1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
1JCLA 2DZXA 2CU0A 5E93A 4XTDA 3STCA 3E02A 1ADOA 1VCFA 4O1BA 4ADTA 4MUZA 3F4WA 5DBTA 4WZHA 4MZ1A 3IVSA 4HN4A 2JK2A 4M19A 4IX0A 3EX4A 2AAMA 3HB9A 4S2BA 2RHGA 3PS7A 3UWQA 3N9SA 3U8GA 5F2GA 3W1PA 4CQ9A 4WX2A 2A1YA 2OCZA 2ZTJA 5AHFA 4POCA 3L68A 4NU7A 1XI3A 5AYXA 3QSTA 4IJBA 3IIZA 1EX5A 1HFBA 3DKLA 5FF2A 5KZDA 3NQ2A 2GVGA 5CZJA 4LVBA 5CZTA 4JTSA 5CGQA 4PCFA 3G18A 3QMSA 1OX6A 3AO0A 3TXVA 1QPQA 4NVTA 4RLIA 1OF6A 1GYNA 3M16A 3P81A 5CPOA 1DV7A 4M7TA 2W79A 3S1UA 3NQCA 4PL2A 5AB3A 2QDHA 5DN1A 2FB3A 1GG0A 4KKXA 1K02A 3Q94A 2JKEA 3UXDA 4QIUA 2CLIA 3DFNA 1LLZA 4UMCA 3FYOA 2E1DA 4IXHA 1ZFJA 1JUEA 4CNOA 1GOXA 3HGOA 3B06A 3C3NA 5EBUA 5G4WA 1S5VA 3LHWA 2PRMA 4PL1A 3FIGA 1WAUA 2WNQA 1TTPA 3CTLA 3FFSA 3P61A 1GVFA 3I68A 1LM1A 2NWSA 2E5DA 3PUDA 4LC6A 4ML9A 3GVGA 3W76A 1KLZA 3BLEA 1SO5A 5G1YA 3TDFA 1PIIA 5IM51 1TPDA 4N4PA 3LX9A 1PHQA 2QCLA 1TTJA 3FEMA 4YCPA 3O8AA 3OEXA 3UPBA 3TE9A 3STGA 2VFFA 3EWBX 5LNRA 1NAL1 1DQXA 4O15A 3NVTA 1J5TA 4WUIA 1GWJA 3N73A 3HF3A 4EF8A 5AHIA 3W2JA 4TU1A 4FXSA 3O6YX 1KFLA 4NT0A 3EXTA 4LTSA 3DKJA 2ZFAA 5KMYA 2QJGA 5G2WA 5F2LA 3IRDA 3W2NA 2YDAA 2C1HA 4RCXA 5KTLA 4A2RA 2VXNA 3DZ1A 2A7NA 3RMJA 2RH9A 3EEGA 3PR2A 5FF4A 3SW6A 4YMZA 3NQ7A 2EKCA 3S6DA 4JXCA 5K9XA 5F1UA 3L65A 2VFHA 1A5AA 3W88A 1W0MA 3N2XA 3TIMA 4N9BA 3GIYA 1D3GA 4H3DA 1RQEA 5HMSA 4Q32A 3BVJA 3FA5A 4JTJA 4M6VA 3S5ZA 3B0UX 3DI0A 1K8XA 3NL6A 3STEA 2H90A 3QMTA 1O4UA 5EY5A 2J6XA 2YW3A 4JTTA 3GXNA 3IIXA 1WV2A 3UNDA 3SZ8A 3PY2A 3QW3A 4IOTA 2DORA 3W2MA 5AN7A 4K39A 2XN1A 3LM7A 2J88A 2NX3A 3C4UA 2ZA3A 2ZCGA 1M5WA 2RDWA 1BKSA 3EXRA 1SZNA 4RXFA 1LOLA 2GVLA 4M7SA 4NX0A 4Z0SA 1VHCA 1K8ZA 2NXIA 3CWNA 1DKWA 4O4VA 2XN2A 3GDKA 1Q6LA 3W7CA 4JX6A 1L9WA 4DF2A 4NJKA 3P5YA 1RV8A 1B4KA 4HT3A 1BWKA 1AMKA 3OBKA 3G1DA 2EHHA 4CQAA 4JYFA 1V7YA 3PSWA 1VLIA 3TW6A 1DJQA 1KM6A 5KZEA 3IGUA 1RPXA 3GKAA 3BW2A 4RJEA 5EMUA 3P8IA 5H91A 5C5YA 4FNSA 4I7WA 3I7SA 1OG0A 4MJMA 4MPQA 1VCVA 1P0NA 4ALDA 2V2CA 3NG3A 5C6MA 3IGSA 2NUYA 5C2XA 4M6PA 1GZGA 3W1QA 4UFHA 3M5ZA 3DFSA 4LVAA 1OYBA 1YXDA 2QCHA 4MY9A 2FPTA 2ZZ2A 1QPOA 2V2HA 3KRUA 4RR4A 1JRCA 3TC6A 4Z1CA 1TRIA 3W1TA 2DJLA 1G4PA 4HNVA 1G4EA 1H51A 3FOKA 1XUUA 1OFOA 1MEWA 1TYGA 5AYZA 3W7PA 1H7XA 3GR8A 2RKXA 1R2TA 4AF0B 3SJ3A 3HIJA 3A9IA 1LRTA 4ZQNA 4LVGA 2OMAA 2BLEA 1XL9A 1EP1A 1F6PA 3H55A 4IPIA 3NO5A 4AWTA 4IMFA 1TJRA 3TNOA 3A5VA 3GDRA 2Y88A 3VI2A 3LHTA 4O53A 3IEBA 1M7OA 2A6NA 3TW7A 1TMHA 1BEUA 1SO3A 1UCWA 4NNCA 1ZJIA 4PH6A 4A21A 2DZSA 3W7GA 1E51A 5HINA 2DZWA 3TMQA 5DY2A 5F4SA 3FS2A 5K9CA 5D33A 1ME8A 4O14A 4JIPA 2H8ZA 4TR9A 2QUUA 5BW6A 2E5CA 4MJZA 5A5WA 1VYSX 3W1LA 1PL9A 1PVNA 3MYOA 5FI8A 1AL8A 1N7KA 2E5BA 2NUXA 3OVPA 1ME9A 4A2SA 3B0VC 4UFIA 1VYPX 3HPXA 3W72A 1F5ZA 1FWTA 1HG3A 2ZRWA 1YDOA 4ONVA 4Y96A 1ZY9A 1VLWA 2YXGA 3ZFHA 1VQTA 1TV7A 4TO8A 5FF0A 1CX9A 3QMRA 1W5MA 4BWLC 3UD6A 3ZWTA 1FWRA 3DFPA 4K7YA 4K8EA 2P0OA 1Z42A 2C13A 3HPZA 3NNTA 3W07A 4LWWA 3LCHA 3QQ0A 2GVJA 4X9SA 2QJHA 1OF8A 2E6FA 4Y8FA 2WOQA 1JJKA 3TROA 3L9CA 3W7RA 3EXSA 1EWDA 2VEMA 1SZFA 2Q8ZA 3M5VA 4L4LA 4OV9A 1G4TA 3S9YA 4ZZ9A 3BGJA 3EX2A 1GYLA 4N9DA 5FF3A 4UTKA 2E6DA 1RD5A 2QAFA 1JQXA 1EUNA 3CWOX 3PB0A 3BLIA 4O17A 3Q58A 3BPWA 3G1FA 5I3KA 1O60A 4ZQCA 2G97A 3TQKA 2DZPA 3QC3A 2VFIA 5HWNA 1W56A 2CZFA 1DHPA 2B7OA 1D3HA 4X3ZA 4IXXA 2EAWA 3C2FA 2E77A 1TPWA 3GLCA 3WJWA 3N2MA 5EL1A 3JS3A 1ALDA 3G0XA 4UR7A 3LRKA 3RU6A 1DQWA 4QAIA 3W7JA 1QCWA 1LDCA 1QNVA 1PE1A 3H53A 4MFEA 4XUGA 4HSOA 2QF7A 2Q8LA 3TMLA 2BX7A 3W71A 4PFMA 1YTDA 4MOZA 4HNTA 3KVKA 1DOSA 1OK4A 5L6UA 2Z2UA 4PODA 4U4MA 3SSJA 1FXQA 1XBXA 4GUHA 1LRNA 2V30A 1N8FA 3PULA 1F73A 3MWAA 1SW3A 3MBFA 1LYXA 1KTNA 4HKPA 3W7EA 1N55A 4EF9A 1K7FA 4ZMGA 3CLMA 4OU1A 1T0OA 5G1TA 1ME7A 1JVNA 3G3DA 2B4GA 5C55A 3M7WA 3W9ZA 5E0KA 2B7QA 4X22A 4OV4A 3CM4A 3R2GA 3QJAA 4K38A 4JTFA 2NWRA 4UMAA 3W22A 2Y6ZA 2W6RA 4NUWA 1G67A 2HMCA 1MO0A 3DHFA 4BI7A 4JNMA 4UC5A 5CKSA 1DORA 2NX9A 4AHQA 1GG1A 1WBHA 1FDJA 1ICPA 3HG4A 5K9DA 1C9DA 4JR5A 3WFAA 1S5WA 2ABBA 1Q45A 2Y7DA 3C56A 1LBLA 4O18A 4Z08A 1GVQA 3FLUA 1OX4A 1H5YA 3IGXA 1S5TA 1XC4A 2NV1A 4KFPA 4R7JA 4NJHA 4D2JA 2QCEA 1T96A 1DVJA 4UMBA 4TX9A 2BTMA 2G95A 2PURA 5TIMA 5D2VA 4MYXA 4RZ4A 4GXMA 1ZNNA 4E0CA 4GWEA 7TIMA 1SZGA 2H3DA 1O5KA 3LCXA 1GTEA 3G1VA 5KZMA 5KINA 2QR6A 3BW4A 3N14A 3PAJA 1NFBA 1JCNA 2LLEA 3EKLA 3NQGA 1OFEA 2FQIA 2Y7EA 5J5RA 3N3MA 4DO4A 1HL2A 1W5NA 2VKZG 4GBUA 1KV8A 4HPJA 5LNVA 3GNDA 2A21A 1JCMP 1H7OA 3ABSA 3R8RA 3W23A 3ZWSA 1ZAJA 4UR8A 4E2DA 3LOTA 3DENA 5FF7A 1VS1A 3DBPA 3PVFA 4YWIA 3RFAA 4O1AA 3DAQA 3DH7A 2DJXA 1SUXA 5F2IA 3W1MA 5HWJA 1G69A 2Y62A 3MW7A 4N9EA 2NX1A 3W1NA 2CLKA 1Q6RA 3UY8A 1TSIA 4NJGA 5HULA 3UYCA 2O7SA 4N6EA 4AB4A 3V1PA 1IIHA 3BLFA 3UWWA 2ISSA 3OG3A 5DY3A 4O12A 3NAVA 3PSVA 4AHPA 1HUVA 1SZEA 3GXTA 3W2UA 4KFNA 1VHNA 2OT0A 2GJNA 4QSHA 1WA3A 3W7LA 4AAJA 3HG3A 4ZQPA 2CLOA 2WV8A 4FO4A 3RLUA 3T78A 2A7PA 3O63A 3LLFA 5U7SA 2E68A 4JS3A 4EWND 3M43A 1NVMA 4BWLA 3PM6A 3A5FA 1W3TA 3ABOA 4GE8A 1XDMA 4S1FA 3L66A 