1S2UA

Crystal structure of the d58a phosphoenolpyruvate mutase mutant protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
290
structure length
290
Chain Sequence
b'VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
molecule tags Isomerase
total genus 110
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2uA00
1S2WA 4YNGA 1JDEA 1A5UA 1Z6KA 2HJPA 3QTGA 4FXFA 1E0TA 4KS0A 2VWTA 3QV9A 3SRFA 1PKNA 3QV6A 4IQEA 1IZCA 3MA8A 3G2GA 4QG9A 4KCTA 2QIWA 1UJQA 4L7ZA 2HWGA 1GGOA 1PYMA 3VAVA 1PKMA 4HYVA 4MG4A 3OYZA 1DIKA 2XDFA 3E5BA 3FA3A 4KCVA 3SRKA 4ROQA 1XG4A 2G50A 3U2ZA 3ME3A 4WJ8A 4B5SA 4TV6A 1F3XA 3SRDA 2L5HA 3N25A 4G1NA 1XG3A 3GR4A 4QGCA 4RPPA 1OY0A 2X0SA 3FA4A 3PP7A 3LYEA 4IMAA 1T5AA 1IGWA 2R82A 2VGIA 3EOEA 3HQPA 1F8MA 3T05A 3SRHA 4QG8A 2KX9A 1ZJHA 3EOLA 4L9ZA 3GG8A 2VWSA 3QLLA 3EZ4A 4LSBA 3GQYA 4TV5A 2HROA 1O66A 1F3WA 4DRSA 2BG5A 4B5VA 1OQFA 3I4EA 4YJ5A 3PUGA 4KCUA 3M0KA 4L80A 2DIKA 1S2TA 2WQDA 3OQ8A 3M0JA 1O68A 3T07A 1MUMA 5JVLA 3BJTA 3H6OA 1O5QA 4B5WA 1AQFA 2DUAA 5TAOA 4B5TA 4KRZA 2XZ7A 1E0UA 4MF4A 3OYXA 1M3UA 3E0VA 1DXFA 2V5KA 1SGJA 4FXJA 3R4IA 4HYWA 3HQOA 3QQWA 2OLSA 1VBGA 3E0WA 4KCWA 3T0TA 1PKLA 2HRWA 1PKYA 3HQNA 3EOOA 1A49A 3IS4A 1DQUA 2E28A 1VBHA 4B5UA 3P0XA 3BJFA 4L9YA 4IP7A 3B8IA 4B2DD 1U5HA 3LG3A 4IQDA 4JPGA 2VGFA 4B2DA 1S2UA 2VGGA 3KHDA 1A3XA 1DXEA 1A3WA 4B5XA 3QV7A 1F8IA 3KTXA 1U5VA 2ZE3A 1F61A 4QG6A 1M1BA 3QV8A 1ZLPA 2VGBA 1S2VA 1KC7A 1KBLA 2V5JA 3QZ6A 2XZ9A
chains in the Genus database with same CATH superfamily
3CQJA 1UKTA 1LZOA 4AD1A 1ADSA 3LBOA 2J88A 2NUXA 3MMWA 5E6ZA 4E2VA 5GNYA 1A80A 2ZFAA 1S5MA 7TIMA 1N8IA 4UTFA 3VGBA 4DXKA 1JNEA 4UQAA 4XKMA 4TVCA 1QRQA 2J6XA 4LY8A 4UFIA 2RKXA 1F3TA 3OHIA 1EJTC 2G5WA 1VHCA 4CUCA 1IT0A 1QFEA 4PR4A 4ERGA 3A4WA 2VXNA 3UR2A 3BANA 3T1GA 4MWAE 1MEIA 4GY1A 5LNSA 3SFWA 3W7RA 4XZNX 2DGAA 3MO7A 2Z1VA 1W9DM 1Q8JA 2X1SA 2YB4A 4ZTXA 3DOPA 3UW6A 3WK2A 5A6JA 1E6PA 3GIYA 4WCJA 4AQLA 4D8AA 3CWNA 3VOGA 3K1GA 1XLJA 1TA3A 2YSWA 3BCDA 3V1HA 4B5TA 3B3DA 4LB3A 1QWKA 1X7IA 1Q6EA 3R4IA 2GGGA 2QUNA 3EPOA 3ZJ6A 1O5KA 4QNEA 1CGUA 3WLHA 2VTFA 3BJFA 4MM1A 3AI0A 1FCVA 4IL0A 1JCYA 1B3WA 2XINA 3ABSA 2XH7A 4KWWA 3HGJA 2WW5A 4GIYA 4EXAA 1KXQA 4MKSA 3BG5A 2IKJA 3HG4A 4ERIA 1V4YA 4W8LA 4F0SA 1RPXA 1VFMA 3W85A 4JDYA 1W1PA 1XINA 5BRBA 4GKLA 4L9XA 1WV2A 4AVFA 3AYRA 3UWWA 5T8GA 4CEUC 1M01A 1QBAA 1OFEA 1PUDA 2QF7A 4RDWA 2XVPA 3PZMA 5CZSA 3MVIA 5CPNA 5CZKA 1XPYA 4LUIA 3UT0A 3LN3A 3C8FA 2NSOA 5JIPA 2NXIA 3I6EA 1MFUA 2I16A 1J0ZA 3PWIA 5F1UA 1MXGA 2P3ZA 2BOGX 3MBFA 3MW7A 2E4TA 1X96A 3EEGA 5I03A 1R7AA 3QLLA 1DJHA 5J5RA 3T08A 4QE5A 1UQYA 2C7FA 3RDKA 5H8PA 3I65A 5FOOA 4L80A 3FJLA 3PUOA 2XYLA 4P8XA 3CZKA 1TVNA 4MWAA 4Q8OA 4EVZA 3OEXA 4ML4A 4KH2A 1A5KC 4JIRA 3QGKC 5I3FA 4GX9A 5EMJA 1YPIA 2CZDA 4EIVA 3TW9A 4UFHA 2ALDA 2YW4A 3THDA 1JFXA 4UQBA 4KWSA 1GEHA 4WDXA 3LTYA 4RE3A 5I7GA 3P80A 1XSIA 4S3AA 4B5NA 3W86A 3EEZA 2V3DA 1EXPA 4AW7A 2YYTA 2CETA 3PFMA 1JNDA 1SO5A 1O4UA 1HL9A 2QV5A 2YXXA 2ZE3A 3QMTA 1M1BA 4XVEA 4PFMA 1CLVA 4LNCA 3C2YA 3ES8A 4H7ZA 3DHDA 1H3GA 2XZ9A 3A21A 5DXYA 3AUOA 3O1NA 4QJ1A 4UTWC 4TX8A 2PGEA 4GCXA 4O8RA 2WSPA 3NQBA 2ABAA 5JUVA 3NO3A 4CNPA 3WBYA 4PMVA 4GBUA 3LCGA 2CHNA 1UIPA 2HWGA 3U2EA 2AAMA 2PRLA 3TOYA 3WLJA 2PFHA 2R1PA 4Y9AA 5LHFA 1D3GA 2FGZA 3JRKA 5PTDA 4NF7A 2C3ZA 5BXRA 1H5VA 3EKZA 1TTPA 5GNZA 1QATA 4LANA 4DELA 4DO6A 3HG2A 7ODCA 3KL5A 3N2MA 2JALA 3C2RA 1XI3A 5HXMA 2Q09A 4UC5A 2NUYA 3R12A 3GTFA 1PX4A 2VO5A 4HHPA 5K9XA 3JZEA 1OGSA 3VGGA 4QTGA 3EOUA 4YPJA 1JI1A 1JZ6A 1MEHA 3BLKA 1X8CA 1DORA 3WDRA 3VDAA 3EB3A 1VENA 4XTIA 2PDLA 3OW1A 4AH7A 1W9VA 1QPOA 5FSDC 4IL2A 2J74A 4PZVA 2Q3RA 1HKKA 4RW5A 2PDMA 1HKJA 1DIDA 3BE7A 1K7XA 4QISA 4HSOA 3KS5A 1KXHA 1JEZA 2WVUA 3AU2A 3IJLA 3REQA 3NL6A 4KRTA 1AH4A 1TVPA 3OIHA 1NEYA 4H6EA 3NPVA 5CQ1A 1H51A 2CBJA 2P50A 4PTDA 4EACA 1SUXA 3FFSA 3UGVA 6A3HA 4AC7C 2OO6A 1TWWA 3S5ZA 3PY2A 1Q6GA 2NQ5A 2Q71A 2QCNA 3LMZA 2Y8KA 2WNZA 2WNWA 3QPYA 2ISVA 1TV8A 5EBAA 3TQ0A 1FBAA 4Q8VA 3QOKA 1V0LA 4IT1A 1XIBA 1JYVA 1DJZA 1F5ZA 3UZYA 4D6IA 3FGCB 1ZAIA 1FCQA 4FLSA 4DBEA 4UOQA 1ZRQA 3N25A 3LMYA 1P5BA 3IIPA 3C0SA 1UC5A 3VD4A 4H01A 4Q8UA 5F2GA 2HK1A 3LNMA 4H00A 4MY8A 1VYRA 1U30A 3W6LA 5T9CE 4M24A 3N19B 3T8LA 3UEQA 5BWAA 4ZCWA 2RGMA 3NQ8A 5A8GA 4HA3A 3NQ6A 3WFLA 3HM7A 3QRHA 2ACQA 3UR5A 2D22A 1JYNA 4U4MA 2W63A 3EX3A 3AOFA 1TWSA 3EWBX 4XAZA 1PZ2A 3DERA 4LB4A 1RY8A 3BMXA 5C7HA 3LX9A 3UP8A 5TQLA 1LRTA 2AQOA 3IJ7A 3K46A 3GXTA 4Z42C 3WL0A 4D6DA 1MYRA 3AMLA 1YLVA 4LVBA 2X2GA 3S1GA 2XIIA 4IPPA 4FNQA 1AQHA 2POZA 2VR5A 4M1BA 4ZE5A 2FH8A 4S3DA 4WGHA 4Z2JA 1EHAA 5G4WA 1W1TA 3E3HA 3C2EA 2AQVA 4QDWA 4DWSC 4HK7A 1WAUA 4IFRA 3G1HA 4S3CA 3VTRA 4ATWA 2I17A 3EPMA 1PV8A 3WH7A 2DIEA 4MIMA 5CG7A 1NELA 3GFXA 3AS0A 3T0DA 3DYPA 3FV9A 3GR4A 2Z24A 3LLFA 3UJFA 1H63A 1KFKA 4IPLA 2E5DA 4HCLA 3A23A 1DJIA 5CJMA 2EEXA 5LXXA 2QJJA 1KV5A 2XU2A 3IGHX 4DO7A 8RUCA 1VZWA 2NX3A 4PL2A 4HD5A 2OOGA 3SCNA 1IWPA 3CZEA 4ENLA 4XSLA 2CEQA 4JTIA 4H3DA 4HZ6A 2AGKA 3SQLA 4AU0A 3N11A 5LYRA 2FHFA 1GVIA 5CGMA 2H8ZA 3KVLA 4M51A 