1W17A

Structure of bacillus subtilis pdaa, a family 4 carbohydrate esterase.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
235
structure length
235
Chain Sequence
VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROBABLE POLYSACCHARIDE DEACETYLASE PDAA
publication title Structures of Bacillus subtilis PdaA, a family 4 carbohydrate esterase, and a complex with N-acetyl-glucosamine.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 90
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1w17A00
3QBUA 4OUIA 2W3ZA 4NZ3A 3HFTA 3CL7A 2Y8UA 3WX7A 2C1IA 2DFAA 4NY2A 4V33A 4NYUA 5BU6A 4HD5A 3VUSA 4U10A 4NYYA 2QV5A 2J13A 4LY4A 3S6OA 4NZ5A 2VYOA 4WCJA 2NLYA 1NY1A 1W1A1 3CL6A 4NZ4A 1XW8A 2IW0A 1V6TA 1Z7AA 5JMUA 3CL8A 4L1GA 4NZ1A 2C1GA 1W17A 3RXZA 2C79A 2E67A 4F9JA 2CC0A 4M1BA 4F9DA 2XU2A 2C71A 2I5IA 1W1B1
chains in the Genus database with same CATH superfamily
4E6MA 4V1YA 3K4AA 4D8ZA 4HHMA 5A8MA 2G96A 4HD5A 4U3AA 3UZXA 2ZRWA 3C0JA 4LYPA 2CLEA 4PEKA 1F2JA 4CUCA 3PK7A 4XTDA 3TW9A 3H6OA 3EWUA 2A7PA 3MKVA 2W5FA 2NSXA 4GLEA 1JYWA 4FEZA 2X7WA 4DJFA 2D3LA 4C1LA 1X1ZA 4N4QA 4EWJA 3MYOA 4DEFA 4C5YA 4K1GA 1W9DM 3G0SA 1YMYA 5E1QA 1XYMA 3FOKA 4A3YA 3UWQA 3TTQA 4A3UA 1TZZA 5BXRA 3P5ZA 5TNVA 2ISVA 1TCDA 3SCRA 4IP5A 2XGIA 1LTDA 1KC7A 3VDAA 4KESA 3WH8A 4BEUA 1XGEA 5IBXA 1XLJA 2V38A 3IVTA 4JTAA 4HZMA 1G5AA 2VGGA 2NQ5A 1VF8A 4M80A 3Q45A 4GNVA 4M5PA 3E0LA 3WSUA 1UKOA 3WNOA 1PPIA 5I3HA 4LC8A 4DUWA 2VEPA 2Y8UA 3TWAA 3ARYA 2CHRA 4ZB5A 3O63A 4YVXA 3DKJA 1LT8A 1BG9A 3G1SA 3WLTA 4JTFA 4AYGA 2DSKA 2CBUA 2XIMA 1D8WA 3OBEA 2FIQA 1TWIA 1CXHA 3A3XA 5LIWX 5HJLA 3EMZA 3WQCA 4WIWA 4H8NA 2BOFX 3TYDA 4PCTA 1W5QA 4QS5A 4GNJA 3WNLA 4GQRA 4HPNA 3O9NA 1GPWA 3EYPA 2XG9A 3VFCA 1OX4A 2XUCA 4IGMA 4IIGA 1B1YA 4RE2A 3WK1A 3AXKA 2DZAA 4PE8A 4ZO6A 5LYRA 3KOXA 2ZTJA 3FVMA 4GVGA 2OX4A 4O57A 2ONEA 4GCXA 1IZKA 3UJ2A 3NL5A 4O14A 3SW6A 2ZKMX 3RPMA 2QV5A 4CU6A 5CSRA 2YCJA 1NP2A 2W79A 1GK8A 1QI4A 4LUYA 1I60A 5JVLA 3NA8A 4AZIA 3NPXA 3CUHA 1V02A 1G69A 4PMRA 1H50A 3WKZA 4NRRA 3SAZA 5I3FA 3UWEA 2GK1A 2OSYA 3V36A 1H5VA 2PE4A 3CU2A 3UWYA 3NCOA 4GBUA 2INZA 4Y90A 3WJZA 4GGBA 1OX5A 4EAYA 3U2ZA 2CXGA 2FVMA 2WJZA 4G2DA 1WKFA 4H6QA 2B4GA 5C70A 3N3MA 3M0LA 1ZAIA 3IIOA 1GZJA 1EJSC 3AMDA 2P10A 4GJIA 4EPDC 1K8XA 4L6DA 1YE4A 3AXXA 2WMIA 5EA9A 3GR4A 1V6UA 3WYZA 3AMKA 3VABA 4CD6A 4G9PA 3QBUA 3JVAA 2V0TA 2PDGA 1LLWA 4Y9MA 4JTIA 2CNCA 2DZBA 3VGGA 5MKGB 2VX7A 3KZSA 1UUQA 3G1FA 3UJFA 1UWTA 5DCEA 1GVOA 3KL5A 4RXGA 2WM1A 2QCCA 3LDVA 2LLEA 3MT1A 1PHWA 1IXOA 1YDNA 2FH6A 3GXIA 3VPLA 2CLHA 2QCFA 4W7VA 1XF0A 3DI0A 4AISA 5D2YA 1J10A 3IEBA 4LAZA 4MPKA 3G2GA 2PBOA 4TU1A 3ZJ6A 2Z29A 2J74A 4HPXA 1A53A 4B3ZA 1ENUA 3WDRA 5LHFA 4LUJA 2HDJA 4PFMA 2CZDA 2OSWA 3T4CA 2V82A 2C16A 3UZYA 2VRQA 1CDGA 3PWGA 5I3GA 3M64A 3CTLA 1I2PA 3OLDA 2DVUA 4WEVX 3ZLFA 4PTNA 4GISA 4LVGA 2QNEA 5MHBA 3WH7A 3ARTA 3WNNA 2FVKA 3H53A 1S2TA 3AZTA 1XXXA 1K8YA 2A6LA 4O13A 5JBDA 1IGSA 2Y1HA 1E9YB 2FH8A 4BY3A 4HOXA 5AN7A 1AZ2A 1UUOA 3PTDA 4PBFA 3AO0A 3VIIA 4HHLA 3P81A 4J40A 4LTSA 1DQUA 4E4UA 1CGTA 3PZ9A 1DJWA 1M7PA 4OJYA 1XLFA 1DIKA 3QV6A 4CEUC 4LPCA 4JL1A 2IPGA 3SQLA 3W7JA 2ATMA 3C8FA 4D71A 3WK3A 4K68A 3PZOA 4DRSA 2OEMA 5D2TA 2Z1VA 3UGRA 4NHVA 3OQ8A 1J2BA 4QTGA 2JALA 1JZ7A 2OLSA 1QPQA 2EPHA 2WPBA 2YCIX 1HGWA 3E9AA 4TOQA 4H8VA 2WMGA 5JH2A 1RA0A 3VINA 1CXEA 5M17A 3VIHA 3HQOA 2V67A 1KWKA 1F05A 5H8MA 1JI2A 3AHTA 3EPMA 2GZXA 2QUNA 1WDRA 1A49A 4UTHA 4I9AA 4KW2A 4LBSA 4M1BA 3N6HA 5H6HA 4PGLA 1GJUA 3KRUA 3BSHA 3D3FA 4O52A 4DAFA 4C90A 4M6QA 3W7EA 2FB2A 2DH2A 5C2GA 3W00A 5I6SA 1W6TA 4RDZA 1D7FA 1VFOA 3I6RA 5IFPA 1VGAA 1OZQA 2G0WA 1BAGA 2A3CA 4N6FA 1DWFM 4LU0A 2FPTA 4FX8A 4EXQA 4LXFA 2F7FA 3QY8A 2OQYA 3UWWA 1WBHA 1HL2A 4NJHA 1JFXA 4V2XA 2F8QA 4L4LA 1SSGA 2L5HA 4R7JA 5FJPA 3GTHA 5LNVA 1DXFA 4YJ5A 4NI8A 2X41A 1BYCA 3U4FA 1POJA 5DO8A 2VEIA 3LCFA 1A3WA 4ADTA 1OEPA 1D9EA 2I5IA 2ACQA 1NARA 4GHRA 1QU4A 2OKTA 3PJUA 2F9RA 4UTFA 3PZNA 4IGSA 3ONCA 1TMQA 2VFIA 1GOQA 3G1HA 1EA0A 3S46A 3G18A 2CXEA 1KM5A 1VCVA 2WMKA 2C15A 2JIEA 3QJAA 5EPDA 3R0KA 2EKCA 1VFUA 1VB9A 1FVPA 1GKRA 3TOYA 2DW7A 2OTDA 1TCMA 2GSEA 3TZFA 3CS2A 1XHGA 3W07A 4MWAE 3M0VA 3GTIA 4H7ZA 3FDGA 3TNOA 4FMVA 2H9AA 1C7TA 5JQ9A 3IJQA 4WVXA 1A4MA 4S1FA 4JXCA 3WH9A 4MDOA 3U9IA 2ZUNA 1DIEA 3T40A 1C93A 2WHJA 3HJZA 3B0YA 1C9WA 3OLGA 5HWMA 1QBAA 3KXQA 1QW8A 3QVQA 3LK6A 4MWAC 4R9XA 3B8TA 3CIWA 2BWGA 4ML9A 1A4LA 5FAJA 1JZ5A 2NVCA 4UBPC 3B8IA 3AC0A 4HVXA 3G77A 2EHHA 3NPWA 5HUOA 4XZNX 3EOLA 4CVUA 4TIMA 1LM1A 4E4FA 3WQ5A 4GQ0A 5HMFA 1PS9A 3F1QA 3W1XA 2ZZ4A 2YKKA 1K9TA 3EWCA 2PZ0A 1JUKA 5HAOA 5BXPA 1EB3A 2A0NA 4CQDA 3A3HA 2J8GA 1S2CA 4QE5A 4KCUA 3NR0A 4HSHA 3U48A 2PLCA 5BZAA 4W88A 1WZMA 3RHGA 1RALA 2XISA 1JZ3A 3JUGA 1WCGA 1ISVA 1D3CA 1C8YA 2OGJA 3O15A 1OT1A 2A5HA 2VFFA 4UTUA 3I3BA 4GKLA 3ZJ7A 3F4WA 3IJ9A 2QF7A 1DTUA 3DFOA 4LNCA 2Q01A 1AFSA 2E1WA 4QX4A 2ISFA 3T8QA 2FFCA 2TSYA 3NPVA 3VKAA 4A6GA 3FJLA 3SJNA 5AC8A 2VJXA 3DAQA 5E6ZA 3UYCA 1BSLA 1GVIA 2NQJA 1RZMA 4O19A 3VOJA 4DJDC 1GQKA 3TJXA 3P5YA 3PP7A 3USZA 5JMUA 2WSYA 5M3WA 