2QUNA

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii in complex with d-fructose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
290
structure length
290
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 112
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2qunA00
1D8WA 4XKMA 4QE5A 1XYLA 3KCOA 3BZJA 2XINA 3M0MA 4W4QA 4ZB2A 4ZBCA 5B7ZA 5XIAA 3XISA 1A0CA 5I7GA 3CQHA 2QUMA 4A8LA 4K1GA 2I57A 3KCLA 1YX1A 1QTWA 4US6A 1S5NA 5EMLA 3LMZA 4QE1A 3OBEA 6XIMA 3BDKA 4HHMA 3UA4A 4EACA 2X7WA 5FA5A 3P6LA 3KTCA 1S5MA 3ITTA 4QDWA 3JU2A 3XIMA 3ITOA 3CNYA 3QXBA 2GUBA 3ITLA 1XIEA 5J8LA 4XSMA 1XIJA 5XINA 2NQJA 2ZVRA 3AALA 3DBNA 4HGXA 4X60A 2QUNA 1CLKA 1XYAA 3VNMA 4ZB0A 1O1HA 2Q02A 3ITYA 4YTTA 1XIDA 1XLIA 5AVNA 1QT1A 4X61A 1XLHA 5C9ZA 2NQHA 2GVEA 2HK1A 2OU4A 3IUHA 3ITXA 4GQBA 1K77A 3VNLA 3UXIA 2QW5A 3BZGA 1QUMA 3TVAA 1XIFA 1XLAA 2XISA 1TZ9A 4XIAA 1XIMA 3DX5A 2G4JA 1DE6A 1XLGA 5XIMA 3KBVA 4LNCA 3VNIA 1XLLA 4PGLA 4XISA 4A8IA 1XLJA 3XINA 1XLMA 5TNVA 3TC3A 9XIMA 1XLKA 1XIBA 4QEHA 3CQKA 3KBNA 3QZAA 7XIMA 4Q7IA 3KBMA 3L23A 4GJIA 2XIMA 1XISA 3U3HA 4HHLA 4YTQA 1XIGA 3AYTA 4A8RA 3WQOA 5H1WA 4E3VA 3CQJA 3KBWA 1MUWA 4OVXA 1A0DA 4XSLA 3IUIA 1XLFA 4QEEA 3CQIA 4G56A 2HCVA 5H6HA 3UVAA 4HNOA 1OADA 3KCJA 3VNKA 9XIAA 2I56A 5EMJA 3GNXA 3CWHA 1DE5A 4GJJA 2X7VA 4QDPA 1XLDA 2J6VA 3UU0A 3U0HA 1XLBA 1XYBA 1XLEA 2ZDSA 3FVMA 3VYLA 3C0LA 1XICA 2QULA 4J4KA 3KBSA 5EMKA 5AVHA 5B80A 1DIEA 6XIAA 4YTUA 3QC0A 1DIDA 4EAYA 1DXIA 1XIHA 4KW2A 4QE4A 2NQ9A 2HK0A 1XINA 1BXBA 3C0SA 3QYSA 3KBJA 4PFHA 4A8NA 2G0WA 3N4AA 4X63A 3KWSA 1BXCA 5EMMA 1XYCA 1GW9A 1MNZA 1XP3A 3IUDA 3P14A 1I6NA 3AAMA 3M0HA 3ITVA 3M0YA 3M0XA 4DVOA 1XLCA 5B7YA 3UA3A 2GLKA 8XIAA 1I60A 3AYVA 4YTRA 4K3ZA 4GLEA 3VNJA 1XYMA 3M0VA 4XIMA 1A0EA 4ZB5A 4DUOA 4YTSA 3M0LA 3C0QA 3NGFA 2GYIA 3BANA 8XIMA 1XIIA 3BWWA
chains in the Genus database with same CATH superfamily
4OGZA 3DG7A 1XL9A 3BZJA 2DW6A 1EGMA 4QIUA 1XF0A 2X0HA 2VX6A 4HCLA 1EUNA 1CGYA 3TN6A 5HWMA 5PTDA 4O1DA 3MMTA 3A5FA 4DI8A 2GPTA 2TODA 2A3AA 4I5XA 3PVFA 5I24A 1S5MA 3JS3A 3VOJA 2EPNA 3KZPA 1ZJAA 3VPLA 1F9CA 4GIAA 3AI0A 1KA9F 4CNSA 5FEXA 3HPZA 3L67A 4NZ4A 2HK1A 3MI3A 1V0NA 1UMYA 1OX6A 3TVAA 1P43A 2VVNA 3AZTA 4HK6A 5C0QA 3SQLA 1PDZA 1LG2A 2CLPA 5A6JA 1GZJA 1FWSA 1V6VA 5JBDA 3GS6A 3GFYA 2J75A 2FDMA 1SZNA 3AMCA 2GUYA 4QGCA 3RJYA 2ASHA 5A6LA 4KS0A 3OW1A 2ISWA 3KDOA 4BEUA 4G56A 3QR0A 4WR3A 3MKCA 2XWEA 3WL0A 1ZNNA 1IXPA 1LWIA 3F2DA 2CITA 2V0TA 4GIEA 2QKFA 4DJDC 2ZUWA 3FNDA 1EKOA 2P50A 1DJQA 2YBUA 4GO9A 4I5RA 3QZEA 2REQB 4HU8A 4I7VA 4H9ZA 3M0VA 3NVDA 4LF2A 4HPGA 3KL5A 4PEKA 3KS6A 3RPTA 4OUIA 2OWWA 1PKMA 3W7OA 1TPB1 3RYSA 2QPSA 2X0SA 3M5XA 4I3GA 1NF0A 3S9YA 3WJWA 1V3LA 2I57A 4US6A 1BPLB 3MYPA 1E4NA 1PX4A 3V7PA 1ISYA 2JKEA 3U7BA 1NU5A 1ODUA 1AL8A 3L4VA 5HNNA 4LVDA 1G67A 3R0DA 4D6FA 3CWOX 3QN3A 2WVSA 4JHMA 2ACQA 1Q3NA 3GIPA 1YRRA 4JNZA 3NDYA 1E43A 3SURA 1IR2A 3UXKA 3MI6A 1U5HA 5DN1A 4JQ4A 4UTJA 4CVUA 1H60A 1Q4NX 1S2WA 1JCMP 2QV5A 2FHFA 4AMCA 1H11A 3COTA 4JFSA 1S2AA 3BK0A 3SCPA 3BSHA 1DBTA 2YL5A 4V1XA 3BG9A 4QQ3A 2YA2A 1J2BA 2J7DA 2O56A 3LCHA 3TR9A 1UKOA 2GVLA 5I3GA 1ZCOA 3W85A 3Q45A 3WLSA 5CLTA 1QK2A 1QHOA 1R3SA 4FOJA 5CJNA 4HMCA 2DZWA 1EYEA 3GUWA 2ODOA 1LP6A 1QO2A 3PZGA 1KO0A 3MHFA 1JZ8A 5FEPA 3AAMA 1OFDA 4ERGA 2QS8A 1Q8JA 2GLKA 4OOUA 1KGXA 1ISWA 2XDFA 2X1UA 5CZTA 3CTLA 1F3WA 1TVPA 4NX5A 1S5NA 4KEZA 4M5PA 4NG3A 5FKYA 4GO8A 1XRSA 1I2NA 2YSWA 3MA8A 3PUOA 4JFUA 1UUQA 3UWEA 4GYJA 4JYDA 3CEUA 1DV7A 3VIKA 2PCQA 1JEZA 2JEPA 3DG3A 3G22A 1K4HA 5IOBA 1LYXA 1TV4A 3LRMA 5F2GA 3ITYA 3U5UA 4H1ZA 3PBWA 4ENLA 3WQFA 4WK9A 1OINA 1JCTA 1AW2A 2DZXA 1OCBA 4R5EA 2H3BA 3IAQA 4WQ6A 5E93A 4MJMA 3BUVA 3APYA 2ACSA 3BCJA 1D7KA 4XBJA 3MKVA 4XVDA 4XZ9A 1JZ5A 2EG6A 1KM3A 1EHNA 3S1XA 2EPOA 4C6OA 3L68A 1CXEA 2XG9A 1LBLA 1CECA 3CPGA 1GT8A 1P6WA 3PJUA 4CN4A 4MZ1A 1W9DM 3EXSA 4XG1A 2J7GA 1NWRA 2QAPA 1YNYA 4NI8A 4JTTA 1KFBA 1KTCA 4ROPA 4S23A 3NPWA 3TJXA 2E40A 3KZSA 1H7RA 4W89A 3IS4A 3R8RA 2XH0A 3D6NA 1HGWA 1MO0A 3UBPC 4EPBC 3FSUA 2Z7GA 3I6TA 2G41A 1BVWA 2V5CA 3FA3A 2VT0A 4I7WA 4GABA 1E0WA 2OG9A 2I5GA 3CLMA 3EDJA 4X60A 1N8WA 2Z28A 3HGJA 4MZYA 4AX7A 1EF3A 5HDRA 3T7VA 2WVTA 4ADTA 2IKJA 2PDLA 1KM5A 1B3VA 3VD5A 3ZZ1A 4DF2A 2XIJA 5FJIA 2D20A 1IEIA 2BASA 3NJ3A 4HHPA 2CC0A 4GIYA 4REQA 1TPUA 3LG3A 1WB0A 4O8AA 4BQ4A 4YTQA 2D2JA 1VYSX 2P3ZA 3AMLA 2EJAA 3F4NA 3WEZA 3NSMA 1IT0A 4IP4A 3HGOA 3M5ZA 1IGSA 5CAHA 3R79A 2DV0A 4XZHA 1LLZA 4MF4A 5G4EA 4FX7A 5GNYA 3CIXA 2XFYA 1A5UA 3FJ6A 3VKKA 2Y7GA 1UR0A 3TU9A 1NOWA 1DXEA 5HWNA 3G0UA 3CH0A 4Q6XA 1M9HA 1TE6A 6A3HA 4AD2A 5DLCA 5AY7A 3LBMA 3L4YA 4PE8A 1FOBA 3BLKA 2WCSA 1K8XA 3LEPA 3SQSA 1NP2A 2HJPA 3O06A 4G9PA 1EL3A 2OXNA 1DORA 2WMIB 4XZLX 2Q09A 1JYXA 1EDGA 3WQEA 4NNBA 4X2RA 2YL8A 3CHCA 3UY7A 2PCEA 3CPUA 4WLCA 2ZZ2A 2KZHA 3O2LA 2NVCA 2POZA 2ZUSA 3MUCA 4ML4A 3SSJA 3KRUA 1NP0A 4M6QA 4BQ3A 4ES4A 4IHCA 3LV5A 2YBTA 2J4GA 4DWSD 4EP8C 5BOOA 1KXQA 3PPHA 4FXSA 4PTNA 4MG4A 4HNVA 3CZLA 4LNCA 3H6OA 1RVGA 2H6RA 3A4JA 4MNKA 1P1XA 3QMSA 3FK4A 3TZFA 2F6UA 