1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
1JCLA 1GYLA 3R89A 3W1XA 3N14A 1KFLA 3GAYA 2AGKA 1OABA 4NZFA 3QM3A 4FXSA 1ZFJA 2Y63A 3BG9A 4ALDA 2ZZ6A 1DORA 3LHVA 3PS7A 3CIWA 4UC5A 2J9YA 5FEWA 3P81A 4O50A 2X30A 4S2CA 1I2NA 4UTWC 3VFLA 3FJ6A 1AW1A 3UWQA 5CPMA 1H60A 3PUDA 1LM1A 1L6WA 3LRLA 1L6YA 3D0CA 1I2QA 3LI0A 1K02A 3MJYA 3C4UA 3LHZA 4IJBA 2Y7EA 7TIMA 3CIXA 3NYZA 3KXQA 5LHEA 1DQWA 1O94A 3S6DA 1SW7A 5KINA 3BW3A 3RK8A 4X22A 3I7QA 2EF9A 4BFAA 1VLIA 2NWRA 4ZQMA 5EL1A 1UUOA 4FHAA 3NZRA 1J4EA 3KAOA 4N9BA 3F4WA 2QDHA 3VNDA 4LU0A 4DF1A 1PV8A 4AAJA 3PWAA 2ZRWA 1W5MA 2QJGA 1YPIA 4Q4KA 1KBIA 5G2IA 3G1VA 3L21A 4BWLA 4X9SA 4R34A 5D05A 4AB4A 2I14A 1VR6A 3B4UA 3SIZA 4A29A 3FOKA 1XDMA 5AHEA 3G3MA 3P82A 5HUPA 3C2RA 1LBFA 2YFNA 1S5VA 2FPYA 2GOUA 3S1VA 2FTPA 5CGQA 4U28A 1TJRA 4RCXA 3S8HA 3NA8A 4YCOA 3EX3A 4WXYA 3TMLA 3G1AA 3ABQA 3C61A 4UTKA 4OU1A 4FX7A 4UFIA 4ZQCA 1W3NA 2ZA3A 4M6VA 5KTLA 1KTNA 1F76A 4FNSA 5LNVA 5FF2A 3A23A 1QOQA 3W74A 4JTSA 2ZZ2A 2VOMA 2YGYA 2ZZ4A 2RFGA 3KRSA 3UYCA 5GVJA 2A7NA 1ZENA 4DXVA 3GX9A 1TTQA 3HF3A 3PVFA 3U6WA 3W1NA 3W1TA 4QJ1A 3CM4A 5DLCA 1OX5A 2YCEA 4WOQA 3W3OA 2G97A 1K8YA 1XM3A 4RXGA 1AK5A 5A8GA 4RJEA 2B7NA 1I2RA 3IVSA 3HIJA 4DBDA 1KW1A 3W87A 4QQ3A 2G96A 5I3IA 2Z6JA 5CPLA 1QO2A 1VGAA 4C1KA 2WPBA 3LXCA 1VZWA 1TIMA 4MUZA 1RV8A 3UWYA 1MEIA 3NM1A 3GXTA 1KFJA 1XI3A 1CW2A 2VFFA 4XBKA 1VYSX 3NQVA 3SY5A 1ICSA 4BR1A 2QUUA 3QJAA 4MZ8A 3FA5A 1GYNA 1HFBA 2EHHA 5D37A 4AHPA 1I2OA 2VEPA 5HNRA 1PHWA 2B0MA 1OX6A 1TB3A 4NZJA 1LOSA 1MXSA 1EP3A 2NUYA 1SPQA 3R12A 2X1RA 2Q3OA 2ZBTA 3IEBA 1VS1A 3SFKA 4N4QA 1FDYA 1GVSA 5U4NA 2X2GA 1S5WA 1JRBA 4WJEA 4FEZA 1O60A 3UD6A 1O4UA 3HG2A 3QQ1A 2J9ZA 5LZLA 1LRTA 2ZQ0A 2BX7A 3Q37A 4DEFA 4E2BA 3OIXA 1Z44A 3DBPA 2DZSA 1J2WA 2ZZ7A 3N3MA 5BMXA 1SUXA 2QCDB 1DKWA 1Z48A 1QNVA 3LHYA 4POCA 2NX3A 3A22A 1RQEA 3W7GA 4MZ1A 1ICQA 2OMAA 3CU2A 5F1VA 5IBXA 1OYCA 1W54A 3W23A 3F03K 2ZYFA 5F1UA 1GWJA 1TQXA 3CEPA 3KRZA 5LNUA 4QSHA 1KLYA 1XUUA 2ZTJA 1QOPA 3C6CA 4LVBA 4IXXA 3B05A 5LNSA 1X1ZA 4LVAA 3LCGA 4HPXA 1LOQA 3P8IA 2BZNA 3NG3A 3N19B 3W75A 3W7LA 4IGHA 1FY6A 4HSOA 3STGA 1FWSA 3HOJA 3RF9A 4OBTA 2JBMA 2DJXA 5I3JA 3DAQA 5K4ZA 4LY8A 3TA6A 4LV4A 4JN6A 3MHFA 3TQ0A 2ZFAA 3LRMA 5AN7A 1A50A 2YZRA 1SU5A 4RR4A 1O5XA 1EP2A 4FO4A 2A6LA 4UFMA 5BOOA 1Z41A 2ZRXA 2TSYA 4M6PA 3ZFHA 4LC8A 4MY8A 1G7VA 2NUWA 4GUGA 2EGZA 5IBXC 4JTGA 3T7VA 5K9XA 3Q2DA 2CU0A 1EWDA 3DKJA 4O19A 4JTHA 2WKJA 3HGJA 3SGZA 3UZJA 4IOTA 5FF7A 5F2GA 3UPWA 1OFPA 1KTBA 5CSRA 2GQ9A 4K37A 5CZTA 3M5YA 3WK2A 5J5DA 3BLFA 1T96A 4IMCA 1Z42A 1UASA 3NZ1A 5C5YA 3O1NA 1G4PA 5H2ZA 1G6CA 4IWWA 4XQ6A 4PFMA 4FF7A 1MEHA 3DU0A 3M7WA 3MBFA 1SO3A 1W5QA 4O53A 5FI8A 4HN4A 5AC8A 2DZWA 2O7SA 2QCHA 1PL9A 2Y70A 4O57A 4R53A 3L68A 1YXDA 3N73A 3QSRA 4JR5A 3NQ7A 4EIVA 4FX6M 1G7UA 3NNTA 4C1LA 3LM7A 1XKYA 1FWRA 2XN1A 5TBOA 3IRDA 4OV9A 3PF3A 3GNDA 5G2HA 4UFKA 4U4MA 4AH7A 2JKEA 5EMUA 1VQTA 5I3FA 5EBUA 4A3UA 4WZHA 4OT7A 4PH6A 1DOSA 3EWBX 1BKSA 1L6SA 4LVDA 3QQ0A 3G18A 3W2NA 4IMFA 1KM1A 4Q33A 2VFHA 3RMJA 1DVJA 4YWIA 3BG5A 4IX2A 2LLEA 3W7JA 5CKSA 4MJMA 4JTEA 3S5OA 3UXDA 1F05A 3QPZA 4CNPA 4FNQA 3LHUA 3P80A 4JTFA 4LS0A 1K3UA 5D2XA 1DL3A 3B0UX 4JEQA 1IXQA 1WOAA 1I8JA 4XTIA 1TRIA 5KZDA 3HG3A 4LWWA 3FYPA 3NL6A 3VKJA 4MVAA 4QISA 1YDOA 3TIMA 3LCLA 3CWNA 3IGXA 5C55A 3C52A 1H1YA 1TPUA 5D09A 3DFNA 2E77A 4KFOA 3JS3A 1A5CA 1C8VA 1B57A 1LDCA 5L6UA 3QRHA 3W70A 4ORMA 1M7OA 5AC7A 1M5WA 3TV8A 2A7PA 4WD0A 3LERA 3FJLA 3M44A 1YDNA 4QNWA 3THAA 4CCDA 3GK0A 1UB3A 3A21A 3LV6A 1AMKA 1DQXA 2B4GA 2NUXA 3TW7A 1RZMA 4XBSA 3NL3A 2Y61A 3DZ1A 5KITA 5LNRA 3E49A 3EX1A 1X6UA 1PVNA 4GE8A 1F7BA 5C2XA 4AVFA 3W2LA 3GR8A 3M43A 2RDUA 3K30A 4DO5A 4ZZ9A 1FXPA 1DHPA 1YXCA 3W1QA 1M6JA 2A6NA 4AHOA 4M6QA 1NSJA 1H61A 3SZ8A 1GTHA 4LS1A 3B8DA 5AYZA 4ONVA 3WK3A 1SSDA 3W86A 4Y9AA 4UTTC 1KLZA 3U8GA 2BLEA 4QM1A 1LYXA 5D30A 1F73A 2Y7DA 3QC3A 1TREA 3QSTA 5SWUA 4GNJA 2ISVA 1VHCA 3Q58A 4P61A 2CZDA 4JTJA 3G1XA 3TH6A 4XUGA 3L5AA 3EWUA 3SGUA 1TJPA 1JULA 4AHQA 4Y90A 5HWNA 3L67A 1H5YA 3BW4A 5D38A 1B4EA 1KFKA 3S0CA 3NL2A 2QR6A 2RH9A 1TTIA 1ZAJA 2GVJA 1V5XA 2Y7FA 3TUUA 1GEQA 1A5SA 1I2PA 1TPFA 4E0CA 2FPVA 3PSVA 4UR8A 4LUJA 2PURA 1KV5A 1SZNA 2WNQA 4OWGA 3LBCA 2VC6A 3V1PA 3THQA 4LUIA 4A2RA 3W88A 1EEPA 4MKNA 1O95A 3BO9A 3FKRA 3T4CA 5F2LA 1JJKA 4NJJA 4JGDA 1FWWA 3TFXA 2E6AA 4I7WA 2DZUA 5G2WA 1ONRA 4MZYA 3DFPA 2A4AA 3ZWSA 4KKXA 1VYPX 4LW7A 4YL2A 4EOUA 2QCDA 2YX0A 4UTLA 1ZCOA 2O7QA 2B7OA 3G0SA 3M5XA 1S5TA 3W7PA 2A1YA 3B06A 3CC1A 3ATYA 2WQPA 4JX5A 5CZSA 3NQGA 3GB6A 4UTIA 2QAFA 4CCEA 4K39A 1ADOA 3RLUA 4N6EA 5HINA 4O12A 3BV4A 5DXYA 5K9DA 1GJPA 1ZAHA 3G0XA 2NV2A 2HS6A 1FBAA 4JTIA 4MY1A 2X1UA 1R2RA 1FDZA 1OFBA 1TSIA 3W7MA 2NX1A 1TPDA 4FB7A 3NO5A 3QMRA 3YPIA 3LXAA 3LLDA 2P0OA 5EA9A 1PHQA 3NPXA 1YPFA 3EX4A 2ZRVA 2AAMA 3TSDA 3TXVA 1G4SA 4LVGA 3IVTA 3L0GA 3O15A 2Z1BA 3E0IA 3MW7A 5HULA 3P7YA 2BWGA 2HS8A 1M7PA 4FXRA 1DJNA 4LTSA 1ME9A 1PCKA 1XFBA 5G1TA 4PCFA 3ANYA 1IXNA 1RVGA 2OZ0A 1A5BA 3VE9A 4DELA 1TPC1 3WJWA 2ZTKA 1XL9A 