4AXKA

Crystal structure of subhisa from the thermophile corynebacterium efficiens
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
b'TFTILPAVDVVNGQAVRLDQSYGTPLESALRWQEQGAEWLHFVDLDAAFNRGSNHELMAEITRQLDIKVELTGGIRDDASLERALATGATRVNIGTAALEKPEWIADVIRRHGEKIAVDIAVRLENGEWRTKGNDGGDLWEVLERLDSQGCSRFVVTDVSKDGTLTGPNVDLLRDVAAATDAPIVASGGISTLEDVLGLAKYQDEGIDSVIIGKALYEHRFTLAEALEAVEKLGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENE
publication title Evolution of Substrate Specificity in a Recipient'S Enzyme Following Horizontal Gene Transfer.
pubmed doi rcsb
source organism Corynebacterium efficiens
molecule tags Isomerase
total genus 82
structure length 235
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4axkA00
3HBLA 4LRSA 3P8JA 3O06A 1YDNA 5TQLA 5LHEA 4JX6A 4EF9A 1DOSA 1NVMA 4PC8A 1ZCOA 3TU9A 1DORA 3PSVA 3DHFA 3IIXA 1GVSA 6TIMA 5KTLA 3LRMA 5D38A 2RHGA 4NNAA 2Y7FA 2YGYA 2Y88A 2Y85A 1JUBA 5G2WA 4JTTA 1S5WA 2WNQA 3HGRA 3KOFA 4TMCA 3HQ1A 1E51A 1I2NA 4JGDA 1IGSA 1QPRA 1O60A 5AC7A 3TX9A 4Z1AA 2VXNA 5HR6A 1NF0A 3HG5A 2IQTA 4K8HA 2X1TA 1QPQA 3KRZA 1GVOA 5FEWA 2A7RA 2ZZ5A 1OYCA 3DFTA 2C0AA 4Z1CA 3QRHA 2B4GA 4KKXA 3L5MA 2GVLA 2FDSA 2R91A 3LTYA 1WQ5A 3QMSA 3TH6A 3VI2A 5HINA 3Q37A 4QNEA 3MHFA 3EKZA 2DZXA 3EX2A 1XKYA 4IMDA 4UFJA 3KVLA 3CIXA 2P1FA 3R89A 2ISSA 2X16A 3G0XA 5CPLA 3LLFA 1SZFA 5DELA 1EB3A 4JY8A 1GVQA 1ICQA 3NQVA 2CLHA 1EP1A 1SFJA 2B0MA 4MYXA 4QISA 1EA0A 1FWRA 4YXGA 3BLIA 2QJIA 3FFSA 4O1DA 3DXIA 3GX9A 2NUYA 2CLIA 4JX5A 3GKFA 3W7QA 4GWEA 1TREA 4XTIA 1SO6A 2A4AA 2FFCA 1W3NA 5AN7A 2ZYFA 3W1MA 3KVKA 1H50A 1YPFA 5K2ZA 2W79A 1DV7A 2HTMA 1GYNA 4NJHA 1XUUA 1M6JA 1V5XA 1ZAHA 3C8FA 3W75A 1YPIA 5FF3A 1KFLA 5BMXA 4DF0A 1IF2A 4MY9A 2Z1BA 4KWWA 3SGZA 3KAOA 2V5LA 4O4VA 3KVJA 3G1FA 1RD5A 3M43A 4LVAA 3IIPA 4O16A 4O13A 4XUGA 5G2HA 3SZ8A 4AAJA 3STCA 2LLEA 2QUUA 1BWKA 1X1ZA 1XBXA 1WOAA 2UV8G 1FWTA 4M19A 5FEPA 2NZLA 4HNUA 1R2RA 3HGOA 3W88A 3U2OA 4JDBA 3UY7A 3W7EA 3EX3A 4ZMGA 5EL1A 2X30A 1JULA 3W2LA 3W1TA 2GOUA 1SZEA 2J24A 4AWUA 1HG3A 3PSWA 2AQWA 3OBKA 1W31A 1HO1A 2H8XA 1TTQA 1VLWA 3NQAA 5K9XA 4UTIA 3EXTA 2XN1A 3O6YX 3W1NA 2ZRVA 2E5DA 3VE9A 1TTJA 5D03A 3DFPA 2VEMA 2R14A 5CGQA 3LCWA 5HR7A 3DZ1A 4JIQA 