2QUNA

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii in complex with d-fructose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 112
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2qunA00
1DE5A 4QE1A 3M0MA 1XIIA 3KBSA 4OVXA 2NQ9A 4A8LA 2G0WA 1BXBA 1XLLA 1YX1A 4Q7IA 5B7YA 3UA4A 4K1GA 2ZVRA 3KBMA 4YTQA 1MUWA 3KCLA 3VNLA 2NQHA 4A8NA 5XIAA 4YTTA 3DBNA 2GLKA 3ITYA 3AYTA 3TVAA 3ITTA 1QT1A 4US6A 3VNKA 1A0EA 6XIAA 4E3VA 1XYCA 2X7VA 3UXIA 4DUOA 2HCVA 1XLEA 3BANA 3CQJA 3QXBA 4X60A 4ZB5A 4HHLA 3CQIA 3WQOA 3XINA 1XIGA 1XIDA 4K3ZA 4EAYA 1O1HA 2I57A 4QEHA 4GJJA 1S5MA 3UA3A 3KCOA 3L23A 8XIMA 4XSMA 3BZGA 1XLAA 5H1WA 1GW9A 4XISA 3AYVA 3ITXA 3LMZA 1XLMA 1OADA 1DIDA 2QUMA 3AALA 5B80A 5B7ZA 1XLHA 3M0YA 3ITLA 4GQBA 1XLDA 3TC3A 2G4JA 3N4AA 3KWSA 3VNIA 5TNVA 4J4KA 8XIAA 2X7WA 7XIMA 1A0DA 2HK0A 1XLBA 1S5NA 3DX5A 3QZAA 5EMMA 5AVNA 3VNJA 5H6HA 5XIMA 4DVOA 9XIMA 1CLKA 3XISA 4EACA 1XLJA 3M0LA 1XIHA 1XICA 4GLEA 3XIMA 2NQJA 3KBNA 1XIEA 3BZJA 3KBJA 1XIBA 3M0XA 5EMKA 5AVHA 5FA5A 3VYLA 3C0SA 4GJIA 4PFHA 1QUMA 3CWHA 4ZB2A 1BXCA 2XINA 2GYIA 6XIMA 4LNCA 9XIAA 1K77A 3IUDA 3CNYA 4PGLA 2QULA 1XYAA 1XYLA 3KCJA 5J8LA 4QDWA 4A8RA 2HK1A 3CQKA 3ITOA 3UVAA 4G56A 5EMJA 1XYMA 1XLCA 1XLFA 3NGFA 1A0CA 3OBEA 3QC0A 4XIMA 2GVEA 3JU2A 1XIMA 3C0LA 3UU0A 3M0HA 1QTWA 3GNXA 1I6NA 3IUHA 1XLIA 5EMLA 3U3HA 3VNMA 1XP3A 1XIFA 4QE4A 4XSLA 5XINA 1D8WA 4XKMA 5C9ZA 3QYSA 1XINA 4W4QA 2I56A 3U0HA 1TZ9A 4XIAA 3BWWA 4HGXA 1DXIA 4HNOA 4YTSA 3C0QA 1DIEA 1XYBA 3KBVA 1XLKA 2GUBA 4QDPA 3P14A 2XIMA 3ITVA 3P6LA 3FVMA 4X63A 4QE5A 3M0VA 1XLGA 4ZBCA 2Q02A 2J6VA 3KTCA 2ZDSA 4X61A 5I7GA 3AAMA 4ZB0A 1MNZA 4KW2A 4QEEA 4A8IA 2OU4A 2QUNA 3CQHA 4YTRA 2XISA 2QW5A 4HHMA 1XISA 4YTUA 1I60A 3BDKA 1DE6A 3KBWA 1XIJA 3IUIA
chains in the Genus database with same CATH superfamily
1GTHA 1PKNA 4DWSC 4RZ6A 4ZOEA 4D6CA 3NQBA 4D1JA 1K1DA 3LPOA 1KM2A 4FOKA 1RK6A 3FGCB 1WAUA 4M0XA 1LWIA 3TOPA 1JCXA 1FBAA 4P8XA 4A4AA 4PEKA 4QRNA 2UWFA 3UWUA 2VR4A 4ZMGA 2VZTA 5H8PA 4C1LA 4LRSA 4A3YA 3WQ5A 1IEWA 4W86A 3T81A 3VD5A 2NX3A 2J47A 3PZMA 4ZB2A 2GOUA 4IGMA 1PX3A 3R94A 4PUDA 3ABSA 3NQGA 3WBYA 2PLMA 2XWEA 4C91A 1GG0A 2PC4A 4L80A 4EX4A 5D9MA 3ZMRA 1KRBC 3L4UA 4LAUA 1MEHA 1TIWA 3ARYA 2PDLA 4FXSA 1Y0EA 3VMNA 3J7HA 4JZ5A 3ABQA 2J6VA 2OTDA 2WMHA 4O11A 2V6AA 3T9PA 1H7WA 5DFAA 1G4PA 2HBVA 4NP7A 4IICA 5CG0A 1J2BA 1DJIA 2JGQA 3IRDA 4E4UA 2GLKA 4Z1YA 4ZOCA 1DL3A 2GWNA 3O3RA 4IPJA 1W31A 2YOCA 4X0NA 4P7RA 2BDQA 4DUOA 3ANUA 3JUGA 2ZYFA 3S2LA 4C6NA 2FQIA 1F3EA 3MSGA 3I3DA 2VT0A 2E40A 4KPLA 1X1NA 1OC7A 3OGVA 4A3HA 3TC3A 1PBGA 1EP1A 3S9IA 3IWPA 1NOUA 4JHZA 5HINA 1VBJA 2QR6A 3M0LA 2ZADA 2SFPA 1JRCA 4B16A 1EUNA 1C3FA 4MJZA 2BG5A 4C6IA 3CQ0A 1EC7A 4LC8A 3RG6A 2E1WA 3MZNA 3WUEA 3G3DA 1Z32X 3OTRA 3I3EA 1KBLA 3AHTA 2YIHA 1Y65A 4DN1A 5C7HA 3R4IA 2IKGA 3EYPA 1FWEC 5I00A 2J8GA 3MHGA 1LF1A 1AL8A 1JZ8A 1Z8AA 2FPVA 5C2CA 2YDQA 2TSYA 3GU9A 1S5TA 4LV9A 1FXQA 3RCYA 4UFHA 5K7JA 4DZHA 2H3BA 1WE5A 4PN2A 4GACA 1VFSA 2IXUA 3I4KA 3USZA 1C7TA 2RHGA 5D03A 1FCBA 2IXVA 3LK6A 2W5FA 3IV8A 4NXKA 4IXXA 4FMVA 1ZALA 2J7FA 1ZJBA 2YCJA 3AS3A 1BSLA 2PE4A 3BCFA 3M6YA 1U83A 3PANA 2CLOA 1OADA 3EDKA 2B7NA 4Z42C 4FSAA 2Z7KA 2VZOA 4UTWC 3R43A 5D4YA 5KMYA 5FIPA 2ANUA 3BE7A 4LU0A 2ZA3A 4EANA 5DRCA 4XZLX 1O5RA 5FA5A 2PDNA 3VYLA 1CXHA 2GSHA 5MKGA 1TO3A 2IKJA 3SQLA 3VIHA 1FH8A 3GIPA 3VDAA 3ARTA 3BMWA 2C14A 3YPIA 3LM3A 3JU2A 4C7FA 1TV3A 1ZENA 3WEOA 3PP7A 1VFUA 3CL7A 4TIMA 3OEXA 1ZS2A 4E2OA 1O5KA 3S42A 3I6TA 1U5HA 3PPHA 1UPMB 1VLWA 3P14A 4W87A 2ACUA 3EA1A 2VX5A 1JEZA 1PB0A 3KTCA 2CZEA 4JTSA 3ALFA 4HNTA 4KW2A 3GTHA 4OGZA 1R46A 1K6AA 4OZOA 1W1TA 3KVMA 2X41A 1I2PA 2QPSA 4N4QA 2Q6ZA 2YKKA 3NZPA 4MZ1A 3WLJA 1XW8A 1HJUA 1IZKA 3L5AA 1R7AA 2JK2A 3CT7A 4BI6A 3B3DA 3F4VA 4WKAA 5KZDA 2AGKA 1A47A 4H4IA 4FF7A 2FGBA 2HJPA 1H1ZA 3M47A 4CQ9A 2OSYA 5M17A 3CT2A 3MSDA 1IT8A 3ITXA 4GINA 1A4LA 5AKQA 4Q4RA 5CC7A 3NA8A 3SCOA 3TYEA 1PWMA 1EP3A 2R82A 1EJXC 4PEEA 1POKA 3MSYA 1UW9A 1CENA 3A64A 3PTDA 4G7EA 1E43A 3BW4A 4IPIA 2VZSA 2W0UA 4YCOA 4ZO6A 3DHFA 3O2LA 3FXYA 1S1RA 1MW3A 1L6WA 1W2PA 4GY0A 5A2AA 1SJDA 4BEUA 1SM9A 3ITGA 5IHSA 4X9YA 2HWGA 5AHNA 2OMAA 3LCFA 4DBWA 3LRMA 1JQXA 2X0HA 4PMOA 3KAOA 3W01A 3LENA 4GC3A 3SI9A 3UEQA 2XIBA 2CBJA 2DW7A 3MHFA 2RDXA 5I3GA 4OECA 1A5UA 3F1QA 4UTJA 1FH9A 2QLYA 3NL3A 3DN5A 4HQVA 2E9BA 1BWKA 3H8AA 2WMIB 1SO5A 3LLDA 4RW5A 3AIRA 3CIWA 3D47A 1KC7A 2OQHA 1GEQA 2WYSA 4JKLA 4DXVA 3S4TA 3BDKA 4QROA 3ARVA 3G5EA 4XZBA 2I9UA 4NJKA 1NY1A 4YTTA 1XI3A 5EYWA 4DYEA 2RJHA 4HB7A 2WM1A 3UR8A 3GXDA 1L0PA 3U57A 1CCWB 5I3HA 3S3GA 3E49A 2MUCA 4O28A 3W07A 2INFA 3JW7A 1KXTA 4DLFA 4RDYA 4O14A 2ZXBA 1P6BA 3EWDA 4XKYA 3E96A 2E6AA 1HKWA 3W2LA 1K7EA 2YZ5A 3OBAA 3ANYA 1J8VA 2IKHA 2HV5A 3QLLA 4DQWA 3HM7A 3VOJA 3HFYA 5CQ1A 3KRUA 3KLKA 1JGMA 2O7SA 5EA9A 1QPOA 4W84A 1G67A 4C6PA 2CXGA 2REQA 3SRHA 2CYGA 1EGVA 3P93A 4DWSD 1YDNA 1M5WA 2VNCA 3UVAA 4WXZA 3UJ2A 1SFTA 2XFRA 5DELA 5GPRA 3LS9A 3WSUA 4C6KA 3SUUA 4XSLA 3EWCA 3LHUA 3P61A 1HL2A 2RDUA 4JPGA 2XIJA 1O95A 1E9ZB 1H61A 3NPVA 