3VD3A 1D3GA 2CZEA 2GDUA 4I90A 1EO5A 3WCZA 2C3ZA 3VGFA 4DNMA 3VILA 1XLGA 4L4PA 1EC9A 1WNOA 3D46A 1ONRA 3RYSA 1NAL1 2HVMA 5HATA 3PG9A 2QPXA 1SM9A 2C91A 2CLFA 3TIMA 5A8PA 1IXPA 3Q94A 1YPXA 3PC0A 3NQEA 4QHRA 2A1YA 3B05A 3NDYA 3FGCB 2NLYA 4R88A 3U8GA 1UW9A 2PURA 2A3EA 3LHUA 1B31A 4J28A 3UPMA 1YXYA 2E1DA 4S3DA 4U2ZA 4AD0A 2P3ZA 3FS2A 3GU1A 3B04A 5SWUA 3GXMA 1RD5A 1FP8A 1PIFA 1NTHA 2BLEA 5ABHA 5DBUA 1RK5A 2YCKX 4X2PA 4CCCA 2P76A 1BF2A 2D2OA 2Q8ZA 3THAA 4AXKA 1W1YA 3UVIA 1J0JA 1VYPX 3DCPA 3VX0A 2WVVB 1K4GA 3BURA 4ORIA 3HIJA 4ZENA 4K8EA 1XKJA 1JDEA 3POHA 2F6KA 3MCMA 1BXNA 4LAMA 5LXEA 4E4PA 3CH0A 4GABA 4Q4OA 5C6MA 1R87A 3L4TA 1UCWA 4O18A 1UWIA 4LALA 3FFSA 4IIHA 1WDWA 4Z0JA 3GAYA 4WKFA 2ZE3A 3VAVA 4C6BA 1KTCA 1T7LA 1K3UA 1ZJIA 1R7OA 4IIBA 3DG3A 4S3CA 3BV7A 3WNKA 3SGUA 2OZ3A 4JN7A 1SU5A 2HXUA 2ZX8A 5D37A 5K4ZA 3TW7A 3NEVA 5C71A 3UPBA 3VZXA 1XYLA 1ODUA 3FEMA 3CQJA 4O1EA 3EDFA 3IGSA 3S6DA 2XIOA 4IL2A 3EMQA 4A29A 2XWDA 3NZ1A 3DC8A 4GIRA 2R8WA 3AWOA 2ZUSA 3M5YA 3WQ8A 5CC7A 2G4FA 5FIPA 1MW3A 3DGBA 2A21A 1H1NA 1UMYA 5IFTA 4U3CA 1IXNA 2F2KA 3E0WA 2QCGA 3O0KA 1TFVA 2V2CA 5DXYA 3F2BA 3EDEA 3HV9A 4DF2A 4DM2A 2BGSA 2POZA 5T9BG 4INFA 4M6PA 1OGGA 4MB5A 3TJIA 4D6GA 5A6LA 3M47A 3I7RA 3F2DA 1MEIA 1JCNA 4UC5A 4B90A 1O5QA 5C0QA 1UR4A 1UD8A 2WKLA 1HNYA 1NOUA 3CYJA 1NWRA 3R10A 3BSGA 1EC8A 3EZ4A 2YBVA 4JR5A 5HR7A 1FA2A 3CV1A 4F2BA 1YW1A 3V75A 4CD8A 4CNNA 4H00A 4UR8A 2XIBA 2ZCGA 3OVQA 4HN8A 3WLRA 3OIXA 3U2OA 2V3GA 1DJXA 5EBAA 2Z6JA 3ZT6A 2CBJA 4DI8A 3EXSA 2C13A 3V5CA 2X8RA 1K7EA 1F61A 1JDDA 3QPZA 4DJFC 3O16A 4ZGYA 4YVVA 1C29A 4EOUA 4KFOA 5G1TA 4QEEA 4DUOA 3KOWA 3KBSA 5REQA 5F2MA 1TTIA 4DBEA 2QCEA 1XW8A 2PA6A 3H7UA 4ZVJA 3ZWSA 4JPGA 2DSUA 4E8CA 2OOGA 3TN3A 1OFBA 5DELA 3OP2A 2WHLA 1JDCA 3FNDA 4JKKA 3G6MA 2AMXA 3S1WA 2IKHA 3SSJA 5IBXC 4X63A 3LHYA 2X1IA 2Q8XA 3RIKA 4HPHA 3S3GA 4LEFA 1P0EA 3QOMA 3LI0A 5HQMA 1UMLA 1GOIA 2E40A 3AS2A 3UR7A 4RPPA 3SCNA 4UQAA 3OZPA 2ZDRA 1XPYA 1FHDA 2D73A 3C0LA 4JNMA 4GQQA 3O6CA 1G4EA 3TR2A 3RX4A 3TONA 4H6RA 4EF9A 4XX6A 4C6JA 1EUNA 4LCQA 3QMRA 2XIIA 3OB8A 4XUGA 5H91A 4CU7A 3T6CA 2FPYA 2FB3A 4NX5A 3WUEA 1GCYA 2EPMX 5BOOA 2VGBA 2WWDA 3UA4A 1ICSA 1DQWA 3N14A 4JX4A 3C0QA 4TXEA 2WZHA 1Y8BA 2GSHA 3W7OA 1A47A 1JVNA 2V6AA 7REQB 2DZWA 3V0TA 2BGNE 4X9SA 3VUSA 1GUVA 4H9TA 1V02E 4LAKA 1AVAA 2RGLA 4YTQA 4JQ3A 1HVQA 4A3QA 3VOIA 3DH7A 4Q8VA 3RITA 3VD5A 4GIEA 2VCBA 2B7PA 1XWYA 4REQB 1JUEA 4AMCA 3GRIA 4PUEA 1EJUC 3A4JA 4QNWA 1OYAA 4HOZA 2QDGA 3HPXA 4FZIA 5E5CA 3I4EA 4W93A 2XM2A 3R43A 3ZQ9A 1GOWA 1YYAA 3U4AA 3KCJA 3TSDA 1IR1A 3GHUA 1KFJA 3FYPA 5BMWA 3W2JA 4YS1A 3P62A 4GH1A 5M5DA 4PUDA 5FD0A 2PRLA 3GM8A 1KGWA 1RY0A 1M01A 4MNLA 2WCGA 2QCLA 3RLVA 3RGTA 2UZ9A 5ECUA 1LG1A 5CSUA 2VZOA 3CUFA 1I75A 3MA8A 4I6VA 1ZB5A 4A8LA 4QITA 3R6IA 3NOEA 2YX0A 5I07A 3NAVA 4GYKA 4Q8PA 1OFEA 1WQ5A 1MFUA 2OZ0A 5D04C 3UF9A 3WQVA 4O4WA 3W38A 3LZ5A 1J11A 4GZJA 3T55A 5K4XA 3SIZA 2J75A 4P7LA 3V4BA 4G5DA 3DFNA 3GTFA 2CBIA 1H09A 3N04A 4J3XA 1SYTA 2C1IA 1V3HA 2I57A 1GVSA 1WAWA 2VC6A 4W5UA 1L8NA 4HA3A 4XKYA 2ZRZA 4KFNA 1IEXA 3PPFA 5AYBA 3N2MA 1EHNA 1U5VA 2QDEA 5G2WA 1CNVA 3IUDA 1KXVA 4X2RA 2X1UA 4B3LA 1Q6EA 2OX1A 1J6OA 3H4GA 3TQ0A 1TTJA 4XBKA 2JF6A 3QC0A 3HQNA 1VPQA 4S39A 1T40A 4JIQA 4ZFMA 1BVWA 1NDWA 5FJUA 3TH6A 5EGRA 3QF0A 2J13A 4DX3A 2JKPA 1V4YA 4GMEA 4LRSA 1FOBA 4HMDA 3KOZA 3DN5A 4YTRA 3LX9A 5HOSA 2ALDA 4DQWA 1R47A 3TFCA 4XBSA 3IIZA 5LA2A 1DWAM 3CAVA 2R24A 2ZYFA 1H1YA 1C8XA 5AVHA 1MUWA 2CPUA 1X96A 4CNPA 3CASA 1AQHA 2E6YA 3W01A 1MI3A 3BOFA 1SFLA 4YN5A 1F9CA 4UFJA 3WUBA 1PZ0A 2VR4A 1JRCA 4R33A 3WDQA 3LNPA 5LA0A 2V5DA 2RDUA 3PBVA 1FWIC 3TA9A 4AVNA 4AXNA 5AYZA 4AWSA 2E28A 5CZKA 2VXNA 4ZOEA 3AYRA 3CAQA 1S38A 4AY8A 1WDDA 1Z3NA 2O9TA 3TSMA 4K3ZA 3L5LA 3LLDA 3A5FA 1TQJA 1YPFA 3K30A 4PB4A 1ITUA 2C79A 3MBFA 1W32A 1EP3A 4KEUA 4OECA 1P6WA 1KFCA 2KZHA 3HN3A 1BQGA 2V5CA 1QHZA 4MHBA 3TVAA 4LJ3A 5HPOA 3VCNA 4JTCA 2YW4A 1EHAA 3HGJA 4LYQA 5D9OA 4CD7A 4XKMA 4NKCA 1HJUA 3T81A 3AAMA 5IHSA 1DJHA 3KCLA 1EWDA 3NIYA 1MNZA 1YHTA 4CD4A 4JTKA 1EUAA 1KTBA 3K4WA 4IIDA 4OVXA 3FDKA 2UWFA 3VOFA 2PCEA 4FO4A 4UQCA 1LRTA 2B31A 3CUZA 5AOUA 1KBLA 3VNJA 2QUUA 1MYRA 3S47A 2V9DA 4M8UA 1TA3B 3S5ZA 1AW1A 2CZVA 3L0GA 3WX7A 1FHVA 5LIKX 4WQ6A 2Z2UA 4Z0SA 4C1NA 3WLHA 2X1RA 2OODA 4XIAA 1XCWA 3GR7A 3J7HA 1GOXA 3K1GA 4ATWA 2FMNA 2AGTA 3TYAA 1CW2A 3STFA 2ALRA 1VC4A 3HFYA 4QGCA 1KD0A 3ZSTA 4HNTA 5EL1A 1TV7A 1W1A1 3A4AA 2E0PA 2BNJA 2YDAA 1PZ3A 4J3SA 4NZ1A 1K7FA 4L6HA 5EB8A 3GYEA 3WD4A 4KWWA 1LOSA 2OQHA 5FF4A 1XLHA 4H9MA 1WBJA 3MANA 1PWLA 2O92A 3ITTA 1TWSA 1WUEA 3S2CA 4N9CA 2Y7EA 2X16A 3K4DA 4GIYA 3T2OA 2J4GA 1F8IA 3ZOAA 4FNQA 4IJBA 1L2QA 3VCCA 3QSRA 4AYSA 1HX0A 1H11A 1UJQA 1G0CA 3DKLA 3PBUA 3GUWA 4B2DD 3U2CA 1XH0A 3UD6A 5A6SA 3QRHA 2ACSA 1UD5A 3PNUA 3VD4A 2H6RA 1XISA 3GTNA 2QEZA 4UOQA 3PBWA 3DHPA 1LRQA 2RAGA 1XRVA 4NYYA 2O9PA 4C91A 4KEZA 2ZRVA 5CPNA 4GXWA 4WHBA 1A5AA 1VCGA 2XGZA 3L4YA 5A69A 1CXFA 1XLMA 3PB0A 4MUZA 1VFFA 2OOFA 3D3AA 1JD7A 1EQPA 1V3MA 2PGFA 4QE4A 3GDMA 1TQXA 4KWOA 3FY1A 4GD0A 3P93A 1UWUA 4O12A 4EIVA 1ZBVA 4MIMA 3RLGA 