2QUNA

Crystal structure of d-tagatose 3-epimerase from pseudomonas cichorii in complex with d-fructose
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
290
structure length
290
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
publication title Crystal structures of D-tagatose 3-epimerase from Pseudomonas cichorii and its complexes with D-tagatose and D-fructose
pubmed doi rcsb
source organism Pseudomonas cichorii
total genus 112
structure length 290
sequence length 290
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2007-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 2qunA00
6XIAA 8XIAA 1XIEA 3AAMA 1XP3A 2XISA 5TNVA 3VNLA 4GQBA 3QXBA 3ITYA 5I7GA 4HGXA 4LNCA 3U0HA 4EACA 4QEEA 5B80A 1A0EA 5EMLA 4DVOA 3KWSA 3VNJA 3XINA 5XIAA 5FA5A 5EMKA 2GUBA 2GYIA 3KBVA 3DBNA 3KBSA 3M0XA 1XLCA 4PGLA 9XIMA 1QUMA 2ZVRA 4HHMA 3KBWA 3KTCA 2NQHA 1I60A 3VNIA 3L23A 2NQ9A 2I56A 1XIFA 1XISA 2OU4A 1OADA 3CQIA 1TZ9A 1XICA 3TVAA 3UVAA 1O1HA 2XINA 3CWHA 4QDWA 3IUIA 4GJJA 1XYMA 6XIMA 3M0YA 3AYTA 1XLEA 3QYSA 1CLKA 4US6A 4YTRA 2ZDSA 3ITTA 1DE6A 5XIMA 4A8LA 1A0CA 3WQOA 1XIMA 2G4JA 4G56A 2QUMA 3CNYA 5B7YA 1DE5A 3M0MA 1XYAA 3P6LA 3UA3A 1XLLA 4XKMA 1XLJA 1GW9A 1XLIA 1XLKA 3FVMA 3UXIA 4GLEA 4K1GA 4OVXA 3U3HA 5B7ZA 4XSMA 1QTWA 4XIMA 4A8NA 3LMZA 3BWWA 4A8RA 1XIBA 4ZB0A 1XLGA 1BXBA 4QE4A 3ITVA 4XSLA 5EMJA 3ITOA 2GVEA 3C0QA 3IUHA 3M0VA 3UA4A 4YTSA 3AYVA 4YTQA 1DIEA 1S5MA 3BZJA 2G0WA 2QW5A 1XIJA 1XLHA 3C0LA 4XIAA 3VYLA 7XIMA 4KW2A 3KCLA 3BDKA 1DXIA 3KCOA 3UU0A 3ITLA 3OBEA 4ZB2A 2HK0A 3AALA 4ZB5A 1K77A 3VNMA 2X7WA 5EMMA 3IUDA 3KBNA 4DUOA 4A8IA 1XINA 3QZAA 4QE1A 2GLKA 3TC3A 3XISA 2XIMA 5XINA 2X7VA 4HNOA 1D8WA 4X63A 5H1WA 1DIDA 8XIMA 3M0LA 1XLBA 4PFHA 1XLMA 5C9ZA 2NQJA 1XYLA 1A0DA 3M0HA 4GJIA 4QE5A 4HHLA 3VNKA 4EAYA 4J4KA 3JU2A 3BZGA 3C0SA 4YTUA 3GNXA 9XIAA 3CQKA 1XLFA 2QUNA 4Q7IA 1BXCA 4K3ZA 4W4QA 4X60A 4QDPA 3KBMA 2J6VA 1XIIA 1MNZA 1XLDA 3P14A 5H6HA 3QC0A 1S5NA 1QT1A 4E3VA 1YX1A 1XYBA 1XLAA 1XIGA 1XIHA 1XIDA 2HCVA 3ITXA 3KBJA 4X61A 4YTTA 2I57A 3KCJA 2HK1A 5AVHA 1XYCA 4ZBCA 3CQHA 3CQJA 4QEHA 4XISA 2QULA 5AVNA 5J8LA 3XIMA 1I6NA 1MUWA 3DX5A 3N4AA 3NGFA 2Q02A 3BANA
chains in the Genus database with same CATH superfamily
4ENLA 3FV9A 4C5ZA 3PG8A 2QJHA 2W67A 3W7CA 4H6KA 4A2RA 4JD4A 5FJUA 4ACZA 4G2DA 1E0WA 3HN3A 3R12A 5KSWA 1XDJA 4ZODA 4PMNA 4D1IA 2PWFA 4PCPA 4CUCA 3QYSA 3CMGA 5CPSA 3WYZA 3DUGA 1WKDA 2C8NA 4RCXA 1TCDA 3N13A 2Q3RA 4LEFA 2ACSA 1K8CA 1DBTA 4XSMA 3WO8A 1TFVA 4W88A 3WDIA 3MY9A 1BXBA 1JZ7A 3GTFA 1K1DA 3CASA 4JFUA 1KWGA 1UG6A 4KMQA 1J11A 3KRUA 4JY9A 4EANA 5FF0A 3PB0A 1BSLA 1EF3A 2E09A 3FA4A 1DXFA 1BQGA 6TIMA 3VOIA 3KVLA 4AC1X 1Z9AA 4DJED 3OZMA 1QHPA 3KBNA 3PUDA 2Z00A 4KWUA 3IS4A 2DGAA 3SUWA 3PVFA 2DT3A 2GGIA 2VFDA 5I2UA 1L6WA 4X9YA 4C6FA 3MJYA 2FVMA 3AICA 1JULA 3CT7A 1CX9A 4DM2A 1UR9A 1KRMA 4TV5A 3OYXA 4INFA 3KM8A 5AB3A 4H41A 1EXBA 2HS6A 1G4SA 3VXGA 1R2TA 4LQ1A 3W87A 3PTQA 4WDUA 3B8UA 4RDZA 3B9NA 2ABBA 1EGZA 1J8VA 3BSHA 4JQ2A 1GVFA 2CNCA 3UZWA 3KWSA 3N1AA 2GJLA 2QCCA 1F76A 4C6QA 4UFLA 3IIXA 3CL6A 4AHOA 1BAGA 5I6SA 4M5PA 1QR7A 3CQIA 4FPSA 5LNSA 4AHQA 2IPGA 4L4PA 1EEXA 4KCTA 3AS1A 1RA5A 4B5SA 3LERA 3ZOAA 3S9IA 2ZTJA 2PA6A 4A8LA 4E6MA 4NNAA 2X42A 1YTDA 3L9CA 3FY1A 4PTXA 5LHEA 1K7XA 3FVDA 2RDXA 4ZQOA 2IKGA 3VOHA 3NM1A 3DU0A 3ARUA 4ZEPA 2R1LA 4WSJA 3VGGA 1SMDA 1NF7A 2J25A 2XZ9A 3LUTA 3AALA 1SZNA 2REQA 3B0PA 1XX1A 4NJIA 1SZEA 4GUGA 2YB4A 3B9AA 4ZQCA 4JIPA 2P8CA 2VX5A 3QR1A 4W84A 5CSYA 4B9YA 4HHHA 4Y9MA 1TMHA 1CGYA 1BG4A 3AS2A 4LFYA 4A05A 2VHLA 2ZDRA 4JNZA 3N2TA 1X39A 1VC4A 2YGYA 1SU5A 2HCVA 5TF0A 5LHFA 1ITQA 1S1PA 4HJFA 3MUAA 3DG6A 4YHEA 4NI8A 4JY8A 1FWCC 2VR2A 1EDQA 4HNLA 5HJXA 5C9UA 4GQBA 3UG4A 1EOKA 5G4EA 3P93A 4UTUA 3XINA 2PE4A 3VGBA 4AWSA 2P10A 3QLLA 3PPGA 1FY6A 1JPMA 4S23A 1TE6A 4ADTA 1AFSA 1SW3A 2JE8A 4AQLA 3VIHA 1K9DA 1ODUA 4DJFD 2O9TA 4G6CA 2ZRZA 4IISA 1R6WA 4PBGA 4D1JA 1UQZA 1R3TA 1B5TA 2Z0IA 2PF0A 2ZUVA 1GHRA 5DRIA 2FGBA 2IMRA 2FJKA 2XVGA 4ADSA 4AW7A 1E55A 3FJNA 1NU5A 1XH2A 4DLMA 2Y88A 3H2EA 2RAGA 4W89A 3W1TA 3VVGA 1O1ZA 1TVNA 3FFSA 3QSRA 3W7OA 3W2UA 1NM9A 1W1B1 3PAJA 1V08A 5A8OA 3SN4A 5K3VA 3S6OA 3R0KA 1UKTA 1R30A 5I07A 3GR7A 3NNTA 2A4AA 3WKZA 1TV3A 3DYOA 1EA0A 2NSOA 1CENA 3QTGA 5A3HA 4QQ3A 3TQ0A 4XO6A 3COTA 3N17A 4TQTA 4LVDA 1RALA 3ITXA 3CPRA 4C1NA 3PTKA 1ML1A 4QG6A 3N4EA 4XISA 3WLRA 2DY3A 1XL9A 3CGTA 4B92A 5KZEA 4TO8A 3UZ5A 1IXOA 3LYEA 4M6QA 3LGGA 4YJ5A 3ZQ9A 5CPLA 1WZLA 3GHUA 1V7YA 2ZADA 2GVJA 3OVRA 4QXIA 1DJGA 4ZSUA 1Y7VA 4HD5A 1G1YA 3R10A 3W7IA 1W2VA 4FXJA 5T8GA 2WYSA 1V4YA 3VIFA 3FEQA 1H7WA 3NTYA 3A3WA 4PBEA 3AFBA 3W6MA 2HSAA 2HXUA 4W93A 5A5WA 1B3OA 4HIBA 4D8AA 2XIJA 3GTXA 4OWGA 3AIVA 4PMRA 1XLIA 1TIWA 4Q8QA 4DUXA 4GYPA 3HJZA 5H2ZA 4PMZA 3UWYA 4PBFA 3OZYA 5DT5A 4HK6A 2O9PA 1WOAA 3BK0A 1V0LA 4POCA 2DW7A 3SRKA 2DIJA 5IBXC 4Z2KA 4PUEA 5EKYA 3BCJA 3OTRA 3VNYA 3KCOA 1V6TA 1DWAM 4O10A 3A22A 1PZ3A 4XBJA 2GLKA 1F61A 4MG4A 1BRLA 2QKFA 4JQ1A 4JQAA 3S0CA 3GNNA 1H7NA 1V03A 4H8NA 4TX9A 2RJGA 4BCEA 3MC5A 1UROA 4AISA 3G0XA 3GW3A 3A3HA 1GOQA 2ALRA 1EXPA 3SECA 