2CWXA 1VRDA 4NZ3A 1OSEA 3LHVA 4KCUA 3ZWTA 4I6KA 3HQPA 4GABA 1GQJA 1VR6A 4Z1AA 4LAZA 3GXFA 5JMUA 2VDGA 1EGMA 3NQDA 4OE7A 1E1FA 3WD0A 2ZDRA 1GJPA 3CQIA 3PZ9A 3KOXA 1GNXA 1H7XA 3IGSA 1PEZA 2UZ9A 3ZFHA 1W1B1 1OFQA 4FOUA 1R86A 5D9NA 5B7ZA 1W3TA 4C6MA 4UNLA 4PTNA 4Y9OA 3TN5A 3H7RA 3CL8A 2EG8A 5XIMA 1XLJA 3GVGA 1KM1A 3M0KA 4UMBA 2WMGA 4MB5A 5AHMA 3WNMA 4NX0A 3SAZA 1DWAM 3WNPA 2YL9A 4HA3A 1Q85A 5I6SA 1TTQA 3E1F1 2R1LA 3PAJA 2YBUA 1XM3A 3M4HA 1R5YA 3C5QA 1P48A 3WLNA 1IXQA 4GUJA 1XH0A 1DHKA 1R3VA 1FWRA 1W5PA 1W9DM 2DV0A 3CMFA 2HTMA 3GB6A 1E6RA 3ORWA 1POJA 3H22A 3QRHA 4BEQA 2VFFA 2Y70A 3GW0A 3A47A 1QHOA 3EWYA 3T1GA 1P0EA 3K8KA 1W1YA 2WWDA 3KCLA 1XUUA 4GYKA 3VZYA 3PG9A 2EPLX 4LVFA 4JX5A 4PL1A 2YA2A 1ZLPA 2GFTA 3N2BA 1UP2A 2FJUB 2V2CA 1WQ5A 3KCOA 1AD4A 2BOEX 2VC7A 1OD0A 4PUEA 3MMWA 4WHBA 1SMDA 2FDSA 5DY3A 5BWFA 4ICNA 4O19A 3S1XA 4KCWA 5J04A 2OT1A 1W3IA 4DVOA 3PJTA 4B3ZA 1KTNA 1OT1A 3EOOA 2QHAA 1XBZA 1GORA 4GLEA 4NASA 1Q6GA 2BLEA 4IJCA 2PWUA 2QCMA 3ONBA 1O5QA 3EA2A 3RPTA 3TH6A 2E8YA 1B2YA 2HPIA 3I7RA 1UR9A 1W56A 2QGYA 3DHDA 2QAPA 2QDHA 3G1HA 4H7CA 2DIJA 3URQA 3TR9A 2ACRA 1B90A 3S5OA 4CU6A 4XBKA 2DZVA 4I7UA 1IZJA 3U4AA 3T05A 3G77A 2F7FA 3KFTA 4AIBA 4ZBCA 1FP9A 5I3DA 4AW7A 5CPQA 3NM3A 5KINA 3GNOA 2DT1A 3GAYA 4RE4A 2YJQA 3WK3A 1NIUA 2J7CA 2PU1A 4XD3A 3P62A 2DU2A 4K8GA 4TVUA 2PURA 1KWGA 4NI3A 3W23A 3ATYA 2PC8A 1CB2A 3FAXA 2X16A 3A24A 3OIHA 3F2BA 4GBUA 1OVDA 2PLJA 3W74A 3S2MA 3UCQA 3WD1A 3QTGA 3VKJA 4ZOAA 1Z42A 3CO8A 4M6UA 1ITCA 3TCEA 3SQSA 4W7UA 4KQNA 4FO4A 3AWNA 4X22A 2FJKA 2IQTA 3KDNA 3O07A 1ZAJA 3CAQA 2QUMA 1XLHA 4B5NA 1PIFA 4GZ7A 3UNDA 4C5YA 1GHRA 2HVMA 1A49A 4ZQRA 4OV4A 3K13A 4C6EA 4DBDA 4RL3A 4YPJA 1VFFA 4LJ3A 3MPGA 5JBEA 2VRJA 4K1WA 2X1IA 3UZJA 3L2LA 3RMEA 3AS0A 4MWAC 1BAGA 1PS9A 1RALA 2G3NA 4KCVA 3MUIA 3UZXA 1EYWA 1KRCC 3MT1A 1YADA 4M24A 1D8WA 5DXYA 5I02A 3DC8A 1XINA 3GHSA 3W53A 3EX6A 3VIFA 1SQ7A 2E9MA 4LH8A 2JKPA 2KX9A 4Z2IA 1SFSA 1C93A 4ROPA 4IH3A 4JL2A 3VGEA 3B0PA 4HJFA 2JIEA 3WDQA 1P1XA 3QHOA 6ENLA 3AMKA 2FB3A 2YXXA 5JXQA 1WDWA 3L66A 5I78A 1RCQA 3E0FA 1HQTA 1WXJA 2DIKA 4NX5A 3TVAA 3P0XA 1IT7A 5I3IA 1PKYA 4JTLA 1HJVA 1YTEA 2PLCA 3BOXA 4C6CA 3EOSA 3E2RA 3PR2A 1VF8A 2FHBA 3C2YA 1DIDA 3APYA 2QPUA 3M0YA 3T4WA 1VEOA 2A1YA 3N4AA 2WM0A 4V1YA 4H3DA 2Q71A 4LUSB 4L4OA 5BMXA 3QKZA 3VNYA 1RY0A 5CGQA 1PKLA 1KBBA 1H4PA 4GI9A 2QKFA 2VDHA 2I17A 1KXHA 1EJTC 2W92A 2ZBTA 1EWDA 3QQ1A 5H8UA 4D6JA 4AQLA 3G1FA 1XLFA 2MANA 3HV9A 1BWLA 1O66A 1F7BA 4HMCA 3MS8A 3GZ3A 3VIPA 3KVKA 1UD8A 4L1WA 4US5A 6A3HA 5FF3A 3PUEA 3U4FA 4WIWA 4M3PA 3BSMA 4EK7A 4LAMA 3TFXA 4UQ9A 1F3WA 2WCAA 2IKIA 2P0IA 2QUUA 3PBMA 1FOBA 3GDTA 4JIRA 5A6LA 1MZHA 2J9YA 4ZXLA 2WCGA 3IGHX 1WYIA 2YZRA 4AWTA 1XBXA 1J6PA 5E93A 1Z48A 1BYAA 1C8YA 4BQ3A 1TE6A 1OZMA 1XIDA 4QG9A 4TMBA 4CU7A 2PDFA 4HPXA 5HMDA 4PL2A 5FD0A 2TYSA 2XN0A 3S5YA 3SADA 1UA3A 5HPCA 2D2GA 4J4KA 2RDWA 4ZL1A 1Q6OA 2WNNA 1VEMA 4UZSA 5A8MA 3W7GA 3BGGA 2QJNA 1Y5VA 1CLXA 1OIMA 2QF8A 5HXMA 5CPSA 4XAFA 3KLLA 1XBVA 1FHUA 4DPQA 1HF6A 4UFKA 3VNMA 4LANA 1UBPC 1UUQA 3HOJA 3FV9A 3SIMA 4UFJA 2C1HA 2HS6A 2C7FA 1UKOA 3ARRA 2PZ0A 2RFGA 2YBTA 3R89A 3OBKA 2IQDA 3KOYA 1UROA 3BC9A 1AK5A 3EX4A 3K5XA 4Q4QA 4D8AA 3EPOA 2VGBA 3QPZA 4IFKA 3BG3A 1XX1A 2FVMA 4GXMA 3CHVA 4LY8A 3HGJA 3QHNA 3KBWA 4BHYA 4JTFA 3B8DA 1BTMA 4QP0A 1E70M 2ISSA 2HVNA 3MZ2A 3PJWA 1NDWA 2VZUA 4XZIA 3SUVA 4G5DA 1XYZA 5IFPA 1KBKA 2BVDA 2CHNA 4LQ1A 3RX3A 3UA3A 3OQ8A 3ZJ6A 2V81A 3H55A 1ZBVA 3UR2A 1VFLA 2PCQA 3H12A 3REQA 1W1VA 2E28A 2Z6JA 1ONWA 1J0JA 4QBXA 4FA3A 4F9DA 1E6QM 1BYCA 3LCIA 3GUGA 2ZRXA 3THUA 1IGWA 3OO2A 3WF2A 3LMYA 3W2MA 1R6WA 1T40A 3ZYZA 4D6IA 4PCFA 2VMFA 2VWTA 1WP6A 2BXYA 4TV5A 3WBAA 5D38A 1US2A 3AXIA 3H4WA 2QUVA 1A5KC 5BOOA 1FTXA 1Q5MA 3AS2A 4IGNA 1UR0A 4M7SA 3I4EA 3LXCA 2I9EA 2E4TA 1WDSA 3H2FA 1K9DA 1ESWA 4RKAA 2I56A 2GOKA 2ZZ1A 1HKVA 2AMXA 2WLZA 1UUOA 4EPEC 1QDSA 3S5ZA 2GUBA 3URBA 1KFEA 1JPKA 2FDMA 4JNMA 4YIWA 2WW5A 5KZEA 3DEQA 1NF7A 1ZSXA 3LTYA 3THAA 2VGIA 2OLSA 5CBJA 3W1PA 1HN1A 1ITQA 1SW7A 1O1ZA 1K03A 5HA7A 1PSCA 4JTUA 6XIAA 3SCPA 2CBUA 5E5CA 3GNRA 3AXXA 3HIJA 4PUNA 5EGRA 3L67A 4HYWA 5D2XA 1PYFA 3HQNA 4H00A 4XISA 1E9IA 1F73A 3EX1A 3WBWA 5REQB 4XBJA 4K68A 4BA0A 4AHPA 1Z41A 2Q8LA 5DRIA 2A7PA 3MKKA 3LPPA 4PTMA 4HPNA 1X7FA 5I5RA 1CLVA 4KIRA 5AVHA 4CD4A 3R8RA 4XAZA 1CDGA 1LL7A 3L5MA 3W2NA 1X8FA 1KCXA 1TQXA 3GDRA 2GSJA 4CNUA 1KBJA 2OKTA 1T6MA 2F38A 4JL1A 3GD6A 1JNDA 2Q8ZA 3P74A 1OCBA 2XGZA 1NDYA 3U48A 5ABEA 4CD8A 4MAZA 1ME7A 1XDJA 4U4MA 2ZXDA 3FVMA 3RU8X 3IJQA 2VCBA 3IIOA 1EBGA 2POZA 3QY7A 2HDJA 4FXRA 4PTDA 4MB1A 3D5HA 3W7CA 2PP1A 4YVXA 5M3WA 4JY9A 4Q4OA 1BRLA 3N29A 4MWAD 3HPAA 3W7RA 1RY8A 4WR3A 3SN0A 1FKXA 3NQMA 3OVGA 4B3KA 3TQ0A 5LA0A 3GK0A 3FSTA 4PRRA 2F6XA 4W5UA 2VEKA 1EEPA 3OYZA 4XVDA 4EF9A 3NZQA 2GL5A 1ZB5A 4GE8A 1TWWA 1H7PA 1N8IA 2PP3A 5C5YA 4UUIA 3QVQA 1WKDA 4CEUC 3KBJA 1V3JA 1FWDC 1OIFA 2Z4GA 4H8UA 3NQ7A 3N3MA 4NYYA 4MWAE 5T26A 1OGBA 3KVJA 1SPQA 4AG0A 3GH5A 4L7ZA 3NL5A 4Y9PA 1H5VA 4JTJA 3GG7A 5GJPA 1CGXA 3TAOA 5M03A 1KM4A 3T55A 