1VFHA

Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
382
structure length
381
Chain Sequence
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
molecule tags Isomerase
molecule keywords alanine racemase
total genus 124
structure length 381
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfhA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfhA02
3WQCA 3SY1A 1XQKA 4BEUA 3N29A 3WQFA 4BHYA 1TUFA 3GWQA 3AWOA 2NV9A 2P3EA 3B8UA 3C5QA 2QGHA 3LLXA 3KW3A 1L6FA 2J66A 3B8TA 3UW6A 2VD9A 1TWIA 1BD0A 4PB5A 4LUTA 4LUSA 2RJHA 2SFPA 1B54A 4BF5A 4ILSA 2DY3A 1HKWA 3R79A 3NZPA 2YXXA 5GJMA 1W8GA 5GJPA 4ZGYA 2NVAA 3HA1A 3MT1A 1EPVA 3AWNA 4PB3A 3E6EA 2ON3A 3CO8A 1L6GA 3N2OA 4AIBA 1F3TA 4DYJA 2RJGA 7ODCA 4XBJA 3WQGA 2PLKA 4KBXA 4BEQA 3OO2A 1D7KA 1HKVA 4WR3A 3WQEA 2VD8A 3B8VA 4FS9A 1CT5A 1VFTA 1KNWA 3WQDA 1XFCA 5FAGA 1XQLA 4LUSB 3HURA 1NIUA 4LUYA 4PB4A 3E5PA 5IRPA 5BWAA 1SZRA 1SFTA 1NJJA 2ODOA 5GJNA 3ANVA 1RCQA 3CPGA 3ANUA 3N2BA 5FACA 5FAJA 2TODA 1QU4A 2OO0A 4ECLA 1KO0A 4QHRA 3BTNA 4A3QA 4V15A 1VFSA 3S46A 4LUTB 3B8WA 2PLJA 4DZAA 4Y2WA 3NZQA 3VABA 4XG1A 1FTXA 2O0TA 1VFHA
chains in the Genus database with same CATH superfamily
1EOMA 5I3JA 2D0FA 1E56A 5BWFA 3EWWA 1P5BA 1OFBA 1TWZA 3W38A 2C19A 1MXGA 1A4MA 4MJ2A 3N4EA 4DZ5A 1S2WA 1ECEA 3G0XA 3V0TA 3T9PA 3TFXA 5B7ZA 4Q33A 1CGXA 4Z17A 1HGYA 4ONVA 2QJHA 4RUBA 1G94A 4I5RA 2C1GA 4L4OA 4BK9A 2WSQA 1OFDA 2Y0FA 5BRQA 3QMRA 3LV6A 4M24A 1LRQA 5IM51 1EOKA 4ZO6A 4BF7A 3DI0A 3KVLA 1M9HA 3FAXA 3E2SA 3AXKA 4UOZA 2ZC8A 2ZX7A 2E6FA 3SJNA 1UC5A 4NUWA 1S3HA 2OWCA 4IQDA 5DANA 3SR7A 4IMAA 5E70A 2FPVA 2IS7A 4BY3A 1C9WA 4WD0A 3CUJA 5BOEA 1KGXA 2F61A 3H4XA 3DC0A 4LXFA 3R0DA 1TQJA 5CPSA 2PB1A 1UD4A 1E1CB 4NXSA 3AQUA 4QSHA 4HN8A 2YBVA 2NV1A 3SSZA 3OB8A 3ABQA 1XBVA 3U5YA 3CC1A 3UNTA 1Z6KA 3BGGA 4KMQA 1FVPA 1X39A 2ZUTA 4JIPA 3VIJA 3S6DA 3VNLA 3VIMA 3SDOA 3VGFA 4LS0A 1Q6GA 1QW9A 5BOOA 1ADSA 7PTDA 1A5BA 3VD5A 3O6DA 3I68A 4BWLA 4HU0A 4E4PA 5DBTA 2Z7KA 3PZ9A 1CDGA 1C7SA 1K9DA 4IPLA 1X8CA 3UJFA 2X41A 1RVKA 1WKYA 1X6NA 2QIIA 4AWEA 3PFRA 1ZJAA 1IT0A 3W76A 4PFMA 5EU9A 1RPXA 4GISA 2W67A 2VWSA 3HJZA 2QQ6A 2Y6ZA 2ISDA 1OZMA 1GGOA 3D46A 2VP8A 4BI6A 1Q2RA 3LG3A 4Q8PA 1CBGA 1H1NA 2XINA 2I57A 3B8VA 3NQAA 5A69A 1AQFA 4ACZB 3M4HA 2EPMX 2WANA 3EYPA 1W1ZA 2DZVA 1O60A 1Z69A 4MYXA 1MQPA 3QPZA 3UPMA 1QFEA 1EP2A 4Z1DA 3THQA 3STGA 1NARA 3H55A 2IXUA 2E6YA 5HAOA 3UVAA 2WMGA 3M16A 4IISA 4D2JA 2HXTA 1ZBVA 4LEQA 2PTYA 3DECA 1HVQA 3SSJA 1GZGA 2HBVA 5C6MA 1IEVA 5E6YA 1AH0A 2CPUA 2VQTA 3I10A 4LVFA 5C7VA 6ALDA 5CC6A 3W37A 5LIWX 3LX9A 4AMAA 4V1YA 3LHZA 1XGZA 3QMSA 3BOXA 4G7EB 1DJIA 3E2VA 3EWUA 5IDZA 1KLYA 1OIMA 1F4AA 4ERAA 3W22A 3LRLA 2NXIA 1WX0A 4DWSA 1QO5A 1BRLB 2V5LA 3W24A 1HO4A 2YCIX 2JF6A 5T9CE 1KC7A 1U5VA 2ZUUA 2AGKA 2SFPA 2WC4A 3THDA 3LSCA 3WNMA 2DSUA 2WHMA 4S3BA 4CGTA 1ICQA 4G8TA 5K9DA 1RK6A 4J3VA 1YTDA 3LCLA 1NFBA 1KD0A 3SAZA 3URQA 1H63A 4NX0A 1E15A 2OQYA 1L6GA 2NQZA 4ZMGA 3U2OA 3L5MA 3CWHA 4I3GA 1NF7A 3I7RA 2IQ0A 4B2DA 1RXOB 4D1IA 3PZGA 2QUMA 1BKHA 1KXVA 1C91A 3GIQA 2DZXA 4JTJA 1RQBA 3A22A 4WOZA 5C9UA 2GVLA 3OQEA 1S3TC 2ZTJA 3M5VA 3CZEA 3WJXA 1JJKA 4J3TA 1QNQA 2VZOA 4HBKA 4Q8OA 4HPGA 3F4NA 1U1JA 1KA9F 6PTDA 2QF7A 4UTUA 1HKIA 5G1YA 1JUBA 2OT0A 1O95A 1UZHA 4ATLA 1YE6A 1PCKA 4IICA 2QAFA 3BXWA 3PB2A 3KOXA 1YYAA 1PTDA 5XINA 3SIMA 4LY4A 2OZ0A 3FXYA 1SZGA 5ENLA 3B0XA 3PFMA 4K39A 2J7DA 4LUJA 3PUGA 1R9YA 1Q8JA 6XIAA 2WCSA 1PWMA 2J7EA 1TV5A 4O12A 2WSPA 1SVDA 4PCFA 1M5WA 2D3NA 5K2ZA 2XTKA 1PB0A 5HMFA 3FJLA 2A79A 2G37A 1IWAA 2CWXA 2R6OA 2RFGA 3W1LA 2ACQA 4DI9A 3CNYA 4KBXA 1DWFM 2VX6A 4N9DA 3RF9A 3HQOA 1FA2A 4B3LA 3HN3A 9RUBA 2VC5A 3K13A 1JEZA 4L65A 1ZTVA 4IJCA 3HBLA 2XH2A 3LLFA 3C0SA 5REQB 4EIVA 9CGTA 1KBKA 1TVLA 5FAJA 4DUWA 1S2CA 3FHAA 3BLLA 1AMYA 2W61A 3VNJA 3TWAA 1EQCA 2B7OA 1M7PA 5F2LA 1Q63A 1A3WA 1FY6A 5EMLA 1NELA 4MPKA 5B7YA 1TJRA 1VD6A 4LC8A 4NT0A 1ZU8A 4M6UA 1G4EA 1GW9A 1KRBC 3Q4DA 1BXCA 4GWEA 3M41A 2HRWA 1IZCA 1Z9AA 1OFEA 3ZQ9A 3J7HA 2J74A 4CKQA 1WZLA 2O7QA 3EDDA 3FK4A 3UQNA 1IXNA 1XRSA 1SZNA 3KS5A 4PULA 1OK4A 5D4YA 3LZ3A 3BOLA 4D6HA 5HINA 4MSSA 1KFWA 3DKJA 3GU2A 3R4IA 4JTIA 3RX4A 1BKSA 1M65A 1N55A 3TH6A 3GKFA 3F4CA 3PSVA 2ZBTA 3CUZA 1F7BA 1LLOA 1NWRA 2PRLA 1XR2A 1XQLA 1R2SA 2FTWA 2XJ7A 5T26A 3PUOA 3B0VC 3UETA 2CCRA 3HQNA 1XIGA 1Y5VA 2I9EA 1JUEA 1S2VA 3GE7A 1JZ6A 1AQMA 3KBSA 3WQOA 2GJPA 3CV6A 4HGXA 2V0TA 2QJMA 2H9AB 3IVTA 3NOEA 1M6JA 1HKMA 3VKAA 4OBTA 3RITA 2PEVA 5BU9A 2BXYA 3AISA 4YTRA 3HG3A 1D8WA 3W1UA 4G1NA 1VS1A 2DQXA 3CAVA 3NR0A 4MADA 4IXXA 3NQEA 1OINA 3CL6A 2QR6A 2HSAA 4FLRA 5HUOA 4C6EA 4K37A 4KWWA 2P3EA 5AHIA 4JGDA 3B05A 1A80A 1W8SA 4HHMA 3C3UA 2O9OA 2WZIA 1GW1A 1QWKA 3PWGA 2BBFA 4DM2A 5JU6A 4J1OA 2PA6A 4E2BA 5K7JA 1J0KA 1PX8A 2X1SA 4OUEA 3VOGA 3BVJA 2E28A 2NX3A 2GDVA 4ILSA 3L4TA 4O4VA 1JD9A 1XUUA 1HKWA 5AHEA 3XIMA 5FF2A 2I1OA 4I9JA 1XYLA 2O7SA 4L9YA 3B8IA 4AB4A 2GZXA 1V6XA 2V3DA 3CO8A 3GSMA 3RJXA 3RLUA 3BC9A 3IJQA 3EBVA 1Z48A 4F66A 1WDRA 2EBNA 3OLDA 2JIWA 1KFKA 4AZCB 3S5SA 5FSEC 1MFUA 2ZZ4A 2A7RA 2NT0A 1XISA 