1S2UA

Crystal structure of the d58a phosphoenolpyruvate mutase mutant protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
290
structure length
290
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 110
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2uA00
3B8IA 3EOOA 3MA8A 4HYWA 2E28A 4YJ5A 3QQWA 3KTXA 4JPGA 3OYXA 3KHDA 2DIKA 3EOLA 3T07A 1PKYA 3QZ6A 1OY0A 1ZLPA 2HWGA 1JDEA 2HJPA 3FA4A 4B2DD 1XG4A 3M0KA 4KCTA 2KX9A 1S2WA 2QIWA 4IP7A 1VBGA 3E0WA 3U2ZA 4HYVA 3GQYA 4KRZA 3SRKA 1UJQA 2XZ9A 2WQDA 4YNGA 3LG3A 2V5JA 1KBLA 1O66A 4KCVA 4L80A 4B5WA 3G2GA 3PUGA 1IZCA 1O5QA 1A5UA 3HQNA 1F8IA 4LSBA 4B5XA 2XDFA 3M0JA 1XG3A 3ME3A 4B5TA 1DXEA 1E0TA 1S2VA 3BJFA 4TV6A 3QV7A 3BJTA 3H6OA 3HQPA 4FXJA 3T05A 3IS4A 4MF4A 4KCWA 1A3WA 4L9YA 2VGBA 2VGFA 3FA3A 3QV8A 4IQEA 4B2DA 1ZJHA 3GG8A 4FXFA 3EOEA 2R82A 1M3UA 2BG5A 3P0XA 1DIKA 3I4EA 3LYEA 4KS0A 2VGIA 1PKMA 1T5AA 4L7ZA 1S2UA 1F3XA 2DUAA 1OQFA 3OYZA 4IQDA 1KC7A 4L9ZA 5TAOA 1AQFA 1A49A 4ROQA 1U5VA 2V5KA 2HROA 4QG9A 1SGJA 2HRWA 1F8MA 2OLSA 4QG8A 2VWSA 3SRFA 3R4IA 1O68A 1Z6KA 1F3WA 4QG6A 1A3XA 1PYMA 3T0TA 2X0SA 3E0VA 2VGGA 3VAVA 2G50A 2ZE3A 1U5HA 1GGOA 1M1BA 4KCUA 4B5UA 1F61A 2XZ7A 3SRDA 3QLLA 3QTGA 3QV6A 3SRHA 4QGCA 1PKNA 3PP7A 3QV9A 3E5BA 4DRSA 4G1NA 1DXFA 2VWTA 4TV5A 3HQOA 4MG4A 5JVLA 4B5SA 1IGWA 3N25A 4IMAA 4B5VA 1PKLA 3EZ4A 1VBHA 3OQ8A 4WJ8A 3GR4A 1DQUA 2L5HA 4RPPA 1S2TA 1E0UA 1MUMA
chains in the Genus database with same CATH superfamily
3S2LA 1MSSA 3MS8A 1BXBA 3W2KA 3GDRA 3W7MA 1QU4A 2NT1A 3NDOA 3APTA 1UR2A 1XLIA 5E9AA 4EPBC 3CIXA 1TPUA 1IT8A 5D02A 1ECEA 4HP5A 1XW8A 3TN4A 3BLPX 4YNGA 4K7VA 3PS7A 3WLJA 1RVGA 3PWGA 3IJDA 4H00A 3G22A 3WQPA 4LSBA 3PBVA 3A5FA 3M0JA 2F6UA 3QPZA 4HCHA 3TAOA 5DCDA 3GVWA 1DWGM 2D20A 5G5IA 4AEOA 4CU7A 1NOUA 4MVAA 3W9ZA 4DXKA 1C7TA 4H3DA 4IMFA 2WHMA 4UNIA 3UG8A 4MM1A 3KRBA 4MJMA 5E09A 2QYGA 5DLCA 1SR9A 1TZZA 1XISA 2YXXA 1XRFA 2OR2A 2PZ0A 1U33A 4A3HA 1QWGA 3PBUA 3REQA 1EGMA 2EQDA 2ZX8A 2QGHA 1NFPA 2ZVRA 2NV1A 4DRSA 1EP1A 3PF3A 3ZOAA 1XJBA 2Z26A 3UZ5A 3SSZA 5KTLA 4MJ4A 4HMNA 3IUIA 4WCJA 1RQBA 1T8QA 3G6LA 3LQGA 3T8QA 3SECA 1ITUA 4GZEA 5E0CA 4C5ZA 3QHOA 2E6FA 4QXIA 4C1KA 1DIOA 3NURA 1YDNA 4J4KA 1B3OA 2ALDA 3CV2A 1DORA 1PTAA 2BOEX 4DO7A 1JUKA 4IMEA 1UD2A 1MVYA 3M5XA 2Z1SA 3EA3A 5M5DA 3QSTA 1UH2A 4KGJA 2ADAA 3PY2A 5A8OA 3PN8A 2HVOA 4HJWA 2OKTA 4GFIA 4GUJA 1L0PA 2WKGA 1V8EA 2FQIA 2H3BA 1IHIA 4N7QA 4UR9A 4J3TA 3DEQA 1MXDA 4G7FA 3OLEA 2VVSA 4WRHA 1GQIA 1SMAA 4WVXA 4CQBA 1XIDA 3BLIA 4DWDA 2XVKA 3Q37A 2WMIA 4OECA 2F7FA 4DO5A 2WSYA 1XX1A 4DJEA 1EZ2A 1JCMP 1YYAA 2VGGA 1VPXA 1AVAA 5DMYA 3BTNA 1ISYA 2GGEA 2P5NA 3MI2A 4GIRA 1P0DA 4KWOA 2PGRA 3G5EA 2PWFA 2J47A 3DYMA 1TB3A 3S83A 1E0VA 4G1KA 3BXWA 2FB2A 1K3UA 3CJPA 2YGYA 4H01A 1TA3B 1CTNA 3STFA 5M3WA 2WMGA 5DCBA 2GJPA 2ZUWA 1OC5A 4R9OA 3M0ZA 4FO4A 1A5NC 4PRRA 4F0MA 2X0YA 4XTDA 1R87A 1SJBA 2P1FA 5FF4A 3GH4A 3KS5A 2Y0FA 1WXYA 4V27A 1QHZA 4N02A 3S2CA 1CDGA 2FHBA 4DBEA 4M19A 5JMUA 1QPNA 3KVKA 1O94A 3B9EA 4NI3A 3GLCA 3NQDA 1KGUA 3ITGA 4FF7A 3O6CA 4GLEA 3TQPA 1TFVA 5BU9A 4AY8A 3EX2A 4EKJA 1X6LA 2IPGA 2HE5A 1KQZA 3EXRA 3O9NA 1OM0A 3EX1A 2A7RA 4H9UA 4IX0A 2YA0A 1RLDA 2ZZ7A 2YW3A 4CD5A 3M5YA 5HANA 1UBSA 2Y6ZA 4ZMGA 2QCCA 3P62A 3URNA 2I14A 5FJJA 4R85A 3W2JA 1HKWA 2J9ZA 5ABGA 4WF7A 5JBFA 1MXGA 2EXOA 2Z7GA 3B40A 3ZWSA 2ACUA 3QQ0A 3HG3A 4LS2A 3QZAA 4Q4PA 4ZBCA 3NSXA 3L2MA 3MCOA 3PZOA 1H61A 2YPIA 1TWDA 2CIPA 3KAOA 3BAWA 1DE5A 3WK0A 1E6ZA 3N17A 1VYRA 2ZZ2A 3N73A 4GX9A 3P14A 4GCAA 1R7AA 4E2VA 4M8UA 3ZT7A 3O05A 4IXXA 1UR0A 2ZRWA 1BYDA 4J3UA 2KAUC 2QIWA 4JKMA 1ZZMA 5CXPA 1UWAA 1XI3A 1Z8AA 3OOQA 4ICMA 2X7WA 3IPWA 2VRQA 2QVNA 1J18A 3IGHX 4TUFA 1EDGA 3EOUA 2BDQA 1LP6A 1XKJA 3VKKA 1T41A 4NZFA 1BFNA 3LMZA 2D0HA 1VQTA 4BQ5A 3AMKA 4WY0F 1GJPA 5CGQA 1JYXA 1KWKA 1KM2A 4JHOA 4L7ZA 3O2LA 2J9XA 2Z1BA 4C91A 2OLAA 3S1VA 3H7RA 4RX0A 4FHAA 4IJBA 3R94A 4E6MA 1YNQA 3MYPA 3Q4DA 2ZDSA 3W87A 1RJPA 4BR1A 4D6IA 1GYNA 2QVHA 4G8TA 4OWGA 1ESWA 3ZSSA 1FDJA 1EJ7L 1JPDX 4Q32A 1LQ2A 1E6PA 3QV9A 1R7OA 2HE8A 2Y7DA 3EX6A 1FH9A 1FY6A 1GOMA 2R24A 3S0CA 1KBBA 2ZDRA 4PODA 4YMZA 4WXZA 4GG9A 2HSAA 4CU8A 3OLDA 1BRLA 5E1QA 4PTVA 2POTA 3NPVA 4QTGA 3MSGA 2B7NA 2YBVA 4GXWA 5A1AA 3S2JA 4EK7A 2AKMA 1AMYA 1Y5WA 2YDAA 1LOSA 2Y70A 3SCSA 4LUSA 4Q8TA 3SY8A 3L5MA 1MW3A 3V18A 1UW9A 2UV8G 1OGBA 1K9FA 1PXGA 1HTIA 2PTXA 4AWTA 4J3ZA 2WZMA 4LH8A 3LRLA 4W88A 4JQ1A 3V0SA 5C6MA 3WNOA 3F5LA 4CCCA 2GSEA 2J7BA 3M0YA 2VEGA 3STEA 5D9MA 1D3HA 3WLKX 3W53A 1ELSA 3IJ6A 4NRSA 3SN0A 4U5IA 3BLDA 3N2TA 3I7SA 3SIZA 3QFWA 1W1ZA 1H63A 4PL1A 1CGTA 1GVQA 2G96A 4XO6A 4QLJA 1KW1A 3MMUA 5E0FA 3S9IA 6TAAA 1LJYA 5H8UA 1UZHA 3GDKA 4IT1A 3QTPA 5E6YA 4C6NA 1QPRA 2J78A 5DCEA 3BOLA 4HOXA 4HK5A 3AUOA 4O1CA 1QOXA 2OSYA 3WEMA 3CYVA 3K8MA 3WQGA 5CLTA 2PF8A 4YTUA 2E25A 3CHVA 3W0KA 5BXTA 3OYXA 4N0RA 1REQB 2AAMA 1FHUA 3NGJA 2C91A 2P88A 4C6LA 5AHEA 1BXCA 1TPVA 4I7WA 2O92A 3M43A 1ICSA 2H90A 2H9AB 3JZUA 1N2VA 4JIHA 3EPOA 3WLQA 5U7SA 3NQCA 1EOKA 3TC6A 5I23A 5DQPA 3B3DA 3R6IA 2O56A 2ZX7A 2WSRA 3PTQA 2Z1XA 3O15A 4U33A 