1OZQA 3QGAC 3SDOA 3N2OA 3NOEA 2V82A 1U33A 2Z0IA 1OG6A 3LXBA 1SMAA 4IG2B 1RCQA 2JK2A 4C6OA 2AL1A 4GFSA 4NRSA 5H6HA 2EG7A 2V5JA 3NL5A 4YNGA 1A5UA 3ITOA 3ITGA 3LRKA 4W5UA 2PDUA 2QHAA 3CPRA 2NVDA 1B31A 3F5KA 4IQEA 3WNNA 5REQA 1LBMA 3BLPX 2GDVA 1BWKA 4GKTA 4AY8A 4H9YA 3UWQA 5LGZA 1C9WA 1DJNA 3CJPA 1VH7A 2X8RA 1KB3A 3K8KA 3G0XA 5DBTA 1EZ2A 2J7BA 1F3XA 3STEA 3HFYA 3CL8A 3MSYA 1RAKA 5C2GA 4LCSA 2QMJA 2OLAA 3H7UA 2BNJA 2QDEA 2XFWA 1UKOA 1YTEA 4POCA 1QR7A 1V77A 3P8IA 3WQOA 3QLDA 3H7VA 2BODX 3AFBA 4RE2A 2WHMA 4ZR8A 3KOXA 3MO4A 1HO4A 4FLRA 4N6EA 4AIEA 1EC7A 1Y8BA 4V1XA 1W5PA 3WK0A 3P3BA 1MSSA 4DI8A 2PWGA 3N73A 3M46A 4S3BA 4U10A 2PCEA 1DTUA 2WZHA 3PZUA 2CZ5A 3AICA 2X1TA 3L67A 1RA5A 4RCXA 3HQ1A 5FL0A 4HQVA 2OQYA 2DUXA 3M0ZA 2YYUA 4IMEA 4IQDA 1I0DA 1A3XA 1FDYA 1V3HA 4QG6A 4PMZA 2VUYA 5C5YA 3LSCA 2VDGA 3V36A 4W7UA 4DJED 1KTBA 2X0YA 4E5TA 3MY9A 2C1IA 3TTYA 1KKOA 4GVIA 4GYPC 3VIHA 1IF2A 5CH9A 3TAKA 2VC9A 3G0UA 1WXYA 4AWSA 5KMYA 4GINA 1TUFA 2VX4A 4GZIA 3KOFA 3N17A 4FNSA 3LS9A 1ALDA 3NSNA 4TUFA 8XIMA 1EO5A 2AL2B 4ZQMA 3K8LA 3VC5A 1NJJA 3VGDA 3AIEA 3DEQA 1WE5A 4F2TA 1PO9A 4E2BA 5DMLA 4UFMA 4MNMA 3R8HA 2QJGA 1CI1A 2YBVA 1QPKA 1SO6A 1UG6A 2MUCA 2VC5A 3SEPA 5D30A 4GGHA 3NTYA 3RCMA 1DQXA 3ITLA 9CGTA 1SJBA 3L12A 3ABRA 3WH8A 4A8NA 2RUSA 2VWSA 1QCWA 1GQKA 3TN6A 1GOQA 3GQYA 3EWUA 3VDCA 2FTPA 3R0DA 4MB3A 3HGRA 2PSNA 3NQAA 2EJ1A 3GXMA 2BGQA 3GVVA 1UKSA 4MTVA 2QAFA 3EDFA 2VEPA 1W1VA 1NWRA 1ODZA 1LORA 3TWBA 5BXSA 4OBRA 4C6LA 3S3GA 4K3ZA 2GZXA 2QT3A 2FZ9A 2VMFA 4DBDA 4LS1A 4HNVA 4DX3A 4ZGYA 2E40A 1FWHC 2O9TA 3CL7A 4LQ1A 1CGVA 1HW6A 1EDTA 4NIRA 4WUIA 3D3FA 1PJ9A 3QY7A 4PEEA 1XLEA 1VHNA 4FXFA 3K5XA 1JUBA 3S2CA 3LUTA 3FVMA 2Q3OA 4Q4MA 2VRKA 3VIKA 3EDJA 2WLYA 1U22A 4JIHA 4X63A 3D6NA 2YDAA 1G9HA 3APTA 5BXPA 1O94A 4HHHA 3HBLA 3MT1A 3BWWA 3UESA 2PF8A 3LPPA 1KKRA 2FGBA 4N7QA 1TKKA 2ZUWA 4NXSA 2YCKX 4O52A 3ERPA 4TV6A 1W9BM 3TW6A 1F76A 5A2AA 3PUDA 3DCPA 1JDFA 3EOLA 1BHGA 4CNTA 3E49A 4QLKA 4KWUA 4R33A 3I6RA 3SCRA 3I6TA 3IRDA 4XZHA 2NWSA 4CQCA 4UTMA 4PMQA 1H09A 3P84A 4MF4A 3ALFA 3QPEA 1XBZA 3W75A 3WBEA 4JTDA 4LAOA 4BWLC 3LGEA 4HNOA 2WPBA 1CX9A 4F0RA 2QDHA 2YL9A 4GY7A 4PB3A 2G4FA 4MKNA 3DBNA 1TJPA 3A64A 4GQRA 3DKJA 2WKJA 2GWGA 3GU2A 4ICMA 3OU8A 3B8VA 2J66A 4J28A 3LZ5A 5FJPA 4K1WA 3FEMA 4FX7A 5A1AA 2Y70A 5C8BB 3VPLA 1RR2A 5EMKA 2YZRA 3HMCA 2ZVRA 1DE5A 4HMNA 2EG8A 1XSJA 1L6WA 1M65A 1E0WA 2A4AA 9XIAA 3VFLA 3ZVHB 3MCOA 2Y5EA 4S3EA 4C1NA 4O50A 4S3KA 1UD3A 2NV2A 1H1NA 4X2RA 2X41A 2GFTA 2ZZ5A 1XW8A 3SURA 1QI3A 2BY3A 2Z7GA 3WY1A 1ZBKA 4R3UA 4MYXA 3WLRA 5KITA 5D2XA 4BQ3A 1MEWA 1PDZA 4MZ8A 1E9IA 2V2CA 4BS0A 3TVAA 2AKMA 2QNEA 2UBPC 2G37A 3UA3A 1YTKA 2YCIX 4PUNA 2HVOA 1DJYA 3G6LA 3SGUA 4W7WA 3U6WA 2NZLA 5IOBA 4B92A 2FVKA 3VIJA 4I3GA 3QSRA 4N4PA 1B4EA 4GUFA 3VKBA 2GJPA 4H19A 4PUWA 4PODA 3ZS4A 3ZVIA 1TUXA 4UTJA 3ABQA 3IS4A 2BHZA 4HB7A 3N29A 3SIZA 3WO8A 1XBYA 4ATLA 1NARA 4AC1X 2UV8G 1PL9A 4M6QA 1B3XA 1EJSC 3RFAA 2VFDA 3PG9A 3CQ0A 2JE8A 2W3ZA 2V5CA 4MJ2A 3SY8A 1FRBA 1W1ZA 2QQ6A 3L5AA 2PD5A 3SBFA 3O2LA 3G1SA 3CEPA 5D2YA 1TIMA 1UPPA 2V5BA 1W91A 3AO0A 5D04C 2INFA 4DF1A 5LNUA 3AMDA 2WWDA 2VELA 1R6WA 3EX6A 4XO7A 1X8FA 1LG1A 1W5QA 4GRSA 3RR1A 3LHZA 3STCA 4LWWA 3GIPA 1LDCA 1DJGA 5GPRA 3FDKA 5C9ZA 4GOAA 2EPOA 1PDYA 2CZVA 3T09A 3LPFA 4IZGA 1OEPA 2Z26A 1REQA 1EJUC 1OQFA 1TYGA 1V79A 3B8WA 4D1JA 2XH2A 4HSNA 4NU7A 1Q4NX 1DWIM 4EWJA 4IX2A 1X6NA 3E0FA 1H62A 6PTDA 3BGAA 3T0BA 5RUBA 3NQ7A 3COTA 3GDKA 3WLLA 1P6WA 3RJXA 3SQMA 2GOKA 2GSEA 2WSYA 3GO2A 2QGYA 2DP3A 4DPQA 3FHQA 7PTDA 4GUHA 3GTXA 1ME7A 1KFCA 4HHLA 1L2UA 3CIVA 5AVHA 3H2FA 5AYYA 1P7TA 5TF0A 3RNDA 1ADDA 3TQPA 3AJXA 4PMRA 4OFCA 3W9ZA 1GTEA 3W73A 1XX1A 5I77A 2W6RA 4NHVA 6TIMA 2FZMA 3PPHA 3I7SA 3T42A 1B5TA 3CZ8A 3JS3A 3MSRA 1E5NA 5I3IA 5G2WA 1XPGA 4G6CA 2ZUMA 1R87A 2A79A 3FA3A 4RPQA 1GW1A 2OMAA 5I00A 5DF0A 3WDQA 4FNTA 2VX5A 1XYMA 5CEWA 2C8NA 5F2MA 4XZIA 2J7GA 3MZ2A 2AQWA 2C0AA 5E93A 2C14A 3G24A 5DMMA 3W01A 4HOWA 3VDGA 4BA0A 2ZX5A 1ODUA 1RQHA 3NQGA 2BV9A 1OFRA 3W6MA 2I5QA 3B9OA 3AALA 3DZ1A 3CHVA 2GVJA 3SCPA 4PTVA 3PS7A 4C6MA 3NUKA 1VKFA 1NOFA 2NX9A 4M6UA 1A0DA 1UMYA 4JTKA 5HNTA 2Z1XA 3O6YX 3S5SA 1FWJC 2QPSA 1GVQA 5E0FA 3AJ7A 3AIBA 3EA1A 1IXPA 4EOUA 3TYZA 1FWRA 4LC6A 1EBHA 1FKXA 5FSEC 1TA3B 3TFCA 2WZEA 4QLJA 4JQ2A 3UJEA 1XCWA 1BYBA 2WCSA 2P88A 3DHUA 2QVNA 1E4NA 1V7YA 4ZQRA 3WEOA 3TE9A 1F9CA 2ZUSA 3C0LA 3NG3A 2B4GA 3VOFA 2BXYA 4GXWA 4EF8A 3O6AA 1Q2RA 1RP9A 2P10A 1RK5A 4AEOA 3PJTA 4H7CA 3SADA 4O1EA 2FIQA 2DZPA 1ZHAA 3F1QA 5EU9A 5E6YA 1DJQA 1X1ZA 4Z1BA 3NXFA 2PDCA 1R47A 4H6QA 5A8NA 1XLCA 3T7VA 2ZRXA 2XIOA 4GX8A 1M7PA 4NL1A 4MAVA 2VZUA 2WNNA 2J8TA 4MWAC 1D8CA 4HCDA 1VFUA 2HROA 2AMXA 3M0HA 3UQNA 4UTTA 3WMSA 3A6OA 2P76A 1B0IA 3W2KA 2NV1A 3V1PA 2W79A 1AQFA 1W0MA 1OC5A 3MUAA 5DELA 3OGVA 4Q4QA 4LH8A 4DJDD 2WZIA 1S2AA 4EXQA 4WLCA 1JUEA 2QS8A 1PKYA 2IQDA 3RLHA 1DQUA 4O54A 2OG9A 3C3UA 1XLAA 3NO5A 4MWAB 2DZUA 4X0NA 3RAOA 5KSWA 4GG9A 4HNNA 5DANA 1FDZA 3PM6A 2ZXAA 3G77A 2JGQA 1OFQA 1OX6A 4NILA 4HU3A 4NP7A 4JR5A 5FJOA 3AXXA 4IQLA 5ABFA 3TR2A 