1S2UA

Crystal structure of the d58a phosphoenolpyruvate mutase mutant protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
290
structure length
290
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 110
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2uA00
1U5VA 4B2DD 3OYZA 3QV7A 4YJ5A 2XZ7A 4DRSA 1ZJHA 1KBLA 4YNGA 3LG3A 1PKMA 1E0UA 3N25A 4KCUA 3QZ6A 3E0VA 4QGCA 3EZ4A 4KS0A 3GG8A 3QV8A 1O5QA 3GR4A 1O68A 1O66A 2X0SA 4HYWA 3M0JA 3VAVA 1DXFA 2VGBA 2VWTA 2HROA 1OQFA 1F8MA 2KX9A 4QG6A 4TV5A 4B5VA 3M0KA 2WQDA 1A5UA 2HRWA 1IGWA 4IQDA 3EOLA 1KC7A 3IS4A 3PP7A 1UJQA 2R82A 3E5BA 3SRDA 2L5HA 3MA8A 4JPGA 1PKNA 4L9YA 1S2WA 3QQWA 3ME3A 2V5KA 1A3WA 3SRKA 3SRHA 4RPPA 3E0WA 1DQUA 5JVLA 4L9ZA 1VBHA 2QIWA 3PUGA 3HQPA 4HYVA 3P0XA 4KCVA 1Z6KA 1AQFA 3FA4A 1F61A 1M1BA 3T07A 3R4IA 2XZ9A 4B5XA 3QLLA 3HQNA 3HQOA 1DIKA 4L80A 3KHDA 1MUMA 3U2ZA 3B8IA 2BG5A 4TV6A 4MG4A 3QTGA 4IQEA 1PKYA 1S2VA 3QV6A 1U5HA 4WJ8A 1VBGA 1XG4A 3GQYA 3LYEA 3QV9A 4KCWA 4KCTA 4FXJA 1GGOA 4B5UA 2VGGA 4G1NA 1F8IA 1ZLPA 1DXEA 3OYXA 1XG3A 1SGJA 1S2UA 3T05A 1F3XA 3BJFA 1PKLA 4B5TA 3H6OA 1E0TA 2XDFA 3EOOA 3OQ8A 1PYMA 1S2TA 1T5AA 4KRZA 5TAOA 1M3UA 3KTXA 2DIKA 1JDEA 3T0TA 4FXFA 2E28A 2ZE3A 1F3WA 2G50A 1A3XA 2VWSA 1IZCA 1OY0A 3I4EA 4LSBA 4QG8A 3G2GA 4L7ZA 2VGIA 4B5WA 1A49A 4IP7A 2DUAA 2HJPA 4QG9A 2HWGA 2VGFA 3FA3A 4MF4A 2OLSA 4B2DA 4ROQA 4IMAA 3SRFA 3EOEA 3BJTA 2V5JA 4B5SA
chains in the Genus database with same CATH superfamily
2WNWA 4D6IA 1LUCA 5ECUA 3MPGA 2Y24A 2ZRVA 2G3NA 3L4UA 4WJXA 1CXEA 2ACSA 4PMQA 2ZRYA 4ML9A 2PGEA 2Y61A 2J9ZA 2E1DA 1KWKA 2ZWYA 1EYWA 2EHHA 4Q8OA 1GKRA 4CN6A 3UF9A 3HMCA 2OZTA 1BWVA 5LHEA 4Y7EA 5FCZA 4KFNA 4W5ZA 1WKDA 2FTYA 1HP5A 4WRHA 3WUGA 1TPVA 2ZADA 2YKKA 4IPLA 1J79A 4Q22A 4YL2A 5GJPA 4TQTA 3ABQA 4YCPA 1H7OA 2VEFA 2C1IA 3W7LA 2ZCGA 3KVKA 3UY8A 2BFGA 4M5PA 2O9RA 5K9XA 1WZMA 4HHMA 1M7OA 4DLFA 1KFEA 3LHZA 4LVFA 3R1ZA 3C0LA 4Q7NA 3UNTA 4Z1BA 2DIKA 3TK7A 1J6OA 2G4JA 1GVOA 3BV4A 4HB7A 1UOKA 4LAUA 3I4EA 2FB2A 4RNHA 3CV6A 2ABBA 4PYSA 1F07A 1HIZA 4G5DA 5G4HC 1ZAIA 4DYEA 3TN5A 1R0MA 1XIIA 1N2VA 4EPKA 3W7CA 4H8HA 3TN4A 1XSIA 4HBKA 1MI3A 4PMRA 4GWEA 1K70A 1XF0A 2WO5A 1FDYA 3KLKA 1EOMA 1JNEA 1BXBA 4CQAA 4Q8UA 1OD0A 2PPGA 1WDRA 1TVLA 3IUDA 3OIHA 5LNSA 2DZBA 4GZ7A 4L61A 3NM1A 4I90A 2WSQA 3MHFA 3IJ6A 1AMKA 1KR1A 2ISWA 1AD4A 3RHGA 3ARTA 5DCBA 2XH2A 3ECQA 3OVRA 1DJHA 3ZXWA 1I45A 2D23A 3OB8A 4B3ZA 4H2HA 4PC8A 3EAUA 3WQCA 1DWIM 1O60A 1HX0A 3C0SA 4BKNA 1GCYA 3THDA 4PN2A 3B9NA 4AD4A 2WJDA 3DAQA 3SCRA 1EQPA 3NVTA 4OV9A 3ONCA 2GK1B 1O5RA 5CZSA 3IGHX 4DUWA 2QUMA 2WMJA 4L5ZA 1XBYA 3AU6A 2VC6A 2IMRA 5A1AA 2CESA 2G50A 3LCLA 4H6QA 3ZT6A 4H1ZA 1W3LA 5CAKA 1TRDA 3PZUA 1B3OA 2VEKA 3AMGA 1LG1A 3M0LA 1V6TA 1JZ6A 4G7FA 8XIMA 2AQOA 2QUVA 1F73A 4NHVA 4KESA 2V5JA 5CZKA 4PB4A 2E0PA 4B2DD 4RKAA 3VPLA 4IIHA 2VI0A 3SQLA 3UJFA 4ZQRA 3FJ4A 2PURA 2Y0FA 1DEDA 1C8YA 2AOSA 2OSYA 1FHUA 3S2NA 3VZXA 1RSCA 2QQ6A 5EYWA 4CQ8A 4RL3A 5A6LA 4QNWA 1B90A 1QTWA 3DFSA 4ADUA 3ZSTA 3CZGA 5A3HA 4CCDA 3TROA 2FDSA 3A4XA 4YVPA 4F0SA 3OG3A 3OBAA 1PE1A 5K9DA 1ZB5A 4L9YA 3SCSA 4B3KA 2BXZA 2V5KA 1XDJA 5CPOA 3GXNA 1B3VA 1EJUC 3R8GA 3OZOA 4P7NA 4KERA 4R9OA 3G0XA 4K39A 4XSMA 5A6SA 2W6RA 4CU6A 4WKFA 1BWLA 3P6LA 4KEUA 3WDJA 2ZUTA 4KPLA 5DO8A 1JCLA 3CEPA 1DHKA 1VLIA 3DBPA 4FOKA 1PCKA 2JF7A 1UR4A 3LLXA 4IPIA 2VC9A 1FA2A 4ADTA 5AECA 3GTHA 3LRKA 2GDUA 4E4FA 1ZJBA 2PSNA 1IXNA 2BGSA 5CH9A 5JQ9A 1K77A 3UG8A 3P8JA 2NLYA 1XUZA 3B0PA 1XR2A 5KSWA 1EJVC 3RLGA 4A3HA 2GSJA 4JZ5A 3V5FA 2G95A 3T81A 3JW7A 3FX4A 3ITGA 3UA4A 2O4QA 1LYXA 2QCGA 3IEBA 1DKWA 1JAEA 2WNQA 3M46A 3UZJA 1UQYA 1L6GA 1SQ7A 1JDCA 3MSRA 1NTHA 1V03A 2OO0A 1ZCOA 3G1AA 2EKCA 2X1TA 3PP7A 2W79A 6TAAA 1Q2SA 3MA8A 3HPXA 3ABSA 2J9YA 1SJAA 1QNRA 3ZT5A 1EA9C 2BP1A 1E43A 3W72A 5JVLA 3QMRA 3RLUA 1W1ZA 1TVPA 1B3YA 5DMYA 2DZPA 2X40A 4M29A 1SO6A 2E5CA 5FF3A 5J8LA 4IQEA 1FWGC 4WF7A 1DYSA 2VGGA 4F2BA 3TSBA 3PTKA 2F7FA 1FDJA 3VDHA 2ZDSA 2OEMA 4CCCA 4FALA 3G8RA 2PF0A 4ZVJA 3GU2A 1GZGA 3UT0A 6REQB 2G5WA 3QKZA 1LL7A 1UD5A 4QAIA 1JD9A 5D9OA 3W7DA 1OABA 3PPCA 5HNRA 4D6GA 2WB5A 3DFQA 3WQ5A 4HPXA 4XVDA 4XX6A 2FFCA 2YW3A 3CHFA 1FP9A 1KBLA 4C1NB 3AIEA 4J35A 4L1GA 4MB3A 1HF6A 3LU2A 2QS8A 5MKGB 4NZ3A 2GOKA 4FLSA 4Y9PA 1EXPA 2ODOA 3G6MA 3HGJA 2ZWZA 1VIWA 1W0MA 1XW8A 3QVQA 4Z2KA 1QDSA 3FNDA 1OC7A 3BVJA 5CXPA 2W63A 2VTFA 1O1ZA 3S3GA 1W37A 2QUNA 2WCAA 1S3HA 1KM5A 1OZMA 3W00A 3I7RA 3F4DA 2G41A 4MZYA 3CIWA 3EB4A 3STGA 1QT1A 4WKHA 1N8WA 3DKLA 3HJEA 4K37A 4F8XA 1MYRA 1TFVA 3UWVA 3BMWA 3D3AA 1XLEA 2BXVA 2F6UA 1HVXA 4J40A 4CD4A 1C3FA 3RILA 3FYYA 1QUMA 4HNNA 3OZYA 4AIBA 1JZ8A 3HO8A 4GC3A 4IX2A 2YR1A 2DVXA 1KBBA 1UPPA 1UASA 2VYOA 2PTZA 4D1IA 3UZXA 3DDMA 3BOLA 1I60A 4J28A 5FF2A 1X7IA 3CB3A 2HDJA 3NL6A 4E2OA 1FHLA 2VURA 3EOEA 4V1XA 1DJZA 3BURA 5C6MA 3LGDA 7PTDA 4JN7A 1VEMA 4LF2A 6A3HA 1R6WA 4O12A 3H2CA 3O16A 2P50A 1P5BA 4S3DA 3WDPP 1NQKA 1CNVA 4UXDA 3RMEA 3G22A 1K7FA 1UW9A 3B3DA 1R7AA 5HK4A 4E2VA 1D2KA 4E38A 2Z2BA 2F6KA 1D3HA 3CZEA 4Q33A 2O0TA 5I00A 3HJZA 1RLDA 4PCFA 4K3ZA 4US6A 4XAYA 