1VFHA

Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
382
structure length
381
Chain Sequence
b'ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alanine racemase
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
molecule tags Isomerase
total genus 124
structure length 381
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfhA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfhA02
1SZRA 2VD8A 4BF5A 5FAJA 2QGHA 4XBJA 1SFTA 4XG1A 3NZQA 3E5PA 5GJPA 1B54A 1NIUA 1EPVA 2OO0A 1RCQA 4DZAA 4Y2WA 4LUYA 2RJGA 2TODA 4ILSA 3GWQA 3BTNA 3B8WA 1L6FA 4LUTA 3UW6A 1NJJA 2RJHA 1HKWA 2O0TA 3E6EA 3HA1A 2SFPA 3WQGA 4ZGYA 4LUSA 5FACA 2PLJA 4A3QA 4PB3A 2P3EA 3MT1A 3WQFA 1W8GA 4DYJA 1VFSA 7ODCA 2PLKA 4LUTB 3VABA 1TWIA 1D7KA 2NVAA 4LUSB 3N2OA 4ECLA 1BD0A 3ANUA 3C5QA 1L6GA 4KBXA 4PB5A 2YXXA 4BEUA 1CT5A 4PB4A 1XQLA 3AWNA 3WQDA 3N29A 3CO8A 3WQCA 4V15A 2ON3A 5GJNA 5IRPA 1KNWA 4QHRA 2DY3A 1XFCA 3B8UA 1XQKA 3LLXA 1F3TA 4BHYA 3B8TA 3N2BA 1VFHA 4FS9A 5FAGA 3SY1A 3ANVA 1KO0A 1QU4A 3OO2A 1HKVA 3KW3A 2NV9A 3HURA 2ODOA 5GJMA 4AIBA 3AWOA 2VD9A 2J66A 4BEQA 3CPGA 1TUFA 4WR3A 1FTXA 3R79A 3S46A 3B8VA 5BWAA 3WQEA 3NZPA 1VFTA
chains in the Genus database with same CATH superfamily
2ZDSA 1V6UA 4H00A 4O1CA 3HPXA 2POTA 3WL0A 2I1OA 4RPQA 1ISXA 1QRQA 2QUVA 3QHNA 1RALA 1UASA 2V3GA 3QV6A 3HF3A 5A6JA 4PMQA 3EKLA 4NJJA 5XIMA 2X1UA 5KSWA 1UBPC 2E8YA 4TIMA 1S5TA 1TMQA 3W7EA 1BVWA 3W7PA 5EY5A 2EF9A 4U3CA 2R9RA 1ZJAA 1U1HA 1TQJA 2FZNA 4HSHA 3WLPA 2NVAA 2DORA 1UKSA 2YCKX 4Z2LA 5D9PA 3RLVA 2PTZA 3HG2A 4I7UA 4PUUA 3RX2A 2ZE3A 4LU0A 1VRXA 3AWNA 2F9RA 2W5FA 4Q4PA 3NTYA 1EJTC 4DM2A 1PKYA 1TRIA 1XRSA 3ENLA 4H01A 1I8JA 2CHNA 2CW6A 4QNEA 1PL9A 1Z42A 4H2HA 2J7GA 3B8DA 4O28A 2RFGA 4UCGA 1LBFA 4FIRA 1R86A 2FGBA 3CUZA 4IXHA 4M56A 3SGZA 5FJJA 3JZEA 4E2BA 2DIJA 4ZL1A 4GO9A 4B5VA 2QV5A 5HR7A 3PAOA 2WJEA 1GVRA 1V08A 2YA0A 3NL2A 4H8HA 2D1ZA 4ZMGA 1WQ5A 1WOAA 3WNOA 1J0JA 1SZRA 2XVGA 4AD5A 3EDJA 1RVKA 5FEZA 4FNTA 1XLAA 3CZ8A 4FALA 5IHRA 5HMFA 4UMCA 5DRIA 3DG7A 1E0XA 5HXMA 1WBHA 4B5UA 4I9MA 3RYSA 3B03A 3KVMA 5ABFA 4NHVA 5I07A 2WM1A 1OIMA 4ZQRA 2NW0A 1M7OA 4KWWA 4CCZA 4GFIA 1NFPA 4GUIA 1N8IA 4TQTA 4K1GA 3KE0A 3M47A 2WMHA 1NOFA 1D7KA 3CU2A 5HJYA 3O6YX 2EAWA 2EJAA 4HYVA 4Q8VA 5H8UA 1SR9A 3RLGA 3DFTA 3GC4A 4NQ1A 2ON3A 4F8XA 3BAWA 1TPB1 5DANA 2E9BA 4M6VA 1ME9A 3KBVA 5IFPA 3GAYA 3U8GA 1KFBA 5FJUA 2E5DA 3VKBA 3LGEA 8RUCA 3KW3A 3GX9A 2PDJA 3B97A 4FEZA 1RY8A 1ZHAA 4PCNA 1W1YA 4W7UA 2DH2A 1EYEA 4DBDA 5L6UA 3B04A 3PUDA 2VD8A 4Q8WA 2WMGA 1RK6A 1Q4WA 4ZVJA 3QLDA 3QSRA 2FKPA 3MKCA 1J2BA 3LTPA 3UPMA 1E55A 3NVDA 5EB8A 2YBTA 3LCIA 4G9PA 2GUYA 2ADAA 3GR4A 1R30A 5EMMA 4X3ZA 3OZPA 5K9DA 5CQ1A 4N7QA 1Z3NA 3HO8A 3ERPA 5AYXA 2PRMA 4G56A 1XSKA 3W1XA 4W4QA 1HL9A 3NR0A 2ZZ3A 3AMLA 4XAYA 4US5D 3C5QA 2ZRXA 3NO3A 1UH2A 3ATZA 3F5JA 2CLFA 5U7SA 5KINA 3WQDA 3QY6A 1WAUA 3NVTA 2DT1A 2NT1A 4OVXA 2OQLA 1Q63A 1ALDA 2XVKA 4HNCA 1F3TA 1G94A 4JTIA 2FH6A 1FBAA 1CXFA 2WNQA 1F4AA 2YGYA 3ABXA 3POCA 2Z1WA 4EWND 1KO0A 1M5WA 4QJ4B 3VGFA 1RR2A 4KFOA 4OKDA 2HK0A 4PEEA 3W01A 3GNOA 1GT8A 3NAVA 4ERIA 4LYPA 3LQLA 3WQ5A 3S1VA 3M46A 3EPNA 3NQDA 4S3FA 3WQVA 3HTWA 3GTIA 2ZXDA 4F0HA 3FHQA 4CNUA 1K7FA 4BCEA 1GWJA 2XN2A 1F7BA 3AALA 1L9WA 2YLLA 3ES8A 3G0UA 4DHGA 4CQBA 3SJ3A 4NJHA 2ZVRA 2XGBA 1TR1A 2EKGA 2RJHA 3OGVA 3TWAA 3OVPA 3ITTA 7ENLA 4A3RA 2VX4A 1LLOA 2J13A 3D47A 2NSXA 4HT3A 3B9AA 4GQQA 2RUSA 3NZRA 4XZNX 4S1FA 2X7VA 4IFOA 1JZ2A 5HQLA 1GZGA 1GVSA 1ZLPA 5M17A 4DNHA 2IPWA 3OU8A 4I9JA 3R4IA 3RG6A 4MNJA 1V0NA 1D3CA 3MKVA 1S2TA 5D2YA 2A6LA 4QE4A 1IIHA 2VUNA 2D0GA 3U5YA 4EPDC 3N9SA 3N2BA 1VCFA 1W3IA 4I6KA 3TSBA 1XR2A 3GZAA 2UWFA 4UBPC 5JMUA 3GVQA 2OOGA 1EB3A 1NWUA 1JCYA 3I4KA 3TCSA 3PTKA 3RUBL 2INEA 4JN8A 4B90A 1NWTA 2PDQA 3GTNA 4AZIA 4B5NA 1XISA 3VIFA 3V7PA 2E8ZA 4MLRA 2A3AA 4EIVA 4FO4A 4NI8A 1S2CA 4ZOAA 3LNMA 1U33A 4HD5A 3DBPA 2HWGA 4REQA 4S3KA 1F6PA 3UZ5A 1TV5A 1EJVC 1F07A 4J27A 1NAL1 4I6VA 3DKLA 4B9YA 3VAVA 2NQLA 3VIOA 1V7YA 5CGMA 1A5OC 4JTTA 4I9TA 4HYRA 1HJSA 2JF7A 4L4MA 4QAIA 1EJSC 3RRXA 1PKLA 3S5SA 2ZE0A 3KTCA 3L4ZA 4NI3A 4NVTA 3GVGA 2INZA 2WB5A 2V5DA 3GW3A 4HU8A 1XDMA 1KWGA 5F4XA 2B7OA 4KEZA 2DVTA 4M1BA 3GXPA 3W81A 1TPWA 3IGXA 4AF0B 1GQJA 5GNYA 2FHCA 3LCLA 4KWOA 3ZSSA 4UTKA 1JDEA 3AU2A 3RM4A 4IISA 3MP5A 2HS6A 4JX6A 2DJLA 3LI0A 3S1UA 3MY9A 4CGTA 5LZLA 1W91A 4Q33A 3IVSA 3S42A 1DWHM 5FF7A 2ZX8A 5ABHA 2PPGA 1IEQA 1V6XA 1LOSA 5ECUA 2YW3A 4UQEA 3G6MA 4LAMA 2WCAA 4PRWA 3V35A 2YL9A 3H54A 2CBVA 3GKAA 3BW3A 4C6PA 3R0KA 1Q8AA 1DJYA 4ZQMA 1OFDA 5CJMA 5PTDA 4AVFA 4C6QA 3RO8A 5E09A 1REQA 1QFEA 1EH9A 1BRLB 1DQUA 1Q45A 1I1XA 4F0KA 3LGDA 3CC1A 4P7QA 4DJFA 4L6HA 3TIMA 1AJ2A 5CAHA 2ZC1A 3K8KA 1WDWA 3P81A 4CKQA 2ZADA 3TXZA 3TP4A 1MMFA 2KAUC 2PCEA 1ZP4A 3IK2A 1YPIA 2D73A 1UMYA 4L1XA 4MOZA 4MPKA 3KM8A 3OLIA 4E38A 3MV11 3SADA 4J2MA 4NZCA 4LUSA 5ENLA 4J40A 1QI3A 3WDPP 1ISYA 2DW6A 4EWJA 2Z1VA 1MEWA 1EA0A 3BZGA 4AD2A 3L68A 2CLEA 3B9EA 4XB3A 5E9XA 1BD0A 3TMQA 3AOFA 4I8YA 1F73A 4L5ZA 1P5BA 1S1PA 1YTEA 3W83A 1ITQA 1KFEA 1YW1A 2VOMA 1HNYA 3QMSA 2GLKA 