5E9XA 1TPB1 5FF7A 1XLMA 4IP4A 3LI1A 2P8CA 3BLEA 4AVOA 2O4QA 4WJEA 4B15A 1MXSA 4RDVA 5K4XA 1JCMP 5BZAA 1VAHA 1F73A 3KTSA 1EEPA 1ECEA 2OKTA 4LEQA 2ZRVA 3GHUA 1WZMA 2CZFA 1PWMA 4IFOA 2Y7EA 1JDAA 3TJXA 3UR8A 1EF2A 3MQTA 1FHVA 4XZWA 3PUGA 3GH7A 3MDUA 4LAUA 3G8EA 4HZMA 4UWMA 4NJGA 1JI2A 4HA4A 1XIGA 3G5EA 3PJUA 4LUSA 3P67A 3M64A 4GZJA 1J2WA 4Y9OA 2JGYA 3OB8A 5A2CA 3SCTA 1WO2A 5H8UA 3R8RA 2X0HA 3SZ8A 2Y7FA 1TWIA 3E0WA 3BCJA 3W25A 3TYUA 3ZM8A 4A8IA 3STPA 3UY7A 2ZRUA 1QPRA 4MUZA 1O5XA 4O0ZA 5CBBA 1NDYA 3DYOA 1TMLA 4G8TA 2VURA 1KRMA 4OOZA 5HJXA 3DBPA 5HA7A 1JPHA 4N9EA 1TMHA 2E6AA 3TYBA 4L56A 3CYJA 3MP5A 1HTIA 4KS0A 3WLKX 3DFOA 3M43A 2VWTA 3U9IA 1PWLA 3TN4A 4CLMA 3G1AA 1RQEA 1WKDA 1T0OA 2XISA 2HISA 7REQA 4IX0A 2R9RA 3REQB 3CPGA 1PKMA 3B9NA 4RV3A 1QPNA 3LHUA 4UNIA 3WQFA 3I68A 2R24A 4V1YA 3W7LA 3W7PA 4PTWA 1K6AA 3N6JA 3NPUA 2EPMX 4NAEA 1OK4A 3T05A 2ZZ3A 4FLOA 2FH6A 3JZUA 4QM1A 2LLEA 2VDHA 2ATMA 2RJHA 1A5CA 4JXCA 2BWGA 1YDNA 4FPSA 1IWAA 2DZSA 1LWJA 1UUOA 3W29A 1EJWC 4FXJA 1RVKA 2Z2BA 3E0IA 1EWEA 3P82A 1JPDX 4NRRA 4OKDA 5FCZA 1DXIA 4ZVJA 3CQHA 4P5UA 1QW9A 3APYA 3L5MA 1GKPA 5I2UA 1E72M 3RPTA 4NAFB 3VNYA 1A4MA 3LHYA 3S5YA 1J93A 4ZODA 3W1XA 1W17A 5FA5A 4FK9A 4GD0A 4PUDA 1JULA 1JDEA 1E6RA 2C18A 3TIMA 5AKQA 1DPMA 3H2MA 4J27A 4S2CA 2Z29A 2EJAA 2W67A 3BLOA 4M6VA 3B0UX 4H2CA 1UP2A 3N6HA 1V93A 3WSUA 1M04A 5CG0A 1TELA 4A29A 2OQLA 2OX1A 3T2OA 5LIKX 1KD0A 1WZAA 1D7KA 4IMCA 4NJJA 5HQLA 1PIFA 3AZRA 3Q58A 4ZQPA 4PBEA 2CBUA 1EDQA 4F8XA 2PTDA 3NURA 1NY1A 2VVSA 5BNKA 2W66A 2DUZA 1AMYA 1F8MA 4D8LA 3EBVA 1FA2A 1ZBVA 2QJNA 3UG4A 3S8HA 2CU0A 5DBUA 3C0QA 3NDZA 1XS2A 3LQGA 1FXQA 1J12A 1W3KA 1G4EA 1U1HA 3D0CA 1OJXA 3BOFA 3HPAA 4YS1A 1FY6A 2NQZA 1KFJA 2C1HA 2GJLA 2IQ0A 5KINA 1AH3A 4AWEA 1ZNNA 1QXLA 4Y9PA 4NZCA 4QX4A 5FEWA 3BMVA 4E4FA 4NX5A 4MSSA 3PC0A 1TZ9A 4O15A 4N2YA 3MKVA 4DUOA 3AIQA 1AJ0A 4L65A 1OWQA 5DLCA 3KBNA 3SY5A 1Z8AA 1YNPA 4CD4A 1IR2A 2HK0A 2C1GA 5DRCA 4AIOA 2AOSA 1XXXA 4F2BA 5FF3A 4M3PA 3U5UA 2QCFA 1XWYA 2HNEA 4F66A 3UETA 1XYCA 3L65A 1ZTVA 2ZXDA 3T2QA 1ONWA 3P61A 1K70A 3GDTA 4O17A 4JKKA 3U4AA 3AU6A 4DIAA 4P61A 2OEKA 2YBTA 5C70A 3TK7A 5BMXA 3MDWA 4GIAA 1GZJA 2NXGA 2CLOA 3NSXA 4PMDA 4KMQA 3RO8A 4JY8A 3C5QA 1JUKA 1UR1A 4YTTA 1SZGA 1FOBA 1I2OA 3E6EA 1RV8A 4GGBA 4M5PA 1J0HA 4ZZ9A 2NLIA 3P14A 3ARPA 1LOSA 3HGOA 2KX9A 5REQB 3V18A 4Z17A 1AZ1A 1JQVA 4AVNA 4RXFA 3M7WA 1B57A 4XWUA 3GKAA 1HJSA 1VJZA 3GSMA 2CLPA 1RJQA 4NJKA 1XGEA 3LPGA 3URBA 3SJ3A 3PAOA 3WBWA 1LWIA 3WFZA 1JAEA 1FTXA 3S2NA 3TTSA 3ZR5A 4DM2A 4UQCA 1W1B1 3IWPA 1J11A 4GACA 1J5SA 4BFAA 1K8ZA 3GBEA 4MNKA 3FDGA 1UMLA 5FACA 1BG4A 4NI8A 2PDBA 4Y9MA 4S23A 1BLIA 3B8IA 4JDBA 1FVPA 4EF9A 1VF8A 3NOYA 3KHDA 1UWIA 4ICCX 1KLZA 5G2HA 6ALDA 4OUEA 3W7CA 5BXTA 4Q6JA 4QHRA 3O07A 2P5NA 4UQDA 5F7UA 3VO0A 3W1AA 4HZ8A 3W02A 5AC5A 4NJHA 4B3LA 1Y65A 3BSMA 4KCTA 1LG2A 1PE1A 1WDWA 3TQKA 5G4EA 1TJ1A 2NW0A 1K6WA 2NUWA 4OVXA 4MLRA 3GNDA 3PBMA 1K4GA 3WDPP 4FNRA 2ZWZA 2HEJA 3M0XA 3N9RA 4XO6A 1R3YA 4DLFA 2Y5SA 4F9DA 3G1YA 1EA0A 3GR7A 1UP3A 2VNCA 3MYOA 1I1XA 3UWVA 2IMRA 5D09A 1B30A 2FGLA 2J9ZA 1T40A 5JH2A 3ANYA 2OGYA 1V08A 1SW7A 4ZQCA 1UD6A 1QPQA 2DFAA 2WHJA 3PWAA 3PB2A 1HZYA 2ONEA 1PHWA 3BC9A 3HQOA 1S1RA 3WDIA 3WLOA 4ZFCA 4FA3A 2FTWA 1R3VA 3N9SA 3AYVA 3Q37A 4Q8TA 4H2HA 3QJAA 4WX2A 3ID7A 5HMFA 2Z1WA 3GVRA 2V3FA 2QVHA 6ENLA 1LQ2A 4V2XA 4RXGA 2GGJA 1WX0A 2ODOA 3YPIA 4EE9A 1E6NA 1GYNA 2WCAA 3QV9A 1WKYA 4I6VA 3NGFA 4MGGA 4W89A 1HKWA 3VAVA 2J9YA 4GXPA 4UOZA 3HA1A 4MB5A 4UFLA 3FAWA 1NOWA 5L6UA 1UR4A 3STGA 2NWRA 2DEPA 4HMEA 3WH5A 4QROA 1H61A 1FWWA 2ZZ1A 1BAGA 4DYJA 1OYAA 1V6XA 3K4WA 3GNPA 1LUCA 1QVBA 2WVTA 2IKIA 1GQNA 1ITQA 1ITCA 1UH2A 3P62A 1BKHA 3NPWA 4ZO8A 1KV8A 4Z1CA 1KGXA 1TG7A 4B5WA 1DHPA 4HNUA 1GOOA 1QO5A 5A95A 1SW3A 3CK5A 3EB4A 3WIJA 1J0YA 3EDEA 2BBFA 2XIBA 4JNMA 1WOBA 3W24A 4KFPA 3KCOA 1EJXC 4FR1A 1Z7AA 2PDXA 2G96A 4WK9A 3XIMA 1QBBA 4RE4A 5F2LA 2WB5A 2WOQA 3GH4A 1K7FA 3PHAA 3VK5A 6REQB 2VGBA 3VGEA 3PPFA 4K1GA 4WSKA 4LUTA 5FJUA 4PCPA 2GK1A 1U2YA 4HK6A 4Q4PA 4GJJA 1J18A 4B9ZA 5D9MA 5CBJA 4P7OA 3T55A 4K8GA 3ISIX 3C0JA 4H04A 3OA3A 4JTHA 3QYSA 1P0DA 3ME3A 1VPYA 4GPNA 2CESA 2IPJA 3AXKA 3WLMA 4CCCA 3Q67A 4Z2KA 2O0TA 3FN9A 1ZP4A 2BXZA 4DY1A 2WC7A 3W84A 1CTNA 3RILA 3TNOA 3F2CA 1QHPA 3FYYA 3W2JA 3WMCA 2XFFA 3BVJA 4IPIA 3D46A 4H8UA 1VIZA 4J5NA 1IE7C 3A5VA 3WG6A 1PIGA 3LCFA 4C1NB 3WJSA 1WOAA 3P81A 2JFEX 3N4EA 2VCCA 4F0LA 4JCLA 1GUVA 1SGJA 3R8GA 2FZNA 4C6IA 1GPWA 1FP8A 2CHRA 2E6FA 5DY3A 5T9BG 1FX6A 3QC0A 3U3HA 3L5LA 3ZJKA 5CC3A 4PB5A 2WLZA 5ENLA 3BAXA 4AD0A 4GH1A 4ILSA 4AHQA 1YXYA 4R34A 3GY1A 9RUBA 5F4WA 1UWAA 1F8IA 1KFLA 2FPYA 5IM51 2O7QA 4CNNA 3QZ6A 1RPKA 4AB4A 4LW7A 5A69A 4DHGA 1GYLA 2VFIA 3OPSA 3CU2A 4K68A 4KFOA 2OODA 1S1PA 1HJVA 1KBJA 1A3HA 1S5VA 3QV6A 1WP6A 1W3JA 5A6MA 4HMDA 1CXLA 1KCXA 3GS6A 5BROA 4HN8A 3A3WA 4F48A 4C5YA 2E3ZA 4ZA0A 4XK2A 3CTTA 4AD4A 2ZICA 4YYFA 3BL3A 2X40A 1KNWA 1XG3A 4E8CA 5DMYA 2GGEA 1LM1A 1LWHA 1TPWA 1ZB5A 3MHGA 2PGRA 2NQLA 3WQ6A 1T8QA 1V6WA 1SZEA 3AIWA 3ITXA 4LRTA 1VIWA 4AYSA 3IGXA 3WNKA 5BW6A 