2QUNA

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii in complex with d-fructose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 112
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2qunA00
1QTWA 1XLGA 1XLCA 4XISA 1XINA 3C0SA 3DX5A 2NQJA 3CWHA 4ZBCA 1MNZA 1XIJA 1XIEA 4GQBA 4ZB5A 5H6HA 2NQ9A 3CQHA 1XYBA 3FVMA 4HHLA 4EACA 3M0HA 5H1WA 4EAYA 3UXIA 4QDPA 3QXBA 3KCJA 2XISA 3CQJA 3IUHA 2I56A 3UA4A 4LNCA 2QUMA 2QULA 3TC3A 5XIAA 3ITYA 3M0MA 3N4AA 4XIAA 3WQOA 3BANA 3NGFA 4X63A 4QEEA 2Q02A 1XIHA 3XIMA 4HNOA 4ZB2A 5B7YA 3ITXA 3AYTA 4HGXA 3ITLA 2G4JA 5XINA 1XLFA 1DIEA 2J6VA 2X7WA 3KBSA 9XIAA 2ZVRA 4YTTA 2HK0A 4X60A 1XLLA 1XYLA 2GYIA 3CNYA 3BWWA 3C0LA 3XISA 4YTSA 4QDWA 3VNIA 1XLMA 1A0DA 1DXIA 3DBNA 3IUDA 4HHMA 4PFHA 1XIMA 3AALA 1DIDA 5EMLA 3KBMA 5C9ZA 1XLJA 3VYLA 3KCLA 4KW2A 1XLBA 3AYVA 4OVXA 5AVHA 3VNLA 3KWSA 4US6A 5EMMA 5B80A 3KCOA 3CQKA 3M0YA 1OADA 4QEHA 1XISA 1QT1A 1XYMA 4GJJA 1S5MA 3JU2A 1A0EA 4GLEA 5B7ZA 1XLIA 3TVAA 1MUWA 4DUOA 3VNKA 3BDKA 4A8RA 3BZJA 7XIMA 3KBVA 1D8WA 4PGLA 3OBEA 1TZ9A 4ZB0A 3M0LA 3P14A 5EMJA 3GNXA 4A8LA 2QUNA 4A8IA 3AAMA 3P6LA 1I60A 4J4KA 2X7VA 1XYAA 4XSMA 4K3ZA 1XIIA 1XICA 1DE5A 3M0XA 3U3HA 5I7GA 4XIMA 1XLAA 2HCVA 1XYCA 4W4QA 1XIDA 3KBNA 3VNJA 3KBJA 4QE4A 4A8NA 1K77A 4YTUA 3QC0A 2QW5A 2XIMA 4YTRA 4K1GA 3U0HA 5AVNA 2G0WA 3C0QA 1O1HA 1XLKA 1XP3A 1A0CA 1I6NA 4GJIA 3L23A 2ZDSA 1XLEA 6XIMA 3IUIA 1XIGA 9XIMA 2NQHA 2GVEA 3KBWA 3XINA 1BXBA 4Q7IA 1GW9A 3LMZA 4QE1A 8XIMA 1XLDA 3CQIA 3QYSA 6XIAA 1QUMA 3QZAA 5EMKA 4YTQA 4E3VA 4DVOA 3VNMA 1YX1A 4G56A 3UU0A 1S5NA 1BXCA 3ITOA 1XLHA 8XIAA 3KTCA 5J8LA 1CLKA 1DE6A 3M0VA 3UVAA 5TNVA 1XIFA 2OU4A 4XSLA 2GLKA 3ITTA 4XKMA 3UA3A 3BZGA 2GUBA 4X61A 5FA5A 4QE5A 3ITVA 1XIBA 5XIMA 2I57A 2HK1A 2XINA
chains in the Genus database with same CATH superfamily
3KLKA 1ME7A 3GKFA 4JD4A 1XUZA 3AXIA 4YCOA 3WYZA 5AHEA 3IACA 3TSDA 3L4WA 1TRIA 5CJ5A 3LZ3A 3VMPA 3QMRA 1ELSA 1XBYA 2D0FA 3PS7A 4I7VA 1ZBCA 2XYLA 3GTFA 1MEIA 2QUUA 2HK0A 3WLHA 1WP6A 3GHTA 1UWIA 5FL1A 3W7CA 4ZTXA 2BVWA 2Y4SA 4K2SA 5AVHA 3AOFA 3MANA 3WBWA 3AIRA 4HCLA 4EAMA 2WMHA 5ABFB 1XCWA 3V5OA 4N9CA 1C7SA 1N8FA 2JKAA 2PB1A 2ZWYA 4P7OA 2X1UA 3SRKA 3P7YA 1U5VA 1FWIC 1BKHA 3G1RA 4GXPA 2J13A 3QJAA 1NFGA 2WVSA 4P5UA 4JKLA 4WY0A 3AMDA 3DFYA 2NQHA 3GNRA 1V3IA 1VC4A 3A4XA 1VFFA 4E0CA 4GKLA 1W0MA 1RJPA 4J3VA 4W7WA 3U4FA 1B3YA 1S1PA 5F2IA 4D6IA 2J78A 4O8RA 4AMCA 1UKPA 3WDPP 2ZICA 1RJRA 4ZOEA 3QOMA 1OGSA 1XC4A 4IMDA 4R33A 3BV4A 4XIAA 3FA3A 4C6IA 2UY2A 1EX1A 1M1BA 1ZU8A 1DJGA 1V0NA 2DZWA 3S3GA 5J5DA 3GTNA 4L6HA 2ISVA 3H4WA 3GRIA 3W7IA 1H7WA 2A3EA 2OR2A 3PULA 3L5AA 5LA1A 4ADTA 4B91A 4A29A 2ZWZA 4IPNB 2DUZA 1T0OA 3M0YA 1HKWA 1KBKA 4LJ3A 3I3BA 3CQ0A 4DQWA 4OFCA 2OX4A 1NU5A 5I3GA 3QZEA 3MKVA 3A5FA 4UNKA 1JAKA 4BFAA 2HVMA 4D9PA 4AZ5A 4AFYA 3ZT5A 2G0WA 1C8QA 3GWQA 4AWUA 2Y7FA 1F8MA 4DBWA 5AHLA 1OD8A 4AISA 1E9YB 3ZM8A 1E1CB 3BICA 4A4AA 4EPDC 1BXCA 3CAVA 3TZNA 4LRSA 3INPA 2XTKA 4ZZ9A 3AXXA 3UXDA 1AJ0A 4FX8A 1MFUA 3SEPA 3WQFA 3WD3A 1SZFA 4MWAD 4QLJA 3ALFA 3TW6A 2CU0A 4OOUA 1H61A 4H7ZA 2TYSA 2VENA 2FHCA 2YGYA 1C9DA 5D09A 3PBMA 5CJNA 1DIEA 2DSUA 1F3TA 2X7WA 4GC3A 3GNOA 4OKDA 3TN4A 4ZFMA 1FQ0A 1XBZA 2BGQA 3UZXA 3GTXA 1V3JA 2HE5A 3I6TA 3W2LA 3PZ9A 2NW0A 3GXDA 2QS8A 2J62A 4ZCWA 3TVAA 1UASA 3FGCB 3SJ3A 2FHBA 3GG0A 4Q8MA 3FEQA 1W32A 1E0XA 3N14A 3QKZA 4LYPA 2R1MA 4UFLA 1DE5A 1SFTA 1EWEA 1EFZA 4NNAA 4R9XA 4U10A 1E5NA 1RPKA 5C7VA 4UTFA 2J77A 2P5NA 2QUTA 1NF7A 1IT8A 3O07A 3WZ0E 4G56A 5KSWA 4B2DD 4J9JA 2F6KA 3CHDA 1QHOA 2PPGA 5EA9A 4D6HA 1TIMA 1OX4A 4PTNA 5LNVA 4NXKA 1UD4A 2QCGA 4GQRA 4FEZA 1EL3A 2V30A 3DC0A 3CUZA 3LTSA 1PZ3A 4XBSA 5AYYA 3N2OA 1P0BA 3LGGA 2W27A 1EWDA 5JH1A 1PCKA 4NAFA 3VGFA 2QF8A 3BOXA 1ISVA 2FGZA 1FP8A 3R10A 2QJHA 3GUGA 5GQBA 2EHHA 4LYRA 4EX4A 4B5VA 1FKWA 3LQGA 4S3CA 1NELA 3SCRA 4LY4A 1TPB1 4OZOA 1DVJA 4QP0A 2ZZ2A 3S5ZA 5FF4A 1E0WA 1TWSA 2WAGA 4FXJA 4IPPA 4S2BA 1XISA 3EEGA 1JRBA 3BLIA 4UTWC 3BL3A 4DPQA 1G4PA 1C91A 3FA5A 2CZFA 3SSZA 1V6XA 2J7FA 1KRBC 1Y65A 3EBVA 3H2MA 4H8NA 1RVGA 3GVQA 1XYAA 2IW0A 4MFDA 5A8GA 3II1A 3MSGA 5I79A 1G4SA 4L4MA 4TQTA 2I1OA 4DHGA 3GO2A 3QBUA 1LJYA 4TVCA 1TPUA 2YPIA 4L9ZA 2JFEX 4NNBA 4HCDA 4JNYA 4JTRA 2VOTA 1XLKA 1W5PA 1SYTA 1VEOA 1KKRA 2BY2A 3EKLA 3R94A 3M07A 1TPFA 2RH9A 2EG7A 2PP0A 1AQFA 2BMBA 1EUNA 4WY0F 3FAXA 1XLHA 3B0VC 1OM0A 5D38A 4WKHA 2G5WA 2ON3A 2X05A 2OZ0A 1W1YA 4LYKA 1RV8A 3GNDA 3NQEA 5EGRA 2G96A 1BHGA 4NJHA 4DBEA 1JL8A 5FCZA 3M0HA 1ODZA 2OTDA 2QCMA 3CAWA 4ROQA 1M04A 1M53A 3NGFA 4KIEA 3V18A 3NPUA 4UZUA 1W5QA 5DT5A 3O6DA 3U4AA 4KETA 3M43A 1Z6KA 4RW3A 1A0DA 2FJUB 2PLKA 3F4DA 1XYFA 1DWAM 1P0EA 4N7QA 2QDGA 1VHCA 3W2MA 3PZIA 4N4QA 2INEA 3P74A 1QNQA 1OZQA 3GXNA 4LNYA 5EL1A 2J66A 5E93A 5HQEA 1WOAA 1PIIA 4DZIA 4REQA 4GOAA 4DUWA 4GYPC 3NM3A 1EGVA 2NX1A 3P6LA 2FHFA 5GPRA 3QOKA 4J2MA 1B54A 5LXXA 2DH3A 2AKMA 2PURA 5EY5A 1WOBA 2VR4A 3DENA 3LA4A 2ALRA 3AS3A 3H53A 2VRQA 3N9RA 3RF9A 3WD1A 1CX9A 4XX6A 2GWNA 3WQVA 5AB3A 1J10A 4M8UA 1RY0A 2PZNA 1IWAA 4GXMA 2CZEA 5CC3A 5CSYA 1E9LA 3UA3A 