1VFHA

Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
382
structure length
381
Chain Sequence
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanine racemase
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
molecule tags Isomerase
total genus 124
structure length 381
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfhA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfhA02
3CPGA 3UW6A 4PB4A 4BEUA 4Y2WA 2NVAA 3CO8A 4XBJA 3NZPA 1FTXA 2OO0A 1L6FA 2J66A 3MT1A 3NZQA 3WQDA 3BTNA 5GJMA 2PLJA 3N2OA 3VABA 3N29A 2PLKA 4ILSA 1QU4A 3ANUA 3WQFA 2NV9A 5IRPA 4A3QA 1EPVA 4PB5A 7ODCA 1L6GA 1TUFA 3SY1A 2ON3A 4KBXA 1VFHA 4QHRA 5GJNA 3ANVA 1VFTA 1BD0A 5FAGA 1CT5A 3OO2A 1NIUA 2TODA 4V15A 2SFPA 3AWOA 5GJPA 2VD8A 3AWNA 3B8WA 2P3EA 4WR3A 1F3TA 3KW3A 3E5PA 4BEQA 1D7KA 3GWQA 4LUSA 1HKWA 1XFCA 4LUSB 3HURA 4BF5A 1XQKA 4ZGYA 4FS9A 4ECLA 2RJHA 3N2BA 5BWAA 3B8VA 4BHYA 3WQEA 5FAJA 4LUYA 4DYJA 3S46A 2VD9A 3WQGA 2RJGA 3R79A 4PB3A 1KNWA 2YXXA 1VFSA 5FACA 4XG1A 2DY3A 2ODOA 2QGHA 3B8UA 3E6EA 1HKVA 1SFTA 3HA1A 3B8TA 4AIBA 3LLXA 1XQLA 1B54A 1W8GA 3C5QA 4DZAA 4LUTA 3WQCA 1SZRA 1KO0A 1NJJA 4LUTB 1RCQA 2O0TA 1TWIA
chains in the Genus database with same CATH superfamily
4Y9PA 3VD5A 1VJZA 3DECA 2HBXA 4HYRA 3CWNA 1JZ4A 1S5MA 1W1PA 2VGBA 2WWCA 2ZXAA 1EYEA 1RK6A 3HGJA 3BZJA 4LOCA 3GU9A 2OGYA 4Q4PA 3GDRA 1JYWA 3SY1A 5HWNA 4MDPA 1H11A 2CZVA 1TB3A 3N19B 1KB3A 4JYEA 3BG9A 4AMAA 5A2CA 3VOGA 2CLOA 3UCDA 1DJIA 4RR4A 2BVDA 4W5ZA 2J7HA 2ZDSA 3HIJA 4W8LA 3WDJA 3LGDA 3WMSA 2QCDB 3NDOA 5HQLA 4ACZA 4MTVA 3RRXA 1Q2RA 3PPFA 4LUSB 3HPFA 2ZQ0A 1ITQA 2EPHA 1P1MA 4ZVJA 4LVBA 3UYCA 3KRZA 3LX9A 2C1IA 4WGXA 4NQ1A 5TAOA 3VIGA 3T09A 4FA3A 3WDPP 4X0NA 3TE9A 4PTDA 5CPNA 5XIAA 2UBPC 4V1XA 3N6JA 3HU7A 1W5PA 2YL8A 1ISXA 3N2TA 2ZIDA 2D2OA 3GY1A 1HTIA 3ERPA 3FVDA 3IK4A 4GOAA 2ZUMA 1VKFA 4Y2WA 3CUIA 2CLIA 1NAL1 3E5BA 3TCSA 1IF2A 3NG3A 3SRHA 2HK0A 2QVNA 3BLEA 4Q32A 3LBCA 1XWYA 2E3ZA 2V2DA 1X38A 1ZL1A 4Z1CA 2DP3A 2DW6A 2XH4A 2BBFA 2DT2A 2WQPA 3V36A 2G37A 4NKCA 2Y5EA 5BMWA 3G6MA 2XM2A 3T0AA 1E56A 1OC6A 3HQNA 3WNKA 3PANA 3N9KA 1RQEA 4LBUA 1H49A 3QV7A 2BTMA 1DV7A 2PAJA 1C9DA 2VNCA 4M7TA 3URNA 3UXDA 4NNAA 4L64A 1G94A 2R1KA 3G1FA 3ZR5A 3ZZ1A 8XIAA 5ABFA 1UD4A 4PE8A 1TTPA 1R3QA 3WLIA 5REQB 5H8PA 4Q3MA 1H50A 3WQEA 3W25A 1UH4A 2ZX9A 1TJ0A 3P5ZA 2VRQA 4NJJA 2G3FA 1XDMA 3W1MA 3B06A 1X1NA 1QTWA 1VF8A 1SPQA 1C92A 5HMDA 5D30A 3H24A 3MMWA 3WUFA 4O57A 2HE5A 1CIUA 4ROPA 3AIQA 2XPKA 4JY8A 2VZUA 2V81A 1LWIA 4HNNA 8TIMA 3I4EA 3W71A 1VBGA 4QQ3A 4IQLA 4MZ1A 1OGGA 2QV5A 3E3HA 2J25A 1JXKA 2FTPA 3NZPA 3S1WA 3QFEA 3WUBA 4LV4A 1R3RA 2VFFA 1SO3A 3KWXA 1Q6OA 3QJAA 1G4TA 3NQ7A 2DSVA 4LNCA 1TPB1 1KXQA 1E6PA 1LWJA 4AZGA 4DI8A 1P1XA 4ZQCA 2EF9A 1G7UA 4WXYA 4F9JA 2W27A 5LYRA 1HP5A 2FH8A 3WLSA 4NX0A 2Z7GA 3TOYA 2HRWA 5CZTA 4LU0A 4WVXA 2VFEA 3E74A 7TAAA 3BAXA 2HTMA 3NZGA 2HS8A 2VUNA 4OWGA 4B5WA 4X0VA 2PU1A 5CJ5A 2NXIA 4QDPA 3RLVA 4G7FA 4BEQA 2EJ1A 1XFCA 2QCLA 3NQGA 3VIMA 3VD3A 3AZSA 4BS0A 3A3XA 1ZAIA 3KOYA 4C6IA 3STEA 2RJHA 3LXCA 4IPLA 3UFYA 1FWIC 4HA4A 4I7VA 3UR8A 1HNYA 2AQOA 4FX7A 2GYIA 2POZA 3EB4A 3QW4B 4OU1A 2QJGA 3TNOA 3PTKA 4O0QA 4V33A 5MHBA 2VDIA 4LAOA 1YW1A 4EPDC 2VUYA 2WHLA 1L0PA 2PP0A 2VZOA 4RXGA 4JQ3A 2YCKX 2QF7A 3L67A 1HQTA 1V77A 3TMQA 5G4HC 3O07A 3UG3A 1LOQA 4Y9AA 3APGA 2CKRA 2V30A 3IVSA 1EUAA 3WBYA 3S8HA 5AHIA 3U0HA 4UTLA 5D8WA 2PLCA 1MI3A 4CCEA 2DJLA 1J2WA 4ZMGA 4GLEA 4TUFA 2NSOA 3R2GA 3NA8A 1ISVA 5BXRA 5CBIA 1S5VA 1XHGA 3DCPA 1FCVA 2L5HA 3TJIA 3TJLA 3P81A 5LA0A 3PS7A 1QFEA 4NX5A 5DMMA 3QY6A 3TA9A 3RYSA 1OZQA 3LENA 3CZKA 2G3MA 3W1UA 3ITOA 4Q8OA 1JUKA 4Z2HA 4FOUA 4RDYA 3RR4A 1A4MA 1DIOA 1PCKA 2P1FA 3LK6A 4TVDA 2IKHA 1VYRA 3V5OA 3GXFA 3VM7A 3IRSA 2CETA 3VDAA 3D3FA 3KTXA 3A47A 1I60A 3WJZA 1Q4WA 4J40A 3A12A 4AX7A 4JR5A 4O12A 2VFHA 3T42A 4AWEA 1XL9A 4OBRA 2QDGA 5LGZA 4R7WA 1UH2A 4Q4OA 6TIMA 1HUVA 3NZRA 1ZALA 1HX0A 3EMZA 3ARUA 1M65A 1YKWA 4JN7A 1XCFA 3NQDA 3PK7A 1SVDA 2YX0A 4PA8A 3ZWSA 3FNDA 1VJSA 3CU2A 4FNSA 4KWSA 5C9XA 4BA0A 3TSDA 3UPWA 1FHVA 2AQVA 3U57A 3NQ2A 2WMJA 1IR1A 1LDCA 1XW8A 3ANVA 5JIPA 1HJWA 2QCNA 1E0UA 2YBVA 3P14A 5I3IA 1D3HA 1ZY9A 4V28A 5AHLA 4PRTA 4HOZA 1KC7A 1YE6A 3EX1A 1XJBA 4YCPA 4L5ZA 5JUVA 2CZ5A 1EUNA 4KWOA 4X9YA 3KOXA 4WDTA 1V3MA 3L5MA 3I3EA 4JZ5A 3S83A 4IP4A 4S2CA 3BLFA 1GKPA 4K7YA 4UZUA 1DTUA 4DJED 1JYNA 5HK4A 5F2LA 4GACA 1UZDA 1EIBA 1TRIA 3I6EA 1UASA 4KRZA 3CIWA 4GE8A 2ZZ5A 3NNTA 3VFLA 2XIMA 1F3EA 2FPTA 4GKTA 3ZSTA 4NNCA 2GQAA 4L6DA 2FB2A 5G2WA 1PE1A 4PFMA 2B0MA 1V3JA 3VAVA 2V5DA 2DZVA 4FX6M 5CC5A 5CGQA 4RNFA 1BTMA 3KCJA 4AYSA 1ICPA 1EXBA 1JNEA 3RLGA 1Z48A 3BSGA 3UG8A 1QWKA 5DANA 4XAPA 1FQ0A 3GFZA 7ODCA 1UD3A 2YXOA 4Z2GA 3LGEA 4XISA 2DT3A 2DT0A 4GWEA 4B5NA 4U4MA 3PBUA 2XIJA 3M5XA 1HXJA 4GCXA 4I6KA 3C2RA 3Q67A 3ALGA 2WNQA 3K4AA 4K1WA 2R24A 3E9AA 3BSMA 1QHZA 3ONCA 3GWQA 3CUFA 3UXIA 4DUVA 1X7FA 4HT3A 4HYWA 4BCEA 3LY0A 1OCJA 3PTQA 4Y9MA 3FJNA 2PZ0A 3PB2A 3DBPA 2ZX5A 2J6XA 1OHLA 4M80A 4WD0A 1WYIA 1NP2A 3M5VA 1B3WA 2VEGA 2HNHA 1H51A 2Z2AA 1HL9A 4ZB0A 4Y9NA 5A6AA 1K9EA 