2QEZA 1WV2A 3CHVA 4ZQNA 1WAUA 3L0NA 3L0KA 4IPIA 4N6FA 4QNEA 4W9TA 4QAIA 3DFOA 1F2JA 4WQ6A 2VFDA 3MO7A 2NXIA 4BI5A 2ZRYA 4FIQA 1YLVA 4HHPA 2QF7A 3GDRA 1OFDA 4ZL1A 1ZJIA 3G1HA 3MWAA 1W5OA 3MYOA 4HNTA 1LBLA 2C3ZA 2NXHA 1SO6A 3TC7A 1KV8A 3S1WA 5AHFA 5K9CA 3W2UA 1W0MA 4NVTA 1QDSA 1FX6A 4K7VA 4JX4A 1YDVA 3CLMA 3ZR4A 5BRBA 3Q94A 1GPWA 4MLRA 5KMYA 3FFSA 3IVUA 1NF0A 3TCEA 3NQ6A 2QCNA 1P1XA 3PG9A 3HMJG 1IF2A 4UNLA 4YMZA 2NXGA 4O1BA 1ZHAA 1G4EA 3KVLA 3M5VA 1TPWA 2D73A 4N2YA 4O13A 4BWLC 1RQBA 4O17A 5KZMA 4R7JA 2ATMA 1QFEA 3DFTA 1ZALA 1XC4A 1KM3A 3C56A 2VFIA 3SI9A 1OX4A 1QO5A 1SW3A 3BLEA 4O4VA 3GZ3A 2B7QA 3GKFA 2Y62A 5HQEA 4JS3A 3PBWA 2ZZ3A 4GUHA 3G22A 4YXGA 3QW3A 1GVRA 4O14A 2PRLA 1VYRA 4Y8FA 5AHIA 1PIIA 1P0NA 3ELFA 2QCEA 3LXBA 3LGEA 5DY3A 4GRSA 5E0KA 1EPXA 1TV8A 1AW5A 2HTMA 1T8XA 4O0KA 1TCDA 4DPPA 3NQ8A 2TMDA 2ABBA 1OHLA 5KSWA 1GVOA 3L5MA 3ABRA 3W72A 1CX9A 2A5HA 3W7HA 3NQAA 3CEUA 4J9JA 1DBTA 3BW2A 3GDLA 3LCWA 3NPUA 4K8EA 2BTMA 3W7KA 4NNBA 2ZCGA 3O63A 3P67A 4UCGA 3V75A 3WJXA 2DORA 3PR2A 4NXSA 5G4EA 3LBMA 3MI3A 1R47A 3O6DA 3I65A 3DFQA 3UWUA 3NQDA 1F74A 1VPXA 1OYAA 4JIPA 4N9CA 1R46A 2J27A 3CPRA 1Q6QA 2WOQA 5CPNA 4OE7A 4LS2A 1XBVA 3EWZA 3L9CA 3W1AA 3PUEA 2C19A 1QPRA 2W6RA 1TYGA 3DENA 4K38A 2V2CA 2E09A 3S1UA 1AL8A 3CQ0A 1TV5A 4UR7A 4NNCA 4PTNA 1B9BA 2ALDA 4O15A 1KM2A 3IIVA 4XKYA 2A7RA 2GPTA 5DCEA 2FQIA 2C0AA 1B3OA 3UPBA 5FEXA 1PCWA 1KA9F 3P84A 6TIMA 4ML9A 3GVGA 5T26A 2V30A 2IQTA 4WX2A 3QFEA 1UUMA 5G4WA 1H50A 3RNDA 3W2KA 4N9DA 1FCQA 3GDMA 3HGOA 3MP5A 3MI2A 4NX0A 1HO4A 4TU1A 4IMEA 2R91A 3ATZA 1LTDA 4Z08A 2PC4A 4G1KA 3O6CA 3G1DA 3W71A 1NAL1 2F7FA 4AEOA 4ORIA 4CQAA 3W7IA 5DBTA 2BSLA 2J9XA 3N9SA 2NWSA 4O0ZA 2UV8G 4GUIA 5CSSA 2V5BA 3BGJA 4ZQPA 5MHBA 5LKYA 2C1HA 3W7OA 5D2TA 4AWUA 1ALDA 5DXXA 3PUOA 3KVMA 1LBMA 4LV9A 3WFAA 3MP4A 5AB3A 2C18A 3BGGA 3B04A 4Z1CA 1XXXA 4Q32A 3S9YA 1LRQA 3LV5A 4MOZA 2V81A 2DP3A 1Q3NA 3G8RA 5BMWA 4UFLA 4NT0A 1A53A 3W76A 4RV8A 4TMCA 3EXSA 2DZTA 3INPA 1H51A 5AYXA 4I9AA 1X1OA 2WSQA 1TMHA 4MIMA 5FEPA 3PB2A 2Y89A 5KZEA 5A5WA 2VENA 2ATSA 2A0NA 3MYPA 1OFAA 5LGZA 4A22A 1ME7A 2OT0A 3N2MA 3B0VC 4IMGA 2PE4A 4Z1BA 4ZMGA 1QR7A 3BPWA 2C14A 5LGXA 4AWTA 3IGSA 3EWXA 4A2SA 1YTKA 3DFSA 4LRSA 4MFEA 3IV3A 1UBSA 4WOZA 1K7EA 1MEWA 3M0ZA 1XCFA 1OX4B 3N2XA 4HNVA 1WOBA 3UNDA 4O16A 1BEUA 3QZEA 3FKKA 3TSBA 4DF2A 5K3VA 2GQ8A 1FUYA 2W79A 4OV4A 3T44A 2QJIA 3E02A 5I3HA 3HG5A 1ZNNA 1TV7A 1EA0A 1H63A 3S1XA 1LROA 3OVPA 4P2VA 2C13A 3KVKA 1S3HA 2GUUA 1P4CA 4ADSA 2RDTA 2CFFA 1JUKA 1VRDA 5AHNA 1R2TA 4PODA 3EB2A 2E6FA 2XN0A 3HBLA 4JD4A 2Y7GA 1UCWA 4MPQA 3SR7A 1J5TA 1VCVA 2QKFA 4HNNA 3A5VA 4BK9A 3PULA 1FQ0A 2V2HA 3LHWA 4GXMA 2H3BA 5U7SA 1ML1A 4AF0A 2VEIA 3IIXA 2C15A 2GQAA 5AOUA 5F4WA 1NVMA 1T0OA 1TTPA 3P5ZA 3W7QA 5IM51 3M6YA 1G67A 1EWEA 1VHNA 2V82A 3RU6A 5HUOA 4GUJA 4JYDA 3EXTA 3UQNA 1W56A 2BXVA 3VI2A 1AW2A 2QAPA 1QMLA 2WSYA 2F84A 4M5PA 3TQKA 3GXNA 3TNOA 4NNAA 3MHGA 5F2IA 3MBDA 3P62A 1QPQA 4FNPA 4IPJA 3SW6A 2YSWA 3LI1A 2EAWA 4HPJA 5CPOA 1IIGA 3NVTA 3GR7A 2V0TA 2E5DA 2C6QA 4M7SA 4CNOA 1FWTA 2CW6A 4UTMA 2ABAA 2WJZA 2ZA2A 3U2OA 1JRCA 4XKYB 1XBYA 2CLHA 3LTSA 5D02A 3NAVA 2DZPA 3DHFA 1OJXA 3MMTA 4O1AA 4MJZA 4FNRA 2WNZA 3PBVA 2GVLA 4PL2A 5ABTA 1LP6A 4WY0B 2CLOA 1HTIA 2CLKA 5AHMA 4WY0F 4JX6A 4NJIA 5AHLA 2R14A 4HT3A 4OHQA 2Y6ZA 4JYEA 1IXPA 3S5NA 2R8WA 2E1DA 3STFA 2YPIA 3R5EA 1T99A 3NQ2A 3TROA 3GDKA 3USBA 1QWGA 1Q6LA 3STEA 1W37A 2CWNA 3FS2A 3QF0A 4DO6A 2YW4A 3TJLA 4OQVA 2WO5A 4FIRA 4QITA 4GUFA 4O10A 3C2OA 1EX5A 2NX9A 2QCGA 2P1FA 3LTPA 3NOEA 3DGRA 1KM0A 3TJXA 1JCYA 1G4TA 1IGSA 3LRKA 3W2MA 3NDOA 4N02A 3C2FA 3SSJA 1OFOA 2V8ZA 2FLIA 3G1SA 3ABOA 1KFBA 1TO3A 2VELA 4JXCA 1MSSA 4DO4A 3W84A 5HR7A 3HPSA 4WUIA 1LZOA 4IX0A 1NF7A 4MFDA 2ZDRA 3G8EA 4UTWA 1L2UA 2KZHA 3E96A 3QPYA 4S2BA 3W85A 3A5FA 2XFWA 3TU9A 2PRHA 3MI6A 2G95A 3LDVA 3TX9A 4KWWA 3R2GA 4LOCA 2YW3A 3GKAA 3H54A 1SZEA 2Y85A 1EUNA 1W3TA 3N34A 1BWLA 2ZZ1A 3WK0A 4CQ8A 2CZFA 3NPWA 4RZ4A 1N8FA 1F6PA 4BF9A 3HGRA 3OVRA 2CLLA 3G3DA 2I9EA 4K6AA 4Z0SA 4FNUA 1A5AA 1H7WA 1JUBA 1X8FA 3A9IA 4O4WA 2E6DA 2PRMA 4TR9A 4ZQOA 2GVGA 2X16A 2ISWA 4MYXA 5HWMA 5D32A 1C9DA 3UZ5A 3WJYA 1K8XA 2JGYA 2E68A 3O6YX 3TC6A 4UTJA 5D2VA 3L65A 3P74A 4O52A 3W1UA 3BG3A 2RDWA 4JY8A 4H3DA 1RR2A 5FF4A 3UY8A 2AQWA 1JCNA 2A2IA 8TIMA 3RFAA 2QCLA 3UXAA 4JDBA 1K8ZA 3QEZA 3EX2A 5E1QA 4UFJA 4PL1A 4JYFA 5AC6A 1OFQA 3LB0A 3QYQA 1GZGA 4AF0B 4Z0JA 3IIZA 2Y88A 3HB9A 1JCXA 3F4NA 4DBEA 3TW6A 4UXDA 3W22A 1IXOA 4Y96A 1X7FA 2ZRZA 2CLEA 3NEVA 1PE1A 4JTTA 3BARA 4CLMA 1D9EA 1SZFA 1OF8A 4IQLA 4O11A 4XTDA 3ZWTA 3E9AA 3KFTA 4UNKA 3VCRA 1SFLA 5BW6A 1WBJA 1EUAA 3FLUA 3M41A 1U83A 3GIYA 3LLFA 1OG0A 1LLWA 1WA3A 4NU7A 4YLWA 2A85A 3PSWA 3NM3A 3IIOA 5F2MA 4EWND 1VH7A 1FWNA 3PBUA 4CNNA 4DQWA 1SW0A 3W2JA 1FDJA 4JNMA 4O1CA 3DHDA 4JDYA 1W31A 1KM6A 3W7CA 4ADUA 1NFBA 1OYBA 1RPXA 1EB3A 3NPVA 1LORA 2XN2A 4RZ6A 3UWZA 1FCBA 2Q3RA 4D2JA 1TPB1 3TFCA 3R8RA 3OG3A 1L9WA 5I3KA 3BVJA 3I6RA 3HJZA 1YTDA 2OJPA 1I4NA 4RX0A 2E5CA 2E5BA 3EKLA 2H3DA 1ME8A 4O8RA 3EEGA 