4L9XA 2XH0A 4EVZA 2FZDA 3S1WA 3UGVA 4YHGA 4DBDA 2DSVA 5FF3A 5I03A 3T0AA 2YA2A 3P74A 3QSRA 3VMNA 3CLWA 2WHLA 4PZVA 4IP5A 2XYLA 4MUZA 1EGMA 1HW6A 3SN0A 4GQQA 2E09A 3DFNA 5FIPA 4TXEA 4TIMA 2Z6JA 1KFBA 3LXAA 3CV7A 1E51A 2NLIA 3G1DA 3GD6A 3ATZA 3AXHA 1EEXA 1W1A1 4GVGA 2YLAA 1A0EA 4R9XA 3N3TA 4QG8A 2XIOA 1PZ0A 5G1TA 1OG0A 3VVGA 2YSWA 4D6JA 1QNPA 1TX0A 1EEPA 3KRZA 5HMDA 3TSMA 4I7WA 1TJ1A 3AIUA 2WVVB 3W6MA 5HWMA 4R53A 3WQWA 1S2AA 2Y24A 2DZUA 1B57A 2E5DA 3WLNA 2WNNA 4FNUA 1H62A 3PUEA 5M5DA 4U3AA 5TQLA 1TFVA 2ZDSA 1IR2A 3P60A 1RV8A 1ZBKA 1BVWA 4DO4A 1HJUA 5K3VA 4NZ1A 4DXXA 1KM1A 1LG2A 1OD0A 2RKXA 1AL8A 3V18A 4AHPA 4EACA 2VC6A 3CQKA 4UIOA 4E8DA 5LXEA 4F79A 4FR1A 3PTMA 3WQ4A 3L68A 3MY9A 4P2VA 3MZ2A 1ZP4A 5F4SA 1SO5A 3MYOA 3V35A 5F4XA 4EXBA 2XN1A 4XD6A 3SM0A 1GVIA 4RPPA 3W53A 3L5AA 4PMNA 2QUVA 5H91A 1V0LA 1I2QA 2MANA 4UZSA 3W88A 3NQ7A 4O19A 1G6CA 1EHAA 5C5YA 4FXRA 3O0KA 3FXGA 4WGHA 5XIMA 3GC4A 4GCXA 3UBPC 7TAAA 1H49A 1NQ6A 4ATDA 3HPAA 2CBUA 4OQVA 1MVYA 4NNAA 4C6LA 3M7WA 3TJIA 1R5YA 1A3HA 2GWGA 5AYXA 3W7DA 3NGFA 2VHLA 3NPXA 1YDYA 2D2JA 4AISA 4X63A 1Q6DA 4GO8A 1UWTA 1FH7A 1BEUA 1UH3A 4UOJA 3QM3A 1DJXA 3NXFA 2YFNA 1W3HA 3L2LA 4IJRA 4P7NA 5D9NA 3WUEA 1S39A 3R43A 3DEQA 3DERA 5H8UA 1OZQA 4CQCA 2HTMA 3HJEA 3IJ6A 4IIBA 4QIUA 4GUIA 3E0WA 2W6RA 3ONBA 4QXIA 4O28A 1AH4A 3BLDA 3W71A 5DBUA 1XIEA 4JX4A 4O1EA 3WLMA 2Y89A 4XX6A 1MUWA 3N2BA 4XD3A 3RM4A 1QW7A 1AZ2A 1XIJA 2Z24A 4U2ZA 4CLMA 2PRMA 3WLJA 3LMYA 2J7CA 1B3WA 5BOFA 5C2GA 2CWNA 2V68A 1DJQA 5ABTA 4MZ8A 3OGRA 4BJHA 1MW2A 3VIGA 1JXKA 2ZVIA 5JH2A 3GU1A 3LM3A 3RPMA 3UCQA 4MAVA 5FEPA 5A95A 4L7ZA 2GVYA 1LROA 5CCZA 4IXHA 4LRSA 3VA8A 4KEUA 4O10A 5A6AA 3GLCA 2XZ9A 4J4KA 4R5EA 4ZQRA 1K8ZA 1AODA 2G0WA 3DH7A 1B9BA 3GDBA 2OR2A 3AC0A 1TPC1 4C6NA 4LVAA 1LRNA 1GEHA 1LDCA 4HU3A 3DAQA 3EDFA 2XUCA 1XBXA 1EJVC 4IIHA 1AA1B 2BGQA 4DYJA 1UIPA 1IEWA 1B90A 3H2OA 1PSCA 4GZJA 1MQRA 1F6PA 3ELFA 2PGFA 1W1IE 3GVGA 4ZVJA 1JDFA 4AEFA 4PB4A 3E0IA 1QRQA 3G1HA 2OCZA 4H8UA 4KF1A 3HPFA 1A5NC 2HMCA 4F0HA 3RO8A 4HA3A 2X16A 4J2MA 2WNZA 3L12A 4KGLA 4F3HA 4MHBA 1J2BA 1H61A 1QMLA 2O9RA 4A3QA 1JRBA 1LT7A 1XRFA 4MMWA 3CHDA 4JTDA 4ZCWA 3TMLA 1TPDA 2VL4A 2JGQA 5LGXA 3EEZA 2POZA 4K8HA 4NYUA 4NSBA 3EA2A 4QAIA 4XZMX 1C8QA 3BLFA 1W3LA 3NQMA 2BVDA 1M7JA 2XHYA 4HPNA 3VM7A 1LOLA 4EOUA 5LZLA 1JCJA 5M2FX 4LQ1A 4NY2A 3CU2A 1B54A 3EDKA 2A0NA 3HPXA 1KBIA 1V02E 1GTEA 1PX3A 4GKTA 3VGHA 1GVFA 4GC4A 4M7SA 2VVSA 4QQUA 4MM1A 4JY8A 3T8QA 4B2DD 3H4WA 4DX3A 4X22A 2DJLA 3WBAA 3WK1A 2W5FA 4KCTA 2ZRVA 2ISFA 4JX5A 1OC6A 4S1FA 2PDYA 2F38A 3CL8A 1D7FA 3B0YA 2WMFA 3PPHA 4UFLA 5J8LA 3L4UA 4B3KA 5A3HA 5CSUA 2EPHA 1S5VA 1XLIA 4W8LA 1CXFA 3JU2A 4PBEA 5G2IA 2QDGA 2OO0A 1SO3A 1UWQA 4FB7A 1S5MA 4IT1A 3N2MA 4D1JA 5JIPA 4GLEA 3ARXA 1ITQA 2UWFA 3N25A 1VFSA 4XZIA 2YDRA 2YDQA 2V5CA 2CERA 3GDRA 1VFHA 1DTUA 5TIMA 2VFEA 1WKDA 3O0FA 1KRCC 5DEZA 1E1CA 1XINA 3GH5A 3LK6A 3H54A 4QG6A 2FZ9A 3HOJA 2Q8XA 1TO3A 2X2GA 3UG4A 1L6FA 3IEBA 3F2DA 2CYGA 3P61A 1G0CA 1J79A 3FSUA 4LUTA 3O07A 5I3FA 3C2YA 4Q3MA 3K46A 1KV8A 3KRSA 3VPLA 1EA9C 1UR8A 5BRPA 1Z89A 4HJWA 3QN3A 1O68A 2OZ8A 3T4CA 1K70A 1DORA 1HP5A 2GUBA 1XSJA 5LA1A 4OECA 3SADA 3CYVA 5EMUA 1A53A 2NSXA 1QOQA 2DT0A 4L4PA 2ZYFA 1Z3NA 4Y9MA 4JQAA 1E6XM 4OE7A 1RHCA 1ITXA 2WQPA 3MUAA 3ALFA 1L8PA 1VLIA 5I78A 5C9XA 1F3XA 1W37A 4DJEC 4B92A 2X1IA 1H7RA 5A2CA 3PPGA 3R89A 4U5KA 4Z2LA 1TJ2A 3HQPA 1JZ5A 5BRBA 3WQFA 3R94A 2ACRA 2J13A 3TFCA 3CUHA 1NWSA 3KBVA 3VOJA 4Z42C 1QATA 4IOTA 4UTKA 2PC8A 1TREA 1W5OA 3ITLA 4L80A 1VCFA 5D33A 4OU1A 3MMUA 3M0JA 4PMXA 5XIAA 1O5XA 3SCSA 4H3DA 5AN7A 2D23A 4LT9A 4M80A 1TQXA 5CZSA 1TR9A 4Y9NA 3CS2A 4WSJA 3IACA 1AW2A 3CLMA 3DUGA 2FFIA 4FO4A 4XQ6A 3H2AA 4Z0JA 3OA3A 1GOXA 2QCCA 4E4FA 5DCBA 3VILA 5H6HA 3R1ZA 4NXKA 3LNPA 3SBFA 3KDNA 2FPYA 4DAFA 1CX9A 4FSAA 4UR8A 3A5VA 2P1FA 1QTWA 2HDJA 4RXFA 3WJYA 1XLJA 3E49A 4MY8A 3WF3A 5DMNA 3AI0A 4L9ZA 3BURA 5H2ZA 3LBCA 2J8GA 3E5PA 1TVNA 1GK8A 4RKAA 4HNCA 5D2YA 1R3TA 4F0RA 5T9BG 2Z1WA 1T41A 4Z2JA 1K4HA 4A8RA 1NOFA 4C7FA 4LC6A 3GYEA 3WEMA 5FJTA 1RY0A 5A5WA 1KW1A 3RM9A 4QBXA 4CQ9A 1XCXA 4HZMA 1SQ7A 4NU7A 1HL2A 5M3WA 3E0VA 2VELA 2VFHA 4IGMA 3C86A 3LQGA 3NDOA 4TVCA 1JPIA 1JVNA 2NUXA 1F6KA 1JDDA 3EPMA 1IGSA 1K9EA 2DQWA 1JYVA 3IJLA 2XN2A 3S2CA 1UKSA 2KX9A 2XIBA 1VP5A 1DHKA 3ALGA 5DX7A 4BF5A 4FX8A 1A5OC 1EJ7L 3LHWA 3OPSA 4KGJA 4U28A 4CVWA 4DF1A 3GNDA 3NXLA 1GCYA 4CD8A 1H51A 3UXLA 3GXPA 3M6YA 4IPJA 4B5VA 1A4LA 4TVUA 4P7LA 4D6EA 4YTTA 4F0KA 5CC5A 2PSNA 2WC3A 4HCLA 4JPGA 3LTYA 1YBQB 1W5QA 2VRQA 4S3JA 1KV5A 3CWOX 1SFJA 4P7OA 3LLDA 2D73A 1M04A 3MUCA 3KFTA 4US5A 3KOFA 3QV8A 2JBMA 2PDLA 3EB4A 3B9DA 3OLIA 4MKNA 2F6KA 3RG6A 4ZFMA 3LGGA 4RPQA 3KCOA 3G1XA 3ZVIA 1FWFC 5DXXA 6REQB 1AFSA 4QCFA 1S5TA 4KQNA 3NUKA 4RZ5A 3THUA 1EPXA 5CLTA 3VD7A 4QHRA 2CLPA 2XVLA 3CO4A 2J7FA 3S46A 3EKGA 4M19A 5AYYA 4CCCA 3NZQA 1UBPC 2PWUA 1H0IA 5KETA 1ITCA 1X1OA 4AF0B 5CKSA 3G6LA 1FCBA 2G97A 2O92A 2OKOA 2VZTA 2XFYA 3VIFA 4REQA 4ZTXA 5HNTA 4XBKA 2V6AA 3PJXA 1KM2A 3G1SA 3LLXA 5RUBA 4LF1A 3WH8A 3RILA 4M1BA 3E5BA 4Q4OA 1DL3A 2HJPA 