1XCFA

Crystal structure of p28l/y173f tryptophan synthase alpha-subunits from escherichia coli
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
267
structure length
238
Chain Sequence
b'MERYESLFAQLKERKEGAFVPFVTLGDLGIEQSLKIIDTLIEAGADALELGIPFVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNKGIDEFYARCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGFTYLLSRAAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Structures of wild-type and P28L/Y173F tryptophan synthase alpha-subunits from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 82
structure length 238
sequence length 267
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1xcfA00
2Q8LA 4UTHA 1S5TA 1YXDA 5G5IA 3M7WA 1TQJA 1Q6LA 4TR9A 4JTFA 4UR8A 2KZHA 3G8EA 4UTLA 4NJKA 1A50A 2RDWA 2C1HA 3DFPA 3HJZA 1HTIA 4NX5A 3S8HA 1QWGA 1XM3A 1CI1A 3EWWA 4O4WA 4FF7A 3UQNA 1H63A 4FNUA 2O7QA 1SZEA 3SFKA 3W1PA 3UY8A 4A3UA 5K7JA 3I6RA 2A85A 3P81A 2FPYA 1TPC1 2QCLA 5C2XA 3O1NA 4QJ1A 3M5XA 3DFSA 4PTNA 3FIGA 1KA9F 1KTBA 3OVPA 3ABQA 4FX7A 2X16A 3NL2A 1JRCA 3VKJA 1SFLA 1NF7A 3L0GA 4UNLA 1FDJA 1RQEA 1F05A 1I4NA 2B4GA 2QF7A 4K7VA 3W1QA 3W87A 4ICNA 2G95A 4O14A 3W7QA 2C15A 4AH7A 4K39A 1DJQA 4A22A 3CC1A 1GTHA 4RXGA 1NF0A 1OX4B 1FWWA 4WX2A 4DBDA 4GRSA 2NWRA 4NU7A 1K03A 3LV5A 4PEKA 2ZRWA 4UFHA 1TTIA 5AHNA 4Z1BA 1W5MA 2CU0A 4O52A 4IXXA 1AL8A 2E6YA 3NOEA 4JIPA 5FF4A 3MI6A 3E12A 4JTJA 5MHBA 3GAKA 2R91A 3BLFA 3GDMA 4FXSA 3C4UA 1YADA 5IBXC 2FPTA 1PE1A 2TSYA 1IIGA 3MHUA 3FKRA 2VFIA 4LS0A 4UFIA 2YCEA 4LWWA 1IXPA 2Y6ZA 3LLFA 3LRLA 3IIVA 4GC4A 1XUUA 3W7PA 3B0VC 4UFLA 4FHAA 2QJIA 1M7PA 1E51A 1VPXA 2CLLA 4H4IA 4LVGA 5AC8A 1FXQA 1M5WA 4KFPA 3CTLA 1O95A 4HSOA 5D2TA 3W88A 3O06A 1VH7A 4YCOA 3B05A 3P84A 4UMBA 3GVGA 4GJ1A 3JRKA 1TJRA 1OFPA 2JGQA 3DBPA 2A7NA 4X9SA 5HWJA 1EPXA 2C14A 1KM0A 4FEZA 4BFAA 4ADUA 3UXDA 3QEZA 1BWLA 5EMUA 3QYQA 3R8RA 1HUVA 1TREA 3NGJA 3NVTA 1B57A 3PB0A 3DU0A 4IMDA 3GXPA 1V7YA 3NZRA 3DFOA 4YLWA 1OFDA 3QZEA 2X1UA 3ZWTA 5CSRA 1W8SA 3KRUA 4JTEA 1S5WA 3TW6A 3C61A 2H8ZA 3P5ZA 2Z0IA 4KWVA 4AWSA 1X8FA 3M41A 3TFXA 3W1NA 5BMXA 5DCEA 5F2GA 5KZEA 1EP3A 1TRDA 5F2LA 1P0NA 1KM6A 2J24A 2W0UA 5CZJA 4LY8A 3RU6A 4AHOA 1KFBA 1TPB1 5AHMA 3M5VA 3O6CA 2CWNA 5EBUA 2XN2A 4M19A 1KM1A 3HGJA 3QMSA 4LUJA 5F4WA 3LTYA 1OF6A 2VFEA 1KBJA 4QAIA 4FIQA 3FJ6A 4NQ1A 3GR7A 4CQAA 5AHLA 3GLCA 1DVJA 1JQVA 3S1WA 1R46A 3DZ1A 4EOUA 4Z08A 3NQFA 4DPQA 4PA8A 4C1LA 4I7VA 2QKFA 2YYUA 4HNTA 2FDSA 5F2MA 3WJZA 4PC8A 3MW7A 3PULA 1AG1O 2YYTA 2CZ5A 2Q3OA 4A29A 3ZR4A 1JQXA 4CCCA 3MWAA 3FKKA 4PL1A 5C54A 4JDBA 3S6DA 3QPYA 1SO3A 5D2VA 1N55A 1GVFA 1AW2A 3TX9A 2V30A 4IOTA 2WKJA 1XUZA 3PBUA 1TPEA 4EF8A 4FXRA 2WV8A 5L6UA 2FLIA 3MBDA 3LHUA 4JXCA 1LTDA 2JKEA 3QPZA 4N9DA 1QNVA 2QUTA 2Y7FA 4JY8A 1FUYA 3BG3A 3G1SA 4TMCA 2B7QA 1WBJA 2ZZ4A 1JCJA 3RFAA 3W2JA 1L6WA 2Z6JA 3C0JA 3C8FA 3NL3A 4PL2A 4OWGA 3HGOA 3R5EA 4JN6A 3A23A 1TTPA 2A6NA 3LCLA 1EUAA 1SW7A 2OX1A 4KFOA 5CPMA 1VZWA 3KRZA 1VYPX 3L5AA 4HKPA 4ZMGA 4UTKA 2BLEA 3W22A 4Z0SA 3RK8A 3WJWA 1LROA 1KFCA 3R12A 2BWGA 4NJHA 3QW3A 1HO1A 2QR6A 2BX7A 5HWMA 5D33A 2C0AA 2VEIA 1B3OA 3EKZA 5D2YA 3PSWA 1W31A 2V8ZA 1OABA 4M6VA 3QQ0A 3KOFA 3EXSA 3NQAA 1KTNA 3C52A 3TSBA 3BW2A 1LDCA 3N2MA 4UC5A 2G97A 3NYZA 3BW4A 4O18A 3W7KA 2VENA 3PWAA 3EWXA 4AMAA 5I3HA 1G7VA 2ABAA 1QCWA 4KKXA 2R14A 5D04C 5EY5A 5HWNA 4MYAA 1HL2A 3W23A 1JJKA 3S5YA 5DELA 4L4MA 4JS3A 1MEIA 5D05A 3OIXA 4MZ1A 4JD4A 3HOJA 3W76A 4O28A 3BLIA 2Y85A 1ZAIA 5DCDA 4ZVJA 3W2UA 3IIZA 1OFRA 4IWWA 1DBTA 3PF3A 4JIQA 1QPQA 3S5OA 4ML9A 5CZSA 4AF0B 2CLKA 3M16A 3O63A 3E49A 4RZ6A 2RFGA 1XI3A 3A5FA 3R13A 3NQ8A 2DZPA 2ISSA 1QOQA 1WOAA 2Y7GA 3LCIA 1TYGA 5LNSA 1TQXA 3A22A 3LRKA 5LSMA 3VE9A 3Q58A 3CLMA 4DF0A 4Q4KA 1TPVA 1H1ZA 3DHFA 3MP3A 5AC6A 3EX3A 3GDLA 6ALDA 3S1UA 3W1XA 4FB7A 1M6JA 4RZ4A 3WJYA 1EX5A 1ZJIA 4MY1A 5C55A 4OE7A 2RHGA 3EWYA 1MXSA 3RLUA 1F7BA 4CLMA 5CKSA 3C2VA 4E2DA 1F6PA 2HS8A 4K7YA 1W56A 4MLJA 2BZNA 1O60A 1YTDA 4BI6A 5J5DA 5LGXA 3P5YA 2E6AA 2Y70A 5F4SA 4BK9A 3CIWA 2X1SA 1TCDA 4M5PA 4HSNA 5U4NA 3TXZA 1P5BA 3N14A 4WZHA 1EWEA 1G4PA 2FFCA 5K9XA 2VEMA 3CEPA 2Y62A 1TTJA 5FEXA 3FLUA 1K3UA 3AO0A 3GIYA 3NQMA 5LZLA 1BEUA 5FI8A 3T78A 1N7KA 1YXYA 3A24A 1W3IA 2CLFA 5D30A 3P82A 3TW7A 2E1DA 1TPWA 5DXXA 3IGUA 1L6YA 2EHHA 1UB3A 1OF8A 3WK0A 2I1OA 3UWWA 5D38A 2EGZA 4HNVA 2CLMA 1MZHA 3WJSA 3N34A 1W5QA 4BI5A 3B4UA 4Y90A 4O57A 3TA6A 3HBLA 1JCMP 2DZUA 2YW3A 3V1PA 3TU9A 2ZZ2A 2OCZA 4ZZ9A 3GDKA 5FEPA 3W2LA 3IVSA 3QRHA 2NX1A 4M7TA 4O53A 2WO5A 4GFSA 2CLIA 2DZSA 1P1XA 4POCA 3C56A 1DQXA 4JTLA 1FDYA 4OV4A 3M43A 2XN1A 1Q6RA 3IGSA 1TRIA 3M0ZA 1PVNA 1D3HA 2P10A 1MEWA 4WXZA 1H60A 3EWUA 2ATSA 1T0OA 3C2EA 3LM7A 1KTCA 3FFSA 3W1UA 3EX6A 4MFDA 3THQA 3CT7A 3N2XA 2QDHA 1RZMA 1WQ5A 1JULA 5G1YA 4CNPA 1SSGA 4ADSA 3YPIA 1PCKA 1DV7A 2DU2A 2EPHA 1FCBA 1XC4A 1XXXA 5I3GA 1UBSA 3HMJG 5GVJA 1EWDA 1OHLA 3TK7A 3P67A 4XTDA 2V82A 3F4WA 5TBOA 4WY0F 1W5OA 1J4EA 2C18A 1G4TA 1IXQA 4WQ6A 5AHFA 5D2XA 4I7UA 2CZDA 2EAWA 4AAJA 2QUVA 3MHGA 4OT7A 1ZALA 1OVDA 1XBZA 5HR6A 3S1XA 3P74A 5DXYA 3NZ1A 4AF0A 3DENA 3NQDA 5AOUA 3WK1A 1I2OA 4K8HA 1SU5A 