4NJJA 5I3JA 4UFHA 3KX6A 5IBXA 4PH6A 1I4NA 1I2QA 3DKJA 4JYFA 2F84A 2VEPA 4XTDA 3W2NA 3VKJA 5DN1A 1G4TA 3W1UA 3GXTA 1N8FA 1NSJA 1H7RA 4MPQA 3CWOX 3KFTA 4UTKA 1JJKA 1W56A 3QMRA 1TO3A 5D30A 1X6UA 4JDYA 4IUOA 5HQEA 3WK3A 3LCGA 1FWWA 2V2DA 4ZQCA 1JCXA 1IXPA 4LY8A 3B0PA 5AOUA 1P1XA 4LVGA 4NNBA 2OJPA 2XFWA 5FF2A 3VFLA 2ZZ2A 3NO5A 4O11A 4Y8FA 1VZWA 2YZRA 4C1KA 1F5ZA 2G96A 3V75A 2DJLA 3WJXA 3GDKA 2EPHA 1F76A 4ORIA 5D04C 1LM1A 2WOQA 4K6AA 1KLZA 1AW5A 3M16A 4JYEA 3IVTA 2CZFA 2GUUA 3W7PA 4N4PA 1YADA 4XKYA 4HIBA 1FDJA 4I7WA 3LI0A 3NQ2A 3P81A 3WJYA 3P80A 5TBOA 3OA3A 3P82A 1QMLA 3F1QA 1K8YA 1OF8A 4TIMA 3L2IA 3TSDA 1VQTA 2ZA1A 3H53A 4R7JA 3C52A 1IXNA 5HMSA 1H1ZA 5F1VA 1D9EA 3PBWA 5LZLA 5G4EA 1ME7A 5G1YA 2VFIA 4TMBA 4RLIA 5E93A 2VFFA 2J88A 3L0GA 3LX9A 2YPIA 5K9DA 1WX0A 4EF8A 3NQMA 3ZFHA 4W9TA 1FCUA 3EWWA 4JYDA 3ELFA 3MI2A 3ABSA 3QSTA 4MIMA 2C13A 1H60A 1W5QA 1N55A 4GFSA 3DENA 4L4MA 5CZTA 3BGJA 4KFNA 1TV5A 2CLEA 3TQVA 3LOTA 3PWAA 3NGJA 3MHGA 1JCNA 3H55A 4OWGA 2V82A 2HS6A 3NL2A 1VCVA 4O50A 1XBYA 3QEZA 4OHQA 1P5BA 2CFFA 4YLWA 2NWSA 4O53A 1S5VA 3CIWA 4RXGA 3UQNA 3IGSA 3TROA 2ZA3A 3IEBA 5HWMA 3GXNA 3WK2A 3DFNA 5D2VA 4R33A 3MW7A 2VEKA 4RZ6A 5K3VA 4JIPA 2QCNA 2YXGA 3LHWA 3QC3A 2E5BA 1A53A 3HGSA 1BTMA 3TAOA 5LNVA 4PODA 2NX3A 2OX1A 3LHYA 1L9WA 4WUIA 5EYWA 1J2WA 1Z41A 4M6QA 4MZ8A 2WNNA 5AYXA 5G5IA 1IIHA 5AHLA 3INPA 3SSJA 1RV8A 2PRMA 3LERA 1C9DA 3PB2A 1XI3A 3E02A 3QW3A 4JR5A 2VKZG 4MJZA 2RDWA 4O12A 5HJLA 3S1UA 3W1XA 1B9BA 3M7WA 2JKPA 2AGKA 2V5BA 2BXVA 5L6UA 1KV5A 1VLIA 1KM2A 3OVQA 3PBVA 2DU2A 3QZEA 3W7KA 1TQXA 4XQ6A 4A21A 1H1YA 4EIVA 4IMEA 2CLOA 1K8ZA 3PBUA 2V8ZA 5CZ0A 1T99A 5HULA 1G7UA 4O19A 2JK2A 2X1SA 3U8GA 1QOQA 3NZRA 4DF2A 3NQFA 4DPQA 3UWWA 2WKJA 3QFEA 3QJAA 4R34A 2TYSA 1KM5A 4CCCA 2PCQA 4XWUA 5C2XA 4DEFA 5KZEA 4UFKA 2VFHA 1I2RA 2D73A 1KA9F 3FOKA 1PV8A 4O1CA 4AHPA 4JTHA 4O14A 4OQVA 1TTPA 2H90A 3TFCA 3H54A 4OE7A 4OU1A 2QCMA 5D2WA 2P10A 4RR4A 3QPZA 4LVBA 4KFPA 1EUNA 3MI3A 3GZ3A 4NZFA 4MLRA 3MP5A 4AEOA 4HT3A 4LUJA 4Q33A 4BI6A 3AO0A 1TPVA 1LOQA 3LCLA 4BWLC 3VNDA 3W07A 4ADSA 3S5ZA 1F73A 5F2GA 1M5WA 4JY9A 1U5JA 1YLVA 4LWWA 1TPFA 2WJZA 1XDMA 1Y0EA 1P4CA 5I3IA 1OFQA 3S42A 4UR8A 3LRLA 2YYUA 2A2IA 3W86A 1JCLA 