1OYCA 1HQTA 1OCBA 2BV9A 4UFMA 4AZ6A 3UWVA 2NQ5A 4UWMA 1VIZA 3ZOAA 4LBUA 2EAWA 1HJWA 4DELA 4GQGA 4PR4A 3IS4A 1SJDA 4JAWA 4CNUA 5A8PA 2XVPA 3LRKA 5T8GA 3IV8A 3WQEA 2HPMA 4TMBA 3NA8A 1RK5A 1ZJBA 3GH4A 2FVKA 2XWDA 2PDQA 4ZL1A 1WDWA 3HFTA 1IEQA 1K7XA 2FTPA 4RDZA 1UBSA 2YYUA 1M1BA 3W1XA 4NQ1A 4C1NA 4W7UA 2CHNA 2CU0A 3CPUA 4W5UA 1UQYA 5I06A 3ARUA 5D2VA 4GH3A 3MWCA 3VCCA 1A5AA 3PK7A 2VC9A 3T0CA 1W2PA 5TBOA 5DY2A 3MO4A 2B31A 3CTLA 2GQAA 3NO1A 1ZFJA 5CPNA 2GSHA 3TYEA 3EDJA 3BZGA 5AC8A 4CQAA 2WW5A 2E3ZA 2QKFA 4CNPA 4JHOA 3BANA 4LF2A 2J24A 3REQB 2ZKMX 3VKBA 4AQLA 1XP3A 2CNCA 4QAWA 4I6VA 2ZZ5A 2E0PA 4E4UA 1LM1A 2HNHA 4MWAA 3ZT5A 3QOMA 3RLGA 3LQLA 6CGTA 4Y7EA 2ZWYA 4UTIA 2O56A 2ISWA 2PCEA 2HCVA 5BROA 5JIWA 3WK3A 3CZGA 3AHXA 5LA0A 1XC6A 1OGSA 2D3LA 2IPFA 2J9YA 2OKTA 4WSHA 1MUCA 2F6XA 4LAMA 1CXLA 2ZA2A 3T2QA 3TE9A 3REQA 4MZ1A 1B3ZA 2YIHA 1ICPA 1DPMA 4I90A 3DBNA 5KZEA 1V3MA 3NL5A 2ADAA 3NZGA 3TXZA 4OJYA 2VZVA 4WVXA 4HVXA 2PLCA 4CD4A 3BJFA 4LTSA 1M7OA 3W72A 3GO2A 3SEPA 3UU0A 4DJDC 4HOWA 2W27A 5KINA 4AH7A 3THAA 4C6CA 1DJGA 1KXHA 4TO8A 3WMBA 1U1UA 2YYTA 3R6IA 1EJXC 3S4TA 1P7TA 3BMXA 3CV2A 3D3FA 3KVKA 1PKMA 1FUYA 1OFAA 5CC3A 3MSRA 4W8BA 1KLZA 5DMYA 3MMWA 1XLLA 5IFTA 2X7WA 1PIFA 4QJ1A 3B8TA 1NVMA 1Y65A 4YLWA 4O57A 3VOHA 1Q4WA 2E8ZA 3N1AA 3IK4A 2CFFA 1IT7A 2GJRA 1BQGA 4N2YA 1ZAHA 4IUOA 2A2IA 2PTXA 2B7PA 1CTNA 1MDRA 4K1WA 2GWNA 2I5QA 1CW2A 4ZOBA 1B5TA 4IQJA 4JFUA 4QLLA 1R85A 1Y7VA 4ZXOA 4XSMA 4QX4A 1CZ1A 3CIXA 4QDWA 1E4LA 2OOFA 2BHYA 4GVIA 1M3UA 1U5JA 4LAZA 1JYWA 3W7RA 4JICA 1ONWA 5FJPA 3IPWA 5CGQA 2D22A 1OD8A 4JL2A 2O4QA 1J0IA 4NX5A 4FF5A 1XHGA 3AXXA 1TPEA 2WBKA 2X0YA 4DWSB 3UWEA 1X6LA 2W63A 1FOBA 4K36A 1TV4A 4PTNA 4DRSA 3AU2A 1EO7A 5C2XA 5EYWA 4GJ1A 4UQBA 2DUZA 5CZ0A 3AO0A 2GGIA 4OOUA 3SN1A 4GI9A 3BG3A 3QQ1A 4QR6A 2I5IA 1Q66A 4V28A 4GFSA 1BSIA 5AYIA 5TD4A 1UP0A 3AIWA 3BWWA 5I6SA 3TW7A 4P7QA 7A3HA 1VAHA 2X09A 4NAEB 4OTKA 1JI1A 5AZ0A 2AAAA 3UYCA 3UA4A 3WF0A 2ZOXA 3O6AA 5BU6A 8XIAA 1KM6A 2C6QA 1DIDA 5HNNA 3GVVA 1I8JA 3WH7A 1VJSA 4UTLA 1Z42A 3IJ8A 2YZRA 5GJPA 1SJBA 4WOQA 2ZCGA 2GGJA 1FWDC 4CD6A 3I7QA 1PYMA 5PTDA 3IGXA 3G3MA 5F2GA 1E70M 1EYEA 3WYZA 4R27A 3A47A 5CSYA 4WLCA 1CGTA 4RV3A 4A8LA 3WMLA 2AQWA 3K1DA 5EKYA 3URAA 3SIZA 2VR5A 3QV7A 4IWWA 2V5JA 4IIGA 4ADSA 3B40A 2VX4A 3W7EA 4S2BA 2WO5A 4AXKA 4YTQA 3OLEA 1DJYA 3OZPA 2WKLA 3S2MA 4ZR8A 4V1XA 2Z1SA 1H5YA 2GSJA 4OV4A 3U4FA 5ABEA 1IXOA 5AC6A 2EPKX 1ZSXA 3WLKX 4O8RA 1XKYA 4JKLA 4TOQA 3GNRA 3PSWA 3WL0A 3IAPA 2QCEA 3WFAA 3MUXA 2NWSA 4QSFA 4HA4A 1FX6A 5E09A 3QW3A 3UJSA 1C3FA 1C29A 2CKSA 3RCNA 3W84A 3WQVA 2IKJA 5LKYA 1H11A 4WGXA 3M0IA 5CPTA 1FWJC 3EOLA 1RY8A 3LCHA 1F07A 4HNOA 3VKKA 2PGEA 2Y7GA 3DI1A 3E74A 2P88A 5U4NA 4I7VA 2FLIA 3ES8A 1R7AA 5AHNA 3VGGA 1TELA 3UR5A 4RDVA 5REQA 1E0XA 4XV0A 2UV8G 5IOBA 2XISA 4IMEA 3Q67A 5U7SA 1Q8AA 4JTSA 2O4MA 3GG7A 2BVYA 4EPKA 4H9XA 2QVNA 4HNNA 3MV11 1IZJA 3SURA 4HT3A 2OX1A 3VIKA 3OIHA 3RLVA 4GJJA 1DTNA 4W5ZA 2GQ8A 5CQ1A 4R7OA 3OHMB 4P8UA 2AQVA 5CPLA 4DO6A 3C56A 2ZA3A 2KAUC 2A3LA 4HP5A 3W81A 4UTWC 1QBBA 3CIVA 3NURA 4A2RA 2YKKA 3M0MA 3BO9A 4O54A 3I3EA 1PUDA 4ZOCA 2EKGA 4LNCA 3GHUA 4HIBA 3EOEA 5KZDA 3GXMA 1EX1A 3ZFHA 1WB0A 1GJWA 4GX8A 4JY9A 4JHMA 1ICSA 4XO7A 1DJZA 4EP8C 3IVUA 3L66A 2OLHA 4JFVA 2H3DA 4UFKA 3CAWA 3EXRA 3STEA 3AHVA 3MW7A 3TONA 1JCMP 1DHPA 1VPQA 1LWJA 4UQ9A 4C1NB 1W3TA 1LBMA 1UASA 1XBYA 3CJPA 4A35A 1BD0A 4PTDA 2YW4A 1Z41A 3NG3A 3G8EA 2ZUVA 3S83A 4Q6JA 1XW8A 3F5JA 1AW5A 1I2OA 3HG5A 2INZA 2NVCA 1P6BA 1LP6A 3O05A 3TOYA 3A4AA 2H9AA 3GB6A 5HQEA 1LWHA 1FWCC 1YKWA 5HATA 6A3HA 4E2OA 2VYOA 1W9DM 3KUMA 1O6IA 3O15A 1JCNA 2XGIA 4GIAA 4NHVA 4BQ3A 3VXGA 1TUXA 5JH1A 1PVNA 1JAKA 1EJSC 3LCGA 4IGSA 4QEHA 4FNRA 2A3EA 5FEWA 3W1AA 2PTZA 1LQ0A 3IANA 4YVXA 3CXOA 5D05A 1S5WA 2GL5A 2QPXA 3B9OA 2PP1A 4M1RA 2VNCA 3BTNA 3BAJA 1E1FA 2WB5A 2VO5A 2Y2WA 2BLEA 3VNDA 4ZO7A 1JDCA 4QE1A 4RZ6A 5K4XA 2OXNA 1DEDA 3L4ZA 3F7JA 3VNZA 2A3BA 4AZBA 4BHYA 4CNNA 4DYEA 4PMYA 1WCGA 4ZQMA 4XKYA 1UD8A 1TIMA 3HFYA 2VGGA 4M7TA 4GXWA 1KCZA 3KAOA 4LS2A 5LNUA 3ZWTA 2OOGA 3B9EA 5JBEA 1L9WA 4ROQA 3U9IA 2E68A 2WJDA 3GZAA 1ZPTA 5I23A 3TTEA 3QGVA 3DHPA 2X0SA 3U2ZA 4PMJA 3WJSA 4AC1X 4QE4A 3NDZA 5BYWA 3R0UA 4XAFA 4X61A 4FS9A 4K8EA 3HGOA 3RRXA 3UXAA 5LGZA 3UZ5A 4HSNA 1L0PA 1WDDA 3LZ5A 3K8LA 2GOUA 2PWGA 3AZRA 4OT7A 3W2NA 1FWTA 3TR2A 4PA8A 1MXDA 2V69A 1H5VA 1F5ZA 1ODZA 2VX5A 3SUWA 4GUFA 4WUIA 2G4JA 4AIUA 5CG7A 2FKPA 1H09A 3VTRA 3BLKA 3QHMA 3W7IA 2TPSA 1U22A 3WDJA 3KWSA 5CSRA 1EJTC 2CLKA 1GWJA 3W87A 1GYMA 2JK2A 5E9AA 4GQBA 1QT1A 1PBGA 3L7RA 1IR1A 5T91A 2ZZ1A 3AYTA 1ESWA 2UY2A 4WDUA 3V7PA 3A21A 4XVEA 4JQ4A 5CJ5A 2W4XA 5IFPA 3RR4A 3WDIA 3CZJA 4LUSA 1T99A 1NAL1 4LYQA 4RE4A 2NQHA 3GRIA 3MJYA 3MS8A 3VDGA 5SWUA 3SCUA 3NQVA 3R8RA 2BY0A 1MW1A 1OYAA 1PDZA 3NQ8A 1KWGA 4UBPC 2C91A 1I0BA 3F4WA 4JOMA 2OYLA 1HIZA 2L5HA 3WD4A 3WF2A 4JN6A 3LS9A 2QHAA 4AW7A 5GNXA 1KNWA 3LBMA 1J01A 3CZ8A 4WCJA 5F4WA 2JKAA 3G1VA 2D24A 4FR6A 4DNMA 2P8CA 2C1HA 1POKA 2DUXA 4EKJA 5CPMA 1VJZA 1AK5A 1HVXA 4WX2A 3TA6A 1OEPA 3BG5A 4EF8A 3OVQA 5KZMA 