3P62A 3QF0A 1QO2A 1VYRA 2ZCGA 1Z42A 5FF7A 4N6FA 3BARA 4HNNA 1OFEA 3ATYA 2NUYA 4ZQMA 5F4XA 3ZFHA 3EWBX 5FEWA 1FXPA 3CPRA 3Q94A 1JUEA 1F2JA 1VCFA 1TB3A 3DFQA 3PVFA 2H6RA 2ZZ1A 2HSAA 3L68A 3RLVA 4EF9A 2QAFA 3B06A 4WD0A 4UNKA 1TV7A 3N9RA 5I3IA 1LOQA 3WJXA 1G6CA 4EWND 3PY2A 5AHIA 4RV8A 5D02A 1JCLA 2VELA 1PHQA 2RKXA 3E02A 2J6XA 2ZTKA 3GK0A 2C3ZA 4MFEA 4JDYA 2E09A 5HUPA 1PHWA 5AYYA 1YDNA 1WBHA 1DQWA 3O6DA 1IF2A 1UCWA 2QCCA 3NL5A 1K02A 3SI9A 3GKAA 3KRSA 3HGRA 4JX4A 1Y0EA 1RVGA 3NQ2A 2A2IA 3NEVA 2Y7EA 3PG8A 5CGQA 1ME7A 4JYFA 3HG4A 3NM3A 2R94A 2GVJA 1OFBA 4LS1A 1GVSA 1JVNA 4G1KA 1G69A 5KTLA 4JNMA 3L9CA 3KVKA 3QFEA 3W2KA 1TSIA 4O0KA 2NX3A 4LVBA 3EXTA 5A8GA 3W7HA 4DO6A 3PBVA 4EVZA 1ZNNA 3EB2A 3NPUA 4AXKA 3W1LA 3T40A 1W3NA 4MVAA 4QISA 5G2HA 1I2QA 3STGA 3LBMA 3NAVA 2GVLA 4OHQA 4XTIA 4IPJA 2EKCA 3UZ5A 4FX8A 1GYNA 2VFFA 3WK3A 4JX5A 1T96A 4LRTA 3NQEA 2V2CA 3LTPA 4UMCA 4FNQA 4JYEA 3S5ZA 1EEPA 3QMTA 1TV8A 1DL3A 1KM2A 3W7DA 1A5SA 3TC7A 2XFWA 2RDTA 1QOPA 4LUIA 4N2YA 4LTSA 3LCHA 2YR1A 1JR1A 2CW6A 3UY7A 2TMDA 3AJXA 2QDGA 4R53A 1I8JA 3M9YA 4JR5A 4LV4A 3T44A 3MJYA 3Q37A 1XDLA 1LYXA 3DI1A 1BTMA 2VEPA 2QEZA 1RD5A 4NUWA 1ICSA 1ICPA 1WDWA 1DHPA 5IM51 4NJGA 3TNOA 4AEOA 1NFBA 5DBUA 6TIMA 3VNDA 3ABSA 3LLDA 1T99A 2R8WA 1OFOA 3QSTA 1VGAA 2PRMA 4WY0B 3TSMA 2QJGA 1SUXA 2NXIA 5AYZA 1VLWA 1W3TA 2RDUA 3I65A 4IPIA 1DOSA 4XBKA 4DF2A 5KINA 4GXMA 3UWUA 2CZEA 1KV8A 2V5BA 4A2RA 3D0CA 4AHQA 3S42A 4QSHA 1M7OA 2DP3A 1G4EA 3W70A 3SY5A 2GQAA 2C16A 5EPDA 4XUGA 4GUFA 1XBVA 2NXHA 3LXCA 4RXFA 4Z0JA 5EL1A 4LS2A 2NV1A 3ABRA 1LLWA 2Y7DA 3W07A 2QCFA 2O7SA 1H51A 2ZA2A 5G2IA 3NXFA 2NZLA 5LNUA 3NQGA 4I7WA 4WUIA 3S5NA 1XKYA 5F1UA 2DZTA 5AFDA 1R47A 1VHCA 3O15A 3QM3A 4O50A 3LRMA 4K38A 2ZRZA 3DH7A 4N4PA 5CPOA 2GQ9A 1FX6A 2P1FA 1VYSX 2WPBA 4NX0A 3LCGA 1TO3A 4S2BA 2YW4A 3L5MA 1YPFA 1UUMA 3BV4A 4L4LA 3CHVA 3HPSA 2DZXA 4DXVA 3EX4A 4O1AA 1FCQA 3UWQA 1ME9A 1EIXA 3GNDA 4Z1CA 4FNTA 3H54A 5HQEA 2ABBA 1OX4A 3EX1A 3M1ZA 1ZHAA 1TPDA 1X6UA 1DKWA 3MP4A 4UTWC 2ALDA 2IQTA 1KFKA 3M5YA 2GJLA 1RPXA 7TIMA 1OK4A 1Z44A 1W0MA 2GJNA 4MKNA 3TQ0A 2LLEA 1S3HA 3FYPA 2ZZ5A 3LXAA 1H7WA 1TMHA 4FO4A 3TJLA 2E5BA 3L2IA 2PURA 1WV2A 3GB6A 5DCBA 5C5YA 1YYAA 4IMCA 1PS9A 3KXQA 2A7RA 3W74A 3MHFA 4IUOA 1GVOA 4H3DA 3IVUA 4TO8A 4GWEA 3NQCA 5HJLA 3IIPA 4NJJA 1LRTA 3G3DA 4TU1A 2TYSA 3SW6A 3CIXA 1XDMA 2V0TA 1GWJA 3T55A 1XBYA 3MI3A 1YXCA 2B7NA 2BTMA 3MO7A 4GUHA 3W7MA 3LCXA 4O16A 2QUUA 3MYOA 5E93A 3N3MA 3O8AA 3KVJA 3EX2A 3W2MA 4WOQA 1O94A 4K6AA 2YXGA 1LCOA 3NM1A 3O05A 2A21A 3UZJA 1FY6A 1FCVA 2GQ8A 4NNBA 4O15A 3N19B 1XCFA 1ZAJA 2XN0A 1TPFA 3HG5A 1ZAHA 2A6LA 2PRHA 1TPH1 1KFLA 4UTWA 5FF3A 4LVDA 3OA3A 1JCYA 1GG0A 1RQBA 1NEYA 5HMSA 4S2CA 4PCFA 2OZ0A 3F4NA 3KHJA 3O16A 4AWTA 1R2RA 2JKPA 4BWLC 4WY0A 1LZOA 5LGZA 1K7FA 3A5VA 1KLYA 3T7VA 5BRBA 1ZY9A 4ONVA 4WXYA 5FESA 5EA9A 1KM4A 1OX6A 4LC8A 1VRDA 4HHPA 2C19A 4UIOA 1QPNA 4E0CA 2FB2A 8TIMA 4K37A 3SJ3A 3SZ8A 3STFA 1PCWA 1TJPA 1I45A 1W1ZA 4UFMA 4P61A 3IVTA 1V5XA 3C6CA 1H7OA 4R33A 3PSVA 4XZ9A 1UUOA 4LT9A 3LBCA 4GUGA 3UWZA 3ZS4A 1KM5A 4HT3A 4Q33A 3GXTA 5G2WA 1SW0A 4X2RA 5K4XA 5DN1A 4N9EA 1YTEA 2NXGA 2Z6IA 4DEFA 3LB0A 2V9DA 3U8GA 4BI7A 1L2UA 5D09A 4MJZA 1FWRA 2H3BA 4BWLA 2W6RA 4JGDA 3UD6A 4NZFA 4JEQA 4HN4A 1SZFA 3LHWA 2YDAA 1LRNA 2ZYFA 1YDOA 2FPVA 3M47A 3C2OA 2ZFAA 1CX9A 2Y63A 3TDFA 2Z1BA 3KAOA 2F7FA 5DY3A 4IQLA 2OT1A 3PG9A 3G1XA 1K7EA 2ZZ7A 2E6FA 1MO0A 4QNEA 4YMZA 3N73A 5K9CA 3HB9A 3B8DA 3MMTA 1UASA 5DY2A 2PRLA 3JS3A 4KFNA 2Y89A 3UWVA 5DLCA 2TRSA 3W7OA 3DHDA 2QCNA 3W7RA 4A2SA 3BVJA 5LNWA 5FF0A 4TX9A 1J2WA 1TTQA 4P2VA 2QCEA 2GVGA 4BF9A 3KVMA 3U6WA 3I7SA 4CQ9A 2ISWA 4JICA 4O12A 4RJEA 1XBXA 4MZYA 4CCDA 1WA3A 3OHIA 3IEBA 5AYXA 3QQ1A 3PB2A 3E0IA 1MSSA 3UNDA 3B0UX 5CZ0A 3NPVA 5C6MA 3FEMA 4LU0A 4QM1A 3ELFA 4IMFA 4JX6A 4B5NA 4OGZA 4UUIA 2OMAA 2WNQA 2GUUA 2X2GA 5G1TA 3TIMA 3MBFA 3G0XA 3M44A 2WOQA 3DKLA 1LOLA 2WJZA 2WNNA 3GR8A 5K3VA 1QMLA 3DXIA 3CEUA 1QO5A 3GXNA 2UV8G 5HR7A 5D32A 1F76A 3FYOA 1Z48A 3PBYA 2NUXA 4FNRA 4O19A 1WXJA 4IMEA 4NXKA 3TV8A 2W79A 2AQWA 3R89A 3G1AA 5KITA 3STEA 4ZQNA 3LHTA 1VHNA 2G5WA 4O11A 1EP1A 4XQ6A 4MOZA 3RMJA 3E9AA 3CM4A 2ZZ6A 4PFMA 1HG3A 3LHYA 3EWZA 1VC4A 2ZA1A 5CPLA 4OU1A 1DORA 2ZBTA 2DJLA 4FNSA 3U2OA 1SO4A 5D37A 4IX2A 3W71A 1UJPA 3W72A 5D03A 4GUJA 3EKLA 3BG5A 4ZQRA 4W9TA 1VR6A 3S0CA 5K9DA 1GTEA 4O10A 3W7CA 3TUUA 5CZTA 1T8XA 2ZRXA 3LHVA 3KFTA 1R2TA 1Q3NA 3DAQA 4FIRA 3L0NA 2HS6A 2JBMA 5LNVA 3LI0A 2RH9A 5BNKA 1A5AA 3V75A 1FBAA 5AN7A 5L9FA 1F73A 3L21A 1KFJA 3B0PA 3HPZA 2A1YA 2NV2A 3F1QA 4UCGA 2Y61A 2ZA3A 2YGYA 2DZVA 3GX9A 4XKYB 1NSJA 5I3KA 5HULA 4YCPA 2FQIA 2A7PA 3NQVA 3A21A 1X1OA 3NQ7A 4Z1DA 4NZJA 2CLHA 1K8ZA 1ML1A 4JTSA 1Q6QA 3UPWA 4DQWA 3BGJA 5HUOA 3W2NA 5TIMA 3ZWSA 3MI2A 4LNYA 2D73A 3PUDA 3SSJA 4N6EA 1AW1A 3LXBA 3W7GA 4ADTA 3VCRA 4O1CA 1U5JA 3BW3A 3LHZA 1VS1A 3MP5A 1SQ7A 2ZRVA 4O13A 1VLIA 4IMGA 3E96A 1KM3A 1U83A 4UFKA 1R30A 1X7FA 1A53A 3W85A 4LOCA 2GPTA 4HIBA 4N02A 1IIHA 4NNCA 1W54A 4MYXA 1KBIA 1LBFA 1O5KA 3CU2A 1O5XA 2V2DA 1SO6A 5CSSA 1GJPA 4UFJA 1C9DA 2B7OA 1H7XA 4Y96A 1O4UA 4UMAA 1PL9A 4UR7A 2CFFA 