2Y1HA 3IAQA 1TV3A 3AYSA 4G2DA 1CGUA 4V2XA 1WDQA 5AFDA 1ZGDA 4HP5A 1MFUA 4O1DA 1K9FA 3BW2A 2CU0A 3K4WA 5HQMA 1J11A 3GFZA 3MSYA 2Q6ZA 4TUFA 1OFQA 3AHTA 3OZPA 4CNNA 3OZMA 4UTWC 1TTIA 1V6UA 4JEQA 5FJUA 4R9XA 1YW1A 1Q6LA 4R34A 1NWSA 1B2YA 1EGZA 3DCPA 3POHA 1W8SA 5F1VA 3TAOA 2DY3A 4QS5A 4IF2A 4CD8A 3I6EA 5GJMA 5KZDA 4LT9A 1QPQA 4ICMA 3AC0A 4MMWA 3KBJA 2XIOA 4LV9A 1Q4WA 3WMLA 2AMXA 5FA5A 4DWSA 2PDWA 4P7LA 1Q6GA 4IP7A 1HJXA 3TW7A 2R94A 5HWMA 4B5NA 2GQ3A 1MW3A 4U31A 1VLWA 3PZVA 1GQJA 4GBUA 2IQDA 4L6DA 2OYLA 3G5EA 3SN4A 4DUOA 5K2ZA 4DJDC 1FWSA 3G0UA 4WDXA 5JMUA 3MI3A 1NFGA 4YTTA 1T8QA 3WK2A 2YLLA 1B9BA 3T08A 2FVKA 3TLQA 1GW1A 1UKQA 1EBHA 1A0CA 4GHRA 5G1YA 1HXJA 4HMEA 2C18A 3B0VC 1UG6A 3STEA 3BAYA 4AVOA 2G8ZA 4HQVA 3TKFA 3H2EA 4JFTA 4AF0A 4MB5A 3SCOA 1LLOA 4JIIX 2VJXA 4WGHA 3C2FA 1W32A 2XPKA 4QEEA 1J6PA 3V0SA 1FWFC 1WO2A 4R53A 3ZZ1A 2PDFA 1XKYA 3A13A 3JRKA 4R85A 1R7OA 3HQPA 3QEZA 5TBOA 1TTPA 4W8LA 1U1UA 2VCAA 4XZ9A 5AZ0A 4AQLA 1MUMA 4LUJA 3ZJKA 1GVQA 3LENA 1V6XA 3WQ6A 4AD2A 4GLEA 4MKVA 4NZJA 3EX4A 4W86A 1PX4A 2QYGA 3KUMA 3FKKA 1SUXA 3PVFA 4C91A 3KRSA 1OX4B 1XLLA 1KM3A 3BCFA 2UV8G 1YBQB 1XYBA 4PODA 5CZ0A 4QX4A 2VWSA 4IIGA 3LXAA 2YCLA 1Y5XA 5G2HA 4JNZA 5M3WA 4W88A 1FWWA 3S5SA 4H6KA 4UQAA 1MUWA 3KDOA 1AH3A 4NZ4A 5CPSA 2QKFA 4PUKA 4S1FA 1A5CA 2CZEA 4ADSA 3UQNA 4FNTA 5FSDC 3C2EA 2VC5A 4NP7A 1G1YA 3C3NA 1F4HA 4BCEA 2VWTA 3VC5A 3GX9A 1M9HA 3A9IA 1SU5A 2A6NA 3GHRA 4W8AA 1KC7A 1OFAA 2R82A 3WNOA 8A3HA 1IYXA 1RP8A 1E1FA 3A3XA 5A8GA 3PS7A 1Q7MA 4ERAA 4O0KA 3TZNA 3II1A 2UZ9A 3FA4A 4CU7A 2CZFA 1YXYA 4DNHA 3FGCB 3NQVA 1XYZA 4XKYA 5G4EA 3WJYA 4X63A 2PLCA 1BXNA 3EMCA 4IGSA 1W31A 3B0XA 2QAFA 5CKSA 3P67A 3T0AA 1GVIA 2C13A 3NYDA 3GO2A 5CC7A 4JY9A 3PB2A 1BYCA 1TVNA 2CZVA 3UXKA 2Z0IA 4D6FA 3IJ9A 2WM1A 4WDTA 4ZOBA 2WKLA 4GNKB 3CH9A 3POCA 5AC4A 3FVDA 3LXCA 3PZIA 5JBDA 3EYPA 1UUQA 3Q2DA 2E7FA 4A05A 2W0UA 4RR4A 1XSJA 2GJLA 3UYCA 4EANA 1BPLB 4LXFA 3REQB 3ALGA 2W62A 3ID7A 1R9XA 4Q6JA 1MQQA 2I56A 4JQ1A 4M80A 1XD1A 3U57A 3IIVA 2XGZA 1XHGA 3C2RA 2FJKA 4N2YA 5HQLA 1VJIA 3U3HA 3G1YA 1UPMB 2H6RA 2WQDA 1HW6A 1JPMA 1S5NA 2Z2UA 1RUSA 1TA3A 1GQNA 2CKRA 4OUEA 2QW5A 5KMYA 3N13A 4US5D 2VKZG 4R5EA 1A3WA 2FH6A 3HIJA 3NPWA 2PDMA 3UR7A 5LIUX 1PL9A 1FTXA 4JCMA 3KWXA 5ABFB 1KM6A 1I8JA 4DBEA 4DF2A 1ZAHA 3NL2A 3W38A 4WXZA 3N6QA 5HANA 4JDYA 1XCFA 4OKDA 3M41A 4UFMA 4ACZB 2V5LA 3KTSA 2PWVA 1H62A 1UOZA 3ATYA 3KLLA 2ZBTA 3EDDA 4GC4A 2OQLA 3MKKA 3GTNA 5DRIA 1K8YA 2G0WA 2DJLA 4MKNA 1FCBA 3NQGA 1H0IA 1BSLA 5TQLA 4A3RA 3M0IA 3UCQA 2OOGA 3LPPA 2DUAA 4DZIA 4BI7A 4YXGA 2QCNA 5AN7A 1W5NA 4FSAA 1XM3A 4F3HA 3GWQA 3UY7A 2VCBA 3IIOA 4JS3A 4AEFA 2WPBA 4N42A 1PS9A 2VEMA 4C90A 4AZCB 4LYPA 4KRTA 3VNMA 3CTLA 1JI1A 1OSEA 2PC4A 5J04A 4DM2A 3J7HA 1K7EA 2D2GA 3T09A 1DE6A 5CCZA 3NSMA 3UWQA 2OLAA 4KETA 2FZ8A 3RCMA 2VL4A 1HG3A 2WMHA 5HPCA 3EXRA 2CLPA 3LHYA 3NOYA 3HBLA 1FWTA 2YDAA 4N9DA 3RR4A 3F1QA 2VFIA 2VO5A 4NJJA 1E5JA 2Q8XA 1AQFA 1P7TA 1XRVA 3TTEA 1W9BM 3H2NA 4UTLA 2BG5A 1Y5VA 1MUCA 4H9UA 1U33A 4AIEA 3N9SA 2PC8A 1ME9A 3AIVA 5IFPA 1UWRA 2XTKA 2C1GA 1SMAA 3CL8A 2CCRA 4NAFA 3G1RA 4BS0A 1VRXA 3R8HA 4X2RA 5AOUA 4O50A 4H00A 1G01A 3M0YA 1A47A 1J18A 3V5CA 3AO0A 3MWAA 3TYCA 2P8BA 5HR7A 1LOQA 4N9BA 1W9PA 3OO2A 2X41A 2NXIA 1QO2A 1LLWA 5JH2A 4FOUA 2NVDA 5A69A 1UD6A 3E0VA 4HNLA 1JJKA 4I7VA 4X9YA 3BDKA 1CEOA 1LWHA 2DSVA 1E6SM 1AD1A 2PWHA 3STCA 5I24A 4RZ5A 5HA7A 3RJXA 4CVWA 3C3UA 2HRWA 3QHNA 3S1UA 3A64A 5E0CA 3GFYA 5D2WA 2A3BA 4JBRA 2AQVA 1X1OA 2YDRA 1X7FA 2Z6JA 3GR8A 1ADSA 1IWBA 1E9IA 2PTYA 4N4PA 1XC6A 2WMIB 4GY7A 3CU2A 1LQ2A 3QTGA 4PBEA 2V5DA 3NYZA 3UXIA 1ZJAA 1O5XA 3GK0A 3L5MA 4RZBA 4CCZA 1V3KA 1TX0A 3LTSA 1GYNA 2W67A 1GYLA 3D6NA 2XDFA 1V6YA 5D8ZA 1R3QA 1HKJA 2V3GA 2ZC8A 2J74A 2VEIA 3E6EA 1HJWA 5CZJA 2OQHA 1EJRC 1V77A 5I23A 4Y9OA 5A2CA 4DM1A 2ACUA 4DJFC 3UZWA 4W7UA 1NWTA 3AYRA 2FPVA 4FNRA 2VRQA 3WIJA 3GSMA 1NJJA 1VS1A 3VIPA 3AHYA 3KEHA 4BK9A 4LJ3A 3T6CA 1AQMA 1KV8A 3VZYA 5HMDA 4PULA 3S2MA 2XH0A 2A6LA 3PBYA 2HROA 5HJLA 1V0LA 1IZKA 4GI9A 3GXTA 1DWJM 4Z2JA 4XAGA 3EWUA 3WL1A 1K02A 4EAYA 3W2KA 3RPMA 1NH6A 3S1VA 4ES4A 3T55A 6CGTA 5ENLA 3BJSA 4JX5A 1M1BA 4UC5A 3ANUA 1I75A 5IHSA 4GG9A 1TR9A 5IXEA 3LEPA 3UU0A 2CZ5A 3NXLA 1TZ9A 1YPFA 2GWGA 3UPMA 3WFZA 1PHQA 4H41A 2TODA 1A5AA 5M1TA 3VKKA 1B3XA 4JHOA 1UZ1A 1JL8A 1BG9A 4P7QA 2R91A 1AMYA 3NJ3A 2OODA 1U83A 4V33A 2ISSA 2RUSA 2D20A 4PMOA 1D3CA 5BROA 2B0MA 1PTGA 3W7IA 2C71A 4MF4A 3PZNA 3SQSA 1UIOA 2XH4A 3SW6A 3G18A 3MMUA 1ZCCA 1TZ7A 2R6OA 3W76A 1TMLA 4B5SA 4B92A 4ZQMA 3QV7A 1LOLA 4B16A 3L12A 4H3DA 3LRMA 5GPRA 3WD1A 2G3JA 4N7QA 4Q8MA 1LBLA 5JIPA 5JUVA 1T99A 1V02A 4GJ1A 3IGSA 1TPEA 3DFNA 4OBRA 4BQ5A 4LPCA 3MU7A 4PUJA 2NVAA 3QZAA 4NL1A 1IGSA 3FFSA 1EJSC 2PGFA 1Q6QA 2BSLA 3RM8A 2H3BA 4HOXA 2QCCA 4RK8A 2DIEA 3GBEA 1HL2A 3AWOA 1VEOA 4K1WA 1IWPA 1MQPA 2BVTA 4IFRA 2GVYA 3RNDA 3CO8A 3U0HA 1K3UA 3ITCA 1GZJA 4KIEA 4AZ6A 1FQ0A 4AZGA 3T05A 3RR1A 2NV1A 2JKAA 4IMCA 5DELA 2TAAA 1PTDA 1F9CA 1WB0A 4N02A 1Z89A 3HPAA 3IV3A 4NZ5A 3WLIA 4O18A 2A85A 3W6YA 1M04A 2HMCA 3GDRA 2E1WA 