1VFHA

Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
382
structure length
381
Chain Sequence
ETPTRVYAEIDLDAVRANVRALRARAPRSALMAVVKSNAYGHGAVPCARAAQEAGAAWLGTATPEEALELRAAGIQGRIMCWLWTPGGPWREAIETDIDVSVSGMWALDEVRAAARAAGRTARIQLADTGLGRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPATLTLPETHFDLVRTGLAVYGVSPSPELGTPAQLGLRPAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords alanine racemase
publication title Structural evidence that alanine racemase from a D-cycloserine-producing microorganism exhibits resistance to its own product.
pubmed doi rcsb
source organism Streptomyces lavendulae
total genus 124
structure length 381
sequence length 382
ec nomenclature ec 5.1.1.1: Alanine racemase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00842 Ala_racemase_C Alanine racemase, C-terminal domain
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 1vfhA01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 1vfhA02
3WQCA 3ANUA 4PB3A 2DY3A 1SFTA 2PLJA 1KO0A 3CO8A 1RCQA 1SZRA 1NJJA 5FAJA 2VD8A 3WQFA 3N2OA 4Y2WA 3S46A 2P3EA 1CT5A 1B54A 3WQDA 3N2BA 1HKVA 4A3QA 4ILSA 5FACA 3NZPA 2NV9A 3UW6A 1FTXA 5GJNA 4ECLA 3ANVA 1XFCA 2O0TA 1VFTA 5BWAA 4DYJA 2ON3A 1XQKA 1VFSA 3R79A 3B8WA 4BF5A 4ZGYA 2YXXA 3BTNA 1F3TA 3B8VA 3E6EA 1BD0A 4LUTB 3WQEA 1XQLA 4AIBA 2QGHA 3MT1A 4BHYA 3OO2A 4V15A 4PB5A 4PB4A 4LUSA 3B8UA 3HA1A 3AWNA 5FAGA 3WQGA 3C5QA 1HKWA 2NVAA 4DZAA 1EPVA 1L6GA 2ODOA 2VD9A 2PLKA 1VFHA 2OO0A 7ODCA 5IRPA 4KBXA 1W8GA 1D7KA 4BEUA 4BEQA 3NZQA 4LUYA 3LLXA 4XG1A 3GWQA 3B8TA 3VABA 2RJGA 2RJHA 3CPGA 4XBJA 1KNWA 4LUTA 3KW3A 3N29A 4QHRA 1NIUA 5GJMA 1TWIA 1QU4A 3SY1A 1TUFA 3AWOA 4FS9A 3HURA 2SFPA 1L6FA 3E5PA 2J66A 5GJPA 2TODA 4LUSB 4WR3A
chains in the Genus database with same CATH superfamily
1VR6A 5DO8A 1DQXA 4JGDA 4B3ZA 1AQMA 3W1MA 5G2HA 1DVJA 4IL0A 5I3KA 3H23A 2VP8A 4IPJA 1A5OC 1JF6A 3HPFA 5B7ZA 3W1UA 1BYBA 4EF8A 1KTBA 1E5NA 5LNRA 3BCDA 1UH2A 4K2SA 1V6VA 1RCXB 4A22A 4Y96A 4DHGA 1XPYA 2IPWA 1LYXA 3VO0A 8RUCA 3W7LA 2UY3A 2ZVRA 4JFTA 1UKPA 4R9OA 1AW2A 5HNTA 3QKZA 1YHTA 4A6GA 3UG3A 3NQGA 3RO8A 3VKDA 4US6A 1E1EA 4JIHA 4X22A 1EXPA 2PC8A 1RLDA 2RGLA 3UG5A 4JY9A 4UZUA 3V0UA 3E49A 3KOFA 4JFUA 4S3AA 2QJIA 1Q7QA 1VFHA 3BLPX 3POCA 3GXTA 2G3FA 4S3KA 1PTGA 3AMGA 3MDUA 3HOJA 3ITXA 4W8LA 4HSOA 1RQHA 2YL6A 4M51A 3KLKA 4ENLA 1NVMA 4U10A 2J8GA 1OWQA 3WFZA 4GI8A 4YLWA 3ZO9A 1YDNA 2IXVA 2Y8UA 4HJWA 1Y7VA 3WY1A 3XINA 4WZHA 4JN8A 4D6EA 1ISZA 2NVCA 1P0DA 3S6OA 3QTGA 1S3TC 3LQGA 1XC4A 1TPDA 1KV5A 3CHVA 5HNRA 4GO8A 1JZ2A 3V0TA 1LBMA 5F2LA 4QDMA 5J5RA 4HPNA 3QPEA 2A3HA 3RLVA 1K9TA 3GKFA 4WJEA 1QO2A 1E72M 1EO5A 1XIIA 3CZLA 4BA0A 3QC3A 3WLNA 4ICCX 5MHBA 2PD9A 1XCFA 1HXJA 4V15A 4AG0A 4JQAA 2NZLA 4ZO9A 3UP8A 4S1FA 3IJ7A 4M1RA 4NAFB 3SQLA 2DIEA 3IV3A 5I09A 3VOHA 3L4WA 1DJYA 1F8MA 5FA5A 3T05A 3M5XA 2ZTJA 1OFAA 3SCQA 4WCJA 8TIMA 1DJHA 3GYEA 4JIEA 1D8CA 1KV8A 3USBA 4DPQA 4FNQA 3QW4B 1GUVA 1E5JA 3C4UA 2EHHA 3E3HA 5KZ6A 1XBVA 2FPVA 3GKAA 1X8CA 4R27A 5EY5A 1PDZA 4KH2A 3WQCA 3EOSA 4H8HA 4HPGA 1X96A 4QRNA 4XAZA 3N3MA 3FHAA 4GYPA 4Q7BA 4O4WA 1B9BA 2CBUA 4AYSA 2QF7A 1H51A 3NOYA 3UPBA 5LIXX 3B8IA 3UJRA 4GY1A 2WZEA 3FHQA 3IIVA 4TTGA 2YYUA 4JHMA 1XM3A 3W1TA 3BSMA 4AZCB 4LS1A 1TCMA 3WMSA 3OVGA 4YL2A 3SGGA 4L56A 2TAAA 1NF7A 5ENLA 3WKZA 1R5YA 4DBSA 1XDJA 3DFTA 3H54A 4HHMA 1B30A 3ZJ8A 4B90A 3AZSA 1MZRA 4PRTA 5FAGA 4JYDA 4PBEA 1FWBC 1OVDA 1ZSXA 3L66A 3A3HA 4W87A 4BI6A 3EEZA 5XIMA 1FCUA 2J75A 4P7RA 4B5TA 2QULA 1GJWA 2PBOA 4UFIA 3PWIA 3ZSTA 4OBTA 4EP8C 3RU8X 3BE7A 4W89A 5CZ0A 3R8HA 1XIGA 3HV8A 1NDYA 4UMBA 2CWNA 3VIJA 2VFGA 3C8FA 5HULA 1C8VA 1J0IA 4HMNA 5BMXA 2PP3A 3M1ZA 5D04C 3OLDA 3SN1A 3MZ2A 2G3JA 2I5QA 2XFFA 1Q65A 2F61A 3MSYA 4F2BA 1W5MA 2VT0A 4E38A 3S46A 4JTKA 2PSNA 4H9ZA 1KM4A 4TV6A 3GXDA 2CXGA 5KZDA 3AXXA 1RUSA 1KQZA 2JALA 1W9XA 4GHRA 5AVNA 2YSWA 1LDCA 4RCXA 3LPFA 3QN3A 3WQWA 2CXEA 3C52A 2PLCA 1LOSA 1XG4A 1FKXA 2QAFA 3R0DA 1PTAA 1QI3A 1N8FA 4U28A 1Y5WA 4K8GA 1QNRA 2WO5A 4MMWA 4P8UA 1O66A 4J4KA 1EHAA 1XSIA 5ABGA 3HG3A 1CXFA 3B04A 1MFVA 3GR7A 1BQGA 5J8LA 3A3XA 4UFJA 2AL2A 1I75A 3A9IA 4DLFA 3H2OA 4HMDA 1ME7A 1HF6A 5D9NA 3NPUA 5BOEA 1TJPA 2J47A 1DHKA 1WE5A 3QJAA 1KFWA 2Z28A 4IX2A 4KGJA 1MI3A 2X42A 4Z2GA 3ARTA 3VKCA 3O63A 1CGYA 4PUDA 5E9XA 4L1XA 3TU9A 2G3NA 3O1NA 2NV1A 3GWQA 4C6BA 2EF9A 1LBLA 3BLLA 5DY2A 1QHPA 2XIBA 3RX2A 4QHRA 4UR8A 3W37A 1PJ9A 1EUAA 2EBNA 3AXHA 3PWGA 3DN5A 1V8EA 3B9NA 3CZGA 4U33A 1K9DA 3PZQA 3MQTA 1VLIA 4CU6A 3G5EA 2CLPA 4JIPA 1YBQB 1AK5A 3G8RA 4B5XA 2V63A 2FZNA 2DSZA 2V69A 2BOGX 3S9YA 1C8YA 2EPKX 3OLEA 4NP7A 3A5FA 2NLYA 2J4GA 4QX4A 5LA1A 3VDBA 1E6ZA 2ZWZA 2VKZG 4Z2LA 3N18A 1ZHAA 2Z1KA 3LHWA 1GOKA 2QHAA 3S5ZA 4RE3A 4QSFA 5CC7A 3RITA 4JHOA 2YYTA 5AC6A 3SM0A 3U4AA 5HMEA 4U4MA 3NR0A 1W5PA 4KT2A 4U3CA 2EGZA 4MNKA 3LV5A 4JTDA 2P0IA 4UR9A 4K38A 1MXDA 3LBCA 4YVPA 1XYLA 5I2UA 4KWOA 1YPXA 5DX7A 2W92A 3DBNA 3AICA 4FB7A 3ITCA 3SURA 5AYBA 1E0TA 4JN6A 4M6VA 1XLIA 4S2CA 3TV8A 1XKYA 1K4GA 3UY8A 4XD3A 4NZ4A 3TN5A 2YXOA 2XIIA 5AECA 3DFPA 5JBFA 1R3RA 1HTIA 3M43A 3TC7A 2ISVA 1K8CA 1XINA 3GC4A 1WO2A 4JTHA 2O7QA 4MFDA 1I0DA 3SZ8A 3UCQA 