1XBZA 3W7NA 4BI5A 2WSRA 3P80A 2ALDA 2X1RA 3HGJA 3UY7A 2A5HA 4W9TA 1C8VA 3L0GA 3QZEA 4JDBA 2DZUA 2NXGA 5LHFA 3S5YA 5CG7A 5K3VA 3INPA 3DFTA 3L5AA 1GVSA 3G1HA 3DFOA 1YXYA 1J4EA 3TQVA 4Q4KA 1UBSA 3PG9A 1XBVA 1TTIA 4O16A 3T44A 2C6QA 2JGQA 4UTTA 4HNNA 2QCGA 3P84A 4XQ6A 1FQ0A 1AW2A 4C1KA 4L4MA 2HS6A 2A6LA 3QEZA 1OK6A 4Q33A 2FJKA 3L67A 4CCDA 4RK8A 3LGEA 2VEKA 5AHLA 4CCCA 1BWLA 3IIVA 4XZ9A 4K6AA 4G1KA 1ICQA 2NXHA 4DBDA 3G1SA 1KM3A 1I8JA 1SQ7A 5I3HA 2ZYFA 3PBYA 1TV8A 2E6AA 5F4XA 3O05A 1MZHA 4FHAA 4JEQA 3UXAA 4EOUA 1TCDA 1GJPA 3DU0A 3SY5A 3W75A 2CZDA 3MI2A 3LCWA 3P60A 4QITA 1X1OA 5D37A 5C54A 2JKPA 3SGUA 3LV6A 4FEZA 3ZS4A 1OFDA 3Q2DA 1PCKA 1QMLA 1X7FA 3MP5A 1TV5A 4O0KA 5D32A 4WQ6A 4MVAA 2OT1A 4YXGA 3IIOA 2RDUA 3RNDA 4U28A 5LNSA 2EF9A 2RDTA 2YPIA 1XDLA 3PG8A 4MKNA 3KVLA 3LRMA 4UTWC 2WSQA 3ATYA 3L0KA 1DJNA 3W1XA 1QDSA 3IIPA 1FDZA 4JICA 3DFQA 1G7UA 5K2ZA 3PWAA 2FDSA 1F6KA 1TJPA 4UCGA 1EP3A 2C18A 3TC7A 1TRDA 2QJIA 2QEZA 3C2VA 4AF0A 1KM0A 1W54A 4AHOA 1THFD 1UJPA 1A50A 2R94A 1XM3A 3LCFA 3I6RA 2PRLA 1JCXA 1VJIA 2A7RA 4UNKA 4UXDA 4ADUA 1Q6QA 4LS2A 1MSSA 3LBCA 3D0CA 3NQVA 5EPDA 1OHLA 3G22A 4PTNA 4DPQA 3P7YA 4FNQA 3T55A 3L21A 4C1LA 2CLMA 4JDYA 1KBIA 4JYEA 5G2HA 3GDTA 3TV8A 4GNJA 4TMBA 1PV8A 2PRHA 2YYTA 4BFAA 3KHJA 2BZNA 2NV2A 3HOJA 1DBTA 5FEZA 2A85A 2ZZ6A 3TAKA 4PC8A 3L5MA 4NX5A 3W74A 1L2UA 4O0ZA 2ZQ0A 2YSWA 2ZRXA 3NPVA 5HNRA 4OBTA 1KM4A 5AHNA 4R33A 5I3FA 1CI1A 1UUOA 4IUOA 5D30A 1FCUA 2YR1A 3MI3A 5HUPA 4H6KA 5AHMA 2QCMA 2GOUA 4WXZA 4O8RA 3LXAA 5LHEA 5IBXA 1EEPA 4CQ8A 3TSMA 5I3JA 3CEUA 1F76A 2ATSA 1OYAA 1QOQA 4WY0F 3CPRA 3B0PA 3TUUA 4OQVA 4CLMA 5LNUA 1H7NA 1LOSA 5TQLA 5BOOA 3NQMA 4N4QA 3GAYA 2PC4A 3L0NA 2HSAA 3CEPA 3RLVA 1W31A 2YFNA 1L6SA 3W2LA 2FPVA 1YXCA 2EGZA 4LVDA 1B57A 4CCEA 3GNNA 4RZ6A 3CB8A 4IQLA 1EWEA 2DZVA 4XBSA 1I2PA 4NXKA 3UQNA 1RR2A 3N19B 1GQNA 3SR7A 2CW6A 5LGZA 3KVJA 5T26A 3W7QA 3LTSA 1OFBA 3HPSA 4IMEA 1B4EA 1GT8A 3T40A 3GB6A 1KA9F 1QR7A 3NZ1A 3PC0A 5I3GA 4Y9AA 3GR7A 3QFEA 3JRKA 4JX5A 2FB2A 3SGZA 3W7KA 1R46A 4UTUA 1AK5A 2ABAA 4LU0A 3THAA 1FCVA 4IGHA 3OVQA 5D05A 2TYSA 4AVFA 3T4CA 3S5NA 1NSJA 1OFPA 3UWUA 2C15A 1R2SA 1KM5A 1MEIA 2ZTKA 4HPXA 5CZ0A 3SIZA 3UZJA 5I3IA 2GQ9A 3IV3A 2I14A 4XWUA 3UPWA 1TPVA 1VC4A 3OHIA 3GDLA 3PUEA 3HMJG 4Z1DA 3LHVA 2CFFA 2A0NA 2I9EA 3LERA 3TSBA 2ZZ7A 2JGYA 5ABTA 2WQPA 1NF7A 4UFKA 1GEQA 5DCBA 2AQWA 3C2RA 1LROA 1A5BA 2V5LA 3GYEA 4UTHA 2J27A 4N9CA 3THQA 4R34A 3VKJA 4NZFA 1FDYA 3LI1A 1D9EA 1XCFA 2I1OA 2PCQA 1YLVA 4ZQMA 4S2CA 5TBOA 2OZ0A 5D2TA 1W1ZA 5KSWA 1H60A 1YTKA 5FEWA 2Y85A 1KM2A 2QAPA 2YW4A 3NQAA 1ZAIA 2QDGA 2GUUA 2FPYA 3LTYA 4AWUA 4NQ1A 3KOFA 1G6CA 3ELFA 3G3MA 2QCDA 4QNWA 2WNZA 4MLRA 3W7DA 1B9BA 3BG5A 1VZWA 3S1XA 3HBLA 3M5XA 3B05A 3G0UA 2ZZ4A 2V81A 3HGSA 4FB7A 1IXPA 3C61A 3U6WA 4JY8A 3E0IA 2DZTA 3MP4A 4P2VA 1SO6A 2ZBTA 1OX4B 2R91A 3MUXA 3TQ0A 2V0TA 4OT7A 2WSYA 4QISA 2X2GA 3WJSA 1JCYA 3EWUA 3QW4B 2GJLA 1XXXA 2ATMA 2ZRZA 3PF3A 3M9YA 2NLIA 1KTBA 4IPJA 1WQ5A 2YFOA 4NJJA 5CZSA 5BMWA 3KX6A 3EX3A 4DO6A 2DU2A 4QM1A 4AXKA 1O95A 1QPRA 3G1XA 5D09A 1VGAA 3E12A 3TK7A 3IVTA 4Z1AA 5DBUA 1QOPA 1TPB1 1SO4A 2TSYA 5HQEA 3TAOA 2CLEA 3M47A 1VCGA 3M41A 2JKAA 2D73A 1WOBA 1OVDA 1EPXA 2GPTA 3QRHA 3WK1A 5HR6A 4O19A 1K7XA 3QYQA 4HNUA 3G8RA 5G5IA 1W37A 5HJLA 3TSDA 4O54A 4LV4A 5EYWA 3CHVA 1KFBA 2TRSA 3TJLA 4JTGA 4A22A 1KFJA 5LSMA 3UWYA 3NL3A 3FYPA 4FX6M 3L5LA 1KFCA 3ABQA 2CWNA 3KFTA 4NNBA 4WY0B 2R14A 3H54A 5H2ZA 1QO5A 2X1TA 4GUJA 5G2IA 3KXQA 4LRTA 2P10A 3F4NA 3MI6A 1TPEA 1YTEA 1P4CA 4JTLA 4FF7A 3M0ZA 3KRSA 4MFDA 2QCNA 3ZR4A 4O11A 3P5ZA 4JD4A 3O07A 1U5JA 1F05A 4M6QA 2QKFA 3CU2A 3WK3A 1SPQA 3U2OA 3NXFA 1H1YA 2WKJA 3VE9A 5SWUA 1XKYA 4PEKA 1WXJA 3BV4A 2HS8A 2XFWA 3W7OA 3A23A 1EIXA 1FCQA 4GJ1A 5LNWA 4IMGA 3NZRA 4KWWA 3MYPA 2Q3RA 4K8HA 1I2NA 3JR2A 1UB3A 1W3NA 4GFSA 4P61A 3QF0A 1W8SA 3M5YA 3R13A 4DELA 3S1VA 5F4WA 2QUVA 1KBJA 5L9FA 1YADA 4O57A 1A5CA 3Q37A 2G96A 3LB0A 4B5NA 3G1YA 1OFQA 2V82A 3GDMA 3HG5A 3ABRA 1ONRA 2ZZ3A 5D02A 2B7PA 4MY1A 5F2MA 3K30A 2A2IA 3W7IA 3QQ1A 1R47A 2VELA 4QJ1A 3WK2A 3I7RA 4DF0A 5AYYA 3FJLA 3O6DA 3S8HA 4UTIA 4BF9A 3C52A 2YCEA 1TTQA 5D2WA 1QO2A 1OYCA 3P74A 4R53A 3C2EA 3WK0A 1WYIA 3E9AA 2NZLA 3B8DA 5DCEA 3I7QA 5D2XA 3LBMA 1SU5A 1NEYA 1RQBA 1IXNA 3AJXA 2C3ZA 3TR2A 2VFGA 5EKYA 1YPIA 3W7MA 1EA0A 1F2JA 3O06A 3GXPA 4XTIA 4TIMA 1Q6OA 3IVUA 2ZRYA 3NPUA 1IGSA 2E09A 2X1SA 4QQ3A 4LVFA 5LKYA 1WOAA 1H7WA 3HO8A 3W1UA 2Z6JA 4IX2A 5BNKA 4FIQA 4DEFA 4CNPA 3VE7A 3SECA 3O15A 3C8FA 1R30A 1OFRA 4LV9A 1H61A 3WJXA 3I65A 1P5BA 1NF0A 4EIVA 3NQEA 5K4XA 2ZZ5A 4JTHA 3MJYA 4O50A 3G1AA 2FIQA 3HQ1A 4RKAA 1MXSA 1JQVA 3SI9A 1TQJA 3O1NA 3VFLA 4O28A 3FKRA 1I2OA 5HUOA 2ZDRA 3P8JA 1HTIA 2YZRA 1FX6A 4MYAA 3NOEA 3F1QA 4O10A 3NQ6A 4ZVJA 3UWZA 1T8XA 5EA9A 4IWWA 3LDVA 3NGJA 3F03K 1S3HA 5LZLA 3EB2A 1RZMA 1XBYA 2GQAA 4M5PA 4ZL1A 1KLYA 3GX9A 5CSSA 5D38A 2V5BA 1FWNA 4I9AA 4NJIA 4LRSA 4JTIA 5HWMA 3TU9A 2Y7FA 4N6FA 4N2YA 3M44A 2X30A 1AW5A 1IXOA 3A24A 1F74A 3BW3A 5AC6A 3NPWA 1PS9A 3KRZA 1ML1A 3TJXA 1Y0EA 2ISVA 2Z6IA 