1S2UA

Crystal structure of the d58a phosphoenolpyruvate mutase mutant protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
290
structure length
290
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
total genus 110
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2uA00
4MF4A 3MA8A 1VBGA 4KS0A 2E28A 1PKMA 1F3WA 1U5HA 1VBHA 3EOLA 3FA3A 4B2DA 3VAVA 2KX9A 3HQPA 2G50A 1F8MA 1SGJA 3BJTA 2R82A 4KRZA 4ROQA 2VGIA 1PKLA 2DIKA 4HYWA 1XG3A 4JPGA 4RPPA 1O5QA 4B5UA 3I4EA 4L80A 1PKYA 4B5VA 5TAOA 1E0UA 4FXJA 2HJPA 3GR4A 3R4IA 2HRWA 3QLLA 3M0KA 1F8IA 3FA4A 2BG5A 1M1BA 4IP7A 5JVLA 3SRFA 2V5JA 3QV9A 4YJ5A 2VWSA 1ZLPA 4QG9A 4B2DD 2QIWA 3ME3A 4YNGA 4L7ZA 3OYXA 4IMAA 3M0JA 3QTGA 1O68A 3GG8A 1M3UA 4TV5A 2VWTA 1F3XA 2DUAA 1GGOA 1S2TA 1JDEA 4FXFA 2WQDA 1S2WA 3T07A 1A3XA 4MG4A 1T5AA 4KCUA 4DRSA 1PKNA 3EOOA 1IZCA 1OQFA 3B8IA 2XZ7A 1A49A 4LSBA 1XG4A 4G1NA 3LYEA 3E5BA 3G2GA 3SRHA 3PP7A 4L9YA 1S2UA 2XDFA 4QGCA 1Z6KA 3LG3A 1KBLA 1A3WA 2VGGA 4KCVA 3E0WA 4IQEA 4QG8A 2ZE3A 1S2VA 3IS4A 3KHDA 1DXEA 2L5HA 3H6OA 1E0TA 3P0XA 3T0TA 4KCTA 1PYMA 2HWGA 2VGBA 3N25A 4B5TA 2VGFA 3HQOA 3KTXA 1DXFA 4KCWA 1AQFA 3QV7A 3U2ZA 1DQUA 4TV6A 3QZ6A 3EZ4A 4L9ZA 2XZ9A 1F61A 3SRDA 3QQWA 2V5KA 1O66A 1ZJHA 2HROA 3OQ8A 3E0VA 4IQDA 3T05A 3PUGA 4HYVA 3EOEA 2X0SA 1A5UA 3GQYA 3HQNA 1DIKA 2OLSA 3OYZA 3QV6A 1UJQA 4B5SA 1MUMA 4WJ8A 1KC7A 4QG6A 3QV8A 4B5XA 1U5VA 3SRKA 4B5WA 3BJFA 1IGWA 1OY0A
chains in the Genus database with same CATH superfamily
3LCLA 2PRLA 1OZMA 4GPNA 3NR0A 3S2LA 4H9XA 2WYSA 2OZTA 1X38A 3TJ4A 1ADOA 4UBPC 1NWSA 1KTNA 5FJTA 3H55A 1TV8A 3NQBA 4AWTA 5K9CA 2E9MA 2GWGA 2WSPA 1US2A 3IUHA 3KCJA 5GPRA 3NPUA 5CBIA 2WKJA 1MW3A 2V5JA 3IJ8A 3KUMA 3TN3A 1PJ9A 2ZYFA 4E8CA 3G1RA 1UYQA 3UA4A 5TIMA 3EMZA 2QZRA 3G18A 4GKLA 4BI7A 1NM9A 2DVXA 4QP0A 3BLOA 3G0SA 2WZHA 3DG6A 2FIQA 2Z6JA 4LF1A 3P7YA 3HPXA 2WZIA 3CMJA 3CO8A 3CV6A 3KVMA 3N9RA 2VDHA 3ZT6A 3P81A 3MU7A 4HA0A 2ZE3A 2A3LA 2BY1A 3QTPA 3QGKC 5JH2A 4RE0A 4H9TA 2V68A 2TMDA 3AZTA 4TOQA 4PEKA 2RDTA 3OVRA 3HB9A 3UD6A 5DN1A 2VGFA 4KCWA 4L4LA 5CG0A 1L2UA 3WFAA 2W92A 4S3BA 4XISA 1C8VA 4YWIA 2AQOA 4JIEA 3A24A 1NP0A 1XH0A 2ESCA 1XKJA 4A3YA 3I6RA 3P14A 3WBXA 1Y5WA 3TMLA 1RJPA 2C14A 3M1ZA 2AKMA 1E0XA 2LLEA 3N29A 2OSYA 4F9DA 3MSDA 2VT0A 4S2CA 1JDDA 1M9HA 1JCJA 2ZX6A 3LQGA 3L9CA 3RILA 3E02A 1EDGA 3A3WA 1SZEA 1EWEA 3Q67A 3WLJA 2ZKMX 1JNDA 4XKYA 3BQ5A 3ARTA 3TQPA 1EYWA 3NYZA 1FWJC 1LQAA 4OIFA 4CCZA 1MUCA 2PLKA 4GC4A 2PDPA 3SUUA 3TYZA 6TAAA 1B31A 3H2NA 4C91A 4M6QA 1MRQA 5HPOA 5ECVA 1W1VA 4Q8WA 4ADSA 4X2RA 2A6LA 1GPWA 1WDPA 1PVNA 5CSUA 2DZVA 4J28A 3TR9A 5E6ZA 3HGRA 3KCOA 3GLCA 1TELA 1KBLA 3WK1A 3UPWA 2I1OA 4GYFA 1FA2A 4AU0A 5JIWA 1L8PA 2FTPA 4PBEA 7TAAA 1DTNA 4BEUA 1I2NA 4IGNA 5AHIA 5HR7A 1VHNA 2VKZG 4AB4A 1K6AA 3TW7A 4OKDA 3RHGA 1FWTA 3T08A 2RH9A 4N9CA 3DBPA 1TV3A 4YTQA 2A7PA 2XGZA 4CD6A 1CXLA 3ITCA 2R8WA 4JTJA 1OY0A 2OLAA 3CT2A 5HAOA 3Q2DA 2VOMA 5EFDA 4KEUA 2NQJA 1UMLA 2QUMA 2VFHA 1R85A 3LK6A 3GXMA 4JHZA 3ARXA 1A5NC 3FCPA 1OCQA 1DE6A 4HNCA 2GWNA 2UZ9A 5JXQA 1OCBA 2FB3A 4KWVA 4QCEA 1S39A 2WLYA 2ZVRA 5EYWA 2VWSA 3APYA 3TLLA 2PMQA 2VC6A 3PZUA 3B9NA 2HE8A 1JZ8A 2CBIA 4L64A 4IPNB 1ITXA 4PGLA 3TVAA 2Y1HA 3BO9A 1GQIA 1TCMA 3PBVA 5TQLA 4AY7A 4ZOBA 3J7HA 3E5BA 1VJSA 1TYGA 1KV8A 1XGZA 1LBFA 3MUCA 4AD4A 4Q4OA 2WWCA 2PRHA 2DSUA 1KXQA 2V8ZA 3K1DA 4AIBA 2EXOA 2ISFA 2PTYA 1F6YA 2NT1A 2CKRA 3RU6A 1IXQA 2Y2WA 4Q8NA 1FUYA 3F4CA 1PDZA 3G0UA 4KETA 4PUWA 5H1WA 3DFPA 3ZZ1A 1VLWA 4A29A 4QEHA 5HMSA 4ZO6A 1K1DA 1ZJIA 3E2VA 3W2KA 4G2DA 2NXHA 1ZJHA 3IK2A 5LNRA 2ODOA 3VD4A 1H1NA 3ABRA 3WDRA 5I2UA 4HA3A 1PHQA 2PFHA 4TX8A 4D6HA 1NU5A 3RCYA 4HSNA 2VC5A 2AKZA 1LLZA 1F2JA 4HPNA 1JI2A 3K4AA 4HTYA 1PB0A 3THUA 4D6CA 1XLLA 2ZX7A 3EOLA 4JTFA 1H7OA 4ROQA 1CLXA 3T0AA 3A9IA 4XAGA 4Y7EA 2QPUA 4XG1A 3U3HA 3M0LA 2V3EA 1BRLB 3WD2A 3WF4A 2HRWA 3L4XA 2ZRZA 4XZBA 1ICSA 3KFTA 4B2DD 3CIVA 3IVUA 3QH2A 2V69A 5HNTA 1UBPC 2KZHA 4QITA 1FDYA 3RPTA 3WK3A 2A1YA 1NF0A 3HG3A 4AG0A 2G4JA 3M0XA 1VCFA 4UTFA 1XBZA 5PTDA 4B92A 1B3VA 1IYXA 3F2DA 5D8ZA 3AWNA 1NFGA 1W9UA 2OYKA 4Z1CA 3T8LA 8CGTA 2GK1A 1JZ5A 5LSMA 4D71A 4PSPA 1OX6A 4GFIA 4P7QA 5E1QA 2CLOA 1POJA 1YADA 5CPMA 1ITUA 1ICPA 4H6QA 4WK9A 3OQ8A 3TFXA 4NZCA 1XYAA 1GQLA 1HL9A 4QDMA 3P80A 2Z27A 1QPNA 2ZZ3A 3C3NA 1J2BA 3O06A 5LKYA 9CGTA 4JYFA 4XZLX 3Q58A 3IIZA 3NGJA 1B4EA 2VGIA 4DUWA 2CYGA 1MQQA 4WDWA 2FZBA 2PU1A 3ITTA 2JF6A 1W3JA 1DJQA 3S1GA 4S3AA 1S5VA 1H11A 4H8VA 4MM1A 3K4WA 1H2JA 3TV8A 1ESWA 5A6AA 3HA1A 3NYDA 3AXXA 4PMRA 2PDNA 4D6IA 3P82A 5D33A 1GGOA 1WZAA 4CEUC 3PTQA 3TQ0A 2QCHA 4M8UA 2A85A 4X9YA 2PF8A 3VU2A 4NZ5A 3WQVA 3GSMA 3RLVA 2X7VA 3GXFA 4R53A 4HTBA 1SR0A 3U57A 4TTUA 4U5IA 2IKJA 3IS4A 4IMGA 2YCKX 4DO6A 3TU9A 4DAIA 2OOGA 3DFTA 4H7CA 3SR7A 2Z2BA 3VGFA 2YFOA 3WK2A 2FZDA 1WUEA 2OO6A 4ZQNA 4PCTA 4L9ZA 3B9DA 3FOKA 4O28A 1BTCA 1A5UA 3K8KA 4QJ4B 1TVNA 3LPGA 2WMHA 4QTGA 2I9UA 1JAEA 4BI6A 1RXOB 1W9VA 1WDWA 2YA1A 4UWMA 1J2WA 2HNHA 1ONWA 5XINA 4B4HA 3T2PA 1HG3A 1E6SM 1ZRQA 4A3RA 1H4PA 4GUHA 3BGJA 2J7GA 3A3XA 1HL2A 3PR2A 4ZOAA 1YLVA 