A0NA 3WK0A 1VHCA 2ZZ3A 3F4NA 5CPOA 3G1XA 1M6JA 4UTLA 1WA3A 5AC6A 4Y9AA 2V0TA 3R2GA 2FPTA 3M44A 2DZSA 1L6SA 3STGA 4QM1A 4CQ8A 5EYWA 5LHFA 1ZFJA 2E5CA 3E0IA 2OMAA 5EMUA 3P74A 3BV4A 3IEBA 4NU7A 3L9CA 3CIXA 2G96A 2WKJA 5HUOA 1VR6A 3NO5A 1OX4B 1FWSA 4LC8A 2WNZA 4WUIA 1HL2A 3TXZA 1QDSA 4JR5A 2DZPA 2CZFA 2J9YA 4MLJA 1VGAA 1AMKA 1K7FA 2D73A 1OJXA 3NVTA 1TO3A 5AYXA 3EKZA 3M43A 8TIMA 2R14A 2VFHA 4MY1A 3KFTA 4LC6A 1EUNA 3NZ1A 3U8GA 1A50A 3TR2A 2BLEA 2NXIA 1Q6RA 3T44A 4DPQA 2JGYA 2CLFA 3UY8A 3PUEA 3TROA 1N7KA 3G1VA 1KFEA 1OFRA 4MY9A 3OVPA 3RFAA 5DN1A 2GQ9A 5IM51 5KINA 4UR8A 3L2IA 1CI1A 4JTJA 3AJXA 3F1QA 3W75A 3PAJA 2OCZA 2QF7A 3EWYA 3MYOA 3LGEA 1RVGA 2FPYA 4IMCA 1OK4A 1RPXA 1LROA 4GC4A 1G4SA 4POCA 5CPNA 5FESA 4CCEA 3W2NA 1DOSA 2ZQ0A 1DBTA 1F73A 2W79A 5AN7A 3NQMA 4ZMGA 3NQ8A 2B7OA 3W23A 2YR1A 3W1NA 1A5SA 2NV1A 2PRMA 2YW4A 2YYUA 2AGKA 4IGHA 4NVTA 3M9YA 1YTKA 1MSSA 2C0AA 1O60A 2ZRWA 3N2MA 4X22A 3W7NA 2VFDA 4UTWA 4RZ5A 4JTUA 4RR4A 1QNVA 3A24A 3TC7A 2DU2A 1BWLA 4ORIA 3P5ZA 3W1TA 4M7TA 1L9WA 4QAIA 4JEQA 2FJKA 4JNMA 4PODA 1FXPA 5HWJA 3L0NA 3CQ0A 4WY0F 1H7OA 4JTGA 3DENA 3I6RA 4BF9A 2P10A 1JCXA 2OX1A 4CNPA 5HINA 1GG0A 1F6PA 3T78A 5LZLA 3WJWA 1RV8A 2ZFAA 3UPBA 3SECA 1SO5A 2QUUA 3L65A 4UXDA 4RX0A 3QJAA 2ATMA 2FTPA 3GNDA 4BWLC 3LXAA 3KVJA 1PIIA 1QMLA 2Z0IA 3FS2A 3MP4A 5E93A 3PY2A 4JTTA 2OT1A 3MP3A 3MI3A 1X7FA 4YXGA 1IXPA 3G8EA 4JX6A 3MW7A 1MXSA 1C29A 1Z42A 3NPWA 3QFEA 1SFLA 1F05A 1XXXA 3CB8A 2Q3OA 5J5DA 3UWQA 1Z41A 3QPZA 3TW6A 3LXCA 1ONRA 4D2JA 1DV7A 1WYIA 4OGZA 4NX0A 3MJYA 3O6YX 3PSWA 4M6PA 4WJEA 3LB0A 1EP3A 3VE7A 4Y8FA 2DJXA 1VH7A 2QCFA 3H53A 2CLIA 1QPQA 3P8JA 4OHQA 2LLEA 3EWXA 1AK5A 1TTIA 3LI1A 4YCOA 2CLLA 3W2UA 3L66A 4LVDA 1SW7A 1VS1A 2GVJA 4N9EA 1VJIA 2E6FA 2DZVA 1SR9A 4B5NA 3FEMA 1YLVA 4UTMA 5C55A 1GVOA 3P62A 4KWVA 1XDLA 2V81A 3HG2A 1GTHA 3HQ1A 4OV4A 2VFEA 1WV2A 4M7SA 2EPHA 2X1TA 2QUTA 2Y63A 3PR2A 1OFAA 3W7KA 3NL6A 2Z2UA 1TIMA 4MVAA 1J4EA 2QJGA 3M6YA 5CZJA 4FNRA 4I7WA 4DPPA 4O15A 3AO0A 1XCFA 3C61A 3W7RA 2RDWA 3Q58A 2NXHA 3LLFA 4O16A 2QAPA 4Y90A 4Z1DA 2C16A 1NSJA 1JQVA 3QPYA 1TQJA 4IPIA 4ZQPA 3JRKA 2PRHA 1ME9A 4JN6A 3EB2A 4FB7A 1PV8A 3KRSA 4BI5A 3DI1A 4UTIA 2V30A 3W83A 2FQIA 2BX7A 1VCGA 3MHGA 5FEXA 5G4WA 1QOPA 1YXYA 5F2LA 1PCWA 3LCXA 4JS3A 2GVGA 3C2VA 1NEYA 4LTSA 4NQ1A 3S5OA 1P5BA 1LBMA 4N2YA 4O1DA 1OABA 1SFJA 3G24A 2WSQA 3HPZA 3C4UA 2B4GA 1FY6A 5SWUA 3W1QA 3DZ1A 1KM0A 1I2QA 4JYDA 3LRLA 1W3NA 3QH2A 5G4EA 6TIMA 3G0UA 1RQEA 5EBUA 5F4WA 4UFJA 3W86A 3LDVA 1DQXA 1PE1A 1VPXA 4QSHA 4IUOA 1GWJA 3M5ZA 1QR7A 1KBJA 3C2OA 1TPWA 3PVFA 5DY3A 3F03K 5D2TA 4Q4KA 5DXYA 3CM4A 1KFKA 2P0OA 4LT9A 5D32A 4Q32A 3L5LA 4X9SA 1ZHAA 1H1YA 5I3IA 1TJRA 1ZAHA 2EKCA 3W7IA 2EHHA 3WJYA 1QWGA 4YWIA 3CT7A 3SZ8A 3RLUA 1G69A 3LTSA 4UUIA 1EEPA 4HNUA 3R5EA 1S5WA 4Z08A 4IWWA 3TJLA 1HG3A 4BK9A 3P84A 2YSWA 3W73A 3W1AA 2GUUA 5K7JA 3LTPA 3QF0A 3NQVA 4TMBA 3Q94A 3EWUA 1K7XA 2QCLA 3STEA 3G0SA 3GKFA 3R12A 2QCEA 4JTHA 4HSNA 2E68A 2C6QA 4A29A 2BZNA 2HTMA 4E2DA 3GDKA 2ZA2A 1U83A 5EPDA 3ZWSA 1Q3NA 1TQXA 2QDGA 1F76A 1EPXA 1TSIA 3ATYA 4XBSA 4WD0A 4UTTA 3S1VA 1DVJA 4XKYA 2W0UA 4JICA 4GFSA 2NWSA 1AW5A 1ZAJA 4X3ZA 3SR7A 2I1OA 4LUJA 2CLEA 3U6WA 5BRBA 1H50A 4CCDA 1KFLA 3WFAA 5K9CA 2CZ5A 2GPTA 3GIYA 1PS9A 3ABQA 2P1FA 1H7WA 4FF7A 4G1KA 2J9XA 3OVQA 4AWSA 4RZ6A 3NYZA 3B05A 4HPJA 2JK2A 2J9ZA 4RLIA 4WX2A 1X1OA 3S42A 3ANYA 2O7QA 1GYLA 1KW1A 1KM1A 3NQGA 1H62A 4H3DA 5G1YA 3LCHA 3W7PA 3WK2A 3QQ0A 4A22A 1FCUA 4K7VA 1H1ZA 3HBLA 4RJEA 3LHTA 1YDNA 2ALDA 3HG3A 2C14A 1JRCA 5CSSA 4E2BA 1JUKA 4GXMA 3QZEA 2QCNA 1BTMA 3M16A 4XWUA 2CWNA 3THAA 4AB4A 4DQWA 4MZYA 3S1XA 4R33A 3IGXA 4LW7A 2H8ZA 4DO4A 1EX5A 4N6FA 2E5BA 3LLDA 4AMAA 3KVMA 2WSRA 5HQEA 4AHQA 3L21A 3G0XA 2A6NA 3FKRA 1SPQA 1R46A 1YADA 1I4NA 1GVQA 5LNWA 4L4LA 3DXIA 1Q6OA 4MOZA 4TO8A 5AHNA 5F2IA 3HIJA 2YX0A 3GDRA 5HUPA 3B0PA 5BW6A 1K02A 4H4IA 4WXZA 3UQNA 3SGZA 4AWUA 1HO4A 3NQ2A 1E51A 4O14A 1VCVA 2E1DA 4IQLA 1LLWA 4A2RA 3LHZA 1VYRA 4FNUA 3LERA 1JJKA 5LNRA 4R53A 4XZ9A 4ZL1A 3EWBX 3STFA 3C2FA 3B0UX 4OE7A 4Z1AA 3O6CA 1DORA 3E96A 3GR8A 1JULA 3VFLA 4GUGA 1K03A 1FUYA 2YCEA 1VLIA 3W7HA 3NL5A 5C6MA 3W87A 3L5AA 1GT8A 2Y62A 4IXHA 1F74A 4ICNA 3P7YA 3I65A 3A23A 3S1WA 1W5PA 2E77A 3SIZA 3TMLA 3HG5A 2Y88A 2A21A 3M41A 4M6VA 4MUZA 4MZ8A 2ZTJA 4K8EA 4ZQOA 1ZY9A 3QMRA 1YXDA 3N14A 1GVFA 1I2RA 4RCXA 1TTPA 2XN2A 1ICPA 3EX1A 1UBSA 4LVFA 4JTFA 3QEZA 4EOUA 2Y7DA 1B4EA 3MUXA 4UFHA 5HULA 3TK7A 2NZLA 4O4WA 2V2HA 5LHEA 4LWWA 2BSLA 1YPIA 3W07A 3O05A 3W1PA 3FJ6A 4DXVA 3W2LA 1SZGA 2KZHA 5D37A 4XTIA 3BK0A 4QISA 5FEPA 3W72A 2CU0A 1W54A 2WOQA 1AL8A 3PULA 5HMSA 5FF4A 4CNOA 4XUGA 2X30A 5AHIA 1BEUA 3DAQA 3N19B 1WQ5A 4PL2A 1PHQA 3T55A 2DZWA 4XBKA 3NPVA 5U4NA 2QJIA 1RD5A 3TIMA 2EGZA 1WDWA 3TSBA 4C1LA 4K8HA 3KOFA 5DY2A 4LNYA 3NAVA 4O53A 2PCQA 4MJMA 5KTLA 1K8YA 4ADTA 1JUEA 3DBPA 1N8FA 4BR1A 1UASA 4EWND 3PSVA 1OYCA 4EVZA 2FDSA 3W1UA 3W85A 3TV8A 5LSMA 5G5IA 3A5FA 2I14A 3W7QA 5HJLA 1PHWA 1VCFA 2ATSA 1KM5A 3W7OA 3QRHA 5BMXA 1ZNNA 4UTWC 1ICSA 4M19A 