2J13A 3ABXA 3DOPA 1MYRA 1CZ1A 2O7QA 1MQRA 4IMGA 3TV8A 5HPOA 2BP1A 3ARWA 1E4LA 4QJ1A 1A5CA 3ZR6A 4I8YA 3SUTA 4C6FA 4C7DA 1H7RA 2VWSA 1S2TA 1O7AA 4GWEA 2C16A 3KTSA 3RLVA 2VO5A 2IW0A 1BXBA 1RBOB 5DMNA 3NSMA 2DUAA 1JDCA 1S1PA 4DWSB 3ITTA 3B0UX 5I2UA 4U2ZA 3VVGA 3ZIZA 5DMMA 2YDRA 5ENLA 1CT5A 3H54A 3NJ3A 4HN4A 4XAPA 4NNAA 3ZO9A 4FNQA 2Z28A 4S3DA 4QJ4B 4HTBA 1R38A 2DPEA 1E4IA 1UR2A 1PUDA 5BROA 4KEVA 3STPA 3CIVA 4ONVA 4PRTA 1XKJA 5FJIA 3CL6A 4FNUA 1R7OA 3N25A 5CJMA 3ICJA 1H60A 2DZXA 3QZAA 2Z1VA 1YXCA 1ZTVA 2XN2A 2YCLA 1TZZA 3W76A 1PJ9A 1AMYA 4HCDA 3MUZ1 1OFRA 2PDBA 2ZCGA 3UY8A 1J10A 2OWCA 4FNPA 4IP5A 1V4YA 4IFKB 3OJGA 3R0KA 5IHRA 1C9DA 4FX7A 4TX8A 5FJTA 1TYGA 1AUSL 4Y2WA 5I07A 2VEIA 8A3HA 3GXPA 2VFGA 4MAVA 3I3BA 2D24A 2GVJA 1SFLA 3P8IA 3TXZA 2VR2A 3UWZA 3C2VA 3D0CA 3AQUA 5T91A 2XIOA 5I77A 5AHLA 1JZ6A 5M1TA 2WPGA 5C9XA 4W89A 3EDDA 4YTUA 3REQB 4S3KA 2ZWYA 1M68A 5CZJA 3HJEA 1Q6LA 5M2FX 3WIJA 3H4XA 4KRTA 2D2OA 3WNKA 1XRFA 3MW7A 3QMSA 4IJBA 3MUAA 2X1UA 2HXUA 1EBHA 1THFD 4JN8A 3V18A 5A6BD 2E6FA 5H1WA 3C61A 4PMJA 3SY1A 4OOUA 1FWHC 3FFSA 4JCLA 3ELFA 1EX5A 4XZWA 3UYCA 3F7JA 4DO4A 1SJBA 3FSUA 3ES8A 2EGZA 3B06A 3OGRA 3GVWA 4V1XA 3R1ZA 4PMNA 4GI6A 4DM2A 4GUGA 1BFNA 1ZP4A 3STGA 1OF8A 4K36A 5D2YA 6XIMA 4E4FA 1NQKA 4KETA 1B30A 4CQDA 4Z1CA 2WNQA 5LIUX 3UGRA 4XZNX 3W26A 5LGXA 4DRSA 1Q7QA 1JYVA 4BQ4A 4AWUA 4OUIA 1PAMA 1SGJA 4F2UA 2V5CA 4XZMX 3TC6A 4N6FA 1QJWA 2XIMA 1HJWA 4KGLA 3FKRA 1MQQA 3M7SA 1HT6A 4Z2LA 3QEZA 1C8XA 1PVNA 1W9UA 4XZHA 4CNNA 1W17A 3H70A 5I7GA 3VKDA 4UTUA 1I0BA 3WH6A 1XISA 3GSMA 1DE6A 1XPYA 4JEJA 3AHZA 1TPWA 5CLTA 5AZ0A 2D73A 5LGZA 2DZTA 3LYEA 3N34A 1VCGA 1J0YA 1QT1A 1UBSA 3VA8A 1UH2A 1E3XA 4F8XA 1FRBA 4LTSA 2YL5A 1F9CA 1IXOA 1G4SA 1OABA 4LYRA 3SFKA 4GJ1A 3VKAA 3VD7A 3NVTA 1MEIA 1LOLA 3POCA 1S5VA 1BD0A 3QYQA 1E3ZA 1EC8A 2YFNA 4O16A 5TAOA 3QY6A 1GW1A 4RZ4A 2GQAA 2VTFA 2X8RA 1JDEA 5A2BA 3ZS4A 4F66A 4PUJA 3M0JA 1P7TB 4ERIA 4PMVA 4CD7A 2X1TA 1RH9A 3AIBA 3W7OA 4DM1A 3MSRA 3ZSTA 3BGAA 3NEVA 4JDBA 1OK4A 3U2EA 1VGAA 3KE0A 2CPUA 4H9ZA 3TAKA 3RRAA 4M56A 4F9JA 4ES4A 4RPPA 3IUHA 3UT0A 2F6UA 4NUWA 3FW6A 1NFBA 5CZ0A 5ABFB 2GDVA 4FP1A 1BRLB 3N6JA 3QSTA 1ZY9A 4GOAA 4YTSA 3W2KA 4CVUA 1FDJA 3V4BA 3LZ3A 2AMGA 2OLHA 4UZUA 2YXOA 1QI3A 3OA5A 1IZCA 6TIMA 3GM8A 5IM51 4EPDC 2G3IA 3BJSA 2WJDA 1VZWA 2C19A 3V1HA 1B3ZA 1PZ2A 1SMAA 3UWQA 1R2TA 2HRWA 3B8IA 5FSDC 2D3LA 3WX7A 3I65A 4MY1A 3CQJA 3CUIA 3PWGA 1BF2A 3QZEA 1TCMA 1R3QA 4DPPA 1U33A 2ZE3A 1EGZA 3PSVA 3QLDA 1QI5A 4GYPC 2VC5A 3T2PA 4Q6JA 3WLRA 1BGAA 1E9LA 4ZCWA 5EMMA 4W7WA 5AVNA 5KTLA 2ZC1A 2CXEA 3WN6A 4LF2A 1HL9A 4XD4A 1VBHA 1JCLA 3PFRA 4MPQA 4X9SA 4IPPA 1VBRA 3DHUA 3C0SA 1ZGDA 3PY2A 1ZJAA 2Z2AA 3QFWA 5CC5A 3CNYA 1XYLA 7PTDA 3TSMA 1RVGA 2QCDA 2JKEA 1PZ0A 5F7UA 5IBXC 4MUPA 2QDEA 3GH7A 1JF6A 2QT3A 3N12A 4H8HA 1VYSX 1UH3A 1SZFA 1OK6A 1LRQA 4AZCB 5HNTA 5BXRA 3AUOA 5TBOA 1UOZA 4ZA0A 4JFWA 3D6NA 4YJ5A 1OFOA 2P76A 1EIXA 2X2GA 4AX7A 1CNVA 1EUAA 2QMJA 1MXSA 2H3DA 2RGMA 3TOYA 3SURA 5JVLA 1PWLA 5I3JA 3SSJA 3H2MA 2NT1A 1TELA 3NURA 1GWJA 3BAXA 5HULA 3H21A 3TYCA 1YX1A 1RJQA 4PH6A 3MY9A 1GVYA 3M07A 3GHTA 3VNKA 1ODZA 1TFVA 4RE3A 5KETA 2HXTA 1JD9A 1E4MM 3ITCA 1ZBCA 3F2CA 2FPYA 1E15A 1XDMA 4DAFA 5CPMA 3PBYA 4HZMA 4HPHA 1EA0A 3QGAC 2W63A 1FQ0A 1UWRA 2DT3A 2J7HA 3GVQA 1Q6EA 3BARA 3LHYA 3WDRA 3GE7A 5CPLA 5I0DA 3O05A 1WDRA 2UY4A 3ARZA 2FH8A 4DB7A 3RAOA 3WQFA 3RGTA 2P0OA 4E8CA 4LVGA 4KIEA 5LIKX 2PCEA 1QOPA 4GD0A 3W70A 4FNTA 2A3AA 1MEWA 4XD6A 4RNIA 4XV0A 4CD5A 2ZZ2A 2VUYA 5LHFA 3UG5A 4ZEPA 1KRAC 5HUOA 2XFFA 1FWTA 2OOGA 4C1KA 4B15A 4AZGA 2DVTA 4Q32A 4UOZA 3GNNA 1G4EA 3UXAA 1VHNA 4AZ6A 4IMCA 2FHCA 1HGYA 5DCBA 2PBGA 1GEHA 1QO5A 1MUCA 1KRMA 3ZR4A 1RA5A 5LNWA 3P80A 3PNUA 4CN4A 2X0SA 1KFCA 1XSKA 2QUNA 1SZGA 4GJIA 3W28A 4YHGA 4QE1A 2NT0A 4TUFA 1B1YA 3DC0A 5G1TA 3T7VA 3NPWA 1Q45A 1EJSC 2WSQA 4JTTA 4LYQA 2XH4A 2DSWA 3QN3A 1JZ3A 1VHCA 2DEPA 4IUOA 4S39A 5LIXX 1Q6FA 3A4AA 1LBMA 4Z2HA 4GVIA 5E9XA 3VD9A 4E0CA 5G4EA 3H2EA 2PEVA 4NL1A 5F4WA 3V35A 1Q4NX 1WKEA 1I2QA 3AICA 5DY2A 4NZ1A 4U28A 3UWEA 1NP2A 4O1EA 3IV3A 1IHIA 2G50A 4FAMA 2Y7FA 3P82A 2XSXA 1XICA 3SY8A 2Z24A 1LDCA 3CEPA 2JBMA 3KTXA 3HQ1A 2EJAA 3KVLA 1XCXA 2VOMA 5I3FA 3CV6A 1H7NA 2PUZA 4D6GA 4AY7A 4OIFA 3NWRA 4HZ6A 1ISWA 3SRKA 1Z3NA 5LA2A 4E2DA 3UGVA 3R0UA 1XJBA 2CZ5A 2G95A 3DZ1A 1RP8A 1QRQA 1X98A 3C6CA 4X2PA 2OB3A 4PUUA 3UJFA 2NWRA 3VU2A 1SZNA 2AQOA 1FX6A 1CXEA 3WQ8A 3B8UA 2LLEA 1XYBA 2RAGA 1Y7VA 4IL2A 4AF0B 4HPGA 1TWDA 4HBKA 3S9YA 1ZBKA 2O9PA 1JUEA 1UJQA 1PPIA 3RK8A 3QJAA 1J11A 1VLIA 4BKNA 2X05A 4HNNA 2PDPA 3DUGA 2GSEA 1GVFA 3GNDA 2PDQA 1TTIA 4D6DA 2J27A 4GG9A 4M29A 2JGYA 2ZZ4A 5K4XA 2BY0A 5I06A 3TW6A 2GDQA 2UY2A 3QW3A 1QPKA 3MO7A 3IS4A 3TNOA 4X0VA 4RXFA 4MADA 2PU0A 2PDWA 1UHVA 2CLPA 3M6DA 1GZGA 2VJXA 3L4ZA 2WJZA 4ZE5A 4LS0A 4O50A 1YHTA 1W9VA 2X7WA 3CAWA 3QM3A 5G2WA 3GFZA 3LLFA 3BLOA 1S46A 2ALRA 5H6HA 5G1YA 1AL7A 2Q8XA 3KL0A 3N4FA 7REQA 2WBGA 3ATZA 1BSIA 3LY0A 4W88A 4B9ZA 2AKMA 1FA2A 1UD3A 4IUGA 2JFEX 1W3JA 1VB9A 4QLKA 5BYWA 3N6QA 2D1ZA 3LBMA 1TZ9A 4JS3A 