3SUTA 4QTGA 4L9XA 3KRUA 1JZ4A 3B40A 1CI1A 4BQ3A 4XQ6A 4U5KA 2VP8A 3CWHA 1M41A 3SI9A 1PKLA 2F84A 4EXBA 5C9XA 5K4ZA 4H9MA 4CQ9A 1YKWA 2W5FA 3EDEA 4I7UA 1E1FA 1M7JA 2AL2B 2ALDA 3BJTA 3U2CA 4QGCA 2J6VA 4L1WA 1BG4A 2ISFA 2FTPA 4NZ4A 2PDUA 1B1YA 4OWGA 4GNVA 2ACUA 1W31A 2XIOA 3IV3A 2F9RA 5CPSA 4DM1A 2GDUA 3O05A 2XZ7A 1D7KA 4H6KA 1QO2A 2H3DA 3NPXA 4BEUA 1BAGA 4ZQNA 4V1YA 1XQLA 4AX7A 3TYEA 1M7XA 5HAOA 4Z2GA 2XDFA 3CHVA 1HIZA 3HPSA 1FWDC 3CUIA 2D2JA 3MUXA 4HB7A 1VBGA 3FKRA 3LCGA 2VC7A 2QR6A 4MG4A 1JUEA 3W71A 2ZBTA 1F6YA 1J6PA 1E55A 3AIBA 3R7MA 3SUUA 1XSIA 3DXIA 4D72A 3FAWA 3DI0A 1R87A 2BHUA 1KXHA 1VZWA 3VD4A 1G5AA 1UUOA 3W72A 1WZMA 5KMYA 4Z17A 1PTDA 3KOZA 3UZJA 3STGA 4TX8A 3VZYA 3KCJA 5H8PA 3IPWA 4HK5A 5D4YA 4WUIA 1AQ0A 4GZEA 2VI0A 1Z89A 2XVGA 4PMOA 1QBAA 2VUYA 4JKMA 1KR1A 3MQTA 4MWAA 1SW0A 5GJPA 3QM3A 1CBGA 5I3IA 3SR7A 1RD6A 4FLQA 3MVTA 3PF3A 3T05A 4WZHA 3BJFA 4UTIA 1QNSA 3BXWA 3D3AA 1DJIA 3NO5A 4EIVA 3S0CA 3G18A 2Y6ZA 3DHUA 4ROPA 1BVWA 4M5PA 4ORIA 4LVAA 3P81A 4F0MA 2A7PA 2WC3A 4YWIA 2OMAA 1VYRA 2PC4A 4PTDA 3P14A 3RGTA 4GQGA 4HYRA 1MMFA 3DFNA 4KWVA 3CTLA 3QLDA 3K30A 2D3LA 3S6TA 5DCDA 2AGKA 2ZA1A 4BF5A 5HATA 3OODA 4HU0A 3ZSSA 1VF8A 1MYRA 3H2NA 3LN3A 3LRKA 1BXBA 1DQXA 3CV1A 2EG8A 4JY8A 4IIFA 2X41A 3CO4A 2FZNA 4E38A 4HPNA 3OPSA 4S3AA 3W1RA 3LLXA 4IP7A 2QHAA 2YBUA 1TR1A 1QU4A 1PB0A 3BUVA 4B2DA 4G7FA 3IAQA 3VA8A 3EYPA 1I2NA 1V8EA 1XH2A 3O9NA 1JR1A 4K38A 1W6TA 5D05A 2CIPA 4ES4A 3CZGA 2J9YA 2Z1XA 1I9CB 2NX9A 4C6QA 3CPUA 3BLEA 5EMLA 1SO4A 1G0CA 2PDYA 3A4AA 1GT8A 1HO4A 2J9ZA 4TO8A 1H50A 2PWUA 1S46A 4IL2A 2YYUA 5B80A 4HVXA 1TR9A 3RG6A 5EFFA 4QJ3B 2P3EA 2PD5A 3I6RA 4JPGA 1PZ2A 5I23A 3OGSA 5A8QA 3W7GA 1P0KA 3L4TA 2NT1A 2OVLA 3H4GA 2PF8A 4NKCA 1VLWA 2F38A 2PU1A 4TX6A 5U4NA 3LCWA 3PPGA 4HSHA 3SSJA 4CD5A 4CQCA 4JXCA 1K03A 1EA9C 3C0QA 3GXFA 3CYJA 5C7HA 1M65A 3W27A 5HQMA 3OYZA 3ABQA 4HBKA 3P8JA 1UH2A 1Z42A 4UTJA 4WSHA 5HMEA 2QCFA 1MEHA 1O5QA 1UOZA 3VZZA 1O5KA 4XUGA 3WIJA 4AXNA 2YSWA 4Q6XA 1PKYA 4KKXA 4WK9A 1XLCA 1N2VA 2HRWA 1SJBA 1UR4A 4DXVA 3R5EA 3PUDA 1IEVA 1WNOA 3C56A 3TIMA 3ITXA 1U1UA 3LSCA 5HUOA 2A6LA 3WQPA 2ZVRA 4K36A 3GDBA 1HQTA 1GG0A 1QHPA 3WUEA 2ZZ5A 5I2UA 3MI2A 1BGAA 1DJXA 3KOFA 1B3XA 3LTYA 4V1XA 2CHOA 4GJJA 2FZ9A 3SY1A 1YE6A 4AB4A 2YXGA 1CDGA 4NRRA 2GQ9A 1EDTA 3B8SA 3AZSA 4JL1A 1DJWA 2GQ3A 5BXRA 4FPSA 5FF3A 1AL7A 3I4KA 4US5D 1ENUA 4JX5A 1E0UA 1BQCA 3VFLA 2DZAA 3U48A 3WX7A 3TOPA 3ZJ8A 3NTYA 3HQ1A 4QQ3A 3OBKA 1DIKA 5A2CA 2I5QA 5K9XA 4GD0A 3TYBA 1SO6A 5CPNA 4PEEA 1MRQA 4UQAA 3ONBA 3VNMA 4F0SA 5A3HA 2HWGA 4GYFA 3H2CA 2GUBA 1IEQA 1GKRA 3LXAA 4HZ6A 4WQ6A 4ML9A 3H22A 2Z7GA 4UC5A 5HQLA 2BVTA 5HA7A 2EQDA 1MO0A 1GUVA 3EWZA 4CN4A 2EPMX 2J6XA 1TV2A 4UFIA 1ZCCA 3BANA 3SECA 1KXVA 4GFIA 3AYTA 2PWHA 4TVUA 2PDQA 1VGAA 1TWWA 5LGXA 1ZPTA 3S5NA 3SCSA 3VUPA 5C0QA 1K7XA 3N15A 3RDKA 3IUDA 3DECA 3NQ2A 3NDOA 4NVTA 1KM5A 2CLPA 2XVNA 2ZRZA 3DFPA 4DB7A 5CJMA 2PMQA 3KWSA 5AZ1A 2PI6A 4Z1CA 4IG2A 1OQFA 2HROA 3SN0A 3EOEA 2OLAA 3M0ZA 3VNKA 4FO4A 3VKBA 3SQLA 2NXGA 1GVQA 3VDAA 4Q8TA 1JCMP 1LBFA 1CGWA 4XBKA 5A2BA 5A95A 5J5RA 1TTPA 2ZZ3A 3ZVHA 5DRIA 2HEJA 2AGTA 5A6LA 3EWXA 2J7DA 1PV8A 1XYZA 3WDJA 1TZ7A 4JN7A 3N4FA 5FJPA 1JGIA 3ANVA 4EF9A 3ZR6A 1OX5A 3LHZA 3QFWA 1UW9A 5G2HA 1MUCA 1R46A 1QI4A 3W1PA 2INFA 2B0MA 4HPHA 1AD4A 1SO3A 2C7FA 4JR5A 4MB5A 1LG1A 4DJEA 4GNJA 1KB3A 3QTPA 4GQBA 4UQCA 3M16A 5E0CA 3P0WA 5G4WA 5FI8A 1QOXA 2DZXA 3DOPA 4C1NA 3MMUA 2IQ0A 4R5EA 3WUBA 2E3ZA 2R1NA 3AYSA 3F2CA 3EPMA 2QIIA 3QH2A 4F40A 3NQFA 4IUOA 4Z42C 2W91A 2EJAA 1HTIA 4MLRA 2UZ9A 1KGXA 2Q8XA 3DIPA 4GIYA 1H7NA 2J79A 3M47A 1ISYA 1W3NA 2WSYA 4GK8A 4AXKA 4G9PA 3W7HA 1W9BM 3UYIA 1IF2A 4XG1A 1KV5A 3O0KA 1E5JA 3A5VA 3F1QA 4F9JA 1MQQA 4ML4A 3KTSA 1A50A 3ZO9A 1A0EA 3WMSA 2IQDA 5I06A 1T41A 4BF9A 2NLYA 3Q45A 1FFQA 4TVDA 3W76A 2HQAA 3AISA 1Q63A 2VX5A 3CGTA 3EWYA 3NURA 3EZ4A 1E4IA 2DSVA 1CXIA 3LXCA 1EJVC 1TZZA 3VGEA 1V6TA 3WDQA 2VTFA 4JICA 1XLAA 5GVJA 2VUNA 2ISDA 1W2VA 3OZPA 4JNMA 3B8WA 3AZTA 3ABRA 3W0KA 4JDYA 2W61A 4F0HA 1WE5A 4M19A 1O7AA 1WDPA 5T26A 4IM4A 1F07A 1XIFA 1SMAA 3TSBA 2PDLA 2WYSA 3I3DA 4KT2A 1HJWA 4F48A 8RUCA 3W7PA 2ISSA 2XIBA 2J47A 4O17A 1XGDA 5JH2A 4H9XA 1UZHA 1KFJA 1R2TA 1KXQA 5BOOA 1GOWA 1I2OA 4PH6A 3VDGA 4P8WA 2PGWA 2VEFA 5HNUA 1NFPA 4W8LA 1XLLA 2W6RA 3VD5A 1FCVA 3P3BA 2ZUWA 3AALA 5AOUA 1NARA 1F3EA 1U1HA 1KQZA 1DTUA 1GGOA 4B5NA 1A3HA 2J8GA 4GLEA 2XGBA 1OIMA 2XH0A 2CBVA 3GYCA 3NVTA 4PUNA 1XRSA 2ABAA 4LANA 3PUOA 1GW1A 3TZFA 5CGMA 3B8DA 1TA3B 4HOZA 2Z2BA 2Z7KA 2NQ5A 4ZOAA 2OT1A 4UMCA 3QC0A 3TNOA 5AC6A 4H8UA 3U0HA 3UJRA 3M0JA 2RJHA 1VPYA 2J24A 1DYSA 4O10A 2DT1A 1UG6A 3HURA 4Q7BA 1V0LA 2Z29A 4S2CA 4MJ2A 4OV4A 2OCZA 3EWDA 2D20A 4AW7A 4H6QA 3N4EA 3LHUA 4F79A 3PJUA 1O95A 5REQA 1O5RA 1OINA 4LUIA 4IIBA 4KESA 4Q6JA 3IANA 5FEWA 3GG8A 3NPVA 1DQWA 2OOFA 2V5DA 3W7RA 3JRKA 3BGJA 4HPXA 2OZ8A 3CV6A 4I90A 2BB0A 4MUZA 4ZGYA 3G1YA 3TV8A 2E1WA 1EPVA 2DU2A 1U83A 3HGRA 5C9ZA 4WY0B 3AIVA 3CIWA 1A5SA 2QJNA 4O52A 1R30A 3W1QA 3WQDA 4UTLA 3BAXA 2Y8UA 4XAGA 3GFYA 3VOIA 5EBUA 1T8QA 