4DBEA 2DZPA 1T0OA 2I9EA 3W87A 4UTWC 3EKLA 3PVFA 1V7YA 1UB3A 5A5WA 5F1UA 5HWNA 2GQAA 7TIMA 3EWZA 1FCVA 4UMBA 3TMLA 3W85A 3GKAA 4NQ1A 3DFSA 3LGEA 4LS0A 3CU2A 3W7GA 3ABOA 2ALDA 3M41A 3B03A 1OK4A 4RJEA 4S1FA 1AL7A 3TCEA 1L6YA 4O10A 4UFIA 1PCWA 4WY0F 5K7JA 2B7OA 3N19B 4UTHA 2QCCA 1OX4B 2FLIA 1OHLA 2A7NA 3IRDA 3E0IA 1EP2A 4MY8A 3LCXA 1OABA 4PL2A 2CWNA 5KITA 3MP3A 2GJNA 3G24A 4IPJA 3W2UA 3T55A 1A50A 4FNUA 1LZOA 2GQ8A 5EKYA 1GTHA 3W74A 2J6XA 4GRSA 1F6KA 1K7XA 4N6EA 4M5PA 1KTBA 4Y90A 5SWUA 4UNKA 3TDFA 2EKCA 1C29A 1H7WA 5D02A 2DP3A 1YXDA 4RV8A 5I3KA 2VFEA 1A5SA 3RLVA 3HO8A 1H7XA 1TYGA 4O57A 1IXQA 3M5VA 2C16A 5DCEA 3FJLA 3UZJA 1LROA 4MVAA 1ZAJA 2YFOA 1R2SA 4AHOA 5FF0A 3NA8A 2OCZA 2YR1A 3DFQA 1FQ0A 2ISVA 1TV7A 4RX0A 4EWND 2CZEA 1EIXA 4IX2A 5G1TA 1NAL1 4OGZA 1W5PA 4GNJA 5AYYA 3O15A 2VELA 2JKEA 3NQ8A 3GR7A 3LHZA 3MBFA 1OYBA 4Z1BA 1JUKA 4G1KA 4K36A 5AHEA 4H6KA 3QSRA 1FXQA 3MJYA 3MMTA 3FEMA 3T44A 2EGZA 1VCFA 4FB7A 2FTPA 3M0ZA 3HG4A 1FWNA 2Z2UA 5E1QA 1FX6A 1KM1A 3GIYA 5AHMA 1XDLA 2PURA 3B0UX 5D2TA 1B57A 3HPXA 4RCXA 1EPXA 4AF0B 5LGXA 1RQHA 3JS3A 5EPDA 3TV8A 2QCDA 3QMTA 3W1QA 3WK1A 4NJKA 3UWVA 3GVGA 1LLWA 4LRTA 1GT8A 1YTDA 8TIMA 5EY5A 1LYXA 3W7DA 3B06A 2DZUA 1GYLA 1W3TA 3LXAA 4FX6M 1H7OA 1R46A 3F4NA 2QDHA 1JRBA 2B7NA 2ZCGA 1HFBA 4TO8A 1JR1A 2Z0IA 4HN4A 1IXOA 1UUOA 5BNKA 4OBTA 2C6QA 4WD0A 2Z6IA 4DXVA 4Q32A 3A23A 4NXKA 3IIZA 3TC6A 1FXPA 3W70A 3SIZA 4ZVJA 4X22A 4E2DA 3SI9A 4IWWA 4DQWA 4LV4A 1VYPX 2FB2A 3TXZA 1JCMP 3N2XA 3FLUA 3NL3A 4JTIA 2H3DA 4LNYA 4GE8A 2PRHA 3G18A 4AMAA 3ZS4A 1RQBA 4QQ3A 1PHWA 4IMFA 1FDYA 2NX1A 3LBMA 4RK8A 3QQ0A 2CLMA 4LS1A 4N6FA 1QNVA 3EWXA 2NUXA 5LNUA 3G1HA 5LKYA 1VPXA 2V30A 1ICPA 2ZZ4A 1AMKA 3PBYA 5KZDA 3SFKA 1ADOA 1UCWA 1T96A 3G22A 3I65A 1TMHA 2WSQA 1JCYA 1Q6QA 2BLEA 4K7YA 4MKNA 2TSYA 3LCFA 1W5NA 4FIRA 2OZ0A 2W6RA 2Q8ZA 2A85A 2QKFA 3K30A 5LSMA 3W23A 3GNNA 4ZQOA 3P62A 2JGYA 5BMWA 4FNQA 1ZALA 4IXHA 1H62A 1A5BA 1MXSA 3B0VC 3GR8A 1D3HA 1WBHA 3L67A 1ME9A 3HG3A 1RQEA 1B3OA 2ZQ0A 5DBTA 2Y6ZA 1K8XA 4UTUA 1DJQA 2Y7EA 1KFKA 3QYQA 3W71A 1W0MA 1S3HA 2R94A 4MJMA 3NR0A 1GG1A 4MLJA 3LM7A 3WJSA 3OG3A 3M1ZA 1LORA 4JTJA 2VC6A 4Y9AA 1DQWA 4JTSA 4PCFA 4AHQA 3EXRA 4WOZA 5KSWA 1GPWA 3LI1A 4BF9A 