4Y9MA 3G77A 1SFTA 3A3HA 1MZHA 2WCSA 4HK7A 2VOTA 4WSKA 4MPQA 1CB2A 2OPJA 2XIIA 3V7PA 1BFNA 9CGTA 1QW9A 3GW3A 2PCQA 1QASA 1Q66A 2EG6A 3PY2A 3NQ2A 3QY6A 4JKMA 1BVNP 5LIXX 1P43A 1ZJHA 1J9YA 4C1KA 3BH4A 4JHMA 2FLIA 2OMAA 1XIMA 4A4AA 3B0YA 3P0WA 9XIAA 3L4TA 3TNOA 5HUPA 3EA1A 1C8VA 3MANA 4MWAB 4Y2WA 4XBKA 4CN1A 5CPMA 1UMLA 3DYMA 1UJPA 4X0VA 3P62A 5E9AA 3WQGA 4HA1A 3A23A 3W7EA 1Z41A 2OZ3A 3ITTA 1A5KC 1EJTC 3GG7A 2QCHA 2VFGA 4REQB 4MSSA 1HO4A 3SUSA 5HOSA 4QISA 1YE6A 1TV7A 3NZQA 2YXXA 4LC8A 1ZQ5A 1KR0A 3I10A 2DUXA 1WXZA 1Q6CA 4Z42C 1OC5A 3QMSA 1DTNA 3AOFA 4M6UA 4O4WA 1VZWA 3QW3A 4NX0A 3N4AA 2F2KA 1OYCA 1SZFA 2WHJA 4RPQA 1S2UA 3G1DA 1QAPA 2OU4A 1NWUA 3UCDA 3JZEA 2ZOXA 3AIWA 4I3GA 4F79A 3H7VA 3PAJA 3CM4A 4A3YA 1F3WA 4K8GA 3A3WA 4WDWA 3KZSA 3IRDA 1IIGA 3L2IA 3VUSA 2RAGA 3LCIA 3A4JA 3FA3A 3APTA 1H1NA 2BZNA 2OLSA 1T40A 3M5YA 1ME7A 3B9DA 1WDSA 1BLIA 2B7PA 1A0EA 1VIZA 2CWNA 3AHVA 3VZZA 5I77A 5BW6A 2VR2A 4EVZA 1R46A 2QDDA 3LI1A 1T0OA 3C5QA 1CXLA 5EMYA 3PN8A 2IQTA 4B4HA 1SYTA 4JL1A 5C8BB 1XPYA 4CVUA 1KWGA 3NDYA 1EL3A 4JNMA 4RE2A 4JOMA 1UWTA 1DE5A 3CUZA 4HT3A 4Q8TA 2IKGA 3VUPA 1KFLA 3MCMA 3MJYA 4DEFA 3EGJA 3W1RA 3P8IA 1E1EA 4TR9A 3TONA 2WVSA 3BMVA 4IISA 3GU1A 2J6XA 3LB0A 2NQ9A 3FXYA 5BU9A 4P5UA 2BY1A 2D3LA 3DHUA 2X1UA 3ZS4A 2WANA 3TCSA 3MQTA 4GUJA 1GORA 3IPWA 4NJHA 3TR9A 5LNVA 1KCXA 2A7RA 1A53A 4C5YA 3WF2A 4NAEB 2HV5A 3W1TA 4B5TA 3QLDA 3R89A 2Q3RA 4ZODA 3VOFA 1HTIA 2VELA 4GO8A 1PB0A 2X16A 1WQ5A 4B91A 2A79A 4AWEA 4ZSTA 2YA1A 1OCNA 2Z7GA 3U4AA 1E6QM 4HIBA 5BMWA 4QSHA 1Q6FA 2INEA 1OFPA 3IACA 3W24A 2EF9A 1N7KA 2VOMA 4KCVA 1C7TA 2YCEA 1MMFA 2Y4SA 1XI3A 1TWWA 3FVMA 3R5EA 1SR0A 3S4TA 1F76A 1GT8A 1GTHA 5GJNA 1D7KA 4UUIA 2ACRA 3MUY1 1K6AA 3HMJG 1NOWA 2CPUA 1S3TC 2KX9A 1ONXA 2YL6A 4BEUA 1K8XA 3H70A 2MANA 3GIQA 4ATDA 1DPMA 4IT1A 1JF6A 1BVZA 1QRQA 3DFYA 4ZQPA 3QRHA 3PZQA 4LAMA 4LRTA 1O5KA 4YYFA 3AMCA 1H7NA 1Z69A 3KCLA 1K4HA 5IRPA 1RALA 4WY0B 5DANA 2QPSA 1TMHA 3BLEA 2WAGA 2XFFA 4A8NA 3KE0A 2V0TA 4GFSA 4YYCA 1R3VA 3DEQA 5I2UA 5H8UA 4GUGA 5JBEA 4M1BA 9XIMA 3IANA 3SO7A 1GEHA 3NQ8A 1US0A 4JTTA 1OCBA 1EO7A 2E28A 4CUCA 2AQWA 4UQEA 1AJZA 3WD4A 3U7VA 4TMCA 2YL5A 3C0QA 2EJAA 3GC4A 5F2IA 1W3JA 3WQOA 2HBXA 3CL6A 5F4SA 4HNOA 3QZEA 1ISVA 1WAWA 6XIAA 1TB3A 1F6YA 4GIEA 4MWAD 4IFKB 1OB0A 1W54A 3H7UA 2WNNA 4X9SA 2FGZA 2C19A 1QHOA 4MJ4A 4BWLC 1JGMA 3BSGA 2CLOA 3ZLGA 1XH0A 4CD7A 2P0IA 2E25A 5IBXC 4KWUA 4ZL1A 3GC5A 3F5JA 1PZ0A 4I8DA 5EMUA 1OJXA 3GC2A 1AQHA 3PNZA 4GH1A 5A94A 3U2EA 1EP2A 5U7SA 4LQ1A 4L1WA 1QK0A 1OFOA 1PTAA 5CPTA 4TV6A 3OEXA 4GO9A 2UY4A 2WPGA 2CBUA 2BOEX 2EPKX 1BWKA 4WJEA 3RU6A 1RBAA 4B9YA 3SGGA 3N17A 1X39A 1JYNA 3LZ5A 4LWWA 1OADA 1GNXA 3OBEA 4KWWA 5F2LA 4B9ZA 1NDYA 2PLMA 2OFJA 3W22A 4WKAA 1VFHA 4O8RA 3TN3A 1QXLA 4Z2IA 3GDMA 4W9TA 5D2XA 1JQVA 3HV9A 1R85A 1W1YA 5KEZA 2OVLA 1JR1A 3NEVA 3SQMA 3DHFA 2OZ8A 5JBFA 4JKKA 2VR5A 3L4WA 2PTWA 2P3EA 3F5LA 3GAYA 2QJHA 1GKPA 1O68A 2V81A 4L9XA 4JIEA 1NM9A 3TDFA 3O06A 2OO6A 3NXFA 4K1GA 4M51A 1BQCA 1V8EA 4LCRA 1AW5A 3S6DA 4ZO7A 5E6ZA 1S5VA 1K4GA 1NF7A 1EF2A 1RBOB 3DIPA 2RDUA 1VFFA 4OQVA 3MP4A 2GDQA 2XIMA 3LHTA 1RLCL 5C2GA 1YIXA 2QVHA 3K13A 3LHUA 3U2ZA 1FBAA 4A22A 3PBGA 3GXIA 4M1RA 5E6YA 1KTBA 4UQBA 3M0ZA 3N2XA 3VE9A 4LBSA 1WBHA 2DEPA 2X8RA 3H8AA 3TV8A 3BJFA 2QIIA 3DG6A 4PRWA 4I6VA 3OODA 1RQBA 4XUYA 4JTIA 1E40A 3M5XA 4GQBA 3UGVA 1QVBA 3CQKA 1QI2A 3W1XA 3NPUA 1DJGA 2NV2A 1P7TB 4UFLA 3G3DA 1XPGA 4B90A 4AEOA 4IIFA 2HWGA 2WZEA 2ZZ6A 3AI0A 1XQLA 2E68A 4D1JA 1VR6A 1AG1O 2JK2A 5DBUA 3U2OA 4YN5A 5CG7A 5EBUA 2HS6A 4FP1A 4W5UA 5FIPA 3VINA 4MFEA 4JIQA 1S1PA 2ZZ7A 1RXOB 2DT2A 4U3CA 4YTRA 3L0GA 2O7SA 2YJQA 3WEOA 1N82A 3UG3A 2PUZA 3MMDA 1KLZA 4RDZA 3TCEA 5K3VA 5HAOA 1HUVA 2OYMA 3LM3A 4E8DA 3BQ6A 3I4KA 3EX1A 1ZBVA 2GFTA 2W91A 1W1A1 4PUNA 2PDBA 4C6QA 1AZ2A 3GXPA 3NZGA 5CPLA 4O1BA 2FZNA 1L0PA 2O9OA 4XZWA 4S3BA 5D37A 4ZQNA 1PSCA 5BXPA 4M19A 3NQFA 3USZA 4EKJA 2C0AA 4HTBA 4KEMA 4TMBA 1R9YA 1WOBA 1RH9A 2VEPA 1GG0A 1PYMA 3UP8A 2EPOA 1UWAA 4H7CA 3LD5A 3KTXA 5DN1A 1TV5A 3LBMA 3OPSA 4LU0A 1MNSA 2O56A 2V2HA 3LLDA 5FEXA 4AWUA 1WX0A 4H8VA 3U2CA 4PUDA 1I6NA 1EEXA 4INFA 3BAJA 1UH2A 1BGGA 2J62A 3G1XA 2ZE0A 5F2GA 3P61A 2QNEA 3H4WA 1GOMA 5DMMA 3W7JA 2WHMA 4KGJA 3A4WA 2CLHA 3LV6A 1E55A 1HKIA 2JFEX 3MB9A 4Y8EA 1M68A 2I5QA 3G24A 2E5BA 4QG6A 5CBBA 3C6CA 4AIOA 2G4FA 3NQMA 3L2MA 1FH9A 3W26A 3RCYA 3WN6A 4ZA0A 4FLOA 3G8EA 3UZ5A 1UBSA 2DSKA 4O1CA 4GKLA 3N34A 3VIKA 3K2GA 4MUZA 3BARA 3BGGA 3KTCA 3E12A 1TUXA 1OG0A 3HQOA 2AL2B 1Q63A 4DLMA 5U4NA 2AGKA 3E3HA 2XUCA 3L65A 1TSIA 4X60A 4FXJA 1ICQA 1I2QA 3W1QA 1HL8A 3RMJA 2IKIA 3N4EA 3PK7A 4JHZA 1I2NA 1PHWA 1SPQA 1M3UA 3MCNA 3WLJA 4JD4A 2WC4A 4DJEC 3FDGA 4WD0A 1KBJA 3SBFA 1TPFA 2PRLA 5BRQA 3BICA 3EMQA 3QR3A 4DXVA 1ZTVA 3H24A 3W86A 2D24A 1BSIA 3N73A 3M44A 2ZVIA 3CZJA 2E6YA 2V3FA 4ZZ9A 2NXGA 1WZLA 4PGLA 1VD6A 3AJ7A 4RXFA 4QFUA 3MY9A 4P8WA 3MWCA 4YPJA 3NQDA 3BOXA 4ZO8A 4HYWA 3AS1A 3M0KA 4LUSB 2C0HA 3PJXA 1G0CA 1XUUA 1YX1A 3IS4A 4JYFA 3CV2A 1EQCA 1KLYA 2GOUA 1YXDA 5D2YA 1LL4A 3H23A 2J7BA 3D0CA 8RUCA 1V4YA 