1S2UA

Crystal structure of the d58a phosphoenolpyruvate mutase mutant protein
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
290
structure length
290
Chain Sequence
VKKTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRASNEASWTQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMKAWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKEIFRLQRDDELVQAEDKYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoenolpyruvate phosphomutase
publication title Conformational Flexibility of PEP Mutase
pubmed doi rcsb
source organism Mytilus edulis
total genus 110
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 5.4.2.9: Phosphoenolpyruvate mutase.
pdb deposition date 2004-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 1s2uA00
3M0KA 2G50A 2XDFA 1O66A 1Z6KA 3KTXA 4KCVA 3E0VA 4L80A 2WQDA 3GQYA 2R82A 4IMAA 2VGFA 3EZ4A 4KRZA 4DRSA 1OQFA 1S2TA 4LSBA 1F3WA 4B5TA 3EOOA 4JPGA 1GGOA 3T05A 1S2UA 4KS0A 1DXEA 2V5KA 4IQEA 2DUAA 3MA8A 4QG6A 2KX9A 2HROA 3E5BA 1A49A 1PKMA 4MG4A 4L7ZA 5TAOA 3EOLA 4HYVA 4L9ZA 1ZJHA 1JDEA 4L9YA 1U5HA 3FA4A 3SRKA 3QQWA 2VGBA 3EOEA 3LYEA 4ROQA 3QLLA 1KBLA 1SGJA 1DQUA 3E0WA 2V5JA 3GG8A 4TV5A 3OYZA 1OY0A 1XG3A 1IGWA 3FA3A 2DIKA 1MUMA 3QV9A 1M3UA 1PKLA 2VWSA 3T07A 4IQDA 2E28A 3N25A 2BG5A 1PKYA 3IS4A 1A3XA 1PKNA 1XG4A 2QIWA 4HYWA 3QV6A 3SRHA 3GR4A 2XZ7A 4MF4A 4B5SA 3BJTA 3PP7A 3ME3A 1VBHA 3I4EA 2L5HA 4KCTA 4YJ5A 5JVLA 3PUGA 4YNGA 1F61A 1F8MA 4IP7A 2HRWA 1S2VA 4QG9A 4QG8A 1E0TA 3R4IA 1F3XA 1U5VA 3G2GA 1O68A 4KCWA 2VGIA 1S2WA 1ZLPA 1A5UA 1IZCA 1M1BA 3BJFA 2VGGA 1DXFA 3T0TA 3HQNA 3HQPA 3SRDA 3VAVA 3U2ZA 2ZE3A 2HWGA 3LG3A 4FXJA 2OLSA 3H6OA 3KHDA 4TV6A 4RPPA 4FXFA 1KC7A 3HQOA 4KCUA 1AQFA 1PYMA 4B2DD 1F8IA 3QV7A 4B5UA 3SRFA 1T5AA 2XZ9A 1E0UA 4G1NA 4WJ8A 4B5XA 2X0SA 2HJPA 3P0XA 3QTGA 1VBGA 1A3WA 4B5WA 3OYXA 1DIKA 3QZ6A 1O5QA 4QGCA 3QV8A 1UJQA 4B5VA 3OQ8A 3M0JA 4B2DA 2VWTA 3B8IA
chains in the Genus database with same CATH superfamily
4XZBA 4LVGA 4KCVA 1QHPA 4L80A 3R13A 4GG9A 4KETA 3RLUA 3CV1A 2PGEA 4HNNA 4IG2B 4UFIA 4XZLX 5H2ZA 3UT0A 2ZX7A 4EF8A 1NF0A 2KX9A 2R1LA 4UQAA 3EB2A 3GXNA 4F48A 3UG5A 4B3LA 4FF5A 4BF9A 1PIIA 2I5IA 4G7FA 3VIKA 1S5NA 1YXDA 3G1FA 4KESA 4NZJA 4QISA 2IXUA 3WG6A 3ZT5A 4N6EA 3WLLA 1N8WA 2YIHA 3AHZA 3DG3A 1CXHA 2OEJA 1ISVA 3POCA 1YHTA 3GHTA 3NL2A 3I6RA 1GOWA 3O05A 2REQB 3M4HA 4YJ5A 4DUWA 2ESCA 1BLIA 4JQ2A 2C15A 4AWSA 2XH4A 2C8NA 2WBKA 3BG5A 1SSDA 5FJPA 4WSJA 4H83A 1LBLA 4RZ5A 3GW0A 1Z42A 1YEYA 3W71A 3FDKA 1KV8A 1ZHAA 2VRQA 3UZ5A 5A94A 1OT1A 1O5KA 1BKSA 2JKEA 3UVAA 3OW1A 2VCBA 3WF1A 3U4AA 3M0JA 1GVEA 3PFRA 1QW7A 4GYKA 2C91A 3AQUA 1AD4A 4IISA 4HPXA 4BWLA 3V18A 3TNOA 3URBA 4B5TA 5D9OA 5CPMA 1QNPA 2GVJA 2H9AB 3EB3A 4INFA 1IQ8A 4K6AA 4N02A 4PCSA 2J27A 4U3AA 3OZMA 1PKMA 3T1GA 1QBAA 4HU3A 1C8VA 2NLIA 4J27A 5LHEA 2BWGA 4G56A 5IXEA 3GB6A 2D23A 3G6MA 1JPDX 5LA2A 2Y8KA 1W3NA 1Q66A 2A85A 2Z1XA 6ALDA 4UTHA 4ZBCA 3DKLA 3TJ4A 2R1NA 4H6RA 3W38A 2X41A 3KVLA 4MWAB 3OZYA 3KL3A 4WIWA 4O16A 3DOPA 1QWGA 1D7KA 2VZOA 5CBJA 1OG0A 4M56A 4DF1A 1BF6A 1R38A 3RX3A 3N73A 4JTAA 4DXKA 3DFNA 4K2SA 1DWFM 4N9CA 2Z0IA 2JE8A 3HGOA 2P5NA 3EDJA 3PBMA 1GYMA 4OU1A 1OX6A 1FH7A 3CT7A 1D9EA 4NXSA 4HOWA 2YX0A 3NOEA 2ZE0A 2B81A 1BGGA 3ZFHA 3I7QA 3N2CA 5AN7A 5I23A 4TOQA 3TN4A 2XJ7A 3NQMA 3GNPA 2HSAA 5CSRA 1HX0A 1SFSA 3IRSA 1KQYA 3FSTA 3WNNA 3PUEA 5XINA 5FACA 2G3JA 4IGMA 3ZZ1A 1K9TA 4B5NA 3VK5A 2PLCA 3MUXA 4XIMA 2OMAA 4IQJA 1ZJAA 3PB0A 4HMDA 1BD0A 3AISA 3BC9A 1AJZA 4PCFA 2EPLX 1RBLA 1RUSA 2ZZ6A 4V1YA 3I6TA 3W85A 5BCAA 1MVYA 3KEHA 3NR0A 3P81A 5EMYA 3H2AA 3BL3A 2YSWA 3LD5A 3A3XA 2DVXA 2OZ0A 1KXVA 1XUUA 1BWVA 3G18A 5RUBA 3VNMA 4D6FA 3QBUA 3OTRA 1E6PA 3FKRA 3NZQA 4XV0A 1X8CA 3FOKA 4U2YA 2XTKA 1TZZA 3CL8A 2BTMA 1VBHA 3QMRA 2ZA2A 1A53A 3ZLFA 3N29A 3UY7A 1J01A 5CCZA 2Y5EA 3H2OA 1SMAA 5ABHA 3I65A 2FB3A 3NO1A 1ISYA 2TYSA 3L66A 4PUWA 2E5DA 4XZNX 4J5NA 3BVJA 3KWSA 3TW9A 2DP3A 2QUNA 3AC0A 1S3TC 5KZ6A 5LKYA 2D1ZA 1KB3A 4MFDA 4HCDA 1OCNA 4U3CA 3R94A 4HZMA 3G0SA 4N4PA 5D9MA 1MXGA 4IIFA 4YVVA 4RDYA 4W8BA 4O12A 2EGZA 4GZ7A 4YTQA 1FA2A 1QOPA 1Y8BA 2NV9A 3TUUA 4H6QA 3P5ZA 2C79A 4EAYA 4LUJA 2D2HA 4K1WA 1FDJA 3BMXA 3CPRA 3WQFA 4LUIA 5A8MA 5CLWA 1M6JA 3DYMA 3WQGA 4XX6A 2HXTA 2PWDA 2V5JA 4LV9A 1TJRA 4FLQA 3IJ6A 1DJGA 5EPDA 1M3UA 1Z89A 4LT9A 1SJDA 2CZFA 3G8RA 1OABA 2CZVA 4NG3A 2R91A 1OD0A 2PUZA 1W9BM 4DYKA 1UWQA 4CQCA 2WSQA 1TO3A 3UYCA 2CEQA 3DFHA 1E9IA 1A5OC 1NQKA 2BSLA 1HKIA 3ARVA 3SY1A 5HJYA 2DZPA 3CAWA 3SY5A 2GSEA 3LG3A 4CN4A 5CC7A 3D0CA 4W7VA 1H50A 3QQ1A 3PAOA 2GJLA 3S6OA 1Q6CA 1XRVA 2YCLB 5U7SA 2VUNA 4XD6A 1HXJA 2DSUA 4FR6A 4L4PA 4C65A 1FDYA 2PD5A 3DFOA 3ANUA 3TEVA 1OCJA 1W5QA 3DGRA 3T05A 3KP0A 4F40A 2A1YA 3VKKA 4PSPA 1H0IA 2ONEA 2H3DA 1LRTA 1QU4A 3DKJA 4GQGA 1A49A 5I78A 4XUGA 1HP5A 3T81A 2YL8A 1OVDA 3IIXA 3S42A 4HHMA 3W74A 1DORA 4YHGA 4C91A 1UHVA 3FSUA 4RE0A 1ONEA 2V3FA 4OIFA 4BA0A 3FS2A 1LT7A 5CPOA 1SZGA 4JX5A 5I6SA 3LENA 1E40A 1TWIA 4ZL1A 4HYWA 1SW7A 1WKFA 1TVNA 3CL7A 2WB5A 3WBXA 3MJMA 3WBWA 3WFAA 3R0UA 5AB3A 3VMNA 3UGVA 5CPLA 5C6MA 4HU4A 5I3HA 4W4QA 3LCIA 6TIMA 3H7UA 1VJIA 4XAZA 1IZCA 