3VIJA 3WQGA 2YDAA 4HYRA 3HG4A 4MY9A 3KRSA 2FZDA 3W88A 3VIKA 1RAKA 1H41A 1G94A 4FNSA 2Z2BA 2CIPA 3GHRA 1YTDA 2FZBA 4NAFB 1RD5A 4YN5A 2TRSA 1LYXA 2E1DA 5AYXA 2PD5A 3QQWA 1DKWA 4AZIA 3TIMA 4UR8A 4O10A 4O1DA 2EG6A 3TQVA 5JH2A 1V3HA 4JN7A 4MY8A 5FF2A 2CESA 2HZGA 3OVPA 2E68A 3W22A 4AFYA 1UYQA 3DH7A 4WF7A 4U2YA 2BXVA 3B04A 1YPIA 1KM5A 2WHKA 3G24A 4YMZA 2CBVA 1F76A 3WQPA 4WD0A 4GCAA 4IIBA 4FR1A 7XIMA 4S2BA 1B3VA 9XIMA 4IX0A 2Y62A 4NYUA 2R24A 3APTA 4O1FA 1AH0A 1W5QA 3SO7A 2FGZA 4IHCA 2R9RA 3CB3A 3C56A 2RGLA 3BLIA 4CCDA 3IJ8A 2WC3A 4OV9A 4AIUA 2PDUA 3LPGA 4MWAB 3QOMA 3WDJA 1VPYA 5HWMA 4CGTA 1Q4WA 4D6HA 4CCCA 2V68A 1HP5A 3W6MA 2D20A 3DGRA 1EH9A 2VGFA 2B4GA 3CTLA 1SSDA 3W7QA 4Z1DA 3KL5A 1DJGA 3N11A 4N7QA 1EYEA 4EPBC 3V75A 4AYGA 1H51A 3FA5A 1GOXA 1E56A 1UZHA 4QSHA 3S8HA 3ZLHA 2NV9A 2O9TA 1I1WA 1YQ2A 2Y0FA 4K37A 4TO8A 2BASA 2TAAA 3CM4A 2D2HA 1TVLA 4NZFA 4NIRA 4AZBA 5C2XA 1YMYA 2AOSA 2R1NA 3NQ6A 1R2RA 3E0WA 1A0DA 4GC4A 2ZZ7A 1US3A 3PAOA 4QJ3B 4JAWA 4JYDA 4ZSTA 3W82A 3Q94A 3ZLFA 1E71M 5A6AA 4NJJA 4Q7NA 1V5XA 2GGEA 4F2BA 2HPMA 1HL8A 3IUDA 4HD5A 1VRXA 1ZZMA 4QDWA 2C79A 2DVUA 3VZZA 5EFDA 1LT8A 4ZZ9A 4ZQNA 1JCNA 3B03A 3MJYA 4XKMA 3LGGA 4GIAA 3G1VA 4N42A 1N82A 1DXIA 3DI0A 2XWDA 3DCPA 5CPNA 2XIQA 1A5AA 3EWZA 4HIBA 4ZO9A 3WL0A 4WJXA 3R5EA 1TA3A 1UR3M 5LIWX 2FTWA 4N4PA 5EFFA 3R11A 2ABBA 1OYBA 5I09A 3T78A 1HO1A 1S2WA 3AJXA 3HG3A 3EEZA 1ADSA 3PZIA 2PLKA 1DOSA 1P0KA 1TIMA 4XZ9A 4HMDA 4AISA 3WUGA 4IQLA 4WSKA 3PTMA 2QS8A 3LCHA 3M44A 3TQKA 4JKKA 2WXDM 4JTIA 1A3WA 1RBLA 3GXTA 3V5OA 4I9JA 5EB8A 2ZOXA 2WB5A 4WQ6A 2G97A 2PTWA 4GY7A 4B91A 3E12A 1B5TA 4GQBA 2JF6A 5F2IA 4IZGA 1V93A 2ASHA 3Q2DA 2PWFA 3RFAA 2B81A 1J96A 1IXPA 1GK8A 1JPIA 1QWKA 5DXXA 4ZR8A 4GI4A 1XIBA 2ZUTA 3NIYA 1X6UA 3GLCA 3ALGA 3G0XA 1YYAA 4LC6A 5HJLA 5DMYA 3K30A 1OX4B 1IT0A 2VQTA 5FAJA 1F07A 3UPBA 2OXNA 2WHJA 4JX6A 3PPFA 1JNEA 4W93A 5PTDA 5CSYA 3G8RA 4L1XA 1CEOA 3HBLA 4PYSA 4WOZA 3LEPA 2Y1HA 5JQ9A 3NEHA 4V2XA 2VFDA 4IIGA 4OU1A 1HNYA 1LRNA 4MJ4A 1ZCCA 2VX4A 1FWGC 3BAWA 1WA3A 2YCKX 5EL1A 4B4FA 1WBHA 2Y8KA 1O60A 2ZDSA 5EY5A 4Q4MA 2X1SA 4Q7BA 1F8MA 4UFIA 2XVKA 1TX2A 2HROA 3DDMA 5DO8A 1IQ8A 5GJMA 4KWWA 3FDGA 1TE1A 3W27A 1VFOA 3W84A 5BXPA 3UA4A 4CQBA 3K4WA 3UXIA 7REQB 4S3FA 1ICPA 2DQXA 3RO6A 1TTPA 4XX6A 4JR5A 3C2RA 3L2MA 3WLOA 4DJEA 2Q09A 1C7SA 2J8FA 3W1TA 2GUYA 1DYSA 1E0WA 4R53A 1E5JA 2HNHA 5BWAA 2I16A 3GTNA 4PTWA 4N6EA 5G2IA 2PZNA 4EPKA 1IEXA 3H7VA 3SY5A 3LTSA 3WLHA 3VIGA 1AZ1A 2A3EA 2PRHA 1U2YA 3LHWA 4PULA 3NGJA 1Z9AA 1XF0A 3PB2A 1NDVA 2INZA 3POHA 1MFVA 1PXGA 4TOQA 1K70A 3VPLA 3AHVA 2Z1WA 1DJWA 4KWVA 4PUWA 1AFSA 2NXIA 1B4EA 3BPWA 4R27A 3SGUA 4DZ5A 1SO3A 4MLJA 4Q8VA 2PWGA 3IK2A 4JGDA 3O9NA 3BSHA 3S6OA 3VE7A 2PDMA 3ZVIA 4QEEA 4HA1A 1U1JA 3G6LA 3EMCA 4LAKA 4MKNA 1K02A 2NXHA 1CWYA 2QVHA 3KBMA 2GVYA 4AD5A 3BCDA 3N2MA 4DNHA 3VZXA 3A5VA 1D3HA 3OODA 3BCJA 4Q33A 2DVXA 4LOCA 3V1PA 4O53A 4JQ3A 1B3YA 3N2TA 5C2GA 4IPLA 7TAAA 4NXSA 3R7MA 1VCFA 1V8EA 4IMDA 1NELA 1A50A 3JRKA 1XLDA 3VC5A 1Q2SA 3T2QA 1OCNA 3PBWA 4G7FA 1ML1A 3MP5A 4GO9A 4FX6M 1QI0A 4LCQA 5HQEA 2RKXA 1AH4A 3F5LA 2JEPA 1PIGA 3W1UA 1YPXA 2BGNE 2Z0IA 2OCZA 1VJIA 1XG4A 3Q4DA 2VDIA 3WH9A 4GI8A 3UXLA 2E8ZA 1T96A 1MMFA 2VEFA 3BVJA 4E8DA 2GDUA 5EMJA 5F2GA 2VCCA 3H23A 1ZP3A 4R7WA 4MDOA 5I79A 3CHDA 3NQ2A 3THCA 3W7IA 1EC9A 3AS1A 3C2FA 2CKSA 1NJJA 4IGHA 4REQB 1E6XM 1XCWA 2QGHA 4GUFA 3WJYA 1P5BA 4WDTA 2PA6A 5HMFA 4YWIA 3WO8A 4AWSA 1I8JA 3UZZA 3V0TA 5TD4A 2D23A 5FL1A 4K1GA 1AQHA 5CKSA 4AH7A 3G1SA 3HB9A 1FDYA 4F3HA 2OT0A 3F5KA 2CZFA 3WUFA 4BY3A 4Y96A 2ZA1A 3KX6A 4KFOA 2XH0A 4DO6A 3LD5A 1R30A 2V9DA 4QS5A 1IXNA 4GQ0A 1REQB 1MSSA 2G4JA 3W1AA 2V0TA 2HSAA 4IGSA 1WZLA 1AW5A 4W85A 2I5QA 3M43A 1LP6A 1ONXA 1M1BA 4IG2B 3TONA 1V51A 5EMKA 2WO5A 1UZ4A 3EKGA 3VUSA 3W37A 1R3WA 3CPGA 2WK2A 2FH6A 4ROQA 1TA3B 3P2VA 1WZMA 3ME3A 2PDJA 1EXBA 2GPTA 5AY7A 4HCLA 1RR2A 1I6NA 2XYLA 1SR0A 1KKRA 4KRUA 3PM6A 1P6WA 4BCEA 1W9XA 5D9PA 4MNKA 3DFQA 4B3LA 4LUTA 1E0XA 1WZKA 5BCAA 3VC6A 4GISA 1B54A 5DBTA 5HMSA 1B3XA 1MO0A 3CZ8A 2QJHA 4IT1A 1LUCB 2Y5EA 3WF4A 3BURA 3ERPA 3W1LA 1ECEA 4UCFA 4PMYA 4Y7EA 1MUWA 4A8NA 3DGBA 3E9AA 4PC8A 3WQ4A 3RLHA 1E1EA 5GNZA 3N9SA 3T8LA 3TJXA 4E3VA 1EEXA 4L9ZA 1KCKA 3LBOA 3OZPA 2GGGA 3Q37A 4MKSA 1MVYA 3NPXA 4QLJA 2C0AA 4DUWA 1UWTA 3COTA 1CGVA 2G4FA 4ZQMA 3MKVA 4GVHA 1XLBA 4JDYA 4QM1A 1U5JA 3EKLA 4NAEB 4GZIA 1GONA 4JFVA 4O57A 3M41A 2QVNA 3AMDA 4JHOA 2XG9A 3AROA 5E70A 2DT2A 1ZL1A 2A7RA 2PPGA 5HNUA 4KEMA 3TFCA 4IQEA 7A3HA 1M3UA 2PWHA 3PULA 1FWSA 1FCUA 2VENA 2DDXA 3IIVA 1FWJC 1MZRA 5HQLA 2I14A 3EXSA 4JYEA 5CZKA 1DTNA 1DIEA 4HNVA 2BMBA 4M8UA 1AODA 1CIUA 4B5WA 1J4EA 3TSBA 4J27A 3WEMA 3RO8A 4RE2A 4JNZA 1J0IA 2ZUSA 4XTDA 5G5IA 3TQPA 1WO2A 4HSOA 4U10A 3BLFA 3CS2A 4IM4A 4RR4A 1XYFA 3V7PA 3DESA 3CHEA 4ERGA 4L1GA 3CTTA 4JTGA 3G3MA 2X7VA 4DIAA 1UUMA 4ZVJA 4RPQA 3AI0A 4ILSA 4Y8FA 1RV8A 1ZPTA 1MUMA 4RE0A 1LQ2A 1VJSA 4R88A 1RD6A 3OG2A 1PCKA 1D2KA 1F5ZA 5L6UA 4I5UA 4FNRA 5A6KA 5MF5A 4U3AA 1GGOA 4RCXA 4YHEA 3UYIA 4RDWA 4AY1A 3DX5A 4KGJA 4IIDA 3WD2A 