2VI0A 4DF1A 1RQHA 1C3FA 4ML4A 4Z2LA 4QM1A 4YCOA 2VUYA 1R6WA 4AX7A 1XG3A 4UNIA 4PMUA 4ZO9A 4NUWA 4Q4PA 2PBGA 4RR4A 3ABRA 5A8NA 2OJPA 4E38A 5DRIA 2PDCA 1VH7A 4MUPA 3U57A 1H7RA 1UPMB 4GJ1A 4NNCA 2CITA 1FFRA 1V0KA 1OG0A 1QVBA 3DYMA 4AD4A 1SZEA 3HO8A 4H8UA 4AIEA 4F9DA 3NQ6A 1IHIA 1FCBA 3QKEA 5EYWA 3I4KA 5ABTA 2NQHA 1TV8A 4D6CA 3HZ3A 4W84A 4AF0A 1ZQ5A 3MKKA 1Z42A 1LWIA 3VM5A 5BWAA 3VGDA 3PY2A 1UP3A 1H5YA 4GO8A 1PAMA 2EO7A 1E9ZB 1TJ0A 1M03A 1YPIA 4MKVA 2EQDA 4H9YA 3CH9A 2PTWA 3ABZA 5CAKA 4MB4A 2ISSA 4GK8A 4XK2A 5F7UA 2ABBA 1ALDA 3M1ZA 2DT1A 4X60A 3TFXA 1BHGA 1WXJA 1Z8AA 1W9VA 3JZUA 3WO8A 4GYJA 3RO8A 1C8QA 3E2RA 2W6RA 1VKFA 1BTMA 3W75A 1XGZA 3PZQA 1BTCA 1WE5A 1JL8A 1HKKA 4GY7A 5HR6A 3TA6A 1GVEA 2TRSA 2Q3RA 4I3GA 2V5LA 1EJVC 3LV6A 5I5RA 4RKAA 1B5TA 3CWNA 3R89A 1BD0A 2NXGA 4N7QA 4I7UA 5DT5A 4O1FA 4J3UA 4PUUA 2QCNA 3B97A 3WBXA 4ALDA 3HV8A 2GSJA 3MSYA 4HYWA 1OX4B 1NVMA 3UG4A 2W0UA 1JCLA 4KRTA 2INFA 1XG4A 4RDVA 1AH3A 4NJIA 1SFSA 1J6PA 1JXKA 4PSRA 2QV4A 4I9TA 4BK9A 1VEMA 3BG9A 4LV9A 2Z1BA 1QCWA 4M7SA 1QI0A 1I1WA 4O54A 1FWHC 1CGXA 5GNXA 5T26A 3THDA 3OYZA 4O15A 4QLJA 1SJCA 3UZZA 3R12A 5DT7A 3F4VA 1H4PA 4JY9A 3G1AA 3M9YA 3IJLA 3EB3A 3I7QA 1RCOB 1S5VA 2AGKA 5CGMA 1Y7VA 2D2GA 4BF7A 1QW7A 1I2NA 2O9OA 3I65A 4HSOA 5I3KA 4XD6A 3STEA 2GK1B 3KX6A 4S3FA 3CMFA 3GUGA 5G4WA 1POKA 1EZWA 3VIPA 4Y9NA 4YYCA 4NU7A 3EXTA 4HKPA 4RZ5A 4H9ZA 2OB3A 1ZBWA 3WEOA 4JHOA 1KFWA 3W87A 3MKCA 4DZIA 1WO2A 1XSKA 1S1PA 3CO8A 5AB3A 2QUVA 4KS0A 1GQJA 4U2YA 3SUTA 1AQMA 3WQFA 4I8DA 1W3NA 1MQQA 2AKMA 2QJIA 3W7CA 3KRSA 3R5EA 1F6PA 4HK7A 4C7GA 1WX0A 3MBDA 4AC7C 4UFMA 4IMCA 1P6CA 1BXBA 3A64A 5BRQA 3V7PA 3WK0A 2H8ZA 5AC4A 3IAQA 1UD2A 1VFLA 1IV8A 3I7SA 1QPOA 1GJWA 2YBUA 3CWHA 2Q71A 1DIOA 1HJXA 4B5TA 3SB0A 1ZP3A 1SO5A 3H12A 4FIQA 5LNRA 2XVKA 3ALFA 1CTNA 2PDFA 4MYXA 2A3HA 4UTWC 3MJYA 1ZP4A 2QUTA 1B90A 4C65A 5FJJA 4XZ9A 3NQFA 4HT3A 2B0MA 2VTFA 1XQLA 1LLZA 4I6KA 1SR9A 1EIXA 4IM4A 2CERA 3SO7A 2H3DA 3FJ4A 4MFDA 1KM0A 3C56A 1EH9A 1LL4A 2XYLA 1QMLA 1W91A 1CEOA 1KO0A 4YTUA 2Z7GA 1XLKA 4IL0A 2CLIA 1NFGA 4IGNA 1J0ZA 4J27A 4HYRA 2AL2A 1W5PA 4WOQA 1OIFA 2PP0A 1BKHA 2E6AA 3CB8A 3RAOA 5JBEA 1VIWA 3QHOA 2R82A 4XZMX 3LUTA 1RSCA 1XLLA 2YGYA 2WVUA 4R7OA 3FYYA 2ZRXA 3N2XA 4GI9A 4AFYA 2X1SA 3C6CA 4JAWA 3BV4A 4NF7A 1G4PA 1YIXA 4Q8NA 1PYMA 4OIFA 4WKAA 5T8GA 4ADUA 3HF3A 3IK2A 1V8EA 1EEXA 1D3HA 1XC4A 2IPWA 4RV8A 1QNSA 4UOJA 3W73A 4E2BA 3MI2A 3QM3A 3GNDA 3BLIA 3TZNA 3L9CA 1MNSA 5IRPA 3B0UX 4Q8UA 1KKOA 4MNMA 2DJXA 1ADSA 1J8VA 4LSBA 3GK0A 4AZCA 4DUVA 3DG7A 2OYLA 4DPPA 4Q8OA 1P0NA 4XB3A 1G1YA 1AUSL 3B9NA 1JYNA 2YFOA 4AHQA 4NVTA 3UGVA 1JYXA 3R25A 3CZJA 2P50A 1TPB1 4H04A 1B4EA 1JJKA 2WMJA 5IXEA 1AQFA 3PJWA 2WO5A 3P82A 4S23A 3W7PA 4CQ8A 1E6QM 4ONVA 2YOCA 1TYGA 1XLEA 3C3NA 1XIHA 5BCAA 1O94A 2WMHA 5D2XA 4PRRA 1H41A 1J4EA 4FIRA 3PSWA 5C54A 3DOPA 5HA7A 3TROA 3GH7A 6ALDA 1DOSA 3OJGA 2DZUA 3LTSA 1XUZA 3OVRA 1F6KA 1OC6A 5E0FA 2PF8A 5GNZA 5HNNA 2ZC1A 1ME9A 4LBRA 4NYUA 2WQPA 1NM9A 4RK8A 2RGMA 4J1OA 5CJ5A 3RNDA 3A6OA 3CZLA 2WKJA 2V5BA 4JYEA 2YCEA 4FAMA 3G1YA 3B4UA 4WJXA 3PTKA 1EGMA 4IXXA 3BAYA 3ZR4A 2VC5A 3VFLA 2BB0A 1VCFA 3AYTA 3JU2A 1XBVA 2J7BA 3MZNA 4US5A 2C19A 4MMWA 4HCDA 4DPQA 2YXGA 1IEIA 2FPVA 3OVPA 3WJYA 1J18A 4AWUA 3LHVA 3NYDA 4P8XA 3L5AA 2WAGA 2G3FA 3DEQA 1HO4A 2PDNA 3ITGA 1VLIA 3EAUA 2PD5A 1NP0A 1EYWA 1GYMA 4MJ2A 1PKLA 1OK6A 1UP2A 2O9RA 5AYXA 4JYDA 3E6EA 1PBGA 2FZDA 2D1ZA 1I0BA 4ERGA 1F7BA 3DX5A 4MZ1A 4LYRA 4UZUA 5CPQA 2I7GA 2IKIA 4PODA 1TSIA 1NFPA 2H90A 1GNXA 3KTCA 2CKSA 1KBBA 1ZJAA 4TVCA 5HQEA 3W1QA 2PSNA 1JR1A 1M53A 5DN1A 3WL1A 3LGGA 1B30A 1E0VA 1WXYA 3SURA 3R0UA 5FL0A 5D32A 1ZNNA 4KQNA 3CHEA 1JPHA 3KOYA 3M5ZA 1WA3A 3ELFA 1JEZA 3LG3A 1ICQA 2GFTA 1XIGA 1S5TA 1Z89A 2OLAA 5GPRA 4GVHA 1KCZA 4GY1A 1HQTA 4MB1A 3GU9A 2RFGA 3WJSA 4AB4A 3K5XA 3VIOA 4CN1A 1TIMA 4Q3MA 4O50A 1DYSA 4C6PA 4D6JA 2Q6ZA 4TV5A 2O4QA 4L56A 2O7QA 2VWSA 4HBKA 4PBEA 1J9YA 3II1A 4KWUA 1BG4A 4Z2GA 4K36A 1P1MA 3Q4DA 3N9SA 2Z25A 3VMOA 3CL7A 4IQLA 3IVSA 4W7WA 3IV3A 4PBGA 3NQMA 4H1ZA 4TVUA 4TX6A 3ITYA 4FLSA 1CWYA 3UJEA 3L21A 4C5ZA 3QTGA 1VZWA 3APTA 2G8ZA 5AZ1A 2QKFA 3UR5A 3RCYA 1SQ7A 2PDWA 4HQVA 2FZNA 4Z42C 4IFKA 5CC3A 4IUGA 3SJ3A 1S46A 9XIAA 1TJ1A 2OCZA 1PX3A 3ERPA 1EP1A 4H2HA 2V5JA 3PULA 2C7FA 2AQWA 4NG3A 1N8FA 3EA3A 2Y89A 4GYFA 5D4YA 2CU0A 1ZS2A 3TTYA 1S2UA 3DFPA 3NO3A 3GG0A 2WC4A 3CL6A 2V30A 1RBLA 1XYAA 2NQ9A 2VC9A 1E4NA 4E8GA 2PRHA 1PEZA 1KFKA 4RDYA 2DUXA 3B9EA 2YCLB 3W82A 4IX0A 1VBUA 3VMPA 3VU2A 4F0SA 3LBCA 5ENLA 3CZ8A 1CPUA 1RP8A 3U7BA 4RLIA 1OFDA 3EOSA 3GNPA 2PDMA 2C71A 2DVXA 3VGBA 1K9FA 4KFPA 3MUCA 3U7VA 4ERIA 3GIYA 4WXZA 1EGVA 5DBTA 3VIFA 4LY4A 1BYAA 2WKGA 2HE5A 1XV8A 1I2QA 4YHEA 4ZB2A 4V27A 1EGZA 2FHFA 2DJLA 3PANA 4Y96A 4LCSA 2Z1XA 3UVAA 2F6UA 5D9PA 2XVPA 2PDKA 3GYCA 1BKSA 5CPTA 4KETA 1XIDA 4QJ5B 2VT0A 3L4ZA 1X98A 1YADA 4Z2KA 4JD4A 1K7XA 1LBLA 4DB7A 1IEWA 1QRQA 3VNLA 2XN2A 4Q4QA 3P60A 1PDYA 3GFZA 3NOYA 2GL5A 5CZTA 1WDPA 3BARA 4C6IA 3GNXA 1J0KA 1JFHA 3MV01 1SJAA 4B5VA 1S5NA 1DQXA 1AW2A 2ZZ6A 3E0FA 1GOOA 1W3LA 5G4HC 3RLUA 4GUHA 3KTXA 3GH5A 1R5YA 