3L5LA 4O1CA 3WNOA 3TYZA 4GXPA 3CZJA 3BAJA 1IXOA 1S2UA 1R30A 3HA1A 3GSMA 1LROA 5M3WA 3EMCA 2PD9A 4IXHA 4W86A 3FJLA 1XDLA 1QCWA 3WZ0E 2FDSA 3R8GA 1TZ7A 1MXGA 4WDWA 4HU8A 3FJ4A 3MYOA 4JFVA 4O19A 2KX9A 4IIDA 4CVUA 2V3GA 4F2BA 4FMVA 3KS5A 3GNXA 3WD1A 4NZ4A 4CQCA 3EYPA 3WELA 3UJ2A 2G41A 1Q6LA 5U7SA 1C8QA 4D6FA 1EC7A 4GYFA 4WY0B 2GL5A 4C6NA 3AIBA 3WH8A 4KCTA 4CVWA 1ZJAA 4K37A 1DWIM 2J13A 1KM2A 3AU2A 3MB9A 4PYSA 1R85A 3MDUA 1E9IA 3B8DA 3GXDA 2MNRA 4URIA 2DZBA 1W9DM 1U83A 4NG3A 3SCOA 1H63A 1C3FA 2UY2A 2PS2A 4IIEA 1HL8A 3W7RA 4FNQA 3ONBA 3B0VC 3OHIA 1Y5XA 4YPJA 1UJQA 4MUPA 1TPC1 3FGCA 3PUDA 1E72M 1KD0A 5EL1A 1JPKA 4IMCA 3LYEA 4WY0F 1E6XM 4AG0A 1KXHA 3T2QA 3SUVA 2FZBA 3RX3A 3D3AA 1FRBA 4PUKA 3EPOA 2MUCA 3EWBX 4S38A 2H3DA 3PTMA 3LU2A 4AD4A 1F73A 1HKVA 1OX4A 2PCQA 3ZJ8A 3E49A 2ZWYA 3L66A 2E4TA 4REQB 3BOXA 2OWWA 5JMUA 4DO5A 3W9ZA 4PMRA 2GJLA 4NZ3A 1W3LA 1TJ2A 3LMYA 3DFNA 2JKPA 1FVPA 1IZCA 2PDHA 3AMLA 1ZJHA 4IJRA 3WK3A 3Q45A 4GCAA 4D6CA 1RLDA 1XH2A 1DQWA 3TYCA 1DORA 2DQXA 3VX1A 3WIJA 2AQWA 3T78A 3OTRA 3UYIA 4OV4A 2VR2A 4JQ4A 4RNHA 2D3LA 3I3BA 4DIAA 2YA2A 4NY2A 3WK2A 3R0UA 1B57A 4CN1A 1VLWA 2WBKA 1PZ0A 1U5HA 1A5AA 4Z1AA 7REQA 4IHCA 3M46A 1UR1A 4L4OA 3TW9A 1BFNA 4JXCA 1GHSA 1P0BA 2WVUA 4HU0A 4IX0A 1RH9A 3NXLA 1XLHA 3T0TA 2X16A 1NDYA 4JKMA 1EEPA 2ONEA 1SFSA 2PWEA 4LVGA 5DCDA 4IZGA 2WVVB 4A8NA 4GJJA 2GGGA 3WLOA 4D6DA 3RO8A 3DFQA 2YCLA 5JQ9A 5ABEA 4F0MA 2ZDRA 3H4WA 2V3EA 2WSPA 3QR3A 1LUCA 4D6IA 4LYQA 5D03A 6REQA 3Q65A 2CLLA 4XIMA 1HVQA 3LHUA 4EIVA 1EGMA 4MG4A 4AIBA 2WO5A 1W8GA 2QKFA 2E9LA 3H26A 3AS3A 1KCKA 4C90A 4MB5A 4PBEA 1J0KA 3JRKA 2WMKA 1A53A 1QO5A 1HL2A 3ZR4A 2NQLA 1P0NA 5CAKA 2Z00A 4J7RA 2W4XA 1TV8A 4P5UA 4YTTA 3M07A 2I14A 3OIHA 1QRQA 4WEVX 2PDLA 4PUNA 2VEIA 1QHPA 2ZUVA 3OLDA 3BE7A 4I9JA 4MNJA 4Y90A 4EPKA 3H6OA 1LOLA 1DHPA 4NF7A 1UZHA 4KCWA 5CPTA 4S3AA 4QDWA 3PZTA 3PFRA 3MI3A 5JBFA 1JAEA 4AHQA 1WAWA 4GMEA 1HKJA 1QWGA 3NO3A 4NJHA 2OKOA 4C6MA 3GH5A 4A4AA 3W2NA 2VZSA 2DDXA 2WCGA 1KR0A 2W61A 2PWGA 4Y8EA 4QG6A 2ZA3A 5LIWX 1KGXA 1F2JA 3EX6A 4R53A 1J0HA 2X42A 2D1ZA 2ACUA 2WAGA 3KL0A 3M16A 4JTRA 3SN1A 3UZYA 1AUSL 1V0MA 3Q2DA 5SWUA 4DN1A 3DFPA 4EP8C 3H8AA 2IXVA 2WKJA 1F6KA 1H5VA 4LC8A 5I7GA 3VVGA 4M5PA 2DEPA 3NQ8A 3AIRA 1PIFA 1X8CA 3EWWA 2FGZA 2QYGA 4KT2A 4PMQA 1J18A 4AHPA 3G8EA 3KVJA 1LLZA 1MMFA 4NAFB 9RUBA 1ZP3A 3MPGA 3W7OA 4CNPA 4UR8A 2R6OA 2J7DA 1SJCA 1BKSA 3GR4A 5LKYA 1XKJA 3LCLA 4NZJA 5A6TC 4FX8A 3ABXA 4D8ZA 2NV2A 2Q3OA 3CPUA 4H7ZA 1W9UA 1P5BA 3B0UX 3W1AA 4CNSA 4GQRA 2XFWA 4WJEA 2OR2A 3DZ1A 3WBXA 2WKLA 4PTNA 3TWBA 4DJFC 3TAKA 3PBYA 3M0HA 3T0CA 4GUFA 3AXIA 4R3UA 4G56A 5PTDA 3GDTA 3W73A 3BZGA 2G50A 1TV7A 4LF2A 3N14A 3W2KA 2BXVA 4H8VA 1F3TA 4A8IA 1Q8AA 2H8ZA 1TIWA 5C7VA 1OFEA 1IYXA 4MSSA 4EF9A 1BRLA 1K03A 4RX0A 1MQRA 1VB9A 3W70A 4UUIA 4TV5A 4C60A 5FF0A 3SW6A 4EPEC 1VFMA 3S5ZA 3F2CA 1V8EA 2Y5SA 1FCQA 3S46A 1IWAA 4LAKA 3PZVA 1PTDA 2RGLA 1RPKA 2BB0A 2C3ZA 4NT0A 3C2FA 3QKEA 4Q33A 4FIRA 4JX5A 2PDYA 4MB1A 1K8XA 2A0NA 4F0RA 4QXIA 3UP8A 4IIBA 3W72A 4PB4A 1I9CB 2YA0A 1ODUA 2DZAA 4DZ5A 4O11A 3BTNA 5GJMA 1KFEA 1AW2A 1KM4A 2OCZA 3GIPA 1R9YA 3LM3A 4UQAA 2CXEA 3SRFA 3BMWA 2A3BA 1E0VA 3LCXA 3AO0A 4HN4A 2GVYA 3QN3A 4Q7IA 3O9NA 1AQMA 2TPSA 4QE5A 2HNEA 4OKDA 3TYDA 4M56A 4L4LA 5LHEA 1V5XA 3M47A 1BQCA 3ITTA 4S3DA 1YPFA 4W4QA 4QAWA 4QNEA 1TPDA 3AWOA 1HO1A 3RJYA 4NUWA 2VDHA 2J7FA 3ZR6A 4LCQA 3KBWA 2EGZA 2R8WA 1QW8A 5IFPA 3M7SA 1RBOB 1H7NA 3W23A 5CZKA 4FNRA 3MP3A 4MNLA 1X6NA 1GVYA 2J7CA 2GOUA 2NXGA 1QO2A 5F4WA 2DT1A 3NWRA 5XIMA 1TX0A 3N3MA 3UWVA 4JHMA 4P8UA 1D7FA 2WMHA 4K8GA 2BV9A 4Z1BA 3SEPA 1HJXA 1RY0A 3T2OA 2JKAA 4G8TA 2ASHA 3K1GA 3B03A 3TA6A 3EMQA 1UR8A 4U5IA 2D2GA 4LS2A 4ATDA 3VIJA 2WMGA 4GNKB 4ZE5A 3WMCA 4GISA 5DQPA 3CEPA 4ZQNA 3CQJA 4Y7EA 2HWGA 4EX4A 2NQHA 3PPCA 1LQAA 1YNQA 1IXPA 2WYSA 3EWXA 1XIBA 5GVJA 1FWEC 3QF0A 1XIMA 5M2FX 2Y5JA 1C29A 3F7JA 1UUQA 4JNYA 2DU2A 2J7GA 4Q4RA 3KX6A 1W1YA 3IPWA 2I57A 1XBXA 4QJ1A 4V15A 1T5AA 3T6CA 4HHLA 3HN3A 1W9VA 1OFPA 1GYNA 5T9BG 2ACRA 3NGJA 1OD0A 4DUOA 4JFSA 1W3TA 5AYIA 4WGHA 3NO5A 1A5LC 2E40A 2NVDA 2WZHA 2EPMX 4QCEA 1TTQA 3LCIA 4J5NA 3IIPA 4JN6A 2VD9A 1OADA 3WQGA 1GONA 4W89A 2E1DA 2C13A 5CC7A 3PZ9A 2P0OA 3PTDA 4ZQRA 3SY5A 1JFHA 1KXVA 2GDQA 1AZ2A 2A3EA 4J3VA 1XYMA 1BG9A 1AVAA 1SSGA 4ERAA 3VD9A 5G5IA 1XFBA 5K9DA 2REQA 1BVWA 1MQPA 3MCOA 5KSWA 3GC5A 3P61A 4AZ6A 4HA1A 1ZQ5A 3ELFA 3A64A 5D09A 3E1F1 3DYMA 1H09A 1LRNA 2HXTA 3V1HA 2F61A 1Z7AA 1P6WA 4RK8A 1JZ5A 3GX9A 4PUMA 3ARPA 1U5VA 3AAMA 4DBEA 4C5YA 1H61A 2QCGA 3G0UA 4W9TA 3VMPA 1KM1A 4C6JA 3V3WA 4J27A 1I8JA 3DFOA 4AIUA 4O15A 3W38A 1V3LA 2F6KA 3PVFA 4US6A 5E0CA 2YW4A 4DZHA 3OBEA 4AC1X 3W1QA 4M7SA 3DGRA 1W37A 1JUEA 4WOQA 5HQEA 1A3WA 1BG4A 3CAQA 2AKZA 2A4AA 3SUSA 1GOXA 4H6KA 2GZXA 3N11A 3OEXA 4O10A 1MW0A 1RSCA 3IRDA 3M0MA 3SN4A 1R3SA 4CEUC 1FCBA 1QNRA 4HNLA 3EDDA 1FWSA 4HYVA 3C61A 5HBFA 4ERGA 1A0DA 3SUUA 3LCWA 1H0GA 2ODOA 3BCDA 2HJPA 3II1A 1S46A 1W1B1 2ALDA 5DXXA 3LI0A 2ISDA 3WJSA 4IISA 1MUMA 2YW3A 5JH2A 1FWBC 2EHHA 2J78A 4DPQA 4EACA 3WLKX 1VBHA 4LUTB 1B3OA 2Y63A 2BP1A 