3O16A 3G0SA 1ZENA 3P82A 2TPSA 4UTJA 1FCBA 2BXVA 1M6JA 3QM3A 2OX1A 3C2OA 2V8ZA 3EWYA 4FIRA 3CQ0A 2J9YA 3WJZA 3E96A 4JTEA 3MHUA 4JTUA 1H50A 1KTCA 2JBMA 3G24A 1X6UA 6TIMA 4UNLA 4I7UA 1O94A 4WXYA 1W5OA 1IF2A 2PE4A 2Z1BA 3W85A 2FFCA 2Y89A 4WY0A 3DXIA 1W3IA 4FNUA 2C14A 3QPZA 1VH7A 3LCGA 2FLIA 4Y6GA 1OFAA 2QCDB 3W2KA 2CZ5A 4UFJA 3BG3A 4RZ5A 5BRBA 4HIBA 4GC4A 4UTTC 1KFEA 1TPUA 1EB3A 4IMCA 3LV5A 2YYUA 4JX4A 5G4EA 1RVGA 3DI1A 5J5DA 1TPC1 4YL2A 4A3UA 4UTWA 1AW1A 2GQ8A 5FEPA 2ZA1A 1FBAA 3LLDA 4J9JA 2WPBA 3EWZA 2BWGA 1G7VA 4MZ8A 2CLLA 5DXYA 3C0JA 3FJ6A 4LC8A 3PUOA 5U4NA 4TMCA 1ICSA 2J9ZA 1L6WA 3LRLA 2DP3A 2Y63A 1LLWA 1H7PA 4QNEA 3LXCA 3UWVA 1WDWA 3OVRA 2EPHA 4JYDA 3W84A 3NA8A 4A29A 1JCJA 1EUAA 1QAPA 2WO5A 3DGRA 5D2YA 3TX9A 4RV8A 1GPWA 1SSGA 3BK0A 3C6CA 4UFMA 3YPIA 2WNNA 4Z1BA 4YLWA 1KFKA 3TCEA 1W5QA 3GK0A 4UTMA 2CLHA 5E1QA 3MP3A 4I7VA 4DXVA 4NZJA 1LRQA 1K8YA 3NQ8A 4UIOA 2VEIA 3LHUA 5BMXA 4RXGA 1C29A 1WX0A 5DELA 2YX0A 3GKFA 2B7NA 1JRBA 2NUWA 3UZ5A 1GTHA 3R12A 1O5XA 4FNPA 4MIMA 3W83A 2X1UA 2YGYA 4K37A 1YYAA 2ZRUA 4H4IA 4FXRA 3NM3A 1Q3NA 1SW7A 1T99A 3HG2A 4FX7A 4UFLA 1HO4A 2VFDA 1X8FA 1F7BA 2UV8G 3A22A 3MMTA 4O1CA 3USBA 1IXQA 1LZOA 1I4NA 4MY8A 1TB3A 3S42A 3A21A 3KAOA 1TREA 4DBEA 1RQHA 5DCDA 5CPLA 1VPXA 2W0UA 3E49A 3R5EA 3RK8A 3KVMA 2HTMA 4DPPA 1XUZA 5HR7A 1ZAHA 3GAKA 4LS0A 4WJEA 1OX5A 1B3OA 3P67A 2VEPA 4UTLA 1YPFA 3TFXA 4GUIA 4OHQA 1IIGA 2G5WA 3LCIA 2QUTA 4LY8A 1LORA 4LW7A 2X16A 2V2DA 5CSRA 3QSRA 2Y70A 3EKZA 2CZEA 2H8XA 1AL7A 1ZHAA 2V9DA 3W73A 1LP6A 4UUIA 3LHZA 4HSNA 1VYRA 4JY9A 4O4WA 1CW2A 1TO3A 2H3BA 4E2BA 2P1FA 2FTPA 4YCOA 3G8EA 3LCLA 4BK9A 3EX1A 3CIXA 4JN6A 5MHBA 4LT9A 3W86A 3B4UA 3NR0A 4DO5A 2F84A 4ZQOA 4K36A 2F7FA 3TH6A 4OE7A 4KWVA 4O52A 4FNRA 1KV5A 2Z0IA 4JGDA 1PCWA 4OWGA 1SFLA 4ORIA 3NPXA 2VFEA 2A4AA 4LUIA 1P0KA 3M6YA 1JR1A 1OABA 1H1ZA 3TKFA 3TA6A 4KFOA 2VOMA 4NNAA 4O1DA 4XKYA 3BG9A 1KM1A 3VCRA 1Z48A 2ZA2A 5D04C 3EWXA 4MLJA 2BSLA 1UASA 3L2IA 5D03A 1YDVA 4EVZA 1TPH1 5A8GA 2KZHA 1R2RA 3R89A 4MZYA 3VNDA 3CT7A 3W1AA 1JUKA 4ICNA 2WJZA 5IBXC 3V75A 3LHYA 1TPFA 3W70A 3HJZA 1JULA 1FWSA 4AEOA 1I2RA 1LCOA 1QWGA 2ZZ1A 3P62A 5DLCA 3S1WA 1H7RA 1QFEA 3EX6A 4AWSA 5AHEA 5FEXA 3N34A 5GVJA 1U83A 1SFJA 4GUFA 2XN0A 3W1RA 3S0CA 2O7QA 2QCCA 3N9RA 4DF1A 4WOZA 4Z0JA 1MEHA 3TXZA 3NQFA 5AC7A 3NYZA 3STFA 5CPMA 1SSDA 1J2WA 3NL5A 2ISWA 4X2RA 3MBDA 3ATZA 4O13A 4Y90A 1I45A 1TQXA 1VRDA 1KW1A 1ZCOA 3WJYA 3DHDA 3W7HA 4ZQRA 3MHGA 4IMDA 3LXBA 1M7PA 2IQTA 4LUJA 3EWWA 4K7VA 4RX0A 4FX8A 1GVRA 3LI0A 4JIQA 2C16A 3PB2A 4GUGA 3RF9A 5AOUA 5AFDA 1A5SA 4HHPA 1WBJA 1H62A 3OIXA 4LNYA 1QPNA 1I2QA 4DQWA 2VENA 4PA8A 4XBKA 3W87A 6ALDA 1VR6A 3GZ3A 1BTMA 1FXPA 5DXXA 5FESA 5LGXA 3NM1A 1LOQA 3LTPA 1K03A 1SR9A 2QCFA 4AH7A 4CNNA 1EP2A 1FY6A 1LTDA 3TFCA 8TIMA 1P1XA 4WOQA 3W6YA 1L6YA 1FUYA 3M1ZA 1JUBA 1OJXA 1TIMA 3HGRA 2CLFA 3BGGA 3O6CA 3S5OA 1G4SA 1K7EA 3B03A 1GVOA 3QPYA 4BR1A 1DL3A 4OGZA 4LOCA 4LS1A 4ADSA 1H63A 1Z44A 3MO7A 3MHFA 4XKYB 3PBWA 1X1ZA 1SW0A 4WD0A 3CC1A 2Q3OA 3NDOA 3PBVA 2OJPA 4AMAA 2ZRVA 3NEVA 3BO9A 2R8WA 2E6YA 2VC6A 3SFKA 3NQDA 1XFBA 1W5PA 4GRSA 1FWWA 2RFGA 1HO1A 2J24A 3BARA 2TMDA 3W3OA 4JTKA 1UUMA 3CIWA 3PBUA 5AC8A 3T7VA 1Z41A 3ANYA 3QH2A 2H6RA 1LBMA 1YDNA 2AGKA 3B04A 4ORMA 4E38A 3FKKA 1K3UA 3OA3A 3NL2A 1LBFA 1PHWA 1ZALA 2C0AA 5K7JA 4FNTA 1AG1O 1V5XA 2B0MA 2Y61A 5CPNA 4NXSA 4BI6A 2J9XA 5K4ZA 4N02A 5F1VA 5KITA 1A53A 2Y7GA 2C19A
chains in the Genus database with same CATH superfamily
2CYGA 4XZIA 2FZNA 1VAHA 2VRKA 3STCA 2E28A 1AQFA 3SUWA 3UXLA 1VCFA 1PTAA 4O1BA 2VR2A 2VRJA 1EEXA 1DTNA 5C2CA 4MZ1A 4HN4A 4IX0A 4L7ZA 3HB9A 4XKMA 1UWAA 4MB1A 1H49A 4L4OA 2RHGA 1Q63A 3BDKA 4X2PA 5F2GA 2OWXA 1QW8A 4IISA 4CQ9A 2UWFA 5HNTA 2XIIA 3L68A 3T2PA 4EX4A 3UCDA 4B4HA 1EX5A 3DKLA 2DSUA 1WKDA 1KGXA 5FF2A 2Y1HA 3ITCA 2ALRA 2GVGA 2XPKA 3MU7A 4XZNX 3POHA 3AO0A 4GPNA 1H0IA 3ZXWA 1GJWA 1C8YA 4JPGA 1DV7A 1IGWA 4M7TA 3LEPA 2PWDA 5AB3A 3ARXA 1G94A 3FGCB 4XD3A 3PZOA 4WRHA 3TN3A 1UOKA 4GIYA 1HIZA 2JKEA 2CLIA 1LLZA 3FYOA 4D6EA 3WF1A 3U2EA 3HGOA 3C3NA 3BLLA 2PRMA 4DYKA 1R86A 3FIGA 1WAUA 2J77A 3CTLA 3FFSA 3P61A 1GVFA 1R3SA 4ML9A 1EO7A 3VOJA 4HZ6A 1KLZA 1SO5A 3NJ3A 3TN4A 1J12A 4WGHA 3LX9A 1E4MM 1TTJA 3OEXA 4QS6A 3CXOA 4DYEA 1JFXA 4IIFA 5LNRA 3QOMA 2QMJA 4O1FA 3IGHX 3SCWA 1C7SA 5AHIA 1KFLA 1UROA 3NZGA 1E0TA 3B9DA 3SY1A 2ZFAA 5F2LA 1DE6A 5DRIA 3IRDA 2Y5SA 1PAMA 2GWNA 2YDAA 4NP7A 2ADAA 5JQ9A 3AMCA 2ACSA 2HISA 1PXGA 1A3WA 3DC0A 4G7FA 3EEGA 3EDKA 2GGGA 1J8VA 2YL6A 4JKKA 3LZ3A 3O0KA 3OU8A 3NQ7A 1BHGA 2EKCA 3PJXA 4JXCA 1TKKA 1CZ1A 1XLIA 2VFHA 3FK4A 3KUMA 1D3GA 3FA3A 4NI8A 3BVJA 3FA5A 3PPHA 3OLEA 3N25A 3V5OA 2AKMA 1K8XA 1V0MA 3NL6A 3STEA 2H90A 3VZYA 4HK6A 1SMDA 4XX6A 5EY5A 3VMPA 2J6XA 3VNYA 4JTTA 1Q6GA 4ROPA 1DJXA 3F4DA 4B5TA 1VBHA 4K39A 2XN1A 2J88A 1E71M 3F7JA 5FJUA 4W85A 3VO0A 3B9AA 2ZA3A 2RDWA 2ZX8A 4RXFA 3VNJA 3UFYA 3P2VA 4NX0A 4Z0SA 3AZTA 3IUIA 3A9BA 3CWNA 4OBSA 2DIJA 4U3AA 3C2YA 3RCMA 3OODA 1UD8A 1BD0A 4HT3A 4GACA 4HHLA 1NQKA 4DJEA 3OBKA 4CQAA 1A4LA 4JYFA 