3KHDA 1P0KA 4PCPA 2YCKX 3TK7A 5CGQA 2QJIA 1I2QA 4W86A 1XUUA 2WMFA 4LAOA 4UTWA 3CWNA 4GJJA 1B3ZA 3W0KA 1JNEA 3V1HA 4FK9A 5C8BB 4JEQA 1EX1A 3FEMA 3UPMA 4FNSA 4DJFA 4Q8QA 3E9AA 2WHJA 3S2MA 4A3HA 4A8NA 4PMXA 2PWFA 2DQWA 1GW9A 1XRTA 4WY0B 3LI1A 3ZJ6A 4C5YA 5BRPA 4C6IA 1WYIA 2WSRA 1J5TA 8XIMA 5CCZA 1VGAA 1W1VA 4R7JA 4V27A 4GYPC 4IIBA 1Q13A 2A1YA 4KEMA 1UASA 2PB1A 4CEXC 2Z6IA 2VENA 2GDVA 2ZUVA 3MMDA 4O10A 1TTIA 2Y5JA 4M56A 2WV8A 3DXIA 3W1XA 3MO4A 3WQDA 4I8DA 1L2QA 1XI3A 3R1ZA 3RR1A 4IGMA 4WOZA 4TV5A 6PTDA 2ZADA 1BYCA 4G1NA 4AQLA 3IGHX 5CZJA 4O18A 2ZZ1A 3C4UA 3WBWA 3CZGA 3II1A 4Y6GA 1CCWB 4H8NA 3P93A 3K4AA 3CQKA 4J3XA 2PZ0A 3CQ0A 1AK5A 3N34A 3DDMA 4E3VA 1XBXA 3N9KA 3TYBA 4LYQA 3MHUA 1XPGA 4OHQA 3WD4A 3DAQA 3GDBA 4JTJA 3W7NA 1QNOA 2DSUA 3T55A 4R27A 5LIXX 2Y7EA 2FGBA 2KX9A 1DIDA 3H2AA 3LHWA 3P5ZA 2IQ0A 2QJHA 4MY8A 1ME7A 2OYLA 3SSZA 1MEIA 4H6KA 4DIAA 1TPVA 1WDRA 3NYDA 4HA1A 1GHSA 3B9DA 1TMLA 2NX1A 1ENUA 3U48A 1F3TA 3O63A 1CXLA 4MOZA 3W24A 5BRQA 4W8AA 1KBLA 1H61A 3LD5A 3PC0A 5GNXA 1B5TA 4CCEA 2AQVA 1F4AA 1KR1A 1YNPA 2BG5A 1KGWA 1FH7A 3DBNA 3CEPA 4MHBA 2CPUA 4D6DA 3UVIA 1A5LC 5TIMA 2DZBA 4GUHA 2GVEA 4JTEA 3STPA 3NFUA 3RLUA 1XC6A 3W2JA 3BC9A 4QAIA 1I1WA 4Q6JA 4Z1YA 4X0VA 2V3FA 3TC6A 4PMYA 4ZQRA 1BFNA 4YNGA 2FIQA 3KBWA 4UWMA 2QVHA 1CWYA 1PS9A 3IRDA 2O55A 3C2EA 2F6XA 4RK8A 3A3XA 1FP8A 3TSMA 4JY9A 1J11A 1QWGA 3KOFA 1JCYA 3UCCA 2E9MA 4H4IA 2WZEA 4AEOA 1GTEA 4C1LA 4S2CA 3NEHA 1B9ZA 2OLSA 4IPPA 4XAFA 3OZMA 4PUMA 5C55A 1LRTA 1TMHA 1H41A 1QOQA 2PDBA 3STEA 4XUYA 1XYMA 2Y70A 4ACZA 2EF9A 4QCFA 4OZOA 3N2TA 3B8DA 1B3WA 4DAFA 5D09A 3V3WA 1QOXA 3BCDA 3DIPA 2Z26A 4CCDA 5BRBA 1RBAA 1SJBA 1YX1A 1IZKA 2G3MA 4GZJA 3TCEA 1FA2A 3LPGA 4F40A 1XG3A 1W2PA 3W1QA 1FVPA 3ITTA 2HXUA 3LLXA 3NQFA 4IIEA 3R25A 1EWEA 3HO8A 3R0KA 2ZRYA 3GLCA 4LB4A 2WQPA 3ZXWA 4W88A 2E8ZA 2GOUA 1VP5A 2HDJA 5E0FA 3UR2A 3ABXA 3U2CA 1O4UA 1BGGA 1A5KC 1YNQA 3AS1A 3VCNA 1ZZMA 2WZIA 3IGUA 1SJDA 3KBMA 3DFOA 5A8PA 3KTXA 1XBVA 3AIRA 1C8QA 3GNPA 5G5IA 2GGJA 1SW3A 4B2DA 4IGNA 5AECA 3SDOA 2FZNA 4LS0A 1RK5A 3WQ5A 3G1SA 4NY2A 1FHDA 4D6EA 2G37A 1YDNA 3G1DA 2Z2UA 1C9DA 1W1IE 1GJPA 2PDUA 3H54A 4JD4A 1POKA 2HK0A 3V5CA 2XIQA 2CBUA 3M0HA 2XH4A 3MP3A 4CU7A 1LUCA 1R38A 4QG8A 3GVRA 4HOXA 1FUYA 1WA3A 4C6JA 4GCAA 1EEXA 2XU2A 4O14A 1QATA 5BXSA 3GYCA 5LGZA 3OJGA 4P7RA 3BVJA 3GZAA 3GVQA 2Y5SA 3I65A 4AXNA 5IXEA 3P0WA 3VDGA 3OA5A 4L6HA 4NIRA 3O8AA 5ABEA 2BXYA 3EA1A 4RR4A 1VBJA 5G4HC 1R86A 1UYQA 1EA0A 1UD6A 3BCFA 4G7EA 3VX0A 2ZOXA 5E9AA 4KIEA 4E8CA 5JXQA 4YCPA 1D3GA 3DFNA 3KVLA 2AKMA 1RLDA 5CZ0A 5A8GA 3CU2A 2J7CA 3B9EA 4B5TA 4BKNA 1VFLA 4NJIA 4DM2A 1J18A 5JVLA 1QW7A 4PULA 3IVTA 1AODA 3O6DA 2UY2A 3SCQA 4LRSA 5H6HA 3VKDA 4LUIA 2F9RA 4C6MA 3JVAA 3R58A 4EPEC 3AS3A 3W27A 3W74A 1K7XA 4PZVA 4QSHA 2D2OA 5DCDA 3BJTA 4GRSA 1AH0A 4FHAA 4H9MA 5FJRA 4ZMGA 1KC7A 1EZ2A 2BGQA 1O6IA 1H63A 3SQMA 2XH2A 2XIOA 1TREA 4BCEA 4TVDA 3RLGA 7A3HA 3W38A 3KVJA 1YHTA 5CKSA 4A8LA 1E3ZA 4HYVA 2NXHA 1IXQA 3ABQA 1UD2A 1K9DA 4CCZA 5CXPA 4CQBA 1P6CA 3FCPA 4ZOBA 2CBIA 5CG7A 4BY3A 3HJZA 4PEEA 3LNMA 1TA3A 1XIDA 2ZE3A 1XCFA 2C79A 3RU8X 3S5SA 1DJZA 4LCRA 4RW5A 5GJMA 3CZEA 4JCLA 3SB0A 2GDUA 2YCIX 3L2MA 4GY7A 2W5FA 4RDZA 4ZO7A 1AL7A 4XB3A 1U1UA 5K4XA 5BMXA 1UZ4A 1CI1A 4D6CA 1RBLA 3U3HA 4DM1A 3RF9A 2EEXA 3LU2A 2A3HA 4AHOA 3WH5A 1EJSC 4OVXA 1FDJA 2QDEA 4F2UA 3NYZA 4DELA 1CEOA 1EX5A 1SFSA 1IYXA 4RE3A 1FFQA 2OVLA 2VFGA 3L5MA 2W61A 2C8NA 4H9YA 1AG1O 1JNDA 3A23A 4QTGA 2CU0A 1T96A 3VTRA 2OX4A 1B1YA 1THFD 1MXSA 4IPLA 4KW2A 1WKFA 1OC7A 3W7RA 2BY1A 3IJ9A 1HQTA 3EPOA 1T0OA 1FFRA 4XAYA 3E2SA 3S5OA 3TMQA 5BW6A 5LIKX 1E9IA 3VXGA 3TE9A 3A4WA 4FX8A 1T6MA 2J88A 4O17A 4PTDA 3RX4A 1RP9A 4PUJA 3ZR6A 2BOEX 1SR9A 1W5QA 3UA4A 1KKOA 2A4AA 2X42A 2ZTKA 3RFAA 1TJ1A 1ADOA 3MSYA 3T2OA 3VIOA 5LSMA 4AZIA 2IQDA 1JUBA 5M1TA 4P7NA 1ML1A 3E6EA 3IUHA 3UT0A 1GWJA 3BOFA 3MCNA 1G7UA 1LWHA 1EC8A 1C91A 3WJSA 4LUJA 3VC6A 3DX5A 1D3CA 3CUGA 4M1BA 4FF7A 1TPEA 4GD0A 1EH9A 5CAKA 2ACUA 2VD8A 1HT6A 3VKCA 3K5XA 4ACYA 1OD8A 2VVSA 3OLIA 1H7OA 1KRMA 4I6VA 1E51A 3UVAA 4HNOA 3TQKA 2OEMA 1TV5A 2WSQA 4ZFCA 3I7RA 4W9TA 3SUSA 4N2YA 1Q4WA 4EAYA 2XUCA 1E1CB 5JH2A 3G0SA 5CG0A 5EMMA 1VIWA 3BW3A 4BFAA 2PDMA 1O5KA 4GWEA 3MCOA 2CWNA 4CN6A 1ZBWA 5C9WA 4O11A 3C3NA 1UWIA 2VX5A 1WPCA 1H1ZA 4AD5A 2ZZ3A 3FLUA 1HF6A 3I68A 1KV5A 1CXKA 2OEKA 5K9XA 3EEZA 1AQ0A 3DC0A 5LGXA 4O1AA 4C1NB 3A3HA 3MVIA 3H4GA 4MPQA 3A22A 1NWSA 3DZ1A 1HKWA 3ATZA 4HQVA 2ZVRA 2ZRVA 2GJNA 2Q3RA 3ANVA 2Y63A 3W25A 4EWJA 1I0BA 3NM1A 1Q6RA 2V30A 1IZCA 2WKLA 3CUXA 3W4RA 5D30A 1DHPA 3THAA 2CW6A 4LX4A 1TKKA 3QHNA 1X1NA 3QBUA 5D02A 2A7RA 1FWDC 3F2CA 3ANYA 4PODA 4H8UA 1KD0A 1VCGA 3NPUA 5H1WA 3KM8A 5CSYA 3EBVA 3MC5A 2NSXA 5LA2A 1ZCCA 2VTFA 3SRKA 1EEPA 2VC9A 4DJED 1CDGA 3W2KA 5F1VA 4DO6A 4AEEA 1Z44A 3SRDA 3CAVA 3MZ2A 1W5OA 5T8GA 1ALDA 4AISA 1P5BA 3P7YA 1IWBA 5I3HA 4LUTB 2YDRA 2Z1SA 1P0BA 3BWWA 2BVDA 3DFQA 2PBGA 3LHUA 1E9ZB 4CQAA 1QTWA 5ABHA 1W1TA 1EJWC 2ZZ5A 5D8WA 4DPPA 3V5FA 1W6TA 3LTPA 3HF3A 4C6NA 2BY3A 2NWSA 1W5NA 4UIOA 4W5ZA 1KM4A 2J8GA 3QFWA 