4GUJA 5H91A 1W5NA 3N9RA 4NT0A 1QPNA 4JDBA 2Y85A 4JTEA 5KZEA 2V5LA 4HIBA 3W7GA 4HKPA 1JCMP 1LRNA 1SZNA 2XN1A 3ZFHA 2ZCGA 2FIQA 1IXQA 4GE8A 4FEZA 2J6XA 5CKSA 3KXQA 4UTHA 3IIOA 1RR2A 1PL9A 3M0ZA 3MBFA 2YYTA 2E09A 2VELA 3ELFA 1Z44A 3P82A 4FIQA 4R34A 1L2UA 5C5YA 3EX2A 1JCYA 2A2IA 3IVSA 1XBXA 1JR1A 1FDZA 3TX9A 1B9BA 3NPUA 1QOQA 3UWUA 5AYZA 1ML1A 4JYEA 3PG9A 3W84A 2ZZ5A 3CIWA 3HGJA 4AF0B 3S0CA 1IF2A 2QAFA 5TBOA 3UWYA 2PC4A 5F2MA 1O95A 1TPH1 1GVRA 3G18A 2OT0A 4KKXA 4LS2A 4FO4A 4O0ZA 1FXQA 3DFTA 3LCIA 4MFDA 5D30A 3I7SA 3B0VC 2ISSA 4M6QA 4PEKA 1A53A 3FLUA 5ABTA 1WBJA 5D03A 4DO5A 2ZDRA 3TFCA 3V1PA 3G22A 3MI2A 1FQ0A 4ZQCA 2EF9A 2V5BA 1W3IA 2YZRA 1F6KA 4FXRA 1L6YA 4JIQA 3N3MA 3CPRA 2XN0A 4WY0A 2ZZ2A 2QCCA 2YPIA 2QUVA 1TRDA 4UTTC 1KM2A 3FYPA 4GUFA 3I68A 3TE9A 3PBYA 4IMFA 2OZ0A 3B4UA 1KTCA 2R94A 3TJXA 4AEOA 1SW0A 1GOXA 2DZXA 1FX6A 1EWEA 1G4EA 3TAKA 2AAMA 3BLFA 2TYSA 3RU6A 1TPEA 4O4VA 1XUZA 4U4MA 3UXDA 3C2EA 1OX4A 3NOEA 4O1AA 2WQPA 4UFMA 5BOOA 1GPWA 2GVLA 3W1XA 4K38A 3B03A 1Z48A 1OYAA 3WK3A 1KFBA 2VKZG 3MI6A 3CU2A 4O50A 3OHIA 5I3GA 5KZMA 3R89A 3FOKA 3KVLA 4WXYA 5FI8A 1B4KA 1LZOA 1UB3A 3E12A 1HO1A 3NGJA 2VC6A 3DKLA 3T4CA 3NG3A 4K39A 2Z1BA 4TIMA 4RKAA 5CZTA 1YDVA 3IGUA 4H6KA 3LV5A 4NNAA 4PC8A 4ADUA 3LM7A 3BGGA 1ICQA 1LP6A 1QPRA 2G95A 1OYBA 3DU0A 3GZ3A 3MHUA 3EX6A 4Q33A 2ABAA 3THQA 3R8RA 3UPWA 3G3DA 5A5WA 2CFFA 3EXSA 3G1FA 5T26A 3INPA 3GKAA 3GAYA 4ZQMA 3KRUA 1I2PA 2BXVA 3R13A 3GB6A 4YCPA 3W3OA 1X1ZA 2DZTA 2J88A 3GXPA 5E1QA 2Y61A 4QNEA 4O18A 3GXTA 1JCJA 3F4WA 4PH6A 3IGSA 2QCHA 3C8FA 3LHVA 1IXNA 3EEGA 2B7NA 4MPQA 2A7NA 5LKYA 4JXCA 4O54A 1LDCA 2DP3A 3FYOA 1XBYA 3BLEA 2WNQA 1ZCOA 3LRMA 4IX0A 3QQ1A 4UMCA 4E0CA 3NNTA 5KZDA 1K8ZA 4QJ1A 4DEFA 3BW3A 2QKFA 1AW2A 3W1RA 2WNNA 2X1SA 3UZJA 3A5VA 4J9JA 1OFOA 4ORMA 5K4XA 3TKFA 4BFAA 3E9AA 2ZTKA 2IQTA 3GLCA 3O07A 3W7JA 1CX9A 1N55A 3PBWA 3MMTA 4GBUA 4HNVA 2FB2A 4KFNA 1SW3A 1W31A 3EXRA 3TAOA 4N9CA 3HOJA 4Y6GA 4JX4A 2OJPA 3LCFA 5KITA 4MLRA 4LOCA 3PM6A 4NUWA 5D09A 4RXGA 3USBA 3PG8A 3OEXA 3DFOA 3W22A 3OIXA 1K8XA 3W7EA 3C3NA 4O28A 3NA8A 4O1BA 5CGQA 5D05A 1NF0A 1O4UA 2QEZA 3B04A 2C13A 4L4MA 5I3FA 4UR7A 2JKEA 3HJZA 2ZRYA 1FWRA 5C2XA 2TSYA 2JKAA 3PWAA 1NAL1 3GDMA 5L6UA 1FWNA 3IVTA 1ZENA 2J24A 4TMCA 1T99A 2J27A 1LBFA 3FA5A 1VYPX 3PS7A 4OU1A 5DCDA 1TMHA 4U28A 3P80A 3ZR4A 5FF0A 3CEPA 2WSYA 1CW2A 1D9EA 4HPXA 3A22A 5A8GA 2VEPA 1B3OA 3W76A 5TQLA 1KBIA 4FX8A 4S2CA 4CNNA 3KAOA 1GQNA 5IBXA 5LGXA 3HGRA 3H55A 3W1MA 4KFOA 6ALDA 5DLCA 4ZVJA 3IRDA 3ATZA 3VCRA 2W6RA 2JKPA 4Y96A 4EF9A 2O7SA 3NQDA 2RDUA 2V2DA 3NQFA 4LY8A 5I3HA 4GUHA 4NXKA 4DELA 1FDJA 2A1YA 4I9AA 1M7PA 5DCEA 4EF8A 2GOUA 2ZZ4A 3BG3A 4NZJA 3K30A 1A5AA 2QR6A 3L68A 3W6YA 5KMYA 4AF0A 1M7OA 4JY8A 4JYFA 1GG1A 4LUIA 5AHMA 3RK8A 4JTLA 5D2WA 2TMDA 4CQ9A 3GDLA 1U5JA 3O6DA 4OWGA 4PTNA 2Q3RA 4HN4A 2PRLA 2VEIA 3DKJA 3W74A 2F84A 3UYCA 4QITA 2FFCA 3HB9A 3IIPA 2RDTA 3TSMA 3TW7A 1TB3A 3O63A 4FNTA 2HMCA 1I8JA 4FNPA 3HMJG 3LCWA 3T40A 1P0NA 3W7CA 3P60A 5D33A 2X2GA 3EKLA 1V5XA 5CZ0A 1R2SA 1H7RA 4CQAA 1H7PA 3HG4A 3SI9A 3QMSA 2CZEA 2VEKA 2WPBA 3RNDA 4IJBA 5U7SA 1MO0A 3CTLA 1NFBA 1F7BA 1T96A 2H6RA 1EIXA 2H3DA 1HUVA 5F1VA 2NUWA 1SU5A 1G4PA 3P8IA 4LV4A 4YL2A 4PL1A 3UWWA 4NX5A 5AYYA 5FEZA 3TQKA 3DI0A 3Q37A 5AFDA 1ZAIA 4FNQA 3LCLA 3LHWA 4ML9A 1BKSA 4FX7A 2NUYA 3CC1A 4C1KA 3W9ZA 4A21A 3G3MA 3IIXA 2E5DA 4IXXA 1HFBA 4WQ6A 3DFNA 2NLIA 3SY5A 1OFEA 2A85A 3V75A 5CPLA 3JR2A 3OG3A 3S5NA 7TIMA 4JY9A 1EA0A 3PBVA 4IX2A 3W7MA 2V9DA 3NQAA 3G1HA 1S3HA 2F7FA 2C1HA 1QO5A 1O5XA 3CLMA 3FJLA 1H63A 5IBXC 1C9DA 3QM3A 4EIVA 4NJIA 1DJQA 1BWKA 4AWTA 4O8RA 3IV3A 3LI0A 3DHFA 3P61A 1SZEA 5DBTA 1KTNA 3HO8A 4O10A 4NNBA 2RKXA 3QYQA 2Y6ZA 4NJGA 2Y89A 4JGDA 2ZBTA 1MZHA 4N4QA 3BVJA 1R30A 1LRQA 2ABBA 2ZA3A 4NZFA 5AOUA 4GJ1A 1WOBA 2RFGA 1S5TA 4UMBA 3EXTA 3M7WA 4WZHA 4GWEA 3S8HA 1RQBA 2NX3A 5G2WA 2QCDB 1SSDA 5G1TA 3UWVA 1TPDA 4O11A 3OBKA 3W2MA 1C8VA 1FCVA 5EL1A 2TPSA 3MWAA 3NPXA 4UFKA 3S6DA 1H60A 2PURA 1LTDA 4BI7A 4Z0JA 2BTMA 3HF3A 2X1UA 4UCGA 4WY0B 4MFEA 4OV9A 3NL3A 2YDAA 3FIGA 1IIHA 3CWNA 1GTEA 1SO6A 3N34A 5K9XA 5FF3A 4YMZA 1FWTA 2VFFA 1KLZA 1KFCA 3E49A 1D3GA 1LOSA 3HPSA 3SW6A 2Z6JA 4MJZA 5K2ZA 4FHAA 5BNKA 4X2RA 4HHPA 2QCMA 2CZDA 3DFPA 3RMJA 1UCWA 3LV6A 1D3HA 3S5YA 3LBCA 3DH7A 1R47A 2HSAA 2ZZ6A 1DL3A 1TYGA 3C2RA 3N73A 3GYEA 3WJZA 1MEIA 4LVGA 5D2VA 4ADSA 4NJJA 1MEHA 1MEWA 1RQHA 3L0GA 1ALDA 5FEWA 2H3BA 5HWMA 4DBDA 1F5ZA 4A2SA 2CLHA 3GVGA 3NQCA 3MYPA 3QSRA 3QSTA 1FCBA 2XFWA 5E0KA 3LHUA 2A7RA 3LTYA 2YXGA 2A5HA 5AHEA 1WXJA 2Y7EA 3W2JA 3B06A 3LBMA 1JRBA 5LGZA 4JTIA 3VI2A 3S1UA 4NNCA 5CSRA 1TV8A 1XM3A 3RLVA 1H61A 4XTDA 4LRTA 1TTQA 3M5XA 4TR9A 3TMQA 4R7JA 1LCOA 1WX0A 2ISWA 4NJKA 5F4SA 4RXFA 1AG1O 3HGSA 1OVDA 1SZFA 2QDHA 4NJHA 5LNVA 4JD4A 3ABSA 1G7UA 4N9DA 4ZQRA 1UUOA 3PBUA 5HR7A 4UNKA 1LYXA 5DBUA 3SGUA 3BO9A 4UC5A 1WBHA 5KSWA 1XBZA 2AQWA 4DF0A 1B57A 3LRKA 2R8WA 1QFEA 4S1FA 3MBDA 1AL7A 3CHVA 2QCDA 2Y7FA 2H90A 1K7EA 4PA8A 1OHLA 4DF2A 1W0MA 4P61A 1S5VA 2V82A 2VXNA 2WV8A 