4K7VA 4N9DA 1FVPA 5E6ZA 3S1UA 2ZA1A 1GQIA 5C9WA 3DI1A 3MUY1 3LPFA 2PRLA 3GH7A 3WLIA 1JCLA 2C19A 1JDFA 5DCDA 4MLJA 3P3BA 1LJYA 2VUYA 6XIMA 1GJWA 3RGTA 3ZMRA 1X38A 1XH2A 4ZA0A 1XLKA 1GOMA 3KW3A 3W1AA 1OQFA 4DWSA 1EUAA 3TYBA 3S4TA 2CZEA 3CQJA 4LVFA 2EXOA 1F5ZA 4AZCA 3NPUA 4G9PA 1U33A 4D6HA 1E3ZA 3IIPA 4IT1A 4K38A 4MB5A 1J6PA 1H1NA 2OWWA 4WRHA 3W29A 1WX0A 2V69A 3KVKA 1WDWA 3WL1A 3IACA 3UERA 1KTBA 5BXPA 2Z2AA 3AIRA 1C8YA 4X2PA 3UVIA 3LRKA 4MKVA 4LAUA 1P1MA 1XG3A 5FJUA 1VYPX 1REQA 1LQ2A 3BOFA 3PTMA 4B9ZA 1PPIA 4QIUA 1AH3A 4QS6A 3I7SA 2FDMA 4JIQA 4Y96A 4J35A 2YLLA 4HHHA 1DWJM 3EBVA 2GL5A 1IIHA 2D0FA 5LHFA 4K8HA 4NP7A 1TV4A 1DE5A 1QFEA 2Y4SA 3ISIX 4X9SA 3ZXWA 1TV5A 3OBKA 1P0EA 1UWUA 2B4GA 2GGJA 2B7NA 3FV9A 3MUCA 3GNXA 1XYAA 3JS3A 1QUMA 2OT0A 3S0CA 5LIWX 1RD6A 4MZYA 4O8RA 3MMUA 1HL2A 4KEVA 4E4PA 3OOQA 3ZS4A 3H24A 4Q8PA 3T42A 2E6FA 3OB8A 1NWTA 2YZRA 5HINA 1NM9A 5AHNA 1NFPA 4GYJA 4HB7A 4UR8A 5EBAA 1SJBA 4TVDA 2RH9A 2WVVA 2PTDA 1SJAA 1HKWA 5HQLA 4O8AA 5HQMA 1HTIA 1W54A 4RV3A 2VZUA 1ML1A 2Z25A 2R94A 4QCEA 3LXAA 4E8CA 1BPLB 5HQEA 4PSRA 3VGHA 3CNYA 5L6UA 4DAIA 5CGQA 4LYQA 3WL0A 3AMKA 2NQJA 3NZGA 3TOYA 1HJSA 1VIZA 1OFRA 3KXQA 1V02A 1PKYA 4LB4A 4Q33A 4IFRA 1L8PA 1V6YA 2P76A 3UBPC 4CU8A 4LBSA 2J88A 3S1GA 1VBJA 5G1MA 1DTNA 1J10A 3G2GA 2ZTJA 2VRKA 1SQ7A 4TX8A 1G9HA 2XHYA 3CM4A 4IIHA 2R24A 4HZ7A 2NSOA 4IF2A 2YA1A 3K46A 2E6AA 3CWNA 4A2RA 2X7WA 4E3VA 1CGTA 4GA8A 3WK0A 3B9NA 1BYDA 1WDSA 3DX5A 2W66A 4NQ1A 5H8UA 1HZYA 1EDQA 3UGRA 2CLOA 5EMLA 3RDKA 1H51A 4W5ZA 4I8DA 5FJTA 3C61A 5TF0A 1G7UA 4HA0A 1H5YA 1TMLA 4B5VA 3IK4A 5C70A 2UY3A 3UWZA 1UMYA 1VC4A 2I9UA 3EPOA 4IUOA 1UWSA 4D8AA 4IFKA 2Y7EA 5EYWA 3MQTA 2PE4A 1T8XA 3AHXA 3VDBA 4P61A 3QPEA 1KRBC 4YWIA 5U4NA 3GDKA 2YA2A 4WY0A 3S3GA 1EYWA 1QCWA 3KRSA 1UOZA 3ES8A 4R9XA 3F2CA 2OLHA 3UYIA 4AFYA 1Q6EA 3PG9A 1YTKA 5D33A 3R7MA 4GC4A 4L61A 5C2CA 4IL0A 4C6QA 3ZR4A 5FJIA 4TMBA 4JL1A 1W91A 3W2LA 4EXQA 3PAJA 3CAQA 2DW7A 6XIAA 4GI4A 1HGWA 1UP2A 3H53A 5SWUA 5HXMA 3LGDA 4CCZA 2OTDA 4MM1A 3EDDA 1B31A 4UUIA 3UXIA 2XIQA 1E6RA 6ENLA 3MVIA 3M0VA 3TC3A 4CD5A 1US3A 2ZXQA 3ABXA 3HU7A 8XIMA 4NASA 4GIEA 1U30A 1E0TA 4ZQRA 4PTVA 1M53A 4Y9MA 3ANVA 5HBFA 3KUMA 4O0ZA 3NQVA 1DOSA 4FOUA 5I3GA 4BI5A 4AZ7A 4MJ4A 2NVDA 2FH8A 3LPOA 4O10A 2CWNA 3I4KA 2EG7A 4U4MA 4BQ2A 3M47A 2JEPA 3QZAA 4L9XA 4JFTA 2BHUA 1ZRQA 3RM4A 5AKQA 3NUKA 4XZ9A 3MP3A 1D3HA 4K36A 1YDNA 1T41A 1H09A 3UP8A 3W7LA 1PHWA 4KIRA 2EF9A 3O6DA 5TAOA 2WVSA 3RILA 2CYGA 1ZJHA 3EKLA 3TYEA 1PX3A 2ISFA 4OKDA 4JKKA 4DJFD 1R5YA 3FJLA 1BGAA 4TVUA 4DLFA 5BRQA 4M0XA 3SM0A 1Q8AA 4BFAA 1PCKA 2BMBA 5CSYA 2V5LA 4I90A 1H11A 2NUXA 3CMJA 1AZ2A 2V38A 4L64A 4HA4A 3RYSA 2ZXDA 5KEZA 3CZGA 1LWHA 3TJLA 1V77A 4AIEA 4UTWA 3PZMA 3M64A 3VIFA 5K2ZA 6PTDA 1DWGM 1KFWA 3UA4A 5FESA 3UR7A 3FNDA 4HGXA 1ECEA 1H7NA 5DBUA 3G5EA 1HP4A 2Z1SA 3UETA 5F2GA 2VYOA 4CNUA 1B1YA 3AMLA 5CXPA 4Z2IA 2GJRA 3LSBA 5D09A 2BY1A 4MJMA 2P1FA 2QJHA 1LTDA 2PDGA 3A5FA 2GJNA 1OSEA 1S2AA 2VX5A 3FAWA 4QR6A 2UY5A 4MMWA 4PRWA 5I07A 1J6OA 3M0XA 2VOTA 1QRQA 1B2YA 2HVMA 3W7EA 1XYBA 1OIFA 1XLHA 3E0FA 1ZALA 4MB1A 4Z2KA 5CQ1A 4M1BA 1GVFA 4N0RA 4FLRA 1TPWA 3W2UA 1TVLA 4JXCA 4B91A 3WK2A 4BY3A 1S2UA 4CD4A 2OXNA 4UFKA 3S46A 1E55A 4AAJA 1K77A 2XISA 1B9BA 1ZCCA 2E9MA 3TU9A 3UFYA 3W23A 3PF3A 4KBXA 4RL3A 2J75A 3BOLA 3ZWSA 4AY7A 2VOMA 1J2WA 4O11A 1EIBA 1UYQA 2VMFA 3GC4A 1TVPA 2ACRA 1KD0A 1VJZA 1IZJA 2ZICA 1TTJA 2Y5JA 1J0JA 4NAFB 5G5IA 3ITVA 2CNCA 4RW5A 4JN8A 3NM1A 2Q09A 4KFPA 4K7YA 2GLKA 2VM8A 4PTNA 3P14A 1ICQA 5IFTA 2X1IA 1F3XA 1UWTA 4CNOA 3UXLA 3WD0A 2ZE3A 1ITCA 2HWGA 2VFHA 5I5RA 4F8XA 5A8QA 4UFMA 2GVGA 2VL4A 9CGTA 1GVIA 4JIIX 1NOUA 3ZWTA 3S9IA 3L12A 3RITA 1DIDA 1W9UA 1UJQA 1XCXA 2DT2A 2IS7A 4GYPA 3W1NA 4AISA 4R27A 5CSUA 1HL9A 2J78A 2H6RA 1Q4WA 3O9NA 2X30A 1YX1A 4P7OA 4EANA 4NYYA 2GGEA 2XWEA 1YNPA 1XYZA 3P93A 1V0LA 1XLEA 4US5D 3UWEA 1U2YA 3T08A 3BK0A 4UCGA 2QS8A 3QQWA 1FHUA 4PE8A 5BU6A 1PIFA 3LOTA 2PZ0A 3AYRA 3QY8A 1XKYA 3R58A 1PO9A 3C8FA 4OOZA 2VEPA 5ABFA 3W70A 3RAOA 3AZRA 3PTQA 3HMJG 1PTGA 1R46A 3I68A 2QIWA 1F4HA 3EGJA 3R25A 3GXFA 1HJXA 2WLYA 5DT5A 1CLVA 5M1TA 2H3BA 2R6OA 1XI3A 5DT7A 3R2GA 3MKKA 1DXFA 3HQPA 3PZIA 5BYWA 4I6VA 3S47A 3G0XA 1F2JA 1QTWA 1QI4A 3SRFA 3HV8A 1V6WA 2XZ9A 1KTNA 1MI3A 1FWSA 4Y9NA 4PZVA 3CAVA 3CQHA 2OSWA 5F4WA 2ABBA 2Y2WA 4O50A 1Z6KA 2PU1A 4AD4A 1US2A 4O0QA 4GUJA 4XIAA 1VH7A 1Q5MA 3B8VA 3SN1A 4P5UA 3M0MA 4UR7A 2FVKA 1TUXA 1ONWA 4HKPA 4MJ2A 2QDEA 4HP5A 4CCDA 5F1UA 1UR8A 3W6YA 1JQVA 2IPFA 5CJMA 2ZYFA 3HTWA 1KWGA 2I5QA 3XISA 1YLVA 3LQLA 1OYAA 5ENLA 1VR6A 1CENA 2ASHA 1XISA 1XCWA 3L23A 3GE7A 5AVHA 2YGYA 4C6IA 1GOIA 3HV9A 1EOMA 4XVDA 4IQDA 3GVVA 2IPGA 1LROA 2GGIA 3BW2A 4HIBA 3W25A 4AX7A 2VT0A 1R9ZA 4AH7A 5I0DA 5A69A 4XAFA 3B3DA 2G97A 2J4GA 3MT1A 5GNYA 1N7KA 1OC5A 1UH3A 1BYAA 3FLUA 4M6PA 5HUOA 1QXLA 4E8GA 1TTIA 1XIDA 2ZX9A 1XWYA 5LIYX 2VEMA 2OFJA 2QVHA 4E2VA 3DCPA 3WEZA 1I4NA 3NGJA 2QCHA 4LNCA 3UWVA 1I0DA 2PLKA 1EWEA 4DBEA 5DFAA 3IIVA 1VLIA 1FX6A 1JAEA 2RDUA 4S2CA 3RMEA 1IR1A 1PTAA 4JTQA 4MZ8A 5DANA 1EPVA 2QYGA 2PGFA 3PUDA 4RLIA 1T0OA 4IZGA 3KBWA 5JIWA 4ADTA 3ARYA 1C7SA 