4WY0B 5D32A 2H8ZA 5K9CA 2BSLA 2Y7DA 4UNLA 3MUXA 4QSHA 3QM3A 2DJXA 3IIVA 4JICA 2CU0A 4HHPA 2G5WA 3IGXA 3YPIA 3O05A 3PM6A 5D09A 5D2XA 2VFGA 1EX5A 1KW1A 1TPB1 1XBVA 3JRKA 4EVZA 1W5MA 1VCGA 3MHUA 2J9ZA 1X8FA 1Q45A 2NLIA 4XBSA 1VJIA 1FWSA 3BPWA 4YWIA 2E77A 2DZTA 1RR2A 3CQ0A 1GWJA 2QCFA 3GDTA 4K8EA 3E12A 1FUYA 4WOQA 3L21A 4C1LA 2AAMA 3GAKA 5FESA 1WYIA 4Z08A 3G1DA 1ZENA 2CZ5A 1PHQA 5FF7A 5CKSA 3OIXA 3S5OA 1KBIA 1SO4A 3C0JA 3N9SA 5AC6A 3ABQA 4WXZA 4AWSA 2VOMA 4FX8A 5HWJA 4P61A 5DY3A 1DVJA 1DJNA 1WV2A 4NX0A 5DXXA 1LRQA 3NPXA 2Q3RA 6ALDA 3TK7A 1SR9A 4M6PA 1J4EA 4O8RA 2NV2A 2FPVA 3CT7A 1DBTA 5DXYA 4LV9A 2Q8LA 1R47A 2V2HA 4NNCA 3LV5A 1W5OA 3NEVA 1HL2A 5DCDA 3O63A 2B7QA 3W3OA 3CTLA 1W37A 4I7VA 3RK8A 2JGQA 4LU0A 4GUFA 3UYCA 3UY8A 4OV4A 4DF1A 4UMAA 3DAQA 3DHDA 3NDOA 1FBAA 4PEKA 3TR2A 2EAWA 3LCIA 3A22A 2GPTA 2BX7A 4AXKA 4IQLA 3G8EA 4X3ZA 4HPXA 4QITA 1KBJA 1SW0A 5AB3A 1OFDA 3DI0A 1PCKA 2YCEA 1KTNA 3TAKA 3NM3A 5LNWA 3BGGA 2I1OA 5A8GA 3PG9A 4Q4KA 1XBZA 3O8AA 1LCOA 3OHIA 2BZNA 1VHCA 1HUVA 4D2JA 3LBCA 4O0KA 1TPDA 2G97A 3UD6A 1QAPA 4O15A 3PG8A 1THFD 1G6CA 4FNTA 1NF7A 3L0KA 3HGJA 4HPJA 3G1SA 1TSIA 2E6AA 4JNMA 2ABBA 2X1RA 2E68A 4HNVA 1AK5A 3T4CA 3TSBA 3DU0A 3TMQA 1CW2A 3L9CA 2ABAA 4IOTA 1KM6A 1TPEA 3DKLA 3W84A 2Y62A 2QDGA 3G1AA 3GDRA 1A5AA 3M5YA 4NUWA 5DBUA 2ZZ3A 5U4NA 4A29A 4BK9A 3LV6A 2Y70A 3T7VA 2NXIA 3O07A 5F2MA 1D3GA 1YXCA 1SPQA 1TCDA 2XN2A 3P61A 1UBSA 4QAIA 5AHNA 1ZJIA 4CCEA 3NPVA 4JTUA 1DL3A 1J5TA 1X1OA 5CPMA 1OFAA 2A7PA 3TQ0A 5U7SA 3CEUA 2G95A 4Z0JA 1OX6A 4Z1DA 3W72A 2RH9A 3G3DA 4NT0A 5FEXA 4LS2A 3LTPA 3HJZA 1XM3A 2ATSA 1W54A 1Z48A 3A9IA 3STEA 3BW2A 4ZQNA 3PY2A 1TPWA 1A5CA 3EWUA 4I7UA 4UFMA 3W2JA 3C2RA 3DH7A 3PS7A 4JEQA 1SQ7A 4JTEA 2GQ9A 4FXSA 1BEUA 3QQ1A 1O94A 4CQ8A 3TKFA 2TPSA 3LLDA 1UASA 3GDLA 5J5RA 4QM1A 4MFDA 1ZHAA 5DY2A 4HKPA 5E0KA 3UWYA 3NL6A 1KFEA 4YMZA 3NZ1A 3EXSA 4UCGA 4IX0A 3P67A 1TJPA 4X2RA 3W6YA 1I2OA 5C54A 4NZJA 3W2KA 1G4PA 3S1XA 3OEXA 3N9RA 1ONRA 5CZSA 3GK0A 5KMYA 1GEQA 1MSSA 1HO4A 3RMJA 4O28A 4TX9A 4A2SA 5LNRA 1S5TA 2A6LA 4K7VA 4UC5A 4ZZ9A 3GAYA 1OFRA 2BWGA 3W76A 4ORMA 2NXHA 3CB8A 3P5ZA 1VYSX 1DQXA 3FYPA 5F4SA 2ZZ1A 1EWDA 1KFBA 5F4WA 3OVPA 1JRCA 4NVTA 1M7OA 4Z0SA 1GG0A 4PA8A 3W7JA 