3SJNA 2E77A 4DO5A 4EOUA 2PAJA 4J35A 4CU8A 3NZ1A 2WQPA 3MO7A 3MCOA 2E8YA 2B7NA 3V18A 3C86A 3W86A 5JH1A 1N8WA 2YL9A 4CQAA 2IKGA 1WP6A 2DZUA 2XU2A 2H9AA 4OHQA 4TQTA 3D6NA 7ODCA 2WPGA 3PAOA 3C0JA 3CV2A 5ABFA 4CU6A 2XFFA 3AIWA 3IJIA 4QNWA 3CZGA 5D9MA 1R3RA 3PP7A 3FN9A 3P62A 4UTIA 4QGCA 2J78A 3GFXA 2OSXA 2ZA1A 3PFMA 2WVVB 2J6XA 3L4WA 4JQ4A 1UCWA 2D1ZA 3C56A 2PBGA 2NVCA 3ZJ7A 3K8LA 1DJWA 2XSBA 3P0WA 3PJTA 2PODA 4PR4A 5BRQA 5IFPA 1NF7A 3AISA 3BCDA 4NVTA 3GG1A 2B81A 2QF7A 3NM1A 2PDYA 5CBBA 1JXJA 4M56A 3UXLA 2A21A 6TIMA 3WQFA 2CU0A 4GQ0A 4WXYA 1EB3A 2VX7A 5G1MA 4JFSA 1O1HA 5C9XA 1R3VA 3LTPA 3KWXA 5C9ZA 3U2OA 2WKGA 1NOFA 4FX7A 1WKEA 3CV7A 5HR6A 5A94A 3RK8A 4XD5A 5M1TA 2Y89A 3QBUA 2YX0A 3LGGA 4WUIA 2G3FA 2XIMA 1GW1A 2YBUA 3AYSA 1QR7A 2QJGA 3I10A 5A6LA 4DWSC 1XD1A 5DCEA 2WVTA 1TWIA 1Z89A 2O9TA 3VIPA 1ZNNA 3PBUA 4M7SA 4KMQA 4IG2B 1DBTA 4XSLA 1GVOA 1K8XA 4DYEA 4AAJA 4S3GA 2QAPA 1D7KA 4XZ9A 3GH4A 2E5CA 2DSZA 2A6NA 5CJ5A 3W1LA 1KBIA 3SRHA 1QWGA 3ARVA 4AHPA 3Q4DA 2DUZA 1W5OA 1VGAA 4GX8A 3OW1A 3F4NA 2ZX9A 3L5MA 3GDMA 3N6HA 2ZICA 2XG9A 4GUJA 4OWGA 1MRAA 1UG6A 3DHDA 4AHQA 3SCRA 3AXMA 2WKLA 1UIOA 2E9BA 3IANA 4LH8A 2RKXA 3GC2A 4A35A 4XX6A 2X40A 1A5MC 2GJXB 4EPKA 4EX4A 1IEVA 3WSUA 1KCXA 3HOJA 3WH7A 2DT3A 1PEZA 2ZVIA 4LAKA 3UZJA 1TREA 3WQOA 2QJHA 4REQB 5LZLA 1ZTVA 1TV5A 4KFPA 1IEIA 3VNIA 4U3AA 1W91A 3RRXA 1ISYA 2XYLA 3VYLA 4FOKA 1V93A 3LI1A 4KFOA 1KCZA 4DBSA 3OA5A 3G77A 1EJ7L 2OO0A 3BURA 1U2YA 3BMWA 4XBSA 1P0EA 1BD0A 2CKSA 1L8NA 4TVUA 1NFPA 1TQXA 1B4KA 3NM3A 6PTDA 1X8CA 4E2OA 4FXRA 1E4MM 1EO5A 1VRXA 5D03A 3O7UA 5SWUA 3BVJA 4D72A 4NAFB 2HK1A 3KLKA 4NJGA 1UR9A 4IJRA 2QCCA 3IJ6A 1AL7A 3BGAA 2E67A 2XFRA 2ZRXA 4ZQOA 4U2YA 1R38A 4G7EB 4FX6M 4W87A 1LG2A 2INFA 1KCLA 4W88A 5BOOA 3E2SA 4F0HA 5M2FX 4DPPA 4JHMA 4W7VA 1KM6A 3VNLA 2OLSA 1HKVA 2BXYA 5FJIA 3R0UA 1C91A 4A3QA 2ZA3A 5MKGA 3MWAA 1ADDA 4I7UA 1IT8A 3VINA 3F4DA 3CWHA 1Z42A 5DRCA 2XTKA 3GHTA 4FI4A 1ADSA 1UH4A 1OX5A 1KRCC 3DFNA 3SCOA 4JHOA 4GVGA 4JTEA 1TZ9A 4ZTXA 5CZTA 4F66A 3PSWA 5AY7A 2EPHA 3G1SA 4N2YA 5J8LA 3RF9A 1NWTA 2Q8LA 3VOCA 3AWOA 4U33A 2R1LA 3F2BA 3GX9A 3GNOA 4BF9A 4AD5A 2EAWA 1JQVA 2FLIA 4A3UA 3TE9A 3VIMA 3V0UA 3FLUA 3R0KA 1HQTA 1HJXA 3VGGA 4E5TA 2XHYA 1QNSA 2IQ0A 1ZFJA 1O4UA 4QFUA 5CAKA 4H8NA 1XG4A 4JN8A 1JI1A 1JZ2A 3UG3A 1WDRA 1WOAA 4CQCA 4MNKA 2FB2A 2BHZA 4F0LA 2J4GA 3H6OA 3XISA 4CNUA 1UWQA 3DHPA 2ZADA 3FXGA 5CC3A 1GKPA 3K13A 4WSHA 4J9JA 1MXSA 1E6ZA 4MZ1A 3SECA 3UY7A 3C0QA 3ARUA 4Q8QA 3HZ3A 1W1B1 1UKOA 1D9EA 1XLDA 2PDCA 1UJQA 1LT8A 5D2VA 3AIQA 3CPRA 4HPXA 3T09A 4ZZ9A 2PWVA 2F2HA 3G5EA 2C91A 1IIGA 2BZNA 7CGTA 2OZ3A 3AS1A 2FVMA 1V8EA 4J7RA 4GXMA 3V5CA 1LOLA 1U1HA 4O4WA 4RNJA 1Q6OA 3G0XA 1G9HA 2XVNA 3IEBA 1Y0EA 3M46A 2CZ5A 4PRWA 3W7HA 3EKZA 4XZNX 4P8VA 2QCLA 2J88A 1EYEA 2QMJA 1C3FA 2PDJA 3QTGA 2ZUWA 3W7OA 2NW0A 1TPWA 3HPAA 3N6QA 4BI5A 4ATDA 4OQVA 1A3XA 7ENLA 4AMAA 3UGVA 2CCRA 2VI0A 4RX0A 3V0TA 1EH9A 1F7BA 1KFCA 3LHVA 4K1GA 4IIFA 3WLQA 1TZZA 3ABOA 3LCGA 2HS8A 3N9KA 2DT1A 1CI1A 1HVQA 2UWFA 1XLFA 3GH5A 2Z1BA 1PPIA 3GVQA 1GUVA 1YTDA 4PODA 2PTWA 4ACYA 1PO9A 3CEPA 4Y96A 3O15A 1RQEA 4DM2A 4CD8A 1M7XA 4R7WA 4Q7NA 3W01A 3TCSA 1XPGA 4TX9A 1Q8AA 4EIVA 4LS0A 4OE7A 4I7VA 4QAWA 4C65A 4JTKA 3AMGA 4DPQA 4H1ZA 3AUJA 4AQLA 2V2DA 5A1AA 3LHUA 4FIQA 1KM0A 2HVNA 2IMRA 2FVLA 2DZPA 2Y63A 3I7SA 3GWQA 1W1PA 3CL8A 1DL3A 4RPPA 1EJRC 4ZB0A 2WV8A 1SMDA 1VFSA 3GR4A 3FA4A 3QHMA 1QFEA 3MUZ1 2GUBA 2GJPA 1RD6A 4HU4A 2VCBA 3WO8A 3HGJA 3N4EA 3VI2A 3HFTA 3NURA 4XAYA 1DQWA 3I7RA 3GY1A 4PUMA 2FHCA 2EPKX 2BY2A 4JD4A 4C1NA 2OELA 3GYEA 4X3ZA 4LYKA 1HGYA 4AY8A 3EDJA 5I07A 1LORA 5M3WA 4CD5A 2O7SA 5E9AA 1CBGA 1VFLA 1V3IA 1RK6A 2XGIA 4TV6A 3SUVA 3UZWA 4UR8A 1O66A 2YA0A 3GDRA 4K8GA 1OBAA 2DY3A 2FPTA 4DWSD 4CD7A 1DJZA 3K1GA 4F48A 2PB1A 3AYTA 2H3DA 3TFCA 1H50A 1CDGA 4UCGA 3W2UA 1VBHA 1H09A 1ZB5A 4L6HA 1Q45A 2ZC8A 3RN6A 2BVDA 3UWQA 3M7SA 3WL1A 5CEWA 2RJGA 3Q65A 4GD0A 4GBUA 3C8FA 3B0VC 4XAPA 3R2GA 3W7MA 3N2XA 4JKLA 2E25A 3TN6A 5F4WA 4PB4A 3ZOAA 3E0FA 2YGYA 1L6YA 1V0KA 1QTWA 4DBEA 1J96A 1BXCA 3FHQA 1DWGM 1UUOA 4K8EA 4FXFA 3HG2A 3LZ3A 3W1RA 3P5ZA 4N4PA 4H7VA 1A5KC 2QCDB 3G3DA 2VX6A 1J93A 2DU2A 3DFOA 2AGKA 3PBWA 3PPCA 1NIUA 2XVGA 4GHRA 2D73A 4O54A 2PDBA 3A9BA 4I5XA 1ZY9A 1V6XA 1J8VA 2XN1A 1UPMB 5EKYA 1W1TA 5EA9A 1DXEA 4LS2A 1V3HA 4AXNA 3FGCA 3P0XA 3F5JA 2G3MA 4AZ5A 4XTIA 4C1NB 3LBCA 3S47A 3CWOX 3IJLA 1DTUA 4HOXA 2V2CA 1G5AA 2GUYA 3ZVHB 2UV8G 1LOSA 3GAYA 2PP3A 3HQNA 3N2MA 3UWZA 5DMLA 2HVOA 3VKJA 3CQKA 1MUMA 3VGDA 1MEHA 5HOSA 2F9RA 3QV8A 1XH1A 4L1GA 4O1EA 3O63A 1QPRA 4Q8TA 1UC4A 4M6PA 2FQIA 4AIUA 4Q4KA 3P67A 3OBAA 3LGDA 4AVFA 1E70M 2G96A 1XP3A 3B8VA 2WSYA 1LZOA 1QU4A 3HPZA 1PKLA 1GQNA 4AZ6A 1DIEA 1ALDA 3A23A 4MTVA 1XLHA 1FKXA 2GVLA 2REQA 3VIOA 3FJ6A 1OINA 5I3FA 3E12A 1TPEA 1SM9A 3QVQA 1VPQA 1AJZA 4FF5A 2VD8A 1IZJA 1X1OA 1MEIA 4J2MA 1ISXA 4XO7A 1VBRA 3WBEA 3GNRA 1QOXA 1DJGA 1K7FA 3B8IA 4HCHA 4JCLA 2ZWZA 1KO0A 3B05A 4LRTA 1ME7A 3CEUA 4V28A 2NV9A 3A4XA 1TMQA 1KBKA 4LB3A 3SGGA 2WOQA 4NZ4A 1I2OA 5BRPA 2NXIA 4KWUA 4GINA 1WOBA 