1W17A

Structure of bacillus subtilis pdaa, a family 4 carbohydrate esterase.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
235
structure length
235
Chain Sequence
VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Bacillus subtilis PdaA, a family 4 carbohydrate esterase, and a complex with N-acetyl-glucosamine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords PROBABLE POLYSACCHARIDE DEACETYLASE PDAA
total genus 90
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1w17A00
2CC0A 4LY4A 2QV5A 3CL7A 2Y8UA 2C71A 1W17A 4NYUA 4NZ3A 4U10A 4NZ5A 3S6OA 2C79A 4NZ4A 4NY2A 5BU6A 2W3ZA 1NY1A 3CL8A 3HFTA 2IW0A 3QBUA 3RXZA 2I5IA 4HD5A 2DFAA 4OUIA 5JMUA 2NLYA 2C1GA 4M1BA 1W1B1 4WCJA 2C1IA 4F9DA 2VYOA 4NZ1A 2J13A 4V33A 4F9JA 1V6TA 4NYYA 3WX7A 3CL6A 1W1A1 1Z7AA 2XU2A 1XW8A 4L1GA 3VUSA 2E67A
chains in the Genus database with same CATH superfamily
3VGEA 3N2CA 4H04A 2BLEA 2Z1BA 4UMBA 1GQJA 5D37A 4W87A 3MZNA 3RGTA 1A5KC 2X1IA 3B4UA 5F7UA 1W1B1 3B9NA 3SQLA 2PGWA 3ICJA 4GH3A 4AC7C 5IM51 3IGHX 4AWTA 1Y0EA 1EP2A 1VH7A 1H62A 4PULA 4EE9A 1SW7A 3FHQA 3PVFA 5CPNA 1ODUA 3RILA 2OVLA 3UXKA 1EH9A 3R79A 1KGXA 4AZHA 4QTGA 1FWDC 1MW3A 3BV4A 4AZ7A 3C5QA 2FGBA 4F0HA 2PWVA 4M7SA 3WH6A 5I78A 3CPRA 4BJHA 1K8CA 1M7JA 1W5PA 4GIRA 2VD9A 3ATYA 3KLKA 4MMWA 1TIWA 3WLLA 1IR1A 3UWWA 4XQ6A 2I1OA 1ZBCA 1FP9A 4FK9A 1T8XA 1JZ2A 5AYXA 1PYFA 5FL0A 7PTDA 4DY1A 2VVSA 4YIWA 3E9AA 2V5CA 4L1XA 3H2EA 2NUYA 4Z2HA 1XHGA 4M6UA 3AAMA 3W1PA 2VP8A 3RM4A 3ME3A 4MM1A 3UA4A 3VX1A 6CGTA 4FXJA 3HPAA 3AMKA 4I5XA 3Q45A 3OG3A 2AKMA 1AD4A 4KPLA 1IT7A 2PDQA 4JBRA 4GQRA 2VC5A 1VP5A 4PBFA 1KFEA 3RX3A 1DQUA 2PDMA 1RHCA 1KV8A 1YLVA 1BF2A 3MV01 4KWSA 2FLIA 4GC4A 5HAOA 1JD7A 3F5JA 4XK2A 5FJRA 3BCFA 4R3UA 1QWGA 4Q8TA 2J77A 3ITOA 2UY3A 3EKGA 2JF7A 4DWSA 4CCEA 3LCXA 2V81A 1V08A 3TTQA 1V02E 4D8ZA 5E6YA 3HF3A 3N4AA 4BQ2A 4N02A 3GAKA 1TVNA 3TYCA 1XWYA 2BOFX 3AS3A 3DERA 3R94A 2VC7A 4F79A 3B8UA 3T55A 2XZ9A 2X42A 3F1QA 1Z7AA 3BOXA 1ICSA 2W92A 3CS2A 4YTSA 1TIMA 1OFPA 2X7VA 4AWEA 3UJEA 3WLNA 5D9NA 4TV5A 2GJXB 1YQ2A 4IF2A 1CIUA 1E73M 3N3MA 3ZJ7A 4CVUA 1UOKA 3M5ZA 3NM3A 4IL0A 4JKKA 4ZO8A 2QR6A 1EP1A 3C61A 4KQNA 4JAWA 4HA0A 2PCQA 1QBAA 2GDUA 4ROQA 2HE8A 3DFYA 4X63A 2XG9A 3R12A 1UC4A 4GQ0A 2PDWA 3VE7A 1P6BA 3W37A 4NAEB 3UP8A 5I07A 3MANA 4D9PA 1U83A 3NL6A 1R86A 3EOLA 2PDLA 1MXDA 3MDUA 5A6MA 3S9IA 4IMGA 3RRXA 1Q45A 1TA3A 3AROA 4FSAA 1E9IA 1ISZA 1VYPX 3QKZA 1K02A 2FGZA 4N9EA 2O9TA 3II1A 3S5YA 4IH3A 4GKTA 2PURA 2GJPA 1WAUA 1UOZA 4W4QA 3DEQA 3A3XA 4FLRA 3ZZ1A 1UQZA 3EX2A 1OG0A 4G5DA 1KD0A 5D38A 2G95A 4JQ3A 1EFZA 2ISWA 2E5CA 4UTTA 3ES7A 1W3NA 1QATA 3EX1A 5JBFA 3OPSA 1BG9A 1ZAHA 3VIHA 2QIIA 1C8XA 3FYOA 5EFFA 4S3CA 3XINA 4AD2A 3M46A 1XSJA 3RF9A 2FFIA 2XHYA 5HK4A 1I0BA 1R2RA 2VEMA 3BG9A 3P0WA 5BRQA 2FPTA 1R2TA 3E1F1 3M9YA 1F3WA 1XC6A 2Q01A 4YPJA 3EB3A 1GK8A 1XYFA 4LVAA 3LXCA 1Q2RA 2WB5A 3STPA 4CNUA 1ZLPA 4XKMA 4IG2A 3CIVA 2V2HA 4MWAC 1R85A 3E49A 2I16A 1TUFA 4O50A 4E2VA 2ZA2A 3FFSA 1NDZA 3WD4A 4X2PA 1N7KA 2EJAA 3S6DA 1E3XA 4LEFA 3C2FA 4B92A 1UR1A 4G7EB 4ZBCA 1JAEA 2OPJA 4I7VA 5DRCA 2B7OA 1UH2A 3ITYA 4UC5A 1TPEA 4D8LA 3MBFA 1UHVA 1EUNA 3VOIA 3FJLA 4HK7A 4AQLA 1QR7A 3GE7A 4CD8A 1X6UA 3H7UA 2VR2A 3M6YA 3BG3A 3AMGA 3O0KA 1T7LA 4LNYA 4MKSA 3VIOA 4I9JA 3C4UA 1I2QA 2RAGA 2E28A 2XIOA 3BGJA 4KEVA 2OQHA 2DT0A 3OODA 1KLYA 4NX0A 3KTSA 2BZNA 1LL4A 3VGDA 5HJXA 2X05A 5C7HA 1IT8A 3DOPA 4ZB2A 3F7JA 1UPMB 4IGSA 3KVKA 1JYXA 5E1QA 5FF7A 1DJQA 3QTPA 3SUSA 4M81A 3N15A 3TN6A 2C19A 3N12A 3CM4A 2FH8A 4P8WA 2HS8A 3L12A 3E38A 1VEPA 3MSRA 3RJXA 3UT0A 4IUGA 1YNYA 4GNKB 1I2PA 3EDEA 5KEZA 3TA9A 4ZSTA 3UGRA 1V6YA 4HNOA 3G1SA 1CZ1A 4RPQA 2ZIDA 3ZR5A 3ZLGA 4NL1A 1S2UA 1CLVA 3MB9A 2HRWA 4M82A 4KWUA 1XKJA 3D3FA 2NQZA 1P6WA 2GWNA 3LA4A 3QPZA 3W75A 3WF2A 1XG3A 3K1DA 1AQFA 1Z9AA 4WXYA 1ODZA 1S5WA 2YDQA 1FQ0A 5GNXA 2BGNE 2WMIB 1NM9A 1UIOA 4G7EA 4W8AA 2OGJA 4IPLA 4TO8A 5LSMA 1EJ7L 2R8WA 2HBVA 4UR7A 3V35A 1NWRA 3ALGA 4PTMA 1HGYA 3Q37A 1OC5A 4FLQA 1UKOA 4A3RA 2E67A 4HPXA 3JR2A 5G2HA 3BLDA 3SGGA 3WCZA 3CUHA 3FA4A 1QTWA 1SR9A 2GJRA 1OT1A 3H54A 3QTGA 3WLKX 3SY1A 1AH0A 2Y70A 2VTFA 4JY8A 3KE0A 1EYWA 3W1LA 4PSRA 2VDIA 3B0XA 4AG0A 3URBA 3FVDA 4PUKA 3A4XA 5A6SA 3AUJA 5LNVA 5CZJA 1WDSA 1KFWA 3GC2A 2BFGA 3BMWA 4QJ4B 3H12A 3NNTA 3R89A 3VUPA 3WLJA 1I60A 3W1NA 3VDCA 2QJGA 3CAWA 4YJ5A 4WVXA 4Z2IA 2XH7A 4UOZA 3B8TA 2OEKA 2PDFA 1ENUA 1SFJA 2QUMA 2GGIA 4OIFA 3KWXA 2PDGA 3W70A 2EGZA 5M17A 4A35A 4DN1A 4W89A 3W0KA 1PS9A 4UNIA 3N13A 1CB7B 3C2VA 2YCLA 5LIXX 2PF0A 4GBUA 4X9YA 5HPCA 1ZFJA 1QK0A 2F7FA 2G96A 3FA5A 5IBXA 4KWOA 3TMLA 4C6NA 3QPEA 1KCKA 2HCVA 3M07A 3LM7A 1LQ2A 3GH7A 3SCRA 1E6ZA 2XVPA 2YCLB 3PJUA 4E3VA 5M3WA 2RDTA 2WKLA 3OLGA 1XLMA 1WXJA 3HG5A 2E8YA 3UJRA 2CBIA 5HOSA 2G3FA 4IICA 4C1NA 4US5A 4AB4A 4XAYA 1PCWA 2D2GA 2ASHA 2ISVA 4RE4A 2XFYA 2GSJA 4RDZA 1GOOA 3CAKA 3O15A 4W8LA 4HCHA 5KZEA 1OZMA 1LUCB 5D9OA 5HMSA 2XVLA 4JXCA 4DF2A 3M5YA 2TODA 3O0FA 2NUWA 1FBAA 3LD5A 1GPFA 5D9MA 4MTVA 4H7ZA 3C2RA 2BTMA 2QEZA 1HN1A 3ENLA 2R91A 3BUVA 3VILA 3LHVA 1KWGA 1KGUA 5LGXA 2I9EA 4L65A 