4ICNA 1MEHA 1W9UA 1MYRA 2HVOA 5I7GA 4XZIA 1HJQA 3TTOA 4DBDA 2FHFA 2E5CA 2WPBA 3UFYA 3R94A 3EOOA 3BV7A 2A2IA 5C2GA 1YRRA 4AEEA 3T78A 1M01A 1GOWA 1LF1A 1Y0EA 3I65A 4QROA 3KOWA 4ZGYA 1J18A 2FZ9A 3AO0A 3RYSA 1UZDA 4E2OA 1TG7A 1ZJAA 3CL6A 2DVUA 3WN6A 2F6XA 2AGKA 2DQWA 4GABA 5CSUA 1ITUA 1V7AA 1A0DA 1RA5A 4J7RA 1OBAA 4LF2A 2AGTA 4MKVA 4FA3A 4DJEC 4FPSA 2NSOA 3NDYA 2QZRA 4JTIA 4MADA 3GX9A 4N0RA 4Q4PA 1W3NA 4Y9PA 2BOFX 1NWUA 1VF8A 1D7KA 3TYDA 4ROPA 2AMGA 4CNOA 1Q7ZA 4PCSA 1DEDA 1W5OA 2YIHA 1L6WA 1U83A 3RIKA 4IPPA 2QCCA 4GI6A 2IQ0A 3S1WA 5JQ9A 4GXPA 1TZ7A 4RDZA 4S2BA 4AVNA 1Z3NA 1N8IA 4FXSA 3VGFA 3VE9A 3NSXA 3E12A 5DCBA 3ZZ1A 3N11A 4GNKB 3QHOA 1RJPA 1WX0A 4XAFA 3G3MA 5GPRA 3HBLA 3FDGA 4C1NA 1OZQA 5XINA 4BQ5A 3R12A 4L4MA 2RHGA 3VKBA 3QGAC 4HYVA 2CU0A 3RJXA 4E3VA 3WLRA 1TVNA 4K39A 2QGYA 4M82A 3S9ZA 1W1PA 1JCTA 2YBVA 1UIOA 3EX1A 5D05A 3GW0A 1O5QA 2J24A 3QEZA 3WQOA 1XXXA 1DJWA 1DP0A 3HG5A 3W74A 2DUZA 1LWHA 3MC5A 4JHZA 3UXIA 3W53A 4O1EA 1IZKA 4LEFA 3AWNA 3PPGA 3WG6A 9RUBA 1V6UA 4Q22A 4L9ZA 4ZFMA 3GDRA 4K3ZA 4JQ2A 3GIYA 1WDDA 4Q7NA 1EKOA 1XKJA 2XIJA 4D1IA 4EPKA 1VB9A 2XGZA 1XSJA 1V0LA 4H9VA 2C0HA 5HJLA 2Y62A 3QM3A 4I5XA 1W31A 3QSRA 2GJLA 3LM7A 4Q32A 4MKSA 5K9XA 4JQ4A 3TN4A 1EA0A 3T4WA 5GJMA 1V02E 6PTDA 5GJPA 3D6NA 3IUHA 3NQFA 4XAYA 3S5YA 2W5FA 1UJQA 1VEMA 2VX7A 3MY9A 4P7NA 2RGMA 4B2DA 2OKOA 3RM4A 3ATZA 4NJGA 5SWUA 2EJ1A 1LTDA 3M16A 1FOBA 1WYIA 9XIMA 2NUWA 3W88A 4AH7A 1PL9A 2GVYA 4LS0A 3NM1A 3RCNA 4EACA 4YS1A 3HZ3A 1GZJA 3KS6A 1Z9AA 2REQA 1TUXA 2ZTKA 3N3TA 1TIWA 2DZXA 1TPC1 3UJ2A 4EPEC 3M64A 3TYBA 2ZCGA 3VINA 3KM8A 4GJ1A 1SYTA 5DLCA 1BF6A 2D3NA 4DM1A 1UD3A 4GQRA 3L0GA 2EJAA 2ALDA 4IHCA 4I3GA 4KW2A 1H1YA 2NVAA 3L23A 5BXRA 3A47A 2JE8A 1SW3A 3AHYA 1XCWA 1CLKA 3T08A 3N2MA 2VHLA 1KBBA 3IS4A 1XLEA 2VENA 4RDVA 4FOKA 3URNA 1K02A 2VZUA 4HTBA 3LLXA 3MSRA 2Z6IA 1GTEA 3RRAA 1XL9A 3WBAA 3EPOA 1WZLA 4CNTA 3QYSA 1IYXA 1VLWA 1KLYA 3WF4A 2VC6A 3A6OA 4I7UA 1JPIA 4UUIA 4LNCA 1LL4A 3O7UA 5LGZA 5ABHA 1WNOA 2J66A 4GOAA 4TMCA 1HO4A 2QUVA 2AL2B 2Y5SA 3W28A 1I2PA 4ZO7A 1JAEA 3EXTA 2PRMA 3CTLA 4JCMA 2ZUMA 5EMYA 3AXKA 5I02A 3L21A 2PZNA 2CZVA 2B7QA 4AIUA 4WHBA 4MDPA 1DIKA 1JPKA 1X1OA 4A29A 3QOKA 4FR1A 4LV9A 2B81A 3FA5A 1B4EA 3LENA 2OT0A 2HCVA 3WBWA 4C6CA 1E3ZA 3THAA 3WMLA 1EWDA 2QCLA 1X38A 3VD5A 6REQA 1C93A 1GORA 1EJXC 4R88A 5FEPA 1H50A 1GW9A 3M47A 4UOJA 3I3DA 1O4UA 2E7FA 4A3UA 3DAQA 3NQ2A 1SJBA 2OTDA 3JS3A 3RLHA 4QQ3A 3TTYA 5A95A 3ARXA 5D9MA 5C9RA 5HMDA 3AZTA 2X7VA 1AD4A 4RJEA 5C2XA 1NSJA 1W2PA 2OX4A 1IXPA 3W7JA 3H2CA 3M41A 5K4ZA 1OG0A 3P74A 4QLJA 1B2YA 3DZ1A 4Q8TA 3ONBA 3CJPA 2ZZ2A 2Y89A 3NO3A 2XIOA 3Q65A 3KWXA 1V02A 2A7PA 5LNVA 4KGLA 4ZB2A 3W7NA 2WV8A 4NYYA 1ZP4A 3BQ5A 4NZ1A 1WKDA 5HQLA 4Z2JA 1G7UA 2FDMA 1VYPX 1XYMA 3ISIX 2NUXA 3WF0A 1CW2A 1W0MA 4BI7A 2R14A 3BPWA 3H2EA 4C5ZA 1GVIA 1QFEA 5BRPA 3UWEA 4GNVA 3TW6A 3ABZA 4WGHA 5C9ZA 1J2BA 5D33A 3GYCA 4V33A 2NUYA 4J28A 1N7KA 3CHFA 1FX6A 4JDYA 1OY0A 2Z4GA 3SUSA 4L64A 2DT1A 2A4AA 2MNRA 1J79A 1FDYA 3NQ8A 2WSKA 3WH5A 3ATYA 5LHFA 4YHGA 3T9PA 1LRQA 3KCLA 3GR4A 3MBFA 2WC7A 3H70A 3TOPA 2V68A 2MUCA 3CAKA 4I5RA 4NX0A 5DBUA 5B7YA 4XZMX 3CWHA 3GW3A 1ZJBA 1BLIA 2I57A 3N15A 4LUTA 2ZE3A 1U33A 1E15A 1K9EA 4KRTA 1GNXA 4MOZA 3NYDA 3ANUA 1SM9A 3W85A 4HNUA 3RG6A 2EKCA 1J6PA 1PIFA 2Y8KA 2QPUA 1JFXA 4O11A 1ZFJA 2VMFA 4ILSA 2OFJA 2PDBA 1SO3A 3CV6A 2A6NA 2YZRA 5EGRA 4O1FA 5A2BA 2Z26A 3MCNA 2XH0A 4AVOA 1OFOA 3FAXA 3T55A 4QG6A 1DJIA 3AYSA 4XBKA 1OFRA 1W1A1 3EX2A 3BWWA 4GMEA 3LXAA 1KBIA 1BD0A 3MP3A 3KVJA 2BXZA 3MT1A 3HQPA 4E2DA 1S2UA 1GOMA 2ZICA 3GVWA 1DIOA 2FYMA 3WDIA 5FESA 4H9XA 4R5EA 2ISFA 2QJJA 2PGRA 2VFHA 4YNGA 3LV6A 4B91A 1LL7A 5C55A 4C1NB 1VIZA 3NPVA 4YVXA 3UGRA 2ZIDA 3N25A 4UTHA 1EF2A 4W7UA 2GLKA 5CPLA 3THCA 2OODA 4FLSA 4ZQRA 4W84A 3D46A 2GGEA 2ZX7A 3UR2A 4RV8A 2Q6ZA 5HOSA 3WH7A 3ECQA 4CNPA 1ME9A 3A24A 2GQ3A 3UGVA 4G6CA 3N4AA 3FXYA 1H7PA 2E09A 3S5OA 3UF9A 4JX6A 1R3VA 1S1RA 2IQTA 4N9CA 1POJA 4DUXA 3MHGA 4PR4A 2QLYA 2DW7A 2JIEA 1W5QA 2OU4A 2YGYA 3W82A 3I10A 4JTAA 2Z1VA 1WBJA 1DHPA 4LVGA 1E6SM 4N9EA 5KITA 4B3LA 3CUHA 2WVTA 4M5PA 3UYIA 2J9ZA 1B1YA 3WNLA 2OO6A 1P6WA 4N02A 1XQKA 3MW7A 4WK9A 2CLIA 2YLLA 1XGDA 1TPEA 1N2VA 2AL1A 5B80A 1EC7A 3PBVA 3BCFA 4S3CA 3B8UA 3A4XA 3W84A 4YYFA 1UWAA 3W23A 3DG3A 1OT1A 3LXCA 1IXQA 3W00A 3BAJA 1TRDA 3R0UA 1G69A 2J7FA 2GUBA 3PZMA 3M7WA 3SQSA 4QSHA 4O50A 4C6DA 4RNIA 3QY6A 5A5WA 4W9TA 1EDTA 1KTCA 2REQB 2CEQA 1JNEA 2VRQA 4DJDD 1UCWA 1K70A 1O12A 1TE1A 3BCJA 4JY8A 1FRBA 3URBA 4HHPA 4FIRA 4QEHA 4FLRA 2PAJA 4YTUA 1A5AA 1OFDA 4MKNA 4JR5A 2AOSA 1K7XA 4A3QA 2VQUA 3GDBA 3UG4A 3OLIA 2A79A 1UPMB 2VZOA 5F2GA 4GI4A 1NU5A 2HK1A 1HJXA 3DYMA 4TTUA 2VX4A 2V2DA 3ALFA 5CAHA 5HPOA 3LGDA 4IIBA 1XIEA 5TF0A 4WSJA 3DH7A 2HTMA 1PYFA 1HKMA 4IMDA 5EU9A 3EB3A 3LTPA 4WY0F 2W61A 1MNZA 2PPGA 5T9CE 2WJZA 1ITCA 1G4SA 2VL4A 3G1XA 2FZBA 4DN1A 2AQOA 2HE8A 5FEWA 4QLKA 2E68A 4D1JA 2Y1HA 3L5MA 3TN6A 2OYMA 2WHLA 5DEZA 4IZGA 2I14A 3O6CA 2A3BA 2CLOA 4UNKA 1XLDA 1XH1A 2AMXA 1XSKA 3IJDA 5CAKA 4LYKA 1RJRA 4UOQA 2R1PA 2DZPA 3WQ6A 5KETA 3VC6A 3TXZA 4WKHA 6REQB 3AWOA 4G56A 3TTQA 1O68A 2DY3A 4F48A 3LB0A 4MAZA 