4FP1A 4X60A 1B5TA 2QULA 4KT2A 3USBA 4RW5A 1UUOA 2PB1A 4Z42C 1VKFA 2BVTA 1WDDA 5F7UA 2ZZ5A 3PG8A 4ZODA 3MU7A 4IG2B 4TV5A 2R6OA 3FN9A 2ZBTA 1XM3A 5CCZA 2A3BA 1TPH1 3C0LA 4AWEA 3ID7A 4LEQA 3ZQ9A 3DBNA 2FDSA 3LZ3A 2L5HA 1V93A 1FH9A 2W92A 2YYUA 3K2GA 3BJSA 3S0CA 5JU6A 3U2OA 1XCXA 3VKDA 2J24A 2PDXA 1RCQA 1XF0A 1YLVA 3PG9A 4GZ7A 4UR7A 2VFHA 4F0SA 1V0KA 2G8ZA 5CG7A 3FLUA 1IE7C 1YNPA 4FSAA 1CWYA 5AYYA 3CTTA 1WDPA 3U48A 3TXVA 5HWNA 2WSYA 3WJSA 5CSSA 3K4DA 3E49A 2ISVA 1YMYA 4IP4A 2W79A 3URQA 4AHQA 2EQDA 3FKKA 4OE7A 2HISA 2PURA 5HDRA 3FA4A 4GJ1A 4L4OA 1BSLA 1PYMA 1T96A 3NL5A 3L5AA 2G50A 5J04A 3PR2A 1TWDA 5LGXA 1H7PA 4W8AA 3SURA 3ISIX 3CIVA 2G0WA 3CV2A 4AU0A 3MMDA 5AHLA 3EZ4A 2HSAA 3E1F1 3ARXA 2IKJA 3CB8A 1UC4A 5BOOA 4GC4A 1FQ0A 1G69A 4JDBA 3W71A 1K9FA 3LZ5A 3P0XA 3TDFA 4EE9A 5HMDA 1LRTA 4UR8A 2BZNA 3L2IA 2VFDA 4AY8A 5AC4A 4RZ5A 4GUHA 5I3JA 3VKJA 1WKDA 1JGMA 2XN1A 4MVAA 1LTDA 4GQGA 3BJTA 3VPLA 1A5MC 1PSCA 2BY1A 1O7AA 1VFUA 4FA3A 3VDCA 3VZXA 5IOBA 1HKIA 3QV8A 4AEOA 4JS3A 1TRDA 1FDYA 4LXFA 5M03A 1G4PA 4QCEA 1CECA 3UXKA 1K70A 2SFPA 3U57A 3W7QA 1XINA 1X96A 3NDYA 3UR8A 3W07A 3OBEA 3E2QA 2HVOA 2OR2A 5AVHA 5HBFA 4MY9A 3TC7A 3QBUA 4O10A 1VPXA 2ZXBA 3VTRA 4QJ5B 1TWSA 2V5LA 3W74A 3S5ZA 1LORA 1W0MA 4UTIA 5HQEA 4H4IA 5CPTA 1XCFA 2E6DA 4P7RA 4V15A 4CU7A 1V03A 4UMAA 2BOFX 3W26A 3J7HA 1BF6A 3T8QA 4XK2A 3TV8A 1K1DA 4JFTA 3UR2A 1ZPTA 2BSLA 2OB3A 2OELA 4S2CA 5FIPA 3BOLA 5TNVA 3PFMA 1UPPA 3O16A 4IPNB 3L4VA 4FHAA 1W8SA 2XZ7A 1HO1A 4PZVA 5I23A 3EA3A 3W82A 5T9CE 4IGMA 1J0KA 2YA2A 2ZUNA 3OLDA 4O18A 4Q6XA 3AS1A 3W88A 4A8IA 4CUCA 5E0KA 2CWXA 1XG3A 4HU0A 4Q8NA 4BS0A 3V5OA 2O4QA 5I77A 1EP2A 1UKOA 3NGFA 3W2NA 2JIWA 5BMXA 4JXCA 3I68A 3G6LA 1P4CA 2PDYA 6ALDA 2XIOA 4Y9NA 1UIOA 1HF6A 1VEOA 4EF8A 3AHXA 1XLMA 3QZEA 4KKXA 3N6HA 1OB0A 1CX9A 1YHTA 2P1FA 3WELA 3BOFA 4HPNA 3DGBA 4PULA 1R7OA 3ALFA 3G1YA 3VMOA 3B4UA 4F2UA 1KGUA 3N13A 4GUJA 1Q4NX 3C6CA 1PWLA 3VGDA 2YCEA 1RP8A 1S2UA 2AMXA 5CJNA 3HQNA 1FXPA 3VU2A 4IXXA 1PHWA 3W70A 4GXMA 4DNMA 3EKZA 3ITVA 4JOMA 1KM6A 9XIAA 3W75A 3UFYA 4P7OA 2CLMA 4B92A 1MYRA 3LENA 2PI6A 1K9TA 3RFAA 2WKJA 2NUXA 1D8CA 8XIAA 3S5YA 1OFEA 3EWCA 1ZBKA 4JHMA 3PTMA 1BTMA 1QNOA 5CAKA 1LBLA 1O6IA 4W7WA 3BCFA 3R89A 3TWBA 3UA3A 3KHDA 3APGA 4UUIA 4XX6A 3VOJA 1M9HA 3KP1A 3N9KA 4IUOA 4JYDA 4FAMA 1XD1A 4ATDA 5E1QA 1P1MA 2B4GA 4DF2A 2VELA 3IV8A 4MDOA 3I3EA 4A8RA 2ZYFA 2HEJA 1JCMP 3SCVA 3G1SA 4DO6A 1XP3A 1R47A 3KTXA 5BWAA 3TE9A 1AK5A 2O0TA 3S3GA 2W66A 3QKEA 4IMFA 4B5TA 1R3WA 1J12A 3ZR5A 2IXVA 1UZ1A 3O07A 1QO2A 2CLOA 2IPGA 1D3GA 3O0FA 2PP0A 1R3QA 4CQ9A 4NZFA 1HJVA 1D3HA 4D6FA 3GXDA 1FWAC 3VD4A 1QAPA 2Y5JA 1QT1A 2VVSA 1GTHA 1GOQA 1AQMA 4KF1A 3PJXA 2OZTA 4LFYA 1GQLA 4MLJA 4Z0JA 1JPIA 1OYAA 2NV2A 2BLEA 4QE1A 2GUBA 3N12A 3VIPA 2WMIA 1UP2A 3LMZA 1JYVA 4RZ6A 3ARRA 3SQMA 1IEXA 2GUUA 2ZX9A 2J7HA 1JL8A 4NZ1A 1HJQA 2VHLA 1FWBC 1P7TB 1FWSA 1E1CB 1PTAA 1Q66A 1EJ7L 1A5BA 5J5DA 1TCDA 2GDUA 2OU4A 2PWHA 2WLZA 4AXKA 4HK6A 1K6AA 4OHQA 3HV8A 2W4XA 3GAKA 3OVQA 3WF4A 3NM1A 2V0TA 1OFAA 2YBUA 2YFNA 1EJXC 1TUXA 3R10A 3E0WA 4UTLA 4I9AA 1OGGA 3HGRA 4XZIA 2WSQA 4I7WA 2BWGA 3W24A 3W2MA 3VUSA 1E6NA 1OT2A 1W5QA 2OODA 1FHLA 4ZSUA 4Y6GA 5JIWA 4HMEA 3H4WA 1CGVA 3W7DA 1XICA 4ERAA 2DW7A 4JIEA 4UQDA 3BLPX 3CUHA 4EPEC 3F03K 1OFRA 4LUYA 1THFD 5A69A 2EKCA 3KS5A 4PUWA 4JTCA 5CLWA 1Q6RA 3VNJA 4C7DA 1ADDA 1O12A 3ANYA 2JE8A 1CENA 2YYTA 3BE7A 1VBRA 3I7SA 1E9LA 1VBUA 3LRLA 2E09A 2J79A 2J7FA 3TR9A 3OEXA 3EB2A 1ZNNA 2WHKA 4HGXA 5DMLA 2X1RA 5K9CA 4R7OA 4HTBA 1PAMA 5FJOA 1W5OA 2OSWA 2GJLA 1T41A 2DUZA 1XYZA 3LLFA 1TTIA 4GO8A 4O13A 2J62A 4K39A 2ZA2A 3TQPA 1W56A 1SQ7A 2OWCA 1OCNA 1W1ZA 3CAQA 4G5DA 2P8BA 3MBFA 2YLAA 3W7OA 5G4WA 2XUCA 4YU1A 2VD9A 3GG0A 1RQHA 3THDA 3EWXA 1GOWA 1I9CB 4AZ5A 5D2XA 4PTNA 2Q6ZA 1LT7A 1WBJA 1ME7A 4NG3A 1YDNA 1SW0A 3A5VA 3A3XA 4AD3A 5M2FX 1F74A 4M1RA 3SI9A 1E6QM 3CUJA 2Q01A 5DQPA 8TIMA 5DMMA 3WF0A 3K5XA 3VIKA 7REQA 2ZICA 4IP7A 1Z48A 3GVWA 2IKIA 1MXDA 3B8WA 3W4RA 3M0JA 1OM0A 1VAHA 1EOKA 4R27A 4GC3A 2CHOA 2F38A 3W1RA 1T40A 3G2GA 2PDKA 3NGJA 4HSNA 1NM9A 1G01A 1GNXA 5KZMA 3TLLA 5BXRA 2CZFA 3PVFA 5G1MA 4WXZA 1Q13A 1NDYA 1H09A 2C6QA 1IZKA 1DWAM 4OV4A 3UNTA 3NZ1A 2TSYA 3CB3A 2WMKA 3VFLA 1BG9A 4K8EA 1C7SA 1E9IA 2CXGA 3LTSA 1XFCA 3XIMA 2Q09A 4IT1A 4N9CA 4KIRA 4JL2A 1HT6A 4UFMA 4PODA 4EXBA 2D24A 2OYKA 1KD0A 5LNRA 3AZRA 5AHEA 1AW2A 2NVCA 3GNRA 5LNVA 3S6OA 4LCRA 3ABQA 3BDKA 3DFQA 2VP8A 3ABOA 1L0PA 1GGOA 3Q58A 2AL2A 1NFBA 1O68A 3T78A 3P93A 5B7YA 3UWEA 5J5RA 1R46A 2Z25A 3T0DA 1DV7A 2TYSA 5D37A 5EA9A 1B90A 2XVLA 2JALA 1HKWA 4GRSA 4HNNA 1ITUA 5JXQA 2VTFA 4DXXA 2IMRA 3ZJ7A 3B0PA 4UOJA 2PLJA 1MW3A 4IMDA 3LCHA 1YE4A 1OEPA 5FCZA 1S39A 1HXJA 4UNKA 5I3DA 4WOQA 1FCQA 3LERA 4PTDA 2WSRA 3H26A 3L7RA 1UJQA 4PB5A 4U3AA 4A22A 1AUSL 5A6TC 1H2JA 4GXWA 4M3PA 1H61A 2QJIA 4UFJA 1QO5A 3GHUA 5LIYX 4S23A 3AIQA 3B0XA 1HIZA 1MZHA 5A2BA 5AYIA 2OOFA 2GJXA 1O5QA 3OG3A 4L7ZA 1XYBA 4JD4A 2BOEX 1SFSA 2PLCA 4IX2A 3COTA 1G9HA 5C9XA 4AFYA 3RF9A 3UERA 3OGRA 1EGZA 3UY8A 4DI8A 1KM0A 3L2MA 5TF0A 1L6SA 4TVCA 1A3WA 1T99A 3CAKA 