3EX1A 3ARSA 1XUUA 3UJ2A 1WQ5A 3GZAA 2D2OA 2F2HA 3GVGA 4GXWA 5A6BD 4UQDA 2WHKA 2VC9A 3UWYA 1QASA 2ZUVA 3OVQA 3WBAA 4XTIA 3PWAA 3PPHA 3DFHA 1HL8A 1JG9A 1BSLA 4D6EA 2V9DA 3KXQA 3I7SA 4L56A 1IT7A 1OC6A 1GPFA 3BQ5A 3HG3A 4US5A 3KBWA 1Q7ZA 2BS9A 3VIGA 4E4UA 4J2PA 4Y7EA 2P3ZA 3VIOA 3WLKX 2BGSA 5F7UA 5CZJA 1HL9A 2WK2A 3OHIA 3TK7A 4PUEA 5ECVA 1SQ7A 1OC5A 3K4WA 4PRWA 4IMEA 2GJXA 3BCJA 1TMLA 3P0XA 3RLGA 4MKVA 4R7OA 1RK6A 3W1LA 4DAFA 2X8RA 4O19A 1HP4A 3GC5A 4WLCA 4EXQA 2D2HA 1J9YA 5AFDA 2WMGA 4O8AA 1P5BA 4INFA 3OEXA 3G8RA 1V7AA 3TAKA 4KW2A 1NDZA 2RGLA 1NDVA 1WBHA 4JTUA 3G6MA 4IMGA 4C6CA 2WB5A 3BZJA 2EEXA 2E6DA 3FS2A 3TU9A 3RHGA 3GXTA 4H6EA 3VI2A 2CHNA 3EWWA 1UIOA 1FWHC 2IKHA 4K3ZA 2OO6A 4CU7A 1W5NA 1VJSA 3WNOA 5TF0A 3ENLA 2DZPA 4JYEA 1W3HA 1GOQA 4A3UA 5KZEA 2Y0FA 1ICQA 3V7PA 3SURA 1GWJA 3URBA 2ZZ7A 1U2YA 4KRZA 3APYA 3QYSA 3LGDA 4JQ1A 4CGTA 5JQ9A 4UTTC 5AKQA 1NY1A 3TNBA 1AMKA 3SUSA 4HCHA 1IWPA 2PTZA 2R9RA 5G2IA 2GGGA 4NSBA 3E3HA 1Q6RA 1SW7A 3W2KA 4KRTA 3NL5A 4JTIA 4JYFA 3IJIA 1SVDA 5AZ0A 3GW0A 3LV6A 2WMIB 3O3RA 2JIWA 4YVXA 3S4TA 4H9VA 1YRRA 1Q6OA 2XISA 2FTYA 5FEZA 4PR4A 5F4WA 1XRFA 3MO7A 1IIGA 2FH6A 1GVOA 1OSEA 2AAMA 1Q7QA 3UCDA 4AHOA 1QVBA 1PIFA 3GQYA 3C4UA 4AZBA 5GNXA 1YDOA 1TIWA 1BYBA 4AC1X 4JIEA 2EPLX 4U3CA 1E9ZB 4JTKA 3AYVA 2E1DA 3LENA 2QLYA 1XDMA 1KBLA 4AU0A 3IIOA 1OX4B 1P0DA 4ZQOA 1TWZA 2CXEA 1ADSA 5D9MA 4PTVA 2XVLA 4YVVA 3N9KA 3NWRA 4EK7A 1CW2A 2RUSA 4O16A 4GYJA 1OGGA 1RALA 1E72M 1P1XA 3MCNA 5CC7A 2VQUA 1VR6A 4HMCA 3VNJA 1E15A 3MB9A 4Y8FA 1PTGA 3E0LA 4NAFB 5FJUA 5C70A 3PTQA 1ZBVA 1Q6EA 3M0KA 4QX4A 5EMUA 2E9MA 4AEFA 1Q3NA 3TA9A 4LW7A 2HXUA 3RM4A 4BZYA 4Y9MA 1QPNA 4JTTA 4AVOA 4EOUA 1MXGA 5ENLA 3W1AA 2GVGA 1VBRA 4XD5A 1IXPA 1G4EA 2VFDA 4V2XA 3T78A 4XZHA 1CTNA 3DBPA 1DXEA 4QIUA 2NSXA 3RMEA 4R85A 3T0DA 3BLKA 3MA8A 3ARYA 1ADDA 2WBKA 5DQPA 1E4LA 2GYIA 2X1TA 1P6BA 3CUGA 4JTHA 1V93A 4B15A 7ENLA 3AIUA 4NRSA 3WNMA 1C8YA 1KM0A 2D73A 4ENLA 1XCFA 4DPPA 4NHVA 1GEHA 1W56A 1DWGM 3UWWA 3UWZA 2HVOA 2HS8A 4QEHA 4K68A 4GISA 3IJQA 2CFFA 2EPHA 3F7JA 2YDQA 2V3DA 2Y85A 4FNUA 2X42A 1ZP3A 3CB8A 5C54A 3ES7A 5FF2A 4DUXA 1TREA 3VFCA 2FTWA 1UD6A 3WK3A 2VOMA 3KBNA 4A05A 3F4CA 1K9FA 1H41A 4B9YA 3ARZA 3C86A 3L2LA 3L4UA 5T8GA 3B0UX 2NX3A 1A5OC 1SR9A 4DYEA 3WMLA 2OX1A 1FVPA 2YFNA 1YDNA 3HG4A 2OQHA 5IBXC 4O13A 4G2DA 3ZVIA 1UMLA 5KETA 3PC0A 3TN5A 2NLIA 1MXSA 4K8HA 2XUCA 3DCPA 3OLDA 4UOZA 3UXIA 2E09A 4OBSA 5LIXX 2L5HA 2VHLA 1GQJA 3OZOA 4REQB 1KFKA 3CS2A 3GU2A 3G1SA 5L9FA 4DJDA 4L4OA 3G1VA 3AMGA 4LBUA 1D3CA 4A22A 5LNUA 3R0UA 1G67A 1GHRA 1VKFA 3WJXA 4OIFA 4XZIA 7TAAA 3VYLA 1UOKA 4L6OA 3VD9A 1DJYA 1FWAC 4H7VA 1TV3A 2P0IA 3BPWA 1PDZA 3FVDA 5I3FA 1KW1A 3AIQA 2X1SA 4S3BA 2FPYA 1D8WA 2XIIA 4JX4A 3KHDA 2ACQA 1K7EA 3M0LA 4NY2A 3LI1A 3WLMA 3O1NA 3ZS4A 3LB0A 2XM2A 2OODA 3M6YA 4GKTA 5HMDA 1E71M 3NYZA 1AL8A 1OFAA 5C6MA 5FJRA 2Y7EA 2WZTA 4JTQA 4N6FA 1TV4A 2G3JA 1R7OA 1A0CA 4E5TA 5A6BA 2GSEA 4FXRA 3HOJA 4M3PA 1GYNA 1KBJA 4FNTA 3UPWA 2PCEA 4KCWA 4F66A 2J7HA 1WCGA 1R3YA 2DZUA 4RW5A 4KCUA 4WRHA 1YXCA 5C71A 4CNSA 2YYTA 4FALA 2DIEA 1TVNA 1OZMA 1XH1A 1E4NA 3K13A 3NOEA 3TJ4A 1HX0A 3PBVA 1BLIA 3FLUA 1TJ0A 3CEPA 5T9CE 1EEPA 3KS5A 5EB8A 3AFBA 2C8NA 3LSBA 3GZ3A 5HBFA 1TVPA 4H19A 4NZCA 4TMBA 5B7YA 4O1BA 4GFSA 5I3KA 5HNNA 1PWMA 5FSDC 1EP3A 3WD4A 1N82A 3KP1A 3UZ5A 1VP5A 4XV0A 1WV2A 1X6LA 2GUUA 3WLSA 4O1EA 5LGZA 1GQNA 1ML1A 3ARUA 4OU1A 1E6XM 2A6NA 1NQKA 4QFUA 3BCDA 4AUBA 4HK6A 1ITCA 1X7FA 2YX0A 4F0KA 3UR5A 3GKAA 5FKYA 4XSMA 1NWUA 4IF2A 2QCLA 1XD0A 1H0GA 1UQZA 2G3IA 1A5KC 3TLLA 3W53A 2QF7A 3CPGA 3ISIX 4HA1A 3CUJA 2WM0A 2ZA3A 3W7JA 3OTRA 1LWIA 2A4AA 4AD3A 1WZLA 3TMQA 4JTCA 4CQDA 4MWAB 2YCKX 4YTQA 3PZNA 1QW7A 3AUOA 7PTDA 4CKQA 4ATWA 3T42A 2XU2A 3DYOA 1DWIM 3M7SA 5DMNA 1FCQA 3V1PA 2WM1A 3CAQA 4PRTA 2NVCA 3GFZA 3TLQA 3S2MA 1Y5XA 4N2YA 5I24A 2W92A 1R6WA 4XD3A 2A2IA 1QPOA 1JCTA 3N4AA 3GIPA 3ATZA 4IGMA 5H8MA 2GZXA 3XIMA 2I7GA 2OO0A 1A5UA 3N2MA 3MTWA 1G6CA 2QV4A 9RUBA 1E0TA 1LDCA 1F76A 2HBVA 3CWOX 4GACA 4AEOA 4ADSA 4N4PA 1WUFA 2P50A 1JCNA 2PDJA 3FK4A 1OK4A 1KV8A 3FKKA 1FCBA 3VIFA 4A3YA 3RCMA 4GGHA 5EPDA 4PUMA 1AH0A 1RP9A 5EBAA 2YA2A 3MO4A 1XLIA 5C8BB 1R7AA 4NYYA 1PYMA 3CXOA 3R25A 4FXFA 3SUVA 4KGJA 3FHQA 3W29A 3OQ8A 4UTWA 3GLCA 1FOBA 1CGUA 1ECEA 1YTDA 3MI3A 1NOWA 3OHMB 3VM7A 1PX8A 3T6CA 4P8XA 2HISA 2HCVA 3E2RA 2KX9A 3MI6A 2DQXA 3UY8A 5ABGA 3W7DA 4WF7A 4ZE5A 3IUIA 4HNCA 3N13A 1OVDA 2Z25A 1K9EA 4Q3MA 2D2GA 4LOCA 4ZO9A 4FLRA 3W84A 2OYMA 3GXIA 3N34A 4I9AA 2DIKA 3VGDA 4D6DA 3C2YA 1LL7A 1FWJC 1H62A 1UH4A 1P1MA 2VRJA 3GVRA 2XFFA 5BRQA 4L5ZA 3W7QA 4IQDA 1XC6A 2W4XA 3FNDA 1W3TA 1E6QM 5I0DA 3W01A 4CQBA 3L4XA 2OKOA 3SY5A 4XZWA 2CW6A 5BMXA 3U2EA 2F6UA 3C2VA 2Q01A 4RCXA 4J3XA 3PZTA 4IT1A 3M4HA 1SR0A 4GQ0A 2VZSA 4Q8VA 2B4GA 3ARTA 1ISXA 1FDJA 1S2WA 2WW5A 4O18A 3KWXA 4HPJA 4H8HA 3SN4A 1TTIA 3N6QA 3D5HA 1UA7A 2WOQA 4GI6A 4PFHA 3O6YX 1VJZA 1W1TA 2VVSA 4RDZA 1V3LA 4JTDA 2HDJA 1KO0A 3LPGA 4P8VA 5IM51 3MSDA 1TKKA 2DDXA 5D9PA 4HNNA 1TYGA 4IGHA 2QDHA 1CECA 1L0PA 2CBJA 4OBRA 4HPGA 4PBEA 4A8IA 