1UIOA 1JGMA 4W7UA 4LAOA 1WV2A 1ZALA 1ZU8A 5GNXA 2QS8A 3UWZA 4OHQA 3W7JA 2PGFA 3ARPA 2OYKA 1JYXA 4NU7A 2Z2UA 2CZEA 4TTGA 1SQ7A 3WK0A 3WQCA 3TMQA 1SMAA 3S3GA 1MFUA 2QCDB 4IMAA 4NSBA 4CD5A 5DO8A 3WQOA 1U5HA 5CGTA 3VIMA 1KM1A 4QNEA 2XVNA 2PBOA 2AQWA 2KAUC 4C6LA 3HURA 3CQ0A 1GW9A 2FDMA 1A50A 4B15A 3DH7A 2XG9A 2PDPA 4WLCA 3KEHA 1LTDA 1J0IA 1PS9A 3WENA 2GQAA 1OHLA 3FGCA 4RXFA 4ZOCA 2X2YA 4QLLA 4MADA 1QPOA 4IP4A 2ZZ2A 1E4NA 1UASA 1N55A 4Z0JA 4H01A 4GD0A 1VD6A 1KFJA 3MKVA 4US5D 4MB5A 2HTMA 4MZ8A 5GJNA 1BF6A 5LXEA 2NQJA 1XYLA 1W56A 2WJDA 3G5EA 1P0BA 1B57A 3VMNA 4AEFA 2FVLA 3RLGA 2CZFA 1JDCA 2V5CA 2G37A 1XRTA 3CL7A 2VCCA 1YADA 3BCDA 4YWIA 2E25A 1XIIA 1RLCL 3M5YA 2TAAA 4JNMA 1M65A 5IDIA 4OQVA 3VK5A 3VKJA 4HPJA 1GOKA 4HA3A 4QGCA 4B16A 2AMXA 1SZGA 3HTWA 4UCFA 3RX3A 2OYLA 2OFJA 2ZX7A 1OFAA 1W5QA 5FL1A 3L23A 2XM1A 3P84A 4BI5A 1HQTA 2VI0A 2EPNA 3W1PA 1FDYA 3DZ1A 4FMVA 1XXXA 4ZL1A 1JF5A 3IGXA 4D6IA 2YLLA 3DBPA 2A7PA 4CD6A 3NQAA 1RQHA 3AMCA 1KLZA 2Z6IA 1S3TC 4HP5A 4J3ZA 3VKKA 4QCEA 3NO1A 1QNPA 1REQA 1CT5A 3CH0A 4XK2A 2JBMA 4PMQA 3WG6A 1P5BA 2WJEA 3QHNA 1GOOA 4NYYA 2OR2A 1S5TA 2HK0A 3ITGA 1SPQA 1XYFA 3L68A 1KBJA 5CBIA 3TLQA 2EF9A 1GQLA 3S2JA 3HPAA 2WZIA 3L65A 1RD6A 1ADOA 1HGYA 1G94A 1LRNA 2XWDA 4J9JA 1OINA 3RU6A 1HO4A 2NWRA 4H19A 2HK1A 1FWHC 1PZ2A 4CQCA 3MVIA 3EZ4A 2ACRA 3M6YA 3VNLA 1V3JA 3GUGA 1F3TA 1X6NA 1Z48A 2RGLA 3BOFA 2QMKA 2QNEA 3ORWA 1EJRC 2E5DA 3N3MA 3H2MA 4D6DA 3MP5A 1XSIA 2Z1XA 5KMYA 4IM4A 5CC3A 3U5UA 2A3AA 4WIWA 2FVKA 2AOSA 1JCNA 5HAOA 4IUGA 1W5OA 3NZQA 2V3GA 3SCUA 4HA0A 4LBSA 3C5QA 3LMZA 4HBKA 4DXVA 3R5EA 3ITVA 3CXOA 1LWHA 1EC8A 3S5OA 4Q8UA 5IOBA 1B1YA 5BWFA 5K9DA 1QI5A 3AMLA 4H83A 3CHVA 3PZ9A 3AWOA 3V1PA 2FGLA 1GPFA 3N12A 2PTXA 1KFLA 4DYKA 4UUIA 3C6CA 4HB7A 2AL2B 2OSWA 3L5MA 4IQLA 4P2VA 3H26A 1AQ0A 4GZIA 4GNVA 2D3LA 2XH2A 4GC4A 1ISYA 1PL9A 1YX1A 4XZBA 4NJHA 4L1GA 1XIGA 2BOEX 4KFPA 6REQA 3F4CA 5A6LA 1GKRA 3UNTA 1HFBA 5A94A 2C18A 4S3DA 4PMJA 4QNWA 3PULA 1R0MA 3W6YA 4FP1A 1T96A 1F05A 1P7TA 4RL3A 3SCSA 3ZR4A 2BHZA 1JEZA 4MYXA 3MDUA 4UTJA 4E8DA 3OVQA 3WQ4A 3WN6A 1XRFA 2DFAA 3S5NA 4NX5A 3TXVA 1PJ9A 2PDWA 2WKLA 3ALGA 1YE6A 2VJXA 3LHZA 3OBAA 1Q2SA 1M1BA 5FOOA 2JKAA 4N6FA 1K6WA 1EYEA 3MCMA 3UETA 1UKOA 1JD7A 3W6LA 4J3SA 2P1FA 3H55A 4I9AA 1FWTA 3TYBA 2DSVA 5I3KA 3D3FA 2DT0A 3K5XA 1VRDA 5CGMA 1MRAA 5DMNA 1K8XA 1S2UA 1AZ1A 5LIKX 3VNKA 4CQ8A 2NVCA 4ES4A 3K1GA 4NG3A 1KR0A 3VKBA 1W91A 4AZHA 2DDXA 8TIMA 1AVAA 4MZ1A 4IIHA 1M5WA 3ZO9A 1W8SA 3W4RA 2AQOA 1WOBA 1ZJIA 3OLIA 1AODA 5IDZA 2PI6A 1Y5XA 4BQ5A 3EMZA 1JYWA 1EX1A 2WWCA 4QEHA 5LZLA 4JEJA 3HO8A 2DZBA 3VNDA 1A5SA 3CLWA 3UR5A 2GK1B 4O14A 3PNUA 2ZOXA 1EHNA 4WJXA 5BRPA 1XCFA 5BCAA 2DUAA 3W72A 1VJSA 3UZZA 1O94A 2DQWA 4LV4A 2VX7A 5G1TA 3C2VA 4WVXA 1UA3A 4GXWA 3PJUA 3WK2A 2GGEA 1A4MA 1FHDA 4M24A 3R89A 1TRDA 3O6YX 2WMJA 1EZWA 1E40A 3QFWA 1XW8A 3CBWA 4NKCA 3QY8A 1HJUA 3QMTA 1O5KA 2QJNA 2YOCA 1DJWA 1L6SA 2GVLA 3S2MA 3C2FA 4EOUA 3DC0A 1WE5A 4JIEA 3TLLA 3SN1A 1GJWA 1UR2A 3AHTA 3CTTA 4ZOBA 5EFDA 4DWSA 1FH9A 4EF8A 3GHRA 2WVVA 3W02A 1OG6A 3TCEA 3F2DA 4KWWA 5IXEA 5CC7A 3WLTA 3M0IA 3Q58A 4DI9A 4OOZA 1JZ8A 2ZRVA 3N2MA 3H8AA 3OIHA 3MHGA 3LM3A 1V77A 4CN1A 2VC7A 2FB3A 1HJXA 3GR4A 4UC5A 3B8DA 5GPRA 3JZUA 1JQVA 1PIFA 1UP0A 3W37A 2HEJA 3H4GA 1UZ1A 2PDXA 1YMYA 4Z2IA 3TUUA 4DYEA 3GSMA 3BLOA 3KBWA 2DIKA 4QJ3B 3ANUA 3K4DA 2WCAA 3N4FA 2FKPA 3LCWA 4P7OA 5I3HA 2O0TA 2YBVA 2OB3A 4Q6XA 4AXNA 1KRAC 1QTWA 3NL5A 4B2DD 2EPKX 5FJJA 1XCWA 3BMWA 2Y63A 4Q32A 4RW3A 2ADAA 2XH7A 3ARQA 1ZPTA 5BMXA 4HPXA 3C0LA 2IPWA 4C7DA 3W1LA 4GRSA 4LRSA 4NZ4A 2E6YA 3NL3A 3FS2A 3EB2A 1XINA 1TVLA 2BBFA 3GTNA 3M7SA 4EIVA 4IMEA 2J7CA 1UB3A 2WBKA 2DSKA 4WSHA 1SFLA 4KEMA 1FWAC 5G2WA 3O1NA 4NNCA 2J88A 4UFKA 1EDGA 4KCWA 1PYMA 2BGQA 4WD0A 2G3MA 1FOBA 1XYBA 1M7OA 1H09A 2P3ZA 3N14A 3NQ7A 3H2NA 5LA0A 5AVHA 4AVOA 4HMDA 1JFHA 2V5DA 2CHRA 4BQ4A 4Z1AA 5D8ZA 1KBIA 3EWUA 4ZO6A 2JKEA 1V8EA 4UXDA 2WXDM 3RIKA 5BOFA 2GQ8A 3PSVA 4HNUA 2C13A 2R1PA 2WMGA 4CQAA 3SFKA 5HQEA 4YCOA 2V67A 5D8WA 4PTNA 3B8TA 5LNVA 1XFBA 3WNNA 5DXYA 4NRSA 3FN9A 3BW2A 1W9BM 2V81A 4X0NA 4GHRA 2DZWA 2INZA 2DJLA 4K1GA 1H1YA 1K3UA 5M2FX 2GJNA 3QVQA 4AZCA 2H9AB 1GVOA 3TEVA 1H11A 2QIIA 3HPXA 2IQ0A 3TQVA 2YIHA 2G5WA 1YLVA 3BLPX 3SIZA 2ZRXA 3LDVA 4URIA 4DJEA 3NL6A 5KZDA 2C91A 1LUCA 2F38A 1DHKA 1EPXA 5DFAA 5U7SA 2PFHA 4HHLA 2YCIX 3PC0A 1QI3A 4JAWA 4S38A 1E4IA 1DJIA 4I9JA 4XVDA 2YFNA 2WBGA 5HDRA 3T78A 1S5NA 4YMZA 1N8WA 1ME7A 4GABA 3NDOA 4BI6A 4H9YA 1SZFA 3DG3A 2VRQA 3E74A 3O06A 3M7WA 4NL1A 2OX4A 3OA3A 4GVIA 2CETA 3LTYA 1LJYA 2XM2A 1EL3A 2DUXA 1XKYA 1Q8JA 1WB0A 1GOIA 4GIYA 5C7HA 2QIWA 4KFOA 4JIIX 3AHZA 4G7EA 3UVAA 1V6UA 2BZNA 2UY3A 1KC7A 1DE6A 1W5NA 4Q4SA 2E3ZA 1NF0A 1ZAIA 5A6TC 4M1RA 1A3XA 3RLUA 4C1LA 2NVAA 2OSYA 3V36A 3U3HA 1RK6A 1ZSXA 1E15A 4Z2LA 1IWPA 1V93A 1C9WA 1CZ1A 2QCFA 3TTOA 3OVPA 1PX3A 4PCFA 1GVQA 1W1ZA 3OB8A 5HWMA 4E4FA 2UY4A 3GTIA 1IV8A 1E71M 3G1HA 5A95A 3A5VA 1RP8A 5C6MA 2JIWA 2PC4A 4KPLA 5A6KA 3I4KA 4ACYA 4CCEA 3CQKA 2EJAA 2ZA2A 3CEUA 5BZAA 4YXGA 3EPNA 2C71A 3C61A 2X1SA 4PL2A 2R82A 2E9LA 5DCDA 5EY5A 3RPDA 3N11A 