4H9TA 4NF7A 3TYZA 2WVVB 4GMEA 3ARWA 3MUCA 4FMVA 2IKJA 4O28A 1B3WA 1XLDA 1E15A 3QHOA 1E4NA 3AZRA 1J2WA 2XWEA 4F48A 1C9WA 3G3MA 2XM2A 3LXBA 4RDVA 4LYKA 4CN4A 3VA8A 3B97A 1CWYA 5EA9A 3VILA 2PBOA 2Z2AA 5HMEA 3WLTA 3AS2A 4WOZA 2RDWA 5TIMA 3VOIA 3EMZA 4GXMA 1KFJA 2VFFA 1ZFJA 3E0IA 3VYLA 1R8LA 4UFKA 4TXEA 4ZSUA 1BQGA 4IMAA 4P2VA 1JVNA 3GXFA 1B57A 4CGTA 3VCRA 1F3TA 1OG6A 1XINA 1YNYA 2HVMA 2Q8ZA 4JFVA 4DRSA 5DCEA 3M5ZA 4FXSA 2GUYA 4IJCA 2IQ0A 4S3CA 4GABA 7XIMA 3SDOA 4AXKA 1XIBA 1LOSA 1W9UA 2CBVA 1NP0A 3GR4A 3I7QA 3QW4B 3EEZA 3CHDA 2QMKA 3DHPA 1ZY9A 4LUTB 2YBVA 4J2MA 3LBOA 5FESA 2Z1WA 4GFIA 2R9RA 5HJYA 2BDQA 4MDPA 3TSMA 4F0MA 1BHGA 3K46A 1FHVA 3TJLA 4NNCA 1QBBA 1VBHA 2V82A 3FA5A 2QF7A 4PFMA 1TZZA 4WEVX 4H9VA 5BCAA 4R7JA 4GY0A 3W73A 7REQA 2CEQA 3IAPA 4JX6A 3BLKA 4MADA 4AEEA 3GDLA 4CLMA 4UFJA 5K7JA 4V27A 3VKCA 3TYDA 1CI1A 9RUBA 3DGBA 1TG7A 5D4YA 2PAJA 1TIMA 5REQB 3G2GA 3KOYA 3JUGA 3IIXA 3WK1A 1R3TA 2VGFA 3W27A 3HPFA 3WLPA 3RDKA 1F2JA 3S6TA 2R1PA 4J7RA 1K8ZA 3NDZA 1AFSA 4GYJA 3M47A 5LGZA 1IZJA 2V2DA 3UESA 1GEQA 4E3TA 3UZZA 3IVUA 3LG3A 5DEZA 1DQWA 1U30A 3SJNA 4ZTXA 3E96A 4FOJA 4ZB5A 1UR2A 3NQ7A 4G1KA 1XKJA 4RZ6A 5CQ1A 4JKLA 2OB3A 1MW0A 1W91A 8XIAA 1RJRA 3RU8X 2XVGA 3I65A 3LV5A 2A3EA 1L8PA 4QIUA 3W1LA 1ZALA 4IGHA 2HEJA 4QE4A 1VEPA 1HVQA 1EFZA 1H61A 1P6CA 1FVPA 1A4MA 3XINA 3S5ZA 3AYTA 2PI6A 4B5XA 6XIMA 2PDJA 2GJXB 1CCWB 2P5NA 4WHBA 1CECA 4IG2B 1CIUA 1W3TA 2FHBA 4GJJA 4NSBA 3MZNA 3M6YA 1W9XA 3KFTA 5G1TA 2ZUWA 4A35A 4K8EA 1TWDA 2QJJA 4NRRA 1V0MA 1KTNA 3NGFA 1AZ1A 3VMPA 3B8TA 4JICA 3S83A 1SZNA 3VNIA 3KOZA 2Z27A 1BTMA 5FF7A 4HHPA 3D5HA 3ARZA 3KBNA 5E0FA 3P60A 2E9LA 3GAKA 1ENUA 5FEPA 2WJZA 1Z42A 1SMDA 4Y9AA 1R3WA 4L6HA 1UKPA 3QY8A 1IEWA 3T40A 4C1LA 4WDUA 1H63A 4LYRA 4W7VA 1X6NA 2POZA 5RUBA 3UFYA 4ERGA 1RD5A 1U2YA 2WHKA 3IJQA 3KCJA 8TIMA 4N9EA 3EOLA 3SCVA 2DQXA 3UR8A 3VABA 2EQDA 3QJAA 1S2CA 4U28A 4W93A 2OZ0A 4OHQA 3WD3A 3W53A 5LSMA 4IIBA 1J01A 1N8FA 4JTLA 3SEPA 3GHUA 2VFHA 4GXPA 1UA3A 4MB4A 3Q94A 2YBTA 3HQNA 4FF7A 3DH7A 4I7UA 4EOUA 4L4LA 1FHDA 4D9PA 1KD0A 3ANYA 1S2VA 1S5WA 1GUVA 1WDWA 4DJDD 1XIJA 2DSUA 5HNUA 1JI2A 1OD8A 2GVEA 3QGKC 3G0SA 3RM4A 1W5OA 1T5AA 1ODZA 4L65A 3T1GA 3VOHA 4MM1A 3CHCA 2P76A 4HSOA 3BLPX 4IL0A 5EY5A 5D30A 1BXCA 3VFLA 1XIEA 2ZXQA 5AVNA 3GTXA 4KH2A 4RE0A 2HQAA 3RRXA 1U5JA 4QR6A 2NX9A 2QHAA 1JCJA 2IW0A 2DGAA 3AXMA 3R0KA 2J79A 1OYBA 4NG3A 1P0BA 1XYCA 2AL1A 1NEYA 3STFA 1M03A 2JF6A 3G1FA 3O1NA 2QXWA 1DJXA 4U10A 4S3KA 3DU0A 4IUGA 2V30A 4PUUA 3L68A 4UMAA 2J4GA 3TQVA 3VGBA 5FEWA 4UWMA 5A5WA 1PX8A 1S5TA 2X42A 1I1XA 4XBJA 2PRMA 3APGA 3O8AA 1XH1A 2CETA 1CT5A 4LBUA 3WLNA 2HE5A 2ZVRA 4AHQA 4E6MA 3CH0A 4WJ8A 4M3PA 4B5UA 3CWNA 3DG3A 3TW6A 3C2VA 3M07A 1H51A 4ERIA 4UTIA 4F0LA 5EFDA 2RGLA 2WHLA 2INFA 2G37A 3C2OA 4UTFA 5DXXA 2NQJA 1DWGM 1XP3A 3BAXA 2GSHA 4J9JA 1NY1A 4MLJA 3P7YA 3HURA 2BY2A 3WCZA 4BHYA 3BZJA 3F03K 1KFWA 2B7OA 1T7LA 1P6BA 3BL3A 3S2LA 1QU4A 2VR4A 4G7EA 2QJMA 2ISVA 1ZBWA 3O15A 4UBPC 1JF5A 3QV8A 3C56A 4NT0A 4PSRA 3UCCA 1F8MA 4LUYA 3SUVA 3EBVA 5FF0A 3ARPA 1PXGA 4RE3A 1TYGA 3KHJA 1TJRA 4JTAA 1Q8JA 5FSEC 1I2PA 2ZZ3A 1QI5A 3RUBL 3ZWTA 5I02A 4GI4A 3UEQA 4HU8A 4UIOA 3M64A 4PB3A 1IT7A 2YB1A 2QF8A 2H9AA 1AQ0A 1QFEA 1GOKA 1MRAA 2QLYA 4YU1A 4M6PA 4S39A 5XIAA 4F0RA 5E1QA 2PWFA 3QGAC 4Z1DA 1EHNA 3QOKA 1JAKA 3PZTA 4JTUA 1WKFA 4KEVA 1KCLA 2GQ9A 2FKPA 2ZX6A 4MHBA 4Y6GA 3WQWA 4KIRA 3K8KA 5BMXA 3BE7A 3ZVHB 4NRSA 1WP6A 4KMQA 1E1CA 2PLKA 2WVTA 3A4AA 1X96A 4GX8A 4EIVA 3H7RA 1LJYA 1ZENA 2NVCA 2BWGA 4IHCA 2ISDA 2V68A 5I07A 3QSTA 3AHZA 3R58A 1OF8A 4JTJA 1QW7A 2FGBA 3VVGA 5LIYX 1TQJA 4JNYA 2H3DA 2JE8A 1EIXA 1FH8A 3PSWA 3ARRA 3EZ4A 1NDWA 4M82A 1H5VA 3WLOA 3DXIA 2OWXA 4XZMX 1PZ1A 4ILSA 4XO6A 1GVYA 4O1AA 1WPCA 4GINA 2NV9A 2JKEA 3MS8A 3E02A 3HGRA 3VOJA 4FS9A 4GUIA 3ONBA 3N12A 3IUIA 1RCXB 3NAVA 1SW0A 1FKXA 5HATA 2OX1A 3INPA 2UY5A 3KOFA 2E40A 3DC8A 3W1MA 1VFMA 2CXEA 2CYGA 1KM1A 3M0MA 4S3GA 1E6RA 4QQUA 3CAKA 2J27A 4Z08A 3UJSA 5LNWA 1ODUA 2DDXA 1B4KA 1W8GA 3SB0A 3SFKA 4F9JA 2YA0A 1OT2A 3W6LA 3FJ6A 4MJ2A 3TMQA 3EWDA 4QNEA 3QPZA 2PE4A 4WX2A 4FLRA 4LNCA 5JU6A 4MKSA 7ODCA 3S8HA 2A3AA 1VHNA 5LIKX 1J0YA 1W6TA 2SFPA 5BOEA 1SW7A 4Y90A 4L7ZA 4NI3A 1ZU8A 3QFEA 1OF6A 5AYZA 1TMQA 3WY1A 2E6FA 3ITLA 3B9AA 1PJ9A 5D9PA 4PEEA 3TXZA 3CBWA 4GACA 4E2BA 3N2OA 3WQEA 1FKWA 1XIGA 1UR1A 1WV2A 2OLHA 1CTNA 3R13A 4ZMGA 2RFGA 4WSJA 4FX7A 1RK5A 3R7MA 4MUPA 4BJHA 3PR2A 1Z8AA 2D0FA 1TRIA 3T7VA 3GXMA 2Q01A 4H2CA 4Z2HA 2XN1A 1OIFA 3IGUA 5T9CE 1DJIA 3NZPA 1FP8A 2F8QA 2HS8A 2REQB 4FR6A 3CQHA 2J78A 4A21A 3GVGA 2CFFA 1EZ2A 4BFAA 3CUXA 5CGQA 3L4XA 3HB9A 4JN8A 2WKJA 2HE8A 4G1NA 2Y5SA 4EACA 4WXYA 4XVEA 2E9BA 3W2NA 3K1DA 1TJ2A 2W27A 3F4CA 3BLFA 3P74A 1A3HA 1JZ7A 3U5YA 3SURA 1CBGA 4IUOA 1Z32X 3GYEA 3LCXA 1EJXC 3N2TA 1A49A 3R0DA 2VX4A 2YL9A 3C8NA 3CL7A 4B2DA 1MQRA 3EWBX 3DZ1A 4HZ7A 1TR1A 3OYZA 3W7HA 2NX1A 3G1SA 1QJWA 4FK9A 4P7RA 4EK7A 3BK0A 3QFWA 3B40A 3FIGA 5AYBA 3W70A 4IFOA 3NIYA 1NF0A 2Z4GA 3NOEA 2DW7A 1O66A 1TWSA 3AZSA 1SZGA 1P48A 4LB4A 2QCDA 5CSUA 4OVXA 2P8CA 1DQXA 1EPXA 