3M5VA 3OIXA 3S6TA 2DH3A 3KHJA 1KTCA 3F4CA 3MJMA 1OIMA 1GVIA 1TTQA 1W3LA 1CYGA 4NASA 3G0UA 3AYTA 3P60A 4KRZA 4NNCA 1HJUA 3PC0A 3MMTA 4TX9A 4O0QA 1N8FA 1NFBA 2OOFA 1Q6EA 3OBKA 2ZE0A 4LCSA 3SRDA 4DYEA 3SURA 1T40A 2UBPC 2CKRA 1WV2A 3PY2A 3S46A 4AIOA 1T8QA 3KRBA 2FGLA 2CW6A 4XZIA 3TCEA 5JUVA 4Z1CA 3RO6A 1WUEA 5K2ZA 4S3KA 3VMOA 3BSMA 3WQVA 3GDLA 4HVXA 1OK6A 2XDFA 5CXPA 5DMYA 3S9YA 4IGNA 4DUVA 2HXUA 3NOEA 1AMKA 2WAGA 3PAJA 3S1UA 3TH6A 3W27A 3NA8A 2Y2WA 3KCLA 1GTHA 1ZP4A 3E0VA 2ZZ4A 3W00A 5DO8A 3N6QA 3HMJG 4R9OA 1E51A 2Y88A 2ICSA 5GJPA 2KAUC 1UUOA 1C3FA 5BYWA 3H7VA 4DZ5A 5FEZA 3PR2A 3M0ZA 1YXCA 2JK2A 4NILA 1FXPA 4P61A 3LTYA 2E9BA 4AY7A 4C6MA 2WM0A 1H1NA 3VOJA 3BVJA 3GLCA 5CPLA 5CJ5A 2PDKA 1REQB 3ZJ8A 4U3AA 2YPIA 1FHDA 4PGLA 1VCFA 7ODCA 1XGZA 3N18A 4Q8WA 1TR9A 1QFEA 1DYSA 1NOFA 3DENA 3JZEA 1M3UA 5BMXA 4I7WA 3LN3A 1O60A 1KGWA 3A9IA 4I5UA 1J18A 1OC6A 1QO5A 2Y85A 3S3GA 5LHFA 1LDCA 5DELA 2J8GA 3WMSA 1BSIA 3HMCA 2CIPA 2IPWA 3UGVA 2WVSA 4W5ZA 3MTWA 3VIKA 4GQBA 3ALFA 4GK8A 3MI6A 4LYQA 4RE2A 3VK5A 2WKGA 4CU6A 4DX3A 4RNFA 3TSBA 3W82A 2OYKA 3GK0A 1XYCA 3ES8A 2OLAA 4ROPA 1R3RA 1WP6A 1VR6A 1UWQA 3F5KA 1Q6OA 1VAHA 1EHAA 2CITA 1J0ZA 3TFXA 1RY8A 3IK4A 4FNRA 3RM9A 4FOUA 4UOQA 4CNTA 2OKTA 3V0TA 5LXXA 3AIRA 3ARZA 1VENA 3OZOA 3C8FA 3TW6A 5LNUA 3NQCA 3MS8A 3GDMA 4O1AA 5GNYA 1XFBA 3WNPA 3U57A 1I1XA 2PWFA 2J62A 3KBMA 1W1ZA 4C65A 4ZQOA 3H21A 2WZTA 3NM1A 3H2MA 5EB8A 2QQ6A 5FCZA 4H9YA 1FWEC 2O4QA 3VI2A 4RE3A 5KZMA 3FYYA 2ZADA 3EEGA 5FF3A 1FKWA 2ZRUA 3CB3A 1P0NA 4ZB0A 5I3JA 3KBNA 3NAVA 3UVAA 1H2JA 4FMVA 4ZQRA 1FOBA 3CQ0A 1OT2A 3FJ6A 3MSGA 3G18A 3GNPA 3T0AA 1AZ1A 4AAJA 5ABFB 3AQUA 3R43A 3TN5A 4DM1A 4Q8MA 4I90A 3NO3A 4MZ1A 1EJRC 2OT0A 2J7HA 1BVZA 1BKHA 3SJNA 4GY7A 2WANA 2DSVA 3CZJA 4J7RA 2QCLA 3NSMA 1F5ZA 2BGQA 1KRAC 4WOQA 1UD2A 2JKPA 4IGHA 2ZZ1A 3O9NA 1B30A 4LRTA 1GONA 4S3GA 4ERAA 3JU2A 1TO3A 1PTDA 4RW3A 3VDGA 4BY3A 1XDLA 2BY0A 3OVQA 4HOWA 1LRQA 2QUUA 1WKYA 1YHTA 3PUDA 5LHEA 3I7QA 3CV1A 1Q7QA 2VWSA 2O0TA 4LBSA 1JYNA 4JTHA 4OWGA 3I68A 4GZEA 2WZIA 3IRSA 4YWSA 2BHZA 4Z2GA 1G94A 3R7MA 4BWLA 1UBSA 4M1BA 1DJIA 4HPNA 2OSWA 4NJKA 1A0CA 1SO5A 2X41A 4JCLA 2VI0A 4OUEA 3ONCA 2FPVA 4IMAA 1BVNP 4JYFA 3SFWA 4O17A 2FFCA 2UWFA 1ALDA 4GHRA 1VLIA 3MCNA 3W7NA 1XBXA 1JFHA 4L9XA 3BXWA 4GVFA 1JUEA 3FA3A 2PE4A 3B8DA 2J4GA 3GR4A 1FWBC 2Q09A 3UXLA 1WOAA 2FKPA 1SPQA 1P7TA 2BVWA 3M0LA 5T9BG 3DHUA 5C5YA 1SJCA 3BAYA 4OECA 1JQVA 4KCVA 3VM5A 4FNQA 3VIFA 1RSCA 2MUCA 4LB3A 3A4WA 3LRMA 1BEUA 2YA1A 3ARYA 1UD3A 1XRSA 2ZZ2A 1FDYA 3HGOA 4IFKB 4QP0A 1V02A 3T9PA 4IX2A 4NRSA 4MSSA 3ZT7A 1N82A 3RCYA 3KL5A 2OSYA 1JG9A 4JTRA 2VCBA 1TRIA 1R7AA 4DAFA 3AI0A 4HT3A 2O9PA 3LHUA 3VOFA 4YWIA 1YMYA 4J3VA 1A3HA 1QNOA 1OC7A 1CENA 4TTUA 4QSHA 3E74A 3CMJA 5AN7A 1TQJA 3WQ6A 4DJDC 2WW5A 2G0WA 3H4WA 2QJIA 1BPLB 1E9ZB 2JE8A 1VPQA 4HA3A 4WQ6A 4XZLX 4W5UA 4LUSA 3SI9A 4MY9A 1F73A 1HVXA 4K1GA 3ARXA 2R1NA 4H6EA 1QW7A 3TUUA 1EX1A 1EJXC 3NQMA 3I4KA 5BW6A 4MFDA 1V6TA 2ZA1A 2WVVA 4O1FA 3VUSA 3TK7A 3W6YA 4GMEA 3GY1A 3KL0A 3MSDA 2V8ZA 4O19A 5EA9A 3ZLHA 3W01A 2OXNA 2DVTA 4LH8A 3NZQA 1PBGA 5I3KA 3JVAA 1RP8A 3K2GA 2EBNA 6ALDA 3BZGA 2PA6A 3P82A 4UUIA 3TTEA 4AFYA 1J79A 2FZ9A 2WBGA 3V1PA 4JTDA 5LIYX 4OV4A 2OZTA 1JZ6A 3H2NA 1O1ZA 4RZ6A 3NL2A 3EDKA 1LLZA 2P50A 2F61A 3HM7A 4LBRA 1PSCA 3L5LA 3MW7A 5T26A 4B5XA 1PTAA 1A5CA 1J0HA 4PMVA 3ISIX 1TWZA 1YE4A 5TNVA 3FW6A 3LPGA 2DZVA 4M29A 2V0TA 4R7JA 5J5DA 2VENA 5CSYA 1JULA 3DFQA 3O1NA 3DGRA 2V6AA 2DZBA 3OU8A 4A2RA 3NQ7A 5I3IA 1SM9A 1ZJHA 2FIQA 2EG8A 4Q4MA 3VKDA 1UKTA 1OCNA 4AX6A 4JFTA 1OADA 4MPQA 4URIA 4GUHA 3EBVA 4KFNA 3VCRA 1Z41A 3CWOX 4IT1A 1UKQA 2UY5A 1EIBA 4F3HA 2WSKA 1D7FA 2ZUUA 3NSXA 3IAPA 1L8PA 1OJXA 2PTDA 5DCEA 3CC1A 4B5UA 3QXBA 2DZAA 4YLWA 3GFXA 1J11A 4XBJA 2WCAA 4F48A 5EPDA 1XRVA 3ANUA 4ICMA 1PZ0A 4KW2A 4H19A 2OR2A 1UZDA 3VNZA 2J7EA 4H41A 4C6LA 1H60A 4U2ZA 1UC5A 1Q4NX 5EMYA 2BX7A 1KFCA 1I0DA 1DJGA 1RAKA 4YTQA 4KWWA 4EF8A 3U4AA 4BF5A 1RJQA 2CBJA 4CD4A 2AQVA 2GVYA 1VKFA 1D3HA 3BCJA 1EEXA 1ZTVA 4GZJA 4CCZA 2TSYA 1UQYA 4JFVA 4A8RA 4TX8A 1ZNNA 2YJQA 1H61A 2XSBA 3K30A 3IVSA 4LALA 3GKAA 1B2YA 3CPGA 2A3EA 1MNZA 3AHYA 3VNLA 4K7VA 2W0UA 5LNSA 5AHLA 2A3AA 1XUUA 2OEMA 1XV8A 2WCSA 3ZWTA 4I8YA 4UFLA 3TTSA 5EY5A 3GG8A 5LGZA 3W2UA 3PJXA 2FZDA 1Q2SA 5HWMA 1A80A 3PBGA 3IIXA 2GGJA 3DBPA 4IQJA 3MMDA 4MZ8A 2P53A 3OG2A 4L4MA 1XR2A 1MQQA 3FGCA 1K7XA 1KRBC 4IX0A 1XDJA 1B3XA 2VC9A 3H53A 3IGSA 1S3TC 2VRQA 1LP6A 1XLFA 4ZOBA 1TCMA 5I23A 1TX0A 3LM3A 1I1WA 4N9CA 1UG6A 4PCSA 2GOKA 3K8KA 2ZUVA 1A0DA 4K8HA 4BA0A 4FNPA 3S5NA 1ZENA 5LIUX 2YOCA 4S3JA 2QIWA 1UMLA 2UY2A 5CEWA 3CV7A 3OZPA 2WHMA 1SO3A 3SCQA 3GM8A 1XCWA 4MWAA 3HN3A 4AXKA 4XAFA 2CETA 1UP0A 4O10A 3W2LA 1MW1A 1KM1A 4NY2A 4NJJA 3UY7A 3C2OA 1XBYA 2DV0A 3BURA 3SCOA 2PP3A 3QY8A 2RHGA 4E8GA 2QS8A 3WF3A 2YX0A 2CCRA 3F03K 3GHTA 4TOQA 3M0HA 4YVXA 3DI0A 4LAOA 4NAFA 1JCTA 4IMFA 1TELA 4HOXA 4JIPA 2W4XA 1UWTA 1V77A 3OZYA 3NQFA 4H7VA 5A6AA 2XVGA 4MOZA 3RR1A 5HUPA 3MV11 3B9OA 2J24A 2YDRA 1PAMA 1AD1A 1DHPA 3RCNA 4WGHA 1EQCA 4LWWA 1ECQA 1QOXA 1EDQA 1FWGC 3TYDA 1OWQA 1PYMA 