2PRLA 1XYCA 4RNIA 2WHLA 5DBTA 1F4HA 1LP6A 1E72M 1XIEA 3VGFA 3PBWA 2V5JA 3PWGA 2GGGA 4G1KA 4S3EA 3T81A 3M0XA 2WZHA 2CXGA 2AAAA 3LHYA 3M0JA 1PTDA 2QVHA 3F2BA 1NP0A 1U33A 2OX1A 4AY8A 1JDFA 3EX1A 4H8HA 3AYRA 3USZA 1PIIA 3EWCA 2VFGA 5CEWA 4I6KA 3URAA 4EPEC 2POZA 2V5LA 2XN1A 4MM1A 1X8FA 7ODCA 4XX6A 4QM1A 4GNJA 3O15A 4Q7BA 3SUUA 3VIJA 3FVMA 2NXGA 4GKTA 3QQ1A 5G1MA 5SWUA 3RLVA 5A2AA 3NQDA 1AMKA 2A79A 4GUIA 2PDQA 3W1QA 5AZ0A 3O6AA 1BXNA 3GBDA 4I7WA 1XRSA 5CLTA 3N04A 4IXXA 3TOYA 1LLWA 3T6CA 1UKQA 2WVUA 2XIOA 4HTBA 4C6BA 3FK4A 3E02A 1ZJAA 1C91A 1E1EA 1GT8A 2EG8A 1V3HA 3JR2A 3SRFA 1QPNA 2X40A 1E9LA 4IGNA 1VGAA 2PDNA 1FUYA 3HMJG 3GH4A 4GYJA 4HCHA 2B4GA 1G4PA 2G8ZA 4FHAA 7ENLA 1XWYA 3I7SA 2WZTA 5D2WA 2YCLB 1UZDA 3NQ2A 4QAIA 3BAWA 3MCNA 4ZTXA 3TYCA 3PR2A 3VZZA 3AAMA 3OW1A 1UW9A 3WBAA 4QS6A 2Y24A 4F2BA 3M64A 5BMWA 3GC4A 3L67A 2HE8A 2X8RA 1O66A 2PAJA 3PANA 3RNDA 3WELA 3WBYA 1JDEA 2FHBA 5XIMA 4RNFA 3EEGA 4BHYA 2PDUA 3SEPA 2X1IA 5A69A 4FOJA 4ZOAA 3WD3A 5HMDA 4ZTYA 3WL1A 4KWSA 4GIEA 2ZRUA 3G8RA 5H91A 3WD2A 1H0IA 3P7YA 4AZ7A 1HF6A 1S5MA 1WDPA 2QW5A 3LHUA 1EB3A 3KS6A 4W87A 3GYCA 1OCQA 2VWTA 2OLHA 1UD4A 2G3NA 1FDZA 1TTJA 2YDQA 3UJSA 2Z1WA 2CERA 4JX5A 5ABGA 2X0HA 4EXAA 3F5LA 3RCNA 3EDKA 2B0MA 2OZ3A 5CSSA 3G1SA 4HNVA 2VGGA 3RAOA 3TP4A 1E70M 1XLFA 4KGLA 4A6GA 3GY1A 3KOZA 3UZXA 3JUGA 1WDRA 1DVJA 3VIIA 1NARA 2V30A 1Q6CA 3EA1A 1KFKA 2O9OA 3U4AA 2FZDA 4MNMA 3O0FA 3Q94A 4GI9A 4QG8A 5D9MA 1SW0A 2ZTKA 3STCA 3THQA 3GAYA 4RNJA 2A3LA 1KM2A 3WBWA 3PZGA 4LPCA 4J7RA 3VNJA 2QEZA 5EPDA 1FCQA 3GM8A 3IWPA 3PTDA 5F7UA 4P8VA 3H22A 2ZX9A 1HIZA 3MA8A 1R2RA 1JYNA 1H51A 3BLIA 1XYMA 5BOOA 4JTGA 5JU6A 1V6XA 1AL7A 3TH6A 3GW0A 3ARRA 2D2HA 3SQLA 1Q6FA 1GW1A 4GQ0A 3TJ4A 1TJ0A 3UXIA 4IX0A 1HP5A 3C2OA 4NF7A 3IJDA 4D6JA 4O50A 2WSKA 1P1XA 4JTJA 5EGRA 1W1TA 2V5BA 4KW2A 4DPPA 4A2SA 1W1IE 3STEA 4US5A 5AHFA 2C16A 1LL4A 1MW1A 2PB1A 3M0LA 1PKLA 1ZRQA 2HWGA 3T42A 2A6LA 1H7RA 4U28A 3UW6A 1ZBWA 3O3RA 1NDVA 2IKHA 4HCDA 3QY6A 3BG3A 3MUCA 1GWJA 3L5AA 3GXTA 2PDYA 1XG3A 2BHYA 2VC5A 2G97A 4HZ8A 4NHVA 4JFWA 2C1GA 3A12A 1YDNA 1S39A 3STPA 1FHVA 1IT0A 4ZFCA 1MEIA 3ZLGA 1GPWA 3AI0A 3N2OA 1C92A 3S1XA 2E6DA 2CC0A 3QC3A 5HK4A 5ABFB 3WUEA 1WBJA 5CZ0A 4GFIA 4FR6A 4Q4PA 4L6DA 3SCQA 4HSOA 5CPNA 3WUBA 2OO6A 4JTLA 1PX8A 5A1AA 4F8XA 3QV6A 1EYWA 4DWDA 1DJZA 1U2YA 4J40A 4YS1A 1KXHA 3UNDA 1XLLA 1CECA 1HT6A 2Z29A 1XC4A 1XLKA 3WSUA 1BF2A 1Q7MA 2POTA 4UFMA 3APTA 3TK7A 3EX4A 4UTKA 3C0QA 1EQPA 2NW0A 2WCGA 4NJJA 2MNRA 1UC5A 1SUXA 4XAPA 1VEPA 2WNZA 4IJBA 2B7OA 3OBEA 1WP6A 2A5HA 4UTTC 5K7JA 3GH5A 3E49A 2XDFA 2BVTA 1DIDA 2ZZ3A 8XIMA 1ZB5A 3FCPA 2Y70A 4GK8A 1HUVA 4L4LA 1BD0A 2VGBA 3W2MA 4HNTA 3C2YA 4GXMA 1H2JA 3W75A 3KBMA 3SCTA 5J04A 4C60A 3VGEA 4HK5A 5E1QA 4Q8VA 2GPTA 4ZO8A 4D72A 6CGTA 5MHBA 3SCNA 3BQ5A 4M3PA 1V6WA 4LNYA 4WGHA 3AIBA 1RCXB 4UQDA 5D2YA 6A3HA 3AZRA 1BQCA 3GTHA 4H9UA 3VA8A 3EOUA 3ABQA 3ME3A 1YXDA 1EP1A 3KZPA 3WNLA 2QZRA 1EDTA 1IGWA 2XH4A 3O8AA 3R4IA 5JXQA 2XINA 2BS9A 5BXPA 4DNMA 1F73A 3AU6A 2G3IA 1CTNA 5HOSA 1KBKA 1JCJA 4F4RA 5IHRA 4IXHA 4BI7A 3CU2A 3R25A 4AU0A 5F4SA 1A4LA 1O68A 3WQFA 3P0WA 1M68A 4RV3A 4Y9NA 2R1NA 4Y2WA 1SSGA 4A35A 1PX4A 3WQ8A 1X38A 5TBOA 1R5YA 5CBBA 1S46A 1IEXA 2YFOA 3W07A 4BF5A 3TU9A 3WF0A 3SR7A 4UBPC 3MUXA 3F4WA 3OLEA 3SY1A 3WH6A 2UZ9A 4RXGA 1G69A 4OJYA 4O1FA 4V33A 3FJLA 1XDMA 4UFHA 3BTNA 4ROQA 4QDPA 1XLDA 1NWTA 1LROA 4HYWA 3I65A 4N9CA 5FEZA 3AQUA 3EDEA 3R58A 3EA3A 7REQB 4CNSA 4C5YA 1B90A 1UKSA 4QJ5B 5D30A 1QNOA 5D05A 5DX7A 1ZP4A 3GNPA 2DW6A 4BQ3A 5FCZA 3GNOA 2DIEA 1CLVA 4JS3A 1YDOA 4PZVA 1QNSA 4OBRA 3BV7A 2AAMA 5BYWA 3DG7A 3HM7A 2XVKA 4D6FA 3CAVA 3WDRA 5AKQA 2BXZA 1HKWA 4RE3A 4JFVA 1V51A 3H7UA 4JQ4A 1OFDA 2HV5A 3VDGA 3KVJA 1IT8A 2BMBA 3ENLA 3ANYA 3N9SA 3TN5A 4E8GA 5EMJA 1GNXA 3E3HA 3SCPA 1K02A 4F3HA 4DZAA 2NZLA 2D1ZA 4YIWA 1TTIA 1C8YA 1VIZA 4LY8A 3RITA 4OECA 2V6AA 3II1A 7TIMA 3N6QA 3MI3A 3KE0A 1F8MA 3TONA 1R3RA 5CKSA 2V5KA 4WKAA 1A0DA 4GJIA 3H2FA 4L1WA 3MMTA 1RCQA 3S6DA 3AOFA 5BXSA 1NDZA 4JXCA 3CUHA 5HJLA 3QHMA 1ZJBA 3RX2A 3VILA 5CJNA 3UR7A 5DMLA 4JPGA 3GNRA 4BWLC 2RFGA 3M07A 4E3VA 3ABRA 2D2JA 4NZ3A 2BVYA 3F5KA 4I90A 5HINA 3W7GA 3RILA 3EGJA 3U0HA 2H6RA 2EO7A 1P0EA 3TDFA 4F9DA 4RDWA 3MUIA 3I6TA 3KRBA 4UTLA 2BG5A 3AIUA 5A8PA 1TJPA 1CDGA 1Q6LA 3K8KA 1FCUA 4TMBA 4UMBA 1R9ZA 4GI6A 1R3WA 3VCRA 3IPWA 3WNOA 1JCTA 2NUXA 4H6QA 1E51A 3PJXA 6ENLA 3K8MA 1TR1A 1LL7A 1TTQA 4MPQA 3WCZA 3HJEA 2QCDA 1IXQA 4IIFA 1AQMA 2VEFA 3IV8A 4MLJA 2EG7A 3WF2A 1VH7A 3CUGA 2DV0A 4YTSA 4JCLA 3JW7A 4XB3A 4U2YA 1FHUA 4K39A 1H61A 2BVDA 1VZWA 2ZZ5A 3QGVA 5J5RA 3MSGA 2AMGA 1ITUA 1PDZA 2P50A 1G4TA 3NSMA 4HYVA 3BMXA 3TKFA 3SJNA 2X41A 5FJRA 3ZVIA 5CQ1A 4FR1A 1NVMA 5CSRA 4XAFA 3KP0A 1FCVA 4LAKA 3B04A 3BGAA 4LUIA 1EO7A 3N73A 3OLDA 5IFPA 1ONRA 3L2MA 2V68A 4HK7A 4OV4A 2QJGA 4R85A 1YE4A 4NAEB 1NFPA 4D6EA 1UKPA 5BXRA 4P7RA 2ATMA 4L4OA 1H62A 3WIJA 1US2A 4FEZA 3AIQA 4U4MA 4W8BA 2BGSA 4CCDA 3QOMA 1FWWA 1LG1A 1I45A 2DQXA 1J6OA 2BXYA 4S3CA 1SW7A 4XWUA 3T2PA 2J75A 2OWWA 1EQCA 1EIXA 5M3WA 4WQ6A 3KX6A 5CPMA 3UPBA 3MKCA 1EJWC 1NJJA 2WC4A 2PRHA 1TWZA 