3C52A 3RX4A 3PG9A 1DV7A 1E4IA 2Y7EA 4GOAA 1JPIA 1S38A 1UCWA 2HNEA 3BUVA 1W5MA 2DP3A 5D2VA 4W7WA 4H9YA 1DWFM 3WSUA 1YLVA 2PTDA 3OA3A 3R4IA 2PEVA 5HWNA 6PTDA 3LUTA 3GH5A 3P5YA 3KRBA 1SO4A 3W01A 4H9ZA 2ASHA 3P5ZA 1JCYA 3ES7A 1XLMA 4C7GA 4OTKA 3UJ2A 4CKQA 4DJFD 5I0DA 3SIMA 4HPJA 1E9ZB 2FZ9A 5KZ6A 3JS3A 1R30A 4O0QA 4QXIA 1OT1A 3V35A 3B8UA 4Q4KA 2PD5A 5DCDA 3WJWA 1OIMA 3WL0A 3F5KA 3W82A 3TC6A 4YLWA 3TC3A 3LMZA 3T2OA 2YCIX 4LAZA 4FZIA 5DX7A 3HG4A 4S2BA 3BSHA 1MRQA 4L4OA 1ZHAA 1BRLB 3VIOA 1OHLA 1QW8A 3WKZA 4UNKA 4GY1A 2CC0A 1V3JA 3OHIA 2GVGA 3N19B 1RR2A 3AJXA 3EWCA 3TIMA 4QBXA 4J27A 4LVGA 5D2TA 3TN6A 3FSUA 2FVMA 3P84A 4RPPA 1KV5A 3GVVA 3CMGA 3CYVA 1Z6KA 2PWGA 2NSXA 3FS2A 4IPPA 4QDPA 1YTEA 7ENLA 1BF2A 4RDWA 5LA2A 2C3ZA 4YCOA 5A8NA 2TYSA 4K8HA 4JCLA 3VIIA 4LY4A 4LVAA 1EF3A 5KETA 1LQAA 4CQCA 4HN4A 4ZE4A 1OYAA 2ACQA 1XV8A 3OYXA 4AY7A 4AAJA 4W4QA 5HBFA 5EMLA 1W17A 1YYAA 4IQJA 3S5NA 4IZGA 1LZOA 1NDZA 3M6DA 5BRPA 4E8GA 3AS3A 1VQTA 4QP0A 1B9ZA 4FXFA 1A3XA 4AW7A 2WSKA 2GQAA 5DXYA 4DYKA 5H2ZA 4N6EA 4KBXA 4FAMA 3F4WA 2DZSA 1XLHA 3THQA 3K30A 3VNDA 4GYPC 3VDAA 4JFUA 4ZXLA 3RYSA 2Q71A 2QZRA 3UYIA 3BSMA 1V93A 2OYKA 4FNUA 2Y5JA 3H2MA 5FJRA 1JIBA 4AIUA 1ICSA 3C2YA 2DJXA 5FD0A 5D03A 1PPIA 3EB3A 3CTTA 4GIAA 3CUFA 1L8NA 1V02E 4O15A 4UTKA 4TTGA 2ABAA 3SY8A 3BLLA 3L23A 4JPGA 4Q32A 1CXHA 1VP5A 2XU2A 3G1VA 1E6XM 3SR7A 3SIZA 1YEYA 2FYMA 2Y2WA 3VFCA 4AG0A 2E9MA 3E0FA 4YHGA 2GK1A 4PRTA 2WC7A 2YFNA 4OBTA 1TX2A 1GGOA 1XGZA 4GVFA 2F84A 1Z48A 1WYIA 2QT3A 3HZ3A 5KZMA 4H6EA 2GQ8A 2V2CA 4AXNA 1IV8A 1ZBKA 3GVQA 3WH6A 3WUBA 2I7GA 3GNXA 3VKBA 2WCGA 4C6CA 5L9FA 2KAUC 1TE6A 2Y89A 1UP3A 3F4NA 3P3BA 4HYRA 3FXGA 3SFWA 3N2CA 2J7DA 4GJIA 3U4FA 1XGDA 2D69A 2HCVA 2NUWA 1OFRA 2FPTA 2ZUVA 3DFOA 1F74A 2O9TA 2WYSA 4QLKA 1H11A 3GH4A 4MAVA 5BNKA 1XS2A 5B7YA 3LX9A 3DX5A 1JRBA 3TYEA 3O2LA 1DTUA 3CZLA 4C7FA 1QNVA 4JL2A 2ZA1A 3TW9A 4HJWA 3BC9A 4PCNA 1UKTA 2QULA 3BAWA 4DVOA 3D47A 1M65A 2CXGA 2PGRA 1MEWA 4HCHA 2DZWA 3O9NA 3MI2A 3BCDA 3Q58A 4IIDA 2FIQA 1DWHM 2VX6A 2NQ5A 5FF4A 3PUGA 4O19A 3HQ1A 1ONEA 4A2SA 1KQYA 3NQBA 2DVUA 4Q8NA 4AD0A 3CIVA 1XLKA 4JQ3A 4ROPA 3R11A 4IH3A 1CPUA 4GX9A 4Z2GA 3PFMA 4XZBA 1YDYA 3O07A 5H8PA 3GTIA 3MBFA 3GD6A 3S5OA 4QEHA 5A6BD 3RRAA 3TQ0A 2C91A 3I7SA 4AISA 1KXVA 2HTMA 4ZE5A 4L4MA 1NWRA 1UR0A 3U5UA 1QI3A 1FDZA 4RXGA 2JIEA 5D9NA 4ZXOA 4K2SA 4QG9A 4GA8A 2BHUA 3VDBA 2A1YA 3M0XA 1MDRA 2V3EA 3GNRA 1EDGA 2ATSA 3BJTA 4NASA 3IRSA 3QY7A 1FWIC 3BAIA 1E0UA 3TWAA 4A8LA 3IJ8A 4NJKA 3UG5A 5ABTA 2XYLA 2DQWA 3AMDA 2YA2A 2I14A 3FJLA 3W7NA 3RX2A 2H90A 3D46A 5ABGA 1A5MC 3KWSA 1NDVA 1IGWA 3LSCA 1QMLA 3KM8A 1B54A 3NQCA 2VQTA 1I9CB 5HQEA 4KRUA 3RO6A 3WLSA 3BZGA 2PCEA 3VKJA 4ZENA 2ZRUA 2XN2A 4JEJA 4MVAA 4FO4A 1QHZA 1PBGA 1WZKA 2VM8A 4UTTA 2PP1A 3N18A 1P1MA 1TV4A 4FNPA 3RFAA 3S5YA 3PTMA 3QV6A 1TKKA 4XB3A 2BX7A 3MKVA 6REQA 3ALFA 2DPEA 2G97A 2P88A 2GSEA 2HXUA 5CLWA 1JG9A 3NQ6A 4TVUA 3B0UX 5PTDA 4ZR8A 2PWUA 3C86A 3VKDA 5M5DA 4MNJA 3KP0A 4LW7A 5I06A 3DBNA 2PS2A 2PDKA 1L6YA 2FFIA 1IF2A 3BWWA 5J5DA 1H3GA 3NSXA 4C1NA 3ZO9A 4LF1A 4D6HA 1UD3A 5MKGA 1GOXA 1KXQA 1SFSA 5T8GA 3SUTA 3UWUA 1HKVA 1R9ZA 4PMYA 5DFAA 4MYAA 4J3TA 3NWRA 4BF9A 4BWLA 1K9EA 4Q4OA 3H2OA 2DZXA 5FI8A 1F4AA 4KS0A 2J88A 4N0RA 4O4VA 2B4GA 5IBXA 4AHPA 4LS1A 1FWAC 5H6HA 3E38A 4R7WA 1BYDA 4H6RA 1PO9A 3QOMA 3WQDA 3UR5A 3QPYA 4XZHA 3V36A 1S39A 4E8CA 1VKFA 3QMTA 1QNSA 3ZJ7A 3KBVA 1XICA 3WBYA 5MHBA 3N6HA 4ECLA 3W88A 3SECA 3W7GA 1FX6A 1AW2A 3MDWA 3FAXA 1XJBA 3MI6A 2HK0A 2QJIA 1XQKA 1WBJA 4V28A 2PF8A 4PRRA 1E3ZA 1W5PA 2TMDA 3E74A 4FA3A 1WAUA 1UROA 1NFBA 1S1RA 1LWIA 1YNPA 5HINA 4GZJA 5TAOA 5AYIA 2GJPA 4NNBA 2ZE3A 4IMDA 4JTDA 4AD3A 3DOPA 4OBSA 1JD7A 1EC8A 1F7BA 1EEPA 1OM0A 3B8WA 4QG8A 1YKWA 5EFFA 3ITXA 4HMCA 3N1AA 3URNA 1V79A 3R6IA 3VNLA 4YVXA 1XYLA 4DI8A 2YBUA 1LT7A 3NQEA 3ZMRA 5CJ5A 4QGCA 1XLFA 5CBIA 4D6EA 3SCPA 2WJFA 3P14A 4Q4PA 1GPWA 3O0FA 1T96A 1ITCA 3E5PA 1Q5MA 2VENA 3LBCA 4JTFA 2X1SA 4IGMA 4PL2A 3TMLA 3VK5A 4US5A 1XIDA 3IJIA 1Q45A 3E5BA 3WQPA 4UMCA 3CK5A 3CPUA 1UZ4A 3ME3A 1Q6RA 3SRHA 1UMYA 3B8SA 5LXXA 3Q67A 4PE8A 1LRNA 4K68A 3S6OA 4IMEA 3TJXA 2DIJA 3THAA 2QV5A 4R7OA 2YYUA 4RLIA 2CITA 1AH4A 1GJWA 3LI0A 1T6MA 3MV01 5AVHA 1REQB 2DT1A 3U48A 2PWDA 5A6MA 1WDDA 3T2PA 4S38A 2J7HA 4GYKA 2W66A 5HJXA 2WWDA 3Q65A 3WLQA 2VMFA 2EBNA 1TPUA 2RHGA 2X09A 4IICA 3VNKA 4FEZA 3MP5A 4PMZA 4G56A 1AL8A 4F2TA 1ELSA 2ALDA 1X8FA 4QJ1A 3NR0A 2YCKX 2OT0A 4H83A 4M8UA 2V3DA 4BQ2A 1EUNA 1DIEA 1VC4A 1IXPA 1OFBA 1H1YA 2VX5A 3ARYA 2WBGA 2FDMA 3K4AA 1F05A 3PPGA 2NW0A 2V63A 3M0HA 3GKAA 2XVNA 4ALDA 3WNMA 3EXSA 2O7QA 3NCOA 2Z25A 1H7XA 3QZ6A 4RV8A 3OLGA 4BZYA 1PZ2A 4D8ZA 2QCEA 1LUCB 4WGXA 1GOWA 4PTDA 2EAWA 1WUEA 3AS0A 4QLLA 1SSGA 3S0CA 3TSDA 1OC6A 4K7YA 2QPXA 3TJIA 1IT8A 3MSGA 2Z1SA 3L4YA 1TPDA 3VKAA 4JXCA 4AZBA 1R3RA 1BF6A 1OCJA 3UVIA 3PSVA 2WBKA 3NPVA 1DORA 3VD7A 3TQKA 4PMVA 2JGYA 1FFRA 4HZMA 3UWYA 3WF3A 4O1EA 1PWLA 2ZTKA 1OX4A 3N04A 1JPKA 3GDKA 1YBQA 4M81A 1ECEA 1VB9A 3Q37A 5A8OA 3BMXA 3OQ8A 3SADA 3WEMA 1GJUA 1KW1A 1HNYA 4AZHA 1V08A 3JVAA 3V1HA 