4JY8A 3P61A 2Q8ZA 1Z9AA 5AC5A 3HPFA 3VCCA 4OJYA 1ONXA 1Q8JA 1PTDA 4OV9A 3HQOA 3NDOA 4ICNA 5CPQA 4D6JA 3SCUA 3MSRA 4YHGA 3WQDA 2ATSA 1DHPA 1E6NA 3QHOA 1FH7A 1JCMP 3PG8A 1W9DM 3EX4A 3GTFA 3VIJA 3TYAA 1IV8A 1Q65A 3PK7A 5L6UA 5XIAA 3U0HA 5DT7A 4HNLA 3BJFA 2CWXA 2G5WA 3G1HA 2QT3A 1AH4A 3ZJKA 4ACZB 3CUXA 3ZSTA 2QPXA 2E0PA 1GCYA 2DQWA 3M5XA 5FSEC 3EWDA 4FLQA 2WJZA 1E51A 5MKGB 3AZSA 1V51A 5A2BA 4IXHA 4MJMA 4HQVA 1DKWA 3A6OA 1XC4A 4ZO8A 3G6MA 3VNKA 3GU2A 4ROPA 5U7SA 1TJ1A 3O16A 4FP1A 1M5WA 2WC7A 2Z2AA 1XIIA 8TIMA 3WBYA 3T07A 3TCEA 1AZ1A 5B7ZA 4FMVA 4S3JA 8RUCA 2GDUA 4KBXA 2J7FA 4ZO9A 2Q09A 2R94A 4DLMA 3HMJG 3BV7A 1P7TA 3TQKA 1TPDA 4DUXA 4UTKA 5DXXA 3TQVA 3VZZA 1JF5A 6REQA 2VZTA 4B5TA 4R33A 1ELSA 1JCYA 1Z41A 3RYSA 3HBLA 2WVUA 3NQEA 4PUEA 2EHHA 1Z8AA 1GHRA 2J6VA 3B03A 2C3ZA 3SQMA 3WLNA 3N3TA 1BAGA 4ZB2A 5D2YA 3GHSA 4M81A 1JDCA 3VVGA 1EA9C 1H63A 2FZ9A 2ZWYA 1H62A 3FGCB 2D3NA 3DFQA 5E6YA 1YXCA 3QKEA 2VZSA 4J3SA 4KEZA 4BR1A 1QO2A 1KA9F 4F4RA 3BLKA 4GI9A 1VEOA 2YXGA 3HQ1A 2VX5A 2ZZ7A 1XRSA 2BX7A 3FW6A 2ZRYA 1C8QA 3ZT5A 4HK7A 3TA9A 2NVAA 1C93A 3WJZA 1XDMA 4XWUA 2OU4A 3REQB 2DDXA 4X61A 1FH9A 1K4HA 1UR3M 5DMNA 1C8XA 3A21A 3GW0A 3EOOA 1GOIA 3NSNA 3KOZA 3W0KA 1BQCA 3UA3A 2YFNA 2OEKA 4POCA 3WCZA 3IK4A 2Y85A 4H83A 5KEZA 4K1WA 2L5HA 1EQCA 5K4ZA 1RQHA 2Y8VA 3VFLA 2D2OA 2VFDA 4Z2GA 3DGRA 2BSLA 3RLUA 2HCVA 4DELA 4O4VA 2OJPA 2YW4A 3V75A 5F4SA 3S9YA 1N8FA 5BXRA 3O3RA 3PJUA 5BWFA 2QEZA 3MSGA 2QUUA 1CIUA 2CW6A 4QDWA 3TW6A 4HYVA 3PB2A 1L0PA 3GC5A 1W31A 1HP4A 2PWDA 4YVVA 4AX6A 4MY1A 4NNAA 4UTWC 2ZRVA 2UY2A 3CC1A 3UGRA 3WLTA 3I4KA 4XIAA 4GZJA 4LYPA 3WENA 4LUIA 4KWOA 4PMYA 4Y9NA 4M29A 1EJUC 2QVNA 2ZUUA 3THQA 5EL1A 4N9EA 1BXNA 3BG5A 1R3QA 2WHMA 3S5OA 3OG2A 3VTRA 4PYSA 3MJYA 3BW3A 3SGUA 1YXDA 3U48A 4RDZA 5I7GA 2CEQA 3HU7A 4MJ2A 3MV01 4LEFA 1FCQA 4Q8MA 2D22A 3S2MA 3NQ2A 3LCHA 1IEWA 2O4MA 4I90A 4UFIA 2J9YA 1R7AA 1V6UA 1E71M 5FAGA 3VOIA 1VZWA 4QJ3B 3DI1A 1J0JA 4AWUA 4FNRA 4B4FA 4QG8A 3W7LA 3GVWA 1NELA 3MANA 4WHBA 3I3EA 4ORMA 5FF4A 4KCTA 3ERPA 2QCEA 4QJ1A 3VX0A 5A3HA 2Z1VA 3BGGA 7REQB 3GBEA 3SN4A 2P10A 5CSRA 3QF0A 3W71A 4AISA 1P4CA 1JG9A 4FS9A 1QI0A 1EX5A 3K2GA 3LHTA 1VCVA 1SW3A 4AD0A 3CK5A 2QDDA 1TJPA 1JAKA 3DH7A 4ZOEA 5BOEA 3UZYA 1L6FA 2E6FA 1US3A 2ZXQA 3TX9A 3LV5A 2DJXA 3MWCA 4Z08A 3FVDA 2FZNA 3NEVA 1U5JA 4F0RA 4RK8A 2FMNA 1XLCA 3SY8A 4LAOA 2OYMA 4PULA 3C2EA 4L7ZA 3P60A 5HWMA 1YIXA 3DC8A 4E4UA 4GK8A 1UD3A 4J3XA 3W84A 2I17A 2W9MA 3GAKA 1L6GA 5LIXX 1SYTA 1CXHA 1RP8A 1VBJA 4JTCA 5LIKX 1XIJA 2PSNA 1S2UA 3N11A 1TJ0A 3TYUA 4JTUA 3MKVA 2WVSA 4A05A 3VK5A 2QMKA 1Q2RA 2I57A 3PJXA 1EIXA 4KPLA 3NCOA 3RPDA 5J04A 4GG9A 3SSJA 1P6BA 4JBRA 4KW2A 3IGUA 1Q7ZA 4ZCWA 2BXZA 5AC6A 4RXFA 4CCEA 4FLRA 3PC0A 1LT7A 3UG4A 1TRDA 4CNTA 4LALA 3W2JA 2E28A 5D05A 1X6NA 4HZ8A 1SPQA 3LTSA 2H90A 2G3IA 1UR8A 4HBKA 3E5PA 1TPB1 3W72A 2FGBA 5GNZA 1TTQA 3TA6A 3M44A 2VFGA 3GBDA 3RM4A 3Q45A 1CYGA 2IUZA 5M17A 3O0KA 1MW0A 1RBOB 2W0UA 3CAVA 3QZEA 2V5LA 1JDAA 4JEQA 1UWAA 3TC3A 3A4AA 2X41A 3PFRA 3G24A 4H04A 2PLJA 1OVDA 4DRSA 3MUIA 1BGAA 4FNUA 1B90A 3AAMA 4EVZA 3WNKA 3AC0A 3TNOA 3CTTA 3E96A 3L67A 5HQEA 4O1FA 4LUTB 4IH3A 1R9YA 5FF7A 3BAWA 5BCAA 4W84A 2Z7GA 3DESA 2FVKA 3UERA 3VABA 1KLYA 4NU7A 1MUWA 2WHJA 4HD5A 3MVIA 3L0GA 1IQ8A 2CBJA 1OIFA 4ML4A 2BV9A 1O5RA 4HPHA 5G4HC 2F8QA 4IMDA 2BLEA 2ZC1A 1WZLA 2OQHA 1FCUA 1ZP4A 1KLZA 3SIMA 3GUWA 5ABGA 5C54A 3EAUA 3F03K 3OBKA 2OR2A 4MFEA 3UU0A 4DJFD 2Y7FA 4UZUA 1MDRA 1IE7C 2OT0A 1XYZA 4O0ZA 2ASHA 3AXIA 4Y8FA 1W1ZA 5D2WA 4KRZA 3W7RA 4O1BA 2PLCA 2Z2UA 1XS2A 4O1CA 4HHMA 4PCNA 3ONCA 2IS7A 4HHHA 3CJPA 4GYKA 2V82A 1Z7AA 3FFSA 1JPKA 3ZWSA 2XIJA 4AF0A 1SU5A 5A6TC 1EP1A 2HMCA 4EACA 3GNPA 3VDHA 5DLCA 3PBYA 1ZJAA 1UC5A 1AG1O 2YDQA 1I75A 2QHAA 4DNMA 1BWLA 4BK9A 1KTCA 1O95A 1LWJA 4RLIA 3W00A 3EDEA 4I6KA 1I2PA 1H7WA 5K7JA 1JF6A 1FWBC 1TVLA 3QPZA 4AY1A 2D0HA 5LXXA 1HT6A 5K2ZA 3M0MA 3QMSA 1U83A 3N14A 1J6OA 4S3DA 4HMEA 3T78A 3A22A 1CENA 1OC6A 4DQWA 4KQNA 2CPUA 3T42A 4O57A 3MUY1 3MYOA 2HQAA 4CCCA 2XZ9A 4Z1AA 3HG5A 1KW1A 2HV5A 3QXBA 1RCXB 1PDYA 4JIHA 2WSRA 4CQ8A 3W38A 2GOUA 1RVGA 4PMNA 5CJNA 3ZFHA 1EPVA 2AQWA 3UP8A 4LGXA 2GSHA 4B5WA 2OX1A 2B7QA 3RU8X 4DXXA 1PAMA 1HJWA 2YSWA 3USZA 4IMCA 3NPXA 4IWWA 4RPQA 3FXYA 4AIOA 4WCJA 5DELA 2F84A 5FJUA 3MBDA 5LA2A 1GWJA 1CXEA 2RAGA 5I24A 2V2HA 4DHGA 3FKRA 1M65A 2Y61A 3AXHA 5BW6A 1MI3A 2PDFA 1SW7A 1PKYA 1TTIA 3M64A 4FXJA 5HPCA 5F1UA 5CC7A 1EP2A 4ZFCA 4IP7A 3N2TA 4DZ5A 2QV4A 1P1MA 3NQGA 1SJAA 4M82A 3QFWA 4LAZA 3FDKA 1OC7A 4JY9A 3GG8A 1JZ4A 1PXGA 3POHA 3D46A 1SMAA 1T5AA 4WY0A 2WNQA 3LYEA 3B9EA 2J7EA 4NT0A 1SFJA 4IPPA 3HJZA 1V03A 1RP9A 3R25A 1H7NA 3ISIX 1XHGA 5IM51 4X0VA 3UXKA 1BVZA 1A47A 3VZYA 1M68A 1ITQA 4ERAA 4M80A 5HMEA 4AEEA 2A7RA 5T8GA 4JTSA 3VOJA 1A4MA 5JMUA 2J24A 1GZ1A 2WMIB 4NNCA 1IT0A 2WM1A 5HINA 1QI4A 3S9IA 3K46A 1T96A 3M0IA 4OT7A 1NTHA 4I8DA 3VA8A 1G4TA 4XZMX 7TIMA 1P0NA 4E4PA 3KVJA 5FJPA 1R2SA 4LV9A 2HXUA 2V5DA 3N6JA 5BWAA 2CZVA 2D24A 3TTEA 3CLMA 1XJBA 2J7DA 1KWGA 3UEQA 3L0NA 3U6WA 1TPH1 4WY0F 1PIFA 1KM3A 1GJUA 1Z44A 