4DM1A 5C5YA 5LNUA 1UYQA 2XIIA 4QRNA 3UZWA 4INFA 2G3JA 3O7UA 2WJDA 1UA3A 1XLJA 3D5HA 5LNVA 3PR2A 2G0WA 3LSCA 2H8XA 3DESA 1SQ7A 2EO7A 3T2PA 1ZBKA 2VGFA 3R8HA 3VGEA 1VRDA 3K8KA 4J9JA 4JKLA 3PPGA 3WBEA 4ZODA 3IGSA 2ZRYA 3OU8A 1GWJA 1UW9A 4ALDA 3TEVA 1C7TA 4FIQA 4H6QA 2C0AA 1M03A 3N3TA 1E0WA 5M17A 2VKZG 3OG2A 4Z2IA 2IPJA 1RD6A 4IFKA 1PKYA 3GG7A 3LNMA 1Q6DA 1UP0A 1N2VA 3W00A 4ML9A 5HR6A 3BL3A 1LL4A 3GYEA 3L65A 3PZQA 1RD5A 1WPCA 2FPYA 2RUSA 1TZZA 3ZOAA 4KFPA 3CAKA 4EXQA 1JZ2A 1XIFA 1EIXA 4GUJA 3VMNA 4GI4A 1CWYA 1ZCOA 2DSUA 1LZOA 1W8SA 3T55A 1XLGA 3P60A 1VPXA 4LB3A 3NO1A 4J2PA 4O1BA 3O0KA 3VOIA 3W1XA 3FIGA 1NQKA 2J6VA 2Z1VA 1ISWA 3GLCA 2BXYA 1KLYA 3W7MA 4QLJA 1M7XA 3GVWA 3OA3A 1TSIA 3FXGA 4JTDA 3H4XA 5F2MA 1B2YA 3VILA 1VHNA 1P6CA 1XGEA 2HZGA 3BLPX 4C1NA 1XBVA 5CLTA 2O9TA 3W88A 4J3WA 4M81A 3OGVA 3VUPA 4EWJA 2NXHA 1MZRA 3L5AA 3CEUA 2BDQA 2QZRA 4D6JA 3V0TA 1DTNA 1G1YA 3TJ4A 3ANUA 3S9YA 5I3GA 1H3GA 1JCTA 1QBBA 1XLEA 2WVTA 5LGXA 4XTIA 4WZHA 4ZSTA 1T6MA 3GNPA 1YE4A 4FLQA 3VOJA 2BVYA 1CCWB 4OIFA 1J01A 1CGXA 1QJWA 1UC4A 1XRFA 1H7RA 4DYEA 2PODA 3NQFA 3MU7A 3H22A 1ME7A 3MYPA 2DGAA 3CPRA 1QPKA 4U33A 1A80A 4IMFA 2HVNA 4RZ6A 2QIWA 1OGBA 1K8YA 2PWFA 4JDBA 1AJ2A 3BG5A 1Q6FA 1C9WA 4DO7A 4GINA 1VPYA 2VQTA 4UTMA 3KBJA 1DJWA 4NU7A 3H4GA 2V3DA 5CGMA 8A3HA 3SCQA 2WCAA 2Z2BA 3MV11 4DZAA 3SGGA 4H9YA 1O5KA 1BYBA 3GH7A 1X98A 4X63A 5E0FA 1X7IA 3NFUA 1Q2SA 2GFTA 3W24A 1TWDA 3ABOA 3VKJA 1Q6CA 1P48A 3QH2A 2Z0IA 2J66A 5BU9A 3F03K 1N55A 2NQ5A 1EDQA 4Q8MA 1JVNA 2ZTKA 5A8MA 2PDWA 3VKAA 1Y7VA 1OYAA 1ITUA 1GKQA 2Y70A 1H7XA 2PMQA 2PGFA 4HQVA 4WCJA 1DE6A 4CQAA 4W7WA 1ODZA 2FMNA 4G2DA 3MUIA 2QUUA 3MJYA 2YFOA 5CKSA 1M7JA 2XH7A 4HK5A 1ZCCA 2PWVA 4S2BA 5I03A 4AAJA 2DZTA 2OZ8A 2BGSA 4W5UA 1GZGA 3H2AA 3SURA 1TX2A 3BG3A 2QCDA 1GT8A 3B8WA 1I45A 1GKRA 1NH6A 1TFVA 4LCSA 2R94A 4LUSA 3RG6A 5C2GA 4DB7A 3IV3A 1SZFA 4JIPA 1EPXA 3OVQA 5A95A 1RY8A 4KWWA 1S5TA 5HJYA 5FAJA 3BV7A 1CGUA 1WZLA 3MJMA 4H8UA 1XRSA 4PB3A 3GK0A 4I8YA 3LHVA 1OK4A 3UG4A 2X30A 1MEWA 2QGHA 7PTDA 4W88A 4C65A 2X0HA 2OU4A 3WLHA 4RDVA 3E0FA 5D9MA 2ANUA 3U7BA 5AC7A 3S1XA 1E9YB 1JXJA 3SM0A 4XSMA 3CMGA 3Q58A 1RCQA 4UTJA 5EMYA 3M1ZA 3KBMA 2A21A 3TN3A 3KOZA 1V6YA 4LYKA 4FLSA 4UTTA 4Y6GA 1E6NA 1F6PA 2INEA 1JCXA 1YXYA 2WSKA 4KS0A 1TV3A 5A6MA 1E4NA 3UGRA 2PGWA 4GO9A 5ECVA 1GZ1A 3URAA 5A6SA 4FF7A 4GVHA 2X2YA 3M4HA 2JEQA 2R1MA 3IGHX 3GB6A 1CXFA 2DZXA 3LCGA 2YDQA 3P0XA 2OB3A 2VX6A 3R1ZA 4LUJA 5TNVA 3FKRA 3LV6A 3R43A 3E2QA 4WQ6A 1TMHA 3TOPA 7TIMA 1ZSXA 4GA8A 1D2KA 1L6YA 4OUIA 2XSBA 2YL9A 2FVMA 2NUWA 4D6EA 2I16A 4ZCWA 4BF5A 3ANYA 3BV4A 2NX1A 4E4PA 3AHZA 4IXXA 1BWVA 1XIEA 1CXKA 5REQA 4MLRA 5C2XA 1DJNA 3A9IA 1DHKA 3L2LA 1O12A 1UMYA 4HSHA 5C8BB 2PBOA 1TCDA 1CNVA 1JI1A 4CD4A 1B3ZA 3G8RA 2Y8KA 2YDAA 4PMDA 4UOJA 2DQWA 1O7AA 2RDTA 4W87A 1B1YA 5AOUA 1JCJA 4EVZA 1GORA 4IPJA 4FR1A 2ZADA 2W3ZA 1XC4A 3AQUA 3PWAA 3QHOA 4N9BA 1E0XA 4JL2A 1KCXA 3MQTA 3DFSA 4H7CA 2V69A 1CI1A 3BAIA 4FPSA 5I09A 1JI2A 3WJWA 1H4PA 5JH1A 1CB7B 1XCWA 4X60A 3DENA 2QQ6A 3PAOA 4MYXA 1GVFA 1IEVA 1MFVA 1UWAA 3LDVA 2P50A 1AQHA 4WDXA 1XM3A 3BLLA 1Q7MA 5CSRA 5A5WA 3VGFA 3CZ8A 2V63A 4JX6A 2ABBA 2XZ9A 4LAUA 3TR2A 2GPTA 1CYGA 3FJ6A 2XVGA 1FFQA 4JTCA 4RZBA 4XO7A 4JX4A 2E1WA 2QPXA 4AVNA 1LORA 4B91A 3QHMA 3CIVA 1JG9A 3RX4A 1PCWA 2A2IA 3BUVA 3YPIA 4XZLX 1E51A 4O1EA 2OQYA 4ZBCA 1JPMA 5CPOA 3VINA 5CSUA 1H0IA 1QK2A 3A24A 1W3HA 5HOSA 2Z6JA 4QROA 1KO0A 4LF1A 3GU2A 5I00A 1NFGA 3B0YA 1RBAA 2I5GA 4HSNA 3W7GA 2Z1KA 1FDZA 3EOUA 1EJ7L 3PNUA 4O0KA 3VUSA 3WQFA 1DQUA 1TUFA 3CWOX 3UJSA 3ARSA 3BCJA 2IUZA 1XIDA 1WKDA 2PF0A 3HGRA 2E6AA 1AQ0A 3GNRA 1EO5A 5HA7A 3G1AA 3GR7A 3PZOA 4CD8A 1VFTA 3DFTA 4R9XA 3ITLA 3AHYA 3BLIA 5A6BD 3VE9A 3WEOA 4ZENA 2Z25A 3WFLA 2QUMA 3F4CA 4S3BA 1R3YA 1P0EA 1JRCA 3VM5A 4W7UA 3CLMA 2EAWA 2OX4A 1XYBA 3V0SA 1JGMA 5JU6A 5I3DA 4KEZA 2DFAA 2WMFA 3EXRA 3IUDA 2VGIA 4C6EA 3GC4A 3TUUA 4LC6A 5AYBA 2WZIA 3ITXA 2NUXA 4LAZA 4LCRA 2OG9A 1M9HA 5I23A 4IL0A 3BJFA 5J5DA 1E3ZA 4O13A 5CCZA 1PX4A 2QDEA 3GVQA 3HQPA 1FWDC 3AXHA 1T99A 4AF0A 1JFXA 1A5SA 5F2GA 4UXDA 1E6ZA 3PBVA 4CLMA 3G18A 3O6DA 3TP4A 1AMYA 1NDVA 3EOOA 4LFYA 2FTWA 3CUXA 3DHDA 1FH7A 2ISVA 1DJZA 5C70A 4NILA 4NP7A 5MKGB 1EF3A 2PCEA 3CZLA 3C2YA 4PL2A 1HGYA 4XTDA 4JKKA 3VCRA 1PHWA 1EKOA 3NAVA 3DGBA 4IICA 4NZ1A 4XZBA 4NAEB 4NXSA 1WKFA 5KITA 5CPMA 2F9RA 4GZJA 4A8RA 4C7FA 2W9MA 5HUOA 4UFHA 4ENLA 2XG9A 1OG6A 4PODA 3IV8A 1KQYA 4IFOA 3U2OA 4MOZA 4RE4A 3TJXA 4TTGA 3WMLA 2ZVIA 1OG0A 1VENA 1IE7C 3O15A 3CTTA 3WQ6A 3W7QA 4GX9A 1F07A 1UD5A 2CBVA 2RDUA 3OGRA 1E1CB 2OEMA 3RIKA 3W85A 3EWYA 2WPGA 2XH2A 3N18A 4ZSUA 1J8VA 1O4UA 2R14A 2O9OA 2XISA 3G6LA 2V3FA 4CUCA 1V0NA 3FY1A 1W17A 2F2KA 4R9OA 3ATYA 4UC5A 4QGCA 3TC6A 1K4HA 1ELSA 3CUZA 1YPXA 5D9NA 1NOWA 1Q6QA 4HCDA 2QJIA 1HZYA 3NPVA 3GD6A 4AFYA 2WC3A 2Y7GA 5IDIA 4RV3A 3EX2A 4QBXA 1EYWA 2ZCGA 1V6VA 5D2YA 3UWUA 1JZ7A 3LUTA 3ITCA 4QNWA 3UA3A 2PFHA 1JJKA 1EP3A 1GVQA 2ZKMX 2R1LA 4NZCA 3ZT7A 3RM9A 3KRSA 3H53A 3GXTA 4JYFA 3NEHA 3P5YA 3CUHA 1QOPA 4C6OA 4BF9A 3BGAA 1ICSA 2HPMA 2P5NA 4S3KA 2OZTA 1Q6GA 