2QIIA 3CZKA 2D20A 5DLCA 4DELA 1QOXA 3ITVA 1DXEA 2Z1SA 2WNWA 1OF8A 3SM0A 2Q09A 5CQ1A 4NZCA 1UKPA 2DZPA 1UZ1A 5FL1A 4Y2WA 4ICMA 1VFHA 3C3UA 1WDQA 3WH5A 4NJGA 2VGFA 4FXFA 1JXJA 5FAGA 4WF7A 2BX7A 3A13A 4M1RA 3R58A 4M7TA 1PZ2A 3W6MA 4F40A 1EYEA 2VFEA 1TWZA 3AIWA 4R9OA 3E2QA 3U6WA 3PFMA 2Y0FA 2EAWA 2WV8A 1PV8A 4UTKA 1GONA 1ESWA 3H70A 4PTMA 3TYUA 3GHTA 3MJMA 4J3VA 3K8KA 5HNTA 4O11A 2XZ7A 1LQAA 3PZMA 3EOEA 1T99A 1ZENA 3UYIA 3QOKA 3KWSA 2AOSA 2DUAA 3FXYA 3O0FA 1UWSA 1U83A 4Z1YA 4O8RA 3ORWA 4A2RA 3IRSA 3S1VA 1RLCL 4UFKA 4E5TA 4QJ1A 4O8AA 3NZPA 5FI8A 1VD6A 3M0IA 4UTMA 4GC4A 1OD0A 3WDIA 1XX1A 3R8GA 4W89A 1UOKA 1ZCOA 2J62A 1IXQA 3BMWA 3PZTA 4MWAD 5AHFA 3MUY1 3OGVA 5D2WA 3WBYA 4AVOA 5K2ZA 3N4FA 1E4LA 5BU6A 3GVQA 5H1WA 1P1XA 3BW3A 2YDSA 4K8HA 1NEYA 3BTNA 1KTNA 3SRHA 1QWKA 2QYGA 1UQZA 1J12A 4HGXA 3CT2A 4JKMA 4UFLA 1XRTA 4C6NA 3CT7A 2HNEA 4AMAA 3S5NA 3W84A 5REQB 3KUMA 3LXAA 4IPLA 1UR3M 3O07A 2HVOA 3W9ZA 3UNTA 2GGGA 1R3TA 1PSCA 1XBZA 2OG9A 3ABSA 2R1MA 3LV5A 1XDJA 3B03A 4X0NA 4JCLA 2W67A 2ADAA 3UXKA 3OYXA 1JZ4A 2OQLA 3P8IA 3AHXA 4OT7A 4LEQA 3QW3A 1QPNA 3E74A 1PYFA 4P5UA 4NAFA 3MP5A 2GUBA 3UZWA 2KAUC 5FACA 4GGHA 1P0KA 2QVHA 3JR2A 2A7NA 4MWAA 4ZMGA 3SRKA 3FEQA 2W4XA 1LRNA 3R7MA 4TMCA 4EANA 3C8NA 3VNYA 2B81A 3P80A 2P1FA 4DJDD 4DO7A 1K4HA 2QJHA 4JX6A 1FWWA 3ARWA 1Y5VA 2W63A 1S5WA 3L7RA 2EEXA 4ZQCA 2WLZA 3E0VA 3KDOA 4W8AA 1TUFA 2VOTA 1U22A 3BZJA 4Q6JA 1R3SA 3IRDA 2ZUUA 3AICA 4PMYA 2BHYA 2R6OA 2VCCA 1JDAA 5I3JA 2F61A 3D0CA 1LOLA 1SZGA 1QHPA 2Z1KA 2BZNA 2BXZA 4W7UA 1SO3A 4GUGA 2H8XA 1LBFA 1R2RA 1DKWA 3VDGA 4QNEA 5EMKA 4TTUA 3ZMRA 4PULA 5CPLA 2E67A 4JDBA 3HPSA 2J7FA 4H7VA 4HZ8A 2CZFA 1EL3A 2EF9A 2VFHA 3O7UA 2DU2A 1EBGA 1B3WA 4XAYA 1H51A 4AG0A 3NFUA 4DBSA 4DWSA 5CPOA 4Y8FA 1JGMA 3CL8A 3UR2A 1QTWA 1SSDA 3MHUA 3CZEA 4AIUA 1BWLA 3GH4A 3UFYA 1VBRA 5ABGA 3OLEA 4DJEA 1BEUA 3BAIA 4GXMA 4B5NA 4JIIX 3VO0A 3KVJA 3MUXA 1FRBA 2O7SA 3W25A 1H7NA 1AJ0A 1OFRA 1M3UA 2J7CA 1P7TA 4KBXA 3MB9A 4U33A 3B9AA 1CLKA 1FWBC 4DY1A 2VKZG 3QHMA 4YCPA 1V3KA 4F4RA 1JG9A 4A3RA 3OGRA 5G2IA 4H3DA 3TMQA 3O6AA 3N19B 3EWYA 1B57A 1CB2A 3UY7A 3APYA 3LGDA 2VEMA 3B0XA 2V69A 4AX6A 3B8VA 2HPMA 3MSGA 3OHMB 1PKNA 3EBVA 3LBOA 4BQ5A 3M5VA 2OEJA 3NO5A 1T6MA 1YRRA 4N02A 4PUKA 4QDWA 2CYGA 3IJ8A 3W1RA 2WZEA 4JQ4A 4OBTA 3WF3A 3NDZA 4CGTA 2WSPA 3NZQA 3C61A 1JNDA 6ENLA 1UYQA 3EDKA 4HYVA 1Y65A 1TVNA 3A4WA 4WUIA 1YBQA 4O53A 1E9IA 3JRKA 3S6TA 5CZSA 1V7AA 1TV5A 2NW0A 3V16A 2FZMA 1TKKA 3M5XA 1LL7A 1EX5A 2GDQA 2OMAA 2X40A 1E70M 4GWEA 1RCQA 5DFAA 1SJDA 3TOPA 4JTJA 4XKYB 2ABAA 4Q8QA 2WNQA 3WBAA 3M46A 2PTXA 2PDPA 1RY8A 3LOTA 3QKZA 1UKTA 4CNOA 3A21A 4GZIA 1OGSA 3HU7A 1AODA 4JFWA 3N18A 5LZLA 3LMZA 1R3RA 4XD3A 3F4DA 1L0PA 3S6OA 2VEKA 1PTAA 3KL0A 3IUHA 3PR2A 1OFAA 4JIHA 1W37A 1UJPA 3A24A 3B8WA 1J93A 2O4MA 1QXLA 2WHKA 4PUMA 5GQBA 4O1AA 4R27A 3WFLA 3ZS4A 1FCQA 3M41A 1Z44A 3H2OA 3IJIA 4JX5A 4QSHA 1TPUA 4GX9A 1TO3A 1JI1A 3BAWA 4NQ1A 1A80A 3MYPA 2WCSA 2WPGA 4V1XA 5C7VA 4OU1A 4XUYA 1IWAA 3Q58A 4L1WA 1TIWA 4GZEA 2GQAA 2RJHA 3P2VA 1UR2A 5C9UA 2FJKA 2NVDA 3MZ2A 3I68A 3LY0A 2VOMA 1KB3A 3F7JA 1JZ8A 4WY0F 1Q6CA 4GVIA 3R2GA 1DHKA 2BFGA 4DXXA 1NH6A 1EJRC 1PO9A 2BXVA 1HXJA 2FZBA 2FYMA 3C0SA 4DZ5A 5LKYA 3RFAA 2FTYA 4KH2A 2DY3A 2CLOA 3TXVA 4UQDA 3GBDA 5AC6A 4HK5A 3KBJA 1GKPA 1XH2A 1E5NA 3WLLA 1CLVA 1F4AA 3K2GA 2ZX7A 5IOBA 5AC5A 3LERA 2B7OA 4U5KA 3TN5A 4MVAA 3AS3A 4NZ3A 3TTSA 3VKKA 1X8CA 5FF3A 1CGVA 4IP7A 4J2PA 4OV9A 7ENLA 4B92A 3GKFA 4AUBA 4M0XA 7TAAA 4IPJA 3VNIA 1E6ZA 1FXQA 2J6VA 3G8RA 2J24A 3B0VC 1RHCA 4I5RA 4ZQRA 4JTUA 3OG2A 3DFHA 1X97A 1EJTC 4UWMA 4J3WA 4ZSTA 2G3MA 4KRUA 3W7IA 3SN1A 3WDHA 4AD1A 3O1NA 1IF2A 4KPLA 3MWCA 1EDGA 3MV11 2WHMA 2BDQA 1DEDA 4O16A 3W2MA 3W3OA 1EFZA 1NIUA 1RXOB 3G5EA 1LWJA 1FP9A 1M41A 3E2SA 3W26A 4UR9A 1OFPA 3SBFA 1H7WA 5G1MA 1PDZA 3ONBA 3W6YA 1TZ7A 4H4IA 1E1FA 1OCBA 1V79A 4IQEA 3P14A 3G3MA 1EOKA 2XSAA 1R30A 3BOXA 1WZLA 3LA4A 4UQ9A 4KRZA 2J77A 3GU2A 3VNDA 1NDZA 1P0DA 3QV7A 2OPJA 3ARRA 2CFFA 4HNUA 4GI4A 4C1NB 5G4EA 4A4AA 3QLDA 2ISDA 5I06A 3WF1A 4X61A 4WKHA 5DRCA 1K70A 4L61A 4XV0A 2X7VA 5A3HA 3RF9A 4HHPA 4FR6A 4JICA 1BPLB 3CXOA 4CEXC 2G3NA 1CIUA 5DMLA 3TR9A 3F5KA 4PH6A 3ZVHA 1THFD 3IAPA 1L9WA 1KWGA 4LH8A 3QLLA 2C0HA 3AMLA 1XIJA 3BAXA 1V0LA 1UR1A 3CO4A 2UV8G 3V18A 5I03A 4QIUA 4MOZA 5F2LA 3VYLA 3VMNA 4OV4A 1FH9A 4C6DA 4AZHA 3G1RA 2YDRA 3QW4B 3ITLA 5LNWA 4AZ5A 1GW1A 1UG6A 1FKXA 1IZCA 1DE6A 5H8PA 2ZOXA 2G3IA 1TPDA 3GC2A 1C9DA 3DHUA 2WZIA 2ESCA 1MW2A 3IJDA 3AFBA 3BMVA 3G8EA 4N42A 4NI3A 1UA7A 3DUGA 2DT3A 3GW0A 1JCJA 3N6JA 5D03A 5CEWA 3TAOA 3UESA 5I7GA 5I2UA 1RV8A 2QHAA 1TE6A 1A50A 3DU0A 4M29A 1VENA 1N55A 2BGQA 2WC3A 3SQMA 2YZRA 2DUZA 1US3A 1BVZA 2WWCA 2IQ0A 1YTKA 2NQLA 4AAJA 1FKWA 4Z17A 1W3HA 3H2MA 2R1LA 3B4YA 3VIJA 3FA4A 1VBGA 1X1NA 3NJ3A 3BL3A 4H9UA 2IW0A 2P8BA 3NNTA 3GDTA 1YXCA 1G94A 1KQZA 5D30A 1JIBA 4WR3A 1IR2A 4LCRA 1U2YA 2AL1A 1F76A 2GOUA 2J88A 2REQA 4ZL1A 2PCQA 4DYJA 1R85A 2FZ8A 5I77A 3ISIX 3N4EA 4ILSA 5CG0A 2FHCA 3L23A 3EX2A 2PLMA 5JXQA 1D7KA 1KBKA 3CLWA 1UOZA 3IIXA 4NSBA 5EBUA 3PNZA 4IG2B 4K7YA 3I3DA 3VOHA 