4LW7A 4LC8A 4JTLA 4MZ1A 3A21A 1HTIA 4LTSA 4O1BA 4UTTC 1I2PA 1GVRA 4YCOA 1Q6LA 3LXBA 3TIMA 4CCDA 5K4ZA 3MBDA 3M5ZA 1LTDA 1SU5A 1SZGA 5T26A 2ATMA 1G4EA 2E1DA 3I7QA 3O6CA 2Y7GA 3KRSA 3PUEA 3ZR4A 1W1ZA 3LB0A 3SGUA 2A21A 2RDUA 3HMJG 1H51A 3FYOA 1UJPA 3I7RA 4MY1A 1OFOA 3FA5A 1TPH1 2QEZA 4BI5A 2BTMA 3ABRA 1YTKA 3R5EA 1Q3NA 5FF4A 1H61A 4UFLA 3BK0A 4LC6A 3PUDA 1RVGA 3UWZA 4RKAA 3ZWSA 2C18A 3M5XA 4RZ5A 4DO6A 5CZJA 3GDMA 5IBXC 2RFGA 3SR7A 3N2MA 3WJWA 2EF9A 1RZMA 2DZSA 5H91A 2YYTA 4CNOA 4MZYA 4ALDA 1F05A 1NFBA 3O6DA 4UTJA 4AH7A 3P84A 2Y61A 5LNSA 4JD4A 3CWNA 4QJ1A 5BRBA 1TPC1 1QOPA 3S1WA 5DCBA 3BG9A 4IGHA 4CNPA 2QR6A 3IV3A 2ZZ6A 1MZHA 1QO5A 4WZHA 1ZAIA 1SSGA 4HSOA 3EX6A 4Y6GA 2ZFAA 5CSRA 3NG3A 1LOLA 3MI6A 3C61A 2H6RA 4LVDA 4UUIA 3M6YA 1F7BA 4PTNA 2RDTA 3STFA 2WO5A 4FO4A 1VH7A 3I68A 2H3BA 4GBUA 3I6RA 1QDSA 4YCPA 2O7SA 4DO5A 3PUOA 3P5YA 1NEYA 1XXXA 4ZL1A 1TRIA 3BG3A 5D05A 2Y63A 3N73A 2C15A 3HIJA 2QJGA 3A24A 3GYEA 3EX4A 1F6PA 2FB3A 2O7QA 1WBJA 3S0CA 4DO4A 4A2RA 4DPPA 1B4KA 1WA3A 1SUXA 3G8RA 3NQCA 1JUEA 1TB3A 3LDVA 4MYAA 1EEPA 1FCQA 2JBMA 3BLEA 2ZRWA 4UIOA 5IM51 4OV9A 2QAPA 3VE7A 1RPXA 2DORA 3TFXA 1VC4A 3FJ6A 4IXXA 1OX4A 3R12A 4B5NA 2ZDRA 4O54A 1XFBA 2CLFA 3NVTA 1QFEA 1FCBA 2F7FA 2GVJA 3UZ5A 3W7LA 4GJ1A 3TW7A 1OFBA 1OJXA 1LDCA 3CPRA 4GUHA 1YDOA 4FEZA 4WX2A 4XZ9A 5LGZA 3EEGA 4O52A 3B05A 1ME8A 3N14A 1CI1A 4DBDA 1Q6OA 3C2VA 3W1AA 1M7PA 3ATZA 2WV8A 2A6NA 3LHVA 3NXFA 3M44A 1VYRA 2C1HA 5H2ZA 1MEIA 5AC8A 4LUIA 4GUGA 2WQPA 2ZTJA 4AB4A 2DZVA 4CQ9A 4BWLA 4CNNA 4TU1A 3U6WA 1OF6A 1LBFA 1TV8A 1VS1A 3NPUA 3ANYA 3NM1A 4FF7A 4N9BA 4O18A 3USBA 5CPOA 4WQ6A 1JCJA 2FQIA 2ZBTA 3C6CA 3W7HA 3D0CA 3N34A 1LBLA 3HG2A 3WFAA 5I3GA 4JXCA 1L6SA 4L4LA 1JQXA 4FIQA 4XKYB 3T78A 3E49A 3QPYA 3V1PA 4UTTA 4UTWA 3MP4A 2WSRA 1WXJA 1KM0A 2DZWA 2VENA 3C2FA 3QH2A 5AHIA 3CM4A 4O4WA 1VR6A 5C5YA 2ZTKA 3W1RA 1AL8A 1ZNNA 1KM3A 5EBUA 1ZFJA 2C19A 4WJEA 4MOZA 3L68A 3NQGA 5AFDA 2HMCA 3R13A 4NJGA 1KM4A 2E09A 1QR7A 1FDZA 1PL9A 4N9CA 4CLMA 2FPTA 4QIUA 1OG0A 2V2CA 2Z6JA 3NQ6A 1B4EA 3HB9A 5MHBA 1W8SA 2ZRYA 5HUPA 2NV1A 3RLUA 3RU6A 2X1UA 3HPSA 2HS8A 2P0OA 3A5VA 3G0SA 4KWVA 2PC4A 4X9SA 4AF0A 1CX9A 2C3ZA 3IIOA 4J9JA 1YXYA 2FIQA 1XCFA 3UXAA 3W2MA 3CEPA 