1DIDA 2PTYA 1HP5A 3LCXA 4LQ1A 5JBFA 3QTGA 4A35A 3UJ2A 3AS2A 1LP6A 1VQTA 2DGAA 5HJXA 1A53A 4GPNA 4G7EA 3ARYA 5I7GA 1WNOA 4AH7A 1PWMA 3BTNA 5EMLA 1UIPA 2VL4A 4WLCA 1P0NA 2A2IA 3SCNA 5EPDA 2EG8A 2OZ3A 4OBSA 2C14A 3CEPA 4MFEA 4EPBC 2VR5A 1P6WA 1N82A 5J8LA 1XL9A 2WANA 2ZRUA 3VX1A 3KDNA 2Z1KA 3GH7A 1G67A 1OABA 4MAZA 4PB4A 1V4YA 1NEYA 5AC5A 2Z2BA 2J9ZA 3N19B 4L1WA 3W23A 4X63A 4JQ1A 1ZL1A 3N9RA 3R1ZA 1A3XA 3SFWA 1V3JA 4S3GA 2GGIA 1WDSA 4PMOA 4GIYA 1VYSX 2CZDA 2DU2A 3DX5A 3PPFA 3NQ7A 2YXOA 3GC5A 4AX7A 1EL3A 4A2SA 4GHRA 3S9YA 3IJLA 4YCPA 1E3ZA 3E9AA 5A6MA 4C91A 2FVMA 1A5KC 1H49A 3HFTA 4TVUA 9XIMA 3FCPA 1KLYA 4NAFA 1KTCA 3GFZA 1XLKA 1ONWA 2I16A 3TTYA 3TYUA 4H9ZA 1XSIA 4UTWA 1ODUA 3MSGA 1OY0A 5KETA 3A12A 4QM1A 1KCKA 1EGMA 4LEFA 1SSGA 3WIJA 4AY1A 2PBOA 4WOZA 1QK2A 2XIJA 1XH0A 2ALRA 3MANA 2V3EA 2Y4SA 4P8VA 4GFSA 4HOZA 4FMVA 4OT7A 1NOUA 4XBKA 1OF8A 1XYAA 2X1IA 3UETA 4AWTA 3QYSA 3E74A 1M65A 4D6CA 1XIHA 4Q6JA 4JR5A 3O06A 3GE7A 4JTJA 4RCXA 2VFFA 4LWWA 5KITA 1RVGA 1MVYA 5ABFB 3BLDA 3GTXA 2E1DA 3BMXA 4GD0A 4WRHA 4TTUA 4GY0A 1HL8A 5G1YA 1E4MM 3H2FA 5LGZA 4MTVA 3THUA 3FDGA 3VNDA 1P43A 2WNWA 3Q4DA 1TJ1A 4JGDA 2QIIA 2QUNA 1MFUA 3GR8A 3MMWA 3M16A 3ES7A 2I9UA 3WBXA 2PAJA 5D2TA 5A8PA 4UQ9A 3K13A 2D2JA 4O8AA 3WF1A 5EMKA 5LHFA 5LHEA 3KVKA 3ITXA 1PO9A 4XAGA 5C71A 2QCHA 3SEPA 3GU2A 4OIFA 2OEKA 3BV4A 4IOTA 1EF2A 3WLMA 3KOFA 2NLYA 1FWDC 4PCSA 1VLWA 3EAUA 3RCMA 1FVPA 5A94A 4Z17A 3WN6A 1QW7A 3SCRA 1QDSA 3VUPA 4QAWA 3TJIA 2C1HA 3LV6A 1SM9A 3LRKA 3GVVA 3UR5A 3TFCA 2E6YA 4QS6A 1BFNA 1XBVA 3AIVA 3GWQA 3HZ3A 1RCOB 3TA6A 1YNYA 2UY2A 4A8LA 3N2TA 1HKJA 1F3XA 1YIXA 3BGAA 3CL8A 2G5WA 3ZM8A 5IFTA 1JXKA 2WVVB 1H0IA 3TYCA 2WVSA 5FESA 3M9YA 2QCCA 3HG5A 1ITCA 6XIMA 2XYLA 3NIYA 2FB3A 3FV9A 3ITCA 4R3UA 1DTUA 1YDVA 1K8CA 4RKAA 3SGGA 2YDQA 3HPZA 1EO7A 2C1IA 3A3WA 1C9DA 4IGSA 4DO7A 3DCPA 1GHRA 4C6OA 4WIWA 1J5SA 1KNWA 1IIGA 3TA9A 5HMEA 1CXIA 2HV5A 3PULA 3C3NA 1OC6A 4GI8A 1CBGA 2FMNA 1H50A 2DUXA 1UR0A 2PDIA 4OWGA 3PZOA 3STPA 4PMRA 1UR1A 3AUJA 3GHSA 1O1ZA 4O53A 1IQ8A 2V2DA 4O1DA 3S46A 2DIEA 1J01A 3BLOA 3BMWA 4GQ0A 4AAJA 3OVRA 2FMOA 2OLSA 3IEBA 1F61A 1A80A 5LXEA 3CLMA 1JVNA 4D8ZA 3BWWA 1WX0A 5FL1A 2CLLA 1TX0A 5CBBA 3BLKA 4YS1A 1QOXA 3DECA 3CQKA 3W6MA 4WKFA 2W6RA 4E2VA 2WJZA 1XKYA 4LBUA 2XFFA 3CQIA 3ZJ8A 1B1YA 4CCDA 3ZT6A 4AMCA 4GX8A 1NDWA 1PIIA 1JD9A 1W3TA 1Q85A 1GJPA 2FVKA 1M7PA 1AODA 4GGHA 5A6LA 1UD5A 3P6LA 1E6PA 4ZO8A 3LPPA 4MNMA 3WUBA 1AH4A 2G3FA 3ELFA 2EPHA 3WNKA 4B3ZA 1C9WA 1GONA 3WBWA 3QH2A 3VDAA 4AWSA 3WCZA 4UFIA 4BHYA 5BMWA 4Z1CA 4DQWA 4RPPA 3GDMA 4H6RA 3UCDA 3NG3A 1ECEA 3WJXA 3W76A 4KWVA 3SUVA 3W73A 3FSTA 3QFEA 1QK0A 3I7RA 3PPCA 1XRFA 2J66A 1FWCC 4HYWA 4LC8A 4RDYA 4PRRA 3KP0A 1MRQA 3SRKA 4KRTA 2VGGA 5CBJA 4HNUA 5BXTA 1LCOA 3RPDA 4ADSA 1K8ZA 2WC7A 3UA4A 1XDLA 1IWBA 1ZAIA 3RIKA 2AKZA 3KBNA 3VCCA 4C5YA 1RY0A 4NXKA 3LS9A 4NY2A 4MAVA 1Y7VA 1NY1A 3IIZA 3DEQA 4RW3A 5JH2A 3AICA 1ONRA 2PWEA 3VIJA 1GOOA 1NWRA 2PSNA 3QHMA 2XIIA 3A24A 5I00A 3WLSA 4JNMA 2W67A 1S2AA 4IQEA 1TVLA 3ZWSA 1ZS2A 3CGTA 3HQPA 3VNMA 3O3RA 3EMCA 4JBRA 4M6UA 1W9XA 3MZNA 4BI5A 2R1LA 3AHVA 4Z2HA 2HCVA 3P14A 4WJ8A 1JD7A 1G6CA 4HHMA 4AZ7A 3ZYZA 3WFLA 4L4LA 1M7XA 2WKGA 3GSMA 3OTRA 2NXGA 1I2PA 1QNPA 1XBZA 3RX4A 3UVIA 3DESA 3LG3A 2P5NA 5C54A 3CWOX 5EYWA 4HHPA 3P5YA 5CSYA 3K4WA 2J9YA 3LXBA 4GGBA 5F2MA 2ACQA 3K1GA 4O16A 3W22A 1E0UA 2XTKA 4GQRA 1F8IA 3HPSA 3S2CA 1I1WA 1US3A 3JR2A 4LY8A 5MHBA 4BKNA 2XIBA 1REQB 1ZRQA 2GDVA 3VK5A 3QV7A 3S5NA 3WD4A 4AC1X 3L0GA 5AN7A 4XKYA 4DF1A 1V02E 3KDOA 2PA6A 2XWEA 3SN4A 1WUFA 3FVMA 2X05A 5I06A 2XPKA 4YVXA 4EP8C 5A8MA 1BWVA 3GG7A 2F2KA 1KBJA 7PTDA 2ZC8A 4PMYA 1YE6A 3ARVA 4LUSB 4ECLA 3QC3A 2Q3RA 3VOIA 2C8NA 2PD9A 3U2ZA 3K4AA 2ZRZA 2VM8A 5LNSA 1BYDA 1SO3A 2YDRA 1KTBA 1IXNA 2VX7A 1BWKA 5H8MA 4IM4A 1EBHA 2PZNA 5AC8A 6PTDA 3CWNA 1PDYA 1M53A 3ZVIA 3LSBA 4JTRA 5E9AA 3PUEA 2GGGA 3L23A 3ITLA 3DFSA 3KOWA 3EOUA 2GVYA 5CZ0A 5BWFA 3EDDA 4JTEA 3F5KA 4M8UA 2ZDRA 2JIEA 3R12A 4H7ZA 1OX5A 2OEMA 2DZSA 2VGFA 3A4AA 4JIIX 1W1B1 3EDFA 4E5TA 1CB2A 2OQHA 1HVQA 1EQPA 3TK7A 3WUFA 2GQ3A 3XISA 4GLEA 1IT8A 1R7AA 1ZBVA 4DZAA 1CW2A 3OB8A 2VZSA 3LRMA 1UB3A 4IIGA 4O54A 1JZ7A 1MNZA 3KVLA 4M5PA 1GG0A 4NP7A 3R5EA 2VCBA 4Q8QA 4C7FA 3NQEA 5KMYA 1Q6DA 4J3VA 4M24A 1R2SA 1OX4A 3TNBA 3LHWA 4LANA 4DBEA 3T9PA 1ZAHA 3CMGA 5DBUA 3VGGA 5D05A 2BV9A 4MZ1A 2DZPA 3CV7A 1PV8A 1QPOA 4GUGA 1S3TC 4D72A 3Q94A 1JIBA 4I5UA 3WH5A 1I0BA 1UH4A 4IIBA 1IR1A 4QLLA 3OODA 2POZA 3T2QA 1B0IA 1GOXA 5BOFA 4GE8A 2QNEA 4IUGA 1UD2A 4HNOA 2VC6A 3DHDA 3QVQA 2TAAA 5KZEA 1DJXA 3W29A 3TEVA 3TTEA 2ODOA 2DZVA 5KZ6A 2Z00A 1H60A 2OCZA 4C65A 1W1VA 3AXIA 3NSNA 4Y9MA 1AH0A 2EPMX 1I75A 5M1TA 3D0CA 3IAPA 1KW1A 2OFJA 2R94A 4Q4SA 5C55A 4DX3A 4ZQOA 3ZLHA 4GVIA 4ZOCA 3RJYA 3WH8A 2VENA 1RCXB 4NYUA 3LXAA 1SFTA 1JCLA 1PTDA 1H63A 1K9EA 3WK0A 1JDFA 3GU1A 3GW0A 1KBIA 1XKJA 2O92A 4KMQA 5AVNA 4QITA 3HG4A 3M5VA 1CIUA 4H2CA 3PM6A 3HOJA 3LHUA 4A05A 2E5CA 4B16A 4N4PA 4F40A 1JPKA 1PX4A 4DEFA 1EEPA 2VEIA 2G3NA 3T44A 3ABZA 1B3YA 2KX9A 1H7XA 3WK2A 1JCNA 4Z08A 1XLHA 1XQLA 2E28A 