1THFD 4OQVA 1FDYA 4IMGA 4HT3A 3LCGA 5K9DA 1TPVA 1XUUA 3G1AA 4HNNA 1IIGA 2NV2A 4LVBA 1KTBA 5HR6A 3P81A 3KX6A 3TFXA 3NQ6A 4O52A 2ZYFA 3M5VA 4O17A 3GX9A 2JBMA 5L9FA 2HS6A 4FIRA 1W3TA 4LV9A 1A5CA 3NZRA 4E38A 1XDMA 5K4ZA 1OFDA 2B0MA 3CEUA 1O94A 1H7NA 1M5WA 5FF7A 3LXBA 4HNTA 1TJPA 2X1RA 2ZRUA 5AB3A 3EX3A 4N4PA 4IOTA 3KHJA 3W70A 2H8XA 3ABOA 3LX9A 1VQTA 4N9BA 4WOZA 3TSDA 1SO3A 4AVFA 4ZZ9A 2UV8G 1YXCA 3L67A 4XQ6A 4N02A 5GVJA 3Q2DA 2CW6A 4ONVA 2E6YA 3GAKA 3GR7A 5EA9A 3LOTA 4UTUA 5CPMA 1QO2A 2TRSA 2GJNA 5D38A 1R2TA 4MYXA 1OX5A 1KV8A 1TRIA 5HNRA 2GQ8A 4K7YA 1UUMA 5AHLA 1XI3A 1XL9A 3NXFA 3S9YA 1LBLA 3SFKA 1GJPA 4MYAA 3STCA 3O1NA 1Y0EA 3O06A 3IIZA 3TQVA 4BWLA 3M47A 3H54A 1EUAA 5H2ZA 4MKNA 5DELA 5DCBA 3EX4A 1DQWA 2PE4A 1G67A 3BW4A 1L6WA 3WJSA 5LNUA 1TPC1 3TUUA 2C15A 1LOLA 1QCWA 1VRDA 3B8DA 1W37A 4LRSA 3WJXA 1WOAA 4TX9A 3N9SA 1OX6A 1XKYA 1P1XA 3BG5A 4FXSA 1IGSA 3PC0A 2CLOA 4QNWA 5I3KA 3VNDA 1EP1A 4S2BA 5C54A 1TCDA 4IMEA 4QIUA 2ZRZA 3O8AA 1ZALA 4RK8A 3PUOA 1VHNA 4UIOA 5CG7A 4K37A 4FX6M 4PFMA 1G6CA 2Y7GA 4AHOA 3MO7A 1YYAA 1X6UA 3NQEA 3VKJA 1SQ7A 3CWOX 4W9TA 5DXXA 3W2KA 3KVKA 2V8ZA 3W88A 2I9EA 5MHBA 2ZZ7A 2YFOA 3DHDA 1YDOA 2VFIA 1LORA 3P67A 4AHPA 4UTKA 5F2GA 3C6CA 1YTDA 3FFSA 3BARA 3DFSA 1KM4A 3M1ZA 3NEVA 1FBAA 3L0KA 2C18A 4JDYA 3UXAA 4Z1BA 3UY7A 4QQ3A 1OG0A 2YW3A 5AHFA 5D2XA 4DBEA 1JCNA 3UD6A 1Q6LA 2A6LA 4UFLA 1HTIA 1W5OA 3O15A 5D04C 3G1SA 4Z0SA 5D02A 5CZSA 2JGQA 4O57A 4O13A 2C3ZA 4UNLA 3TCEA 4A3UA 5EY5A 3YPIA 3MHFA 3TDFA 3O16A 1Q45A 4LVAA 1NVMA 5EKYA 4LS0A 1JQXA 2ISVA 1KM3A 1KM6A 4MZ1A 3TA6A 4XKYB 1R2RA 1XC4A 1NF7A 2VFGA 3I7RA 5FF2A 1Q6QA 1SUXA 3ZS4A 1J2WA 2A7PA 3QW4B 4LS1A 3TNOA 5I3JA 1A5BA 1PVNA 1XFBA 2VENA 1W1ZA 1I2OA 2EAWA 4UMAA 1ZJIA 3TQ0A 1T0OA 2YGYA 4OBTA 2R91A 4UFIA 3QMTA 5AC7A 1V7YA 3DGRA 1I45A 2E6DA 1VZWA 3BGJA 3WK1A 1IXOA 4AAJA 1GVSA 3MP5A 2X16A 3HPXA 1W8SA 1H51A 4DF1A 3D0CA 4AXKA 4O19A 3IVUA 1FWWA 1X8FA 4JX5A 1EB3A 3KRZA 5D2YA 3E02A 1XBVA 2G97A 5AC8A 3N2XA 1KFJA 1SSGA 1QPOA 1JCLA 3VE9A 1P0KA 4I7UA 3I7QA 4UTJA 1TV7A 3BW2A 1KLYA 2ZRVA 4O0KA 3PB2A 1P4CA 1TTJA 2DORA 3QW3A 3OA3A 2WJZA 3U2OA 1O5KA 3OVRA 4Z1CA 4DO6A 1QAPA 2HS8A 1I2NA 3GNNA 2NUXA 4O1CA 3BLIA 3T7VA 2FPVA 1JUBA 3C0JA 5TIMA 1W5MA 2NX1A 3DFQA 1K3UA 2Z6IA 1GEQA 4LU0A 2BWGA 1DKWA 3PUDA 3NM3A 4FNSA 4KWWA 2VOMA 1OF6A 3GDTA 2CLMA 3EWWA 1EWDA 2GQAA 3RF9A 2YFNA 4ALDA 1UJPA 3NL2A 2Q8LA 2NX9A 3W1LA 2G5WA 1OFBA 3P5YA 3JS3A 4KFPA 1TV5A 4JTSA 1T8XA 1KA9F 4BI6A 2C19A 3M5YA 4ZQNA 3TXVA 4TU1A 4JIPA 4CCCA 1LLZA 2ZRXA 2Y70A 3SJ3A 3A21A 3UWZA 3FKKA 5K3VA 1YPFA 4GRSA 4RZ4A 1JVNA 1LOQA 1OF8A 4N6EA 3IIVA 3S5ZA 2A4AA 2NXGA 1OK6A 2NWRA 2Q8ZA 2QJHA 4CLMA 4YLWA 5F4XA 5BMWA 3TC6A 3NR0A 2RH9A 1W56A 4JTKA 1TPB1 1VLWA 1GYNA 2RHGA 4RV8A 4O12A 2WO5A 4K6AA 1SO4A 2VEMA 4NXSA 1G7VA 2DJLA 1H5YA 4HSOA 3EWZA 1ADOA 3NDOA 1DJNA 3PB0A 4OT7A 1PCKA 3BG9A 3TU9A 2QCGA 1VC4A 4MIMA 1OFPA 2CLKA 3W7LA 4WOQA 1WAUA 1H7XA 5LNSA 4AH7A 4IPJA 1GZGA 3A9IA 2B7QA 3NM1A 5G2HA 3C52A 1KV5A 3G1DA 3UZ5A 1FCQA 3UNDA 1VYSX 3LHYA 3L5MA 4GNJA 1W5QA 3W71A 4GUIA 5F1UA 1DHPA 1AW1A 3BPWA 2FB3A 1ME7A 4I7VA 2V2CA 1TPUA 2B7PA 5J5RA 3ABRA 2ZZ1A 1ME8A 5G2IA 3C56A 2GJLA 4P2VA 3GXNA 2FLIA 1LM1A 1F2JA 1YTEA 1J5TA 1OFQA 1TREA 4IMDA 1TPFA 1G4TA 3TH6A 1EP2A 4M5PA 3GK0A 3QC3A 1LRTA 3SSJA 4MY8A 3G8RA 2ZA1A 4PCFA 3PF3A 3HGOA 2E6AA 3W7DA
chains in the Genus database with same CATH superfamily
1RZMA 4BCEA 2E4TA 4AC7C 1GOMA 3WK0A 4KWOA 3RPMA 4E4FA 3CUZA 3UU0A 2GDVA 4DAFA 1A0CA 1DIOA 2QHAA 2W63A 4GI6A 4A8RA 1L6SA 3STGA 3VILA 1HP5A 3EDKA 5LHFA 1ZFJA 3R0UA 5HPOA 5EMUA 3AWNA 2FH6A 3IEBA 4AISA 1JZ6A 5DMLA 1IEVA 2G96A 4RDVA 3WLKX 1YE6A 2XWDA 1QNSA 5DF0A 3FDKA 1QDSA 3O3RA 4B5VA 4KCWA 1VGAA 4MGGA 1S5MA 2CLPA 1HZYA 3M43A 2SFPA 3RM8A 4ACZA 4MY1A 4QJ3B 4JIEA 3U8GA 2DQWA 1LQAA 4PBGA 3DHUA 2RDXA 1N7KA 3G1VA 4AVOA 1OFRA 4MY9A 4PGLA 4QE4A 4UR8A 1CI1A 1B0IA 3PAJA 7TAAA 1DYSA 1SMDA 1POJA 2FPYA 3F2CA 1P6BA 4GC4A 5T9BG 2R82A 3KOYA 2IXVA 4CCEA 2ZQ0A 3AALA 3V3WA 1QBBA 4V28A 4A05A 2D22A 2EEXA 1UA7A 2GJXA 3UZWA 2YR1A 1A5SA 2NV1A 2YW4A 4GH1A 1R3YA 4ZFCA 3IAPA 3P3BA 4UTWA 6CGTA 3ITGA 4LYKA 3TYAA 3A24A 5CC3A 3DN5A 3TC7A 1BWLA 1EQPA 4ORIA 3BAJA 3P5ZA 3APYA 3SCWA 3BOLA 6ENLA 4QAIA 5ENLA 3ARTA 1A5LC 3ZVHB 4PODA 1FTXA 3VCNA 3GQYA 3CQ0A 4HHHA 4GXPA 1H7OA 4GG9A 3PK7A 4H8UA 2C0HA 2FHBA 1JCXA 2OX1A 2Z7KA 2VC7A 3CZEA 4HYRA 3SECA 1PTAA 3L65A 4RDYA 1Z3NA 4RX0A 1FP8A 3QJAA 2XWEA 4JN7A 3LSCA 4B5TA 1XLAA 1DIKA 3PFRA 4YHGA 5E93A 4JTTA 2XIQA 4KQNA 1X7FA 4G5DA 1MXSA 1VFHA 1C29A 1J93A 1Z42A 1TV4A 1R9YA 2Q3OA 2FMNA 3UWQA 2DFAA 1Z41A 1UP2A 4CD6A 1HN1A 2IPJA 1DV7A 4DZHA 1WYIA 4NHVA 3E0WA 2WMGA 2IKIA 4WJEA 3OLEA 3KLKA 1T8QA 2DJXA 4KGJA 1VH7A 1PDZA 1CXHA 1QPQA 1TTIA 3LI1A 4PR4A 4N9EA 1VJIA 2E6FA 4DWSD 2D1ZA 3FEMA 3UA3A 1GNXA 1I1XA 2QMJA 1LQ0A 3P62A 4XK2A 5JH1A 3HG2A 3R25A 1PAMA 4OV4A 1WV2A 1H0IA 2OEMA 2RAGA 2OG9A 1E5NA 1J4EA 1UWSA 5CZJA 1P6WA 1U33A 1W9XA 3AIWA 4XAGA 1S2TA 3GG8A 4S3GA 1BD0A 3EZ4A 1BFNA 3CHEA 1ME9A 4JN6A 5DMYA 3WH5A 1PV8A 