3FEMA 3NA8A 2FYMA 4FMVA 2O4MA 4GYPA 3W6MA 3WL1A 1W3JA 4L80A 3MZ2A 2BOEX 2C91A 4J5NA 2VMFA 3PAOA 4LC8A 1I45A 2E4TA 1EHNA 1XLEA 4QCEA 3VGGA 1V6VA 4CD7A 1QDSA 3MDUA 3A6OA 2IKJA 1EIXA 1K70A 1NOFA 3GYEA 1ZZMA 4K39A 4RL3A 1W1ZA 4MY9A 3HB9A 2YL6A 5IHSA 2GVLA 3T81A 2GJRA 1H1ZA 1WKFA 4ZO8A 2GUYA 4GIEA 3CH9A 2A1YA 3PN8A 2YR1A 1VFOA 2WSKA 3H12A 2QUMA 1US2A 2CBUA 2OWXA 4WR3A 1NWSA 2WQPA 1XXXA 3NQ7A 3CWNA 2RAGA 1DBTA 4XZ9A 2ZX5A 1PAMA 1P43A 4X22A 4NF7A 1IQ8A 4CCZA 1I8JA 3H7VA 4DZ5A 5D8ZA 2WQDA 1FY6A 5U7SA 3B9OA 3ZYZA 2OYLA 1VCGA 2BX7A 3HTWA 3SCPA 2WMJA 4DI8A 2WNNA 5HNRA 3RCYA 2R24A 1E6SM 3BMWA 1XCXA 2Z28A 3KE0A 1ZS2A 3ZQ9A 1F6KA 2Z2AA 3O16A 1GOOA 4A8LA 4B9ZA 2QVHA 4JTGA 1SU5A 3CZEA 3BLFA 1OD0A 3IJ8A 1ESWA 4C6JA 2PZ0A 1XIDA 3PANA 3VOJA 4U3AA 1D7FA 4RR4A 3M46A 1K9TA 3VU2A 1V3HA 3GBDA 4UR8A 3TEVA 2EPKX 1YX1A 3EX3A 4HTYA 2OZ3A 3NL2A 3S2CA 3T07A 5DX7A 3CZ8A 3TCEA 3R4IA 2WHLA 2X0HA 1CXHA 2WJDA 2I57A 3KRBA 1S2UA 2NWRA 4GPNA 2NUYA 2O7QA 3SCVA 6CGTA 3QGKC 3AS0A 3CQJA 3IUHA 4LGXA 1DWJM 4RE3A 4R3UA 2D69A 3EA3A 1XWYA 1JFXA 4UCGA 1DV7A 2CLHA 2QNEA 2V81A 1NOUA 3ABSA 3BSGA 3IIXA 3S5SA 4I9MA 3CHCA 7REQB 2YCIX 3GDRA 1U30A 3HPAA 3ZVHB 3UQNA 2Y89A 1BXNA 2G4FA 3GE7A 4HN8A 4HHMA 3TMLA 4S3GA 3RFAA 1TPC1 4HYVA 3KCOA 4UBPC 3U8GA 2C14A 3PBGA 2FVMA 2PU0A 2ZX9A 4KWOA 1JD7A 1W3LA 3K2GA 4C6MA 2WV8A 2YA0A 4A35A 1ZJAA 1EOKA 3Q65A 1GNXA 3CH0A 1F05A 1QFEA 3S83A 3V75A 3WLNA 3NQDA 4DJEC 2R8WA 4C1NB 6PTDA 3HQOA 3HFTA 1XP3A 5LIWX 1QI2A 3GU9A 3VOGA 3TJLA 2V63A 3H2AA 8XIMA 4JFSA 3WLOA 3L2MA 1CLKA 5FL0A 3R11A 3WO8A 3VKKA 2PRMA 2WANA 1WZKA 1GPWA 3SQSA 4CUCA 1XLGA 3MYOA 1WAWA 1MQPA 3JUGA 3TYUA 3EMQA 1JXJA 4KF1A 2AQOA 4PCFA 1X98A 1RBLA 2C79A 1FCUA 1M03A 1BVNP 1JZ7A 2HJPA 3WD2A 4KH2A 2C0AA 4GQQA 2ANUA 3WK0A 2CLOA 3VKJA 1UWSA 5A8OA 3UR7A 3BARA 2CWNA 3PY2A 2QJIA 1R3QA 5M3WA 4DF0A 1F73A 1JRCA 1Z41A 1E6PA 2Z1WA 3LNMA 2E5CA 2I16A 5TAOA 1LTDA 3TJXA 1V4YA 1RBAA 4MPQA 3MV11 3TR9A 1UR3M 3EB4A 4BQ5A 2WHMA 1H5VA 2FZBA 1FDZA 4C6LA 4CQ8A 1P48A 1JYWA 2GSHA 3UWUA 4O53A 3ANUA 2YZ5A 3IGUA 1I1WA 3G77A 4AIEA 1TJRA 4A8NA 4DO5A 4Y90A 3WL0A 4WGXA 5BU9A 3E0WA 4NI3A 3SCNA 3UESA 1VCVA 5A6TC 1SM9A 5EMKA 1X1NA 1FP9A 1N55A 4OBTA 2J7CA 3VE7A 1R9ZA 1ZY9A 2YDSA 3MWCA 1KLYA 3LXBA 5LA2A 1X39A 3E5BA 3SCUA 4OUIA 1O68A 3NM1A 2PODA 3AS1A 3MCMA 1OFDA 2Z1VA 5TBOA 4N02A 1VLIA 4QDPA 1UBSA 4JHMA 4QHRA 5K4XA 1Y5VA 4GUJA 2VZUA 2PDHA 4AF0A 2C15A 4J7RA 1L8PA 3RPTA 3ITLA 3GNNA 3GW3A 5EFDA 2ONEA 2X09A 3SCWA 3BWWA 4RK8A 1XLMA 2FFCA 1WKEA 5T9BG 2YB4A 4EANA 4JQAA 2G95A 2VX6A 3UPMA 4XO6A 3GHRA 1PWLA 1VFMA 3G1XA 2C1GA 3OZYA 1LZOA 1TO3A 1NF0A 3H2EA 3BDKA 2I9EA 3BGAA 2ZXDA 3WF4A 1LRQA 3K4AA 5CPLA 2OWWA 4ZSUA 3EDFA 3QR3A 2Z4GA 1AODA 3TE9A 1IGWA 3W3OA 1T99A 3S2LA 5E9XA 6XIMA 3HPZA 4JBRA 4GO9A 3URNA 4UQ9A 2Y8KA 1YE4A 1MXDA 3RAOA 3VC6A 4HNVA 1POKA 2GGJA 1IHIA 1WDRA 1BF6A 2QPUA 2X2YA 4LY8A 3WLQA 2B7PA 1VENA 1JNEA 3G1FA 4B5XA 5E5CA 4KEMA 4CNPA 2H3BA 4M6VA 3TTYA 2JK2A 2E6AA 1G9HA 1KCKA 1V3MA 1QJWA 4GY0A 4YPJA 3L66A 3KUMA 2QCCA 4WJ8A 1F9CA 2JKEA 4IIGA 4S1FA 5A6MA 2OJPA 2H6RA 4PMRA 2YXXA 4W8BA 2VEGA 1TB3A 3O8AA 1K3UA 4PMYA 4UNLA 2W0UA 5ABTA 2DT3A 5LSMA 5D2YA 2GPTA 8A3HA 1TPEA 3L4YA 1Z32X 1ZFJA 2OLHA 4RX0A 1M6JA 3PUGA 1W3KA 4YU1A 5B7ZA 2MNRA 2GVYA 3QLLA 3OVRA 2PDPA 2WPBA 4YWSA 3QKEA 3LK6A 2V3EA 2YCJA 2Y1HA 3K46A 4CD4A 2ZQ0A 1J12A 5I02A 1XICA 4U5IA 4GH3A 4ACYA 4DO4A 3VNYA 1YBQA 1TJPA 1BD0A 4U4MA 4TV6A 3AWOA 1UR8A 4W8AA 3G24A 4O57A 2O92A 1F3XA 2QJGA 4HZ7A 4AVFA 3A3WA 3GVWA 4C7FA 3I65A 3FSUA 3ITGA 1BYCA 3LM7A 3ITOA 1FFRA 2JALA 1HW6A 2JBMA 5HMFA 3UXAA 1DQUA 4YYFA 4MY1A 2WZIA 1PE1A 2NQJA 4WX2A 1MNZA 4LUYA 3HN3A 2V2CA 2VJXA 2VDHA 2CITA 4NNCA 3Q2DA 3I68A 3NG3A 2XJ7A 3MSYA 3PZMA 4F8XA 1DL3A 3S9ZA 1QNPA 1X7IA 4S38A 1VPQA 1XYLA 5CGTA 1EDQA 4FIRA 5JU6A 1UPMB 4I5RA 4IPLA 2O9PA 4UUIA 3S46A 3LPFA 1E40A 4LYQA 3BW2A 4QNEA 4GYKA 3DUGA 3C3NA 3BG3A 3GY1A 2GJPA 4H2HA 3T8LA 4F9DA 3M7WA 4YN5A 4XIMA 2QEZA 4RZ4A 2CPUA 3GG7A 4ZQCA 3DGRA 4TTGA 5F1UA 4L64A 3R43A 3W38A 3UFYA 3ZR4A 2FVKA 3G8EA 3QYQA 4QE1A 1EO7A 3TN3A 1H7XA 4PCTA 3LHVA 2XVKA 2UWFA 4GABA 1A3XA 4GX9A 3AHVA 2WCSA 4MLJA 4S3DA 1ME8A 2GLKA 3N6JA 3PWGA 1X8CA 1WKYA 3WH7A 4BK9A 5EMYA 2JQXA 3K8MA 1YMYA 3HA1A 3KFTA 4LVDA 5GJMA 3PNUA 4LCQA 3ANYA 1FHLA 2Q3OA 3A3XA 3CQHA 4EAYA 3BAIA 1OCBA 3UA4A 3BW3A 1E73M 4IX2A 3KOXA 4DELA 4QQUA 4FAMA 2DIJA 3P5YA 1W37A 2RDUA 3PPFA 1Q66A 4UTUA 4CVUA 4Q8QA 3OIXA 1Y5WA 3WNLA 2GFTA 2PDIA 4HHPA 2PSNA 3WFZA 4AY1A 4L9YA 4DAIA 3VABA 3WY1A 1RD5A 4Q8WA 3H55A 2QPSA 1GVSA 1EOMA 1P4CA 4U28A 1UZ4A 3N11A 2CEQA 5EMMA 3I6EA 3OG3A 3GSMA 3ZOAA 5FJTA 2HVNA 3F4VA 2FMNA 3GH5A 2DVXA 7XIMA 4O11A 3ZFHA 4JTLA 4UCFA 3MSRA 3P84A 5AY7A 4DM2A 1UWUA 2VR2A 1TMHA 3T40A 2NV2A 1UWRA 4IJRA 1KM1A 1GOIA 1R0MA 1QAPA 2YW4A 1TA3A 4LUSB 4L4LA 2JE8A 4LS0A 3R58A 1LOQA 3S5YA 1PL9A 2ZTKA 3GNPA 2QJMA 4NP7A 4K8GA 3LQLA 1D3GA 1UC4A 5DBUA 2WC4A 4G6CA 4O1FA 2W79A 4H9YA 2V82A 7ODCA 2QZRA 3COTA 2O55A 2JEPA 2YB1A 4JTJA 4PN2A 4KRUA 3WEMA 2ZKMX 1SFLA 2CCRA 1J0ZA 2PTXA 1NP0A 3NCOA 1MVYA 1GVIA 1YXYA 