2WMHA 4GA8A 3C0QA 2BP1A 2DP3A 4FXSA 1XLDA 1UWIA 2WSRA 4GBDA 3V0SA 3NVDA 1XG3A 1V6UA 1B3VA 4C6QA 2NX1A 4PBGA 2QIWA 2CIPA 1VEPA 4UCGA 1XYBA 1SUXA 2R9RA 3WBXA 5BMXA 1YTKA 4ZBCA 4CEUC 1BTCA 1XICA 3VC6A 3PUDA 1NDWA 1KBJA 4JS3A 3BZJA 2PI6A 1GG1A 1KQZA 4LAKA 3QR0A 3EX6A 2WLZA 3BLOA 4X3ZA 1T8QA 4HYRA 2NW0A 1ZY9A 1MRQA 2Z29A 1XIBA 1A0CA 3EX3A 4H9VA 4DPPA 4W85A 2NV2A 3WD1A 5JMUA 1P1XA 1UKQA 2A1YA 4GZ7A 1FFQA 2BS9A 3KS6A 4P61A 1T96A 4Q8TA 1UR4A 3PZNA 3A3HA 4A21A 2QULA 4AY1A 3UJRA 3T8LA 2R1PA 2HWGA 2Q02A 1V8EA 3ZO9A 3SB0A 3WY1A 3N14A 3VKDA 2W62A 3ISIX 4YN5A 1YXYA 3TYUA 4C5ZA 3IIVA 1JPMA 2DIJA 3DESA 1FHLA 5JUVA 4MNKA 1HUVA 4Q8NA 4KFOA 3NL3A 2F6UA 4F0SA 1KFCA 1RH9A 1LBFA 1A49A 1Q3NA 4HZ8A 4JIEA 1HNYA 2PLMA 2ZZ7A 4KRUA 3PPFA 3EOUA 5CSSA 4FI4A 1JYXA 5BXTA 2J7GA 1UP2A 3WLLA 2VMFA 4C91A 3CH9A 2VEKA 3WNNA 3RN6A 1WV2A 3MA8A 1Z32X 3UZJA 5TAOA 3TJ4A 5BXSA 1V0NA 3IRDA 2J88A 5DRIA 4PRTA 1W2VA 2Z6IA 4LPCA 1EF2A 3HIJA 3NQFA 3LMZA 1VBJA 2WJZA 2EXOA 4HHLA 2PDHA 3CYJA 3PVFA 4JTFA 1HL8A 2EG6A 4KPLA 1IXQA 2INEA 2ZX6A 4AG0A 3N12A 4N02A 1TWDA 3VD4A 3SN4A 2FPTA 1GVRA 4AU0A 1V51A 5I24A 4WK9A 3WLRA 1J2WA 3LCIA 2KZHA 3GDKA 5GQBA 1PDYA 3V4BA 2FH8A 2PLKA 2Q8LA 1A5CA 2Z26A 2QLYA 1W9UA 4N9CA 1VHCA 1WE5A 3BUVA 3CMFA 3YPIA 3UESA 4OFCA 2XFRA 4GFIA 1IV8A 2C79A 2PTDA 1HX0A 4JTLA 5AFDA 1P6CA 1T5AA 1N8WA 1E9ZB 4N6FA 3RPTA 4HMNA 3E3HA 1TVPA 4MKVA 3AXMA 3QY8A 1YNQA 4GBUA 1XPGA 1O94A 3QV9A 1WXJA 1DE5A 2WPBA 1VFLA 2V67A 3PWAA 3FKKA 1F05A 3PG8A 2VUYA 3VGBA 3FCPA 1S1RA 4RW5A 4JIRA 1L6WA 3PAOA 5AZ1A 4PUJA 3W1PA 3VD9A 5FJRA 4JHZA 1DE6A 4PTMA 4OBSA 2YFOA 2NQ9A 5HANA 3NO5A 5I3GA 2DSZA 4KCUA 2VD9A 1U30A 3QFEA 5HNRA 1FWIC 5C54A 3SZ8A 2ZQ0A 1VKFA 1QCWA 4HTYA 1XLGA 3RCMA 4JTCA 1IZKA 3N6QA 3LGEA 7TIMA 4GUJA 2FTYA 3P0WA 2FJKA 3WX7A 4Q4QA 1L2UA 3OVGA 4REQB 5CJMA 2EKCA 3H2EA 3VIHA 3CTTA 2XVKA 1W9BM 3LXCA 3CUGA 2GJLA 1REQA 2C1IA 3A64A 3TNBA 1KWKA 3MHFA 4H7VA 3KEHA 1Q6OA 1GQLA 5FJJA 2PRHA 2P50A 1FWGC 3IJDA 2ZRYA 4XZLX 1VGAA 1RBOB 1LORA 2BY3A 4CVUA 2Z1BA 4HZ7A 1OYBA 3VIPA 3GTHA 1RA0A 1AL7A 2E5BA 4PE8A 4LUTB 1I1WA 2E77A 3OLGA 1R3SA 3UERA 1QI4A 3DHUA 1MUMA 3QQ0A 4RDYA 3HM7A 3WD3A 1W5PA 3A4XA 1TJPA 1W9XA 3RX2A 4JNYA 1UP3A 2ZADA 4Y8EA 5I00A 1Q4NX 1R30A 2WNQA 4O52A 4W9TA 3RIKA 4FLQA 5D32A 3KW3A 2VFDA 3G1FA 3BAKA 1ML1A 3TN6A 3LCXA 4DJEA 1E4MM 1HFBA 4ACZA 1ONEA 1ISVA 4HK5A 2IKHA 3BLIA 5CEWA 1VBUA 4Q7BA 4Z1AA 4A3RA 1E6ZA 1AJ0A 1WZMA 1NP2A 3HGRA 2B7NA 5CZJA 3N4AA 1SJCA 4D6IA 3AHTA 1VLWA 3H7VA 3ZLFA 4QNWA 5FCZA 2I14A 2DT1A 3VX0A 4AEEA 4NAFA 1F9CA 2GGEA 1DWJM 3P14A 4JFSA 1GPFA 3N6JA 2NXGA 2VGBA 1OSEA 5CXPA 4IFRA 1F3EA 4PTVA 4J3XA 1LL6A 2H3BA 3HGSA 4HOXA 2HXUA 1YHTA 8A3HA 5JBDA 1F2JA 1QBAA 1JQXA 3RFAA 3UZYA 4KS0A 4JTAA 4IM4A 2BXVA 1Q6CA 3PZQA 2DFAA 4GD0A 5H8MA 5FACA 2VENA 1MZHA 4LV4A 3STFA 2V38A 4YCOA 3AMKA 2ESCA 4GNJA 3TCSA 3PAJA 3N2TA 1XYAA 5CJNA 3KVJA 3RYSA 2J8FA 2WZHA 1OHLA 4C6JA 3P8IA 2QMJA 4HQVA 5KITA 4LBSA 2G3MA 1BLIA 4ADTA 4CN6A 1DBTA 3D5HA 4HOZA 2QGHA 1UR2A 5E1QA 3U7BA 1OCNA 1XIFA 4IP7A 3UWWA 3APYA 3UA3A 2OODA 5LXXA 1ZHAA 4LCQA 2YZ5A 5D8ZA 2WHJA 4RX0A 4JTKA 1J0HA 5D30A 3WLHA 3UG3A 2HS8A 1AZ1A 1I0DA 2E9MA 4HYWA 2WXDM 2OWWA 3V3WA 1OFOA 3CM4A 2VR4A 1W1B1 1V3IA 3BLEA 2PGWA 2D0GA 4WKFA 1W1TA 2CEQA 1HT6A 4CEXC 3L4YA 1JDEA 2D2GA 5LNWA 1K77A 5C2CA 3BGAA 2J7BA 1CECA 1R2RA 3IIOA 2YL9A 2BGNE 1VYPX 1VEMA 1YPXA 3NFUA 1RCQA 3NQ6A 4DJFC 4F9JA 1TTPA 2AKZA 3K8KA 3FDKA 2A5HA 3W7JA 3AOFA 2VFFA 4NNCA 3VKJA 1CEOA 4YTUA 3FYYA 2D0HA 1KBBA 3WF4A 1SZEA 3GXIA 1ALDA 1XWYA 3GNXA 4L1WA 3OQ8A 3N9KA 3TROA 1QPKA 3WELA 4GYJA 5A6BD 4O0KA 3HMJG 3CHFA 4MZYA 3WO8A 1TTQA 4HKPA 2C8NA 1FWWA 4UTJA 4GY7A 3TSDA 2MNRA 3ZVHB 2DSWA 4DLFA 3FJ4A 5AYZA 1CXKA 1EBGA 2E1WA 3EMCA 4LBRA 5CLWA 3QVQA 1SFLA 2DPEA 1H2JA 3GM8A 2HZGA 5JBFA 1XV8A 4QE5A 1LOSA 1TG7A 3GIYA 4RNIA 1DIKA 2BZNA 5EGRA 4BS0A 2UZ9A 2ZXDA 5D9PA 2WCAA 2NVDA 5IBXA 3TIMA 2Y62A 2CZDA 3S5YA 4JDYA 3N18A 4HK6A 1GQJA 4PTWA 1HKVA 4KIEA 1S46A 1XLAA 1JFHA 4JQ1A 2F84A 1C8VA 3CAKA 2PFHA 4GXMA 3DFPA 3MO7A 3H21A 3UF9A 3TDFA 1PTGA 3CPGA 1D2KA 5HMSA 1H4PA 4Y90A 3GFXA 2BTMA 3PBUA 1CGUA 1X1NA 4GACA 2I7GA 4L1GA 1YMYA 1C8XA 1WZAA 3GX9A 2XM1A 2E8YA 1ZCOA 3W7CA 3F1QA 4JYDA 3G5EA 2G3NA 2W92A 2JF7A 1XSKA 1O1HA 1VRDA 4YWIA 1X1ZA 4Z08A 1XH0A 4YJ5A 5FSDC 2XGBA 1QVBA 3BV4A 4UNKA 4PUDA 5E9XA 4LOCA 2EPNA 1HL9A 3P6LA 3ARYA 3MMDA 3GW0A 1BVNP 4M81A 2J66A 3OZMA 3MQTA 2Y85A 2BSLA 5FJOA 4QJ5B 3P2VA 3VIOA 2Z25A 1SM9A 2FDMA 1RBLA 4HJFA 2H90A 1LQAA 1EIBA 2YCEA 1GKQA 4QDMA 4TV6A 2GDQA 1GNXA 3N2XA 3QR1A 1J5TA 4TX8A 3TP4A 3BMWA 1QPRA 2NZLA 3R0KA 1V7YA 1YDVA 4PN2A 3NZ1A 2GLKA 3TA9A 4C6OA 4IG2B 4Q22A 3E2QA 2ZFAA 1LYXA 2X30A 6XIMA 1XFCA 1OIFA 4MWAB 3W2KA 3C2VA 2E9LA 1WO2A 4M6QA 5HULA 3UCCA 1VJIA 2RDWA 5GJNA 2VKZG 2A6NA 1D3HA 3O3RA 4FIRA 4IJBA 1RQEA 1H7OA 2VDGA 4H7ZA 4XKYB 4TTUA 2Z1XA 2DZTA 4QDPA 3DIPA 1P48A 3AMLA 4BCEA 2FHBA 1HTIA 1PKLA 3BAXA 4DY1A 1US0A 2OT1A 5IDIA 5C8BB 3WQCA 2DT2A 4BI7A 3SCRA 4JKMA 1VFMA 2RUSA 4PMVA 2A3AA 3S6TA 1XLMA 1UMLA 1OWQA 3WQ5A 4L64A 4JIQA 4G9PA 4S3GA 1BWVA 4ZENA 3P67A 2XZ7A 4CQ8A 