4L6HA 3V18A 3QGAC 5I6SA 1CXIA 3SUVA 3I7SA 4HNCA 1XCXA 2NX1A 1KC7A 4NI3A 3GTXA 2WZMA 4PMNA 3TC3A 3GB6A 3P0XA 5CGTA 3AS0A 3GKFA 1OCQA 3T1GA 2EQDA 1UYQA 4PMYA 3EWYA 3NZRA 4BK9A 2G4JA 1XUZA 1NFPA 3NEHA 1X6NA 4B91A 4EANA 3PHAA 3ITLA 3DXIA 4QHRA 2QCNA 4BZYA 4NAFB 4AVFA 3OGVA 4LC8A 4JL2A 3F4WA 4LY4A 1MI3A 3DFNA 3FJ4A 3A12A 1C8VA 1EA0A 4IWWA 3HV9A 3LS9A 3UFYA 3LCGA 3L9CA 2E4TA 1DPMA 3W1TA 2PD5A 3TJIA 1KRMA 3VIPA 2QJJA 4CUCA 5BXSA 2TMDA 3N14A 3AZSA 1OD8A 4XD5A 2EPMX 4KF1A 1PCKA 5HANA 3EWCA 1SU5A 3ZIZA 3GO2A 3UR8A 3KL3A 3ITGA 5K9DA 5A8OA 3PB2A 3G1AA 3W7IA 3ERPA 3G8RA 1FRBA 4MY8A 1F07A 3GVRA 4FEZA 3EKZA 1A4MA 2YL5A 2GDVA 2FDSA 4PTNA 5C7VA 5DANA 3PPFA 1W9VA 4DXKA 3BAIA 4ZGYA 1RH9A 3J7HA 1JZ3A 2NZLA 3GVWA 5CAHA 4MJ4A 5I7GA 3CHEA 3EX6A 2W67A 3LBOA 4H3DA 3DIPA 4U10A 2V63A 4Q7NA 3LCWA 3G1VA 3WDJA 1GOKA 5A6BA 3KTCA 2XZ7A 4LVGA 3RG6A 3ZJKA 3D0CA 2X1RA 4K38A 3UR7A 3MUZ1 1P1XA 2FHCA 5CQ1A 3T42A 4EAMA 3DG7A 3ZR4A 1DWGM 3EZ4A 4BFAA 4MB3A 1ICPA 1QI5A 3QFEA 3WH7A 3BK0A 3HPFA 3L4YA 3HBLA 5HR7A 4UTHA 1OM0A 3AMCA 4DLMA 3VC5A 1RBLA 2VM8A 3V5CA 3BGAA 1SO4A 3TJ4A 4HYRA 1KO0A 4JHZA 3BLKA 3VYLA 2XVNA 1QHOA 5DY2A 2DW6A 3LRLA 2HBXA 4FA3A 4GA8A 2VX5A 4GH1A 4MLJA 4LVBA 1PX4A 4GUIA 2QHAA 3AS1A 3IACA 1XPGA 4MAVA 4RNIA 4J3ZA 2Z27A 3CV6A 2VEKA 4FP1A 1P7TB 5JH2A 1KQZA 1TTIA 1MUMA 4UFJA 2YL8A 2GUYA 2ZX5A 2NV9A 4QFUA 1Y65A 4TVUA 4D6CA 3SN4A 3EWUA 1XP3A 1KNWA 4HJWA 5BCAA 4AVNA 4WRHA 3VD7A 1J0IA 4XV0A 2QCFA 4XSMA 1B4KA 1LQ0A 3W7PA 4MADA 1GZGA 4QCFA 1BGAA 2XGZA 1DIDA 2DUZA 3ABOA 5BOEA 3L21A 3V36A 5A8NA 3DHPA 1M7PA 4X0VA 3M6DA 2VYOA 2UV8G 4QDWA 1FHUA 1U1UA 4MYAA 1G7UA 1J8VA 3DZ1A 4Q7IA 2PTXA 4HBKA 3UG3A 2C71A 2TAAA 1H41A 4IP7A 5MKGA 3VFLA 4FXSA 3KDOA 4HN8A 2D0FA 3N04A 4GOAA 1XLGA 4XBKA 3BW3A 3SW6A 1LTDA 3NQGA 3H70A 1L6FA 2V3GA 3ITXA 3TAKA 4XIMA 3G3MA 3QEZA 3FXYA 1HGWA 4C6OA 9XIAA 1D9EA 3OJGA 4Z1YA 1TPWA 1VJIA 2AMGA 3KX6A 3SJ3A 4JYEA 4M7TA 4WKHA 1VIWA 3BJTA 1Y8BA 2OMAA 1VS1A 5I00A 4CQCA 1RVKA 1VJZA 5JH1A 1F4HA 2H8XA 1YRRA 4C1NB 1VFLA 5EMKA 4U3CA 4TU1A 3W7DA 3P6LA 4CD7A 2ZUWA 3M0KA 1DWJM 3UU0A 3WQ4A 5F1UA 1JPKA 3NL5A 1LG1A 4CN4A 2WO5A 2CLHA 4LCRA 5K3VA 4DWDA 2WYSA 3TX9A 2RUSA 2Q3RA 1FDJA 5CBIA 2DORA 2YW4A 4LUTA 2EAWA 1B3YA 4NZFA 1MYRA 1QI0A 3KBJA 3PFRA 3LQGA 3UWQA 4FXRA 4WCJA 1UCWA 2RDUA 1PZ1A 1G0CA 4OKDA 4CNPA 4R27A 1KW1A 5AZ0A 2V68A 4GZIA 3QW3A 1P0KA 2SFPA 5E93A 4CQAA 3W7OA 4JN8A 4LAUA 5C70A 1TPC1 4S3EA 3GYCA 4NYYA 4AYGA 1K9EA 1E4IA 2E6FA 2OSXA 3DAQA 1Q6DA 3G3DA 4BCEA 3SGZA 3TSDA 3KP0A 2CNCA 1BKSA 4LW7A 3LXAA 4ACZB 1E1EA 2R94A 2WSRA 3CHFA 3SN1A 1H3GA 4YCPA 1M6JA 5A69A 1YIXA 4EACA 4KT2A 4P2VA 3R0DA 3M43A 4J28A 4JTCA 3SCPA 5G5IA 4A6GA 4R53A 3CH9A 1XLHA 1QJWA 1VD6A 5G2WA 1GVRA 2B0MA 2PLCA 4AZCA 5CC7A 2XIQA 1GORA 3WQPA 3BAWA 3TQPA 1JL8A 4IIFA 3O6YX 2A5HA 1YADA 1ZCCA 4R5EA 4FNTA 1KM6A 3LG3A 2O9RA 3I10A 3AC0A 1Z8AA 5AC8A 3WFLA 3CH0A 2EO7A 5CCZA 3H24A 4ZO9A 1X7FA 2G50A 1XQKA 2JKAA 4PMOA 4DM2A 1PE1A 4EKJA 5JVLA 2Z1WA 1BD0A 2J75A 1NH6A 2Z2AA 1OZQA 4DPQA 2DH2A 2ZTJA 2HEJA 4PMJA 3WNNA 4FOKA 4DNMA 1TPFA 2CEQA 2TPSA 2O9OA 2AGTA 1ZBWA 4MJMA 3NURA 3WUFA 3LSBA 3FKKA 4XUYA 5BNKA 3B3DA 5CC6A 5IDZA 1XLLA 4UB9A 4C5YA 5A2AA 1EJUC 2YA2A 4KH2A 2ZDSA 3UCQA 5BOFA 1SGJA 1XH1A 3AIWA 1FCQA 4H6KA 5H2ZA 2VZVA 3MWCA 5JU6A 1Q7MA 4IQEA 3THQA 4KETA 1ADSA 1K6AA 3MHGA 3TZNA 1FDZA 5D05A 3IEBA 4IM4A 5F4XA 2A3BA 3QC3A 5C6MA 3VIJA 4Q7BA 3GW3A 3CIWA 3SRKA 2BDQA 2A7NA 3DGBA 5A8QA 2BSLA 1VRDA 4X2RA 4CNNA 3MP4A 4F0SA 2OYMA 3PBYA 3EXTA 2CZEA 4ADUA 5B80A 2X2GA 3QV7A 3E3HA 3CAVA 1Y7VA 1CDGA 3SM0A 4PMQA 4WK9A 1QO2A 1QUMA 4JTJA 2BP1A 3S42A 2GUUA 2I7GA 3M0IA 4B2DA 3JUGA 4AZ5A 1YPIA 1XI3A 2B31A 1A50A 4M24A 2X40A 3OO2A 4JFSA 4DQWA 2VZUA 2ZQ0A 5CGMA 4F9DA 1XM3A 3BLIA 4B3KA 1XL9A 3UCDA 3L65A 2X8RA 5AOUA 4L1GA 3EOOA 3H7RA 3HA1A 3H4GA 3K46A 3T8QA 3KTXA 2VWTA 2WQDA 1LUCA 4Z2LA 2PC4A 2QVHA 5HATA 3B9DA 3UQNA 3EPOA 4V15A 4PTDA 3NCOA 3MYPA 1W5MA 1DJNA 1S2VA 1QRQA 3WQDA 5C0QA 1UZ4A 3G1HA 3GU1A 1FKXA 5CPQA 1IZJA 1GYLA 2EPLX 2ZZ3A 2Z0IA 1GVQA 4NJIA 4XZWA 3RLVA 4ZOCA 4HD5A 1YDVA 2PDNA 4DI8A 3SADA 3TLQA 3CO8A 4AX7A 2QNEA 1OX5A 3WQ8A 2PUZA 1P0DA 4KEZA 2ISFA 2IXVA 1SMAA 2QJHA 2WCGA 1TKKA 2CBUA 1V93A 2D22A 3DESA 1W54A 5I79A 2Y4SA 4O1BA 1W9PA 1QOPA 3WBXA 4REQB 3LI0A 3ZVIA 5LA0A 5U7SA 1UR3M 3Q4DA 2ISDA 4HZ6A 4EX4A 1XH0A 4S3DA 3DDMA 1EC7A 2A21A 1VFSA 1YDNA 3G77A 4AW7A 4M6QA 4E4FA 2BVYA 4O15A 3GIYA 3CGTA 2NV1A 4XTIA 3STGA 3LLDA 1MDRA 2XVKA 1NF7A 2ZRVA 1DQXA 1UR9A 4UTJA 5B7ZA 2V2CA 2A1YA 3H26A 1C8QA 2QGYA 3LPOA 2CLFA 4YN5A 4LF1A 2ZZ6A 1E0UA 4E6MA 3IJDA 5FIPA 1O6IA 1HTIA 4ES4A 5DX7A 3AHXA 4FNSA 3T44A 4LB4A 4RK8A 4LXFA 3IIOA 1HKKA 2PDUA 3M1ZA 4MNKA 1US3A 2WC4A 4NG3A 2DDXA 2QCHA 1K1DA 3PBMA 1FHVA 2JGYA 1GKRA 1KXVA 4U33A 1VB9A 1S1RA 3TZFA 3K1GA 3PK7A 4GCAA 1W1PA 4PUMA 1XINA 2D3NA 4ICNA 4ATDA 3AYRA 4JQ2A 1IXPA 5HA7A 4RR4A 5DCBA 1THFD 5JIWA 4JEQA 4QG9A 3BG5A 4ZMGA 3MHFA 2FYMA 5XIAA 1CXHA 4H8NA 9CGTA 3G22A 4C6FA 3QBUA 1OINA 1F7BA 2DJLA 3WBWA 2FPYA 1YKWA 4AH7A 3QMRA 4XKYA 2XGIA 1TTJA 1AW1A 3FSTA 5FF0A 2QCGA 4MUPA 2V5JA 4A3UA 3A4AA 1EA9C 1TTPA 4E2DA 