1VCGA 1PV8A 3LCFA 3W3OA 4TIMA 3L67A 3UWYA 3NNTA 2PCQA 5KZDA 4R7JA 4MLRA 4ZQCA 1I2NA 5LHEA 2C13A 3WK2A 3W7NA 3TQVA 3KVLA 2DORA 5A5WA 3W83A 3DFNA 1H7NA 1GEQA 4OBTA 1FWTA 3FS2A 5BOOA 4Y8FA 1F5ZA 1JCNA 1ALDA 3P80A 1LLZA 2WSYA 3G24A 3L66A 2CLEA 3CWNA 5CPNA 4RX0A 4NJIA 1GZGA 4GBUA 1SW3A 3SECA 3I68A 2ZQ0A 3W1RA 2FTPA 3OG3A 1AL7A 3DI0A 2PE4A 5ABTA 1ZENA 2B7PA 4RLIA 3QH2A 1GG1A 3IGXA 3BG9A 4MJMA 1QR7A 2YZRA 5F1VA 1H61A 3NPXA 1OYAA 4AVFA 2WSQA 4XWUA 1K8XA 1L9WA 3FJLA 3NPWA 3W7JA 2YFOA 1Q6OA 3LTSA 2GOUA 4MIMA 3NDOA 4O1BA 1GT8A 2J9YA 3S9YA 4IX0A 2HMCA 2QCGA 2QCDB 1H62A 4K36A 3BLEA 3L5LA 1QAPA 3PM6A 1W5PA 4JTGA 2QJHA 3GKFA 3VFLA 4DO5A 3Q2DA 4QNWA 1TV5A 2FIQA 2ZRYA 4DO4A 1GYLA 1WOBA 4DF1A 1OK6A 1XL9A 4JTIA 4JTTA 3PUEA 3TSDA 5J5RA 4Y6GA 3QMRA 5T26A 3WFAA 1D9EA 3H53A 3TFCA 1HFBA 2JKAA 4JTHA 3HPXA 3MYPA 2WQPA 3PS7A 3LV6A 1YPIA 4NNAA 3QC3A 1LOSA 4UXDA 3UPBA 1AW5A 1D3GA 4ORMA 4PODA 5IBXA 3GNNA 1WYIA 3NR0A 4XKYA 5AHEA 3QSRA 1C8VA 4LV9A 3LI1A 3LERA 4AB4A 2ZDRA 3M6YA 3OVRA 1EB3A 3NL6A 4LC6A 3W7LA 1LBLA 1RR2A 1YTKA 2ATMA 3JR2A 1LRQA 3P8IA 3CWOX 1IXNA 5D2WA 1B9BA 1P4CA 2PC4A 3TMQA 2B0MA 4O54A 4GE8A 3LDVA 1K8YA 2E5CA 1F74A 2X1TA 3LOTA 3C2FA 4WJEA 3P61A 4AWUA 4O8RA 4J9JA 1SZNA 3FA5A 3M5ZA 1ICQA 1EA0A 1FDZA 1R2SA 3G22A 1NAL1 3G1YA 4RR4A 4S1FA 5TQLA 5F2IA 4LVFA 1HO4A 3TKFA 2G96A 4UTIA 3OVQA 4UTJA 5BMWA 4CCEA 4M6QA 1JUKA 3GDTA 4Q32A 2A4AA 1GPWA 4ZQOA 3K30A 5KSWA 4K8EA 1LORA 3OBKA 3G0SA 4UTUA 3STCA 3LCWA 2E68A 3NO5A 1SPQA 4QQ3A 3GAYA 4DBEA 1W37A 1H7RA 3O07A 4N9CA 1JRBA 2YX0A 2VKZG 1L6SA 1LP6A 4X22A 3SR7A 3UYCA 3W75A 3LX9A 1FWNA 2YPIA 3ATZA 4HPJA 3UXAA 1GVQA 2J88A 3HG3A 3BPWA 1JUBA 3W7EA 1H50A 2V5LA 1MEHA 2P0OA 3W1TA 5KZMA 5G4EA 1KW1A 4JY9A 2A0NA 1OFQA 2HTMA 3B04A 4RK8A 4ALDA 3PAJA 5E0KA 3W1AA 1K7XA 3P8JA 3HG2A 2H8XA 4JYDA 4U4MA 2EF9A 4YL2A 3MUXA 4MY8A 4BR1A 1G7UA 3PBWA 1VQTA 2QCDA 3TROA 3DKJA 4UTTC 3TQKA 2JK2A 1ZCOA 3DFTA 1A5CA 1H5YA 3P60A 5AC7A 4O17A 3W9ZA 3NQ6A 3BK0A 2J27A 2WNZA 4NVTA 4YXGA 1X1ZA 5FF2A 2V2HA 3VE7A 2NWSA 1OJXA 1C29A 1BKSA 2FB3A 3EXRA 1QDSA 3THAA 3NG3A 5H91A 1OYCA 3B03A 1YDVA 1N8FA 2WSRA 3W73A 4O0ZA 4LRSA 3IV3A 4I9AA 2OJPA 1PIIA 3HGSA 1I2RA 3I7RA 1FQ0A 4RZ5A 4ZQPA 4CNNA 4MY9A 2AAMA 4ZL1A 2I9EA 1B4KA 1JCXA 4M7SA 1EUNA 3TXVA 3ANYA 1FWSA 5EYWA 5CG7A 2AGKA 4NT0A 4RCXA 1IXOA 1SZGA 4A21A 2CLOA 4FNPA 1GVRA 4C1KA 2FJKA 4X3ZA 4OQVA 2ZZ3A 3TAKA 1EP2A 2VXNA 3QJAA 4IJBA 3TAOA 1OG0A 1ZFJA 4DPPA 4GNJA 2VFHA 4UTMA 5H2ZA 3HQ1A 2QCMA 2OT0A 1GQNA 3SGZA 1B4EA 4UTTA 1VJIA 4HPXA 4N4QA 1H1YA 1KFEA 5KMYA 2QCHA 3NA8A 1YLVA 3O6YX 3R2GA 5BW6A 1XFBA 1Z41A 1NVMA 2Q3RA 4MUZA 1AK5A 2YFNA 3IIOA 2X1RA 2BSLA 3TC6A 2V81A 5E1QA 1BWKA 4N9BA 4TMBA 2F84A 3BGGA 4WOZA 1W5NA 1J5TA 1SFJA 4H6KA 1CW2A 2ZTJA 2TPSA 4QIUA 2JGYA 3PUOA 3A9IA 4QITA 4LW7A 1P0KA 3TCEA 3ABOA 2DJXA 3TJXA 2X30A 3G0UA 3C2RA 3CB8A 2Q8ZA 4D2JA 1ADOA 2VEKA 3G18A 1SR9A 1KLZA 2NLIA 4LVAA 4AHPA 4M6PA 4O1DA 4XBSA 1QFEA 2E5DA 2DZWA 1SO5A 4ORIA 2QAPA 4CNOA 4FX6M 5K4ZA 4GUIA 3DGRA 3W84A 4Z1AA 5I3FA 5U7SA 1G67A 4CQ8A 5DBTA 3SGUA 3T4CA 3L0KA 5I3JA 3QW4B 3W1MA 2NUWA 3TMLA 5LNRA 3IRDA 3OEXA 4IXHA 4KWWA 5SWUA 3W6YA 4PH6A 1ME8A 1S5VA 4IGHA 2ZRUA 4EIVA 3W86A 3GZ3A 3PR2A 1RV8A 1IGSA 2VFGA 3G8RA 5HNRA 3S1VA 4YWIA 1OYBA 2CZFA 3HF3A 5EKYA 3KX6A 4JTKA 3SIZA 3H55A 2E6DA 3RF9A 1SSDA 4E2BA 3I7QA 5LKYA 4RKAA 1QPOA 3G3MA 3INPA 1I2PA 2VFDA 2VOMA 1TPUA 5K2ZA 1AMKA 2H90A 2NX9A 4MZ8A 3FOKA 1QPRA 3N9SA 1A5BA 2Y88A 1F6KA 3W7IA 3TH6A 2YSWA 1THFD 3PC0A 3VI2A 3HO8A 4JTUA 3G1VA 3GDRA 3LGEA 4O4VA 1RQHA 3GYEA 1VCVA 2VC6A 4MPQA 1DJNA 2J9XA 1WAUA 3G1FA 4U28A 3HIJA 3C3NA 3F03K 2Z2UA 3BO9A 3USBA 3TE9A 1Q45A 3G1DA 5LHFA 4NXSA 1OFAA 1TIMA 1KV5A 1LBMA 2ISVA 3P7YA 3RNDA 5HINA 2H3DA 1ONRA 4Y9AA 1G4SA 1H7PA 1OX5A 3EEGA 5G4WA 3TR2A 4R34A 2A5HA 3G1HA 5FEZA 1FCUA 5AB3A 3IIXA 4DELA 2J9ZA 4E38A 4OV9A 2BXVA 2E77A 2I14A 3L65A 4HNUA 3CQ0A 1GOXA 1LM1A 2C6QA 1WX0A
chains in the Genus database with same CATH superfamily
2Q8LA 3AS3A 1UR3M 1YXDA 4CQCA 4RNHA 3TYAA 3F5KA 1AQFA 1MUMA 4NAEA 3M7WA 1W3LA 3DYMA 2R1NA 2KZHA 2V3GA 4NJKA 1A50A 3HJZA 2C1HA 2OQLA 2J25A 4EPBC 1HTIA 4QDWA 3KBJA 4O4WA 2C1IA 4PE8A 1E9ZB 2V69A 1OCQA 4I5UA 3VOGA 4CU8A 4XV0A 1TWZA 5K7JA 3I6RA 4ZO8A 3AFBA 1W32A 3SFWA 2ZC1A 4QJ1A 4FALA 3DFSA 1RXOB 2YB4A 4XZWA 5BOFA 1FDJA 1YE6A 4GVGA 4QEHA 3KOWA 1QNSA 3GSMA 4K7VA 3WUEA 4H8HA 2BHYA 4K39A 3SQLA 3IJ7A 4A22A 3OLIA 3LN3A 3GXMA 4RXGA 2ZX7A 4TVDA 4LUTA 1K03A 4Q7IA 1V3HA 2WBKA 3ARSA 4REQB 2CU0A 4Q8VA 1TR1A 3CS2A 5T9CE 3URQA 1XIBA 1T8QA 1AL8A 2E6YA 5CC7A 3NOEA 1UQYA 3HQOA 5I24A 3GAKA 1JZ5A 4BS0A 2R91A 1TUXA 3GDMA 2VWTA 3UP8A 2TSYA 4O8AA 2P8CA 1NWSA 3NSXA 4LAMA 1W8GA 3M0MA 2DFAA 4LS0A 2EO7A 1DJGA 2FZMA 3ES8A 4C6FA 3F7JA 4LWWA 3RX4A 3TOPA 2Y24A 3LRLA 3VFCA 3IIVA 2O9RA 3B0VC 3T0BA 3AIQA 1E51A 1VPXA 3SUVA 2XH2A 2CLLA 2DDXA 4LVGA 5AC8A 1UZHA 1M5WA 1X39A 4KFPA 4HSOA 4A8RA 1J6OA 5D2TA 3GH4A 3W88A 2OKOA 1OZMA 4YCOA 4J27A 2PDIA 3B05A 4IIEA 4GJ1A 4IFKB 3NIYA 1T7LA 1S5MA 3E2QA 5BROA 4CKQA 1KM0A 5A6KA 2E0PA 4YVVA 2PDLA 3WIJA 1UD3A 4FS9A 4BF5A 3QYQA 3NGJA 5A8MA 2QMKA 2GJRA 3CTTA 3DU0A 3NFUA 4O1FA 