4UTMA 3M0HA 4LYRA 3EBVA 4GX9A 4YLWA 3ARPA 3Q37A 4JFTA 3IV3A 2ZXBA 2ZOXA 2D20A 1TA3B 1IXNA 3SM0A 1PS9A 1CGXA 1FBAA 4O52A 4XD6A 3KDOA 3RJXA 3DZ1A 4MB4A 3SN0A 3I6TA 4ZE4A 1GT8A 1WZKA 2GSEA 3G2GA 4US6A 4K7YA 4FF7A 4GQRA 4IFKA 3L4TA 4R7JA 1DORA 3S83A 3E0WA 2RFGA 1SJBA 1KTBA 3ENLA 3CUIA 1MW1A 4Q33A 4LUYA 3CM4A 1S3TC 5DMYA 1HNYA 2R1MA 3JS3A 4M1RA 2RGMA 1EOKA 3TLQA 2HWGA 2GDQA 1WCGA 3S6TA 4UTTC 2J9ZA 3N25A 5REQA 4LF2A 3O2LA 3H2OA 1Q7QA 4L6OA 1TWWA 1O6IA 2W79A 2WNNA 3RLGA 4O0KA 1QOPA 3AU2A 3KBJA 1QASA 2XH2A 5HQMA 3DG3A 3AYVA 2E8ZA 4NYYA 4JL1A 4U28A 3R8RA 5LNUA 5D02A 4CNOA 1JCXA 2WZTA 3WDIA 2R6OA 3NAVA 5EMYA 4XSMA 2KX9A 1FFQA 1V0LA 3OO2A 4HSHA 3PSVA 1ECEA 2VELA 2WC3A 5EMLA 4DEFA 1SUXA 1ISWA 1VCGA 1XLMA 4GY0A 1PIGA 2Y5JA 3OOQA 1CGTA 3L68A 3QC3A 1AJ2A 4LNYA 4LU0A 2PGEA 2FMOA 3GC4A 4RZBA 1D2KA 3K30A 3UJ2A 3UG8A 3B0XA 5IDIA 4BWLC 1MFUA 3OA3A 3RX4A 2Y7GA 4BZYA 3QYSA 4NG3A 1JRBA 3DYOA 3OG3A 4XAZA 1Q4WA 4C6FA 1YE4A 2QQ6A 4Y9AA 1Q5MA 3QQ0A 3DUGA 1N55A 1S1RA 4A2SA 2Z7KA 4FPSA 2X0HA 1EP3A 1VFUA 2PTDA 1ZCCA 5C9UA 5DY2A 1IEXA 4V1XA 1V5XA 4UQDA 4B3KA 3EZ4A 1XSIA 3WNMA 4N02A 3LCFA 1KBBA 3LV6A 1TV2A 3REQA 2TPSA 2J7BA 1Y5XA 2E6DA 4UIOA 3IJ7A 1K70A 3R7MA 3OODA 1EOMA 1T99A 3OGRA 2JGYA 5CSSA 1F9CA 2W6RA 4TVCA 3WDPP 4AVOA 1T41A 1TO3A 4H8HA 1VPYA 5CSYA 1E6XM 1F3WA 2TODA 1KM5A 1XIGA 4FXSA 3ZT7A 1WUFA 4WGXA 4XQ6A 5ABEA 3FV9A 3W2MA 1OC5A 3LNPA 5LNVA 1UA7A 2GQ8A 3CZ8A 1UKTA 4MLJA 4ADTA 4EKJA 1E1FA 1JGMA 2F6UA 4P61A 1D7FA 1ITCA 4YTUA 5AC7A 4XK2A 5EBAA 4JTRA 2VZUA 3AXKA 1NFBA 3TZFA 1EC7A 3LXBA 3IGSA 1CPUA 4J27A 1DEDA 3CTLA 1LG1A 3TJIA 3VO0A 1UJPA 3FJNA 4UFJA 5B7YA 3RJYA 4FNPA 5G2HA 2WPBA 1XCXA 3RXZA 2PDLA 4RZ4A 1K8YA 3AIBA 3SFKA 1B9ZA 3W82A 1EXBA 3ZJ8A 3DU0A 1U30A 1YQ2A 2WZEA 4P7NA 1UQZA 1XDJA 2EEXA 1GORA 1TWDA 1W3IA 2DZSA 4H2CA 1JNEA 3VIKA 4XV0A 2OEMA 3V35A 1ZBWA 3ICJA 3P93A 4H9MA 3AICA 1ODUA 2EF9A 5J5RA 4WDXA 1HW6A 3MP3A 1B3XA 3SCPA 3GS6A 2YDAA 3PUGA 1J4EA 2DVUA 1S2AA 3KS5A 3VCNA 2HK0A 4HOWA 3T40A 2ZXAA 3F4WA 2GFTA 3APTA 4GH1A 4MADA 1R9ZA 3W7JA 1GTEA 5DQPA 2VEKA 3SQLA 3HF3A 3A4WA 2G41A 1EGZA 3LUTA 4WD0A 3SEPA 3LBOA 3WH6A 1XCFA 2F38A 2PDUA 4ZENA 1HTIA 1O1ZA 2GK1B 2DSKA 2XUCA 3GDTA 1OYAA 3C2RA 3W7CA 3WY1A 3O6DA 4YS1A 3W83A 5I78A 3LGEA 3PG9A 1W3HA 3ANVA 2NQLA 3AS2A 3THDA 1I45A 1C9DA 3W2LA 3MCNA 3VCRA 2ZFAA 3JR2A 1RQBA 3QGAC 3QSRA 1QVBA 3CMFA 2HNEA 3RNDA 2QCMA 4AYSA 3WQWA 2PP0A 3ZR4A 1POKA 4PBFA 3WH9A 3GKAA 4JICA 2J74A 1R9XA 2OWCA 4C7FA 4QQ3A 1DXFA 3PZQA 1KFWA 5EGRA 3SDOA 1XM3A 3O05A 2HROA 3MHGA 1EXPA 1ZJBA 3CQ0A 2PDIA 3WDQA 4GH3A 3NFUA 5E70A 3W25A 1RPXA 2VO5A 5CPSA 1KWKA 1X7IA 3RCMA 3UBPC 3TEVA 5AZ0A 3W74A 4JTTA 3H7UA 1JYXA 5A8OA 1VBGA 3WBAA 3KVKA 3RLHA 1PKMA 3AHTA 1S38A 4GUFA 1Q6FA 2CBUA 1Q85A 1V7YA 5FF0A 1Z48A 1CGVA 1NEYA 2R82A 3KX6A 3ZSSA 2V3FA 2O56A 4M0XA 2ZDRA 1M1BA 1OK4A 5F7UA 3EWCA 3NOYA 2B7PA 1HUVA 1V02E 4I5UA 1MZHA 5KITA 3NZRA 3BAXA 4CQBA 1FY6A 3WLOA 3OYXA 2XN0A 4AD2A 1VQTA 4ZE5A 3SCVA 3V7PA 4ENLA 3VD3A 3W88A 4GABA 1EQPA 4HJWA 5G2IA 3WG6A 3H4WA 3QZAA 3DYPA 1OT1A 3OLEA 1D3GA 1ZBKA 2DZTA 3TWBA 2XIQA 4IX2A 4AC7C 3PHAA 4CQDA 5A95A 1RJRA 3EPOA 1RHCA 3A13A 5F2GA 4JIRA 3B9OA 4W86A 2HZGA 3DENA 1W56A 1OIMA 2Z00A 3TC7A 5FAJA 4CQ9A 1AQFA 1DWIM 2VR5A 3G22A 3DG7A 4DUVA 1LLWA 1J6PA 4KGJA 3BG3A 2OT1A 3VILA 3NQDA 5DEZA 3W1TA 2AMGA 4LRSA 2Z6IA 3CZLA 3TIMA 1GK8A 2HE5A 4KS0A 2NLYA 1N82A 3DFHA 4MDPA 1FWFC 1TPUA 3SB0A 3V36A 1IWBA 3RFAA 4NZFA 4JPGA 3NUKA 3WLIA 4Z17A 4A8NA 1FWAC 2ZUSA 1UWSA 2XJ7A 4IL0A 1JD7A 4WDUA 3KRSA 1OFAA 3MVTA 3GVGA 1Z69A 4WJEA 2E9LA 3SRFA 2Y5EA 3E49A 4JKKA 3ELFA 1RBAA 4TIMA 4LJ3A 3W02A 3QFEA 3GB6A 4C6LA 1QCWA 1NDVA 3RGTA 1K8ZA 4Q8OA 1I4NA 2YLLA 3BLFA 6ENLA 5EU9A 1H5VA 4LUSB 4ECLA 5FEXA 3ECQA 3KDNA 2JBMA 4HN8A 2NVDA 1V0NA 3VD9A 3HN3A 1A3WA 3PUEA 3STGA 3WNOA 1MXDA 2ATMA 3W6LA 5HXMA 4W7UA 1AMYA 1QOQA 3EXSA 1QK2A 6XIMA 3TYDA 4J3ZA 2PWFA 1N7KA 1K7EA 3VM7A 6REQB 4Q4MA 3WL0A 4DUOA 1LQ2A 3NQAA 1VFTA 4WJ8A 3S6OA 4GQQA 4BQ5A 3SRKA 4H6RA 3L4ZA 3THAA 4L1WA 1A3HA 2DEPA 4QISA 2YDRA 2FGLA 2Y6ZA 1JPMA 1VRDA 5E5CA 4EPDC 2R1PA 3UVIA 1KBJA 1XUUA 1X6LA 3ARRA 3WELA 4B5VA 3O6CA 1BYCA 1AA1B 2R1KA 3PANA 3STEA 4QXIA 3EEGA 4C90A 4LAUA 2WLZA 4YCOA 1OB0A 3MI3A 1Q6GA 4TV5A 1DJXA 2OWXA 3F5LA 2XVPA 5E9XA 1JYWA 4MG4A 1SO6A 1BG9A 1LWHA 2GVJA 1SSDA 4QR6A 5L9FA 4PL2A 2J62A 4XZIA 4IIGA 5FJRA 3CHFA 2O55A 1Y7VA 3QY6A 4TO8A 2BGQA 5D9OA 1U33A 1GOQA 2O9RA 3FDGA 3KXQA 4GO9A 4K37A 3C61A 2ZX5A 1S5NA 4U10A 4W5ZA 2VUNA 3MCMA 2JALA 1LF1A 4HNUA 3BL3A 3EXTA 4GBDA 4J4KA 1XKYA 4D8ZA 4JFWA 3GKFA 1P1XA 1BYBA 3L2LA 5LIYX 1WDQA 2FPYA 4B3LA 3EA1A 1RAKA 1GJPA 1R6WA 3WEMA 4KWWA 4URIA 4DBUA 1EC8A 1ENUA 2P0OA 1B54A 1ZUAX 3U4FA 3IJQA 3FYYA 1UWTA 4DX3A 4U31A 4AZGA 4NSBA 2DP3A 1W37A 4JR5A 4ES4A 4GI8A 5TF0A 4BQ4A 4Z1YA 4P7RA 4C1LA 4PC8A 2QIWA 1RA5A 4KEMA 1XISA 3WLSA 1L9WA 1K03A 1XBVA 3GZAA 1V6VA 3N2BA 2PC8A 3NQ6A 5HBFA 4IIDA 1TQJA 2JGQA 2YCJA 4GOAA 4PA8A 3EYPA 3TAKA 4JN6A 1XFCA 3V0SA 4L9YA 1QNPA 4ZSUA 1GOOA 3W24A 1NY1A 1E73M 1PUDA 1SO3A 4PUKA 2JFEX 1MWOA 3H2EA 3LSCA 1W6TA 2GUUA 3GNDA 4GI6A 