2J78A 2WJDA 1R5YA 4WVXA 1V6WA 3M0IA 3GBDA 3SRDA 4Y9AA 1MXGA 1BVNP 1R87A 3WENA 5C2XA 4P8XA 3LPGA 3GBEA 1G4TA 3IJ6A 3TU9A 1YX1A 4F0LA 4O0KA 4Z2IA 1SMAA 3UG8A 4MYXA 2HBXA 4JNZA 5A6BD 4BQ4A 1K6WA 1LG1A 1UD8A 3M64A 1JUKA 2PDWA 4LPCA 3DIPA 3HURA 4MJZA 3DI1A 1Y5VA 2QCMA 2XH4A 1ZCOA 4GZJA 4JTUA 3W7IA 3RPTA 1KQZA 2GJRA 4AD1A 3TROA 4PCPA 4LC6A 2C0AA 5I09A 3R8RA 1QBBA 3TUUA 3HU7A 2OO0A 1MO0A 4F0RA 4YNGA 3ZXWA 1NARA 2A79A 1AA1B 1XSJA 3GNDA 2A1YA 1E40A 4ZEPA 4DJEC 1GZJA 3E6EA 8A3HA 3W1AA 4PE8A 4GI4A 3MT1A 3GNNA 1Q3NA 2BOGX 4NRRA 1UYQA 3N14A 2R24A 1FHUA 3W1NA 3WH6A 5AKQA 4TVDA 3S2NA 1A5LC 1JUBA 3P8IA 5IXEA 2JQXA 2CBIA 1GG1A 4RR4A 1TJPA 4Q8OA 1H1ZA 3P80A 3RK8A 5A3HA 3WEMA 1KRCC 1M04A 3S4TA 5AOUA 3THAA 3N4AA 4OOZA 3UG5A 5DX7A 4AZ6A 2EEXA 3SCWA 4Y96A 2B81A 1QPQA 1UWAA 5LYRA 2C7FA 4IPLA 4W87A 1J6PA 5H8PA 5E5CA 5JBDA 4YCOA 2BB0A 1HKVA 2ZRWA 1Z8AA 5BOEA 1UKQA 1C92A 3AYVA 3VNZA 3AMKA 4QG8A 1WZLA 3T05A 3GYCA 3SO7A 2VYOA 3N6JA 3AUOA 3PPGA 3T09A 3A4XA 2Y62A 2V2CA 3RJXA 2ZX7A 4PGLA 4J5NA 2UY5A 2Z24A 3GR7A 1FWIC 1RBAA 1UQZA 3NQGA 4W7VA 3QZAA 2JKAA 3MHGA 3NM3A 1UD4A 4NNBA 3EOSA 3NZGA 1UUMA 4YVVA 2ZVIA 3FYPA 4JIHA 1E0WA 2PU1A 3SSJA 1VP5A 3UWQA 1RBLA 1OC5A 3G1DA 4JYEA 4IMAA 3I3BA 3STFA 5GQBA 1ZJIA 4FNRA 3TN5A 2WMIB 4GK8A 1GOIA 2EXOA 3B06A 3PHAA 3I6RA 4IICA 3LEPA 1R3VA 1FHVA 4NIRA 1IT7A 1QTWA 3VILA 4X0NA 3NURA 1B9ZA 2GVGA 3CHVA 2AL1A 4U28A 2WZTA 3WLNA 1C93A 1BLIA 5AC6A 1B31A 4HMNA 1N2VA 1H4PA 3SCQA 5M3WA 3KX6A 1F6YA 1MXSA 3L5MA 3D6NA 4YPJA 1UOZA 1RXOB 3SY5A 3WDHA 1PJ9A 3CWHA 2FYMA 3M0LA 5GJPA 5CGQA 4H9UA 3BOXA 3DENA 3KAOA 3IARA 2E40A 1GK8A 3LN3A 3DC8A 1GVYA 3OW1A 1NJJA 2C19A 6XIAA 1WDQA 3DYOA 5JH1A 2I57A 3WLOA 2WC3A 2H90A 1GYLA 4OBTA 4MNKA 2A7PA 1QWGA 1RPXA 1V0LA 3GK0A 3MCOA 2HXTA 3E0FA 4O1AA 2FTYA 2J25A 3OYXA 2PDLA 3W02A 2ZRYA 2DSUA 2PGFA 1JPHA 2HNHA 4NASA 4Q4KA 2RGLA 1NQ6A 3PZUA 4K7VA 1W54A 5XIAA 1X6LA 2IXUA 4AB4A 3E0IA 5A8GA 2P0IA 5AZ0A 3A22A 3LHZA 1HP4A 4JTLA 1RUSA 3N3TA 2B31A 2B7PA 2WPBA 1DHKA 1Q7QA 1F3EA 2Y89A 3DHPA 4RZBA 1SZEA 4XSMA 3QPYA 4P61A 4W93A 2G95A 2X0SA 3P84A 4PMZA 1O94A 2PDBA 3CQ0A 4F2TA 3M6YA 1Q6LA 1JRCA 2I5QA 3QOKA 3H12A 4I90A 3MVIA 4GYJA 4MUPA 3GG1A 3WD2A 2ZCGA 1DQWA 1K9DA 3MDUA 3RNDA 3KL3A 3BQ5A 3UWZA 1ML1A 2WWCA 3EPMA 7REQB 1Q6OA 1NP2A 3O05A 3OP2A 2BFGA 5HANA 1X8CA 3AIUA 4O17A 4O14A 2G4JA 4PL2A 4LS1A 3NQAA 3G77A 4X9SA 1FKWA 4CQ8A 3NOYA 1BXCA 1OT1A 1BYBA 1WKYA 3F2DA 3WK1A 4MM1A 3E5BA 4FZIA 4MADA 3SCPA 3PBYA 1T0OA 4S3AA 3HQ1A 1XIBA 1X97A 4ZENA 1QCWA 1S2VA 4C1KA 4EPKA 1RJPA 3CHDA 3PZGA 4QISA 1E9ZB 1XD0A 2NWRA 3HG3A 3M0YA 3NDZA 4JQ2A 4NAEB 3N25A 2CZVA 1VYPX 5IDIA 1KM3A 1KM4A 5EKYA 5MKGA 5CG0A 3WQEA 6CGTA 5DEZA 3EMQA 1IZJA 5FAJA 3UXDA 5JQ9A 2WMFA 2H8XA 1HQTA 4H9MA 3ONCA 2E68A 4PUJA 2PDHA 5FJRA 1W3HA 3CM4A 3OBAA 1FDJA 1U5JA 2AL2B 1IWAA 2ZUTA 1KBBA 5G4EA 1EX1A 1RPKA 4YHGA 2VDGA 3JW7A 1NF7A 3TSMA 1ZSXA 2NXHA 5JBEA 4MNLA 4UTTA 1IZCA 2DQWA 3LV5A 2YCIX 3CIWA 5DCEA 1KKOA 1W32A 3PPHA 1ISVA 1CGTA 5D32A 3G8RA 2C16A 3EDEA 3FXGA 4BEUA 4RL3A 3W87A 1Q7MA 4GVHA 4H6EA 1TPC1 1TTQA 4F9DA 1EBGA 1W1IE 1VCVA 1E70M 2J7EA 1BEUA 3MCMA 4IJRA 1NOWA 3F1QA 3BGJA 2QCGA 3EA2A 1MW1A 2JGQA 4ICNA 2AQWA 3P3BA 3ZVHA 2E9LA 1UPMB 3BJFA 2GJXB 2RDTA 4N6EA 4QLKA 2OWXA 3AMDA 2Y5SA 3DHFA 4NZ5A 3TOYA 3R8HA 3V5FA 1UZDA 4RNIA 4RJEA 1CTNA 3QPEA 5D2VA 2FHBA 4RNJA 4QDMA 5C6MA 4RE4A 1CDGA 2RJGA 4LAZA 1FWFC 1LRNA 4TX6A 3E0VA 3UW6A 1J79A 3WY1A 3U5UA 3AZTA 4R34A 1FA2A 4HMCA 3IIPA 1ADSA 4UZSA 3NXLA 1M1BA 5CH9A 4O4WA 2O9RA 4MUZA 3WQWA 3U7VA 1H5YA 1VBGA 4Q4MA 4N9EA 1KCLA 4ACZA 2YR1A 1J6OA 4HOXA 1B30A 1XFBA 3ECQA 3THQA 3UVAA 3ZO9A 1ZQ5A 3JS3A 2J8FA 4UZUA 3RAOA 1JPMA 3LHVA 1BKSA 3H21A 4B4FA 2A6NA 1DORA 2VC5A 4UQCA 4NT0A 4CCCA 1KM1A 1HX0A 4ZSTA 3GXMA 5LA2A 1GOMA 3A4JA 3B8TA 1JZ5A 1TPDA 2O55A 2VOTA 1MDRA 4CN1A 3L4TA 1V79A 3BPWA 2J74A 3FW6A 3K8MA 3R2GA 5BU9A 3OIXA 2YXGA 1FTXA 1HJUA 3B8VA 1UC5A 3NQBA 4WZHA 3PZVA 3HMCA 5D38A 1W2PA 4AX6A 6REQA 2A3HA 2EPOA 4LRTA 3MQTA 1E1EA 4DZIA 3M41A 3R58A 2J4GA 4NAFB 3OHIA 2F6XA 1OFPA 4MWAE 5CXPA 1GVFA 2BHZA 3ME3A 3GNPA 1TWWA 4GACA 4NJKA 3CT2A 3MYOA 4N6FA 1N8FA 1RHCA 5LA1A 4B5SA 1GQKA 2PDPA 4YIWA 3SUSA 4JFWA 2C0HA 3WYZA 5LIUX 3UQNA 1BQGA 2PTDA 3OQ8A 3GTHA 2DT2A 3S6TA 3PY2A 3T4WA 4HK7A 4WDWA 5RUBA 5D8ZA 1SYTA 4U2YA 3ZJKA 3BO9A 3N29A 4JY9A 3NWRA 4YN5A 1SO6A 2OVLA 3MS8A 3S9IA 2YCLA 4QHRA 3BVJA 2HROA 2WZIA 3PFRA 1EPXA 4S38A 1ISZA 1GOKA 1XGZA 2HQAA 2V2HA 1UG6A 4O1FA 4WY0B 1CXEA 4RE3A 1EQCA 3UZXA 3LU2A 3MSYA 1WKEA 1F05A 4CU8A 4W89A 1H7RA 1NQKA 2D0FA 1XLCA 3H2NA 2YZ5A 3QC0A 3LM3A 2HPMA 5F2IA 1W1TA 4DUOA 1DYSA 1WE5A 4H19A 4GABA 4HK5A 2FB2A 4O8RA 1R2RA 1XC4A 3IWPA 2OWWA 4FXSA 2YIHA 4NZ4A 4DIAA 4LALA 4FX7A 4MKSA 3RCYA 3C2OA 1DJWA 3KTSA 2O9TA 1J93A 4MPQA 4NRSA 1R3YA 3KBMA 3UEQA 2R8WA 5CPMA 2W61A 2DSVA 4ILSA 4Q8UA 3C86A 2TRSA 4IJCA 1JZ6A 1NDVA 2V5JA 2Z27A 2WAGA 3SJNA 4AZCA 3H2OA 1UKTA 3C2YA 2JGYA 2XFRA 3N04A 3BSGA 1O5XA 2YSWA 2ZWYA 3N18A 1TCMA 3MJYA 1XLFA 1LUCA 1WP6A 1SFLA 1L6GA 4NYYA 1ENUA 3MKKA 5FEWA 1IEWA 4CVUA 1CPUA 2Y61A 4JTAA 4RV3A 1FDZA 2ATMA 5DXYA 4UTJA 