3TXZA 3DCPA 2TPSA 3BZJA 2PP1A 2G3FA 3CIWA 2SFPA 1WAUA 1Z8AA 1KWKA 2DU2A 3WF1A 2BB0A 4C6PA 4WOZA 4JX4A 4AC7C 4CLMA 4PRTA 3BH4A 1EJSC 1I4NA 3E0WA 3GXNA 2H90A 2VFFA 3C3UA 2NUWA 1J12A 3KRSA 2Z1VA 1A5AA 3IVSA 2EKGA 3ZLHA 1H41A 4S1FA 3BARA 1A3WA 1KFBA 1KXTA 2J24A 4ZOEA 1CYGA 3EDJA 3DC8A 2DEPA 1OGBA 4DRSA 4XKYB 2ISSA 3FHQA 3A4AA 1JD9A 1P6WA 4LGXA 3RR1A 3TTSA 1TWWA 1E9ZB 3F5JA 1WNOA 4GACA 3TSBA 3CZEA 3M47A 1KRCC 3EB3A 3T09A 5DY2A 1OT2A 1GOWA 3ERPA 4BFAA 3P8IA 5JBFA 3RDKA 1JAKA 1MI3A 5CPQA 2Y8VA 2QCLA 3SRDA 4OE7A 3KHDA 3QLDA 3HMCA 2NQ9A 2I14A 3W76A 2PWUA 5HPCA 4QDWA 1DHPA 3WLLA 2D2OA 2NSXA 5DMYA 1A5UA 4DNHA 4J3TA 5JBEA 2VT0A 3N3TA 3CV2A 1JYVA 3VD9A 3AZTA 3GDRA 4Y96A 2CWXA 4F40A 4CCZA 5HWJA 1TREA 4AX6A 4XO7A 2GOKA 3MMUA 4Y90A 4B3LA 3QR0A 3AU2A 3B8VA 2D24A 1TO3A 3L4UA 4XIAA 1LCOA 2PDJA 4HU3A 1JVNA 3V0TA 2PUZA 3UJFA 2QAFA 3UBPC 3QFEA 3WH8A 1UWTA 5CC5A 3C2EA 3SCWA 1P0NA 2WC3A 5G1YA 5C8BB 4LUTB 1Z32X 1EZ2A 3JU2A 3BZGA 3T8LA 4PUDA 4M7SA 1SO4A 3WK3A 4LYRA 2AL2A 2J7HA 4ML4A 3ARXA 4JL2A 3BW4A 3QN3A 1THFD 1FXPA 1UJQA 3W70A 5F1UA 3OU8A 3W3OA 1M53A 2IUZA 1RJQA 5TNVA 1JRBA 2RDWA 3NJ3A 3QXBA 5G4WA 3AUOA 1A0EA 3FOKA 3T08A 4GKLA 2Z24A 2QJIA 4N7QA 4DZ5A 3RM4A 2NV2A 1TKKA 3BCFA 2Y6ZA 1E43A 2OEMA 1I2NA 1T8XA 1IGSA 4M19A 1PVNA 3TCSA 2WPBA 1VBRA 1W8GA 4IMFA 1XV8A 4AG0A 3P6LA 1IQ8A 4PL1A 4J1OA 2PP0A 3AC0A 2BP1A 1QJWA 4QE4A 4R7JA 4I8DA 2YYTA 3Q4DA 3FEMA 4GG9A 2W4XA 4GUHA 4LVBA 2QV4A 1ESWA 2E28A 3KVKA 3KWXA 1SGJA 3S5YA 2I9UA 3QV9A 4ILSA 4PMVA 4AZBA 2VDIA 1CIUA 2V69A 1IT7A 1HJVA 5C70A 1FWDC 3VM7A 1EJXC 3R79A 3BSMA 3WD4A 3QPEA 1MSSA 3W7RA 3MS8A 2PDCA 3DN5A 4KF1A 4JN6A 1JI2A 3LXAA 5EU9A 2QUVA 4HNNA 4MY1A 4PN2A 3GWQA 2ISWA 1ADDA 1JF6A 2JF7A 1IXPA 4DAIA 1NWRA 2A3CA 1K7FA 2XSXA 1GYLA 4LNCA 1UUOA 3P61A 4HOXA 1G9HA 1VFHA 4CN4A 1O60A 3PZTA 2I9EA 2OQYA 1MQPA 4EK7A 2GK1A 1E6ZA 1KBBA 4H7VA 4D71A 1HL2A 3H2CA 3M5VA 4QG9A 4N0RA 1J2WA 4C6EA 2OT0A 1OY0A 1Q4NX 5GQBA 4PUNA 3A4WA 4LCSA 1PDYA 4HSNA 3CV6A 4JQ3A 3B05A 2JIEA 2VUYA 3OZOA 1RY8A 3H7VA 3LXCA 4A3RA 4L7ZA 4GC3A 3TJLA 3VOFA 3NFUA 1V79A 3R8RA 4MWAC 3MUZ1 4WXZA 3A47A 2GOUA 1YRRA 4ZB2A 5K2ZA 4O4WA 1R7OA 3RPTA 4DBWA 3PJTA 1G4EA 3TFXA 1UWQA 2FZ8A 3HV8A 3PM6A 3ZSSA 2GJXB 4YWSA 3UWVA 3CMFA 4GO9A 4KCVA 2Q09A 3CZJA 4O57A 3UP8A 4YLWA 4X22A 1JPDX 2VGFA 5A8NA 3UCQA 2Y0FA 3LM7A 3IACA 3W1NA 4K38A 1X6UA 3CQHA 3SSZA 2V3FA 3T05A 3E2SA 2BHUA 5E6ZA 2P53A 3SB0A 4H9ZA 4XBKA 3LRLA 4V1YA 1PHQA 3EOEA 1FDJA 2GDVA 3PZVA 1VFUA 5M1TA 4XAYA 1BWKA 1KXVA 4Q4OA 5G5IA 1L0PA 2ZA3A 3UR2A 4DELA 3CWHA 3TN4A 3IIPA 1KGXA 2PCQA 4OZOA 3W7PA 5GJPA 3WLOA 2QPSA 3SGUA 3W88A 1H7OA 3HIJA 3APYA 3UG3A 3NXLA 3MU7A 3SURA 4Q4QA 1FWBC 4GMEA 3N25A 5GNZA 3VMPA 2VVNA 1E6SM 2XGIA 1H50A 3N9KA 4YTQA 3W24A 3SY8A 1AUSL 4JTDA 4GO8A 2ZFAA 2ZUSA 1DXIA 1MZHA 3L21A 3TTEA 2QDEA 2PP3A 2XJ7A 4A3YA 4AUBA 2VZTA 5I3DA 4TX8A 3H12A 2QF8A 2CLLA 4X63A 1QPRA 1VFFA 4IL2A 3ZMRA 2E6FA 1DWJM 1JJKA 1JCXA 1IHIA 1I2OA 4JNYA 1AW5A 1RSCA 2VENA 5D2VA 4QTGA 4Q7IA 2FMNA 4DJDC 2YW3A 2YCJA 1OFBA 3WEOA 5IHSA 1PWLA 5JVLA 3PAOA 3R94A 1KRBC 3AJXA 2J7GA 3WLHA 1CXKA 1XP3A 5IFTA 4UQEA 1TPH1 3LRKA 2CCRA 1LLZA 3N29A 1VYRA 3EOOA 2B7NA 4FLQA 2FHFA 1ME8A 3NQCA 3G6MA 2WW5A 1V3LA 4E5TA 1EF2A 4IJRA 3PN8A 2J79A 4QBXA 2NXIA 4LS1A 2NX9A 3ARSA 1T7LA 4BZYA 1R3YA 1VCFA 2WM1A 3TAOA 4MKVA 1K03A 3DFNA 1C90A 2X1TA 3EX2A 4MJ4A 4CNPA 1POJA 1PIGA 1V6YA 4GXPA 2HXTA 3M0ZA 4L65A 1OG0A 5A6MA 2YA1A 3N34A 1AH4A 3NL2A 4J2PA 3U2ZA 5I77A 2H9AA 4PRRA 3SFWA 1QPQA 3SQMA 2VRJA 3E2QA 3W73A 2PU0A 5E9AA 3QZAA 3TC3A 1QFEA 1UC4A 1EJVC 3Q67A 2Z6JA 3REQB 1U5JA 3V3WA 1P6CA 2EEXA 1M6JA 4XZLX 3GZAA 3M4HA 4DI8A 1QO2A 3URNA 4YTTA 4GZ7A 3F1QA 2C19A 1Y0EA 1QOPA 2BNJA 3N4AA 4GUFA 1J79A 3TC7A 2VEGA 3A23A 2PS2A 1OX5A 1C3FA 5FJPA 1XR2A 2VUNA 2I5GA 4G7FA 3EWZA 4X0VA 5EMKA 3DBNA 3FA3A 4D2JA 1SO6A 1J01A 4EAMA 1RY0A 4IJCA 2WNQA 2HVNA 2OGYA 1RXOB 3H4WA 3T0DA 1OEPA 4HYRA 1OM0A 1OCBA 3CYVA 1RLDA 1CXEA 2IS7A 2PWGA 4CEXC 3O0KA 4BJHA 2OEJA 3A13A 1PZ1A 4C1KA 1QMLA 3SUSA 1AW2A 3ITOA 2A6NA 4H4IA 1J6PA 1B0IA 2RKXA 5CLWA 1LT8A 4D8ZA 3GDTA 4GY0A 2UBPC 1Q13A 3QH2A 3O05A 3LEPA 1VAHA 3OG2A 3QBUA 1R3SA 3CV1A 1H7PA 1R9YA 1ZFJA 2JEQA 4LC8A 3POCA 2ZE3A 1ZS2A 4JTCA 1KR1A 1ZGDA 1AG1O 2RDUA 3UYCA 1HP4A 3AUJA 4L80A 4XZHA 4ZO7A 1XI3A 2OEKA 3NPVA 2C14A 4MF4A 1B3YA 5GVJA 1F3XA 4E4UA 4NZFA 1EHAA 1BG9A 4LX4A 1TRIA 3W83A 4GJ1A 4JCMA 1G6CA 4U3CA 4Q7NA 3DHUA 1ZTVA 4JTAA 3F03K 1L8NA 2VXNA 1W1YA 2C15A 4X9SA 1W9UA 2X16A 1K7EA 4I8YA 4IZGA 3ANVA 4AB4A 1GTEA 5FL0A 4MB3A 3RCMA 2IW0A 4DUWA 4FO4A 3I3DA 5E0KA 2OU4A 4RR4A 4AMCA 2PODA 4DF0A 5PTDA 4IF2A 3HQPA 3OJGA 2UY5A 3GC2A 4GGBA 2CLMA 3UWEA 5CZSA 3ZZ1A 2INFA 2FZMA 4M82A 1ISWA 1HJSA 1QNQA 3L0NA 1NTHA 1W3NA 4RZBA 4N6EA 3VX1A 2F2KA 3EB4A 3GLCA 2AGKA 3N19B 4I9MA 2CU0A 1VFMA 2IPJA 1ME9A 2C3ZA 1ZBVA 3DGRA 3TR2A 1CI1A 4KFNA 1ITXA 2ZA1A 4DUOA 2TODA 4DO6A 2Q3OA 1EJUC 2YZ5A 4LV9A 3RRXA 3BG9A 3SCOA 1EGVA 4DIAA 2J8TA 5CXPA 3UPWA 4W4QA 2VOMA 4XVEA 2NV1A 4H9MA 4B5XA 2WV8A 3H70A 1TJRA 4UTTA 1XH1A 1KTBA 2ZE0A 1CPUA 4QCFA 3NDZA 1PKMA 3AIEA 3T8QA 1UA7A 1VEMA 4PTWA 1LQ0A 5LA1A 2D3NA 4LAUA 