1C8QA 4RE4A 4Z0JA 3UJFA 3EWUA 3C3UA 1Q2RA 3VNZA 3OP2A 3LY0A 3V0SA 3H4XA 3THCA 3WQCA 2I14A 3FXGA 3GKAA 3SCTA 3IUHA 3RJYA 3ZR5A 4HPHA 1A3XA 2W4XA 3BLPX 1JDAA 2WSYA 1XLFA 3M7WA 5J5DA 3CHCA 4YNGA 3RLHA 3UG3A 5DY3A 3R4IA 5HMEA 1KWKA 4C6FA 2QGYA 3TMLA 2YR1A 2DJLA 2F6KA 5EFFA 3U2ZA 4I3GA 3AZTA 1XH0A 1VP5A 3V4BA 1UJPA 4LUSA 1WUEA 3RNDA 1T7LA 1BRLB 1W1PA 4S39A 3DFPA 3SCWA 4HQVA 1FWHC 2QCDA 1QPNA 2WMJA 1HKKA 2ADAA 3TQPA 4XK2A 5EB8A 3BARA 1RV8A 5AY7A 1G4EA 2DJXA 4ZOAA 5GJNA 3OZOA 3SURA 4LSBA 2QCFA 1MEWA 3STEA 1JPHA 4GH3A 2VD9A 3DFQA 4NZFA 2JEQA 1XFBA 2HE5A 4LOCA 1M9HA 5DF0A 4EF9A 2XVPA 2WYSA 3TR9A 5I2UA 4QQ3A 4AMCA 1AUSL 3L5LA 3TZFA 2Z28A 3SSJA 2WZIA 4FR1A 2OG9A 3NQAA 2PDXA 1V4YA 3CU2A 2NX1A 2VURA 2G0WA 3FK4A 4XSMA 1X6NA 1UR9A 4G1KA 1BVNP 2DSWA 5ABGA 5IOBA 1GEQA 4B5SA 1DKWA 3ZOAA 3W73A 1R9YA 2WNWA 3LM7A 1YDVA 2ZUMA 1XLAA 5CLTA 2PP0A 2XH2A 1AW1A 4NNBA 5AC6A 1S39A 4JKMA 4JD4A 1PX8A 4DJED 1JULA 1VCFA 2YFOA 2D3LA 2VFFA 3GTFA 1PBGA 3TQVA 5AHIA 2YYTA 5K4XA 4YYCA 2YBTA 1IV8A 3EDEA 3ARRA 3TH6A 1A0DA 3VYLA 1Z8AA 1ZPTA 3GNNA 5FEXA 2JKPA 5C0QA 2IXVA 3NTYA 4JNYA 5CH9A 5M17A 1Q6QA 4MG4A 2QW5A 1Q85A 3UXDA 2WZHA 4PEKA 3I6EA 4W84A 2NWSA 2J7FA 3W86A 4Z2JA 3VKJA 1KM0A 5JU6A 2XIIA 2ZZ4A 3QJAA 1KM1A 2BVYA 4OGZA 3C5QA 4NJGA 1W8GA 3TONA 2WMKA 4QNEA 4OBRA 1MEHA 4MWAC 3NXFA 4UQEA 1PS9A 3K8LA 4HHPA 4QDPA 1LYXA 4U5KA 4P8XA 3SUUA 3VOHA 4O54A 2GDVA 1SFTA 2BODX 3VNKA 3UXKA 3ABZA 2WHKA 3KBMA 3EXTA 3OLGA 4PUJA 4Y8EA 4BEUA 1E5NA 2A7RA 2CKSA 2NT0A 3FEMA 4K37A 5E9AA 1KXTA 2QV4A 1WDQA 5MHBA 2P50A 1JYVA 4ZXOA 3N2OA 4D6CA 3FHAA 4JEJA 5CGMA 1ONRA 2YBVA 3CMGA 2ZDRA 3Q37A 5G4WA 3C8NA 1NELA 2BZNA 4G2DA 4GOAA 1CXIA 1UR3M 3BAXA 2C71A 4UZUA 1K70A 2ZA3A 1UPMB 5D9PA 2ZRWA 4Z1DA 4A8NA 2DEPA 3A47A 1XD0A 2Z00A 5HR6A 1F6KA 1N55A 1UWRA 3KBSA 1JDCA 1R7OA 3NXLA 1C3FA 1HN1A 2CU0A 2B0MA 2HVNA 3IARA 2V5DA 4P2VA 3S1VA 3AS0A 3W2KA 4PMJA 2VC9A 2VGBA 1H49A 2ZZ2A 1DWIM 2GOKA 3LCWA 3QFEA 2A3BA 5DY2A 1E0VA 1EL3A 3TSMA 5GNXA 3RG6A 4JZ5A 2WZMA 4DBUA 1GEHA 5CZKA 3HM7A 3ORWA 3H22A 3VX0A 2XGZA 4MOZA 3S2CA 3U9IA 1YIXA 1POJA 1QI5A 3G3MA 2Z1KA 3EWXA 2YBUA 2W79A 2BOFX 4MUZA 1TZ7A 1OZMA 2CXGA 3M0ZA 1FH9A 5D38A 3LHZA 4JIRA 1DQXA 1LLOA 3QF0A 3ITLA 4A8IA 1KBIA 4H2CA 2WJEA 1AQFA 1OM0A 4JR5A 5AHEA 1UKSA 1CYGA 2Y8VA 1B90A 3M0HA 1QAPA 1RCOB 3DEQA 1EBGA 2GWGA 2GQ3A 4IJCA 1M7XA 1D2KA 5HPOA 1VENA 2EPOA 1DEDA 2PGWA 2R82A 1E6ZA 1L6WA 2A7NA 3WLSA 2ZUNA 3GO2A 3TYZA 2E40A 4OVXA 1AZ1A 1YKWA 3BQ5A 2PF8A 3C52A 4ICNA 3G6LA 2QUMA 5HNNA 1CNVA 2BP1A 2GK1A 4M6VA 4UZSA 4XD4A 5I03A 4KPLA 1Z41A 2CHOA 1JDEA 2D22A 3VZYA 6A3HA 3VA8A 3EKGA 2OZ8A 1DIEA 1WKDA 3RU8X 2QCNA 4X2RA 5FL1A 4R34A 3EWWA 3NFUA 3CIVA 4E6MA 4AY1A 4PMQA 1WBHA 1CGWA 4EVZA 3M5VA 3CZLA 4LNYA 2VVSA 3DC8A 9RUBA 3PZUA 1AH0A 4L1XA 4ZB0A 3LI1A 1ME7A 1V0MA 2ZZ5A 1OK4A 1UIOA 3NQBA 4HSOA 1U83A 4Q22A 4CEUC 1XBXA 3P8JA 3S5OA 4TVCA 2E1DA 3GHRA 1R30A 1J9YA 1F73A 2CC0A 4ZE4A 3U4FA 4ZEPA 2VEKA 1K03A 3RCMA 4V2XA 4ZQMA 4WSHA 2V9DA 4EXAA 5AFDA 1R87A 1EC8A 2J7BA 5CG0A 1XRSA 1Q6DA 1RQEA 1RLDA 1W9VA 4FXRA 3VGBA 4IX0A 3AHVA 1JCNA 1UD5A 1V51A 3ALGA 4GQQA 1OB0A 3EXSA 1JFXA 1P1XA 1KR1A 1ICPA 1VFFA 4B16A 4H9MA 2WVUA 2FJUB 2BHZA 3C0JA 3WLQA 1P6BA 1S2TA 5A2CA 2R14A 4LAZA 3LGEA 3H26A 4WCJA 2FPTA 4WK9A 3LHVA 3N17A 4IMCA 3E5BA 3G1YA 6REQB 1LP6A 3W24A 3W7NA 2TODA 3W72A 4NHVA 1AW5A 3BLEA 2YCKX 2ZRYA 1KBLA 2A4AA 1W2VA 3E02A 4MAVA 3MSRA 1P7TA 3UZZA 3H55A 2YKKA 1IGWA 2FZNA 3QR1A 3W76A 3CH9A 2IPWA 2PDYA 5HMFA 3EB4A 4P8UA 3TVAA 2CZDA 2PMQA 2FMNA 1TG7A 1P43A 1V08A 1UH2A 4NX5A 3WQ8A 1UKTA 2AL2A 2PDLA 4R33A 3QHMA 1XKJA 1KLYA 5CZJA 1XIHA 1XPYA 3KHDA 1GQKA 3NAVA 4C6OA 3REQB 1HJVA 4I7VA 2O56A 3FN9A 4CCEA 3QGKC 5HR7A 3WBAA 1IEWA 5M3WA 2Z1BA 3BCJA 5I24A 4IL2A 5PTDA 4C1NA 1UKPA 1R9XA 1HG3A 2FYMA 2BS9A 1KLZA 3E6EA 3T8QA 1NJJA 4IFOA 3TDFA 3PBYA 3B0UX 4JFWA 3CIWA 3DUGA 4KT2A 3L2IA 2ACQA 1JCXA 1XDMA 3WLMA 3KE0A 3SIMA 1TCMA 1JZ4A 1PDYA 4IIBA 1XLBA 4DZIA 3AWNA 3ZSTA 2XH7A 1HQTA 4U33A 4WDTA 3KBNA 3EMQA 1QK2A 2NLYA 4CNNA 3ARQA 2UV8G 4WGXA 4QXIA 3WD1A 3VNIA 1J18A 2WK2A 1EXPA 4X0NA 4DWSB 1MW3A 1YYAA 4BCEA 4ATDA 1KCKA 1NP2A 4DNMA 1OX4B 4LV4A 2QJMA 1GPWA 1LCOA 1IEVA 1S2VA 3H54A 2W5FA 5DXYA 2PTYA 3P84A 1H1ZA 4XTIA 1PB0A 4NJJA 5HNRA 1O12A 1XJBA 3JZEA 4ERAA 2VI0A 2BX7A 3O6AA 4YS1A 4NILA 1LDCA 5LSMA 2XIBA 2ZOXA 4W8AA 2PEVA 3T0AA 3SBFA 2W92A 1JZ5A 5CC3A 4DJEC 3KAOA 3GFYA 1W3KA 3N12A 3AIWA 3E96A 3BSGA 2DZSA 2NX3A 1XIBA 2DT3A 1GVRA 3K30A 2G3IA 1SZNA 1LUCA 2ISWA 5LGXA 4HOXA 3P60A 3RF9A 5JH2A 4XD3A 2DZXA 3V1HA 1K3UA 4A21A 2BBFA 1UR2A 2FHFA 2X8RA 3KHJA 2GQ9A 5CZTA 3GIPA 4EPEC 5HNUA 1HFBA 2OX1A 4R53A 2PF0A 1OC6A 2VJXA 2JF6A 4GLEA 1BQGA 1T40A 5D2WA 2RJGA 4EX4A 2WHMA 2WVVB 2OCZA 5BOFA 3AZSA 3LZ5A 3QV6A 1KM3A 2YL9A 4H00A 3CZKA 4HTBA 4JCMA 2X0YA 2L5HA 5CPTA 3M0LA 4NI8A 1OFQA 4O15A 3OQEA 1UG6A 4TUFA 4E3TA 3RLGA 3NA8A 3ENLA 2XM2A 2TAAA 3R12A 3MP5A 3B9OA 4XISA 1H7RA 3GFXA 3KBVA 1C8XA 3ZT6A 1R0MA 3SCVA 3AICA 4FMVA 4H01A 4NU7A 4Q8MA 3OG2A 3EX4A 2VKZG 3BTNA 4KGLA 3OA3A 1JUEA 3MANA 1A4MA 3ITCA 3CMFA 3TFCA 2VR2A 4RUBA 1LWIA 1V6TA 2QKFA 1EBHA 3ARPA 1OGGA 5A6MA 2Q01A 3TJXA 1VEOA 