3TMLA 4OBRA 1E9YB 2WBKA 1SW7A 3ITYA 3T6CA 1R3RA 2IKHA 2FZ9A 1K8XA 6TIMA 3H4GA 4V1XA 1E4NA 2WVVA 3FEQA 5CC6A 4JQAA 3EYPA 2CPUA 3VOGA 2DJXA 4O15A 3LY0A 3S1GA 1ECQA 1KFLA 4CD4A 2WHMA 1A50A 2QIWA 3NZQA 4L6DA 4MWAC 1NVMA 1JDCA 3FDKA 1KXTA 2UZ9A 3EKGA 4AVNA 1UBSA 2HRWA 3U2EA 3P60A 5GVJA 2OSYA 3B9OA 1J0YA 4LV9A 1S38A 3WNNA 3KBSA 5LIKX 4K3ZA 4MF4A 2ZKMX 3VZYA 3VA8A 4MWAD 1R9ZA 4M19A 3OA3A 4DYJA 4JIQA 4N0RA 4WY0F 1LL4A 3RO6A 5HK4A 4PCFA 1VJZA 4PCTA 1IXOA 5G2IA 1U30A 3CIXA 2FZ8A 3QN3A 3ZIZA 1BTCA 3MCNA 3WEZA 1UUQA 3IAQA 1WDRA 4F3HA 2V3FA 2H3DA 1J0ZA 4WGHA 2CC0A 1WXYA 2H9AA 4BWLC 4E4PA 1AMYA 3HV9A 3GDBA 2OKTA 2RH9A 4MY8A 3G18A 3MTWA 3VGEA 1LM1A 3L4UA 1YNQA 2NZLA 4WK9A 1KRAC 1FHDA 2W3ZA 3C2VA 2NV9A 4GKTA 1JI1A 4HHHA 3TTSA 3R79A 1Q6FA 3E38A 3GG8A 2NX9A 1ZGDA 3EXRA 3TJLA 2V82A 3VNLA 1KGWA 2VXNA 3PBMA 4N9DA 1UOKA 3KVJA 3WNLA 5DBTA 3Q67A 3VIGA 3VM5A 1S3HA 1A0CA 1EDTA 5AC7A 1B54A 3O6DA 1XBYA 5IBXC 2G37A 3TAKA 5FF2A 2J7DA 3BSMA 3N4EA 3W38A 4MG4A 8CGTA 3G5EA 4U4MA 3M0KA 3TQVA 1HJXA 3VCNA 3W7CA 3IPWA 1M03A 4LAKA 1D7FA 4OV9A 3IJQA 2ESCA 3BC9A 2CWNA 3M5ZA 4KWSA 1A4LA 3VD3A 4UFKA 4OZOA 2J77A 2QJGA 4FOKA 4GWEA 4ZTXA 5C8BB 4L6OA 4V33A 4H3DA 3MI3A 2W91A 4XAPA 4JTFA 3II1A 4GBDA 5BXSA 5H1WA 3N3MA 1P0BA 1UD3A 5FJPA 3AAMA 3CAVA 1V8EA 5C5YA 5C9UA 4DWSC 3RM8A 3QYQA 4O12A 4ZA0A 4QG6A 1US2A 1JXJA 2Y85A 3FA5A 1BKHA 2ALDA 2Y7DA 2R91A 1XLGA 3DUGA 1TQXA 4G7FA 1H1NA 4U2ZA 2R1MA 2CERA 4DWSD 1M68A 1ICPA 1B3OA 3HJEA 2DPEA 2FLIA 3QF0A 4XD4A 2YB1A 3MUCA 3NZPA 2ZFAA 1HGYA 3M0VA 1XYMA 3T2OA 1DWGM 1K7EA 1SZGA 5AFDA 1XG4A 2ZOXA 1J0HA 3NA8A 1GYMA 4KCUA 3FKRA 4ML4A 4EVZA 1GW9A 3QZ6A 1DIEA 1TZZA 5FSEC 1RBOB 4RV8A 4PBFA 2VGBA 3QR3A 3PN8A 4Q8TA 3E2RA 4F48A 1P0EA 3QTPA 2BTMA 2VEPA 4MB1A 1OCJA 4EAYA 4BQ3A 1Z9AA 4XKYB 1QI2A 4YMZA 4P7LA 1VEMA 5AHFA 3ZMRA 5DELA 3CZEA 3GLCA 2E25A 3RR4A 4WDUA 5GPRA 3AXHA 4NNAA 3B8IA 3ITOA 2EBNA 1WOBA 1LT8A 3C4UA 3LOTA 5IRPA 2C3ZA 4O11A 1VRDA 1UJPA 3ZLGA 3B8UA 2X16A 4JIRA 2YZRA 2BG5A 3ZT5A 3O9NA 3S2MA 1VZWA 2HK1A 4YVPA 2V3DA 4US5A 1EA9C 1GQNA 2A3LA 1BYCA 4ASTA 1CGUA 4L1GA 2WOQA 5D02A 3Q45A 4ICCX 4M81A 3QY7A 2ZUVA 2QJHA 2CZ5A 4V28A 2E5BA 5DY3A 2G41A 1ZBWA 4F79A 2P10A 3PBUA 1C3FA 2PF8A 5BYWA 1WZMA 2HTMA 2WZMA 2QPSA 4JTGA 1XHGA 1KFKA 3UPWA 1VC4A 3PUGA 3GXNA 3BARA 4L80A 3F2CA 3M0ZA 2TODA 1KV8A 2XVPA 4QDWA 3GD6A 3A23A 3KOYA 3AMGA 4CQAA 1DQXA 2BXVA 1TIMA 3C2FA 2P3EA 4EF9A 1H5VA 3BCJA 3OLEA 3USZA 1E51A 3R8GA 2CNCA 2HPIA 2W0UA 4B91A 5LKYA 4LGXA 1TE6A 3DDMA 3WMLA 5AHIA 4RUBA 1AQHA 3VOFA 5K4ZA 4HA4A 3MMUA 1OX4B 1TMLA 3CZKA 4C6DA 2BODX 3EOEA 4S3BA 5DMNA 2Z6JA 1CB7B 4TR9A 5DCDA 2PU0A 4KWUA 1FFQA 3NSXA 4B5WA 2HS8A 1XGEA 3CYVA 1ZP3A 1R6WA 4HU3A 1DJGA 3XINA 5DY2A 1QNRA 3QKZA 2C71A 2J7BA 1O1HA 3W1PA 1N8WA 3EEZA 2VI0A 1EOMA 5XINA 4W5ZA 3IGSA 4HBKA 3R94A 5DT7A 2BP1A 2PP1A 4WJEA 2X7WA 3SCSA 1UR9A 5FEXA 1IGSA 3T0CA 1H3GA 2V5BA 4HA1A 3PWAA 1OC7A 4U31A 1H7WA 2PGRA 2J88A 3H6OA 3UJSA 1QXLA 3L12A 3N4FA 4XV0A 4RNFA 2YB4A 4LBRA 5A2AA 4OTKA 2JKPA 2BVYA 2VDHA 4ZCWA 4EX4A 1GORA 4A3YA 3O15A 5EBAA 2XWDA 1EGVA 3S5OA 3WFZA 1UCWA 2GDQA 3MMTA 3K8LA 3NOEA 4HVXA 4AZHA 1W6TA 3QLLA 4DXVA 2VT0A 3N2MA 3IJDA 4Y9OA 4DF0A 1MRAA 4A21A 4B15A 3MUIA 3NPUA 4TOQA 4ZQPA 2VJXA 4LUIA 2Q02A 4DWSA 2DZWA 1DTNA 5KZDA 1T8QA 5D04C 3C0SA 1GKQA 4XWUA 2CIPA 4WHBA 4JKKA 4J9JA 2CYGA 4KFPA 4I8DA 3H2MA 4P2VA 3CO8A 4UTHA 4YWSA 4CU6A 2FPVA 2FZMA 2D0HA 4C6FA 3PSWA 4H6KA 4FB7A 1JCXA 4GOAA 2HNEA 4O57A 2EGZA 4H83A 4ATLA 1KKRA 1XIEA 3W7GA 5U4NA 1LLZA 1SPQA 3HPFA 1V5XA 4V1YA 2Y0FA 1PE1A 3FYOA 4W88A 3OJGA 4Q8PA 1UW9A 4GYPC 4N02A 4GQBA 5G4HC 3WLKX 4EOUA 3O7UA 1UR4A 1E0TA 3WJWA 4EAMA 5IHSA 4PUDA 3UGVA 1F76A 2FFIA 2NX1A 2HJPA 1OINA 1EIBA 4HB7A 3U0HA 3QSTA 2XGZA 2PODA 1K7XA 4M7SA 2IPJA 1ODZA 3HGSA 3MV01 3C2EA 2YDSA 2ZZ4A 1DJZA 1TVPA 3HA1A 2QGYA 2BASA 4LRSA 4NL1A 4HN8A 3QXBA 3W7JA 5CGTA 2OLHA 1L2QA 5EFFA 4BFAA 3VKAA 3N17A 3UU0A 1SZFA 1EHAA 2OG9A 3MSDA 1ZCCA 3KFTA 4FXRA 3E12A 1KM2A 1ZFJA 2O7QA 3W1UA 1K77A 4MB3A 3B0VC 4HQVA 3FYYA 3CZLA 1Q5MA 3DYPA 3POHA 1E0VA 3JUGA 1B3XA 4RXGA 1VS1A 3K30A 1YPFA 2VEFA 1VPYA 4EXQA 4U10A 3WD3A 4O4VA 3WDQA 1C8XA 4YTRA 1ADOA 1K3UA 1MQPA 2VFEA 3WSUA 1CNVA 1BYAA 4C7GA 1SJCA 1JGIA 2J47A 4KETA 5E6ZA 3CYJA 3T08A 3PC0A 1VIWA 4OUIA 1NWSA 1U5VA 2XIQA 2ZRVA 3NNTA 2F7FA 1B3VA 4KESA 2A85A 3CMJA 1DE5A 2PZ0A 3G3DA 4GI9A 3V0UA 4ATWA 3LTYA 3T0TA 3WLHA 4D6DA 5BROA 3E3HA 1TV4A 3B9DA 3ZR6A 3YPIA 5E6YA 4R7WA 2F6KA 2PRHA 4JTDA 1HFBA 3WD1A 3A47A 3KLKA 1MEHA 3CUXA 4FX8A 1XPYA 2VEGA 4JTSA 2H6RA 4G1NA 1PCKA 1GPWA 3BAJA 2VFIA 4WSKA 2OQYA 1W1PA 3LYEA 2QVNA 5I3HA 1R3SA 2OO6A 4TMCA 3T0AA 4ZQNA 3SM0A 4DUVA 1VBHA 4ZR8A 4C6LA 4MKVA 3SRFA 3I7QA 1PB0A 2REQA 3KRUA 3LPFA 4C5ZA 3IJIA 5BCAA 3BSHA 5D2WA 4C6NA 1OADA 3NL3A 1UP0A 3SN0A 1DKWA 3FS2A 4FPSA 4YL2A 3RGTA 3UP8A 4UWMA 4NJGA 3M0HA 5D09A 1EDGA 2DFAA 5G1TA 2HE8A 4HNVA 3F4DA 3KOXA 5C2GA 2Z1XA 1H0GA 1Q8JA 3C52A 1PBGA 4HKPA 4NZJA 1W3NA 1QPNA 1PPIA 5TD4A 2V9DA 1FWEC 4JNYA 1AFSA 2Y7FA 3UG4A 3DG6A 3V1HA 4K38A 2G3JA 3F4WA 5LXXA 3KXQA 3GNXA 4YTSA 1C7TA 1V6YA 4FOUA 1XIJA 3WQOA 