1C92A 3CYJA 1V3IA 3WLHA 1LM1A 1VBRA 5H8MA 1IZCA 1PIFA 1C90A 3H55A 4O17A 1ZNNA 4O53A 5LYRA 2PDCA 3LTPA 1M53A 4A3UA 1F6PA 1LP6A 1IWAA 3PFRA 4AC7C 5D9MA 3NO1A 1J2BA 1EGMA 4IOTA 2XISA 1G4TA 3IK4A 5ABEA 4LH8A 3PF3A 4HNCA 1FCQA 2C16A 1H5YA 1SR9A 3GNOA 4JTEA 1GOQA 3AYVA 3VDCA 3FSTA 2X0SA 2DZVA 3ZSSA 1E9YB 1DBTA 3U7BA 1E3XA 3OGVA 2VC7A 3N9KA 3W3OA 3LPOA 2DU2A 3ENLA 1E73M 1DP0A 3MUXA 3FGCA 3ITOA 3GZ3A 1V0NA 3RLHA 2Y8KA 3AIQA 2Z28A 2NX3A 1C91A 4NXKA 5BYWA 4IX0A 3AFBA 4AD5A 5F2MA 4AWTA 4H8UA 3W2MA 1XIHA 3TR2A 4AZIA 4DJEA 3NL3A 3GB6A 2OGYA 4DELA 3H6OA 2IPJA 3R12A 1KB3A 2J77A 3A6OA 1R2RA 2GGIA 4TX9A 3N6JA 3T4WA 4AX7A 4B4FA 2Y7FA 5FJPA 1EA0A 1TELA 1GPFA 2ZXAA 1FXPA 3TP4A 4Z2LA 4H01A 4U3AA 4FB7A 2P3ZA 4YTUA 4LB3A 4PB5A 3REQA 3UPBA 3IWPA 5LA1A 3TX9A 2V5BA 2ZFAA 1WNOA 2ZXDA 1ALDA 1VPXA 4Q4MA 1CLKA 2QPUA 3THUA 3JU2A 3PG8A 1A5NC 1XH2A 3PWIA 2XSXA 3EDEA 1S46A 2ZA3A 2B7NA 3ZR5A 3NZRA 1HGYA 3EWXA 2PB1A 4IPJA 1RVGA 1O5QA 3GG0A 2EEXA 3VM5A 2HK1A 4E4UA 2LLEA 3T4CA 3TTQA 1R86A 3T42A 1EB3A 4GZIA 2XFWA 2VD8A 3W0KA 5FL1A 3C0JA 5ABFA 3R8RA 4EXAA 2BLEA 3BG9A 3URAA 1NQ6A 2AKMA 3MW7A 4ACZA 2INZA 4DJED 1F61A 5G2IA 2XZ9A 1IEXA 4GI8A 1MVYA 5E9XA 1HT6A 2C6QA 3LCHA 1I2RA 4AB4A 4EXQA 1GTEA 4GKTA 3WO8A 2EKGA 1EUAA 5A6KA 2OEKA 1F3XA 4GIRA 4JIPA 3SY1A 2A3HA 3LCWA 1YTDA 3G1HA 1EJ7L 1RJPA 2CLKA 5E70A 4LBRA 5EB8A 3OIXA 1NP2A 2QJGA 4F0KA 4I9AA 5A2AA 1JCNA 4PZVA 3SCQA 3B9EA 3KOWA 1UWQA 4H7VA 4AZCA 1KM4A 3SRFA 3WMCA 3W71A 2XIJA 3SSZA 2E6DA 2PBGA 3H2AA 4LRSA 3KDNA 4JX4A 3AUOA 2EG7A 3HM7A 1XLJA 1Y0EA 4J3WA 1I4NA 4H04A 3LGGA 4Q4QA 1VYPX 1GKQA 1DXFA 2VGBA 4PMDA 3UERA 1ZSXA 2JEPA 2GZXA 3DKJA 3HPZA 1JDDA 3UNDA 1WOAA 1EPVA 3QQWA 4OECA 4D6CA 3B03A 4I6KA 3AXHA 4HYVA 3VO0A 1EIBA 4R27A 5H1WA 3VGEA 3B8DA 3AXXA 4N9CA 2GGJA 3TLLA 2P1FA 1I0DA 4NYYA 2BMBA 4I9MA 3WEZA 1KBKA 1RCQA 3VE7A 2XFRA 3KL0A 4DO7A 1H41A 5A8MA 1EX5A 2C8NA 4PBFA 1Q2RA 3W6MA 2FH8A 3TEVA 1O6IA 2I57A 1PYFA 3FYOA 4NYUA 1Q6OA 2D2OA 4XBSA 3VIHA 4AFYA 5AY7A 2Z24A 4MPKA 3EPNA 1I0BA 5AC5A 3WBEA 1J0HA 4ROQA 2YX0A 4XK2A 3ARVA 1FRBA 5A8QA 5KITA 4WK9A 3IJLA 1T8XA 1CYGA 4AZ5A 4JGDA 4M24A 5CBJA 3OJGA 4YS1A 3WF0A 4LTSA 3THCA 3GG8A 1OVDA 1V3HA 1XLGA 1HJVA 3AZTA 4I8YA 4HOZA 3I3BA 4BY3A 1XL9A 3GLCA 3CZKA 4Q3MA 4DBWA 5BZAA 5I3FA 3VD4A 4IMFA 3IIPA 3CNYA 2CKSA 3QC3A 4NJGA 1UJQA 1QPOA 5BOOA 1VJZA 3CO4A 3SRDA 3UXDA 5FKYA 4M6VA 5KINA 2WMIA 4L64A 1JEZA 4O1FA 5EKYA 2WZMA 1CGTA 4LAKA 2Y5EA 4P61A 4C6KA 3AXKA 4BI5A 2PDGA 3WD2A 3NNTA 3SI9A 2E67A 2YXOA 3M1ZA 4MJZA 1EZWA 1O12A 1PDZA 3CAVA 5AHIA 1UIPA 3NG3A 4MY9A 1LT8A 3QGVA 3TA9A 4AWSA 2NLIA 4F4RA 1PKLA 3O6AA 4JFWA 1JUKA 4PUMA 3HA1A 4J3XA 1S5MA 3W1UA 2Z00A 2X7VA 1K6WA 4RX0A 2WMFA 2GYIA 2P0OA 1EP1A 5JXQA 1D8WA 2J9XA 2CBJA 4X3ZA 3E2VA 4NUWA 1YXCA 4UFHA 2DSZA 4QJ4B 1QK2A 1RZMA 3RF9A 3RN6A 5FEZA 2PP3A 1MW1A 2X0YA 2WXDM 2EGZA 2WQPA 3GDTA 3GDBA 4JAWA 4YIWA 2YW4A 3W74A 3VI2A 1YPXA 2WZTA 3GUWA 3OQEA 1EC7A 2GGHA 2BXYA 2Y85A 3TAKA 4FLQA 1W3KA 1P0NA 4I5XA 4S2CA 3GHTA 2VUYA 4UZUA 1J0KA 4J3UA 3HGOA 4HD5A 3CLWA 5I3HA 4CNOA 4BI6A 2GL5A 1GVFA 1LCOA 1CXKA 2NUXA 4ZO9A 1DIKA 3TU9A 1TWZA 5DT5A 3NTYA 4TVDA 1SFJA 3W7OA 2ZYFA 1XG4A 1UR3M 1J0JA 2VXNA 3BCJA 3H2FA 2ZUNA 4D72A 4H4IA 4EAMA 1TTJA 5CG0A 2J13A 2XGBA 3RXZA 5I7GA 2D73A 3H22A 1J12A 4XD6A 2NZLA 3W7PA 1LROA 2WJEA 4J4KA 4XD3A 1JUEA 3W1NA 1JDEA 3G6LA 4Z0JA 3TXVA 1DIDA 2NUYA 1RA0A 2PTXA 2GPTA 4A8IA 3PZ9A 2Y62A 1RPKA 2CZDA 3MO4A 1H1ZA 4EE9A 3S46A 2PDXA 4LV4A 4DWSB 1O1HA 2PDQA 4WCJA 1TWIA 4OU1A 5SWUA 1L2QA 5LNRA 1KCKA 5B7ZA 3HV8A 2W9MA 2Y7DA 2Y7GA 5HXMA 4Q7BA 1KKOA 1RCOB 1XLBA 5EGRA 3W2UA 1HP4A 4BQ3A 2CHRA 1TPC1 4JQ2A 1SJBA 3FV9A 1EJWC 3KAOA 4UQDA 4U4MA 4JY8A 1MEHA 2FMOA 4NQ1A 2ZZ2A 1EWEA 1Z44A 1KRBC 1PKNA 3S2CA 3EB2A 3W28A 2VHLA 4UCFA 4AF0B 4JTGA 2IXUA 2QIWA 3CV7A 4TTUA 1RP9A 5K4ZA 3GU9A 1E56A 4RUBA 3L7RA 3I3DA 2WNZA 3QHMA 3AIBA 3DFTA 4J3SA 1WUFA 3F4VA 3BV7A 4HZ6A 3H53A 3KX6A 1Z7AA 4O16A 4S3FA 3CUGA 3W29A 1A50A 2GDVA 5ECVA 1HJSA 4LVDA 4FI4A 1EO5A 3L66A 2PZNA 2JALA 1CZ1A 1H49A 2FMNA 4G6CA 5DY3A 1ECQA 1FOBA 5L6UA 1J0ZA 1IE7C 1ZPTA 2ANUA 4HHHA 1XBVA 2YOCA 4HA4A 5AHEA 1XLIA 5C9ZA 1FWJC 2YCLB 3A21A 5EMJA 1DVJA 1U5VA 4CNPA 3UXAA 4C7DA 2A0NA 1HL9A 2XZ7A 1KBIA 2YYTA 2ISFA 3CMFA 4POCA 1YQ2A 1A5SA 1IIHA 1PWMA 1E0XA 2R14A 4MWAA 2D0HA 3RITA 1MDLA 5D8WA 1M6JA 1XRSA 4V15A 3PTDA 1VF8A 2XHYA 3WZ0E 5C5YA 1J8VA 2NQZA 3VXGA 1HJUA 4AY1A 4TIMA 4FIRA 3ZWSA 4IIEA 4REQA 3AWNA 1W3IA 3WQFA 3LHVA 4Z1CA 2WVUA 4KF1A 1TE1A 4FPSA 1EC9A 3LNPA 4LS0A 4LUIA 4MNMA 1A5OC 1E4MM 4HSNA 1SM9A 4PMNA 2X1RA 3NUKA 1GYMA 3ITVA 4XISA 5A2BA 1QCWA 2A2IA 1V6WA 3FLUA 3EWZA 3GIYA 4GPNA 4Q8WA 4XKYB 3WNPA 3KS5A 1N8IA 1QPRA 4MIMA 4J1OA 4XG1A 3EDFA 4MAZA 5AHFA 4WQ6A 1OINA 2ZKMX 2FHCA 2D22A 1IXOA 1I1WA 1ZZMA 3QYSA 1VCVA 3GKFA 1MFVA 1JPDX 3VIJA 4HPGA 4TX8A 1AL7A 1BAGA 5M2FX 3GXDA 3BO9A 4GRSA 3M7SA 1SZEA 1TUFA 2BHZA 3W7QA 3BQ5A 3S47A 1E6PA 3WLRA 1UC4A 1YRRA 1ZAJA 2YDQA 4HPHA 5I5RA 1VRDA 4R88A 1CGWA 3M43A 3TYBA 1EDQA 1TJ0A 1TO3A 1XDMA 3DERA 2R8WA 4URIA 3V16A 4DPQA 3CEUA 4KGLA 2FZMA 2VQUA 3VAVA 1IEVA 