3PFMA 3C3UA 4DJDA 3RPMA 3TYBA 1AG1O 2OWWA 4IF2A 3H6OA 4Z1BA 3B8TA 3GBEA 2TPSA 5C6MA 3F03K 2OO6A 5A8OA 1GOIA 4J3TA 4GMEA 1XFCA 1OCQA 4WY0B 3HGSA 3PBGA 1L6GA 3SGGA 3S47A 3DAQA 1GQLA 1B0IA 3UJSA 2QCCA 2WVVB 4DUVA 1NEYA 6ALDA 4E6MA 3BJFA 1VP5A 2VELA 3R8GA 2H90A 4WDXA 2NVDA 3TNBA 4CN1A 4DZIA 4QLLA 4PSRA 3UCCA 4UQEA 2GQ3A 3NO1A 4C1NB 3MDWA 4K8EA 1QNQA 3N13A 4TV6A 5C70A 3CH9A 3K2GA 4WGXA 4MMWA 2J6XA 4QS6A 1J5TA 4J35A 1VIWA 4MG4A 4BS0A 3WNOA 3OOQA 2FZ8A 1CGTA 3DYPA 3U9IA 5B7YA 4HU4A 3AZRA 3NYDA 3RDKA 1DQUA 2EG7A 3FYYA 1KCZA 3T44A 3QV6A 2OWXA 1XC4A 5I23A 2QZRA 3LRKA 5EBAA 3E2VA 4IOTA 4NKCA 1EB3A 1W1ZA 1QASA 3OIXA 1EO7A 3RN6A 5AYYA 3LPFA 5BW6A 1ICQA 3IAPA 1DJQA 1ISXA 1M53A 2W79A 4AHOA 3WLSA 4UCGA 3CH0A 1VKFA 3UETA 1LTDA 2WSYA 2V38A 1WDDA 2ESCA 2BHZA 3MC5A 4YCPA 4WUIA 2WSKA 4UTHA 4JIEA 2E6DA 4M6VA 5BXSA 1YRRA 2DSKA 1DWJM 5DN1A 1JRBA 1OEPA 3R8HA 4XQ6A 3DXIA 2YCEA 1K9TA 1ECQA 1XD1A 2EPHA 1IR1A 4TX6A 3GFXA 1PKMA 3W25A 1XIMA 4NJIA 1NM9A 2PDKA 1O5XA 2WBKA 4D2JA 1NWSA 4H1ZA 1Q7MA 3GW3A 4D72A 4GYJA 2YR1A 1F4AA 2QCFA 1I45A 1H62A 1W5OA 2Y6ZA 3VFCA 2PDIA 3MMTA 3NZ1A 1TJ0A 5CZSA 2D22A 3FVDA 1E55A 1OJXA 4QDMA 3GC2A 4NY2A 1RJRA 3QR0A 4WJEA 5D37A 3W7KA 3AIWA 4QE5A 4G9PA 4HT3A 3KOZA 3BUVA 2OX1A 1G5AA 4Q7IA 1UMLA 4GX8A 3CUGA 1FWCC 5A6JA 1A5LC 3NYZA 1IR2A 3PN8A 4O17A 5ECVA 5CC6A 4J3XA 4PRWA 4ZQPA 2OO0A 3DENA 3H4GA 2NV2A 1KGUA 3QF0A 1TRIA 3MVIA 3LMZA 2VFHA 3WY1A 1UB3A 1OD8A 2PF0A 1RLCL 3LUTA 5E6YA 3LU2A 3V0UA 1LT7A 1E0UA 1SR9A 2DJLA 1AQ0A 1ITUA 3T6CA 4A2SA 2YL8A 2ABAA 1L9WA 4JD4A 3QY8A 1ZU8A 4AIOA 1J0KA 3D3FA 4ENLA 1E4NA 3N19B 3PZGA 3BICA 1T8XA 4O54A 4M1BA 4XTIA 2J66A 1B9ZA 2IPJA 2VL4A 2YGYA 2C1GA 4POCA 2EPOA 4DYJA 1QK2A 4H9UA 1JQVA 4LCSA 3K4AA 3GNXA 4DXXA 3TJ4A 4AEOA 2H8XA 2PDGA 2E5DA 3GO2A 3A6OA 1SZRA 1ZJHA 3EDJA 1TPVA 1R87A 2OSXA 3CAKA 5TIMA 3PZQA 3WDPP 2FZ9A 3WKZA 3OA3A 2PI6A 2Q01A 3GH4A 2D0GA 3WDIA 5C55A 1UWSA 2WJFA 3H2OA 3WJZA 1ISZA 2XFYA 3WH7A 5XIAA 1QNOA 3T40A 4GK8A 5A8QA 2QIWA 4M5PA 3RJXA 1LJYA 1XYCA 3BANA 3U7VA 3VKCA 4WEVX 4NJGA 3DKJA 4N9BA 1TUXA 1XLMA 1Y5WA 4K7VA 5LNUA 3B9EA 1LWJA 2DZUA 1XSJA 2JIWA 1EQPA 1E0VA 4JKMA 4NZ5A 1UH4A 3WFAA 4ACZA 1S5NA 4JTKA 4PFMA 2BHYA 1BQGA 1CLKA 2DGAA 2Y2WA 1A80A 1TJ2A 4I7VA 1Q6CA 3CB8A 4GX9A 2R91A 3WELA 1UD4A 4LT9A 3M0XA 4O1BA 4AD1A 1JXJA 1VH7A 1XG3A 1FCQA 3AIVA 2PTDA 1JFHA 1RQBA 2H8ZA 4H8NA 4XWUA 4AMCA 3DYMA 1EPVA 2JEQA 1XYMA 2OFJA 3TWAA 1LOQA 4US5D 4LB3A 5XINA 2PRMA 3RCMA 3WLPA 3URAA 3EAUA 1KM3A 3OLIA 5HAOA 4QITA 1JYWA 3M1ZA 4J9JA 2Z1XA 3WF1A 4GVFA 3DERA 4R5EA 4YLWA 2QV5A 2NXGA 4R7JA 3FDKA 4Z0SA 1UC5A 1Z44A 3SEPA 1JAKA 4A8IA 4S1FA 2G96A 5JU6A 3TTYA 2PRLA 1UWUA 2PFHA 1R3SA 1UG6A 5HR6A 1MDRA 5DBUA 5HUPA 2IUZA 4Q22A 3UXDA 4E38A 4PCSA 4B5TA 2CC0A 3VDGA 3QPEA 5AN7A 2CEQA 2EBNA 2Q3RA 1CX9A 4CCEA 4XSMA 5AC4A 1EKOA 4O0KA 1KFWA 1JG9A 3PVFA 3KXQA 5GQBA 4R34A 1Z6KA 4LBRA 4DWDA 5CCZA 4P7LA 2V5KA 1RHCA 4XK2A 2NSXA 3VXGA 2D0HA 5FJRA 3VD4A 1YDYA 3NZGA 4Q8QA 5IDIA 5E0FA 2VVNA 1OGGA 4I7WA 3SCWA 3DFSA 1OGSA 1D7KA 3PZVA 4KMQA 3LI0A 1KCLA 4ORMA 3A23A 1ENUA 4H9YA 4UMCA 3SCTA 1A4MA 3TYUA 2AL2A 4F0RA 4PBGA 4MZ8A 1UC4A 3W2JA 2NLIA 2CFFA 2YFOA 1Q3NA 3DIPA 5FI8A 3CPUA 3BWWA 3TMQA 4PA8A 3A4JA 4OKDA 4Q8PA 2OZ0A 5D04C 4DBUA 3BLPX 3ITVA 3H24A 1GYNA 3T0CA 2CLFA 4MOZA 1U1HA 3G22A 4ZB0A 5T9CE 2OSWA 4I5RA 3SR7A 2QMKA 3EX2A 3ZT6A 3F4NA 5HMEA 4V27A 2ICSA 3FEQA 1AMKA 4H41A 1AW1A 1FWBC 4HYVA 2FFCA 1DQXA 2YCIX 5BMWA 3TN6A 2F2HA 4GNJA 3BV7A 1FP8A 2VR5A 2PGRA 5HNNA 2V2HA 2ZXQA 3W7MA 3B40A 1UMYA 4AY8A 5BU9A 1QCWA 1H50A 2BVWA 3K46A 1GOMA 1JJKA 2RH9A 4HVXA 3WK1A 3EKZA 1EFZA 4IQDA 3PTKA 1Q2RA 3KWXA 4LX4A 3UVIA 1GUVA 2EPMX 8XIAA 1GZ1A 4I9AA 5G4HC 2DT0A 4DEFA 2P3EA 4XO6A 2V5DA 5LSMA 1MW1A 1W3LA 1O12A 4J3VA 1HIZA 4F0MA 3M9YA 3I68A 3EOEA 1W5NA 4JTQA 2CLEA 4AYSA 3F4DA 2HK1A 4QQ3A 3MWCA 2DUXA 5EMUA 1YE4A 2KZHA 4JTEA 1E72M 3A21A 3U3HA 1GYLA 3ARPA 2O0TA 2J7DA 2HS8A 1OB0A 1Q8JA 2DORA 1E6PA 1NTHA 1YBQA 5FF7A 2WZTA 4KFPA 1LG1A 1UKTA 1W5MA 3NQVA 3VIMA 1OCJA 4AD3A 1FXPA 1WV2A 3HPXA 1GPWA 1PTDA 4JN6A 2G37A 5TF0A 5MKGB 2NUWA 4MGGA 3LHZA 3N15A 3ZVHA 1P0NA 3NR0A 3LA4A 1DE5A 1QWGA 3P3BA 3O15A 1AD1A 5CXPA 4LALA 4LYKA 1K7XA 3VGFA 3CZKA 1UQZA 1VENA 1WOAA 3RITA 2YL6A 3QHMA 3VCNA 3G2GA 1IWPA 2HCVA 3KW3A 4LW7A 3TR2A 1OFDA 3MUY1 5FCZA 1JL8A 2C91A 2YLAA 4GUIA 5E0KA 3ENLA 1GYMA 4ADSA 3WQWA 4BF5A 3C8NA 2ZVIA 3LXAA 4U31A 2PAJA 1XV8A 1JDDA 4ICMA 2GJXA 1FHVA 3S1GA 1UCWA 1J18A 4PMUA 1BF6A 3BZJA 1KXVA 2FKPA 1CPUA 4L6OA 1J0ZA 4Z0JA 1JGIA 3OGSA 1RUSA 2VURA 3SB0A 1KW1A 1QXLA 3LQGA 3OW1A 3C2EA 2DIEA 4UTTC 1RSCA 3OG3A 5A95A 1XLCA 3QFEA 1DQWA 2NVAA 3NQFA 3W2UA 2V3EA 5EBUA 1NWTA 2XVNA 1DJZA 3GR8A 1W8SA 2JE8A 3KOFA 1R85A 3NL6A 7TIMA 1TV7A 3PC0A 3HJZA 4PMXA 4F79A 2WKLA 4G7EB 1UWQA 4UXDA 4CQAA 3VNZA 1PDZA 3NDYA 2OQYA 3AYSA 3IIPA 1V0KA 4JIPA 4UTLA 4KEUA 2VD9A 1H49A 1EDQA 3LNMA 1PZ1A 4HHMA 1V6VA 2NQ9A 1DJHA 4W9TA 4A22A 1BKHA 1M7JA 1TV8A 1LG2A 3B0XA 5C54A 1B57A 4J3SA 5G2HA 4RJEA 3WL1A 3WZ0E 5AFDA 2VD8A 3GTIA 1G6CA 1JYNA 3NQCA 5D8WA 3WNLA 4RV8A 2DSVA 3W7NA 4I3GA 