1US3A 4IG2B 5AHIA 1E5NA 1J93A 4TMBA 5AVNA 1QT1A 4QROA 3THDA 1K77A 2C3ZA 5I23A 4E2VA 1MQRA 5CGTA 3P3BA 1XLGA 1E40A 2Z29A 1UH3A 3T1GA 1JVNA 1XLKA 3PR2A 1TVNA 2C14A 3IV3A 1FCUA 3RCMA 1XFCA 1KLZA 3OGVA 3OG2A 1LL6A 2D22A 4JDBA 3RX3A 2NUWA 3IAPA 1D2KA 4ZVJA 3FJLA 4GKTA 4JTHA 5I09A 3AQUA 3KXQA 1QJWA 1YTEA 4MDOA 4KEVA 4NNAA 1AQHA 5JU6A 1KFKA 4GXPA 1QI2A 3PBMA 1LBFA 2DT1A 1JQVA 1AJ2A 1L6FA 2Y24A 3WL1A 3RRAA 1OABA 1PBGA 4ORIA 3ZJ7A 1C92A 4CNTA 4UTTA 1JDCA 3C2RA 4KERA 2RGLA 2XINA 3VMPA 5B7ZA 4R88A 3W86A 4ZO8A 2OEJA 1SO4A 3OP2A 1RP8A 2DJXA 1W91A 3ZJKA 3LGGA 2WPGA 4ZOAA 4CN1A 3R12A 4DLFA 3QFEA 3SUVA 2UV8G 2PFHA 2OR2A 1EA9C 5HANA 1WNOA 3T42A 2P76A 3LM3A 3HM7A 2WWDA 1BVZA 5DANA 6CGTA 1KXHA 3O0FA 4H01A 1GUVA 3OHMB 3RILA 1OFOA 3QV7A 2R8WA 2GSHA 1DYSA 1O94A 1VFUA 2FLIA 2V5KA 1VRDA 3CGTA 4J3TA 2DZPA 3NIYA 3VMNA 2WVVA 3PANA 3WUBA 3T05A 2V82A 4GK8A 4K7VA 5EY5A 3WNNA 2Y61A 3LBOA 3EX2A 4H6EA 3NQ6A 3WZ0E 2WJDA 4AZ6A 4HSNA 4GPNA 5DX7A 3VDHA 1GNXA 9XIAA 3C0JA 1RCQA 2OSWA 3VKAA 4DWDA 2Q8XA 1UPPA 4GBDA 1UP2A 4HPXA 4A3RA 1DIEA 1S3HA 1YW1A 4J3UA 1US2A 4L1XA 2QIIA 3GDLA 1Q6FA 2ZCGA 1P7TA 2GJXB 4ZOCA 4YHGA 5C9UA 1XGEA 1UKQA 4FI4A 4DJDD 2CBVA 4UZSA 5D4YA 1G4TA 3H4WA 3M0LA 1KM2A 1SYTA 1YPFA 3G3MA 2V2CA 2OJPA 3CUFA 3WD2A 1YDOA 3RXZA 1R9ZA 1W5MA 1N8IA 2EHHA 4HHMA 2Z1BA 4YN5A 1O95A 1PZ3A 3C2OA 4IPNB 4E2OA 4U31A 1TTJA 2CKSA 4YVVA 2NW0A 2NLYA 1RAKA 3LN3A 2ZBTA 4LNYA 4QXIA 4A2SA 3E12A 1OG6A 3DUGA 5FAJA 1G1YA 3CB3A 4POCA 3GFXA 3VNLA 1S5TA 3UXIA 4H7VA 2QVNA 2VDGA 5BCAA 3OEXA 4O1BA 3CM4A 1HO1A 1HKMA 3DFHA 1EIBA 2H8XA 4F8XA 4N4PA 1MW3A 4BI5A 1UBPC 4O4WA 3A12A 3AC0A 3CASA 3NG3A 3VE7A 1ZJHA 3BV7A 2ONEA 5BMWA 3EDDA 2OCZA 2OLHA 5KETA 1A0DA 4GI4A 2R1NA 3WK0A 4DBEA 2A0NA 4UOJA 2GQ9A 1TWIA 2WNZA 3WLLA 3OQEA 5EU9A 4FIRA 3GXIA 3IJQA 4L6DA 4JDYA 2CLIA 3REQA 3WH6A 3TWAA 3Q58A 1OT1A 1BSLA 4JX6A 4IGSA 2YXOA 3ZIZA 3QPEA 4MWAC 4RXFA 3M0XA 2C7FA 3VE9A 2E25A 3H53A 3AYVA 4HU4A 3ELFA 4K68A 3FW6A 1XQKA 2V8ZA 3FIGA 1W3TA 2P88A 1TWDA 5XIAA 4G8TA 1B3XA 1FWTA 3GC2A 2ZQ0A 1Q63A 3GDMA 3HOJA 1M5WA 2WCGA 1T5AA 1HUVA 1KNWA 1BTCA 1OX5A 2VZTA 2DORA 4XAGA 5FI8A 2ZZ7A 3KOXA 2J7EA 5HAOA 2R82A 1OIFA 5XINA 5MKGB 3UYCA 2VDHA 3WH8A 1QHZA 2CESA 1I8JA 3D0CA 1ISZA 4AY8A 2X09A 2RDUA 3EX3A 3C6CA 4ZO6A 4Z1BA 4NL1A 4PGLA 2PU1A 1JF6A 3Q67A 1XGDA 2PDGA 4Z17A 4P61A 3WQOA 1GJWA 4S1FA 1WBHA 5HULA 4WY0F 1H1NA 3W7KA 3MJYA 3N2BA 3B9AA 1JPIA 5I3JA 4ROQA 1B4KA 1L2UA 1FDZA 2A3LA 2DT0A 1Z3NA 1AVAA 1PVNA 4L61A 1CIUA 4AZCB 4PR4A 3KW3A 7ODCA 3EX4A 3T78A 4Y7EA 4E8GA 1W9VA 4YMZA 3RR4A 1CBGA 4CD7A 1Y5VA 4QJ3B 3BLDA 5FF7A 2R1LA 2P1FA 3SJNA 3S46A 3A24A 4S2BA 3CYVA 3NL6A 3MV01 4PSRA 1SFTA 3DGBA 5DMYA 3KOWA 4IQJA 2BVWA 1UB3A 2PWEA 4AD3A 4L9YA 1GCYA 3L4TA 1WDDA 4RDWA 4F0SA 4MUPA 4JX5A 1GORA 4JIHA 2RFGA 3GHUA 3UZWA 1HX0A 2VQTA 4OV9A 3MCMA 3FFSA 3NXLA 3R13A 2A2IA 4UFLA 4XD5A 4LAMA 1XWYA 3PHAA 3W7IA 4KCUA 5LHEA 3SUTA 4GUFA 4CNUA 1FCBA 3P82A 3M41A 2Q71A 5CPSA 2O92A 2PDHA 2FPVA 2X1TA 2OWCA 1W3KA 4NILA 2OKTA 2R24A 2WVVB 2OWXA 4JQ2A 2NV2A 4JOMA 3PFRA 4UQDA 4CKQA 3WX7A 3TFCA 2FJUB 1R9XA 1EGZA 1CZ1A 1Z89A 4CU6A 5LNVA 4WX2A 4FLOA 4J5NA 4XZNX 3BICA 4KKXA 3GC5A 4OE7A 2A6NA 1MNZA 3TFXA 3B8TA 4H8VA 4O53A 3PAJA 2EPKX 4R9XA 3AZSA 2QNEA 2TMDA 3LX9A 4LXFA 4GUJA 2IKGA 2D0GA 3L7RA 2WOQA 3RHGA 3UR8A 4K36A 1HL9A 3AROA 1U5JA 2QDGA 1XBYA 3G77A 2R14A 3CQHA 3U2ZA 4RJEA 4QE1A 4R7WA 3PY2A 1JPMA 5EBUA 2IXUA 2G3IA 3V0SA 1ZB5A 5FAGA 4MNMA 3IANA 3RPDA 3KVMA 3VGFA 3BLPX 3QY7A 4YTTA 2CETA 5I77A 3PULA 1XLHA 3AWOA 2E68A 1J5SA 1VEMA 4LVAA 4JIRA 1GKPA 3S2JA 4XIAA 1F73A 3RM4A 3S4TA 4BF9A 3OIXA 4C6QA 3DYOA 3OBKA 4XZMX 3GTNA 2FZMA 5D37A 4IWWA 1E4IA 4P8UA 4S3FA 2BP1A 3CPRA 5A6SA 3G6MA 4M19A 4DYEA 6REQB 3TTEA 2W3ZA 3GKAA 1E9YB 5HOSA 3QQ1A 3U0HA 1JI1A 2J6XA 3KBSA 1MQQA 2Z00A 1ZJBA 2DFAA 3ZVHA 2NV1A 3FDKA 2Z2BA 2V38A 4B15A 3S9IA 1X7IA 3WELA 2QLYA 2QCCA 1WBJA 1V3MA 2I9EA 1UOZA 1W0MA 4OFCA 4QITA 4JTDA 1SFJA 1EXPA 1K7FA 3QVQA 3XISA 2YCJA 1FP9A 5TD4A 1VF8A 2X1IA 3W37A 5G2HA 3W84A 6XIMA 3GX9A 5AOUA 1GOIA 1W37A 3U57A 3STGA 2X1RA 4DWSA 3CUZA 2DDXA 1JYVA 3N4EA 4HVXA 2VFDA 4AWTA 1AUSL 1UP3A 4LC6A 3WDIA 1O1HA 4MWAB 2ZXDA 2F38A 4QQUA 4JTUA 2VO5A 4Y9NA 1MVYA 3ICJA 3RIKA 1R0MA 1AW1A 4TMCA 3EYPA 3SO7A 4GX8A 4EXAA 4Y8FA 3XINA 1HTIA 1YE6A 3B9OA 4IM4A 3ALGA 4GKLA 1U2YA 3NQEA 5AHFA 2D73A 1BD0A 4O0ZA 4NHVA 5ENLA 1IQ8A 1H7PA 4IZGA 3S83A 1BG4A 5E0KA 3IJ8A 4B5WA 4Z2LA 2OLAA 4O16A 3PB2A 2E6AA 1V0KA 3M0ZA 4MADA 2OQLA 3GK0A 4H83A 2ZTJA 1TUFA 2Z2AA 4AD0A 1B3OA 2GK1B 4FLQA 3SN0A 3Q65A 2Y8KA 1I60A 3I6RA 5D9MA 4BK9A 4M1RA 1CTNA 3C5QA 4Q8OA 2A3EA 2CERA 1W3IA 3S5ZA 5I7GA 1SMDA 3N9RA 3UERA 1C8XA 5F7UA 2RAGA 1XJBA 2R1PA 1JULA 3AYSA 1UD3A 5DT5A 4GIRA 1F8MA 1DJIA 3PZUA 3M1ZA 4FALA 2Z0IA 3KOZA 1JZ3A 2AAMA 2HZGA 2XGIA 3TLQA 5LYRA 3U5YA 1VEPA 3W2NA 1AD4A 3RK8A 1GZGA 4IQDA 3VOGA 4GX9A 4PMQA 3GIYA 4US5D 3N2OA 4E3TA 1EFZA 1LM1A 3PTKA 3GG0A 4ZGYA 4PB4A 2O9PA 3W1PA 2VX7A 3K46A 4H7ZA 1RQHA 2PU0A 4MPKA 1BYBA 2AL1A 3SIZA 3T09A 3VIGA 4UTIA 4HB7A 3VA8A 1IIHA 5FD0A 3VGHA 1WO2A 2VGGA 4C6BA 4CUCA 1LLOA 