3WQ8A 1YPIA 2OZ3A 4Z17A 5D4YA 2TAAA 1EOKA 3HQ1A 1SJAA 4QR6A 4BKNA 1XH0A 5GNXA 5L6UA 1R86A 2TSYA 4GRSA 3G0SA 3RCNA 4DJFD 2NX9A 3FSTA 1QNVA 1KNWA 2OT0A 4YVVA 3TX9A 1YDNA 3W0KA 3QGAC 4XAZA 3EWUA 3GBEA 4CQ9A 1ZAJA 1MVYA 4CCZA 4ZOCA 1HKMA 2VT0A 1V08A 2DSZA 4UTWC 2D0GA 3W74A 1KFKA 2OJPA 4MMWA 3CT2A 3E38A 3HQOA 3H12A 4MB3A 4A2RA 3RHGA 1T96A 3L4XA 3O1NA 1QOQA 3ZWTA 5LNSA 3AMCA 1AL7A 4XQ6A 2VX4A 1Q65A 4JTQA 1UPPA 3UZXA 3WLLA 3OGSA 1POJA 5BWFA 1XG3A 4AVFA 1YDVA 4ZOEA 2X8RA 3D46A 1FKXA 1YHTA 3RPMA 1A5MC 2CBJA 3GXNA 3M0IA 4JTUA 4Q6XA 1W5MA 3RN6A 1CT5A 1ITXA 1CTNA 3FK4A 1KGUA 3ZVHB 3EPNA 2CYGA 1VCFA 3ZYZA 5AC4A 1NSJA 3TXZA 3GHTA 2PTYA 7XIMA 1KFJA 4FB7A 3MKVA 4L9XA 3TTOA 5LZLA 4V2XA 5DO8A 1M41A 1WUEA 1JAKA 4D9PA 3WYZA 4G7EB 4FS9A 4J3SA 5A2AA 4ICNA 1DXFA 3AJXA 2ALRA 4CKQA 2XVLA 4Q8QA 3AXMA 1OFOA 2HEJA 4RNJA 4DWSC 3U5UA 4PRRA 3LRMA 4FZIA 1A50A 1NOUA 1T41A 1RVKA 3QBUA 3P6LA 3K30A 5E09A 4REQA 2GWNA 2NT1A 2E5DA 2Y1HA 4AHOA 1XRTA 1PIIA 4DLFA 3FHQA 3CZGA 3ZXWA 1OX5A 1KCZA 3RLHA 3TW7A 4J1OA 1PDZA 1DXIA 1VZWA 4H9XA 4JD4A 3H70A 3FW6A 4FO4A 3HMJG 3RPDA 3P84A 5T91A 1YBQB 1J12A 5FEZA 4UR7A 3BDKA 5FA5A 1VIWA 1JL8A 3OJGA 2J7EA 3S1UA 1VH7A 1P4CA 2FJUB 4FXSA 4CNUA 4MY8A 3AYSA 1B31A 5DN1A 3SR7A 1WKYA 1I2NA 1TVNA 3QQ1A 4LY8A 2GGIA 5BMXA 3U9IA 4LY4A 1XQKA 3K46A 2WVVA 4JQ2A 2X09A 1KRAC 1NWSA 4IL2A 1E73M 2VCAA 5EFDA 5FD0A 4DNMA 3H21A 5DY2A 4YWSA 2NQZA 3HMCA 2A5HA 1XISA 3DI1A 4UQCA 2GGJA 4XG1A 3TTSA 4QTGA 4WX2A 1H2JA 4RW5A 2VC5A 3PUEA 4I5RA 4MKNA 5D02A 2Z1WA 4HPHA 3KBNA 3PBGA 2B7QA 3MWCA 3W7CA 4BEUA 3MDWA 3GO2A 2OLHA 3GKFA 1O1HA 3CAWA 3C0LA 5DRIA 3QR0A 1LTDA 4HZ7A 3W26A 1IXQA 3U2ZA 1EX5A 1HF6A 2D2HA 3KDOA 4MKVA 5AKQA 2VP8A 4I9AA 4TVUA 4BWLC 4RZ4A 4KKXA 1H5YA 3UXLA 3LGGA 4NYUA 1G4PA 1VFFA 2C15A 4J28A 2WNNA 2B7OA 2PP3A 2BOEX 2HK1A 1PB0A 4CD5A 3BWWA 1YEYA 1UWQA 4DJEA 4AZCB 1QPQA 2G3NA 5FJOA 1FWFC 2ZZ7A 3QMTA 1VBRA 3I6RA 4F8XA 4HKPA 3S9IA 1LQ2A 3T0BA 4B9ZA 4ZGYA 4ECLA 3L0KA 4OHQA 4F0KA 1XDJA 5A6JA 1E70M 5TBOA 1QATA 3M7WA 1RAKA 3M0JA 2VURA 1U2YA 3VU2A 3QQ0A 3NR0A 1EB3A 1DIDA 1MYRA 5KTLA 4KMQA 3MI6A 4NAFA 5ABFB 2ZOXA 1EHNA 3FN9A 4AXKA 4JNZA 5DBUA 4LAMA 1TA3B 1OFAA 3PULA 1KTNA 1X96A 4JIRA 1CENA 3RITA 1S5NA 4ACYA 1M53A 3OPSA 1S3TC 3UY7A 1YLVA 3SCWA 3VIOA 2FLIA 3NYDA 4YVXA 3DG6A 1B3YA 4LX4A 5TIMA 4PUWA 4ZXOA 4KBXA 1RUSA 3F5JA 3UWZA 3P8IA 2D23A 1THFD 4V27A 3WX7A 3CNYA 1SGJA 3MWAA 5CBJA 3TC3A 4W8BA 2VRJA 5A6KA 4QE4A 3H55A 1OF6A 1CEOA 3F1QA 3SCSA 3C0SA 2C79A 1F61A 2OSWA 1KWKA 1YMYA 1QI3A 2Y4SA 2QUVA 3ID7A 3WNLA 4MAVA 4BQ4A 3AFBA 4K36A 5T9CE 2EPKX 4JDYA 5HDRA 2GGHA 1IGWA 4YWIA 1XSKA 5I24A 3AI0A 2ZZ2A 3M6YA 4LTSA 4U10A 5KINA 3VA8A 2ZWZA 2FQIA 5EA9A 3WD2A 4L80A 4DBDA 4A29A 4BJHA 1QI5A 2G3IA 3LPPA 1TIMA 1A0CA 2VEMA 1FHDA 1RJQA 5BOEA 3KL5A 4BQ5A 1R7OA 2PDNA 4CU6A 5K4ZA 2OELA 2YZRA 2Z1XA 3OVRA 3PWGA 3IJQA 3DYPA 3ZFHA 3QPEA 2RHGA 2YCIX 3GC2A 3DYOA 4LEFA 5K9XA 3EOEA 1E55A 1F8IA 2PDPA 3LXAA 3RR1A 2NV1A 2QT3A 3HJZA 3BLDA 4PR4A 1J2BA 2ZICA 5HMSA 2JF7A 1BD0A 1FH8A 4HJWA 2OWCA 1S39A 1TTJA 3GHRA 2G4JA 2C7FA 2XJ7A 2R82A 2F84A 3WMBA 4UR9A 4XZ9A 3NL5A 4DF2A 2BLEA 4R33A 5JBDA 2VFDA 4C6PA 4PMVA 3A4XA 3UR5A 2TYSA 2I17A 2PDMA 3NXFA 1ONWA 4AYGA 2VFIA 1FWAC 3GRIA 2BVTA 2PA6A 4NJGA 3SZ8A 3EGJA 4MUZA 5DT7A 2BHZA 3OBKA 5TF0A 5I0DA 3N9SA 1NDZA 4B2DA 3NQMA 3SCVA 4U3AA 4E8GA 3VIKA 3D0CA 3E02A 3QC3A 1UOZA 3WF0A 1O66A 4NASA 4OOZA 3MBFA 3R0DA 3NCOA 3W01A 4XKMA 3E2RA 4A05A 2CITA 4XD6A 1PSCA 3RJXA 1R7AA 1GQNA 3S2LA 4AZIA 1P0KA 4Q8PA 4IP5A 4KFOA 4IIHA 3S9ZA 2F6UA 2ZYFA 1EP1A 3K8LA 2PLJA 4HOXA 3N2OA 3THAA 3DHFA 1W91A 3RDKA 1BWLA 3ZJ6A 5EMJA 4UQEA 3QV6A 1S2AA 1EPVA 3O6AA 1J0IA 1FBAA 3KVMA 2O4QA 3K8MA 3ZO9A 2BY0A 4I5UA 3HPSA 5BOOA 4EOUA 2QXWA 2XINA 4H04A 3H23A 2Y85A 3NOYA 4A6GA 4N2YA 3HF3A 2DUAA 2FIQA 3GUWA 4C1KA 3V5CA 1BGGA 3GR8A 1YX1A 1JQXA 3WBAA 3N34A 3VGGA 4BQ2A 1XI3A 2QLYA 4I6VA 1J96A 1OBAA 2XTKA 2VO5A 1PZ2A 2BZNA 3SCNA 2HV5A 4MY9A 2WNWA 1IGSA 1RJRA 2BX7A 2HXUA 4PZVA 2QPUA 3DG3A 4ZQMA 4Q7NA 5LNWA 4M1BA 2PDGA 2CHNA 4CD7A 3R25A 2TRSA 3L23A 3HV9A 3JUGA 3VIFA 2IQTA 3MANA 3VGDA 1W3NA 3B9AA 2FFCA 4N42A 1AA1B 3IJ7A 1N8IA 2CLHA 5D2WA 3W2JA 4F2UA 4IMEA 1FHUA 4DELA 1A49A 2AMXA 4AY1A 1PYMA 1TO3A 1BHGA 2X1IA 4Y96A 1K6WA 3WNNA 5GJNA 1KLZA 3TFXA 4Q22A 3WJYA 4JCLA 1VEOA 3W22A 3U4FA 3IEBA 1MSSA 3GTXA 4O50A 3G1YA 2JFEX 4IG2A 4M24A 4X22A 1VGAA 5M03A 4KRTA 2ZXBA 2CESA 3BCFA 5AZ0A 5AYZA 1JCLA 4ZFCA 1N7KA 4J2MA 4GYPC 4PCPA 4XIAA 5EMKA 1X1ZA 1A5CA 3ITYA 4L61A 3C0JA 2Z28A 3WDRA 1MUWA 4HN8A 3TXVA 1ZBVA 1JCMP 1GYLA 1QUMA 4R88A 1Z44A 3E0IA 3DHPA 4MM1A 3MSRA 1Q6RA 3VKDA 3UJRA 4BFAA 2YXXA 3IJDA 1D8WA 3MMUA 3QZEA 4KPLA 2XSXA 3QSRA 4PGLA 1MNSA 3VTRA 1GQIA 1ZBWA 3KHJA 2C0HA 4GH1A 4LUTA 2H3BA 4JHOA 2ATMA 3IJIA 4CEXC 1F3WA 4MB4A 3OA5A 5G1YA 4AD3A 3MUAA 4JTSA 2ZRWA 3GDLA 4FNUA 5CG0A 2YFNA 4LV9A 1W3IA 3EDEA 3M0XA 2OOFA 3ARWA 3HTWA 2PE4A 3B8SA 3BMXA 1G01A 3G1RA 4PTWA 1QNSA 4YHGA 1JGIA 5LIYX 1KM0A 2UV8G 4E3VA 3V4BA 1Q63A 1TQXA 2YYTA 2ZX6A 4AUBA 4GBUA 5AC5A 4DRSA 5C71A 3RCYA 3P80A 5FAGA 2OMAA 3WLJA 3M5YA 1CGWA 3B9DA 3PNZA 