2DZSA 1JI2A 2VI0A 4E4PA 3CLWA 3N73A 1ELSA 3UBPC 2Y4SA 1PCWA 4GGBA 1TRDA 4LWWA 2ATSA 3DHPA 1VYPX 3EMQA 4XB3A 1UWAA 5E0CA 3LCXA 1ICSA 1TQJA 1QI4A 3GS6A 4P8UA 2VRQA 1OM0A 3HA1A 2FMNA 3E0LA 2PMQA 2G3FA 4EVZA 4P2VA 1W3NA 4D6FA 1TJPA 4EXAA 1V6UA 1HO4A 5CLWA 3UZWA 3CQKA 3U6WA 1UOKA 4K2SA 5IDZA 1GHSA 2P1FA 3FJNA 4XKYB 1VFTA 4QISA 2C13A 3VDHA 2INEA 4GYFA 3UNTA 1NARA 1XWYA 5TQLA 4NRRA 3WK2A 3MI2A 2ISFA 2A2IA 4Z08A 4PB5A 3H2NA 1HTIA 4LUIA 3MCNA 3R2GA 3DKLA 1ZBWA 1G1YA 5CGMA 1MW2A 2Z26A 3HG5A 2REQB 3K4DA 1YNYA 4LYPA 1LWHA 4GXPA 2NQHA 2D3NA 2OYLA 3NZRA 1S2CA 3LI1A 4J2PA 3BLKA 1M7OA 3FX4A 4EAMA 3GR4A 3W1XA 1TSIA 3FJ6A 3WNNA 1YE6A 1CXKA 1E51A 4C6OA 1KR0A 4H83A 4B92A 3A22A 5HDRA 3CXOA 3ZJ8A 1TWZA 4BZYA 3BG5A 3CUHA 1Q6RA 3AZTA 4EACA 3PHAA 1V03A 2NLYA 2OLAA 2POTA 3II1A 1WOBA 2KAUC 3CWHA 3MA8A 4UQBA 5I24A 1OQFA 3S0CA 1XYAA 2BNJA 2Y61A 3CC1A 2BWGA 4WRHA 3CZJA 3EWUA 3T0BA 3O0FA 1JYXA 3R58A 3PZUA 1B3OA 4DBSA 3PB0A 4JCMA 4HNOA 3FA4A 2F2KA 4HMEA 4FF5A 2QJMA 1QATA 2NUYA 3TYZA 1WB0A 3QH2A 4OTKA 1GCYA 4G1KA 2FVKA 4ASTA 1Z7AA 2BGQA 3W6LA 2PTXA 2W6RA 3W73A 4AZ7A 5U4NA 3MHUA 4I90A 5AHIA 1C92A 4BF9A 1FWNA 5BU6A 1A5SA 3SCQA 3IPWA 3KP0A 3H53A 5HK4A 3T2OA 3APGA 3U5UA 1AQFA 2R1KA 4DLMA 2D2JA 3WBXA 2OKOA 2V2DA 3NOEA 1KM0A 1Y8BA 3L4TA 4ADTA 4EWND 5AZ1A 3AMCA 3HTWA 4MJ2A 3EWBX 5CAKA 4GCXA 1YDOA 3CWNA 1YKWA 4B5XA 1XXXA 1XIEA 1R9XA 3VKBA 4QAIA 3W4RA 2Z7GA 8TIMA 4JQ1A 3L0GA 2CLIA 5KZMA 1QMLA 3ITOA 2BX7A 2XDFA 3I10A 2YB1A 3B9DA 1W1PA 4AVOA 5J5DA 2RUSA 3O6DA 1LRTA 4S3AA 3TTEA 1QPNA 1NQ6A 3TJIA 4GHRA 3E5PA 3VABA 2W67A 2ZA2A 4ZTYA 3MBDA 3E74A 3TA6A 4MZYA 1QVBA 3RRXA 1HUVA 1KQZA 1MNZA 1NU5A 3TDFA 5E1QA 1JULA 2PF8A 4DJFA 2Q3OA 4GUHA 1X7IA 3UJRA 3W7EA 4P8VA 3CK5A 1ZJIA 1QR7A 2V8ZA 3C8FA 2DW6A 2WHMA 3RM9A 4O18A 2BY2A 2GJRA 3TZFA 2ISVA 3GYCA 1H2JA 1W54A 2P50A 3I7QA 3PUDA 3EB3A 3RILA 2QF7A 3QV8A 3ZM8A 3VNIA 1SJAA 1GVIA 3AC0A 4HHHA 2HK0A 1WUFA 4UR7A 4F0KA 2V82A 3HU7A 3OP2A 2J74A 2QAFA 1BXNA 1TKKA 1V7AA 1XIHA 4R9OA 4CVWA 3R79A 5F4SA 2WMIA 2J24A 4PMQA 4Q4PA 3T08A 4M82A 2NQZA 2F84A 2XINA 1YTKA 2QULA 3LQLA 4L9XA 2XJ7A 4KS0A 4QCEA 3WH5A 4X2RA 3SCNA 4B2DD 2ATMA 3NUKA 1XLIA 4WX2A 3VOIA 3HURA 3U0HA 3L4XA 5K3VA 2Y24A 4AC7C 3RYSA 4KWOA 3C0QA 5A6SA 2R94A 1T8QA 2VEPA 1QOQA 4GQQA 4UTKA 2PP0A 3BW2A 2BZNA 4H7ZA 4S3CA 3B0VC 5FEXA 2ALDA 1GVOA 3E3HA 3N9KA 4R85A 4C65A 1A53A 4FXJA 3LERA 1I2OA 3DI1A 5E6ZA 4PE8A 2OELA 2XVPA 2NW0A 2BOFX 5DMLA 3M16A 5HJXA 2EJ1A 1QBBA 3OZYA 4LFYA 3GG1A 3QMRA 4G8TA 1Q63A 2EQDA 4IX2A 1JFXA 1HFBA 1BVZA 1W32A 3ZJKA 2XPKA 5D9OA 4ZTXA 2Y8VA 1CBGA 1YW1A 1PDYA 1KB3A 3AALA 1GOQA 2BFGA 3QBUA 2BVTA 3S46A 3P8JA 1IWAA 2QXWA 1M65A 1TTJA 4OHQA 3LXBA 5F1VA 1J6OA 2XVLA 2J77A 1EX1A 1KA9F 1S3TC 2ZX8A 4F4RA 1EF2A 2PB1A 4WGHA 4L4PA 4GVGA 2F8QA 4R33A 1RCXB 4HOWA 4BF7A 3CUXA 1L6YA 3OBEA 5ABTA 3HFTA 3NTYA 3GQYA 3DFYA 3G1YA 2P3ZA 1EA9C 4LY4A 5HJYA 1TVPA 1YPFA 4H6KA 4JFUA 1ZCOA 3RNDA 2PSNA 2UY5A 1I75A 3CMJA 3K8LA 4HOZA 1E40A 1V79A 4P5UA 3W24A 3TK7A 2WC7A 4BI7A 2R6OA 1QHZA 1JPMA 2IPFA 1YLVA 3LN3A 1EF3A 2EEXA 4NI8A 3MB9A 1TZ7A 3IK4A 1N7KA 2C1IA 4WCJA 1WPCA 1GQNA 4M80A 4E2BA 3GC4A 1NH6A 3GNPA 3N14A 1GTEA 4HU0A 2B7OA 4LXFA 3BAJA 4J5NA 5FJOA 4DBEA 3BXWA 1LQ0A 1UZ1A 3AUJA 4GGHA 4NG3A 3MCMA 1OG6A 1HZYA 5TNVA 4EXBA 2W61A 3WFZA 4PR4A 1KNWA 2J88A 3E2SA 1V77A 1JR1A 1M6JA 2V30A 2C3ZA 2E3ZA 2OG9A 3P5YA 5CEWA 3S2NA 4LEFA 4QAWA 1Q13A 2XGIA 3HPFA 1V6XA 3AMLA 1W2VA 2V63A 3HZ3A 4QG8A 4WSJA 3XIMA 2V3FA 4AVFA 3EX3A 4EIVA 4DYKA 5CZTA 3PTQA 3VE9A 2BXZA 5GJNA 4X3ZA 1L2UA 1XGDA 3ARUA 1KLZA 4Q6XA 2CITA 2E5CA 1GOKA 1Q65A 2AKZA 3NM1A 1D9EA 4F0SA 3QV9A 3W7LA 1QBAA 2CLHA 4PBFA 3M5ZA 3SECA 4AXNA 1TMQA 5HWJA 4QXIA 2WMJA 3G0UA 2ZVRA 6REQA 4J3WA 1BYBA 1KV5A 4UIOA 1W3HA 1L2QA 5FF0A 3QSRA 2EKGA 3DBPA 1AQMA 4H8VA 8XIMA 4NJHA 4JTDA 4ACYA 1K4HA 3WD4A 1I4NA 3KOWA 1R47A 3N9RA 4ZGYA 2WWCA 3STFA 1E1CA 4S3GA 3Q45A 2A21A 4K38A 3I6EA 4C6QA 1UP0A 4H6RA 3T8QA 1K77A 4PGLA 3KCJA 3SN1A 2YXGA 3STEA 4MUZA 2FLIA 2P8BA 1YIXA 1KFLA 3BMVA 2WNZA 1ISYA 4DJEC 2X42A 1IF2A 4ATWA 1EDTA 2WV8A 2X30A 4GIYA 1E0TA 3IIZA 4GH3A 3RF9A 1X1ZA 1AJZA 3QGKC 2PGFA 1DEDA 4JTHA 4D6EA 2WPBA 1VS1A 3PSWA 2YSWA 3NO3A 1FFRA 1UP3A 1TR9A 2ISWA 3MMUA 1VCVA 2CHOA 2P8CA 4QGCA 4A3RA 1DBTA 3VINA 1KD0A 3L0KA 3E0VA 3OYXA 3UF9A 1KBIA 3S1WA 4M7TA 2E9LA 3ISIX 1F05A 1JVNA 3BQ5A 2XZ7A 1K8YA 3UFYA 2E25A 5FJPA 4S3JA 1M9HA 1EWEA 1O6IA 2OR2A 3NFUA 1X6LA 3V3WA 5DT7A 3LHTA 4PMZA 4A21A 1X38A 5CJNA 3AXKA 2ZKMX 1UKQA 5FSEC 3WQDA 2CW6A 5C9RA 1TX0A 2C15A 1VPQA 3S1UA 4HKPA 5EU9A 1RQEA 3R25A 2QYGA 4LS1A 3I7SA 4HNCA 1X97A 4E2VA 4TTUA 4AIEA 4RNJA 5BZAA 2ZX9A 3GWQA 2R14A 3WQ6A 3A9BA 3SN4A 3FAWA 3EWXA 5D09A 1A5MC 4MLRA 2HQAA 1BQCA 3A9IA 1R9YA 3LGDA 3AU6A 1K7FA 1OYCA 3R6IA 2E67A 2OGYA 4OJYA 4P61A 1MI3A 3MKCA 1IIGA 1DWIM 3PPGA 3V5FA 4XAGA 4U5KA 4LUSA 2G41A 4HP5A 2NX9A 1QNSA 5FL0A 4B90A 1HKJA 1EZWA 4O8RA 1NSJA 1OHLA 2XIIA 3TW7A 5AB3A 5K2ZA 3E02A 3DBNA 2FHFA 1TCDA 4OBRA 4WOQA 1OFPA 1W0MA 2BHUA 1YXDA 3WUBA 3STCA 4KERA 3FA3A 3JS3A 1H5YA 4A29A 3UQNA 3W6YA 1L6FA 1CI1A 4P7OA 