1V7YA 2V5KA 4YLWA 1OFDA 3QZEA 3TW6A 2ZC8A 2H8ZA 3P5ZA 3FNDA 4AWSA 2XGIA 1EJXC 5H8PA 5DCEA 1A5LC 4LEFA 4XVDA 4DUOA 3QVQA 4KERA 1P0NA 2J24A 4AHOA 1O7AA 3RCMA 3WLLA 1YBQA 3QYSA 5EBUA 3SSZA 4M19A 1J10A 5F4WA 3VC6A 1GOOA 1OF6A 3PFRA 3FJ6A 1L8PA 4NQ1A 1DVJA 1HX0A 4GI8A 4CQDA 2O4MA 2ESCA 3DZ1A 1DWGM 3I3BA 2WLZA 3NQFA 2DVUA 4DPQA 4PA8A 4C1LA 5ABHA 2YYUA 1L6FA 3Q65A 3K1DA 1KBBA 2G50A 3BH4A 2PWVA 2FDSA 4PC8A 3PULA 1HW6A 3WQDA 1OCJA 2P88A 3FKKA 3GBEA 3F4VA 4PL1A 1UROA 2PPGA 5C8BB 4JDBA 3K1GA 1CGYA 4EF8A 1MFUA 2CBVA 2WV8A 3AWNA 4MKVA 1HN1A 3VMPA 1FUYA 4LCQA 3QY8A 4TMCA 3BICA 1JCJA 3UR7A 1KFWA 4Q8PA 1XYMA 2A3EA 3A23A 5HNTA 4EPEC 4KCWA 2OX1A 4E8DA 1VYPX 3VOHA 5A8QA 3L5AA 4Q8OA 2BLEA 2XVPA 3W22A 1OD8A 3WF4A 2Z25A 4KQNA 4C91A 2HPMA 3WLQA 4MNLA 4C6PA 1HO1A 3VKDA 4TXEA 2QR6A 5HWMA 1Y5XA 3OZOA 2VEIA 4GH3A 3VIMA 3EKZA 5D2YA 4M6VA 4B5VA 4L80A 3NQAA 4IT1A 2YCLA 3NYZA 4O18A 3M0KA 4OKDA 3PWAA 2XINA 2WMJA 3EWXA 4AMAA 3RYSA 3GG1A 5CH9A 5EY5A 5D04C 4JFUA 2WVVB 1E72M 4MYAA 2Z1SA 1HL2A 3W23A 2REQB 4PTWA 1JJKA 3SDOA 3LMZA 1K6AA 3QZAA 3KM8A 5DELA 4JS3A 4P7QA 3OIXA 3MANA 2Y85A 1ZAIA 2BY3A 1FHVA 1DIOA 3IIZA 1V6YA 1XGEA 2CLKA 1ZGDA 2Z1WA 1LUCB 1Q13A 1A0DA 3QY6A 2ISSA 2Y7GA 3IJDA 4YTRA 1TYGA 5LNSA 5LSMA 3VE9A 2BOEX 1P7TA 6ALDA 3W1XA 1Z3NA 4Z42C 4HPGA 3M46A 3AHVA 3TZNA 1JPIA 1EX5A 1V6TA 1ZJIA 3DUGA 4CN6A 4JCMA 5C55A 2MANA 5CBJA 2WCGA 5A2AA 2NQJA 3NTYA 3BZJA 4E2DA 3VNIA 1W56A 4MLJA 1O60A 1HJWA 5LGXA 2VUNA 3W4RA 2EXOA 2E6AA 3IJ8A 3J7HA 4BK9A 2QVNA 3CIWA 2X1SA 1TCDA 3L4WA 3VIIA 4U5KA 3TXZA 3CGTA 4ERGA 3QN3A 3KZPA 1HKKA 2Y62A 1W1TA 4XSMA 4EPDC 5FEXA 1SMDA 3BOLA 1VFTA 1NDWA 5FI8A 3T78A 2GK1B 1N7KA 1YXYA 1E1FA 5DXXA 5EMLA 3VIJA 4W5ZA 2EHHA 5XIAA 2ZUUA 3IACA 2R1KA 4E2OA 3RDKA 4L4PA 1I9CB 3QTPA 1BVNP 1XLHA 2OLHA 3VA8A 3TU9A 3EMCA 3KBWA 3GDKA 4GNVA 3WDRA 3WQWA 3IVSA 1K70A 5ABGA 4D9PA 2VD9A 4H2CA 2W92A 2QPUA 1P1XA 4POCA 4HD5A 3O7UA 4JTLA 2XN1A 3IGSA 2PWGA 3NDZA 1G1YA 3WLMA 4DIAA 2VMFA 1BXNA 3W1UA 5AZ0A 3GVWA 3N2XA 1PTGA 4G7EA 1JULA 5G1YA 3UJRA 1SSGA 1SJCA 1E1CB 1XLAA 2OGJA 1WZKA 1J0JA 3E2RA 1S1RA 1S1PA 2DU2A 4NRRA 1FCBA 5H6HA 5I3GA 1FFQA 4OIFA 3HMJG 1BKHA 2OO6A 4ERAA 3AZTA 4XTDA 1A80A 2X40A 5TBOA 1MDRA 2C18A 2CERA 1OGSA 1G4TA 1IXQA 1K4GA 5AHFA 2EAWA 1WCGA 4GQRA 5IFTA 2VD8A 3NQDA 3UG5A 3CV7A 2AKZA 1SU5A 3P62A 3GDBA 3BLDA 3QF0A 3IJIA 1OIFA 5FJTA 1UR2A 2Z4GA 3BSGA 4F40A 1EZ2A 6ENLA 3DIPA 1W1B1 3T09A 3VNMA 3ZFHA 4KEMA 3ZOAA 3Q94A 5A6TC 2H6RA 4F79A 3L68A 3UCQA 3ITLA 1YE4A 4WD0A 4UNKA 5I3IA 4XSLA 4EWND 5AHIA 1BSLA 4LJ3A 1JCLA 4RW3A 3PPGA 4MSSA 2J6XA 4AC7C 2C3ZA 4MFEA 4JDYA 4R9OA 2E09A 1ZJHA 2Z29A 1PHWA 5AYYA 1Z6KA 3UPMA 2CKRA 2NQHA 5EMYA 3STPA 1NP2A 1K02A 5AC4A 1P0BA 3KRSA 4DJDA 1A5NC 1RVGA 2G3JA 3BAIA 5CXPA 3GZAA 1A3HA 4JYFA 3WQEA 3HG4A 2GVJA 1MW1A 1UG6A 1MWOA 4IL2A 4LS1A 4IGNA 4Q7BA 1J01A 1XRFA 4IG2A 4BEUA 1TSIA 2E9MA 3ZXWA 3KP0A 4LVBA 3EXTA 5A8GA 3E1F1 4ZXOA 3W7HA 2J66A 4GACA 4IIDA 2CHNA 4AXKA 4Q8UA 1X97A 1W3NA 4MVAA 4S3CA 2PSNA 4P8XA 1ISXA 5F7UA 2VGBA 3AU2A 3RLGA 2PTWA 2WB5A 2FYMA 3ITVA 4UMCA 4PMVA 4LB4A 5A6AA 2ZUSA 5TAOA 1H2JA 3WDHA 4HMDA 2Y2WA 3PJWA 4DN1A 3OPSA 2MUCA 1ZJAA 1LYXA 5BU6A 3U4FA 1RD6A 2VEPA 4GVFA 1ICSA 5IM51 2QF8A 3BWWA 1JFXA 6TIMA 1KRCC 3LLDA 3S3GA 3LUTA 1JDDA 1OFOA 1F6YA 1JYWA 5AYZA 4XBKA 4DF2A 3GTFA 3UZXA 4CEXC 5D9PA 3UXLA 4A2RA 3S42A 3SCUA 1KBLA 2C16A 4FLSA 3LXCA 1U30A 3AS1A 4RXFA 2WBGA 1W3HA 2O7SA 4PSPA 2GUBA 3TYUA 4ML4A 4OUIA 4I7WA 3S5NA 5DMYA 3GXIA 1F3WA 5F1UA 3O15A 2CZVA 4PUDA 4K38A 4PUEA 2GJPA 2GQ9A 4FAMA 1VYSX 2WPBA 1TO3A 1DJWA 1VBUA 4NI3A 4C6OA 3CHVA 1EQPA 3HPSA 1XH2A 1KXVA 4DXVA 3UWQA 1EIXA 5HQLA 5HQEA 3L7RA 4EWJA 3AHXA 4NAFB 4E8GA 1X6UA 4DJDD 4W93A 1KCXA 2OSWA 1CGUA 4W5UA 1UHVA 4C6EA 5JIPA 1DKWA 1I0DA 1EBHA 3ANVA 4K1WA 3F2BA 2ALDA 1PO9A 3EMQA 1C93A 2DUAA 4IPPA 4Z2LA 2LLEA 1S3HA 4PMUA 4XZNX 1JZ4A 2ZZ5A 1PKLA 3TJLA 1E6XM 3SUWA 4LGXA 1WUFA 2PURA 1Q6FA 1GQIA 1UMLA 4IMCA 3KXQA 1BRLB 1RK5A 2A7RA 5D9OA 1GVOA 4YJ5A 1NOUA 3PZVA 3C0LA 4AZ6A 1PBGA 1N82A 2QV4A 4TU1A 2NQ9A 1ITXA 1NWUA 2EG7A 3MI3A 2B7NA 4C1NB 3W7MA 3GG7A 3MYOA 2W63A 3KVJA 3EX2A 4K6AA 1JPHA 2GQ8A 2HROA 4CEUC 1XCFA 1ZAJA 4RPPA 4HA0A 4H1ZA 3MKCA 3BMVA 2PRHA 4J3XA 3M0HA 3FA4A 4ZO9A 1GG0A 3UZYA 4QDPA 4AVOA 3AZRA 3F4NA 5MF5A 4PR4A 1S2VA 2AL2B 2JKPA 3R8GA 4WY0A 1PX3A 4AZIA 3WQ8A 5CAHA 4C6LA 4QROA 4DJEC 3T7VA 3WCZA 2J7HA 2PGRA 4ERIA 4PUJA 5CPTA 4GCXA 5FESA 1XC6A 4LC8A 1VFUA 2C19A 3CZ8A 3SRHA 1J2BA 3M6DA 2XVGA 5JBEA 4K37A 1EGMA 2EJ1A 1PAMA 1TWIA 3VIFA 4PCNA 3KTXA 5CPSA 3QFWA 1I45A 2G4JA 3GU1A 3LSBA 3ZVHA 3T2PA 2CBIA 1OY0A 2OEKA 4GUGA 3EWCA 4FR6A 1SW0A 4N9EA 4HCHA 1A0CA 4Q8TA 4DEFA 2Z1XA 2VGGA 3A4JA 1O66A 3M0XA 4J3VA 1W3KA 4K2SA 3U8GA 3ARWA 3FW6A 4MJZA 2YIHA 3GNOA 1RP8A 1S2UA 1WB0A 3VZZA 4URIA 3UD6A 3ZSSA 1BYAA 4HN4A 2Q02A 3WH5A 3LHWA 2YDAA 4UQAA 2FPVA 3C2OA 2H9AA 2ZFAA 3TDFA 3KLKA 2F7FA 5DY3A 3G1XA 4I5XA 4HU4A 1E43A 2ZZ7A 4QNEA 3N73A 3CV2A 3VM7A 4D6GA 3WMCA 2QIWA 2L5HA 4A05A 2BXYA 4KFNA 1E73M 2Y89A 2HPIA 1ZBCA 2DSUA 3AYRA 3W7OA 5LIXX 3BVJA 5HA7A 1MUCA 3R0KA 2DUXA 2GVGA 4IP5A 4CQ9A 4JICA 3XIMA 3T6CA 4TQTA 3MUZ1 3KCLA 