2YDSA 5E0FA 2INFA 5CPNA 2ACUA 4I9TA 3U5UA 1SUXA 3T4CA 3IJ8A 4UTIA 3IWPA 4GBDA 3AXMA 3F1QA 1A3HA 4M19A 4GINA 4YHEA 5HPCA 3IANA 4W9TA 2WV8A 4PUKA 4GJJA 1HO4A 4NXKA 2GQ8A 3KOYA 1Z48A 1Z44A 3RK8A 4DB7A 1QNSA 4PTWA 1J12A 5I06A 3BZJA 1W37A 1DBTA 2PS2A 2OB3A 5BXTA 1UW9A 2EPMX 4AC7C 4I5XA 4Q4SA 3BPWA 5AHLA 1RY8A 2IKIA 3T09A 3EAUA 3ZSSA 3TTQA 2VQUA 2ZZ3A 4B2DD 4HMEA 4JYFA 4JFSA 4S3JA 5M2FX 3F7JA 3PPGA 4A4AA 3SO7A 3L4WA 1ALDA 4FP1A 3B8UA 1GOKA 4LAKA 1FCVA 1D3CA 3MHFA 1KO0A 4AEEA 3WLNA 1DHKA 3JU2A 3GH4A 4QLKA 4M81A 3WMCA 1B3WA 2DQXA 2I1OA 5A8GA 3SCOA 1BSIA 3VABA 4E4FA 4F66A 3W1LA 3KS5A 4QE4A 3CT2A 1MZRA 5HAOA 3BOXA 4WKFA 3B0XA 3LRMA 2PRMA 4L1WA 4YMZA 1MW0A 2WM0A 4ZODA 5KSWA 3OG3A 3VM7A 4XBSA 5CBIA 3WF4A 3IPWA 3B40A 3KLKA 5REQA 1NDVA 3CWOX 3MI3A 1GVOA 1R85A 2VDHA 1QI0A 4AF0A 8XIAA 4LY4A 1B57A 3UR2A 3GXTA 3NPXA 2DT1A 1FWIC 3G1DA 4LYPA 4ZSUA 5T8GA 1IXPA 3K4WA 1GG0A 4Z1AA 4GXMA 3DYOA 3PG8A 4HN4A 1I1WA 4NRSA 3LK6A 3AXXA 4EKJA 1VFHA 5E93A 3AS3A 5D8ZA 4O17A 3CS2A 3O6YX 3U2CA 4IH3A 2EKGA 2QQ6A 4Q7NA 1OFDA 1ICSA 4AQLA 1J5SA 2FVMA 3W4RA 3W2JA 3EWDA 1JPMA 3OQ8A 5IRPA 1L2QA 1W5OA 5G4EA 2C7FA 4O13A 3MBDA 1E3XA 4F4RA 4PBFA 4UTUA 1JR1A 2CLKA 4PFHA 3NQ6A 1XINA 2WWDA 3UR5A 4QG6A 1SSGA 3MP4A 5T9CE 5E0CA 2ANUA 4DO6A 2VXNA 2YL6A 1VZWA 2HNEA 4H19A 4C6DA 3WQ6A 3C3NA 2C0AA 5M03A 1TMHA 1UKOA 3M0YA 1HGYA 2Q3RA 4AZ6A 3A21A 1B30A 3SGGA 4AMAA 1DXIA 2YFNA 3AU6A 3GBEA 1YXYA 4RKAA 3QH2A 3DECA 1VFTA 1BG9A 4IOTA 4D9PA 1YTEA 5GNZA 4GFSA 2GVYA 2NW0A 1N82A 1WQ5A 1CCWB 4RPPA 2HTMA 1DQWA 1AL8A 1X8FA 3IVUA 1T5AA 2HVOA 1D3GA 3L5AA 4B4HA 1E72M 3T6CA 1EEXA 4UNLA 2VC7A 1HKJA 3QOMA 1G0CA 1RP8A 2X09A 5IBXC 7REQA 4JN7A 1BKHA 1BYCA 4FA3A 5A8NA 3PWIA 1DJWA 3MUIA 3BANA 2CIPA 1ZQ5A 7ENLA 5EA9A 1UUOA 3UZJA 2V82A 3EWYA 1EEPA 1W3IA 3S6TA 4CN1A 1ZU8A 3IGHX 4NSBA 5A6BA 1GHSA 3VTRA 2CCRA 3TCEA 4AC1X 1XC6A 5BXSA 4E0CA 1E70M 2VCCA 4MUPA 1IEQA 1M03A 4ZQNA 5FOOA 5DCEA 5D4YA 1PZ3A 1VPYA 1XSIA 1SU5A 2QCCA 4JGDA 4V28A 2YCEA 1UA7A 4C1LA 1EJSC 3BURA 3HMCA 5BU9A 1GOQA 5HWNA 2VC6A 1XG4A 3KRBA 1S1RA 4C1KA 2CBJA 4ONVA 4OT7A 1RHCA 4D2JA 5T26A 3PZOA 3AUJA 3QC3A 3B06A 2FZMA 3BGGA 1CGYA 4WKAA 3HURA 2MNRA 1IE7C 1Q7MA 3IAQA 2G41A 3HQNA 4XZHA 9XIMA 3U5YA 1XBVA 4E38A 3KOXA 1MWOA 4G7EB 3HB9A 4I9JA 4D1IA 1TPEA 3SW6A 2A3HA 3WQWA 1UWIA 3HF3A 4IG2A 1OINA 3FVDA 3WLTA 3HFTA 1FWFC 4AY8A 1U1JA 3QYQA 3AYSA 2W62A 5T91A 4B90A 1I60A 3URNA 2Q8ZA 1FKXA 3FIGA 1EP3A 3H8AA 3GTIA 1E4NA 3QW3A 4JQ4A 1EO7A 3MO7A 4UQCA 4ZB2A 2A3AA 1FCQA 2WJDA 1J5TA 1XW8A 3CAKA 3UW6A 5LIKX 3UJRA 2FZDA 3N1AA 3VDGA 1O1HA 3KZPA 4FB7A 5C7VA 1QPQA 3LV6A 4KKXA 4P8WA 2REQA 3QVQA 4K8EA 2NXGA 2QULA 4WZHA 4GY0A 3LSCA 1XICA 4JEQA 4B3KA 4FIRA 1F8MA 4IP7A 3UXAA 4C6KA 1RSCA 4J3VA 5K9XA 1FY6A 1RXOB 4JN6A 3WEMA 4LGXA 3CB3A 2EG8A 3NO3A 1PUDA 4S3EA 4YCOA 1WNOA 1BXNA 1IT8A 3W7QA 4OE7A 2IW0A 4IIEA 4DM1A 4UFJA 1VBGA 1W9DM 7A3HA 4QE5A 2WSKA 3RUBL 5E0KA 4KRTA 3PJXA 3NZ1A 4CNSA 1E43A 1MQRA 2BXYA 4JY8A 4CU6A 1YE4A 1YDYA 4J3WA 4XZMX 4LFYA 3UJSA 1T99A 4AD5A 1Z69A 3RRAA 4H1ZA 4PYSA 2XSAA 1Y65A 3SUWA 2FVLA 2YZ5A 5A2AA 1QI3A 3EOSA 4ZOCA 4YVPA 3A22A 1VCGA 4M8UA 3W84A 3VGFA 3WMLA 3MKCA 3SN0A 5DRIA 3ZO9A 1CLXA 2ZWYA 1L8NA 4UQ9A 4GVIA 5BZAA 2IUZA 2Y7GA 4GUHA 1QPOA 4MWAA 2OWCA 4DIAA 3QR0A 3A3HA 4W5UA 5JBEA 4A29A 4PH6A 1ZNNA 4HPNA 2F84A 1G7VA 2CESA 3QTPA 3DZ1A 1SO3A 3MMDA 2PDNA 4MF4A 4PMOA 2UBPC 2WZTA 3B4UA 1LORA 5FJJA 4GYFA 5H8PA 4N7QA 2BY3A 4Z42C 1JYNA 1TR1A 4J3XA 4LQ1A 2YXXA 3ARZA 3LX9A 3VD3A 2HXUA 3NVDA 1H7WA 4C5ZA 5C9ZA 4GE8A 1L9WA 3IEBA 3VINA 2E09A 2E77A 4GXPA 4POCA 3DG7A 5EBUA 4MY8A 4WR3A 2B31A 4FXSA 3N3MA 1VYSX 2WPGA 4LUSB 4A2SA 3TTSA 1Y5VA 1NOWA 3GH5A 1AG1O 4L9ZA 1ZAJA 2XGIA 4IMEA 1B4EA 2QCDB 1UR1A 4NAEA 4V27A 1BXCA 1QASA 4YLWA 5FSEC 1WXZA 2Z27A 5LA0A 4DQWA 2P3EA 2Y63A 3RX4A 2BASA 3NYDA 1CX9A 1W32A 2HISA 3L2MA 3PZGA 1LBMA 2AQWA 3P6LA 4PEEA 4CQ8A 1TFVA 3R43A 3BAYA 5BRPA 4KWWA 3QKZA 1A5BA 2YOCA 3GK0A 3TAOA 1SFLA 1DWHM 2QPUA 2NX9A 3RCYA 3VUSA 1OWQA 5LIUX 1IZKA 3RIKA 1X97A 1W1VA 3APYA 3H2NA 2VGIA 1GOOA 2BB0A 1FWWA 1FTXA 5LXEA 1W3TA 1WDPA 3G1SA 1WBJA 2WCGA 3SECA 3W88A 5E5CA 1M7PA 4AX6A 4J28A 4LVAA 3V5CA 4RE2A 3RLVA 3G1XA 2WZEA 3QY6A 4A3YA 3GR8A 1ODZA 2W9MA 1V79A 2XIMA 4DBWA 3N2MA 2ZDSA 2VC5A 5E6YA 2WKGA 1XM3A 3E0IA 3B0YA 3VO0A 1ZENA 3W7PA 2QDDA 2I16A 3AIUA 4UIOA 3DFYA 2PB1A 1Q8JA 1X1ZA 5A95A 2V0TA 1DPMA 3I10A 1A5CA 1EYEA 1JRCA 4HMNA 3PR2A 3Q58A 4QEHA 5DMLA 1TX2A 3IJ7A 4C7GA 3EX3A 4RXFA 3ITYA 3KVJA 1QW9A 1TV3A 4AYSA 4EOUA 4HNUA 4CN6A 4F0RA 5I02A 1KBJA 3FYOA 3VCNA 1PAMA 2INZA 4DYJA 3PBUA 5DQPA 1EFZA 4QFUA 4P7QA 3FA3A 1GQLA 2BGNE 1AQ0A 4EACA 1W0MA 1ADSA 1SMDA 3IS4A 4YVXA 2ZRXA 4UCFA 1GW1A 3ITGA 4O52A 3OGSA 5FJOA 5GJMA 2NV2A 3M5YA 2X0HA 2Y85A 2JF7A 3WEOA 5CGTA 1FWGC 1R3SA 1R2RA 4I7WA 1G67A 1FWAC 1P0NA 5GJPA 1FH8A 3THAA 2XIOA 2ZC8A 4XG1A 2J8GA 4WJXA 1YPXA 1Z32X 2YCLA 3S2JA 3B9AA 3LHYA 2E7FA 2VD8A 4NIRA 3RPMA 1F76A 5TQLA 2X0SA 2CXEA 2QR6A 3C86A 5A5WA 4HD5A 3WK3A 3N34A 1T96A 4W93A 1BVZA 1O66A 3U8GA 2O4QA 3IJIA 1EJVC 2CBIA 3BCDA 4Z1CA 2FGBA 4GCAA 4MYXA 5BXRA 2OR2A 4HSHA 2WHLA 1PTDA 4A22A 2HE8A 2BV9A 3TLQA 2AGTA 4H6EA 