4DI9A 3RM9A 2IXVA 1OG6A 2VNCA 4XAYA 1VS1A 1QHZA 2DSZA 5CLTA 3VNLA 3UJFA 3WFAA 1B90A 1EHAA 1SZGA 3OIHA 3CQKA 4ZTYA 3IK2A 3W26A 1H1YA 4WHBA 4L6DA 2GDVA 3PJXA 5KZ6A 1VBJA 1LBMA 4M80A 4Q4MA 1KWKA 3AYRA 1T6MA 2CWXA 5I07A 1EC7A 1MRAA 4JZ5A 1X97A 2Z2UA 4ZENA 3VK5A 3UG8A 1EBGA 4HP5A 1VBUA 4TX9A 2YL9A 1O1HA 3QGAC 5DCBA 1XG4A 3VKDA 1LROA 4DJDC 2OYKA 2C19A 3AU2A 3VCNA 3SN1A 1UHVA 4FF7A 1NEYA 5CBBA 6REQB 3W1MA 2VD9A 1C92A 1EF3A 4LQ1A 2NQZA 3NSXA 1MDLA 3N12A 2J9XA 1RQEA 4POCA 4MJMA 3LHYA 3TC6A 3VMNA 3O15A 3M0MA 1RCOB 3GHSA 4H6RA 1JVNA 4GO8A 4PSRA 2XHYA 2HXTA 3HIJA 5I5RA 4KBXA 2B31A 1BVZA 3VIKA 3WSUA 4EE9A 3NZ1A 1TV8A 1DIDA 4CCDA 1S2AA 4AX6A 3AIWA 3GIYA 3EX2A 3E5PA 1Y0EA 3CUFA 5CAKA 3UT0A 4QLKA 1WA3A 4GE8A 2XWEA 2F6XA 1NWRA 3AAMA 1FUYA 3E0IA 3CZLA 1GEQA 5LIYX 2ZUMA 3RO6A 3WD0A 2RKXA 1K77A 1NDWA 1O94A 4RPPA 1Q6FA 4PMNA 4YHEA 2GK1A 4ZQPA 1CIUA 4IMCA 1HG3A 2Z0IA 1XPYA 2EO7A 1OX6A 4KWUA 5FF0A 4ACZB 2NUWA 1V02E 1TUFA 2G41A 3ORWA 2BXVA 3WH5A 4UTTA 2ZADA 1EYEA 2WMKA 5BXTA 4WXZA 4HHLA 1TPVA 4JFWA 4QISA 1QPKA 2X1RA 4PMDA 1HZYA 1Y7VA 3SBFA 3RLUA 4ICMA 3USZA 2WMIA 2OOGA 1KGUA 3QW3A 3LGEA 1UP0A 1IE7C 3WJYA 2CZDA 2PFHA 2E77A 3AXMA 4J40A 3BAKA 3R13A 2BV9A 1VYSX 4LC6A 3H54A 4OECA 5DELA 5IDZA 4MNJA 3GX9A 4HZ8A 5DEZA 5BU6A 3L68A 4O0KA 1FWEC 1VYPX 1TJ2A 3TFXA 1O5XA 3KHJA 4KS0A 3KDOA 2XSAA 1O66A 2ZXAA 4Z2KA 3BSMA 1HL2A 3WFLA 3HJZA 1TX2A 3G2GA 4W84A 1QATA 4GUHA 1JZ2A 1TX0A 3TYDA 4O1AA 1WAUA 2IPGA 2WO5A 4UQEA 4DJFA 3MUIA 3IJ7A 3CC1A 4H41A 5CH9A 5LNRA 5HPOA 3IJDA 1XG3A 1RA0A 4JFVA 5MKGB 4H9UA 4P8UA 3R6IA 1ZQ5A 4IHCA 4UFHA 3GXPA 1SFJA 2HMCA 1BQGA 4G7EA 1JPIA 4ZO6A 3ZXWA 1EZ2A 4TUFA 2PE4A 3ES8A 2I5GA 1ITQA 4Z2IA 5CSRA 4WD0A 4QG8A 2PGEA 3F5JA 1FWSA 3HJEA 4XB3A 2R91A 2IKIA 1WB0A 1HGYA 4UOQA 3EOSA 3NXFA 3BTNA 2ICSA 4F2TA 4NX0A 5HUPA 3S8HA 5G2WA 4LEFA 6A3HA 1LLWA 1XLJA 4XD4A 3G6LA 2P53A 4Z2JA 4N9EA 4US6A 5C9RA 2BY1A 4B92A 4ZMGA 1MUWA 2FZMA 3G1AA 2X1IA 3MP5A 3KEHA 3CB3A 4ILSA 1OG0A 3VILA 3AROA 2E67A 3RJXA 3C2EA 1EQCA 2OEKA 2W62A 4YS1A 5A5WA 3EA1A 3V1HA 3BAYA 1UIPA 2V0TA 3ABXA 3VINA 3WEOA 4F0RA 3TQPA 4DEFA 2QMJA 3A4JA 3WMCA 4FX7A 2WVVA 4I3GA 1A5AA 1J96A 2ASHA 5JBEA 4LWWA 4MDPA 3VDBA 5D9NA 3LMZA 1Q6GA 2C71A 3MHGA 2VCBA 3TX9A 5KZMA 1RVKA 3DI1A 4KEZA 1BF2A 1LF1A 1G7UA 4FNRA 1ZBKA 5FA5A 1KBBA 4NQ1A 4D71A 4B3KA 2WZMA 5IBXA 3MPGA 2PDBA 1ZJIA 1XJBA 1VFHA 1IWBA 5DF0A 1ZAIA 4GJ1A 1RH9A 4E8CA 4HHHA 3EMZA 3WENA 2A79A 5MF5A 2FB2A 4LAOA 2Q02A 4MZ8A 2OELA 4F0LA 5E0FA 4GX8A 3FYYA 1YIXA 1A5CA 3S1GA 1GVFA 3BQ6A 4RNJA 4UXDA 3WLPA 1QWGA 4KQNA 3DHFA 4QJ1A 3B9AA 4L61A 4IH3A 4ZA0A 3GFXA 3UGVA 4EPBC 3L0GA 3VAVA 1LCOA 4IPIA 2QCNA 2VFIA 2J7EA 1LOSA 1YTKA 4CNUA 4H1ZA 5IHRA 2FZDA 3KZSA 3H7UA 4W7VA 1W1IE 5D04C 4WOQA 5JVLA 2ZRWA 4B90A 5DMMA 4QDMA 3T0TA 3W02A 2QUVA 1LT8A 2I9UA 3R12A 3DH7A 3W70A 4L1XA 3BLOA 2AL1A 3BAWA 1F8IA 4B5SA 3EOUA 1RCXB 1J0HA 3UPBA 3EDDA 4K6AA 4JIHA 2Q09A 5CG7A 3B05A 3WCZA 2DVUA 3UCQA 1RLDA 3RYSA 1RLCL 4GIAA 3MUCA 5KEZA 1TPH1 4IFKB 1U22A 2KAUC 3N1AA 4ATLA 1LYXA 4Z1AA 1LORA 3I4EA 2AQWA 2BVDA 1OABA 3QRHA 5XIAA 1QNRA 2BOFX 4HD5A 4EWND 3QHOA 3RX4A 1X6NA 3SY8A 4NZJA 5G1MA 3SGZA 3JZEA 4Y8EA 9XIAA 3LG3A 1PTAA 3HPXA 3RO8A 3CT7A 1VD6A 1ZCOA 2TAAA 5ABEA 3F2DA 3PHAA 2PBGA 2E6YA 1VFLA 1U5JA 2V3FA 2D1ZA 4XZLX 1Q4NX 3MDWA 3T9PA 3R1ZA 3RNDA 3D6NA 3CIVA 3UG5A 4MOZA 4V15A 2IPFA 1YPFA 4MMWA 2IXUA 4DJED 4HTBA 1SW3A 1I60A 1FH8A 4XD6A 2NXHA 2F8QA 4CLMA 3ATYA 3E74A 1I2QA 4MYAA 3OOQA 5BWFA 4P2VA 2PS2A 1JZ8A 3EDJA 5BMWA 4NYUA 1UZ1A 3UWQA 2BZNA 2A7NA 1SSGA 2AMXA 6XIAA 2VFHA 3Q4DA 3WLJA 1MNSA 2BFGA 3KX6A 4AIOA 3W2JA 4O12A 4V28A 1R9XA 3E2VA 4QXIA 3WNKA 1B3VA 1R85A 4JX6A 1EJSC 1X1OA 1IZCA 3TC3A 3QQ1A 2YCEA 3STFA 3AICA 1JDFA 4UQBA 3GS6A 3FX4A 5A6KA 2ODOA 3LV5A 3TJIA 1RQBA 3P5ZA 3XISA 3C0LA 3G22A 1VEMA 1YHTA 4XAFA 1IZJA 2XGIA 4H7CA 1KRMA 1JQVA 2C16A 1IGSA 2PDMA 5IOBA 3AS2A 1LP6A 1LRNA 4C90A 3IVSA 3VC5A 3EXSA 3DN5A 3FW6A 5DXXA 2PLCA 1MI3A 2FIQA 4IXXA 3THAA 1GZ1A 4X0NA 1UH3A 2NT0A 1QBBA 2R82A 3MMTA 5DMYA 2XFYA 3CV2A 3NEHA 1PX3A 2XIMA 3B4YA 3BVJA 2Y62A 4JFTA 3NYDA 4CU6A 5E9AA 2CESA 3SAZA 4KPLA 3MJMA 3RRAA 3CO8A 4PB3A 3Q37A 4LU0A 3G1HA 4MNLA 3THQA 3OVGA 2QXWA 3LBOA 5CKSA 3UD6A 2WZHA 3CASA 3SADA 4UOJA 4FHAA 4AC7C 3B97A 1I0DA 1MW2A 3APTA 2YFOA 2QCEA 5JXQA 3C6CA 2MUCA 4P61A 4AVNA 1AA1B 4W9TA 3U5YA 1FWRA 1J11A 1Q6LA 4JKKA 1QI5A 3M6DA 4O4WA 1UKTA 1X6UA 3W1NA 4RDWA 2R1KA 1XBVA 3M5YA 4PUWA 3LD5A 1TE1A 3MKCA 5FF7A 3F2BA 4Z0JA 4PTMA 4Y9NA 5CZKA 3DESA 4GI9A 3ZR5A 5DLCA 1EA0A 1W5OA 3PM6A 2Y7DA 1FDYA 3U7BA 3MUZ1 4B5UA 3VTRA 3P2VA 3UG4A 1QI0A 4RKAA 2DPEA 3P62A 4ZXOA 5C2XA 1EP2A 4GVHA 2Q8LA 3E2SA 4BF7A 4LB3A 1DJQA 1IEWA 4AF0B 4HN4A 2VWTA 1V0KA 4DVOA 3OW1A 1V6WA 5D33A 4E2BA 3T1GA 5C55A 1RHCA 2ZX8A 1CZ1A 1JXKA 2D0HA 1DIOA 2BLEA 3TQ0A 1W17A 3BCFA 1MSSA 3E1F1 3NNTA 3HM7A 5AN7A 4P7LA 1Z69A 2RDXA 1M9HA 4DWSC 3T4CA 1BG9A 4C7GA 2QULA 1K8XA 1W1PA 4ERGA 4WSJA 4CEUC 4PFMA 4PMXA 1WX0A 3WF2A 2OPJA 3H7RA 4DRSA 4C65A 4FLOA 3TUUA 1IYXA 4QROA 2HPIA 1QWKA 4PUUA 2FZ8A 3QY8A 3CZJA 1OYAA 4ORMA 3QHMA 4MJZA 