1R2RA 2QJJA 1QNOA 4L9ZA 4MFEA 5DMNA 4Q8VA 1Q3NA 5HATA 4HCLA 1TJ1A 1LL6A 3FDKA 4E6MA 1R3WA 4G9PA 1NM9A 1W56A 3B4YA 4LVFA 4AY8A 4P7RA 2I9UA 4AIEA 4MJ4A 1SMDA 1V6WA 4JS3A 5D8ZA 2QJNA 4L6OA 4O52A 3LLDA 3V35A 4HBKA 1KGWA 3PF3A 4O14A 3KXQA 3WDHA 1TPEA 3MUZ1 1OFRA 1CGYA 1ZFJA 1EXPA 1RALA 5F4SA 4CU7A 4D2JA 1KRCC 5D2TA 1O60A 3QY8A 1WUFA 1EEXA 1CECA 1DQXA 2XN0A 3UW6A 3PJTA 4AEEA 1REQB 2GVGA 1R9ZA 3ZSSA 3UD6A 2MANA 4MPQA 3WFAA 4AH7A 1D3CA 2YA1A 1L8PA 3VD4A 2X05A 3UY8A 4Q7BA 2A3LA 5DLCA 3G2GA 1VQTA 3FEQA 1FWNA 3MP5A 3BMVA 2IKIA 4PB5A 2AL1A 4OUEA 1Q85A 4E4FA 1L2QA 1IEWA 5HNNA 2EBNA 5CAHA 3TMLA 4CCCA 2NQ9A 3G1SA 1TREA 1JDCA 3EZ4A 1KM6A 4HMDA 5A2BA 5FI8A 1T40A 4FXFA 1O1ZA 3BGJA 4ZB5A 2ZRZA 1S3HA 2ZE3A 1DJGA 2YCJA 3IGUA 1WBHA 2EPLX 5I77A 2QV4A 2Y88A 4AX6A 2DZUA 4O8AA 2C19A 4N02A 2BODX 1IEXA 4MGGA 2OSXA 3APTA 2PB1A 3UNDA 4N7QA 3MO4A 1G6CA 3GTNA 4QISA 7REQB 3UVAA 2CW6A 3E96A 5EY5A 2V2HA 2QW5A 4A2SA 3W07A 4KIEA 2Y0FA 1NOFA 4L7ZA 1JPIA 2X1TA 1SFTA 4X9SA 5CXPA 2YDSA 1EGZA 3EA1A 4B3LA 3E0LA 1DE5A 4P7NA 4JQ1A 5ABTA 3K5XA 1HIZA 1UWIA 1R8LA 3FXYA 3VC6A 3NZQA 1H60A 4GXWA 6REQB 4DJDA 1VRXA 1XIIA 2WMIB 4GVFA 2PUZA 1IZJA 3FX4A 3TNBA 1YTEA 2ZUTA 1K9FA 3USZA 2PWUA 1ZJIA 4O1DA 2Z6IA 1TPVA 3EX3A 1FWWA 5BROA 5FSDC 4YVPA 2ZZ4A 4BK9A 3F5LA 2PDKA 1KBIA 4FK9A 1OT1A 4TX8A 5DMYA 2HBVA 2QUNA 3HGOA 1WDWA 1F7BA 4JTGA 1JD9A 3PJWA 4AVOA 4DJEC 3G24A 1ENUA 2IMRA 3GDMA 4IMDA 1GZJA 2H9AA 2E9BA 3W53A 4PUUA 3GVRA 4J4KA 3BURA 3GG1A 3B05A 5EU9A 7ENLA 1BXNA 3RILA 4O1FA 3GFYA 4G1KA 1AG1O 2CEQA 2PRLA 3I7SA 3STPA 4BY3A 3F4NA 4I90A 3DX5A 3NQCA 1JULA 4RNIA 5H8UA 3E2VA 2FMOA 2RAGA 5B80A 3NM3A 2PWHA 3SCUA 3W7LA 1E0TA 5FEXA 3F4WA 3S5SA 2GJRA 3TCEA 3VMOA 3XIMA 3VO0A 1RBLA 5BNKA 6XIAA 2WOQA 3KBVA 3FYOA 3I68A 4W8AA 5HJXA 1YXCA 4C6QA 3KHDA 4K6AA 5ENLA 1NDWA 1HGWA 2F8QA 2WQDA 1SR9A 2YSWA 3KEHA 1FCUA 5FEPA 5IOBA 2O92A 2B31A 1XLBA 3HBLA 3MVTA 2CZEA 4UCFA 1M01A 3B9EA 2FKPA 1OC5A 3BW2A 3S5OA 1XSJA 2UY5A 1JZ3A 3QYSA 1YDOA 5FIPA 3CTLA 4GKLA 4LUIA 2WK2A 4O1AA 1UJPA 4R7OA 4GPNA 1XP3A 3TYUA 1WO2A 2XVKA 4RPPA 3ZLHA 3BQ5A 5BWAA 3UZ5A 1YDYA 3B0XA 1XBYA 4NL1A 3LHTA 4CN6A 2Y8VA 5RUBA 5EFFA 3CC1A 3WEZA 1VEMA 5TQLA 5HPOA 5I3FA 2XN1A 2UY4A 1SYTA 3RGTA 5AY7A 1VR6A 3OW1A 3K4DA 4HJFA 3LPFA 3PY2A 1SZRA 3H2OA 5DRCA 1TPUA 1HW6A 4XD3A 1VS1A 4MWAC 4L56A 3QPYA 1L6FA 3AICA 5A8QA 4IF2A 1AH3A 4GNJA 2X0YA 4XO6A 3SJ3A 1XYCA 3E0VA 1J0JA 2EPNA 4HPGA 3H2MA 1A5NC 4AMCA 1GGOA 2J47A 1Q6EA 4HB7A 4US5A 4K3ZA 3CH0A 2E67A 3W7PA 4O53A 4GI8A 2XFRA 2ON3A 1XIJA 3T8QA 3FEMA 1SZEA 5G1MA 1U1HA 4MJZA 3IIVA 3R11A 2V5KA 5EPDA 3W87A 1F05A 3CV1A 4PH6A 2BASA 3WSUA 3TN6A 1D3GA 4GIYA 5LIXX 3KLKA 4C6KA 2X1RA 4EK7A 6CGTA 5I3HA 1AW5A 5I02A 1UCWA 1WDQA 3SRDA 2GJXB 3V5FA 3CK5A 1XBZA 2FZMA 3CL6A 2BS9A 2CZFA 1WOAA 4POCA 5DBTA 1JZ6A 2BY2A 3WD4A 4FOJA 2FGLA 4B4HA 3LA4A 4O28A 3R6IA 3U5YA 1ITCA 3OG3A 4IGSA 1LL7A 2QR6A 4CQDA 2PC4A 5BRPA 3RM4A 2PPGA 3C8NA 3GXIA 2XH0A 3MHFA 3TSMA 5E6ZA 2FZ8A 5CZ0A 1SZGA 1VBUA 1I2PA 4CQ8A 4NYYA 1F74A 3LCFA 3CXOA 3GXPA 1E43A 2Z27A 4U2YA 3O16A 4F0LA 2VR5A 4DI9A 3T40A 3LZ3A 4CD6A 3M0VA 4QLLA 4F40A 1TVPA 4DWSD 3MV01 1IIHA 1JRBA 2Y7EA 4IJCA 4EF8A 1DIEA 1OFDA 1UPMB 2PDXA 1TPFA 3B04A 4PUJA 4JHZA 2CU0A 3OLGA 1QASA 4LBRA 3R0KA 1OD8A 2A7NA 2WJFA 3AC0A 1NVMA 3GE7A 4MIMA 3O3RA 3TWAA 2QGYA 3WUGA 2PURA 5ABGA 1LCOA 4YN5A 3AWNA 2E6YA 3PBWA 5D2XA 3MHUA 1GK8A 5FJJA 1V7AA 2E6FA 1BLIA 3H7RA 3KP1A 4HD5A 2Q71A 1VD6A 1LG2A 2VVSA 3CO4A 3GVVA 4QP0A 2CLKA 4ZO8A 1BF2A 4C6DA 3K1DA 3WN6A 3SB0A 3WLQA 2AL2B 3SY8A 4B2DD 3LHWA 4YS1A 4DLMA 3CZEA 3PZMA 1W32A 1BXBA 4H9MA 4WRHA 3CQHA 1UG6A 5JIWA 3DH7A 1GOKA 3HG4A 4UNIA 3M9YA 2I5IA 3BAWA 5DEZA 4I5XA 1U1UA 5JBEA 5KMYA 4G1NA 3GQYA 2XN2A 1E71M 2ZFAA 1NJJA 4E2VA 4GNVA 1KFWA 5K7JA 4BI5A 1UR9A 4HNUA 1XIHA 1MW2A 4O4WA 1BSLA 3MKCA 1W6TA 3NOEA 2V68A 1W3KA 3UWWA 3UPMA 4OJYA 2CFFA 2PRMA 3IARA 5MKGA 1LT8A 3I10A 3EWZA 4QEEA 1T0OA 3S6OA 1J10A 4ZEPA 2E68A 1UKOA 3VIPA 3A3WA 4HK6A 3ARYA 3QVQA 3M6DA 3TYBA 1BXCA 3USBA 5FOOA 4U3CA 1VHCA 1CW2A 1XINA 4MAZA 4P8WA 2B81A 4UNLA 2D0HA 2Y7FA 1PZ1A 3SGZA 3CJPA 1FWJC 5I3KA 3S1GA 4TX6A 4XAYA 4XD5A 3GTHA 2OLSA 3CMFA 2W92A 1GOIA 4FF5A 5AHMA 3B97A 3T4WA 2FPVA 4MPKA 3TQ0A 1LM1A 2INZA 2E28A 3SO7A 4I9MA 4S3CA 3PUGA 3N6HA 2OQLA 4DXVA 4AZBA 3S2JA 1FFRA 4P7LA 1E1CA 5E6YA 2FZDA 4LALA 3VC5A 3W7NA 4GYKA 1UWSA 5M5DA 4H9ZA 2JBMA 3LXBA 1XLIA 1SUXA 1T7LA 5FL0A 4W84A 1E4IA 4A3HA 1WXJA 4HSOA 2ZC8A 3WCZA 4CU8A 4UNKA 2Q8ZA 2OODA 1ZGDA 4R5EA 1QNPA 3E0WA 1ZRQA 1KRBC 1M7PA 1QW9A 4HPXA 4IM4A 3LV5A 5AC8A 5HWJA 2J4GA 1KA9F 1OT2A 3LD5A 3MA8A 3DIPA 2R1PA 4NVTA 2GVJA 3UPBA 3A4JA 4ES4A 1EJXC 1LWHA 1SO6A 2XVNA 1PS9A 4KEUA 4ZO7A 3L2MA 3PZIA 4GZ7A 2WC7A 3W86A 2EG6A 1GJWA 3TR9A 3KVLA 2W6RA 3AS1A 2BGQA 3NM1A 4CNNA 1XLFA 3OP2A 5XINA 5LA2A 4TVCA 1F5ZA 1CDGA 3OQEA 2R91A 1FXPA 1NFBA 5C2CA 3EXSA 3WNMA 2G4FA 3I7QA 1NWRA 4QEHA 1ESWA 4ZR8A 2DY3A 1E4LA 5HAOA 4A3UA 1QXLA 2JIWA 2D69A 2VEKA 2WBGA 1TPWA 1WKEA 4IGNA 4GQ0A 3PAJA 4M51A 2QDHA 4N9DA 3GNDA 5H2ZA 2WANA 3G1VA 2VVNA 3LLFA 3HGSA 3JZUA 2WSYA 4HHPA 2PDJA 3A4AA 2A7PA 