4GZEA 3UERA 3M4HA 4L4PA 1F6KA 1CYGA 3EX4A 1ZENA 3APYA 1RALA 1K6AA 1LT8A 3VTRA 2GOKA 4M19A 3UWQA 3ITLA 1L8NA 1R3SA 2XHYA 4OZOA 4CD7A 3HTWA 4QJ1A 2PZ0A 1VFSA 1RK5A 3OVPA 2DGAA 4PMQA 4GXMA 1NH6A 1L2UA 3S47A 3P2VA 4XIMA 3WDHA 1XH2A 4LT9A 2WMKA 2VJXA 3GUGA 4MWAA 3W73A 3EWWA 3LCXA 3AS3A 4GACA 3HO8A 1YX1A 5F7UA 1H4PA 2ZUUA 1Z44A 3LHYA 3TCSA 3PNZA 4YMZA 1F6PA 3P5YA 4DO4A 5BXPA 1EO7A 2PDQA 1H61A 1RXOB 3MDWA 3FLUA 1FUYA 4RZ5A 1QASA 3MYPA 2E1DA 5I23A 3GH4A 2WHMA 1J96A 1ICSA 3R8RA 2J7GA 1KM0A 3AHXA 3ZLGA 3LA4A 2XG9A 1SGJA 4DAIA 5MF5A 4U31A 2NSXA 2J9YA 2ISWA 3VIHA 1QUMA 2GJXA 4IP5A 4AD3A 3IK4A 3KBSA 5A8QA 1UOKA 5M1TA 3VIGA 4PMDA 1V3IA 3TMQA 1E4NA 1BYDA 1RPKA 3IIZA 4TV5A 3ZQ9A 3S9IA 4UOZA 3DFQA 2GYIA 2WHKA 4ZTYA 2GVLA 3TQPA 4KMQA 3LY0A 3GDLA 2OKTA 4LUTB 2XH7A 3P0WA 1HW6A 2WOQA 4MM1A 3CPRA 1J0JA 4IP7A 4Y7EA 3R6IA 3VGEA 1ISYA 6CGTA 2VEKA 4AWEA 3PB0A 1GVEA 4H8VA 4Z0JA 4UQ9A 3MI3A 4RLIA 4GH3A 3CZJA 4IF2A 2PDKA 4C6IA 4FALA 4G1KA 3NTYA 1W32A 2DVXA 2VWTA 1CECA 3RHGA 1R2RA 4A3YA 2PDWA 2X0YA 4GLEA 3OQEA 4BWLA 4ZQMA 4GZIA 4NXKA 2PDIA 4ZODA 3W1LA 3WUGA 1QPKA 1UIPA 3PSWA 1Q6GA 1SO4A 4C1KA 2ZZ7A 1V08A 1Z89A 3UYCA 3NYZA 1RH9A 4DJFC 2PU1A 3VMNA 3WLMA 2QDHA 4RW5A 3YPIA 4PMVA 1JNDA 4IUGA 1VEOA 1P6CA 4ROQA 1GTHA 4O57A 1UBPC 4AY7A 1EX1A 1IT8A 2WNNA 4TVCA 3K4DA 2V3DA 4UNLA 3NPWA 3VD7A 4MTVA 1FY6A 1QATA 3SB0A 3C0SA 1EQPA 2VZVA 2RDUA 4HP5A 1CEOA 5LA0A 5HNNA 3NSMA 3GNPA 4M0XA 4AZGA 4LUSA 1RCOB 4D71A 5BXTA 2P0OA 3MUAA 4PTVA 4HQVA 5FD0A 5AY7A 5MKGA 5FF0A 3LMZA 4QISA 3FJ6A 3I4KA 3WD1A 2BVYA 1WOAA 4AX6A 3PB2A 1PX8A 3P5ZA 3VPLA 2CLHA 2O9OA 4NU7A 5HXMA 5AC4A 3KZPA 3LLDA 4N9BA 1TTJA 3BXWA 1V3HA 2EG8A 2G4JA 4NL1A 3CPGA 5DANA 5IDZA 3OVQA 3EBVA 1OK4A 4R53A 1OC5A 3F2BA 3OGRA 2XM2A 4ZXOA 4LVAA 5IBXA 3PK7A 2MANA 4DVOA 3WNKA 5A1AA 1X98A 3W24A 4LX4A 1O94A 4F3HA 2NW0A 3UW6A 3NURA 3BDKA 2VC7A 1FDZA 3GH5A 3M0IA 4DWSC 5BWAA 3QY8A 4NZJA 2BFGA 3CZKA 4J3ZA 1CXEA 2RUSA 3CQ0A 4Q4SA 1UA7A 4GUFA 4A3RA 4WXYA 3M0XA 4FF5A 2ASHA 1DJZA 4MJZA 4LVDA 1JUBA 4YCPA 3NCOA 2WCSA 3GG1A 4DBEA 5GNZA 1DJNA 2A3EA 1AQHA 1GVFA 1H1NA 3VGDA 4PB5A 1R9YA 3GVGA 3GRIA 2HBXA 5A94A 1Q45A 3D3FA 3OU8A 1TV7A 3EA2A 1MXSA 4FIQA 5F4XA 1JYNA 2XFWA 3BH4A 3L7RA 3IWPA 1ISXA 1FWDC 2V2HA 3RRXA 3RK8A 2ODOA 4MUZA 1HQTA 4CNSA 4H3DA 4PMYA 4XIAA 4W85A 2PBGA 3RMEA 1Q66A 3KP0A 4WGXA 3KVKA 3B3DA 3MBDA 5A8OA 3OZMA 4CN4A 3L67A 4RUBA 1M53A 4O13A 3HB9A 1UR1A 3QZ6A 3HFYA 4WRHA 1TSIA 1CX9A 2PC4A 2YLAA 2WWDA 3EA3A 3HQNA 3THDA 3IUDA 3W7CA 1P0NA 3V1PA 2PWVA 4C6FA 6XIAA 4F40A 3KAOA 5I06A 5G2WA 3TR9A 2FJKA 3CBWA 4BCEA 3TYZA 4I5UA 2HWGA 3OODA 4JIQA 1GQJA 3DG7A 4DUOA 3EGJA 4B2DD 2A3LA 1ISWA 2WMIA 4RDWA 2BSLA 2GQAA 3PANA 3O6YX 1A50A 1Q4NX 3SN0A 4DZ5A 1L9WA 3WQVA 3ZWSA 5JH2A 3AHZA 1MWOA 2VWSA 1CNVA 3QMTA 1QHOA 1SMDA 3VILA 1WXJA 1W5NA 3I3BA 4I8YA 2V82A 2J27A 4OBSA 5CZKA 4YN5A 1JYVA 2OO0A 4W5UA 2ZC1A 3NPXA 1R87A 1TV8A 3HMJG 3K13A 3UXLA 4UR7A 3OZOA 2JEPA 3M0YA 1DXFA 1O7AA 3AFBA 4TOQA 2F6UA 2QCGA 3T09A 3BARA 4LY4A 1M3UA 2FKPA 4LYRA 4XKMA 1VS1A 3W1XA 4RE4A 1E4IA 3FW6A 2F7FA 3C0QA 1R47A 1RSCA 1DJXA 1JR1A 2OJPA 3K30A 4MWAB 2UWFA 4YVVA 4DXXA 2OELA 1ZJIA 4G9PA 3U2CA 1MFUA 5CZTA 1GKPA 2XH4A 3PS7A 1XRTA 3V75A 5LKYA 4AZ5A 1F07A 4ZQPA 3MSDA 2PDYA 3B8SA 3GG7A 1JDAA 3FA4A 3A5VA 3B0YA 4H6QA 4UTFA 3I68A 5CC5A 3VU2A 2XVNA 4CCZA 2QW5A 2ZX8A 4GIAA 4Z17A 2NX9A 2Y88A 4XZNX 2BY2A 5CLTA 4KWUA 5U4NA 2TRSA 2RAGA 2G0WA 3QV7A 4AD4A 2ALRA 4O1DA 1PWLA 2QR6A 2GJXB 4EE9A 3OHMB 2DU2A 3KBWA 3UETA 5I3FA 4WOQA 3ORWA 5ECUA 4Z1AA 3VD3A 3CAQA 4D6FA 1AD1A 2OYLA 1JRBA 1KM1A 4NRRA 2C1IA 1GEQA 2C14A 3NO5A 3UZXA 1NOFA 2TMDA 3KTCA 1R7AA 4HZMA 4FI4A 2YKKA 4HN8A 3E0FA 3CGTA 4QG9A 3VNJA 3GNRA 4QITA 5DFAA 3SRFA 2OZ0A 4F0KA 3HJZA 1QU4A 3HG2A 1EWEA 4FS9A 4A8NA 4DB7A 3C0LA 3HURA 1L6FA 3KRUA 3EDFA 3W83A 1S5MA 4CQ9A 2TODA 3M44A 1TPFA 1W54A 5CPMA 4WDTA 3Q37A 1WKYA 3NOEA 1TCDA 5FAJA 2BV9A 4M8UA 3Q4DA 1AJZA 5DXXA 1GONA 1KM5A 3E0IA 1WA3A 4ZXLA 2VZTA 2YW3A 2OWXA 4IOTA 2F84A 4FLQA 2Z7GA 1E0XA 3G2GA 3IUIA 1W3LA 3IPWA 5KMYA 1ME8A 2DJLA 3C2VA 4D6GA 4PCFA 3DKLA 4NNBA 2ZA1A 3EX3A 1GKRA 3AC0A 5D32A 4OBRA 4KFPA 3F4DA 3CV1A 3VIIA 1H60A 4QR6A 5A6KA 1PDYA 4UQDA 5LNWA 4CQCA 1JZ8A 3TJLA 2PP0A 3HA1A 4AHPA 1GOOA 3NQAA 1QOQA 2PTZA 2WAGA 1R7OA 4DZAA 1LQ0A 3DYOA 2DT2A 2WMHA 1GJPA 1LQAA 1E3XA 1F3WA 2RH9A 2PTDA 1KRMA 2NX1A 4UQAA 2V3FA 4ATWA 2J9XA 3CHCA 5C0QA 3SCNA 1RAKA 4H7ZA 4R3UA 3UXDA 3LRKA 3MMDA 4W88A 3V7PA 2WZHA 4IIGA 4IGSA 4LUSB 1EC8A 3R11A 4JIRA 5MKGB 3MSGA 3NQ6A 2VOMA 1YNQA 3W9ZA 3CAWA 3NXLA 3AU6A 1MNSA 4HU0A 1K03A 4MY1A 2C15A 1S5TA 3M07A 4M81A 2ISSA 4MB4A 3BZGA 5DRIA 2V3GA 3ABSA 1XIMA 4D6IA 5C71A 1D3HA 4K37A 1QAPA 3V4BA 1KM3A 4X2PA 4AMAA 2YFNA 1B5TA 2Z0IA 5HR6A 4ERAA 2P50A 4LW7A 5TD4A 2XVPA 3VGHA 3GXNA 3QBUA 2V9DA 1VP5A 3PUGA 4AZHA 3SGZA 2PFHA 1ZAHA 1XP3A 2QDDA 2O7SA 3PHAA 4LVFA 1Z7AA 4L6OA 3SCSA 3S8HA 4EAMA 4D8ZA 4JXCA 3SI9A 3KX6A 4XUYA 1R6WA 1KKRA 4LCSA 1ZLPA 3EXRA 3S5SA 3UJEA 3KLLA 4KWSA 1HIZA 5EA9A 4WDXA 4J3XA 1WXZA 4Z0SA 3T42A 2WMGA 5DCEA 1DIEA 5A8MA 2OX1A 3OYXA 2CESA 1RPXA 1RD6A 4Q6JA 2R8WA 4B15A 3AYVA 1TQJA 4EPDC 2G37A 3N73A 3TAOA 1AQ0A 7TIMA 2X40A 5CZJA 3LHTA 