3OZMA 1ME8A 2WM0A 3W84A 4QCFA 2OMAA 1KR0A 3STGA 4R88A 4JZ5A 3PZIA 3BANA 1L6YA 2BVWA 1JQVA 3NPWA 4LUTA 1TO3A 4PMUA 4P8WA 2GGEA 3O0KA 5FI8A 4LAUA 1VJSA 1EF3A 3MYPA 1OD8A 1ICQA 4WDXA 3TW9A 1AD4A 5G5IA 1N55A 1XIGA 5HNUA 1DL3A 3BLEA 4LVDA 4MY1A 1VHNA 3AXMA 5CSUA 2QAFA 4KIEA 2WMJA 3R11A 4J35A 1CT5A 2NQJA 1OYCA 3EX2A 2FGZA 1OSEA 4FIQA 1GHSA 5HPCA 1L8PA 1VHCA 4ORIA 3IV3A 4Y90A 1E56A 2FTWA 2QPXA 1XYCA 2I7GA 3TYDA 1JI2A 1XQKA 2PWUA 3WNPA 4C6EA 1HZYA 3PTQA 1DJHA 4H8VA 5BNKA 4O0QA 2QUUA 3W25A 2PBGA 1V6TA 3SECA 1AZ2A 3LBOA 4DLMA 3FHAA 3MO7A 2WXDM 4WGXA 1XC6A 3U4AA 3BICA 3CPGA 5AYBA 4WR3A 3EWZA 1C90A 4XUGA 1YPXA 1F2JA 3N1AA 4Z1YA 1VGAA 5A95A 3OPSA 3VD9A 1E6RA 4FNQA 2O4MA 3W7NA 1OX6A 4MB5A 1XI3A 5E0FA 3MPGA 2A5HA 3WEOA 2OX4A 2GK1A 1WYIA 4F0MA 1TTPA 5CZJA 1YYAA 4XSLA 2X1TA 1OG6A 5EMUA 2PWDA 1L2UA 1OK6A 1MQQA 4O19A 2ZUSA 2YW4A 5I79A 2QF7A 2A0NA 3AC0A 2A4AA 4R9XA 5FACA 1OCBA 1T8XA 3Q37A 2VRKA 2NQHA 1QPRA 3QGVA 3QFWA 2OPJA 2A3CA 1O5RA 4LVAA 4XZ9A 4KCVA 1QHOA 4PMDA 1AQFA 2WVTA 1N7KA 3C2RA 2GGHA 4KFNA 1ICSA 1TPEA 4DAIA 1IWPA 3H23A 4PBGA 2PDGA 3PJWA 5A1AA 4GCXA 4GA8A 4XUYA 1E71M 1V3MA 4RE0A 2FJKA 3GH4A 3M4HA 5E0CA 4OU1A 3CPRA 2CU0A 1LL6A 1E5NA 4IPIA 4XD5A 2Q71A 3PUOA 3WX7A 3P0WA 1UH3A 1ONEA 1A47A 5LSMA 3TZFA 2I9EA 3HFYA 1V3HA 4LW7A 2BNJA 5FD0A 5REQA 5MKGB 1XIDA 1PX8A 1ONXA 4N9BA 3KCLA 1P6CA 5GNXA 4PFMA 4AHOA 3D46A 3H53A 2ISSA 2CBJA 1OZMA 2INFA 2QCEA 3BQ6A 3CH9A 4A2RA 4HNLA 3EWWA 3BURA 2ZUMA 1F5ZA 3LNPA 3O2LA 4GZIA 1NF0A 3TR2A 2YL6A 3RHGA 2PDMA 4NAEA 3OHMB 2J6XA 3UYCA 5C2CA 3NQ6A 2QCFA 4ZFMA 3IJ9A 3S83A 5ABGA 1TFVA 1KBKA 3PZTA 2BHYA 3DH7A 1XV8A 3RLHA 4XTDA 4LVGA 1EXPA 1W9UA 1B2YA 1GKPA 3V5CA 3U7BA 1LLWA 4N4QA 3CNYA 2OT0A 2OGJA 4O0ZA 4QP0A 2PRLA 2ZTKA 3W00A 4FS9A 1QU4A 3OO2A 1DIKA 2VO5A 4LX4A 1E73M 4ALDA 1NTHA 1EIXA 2OLAA 1RV8A 3FEMA 2PF0A 3WKZA 1SUXA 1ZUAX 4JCLA 1QNQA 4UTFA 4ZZ9A 2ABAA 4HMDA 2QT3A 4PN2A 5E93A 2V67A 4XIMA 5EFDA 3ZVHB 2Z2AA 2PDUA 5D9MA 7TAAA 4B3LA 4J3TA 5CPSA 4E3VA 4XG1A 2G3MA 2VC9A 2OSXA 3EB4A 3Q2DA 4H1ZA 4BK9A 3GHRA 3GXFA 2CITA 3BW2A 4HJWA 5DXXA 3STCA 3NQ8A 5JUVA 4BZYA 2X0YA 5EU9A 2HDJA 1VFLA 5A8OA 4A3QA 4LUJA 3W1TA 3CBWA 1YXCA 1W8GA 1EFZA 4RXFA 1R0MA 3LDVA 4KERA 1EDQA 1KGXA 2WQDA 1ZBCA 1F8MA 2QCDA 3UWWA 3WF3A 1LWIA 6A3HA 4FXJA 4WJXA 4KCTA 3RLUA 1SJAA 3A5FA 4DJFC 2OEJA 1V3LA 2X2GA 3QQ0A 4R9OA 3UCQA 3ALGA 3H7UA 4L56A 3PBVA 1TJ2A 3L65A 4ACZB 1TIWA 3S2LA 4IIDA 3UZZA 3ABSA 3A21A 5T8GA 4ZFCA 1ZAJA 1RJQA 3UBPC 3UT0A 2Q8ZA 2Y63A 2D2GA 1W5PA 4DJFD 3GIPA 5AYZA 4DELA 1UWRA 4HZMA 3DKJA 1KCXA 4GYFA 4JEJA 4OECA 1KTNA 4LJ3A 4BF7A 1CXLA 1JF6A 2Y24A 3W7RA 3LPOA 3A3HA 1H7OA 2ZXQA 4KRUA 1A5SA 4OJYA 3D3AA 1GKRA 2YPIA 3EXTA 4D6EA 2WSKA 1XIMA 3TAOA 2EPLX 2PGWA 2VRQA 2CLHA 4C6MA 3W85A 4AZBA 1A3HA 3WDRA 3WFAA 4Q3MA 1OHLA 1BVZA 5DO8A 5I78A 3T8LA 3UY7A 6REQB 4HCHA 4CVWA 1X98A 1BQCA 1EWEA 2ZWZA 4S3EA 1V6VA 3GC2A 3EX4A 4QLJA 1NELA 4B9ZA 2XDFA 2GYIA 3ARQA 2EO7A 2UY3A 2CHRA 4XQ6A 2R82A 1YQ2A 3SW6A 5D9OA 3VKCA 4R53A 1PKMA 1HG3A 4LB3A 3STEA 5LNUA 4E4FA 5C7HA 3UCCA 1MUCA 1CGXA 2EG6A 3GDTA 3WMBA 1J9YA 1XH2A 2WZHA 4ZE5A 2BHUA 4PUKA 1JULA 3B0YA 4FR1A 4ADUA 5I5RA 3CZGA 2ZZ1A 1TVNA 1V3KA 3KRSA 1P0KA 2Z7GA 5GJNA 3QQWA 2PLMA 3L5LA 1XLBA 3L0NA 1TPFA 3LLXA 3SRHA 4NXSA 4FK9A 3KCJA 1X7IA 4FLOA 1MWOA 3E2SA 3ARPA 3T42A 2YCLB 3FIGA 1NH6A 4ROPA 1D2KA 4FNPA 3DU0A 1PEZA 4OOUA 3V36A 2V5CA 3IJ7A 3TX9A 1OGBA 1EUAA 2CLPA 2VWSA 4JL1A 4J28A 2XJ7A 1POJA 3TNOA 1KR1A 3AU6A 4V2XA 1XIIA 3CMFA 5CPLA 5FL0A 4MKNA 3FAXA 1KLZA 3DXIA 4UC5A 3BH4A 4XZMX 3MSRA 1ZZMA 1KFCA 2QLYA 3VDBA 1SR0A 4M7TA 3GIQA 3JU2A 3H7RA 3R0DA 1GPFA 4WY0A 5AECA 4Q7BA 4U5IA 5CZSA 1XH1A 3L9CA 4D2JA 2YJQA 4AZCB 1BGAA 4C6CA 3BLFA 3I6TA 4PTVA 2XSAA 4Q7NA 1XXXA 3RMEA 2FQIA 2QUTA 1RD5A 2H3BA 5K3VA 4QXIA 3M6DA 1LUCB 3WNMA 1CGYA 3N2XA 2XH7A 1OF6A 1HVXA 1QPKA 3CJPA 4UOZA 2HE5A 4QEHA 1GJUA 3ARUA 1R38A 4J4KA 5DMYA 4MJ2A 4DPQA 3IJ8A 3F2BA 3AHYA 3LK6A 3SY1A 3RR1A 4H8UA 3SUWA 3UPBA 1OJXA 5FKYA 4U5KA 1Q6CA 5EMYA 4HA0A 2VEKA 3G1FA 4D6GA 1O4UA 1JAKA 1W9PA 3U2CA 1CXKA 1WXZA 3GXTA 4XKMA 1DXIA 2PWFA 4B2DD 2Z1BA 4HP5A 3TYEA 2PMQA 3JVAA 2PGEA 3DGRA 1UWSA 4IQLA 5I3KA 2X2YA 2ZTJA 3T1GA 1DVJA 1UWIA 2PS2A 3EPOA 4D1IA 2G96A 2BMBA 3AHZA 1DBTA 2CFFA 2YA1A 1MFVA 5G2HA 4YWIA 3V4BA 4Z2KA 3ONBA 3UF9A 2AGKA 4AVOA 1RK5A 3KCOA 3SCOA 2V68A 2VQTA 4BQ5A 1V7AA 3A13A 4TO8A 3SSZA 1JFHA 2WJFA 4PMNA 2VQUA 1J4EA 4E8GA 1VFSA 2IS7A 3VYLA 2PLKA 1ESWA 3VC6A 1TV8A 4FLSA 4WXYA 1RSCA 4NX0A 3NCOA 3WDJA 2YXXA 3VI2A 3PJUA 5JIPA 3EGJA 5HUPA 2TMDA 2DVUA 2CCRA 2F8QA 1FKXA 1U22A 2FIQA 3GUWA 3W72A 1QATA 4ZB2A 3HM7A 1YBQA 3ZJ6A 3MHFA 1A5UA 1TB3A 3MA8A 2E67A 3F7JA 4L61A 1GYNA 4E4UA 3B4YA 4JFVA 4HPGA 1GUVA 2V38A 4PL1A 2H9AB 4AW7A 3CUGA 2VKZG 4GVFA 3AS0A 1RQEA 4LTSA 1VEPA 3S1XA 1GTEA 2JKEA 3EWYA 3PZMA 4YXGA 3G1VA 2G4FA 2PP3A 3MUXA 3VD7A 3ZZ1A 2JBMA 2Z7KA 2V81A 4QEEA 1QHZA 3S8HA 1NIUA 1F4HA 1M01A 1YEYA 1A5NC 3VM7A 3MO4A 1V51A 1VFOA 2NV1A 4IHCA 1XUUA 1LQAA 1JJKA 1FCBA 3WQFA 1P1XA 4RX0A 4K1WA 4CN4A 1US0A 4LNYA 4AIEA 1UWQA 4MFDA 3WQ8A 5SWUA 1EJUC 4QSHA 1XLJA 3NJ3A 5D8WA 