2AGTA 4LUJA 2ADAA 2E5BA 1A4LA 1MUCA 1DWAM 1QNPA 1Q7MA 1N2VA 2QXWA 2ISFA 5CXPA 3W1RA 3SCWA 3F2DA 1EC9A 1VFTA 3V0SA 3SUUA 3V4BA 1REQB 4MDOA 3E2SA 4IGSA 3N04A 3CAWA 2OWXA 1F4AA 4PMOA 3EMCA 3VCRA 1OINA 1L9WA 1C8XA 5FD0A 2ZCGA 3UWUA 1ZUAX 1S2WA 4DO4A 1K9EA 1SZNA 3P93A 3UXKA 1ZL1A 4MB1A 4YCOA 1TTIA 1RP8A 1RLDA 2WXDM 2GGHA 4UCGA 3VKJA 1H5YA 2WKLA 2RDTA 2C19A 3QHOA 2XDFA 3ECQA 4US6A 4PC8A 3FIGA 4IGHA 3BW4A 2G50A 4DJDC 2JKPA 4V28A 2VCAA 2D2OA 1IYXA 1H4PA 2BY0A 4P8WA 2Y5JA 4G1NA 2VZOA 1Y7VA 2OWWA 3KRZA 3DG7A 3CUGA 4W93A 5CSRA 2UY5A 1XD1A 3IV3A 1PXGA 2GUBA 2CLKA 5FEZA 4DI9A 1QK0A 1Q6RA 4P7QA 1VPXA 4UMBA 5AHFA 2ZA1A 2OT1A 5TAOA 3OODA 2PDJA 1JD7A 1YPXA 3OYXA 3OP2A 2D0HA 2V5KA 3LI0A 3RHGA 4YIWA 3SN0A 3EWDA 4O1BA 4OGZA 4Z1YA 4AZIA 2E25A 2P1FA 1TJRA 3UBPC 1J2BA 3W7JA 4C6DA 4MY1A 4OOUA 1SVDA 3GLCA 3FKRA 1PCKA 1TVLA 3LRLA 1LLZA 4XQ6A 3N2TA 3BLLA 4QP0A 4AY1A 4U2ZA 4CNOA 5HDRA 1BVZA 2GWNA 3TKFA 3UNTA 3OG3A 1Z41A 2OEMA 5IBXC 1VS1A 1LCOA 3S9YA 2PI6A 1W2VA 1KXVA 4CGTA 4JBRA 4BQ5A 4JTJA 3QGVA 3UVAA 3RR4A 2E6DA 4WDTA 2Z25A 3O16A 3UD6A 3CL6A 3ES7A 3FNDA 3HPXA 4A35A 3GG1A 2YL6A 3N9KA 2R82A 3EOEA 1P48A 4G5DA 4XISA 4LSBA 5LGXA 4O28A 1BRLA 3QHMA 3W7KA 4B5VA 1W3LA 4URIA 3IIOA 3MI2A 4TTUA 1OC6A 4QS6A 1TCMA 1GOMA 3AS2A 2G4JA 2PS2A 3MMTA 2OU4A 3GZAA 5E0CA 4IUOA 1GVEA 1XIFA 1VBRA 1ONXA 3UZWA 3R89A 3WELA 4G7EB 1B9ZA 4HU0A 4N9CA 3VNKA 3GHSA 3BAWA 1E3XA 1KCLA 4LVDA 2DSKA 3SW6A 2WNQA 1UD8A 4LC8A 2FPVA 3QM3A 4LTSA 4AXKA 2RH9A 3TYEA 5LSMA 1MW3A 3W1TA 3MI3A 3A13A 3S83A 4OBSA 3BZGA 4H6KA 2TODA 2F8QA 1JZ7A 3TC3A 7TAAA 4W9TA 2QIWA 4L7ZA 1IEIA 3W27A 5AZ0A 3A4XA 4DF0A 1OFBA 3LLDA 4U5IA 4WKFA 3LDVA 4BR1A 3U2OA 1QAPA 2OEJA 1IQ8A 3EX4A 1QDSA 3AIRA 2HPIA 5LIWX 4X9YA 1SSGA 3LPOA 4JICA 4C5ZA 4AX6A 3OZOA 1VGAA 1VQTA 1WUFA 2O4MA 4YTRA 3IK4A 4NZ4A 3HO8A 5ABFB 1G7VA 2XVKA 2ISWA 2YX0A 1TPH1 3CAQA 4DJFD 3CLMA 4P8UA 1E51A 4L4PA 1AQ0A 3GTIA 1KM2A 1W1A1 4YMZA 2OX4A 4UTLA 3DU0A 1EPVA 2EHHA 3ANVA 3WEZA 5KZ6A 3WF2A 1RCOB 3PB0A 3APGA 1JF6A 4GQQA 1ICSA 1ZCCA 1L6SA 3KRUA 5EMUA 3ZJ8A 2ZADA 1Q13A 3QSTA 1YXCA 5EB8A 4G2DA 4LUSB 4LAKA 4MJZA 3TCSA 4Y96A 4XAGA 2YBUA 1TSIA 4QJ5B 1YBQA 3BCFA 1MDLA 2C13A 4BI5A 3FCPA 1ADOA 4RZBA 2QUVA 3CO4A 1VYSX 4RZ6A 1US0A 4I8DA 2CWNA 2BMBA 2V2DA 1T6MA 3M0LA 4ONVA 1ZZMA 8A3HA 5C71A 2OTDA 4C1KA 5B7ZA 3OVPA 3A9IA 3HTWA 1W8SA 2PDHA 3URNA 1RJRA 4RKAA 4L4MA 2CC0A 3GNOA 3ITYA 4LBRA 2ZTJA 5I0DA 3VOJA 1DQWA 4G56A 1LQ0A 3L68A 4QG8A 3LA4A 1QI4A 2DSWA 3A24A 2I56A 4XTDA 1Z69A 7REQB 4PSRA 2Y61A 1FHLA 4LS0A 4YJ5A 1JCTA 1JGMA 3AMCA 1KO0A 1EOKA 2DV0A 2E09A 4X0VA 1NFGA 3G1RA 1HT6A 1TX0A 1LT8A 3INPA 1GVFA 3QBUA 2QDDA 3BO9A 1K7EA 4NAEB 2WBKA 1GCYA 3W7OA 1PSCA 5DFAA 3Q2DA 2Z4GA 3W88A 5CLTA 1EPXA 4Z1DA 3UCDA 1MW2A 1W54A 2HTMA 4Q8MA 4B2DD 3BG3A 4I7WA 2PEVA 3QV7A 1HIZA 4Q7BA 5IXEA 5GJPA 3VMOA 2VQTA 5BU6A 1BPLB 3NA8A 1HJWA 1VBUA 3KCLA 3THQA 4JN6A 1V03A 3RN6A 3AMGA 2VVNA 3WK1A 3M0YA 4NVTA 4N4QA 4DAIA 5K2ZA 2EPNA 2TAAA 2X2YA 1LF1A 3NZRA 3VDBA 3PTMA 4WF7A 1Z3NA 3FJNA 4GISA 4XZ9A 5A6BA 4H9TA 3R6IA 4GVHA 1H7NA 3XISA 1OGBA 1HGWA 2NQHA 4TMBA 2V5DA 2IW0A 3I3EA 1EOMA 3SRDA 3HB9A 1FUYA 4J3TA 1Y5WA 1T5AA 1BD0A 3V16A 4O19A 3HQPA 1QNVA 1RHCA 3H26A 1UWQA 1TR1A 3WH6A 1EGMA 1PS9A 1GKQA 4DPPA 3ZR4A 1F4HA 5BOFA 1FWGC 1OCQA 1V51A 5A6KA 1OG0A 4Q4KA 4FZIA 3UWYA 3WJXA 3OQ8A 1PZ0A 2ZOXA 3W2NA 3IANA 2XGIA 2G3FA 1XRSA 5LHEA 1J01A 4HYWA 4LCRA 4YXGA 5FEXA 3O0FA 3FK4A 1I60A 4Q4RA 3GKFA 3SSZA 4D71A 1CYGA 1GOIA 2ZX6A 6CGTA 5EMYA 1TE6A 1JRBA 4D8ZA 4ZMGA 3QV8A 2GUUA 4FEZA 4WDUA 1JPMA 3AXHA 4PE8A 3AXMA 4FIQA 1E1CA 3EGJA 4GLEA 3RU6A 3WYZA 3ZZ1A 3EA2A 1PVNA 2PWEA 5HWJA 2XM2A 1OYCA 4ZSUA 3PPGA 1CEOA 1UC4A 3T8QA 3VINA 2XJ7A 4F9JA 2WJFA 5LA2A 5JBDA 2D3NA 4FALA 2UY2A 1AD1A 5FAJA 4DQWA 4XV0A 1JFHA 5XIAA 3ARXA 1KFEA 2WZTA 3R1ZA 1HXJA 2QUUA 3PK7A 2EO7A 4HPGA 3W7EA 1G6CA 2BB0A 2A0NA 2FMOA 3DGBA 3V5OA 4A3QA 7XIMA 2XIQA 3N3TA 2DQXA 1V3KA 3UXLA 1CNVA 2E7FA 3GU9A 1HP5A 2FZDA 3L4VA 3S1WA 4LYQA 1UR3M 3AIVA 3RXZA 4ZOCA 3T07A 2BXVA 4JYFA 3RJYA 3DENA 4AD2A 4ECLA 1A5OC 4CU6A 4PSPA 3PN8A 4A2RA 1NWTA 3S6TA 1ZJIA 2FZBA 2PWDA 1AJZA 3IJ9A 3RK8A 2YLLA 1U5HA 5DT7A 1YTDA 1ITUA 1TPDA 3ONBA 2VD8A 3PBGA 4LYPA 3D3AA 3WLNA 1JR1A 4D9PA 1KLYA 3OBAA 3U57A 1XGZA 3QY8A 1F7BA 1OT2A 1Q85A 4RDZA 4ZTYA 3GXNA 4MKVA 3M6DA 2ZUVA 2H8XA 2HXUA 3UWEA 1H41A 4WOZA 1XFBA 1LLWA 1T99A 2GVLA 2J7DA 1OFAA 4HPXA 3IJQA 3SR7A 3EXSA 4HYVA 4F0HA 3TQVA 2V68A 3LTPA 1L8PA 4CD6A 4GNJA 3TDFA 3A3HA 2VC7A 1KBBA 3SCVA 4QE1A 2VR2A 3H2NA 5CC6A 1W5OA 3VNIA 1ICPA 1TMQA 4CQ8A 4C91A 5JMUA 1SFLA 4F4RA 8CGTA 2CNCA 4JD4A 4F79A 3W71A 4R88A 1HJUA 2UZ9A 2WMIA 3XINA 3F03K 4HTYA 3UXDA 3I7QA 2XN0A 4FF7A 4E3VA 2PC8A 3GDRA 3KP0A 2HQAA 3QXBA 1SQ7A 3T0TA 5G1MA 2BY1A 5CPSA 3ARYA 2ZUUA 4W7VA 5EFDA 1DKWA 4BY3A 5J8LA 3GG0A 2O9OA 3MYPA 1NF0A 3EXTA 4JTSA 5AECA 3NQCA 2EQDA 4JHMA 2CLMA 3B4YA 2J77A 1BQCA 4Y9NA 1ZCOA 3RO6A 4H9UA 2PDKA 3GDLA 4GABA 4Q3MA 1PHQA 4QR6A 4E8DA 1PZ3A 1GTHA 4RW3A 1ITXA 2O56A 5HMSA 3L21A 1UJQA 4QSHA 2QCLA 4MG4A 3USZA 1Y5XA 1UROA 3NQFA 1CLXA 5BOOA 2C16A 1XR2A 1TV4A 2J8FA 