3CZKA 3KRSA 3LY0A 5I03A 4GHRA 3MSDA 2WMJA 4PMYA 3HFTA 2W92A 3MHGA 1YXYA 1SR0A 2J79A 3VU2A 1ISVA 1QRQA 1W2VA 1HNYA 3HPZA 5TNVA 3R43A 3WLNA 1FY6A 1I2QA 2X8RA 3RYSA 4V27A 3QH2A 5G4EA 1XHGA 4HCDA 3Q65A 2AL1A 5EBUA 1RQEA 1FRBA 4UFJA 4XSMA 3LDVA 3VPLA 4EX4A 5LIKX 4QSHA 1JL8A 4A8NA 3UVIA 4IZGA 1PPIA 2GLKA 1KBLA 1EXBA 1OT2A 2UY5A 5D2TA 1XKJA 4Q4KA 2P5NA 4CVUA 1BRLA 2OO6A 1DHKA 1FVPA 3EDJA 2Y4SA 4EANA 3KOXA 3R94A 4FLQA 3FGCA 4LXFA 4IJRA 1P1MA 1ZAHA 2EKCA 3W7IA 3WJYA 4AIBA 1GYMA 5D8WA 3SZ8A 3RLUA 4AXNA 4UUIA 5I24A 2Z00A 3BCJA 4HNUA 5JIWA 4BK9A 3ORWA 3LTPA 3WDJA 4QSFA 3NQVA 3Q94A 1O1ZA 3CWHA 1K7XA 1ZTVA 3GKFA 3VNJA 4DYEA 2FGLA 4HSNA 2C6QA 2FGBA 2VYOA 2HTMA 2XM1A 3VOGA 3VNYA 1ONXA 4E2DA 2ZA2A 3ZWSA 2VRJA 4UQBA 4H8HA 2W61A 3QGVA 3KZPA 4JPGA 3DHPA 1IV8A 4Q4MA 3F4DA 1AW5A 1ZAJA 4X3ZA 2CLEA 1K9DA 3U6WA 1P48A 3GH4A 4ZTYA 1R3TA 4G7EB 2PDCA 1HJWA 2VC9A 1PZ2A 2I57A 1E4MM 2CZ5A 1GOOA 2PODA 1ITXA 3ABQA 3TTEA 1BHGA 5I5RA 2E0PA 1CLVA 3SN0A 3OVQA 1F4HA 1UKQA 2A3HA 3MPGA 3T4WA 3NYZA 2A3EA 4J2PA 5IHRA 3B05A 5CAHA 4HPJA 4GYPA 3SAZA 1X1OA 3S42A 2VQUA 5DMNA 2PWVA 1KM1A 3WL0A 3NQGA 1H62A 5G1YA 2Y8VA 1JYVA 3QQ0A 3LPOA 1FCUA 2J66A 9XIAA 1QUMA 4M24A 1Q85A 1DP0A 3HG3A 3QN3A 3QGKC 1VIWA 3RMEA 4XV0A 2ADAA 1JUKA 3W02A 3IJ7A 5A2CA 2AKMA 3D6NA 1VJZA 1BTMA 1B54A 2D2HA 2PWUA 4XUYA 5TAOA 1KFWA 2GVEA 2XVNA 3S1XA 4R33A 3IGXA 1EQCA 3MCMA 4DO4A 3ZLHA 4N6FA 4AHQA 3L2LA 1XLFA 2XZ7A 3L21A 3LQGA 1SPQA 4W89A 1YADA 4YVXA 4WJXA 1RP9A 4DM1A 1Q6OA 4GQQA 4MOZA 3B8WA 1MDRA 2YX0A 4PB4A 3WUEA 5HUPA 5BW6A 4WXZA 3PNUA 1DWGM 4DN1A 4O14A 1VCVA 2VZTA 1IQ8A 1VYRA 3LHZA 3LERA 5FKYA 3VOIA 4L1WA 1XLKA 3BAKA 3B0UX 3GU9A 4G1NA 1GOIA 3PFMA 1BYBA 1JULA 3AXXA 3BLDA 2YCEA 4DB7A 4JEJA 1XIIA 1VLIA 2XISA 3FN9A 3NL5A 3KM8A 3UJ2A 3VIGA 1PKYA 2FVLA 2Y62A 3AXMA 4O1EA 3P7YA 3A23A 4MWAC 2E77A 3TMLA 3VIOA 3SIMA 4MUZA 4ZQOA 4K8EA 2NV9A 1S1PA 1CDGA 1X7IA 1XINA 2D23A 4RCXA 1R3QA 2XN2A 3QTGA 1OC6A 3EX1A 3BSMA 2VOTA 1RSCA 4JTFA 2WMIA 3QEZA 4HN8A 3WN6A 1PEZA 1QI4A 1TA3B 1NDWA 4LWWA 1V93A 2BSLA 1Y8BA 4J3VA 5CPTA 8CGTA 4BEUA 2WVSA 1CNVA 5D37A 4XTIA 3T42A 4QISA 3W72A 2CU0A 5FSDC 4Q8WA 5FF4A 1TUXA 2DH2A 3S6OA 4CNOA 3BAYA 4FOJA 3DAQA 4J3WA 3PZNA 4PL2A 2DIEA 2DZWA 4XBKA 1AZ2A 2QJIA 3TIMA 3AHYA 1WZLA 4QG8A 3NO3A 4LNYA 1EBHA 2FVMA 4O53A 2J7EA 4I8YA 1VRXA 4HA3A 1E1EA 2PCQA 3GVWA 1K8YA 4ADTA 3URBA 1JUEA 2DPEA 1N8FA 2QQ6A 3OVGA 3PSVA 3TEVA 4EVZA 2FDSA 3PBMA 3D46A 5G5IA 3ZT5A 4LSBA 5AC5A 1CXFA 1NTHA 4REQB 5BMXA 3S6TA 1W5NA 2GYIA 2J62A 4NT0A 2Y85A 4JTEA 5HJYA 4DJDD 1XG4A 3W7GA 4HKPA 1XH0A 2XN1A 4OECA 1P0BA 1V77A 2ZCGA 2FIQA 1LWJA 2FGZA 4FEZA 4KEMA 3SADA 4C6LA 4JCLA 1N2VA 1RR2A 1NWTA 7PTDA 3MBFA 1V03A 2YYTA 3WNPA 1QHPA 3VUPA 3BQ5A 3P82A 1L2UA 3EX2A 1XBXA 7A3HA 3AQUA 4HTYA 2C91A 2WWCA 3KCLA 1F07A 2XFFA 3ZO9A 3H2FA 2VDIA 5AYZA 3A6OA 4IICA 1OCBA 3BSHA 1XCXA 2IS7A 3JVAA 4NL1A 2PA6A 2PGEA 2MANA 3EMQA 3S0CA 2QAFA 3CT2A 2PC4A 2PGWA 1TPH1 3UG3A 3U4AA 4KKXA 3RM9A 2E8YA 3N6JA 4LS2A 3KP0A 3T8QA 3AS1A 5CPQA 2NT0A 3W29A 1K1DA 1FWFC 1WBJA 5D03A 4DO5A 3TFCA 6PTDA 3V1PA 5DRIA 4BQ3A 1FQ0A 4ZQCA 3AXHA 2EF9A 2V5BA 2YZRA 2J7FA 4XZNX 2GFTA 2FKPA 1V3HA 3N3MA 2RGMA 2PMQA 2XN0A 1MW1A 3CHFA 5CZKA 4HOWA 2QUVA 2WVVB 1KM2A 4J5NA 4HMCA 4PUDA 3B4UA 4ZB5A 4AEOA 1H3GA 2H9AA 1VENA 1G4EA 2PDHA 1M7JA 3EYPA 2BOGX 3BLFA 1TPEA 3WF0A 2BY3A 3WK3A 1OYAA 4AZBA 2FTYA 3PANA 4J1OA 4LYRA 5KZMA 3UNTA 3AS3A 1J8VA 2G3JA 3FOKA 3KVLA 5FI8A 1LZOA 1UB3A 3OHMB 3NGJA 5FCZA 1EA9C 4HU0A 4IUGA 3FA4A 3NG3A 4IJCA 4QG9A 3AZTA 5CZTA 3LMZA 4H6KA 3LV5A 1GVEA 4ZSUA 2D3NA 1Z32X 1QPRA 4FF5A 2XIOA 4ATWA 1UWAA 2ABAA 3L4UA 5A8PA 5EMLA 2ZIDA 3A4JA 1UHVA 3TOPA 5A5WA 2CFFA 3GG1A 2J77A 3INPA 3GKAA 3EOOA 1JZ8A 3GB6A 3U57A 2BS9A 4DUXA 5GQBA 3WLSA 4QNEA 1WDDA 2PLCA 1SM9A 3F4WA 3APTA 1F9CA 2GGGA 1UR0A 2EXOA 1B3YA 5CJMA 3WLIA 3IGSA 2QCHA 4MPQA 4ZO7A 2O9PA 3BAIA 2ZE0A 2WNQA 4H00A 2P3ZA 3OIHA 1K8ZA 1CIUA 1CT5A 2BV9A 4M1RA 4ERGA 4DEFA 5A8QA 1TJ0A 3A5VA 2XGZA 5TD4A 4CUCA 3RR4A 2BG5A 2PI6A 3VNIA 4ZE5A 4RNFA 3GC5A 5AVNA 3VIHA 5TF0A 1UQYA 3GLCA 3HA1A 3WLOA 3IARA 3AZRA 4GBUA 5I79A 1QPKA 3UJFA 4IH3A 3HOJA 2WHJA 1F3WA 1V3LA 3K8KA 2OJPA 2BY0A 5KITA 1EDGA 3USBA 3TW9A 3OEXA 3W22A 1W3JA 3W7EA 3C3NA 4F9JA 7REQB 4O1BA 4QS6A 4L4MA 5LYRA 1XW8A 3UETA 1B3XA 4C60A 3DYPA 3RHGA 1VIZA 3K1DA 2CYGA 2J24A 1T99A 2J27A 4OU1A 1VYPX 4DJED 3P80A 4HBKA 4K68A 4IFKA 2PZ0A 1TWDA 3WIJA 4G6CA 3E2QA 3A22A 5A8GA 2REQA 2VEPA 2PDNA 1H49A 2PDJA 3L2MA 3DC8A 4KFOA 4ZVJA 3IRDA 2JFEX 3USZA 2W6RA 4W93A 2JKPA 1W2PA 4EF9A 3N2TA 4IIDA 2RDUA 2V2DA 4LY8A 4NXKA 4DELA 1DWHM 2ZZ4A 5FL1A 1FHUA 3L68A 5KMYA 4EPKA 2G4FA 1ZBWA 4BF7A 2FMOA 3F2DA 1GG1A 5D9MA 4CQ9A 5JXQA 2OWCA 3GDLA 1U5JA 1FKWA 2JF7A 1G1YA 2J75A 2ZXAA 4IP7A 1KO0A 4EXBA 3W74A 2FFCA 4PRWA 2WCAA 3DESA 3TSMA 3O63A 2PGRA 2HMCA 1OD8A 2NQ5A 4FNPA 4AD0A 3T40A 1ITQA 4I6KA 5HBFA 4J3XA 5CZ0A 4A3YA 3HG4A 1CXIA 1S3TC 3RNDA 4GA8A 1B5TA 1F7BA 3VMNA 2H6RA 1HUVA 3VIMA 2PDLA 1WZAA 1MXGA 4PL1A 4WR3A 2X0HA 1GCYA 1V3MA 4A35A 4C7GA 2X1IA 3Q37A 5AFDA 1ZAIA 