4JYEA 1LDCA 2XWDA 1M7PA 4HU0A 4F66A 4NZFA 1V3LA 3VCCA 3OBKA 1G7UA 2XVLA 5AZ1A 3UW6A 4GNJA 4PH6A 2J25A 3S9IA 3S1XA 3IVSA 2UY3A 1TTQA 4NY2A 3ABZA 2NQHA 1H4PA 1YHTA 5IOBA 1TA3B 3P2VA 3VOGA 1Y65A 5IFTA 4AU0A 1Q7QA 1RK6A 3BGAA 4CNSA 5IHRA 4CQDA 2QVNA 4NAEA 4W87A 2H8XA 3ZLHA 1AUSL 3E9AA 3EWYA 3QR1A 3PUEA 3ZLFA 1TPB1 1X1NA 5T9BG 5DBTA 4QS6A 1K8CA 4EWJA 3R2GA 4RDYA 1GQIA 1QATA 3CUJA 1K9DA 4L6OA 2J7CA 2JIWA 3PHAA 2GGEA 2AAAA 4Y96A 2P10A 4XUGA 3CWOX 5FJOA 1EHAA 4ML4A 3QQ0A 4GUFA 4DWSD 2BGNE 1C8QA 1KKRA 2D0GA 2XGIA 3BLIA 2I5GA 1PAMA 3P82A 1VFOA 1ZUAX 2IS7A 1A0DA 4FNQA 2CLMA 2OWCA 1Q85A 1EOKA 2XFYA 1US3A 3PUOA 3TWBA 3RK8A 2D3NA 1E51A 1ESWA 3B9OA 4S3JA 4KWVA 4EF9A 3MCOA 1KM0A 5CGTA 3PPHA 1B3ZA 4HCDA 1OK6A 1FWDC 5AYXA 2OWWA 5AHMA 4WY0A 1B4EA 1EYEA 2OTDA 4OFCA 3EOSA 2BBFA 3ZYZA 5DY2A 1H50A 3MC5A 1UQZA 1MW2A 4GQRA 5HDRA 3W85A 4L80A 3WQ4A 2J75A 4PTVA 1A5LC 3WENA 4QLJA 3WH5A 4TVCA 1QOPA 2ZUUA 3WDHA 1C29A 1UWSA 3ICJA 3EOUA 3TYUA 2J6VA 3FN9A 2J7FA 1WE5A 1FY6A 3QTPA 1XYFA 1UR9A 3VDGA 3ARQA 3W84A 3RJYA 1OCQA 2IPFA 4QQ3A 1XXXA 4DBDA 2ZZ4A 4RJEA 3O63A 1US2A 1NOFA 4UR7A 3R79A 4NAFB 4GCXA 3WG6A 5HR6A 1NOUA 1ZS2A 3V1PA 2OCZA 1G9HA 1VCFA 2C7FA 3EPOA 1YDNA 2VRJA 2Z1BA 3PULA 4GNVA 4PUEA 4JTRA 4IFKA 3WUEA 1A4LA 3GRIA 3AROA 2OT1A 2EPNA 4NZ1A 3WYZA 1X8CA 5BXRA 3LCFA 5EBAA 4UCGA 2I9EA 4QAWA 4S3AA 4WUIA 4E3VA 3PJUA 3VNYA 5C0QA 5T91A 1JZ2A 1QNQA 2GVLA 1VFSA 4IQDA 4OJYA 3ERPA 2J66A 3WNLA 3UWZA 3SRKA 1GHSA 3WF1A 3NVDA 3F2CA 2JQXA 4L9ZA 4HN8A 3MKCA 1W2VA 4O13A 3KOXA 4NXSA 2WW5A 1D8CA 3M7WA 4GUHA 3UR2A 1CENA 1AH0A 1D9EA 1PV8A 4HCLA 4JIRA 1QWGA 4LC6A 5LA0A 3TC7A 1UH3A 1TQXA 4BEQA 3K1GA 3UBPC 3LHWA 2I16A 3T78A 4XAFA 3EA2A 2DUZA 3ZQ9A 3KL5A 3AMLA 3QKEA 2Q09A 4HK6A 1TREA 1PEZA 1XGEA 4RZ4A 1CDGA 1X1ZA 2VFEA 3HG3A 3URBA 4F2UA 3QR0A 1GVEA 3MHUA 3F2BA 3EKLA 4MJMA 3ZR6A 1AW1A 3RGTA 4FNSA 2YB4A 2H8ZA 3I68A 4UR9A 3VCNA 1C7SA 1J5SA 3CAWA 4HU3A 4ZB2A 4HNUA 3FKRA 4ACYA 1POKA 2G3IA 2JGQA 4PCPA 1HKWA 3UETA 4W89A 1VYRA 4PMUA 1RY8A 5CPQA 2XVPA 1W9VA 3O7UA 4GI6A 4KKXA 4HNVA 2FHFA 3W81A 2DORA 3GIPA 3WH8A 2MUCA 4DO4A 3BAKA 3W1AA 3SGZA 3VD9A 4JTCA 4K38A 2RDTA 4AX6A 3KRZA 3P0XA 3SUWA 3C61A 3VMNA 1P1XA 2UWFA 1EX1A 1VBJA 3ARXA 5CC5A 4TU1A 1LG2A 5EL1A 1VBGA 3A22A 4DF1A 4LEQA 1BKSA 4ICNA 2WOQA 3SJ3A 3WDIA 5I79A 2CWXA 3H54A 5DF0A 4F40A 1UWUA 2VZSA 3R10A 2O55A 2E5DA 4E5TA 4C6BA 1BD0A 3BGJA 3MYOA 3BTNA 4HZ8A 3M0VA 4GYPA 1HKKA 3T0TA 3E0LA 3VNZA 3TA6A 4WVXA 4CEXC 3V0UA 2VP8A 3U6WA 1XRFA 4ZFCA 3RPDA 4Z1YA 3HTWA 2O9PA 4BF5A 1D7FA 3N3MA 5A6AA 1X38A 2Z29A 1E72M 5DMNA 5EMMA 1DIOA 2FJUB 3MUAA 3OG2A 1JZ4A 3WJXA 2Z26A 1PUDA 4QHRA 3RO8A 3LZ3A 1WKEA 5I3KA 4QDWA 4D6DA 1JCXA 3CPGA 5B80A 4ORMA 4I5UA 5GNZA 5JH1A 1GONA 1KGWA 1VH7A 4XO7A 3ZIZA 4DBSA 3L5AA 2ZIDA 1I2OA 2PODA 3T9PA 3FJNA 4HMNA 2VDIA 1PCWA 3W2LA 3MVTA 1RAKA 1IEQA 1KFCA 2MNRA 2CIPA 1N55A 4O11A 4HOWA 4QCEA 2YL8A 2BV9A 1Z3NA 3CASA 2XSAA 5D04C 1UP2A 2HPIA 2CLFA 4PCSA 3VU2A 3AICA 4LALA 3PBUA 3MVIA 4M7TA 2OQYA 4MDOA 4UQCA 5A8PA 1ZJIA 1KRMA 3SGUA 3A47A 1DOSA 1BTCA 4XIAA 2PDPA 3RG6A 2QMJA 4S23A 4IM4A 2GWNA 1XDLA 4RW3A 4ZOAA 4Q8QA 1L6WA 1IR1A 1UZHA 3QXBA 1E0VA 1XCXA 4DXXA 4Z1AA 3AIRA 1R2SA 3PPFA 1BYAA 4R33A 1UYQA 1W1PA 3PZMA 3PZOA 2Y6ZA 1UUOA 5GNYA 4FX6M 3N3TA 1JCMP 2YIHA 4TV5A 3HG2A 3KBWA 1KCZA 4NX5A 4AMCA 3A9BA 3TTOA 2V38A 3N14A 5I6SA 3DFPA 4X0NA 4FF5A 3SN1A 4IL2A 2WKGA 4ONVA 1ZBCA 2QUUA 1UHVA 1J0IA 3CQJA 1EKOA 4HA3A 1XLCA 1XFCA 3TTSA 1EXBA 4NJIA 2OKTA 2AL2A 1TJPA 1UD2A 5DMLA 4CD6A 5HMFA 4EXBA 2W61A 1VPYA 3OOQA 1OFDA 1B31A 2ATMA 4G9PA 4CEUC 1AA1B 4N6FA 3SCTA 3E49A 4DXKA 3T0CA 2QR6A 2RH9A 4H8NA 1FCVA 1E71M 1E5NA 3PZGA 4PMJA 2A7NA 4DNMA 4MGGA 1RV8A 2HVOA 3GM8A 3EOOA 3PBVA 2PDYA 2AAMA 4ZOEA 1GZ1A 5CJMA 3W87A 2ONEA 3A5VA 4JDBA 1UBPC 4LY8A 4HTYA 2E4TA 3CUHA 1SJDA 4M6QA 3FDKA 2O92A 4ORIA 5FACA 2BTMA 5BRBA 5C71A 3O6CA 4I7WA 4K36A 3IV8A 3USBA 4KFOA 1IEIA 1RVKA 3W1PA 3NQAA 4IJBA 1RPXA 4KCUA 3P93A 1U1HA 4HA0A 4LUSA 2DW6A 4UTMA 1IR2A 2BOGX 1WZAA 2PWEA 4GVIA 1J5TA 1JZ5A 3VIMA 4UTWA 1Q3NA 2D1ZA 2AGTA 2TPSA 1YNQA 4LOCA 4I9JA 4CCEA 1PZ3A 5BXSA 1JYXA 2CBIA 1LORA 2WVVA 3E2QA 2WLYA 2CERA 3WBWA 2Q02A 2ICSA 2ZQ0A 4JTQA 3MO7A 4GQ0A 3EKGA 3WMSA 5BWFA 4W85A 3LOTA 3QBUA 5BXTA 3WUFA 3BLOA 5MF5A 1AODA 3KBSA 3I6TA 1Y8BA 4XTDA 1KGUA 3BPWA 4DJDA 1CGVA 8CGTA 1IQ8A 1HO1A 2B31A 2NQLA 5TF0A 2EPLX 3FEQA 3S9ZA 3CS2A 5GVJA 3H21A 3TTYA 4Y8FA 4CD5A 4HVXA 4O8AA 2QCFA 3B4YA 4LGXA 1RA5A 3GUGA 3GNNA 4AY8A 3SM0A 5F7UA 1OEPA 3EKZA 4J3VA 3SCNA 2RJHA 4GXWA 4Q4SA 4FX8A 1CLVA 4DO6A 1IHIA 1R3SA 1UKSA 4PTMA 2PU1A 3L67A 1ZRQA 4XZLX 1ISXA 4U2YA 1PX3A 4C5ZA 1UR8A 4H7ZA 3KS6A 4B15A 4LUTA 4OWGA 3IJDA 1UD4A 1ICPA 3AQUA 4QITA 5CSRA 1UD8A 2QEZA 1UH4A 3VMOA 5ABHA 3PUDA 3KVMA 4BR1A 4K6AA 4TO8A 3SCUA 4S3EA 1R3YA 3UD6A 3MTWA 6ALDA 3GE7A 3MBDA 1MXSA 1QPNA 3DFHA 3KVJA 4EF8A 3OLIA 1W9DM 2ZA2A 3CGTA 4C6DA 4C65A 4LX4A 4MZ8A 3BG5A 4AMAA 4IXXA 3QLLA 4R3UA 3FAWA 2J8GA 4OE7A 2R1KA 3V4BA 4UNLA 2BNJA 3H12A 3PTQA 3GQYA 4AVNA 2POTA 3QV9A 4JR5A 4KCWA 1VJSA 1JDFA 1XIFA 5REQA 1QNPA 1BVWA 2QV4A 5CLTA 