1YDYA 3RU6A 4QG9A 3JS3A 1NU5A 3LRKA 1NOFA 4WCJA 2PU1A 1HL9A 1VLWA 4DYEA 1IT8A 2V5KA 2AMGA 3FW6A 1DJZA 2VEGA 2NX3A 2MANA 4IHCA 2VP8A 1MUCA 2C1HA 3EKLA 5FEZA 3M0XA 3NUKA 4UQEA 3WDPP 3WLSA 4EPKA 4GPNA 1YDVA 1MSSA 2BHZA 3GR8A 4W87A 1EXBA 1HKVA 2QJGA 3M4HA 3EKZA 2X05A 1UR8A 3ZYZA 3WBWA 4O1BA 2FMOA 3EOOA 2BY3A 1EKOA 3GVWA 3SN0A 1UZHA 2V63A 3ZXWA 4LRTA 4BQ2A 1QNRA 4IJRA 4XAPA 3TQPA 1F3EA 4ZXOA 1CX9A 3BLLA 3N17A 1G9HA 3M7SA 3QQWA 1O6IA 1D8CA 1W5OA 4AZGA 3FA5A 1VQTA 3KS5A 3WQGA 4BFAA 1CI1A 3BQ6A 3CYVA 1Q6OA 3H4XA 4L65A 1BVNP 4A2SA 1JGIA 2CWNA 3GFYA 1FX6A 1OT2A 4O1DA 3SGZA 1JPIA 3UZJA 4DZAA 1UR0A 1A5LC 1V3JA 3T44A 2O0TA 2YIHA 1OY0A 4CNSA 3XINA 3SADA 1X8FA 2O56A 3WQPA 4MNKA 5M1TA 1V5XA 2GQ8A 2J9ZA 4BS0A 3ALGA 5CH9A 2OFJA 1B9BA 2PDBA 2R94A 5TIMA 3GIPA 2D0HA 2EJAA 2A79A 2QAFA 3SY8A 2DZSA 3W7NA 2VUNA 3MP3A 2QCDB 3KW3A 1A0DA 1LT7A 1QI3A 4B4FA 4IMAA 3RM4A 4JIPA 3UETA 3LHZA 5J5RA 2DZVA 3SEPA 1LLOA 3PS7A 4AHPA 5D8ZA 1K6AA 5GJNA 1ZBCA 5HXMA 1E73M 4IFRA 3RK8A 5D02A 3KP1A 3GLCA 3BGAA 5C8BB 5F2IA 2PPGA 1H0GA 3CEUA 3L68A 2E5CA 1GQIA 4HN4A 3MMUA 3M0HA 1NDVA 4X3ZA 3N13A 3VUPA 4IZGA 1PX8A 4DN1A 3FCPA 3WLNA 1MRAA 2BASA 2FJUB 1AJZA 5LA1A 1V3IA 3LSBA 4J5NA 4L80A 5AYYA 3RDKA 3WLPA 1I8JA 4J4KA 3TCEA 3W2KA 4KGLA 2EGZA 3KHDA 1HTIA 2OT1A 1EEPA 4DBWA 3N2CA 3V0UA 3GHSA 1XLIA 3WF2A 5HUPA 4WDXA 4B5UA 4NT0A 4MGGA 3BLDA 4H6EA 5BRPA 2WM0A 3M7WA 4H9VA 3O05A 3FJ6A 5BXTA 2YXOA 5CJNA 2BVYA 1OFOA 3UXIA 3PWAA 1KXHA 5KETA 3W02A 2YYUA 4PTWA 3N9RA 1V08A 3AU2A 4LANA 3AWNA 3OODA 2DIKA 4ZODA 4LS1A 1RLDA 3TTOA 5DMYA 1UHVA 2UY5A 3N12A 3CJPA 2XVLA 2YLAA 2PWEA 1LCOA 3WJXA 1J2WA 1Z6KA 4IQDA 4PL2A 2XVNA 2A6NA 4V28A 4K7VA 2PMQA 4FALA 2R91A 2VD9A 3E02A 3OO2A 3LPGA 3ECQA 1QK2A 1QI2A 4K37A 3ARVA 3Q65A 3THQA 1BGGA 1GHSA 4LUSA 2OWCA 2FDSA 4Q8TA 2G37A 4PR4A 4C6QA 2B7QA 4FX7A 4M6VA 2XINA 1H1ZA 2E09A 2EXOA 4JIEA 3FK4A 3TMLA 3IS4A 1A5SA 2V2HA 1X1OA 2HPIA 3SQSA 2CW6A 2I14A 2ZADA 3GFXA 2A3LA 2XH2A 3B8UA 3MY9A 4MKSA 4ICCX 4P7NA 3HQPA 1LJYA 4AY1A 3T08A 1F6YA 3DHDA 3SCQA 3VVGA 4YL2A 1TUXA 3T0TA 4D1IA 2PD9A 1A5NC 4L1XA 4M51A 2AL2B 4JFUA 3TE9A 1XICA 4LF2A 4JZ5A 7REQA 2PLKA 3POCA 3TXZA 2WJDA 3AALA 4LVBA 4M19A 4OWGA 1QOQA 1JPKA 4PB5A 4F2TA 3ZLHA 2FGZA 5K3VA 1H7XA 3UWUA 3CZGA 5C9RA 2GUUA 1PB0A 4ASTA 1QASA 3T8LA 3EDDA 4AZCB 3V3WA 3BZGA 1J5SA 5CXPA 3DFQA 1GOMA 3CIXA 3LQLA 6A3HA 2YL5A 2BV9A 5EFFA 2QLYA 3MSRA 4ENLA 1T96A 5FF0A 4GCAA 3CLMA 3S4TA 2ZDSA 5HULA 1AMYA 1K9DA 1JZ6A 3W71A 4DWSC 3P0WA 1U5HA 2Z2AA 3IVUA 2HSAA 4CCZA 1PHQA 3PAJA 2ZZ3A 3L4WA 1E72M 2IXUA 2OZTA 4XD4A 1G6CA 4PL1A 3T2PA 4LAUA 2Y4SA 1IZJA 3ZR6A 1FWAC 1QUMA 4DJEC 4GG9A 4IOTA 1Q7QA 4OOZA 3DIPA 2NX1A 2GWNA 1W1TA 1KBIA 3UT0A 3B8DA 4TR9A 4HPJA 5LXXA 4Z1BA 1A3HA 3WQDA 3GXDA 3T7VA 2YW3A 5GNYA 1KLYA 1P43A 3M16A 4JQAA 3U5UA 1NELA 1W8GA 3EGJA 2WZTA 1EBHA 3GD6A 2J8TA 1V03A 1F07A 4KIRA 4LVAA 1UROA 3S2NA 5K7JA 2GJLA 1CGUA 3W23A 1WKEA 2ZQ0A 2NV1A 2VX6A 4HK6A 4GUJA 1GYNA 3UNDA 1PVNA 2G50A 4G8TA 4HMCA 1L6WA 3V35A 1CB7B 1RUSA 3RLHA 1N8IA 2PWVA 1KRBC 3FX4A 4HHHA 1GVYA 5GJPA 1TR1A 1O5RA 3N9KA 4GKTA 3N2TA 2BY2A 1UB3A 3EMCA 1PCWA 2PLJA 1KM3A 1REQA 1SW3A 4FHAA 1PTGA 5HJYA 4JNYA 1E43A 1XJBA 3H2NA 4ZOCA 4UTTA 3CHDA 1EO7A 3STGA 4QRNA 5KTLA 5A6BA 2ZXAA 1A5CA 2VMFA 1VHNA 4TX9A 2VDHA 2V81A 1OGBA 4W86A 1L6YA 3VOCA 3CWOX 1E1CA 4ZTXA 4ZR8A 3VOGA 2DPEA 2XSXA 4J9JA 4WGXA 4GQGA 3RMEA 4B9ZA 2ZRYA 5DCBA 5HANA 3LCLA 3DXIA 2R1PA 4M56A 3LLXA 1ZBKA 1FH8A 3LS9A 1W0MA 5FF7A 3QY6A 3BMXA 4CU8A 1W2PA 1W5NA 5U4NA 2BOGX 2QW5A 1MO0A 4P8WA 1VAHA 2ZUMA 3B9DA 2VR5A 1DJQA 3OTRA 3NXLA 4HTBA 1EP2A 3KM8A 3AQUA 1LDCA 4RE0A 1XP3A 3ZR5A 1F3WA 1EJ7L 1QPRA 4HPGA 1GYLA 3LXBA 4Z2HA 2MUCA 1F4HA 4ZXLA 3TU9A 4IMDA 1L2UA 1H2JA 2P3EA 1ML1A 3INPA 2ACUA 4XTIA 3W7MA 4EP8C 3ANYA 5XIMA 1PCKA 4H2CA 2ZXDA 2GGHA 5A6KA 3W2LA 4FXJA 1ZUAX 3WY1A 1YNPA 5E93A 3RXZA 4XAZA 3OA3A 4Z1DA 4I5XA 1ONWA 4B91A 5DY3A 3W24A 4FNTA 1AA1B 1SFJA 1FWNA 4LAOA 5H2ZA 1HJVA 4GI6A 3UCQA 4AWEA 4DNHA 2BXYA 3MUAA 5KSWA 3EWDA 1I4NA 1ZALA 3GG8A 2X42A 4LY8A 4DF0A 3N29A 3FJNA 3ABXA 2PDUA 2ZX6A 2X30A 3C2EA 4E2OA 4LFYA 2DORA 4AWTA 1UQYA 5K9CA 3EX3A 1TVLA 4HB7A 5IDIA 1NQ6A 4XO7A 3N1AA 4FOJA 2NQZA 4IPIA 2X0HA 2D24A 2HNHA 4XISA 4B15A 3VM7A 2E5BA 3W4RA 2OLHA 4FXRA 1V0MA 4IFKB 3IGHX 1BQCA 4UTWA 1TRIA 1WZAA 1Q13A 4ZQNA 3BSMA 2EPLX 4JS3A 4G6CA 1G4SA 2GVLA 2WNZA 3NVDA 2VZTA 3BDKA 3A23A 5BMXA 1XL9A 4JFSA 1OM0A 5TD4A 3LRLA 3F4NA 2INEA 1ADOA 4AQLA 5TBOA 2JBMA 5FEPA 3PBMA 1XC6A 1T41A 2ZC8A 1UIOA 5F1VA 1OJXA 2HXTA 4EX4A 5FSEC 4MY1A 4ROPA 4Y6GA 1GVQA 4LS2A 3T42A 5KZ6A 5HMSA 3KVKA 5EMMA 4OOUA 4KCTA 3KCOA 1TMHA 3GVGA 1A3XA 3P7YA 1GKQA 4QQ3A 5CCZA 1E15A 3H2EA 3CV7A 1QNVA 4LUTA 2Z2BA 3V1HA 2Q02A 4L7ZA 3W2NA 4IFOA 3LCXA 1KR0A 3V5FA 3KBNA 1AMKA 2E8YA 2J25A 1TX0A 2OO6A 3E38A 4BI7A 2PWHA 3UPWA 3U2EA 1HN1A 1WOBA 2BODX 4R7WA 4L64A 4B4HA 4HNNA 2GOKA 4GUIA 2C8NA 2PU0A 2ZBTA 3IJ7A 3CEPA 4Y9AA 4IH3A 1IWBA 2NVAA 1EF2A 3ANVA 1H0IA 1DORA 5HBFA 3L0NA 1TJPA 3AXMA 4PTDA 1GQNA 2POTA 4FNUA 4JHMA 5FCZA 2E9LA 3SI9A 2E9BA 4RZBA 4OFCA 3OZYA 4JKLA 2PS2A 3M0KA 3YPIA 1UH4A 1HW6A 3ATYA 2PTDA 5HWNA 