2DSZA 3Q67A 1Q2SA 2WMKA 4I9TA 1AD4A 4NZJA 1V0KA 4H04A 4HOWA 3GDTA 1TR9A 2P0OA 3HGRA 2W0UA 1PV8A 1WO2A 1ME7A 2PPGA 3HQPA 4P8XA 3GK0A 5EPDA 5GQBA 4RDVA 3UXDA 3H4XA 2R94A 1DJGA 4TX9A 2Y61A 3RO6A 1CGYA 4PTMA 1W1YA 4BF7A 1QI2A 1XS2A 4PSRA 1W3NA 3BCDA 1WBHA 3VD4A 3CUGA 4PFHA 3H12A 4YS1A 2OX4A 4A3QA 5MF5A 4WY0A 3VDAA 4AZ6A 1HG3A 4GY1A 3WLOA 4GQ0A 3SCPA 3VC5A 5C2CA 3BUVA 4NASA 3WEOA 2JALA 5GJPA 4PRWA 5D03A 4Q8NA 3NUKA 1DHPA 1HGYA 1LLOA 2V6AA 4MWAC 3OZMA 2GJXA 5DXYA 4GQQA 2ZRYA 3CEPA 4JBRA 3WUBA 5CBIA 1L8NA 3HG4A 1XFCA 2RAGA 4WKAA 2WCSA 3OVPA 4UZUA 1XH2A 4UTWC 3VIFA 1OF8A 1I1XA 1ZBVA 3AJ7A 2EPOA 1BLIA 2HISA 4W87A 3GNXA 5JUVA 1OADA 1R5YA 4H9VA 4WDXA 1Q5MA 5I3KA 3I7QA 3BSMA 1KCZA 4NHVA 4CQAA 2BTMA 3MMTA 2XVPA 4BI7A 2OSXA 3UCCA 3PBGA 1HKKA 5HNUA 2PCQA 1QHPA 5C54A 3BICA 2OYMA 3ITCA 2PBGA 3PZIA 3GNDA 1FWGC 5XIMA 2QMKA 3SUUA 1F5ZA 5AECA 1NF0A 2V3DA 1PPIA 4A35A 3WBYA 1LYXA 4W9TA 1U5VA 3AMLA 4LVAA 4H9MA 3B8WA 1SGJA 1N8IA 3UWUA 1Z44A 2J9YA 1GOQA 3D5HA 1POKA 4MKSA 2X7VA 1SW3A 3LCLA 2PP0A 3UR5A 1CXKA 1IWBA 4D6FA 1PYFA 3AXKA 4RL3A 4UC5A 2TYSA 1IIGA 3W7DA 2G3FA 4LYQA 2FYMA 3QFEA 4PC8A 2PRLA 2YDSA 4YYFA 2GK1B 3V0UA 4JTAA 3B06A 4N9DA 2DT3A 2GDUA 3T42A 1Q7QA 6ENLA 3TE9A 5JIPA 2YFNA 1QXLA 3GVVA 1PB0A 2NWRA 4CU6A 3FYPA 2NXIA 4PZVA 3EMCA 3VUSA 1VFUA 4LYRA 1KBLA 1QAPA 4F8XA 1SM9A 3PR2A 3UZYA 5GNXA 1KB3A 1ZPTA 4UTIA 2WO5A 4XKYB 1P1XA 2OJPA 2WVSA 5HNNA 1Q66A 3LCHA 2FIQA 3W7EA 1LUCB 2XM2A 3NXFA 3OU8A 3QY7A 5CZTA 3W7KA 3ARZA 4YCPA 2GGJA 2G41A 4JTQA 1P0KA 1FQ0A 2OKOA 4ERAA 1E55A 2FFCA 3RO8A 1TRIA 2C71A 3R43A 4ATWA 6XIAA 3I7RA 4RPQA 3AXIA 2E9MA 3WH8A 1EB3A 2QS8A 1E1CB 3CUFA 1EWDA 1ONWA 2YBUA 3BCJA 2BVWA 2ZIDA 5E93A 1F61A 4MFDA 3VNJA 1NFGA 2XJ7A 3VD7A 5HMSA 2OYLA 5TBOA 1T40A 1TPB1 2WKLA 4OQVA 1VGAA 2OEMA 4JTCA 4HMDA 4U5KA 1KLYA 3T0DA 4UR7A 1FXQA 2YYUA 4AYGA 4MGGA 2Z2UA 4FNRA 1Y7VA 1KNWA 1NSJA 3GKFA 2RJGA 1WDQA 4XZWA 4X2PA 4EPKA 3ZJKA 1R9YA 5AN7A 1AZ1A 3CQ0A 3N13A 2BVYA 2DGAA 3WJWA 3BMWA 4UTTA 1KCXA 3N14A 2X8RA 4QHRA 3ORWA 1MFVA 3NQEA 2QJNA 5PTDA 5A94A 1E3ZA 3KXQA 1DL3A 3B4UA 1RPXA 3AHTA 4MADA 1O1HA 2GPTA 2VYOA 5I3JA 3ZO9A 1F05A 3O1NA 1RAKA 5AYZA 3W84A 2BP1A 4OZOA 3Q58A 3WD0A 3EB3A 2Z1WA 3NQFA 4CQ8A 5D37A 2VM8A 3TA9A 3W37A 3AISA 4TXEA 4DJEC 4O13A 3S1WA 3IIZA 2FVKA 3ECQA 1EXBA 1TA3A 2A3AA 1HUVA 5HAOA 5DN1A 4JTSA 2FB3A 1CENA 3U2OA 4IICA 1VR6A 3OHMB 3N2OA 5I3DA 1XLBA 4DJDA 4NJJA 3A3HA 2QAFA 4JTKA 3QR3A 3L67A 3W1AA 1G7UA 5T26A 4HHMA 1UCWA 2EG6A 3NQ8A 1AODA 3WK3A 3W1TA 4L4MA 5DMMA 1VENA 4JIPA 3VE7A 5G2HA 1OABA 2QV4A 3A13A 4C6BA 2WJDA 1JDCA 1ADOA 1EJVC 5A6SA 4GUIA 4MLRA 4GD0A 1CGWA 1MW1A 1UP2A 3UWQA 4DZHA 1VC4A 4GVHA 4QAWA 3U8GA 1BPLB 4AX6A 1HX0A 1SZEA 3NXLA 4S2BA 4D6JA 2XZ9A 5HJLA 3B8UA 5C2GA 1XIJA 3HU7A 1K9TA 2RDWA 1JXKA 4GKLA 1VBJA 4I8YA 4C6KA 4EWJA 4B16A 1KXTA 1R6WA 3LLDA 4LXFA 2IKGA 2Q8LA 3GTFA 1UWQA 4ZB5A 3IIOA 4GYJA 4NG3A 3VDCA 3NZRA 4FLRA 3W7JA 2XYLA 2VZTA 1KGWA 1V3LA 3KBJA 4GQBA 1JDFA 1NVMA 2J27A 3BARA 4RE3A 3ZVHB 1H49A 3JVAA 1MRQA 1VJZA 2QT3A 2AAAA 5EB8A 5K4XA 1V08A 2Q01A 4C6FA 4GIYA 2V82A 3OG2A 2J77A 2E5BA 1A47A 4I9AA 3WQ6A 4ERIA 4IMGA 3AZSA 3ITYA 1XYZA 1XCFA 4GFSA 4WJ8A 1O95A 1M7JA 1WXZA 1LG2A 1QW9A 3ABQA 1FH8A 1H60A 2Y89A 1QBBA 4K6AA 1UWIA 4NAFB 3LNMA 4P7RA 1RBLA 3SGGA 3MV01 4Q8OA 3BE7A 1FCVA 2VP8A 4ILSA 1XXXA 3VU2A 1C8YA 4Z1AA 2ZKMX 1LRNA 1AJ2A 2D3LA 3HGSA 3CUHA 5IFTA 3W7LA 3TYAA 4DAIA 4AMCA 3BG5A 2G0WA 2QXWA 1M68A 1JVNA 2V3EA 1NQKA 5D32A 3OIXA 1KM4A 4LUYA 3AS2A 5G1YA 2O0TA 1H7PA 4DLFA 1MEWA 4CCEA 3B05A 3DG7A 5CPNA 1W5PA 1BEUA 3IJIA 5EYWA 4GINA 3U57A 1LQ0A 5REQB 5HXMA 4J9JA 2CBIA 2WW5A 2CHRA 1CGXA 1WUFA 2VQTA 5H6HA 4MKVA 4OIFA 5G2IA 1TJ0A 2J7CA 5C7HA 3H2CA 1K1DA 1QO5A 3UERA 3E5BA 4PSPA 4C5YA 2IMRA 4ZA0A 4I7UA 1PTDA 1A50A 2Y63A 2PDUA 1NWUA 3IIVA 2Q3RA 1HJWA 3KOFA 4HSOA 2IXVA 2OWWA 1FWNA 1Z41A 2GJLA 3SB0A 3AU6A 2X41A 4HZ6A 1V6XA 4B2DD 4AUBA 1M01A 1VBGA 4QM1A 2EHHA 1LLZA 1E6SM 4XVEA 2DZBA 1SR0A 3H54A 1G94A 3NPXA 1BF2A 4GOAA 4RNIA 3QGKC 4NYUA 2WZIA 2HMCA 2ZBTA 2R1PA 1V3HA 3EAUA 2X1RA 3UFYA 2WYSA 4LBUA 1EHAA 1XFBA 1C93A 1QVBA 3CHFA 4HHLA 4BWLC 4G2DA 4GNJA 2PWVA 2XFFA 2INZA 4PTNA 4QJ5B 1ZTVA 5FESA 3AROA 3PZUA 1GZGA 3VKAA 1FKXA 2WJEA 2OLHA 1EA9C 4H1ZA 1REQA 5HQMA 1TKKA 4LAKA 3H2EA 1HL8A 5FJIA 1SVDA 2H9AA 1VHNA 4GHRA 4LEQA 2QULA 4HA3A 4WOZA 1PHQA 4TR9A 1GW9A 4F2TA 3PWIA 3THCA 4XG1A 4XBJA 5AZ0A 5JVLA 3LPFA 4MKNA 3T44A 3SAZA 4BCEA 4CNPA 3A22A 1KM3A 3F5JA 4RDZA 3UYCA 5A2CA 1DQUA 4U31A 3NR0A 4GH3A 1XDJA 5AC4A 5CPOA 1UD5A 4MNLA 1QUMA 1OFBA 3ITVA 1J79A 2ZUUA 3PPFA 2NV9A 3AMDA 3ALFA 1QBAA 3PBMA 1WDDA 4IOTA 1B57A 2A7PA 3HPZA 2BHUA 3RR4A 3MBFA 4DUOA 4DZAA 4FNTA 1X97A 4GVFA 4UQBA 4TIMA 2FTWA 4LAMA 2Z0IA 5K7JA 1AG1O 1HW6A 4LAZA 5A6BD 1RK5A 1FKWA 3LXAA 1G7VA 2E5CA 3TLQA 2DORA 3WNKA 4Z2KA 4ZFCA 3MY9A 3QGVA 1YEYA 2ZZ4A 4DYEA 2Y8UA 2X1UA 3KE0A 1TMQA 4S23A 5FEXA 3GR7A 3H2MA 4PB4A 3OVGA 4ZOAA 2XFWA 2CKSA 2D2JA 5LIYX 3KCOA 3R25A 1K9EA 2E4TA 3N6HA 4M24A 1OF6A 2E6AA 4C1NB 4REQB 1O6IA 4UB9A 3GNOA 3V0TA 2RHGA 5I00A 4MZ8A 3CZJA 5HDRA 3TJLA 4GUFA 3WZ0E 