3LCLA 4ML9A 4FX7A 1SFSA 2NT1A 3VGDA 2NUYA 5E9XA 3AWOA 3IIXA 1PJ9A 4FXJA 3CK5A 2V3DA 3DFNA 2FZMA 1MNSA 1OFEA 1XYBA 5CPLA 3GTXA 1P0DA 3JR2A 1QI5A 3K4DA 2P8BA 3QY6A 3WBWA 4JY9A 2F7FA 1DTUA 1IHIA 2C1HA 4ZFMA 3VFCA 2YCLA 2PS2A 3CLMA 1QT1A 2VWSA 4IG2A 1DJQA 4GZ7A 3VZZA 3E2VA 1FOBA 3THCA 1Z7AA 1OB0A 3AIRA 1DJZA 3P61A 3HMCA 4ERAA 4WDUA 3N2CA 3OG2A 3HO8A 2AAAA 4H04A 2FZBA 2Y6ZA 2VR2A 1PZ0A 4F9DA 1MZHA 1XC6A 1LRQA 1UZ4A 2ZA3A 3MUZ1 3CV2A 3QV8A 2BFGA 4UMBA 1AQMA 3CV7A 4WZHA 4GWEA 4WLCA 2G0WA 2NX3A 1ECQA 1O5QA 3UEQA 5FD0A 1SSDA 5G1TA 2ISDA 3IV8A 5FSEC 1K4HA 4O11A 2PPGA 3OBKA 1E4LA 3Q45A 3STPA 3MWAA 3T6CA 4W7VA 5CJNA 4UFKA 2G41A 1UA3A 3RIKA 2PURA 4ZO8A 1OQFA 1IZKA 4BI7A 4WCJA 2BTMA 1BF2A 3TQPA 4FMVA 4LH8A 4M82A 4WY0B 2Y8UA 3M4HA 4UBPC 5CSYA 1XIBA 3FIGA 1IIHA 1XGZA 4WKAA 1SO6A 1ZU8A 1SJDA 2OLSA 4YMZA 1L6GA 4S38A 1KLZA 4LUTA 1KXHA 1LOSA 3IJDA 1PWMA 2EPLX 1F3EA 5GJNA 2B81A 1FWAC 3AIBA 2VO5A 4BF5A 3RM4A 3SUVA 1US0A 4HHPA 3DBNA 2CZDA 3DFPA 3NEHA 1BG4A 1OEPA 3LV6A 1D3HA 3S5YA 3DH7A 1U2YA 2HSAA 1DL3A 3C2RA 3GHTA 4NRRA 2BOFX 3QKZA 3WJZA 1MEIA 1PX8A 4D6JA 4NJJA 3F7JA 2Q71A 5FEWA 5A69A 1IZJA 2H3BA 2PDYA 1HX0A 2CNCA 2ZWZA 4RZBA 2BBFA 2HRWA 3GVGA 4E5TA 2V3FA 3MYPA 4X60A 2ASHA 5BXSA 5E0KA 3L4VA 4IGNA 3SQLA 2YXGA 3QXBA 2Y7EA 3W2JA 2OZ3A 1JRBA 5LGZA 4IIBA 3AXIA 3IAQA 3UZXA 3HTWA 3B97A 3RLVA 3RRAA 2XGIA 3R0KA 2E9BA 3GY1A 1TTQA 2YA2A 4TR9A 3TMQA 2QMKA 4XISA 5F4SA 4RXFA 4DJEA 4HJWA 4HZ7A 4TQTA 4NJHA 2J7CA 2XIIA 4JQ1A 2V6AA 1UUOA 1L8PA 4EWJA 4D6IA 3B9OA 3PPFA 1EF2A 4UC5A 1GVYA 3O2LA 1B57A 2EPNA 2R8WA 1QFEA 1NFPA 4FOKA 1UZ1A 4M80A 3MBDA 3CHVA 1DXFA 2NQZA 4NYYA 1DJXA 1YNYA 2H90A 4P61A 2JEPA 2V82A 3TN4A 4C91A 2WV8A 1THFD 4OQVA 1E56A 4MKSA 3LCGA 3KCOA 1TPVA 4K3ZA 5K9DA 2NV2A 1BXNA 1KCLA 4D6HA 1R3SA 5HR6A 2OZ8A 3FCPA 3V0UA 4MNJA 3QKEA 5H8MA 4G9PA 4IG2B 1IR1A 3RPDA 2JBMA 1A5CA 4XZLX 4MF4A 3QZAA 4HU3A 1CGVA 1WDQA 1H7NA 1M5WA 1GOWA 5FF7A 1C92A 4YJ5A 4GIYA 4FAMA 2PDKA 4N4PA 2DGAA 3LPPA 2HROA 3ZQ9A 1SO3A 1OINA 4JHOA 3SDOA 5GVJA 3Q2DA 4L64A 4ONVA 2E6YA 3GR7A 1FH7A 1A5UA 3U7VA 4H2HA 2TRSA 2HCVA 5D38A 4MYXA 1TRIA 3WBAA 2QV5A 4IFKB 5AHLA 3EWCA 5H8UA 1JDFA 1R38A 3S9YA 3SFKA 1M01A 5C7VA 4MYAA 3STCA 3O1NA 3M47A 2AOSA 1ITCA 5DELA 1E73M 4U2ZA 3BW4A 1AZ1A 4K1WA 3WJSA 1LOLA 4LRSA 3WJXA 3WDPP 1E1CB 1IGSA 4QNWA 3DUGA 1E6PA 1EP1A 1TELA 4S2BA 1TCDA 2PAJA 3B8SA 3GIQA 2Y24A 4UIOA 4PFMA 2Y7GA 4NASA 1YYAA 2P53A 3NQEA 3MANA 3CZ8A 2JEQA 4AYSA 1XLDA 2I9EA 5CC5A 3NZPA 2XVGA 4NRSA 5AKQA 3DHDA 2QPXA 3WUFA 1YDOA 4Z42C 1QWKA 1GOKA 2VFIA 3UCQA 8XIAA 1YTDA 2WSKA 3FFSA 3BARA 3P2VA 3R0DA 3NEVA 1FBAA 3NZGA 3WLPA 2DVUA 5LXEA 4YYFA 2CBUA 5D2XA 3VIIA 3VDHA 1ONWA 4XD3A 1Q4NX 3RR1A 2WBGA 2EQDA 4UFLA 4E2VA 3QLDA 2W62A 5D02A 1IYXA 3M0VA 4M51A 4ES4A 4R7OA 3YPIA 2FZ8A 3MHFA 3I3BA 5BYWA 1AMYA 2QDDA 4ILSA 5EKYA 4ZB0A 1OZMA 2ISVA 1KM6A 1W9DM 4GY7A 1B2YA 4ERIA 3GVRA 2VFGA 1KR1A 4OUEA 1SUXA 3MWCA 1J2WA 1CGTA 2PDFA 2W67A 4I9JA 3AC0A 4GKLA 5IXEA 1A5BA 4PTDA 4AZ6A 4DHGA 1W1ZA 3FA3A 4H9UA 4XIMA 2YGYA 2OTDA 4LF1A 4UFIA 3QMTA 1I45A 4GZJA 4IQEA 1VZWA 5J04A 4FP1A 3WK1A 1BXCA 2PDXA 3MP5A 4MUPA 4QG6A 1UR3M 2G97A 1UR4A 2YKKA 3H8AA 1J0YA 4K1GA 5AC8A 3E2RA 3WO8A 3S4TA 3VE9A 4HU8A 3NFUA 5LIUX 2XVLA 4MMWA 2BY1A 3H12A 3ANVA 1S5NA 3BANA 2ZRVA 2Z7GA 4O0KA 1OGBA 1ELSA 1YBQB 1VFSA 4CD7A 4D6EA 3ARZA 4Z1CA 3ID7A 1I2NA 3GNNA 5DEZA 1NELA 4P7NA 1WUEA 3OZMA 3S3GA 4NZ1A 1M03A 1V6VA 1W5MA 4M56A 1A80A 2J8TA 1VFOA 3VINA 3M0JA 3NM3A 3S83A 1UH4A 2YL5A 1E0UA 3GDTA 4LYQA 2CLMA 3EWWA 1I9CB 3PZUA 5HJXA 1EWDA 2GQAA 2YFNA 1UJPA 2Q8LA 3GU2A 1GK8A 1KA9F 4BI6A 4K2SA 3VYLA 4TU1A 1V8EA 2Y70A 2X7WA 2INZA 2QULA 3WNOA 4RZ4A 2PP1A 3FVDA 1PB0A 1PKNA 1OK6A 1WDRA 4B5WA 4HB7A 4R9XA 4HNLA 3TC6A 3DCPA 4YTSA 2RH9A 1W56A 1J5SA 1TPB1 1OCJA 1VLWA 3A3HA 5I7GA 1GYNA 2WMIB 1SO4A 3AJ7A 2VX4A 1X8CA 4L9YA 4NXSA 3CHCA 1DJWA 1G7VA 1QNRA 2QDEA 3H24A 3C2YA 3WEZA 2YLLA 3NDOA 4PMDA 3BG9A 4PMUA 4KRUA 3TU9A 4PMJA 5EBAA 2GUYA 1E6QM 2Z24A 1JDAA 3WG6A 2WVTA 4AH7A 1I1WA 5DFAA 4M8UA 4F8XA 4CQBA 3EPMA 2POTA 1KV5A 3G1DA 3UZ5A 3NDYA 1FCQA 3UNDA 4MM1A 1VYSX 3LHYA 3SRFA 1QTWA 1U1JA 1V79A 4GNJA 1W5QA 5XIMA 1XYMA 2MUCA 3MTWA 1C8XA 2XZ9A 3VKBA 2FB3A 3ZZ1A 5A6BD 2PWGA 3ABRA 4L80A 3REQB 2INFA 2ZZ1A 5G2IA 1YHTA 1Q6GA 1WUFA 4BQ2A 5ABGA 3MMUA 1TPFA 3OQEA 3FW6A 1LRTA 4EAMA 4J3TA 2Q02A 3W7DA 1VEPA 3WEMA 3ZWTA 1LT7A 2DZUA 3NQ7A 2WHKA 1VHCA 2ZZ3A 3UCCA 1WA3A 1ZPTA 1VBUA 1G0CA 2CHRA 2FPTA 2ZXDA 2DZSA 3IRSA 1F8MA 1X97A 2E5CA 2PUZA 3CASA 3E0IA 3JZUA 1KKRA 2Y5EA 3XISA 4V1XA 3VGHA 1RJPA 2WKJA 3UP8A 3U2CA 1TE1A 4QTGA 1OX4B 1FWSA 4LC8A 4WDWA 1ZUAX 3TXZA 5A6SA 2ALRA 2DZPA 1XRFA 3CMJA 2J9YA 2HISA 4F2TA 2D73A 3EKZA 4WGXA 5JMUA 8TIMA 3ITTA 2VFHA 4AZ7A 1ZB5A 4C6CA 3EKGA 3NZ1A 3L4TA 4JOMA 2BNJA 2BLEA 3VD3A 3A3XA 1Q6RA 3T44A 4Q8MA 1YIXA 3MKKA 3ICJA 4ML4A 3TROA 4AX6A 3SCNA 3MKCA 1EYWA 3BSGA 3OVPA 3RFAA 2WZMA 2GQ9A 2AMXA 3SQMA 4YIWA 2QF7A 3MYOA 4DVOA 3KCJA 1OK4A 4FOUA 3VM5A 2D24A 5CPNA 4POCA 1CEOA 1NP2A 1DOSA 4ZE4A 1F73A 2W79A 1WP6A 4XZBA 4KIEA 3W23A 