4CCDA 1WA3A 3L4TA 3DN5A 3B0UX 3UXIA 4S23A 2BVYA 2PTZA 5GNZA 3B9EA 4IMFA 2WNQA 2IPGA 2XIOA 4YHEA 3G0XA 2JIWA 2WJZA 4GCAA 1QMLA 3CEUA 1SM9A 1ISYA 1DWAM 2PBGA 3WNNA 2FZBA 4JCLA 2V63A 3M07A 1Z48A 2VX5A 4HK5A 5I00A 4FOUA 1N8WA 3TV8A 1AQHA 2W79A 3MDUA 3R89A 1UC4A 4LUSB 1VHNA 2G5WA 1EP1A 3PP7A 4IGMA 4GA8A 2G41A 3E9AA 4HZMA 1MYRA 1HG3A 1QVBA 2J7DA 1VBJA 3AHZA 1F3TA 5CPLA 4G56A 4YU1A 3W71A 1RH9A 3W72A 3N2CA 3OIHA 4WVXA 3BG5A 4ZQRA 3S0CA 4AY8A 4ZODA 3TYCA 3RJXA 3MU7A 1PZ1A 3LPOA 3RLHA 1SVDA 1CLKA 4HHMA 4DZHA 1F73A 4AZCB 2P0IA 3TJ4A 1KFJA 2O9TA 2OX4A 2NV2A 3V0TA 2ZWYA 3H70A 2YGYA 1V02A 5H8MA 2DT2A 3UESA 3UJEA 2QMJA 1PJ9A 3S47A 1W17A 1F8MA 1UKSA 5HULA 2FQIA 2CLHA 1MRAA 1M9HA 5HUOA 1IWPA 1MFVA 5TIMA 2J77A 3U3HA 3ZWSA 3PUDA 2J13A 1V6XA 3T0DA 1TR9A 1YMYA 3IANA 4O1CA 1U5JA 3BW3A 5I77A 2PWHA 3DG6A 5G1MA 4GPNA 4IISA 3CHFA 2RUSA 1VLIA 4IMGA 3E96A 4UFKA 1A53A 1L8NA 1GYMA 4KCTA 1M53A 3PTKA 4MYXA 1KBIA 1YEYA 3FJ4A 4PMOA 2V2DA 1RK6A 3ZJ7A 4UFJA 1Y7VA 3E3HA 3IWPA 4C6BA 1E0WA 4H9XA 3VGDA 4DUXA 4UMAA 2E8YA 2CFFA 4HZ7A 3N2OA 1PV8A 3RUBL 3UWYA 2GFTA 1H09A 3A6OA 4PUUA 1YRRA 4ZQCA 3WK2A 5CZKA 5A5WA 4AD4A 3ICJA 4ATLA 2F8QA 1EC7A 3S6OA 1GEQA 4OBTA 1FWTA 4KEUA 5BOOA 1Q8AA 1JCNA 1ALDA 1EJTC 3P80A 1EFZA 4H41A 4Q4OA 5I6SA 2PTXA 4GZ7A 1I60A 2PWFA 3W1RA 2A3AA 1A49A 1EO5A 3OG3A 3DI0A 3FA3A 5ABTA 1ZENA 4IP7A 1MXGA 3QH2A 3UU0A 1HKJA 3NPXA 4GQBA 4AVFA 5AECA 3MVTA 4XWUA 4JKMA 3FJLA 3NPWA 4MB3A 2ZXAA 4M81A 3DX5A 2GOUA 1R3YA 2E9LA 3WBYA 3K13A 4O1BA 2XWEA 2J9YA 3U0HA 1E6QM 3EDFA 1S5NA 1H62A 1QAPA 5GJNA 3BAWA 1W5PA 1KRAC 3FK4A 3H7UA 4KRTA 3AIWA 1JYVA 2ZRYA 2VEFA 1WOBA 3B97A 5AKQA 1GOIA 4DF1A 4XX6A 3PUEA 3TSDA 2VX7A 5B7ZA 3GIPA 1S46A 4JTQA 3XISA 1XQLA 3A4WA 1HFBA 3TFCA 4JTHA 5LA0A 4GBDA 1H41A 4WLCA 1LJYA 4GVHA 4XKYA 3A3XA 3LERA 3RO8A 2UY4A 3RXZA 2J6VA 3M6YA 1R9XA 3NL6A 1X6LA 3CZLA 1LBLA 3P8IA 4GY0A 5D2WA 1UPPA 1P4CA 2ALRA 3LNMA 3LDVA 4XAZA 3LOTA 3UCDA 5I0DA 3MQTA 1E4IA 5HATA 3C5QA 4GKTA 2BODX 3KCOA 1E0XA 3M5ZA 1ICQA 3DECA 3RU8X 3PZQA 1FDZA 2DT3A 2W66A 8XIAA 3G22A 4RR4A 4S1FA 2AOSA 5F2IA 4FSAA 3I3DA 1HO4A 2PD9A 1PTDA 1Q6CA 3ZYZA 4HU0A 3OVQA 4AZBA 5BMWA 4M6QA 5A2BA 4Q32A 4Q7NA 4ZEPA 2D0FA 3BDKA 1IV8A 4CNUA 3ALFA 3G0SA 4N7QA 1SYTA 3LCWA 2E68A 2PF0A 1US0A 3V5FA 3T0AA 2Z7KA 3G1RA 1ODZA 4B4FA 2YX0A 2VKZG 1LP6A 4HP5A 4M80A 4GXWA 3C2YA 3GW3A 1FWNA 4H7VA 1F61A 1GVQA 3M0JA 4J2MA 1HJUA 3P0XA 3GY1A 3HG3A 3KWSA 3PZUA 4OFCA 5BRPA 1KBKA 2V5LA 2O4QA 4K3ZA 1E0UA 4ZGYA 4B5XA 1KW1A 2BASA 2A0NA 3B04A 1W6TA 3W1AA 1K7XA 4IF2A 4JYDA 4U4MA 2Y5SA 2EF9A 4YL2A 4BR1A 4EXAA 1FWAC 4KETA 1G7UA 3L12A 3UJFA 4S3EA 2JK2A 4L9ZA 1HNYA 1ZCOA 4UCFA 1A5CA 2A3BA 3SCNA 1XINA 2WQDA 1IZKA 4AZ5A 4O17A 3W9ZA 2HXTA 1DE5A 4NVTA 3LZ3A 3GC5A 3AALA 2V2HA 2NWSA 1OJXA 1BKSA 3THAA 5H91A 2VZSA 3WH7A 3B03A 1JXKA 4PYSA 5HOSA 1N8FA 4HYVA 5T9BG 3WLJA 3IV3A 3I7RA 4HA1A 1B3YA 5JVLA 4Y9NA 4M7SA 3CPGA 1EF2A 3TXVA 3ANYA 5EYWA 1E15A 1DIKA 4AWEA 1C8YA 2CLOA 3OB8A 3WH9A 4FNPA 5EB8A 3BXWA 1XX1A 2HJPA 2BDQA 3IAPA 5D9NA 2VOTA 1CEOA 3GNPA 1E71M 2ZZ3A 3URBA 3S2CA 1K9TA 2WW5A 2VFHA 4UTMA 2JEPA 5C7HA 2QCMA 2OT0A 1GQNA 4JKKA 4UTTA 2G8ZA 1VJIA 1PKYA 2CITA 4N4QA 1WP6A 1XH0A 3K4WA 2DT0A 1H1YA 1KFEA 2YB1A 5KMYA 2QCHA 1VD6A 4S38A 3EDKA 1YLVA 1XRTA 3O6YX 3KUMA 1I1WA 5BW6A 5LYRA 2VRJA 3VDAA 2OYLA 4UQBA 4NAEB 4QJ3B 4GMEA 1KXQA 1FVPA 2DIJA 4XO7A 3GWQA 3TC6A 1G01A 2OLAA 2CHRA 4N9BA 1XISA 3BJTA 3CYVA 7A3HA 3V1HA 4LQ1A 4H6KA 2J7CA 2AQVA 3A9IA 5FCZA 1D2KA 4PBEA 1OZQA 4LW7A 4AG0A 3LBOA 4D6FA 3TJXA 2X30A 4HPNA 2WC3A 2OYMA 2VEKA 1KLZA 1E55A 5LIWX 5C71A 4LVAA 2J47A 5I5RA 1HL8A 4R9XA 2WC4A 2DZWA 2DIEA 2AAAA 2QAPA 4FX6M 4LUTB 3M4HA 3NXLA 3SB0A 3DGRA 3OW1A 5GNYA 1LF1A 3KE0A 3N6HA 4U10A 5M1TA 3PTDA 1G67A 4ES4A 2I17A 1YW1A 3BMWA 4HZ6A 1UQZA 3WL0A 2YA0A 3L0KA 3WQPA 3FDKA 3W1MA 2NUWA 3TMLA 4A6GA 4MF4A 5LNRA 5SWUA 4KWWA 3BLOA 5A94A 3FCPA 4PH6A 2O0TA 2YL6A 3EEZA 4IGHA 3FAWA 3W86A 1V79A 1IGSA 3G8RA 1QTWA 5I06A 3VILA 4YWIA 4M1BA 4DJFA 1OYBA 3VCNA 3HF3A 1C90A 4JTKA 2XISA 3EDEA 1HIZA 1SSDA 3I7QA 1OC7A 5DT5A 5BWAA 1FTXA 1I2PA 2WMGA 5K2ZA 2ZUVA 2VC7A 4MADA 1AMKA 4MZ8A 2FZNA 3ME3A 3VM5A 2OEJA 1R8LA 1NM9A 3W7IA 3WMBA 2YSWA 1THFD 3SCSA 2VC9A 3P93A 3VI2A 3W28A 3U5YA 1R3TA 4QLLA 4J3ZA 1K1DA 3G1FA 5BXSA 2GZXA 1BQGA 1GORA 1XIGA 4QAWA 3ZR6A 5DX7A 5LHFA 4MAVA 3VKAA 1GCYA 1GKRA 5FEZA 3ZJ6A 1QK0A 3CZJA 5AB3A 3T8LA 3LPPA 4DYJA 4E38A 2BXVA 2I14A 4HNUA 3VUPA 4NZ3A 4D72A 3CQ0A 3T8QA 4OBSA 3AJ7A 1U1HA 1S5TA 3W25A 5C0QA 1OBAA 5G5IA 4JTFA 3VYLA 4DAIA 1AJ2A 2RDWA 1YBQB 4DVOA 4F0LA 2VR4A 1RJRA 3VZXA 2NT0A 3OG2A 4K8GA 2C0HA 3WD2A 1M41A 4FF7A 1H63A 4FNUA 1SZEA 4A3UA 4C5YA 4US6A 2PZ0A 2A85A 5C2XA 4EXQA 3O1NA 1RCQA 3FIGA 4JL2A 1KA9F 3OVPA 3HJEA 4FX7A 1IEVA 3NL2A 1LL4A 1SFLA 1NF7A 5CGTA 3L0GA 4UNLA 1F05A 1O5RA 1I4NA 2B4GA 2X0SA 3W87A 4ICNA 4O14A 2C15A 3M0YA 1DJQA 1HJVA 1FWWA 4WX2A 4DBDA 3ZJKA 3GD6A 3QY7A 5CG0A 5AHNA 1F4AA 1IT8A 4Z1BA 1UR8A 3AMKA 1XYZA 3AIUA 1L2QA 4F0HA 5FF4A 4P7NA 3MI6A 5CEWA 4BKNA 3A9BA 3VIOA 4E4PA 3T07A 5LIUX 3SGGA 3WENA 3DFYA 2WHLA 3QC0A 3UF9A 2ISFA 4DJFD 5BRQA 1XRVA 1K77A 1V3JA 2QUMA 1V02E 3ECQA 