3WLLA 3M16A 1TZ7A 4XAFA 4XD3A 3VNYA 3GR8A 2Z26A 3LENA 1CZ1A 2Y8KA 3GW3A 4Q8UA 1I1WA 2Z28A 5A8MA 4AUBA 2X0SA 2PWUA 2PCQA 4AZCA 1I0BA 2QW5A 3CWNA 4Z1BA 2EG6A 3PVFA 3O9NA 4QJ5B 3KS6A 5IHSA 2J8TA 3N1AA 1GPFA 2WK2A 1OF6A 4WSKA 3PZGA 1OABA 4E2DA 4TR9A 2YLAA 1KFBA 3VPLA 4U3CA 4E2VA 3NDZA 1FWNA 4BF5A 1TPC1 2JEQA 2OVLA 2YCLA 2F61A 5LIUX 4XUYA 4G8TA 3D3FA 4YNGA 4MIMA 3ZR5A 4ZODA 4AZ7A 2OODA 3WNPA 4Z1DA 2EPMX 2R14A 1ZZMA 3B06A 4NY2A 2Q8XA 1R3TA 5A6BA 4QSFA 3OZYA 1VF8A 2AL2A 1PCKA 3UJSA 1ZP3A 1DP0A 2EPNA 4IZGA 4HOZA 1XIBA 3CXOA 5LGXA 3UXDA 1S3HA 2C6QA 1SFSA 2CZDA 2I7GA 4WOQA 1FWGC 3W9ZA 3W76A 4FR6A 5D38A 6ALDA 4U5KA 3V5FA 2W63A 4YTRA 1GNXA 2AQVA 3NQMA 5XIMA 3H8AA 1V02A 2PDQA 5DMMA 1FTXA 2BMBA 3C2YA 4U2ZA 1GVQA 1LL6A 2D23A 1JR1A 3EWUA 1Q4NX 3UR8A 1RLCL 2TSYA 3TW9A 4GCAA 4BS0A 4RJEA 3BARA 4EXBA 2H8XA 2GYIA 4WX2A 3TAOA 1B3YA 2PDKA 5AYIA 3MTWA 3PTDA 4GQGA 4DNHA 1Q63A 4H8UA 4NXSA 5C6MA 4O10A 1F4AA 2J8FA 3KEHA 3SY5A 1H7RA 1O68A 4JZ5A 5FESA 2Z24A 2J75A 1BVNP 1VYSX 2DPEA 4E0CA 4O18A 3UZ5A 4MWAD 3T7VA 4ATLA 3USBA 4C1KA 2NX9A 5KZ6A 2I5GA 4NX0A 4O1DA 3OLGA 4FK9A 4QRNA 3KHDA 1J12A 1SSGA 2VZOA 5AHMA 4X22A 3PWGA 1J5SA 2CIPA 2BGNE 3N34A 4KRUA 3CHDA 4CUCA 3WD4A 4H2HA 5I02A 5H8MA 4V27A 3H70A 4FSAA 1TIMA 1DIDA 5K3VA 4UQEA 2UY3A 1BWKA 4QEEA 3HJEA 1XGDA 1YRRA 2WHKA 4PH6A 3OBEA 4L65A 3IARA 3W7DA 4O15A 1QO5A 5G1TA 3TDFA 3PBMA 3N2CA 3CGTA 5IBXC 1J9YA 3ZLGA 1KNWA 3UWEA 3N13A 1B3WA 4LVDA 1EL3A 3WUBA 2ZUVA 4M7TA 2PZ0A 3W23A 3T0DA 1YEYA 4WJXA 2ICSA 5JVLA 1J01A 1QI5A 1EGMA 1OF8A 1EPXA 3LMYA 3NQVA 2ZCGA 3OGSA 1K77A 3PY2A 3VMNA 2Y7DA 1RALA 1V3KA 1S2TA 3V4BA 3K4DA 4MPKA 3BJSA 1H0GA 3HV9A 4HMNA 4GNKB 5FA5A 3H2AA 3WJSA 3OZMA 2WBKA 4Z2JA 1KFKA 3AMDA 1K9TA 3CUGA 3C0SA 4XKMA 2IXUA 3RUBL 1DWHM 3PTMA 2PGFA 1LRQA 4JNYA 1XIFA 2WO5A 4P7LA 3BPWA 1DWJM 4LFYA 1B1YA 3UJEA 4GJJA 1R3SA 1F74A 1OJXA 4EK7A 4DXVA 4OOZA 3N73A 3IUDA 3IGXA 2VFIA 1OFOA 2ACQA 1TR1A 1M03A 1EKOA 1FDZA 5T9CE 1WO2A 4AIEA 3T4WA 5GQBA 3UJFA 4JNMA 4ICCX 2FH6A 2PI6A 4TMCA 2INZA 3NZPA 3ZVIA 1UROA 2HTMA 4RDWA 3TSDA 1OG0A 2NQHA 3MMWA 3IIXA 4GMEA 3W7PA 3COTA 3RPMA 1VYRA 1OFDA 4S39A 5B80A 3N4AA 2BFGA 2C0HA 2PTXA 5E0KA 3SZ8A 3IWPA 1KM2A 1RY0A 4HZ7A 1ZGDA 2H9AB 3QJAA 2DUAA 3ZIZA 5CCZA 2VEMA 3GM8A 3LPPA 4MAZA 1V3LA 2BHYA 4WIWA 1W5QA 1XQLA 1P6CA 1QUMA 1HO4A 2A2IA 1V08A 1XX1A 2VNCA 3CPUA 1X98A 3CZJA 2Y0FA 3T2OA 4HK6A 1WPCA 1KXTA 3H21A 4KFNA 2B4GA 3PPHA 1CGYA 1R2RA 1VFHA 1I2RA 3CASA 3KE0A 2ZQ0A 3A12A 1NDZA 4WLCA 1QPOA 6XIAA 1YDYA 2PWEA 1H1ZA 2VDIA 4RKAA 5G2WA 2P0IA 4FHAA 4DZIA 3MDUA 1LDCA 2W67A 4H9VA 2E4TA 4ZSTA 5BMWA 4CVWA 1BTMA 1F8MA 1QBAA 4HYWA 3LNMA 4HGXA 4PUJA 2OTDA 4JFVA 4ZB5A 3WD0A 2DGAA 1H61A 4ML9A 3T4CA 4NUWA 1FHVA 5TAOA 3AQUA 1S1PA 3YPIA 2C79A 4MNMA 4AEOA 5C2CA 5TD4A 4ZQPA 2P76A 3CS2A 4JOMA 3W2NA 4N6FA 4HU8A 5F2LA 1IEQA 2GQ9A 2VRJA 5AHNA 3WQ8A 4PMXA 4WGHA 4F40A 3NL2A 4JYDA 1FWDC 2X16A 3MO4A 4JTQA 2AL2B 1LBLA 2NUXA 4M1BA 3BMVA 1GOMA 1OX4A 3ZS4A 1J0ZA 3QN3A 2J25A 4Q3MA 2WCAA 3TTOA 3AIVA 3CUZA 5BROA 3WJXA 1VBUA 4BFAA 3H24A 1K9EA 2GJNA 5DCBA 5DFAA 4DWDA 4MY8A 3QV7A 3SCWA 3EDFA 2VEFA 3QMTA 4TMBA 2ALRA 1YPFA 3U8GA 1Y65A 3TP4A 1OFBA 5CG7A 3SADA 2E3ZA 4L6DA 1AL8A 2JK2A 1XGEA 2CLPA 1PIIA 1EJWC 1VIZA 4ACZA 4FNTA 4IICA 2JEPA 3TONA 2GJXA 1G7UA 3GDKA 3CQJA 5CZKA 1ZENA 4PUDA 4F2BA 1V79A 3WNNA 3VD7A 3TYCA 5AHEA 1RK5A 2QYGA 1M01A 3S1XA 3VM5A 4P5UA 1AQMA 3E9AA 3ARZA 1FFRA 3PUDA 2W62A 1DOSA 2JQXA 2Y5SA 2UY5A 3DECA 1Q13A 4KRTA 3WQEA 5EY5A 1I0DA 2JIEA 1C92A 3TTSA 4E3TA 2VENA 2POZA 1IWPA 1DJIA 4ZQRA 4NZ1A 8XIAA 3MHUA 1EA0A 4ZO7A 3EB2A 3GXIA 5JU6A 3STFA 2BBFA 4FALA 1LL7A 4X0NA 4HYRA 3FJLA 4UUIA 4Y90A 3W75A 1G1YA 1FVPA 3LG3A 7A3HA 4UXDA 2F6KA 1YKWA 5CBJA 3RO6A 1XLBA 2V3GA 3KOWA 4NRRA 1WXZA 5LXEA 1SFLA 3KWSA 4MLRA 3U7BA 2CITA 3KLLA 4QS5A 3OGVA 4V33A 2ZE0A 1X39A 2XH4A 3L5AA 4IGMA 4RCXA 4S3EA 3MT1A 5I3DA 2A79A 4ZQMA 2QXWA 1VEMA 2WCSA 3I3DA 4LUSA 4CN4A 4MAVA 4K8HA 1RY8A 1XFBA 2Z1WA 4GUIA 4D6DA 4MSSA 1ME8A 5ECUA 5FL0A 4B16A 3N19B 4UTLA 3ZWTA 2QUTA 1G69A 1ZAIA 1W2PA 1BEUA 3AS3A 3BC9A 1VPXA 3GFYA 1XWYA 3BH4A 3QOMA 1JEZA 3RMEA 5MF5A 3IGHX 2QDHA 2FTYA 2C71A 1CEOA 2BVWA 3XIMA 2HXTA 4ZBCA 3WJYA 3M0KA 2BG5A 2NWRA 4PRTA 4LCQA 4IPJA 3R6IA 1IR2A 2EKGA 3SUWA 1UR4A 2E5BA 3BZJA 4ONVA 4I6VA 4DJEC 2TYSA 2Z25A 4Q4SA 5CLWA 3W7QA 3APGA 3NXLA 5K4XA 2ZTKA 4MB1A 4IMFA 4MJ4A 3EX6A 6A3HA 1E4NA 1JZ6A 1YYAA 4IIEA 3UCCA 3U9IA 1WXJA 4YYCA 1JCNA 1OADA 4G6CA 1OZQA 3FYPA 4TVDA 2VXNA 1YNPA 1LROA 5GNYA 4FLOA 2NUWA 3H2FA 4JTHA 3NL6A 2EJAA 3DCPA 4QAIA 4A22A 1BVWA 3CIWA 1EC9A 4PRRA 3BAYA 3E38A 1B3OA 2ADAA 2B7OA 1U5VA 1R7OA 4UTWA 1KKOA 1UD5A 1BYDA 5FF3A 4UR7A 3CLWA 5KSWA 1OSEA 4NI3A 3GXDA 3MUAA 3EDDA 3G6LA 3MS8A 4JFUA 2V5CA 1EEXA 5FOOA 4US5D 4REQA 3AO0A 3MKKA 3KM8A 1V4YA 4IGHA 4WOZA 2QGYA 4MWAA 3BAIA 2O9PA 2XIIA 3A3HA 1UH3A 3M0JA 2J7CA 3ITVA 3AIEA 1XH2A 3DIPA 5AHLA 5A2CA 1ZQ5A 4RE3A 4IIBA 1OD8A 1P43A 3EX2A 3FHAA 2ZZ4A 3II1A 4V2XA 4TU1A 1XIEA 3BW4A 1YBQB 1TWSA 4GZ7A 1OGBA 3DFSA 3U4AA 3OLIA 3LX9A 4PTNA 2NSXA 1LM1A 5BXSA 1FH8A 3SFWA 4Y9OA 4H41A 4Q4PA 