1BLIA 4GC4A 1I4NA 4QDPA 3EKGA 4Q33A 4D8AA 4XUGA 3GVWA 3IIXA 1C7TA 1FTXA 2G97A 1BVNP 3ZT5A 2BOGX 2WM0A 2PWGA 5I78A 2ESCA 3CK5A 3THCA 1FHLA 4MB4A 4N9EA 2CLMA 8TIMA 2WM1A 4ZB5A 2WKGA 3C3UA 3MI2A 3NGFA 1RJQA 3QV8A 2GVJA 2XTKA 3AHTA 4QG6A 4LAKA 5HK4A 1AW5A 3BO9A 2AL2A 1F3EA 1EOMA 5CBJA 3W9ZA 5A1AA 2WZHA 3XIMA 4M0XA 2QPXA 3MQTA 4JTRA 5IM51 3UGVA 4Q4QA 4IMGA 1FHUA 3W83A 2OKOA 5FACA 1ZUAX 2OT1A 4CQ9A 3M0JA 1TTQA 4FO4A 3WG6A 4PMVA 1VPXA 3BZGA 1CPUA 3UP8A 4UMAA 1QPKA 4UQEA 1TZ9A 3AS2A 3RM9A 1ZAJA 3IJLA 1IEXA 1GG1A 2OZTA 4RNIA 2V3EA 2J27A 3NZQA 2VGIA 3FYPA 1WCGA 3CLWA 2WKJA 3ZO9A 1KTNA 1W1B1 1BXNA 2C15A 4X22A 4YJ5A 4DYKA 2O7SA 4NAFA 4M82A 3LPOA 4TX8A 1VCVA 1C3FA 5ABFB 5B80A 4L65A 4J40A 4Z2JA 5KMYA 4DQWA 2ISDA 3NVTA 5DCEA 5FSDC 5T9BG 3PPGA 4LQ1A 1EBHA 4RW3A 3LCIA 1WDSA 3B8UA 5IHSA 2G95A 5HNTA 1W54A 1E6NA 1XM3A 4LB3A 1HKJA 3STCA 2NXIA 1S1PA 2NX9A 4D1IA 1R3YA 3ID7A 3VC5A 5A2AA 1VPQA 3UETA 1W56A 3FVDA 5T91A 3T8LA 4A29A 1KRCC 1KM0A 3ITOA 3S5YA 5FEWA 1LL4A 1VAHA 1RA0A 3SRFA 4MYAA 3OGSA 1V6UA 4XBSA 3UR5A 3GXPA 2V3DA 4QDMA 4B9YA 2QZRA 5FJUA 5M03A 4IL2A 2WZTA 3EKZA 3M16A 2YA0A 5IRPA 1VBGA 3P74A 1J0YA 4QR6A 3BW2A 2I7GA 4GFSA 5FJJA 4D1JA 1ZBCA 2PTZA 4D6GA 4CD6A 3MB9A 1A3WA 2VOMA 4IIDA 2WHMA 1FH9A 1XXXA 3QF0A 5FJPA 4GJIA 3UY8A 4FPSA 3LQLA 2MNRA 4AIEA 1S5WA 1FWFC 3AXKA 3BAXA 5A8OA 4HK5A 4V2XA 3G1VA 3ES7A 2RJGA 3CQIA 1Y0EA 5KZEA 1SO6A 1HG3A 2XVKA 3LDVA 3WJXA 4CCCA 5EMKA 1E1FA 1DQUA 3M0KA 3IJ7A 3LM7A 3P80A 1GQNA 3GXDA 4O0QA 4H00A 4M6VA 5IBXC 3PFMA 5J5RA 1W31A 2E1WA 2BY0A 1TCDA 5J5DA 1UZDA 4PBFA 1IT7A 4XKYA 3GFZA 4IJRA 2D23A 1J01A 3N19B 2ZX6A 1V6XA 1OFPA 1E3XA 4ZTYA 3DFYA 1C93A 2A85A 4LGXA 1Q6DA 4JIEA 5AN7A 4Y2WA 4W85A 4BJHA 2FHBA 3VNDA 5M5DA 3HFTA 3OOQA 4W87A 4JR5A 4MLRA 4GI8A 4AF0B 3S1VA 3NQMA 4JN7A 1IEQA 1RJPA 3TN5A 4O28A 2HWGA 2PC4A 1GQIA 1SPQA 4V33A 1LRNA 1US0A 1W32A 4Z1DA 3AHYA 4B90A 1XLLA 4I8YA 1J10A 4MZ8A 3WMCA 4IXXA 2XPKA 3G0XA 3EPNA 1UR2A 1SSDA 4PUKA 5F4XA 1PUDA 3GHRA 5CBIA 1PDYA 2NT0A 3QEZA 4QLKA 2X16A 1W1YA 3N25A 4DO4A 1OIMA 2J74A 4L4OA 3M4HA 3VM7A 5I0DA 3KDNA 1JRBA 1ELSA 4LBSA 1FWEC 3ZWSA 3B8WA 1VFFA 4PTMA 3AHXA 3V36A 4PTXA 4FX6M 1HXJA 1BXCA 1CXIA 3APGA 4AVOA 2BHUA 1GONA 1HL2A 2A5HA 2XFWA 2F61A 4I9MA 4JGDA 4N7QA 1JXKA 2AGKA 2I16A 4QE5A 1JRCA 2GQ3A 1HN1A 4HNTA 4MGGA 1BWLA 1CX9A 3KVKA 3VU2A 1ZP4A 1O12A 3A47A 5L9FA 1E15A 3GQYA 4ZOEA 5HMFA 1E6RA 2BXZA 4H2CA 4X9SA 3HMCA 5U4NA 2SFPA 2FJKA 4AZBA 3H2CA 5A5WA 1UC4A 4KQNA 1ITCA 2RH9A 3OO2A 1S38A 3WYZA 4CLMA 1JGIA 4LVGA 1BSIA 2BV9A 2O9OA 3TWBA 2AL2B 1HP5A 4H04A 5HMEA 3QGKC 4HA4A 1ITQA 3LTSA 1ZENA 2OYMA 2J47A 4J2MA 1X1ZA 4PMJA 3TC3A 1OFEA 4L4MA 3JZUA 1JCLA 4KRTA 3LCWA 1T99A 1RR2A 3ZT6A 1JFXA 4UTHA 4YIWA 3RMJA 5AHEA 4GHRA 3PM6A 4DZ5A 3WH9A 3TXVA 3TCSA 5D2XA 5LNSA 3QOMA 1W8SA 3EOEA 4UZUA 3CV6A 2G4FA 2Y89A 3FKKA 1QK0A 3BPWA 2HNHA 4LS1A 1XICA 1TPFA 4YU1A 4C6LA 3NA8A 3FKRA 4R3UA 1UG6A 5CPMA 5C7HA 3MU7A 3AIVA 4ZQNA 3GE7A 3THUA 3STFA 2AAAA 1I0DA 5K7JA 3HPAA 3GY1A 2Y7FA 3C0QA 2BXVA 1SMAA 3TAKA 1KLYA 4AZHA 3PPCA 3S1WA 1BRLB 1R3QA 2PTYA 2BGNE 1REQB 3AMKA 3EXRA 3BDKA 2YL6A 1E72M 1WOAA 3TSDA 1BWVA 2UWFA 1KBIA 4KGLA 3ZLGA 3ZYZA 1NFGA 3Q37A 3TONA 4H9VA 5CSSA 4NASA 1X7FA 3SM0A 2NVAA 4FXJA 1M6JA 3LYEA 4H9XA 4PUWA 2REQA 4BA0A 3PG9A 3PB0A 4FSAA 1EZWA 4ZA0A 1EP1A 3CB8A 4EWND 1BAGA 1YTKA 1G4EA 1VHNA 2YXXA 5LNWA 3H7UA 3MVTA 1C9WA 3D3AA 2X41A 4O8RA 1VFTA 3P5YA 4MWAE 4H2HA 4WKFA 5D03A 3GHSA 4R7OA 5FSEC 1X8FA 2YBVA 2VD9A 5CPNA 3GVGA 1DWIM 3WLRA 1NY1A 1SJCA 3ME3A 3WQ8A 3VIMA 1DJYA 3C2VA 4YTUA 4C6FA 3F4VA 3GG8A 3PBYA 3TNBA 4KF1A 1JUEA 4NYYA 3S6OA 2YZ5A 3BG3A 2PP1A 5EB8A 2F84A 1R47A 4QX4A 3ARZA 2PODA 1RUSA 1GJUA 4PCNA 1Q45A 3V18A 4A3UA 4D8ZA 4NXSA 2Z25A 1Q6OA 2ZWYA 2BSLA 4BWLC 2WB5A 4LTSA 3QW4B 2RJHA 2PP3A 3EOLA 5E09A 3SCSA 4EE9A 3EGJA 2DQXA 2PGWA 3W07A 2PC8A 1K8ZA 1OYAA 3N2XA 3LS9A 4QJ4B 1V79A 3WH7A 4Z0JA 3MT1A 2V6AA 1XIFA 4XV0A 4LVBA 1M04A 5FF0A 1SZEA 2QCLA 4Q4PA 2P10A 4ZE5A 4WF7A 3S2LA 2VP8A 4LT9A 4QG9A 4DJEA 1WXYA 4KT2A 3E0LA 3LERA 4MY9A 2IPJA 3CXOA 2ANUA 1PCWA 1ZS2A 1S2UA 2JGQA 3CL8A 2Q8LA 2POTA 4JFWA 4LAZA 4W84A 4AH7A 2WLYA 3EX1A 4Q4OA 3DU0A 2ZRXA 4ZCWA 3TTYA 3W72A 3VZZA 2OT0A 3W1UA 4Z2IA 3SCWA 4IX2A 2ZX5A 1RH9A 2RDTA 3E0WA 4FB7A 3L4XA 4RX0A 4DBSA 3LMYA 5REQB 2P0IA 1VZWA 4GI6A 3DHUA 4CGTA 4U4MA 2C6QA 5A6BD 4G7FA 3R94A 3VK5A 4DEFA 2EPLX 4D6JA 3OBEA 4U3CA 1ONWA 1EO5A 5FA5A 3UJEA 2YCEA 2YZRA 4GG9A 3RN6A 3K2GA 1GVFA 3H12A 5AC7A 1MXDA 5G1YA 3DCPA 1D8CA 4GQQA 2WBKA 4U3AA 4D2JA 3ARPA 1H0GA 3H26A 2E77A 4F9DA 3QV9A 1ZP3A 1P0EA 1HJSA 1HGYA 2Y0FA 4EF8A 1XS2A 4UR7A 2TRSA 2J7BA 2JE8A 1PTGA 1XSJA 4HHLA 4GQGA 4CNOA 1ADDA 3BE7A 4KFNA 2D2HA 3PUDA 1NDYA 8A3HA 4G6CA 1OADA 3S2CA 3MWCA 3SCUA 1CNVA 1K8YA 4OU1A 4J9JA 3GC4A 3B06A 1BGAA 3GXNA 3M5YA 3R5EA 5HMSA 3SW6A 2Z1KA 4LBUA 3MZNA 5I06A 1L6YA 1Q2SA 4PFHA 3UEQA 1LF1A 3CHVA 4XAZA 5IDIA 3ITVA 2HE5A 4UUIA 2PF0A 1R5YA 4P5UA 1QBAA 4GQ0A 1QPRA 2X8RA 3FA5A 4HA0A 3VUPA 3F5KA 2TPSA 3B97A 4YCOA 4UQAA 3CIWA 1H5VA 3TYAA 1F6YA 1IXOA 2Q01A 1Z7AA 1TO3A 3KTSA 4JHOA 4LUSB 3TA9A 