5BRPA 4L4LA 3B40A 3QGKC 4PL2A 3MCMA 3M44A 2OLSA 5EYWA 1FH9A 4GYJA 4EOUA 4RUBA 3W2NA 2QUVA 1CGXA 4DZHA 4KFOA 3W22A 3EXSA 2VZSA 4MDOA 1QOQA 2Y5JA 3LOTA 1SJAA 3HPSA 1H5YA 8XIMA 1T6MA 4PR4A 2DT1A 1HG3A 2V38A 4Q6JA 3SIMA 4P5UA 2XM2A 4US6A 3GAYA 1PIGA 4ZO6A 1VFOA 3MDWA 4P7QA 1TPUA 4IPNB 2O55A 4PMDA 1BSLA 4WDTA 4JTAA 3QMSA 3DBNA 2FVLA 4UTMA 2NXHA 4E3TA 1LCOA 1OG6A 1S38A 2J7CA 3KM8A 3N17A 4ZFCA 1GJPA 3N3TA 5AHNA 1TJRA 4ZE4A 3QC0A 4YXGA 1JNEA 4DIAA 3QSRA 1KM0A 4B3LA 4HK5A 4CCDA 1J10A 1WDDA 3DC8A 2R1KA 3GNRA 2OO6A 3KOXA 4RXGA 1LBFA 3NG3A 4YTTA 1J5SA 2YYTA 1RCOB 3GG7A 4QJ1A 2CLIA 4Z1BA 1LROA 1IIHA 5G2IA 1CTNA 2IUZA 5DLCA 5C9UA 1JZ5A 3IJ8A 2WJDA 3NZPA 4Z42C 3E0FA 2JF6A 3A47A 5I24A 3LPPA 2RH9A 1ZAIA 5CPOA 1QHPA 3MU7A 2QXWA 1HX0A 3NIYA 4AZCB 4KCUA 2Z7GA 1B3OA 3P80A 1ZHAA 3BSGA 2J7BA 3H55A 3KZSA 1AG1O 3EPNA 5AECA 4ORMA 1U5VA 1KFKA 3LPFA 2A7RA 3NDZA 2C3ZA 3TONA 1LBLA 4KIEA 2EPNA 2HNHA 5CJMA 1H0GA 3KCJA 3P3BA 3EOUA 4M56A 2A85A 1TSIA 1ITUA 2EKCA 1XXXA 1MNSA 1GVFA 3GTFA 3WH9A 3P61A 2ZICA 4OBTA 3UW6A 1E40A 3K8LA 2WMKA 4UZSA 4MWAE 4FLSA 3R2GA 2XJ7A 4HYVA 3VKKA 1LOQA 3BSHA 1JDCA 4JS3A 4PMXA 4JNYA 1XIJA 4GBDA 2HXTA 3L5AA 2ACQA 1NP0A 4GUGA 4GISA 4ONVA 1QNRA 2J9ZA 4IHCA 4OJYA 4E8DA 2NXIA 3WELA 2VVNA 4N42A 2CXEA 4AIEA 3CL6A 3GC4A 3H23A 3I3EA 3W1RA 3Q94A 4MNLA 2REQB 4NIRA 4OBSA 2GUBA 3LBMA 2Q3OA 1O5QA 2WSPA 4AHQA 4JX4A 2OELA 2R1LA 4K36A 3UZXA 3LCIA 1EDGA 4MJZA 4CGTA 1H1YA 3O7UA 1TJ0A 3OTRA 3T0TA 1X6LA 1R9ZA 3G0SA 3WLMA 2X0SA 5AVHA 4C6EA 4R85A 5C55A 4ZVJA 1V6XA 3DYOA 1QBBA 1LRNA 2BBFA 3NYDA 2WWDA 1ZL1A 3UG5A 1V4YA 3N2TA 4XB3A 4BEQA 5DXXA 3PN8A 1SJDA 3BW2A 4KEUA 4C6CA 3CASA 2WQPA 2FDMA 3K5XA 3C0QA 4C1LA 3G1RA 1HL9A 2ZXDA 2H9AA 4NYUA 2O92A 3MWAA 3UWVA 5I5RA 1LOLA 1T41A 3OA5A 4NHVA 1RALA 3LTSA 3W23A 3M4HA 4P8UA 1ITCA 1W1A1 2YW3A 3WNKA 1KFJA 3VIIA 1L6GA 4GFSA 1QK2A 4YHEA 1JYWA 4PTXA 4NZJA 1QI3A 2Y5EA 4QXIA 3TOPA 4A8IA 3L7RA 2I9UA 1ZZMA 3W29A 1SZRA 1ITXA 4YL2A 4QIUA 4PSPA 4S1FA 4GPNA 2QMKA 1ZRQA 3W74A 1DE5A 4CD6A 3IPWA 3BDKA 3TSMA 4WHBA 5KMYA 3NO5A 5ECVA 1TPDA 1NOUA 1ESWA 1H4PA 5EMMA 3TW7A 2WLYA 1JZ4A 4WR3A 4FHAA 4ICCX 5A2CA 3DG6A 1KBBA 1UR0A 2OFJA 4Q3MA 1W0MA 3UR2A 3GFYA 1YTKA 5IBXC 1NDWA 4PUUA 3T4CA 3DFTA 4JIRA 3DYMA 2IPJA 2CWXA 5JIPA 3TYBA 4PYSA 1TWWA 4EAYA 3G5EA 3RDKA 4H00A 3QRHA 3W38A 3STEA 1HJQA 2GQ9A 4C1KA 1XYLA 1BXCA 3IV3A 1B3VA 1QT1A 2INZA 2E6YA 4AMCA 3B0PA 4JD4A 1JRBA 4PRWA 3R8GA 1FA2A 1NAL1 2POZA 1K03A 3VX0A 4F0KA 3N2BA 4X61A 1L2QA 3BL3A 2DT2A 2NV2A 4EP8C 4RV3A 4DBEA 1C8YA 1LG2A 1YXYA 3W7MA 4WKAA 2C14A 4TV6A 1TX2A 2XH2A 4YCOA 1Y5WA 3SY8A 2GJLA 3PB0A 2YFNA 3EDJA 3MMUA 1ZU8A 2XFFA 1JCNA 2PMQA 1KBJA 1R9XA 3P67A 3W83A 4DJDD 2ODOA 4RL3A 4MVAA 4MZYA 2CLEA 2EPKX 3L0KA 1AJ0A 1CXFA 3ORWA 3UJ2A 1R0MA 4QSFA 3L4TA 1RXOB 3QF0A 1GOWA 2DP3A 3B8SA 2WSQA 1W56A 4L6DA 2VOTA 1FP8A 1HO1A 1V3JA 5E0KA 1Z3NA 3N2MA 1V3LA 1WE5A 1EJSC 1XRFA 3PFMA 3NFUA 3W24A 3UG8A 4HTBA 1LLOA 3TXVA 1V3HA 1XYZA 4F2TA 4G7FA 2RDXA 2LLEA 3CPUA 1AK5A 3SQMA 3IS4A 3VOGA 4K68A 5HWJA 3UZ5A 2QCDA 1NWTA 2BVTA 3UPBA 3W73A 6XIMA 3W7RA 1HL8A 4GABA 1OBAA 4QISA 1VYSX 5C9XA 3L2IA 4GQQA 3T09A 3WD3A 1V3KA 3MJYA 1XC4A 1R38A 3LUTA 1RR2A 2CC0A 2R1MA 5REQA 1PTGA 4DF1A 4LS0A 4Q8UA 1LQAA 1LRTA 1RY0A 1PZ3A 4CEXC 1LLWA 3VTRA 2XIJA 3SFKA 2F6XA 3RUBL 2XUCA 2HQAA 4KS0A 4LCQA 3LLXA 4YHGA 1KR1A 3S83A 2I17A 3VAVA 3Q67A 1XJBA 3A13A 1WBJA 4PBEA 1WAWA 2PWGA 5SWUA 2EXOA 5G4HC 4X60A 1B90A 3K4AA 3UD6A 2V5KA 1AQMA 3SUUA 4HMNA 4QLJA 1ADOA 3P74A 4JR5A 3BLOA 2QPXA 3TC6A 1PKNA 1C7SA 3NQDA 4QG6A 3QLLA 1V0KA 1BGGA 4XVEA 4TVDA 3AXXA 5C9ZA 1DWHM 3CHVA 2C16A 5T91A 2OO0A 1QXLA 3FCPA 2FHBA 3KUMA 2WHLA 3NDYA 4QDPA 1A5LC 4PMUA 2VURA 4EXBA 1FWJC 4GXWA 4B5TA 1J0KA 1GKQA 1DIEA 3WG6A 3KRZA 4QJ5B 2EG7A 2VT0A 4LYPA 3UZWA 3XISA 1DQWA 1OGGA 3WK2A 1RCQA 3ZR6A 5TAOA 1NARA 1S3HA 4HHHA 2QW5A 3UXDA 3PG9A 1G4PA 1RA5A 3D46A 5D2WA 2YZ5A 3HGSA 3ITTA 3GNNA 2O56A 4LOCA 1VHNA 3VNJA 1VBUA 2FJUB 3ID7A 4KBXA 1SVDA 1R3VA 1U1HA 1EX5A 2NVDA 3VDHA 3LV6A 1H7OA 2EHHA 2Z1SA 1HKWA 2ZRXA 3RJYA 3AFBA 3S1GA 5CC3A 3NPUA 4NZ4A 2W27A 3FNDA 5F1VA 4AEOA 1HZYA 1WZKA 4I9MA 4JN7A 4UWMA 5LIKX 1R3WA 1S39A 1XW8A 2W9MA 2P1FA 5CG7A 4Q8PA 3WY1A 4A21A 3AIBA 2BB0A 4ACZA 5G1TA 5FF2A 1BQCA 3HQ1A 3QHMA 5DBUA 3U2ZA 4XVDA 1HXJA 4GYFA 3VDBA 2DPEA 1U1JA 2AQWA 4AY1A 4C90A 2ZX7A 3FYPA 3F5LA 2C15A 2Q02A 3ZJ6A 3QV6A 4GJJA 3EAUA 3WL0A 4J3SA 5DF0A 3DFOA 3DHDA 3PZIA 1WOBA 2PWUA 4MUZA 3UCCA 1POKA 2OX4A 4GVIA 1TZZA 1PB0A 9XIMA 4ZOEA 3FIGA 2C91A 2FVKA 3WF1A 2V2DA 4GXPA 4IZGA 1UPPA 1DE6A 1VCVA 3E2VA 5I77A 4LQ1A 3FAXA 3KOYA 4IGMA 1BXBA 1RJPA 4GKLA 1TZ7A 1W32A 3ARUA 3MC5A 3R0KA 2E40A 3L2MA 4UTKA 3ARRA 1A5MC 1GYMA 3R0UA 3B9EA 2X0YA 3DFPA 1ZS2A 3TE9A 1RBOB 1E43A 2WWCA 5DY3A 1JVNA 1AMYA 5JXQA 3KS6A 1O68A 3KP1A 1Z48A 3ZWSA 4PUJA 1IEXA 2WHJA 2PODA 4IIBA 4YVVA 2X1SA 4LEQA 4O53A 4DO6A 4Q4SA 2FQIA 3UZZA 1WDQA 4EPBC 4BF9A 1SMDA 2ZUMA 3KOZA 1W9UA 1H7XA 3RXZA 1E1FA 3L4WA 4FPSA 1DV7A 2VZOA 3F2DA 1K8ZA 1W3HA 2YZRA 5FOOA 4XX6A 4DRSA 2NWSA 4QJ3B 4EK7A 2VUNA 5BXTA 2J7DA 1W9XA 3DG3A 1WKEA 4AZGA 5ENLA 3B0UX 4LY8A 4ZEPA 4RNHA 