4IPNB 7CGTA 4QJ1A 2CKSA 4Q8NA 3GXFA 4GZEA 1YKWA 1GUVA 3G1XA 1RZMA 4CU8A 3BLDA 3C4UA 1NP2A 1MXGA 3NG3A 4AVFA 1TZ9A 3ABOA 1BWLA 3U5YA 1KM0A 1DWGM 6XIMA 3S8HA 1XLEA 1CLKA 2ZDSA 1GONA 3QMRA 1XIMA 2WOQA 1JPKA 1B3WA 4MGGA 3NPUA 2GZXA 3NO3A 3G22A 4LVGA 3QQWA 4DO7A 1B30A 3W22A 4Q33A 2ZUTA 3IJ7A 3SDOA 4AF0B 3CWNA 5HWNA 3MJMA 1KV8A 5JH2A 3MT1A 1GOXA 3P3BA 3DIPA 4L9XA 5BRBA 4R7OA 1X96A 3K4AA 5BU6A 2FPYA 4QIUA 4TVCA 4MZYA 4DPQA 1KLYA 2VR4A 3M9YA 1S2AA 3LPPA 3NOEA 1JDDA 3T4WA 4EXQA 4EX4A 4FNPA 2WWDA 5F1VA 4B5VA 3VKAA 4REQB 1S2CA 3C3NA 2I7GA 3GVQA 2PDMA 3OGVA 3QOKA 4LUJA 1QT1A 1QXLA 4R27A 1E6RA 3RM8A 2I5IA 3HU7A 3W7DA 3H4XA 3LLXA 2WC7A 1J93A 3B9EA 3PFMA 1L6FA 2EPMX 3U2CA 1V3MA 3IAQA 2BVWA 4H1ZA 3WJZA 4UOZA 3N15A 4LUYA 5C2CA 1NWUA 4IIGA 1OC6A 3FA5A 2ZVRA 3B0XA 4IFKB 2DUZA 3TAKA 3AHYA 1GJPA 3SZ8A 2PDGA 4C6DA 3KZSA 3EDDA 5GJMA 2QUMA 4WUIA 1S2WA 3S4TA 1JXKA 3TN6A 3LU2A 3LV5A 1Q45A 2DORA 4ZXLA 1EIBA 4RPPA 3EBVA 4ONVA 1AQHA 1D7KA 2WVTA 4J2MA 1RH9A 3PZOA 3BQ6A 3DHDA 2C79A 1ISZA 3BURA 1U22A 3WLPA 3TE9A 4JYEA 3FNDA 1REQB 5C0QA 1VPYA 3B8WA 4WK9A 2Q6ZA 1MDRA 3VIOA 4QE5A 1GQIA 3VM5A 2CLFA 3PF3A 1OYBA 5F2GA 4IQDA 1ICPA 4FNRA 1G5AA 5KINA 3ZVHA 1POKA 4TR9A 2XFRA 2DVXA 1VJZA 4WHBA 1BPLB 1ONWA 4RK8A 2BXVA 3L7RA 4M81A 1LQAA 1DTUA 2CFFA 1ECEA 2OLSA 3DFPA 4B4HA 4MY8A 1NSJA 3BOXA 3LCHA 3MTWA 5FA5A 3S5ZA 2C0AA 5BNKA 1OFRA 4LB3A 1DJHA 4AYGA 3GG0A 1LF1A 3AJ7A 2PD9A 1TB3A 3U7VA 4M6UA 4YNGA 3HGSA 1H5YA 4C6KA 1BTMA 1EFZA 3W7HA 1X6LA 3QY7A 4Z2GA 2CLPA 2Z7KA 2PTZA 2CLKA 5ABFA 2QDDA 2GSEA 2IXVA 4U3AA 3W7LA 1QOXA 5HBFA 4UFJA 3LPGA 1P6BA 4DZIA 4EWND 3WMLA 3WLQA 4LW7A 1OFPA 1Y65A 1TA3B 4PYSA 3TYEA 1BWVA 1WQ5A 1Q6GA 4FS9A 5G4HC 4JGDA 4PC8A 4BEQA 2PC8A 1KFEA 5I09A 2YCKX 2PDFA 3VYLA 1UIPA 4Q4RA 1CLXA 1PV8A 2QJMA 1P4CA 1UD8A 3LNMA 4R5EA 3WDHA 3B0UX 1S5VA 3EXTA 2DZSA 1XSJA 1J9YA 3FKKA 2CZDA 4U10A 2EKCA 4H8VA 4QLJA 5KETA 4UR8A 4KIEA 2W62A 2ZC8A 4HSHA 3OA5A 3VMOA 3L66A 2PWVA 1Q63A 4DYJA 2E5BA 1HKJA 3KOWA 4JTRA 1A47A 3T55A 3WMBA 2V9DA 5CZKA 2XISA 2YXXA 4JTFA 1GQJA 3PWAA 1A5LC 4W5ZA 4ASTA 5CCZA 5FAJA 1RJRA 4ICMA 3BLKA 3WQPA 1NIUA 2E1DA 2ZCGA 1GYMA 4MJ2A 3TZNA 2WNWA 1M9HA 3SIMA 4AH7A 2C6QA 2BFGA 4LEQA 1IWBA 3DERA 2OT1A 4R9XA 4UR7A 4NZJA 4K36A 3WQGA 1N7KA 4OUEA 1KGWA 4S3AA 1VLWA 3EEZA 3GDLA 3C52A 5MKGB 3MUY1 4WDXA 5C71A 4RE0A 3I7RA 1QW7A 4ICCX 3E12A 2RGMA 3ES7A 1SM9A 1LYXA 2GGHA 3M0KA 5A8GA 2YL9A 1W3HA 3S5SA 1IIHA 3CYJA 5FACA 3GDBA 4HMNA 4KT2A 1GEHA 3XISA 3VNZA 5F4XA 1TPB1 4AWTA 1R47A 2WK2A 2XFFA 4GVGA 3HG4A 2DP3A 2CYGA 3CS2A 3VE9A 4S3KA 1XLAA 2EJ1A 3PTMA 1CB7B 3KXQA 4H9VA 3H24A 3HQOA 2P8BA 3C2RA 2QPUA 2VL4A 4DBEA 2NWSA 3BLEA 3EKLA 1VBGA 2F6KA 4RDVA 3B4UA 1XSKA 3BLLA 3ABXA 3IAPA 7REQA 1DPMA 2NLIA 3SCRA 1XLCA 2XSBA 2VEIA 2X0SA 2VO5A 3LZ3A 5DBUA 3DFSA 3FXGA 1GK8A 3CO4A 4O28A 4Q3MA 1F7BA 1Q7QA 5EFFA 3V1HA 1Q66A 1O5QA 4P61A 4LYQA 1AQFA 2XIQA 3PPHA 4FXFA 2Y85A 1R87A 3NQ6A 4UNLA 4WJ8A 3QR3A 1MQRA 1SO3A 4IICA 4K1WA 4WGXA 3DFOA 1SFSA 3CL8A 3DXIA 2FIQA 3ARYA 3S1UA 1G01A 3HF3A 3BPWA 3AXMA 3UA4A 3AXHA 1G7UA 3V35A 3WUFA 2DZTA 1ZJHA 4PUWA 2Y7EA 4A22A 1W9DM 2RH9A 4IP5A 1CGVA 2V3DA 4FNUA 4LAZA 4XAGA 4AD2A 2HRWA 2G3JA 1QOQA 1D8WA 3VGDA 4YN5A 2P0IA 2PDHA 5LIWX 3P5YA 1HJWA 1KD0A 5DF0A 2E9BA 3NYZA 4JHOA 2WVVB 3GYEA 3LTPA 1MXSA 2ON3A 3QC0A 1B4KA 1JCYA 3UR8A 4ML9A 1WZAA 3PPFA 4FIQA 3UJEA 1CW2A 2YLAA 2XSAA 2WQDA 1LRTA 1L9WA 5CGQA 3MSRA 1BYAA 5DCEA 4X2PA 2YX0A 1K4HA 4I5XA 2QJJA 4IUOA 4GBDA 4RV8A 4XQ6A 3KBVA 3MVTA 3T2QA 4CNTA 3EPOA 4LWWA 4R3UA 1KCLA 1SFJA 3L0GA 1VEOA 5F2LA 4R33A 3IGHX 3W01A 3P80A 1K9TA 1ISVA 5TD4A 3CB8A 2YBUA 2W3ZA 2ZVIA 3FLUA 2PLCA 4N2YA 3GVGA 2GUYA 3WFLA 4EP8C 1KV5A 4AFYA 1OK4A 5B7YA 3B03A 3KVMA 4A3HA 4WKFA 2DT1A 4IHCA 1NOFA 4F0LA 4HZMA 3HGJA 4GIRA 4H6EA 3TN3A 4FAMA 2PDIA 1E1FA 3BUVA 3VO0A 2J7BA 4AIUA 1Q85A 5E5CA 4CNOA 1XIJA 5A6BD 3B4YA 4G5DA 3O63A 4ORMA 5ECUA 3R8HA 3F4NA 2XTKA 3WF4A 3UXLA 1FWIC 2VURA 1OC7A 4TOQA 4EAYA 3U8GA 3AROA 5HQLA 4WY0B 1X7FA 3IJ9A 2ZKMX 1NEYA 4AHPA 3FYPA 3I7QA 5FF3A 1Q8AA 4RZ6A 4R88A 5MF5A 3BMVA 3MB9A 4F0RA 1VFTA 2V63A 2WO5A 1EPVA 3ITYA 2NQLA 3CMJA 2BX7A 1OYAA 5EMLA 4JTHA 3EYPA 4NAEA 4J28A 2PLJA 5RUBA 3U2OA 1QI4A 5XIAA 4UTIA 3WK1A 2Y4SA 3QM3A 3P62A 5FJTA 2GQ9A 4UWMA 2WMHA 1Z42A 2PPGA 1OWQA 5CZTA 2QAPA 3W25A 1KTNA 4MAZA 2BY0A 3GVVA 1HKIA 2YL6A 1E6XM 4NILA 4IGMA 5D2TA 1OBAA 4S2CA 2WLZA 1OVDA 4UZUA 1MZRA 2A1YA 2VFIA 2Y5SA 1ZUAX 3RK8A 3TMLA 2WAGA 4KRTA 1Q6EA 2ANUA 3UYIA 3CLMA 2G0WA 1S1RA 3SADA 3LCXA 5KTLA 3VUPA 4AZCB 2VEKA 2PGEA 2QV5A 1N8IA 3VZYA 2X1RA 3CAKA 2I17A 3KHJA 2CITA 3KLKA 4GISA 1KKRA 1LM1A 1ICQA 4Q22A 1HW6A 2J6XA 2RUSA 3ZJ6A 4DN1A 1EGMA 5BRQA 1QWGA 1UJPA 2E68A 1PSCA 4B5WA 4Z1DA 5FKYA 3RO8A 3KBJA 2DSZA 4KETA 2WSPA 2OG9A 2FTPA 2PWHA 2VCAA 4DBUA 2Q02A 3VIGA 2BGNE 2OZTA 2E5CA 4PTMA 1HNYA 2HVMA 1A5OC 3LBOA 3VKDA 4XKYA 1TE1A 3LZ5A 1TJ1A 4LCRA 1V02E 3PZIA 1ISXA 2ZUUA 4LYKA 1F6PA 1Q3NA 2HROA 5FF2A 1ELSA 3WFAA 3A9IA 3I4EA 4AY1A 4F2UA 3L0KA 4K8GA 4MIMA 1J96A 1LDCA 2W63A 3GB6A 1O1HA 4BQ2A 3ID7A 3T7VA 2WJZA 3MYPA 3LNPA 4WDWA 5CJMA 3TV8A 1PTGA 1O5RA 4ZXOA 3BV4A 3M0MA 4EPDC 4ZR8A 