4ZQMA 3TNOA 1K03A 2E5CA 4UTLA 4IMGA 4BI7A 3EWYA 1KFJA 3P74A 3UPWA 1TIMA 2QCHA 4U28A 3PC0A 3UPBA 2RKXA 1BKSA 1I45A 2QCEA 4YL2A 2C14A 1L6WA 1GZGA 3SW6A 2NXGA 5AHFA 4CQAA 2ZRXA 1F74A 1H5YA 5CSSA 3GLCA 3S9YA 5FEZA 4WXYA 3A5FA 2NX9A 4FNSA 1XC4A 5FI8A 4JTKA 2TRSA 3GXPA 5LHFA 1K7EA 3MWAA 4LT9A 3EX1A 5AYZA 4POCA 1VHNA 3SY5A 4GUJA 4LOCA 3F03K 1TRDA 2QJHA 4ZQPA 4NJIA 1GQNA 3TSMA 2ZRZA 1P0NA 3VCRA 3RFAA 2I14A 4IMCA 3P8IA 1K3UA 3UXDA 1QPNA 3LTSA 3B8DA 1TTIA 3UNDA 3PR2A 3DI1A 1LBMA 1O5XA 1EUAA 1TQJA 1IIGA 4GXMA 5KINA 1KFCA 3PF3A 5F2LA 4TR9A 4EOUA 5EA9A 1OFPA 1ZY9A 2VFDA 3TC7A 3F4WA 5HNRA 2CLLA 2GVGA 3W1LA 1SSDA 1L2UA 4U4MA 1BWLA 3B4UA 5ABTA 4NXSA 4JTFA 1LP6A 3M47A 2JKAA 3C2EA 1K7FA 3PAJA 1P0KA 3BO9A 4N9EA 3W7CA 2HSAA 1MO0A 4O1AA 3PB0A 3CLMA 1OX5A 4O17A 4UMCA 4LVFA 1SW3A 2OMAA 4QNWA 2OT1A 3QF0A 3O16A 3BLFA 3C3NA 3OVRA 3G1YA 3W7MA 3KRUA 3BARA 1AG1O 1GJPA 3UWUA 2YX0A 1H7NA 3THAA 4AWTA 3LRKA 5EMUA 1C8VA 4S2CA 3FIGA 4N02A 1SO3A 1LRTA 4WY0A 4DELA 4IJBA 1R30A 4MFEA 3NPWA 3PULA 3HPZA 3MYPA 3G1XA 1X7FA 5L9FA 1VGAA 1N7KA 2YFNA 4JN6A 3NOEA 3SJ3A 3W1PA 3Q2DA 2XN0A 3BW3A 1U83A 1O4UA 2E6FA 1AW2A 2ISWA 4R53A 3W7NA 2ZRUA 3BG5A 2Q3OA 3O1NA 1PS9A 2QUVA 1EWEA 4FXRA 3IVSA 1GVFA 1UUMA 5K4XA 2X2GA 3TA6A 4A3UA 3NQEA 2ZZ7A 1JQVA 3KXQA 4E38A 4JX4A 4PL1A 3T40A 2NUWA 3S6DA 4NU7A 2QCGA 5DLCA 4BR1A 5HUOA 1T8XA 3C56A 3UWQA 4UR7A 1QWGA 2VEIA 4NX5A 3N3MA 5CG7A 2J27A 2QCLA 2YW4A 3HOJA 3KVMA 1OVDA 2B7PA 5F2IA 1WAUA 3Q94A 3MYOA 3CHVA 1OK6A 1H63A 1WDWA 3BV4A 3S5NA 3R2GA 3FKRA 1KLYA 1I8JA 2J9YA 2J9XA 1LOSA 1KTCA 3W83A 3W9ZA 1O95A 2V81A 3P60A 3W7IA 1EP3A 2E6DA 5D33A 4BFAA 4RZ4A 2QAFA 2YSWA 1TJRA 4K39A 2R8WA 3EB2A 1YTEA 5F4XA 3TJLA 5GVJA 3WJZA 1KV8A 4M7SA 1QO2A 2GJLA 3CC1A 3FS2A 3IVUA 1WOBA 3GNDA 1DHPA 3LHTA 5G2IA 3L0NA 1R2TA 1YYAA 3S5YA 3G1VA 2ZA2A 3GB6A 3DBPA 3RF9A 1ALDA 5I3HA 3L66A 3G3MA 4MUZA 5D2YA 1JVNA 1XUZA 1F2JA 3TE9A 3L65A 4ZQRA 4ONVA 2A5HA 1GOXA 3G0UA 1QPOA 4ML9A 4H4IA 3S8HA 1G67A 3NAVA 4GUIA 2WNZA 3BW4A 3E9AA 2E6YA 3HF3A 3IGUA 4A22A 3SECA 1FY6A 1Z42A 4ADUA 5C6MA 2TMDA 4FNRA 1AW1A 3NQDA 4I9AA 3TW6A 1XL9A 4UTMA 1K02A 3LHUA 4N4QA 4N2YA 1LRNA 4HNTA 4E2BA 3P7YA 1Z44A 5KZMA 5BW6A 4HNNA 3THQA 3WK0A 4IPIA 3AJXA 4M6VA 1SO5A 