3PSWA 5FAGA 4F66A 3TW6A 1DJQA 3GKAA 3BW2A 1HJWA 3MANA 1VPYA 5H91A 4FNSA 3I6TA 3I7SA 4MPQA 3PTDA 1E9ZB 4XZWA 1F61A 4M6PA 1Q2SA 1GOMA 3VMNA 4UFHA 1BYDA 4MY9A 2QCHA 1QPOA 1ZZMA 8RUCA 1JNDA 3AI0A 1H51A 3GHRA 3GHUA 2D3NA 1IWBA 1XUUA 1OFOA 1MEWA 3W7PA 2PI6A 3GR8A 1WUFA 1D8CA 3SJ3A 3HIJA 4LJ3A 2YBTA 1LUCB 3H55A 2NT1A 2GSEA 1WNOA 3AIQA 2VJXA 5A6BD 2CITA 5DMMA 4IMFA 3QGVA 1JDAA 4HK7A 3SIMA 3A5VA 1OD8A 3ONCA 3TNOA 2WXDM 1M7OA 1LQ2A 3TW7A 3A4WA 1TMHA 3OBAA 4ML4A 3VIIA 1UCWA 5A6LA 4PH6A 4A21A 2DZSA 2OB3A 4UB9A 2PDKA 1QI0A 3TMQA 1B5TA 5K9CA 4L9XA 2GJXA 4O14A 5E0CA 4US5A 3BJFA 3AFBA 3VAVA 1UC4A 5BW6A 1W8GA 2E5CA 1O5RA 5CGTA 3DHPA 1BAGA 2GQ3A 3WMSA 2NUXA 3LSBA 4A2SA 3B0VC 5GNYA 1F5ZA 1A5MC 4WIWA 3VDGA 5GJNA 1ZY9A 1VLWA 3W4RA 3ZVHB 4TO8A 4BCEA 3ARQA 2P53A 4QCFA 3NSXA 3FXGA 1CX9A 3VIOA 4RE4A 3WH5A 3ZWTA 4K7YA 3U9IA 3BAXA 3VD4A 3NNTA 4ZR8A 3W07A 4QDPA 1ODUA 3E2RA 2V69A 1BPLB 3BICA 2QJHA 1XLLA 3CL8A 4L5ZA 3T4WA 1C7TA 4Y8FA 4L6DA 3EWDA 3TROA 4L64A 2CZVA 3HPAA 4Y9PA 3I3BA 2Y8UA 1G4TA 3DOPA 3EX2A 1GYLA 4N9DA 5FF3A 4D71A 3THDA 1E9LA 1SFSA 1J0HA 1Q6EA 4CN4A 4QE5A 4O17A 3AICA 5FL1A 2Y24A 1O60A 4PTWA 3QC3A 2AQVA 2VFIA 3M0LA 5HWNA 1W56A 3URAA 3UETA 2B7OA 4Z17A 3EB4A 4KIEA 3WJWA 1QI2A 5I5RA 1MW1A 3JS3A 3N11A 1ALDA 3RU6A 1SJCA 1T5AA 4P8WA 4JL1A 2JIWA 3EOSA 3H53A 3EKGA 4XUGA 4HNTA 1XF0A 5L6UA 2YCLA 4PODA 1GGOA 1G5AA 1OBAA 2OZTA 4GUHA 1FXQA 1XBXA 1YHTA 2V30A 3OZOA 1JZ4A 1KTNA 4HKPA 1CECA 1N55A 2JEPA 4KPLA 5GNZA 5HNNA 3GH5A 4P7NA 1VFFA 4W84A 1KRBC 4K38A 4I9JA 4N7QA 1WPCA 3OB8A 1LWIA 3SQMA 3WO8A 4C6QA 4HNLA 4JFVA 3W22A 1G67A 1O7AA 3LGGA 1MNZA 4L65A 4UC5A 2WJDA 1OSEA 1WBHA 1WUEA 1ICPA 4J3XA 2HROA 1C9DA 4JR5A 2ABBA 1ISWA 1Q45A 1E43A 2X0YA 3WIJA 3VC6A 1L8NA 1LBLA 2BOGX 1GVQA 4J3TA 3N1AA 5LIXX 4ATWA 5IDIA 4HB7A 4KFPA 5REQB 4ZE5A 1CXEA 1T96A 2D23A 3EDJA 2PURA 1LL7A 2G3IA 5D2VA 4RZ4A 1VB9A 1EGZA 2EG8A 3I3DA 2PDNA 1V03A 2PFHA 1SZGA 1A5UA 1P0DA 3N04A 4M8UA 1BF6A 2WKGA 4S3KA 2FH6A 4IL0A 3AUJA 4WSHA 1E4IA 1TWIA 1A5LC 2J75A 3PAJA 4RL3A 3WG6A 3K8KA 4A35A 2O56A 5J5RA 3N3MA 4DO4A 2HV5A 2L5HA 4GBUA 3GNDA 1DWIM 5A8MA 4ES4A 4PMRA 4C6DA 2XJ7A 3NUKA 3NSNA 4E2DA 3GDBA 1VS1A 4GQ0A 5GNXA 4EACA 4LUTA 1NWRA 3XIMA 3PVFA 4YWIA 3DAQA 2VI0A 3QN3A 2NX1A 1DXFA 1Q6RA 1JPDX 3LLXA 1KWKA 3UYCA 4PBFA 3VGDA 2O7SA 4OTKA 3V1PA 3UERA 2HPMA 4X63A 3URBA 9RUBA 3PSVA 3U7BA 3B0XA 1SZEA 3PN8A 5IFPA 2DSWA 1UH2A 5I78A 4GHRA 2QVNA 4RE0A 1WA3A 2CLOA 3WDRA 2OVLA 3RLUA 3OBEA 8XIAA 1B1YA 3LLFA 2QDEA 5BWAA 3M43A 3UJEA 2HXUA 4FLSA 3N2BA 3PM6A 1KFWA 5A6AA 4ZO8A 3W7NA 4MHBA 4XZLX 4W9TA 1GW9A 4HYRA 2W5FA 3L0GA 3W27A 4KETA 2DZUA 5HBFA 4ATLA 1UP3A 5CG7A 3QBUA 3L5AA 1GVSA 3BCDA 1K8CA 1YXYA 3GY1A 3T44A 4BF5A 1HJSA 4XQ6A 3GE7A 3R4IA 4C1KA 4L4MA 3LQLA 5EFFA 2HS6A 2VX6A 1VFTA 1GUVA 3KCOA 3QEZA 2BGNE 2GDUA 2FJKA 1OWQA 4CCDA 3LGEA 4AW7A 2HE5A 3KP0A 1XG3A 4XZ9A 4C6MA 3G2GA 4G1KA 1NELA 5D4YA 1ICQA 2NXHA 1KM3A 2E9LA 2ZYFA 4BQ2A 4TX6A 3PAOA 5F4XA 1KXVA 4EPDC 4JEQA 4FAMA 1RP9A 3DU0A 3MI2A 3C0LA 4UCFA 2OR2A 4QITA 1X1OA 3B3DA 2INZA 1PKLA 1XYBA 4Q8NA 3WN6A 4RDVA 5RUBA 3WFLA 2PLCA 1QMLA 1X7FA 3GWQA 3WQ8A 1DHKA 4O0KA 3WLIA 5D32A 3PANA 4GD0A 2RDUA 2XIOA 3N2TA 3H70A 4JCMA 5PTDA 4MKNA 3KVLA 4PUUA 4AZBA 1F8IA 4UTWC 3E6EA 3WH7A 2WSQA 3L0KA 1DJNA 4R3UA 1TMQA 1EYEA 3VCCA 2XVNA 1XISA 2DY3A 1JDCA 2FDSA 7REQA 1A0EA 3VC5A 3TC7A 1TRDA 4ZTXA 4W8BA 3OYZA 4AHOA 3VX1A 3ZLGA 1UJPA 1F4AA 2R94A 4HQVA 4KWSA 1FTXA 3MSGA 5TD4A 3WEZA 3I6RA 1NQ6A 4FXJA 3UBPC 5C70A 3D0CA 5EPDA 2IQDA 3FX4A 4E8CA 2PD5A 2V5KA 1J96A 4HSHA 3T55A 3L21A 2PB1A 1K9DA 4D6IA 4QG6A 4BFAA 3WNLA 1EJ7L 1DBTA 5FEZA 1BGGA 2A85A 4KWUA 3W74A 1R7AA 2YSWA 3WNKA 4Q8OA 5A6JA 5AHNA 2ZE0A 4IIDA 2E0PA 3BLOA 2GOUA 3APYA 1MDLA 4RDYA 1DYSA 3T81A 4AIOA 4A8RA 1AJZA 5CPTA 3GXMA 4Q7BA 4XD4A 1UD6A 3W01A 3VMOA 2Y5EA 2DVXA 2Q01A 4EPBC 1RK5A 4OQVA 1IT7A 4GZJA 2J8TA 3MSRA 3TQPA 5BOOA 4N4QA 2OOGA 4DB7A 2HSAA 4PUDA 2HVOA 3GS6A 1W31A 1ZTVA 1RCOB 2QGHA 4W93A 2FPVA 3N4FA 3MSDA 4XVDA 3CB8A 4XBSA 4TV6A 3WFZA 3AC0A 3BUVA 1RR2A 3N19B 2CW6A 3DYPA 1PIGA 1EL3A 4IMEA 3GB6A 3CL6A 1QR7A 4A05A 3NZ1A 5I3GA 3MC5A 3JRKA 3TA9A 3W7KA 1GORA 4H04A 3O3RA 2WBGA 5HATA 3THAA 2Z29A 2TYSA 4YTQA 2QHAA 3S5NA 1A4MA 1NSJA 1OFPA 3RLHA 2C15A 2ZTKA 3WLLA 5CZ0A 3UZJA 3L12A 1NFPA 3PZQA 2PDBA 2OZ3A 1KNWA 4XWUA 3UPWA 3OHIA 3F4VA 2BOEX 4AISA 1HL8A 1UZDA 5I2UA 3HMJG 1FWDC 4Z1DA 3CHFA 3D47A 3LHVA 2CFFA 4JQ3A 2X1IA 2EPNA 2VQTA 2WQPA 5A8NA 2AQWA 3WD3A 3RIKA 1LROA 2V5LA 4UTHA 2HEJA 3THQA 1D9EA 1XCFA 5IHSA 2BOFX 3MTWA 5D2TA 1CXLA 3VIJA 1W1ZA 1W9BM 3CZJA 5KSWA 4ZB0A 1K4GA 1V93A 2YCIX 1KM2A 4BEQA 4C6BA 4JQ2A 3SRDA 1ZSXA 2QDGA 4AWUA 4C1NA 4NQ1A 1YNPA 4KESA 1LLOA 4QNWA 3TYZA 1M53A 3HBLA 2ZZ4A 4PEEA 3H26A 4JY8A 4UWMA 2ZBTA 1KQYA 3W37A 1ZBKA 4IL2A 4CD5A 3VUSA 2V0TA 3TNBA 4QISA 5E9AA 1ESWA 3OGSA 4QP0A 3KP1A 4C6PA 2YOCA 4M51A 3EWUA 1XXXA 2ATMA 4BQ4A 1W9UA 1NWUA 4YHEA 3KX6A 4ERGA 2I5IA 5EMLA 1PO9A 3K2GA 1J10A 5D09A 1ZBVA 3E12A 3ORWA 3ZT7A 3AYSA 1DXEA 4GVGA 4OKDA 2D73A 5H8MA 3A4AA 3A3XA 1IZJA 2GJPA 5HR6A 3H12A 