1B4KA 1YXCA 1OABA 3B3DA 5DN1A 2OB3A 3U2EA 4MY9A 4RW3A 4OWGA 2NVAA 1DXFA 2P0IA 1F8MA 3MSGA 4HPHA 3Q45A 3LU2A 4NIRA 1Q13A 1PXGA 1ZUAX 3NDYA 3SRFA 4ES4A 1JGMA 5E5CA 1R9XA 2E6DA 3S5NA 2FFCA 3SRDA 2H8ZA 3UWUA 3FA4A 4AUBA 4RR4A 3V16A 2VZSA 2C0HA 3U6WA 4UMCA 4KCWA 3GG8A 2OELA 2H8XA 2ZTKA 3CB3A 2V2DA 1MSSA 3GXFA 1W0MA 2R14A 3EXTA 4ZQNA 4FPSA 3S2LA 3GW3A 4PYSA 3N17A 2BY2A 4I9TA 3WG6A 4NI3A 2VTFA 1HO1A 3R7MA 2JKEA 3MKCA 1Q6LA 5CGTA 3FFSA 3P82A 6ENLA 3SCNA 3FV9A 3L21A 2ZUSA 2XH4A 2XGZA 4LB4A 2BDQA 3W7PA 3RAOA 1SYTA 1XUZA 1DJHA 1R47A 3GR4A 5ABFA 1DQXA 5DMLA 2YBUA 2JEQA 3I3BA 5AYBA 4AY7A 2P53A 2O9TA 4IZGA 2DY3A 1KB3A 3PJUA 1KM5A 2FYMA 1SW3A 1TIWA 4O15A 4PRRA 3SCOA 3T55A 3E1F1 2PDCA 2QDHA 1UC4A 9XIMA 1TMQA 2PGRA 3OG3A 2D20A 4RV8A 3AZTA 1P0KA 2EQDA 5AHFA 1S2UA 3B06A 4MF4A 5J04A 1G01A 2PPGA 2DH3A 3S2JA 4DBSA 4XTDA 1XCFA 3CQHA 2HE5A 1DXEA 3L9CA 5A6LA 3VFCA 3FYPA 4XZWA 3T07A 3LTPA 1UPMB 2YXOA 1J0JA 3E02A 1BRLA 4IGNA 1H7PA 1GKPA 1CGYA 2WVTA 3C0LA 4JIIX 2ZRUA 4IMGA 2FDSA 3NQDA 4XZHA 1KR0A 1VR6A 2J8TA 1ISZA 3W4RA 3AS0A 3M64A 1K6AA 2BX7A 4MG4A 1RUSA 3C3NA 1I6NA 1GKRA 2QCDB 2IPWA 3OGSA 1RLCL 1QNVA 4GABA 3UR7A 5K4ZA 1KM0A 4N9EA 3NWRA 3P0XA 2PWFA 2RAGA 3V5OA 1PX4A 3ABOA 1JNEA 5LA2A 1O5KA 1PWLA 3PZVA 1JDAA 3QY6A 3NAVA 1DQWA 1G9HA 3S1GA 3ZWSA 4HPXA 1IIHA 4DNHA 2WMKA 1CGVA 2CESA 1QPNA 1IEXA 3PZIA 3ENLA 3P84A 3CK5A 4S23A 2PODA 3VGEA 1BTMA 3L4VA 3V5CA 3MUIA 5EY5A 1XSIA 5HK4A 5GNZA 5I07A 4PCPA 4S3AA 4KEMA 4GZEA 1V77A 3B0PA 3GVWA 1L8NA 3GTIA 1ZS2A 4LAOA 1G4PA 1J4EA 1OCJA 1E6SM 5DRCA 4YHEA 2V2HA 4JTRA 3WLOA 4LANA 3TU9A 2NUYA 3VMOA 1EDTA 3VDHA 3W7OA 3TTQA 3BARA 2WZMA 3MTWA 1DKWA 2IMRA 3C0JA 3VD3A 4MJMA 4MWAC 4PTXA 4W4QA 5I02A 1QHZA 2PD5A 3OP2A 2OU4A 3UT0A 3ITXA 2W66A 2BODX 1NY1A 2E6AA 4IF2A 2VGFA 3RMJA 4B90A 3PG9A 1LRTA 4KIRA 1RLDA 1MQQA 5I79A 1GONA 5M1TA 2ZZ6A 4EX4A 1P6WA 1TPFA 4ALDA 1RBAA 4QGCA 4X2PA 3H22A 1PCWA 1B31A 2FZNA 4UFIA 4E8CA 1E0TA 1X8FA 5A2BA 2QDEA 4HU4A 8XIMA 4Q8WA 1B1YA 4O0QA 3KBWA 3V1HA 1TRDA 1TV3A 2ONEA 3TN4A 2A6LA 3AWNA 2Z2UA 3PZMA 3K4WA 1OT2A 2PZNA 1E3XA 3TYZA 2ZWZA 5HA7A 2ZRXA 3MDUA 1XBZA 3RDKA 5FAGA 3GXNA 2Q6ZA 3HURA 5LIYX 3AU6A 3WDRA 3PZOA 3F03K 3VFLA 2UY3A 2VZUA 4Z0SA 5A8NA 4YL2A 3ZLHA 3EX1A 3HF3A 5JXQA 3BICA 3PNZA 2ZXBA 4IX0A 3MBDA 4WXYA 2OO6A 4UTFA 1GQNA 1UKOA 4GO9A 3CHEA 1XIIA 1YW1A 3KZPA 1PL9A 2VURA 1MWOA 3TSBA 3S2NA 1OX4B 1XX1A 3FJNA 3AYSA 1S38A 2J77A 4QITA 1W1VA 1OVDA 3EPOA 1Z8AA 4R33A 2Y70A 4X0VA 2QCHA 4S3FA 3B8SA 2DVUA 4UMBA 3T7VA 3A12A 3P8JA 1OB0A 3AICA 1FQ0A 2WQDA 2HBXA 4DO5A 3CB8A 5AC7A 1RD5A 3A3XA 4M56A 4EXAA 2X8RA 3UD6A 4CCDA 3W28A 2WSYA 3TW9A 2ZC1A 1XLCA 3TYAA 1RJPA 3VC5A 1X6UA 3KCLA 5C55A 4HA1A 1XLEA 1E71M 3FX4A 4MYAA 3GC2A 1DWIM 1G1YA 2Q09A 3QRHA 1KGWA 5E93A 2FB2A 3GUGA 4X9YA 4I5UA 3QW4B 1QHOA 5BXPA 4CNTA 1V3JA 4AVNA 2QS8A 4ML9A 3NJ3A 4ZE5A 3UGRA 2QCGA 3WD0A 3EB3A 3ID7A 2Z2AA 3QPYA 5IRPA 1L6SA 4LB3A 2Y7EA 2ODOA 2QJGA 4G56A 1FCVA 1XXXA 1YX1A 4QS5A 4EWND 3L0NA 1JZ4A 4JD4A 3SUTA 5I77A 4C6IA 1LL7A 3VCNA 4IUGA 1NF0A 2WMIB 3OW1A 2QMKA 4H6EA 2YDAA 3IUHA 1WNOA 1J0ZA 3VK5A 3B03A 4DYKA 1IQ8A 4GPNA 2XPKA 2YCLA 2C13A 2GOKA 3OBAA 3M5XA 9XIAA 1LL4A 1I4NA 2C7FA 3N29A 1BGAA 4ZZ9A 2W91A 1N8FA 4CQDA 3MDWA 3CZLA 4OUIA 3IGHX 1RCOB 4TX9A 2G95A 2BHZA 1E9IA 4LH8A 3W0KA 3W83A 2A7PA 2WBGA 3CZKA 4ZQOA 1WDSA 1QOXA 2QJNA 4DWDA 5D09A 3KRUA 5BNKA 4O18A 2GQ3A 4A4AA 3IARA 1JULA 4LYKA 2WSKA 4CU6A 1JIBA 3NCOA 3PPCA 1Q85A 1OJXA 3TMQA 3Q37A 1V3LA 5DCDA 2ON3A 4HSHA 2OTDA 4F48A 5FA5A 3DHDA 3PBYA 1TV8A 1OT1A 1EDQA 4ERGA 3TVAA 1CIUA 3USZA 4Y8FA 3TXVA 3URBA 1R3WA 3M9YA 4UB9A 2DZPA 1FHVA 4CD7A 1EJUC 4YTSA 1UZDA 3A13A 3ZJ7A 4L61A 1EH9A 1SO4A 4LEFA 4NAFB 1BAGA 3WCZA 1XCWA 5C0QA 1NFPA 1BXNA 1TSIA 2NXHA 1K6WA 3QYSA 4ORMA 4ZEPA 1ZRQA 1AVAA 1QOPA 2VVNA 3QKEA 3AFBA 1TUFA 4Q4KA 3W1NA 3QLLA 5KTLA 4W88A 1UA7A 4DN1A 1M68A 1KCLA 3CHVA 5AKQA 3R10A 1WP6A 3HG2A 4XZBA 4H9ZA 4BR1A 4RCXA 2DGAA 3IUDA 2ATMA 3TYCA 3ZZ1A 5FJUA 3WSUA 4XAPA 1T6MA 3I6EA 2BB0A 1FWEC 2QVHA 1LQ2A 2I16A 5G4EA 1L2QA 3HZ3A 4JTTA 5HBFA 2HROA 4UTWA 1E6QM 4Q4SA 1SFSA 4UFHA 1DXIA 1G7VA 1HP4A 3KHDA 3N2OA 2GJXA 4YWSA 1HGWA 4U33A 4NNBA 1XLBA 3BL3A 4HZ6A 4G7EA 1VF8A 3LGDA 3W7HA 2Y8UA 4MNLA 4ATWA 3KRBA 3EMZA 1UOZA 1ZENA 3TC6A 4NASA 3SCWA 2QXWA 3WLTA 3NL2A 3EWDA 1M03A 1NTHA 2EG7A 1W1YA 1CB2A 5I0DA 3G6MA 4DO7A 3W1MA 3VUSA 1OFPA 3FJ6A 1HF6A 3SQSA 3GS6A 4BQ2A 4C1KA 3SRHA 3MHGA 4B5NA 3VNMA 1K1DA 1UKTA 1JQVA 2ZRZA 3WEOA 5A8OA 4YYCA 4FNTA 1JNDA 3ICJA 3UYIA 1TB3A 4AZCA 1AJZA 5I09A 1VPYA 3H7RA 4GYFA 1AMKA 3LUTA 2QT3A 2WJFA 3VOFA 4M51A 3LCWA 2QDDA 4LVDA 3QZAA 2ZA1A 1F6YA 4S3KA 3TTYA 4RE2A 4C6KA 3SECA 2OVLA 1J6OA 2CXGA 3FAWA 4IIDA 1XG4A 4C7DA 1O5QA 1PHQA 4DF2A 2YPIA 4PUEA 4HHPA 4FA3A 1EXPA 3FNDA 1F61A 3TJXA 5KZ6A 2TMDA 2I17A 1J10A 4F9DA 1NIUA 1E43A 2F2KA 4FK9A 1KGUA 5ECUA 2X42A 1WA3A 2OWXA 1N2VA 4PUNA 4XZ9A 4UQCA 3TAKA 3ABZA 3EA1A 3Q58A 3ANVA 2TSYA 3W85A 1OX5A 2QV4A 2AOSA 4B16A 3G1YA 2QUUA 4DUXA 4J40A 1P0NA 1P0EA 4MKSA 3U3HA 3KVMA 2WM1A 4C65A 3SQLA 4C6DA 4AHOA 1YEYA 4ZE4A 2AGTA 3ZLGA 1CNVA 1X97A 4RZBA 