3ZLHA 2BY0A 1V02A 1OC7A 4M7SA 1W9XA 1T40A 3BG9A 1EQPA 3RPDA 1H49A 1JPKA 4DY1A 1J0JA 1H2JA 1JZ5A 3ECQA 4JTSA 1IIHA 3LHTA 1UCWA 4WKFA 3HPFA 2FPTA 2V38A 3V5FA 3LEPA 4O4VA 3BLPX 3UGRA 3POCA 4HJWA 4UTHA 1EZWA 2ZXBA 1R3RA 5AC7A 1Q65A 3DDMA 2QJJA 3MHFA 1UR0A 2RJGA 2H8XA 3QPEA 3M5ZA 1PPIA 1S5NA 4HMNA 3N73A 1WZAA 3HF3A 3D3FA 5BOFA 4AMAA 2XM1A 3STPA 2GOUA 3EMCA 1E3ZA 1L6YA 2QAFA 4C6FA 3EXRA 3W2NA 4KCTA 4AY8A 1S39A 3A9IA 1JDCA 4FNPA 3TOYA 3WLRA 5AHNA 1UBPC 1JYNA 1S2TA 4LBRA 4J3ZA 4H83A 3K4DA 1NIUA 2BWGA 3AHXA 1KTCA 4ZB2A 2G8ZA 2EGZA 3TAOA 4DLMA 4CQAA 6TAAA 5LYRA 1AZ1A 4K8EA 3PZQA 1YBQB 4FF5A 3N2BA 1LL4A 1JZ3A 1A53A 3W82A 4C60A 2GQ8A 5GNZA 7REQA 4QJ5B 4H4IA 1DKWA 4HA3A 2J27A 2ZRXA 2DEPA 4C1LA 4U33A 3PTMA 2A5HA 4DYKA 2DV0A 4OJYA 2WXDM 1J6OA 1GYLA 3TP4A 2ZRVA 4MVAA 3AUJA 2J8FA 4A2RA 4NAEA 3VGBA 1KCLA 1CGTA 3M64A 3EKGA 2GVJA 4Y2WA 3QMSA 2OKTA 2WNWA 1RJQA 1ONRA 4IOTA 4PCSA 3B0XA 4LB4A 5CBIA 3EEZA 4W86A 4GH1A 5IRPA 3NZGA 1GJPA 3DEQA 2C6QA 1XFBA 5C9UA 3VOHA 3OLEA 2OU4A 1EJWC 4XKMA 1RQHA 3BO9A 1TV7A 2YW3A 5AYIA 3P8IA 5L6UA 2YBVA 4MWAE 4M82A 1MWOA 1HJVA 1DOSA 5CEWA 4FK9A 3R89A 4O0ZA 5FACA 3TTSA 1UZDA 3L2IA 5CXPA 4B4HA 3TSMA 4UWMA 5C9WA 3DERA 3CYVA 3M41A 3F4NA 1J2BA 1W8SA 5CC6A 1C7TA 4O28A 3A64A 2B7QA 4N0RA 1UUQA 3B8TA 2NVAA 2O4QA 3WBEA 1W1B1 3E49A 3T2OA 1SFSA 3S9IA 3LHWA 4C7DA 4Z2HA 3PZGA 3IJ9A 4IICA 1EXBA 2YKKA 1LG2A 2O7SA 1Z44A 5F4XA 1O6IA 3AHTA 5M2FX 5KTLA 3QGVA 2HBXA 1E56A 4Z1DA 3I7RA 2YBTA 4OUEA 4I9JA 1V08A 4PBGA 1ISZA 3BK0A 3JVAA 1RY8A 4G1NA 3UVIA 3PZVA 3D46A 1ADOA 3LERA 1LL6A 4E8DA 1UKOA 1K6WA 3Q94A 1G7VA 1WO2A 3DHDA 4R34A 4Q8NA 1GJUA 3U5UA 4OQVA 2YCLA 3T7VA 2BASA 4Q4OA 4J3UA 4JNZA 3E9AA 4JQ4A 2AQVA 1JQXA 2E68A 1LWHA 2NXIA 3WQWA 4AIBA 1M5WA 1H4PA 4DYJA 1GTHA 4Z1BA 4E6MA 4YXGA 2WWDA 2QCDB 3WQOA 1YXDA 2GWGA 1MW0A 4PCPA 1J01A 4Q4PA 2PP1A 1BTMA 4NG3A 1US0A 3QQ0A 5E1QA 4A3QA 1C90A 3OGRA 1H09A 1UB3A 1GQLA 4WOZA 4G5DA 3PZUA 1M01A 1QT1A 3JU2A 3HGOA 3BOLA 3LYEA 4D8LA 4BA0A 1O1ZA 4RV3A 4FOJA 1B4EA 3T09A 1UD5A 4JN6A 2I14A 4ZVJA 1JPHA 5C5YA 1VJIA 3APGA 1VRXA 4W4QA 4CEXC 3CL7A 4IIHA 1LLOA 4GCAA 2WMFA 4E2OA 1BFNA 5I3DA 1XX1A 5GNYA 4DJDD 1VQTA 4WDWA 1QMLA 1QW8A 4MSSA 3FFSA 3UNDA 3BZGA 4X61A 1MZHA 2ATMA 3PB0A 5DT7A 1Q5MA 3C3UA 1OT1A 4GI4A 2VC6A 1TTJA 1B30A 1OWQA 3WH8A 2V3GA 3DG6A 3CUHA 3HGJA 3E6EA 2VGIA 1KRAC 2ISWA 5H1WA 1TWIA 3VUSA 1AUSL 1AW5A 1FHDA 5LZLA 1XGEA 1GG1A 4Q8PA 4RZ6A 3W9ZA 5CBJA 1U33A 2VC5A 2Z00A 5BNKA 4J28A 1H1NA 2CERA 1OFRA 4MTVA 3S42A 2BXYA 5CPMA 3T08A 3VX0A 1A4MA 1EB3A 2PWEA 3GDMA 1KBIA 2H9AB 5AHFA 2GGEA 5DANA 1EGMA 4XUYA 5F2MA 4ZB0A 1IEXA 1HVXA 2E9LA 1HKVA 2E8YA 3IIPA 2VQTA 4I6KA 1IV8A 1RBOB 4MZ1A 2Z1SA 4HYWA 2J74A 3UW6A 1LQ0A 2G37A 2Z1KA 4J1OA 5HANA 4XKYB 1XPGA 4H04A 3AJXA 1FWGC 3KLLA 5HINA 5I77A 1ZAHA 5AVNA 1RUSA 3TONA 4KWWA 5BXPA 1W54A 4Q7IA 2PDXA 1EBHA 1V79A 1MW3A 3M44A 4QBXA 1KKOA 3MKKA 3H8AA 4M7TA 4XSLA 2P8CA 4HNTA 3R8RA 4WJEA 2FDMA 1ZRQA 4B5TA 1XI3A 4QSFA 1KRCC 2CLLA 2NQ9A 3MBFA 2C1IA 5D32A 2J4GA 4JQ3A 1XRTA 1KQYA 3NQ8A 3CLMA 4GGBA 4A3RA 1M7OA 1P7TA 3LI0A 4DN1A 3VO0A 1C93A 3U9IA 4HSNA 3IVTA 1MZRA 1EDGA 4RE4A 2WVTA 1N7KA 1RPXA 4BS0A 3QFEA 2W63A 3LX9A 2POTA 3RRXA 2DW7A 3U2OA 4MHBA 4MFEA 1PEZA 1MEWA 1XDLA 2Z1BA 3N25A 2XFRA 2Y5EA 1R86A 2GK1B 2OXNA 3NPWA 4R27A 3NQCA 1HUVA 4C6NA 3QVQA 3W74A 3E96A 4LAMA 4PGLA 1FWFC 2DT2A 3MZNA 1GORA 2CXGA 1Q2SA 5CZ0A 2ESCA 1J93A 2PGRA 3REQA 1TRDA 3F5KA 1NM9A 2DSKA 3PSWA 3JW7A 5M03A 1IEIA 4ZQMA 1UR1A 3MY9A 2PWFA 3KBJA 4QE4A 4G1KA 4YTRA 1CEOA 3T0AA 3OP2A 3LBMA 3AMLA 4GVGA 4WXYA 3RN6A 3T4WA 2ZRYA 1UMYA 4DXXA 1UD3A 4M51A 3GG1A 4H00A 3K1GA 4BEQA 1A5NC 4FOKA 4D6CA 4KIRA 1DJNA 1ME9A 3BMVA 4XBJA 4C6DA 1WDDA 1W5MA 2ZFAA 1F4AA 1CXKA 3PVFA 2WNZA 4UMAA 4XISA 5H6HA 2HPMA 4AD5A 1H0IA 3OB8A 2FLIA 4GI8A 2FJKA 1H51A 3KVLA 3ZJ6A 1JCLA 3PK7A 4RZBA 1L6FA 2PP3A 4AQLA 4AWTA 4WIWA 2H90A 1Q6CA 1ALDA 3LRLA 3VKCA 1ZB5A 1FWTA 1NDYA 3N6HA 4DJFC 4FOUA 5AYBA 3B8VA 3DYMA 1UUMA 3GAKA 1WXZA 4PUDA 1UD2A 3RLVA 5A8NA 2BY3A 3TW9A 1RA5A 2Y24A 2FMOA 4C6PA 1AQMA 1XS2A 2X0YA 5BRBA 4TV5A 3N3MA 3NL6A 1S3TC 2WKLA 3NQGA 1EPXA 3RIKA 1W1A1 1FA2A 1PZ0A 4G7EB 2WC7A 3GDKA 4PMUA 3B03A 3W7LA 2JKPA 2G50A 3WK2A 1Z3NA 1CNVA 1OF6A 2AMGA 3U57A 4NILA 1YPIA 5AYZA 2W67A 4HMDA 1A80A 1P6CA 3WN6A 3LCHA 3O7UA 2WBGA 1C8XA 3FJ6A 3NJ3A 1AQHA 3CQIA 4I8YA 3DYPA 1Z8AA 4A3HA 4MAZA 1E4MM 5J8LA 4LUSA 3M0VA 4HA4A 3W7KA 1J18A 4QE5A 1ZJHA 1H7OA 4H9ZA 1QTWA 2IPJA 2ZX6A 4N9BA 3C0SA 4HT3A 2J75A 4D2JA 1VRDA 3F5LA 3O6CA 1EJTC 1HJUA 4I8DA 1XGZA 3W37A 1VHNA 2V2HA 1DPMA 1CYGA 3LU2A 3RX2A 3S1XA 3HMCA 1ZL1A 4MB3A 5HR7A 3KZPA 4GZIA 3LS9A 5E70A 4I9TA 4A2SA 2GL5A 3TDFA 2WVVB 2ZZ6A 4FB7A 3BLLA 4GIRA 2DSWA 1S38A 2QDEA 3IS4A 4Q33A 2VZVA 1JUKA 3CV7A 3DKJA 4LVGA 1HFBA 4D8AA 4JTEA 5FIPA 2BODX 4F2UA 1MW1A 3UZYA 2R94A 1DTNA 3CMGA 2CNCA 3N2XA 1VPXA 4PUJA 1TV5A 1KR0A 4KMQA 2EXOA 4CNTA 1J0KA 1ZUAX 3OJGA 3NDYA 3L67A 3SDOA 3NGJA 2TMDA 4OV9A 3ZIZA 3P80A 4M81A 2XSBA 1BYAA 1DWFM 1I0BA 2NSOA 3BW4A 2FB3A 3M9YA 3IARA 3WF0A 3WDHA 3RCNA 1PXGA 3FXGA 3MVIA 1HNYA 2JGYA 3HU7A 