4NX0A 3O07A 2YXGA 1A5BA 3LGEA 2WPGA 3RYSA 4N9EA 4KRUA 3GXIA 4MFEA 1HKKA 4RKAA 3WLKX 3UF9A 4C91A 1SFTA 4XD6A 2PMQA 4UQAA 4J5NA 3I6EA 2CW6A 4KERA 2NX3A 2JQXA 3P82A 3BDKA 4TVDA 2VELA 2ALDA 3GU2A 5HMSA 4LYPA 1MRQA 2ZZ4A 3CC1A 2WMIB 3H54A 2G95A 2A3EA 1TV5A 2QCHA 2H8ZA 2ZX6A 1B9ZA 3W29A 1JUEA 5LA2A 3G0SA 1UWRA 4LUTA 5M17A 2QDHA 1F2JA 2QHAA 1LLOA 1F3WA 1B3VA 3K13A 1A5NC 4ZFMA 8XIAA 3MI6A 5DEZA 3CUXA 3WQEA 1S38A 4MJZA 3W7KA 1BKSA 3IJLA 3KL3A 2GUUA 3WQWA 4LALA 5LSMA 4Y8FA 4MPKA 1GJUA 4NVTA 3GE7A 5I3FA 3WDJA 2VC9A 3B8IA 3VDHA 4DO5A 3MCOA 1YBQB 5AC4A 3HFTA 3WUGA 3L12A 4UTHA 2P0OA 1FWGC 1DIKA 1G7VA 1OSEA 4ZVJA 4HPGA 1AH3A 1LBFA 5G2IA 2OZ0A 2Q01A 5TAOA 3PBVA 1ZCOA 3SM0A 3W0KA 2WJFA 4GGHA 4WF7A 1OFQA 5DELA 4KWOA 3S46A 4B5UA 1KM3A 2QLYA 2Y89A 1CCWB 1R46A 3TZFA 3UY7A 3AWNA 3K4WA 2A3HA 2J27A 4WDTA 3ZFHA 2WHMA 1FH7A 4BEUA 1GVRA 3V0SA 4JKLA 1TPWA 1VFLA 1EOMA 3ABSA 3RFAA 4JTSA 4O15A 1H0GA 2QDGA 3T40A 5DRCA 3M0HA 3PS7A 4J4KA 1U30A 5FAGA 1RHCA 3IIOA 4ZMGA 1NELA 1MWOA 3AYSA 4C6NA 1WPCA 5I24A 2OELA 3TFCA 4KCUA 5BOEA 2P5NA 4IQJA 3CQJA 3KTXA 4PA8A 6TAAA 3EMCA 1PO9A 5I3IA 4E8CA 4DF1A 2Y5EA 3SI9A 3EKZA 4QEEA 2KZHA 3UY8A 3E1F1 1WDQA 1SJCA 3MO7A 1A80A 1MO0A 4PULA 3CHCA 1WX0A 2ATSA 5I3JA 3NIYA 2FMOA 3VIKA 3G1VA 4B3KA 3AISA 2OWCA 1WUFA 3IJQA 3B9DA 3GVWA 3KFTA 4XZNX 1O95A 1C29A 1M7JA 2PD5A 3GAKA 1VJIA 4HZ6A 3RN6A 4LAMA 3DFYA 4A3UA 3PZMA 3KL5A 1XBVA 4XZMX 4DF2A 1CGWA 4PB4A 1WAWA 2TRSA 3DGBA 1YQ2A 1TPVA 1GQKA 3KS5A 2FZ9A 1K77A 4PE8A 4F0SA 1V02A 1IXNA 5D38A 3ZSTA 3OGSA 3L4ZA 3BOLA 1QK0A 1YEYA 3CUFA 4FNQA 5FI8A 2W61A 1B2YA 1HVQA 2GJXA 1L8PA 3VAVA 4DY1A 3ZYZA 4BA0A 2PRMA 3DECA 1K8YA 6ALDA 1AD4A 3WNKA 3W82A 3YPIA 3I3EA 5HQMA 1PE1A 4JTKA 3POHA 4P7NA 3UXDA 4ZQPA 1Q5MA 3P81A 4AYSA 1YTEA 3VOCA 4J3UA 1M7XA 5HJYA 4L9ZA 2XPKA 4B4FA 1KXQA 2NVDA 1OT1A 1XICA 3B06A 4GX9A 1HVXA 4HMCA 8CGTA 1PCKA 2C1IA 4Y9PA 1A0CA 1LOSA 4AIOA 1QBAA 4PTVA 4H04A 5E09A 4PMXA 3WNPA 1V6VA 5DMMA 1UUQA 3KRZA 3VI2A 3P0XA 3GR8A 3T44A 1IEQA 2OJPA 4UQBA 1E0TA 4M6PA 3I3BA 4FX8A 3UXKA 3KL0A 5K9XA 4S3GA 4XBSA 1GYNA 1ODZA 2Y7GA 2PTYA 4GY7A 4L6OA 4GPNA 2JK2A 3ZWTA 2FFCA 3SCVA 2HMCA 2X2GA 3A24A 1UR3M 2D20A 1LG2A 4KRZA 4FA3A 3DI1A 1PAMA 3XIMA 2Z25A 4MOZA 3SAZA 5T91A 5LNWA 1UZHA 3KAOA 3MV11 4OV9A 2OXNA 4MKNA 3E5PA 3R43A 2VP8A 3WH9A 4JHMA 1T0OA 3LCIA 1D7FA 5EBAA 2WHKA 2GJPA 2XUCA 3W00A 1OF8A 2VYOA 3DESA 4W7WA 4FOKA 4WXYA 1QO5A 3CTLA 4WOQA 3G0UA 4Y7EA 2J7DA 2ISVA 1TZ7A 1ZP3A 5AYIA 2FPVA 3WQVA 5J5DA 4PMYA 2Y7FA 4DJFC 1WDSA 4G56A 4KQNA 3W1MA 5HANA 3QJAA 3VOJA 2XVLA 1ZENA 2AQVA 3ARTA 1RD5A 4HN8A 5D32A 4FLOA 1L2UA 1CGTA 5GNYA 4F0MA 1GHSA 1GVYA 1QATA 4CD4A 4LY4A 2HZGA 5FD0A 3FYYA 4L56A 4XG1A 1BVNP 4LVAA 3QGAC 2E7FA 3EWDA 3W84A 2XH0A 3W86A 1UR0A 4GI4A 3C0JA 3RHGA 4LB4A 5EMMA 2D73A 4O1DA 3CB3A 5BW6A 1ZL1A 5E6YA 3LPFA 4LC6A 1IIGA 3I10A 4JHZA 5CAHA 4X60A 1S5WA 3REQA 3W2NA 4GWEA 3VFLA 4DLFA 3M41A 2V2DA 2ZQ0A 2YA0A 1WBHA 2B7QA 3BANA 1HL8A 4EE9A 3I68A 4L5ZA 4GBUA 4RZ5A 3TROA 2QCNA 1IR1A 3DKJA 5A2BA 1EP2A 1CEOA 4UOQA 3M1ZA 1PUDA 3BAJA 1BVWA 1UR1A 3EDFA 3USBA 3BVJA 1DWHM 1SJAA 3HB9A 4FNTA 3IUIA 3M0YA 4OUIA 4GCAA 1RQBA 1M41A 3NQMA 1I2QA 5BXTA 1DJNA 5JMUA 4E2OA 3IJ8A 3GD6A 3NQFA 4WX2A 4F79A 3RU8X 4UR9A 1VPQA 4HVXA 2J7EA 3K2GA 2HBXA 3LI0A 4ZB0A 4XSLA 1Q6OA 4AVNA 1X7IA 1HGWA 4QITA 1TPUA 4NIRA 2O4MA 1DJXA 1Q6DA 1W1PA 1I1WA 1ZZMA 4FZIA 2P76A 2DZVA 1JZ2A 4DZHA 3NA8A 4MFDA 1EJTC 2NT1A 1J0YA 3BLFA 2HNEA 5D33A 1ICSA 5AHNA 2V38A 5A8QA 2PLMA 3MQTA 4J3XA 1VFSA 1TSIA 1FWRA 2PF8A 1LOLA 3TWAA 5LNRA 3W7MA 3CWOX 5U4NA 1B3XA 4ERAA 5H6HA 1W3JA 4OKDA 3CH9A 1C9DA 5I02A 3RM9A 3TSDA 1L2QA 1TYGA 3WDPP 1KQYA 2Z1KA 4NZ5A 4YVVA 3FIGA 3R0UA 1E5JA 4AWUA 4CVUA 3UXAA 4QJ4B 1Q6QA 3FHAA 2OQLA 5LIXX 4M29A 2AKMA 2QCMA 5L9FA 1Y5WA 4NNBA 2QUUA 2EXOA 2YDSA 1HJQA 2NQHA 3E0VA 3HV9A 1MEWA 3SBFA 5LNUA 4TV6A 2CBVA 3MW7A 4JYFA 1XIFA 1XISA 3UPMA 1XBYA 5AFDA 3GIQA 4CQ9A 1S3HA 2A85A 3LK6A 4IFOA 1TPC1 1MDLA 4UMAA 4YVXA 4ZQMA 3AS0A 3WF3A 3E2RA 4A8NA 3UCDA 4D6HA 4JN7A 2P88A 3CZGA 3IGUA 4B90A 3SJ3A 2PSNA 2YZRA 4RJEA 1J0KA 1E6NA 4NQ1A 1OK6A 3E2VA 2W27A 3PHAA 2XIMA 1X8CA 5XINA 2FTYA 1E9YB 5ABHA 3PK7A 4RDYA 1XFCA 1YPIA 4Y9AA 3URBA 4MAVA 3A6OA 3ALFA 3IJ6A 3WBXA 1E1CB 1MYRA 1UP3A 4LBRA 3S1GA 2RHGA 2WKGA 1QRQA 2Y7DA 1MUCA 5FEPA 4X2RA 1S2TA 1KM4A 1DQWA 4Q8WA 5C2GA 4KEVA 1RK5A 2JEPA 1LBMA 3PZNA 4UCGA 2QF7A 4LUSB 1NDWA 5T9CE 2VD8A 4G8TA 3DEQA 3LN3A 2Q8XA 1VP5A 3BC9A 1PPIA 2EHHA 2J4GA 2ZWZA 3PG9A 2QUTA 1XBZA 5KEZA 1NDYA 3CK5A 3KTCA 1KCKA 4IG2B 2F8QA 1QWKA 4O18A 1AJ2A 5ENLA 4ERGA 4FLSA 4FF5A 3B97A 4CD7A 4GZJA 3LHVA 1PCWA 1RCOB 1E6PA 4L64A 3TOPA 4C6MA 3VOGA 4N4QA 1TR9A 3G18A 2CHOA 3B40A 1I1XA 3P67A 1R2SA 4QSFA 1R3VA 3UZJA 2Z1BA 4HHPA 2MUCA 2ZIDA 3PSWA 3G6LA 1E0VA 4JKKA 3HG3A 1DQUA 5D9OA 4ERIA 2QGHA 2GVEA 2Y8KA 4XD3A 4AF0A 3W85A 5IBXA 3RX4A 2J9ZA 5E93A 5CG0A 1Z69A 4V2XA 2DSWA 2BY1A 5FESA 3VD4A 1WKFA 2VFHA 4W85A 2F84A 2DT2A 3RF9A 3DHFA 1Q65A 2O9RA 2YCEA 2CIPA 2WNNA 1OD8A 3Q65A 3HG5A 4MHBA 2YPIA 2Q8ZA 4NRRA 4UOJA 1PWMA 1VS1A 5HXMA 1DJYA 4REQA 3STGA 3DYMA 4LS0A 4HU8A 4ORIA 4Q6JA 2ICSA 1ZCCA 1U1JA 1XF0A 