1V7AA 3UG8A 1V6YA 1OADA 3VNIA 1ZBCA 5FKYA 1UKPA 1A5MC 3GHSA 4DJED 3A4JA 3CWNA 1UWAA 3H2MA 2QUTA 2CLMA 3GKAA 4F40A 2PDPA 1W5MA 2QF8A 3MI6A 4U31A 3ZR6A 2XN0A 2PS2A 3HB9A 3CIWA 1MNSA 3QV6A 4NILA 4RK8A 2ALDA 2OMAA 1YPFA 8TIMA 4NZFA 3S5OA 5AOUA 2XDFA 2QAPA 1RJRA 7CGTA 2IKIA 2A4AA 1DQUA 3KHJA 2WM0A 3W26A 2V63A 2YLLA 3B4YA 4GUGA 4TV5A 2ACSA 5FL0A 1K03A 1OFRA 3LDVA 3LERA 1JZ7A 3EDEA 1GVQA 4LU0A 1THFD 3VO0A 4WF7A 3DU0A 4LUIA 3S0CA 3W01A 4HHHA 5FI8A 4AXNA 4PC8A 3W1TA 1M53A 3C6CA 3WBYA 2J9XA 5A2AA 1GQKA 2IW0A 4WEVX 1PZ3A 1MO0A 2UBPC 1N8IA 3PM6A 3V1PA 3F5KA 3H2CA 1E6NA 5J5DA 5GNYA 3VOIA 1GJPA 4X0NA 3W74A 4LVBA 2GYIA 3AJ7A 4Q4RA 3AHZA 3CQIA 3SCVA 1R86A 2X7VA 5C9RA 3W86A 4NVTA 4LWWA 2OGJA 4C60A 4KRZA 4K2SA 4FX6M 2G3IA 4WRHA 1PIGA 3D47A 4O13A 1AD4A 1EGZA 1PE1A 3K30A 1QAPA 2YB1A 1HKKA 2P10A 3TC7A 4O14A 1WXZA 5EBAA 2JIEA 5HJXA 1WUEA 4AVFA 1VCGA 3PHAA 4PODA 1SMAA 4XBJA 1ZQ5A 4NP7A 3I6TA 3K4AA 4FLSA 2YJQA 1DOSA 4C1LA 1B3XA 2RDUA 4S38A 3VOCA 1E5JA 4M8UA 2D2OA 1MNZA 2QGYA 1EWDA 4MLJA 1RCXB 2ZE0A 1K8XA 4L6HA 2XSXA 2QCMA 3KDOA 4KWVA 2OQHA 2G3JA 3PY2A 3MP3A 3LXBA 1Y5XA 3R13A 2FB3A 4QFUA 1VFFA 4CUCA 3QJAA 1EUAA 4GI6A 3WQ6A 2GSEA 4MJ4A 4QRNA 4D6FA 3S8HA 1MRAA 4B4FA 4GRSA 4D9PA 1SR0A 4R34A 2WK2A 3COTA 2V30A 1RZMA 1E6PA 4XUYA 3MCNA 5GVJA 2E1DA 1EA0A 1GZJA 4K1GA 3NNTA 3H26A 1JD7A 1CXIA 2INFA 4GNKB 1G67A 4PBFA 4A8NA 1CENA 1JPDX 1LT8A 3RPDA 2QNEA 4PEKA 1YDNA 5A6TC 3RU8X 4DB7A 1AJ2A 2F8QA 3UXIA 5EMYA 3F2CA 1RALA 1E5NA 2Y5EA 1BF2A 4B3ZA 3MHUA 2VUNA 3ITYA 2BFGA 3I4EA 1MDLA 5EMJA 2Z1KA 4GUHA 3F5LA 1RP9A 2RGLA 1TWIA 4DUVA 1WQ5A 5HDRA 2NT1A 4W87A 1E72M 2Y8VA 5H8PA 3RLHA 3NQGA 3G24A 4NJKA 3RJYA 2ISSA 4OKDA 2BMBA 7REQA 4GQRA 3DFHA 4PB3A 4OHQA 1A5LC 4Z2IA 3U8GA 3KL5A 3QZ6A 1QK0A 1D7KA 1EGVA 5FF7A 3PANA 4Q7NA 1UUOA 3QH2A 3WQDA 4D6CA 3MSDA 4LUSB 3DN5A 4B9ZA 3TAOA 1UIOA 1W3JA 4MWAE 4GYPA 5BWAA 4L56A 1SFTA 3GTXA 4PUUA 2CLEA 4KEVA 1QU4A 5E0FA 1MEIA 2YCJA 2G8ZA 4LSBA 4WKHA 4IH3A 1NWUA 3C8NA 2CHRA 1P43A 4AAJA 4NYYA 5H1WA 3LI1A 3MV01 3ITGA 2NQLA 3AIRA 1XQKA 3BW2A 1UROA 3E38A 1JXJA 2AMXA 1BHGA 3VIIA 3E0FA 4PFHA 1RR2A 2VQUA 3U0HA 3N73A 3Q2DA 1EDGA 1NH6A 5D9OA 4AHQA 3TYBA 1ISXA 1MZRA 3GHTA 3QC0A 5G2WA 3M46A 4FF7A 1D3CA 2GK1B 1GEQA 5LIXX 3NL6A 2YR1A 1R7OA 2YA0A 3K1GA 2CITA 1MXSA 2AQOA 3TOPA 1XGEA 3C4UA 2Y88A 1O1ZA 2GGGA 1HKJA 1UPPA 4B5WA 3AMDA 2PDNA 5IXEA 1FRBA 1G5AA 2RJGA 3LHTA 3QYQA 4XUGA 3T2PA 1RVGA 4E8GA 1NOWA 3JR2A 2J75A 4A3YA 4QP0A 1GYNA 3AS2A 4MIMA 2J7HA 4LNYA 4BA0A 5E0CA 3ANUA 4GH1A 1KFLA 4INFA 3AMGA 3CH0A 3W70A 4BWLC 1FWAC 4GE8A 1BGGA 3WQ8A 3MANA 4H9YA 4UNIA 3EX2A 3KP1A 3LSBA 1GVYA 3RXZA 3VX1A 1BPLB 1GG0A 3L4WA 3SI9A 4IX2A 1FTXA 2O0TA 2YDSA 2DW7A 3DFYA 4Q4PA 3KLLA 3U7VA 1VBGA 3A4WA 2Z4GA 4AWUA 3WNKA 1B3YA 5G4WA 2E7FA 3B8UA 2PP0A 4PMRA 3LTSA 3KXQA 2Y1HA 2YCKX 2IKGA 5E0KA 2PDUA 3S47A 5IBXC 2R1MA 3TTOA 1G69A 4ML4A 3WDQA 1WKEA 5HMEA 4FOKA 5BZAA 2J27A 4GHRA 3URNA 3ANYA 4YPJA 5A8QA 2EHHA 2QYGA 1AQ0A 4ZO9A 2J6XA 4M6PA 2PU0A 2J6VA 3OHIA 4J28A 1IEIA 1MEHA 4HNVA 4Y9AA 4YMZA 4AD3A 3ITCA 3WLQA 4EAMA 2YX0A 3QTGA 3W82A 3VE7A 4DLMA 4JYFA 4XISA 2C18A 5KEZA 1XI3A 5LSMA 4AFYA 2RDTA 3BJSA 3TR9A 4HCDA 3NIYA 1NEYA 1VHNA 5K9CA 4PGLA 4ECLA 4LYRA 3TTSA 1UJQA 3TV8A 3IIXA 1R0MA 2QV5A 3NQCA 3IJ9A 4IPIA 3OZOA 1RJQA 2VOTA 4JL1A 3SUSA 4DIAA 1P0DA 3A5FA 1R38A 2PLJA 6TAAA 3ARPA 5CBBA 2CZFA 3ARRA 3MBFA 1R3QA 1X98A 1EF3A 2ZRWA 5HR6A 1ISYA 3QC3A 2EJAA 3O6CA 3G77A 3GXTA 2A7NA 3I6RA 3SY8A 3DC8A 1LBLA 1OC7A 3EXSA 2WV8A 1YXDA 4MUPA 4GXPA 1Q6EA 2FVMA 1VIWA 5M03A 3WD2A 4B91A 3MC5A 4PCSA 1WUFA 2F9RA 3GU9A 3NPWA 2NLYA 3GQYA 2PMQA 3LPPA 3LRMA 1C90A 2GFTA 1GT8A 1ZAIA 4HA0A 3MUY1 4UTHA 1EO5A 2A85A 1UA3A 4DAIA 3IJIA 3BSMA 4PMUA 1UG6A 1VEOA 3EOOA 1HXJA 4QM1A 3LHVA 2HISA 3R2GA 3QGKC 2AL2A 3N9SA 3MWAA 4F2TA 3LCFA 1CXHA 2CHOA 3HO8A 5FF4A 4CCEA 4XK2A 2QUNA 3O06A 3BE7A 3MYPA 4PSPA 2DZWA 4M0XA 4US6A 1EQPA 4DHGA 2PUZA 3WH6A 4H4IA 4P7RA 3HPSA 3WK2A 3CASA 4IMFA 4IFKA 4YCPA 4B5TA 4ZQCA 3GAYA 1MFVA 3W2JA 4DPQA 5FEXA 1UUQA 3KTXA 4JYEA 5FESA 2Z00A 4V33A 1VPXA 5LIUX 4G5DA 4MFDA 3K5XA 4LY8A 2FMOA 3OOQA 2OSYA 1TV2A 5G2HA 3MVIA 3VI2A 4H6RA 4DUOA 3EGJA 2QJJA 2R1KA 3NSXA 1OFQA 4WDWA 5DELA 1VC4A 1ZGDA 1AG1O 3WN6A 4NI8A 3LB0A 2XVNA 4AZ5A 1O12A 3H12A 3OTRA 1XIDA 3N11A 1LUCA 2G4FA 1AW1A 4NL1A 2C14A 3PS7A 4J3WA 1LG1A 4LAUA 3LM7A 3PR2A 4JTHA 2IXVA 2DT3A 4PMOA 4AD5A 3TUUA 3PF3A 2XSBA 3AYVA 5JVLA 3C2RA 3AS1A 1SSDA 3H70A 3NQBA 2YL6A 3OBEA 4LYPA 4PMDA 4GMEA 1Y8BA 1TPVA 3FA5A 1FCUA 1CLVA 5DF0A 2R1LA 3LV5A 4R88A 4YS1A 5C71A 3GNNA 1PZ2A 3NZRA 4IIEA 1GJUA 3TQ0A 1CPUA 4OBRA 1UR9A 4DXKA 1ONXA 1CLKA 4J27A 1NWTA 1XLKA 2WKGA 3S1UA 1P4CA 1FWRA 2EO7A 4O8AA 4HNUA 5FOOA 2DV0A 4PUWA 4O1FA 4V2XA 3JW7A 4BKNA 1PYFA 1KQYA 4AX7A 3GDTA 1JZ2A 3JUGA 4GGHA 4B4HA 2V9DA 1UWSA 4F0LA 5LNRA 1TPUA 3UW6A 2V3FA 5D38A 3FGCB 4QLJA 5DT5A 2REQA 1A47A 3WK0A 5BCAA 1I1XA 2WOQA 3EKZA 1F73A 4QCEA 4GI4A 5AC5A 3O9NA 4WHBA 3UP8A 4AYGA 4JFTA 4DBWA 3OGVA 3DZ1A 4NRSA 1HJVA 1C92A 1GOMA 2QCDA 4NJIA 2PDXA 1SSGA 2X1TA 4BI5A 3NVTA 3WNPA 1NOUA 2PF8A 4ZB0A 4DQWA 3M47A 2VEGA 