1IEQA 4HNUA 5H6HA 1CDGA 4O54A 3CHVA 1YX1A 2INFA 4LH8A 1W9XA 4JTGA 3UWYA 1TE1A 3ARUA 4DRSA 2PP1A 2CWNA 4AC7C 5H2ZA 1S39A 2ZUVA 1ITQA 1QO5A 1RBLA 3UP8A 1DIDA 2WYSA 4GUJA 3AMDA 1JGMA 1E9IA 3MI6A 2X05A 2INEA 4FF7A 3KRSA 1TWWA 3M0MA 1U2YA 1J01A 1O12A 3DG6A 3KS6A 2I5QA 4GY1A 4B2DD 4GY7A 2NQ5A 1AZ1A 3O07A 4DBWA 3VUPA 5E70A 3LY0A 3NXFA 3WQ4A 1TJ2A 1XKYA 2WBKA 5LXEA 2HS8A 1EIXA 4GJ1A 5FA5A 1EJXC 1XSKA 5LNWA 2J7CA 3TCSA 5DO8A 5D8WA 3WKZA 3CZLA 2XIMA 4URIA 3E2VA 3WMCA 2UY2A 5AECA 1W3NA 3CHEA 4PCSA 4GH1A 4GYFA 4S38A 3WELA 2XWDA 4M1BA 3GVQA 3CUJA 4U5KA 7A3HA 1ADDA 5T8GA 1NU5A 1OFQA 4REQA 1UWQA 1BG4A 2Z28A 3OLDA 4DWSD 3FY1A 3GTNA 1UQYA 4C7GA 2XGBA 2B7PA 5D02A 2WMIB 3K30A 4GOAA 2OSYA 4PSPA 3LMYA 4J2PA 4ZO9A 4IT1A 3S47A 4DF0A 3OLIA 4YVVA 3FJLA 3D3FA 3O6DA 5HQLA 1UR8A 2XFFA 5D2WA 1QO2A 1OYCA 4Q8QA 3WK0A 3E9AA 4WF7A 3I7QA 1B31A 3ARPA 1L6GA 3URNA 2EO7A 4WDWA 3VKAA 1AH3A 4I6KA 2DZAA 2DV0A 1UIOA 5EKYA 2DQXA 3DHUA 4ZXLA 4PMOA 2POTA 4HU4A 4E4UA 3GIQA 2Q02A 3IVUA 2X1SA 3WBWA 3HO8A 3W1UA 4IX2A 1TUXA 4HPNA 4GKTA 3GG8A 2PDPA 3WQGA 4RW5A 2OU4A 4DEFA 3VE7A 3O15A 3C8FA 3H24A 1B30A 4LV9A 3E5PA 6TAAA 3ME3A 1RALA 5LIYX 4G9PA 2C79A 2G50A 1B0IA 2ZZ5A 4GKLA 3MJYA 4L1XA 4NZ4A 2FIQA 1D3CA 1JYNA 2WJFA 2CBUA 4H41A 3T0CA 3SI9A 3O1NA 2YLAA 3FKRA 5HUOA 5HMFA 1HTIA 2YZRA 1CLXA 4O10A 3NQ6A 4ZVJA 4ENLA 4D6DA 4J3UA 3N2OA 4H01A 2H9AA 4DN1A 3PZ9A 5A2BA 3F03K 5GJPA 5LZLA 3CO4A 3S46A 2GQAA 1UJQA 4M5PA 4ZL1A 3GX9A 5D38A 1E73M 4I9AA 1UQZA 4H1ZA 4QLLA 3DG3A 2Y7FA 4N2YA 1P7TB 4UQCA 3M44A 3SFWA 1XYMA 4R85A 1AW5A 1IXOA 2WNWA 3A24A 1F74A 4JFTA 1PS9A 3MUAA 1JFHA 1ML1A 1Y0EA 4DYJA 3G0SA 3P82A 4R88A 3W28A 2HBXA 4TVCA 4JTEA 2JBMA 2FDMA 1X6UA 4UNLA 1OCBA 1O94A 4WXYA 2IPFA 2PE4A 2Z1BA 3W85A 2Y89A 1O1ZA 2DUXA 2WZMA 2GWGA 4PZVA 2FLIA 3ITGA 4Y6GA 2O55A 5EMJA 1QNOA 3HU7A 3T2OA 3TYEA 2CIPA 3DI1A 5AYIA 2WWCA 1AQHA 1TPC1 1EIBA 1E6NA 2VL4A 1RK6A 3LLDA 3AWOA 3REQB 3EWZA 2BWGA 4MZ8A 5A94A 1KRAC 2D24A 3FJ6A 3F5LA 1WE5A 4LC8A 1EOKA 3SB0A 5U4NA 3H2AA 1JDEA 1ICSA 2JEQA 1BVNP 1RJRA 4YVPA 2Y63A 2VCAA 4HHMA 4QNEA 3BOLA 2WVVB 3POCA 1WDWA 4A29A 1QAPA 2VD9A 4IQJA 4MWAE 3RHGA 5D2YA 3YPIA 4AUBA 4YLWA 3FVMA 3UJFA 4CD4A 1B3WA 2ZX6A 4J27A 4I7VA 2G3MA 4JQ1A 4NZJA 3M0YA 3WQOA 1RJQA 3PJUA 3TTOA 1XLGA 2NUWA 4UZUA 2GL5A 3E2QA 1OGGA 4RNHA 1NOWA 4JN7A 4J7RA 4DJDD 5IHRA 4H4IA 2YJQA 1SW7A 5LYRA 1QU4A 4AD0A 4IIEA 3USBA 1FHDA 1LZOA 4UTFA 2ANUA 1TFVA 4IGSA 3S42A 4F8XA 3KAOA 5FAJA 4GABA 4AEFA 1XR2A 3NO3A 1MXGA 1J9YA 3KBNA 1VPXA 1FH9A 3R5EA 3RK8A 3KVMA 3WBXA 4DPPA 3CYVA 5HR7A 1WKEA 4LS0A 4WJEA 3VIMA 1KWGA 1OX5A 3FCPA 3P67A 2VEPA 1YPFA 4GUIA 3LBOA 4IM4A 4OHQA 3R7MA 1EJVC 4JHZA 4LY8A 3S9IA 4AX7A 1I75A 4XK2A 5HMDA 2V5JA 4IFRA 5CSRA 3BSHA 4PMUA 4R27A 3W73A 1LP6A 3VDAA 3BGAA 3EGJA 3V0TA 4U3CA 4O4WA 3EDEA 3IAPA 2ZUWA 2OZ8A 3QVQA 1CW2A 2E9MA 3H7UA 2H3BA 4E2BA 3HM7A 4Z2JA 2GDQA 2FTPA 5LA1A 4YCOA 2OEMA 4JN6A 4PRRA 3UJ2A 3O9NA 1LG1A 4K36A 4EAMA 2HVMA 2QUMA 4XSLA 1T7LA 3H2CA 4ORIA 4ERIA 2VFEA 1FWJC 5ENLA 4LUIA 4G56A 4D9PA 3CJPA 3RM8A 2ON3A 1W2VA 4LEFA 3VIHA 5E6YA 1Z8AA 1O1HA 4GZEA 5BWFA 4M3PA 2VOMA 4O1DA 4XKYA 3BG9A 2PF0A 1W17A 1Z48A 1EC8A 4HNOA 4C6IA 4WDXA 4MLJA 2BSLA 2IPJA 2V3DA 2O9TA 1TPH1 2PTWA 1E6QM 2I9UA 5A8GA 5LA2A 2KZHA 1TZ9A 2ISDA 2IXVA 3R1ZA 3WQWA 3DX5A 5A6BA 4PCNA 2YBVA 3V75A 4ASTA 3W70A 3HJZA 2PU0A 2RGMA 2WHKA 4AEOA 2IKGA 1MFUA 5E6ZA 4DZ5A 3TYDA 4HOZA 3A12A 3BMXA 3RG6A 5I02A 4Y8EA 5AHEA 1TCMA 4MTVA 1P48A 4EPKA 3ZQ9A 3S0CA 4DF1A 3NYZA 1Z32X 3PZMA 5CSUA 2ISWA 3AAMA 3GVWA 3ATZA 4Y90A 1I45A 1VRDA 2O4QA 4AU0A 3KEHA 3V0SA 1VFSA 2WJEA 2GJRA 4JIQA 2C16A 4TOQA 4GUGA 7TAAA 2HK0A 5AFDA 1A5SA 1H62A 4OJYA 4LNYA 2VENA 3W87A 2FHFA 2WVSA 3VOHA 2E3ZA 3HQNA 4WDUA 3M0IA 4WKAA 3CLWA 4UQAA 1K9EA 1BTMA 3T05A 1HP5A 5FESA 1LOQA 2E25A 2F38A 2QCFA 4AH7A 4AFYA 1FY6A 2A3EA 1CBGA 3TVAA 8TIMA 1XGEA 4UOZA 3QY8A 5IXEA 1FUYA 3CK5A 3L4XA 1HL9A 3HGRA 4KGJA 2X0HA 4NZ3A 1LT8A 1HXJA 1PKYA 3B03A 1GVOA 1DL3A 1Q65A 5E5CA 3MHFA 3PBWA 2OWWA 2D2OA 2B81A 3PBVA 3VD9A 3NEVA 1EYWA 2VC6A 4QFUA 2YL8A 2ZE3A 1W5PA 4GRSA 2RFGA 4Q8PA 3W3OA 3U57A 4JTKA 1H2JA 1Q13A 2XVKA 3PBUA 4PUMA 3T7VA 3QH2A 5I0DA 1N82A 4GVIA 3H8AA 3B04A 1H5VA 2OLSA 1K3UA 1JZ7A 3WLHA 4WKHA 1ZALA 4QCEA 2XYLA 1EGMA 1V5XA 1SMAA 2B0MA 2Y61A 3AYTA 1JD7A 1BXNA 2HZGA 3ENLA 1JCLA 2DZXA 5E93A 1RCXB 4XTDA 4ZB2A 5CJMA 4AZCA 2WZEA 4MUZA 2NW0A 1XWYA 3D46A 3F4WA 4DM2A 4LPCA 4IFKB 2JK2A 3N15A 3EX4A 2XISA 4S2BA 3PS7A 3N9SA 3W1PA 4WX2A 2VC9A 2A1YA 5AHFA 1PX8A 4W8AA 4IFKA 3GIPA 3SCSA 3NWRA 4DX3A 1P0BA 5AYXA 4NU7A 3N4AA 2AGTA 1NDWA 5KZDA 5T9BG 3N6HA 1MW2A 2QQ6A 1WB0A 4JNZA 4RZBA 1EZ2A 5CZTA 4AD2A 1XRSA 1LL4A 4IQEA 3G18A 3QMSA 2BHUA 2DVUA 4JQAA 1D2KA 6ENLA 4NVTA 4RLIA 2WZHA 2DPEA 3M16A 2X41A 2P3ZA 2ACQA 3P81A 5CPOA 4A3RA 2G3JA 2WHMA 2W79A 1YQ2A 3S1UA 3NQCA 4PL2A 2QDHA 1GG0A 3IJLA 3BJSA 1K02A 2WM0A 1DIKA 4YYCA 4QIUA 1WCGA 3CZ8A 4IXHA 3A64A 4CNOA 4YIWA 1ZQ5A 4PUKA 3B06A 5EBUA 1FWIC 4EK7A 2FVLA 1EX1A 1IR2A 4Y9OA 1FWFC 1UUQA 3LHWA 1PZ1A 4NRRA 4IZGA 1TTPA 3A4XA 3BZGA 4KEZA 