4YLWA 3GNOA 4NUWA 2GWNA 3UW6A 3NZRA 2OO6A 5F4WA 3AIEA 3SY1A 5TF0A 3DEQA 5EPDA 2WPBA 3CT2A 1JCJA 5G4WA 1OZMA 2P8BA 3UXAA 1UWRA 4D9PA 4GQBA 2XYLA 4IL0A 4MJ2A 4GINA 3WY1A 4FEZA 1VRXA 4MTVA 1PYMA 2NQZA 3UD6A 1P4CA 3QOKA 5AYYA 2WMIA 1XLJA 1FCVA 2VC7A 1K9TA 1FKWA 1DIOA 3EOSA 2ZE0A 3IIOA 4Q8VA 3UG8A 2PDNA 3KFTA 4DO5A 3CYJA 1QR7A 3N4FA 3QMRA 4NAEB 1M03A 1R7AA 3TOPA 3W70A 2Z24A 4CNNA 4LJ3A 3UCQA 2L5HA 3AXHA 4L9XA 3C8NA 4DJDA 1LOSA 2V63A 1OX4B 1ZPTA 1O5QA 5C9XA 2NQ9A 1U1JA 3T44A 1DHKA 3PWAA 1AJZA 1OQFA 3KRSA 3GR4A 4C7DA 4MWAD 1U83A 1F6KA 3OGRA 3CHFA 4Q4MA 2A3CA 1U22A 2A3BA 2RDXA 1TQJA 2Z7KA 2WYSA 1EDQA 2QUMA 1PTDA 2P5NA 2GDQA 2PLCA 1GEQA 1WXZA 2BWGA 4I6KA 2HPIA 3MANA 1Z41A 3AISA 2FZ8A 4PBEA 4PUNA 2VWSA 5D04C 5IDZA 4O1CA 3M43A 2YFNA 4DAIA 2VOTA 2YKKA 5BROA 3DOPA 2OOGA 3A5VA 1XD0A 1E71M 1LT7A 4AIUA 4DBUA 3TKFA 4U2YA 2WC7A 3DKLA 3EDFA 1MEWA 4S3GA 3PWIA 1ECEA 3MHGA 3WQWA 2ZXBA 3BAYA 2NZLA 5CQ1A 3LY0A 4WY0A 4J3SA 5KZDA 1H51A 1VBRA 3MP4A 4B3KA 1AH3A 4E2DA 1WKYA 2RKXA 3E2RA 4ONVA 5A2BA 1R7OA 3BW4A 3RO6A 2UY3A 4A21A 2ZKMX 2IKIA 3L5LA 1XLFA 4L6OA 4E4UA 1W9UA 3TXZA 3HTWA 1BHGA 1E55A 2YX0A 1K03A 5G2WA 4HMDA 2W79A 3H2EA 4GNKB 3GU9A 5EKYA 4M24A 2YFOA 1DKWA 4FMVA 4GCXA 1XYFA 4NJGA 3Q4DA 5I07A 4P7OA 3GDKA 2QCMA 3J7HA 4QJ1A 2E6FA 1GKRA 5LNRA 1NJJA 1UKTA 4N6EA 3TJLA 3NQDA 3QY6A 5K9CA 2WSPA 3OVRA 2CLKA 1BXBA 1FX6A 1WV2A 4HP5A 1TX2A 2INFA 1H1YA 2VRQA 3VILA 3AICA 4F4RA 1TMQA 4M81A 2I5QA 2BVYA 4NJHA 3CTTA 2FH8A 4QHRA 3QSTA 3WEMA 4ZFMA 4GVGA 3AMGA 1R87A 3KHJA 1RCOB 4HK7A 5HQLA 3F4CA 1V08A 4F0MA 3R4IA 3CMFA 3CAKA 4HNUA 3FGCB 4AWUA 1VH7A 7TIMA 4YS1A 4ZSUA 3RUBL 5DXXA 3ENLA 3ZR5A 1HJWA 2WHKA 1ZU8A 3WLNA 1LDCA 4PUUA 1DQWA 1OYCA 1FCQA 3VDCA 1D3HA 2WVUA 2GWGA 2VFHA 4B4FA 2CNCA 4AD1A 4UNKA 2VZOA 2DT3A 4PMRA 2DUAA 1MQPA 2ISFA 3MKKA 5DY3A 3UR7A 2QMKA 3VYLA 3BGJA 3E0IA 3W7QA 3W7MA 5AC4A 3SUUA 1E0UA 3WLTA 3PNUA 4M8UA 4HYRA 3EWBX 3WNLA 2Z27A 2QCNA 3C0SA 5C71A 1VIZA 3VIFA 4BHYA 3O6YX 4PRWA 2A6LA 4HPJA 3W82A 1CXFA 4MAVA 1X38A 2OGJA 3LCGA 2ZICA 3QKEA 4IFKA 4JTKA 4FLSA 1QPQA 3EPMA 1TE1A 3TTOA 3VFCA 1PL9A 1DP0A 5CC6A 4XQ6A 3BSGA 4BQ5A 4AU0A 2VQUA 4ZQMA 5DQPA 4JIQA 3N11A 1NWTA 1KCZA 3M9YA 3UZJA 2C1HA 5H8MA 2NQJA 1DTNA 1VENA 3H70A 5F2MA 3MS8A 3N3MA 3DFPA 2FMNA 4UFJA 2BBFA 4IMDA 2EQDA 4ZQOA 4UNLA 1KM1A 2WNNA 3TW7A 1SM9A 1JCNA 4GISA 3W76A 1UR4A 1A47A 2OMAA 1QI4A 2R91A 1UKPA 1V8EA 2R1KA 3WENA 3K1GA 3E0FA 3N04A 4QLLA 1ESWA 1Z42A 2ZWZA 3UPBA 4B91A 1YEYA 4LEQA 4QEEA 4K8HA 3I10A 3WF1A 2ATMA 4HIBA 1TRIA 4C5ZA 1N2VA 1Z8AA 4O12A 4BQ2A 1V7AA 2NLIA 1UH2A 2QHAA 4C6KA 4BEQA 1MFUA 4QAWA 3V4BA 1MZRA 1IR1A 1P48A 4S3DA 3VKJA 1PIFA 1J6OA 1T7LA 1E0VA 5HNUA 4AD4A 1UA7A 4B92A 1S39A 3KWSA 2QCFA 4C7FA 4GYFA 4ZSTA 4MYXA 5LXXA 8XIAA 3FYYA 1GVYA 3D3FA 3W7JA 3FOKA 1SW0A 1TJ2A 5AC5A 5CEWA 4LFYA 3FX4A 4XKMA 1MUCA 1LL7A 1P1MA 1G4PA 1QVBA 2F6KA 4DUVA 1MW0A 3O0KA 3WEOA 2ZX9A 3SCNA 3TYZA 4UFIA 4LPCA 1TZZA 3ABSA 4UMBA 4PSPA 1XW8A 2D69A 5BXPA 1HVXA 3GDRA 2XSBA 3KS5A 1YYAA 1V7YA 3PUEA 2OZ3A 4HPHA 2VR5A 3GW3A 1CLKA 2XWDA 2CKRA 3GSMA 6TAAA 4LWWA 1UWTA 3G5EA 2OU4A 1RALA 2YLAA 4EKJA 2ZZ4A 1EXBA 1W9BM 4DHGA 4GY1A 3VD3A 3MTWA 4YHEA 4XISA 3IIZA 3AXIA 3GWQA 4NNCA 5DBUA 3AHVA 4MVAA 4WCJA 3EB3A 4CNPA 1OM0A 4V1YA 2ZUMA 3ARYA 4FXFA 4Y90A 1XUZA 1O66A 3NQAA 4GVIA 3IIVA 2LLEA 4PMUA 2R6OA 4P8WA 4AG0A 4RZBA 3DI0A 3DERA 4GVHA 2W4XA 1C29A 3E49A 5K9DA 2NVDA 1Y7VA 1FHVA 3UXLA 1WP6A 4HZ8A 5K2ZA 5HPCA 2VZVA 4E6MA 3CAWA 2PE4A 4A3YA 3LXBA 4X0NA 1IEWA 3NO5A 3TX9A 3IVSA 2DSVA 4GYPA 5TAOA 3AZRA 2GJRA 1LQ0A 4ICNA 4EF9A 2P3EA 3E3HA 1QI0A 1WZAA 4QS5A 3ANUA 1CGVA 1L6GA 2YA1A 4O50A 2A7NA 2F7FA 1EP3A 3WFAA 5I2UA 3O1NA 3M7SA 1F74A 5G1MA 2E6YA 5BXRA 4HZMA 3E5PA 3L4WA 2XFFA 5C70A 2QF8A 2O4MA 2VCBA 5AHNA 2OELA 3G1RA 4JHZA 2BMBA 1ICPA 3URBA 2C13A 4WXYA 1SQ7A 1ZHAA 2E09A 5AZ0A 1B0IA 9XIMA 1XIBA 5GJNA 2GQAA 4P8XA 3NQ8A 1GKQA 3V0TA 3K8LA 1JYWA 4HN8A 3ARRA 1OFAA 1SR0A 4YL2A 2ABBA 1BKSA 3F1QA 3L5AA 1ITXA 2ZFAA 4ILSA 3VM5A 3KX6A 1VYPX 4JTAA 4JL2A 4JKMA 4KCWA 4P2VA 1OSEA 1R8LA 3UESA 1NH6A 1Q85A 5DEZA 3NXFA 1HVQA 2EJ1A 2WJEA 3OPSA 4HTBA 2YW4A 4JTCA 2PDQA 5C2GA 4WDXA 2QCHA 2O9RA 3VNJA 3U7VA 2B7QA 2WSYA 3BURA 3K4DA 4QNEA 3SR7A 3UWUA 3VDAA 4WDTA 3USZA 1LLWA 1NARA 1YKWA 4GE8A 3KL0A 1X39A 2J62A 4WGXA 2DU2A 3L9CA 1CB2A 4ZXLA 3CC1A 4HCDA 4DRSA 1E56A 4LALA 4US5A 4Z0SA 3MWAA 2CHNA 2PWHA 4IFKB 1A5OC 3C86A 1E1EA 1PKNA 4PN2A 3W1LA 3NZPA 3HB9A 2AQWA 1UBSA 3NPVA 3NM3A 2C0HA 3W81A 4IP5A 2EKCA 1KQYA 3HQNA 4KWWA 3ZOAA 4JYEA 3T0BA 2CWXA 2IQTA 4B5SA 1EQCA 4OQVA 2FGLA 4JN6A 1GQJA 4KEUA 1TR9A 1M01A 4AZGA 4UOZA 2XIBA 3CL7A 1NM9A 3JZEA 2X40A 2YLLA 3DYMA 3UNTA 1KFLA 3HN3A 3MMUA 1RLCL 1XP3A 2GQ8A 1MDLA 3EB4A 1O7AA 1N7KA 3CV1A 2ZX8A 3W02A 1XG4A 3C2YA 4EX4A 1KBJA 4UC5A 1OK6A 1O1ZA 1A3XA 4B9ZA 1A0CA 3WQPA 1NOFA 2G96A 1YPXA 3AS0A 1UP0A 1KRBC 1WXJA 4NRSA 2G50A 4IICA 3NQVA 2OTDA 1H4PA 2D3LA 2H9AB 3LHZA 1XRVA 3CNYA 3NTYA 1EQPA 4TOQA 2GVGA 2ZDRA 4FLRA 1TJPA 2QJNA 5ABGA 4K8GA 5ABTA 1E1CA 1GOKA 2HVNA 4K38A 2QR6A 3AWNA 2ZXQA 4AYSA 4XX6A 1M7PA 2EXOA 3N17A 3WDRA 