4RL3A 4ZSTA 3K4DA 3LGGA 3RMJA 1XF0A 3EX1A 3O05A 4J3UA 4LAZA 2YOCA 4IF2A 3JU2A 4JTGA 1F6YA 1VEPA 1RH9A 3VKCA 5ECVA 4CEXC 4TTGA 2G3JA 3PWGA 3IUHA 2B0MA 2VHLA 3W37A 3M0IA 2EAWA 2BVDA 5LNRA 3T40A 2XG9A 2W5FA 3M0JA 1LL4A 1PX8A 1XLKA 3RG6A 3ZT7A 3LZ3A 1FKWA 3GRIA 1IWBA 3PJXA 1RBLA 1UZDA 2OQHA 2CFFA 1BVNP 3ZSTA 3IAPA 4YN5A 1Z44A 2OLSA 1GEQA 1B3OA 2P8BA 1GK8A 1LUCB 3NZPA 2E5CA 4B5UA 2J79A 4AZ5A 4L9YA 2RDUA 1KM6A 3FXGA 2R94A 4NYYA 1R3QA 4QS5A 3W1MA 3B0XA 3GC4A 2XM1A 1BSLA 1Z6KA 5LNWA 3QTGA 3W72A 2V30A 5FF2A 2ZZ2A 3OLDA 1BYAA 4JFTA 3FSUA 3S2JA 2CIPA 3MANA 2DVUA 3VCNA 4I5UA 2G95A 1J8VA 1BKSA 4QCEA 1YRRA 4W5ZA 2P0OA 4RR4A 1DVJA 3NM1A 3WJYA 5HJYA 3BG9A 4NJIA 3W81A 1UWTA 5DCDA 3QFWA 2I57A 2W0UA 4AFYA 3KW3A 4AZHA 3V3WA 3CGTA 3LCIA 3NDOA 4JNZA 1MO0A 2E9BA 3AZTA 4EAMA 2BVTA 4S38A 2PZNA 3PZQA 4R7WA 2E9MA 1JPKA 5DO8A 3OG2A 1ZS2A 2ZC8A 4D6HA 1CCWB 4XD3A 4RNJA 3JW7A 3HN3A 1B2YA 3W7MA 4RE0A 5DQPA 4O57A 4GZEA 3TP4A 5C6MA 1KR0A 1NFPA 4FMVA 1A5LC 4D2JA 1KGUA 4WIWA 1W3NA 4A3HA 1HL2A 3FJ4A 4XUGA 4DUVA 3KVKA 4PBFA 3G1FA 4WY0A 2VP8A 3ZLHA 4EP8C 3PZOA 3M9YA 4B4FA 2C91A 4OZOA 2RGLA 4MNJA 4PGLA 1J0KA 5C7VA 5SWUA 3H2EA 3EMQA 4S2BA 4CVUA 3WQVA 2A5HA 2Y8VA 1C93A 1GJUA 4RNHA 2PB1A 4ZBCA 3CMGA 1EHNA 3DFYA 1XICA 1LOQA 1P0NA 1DIEA 3MSDA 5MKGA 4QIUA 1TWDA 1OBAA 1TJ0A 3E5BA 2Y85A 2YCLA 4A05A 5D38A 2REQA 5TD4A 4FO4A 3S9ZA 4W8AA 3L4WA 1SZRA 1QWGA 3QW3A 4O1AA 4C6KA 2XUCA 5EY5A 1BTMA 5BRQA 1E5JA 2OWCA 3NL2A 1HUVA 1E71M 4I9JA 2J24A 4UTWA 1ZU8A 3EOSA 5C2XA 1GOXA 2DIKA 4MWAD 1R8LA 3RGTA 3TA6A 5LA1A 3BW2A 5FF0A 1EBGA 1MZHA 4OV4A 1SFJA 3GC2A 2PTZA 1XKJA 3SCSA 1UWUA 3SUTA 3UG8A 4I9AA 3QEZA 1AODA 4PMJA 1RD5A 3HG3A 3JR2A 4RDYA 2VCBA 5AY7A 1R3SA 1E73M 1LLOA 1YKWA 3GG7A 4PB4A 1O1HA 1S2UA 4LV9A 2X30A 4J2PA 1S3HA 4C7FA 2YCEA 1XIDA 2Z1KA 4L4LA 2QKFA 4HZ7A 3DESA 3L4XA 1XBVA 3AHZA 2E68A 4AZGA 2D73A 1XLIA 4CNUA 3W1LA 4BEQA 4EWND 3KWSA 1A5AA 3ITTA 3K4AA 4B3KA 3HMJG 1TZ7A 3IGUA 3LEPA 2VYOA 4KWOA 5AC6A 2FHBA 1POJA 4J3XA 3VZYA 1FH9A 5A8PA 4U5KA 2CERA 4DAFA 3IUDA 4Q33A 3AS3A 3GDMA 4YCPA 5FKYA 4B5SA 5AHLA 1ME9A 2WMHA 2HBVA 4DUWA 2F9RA 4GI8A 5IFPA 2XN1A 3CUXA 4V33A 2I1OA 1Q6FA 1TPC1 1ZJHA 4CN4A 5MHBA 4UZUA 2QCCA 4TIMA 2ZZ7A 2CXGA 1O12A 5LNVA 1TFVA 3WCZA 1EDGA 4KW2A 3H54A 1A47A 1RZMA 4IJRA 2OZTA 4DLMA 4UTHA 4GH3A 3I10A 4WR3A 3SUSA 4US5A 4NUWA 5IDZA 4RLIA 2YDSA 3LB0A 1X1OA 4LALA 4N6FA 3OZYA 1ZALA 5K9CA 3W6YA 1RJPA 1QI5A 4IHCA 1LBLA 3W7QA 3EOOA 2O7SA 3WF0A 3Q45A 1U5JA 1UD4A 1EIBA 3VIFA 4LF1A 1V6YA 4KETA 1JG9A 2C71A 2XHYA 3S9IA 3ATZA 4ERAA 3NVTA 1SZFA 1XC4A 2BZNA 2QCDB 3VXGA 1SJCA 3U0HA 1JCJA 3OTRA 3PSWA 4DJFC 1KCKA 1SO3A 4NY2A 3WQWA 4E4PA 3ARSA 3LM7A 3HOJA 1KBKA 1QU4A 2VC6A 3ARQA 4H8HA 1V7AA 3C2VA 5EGRA 3C4UA 3TNBA 2WSKA 1SYTA 1VB9A 3T9PA 3GUGA 4C6EA 4I7UA 2XH4A 2VENA 1OADA 4XBKA 4NZ5A 5F2IA 4KERA 1HG3A 3V5FA 3N12A 1I45A 2ZXBA 2PWVA 2CKSA 2FB3A 1O7AA 3T6CA 2EG6A 3NQ2A 4WSHA 4DWSA 4CVWA 1I9CB 3DC0A 2YGYA 2E1WA 3LNPA 4AIUA 1NFBA 3P2VA 1TV5A 2WQDA 1SJAA 3LD5A 5CC7A 2GSJA 1A5BA 3N2CA 2DJLA 2BFGA 3UG3A 1TWZA 2OR2A 2INZA 3N18A 3WMBA 4JN8A 1EX5A 3R10A 4RK8A 3KBWA 4RNIA 3VOIA 2B7QA 2WJEA 3A47A 3IVUA 2PF0A 3WUGA 4ZO7A 1E3ZA 4LJ3A 1MDRA 4AIBA 2NVCA 2KZHA 5AYIA 4L1GA 2TYSA 4LUYA 3M0MA 3O06A 1IV8A 3MMUA 2QUMA 1YE6A 1EYWA 1XYBA 4OE7A 4B4HA 1JXJA 2PAJA 4DO5A 2J9XA 4HIBA 2PGFA 2DT1A 4JS3A 3DG6A 3DC8A 1PKNA 4U31A 2XTKA 4DB7A 4IJBA 1IT7A 1VD6A 3GZ3A 2X42A 4IOTA 4WJXA 1KW1A 1ISZA 5CGTA 4J40A 1QO2A 4U33A 3U2ZA 4IIHA 4PRRA 3VUPA 2CBVA 3W22A 3O0KA 3GVGA 3B4UA 4E2DA 3AYSA 4MYAA 2B31A 3BV4A 2XGBA 1OHLA 1C8QA 3WNOA 4H7VA 2FZ8A 1JYWA 4TU1A 4I90A 1GZ1A 1XHGA 3CEUA 1Q5MA 2FB2A 3MMDA 2V8ZA 5CZJA 4JY9A 2J4GA 2DT0A 1E4MM 5HPCA 1GHRA 4LX4A 4UB9A 4H4IA 1TCDA 1PBGA 4UXDA 3V35A 4YHEA 1G7UA 2I9EA 1UIOA 4PUMA 1XDJA 3ITVA 3OZPA 4M7SA 5HUPA 4Z2HA 3QY6A 3IPWA 2Z1BA 5BOEA 3G3DA 3VE7A 4QEHA 3BUVA 1UZHA 3M5VA 4DVOA 2H3DA 1F61A 1OD0A 4I7VA 4HKPA 5HJLA 3WENA 1R2SA 2TPSA 3RMEA 2H9AA 1W9XA 3AROA 4KEZA 3G1XA 5F1VA 3HGSA 2YFOA 1WKFA 4GI9A 5GNXA 4PH6A 1CT5A 4GYFA 1LP6A 3BW3A 2FKPA 5I06A 1VLIA 3PVFA 1DWHM 4DWDA 1YBQB 1FFQA 2GLKA 2ZDSA 2ZZ4A 4YTSA 2JEPA 3PR2A 1H0GA 1HNYA 5I23A 3E1F1 4LY4A 1IZKA 3PNZA 3LXAA 4AZCA 3RPMA 4GYPA 3SAZA 4JHOA 3RLGA 1L6FA 4B9YA 3GE7A 2JIEA 4GI4A 4TVDA 1AG1O 1BXNA 3ZO9A 5H1WA 3CHEA 4WHBA 2CLHA 2OCZA 3SIMA 1XLBA 1WXZA 5LIYX 3WD2A 4FNUA 4MZYA 1TE1A 1TJ2A 2V5LA 4J7RA 4MFDA 4O1DA 3BICA 3WF3A 3KDOA 1KC7A 3ZQ9A 2Y2WA 4AISA 2X1UA 1EP3A 2FVLA 3B0VC 3NCOA 3L66A 2VOTA 1TV7A 5CJ5A 2Q8XA 4ZQNA 5IRPA 3MWCA 1XIMA 2WSQA 3KOZA 1IIHA 4IPNB 2PWFA 3HG5A 1M53A 2WQPA 4UTIA 1J10A 2XSBA 2HNHA 3BAJA 3W1QA 5E0KA 1A5NC 4JEJA 4JX4A 3NIYA 5AYXA 3GFZA 1RLCL 3FKKA 2PA6A 3CM4A 4Q22A 4HNTA 3QZAA 1Y5VA 2FJKA 5A3HA 2GOUA 2DT2A 5HWMA 4OT7A 2GDQA 4O53A 1BGGA 5D2WA 1UOKA 3ABOA 3F2BA 1YXDA 3QR3A 3ABXA 4PN2A 1X7FA 4GUGA 2DJXA 3KBMA 1BSIA 1V0MA 1VFFA 3L7RA 4IPJA 1OD8A 1JZ5A 3CWHA 1EJ7L 1MWOA 5I3DA 2ZA3A 2PD9A 4ROPA 1PCWA 3CIXA 2J47A 5AHEA 1UW9A 1WUEA 4NNCA 1B4KA 3VX0A 4WGXA 3W7IA 5L9FA 1FWFC 1UR0A 4CN1A 4QITA 4NX0A 1I2QA 5BRPA 5HUOA 