4S3AA 5T9BG 3KHJA 4D1IA 1EA0A 1KCKA 4HNVA 3A47A 2AMXA 2NVAA 3P93A 4XAZA 1DJXA 4D6HA 4P8UA 1CB2A 4RJEA 1VJSA 4O8AA 3UPBA 1X96A 3EKGA 5AHFA 5DMLA 2Z7KA 4WZHA 2DSWA 3C5QA 1HP4A 2HJPA 4EPEC 3L0GA 2HK1A 3PBWA 1EL3A 2VC6A 5I77A 3N4FA 1J0JA 5FOOA 1OD8A 1B4KA 4ROPA 4QITA 3GXIA 3MI3A 4KEZA 5FJTA 2YX0A 1AH3A 3PC0A 1EGZA 9CGTA 5LXXA 3LRMA 2Z29A 4US5D 3S47A 2DZWA 4IISA 1M65A 1AJ0A 1I9CB 1RLCL 3WFAA 1UWSA 4D2JA 4MB4A 2OCZA 4CEUC 4MF4A 1BG9A 4C7DA 1A5CA 2H8XA 1FCUA 3DFPA 1HJUA 3BLFA 4N2YA 3ARWA 3PB2A 1OEPA 1EDQA 3GDBA 3WY1A 1V3MA 2G3IA 3HPSA 1OT1A 2BXVA 2GK1A 2Z00A 1E51A 2V2CA 3C0QA 5BW6A 1PTGA 2CLHA 1OCQA 3PNUA 1S1RA 3RRAA 2WCGA 4QX4A 1G1YA 2VC9A 3VINA 1D8CA 3STGA 4AVNA 3DXIA 5HJXA 3ONBA 3GH7A 2E40A 5I79A 3POCA 3AICA 1JI1A 1FX6A 1K8CA 2GOKA 2D24A 2VKZG 3NZQA 5C71A 1X7FA 3U48A 5AHLA 2WCAA 4ADTA 5BXRA 2FJUB 4AAJA 4EE9A 5E5CA 1XBZA 5DELA 3MU7A 4HHHA 4AHOA 4ZR8A 1U5JA 1LWHA 3PFRA 2HBXA 4Z17A 1GVYA 2F9RA 1SQ7A 2PD5A 3NCOA 2G4FA 2VJXA 5M17A 1E1CA 1SSGA 1QTWA 2IPFA 5A69A 3W2UA 2NSXA 2PWGA 4JY8A 1Q6LA 3QC0A 1XH1A 4GKTA 3DHDA 4HNUA 1F3EA 3EDJA 1U30A 3XIMA 1M7PA 1WA3A 1KA9F 2ZRUA 1MEHA 3PTMA 3TSBA 4Y7EA 4W8AA 1XYFA 1VF8A 4JGDA 4JDYA 2PTDA 3VMOA 4OE7A 5D30A 1RCQA 3UVAA 1AZ2A 1Y8BA 3HPXA 1XLDA 1Y5VA 2F38A 2YFOA 3Q94A 2VURA 3SR7A 1EP3A 3RN6A 1DIEA 1AD1A 2YLLA 2RDUA 3W7NA 4BK9A 4N42A 4ZFMA 4O52A 1O12A 1H1NA 3W07A 4JQ2A 3UXAA 3LB0A 3RMJA 3GW3A 2VUNA 1FDZA 4RNHA 5CSSA 1A5KC 4HMEA 3CL8A 4PGLA 2VUYA 1N8WA 3DC8A 3WFLA 1JGMA 4NI8A 3G0UA 2FTYA 3RGTA 1SFTA 3PSVA 1KRBC 1PDZA 3LCIA 2VR2A 3GNRA 3CUIA 4AZBA 3CYJA 3TN6A 4QJ1A 2V0TA 1DWFM 4GUHA 8XIAA 1QPKA 1P6WA 3BG3A 5DT5A 4O12A 4ACYA 2AOSA 3ZFHA 3DH7A 3DN5A 1K70A 4HTYA 5CBJA 5CBBA 2X16A 3KWXA 3SJ3A 3LHTA 1IT7A 1AQFA 3WUFA 4KBXA 1J5TA 4QS5A 1C8QA 4D8AA 2X40A 1JUBA 3LBOA 4XBSA 3P8JA 3WQOA 4E8CA 2XN1A 3TSDA 2AL1A 3UA3A 1F4HA 4W4QA 3RJXA 1KM1A 1JZ7A 4IJCA 4KCWA 3VOHA 2CZEA 4C60A 1MXSA 1IEQA 4ZSTA 3NL3A 1ZB5A 3B04A 1ZHAA 2PDBA 4HKPA 4M6QA 4QSFA 4DBUA 5I2UA 1SU5A 1PO9A 3V5FA 2ZRXA 5JBDA 3QY8A 1C9WA 3GM8A 5E9XA 1W1A1 2VRKA 2VEIA 1F76A 3LI1A 3UPWA 3ZVHA 2FGLA 5AC8A 4URIA 1RA5A 1W9UA 1SFLA 1RVKA 1W31A 3OZYA 3TX9A 1LF1A 4WQ6A 1XSKA 2Y1HA 3K4WA 4WSHA 3CK5A 4IPLA 3P0WA 1LQAA 3BAXA 4M6UA 2XSBA 3KOXA 1P1MA 4KIEA 3L68A 1Q2RA 2VEPA 4NYYA 1R47A 2J7EA 2VFIA 5KINA 3LEPA 1NWTA 4GISA 4UR8A 3EX4A 4E8DA 1O60A 1XBXA 3GUGA 1RBAA 5BROA 3ZT6A 3VE9A 3GH5A 3W6YA 4QLKA 3V5CA 2X1SA 1OIMA 4QDWA 1YE6A 3FJLA 1TELA 5H1WA 3KCJA 4EPDC 1Q6DA 3BL3A 1ME9A 2PRHA 1W9VA 4DM1A 1UH4A 3TXVA 1YMYA 3EA2A 2YL8A 1R3VA 2GVYA 3W72A 1E72M 3E12A 1S39A 3SDOA 2C15A 3KZPA 1H3GA 4E3VA 5GJNA 5FJUA 2ACQA 3N4EA 1VFOA 2VEMA 3K1DA 1I4NA 3OLGA 4NXSA 3NQMA 1QW8A 4GH1A 1GKRA 1W91A 3WDRA 5F1UA 1JQVA 1AQHA 1TPWA 1UKPA 5F4XA 5ECUA 5REQA 3CS2A 4F2UA 2QCFA 4GPNA 4M6VA 2BX7A 2A3EA 2WWCA 4ATLA 4YVVA 5IOBA 4XD6A 1GKQA 3FCPA 2EG7A 1KXVA 1A3WA 2PDHA 3KP1A 2IKHA 4IQEA 3NQVA 4UNKA 4DNMA 3VGGA 5K4ZA 3SFWA 2OQHA 2RGMA 1OK6A 3QR0A 3OYZA 3RF9A 1TE1A 2H8ZA 1JFXA 1UB3A 4OBTA 2EKCA 2QMJA 4HU8A 1F3WA 4QLLA 4I6VA 3G1AA 4Q8QA 4X22A 4IIBA 4ZE4A 4RKAA 1VLIA 1ONEA 1V4YA 5B7YA 5FF0A 4K8EA 1G0CA 3BV7A 1SW0A 4H6QA 4ZOCA 3W26A 2R91A 3MI6A 1JPKA 4XVDA 1CGUA 3LRKA 4P7NA 5IFPA 3BLKA 4F9JA 3RCMA 1GG1A 4Z2JA 3W22A 1BWLA 3UR2A 1CXLA 3QQWA 2DSKA 2W66A 1XKYA 3GR8A 3VNMA 2WANA 1J6OA 4WJEA 3KLKA 2NWSA 3V36A 1HKMA 4HMCA 4XAGA 1EFZA 1DTUA 2WHJA 1B54A 2ZZ5A 1HQTA 2EPKX 4L1XA 3I6TA 1GPWA 2IPJA 3TJIA 5EL1A 2Z1KA 1KXQA 4ZENA 3F03K 2PDGA 4PMXA 1WDRA 1W32A 3LUTA 4ENLA 4MZYA 4ZO7A 4RZBA 1O5KA 3APGA 5AY7A 4KS0A 5I78A 3ARVA 1AQMA 4L61A 1VFMA 1JUEA 1LT7A 2OG9A 3VDHA 3BW4A 4XX6A 1XUZA 1A3HA 2YJQA 3MSRA 4KETA 3S2NA 3LSCA 3PJTA 1FHVA 4PMQA 3GXFA 1GONA 5F7UA 2PBOA 3W23A 3OBKA 1YRRA 4EWND 2EAWA 1I45A 4FLSA 1IXOA 4UMBA 4W7UA 1V93A 5BOFA 4INFA 1TIWA 1EQCA 1US2A 2VWTA 1VD6A 3CMGA 3PUEA 1WX0A 4I7VA 3W1NA 3WUGA 2JKPA 4JTLA 1EC7A 3CB3A 1UJPA 1ZALA 1DOSA 3D0CA 4ZL1A 3GYCA 3VI2A 3NM1A 2ZRZA 4I5XA 2O9TA 3VM7A 3AHZA 3OVQA 2DP3A 3KDNA 3DCPA 3I6RA 3AHYA 4EXBA 5FSEC 2BXZA 3M5VA 3M0HA 4M5PA 4DX3A 4G6CA 1YBQB 1AK5A 1YNYA 2WJZA 1GG0A 4CNUA 3FW6A 3VDBA 2ZVIA 2WLZA 1SW7A 3PG9A 4ZTYA 2A3CA 4MHBA 5I0DA 4REQA 1TV2A 4EOUA 1FP8A 3S5YA 2OYKA 4I3GA 1PCWA 3ARXA 2B7QA 1W37A 3TR2A 2G37A 2J7DA 3U9IA 4CN6A 3GBDA 3KUMA 2RKXA 4U2YA 4ML9A 2QDHA 1UMYA 1CXHA 1GZJA 4LCQA 1E5JA 5B80A 3M1ZA 4FNQA 5CZJA 2PWEA 3AJXA 3SRFA 5BMXA 4WD0A 4PBGA 1TQXA 1I0DA 3TJ4A 1J96A 1G69A 1Z32X 4DNHA 2PEVA 1DJHA 3KOYA 5DMNA 3RIKA 2G3MA 1UG6A 2WHLA 1NDWA 1CNVA 2WNWA 3L0KA 3LV6A 4FX6M 3ITOA 3WDPP 2VENA 1GK8A 3Q45A 4WLCA 3EOOA 4PMOA 4MYAA 2FLIA 1XSIA 3S5OA 4Q4SA 1IE7C 2HCVA 2WPBA 2GVGA 3N9RA 2ZFAA 4IPNB 4KPLA 1AMKA 1O5RA 3VMNA 1BVNP 4IIGA 4E2DA 1VCFA 1JF5A 2DZVA 3PTKA 4XUYA 5E6ZA 3AHVA 5FF3A 5F2LA 3CUXA 4B90A 3BH4A 1GTEA 3ZLHA 3AS1A 4NX5A 1TVPA 1W3IA 2YCLB 3ME3A 3TIMA 3C2YA 3N4AA 3WLHA 4D1JA 1R3SA 3GTHA 1VIWA 3VVGA 3KVJA 3RM8A 1IZKA 2AL2B 3STCA 3WFZA 1PZ0A 5HOSA 3WMSA 1V02A 3CQKA 2V30A 1XLJA 3SM0A 5D04C 1J0ZA 1F3XA 1HO1A 4GO8A 2XIMA 2VHLA 4AZGA 2RH9A 3MUAA 4F0SA 