3DBNA 1XR2A 4YLWA 4JIIX 1OEPA 1I2RA 3W6LA 3W02A 5HPCA 3QLDA 3THDA 3N29A 4B16A 1W9XA 1VBJA 2HE8A 4GYJA 4UOZA 4JIQA 2PDBA 3HM7A 4L1XA 4NHVA 4DNHA 1YYAA 4F3HA 1TWWA 3BW3A 1GEHA 1E40A 1PAMA 3GYCA 5CSSA 2YKKA 3HFTA 4GUGA 2Q01A 3ZVHA 3AS0A 4LGXA 4RL3A 4A3YA 4ORIA 3NUKA 4ZFMA 4ZO9A 3RCMA 4I7WA 2BOGX 3TONA 4IT1A 4JCMA 4G7EA 4H2CA 3TROA 2BXZA 2VJXA 4S3FA 2PU0A 1UKTA 3MO7A 4IMGA 3N13A 4D6GA 1JEZA 2O7QA 1FDYA 4M19A 4DM2A 3K2GA 1PTGA 4K38A 3VI2A 2ZX8A 1TWSA 4XSLA 5IDZA 5HUPA 4WOZA 2WB5A 3DUGA 1XPYA 2GLKA 4C7DA 3RPTA 2I1OA 3SQSA 3EWCA 4UQBA 2WKGA 3M64A 4DWSB 2QCFA 5MF5A 5J04A 1EZ2A 1XICA 2V82A 4IH3A 1XLCA 3SBFA 1OVDA 3GTFA 4XV0A 1ML1A 5LXXA 5I3JA 1CPUA 2AAAA 5CJNA 4CQBA 3V75A 1ADOA 4ML4A 1UWUA 3D6NA 3VABA 3CM4A 2XDFA 1K1DA 5A6LA 3QFWA 2OEKA 3C52A 4PTVA 9XIMA 2QIIA 5A6BA 3NQVA 3TYEA 4EXAA 1PZ3A 3IIXA 2VEFA 1GJPA 2OX1A 1EQCA 1FWHC 1YBQA 5U4NA 1LBLA 1MNZA 2CXGA 4UFKA 2YPIA 2JEPA 4K8HA 3GNNA 4QX4A 3QY7A 1GVIA 3K4WA 2YBTA 3P82A 3QKZA 4GY0A 5BXSA 4XZWA 4C91A 4LYRA 5HMFA 2WNZA 3LTSA 2R9RA 1X6UA 3M41A 3W29A 4TIMA 5T26A 4C6BA 1QDSA 2X7VA 3R12A 1QOXA 1SFJA 4JY9A 1XXXA 3VGBA 1XYLA 3S0CA 3VX0A 3MZNA 1B54A 2QCEA 1DWGM 1BF6A 4JL1A 2D20A 3NPUA 2O55A 1H41A 1OX6A 4MLJA 1X97A 1IR2A 4BF7A 2YDRA 3H2CA 3RNDA 3M44A 2YBUA 4M8UA 1V0LA 1FDJA 4GZEA 4DJDD 5IM51 5F4XA 1UWTA 1JD7A 4N9CA 3VKBA 3N1AA 1E6SM 3W1RA 4F9DA 4Q8WA 2QVHA 4KETA 1WE5A 4JOMA 4RCXA 3CAVA 5D38A 1J11A 3C3UA 1EDGA 3EB2A 7A3HA 3UZJA 4AZCA 3ZVIA 2RH9A 2GQ3A 3CQIA 1RR2A 3BANA 2DZPA 1SO5A 3MUY1 1AJ0A 3M0ZA 4UTUA 3RM8A 1IEQA 4PCSA 3SSZA 2XFFA 3HURA 1W3JA 5LHFA 1Z89A 4ZOBA 3GH4A 1KW1A 3B9OA 4QS5A 1OINA 4HP5A 1P0DA 1WDDA 4HA0A 1OY0A 2FFIA 2BFGA 3ECQA 4Q8TA 1DL3A 2PDFA 1ZTVA 1K02A 1B4KA 1XYZA 2VWTA 4QAIA 4QM1A 4RUBA 2VOMA 2CBUA 2VXNA 4CN4A 4F66A 2JALA 1XQLA 2F6XA 4XAGA 5LXEA 5BZAA 4P61A 4PTMA 4L6HA 4P2VA 1SW0A 1J4EA 2E9MA 1TA3A 4AZHA 3AS2A 3CPGA 3EKLA 2VTFA 3S47A 3ISIX 4XBJA 1MXSA 2OTDA 1FTXA 4PUDA 4DF1A 3ARZA 1OJXA 1UR3M 4GQGA 1TJPA 2W63A 4P8VA 2VFGA 1VCVA 4K39A 1N82A 1UR0A 4D6HA 1R5YA 2A85A 1OSEA 4RLIA 3ZIZA 1HKKA 3JW7A 2PTZA 1J6OA 3GW0A 3NDZA 4NI8A 3UEQA 5LSMA 3WLTA 2EG8A 2DV0A 2O4MA 5BRQA 3W7DA 4HNOA 3N17A 4ZO6A 1Q7ZA 3TKFA 1XYFA 3KRBA 1ISYA 1RQHA 4DJFA 5CBBA 1LLOA 1B5TA 1GOMA 4O4VA 5JXQA 3HPXA 1OCQA 1US2A 8CGTA 1VC4A 2XHYA 4OZOA 4PC8A 1A0EA 1GUVA 4YTUA 3BJSA 2ZRUA 4LB4A 3PUOA 4EE9A 3GHUA 2I56A 1UD6A 5D37A 3SADA 1KR1A 3VNJA 2XSAA 5ABHA 1PXGA 2GDVA 5G4WA 4DQWA 4FLOA 1TUXA 2V5BA 3WF4A 1JIBA 3DKLA 5D32A 4DO4A 2ZUSA 3E12A 1E15A 3QGVA 4XUYA 1J93A 2OWXA 1DP0A 1K7EA 5K3VA 4W85A 2CERA 5BCAA 3LG3A 1E5JA 2HVOA 3F2BA 2HS6A 2PTDA 1XX1A 3UR2A 4KEMA 2ICSA 4JFWA 1EHAA 4HZ6A 4US5D 3CL8A 2WZMA 3LHYA 4A3QA 4ZZ9A 4MADA 4R34A 5HXMA 1GTEA 2VGGA 1W2VA 3EKZA 3P74A 2HCVA 1Z3NA 1FWRA 2D73A 4WXZA 3TYAA 2NWSA 2BG5A 2W0UA 1U1JA 3A6OA 4KCUA 5BXPA 4AWUA 1HO4A 4H1ZA 2Q3RA 3S4TA 1HFBA 2HSAA 3QM3A 2VZVA 4BQ3A 1W2PA 5HINA 3SRKA 4JTFA 3WY1A 1WBJA 1VAHA 3O63A 1VFUA 3LMZA 1IWBA 3D47A 3N6QA 3SQLA 3SI9A 4B3KA 3NPXA 4UTFA 3KP0A 2BMBA 2GSHA 3R89A 1KM3A 2QMKA 4IUGA 1GVEA 1PX8A 4EAYA 1EWEA 4S39A 3EEGA 1A5BA 4WJ8A 1VIZA 1GPFA 3P62A 2XZ7A 3MUCA 3H2EA 2NVAA 4UZSA 5DCEA 4LJ3A 3WKZA 4HNCA 3W2LA 4UFJA 3SUWA 1UP2A 3QXBA 5BXTA 1K3UA 4OGZA 5E70A 2PLKA 4KCVA 3R94A 3VDHA 3T0DA 1MDRA 1EH9A 4QITA 1O5QA 3SGUA 1LP6A 4UCGA 2E5BA 4KWVA 4JBRA 4AF0B 1AMKA 1V0KA 4F4RA 2V6AA 2Y8UA 1ONEA 2NLIA 3CHFA 3CUGA 1XCXA 3DG7A 2SFPA 3LZ5A 3SCPA 1RPXA 1MQQA 1KFLA 1V51A 1UIOA 2E0PA 4CNTA 3IVTA 1PTAA 3G5EA 2DW7A 3S2NA 1I1XA 1XRVA 3V18A 1E1EA 3CYVA 3IJLA 1M7OA 2KAUC 3CL7A 1WCGA 4FOKA 4Q4MA 3PSWA 3ZQ9A 2FJKA 5A8GA 3AOFA 2YOCA 1VEPA 2ZUNA 3REQB 1X39A 5A8PA 2YYUA 4U5KA 5F1UA 4B5TA 4L1GA 3B8UA 1ZB5A 1T8XA 4TTUA 1WZKA 4GC3A 3UCQA 2JGYA 3VPLA 3MS8A 2ISFA 3BARA 3WJXA 4OT7A 3MUXA 4ASTA 4LQ1A 4KQNA 1LT7A 3U3HA 4DWDA 4HVXA 5C55A 2VHLA 1F4AA 3ALFA 2ACSA 3T05A 5C9RA 4AXNA 3FV9A 3W37A 1H1ZA 2EXOA 3PN8A 4AW7A 1GQLA 3WQPA 4DYKA 1VFHA 1A5OC 4S3JA 4K2SA 4A22A 2HROA 3S6TA 1QW7A 4NXKA 1WZMA 2WCSA 3HFYA 1BYCA 1GG1A 1CGTA 3DHUA 4ADUA 3EDFA 1O6IA 1FOBA 5D33A 1BVNP 2E09A 1HKWA 4AIOA 5FJIA 3STGA 3AHVA 4IWWA 3WBWA 5B7YA 4UBPC 3BICA 4LVDA 3W7EA 4DXKA 3FKKA 1AD4A 3NL6A 4GJIA 1GQJA 1S2WA 2XIBA 4N4PA 1IEIA 3DFHA 3G77A 4C6LA 1R2SA 5EB8A 3N9RA 5BW6A 5KETA 1QBAA 3WDIA 1XD0A 1GJUA 3M0KA 3LLXA 4IIFA 4H9VA 1ECEA 3LBOA 3AXXA 3O6YX 3N2CA 2DZSA 2QJMA 5EBAA 3SIMA 1C8YA 1PJ9A 1K9TA 4FAMA 1MO0A 2EJAA 1ALDA 3URQA 1G7VA 3I4KA 3W6MA 4C6FA 3S2MA 1UKPA 2HISA 2WSQA 3TLQA 1QPOA 1ONXA 1WDRA 3W7JA 3Q37A 2VL4A 2DORA 3VNMA 3S5YA 1XV8A 1DXEA 2BWGA 1EOMA 3W84A 4DPPA 4DBWA 1LOSA 2E7FA 3VK5A 4HMEA 4L4PA 2O7SA 2HDJA 2JIEA 1XYAA 1UKSA 4RZ5A 1JDFA 1Z41A 3M0YA 5EGRA 5HNRA 2C91A 1AL8A 3AUOA 4LS1A 3B4UA 4MWAD 4WSKA 3TZNA 2YGYA 2QDDA 3UXAA 2GOKA 1PDYA 3G1HA 2AOSA 4PULA 3ZJ7A 2GK1B 3KS6A 5G2IA 4RW3A 1NY1A 1ZZMA 3EOLA 1K8ZA 3OHMB 4CNOA 1CGVA 4D1IA 1GQKA 1J0YA 1HP4A 2PSNA 1GYMA 4FNPA 3KVKA 3LM7A 5KZMA 1CLVA 3W7KA 5AHFA 5H91A 3UNTA 3LQGA 2DSKA 2J7BA 3KRUA 4ICCX 3RF9A 1XC6A 5K4XA 2ZC1A 4XVDA 3C5QA 3GXMA 4KRUA 4QJ3B 3CB3A 4YTSA 