3OA3A 3CB8A 3HPZA 2JGQA 1Q6RA 2CLFA 2VEMA 3TXZA 2CZEA 3L2IA 3C2EA 4EF9A 3S5ZA 4K7YA 2G5WA 1F6KA 3S42A 3LHTA 1W1ZA 1QPOA 3I68A 4BI6A 1K03A 3NQCA 3W1PA 3A24A 3G1FA 4NUWA 2RHGA 4UTHA 1JCMP 1YYAA 3GDTA 1TPEA 5EYWA 1SSGA 2DU2A 2HSAA 3RLVA 3LCHA 1H62A 5TIMA 4GFSA 4ADTA 3L5LA 5DBUA 2QCMA 1JR1A 2ZRUA 5DELA 3NQEA 4KFPA 1H1ZA 1HUVA 4FX8A 3W7RA 2GJNA 1KTCA 3T55A 4ZQRA 3UWVA 3TAOA 1WYIA 1LCOA 3IIPA 5DN1A 1Y0EA 4MYAA 3C8FA 3TKFA 3R13A 4GBUA 2WSRA 1MZHA 2NLIA 4JTKA 4CQ9A 2A21A 3H53A 3TR2A 4LC6A 3SJ3A 4Z1DA 3W1LA 2FDSA 1N7KA 4N4PA 4ZVJA 1EP1A 3WK1A 3C2VA 1LRNA 4O18A 4UUIA 4H4IA 2YYUA 5K7JA 2OX1A 3KVJA 5BNKA 1AL7A 3B0PA 3DI0A 4Y6GA 3FIGA 1SO5A 3PM6A 1NEYA 4DPQA 2W0UA 4IUOA 4HNUA 1HL2A 1TQJA 5CZ0A 5DCDA 5HJLA 2DZVA 4LVFA 3HQ1A 3KOFA 4RLIA 3LX9A 4WY0A 3GYEA 4IXHA 4M19A 2E6YA 3QMTA 3W7EA 2J6XA 3CTLA 5F4SA 2FIQA 5AYYA 1GVQA 1F5ZA 1WQ5A 3WJSA 3O8AA 1RD5A 4NX5A 4XZ9A 5TQLA 3NL5A 2HMCA 1YADA 3KHJA 2H6RA 1QAPA 5CG7A 1JUEA 3F1QA 1SO4A 3TMQA 2RKXA 4GWEA 4UIOA 1BWKA 5D2YA 5D2WA 3OVQA 3LOTA 2YDAA 6ALDA 1ZAIA 4H6KA 1AG1O 4UFHA 5HR6A 4JTLA 2Z2UA 3P8JA 4MLJA 1U5JA 1W3IA 2TYSA 3DI1A 3QMSA 5I3GA 4L4LA 1GT8A 1TPH1 2FB3A 2B7PA 2GJLA 1JCJA 1W5NA 2VKZG 1Q45A 1KFCA 4AWSA 3CWOX 1QPNA 4I7UA 3P5YA 2Z6IA 3O07A 3SECA 4ICNA 1O5KA 3VE7A 2I1OA 2EPHA 3M9YA 3JR2A 3LTYA 4E2DA 3NQMA 3W1MA 3MUXA 1H7PA 3HPXA 1SQ7A 1H7OA 4FNTA 1WBHA 3G24A 3N9RA 5LSMA 3QH2A 3TK7A 4DF0A 2ZZ5A 2NV1A 4TMBA 1YTEA 2FPTA 4X2RA 3O16A 3PBYA 1OK4A 1I45A 1VJIA 2H90A 4LT9A 4UMBA 3LCFA 4JTUA 3I7SA 2FJKA 2QUVA 1VCFA 2J88A 3BLIA 4GJ1A 4HKPA 5EPDA 1MO0A 4PEKA 1FCUA 2V9DA 1HO1A 3BK0A 3E12A 2FFCA 1GOXA 4AXKA 1R2SA 4UMAA 1DJQA 1SR9A 2JKAA 4JY9A 5H91A 4EF8A 4S1FA 3UY7A 3AO0A 4TO8A 1GTEA 4B5NA 4NXKA 3HGSA 5EY5A 3IGUA 3LCXA 4NJKA 3DH7A 3W7NA 1OF6A 5HWJA 1KFEA 4PA8A 3M5ZA 3TQVA 2J24A 2NZLA 3QW4B 2ZA1A 5LHFA 1P5BA 1XBZA 3EKZA 1XBXA 3GXPA 1ZY9A 3ABSA 3EWWA 1RQHA 3W7DA 4LRTA 2VFEA 3GNNA 1ICPA 2QCFA 5D03A 3I7RA 4RXFA 4IMDA 4WXZA 1K7FA 5L9FA 3OBKA 4TIMA 3GAKA 4JICA 3TSMA 2X1TA 2ISSA 1OK6A 3DKLA 3M47A 4RKAA 4Z1AA 1W5PA 3W6YA 3UWWA 1CI1A 2YR1A 3MHUA 3OHIA 2VEKA 4TX9A 4UTTA 4XWUA 1P0KA 3TE9A 4I7VA 3PAJA 3HG4A 3M1ZA 2QCCA 1IIHA 3KX6A 2OCZA 4O1DA 1UJPA 3PB0A 1SFJA 1VC4A 3NGJA 3DXIA 2JKPA 4UMCA 1JQVA 3O05A 5E93A 1V7YA 5DY2A 5DCBA 4AMAA 5F4XA 2YYTA 3STCA 4RZ5A 1FCVA 2YFOA 4K8HA 3TAKA 3G1YA 1G69A 1OFEA 1LLZA 5AFDA 1WDWA 2QJHA 2P10A 3O06A 3NXFA 4KWVA 3LCIA 1D3GA 2QUTA 5C6MA 2WNNA 2X1SA 5G1YA 3EXRA 2FB2A 1E51A 1XDLA 1GG0A 1KM5A 3FEMA 4JIQA 1H7RA 1WXJA 3CT7A 1TPVA 2R94A 2CLIA 4UTUA 1KBJA 3GLCA 4YCPA 3C0JA 1R30A 2DJLA 3EX6A 2EKCA 3PC0A 4A21A 3W73A 5LNWA 2TRSA 2VXNA 4NQ1A 1THFD 4O54A 2WV8A 3OEXA 4LNYA 3AJXA 3PG8A 5FF0A 4MY9A 1H7XA 1VLWA 4K36A 4R33A 3W9ZA 3T40A 4QIUA 2QDGA 5D04C 3M16A 5D33A 2Z0IA 1PS9A 5J5RA 1JVNA 4HSNA 3L66A 3TDFA 1BTMA 4PC8A 4E38A 1XUZA 1H7NA 2VFGA 4EVZA 5FEZA 2TPSA 4L4MA 3MP3A 4GC4A 5C54A 2V5LA 5FESA 1EIXA 1DV7A 4O28A 3S5YA 2H8ZA 3FYOA 5HMSA 3H55A 2JK2A 5EKYA 4RK8A 3T78A 4OGZA 1KM4A 4NJHA 5K2ZA 1LOLA 5K4XA 1OFRA 5FF3A 3ZS4A 2CLMA 1WX0A 5G5IA 1GVFA 2Q8ZA 1TTJA 2C16A 1D3HA 1VCGA 1GQNA 2DZXA 1GG1A 2Q8LA 3W83A 1QCWA 4M7TA 1W8SA 3JRKA 3C3NA 2YXGA 3EWYA 2V2DA 1SZGA 1OVDA 4CCCA 3B03A 2PCQA 3W07A 1FXQA 3WJZA 3KRUA 1YXYA 3NR0A 4BI7A 1Q6OA 3G0UA 3W1RA 1C29A 1HG3A 4KFNA 4HIBA 3NQFA 2OT1A 3HO8A 2H8XA 2CZ5A 1K7XA 1B4KA 5CZJA 1N55A 4N9EA 3P61A 4X3ZA 4NJGA 1JQXA 1TRDA 3P60A 3PY2A
chains in the Genus database with same CATH superfamily
1JCLA 1KFLA 4LAKA 1OABA 2ZOXA 2YL9A 2Y63A 1W91A 4FALA 4S23A 5FEWA 3UPMA 1V6TA 1CIUA 2HXUA 3W38A 1NOUA 2PDNA 4O50A 2HNEA 1M9HA 3TWAA 3VFLA 1ZSXA 3IUDA 1H60A 1M03A 1E0TA 1L6YA 3WCZA 4HZ8A 4GVHA 1OC6A 4PMYA 4GGBA 1OIMA 1S5MA 1NQ6A 3SUUA 1SW7A 3I7QA 1P1MA 2EF9A 2YB1A 3MSRA 4BFAA 1VLIA 2YDQA 2NWRA 3WLJA 5EL1A 4OKDA 4ZB2A 4N9BA 2CNCA 4RW5A 4CU7A 4DF1A 3R25A 3ZJ8A 3T1GA 2TAAA 4RPPA 3VUSA 2W63A 2QJGA 2BS9A 1KBIA 2J13A 3G1VA 3L21A 4BWLA 7TAAA 1BYDA 2PBGA 5D05A 1DWHM 4IHCA 5H8PA 1HZYA 2CITA 3P3BA 3LNMA 4MB4A 4EWJA 2GOUA 2PTZA 2FFIA 1FHDA 2FTPA 1DWIM 1TJRA 3APGA 3BSGA 3NA8A 2NLYA 3EX3A 3G1AA 2WLYA 4KESA 4C6MA 4FX7A 2YCIX 1PUDA 4HCDA 1W3NA 2ZA3A 4H9MA 5KTLA 3E3HA 2FHFA 5FF2A 1UOZA 4J2MA 3DUGA 1V3HA 3EDDA 4H9ZA 3UYCA 2A7NA 3FYYA 3GX9A 3PVFA 1BYBA 1C92A 2OO6A 4QXIA 3BTNA 3WFLA 4DAIA 2G97A 1XM3A 4GVFA 3A4WA 4RXGA 3LMYA 1XLDA 1I2RA 1XSIA 3IVSA 4JHOA 1KW1A 3OZOA 4QQ3A 4BQ5A 3GD6A 4WEVX 1VGAA 1XIMA 3SURA 3WD2A 3QZ6A 1OSEA 3AYVA 3MSYA 4PTWA 3WH6A 2WKGA 1NIUA 3C86A 1YMYA 1XI3A 1CW2A 2OVLA 4XBKA 4Z1YA 1T40A 4BR1A 4M51A 1GYNA 3WH7A 1V77A 3AJ7A 4DJFC 5HNRA 1PHWA 4PTXA 4LUSA 5HDRA 3TN5A 4JL1A 1LOSA 1EP3A 2NUYA 4CD7A 1HJQA 6XIAA 2X1RA 2Q3OA 2ZBTA 3IEBA 3VIMA 4N4QA 1QVBA 1GVSA 1UH4A 5U4NA 4TTUA 4H7CA 5M2FX 1JRBA 4QCEA 1FWCC 2ZWYA 3VNIA 2ZQ0A 2BX7A 3HU7A 4GIAA 4E2BA 3OIXA 3VKDA 5C9ZA 2Y5SA 3N3MA 5BMXA 2XSBA 1QNQA 1W1YA 3GC5A 6TAAA 1E1CA 3W0KA 3K13A 1JDEA 2O9PA 2WMHA 7REQB 3SRKA 1ICQA 1IGWA 2YBTA 3GDBA 2OMAA 3CU2A 1W54A 3GVVA 2V5DA 1QI3A 1XISA 3BSMA 3EEZA 1ZPTA 3H2CA 