3AMGA 2QZRA 3RX2A 1LT8A 4QS5A 4J2PA 4JTSA 5DLCA 1FP8A 2WNZA 2PODA 2PZNA 1B3XA 2Z7GA 1UROA 3DG6A 4AEFA 3JW7A 3EYPA 3L4YA 4OV9A 4IJRA 3OYZA 4FK9A 3TN3A 5K7JA 3D3FA 3AS1A 4PMDA 1GZ1A 4X60A 5A6JA 2VX6A 3E2SA 2BLEA 3BJSA 3QY7A 3WJWA 4J3SA 4ATLA 3T7VA 4LUYA 3MWAA 7ODCA 1A5KC 4GZIA 1BHGA 3QC0A 1C92A 2OX4A 3N9KA 4FXJA 4M7TA 4LVBA 1DJYA 3KS6A 1W1YA 1XGDA 4I5RA 3RO6A 3SI9A 3B8WA 1OYBA 3LDVA 2PWFA 1Q13A 2VEGA 3TSDA 4DEFA 1UR0A 3FJ6A 3HGJA 2DZAA 1LF1A 3WD2A 7TIMA 4MGGA 4QGCA 2J8TA 4HNVA 3CPUA 1YXCA 1UZ1A 2QPSA 1DJQA 3DESA 1ZB5A 4AD1A 3NNTA 1FRBA 4F9JA 1ZTVA 2C16A 1OD8A 1EOKA 4FAMA 3B9DA 2HROA 3VOFA 1CGXA 4HCLA 3PNUA 3FA5A 3BO9A 3KRZA 1QNOA 3JZUA 4JOMA 3GNDA 1Q6OA 4YXGA 1TB3A 4JNZA 4RZ4A 2CHRA 4MPKA 1V7AA 2XFWA 4PB3A 4EPKA 2CBUA 1ZJIA 3VGGA 2OGYA 4REQB 3A12A 1JF6A 1WO2A 2GK1B 3ZYZA 3N6HA 5F2IA 4Q4OA 2RUSA 1FUYA 3DHFA 2RDXA 4RK8A 4WF7A 2PU0A 1XRTA 1VGAA 4WXYA 2V5BA 1SM9A 1J0KA 3E1F1 3MKVA 1VAHA 1UQZA 3BJFA 3GVWA 3R8RA 4XQ6A 3OLIA 3LUTA 4LEQA 1JL8A 1W9PA 4O4WA 1OFEA 3M9YA 3ONBA 4DJEA 3S2MA 2WANA 1J0IA 3WY1A 4PTDA 3HIJA 5EFDA 4ADSA 3QZ6A 3H4GA 1O5QA 4M3PA 4HK7A 3L4VA 1BSLA 4NX0A 4FNPA 4AVOA 1V3LA 3N04A 4U10A 5HA7A 5BRBA 4KRZA 1SR9A 2V2DA 1IXQA 1TWDA 3GXMA 4M80A 2PCEA 1Q63A 3KL5A 3WKZA 4HK6A 2W6RA 5B7ZA 4IGSA 4OUIA 1Q4NX 3SIZA 4PUNA 3GTNA 5BWFA 3MCNA 3VIGA 4MAZA 3ICJA 3DAQA 4WXZA 3S5YA 2Y0FA 2YB1A 4DUVA 1KBBA 4NRRA 2B7OA 4OFCA 5A6SA 1F74A 3WQOA 4QQUA 4EXBA 1W9XA 2MUCA 3RPTA 1NVMA 1VFUA 3E0WA 4A8RA 4I7UA 5AHFA 5DRCA 4O4VA 1P0DA 3FW6A 1VFSA 2BGQA 3EWBX 1QI2A 1ZS2A 3H2MA 2VEFA 4JDBA 1CXLA 2BG5A 5A8OA 3A4XA 1CI1A 3SRHA 3E2RA 2XFFA 2PPGA 1UC5A 3ME3A 3BQ6A 3VOGA 1UD8A 4EPDC 1OFOA 4QG9A 3VX1A 4OOUA 1TJ1A 1SW3A 1WOBA 3W1UA 1E6XM 2PP1A 5D8WA 5AC7A 5C9XA 5HJLA 2E5BA 4AWEA 3T0TA 1RPXA 2QJNA 4GUFA 3Q2DA 4XD5A 5F4XA 4P7LA 3GAYA 2VZSA 2GDUA 3CO8A 2ICSA 2DY3A 4FF7A 4MNMA 3C4UA 3W1RA 4ZTYA 4KEMA 3N19B 4ZQCA 3N11A 3SZ8A 3SJ3A 3EA3A 5IFPA 4X22A 4IPNB 3OGRA 1YQ2A 4UTJA 4FOKA 1XFCA 4MDPA 4LYRA 4QTGA 4A3UA 4D6EA 2ZUVA 3WUBA 3EOLA 2BFGA 3CTLA 3VMPA 1OYCA 1MW2A 1XHGA 3CUFA 1PWLA 4A6GA 4KEZA 3T2OA 1G94A 1Y0EA 1Z9AA 2HCVA 2IKGA 5HUPA 1R6WA 1XXXA 2EPKX 1FFRA 4FPSA 3D46A 4XSLA 2D73A 4TXEA 3W7KA 3W2MA 4TO8A 3FJ4A 3ID7A 4PR4A 3WQ4A 4BK9A 5C7HA 1NU5A 2DZUA 1H7PA 4JICA 3UESA 2F7FA 3N4EA 3CASA 1PE1A 3WNKA 4LAMA 1EIXA 2Y24A 5CPQA 3EDFA 5FF4A 1H2JA 3LTYA 4C6CA 4JFVA 2DIJA 2OT1A 3G22A 2JIEA 4CD6A 1V3JA 3GS6A 3HG5A 3FFSA 3CZ8A 5HMDA 3I3EA 3W83A 3OBEA 1TSIA 1KKOA 3STFA 3ARXA 2YDQA 4PN2A 3KTXA 1O60A 4R7OA 3M44A 3VM5A 1IYXA 1FWTA 3AI0A 4DRSA 3BLLA 4PCTA 2GJXA 3EOOA 2Y70A 4KS0A 4CU7A 4RE3A 2ISDA 4GZEA 4K68A 3ERPA 3WLJA 2XINA 2X2YA 2PA6A 5FAJA 1HJQA 4H7ZA 1B3VA 3K1GA 3PC0A 3WF2A 4X61A 1E1CB 5LXXA 3QGVA 3NZPA 2X1TA 5IDIA 1UBPC 3SGUA 2Z6IA 2QJJA 3EPMA 4XKYA 1FFQA 2BDQA 4XAPA 3MDUA 3LTPA 5BNKA 2CWXA 3VPLA 4F2UA 2F2KA 2Y61A 1E9LA 4IWWA 1PKNA 4RNJA 1LUCB 1TWSA 3ABSA 3DGBA 3DERA 2VCAA 4GJIA 3MJYA 4QJ5B 3PUGA 4N6FA 1Z7AA 3AIEA 1RK5A 3H12A 4I9AA 1F05A 1LBFA 2NZLA 1FHVA 4P8VA 3NYZA 2YCJA 1UWAA 3CHVA 4URIA 3SY8A 1L6GA 1BXBA 3WX7A 3IGSA 3W07A 3UJ2A 3TYDA 2QJGA 2XSBA 1KM4A 3UWQA 1V5XA 7PTDA 2XPKA 4GY1A 3D47A 1C93A 3CPGA 4GVFA 4LS1A 1HNYA 4IGNA 3Q67A 2E6YA 4IPJA 4MKSA 3W02A 2JBMA 4M7SA 4ZB5A 5C55A 4R3UA 3TQ0A 3WNOA 3AIVA 3C2OA 1ZP3A 3THDA 4RPQA 1WZKA 1Q2SA 4GBUA 3PJTA 1TUFA 2NWRA 3LYEA 3KP1A 1EWDA 3PY2A 1JQXA 1RQBA 1E15A 3POHA 3GWQA 2YJQA 1MSSA 1EZWA 3MV01 3L4ZA 1IF2A 3T55A 4JTLA 3T8LA 3K8MA 2BOEX 1LOLA 4AIBA 1V6VA 1B0IA 4FIQA 1I2OA 4V15A 4XO6A 1QK0A 1PKLA 1VF8A 1ISZA 5D2XA 4ENLA 4GGHA 4MDOA 2PSNA 3G3DA 3LBOA 4MLRA 4IQLA 1KA9F 2E8ZA 2FLIA 3LZ3A 3EXRA 1MMFA 1VCVA 4GI8A 2INEA 2DU2A 4OBTA 3M5ZA 3WD3A 3UY8A 4BQ3A 2O55A 2FZ9A 3GR7A 2RFGA 4L4LA 3HOJA 2Z4GA 3L5MA 4ZOBA 4GMEA 4BR1A 1GQJA 1UD2A 3HPFA 3M1ZA 4E8DA 5IBXA 1HKVA 4LS0A 1J79A 5A6BD 2X16A 4GY7A 1AD1A 4L4MA 5MKGB 5GVJA 1NWUA 2IPJA 2BVTA 4HK5A 3UCDA 2G50A 3JR2A 2A3LA 3VU2A 2PWVA 1NF7A 4FS9A 1BG4A 4V33A 1KGUA 5TIMA 1DYSA 1Q7ZA 1WZMA 3IUDA 1CGVA 1V3MA 4FX6M 1PZ0A 3K4DA 3S2LA 1G01A 2QCLA 1XLLA 2CLFA 1DJZA 4ZSTA 2IKHA 4LANA 1KGWA 2G3NA 4AZHA 3O63A 2X05A 2D3NA 2WHJA 1K4GA 1VHNA 4GVHA 3LTSA 1M5WA 1XLIA 3QQ0A 3T07A 3OJGA 2BOGX 2VEIA 2GGGA 3P7YA 3P0WA 1ZFJA 4KCTA 2GSJA 2DFAA 2OEKA 3ZLHA 1U5VA 1FHLA 4L6OA 4C6PA 2ISSA 3Q45A 3F5LA 3OVQA 3E9AA 4MSSA 1ENUA 1RA5A 5F2MA 1Y7VA 1UZDA 3NSNA 1XSJA 3EX6A 3ZJKA 3TA9A 1CXKA 1NQ6A 4UNKA 2OYLA 4NI3A 4W88A 3MVTA 1TPUA 2W63A 3GLCA 2V67A 3TOPA 5CC6A 3DHDA 4QX4A 1NWSA 4LC6A 2HZGA 2Q8LA 2GPTA 3H4WA 5GPRA 2FZ8A 2Y89A 3FGCB 3VZXA 3W7HA 1VKFA 1IWAA 4KIEA 1GZGA 4GIYA 4NZ1A 4BI6A 2RGMA 3KL0A 3KOFA 3QSRA 4AZIA 1KFJA 3OA5A 1MUWA 3TV8A 3S9YA 3U7VA 3ZIZA 4JTHA 3CV2A 3ZQ9A 3E2QA 3T2QA 2PDJA 1DJIA 1AFSA 2ZX8A 3QHOA 1MQPA 1UCWA 4RZBA 2O9PA 3TR2A 4US6A 4M51A 2A6LA 4YPJA 2XM1A 4Z2LA 3QM3A 5JBFA 2ZADA 1EHAA 2V5CA 3W28A 3PBWA 3GIQA 4C6MA 1IIGA 3CV7A 1J0YA 4ZO8A 4Z1YA 3GUGA 4YWSA 2ZUTA 3W1XA 2XIJA 1CEOA 5FKYA 1B54A 4CLMA 3KOWA 3NURA 1ZLPA 2WNNA 3O2LA 2QNEA 4GNJA 1IXNA 3B05A 4LRTA 4UTMA 4WDXA 1W2PA 1OGBA 3GHSA 1JCMP 2JGQA 3GDLA 3WJYA 3STPA 4Y7EA 2FHCA 4B5XA 2VZTA 3NQEA 