1BXBA 2G96A 3K4AA 2CPUA 1V0NA 2QJHA 4IL2A 3CH9A 4PEKA 1DV7A 1CBGA 1KC7A 4GKTA 1GVYA 5DMMA 3TROA 4NUWA 3VGGA 3K46A 3OTRA 5DMYA 1PPIA 5D37A 4UWMA 5E6YA 2FJUB 3MUZ1 2C1GA 5HMFA 1TV3A 3CT7A 4BF5A 3G24A 1OC7A 4L7ZA 3L0KA 1AVAA 4B16A 1NP0A 1WKEA 1WAWA 1F73A 3W26A 2NT0A 5CGQA 4O16A 1LZOA 3VOIA 3S1UA 2BY1A 5E5CA 3PZ9A 3C3NA 3MWCA 4ZSUA 3E2QA 3P67A 4V28A 4K8EA 3SCUA 3WQGA 1M65A 3WD3A 4JCLA 1XLCA 4CNNA 1UZHA 2Y61A 2YFOA 4OGZA 1AH4A 3V5OA 3W7HA 1A49A 3T8QA 2ZUNA 5RUBA 1JG9A 2VEMA 1AA1B 2WKJA 3BVJA 4U5KA 1KLZA 2WMIB 4LCRA 3RR1A 4AAJA 1PX4A 5A6BD 2O4QA 1H5VA 2WKLA 2C7FA 2A5HA 1L6YA 1K8YA 4CKQA 1NIUA 3UWYA 1PZ1A 3RF9A 4I9JA 4A4AA 2SFPA 1EEXA 2HBVA 3L0NA 4X9SA 3NZGA 4ZMGA 5HQMA 1CGWA 1QOXA 3LZ5A 4F0SA 2RDXA 2PWHA 3W7GA 1TX2A 1B57A 1IWPA 3S42A 3FSUA 4O0KA 3VNKA 3WFLA 3G3DA 1VENA 4BY3A 3LPGA 3LPPA 4WKAA 3DDMA 4GI9A 4EKJA 2OZ8A 2WPGA 3VXGA 3WELA 2D1ZA 2PF8A 3QLLA 4QJ3B 3LM3A 1C7TA 4J3SA 4GXWA 3GH7A 1VFUA 4HJFA 5FJIA 4JNMA 4P8WA 1KXQA 1UC5A 1FHUA 3OLGA 4OE7A 3OG2A 4ZENA 4UTUA 3M5ZA 3BANA 4KCVA 3W4RA 1TR1A 4C91A 1FWNA 1L6SA 1Z69A 2V5CA 3VDAA 1R8LA 1J5TA 3H4GA 1JIBA 1ZP3A 1XIHA 2FPTA 1EXBA 2C16A 3ARQA 1TB3A 3ABXA 4MY8A 3BV4A 2PDPA 4GK8A 2OWWA 3PFRA 2EPNA 1F7BA 3R8GA 2EG7A 3GNOA 3GE7A 2I56A 3TW7A 4GBDA 3TW9A 1F4HA 2XZ7A 1M41A 3G6LA 3VCCA 5D09A 1TVLA 2YL8A 2VFFA 4PUJA 4V1YA 3MWAA 3JW7A 1G6CA 4B5UA 4M24A 3N6JA 3MI2A 4GYPC 4OT7A 5CC3A 3A22A 4IMGA 4TX8A 3WD0A 5CQ1A 3BURA 1B9ZA 3QPZA 1LQ2A 2PLJA 2PRLA 1F4AA 3LG3A 4KEUA 3WEZA 4D2JA 5C7VA 4IJBA 1GOXA 5G1MA 3C56A 3APGA 2J7BA 4PE8A 3QR3A 5GJNA 1H09A 5FSDC 2W62A 2CZFA 5D9PA 1ZB5A 4YCOA 3NVDA 3RX4A 4C90A 4GPNA 1YIXA 3IIOA 3CB8A 1DXIA 3PPCA 1NEYA 5I3GA 4IISA 1EDQA 1PX3A 2FHCA 2E9BA 3PF3A 4Q8QA 3G1YA 3O6AA 2E28A 2XN0A 3I3EA 1SMAA 3NJ3A 3R13A 3T2QA 8XIMA 4S3FA 2XH2A 4LXFA 1DE6A 2QCEA 5E6ZA 3TSDA 1CGTA 3ZYZA 3AS1A 5M5DA 5A6LA 4E2BA 4UC5A 2GGGA 4LYQA 3OHIA 3RXZA 4AWUA 1JXKA 1X7FA 2R1NA 2P8CA 4Q8MA 2DORA 3LHZA 2ZKMX 3LUTA 1SR0A 4BEUA 4Y9OA 3AI0A 4BEQA 1B3XA 2WXDM 3EEGA 1TJ1A 3UESA 1ECQA 1I2RA 4I6VA 1SO6A 2WSYA 2CW6A 3O2LA 3J7HA 2W6RA 4H6RA 2E9LA 3W7DA 5AC7A 2FFCA 4Q8NA 2PUZA 1A5MC 5AOUA 1EIXA 3EKGA 3ZR5A 1VAHA 3S1XA 3HU7A 2E9MA 1GPWA 1KFKA 1XFBA 2ZRYA 5H8UA 1X8FA 4JOMA 3WMBA 4PYSA 4NY2A 2C18A 1AL7A 5FACA 4C6JA 1C92A 1R9XA 3LPOA 1QXLA 1KRCC 3GAKA 3EPNA 3P3BA 4YIWA 1ZCOA 1VBUA 3KCOA 3U2ZA 3CMGA 1W9DM 3DYPA 4IFKA 1TREA 1S5VA 2F9RA 3NL5A 4LRSA 1QK0A 2CHRA 3REQA 1T7LA 2WSRA 1EFZA 1IGWA 1OHLA 3IJQA 4Q33A 3W02A 5JUVA 3VOGA 2BVWA 5K3VA 4BZYA 4FMVA 3MVIA 4NJIA 1YLVA 1UP3A 1TPB1 4WKFA 2Q3RA 2R9RA 3CQJA 1R3WA 1EPVA 3CQIA 2VELA 2UY4A 3M0HA 3FA3A 5AC5A 3EB2A 3WLTA 5H6HA 2CLMA 2WMJA 4Q3MA 4JTTA 5C54A 2A7RA 3FX4A 1C9DA 3NZQA 2WVSA 3GBDA 2D2OA 2ACSA 1BSIA 1VQTA 3IJ9A 1DXEA 4W7WA 1F76A 3ZR4A 3F5LA 3V18A 3FY1A 5LIYX 1KM6A 3CHEA 4DF2A 4Q6XA 1A4MA 4HU4A 4KFOA 3RCYA 2QEZA 4KCTA 3SAZA 4UTIA 2C91A 3SFKA 3F1QA 5E9AA 4CVUA 3LGGA 3DC8A 2VR4A 5LGXA 1ZBKA 1BXNA 1W1VA 1PIIA 4BK9A 1R38A 3OIHA 3PJXA 1ZQ5A 3PZTA 5T26A 4K36A 3TTSA 5I3JA 2ZRXA 3H24A 3Q58A 2FVMA 4KERA 2W4XA 3LOTA 7CGTA 4L9YA 4Z42C 4MPQA 4GIRA 4H7VA 1IR2A 4RL3A 3RPMA 1OIFA 2ATMA 1E70M 2H90A 3K8KA 3VD4A 3MKKA 4GFSA 2HNEA 3QFEA 1Q8JA 4UQCA 3T44A 4GISA 1XG3A 4GQ0A 7ODCA 3GNXA 3PM6A 4GJJA 4Q8WA 2GSEA 2YA1A 3C86A 3S6DA 3R0KA 1UD2A 3H26A 4D6HA 4FR6A 2E4TA 1E1FA 3VNYA 5CSYA 4MNJA 1FWAC 5I24A 3PPHA 2O9RA 3MCMA 4Q8OA 1JD7A 2V8ZA 1Q7MA 2GVEA 2J25A 1A53A 3ZXWA 3QFWA 2HZGA 4AX7A 3BAYA 4YWSA 3KE0A 5LXXA 1QJWA 4CD6A 3ZFHA 1XDLA 1GJUA 3SCWA 2QCDA 4HN4A 2C79A 4MNLA 1F2JA 2DH3A 4XISA 4H6KA 4ZO8A 4GFIA 3DIPA 1H7WA 1UROA 1ZGDA 4JAWA 3JUGA 1G67A 4RPQA 3SCRA 5LNUA 2E8YA 2YXXA 1V6XA 4JTSA 2BMBA 5D30A 1PV8A 3DXIA 3RAOA 1W9BM 3W7PA 1TPVA 4AISA 4NF7A 4OV4A 4QNWA 4IH3A 1E43A 3WDRA 1KXVA 3EA1A 1KBLA 3L2IA 2R24A 2UY5A 1AUSL 3C5QA 2XZ9A 5EMKA 1XLLA 4ZB5A 3P93A 4M80A 5CGMA 2D0FA 3GO2A 3LDVA 2POZA 3TYAA 5LNSA 1GPFA 4ZSTA 4PBGA 4I8DA 5EPDA 3FKKA 3VDCA 4G5DA 3P82A 3WK2A 1VD6A 5C9UA 2V0TA 4ZTXA 1XI3A 2GZXA 1KWGA 4EK7A 5IDIA 1XGZA 2DZWA 4A8LA 4IP4A 5A8PA 1UD6A 3GTHA 2X0HA 2DVTA 2Y2WA 5JIPA 1UR0A 3DFNA 4R7WA 2EKGA 4POCA 2Z27A 2A21A 3TQVA 5C7HA 4LCQA 8XIAA 2VCCA 3VAVA 1JYWA 2JQXA 5D2YA 3LRLA 1KFJA 4ZQCA 1OCQA 3AMLA 4KKXA 4RXGA 1KWKA 4GG9A 4XAPA 3PBYA 1TO3A 2CYGA 1EPXA 3WK3A 1S3HA 3N04A 1VJSA 2OOGA 3QRHA 2GQ9A 2CERA 4L4LA 5CJNA 3M0KA 1KCZA 4M7SA 4QS5A 1XBZA 1XV8A 3MUY1 2OLHA 4OJYA 2QV5A 2DFAA 4RNHA 3ABRA 1PTDA 6TAAA 1I2QA 1FXQA 4YXGA 3OZPA 3V35A 3QV6A 7REQA 1TV2A 3NAVA 4PCPA 3CYJA 2E3ZA 3AJXA 4LB3A 4GVGA 1FP9A 3PTQA 4ACZA 1OC6A 2QUMA 3E1F1 3S5NA 4FX8A 4GX9A 2BDQA 1UR4A 3THQA 3TIMA 1DWAM 2YOCA 1EQCA 1W1IE 1EF3A 3UCDA 1A5KC 5AN7A 1QNOA 1KFBA 2VURA 5GVJA 3C2FA 5H2ZA 1BVZA 3WF1A 3CO4A 4PUNA 4TU1A 2OQHA 5BOOA 3E0WA 1P5BA 4K6AA 3AUJA 3VFLA 3VABA 1EJRC 1KW1A 3JU2A 4XK2A 5I07A 2CFFA 2XIQA 4H00A 4Y9NA 1SFLA 1DWGM 4QEEA 4WF7A 1MW1A 5IFTA 5CBBA 3CV2A 3G8EA 4QCEA 3PZUA 4MLJA 3WQ5A 2J78A 1JQVA 2P8BA 1VHNA 2GFTA 2ZA2A 3WQDA 3N2BA 2PDCA 3FFSA 3ZVIA 1I2NA 2NV9A 1BFNA 2V2CA 4AHQA 3P6LA 1R3QA 2VZSA 3W1QA 3BLKA 3DHFA 7PTDA 3ENLA 1EGMA 1U22A 1QWGA 2CBIA 1J12A 1IZJA 3M5VA 1VBHA 2HXUA 