3E2RA 3WLQA 3ANYA 2WNZA 5CGQA 1SZFA 1OCBA 5LYRA 3IK2A 2ZE3A 3E6EA 2D2JA 1JDAA 3N2XA 3QR0A 1YX1A 4ZENA 3LHWA 4FNUA 2NW0A 3BCDA 1MRQA 3HQPA 4JIHA 2HTMA 1SJBA 1QPQA 1OFAA 3LDVA 1GHRA 2H3BA 2VHLA 3T0DA 3TN4A 3W7CA 4ORIA 1SFSA 2ZOXA 1A3WA 5IHSA 1V0NA 3UEQA 2OEJA 1MSSA 1EJWC 4QCEA 2CHRA 2ANUA 3TIMA 3ABXA 3DU0A 1E72M 2GDQA 2OJPA 2V3EA 4B5NA 4HPGA 4WIWA 3N73A 3O05A 2G3JA 4PZVA 3PUEA 3W7JA 2PDYA 3CMFA 5AYZA 2WVVB 1LZOA 1MFUA 4K8GA 3D5HA 4AEFA 4TMBA 1IGSA 1S5VA 2IKHA 3VO0A 4H4IA 1VC4A 1O5XA 3R8RA 3OZMA 2F2HA 1XYAA 4EXAA 1FXQA 3OEXA 1CWYA 2I5GA 1TMQA 1JEZA 3M64A 1FX6A 5IXEA 1UMYA 3IAQA 1HIZA 4MWAD 3W1MA 4OT7A 4F0RA 4DUOA 5LIWX 4FO4A 4PE8A 1B9ZA 3C6CA 2BG5A 2NXGA 4C6DA 4G1NA 4GD0A 4HHLA 3RMEA 1DKWA 4DWSC 2GFTA 1L2UA 3GHSA 4UTWA 1UW9A 4AY8A 1MVYA 2ADAA 1B31A 3ARWA 4D6EA 4XAPA 3UG4A 1V6UA 2D0HA 1ME9A 4O18A 1MO0A 1G4TA 2NQLA 3UJSA 1M04A 3RPTA 1V8EA 3LQLA 1OABA 1G5AA 3DKJA 4GJIA 1J9YA 2DZSA 4JCMA 3S8HA 3TV8A 2FZBA 5D4YA 4DBWA 3W1XA 3OYXA 2W63A 1SUXA 2ZDRA 3GXTA 1DTNA 1BAGA 2Q6ZA 4MGGA 1A53A 1OEPA 4WY0B 1QHZA 3TROA 3EOEA 1XLCA 4ERGA 1EBHA 1W5NA 5AHIA 4C60A 1V3MA 2WV8A 4KRUA 3MO7A 4A22A 1GZJA 4UR8A 5MF5A 1RJRA 1H0IA 4XISA 4O16A 1X98A 4IL2A 3ZXWA 1PX3A 4JIIX 2V82A 3OW1A 3GVGA 3QZAA 3WK0A 4O0ZA 3WH5A 1RLCL 3VDAA 3LZ5A 3T08A 3WJSA 1PWLA 4WXZA 1F61A 5H6HA 1TE6A 3KVJA 1H09A 6ENLA 2JIWA 3B0YA 7A3HA 3CNYA 5AFDA 1ZBVA 2EEXA 2VDHA 2HDJA 3STFA 2CFFA 3AALA 4DYJA 2AAMA 3RU8X 1EPVA 3GTIA 4P7LA 2YBUA 3QYQA 3WO8A 3OLEA 5KTLA 4ZL1A 3MUY1 3W1QA 5DMNA 3VKCA 3BC9A 4U28A 3IJ6A 4B2DD 1FWFC 5FSEC 1RUSA 1HNYA 1LT8A 1CBGA 3CUIA 4JIQA 2NWRA 2D3LA 4O12A 5J8LA 4Y90A 3QH2A 4E4PA 4H6RA 4U5IA 2BMBA 2D1ZA 3IANA 4MDPA 5E70A 4OV9A 2C13A 3UR5A 3QMTA 4UFMA 4S23A 1JDEA 4HNTA 4N7QA 2Z29A 4GRSA 4XIAA 2I5QA 4PUNA 2GLKA 2A2IA 2R14A 1Q6RA 3PZUA 1J5TA 5M1TA 4LSBA 3T6CA 4NNBA 5FA5A 4QLLA 2W5FA 3AISA 4EXQA 1VJSA 4WLCA 4EPKA 1TE1A 2BY3A 3W84A 1TWIA 3TQ0A 4ZQNA 2YB1A 3GUWA 2HROA 5H91A 1G6CA 2PAJA 3R8HA 5C2GA 2CLPA 1E1CB 1LL6A 4JDYA 4PMZA 4UQAA 1TPH1 2Z1XA 2QV4A 3WEOA 4MNMA 3ZVHB 4E4UA 1QVBA 1FWTA 1TV5A 3DC0A 4CU7A 4B9ZA 1LWIA 1DJYA 5GVJA 1KXHA 4H9TA 5LXEA 3UNTA 3L4VA 3HFYA 3MA8A 4V33A 1P4CA 4CKQA 4RLIA 2CLKA 3HB9A 1OFDA 4F0MA 1KWKA 1VFMA 3IIZA 1GGOA 1PIFA 4IQDA 3RLGA 1DTUA 2XPKA 3VMNA 2DSZA 3TN3A 1JCLA 1MW0A 4Q4QA 1Q65A 3WBEA 4HN4A 5AC6A 4XSLA 5DT7A 3FGCB 1NQ6A 2ZRWA 2X2YA 2IQDA 2CXGA 5D02A 1AW2A 2DZWA 3GC5A 1VFHA 4W88A 3EB2A 2VGFA 2E09A 2W91A 1GVSA 1YTEA 4P8XA 4BQ5A 2WNNA 3GSMA 4C5ZA 3PPCA 1FFRA 3WKZA 2TRSA 3P8IA 2VUYA 4UTFA 4DXVA 5FD0A 1E5JA 3TTOA 2Y61A 2Y8KA 3U3HA 1R7OA 4J2PA 4OTKA 3OB8A 2EG6A 5A6JA 2OZ8A 1A5UA 1PKYA 3BLLA 3QZ6A 5K9CA 4NUWA 3UXIA 3RPDA 4V1XA 3BPWA 4ATLA 1UJPA 4IIHA 3O06A 2AKZA 4GYPC 4JX6A 1V7AA 3B8WA 5FESA 1K4GA 2QDDA 4GJ1A 5IFPA 1UR4A 2F6KA 3SAZA 1OCJA 3UWZA 4G1KA 2EJ1A 1Q3NA 4V28A 2QDGA 2DSWA 4ZE5A 3WLRA 3KS5A 3A4JA 1D8CA 3CUJA 4HPJA 4CD5A 2DQWA 2ZZ5A 4QS6A 3VFCA 3GS6A 4RZ5A 3A64A 1DHKA 3S0CA 4IIEA 4D6JA 5TD4A 3NOYA 1AJ2A 1NELA 4AF0B 1A49A 5FAJA 3LNMA 2YB4A 1H51A 1XLJA 1E4NA 2GWGA 3KVMA 4OUIA 1G69A 5AHFA 3K8MA 3H2AA 3VIGA 1J2WA 4WF7A 2E5DA 1TVLA 4D71A 3MKVA 4NVTA 1SQ7A 5H8MA 4IFRA 3GWQA 3ZYZA 2C7FA 2XFWA 2BY2A 3NPWA 4LPCA 1RD5A 4NI8A 2P8BA 2VCAA 1UIPA 2P76A 3ATZA 5LZLA 1J96A 3A5VA 3KAOA 1W3TA 1VIZA 2J7GA 4MNJA 4US5D 3VD4A 1CLXA 3DUGA 2QCDB 3EKLA 3NSNA 1KBIA 3UVIA 1NDVA 5D32A 1TB3A 2EF9A 3G1XA 4NKCA 4NU7A 4O1DA 2NQJA 5CSSA 3T2OA 4NJGA 3ARSA 1IR2A 1FH8A 4J4KA 4Z2KA 3PSWA 4ZB5A 4IP4A 3CZLA 4M3PA 1L8NA 3B8IA 3LCHA 3WDRA 2VEFA 2FTPA 4BKNA 2INEA 4FF5A 2YDAA 3AYVA 1VBJA 3HIJA 3T2PA 4DLFA 4UR9A 3NZGA 4Z08A 1PDYA 5HMFA 1FWWA 1SYTA 1XLBA 2PI6A 5DFAA 2JFEX 4QROA 4H2CA 4DJEA 1MXSA 3GH4A 2V69A 4K39A 3OHIA 2REQA 1OFRA 1V79A 1AL8A 4OE7A 5CSUA 4UFKA 1LL7A 3SQSA 3GNXA 3PSVA 4M51A 3R6IA 1NSJA 3EEZA 1TZ9A 4KGJA 2G3IA 1F6PA 2AMXA 1NF0A 5CLWA 1DIKA 3QV8A 4H83A 3BJFA 2PGFA 1XDMA 4O8AA 1B1YA 3VZYA 4JICA 1HFBA 3CZKA 3KW3A 1GYNA 4R88A 3IVTA 3GG1A 3URAA 1DL3A 1O12A 3ANVA 1ISYA 2DQXA 3B9AA 5FJUA 3EPMA 1MRAA 4LVDA 2E7FA 2IPGA 1HJVA 3L4ZA 2EPOA 2YCJA 5E5CA 4GI8A 3NPVA 4DBUA 3CBWA 1GPWA 3GXMA 1AODA 1WXYA 5TF0A 5I03A 1CGYA 4PEEA 4E0CA 1CXKA 3GXPA 3QHNA 3FX4A 4D1JA 3CEPA 3MP3A 3HOJA 3OVPA 3PTMA 3QPYA 3CTLA 4DXXA 3TC7A 3C8NA 3BOFA 1W31A 2BOGX 3N2OA 5T9CE 1KKRA 3HQOA 3GD6A 4M6PA 1AQ0A 2GQAA 2ZXBA 3R10A 3LMYA 1E71M 3AIVA 3AJ7A 3H22A 3OBAA 4B16A 3C56A 2C6QA 2L5HA 3IIPA 1CB2A 3MMWA 3FHAA 1GVOA 5TIMA 4KFPA 3VNKA 1XGDA 5B7YA 1GCYA 1EIXA 3AYSA 4R34A 1BXNA 1W2VA 2NLYA 4KRTA 1VFTA 3LENA 5G4WA 2J8TA 5FACA 3U2EA 4PB3A 1JI1A 4J35A 4EF9A 3V16A 4RDVA 3W2MA 4AWSA 2GSEA 5CAKA 1KBKA 3DHFA 3I7RA 3KFTA 4HNVA 2NUXA 1VPXA 4H9VA 5AVNA 1EJVC 5FJOA 1B0IA 4HMCA 1FVPA 3WBYA 1B3ZA 3EYPA 3LLFA 1AH3A 2VEIA 1T99A 2X30A 2BXZA 2H9AB 3NEVA 4W84A 7REQB 1R3TA 1W1IE 1RQHA 4KWVA 5FSDC 5LA2A 5KZ6A 1RP9A 1E5NA 2X0HA 3QOMA 2D24A 1UWIA 1I4NA 3APGA 4JZ5A 3IUHA 2JBMA 1UKSA 1PV8A 4IFOA 4L56A 2NLIA 2PDXA 2NVCA 2FB2A 5H8PA 5KITA 4WJXA 2GGHA 4JTTA 4HU0A 3T05A 2VR5A 1L9WA 1W91A 1OHLA 4A05A 1TPVA 3W53A 2QUTA 3WF4A 2ZC1A 3RN6A 3WD2A 5CPMA 1O94A 