3GB6A 4NP7A 1M5WA 4GX8A 1SUXA 4BWLA 5FEWA 2W62A 1WKDA 3WN6A 4WJEA 1F3TA 3MI3A 1CXLA 1U1UA 4RNFA 3WQEA 4NASA 1MW1A 1A0EA 2ODOA 3HFTA 1UWRA 3VCRA 2XPKA 5CC5A 5EMJA 2WOQA 3PHAA 4XZBA 3L67A 3IK4A 1US2A 1XDLA 2E3ZA 1SW0A 2WC7A 4XZLX 1AQ0A 4YU1A 1RQBA 3BUVA 1A5OC 1ISYA 1E0XA 1L8PA 2P53A 3VNKA 4D2JA 3A4XA 3EA2A 5KZMA 1O1HA 1TPFA 1US0A 1RVGA 1UBPC 2EKGA 2Y62A 3KHJA 3FIGA 3EPNA 4C6MA 1E40A 2JF7A 3HTWA 4NZJA 3VD7A 5AHEA 4O1CA 3WMCA 4HSNA 3LSCA 2PDXA 1W9UA 5HNRA 2DSVA 2ZUVA 1VPYA 4Q8WA 4NAEA 4XAFA 3MMDA 4UUIA 1TELA 3EWBX 2G4JA 3SUUA 3P6LA 3MVIA 2J7DA 1O66A 3SUSA 3M44A 3G1VA 4DZHA 1GG1A 2DP3A 1VRDA 1UUMA 1EA9C 1KRCC 3W1UA 1IT7A 2RHGA 4AY7A 3ZLGA 4FF7A 4I8YA 1KM1A 2Z1WA 1NJJA 3HG4A 2D2JA 1UZDA 2WVTA 4LW7A 1ECEA 1JULA 3WLJA 5HPCA 1KV8A 3W1PA 3QY7A 2YL9A 2WJEA 1Q85A 1O68A 3D47A 3W7HA 3HBLA 5DMMA 1ADDA 4IMEA 2NV9A 2W66A 2P88A 1TREA 3SZ8A 3VD9A 4QCFA 2PDHA 1MEHA 4GYPA 3URNA 1YNQA 3ZFHA 2RDTA 4AD2A 1MXSA 2HBVA 4QISA 2C6QA 1QO2A 1OADA 1O60A 3R8HA 4NAFB 4JNZA 1KRMA 4ZE4A 6XIMA 1UWAA 1F5ZA 3ARZA 3CK5A 4MWAB 4U10A 1XBXA 2QMJA 3BAJA 4QAIA 1K8ZA 2BBFA 4NXKA 1B0IA 3PM6A 1R8LA 1XLDA 4Q6XA 3JW7A 1RR2A 2KX9A 2PP1A 3BICA 3NQDA 3S1XA 1RVKA 3I10A 4K39A 3CPRA 4GJJA 2GYIA 2V3FA 3BCJA 3BOLA 2J6XA 4A8NA 3L5MA 2ON3A 2NUYA 1W3KA 4D6IA 4CLMA 5D09A 2E68A 5E70A 3GBEA 3KLKA 1G7UA 4Q4KA 1KQYA 4D9PA 1XLCA 4WDUA 4PUJA 5KZDA 1OC7A 2Y2WA 2G95A 4MDPA 3KRZA 2VURA 1H3GA 4PYSA 1VEOA 1VFMA 5TAOA 3QMTA 4LBUA 1BWKA 3P84A 4DLFA 1W56A 4OE7A 1LOQA 2G5WA 4G7EA 4H7CA 1G67A 4XZWA 4AVFA 1AW5A 1RJRA 1X39A 4DWSB 3SRDA 3EA1A 1E9LA 1AH0A 1UC4A 2YZ5A 3H26A 3NM3A 3UJSA 3E5BA 3BJSA 4AZBA 1ISZA 4DYKA 3ARXA 1GZGA 3HGRA 2NV2A 3M0ZA 3MPGA 1FWCC 2OZ8A 4QG8A 2BY1A 4R85A 3IANA 5A8OA 2IPFA 1QO5A 4FS9A 5CSSA 1CECA 4ACZA 3CTTA 4GZ7A 4NZ5A 3BXWA 1KFLA 2YB1A 2TPSA 3D5HA 5AYIA 2CZ5A 1P7TB 2D2HA 3IARA 5A95A 3LM3A 1KRAC 4KEVA 4YHGA 3BW2A 4MKNA 5I02A 3LD5A 5C2CA 4KMQA 1ELSA 6PTDA 1MXDA 5JBFA 4IIEA 3G3DA 1W1ZA 4GC3A 2V8ZA 4NZ4A 4A3HA 3VKCA 2WYSA 3TDFA 4AEEA 1XIFA 3R1ZA 2ZIDA 4FLQA 3H7VA 1MZRA 1TV4A 1MQRA 2G97A 2I16A 1ZPTA 3OBKA 2QGYA 2V3DA 3IIPA 1LZOA 4GINA 2YDQA 2ZVRA 3Q67A 2YA2A 4UTJA 2I5QA 3HG2A 2PRMA 1UD6A 2E77A 1YBQB 3SY5A 3MUZ1 3FVDA 4P7RA 4HZ6A 3LHTA 1V3LA 2EPNA 1IWPA 4H01A 3WFAA 2XH7A 1NWUA 4PEEA 3PB2A 4FB7A 4AIBA 1QFEA 3K13A 5XINA 3TC7A 1GPFA 1NQKA 3PN8A 2V68A 3W7LA 1W9XA 4ZTYA 2ZZ2A 3PZUA 4WDWA 3WD3A 3AHVA 5EMLA 3KS6A 4A22A 2Q3OA 1IEVA 3OGSA 1NWTA 2OKOA 5CG7A 3AZRA 3KZPA 3VZYA 4W8BA 3WG6A 3SCSA 3FV9A 4IXHA 1Q7MA 1CCWB 1VJIA 4PUWA 1P6BA 1E6PA 1XM3A 2XTKA 3SCPA 1GOKA 4CNTA 3VKJA 1Q2RA 1OB0A 2VD8A 4Z1AA 4KIEA 3DYOA 4ORMA 2OEKA 2P0IA 3RJXA 1XIMA 1TTPA 4QDMA 5EMYA 2GGIA 1JCXA 4JFTA 1DPMA 1QT1A 1LYXA 4WSJA 3AUOA 3C4UA 2VENA 2SFPA 1EWEA 1HT6A 4O28A 3H54A 5F2GA 1W1B1 3W88A 4YLWA 2NZLA 3ID7A 3GS6A 4K8GA 3GNNA 3OU8A 1AL8A 3ARPA 1Z48A 2WQDA 1RA5A 2PC8A 5KZEA 4Y8EA 2CKRA 1O5KA 3AIBA 4DLMA 1DJIA 5H8UA 5ABFA 2CWXA 2HEJA 1QHOA 1T8QA 4JFVA 4WZHA 3EOUA 4DVOA 4PCNA 1M04A 2PODA 3NQAA 2WXDM 4H6KA 1TVPA 4AZ7A 5C7HA 2FZ9A 4DI9A 4C6CA 3CB3A 4PMVA 2W3ZA 3GC5A 3KFTA 3NL6A 3H55A 3URAA 4DIAA 4D6EA 3FSUA 1NF7A 2YYTA 3EEGA 3R13A 2EBNA 3C2VA 1X6UA 3ZT7A 1WKYA 3LTPA 1V6TA 5BNKA 3EX1A 3B9OA 4W5ZA 2XDFA 5BRBA 4FP1A 1GORA 3NEHA 3A9IA 2PDLA 3IACA 1SW7A 3MCNA 4MB3A 3S9ZA 1GHRA 1PE1A 2E6DA 2X2GA 2WSQA 1DWHM 5B7YA 1GVFA 1FWEC 1VR6A 2VQTA 5M03A 1YNYA 1XINA 3F2CA 5E0CA 3TJ4A 2QULA 3AIVA 3OLIA 3PUDA 3OEXA 5FJRA 2XFYA 1UKSA 1XFBA 1YE6A 2R1NA 3QN3A 1M65A 2R9RA 1MZHA 4HOWA 5ECVA 2PGEA 4UTTC 3GXFA 3MCOA 5F4XA 1GEQA 3A9BA 3SECA 3RR1A 4RE4A 3NGFA 1I2RA 1O1ZA 2CCRA 3DECA 3R4IA 4QEHA 1RH9A 2IQTA 1LP6A 1DV7A 2VNCA 4YVPA 2QPUA 2FTWA 1B54A 2NUWA 3LBMA 2NX9A 1PUDA 3UCCA 1NF0A 5E6YA 3ES7A 3ZVHB 4ECLA 3W2UA 1HF6A 2XM1A 4HZ7A 1UH2A 3EPOA 3GIQA 1TTQA 2WANA 1QK0A 4E8DA 1FWRA 1LUCA 4RJEA 3QZ6A 1Q5MA 4UNKA 3GG7A 4S3GA 3E96A 3N3TA 2CHNA 4RE3A 3O2LA 4WY0A 4PRTA 4A05A 3VIMA 5GJMA 2Y85A 4J7RA 2GJXA 2FVLA 3Q2DA 5LIYX 1KXTA 1NSJA 3DDMA 3AZSA 3MUIA 1J5TA 4S38A 4AH7A 5FSDC 1V77A 4B5WA 2YL8A 1L6GA 4C6LA 3CHFA 1XLAA 5F4SA 4BQ4A 1H62A 3EEZA 1V93A 3UCDA 4YIWA 3TX9A 3MHGA 4ROQA 4X22A 3VXGA 3ME3A 4IICA 1XH1A 3GZ3A 1QI5A 4IP4A 3NTYA 3SDOA 3WJWA 4UQBA 4HCLA 1VRXA 3THUA 1ISWA 6REQA 4WOZA 4NL1A 1WV2A 1UZ4A 4MF4A 3VI2A 4LYKA 3LI1A 5BW6A 1E1EA 4ZOBA 2WMIB 1E6XM 1E0WA 3BG3A 4GE8A 1YEYA 3WELA 2REQB 3H4WA 3RG6A 1OD8A 1VPXA 4OKDA 4JL2A 3N15A 3B8SA 4JGDA 2Y24A 2BSLA 3QQ1A 4IISA 5A2AA 2RUSA 2YCLA 2QF8A 1H7OA 4M6UA 7XIMA 1K9EA 4AIOA 2ZX9A 3H24A 3I3EA 1RAKA 3W7DA 3QTPA 3MDUA 4RNIA 3BCDA 1HZYA 2J7EA 4C6OA 1O7AA 1I1XA 1QPKA 1S1RA 1SMDA 4CNUA 1AJ2A 7CGTA 4W85A 1H49A 3CAKA 4MJ4A 3EX6A 2PUZA 4UCGA 2TMDA 1U30A 1ZJBA 5DMNA 4UR7A 1S5MA 3TW6A 1BFNA 1M7XA 4KT2A 1BRLA 4AZ6A 3VIKA 5LIXX 2CIPA 3IIVA 4EPBC 1IIGA 4FR1A 3PZIA 2CETA 5LIUX 4HA1A 3E12A 1JF6A 4IGHA 3UW6A 2V2DA 4MZ8A 1DWIM 2Y7DA 3WIJA 2X1TA 4MY9A 1E51A 1FY6A 1U33A 3N34A 2FQIA 2JGQA 4HU3A 2ZA3A 4QLLA 5JIPA 1VFSA 1GJPA 4JN8A 3TN6A 1RBAA 2YA1A 4OQVA 2PAJA 3DFYA 1L6FA 3TSBA 1PIIA 2OT0A 3ZVIA 5CPSA 2XFFA 4S2CA 3VE7A 1HJSA 1V51A 1R7AA 2CLPA 