1HKIA 4ADSA 3NFUA 1GORA 3ZOAA 4W84A 1XUZA 3ZT5A 4GVFA 3I3BA 3L23A 2W61A 1B3VA 2PPGA 4AZBA 1H7RA 5CZTA 2QJIA 2VEKA 3KLLA 1N82A 2V3GA 2YW3A 3OLGA 2XVGA 4NSBA 3HPFA 3H2OA 1OF6A 1R3TA 4PUJA 1I1WA 2DT3A 1XSKA 4BWLA 1C3FA 3WF4A 4AUBA 4RX0A 5AYBA 1V0KA 1SSDA 2X7VA 3WKZA 1ME8A 1E1CB 2OZ8A 3NNTA 1W37A 5A5WA 3PZTA 4AG0A 4K36A 3WBAA 4BK9A 2QIIA 1AW1A 3A12A 1VR6A 1YADA 3TMLA 2DZXA 1V6VA 2Z2UA 1O66A 4QXIA 3ARWA 4X3ZA 4GQGA 3WDJA 2R1LA 3H2CA 3DUGA 1FFRA 4M80A 3TJ4A 1EO7A 2OOFA 4WQ6A 3B0PA 2Q8LA 4UOJA 5AC7A 1FWEC 2FJUB 2CXEA 3TZNA 3IV8A 1IT8A 4DZAA 3P5ZA 2PDWA 1I6NA 3W28A 3KOYA 4BF5A 2IS7A 4IIGA 5D4YA 3OVQA 1G0CA 1B3YA 4PFHA 1ENUA 4HA1A 2WMFA 4AXNA 3LG3A 1XBXA 2QEZA 3RIKA 1B54A 1J6PA 2VRQA 2ALRA 3ZLFA 4L1WA 3DFPA 1LL7A 3CAKA 5DCBA 4AAJA 3P6LA 2QULA 2J6VA 3B9EA 5HQMA 1YHTA 5EKYA 1G4TA 1H7XA 3WF1A 4YHGA 4GQ0A 3FEQA 1BEUA 3PBUA 4Q6XA 3C52A 1ICQA 3F5LA 3SRFA 2I7GA 1CXIA 2NX1A 3VABA 3LHWA 3G2GA 2WVVA 5DCEA 2A85A 1JXKA 1JGIA 3SM0A 3VE9A 4JFWA 3PBWA 1PAMA 1I2NA 2IXVA 1PB0A 5JH1A 1S2CA 1H1YA 2DZVA 3WUBA 4LCQA 3BMWA 3QN3A 4ZL1A 5JBFA 2ZX8A 3W7GA 4Z2LA 2YB1A 1EQPA 3PP7A 3AS1A 4S3JA 5BCAA 1MRAA 1OSEA 5HNRA 4GO9A 2TMDA 4E3TA 5D05A 4EXBA 4NZJA 3GYCA 1RVGA 2ACRA 3LHTA 2A7RA 2VM8A 3TU9A 3AWOA 3UVIA 1BWVA 1JZ2A 2NVAA 3V75A 2DQWA 1AUSL 1XQLA 4RNFA 1K4HA 3O8AA 4LT9A 2R1MA 3U7VA 1NQKA 3CUIA 3PBYA 5EPDA 3B05A 7CGTA 4M8UA 1Q63A 3T78A 4MY9A 4CQDA 5GQBA 1P0EA 3SGGA 3S42A 1MW1A 1QOPA 1W5NA 2CLIA 2VEIA 4JCMA 4J35A 2WWCA 3MUXA 2F38A 3LENA 2WMIB 1EC8A 1RA0A 4JL1A 3GAYA 4U28A 3WLTA 2GVYA 2QGHA 5CLWA 3H23A 1KBIA 5C0QA 4MUPA 1PIIA 1Z9AA 5A8QA 2ZXQA 3LQLA 1UZ1A 1E4LA 3W2LA 4FOUA 2QCHA 1XH1A 1QT1A 2ZWYA 3KWXA 4JNYA 3NQDA 2F6UA 1FHUA 1BXCA 5JU6A 1XYFA 3LCLA 4RZ5A 1Q6OA 3CXOA 4JTEA 4UQ9A 1LRQA 3B97A 2C0HA 4XAFA 1R9YA 1JQXA 2H90A 4O13A 1UOZA 4O1CA 4OWGA 1LJYA 4JOMA 1QOQA 3TSDA 3B06A 4J3VA 3STFA 2OGJA 3S1XA 3PZNA 4C7GA 4QSFA 3NR0A 1R30A 1E43A 4GQBA 4MDPA 4REQA 3ZXWA 2VQUA 2VEFA 3UPMA 1EGVA 2DZTA 1QK2A 3BURA 3UPBA 4BI7A 2V81A 5C55A 2O9RA 2ASHA 2ZA2A 3OZMA 4X61A 1DP0A 4Y90A 1WKEA 1R9ZA 4AYGA 4N9DA 3IUIA 4XD5A 5AHIA 3ZFHA 2ZRWA 3R25A 4PCFA 1VEMA 1EH9A 1U5VA 1DE6A 1KWGA 3OJGA 2F84A 4YVXA 4WOQA 2MNRA 4WY0F 3DI1A 1R86A 4FP1A 5LXEA 3POHA 1OB0A 4ZOEA 1MZRA 1VLWA 4N42A 4EPBC 3TYCA 2HZGA 1G94A 1DTNA 1QHOA 1OCBA 4JTUA 2OSWA 4CKQA 1PYFA 3E38A 1XISA 1Q7QA 3GXFA 3A9BA 4UQEA 2UY3A 2DU2A 1WBHA 1P1MA 2VX6A 3C3NA 3RRAA 4WJ8A 3FX4A 3WDHA 2YKKA 2PRMA 1HF6A 2YLAA 3JUGA 3E9AA 3W2MA 2BX7A 2MANA 4H41A 4XB3A 1L6GA 1G5AA 3A3XA 3H24A 4Y6GA 2E8YA 1DHKA 2OLHA 3B8DA 2A3BA 1ONEA 3M0KA 3A4AA 3TROA 3M41A 1ZPTA 1E1FA 3OLIA 2D2HA 5G2IA 3M44A 1O5QA 4A2SA 4JGDA 1TRDA 3L9CA 2QV4A 2V2HA 3POCA 2GL5A 3R7MA 4NXKA 3RLVA 2PLKA 1HKMA 1MNZA 1WNOA 1H11A 2G0WA 2V6AA 5A8MA 1EF3A 1DYSA 4GC4A 3B0YA 4XAPA 3QQ0A 2CLLA 4AF0A 2FYMA 2PDGA 2CZEA 3WD3A 4K37A 4XZLX 1ISYA 3OBKA 1QI2A 2WV8A 4CCZA 1QNRA 3NWRA 2PGWA 3D5HA 2ZDRA 4KPLA 1XH2A 1E4IA 4JX6A 2J27A 1GW9A 3SUWA 1E0VA 4OJYA 3B8UA 3L2MA 4MLJA 4UMCA 3I4KA 4WY0B 4JFUA 4C60A 2Y8UA 5CSYA 3SI9A 3OIXA 3CNYA 2GQ8A 4AD5A 3HJEA 2AAAA 3RX4A 2V63A 1CZ1A 1E9LA 1M03A 3TFXA 2GGIA 2HE5A 4HK5A 2OZ3A 4PCSA 3KVMA 3WLPA 3ARZA 4P7RA 3TJLA 3N13A 3H2AA 5MKGB 1US2A 1AW2A 1JPIA 3WQDA 2YDQA 1IEWA 1RALA 4M0XA 1LYXA 2YCLB 2GDUA 2REQB 4DBUA 3WBXA 3OO2A 2F61A 4IMFA 3AXIA 3AHTA 4PYSA 1PEZA 1RK6A 2CPUA 1Q45A 1XDMA 2RFGA 3WQCA 3MV01 2QCEA 3MI6A 3NPXA 1JJKA 2E6YA 4CQBA 3P5YA 3S0CA 3V5CA 3RM8A 3LY0A 5ECUA 2BOEX 3KTXA 4DXXA 5CPLA 1R3RA 3N14A 2E77A 1T8XA 4D6CA 4ACYA 5B80A 5HAOA 2P3EA 4ZQOA 1PTGA 3GC5A 4HU8A 2VZVA 3W82A 5LZLA 1ZAHA 4J1OA 2EBNA 1XCXA 3LHVA 4UFKA 1GGOA 3O6DA 5CSSA 2PU0A 4ATDA 4BF7A 2PBGA 3VCCA 3V0TA 2ZKMX 3KE0A 3W23A 3CQKA 5EMMA 3FVDA 3KUMA 1H49A 4UNKA 3PFRA 4JTQA 1GVOA 5FJIA 3AQUA 2Z6IA 2GJNA 3BXWA 2G41A 2PP1A 2VR4A 1Q7ZA 3IACA 1Z42A 2DIJA 2I14A 1K03A 3UF9A 5CAHA 4C1LA 4ZB0A 5D2VA 4TQTA 2QDGA 2WZMA 3SY1A 1O5RA 1XCFA 1OIFA 1H0IA 1DV7A 5JVLA 1BTCA 4YTQA 5EYWA 2IQTA 4NI3A 1FDJA 1ML1A 2PDYA 4BI6A 1QUMA 4R27A 3EKLA 4KKXA 1CENA 5AOUA 1W8GA 2A7PA 1X98A 4NAFA 2FDMA 1E6XM 1FH7A 5CPQA 3NZQA 1E40A 2PLJA 3LSBA 1JCXA 3ONCA 3D47A 4JPGA 3B04A 1CGWA 3VM5A 3G1VA 4D6FA 4C7DA 4J3WA 3TJIA 3LV5A 1QTWA 4MAZA 3VD7A 4HJWA 4M56A 3R79A 3UYIA 1WDSA 2EKCA 1BF2A 4AWTA 4PMNA 3ZYZA 1QMLA 1V3MA 3DX5A 1YEYA 3NZ1A 1NVMA 3W87A 2A21A 1U1JA 2XFYA 3MHUA 3WNPA 2XWEA 3MUIA 5JIWA 1F2JA 4N9BA 1R5YA 1RSCA 4M81A 4MMWA 4FB7A 1TZZA 2J7CA 1C90A 2WMGA 4CCEA 4XAYA 3VIMA 4ROQA 5HATA 1VEOA 2L5HA 4K8EA 1L8NA 2PU1A 3FHAA 1A0CA 1BXBA 3DFNA 2WM0A 1UZ4A 3EXRA 4YWIA 2VFEA 2ZE0A 5KZMA 3W3OA 4WKAA 2CCRA 2DH3A 1D8WA 3NYZA 3QMSA 1J79A 2I9UA 1WCGA 6TAAA 1XD0A 5XIMA 4GBDA 3P8JA 5AC8A 4PMXA 4KT2A 4EPEC 3S4TA 1K8YA 4E6MA 3NQVA 3LM3A 4KCWA 3LBMA 1CIUA 2Y4SA 1CXHA 4DWSB 4K7VA 2Z1SA 3W74A 1E55A 3EX2A 3GHRA 4J4KA 3TW7A 3VNJA 1R7OA 1BWLA 2ZBTA 4LU0A 1KM5A 2O9PA 4PULA 3OA5A 3UGRA 1KBLA 2H3BA 1US3A 3IIZA 2HS6A 3TCEA 4DJEA 2GSHA 4W86A 3G6MA 5K9DA 4QG9A 4KIEA 3QMRA 1TPUA 2R1KA 3KVJA 4GIRA 1MFVA 4ADUA 3UXAA 2W91A 3DKLA 5LA0A 1V6TA 1D9EA 1OFDA 2PODA 