1XV8A 1JYVA 2TPSA 5G4EA 3TLLA 3A64A 4LBSA 5DBTA 3CU2A 1US3A 5BCAA 1DWHM 4AQLA 5CG7A 3WJXA 1P43A 2Y8VA 2FTPA 3WQEA 4RW5A 4AC1X 4GABA 1TR1A 2V5DA 1R3YA 3F5KA 4TV5A 5LIXX 1N55A 1WKFA 4HQVA 4FNSA 1TZ9A 3UBPC 3QQ1A 3N19B 4GCXA 4A3RA 3SCOA 4F9DA 1OC7A 1PJ9A 4WDWA 1D3GA 3NQ7A 4YWSA 1M41A 1XGEA 4GVIA 2TRSA 2WQPA 4Q8VA 5A8QA 4JIRA 3FYYA 3WL1A 2P8CA 2QDEA 4KH2A 1JFHA 3H2FA 3ZSTA 2DZTA 3P61A 1SSDA 3LG3A 3HMJG 2ZXQA 4V28A 4ZO9A 4Z0JA 3PFMA 2WZHA 1ML1A 4PYSA 5TF0A 4O18A 3CL6A 1HN1A 3QEZA 4B3LA 1S1PA 3GFYA 3AIEA 4XAFA 1IEWA 1RY8A 4LY4A 4LV9A 1FBAA 4ADSA 1V77A 1KRAC 3L4XA 3GC5A 5XINA 3QMRA 5M1TA 3G1VA 3NO1A 3C2RA 1XYMA 1FWWA 2V9DA 5CCZA 2VGBA 4FXRA 1V6VA 3MMDA 1DIKA 3NPUA 4JFUA 2J8GA 1PWMA 3SCUA 4WGXA 3RX3A 2DUAA 4JKLA 5MHBA 1KM0A 3PB0A 1JCTA 5F1VA 5D05A 2WNNA 1JCYA 2QR6A 1R2SA 3R79A 4ZSUA 1EXPA 4YTSA 3H4GA 4AZ7A 3GVQA 2PS2A 3UR7A 4N6FA 4QGCA 2C14A 4B3KA 1PE1A 3MTWA 3QOMA 3BCFA 1CXIA 3VOGA 1TMHA 3MB9A 3KTSA 4XTIA 4D6EA 2NX9A 1PUDA 3HTWA 1E1EA 2L5HA 1FWRA 2BFGA 5EBUA 1CX9A 3VIPA 1BGAA 4O0ZA 4H6EA 3VKDA 1VFHA 5HNRA 3VD5A 6TIMA 1YQ2A 1PBGA 4JEQA 3UT0A 1WDPA 1KM6A 3EB2A 1IEXA 4LTSA 1TE6A 2CC0A 4GWEA 1L9WA 5B7ZA 3WL0A 2GWNA 1FWJC 1IWPA 3LLFA 2EBNA 3I68A 1KV5A 4PCPA 3VZZA 3B9NA 3EXTA 4GIEA 2BY3A 3LPOA 2Z27A 1EUAA 1WDWA 3VGEA 3TYEA 1ZP3A 1K02A 4NZ4A 3V16A 3AWNA 2CLKA 1ZS2A 4JR5A 1W1VA 2VZOA 3A6OA 1OCNA 4IQDA 2FGBA 1OCJA 3UGRA 1V6TA 3H24A 4LANA 3L0NA 1E71M 1TWWA 4ADUA 3KBSA 2PRMA 6XIMA 3ISIX 4NZ1A 3AI0A 4O54A 4A3YA 3HN3A 1XHGA 4O1EA 3VIOA 1H7RA 1F7BA 3L21A 3DESA 1WP6A 2VD8A 2Y7FA 3TK7A 2V69A 2R1KA 2OO6A 3AYVA 3W1UA 4DUXA 3B0VC 1VYSX 1Z7AA 5A6BA 2E6YA 3R13A 3PG8A 3TFCA 3HV8A 1K6WA 3V5OA 4DELA 4PH6A 3W7IA 2F6KA 1LRQA 2VRJA 3OGVA 4OUIA 1F6KA 1EC8A 4X60A 5A8PA 4F4RA 3DYPA 4PB3A 1XIFA 3FA4A 2NX3A 5LA2A 1HKJA 4PUEA 3EKLA 3H22A 5FACA 2YDRA 4Y8EA 2OGYA 3NSMA 4L6HA 1UJQA 3SI9A 3V75A 3F2DA 4K36A 4AEEA 4BI6A 5GNZA 1AH4A 4HHPA 2AGTA 4PE8A 4UBPC 3H2AA 1S5MA 2QUVA 4KT2A 1ZNNA 1MQRA 2A79A 3OW1A 2YYTA 1H0IA 4UTUA 3O3RA 3KWSA 1OG6A 1WUEA 3LQLA 4Q6XA 4WK9A 3FSUA 1EF3A 2OB3A 1BSLA 1JNEA 5ABEA 3TN3A 4J1OA 1W9DM 2V5LA 1A49A 3WLIA 4NSBA 3PAOA 4IFRA 2VMFA 3K5XA 4MUZA 1O68A 3PTDA 1TCDA 3E2SA 1EX5A 2QCNA 2QJIA 3TTQA 1TJRA 2C1HA 1VEMA 4WGHA 3P3BA 2P8BA 1XR2A 4KEMA 2YR1A 1HL9A 1K7EA 3S6DA 1K9DA 1DJIA 2BODX 3CUZA 4JCMA 4B5SA 1B3ZA 4J27A 2JKEA 2W79A 4US5A 4J3VA 4CN4A 4XZ9A 1UD8A 1W1IE 2GYIA 2KZHA 4AD2A 4DAFA 3M4HA 4GGBA 4RZ4A 3W86A 3T08A 5D09A 4P7LA 2JK2A 2I1OA 4LRTA 5A6MA 2NXGA 3CIWA 4Q3MA 1XGDA 3G3DA 4Q4OA 2YKKA 3WQ4A 3W6MA 1PIGA 2WVUA 3IGSA 1V5XA 5HPOA 4F2BA 3H2NA 4MYXA 1QK0A 4AW7A 3ELFA 2OTDA 3C4UA 3SGZA 2D22A 4L80A 2XWEA 4DM2A 3SJNA 1F6PA 2PDWA 4LY8A 1VZWA 4FOJA 3TUUA 5FAJA 3WK2A 1W9PA 1JZ3A 4PN2A 3H6OA 3W7RA 3P81A 3S2MA 2PD9A 3CWOX 1BHGA 4FP1A 1ZJHA 2PA6A 1XIIA 4HU4A 1X6NA 2Z28A 1W1B1 3HM7A 4B5NA 2A0NA 2PTZA 3PZVA 5TAOA 4CUCA 3QJAA 1YDOA 3LY0A 4GQGA 1NARA 2OLSA 2OU4A 2EPNA 4LAOA 5CPSA 1W1PA 2O7QA 3QLLA 3FIGA 2W63A 5BMWA 1C90A 2PWHA 3IVTA 3LN3A 1K7FA 5CPTA 2A1YA 3FA5A 1QMLA 4Z2HA 3N1AA 4S3JA 3SUWA 2Y24A 4PMJA 3MUIA 2HNHA 3CAWA 1E9ZB 3M5ZA 3PJXA 3GU9A 1P0NA 4V2XA 3FGCB 1JRBA 4HYWA 3KTXA 3ITLA 2DT0A 4LF1A 7REQA 3U7VA 3O7UA 1MZRA 2CWNA 1UWUA 2VEKA 4P8WA 3WK1A 2DY3A 5I3FA 3LXBA 4B4FA 1L6YA 3N3TA 1JG9A 3UESA 3OZPA 4AFYA 4J3WA 1ITQA 4GNKB 2D73A 1JL8A 4U3AA 3CAKA 2ANUA 1NEYA 1DHKA 4HOZA 4ACZA 3BAJA 3QC3A 1J10A 1JDDA 2QCDB 2G95A 3UY8A 4PMUA 4GIAA 3DHFA 3T0AA 4PCSA 1PX8A 1XQLA 3SFKA 7A3HA 4X0VA 3LBCA 3NSNA 5I3GA 2D0FA 3C86A 1K8YA 1RD6A 1ZJIA 3E0FA 3MSYA 4M82A 4LFYA 1TPC1 2Y8KA 3MUZ1 4W7WA 3VKBA 5HQEA 3R8RA 4L64A 3VIIA 4MNKA 1W3TA 2J66A 1RALA 1UPPA 4PMDA 2G50A 4WR3A 3LZ5A 1RCOB 3DYOA 2D69A 4HSNA 4GJ1A 3M44A 1GOWA 1ADSA 2QGYA 4AG0A 1VCGA 5HBFA 4I9JA 4XWUA 1WZLA 4G1NA 4Q8UA 3TR9A 2VOMA 3BANA 3DI0A 4WXYA 2JBMA 1D7KA 2YCKX 4YN5A 4R5EA 3UF9A 1LL4A 3DDMA 1EJRC 2Q09A 3ITTA 4LVDA 1W5QA 4KGLA 4LBRA 4UTWA 3HGJA 3B8DA 3C8FA 2NUYA 3WLSA 5EMKA 3C61A 3TYCA 2WSKA 4A4AA 3EMQA 1I2OA 3KRZA 4HYVA 3TU9A 3F4DA 1TV8A 4C6EA 4A21A 4IGHA 4FAMA 3BWWA 4CN1A 2IQTA 2C79A 1EIBA 4R7OA 1FVPA 1Q4WA 4L56A 5AC6A 3ZR5A 5JH2A 3HIJA 2F2KA 4RDWA 1WKYA 1G4EA 4S3KA 1WQ5A 3DFSA 1A4MA 5HATA 4RXFA 1TTIA 4M56A 2ABBA 1SFJA 3TYDA 4Q4MA 5HWNA 1UOKA 3EWBX 3CZ8A 4HZ7A 1H7NA 4WX2A 3WH9A 3GAYA 3CZGA 4DO4A 1I2QA 3C2EA 3SQSA 4B5UA 5IBXC 2RDXA 4Z1CA 4NJIA 3LHZA 4O15A 2X42A 1HJXA 4AWSA 1E4IA 2DZAA 1BVWA 1VPQA 2B81A 3EDFA 1NELA 3RAOA 3GX9A 3VA8A 3EKZA 1VJIA 4J7RA 4NJKA 2XIOA 4U10A 2AL2A 1OZMA 4FNUA 4LVBA 1GVSA 2O7SA 1E9LA 3KCLA 4LS0A 4LUTB 5EMMA 4UOJA 3VKCA 2JIWA 2WBKA 4JD4A 2ISSA 2BZNA 2CXGA 2OZ3A 1TIMA 3G2GA 4GACA 1P7TB 4GK8A 2BB0A 2IUZA 3UJSA 4AIUA 5M03A 5J8LA 3MDUA 2WWDA 3ARQA 3VCNA 2PU1A 1IEIA 3VYLA 1E9YB 2QZRA 4DN1A 2VGIA 3LCXA 1QJWA 1JEZA 3C3UA 2DQWA 4HTBA 4CEXC 2QQ6A 1GVIA 4YCOA 2TMDA 2VWSA 2OELA 1GW1A 4OFCA 2YL6A 1FUYA 2E67A 3RUBL 4QJ4B 4ICCX 4ZO8A 5C70A 4LX4A 4N9EA 2HPIA 4GC4A 1KXHA 4MY9A 1XLAA 2QPUA 4EACA 3THAA 3LTYA 1J8VA 4AF0A 4TOQA 1KLZA 2PDNA 3VOIA 1WV2A 1KTNA 4E5TA 4UCGA 4QCEA 4CCDA 1BKSA 