4JQ2A 2OR2A 4GI8A 1CBGA 4HU4A 1TX2A 5EKYA 3AMCA 3NSNA 2XH0A 1JCMP 3WMLA 2Z27A 4ZFCA 3WL0A 3GVRA 1XIEA 2JGYA 1TPC1 2YR1A 1HFBA 3GDLA 1IEQA 3WK2A 1XYBA 3G1DA 1ME7A 3HURA 4B5XA 4W8LA 2PWGA 1UA3A 3O6YX 4Z2JA 4PMJA 4UZSA 2Z26A 4XD5A 4BWLC 1XRFA 4US5D 3OHIA 2HVNA 4N4PA 3XISA 5A6AA 1TWDA 1EXPA 4PMQA 4CKQA 4P8UA 1K8CA 4LV4A 1P4CA 5AHMA 4MTVA 4QE1A 1R3YA 3WLOA 2VL4A 3CUGA 3R94A 4BR1A 3WMBA 1JUBA 3PUGA 4LOCA 4QS6A 2ZZ7A 2F2HA 1Q66A 2ACRA 2ANUA 4DHGA 1MUMA 4ADSA 4S3JA 4WX2A 5CBJA 3UBPC 4JBRA 3FHAA 4OBRA 2A3AA 2I5GA 5E9XA 4L5ZA 1Z41A 4TVDA 4WDTA 3LLFA 5FKYA 3WUGA 1I0DA 1EPVA 4NRSA 4S3EA 1W3JA 1ISXA 1HKWA 2VEFA 1SZRA 2J7HA 3O6DA 3W1NA 4KERA 3STCA 3HMCA 4ZQOA 3BGGA 3T09A 2GWGA 3B3DA 2OYMA 3E3HA 3GDKA 3N2BA 4FA3A 1Q3NA 3ZSSA 3EDJA 2QPSA 2JK2A 1QNQA 4PCSA 5I79A 3CMJA 4IIFA 3MU7A 2CC0A 2A7RA 3NZGA 2AKZA 5E09A 1HKIA 3L4VA 4TO8A 1R2SA 1SO4A 1TRDA 3WQOA 4ZE5A 5CBBA 1Y5WA 3WQ4A 2GLKA 2RDWA 1DWGM 1BYDA 1CXIA 3UR8A 1E4MM 2ZXQA 2Y8VA 3VE9A 4TUFA 1TV2A 2F84A 3NO1A 4TQTA 3NURA 2AQOA 4QFUA 1XIIA 5AECA 3G22A 1GVRA 4LUSB 4PZVA 3S0CA 1ONXA 2PP3A 1KA9F 3F4CA 2Z4GA 5D2VA 4QR6A 3GX9A 3URQA 4ZA0A 5AY7A 2IPJA 1VBJA 4GYPC 2H9AB 1F8MA 1C8VA 3RU8X 1DP0A 3W7RA 5FJOA 5BROA 3WD0A 2NWSA 4Z2IA 4C60A 4PFHA 4ES4A 4AHOA 3VIGA 2I56A 3HGSA 7A3HA 5F1UA 5A6JA 3CPGA 1E56A 4URIA 1YXDA 4JTSA 3GXTA 3S2MA 2OU4A 2P0OA 4IMGA 4HMNA 3HGOA 3WD2A 5FF2A 2PFHA 4RZ4A 1XFCA 1K02A 5D05A 4R34A 5F4WA 4PTXA 1HGYA 2ZTKA 4MJZA 4PC8A 4PCFA 3WLMA 4TX8A 2RKXA 3BC9A 3QMSA 4TTGA 3LRMA 1TB3A 2Y88A 3CQIA 4V33A 3R0DA 1U5JA 4WLCA 4EPEC 4B9YA 3ENLA 4AD5A 1EDTA 1OFQA 1TE1A 4J3ZA 1JQXA 1M1BA 4UMBA 3MSDA 1DVJA 2WNNA 3TYBA 2QDHA 1ODZA 3MC5A 4LVDA 4NNBA 2JEQA 2HK1A 4D8AA 3AU6A 2VCAA 4NZFA 1XUUA 1WXZA 4NIRA 3QR3A 3UA3A 2WK2A 3W53A 4XQ6A 2DFAA 3WQ6A 3VC6A 3VA8A 3WLKX 4US6A 3STPA 1CLXA 1XSIA 2VO5A 5CZJA 2BVDA 1J0YA 3LPOA 3NYZA 2EG8A 4HNCA 1XDMA 3CM4A 4S3BA 1HIZA 3SFWA 5EU9A 3JZEA 2PEVA 3BLOA 1HP5A 1KW1A 1LQ0A 4IWWA 2OXNA 5M2FX 1AZ1A 4POCA 9XIMA 2GVGA 3NQ2A 1JZ2A 1ZY9A 4HMEA 1B3XA 1F3XA 3R8RA 2DQXA 3AUJA 1QW9A 1HG3A 3W81A 2IKJA 3C2FA 4WSHA 3N6QA 5U7SA 3DG6A 1MEWA 4KWSA 4JTQA 4MZYA 4E0CA 1QBBA 3AJ7A 4RL3A 2VVNA 1V6WA 2IS7A 3MI6A 3SUVA 4P8VA 2IKGA 1KR1A 4EXAA 2AAMA 1PTDA 1ZRQA 1FDZA 3HJEA 3RCNA 2DSWA 5AZ0A 1DHPA 2ZFAA 5G2HA 1R3WA 3IJ6A 5FESA 1ITXA 2E8ZA 1OQFA 4UB9A 1QAPA 1E0TA 1WDSA 3DESA 2XGBA 5JU6A 3WNMA 1AL7A 3QZAA 4CQ9A 1XD0A 1REQB 4QROA 3G0XA 3RX2A 2X0SA 1FHLA 4MNJA 4ATDA 3SCWA 3TC6A 5HK4A 2C0AA 1ZCCA 3T4WA 4XBJA 4HIBA 3P61A 3M07A 3ATZA 1NOWA 1FWDC 1E1CB 2J7GA 3S9IA 5BU9A 3QYQA 1XRSA 2WZMA 1KLZA 3AI0A 3PJXA 4Q7BA 2Z6IA 1H60A 3DBNA 3H23A 2CLLA 2QCHA 1B4KA 4CQAA 3SRFA 3RR4A 1JCTA 4UOZA 4RW3A 4PMZA 1ONEA 2ZA1A 4L4MA 3O3RA 4U5IA 3T1GA 4IX2A 1KCKA 4N2YA 4FNPA 3PF3A 4I9JA 1EJWC 2I1OA 4PN2A 2J47A 3FSTA 4TV6A 5I0DA 3WMSA 3MQTA 3ARQA 2QJMA 2EG7A 3REQA 5I09A 2ISWA 1R0MA 3U5YA 1OCNA 2VM8A 3QYSA 3CQ0A 4H8HA 3T0BA 2R14A 1OVDA 2OVLA 4V15A 5HWJA 3WLIA 2XN1A 1JAEA 4K38A 3FN9A 1XR2A 4WD0A 4BQ3A 4K2SA 4JHZA 3TNBA 2NXHA 3FXGA 3KBMA 3L66A 4ZSUA 5D9MA 3QHNA 3PBYA 3IV8A 1R9ZA 2Y61A 2D0GA 2HTMA 1FFQA 4Q32A 3DFSA 2DDXA 3T0AA 3WEMA 5A8GA 5I78A 1LG2A 1SJBA 1SMAA 4GH3A 4DXKA 1AH4A 2HE8A 3W22A 3ZZ1A 2QGHA 5EFDA 2V3EA 1MFVA 2BVTA 1TPH1 1W1VA 2QJNA 1KKRA 4C6FA 5KEZA 3ZWTA 1XLBA 1JRBA 4FLOA 1QJWA 5CLWA 2PDYA 1DJNA 5DF0A 1UH3A 4Y7EA 3QXBA 1FH7A 2D0FA 3VDHA 1JQVA 2A3BA 4H41A 1ZAHA 3P74A 2FGBA 3USBA 3FKKA 3E5PA 2JIWA 3WZ0E 2Z28A 4FX6M 3CQKA 4O0QA 2OO0A 1YX1A 4BEQA 1JNEA 4EAMA 2IMRA 5C9WA 2IQDA 5E0KA 3TYCA 4F66A 3NL3A 2XZ9A 4F9JA 3DENA 4PUNA 3L2LA 4QBXA 1JAKA 3GC4A 4RZ6A 1PL9A 3MTWA 3QGVA 8XIMA 5FEXA 1GTHA 1H61A 2A2IA 1XCFA 3CIVA 3EB2A 3K8LA 3T0CA 4N0RA 5D33A 3NSXA 4JN6A 2NSOA 4GQBA 3U0HA 5C55A 3CBWA 1EQCA 1PKYA 2D69A 3W0KA 1E71M 1ZGDA 2PF0A 3SCOA 1RP9A 2VZVA 2CEQA 1W31A 3GNOA 4BA0A 3AHZA 2ZX5A 2G41A 3MDWA 2UY2A 2DT2A 3ZO9A 2XH4A 4Q7IA 3AYVA 4DWSD 4E2DA 1XIBA 4O10A 5KINA 3RCMA 4D8LA 3TLQA 1ZTVA 3I6EA 3ES8A 1OCJA 1UBSA 4DJED 5EMUA 4LUTB 1S3HA 2GJNA 4GOAA 3ARUA 2HCVA 4UCFA 3W7GA 2PDJA 1Q4NX 3QV9A 4LB3A 1X38A 3LM7A 1FQ0A 4WGHA 2IUZA 1Q2SA 3CUJA 4H9XA 3W83A 3W1AA 3N2OA 3N25A 2VR2A 3LPFA 1UP0A 1NY1A 3PUOA 1EZ2A 3B40A 3C52A 3VDCA 2TYSA 4M82A 5A2CA 2Y5JA 4N9DA 4GFSA 3PSVA 3LHWA 1GGOA 3AS1A 3ITCA 4S2BA 3P0XA 3QC3A 3WENA 1K03A 4P7OA 1M6JA 2YA0A 4YMZA 2ZWZA 1VHCA 1ZZMA 4RV3A 3TV8A 5G1YA 2Y70A 3APGA 1UIPA 2DV0A 4DO5A 3T05A 3UJRA 1J01A 2PI6A 3NL2A 4LX4A 4Q22A 3W86A 5D8WA 1CZ1A 1EJXC 4KKXA 3LTYA 3C2RA 2RH9A 4N6EA 4X0VA 3KE0A 2QUMA 4AU0A 3S2JA 1ZHAA 1LROA 2HBXA 5MKGA 2HMCA 1JPDX 1E0UA 3UWVA 1YTEA 3UWZA 3B06A 4HJWA 1M68A 3GSMA 1VIZA 2J27A 1DWJM 2FLIA 3ABOA 4B2DA 2GDVA 2R1KA 3B0PA 3OIHA 2GQ9A 1CGWA 2VFGA 1C91A 4ICNA 3OG3A 4IG2A 1VFTA 1QNPA 4I7WA 3OBAA 3MMTA 1DXIA 3KRBA 3GE7A 3WD1A 4JTGA 2HS6A 4XIMA 3BQ5A 3LZ3A 3NQGA 4RXFA 3OOQA 2J9XA 4X9YA 3ZJKA 3IPWA 3AIRA 1TR9A 4OUEA 3URBA 1DTNA 1WYIA 1HJQA 4IPPA 1PWMA 1DL3A 2Y7GA 2QCMA 1R3VA 5IM51 3U3HA 4U28A 3V1PA 5BWFA 4B5SA 3RPTA 5I3DA 3HMJG 1C90A 3KAOA 1RQEA 2ATSA 2OGYA 3TTEA 1MXGA 3T0DA 5HDRA 1XBYA 5CSYA 1OINA 1N7KA 