3IVTA 3L0GA 1SW0A 3UCCA 3VILA 4GUJA 4L6OA 3TX9A 2ZZ6A 4FXSA 4CD8A 1VBJA 2DH2A 2V3EA 4MFEA 2OYLA 4F40A 1PPIA 3R11A 3RX3A 2Q6ZA 1FXPA 1NWSA 4OTKA 3EYPA 4AX7A 1CXEA 2IXUA 3VGHA 4W87A 3BH4A 3H4GA 2ANUA 3C86A 4K7YA 4EKJA 4W8BA 5BU9A 1SR0A 4PMYA 4HGXA 4CQAA 1MMFA 3O63A 3WX7A 3NSMA 3MCMA 2R1NA 1A0EA 1CPUA 1GVSA 4WSJA 3RPDA 1DL3A 2FLIA 1I75A 3ARTA 3R0KA 4DZHA 3B9AA 4OIFA 3FW6A 4GUIA 3S46A 4DYKA 4LYRA 3L4YA 8XIAA 3EDKA 3C61A 2W9MA 1D7FA 2P0IA 3S6DA 1XYAA 2GJXA 2FMNA 3GWQA 5AB3A 3U8GA 1KQYA 1AFSA 2XIJA 2EGZA 4Y7EA 1OABA 3VD5A 4QRNA 4FR6A 1P4CA 1DIKA 1A53A 3G0SA 2X16A 4LYKA 1M6JA 2WO5A 4JAWA 4UTKA 1TPEA 5ABGA 4S3GA 1K9DA 2YFNA 2H9AB 3AISA 2Z27A 5TIMA 3FLUA 5KETA 2OT0A 1GNXA 3VZXA 1J0JA 1UWRA 4GZ7A 5D37A 2QCGA 1BVWA 4KGLA 4BQ4A 3TZFA 3VIGA 2OSXA 3PTDA 3CPUA 5CPOA 1C8YA 2CWXA 1Q4WA 3NYDA 1HJQA 2PTWA 5DMNA 1S38A 3NAVA 1KA9F 4R9OA 4WXZA 3G18A 2EPKX 4HOXA 2XPKA 3RCNA 1VP5A 4AZCB 4ZXOA 4YVPA 1OF8A 3SQSA 3S2LA 1UKQA 2D2JA 1UP0A 1S2VA 1W31A 1VYPX 4J3SA 1UR8A 4A4AA 1Q3NA 4NKCA 3S6OA 5D9NA 2WMJA 1W1YA 1H1ZA 1D3CA 4JX5A 4IIBA 3W00A 4GYKA 3VU2A 1J0IA 1UB3A 5D9OA 4FI4A 2EPHA 1QJWA 4BQ2A 2HBXA 3BGGA 3K30A 4HP5A 1LTDA 4KCVA 3SRKA 1XGDA 3U48A 2Y24A 4UZSA 5IHRA 2CBIA 4MNLA 1WDQA 1CBGA 1C7TA 1DJWA 5I24A 3AHYA 3UYCA 3QOMA 3CZLA 2ISDA 1C9DA 4A6GA 2IPGA 4XZBA 1UBPC 5CJNA 3BTNA 2E9LA 4O12A 3BDKA 4K39A 2C6QA 3TAOA 2P53A 4AY7A 3KL0A 2BDQA 3BOLA 2XZ7A 4IMDA 2E67A 3VNLA 1U83A 4ACZA 3QQ1A 3WD1A 4X60A 3EWWA 3VA8A 3H4XA 4R5EA 3EKGA 1OVDA 3WH9A 2HS8A 6REQA 4HVXA 4LVGA 2E1DA 1TO3A 3R0UA 1Q8AA 1XKYA 2FTYA 3ITCA 1VFHA 4XUYA 1IXNA 3B9DA 4G9PA 2OFJA 5M1TA 1X1NA 2Y1HA 3GHTA 4L5ZA 3LBCA 3E0LA 3NJ3A 1E6QM 4B16A 3E2QA 3GW3A 1BQGA 1EZWA 2HVMA 5FAGA 3G3MA 4D6JA 1KFWA 2FFIA 1F05A 3UG5A 3KL3A 1F74A 5F4XA 1EFZA 3WMLA 1AW5A 4KRUA 1A50A 4QE4A 2SFPA 3M5XA 1JZ4A 2O92A 2E8ZA 1HGYA 4WKHA 2X0SA 2B7NA 3WQ8A 3DIPA 3DHFA 5DRIA 3TA9A 4GNKB 4BKNA 4R7JA 4HJFA 4LV4A 2CYGA 4MZ1A 5HWNA 1MQRA 2WSRA 3EPNA 2DW6A 1CECA 1XH0A 3GH5A 1MUMA 5LKYA 4JFVA 5AFDA 4H9VA 5M5DA 3M1ZA 3KP1A 3Q94A 1EB3A 4UIOA 4C6JA 2FQIA 2DDXA 3CC1A 4C6QA 1B9BA 1NM9A 3C2OA 4HT3A 1K8XA 3M6YA 4Q4SA 4LFYA 2EPLX 1L0PA 3MPGA 1W9UA 3SB0A 3VX1A 3QR0A 4XD4A 3TC6A 4DNMA 1J96A 1TV2A 2QYGA 4IP5A 2VGGA 2ZUNA 5T91A 1JF5A 2QAPA 4YVVA 2NT1A 4JQ1A 3DG3A 3HIJA 3AMKA 1NIUA 4KEMA 3UPWA 1W2PA 3CHFA 4IUGA 3M16A 5FESA 1S5NA 2Z28A 4F3HA 1G1YA 2XN2A 3AHVA 3H22A 2CHOA 1GOKA 1UR9A 2W62A 5FJTA 4M6PA 4CD7A 4C65A 3CBWA 3G8RA 3TOPA 1W56A 3OYZA 3U5YA 1AK5A 4ASTA 1VRDA 4RUBA 3GFYA 1FQ0A 1UHVA 4JKLA 1ZGDA 1FWCC 3VIIA 4DUXA 3ABZA 3QH2A 3GVWA 4IMAA 5HPOA 3ZLGA 1IGWA 2VGIA 3UZJA 3K2GA 3WUFA 4XIAA 1GOWA 2WVVB 1EYEA 4P7NA 1N7KA 4ZOBA 2YXOA 2Q01A 4LEFA 2BG5A 3SGZA 3UERA 3MBDA 3VIOA 3MWAA 4RV8A 4F0KA 1O68A 3W7HA 3HJZA 1RY0A 2YXGA 4B3ZA 3H8AA 3MJMA 1GVYA 1GG0A 3LLXA 2NQ9A 4IFKA 2EF9A 4DXVA 1YW1A 5GJMA 3TN3A 1HL8A 5HNNA 1H60A 1SR9A 3THUA 1XP3A 1CLKA 1H7WA 1WDRA 1TIWA 3Q65A 3UY8A 3FY1A 5A8OA 1TREA 2Y89A 1NDZA 2C15A 2WC3A 3UXIA 3WNLA 3KRBA 5B7YA 1N8FA 1P7TB 3DH7A 1XLDA 5TNVA 3EB2A 3PF3A 2JEQA 5E09A 5CSUA 4GFIA 1XJBA 3PAJA 3DN5A 4O14A 2CLFA 1CXKA 3MJYA 4DN1A 4JQ4A 1EQCA 4OUIA 5FIPA 3TH6A 1TRIA 1TB3A 1SO4A 1TV3A 4KBXA 3GBDA 1AL8A 4FX8A 4O18A 3LYEA 4PL1A 4U3AA 4C6CA 4K38A 3TUUA 3RYSA 5DXXA 1XFCA 1MQQA 2WYSA 4XKYA 3T81A 4P2VA 2BOFX 3N2XA 4DBWA 1ELSA 1JCLA 3BAYA 4F0MA 4OQVA 3PTQA 3M5YA 1K77A 4GE8A 3F5JA 1GYMA 1G67A 1FWSA 3N1AA 4X2PA 5AVNA 3T0AA 3W76A 1AA1B 1PTDA 4WXYA 4DJDA 4QEEA 4IICA 4O1FA 1ZP3A 1FWAC 2INEA 3W2UA 4CQ9A 3AZSA 5CCZA 4DBSA 4FSAA 2ZIDA 3DFQA 1V02E 4XX6A 1GJWA 3ZSSA 4AEFA 5D02A 1TPFA 4WZHA 4REQB 1V3LA 3IRSA 5F4SA 3FOKA 4GJ1A 2Z7KA 1PX3A 2Z6JA 4Y8EA 5M2FX 1A5MC 4UNLA 1P6CA 3GXIA 1GONA 1TTQA 1T7LA 4UTTC 1MVYA 4KEVA 3TTOA 4GNVA 3PSVA 5A6AA 1IXQA 3WEMA 3H55A 1UA3A 3LERA 1WZKA 3LCXA 1FWIC 5CPTA 2PLCA 4C6BA 3DFTA 1OK6A 1VJIA 5FJJA 3VGFA 3GTNA 3W26A 5H8MA 5HMEA 3FYPA 3VFCA 4G7FA 1XIEA 3IJ8A 4I5XA 1DOSA 1I2PA 5IBXA 3T44A 3NO1A 3PZVA 1OCNA 3S1VA 2GQ9A 2DUAA 3E12A 4KRZA 1Q6QA 1S46A 1VCGA 1I4NA 5JQ9A 1S5TA 1YQ2A 4H9MA 3DDMA 3ELFA 5E9AA 4CU7A 4S1FA 3GM8A 1NP2A 2WHLA 3VD9A 2OPJA 4G7EA 1TTJA 4PMUA 3K8MA 2VGFA 1KWKA 1A3WA 1W3HA 3SUVA 1F07A 3H70A 3P74A 2NXHA 2YJQA 3VZZA 5KEZA 4GA8A 1KTNA 1E1EA 3PULA 2RAGA 2YA0A 2VEGA 3QKZA 1TR9A 3BGJA 1V02A 3LCWA 4Z0JA 1VC4A 5TBOA 3GX9A 1B3ZA 3HZ3A 1UCWA 4O4VA 2QPUA 3W7NA 2PDQA 4AF0B 1KM1A 5J04A 1Z32X 3TYDA 2WK2A 3E5PA 3R94A 5HQEA 1XV8A 1U1UA 1RBOB 4U2YA 3M47A 4H9ZA 2GVEA 2OO0A 2GQAA 3KZPA 1YYAA 4LF2A 2VD9A 2J62A 4QAIA 3WD4A 4HYRA 2X1RA 4P8VA 4HMCA 4HNLA 2GQ3A 4DEFA 3O7UA 3L4UA 1NAL1 3VI2A 1XL9A 3IARA 3G22A 1LT7A 1KCZA 1ZY9A 4AHOA 1F3WA 2VOMA 3KOWA 3F4DA 4EPDC 1WZLA 2GYIA 5C9UA 4UMAA 3H7RA 4OU1A 2PBOA 1EUAA 3MTWA 1QASA 1EEXA 2HMCA 3WLSA 3ZWSA 1E0UA 5JBEA 2DVTA 3TWAA 1X38A 1LBFA 3NEHA 1N55A 3AC0A 2QZRA 1F6KA 3T0CA 2WCGA 1GVRA 1WB0A 4NZFA 3A5FA 2QR6A 5XINA 3RU8X 2VFGA 4XIMA 4ZEPA 1QI0A 1YE4A 5ABHA 3BLDA 3GW0A 5CGQA 1V5XA 1X6LA 3IJ6A 2XSXA 3U4FA 3A22A 3CHDA 4ZB2A 1KXTA 3UA4A 3MU7A 1ONRA 4XG1A 3OVGA 5U4NA 3MA8A 4O10A 1HP4A 2EKGA 