1IWBA 1S3HA 3BLFA 4MWAD 4XZWA 3LS9A 3ZJ7A 4CNPA 2OWXA 1KFCA 1XX1A 3GIYA 1JXKA 3W7MA 2A3EA 3EZ4A 3N2XA 1JYXA 4ZVJA 1RA0A 3TNBA 5HJXA 1LL4A 2V3EA 5D03A 3NL3A 3SGZA 2BXZA 3USZA 4WEVX 3CEUA 2W61A 2O9RA 4BHYA 4DAFA 4LWWA 1JZ6A 4FEZA 4N2YA 3KCLA 1H1YA 3SQSA 3UNDA 3KM8A 1OFAA 4GPNA 3BZGA 4GXWA 3CXOA 2OEMA 3N9SA 1C9DA 4HNLA 1DQUA 7REQB 2Y8UA 1NY1A 3VC5A 4CQAA 2VX4A 3MBFA 5BOOA 2RAGA 3N15A 3WQPA 3TFXA 1GCYA 1YRRA 3LXCA 1EA9C 3B8TA 4RR4A 3GDTA 2FQIA 2VRJA 2Y6ZA 4X3ZA 3SAZA 3ZVIA 3IGUA 1WV2A 4UMAA 2FMOA 1TZ9A 3BJTA 1NTHA 3P67A 4W89A 4DUOA 1Q3NA 3M5XA 3GC2A 3GM8A 4Q6XA 3WK1A 4D8LA 1R47A 2J7GA 1XL9A 3PK7A 1WPCA 3VFLA 3N18A 4PUEA 5AECA 1BRLA 1LG2A 4LCSA 1GHRA 3RN6A 2R1MA 3HZ3A 1IR2A 2GUYA 4UFLA 3NSXA 2QF8A 3R11A 4TIMA 4DVOA 4PTMA 2EBNA 1R2SA 4B2DA 2DH2A 3R8GA 1E71M 4MHBA 4LCRA 4HA1A 1E9ZB 4XO7A 3VC6A 1B9ZA 3M16A 1E73M 3IVTA 1ADOA 4QEEA 1RJQA 1V6XA 3KCOA 1CB2A 3QYSA 1OG6A 4J7RA 2AOSA 2FTYA 1WB0A 2ZVIA 4Q6JA 1A50A 4IIDA 4CQ9A 4GNKB 3EDKA 4D6DA 2B7PA 4HNTA 3VDHA 3DXIA 1ADDA 4LH8A 3BLDA 3GNRA 1JRBA 3E38A 3S8HA 3MDWA 2CFFA 2NVAA 4H3DA 4H9UA 3CBWA 1QNQA 3MCMA 2E3ZA 1SGJA 3AXHA 3VKBA 3TC7A 3QFWA 2HMCA 5EL1A 3WMBA 1NAL1 3NPWA 1WXYA 4AHQA 4EE9A 1CIUA 1B4KA 5C9UA 3GAKA 5LYRA 4Z2GA 1RR2A 2BXVA 1F9CA 3BAWA 1EDTA 4HT3A 3UD6A 1JG9A 2PC8A 3TKFA 1HJWA 4RXGA 3CIXA 4YN5A 2JQXA 1TELA 3MZNA 1RCXB 1J4EA 2O92A 4ATWA 5CJ5A 2NQ5A 1Q6LA 1JVNA 1TE1A 3GG0A 1VS1A 2OLSA 3L7RA 1XGEA 3U57A 3E5PA 1ISXA 5AC5A 2I17A 3F2BA 2HJPA 4PCNA 3QPYA 2PBGA 7CGTA 2JKAA 1TREA 4PTXA 3CHFA 3INPA 2X1RA 1VRXA 4D71A 1FOBA 3VNJA 1GT8A 2VR5A 4HMCA 4H9VA 4IMAA 4UC5A 4JTDA 4DJDD 1FCBA 3WLPA 3WSUA 3G1RA 4PB5A 1MUCA 3O07A 1TRIA 2WJZA 1FCUA 4C7DA 1EUNA 2OSYA 3VVGA 4TX9A 4PUUA 2NXHA 3JRKA 1JZ3A 3LNMA 3R0KA 3W1MA 3GU2A 3WBYA 3SADA 4PUDA 3PPCA 1YBQA 5DELA 4MWAE 4N4QA 3LCFA 1OX5A 1E4MM 4ACZB 4ZGYA 5DEZA 5C2XA 3LI0A 5CEWA 1JF5A 2YCIX 1WYIA 1D7FA 2I5GA 3LNPA 4GABA 1XF0A 2ZUSA 1KM6A 5IHSA 4C6JA 1ISWA 3V0TA 3TJIA 3WF0A 1AW2A 3GDRA 3BSMA 2AQVA 3B9EA 4PUMA 3RRXA 5JBDA 1WDDA 2CLLA 2R1KA 3AFBA 3CWHA 1OGSA 4MNKA 3WN6A 1EJ7L 3ITOA 4IMGA 3AROA 4S3BA 3CQIA 3THUA 2P8CA 3VD9A 4LB3A 2V81A 4KQNA 2YW4A 2IKJA 2Y62A 3F5KA 4XAGA 3TTEA 1H60A 5E09A 2Y88A 3T78A 5EMKA 2HPIA 2OZTA 3VGDA 5AC8A 4HN8A 5BOEA 5K4ZA 3WQEA 4DY1A 3H2EA 1RALA 3LXBA 3N13A 1I75A 3PWAA 4KFOA 2VWTA 4L6DA 1VEMA 1D8WA 6TAAA 5BMWA 3UPWA 3GZAA 1UP3A 1VFLA 4QLLA 1IGSA 2G8ZA 1Q6GA 5CZSA 3CLMA 1ESWA 2CZ5A 4ZXLA 2E9LA 3MSDA 3GTHA 9XIAA 1ZP4A 1TPDA 2HBVA 1BAGA 3WJXA 1HKMA 3W7OA 2F9RA 1K1DA 4Q8UA 5C5YA 2CHNA 3S5SA 4JYDA 3NQDA 5FF7A 3DHPA 2A21A 3MV11 4TR9A 3M6YA 2PP3A 4ZO9A 4Z17A 1NSJA 2UY4A 4HU0A 1K9EA 5D9NA 1G4PA 2MANA 3QV9A 3MUAA 4B9YA 2OYKA 1WCGA 4KERA 3S6DA 1T6MA 4JDYA 4ZZ9A 3UCCA 2P53A 2DT0A 4PULA 4NAEB 5M5DA 4CCCA 4K1GA 1EF3A 3BV7A 2Q02A 3W27A 4HBKA 2IQ0A 2CERA 2PD9A 4WX2A 1EH9A 2VDIA 3I3BA 4B15A 1GYLA 1O1ZA 2X40A 2ZIDA 2G4FA 3LRLA 4ML4A 3N2BA 2PURA 3Q4DA 3TE9A 4O1AA 2YPIA 3GG1A 2FZBA 2B7QA 4DX3A 1QWKA 4KW2A 3N9RA 4IIGA 2FGLA 2YXGA 4DM2A 3PULA 2C6QA 3TWBA 2HBXA 5J04A 4L1GA 3TLLA 4BJHA 1G4TA 3VCCA 1XIIA 2DUAA 1RJPA 1FKWA 3FJNA 1K6AA 4L7ZA 3WO8A 4Q4RA 3MI2A 3TW6A 6CGTA 4MFEA 1L6FA 4F2BA 1PL9A 4S23A 4IM4A 5I79A 4J3ZA 4LUTA 2J8FA 1EDGA 3WJZA 4JX4A 4WVXA 5DMNA 3VKAA 2QUUA 4H8HA 1I2RA 1HW6A 1NDZA 5LNWA 3LQGA 4UOJA 3AMDA 4F2TA 1HF6A 5IDZA 1EJRC 1Y5XA 2VWSA 2VTFA 4NY2A 1V0NA 1C90A 3S5ZA 3SCPA 4Z0SA 3O06A 2RGLA 3PP7A 4AZBA 5J8LA 3TK7A 3FVMA 4QRNA 2Q8XA 1NDYA 2XYLA 1US0A 1WKEA 4GX9A 2OSXA 1H5VA 1O4UA 5D05A 1A5NC 3E2VA 4D6GA 3N6JA 2C1HA 2Y1HA 1E6NA 3ZR6A 1BVWA 2OLAA 3MW7A 3LV5A 3KRUA 2ZQ0A 1KW1A 2Z2UA 4AXNA 3IJDA 1GVQA 5H1WA 4FNTA 2J9ZA 1KCXA 3T2PA 2Z6JA 2P8BA 3GXDA 1E6SM 2W67A 1SZFA 4MY1A 1GUVA 3OGVA 1QPRA 1E0WA 3CUGA 1G69A 4MNLA 1O7AA 3HO8A 2CW6A 2E68A 5A8PA 1TPB1 2VGFA 3FYPA 3KDOA 8TIMA 5BROA 2QEZA 1JAKA 4R88A 4WKHA 1XIMA 2DUXA 6REQA 3OLDA 1NEYA 1JCJA 1FWNA 3R8HA 4IPLA 4S3AA 7XIMA 3M43A 4R5EA 2PFHA 2TMDA 2W91A 1I9CB 4IP4A 1MRQA 1K8XA 1OIMA 3TYUA 1RJRA 3MU7A 5C8BB 1JXJA 2I7GA 3TSBA 2FGZA 2PLJA 2DIEA 4Y2WA 2P3ZA 2OQLA 1K4HA 1GJUA 1EX5A 3W6LA 5I3IA 1QNVA 3OVRA 5KZDA 5AC4A 1OY0A 3ALFA 3IRDA 5FD0A 5EY5A 5KZEA 3RJXA 1GPFA 1DHPA 4EWJA 1OHLA 1KFKA 1UR4A 3CEPA 1GKRA 5T9BG 1QHOA 1NH6A 3ANYA 3QOKA 1FQ0A 2WLZA 3GU9A 1TCDA 1QW8A 1KBKA 1QOQA 1H0GA 4BF5A 1UD4A 3C2FA 3VMOA 5GQBA 1SPQA 3AUOA 5DMMA 4S3CA 3W7RA 1JI1A 3REQA 1UD6A 3O1NA 1TV7A 1LZOA 3WH9A 3W7GA 3GYCA 2YB4A 2TSYA 5BWAA 3BAKA 4NVTA 4KEUA 3M0IA 4J1OA 3W9ZA 4WJ8A 3TA6A 2WJFA 1U5JA 3W26A 4A05A 2QGHA 4A3RA 4MKNA 4Q8QA 2CLEA 4PBEA 2WMHA 1A5MC 1LQAA 4FSAA 4IXXA 3K8KA 1W1IE 3FX4A 3NCOA 5IHRA 1BQCA 4TU1A 4F79A 5ECUA 4Q4PA 2FHBA 3M6DA 1ZAIA 4O1BA 4G6CA 2CLPA 3LHWA 4S3GA 4WHBA 2FJKA 1C7TA 1LWJA 2G3FA 1IT0A 3TW7A 1M7JA 1THFD 4H9XA 4O28A 1EGVA 4X0VA 4L5ZA 5CAHA 4OJYA 3LBMA 1V3HA 1VBUA 1A4LA 4JNMA 1K8CA 4QE1A 4WDUA 4QAIA 3B8DA 1AMYA 2O0TA 2WKJA 3W6MA 2XG9A 1OX4A 4UWMA 3WCZA 2HK1A 4HJWA 1G1YA 3V36A 3S5NA 2VNCA 1BWLA 2Z24A 4HNOA 4XAYA 4PMRA 4JIPA 2J9YA 2QAPA 3CGTA 1MXSA 1ZJBA 4Z08A 4TQTA 1WKYA 1NFBA 1TWZA 1FWCC 2EKCA 4QDMA 3FDGA 2XVNA 4GK8A 2PTZA 1A0EA 2C13A 3CZEA 