4ECLA 3W1NA 2PRMA 1IWAA 2CBIA 4M0XA 3W7NA 4RZ5A 3AU2A 4JTUA 4RDZA 1QNVA 4C6KA 3GXIA 3U7BA 4DUVA 3ARRA 4M7TA 2VHLA 4JEQA 5C8BB 3PJWA 4JNMA 5HNNA 3CMFA 1Q65A 3WLJA 4BF9A 1X1NA 1E9YB 3KLLA 2OO0A 4K8GA 4NI3A 3WJWA 1RV8A 1SO5A 1ONEA 1QI2A 4UXDA 2ATMA 2FTPA 3GNDA 4L7ZA 1KXTA 3KHDA 4PUKA 4BWLC 2WMHA 3KVJA 1CBGA 1PIIA 1QMLA 2Z0IA 4LUSB 4ATDA 1GZJA 2OT1A 3MI3A 4YXGA 1IXPA 4JX6A 4DI8A 2Z1KA 3NPWA 3QFEA 1SFLA 4CN1A 1F05A 1XXXA 5FJRA 4Y8EA 3PJXA 3M6DA 3QPZA 3CAKA 2NQHA 3R8GA 4OGZA 3M0MA 3CUXA 3VD4A 3O6YX 4UWMA 3PSWA 3OGVA 2XVPA 4HMDA 1TWZA 3R79A 1EP3A 2VCAA 1ZZMA 2DIKA 3W26A 3NDZA 4DUWA 3P8JA 1KCXA 1G01A 4YCOA 1UJQA 3L66A 3W2UA 4LVDA 1SW7A 3EEZA 1SR9A 4B5NA 1DIEA 4UTMA 1GVOA 3EMCA 2BGQA 1XDLA 2V81A 4I5UA 3HQ1A 3KW3A 2G4JA 4MDOA 2DT2A 2EPHA 1IT8A 4AZGA 1OFAA 3BLLA 4V15A 3M6YA 2R1LA 2GL5A 4I7WA 1E0TA 5HATA 1XCFA 3C61A 4QXIA 1YE4A 2RDWA 1GVIA 3CLWA 1E72M 4IPLA 1JQVA 1Q6DA 3QPYA 4IPIA 2AQVA 1KKOA 3GO2A 1FWDC 2OQHA 4Z1YA 3GFYA 4GO8A 3F5JA 2V30A 4ZSTA 2OSXA 4GPNA 1VCGA 2YIHA 1PCWA 2GVGA 1P5BA 4G2DA 1LBMA 4O1DA 1R3RA 2WSQA 1UD4A 2B4GA 5SWUA 2HQAA 4JYDA 3TZFA 1WKFA 1HP4A 1C7TA 3GTFA 3UVAA 1EGMA 3WNLA 4UQ9A 3M5ZA 1QR7A 1KBJA 2W91A 3H4GA 3HN3A 4JIIX 3PVFA 3LPGA 3F03K 5DXYA 5HOSA 2OGYA 3CM4A 5C9ZA 3S2NA 4S23A 3R8HA 3L5LA 3TYDA 5I3IA 2PP3A 4YWIA 5I0DA 3CT7A 3LTSA 2HEJA 2C1GA 4NZCA 1K9EA 4Z08A 2OGJA 3WF3A 4N0RA 2IW0A 3TJLA 1JF5A 1HG3A 3N4FA 3W73A 5K7JA 3ZXWA 1XIHA 5LA0A 1WKYA 4PRRA 4QE5A 4PB3A 3MU7A 4PMZA 1A4MA 4A29A 4DJFA 2BZNA 2E40A 4ZGYA 5I09A 4J3UA 2E9MA 4YU1A 1K70A 3VO0A 1EPXA 3WMSA 3ATYA 4XBSA 1OD0A 4WD0A 4UTTA 3K5XA 2CWXA 3CMGA 3E6EA 1DVJA 2ZX7A 3ABZA 2W0UA 4EXQA 2KX9A 5DRCA 2NWSA 3LZ3A 6REQA 4RNJA 3ITLA 3SR7A 3VMPA 3O7UA 4MNMA 1IT0A 5IFPA 1XGDA 1H50A 1GW9A 1TZ7A 1ZP4A 1KFLA 4XAFA 3GG7A 1J01A 6A3HA 2GPTA 3GIYA 5K9CA 1PS9A 5AVHA 4Q3MA 1H7WA 3TCSA 4G1KA 2J9XA 4AWSA 1Q4WA 5CXPA 2HVOA 2JK2A 2J9ZA 4RLIA 1J0ZA 4DNMA 5EFFA 1D8WA 1X38A 3ANYA 4AUBA 4CNSA 1OC5A 2WWDA 5AECA 3FXYA 1RP8A 3HU7A 2Z1VA 3LCHA 3OBEA 4QLKA 3IK2A 3R58A 4GYKA 2WM0A 4GGBA 5BCAA 3BLKA 4WKHA 2X05A 1Q63A 2QVHA 3ME3A 3SUSA 3M16A 3SBFA 1KD0A 4XWUA 5C70A 4LW7A 3PZVA 2D0HA 4P8UA 2J78A 1FKXA 1KQZA 1B31A 2A6NA 3G0XA 3ITVA 4KESA 4CU8A 1NWRA 2W4XA 1GVQA 1UKPA 3B8VA 4H4IA 1QW9A 3ITYA 4D71A 4HNOA 3NQ2A 4GO9A 3WDIA 1HQTA 2GJRA 5LNRA 4R53A 4XZ9A 1W32A 4C6OA 3EWBX 3M0YA 2J8GA 3C2FA 1C91A 1G94A 2Z29A 3E96A 1XYCA 3GR8A 4UQAA 3VFLA 3N11A 4AEFA 3NO1A 4GUGA 1E4NA 3KWSA 1FUYA 2YCJA 3W7HA 1QHZA 5C6MA 3W87A 1A5NC 1GT8A 1F74A 5KETA 1WKDA 3SY1A 3S1WA 4WK9A 4HOZA 2INEA 2VEFA 2AQOA 3WDQA 3FV9A 1ZY9A 1YXDA 3N14A 1GVFA 1MNZA 4OOZA 1H41A 4LVFA 5GJPA 3TN3A 4NZ4A 1K9FA 3WFLA 4L56A 3FEQA 1UD3A 3O05A 1P6CA 2A3LA 3FJ6A 1XYAA 4WJ8A 1OZQA 3WFZA 3BK0A 4C6BA 1AL8A 4CN6A 4YTQA 1Q2RA 2PZNA 3RLGA 3K13A 4XUGA 4HSHA 1WQ5A 4XD5A 2IMRA 4J40A 5U4NA 4DY1A 2W27A 5C9WA 4K8HA 2OYLA 3IWPA 2ON3A 3L4YA 2QW5A 1LT8A 4MJMA 1XRTA 2ZUTA 1UASA 4O8AA 2UY2A 3W1UA 5LSMA 2I14A 2A79A 3P0XA 4I9MA 2O9RA 3V18A 3W7OA 3QRHA 4MSSA 1EHAA 2NQ9A 1ZNNA 4UTWC 1ICSA 4M19A 5H91A 1XWYA 4HOXA 4LBRA 4UQEA 1J79A 3N9RA 1QPNA 4PCTA 4JDBA 2V5LA 3MKVA 3EOSA 1SZNA 2W9MA 3ZFHA 3GTIA 1IXQA 4GE8A 1XQKA 6XIAA 2GWNA 3K4AA 1PL9A 3PBGA 4JHMA 2E09A 2X2YA 3UGVA 3ELFA 2V38A 5MKGB 4RW5A 5C5YA 4LCSA 2NVDA 1JR1A 2EJAA 3TX9A 1IEWA 2R1PA 1QOQA 5A8NA 3WQVA 3UWUA 4G7FA 1E5JA 4XZMX 1FP9A 4Q7NA 3CIWA 5C71A 1KBBA 5TBOA 2ZE3A 4ROPA 2OT0A 3LLXA 3LCIA 3I7SA 2WLYA 3WBEA 2GGJA 1PSCA 1HJSA 3G22A 2PDBA 1W3IA 1E9ZB 2CETA 3CV1A 3LNMA 2CKSA 3LU2A 2OR2A 4WY0A 1Q66A 4CU7A 1TRDA 1D8CA 4GUFA 3I68A 3TE9A 3U5UA 2DZXA 2AAMA 1UH2A 5A6JA 1KCZA 1DWJM 1FWIC 4PRTA 4O4VA 3C2EA 1A5MC 3ARYA 1IE7C 1OX4A 3NOEA 4HVXA 1EJRC 3AUOA 1JNEA 5BOOA 3IS4A 5JH2A 1Q7ZA 3W1XA 4K38A 1Z48A 3NSXA 1KFBA 4W8BA 3PZIA 3MI6A 3R11A 1Y7VA 3OHIA 5I3GA 3N4EA 5FJJA 3H4WA 4CEUC 1JGMA 5BWAA 2PWEA 5A2AA 4IP5A 3BDKA 2WPGA 1A3WA 1ZP3A 3E12A 4GYPC 3H21A 1UWTA 3T4CA 4K39A 1JPIA 2E9LA 1XD0A 1XQLA 1XF0A 4ADUA 1H0GA 3MCNA 3GE7A 1BF6A 1C7SA 1EJ7L 4UOJA 1OYBA 3MHUA 1NDVA 4Q33A 4PMNA 4UTFA 3THQA 1UH3A 3CIVA 3R8RA 4H7ZA 1EKOA 1BXBA 4HP5A 3RX3A 3HURA 1MUCA 3WQ4A 3EXSA 3G1FA 4X63A 5A6BA 3KRUA 1I2PA 3R13A 2PP0A 2BY2A 3HQNA 3REQA 2AKZA 2J88A 1A0DA 4PTMA 2GQ3A 3QBUA 1V3IA 2Y61A 4O18A 3EA2A 1JCJA 2IXUA 4XZHA 1J0IA 4GLEA 3GD6A 5GPRA 3BE7A 1ISWA 3LUTA 4W7WA 5HAOA 3U0HA 4JXCA 4O54A 1LDCA 4XD6A 2DP3A 3FYOA 3LRMA 2YBTA 4E0CA 3NNTA 1VFLA 1HGYA 5DO8A 3BW3A 4LCRA 2QKFA 4JL2A 2X1SA 1OFOA 2DZBA 1M7XA 3TKFA 4MAVA 4BFAA 5AY7A 2ZTKA 5CCZA 4BS0A 2WQDA 1KBKA 1N55A 3TAOA 3RX4A 1GORA 3EDFA 1BYCA 3LYEA 1XLCA 4MLRA 4C65A 5HPCA 5J8LA 1FHVA 5D09A 4RXGA 4PTVA 4C7DA 2H9AB 3GWQA 1KQYA 3FGCB 1T6MA 4O28A 5FAJA 1DJHA 5CGQA 2QEZA 2C13A 1CXKA 1V6UA 4GX9A 2ZRYA 1W1A1 2TSYA 3PWAA 4TOQA 1NAL1 1CTNA 1FWNA 3GXMA 3S9IA 3IVTA 4C6PA 2WHMA 3EA3A 2OEKA 5DCDA 4U28A 4DNHA 4GNKB 3ZR4A 5FF0A 1FWBC 1NH6A 1UWIA 3WLRA 4H41A 2C8NA 4C6EA 4DWSB 1D9EA 3A4XA 4FSAA 4PMVA 3VZXA 1B3OA 2QPUA 5TQLA 4CNNA 3KAOA 5LGXA 3HGRA 1GUVA 2NVAA 3H55A 