4EWJA 4OHQA 1MSSA 1QPOA 1UZ1A 1JDFA 5CPTA 1V0MA 4DJDA 4AYGA 4AIBA 4XAGA 3AIRA 4MDOA 4J40A 3UJFA 2OGYA 3S2MA 4HZ7A 4R7JA 1DBTA 4LAOA 3PG9A 3EWXA 3M0JA 5G1YA 4TVDA 3I7RA 3GR8A 3N12A 5K7JA 5LHEA 1OFEA 3O0FA 1TZZA 4JKMA 3WNOA 4ERIA 2FZMA 2JIWA 4X2RA 4LYPA 4EAYA 1E6RA 1T6MA 2KX9A 5CG7A 3BICA 4H7CA 3N2TA 3TZFA 1WPCA 4Y6GA 1QHZA 2OLAA 4IFKB 3VIPA 4RZBA 4P8VA 2GDUA 2NQ9A 4Z1BA 3ZSSA 3H7RA 4MB3A 2ZVIA 3REQB 4JIIX 1W1YA 3KHDA 1QI2A 1ZJHA 2YB4A 3S3GA 4X61A 3B0UX 4AVFA 1TZ9A 3GHTA 4HU8A 1YMYA 2FH8A 4UTTA 1QOPA 4PC8A 5HINA 3WJSA 4NASA 1B31A 1CENA 1SSGA 1AZ1A 2NQLA 1XHGA 4AW7A 1D7FA 1KGWA 3M0MA 2PDHA 4IICA 2J6XA 5C70A 2CLEA 2ACQA 2ZA3A 5FF4A 3GZAA 5F1UA 2I5GA 1TTQA 1IZCA 3CUJA 3KBNA 1H7RA 1REQA 3S0CA 3G1SA 4L6DA 1BAGA 2YCEA 2Y7FA 3GU1A 4C6MA 4JL1A 1EL3A 3KCJA 1OCNA 3AUOA 2NT1A 1KA9F 2FVLA 1GVOA 5HWMA 2ABBA 5C2CA 5JXQA 1SZFA 2Y5JA 2DIKA 4LH8A 5CEWA 2H9AA 3I7SA 1W1ZA 4US5D 1XLAA 1LORA 1PZ0A 5T8GA 1LUCB 4LALA 3CTTA 3MPGA 4CLMA 3V1HA 4KETA 2DT3A 1E4LA 2ZZ6A 2DSKA 3KRBA 1MVYA 3TAKA 3CUGA 1G4EA 3LHUA 1JXJA 1JGIA 2F6KA 3GXPA 4JN7A 3UR8A 1UKSA 1ESWA 1Q6CA 4MVAA 3VM5A 3AYRA 4XTIA 3TNBA 3AMCA 3EKLA 2EPMX 1BYAA 1EGZA 2HISA 1E4MM 4U2YA 1YDYA 4W4QA 3V5CA 3S6TA 5G2IA 1EZWA 1TFVA 3GU9A 2L5HA 1V4YA 4IPNB 4OECA 1VCGA 1J8VA 1S2AA 1PYMA 1ADOA 6XIMA 5ABFA 1F6YA 1FHVA 1W8SA 3L5AA 5C8BB 3EXSA 5BRBA 3ARWA 5J04A 1XISA 2RFGA 4HNTA 1H0GA 1E55A 3S2LA 1IWAA 3P7YA 3H7UA 2QCDB 1QNQA 1JEZA 3WLKX 2VD9A 4DBUA 3SY8A 3JRKA 3WH8A 1PKMA 3KBJA 4MPKA 5HR7A 2D3LA 1VH7A 1JZ5A 3S2NA 2TYSA 4O52A 1X6NA 1WV2A 1Q4WA 5DT5A 4FAMA 2POTA 3AMDA 1NWSA 3N6QA 3DERA 5I00A 3W76A 5BCAA 3GG0A 3NZ1A 3HJEA 1P1MA 4JTJA 4N6EA 4RNFA 2Y5EA 2D20A 2JFEX 4NI3A 3SEPA 3F4VA 4DXVA 2XN2A 2VVNA 2NV2A 3EDJA 1TJ2A 3BAKA 2W63A 3OBAA 2VRJA 3KOYA 2VFDA 1O5XA 2BLEA 2ZRZA 3GQYA 5DRCA 2NWRA 2G8ZA 5CPQA 1VFTA 3WH9A 2E5DA 1ZALA 1XIDA 3VIMA 2BGQA 1E9YB 5H91A 2ZX6A 1KTNA 3IVSA 3BTNA 3W6LA 1LWJA 1V03A 3II1A 1W3TA 1NAL1 2OEKA 1F3XA 4AZBA 5M2FX 4AHOA 3B97A 3KBMA 1NQKA 4OUEA 4O8RA 8A3HA 1D3GA 4ADSA 2PDFA 3KTSA 3PR2A 3F03K 1M9HA 2ZRUA 1RR2A 5DF0A 4HK5A 3VNZA 1RP9A 1FWJC 3RO6A 1M7JA 1I60A 1O1ZA 3M0VA 5KEZA 2E6DA 4WY0A 1Q2SA 4QE4A 3Q94A 1W1B1 2XDFA 1QT1A 4PSPA 2D2GA 3TN3A 1TMQA 2DH2A 2Q71A 3O3RA 2NXHA 4ADUA 4WQ6A 7REQB 1OYAA 3ID7A 4ZR8A 1D8WA 4H9YA 4AWSA 2XUCA 4DYKA 1AMYA 1XW8A 2RDWA 1WAUA 4ACZB 2Y7EA 1IWBA 4ORIA 3FOKA 3MCOA 1SPQA 3COTA 2YA2A 4PB3A 4L65A 4C5YA 4LC6A 1RCQA 3DCPA 1U2YA 3WD2A 3PJUA 1GK8A 3M9YA 4F0RA 1U30A 3L2LA 1HL9A 3BGAA 3NQ7A 4DJED 3ITVA 1BQCA 3MHUA 1OZMA 2BNJA 3VM7A 2ZUSA 2ON3A 1DTNA 3LS9A 4PRWA 2GJPA 1POKA 1OD0A 2BG5A 4CUCA 3IIPA 5AYYA 1G9HA 3TLLA 1W1TA 2XSBA 4IIHA 4H9UA 2NXGA 1XH0A 4IQJA 2JGYA 1U5JA 1OEPA 4O14A 3P62A 2PURA 3ARVA 3UBPC 1QVBA 4B9ZA 4GVIA 1ECEA 2VO5A 3WUFA 4DYEA 3QOMA 3Q45A 1A5SA 3LTYA 1QNSA 1VFFA 4ZO6A 3WLLA 5JIWA 1LRNA 3NXFA 1OT2A 1HX0A 1KFCA 3A4WA 3W86A 4ZZ9A 1Q6LA 3OB8A 3BGGA 1EJTC 4AC7C 3AHTA 4PCNA 3UNTA 3KL3A 3E96A 4HZ6A 3HPSA 1Z48A 3IRSA 3TQKA 4BS0A 1XJBA 2FTWA 2X0SA 4J3VA 4BF9A 2UBPC 4PUMA 1DQWA 1VYRA 1GCYA 4EF9A 5GNYA 1FQ0A 3ANYA 3VDGA 3CU2A 1JZ7A 4PMXA 4F8XA 3BLOA 2C13A 3RX3A 4AF0A 3GFXA 1YEYA 2H8ZA 1WZKA 2B31A 4AFYA 3LTSA 5FJTA 3KDOA 2OLSA 4E8DA 2R82A 2I1OA 1EJUC 4KCWA 4ZOAA 2XGBA 1H41A 1IXNA 3WQPA 1XYBA 5I6SA 1OINA 4UTWA 4ZBCA 3WLJA 3B0VC 3NGJA 3PZOA 1OCJA 3GFZA 2CKSA 5FJPA 4HOWA 5CPNA 3O05A 3E9AA 1BRLA 1J2WA 1E56A 1GT8A 4NAEA 4P5UA 4FP1A 2WVVA 4LSBA 4CEUC 3T07A 2NVDA 3T0CA 3NZRA 2FHBA 5DXYA 4U3AA 3ZJKA 1PUDA 1J11A 3HPAA 1RD5A 3WL1A 1H11A 3SY5A 4N42A 3AOFA 2QJGA 2WZMA 4A05A 5A3HA 4H9MA 4Q4KA 1K7FA 2A7NA 3FEMA 1REQB 1XYAA 2V81A 4FNUA 1BYCA 1T41A 3QSTA 4Y2WA 3VCNA 3F2DA 3BSHA 4X0VA 3O9NA 3CLMA 4Z08A 5AVHA 3R43A 1CB2A 2QUTA 1XDMA 4GY7A 3NL2A 3KRZA 4MWAC 5KTLA 1IEIA 3T4CA 3D5HA 1HJVA 1MZHA 5CZSA 1RBLA 3ITOA 2H9AB 2OVLA 2WCAA 5AZ0A 3MS8A 3W2LA 4RE2A 1NOWA 3QGKC 3UXKA 3UR5A 1R2TA 2D69A 3BO9A 3AQUA 2LLEA 2O9PA 2EQDA 5HAOA 3EZ4A 2GGIA 4DUVA 1O5RA 2BX7A 2X41A 4HHLA 1ICPA 3MP5A 3BLEA 4UB9A 2CZDA 2AKMA 1KM2A 2YZ5A 3BW4A 1SZNA 4RKAA 5AYZA 1UZ4A 3DUGA 3NNTA 4HT3A 5REQA 5KINA 3QXBA 3GAYA 3NO1A 3M5YA 5EKYA 3UWWA 4EPBC 2VM8A 3SR7A 4UMAA 1P0BA 3S2CA 3QYQA 1K8ZA 1ONXA 4XSMA 5F4SA 5CPSA 3G6MA 5ABFB 4CN1A 5BWFA 2OXNA 3SRDA 2JF6A 4FK9A 1CGUA 3UY7A 1J5SA 3WZ0E 4HMCA 3BW2A 3W1PA 1EHNA 4WXZA 2E6FA 3VOCA 3WQFA 2V5KA 3C61A 5KZEA 1TPUA 2WLYA 4GC4A 3TFXA 4Q4OA 4DRSA 1DE5A 5A8GA 3ICJA 3EMCA 4AU0A 4XO7A 3G22A 4N9DA 3W7IA 2OT1A 3O8AA 1TJ0A 3B8VA 4TUFA 3FS2A 4PGLA 1NP2A 2ZFAA 3NQEA 1W56A 3OBEA 1GW1A 3M0ZA 4XD5A 3EWYA 1U5VA 1W3JA 2WKGA 1WUEA 1QNPA 3ZLHA 3QHMA 1L8PA 4M7TA 4O28A 2WM0A 3ITYA 1HKWA 1H7NA 4DF1A 4A8RA 4DPPA 3KXQA 2CBJA 4BWLC 1I6NA 2YCJA 4HOZA 4ML9A 2BHYA 2VDHA 4IUOA 5CCZA 1PKNA 1HN1A 2A3CA 3Q2DA 3BMVA 1MQRA 5I77A 2CNCA 2DSUA 4XB3A 4MHBA 2CITA 5PTDA 4XSLA 3IJLA 1DWIM 2HRWA 3GXMA 4MZ1A 3WLPA 4FX7A 2X05A 4HK7A 3VMPA 4NQ1A 3T0AA 3SCPA 3TC6A 1LG2A 1EYWA 3PZVA 3W25A 3W2UA 4WY0B 1OFBA 1J0YA 4UTKA 1AZ2A 3P84A 3TH6A 5A2CA 4N2YA 5EMLA 2X1IA 3WLOA 3ITTA 2WMFA 4JFVA 3U8GA 1LG1A 3TP4A 1A47A 1V93A 2VRKA 2WQDA 3UT0A 3DX5A 1M04A 2XN1A 2Y6ZA 4ADTA 4W86A 3WQEA 4C1LA 2FPYA 