3NVDA 4JOMA 1GOXA 2WZEA 3SB0A 1VEPA 3VZXA 2CLIA 1SZRA 2O0TA 5CPQA 5ABHA 4B5WA 4TTUA 1QR7A 3W73A 1OT2A 1QK2A 1L9WA 4LAUA 4WJXA 1X8FA 2J88A 6REQA 4LCSA 3E12A 1MUMA 1HP5A 4CCEA 2V8ZA 3EDKA 3QSTA 4TIMA 3MC5A 4PA8A 2W66A 5LIKX 4TR9A 3C2RA 4BR1A 1EP1A 4AHPA 5CPOA 5IXEA 4OT7A 1DXIA 2DUXA 3T2QA 2WJFA 1J0IA 3WH6A 2ZIDA 4ONVA 4P7RA 3GK0A 1GQKA 2CC0A 4HZMA 1BRLA 1US3A 3IJ6A 3IIVA 3LUTA 4C91A 1Q85A 3P67A 4U2ZA 3WDIA 1GKQA 1KFEA 2V5KA 4PL1A 4PC8A 3UR8A 2R14A 1E0VA 1TTQA 1KD0A 2YIHA 3GDTA 3DKLA 5A69A 4K1GA 4PTWA 1ZBWA 4L4PA 3S1UA 3UXKA 3VPLA 4WDUA 2E5BA 1PKMA 3XINA 3S47A 3NAVA 2I17A 4IMAA 1F6PA 1EJUC 4HSOA 1TVLA 2FDSA 4NT0A 5TIMA 5HXMA 1XF0A 1ONEA 5DMLA 1ZNNA 1XIBA 4NJGA 4LUTB 4F3HA 3DG7A 3UY7A 1NSJA 3V5CA 4ACZA 2DJLA 3QC3A 4LALA 5FJIA 6ENLA 3GC4A 2HNHA 4AG0A 1WDSA 4IWWA 5A94A 1SO5A 3KL0A 4EPEC 3LOTA 2E40A 3FHAA 4PZVA 1UJPA 2G4JA 3P60A 3HO8A 5A6SA 4C6KA 3PFMA 3TQKA 3I3EA 3LY0A 3DBNA 1U1JA 4LTSA 1T7LA 2Z6IA 3TWBA 1YLVA 4XZNX 4LF2A 3HG5A 3OGVA 4AZIA 1FBAA 1QNOA 2XPKA 1BTCA 3AZRA 3WBYA 5FSEC 2Y70A 1AH4A 4E8GA 1ICPA 4NJKA 3PSVA 3W75A 1K8CA 3G3DA 1BWVA 4DZAA 5FEXA 3L4ZA 1O60A 3U6WA 3NQMA 3NDZA 4DXKA 2HSAA 2WWCA 3U3HA 1PCWA 3QW4B 5BROA 1A5LC 1QK0A 1ZALA 2OSYA 4XAZA 4YJ5A 4W87A 4GVIA 2DZBA 2FVLA 1THFD 4DLFA 3K8LA 1XIGA 4JL2A 9XIMA 1FHUA 2G3NA 5D30A 1CXEA 1LRTA 3N2TA 4X0VA 3SCTA 1AW1A 4GC4A 3ITTA 3WNNA 5CQ1A 5AHIA 4AZ6A 1KA9F 5BZAA 2CLEA 2XINA 2VEPA 1ONXA 1NP2A 1XSJA 3E38A 5MKGA 2EJ1A 1SSDA 1XYBA 4JQ2A 1Z48A 2G97A 2IS7A 3V3WA 3L5LA 4U31A 4AYSA 2EF9A 4X9YA 4JEQA 3PWIA 3A47A 3AQUA 3WQ8A 5M5DA 4WDTA 3U7VA 5I6SA 3L21A 3NOYA 2VFEA 4FXSA 3CMJA 3V16A 3PBWA 1TQJA 4OHQA 4AHQA 2A3CA 2VL4A 4KFOA 1KGWA 2C13A 5HJYA 3J7HA 3R8GA 2A21A 4Q8OA 1F3WA 5CLWA 5HDRA 3WNPA 1NFBA 5HJXA 3IRSA 4W85A 3TXZA 5H91A 5I78A 3RJYA 3N04A 2WLZA 3R0KA 2ZA2A 3OBEA 3H21A 2PRHA 3A12A 4XO7A 5JBDA 2BP1A 3WJSA 4M6PA 1BEUA 4UZSA 2UY5A 5D02A 1N8IA 1OHLA 2UY3A 2YDAA 5IFTA 1LBLA 2XZ9A 1M3UA 3L4VA 4CD8A 4RDYA 2HE8A 4RXGA 4IIDA 3G0XA 2DJXA 2PGFA 4FP1A 1S2VA 3FJ4A 1B9ZA 2DP3A 3JZUA 5E6ZA 3VVGA 1AZ2A 3GXMA 2B7OA 3H6OA 2OLSA 3HQNA 3QZAA 2E0PA 4K1WA 1X38A 3GH4A 4HMEA 4KWSA 8XIAA 3LDVA 4QR6A 3UNTA 1NVMA 2Y2WA 4JHOA 4DWSD 1Q8JA 3ARWA 3M0IA 3QEZA 4ZB5A 3SIZA 3FYPA 3ARXA 4LNCA 2XFWA 3WQ5A 2AKZA 2ZYFA 1ZAJA 4N9DA 3AMKA 3L5MA 1V03A 4ZL1A 1SJCA 3E02A 1ICSA 4AEEA 1PKNA 4IPJA 2P0OA 4DF2A 1XL9A 2Y5JA 3CIXA 1ZJBA 4LV9A 3YPIA 4JN8A 4ERIA 4FSAA 1EEXA 4UR7A 3PBUA 2VEMA 5SWUA 2POZA 3NIYA 2PTWA 1XKYA 4IIEA 2REQA 5G1YA 1EC8A 2FGBA 2XN2A 2ZUNA 4Z0SA 2Y8VA 3KL5A 2CKSA 1KCZA 4IL0A 1E3XA 1KM6A 3VIPA 4C5ZA 1S5VA 1FWWA 2VEKA 4ZODA 5LNWA 1PX4A 1PYFA 1E6NA 1XYCA 4DZHA 3LCLA 1IXQA 3F03K 4NJIA 2V5BA 1QRQA 2PRLA 3ABOA 3H24A 4N42A 4DNMA 2V5JA 1CGYA 1G1YA 3HZ3A 3W25A 1R3TA 3AXKA 1OEPA 1OFBA 3SGGA 1F5ZA 4K37A 1KFLA 3H2OA 3ITVA 2E8ZA 5F1VA 1RXOB 4RXFA 3ARQA 4Q4QA 3RU6A 4QG9A 4BWLA 4AYGA 3W7MA 1J5TA 1HXJA 4EWJA 5G1TA 1YYAA 1LT7A 4FA3A 2ZUSA 4IFKA 1A49A 1S5WA 3HV9A 3OYXA 5XINA 3KS6A 3ZJ7A 4MY8A 5HWJA 1MDRA 1L6GA 4Y9OA 2R1LA 1R2RA 3UR2A 2P88A 3EXTA 1DXFA 3MMDA 4OVXA 1W91A 3IWPA 3Q67A 3SRHA 4HKPA 1OFQA 2F61A 1D8CA 3W1TA 1UPPA 3W4RA 2ZVIA 2E25A 5HK4A 3QV7A 3ITCA 4JTFA 5EMJA 3TROA 4AZCA 1UA3A 4O1CA 4LFYA 5ECUA 3DU0A 1RZMA 4XTDA 3SCOA 2O56A 1B3ZA 3B06A 2X0SA 1UR9A 2WCAA 3TYZA 2A3HA 2V5CA 3CU2A 4JIRA 4RV8A 1B31A 5F2GA 1NH6A 1GONA 1JI2A 2B7NA 4NL1A 2ACRA 4RZ5A 3NZRA 1B9BA 5AC4A 3EB2A 1TPWA 2VX4A 3UBPC 3UCCA 1K6AA 2QKFA 2GGIA 4J27A 1B0IA 3CPRA 5FAJA 3W7EA 3EWBX 5MHBA 1ZENA 2A85A 3D0CA 3V4BA 1PHQA 1BKSA 3W6YA 3EAUA 3OLIA 1IR2A 1Q8AA 2NV9A 3LZ5A 5KZDA 4J3SA 1LOLA 1XIJA 1KM3A 1XIEA 4JHZA 1AFSA 3NQBA 2OSWA 3NSNA 4LVBA 1BYDA 4GY7A 2O9OA 3UG3A 1PHWA 4B16A 5E09A 4QEEA 1XIHA 4V27A 3GB6A 2YA1A 3T8QA 2UV8G 3IJLA 2VURA 4IZGA 3B04A 4NAEB 4WSKA 4D8ZA 2ZTJA 3S6DA 1W8GA 2DUAA 3KVKA 3MUY1 7CGTA 4C5YA 3S1WA 4LXFA 3MT1A 4NZ1A 3N29A 3W83A 2EG6A 4NJJA 4M24A 2PWDA 3SJNA 3KVJA 1GVRA 2DY3A 4YL2A 1UC5A 4GBDA 3DFQA 3A21A 4R53A 3B8UA 4JAWA 3VNDA 2DZTA 2NWSA 4GY1A 1OFEA 8CGTA 1XIIA 4JIIX 2UBPC 4W5ZA 4HOXA 1PZ1A 4RLIA 4AAJA 1GCYA 2HTMA 5FEPA 3WKZA 1AG1O 2XVPA 2ZDSA 3FDGA 1YADA 2V67A 2VFGA 3MV01 4E4PA 2G3FA 2RGMA 1PBGA 4BQ2A 3RR1A 1SZEA 3WDRA 4L7ZA 3A4WA 3SM0A 2JGQA 4KEVA 4W7UA 3FIGA 3L7RA 4B3LA 3RR4A 5I09A 2RFGA 3B3DA 3H2FA 1FKXA 3R8HA 1OB0A 1REQA 1YEYA 1XDJA 3B0YA 5M17A 2PAJA 1WXYA 3GTIA 4PUKA 1JEZA 4BKNA 3O6AA 2KZHA 4P7NA 4M1BA 2PD9A 4XVDA 2Q6ZA 3FJLA 2CETA 1VAHA 4RUBA 4MJ4A 1D3HA 3EWCA 1CGXA 2VT0A 2A3LA 3N17A 3WJWA 4LPCA 2DZVA 3S5OA 4CVWA 3LPPA 2CHRA 3A22A 3W1UA 5I03A 1LUCA 2YCLB 3EB3A 2VDGA 1ZLPA 4GWEA 2LLEA 2VYOA 5I7GA 1R38A 4HNUA 2EKCA 1X1ZA 4EF8A 1EKOA 1WDWA 1K9DA 2E6FA 4CNNA 1JUBA 1RCQA 4QM1A 1K4HA 4FS9A 1HJSA 2DVTA 3IGSA 3UZZA 4H01A 2WKJA 3TA6A 3CEUA 1J0YA 3NL3A 4HU3A 2Q71A 1DE6A 5IDIA 3AI0A 3W1XA 4J3WA 3W6LA 3R0DA 4Z08A 2YZRA 5XIMA 4QAIA 2PF0A 3CJPA 4O1DA 2C18A 4Q4KA 1EYWA 5IFPA 1XINA 2FPVA 2WLYA 3THDA 4MKNA 3LLDA 3TYCA 5K9DA 4PE8A 3WBXA 2ZUTA 4D1JA 5DY2A 4ICCX 3VDHA 3BAJA 1QNVA 1E43A 1OYBA 2P8BA 5D9OA 5LXEA 1HF6A 