3IVUA 3W83A 3GNOA 4IPIA 1REQA 4L9YA 1ZLPA 1LBMA 4MFDA 2A3CA 1Y65A 4Z2JA 1NF7A 2QEZA 3FCPA 3V16A 1P7TB 3SCRA 2HMCA 4M29A 1BSIA 2OT1A 5F1VA 3KCLA 2ESCA 2Q8LA 1M3UA 1XLDA 1FX6A 2NQJA 3RU6A 2GJNA 3MMTA 9XIAA 2VR4A 3IJ9A 4O18A 4HTYA 3SECA 3FS2A 1H7WA 3STCA 1XUZA 4QFUA 4WR3A 1JF6A 3CV6A 3PSVA 5FSEC 3QMRA 2I7GA 1AH4A 2XM1A 1Q45A 4E0CA 2OSYA 1K9DA 2IXUA 2GUUA 3Q4DA 2AAMA 1SW3A 3S6DA 1J0ZA 1B3XA 1B4EA 1ZNNA 4UTHA 1TWZA 2QCCA 1AH0A 5LIKX 5HR7A 3RMEA 2ZTJA 3AU6A 3T7VA 5I07A 3B8TA 5C9ZA 4RE0A 1YNPA 3IJ6A 4Z08A 1KQZA 2Y24A 1D9EA 1BYDA 1JCYA 1QI0A 3XINA 1Q13A 1L9WA 3DFYA 1KV8A 4DXXA 1RP8A 3W7IA 2WMIA 4H8NA 5CPLA 2Z1SA 1VPQA 1EL3A 4ILSA 1OB0A 3GG0A 3H2NA 4WSJA 3CWHA 5H6HA 1V4YA 1DWHM 1FH9A 1KRMA 5EMLA 5IRPA 1R6WA 2JGQA 3KBSA 1R3TA 2E6DA 1SSDA 2VWSA 4WHBA 4RV8A 5CH9A 1GW9A 1UH3A 4GVIA 1DVJA 1XD1A 4ZTYA 1ISZA 1EBGA 4TU1A 4UTKA 4D1JA 2GVEA 3DU0A 3DC0A 3H7UA 3UQNA 2O9PA 4FXRA 3VIIA 1BQGA 4HMNA 3UGVA 4S3GA 3ICJA 3CBWA 2B7NA 1DJHA 4TOQA 1KXTA 1IQ8A 4YJ5A 3DERA 4IPPA 4DO6A 4PMOA 3LTPA 1G4EA 1NU5A 1LRTA 1ZENA 4H9TA 2X7WA 3F4VA 3GG8A 4Z0JA 5D05A 2OZ0A 3UZZA 1SU5A 3W76A 2BGNE 4K8EA 4ATWA 3MSGA 1ZHAA 3N73A 2J27A 4K68A 4P7OA 1V3HA 3QPZA 3RXZA 2BHUA 4LS0A 4XBKA 4D8AA 2V5JA 2ZXDA 2PI6A 2ZRXA 2NW0A 1P43A 3K13A 5C6MA 1G0CA 4B5UA 1PUDA 4E8CA 1JPDX 3S2CA 1JCNA 3BJTA 5IHSA 4LWWA 4MZYA 2W91A 1UD2A 5E93A 2Q09A 3P2VA 3AALA 1V6TA 4IOTA 3FHAA 1D8CA 3NDYA 1W54A 2NLYA 1A3HA 3B8IA 1POKA 2GDUA 4WKAA 4A21A 4ERIA 4XZHA 2RDWA 5BYWA 1J5SA 3OLEA 3LB0A 4Z2KA 2F38A 2ACQA 4UQ9A 3RRAA 3QC0A 2XWEA 2VC9A 5I2UA 3PBMA 1WAUA 4GHRA 5E1QA 1RP9A 8XIMA 1F76A 1C90A 1I0BA 1V79A 3O6CA 1U5JA 3LRLA 4W7VA 1WQ5A 5CZJA 1S2CA 4WDUA 2E25A 1OC7A 5AFDA 2G95A 4Z0SA 4BI7A 3MI2A 2BSLA 3H7VA 4LUYA 5M1TA 4H41A 3QOMA 3P67A 1S2TA 1DWFM 3WFZA 1QNQA 4GFSA 4I3GA 2Y62A 3KDNA 4FI4A 2YL5A 2PDQA 3BQ6A 1PO9A 1FHLA 3GZAA 4UMBA 4IP7A 3AUJA 4ATLA 3MVIA 3BPWA 3PZNA 5EBUA 1M5WA 5DT5A 1W1VA 3A21A 5CC3A 3N12A 1B9ZA 1IT8A 4IUOA 1O95A 2PGRA 3PB0A 3O05A 2GUBA 3WLNA 2GUYA 2WJZA 2QF8A 2AGKA 5B7ZA 3C6CA 3T1GA 3AIWA 1OK6A 2A3HA 3V7PA 1JDDA 4OOUA 4TR9A 3HG2A 2J8FA 1H1YA 4MWAB 3WG6A 1BEUA 2PC8A 1J9YA 1XF0A 1UR4A 4E38A 1OGSA 3ABQA 3S3GA 5IXEA 3TQVA 4GG9A 3AJ7A 4F48A 1CLXA 3MSYA 3QYQA 3LPOA 3M5ZA 3OQ8A 5CQ1A 4H7VA 1Q5MA 2GJXA 5GQBA 3EEZA 3THUA 3JZEA 5E5CA 4MHBA 2WV8A 3WUEA 4HHHA 5AHNA 1GVOA 3G1XA 2XUCA 1H1NA 3WQVA 4OVXA 2OXNA 4YCOA 1UQZA 2J9YA 2UZ9A 3QW3A 1OM0A 3QTPA 3OBAA 4GI9A 3ENLA 3QTGA 4MVAA 3POHA 1M68A 1XGDA 2AKMA 4JPGA 1TR9A 2G97A 2WSRA 2VDGA 4XB3A 4WY0A 1BGAA 4PN2A 2GGEA 3L4ZA 4Q4QA 5I79A 1TWIA 3CQ0A 5CEWA 4IMAA 2X41A 1LYXA 1DPMA 4R85A 2F2HA 3HJEA 3A22A 3UWEA 1PBGA 4P7QA 1EJRC 3LPGA 3F5KA 1I4NA 3N4AA 3NVDA 3F2DA 2DH2A 4JTAA 2ZBTA 1ADDA 2NZLA 3O2LA 2Q02A 4H8HA 3NSMA 4JFTA 4NJKA 4XUGA 2OFJA 2CZDA 1B90A 5FJTA 3LBMA 3JS3A 1UQYA 3NTYA 1RK5A 1RCXB 1GCYA 3C56A 5AVNA 2EQDA 3N4EA 4RDWA 1MXDA 4QS6A 2ZE0A 3GZ3A 2YR1A 4LSBA 3QV8A 5KZEA 4JFUA 1MRAA 1C7SA 3BOFA 1A5KC 3L0GA 2DIJA 3QZ6A 2Z24A 3G3MA 1C8VA 2AL2A 2Z29A 5F7UA 1QT1A 1EJVC 3RFAA 3XISA 6XIMA 3EDJA 3ARVA 3IIZA 3VIHA 4M6PA 4B92A 1ZPTA 3T8LA 4XKYB 2X1SA 2FHBA 4H4IA 1GOWA 1PEZA 1GW1A 1FP8A 4CGTA 3UU0A 1F6YA 1O5RA 1ADSA 1GVSA 4X2RA 4JGDA 3AMDA 2PDCA 4GIRA 5I78A 3HV8A 1W9BM 4I7UA 3O0FA 5DFAA 4KH2A 2AGTA 2G5WA 2IS7A 1KKRA 1G5AA 3GU1A 2ZVRA 4PBFA 4NSBA 3OIXA 3BK0A 3SFKA 5C0QA 1L6GA 4GVGA 4FR6A 4JICA 3ZT5A 1NARA 1SJBA 4OE7A 3MSDA 3BSHA 3LCHA 3DXIA 4N0RA 4XVEA 4QCFA 1IT0A 5EYWA 2BHYA 1SM9A 3SSJA 3W4RA 2D24A 2PD5A 4N4QA 3WQWA 4EAMA 4DX3A 4YIWA 2CWXA 2CLEA 1S38A 2PLMA 3ZJKA 3UWQA 4ACZB 5HNTA 3BAKA 5C54A 4MDOA 1N8WA 1W5NA 3JVAA 1R46A 3MCMA 3C86A 4GUHA 1QPRA 1EC9A 2NX3A 4IG2B 5HMEA 2QAPA 1HJSA 4ZOAA 4MJMA 4A3RA 9CGTA 3ES7A 4GXMA 4LRSA 2HQAA 1Z8AA 4PEKA 4UTTC 4QQUA 1SZNA 4Q8NA 3SUTA 4B9YA 1US0A 5CPSA 1OF8A 3PZUA 4HU3A 3HG3A 1WV2A 2DVTA 2ZZ1A 3OYXA 3ARQA 5AN7A 4C1LA 3AMGA 5E9XA 4DEFA 2GVLA 1QPNA 2P10A 3VCCA 3MC5A 1SO4A 3CO8A 4CCDA 1LQ0A 1FP9A 1OYBA 2FHCA 4D71A 3AMKA 4E8DA 4PMNA 4GUIA 4TMCA 4R27A 1WXZA 4V1YA 3SAZA 2DH3A 2AMGA 3FOKA 3PP7A 1PIGA 1SJDA 1JR1A 3ZS4A 4GABA 1ZP4A 5FF3A 4KWUA 2VI0A 4ZXLA 2ISWA 4R7JA 5GPRA 3U7VA 3IIOA 2WZEA 1E9LA 3C4UA 4ZA0A 2CHOA 3QEZA 3T9PA 3R10A 1B9BA 3OO2A 1FA2A 3VOFA 4E3TA 3WL1A 4MNKA 3ABZA 2J77A 3BLKA 4B5VA 2H90A 3QLLA 3ZLGA 3TV8A 4NRSA 3DDMA 2C71A 3BLOA 1ME9A 5IFTA 2WVSA 2YB1A 4PMXA 2CCRA 1H7OA 1O68A 1Q66A 1V02E 1MW1A 3TTEA 3G0XA 3VZYA 3BW4A 1I1WA 3JU2A 1G69A 3QOKA 2GSJA 4DYJA 1UBPC 4AEFA 4C7GA 1X6LA 2ZUWA 3I7RA 1M1BA 5E9AA 4ZB2A 4QSFA 4FP1A 2P53A 3R5EA 3NQBA 3RO6A 1RV8A 2PF8A 5C9WA 3L12A 2CNCA 4DY1A 5KEZA 3IK2A 2IKJA 1ZUAX 1E6RA 4X3ZA 5HULA 3PPHA 3DC8A 4LVAA 4TQTA 2XYLA 5I6SA 2XGIA 1EO7A 1KBKA 5LIUX 3VDGA 1KFBA 1L6SA 4N6EA 4UTWA 2ABAA 2QS8A 1JQVA 4YU1A 4PMJA 2BY3A 2VCCA 2X2GA 3EKGA 4B5SA 3HZ3A 2JQXA 3NGFA 3VKKA 1VFOA 1XS2A 3PJUA 2VX5A 3KLLA 3OLIA 2ZX7A 4H6RA 5H1WA 2A6NA 2QULA 3GDKA 2IQ0A 4IIGA 3BOLA 1TPH1 4GY1A 3S42A 3GKAA 1EZWA 5GJPA 4AD0A 1OYCA 1BAGA 2FB3A 1JDAA 3TH6A 4QG8A 2YCEA 3ARXA 3N4FA 1CXEA 5EKYA 4C5ZA 1VCGA 3CHDA 5EMMA 4GY7A 5JVLA 1C91A 