5F1VA 4EXAA 1PWLA 1PX8A 3HG4A 1G67A 1F05A 2E1WA 2PCEA 3P8JA 3HM7A 3D0CA 4JQ2A 4AWSA 3V3WA 3ZYZA 3WMSA 2QV5A 2A3HA 1DJNA 5F2MA 2DH2A 2HSAA 3BCJA 3A4JA 5G5IA 3KRUA 4PUNA 2DV0A 1W0MA 3BMXA 4WR3A 3GNNA 5BU9A 1NQ6A 3S5ZA 1J11A 1FHUA 3MJMA 3EMCA 4BQ2A 3G8RA 1F6KA 1NDWA 1PZ3A 3GU1A 1NOWA 2VMFA 1ZSXA 2ZUMA 1RCOB 2I5IA 1G01A 3GTNA 3MV11 1OCNA 4PMVA 3SUSA 1S5TA 1CXIA 1LJYA 4JS3A 4V1YA 3DKJA 3VC5A 1VEPA 3GE7A 3LHZA 3POCA 4J1OA 3JZUA 5A6BD 3IPWA 1K9DA 3VIGA 4LBUA 3T2QA 3H7RA 1UR2A 3ATYA 3O0FA 2HPIA 3L4VA 4W7WA 2QS8A 1MMFA 3GD6A 4UNIA 2QCFA 2GVEA 1XIDA 4XZWA 6CGTA 3C5QA 2VCAA 1EEPA 2VEGA 4N4QA 3WF1A 2YW3A 4Z2HA 1W3NA 1IF2A 2QPSA 5D2XA 1AW1A 1XSKA 1LWIA 1EBHA 4UQAA 3PTKA 1ZL1A 3GTIA 2QDEA 3ATZA 4OFCA 3H54A 1XIHA 3V5OA 3ZXWA 2PUZA 2HPMA 3RITA 4NJIA 1WZMA 1XLKA 4HNNA 5H6HA 1A5BA 2I14A 4LV4A 4YVPA 3ARQA 4QROA 1F61A 1NAL1 3PZNA 1BKHA 4AVNA 3LLDA 4B3ZA 4LYQA 3UZZA 3W70A 2KAUC 5D30A 3EOEA 3VDCA 4DJED 4OTKA 1UB3A 3MI2A 1KC7A 3UNDA 2V5BA 4C6JA 3NXFA 2CERA 2VFFA 1UKPA 5AB3A 4GYPC 4NI8A 3WEOA 3WQGA 4P8WA 3FEMA 1BQGA 1YDOA 3PZIA 3KTCA 3VX1A 4LBSA 2PU0A 1DWAM 4H9ZA 1IHIA 3CL6A 1W3LA 3ES7A 2W91A 4GZEA 4UTUA 4NZ3A 2WC4A 2QJIA 3H2MA 2X05A 4RE2A 4DY1A 4JIQA 2YCIX 4J3TA 4H00A 5A5WA 4JTDA 5CZ0A 4GYPA 4I9TA 1A0CA 2XINA 4DF1A 3UVAA 1QHOA 2WQDA 4O12A 2D0GA 3VOGA 2YDSA 2QF8A 1JCLA 4Z2LA 1GOWA 2P88A 4PTVA 3WD3A 2CLIA 2XIOA 3WQPA 2ZX8A 5DT5A 1SJCA 3VUPA 1TTPA 2Z4GA 3KRBA 3ABQA 3CYVA 3ZO9A 4O11A 3EWBX 4KCVA 3AMCA 5JBDA 2FYMA 1EGVA 1TA3A 3QYQA 1E6QM 2G3NA 2GQAA 5EMUA 3FA5A 4L5ZA 3PAJA 3ZQ9A 5M5DA 1CT5A 4WXZA 1XBYA 2O4QA 1BHGA 4ALDA 3SJ3A 4UR9A 1PSCA 3KTXA 1M6JA 1GQKA 1XINA 4AEFA 1KR1A 3TSBA 1LUCB 5C7VA 1QNVA 2POTA 4F0KA 4WDTA 4A8LA 4E8DA 3NO3A 4F8XA 3KL0A 2QCNA 1Q6CA 5D04C 4IF2A 1FX6A 1PE1A 3QRHA 2VRQA 2I16A 3BLLA 2W61A 5AC8A 4GGBA 3TKFA 3IIPA 1ZS2A 3PWIA 2E6AA 4R88A 3RCNA 2C7FA 3N3MA 2EKCA 1ECQA 3QPYA 1I9CB 2PE4A 1UUMA 3R11A 4TTGA 4LXFA 3BAJA 4ZFMA 3ABXA 4BJHA 3NPWA 4I8YA 1W9BM 4MJZA 4PB3A 4CEXC 4GYJA 4RV8A 1TUXA 3ME3A 3OIHA 3GZ3A 2X1IA 4LUTA 1HX0A 3U5YA 3WMBA 2CLFA 2AMXA 1F76A 4J40A 4E8GA 4IQJA 1A5SA 3VGHA 1JPDX 2DW6A 4JDYA 5EPDA 4HNOA 2WVVA 4XZHA 1X97A 3NTYA 4AX7A 5FCZA 5CH9A 4K39A 3MKCA 4Z0JA 5A6KA 1GTHA 3RX3A 3AZRA 1JIBA 1Q2SA 1TUFA 1LQ0A 2YZ5A 2E6YA 4RV3A 1JYVA 3NO5A 2DZAA 4IQLA 2IW0A 2QJMA 3N15A 3C6CA 1EUNA 2YL5A 3EWZA 2CHOA 3M41A 4CN6A 1FWIC 4QE5A 4MUZA 1BFNA 2V9DA 3C8NA 1YE6A 2GDVA 3QSTA 3AOFA 3SUTA 4PMUA 3W1PA 4NAEB 1WX0A 2J27A 8XIMA 2JKPA 4ZXOA 3WIJA 2ABAA 5HJXA 1E3ZA 5AYXA 3WKZA 2HBVA 4L4MA 2BTMA 1W1YA 3SCSA 3UFYA 4UFHA 2VVNA 5CAHA 4UB9A 1MFVA 1XRFA 3CBWA 1M7OA 4GVIA 3P74A 3MPGA 3S5YA 2OB3A 3NOEA 3SGZA 2EPOA 2ANUA 1BYAA 1C8YA 4KCUA 4DF2A 3BTNA 4NHVA 3OIXA 3CV1A 4F3HA 4H01A 4PMOA 4LC8A 2IQTA 2ONEA 1C90A 1MEWA 4HKPA 3TR2A 4UNLA 3R8HA 4DBWA 4UOZA 4C6BA 5BYWA 2VR4A 2FHBA 4EWND 3O8AA 1EX1A 4G5DA 3OVGA 4D8LA 2NT0A 1A4LA 4GISA 1BSIA 4GCXA 4LW7A 3OHMB 3B8WA 3UPBA 3M6YA 1EJTC 3CIXA 4FNSA 1AJ0A 1E9YB 3R0DA 2O92A 4FO4A 1P0KA 2PDHA 4IGSA 1SO4A 4XBJA 4I7WA 3W1UA 4KWSA 1GEQA 2V30A 3CPGA 4K68A 4E3VA 4OBSA 1KR0A 4YVXA 1TMLA 4JX4A 3VDBA 3VKCA 3C52A 4IPIA 3L65A 2QUNA 4MOZA 2Q01A 4PCFA 1VJZA 5KZEA 4FX8A 1T8XA 1BRLA 2QCGA 4JL2A 3G1XA 4YL2A 3GXPA 5REQB 4RR4A 1JDEA 2P3ZA 2G95A 3L2IA 4DXKA 3TXZA 4AD3A 1ZAJA 3IUIA 1E5JA 1DE5A 4NIRA 3BW2A 1RBLA 1HN1A 3JVAA 4NJJA 5CZSA 5D2TA 1VYPX 1KXHA 2QLYA 4ZR8A 5A8QA 1SJDA 2Z1KA 5D32A 5HK4A 2OZ0A 1OEPA 4Y8EA 1MSSA 2OOFA 4UNKA 5E0CA 5A8PA 2E5DA 5EB8A 3LY0A 4WRHA 4KKXA 3WX7A 3QZ6A 3BLEA 1FCVA 4GIRA 5I3JA 4N42A 1FOBA 4YWSA 3SY1A 1Q6QA 4IQDA 1EBGA 1GVFA 4MY9A 4XBKA 3ITYA 3OYZA 1FDJA 2YIHA 2VDGA 2WSKA 1YPXA 4W85A 1Q6DA 1XLIA 1GYNA 4HMDA 1CTNA 1YDNA 4H9YA 3TROA 5TNVA 2YR1A 4C6EA 1WQ5A 2X2GA 4G56A 4C6IA 2VFEA 2FFCA 5CLTA 3ITGA 2C16A 4GC3A 1E3XA 3SURA 1R87A 1B2YA 4RNFA 3QY7A 3HGSA 2PD9A 1KQZA 2CHNA 3TJXA 4F0MA 3MZ2A 3T55A 3TOPA 3UR5A 4IMAA 4EF8A 2IPGA 4HA4A 1I8JA 3HMCA 1TB3A 3VOHA 3ZMRA 2P3EA 1OQFA 4HMCA 4S3CA 2OX4A 3I65A 2NV1A 5A8GA 1LRNA 2R24A 1P6WA 4LQ1A 4UFMA 1YMYA 3PPGA 1SZFA 1FWSA 2QVHA 3ZM8A 2BDQA 3RRAA 2QJJA 3BOLA 5CGTA 1AD1A 3NG3A 4MNJA 1D8CA 2DT2A 3TK7A 3LZ5A 4NYUA 3CL7A 2XWEA 3WLMA 4ERGA 1CECA 4HN4A 4DAFA 3VNZA 4DB7A 1A53A 1JFXA 1LUCA 4Q6JA 1UR0A 1RZMA 4IL2A 1UP0A 4GWEA 4DO7A 1YBQA 4UOJA 3HFYA 2BVTA 4J2PA 4AWEA 2VJXA 3EKGA 2OKTA 3AIUA 3TYEA 3W1MA 1TE1A 4IIHA 2F6XA 1JJKA 2ISSA 4M6VA 1OM0A 3MSYA 1NH6A 4ZVJA 1XD0A 4GRSA 4ADUA 4UFKA 2J77A 4FA3A 4MKSA 4MGGA 4PL1A 4US5A 2Q02A 4HSOA 5HDRA 4O19A 3B97A 4WZHA 4D1JA 1NQKA 3BWWA 4Q32A 3M07A 4HK5A 4NASA 3DN5A 4S23A 4AFYA 2OCZA 3P84A 3IJ9A 5HJLA 1E9LA 4MWAC 1DPMA 1OT2A 3ES8A 3S2NA 1I1XA 3OQEA 3EA3A 2MNRA 5C5YA 4ILSA 1FP8A 1QW9A 2ACRA 2XSXA 2XGBA 4LY8A 5HANA 5CKSA 4F2TA 3JU2A 1XC6A 2GSJA 2IPWA 2Q6ZA 3U2CA 5KZDA 3S4TA 3DERA 2RDUA 4ZEPA 4LCRA 2YCEA 4R3UA 3EPNA 2X42A 2XVLA 3B04A 2CZFA 5IFTA 1OYBA 3N9SA 1TPVA 3R58A 1DV7A 1KFJA 4W4QA 2YJQA 4GI4A 4H3DA 4LX4A 3L5LA 2V5KA 3SO7A 1Z3NA 2VM8A 3TN5A 4CNPA 4LUJA 2ZIDA 1W1A1 2OGJA 2ZZ2A 3CHVA 3DEQA 2D2JA 4L61A 4B5XA 1K3UA 4Z42C 1QATA 