4B5SA 2E6YA 4KT2A 5IXEA 1H0GA 1S2UA 3IAQA 2XH2A 2E7FA 4K6AA 1EXPA 1TB3A 1GZJA 1R8LA 1UKPA 2A6NA 1SJCA 3R0DA 4L4LA 4O1AA 4C90A 4MIMA 1RQHA 3HN3A 4TVCA 2YW3A 1XPGA 3W7DA 5LXEA 1M7PA 1BG9A 3BK0A 1TV2A 3TMLA 2DQWA 1WKYA 3BGJA 4CNOA 1XSIA 3FYPA 4YNGA 5SWUA 2HE8A 2V5LA 4EXQA 3PF3A 4W4QA 3S9ZA 3BLEA 4OOZA 1HP4A 1UASA 4TR9A 3CV7A 1B9BA 1JCTA 2PD9A 3P6LA 3O6CA 3C52A 4QNWA 2PDCA 1VPXA 1T5AA 2Q02A 3LOTA 4TVDA 1W91A 2ZRWA 4J2MA 4WKFA 3JVAA 4MPKA 1P1MA 1TPUA 3DECA 1O94A 3QW4B 4UFMA 3S2CA 5BOFA 3C3NA 1C9WA 2X40A 3NDOA 3FXGA 1K4GA 3PK7A 4J28A 4IFOA 3PUOA 3FIGA 4GKTA 3M5XA 3TN3A 3N4EA 1VFHA 4W8BA 1H1YA 1SO6A 3H2CA 4ECLA 3IJ6A 4WDUA 3W1QA 3TU9A 3PJXA 3IVUA 3RR4A 1V0LA 3PUGA 4PUKA 4HNLA 4XD5A 1VEPA 1YNQA 3FS2A 4PCTA 4HSNA 3H7UA 3DFPA 4IFRA 5U7SA 1KGXA 4DELA 4NZCA 5FKYA 2H9AA 4H04A 4PMDA 2VCAA 4JICA 4H9TA 1C91A 2WKGA 1IE7C 1KWKA 1EHAA 3RIKA 3W1MA 2ZX5A 1EP2A 2TODA 1A3XA 4XBSA 4P7QA 3WYZA 3O6AA 3MV01 4MVAA 1Q66A 4DO7A 4ZODA 4I8DA 3EWWA 1I2RA 4K39A 3INPA 3G18A 1WXYA 3SUSA 1KO0A 3P67A 4RK8A 3P84A 3GFYA 6REQB 1X8CA 2I7GA 1JUBA 1I1XA 4IP7A 4D9PA 2QCNA 1ONEA 1EJ7L 3CV2A 3W72A 4AX6A 1RJPA 2YCLB 4D8ZA 4X61A 4RV3A 2DSZA 2OU4A 2O56A 4H6QA 1XHGA 2XISA 3PNZA 4BFAA 2Z6IA 1EPXA 3RU6A 3CIXA 4FHAA 3CHFA 4YWSA 1CYGA 2Z1BA 3CO4A 1E1CB 2X09A 5AHEA 3SW6A 3NAVA 5AC8A 1XIGA 2DZWA 1I9CB 4GQGA 4HHPA 1JI1A 5D2VA 2OX4A 2WCSA 4ZQCA 2GUUA 1XFBA 1OT2A 1DVJA 4QR6A 1WUEA 2XM2A 3CAVA 1T7LA 2WSPA 2YX0A 3IJDA 4UTIA 1G9HA 3OLEA 4F40A 1QUMA 1EQCA 2X0YA 3TE9A 2VYOA 1ONRA 1FDZA 3L4WA 1FVPA 1RBAA 5CSSA 3TSDA 1OX5A 4O1CA 4S38A 4O15A 3MP3A 1MWOA 3S6DA 3GXNA 4GKLA 3QYSA 2FFIA 1Q8AA 3AO0A 5FEZA 1V0MA 4OUEA 3ARXA 1OYAA 3R13A 4DJDC 3LSBA 1J12A 4ZE4A 4FPSA 3RJYA 1M01A 3TN4A 5KSWA 3MBFA 4AAJA 4I5XA 1DWGM 3MUXA 4N0RA 5REQA 1OG0A 1TV4A 3AMGA 2CWNA 4A8LA 1C90A 1WXZA 3N1AA 4GNKB 4ORIA 4EOUA 3QC3A 4KCTA 1JAEA 1TG7A 1S38A 4UOQA 3W7JA 4PUMA 5JIWA 3WF3A 4DJED 3GY1A 2W62A 4JYFA 3EA3A 3NPUA 4GFSA 4DO5A 1VC4A 3MQTA 4LBSA 4MYAA 4GY1A 1KFKA 1KR1A 2HISA 3UG8A 2Z00A 4MKVA 2C6QA 2CZDA 3L21A 4XO7A 5FJJA 1QNRA 2CNCA 1VJZA 4W7VA 4JIQA 4LV4A 3ARSA 3E6EA 1JZ7A 1K9FA 4ATDA 2GZXA 1L8PA 2PGEA 5K4ZA 2A4AA 3UPWA 3G1RA 4B5VA 2GVEA 4INFA 1G7VA 3B8WA 4R9XA 3NXLA 4L56A 2QPXA 1X6NA 3VOCA 3SJNA 2WZHA 4XIAA 3WMCA 4M81A 5FF4A 3SSZA 5JBFA 4BWLA 1EOKA 2YA0A 4C6JA 4GZJA 5LHEA 3AHXA 5D02A 3M46A 4LCRA 2A3LA 1R3YA 2L5HA 3TCSA 3CQHA 2FIQA 1NF0A 3FHAA 3IUIA 3CZLA 2YLLA 5A5WA 3EOUA 1R2SA 4YS1A 3UCDA 1F61A 4N2YA 1LLOA 4WVXA 8CGTA 4LVDA 4ZB5A 1NFGA 1DXEA 1E6NA 2J25A 1P0BA 4LS2A 1ZUAX 5K9CA 1LZOA 1NWUA 3PPCA 3AOFA 2OYKA 3LBCA 3K1DA 3LGEA 4XUYA 3KBNA 2BGSA 1MRAA 3L9CA 4PFHA 2VFIA 1CW2A 1SW3A 3ANVA 3FNDA 3IJ7A 3F5JA 4DI8A 3GDKA 3FY1A 3MI6A 3KHDA 4JHMA 3SRDA 3WENA 4NF7A 5F4XA 2PWEA 3VCRA 1OC6A 4DWSA 6TAAA 3B9AA 1ME8A 4R7OA 1W1IE 4H9VA 3PZNA 1DORA 3A4XA 4JFSA 5F2LA 3NQ8A 4RX0A 5C7VA 3W00A 3WJXA 4DZAA 1XS2A 3MV11 1ADDA 4X63A 2WNWA 1DWFM 2VGGA 2O55A 1I2NA 1RP9A 2JALA 5A8GA 4Q8MA 1HX0A 1CGUA 3LDVA 4IQJA 3ZOAA 3WMBA 2G3JA 3TEVA 5FESA 2QCDB 2BVYA 1TPFA 1S3HA 3WLKX 1NDZA 4LVBA 2H9AB 1S2AA 4S2CA 3VOHA 2VKZG 3UZYA 1ITXA 4PZVA 3KRBA 1DWHM 1GVQA 1M7XA 1MQPA 4LRTA 3T09A 4O13A 4UTMA 5D30A 1IIHA 2VVSA 4IMFA 3VUPA 3BOFA 3VX0A 4HZ8A 3MO4A 2XN1A 4AUBA 3UW6A 4JTAA 2HNEA 2XZ9A 1QHPA 3WK0A 5BRPA 2CU0A 1KQYA 2PDYA 3THDA 1EO5A 3L68A 3AWOA 5FACA 1MFUA 4M19A 2YW4A 5K9XA 4PTVA 1QNPA 3EB4A 1HKKA 1SO4A 9XIAA 1HGWA 1QFEA 4ALDA 3TLLA 2O92A 4B4HA 1XCFA 3GU1A 3T4CA 2AAAA 1SW0A 3D3AA 2WQPA 3VM7A 4UQCA 1G0CA 1GVEA 3QOKA 4P7NA 3OZMA 1ZAHA 3ZJ7A 3PWAA 5RUBA 4YXGA 1KM6A 4ZSUA 1XLKA 4WDWA 3LCWA 2WZMA 3QGVA 4OBTA 2E5BA 3N6HA 2R8WA 2BBFA 1V0NA 5LYRA 4CD6A 3H26A 3TKFA 1JZ5A 3HO8A 2DJXA 3N2OA 2XU2A 1ALDA 4OVXA 2F61A 1UD5A 1NVMA 1EIBA 1V3IA 1H1NA 3T0DA 4U3CA 1X1OA 2W4XA 3W0KA 3WLIA 1V3MA 2E0PA 4J3ZA 4EAYA 4TX9A 4WJ8A 2VC6A 2WVUA 3SM0A 5HBFA 1DPMA 3DYOA 4MJMA 1CTNA 2ZTJA 2BS9A 2PTYA 3AU2A 1ODUA 4MFDA 3OU8A 1V6TA 1MRQA 2VEMA 3ZSSA 1WNOA 1XRVA 1SZEA 9CGTA 3MYPA 3SCRA 4HK6A 3LG3A 4XUGA 3NSNA 3OHMB 3VDCA 5JBDA 5CPOA 2QEZA 1B31A 1Q7ZA 1AJ2A 1ZHAA 4AD2A 1EZ2A 2HVOA 4JQ4A 4YYFA 1E5NA 3NCOA 4ZO7A 1R3TA 3JZUA 2C71A 2QCLA 1O4UA 1GJUA 5DQPA 1J5SA 1FHLA 3EDFA 5DCDA 8RUCA 4KRZA 3F2DA 3OVQA 1M04A 4UBPC 2A3CA 3BL3A 4L64A 3TW9A 1BVNP 3PZTA 1TPDA 3MVTA 3W75A 4NHVA 4KESA 2V5JA 4UTWA 5F1UA 4GPNA 5BRQA 3KUMA 3FYOA 3GKAA 1HKMA 2EO7A 2G0WA 5AYIA 2ZE0A 1P7TA 2XH7A 2V69A 1LCOA 1G7UA 3TWBA 1LBLA 3PZOA 1N55A 1YNPA 4CQCA 4Q8OA 2Z2UA 3VD3A 4B5UA 3S5NA 1XLEA 4PBEA 2I57A 1HJXA 1S5MA 1WBJA 3RM4A 3EXTA 3WQVA 2V5BA 1ZFJA 5D05A 4JIHA 5AC7A 5CBIA 3ZQ9A 3CMGA 1T0OA 3EZ4A 4DJDD 3DFTA 1JDFA 3AJ7A 5ABFA 1S39A 3USBA 4H19A 4K7YA 2V67A 1DV7A 4IXHA 5M5DA 1PZ3A 1VQTA 1QNVA 3IEBA 3BLLA 1UIOA 2BY3A 4A2RA 3TUUA 4FS9A 4UTFA 1SSGA 1ZNNA 3G0SA 3GHUA 4BJHA 4RDZA 1HXJA 2WMKA 3OQEA 4G2DA 3W83A 1B4KA 2BODX 5EMLA 1MNSA 3GKFA 5DANA 1XBYA 3ZLGA 2QV4A 3GTFA 1R9ZA 4NSBA 3B4YA 3AHYA 2XUCA 1A5BA 4RNFA 3RPDA 2YA1A 4JQ2A 1QPRA 4BK9A 2YDSA 4PB4A 4AMAA 1I60A 3S1VA 3Q65A 4AZHA 5I03A 3WEZA 4WK9A 5GNYA 