4HMCA 3PFMA 3GTIA 3HPAA 2J8TA 3KAOA 1IHIA 4Z2LA 1J6PA 3OB8A 3CHCA 4U2ZA 1G67A 4A8LA 3RU8X 1YTKA 3EB3A 1LLWA 6ALDA 3GFXA 4P8XA 4DBUA 2A79A 3LS9A 4B15A 4KERA 4DWSA 3P93A 4QJ4B 2JE8A 3CV2A 4ZE4A 1RZMA 1QHOA 3LN3A 2ZZ6A 4X61A 4M0XA 3ZT6A 2HPIA 1GVRA 3CUJA 4LBSA 3WK1A 1UA7A 1TTIA 4GZIA 5H8MA 1T8QA 1CXHA 4M6VA 4KGLA 3LERA 3VD7A 2QPSA 1JYVA 3HOJA 4WKFA 1S5WA 1AFSA 1KBJA 3A9BA 3T4CA 4NZFA 2OOGA 1EBHA 2YJQA 2C8NA 1MRQA 4GGBA 1N8FA 3W1NA 4XX6A 3WQOA 3MMDA 1ZS2A 4EKJA 2V9DA 3HB9A 1A47A 1BVZA 5IBXA 1KTCA 3L9CA 3IWPA 2XIQA 3A4WA 3AISA 3A5FA 4YYFA 1HT6A 3PJXA 3SFWA 4AZ7A 1L6WA 2C14A 5AZ1A 1ZJBA 4JQAA 3FYYA 4OBSA 1ZAHA 2C1HA 4IFRA 5D04C 2WLZA 3TN4A 4GGHA 1TE1A 4J3XA 1YNYA 4AB4A 1MW3A 1B3VA 2FH6A 4QG9A 3GBDA 3BAYA 4HOWA 2B4GA 3ATZA 3FA5A 2PTWA 1RXOB 2H9AB 2DVXA 4N9EA 1WX0A 1OIFA 3POCA 3TVAA 2DPEA 2PEVA 1ONRA 2OEJA 3VNZA 1H7PA 2IQDA 4GI6A 2CWNA 2B7PA 8RUCA 1PKMA 1TV5A 3SN0A 4Q6JA 6TAAA 4FALA 2OO0A 2Y6ZA 4ORMA 4JNMA 4RE3A 4MY1A 3W75A 1TZ9A 1Y0EA 3A13A 4UMCA 4N6FA 1Q8JA 2LLEA 3LEPA 5LA1A 1PKNA 1XH1A 4JTJA 4F2TA 4QIUA 1TV4A 2Q6ZA 5L9FA 1VYSX 3TQPA 1GOQA 2A7RA 3PHAA 3FA3A 3ABRA 3KOFA 3NQEA 2OVLA 3PG8A 1UUMA 1UMLA 5J8LA 6A3HA 2UWFA 5DY3A 3W2MA 3T81A 3VOHA 1CLKA 1IZKA 3NZ1A 4JTLA 3W82A 4UOQA 4F0SA 1R87A 1UZ4A 4PSPA 4BWLA 2NVCA 3KZSA 2V0TA 4Y9OA 1E3XA 3MZ2A 4ZQPA 4AD5A 4AWTA 3FAWA 5AYYA 3KW3A 4TMBA 4UQDA 3LSBA 1EA9C 4FHAA 2QNEA 1VFLA 2OYLA 3GW3A 1B0IA 1WA3A 3OYZA 5HANA 4PSRA 3NQAA 4JYDA 4I9TA 4M6UA 3TIMA 1WDSA 1CXLA 1W0MA 4JTTA 1WOBA 1IWPA 4WF7A 2DVUA 1EFZA 3P7YA 3TTYA 3UVIA 3WK0A 2OLAA 3PWIA 2CC0A 3WF3A 2OKTA 5G2HA 1W31A 4DAIA 2FVLA 4WK9A 4H83A 3LNPA 2E8YA 2VOTA 2OQHA 3WQCA 1A3XA 5KZ6A 1XLMA 3EA3A 3WH5A 4ADTA 1TKKA 2IPWA 4O0ZA 4F0HA 2WPBA 2ZA1A 3AYTA 3GAKA 4MNMA 1QVBA 4ROQA 1KBLA 5D2VA 1R0MA 3EDKA 1EDTA 4UWMA 1AJZA 1JUBA 1F4HA 2EEXA 1WDPA 3OODA 1CBGA 1QMLA 4LH8A 3PM6A 3VFCA 3UG5A 4JN8A 4IJBA 3LHZA 4KEVA 1U30A 4B4FA 4GK8A 2O9RA 3OZYA 1PX3A 4WJXA 1JYXA 3W2UA 3U4AA 1KTBA 1S2VA 1EJTC 2Z7KA 2NWRA 2BY1A 3AZRA 4AISA 1NIUA 2QCHA 3IAPA 3MCNA 1EF2A 5LNRA 2XIOA 4ICMA 1JDEA 3L4UA 2WW5A 3TQKA 4H9UA 2W5FA 1MEIA 3OZOA 4XBSA 1C93A 3DI0A 4QDMA 1C8XA 3N15A 2E8ZA 3R13A 1KFCA 4YTQA 3TZFA 3V0UA 5I06A 1V6XA 1K4GA 4PMZA 5FEWA 4FXJA 1VFSA 1NP0A 1AZ1A 3CV7A 5CPQA 4JEQA 3T07A 3W27A 1GEQA 4MJ2A 4AZ5A 5BOFA 3WH7A 3UT0A 5AYXA 2FYMA 3IANA 4HCHA 4YYCA 1GPWA 1EJUC 4XZNX 1IT7A 2WM1A 1M04A 1P6BA 3AIUA 2IPGA 2OGJA 5FF2A 2WHKA 1PWMA 4PBGA 1NTHA 4IX2A 1TMQA 1UC5A 3BXWA 1ZBCA 2PP1A 2J62A 2DJXA 2Z26A 3VYLA 2BVWA 3W1TA 5EMUA 1W1A1 4H19A 1SR0A 1IXNA 5CC6A 3U2CA 1FY6A 3NSXA 4LANA 2VQUA 4AY7A 1BYAA 2HVMA 3WENA 2RFGA 1R3VA 1K77A 5DCBA 2VD8A 5HJLA 1DEDA 4AEOA 3B40A 1D7KA 1EJSC 4EWND 4JTIA 3OZMA 4XD4A 2P8BA 3UWYA 3WNPA 3FSUA 3FGCB 2YB4A 4OQVA 1IIGA 4U31A 3NEVA 3TFCA 1HN1A 4KW2A 2ZZ3A 1E5NA 1RJPA 4MWAE 3S5NA 3L21A 3P8JA 2W62A 5FJUA 3UERA 3KFTA 1ME8A 3SDOA 3I6TA 4KF1A 1XPGA 2TMDA 3O8AA 4S1FA 3WD0A 1OX4B 4Z1DA 2DUXA 1L8NA 3EXTA 4E4UA 3WLPA 3EA2A 5D9OA 1BTCA 3KCOA 3OOQA 3MW7A 3W1PA 3CLWA 2YZ5A 5K9CA 5DMLA 2W79A 3UXKA 2I5QA 4IGHA 3FA4A 4B90A 1PV8A 4HZMA 3NIYA 4PRWA 3L2IA 1R47A 1U22A 1I2OA 2ADAA 1DWJM 5BRBA 1OFBA 4WKHA 3IGXA 2P88A 2P0IA 3RAOA 4NZ5A 4W93A 4WUIA 1O94A 3EWDA 4E2BA 4QHRA 4IPNB 2Z2UA 3ITVA 4K7VA 2A6LA 3VE7A 4HU4A 1FWGC 3THCA 1TV2A 4IGMA 4G6CA 3GS6A 1Z69A 3OVPA 3WF2A 3WLMA 4AD2A 1GTHA 3U6WA 1QI2A 2CLPA 1DYSA 3UR7A 1CX9A 3MP4A 2EG7A 1GG0A 3VNIA 4YTRA 1UBSA 2P3EA 3EOSA 4HK7A 3AIEA 4GFIA 1LJYA 1RA0A 3ZM8A 2D22A 2VMFA 2QUTA 3GVGA 3WH9A 5A8OA 5J5RA 2J8GA 1ICQA 4FSAA 3EAUA 1AODA 3CH9A 2UY3A 1UKQA 1K6AA 1SFLA 2ZRVA 2VYOA 4UFIA 4UTIA 3STFA 1TMLA 2JK2A 2VRKA 5FL1A 2CPUA 1QR7A 2X40A 1KCLA 2IPFA 4RDZA 3U2EA 3REQA 1PVNA 3R79A 1TR1A 4C6CA 2YCLB 3FVMA 1LUCB 4YHEA 1TYGA 5A8NA 1PHQA 1JNDA 4DVOA 5DF0A 1B30A 4XK2A 3UESA 4Q4KA 2WHMA 2YIHA 2FVKA 2A1YA 3MTWA 7CGTA 3NSNA 1QK0A 2CBIA 4QLKA 5FJPA 1XKYA 4E2OA 1V02A 1TJRA 1V93A 3C0QA 3LRKA 4OBTA 2Z1BA 3AYRA 1TQJA 1DJYA 2QCMA 1NEYA 4KFNA 3UJEA 4KIRA 2XWDA 2R1NA 1MUCA 1DJXA 2VM8A 3TC7A 2WJEA 3G3DA 2J75A 1V3IA 3AYVA 3CIXA 4TV6A 5ECUA 4HPJA 1J79A 2YLLA 2P8CA 3O06A 3LI1A 1FXQA 5G1TA 1GHRA 3VNLA 3P3BA 3IJ8A 3QMSA 3GIQA 4ADSA 2WC4A 3EPMA 3E5PA 2VZTA 2FGBA 1EX1A 1UUOA 1UROA 4HA3A 1NELA 3VNYA 4L65A 1WB0A 2QMJA 3FYPA 3KTCA 2E77A 1YADA 1WXYA 1LG1A 1SW7A 4BHYA 1GNXA 3WEMA 4H00A 3DEQA 4GYPA 5FJRA 4Z1YA 3NQ6A 4OTKA 4J3UA 2J79A 4HGXA 4LEQA 2ZXQA 3MKKA 1NQ6A 5AVHA 4DUWA 3A23A 1KM5A 4UFLA 3A3HA 3LOTA 5IHRA 2WM0A 4MKSA 4QSHA 2V5CA 3NVTA 3VDCA 2O0TA 1MEHA 2DSWA 3C2EA 2NT0A 3T08A 3TDFA 1GOOA 1OQFA 3WQDA 3NYZA 1K70A 1RQBA 2NUYA 3VNDA 3R4IA 3OVGA 2VENA 2EPOA 5FESA 3PG9A 5HQMA 1OZMA 2GWGA 2RDXA 1I6NA 3AHXA 2FZNA 3JR2A 1NFPA 5F2IA 2P3ZA 4H01A 1F3XA 1TVLA 1IV8A 1OIMA 3N25A 3I65A 1DKWA 2QHAA 3N2MA 1QI4A 2J88A 1UOKA 1R9XA 1UZ1A 1DBTA 2G8ZA 2XU2A 4J3TA 4BI6A 1VP5A 4PTXA 4XZMX 3ZLFA 1KWGA 2X0SA 2X1UA 5D9PA 3Q94A 3C2VA 3RX2A 4XWUA 5AC6A 4LNYA 4PEEA 1RVGA 3CS2A 1OCNA 2GK1A 4GH3A 4LW7A 2CLMA 1LBFA 2OPJA 3AXKA 2INFA 4ONVA 2DIEA 1NF0A 1BRLB 1YTDA 3GHSA 3SQMA 4YMZA 1FWCC 3N2BA