1OGSA 1QW9A 4R33A 3FAWA 5IM51 3AS3A 4UIOA 3F4NA 4ZB5A 3TN4A 4EK7A 3FOKA 3DC0A 1DJQA 1LJYA 3EB3A 2IUZA 7XIMA 4AEEA 4X22A 3ZOAA 1KA9F 2XHYA 4H41A 2J6VA 5T9BG 4MB4A 5IDZA 1VLIA 4IQDA 5F2GA 3U9IA 3QRHA 1E72M 4PRTA 2GJNA 3M0XA 4CD5A 5EL1A 5BXPA 1YRRA 2IQDA 5HNRA 3MP3A 2QZRA 1ZU8A 2Z6IA 3UWYA 3VD5A 2V63A 3W0KA 3W27A 1I2OA 2NVDA 2DZBA 2R1KA 1T6MA 4DWDA 5I03A 2BGQA 3TN6A 4XD6A 4CCEA 4MSSA 2AGTA 4BI7A 2DT3A 4B3KA 3GRIA 1KB3A 3LCWA 3RN6A 5LNWA 2VZVA 1T5AA 2NX3A 2W27A 4O50A 4ZOEA 1HW6A 3O63A 3L4YA 4HPXA 4E8CA 3DYMA 2PDCA 4I7VA 2GVEA 2X1SA 4WKAA 1PXGA 3TQ0A 4PA8A 2D2HA 4LY4A 1G7VA 3W53A 4B2DA 2XH2A 1PZ1A 2XIMA 4MYAA 4Y8EA 1FCVA 2HZGA 3G0XA 3E0LA 1H62A 4PC8A 3EOLA 3MUAA 1R2TA 3C8FA 3DFNA 3I10A 2OZ8A 1HTIA 3P5ZA 2ZA3A 1QOPA 2EHHA 3UWUA 2D3NA 3KRBA 3APYA 3SIMA 3OVGA 3GB6A 3CHCA 3K1DA 3WQPA 4IX0A 3WBEA 4NF7A 1TA3A 3L2LA 3LB0A 3ZR4A 1JFXA 1IEIA 4KW2A 5F1VA 3P61A 3A6OA 2JF6A 1XYLA 4WX2A 1DPMA 4WQ6A 2WCSA 1BWLA 2EPNA 1YKWA 5CZTA 4ACYA 1Z41A 1DWFM 2VCAA 2ZUUA 1O66A 1UQYA 2J75A 4I3GA 1JAEA 4MWAB 1K02A 3P8JA 4KQNA 2IQTA 1EC8A 2QS8A 4ZO6A 4NX5A 3TTQA 1MUMA 3GIYA 1QNSA 1SSDA 3M7WA 2CZEA 3MVTA 3FJNA 4IWWA 1UP3A 5MF5A 3OG2A 2BBFA 5HWMA 1QW8A 1X6NA 3AYTA 2ZA1A 3PSVA 5FEPA 3CASA 3WQGA 1I2RA 2ZZ2A 3G0SA 4GJJA 1QMLA 7ODCA 3S6DA 1UWTA 5K2ZA 2QHAA 1TYGA 1D9EA 2GQ9A 2Z0IA 1SU5A 2NUYA 5HR6A 4Y8FA 1TG7A 3UZJA 3V3WA 4IF2A 5EGRA 4RDWA 2NQ9A 2ZIDA 3AIWA 3QW3A 3CL7A 3GYEA 4Z1BA 3S47A 1XLIA 3VVGA 1NU5A 3V0TA 1XDJA 1TR9A 1VFHA 3C8NA 4IZGA 3W7LA 1JZ3A 3IVUA 2DVXA 3E96A 1GZ1A 3L21A 4URIA 4GIEA 2BS9A 3GM8A 4X2RA 2WVUA 1YDYA 4CN6A 1R9XA 4IMEA 1KBLA 5A6AA 2GQAA 3WMSA 2P3ZA 3W2LA 4CNNA 1MEIA 4CEUC 3SFKA 3WBAA 4UQAA 3TJXA 4PMVA 1W9DM 1VF8A 3FVDA 1MZRA 2IQ0A 4ZBCA 5ABEA 2DT0A 2BY2A 2NSOA 4C60A 3KL5A 2NQ5A 5FJTA 4QSFA 4RDZA 1QI0A 3HB9A 1EJWC 4AD4A 1X8FA 4FLQA 1XLEA 5DLCA 4ZGYA 1Q2RA 3IUDA 2Y7EA 2ASHA 3LHYA 4M82A 5BU6A 1BG4A 3HQOA 1ITXA 4DBUA 2Y8KA 3U3HA 3GH5A 4B5XA 3SUUA 1VFMA 3KEHA 2MUCA 3N2OA 1LOLA 2J7CA 2VCCA 1PS9A 1JNEA 4IIEA 4ZXOA 1VJIA 4GYKA 3VO0A 2VRJA 2C91A 4OUEA 2X40A 1R3TA 4DWSB 1G4SA 3VIHA 5F4SA 3SCTA 4Z2JA 4MMWA 3WG6A 4HOWA 4GY1A 1WCGA 2GWNA 1ZENA 2DY3A 3CEUA 2LLEA 4XZWA 1FH7A 3IIVA 3IRSA 3I65A 2O56A 3CPUA 2VGIA 1M3UA 3BL3A 4W9TA 4CNTA 2XZ9A 4J7RA 4C1LA 4K7YA 3ICJA 2I14A 4XD3A 1AD1A 3C56A 4JQ3A 4LOCA 3MWAA 4JY8A 4NJIA 3UZYA 2OKOA 4DPPA 1LDCA 2VVNA 4CLMA 3WO8A 1Q6GA 2DQXA 2DV0A 1JQXA 3VOCA 1IF2A 1AW5A 2GQ8A 4Q22A 3TTOA 1OYBA 3QY8A 3QMTA 4IFRA 2R1PA 3E02A 4DUXA 5C9ZA 1YXYA 3VNYA 4KRZA 2Y8UA 1Y8BA 1KQYA 2GOUA 3A64A 8XIMA 2HVMA 1OFQA 3LGGA 1GVQA 3QGAC 1JZ4A 4S3DA 2PFHA 4YTTA 1Y0EA 4BF9A 3OYZA 2YDAA 2CETA 2BY3A 2O9OA 1DJNA 3BLLA 2GSHA 2ABBA 4HN4A 3EX1A 4LV4A 3EWBX 4C6BA 4K2SA 1BAGA 2DZXA 4JTKA 2WC4A 4K37A 5HJLA 5HATA 3PBWA 4WUIA 4OGZA 1FWHC 3PBGA 2I5GA 4ML9A 4S3JA 1QR7A 3OGSA 5FOOA 1QJWA 3UNDA 4O1EA 5D03A 3VKKA 1EO5A 2WBGA 4ICMA 4FXFA 5CSRA 4M6QA 1PVNA 4UNIA 2VURA 3VOHA 1V0MA 1M6JA 3THCA 5CC5A 3UXAA 5CC7A 5DF0A 3RDKA 4A6GA 2V5KA 2QDEA 1RJRA 4PFHA 4PSPA 2I5IA 3LHTA 3NUKA 3BAKA 2VX5A 2QYGA 4H6QA 3GDRA 3ITGA 4C1NA 4GY7A 3JZUA 3AHTA 3VDGA 1BGGA 1RQBA 1U83A 4ROQA 2QMKA 4RNHA 3KS6A 4EACA 5C9WA 1UKPA 1IR2A 3R43A 2D22A 3FGCA 1CLKA 1UA7A 1EP3A 1KV5A 1DOSA 1H41A 1JYNA 3TW6A 1EPVA 4GI6A 3VCRA 3L4WA 2V30A 2QPUA 1O5KA 2VR2A 1CLXA 1AQ0A 4DJED 2RHGA 1Y5XA 3KOZA 3CV6A 4ERGA 3TQKA 4PMXA 3WJYA 3QHOA 4WSJA 3KZSA 1NDZA 3FNDA 4J2PA 4S3CA 2I56A 2FTPA 1BPLB 3GTFA 4FI4A 3INPA 4CEXC 2XSXA 2QVHA 1QASA 4AC7C 4KCWA 1FY6A 4GINA 4WEVX 4P8UA 3ANUA 4UTWC 1DE6A 5I24A 4C90A 1JDAA 1FWJC 2REQB 4M80A 1BF2A 1PZ0A 3GDKA 4FF5A 4FNUA 4JX5A 2VNCA 1KCZA 4PUMA 1TELA 1HGWA 3BV7A 1YXDA 1KFWA 4KGLA 5AZ1A 3AJXA 2ZQ0A 4QE5A 1A0DA 3QV9A 4LVBA 3T81A 3M5XA 2YL8A 2YOCA 3BAXA 4DYEA 4NSBA 5GNZA 1C8QA 1EJRC 4IFKA 4Z2GA 1XS2A 3M44A 1EXBA 1IT0A 3CXOA 5EBUA 3CQJA 4HA3A 2FFCA 2F2HA 1YADA 2VZOA 3OBKA 4ZO9A 2E9MA 3UWVA 1XLLA 1L6FA 1FWRA 4TU1A 1RD6A 3URNA 3MBDA 3OOQA 3VINA 3CZJA 3IRDA 4QS5A 1G1YA 1OCQA 3SGUA 2ZZ6A 4IL0A 1DIOA 4LUTB 3SBFA 5LIWX 4TV6A 4H9XA 2DDXA 4H04A 2PWVA 4XO7A 2QJJA 3PF3A 1RA0A 3P74A 5HWJA 1C29A 3FK4A 1CI1A 1FWNA 4DYKA 3JRKA 2O7SA 2VMFA 1LQ2A 2DEPA 1C91A 2OGYA 1SGJA 4LAOA 3WDIA 3WLJA 4IGNA 3IACA 3W1LA 5LIXX 4MGGA 3ARWA 1V02A 5CKSA 2E6FA 4K68A 3AYSA 1WV2A 4WF7A 2J8TA 1JYWA 3MDWA 1DWJM 4DB7A 3HGOA 4NKCA 1Z7AA 3AWOA 2E6AA 1UROA 2CLIA 3TW7A 4JAWA 3RU8X 3MZ2A 3W6LA 1SFJA 2BDQA 5K7JA 3M5YA 4D9PA 4G2DA 2AKMA 4C6JA 3GKFA 5HOSA 1VD6A 2RGMA 4XAZA 3SZ8A 1UHVA 4GZEA 4XIAA 4PTXA 2AAMA 1KC7A 4AYGA 2WHJA 3HJZA 4PMJA 4CD7A 5A6BA 3LCFA 3H4XA 1UZ4A 3NYDA 5K9XA 1TWZA 2F84A 5BRQA 3B40A 4AD0A 4DY1A 4QFUA 2PTWA 3GXIA 3B0UX 1X6UA 3BXWA 3SUTA 1G4EA 3SB0A 2GK1B 3PJTA 3NEHA 1F6KA 1LROA 5HUOA 3VZZA 2Y6ZA 1XYFA 3FJ4A 4H9TA 4J3XA 2QF8A 3H55A 3SR7A 4N42A 5KTLA 2E1WA 3LX9A 3G1AA 2A7NA 4DXKA 1HL2A 1EHNA 3A9IA 4ZOBA 1J0IA 1SO4A 2EJ1A 3W37A 5A8QA 2E4TA 3UG3A 1Q6QA 1MW2A 3WH9A 3WLQA 5HA7A 2YX0A 3RX3A 4W84A 3WJZA 4WKHA 4DJEA 3REQA 1RLDA 3QR0A 1JG9A 1I2NA 3GO2A 1TMHA 1OVDA 2FJUB 3IIOA 4WSHA 5EMJA 3Q65A 5M5DA 3G3MA 1XIFA 2CESA 1TREA 