2NQJA 3ID7A 3RK8A 3IGUA 3WQCA 4UIOA 4DBSA 3QGAC 1GEHA 3EGJA 3URBA 3WD4A 2BGSA 4IFOA 1PDYA 1WZKA 4BY3A 2GUUA 2FHCA 2JEQA 3AS3A 4C7GA 2A3HA 5IXEA 3FK4A 2NVDA 2J79A 2ZE0A 4A2RA 4B5XA 3RLVA 1UKQA 4MJZA 2REQB 1FHDA 2CFFA 2G97A 5CC7A 1EGVA 1BYAA 2DZUA 1E40A 3WMLA 3H8AA 1RQEA 1A80A 1E6NA 1PVNA 3TQ0A 3EB4A 3TQKA 3HMCA 1IEVA 2YCIX 3LMYA 2GZXA 4JTRA 1Q3NA 2W5FA 2D2HA 2DZXA 2WMFA 3WNPA 1QI3A 3PZTA 1G4TA 3UP8A 3TAKA 3G24A 2R1MA 4WHBA 3G1RA 5LNRA 2Z6JA 3QHMA 2CLMA 1MZHA 3GXMA 2J62A 2VELA 4ZGYA 3S9ZA 1KR1A 4Q22A 3ICJA 1XBYA 4RNFA 3THDA 2AMGA 4OOUA 3CMFA 1EO7A 1H1YA 2VX6A 3O0KA 3TTYA 3F1QA 3CH0A 5G4HC 3T07A 1OHLA 5CAHA 5DRCA 4AD1A 3O07A 2QUTA 3MKKA 4Q4RA 1CLVA 4NVTA 3ES7A 1SZRA 1JZ2A 1W2VA 3QXBA 5I6SA 4H4IA 5DX7A 4K7YA 2BBFA 4XAPA 3KX6A 2X0HA 3PAJA 2ZUNA 3W7GA 2BVTA 5FL0A 4JL2A 1XLEA 5HR7A 2OWCA 3CGTA 3VGDA 1WAUA 1OFOA 1H7XA 1EBGA 2YXGA 1UIOA 1K8ZA 3IS4A 4P7OA 1DE6A 4W5ZA 5LHFA 3NM3A 2WHKA 3LHYA 4H8UA 1KM5A 1PX4A 1TUXA 2NVCA 4L4OA 2WJFA 5A3HA 5FA5A 4ROQA 3SZ8A 2GSHA 2WM0A 1KTBA 2I9UA 4X61A 1F8MA 4O10A 4A8IA 3DX5A 1FTXA 3VC6A 2QJMA 4JYEA 5MKGB 4LAUA 1LROA 4FX8A 1FCBA 5JBEA 4I9MA 1ZGDA 1UA3A 3UYIA 4B3ZA 3MDWA 4TO8A 3SRHA 3TC7A 2P10A 1MQPA 4RZ5A 1B4EA 1EDTA 3H23A 5CGMA 4JKKA 1LWJA 3PK7A 1R2TA 2ABAA 3BGJA 3GXDA 1IF2A 1Q65A 3W1LA 1IWAA 1KTCA 4IG2B 2DH2A 1DEDA 3W73A 2VT0A 3E2RA 5BRQA 4ERGA 4HZ8A 2OZ8A 1LRTA 1F07A 3CT7A 1Q4NX 5LGXA 1A5LC 2ZX6A 4DHGA 2E9LA 3K8KA 3NVDA 4DF2A 2E8YA 4N9BA 2F84A 5C9RA 4FNPA 2CHOA 3NQGA 3MCMA 2VFEA 1CEOA 5HMEA 1W6TA 1B3YA 3LXCA 4AVOA 1OFQA 3G1FA 4TU1A 3U2EA 2CEQA 3ENLA 2DIEA 4Q7NA 2GVLA 2QCLA 4ZEPA 1T5AA 1TRDA 1TV7A 1VRDA 3EWWA 1OYCA 4PL2A 2GQ3A 1X8CA 3AXMA 2CETA 2HTMA 4NZ3A 2VDGA 2R6OA 2OX1A 2D0GA 3Q2DA 1P0EA 3ZQ9A 3UEQA 3P80A 3WDQA 2WB5A 4AZCA 4HA0A 4I90A 2CZFA 2UY5A 5LZLA 4C90A 1TO3A 1GHRA 5FJOA 4AZHA 1P0BA 4DO6A 1UD4A 5CKSA 2ON3A 2D23A 1S2AA 3VIJA 3LGDA 3PVFA 3GYEA 5EKYA 4WSJA 1FA2A 3I3EA 4LUIA 2F61A 3R89A 1JD7A 3NQAA 4S38A 3WBEA 4TMBA 2WV8A 4E38A 1SMDA 3RNDA 4FI4A 5AC5A 2IW0A 2OWXA 1DBTA 1GWJA 4NNCA 5HMFA 1TVLA 2C18A 4PTXA 1V7AA 2ZXBA 5CG0A 3GFZA 2I5QA 3OEXA 3JS3A 3K46A 4CGTA 3WO8A 3FHAA 1UP0A 1GOIA 1OZQA 3PZ9A 3SY1A 3MVIA 5A8GA 1Q6FA 2XH7A 3TTEA 1OIFA 4BWLA 3FVDA 1O1ZA 4W5UA 4XSLA 2V2DA 1J0IA 3OBAA 4W86A 1B90A 1QPQA 1YADA 4BHYA 4NL1A 2VZVA 3TV8A 4NUWA 1O7AA 3FGCA 4RW3A 4R7WA 3EDDA 3GNNA 3QPYA 2ACRA 2PGEA 1ONXA 2PURA 3ABRA 3A9IA 4JFSA 2EPHA 1YPXA 1RHCA 2C0AA 3BLEA 3CASA 3L65A 1EJUC 5K9CA 2YB1A 4K8GA 1CPUA 2XGIA 3P74A 1C8XA 1HNYA 1SO4A 1PL9A 1QNSA 1D9EA 5FJRA 4DUWA 5BOEA 4RPPA 1JAEA 1P6BA 5FSDC 3B03A 2OFJA 3HB9A 1XYAA 5C9UA 3QMSA 4HT3A 2YCJA 1G6CA 4EXQA 2GOUA 3OGRA 4HGXA 1OX5A 3A3WA 4YTQA 2XFYA 3TNOA 2E3ZA 3PNZA 2C0HA 2WMIB 7XIMA 1EZWA 2D2OA 3KBVA 1PZ1A 1TSIA 1ZJAA 4C1LA 1YXYA 3C3NA 3DI1A 4FS9A 2ZCGA 3C56A 3WLLA 3OJGA 1BTCA 2E5DA 2E1WA 2A6NA 4GYFA 4MNJA 4V1YA 1F3TA 3FA3A 4LGXA 1UR3M 3LERA 3R1ZA 1GOXA 3QN3A 4PTDA 4KW2A 4KFOA 1S2UA 3I4KA 1OQFA 2QW5A 1POJA 4BS0A 3UY7A 3NAVA 4AZIA 5LIWX 1TUFA 4NNAA 1X1ZA 1XYLA 4TVCA 4GI9A 4ECLA 3RG6A 3SGUA 3EOSA 4BEQA 2QPSA 3T55A 1AW2A 4HPGA 1NH6A 1XLMA 2D2GA 1HO4A 3STPA 1Q7MA 3CQHA 1EHNA 1QDSA 4JTEA 1UR1A 3T0CA 4JIEA 1KO0A 3L9CA 1RJQA 1OYAA 4E4UA 3A4AA 1NDVA 1IV8A 5EMYA 3CQIA 4IGNA 3BW2A 3B8IA 7TAAA 4JYFA 2Z2AA 1AL7A 5D33A 4JPGA 3LHWA 3PUDA 3W71A 2ZUTA 1EKOA 4JFWA 4Y9NA 3SADA 3LU2A 5ABFA 3OA5A 2XIJA 2VTFA 2YBTA 4W85A 4B15A 1XLFA 3GTNA 5K9XA 3RCYA 3GE7A 5KMYA 1VAHA 4Q8MA 4JTTA 2FH6A 5CPLA 3EEZA 4LC8A 2BOFX 1I60A 3O63A 1ME8A 1FRBA 1UUOA 4XK2A 1W5MA 2QF8A 3MHGA 3OA3A 3EEGA 4P5UA 3DOPA 3PJWA 5D2YA 3O06A 2WXDM 3N15A 5CJNA 1UR4A 3WQ5A 1IZJA 5F2IA 4CQ9A 1MUCA 3VD9A 4UQDA 3W88A 2V8ZA 5CC3A 4UTMA 3AZRA 3DFHA 4NJGA 4MSSA 4OGZA 1PYMA 1XCWA 3UETA 3DZ1A 1L2UA 1WKEA 4EF9A 2DSUA 1TTQA 4A6GA 4JNYA 2XU2A 2GJRA 4JTJA 5AKQA 1W9XA 3IVSA 1RV8A 3L66A 3HQOA 4DJFC 1DWIM 2FPVA 3QW3A 3K4AA 3WJYA 3N25A 3WDHA 4H8HA 3W2MA 2VCAA 3EWUA 3BMVA 3HV9A 3L4ZA 3MA8A 3KEHA 4H7ZA 3USZA 2VOTA 2O4MA 2GLKA 3UZWA 1HL2A 3MUY1 1AW1A 4NF7A 3ZR4A 4U2ZA 1E73M 5FI8A 1JZ8A 1PSCA 2JKAA 2Q71A 2IQDA 3CV6A 5IDIA 1QNQA 1VH7A 4H9ZA 2CBVA 1AQ0A 1F4AA 2XGZA 4IH3A 3N29A 2DT2A 4M81A 1XP3A 1KRCC 5JIWA 1WBJA 3AIWA 4LVFA 3G18A 3WH5A 3A23A 4AH7A 1CLXA 3QHNA 4IPPA 3E96A 3SY5A 4TTUA 1OG0A 4PBEA 4AHQA 1XGZA 3WYZA 3IUHA 1R3WA 2HVNA 3LCFA 4Q8PA 4C6DA 3ANUA 2YIHA 3TN5A 1V3KA 4WKFA 4HU0A 1BRLB 1BGGA 4V1XA 2GVEA 1TWZA 1SJAA 1G67A 1EUNA 3RR1A 2GGGA 2OVLA 1GGOA 3I65A 3DFYA 8RUCA 4L4LA 3WDIA 2A4AA 1JGIA 2ASHA 3P67A 1EYEA 3N2BA 5CZKA 4L6DA 1A0CA 1UZDA 2FZ9A 2ZQ0A 5F4SA 4EXAA 3DFOA 4B9YA 4CNTA 4UFMA 1IGWA 3EX3A 4Q7BA 3R2GA 1SZNA 2NV2A 4AVFA 1E0UA 2REQA 3DGBA 1VIZA 1ISVA 3GXTA 2GUYA 3SQMA 4UTHA 3IWPA 4DUVA 3E6EA 1I2PA 4L1GA 3I3DA 2YB4A 3H21A 5EMJA 3E0WA 1A4LA 1KFKA 3G3MA 1VYPX 1GVFA 1WOAA 3BLLA 5I7GA 2VCBA 2EGZA 1ZAIA 2TSYA 1V0NA 5CC6A 1SO3A 1ISXA 1R9ZA 5CSRA 4DJDD 2HS6A 5DANA 2ZADA 1F2JA 4UQAA 3U4AA 3GO2A 4DQWA 1BXNA 1EEXA 3WELA 1DQWA 2Q02A 1M3UA 3LGGA 3RHGA 1VFFA 1SUXA 3QLDA 2R14A 1QNVA 4LT9A 4RCXA 5LNVA 1SFSA 3TFXA 3CPUA 3KL3A 