5G4WA 3LXCA 4KFOA 2YDAA 3W7RA 4S2BA 3NNTA 4O0ZA 2FJKA 3BVJA 1ICSA 3L5LA 5J5DA 1PVNA 2QF7A 2YW3A 3C4UA 4P2VA 3DGRA 2FPYA 4JTGA 2OT0A 3NL5A 5CPNA 3NYZA 4UXDA 2NWRA 4K38A 3TUUA 2QCDB 4E0CA 1O5KA 3MO7A 4K37A 5BOOA 2CZDA 3M9YA 1GTEA 1PIIA 3RNDA 1QCWA 4FHAA 3R8RA 1G7VA 1OYAA 5C55A 1G69A 5TIMA 1Q6RA 2W0UA 2CLKA 4FNPA 2PE4A 3NQ7A 3DFOA 3EWBX 3JR2A 2V9DA 3C2OA 3E96A 3S1VA 1SW7A 1VRDA 4ADTA 3W7OA 4OT7A 2QUTA 3ZWTA 3QW4B 4Y96A 3FKKA 2A0NA 3STGA 3TXVA 3W73A 1YDVA 1SFLA 3B04A 4RXFA 2KZHA 4PFMA 4H3DA 1PE1A 1OFEA 4XBKA 4ICNA 1W3IA 2A1YA 1LLZA 2PRLA 2Y89A 3TQKA 3L5AA 1G4SA 1DKWA 2WPBA 3ATYA 4AVFA 3KHJA 4N9DA 4M7TA 4JS3A 1H7PA 3Q58A 2WSYA 3W22A 1ML1A 3TJXA 1SZNA 4FX7A 3LCHA 1TPUA 4GC4A 3I7SA 4HSNA 2EHHA 1MEHA 5I3FA 1MEWA 2V0TA 5D37A 2CW6A
chains in the Genus database with same CATH superfamily
4GI6A 3P8JA 4AZCA 3GQYA 4ACYA 1HJWA 3C2YA 2Y8KA 5HNTA 4PC8A 3WEOA 3TU9A 4CEUC 2Z1VA 3IIXA 5C2CA 1GVSA 6TIMA 4C6IA 1W1PA 2XSXA 1M04A 2DUZA 3J7HA 1XIBA 2G50A 4F40A 4S3KA 3MUIA 4MDOA 2WNQA 3HGRA 1JDAA 2D22A 4YPJA 1XH1A 4JGDA 1OT2A 1SM9A 3TX9A 3WQFA 4Q8TA 3WIJA 1E6ZA 1NF0A 2IQTA 4DB7A 2X1TA 4L9ZA 2V69A 5FEWA 2ZZ5A 1OYCA 1K8CA 3DFTA 2GVLA 2WAGA 4HK6A 2VGIA 2R91A 3LTYA 1WQ5A 1A5OC 5HINA 2QHAA 3Q37A 3QGVA 3MHFA 2DT3A 5DT7A 3EKZA 4GLEA 3F4DA 1DP0A 4UFJA 3NGFA 1UC5A 3KBJA 4HZ8A 2DV0A 2HVOA 3W27A 3EB3A 5CPLA 3NIYA 2VD9A 1CZ1A 1LLOA 3IGHX 4MNJA 1QHPA 4GVIA 2CLHA 4NKCA 4YXGA 3BLIA 3F5JA 4PTDA 3GX9A 4JX5A 1JXJA 3W7QA 1XRVA 1K77A 3R43A 1IE7C 4UBPC 3R8GA 4F9JA 1TREA 2FFCA 2OOGA 5DFAA 3DFYA 3Q45A 3UG5A 2YB1A 4C6LA 1TE6A 3LPOA 3W1MA 3KVKA 3W02A 1REQA 1DV7A 1TJ2A 4NJHA 1XUUA 2VCBA 5FF3A 3REQA 1KFLA 1C90A 2WPGA 4B4HA 1IF2A 3R79A 4O16A 1IEXA 2ACSA 3STCA 2LLEA 2QUUA 1BWKA 1WOAA 1P48A 2NZLA 2Z2BA 1KXHA 4IF2A 3K4AA 3UY7A 4ZB2A 1PB0A 1ITQA 1TFVA 4FLOA 3ZSTA 2X30A 3C8NA 3UGVA 3W1TA 1SZEA 2WMIB 1AA1B 3OBKA 3CLWA 4AY8A 3S9ZA 2NQZA 1HO1A 1KBBA 1XH0A 1QI0A 5T9BG 3EXTA 3TC3A 2XN1A 2PCEA 3VO0A 2VEMA 1VFMA 1GKRA 5CC6A 4FAMA 1I2QA 4K1WA 5H6HA 3WD4A 2WLYA 5ABHA 3VKJA 3CWHA 5J04A 5FJPA 1G4TA 3EBVA 2IKHA 4V28A 1O1HA 2ZUVA 3A4XA 3TTEA 3W24A 1H7RA 2PDCA 4J35A 2GK1B 1DHKA 4UTKA 5CXPA 4DJED 4XAFA 3QMRA 4AMCA 4NZ3A 2PDNA 4OIFA 4JDYA 5HQEA 3WK3A 