3I68A 1DPMA 4ZTYA 4BA0A 4KEUA 3BLEA 5G1YA 2TODA 1PIIA 5IM51 1I0DA 4YCPA 3UPBA 2EBNA 2QLYA 4RW3A 4IIGA 4GVFA 3UESA 3EWBX 4DJFA 1JYVA 2FGBA 4J28A 1HVXA 5I09A 2OLAA 1GWJA 4X60A 2ZUUA 1W9VA 4FXSA 2IKJA 3O6YX 4DNMA 4L1WA 3EXTA 4Q4QA 1KXTA 4LTSA 5KMYA 2QJGA 1FH8A 3W2NA 5D9NA 2C1HA 4RCXA 5KTLA 4JHMA 2VXNA 3UR2A 1K9FA 2A7NA 3PR2A 3WNNA 2XUCA 1Y5WA 4GMEA 1JF5A 3EMZA 5K9XA 1E70M 3L65A 1A5AA 1W0MA 2Q09A 1Z69A 3TIMA 3LD5A 4AC1X 4H3DA 5HMSA 4GNVA 4H8NA 3S5ZA 3VIFA 3B0UX 5AC5A 5E09A 3QMTA 4TVUA 1O4UA 1JPKA 3KW3A 1B2YA 2YW3A 2GGJA 4K1WA 1E15A 1IV8A 1WV2A 3UNDA 3SZ8A 5JUVA 1M7XA 1EBGA 4IOTA 3W2MA 3SN1A 1DWGM 1MUWA 3VNLA 3M7SA 2EEXA 2HXTA 3AYRA 2EQDA 3C4UA 1HQTA 4MJ4A 5G4HC 1LOLA 2GVLA 2V63A 3CH0A 3W24A 3PWGA 3EAUA 1DKWA 2XIQA 5B7YA 3W7CA 1L9WA 4NJKA 3GR4A 4V28A 3P5YA 1RV8A 1B4KA 2HRWA 3R79A 3MUY1 1AMKA 3ICJA 1D8WA 1ISXA 1V3LA 1VLIA 1RPXA 4D6JA 1TIWA 5C5YA 3DN5A 4MJMA 2ZXAA 1AD1A 1ECEA 3BLPX 1CPUA 3WL1A 1PDYA 1JI1A 2YKKA 1GZGA 4LVAA 1U1UA 1HVQA 2FPTA 4JHOA 3KRUA 3TC6A 4CN6A 2DJLA 2W9MA 3RXZA 3PZUA 3WLJA 1H7XA 5CBJA 1EPVA 3LQGA 1V3JA 4GI6A 2BODX 4ZQNA 2GOKA 2BLEA 1XL9A 2PS2A 3HTWA 1JZ5A 4LB3A 2WC7A 1RUSA 3VI2A 3LHTA 4BQ5A 4W7UA 2BG5A 4PTMA 2IXUA 5FOOA 1BRLB 4GG9A 1ZJIA 1OG6A 3W7GA 3M0JA 5DY2A 2QV4A 3WQDA 2H8ZA 2QUUA 4MJZA 5A5WA 1VYSX 1C9WA 1PVNA 1AL8A 3ZJ6A 1N7KA 4PMYA 3GG0A 1ME9A 3BOXA 4F4RA 1VYPX 1FWTA 3QHMA 4C7DA 3A4JA 3R8GA 1RY0A 2J7EA 3ZFHA 1TV2A 1TV7A 2F6XA 3RR4A 2GUYA 1QVBA 4GY0A 3OLGA 1TA3A 4Q8VA 1Z42A 1PTGA 4LWWA 3LCHA 1TZZA 3QQ0A 3I3EA 1J0YA 4Y7EA 3IK2A 4QLJA 3U7VA 2WOQA 4DWSB 1EWDA 5BROA 4WK9A 2IQ0A 2P5NA 6XIMA 4QLKA 4OV9A 4E8GA 3DG7A 3EMQA 4UTKA 2E6DA 1RD5A 4QSFA 2YIHA 1DTUA 1CCWB 3BLIA 1GQJA 4H6EA 1CT5A 3TQKA 1V7AA 2G97A 5A8OA 2AMXA 1IQ8A 4JKMA 1W1TA 1WXZA 2XH7A 1DHPA 1D3HA 3CUGA 2EAWA 3WEOA 3GLCA 3VNMA 3N2MA 3H4GA 4UR7A 3VM5A 1LQAA 3BAWA 3B8SA 2HPIA 4MFEA 2QF7A 2Q8LA 3GZAA 1ZB5A 1YTDA 3AWNA 3RX3A 3KVKA 3N13A 1ECQA 4QXIA 2Z2UA 4HCDA 4TXEA 4XAYA 3SSJA 4DVOA 2FJUB 1VD6A 1N8FA 4MAZA 1P6BA 2VX7A 2BVYA 3GVVA 4ZMGA 3CLMA 1T0OA 1ITUA 3B0YA 5EGRA 5C55A 3W9ZA 4N42A 1B3YA 4X22A 3CM4A 1XSJA 4JTFA 4AIUA 4UMAA 3AYVA 3NXLA 3CMGA 2Y6ZA 3DFYA 2QGYA 2PDXA 3OPSA 3QGKC 1MO0A 3DHFA 2P3EA 4Z2LA 4BI7A 1HKVA 5CKSA 1DORA 2NX9A 1XLMA 4S3GA 4AHQA 3HG4A 5LIKX 1S5WA 2XSXA 3KBWA 1S2WA 3C56A 4O18A 4Z08A 1AZ2A 3FLUA 4ACZB 3EYPA 5M03A 3PJWA 1PKNA 2PF8A 3IGXA 1S5TA 4YU1A 3WDIA 4D2JA 3P6LA 4TX9A 5TIMA 4MYXA 4JEJA 4H83A 4AWEA 1XLFA 3B8UA 1ZNNA 4XD6A 4GWEA 3FYYA 3QHNA 3PNZA 2GK1B 2GLKA 4CQDA 3L4TA 3KCJA 1JPHA 4DXKA 1JCNA 4C6NA 1MQPA 3EKLA 3MZ2A 2FQIA 2A3HA 4IF2A 1W5NA 2VKZG 4ZSUA 2PDUA 1KV8A 4DO7A 3ABZA 1JCMP 4HOXA 1H7OA 1NJJA 3W23A 1V0KA 4KERA 2E8YA 3MMWA 4LEQA 3WBEA 4EXBA 3DH7A 4EWJA 3UWEA 5CQ1A 2WLZA 4N9EA 1I60A 1TX0A 5HULA 1VPQA 3MJMA 2GGHA 1UR9A 4H7CA 4LUYA 4N6EA 4AG0A 4AB4A 1IIHA 4AHPA 4ACZA 2QIIA 1DWFM 4KS0A 3ARVA 3IJ9A 3GXTA 3W2UA 3NURA 1VHNA 2BNJA 3RO6A 4Z2HA 2OT0A 1DWHM 4XO7A 3W7LA 2PA6A 1W1B1 4AZ5A 5C7VA 4F40A 3HG3A 2WV8A 4IP5A 1O66A 1KGWA 1Z6KA 3AXIA 2E68A 4EWND 1XFCA 4Q8TA 1V6WA 3DEQA 4B3LA 3A5FA 1PDZA 4GE8A 4C6CA 2RAGA 4INFA 3L66A 2WSRA 2WPGA 2CXEA 2ALDA 1DWAM 3EDFA 3HGJA 3KZPA 2A5HA 3TTEA 1C8VA 2PDCA 3P93A 3QZEA 4NF7A 1DJWA 3AROA 3S5YA 4MB5A 4RNFA 4A6GA 1AQMA 5K3VA 3E5BA 3BAIA 3DFTA 1FHLA 3G1HA 3DFOA 1Q7MA 1IEVA 1UR1A 1XIFA 2Q8XA 3P84A 1FQ0A 4E4PA 3PFRA 1UR2A 1FH7A 5HNUA 2ZADA 2A6LA 2ZUMA 1BLIA 4Q33A 1TA3B 4CNSA 5AHLA 3CO8A 1UC5A 3T0DA 4K6AA 3UZYA 1R3VA 3U2CA 3ZOAA 1SQ7A 5I3HA 3URQA 2P8CA 4ZO7A 3UGVA 4DZAA 4FHAA 1EH9A 4EOUA 1GJPA 2R24A 3SY5A 2G37A 1XLEA 2DT1A 4KH2A 2DSZA 1GW1A 3QR1A 4PUNA 3DUGA 3SGUA 4KCWA 4FEZA 3Q2DA 4LNCA 3MP5A 2DDXA 3WNOA 4CVWA 1TV5A 4WQ6A 3QY7A 2OQLA 2QJNA 3IIOA 1WDDA 5JMUA 4U28A 2EF9A 1VIZA 2OQHA 4GISA 3WF2A 3PG8A 5BRQA 1EFZA 5CC6A 3KCLA 4F3HA 1W1VA 1QDSA 2VZSA 1JPIA 4D6HA 3WF3A 1G7UA 3PWAA 4CGTA 2PP0A 1EP3A 4UCGA 2NQHA 4I6VA 2JF6A 1W54A 3SN0A 3IJ6A 1THFD 4CNTA 3LNMA 4I5UA 3LCFA 3R58A 1XH1A 3MVIA 3UEQA 2C1IA 2DVTA 1JCXA 4JOMA 2DH2A 4UXDA 4M1RA 4D6CA 1MSSA 3MV01 1CXHA 3G6MA 4GQBA 1JYWA 3PWIA 4E2OA 3VIKA 4US5D 3VDBA 4YTTA 1HNYA 5I00A 2PWUA 1KBIA 4JYEA 5G2HA 1KD0A 3TV8A 1PV8A 2YYTA 3TEVA 4G2DA 3GHSA 2PTXA 2GDVA 4C1NB 2ZZ6A 2FVMA 4PC8A 1PB0A 3L5MA 4NX5A 1L2UA 2CPUA 1P7TA 2BY1A 2X2YA 2ZRXA 3NPVA 4L6HA 4DIAA 5I24A 3S2NA 3GH7A 2ISFA 5JIPA 1CI1A 2VR5A 5D30A 1KXHA 3P0XA 1FCUA 2YR1A 1Z9AA 3ZYZA 3QLLA 4LFYA 5AHMA 2QCMA 3S5SA 4WXZA 4O8RA 3LXAA 4ICCX 4IGMA 3RJXA 3L2MA 1OYAA 4GI4A 1QOQA 4YHGA 4WY0F 3PTMA 5JBFA 4CLMA 1LOSA 5HDRA 1TWSA 3CEPA 3RLVA 2AAAA 3OJGA 3W2LA 1YXCA 2EGZA 3PZIA 4BHYA 3GNNA 3K8LA 4RZ6A 1EWEA 2W62A 3DERA 4OFCA 5LGZA 3KVJA 5T26A 4H9TA 3W7QA 5FSEC 3LTSA 1JZ2A 4GJJA 3T40A 4IPNB 4GIAA 4LYKA 3UZZA 1E56A 1RY8A 4UOJA 4Y9AA 1XW8A 3AXMA 4JX5A 3SGZA 3UF9A 1VEPA 4UTUA 2MNRA 4LU0A 3WF0A 4IGHA 2WVUA 2OGJA 4LY4A 4PB4A 3IV3A 1W1PA 2DFAA 3GG1A 4FR1A 2I14A 2NQ9A 5HPOA 3W81A 4G6CA 1X6NA 3PUEA 4V27A 3LERA 2ZZ7A 3BLKA 2Z4GA 2PGFA 3CH9A 5ABTA 5FJJA 5DCBA 1KRCC 1A5BA 1ONEA 5FL0A 2PLMA 1OIMA 