1RJPA 2E7FA 5I3IA 1WPCA 3LU2A 4NAEB 1R46A 1Z7AA 4S3AA 4L1GA 1O95A 4BZYA 1Q6RA 4DO6A 3G6LA 3SSZA 3I6TA 2VRJA 1N2VA 2XU2A 5DY2A 2EPOA 3AMGA 3RMJA 3AIUA 4S3KA 1A5BA 2PTZA 3GNRA 4H19A 1K6WA 3KVLA 3PPCA 2HV5A 1W5MA 4IUOA 1S39A 4AEFA 2G3JA 1TPEA 1OSEA 4H83A 1NDYA 4CCEA 5IHRA 4ZBCA 2DEPA 3E0IA 3EWXA 3E2VA 3QPYA 5BYWA 1N82A 3TQKA 3GHRA 2WVSA 3GAKA 4LUIA 1UR9A 3WLQA 4AD3A 1SO6A 1TZ9A 1QDSA 4ZQPA 3G24A 4YWSA 4UMCA 4DM1A 3FAWA 4XG1A 5K9XA 1SGJA 1Z69A 8A3HA 1OYBA 1BWVA 2E25A 1BLIA 1R9XA 3KBWA 3W7KA 1Q8AA 4I5UA 2HROA 3UG5A 3NQVA 3GO2A 1P48A 3A12A 2QCDA 3LCHA 4R53A 4GO9A 3GKAA 2D3NA 1UASA 3EKGA 4JEJA 1W8SA 5T9CE 3IGUA 5MF5A 3TP4A 2W27A 1B3VA 4C7FA 3HPZA 3RM8A 4F8XA 4UMAA 3OZOA 1W9PA 1W2VA 4MM1A 2ZICA 3BLKA 4EK7A 1CENA 4Q4MA 1YQ2A 3DC0A 1FWTA 3ABQA 1OABA 1UD3A 4A8RA 2YXXA 4FOKA 2W91A 4D6FA 1X7FA 2PTYA 2QS8A 3MMWA 5IDZA 1V0NA 3L0KA 1EIBA 4KWVA 3W72A 8XIAA 2B7NA 5LSMA 3W1MA 1OX6A 2XHYA 1S2AA 4IT1A 1VJZA 5AKQA 4GUFA 2UY3A 4HNOA 4G56A 1B9ZA 1Q6QA 3LNMA 3KTSA 1J79A 4XSLA 2VQUA 4QSFA 4NJJA 1V6VA 2BS9A 4DO4A 4D6DA 4KEMA 2ASHA 2GGEA 4MJMA 3WUFA 4CN4A 1O12A 3QH2A 2J8FA 1ME8A 4O17A 1KGUA 1OZMA 4MG4A 3T2QA 4F79A 3KWXA 2GQ3A 4G7EB 1HL8A 2UY4A 1ITQA 4A35A 3W74A 4RUBA 1MWOA 4W4QA 1HKMA 3C86A 3O06A 3CV6A 1KCLA 3BVJA 2VDIA 1ZFJA 4KF1A 3RUBL 4GBDA 3RJYA 5HJXA 4WK9A 3CUXA 3W85A 4AEOA 2JFEX 3AIQA 3AIEA 5J04A 3ZJ8A 5K9DA 5A1AA 4ZOAA 1J0IA 1SVDA 3ANUA 4F0RA 4ACZB 2CBVA 2PWUA 3A5VA 2NUXA 4P7QA 4CQCA 3TEVA 4J35A 1JCYA 2J79A 4YYFA 2OSXA 2XIQA 2BY0A 4ZO8A 1YLVA 3KEHA 2YBTA 2X09A 2YSWA 4Z1CA 3UU0A 2HJPA 4L6OA 4ZEPA 4NJKA 2Y5EA 3NXFA 5AHIA 1W1PA 3VNZA 1RPXA 4R5EA 1C7SA 1MQPA 1XGDA 1AK5A 5BOFA 1KGXA 1TV3A 3MWAA 1KXQA 3NQ7A 1XKYA 3PPHA 4G1KA 3NPUA 4BF5A 1MDLA 2OELA 2HS8A 1HJWA 1KM4A 1DJGA 2C14A 2VRKA 3T78A 3W1LA 1Q7ZA 2VFDA 3PVFA 2E9MA 4J2MA 4JTLA 4BKNA 5E9AA 1XI3A 2GGJA 3TN4A 1I45A 3V0SA 3DFTA 1CT5A 5D9NA 5TQLA 1E3XA 2ZZ1A 1BF6A 2QJJA 4C1KA 3LN3A 2J78A 3WNPA 1Y0EA 1Z9AA 1XYFA 1U1HA 1N8WA 1LQ2A 1WP6A 2BTMA 3GXPA 3KBVA 3CQHA 1FWJC 3QR0A 3R79A 1ITCA 3AYSA 4DBDA 3GXNA 3GVVA 1Q6GA 1PJ9A 3N11A 1X6NA 4FSAA 1Q45A 3HOJA 3SY1A 4LS0A 1CYGA 5A8QA 2C1GA 3HG3A 3AHYA 3PG8A 3LQGA 1OK4A 4QCEA 2Z24A 5KMYA 4OUIA 1RBOB 1GW9A 5LGXA 4UTLA 3IUIA 2JKAA 5JIWA 2GVEA 2YFNA 1Q65A 2W92A 4RX0A 3BLPX 3VTRA 4PA8A 6TAAA 3MW7A 1FCUA 1A0CA 3UY8A 4Y9OA 3MP4A 3W76A 2RJGA 4GRSA 2GJPA 1SFTA 3M0JA 2I9UA 4N9EA 3GZAA 1GEHA 5DANA 2Q8LA 3PPGA 4HCHA 4YXGA 3W1TA 3BE7A 4E2VA 4DXVA 3CNYA 5DX7A 3CAWA 1OF6A 2AAAA 3WBEA 4LT9A 4IPNB 1KM2A 4FPSA 2E6FA 1K1DA 3R11A 1PXGA 3MHFA 2JQXA 1R38A 3MO4A 4QAWA 1UD4A 1SR0A 3NWRA 1IE7C 1KV5A 2YPIA 3FGCA 3L4XA 3ITXA 3IGXA 1XS2A 5ABFB 1TWWA 3TWBA 1PIGA 3V5OA 1LORA 1OBAA 2BMBA 5LHEA 5CC6A 3AOFA 6CGTA 2YB4A 2BG5A 4QJ3B 1E6NA 1EPXA 5FJTA 2VX5A 3BAKA 3VNMA 1X7IA 3GY1A 3PZVA 6TIMA 4I7VA 2PZNA 3GTXA 7TIMA 2FTPA 2C18A 5FA5A 1FUYA 8TIMA 4QQUA 1R2TA 4O0ZA 3CUIA 5B80A 5LNUA 4Q8MA 1DJYA 2WB5A 2OWWA 3P67A 1VJSA 3FKRA 5C9ZA 1OIMA 3H21A 4AF0B 2ZRUA 4IF2A 4O0KA 2WVVA 2FGLA 3OPSA 2QQ6A 2FDMA 3SUWA 3EXRA 3HQ1A 4RW5A 1H7PA 4JOMA 4HNVA 1XYZA 3UP8A 4F0MA 3BPWA 1FBAA 1RK6A 4CCDA 2E5DA 4RNHA 4JY8A 4F0HA 3NDOA 1MRQA 2WMFA 1WOAA 1JPMA 4GFIA 1WB0A 2PGRA 3SFKA 5B7ZA 3BLEA 1T0OA 1RD6A 3HA1A 1BSIA 4ZZ9A 4FK9A 4JCMA 4MLJA 3BCFA 3S5YA 4KGJA 1L6SA 4Y9PA 2ZE0A 4LWWA 2Y63A 3W6LA 4Q33A 1UC5A 1MDRA 4D6HA 5FOOA 3AJXA 2HZGA 4YNGA 3F5LA 2BHUA 3TYZA 3M6YA 3T9PA 5EY5A 4KCVA 1I6NA 4L4OA 4A8IA 1ECQA 3VKBA 2W9MA 1J0HA 3LMYA 2IXVA 4ZO7A 3SGGA 1M7JA 1B3YA 3F03K 4JYFA 2QZRA 1Q63A 1WAUA 2YL6A 5LGZA 1DE5A 3BO9A 1PZ1A 4QXIA 4TMBA 2Z0IA 3G0UA 2FKPA 4L9YA 3L2MA 1IT0A 3FAXA 3DERA 4YWIA 1VYRA 3AXIA 1DBTA 3PZGA 3QZEA 8CGTA 1OCQA 5CLTA 1LUCB 4XZIA 2TAAA 1WUFA 2UBPC 4WSKA 3HB9A 4ACYA 2RDXA 1PKMA 3RN6A 4K1WA 5KITA 3CPUA 4WY0B 3BJFA 2EG6A 2HQAA 3AROA 5I24A 1JDFA 5C2XA 4NNAA 3OA5A 1VEPA 2GJXB 5HINA 2ZWYA 2NWRA 3PWIA 3QEZA 3KLLA 3VGEA 3H2AA 3W29A 3NGJA 1G7VA 3WEZA 1Q6DA 4HJFA 3NG3A 4PSPA 3NZRA 3S1GA 5AFDA 1FXPA 2CESA 2Z7KA 3ICJA 1ZU8A 2JE8A 2P5NA 4XAGA 3W70A 4WJ8A 2XFWA 2CHOA 2PWDA 3N4AA 5CGQA 3LGEA 4UNLA 1E5JA 1IIHA 4OTKA 4E3VA 2XN0A 3NQ8A 4GXPA 2J66A 3E49A 4EE9A 2ICSA 3H2CA 1FTXA 4FI4A 3CMGA 4P2VA 3MS8A 4IQJA 5HMDA 7PTDA 1FWFC 4JQ1A 6REQB 2DGAA 3NVTA 4YTSA 1BYBA 2JKEA 2Y5SA 3GW3A 4M24A 1XSJA 3MO7A 4BF9A 3D6NA 3UXAA 3NQBA 3VZZA 4YTTA 5HQLA 4HP5A 2GUYA 2QIWA 3PTQA 2E4TA 2X2YA 1I2OA 1SPQA 2PGWA 2WCAA 3T07A 4FLRA 4DUXA 4PMNA 4JTEA 2J9YA 3QV8A 1ZAJA 2WSRA 7ODCA 4M3PA 1GTEA 5PTDA 1HO1A 4HTYA 4MLRA 5CGTA 4M81A 4G1NA 3S42A 4C6EA 4DWDA 3TLLA 1HUVA 4BI6A 1B3ZA 1EC7A 1E6RA 1VBHA 3FA3A 2BOEX 2GPTA 3TQVA 4OZOA 5ABEA 2HWGA 4MPQA 3PFRA 3QFWA 1V6XA 2QR6A 3FHQA 2P8CA 3M0YA 3TUUA 3VX1A 2DIEA 5I00A 1BRLB 3LCGA 1RPKA 1FWSA 2PWFA 3W7QA 2CLMA 3WF0A 1UPPA 4LF1A 3SN4A 2Y8KA 1GWJA 1G01A 3K1DA 4FF5A 3H7RA 3QGKC 2DVTA 4AW7A 5DEZA 1E4IA 3KVMA 3IWPA 1OYCA 3OW1A 4JTTA 4CVWA 1W17A 3ZM8A 1AD1A 4PRWA 1SZNA 2ZUTA 5CBIA 4ZB0A 2QT3A 1XQKA 3TCSA 4GVFA 4G7FA 4REQA 4C7DA 1FDJA 3LYEA 1IGWA 4UFHA 3GDBA 3KOFA 1YDOA 1R3QA 1KNWA 1K77A 4CN6A 1UWQA 3UEQA 4F2UA 2O55A 1LL6A 3L12A 4MADA