1NSJA 3BZJA 4PYSA 4H9VA 1W5MA 1A49A 3L4XA 4LF2A 5BW6A 3R13A 5HNTA 3URAA 4LB4A 2XFYA 5CC3A 3AFBA 4IMCA 1EZWA 3I3DA 1XJBA 5C70A 4Q4RA 1F3WA 2Y7GA 4QTGA 3CV1A 1VFFA 4OFCA 2B7QA 3VX0A 3QQ1A 5REQB 1EEXA 3FSUA 3MI2A 4FOJA 2X41A 2VDIA 1VBJA 1RZMA 3E2VA 1UA3A 5DFAA 3WQ4A 4PR4A 3CHEA 5AHMA 4HCLA 3VABA 2MANA 4KEUA 4ZQCA 2QMJA 4PEKA 3SDOA 5CBIA 4LCSA 1QWKA 4YJ5A 3OZOA 3PANA 5ECVA 3TONA 5AB3A 1I45A 1L6WA 4HHLA 3PNUA 3BG5A 2DSWA 2AAAA 4C6KA 3NQ2A 4XAFA 3LA4A 3QEZA 3DZ1A 4AHPA 2NLIA 3B9NA 3V75A 1OG0A 3VE7A 3BCDA 3WUGA 5D4YA 4XO6A 2QJNA 1W3KA 2QDHA 2NWSA 2PC4A 1BXBA 3T2PA 6ENLA 1FOBA 1UMLA 2QUMA 1SJDA 1EKOA 3G8EA 2A21A 2WZEA 3C61A 4YHEA 4DZ5A 1B57A 1MUWA 3S9ZA 1X1NA 3H24A 2QCLA 3IVTA 4GJIA 5C9RA 1XW8A 3TCEA 1WUEA 1P6BA 2WHLA 4LBSA 1VFTA 1SVDA 1E3XA 1LBMA 1XWYA 1TPUA 2Z26A 2GGJA 4D6JA 4D8AA 4AUBA 4TXEA 4KH2A 3QGKC 2B7NA 2BVDA 4IH3A 4R5EA 1AL8A 3EWUA 5LA0A 2D20A 4QG9A 3NO5A 1AH3A 3FXYA 3VDHA 3R6IA 4CD6A 5C7VA 1K4HA 4UR9A 3SQLA 2QW5A 1I60A 1TWIA 4GCAA 5HPOA 4GVGA 1EX5A 2X8RA 4M0XA 3BUVA 2OYMA 1J8VA 3O1NA 3FY1A 4GX9A 2GJPA 1AMKA 5CJ5A 4XVEA 3HN3A 1EUNA 3WLRA 3S2JA 4A4AA 2JEQA 1QNVA 2QCDB 3TFXA 4JHOA 3IK4A 3IUHA 1J2WA 1I6NA 2PWGA 2WLYA 3NQVA 3TYAA 4DJDC 3HIJA 3O6CA 3D3FA 2ICSA 3KZPA 2QQ6A 4J1OA 2Z28A 3WK3A 2HMCA 4PUNA 1FFRA 4D6IA 1D8WA 2YKKA 2ZUWA 9RUBA 3L0KA 1U1UA 1F9CA 3T4CA 4CQDA 4DJDD 1J96A 3IS4A 4EKJA 2QXWA 4BEQA 4K36A 3LD5A 5F4WA 1YTKA 1Z32X 2G97A 3WMCA 1JCTA 3VGBA 1DEDA 2XG9A 3W6YA 4US6A 1LZOA 4IQJA 2YCJA 4LS0A 4W86A 1QBAA 3SQSA 4UQBA 3EWDA 3UD6A 1TJ0A 3KBJA 1YTDA 2ACRA 3NFUA 4OQVA 1S1RA 1WB0A 1GVIA 4FX6M 4AMAA 3M0MA 3RRAA 3K46A 4QR6A 3W3OA 4MDPA 2Y8VA 4W85A 1CEOA 1XPGA 3MP4A 4RZ4A 2FVLA 5CZKA 1OK4A 4TMBA 4D8LA 4JTQA 3EBVA 3CH0A 5DCBA 4KBXA 1JDDA 2OYLA 4AIOA 2Q8LA 1FP9A 2PD5A 4LVFA 4DAFA 1PCWA 3W7KA 1XUZA 1QUMA 1OBAA 3FFSA 1FP8A 4FF7A 2GOKA 4UOQA 1GVEA 1RAKA 1RH9A 3GY1A 4AIBA 3HBLA 4LH8A 1VENA 3ARZA 4KEVA 2PE4A 2MNRA 4O52A 3SCUA 1EC9A 2BXYA 3IUIA 1VR6A 3PB2A 1PZ3A 1TV7A 3AI0A 4X61A 1TZ7A 4E2DA 1PX3A 4D6HA 1BSIA 2NQZA 1J11A 2JEPA 1IGWA 1OWQA 3CK5A 1GEHA 3GDLA 1EWDA 1CZ1A 3AZSA 3BAYA 1E5JA 1ISWA 2FPTA 3C3UA 3H2AA 3UJFA 1WAWA 1GVOA 3WQ6A 3W2UA 4YTQA 3WUEA 2FHFA 3H2CA 4GIRA 3TC3A 1UWUA 4TTGA 1HO4A 1IEVA 4YTUA 3TJ4A 5CPQA 4AG0A 4QJ1A 2FGLA 3WZ0E 5DRCA 3PZQA 4REQB 1ZY9A 3MC5A 2DSZA 3RM9A 1NFGA 4N2YA 4BY3A 3GHTA 2Q8XA 3LM7A 5HINA 3RILA 2JK2A 4GH1A 3UJEA 1FXQA 2GVJA 1OIFA 3VFCA 3HMJG 2CEQA 4ZXLA 4GKLA 1FWTA 2W63A 2PDFA 2GSJA 4JCMA 1ZB5A 4LYKA 3N34A 1H1YA 2F61A 1HKMA 3GUGA 2GSEA 1LRQA 3UR7A 2X09A 3PZ9A 4UFLA 3F5LA 4H8NA 3DFHA 2ZX6A 3CS2A 4FLRA 2XH0A 2C13A 3CO4A 3AISA 2YFOA 3ARSA 1PUDA 1QVBA 2V8ZA 4LYRA 2GWGA 4V27A 4XVDA 3W86A 1U2YA 1UR3M 2ZZ7A 3U4FA 4A29A 1W9BM 1JNDA 3P62A 4JFSA 4CNPA 2E7FA 2EPKX 4Y2WA 3NQMA 4QX4A 3NPXA 3RMJA 1A5AA 4AZGA 4CD8A 3BLIA 4XISA 4HSOA 1KXVA 2WW5A 1O95A 4Z0SA 2Z4GA 1KM5A 3EX3A 2HXUA 3M1ZA 2OX1A 3EMZA 1ELSA 3MUY1 4AF0A 3A9BA 3O6AA 4BQ2A 3FJ6A 4DJDA 3CTLA 4GNJA 1TJRA 3QPZA 5D9NA 4F66A 3D5HA 2Y5EA 4A8NA 4XBSA 2FDMA 5K4XA 4W8LA 4BI6A 3NL6A 4TX9A 1AZ1A 1PHQA 3CT7A 4TX8A 1ZALA 5FSDC 1Q6EA 4R7JA 1C8YA 2PTXA 3TN3A 3BMVA 3LBCA 3GZ3A 4RDVA 3WBYA 1DXEA 4PSRA 3LQGA 1HUVA 3CUFA 4AIUA 4C6IA 4GBUA 1DHPA 2DP3A 5CPNA 4AQLA 1G5AA 3CL6A 4M51A 3UYIA 1SMDA 2XSBA 4PTMA 3TSDA 5HMSA 4AY7A 4GNKB 1J10A 1JZ8A 1BRLA 2CBUA 1FWWA 3CQHA 3A4WA 3BGGA 1FCUA 4ADTA 5GJMA 1O60A 1YBQB 3ZS4A 3DERA 4JKMA 1TUFA 1LG2A 3LI1A 1YDOA 1E4LA 5I6SA 4DUWA 1B3ZA 3ATYA 4MHBA 5A5WA 4UCFA 5FJIA 4KS0A 3VIIA 1HKKA 4KGJA 1AL7A 1VB9A 2VZUA 2XM2A 1J18A 4JICA 2ACUA 7CGTA 3MWCA 4LYQA 2WSPA 5AY7A 4Q4OA 3WLIA 5HAOA 3NDOA 2OZ0A 3WLTA 1S5VA 2ACSA 2OJPA 3NQCA 1POKA 3V1PA 1PIFA 3DG3A 2GVLA 3NPVA 1Z89A 3W2KA 4JQ4A 2GFTA 3ZSTA 3W28A 2VX6A 2J9XA 2P53A 1FX6A 4WCJA 4L9ZA 4GIAA 4XZHA 3G1HA 3V18A 5C0QA 4A3HA 1M41A 2Y1HA 2X42A 4AYSA 2C79A 3I4EA 2WK2A 4IG2A 3T0BA 4DN1A 2RAGA 4Y9PA 1LL7A 4JTHA 4MZYA 2RDWA 2F6UA 3PWGA 2ZX5A 2PC8A 4H7VA 3HPAA 4ZTYA 1IXQA 4HTYA 2FZDA 4MIMA 4EXAA 4Q8MA 1PDZA 3VMPA 4E0CA 1Q7ZA 3EXSA 4QROA 4XBJA 3GU9A 4HPHA 3QJAA 1DP0A 4QDPA 1E6XM 1E6SM 4CNOA 3VIMA 2HVNA 1W3LA 1AVAA 4H7CA 3KLLA 4K8HA 1XGDA 1VYRA 4G8TA 5HQMA 4PUEA 3ZT7A 3ARTA 3DOPA 3SAZA 1XRTA 3DFYA 2IKGA 1W31A 4AXNA 2ATSA 2D23A 1GJWA 3PNZA 1IXPA 1FWGC 4KPLA 3CLWA 3SIZA 1R8LA 3MJMA 2C1GA 2DSKA 4L65A 4UXDA 1X1OA 3VNKA 4IPJA 2VWTA 3RITA 4UFHA 1Q2SA 1KWKA 1A4MA 2IPFA 2RKXA 3ORWA 3IANA 2FPYA 2ISWA 3WH7A 3LXCA 5TQLA 3C0QA 1MW0A 4Y7EA 1CLVA 1K03A 2WCGA 4MJMA 2O9PA 1WPCA 2P88A 1KRMA 5BZAA 3AXKA 4L9XA 5T26A 5TAOA 3GQYA 2VEMA 3KRZA 4W5UA 3ZFHA 2NT0A 3V16A 1QHPA 1Y65A 4P5UA 1TA3B 7A3HA 4ZO7A 3H8AA 4JYFA 1RP9A 5E70A 4JKLA 5AHNA 4CQCA 4JN6A 2WWDA 4L9YA 1ZJBA 1B4KA 3NO1A 1CCWB 2V6AA 3R7MA 3E5PA 1E4IA 3R0UA 2A7RA 2QR6A 4P7NA 3DFPA 3S1WA 2PDNA 4E2OA 2OT1A 1QI5A 2PEVA 4FNSA 4NILA 1QOQA 1W2VA 1MNSA 3T55A 4IPPA 1BXNA 4NU7A 5A6KA 1AG1O 1KXQA 4ORMA 5TBOA 1TTJA 3OIHA 3UJRA 1B9BA 4HNTA 5I2UA 3EA1A 2A3EA 1GW1A 3MHUA 3H2EA 2D2OA 3BW4A 1S46A 4MWAA 2Y2WA 3WQCA 1P0DA 1EC7A 4ZE4A 4INFA 2ZXAA 2E77A 4X9YA 3W7MA 5FF0A 4HCDA 3N2CA