2R1MA 3TOPA 3SN0A 3AALA 1DXIA 3N2MA 2Z1KA 3CWHA 3EEGA 5HNNA 4A6GA 3KP1A 2VFDA 3UJEA 3TQPA 5HUOA 3B8VA 2ADAA 1P0KA 4KQNA 4B5WA 1ITQA 3IIZA 5IDIA 3WBAA 2XN0A 4RV3A 2BASA 3K8MA 4NNAA 3UJRA 4WSHA 1OBAA 1KO0A 2A21A 1Y7VA 4GIYA 3MT1A 5I3GA 1X98A 2HXTA 1H2JA 3CMJA 4YJ5A 1XSKA 2JKPA 3HN3A 4Z17A 3DENA 3ZVIA 2YSWA 4U2ZA 4JQAA 1XD0A 3WF4A 2J7GA 2OXNA 5LKYA 4PR4A 3OA5A 1AJ2A 1O4UA 2FQIA 2ZXBA 4PTXA 4L1XA 3QF0A 1L6SA 4NVTA 3OLDA 4D6JA 2L5HA 4C6NA 3VC6A 1YTKA 2GJXA 5FJIA 3MHGA 4GVGA 3BXWA 3FOKA 2PRHA 1K1DA 4IG2A 5FOOA 1H09A 4DUXA 3IVTA 4QDMA 1KRAC 4XZIA 5I3DA 4AC1X 4ZO6A 1L2UA 2J24A 4EPEC 4M7SA 2DFAA 3PB0A 2TRSA 4RCXA 3ATZA 4XIMA 2QDEA 3TE9A 1SGJA 3QM3A 2VZVA 1GG1A 3N9RA 4KWOA 3O3RA 3MP3A 3WDQA 1BEUA 3B06A 4GK8A 3CHEA 2GUUA 5CC6A 3KRUA 4N4QA 3YPIA 4KT2A 1XWYA 4ICCX 3FW6A 1BGAA 2BY3A 2QCLA 1QO5A 1MXGA 1VPQA 1G4EA 4GYFA 4DPPA 2ESCA 5D02A 3PBWA 2R1LA 4Y9NA 1VHCA 2VZTA 5C55A 2WSPA 4XD4A 5D09A 1BG4A 1V51A 2BVYA 3PM6A 2I17A 1PKMA 5DRCA 5FAJA 1Q7ZA 1F3EA 3WFAA 2Y63A 4RNIA 4OZOA 2OSXA 1YDVA 4HJFA 4E2DA 1GWJA 5G2WA 3FEMA 3TJ4A 3VGHA 4OUIA 4QCFA 4ZB0A 3M16A 4B5VA 6TIMA 3ZFHA 1G94A 3MMTA 1FH7A 1JDAA 3I3EA 5TNVA 2HBVA 4F0HA 3L4ZA 4CQBA 2KZHA 1FXQA 4LNYA 4GCAA 2HVNA 5HPOA 1QWKA 4DUVA 3WH9A 4LS2A 4E0CA 2F38A 4PUWA 3TVAA 3IJ7A 4GQQA 3N2BA 2V69A 1JNDA 2YLAA 3XISA 3CQIA 5CC3A 4A8RA 3KHDA 3S42A 3B8IA 3LNMA 3CHVA 3EX3A 1KA9F 4XSLA 1U5HA 5FL0A 4D71A 2CHNA 3WJSA 1A5BA 1ZLPA 4XQ6A 1UP0A 3AHXA 5G5IA 2OOFA 4OOZA 1SZRA 2CLLA 5DQPA 2X1IA 4HK5A 2OR2A 4MLRA 5FAGA 2ZZ1A 3AMKA 3WQVA 4DZ5A 2W92A 1TCDA 2WZHA 4Q6XA 3UG4A 2WMKA 1EH9A 4ZQCA 2XSBA 1DJYA 4UTTC 2TSYA 4HMDA 1JGIA 5CGMA 1HFBA 3BW3A 1LF1A 4DWSC 1VFTA 4TOQA 4RE4A 1Q6EA 2Z1VA 4D2JA 1W3HA 1VFUA 3UPWA 4CNUA 3CLMA 4Q4RA 4IMGA 3JR2A 3VD5A 3T8QA 3WMBA 2ALRA 2OG9A 4ZBCA 3GR7A 2XJ7A 1FWCC 1YMYA 1FFQA 2BODX 4H19A 2WV8A 1GHRA 2PFHA 3H4XA 1ADDA 3PC0A 4XTIA 1XLAA 2C1HA 3S2JA 1J10A 4JN6A 3APYA 5EU9A 1P0DA 1M41A 3UGRA 3CQ0A 3P80A 5C7VA 2V67A 3MUIA 4YMZA 4EPDC 4JTKA 4DWDA 2C79A 1M01A 3PNUA 1UC5A 2ZUMA 2GJNA 5C9UA 2EJ1A 4B3LA 1R47A 4JTHA 1JYWA 1PKYA 3OVGA 1JRCA 1W3NA 3SZ8A 4C6PA 5HWJA 1OGGA 1PIGA 1QPKA 2DZTA 5E0KA 3DI0A 1TV2A 3DUGA 2GUBA 2IXVA 5I78A 1ONWA 7TIMA 3W23A 4GD0A 3B4UA 1EBGA 1ZP4A 4IXHA 5JIWA 3N29A 3URQA 1DJNA 2EG8A 4OGZA 1ML1A 1VBUA 2PA6A 1XBXA 4IGNA 3EX6A 4DBUA 3GVRA 2YXGA 4UZSA 1B30A 1G4PA 4KEZA 5HMSA 1EDTA 1NELA 4QJ5B 4AUBA 4P7OA 1K03A 5IDZA 4PMXA 4IQLA 3CV1A 4JYDA 3OLEA 1V7AA 3RCNA 1DHPA 4RW5A 2OJPA 3ANVA 2VCCA 1RBLA 3NFUA 7TAAA 3L21A 3BLDA 6ENLA 4PTNA 4XWUA 3ARUA 4EPBC 4ZQOA 5E09A 1CB7B 2J47A 1A80A 3QYQA 4PCTA 4UTJA 3F2DA 3S9YA 3LGEA 4XAZA 1S2WA 1QI0A 2XH7A 1U1JA 5HNTA 3DGRA 1HKMA 3N15A 5DLCA 4CQ9A 4F9DA 1GOOA 1TCMA 3IUHA 4DJFA 2YZ5A 1W1IE 2FZDA 3AUJA 3LYEA 4CNTA 3GVWA 1TPWA 3RX3A 1V0KA 2Y88A 3ZVHA 4C6FA 1KGXA 3MJMA 2PGWA 2VRKA 1YDOA 3HGSA 3GHSA 1FWHC 4QRNA 3PAOA 3HG5A 3LERA 5I03A 2Z1XA 1RQEA 2Q3OA 1FWBC 1J4EA 2Y8UA 3VIGA 1NVMA 5A6JA 4JFSA 4J3ZA 1OY0A 5AC7A 5C2CA 1OFEA 4A2RA 3PANA 3SCWA 4P8XA 4G8TA 4H9MA 3T0DA 2DZAA 1MO0A 3AIUA 3E2RA 5H91A 4XV0A 3GY1A 2VDHA 1LTDA 2RKXA 5KTLA 2XG9A 3NO3A 3LA4A 2B81A 1RQHA 3R25A 3NEHA 4XD5A 2RJGA 2E8ZA 3O05A 4AHOA 3O0KA 4QM1A 4JTSA 2ZX8A 3UVAA 3LSBA 5LIWX 1SW3A 1LWJA 1Q4NX 3LLFA 5AC6A 2DZUA 1H60A 2PDIA 5EPDA 3WK0A 1MXDA 1OQFA 2FPYA 2ZDRA 3GW0A 3QH2A 1G6CA 4C6MA 4PL1A 1G7VA 1MZRA 3IARA 3LTYA 4HGXA 3CPRA 4DAFA 2OEJA 4C6OA 3R43A 4ASTA 3L0KA 1ISWA 4WY0F 4D8LA 5C9XA 2DT3A 3R94A 1LBFA 2ZRXA 2DH2A 1Q13A 4O52A 4V1YA 3DECA 4UNIA 4JQ4A 1ONRA 4NIRA 3QC0A 1IXQA 2BHYA 4TX6A 2XM1A 5XINA 1ADOA 1G69A 5F4WA 3W75A 1JZ3A 1XYAA 1F6KA 2RDXA 3LN3A 3BANA 2Z6IA 2VZUA 5CEWA 3CT7A 5T26A 3VGGA 3U9IA 2VT0A 2WLZA 1H7PA 4ZOCA 3NSNA 3MUZ1 2NT1A 1SSDA 5C54A 3OTRA 3V18A 3DHDA 1OX6A 1QOQA 3KVLA 3E1F1 1NSJA 1X97A 4OOUA 1QI4A 1CXFA 1E70M 2PD9A 3AISA 3BG3A 5K9CA 3RM9A 2J8FA 3AXIA 3XIMA 1HQTA 3ZM8A 1X6UA 1XBZA 3QQ1A 4ATLA 1SO5A 1AVAA 4AH7A 1CXIA 2OGJA 1FCUA 4FR1A 2REQA 1LRTA 1B1YA 1VGAA 4GGBA 3V3WA 4IWWA 1MSSA 2WMGA 3I6RA 4UMBA 2GLKA 4NZCA 1EGVA 5CSYA 1WXYA 3S1WA 1XC4A 3WQ8A 1MWOA 3ITYA 3NZ1A 3DI1A 1UB3A 2V9DA 2Y8VA 4MG4A 2E09A 3WLMA 3HF3A 2OSWA 3K5XA 4X22A 2VX7A 3FHQA 4LVBA 1KM2A 3DN5A 4MY1A 7REQB 3DYOA 2PLJA 3N11A 1KTCA 2DV0A 3LDVA 4GZEA 3VTRA 2BB0A 5M03A 4MFDA 3RPTA 4XKMA 1V3MA 4DY1A 3OVPA 2XVKA 3T0BA 2CLEA 3L9CA 4MY8A 1CX9A 2A3CA 5LGXA 2UY2A 4DB7A 5KZEA 3T2QA 3KZPA 3TH6A 3OP2A 1SJCA 2YCJA 3EA3A 5A6TC 4GE8A 1WCGA 3LM7A 1R2TA 1YPIA 2HISA 1LBMA 2ZC1A 2FTPA 1GJPA 1PDYA 4WLCA 3DESA 2Y70A 3PJTA 1G5AA 3NO5A 2G96A 4X2PA 1A5UA 1DJWA 2CHOA 2BVWA 3WD0A 3GS6A 3FCPA 2C14A 2F2HA 1NU5A 2CNCA 3ELFA 4A3QA 2D2HA 5DT7A 3GTFA 4C60A 5LXEA 5C9WA 3KW3A 3WFLA 3NURA 4CU8A 1JULA 2E77A 1XISA 5CSSA 2E6AA 3VD3A 1OGBA 4DHGA 2HNHA 2PDNA 3C4UA 5G4WA 5IM51 1D3GA 1KXHA 2CLIA 2D2JA 3SY5A 4HPNA 4O54A 1OZQA 4HHLA 3E2SA 5A6BA 1CW2A 1F8IA 3KCOA 4DZHA 3A24A 3WX7A 1PVNA 1E0TA 3W25A 4LCSA 5E5CA 1S2TA 1R5YA 3C8FA 3CUIA 3STPA 1E9LA 1OX5A 5TD4A 1GOIA 5GQBA 2DVTA 3EDKA 4GQGA 2I5IA 3LQLA 2W3ZA 4MNKA 2Z7KA 4ZTYA 2IKHA 1BRLA 2R1NA