3T08A 2OQHA 1EWDA 2TAAA 5AC6A 3ITCA 3GH7A 2QV4A 2AKZA 3TC7A 1KFWA 3MSGA 1QWKA 3PJXA 1MFVA 4C1NA 1I2PA 3PNZA 5D2VA 3ZVIA 2PS2A 1XQLA 2WZMA 2XN2A 3NOYA 3FYOA 1UIOA 2FGZA 3LCFA 1OD0A 1BF6A 5D32A 3OVGA 1I75A 1KFJA 3WLOA 4Q4SA 3HG3A 3HPSA 2FB3A 3QHOA 4CEUC 1DOSA 1T40A 5C2CA 3P2VA 4HMNA 2V5JA 3TJ4A 1FY6A 1CGTA 2VR4A 3WBAA 3L2IA 4B5XA 4YTSA 4J35A 3LHYA 3G1YA 1D8WA 3PPFA 4R85A 3R8HA 4PB5A 3RU6A 1RK6A 1RD6A 2BNJA 1QDSA 3GU2A 3MUAA 1CLXA 4JNYA 5LXEA 2BTMA 5GQBA 3VCCA 2BVTA 2PRLA 4ALDA 5LIWX 2J25A 5D2YA 4MSSA 1CGUA 2OZ8A 5D9NA 1R3RA 3V16A 4A35A 1VS1A 4UR8A 1X8CA 3GTXA 1ZJIA 3IJDA 4MFDA 2OPJA 5ECVA 3GHTA 1MI3A 3WLMA 3TIMA 4K7YA 4LUTA 3I7SA 2CZFA 4Q8TA 2XM1A 5MHBA 2ATSA 4OIFA 3ARWA 2XN1A 3BGAA 1WKDA 1JXJA 1LQAA 1LROA 2PDFA 3T0TA 4P7LA 1QRQA 2VEFA 3GDTA 1QNSA 3UCDA 3NURA 4ORMA 3KCJA 3HPXA 1VCFA 3CMJA 4AWEA 3W22A 4Q3MA 2VEPA 1P0NA 1Q8AA 2B31A 2Y8UA 4JFVA 1XYBA 4K8EA 3GXTA 5HQEA 4IG2A 2E0PA 3H2NA 2VL4A 4KBXA 1LRQA 4C6CA 3UG3A 2B0MA 1C8VA 4NJJA 1UHVA 3Q94A 4WJXA 2G5WA 4GY0A 3R7MA 2CLLA 4LU0A 4W8BA 1V77A 3MSDA 4O52A 5KTLA 3HQPA 3G8RA 1RPKA 1E70M 3LPFA 4C60A 1HO4A 5FJTA 5D9OA 5I02A 1FWWA 3WF3A 2EPHA 4WUIA 4OTKA 3OHIA 4BS0A 2X7WA 3P6LA 3U2EA 4L64A 1E0TA 1PX3A 1DWAM 2A21A 1QHPA 1YIXA 1CB7B 2VJXA 3VD7A 1F6PA 2WJFA 5F2LA 1QPOA 2H3DA 4IIHA 4GMEA 2W92A 2YB1A 3UZZA 3CS2A 3EA2A 1E6XM 2PD9A 3LGEA 4QFUA 1A4LA 3W2MA 2PDIA 4I7UA 4KFPA 4A05A 1V4YA 1FWAC 1WZKA 4MB3A 5A6MA 2PEVA 4KH2A 2Y2WA 3D46A 5DMLA 4Q4KA 4ZO9A 3WQCA 3P60A 1XSKA 2DW7A 4GOAA 1F05A 2PI6A 4RL3A 3WFLA 1EBGA 5GJPA 1I9CB 1F07A 5EGRA 1FWBC 4O13A 2CYGA 5IFPA 1DJWA 2JFEX 2NQLA 5AVHA 2HISA 1B4EA 3LK6A 4QLJA 1JF5A 1BF2A 2DH3A 1TWSA 3QH2A 5D05A 5CC3A 3W29A 3G2GA 1E6SM 1QU4A 4IOTA 5AYZA 2AOSA 4PCTA 4MJZA 5FJOA 3TUUA 1QNPA 1DXFA 1B31A 1M7OA 1YPIA 3B0PA 2PDKA 2X0YA 3DGRA 3H2FA 6ENLA 3SJ3A 4GA8A 1TJRA 3S6TA 1V0LA 3B04A 4Z2KA 1W2VA 1XIEA 3VGDA 3V0UA 5E1QA 2EBNA 3MUY1 3WK3A 3K8KA 3LTYA 2GJXA 1VKFA 2ON3A 1K4GA 2V2DA 3CH9A 3UG5A 4TIMA 2OZ0A 2CEQA 3FXYA 1YXDA 3WQGA 1SUXA 1KFEA 2CZ5A 4QCEA 8CGTA 3FA4A 3WK1A 3ZLFA 2ICSA 2E6DA 4EIVA 4DB7A 5CGMA 1YDYA 3AYTA 3SGUA 2VURA 1UW9A 1DQXA 2WMJA 1V3IA 1J0ZA 5FCZA 1QI3A 2GUUA 2CZEA 1YDVA 2VC5A 4IPIA 1OCJA 3R89A 4DBWA 2DGAA 4H9UA 3TTQA 1A4MA 1XIHA 3GXMA 3H21A 3QYSA 3BL3A 3CL6A 3M44A 3KP1A 3UZ5A 3NZ1A 2HNEA 4AZ5A 1XCXA 3M0IA 5EFFA 4W7WA 3OU8A 4KRZA 9RUBA 1RZMA 3M0MA 4UFMA 5HXMA 3UGRA 3I4KA 4BR1A 2J77A 1BQGA 3EWXA 4UB9A 4GZ7A 4ZENA 4XZBA 1RY0A 3ARXA 4AHPA 4QSFA 1GVSA 1VEOA 3MO7A 4WJ8A 2GZXA 2WJZA 4JCMA 1LOQA 4LY4A 1RD5A 2E4TA 1KCXA 2UY4A 4N02A 5FOOA 1EPVA 1WQ5A 1YBQB 3VCRA 3IRSA 5A8QA 1A5MC 3EWZA 3GR8A 2FMOA 3OIHA 3PZMA 1WUEA 4FNTA 4OECA 1TJ0A 3W87A 3TSBA 4NKCA 1B57A 1G9HA 2WNWA 1E4MM 3TQVA 2EG8A 5I6SA 4H6RA 2VEIA 3BOLA 4JQ3A 4PMOA 4C6EA 1W3JA 4RNFA 1NQ6A 1A49A 3M6YA 2QMJA 1Z9AA 3L12A 2DUXA 4NZ5A 2HXTA 5KINA 5MKGA 1GOMA 1LWJA 1TSIA 3WD3A 5A69A 2Y6ZA 5HINA 3N6HA 3S1UA 4N6FA 2VHLA 1ME9A 1XYCA 3VZYA 4PA8A 4EAMA 5BWAA 3LOTA 3VAVA 2XVGA 4I90A 4XIMA 1PTAA 1F3XA 1PKLA 3BLIA 3ZSSA 2FVLA 3CIVA 1OYBA 4OKDA 4DZHA 3PTDA 1WZLA 4Q4RA 4TTUA 4NZJA 1HJQA 3QQWA 4JQ1A 4MB5A 4RE0A 2FH6A 3GG1A 2GFTA 1XIJA 3VDBA 1R30A 2C1GA 2J13A 4MB1A 4AZCA 4GQRA 1H50A 2CBJA 1ECQA 2X2GA 4ZZ9A 4LW7A 2INEA 2ZRWA 1UR1A 1T8XA 3LXCA 1OJXA 3R10A 2DIKA 3JRKA 1MEHA 3KLLA 2H8ZA 4PBGA 1FBAA 1DE6A 1V6TA 1YADA 4O0KA 2VM8A 1RCXB 3TR2A 1AZ2A 3QZAA 4RZ5A 1T41A 4FNQA 3T07A 4Q7IA 4HSOA 4DYJA 1K8CA 4KESA 4M80A 4ATDA 1DJHA 3IUIA 3B0UX 2CXGA 3BJSA 2WLZA 2VWTA 1LORA 5EMJA 1LOLA 3EOOA 1WKEA 3VINA 2HTMA 5HQMA 1KCKA 3WDJA 3M7WA 1QOPA 4XZWA 1C7SA 4ICMA 4ZR8A 3C2FA 1XHGA 1W8GA 2DH2A 4I9TA 3NQGA 3MBFA 5A6BA 2BODX 3R11A 2QIWA 1JL8A 4CQ8A 3W73A 3SAZA 4DXXA 1UZHA 3HIJA 3UWYA 1PZ1A 7ENLA 2PDJA 3W26A 3BAIA 3UYIA 4NI3A 4K6AA 3CO4A 2Z4GA 5LIUX 3MDWA 5A94A 1KW1A 2VEGA 3W3OA 3F4DA 2QCDA 1V51A 2ZVIA 4LS2A 1JZ6A 4F0LA 3E2VA 1A5AA 3SECA 4D6HA 4CU8A 2VUYA 3GU1A 2PDWA 4OBSA 3CT7A 1PO9A 2VRKA 4PTWA 1X98A 1AQMA 4HT3A 1JDEA 2QJGA 3C8FA 3PZQA 3WFZA 3CZJA 3UZXA 4F0RA 1OC5A 1PV8A 3WF2A 4QNWA 5DT7A 3EWDA 1PZ0A 4ZODA 3KOYA 1L8NA 1XYZA 2NWRA 1NAL1 3V35A 2OYKA 3RNDA 3UWZA 2ZRUA 4GUGA 4CD8A 3MP5A 2JEQA 3EWYA 3SRHA 4CVWA 5GNZA 2A7PA 1G4SA 1F7BA 1VFSA 1YXCA 1VFMA 1E6QM 3P8IA 1J6PA 3BV4A 5LZLA 1WDQA 5A6KA 4UQCA 2J8FA 2X2YA 1OF8A 4IQLA 4DUWA 4AYGA 3AFBA 1EJVC 1HFBA 5CH9A 5HR6A 4NYUA 4DZIA 3FEQA 1PIIA 2FHCA 5CZSA 3MJMA 1PWLA 2V81A 5JMUA 3TW9A 6REQA 3KTCA 1H7XA 5FF3A 2NT1A 3HG5A 3UWVA 1U33A 4RV8A 3AALA 5HR7A 1A5BA 1TPH1 3S1GA 3U6WA 3O6CA 4F2TA 1XLIA 4PUEA 2X1SA 4Q8MA 1F4HA 1XH0A 4I9JA 4ICCX 4RPQA 4D71A 3ATYA 2BLEA 4AIOA 2XISA 2WXDM 2IMRA 3LNPA 4R53A 1OF6A 3WLHA 4EXQA 4UFKA 3WMLA 5BXTA 1TV2A 2VZSA 4AIBA 1HL8A 3HJEA 4PL2A 3UWWA 3OVPA 1I45A 4FZIA 4LYPA 3RO8A 3KWXA 1Q5MA 5K3VA 4GNVA 2YXGA 1CYGA 1YTDA 4UTWC 4O1EA 2TSYA 1W3LA 2VELA 5LA0A 1SVDA 2F2KA 4MWAA 3D5HA 4FIQA 5D9PA 4QE4A 1GHRA 3WBYA 4DJFC 3AIWA 2VFIA 3UJ2A 4O1FA 5M2FX 4JTIA 3SCVA 3P8JA 4DF0A 3R6IA 1OB0A 5M17A 2I17A 3VX1A 2DPEA 2VI0A 1SGJA 3OYZA 1XIIA 4QS6A 3VNZA 1ICQA 2EG7A 3W6MA 2PSNA 