2WMJA 3RM9A 3PZGA 5KZEA 3CO8A 3EWXA 3CIVA 3NEVA 3AQUA 4JQ3A 1ODUA 1R46A 3AALA 3E3HA 3JR2A 5CH9A 3CHDA 2FDMA 1V6WA 2IQ0A 4FF5A 1PKLA 1QI4A 3B9AA 2MUCA 4NXKA 4HNNA 3L5LA 5C9WA 3VNKA 3JRKA 1V6YA 3RXZA 1QW7A 4H9YA 2YL9A 4EAMA 3QMTA 1TV5A 3HOJA 1N82A 2WK2A 4OU1A 3IK2A 1SPQA 1VPYA 3OGSA 3FJ6A 2XIBA 3KOZA 1J0KA 4S39A 2DUZA 7CGTA 3E1F1 2ATSA 3L2IA 4X2RA 4W84A 3GXPA 3K1GA 2QJGA 1CYGA 4WY0B 2Y5JA 3WD2A 4JX4A 3TNBA 4LWWA 3VGFA 5I3IA 2OT1A 3AWOA 4AXKA 1L8PA 5D2WA 3G77A 3NYDA 1GVRA 2B7OA 3W28A 3UJFA 1E15A 2BY2A 1QASA 1UR8A 1GTHA 2Y62A 3USBA 2WM1A 3M47A 4QG8A 4Y6GA 2DU2A 5G1MA 4XAYA 1YKWA 1SJDA 2VZUA 3GU1A 1OWQA 1MUWA 1T96A 3F4CA 3W1MA 4JICA 4YIWA 3G1YA 3SN1A 1KFJA 8XIMA 3P82A 3QYQA 3ATZA 1BQGA 4E8GA 3N9KA 3ATYA 3CL7A 1VKFA 1YDVA 3MCNA 4OOZA 2SFPA 3EZ4A 4JIIX 5EGRA 1UC4A 1KQYA 1OGGA 4MDPA 3P7YA 3S8HA 4DXXA 2CESA 2XGBA 1TV3A 4LCRA 2HXUA 2CLFA 3TZNA 4QRNA 4JQ4A 4M29A 3RRXA 4W89A 3SURA 4UOQA 3XINA 1GQJA 1K6AA 4LEFA 3SCQA 2W4XA 1XRTA 3WQVA 3NOEA 4QISA 1S3TC 1XLLA 5AFDA 1NU5A 1NAL1 1CGVA 1F8IA 4MMWA 1Q13A 4YWIA 4LALA 3RPMA 3IARA 3DFQA 1XL9A 4J2PA 4MB5A 5IHRA 1NF7A 3P0XA 3A24A 4MPQA 4Z2LA 1VS1A 3BQ6A 3W01A 4ZQNA 2A3BA 1IIHA 1PHWA 3PZMA 8CGTA 2CLEA 4D6CA 4JQAA 3V35A 3SW6A 2CXEA 4NNBA 4GXMA 4Y9PA 2DT1A 1H51A 2FFIA 1ZBWA 3FJNA 4I5RA 1QT1A 4H2CA 2FDSA 2PMQA 2VXNA 4C6IA 1YPFA 2O4QA 1XINA 3LV5A 1DXIA 2Q6ZA 2Z4GA 1A5BA 2BWGA 5AB3A 3RU8X 2Y5EA 3ZWTA 1YHTA 1UUMA 3GZAA 3MJMA 3DC0A 1FWFC 2I9EA 4GGHA 2C8NA 4WUIA 2AQWA 3ZIZA 1MUMA 3NZPA 2OZ0A 3LTPA 1H62A 2QNEA 4QSHA 4JX6A 1XLKA 1QI5A 4JYDA 2OMAA 1ICPA 3GHSA 3NQ6A 1JAKA 1E70M 4KCTA 1S2WA 2QJJA 1B31A 2PDFA 4DZIA 1TV4A 1B30A 1QNOA 1X7IA 1RPKA 1QNRA 3ZMRA 4DB7A 1GQNA 4CLMA 1TYGA 3KM8A 2BXYA 4AU0A 3DKLA 4HZMA 4Q8WA 3WNLA 1WB0A 4LC6A 4NP7A 4M0XA 2PDIA 1FCQA 1J11A 2J24A 2BG5A 2V68A 5HWJA 5T8GA 2UZ9A 2WVVB 4OKDA 2CWXA 3FY1A 2VX7A 2W9MA 3G0XA 3WLNA 1JYWA 1MRAA 4DVOA 4RZ6A 2QCMA 4O28A 3MUXA 3D6NA 2E68A 1Q7ZA 4MAVA 1U1JA 4F0LA 5A95A 3TYZA 5K3VA 3FS2A 2I56A 2VFGA 1J9YA 4GZJA 3TW6A 2PDCA 5D9NA 1NQ6A 2A5HA 2VI0A 1TG7A 1RR2A 5LIKX 1JQXA 3PSWA 2P76A 1KV8A 1JDAA 1QOQA 2DV0A 2GQAA 5JH1A 2C7FA 3I6EA 3DFTA 1UH3A 2ZX9A 3MHUA 4Q4KA 5L6UA 9XIMA 1EC9A 3GHUA 2INFA 2CZDA 2C1GA 2WZEA 3OLIA 3VGBA 4D9PA 1ODZA 2FZNA 2QDDA 3LK6A 4EP8C 1H5VA 1SJCA 3F4VA 3HO8A 3NQBA 1BTMA 2XUCA 2X30A 5EU9A 2DIJA 2BGQA 4TVUA 5CGTA 4ZE5A 4LF2A 1Y65A 4FX7A 2V67A 2XVLA 1PZ3A 4BZYA 4Y90A 4S2CA 1UWTA 1B9ZA 1XYBA 3RX2A 3NQ2A 3NL2A 3R5EA 5I07A 4H6RA 4JHZA 1IYXA 4EVZA 5A2AA 3EBVA 1THFD 5HWMA 5J04A 4OTKA 3VDGA 1QO2A 3R0UA 1EJWC 5A6TC 3W76A 4QFUA 3UZZA 4A8RA 5BRPA 2IXUA 2P50A 4N4PA 2JGQA 4AD4A 3WMBA 4DWSD 2EPLX 5LYRA 5C55A 4MWAE 3PJUA 1B3WA 4B5VA 2JF6A 4IUGA 1KBKA 4IP7A 5HNTA 3HPFA 1UOZA 4WEVX 2JIEA 2ZXDA 1RCXB 1Z3NA 2J88A 3T6CA 4LS1A 3GS6A 3CWNA 3V1HA 2RDTA 3A4JA 1HFBA 3VZXA 1JNDA 3BW3A 4JX5A 2DW6A 4PUWA 4DI9A 1DPMA 2CBJA 4AB4A 3GZ3A 5FF2A 1OC6A 1PS9A 3UJ2A 4PFMA 4K1GA 2RUSA 1XIBA 1WCGA 1LT8A 3CHCA 4BEUA 4YTTA 5LSMA 4PUUA 5G1TA 3AFBA 3W82A 1LTDA 2GUBA 2I5GA 3AZTA 3LDVA 1HVXA 1IR2A 2ZWYA 5G4WA 4JTHA 2CERA 4NILA 3IIXA 1Q6EA 1GZ1A 2I57A 4F79A 4IPJA 3WNNA 1F9CA 1EF2A 2ZUMA 3G1XA 3DERA 3VIGA 4XZMX 3A12A 4KESA 1KGXA 4M80A 3AOFA 1XLHA 3LA4A 4JEJA 5TD4A 4F3HA 2V3FA 4XKYA 4AYSA 5HJYA 5CPMA 1OBAA 3ABZA 3POHA 1LUCA 3MYOA 3C8NA 5H8MA 1IQ8A 1KFWA 1UD3A 3HA1A 3MW7A 2YL5A 1G01A 1ZU8A 2WPGA 4UTJA 3UWZA 1RXOB 2W92A 2GVJA 2DW7A 1RP8A 1OFDA 1ZFJA 1LL7A 4KMQA 4E2BA 5IDZA 3ZS4A 4ZZ9A 3M0KA 4FPSA 1Q6QA 3U3HA 2BMBA 2O55A 2BOGX 2UWFA 2P0IA 1PWLA 2PC8A 2X1TA 2WKJA 5FEPA 4YPJA 4KCVA 1K8XA 3U5YA 1DWAM 1G4SA 4BQ3A 3GG0A 4FMVA 2ISWA 3GBEA 4K38A 3VX1A 1F74A 2V5CA 3W7OA 3TTSA 1IR1A 4JY9A 5AHNA 3LM7A 3LYEA 4DLMA 3UWWA 2OZTA 3B0YA 1FWDC 3B9OA 3B8TA 1BQCA 4TMCA 4QG9A 2XVGA 4G56A 1QNPA 4CNSA 2AGKA 1JZ5A 2VO5A 4R7JA 2V81A 2OODA 2CZVA 2VZSA 1R3QA 3TOYA 3QTGA 1JF6A 1J2BA 2J6VA 5E0KA 4Z1BA 5FCZA 1AH0A 3KVLA 4PEEA 1DJYA 4DYKA 3SUVA 1VFTA 1QI0A 3NDYA 4LPCA 2OGJA 1W17A 1LM1A 4IQJA 1R9XA 3MHFA 2PDXA 2WC4A 3S5NA 3HQ1A 3WF4A 2NQ9A 4D71A 3BQ5A 1JZ6A 1GPFA 3CH9A 3HPAA 4HPNA 1ZLPA 1OX4B 2VFHA 4P2VA 4BQ4A 2KX9A 4S3DA 1O5XA 4HNTA 1X6UA 4QCFA 3LZ3A 3UJRA 1Q6CA 3PWAA 4IMCA 5C9ZA 1LZOA 2PDMA 3F2BA 3WKZA 2PP1A 3URQA 2VC7A 1ISWA 1I75A 2YA2A 3EWYA 3N2MA 2XDFA 4HNLA 1E0TA 4O0QA 2PWUA 2R9RA 5D2XA 1DYSA 5T9CE 1ADDA 4QE1A 4Z1DA 2GQ8A 1E6RA 4P61A 1RSCA 2CHNA 3VOCA 3K8LA 2QV5A 5DY3A 1XLGA 3KW3A 4GXPA 4Q6JA 2PDPA 1DJWA 2FZMA 4IGMA 1TJPA 2VDHA 2ZZ6A 3FOKA 1WNOA 4R53A 4X63A 4E4PA 4HK7A 3M7WA 2WMHA 1EPVA 3VCRA 1YW1A 1M7XA 3L2LA 5FKYA 1OD0A 1DXFA 3LOTA 3VIHA 1H09A 2NQZA 2XSAA 3MO7A 4LNYA 1BAGA 3BK0A 4ATDA 1ZCCA 3G1DA 2YZ5A 4QS6A 3K2GA 3OBEA 1VFSA 4XBKA 3F7JA 3KDOA 1EH9A 1W9BM 3N9SA 4ZODA 1LLWA 4JDBA 2PU0A 3UW6A 2Y2WA 1KFCA 1NIUA 3IV3A 3N6QA 4MY8A 4KEUA 2VL4A 2BNJA 3CXOA 3MMWA 4DJFD 4LVGA 3QSRA 4FB7A 3VNIA 4JNZA 2OEKA 2PC4A 4LYKA 4XISA 3R11A 1PZ2A 5HK4A 1KCLA 3TWBA 3WH7A 4F48A 4C6PA 1A0EA 3KZSA 4UZSA 3WF3A 5A8MA 3UZJA 4LRSA 3RLUA 3T05A 3VTRA 3FAXA 2HS8A 1XC4A 3VGHA 1WPCA 1XBVA 1D8WA 4NAFA 4AMAA 5I02A 