3T6CA 4H6EA 5BRBA 1TWZA 4Y2WA 3N2OA 4F0SA 5KMYA 4UMCA 2D2HA 2C1GA 5HATA 2X09A 1BPLB 3P5YA 3UETA 1W54A 4O13A 5AOUA 1R47A 3NA8A 1ZAHA 2EGZA 3B8DA 3GVRA 3LLFA 1KRBC 1GVEA 4M19A 3WFLA 4HIBA 2DUXA 4QG9A 3EB3A 1Y5VA 1SO5A 2VUYA 1OFRA 4PCSA 3WF3A 3KZPA 1K7XA 4R34A 4GVHA 1LTDA 4HP5A 2G3JA 4R9OA 2DQXA 4KERA 3O1NA 1JCTA 1HJSA 3M9YA 1JUEA 1XW8A 1XLEA 1MVYA 3QGVA 3RM8A 4MMWA 3HGOA 1E5NA 4OZOA 2CC0A 3QHNA 4C6KA 2EPLX 1GJWA 3BLIA 1NVMA 3FNDA 1RVKA 2OLHA 1AH3A 4DBDA 2ZZ1A 2FFIA 3NPVA 2GGJA 1J79A 3E2RA 3R43A 2GOKA 4JTAA 2CXGA 3HPSA 4K36A 3MZNA 1TPFA 2BXVA 1B57A 3AIRA 4O1AA 3B0PA 4H7ZA 4Q6XA 5LNSA 1WA3A 1UA3A 1TX2A 4WKHA 5BXTA 7XIMA 5BU6A 2WCGA 2V38A 1XYBA 5J5DA 2PGRA 4X63A 4MF4A 1HF6A 1VHCA 1NDYA 4EAYA 2VZVA 3NQ8A 3FA3A 4FR1A 4IHCA 2GVYA 2Y70A 3MI6A 2I56A 3S42A 1YW1A 5U4NA 3K5XA 3VMPA 1H49A 2V3DA 4CVUA 3M5YA 3WZ0E 1C29A 2XH7A 5JBFA 3ORWA 2ZUNA 4JKMA 1M41A 3UF9A 1MYRA 4JN7A 4MB5A 1NSJA 3W07A 4GE8A 4AXKA 3KBMA 3SAZA 3S6DA 4YJ5A 3RX2A 3BOFA 1ZALA 3M0YA 4Y9PA 3G1DA 3WQ5A 1M3UA 3VKKA 2OMAA 1EDQA 2B31A 1WV2A 4A8IA 4ATWA 4MUPA 3QEZA 1DQXA 3SBFA 1W3TA 3PB0A 3TJLA 2P8CA 5CPLA 4MKNA 5A6SA 4CGTA 2G37A 3AALA 3UCDA 4IUGA 2DZWA 1FKWA 4K2SA 4O16A 1XDLA 4LVAA 3N17A 2P53A 1Y8BA 4IM4A 3OEXA 3G1VA 3W6MA 3W1AA 3B9AA 2PF0A 4C7DA 1IT7A 4DM1A 2OQLA 2ON3A 1AUSL 3LQLA 4XB3A 4EANA 2R91A 1TRIA 5F2IA 4PN2A 4LNCA 2CLMA 1R5YA 3CHCA 4JNZA 4BF7A 4X60A 3NGFA 2QUVA 1QWKA 5FACA 2C1IA 3RMJA 2WMKA 4KF1A 1U5HA 3QM3A 3LMZA 3UJRA 1R46A 4D1IA 3C4UA 4KGLA 1VKFA 3AJXA 3UXIA 4R85A 2C18A 4DJEA 3FJ4A 1ML1A 3EWWA 2A7NA 2ZXDA 1OFQA 2YA2A 4IFKB 2C13A 1IXPA 1ZPTA 3FK4A 2FZ8A 2RUSA 4W8BA 5EMMA 1R3WA 4DJDA 3QV9A 3NL5A 2PEVA 4QDPA 3S3GA 2X2YA 1PV8A 2DVTA 2OXNA 3GNXA 4GIYA 4GY1A 3W1QA 1QT1A 4FEZA 1F73A 4QHRA 1H41A 2V63A 2PZNA 3T0BA 3URNA 3NL3A 1XQKA 4LEQA 1HL8A 1YDVA 3WF2A 5JQ9A 2CZEA 2IPJA 3GO2A 2WSQA 4Q8PA 5M03A 3IVSA 1H7XA 3FY1A 4F79A 3B8TA 2PRMA 5LNWA 2Y4SA 3S1VA 4YHEA 1HKIA 2NQ9A 1OK6A 5G4EA 3WEZA 2UBPC 3NZQA 1OWQA 1UOKA 2O7QA 5AFDA 4OUIA 1UZDA 3WMCA 4O17A 3T05A 5F4XA 3BK0A 3UWWA 3S8HA 1G4EA 3W87A 5DBUA 1WKYA 3CUJA 7PTDA 3W4RA 5DRIA 2ZDSA 5DCDA 3QPEA 3UCQA 3W73A 5CGMA 3H22A 4PSRA 4EXQA 4OOUA 4ZL1A 2A3AA 5G4WA 1U1UA 1AQ0A 3VDAA 1XG3A 4WVXA 4KT2A 1YTEA 2BASA 3LHWA 1OFEA 5E0FA 3HTWA 5H91A 3PJWA 2WM0A 3MHFA 4X9SA 4BY3A 1JZ3A 3P8IA 3CQIA 5E09A 4C6CA 4Q7IA 1TMHA 2RDWA 3WF0A 4AD1A 1L6SA 1P0BA 4DO4A 4Z0SA 4S3FA 3W7KA 4RZ6A 2GPTA 4XUGA 4GY7A 3ARWA 5IBXA 3TYBA 5HMDA 1CXFA 2FDSA 4PE8A 1QRQA 4ASTA 3BCFA 2J47A 1HKMA 4IUOA 3FAXA 2WJEA 2WNWA 1UPPA 2X8RA 4LOCA 4C6MA 5T91A 4DJFA 3EX1A 2XM1A 2Q3RA 3DHUA 2XN2A 3H2CA 3QQ1A 5I3IA 2WMFA 2Q3OA 1DJYA 2O9OA 2ZUTA 4BKNA 3KCLA 2D2GA 4HPGA 4QE1A 1R30A 3RIKA 4DZAA 1EDTA 4JAWA 2BGSA 3CAWA 1MO0A 1WNOA 5HNUA 3MUXA 5DXYA 1XXXA 4MYXA 2BY3A 3DX5A 3R1ZA 1GKQA 4ZTYA 1CLKA 4XVDA 2I9EA 4QCFA 1AMKA 3PUOA 4RDYA 1PZ0A 3R4IA 3CYJA 2EO7A 3B8SA 3W7GA 1IR1A 3NNTA 2VC7A 2Y24A 4NP7A 3M5ZA 5FEPA 1GZGA 3CMGA 5IHRA 4AHOA 2E68A 4PEEA 1KRAC 1F4HA 4IFRA 1THFD 3EOSA 1XBXA 1XRVA 4B15A 1AODA 5CPOA 3LRKA 1EHNA 2XDFA 4HCLA 4QBXA 1CW2A 1A5OC 4ORIA 5AYBA 3CNYA 1LYXA 4AH7A 4EE9A 1JFHA 1EO7A 3H4GA 3W1NA 2PWHA 2YXOA 3W22A 1FWEC 1HKKA 4GNVA 1NJJA 3OP2A 3L4YA 4RXGA 3M0ZA 1L2QA 3KL3A 1I6NA 3WLRA 1TV4A 4GGHA 5HNNA 4DWSB 1KGUA 3DXIA 1UWIA 3SRDA 4LANA 5AN7A 1GOXA 5KZMA 5A6JA 4S2BA 1KFLA 1EF2A 3NQ7A 3R10A 3AYRA 3R94A 3UYCA 5C71A 3LRLA 3WYZA 4LPCA 1E72M 3NVDA 4JDBA 4G1KA 1JUBA 4JX6A 3DC0A 2D0FA 3LM3A 1V7AA 1A50A 2OFJA 3THCA 3WFZA 1HJQA 3DFYA 1UIPA 1JVNA 1CGWA 4B90A 2ZZ5A 4BWLA 1EIBA 3IRSA 4GJ1A 4FAMA 3CH9A 4N6EA 5TBOA 5AECA 2QULA 1UWRA 4EPEC 3O6AA 3OTRA 1MQRA 1GVIA 3VNDA 2ZBTA 1XSJA 3V16A 2DSVA 2QKFA 1JYNA 5H2ZA 3NJ3A 1AZ2A 2OEJA 1E4IA 1B30A 3LN3A 2FJUB 5IRPA 1JXKA 5I23A 1XYLA 3H53A 3GTXA 1J0HA 2PDMA 4L9XA 3LB0A 5C9RA 1DYSA 4AZHA 4WEVX 1HXJA 2ZZ6A 4LBRA 3TH6A 4LVGA 1MW2A 3MC5A 5IOBA 2PDGA 2QJNA 3UY8A 1GW9A 2NV2A 2TAAA 4C6OA 4RUBA 2GQ3A 3BSGA 4L56A 2CNCA 4JTIA 5ABTA 1KFEA 3EMQA 1ODZA 4CNSA 4INFA 2A3EA 4YXGA 4UQCA 1UHVA 1VS1A 4YIWA 3VNMA 4BHYA 4QSHA 2JKAA 4D2JA 1SFTA 2ISDA 2ZA2A 3DOPA 5D4YA 3E74A 1M7PA 3ZVHA 4C6NA 4B5NA 1RJQA 3CB3A 1V3JA 1KCKA 5D9PA 3GR7A 3VMOA 2NQZA 1QHZA 2DJLA 3DGBA 2J9XA 4UOQA 3TZNA 2CLEA 1LBMA 1W5MA 5JIPA 2VD9A 5HMFA 3AFBA 3R5EA 1P48A 1KB3A 4PCPA 1RV8A 3NQCA 4HJFA 2XM2A 1ONRA 4E38A 2VCCA 2J7HA 2WNZA 3GHUA 2OWWA 5D9NA 2GZXA 1G4PA 5EBUA 4QLKA 1QHPA 2VC9A 3BLDA 1FCBA 3L23A 3SQSA 1A49A 3QOKA 4C6DA 4F9JA 3ARSA 2GJRA 1J18A 4M51A 4LT9A 3GYCA 2JE8A 3OZOA 1WDDA 4Q22A 5C2GA 3O6YX 1A5AA 4XD4A 3PZMA 2WMJA 3PULA 4HCDA 3S2JA 4N9BA 3CZKA 1YNQA 4N9DA 1UASA 1P5BA 2A4AA 3GVVA 1W5NA 1GG1A 4PUUA 4ZA0A 2BVYA 3U7VA 3B4YA 4H4IA 1IXOA 1KV5A 3M47A 4PMQA 5EFFA 1GONA 2AAMA 4LAMA 1N2VA 2NSOA 1JGIA 3STCA 1WDSA 3PWAA 4UC5A 4OU1A 4FZIA 3MBFA 1UQYA 2QNEA 3CQHA 3NVTA 5HA7A 2WJDA 4YYFA 1OYCA 3H4XA 3GDLA 2O0TA 3BANA 4YU1A 4TXEA 3KBNA 1M53A 5HWJA 2WB5A 3PZ9A 3S46A 1KM4A 3LPOA 3I68A 3GHRA 1YTKA 2ZRUA 1V0MA 3WBWA 3DI0A 4XTDA 4DVOA 1GHSA 2CLKA 1E56A 2FZMA 1O5KA 1HGWA 2D69A 3ALFA 5LGZA 3LA4A 4UFLA 3ID7A 