4O4VA 2XZ7A 4PB3A 1UUMA 3AOFA 5EMLA 4W7UA 3HGSA 3AIQA 4Y9PA 2HVMA 5FF2A 4XTDA 2AGTA 2FTPA 2E5BA 4JIPA 3LB0A 1H09A 2C19A 1EDTA 1OGSA 2ZC8A 1VPYA 3TEVA 3PUGA 2CHRA 4MKVA 4I5UA 1PXGA 2MUCA 4N9DA 4NVTA 1J4EA 1IWAA 2ADAA 2AMGA 2HBVA 3OLGA 1ZTVA 2GK1A 5HMDA 4AC7C 1UA3A 1MRAA 2QT3A 2IPGA 2PWUA 1JR1A 3PBUA 3AIBA 1K1DA 3W75A 3BQ6A 1B30A 5BOEA 2PDPA 4Q8WA 4BI6A 2XIMA 2E5CA 1OVDA 3L0KA 1VHCA 3H2MA 2ZYFA 4W5UA 1FWGC 4IXHA 3TQ0A 2QPUA 4JTSA 4FP1A 2OQYA 2WC3A 3P84A 4IX0A 2C18A 2RHGA 3TP4A 3WJYA 1DWGM 2YGYA 1JPKA 2GL5A 3UWQA 3VIJA 2GGIA 3PK7A 5DFAA 4UTLA 4XVEA 2O0TA 1EC7A 4FOUA 2F2HA 2IUZA 4JFTA 7TAAA 3W7HA 2E28A 1CLVA 3W1MA 1A5CA 4F2BA 2OB3A 3PTMA 2Y85A 4UTFA 4A22A 3SFKA 4HZ6A 3RX2A 3BTNA 3ZJ8A 2AMXA 2D0HA 3AIUA 3HBLA 3A4AA 4GH1A 1PHQA 2GOKA 3SGGA 2J7HA 2V3GA 5I5RA 1VJSA 3BXWA 2G3FA 2GSEA 1OFRA 1MUMA 3OZYA 3LZ3A 2Z6JA 3W7DA 3EZ4A 5JUVA 3K13A 1R2SA 1J9YA 3GNDA 4MIMA 1XYAA 7PTDA 2Z1WA 1ZGDA 3CBWA 3GB6A 1UQYA 1MRQA 2FKPA 2J7FA 2NQHA 3DHDA 2CCRA 2JALA 3QR3A 4GACA 2C16A 5RUBA 1W9PA 1XLAA 3ORWA 2ZA2A 1Y65A 4QJ5B 1PIGA 2QCDB 3A13A 3T2QA 2W27A 4HPNA 1MNSA 4HJWA 3EMCA 4U10A 2PAJA 1HJVA 2VR2A 3WUEA 4JY8A 3PWGA 3W2UA 2C71A 2B4GA 3N12A 4LUYA 1KFCA 2JK2A 1IEVA 3O9NA 2BZNA 1DWJM 3OB8A 1UPMB 4JYFA 4G2DA 3BMVA 4RLIA 5HBFA 3VOCA 4LYKA 5FL0A 2V69A 3DBPA 3JUGA 2QUTA 4LY8A 1JI2A 1V93A 2VFFA 3K4WA 4F48A 2UBPC 3NQBA 2GVYA 3ITGA 4LH8A 2OGYA 2B7PA 2JQXA 3DHPA 1Z69A 4EPDC 4REQB 1QNRA 1A3HA 1EJ7L 4GGBA 3GTIA 4AVNA 1YMYA 3CJPA 3CUHA 1K70A 4MDPA 2RDWA 3PZOA 2WBGA 5ABFA 1FDYA 1H5YA 5CPOA 4ERIA 4AXKA 7CGTA 4M7TA 2JF7A 3W1NA 4BF5A 1K7EA 3HQ1A 4C6PA 2QUNA 2J66A 1XH2A 4DPQA 3D47A 2HRWA 4TTGA 4WZHA 3P81A 1J8VA 1GG0A 4M3PA 3NO1A 3RJXA 9CGTA 4PFMA 2J78A 1GGOA 2BS9A 3POHA 1EJUC 5EFDA 1HKVA 4IMFA 1UCWA 3PTQA 1B9BA 1EPXA 3A3WA 1JDDA 3P67A 4M51A 4XTIA 3GH4A 1J0KA 1RQBA 1EJXC 4RDVA 1DE5A 2GGEA 3SIMA 1LTDA 2PP0A 4RPPA 3C0LA 1MSSA 1S2VA 4YWIA 4MAZA 1QW8A 4URIA 1TCMA 3S42A 3NQ2A 1JD9A 3E02A 2ZX7A 3B8SA 4KMQA 5DCBA 5BWFA 3U2OA 5BU6A 2CZVA 4GLEA 2VFEA 3FV9A 3FS2A 3V1PA 5FL1A 4ZB2A 4F66A 1NIUA 4KGJA 4D6IA 4INFA 3WIJA 3EDKA 1N82A 3IGSA 1I2RA 4WGHA 1DJXA 3MMWA 4CQCA 3SCOA 4B4HA 3OODA 4EPKA 2JF6A 1IE7C 3WNMA 3G1FA 3TROA 3K1DA 1JZ4A 3HV9A 1Q6CA 3A21A 1OFQA 4J27A 1TX0A 2FPYA 2ZUUA 2W67A 4UTUA 1KB3A 2XVNA 3B3DA 3WD0A 4S38A 4A8IA 3PJTA 4HD5A 5I3FA 2BOFX 3VNYA 1O68A 2VC6A 4RE4A 3WD1A 1PKYA 1XX1A 4KRUA 5DMMA 3WF0A 2G8ZA 3ZT7A 3WUGA 4TO8A 3E74A 3NL2A 3N2MA 3LENA 2XGBA 3TNOA 1JAKA 4AF0A 1XLDA 2CLHA 3UU0A 4JPGA 4RKAA 5CBBA 2I14A 4Q8PA 1OWQA 2QUVA 4YYCA 2ALDA 5EYWA 4L9ZA 2QAFA 1W1ZA 2G0WA 1H7NA 2IXVA 4IT1A 4WD0A 3AXMA 4MNLA 3ZMRA 2WC4A 4WDUA 3ZLHA 4PRRA 3GBDA 4PRTA 3URAA 4WSJA 2P8CA 3S47A 4AC1X 2X05A 4H41A 1NDVA 5C7VA 3T6CA 5E5CA 2HVOA 2NUYA 1YQ2A 5ECUA 1WAUA 3HG4A 3LA4A 5AC8A 1M7JA 3PN8A 3QXBA 3H55A 3I7QA 1QBBA 4AMAA 3S6DA 1C8YA 4Z42C 1FH8A 2V5LA 1EC9A 4Q8NA 4G1KA 3WNPA 4JKKA 1TUXA 1TV7A 1V02A 3CHEA 3AJXA 3E2QA 4NZ3A 3E1F1 1TPDA 4GC3A 1ME8A 2YYUA 3PSWA 2QDHA 4DLMA 5BNKA 3A64A 2FB2A 1LCOA 5LNUA 4C6DA 2W0UA 1LBMA 4KCVA 1R6WA 3O16A 3LCXA 3NOEA 1OEPA 5LKYA 1GQLA 3MPGA 4C65A 3MUZ1 1LZOA 1PE1A 3NCOA 1XINA 1V6YA 1U5VA 3F03K 3IUDA 2YOCA 1OBAA 2FTWA 2PMQA 2QQ6A 4BF7A 1DL3A 2EPMX 4NX0A 2R94A 4UFHA 2WMGA 3VD9A 3WMSA 4J3WA 1UOKA 1TFVA 3ABRA 3PZVA 2P0OA 5C9RA 3C61A 3B0XA 3INPA 2XHYA 4QDWA 2PPGA 3IGXA 1GOXA 3E5BA 1E0XA 1UD8A 1EJRC 3SZ8A 4K2SA 1UR8A 1R3WA 5A95A 3WCZA 4ZQCA 5D8ZA 1Q2RA 1OY0A 3LCLA 1RVKA 4D72A 4HU0A 5I3DA 2XGZA 4QISA 3WK2A 4KCTA 4FAMA 1R3VA 1SO3A 3GKFA 4ACZB 1BRLA 1Y5WA 3OLDA 1JFHA 3KP0A 1FQ0A 1XISA 3PG8A 4WJEA 1REQA 4YXGA 1FWCC 1K9FA 1XC4A 1U1HA 3MUIA 4CD5A 3TN4A 4HA3A 2J6VA 3IPWA 3EKLA 5M3WA 4KETA 1SU5A 1Z32X 2ZXAA 5T26A 3U8GA 3WLPA 1GYNA 2VDIA 4X63A 3TA6A 4TXEA 2YL9A 2W62A 2CFFA 2J24A 3WUFA 1G01A 3QW3A 3OQ8A 3LUTA 1VBUA 4J28A 4GBUA 1JG9A 1X6UA 1IZJA 4KWOA 1UKSA 3I4EA 3KRZA 3UJFA 1J12A 2XIIA 2XN0A 1TG7A 2PRHA 4S3KA 1TV3A 1EYWA 1VR6A 3GR7A 1DPMA 2W6RA 4UR9A 2JIWA 2OSYA 1K6AA 3PF3A 2DSKA 5CJ5A 1Q65A 2PZNA 2EGZA 4PL1A 3DYPA 4HNCA 1SZFA 1RJRA 5GVJA 3JR2A 3S3GA 2FVKA 4B5UA 4GGHA 3SEPA 4J3ZA 5T9CE 2Y8VA 1RHCA 1LUCB 3CV2A 5TBOA 3L21A 2ALRA 3OZOA 1WE5A 1G5AA 4A8RA 3T0DA 3TAOA 3CZKA 1UC5A 4TUFA 4KFOA 1GTHA 3BQ5A 3GUGA 1S2TA 2X7VA 3BAWA 1EGVA 3FHAA 4UCGA 3AO0A 5IBXA 2RUSA 5HWJA 3VGEA 1BYDA 1GOOA 2VZUA 4UQ9A 2DVUA 2HEJA 4A3QA 1X1OA 4G7EB 1JDFA 2FTYA 4GJ1A 3W00A 1A0EA 1IV8A 1FWHC 4UOQA 5SWUA 4DZAA 1YLVA 2BX7A 2PRMA 1K3UA 1XBZA 4C91A 3WSUA 3OBAA 4MNJA 3E38A 3HG2A 3M47A 3HU7A 3GG7A 1TIWA 5FESA 3GAKA 4B5VA 1UR3M 2QEZA 3WQVA 1KWKA 2ZA3A 2YJQA 5DRIA 1RV8A 2DSWA 2DZAA 3NPXA 1F2JA 3BMXA 3V5OA 3QLDA 3I3EA 3AUJA 3RPMA 1UWSA 1ITUA 4TQTA 5REQA 1NTHA 1POJA 4E2BA 3H7RA 2Z1VA 3YPIA 2FDSA 3G1HA 1JAEA 4OT7A 2V68A 3URQA 2X30A 4U33A 3RCNA 3NSNA 4RE2A 4D8LA 4Q8UA 1RQEA 4MY1A 4WOQA 1JQXA 2HV5A 1TA3B 3NWRA 3GM8A 1TWZA 3ERPA 1VLWA 2E5DA 2F8QA 3ISIX 1FXQA 3VIPA 3O05A 3RAOA 4XAPA 1SJAA 3IJIA 3S0CA 1GVOA 3WBXA 4FR6A 1OGBA 3I3BA 3OTRA 4F79A 4ZL1A 4UTTC 3F7JA 2XFRA 1GYMA 3HURA 4B16A 3OLEA 1TV8A 3WJZA 1ZBVA 