1QNOA 1L6GA 2Y6ZA 3TWBA 3W7PA 1PEZA 4UFLA 3FVMA 2ZDSA 5HPOA 4WSKA 1FA2A 1NU5A 4BQ3A 1FXQA 3KEHA 3QV8A 3VDBA 1XIMA 3RR1A 1OSEA 4AD0A 2WZHA 5GPRA 3GVGA 1KO0A 1VIZA 1XSKA 1Q6EA 1BQCA 1OFPA 4LY4A 3DBPA 2A7NA 1J11A 3L23A 1EPXA 4FEZA 1ZRQA 4BFAA 4ADUA 4IIHA 3KBMA 3WLPA 3QEZA 2PDYA 2I5QA 4YYFA 1TREA 4XD5A 5A6LA 3NVTA 3V0UA 4OOUA 1M01A 3GXPA 3NZRA 3DFOA 1SJAA 1B5TA 2VURA 2NSXA 5CPQA 1KB3A 3KRUA 2Z0IA 3R1ZA 1X8FA 3M41A 2OSYA 5BMXA 3W24A 3K4AA 2P50A 4CD8A 3WDPP 1J79A 3BSMA 1ONWA 4KEVA 3A47A 3S5SA 5CZJA 2WWDA 3RU6A 4JQ4A 1TPB1 2WKGA 4ZB2A 5AHMA 2VP8A 3GC4A 2XN2A 1ECQA 3QMSA 4LUJA 1GGOA 3EA1A 1P7TB 3PZMA 4OJYA 3E5BA 4QAIA 4H9MA 1XHGA 1JQVA 1JNDA 3AHYA 1EJVC 3B9AA 1WDSA 7CGTA 4MWAA 1CGWA 1R46A 3WY1A 4EOUA 1TZ9A 4FZIA 4I8YA 1JG9A 3QR0A 5F2MA 3WJZA 1UIPA 3MW7A 2IKHA 4A29A 3R94A 2PBOA 1FP9A 1RLDA 3CZEA 1QJWA 1WKFA 1UWQA 3S6DA 5D2VA 3TX9A 3SM0A 1XUZA 1WNOA 2DSWA 4FXRA 3SUUA 2PLKA 2FLIA 4Q6XA 3MBDA 1IE7C 1Q2RA 1LTDA 3KWXA 2OODA 3PPCA 3VDCA 4JY8A 3MCMA 2VCBA 3BG3A 3G1SA 4GY7A 2HVMA 2IPFA 2XUCA 4I90A 1WBJA 5CSYA 3IJQA 3NL3A 4PL2A 5HJYA 4JN6A 2ODOA 2BY1A 3LCLA 3QTGA 4C60A 4OBRA 4AISA 3KRZA 3N4AA 1E5JA 2VRKA 1VJZA 4Z0SA 1EYWA 4GIRA 4A8LA 1LROA 1AD1A 2POTA 2XZ7A 3R12A 4DWSA 1OIMA 2YCJA 4V1XA 3H26A 4PMZA 4NJHA 4R5EA 4NSBA 5A3HA 2C0AA 5EMJA 3VD4A 4ZO6A 1B3OA 4LAZA 4A4AA 5M17A 2INEA 4RPQA 2QVHA 4J3SA 4G7EB 1JAEA 5BXTA 3PBMA 4UC5A 4I3GA 3TONA 5LIKX 1UP3A 3W7KA 1OC5A 5E6ZA 4DYEA 1BSIA 5I3HA 1F9CA 1V0LA 3JU2A 4QG9A 3UYIA 4L4MA 1DPMA 5KEZA 5D05A 4MZ1A 5IHSA 1GVEA 3HOJA 5M03A 3LD5A 4C6JA 3BLIA 3EB4A 1T5AA 1IQ8A 4MTVA 1DBTA 3ERPA 1KQYA 4ZE5A 1QPQA 4IHCA 1CIUA 1XFCA 2PDUA 3NCOA 4RZ6A 2RFGA 4FOKA 3WUFA 2DZPA 1UBPC 3K46A 3LCIA 3W37A 5EMKA 1NJJA 4ROQA 1J93A 4W85A 1H1ZA 3MP3A 2NQZA 4S3GA 3VXGA 4JTDA 3S1UA 1JDCA 4RZ4A 3BURA 5FA5A 4L64A 4KCVA 4ILSA 3CLWA 4O1EA 2VGIA 4MY1A 1G0CA 2RHGA 4LBRA 3RLUA 4JHOA 1F7BA 4CLMA 1F6PA 4MWAD 2BZNA 2Y1HA 3C0QA 1TV2A 2Q01A 3P5YA 3RITA 1ECEA 3WLOA 1CXKA 3CMGA 3M0VA 3PJTA 1WDRA 2ACQA 1E9YB 3IAQA 3T42A 1V6VA 5IOBA 2VEMA 2PGWA 1TTJA 3WNOA 2G3IA 3GIYA 3NQMA 4JQ2A 3PHAA 3IK4A 2CLFA 5D30A 3TW7A 3E2SA 4LPCA 1L6YA 4GGHA 1OF8A 3WK0A 3UWWA 5D38A 4INFA 2YBTA 1MZHA 3WJSA 4Y90A 1C8QA 3HBLA 1OCBA 5B80A 3V1PA 2OCZA 1TG7A 4IG2B 1QHPA 1TV3A 4YIWA 3W2LA 5FAGA 4OOZA 3A4XA 2WO5A 1AUSL 2CLIA 2DZSA 1ISVA 3OHMB 1DQXA 4S39A 2F6KA 2NQLA 4OV4A 4AYGA 2HVNA 2HZGA 3M0ZA 2ZUWA 1XCXA 3POHA 2P10A 1MEWA 1A5MC 2IMRA 1T0OA 3C2EA 4DWSD 1U33A 3FFSA 1GJUA 3ARYA 3EX6A 3THQA 3V4BA 4F9JA 2PWUA 2Z24A 1BXBA 5JIWA 5A6MA 1XIHA 4RUBA 4ADSA 4N0RA 2ASHA 3IS4A 3VNJA 2EPHA 3ZQ9A 2NV9A 1VEOA 1PPIA 3ONCA 1DJYA 1P43A 1TJ2A 4QRNA 2WANA 3F4WA 4I9TA 4R85A 1QBBA 4NZ4A 4MG4A 4RNIA 4H00A 2WZTA 4I7UA 4S3JA 4AAJA 1XBZA 3JUGA 3P74A 3SURA 6REQA 3LGDA 5AOUA 1XLEA 1I2OA 3ZVIA 1VEPA 3KW3A 4DJDC 3HQPA 4XZHA 4QP0A 1WZLA 3FGCA 3I6TA 4JTCA 3W26A 5FF7A 1W9XA 3BARA 3Q67A 3MA8A 4CUCA 2DVTA 3H6OA 4HNNA 3ATYA 4ZQMA 4UWMA 5HXMA 3IUIA 1EDTA 6XIAA 3EWBX 3H2FA 3G5EA 4PCTA 3H2MA 3T2OA 1GK8A 3ORWA 3RGTA 3DFQA 1PTAA 3BAKA 1DTUA 4EF9A 4Q6JA 2QAFA 3B06A 3ZT7A 1KNWA 1LOQA 3WJXA 1G6CA 6PTDA 3H7VA 3SRKA 2VELA 3QGAC 1QNPA 4Q8NA 3ITYA 5D8WA 5HUPA 1R7OA 3WFZA 2PDFA 2GOKA 4YN5A 2XG9A 2ANUA 4M1RA 4FMVA 2PU1A 3NL5A 5A8OA 3F5JA 1UA3A 1W9DM 3SI9A 5I23A 3BOFA 4MB5A 2GQ3A 1Y0EA 4DBUA 2QNEA 3NQ2A 1EZWA 1YHTA 3VVGA 3CPUA 3WD4A 4HOXA 2HXUA 1PDYA 2JEQA 3WF3A 1B0IA 1GVSA 1T6MA 4HYRA 5FIPA 2VM8A 4G1KA 5XIMA 1XLLA 3QFEA 3TTOA 2WMKA 2OZ8A 1B3VA 3SN1A 3PBVA 1ZP3A 1ZNNA 4PUWA 3W1LA 2DPEA 5DRIA 4QISA 3ARRA 3GQYA 1AFSA 3QXBA 3NAVA 2GVLA 4OHQA 3MSGA 1VENA 4IPJA 1TCMA 4X9YA 4FX8A 1GYNA 2VFFA 3NYDA 3UZ5A 1XSIA 1VFMA 4FNQA 1UZ4A 3EZ4A 4JYEA 3SCPA 1WE5A 4GJIA 2VEGA 1KM2A 3W7DA 3VNLA 1A5SA 3TC7A 2ZX8A 3DHUA 4TVUA 4N2YA 4LTSA 5A95A 3LCHA 1UKTA 1J8VA 2OOFA 3AISA 2TMDA 3AJXA 2QDGA 1UWUA 4R53A 3M9YA 4LV4A 1JYXA 3MJYA 3THDA 3OU8A 4M82A 3WQVA 1XDLA 4DO7A 4S3FA 1ZQ5A 3TNOA 1NFBA 5DBUA 2Z2BA 2RJHA 4LYKA 1VGAA 2PRMA 4WY0B 4NRSA 1SUXA 2NXIA 4H01A 3V35A 1AD4A 3I65A 4IPIA 1DOSA 1KQZA 5DMMA 2JALA 2V5BA 4QS6A 2WNWA 4H04A 1FWGC 2DP3A 1G4EA 4ZB0A 2PLJA 4XUGA 1E4NA 1DWIM 2OO0A 3AHTA 4LB3A 2CNCA 1FKWA 7TAAA 1YPXA 2RGLA 4XISA 3ZVHB 1H51A 2EPKX 4V1YA 1X98A 2NZLA 4H9TA 4HNLA 3VAVA 3NQGA 4WUIA 4C6IA 1LQAA 3TCSA 4HB7A 4O50A 1TE1A 3V7PA 3NUKA 2BFGA 1XDJA 3AWOA 2HWGA 3BAYA 2QT3A 3TLQA 5CPOA 2P53A 3CK5A 2J4GA 1KKOA 3LCGA 1UUMA 2DZXA 1Q4WA 1O1ZA 5I03A 1GOQA 2H9AB 1WXZA 3EX1A 5HDRA 3ZMRA 3MP4A 1HT6A 4JIIX 4FF5A 4ZENA 3MWCA 1EDGA 2I9UA 1JZ7A 1RPXA 2FHBA 7TIMA 2GJNA 4PULA 4IIGA 3ARTA 2P3EA 1ADSA 3PNUA 3LXAA 1PIFA 3CWHA 2BVWA 3L2IA 3I10A 5DCBA 2GSJA 2ISDA 2WJDA 3MHFA 4AC1X 3N17A 1LRTA 2HDJA 3FV9A 3G3DA 3QOKA 2TYSA 3SW6A 3CIXA 1HF6A 1XDMA 2V0TA 2BY0A 1MW2A 3MCNA 4DM2A 1YXCA 3MO7A 1HJSA 3LCXA 4O16A 2ZXBA 3GH5A 2ZADA 4DZ5A 4IIBA 1Q6DA 1E6RA 1G9HA 1O94A 4YTSA 3NM1A 4GK8A 1FY6A 1FCVA 3SCRA 1TPFA 1SJDA 3MUIA 2A6LA 3FHAA 1TPH1 1KFLA 1FP8A 4L1XA 5FF3A 1XLGA 4D6CA 3UXKA 2XIMA 1EX1A 3OA3A 1RPKA 2R6OA 4WIWA 1GQLA 4PB4A 4CD7A 4E3VA 3H21A 3RRAA 2OZ0A 4CN4A 4XAFA 4JPGA 3KHJA 2XDFA 4Y7EA 4PGLA 5D4YA 3IRSA 