3BQ6A 1V6WA 3R8HA 3CHCA 3ATYA 4D8AA 3SO7A 4QNEA 2FMNA 3BPWA 3M0HA 3GDMA 5BW6A 4WZHA 2RDXA 3G22A 3W7LA 1J12A 3GG1A 5HNUA 3APTA 3O1NA 3O2LA 2OEJA 3P3BA 1HJXA 3GIPA 3VZYA 4H41A 1CB7B 3RUBL 1W91A 3QF0A 5LHEA 4RNHA 4XZNX 5HPCA 2DIEA 1XDJA 2DUAA 4RE0A 2ALRA 4Y6GA 1A5KC 1XKJA 1KKRA 1JCYA 4Q8QA 3SY5A 5A6KA 1QASA 1T7LA 1ZCCA 2J4GA 3HV9A 2PDGA 3N13A 4J5NA 1UH2A 3UNDA 2ZE3A 3NSNA 4EWJA 4JBRA 1FBAA 5AB3A 1KKOA 1FDYA 3CEPA 2VRKA 4UTTC 1JZ3A 3TQVA 3UWZA 3I65A 3KBMA 1J11A 5HXMA 1W8GA 2QCLA 1W3KA 2EF9A 3KL0A 2OEMA 1EPVA 3DGBA 1GUVA 3IWPA 2C0AA 3NSMA 3ME3A 4MNMA 2OYMA 1MEWA 1JI2A 1CXEA 3M0ZA 3A3WA 4Q6XA 5FD0A 1K02A 4B9YA 3MI3A 1G4TA 1IWBA 1EWEA 4HNLA 5MF5A 1YQ2A 3W1RA 1QWGA 3S3GA 1K9FA 5F2IA 1G7UA 4ERIA 2CW6A 4UOQA 3JVAA 3FN9A 1VYRA 1XGDA 2Z0IA 1MMFA 1X96A 1Q6RA 4Q8UA 1SGJA 1S1PA 1UWUA 3KL3A 1A50A 3TWBA 5I3DA 3UY8A 4ZB2A 1QNSA 1TRIA 3IRSA 4CNSA 2V8ZA 4DJFA 4ZO8A 2NV9A 4DI8A 5HWJA 1QK2A 2ANUA 2R8WA 3QZEA 3GBDA 2EPLX 4GZIA 4EPEC 3L2IA 4TMCA 1Q65A 1UMYA 4DM1A 1EXBA 4ZB5A 3R79A 1FXQA 3NZPA 3U2CA 1TWSA 2PAJA 4LV9A 1K8CA 4TU1A 3OA5A 3TK7A 3LENA 4J3UA 3BSHA 4F2BA 4Z1CA 1WZKA 3GR7A 4X9SA 3DYOA 3VNYA 1E4NA 4D6GA 2VD8A 1UOKA 2WZTA 1GOOA 4IHCA 3BSGA 4W7VA 3KBJA 5I3KA 1TA3A 2DDXA 3Q65A 3GR8A 4LUYA 3F4VA 3LBOA 1E1EA 1V3HA 3FEMA 2VR2A 3QMTA 3USBA 2GQ9A 3WLIA 2PF0A 3DHFA 4URIA 3MP5A 2GUUA 4AVOA 3VDCA 2X0HA 4K3ZA 4D71A 5LHFA 3VAVA 7REQB 1GYLA 1H1YA 4KESA 1I2RA 3QXBA 3TW6A 3GHRA 2NQJA 3ONCA 3WL1A 1KXQA 3WNLA 3MJMA 4RJEA 2EJ1A 4MOZA 3CMJA 4Q7IA 4MDPA 3CT2A 4AWTA 1JL8A 1CWYA 4UTTA 2CLLA 3N2CA 3N9RA 3AAMA 1NDVA 4XAYA 1VBRA 1FXPA 2HQAA 2YL8A 5ABHA 2VCBA 3AHYA 2BVWA 4L1XA 5AECA 4AD2A 2DVTA 4HN4A 4RE3A 3UVIA 2BASA 2HV5A 5FL1A 1ZLPA 4AEOA 4JQ2A 4U3CA 3GVRA 1B0IA 4PUKA 5A6BA 3S5ZA 3HMCA 4DWSC 3MB9A 4K38A 1XRTA 1Q6QA 4XSLA 2ZX8A 7XIMA 3NEVA 5IHSA 3O63A 3WLSA 1OY0A 1EFZA 1V03A 4NZ5A 3SRKA 4HK7A 4JNMA 1Z7AA 3UY7A 1D8CA 5D9MA 3EB2A 2VWTA 2PDKA 3BGJA 2JFEX 3TQKA 3EWZA 3AIVA 1KM3A 1JCLA 1SR9A 1W9PA 1XYCA 5TNVA 1K7EA 2GJNA 5MKGA 4M82A 4MPQA 3T4WA 3QLDA 1ENUA 5BXRA 2Z2BA 4MB5A 3HU7A 3VDAA 2MUCA 5CGMA 4J9JA 1JZ8A 3BCDA 1VBHA 1FKWA 3KTSA 1TPH1 2PD9A 1FKXA 5JQ9A 3V36A 2WMJA 5A6SA 4FP1A 3VGDA 1KO0A 1XYZA 3S9YA 3DKLA 1FWHC 5HJYA 1I9CB 1QI2A 4Z1BA 4BQ5A 5HJLA 1IF2A 4PL2A 3C52A 4D72A 1A3XA 3K2GA 4H00A 4O1CA 4FAMA 3GWQA 4JQ3A 5LIKX 3ZM8A 3MKVA 3RHGA 2WMIA 1LCOA 1JCTA 1R87A 4A22A 5I3IA 3RR1A 1I2NA 3DXIA 4OOZA 2YOCA 2VCCA 3DENA 4U2YA 3A24A 3TQPA 3O7UA 2AKMA 5AVNA 3S1VA 1E0UA 4CN1A 1TV7A 1GVSA 3U5UA 4POCA 2VEIA 1QXLA 4PEEA 4E6MA 4YYFA 1DVJA 1R9ZA 2NSOA 3FIGA 3FA3A 2HK0A 4ADUA 2PDBA 4OVXA 4AD1A 4C6PA 4J3SA 3D0CA 2FH6A 4S2CA 4X60A 1V5XA 3MVTA 1BYAA 4A2SA 1UR1A 5A6JA 2ZXQA 2BY1A 1O4UA 4JDBA 4O50A 4K68A 3ZJ8A 4PMZA 2WNWA 3IK2A 4IPPA 3G2GA 3M7SA 1OC5A 1EYWA 2A3HA 2FVLA 1XYFA 4YXGA 2FGZA 1D9EA 4KEZA 1WOAA 4ZTYA 3CPRA 4KFNA 1OGGA 4O1DA 4N9BA 3TZFA 2JGYA 3W7KA 7ENLA 2B81A 4A29A 3T05A 2VXNA 3BLPX 1OF6A 2QW5A 4GQ0A 3BW4A 4FZIA 2V2CA 1WYIA 4ASTA 3QFWA 4L5ZA 3AMCA 4GVHA 2FHCA 1EP1A 3GBEA 1AH3A 3D6NA 2I56A 4OGZA 4NG3A 4EE9A 2FHFA 1KR1A 1ECQA 3WBWA 3ERPA 1R3VA 1W31A 3OU8A 3BV7A 1JPKA 4Q32A 5D2TA 1B4EA 3EX4A 1V79A 1W32A 2QCNA 1WBJA 4MTVA 2UY4A 1T0OA 2ABAA 5DXYA 3KZSA 2FGLA 4K6AA 2VX7A 4RDWA 3R5EA 2PWHA 4FNQA 3GC5A 1QO2A 3ZR5A 1XIHA 1UUMA 4Q8MA 3MMTA 2LLEA 3VNKA 4WJ8A 3VZXA 4PRWA 5I3HA 1ISWA 4Q8VA 2XIMA 8CGTA 4H8HA 4L4LA 4H9TA 4G2DA 4LX4A 5D02A 1M41A 1JF5A 2HPIA 5CC7A 1WOBA 4AWSA 4U5IA 5FEZA 1PZ1A 2VGIA 2YW3A 2DSKA 2Y5JA 3PTQA 2W3ZA 4CU8A 1IGWA 3N6HA 2JQXA 2EGZA 1A5UA 4DXVA 3RGTA 4F4RA 4HMCA 1ZAJA 4TUFA 3WNOA 2CZEA 1UJPA 1VB9A 3N34A 2QPUA 4DJDD 3M0VA 1TJ0A 4GYKA 3LOTA 5AHMA 3CAQA 2Z7GA 1JUKA 3W73A 1TMLA 3TKFA 1TCMA 4N0RA 3L4XA 3W7NA 2DU2A 1I60A 2OSWA 4KWUA 4KETA 1FH8A 3PZTA 5AY7A 2C3ZA 4AZ7A 1VH7A 5CG0A 2B4GA 1A0DA 3SQMA 4H8VA 5M17A 1YNYA 3B97A 2E9BA 3KOZA 3E2RA 3CBWA 3KE0A 4GC3A 1BYCA 2EEXA 5DY3A 1BYBA 4B5SA 1EC9A 2I9UA 1DWGM 2EG8A 5GJMA 3U57A 2GPTA 5F2MA 1U5HA 2RH9A 1BSLA 4FXJA 4C5YA 1BWLA 2ACUA 1FDJA 3TLQA 2GVGA 5CPQA 7ODCA 3S9IA 2QZRA 3M0XA 2H6RA 3QKZA 2CXEA 1IWPA 3QEZA 4H04A 1ZNNA 1KRAC 3ZS4A 4QJ4B 2ZDRA 4UUIA 3L5LA 3UJ2A 3LD5A 3CEUA 2ZXAA 1XDLA 2XG9A 3P7YA 3OVPA 1VRXA 2HVOA 1H1ZA 1M7XA 3UFYA 4JKKA 1LJYA 2E4TA 2YL5A 3CMGA 4W8AA 4I9MA 5J5RA 2Y4SA 2B7QA 5A8MA 4Y9OA 3IGSA 3B8WA 1EX5A 1XJBA 3H8AA 1T8XA 3G1RA 1KRMA 3L65A 3FHQA 3W7MA 3EPNA 1OQFA 2V3GA 4BEUA 5DMMA 3IGUA 1QI5A 3JZEA 3GNOA 1IE7C 3UWYA 1YNPA 4W89A 1DIOA 3CUIA 1QR7A 1W3IA 3GY1A 4KFPA 3UZWA 1XIMA 1H60A 1FWNA 1BG4A 3GXDA 3P5YA 2YCLB 3PJWA 3W6LA 5D2XA 2G5WA 2ICSA 4JTGA 3MP4A 1H7XA 3IJ7A 2ABBA 2V5DA 3SUVA 1BQCA 3E0LA 4BFAA 1E55A 1EZWA 3LHYA 1YPIA 3AJXA 1F4HA 3B9AA 3SFKA 3B4UA 2VCAA 1GPWA 1RA5A 4GJIA 3E6EA 4S3CA 2C16A 5D37A 3SGUA 3NPUA 3ZYZA 2VFGA 3TX9A 4R7WA 3T0DA 1OX4A 3T40A 3M43A 4TTGA 3DG6A 4LCSA 4N7QA 3H2NA 1Z44A 1FWSA 5HQLA 4Z1YA 1X7IA 3RX3A 4UC5A 1ZZMA 5EB8A 3QPEA 1U1HA 4L4MA 4E2DA 2RHGA 4WSKA 4C90A 4GINA 3W25A 3EWCA 3DFTA 1XLHA 4EPDC 2OGYA 3WZ0E 4RNJA 3PTKA 4GIYA 4LCRA 2ZICA 1XLFA 2YBTA 3HG4A 3AS3A 3FYOA 3WJWA 