1CWYA 1BTCA 3D0CA 3F7JA 3GZ3A 1UWAA 1W5PA 1X1NA 1Q6RA 5JH1A 4XUYA 1D3GA 4EACA 5T9BG 1DL3A 1XRVA 1XQKA 3S2LA 4L6HA 4O8AA 1UD6A 1LOQA 1FKWA 5AC8A 3IARA 3TTYA 4C90A 3G3DA 1QAPA 3BAXA 2D2GA 3SQSA 3BO9A 4I5UA 2V2CA 2YJQA 4A4AA 4ZE4A 1LZOA 3G1FA 3AYTA 2ZRYA 2J74A 4IFKA 4MNJA 2LLEA 3THDA 3T0BA 4TU1A 4K8HA 3LSCA 3QTPA 4PMOA 3N6JA 3MBFA 3IVUA 1JFXA 3CO8A 1DQXA 2J62A 4Z17A 1KM6A 1VIWA 1XUUA 3KDNA 4XIMA 2FFIA 4UZSA 5BWAA 1DOSA 3NZRA 2VNCA 5A6BA 4G9PA 3LGDA 1YXYA 4GNKB 4D6CA 4A8IA 4O52A 5D9PA 3T9PA 2F2HA 4HNOA 5H1WA 1FH8A 3PBMA 4K37A 1XLMA 1CGXA 4HA1A 2EQDA 2V0TA 1H5VA 4G1NA 1ENUA 3HPZA 3VDCA 1UBPC 1TPFA 1QW9A 3OQEA 3LSBA 1VHNA 1OJXA 2OMAA 5FEXA 2I57A 3VUSA 3UFYA 4ZBCA 4HKPA 5I78A 3L2IA 4HQVA 4D6GA 1W3KA 4P5UA 3HFYA 4B9ZA 3OQ8A 2Z1SA 3FAWA 1I9CB 3MANA 3ZT5A 3DENA 4LF1A 3MSDA 4MDOA 1C8QA 4DM1A 1X97A 1SJDA 4RE2A 1OX4B 5I79A 4DX3A 2X05A 1GOMA 1W9PA 3AZSA 3QYQA 1GKPA 1UOZA 2JFEX 3CM4A 3TVAA 5IRPA 4PUJA 2RJHA 3BAYA 2I16A 3CT2A 1OCNA 1IR2A 2XZ7A 3BAIA 3SY5A 3RG6A 4DBDA 4CGTA 4IT1A 5FSDC 3UWWA 3P5ZA 2NQ5A 4M80A 4W86A 3GBEA 4O53A 4Z42C 1KNWA 3MHFA 4KS0A 4IPPA 4I3GA 3EAUA 3WLIA 3ZXWA 1JL8A 2W6RA 3IUHA 1FCBA 4CU7A 3WQ6A 3M46A 2WMKA 3K8LA 1E56A 1UPMB 4GIAA 3H2AA 2HBVA 2GWNA 1TA3A 3IV3A 3F4DA 2EPLX 1KW1A 4B3ZA 3LBCA 3WJSA 2PZ0A 2J7FA 4ZGYA 4KGJA 4I7UA 1UP2A 2YR1A 1CB2A 2HS8A 3ES8A 1ZHAA 1OGGA 1RR2A 3PZQA 1RV8A 3W7QA 3NQGA 2X09A 4MMWA 2BASA 1OIFA 5A2CA 1DWFM 2ASHA 1IYXA 5TIMA 1MUWA 2XIIA 4MB4A 3NO5A 2FZBA 2VRKA 3HPSA 3FAXA 4PCNA 2BY3A 2G50A 2H3BA 4CQDA 3KLLA 2IQDA 1VQTA 4C7FA 2YDRA 1R8LA 1Z6KA 4XTDA 4UTMA 2V8ZA 3OP2A 2H8XA 1W1A1 4O12A 3S1VA 1NFBA 4AD0A 2VGIA 1UYQA 1EKOA 3TW6A 2BOGX 1A53A 4I9TA 1PEZA 4O16A 4V28A 1R9XA 1L6GA 2YB1A 3M5XA 3LTSA 3T0CA 3CNYA 1I75A 1UH4A 1EC7A 1F3EA 4K6AA 4IP7A 3FXYA 5CZJA 4O0KA 2QVNA 4GH1A 1GG1A 5E0CA 2CLIA 2PWDA 1VKFA 1H7XA 5MKGA 1QHZA 1O4UA 4PEKA 3MMWA 1H4PA 5C5YA 5D9NA 1FWSA 4DXKA 4I5RA 2PBGA 3HQ1A 1FWJC 2GVGA 5ABTA 1PBGA 2NT0A 2V2HA 3UVIA 4QE1A 2BWGA 4XAZA 4YVPA 1XLBA 3KW3A 3DAQA 2IPFA 3UEQA 3LCFA 1MW3A 4S3FA 3A3XA 4KESA 3N6HA 2QUNA 3P14A 3MV01 3TJIA 4IMCA 2PTDA 3FW6A 2G96A 2VTFA 1FHLA 1FWNA 1W17A 4U5IA 2ZZ1A 4K7VA 2VDGA 1MMFA 4NASA 2WHJA 4JR5A 4QSHA 2PEVA 4HGXA 1IEWA 5E0FA 3ONBA 3DKLA 1UPPA 2W91A 2GSJA 1F9CA 4U31A 3OIXA 5FJIA 1UQYA 5I06A 3QGKC 2FHCA 3BGJA 1SVDA 3GNDA 3TR9A 2OKTA 1C8XA 3ZJ7A 4Q8PA 1UCWA 4YPJA 4M51A 9RUBA 2Y1HA 1W32A 3GQYA 4LANA 4BY3A 5LXXA 4AEEA 1S2VA 1TV2A 3G77A 2VX4A 3RXZA 1AH0A 1RVKA 1E0UA 2ZUNA 2CBIA 3AXKA 4LH8A 4RX0A 1W3IA 3TQPA 2ISDA 3C8FA 4J27A 3NYDA 1SR0A 3UZYA 4IX2A 3VGHA 3M43A 1GTHA 1RBOB 4GX8A 1LL6A 1E5NA 5A6JA 1TCMA 3ISIX 4QQUA 1AD1A 1QASA 2YDAA 1ALDA 1N82A 1R86A 2VD9A 3GNXA 4HU4A 4AIBA 4PODA 4MSSA 4TIMA 2J13A 3IK4A 1RUSA 3ZT6A 3ZWSA 1UMLA 5J8LA 3A21A 4GY1A 3GK0A 4TTUA 3R0DA 1A49A 1GZ1A 4R53A 1KCZA 3RMJA 5B80A 1W5MA 1FA2A 4GE8A 2AKZA 5HATA 2GWGA 3D5HA 2FDSA 4GI8A 4HHMA 1F5ZA 1AK5A 2OZ8A 2VQUA 4PSRA 1UH2A 2DPEA 3QZEA 3R13A 4PMUA 3MKKA 4Q8MA 4JTIA 3V18A 2O4QA 1ZAHA 1IZKA 1RQEA 4NY2A 4K7YA 2OOFA 2ZRWA 2AL1A 3CEPA 4MWAB 3RGTA 4Q4MA 3ZT7A 3WH5A 5H8UA 3E9AA 3EWYA 5CPOA 4PTDA 1VENA 4DQWA 4E2DA 2ZZ6A 2XYLA 2ZC1A 3CIVA 2E6AA 4LSBA 3V4BA 3QV7A 1KB3A 3G1YA 4CD8A 4FB7A 3VU2A 5M5DA 3CPUA 5CC6A 2Z7GA 3H23A 2EGZA 5HPOA 1UD3A 2F6XA 1JUKA 2E40A 4WRHA 3E38A 4LS2A 4Q4KA 1XGDA 1JPHA 2HQAA 4YTUA 1BKHA 2GDQA 4MB1A 3EWBX 4NI3A 4LOCA 1KA9F 3U7BA 1RJPA 1PHWA 3ATYA 1XG4A 4MVAA 3U9IA 3MSYA 1FX6A 4WY0A 3WEZA 2GL5A 4ALDA 3NZGA 4YYCA 1WYIA 2VMFA 1CXFA 5T26A 1V0NA 4FIRA 1XDLA 1DWIM 1FKXA 2OKOA 3T0TA 4K2SA 4AD3A 1R85A 1TWIA 3R7MA 5REQB 2VOTA 3L5LA 5C7VA 2E4TA 4PFMA 1J2BA 1C7TA 1W6TA 3CHEA 4IGHA 3WMCA 3WD0A 4S3JA 4O1BA 1XC6A 2G4FA 4ZO9A 3TX9A 4TX6A 3I6RA 3O16A 3WJWA 4WZHA 5HR7A 1Z44A 1I0DA 2QQ6A 3VPLA 3BWWA 3UWQA 4W8AA 4F0KA 1WKYA 4WJEA 3PUGA 3A4JA 4H3DA 3ARZA 4QX4A 1D3CA 3MBDA 1QVBA 3G24A 1BLIA 3KCLA 2VEMA 4PCTA 2J8FA 2WQPA 1OX6A 3EMQA 4FXRA 3LB0A 3AO0A 4L9YA 3U48A 3TA9A 1PKYA 4IPIA 5LIYX 4NZ1A 3RCYA 5L6UA 9XIAA 4EPBC 1YPFA 4NT0A 3CUJA 4ZQNA 3UGRA 2J47A 1J0HA 3NWRA 3RJYA 2O55A 3THAA 3NVTA 3CPGA 1JZ4A 3PB2A 4WEVX 3VTRA 2PGRA 4UB9A 1WCGA 1TUFA 4C6IA 3WDQA 1YNPA 5BROA 1XD0A 3CZLA 1OCJA 2TSYA 4ICNA 2I1OA 2FLIA 4BKNA 4PMDA 4W9TA 4DHGA 3GHSA 4HTYA 3TW7A 3LLDA 2F61A 3LLFA 4HMEA 4DO4A 4ZQRA 1DKWA 3FSUA 3S83A 1GORA 4O17A 3ARVA 4JIQA 4H2CA 3GIYA 3O6CA 3WJXA 3LV6A 1ZAJA 4CCCA 4J3WA 1KM5A 3THUA 4GLEA 3FYOA 3CZKA 3HZ3A 4O1CA 3S1WA 1ONXA 1VFOA 1KQZA 1QCWA 4Z0SA 4IH3A 3E6EA 1K70A 3W7NA 2PDBA 4P7QA 3AXIA 1XLHA 3LCGA 2GQ3A 1KO0A 3GRIA 1PTAA 1HZYA 1JCMP 1KCXA 3Q37A 5HMEA 3IUDA 5AHEA 2HISA 1IEIA 3UCCA 4FOUA 2ZICA 3GXPA 1T40A 2WMIA 1XH0A 3WEMA 2A7NA 4L61A 3IIVA 3L4TA 5FJOA 1MW0A 2ZX8A 1R3QA 3CZ8A 2OGJA 1XIHA 4KWVA 1LWJA 1GVSA 5AVNA 3GS6A 1W1VA 3PBGA 3W38A 4WCJA 2D23A 5AZ1A 2DH2A 5F2MA 2R14A 1HG3A 3KBSA 3DFQA 4P8XA 4ZZ9A 1KFCA 4E3TA 5K4ZA 1DV7A 3ECQA 3W53A 1O5XA 4NAFB 4KH2A 4XZWA 2BODX 4I6VA 4ECLA 4JN8A 3MHUA 1DEDA 3WJYA 3EX3A 5JIWA 1OB0A 1MVYA 1YBQA 2QGYA 1DXEA 1WKEA 3R11A 2PLKA 4CEUC 1FFQA 1J5SA 1FFRA 1JQXA 1XLGA 3AS3A 3INPA 7A3HA 3AXXA 3GDMA 3SRHA 