2FJUB 4AD5A 5A69A 2YLAA 1ZY9A 3VUSA 3ABZA 5EA9A 1OX6A 4HHPA 2YKKA 4E0CA 2FB2A 8TIMA 3WEMA 1E4LA 5ECVA 3SZ8A 4UOJA 3STFA 1EL3A 1TJPA 4UFMA 1HKWA 4P61A 1IHIA 1SR0A 3CXOA 3GBDA 1MQPA 2D0GA 1I0BA 4R33A 4XZ9A 2ACSA 1V03A 3B8VA 1KM5A 1E0VA 4QS5A 4HT3A 2QPXA 5K4XA 1Z8AA 4RNJA 3GFYA 3HU7A 3LB0A 1IEIA 2KAUC 2V9DA 4QXIA 1J0IA 5TD4A 1F3EA 4AD1A 1VFLA 4JEJA 1REQA 3DG3A 5D09A 2H3BA 5B7YA 2VX4A 4NZFA 4JEQA 1UKOA 5A1AA 1QI4A 3HN3A 1RY8A 4CD6A 2Y63A 2Z1BA 4F2BA 4ZE4A 3KAOA 4IQLA 1VRXA 4DHGA 1V0KA 7XIMA 2OVLA 4DBWA 1MO0A 3IGHX 5K9CA 3EOOA 3NDYA 5HQMA 3EA2A 3HZ3A 3MMWA 3UWVA 4HK7A 2JFEX 2W91A 3DHDA 4ZOEA 2X1IA 5A2CA 3F5LA 5FF0A 1CXLA 5CC5A 4A35A 4TX9A 1J2WA 4P2VA 1EJWC 2QCEA 1J0HA 3KVMA 3EGJA 3UZZA 4KIRA 4O12A 4ZFCA 3NSNA 2VNCA 2GYIA 3UNDA 1N8IA 4XBJA 2HNHA 4LU0A 4IQJA 3BCFA 4B5NA 4OGZA 4QLKA 1ELSA 1CWYA 4B2DA 1EJSC 3TIMA 3VIHA 4EX4A 3WLRA 1XRSA 1LOLA 3U2CA 1DXEA 3DXIA 4JFSA 4DAFA 5D32A 1ZL1A 2YA2A 3PBYA 2X41A 3KBSA 4IMEA 4RDZA 2OR2A 1Q2SA 1OB0A 1H0IA 4CVUA 1PZ2A 3VCCA 3CM4A 1J96A 3PWIA 3R6IA 3MKKA 4LBSA 1BF6A 1JI2A 1TWWA 4MB4A 4EACA 5FL0A 1DORA 1K9FA 1SO4A 1WDQA 5D37A 1UJPA 5LXEA 3ID7A 4GUJA 1JL8A 1XD1A 4XUYA 4JTRA 2VR5A 1M3UA 1QUMA 3AS0A 3LHVA 2PP3A 2VCCA 4QQUA 2E3ZA 3DAQA 3L0NA 4HMCA 2JBMA 4AIBA 5LNVA 3SRFA 3V75A 3SY8A 2JIEA 3PUGA 5L9FA 1HGWA 1AODA 1AQMA 3L21A 1YNPA 3T1GA 1IEXA 2OELA 5GJPA 2E7FA 4MHBA 3SO7A 2G4FA 4XKYB 1Y5VA 1PX8A 3EKGA 3RN6A 4LXFA 3NQVA 3A21A 1X1OA 3LMYA 4JTSA 1Q6QA 4DQWA 3BGJA 3W2NA 3AOFA 3AYVA 4HOWA 3SSJA 2WHKA 3W7GA 4ADTA 4KESA 2P3ZA 1T40A 1GONA 1VS1A 3B8WA 2ZRVA 2C91A 2WVSA 1OEPA 2Y4SA 1R30A 1ZTVA 2NVAA 3P0WA 4GGBA 3AIRA 4I9MA 1P6WA 3VX1A 1O5KA 4JHMA 4E3TA 1XLCA 3DG7A 3NQBA 3M0LA 1RBLA 1C9DA 2B7OA 5JXQA 3HV9A 4RDWA 4W86A 4Y96A 1O4UA 1QWKA 3VNZA 3MJMA 3OOQA 3L67A 4GI9A 3AQUA 3IUHA 1XG4A 3NNTA 2PCQA 5KZDA 4ASTA 5C2GA 1Y5WA 1I2NA 1YDYA 2ZX9A 2F6XA 2NVCA 2CXEA 3KVLA 1AH3A 3DFNA 4K1GA 4AX6A 3QBUA 3UEQA 4D8ZA 4Y8FA 4B2DD 1LLZA 3AU6A 1M1BA 4RX0A 2D2JA 2R1PA 2VDGA 1GZGA 4NJIA 3SECA 3WDJA 3WNLA 2FTPA 3XINA 4UQEA 2GGJA 4AD2A 1RBOB 3DDMA 1XF0A 2I7GA 4XAPA 1GG1A 3IGXA 3BG9A 2YZRA 5BOEA 1AH4A 3OZPA 1GHRA 3MT1A 3W7JA 1NFGA 3EPOA 2YFOA 1JPDX 3CL7A 4TTUA 3U2ZA 4GYFA 3VPLA 3KBNA 3KOYA 5ENLA 4IX0A 1QI0A 2QCGA 4K36A 3L5LA 1EH9A 1JFHA 3PM6A 4DZIA 2QJHA 3GKFA 3VFLA 4DO5A 3DESA 2W27A 2ZE3A 4NZ5A 3CMJA 4G5DA 4MAZA 1RCOB 1EGZA 3ARZA 4DO4A 3GXDA 5C9RA 3UGVA 5IFPA 1XL9A 4JTTA 4XKMA 1P0EA 4YNGA 5J5RA 4LAKA 1A3XA 3WFAA 1V93A 1TA3A 1D9EA 3H53A 1BG9A 3H2NA 2VJXA 2WQPA 1GQJA 4KCUA 3LV6A 4LANA 3KDOA 4ZB5A 4UXDA 3WSUA 4PODA 3GNNA 1X38A 1UD5A 2WHJA 3LI1A 3VOCA 2ZDRA 3AMLA 1EB3A 3N12A 1W9VA 1X1NA 3W7LA 3B40A 4AY7A 1YTKA 2ATMA 3CWOX 3LYEA 1HQTA 1W2PA 4DNMA 2B0MA 4WSJA 3GHUA 3UETA 2XSBA 3C2FA 1F74A 4WJEA 3UVIA 1C3FA 3QR3A 4GH1A 4AWUA 1Z7AA 2F6UA 5H8UA 2XPKA 1EA0A 4NIRA 2RAGA 1R2SA 3JW7A 1EJ7L 3R25A 1NAL1 2BGNE 3OGVA 5A8NA 4A3RA 7ODCA 4UTIA 4M29A 2J8GA 2E8ZA 4UTJA 3VINA 2D23A 4HA4A 1JPMA 1R86A 2CC0A 1U1UA 4K8EA 1SPQA 2WMIA 1W37A 4GINA 5TNVA 2I5GA 4S3KA 2YDRA 3EYPA 4X22A 3SR7A 3LX9A 4GD0A 3ATZA 3UXAA 2A79A 2GVEA 4AYSA 4OZOA 1JUBA 6CGTA 4PTMA 4B4HA 3CAQA 3OODA 4FP1A 1MEHA 2CLPA 5G4EA 1PWMA 3ARVA 1PZ3A 4M8UA 1GW9A 1OFQA 2HTMA 1NOFA 5E0KA 3FN9A 4F48A 4MY8A 3RPDA 2IQDA 2WVTA 4UTTC 4MB1A 3ANUA 4CNSA 3DFTA 2PI6A 2WSPA 2PEVA 2O92A 3P60A 1W9PA 2C71A 5FJIA 4EE9A 2J27A 2PDCA 2WNZA 1UD8A 1X1ZA 4S3BA 2FB3A 4UOQA 3NG3A 3VD5A 1MW0A 4JQAA 5BCAA 3SAZA 2QGHA 1YDVA 2WSRA 1D7FA 4O0ZA 4I9AA 3H2CA 2FVLA 2OJPA 3HGSA 4CNNA 2AAMA 3SUTA 1JCXA 1XCWA 3LPFA 1FWSA 2WZEA 1P6BA 1A5OC 1SZGA 4A21A 3S4TA 1A0EA 1W3JA 4QG6A 1BTCA 1PKNA 3LM3A 4IJBA 1EP2A 2VXNA 3URNA 3TAOA 1O68A 1OCNA 3N2TA 1OGGA 3PPHA 1EEXA 4JIRA 3WF0A 2C8NA 4ZR8A 3AIEA 1OQFA 3TN3A 1J0YA 3CHCA 2OQYA 3BAXA 3F4DA 4B3KA 3BC9A 1Z41A 3H8AA 1XLMA 3PTMA 2QJJA 1SZRA 4ZTYA 4US5A 4XG1A 5ABFA 1UWIA 1IWBA 1VBRA 5M5DA 1WUEA 2CBUA 4DJFC 2WXDM 1FHDA 3TN6A 1CXFA 1BWKA 4TMBA 3PWGA 4WOZA 1W5NA 1JZ3A 1J5TA 2WAGA 1CYGA 4OECA 3AMDA 1R38A 2PZNA 4F2TA 3CB8A 1ADOA 3C0SA 3G18A 2XSXA 2F61A 3E0LA 4C6KA 1JD9A 2X0HA 1NQ6A 1BGAA 1QFEA 3ZM8A 4ORIA 2QJNA 1H4PA 2VDHA 2W5FA 3CL6A 4Z1YA 3MB9A 4XZLX 2BNJA 2NLYA 1R5YA 5U7SA 3ZT5A 4B92A 1UIOA 7ENLA 1T41A 1ZCCA 3QLLA 3OQEA 1DHKA 3OEXA 2PS2A 3JVAA 1WAWA 2ZE0A 3PR2A 2GSHA 3W6MA 4TX8A 2VFGA 4J40A 5HNRA 3GHRA 3BGAA 3SIZA 1J6PA 4NILA 2PDGA 1BD0A 1DE6A 2Z26A 3MCOA 5LKYA 5HK4A 1QPOA 2F2HA 3G3MA 2VOMA 4X0VA 2PGEA 3C8NA 1X6NA 1XYFA 1F6KA 4ZA0A 4B9ZA 4RE2A 3PC0A 1HP5A 1M04A 1BG4A 3HO8A 1CENA 3GDRA 1US2A 4R7OA 1O5QA 3GYEA 4MPQA 3R0DA 2DGAA 2J9XA 2PDMA 1GOKA 3HIJA 3C3NA 1TV4A 3BO9A 3P14A 1Q7QA 2IKGA 1OFAA 1KV5A 1LBMA 1QASA 2ISVA 1YQ2A 1V77A 4QJ4B 2H3DA 3AXMA 1H7PA 4U2ZA 2PF8A 4XIMA 3EEGA 5G4WA 4DWDA 4ACYA 3FYYA 3TR2A 4R34A 3WX7A 1FCUA 4DELA 1Z32X 2J9ZA 4C6CA 3UA3A 3W29A 1AA1B 2CESA 3LEPA 3BL3A 3TTEA 2C6QA 1Q4NX 1WX0A 2EG8A 3S9IA 3OYXA 2YXOA 4UTHA 1IR2A 1Q66A 2VZUA 3EDDA 5C2CA 1TQJA 3GC2A 3GNRA 4RE0A 2XVLA 3G8EA 4UTLA 3HPFA 4GC3A 3E38A 1OINA 4NX5A 2CWXA 4WCJA 8CGTA 1QWGA 3EWWA 4US5D 1R0MA 3UQNA 2D2HA 3T0TA 2O7QA 2JF7A 3W1PA 4QJ5B 4NYUA 5CJNA 1VPYA 