3HV9A 3LU2A 1PYMA 2EXOA 4LRSA 4QBXA 4GO8A 3W53A 3WQ5A 2HPMA 2V67A 1R46A 3PZGA 4DF2A 2A3HA 1OYBA 3UWZA 1NTHA 3AWNA 1MRQA 2J75A 2WANA 3P0WA 3HF3A 3K13A 1DEDA 3ZMRA 4JTTA 1Q2SA 1ZBCA 1T41A 3IK2A 4R85A 4L6HA 1Z48A 4B91A 9XIMA 4KCUA 4EX4A 3THCA 1S2TA 5M3WA 3H6OA 4QQ3A 3GB6A 2D2GA 4RJEA 4ZFMA 2QW5A 5D8ZA 3W1PA 1DXFA 4H9XA 2YR1A 3JVAA 1ZAJA 4R9XA 2PE4A 4XZMX 4JIQA 4MJ4A 1AVAA 2F2KA 3II1A 4BHYA 2ATSA 4AEEA 5I6SA 2VRJA 1O60A 3LTSA 4E4UA 3PZ9A 4B90A 5G4HC 3CYVA 3VKKA 4D72A 4Z1AA 1M9HA 2ZTKA 2DW7A 1CGYA 1WDDA 3SN4A 2V9DA 1E70M 1TQJA 4GVGA 3J7HA 1EIXA 1IEXA 1SM9A 8TIMA 1OX4A 1UYQA 4ZENA 3QTPA 4DYEA 4OV9A 3CASA 2HCVA 3W4RA 5HK4A 3CB3A 3FSTA 4TX9A 5CPMA 1E0XA 1R38A 1P6BA 1V6UA 4UR9A 4FHAA 2PDFA 4HCHA 4JKMA 4IGNA 5IFTA 4I9MA 4BZYA 3QF0A 1E56A 5FEPA 2VL4A 3PG8A 4Y2WA 1RBAA 3ORWA 4H8VA 1TX2A 4NQ1A 1XM3A 1K8CA 5A2BA 5FL1A 4OBTA 1WXJA 3LGDA 4D1IA 4JYEA 4UR8A 1Y0EA 4A8RA 3KEHA 1JL8A 1J4EA 1JIBA 3OLEA 1UQZA 4Q8WA 1O1ZA 3VNZA 3W7DA 1HJXA 4QQUA 4LS2A 5I5RA 2QJMA 1YPFA 5H91A 3MP4A 4ZB5A 3R5EA 2D24A 3CH9A 5IHSA 5BWFA 3UJ2A 2IPWA 1M3UA 4N0RA 3L2LA 4W88A 5I3GA 3KDNA 2Y62A 2H6RA 1QNSA 3L4TA 4Z2GA 5E70A 1FWTA 2CITA 3HURA 1GKRA 1R2TA 1FWDC 4IP7A 2A3EA 4DJEC 4DZIA 3VUSA 3MS8A 3U2CA 4HPHA 1WA3A 3EWXA 2RHGA 2KAUC 3URQA 5K3VA 3VVGA 3KBJA 4AHPA 4WVXA 4GHRA 2D3LA 3CWOX 3KLKA 4JZ5A 1OX5A 2J13A 1CGXA 1M68A 2BLEA 4FX6M 1GT8A 2VKZG 3S5OA 1JDCA 5A6BD 1ZBWA 4NNAA 3QVQA 3ZJ7A 1VFSA 4GI6A 3USBA 1L6YA 1IZJA 1NH6A 2ZUTA 3PZIA 3B40A 3DI0A 1R3WA 3QHNA 3BQ6A 4CD5A 2DZWA 3TN5A 1VPQA 3OGRA 4O16A 1XDLA 3R58A 1EXBA 4OECA 4JQAA 4LVAA 3BLFA 3SRHA 3MKKA 5DN1A 3I3DA 3RF9A 3VNMA 1FWBC 3S2MA 1N8WA 1JD9A 4FF5A 4ES4A 3TC7A 2BVYA 1JAKA 5T26A 2VEMA 4PUEA 4L64A 2Y0FA 2D23A 3P60A 1HN1A 4CCDA 5C9XA 2WPGA 3AIUA 4MOZA 2I5IA 3QFEA 5CBIA 2QCMA 5KZEA 3VM7A 1DWGM 1G4PA 5BMWA 3PUEA 1SPQA 2WBGA 1Q6DA 3UFYA 1IEQA 2OB3A 3BJSA 3RCYA 2WC4A 3P0XA 2XWDA 1NP0A 3CS2A 3AYTA 4B5XA 5AHNA 4V27A 1AZ2A 3TSBA 5G1TA 3AAMA 5A6SA 3BSHA 4HN4A 3KS6A 1G01A 3IJDA 1XC6A 5MF5A 4Q8NA 1YDVA 4NT0A 4MHBA 4TXEA 4XBSA 4Q8PA 1VFOA 3RX2A 5HR6A 4N02A 3UU0A 1WPCA 2BVWA 3WUEA 3WK3A 3GUWA 3PPCA 3LV6A 1CB2A 3KXQA 3TMQA 4EAYA 3W07A 2F2HA 4JQ3A 4UUIA 4D6GA 3W1NA 1RCXB 4HPJA 2GJXB 1QNQA 4JHZA 3CZGA 4HSHA 2Q8ZA 3RM9A 4NZ3A 5KZDA 3SN1A 2IKHA 4R7OA 1ESWA 4AWUA 2XVLA 3NGJA 2O55A 2OJPA 2ZX9A 3HU7A 2XGZA 3N4AA 2PMQA 5D9PA 3OGSA 4ORMA 4MB4A 5C54A 1P0BA 2JQXA 5H2ZA 1JYXA 3N4FA 4UCFA 2DZAA 1I0BA 3WD0A 2PRHA 2Y7GA 4MVAA 2YIHA 1IGSA 2FHCA 2VFHA 2YDRA 3ZWTA 4ZE4A 3R43A 1UJPA 3E2RA 2BSLA 1ISVA 4K6AA 2G97A 3AHXA 2XH0A 2YA2A 5A6TC 2C79A 4YL2A 4E8GA 1F3EA 4GMEA 3BLIA 1C8VA 4JTCA 2A6NA 4J2MA 1BG9A 1GQJA 3CAVA 3CMFA 4TOQA 1YNYA 5HR7A 1SFSA 5G1YA 5I3KA 4FNPA 1HO1A 1W5MA 1UH3A 1UBSA 4IQJA 4IISA 1OM0A 3FS2A 4GK8A 4IMGA 3UR7A 4FIRA 1M7XA 3BARA 1X97A 2I5GA 1NF7A 5M17A 4GCAA 5D8WA 4FAMA 2F6KA 1QNOA 1AMKA 3ARVA 4J9JA 1PZ1A 1E9ZB 2V38A 1R2RA 2VZTA 3FA4A 3MSGA 1EWDA 3N2BA 3M7SA 1EGZA 1H2JA 1YX1A 2OXNA 4AZ7A 3CT7A 3RLUA 3TSMA 3KFTA 4M82A 2A3CA 2CLEA 4Z2IA 3DECA 3PBVA 5ABTA 1NU5A 2UY4A 3I4EA 3SO7A 4NASA 2J7FA 2PTYA 1W32A 1MXDA 1GQLA 2ZC1A 4JEQA 4AMAA 3WZ0E 4L6DA 2ACUA 4LAMA 4A3YA 3GAKA 1FCBA 1IEVA 3WQ4A 4CNSA 5AYZA 3CQIA 1UD5A 4BCEA 3VYLA 1G4SA 5D33A 2WM1A 2JF7A 1HFBA 4JTFA 2ABBA 2W92A 1J6OA 4UR7A 2GPTA 1FCUA 3S47A 1XLLA 1P1XA 4PCTA 1QHZA 2QMKA 3GTHA 3Q4DA 5HBFA 1BF6A 1W3IA 2BHYA 5HINA 4KIRA 5FI8A 3SCUA 1WDPA 3MVTA 5A6LA 3E0VA 2PLMA 2HJPA 3NDYA 2GUYA 2POTA 4LUTB 3WQPA 2GK1B 3H4WA 3M07A 4ACZB 4X9SA 4Z08A 1RD6A 2HSAA 2ZQ0A 4QDMA 3KM8A 3CLWA 4PTMA 4M1RA 1H50A 3W1UA 2A2IA 4WD0A 4FXRA 5E5CA 3BAKA 3SJNA 3DAQA 2ZRZA 3MUY1 5D32A 3C8NA 5GJNA 2J8GA 3CUZA 4C90A 1IIGA 3EWCA 1KQZA 3W38A 1R0MA 5LIUX 3GVQA 1DWFM 2D69A 4PCNA 4O0KA 4Y8FA 4LOCA 3IJIA 3DYMA 2BY2A 4KEUA 3TTEA 2HVNA 2V0TA 2X7WA 1MUWA 3VKDA 3N15A 4A21A 1LQAA 1XYZA 4K8HA 2NT0A 5I02A 4M7TA 5EA9A 1VBGA 1BFNA 2HRWA 3EMZA 1A49A 1ISXA 3H21A 3O6CA 4O8AA 1LOLA 5IDIA 2A3LA 2WKGA 3VDHA 1E6SM 2PDNA 3B8SA 5FF4A 3KBVA 4C6FA 2CKRA 5EFFA 3SSJA 1FH8A 3TLLA 4GYJA 1GWJA 3VMPA 2ESCA 3LRMA 3KX6A 3KTCA 1K1DA 2G3MA 4O0QA 1IR1A 3OHMB 5HANA 4HHMA 3PNUA 4YYCA 3QR1A 3F7JA 2YA1A 1O6IA 3FJ6A 3WLIA 3GDBA 4PTNA 3KHJA 3GNNA 2GJRA 2NQJA 4I6KA 1C29A 2YL5A 4MPQA 2OKOA 3FAXA 3C6CA 4LGXA 1BYCA 4JFSA 2OSYA 3GK0A 3UJSA 2PDIA 1P43A 4OHQA 3UCQA 2PWUA 4GY0A 1A5SA 1TPVA 4XD6A 4DRSA 4QJ4B 2FVMA 4KGJA 1ISWA 1JCNA 3UZXA 3MUZ1 5I78A 2ZVIA 1MQPA 3HV8A 4A3UA 3WQGA 3CV2A 4NZ1A 1CXFA 4Q7NA 3ENLA 2OZ0A 1EA9C 1BYDA 1FHDA 1OGGA 5DT5A 3QQWA 3QYQA 2HXTA 4DZ5A 3F4CA 4XBJA 3CHCA 2PDPA 3ZIZA 2G8ZA 3NM3A 1KGWA 1GZGA 3CUFA 4LBUA 5G5IA 1UKPA 3ATYA 3FGCA 1KR1A 4KESA 3ZR6A 1XLGA 1DIOA 4UTUA 3W70A 1M41A 3OBEA 3WN6A 1W3TA 4JIPA 4IFKB 3MP3A 2QLYA 1X6UA 3LCHA 5ABEA 2PUZA 2WJZA 4M29A 2WVSA 3LK6A 3NZGA 3NVDA 4TX6A 4QFUA 3EDDA 5EMLA 4H83A 4IWWA 1EX1A 3QZEA 4S3FA 2B81A 3R13A 2Y88A 4QNWA 2NLYA 4DM1A 3TONA 1E15A 4HPNA 2DZBA 3QKEA 3VNDA 3MZNA 1RXOB 3UZ5A 4O11A 1NQ6A 3G1DA 1JVNA 2DSZA 3E2VA 1D2KA 2FFCA 3MC5A 3IEBA 1RUSA 1YDYA 3TR9A 3TXVA 3CT2A 3UJRA 2WMKA 1B1YA 1IHIA