3QV7A 1XR2A 2GJLA 1C8QA 3LX9A 3UY7A 4Y9MA 1DHPA 3S83A 4IIFA 2IPGA 1V3KA 3ABRA 1DTUA 1K6WA 2J9ZA 4GFIA 3WMSA 1OC5A 4O4VA 1HW6A 4PCPA 1XRTA 3KEHA 2J7GA 4AZCA 5IRPA 4IMAA 3VKKA 3D46A 1J93A 3U8GA 3N2CA 3LZ5A 1TJ1A 5BXTA 2DH2A 2NSOA 3CUJA 4C6LA 2GGIA 3MCOA 5CPTA 3L4YA 1BWVA 2NQ5A 4CU8A 3QPYA 1PYMA 3MUCA 5L9FA 4LUJA 2WANA 2C0HA 4KKXA 4LBUA 1P4CA 3WLQA 4QSFA 2ZUVA 2J78A 2DFAA 5D33A 2EAWA 4IJRA 1BKSA 1GOWA 1LOSA 3VIIA 4QHRA 3MTWA 2ZZ3A 4S23A 2GVGA 1NOFA 3OLDA 2ISDA 1UJPA 2X2YA 3GDLA 3QMTA 4UR9A 3SJ3A 4J7RA 3WQEA 4AVNA 4PTXA 4ICCX 4IMEA 5BNKA 4OQVA 5H91A 1V08A 2NVCA 5G1MA 3W29A 7CGTA 4CEXC 2FZNA 5AHFA 2OZ8A 2GVLA 3IGUA 4Q8UA 3C0JA 3XINA 2Y85A 3U5YA 3NSXA 3VIOA 4GQRA 2CKRA 1TPB1 1JIBA 1OFBA 1HJQA 4ZO8A 6CGTA 3N04A 1F6KA 3FJLA 2Y63A 3VGBA 2Y88A 4GBDA 1FUYA 1AH3A 3VGDA 3SRFA 3VNDA 2OZTA 1DJXA 3AZSA 2NV1A 1L8NA 3PBVA 1W9BM 1AJ0A 1NFPA 3SCSA 1F2JA 3HMJG 1FWFC 2OPJA 4MNLA 4DNMA 3G8EA 2B31A 4JOMA 2ACQA 2W66A 2ON3A 4F48A 3WH8A 2BY1A 3LM7A 1TVNA 4QNEA 1EHNA 3MDUA 1MXDA 4WY0F 3BG9A 5LIYX 2EPNA 4L4MA 2J79A 1F4HA 4O0ZA 4CKQA 9RUBA 2AGTA 2ZIDA 3WFLA 4CQ8A 4CCZA 3V36A 1GVRA 2Z1SA 3P5ZA 1WX0A 2CZVA 4CNSA 1WKFA 3M0VA 2WC4A 1U5VA 2IPWA 1JUKA 1PV8A 3LRLA 3HV8A 4Z2GA 4LF1A 5ECUA 2J62A 1UIPA 4GZEA 1T99A 3SCVA 4OBSA 4NZJA 3RX4A 2TMDA 1SUXA 5LNVA 1H63A 3GIQA 1RXOB 3NVDA 2ZUUA 1HVXA 2DP3A 3RHGA 5A6MA 4U33A 2ZUWA 4ATLA 4FLOA 4MB3A 5FOOA 4HU3A 5AOUA 3IJ9A 3T07A 3WG6A 2QCGA 2YPIA 1JF5A 4HHLA 3CASA 3MWAA 1UPPA 3BZGA 3DU0A 4WZHA 4FALA 2A79A 1ADOA 2BSLA 2GK1A 3QTPA 3M0IA 1FWWA 2ZXAA 1H09A 4MNMA 3NQEA 3ITLA 2XSAA 4J40A 2OODA 2CERA 3VNJA 2Y7DA 4Y8EA 5DX7A 3W7PA 1E6SM 4A3QA 1FCVA 1CGWA 4AF0A 3Q67A 3RMJA 4MYXA 5KZ6A 4DAIA 4V28A 3K1GA 3EXRA 1N8WA 2NUXA 3MI3A 4NILA 5JUVA 3C86A 4HK5A 1V6YA 2ZX6A 3GAKA 1TPEA 4RW3A 1KFBA 3IARA 4NNBA 1I0DA 3MJMA 1PL9A 1MDLA 3L5LA 4PODA 3TJLA 1LBFA 1XIFA 4H6EA 4JIIX 5DF0A 4Z2KA 3UD6A 1TREA 3UWVA 1EJRC 1K8ZA 2QDGA 2OEMA 3KBVA 1F74A 1M03A 1LQAA 2E77A 3RX2A 4O4WA 3CBWA 3FCPA 2A0NA 3GC5A 4HMNA 1X96A 4QG6A 3GZAA 1KGWA 3KL3A 1MW0A 2Y89A 2ACSA 1BG4A 1RK5A 1SFJA 1XIIA 1YDVA 2J7EA 4E3TA 1XLLA 1RA0A 4B2DA 2F6KA 3ITYA 2CCRA 2HMCA 3HPSA 2FZMA 2UV8G 1V7YA 3WDHA 3QQ0A 4C6DA 2YYTA 2P5NA 4AZ5A 2QNEA 1XLAA 1R0MA 2GGJA 1E6ZA 4DX3A 4JEQA 4DHGA 3MMDA 3CZGA 3AFBA 1OFEA 3WLTA 3DG6A 2OQLA 5A6TC 3UWWA 3UG4A 3C2OA 4HTYA 4RXGA 4UQAA 1IEQA 2CBIA 4KH2A 1K9EA 3WQCA 3O7UA 3CJPA 2VUNA 3TX9A 4UTTA 3K8MA 2W27A 4NAFA 4Q3MA 1OFAA 3VGGA 2I5IA 1F3XA 2I5GA 1ME9A 1GQKA 4D1IA 4KEZA 3QC0A 4IL0A 3A5FA 3GUWA 1G01A 1W37A 3VOFA 4OFCA 4IP4A 4ZFMA 2XSBA 2QDDA 3UP8A 1OBAA 3TTSA 5A8PA 1MXGA 2J4GA 1XLGA 1KFJA 2G8ZA 3AIEA 4C6BA 2NZLA 1FH7A 2WZEA 2EKCA 1XL9A 4Q8NA 4ZENA 2VHLA 1IWBA 2ODOA 3AISA 3I6RA 2ZUMA 2YYUA 1XQLA 1QI2A 2QIIA 1KKOA 3ABOA 4N9EA 3ECQA 3ID7A 3AYTA 3JR2A 1UD6A 2AQWA 3N2XA 3C4UA 4LB4A 2DH3A 4KBXA 4K3ZA 4NQ1A 3AIQA 2PBOA 4MWAA 1Q6QA 3IIXA 3A12A 3BJTA 1GT8A 4Z17A 3AYVA 2VC9A 1AVAA 1OY0A 3CPRA 2DZBA 4D71A 2RJGA 3N18A 3ZZ1A 1PE1A 4GH1A 2GJPA 4DJFC 1HG3A 3XISA 4TXEA 4AEEA 4RNHA 3TC7A 2DZPA 5JH1A 4HOXA 1D8CA 3O6YX 1EJWC 4O0QA 4Y9AA 1IGSA 5FJUA 1J2WA 1JCJA 3CYVA 3W1NA 2I1OA 3LCLA 2QQ6A 4JNYA 2NX1A 3UU0A 3MP4A 1U1UA 3KZSA 3M0HA 2VQUA 1XQKA 2Y5SA 3TTQA 1CXIA 5C9ZA 3UZ5A 4ERAA 3CWOX 4HGXA 1K8CA 4TMCA 3S6TA 1VFMA 4XAYA 1RCOB 3W81A 3URNA 4FIRA 2WLYA 3A13A 4KWUA 3GX9A 1BGGA 4V33A 2YB4A 3FHQA 2Z25A 3KBSA 3CZEA 4AD0A 2P53A 4K8HA 2ZRVA 4QTGA 1W8GA 3SZ8A 2GWGA 1QW8A 4GIEA 3GXIA 3GVVA 1PIIA 3NDZA 4HN8A 1CECA 3L0NA 1UR4A 4GNVA 3M7WA 1W3KA 3AIUA 1A5NC 4U5IA 3L4VA 4PMRA 4AC1X 3GYEA 1XH1A 4M1RA 4O52A 3VAVA 4L6DA 1A3HA 1SU5A 3M5VA 2VEGA 4EE9A 1CXFA 2ZRZA 3TTOA 3SBFA 2O4MA 4MHBA 4CN6A 2NQJA 3NL2A 2J9XA 2PODA 3CYJA 2WVSA 4IIHA 4J1OA 4NU7A 4EKJA 1U22A 2VRKA 5ABGA 5HNRA 3QR3A 3GDBA 4WXYA 1PTAA 2ZICA 4L9YA 3GDMA 4L5ZA 3EGJA 5LKYA 4YVPA 3FK4A 3Q58A 3RM8A 1XGZA 5C8BB 3R10A 3GR7A 2UY3A 1YXYA 3W87A 1TR1A 1LROA 3VO0A 3LV5A 3VM5A 3L12A 1XKYA 4LUYA 4ADUA 1F6YA 1WDQA 4YU1A 3V5CA 3B4UA 2GK1B 3UR5A 3LLXA 3MU7A 1CGYA 1RPXA 3PG8A 3VNLA 5CSRA 3CLMA 3L2IA 5A69A 1QW9A 5G4WA 4DXKA 1TV5A 4NRSA 2G5WA 3AXHA 1OX4A 5A1AA 4X60A 4HU8A 2P10A 4KFNA 1RVKA 2NQLA 2PTZA 4FZIA 3EMZA 4LUTB 3CUFA 4FLQA 4QIUA 3FN9A 2ZRYA 1IEIA 4FXFA 3MYOA 5A6BA 5LZLA 2WAGA 3VDBA 2QCEA 1JZ4A 1FHDA 1UD2A 3PS7A 5C9UA 4S3EA 3QR1A 3WJWA 5ABHA 4AU0A 4FLSA 5D2WA 4UQDA 2H6RA 4EF8A 1HVQA 3W02A 2EXOA 2ZRUA 1PHWA 1B3WA 4WLCA 3ARQA 1JCYA 3WJSA 4A8RA 2C8NA 1Y5XA 1UKSA 1FFQA 3PJUA 1GKRA 3VGHA 4N9CA 4Y9NA 4BQ2A 1NWRA 3BTNA 1AA1B 2E09A 3TYAA 1GPFA 2QCHA 2EPKX 1BLIA 2Y8UA 2HBXA 3HG2A 4UNIA 4YVVA 3SIZA 2CETA 3VMPA 3MANA 5CJ5A 2NWSA 3CHCA 1D3CA 4A3UA 1FY6A 1N8FA 2ONEA 1JDAA 3IJIA 3SDOA 5A3HA 5LNRA 4Q8TA 2A5HA 4A05A 1NOWA 1W6TA 2FGLA 1F8IA 3DFOA 1TPH1 4MM1A 2Z29A 3F4WA 1FKWA 1H3GA 1OZQA 3HMCA 1C8VA 4QFUA 1XIJA 4GRSA 3B97A 1BVWA 3NG3A 4ZOBA 5EKYA 3EPMA 3NNTA 3W7HA 3EBVA 1Q6DA 4US6A 3NQAA 1H7OA 3NXFA 5LA1A 3WQOA 4QEHA 1PTGA 4PSPA 2EHHA 4C7GA 3VI2A 1HKIA 2FTYA 3E38A 2O9RA 3IANA 3GG0A 3W38A 4F0LA 2WHLA 4ZXOA 5CG7A 5H2ZA 1D7FA 1EJUC 2WVTA