1XD1A 3OZMA 1OK6A 4DWSA 4MUPA 3SO7A 5BOEA 1MFVA 3C8NA 4RE0A 3W7OA 6ALDA 4FNQA 4MNMA 2WJEA 4D6FA 4Q4SA 1HKMA 1Q6QA 1XV8A 2PDKA 5LHEA 1B5TA 2Z27A 1E6ZA 1OCQA 3UWVA 2TSYA 1KFCA 5BRPA 2FH8A 2VGFA 2Q3RA 3MJYA 4MDOA 1L2QA 4S3FA 5M1TA 1OF8A 2YOCA 3QV6A 2FKPA 3IV8A 4GZ7A 1UYQA 1JIBA 3W81A 4ICNA 1T5AA 4X9SA 5HMSA 4RNIA 2CLKA 1TFVA 2J25A 3SZ8A 2X7VA 4LEQA 2PC8A 1P6WA 1OY0A 4GUFA 1KFBA 1OBAA 1JDEA 2BVYA 1GVEA 1S5TA 3CTTA 1C3FA 3G0UA 2CYGA 2CZ5A 1XM3A 3KVMA 2QQ6A 4LS2A 3AMCA 2AAAA 3QMTA 4UTMA 2BHYA 2CKRA 3WG6A 1BPLB 3QPZA 3ARPA 4IXHA 1S1RA 1CCWB 5D2TA 1ECQA 1HKJA 1PO9A 2X30A 1J4EA 4BI5A 3UJSA 5A6AA 5LIUX 2JIEA 4AWEA 2GSJA 2WVUA 3DX5A 3W7NA 1XRVA 1WYIA 4QG6A 1HJQA 4WEVX 3UWEA 4KGLA 1XR2A 1D9EA 4ALDA 4JCLA 2OQYA 4UFKA 1FTXA 3SIMA 1BWLA 1F61A 2ZE0A 1G4TA 1Q45A 2JF6A 4XVEA 2IPWA 4LT9A 4A6GA 3QZ6A 3S9YA 4B4FA 3ARVA 1Z9AA 1DEDA 1TMQA 4LSBA 2HV5A 3OO2A 4GUGA 4PYSA 1T96A 1XBXA 2NVDA 5K2ZA 3SUWA 4LS1A 2BHZA 3LTPA 2RDTA 1EF2A 3BOFA 3SCQA 4NZ5A 4QNWA 2QMKA 3BG5A 4WDXA 1P7TB 1W9VA 1KTBA 5I3JA 3PBYA 2PA6A 5CC5A 3Q58A 1B4KA 1JAEA 1J8VA 4UFJA 3CBWA 3KW3A 2A7RA 1SUXA 4GNKB 3EOLA 1TELA 3AIEA 4H3DA 2UY4A 3G5EA 3P93A 1B3WA 5A6JA 1K02A 3A9BA 4MKSA 5K9CA 4CN1A 1EUAA 1I4NA 4DBUA 3SRFA 1GZJA 1XQKA 3MW7A 2MANA 4JYDA 4AH7A 3FV9A 3EGJA 3ID7A 1S2CA 4I5UA 3TTQA 3VIHA 5LHFA 1Q2RA 4PB5A 2IKGA 9CGTA 5DBTA 4DJFD 3THCA 3REQB 1I1XA 2OWCA 4EKJA 4HIBA 3VDCA 2NQLA 4PMQA 1N8WA 5A2AA 3WLIA 3W86A 4LUJA 3VNIA 4IQJA 4UNIA 2E28A 1GQIA 3KBMA 4QSHA 2OZTA 1QXLA 2WNQA 3H70A 3ABZA 4ZFCA 3MP3A 3QHNA 2XH7A 3N18A 3MP4A 2ZZ4A 3GAYA 1R9YA 1F7BA 4MYXA 3UP8A 3KOWA 2PDCA 4MM1A 4JGDA 3KBVA 4CCCA 3GU1A 4QRNA 3TH6A 2VDIA 1KTNA 2PLMA 4NZFA 3GR7A 3DFTA 3FJNA 1Z7AA 3KL3A 4YVPA 4DO6A 3RUBL 2YXOA 3GM8A 1EH9A 2OQLA 1VBHA 3L9CA 1AH3A 4WCJA 4PMJA 2P76A 5HR6A 4NXSA 1F74A 2QW5A 3GVVA 3B9DA 3LLFA 2J7BA 4GJIA 4GHRA 4R7JA 1GYMA 4IP5A 3PPCA 1E70M 1M7PA 4ZOBA 3WUFA 3PR2A 4ADUA 5D8WA 1IZKA 3HGSA 2DFAA 1Q4WA 4ASTA 5ABFA 1E1EA 5AC8A 3PP7A 5BYWA 3V35A 4IX0A 4JCMA 3N2CA 3VXGA 4OOZA 1KC7A 1JCYA 3V36A 1SMDA 4QS5A 4R9OA 4HNLA 3UERA 1WPCA 3QV8A 3QV9A 5K7JA 2PTYA 3GUWA 1VCFA 1XKJA 5JIPA 1KNWA 2ADAA 3ITYA 3FDKA 1OFOA 5CSSA 2D23A 2NV1A 4RJEA 5AHMA 2VVNA 1NTHA 4HGXA 5I3HA 1NAL1 2XIJA 1OCNA 3GBEA 3A23A 1JULA 1G94A 4TMCA 5DXYA 1SJDA 2QCDA 3QY6A 5G4HC 4UFMA 2ZX7A 2X2GA 4ZE4A 6TIMA 1XIMA 1U5HA 3M5XA 1V6YA 4CN6A 2DH2A 4S3EA 1XSKA 1LM1A 2EPNA 3CUXA 3KDNA 1PVNA 2OT0A 1O4UA 1WXJA 1R5YA 3WMBA 3FY1A 1IXNA 3VIIA 3N19B 2VCCA 4FNSA 3NFUA 3W00A 4YLWA 3MBDA 1HKKA 5BXSA 7TIMA 4KERA 4YTUA 3CT2A 4HU8A 4Y9AA 2VM8A 2V5LA 4DIAA 1YNPA 4EVZA 5LA0A 1GW9A 3O0FA 1JZ6A 3FOKA 3O63A 3ZMRA 5BWAA 3NUKA 5HJLA 3SQMA 3LCFA 3TN6A 1QOPA 1RK5A 1LQAA 4NASA 4PCNA 4Q22A 4PULA 4YYCA 4ZBCA 4P7QA 1ITUA 3N9SA 1PIGA 1RR2A 2QT3A 3FVMA 4DBDA 1JDAA 1NJJA 1L6SA 1KFWA 1CGVA 3ZLGA 1CLXA 1PSCA 1TCDA 1JNDA 1B57A 3A13A 4HQVA 3V0UA 3KBSA 1UD8A 2ZE3A 3AJ7A 1E1CA 3GTHA 4MAVA 3KP0A 1QCWA 4MGGA 3SFKA 4D6GA 1AK5A 1SZNA 1C29A 5RUBA 1DHPA 4GBUA 1ZHAA 3PFRA 2Y88A 4KEUA 5FD0A 2FQIA 3CK5A 3ICJA 3TFCA 3MHUA 3U2ZA 3ZT7A 4ZXLA 4IQLA 3G1DA 3ARRA 2ZZ1A 3B9EA 2Y63A 5EKYA 5EU9A 4PMVA 3DGBA 3GNXA 3W24A 2QUNA 1CB2A 4AZGA 2H9AA 3NZQA 1K1DA 2CBIA 1GJWA 5FAGA 1IT0A 4MF4A 1XH0A 3CHEA 3TKFA 5D37A 3CAKA 4C6EA 5LNSA 3T2PA 3RU8X 3SW6A 1H63A 2D3NA 5DRCA 3ME3A 3MYPA 4E3TA 4OE7A 3IIZA 5C2GA 3C8FA 4XKYA 2Q8ZA 3WLLA 4CD6A 2QVNA 1UJQA 3FGCA 3CLWA 3BE7A 5DFAA 2NZLA 3QSRA 1OYCA 4C6OA 3KOYA 3WF3A 4Y96A 4PBFA 1F2JA 1BRLB 3A24A 2BDQA 4ZQRA 1KM4A 1PUDA 2OGYA 1R3WA 4MWAC 3M1ZA 1W1VA 1ODUA 2VX7A 2F7FA 3IRDA 3JS3A 3VIMA 3VCCA 4DUVA 4QDWA 4BQ4A 3C61A 4G8TA 1SGJA 1SPQA 5KINA 2EKGA 1AD1A 4PB4A 3UXLA 3TWAA 3CL6A 4AD2A 1WBJA 1XLBA 3CHFA 3OA5A 4H2CA 3T44A 3WEZA 1I2PA 4JIQA 3IEBA 4QCFA 3DHPA 3ALGA 3DAQA 2OEMA 4S23A 1OCJA 3BURA 4O14A 2QV5A 3FA4A 4S3JA 3LPOA 3VX1A 3NQAA 4YIWA 5G4EA 4HA0A 4FI4A 4O54A 4XK2A 1AW2A 4AY7A 2E9BA 3H23A 2O9TA 3STCA 1J5SA 2XN0A 1YPXA 5D2WA 1UWAA 4GG9A 3L0NA 3L23A 3PG9A 2C0HA 3QR0A 3WJZA 4JTAA 3DFOA 2Y5SA 3ONCA 3BC9A 1OIFA 1JI1A 1XFCA 3GR8A 3IVUA 4A21A 3AHZA 2VGGA 4MIMA 1H60A 2QYGA 4I5XA 1VIZA 1KLZA 5CZSA 3K1DA 4C1KA 2WSQA 2PDWA 2HK1A 4NUWA 4MADA 4AZHA 4D6JA 2ACSA 1TE6A 3KRSA 2OGJA 3PJTA 5HNTA 1B2YA 3P61A 3EA2A 3FYOA 1EC9A 1EJ7L 3QTGA 5K3VA 1TCMA 1EO5A 1DWHM 2YL8A 4HNOA 2BTMA 4BJHA 1TPDA 3QY7A 4Q4RA 1JYXA 4L1GA 3PAJA 3KAOA 1GVYA 1JD9A 1EJRC 2BXZA 2RDWA 1JDDA 2OEJA 2OSXA 2XIQA 1FH9A 4M56A 5T91A 3RM8A 2QAPA 3KCLA 2P1FA 2C3ZA 2PLJA 3GIQA 3NO1A 3E2QA 4HU4A 1TWDA 4LBSA 4DUOA 8TIMA 5H2ZA 3W22A 1JYVA 4DNHA 3WUGA 4J3TA 4Q32A 2WSRA 4J4KA 5HWMA 2BBFA 3UF9A 1HT6A 3B0PA 4MPKA 2FGLA 5HWNA 1YTEA 2NUXA 3WQ6A 1Q7MA 4ZSTA 1TQXA 4N6EA 1JCJA 1IXOA 4EPKA 4X2RA 2ZDRA 3GH7A 4X3ZA 1J79A 1TJ1A 1QUMA 1Q6DA 4OGZA 1BSIA 2F2KA 1QOQA 3B4UA 4BI6A 2VCAA 3VKAA 3HFYA 4NIRA 1CXLA 1G01A 1ITXA 5F2LA 3AO0A 3LNPA 1S3HA 3C2OA 4MZYA 4DF1A 3S6OA 5HPCA 3GC2A 3QXBA 4UB9A 3NQ6A 4FZIA 2PUZA 1EJXC 3TQVA 1FRBA 4RPQA 1KCXA 5A8MA 5AC5A 1W9PA 4YCPA 4YMZA 3EOOA 2BOGX 4S3KA 1EGZA 3LM3A 3H26A 3RLHA 4YTSA 4ECLA 4X2PA