1ELSA 1KRMA 3CC1A 4HA3A 5D37A 1RP9A 2WXDM 3O16A 3A5VA 4B3ZA 3QXBA 2AL1A 4KCUA 4I8YA 2GZXA 3WDJA 1G6CA 4O18A 1JCTA 2ZBTA 3GU1A 1MDRA 4RV8A 3BLKA 5TNVA 3F4CA 3C6CA 1JUKA 4Q8NA 1X6UA 3MY9A 1C9WA 4JTFA 4UTTC 3G1AA 4FX7A 1KKRA 3VGEA 3PWGA 4Y9AA 3SB0A 2WMGA 4I5UA 2AQOA 4D8ZA 3RMJA 1S38A 3NDYA 2PAJA 4AUBA 2YDAA 3U3HA 1E5JA 3NWRA 4OUEA 1W1TA 3EKZA 3PSWA 4DJDC 4AYGA 5FJRA 1QPKA 4PODA 3V35A 4OV4A 3BW3A 4ZOEA 3VDAA 4NZ3A 1WAWA 1TYGA 3LPPA 3VOCA 3BUVA 5B80A 4G5DA 4R7WA 1EQPA 3MI6A 4AVNA 3NQ7A 1P0BA 1CWYA 1LRNA 4GISA 3U6WA 1QDSA 1TWWA 4GWEA 1CXFA 3V7PA 3G24A 5KITA 4LVDA 3LCHA 2UZ9A 2YDRA 3RFAA 3BCFA 2GGHA 3CUXA 4KGJA 3AALA 3C2VA 3U0HA 1SYTA 3WH6A 4FX8A 2J77A 3LLDA 5B7YA 3IJQA 1RAKA 4Y9OA 4W8LA 1UA3A 1Z3NA 1EZ2A 3BGJA 3GC5A 1UUQA 4PBGA 1OCQA 1P6WA 2EPHA 1PZ2A 1F3EA 1BTMA 2HK0A 1UB3A 3VIIA 3PSVA 5FEZA 4C6LA 1GKPA 1UQYA 3EX2A 1E6QM 3JVAA 2E0PA 5AOUA 3UWUA 1JI2A 4EK7A 1QO2A 4LJ3A 4PB4A 2WBGA 2FFCA 3WQDA 2VELA 3GRIA 4KWOA 2XSXA 4GHRA 5HNTA 1CW2A 4GI6A 3DDMA 4Q8OA 2ODOA 5D30A 4QAWA 1LOSA 4K3ZA 5C2GA 1HT6A 2GFTA 1A5AA 3K4AA 4LX4A 4UFHA 1LG1A 4AW7A 3GG7A 2VFGA 3R79A 4QJ3B 3UU0A 3ITTA 3PN8A 1P6CA 3S1XA 2VENA 2ZZ1A 2IQDA 5C71A 4DZAA 1XLGA 1HL8A 3VNDA 1SO4A 1EX1A 1P5BA 4WQ6A 4TV6A 1JFHA 2O9TA 1RBOB 1E1EA 3WFZA 2DH3A 1V93A 5EMMA 5BMXA 3SCSA 2DW6A 3PANA 4ZE5A 3KX6A 4ZO7A 4N9EA 4O19A 1F6PA 4M24A 5DMYA 1AMKA 5DO8A 3SFKA 1LL6A 1BYBA 3E0VA 2HQAA 1O5XA 4O1FA 4DN1A 4DPQA 1QATA 1XYLA 3NPVA 4C7FA 2Q6ZA 3L0KA 3HGSA 3BH4A 5EGRA 1SFJA 1XGZA 4GRSA 4Z2HA 3L67A 1FBAA 4GKTA 4JQAA 5HWJA 3NSMA 5KINA 4AZCB 4LAOA 2JK2A 1AQHA 4C5YA 1DJHA 3AWOA 3BDKA 3NQ8A 1HVQA 3T9PA 3OPSA 2O7SA 1JPIA 3B0VC 2XVLA 3QLLA 4EPBC 3EX1A 5DN1A 4DBSA 3W53A 3UPMA 4DBDA 4TV5A 1RK6A 1NP0A 2ALRA 3DN5A 2GJXB 4E2BA 5I3JA 1KV5A 1KXHA 3IV3A 3IVSA 3VCRA 2V2CA 5I77A 4WJEA 3UNTA 1REQB 3S83A 3CQ0A 4QITA 1NWRA 1WA3A 2EJAA 3TIMA 1JYWA 2XFYA 3TROA 3QW4B 2E67A 3ITXA 1V7YA 1W5PA 2F38A 1W5NA 3AIBA 3P80A 4DUXA 3DC0A 3AYTA 5FL0A 1EXBA 3LGGA 3H21A 3W81A 1TV2A 4XKYB 4R9OA 4GZJA 1MEIA 3HPAA 2C3ZA 2GYIA 5AZ0A 1UIPA 2F8QA 3W87A 1GW9A 1H4PA 2ZRUA 3N4AA 5A6AA 2G96A 4G1NA 1WXJA 1XP3A 4J40A 2BY2A 4Q7BA 2NQ9A 4GJ1A 4PRTA 3VNYA 3C2RA 4HHLA 5CPSA 5D32A 4JIHA 2WW5A 4C90A 3IUIA 3P2VA 1SO6A 2UY2A 4LF2A 3G0UA 4GGBA 1S1PA 3KDNA 3CZJA 4AEOA 4S3FA 3VIHA 3W01A 4IQEA 1ZBVA 2PDKA 1S5MA 4P7NA 1TJPA 4FI4A 4GACA 2RDWA 1H61A 2QUTA 2PTXA 1L0PA 4JHMA 1CTNA 3QKEA 3L65A 5MF5A 5HWMA 1R7AA 1S46A 2J24A 3M7SA 3AMCA 4L4OA 3MB9A 3RPDA 1TKKA 1BTCA 3W7IA 5LNVA 1SZRA 1RZMA 3CK5A 4HNCA 3WDHA 4CGTA 1DIOA 1J0ZA 5FF0A 4GX8A 1FP9A 2D20A 1J0HA 2G95A 3GR4A 1M65A 4BI7A 4PL2A 1Q65A 3O15A 1ZBKA 4RDZA 1XBZA 2YYUA 4U2ZA 2OKTA 3F03K 5LNRA 1H7OA 3R89A 3GW3A 1MZHA 1W17A 3WH5A 4FALA 3ABOA 2F6XA 2ZCGA 3CUJA 4U31A 1H41A 3O8AA 3MWCA 4JTCA 3BSHA 1CECA 2CLMA 1WP6A 3CYJA 3B8SA 3LN3A 5LZLA 3SDOA 4XB3A 1S2CA 1F3TA 8CGTA 2ZKMX 4NUWA 1E9YB 1KTCA 3P62A 4Y90A 1X1OA 3G1VA 3RHGA 3M0KA 3NQ2A 2D0GA 4WOQA 1MNZA 5E70A 4OTKA 1BEUA 4GI9A 3ZVHA 5AVNA 1KFBA 1ZSXA 5ABTA 1LLWA 2QMKA 4ACYA 4N9BA 3V5OA 1O5RA 3QGAC 1GVYA 2C0HA 1QT1A 4IFKB 2VDGA 5TD4A 3ARTA 3W1QA 3BW4A 1W56A 3STGA 1FDZA 4DO5A 3FA4A 2A2IA 3GXPA 4S2BA 2G37A 3EEGA 4WY0B 4JTEA 1RY0A 3U2OA 4UMCA 3B0PA 5FAGA 3HFYA 2PDCA 3F5JA 5D04C 2VHLA 2P0IA 4AVFA 4D6JA 3WENA 2IMRA 3E49A 3GYEA 4DXXA 2BVWA 2Z2BA 3LB0A 4UR9A 4AB4A 2GJPA 2RKXA 3A3WA 5LNSA 3CYVA 3QMTA 3PS7A 3TTOA 3K13A 3A4WA 3NIYA 3SQLA 4PA8A 3VUPA 2QHAA 2DORA 4IPIA 2XZ7A 3HG4A 4QBXA 1H63A 1UP0A 1KCLA 3UG8A 3WF3A 4D72A 2WMIA 4M82A 1YE6A 3SCQA 3VE9A 2YLAA 4G7EA 4IP5A 1W6TA 3OLEA 5CG7A 4BKNA 3DBPA 1PDZA 5A1AA 3ARUA 1TJ0A 3F4VA 4IX2A 4ADUA 1UMLA 3SR7A 5FCZA 3T4WA 1KFEA 4NZCA 4AZ5A 3GVGA 1ONXA 2ABAA 2J7CA 4GFIA 4O1CA 2EJ1A 4CEXC 3OO2A 4A35A 1EP2A 1XV8A 2PDHA 3WDQA 2DVUA 4CUCA 2V5KA 1SZEA 4F3HA 2JGYA 4WDWA 4GC3A 3P82A 3WH8A 4U28A 3VD5A 1VEPA 3ZM8A 1OF8A 1WOAA 1U22A 1DJNA 3N6QA 5AYXA 3LBCA 4W7WA 4QHRA 2EAWA 2OYMA 4TMCA 4LF1A 4HZ6A 1J11A 3AS2A 3VKCA 4AWTA 1DL3A 1VPQA 1XSKA 3NEHA 4QP0A 3GY1A 3W7CA 1NARA 1OBAA 4MY9A 3L68A 3LCGA 4BZYA 1JNDA 4MIMA 4FLOA 1TTPA 5FI8A 4IPPA 5HDRA 1OEPA 3T0DA 3E0LA 4KWUA 1SW0A 2QVNA 1IEXA 1DE6A 1KRCC 4FHAA 1JNEA 3WLKX 3YPIA 1E1FA 1I0BA 1UUMA 1MQQA 2A79A 3CHDA 3G1HA 3EWZA 1EGMA 3OHIA 1YW1A 3HBLA 3GXIA 1K9FA 3LMZA 4PMYA 3WLHA 3BGAA 3MTWA 4Q4MA 2VQTA 4EAMA 1V03A 3RR4A 1EC9A 3OU8A 4LPCA 4UTFA 4N42A 1V6UA 2WPBA 1GYNA 1ZBCA 3MS8A 1K6WA 2RJHA 5FA5A 1N2VA 3CL6A 4PMZA 4HPJA 4M1RA 4ORIA 3MPGA 2J7EA 3V3WA 5D2YA 1N8IA 2WCSA 4W86A 2IQTA 4ZFCA 1KQZA 5G2HA 3NQCA 2FB2A 4ZR8A 3TYCA 3CJPA 4PMXA 1IHIA 1XH1A 4ZQOA 1CB7B 5CBBA 3G77A 3QR3A 3EOEA 2OPJA 2DDXA 1FWJC 4C6BA 5H91A 1QOXA 1UPPA 2XVKA 1X7IA 2V68A 1W31A 3FEQA 3IAPA 1VB9A 1EGZA 3LM3A 1MUMA 3HG2A 4LXFA 4GQBA 3VILA 1Q6FA 1VBRA 5FF3A 3TP4A 4GKLA 1UZHA 2I56A 3E12A 3MC5A 2V6AA 2XN1A 4IICA 1AJ2A 1B3ZA 1CZ1A 3A4AA 2FH6A 1A5UA 2VGGA 4OZOA 4UOQA 2WAGA 2FIQA 3VAVA 1VFMA 2OO0A 3WNPA 3R1ZA 3L4XA 4MB4A 4JS3A 3WD4A 4PC8A 1TA3A 5I3DA 4B5WA 2KAUC 2OKOA 3QV8A 1P0KA 2A0NA 4DF2A 3R0DA 4OBSA 2Z26A 4YTSA 1EF2A 1HVXA 3NOYA 3SUVA 4HOZA 5H8MA 1X1NA 3LHUA 3PBVA 1W3JA 4JPGA 3PZNA 1MDLA 