4IMDA 3B8VA 4O17A 1D3CA 1UKOA 2XVNA 5CSYA 3OZOA 1OJXA 4XUGA 1Z69A 5GJMA 3SUSA 2HRWA 2FMOA 7ODCA 1FWCC 3W81A 1I2RA 3DGRA 4H83A 4PA8A 3B97A 4Z42C 3MO4A 2VFDA 3PHAA 3UJEA 3ZT5A 1E5NA 4O1AA 5D38A 4DWSB 2PDLA 5KZDA 2EKGA 3OPSA 3RPDA 3SEPA 1BD0A 3TOPA 3ZJ7A 3J7HA 3THQA 5HR6A 5D4YA 4MY1A 3ABSA 2JE8A 1TCMA 4GY7A 4UFLA 3O0FA 4KF1A 3NO5A 3O6AA 5KZ6A 4C7FA 3W00A 3KL5A 3MUCA 3E9AA 1XCXA 3PANA 2VCCA 4QBXA 3NDZA 1RZMA 1IGSA 4JIQA 2PDKA 3AYSA 4MAZA 1PEZA 2FZ8A 4IIEA 4PEKA 3VABA 5DBUA 1ZAJA 2XPKA 3LBMA 2Y88A 3CUJA 4M3PA 3M16A 4ASTA 3M6YA 5CPQA 2OXNA 2VDIA 3EPMA 5D8ZA 3EPNA 1GKPA 1FWBC 3DFNA 3ZXWA 4DXVA 3BC9A 4B91A 3GHTA 3C2FA 2XN2A 2EO7A 1E6XM 1FDYA 4PUNA 4HA1A 4JCLA 3AHXA 3JU2A 3E02A 5C9XA 4YHGA 3N04A 3ES8A 3HBLA 3T40A 3IJ7A 4QQ3A 3GSMA 3IIPA 3RX4A 1ITCA 1SO6A 2DDXA 3EYPA 3H7UA 1MNSA 2G3NA 3WNMA 4HSHA 2OQYA 3VAVA 3VOFA 5M2FX 4KFNA 2W27A 1B1YA 4MUPA 4C6CA 3BGAA 3PZQA 3WLTA 4Z0SA 5LKYA 3BSGA 4E2OA 4BI5A 4WKHA 4MG4A 1B9BA 3K13A 5LXEA 2ZA3A 1NWRA 4IPIA 3B4YA 1VBHA 2V63A 3MKVA 3K30A 4MJ2A 3DHPA 1VRXA 1B0IA 1UMLA 4GE8A 3WD3A 4ZB0A 2W67A 5FIPA 3FV9A 3ZLFA 3GFXA 3WEZA 2WVVA 4ZXOA 3BSHA 4Y8FA 1DJZA 3INPA 3KRUA 2Q3OA 3MC5A 1FXPA 4HPXA 4A3UA 2WSPA 4PRTA 1A5MC 4FALA 3VNLA 1TPEA 3IAQA 1A5UA 1TMLA 2FJKA 3WG6A 1WYIA 1KFEA 4S3EA 2PDJA 2I5IA 3AS0A 4XV0A 2BHYA 4MPKA 4FK9A 3L23A 3M0IA 4DF0A 3IJQA 4UTKA 2WC7A 1WDSA 3T0TA 2VEFA 3E0IA 5EBAA 1E43A 3M7SA 4CQCA 3FXGA 1AFSA 3L4TA 3M64A 3W02A 1XPGA 3ZR6A 4A2SA 1IXPA 4PUMA 3S1UA 3F4NA 4A8LA 3NL6A 2UY4A 3PM6A 4V15A 1YXDA 4KERA 1JPIA 3TWAA 4C1NA 5TIMA 4E0CA 5CZSA 1X8FA 1ZUAX 3ALGA 1K7XA 4Z2IA 5DO8A 3T09A 4DF1A 2PZNA 4AY1A 4K39A 1MDLA 2DUXA 3BAKA 3TMLA 3AMGA 4QDMA 1S38A 1J0HA 1VFLA 3URAA 3UPMA 4GBDA 1XLCA 3E38A 3SUTA 1ISZA 2VX4A 1W8GA 3FYOA 4G9PA 3U4FA 2XFRA 2PTYA 3GIPA 4LOCA 4M1RA 1LOQA 3EA1A 1T99A 2ZTJA 1RK6A 3LLXA 3V7PA 1EOMA 1RJRA 5F4WA 2INEA 2H3DA 1SZFA 2BLEA 1Q45A 2GWGA 1DTNA 4V33A 1CBGA 1ONRA 1E56A 1SO5A 4FXJA 4O1BA 2Y7GA 3B0XA 2HNEA 3T9PA 1E6QM 3BAYA 3NGFA 1MFUA 3I4EA 4QEHA 2DSVA 2YA1A 5AYIA 2F8QA 4A05A 4JN6A 2CLIA 5C0QA 4L9ZA 1KD0A 1EQPA 1WXJA 1JIBA 5FF7A 3E2VA 3W7QA 1XIMA 4H41A 1I8JA 5IBXA 2V3GA 5KSWA 1VBRA 4WDUA 5GNYA 4FOUA 3THUA 4AZ5A 2DH3A 3IRDA 4ZB2A 5FEWA 1CXEA 3TP4A 4NU7A 3RCNA 2F6XA 4TX6A 3U2CA 3CPGA 3WF1A 4NX0A 5FEZA 3ZLGA 3GRIA 3CB8A 1Q85A 1ZENA 1JCXA 2FPTA 1GORA 4LQ1A 5LGZA 4FEZA 1E1FA 1XQKA 1YDYA 3CV1A 1VLWA 4JZ5A 5LIUX 1HVQA 1SZGA 3WQFA 4O53A 3G6MA 3R8HA 1M04A 2WOQA 2ZTKA 1NDYA 3AXHA 4CNOA 1HKIA 3WBAA 4ZTXA 1TWSA 2G3JA 1J0YA 1UR9A 4CVWA 1XG4A 4F66A 4UQCA 4R27A 1UYQA 1AUSL 4H7VA 1LOLA 2VC5A 2WQDA 2GSJA 2HK0A 3SCVA 1HXJA 3HGOA 3RPTA 3TZFA 3WSUA 1BYCA 5I3HA 3E5PA 2PSNA 4K37A 3CTTA 1C8VA 2R1LA 1CB7B 3OTRA 2NZLA 4NIRA 4S3FA 2POZA 1J12A 5BXSA 4XIMA 3U6WA 5I24A 3W2LA 1CW2A 3VIKA 3V4BA 3VX0A 2PP3A 1R85A 3M41A 2ESCA 4CQDA 5AYXA 3PPCA 1ZRQA 1E4LA 3TMQA 1UWRA 3AMCA 4O0KA 4IX2A 1Z6KA 3FKRA 4D6GA 3CNYA 3B0PA 3UG4A 2B7PA 1W3LA 4Z08A 1NOWA 1JCNA 4QDPA 2HEJA 4FXSA 1KFBA 4MLJA 3CHEA 3DG3A 1XDLA 4IL0A 1ZBCA 2FMNA 5CC5A 1LDCA 3UXLA 4IL2A 1TZ7A 3OODA 5U4NA 4AY7A 1GJWA 3QF0A 1HGWA 1B5TA 1S3HA 4R3UA 3QYSA 3ABOA 4H9TA 1H0GA 2I17A 2P3ZA 5DEZA 1TREA 4LJ3A 1HF6A 1R2RA 4KKXA 4OUEA 1CECA 3P60A 3DIPA 1C7SA 5CQ1A 5C2XA 1GYLA 1H4PA 3ERPA 1V6UA 3W1XA 2WLYA 3RU6A 4ZQOA 3D3AA 1HIZA 2PLKA 5HUPA 2C3ZA 1JJKA 1K03A 3S6OA 5HINA 4B5TA 3RM4A 1XD1A 4GC3A 1OT2A 3MWAA 2ZC8A 4C65A 4B2DA 1TQJA 2IKIA 4H9XA 2ZYFA 2F2HA 3VOJA 2Z24A 4B9ZA 3ONCA 1KC7A 3O8AA 4US6A 3CEUA 4GX8A 4RLIA 3S5SA 5DFAA 3OB8A 4PCTA 1PX3A 2A3LA 3WQWA 5I09A 1BWVA 1OX4A 1M03A 4KRUA 1B3VA 9RUBA 3GNPA 3L4VA 3IACA 1VBUA 4AIOA 3C0SA 1EBHA 3MP5A 2IPWA 3TDFA 4I8DA 1H50A 3RILA 4A29A 1NJJA 4UFHA 5BU6A 2WC3A 1M9HA 3COTA 3KBMA 3KP0A 4M7TA 4ZOEA 3L7RA 1MYRA 1WOBA 4U3CA 1UD6A 3CWHA 5BYWA 4AC7C 1GCYA 2OEJA 3GDLA 3OG3A 4DBDA 1JZ4A 4MTVA 1UC5A 1Z42A 4HNOA 4G7EB 4AWUA 4WOQA 5TQLA 3GVRA 2X2YA 1W56A 1VCVA 1VHCA 4G5DA 3VFCA 1FWEC 1GVOA 1M6JA 1GNXA 3T4WA 3WMCA 2QDGA 4D72A 4UQEA 1V3JA 3V3WA 2A2IA 4TV6A 2C19A 5CZ0A 5HULA 3W85A 1R3TA 4WIWA 4MDOA 1TPH1 3FDKA 1O4UA 4UMAA 9XIAA 1DIDA 1UZ1A 3H26A 3C0LA 3RJYA 3BLOA 4UUIA 4J40A 4DI8A 4DPQA 2ONEA 4D8ZA 4F0KA 1GUVA 1XD0A 1YE4A 2FGZA 3QKZA 4RE4A 4EX4A 3SCNA 2V5KA 2NX1A 1LBFA 2P53A 2PODA 3R4IA 4LUJA 1A3XA 1AW5A 3KBNA 2ZC1A 4NQ1A 1OB0A 5I5RA 4XZIA 3I3BA 4KCUA 2XZ7A 1CI1A 1GOKA 2PGFA 2Z25A 4XSMA 3RFAA 2Z1VA 3OIHA 3H55A 3PP7A 1OSEA 4AIEA 4RUBA 4XZHA 4LCSA 3LM3A 3R8GA 3S1GA 4AISA 4GQRA 1L6SA 3GG7A 1R8LA 3NG3A 1XIEA 4R9XA 1S2TA 4XO7A 2V38A 5T91A 4ZXLA 1BVZA 1VEPA 1Z9AA 4MIMA 1UUQA 2O9OA 1ITXA 2QEZA 3T81A 2QAPA 2J7GA 3R10A 4PR4A 2Y7EA 1OINA 4X9SA 2FHFA 1IT0A 4O8RA 1UPMB 1F6YA 2GJNA 3U2ZA 1KFLA 4KRZA 3UGVA 1H7WA 2GQ9A 1H7OA 4KWSA 7ENLA 3UVIA 3IJLA 1FWHC 4O1DA 3BOXA 5DRIA 3LPGA 1MI3A 2Y85A 4UFKA 6PTDA 3M07A 4O19A 1ZL1A 4O57A 3HQNA 3QZEA 3KTCA 2W6RA 5RUBA 4HVXA 3L4YA 2ZA1A 4CNNA 1GT8A 2E9BA 4KQNA 2NXHA 4HNCA 4IF2A 3WENA 4DWSA 1UHVA 3QBUA 2FH8A 2XSXA 3B8SA 3W1PA 3VFLA 2DFAA 5KEZA 2VNCA 4M6PA 2BASA 3HURA 3IGXA 2PLMA 1H11A 1BKHA 5A6KA 3EDEA 