4FF7A 1TMQA 3TYZA 4DJFA 3D46A 4GYFA 2CLOA 5ECVA 1H49A 1NQ6A 1PXGA 4S39A 3TSMA 1E6QM 1ZBCA 2W9MA 4PH6A 2R1MA 1MW2A 2ZXQA 5LGZA 5FF4A 1AJ0A 1TZZA 2VEPA 3STFA 4U2ZA 1JNDA 2TYSA 3LA4A 4ZENA 3MMDA 3WMSA 2G41A 1SSDA 4OTKA 5ABEA 4CNUA 2CWNA 5I03A 4N9BA 4W8LA 3LQLA 4PB3A 1T99A 3DFHA 4X61A 5D37A 3NDYA 1FXQA 2QCEA 1D2KA 4ACZB 2QMJA 1US3A 6XIAA 2OQHA 4EWJA 1PB0A 1AA1B 1AL8A 3HOJA 1TWDA 1MXDA 2JKPA 5D04C 2DVTA 3LQGA 4DVOA 3HG2A 1E3XA 3W23A 4EPKA 3PP7A 2A7RA 4OFCA 3LCLA 1W9XA 1VF8A 3BW3A 5F2IA 3GU9A 3SUVA 4B91A 4MTVA 3W2LA 3GVRA 3W71A 2D22A 4ZA0A 3QKZA 2J78A 3OLGA 2NUYA 5K9CA 5DANA 3VFCA 3FJ4A 1XIBA 3UT0A 3MO4A 2VZVA 4KBXA 4MWAD 5CAKA 3EOSA 4JBRA 1OD0A 3THCA 2NQZA 3W2JA 1HTIA 1TPDA 5KZ6A 3BJFA 1GGOA 4RLIA 1I2PA 5D2XA 5EL1A 2IXUA 3ABZA 5HNRA 1XJBA 3WH7A 3OZPA 8A3HA 3BG5A 1IZJA 2R8WA 3J7HA 1CXLA 3TQKA 2XN0A 3V75A 3O2LA 3RLHA 1MEHA 3U57A 4ATDA 4GCXA 5DXXA 3IK2A 3WLMA 4D9PA 2QR6A 1YW1A 4UNIA 2XIBA 4QS5A 5HMFA 1F6YA 2R6OA 2W79A 4IIEA 1CNVA 1DORA 5C9WA 2NXHA 4JEQA 2F7FA 4Z1BA 5JUVA 3NXFA 1GVIA 4BF7A 1WO2A 1AZ2A 1UWSA 4O4VA 1SYTA 4KEZA 1QUMA 1TMLA 1QNVA 3PBYA 1QBBA 1NWSA 1VCVA 3LG3A 5C2XA 1I60A 2OCZA 4H9XA 5CSUA 2VVSA 2ACQA 3GXDA 3NZ1A 4AZ6A 4Z1YA 1VLIA 1NY1A 2O56A 1TPEA 4ATLA 8RUCA 3WZ0E 2INEA 2IKJA 5D02A 1SR9A 2A0NA 3O7UA 2XN2A 3VD7A 3NEVA 1OZMA 2VQTA 3GUWA 3PJWA 1J4EA 2HJPA 2YA2A 4OVXA 3MP4A 3BAKA 1U83A 4UTFA 2ABAA 3G1DA 1DIOA 5G2HA 2CHNA 2C0HA 2REQB 3W27A 1TWSA 6PTDA 1QU4A 3TYAA 1Z89A 3N2BA 2ISFA 4DB7A 4NP7A 3NEHA 1O6IA 3CJPA 3VC6A 4ADUA 4QROA 1T6MA 2J66A 3A9BA 3ZR5A 4FX7A 1XGZA 4Q8OA 3KOYA 1J18A 2X7VA 1WZKA 1TV4A 3TA6A 3N2CA 1DP0A 3R8GA 4HT3A 3TYUA 3WBEA 1TX0A 2Y62A 1TIMA 2DZAA 2GFTA 3MI2A 3LBMA 3O6DA 3TC6A 4DJDD 2XGBA 3T1GA 5F4WA 1EUAA 1VPXA 1H1ZA 2P3EA 1X98A 1H60A 1XPGA 2EAWA 1P43A 3AIRA 3ZVHB 4PCSA 1KFWA 4QISA 2TMDA 4EF9A 3KP1A 2FH8A 1K6AA 3CHFA 1WXJA 3ZS4A 4RE4A 4AY7A 3P2VA 2ZBTA 5AYBA 3EXSA 3NSNA 1I2RA 4Y9OA 4N9DA 7TAAA 1F74A 3QRHA 3CUIA 1U1UA 1TG7A 1V5XA 1WDDA 4TVUA 3S9YA 4Z2JA 4AXKA 2X1UA 4AD4A 3W28A 1UZ4A 1B54A 1Y5VA 1VBHA 1QHOA 3OOQA 3OPSA 1NFGA 1C7SA 5DLCA 4LTSA 4UTWC 5DN1A 4EXBA 3NUKA 1R38A 5AYZA 2X7WA 3C86A 5C54A 2PWEA 1QW8A 3H2OA 4O1EA 3NM3A 3KTSA 2ODOA 4CN6A 2Y8UA 3KDOA 1K9EA 1P1MA 4C1NB 4TMCA 5TQLA 3BGGA 2F9RA 3N18A 4XD5A 3GFZA 2HPMA 5HNTA 2C1HA 4UFIA 2WM0A 2E0PA 2UY2A 3PNZA 3LY0A 3K46A 2HPIA 4P7LA 2YSWA 3MYOA 1GQNA 4P8UA 2O7QA 3VNIA 3DFTA 2BV9A 3UGVA 4O1AA 1TELA 1JR1A 3UD6A 4XTIA 4HNCA 4DBSA 4HOZA 2BY2A 2G4JA 4L1XA 1O12A 2OWXA 5LKYA 4MUPA 1TQJA 5D4YA 1QI0A 1VYSX 2X0YA 3ZR6A 1VYPX 3RO6A 4FLRA 2Z2BA 2VKZG 3TWBA 1XKJA 2W92A 3GG1A 4LCQA 4XZ9A 1BRLB 1QPKA 1HX0A 5H8PA 3H21A 1E4LA 1XCXA 1XPYA 2Z4GA 4ZB5A 2Q8LA 2XFYA 1W37A 3E5BA 2D0GA 3AMKA 3VINA 5JIPA 2A21A 4GH3A 3B3DA 1CXIA 3S6TA 3SSJA 1U1HA 2YCLA 3WFZA 3W7EA 4IOTA 5AHLA 5AN7A 1OABA 2DSUA 4H6RA 1J10A 3VDAA 5FEWA 3ELFA 1M03A 2ZXDA 1JI1A 1P48A 1V0MA 3NQ8A 4FX6M 3VC5A 1E4MM 1K8ZA 3ZLFA 4UQ9A 5CH9A 3EPMA 4M1BA 4FNSA 1UUMA 3APGA 2ONEA 3W9ZA 3GH7A 1CXHA 3MWCA 2CKRA 3A5FA 3VD5A 4U33A 3OGRA 3W26A 5HA7A 1IWAA 1VBUA 3EXRA 3OG3A 5AYYA 3TIMA 4JX6A 1US0A 3V7PA 7PTDA 4V15A 4HN4A 1M7PA 1W3LA 2FTWA 4NZCA 4CVWA 9XIMA 4LJ3A 4O54A 5CJ5A 4C7GA 4M8UA 3AMDA 3NOYA 1BEUA 4A29A 2ZYFA 4Y8EA 2WSYA 4XD4A 3PZUA 1R7AA 1LWIA 4PUKA 1OFOA 4MJMA 4CQBA 5HR6A 4HPHA 4YTRA 2ESCA 3HPFA 4MY9A 4S3BA 3VCNA 5DT7A 1GZJA 4XKMA 1K9FA 3FGCB 4YU1A 1ZY9A 2YL5A 5B7ZA 3NZPA 1JIBA 1C8VA 4AZIA 3BSGA 2OTDA 1NQKA 1XM3A 4MDPA 1LRQA 4BF9A 1JCLA 4UMCA 4JDYA 5HULA 2HVOA 3QQ0A 3R2GA 3UJ2A 1RBLA 4KIRA 1BYDA 1U5VA 1W0MA 4IQEA 5EYWA 1N2VA 2WLYA 1JPIA 1UBSA 1V3KA 2HNHA 3WLJA 1RVGA 4NUWA 1VRXA 3W1UA 1VB9A 3H53A 1ADSA 1TV7A 1UD2A 4NJKA 5D03A 1GZGA 3B8SA 2J6VA 3AHVA 1NH6A 3CAQA 1Z7AA 1E1CA 1KGUA 1RPKA 3NQVA 1PYFA 4YCPA 3EKGA 1V0KA 3N2XA 4H9TA 1BYCA 1EP3A 1EH9A 2WSRA 4ROPA 2O7SA 2FH6A 3F4VA 3GFXA 4LUSA 3OO2A 3WX7A 2NX1A 4O0QA 3CAWA 4P8WA 5FSEC 4AD5A 3BICA 2B31A 3VZXA 3UJRA 3FDKA 4IG2A 3IEBA 2E8ZA 4S2BA 2MANA 4AZ5A 1Q4WA 2Y5JA 4JYDA 3EA2A 1A5MC 4PR4A 4NJGA 3U2EA 3LX9A 5AC7A 1XS2A 3FX4A 3P60A 1GKQA 4A21A 3MWAA 1DIEA 1Z3NA 4H00A 2W66A 2VZSA 1A5CA 4J35A 2Z28A 3PBUA 1MQQA 3SUTA 3ITLA 2H3DA 3VNMA 4JFTA 3ZJKA 1DYSA 3GO2A 2FB2A 3T4CA 4B5NA 2QPXA 3NAVA 1K4GA 4NYUA 4OU1A 1XUZA 1XQLA 4JOMA 2VX6A 5I23A 1EEPA 1BXCA 4XZIA 5DQPA 4AD1A 4PB5A 5IM51 1RPXA 4F9JA 1UR4A 2JALA 3RJXA 4BWLA 3HA1A 1HO1A 2FGZA 5AY7A 4D8LA 1GVEA 3GG7A 3VABA 1F8IA 2Z2AA 4Z2HA 1WXYA 2PURA 4O13A 1E0XA 5CBJA 3GKAA 1BFNA 5HNNA 1SZRA 4U5KA 1GG0A 1OF6A 2W0UA 4GYPC 5LYRA 2YL8A 3HQNA 4KEUA 5HNUA 1FBAA 3L4VA 1D8CA 1XHGA 3QW3A 2VCBA 3S42A 4US6A 4H8UA 2ZWYA 3F2CA 4QAWA 3GFYA 3G8EA 4F66A 1J0JA 4ZCWA 4RW5A 2Z27A 1QNRA 2CXEA 2FZNA 3G3MA 1UWIA 3SO7A 5EBUA 2VZOA 4Z1CA 4JTEA 4C65A 1DJQA 4A8RA 3PPCA 1LT7A 4RZ4A 3UESA 3PY2A 3M6DA 3ZJ8A 4MYAA 5EMUA 3URQA 1TUXA 5EMYA 3QW4B 4QHRA 3PFRA 1PKNA 3GKFA 4IMGA 4PFHA 4B2DA 2IKIA 3PUEA 4GINA 5K4XA 2CPUA 3ARWA 4AX7A 2CEQA 4M6VA 1T8QA 6REQB 2OLAA 4A3QA 3W1AA 2DZXA 3CUZA 3HGOA 3DHPA 1YDYA 4O19A 4EVZA 2OSXA 1P7TB 4FK9A 1QK2A 3DX5A 1W31A 3D47A 1OQFA 5I3GA 3UWUA 3GU1A 2FYMA 3Q45A 1B9BA