4GY0A 2PMQA 3H2OA 4WSHA 5LNSA 1X1ZA 3PP7A 2BZNA 3W75A 3W7LA 4IGHA 4HSOA 4ZOCA 1RSCA 1UZ1A 3RF9A 4BF7A 1YPXA 5I3JA 1J5SA 4LY8A 3N4FA 4H83A 1E4NA 3TQ0A 2WZTA 4YS1A 4PFHA 3LRMA 3NJ3A 2PEVA 3RX2A 1S2VA 4RR4A 4NG3A 1D8WA 2TSYA 5I5RA 3VGDA 4M80A 4AY8A 3J7HA 4MY8A 1JG9A 3UZZA 3BCJA 1AJZA 3T7VA 3Q2DA 3EMZA 1B54A 1EWDA 1PX8A 5AC5A 3HGJA 2OKTA 3UZJA 2WHMA 5FF7A 1UWIA 3TTEA 2VO5A 5CSRA 3M5YA 3WK2A 3CHDA 2YOCA 3VZYA 4JBRA 4JQ4A 5CPQA 4KRZA 1UMLA 1RP9A 4F0HA 4Q4SA 4MNKA 3IPWA 2YA0A 5M3WA 3DU0A 3M7WA 4GI9A 4O53A 3DN5A 4HN4A 3VDAA 4O57A 3L68A 4FS9A 1IE7C 2R1PA 3KHDA 3AU6A 2J6VA 5TBOA 5GNXA 4MWAA 1DE6A 1AQFA 1QW9A 5LXEA 2BBFA 3DFYA 4U4MA 4Z2JA 1XWYA 2WSPA 4WZHA 4WKHA 4OT7A 1GEHA 3EWBX 5BOFA 1BKSA 5H8MA 3TYCA 4RDWA 3QQ0A 3H24A 1XPGA 2VFHA 2GGIA 4U5KA 4YWIA 3BG5A 5CKSA 4MJMA 4JTEA 1RJRA 2PTYA 4FNQA 3VM7A 4TX6A 3M0VA 4NAFB 4LS0A 3BV7A 2DZBA 3B0UX 1K70A 4JEQA 2VC5A 2PP0A 1J01A 3CAQA 1JF6A 2CLPA 1E4IA 3HG3A 4XK2A 8CGTA 4XZLX 3CWNA 2XVPA 4F3HA 3GH4A 1JPHA 2DT2A 4U5IA 1BAGA 3MSGA 4QR6A 1B57A 4Z2GA 3BL3A 2O55A 1LDCA 3QRHA 3OTRA 4HSHA 4ORMA 2C7FA 5AC7A 2HROA 1Q63A 3FJLA 4Q22A 4S3FA 3KDNA 2VI0A 1UB3A 1AMKA 1RZMA 4XBSA 3NL3A 4DNHA 2Y61A 5KITA 3KBSA 4ZFCA 5LNRA 4BS0A 1F7BA 5C2XA 4ZO7A 4E5TA 4WRHA 3STPA 3M43A 4ZZ9A 1RBLA 1FXPA 1D7KA 3W1QA 1P48A 1WPCA 4L65A 4M6QA 3AUJA 3UW6A 2C1GA 2Q09A 1QHOA 1KGUA 3P0WA 5AYZA 2A3HA 4HZMA 4IJCA 4GYJA 2OSYA 1QHZA 1XQLA 3WMLA 4XUGA 3L5AA 4H04A 4ZBCA 3VGHA 1RD6A 3B4YA 3L67A 1NWSA 5D38A 1B4EA 3RLGA 4JFWA 2VTFA 5M5DA 4GZIA 4LF1A 1TTIA 3B8IA 3OLIA 3ZT6A 2G50A 4WHBA 2FPVA 4UR8A 4B9YA 4CQCA 1J6PA 1UR8A 3UJ2A 3UR5A 2G3NA 3KOXA 3RM9A 2QULA 2WNQA 3LBCA 3MB9A 3W88A 1EEPA 1O95A 1B0IA 3SCUA 1J0IA 2DUXA 5F2LA 3M4HA 1VBHA 1FWWA 2Z29A 1CXHA 5I6SA 3VOGA 3RMEA 5G2WA 4BJHA 1JDDA 2A4AA 4KKXA 3TN4A 3DEQA 5IDZA 5C7VA 5BWFA 2YX0A 4UTLA 3ECQA 2O7QA 1DWFM 2B7OA 4H7VA 3W7PA 4DY1A 2A1YA 3ATYA 3M0IA 4RV3A 5CZSA 1R3YA 2QAFA 1R3TA 4KEUA 5HINA 4O12A 3PK7A 1HT6A 5K9DA 1ZAHA 3G0XA 1VRXA 4NSBA 1Q66A 3ARVA 1OFBA 1TSIA 2EG7A 1TPDA 4FB7A 4C6LA 2ACSA 2P0OA 2ZWZA 3SRHA 1PHQA 1HKIA 2BB0A 5JBDA 5CZKA 3TXVA 4QLJA 3IVTA 1RY8A 5HULA 5I02A 2HS8A 2BY3A 4CVWA 2DSVA 4WSKA 3WQ4A 4ACZB 5G1TA 2PD5A 1PTDA 3CMGA 5CBBA 4E4FA 1WKEA 2ZTKA 3RRXA 1YBQB 3O3RA 2NVDA 4QNEA 3L0KA 4IPIA 1KNWA 2RGMA 1VBJA 3PZUA 4PB5A 4WQ6A 3MO7A 1UWAA 1R9YA 4WDUA 3GDRA 4ZL1A 3UESA 1KV8A 1W1IE 3G6LA 3WDRA 1PPIA 4CD5A 3S9IA 5GJPA 3W2UA 1UPMB 1QDSA 1FX6A 3ZR4A 3CPUA 2E0PA 5HMFA 5BRBA 4LANA 4PMNA 3IVUA 4B3LA 1J8VA 2QCNA 3PG9A 4CEUC 3HPAA 3SCWA 3VVGA 1OD8A 1XIJA 5AVHA 1ZHAA 1HGWA 1G4EA 3KVLA 2D73A 3MY9A 5BWAA 4RE0A 3A9BA 3HTWA 1RQBA 2XH4A 3GHRA 3GVWA 4X2PA 4F2UA 1GW9A 4ASTA 2PC8A 1O7AA 1XC4A 3L4ZA 4PGLA 1RALA 1FFQA 1SW3A 3BLEA 3KBJA 2E8YA 4HA3A 5AZ1A 2B7QA 3WUBA 2Y62A 5HQEA 4PMXA 1C91A 1J93A 4O14A 1BRLA 4NAFA 1MXDA 4PRTA 1EQPA 4HHMA 1AQHA 2FYMA 2E9BA 4CUCA 1UH3A 3SGGA 2DV0A 5DY3A 3IJ8A 1NARA 4ZENA 2HTMA 3QHMA 2CZVA 1TELA 1GVOA 3AOFA 2Z2AA 3ITCA 3ABRA 5ECVA 1Y65A 3W72A 4WVXA 1CGUA 3BW2A 3GDLA 3LCWA 3W27A 2GZXA 4E4PA 4Z2IA 3VX1A 3OBEA 2BTMA 5DQPA 2BHZA 2PLJA 1VD6A 5EFFA 2QUNA 3WJXA 4NXSA 2HNHA 3E0VA 1JPDX 1WE5A 3WX7A 4XO7A 2IQDA 3DFQA 4AZCB 4TVDA 1IEWA 4FLSA 4JIPA 4N9CA 3CPRA 1K8CA 2WOQA 1PAMA 1PSCA 3ORWA 2QPXA 4DZAA 2XWEA 4X63A 1TYGA 3DENA 2GGGA 2E09A 3REQA 3GG7A 1XFCA 3ENLA 4BEUA 1A0EA 1XDJA 2FQIA 3NSNA 2DW6A 3WNPA 1W9PA 6TIMA 2E8ZA 5BRQA 5T26A 2V30A 2IQTA 4GO9A 4WX2A 1BQGA 3RNDA 3W2KA 4TXEA 1FCQA 3U4FA 2CHOA 4DBWA 5I09A 4NX0A 2R91A 5MKGB 3LPPA 3G1DA 1NAL1 4ORIA 4CQAA 1ISZA 5DBTA 4YYFA 2BSLA 3LEPA 4PCSA 3VD4A 5MHBA 4MWAE 1QATA 3W7OA 1P0BA 4L9XA 1IHIA 1CGXA 1V0MA 5AB3A 4Q32A 4HCLA 3KTCA 4S39A 5EU9A 1HJVA 3ES7A 3WQWA 5BMWA 2DP3A 4TMCA 3EXSA 4HK5A 1UA3A 2DZTA 3INPA 4XZIA 5FEPA 3LPFA 3QTPA 1OFAA 2G4FA 5CCZA 4LQ1A 2E40A 1QR7A 1XS2A 4W7UA 4FF5A 3U9IA 5T91A 4O1FA 4MFEA 1CBGA 3KL5A 2OKOA 1B3XA 3IV3A 3M0ZA 3UNTA 1WKFA 1YKWA 4HNVA 1GKQA 1MQRA 5HNUA 4ZCWA 1BEUA 1AH3A 1AA1B 5TF0A 5K3VA 4B90A 2GQ8A 3T44A 3E02A 5I3HA 4MADA 2CWXA 1VJZA 4HVXA 5DANA 3ZIZA 1CTNA 1XSJA 4Q8PA 3OVPA 1XRTA 1EYWA 4P2VA 4GI6A 1PDZA 1GJWA 2GUUA 4W7VA 2CFFA 1JUKA 5AHNA 5CC3A 4PODA 1R2TA 1D3CA 3NZGA 3CL7A 1WXYA 4KW2A 2OQYA 3V35A 4GO8A 3M6DA 1FQ0A 1UD8A 2V2HA 3SO7A 2Z2BA 3MDWA 1YBQA 5U7SA 4AF0A 2FVLA 3FEQA 2VEIA 1TTPA 3U7BA 1G67A 2O0TA 1BXCA 4XAPA 3GE7A 1UR4A 4JYDA 3TA9A 1UWTA 4UQ9A 2F8QA 3N1AA 3AZSA 5LIUX 3JU2A 1OT1A 3OBAA 4O0QA 3TQKA 4C6EA 3CO8A 3B0YA 3W6MA 4IPJA 4WDXA 5DMMA 1JAEA 2NQLA 4V33A 3LZ5A 2OPJA 4CEXC 4XAFA 2CW6A 3MUAA 2UY2A 2CERA 4D9PA 2WJZA 2ZA2A 4H00A 4F48A 4XKYB 3LTSA 5D02A 3VAVA 5BCAA 3MMTA 6ENLA 4O1AA 3LPGA 2CC0A 2QGYA 4PL2A 2ZX9A 4KF1A 3FGCA 2AOSA 5AHLA 2Y6ZA 1PJ9A 4L61A 3BQ5A 4JYEA 5CEWA 1EXPA 2HE5A 1UH2A 3TROA 3WEMA 3GDKA 1RXOB 2CWNA 3QF0A 2ZX7A 2OR2A 2YDSA 1L6FA 2VVNA 1H3GA 4HPNA 4D1IA 2WHJA 2NX9A 4JFVA 3LTPA 1LWIA 4HYWA 1KM0A 1R0MA 1J11A 3TJXA 2D0HA 4E6MA 2PDCA 3G5EA 1A5LC 3GS6A 3W2MA 3C2FA 3IJIA 3EPMA 1DEDA 1WDSA 2IW0A 1XRVA 2QDDA 3G1SA 3PWIA 1N2VA 3UA4A 3UYIA 1ZU8A 1SVDA 