2VGGA 3TLLA 2J27A 4N9CA 3S1GA 1GONA 3VKJA 3ARZA 3H6OA 4NZFA 1I1XA 1FDYA 2XVLA 3LI1A 4ZQMA 2PCQA 1A5KC 1YLVA 5TBOA 2OZ0A 3T9PA 2Z1KA 2QS8A 1TG7A 1BSIA 1R7OA 4G7EA 1HGYA 4LAMA 2IS7A 2O9OA 5FEWA 3DGBA 2Y85A 3AHYA 3E0WA 1DWJM 1QW9A 2ZDSA 1EJWC 3UXKA 1ZAIA 1ZJAA 2FZDA 1ZLPA 1UPPA 1CB2A 5MKGA 3G3MA 3LU2A 2QCDA 1S1PA 2XM1A 2EPKX 3IJDA 1OY0A 4MPKA 2DIKA 1V6VA 4B5XA 2V81A 4FB7A 1IXPA 3C61A 4O8AA 4F79A 3E0IA 3MP4A 2F6UA 1SO6A 2EXOA 4NZ1A 2R91A 3TQ0A 1TV4A 2X2GA 1F8MA 4XISA 5A8QA 1GEHA 1VBRA 3WJSA 3R0UA 2FMNA 1WAWA 5DX7A 4IPLA 2W27A 3PF3A 4F0SA 1U1HA 1GOIA 1J0IA 4IPJA 1WQ5A 2YFOA 4NJJA 3SRFA 2VCCA 4AXKA 4YTUA 4TUFA 3G1XA 3BOFA 1VGAA 4Z1AA 3IVTA 1TPB1 1VJSA 1SO4A 5C7HA 4AEEA 5ABFA 2CLEA 1GK8A 1BTCA 3CQKA 5CEWA 1WOBA 2AQOA 3MMDA 3OZYA 4ZEPA 1OGSA 2CHNA 2GPTA 3QRHA 3WK1A 4O19A 3PZGA 3Q67A 3QV8A 5G5IA 1Q2RA 1W37A 5EYWA 3KE0A 2TRSA 1K9TA 2BHYA 4ZENA 2Z1SA 3NL3A 1Q4WA 3ABQA 4NNBA 3VDHA 3ZJKA 5CJ5A 2R14A 3H54A 3LNPA 2VURA 3UVIA 1MUMA 2X1TA 1QK2A 1H1NA 1LG2A 4GH3A 4JTAA 5G2IA 3PTKA 4LRTA 4XZHA 3GU2A 4QAWA 3VABA 3BJTA 4NI3A 1TPEA 4IFOA 1YTEA 3AQUA 1UZ1A 1DIEA 1P4CA 1XPGA 3TOYA 2ZVIA 2QCNA 5GQBA 4O11A 3UW6A 1A3HA 1F05A 2XH4A 4M6QA 5BXTA 3T8LA 1UKSA 2ZUTA 5D8ZA 3L2LA 1E40A 1HN1A 3NZPA 3V36A 3JZEA 2X0SA 2OO0A 3FEQA 4MNKA 2UZ9A 2DSVA 4K8HA 4PB3A 1YEYA 1UB3A 3AALA 4Q8WA 3QF0A 3WDQA 3WLQA 3VVGA 1UWUA 1V3KA 3Q37A 2G96A 2ICSA 3ZSTA 1JI2A 3C0QA 3ARSA 2W67A 3ABRA 6REQA 4KRUA 4L61A 4E6MA 1R47A 1BXBA 1OCJA 4R7OA 2BV9A 4QJ1A 2OYLA 3MCNA 3I7RA 1D7KA 4ZXOA 3WK2A 4MWAB 2WSKA 4OIFA 1MFVA 1X6LA 2A79A 1XP3A 3CGTA 3HMCA 3H2OA 3B8DA 3F5KA 1IE7C 5D2XA 2PTDA 1SU5A 1RQBA 3V4BA 3AJXA 4H7VA 1F2JA 1B3ZA 3GXPA 4TIMA 1IGSA 2IPWA 3ONBA 3U3HA 1H7WA 1CXKA 3AIRA 2E4TA 4NKCA 3GYCA 2PDMA 2Z6JA 1J0ZA 1Z7AA 1ZU8A 3IPWA 5BNKA 3RITA 4MM1A 4PRWA 1R30A 1OFRA 2DW6A 3WJXA 4WKFA 5ABEA 3I65A 1M41A 3WMBA 5K4XA 4JTHA 2BFGA 3C5QA 3G1AA 2Y4SA 3T0TA 3QV7A 2VVNA 4DHGA 4J5NA 1JQVA 2VQUA 1TQJA 5AY7A 1FKXA 3TLQA 2ZDRA 3VTRA 2MUCA 2W92A 4MYAA 1QNSA 1LL6A 1T8XA 3SBFA 1VIWA 1XYZA 4I8YA 1Q66A 3WMLA 5C71A 5HJXA 1W1YA 3LDVA 2C0HA 4CU6A 4WGXA 1XSIA 5CSSA 3NOYA 2IMRA 3LPFA 1UD3A 5HWMA 3TU9A 2PU1A 4JIIX 3BW3A 5AC6A 1WDRA 2GYIA 3NPWA 4S39A 4TQTA 4XAPA 3N2CA 1KCLA 2ISVA 2R1NA 2Z6IA 1T41A 1XCXA 3LPPA 1RPKA 1BF2A 2BXVA 4F2BA 1M6JA 3QM3A 2OX1A 2G3NA 4UQEA 3EWYA 1E3ZA 4AX6A 1H50A 6TIMA 1W1IE 1W5OA 2YDQA 2ZX7A 2PD9A 4DUXA 4KW2A 4WY0A 1Y5XA 1YNQA 4FNUA 1US0A 4GX9A 3LCGA 4B5UA 1BVZA 2CZ5A 4UFJA 3P14A 3GHTA 3WLPA 2IUZA 1EB3A 4IMCA 3W6MA 6CGTA 2YYUA 3EOLA 4JX4A 5G4EA 3VIPA 4OUIA 5J5DA 3CV2A 4XSMA 1I0BA 4U5IA 4H2CA 1R9ZA 5FEPA 1FBAA 3VKKA 1FHUA 1C91A 2WPBA 1G7VA 1E6ZA 3BL3A 1NWSA 4PMQA 3OTRA 4AD3A 2GFTA 1JYXA 1MWOA 2ZUSA 1LLWA 1DE5A 3LXCA 2I16A 3OVRA 3TOPA 2PGRA 3ARWA 4HBKA 5CGMA 2WHLA 2VO5A 4GJIA 3OA5A 3DGRA 1OD0A 1E1EA 5I3DA 1SSGA 4UFMA 3E3HA 1S1RA 1PZ0A 1NP0A 3K8MA 2XIJA 1IWAA 3DESA 3SCOA 4I5RA 1J0JA 1K8YA 3RJYA 1TUFA 1ZP3A 4RXGA 1R3QA 3GKFA 1MMFA 3AOFA 4AXNA 4KBXA 3GH4A 1PZ2A 4W87A 3R12A 1Z3NA 3W83A 4OOZA 2FZ9A 2X1UA 2RUSA 7REQB 4AD1A 1S38A 4XAFA 1EXPA 1JL8A 2AL2A 2E9BA 4UFLA 5KZ6A 1RAKA 1X8FA 1F7BA 2A3LA 4ZFCA 1XCWA 2J7DA 3MMTA 4O1CA 1V3IA 2D0HA 2I7GA 3APGA 4MY8A 1TB3A 3A21A 1TREA 1HJQA 5CPLA 4UNIA 3ITVA 1E5NA 4QBXA 2BXZA 1ZAHA 1R3WA 1PUDA 1B3OA 4Q4PA 4E5TA 1KO0A 4UTLA 3TYCA 5M3WA 2I5GA 2G5WA 1HJXA 2QUTA 3LCIA 4H9MA 3WLKX 4LW7A 3QSRA 2Y70A 3WY1A 2CZEA 2VMFA 1PTDA 2V9DA 1FP8A 4UUIA 3S2LA 1NFGA 3W82A 1ZGDA 4JY9A 3KWXA 2Y8VA 1V6TA 3CS2A 5HAOA 4TTGA 1TR9A 2E8ZA 2P1FA 4ILSA 4WLCA 4R9OA 1X39A 5MHBA 3W86A 4DO5A 1OGBA 1AJ0A 1E1CB 2F84A 2ZX5A 4ZQOA 1JAEA 5EU9A 3TH6A 3WD1A 1QI3A 2ZUNA 4XZMX 4B9YA 2YDSA 1EDQA 2FGLA 4MWAA 1G1YA 3G77A 2ASHA 1V02E 3M6YA 1Q6FA 1MI3A 4D6FA 1OABA 1H1ZA 1XS2A 2CNCA 4BZYA 3WQFA 3VCRA 2ZA2A 3WBAA 3L2IA 5IDZA 3EWCA 5DANA 1J11A 1R2RA 4A3QA 4FOJA 4QDMA 3UNTA 3S3GA 1E4LA 3BMVA 1TPFA 1KBKA 4GZ7A 1FWSA 1LCOA 1QWGA 3P62A 3S1WA 2ZXDA 4CUCA 4FP1A 1H7RA 1CGXA 1SFJA 2O7QA 4WOZA 1MEHA 3NQFA 3WLSA 3SUSA 3VIGA 3CL7A 1PX4A 3A3WA 3UJSA 3IV8A 3VXGA 1J2WA 4FMVA 4W5ZA 2SFPA 1WZLA 1RVKA 4X2RA 2J47A 2XFRA 4UZSA 1KW1A 3RR1A 1SJDA 2FTWA 3WJYA 4PMZA 3W7HA 4ZQRA 2X8RA 5BU9A 4AZ6A 2IQTA 3LN3A 3UG5A 5C9UA 3EWWA 3LI0A 2X42A 5A2AA 5AOUA 1WBJA 1QPNA 1I2QA 4GCXA 4PA8A 9XIMA 3QQWA 2CLPA 3GZ3A 3MQTA 2PZ0A 3BCFA 3KBSA 4O0QA 5DXXA 3EA1A 4FLRA 3NM1A 2WCGA 1UZHA 1B54A 1LTDA 1E55A 4W8LA 3GW0A 4DJFC 1L6YA 3F2CA 4H8VA 1OC5A 2WSPA 3ZLFA 3TJIA 3S5OA 3O6CA 1G4SA 1S5NA 3NIYA 4Z2IA 1VRXA 3WNPA 1W2PA 4BR1A 1FVPA 3SCPA 4ADSA 4IH3A 1F3XA 3MO7A 4QTGA 1UOZA 4XKYB 1SW0A 4WD0A 1QJWA 3CC1A 2RJGA 2EG6A 2Q3OA 2OJPA 4IICA 3BO9A 4X0NA 3XINA 3TR9A 3SM0A 4JFSA 2J8FA 4P7RA 2BBFA 3BARA 2TMDA 2J7HA 3CIWA 4DUOA 1F9CA 1UG6A 2BDQA 1Z41A 2WLYA 1Q4NX 4WHBA 4C6OA 7XIMA 2AGKA 1OQFA 4ORMA 3W25A 3T6CA 4E38A 2XZ7A 3NL2A 1LBFA 1PHWA 4E3VA 5K7JA 2HVNA 1E9YB 5CPNA 4PUJA 3QKZA 2D2JA 3FDGA 4N02A 1A53A 4JIPA 3KTSA 4AYGA 2CU0A 4GINA 2ZWZA 3E02A 1ISYA 1ADOA 1CTNA 5DBTA 4WZHA 1J93A 1RLDA 3IVSA 4GK8A 2AAMA 4D8AA 2PCEA 1SFTA 