2GVLA 4H9YA 1KFLA 1AK5A 4JFUA 2NSXA 1XPGA 2DSKA 1MXDA 1YNQA 3NEVA 5KETA 3VIPA 3NDOA 4BS0A 3A24A 3UPBA 4AXKA 3H70A 5KTLA 4IJBA 4K8GA 4U5IA 3FXYA 1J2BA 1CDGA 4PCPA 5G2IA 1LLZA 2G4JA 2PWEA 2J13A 4RDVA 1RVGA 2C1GA 1L2UA 4HU8A 3UJEA 2D2JA 1PV8A 3BV4A 3GSMA 5DBTA 3P8IA 2PDWA 3SCNA 3KVMA 5ABFB 3U2EA 4Q4QA 3SSZA 5CAKA 4FNQA 4Q8WA 3Q65A 3GFZA 3VD4A 4ICCX 2QLYA 2P88A 2GUBA 3OEXA 4TX6A 3D3AA 1GWJA 3H6OA 4MTVA 4DJFC 1PWMA 1F4AA 4LW7A 3KLLA 1ECQA 1Y5WA 1EJTC 3N2TA 3M41A 1BWKA 1GQNA 1LL7A 3ARWA 4YYFA 1E4IA 3D6NA 4D6IA 2F2HA 3PPFA 3OBAA 1DIKA 1B3OA 2J9XA 1IXOA 2O7QA 3WQVA 1JZ2A 1VJSA 4ERGA 4ASTA 4YTUA 2OGJA 1KNWA 1AA1B 1IT7A 2D2GA 1I6NA 2ZWZA 2E6DA 2V63A 4JL2A 3AU2A 4KMQA 1F3WA 2CBVA 2DSVA 3MHGA 4ALDA 5D02A 3LEPA 1OFPA 1QVBA 1W1ZA 4H04A 4F0MA 1AH4A 1SVDA 3DBNA 3RM8A 5J5RA 1K7XA 1JD7A 1PZ1A 4E2OA 3MSYA 4L56A 4OHQA 3VZZA 2BVDA 1YNYA 3N4FA 4DI8A 5ECVA 3VFCA 5XIMA 2UWFA 1GNXA 3MUZ1 4J4KA 1UOKA 5L9FA 1GKQA 3RXZA 3CB8A 5C54A 3UA3A 1FWDC 1YDOA 4CVUA 5AYYA 2C14A 2QCGA 4S3KA 4RJEA 1YBQB 1XLJA 3QHNA 1VYRA 3H23A 4DXVA 1MNSA 2TPSA 2YXOA 2H9AA 3PZVA 4QDWA 4CNTA 3HA1A 4NNCA 4GH1A 4HZ8A 3E3HA 3DU0A 3TCSA 2CKRA 4RNHA 3TWAA 3EMZA 1QNRA 1AVAA 1TPFA 4GUGA 4GO9A 1TJ2A 4A3HA 5E9XA 1RQHA 4ZFMA 3W75A 3IIZA 5F4SA 3TN5A 1PYFA 4Y8FA 3O7UA 4J9JA 8A3HA 1XS2A 1ZY9A 4LS2A 5BW6A 3NDZA 1KRAC 5FSDC 3KWXA 3PM6A 3K1DA 2LLEA 1A0CA 4JTRA 2D69A 3DENA 1ME9A 1N8FA 3NVTA 4DF0A 3UEQA 1YPIA 5DXXA 2BGSA 4UQDA 2Q71A 4OQVA 1VQTA 4UMBA 1B3YA 2WVTA 3GVQA 3TQKA 4FNSA 3VD7A 3MZ2A 1O94A 1DP0A 1ZCOA 5EU9A 1PXGA 1LRQA 2C1IA 3URQA 2QV5A 2ATMA 3C2YA 2JALA 4OECA 4JTUA 3DIPA 3RM9A 4IUGA 2WC4A 1FWBC 2HNHA 1L6SA 1YPFA 1FWEC 1AODA 2VR4A 3R10A 1J93A 1TV8A 2QDHA 4FOJA 2NUYA 3VIOA 4JIEA 5HK4A 5JMUA 2VP8A 3OVPA 4WUIA 1G5AA 1OZQA 4JQ1A 3VNLA 2AKMA 3GDBA 4DI9A 2E8YA 3EWCA 3WUEA 4GNVA 1R3WA 1W1A1 2PDQA 3APGA 2E9BA 1U1UA 1MFUA 4O14A 4WY0F 3GKFA 4R85A 1UC4A 4O53A 4YIWA 5A2BA 1B5TA 1NIUA 1F8IA 3SUTA 1CLKA 4DLMA 1IEIA 3NJ3A 4OWGA 1EKOA 3KOZA 1DVJA 5ABEA 1MFVA 1X98A 4DWSD 3QRHA 3O0KA 4O57A 3QSTA 2WQDA 2XU2A 3T44A 4ZO6A 1H62A 5K9DA 4LBRA 4LBUA 4JBRA 3PJUA 2YW3A 3TTYA 1ZUAX 2NT1A 2F6UA 3N14A 1MRAA 2YA0A 5I7GA 3ELFA 4H8VA 2WOQA 4XVEA 4REQA 4YCPA 2I57A 3ES7A 3H7RA 4H9TA 2Z29A 3EPNA 1R2TA 2W27A 1W1B1 1M01A 5A6KA 3USBA 3B03A 2POTA 3THQA 1KR0A 3UQNA 3MMWA 3A13A 1TR9A 2V3GA 5C9RA 3WUFA 4PL1A 2GUUA 2OJPA 2X1UA 1UD3A 3FYYA 4KF1A 4HCHA 2X1SA 4LUTB 5CC5A 5JUVA 3SCRA 3UZXA 1M68A 5HMSA 1RBAA 1UASA 3KCJA 2OQHA 3ZLGA 3NM3A 4H7CA 4C6NA 2CPUA 4W7UA 1OCBA 4UTTA 1D8CA 5EMJA 4KWSA 3V16A 4GIRA 3BG9A 1CBGA 3MYOA 1W3LA 3AHYA 1M41A 2HPMA 3NQFA 3S9ZA 4HPGA 4M5PA 4BQ4A 3LPGA 3QMSA 2PC4A 4QLJA 2JIWA 4CQDA 2Z1VA 2QAFA 4LYKA 3J7HA 1GGOA 5AYIA 1K02A 3FY1A 4DELA 1W8SA 4DJDA 3U7BA 2PCQA 3C0QA 4QJ4B 4BWLC 2BHYA 2FPVA 2QMJA 3EA1A 4NZ5A 4JY9A 4JTGA 2FTWA 1DJXA 4B92A 3BLIA 1C29A 5JIPA 3RU6A 4QSHA 3OIHA 2X42A 2RDTA 3W1PA 4A3QA 2XN2A 3COTA 3II1A 3H2FA 2AMXA 4AU0A 4ZTXA 1FHDA 5I09A 3BLOA 2POZA 3XIMA 2J7HA 2Y7FA 4UTLA 4YTTA 3N25A 5JQ9A 2ALDA 3W2NA 1JIBA 1XYCA 1I8JA 3KZSA 4F0LA 2XGBA 4PMVA 2OO6A 5FEPA 1E4LA 4H41A 4MPQA 3I3DA 5JVLA 4LCQA 1F61A 1V3IA 3PUOA 2AGKA 3GZ3A 2EEXA 3AJXA 2GSHA 4LEFA 1M1BA 1XYMA 4O1DA 3IGXA 2ON3A 4MADA 3UG4A 1TQXA 2DVTA 3HPZA 1RD5A 3DFTA 5LNUA 2AAMA 4CKQA 2XVGA 3W3OA 1M04A 3H2CA 3LHTA 3P61A 3TC6A 3HN3A 5EMUA 3A9IA 1LQ0A 1EHNA 3MHUA 2R9RA 3T0CA 2WC7A 2QF7A 4AZGA 4UOZA 4HJFA 1R3YA 3BAIA 4CQBA 2ZUUA 3MYPA 3GHUA 5D2VA 3EMCA 5CSSA 3WDIA 5IM51 1FXQA 3QZEA 2Q3OA 3SJNA 3JUGA 1A47A 4NNAA 4AHOA 3UCQA 4NJKA 5K3VA 3AO0A 3L21A 3SRKA 4RCXA 1PVNA 3UZWA 2GQAA 1CGUA 4IMDA 4WSKA 4GVGA 2EPNA 2OZ3A 4J3UA 5A6LA 3V0UA 4RZ6A 3WDRA 3LMYA 4D1JA 1HIZA 3C0LA 4L6HA 4NF7A 2PDFA 1V8EA 3EA2A 4NJHA 2ZC1A 2J74A 3O6CA 2XFRA 4DWDA 1PCWA 1J8VA 2J6VA 4EP8C 4ML9A 2RHGA 5I00A 1ZL1A 4Q8VA 3CH0A 2FKPA 4M6QA 1XCFA 1NFGA 4HSNA 4F9DA 2H8ZA 2TRSA 1JDDA 3TZNA 2WNQA 3BWWA 4P7RA 2A3CA 2AMGA 3PTDA 3A9BA 2XUCA 4JHZA 4QNWA 2DSZA 2PWUA 3STCA 1F7BA 4FXFA 4PGLA 1VHCA 4WD0A 4AWUA 3OZPA 1EP1A 3W00A 5I3FA 1WUFA 5LIXX 1TX0A 5H6HA 2E1WA 5KZMA 2GOUA 3UWYA 2A7PA 3FKKA 1SJCA 1P48A 3W37A 2XDFA 4H6KA 2OQYA 2CLHA 1QJWA 3VOIA 3S2NA 1OT2A 3MCOA 4DNHA 2OELA 1L6YA 1S5VA 5LA1A 2D24A 1CPUA 4NL1A 4H9ZA 3ZJ8A 1JUBA 1E1CA 1EA0A 3CUIA 3GNOA 3WUGA 2OODA 3F4WA 2A6NA 3GD6A 2V30A 1E0XA 1JZ7A 3A6OA 3PJWA 1C91A 2P0OA 3U48A 4O0KA 2P10A 4NT0A 1GK8A 1V3KA 3NO5A 5F2LA 4ZQPA 1GOXA 4M6UA 3LCLA 4H8UA 3AHTA 3SN4A 3AXKA 1JJKA 3CHEA 3NGFA 2DIKA 3IIOA 3LA4A 2NQHA 1F6YA 1H7XA 3HPSA 4QSFA 3Q94A 3URAA 5CJNA 1ITQA 3BG3A 1JGIA 1POKA 2NVCA 4QG8A 1TIWA 3TXZA 1XRFA 3L4TA 4XTDA 3PZ9A 3UF9A 3KBJA 1V02E 2X2GA 4DZHA 2ZX5A 1RPKA 1HJUA 3KTCA 2AAAA 4B5UA 2O9OA 1KM2A 4Z1BA 2DZTA 1EJWC 1A5LC 3SUSA 3QTGA 1KXQA 1I2QA 4ROPA 3PTKA 4IHCA 1AQMA 3TMQA 5JXQA 2E5CA 3B8IA 1JGMA 2E4TA 4LTSA 2PI6A 4JTTA 1G4SA 2XWDA 3N3TA 2FDSA 4PMUA 2J7DA 2FFIA 1XLCA 4HYRA 5HANA 2R8WA 4Q8TA 5EKYA 5DCBA 2NQZA 1M7OA 1ME8A 4YTRA 4I9MA 1EC7A 1XUZA 3G8EA 4F0SA 1U5HA 2VZVA 4JTJA 5LGZA 3LLFA 1GORA 1NOFA 3WFLA 3PHAA 1Q6RA 1P4CA 2G3MA 2QT3A 4XKMA 4S38A 1UH4A 3VOJA 2ZRVA 4S3DA 5DX7A 3GG8A 1QR7A 2ACSA