1LBFA 4QAIA 1F8IA 1GVSA 4B5VA 3AIWA 5FEZA 1LWIA 2WZTA 3KOZA 4LTSA 4JQ3A 3P81A 4XD4A 4XD6A 3B8DA 3ITGA 2YXGA 3RPDA 2X09A 2IXUA 4PH6A 1EC9A 1M1BA 2QS8A 4PL2A 1RZMA 1KXHA 1V5XA 2D2JA 1S2VA 5BYWA 3KTXA 1ITXA 1Y5XA 5BZAA 4YTTA 1FWCC 5D8ZA 1MEWA 2I16A 1UWUA 3A12A 3IGHX 2CLFA 5BXSA 1X1ZA 1LL6A 1LOQA 5IBXC 1FWWA 4G2DA 4BR1A 1UQYA 1DWFM 3BL3A 3ZM8A 3KL5A 3ZIZA 4HVXA 2X2YA 1GG1A 1W2VA 1G7VA 4E4UA 4H9TA 1QPQA 4XBSA 4O8AA 2PWGA 5LIUX 3IVTA 3VGBA 2GQ8A 4GIEA 1SUXA 3B0XA 4A21A 3WJYA 4H01A 4DZHA 2OZTA 1VRDA 3MJMA 3G1VA 3G1RA 3MUXA 2VC5A 3CUFA 2PMQA 4ATLA 1N82A 1XLMA 3QLDA 2ZADA 2X7WA 2YDQA 4YJ5A 3TKFA 3QQ0A 4BHYA 3AHVA 4DAFA 3FEQA 4UFLA 2CZ5A 1OQFA 4FXRA 2PWDA 2E6AA 3BMXA 1IEWA 3AMKA 4KS0A 3RM9A 4AXKA 1O95A 2J88A 1GOQA 2ZDSA 4PL1A 2I5IA 1P4CA 4O19A 4HCLA 1MO0A 1TTPA 4AF0B 1VZWA 4P2VA 2VEGA 5JVLA 3ZOAA 1I1XA 3H2AA 3SUUA 4ALDA 2A6LA 4J27A 3TJXA 4WD0A 3W29A 5LIWX 4RX0A 1TWZA 4L1GA 3ABQA 5HJXA 1ELSA 1P0EA 5AHIA 3I7QA 1FWGC 3E2SA 1PHWA 3PULA 3L68A 3USZA 4GWEA 4AD5A 3CM4A 5IXEA 1TX0A 4N7QA 1Z32X 1TQXA 4RV3A 4PUEA 3RGTA 2WC3A 4E6MA 3W2KA 3I6RA 3KEHA 2J74A 4PTWA 1QPNA 1QO5A 2YBUA 1BRLB 1YTDA 4ZOEA 1UMLA 5KZMA 4NAEB 3U6WA 1P1XA 3UA4A 2WVVB 5BROA 3N1AA 4DI9A 1CZ1A 5BOFA 2XFYA 1Z41A 1IXOA 1PVNA 4JTUA 2RDTA 1PE1A 1VPYA 2W27A 3KZSA 4J1OA 2C1HA 3TWBA 1ZPTA 2CHNA 5A6BA 3MO7A 3ZVHA 2VEFA 5JBDA 3WLSA 3OG3A 2EEXA 3W70A 1SW7A 4TMBA 3N2XA 3GBEA 1KQYA 1OJXA 1X1NA 2FMNA 1NOUA 1KBJA 2EPHA 1UWRA 4TIMA 3W7MA 3MYOA 4GA8A 4GVFA 3B05A 2OSYA 4IWWA 2PA6A 1JJKA 3TDFA 2FZDA 5EMJA 3AS2A 4NT0A 2BWGA 4LUYA 3KUMA 4O12A 3E02A 4GBUA 2G97A 1HGYA 4ZE5A 3T7VA 1JUEA 3QVQA 1UUOA 5FL0A 1V79A 3M0LA 4XZWA 3AIVA 3KRSA 4IQLA 2JGQA 1V7YA 3R5EA 1EP3A 4A2SA 2IS7A 3PBWA 4GZ7A 4S39A 5AHFA 1QCWA 2ICSA 2ZX9A 4PMUA 2QVNA 1FCBA 4EXQA 3WNPA 3GK0A 3B40A 4L4OA 1VFOA 5E09A 5FJUA 5REQB 4LF1A 1FH7A 1FWTA 1RJQA 2BVDA 3L4VA 1UW9A 5CBIA 2CKRA 4GGBA 1Q63A 2O0TA 3C2RA 1FWSA 2PS2A 2DZSA 3EOLA 5JU6A 3W01A 1F3TA 1HVXA 4GY0A 2FVKA 3IVUA 3L4UA 2PDLA 4C6EA 5CSSA 4K7VA 2KZHA 2VFIA 1B3ZA 2V3EA 3EMQA 1M03A 2ZBTA 4LY8A 1OSEA 1OGSA 1SJAA 3R58A 4KEZA 3R2GA 1R85A 3HV9A 4LB4A 1NWRA 1P0KA 3NFUA 4K1GA 5LA2A 3IRDA 1H0IA 5K4XA 1KRAC 4I9AA 1AJ0A 2BGNE 1I9CB 1TWIA 1IEXA 3VKJA 2QYGA 1E9IA 1HKKA 4JS3A 2W79A 4W93A 3DFOA 2A3AA 5AHMA 1V77A 2R91A 1UOZA 2PDGA 2D73A 3I6TA 2X1TA 4FXFA 4HZ8A 3DG6A 3NIYA 3DFHA 4NZCA 2HEJA 4D6DA 1C8XA 5HWNA 1EB3A 1R9ZA 1MW3A 2GWNA 3SGUA 3W6MA 5TIMA 2BY3A 1HO1A 1H62A 1VJIA 4GYJA 3HQ1A 2ZZ3A 4DEFA 4Z2IA 2ZOXA 3H53A 1TWSA 1E71M 1U1UA 2YCLA 2ZZ4A 3FNDA 1UR9A 3N4EA 1ADDA 4F2UA 5XIAA 4E3TA 4BF7A 1E6QM 3SN4A 2GL5A 4Z1CA 3FGCA 3QY7A 4IFOA 3WDJA 1AW1A 1W91A 2PLMA 4IGNA 3A23A 3SJ3A 2X8RA 1ZAJA 3SUWA 2VGBA 1THFD 2W91A 3OVRA 4JYFA 3CUXA 1KR0A 1DQUA 1Z8AA 4QXIA 1J0HA 3TWAA 1JDEA 1XRVA 3CMJA 5D4YA 2HE5A 4H2HA 1QW9A 1JL8A 2PDXA 3N29A 1E0VA 3BAXA 2QMKA 4O53A 4NJHA 3GU2A 3IJ8A 4K68A 4D6JA 1SFTA 1HUVA 3T0DA 1OF8A 4IXXA 3F5JA 1WDSA 3WUBA 1J0ZA 1FWIC 1US2A 3W22A 3N2OA 1Q85A 1GQIA 2HS6A 2Z2UA 4MG4A 1DJGA 2WZIA 3KS5A 3GTIA 3ANVA 3PZNA 3BLDA 2ZUTA 3C2YA 3QW3A 4LANA 4MZYA 3U4FA 2W0UA 3G18A 2ZC8A 1KD0A 2PWEA 3N9SA 1J0KA 1ZL1A 1E6PA 3RMJA 1H1ZA 5CKSA 3VX1A 5E93A 3P80A 2J77A 2YDSA 3ES7A 4LAMA 2FGBA 1G5AA 5LZLA 2E8ZA 4JFSA 5IHRA 4FLOA 3SCTA 4NX5A 3G1DA 3AIBA 5E0FA 1ZZMA 1E40A 1V0KA 4WJXA 4BQ4A 4FEZA 5JBEA 1NTHA 3H4XA 3KOXA 3MMWA 3MTWA 3BC9A 1WP6A 1ALDA 4HMEA 3UPMA 1ISVA 3LK6A 4DJFD 4PMZA 5HJYA 4OIFA 3RNDA 5AB3A 2BOEX 1R30A 3PUDA 3VD9A 1Y8BA 2Z29A 3UWUA 1KFLA 2XSAA 2J8FA 3G0SA 3RPTA 3VNMA 2PI6A 2YX0A 2AKZA 3WMCA 1GWJA 3RDKA 4ZQOA 3KW3A 3W1RA 3F7JA 4YTQA 2G3IA 3R25A 3SY1A 2Y8VA 3K1DA 3RR4A 2CETA 3VFCA 3GVRA 2PGEA 4PEEA 1BG4A 4TR9A 4DWDA 3C3UA 3N6HA 5HPCA 1NJJA 2EXOA 1XX1A 4J2PA 3T6CA 2VD8A 5HANA 2P10A 1HKIA 4C7DA 4I6KA 1UH4A 3LCWA 3VX0A 1UKQA 3M46A 1XFCA 4REQA 1A5CA 3W71A 4L61A 2YA0A 2PD5A 3LYEA 4RE0A 1SJDA 3SECA 1TWDA 1VYSX 1Y5VA 1GQLA 4LGXA 4DELA 2HROA 4PTDA 4O15A 2EO7A 4WX2A 3CIXA 3PG8A 4CQAA 3LSCA 1JCJA 1SVDA 5M03A 1OX4A 2CIPA 4O0QA 3BAIA 1C8QA 2PF0A 2QMJA 4R33A 2PTWA 1YTEA 2OCZA 1UWSA 3VCRA 1B4KA 4WEVX 1JD9A 1A3XA 2HSAA 3LU2A 4HNNA 3WCZA 3GIPA 2PLKA 5T9BG 5AYXA 1Y65A 7XIMA 1JPHA 1TIMA 4XV0A 4MFEA 2FIQA 5TBOA 2B4GA 4HHHA 2ZX5A 2GUUA 4IQDA 5FF2A 4FHAA 4NYUA 4OOZA 4NIRA 4FNRA 1A0CA 3WEOA 2Z1WA 3AZRA 4DWSD 3CPUA 2CWXA 1HFBA 4NZ3A 4XVDA 1KNWA 4MNMA 1FKWA 3ZVHB 2V5LA 2IKJA 3BLIA 4XVEA 3UEQA 3LN3A 4JL2A 4MUPA 3UZZA 1VPQA 1UWTA 3GHUA 2WCGA 3CL8A 2PE4A 3B06A 5K9DA 1GYLA 2BVTA 4HOXA 3CZEA 3ZJ7A 1RVKA 2VGGA 2VR5A 3GDTA 5CSRA 4R34A 4UFMA 5I0DA 1TMHA 4KRUA 2V67A 3BOFA 3N9KA 2OYKA 3T40A 2PEVA 3SO7A 3DEQA 2ESCA 1LCOA 1KB3A 5IHSA 2ZZ1A 2D24A 1S2CA 3EDEA 1CLXA 3E2RA 4HKPA 1EJWC 2DZBA 2PDNA 2ZXAA 4HNCA 2J7CA 4JD4A 3A3WA 4JNYA 4ACYA 1BHGA 4HBKA 4PB4A 4ZE4A 2DEPA 4MJMA 5JMUA 3VIKA 3WX7A 3IARA 2JBMA 2O4MA 4YHEA 3ZWTA 1FWRA 1WUFA 3GD6A 3EWBX 1SFJA 2R1LA 2FGLA 4HPXA 5IRPA 2PGFA 2WQPA 4QGCA 3H7VA 4Q7IA 3JZEA 3PBMA 2JF7A 9XIAA 3GLCA 2V5JA 3QZEA 4B5SA 1FA2A 4UFKA 3F2CA 4Z1DA 4JPGA 2EAWA 1CTNA 4Z1YA 3WK1A 4H19A 3CMFA 2DZAA 1RBAA 2WYSA 3PBGA 2Q3OA 2OWCA 1A5LC 3OOQA 1V51A 4J9JA 4JTRA 4EOUA 4LUJA 3C2OA 