4ROQA 3ZXWA 1K9TA 3LBOA 2HK0A 1XD1A 5ENLA 4IX0A 3CHFA 4Y9MA 1NF7A 3G8EA 2P8BA 3E96A 1VEPA 4S2BA 5HJYA 2J77A 2I57A 3PFMA 4J40A 1BPLB 3I4EA 4IH3A 3LDVA 3TX9A 4ZB5A 3R2GA 4XZBA 2Y85A 3WZ0E 4HZ7A 1BWLA 3WDPP 4ERAA 4BQ2A 5A6JA 3CGTA 1IR1A 3WNMA 1H7WA 1ZBWA 2WZIA 2E6DA 2PRMA 2GK1B 3GZAA 1EC9A 3CWHA 2J25A 3IAPA 3U4AA 3DIPA 3OHMB 4GYPC 1B2YA 4YTTA 4YHGA 2JGYA 3O6YX 1F3XA 2VHLA 1KCKA 3L65A 4O52A 4XD3A 3DYMA 3W1UA 3WLLA 4JY8A 3PZGA 3UY8A 5A6LA 4PCPA 4C90A 3RPMA 4JDBA 1ZBVA 3QEZA 3AMLA 4MDPA 1OFQA 1TZZA 3S1GA 1GZGA 4Z0JA 4UR9A 3HB9A 1JCXA 3F4NA 4DBEA 3TW6A 4UXDA 1LUCB 1JZ6A 1IXOA 1HJWA 2QJMA 4G9PA 2FH8A 2WVSA 3PBMA 2QW5A 1PXGA 3AHZA 5A94A 4FLQA 4O11A 3KFTA 4UNKA 4WJ8A 3RILA 4BY3A 3CZJA 1EUAA 3QLDA 5FL1A 1F9CA 4JTAA 3LLFA 1ZB5A 2RJHA 3NFUA 1OG0A 4KWSA 4YLWA 5I79A 3PSWA 5T9BG 4IMAA 2FH6A 1YNQA 4EWND 4CNNA 1Q13A 1FDJA 4JNMA 3ARXA 4O1CA 4G7EB 4JDYA 5BRPA 1W31A 2PP1A 1KM6A 3W7CA 4ADUA 4DHGA 4GK8A 2X8RA 1RPXA 3NPVA 1QHPA 3SRDA 2Q3RA 1TPB1 3TFCA 1CECA 5I3KA 4E8GA 4S3GA 2VZTA 3KTXA 1J10A 1I4NA 1W3KA 2E5CA 1TE6A 3EKLA 4XAYA 3FJ4A 1ME8A 3V18A 3N4AA 3S2LA 4O8RA 3NDYA 3GTHA 3CL8A 5ABHA 1Q6RA 4GIRA 1ITUA 2VEMA 3A4AA 4DUXA 1QNSA 3OODA 1V6VA 3E5BA 1AMYA 5AVNA 2PAJA 1S3TC 1RBOB 3O0FA 2PCEA 2Z27A 4BI6A 1TVLA 3AYTA 3XIMA 3IK2A 4DYKA 3G1FA 4NUWA 2D3LA 1YW1A 1CGVA 3COTA 2PB1A 4DM2A 1TPEA 5EYWA 3MO4A 1SSGA 3W24A 4R85A 1XLJA 1VAHA 1UR9A 4ECLA 3CUHA 4KFPA 1G01A 2GJNA 1KTCA 3WLIA 4ZQRA 3AMDA 3TAOA 3OIHA 4L80A 1LCOA 3IIPA 1ISXA 4JZ5A 5ABFB 3AYRA 2J79A 4JTCA 3C8FA 1DJGA 3BICA 3QGKC 2FGLA 4GBUA 5J8LA 2XIIA 1Y5VA 3TR2A 3SJ3A 1VP5A 1N7KA 2HBVA 1EP1A 3AMGA 4O18A 3GRIA 4H4IA 2YYUA 2OX1A 3KVJA 2WBKA 1AL7A 2D22A 3CUGA 1UP3A 3PM6A 4OBSA 3BAWA 1NEYA 4IG2B 4IUOA 4QCFA 3DG7A 2VMFA 5HJLA 3ES8A 1VF8A 4LVFA 3HQ1A 1FWDC 3KOFA 4AWEA 3AIVA 4RLIA 3NWRA 4IXHA 3NVDA 2ZE0A 3R43A 1GVQA 3VM5A 4WSJA 3WJSA 2P50A 5FSDC 3O0KA 1I1XA 2ZXDA 5I00A 2UY4A 2XU2A 1F6YA 1YADA 1XGEA 2BOEX 2PZ0A 1KB3A 1L8PA 2DZAA 2EBNA 5D2YA 3VKAA 1X98A 3A6OA 4JTLA 1NH6A 5D9MA 3BLKA 3DI1A 4PMJA 1M7JA 1AZ2A 1GT8A 2B7PA 2GJLA 3HQPA 3ZLFA 1MYRA 2PDIA 2ACRA 3EA1A 1UR0A 1A3WA 2A79A 3P5YA 4IP5A 3SECA 4ICNA 1K77A 4UWMA 2I1OA 4I9TA 3VYLA 2PDHA 3JZEA 2KAUC 1O6IA 3NQMA 3W1MA 1OY0A 2NQHA 4FNTA 5FJOA 4GG9A 5LSMA 3QH2A 4KERA 3FW6A 3UXIA 1YTEA 5BXSA 2FPTA 4PMVA 4Q8MA 3AIWA 2H90A 4LT9A 1BKHA 2XZ7A 4MJ4A 3WF4A 1V51A 1QI4A 1MW2A 1WUFA 5C2CA 1JCTA 1K6AA 4LF2A 3DGBA 2V3GA 4DN1A 1R2SA 1DJQA 3BZGA 3KZPA 2GK1A 2DSZA 4H2HA 3CHEA 4JY9A 5XINA 3AO0A 4TO8A 1GTEA 3EOLA 3EB3A 4B5TA 1PKMA 5EY5A 4GABA 3IGUA 5CJ5A 3PNZA 4KCTA 3MV01 5DMYA 3TQVA 4PUNA 4HTBA 3TLLA 5H1WA 4C6QA 5LXXA 2ZA1A 1RBAA 2MANA 1MDLA 1XBXA 1US0A 1MVYA 4JTRA 3VZZA 1RQHA 2VFEA 1BVZA 3K46A 2QCFA 1PBGA 1TUXA 1B30A 4IMDA 2NQZA 2PWHA 2GVEA 4JICA 2AKZA 1O5QA 2Z7KA 3M47A 2PGEA 2VUNA 3OLGA 3RM4A 3W6YA 1A3XA 1ISYA 3UWWA 1CI1A 2YR1A 3W00A 4ML4A 4K2SA 3S5SA 3B9AA 3PAJA 1V02E 4LUTB 4O1DA 3PB0A 1SFJA 3VINA 3PHAA 3BOFA 1JQVA 3O05A 5DY2A 4C5YA 3STCA 3OLEA 1CXIA 2W67A 4YNGA 1NDWA 3G1YA 3BANA 1G69A 4H6QA 1V0NA 4G7EA 1E70M 1JNDA 3SM0A 4XIAA 1ITQA 3PAOA 4FI4A 3FXGA 5G1YA 2FB2A 3UXLA 4YWSA 1TJ1A 2CLIA 3F5JA 3RO8A 4WGXA 3UR2A 5I06A 3N9KA 3C0JA 5E5CA 2EKCA 3UJEA 2VGFA 1THFD 1VJSA 2WV8A 4JIEA 3AJXA 2V3DA 3NZPA 1MQQA 4FP1A 4NAEA 3W9ZA 4QIUA 1R5YA 1WO2A 3M16A 1J0KA 4G6CA 3BLDA 1GQJA 5J5RA 1X8CA 4DX3A 3XISA 4P7NA 2OZTA 4MNLA 1GOMA 1XUZA 2VFGA 4EVZA 3AMCA 3MP3A 4GC4A 4HQVA 1BSLA 2GL5A 1XH0A 3KDOA 2JEQA 1DV7A 4H8UA 3CZGA 3VD9A 1KFWA 1M04A 3AS3A 4RK8A 4GXPA 3T78A 5K2ZA 4NJHA 1GHRA 1OFRA 5FF3A 3Q45A 1R9XA 1GVFA 4CN1A 2BP1A 2OEJA 2XINA 2C16A 2GLKA 1EDTA 1VCGA 1EC7A 3MTWA 4F0KA 2AGTA 2YXGA 4UBPC 3ERPA 1OVDA 3B03A 3WLNA 2WANA 4QROA 1NP0A 1Q6OA 3V4BA 4AC7C 1UKQA 3W1RA 1C29A 4KFNA 5ABFA 1XCXA 3NQFA 4HB7A 3HO8A 1OZQA 1B4KA 1JZ7A 1K4GA 1N55A 4N9EA 4NJGA 3TJIA 3FVMA 1TRDA 4LSBA 1GYLA 1XIDA 4FOUA 3N14A 3GAYA 4AC1X 4CNUA 4FXSA 5HK4A 1ZFJA 1DJZA 3SY8A 3PS7A 4UC5A 1XLKA 7A3HA 4J3VA 4PE8A 5M17A 3VCCA 4S2CA 4PBFA 4XD6A 4UZUA 4UTWC 1XR2A 3RITA 3RX3A 1AW1A 3UWQA 4MG4A 1MWOA 1L6WA 1EIBA 3LI0A 3OGRA 1CNVA 1R87A 3MJYA 3LHZA 3S47A 4ICMA 1O12A 1DQWA 2ZADA 3DHPA 3PJWA 3S6DA 3TQPA 5A2CA 3RK8A 2IUZA 5JQ9A 1KCZA 4ZQMA 2CBUA 4QRNA 4FHAA 3C8NA 4GD0A 1EOMA 3L4TA 2QDHA 4NRSA 3VNDA 4P8WA 2VX5A 1XYMA 4Q8OA 1PV8A 2ZRWA 1W5MA 1XGDA 4Q4KA 2VWSA 1QRQA 4R34A 2Z24A 2V6AA 2ON3A 4U31A 2I14A 3OJGA 2VGBA 2INZA 4QP0A 1Z8AA 3G3MA 3UZXA 5HUPA 3VGBA 1W6TA 3I3DA 1RH9A 1S5VA 4GCXA 2FZMA 3GVQA 4RCXA 3S8HA 3XINA 2W61A 4B4HA 1S38A 4UFIA 4KWUA 3LU2A 4DJFA 5LNVA 4ZTXA 3RX4A 2ZZ4A 3KRSA 3A3HA 3DOPA 2P88A 3NXLA 3A12A 5GVJA 3AICA 4HGXA 1ZENA 4DXVA 1TWDA 4UQBA 4GY7A 1TTQA 3U6WA 4RNJA 3W1NA 4H8VA 4NZ3A 1F8MA 1OX5A 2J7EA 2PU0A 3W3OA 1C9WA 4UNIA 1K8YA 2J7DA 1AK5A 5A8GA 5C0QA 3RCNA 3HIJA 1CXLA 3W87A 5I3IA 3UVIA 2I17A 2WZEA 2J7HA 1QO2A 1DWJM 1NDVA 2WPBA 4AIUA 3VILA 2CXGA 5HPCA 4DZ5A 1VENA 4MUZA 5HAOA 1RP8A 3UWYA 1MEIA 3NM1A 2OQHA 3GXTA 1KFJA 1ICSA 1TJ0A 2QUUA 1A5MC 2EG6A 4MZ8A 1GQKA 2P3ZA 2Z1SA 4HPGA 1XLMA 