4UTUA 3G6LA 5DCDA 2JKEA 4YTUA 1QW9A 2ESCA 4PODA 3L66A 2A3HA 2Q8XA 3W2JA 1QW8A 4MAZA 5D2TA 3REQA 5TBOA 1OFQA 1EZ2A 5D8ZA 2UY4A 4JQ1A 3S1VA 4FR6A 1PEZA 3WLIA 5A94A 2WOQA 3MI3A 5K4XA 1E9YB 1VHCA 4PEKA 2ZA3A 1UUQA 3W86A 1W8SA 2J7FA 4MG4A 1XCFA 1D3GA 1ECEA 5EL1A 3W26A 1LORA 1UBPC 5HBFA 4LVFA 5HINA 3BLEA 4FZIA 4S2CA 1V3IA 4RCXA 3GYEA 3M0JA 3R58A 3SUTA 1EF2A 3DN5A 1C9WA 2W62A 4K7YA 4P7NA 2ZBTA 3WQOA 3QVQA 4AHPA 3V75A 4I5RA 1AZ2A 3LX9A 1HP4A 3MKCA 1O7AA 4S39A 1PX8A 1OYBA 1L6SA 1ICQA 1CECA 2C0HA 3G1YA 3VOHA 3KOWA 4LJ3A 4TTGA 4OVXA 4Y8EA 1A5BA 5F2LA 3WFZA 4LUYA 3TJLA 4BI7A 3O8AA 1G7VA 2GQ8A 3G1DA 4X3ZA 1RZMA 1H7WA 1K70A 1WKDA 5JMUA 4M0XA 4W7UA 2VFEA 3V7PA 3WDHA 2INFA 1JXJA 4WSKA 1AH4A 2AL2B 3GG0A 1AA1B 2E5BA 5DT5A 1J6PA 2IKGA 4QE1A 2VRJA 3TQKA 4WKFA 3RO8A 3SSZA 2A3CA 4HK6A 3FN9A 5HPOA 3OHMB 4IXXA 4ZFMA 5C2CA 2A7PA 4IQLA 5CZ0A 2XINA 3BGGA 3S5OA 1Q6GA 1HW6A 1FCBA 1O5RA 3UERA 4ZZ9A 4CQ9A 3M7SA 1EB3A 3AHTA 1AVAA 2BHYA 2O4MA 2BHUA 4UCGA 1A3XA 3VKBA 2NQHA 1Z69A 3TYAA 1IZCA 1MW2A 4ENLA 4H9XA 2E8ZA 2VMFA 2X1TA 2PD9A 2I14A 2Y7FA 3W88A 2DY3A 1VBGA 2VKZG 4JKMA 3WUGA 2E9MA 3GU9A 4CEUC 2YCKX 3N34A 4ZXOA 3CUXA 1NJJA 3BWWA 1WO2A 2OWWA 2QPUA 3KVLA 1R3QA 4UQCA 2D0GA 4QS5A 2WK2A 4ZOAA 1VBRA 1D2KA 1TMLA 1P48A 4DO7A 1V0LA 3M0XA 4XD6A 5I3HA 2QV5A 3FKRA 7REQA 2POTA 3AICA 5MKGB 1SO6A 3S2NA 3KBWA 3UPWA 3CHCA 4QR6A 1M41A 1TV3A 4CQBA 3HU7A 1EQPA 3MUCA 1GKPA 1WBHA 1XF0A 4POCA 1O4UA 1XD1A 4WDUA 1E9LA 1ZALA 4PBGA 5J04A 4O11A 3W25A 2WJEA 3WK1A 3MPGA 1BTMA 3EA3A 2VDGA 1AUSL 1JCMP 4JGDA 1IGWA 4B3ZA 1TV2A 4K37A 4J40A 1UZ1A 3QHOA 3SB0A 4ATWA 2XN0A 1GNXA 5AKQA 2PBOA 4Y9OA 5U4NA 2XWDA 5A6TC 1NEYA 3SZ8A 1F05A 2Z28A 1R3YA 3VKAA 4TXEA 4H6QA 4HB7A 3T4WA 3W1AA 1OY0A 3MUIA 3WEMA 1B57A 1CW2A 5I0DA 1SW3A 2VD8A 3FDKA 2F8QA 1OFEA 5G1YA 3IGXA 1JPIA 2J79A 4ERIA 1MWOA 4JL1A 2R9RA 4AHOA 2RGMA 3QQ1A 1TQXA 4LYRA 3HG4A 3MZ2A 4KESA 2HPMA 4LV9A 3LV5A 2RGLA 3GIPA 4A3HA 4HKPA 1X8FA 3T81A 1DJHA 1PVNA 3ZOAA 5CKSA 1S5TA 4WUIA 4N9BA 3GFZA 1QPOA 3AZTA 2GZXA 3TWBA 4GC3A 3E12A 1IE7C 4QRNA 1VZWA 3XIMA 4LAMA 1NIUA 3TA6A 1VCGA 1JRCA 2QPSA 5ECUA 4UTLA 3GVVA 2PFHA 1YPXA 4BI6A 2DIKA 5C8BB 5DQPA 4LUJA 1I8JA 1U30A 2C79A 4F2UA 3O3RA 5A6BD 8RUCA 5BROA 3LU2A 4WX2A 1E0VA 1E56A 1XIMA 5BRBA 4LC6A 2ON3A 1RA0A 4S38A 2CHOA 3V3WA 1HKIA 2W3ZA 3N19B 3GXDA 3UWEA 2ZUSA 4BF7A 2B7QA 2VRKA 3LZ3A 4IMEA 1SZEA 3P8JA 3AIUA 3SUWA 1DJZA 4UNKA 4JHMA 2V5DA 3SCNA 2WMGA 2JALA 4KGLA 2OQYA 2OWCA 4QDMA 5A8GA 4UBPC 3TR2A 4EVZA 5D09A 4CU8A 3AZRA 3TMQA 2CERA 1GW1A 1YPFA 1ZB5A 5DMLA 5HQEA 1ZSXA 1C90A 1BTCA 2VGGA 4UTIA 5K9XA 2PDHA 1FUYA 3OIHA 4LNCA 1WCGA 4M80A 3HG3A 2WNWA 3A9BA 5CSRA 1J93A 3PWIA 3WJXA 4RDWA 4NXSA 1UWRA 4PN2A 3W87A 1YW1A 1VPYA 1KTBA 2CBVA 3MQTA 2D2OA 1SSGA 4V1YA 3EXRA 4JYDA 1EZWA 4DWSB 1WYIA 4C91A 4GWEA 5AZ1A 4B5VA 2VEPA 1EJTC 1JFXA 5FJIA 1QNVA 2R6OA 4D6FA 3C2YA 1EC8A 2D69A 4UQEA 1J0YA 4H8HA 4HU3A 2OQLA 3THAA 3USZA 2HWGA 3B0VC 3AIQA 3G1FA 3TYZA 3AXMA 2ZX9A 3RLHA 1UA3A 3LI1A 2RJGA 2XSXA 1NDYA 4HZ8A 3N4EA 1CEOA 2ACSA 2CZDA 2PTZA 1EGVA 4F40A 3CT7A 2H90A 3PPHA 4XD4A 1AQHA 2DSUA 3WENA 2ZWYA 1E0WA 3MHUA 1A5AA 4AD1A 8TIMA 1OYCA 3NR0A 4HNLA 2OTDA 3THCA 5HR6A 2R1PA 1GVEA 3VD3A 3F4NA 3M5XA 3ECQA 1R9YA 3ITCA 2X1UA 3RITA 4JNMA 5T8GA 4KCWA 4X0NA 4HP5A 1L6YA 4K3ZA 4PUEA 5CJNA 4HNNA 2FB3A 4XKYB 2P5NA 2OG9A 3UBPC 4QEEA 1S2WA 4YYFA 5CZTA 2V5LA 4MKNA 3ARTA 3CB8A 4Z0JA 4GIAA 3URNA 2Y7EA 2IQTA 4M5PA 4PCPA 3TNOA 2XSAA 5LNRA 3SCSA 3ONBA 1BRLA 3FK4A 2DJXA 2DIEA 4J5NA 1AFSA 2ZUTA 2YDSA 2AQOA 3PULA 1XBVA 1XQLA 1GJWA 1IYXA 4HYWA 4WGXA 4DJFC 4C6IA 3GHUA 1EC9A 1XG4A 1RV8A 1EXPA 3SCVA 2F9RA 1WPCA 4Y9NA 1F9CA 2FTWA 1UWUA 3B03A 2W61A 4S3FA 3RX2A 4Q8QA 2J13A 1L0PA 1NVMA 1S2TA 2VGIA 5I06A 3PJTA 4V2XA 4FAMA 7XIMA 4GX9A 4DO4A 2PDIA 1OIFA 1S2AA 5BU9A 3VE9A 3LHTA 4MJ2A 4W85A 3TQVA 3BJSA 2QZRA 4HU4A 3CIXA 3LNPA 2OODA 3NPXA 4Z1AA 2FZNA 3LXBA 1F6KA 4RJEA 1EGZA 1F74A 1I6NA 4HTYA 4MYXA 3E02A 4U31A 1JR1A 3T78A 1IXNA 3CQJA 3ZLFA 3GH5A 4D72A 3ABSA 1N2VA 3SDOA 4PMRA 3TW9A 2D20A 3KRSA 3WQGA 1XYMA 3VNYA 1K9TA 3PF3A 4PUWA 2R82A 1NP2A 4LUIA 2E9LA 1K8YA 4S2BA 3OQEA 4AZ6A 4J3XA 1R5YA 5HNNA 4LTSA 4NAEA 2ZXQA 3C0JA 2YL6A 3S1WA 3IJ9A 3ZSTA 1JPMA 1TWDA 1RK6A 1X1ZA 3DCPA 3KWSA 1MUWA 2CWNA 3AMDA 3RFAA 4XZBA 3LMZA 4UFIA 1UZHA 1SW0A 6REQB 3PBWA 2J25A 3AXIA 1NWSA 4D8AA 4QNWA 3WFAA 3TVAA 4A8LA 1M9HA 6TAAA 1JIBA 2IQ0A 5IDIA 5BZAA 3WMLA 4ZSUA 1GOMA 4LU0A 4GINA 4XWUA 1M53A 4J1OA 2RJHA 1NU5A 3W7GA 5KSWA 1D3CA 3TU9A 4F2BA 3PTDA 3EA2A 2ABBA 3BH4A 4J9JA 2QDEA 4GVGA 4INFA 2ZVIA 1O5KA 3GU2A 1Z42A 3V5FA 3PUOA 4QE5A 1QU4A 4PCTA 1Q8JA 2ALRA 4HGXA 2IKJA 4AF0A 5HMDA 3MBDA 1H7PA 2ZVRA 4MHBA 3DH7A 4GX8A 4AEEA 1EWDA 4O57A 2XH4A 2VZTA 4IMCA 2G3MA 4H8VA 4QLKA 3VZZA 4GNJA 3HFTA 5A2BA 3PAOA 2CESA 4L4PA 4CNSA 3GQYA 4LGXA 1F8IA 5BWFA 5TQLA 3T2QA 4TVCA 4HCDA 4CQDA 5CBBA 5C9WA 2YSWA 3GR8A 3TOYA 4RKAA 5JQ9A 2PU1A 3EGJA 4XZMX 3WEZA 1GEHA 3V0UA 1JUBA 1TR1A 4GY1A 1HJSA 1DORA 1GOQA 4Q4PA 2ABAA 3SY5A 2PLMA 3S47A 3RU6A 4L9YA 4W8BA 2FHFA 2OU4A 2OZ3A 1F6YA 1MZRA 3S5SA 2WM1A 4LAKA 4TQTA 3HO8A 1W3JA 4JTFA 3B8VA 