2C71A 4QTGA 3UXAA 4UCGA 1IIGA 3RLGA 3WIJA 3QR1A 1XICA 1B54A 4F79A 3PVFA 3DESA 1W17A 2D2HA 5DY3A 3TX9A 3O16A 3KL0A 4RXFA 1HNYA 1XUZA 2QNEA 4Y8FA 4DX3A 3FK4A 3S1VA 1GG0A 3TZNA 1PSCA 3BMWA 3NQCA 5F4WA 3B03A 4X0NA 2DSVA 2VTFA 1UKOA 4AQLA 3TXVA 4B5NA 1W9PA 2ZUWA 4NRSA 1JPDX 3OO2A 4QNEA 1FHLA 3U5YA 3DKJA 2OEJA 1TWWA 2QDGA 3CUZA 4XZLX 3VOFA 2XM1A 1X6UA 3UWZA 5AYIA 1O6IA 2GUYA 4PMOA 1UP2A 1LT7A 2TPSA 1US3A 9CGTA 3LBOA 2E5BA 2WB5A 2UY2A 1ZRQA 1PB0A 4D9PA 2G41A 1B90A 1HKJA 1UYQA 1OIMA 4UBPC 1D2KA 3P60A 4KWWA 3PY2A 1GHSA 1ICQA 5DN1A 1W3HA 3FAWA 5HNUA 3SCOA 1TMLA 3U7BA 4HYWA 2ZXDA 2QKFA 1JRCA 4KIRA 1TVPA 3HPZA 1NDWA 4P7LA 3TJ4A 2YCLB 5AKQA 4S3BA 2IPFA 4P7QA 4C6OA 4DI8A 3C2EA 2PDUA 3S83A 2Y7DA 1XF0A 1JGMA 3V16A 2ZRVA 2PU0A 3DGRA 4NXSA 1A5UA 3EKZA 1AQFA 4KFNA 2TSYA 2YL5A 3FGCB 2XFRA 3R4IA 1MDLA 2P88A 4UTJA 4NNAA 2IMRA 1ZUAX 2NWSA 4JTGA 5CBJA 4CN6A 4E0CA 2IPGA 3INPA 3GY1A 4D8AA 4GYKA 4UQEA 2BHUA 3UWVA 2R94A 1KCXA 3QV8A 4WDWA 4M56A 3R79A 3CEUA 1PS9A 1KFEA 3CZ8A 3WUEA 1UP0A 4PULA 3WF2A 2H3DA 4TQTA 4RK8A 4CCEA 5E1QA 1DKWA 4NZ5A 3KVMA 1MRAA 1NFGA 4KEMA 4TX9A 3QMSA 1V3JA 3TTEA 2C6QA 3GHSA 4D6CA 1QW8A 1R0MA 3H2MA 3FXGA 3E0VA 1CLVA 4O54A 3WLHA 1CXHA 1JUKA 4GNJA 1R3YA 4LAZA 1RHCA 3SADA 2FB2A 2J62A 1AH0A 1MW2A 4C7GA 1XS2A 3WLIA 3LCFA 1F05A 1IQ8A 1VBGA 3A21A 4E8CA 1BWLA 1XD0A 3PUEA 1UA3A 3TLQA 1WB0A 3R1ZA 1HP5A 3VI2A 4A3HA 5LIKX 3UZYA 4PN2A 1UQZA 2DT0A 3UZWA 2J7DA 1AH3A 4WDUA 2E1WA 2Z1BA 1T8XA 3DU0A 3CT2A 1PO9A 3WBEA 3EOUA 1P48A 2Y24A 1LP6A 1JF5A 1QI5A 1WQ5A 2Y85A 2VCAA 4MYAA 1T96A 3QQ1A 3QF0A 3ZT5A 2W66A 3GVQA 1XQLA 1UC4A 3TR2A 5LYRA 3GUWA 2OB3A 4RW3A 2O92A 4Z2HA 1TPH1 2J8TA 1EIBA 3VE7A 1TR9A 3HGJA 3JVAA 3NSNA 3DHUA 2Q8LA 1JCNA 3TSMA 2ZUVA 4IM4A 3GSMA 1EP2A 4KWVA 3OA3A 1VC4A 1ENUA 3TK7A 3CK5A 3B9OA 3PTKA 3STEA 1UBSA 2J79A 5A6MA 1YNYA 1GZ1A 3GXIA 4JBRA 3M6DA 1GGOA 4O4VA 3SSZA 1BXCA 4AIEA 1NQ6A 1G1YA 4Y8EA 2YR1A 5BU9A 1GYNA 3MUIA 2B7OA 4EWND 4GQGA 1GQKA 4JEJA 1CXLA 5E0KA 4D8LA 4Z2KA 4US5A 3QR0A 1S2TA 4ES4A 2VXNA 3MA8A 2ABAA 3LCHA 5EYWA 3HM7A 1XIFA 2BY0A 4GCAA 3IIXA 3AAMA 1FH8A 1B3WA 1P7TA 2OR2A 2Z1SA 4UIOA 2C19A 3CWOX 4JZ5A 3IGUA 5G1TA 1OFQA 2FMOA 1L6GA 1SFSA 5D2TA 1UD4A 4REQB 4YWIA 1YE4A 2VX5A 1XRSA 1BKHA 2DPEA 1WCGA 3LMYA 1BVWA 4Q4RA 3DECA 4PTNA 4GQBA 4HK6A 1KCLA 4C6KA 3AXIA 3HF3A 3MVTA 4QJ5B 3UZ5A 1I45A 4HA4A 4INFA 2X30A 3QZAA 1OX4B 1CI1A 4O17A 3GTNA 2ZZ5A 1OB0A 3IV8A 3UNDA 3EAUA 3B9DA 2YL9A 4LU0A 1Q13A 4CCCA 2QT3A 2GGHA 4OKDA 1ZY9A 1FXPA 4BJHA 1JFHA 3OW1A 4F9DA 4Q8PA 3RJYA 1A5BA 1QBBA 2DQXA 3CHDA 1V3MA 1PEZA 3E2VA 1PXGA 1XIJA 2CLKA 1BPLB 4XQ6A 1IT7A 1MDRA 1FBAA 3FKRA 2QUNA 3UJSA 1E1CA 4F9JA 2FB3A 3UU0A 1XLJA 3LQLA 4OVXA 4UMCA 5HA7A 1DIDA 2P3ZA 3CB3A 3FYYA 4J2MA 4I9MA 3PC0A 2QUUA 4Y9AA 4ZCWA 1NFPA 2VEIA 2GVGA 1M7XA 5FEXA 1XIBA 1JCLA 1C91A 4D72A 3STFA 3VNDA 2WBKA 4LAUA 3TQ0A 4F0LA 3QV9A 4UFHA 1B0IA 4F0HA 2XGIA 1I0BA 4FNTA 1E9LA 3DC0A 3S1GA 5FI8A 3GDKA 2HXTA 2JKAA 2EG6A 4ZEPA 1RBOB 4LJ3A 5L6UA 3GM8A 4X63A 1JDCA 4K8HA 3LBMA 3UR7A 4WIWA 2VNCA 2DZTA 2HPIA 3KP1A 4KF1A 3O07A 4HTYA 4OOUA 3RN6A 4GH1A 3VUSA 2WSQA 3LX9A 1DL3A 1OK6A 5AHLA 1HG3A 1UR2A 3DBPA 3HGSA 4EXBA 1XWYA 1X39A 2GDQA 2PWUA 2G50A 2H3BA 1AL8A 3NZPA 3U5UA 3DHDA 3W1AA 3WENA 4EANA 3W7QA 3LD5A 1KXTA 4DO5A 2CHOA 3OP2A 4S38A 2YDRA 1JZ4A 4IIFA 3LEPA 4F66A 4QCFA 3TYCA 3B9EA 1PZ3A 2VUNA 1EOKA 4AZIA 3SQMA 3L65A 1K4HA 1XBYA 4S3EA 1EJSC 2WM1A 2X2GA 3TSBA 1T0OA 3LI0A 1BWVA 4ZB0A 2V30A 3TEVA 4HB7A 4ML4A 3FYOA 1SJCA 1XUUA 3FJLA 3MKVA 3B4YA 4MWAE 1OGBA 3CXOA 2JKPA 3ERPA 4QG8A 1TA3A 4ZVJA 4MYXA 3EWZA 2ZRWA 3BK0A 3WBYA 4GUIA 4WLCA 5FKYA 3WEMA 5EBUA 3UZJA 3VZYA 2OZ3A 5L9FA 4CQDA 2DJXA 3PWAA 3L4XA 1QMLA 4DJEA 1QTWA 4QBXA 1WDPA 4JICA 3FN9A 4N4PA 1K7EA 1G94A 3OQ8A 4AEOA 1IHIA 3CC1A 3CS2A 1FWFC 1K9FA 4ZL1A 2XVLA 3UG8A 2HV5A 3MO4A 3VA8A 4OV9A 4TXEA 1VJZA 4YU1A 1E73M 3G77A 4WR3A 4A8IA 4HA1A 4GCXA 1BTMA 1SZRA 1T99A 4FZIA 5EBAA 4XZHA 4HYRA 3SIZA 1Z42A 1E0WA 2Q8ZA 3MMTA 2YW4A 2J6VA 4AMCA 1YXYA 2P3EA 5EMMA 4LC8A 2INFA 2PTXA 3W3OA 3W1NA 3IJ6A 3VC5A 4DUWA 4ECLA 1OYCA 1LOLA 3K8LA 1HVQA 4M6PA 4DJDC 1XLHA 5ECVA 2WJDA 3H8AA 1GQNA 2GSHA 2HJPA 4AIOA 1PWMA 3MI6A 1BGGA 3MHFA 1DORA 1W9VA 4A35A 2YDAA 1EJVC 1AFSA 3TA9A 4PUKA 1EBHA 3PNUA 1OCBA 4L80A 4ZOCA 1ZU8A 3SSJA 3JR2A 4CEXC 1SW0A 1C7SA 4PTXA 2W3ZA 4RZ6A 5I5RA 4XX6A 1U1JA 3QKEA 2GGJA 2HPMA 2PRHA 1BGAA 1OX6A 3BJTA 2P53A 1MW0A 2D22A 5D38A 5HMSA 1WOBA 4PCTA 3HFTA 1JDDA 4URIA 1W8GA 4H1ZA 1J93A 1NDZA 3QH2A 4LBRA 2V38A 4FO4A 4ORMA 1L0PA 5E0CA 1ONWA 2G5WA 1NELA 4GRSA 3ARPA 4XBJA 4H4IA 3W38A 1TE6A 3CIWA 3WJWA 3I4EA 1TTIA 2A0NA 5A6AA 4JDBA 5CXPA 3WQ8A 3AS0A 5D2XA 1O5KA 1X97A 4HSNA 2Z25A 5HATA 1VBJA 3FYPA 2FLIA 2Z6JA 4UTTC 4EX4A 1XCXA 3ZS4A 4HA0A 2J13A 1S5WA 3H2FA 1BF2A 2A1YA 1M5WA 1KGUA 1YXCA 3KDNA 3BSGA 1FH9A 2GJNA 3NQMA 3L5LA 1IT0A 2DUXA 2WK2A 3MP4A 4EXAA 4MGGA 2DP3A 2EPOA 5AFDA 3SRKA 3A4JA 2OSXA 1FP8A 2ATSA 1W37A 4B3KA 2VGIA 3AXMA 4FXJA 3E6EA 2HNHA 5FF3A 5BNKA 3PZGA 3HN3A 4Y90A 2OEMA 1MQQA 4M6QA 4IG2A 1SU5A 3BG3A 4KEVA 5DMNA 1FDJA 1FFRA 2VFEA 2J7EA 2JEQA 3VYLA 3VZZA 1DJQA 1E6XM 3LGEA 3BJSA 4HIBA 3E0LA 4Q4QA 4LVBA 3CWNA 5U7SA 1E51A 