4FK9A 3IJDA 4NZJA 3RO6A 5FJRA 4Z2LA 1MXSA 2WMGA 1SPQA 3R12A 1VS1A 4CVUA 1DJWA 4AX6A 1Q5MA 2PZNA 3Q65A 3TEVA 4WJEA 1O60A 3I6EA 3QQ1A 4XV0A 5G4HC 3URNA 1KRBC 3UG8A 3SSZA 5E09A 5DT7A 2QCDB 4LUTA 1V3KA 1Z48A 1O66A 4Z2KA 1QNVA 1SFSA 3LHYA 2NX3A 2VGGA 1RQEA 3DBNA 5I78A 3L4VA 2HISA 2VGIA 3R94A 3VABA 2YCJA 3SUSA 5F1VA 1IR2A 2AKMA 2WAGA 1GWJA 3CEPA 5LNUA 1XUUA 4NI8A 4I9MA 3OYXA 1EX1A 1QOPA 3C6CA 4M29A 4HA0A 4QBXA 4B3KA 3N29A 2INFA 1HJUA 6REQB 3R0UA 3LCGA 4PMRA 2ASHA 3P8IA 3N19B 1CXKA 3STGA 2BY2A 1FWSA 5CC6A 4WKFA 1I1WA 4H19A 4AIEA 4IIEA 3TVAA 3DAQA 3CASA 3SJNA 4JTDA 3TA6A 2W3ZA 4GI8A 3SQSA 2ZFAA 3CQKA 1DTNA 3H2AA 4QX4A 1A50A 1RJPA 3AU2A 1SU5A 1O5XA 1EP2A 4FO4A 1R38A 4UFMA 1UHVA 2ZRXA 2WHKA 4CNSA 4M6PA 3ZFHA 2NT1A 4LC8A 4JTGA 2X1IA 4A4AA 3TJ4A 3AHXA 1L2QA 2ESCA 5EFDA 3TONA 2XVNA 1V08A 4A6GA 4AD2A 1W1VA 3NZQA 1EF3A 3GH7A 1KWKA 1H09A 2OB3A 2IPJA 1UASA 5C5YA 4RL3A 1HVQA 3O1NA 4FF7A 4LAUA 1MEHA 1W5QA 5FI8A 3WF0A 1PL9A 2Y70A 4CN6A 4J3UA 4R53A 3QSRA 1PX3A 4EIVA 1G7UA 3NNTA 1DXFA 1E40A 1FWRA 2XN1A 3QTGA 4HJFA 4Y2WA 4OV9A 2WJEA 3PF3A 5LA2A 2DVTA 4UFKA 4AH7A 1CLVA 4I5UA 3VNKA 4PUUA 4MJ2A 1W3JA 1E4MM 2ACQA 4PH6A 4EXQA 1DOSA 4UZSA 4AY1A 4PULA 1U1JA 1GONA 1E71M 2F61A 3VD7A 2R9RA 3QQWA 4IX2A 1SR0A 1TX2A 2WMIB 1F05A 3WYZA 2W92A 2VDGA 1K3UA 1DL3A 4R7OA 1E43A 1WOAA 1KWGA 1I8JA 4PEEA 4XTIA 1TRIA 2Z7GA 5C8BB 2HVMA 1XLFA 3VKJA 4QISA 2Q02A 2XJ7A 1TPUA 3SUTA 5D09A 3WNNA 1ZJAA 2ZXAA 4IUGA 4J5NA 3JS3A 3TTQA 3BAXA 2EPNA 2IQ0A 4V15A 3T09A 5L6UA 3W70A 3QY6A 4S3AA 5D4YA 4EKJA 4HNOA 3KBWA 4WD0A 3LERA 3VZXA 3CZEA 4CU8A 3A21A 3LV6A 5I23A 3EX1A 4B5UA 3QGVA 1PVNA 4GE8A 3MCMA 3W2LA 3WNLA 2I5IA 3GR8A 4LEQA 3K30A 4DO5A 2AL1A 4D6HA 4E4UA 4GZ7A 2F6XA 5I0DA 3B9OA 1M6JA 2A6NA 2WVVB 3ZVIA 4AHOA 3CV1A 4RE4A 1UROA 2BVYA 4XBJA 1HX0A 1GTHA 3ITXA 1XJBA 3Q67A 4L56A 1FWIC 5BXRA 4DJEA 1V8EA 1DIOA 3U5UA 4HMEA 4C6NA 1SJBA 4UTTC 1KLZA 3CUXA 3QV8A 2BLEA 1FP9A 2HK1A 1LYXA 2Y7DA 4H41A 1TREA 3QSTA 5SWUA 2ISFA 5BU6A 1DPMA 4QLKA 4A8NA 3Q58A 1VKFA 5GNYA 3G1XA 3TH6A 3VIHA 3EWUA 4PBEA 2ODOA 1JULA 3NO1A 1K9EA 4Y90A 1XRSA 5HWNA 4QTGA 3BW4A 1EOKA 3D6NA 4GX9A 2RH9A 1FWFC 1ZAJA 2Y7FA 4X60A 5GJMA 1RPKA 4XD5A 1I2PA 1TPFA 4M81A 4E0CA 2XUCA 2PGRA 1EO5A 4HZ6A 4Z17A 4LUJA 1B3YA 1KV5A 3KEHA 1SZNA 1KXTA 2EPMX 3THQA 3H6OA 1DHKA 4A2RA 4DJED 4ZR8A 3T4WA 3FKRA 3VTRA 1J0JA 1EXBA 4JGDA 3TFXA 4I7WA 3V0SA 3BUVA 2DZUA 3RIKA 2Q71A 3GFYA 4MZYA 4URIA 3DFPA 4V2XA 4G7FA 3ZWSA 1VYPX 3ZYZA 4YL2A 1E9YB 4EOUA 2QCDA 3WF2A 1KQYA 3SQMA 3G0SA 3M5XA 4ZSUA 1DJYA 5I7GA 4HYVA 2WQPA 3VIJA 3NQGA 4GZJA 2RUSA 4UTIA 4TVUA 4K39A 3WLSA 1ADOA 3RLUA 4W86A 1S2WA 4PMUA 2GQ3A 2NV2A 1HGYA 3AALA 4Q8VA 3OP2A 1ZQ5A 3UVAA 5CJMA 3T8LA 4GLEA 2NX1A 2VT0A 3WF1A 3QMRA 2XGBA 1AQMA 3LLDA 4IP4A 1OCQA 3E5PA 3NPXA 1YPFA 3OZYA 4YTRA 2WPGA 4LVGA 4AD5A 1UC5A 3FJNA 3MW7A 4NILA 4FXRA 1DJNA 1Q85A 1OGSA 3S83A 1L0PA 1IXNA 1RVGA 4O1EA 3F2CA 2P5NA 1JZ5A 4ZSTA 3VE9A 4DELA 3ITVA 2YCLB 3PTMA 3T6CA 3WJWA 2FTWA 1KBBA 1XL9A 3E0FA 1WAUA 3PUGA 4W9TA 3BQ6A 4GQQA 3DFOA 2MNRA 4QAWA 4BI5A 3HA1A 2ZRYA 4FIQA 1YLVA 4HHPA 4YVPA 4HNLA 2HVOA 2BVDA 3G1HA 4KPLA 4YTUA 3KCLA 5XIMA 4QQUA 1SZRA 2Z00A 3SY1A 4ATDA 1O5RA 1MQPA 4MSSA 2W62A 4NVTA 4JX4A 4DUWA 3VKKA 1S46A 3M0MA 3U7VA 1B3ZA 1C90A 1TWSA 1DJHA 1NF0A 1UUQA 3GTNA 3T08A 3EDJA 2QMKA 4Z2HA 1DIEA 4UNLA 4PMOA 3FV9A 1UIPA 2YCKX 3M5VA 1TPWA 3ZJ7A 4H1ZA 4QJ4B 2Z4GA 4WIWA 4BWLC 1C8YA 2BHYA 4O17A 4R7JA 3F4VA 1KM3A 3C56A 4C6JA 3GZ3A 1W32A 5CBJA 4GKTA 3ZT5A 4FAMA 3PBWA 3G22A 5C2GA 2ADAA 4YXGA 2PFHA 1VYRA 4AD1A 1TA3B 1PIIA 4B9ZA 4LAOA 2QCEA 1SMDA 3HV8A 5HQLA 5E0KA 1TV8A 1FA2A 2VCCA 1EEXA 3MT1A 3W53A 3VD3A 5KSWA 4AFYA 5FSEC 1H49A 1LL6A 1TE1A 3CEUA 1DBTA 1G9HA 3NPUA 2ZCGA 2QV4A 3O63A 5A2AA 3P67A 1U1UA 4HNCA 3H7UA 1K9FA 3VNZA 2X0YA 2FZ9A 1R47A 3UWUA 1EH9A 3II1A 4I6KA 3NQDA 3QV7A 3THUA 1VPXA 2FMNA 1OYAA 1R46A 2VM8A 4Y9PA 1JIBA 3E2RA 3MCOA 4OE7A 3CQHA 4LS2A 4EAYA 1GOKA 1GZJA 3L9CA 3PUEA 3FNDA 3BJSA 4PUEA 2J47A 2V2CA 4NNCA 4PTNA 1EZWA 3B9EA 2ALDA 1MW1A 1QI0A 4BKNA 5JUVA 1KM2A 3IIVA 3AISA 2A7RA 1UQZA 2C0AA 3UPBA 4HK6A 4J35A 3QFWA 3KUMA 1EJ7L 2OFJA 1UUMA 5G4WA 5H6HA 3BMWA 1UIOA 4Q6XA 3GDMA 4JNZA 3HGOA 3VGGA 1IT8A 3KS6A 2O4QA 3RPTA 4N7QA 2W4XA 4TU1A 3MA8A 2E3ZA 3ATZA 4Z08A 4FXJA 3O6CA 2PDPA 4KMQA 3ICJA 4X9YA 4F2BA 3N9SA 4GVGA 2NWSA 4O0ZA 2UV8G 5CSSA 2V5BA 2YBVA 3BGJA 4ZQPA 4GMEA 2DDXA 2DFAA 3JUGA 1W9XA 3WELA 3KL0A 4AWUA 4QG8A 1ALDA 2O56A 4UCFA 4LV9A 3WDIA 3BGGA 3SCSA 3QHNA 3DERA 3ZVHB 1KRAC 5EB8A 2F2KA 3S9YA 1EZ2A 1ONWA 4XD4A 2IKJA 4UFLA 1A53A 1LWJA 3UJRA 3GR4A 4LBUA 5AYXA 2QXWA 1X1OA 2WSQA 3KTSA 1P0EA 4MIMA 3D3AA 2Y89A 4YTSA 5KZEA 1T5AA 1Z89A 2AMGA 2F6UA 3MYPA 2GSJA 2Y1HA 5LGZA 5A6AA 4A22A 2J7BA 3B0VC 4IMGA 4Z1BA 4ZMGA 4N0RA 4WF7A 5LGXA 3ZJ6A 1FWGC 4MF4A 1WDPA 4FLRA 4A2SA 1YTKA 3DFSA 2WHLA 1MEWA 4ZGYA 2D24A 2VCAA 1XIFA 1LLOA 1OX4B 4PUMA 4DWSA 4AZBA 1NWRA 2PDXA 3FKKA 3OZPA 3TSBA 4DF2A 4C7FA 1FKWA 2DW7A 5A3HA 4LYKA 1EA0A 3S1XA 2AQVA 1MI3A 1S3HA 5LIKX 2DY3A 1N82A 2GWGA 4MKVA 3BAJA 1VFSA 2GFTA 1G5AA 1MRAA 