1TR1A 2UY5A 4GCAA 1DJNA 1L6YA 4H2HA 3BG9A 3FKRA 3FS2A 1TZ7A 2Q3OA 2VJXA 3DBPA 2R91A 3DGRA 1EZ2A 1FP9A 1REQB 3AIQA 1TYGA 3UZZA 1S5NA 3FOKA 3UXKA 3A23A 3MI2A 4GK8A 2OJPA 3NEHA 4DVOA 1W3NA 1DV7A 5DO8A 4AIEA 4UFJA 2YXXA 4ZA0A 1V3KA 1KTBA 4MAZA 4FX7A 2PBGA 1K4GA 3GVQA 2Z28A 3A6OA 3ABXA 4YVVA 1ME7A 1O66A 4KT2A 4M29A 3NM3A 3P81A 1S2TA 2DJXA 3R8GA 4BEQA 4YVPA 1E4IA 4K8GA 3KTCA 4DWSD 3OG2A 3KCJA 4IPNB 2IQDA 4CN4A 3KOWA 3WUGA 1TPB1 1LLZA 4XAZA 3I3DA 4GY1A 1LUCB 4G6CA 2VRJA 4FLOA 5G5IA 1FHDA 5FJIA 1JRCA 5CZKA 2NX9A 4KW2A 1M01A 3K8MA 2DZAA 2HE8A 1J8VA 2HVMA 4YIWA 1V93A 3HQ1A 4FOUA 3FEQA 4ZXLA 3NTYA 2OEKA 2VDHA 4PH6A 1YLVA 5BMWA 5DCEA 2F7FA 3KLKA 4A6GA 3VKCA 3FGCA 3VMPA 3I4KA 2ZUMA 1BVZA 1F3WA 2WVVA 3QTPA 3T2OA 1GVEA 1P0BA 3JRKA 3M0KA 4Z2HA 4AZIA 3G18A 1XDMA 3STPA 1PEZA 3UCDA 1K8YA 1ZP3A 3N19B 1IHIA 4ZODA 3ARWA 2VI0A 5EL1A 1RQHA 3MU7A 1US2A 2ZX9A 3WMCA 1VQTA 3VM5A 1QNOA 4GX9A 3MKKA 1ADDA 2Y7DA 3GTNA 3N15A 4IFOA 4NZJA 1DJWA 3H53A 3ABSA 2IPGA 2VC7A 4JN7A 2OX4A 3H24A 1WXYA 3T6CA 3GUWA 2DVXA 5CH9A 3QR3A 1JFXA 4LGXA 4E2VA 3OO2A 3WUBA 1GHSA 1WPCA 3KBNA 1OG6A 3LY0A 4JCMA 2BVTA 4Y9PA 2PWEA 3IIPA 1BG9A 2IPJA 4NF7A 4S3DA 5ABGA 3W6YA 4NZ4A 1XD1A 2IQTA 3OYZA 1D3GA 2CLHA 1EJWC 1C93A 1GOWA 2VT0A 3HV8A 1QW8A 3HPZA 1FWBC 3EOSA 4UCFA 2V5KA 4EPBC 3RMEA 1LLWA 2OLAA 4UXDA 4AD4A 1O7AA 3G1AA 2CLFA 4FNPA 3W07A 3SY1A 1NSJA 1H41A 1SU5A 4N4QA 3ECQA 4JCLA 1IIGA 2HS6A 5A1AA 1LWIA 3FY1A 1PIIA 1BYDA 4MVAA 3VCRA 2BGSA 3AIBA 3UPBA 3UXDA 4UZUA 3B04A 4WY0F 2G3FA 4LALA 4PUMA 4B5UA 3LNMA 2AL2B 2JE8A 4GIEA 4CQBA 4ZOAA 4ICMA 4C6BA 5EA9A 1R46A 3DFSA 3WDPP 1BFNA 1LOQA 2Y61A 4GIRA 3DOPA 3A9IA 4WR3A 2P5NA 1CYGA 3GK0A 2CC0A 4QROA 2D1ZA 4O4WA 2VDIA 2OQLA 1F74A 2PTWA 1TZZA 1UCWA 4JX6A 1VZWA 2OYKA 4RL3A 3CL7A 3FVDA 3INPA 3DDMA 1EL3A 2QJIA 1NDZA 1PO9A 4XD5A 2WPGA 4BF9A 4KH2A 1JAEA 3W7QA 3TC3A 4M5PA 1LZOA 4LRTA 3QQWA 2WWCA 2Q3RA 3LA4A 2GUYA 3WH9A 1YADA 1E9YB 1GORA 2FIQA 3IV3A 1ME8A 2FZBA 4NKCA 3UWQA 3QSTA 3VU2A 3QGAC 3IAQA 4WY0B 2PURA 2XIQA 2CBVA 4NZCA 2CKRA 3RRAA 2CZVA 3T0BA 4P8VA 4UQDA 5E6ZA 3NYZA 2WWDA 3V0UA 1W1PA 3FVMA 2BOEX 4QS6A 4GG9A 5AVHA 4H6KA 1FHUA 4H1ZA 2ATSA 4QJ3B 3S42A 1V4YA 1R2TA 5C7HA 4UQAA 5KMYA 3UR2A 2FZMA 3LHUA 4X2RA 1PHWA 4D8LA 4H83A 3CUXA 1QNRA 3NOYA 1PKYA 3SUUA 1F3TA 3O16A 1XFBA 4XBSA 3OEXA 5HPOA 3XISA 4LS1A 4JFWA 5ECVA 2X40A 1K7FA 4MFEA 5LYRA 5A94A 2XU2A 4H7CA 4H6QA 1F8IA 2V3EA 3CQ0A 4FIQA 3FW6A 3SJ3A 1IXPA 4E3TA 3KOYA 3O6YX 1UD3A 1DWAM 4NJJA 3V5FA 4WIWA 1H7NA 1DIEA 3NGJA 5EFDA 1PPIA 3TCEA 3S1XA 4U4MA 4YNGA 3QHOA 1Q45A 2XVGA 2OSXA 3I7SA 4QG9A 1KFJA 4A05A 5EFFA 1EIXA 4O0ZA 3RU6A 4EAYA 1QPQA 1QI0A 4GKLA 5D04C 5LNSA 3OODA 2TYSA 1J0YA 1PJ9A 2ASHA 4NJGA 1VYSX 4HMDA 3WBEA 3W75A 3STCA 1NU5A 3EWBX 3C5QA 3DYMA 3PP7A 4AY8A 4JEQA 1QHPA 3DG7A 1YDOA 4K7YA 1SO6A 1XH1A 3M0LA 3BW3A 4AZGA 1WDQA 5C9ZA 4AC7C 4I8DA 4CNOA 3UJEA 2ZZ3A 3AXIA 2PC4A 4GYPC 4D8ZA 4NRRA 3TNOA 2ZX5A 5EPDA 4PMQA 2TRSA 3N4FA 5MKGB 4EXQA 4NZ3A 5L6UA 2DZSA 3M0YA 3QBUA 3QHNA 2Z1VA 3T44A 1KXTA 1PS9A 3TN5A 1C9DA 3VE9A 4MB4A 4L6DA 5CZTA 2J9ZA 1IT8A 1DP0A 1MW0A 4GI8A 5IHRA 5ABFB 1UW9A 3UEQA 3H7UA 3T81A 2WKJA 4W7WA 1B9ZA 2FQIA 3NM1A 4HSOA 4AMCA 1R3RA 3SCTA 1RAKA 1JG9A 4W84A 2ZUWA 4Y96A 3A9BA 1GOIA 3G3DA 4R9OA 4W86A 5A8GA 2GK1A 2PDFA 4ROPA 5DQPA 4QQ3A 3AROA 4CCZA 1RPKA 5HOSA 3XINA 1DWHM 5HWNA 4DF0A 4I5XA 4QISA 2D69A 2GJXB 1JGIA 2BWGA 3WDHA 4GVFA 4IMDA 4XAGA 3H4GA 3H6OA 2R24A 1MW3A 2Y7FA 4BZYA 4O16A 3OIXA 3LPOA 1KTNA 4QLKA 2WYSA 3P93A 4MB1A 1POJA 2X1UA 1PV8A 1E9LA 5D2WA 2BOGX 1H0GA 3ABRA 4XTIA 2JKPA 1QJWA 1ZL1A 3ARTA 2V81A 3ITTA 3LYEA 1JR1A 3B8DA 1E3ZA 1SJAA 1YTEA 4C6FA 4AZHA 1OK6A 4O1AA 2P76A 1RP8A 1UYQA 3IVSA 4AX6A 2XFWA 3E96A 5D8WA 3EMQA 2Q71A 4HCHA 4LJ3A 1XS2A 1W17A 4GGBA 2IUZA 3C2EA 2DORA 4MDOA 1H3GA 4NAEA 1GQIA 1WDPA 3R12A 5TF0A 4I7UA 2O55A 3C2OA 3WFLA 1KBLA 3G0UA 4ICCX 3T08A 2CZ5A 3G0SA 4WDTA 1V02A 3RK8A 4HU8A 1WKFA 3EEGA 4JTEA 4JXCA 1SW0A 1EP3A 1ZB5A 2Q8ZA 4J2PA 2XM2A 4XG1A 3PC0A 3PBGA 2GDUA 1YRRA 1ME9A 4G7FA 3HTWA 2J79A 4E38A 4EF9A 3ARSA 4XKMA 2HVNA 4WKAA 3SCPA 4JTUA 1WBHA 1I2PA 3WMSA 4IIFA 6REQA 1E6RA 1TMHA 1NM9A 3APGA 1PTAA 1CCWB 3ARVA 2CETA 2RJHA 3CT7A 4OV9A 2GGHA 2O9PA 3VUPA 1UHVA 2VEPA 1AQHA 3CQJA 5HUPA 1UR3M 3GG0A 4AF0A 3BJTA 3MT1A 3ES7A 4DJFD 2VFIA 3WJZA 3HGJA 4KCVA 2PDMA 4I9AA 3WQGA 2DW6A 1ODUA 1EJRC 3ARQA 4ORIA 5HR7A 2BOFX 1C7TA 3DYPA 3ZXWA 5LNVA 3BDKA 1OM0A 3GFYA 3UG5A 1VFOA 3G8RA 3RO6A 1V6TA 4R7JA 1TX2A 2NWRA 3KP0A 1KFEA 3PWIA 4LVGA 4FMVA 1NJJA 2HNEA 3GH7A 2YXGA 1EUNA 2PWVA 2TODA 1VFUA 5D03A 1E0WA 1JCXA 5GPRA 1W9VA 3ZSSA 1EC7A 1FP8A 1QUMA 3BAWA 2RGMA 4Q4MA 2JALA 2FGBA 3ZT7A 1TE6A 4S39A 3GAKA 3KWXA 3LPGA 3AWOA 1QI3A 1Y5WA 5CBJA 1V0MA 2J25A 2EPOA 5AC4A 2CLIA 3P5ZA 4MLRA 1J93A 2X1RA 2YA1A 4RLIA 4HB7A 2R82A 1XL9A 1HZYA 4PB5A 1JF6A 4H19A 4DBEA 1GZ1A 3VINA 3VYLA 3B0UX 1UH4A 1TPWA 5I5RA 3L0KA 3K4DA 4QEEA 1XH2A 3GTFA 3R25A 4H9UA 2TAAA 1B30A 3AALA 3ARZA 1KCXA 2VEFA 1RD6A 4TX6A 2Z27A 3NO3A 2B0MA 2C71A 4IL0A 3PTDA 5CBIA 1ONRA 3W7GA 4TR9A 5F1VA 1B2YA 5HQMA 4FOJA 1TKKA 2E67A 4UQEA 4G1KA 1CT5A