6ALDA 2G37A 1XLJA 3ATZA 2Q8XA 4ACYA 4Y96A 1VFUA 1ADDA 1TV3A 3HV8A 1MWOA 5I3HA 1W8GA 3AMGA 1M7PA 4EF8A 1M9HA 5I78A 3QFWA 4H9ZA 2XJ7A 3K30A 1A5AA 2PTXA 4AF0A 3MO4A 1B9ZA 1RCQA 4W87A 4LUIA 3MUIA 3GXFA 2HBVA 4Z2JA 2G50A 3NSNA 4PTWA 3VOHA 1Z8AA 4KF1A 3O6DA 3ARVA 4OWGA 2Q3RA 3GUGA 4B90A 2VEIA 4HMEA 5C7HA 5CQ1A 2DUXA 3MVTA 3DKJA 1HKJA 3UYCA 1W1TA 3B9DA 4RW3A 1DEDA 1WNOA 2WHLA 3IIPA 2RDTA 1KWGA 1XSIA 2RUSA 1TB3A 1VBRA 4FNTA 2DDXA 4O1FA 1OBAA 1SVDA 2FJUB 4IP4A 4MAZA 3W7CA 3EKLA 4PCSA 1XYZA 1H7PA 1MQPA 3CPUA 3TNBA 4L65A 2VEKA 4D1JA 1UR9A 5U7SA 2VC5A 1NFBA 3OB8A 3XINA 3N9KA 1DXEA 1T96A 2NUWA 1A49A 4WHBA 4HGXA 4LV4A 4PMQA 4D72A 4RUBA 3UWWA 3H22A 3EB3A 1JPKA 4H8VA 4H83A 4AEEA 3DI0A 4FNQA 4ZOCA 3NSMA 1E6SM 2EG7A 2ZADA 3FSUA 4YTRA 1SJAA 2AL2A 2E5DA 3AS0A 1H1NA 3SY5A 1IT7A 3V75A 3WYZA 1RUSA 1H4PA 4AQLA 4AVNA 3OG3A 1PX3A 3PBVA 1PXGA 2V68A 4IX2A 1V3KA 3NQAA 3D5HA 1ZQ5A 5FJTA 3QR3A 1O5XA 2V67A 4DLFA 1VEMA 2Q01A 4XIAA 1C9DA 1RCXB 6XIMA 3C0QA 1YMYA 4NJIA 4WGHA 3KRBA 3W38A 2VDHA 4O8RA 3LI0A 3DHFA 1SZEA 2ZXBA 5DBTA 1KTNA 4Z2GA 4NNBA 2RKXA 3QYQA 3PPGA 4NJGA 2ZUMA 2ZBTA 4N4QA 3TJIA 1R30A 3TVAA 5HNTA 4NZFA 4GJ1A 1EYEA 1S5TA 3EXTA 3AMCA 3DFYA 1ODUA 3I3EA 4B4FA 4RE3A 5EFDA 3H70A 3TP4A 1BKHA 3W2MA 1XISA 5ECVA 5EL1A 4B5UA 3I6TA 1XH1A 3BMVA 2TPSA 3CAWA 2P50A 4RE2A 3RCMA 3S6DA 3V16A 1H60A 2X1UA 4ZO6A 3KOWA 3UGRA 1E40A 3WMCA 1W9VA 1E6NA 4IIEA 5F7UA 4U10A 5XINA 4GZIA 1GQKA 3N34A 5K9XA 2I16A 4HCHA 1FHDA 1FWTA 1PO9A 2QS8A 4Q8UA 3S46A 4AW7A 3N29A 1KFCA 4J2MA 3T9PA 2HVMA 5HDRA 3SW6A 4GNVA 3VC5A 2HWGA 1UKTA 3KBMA 5K2ZA 4FHAA 2O9TA 2UWFA 4X2RA 1UWRA 2DV0A 3VKKA 1S1RA 2QCMA 2GK1A 2I56A 1UWUA 3RMJA 1UCWA 3VOCA 2DT0A 3LBCA 1R47A 3CQIA 2ZZ6A 5E09A 2V69A 3GYEA 3QV7A 4LVGA 4KWUA 4ADSA 1ZSXA 3V0SA 1RQHA 1ALDA 3DX5A 2OOGA 4HA0A 4DZAA 2GJPA 4DBDA 4OJYA 4S3EA 4F0KA 2X7VA 8A3HA 3T0BA 4IQDA 4M81A 3QTPA 4OZOA 2A7RA 3WDHA 5AHEA 1WXJA 2YBUA 4OFCA 4MJ4A 3RX2A 3B06A 3LBMA 1OT1A 2QLYA 3S1UA 4F2BA 5CSRA 3SUUA 3VMOA 3CH0A 2YBVA 2VCBA 3M5XA 3GYCA 4R7JA 1WX0A 2GUBA 2HXUA 2XFRA 4HYWA 4NJKA 5E0CA 3S2MA 1OVDA 1SZFA 4JD4A 3Q67A 8XIMA 1XSKA 2I9UA 2X42A 5DBUA 3HM7A 3U2EA 1WBHA 4NILA 5KSWA 1XBZA 2AQWA 3LENA 1AFSA 3LRKA 3F4CA 1T40A 3NCOA 1BPLB 2QJMA 4PMOA 5CGTA 1HJXA 2QCDA 2Y7FA 7ENLA 1K8CA 1S38A 1OHLA 2R1NA 3G5EA 3KBVA 4GY0A 1EJWC 2WNWA 3WQOA 4QLLA 4QJ4B 5D9OA 2V5JA 1TMQA 2EG8A 4IMGA 4OBRA 1FWEC 4XAPA 3BJTA 2J25A 1VJSA 3THDA 3IUDA 3P81A 3KX6A 1EBGA 3NQ6A 3GX9A 1AJ2A 2HPIA 2HS6A 4JFSA 3WBYA 2GSHA 4E38A 3K46A 3A3WA 1H2JA 3T2PA 1OFDA 2B0MA 5HMDA 4U33A 3VD5A 4HNTA 2W3ZA 1O1HA 3OLIA 3EX3A 3CUGA 3THUA 1VQTA 4P8XA 3TN6A 4AVFA 3W81A 3FJ4A 3M7SA 4Q6JA 2DT3A 4N02A 2CW6A 4RE0A 5AYBA 3GAKA 5EA9A 3LOTA 4UTUA 5CPMA 3VM7A 1QO2A 2Z1SA 2BHYA 3P0WA 3ENLA 3PZ9A 1VP5A 3BL3A 1QNQA 4GVFA 1UUMA 2QYGA 2VQTA 5HXMA 1XI3A 1XL9A 1MYRA 4QS5A 2ICSA 3SCRA 1UZDA 3RXZA 1Y0EA 3O06A 4WDTA 2I5GA 1EUAA 1E3ZA 1G67A 2ZXQA 1L6WA 1J18A 2J7HA 3TYEA 1QNPA 1WOAA 3S2JA 4S3DA 1OX6A 1XKYA 3DG3A 4YN5A 4UCFA 3VNMA 2CLOA 2WBKA 5I3KA 3VNDA 1AD4A 1VBHA 1J0KA 1PYMA 5C54A 3T81A 3TYZA 2R6OA 2ZRZA 3O8AA 4XZWA 3K8LA 4QEEA 4FX6M 4AHOA 1UW9A 3VKJA 1XDJA 3W00A 1HKMA 4DBSA 4GVGA 1UMYA 4UOQA 3B0YA 2X41A 1NFGA 1LORA 3DFSA 4WRHA 3M1ZA 3VC6A 3QGAC 4Z1BA 4QQ3A 1UIPA 1OG0A 3PPCA 4IGSA 3GW3A 3FYYA 3ECQA 5D04C 3O15A 5MF5A 3TYCA 4B92A 1SMAA 5CZSA 4BKNA 3WH9A 1GJUA 2C3ZA 4AD2A 3WQCA 4KEZA 5CLTA 5EY5A 4HA4A 3O16A 4GIAA 4A8LA 3WH6A 1Q45A 1NVMA 4MHBA 1X39A 4LS0A 1F3TA 1JQXA 1KM3A 5A6MA 3AHVA 3TA6A 3SN4A 2VCCA 3FXGA 4AZCA 1XLGA 4GGHA 3ARSA 1FFQA 3QW4B 4LS1A 2PDPA 1UPMB 4JHZA 3TNOA 2Y2WA 2I17A 3CH9A 1HKKA 2VENA 4QBXA 1GKPA 4GY1A 5A6TC 4PTXA 5BRPA 5AC7A 3SY8A 3T0DA 3DGRA 2PD5A 3WCZA 3H7VA 2E6DA 3LS9A 3EA1A 3MSYA 3ARQA 1EF3A 1VBJA 2PDMA 5DQPA 4DF1A 3W24A 2YCIX 4Q8PA 1FWWA 1AA1B 1EB3A 4EK7A 3N15A 4AY7A 1KRMA 4IGMA 2FDMA 2QGHA 1B3VA 2ACUA 2VZOA 4UTJA 3UWEA 1TV7A 1KLYA 2NLYA 5FOOA 3UXIA 3PB2A 3RRXA 3OQ8A 3PWIA 4R7WA 2QUNA 4US6A 3MUY1 4DLMA 2WJZA 3L12A 4PUUA 1O5KA 3NTYA 5AZ1A 1ADSA 2YL6A 4IPNB 2PLJA 3KL5A 3T7VA 4GQ0A 1AD1A 2BHZA 1MXDA 3DFQA 1GEQA 4C6NA 4ZTXA 1DKWA 4DI9A 2BB0A 1ZL1A 1OF6A 3RF9A 1JI2A 3GNRA 3NL2A 2EO7A 2G5WA 4JBRA 1OFBA 4KEVA 5FJOA 2P8CA 3DERA 4ZQNA 2UZ9A 2HZGA 1BLIA 3A21A 3UWZA 1LOQA 4GCXA 3M0HA 1PDYA 3CUFA 3IIVA 5JQ9A 3T8LA 2A4AA 1DWFM 2DSZA 3B0XA 4NZ3A 3TN5A 1JYXA 2QJHA 5FACA 2PTWA 5BMWA 1W3KA 3AIEA 4JTKA 3QPEA 1XPYA 2RHGA 4TX6A 3EGJA 4M3PA 5A95A 4ZR8A 4NF7A 4RNIA 2DJLA 3XIMA 2DSUA 1YNPA 1QU4A 2PF8A 3KL0A 4HSOA 4AZ5A 4Y2WA 4TTGA 1ADOA 4OT7A 1PCKA 2QCGA 3W7LA 1CGWA 1WAUA 1TUFA 5LNSA 3GU1A 5CC6A 4IPJA 1XH2A 4IT1A 2QJJA 1XIJA 3LNPA 3HQOA 3UJRA 1S2WA 1ODZA 5JBDA 1XIFA 5CG0A 4NP7A 2QJNA 4GUIA 3QY8A 2ZICA 1ME7A 4BY3A 1DJYA 1TPUA 5J5RA 1LL4A 2FLIA 4LB3A 4HHLA 1YTEA 3N3TA 4GQRA 1J5TA 4X0NA 3GH5A 4D8AA 4AC1X 2Z2BA 5I02A 1E15A 3G8RA 4U2YA 3HGOA 2E6AA 1JNDA 4MNLA 2WK2A 4IFOA 4UB9A 1UD5A 2VGBA 3F4NA 5CPOA 4JNZA 4D6DA 1W3HA 3URAA 1OIFA 3WH7A 4Y9AA 4QRNA 4Q8VA 2V0TA 2XPKA 1HT6A 3TWBA 4CKQA 3R2GA 7CGTA 