3EDFA 1ML1A 2OCZA 3N9SA 4KERA 4H9ZA 3PG8A 2CLMA 1OF6A 3V4BA 1P1MA 2Z2BA 1ZJBA 1CNVA 3AU6A 2G37A 3BQ6A 5ABEA 4ML9A 3PNZA 1FY6A 5HMEA 3ABQA 1G1YA 4IIDA 4GI4A 3I6TA 3MVTA 2YL9A 3WJWA 3EWBX 3SSJA 2P3ZA 2PPGA 5FAGA 1ZQ5A 3C52A 3EWWA 1C7TA 3S5ZA 1ONEA 1YYAA 1VBHA 3U0HA 1R2SA 1YTDA 3TCSA 2PS2A 1WDWA 3CT2A 5D2VA 3U6WA 3CQIA 1BQGA 4O28A 2ZCGA 4JOMA 3CWNA 4BWLC 2HISA 2F2KA 1WDRA 3FEQA 4ALDA 4DUWA 1K4HA 5HNRA 3UJFA 1IEVA 2HVOA 1DIOA 4Q4RA 2XISA 3I6EA 4OU1A 1ISXA 3POCA 3NWRA 4NJHA 1NQKA 1VRXA 1U5JA 1JF6A 2I5IA 3DYPA 3RAOA 3WBAA 5HULA 4BQ3A 1IQ8A 4IUOA 4UCFA 4DELA 2PU0A 3M7WA 3WF0A 4DYKA 4CN1A 4U5KA 2YGYA 1O1HA 2MNRA 4DF0A 4J3UA 1US2A 3S4TA 1KM4A 2DZUA 4D6GA 4Q4OA 2H6RA 2WPBA 4JEJA 1K7FA 4L80A 1J0JA 2Y7GA 1CXLA 3CYVA 4WOZA 3BMXA 4BI5A 1JGIA 5HNTA 4WD0A 2C8NA 4HPHA 1EXBA 2Z26A 3VM7A 3WNMA 2GK1A 4DZIA 4A2SA 2KZHA 3RK8A 2F38A 4IXHA 5AC4A 2WC3A 3CQKA 3WN6A 2QUNA 4WDXA 4O0KA 2HZGA 4O1EA 1VQTA 5DBTA 2JEPA 3BZJA 1E6SM 4N4QA 3N11A 4IJBA 3WMBA 5J5RA 5CZKA 2J78A 1XSIA 3D3AA 3NO1A 3M41A 2F6UA 2G41A 4AZIA 5E0CA 3PZNA 5ABFA 2QCEA 4H8UA 2C1HA 1ZGDA 3UNDA 3TEVA 2QMJA 2XN1A 2VEGA 2J66A 3CJPA 3LYEA 2P0IA 1J6OA 4L5ZA 1EPXA 3KRUA 4L61A 2WKJA 4GQGA 3LBCA 1UB3A 4DHGA 2P88A 1XIDA 2GVEA 2XH0A 3BW4A 4JY9A 2PCEA 2MANA 1PDZA 1PKLA 3QLDA 1VFFA 4QE4A 1EF3A 3UXAA 3QJAA 3WMCA 2QT3A 4GACA 1K7EA 3TDFA 3EOSA 5A95A 3WNLA 1CI1A 1TJ1A 4UFHA 5H8UA 3QQ0A 1UWAA 4GNVA 4B15A 1TV4A 4UQ9A 3WQEA 3W7LA 2HVMA 2B7PA 5HXMA 2F84A 4GE8A 4GYKA 1HKVA 3W2KA 1S1PA 4XZNX 3UA3A 1ADDA 1J2BA 4TIMA 3SN0A 3QQWA 1DJXA 1R87A 3NGFA 4FX6M 1UROA 3CLWA 1SZGA 1E0TA 3IARA 3H2OA 3O07A 1N8WA 5G4EA 4HZ7A 1JPHA 2ZTKA 1QCWA 5EBUA 3GDBA 3GZ3A 1X1NA 4DUXA 1ZY9A 5CBJA 5H1WA 3THUA 1RCXB 5D30A 2Z4GA 2E77A 3U9IA 4W7WA 3TYUA 4HHPA 3A5FA 5KINA 4ZO7A 2PWHA 4XZHA 5F2IA 3H6OA 4OFCA 3RM8A 1KQYA 3UZJA 3T8LA 5LKYA 2QLYA 1TFVA 3PZMA 1E6XM 3LY0A 3PZ9A 3AHVA 4JTGA 4LANA 3PS7A 1CPUA 4UXDA 3ABRA 4O13A 1UWSA 1PWMA 3TYEA 3R11A 8XIAA 2WZHA 2AGKA 1NFGA 1NOWA 2YBVA 3UYCA 1REQA 3N25A 1GWJA 3KEHA 1W8GA 1XISA 2YIHA 1K6WA 2CKSA 3W85A 1F76A 5E9AA 1YBQB 1I75A 2ONEA 2AL1A 2CU0A 1V03A 1ONXA 5RUBA 1AJZA 5BOOA 4O54A 3E2SA 1DWIM 1DOSA 2W66A 2XN2A 1JCJA 2PC8A 1HVQA 5D8WA 1A5OC 5D2XA 1OSEA 4XD3A 1FWRA 1V6WA 1M65A 1TUXA 4AU0A 3IJ7A 1KCZA 2DZXA 1W9BM 1BWKA 2G97A 1OGBA 4DBSA 1M7XA 2HPIA 1BRLB 1EOMA 1VLWA 4N6FA 4LS1A 1UH4A 4UMAA 3AOFA 3TTYA 1VYRA 1V51A 5CLTA 3WNOA 4AWUA 4WJ8A 4D6IA 1PL9A 2YFOA 1GOXA 1ZCOA 1FFQA 2BGSA 3H2FA 1O66A 1GQLA 1E70M 2V30A 2V3FA 3VD9A 4JQAA 5KETA 1FHLA 4FXFA 1SFLA 2P3EA 3U2CA 3ITVA 4U4MA 7TAAA 4GFIA 3HJZA 1HP5A 1ITQA 2PRLA 4E38A 1TJPA 1S46A 1MFVA 2PLJA 1PIIA 2BWGA 3WD0A 2JQXA 3T40A 3IVUA 2IW0A 3BICA 5E6ZA 2ALDA 4PC8A 3EX3A 1XIFA 1KM5A 3RIKA 2JIEA 4AISA 3B06A 4C7FA 1GQIA 3VU2A 4WEVX 3V5OA 9RUBA 4WZHA 2XYLA 5GJNA 4X22A 5F4SA 5I3GA 2W79A 3PNUA 5F2MA 4XAGA 4RXFA 3NQ2A 1S5NA 4Z0SA 3BE7A 3NVDA 2V3DA 3VA8A 3GNOA 3P5YA 3QFWA 1PXGA 3SGUA 4GO8A 2OWXA 5E9XA 1X38A 3AWNA 3MKKA 5D9PA 3GXNA 4E5TA 3FS2A 1V5XA 1FCVA 3QR3A 4UTWC 3V1HA 1MEIA 2ZFAA 4NZ1A 3EX4A 2DUAA 2QCMA 3N1AA 4Q4KA 4MKVA 4BEUA 4IIGA 4OZOA 3ZSSA 3FVMA 1VF8A 4LYKA 4P7OA 3S6OA 3WL1A 3W6MA 3HPXA 4AD4A 3IJLA 1W2PA 2E1DA 4K1WA 4O4VA 1JI2A 4O1CA 5REQB 5FI8A 1EEPA 1AL7A 1UA7A 4H9MA 4UQDA 4LFYA 5HDRA 3DECA 2YCEA 3CUGA 4FX7A 1GW9A 3C3NA 3PZQA 1OB0A 3A21A 1EYEA 4Z17A 5C9RA 4G56A 1G4SA 4U2YA 1Z89A 5AHMA 5D04C 4PB5A 2DVXA 2Y62A 3NXLA 3VINA 4ZA0A 2QYGA 5EMUA 5F2GA 4MWAB 4IOTA 5AC7A 4HU8A 4Q6XA 4ZTXA 1IXQA 5EFDA 4WDWA 3P62A 2CHNA 3RLUA 1OX4B 3RHGA 3IRDA 2QVNA 3VCNA 1H50A 4FX8A 4IFKA 3V0SA 1FWCC 2Z6JA 4KEMA 1DWAM 1SR0A 1FCUA 3JS3A 3SEPA 4A29A 2GQ3A 3KDNA 1OK4A 1XLDA 2E6DA 1OD0A 4M6VA 1TCDA 2NT0A 3U7VA 1QPNA 3CTTA 1UP3A 2PZ0A 1B54A 4KIRA 4AC1X 1T96A 2XWEA 3OGSA 3R13A 1ZJIA 3VNIA 5CH9A 2Z1KA 4C6KA 1JDFA 1BLIA 5BXPA 1ZAJA 1BWLA 3PZTA 3ZFHA 4XTDA 5EU9A 2VOMA 5D33A 2BOEX 5I3FA 4O8RA 3BANA 2VR4A 5HUOA 1JQXA 1UASA 4R33A 3REQB 3B4YA 1XIBA 1JD9A 2VX7A 3Q65A 4FF7A 4F0LA 2DZPA 1J01A 2FMNA 4ASTA 2Q71A 3FEMA 1XLKA 4PB4A 4B9YA 2GOUA 2OKOA 1W3IA 5HNUA 2GGEA 3A3WA 2PDJA 1X39A 4GLEA 5AHEA 3F4VA 5FEXA 1M5WA 4I7UA 1CXEA 1GT8A 1BFNA 2PZNA 3SRFA 3SECA 2AAAA 1MQRA 2PDCA 2OB3A 6PTDA 3NXFA 2GVJA 7CGTA 4ADSA 2VQTA 2XIIA 4EIVA 3KLLA 1E4MM 1JGMA 3WYZA 4PTVA 1TPB1 2QJNA 1HO4A 3CWHA 1POJA 1HJWA 4I8DA 4XUGA 1E6RA 4H7CA 1ZP3A 2HJPA 5IHRA 4QAWA 4JTKA 4UTTC 1KB3A 4CQ8A 4KCTA 3E5PA 5AYBA 2A4AA 2GGGA 2GVGA 3K4WA 3D6NA 3QW4B 4F8XA 5AYIA 2WBKA 1W1YA 5CPTA 2E0PA 1NTHA 2IXUA 1IWAA 2VO5A 5L6UA 4HA4A 1A5NC 5G1MA 4OHQA 3NL3A 4D6DA 3F2BA 2QKFA 3GNDA 4DB7A 3NDOA 1U22A 4E2OA 4JTSA 3RR4A 2YCIX 1K3UA 2Y6ZA 3WUBA 1WKFA 2A6LA 3WK3A 4XBSA 1E6PA 3GIQA 4XZ9A 3PJWA 3LGEA 2P0OA 5A6KA 4ZQPA 1LJYA 3EWZA 3UY8A 4OGZA 3U5YA 3HJEA 4AVOA 2VL4A 3BAJA 3TR9A 4I6VA 3S2CA 1KV5A 1P0BA 1MEHA 3SCWA 2P10A 1KKOA 3G2GA 3PWAA 3SCTA 2E1WA 1GG0A 3S2JA 4C6BA 3W3OA 2FH6A 5FEWA 1KXTA 3QZEA 4UZUA 1R46A 1RPXA 2Z7KA 6REQA 5A1AA 3AWOA 1RK5A 1EHNA 1JNDA 3FV9A 2E68A 1TMHA 2H8ZA 1YNPA 3TP4A 4GUJA 3ARPA 4JIEA 1XKYA 1Q8AA 1OX6A 2GL5A 4XG1A 1M01A 2A79A 4HSOA 3P93A 1B3WA 4A4AA 