3TC3A 4L1GA 2VQUA 2FPYA 1TPC1 3M5XA 4PTNA 1KTBA 1PB0A 5D8ZA 1JRCA 2IKJA 4H9VA 8RUCA 3W00A 1WKDA 2QUNA 1TX2A 2XVKA 3W7QA 2XJ7A 3FEQA 3CC1A 2GLKA 1NF0A 1OX4B 4GABA 4F8XA 1DWHM 5FJUA 3MY9A 3N1AA 4AY1A 2ZRWA 3SN0A 4UFHA 1TTIA 5KZ6A 2OTDA 4GO8A 3L4VA 1W5MA 4O52A 4IXXA 1VFFA 5CSUA 1KR1A 2IS7A 3N4FA 2BHZA 1HJXA 4YVPA 1DXIA 3S1GA 2HEJA 5IBXC 1FWCC 1PE1A 5HAOA 1NELA 1Q63A 1EF3A 4UFIA 4W88A 4F0RA 2YCEA 3O2LA 5EFFA 3AYTA 2HBXA 2BOGX 1IXPA 2CCRA 3LLFA 1V51A 4HQVA 1FH7A 5JMUA 3LNPA 1XUUA 3P2VA 4UR9A 3V36A 4LCRA 2QJIA 4DWSB 9XIMA 4H4IA 1E5NA 2RDXA 4QX4A 2VC5A 2V6AA 3PAOA 4WJ8A 3SN4A 2R1MA 1HL9A 2DUZA 3KHDA 5CC6A 4MWAC 2DW7A 3JRKA 1TJRA 1EKOA 4N42A 1B3WA 4X9SA 5HWJA 2AMXA 3WMSA 1D8CA 3QLDA 1EQCA 1TELA 3GRIA 3UXDA 1BWLA 1VBHA 4AZCA 1HUVA 3VOIA 1B57A 4IMDA 3HMCA 3S83A 3VD7A 3ZWTA 3PNZA 4JTEA 1S5WA 1HP4A 1JGMA 4KWVA 1TFVA 2X09A 1V7AA 3W1NA 5I07A 3CAWA 1M03A 3PZOA 3R4IA 1EP3A 3CT2A 5F2LA 1KM6A 4GZIA 4LY8A 3MSRA 2FMOA 2MNRA 4H19A 3O6CA 3HGJA 8A3HA 2VFEA 1KBJA 3CAVA 3OTRA 4FIQA 1E4MM 4WEVX 4JFVA 4B91A 3IPWA 3GR7A 5AHLA 3S1WA 2Y5EA 5FJRA 3KOZA 4LAUA 1RBAA 3WEZA 1OGBA 4DBSA 4Z08A 4ZSUA 1FWEC 2YBVA 4V28A 1ENUA 3TTQA 3RM9A 4HNTA 5JUVA 3TP4A 1E0TA 4FA3A 4FLQA 1AG1O 2PLMA 4DWSC 2YYTA 2CZ5A 1JQXA 4CCCA 2V67A 3BMXA 3KBVA 1Y65A 3UR8A 1R85A 3QPYA 1Q7MA 1SO3A 4X60A 1C7TA 1N55A 2X7WA 2WKJA 3PBUA 1VBGA 5AZ1A 4JXCA 1QNVA 3W27A 2WC7A 2Z7GA 3GHTA 3N15A 3VD3A 5M3WA 3W2JA 1GOWA 3WQOA 1L6WA 4IQEA 2Z6JA 3C0JA 3C8FA 3K5XA 3AICA 3HGOA 3R5EA 3LA4A 3NO1A 4D6JA 4ZXLA 1SW7A 4KFOA 2YDQA 1VZWA 1C9WA 4UTKA 1RALA 3WYZA 3DCPA 3IJLA 3HM7A 2DSZA 4UOZA 3SJNA 1UH3A 3WJWA 4MM1A 3R43A 4L4OA 4CD5A 1VFOA 3AXXA 3ENLA 3TR9A 1EA9C 3QW3A 4WKHA 5D33A 1RA0A 1J5SA 2GGHA 2P76A 4I9JA 3MUY1 1W31A 2OOGA 1ODUA 2V8ZA 2ON3A 3QQ0A 3KOFA 1QHZA 1KTNA 3HA1A 4D6HA 3TSBA 3BW2A 1LDCA 3BTNA 3N2MA 4JQ3A 3WBXA 3I4KA 3BW4A 4Z2GA 4LAOA 2VENA 2I16A 4W7UA 4MUPA 1G7VA 1QCWA 4KKXA 5HWNA 2D2GA 4LCSA 3S5YA 1MEIA 3WUGA 4JD4A 5DEZA 3W76A 2BGSA 4L6DA 9RUBA 4O28A 1UR0A 4ZVJA 2IPWA 1OFRA 2DQWA 1XKJA 3PF3A 3S5OA 6REQB 4ML9A 5CZSA 1K9EA 2QGYA 3E49A 1TVLA 3R13A 3NQ8A 4DY1A 3A22A 3FGCB 3EB3A 3LRKA 2G0WA 3CLMA 4Q4KA 1TPVA 5AC6A 4LYQA 3EX3A 1KR0A 4W8BA 1UP2A 4FB7A 1UWAA 3BLKA 2ZX6A 4B15A 4V27A 3EWYA 1CPUA 2QIIA 1ONXA 1UKPA 4G1NA 2FGBA 2HS8A 4K7YA 3W0KA 4BI6A 2J7GA 4W8AA 2P8BA 3I3EA 4QFUA 3WG6A 1E9IA 2UBPC 2Y70A 5F4SA 1E3XA 4O0QA 3GUWA 3A4AA 4HSNA 3HV8A 1S2AA 1V3KA 1P5BA 4WZHA 1G4PA 2FFCA 5K9XA 3U7VA 1EC9A 3MO4A 4F2UA 1XH1A 4YTUA 1K3UA 3AO0A 1BYDA 5LZLA 1BEUA 5C7VA 2X42A 1W3IA 1RAKA 4BCEA 5IRPA 4H6QA 2E1DA 1TPWA 4KRUA 3QKZA 1ITUA 2I57A 3M7SA 2OPJA 1YNQA 3DGBA 2CLMA 2DY3A 4Q4QA 1W5QA 3B4UA 5JH1A 4O57A 3A13A 3II1A 4ZZ9A 4KF1A 1JDAA 5FEPA 4BQ4A 1FH9A 3CMFA 1FWFC 4O53A 4M7TA 4FI4A 1S2WA 4JFTA 3HURA 4GFSA 5A6SA 2BXZA 1UOZA 1DTNA 4JIHA 2A3CA 2KX9A 1M68A 2D24A 2RJGA 3EWUA 3LM7A 1KTCA 2OWCA 3ZLHA 3G2GA 4MFDA 3CT7A 4FPSA 3SY1A 1L0PA 1NDVA 1RZMA 1W2VA 3RX3A 3YPIA 3RILA 3WMLA 1PCKA 1B90A 4DZAA 1XXXA 3GUGA 3KTSA 5GVJA 4WKFA 3R0UA 3P67A 4M6UA 1EHAA 1W5OA 1W1PA 4KRZA 4WY0F 4E2VA 4E4UA 2R82A 5D2XA 1D7KA 2CZDA 3EBVA 3WBAA 2QUVA 4OT7A 1ZALA 1OVDA 2F9RA 3S1XA 1Q5MA 4PMRA 3OLDA 5DXYA 3NZ1A 4AF0A 4GIYA 4V2XA 4UZSA 3BJSA 2ZVRA 4RV3A 4XB3A 2PWDA 3WH6A 1VYRA 2ZCGA 1H49A 1W9BM 3EMZA 1DEDA 2HV5A 1KGXA 4PRWA 2NUYA 3EOLA 1BAGA 1YKWA 4RNFA 5F4XA 3Q4DA 4LYRA 4I5RA 2BVDA 4UBPC 5FEWA 1FXPA 2PODA 3CPRA 1XS2A 1F2JA 1I6NA 1TB3A 4HCLA 3PVFA 1NOWA 3N9RA 4F9DA 3PY2A 4RV8A 1CLVA 5D02A 3RO6A 4HHLA 1PHQA 1S38A 2RKXA 4OUEA 1DIDA 3E02A 4TVCA 1FRBA 2QQ6A 1VFSA 2FZDA 1ISZA 1IF2A 1SMAA 1U5VA 3NZQA 1UCWA 1V08A 3OZMA 4WGXA 1MUWA 1AJZA 1RCXB 3GKAA 3HGRA 4JX4A 3RCNA 3H2OA 4QE5A 4ZBCA 3AS2A 4BZYA 2J75A 1PSCA 4D6DA 4GQ0A 2XFYA 1ZS2A 1AVAA 5CGQA 1WXYA 3NM3A 2R94A 1OFBA 2E67A 3GU2A 5E5CA 3ARQA 1JVNA 1J9YA 1AZ1A 3L9CA 1DQUA 2IKIA 2CHOA 4IGSA 2FZ9A 4ENLA 5FACA 1PKMA 4O0KA 4GHRA 1XICA 4EVZA 1EPVA 1XPYA 4PSRA 3EB2A 3H4XA 3T40A 1KRMA 4V33A 5G2HA 1I2QA 3STGA 3LBMA 4IJCA 2B81A 4CQBA 4GX8A 4XTIA 2EKCA 3WK3A 4D1JA 1T96A 2XHYA 4LRTA 3NQEA 2V2CA 1EEPA 4PBFA 4JN8A 3QZ6A 4L6HA 1XGZA 2ZVIA 4LUIA 1ADDA 1JR1A 1TVNA 1KCLA 2CW6A 3L4ZA 3UY7A 2DH3A 1XYCA 4GZEA 4JR5A 3T44A 3BE7A 4L1WA 3SIMA 1SFTA 3Q37A 3N11A 3TN5A 3DI1A 3HTWA 4WKAA 4PEEA 2BP1A 4NUWA 1RD5A 1ICPA 1WDWA 1DHPA 2Z1VA 3NVDA 2PLCA 4IFRA 1T99A 2R8WA 5HPCA 2QJGA 2XVNA 1VLWA 1W3TA 2RDUA 2J7EA 5KINA 2QS8A 1KV8A 3THCA 4IPLA 4AHQA 3APYA 4P8VA 1LL7A 3WL1A 4QSHA 1M7OA 1HVQA 2GQAA 5EPDA 1QT1A 4GUFA 3UR2A 1XBVA 2YDSA 5LIYX 4Z0JA 5EL1A 4LS2A 1XW8A 2QDDA 2PUZA 2Y7DA 3W07A 3W53A 2QCFA 2ZA2A 5G2IA 2HNEA 1WZMA 5MKGB 1Z69A 5EFDA 3QV6A 1E1EA 1K4HA 3T05A 3CUZA 5AFDA 3QM3A 1XIIA 1XGDA 2YXXA 4N4PA 5G4HC 1FX6A 2P1FA 4DYKA 3N18A 4S2BA 1REQB 1XYBA 2WMHA 1YPFA 1EC8A 4EP8C 4O1AA 4QDMA 3SCTA 1ME9A 4FNTA 4CVWA 1JD7A 2DW6A 4GO9A 1QW7A 1ZHAA 3D5HA 1TKKA 1Q6GA 3QPEA 3QQWA 3KCJA 1UD2A 1NDZA 4XZMX 2VYOA 3EA3A 4I6KA 3GG0A 1KFKA 4ZOAA 2GJLA 1OK4A 4Z2IA 1Z44A 1W0MA 1WKEA 4MKNA 4MDPA 3TQ0A 1AZ2A 3V5OA 1KKRA 3EAUA 1NP0A 4IZGA 3SCQA 3V5CA 3GFZA 1RJPA 3GVVA 3SQMA 1RJQA 5JQ9A 4C7DA 1H7WA 1TMHA