3HBLA 2Y7GA 1XYBA 1UCWA 3SR7A 2R1NA 3PULA 4M1RA 4J3TA 5REQB 2Z1WA 4AUBA 2VX7A 3NTYA 2GQAA 5AOUA 3V0TA 1NVMA 1T0OA 4DWSD 2BV9A 1TX0A 5IM51 4W89A 3VIFA 2V82A 3O6AA 5KETA 2PPGA 5EMMA 3O7UA 4DWDA 1U2YA 4W8LA 3PTQA 4MM1A 1POKA 3VI2A 2BVTA 1QTWA 4M5PA 3MHGA 3QV9A 3GSMA 2YSWA 3LI1A 1B3WA 3T0DA 1IIGA 1CB7B 4PUKA 2E5DA 2C6QA 4M7SA 4CNOA 3POHA 1FWTA 1YNYA 1JXKA 2PBOA 4UTMA 2Y8VA 4ZODA 1JRCA 3T0BA 3DHFA 1MRQA 4FNRA 3H4XA 3OQ8A 3WUEA 3PNUA 2VCBA 3IJ6A 1LP6A 3WSUA 4WY0B 1QOXA 4WY0F 4JX6A 1YQ2A 2R14A 4HT3A 1E56A 3TYEA 2BY0A 1E1EA 1XLEA 2E1DA 5B80A 4JQ1A 1W9BM 2PDYA 4FSAA 3CQIA 4V28A 3TJLA 4OQVA 3KE0A 5BXPA 2WO5A 4QITA 2Y4SA 2BGNE 3N6QA 1JZ3A 1V6UA 2P1FA 3GXMA 2JIEA 4BF5A 2BASA 1IGSA 1HKWA 3LRKA 4IM4A 2V8ZA 3CUZA 2QDEA 2FLIA 3N13A 3H4WA 3VD5A 2D0GA 4R9OA 2C79A 3K8MA 5D9PA 3W84A 5HR7A 3FN9A 3HPSA 3V16A 2J75A 4B5SA 4MFDA 2ZDRA 2Q8XA 1A47A 3QPYA 1ZGDA 2F9RA 3MMUA 5C9RA 3UFYA 4P7LA 2CXEA 1OQFA 2PRHA 3KM8A 2DUZA 1WDDA 4KWWA 5GJNA 1BHGA 1CPUA 3GKAA 4HOWA 1LG1A 1TMQA 4C6KA 3N34A 4GVIA 3WK0A 4CQ8A 2ZXQA 2CZFA 1K1DA 2OGYA 2CHRA 1KQZA 1N8FA 1F6PA 3WMBA 3WY1A 2HE8A 1DWGM 1LT7A 1VBRA 4PN2A 1OADA 5CSYA 4DM1A 4FNUA 4NL1A 2D2HA 1A5AA 1WB0A 4TV5A 1X8FA 3N3TA 1UZDA 3A9IA 3QKEA 3CV2A 4O4WA 4K8GA 2B31A 2XYLA 2ISWA 4MYXA 4S3KA 5HWMA 4CKQA 3MMDA 2D23A 3FXYA 5A95A 1C9DA 1A3HA 3UZ5A 1PZ2A 2CKRA 3TZFA 1PTAA 1WKDA 1K8XA 2XVGA 3TC6A 2VYOA 3UEQA 4E3VA 3QZAA 3BG3A 4AISA 2OODA 5AKQA 2GGHA 2AQWA 3F4CA 1T6MA 2W91A 2A2IA 3ZR6A 4KIRA 3AHTA 3VFCA 5E1QA 4K3ZA 3VC6A 2VZUA 3HV9A 3IIZA 2OEMA 2Y88A 2IPFA 2FHCA 4IIHA 1VBGA 5CAKA 2ZRZA 2CLEA 4P7QA 1PE1A 1RLCL 1QNRA 1FHUA 4JTTA 1E6RA 2XIBA 5C70A 3CL6A 3WQVA 1EGMA 4CLMA 1D9EA 1M1BA 3E6EA 1SZFA 4XTDA 3ZWTA 3E9AA 3WFZA 3UCQA 4IPLA 1SFLA 5BW6A 1WBJA 1ITXA 1JDAA 3FLUA 2V3EA 1JFXA 1U83A 4Q8WA 3R11A 4HYRA 3CB3A 4F0MA 2O9RA 5FKYA 1GW1A 1LLWA 1WA3A 4BQ4A 2A85A 3NM3A 4CQDA 3AYSA 3WLPA 3WNKA 1E3XA 3MVTA 4D8LA 5HATA 1GQLA 3IACA 3KBMA 2WNWA 3HQOA 1NFBA 1WZAA 3AI0A 4Q4QA 4AEFA 3MWCA 3PFRA 4DYJA 1YE4A 2FZ8A 2XN2A 4Q8NA 1IEXA 1XPYA 3OG3A 4DYEA 4RX0A 2E5BA 4OUEA 2H3DA 3R0DA 2DVXA 1DIDA 2HRWA 4FLOA 3CB8A 4D6CA 2FDMA 5AY7A 2D2JA 4U10A 3WNOA 2VC7A 3MV11 1CENA 4K7YA 1F6KA 4X0NA 4ZE4A 1NELA 2UY3A 4Q4MA 2GJPA 3CO4A 3MPGA 2XGZA 4Q7IA 1GOOA 3C5QA 3W1PA 3WKZA 3A24A 3TYBA 2RHGA 4XZWA 1JCMP 1HKKA 3GDTA 2INEA 4YVVA 2VRKA 2DU2A 1W2PA 4GFSA 5DBUA 1JR1A 2ZRUA 1BVNP 1XW8A 5DELA 1ESWA 3APYA 4NY2A 3NQEA 5I03A 1JF5A 4NZ1A 1ZBKA 1JYNA 4YYCA 5DN1A 2ZC1A 2W66A 5DF0A 1KR1A 4B2DA 1S2UA 3DDMA 2WSRA 3GHUA 2NLIA 3EDFA 1E6XM 4L6OA 4LC6A 4Z1DA 1ADDA 1DXIA 1R6WA 3WK1A 2OSWA 3N2OA 5K7JA 3WLHA 3B0PA 4RE2A 3FIGA 4DPQA 4TVCA 1HL2A 1JZ2A 2VZVA 3WQPA 5FIPA 1HL8A 4WY0A 5GQBA 3GYEA 2DUAA 1IQ8A 4M19A 3VDCA 3AIBA 5AYYA 1F5ZA 2JFEX 1C7TA 4TUFA 3TYAA 4PRRA 1XYZA 4XZ9A 4AEEA 2BG5A 4QFUA 4B2DD 1QUMA 2HBXA 2CBVA 5CG7A 1SO4A 4UIOA 2OZ8A 5D2WA 5IRPA 3OVQA 3WQOA 4KCWA 1ZAIA 4H6KA 4REQB 3S3GA 2HQAA 4YN5A 2FB3A 1KD0A 2VKZG 2NQJA 1KBLA 4M82A 3CWOX 3RAOA 3AUOA 1P7TB 1PX4A 1E15A 5CC7A 3CPGA 2Z6IA 1O5KA 1XIIA 3CK5A 1IT0A 3LTYA 2QVNA 1H7PA 1SQ7A 5EMKA 1BF2A 1EKOA 3G24A 1UWUA 3N9RA 1FWJC 3TK7A 4DF0A 4C6DA 2NV1A 5FJJA 3A64A 4C6BA 1Q2RA 1VJIA 3NYDA 1RY0A 1EJTC 2J88A 4GJ1A 4HKPA 4AVNA 1EGZA 4QEEA 1HO1A 3BK0A 2FFCA 1GOXA 3VO0A 1REQB 4Q4PA 3P93A 5BYWA 1J96A 4S1FA 1A0DA 3H70A 1P6BA 1SFTA 1U33A 1EQCA 3LCXA 4JIIX 3GQYA 4NJKA 4GNVA 3ITGA 1KRCC 1OT2A 5HWJA 4JN7A 2XFFA 3W26A 3OGVA 1P5BA 4Q7NA 3KBVA 5BOEA 1E1FA 5EBAA 3EWWA 4B3ZA 2FHBA 5A6BA 2W27A 3E38A 2XM1A 1QU4A 4RXFA 2IXVA 4HHHA 3PJUA 4MWAD 4C60A 2ISSA 1OK6A 6XIMA 4RKAA 3MKKA 3RRAA 4PMDA 1HJSA 5LIXX 3MHUA 4W88A 4Y9NA 4TX9A 4KCUA 4RPQA 1C8XA 4HMNA 2VR5A 4DRSA 3LK6A 3VDGA 4D8AA 3KX6A 1DIKA 3KBNA 1PWMA 1VC4A 1I75A 1V7YA 5DCBA 1EO7A 1E5NA 1TCMA 1TUFA 5IOBA 4AMAA 4ENLA 2XZ9A 4RZ5A 1E6QM 1FCVA 2YFOA 4K8HA 3TAKA 2IPGA 2H9AB 1M3UA 3K1DA 4IPNB 5AFDA 2P8CA 2BODX 5A6BD 2IXUA 2QJHA 3CAKA 3O06A 1Q8JA 3NXFA 2VEGA 4PMQA 4R3UA 3LCIA 5MF5A 5C6MA 2X1SA 1RJQA 1S39A 1E51A 1XDLA 5M03A 2E67A 4JIQA 1XG3A 4GYKA 2XIJA 3H23A 1KBJA 3GLCA 1ZL1A 1R30A 2DJLA 3EX6A 3PC0A 4A21A 3W73A 3KWXA 2Z1VA 4NQ1A 4O54A 3CYVA 5FF0A 4MY9A 1H7XA 3RGTA 2GSHA 4M3PA 1RCOB 4R7WA 1TZ9A 3P0XA 2QDGA 3L2LA 5D04C 1RAKA 3O2LA 4HSNA 4ICCX 7PTDA 3L66A 3TDFA 1BTMA 3UU0A 4IFKB 4QJ5B 1VPQA 2R6OA 2PI6A 3LMZA 3UG3A 1E0WA 5FESA 1W9UA 4WK9A 3FYOA 1IZCA 2JK2A 2UZ9A 4OGZA 3C0SA 2ZICA 2Q8ZA 1ADSA 3AQUA 3GIPA 3NDZA 1D3HA 3GC4A 3SN1A 2Q8LA 1GG1A 3MZNA 1QCWA 4M7TA 1E6ZA 2I16A 3C3NA 2XH7A 3LGDA 1E9IA 4GXWA 4ZO9A 4H2CA 4CCCA 5F7UA 1MW0A 4I3GA 2PCQA 4M24A 1UP0A 1GQIA 1WZLA 2I5GA 1FXQA 3SCVA 3W07A 4LYQA 3NR0A 3WMCA 3IJ7A 1YIXA 3G0UA 1EYEA 3AS2A 3N17A 3IWPA 2CZ5A 5CZJA 3F2DA 2NQ5A 3WDJA 3BJFA 3A4JA 3W1XA 7REQA 4LPCA 4R9XA 3UF9A 3S2JA 1TR1A 1C8QA 3LHVA 1RK6A 4L5ZA 3URBA 3P81A 4ILSA 3WQCA 2X30A 1NDYA 3FJ6A 3GUGA 2QYGA 3AHVA 2Q6ZA 1P43A 3N6HA 1LM1A 3LRLA 3D0CA 1K02A 2ALRA 1KR0A 1HP4A 7TIMA 2B81A 4C1NB 3NYZA 2DPEA 5LHEA 3GBEA 1F3WA 2QF8A 2G3IA 1KGXA 2HXTA 5KINA 4PZVA 4HPHA 1BGGA 