3FA4A 3U4AA 2NV9A 3UG3A 4ATDA 2OCZA 2ZTJA 4HU3A 4BEUA 3QSTA 4F2TA 4IJBA 4HA4A 1HFBA 4E3TA 1AQ0A 4CQBA 1XH2A 5CGQA 4RE3A 4PCFA 2VGIA 1QUMA 1UA7A 1ONWA 1QPQA 3QGAC 3AS2A 1OF6A 1A0CA 1M7JA 3BAYA 2VZVA 2FB3A 3CBWA 1DJIA 3SEPA 3UXDA 1K6AA 3JW7A 4UMCA 1HW6A 1ZFJA 6PTDA 4U10A 1FFQA 2ZICA 4DZHA 4PL1A 2WNQA 1EJUC 2R9RA 2NWSA 2DT2A 4LC6A 3W76A 1TPDA 4N4PA 3SQLA 1PHQA 2QCLA 4I3GA 2QPSA 3FEMA 3TE9A 4QJ4B 3WYZA 3STGA 4JKLA 2VFFA 2YXXA 1CLVA 4BY3A 2Q6ZA 1NAL1 4G1NA 1P6WA 2E40A 1DQXA 2X09A 2WWDA 3MDUA 5HPCA 1J5TA 4WUIA 4KCTA 5A69A 3W26A 4DBUA 3ZSSA 3R0KA 3N73A 1XGDA 4H6QA 4XVEA 3W2JA 3IACA 1BSLA 5A6TC 1W91A 1WZAA 4P8XA 3W29A 4EKJA 2WVVA 5G2WA 2XVPA 4H8HA 3KOXA 3K1DA 4DZIA 2QV5A 4JCLA 3DZ1A 3RMJA 2RH9A 6REQB 1SM9A 2YB4A 2PDLA 1B90A 2PTZA 2YXOA 3IJ8A 1M01A 1YNYA 4YMZA 2ONEA 5CAHA 3LMZA 2JALA 2FZ8A 3S6DA 5D9PA 4Q8MA 5CC7A 3SCNA 2PWGA 1GYMA 4JTRA 4DM1A 5I23A 1V3MA 3W88A 4Q4SA 3GIYA 1RQEA 1IEXA 3CNYA 4MDOA 4Q32A 3CAWA 1WKFA 1HT6A 4M6VA 3WQVA 4KMQA 3TONA 3EEZA 3DI0A 4G5DA 4PMDA 5CZKA 1KKRA 1S46A 2P8BA 2HDJA 1UYQA 1SVDA 1UKOA 3GXNA 3MSYA 3IIXA 3GVRA 2QT3A 1FA2A 3PY2A 2JQXA 3VZZA 4Q6JA 1QTWA 5AN7A 3V3WA 1GVIA 2NX3A 3OIHA 1NOUA 1FWAC 3EXRA 4IJCA 3AIUA 3WENA 3QOKA 2YBUA 1O6IA 1MW0A 3DIPA 1VHCA 3M64A 2NXIA 1QNQA 2XN2A 1Q6LA 4DF2A 2J6VA 1F4HA 3F5JA 3UYIA 3G1DA 4FSAA 2XG9A 1KM6A 1IT0A 2PDHA 2H9AB 2MANA 2NQJA 4CU7A 3QLDA 3WCZA 4I7WA 5J8LA 1TR1A 1R3YA 1VCVA 4ALDA 3NYDA 2V2CA 5C6MA 3IGSA 4ZGYA 4LALA 2XSBA 2VRQA 4I90A 3W1QA 1IYXA 3VD5A 3OYXA 2V2HA 1G4PA 2XGZA 4HNVA 1XC6A 3FOKA 5AYZA 4ROQA 3GC2A 4J3WA 5EMMA 2RKXA 3QZ6A 1R2TA 5DEZA 1XIHA 1LRTA 2OMAA 1F6PA 2ZWYA 4GI8A 3ISIX 4HMEA 1J5SA 1XIMA 4IPIA 4AWTA 3K4AA 4A3HA 2WMKA 2Y88A 3MB9A 1YE6A 3IEBA 4O53A 4DAFA 1R9XA 3FJ4A 5BRPA 5JH1A 2A3CA 1BEUA 4NNCA 5HINA 3VK5A 9CGTA 4RPPA 5F4SA 3FS2A 2GGIA 5ECUA 5D33A 1ME8A 3B40A 3SRKA 1WKYA 1M3UA 4TR9A 3FV9A 2ZX9A 1PL9A 5FI8A 3HFYA 1Q5MA 3II1A 2E5BA 3OVPA 4UFIA 3LM3A 3W72A 1DP0A 1HG3A 4HA1A 4IPPA 2WMIA 2J7BA 3DCPA 5D9MA 4LAZA 8CGTA 1VQTA 3CPGA 3VX0A 3SCTA 3AIEA 1W5MA 3UD6A 1FWRA 2CXGA 4K8EA 2P0OA 4KCVA 4BJHA 2C13A 4LYQA 1ZPTA 3DBNA 2XH2A 1V79A 2GVJA 4LF1A 1OF8A 2OSXA 2PBGA 4IP7A 1JDFA 2E6FA 2HK1A 4WR3A 1KBBA 2BVTA 2Q8ZA 4MB3A 1E0XA 4L4LA 3N6QA 1F3TA 2D0FA 4ZZ9A 1RCQA 3BGJA 3AS3A 3ERPA 1VEMA 2QAFA 3H21A 3CWOX 3K1GA 3ALFA 2OEKA 1NDYA 3PK7A 3BPWA 3O7UA 3B8TA 2CZFA 2G41A 4AMCA 1PZ3A 3H2FA 4X3ZA 2E77A 1DJYA 3UA3A 1XD1A 5EL1A 4LBUA 1BG9A 3WDJA 3LRKA 3OZPA 1DQWA 4GYPC 3ZLHA 3QXBA 4J3ZA 1LDCA 4DJEC 1GKQA 4MOZA 1NTHA 1DOSA 1OK4A 2EPMX 3PULA 1NARA 3WH8A 3DECA 4JFWA 2XZ9A 1LYXA 2EKGA 4EF9A 1K7FA 1DEDA 2QYGA 4OU1A 5G1TA 3RX4A 2ZC8A 3E2SA 1ME7A 1JVNA 3G3DA 2B4GA 3M7WA 3RCYA 3SN4A 2C91A 2B7QA 3QJAA 3LPOA 3PHAA 2NWRA 5BZAA 1Q8JA 1XPYA 4QX4A 4C5YA 2W6RA 2HMCA 4B9ZA 2NQLA 3KBVA 4JNMA 1XDJA 1OM0A 4LYPA 1EF2A 2Y7DA 3C8NA 1VENA 1J6PA 1CB7B 1XC4A 2NV1A 3EOEA 2ZVRA 4NJHA 1QI4A 1PKMA 4CEUC 3COTA 1CXFA 4UMBA 2BTMA 2PDYA 4GXMA 4QQUA 4E0CA 3VZXA 2H3DA 1O5KA 2Z1XA 3LCXA 4RDZA 4LUTB 1GTEA 3G1VA 1C90A 3UG8A 3QHOA 1NOFA 2QR6A 3BW4A 3N14A 1NFBA 3LS9A 2BY0A 2LLEA 3NQGA 1UKTA 4MJ2A 3OP2A 4YN5A 5FJPA 2HNEA 3MT1A 2Y7EA 3KRBA 4NRSA 1HL2A 3G6LA 1CGTA 1H4PA 1SGJA 3NCOA 3ABSA 3APTA 1ZAJA 2W66A 3LOTA 5FF7A 3U4FA 5C9XA 3DBPA 2DJXA 2F9RA 5F2IA 3W1MA 5HWJA 3MW7A 3W1NA 3UY8A 2G0WA 1TSIA 1H11A 2GVYA 4NJGA 3S83A 4ZBCA 2WC3A 3QR3A 2ISSA 5DY3A 4B92A 4O12A 3NAVA 1B3VA 2AL2B 1JG9A 3OW1A 3RUBL 4ICMA 1IWPA 3IJQA 1YIXA 2GJNA 4QSHA 1CENA 4UR9A 4FI4A 4AAJA 1EKOA 4ZQPA 4FO4A 4I9TA 4MNMA 3T78A 4C65A 1WDQA 2J25A 1T8QA 5U7SA 3ZIZA 3R8HA 3KZSA 4PFHA 3FAXA 1NVMA 1VBGA 4BWLA 2BGQA 2C1GA 4B15A 4HVXA 3VD7A 1R87A 2QJMA 1XBZA 3SDOA 4BI5A 3P80A 5FJTA 4DI9A 4JNYA 4HZ7A 3WUGA 4JDBA 3LYEA 4ZE4A 3WEMA 1TELA 3KTXA 2DQWA 1JCTA 4AQLA 1V02A 3BV7A 3INPA 3S2CA 1QPKA 3LPGA 1TV3A 4W89A 1V77A 1J4EA 2B31A 1M9HA 1OINA 1UBSA 1XBVA 1QRQA 2JGQA 4UTTA 2QCGA 3WBYA 4HTYA 3M0KA 2C71A 3HQPA 1UA3A 4J3VA 1L8PA 1V08A 3VNIA 3CV7A 3H2MA 5A3HA 5I7GA 3L67A 3EB3A 4CCCA 2VEKA 1ISVA 3GUWA 3L4WA 3IIVA 5JU6A 4DBDA 4R9XA 3GBEA 1I8JA 3THUA 3PBYA 4LBSA 1TV8A 2VEGA 2E6AA 1MZHA 2ZC1A 2REQB 3AZRA 1TCDA 2X40A 3W75A 5HJYA 3LCWA 1FRBA 1V6UA 1ZJHA 2FTYA 4ECLA 5C54A 2JKPA 4Q22A 2OGYA 1TMLA 1PCKA 3GNPA 1QHOA 3S6OA 4HCHA 1E3XA 5HMEA 3RNDA 5TAOA 2RDTA 3OG2A 1XDLA 3MVTA 3KBJA 3ATYA 3SADA 3IIPA 4LAOA 1FDZA 2Q71A 4UQDA 3GFXA 4NAEB 4K2SA 4ACYA 1AJ2A 1C8XA 5JXQA 5K2ZA 4LAUA 4AIBA 2QJIA 4MAVA 1J18A 2CBJA 2J7GA 2WW5A 1A50A 1XM3A 2JE8A 2GK1A 1R3RA 3O2LA 1XRFA 3DYOA 4Z2GA 2A7RA 4HZ8A 4PB5A 1ZL1A 1UMYA 5LIWX 3LBCA 3WLOA 1EJSC 2OSWA 4NZ5A 3ZVIA 2WCSA 4PTNA 5H8PA 3P7YA 4FNQA 2I17A 2QUNA 4YPJA 4C1LA 2CLMA 2D2HA 4JDYA 4MWAC 3GDTA 4FK9A 4MG4A 2PGWA 1GOOA 2PRHA 1J0KA 3R11A 3KHJA 2BZNA 4LUSA 2NV2A 3PPFA 3KL3A 4JN8A 1WO2A 4MUPA 3B97A 3T8QA 4HCLA 3W0KA 1JZ6A 3B9NA 1E0UA 3VOFA 4R33A 4XZBA 2V3GA 3RPDA 2W63A 4FOKA 1WZKA 5HUPA 3O6AA 2EPOA 4L80A 5LHEA 1EEPA 2QZRA 2G3FA 1X8CA 4CQ8A 3TSMA 3UGRA 3R25A 3T07A 3CEUA 5I3JA 3WSUA 2F8QA 3CPUA 4AIEA 4MMWA 2J7FA <