1R38A 4JOMA 3WQDA 1S5WA 1ZSXA 4IIDA 4HYRA 4YL2A 3TA6A 2HQAA 3WD1A 1A5SA 3CC1A 1GVEA 1GJUA 4GNVA 3M0LA 3P5YA 3W1QA 2CLPA 3T4CA 4ZQCA 5K2ZA 2NQ5A 3KLLA 4B92A 4XZBA 3AIRA 3JW7A 3OQ8A 3RLHA 3BDKA 3LPPA 2VX5A 3UNDA 3TCSA 3A4WA 1YNPA 4LU0A 1YIXA 3VUPA 2HV5A 5DY2A 3A4XA 4Q4QA 4HN4A 2YSWA 3AXXA 2CITA 2PI6A 1J5SA 3NJ3A 3LX9A 4ORIA 4YVXA 1K4HA 2PLCA 3ANVA 4EANA 4GO9A 4BJHA 5C8BB 1JPHA 4B5WA 1HP5A 2WNZA 8A3HA 1GOOA 3AIQA 3AYRA 3P2VA 1KWGA 1PAMA 4J5NA 4RK8A 4GI6A 3NEHA 2QIIA 2RFGA 5EFDA 4QR6A 4UTLA 3W25A 1TVNA 1RP9A 1SYTA 4DIAA 3HG5A 2FKPA 2WSQA 4QP0A 4BFAA 3HFYA 1W5OA 3FNDA 3L5AA 5I06A 3BG9A 5J5RA 2HZGA 4PMNA 3CO4A 4E4FA 1U1UA 4AD5A 3JUGA 2BGNE 3CMJA 3S1XA 3TC3A 3DENA 4RE0A 1T6MA 5I03A 3DBPA 1IXQA 1E9IA 3C6CA 3SRDA 2PDQA 4HK6A 3VILA 4JN7A 4M51A 2ACSA 4O4WA 2ISFA 1I6NA 3IJ9A 2J74A 4AD3A 2OT0A 1K4GA 1RY0A 1QPOA 4A8NA 2PF0A 5LA1A 3N2XA 3TXZA 2ISDA 3VCCA 3ARYA 4UNLA 4FR6A 4Z2GA 2ZRVA 4PB5A 4XQ6A 4YJ5A 1NTHA 1T7LA 3WH6A 3LS9A 2Z2BA 4OV4A 3FJ4A 4Q7IA 1EX1A 2HWGA 3LCGA 2E8ZA 3NZGA 3GY1A 1A53A 1T8XA 1D7FA 4J2MA 1H5YA 1LBMA 3W38A 1IXNA 4IIHA 4UTTC 2NQLA 3N11A 5AOUA 2J8FA 3DG6A 4NJHA 1IZCA 2YZRA 4GI4A 1XH0A 1RD5A 1XG3A 2J7FA 5EY5A 1CIUA 3A3XA 4KWWA 3LTSA 1DKWA 1U2YA 2VGFA 4HD5A 4FXFA 1YBQA 1KBJA 4PMRA 2TAAA 1Q6GA 1ZY9A 3A9BA 1XICA 4UMCA 3EWCA 4MWAD 2G5WA 4AEFA 4KIRA 5H2ZA 2DJXA 2YOCA 3EDKA 3QPEA 4XZNX 4QROA 4DBWA 1UROA 1EJXC 3T2PA 4GJIA 2R1NA 4IXHA 3LNPA 4QQUA 3H7VA 4DZ5A 4C6JA 4DJDC 1VB9A 4UOZA 3TYUA 1LG1A 1W3HA 5CEWA 3P84A 4X0NA 3VO0A 3AUJA 4WJXA 4DYJA 3UR8A 5A6LA 3ARRA 2BY0A 2C1IA 4CD8A 2H6RA 5D9OA 2CLLA 3QW4B 3OQEA 3BGGA 3T2OA 1E3XA 1LBLA 4RV3A 1MO0A 5KETA 2CW6A 4JNMA 3EOLA 3FKKA 4QEEA 1JXJA 1UQZA 5H8PA 2ZZ3A 3LCWA 1R86A 3W27A 1OK4A 3UA4A 5F2GA 3EWZA 4OHQA 1W54A 3H4WA 3S9YA 3IRSA 2B31A 2YDQA 3CV7A 5IHSA 2CLOA 1XIGA 2VVNA 3MZ2A 3GKAA 3WLMA 1AA1B 3L12A 3GVGA 3U5UA 4JFTA 1C3FA 3MZNA 2I16A 2J4GA 3R12A 3W70A 2QHAA 1ZCOA 4XIAA 4LW7A 3OO2A 1FP9A 1V3IA 1W0MA 1XRSA 3KFTA 1I0BA 3AIVA 4ZO6A 2X05A 2XH4A 2J6XA 1E0XA 5HQLA 3UXIA 1C9DA 2YCLA 4QE5A 2CPUA 1YTEA 2O9RA 4HPHA 2XTKA 1PIFA 1TX0A 3RDKA 3LHUA 4DJFA 3ABXA 2EJAA 1LL6A 1PIIA 3NFUA 1YPIA 2NLIA 3G0SA 3W4RA 1QFEA 4QE4A 3MSDA 3UCDA 1J93A 1DJQA 4R88A 3K4DA 3KS6A 3WCZA 4JTFA 4CVUA 2ZOXA 4J3SA 4HB7A 2MANA 4IFKB 4RV8A 3FN9A 1GQLA 4W8BA 2XWDA 2WAGA 2QF7A 2B0MA 3SO7A 4MNMA 2J13A 5DXXA 1KKOA 1EJSC 1MWOA 4BF9A 3ARSA 1LCOA 1OCBA 3H70A 4NY2A 4TVDA 3QM3A 1DXEA 5HA7A 3ZZ1A 4S3CA 3UNTA 1W3KA 1VP5A 3GC2A 3ANYA 3MT1A 4RE2A 1S5NA 4H19A 3QY6A 1V7YA 5J5DA 1Q6OA 4YU1A 3B0UX 3P5ZA 3R0KA 1UQYA 2HROA 4O1FA 3T8LA 4PUJA 4FIRA 4E3TA 1EYWA 3CPRA 1V51A 4AXNA 3NO3A 2QUMA 1U1HA 4CD7A 4PMYA 3UQNA 1A5OC 4D6DA 1WZAA 1Q8AA 3MP3A 4ML4A 5KZMA 3TQVA 3NIYA 4HJFA 4J35A 4ZOBA 3D47A 1WZMA 3OHIA 4KWVA 4XD4A 4UFJA 1S46A 1FHLA 4JTIA 4HCDA 1NDZA 4DJED 2E1DA 4GZIA 3FEMA 3TW9A 4N6EA 1TJ2A 3VPLA 4S1FA 3P8IA 3FSTA 3G8EA 1WE5A 1OFRA 3FFSA 4FIQA 4NZ5A 4IIFA 3BJSA 1XF0A 3T7VA 4ZCWA 1UBPC 3WQ8A 1X39A 4C6MA 4XB3A 2J25A 3MANA 2CBUA 4XD3A 3BZGA 3CLWA 1S2VA 3C52A 1US0A 1X1NA 3BJFA 3SCTA 3WIJA 3ARUA 3FAWA 1QRQA 3LD5A 4LB4A 3GG8A 3EOEA 3E2QA 1GQKA 3SCWA 5FL1A 4GA8A 3W3OA 4PUKA 1ICQA 2QPXA 1OVDA 2D1ZA 4NZCA 2NUXA 5BRBA 1ALDA 2GFTA 7REQB 3ZVIA 1XM3A 3TVAA 4FOKA 3N2CA 1EPXA 3C2VA 2NT0A 2NSOA 4IHCA 3S42A 4JAWA 2PWDA 1R0MA 2GGHA 4G7EA 5L9FA 3ARPA 1NM9A 3GTXA 4IMAA 5BOOA 4ACZB 4H8VA 3W1RA 1XIHA 1E4NA 3WF2A 5FJPA 3NOYA 3BOFA 3LENA 1XSJA 3UG5A 3BVJA 1JYNA 2JFEX 3T78A 2LLEA 3CLMA 1Z89A 2BSLA 3DAQA 5C7VA 4UTFA 1F73A 1W2PA 2Z6IA 6REQB 3W75A 4R33A 4HN8A 4GYPA 5BXPA 2O9PA 2Q8ZA 4UXDA 1QCWA 3SRKA 4XKMA 3S3GA 2FVMA 2J8TA 3QVQA 5G2WA 4TQTA 1GHSA 3PUOA 5F2MA 6A3HA 3H53A 3BV4A 1HZYA 1S5TA 1S2CA 3CAQA 1G5AA 1RA0A 2EG8A 3QKEA 3IK4A 1E4MM 3Q65A 3IVUA 4NAEB 4Z1YA 4OBRA 4MWAB 1U83A 1ZP4A 4BKNA 3F2CA 1Q6RA 3WJSA 3NWRA 5C5YA 1CT5A 4YTRA 2Y5SA 1GYMA 1WAWA 1DV7A 3QR1A 3TYBA 3W7CA 4W7VA 5CJ5A 4X3ZA 2JEPA 2X0SA 4AX7A 4H6KA 2ZA2A 1B3XA 1QHOA 4OVXA 1H1ZA 1JR1A 1C92A 3GUWA 3TEVA 4PCFA 5AYYA 1H41A 1HJVA 3NA8A 1XYCA 1FH7A 1EO5A 1K77A 4RR4A 1KBIA 3IANA 1ZJBA 3N3MA 3CBWA 3MKCA 4OV9A 1M53A 4QIUA 2DQXA 2W62A 5LA0A 4FLQA 1NFBA 1XWYA 1X98A 4LB3A 3M46A 3W6LA 3KHDA 3SIMA 3DHUA 4H2HA 1FWAC 5D9PA 4C6OA 3E74A 3MQTA 2CYGA 4QAIA 1YX1A 1JDEA 4L1WA 4GRSA 4UWMA 4KEVA 1FWSA 4OBSA 7PTDA 1V79A 3GIYA 4QNWA 4H8NA 1V0LA 5A5WA 1W1TA 1AJZA 1C29A 3FLUA 4GY0A 2G4JA 2RGLA 1EP2A 4DWSC 4NT0A 1GEQA 1O5QA 1KKRA 4L9XA 3GD6A 3E49A 3KBWA 2BV9A 3TONA 3MV11 5EA9A 3XISA 3BURA 4QNEA 5DF0A 1NP2A 1T0OA 1ZBKA 2EPMX 5A2BA 2ZUSA 2R82A 1LORA 1A0DA 1R3RA 3RMEA 3UZXA 3VD3A 2J7HA 3AIBA 2HBVA 2AKZA 1UKTA 2PAJA 2E0PA 4W93A 2G8ZA 4MB1A 5DT7A 1EWEA 1TTPA 2FZDA 1V03A 4GBUA 4WDTA 1NP0A 2PLJA 1FWIC 2J75A 3WF0A 3U7BA 1B2YA 4O16A 1L6WA 2UY3A 2A85A 5A8NA 3V1PA 3KL0A 4AD0A 1OFPA 2W61A 1MDRA 3PPHA 2BVDA 4RNJA 4ONVA 3AIUA 2TODA 4K8HA 2EF9A 5ENLA 3VNZA 5EFFA 4Y9MA 3UWVA 2ZX5A 4O4VA 4N4QA 5HPCA 1EIXA 2CZ5A 1J6PA 3H2OA 3M6DA 3ZJ8A 2OPJA 2YW4A 3FX4A 3G1HA 3RITA 1CLKA 4MB3A 3FHQA 3REQB 4JL1A 3MBDA 4D8LA 2MNRA 2CNCA 4XZLX 1MQQA