4G9PA 1YNQA 1KA9F 3UESA 2J8FA 3MP5A 1XSKA 1PJ9A 2OGYA 2G3NA 3W4RA 4E8CA 4DI9A 2WSYA 1H7RA 1V6VA 5C71A 3QY7A 4DAIA 2DUXA 4RV8A 1C92A 2PBGA 1V0MA 3N9RA 2J9YA 3T07A 3AXKA 4AMAA 4CNOA 2WMHA 1R8LA 4Y6GA 4B5WA 4LUSB 4QNEA 3S2MA 1EKOA 1TA3B 4MIMA 4M1RA 3GHRA 4W9TA 3RPMA 3NGJA 2YXGA 2D23A 3INPA 2QAFA 2VFFA 1XRTA 4UIOA 5E09A 1IEQA 2ZWZA 1V7YA 1I2NA 4DJFD 4Q8NA 1DWFM 2Y7DA 1FWAC 4AIUA 2XGBA 2Z2UA 3LCFA 4K2SA 1W5QA 2FVMA 1QNQA 3PTQA 5K4ZA 1W9DM 1GG1A 5EBAA 3AS2A 1YXDA 1GUVA 5BMWA 2PTYA 4I9AA 4HQVA 4FIRA 5BWAA 1ONRA 4FIQA 3PBVA 2J74A 1XIEA 1FWSA 3TKFA 2GJXA 1H5VA 1RD6A 1C93A 1U33A 4BR1A 2IMRA 4HA1A 4LS2A 3VNMA 3GW0A 5HJLA 4GVHA 1Y5XA 3OYZA 2VFIA 5I3DA 2OYLA 3DFSA 2I56A 1EWEA 4Y96A 4JTUA 1JUKA 1R6WA 1K77A 2BVDA 2FJKA 4WSHA 4PH6A 4ML4A 2VFHA 3THDA 1MEWA 2E6AA 3EWXA 1X1OA 5FL1A 1CLKA 3BARA 2ZX8A 2RDWA 3PUGA 2PWDA 2VQUA 1CGVA 2VX4A 5GPRA 3GVQA 3F4DA 4HMEA 1RQEA 1I45A 4QITA 1P43A 1TRDA 3LCLA 4R7OA 3W6LA 5DRIA 3W02A 1FWHC 2CZ5A 3GXFA 3B05A 4PTWA 1ZJAA 2PEVA 2BXVA 2W6RA 3C3UA 3ZO9A 2Y5SA 4XO6A 5AB3A 4Y9AA 3SO7A 1ISWA 3VKJA 4H1ZA 4J3TA 1HKJA 1Q13A 4DJDA 5E0FA 4AIBA 3WQWA 1A0EA 1CGUA 3HGJA 1Q6LA 3OBEA 3AXHA 3G0XA 2GJNA 1DBTA 2PWEA 1W3KA 2PDBA 4W86A 4JKLA 1XLIA 2HS6A 4PFMA 3BTNA 3GR7A 2ZUNA 1RVGA 3LK6A 2JGQA 1CT5A 2QGHA 3TLLA 1U5HA 3O6CA 5EMJA 1PO9A 3WJYA 4NT0A 1DXFA 3W9ZA 1FWNA 3GBDA 4C7DA 3KHDA 5IOBA 4TR9A 3BO9A 2NX3A 1LOSA 3MY9A 1XGEA 3ZT6A 4CVWA 4QQUA 4D1IA 2Y89A 4HCLA 1QPKA 5GNZA 3I4EA 4CCCA 4MLRA 2DGAA 1XYBA 4GIYA 5D2YA 4ECLA 3DI1A 3CUFA 3HV8A 4UOJA 4MY1A 3CZEA 3F2CA 4RZ4A 2BODX 3QN3A 2C1IA 1I9CB 3BOLA 3IUDA 3PP7A 3L5MA 1O95A 2AL2A 1WNOA 3WDIA 1F3EA 1Y5VA 3I6RA 2VCCA 1K8XA 3P5ZA 3WLPA 3MCOA 1WUFA 3HURA 5FEPA 3PZOA 4DO5A 4Q8OA 1Q6FA 3HG2A 2YR1A 3FDGA 3KZPA 2WLZA 3A3HA 4DWSD 1G01A 2O7QA 4JPGA 5ABHA 1BYCA 7TIMA 3R5EA 3Q58A 1PHWA 1XPYA 3OP2A 3L4XA 4I3GA 4PFHA 3ZVHA 2A3LA 3MO4A 1EGMA 6A3HA 1Z44A 3OGRA 3MYOA 4A8NA 2QJMA 4O14A 3CYJA 2BY1A 2CLOA 2WNQA 4RZBA 1JJKA 2WC7A 3R25A 4C7GA 4F66A 3AJXA 2Z6IA 3VMPA 1G9HA 4IPIA 1BF6A 1N55A 2R24A 4RPPA 3NUKA 3DKLA 3W1UA 4JX5A 4PRTA 4R7WA 1TVPA 2VJXA 3CEUA 3EDDA 3U4FA 4MB1A 2WZEA 4TX6A 1XLEA 3LERA 4ACYA 4AZBA 3CL7A 4FR1A 1QWKA 4NZ3A 4LUTB 3P84A 1TJ2A 2D73A 2YYUA 2A6NA 2DIJA 2RFGA 1HL2A 4Y9PA 2PRMA 4Q33A 3QM3A 1PZ2A 1ZUAX 4K8EA 1MQPA 2ATMA 2HVNA 3ZS4A 1VFUA 1E0XA 3CZGA 3PZVA 2Y0FA 2Z25A 1BHGA 4FLOA 2YKKA 8CGTA 3QV9A 3DX5A 3G6MA 2O7SA 2ACRA 3WZ0E 4J3WA 3H2CA 4PUDA 4H01A 4YU1A 1HJXA 3OLIA 2BS9A 1IXOA 3NTYA 2OOGA 1IHIA 3UZYA 4RNJA 4L9ZA 3LTPA 3W7HA 1JZ7A 3P7YA 4GI6A 1JXKA 1EDTA 3W28A 4DJED 4V27A 3VPLA 3GDRA 2HNEA 3NQEA 3VD5A 3YPIA 1E4LA 3UWUA 1T5AA 3G24A 1WQ5A 3SBFA 2J6XA 2PDPA 4RX0A 3BAXA 4HSHA 2XU2A 1KFBA 1P0EA 1PKMA 2DSKA 3P14A 1BVWA 3VABA 3OQ8A 4JTQA 1XLAA 4YMZA 4DPPA 4S3AA 3WSUA 1EUAA 3ZT5A 4NQ1A 3NQVA 1XX1A 3U7BA 5A3HA 3JRKA 4F9JA 3E2QA 3T0BA 1QPRA 4DJFA 3PBUA 2BXYA 3FJNA 5CZSA 2AOSA 3FSUA 3HQNA 5CC5A 4LBUA 3PANA 1NWUA 1QAPA 4L4OA 3URQA 1M7OA 3N9KA 1IT0A 4YS1A 3W72A 4A3QA 5FJTA 1EL3A 3IIVA 1I2RA 1Q66A 4G6CA 3HGRA 4Y7EA 3MVIA 1VGAA 1R47A 1T0OA 3EA1A 3O16A 1FH7A 2B4GA 3UYIA 4HSNA 4YTRA 4MPKA 4L6OA 1IF2A 1WDPA 3U8GA 4TMCA 1JCYA 4B5SA 1TREA 1QNPA 5XIMA 1KFLA 3QY6A 3U2OA 2WJFA 3LHZA 5HQMA 3WLTA 1J12A 3LSCA 1QMLA 4ZXLA 3CV2A 1CGTA 1C91A 2QULA 2PB1A 3LRKA 4AYSA 5C54A 1P5BA 2ACUA 1Z6KA 2X09A 1OYAA 4Q22A 2YXOA 5GJMA 1CCWB 5ABTA 4LF2A 3PWGA 3A6OA 1UP2A 2Q8ZA 5L9FA 1JF5A 4NSBA 1JCXA 2ISSA 1I2OA 4LRSA 1E6NA 2KX9A 4FOJA 3A24A 5CPSA 2DW7A 4H9UA 4UQBA 4QX4A 3T7VA 3DFHA 3MUAA 2NQ9A 3MSYA 1HT6A 3GZAA 1SZNA 2DEPA 4W93A 4RW5A 2CPUA 3B04A 4WSJA 2C18A 4LV4A 3ARQA 3A23A 3VGHA 3M0YA 4L1WA 1IZKA 3M0MA 2ZC8A 4XAZA 5EGRA 5AC5A 1MXGA 4DVOA 3D47A 4JQ4A 2HSAA 2DT3A 3UF9A 1F3XA 4Z2JA 4JNZA 4REQA 3N4FA 1U2YA 5EMLA 3HPZA 3NYZA 4IP5A 5A8PA 1K9FA 4C6QA 3AU2A 4N4PA 4D6HA 2VGBA 1MZHA 1DXEA 4MFEA 5LNWA 3OOQA 2J6VA 1ME7A 2ZX6A 4JTEA 4S3BA 1FTXA 2C1GA 4NP7A 1G4EA 1H11A 5IFTA 1UUMA 4MB5A 1W5OA 2QDHA 4RDYA 3SRHA 3APYA 1E15A 3L68A 1XIGA 1F3TA 3OA3A 3E96A 4GXMA 3VGGA 3VVGA 1OX4A 2PGEA 1YE6A 4JTIA 3HTWA 2PRHA 4GGHA 4ZTYA 3OLDA 4AXNA 4GYPA 4KMQA 4BQ4A 4FI4A 1E1CA 6TIMA 5A6LA 2Y8VA 3W76A 4PA8A 4GIEA 1LYXA 1R3SA 1A4LA 3I65A 2IPFA 5DEZA 3TWAA 2Z1VA 2FMOA 3OVRA 4HZMA 1D7KA 5KZDA 1PPIA 4EWJA 5HJYA 1H1ZA 1PUDA 2OX1A 2WXDM 4ZR8A 2YLLA 3NJ3A 5PTDA 2PLKA 1K9DA 2WMIA 5I2UA 1JDDA 4ZODA 1EP3A 1BYAA 1B4EA 5MHBA 5FJPA 4NZCA 1DJWA 4K6AA 2Y8UA 4WJEA 3RNDA 1KRCC 2CLLA 3AUOA 3M47A 2FZ8A 1WZMA 1DP0A 2E25A 1Q4WA 4ZQCA 4P7RA 5DXYA 3RRAA 4NX5A 3E0LA 1ISVA 4HOZA 1JYVA 3SCUA 3WIJA 1EO5A 1JPDX 2XIBA 4PCNA 1GOIA 3BV7A 1NY1A 2GPTA 3LB0A 1IIGA 5CG0A 1TG7A 3WDQA 3CUZA 3PM6A 1JZ8A 4I9TA 4HJFA 3QYSA 3TFCA 4GY0A 3WLOA 4TUFA 3GTNA 1TV7A 3STCA 2VFDA 1QASA 2BNJA 3JZUA 4M8UA 3TAOA 3BMVA 1LF1A 3AO0A 3LGGA 4AD5A 4OOZA 3CU2A 2A0NA 3USBA 2OT1A 3O2LA 4YYCA 3KBVA 1A47A 1GQNA 1TYGA 7ENLA 3FOKA 3TJXA 1WZAA 1X97A 5F4WA 3LHYA 3L2LA 4MF4A 1LT7A 5JBEA 1PHQA 3QGVA 3WD1A 3H8AA 3EMQA 5A5WA 5A8MA 1JAKA 5D03A 3NQAA 3N6JA 3C2EA 4PCFA 3MT1A 3JW7A 3WUEA 4WY0A 1SSDA 1RLDA 1EOKA 3GBEA 3WQCA 4FALA 4LX4A 5DN1A