1MQPA 3QHNA 5AHNA 1UH3A 3O06A 1OF6A 2HMCA 1UKTA 5FL1A 4QE5A 1CGXA 4X60A 4DO6A 2XYLA 3TA6A 1GYMA 4HGXA 3T2PA 1QI4A 3EWCA 4NI8A 3WBXA 1VCFA 4TO8A 2G3MA 3TFCA 5CLWA 3D0CA 3CNYA 3PN8A 4AEFA 4AD2A 4UXDA 4H8NA 4FNSA 2E67A 1WDRA 3W7RA 1GZGA 3SCVA 1B3OA 3G1AA 2HVNA 3ARRA 1K6WA 1FFQA 2BHZA 1P7TB 2QIIA 1WZAA 3P8JA 3OBKA 4DNMA 4NHVA 4GGHA 1G0CA 5CPOA 5F2MA 1UR8A 3E74A 3TYEA 1S38A 5FJJA 1OADA 3PAOA 1S2WA 4DLMA 4LOCA 4WJ8A 1IEQA 3FDKA 1HL2A 1IGSA 4PODA 5F2IA 2P1FA 3IANA 1UHVA 1YXDA 3W7KA 1P43A 3LERA 4J3UA 1Q5MA 3CV7A 5J5DA 2BP1A 2QGHA 2QJNA 4J3WA 1HT6A 1E6NA 1EOMA 2C3ZA 1WBHA 1RQEA 3DENA 2QDEA 3RILA 3A13A 4IIEA 1AW5A 1F9CA 5H1WA 4R7OA 5GQBA 2BZNA 3ME3A 3U2OA 2XIMA 4JTEA 1OFPA 5F1VA 4L6HA 4J35A 3SUTA 1CPUA 2O9TA 1BWKA 4CD5A 1LROA 4WOZA 1N8WA 2VI0A 4IPIA 5D03A 1E1CB 4V1XA 1VGAA 4UNIA 2X16A 3WJZA 1TV4A 1R86A 2QXWA 2P5NA 1RY0A 1JI1A 4LPCA 4W8AA 3U2EA 5C5YA 1A80A 2F2KA 4M1BA 3GC5A 3NQDA 1EUNA 1WDQA 1H7XA 1KBKA 4UTLA 3CO8A 4CQ8A 1F61A 2GSJA 5EFDA 2QPXA 4B4FA 2E6YA 1LUCA 4DQWA 3HGRA 1HKVA 2NXIA 3BGJA 4HD5A 3W2MA 1F74A 2QVHA 4E4PA 3TONA 1BTCA 1LLWA 1UASA 3KHJA 4O18A 1V6YA 1EDGA 4JQ1A 2XWDA 4QDWA 4O1AA 2FFIA 1ZBVA 3N19B 5M3WA 5I3IA 1VIWA 1UUQA 3ALGA 1EGVA 4MB1A 3JZUA 2GK1A 3L12A 3SBFA 3PJWA 2OOFA 2XSXA 2P76A 4HU3A 1YDVA 3R7MA 1ZBWA 2OQYA 3TUUA 4OWGA 3TMLA 1WXYA 4PFMA 4L5ZA 1DYSA 3VK5A 2D0GA 2BBFA 2ZQ0A 1JPMA 1LLOA 2DDXA 1VHCA 3IAPA 3LSBA 3CLWA 1CXIA 1J4EA 3SJNA 3U9IA 1LRTA 2F2HA 2GDVA 4J5NA 4H2CA 3LCLA 4ZOBA 1S5NA 4MY9A 2V5BA 3AALA 1QDSA 4IQEA 1J9YA 3B4UA 2RJHA 5LXEA 1XR2A 2B0MA 3WDQA 1XYFA 3XIMA 1CGVA 1O60A 1TYGA 3GZ3A 5EMUA 1ZS2A 4IXHA 3E5PA 4OFCA 2GVJA 1X7IA 1ZAIA 1YPFA 2WHJA 4IJCA 1PAMA 2WSPA 3ZMRA 2R6OA 4PMNA 2QCHA 4XTDA 2GPTA 1TA3B 1MUMA 4NJKA 5D02A 3NGFA 3NQVA 3URQA 3OJGA 4A2RA 3AIUA 4YTSA 1A5NC 1RA0A 3HPXA 1SSDA 3DGBA 1V6TA 2NQ5A 2VYOA 5GNXA 3H2NA 3N34A 3EDKA 3SRHA 1NM9A 2EPLX 2C0AA 3VNLA 4PUWA 1EYEA 2QCFA 3Q67A 2PDJA 5CGTA 3ARYA 1JAKA 2YCKX 3VUPA 2WWCA 1U5HA 1DTUA 3NM3A 4G7FA 1OABA 1VKFA 1VFMA 4YPJA 4TX6A 3GVVA 4FOUA 4LRTA 3O6DA 1MEIA 3TJIA 3WJXA 1YADA 1Q6QA 4KPLA 4CVWA 4JEQA 5C9XA 5I3HA 1H3GA 1ITQA 2Q01A 5CH9A 3AIQA 3MUCA 3FIGA 4BFAA 4GQQA 2B7NA 3E5BA 5DELA 4QJ4B 1UPPA 3W07A 3KFTA 3SDOA 2PDMA 4QAWA 1P6BA 3W0KA 5BMWA 4DNHA 1XC6A 4GUJA 5TAOA 1CT5A 1SZGA 1OG6A 2ONEA 1SZEA 4S3GA 3W2JA 3N14A 4H6EA 5A6SA 1JZ3A 4F0MA 1YYAA 4NNCA 3POHA 3BG5A 2PTYA 1UWQA 2IPJA 3V3WA 3VKKA 4UTWC 4LQ1A 5ABTA 2Y70A 3BLFA 3MJYA 3ZJ6A 1DOSA 1CWYA 1KCKA 4WVXA 3B9AA 3VVGA 3DFYA 2ZXQA 4O10A 4IT1A 1QPRA 3LRMA 5K2ZA 5HUOA 3RM8A 3L4TA 4WUIA 1Q2RA 2PGWA 5HBFA 2PCEA 1OGGA 4F4RA 3ES8A 3AJ7A 2OSWA 1Q6FA 3UCCA 1IEVA 1R2SA 2VDIA 2WANA 1I2OA 4NILA 3O15A 4CD4A 4IJRA 3TCEA 5C9WA 4G1NA 5G4WA 4KBXA 2XISA 3EDDA 3NWRA 4UTMA 1GVQA 3M6YA 1MRQA 4JFWA 3W87A 2Z2BA 1MUWA 3F4CA 4I7WA 1M7OA 1R3TA 3N17A 3NG3A 3RUBL 2BS9A 3WL0A 4JTQA 3BQ6A 3AYTA 1C9WA 4IG2B 1S39A 3VIOA 2DSWA 3OPSA 4AY8A 1AG1O 1EEPA 1S1PA 5A6TC 3U48A 2NQHA 3EWUA 4DBWA 2DZUA 2RKXA 3G0XA 3MV11 3U57A 1VCVA 1S46A 1FWEC 3H12A 3PTDA 1LJYA 1BEUA 1Z6KA 4HPHA 1D3CA 4AUBA 3A9BA 3APTA 3K4WA 3GHRA 3KVLA 3ZT7A 3BW3A 4GO9A 1GHRA 3D47A 3W72A 2IUZA 1WDWA 4DYJA 4AD1A 1TRIA 1U1HA 3F4NA 5TQLA 4AZ6A 3QMRA 5DT7A 5DQPA 2NX3A 1ONRA 3SW6A 1UJPA 3CH0A 2ZYFA 4C6PA 3QGVA 2Q8XA 1PIGA 2DV0A 4XZBA 1JYXA 2IKGA 3G0UA 3EPMA 2HQAA 3VDHA 2PWFA 2WC4A 2PB1A 3T0TA 1B3VA 3P8IA 2I17A 5T91A 3KBVA 1KRBC 5LSMA 3K8MA 2H6RA 3MANA 1GKQA 3CQHA 4QIUA 3H22A 3MB9A 2VGFA 4C7FA 2J7HA 3WSUA 5E70A 3HG4A 5A8NA 2VR2A 1V3KA 4Q4MA 2VEPA 1RY8A 3CASA 3NL6A 2R1KA 3STCA 5K9CA 4DZIA 1ONEA 4IMCA 5CG0A 1T5AA 5D8WA 1US0A 4OTKA 3B0PA 2H8XA 3P14A 1AODA 2W9MA 4B5WA 4DY1A 4XKYA 3PUOA 3ONCA 1XRFA 4BKNA 5IM51 2F8QA 1EX5A 5G5IA 4B92A 1IIHA 3H55A 3WNNA 2JKEA 3OEXA 3P0XA 1QNVA 7ENLA 3OZYA 2CLLA 3IJIA 4W7VA 4ONVA 4S23A 6TIMA 5CJ5A 2ISDA 1DWHM 1GOIA 3GTFA 2QPSA 3HIJA 1W6TA 3C6CA 1HGWA 1PKLA 4PFHA 4S3DA 4GUHA 4PRRA 2NQJA 4K7YA 3UVIA 3STPA 3IACA 3B8WA 5AHEA 3W75A 4AWTA 4AD0A 1SQ7A 2HVMA 3WO8A 3WLQA 3LLFA 4JTCA 1I1WA 3ZR6A 2HS8A 3OYZA 3RU6A 3H21A 1XLKA 2BXVA 1IE7C 1EJ7L 3NEHA 3GIQA 4AC1X 1C3FA 1ODZA 5H8MA 4PUUA 4YTRA 3GS6A 5I3DA 1HL8A 3N4FA 4O1BA 2YJQA 1PHQA 3G1FA 1ZTVA 5FCZA 1KR1A 4KESA 2DUAA 4IIDA 3K1GA 4HPJA 1ZNNA 3LNPA 3EB4A 4XG1A 1KGXA 2QF8A 2IKHA 3T0BA 1BKSA 2WNZA 2GK1B 3CQKA 4XO6A 1UG6A 3T1GA 1JCXA 5A2AA 5FF7A 5I78A 3W81A 2FTYA 1R46A 3H4WA 2I9EA 4K1WA 3AISA 2E40A 3AROA 3OIXA 1L2QA 4PMRA 1JCMP 3GNDA 4X9YA 1NY1A 1F5ZA 1QBAA 1RP8A 4P61A 2GWGA 3FV9A 1BVNP 3N13A 1DWJM 6A3HA 2WW5A 3BOLA 5EB8A 4E5TA 4O0ZA 1NARA 2Z1XA 2Z7KA 1EZ2A 2XPKA 3QQWA 5I03A 4LEQA 4JKLA 3IK2A 3WH6A 4NJJA 3NDOA 4HSHA 5G4HC 5IOBA 3WQ4A 4MIMA 4N4QA 4E8GA 3ARSA 4AB4A 4HA3A 3S4TA 4LFYA 2AAMA 4QS6A 1TPWA 1WKFA 5ABEA 4BQ3A 2XJ7A 2BODX 4Y9MA 2DZVA 5FOOA 1HJWA 3GC2A 3FVMA 2HK0A 2B7PA 2D23A 3GXFA 1FVPA 1Q3NA 2ANUA 3NA8A 4EVZA 4LUIA 5IFPA 3W27A 4C60A 3EMZA 2DW6A 1CDGA 3LI1A 5HQEA 1VPXA 1J10A 1IF2A 1MXGA 1PCWA 4RR4A 3W2NA 3WYZA 1YDOA 3IAQA 2GOUA 2BB0A 2Z00A 1XLBA 2GJRA 3GFYA 5FSEC 1H2JA 4PZVA 1HJUA 4H41A 2V5DA 4UZSA 3VIFA 4PMJA 1JVNA 4HCDA 1FTXA 3N2CA 3CIVA 2WJEA 5C6MA 3LXBA 4DJFA 5FJOA 1W3IA 3IGXA