3TWAA 2QDGA 3IAPA 4C5ZA 1C7SA 4Q4RA 1U22A 1PZ1A 1QBBA 4KESA 3ARYA 3BDKA 5HWNA 1PTGA 3PBGA 2DIJA 5HUOA 1XI3A 4TX6A 2HEJA 2YL6A 3DAQA 2C0AA 3A47A 4R27A 1WBHA 1HVXA 3NQFA 3KOYA 5AZ1A 1K4GA 2INEA 1VFFA 1P0DA 1BXBA 3FS2A 4B9ZA 3UESA 5I3KA 1E6PA 2CBVA 1GVRA 5C55A 3T81A 1VIWA 3INPA 3D5HA 1RA0A 1VAHA 5FEWA 3IVTA 5I5RA 2A0NA 4D9PA 5KINA 4OECA 4GA8A 1VB9A 1I2QA 3CHEA 1E40A 3FVMA 3P3BA 5GJMA 3EDKA 2PTZA 3LI0A 4YTTA 1YHTA 1ME9A 3JZEA 3RR4A 1GVYA 4QIUA 4LWWA 1HKJA 3H26A 1GOKA 1IGSA 1T40A 2G50A 3SIZA 5LYRA 4PMJA 5CPTA 3KP1A 2SFPA 1S46A 1DHKA 4H6KA 1EJXC 4A21A 3LM7A 1F8IA 5FSDC 1Q6LA 4JQAA 1YPIA 2J66A 3S1UA 1ONEA 4IXXA 5CQ1A 1DVJA 2IKIA 3FYOA 1UZ1A 2H3BA 2HDJA 3T9PA 1S2WA 2IXVA 2PURA 3W7EA 1TG7A 4PFHA 2PS2A 2Y7EA 4WY0B 4BQ3A 1QW8A 3M4HA 1FWCC 2XH0A 3KVLA 2VURA 1O12A 4U4MA 4QLJA 1S2VA 1W3KA 2VRKA 2G4FA 3XINA 3SW6A 1H60A 3G1FA 1NWRA 2QAFA 2PA6A 3H7VA 3JUGA 2ZTJA 2H6RA 3U2ZA 3VKAA 4MNLA 5FEZA 1X7FA 3VZXA 1REQA 2HBXA 3DHFA 2W66A 4ERIA 2HISA 3UWUA 4O8AA 5CPNA 4UZSA 2NX3A 2RHGA 3EGJA 5AVNA 4AC1X 2A3BA 4HNVA 2ISWA 1BF2A 1C7TA 3W28A 4LS1A 2YZRA 2YB4A 4JX5A 1OGGA 4DLFA 2OGYA 3NWRA 1QNOA 3SCTA 5AC4A 1IWAA 1REQB 1I60A 1KQYA 3F7JA 1RLDA 5AVHA 1EFZA 3LCXA 3GIQA 3GG7A 3P2VA 3LBMA 1FP9A 5H8PA 5AKQA 2NQ5A 2GGHA 3EEZA 3URBA 4Q8VA 5MHBA 1PHWA 1AH0A 2XWDA 3FSTA 1ZLPA 3VKDA 3WLPA 2RJHA 3N18A 4IP5A 3QW4B 3MYPA 3VOFA 1T6MA 1AW2A 3QLDA 1W9XA 3VGEA 2Y88A 4S1FA 3OHIA 3A5VA 3GIPA 5HUPA 1VC4A 2XISA 2XZ7A 2PPGA 1OCJA 3WUGA 2AL1A 3QR3A 1RD5A 3LU2A 4I9MA 3BUVA 4X2PA 4DIAA 2YL8A 4GXPA 2WMGA 3WLHA 3KTSA 3PZTA 2DW7A 4HNTA 2FPVA 2FJKA 3LEPA 3NSMA 5RUBA 3PPFA 1TFVA 4E6MA 1MDLA 3ITOA 5I09A 3B40A 1H3GA 2XFYA 1TKKA 5LA1A 4GIAA 3BQ6A 1E6RA 4GVFA 2DZXA 1G94A 1FXQA 3KHJA 4MFDA 3FSUA 3TTYA 1QAPA 5JBEA 2YCLB 4B5SA 4I3GA 1U1JA 3WNLA 3LPFA 4DI8A 8A3HA 3OU8A 1X96A 2IPFA 1KKRA 1J10A 1O5XA 4QQUA 1PCWA 4ZGYA 3WH5A 3U2EA 1VLIA 1PTAA 4OGZA 4R7OA 4QM1A 3CH0A 3IACA 1SR9A 1SZNA 1WXYA 3TSMA 1H0IA 1W9PA 2DORA 1V3MA 2X1SA 3S1WA 1J0KA 4MDOA 4Q7BA 3LXAA 3VGBA 1AQHA 3VC6A 4IJBA 4JEJA 4PBGA 3VIHA 1PZ2A 2OZ8A 4R9XA 1PKNA 5GVJA 2P5NA 4KIEA 1A5CA 1MNSA 2OKOA 1IIHA 1XCWA 1GKRA 3B8UA 4JCMA 4GQBA 4IQEA 2VOTA 3A64A 1AK5A 2YBVA 3AJ7A 4OUEA 1GEHA 3OVQA 4LCSA 4K6AA 2GGIA 3C3UA 2FHFA 4NJHA 3H12A 5T26A 2NWSA 1DWFM 4IJCA 5JUVA 2PDXA 1W8GA 3AMLA 4S38A 1AVAA 1CB2A 4GUGA 4G7FA 5ENLA 2Q71A 5DX7A 3GUGA 3TNBA 3UR7A 3VKBA 4DJFC 1C9WA 2VTFA 3GQYA 1H7PA 1A5LC 1MXGA 4DYJA 3MP4A 2VHLA 2WANA 2CWNA 4K38A 2YOCA 3GDBA 1PWMA 4N0RA 4GJIA 4LC6A 4F2UA 3WJWA 3F2CA 4DJDD 2BWGA 4GACA 4AYGA 2Y8UA 1F07A 4RNIA 2VYOA 3L7RA 3HO8A 2REQB 4PB5A 1XIMA 2GL5A 3GU9A 4NJKA 4A2RA 2A3CA 1YX1A 4L4PA 1UKSA 1Q3NA 3BZGA 4AF0B 1V77A 4D6GA 4H9UA 4P8XA 4MHBA 5BNKA 3KBSA 3U5UA 1XLAA 4BCEA 3BLPX 2ACSA 2YXXA 3KZSA 5BOFA 5LHEA 1E1EA 3PM6A 1EF3A 1UWUA 4RNHA 5CJMA 1QK0A 1UOZA 3L2MA 1XYCA 1JZ7A 3LDVA 4A6GA 2PLMA 2X1UA 4Z2KA 2NXGA 4P7OA 1EJVC 1H51A 1PBGA 1ISVA 3CB8A 4PMDA 1MNZA 3E3HA 4CKQA 4QS6A 3R89A 3TTQA 1O60A 2EBNA 2NUYA 3EA2A 1QI2A 3WDJA 1NWUA 3T0TA 1CX9A 1B3ZA 4W8LA 1QNQA 4MZ8A 3T44A 4UQBA 2GVGA 2DSWA 2FGZA 3LCIA 1TJRA 4J3VA 2E1DA 3BE7A 4HHLA 3UW6A 1HP5A 3ITLA 1EZWA 2BHUA 5CGQA 4G9PA 1XR2A 4FB7A 1MZRA 1JQXA 3ZLHA 1KXVA 5FKYA 3BXWA 4FLSA 4UMBA 1CGUA 4IP4A 1GYLA 1IGWA 3SI9A 3MA8A 3N04A 3MQTA 2PBOA 3VAVA 4AZCB 2EQDA 1GQJA 3T8QA 4K3ZA 1R3YA 1ZHAA 2WJFA 4MWAB 1KM1A 1KRMA 1FWHC 1F5ZA 1Q6EA 1O5QA 1Q7MA 1E43A 1T0OA 4JXCA 3I7QA 4MZYA 5BMXA 5CC6A 3E1F1 1OG6A 1HFBA 1FXPA 3WN6A 3UWVA 1CXKA 4M3PA 5I06A 3CZEA 1XPYA 1KD0A 2BOEX 2B0MA 3M6DA 3EKLA 3AMKA 1QNRA 2JIWA 3VDGA 4CN1A 2X30A 3HURA 3FIGA 3ABSA 1WBJA 2YBTA 3RO8A 1D3CA 2VQTA 1CWYA 1XUZA 2Z1SA 3OVPA 4NZJA 2VEPA 4LY4A 3EOUA 5C2XA 3MMUA 4IMEA 3VFCA 4J3WA 4DF0A 3BICA 1E55A 1ZBCA 2Y62A 3G1YA 5GNXA 4CD4A 2JKEA 2QIIA 5HJYA 5CXPA 2WXDM 2OSWA 4JTGA 1QPQA 9XIAA 5DY3A 5ABFB 4YMZA 1HIZA 1G6CA 5E93A 1TR9A 2NLIA 4NL1A 4P8UA 5DF0A 2FH8A 1GG0A 4IISA 1L6WA 1TE6A 1R86A 1G0CA 4DJDC 4PZVA 1BG4A 5CZJA 3DDMA 2QCDA 5K9XA 1SGJA 1QJWA 3GH7A 5D8WA 2DIKA 1VR6A 1F6PA 1DJHA 3N4FA 2NX1A 1WB0A 4TUFA 2G97A 1UR1A 2FKPA 2VQUA 4Q4QA 1JUKA 1E15A 3E0LA 1VD6A 1FHDA 2DFAA 3IAQA 5DO8A 2C1HA 3ONBA 2OYLA 1XYFA 3UXAA 3VE9A 3UQNA 3E0IA 1Q66A 1FHLA 4QLLA 5T9BG 4JIPA 4NQ1A 1J0IA 4L1XA 3AHYA 3UZXA 2XSAA 1A80A 3TUUA 4GO8A 1YXYA 1JPHA 1Z6KA 9XIMA 4KH2A 2CFFA 5C0QA 1QXLA 3L4UA 1AD4A 1LCOA 4JQ3A 4GXWA 1P7TB 3M5VA 4GZIA 1OHLA 2BY0A 1TTJA 4UQ9A 4YCPA 3CUHA 3W81A 3VIIA 4HZ6A 1V6WA 3OB8A 2MANA 3KOFA 2GJLA 3GK0A 5BXPA 2WAGA 3NSXA 3DYMA 3MW7A 3T0CA 3NEHA 1UD6A 2VL4A 4UTHA 3W29A 4PFMA 4ZMGA 2AAAA 5IXEA 2QGHA 4ZXLA 1K02A 4C6QA 1XV8A 4S3KA 3RDKA 3OPSA 1RPKA 2BOGX 3FEQA 4MB3A 2XIBA 3W27A 1VP5A 3OJGA 1JPIA 1LLOA 5I03A 1NOUA 1SQ7A 1BF6A 4LVFA 1IZCA 1KGWA 3QMRA 4C7GA 1UUQA 3WQ6A 2RDXA 4DN1A 3ZR6A 2C8NA 1VFMA 4NKCA 2VX4A 3W7IA 3N12A 3P6LA 1CB7B 1JD9A 4WF7A 4IPLA 2ALDA 1PX4A 4MWAE 1UD4A 1S2CA 4GFSA 4NAEA 5FD0A 3AHXA 5A6MA 3M43A 3EB4A 1BGGA 1XLJA 4HZMA 4HU3A 4DI9A 3CAQA 1TSIA 3TMQA 5D09A 4O50A 5I0DA 4KEVA 3GXTA 4Y6GA 4RE4A 4R5EA 3AU6A 2J79A 4RL3A 2V67A