3PWGA 2PLMA 4U2YA 1UUOA 5AC4A 3PZQA 1Z69A 3GG1A 4LU0A 4AAJA 3PWAA 3RG6A 3MJMA 5A6SA 4UB9A 2YL6A 3CLWA 5G2IA 2OEKA 3Q4DA 2HVNA 4AB4A 1R3SA 2CETA 1VR6A 1P7TA 3T81A 3B4UA 2ACUA 3VOHA 3FOKA 1XDMA 4KETA 2D3NA 1NU5A 4FR1A 1EPVA 1LBFA 1F4HA 2FPYA 3S1VA 5CGQA 1QASA 1ECEA 3BE7A 3K5XA 1T8QA 4JNYA 2ONEA 4WXYA 3TMLA 2WZHA 3ABQA 3BAYA 4GC3A 3CH9A 2HPIA 4ZQCA 1PKNA 1F76A 4FNSA 1LL4A 3A23A 1QOQA 4LCSA 4JTSA 1CGWA 2VOMA 5DRCA 4F0RA 1OBAA 2OX4A 2XVKA 3HF3A 4D6DA 1REQA 3W1TA 4B5XA 3CM4A 5DLCA 2YCEA 5HOSA 2C91A 4ZO6A 1PIFA 3ARUA 3ARRA 2WXDM 2ZKMX 4RJEA 3PPHA 1IV8A 2V5CA 3IK4A 3WQ5A 4DI8A 2G96A 3OU8A 4OTKA 5BZAA 5CPLA 3AXKA 3LXCA 1RA0A 4FZIA 1LG2A 1RV8A 1XH1A 4B91A 1XRFA 4S3JA 2Z28A 2WJFA 2VFFA 5C7HA 1VYSX 3NQVA 3SY5A 2PDGA 4AYGA 2CIPA 1I0DA 5DO8A 3QJAA 1AVAA 3EA3A 4HA1A 2EHHA 5D37A 4RZBA 2VEPA 2ZUNA 4IZGA 3L23A 1OX6A 1D8CA 1OGBA 3SQLA 4MNJA 2GVYA 4IGSA 3FAWA 3THDA 7ODCA 2SFPA 1NFPA 1XLAA 1S5WA 4FEZA 1AZ1A 1O4UA 5LZLA 1LRTA 3Q37A 1GHSA 1J2WA 1Y5XA 1EJUC 4POCA 2OWXA 1ZBCA 3W7GA 3I3EA 1Q6FA 5E0FA 4QJ3B 1N8WA 5D9NA 5A6MA 3JW7A 1Z3NA 2ZYFA 1V7AA 4OFCA 5F1UA 1TQXA 1KLYA 3U48A 1XQKA 3K1GA 3K4DA 1CXEA 4KS0A 4LVBA 3M0HA 1EBHA 1H41A 1XLBA 4IXXA 3QGAC 3B05A 1E6PA 1BLIA 1GOQA 2FJUB 3C0QA 4LVAA 1CGYA 4JKMA 1LOQA 3NG3A 4G5DA 1FY6A 1V6YA 3ARQA 3PZTA 4OBTA 3B40A 3AIQA 3THCA 1V4YA 3UG5A 4JN6A 3MHFA 1JDFA 4LEFA 5AN7A 3B3DA 2YZRA 4KGLA 1XV8A 3VDBA 5BOOA 1SJAA 1LL7A 1G7VA 2NUWA 4GUGA 2EGZA 4GCAA 5IBXC 5K9XA 2CU0A 4UQDA 4WLCA 2PLCA 4O19A 1UP2A 3UPWA 2PGWA 1OFPA 2GQ9A 2Y5JA 5FACA 5J5DA 2DH3A 3BLFA 4IMCA 4DXKA 1C7SA 3NZ1A 2VURA 3UJFA 3WDQA 3TOYA 5H2ZA 2WMKA 4PFMA 3EAUA 3H2MA 3IS4A 4MPKA 3UA3A 2DZWA 4PTMA 2QCHA 2ANUA 3WBAA 4AW7A 4C6FA 1OM0A 5CGMA 5CBIA 2IMRA 2VVSA 5B7ZA 1M01A 3IRDA 3GNDA 2Y24A 1Y7VA 5I3FA 2EPKX 3ANUA 4ERIA 2PWFA 2DIJA 1GKRA 3OPSA 3SAZA 3B8SA 1ZP3A 3DC8A 2WKLA 3G18A 4JAWA 5FJUA 1KM1A 4Q33A 3MS8A 2J8TA 3CAWA 5DT5A 2WB5A 3RMJA 1DVJA 3PZIA 3W7JA 3S5OA 2NSXA 3LHUA 2OOGA 1JYWA 3LYEA 5HANA 1Q6CA 1OC7A 5D2XA 3PTKA 3BZJA 1TWZA 1IXQA 4PB4A 4ZB0A 4EXAA 3VOJA 4LWWA 3FYPA 3NL6A 4F0LA 3TIMA 4ACZA 3IGXA 5C55A 1H1YA 4GJIA 1GKPA 4ZFMA 1A80A 1A5CA 4HCHA 4GQGA 3IJ9A 4WGHA 2JALA 3ZO9A 3ARYA 4AZ5A 3WL1A 2WMFA 3TV8A 4JL2A 2DGAA 2NVAA 4QNWA 4GYFA 4CCDA 1E1CB 1NTHA 2EG8A 1DQXA 1AFSA 2A3LA 2VZSA 3DZ1A 3SUVA 1NY1A 3E49A 4GKLA 1X6UA 4F9JA 2TODA 5JH2A 3V3WA 4DXXA 5FAJA 1PWLA 3WBWA 2QT3A 1S2AA 3B8WA 1WZMA 1YXCA 3R7MA 4C6PA 3WLKX 2E28A 1H61A 3DC0A 4CD8A 3SZ8A 4LS1A 3B8DA 1V93A 4ONVA 3RJXA 3ITTA 3K2GA 4N42A 1SSDA 4W5UA 1YEYA 3L4XA 2GYIA 2EKGA 5D30A 1F73A 1UG6A 1HP5A 3KLKA 3QC3A 1XC6A 1VHCA 5G1MA 4P61A 1V02A 2CZDA 4JTJA 2WVUA 2E1WA 4NYYA 1JNEA 3SGUA 1TJPA 1EA9C 4AHQA 3EA2A 2O9OA 2OYKA 5JVLA 1H5YA 1KFKA 3S0CA 1TG7A 3NL2A 2QR6A 3UGRA 2OLSA 1E9LA 1GEQA 4S38A 1BXNA 1A5OC 1A5SA 2G4JA 4JKKA 2DQWA 3P2VA 3ZSSA 3PSVA 4AZGA 2PURA 2EPOA 2DEPA 4MKNA 2I5QA 3BO9A 2WC7A 3T4CA 5CC5A 1RK5A 1XP3A 4W4QA 1JJKA 4NJJA 3KZSA 1G1YA 2WBGA 3IV8A 4J3WA 3SEPA 3PN8A 1HL9A 2QV5A 3W29A 2WW5A 1X97A 4ZA0A 4MWAB 3GBDA 4AZCA 1JD9A 3A3XA 3B06A 3CC1A 3LSCA 4JX5A 3GB6A 2WC4A 4CCEA 4GJJA 4PBGA 1GJPA 1XIBA 1NOWA 5DMNA 2HS6A 2POTA 2NV9A 4F79A 5JXQA 2PODA 1FBAA 3RJYA 1JEZA 4JTIA 4MY1A 1V6WA 1A5KC 3NO5A 5CLTA 2XH2A 3YPIA 1P6CA 2W9MA 3ABZA 2ZRVA 4XUYA 3L0GA 1B90A 2FGZA 2BFGA 2Z1BA 3E0IA 3O15A 5A8OA 4IQDA 1UKPA 1M7PA 6A3HA 2EJAA 1ME9A 3HMCA 1PCKA 4JIHA 5DEZA 3QN3A 4RDYA 1A5BA 1HKVA 1NDZA 4BCEA 5MKGA 3KS5A 2QEZA 3GXIA 3CHVA 4ZXLA 3GC2A 3L0NA 3BURA 2VFDA 1NFGA 2NXIA 5C9UA 1OFDA 1W5OA 4GZEA 3MYOA 4CN4A 4HNTA 3LQLA 1LBLA 3AS1A 3TC7A 3U2CA 1Y5WA 1FOBA 2PWEA 5AHFA 1FRBA 5K9CA 4MAZA 2RGLA 4P8VA 1JD7A 4K7VA 1YDVA 3CLMA 1DTUA 4HP5A 3Q94A 1WNOA 1GPWA 5KMYA 3FFSA 1P1XA 2CBJA 3UERA 1IF2A 1PEZA 4O1BA 5JIWA 3ZT7A 1TV3A 3WUFA 3UBPC 3LGGA 4W8AA 1O1HA 4LBRA 2ATMA 3LPOA 3QR0A 1QFEA 4XSLA 5C9XA 1ZALA 5AYBA 4KRUA 1K4HA 1XX1A 2VFIA 4DLMA 3N4EA 3TN3A 4QDPA 4O4VA 1E55A 5LYRA 3LNPA 5E9AA 2ZZ3A 4GUHA 4NZ5A 1GVRA 3AIRA 2PRLA 5AHIA 1P0NA 3LGEA 4JPGA 4GRSA 4BA0A 4GOAA 1EPXA 3PPFA 1T8XA 4O0KA 3W28A 2TMDA 3A47A 4B92A 1YNPA 3B0XA 1CX9A 1V0KA 2A5HA 3NQAA 3RYSA 2X7VA 3CHCA 2QJNA 4PRWA 4Q4OA 3NGFA 4UCGA 3V75A 3PR2A 5T8GA 4KIEA 3OOQA 3I65A 2V5KA 3ONBA 1QWKA 4QDMA 1F74A 1SJDA 2HZGA 2E25A 4LCRA 4W7WA 3DHUA 1Q6QA 2JF7A 5I24A 4GACA 3EOSA 1XBVA 4R5EA 1LWHA 3VGEA 3DG3A 1GVIA 3W1AA 2JIWA 5E6YA 1R85A 2C19A 1QPRA 2W6RA 4L6HA 4K38A 4RUBA 1AL8A 3CQ0A 4UR7A 3QYSA 5C9WA 4O15A 4NYUA 3EDKA 4DZHA 3MKVA 3CUJA 3MU7A 3VCNA 4XKYA 3HZ3A 1NWUA 4DJDA 2KX9A 4ATWA 1JDCA 1B3OA 5FEXA 1NJJA 4JOMA 1KA9F 4ML9A 2P53A 4LALA 3VIKA 3QFEA 2G8ZA 2CBIA 3BLLA 5IHSA 3OO2A 4L9YA 3MP5A 3WO8A 3MI2A 3VOFA 4L9ZA 4J2PA 4IMEA 4RNHA 4XX6A 3AWNA 4B5WA 3VPLA 1YHTA 4GIEA 4L1GA 5M1TA 3W7IA 4GH3A 4V1YA 3NSMA 5HJXA 2OZ3A 7ENLA 2PD9A 7CGTA 1F61A 2X2YA 2AQOA 1RHCA 3TP4A 4DJDD 3KVMA 3QR1A 3WFAA 3ARTA 4HMCA 4AXNA 3UETA 1J79A 4FPSA 1OG6A 3MUCA 1LRQA 3LV5A 4NT0A 3BAKA 3U2ZA 4I9AA 1EJVC 1JPMA 1TMHA 3GU1A 3PB2A 1A4MA 5A5WA 3V5OA 1KKOA 3CV7A 2ZVIA 2A0NA 1S5NA 3ID7A