3M44A 1QW7A 4QM1A 3VNKA 5EYWA 1UC5A 3AHZA 2OYMA 3BWWA 4L9ZA 2OMAA 4NU7A 1FWHC 4HTBA 3NWRA 3NGFA 3SRHA 4HK5A 3VKDA 2WNZA 3LEPA 4WUIA 1W91A 1HL2A 1DQUA 3PTQA 1AMKA 2CHOA 3NVTA 1OJXA 5AYXA 3DDMA 2PDQA 3CB3A 3ITCA 1RA5A 1BWVA 3EOLA 1A50A 3VIKA 2NXIA 2WCSA 1LL6A 2JGYA 4E8CA 4DWSA 1QVBA 5D9NA 4X9YA 2ZUUA 2VD8A 3T2QA 3V36A 2XIBA 5DN1A 4AIEA 5KINA 3AJXA 3F1QA 3W75A 3EWYA 1JXKA 1QBAA 3LGEA 1RVGA 4W8LA 4KMQA 1RPXA 3M0XA 1LROA 4KERA 1G4SA 3UR2A 4PEEA 2ACSA 1QI3A 5AN7A 2GGHA 4ICMA 3NQ8A 1HVXA 1S2UA 1UPPA 3ZT6A 2HE5A 2YYUA 1RY8A 4NVTA 3I4KA 4HJFA 2C0AA 1O60A 3N2MA 2YLAA 4MWAE 1AQHA 3WQEA 1J11A 1WDSA 1B30A 3FY1A 3W1TA 1PZ3A 4JKLA 3UW6A 1L9WA 1P7TA 4NI8A 2WZHA 2FJKA 1FXPA 1XIGA 3L0NA 3T2OA 4F66A 4WY0F 1ZBKA 2WCGA 3WZ0E 4ZXOA 3OYZA 3UF9A 4CNPA 5CJ5A 3UPBA 3ARWA 1U5VA 4E4PA 2X0SA 4GIEA 3T0TA 3U4FA 2FH8A 4H7CA 3TR9A 3LZ5A 4F40A 4HK7A 1O7AA 1ITUA 4AZIA 3FS2A 3CJPA 3MP4A 4H2CA 5EMMA 5CH9A 3PY2A 1UOZA 5I06A 4I90A 4MPKA 3WNMA 2G3NA 3MC5A 2IPFA 3MB9A 3MW7A 4KGLA 3EBVA 5J5DA 1UZHA 3MCOA 4IHCA 4C1NB 4J3SA 2VTFA 1ONRA 4D2JA 1EPVA 3TTQA 3EB4A 3MJYA 2WJEA 4M6PA 2XGBA 4F3HA 1M04A 3IUHA 2ANUA 3VE7A 1UP3A 2QCFA 3H53A 2CLIA 2XIJA 4AD4A 2LLEA 2B31A 3EWXA 3CS2A 2VVSA 1AK5A 1XCWA 4GZEA 3V4BA 4KW2A 1VS1A 2GVJA 3ES7A 3MS8A 3CV6A 3MDWA 4DXKA 4KWVA 2VJXA 2VFEA 1EZ2A 3RDKA 1CB7B 1XICA 3PR2A 2Y63A 2X0YA 4J4KA 1V0NA 2J47A 3GDBA 4QAWA 2QJGA 1U30A 5BXTA 2P76A 3AO0A 5DT7A 2PC8A 4GK8A 3W7RA 3CQKA 1GHSA 4O16A 2D0GA 3EPOA 3NUKA 1E55A 3NURA 4Z1DA 2JALA 3AZSA 1WPCA 1TQJA 3O6AA 4ZQPA 4XVDA 2PRHA 1XS2A 4PFHA 1XG3A 3EB2A 1V6TA 3H2AA 3MT1A 1XGEA 4UTIA 1ZJHA 3N1AA 4QGCA 3UR5A 1QOPA 5F2LA 2E67A 2DIJA 3LCXA 2CBVA 4LTSA 4NQ1A 1J0JA 2BVDA 3MJMA 1A0EA 3PZTA 1CYGA 1OABA 3G24A 3ZJ6A 1QI0A 4KCVA 3C4UA 3W1QA 2XG9A 5M2FX 3URQA 1W3NA 2GOKA 4GABA 3E38A 3A9BA 1EH9A 1PE1A 1VPXA 4H6QA 1GWJA 2WXDM 1M68A 2R9RA 4HZ8A 1TPWA 5DY3A 3AROA 3AMKA 1TCMA 1KFKA 3AOFA 2P0OA 1RLCL 4IFRA 1PIGA 4BQ4A 4Q32A 2ZVIA 2VRQA 4X9SA 1H1YA 1TJRA 3MZNA 4KETA 1J9YA 5LIYX 1G69A 3BXWA 3VUSA 3R5EA 4LBSA 1S5WA 4AD3A 2WLZA 4V33A 3P84A 2HJPA 2YSWA 3W1AA 4AIOA 5XIAA 2HDJA 4P7LA 2JIWA 2QCLA 4PUEA 3STEA 4P8VA 3R12A 2QCEA 5M03A 4JTHA 3WD4A 2E68A 4WSJA 4XVEA 1GQJA 2YXXA 4YPJA 1NU5A 1Q3NA 1F76A 1TSIA 4JFTA 3OLGA 1R3WA 1K6WA 3NYDA 3ES8A 4G56A 1REQB 3IACA 1VKFA 3KUMA 3CYJA 1QJWA 1RJRA 3OPSA 1TZ9A 1WXYA 1G9HA 2I1OA 4LUJA 1R0MA 5BRBA 5BROA 3WD0A 2XDFA 1AODA 4Q4PA 4F0LA 3CNYA 4IF2A 1QK0A 4YTTA 2V63A 3WFAA 1W9UA 4B16A 1GJWA 2P1FA 4FF7A 1E43A 1LQ2A 3L23A 3VIPA 2FHCA 1HKIA 4DZIA 1VBGA 4WX2A 1UKSA 1TWIA 5EMJA 3PZMA 1JAKA 2YDSA 2O7QA 3BJFA 5FL0A 1KW1A 2VT0A 2GGIA 4H3DA 4A3QA 3GSMA 3FSTA 3WK2A 1V0KA 4H9TA 4A22A 4K7VA 3B9NA 3HBLA 4AYGA 4NG3A 1YDNA 3S2CA 5DX7A 4E2BA 4GXMA 3QZEA 2QCNA 1VFFA 3W82A 3M0IA 2CWNA 2VI0A 4DQWA 3UZZA 4B2DA 2CEQA 2H8ZA 2E7FA 3ZYZA 4Q8QA 1EX5A 2E5BA 3LLDA 3KVMA 2WSRA 5HQEA 4PE8A 4HD5A 3SCVA 1HJQA 1I4NA 3DXIA 4TO8A 3RAOA 3HIJA 2PTDA 3B0PA 1XLBA 1K02A 3UQNA 3SGZA 3JZEA 4DUOA 2E1DA 3QHMA 5BZAA 3OZOA 1JFXA 1JJKA 3N6HA 4DZ5A 4KS0A 3WEOA 3LG3A 3PUGA 3O6CA 4FALA 3ZR6A 3WLLA 1EDQA 4IMAA 4YYCA 2YJQA 1O66A 4AX7A 4NAEA 1Z9AA 1KNWA 2DUZA 1OGGA 3IJ9A 1EOKA 3I65A 3WQGA 1W5PA 3SIZA 3HG5A 2Y88A 2A21A 4MZ8A 4M6VA 2ZTJA 1QNOA 3QMRA 4RPQA 1I2RA 1TTPA 1UBSA 1SYTA 2VR4A 1JAEA 4EOUA 3MUXA 1B4EA 5HULA 3K8MA 4O4WA 3I4EA 1JZ7A 4EXAA 2V2HA 2J7DA 4QDPA 1Q8AA 4PMRA 1YPIA 3W07A 4JTDA 2WVUA 2XHYA 3W1PA 1KRAC 4DXVA 3W2LA 4YNGA 3P93A 1CGXA 4FZIA 1R6WA 4HU4A 4AU0A 2YL8A 1I6NA 4EACA 2WOQA 5HMSA 1ENUA 3KTSA 1DJGA 1F4AA 2X30A 5AHIA 4MG4A 2P0IA 4XAZA 3KBJA 1PHQA 3SRDA 3NPVA 1RD5A 1LUCB 4DJDA 1WDWA 4C1LA 1CLKA 4Y9OA 4CNTA 5DY2A 5JBFA 4WSKA 1LJYA 4XO6A 1KRCC 3NAVA 4RDWA 1POKA 5KTLA 5JVLA 5HK4A 3DBPA 4EKJA 4CGTA 1OYCA 1E0VA 5FA5A 3QV6A 3W85A 4RV3A 3A5FA 3W7QA 4S39A 1PHWA 1VCFA 2BODX 1KM5A 1N8IA 2L5HA 3ZSSA 5FJPA 4WSHA 3MMWA 4HIBA 1JCMP 1LRNA 1MW3A 4HK6A 5M17A 3FAXA 4LGXA 2YA0A 1L2QA 5CKSA 3CL7A 1RH9A 2NQLA 1E71M 3OLDA 4NYUA 4Q4QA 1K77A 1QW8A 1AQFA 3CXOA 3UA4A 9CGTA 4DBWA 1FWJC 1Z44A 3RJXA 4I5XA 4R34A 1JCYA 2A2IA 1MMFA 4DYKA 1FDZA 5CBBA 3ZSTA 2I5QA 1Y5XA 1PTGA 3SO7A 3WL1A 1ML1A 3GNXA 3PJUA 3BC9A 4JYEA 3SCQA 5E6ZA 5IDZA 2CIPA 3PG9A 3PPHA 1Y5WA 3W84A 1TR1A 2OYKA 3UWYA 2G3MA 4F0HA 5F2MA 3WX7A 1O95A 3ZIZA 4ASTA 1GVRA 3G18A 1MUWA 4C1NA 3RLHA 3R10A 2BP1A 1UR8A 3F2BA 1JDCA 1R9XA 4M6QA 1A53A 1M53A 3FJNA 2QV4A 1BYAA 3OOQA 1TX2A 3MI2A 3KP1A 1O6IA 1EOMA 4GC3A 1L6YA 4JIQA 4GKTA 4NKCA 3KBNA 3LGGA 3TOYA 2PTYA 1K6AA 2ZZ2A 2QCCA 2YPIA 4UTTC 1JD7A 1FWGC 3FYPA 3WQWA 4UQDA 4TX8A 4P7RA 3PBYA 4IMFA 2OZ0A 1RA0A 4ZOBA 1RALA 1UROA 2R94A 2ZVRA 5G4HC 4XO7A 2Z1XA 1GOXA 5RUBA 3RU6A 3U3HA 1VPYA 3CUJA 3KDNA 2VX7A 1M1BA 2PDWA 4OOUA 4O1AA 1YQ2A 1GPWA 4ZOEA 3B03A 1V6XA 4D6GA 5B7YA 3BJSA 4O50A 3WDRA 1KGXA 3BOXA 3L4XA 4NZ5A 1ZJAA 4WXYA 3T1GA 1EO7A 2YCLB 5T9CE 1JPDX 5E5CA 1HO1A 3E1F1 2WAGA 3GHUA 4TIMA 4RKAA 3SFWA 1W1B1 3IJQA 3QHNA 4C6MA 1YDVA 3IGUA 1XLEA 2DSKA 3LM7A 1XLHA 2P3EA 4NY2A 5IOBA 1ICQA 3GBDA 2G95A 1JXJA 2EPOA 3DU0A <