1UD4A 2PDCA 4N4QA 5E6YA 4FR1A 4IIGA 4E4FA 3HA1A 3IV8A 5DXYA 3CHDA 1EP2A 3SFWA 4MMWA 1F76A 1K9EA 5BOFA 4Q22A 1G6CA 1R2TA 1I2OA 1TZ7A 3L0GA 3RDKA 3SN4A 4ADSA 1OGGA 2DIJA 3G24A 1MW2A 2YDQA 2ZZ6A 1XDLA 4J2PA 2FYMA 1Z48A 2VX4A 5AYBA 4HJFA 2I5IA 2JKAA 2QXWA 5E9XA 4TR9A 3EA3A 4JL1A 4N9BA 1OT2A 2HROA 3B8VA 4ATLA 2B7OA 1KR0A 2E8YA 4TX9A 4WXZA 4L56A 4LUSA 2HCVA 3ONBA 2BGSA 3NQ7A 5AHMA 3L2LA 1P6BA 1AMKA 4PCFA 5E70A 1HZYA 3CWHA 2V67A 3NEVA 3QZ6A 2B81A 2PD5A 1G69A 4B3LA 1ZLPA 4LAUA 4H3DA 4QP0A 4G5DA 4NJKA 5CPQA 4F9JA 3W7LA 1LT8A 3BLOA 2YDAA 3TOYA 4HMEA 5J04A 4RXGA 5A3HA 4MFEA 4NT0A 2UZ9A 4OUEA 3IK4A 4EVZA 3BLFA 5DO8A 2NQ5A 1ZAIA 1AA1B 4AWSA 3F4WA 4ZE4A 1ONRA 1L6SA 2ZRZA 6TIMA 3GRIA 1XYLA 1VC4A 2W66A 3QMTA 3PZTA 4NAEA 4GNJA 1Q6QA 4UTKA 1X97A 1UMLA 1TIMA 2YIHA 2QGHA 2A79A 3G18A 3IEBA 4JZ5A 5FF4A 2E9BA 4HBKA 2WMKA 3KUMA 3B0VC 5C54A 3NAVA 2W9MA 1OX4A 4WSKA 2JBMA 1CGWA 1S46A 3ITXA 3WNKA 2IPFA 2PUZA 5TQLA 4LOCA 1XCWA 3FY1A 3DH7A 3P0XA 3WF4A 1A5SA 1WAWA 2E1DA 3WLIA 4O57A 1VBHA 4MKNA 1CXHA 4QEHA 5HJXA 3UPWA 2CLFA 4XSLA 4RNHA 2KAUC 3EDEA 3UXDA 1H0IA 4X9YA 3ARSA 3ARQA 1IF2A 3NL5A 3BAKA 4OWGA 3EAUA 2ZDSA 3FVMA 3ZWTA 3AJ7A 5H8UA 1Q6EA 5HPOA 6XIAA 1V3JA 3QC0A 2HS8A 3CAQA 4L80A 3CUIA 3ZR4A 3QM3A 4NF7A 4K3ZA 5JBEA 4PMNA 4B5NA 1XR2A 3WQ6A 2GYIA 4V15A 5EL1A 2WW5A 1SSGA 3LGDA 4KIRA 2D3NA 3H8AA 3G8EA 3VD4A 3BJFA 1XPYA 4BWLA 3H22A 1TPC1 3N18A 3EMZA 2HPMA 4OOZA 1JPHA 3OVQA 4XWUA 1TWWA 4IMAA 3QSRA 1OG0A 3AMDA 3C56A 1BKHA 3A6OA 1QNVA 1S3TC 2WWCA 2YB4A 3U4AA 2DZTA 5C9ZA 3A4XA 2VCCA 4HNNA 1LG1A 2FQIA 2QW5A 5BU9A 4JBRA 3HFYA 3W6YA 4KPLA 2CXEA 2OO0A 2XSXA 1U30A 3VNIA 2DEPA 3T2PA 3DESA 1OCNA 2PF8A 2NXGA 4H7CA 4PCSA 2WK2A 1MUWA 3AUOA 4L1WA 2Y5EA 1TRDA 1UQZA 1OCQA 4Y9MA 4LEFA 3EMQA 4RV3A 4U5KA 4M6UA 1WOBA 3LPPA 4UBPC 4TVUA 4S3BA 2FPTA 2OOFA 3FGCA 1OZQA 2V9DA 3P14A 5E0CA 5A6AA 5H8PA 3MDUA 1UUOA 5A8NA 5H2ZA 3QJAA 3GNNA 3H24A 2JIEA 3OG3A 4RZ6A 1X6LA 2ISSA 4YYFA 2Z1XA 3AU2A 4JTFA 2G3JA 2PLKA 4F0HA 4ZTXA 3QGVA 1E9LA 2R9RA 4EACA 4U28A 2DIEA 4LV9A 1D9EA 1F5ZA 3AHZA 2ZUNA 1J79A 2I1OA 1B90A 4ZB0A 2Q02A 4DXKA 1KWGA 3RITA 2PDYA 2PGFA 4P8VA 5GPRA 2VRJA 5AB3A 1NQKA 4HKPA 1XIMA 1NFBA 3OA3A 1QAPA 1FWIC 1GPWA 3DECA 1OFBA 1A5NC 4AX6A 1W5PA 3M07A 1QASA 1E6PA 2VUNA 3IJ6A 3A9BA 3QTPA 3F5JA 4FS9A 3WKZA 1JZ7A 4XD6A 3N14A 3N73A 1PEZA 1NELA 1TTPA 1W3HA 1VJZA 4FA3A 4WHBA 3GNXA 3SGZA 5F4SA 4UXDA 1EOKA 1Q6GA 1TQXA 3B03A 1NSJA 2FFCA 3HPFA 5AKQA 3TLLA 4J1OA 1G94A 2HQAA 3AU6A 3TZNA 3V75A 4LSBA 5KZMA 2P53A 2J79A 1KXVA 4YVPA 4L7ZA 2J9YA 2XH7A 4Q7NA 3W7GA 1L8PA 2VKZG 5D38A 3N6QA 3TMLA 3GTHA 4JAWA 1PJ9A 4WIWA 4L1GA 2O9TA 5FEZA 1GOQA 1SW7A 1NOUA 4XD3A 1R9YA 3GZ3A 3TYUA 3TW6A 3FXGA 2GUBA 3B8IA 3ITLA 4CQDA 3G3DA 1J96A 3SI9A 4WSHA 1EHAA 1KKRA 4X61A 2HE8A 1WDPA 3UF9A 2YDSA 3TDFA 1P7TB 3VIIA 3ZM8A 1QMLA 1QUMA 3LLDA 5JH1A 3GH5A 3RG6A 4I9AA 2PDXA 3ES8A 2R1MA 2QYGA 3ARTA 1QO5A 3NNTA 3DKJA 3VVGA 1UWQA 2YW3A 4R9OA 4TVCA 3N15A 4GUIA 5D2WA 3R8GA 3UJRA 3ONCA 1W1A1 5K4ZA 4IUOA 4EK7A 3GBEA 1TR1A 3CO8A 2D24A 5HJLA 4S3CA 1TELA 2QULA 3BH4A 3W6LA 1KXTA 2PURA 1EJTC 1QPNA 1WX0A 1YE4A 4JIIX 3PP7A 4FOKA 4Y8EA 2QJMA 2VNCA 3EX6A 4Q32A 4K1WA 5H91A 1F61A 4LRTA 1DWHM 1PCKA 4E8DA 3UA3A 4IP7A 4JNMA 4DJFD 1HKIA 1V5XA 6ALDA 2INZA 4K37A 4J3VA 3TTSA 1GOWA 5A6TC 1N8FA 3DENA 3ECQA 1F8IA 3C52A 1UWUA 4Z08A 1O5RA 3ARVA 3EWWA 3R43A 3MV11 1H7WA 1H3GA 1P0DA 4R34A 3MSRA 3QKZA 5HATA 4EOUA 4DN1A 4LV4A 1A80A 1K02A 1PB0A 1EF2A 3LHVA 4DWSC 1H62A 1AZ1A 1MDRA 3REQB 4PMZA 3W2LA 5LHFA 1NDWA 4AZ7A 2PTXA 3FJ4A 4JXCA 2WSKA 1E4LA 1ZY9A 1FWJC 5KSWA 1TB3A 2ACRA 3W88A 1GVIA 5CSRA 5AYIA 4O15A 2QGYA 2GGHA 4XBKA 2UY5A 4Z2HA 3H4XA 3L23A 3PJWA 4W93A 5MF5A 3MW7A 3BSMA 3VOHA 1KV8A 4HU3A 3CV7A 5HUOA 4A2RA 2TYSA 4IH3A 4MUZA 4NQ1A 1AH4A 4XK2A 2ZIDA 1BG9A 3IWPA 1J0IA 1ZFJA 3FN9A 4DNHA 2E7FA 5G2IA 3O7UA 4LF1A 3ZS4A 1QXLA 4NP7A 3TN3A 3GW0A 4NZFA 1XKJA 3I3DA 1KTBA 1EB3A 4DUOA 1TVLA 1SO5A 4LCQA 4GXWA 3LSBA 1JZ2A 4PYSA 1DVJA 3TYCA 4E5TA 5DF0A 1V02E 4Y96A 1NEYA 4JKLA 1Z6KA 3UNDA 2BHYA 4Q7BA 1ZALA 3W01A 2FZDA 4HZ7A 1ZQ5A 3VZXA 3T9PA 2PWVA 1M7XA 5F2IA 3FSTA 4TX6A 1XGZA 2Q8ZA 2VXNA 3LHTA 1D7FA 1S5VA 1EO7A 1BTMA 1PX8A 4ZXOA 1ICSA 3LBCA 4LANA 1M53A 3KAOA 3LSCA 3URNA 1AMYA 2YCLA 1UWAA 3EWCA 5EBAA 1VD6A 4JTGA 3S5NA 3B05A 4DXVA 3CQJA 1GQKA 1FWRA 1MZHA 4PTVA 2DZVA 3W1RA 5AYXA 1GPFA 4A4AA 4HCHA 4F0KA 1NFPA 2Y7DA 4M29A 3SUWA 2DUZA 3S2NA 4IUGA 2WO5A 4AFYA 2GGGA 3QV6A 2GJPA 3WLQA 1E73M 3FJNA 3G1XA 1J2WA 3SBFA 4KWSA 1GYLA 1TYGA 2AQOA 1HKKA 4Z1AA 2C91A 4YTRA 5HJYA 4K39A 4Z2GA 1JCXA 3WDPP 2H90A 3VMOA 3WDQA 4QBXA 3SY8A 3TH6A 1KBBA 4N0RA 3GD6A 4O19A 4P7QA 1JD7A 2JGYA 1C90A 4UNIA 4JN8A 1E6ZA 1HJXA 3SCRA 4EXBA 4PMDA 1QW9A 3FHQA 3W71A 3M64A 3JU2A 3DG6A 3W53A 4YWSA 1V03A 2CLEA 1W17A 5DELA 1BWKA 3WLKX 1MWOA 5CLWA 4DNMA 3EXTA 3SADA 5G1TA 1DTUA 1V3HA 4KWUA 3B40A 5U7SA 1G7VA 3I6EA 1Q7QA 4Y9OA 4R33A 2CZDA 5IHRA 4ZEPA 5E6ZA 3T4WA 4FNUA 1Q7ZA 4MKSA 1HNYA 1OHLA 3T81A 5C5YA 5EMYA 3VUSA 4WRHA 4UMCA 4NZCA 2DVXA 4H19A 1HW6A 3KEHA 3G1AA 1ZRQA 3WLJA 2DT2A 2H9AA 3VKBA 3VO0A 2J9XA