4JIIX 4QS5A 3OW1A 1ISXA 4GX9A 4GNKB 2G37A 5T8GA 1R3VA 2MNRA 2ZZ2A 4O11A 1VZWA 2YZRA 1F5ZA 2G96A 3V75A 3WUEA 4R9XA 2EPHA 2OQLA 3LD5A 1UP3A 4KCWA 1Q7MA 4ORIA 1LM1A 2VZUA 4K6AA 4JQAA 3DESA 1EYWA 2ESCA 2REQA 4G7EA 2D20A 4NZCA 1V3JA 4N4PA 4MWAE 4DJFA 1EJWC 3ZIZA 1UBPC 3HQNA 3OA3A 6REQA 3P82A 1GOOA 1K8YA 1P0BA 4PGLA 1VQTA 5HK4A 2G3NA 2C71A 2PI6A 3MU7A 3AUOA 3PBWA 1KGUA 5G1YA 2VFIA 4LCRA 4RLIA 2VFFA 1XIHA 1RCQA 2WCAA 2VWTA 1B3WA 3M0KA 3NQMA 3ZFHA 2PTYA 4W9TA 3PJTA 5C8BB 4MIMA 3UA3A 1H60A 1W5QA 1V93A 3WBWA 3SGGA 4GFSA 1HJUA 5GJNA 4I9JA 3DENA 4JTDA 3RU8X 4YYFA 3PWAA 1R86A 4H9XA 1JCNA 1HNYA 4J3VA 5AC4A 2VHLA 3WQPA 4OHQA 3T0TA 3SRFA 4GYKA 1OIFA 3BMVA 4AD2A 3IEBA 2VDIA 2WYSA 3UCDA 3WK2A 1D8WA 1PYMA 4RZ6A 1S2UA 5KZ6A 2D69A 3WN6A 3HGSA 4WKFA 4MZ8A 1W6TA 1VF8A 3EZ4A 3GIPA 5AHLA 4V1XA 1XV8A 5G5IA 1EC7A 2PRMA 1R9XA 2VR4A 3HJEA 3Q4DA 2VJXA 3ZJKA 1XINA 2UZ9A 3SO7A 3E02A 4N42A 2VKZG 5GJMA 3LA4A 4C5YA 1KV5A 4UOJA 5EMMA 1KM2A 3QZEA 4XQ6A 4A21A 1MW3A 3QZ6A 4IMEA 4S38A 2P88A 1GHRA 3PBUA 5I79A 2BOGX 2V8ZA 4B5VA 1PKNA 4TV5A 5HJXA 4TOQA 2X1SA 3SCWA 1K9DA 1LG2A 1QOQA 1NQ6A 1ZQ5A 4DPQA 5EFDA 4ZENA 1KM5A 2PCQA 3VDAA 3QLDA 1SZRA 4XWUA 5C2XA 4F2TA 1AQ0A 3VUPA 2D73A 1PV8A 4O1CA 4JTHA 4O14A 4ICCX 1EJXC 2H90A 3H23A 2HRWA 3SB0A 2VVSA 4S3GA 3QPZA 2XH4A 2GJXA 3AHXA 3GUWA 3GZ3A 3S4TA 3NDYA 4U10A 4NZFA 3FAWA 5CH9A 3BAWA 3PTQA 4HT3A 2ZADA 3UEQA 4Q33A 4HHLA 4UR9A 3WQDA 1E70M 3S5ZA 3AXMA 3D3FA 1E3XA 1EPVA 5BOFA 1YLVA 4LWWA 4C1NB 3CIVA 4B3ZA 1TVNA 3GC4A 4Z2JA 3CV1A 3TN3A 3SADA 2YYUA 2BNJA 7REQB 2Z28A 3ES8A 4EXAA 4CGTA 1J6PA 1V7YA 1UB3A 5A5WA 5F1UA 3EWZA 1GZJA 4UMBA 2R1KA 5IDIA 4LYPA 1EF3A 4CQCA 3W85A 3I4KA 1PKMA 4W85A 1EC8A 3B03A 3M07A 4RJEA 2OWCA 2QJJA 3MCMA 2CCRA 1OX4B 5LIKX 1PZ0A 4FOUA 4RNJA 1H0IA 5M1TA 1OC5A 2RDXA 3E0IA 1Q6FA 1OABA 4PL2A 2CWNA 3G24A 3B9NA 3CAKA 3TOPA 3SEPA 1F3WA 4M5PA 3GIQA 1WXZA 5SWUA 1FWEC 1C29A 1V0NA 2DP3A 1L6GA 1YXDA 1RUSA 1TG7A 4RV8A 3SRKA 5HNNA 4PMXA 4PTXA 1EF2A 2YIHA 3M5VA 4E4FA 1LT7A 2V38A 4D6HA 2ZVRA 1OGGA 4C65A 3VTRA 2YFOA 3S1GA 1QK2A 3NA8A 5A6AA 1EJVC 5H1WA 4UQBA 2ISVA 1TV7A 2CKRA 2CZEA 1NAL1 1W5PA 3AIEA 3OHMB 5AYIA 2JKEA 3NQ8A 3UETA 1EOKA 4HJFA 1OCNA 4XZLX 2VR5A 1JDDA 2E28A 1JUKA 4K36A 1ENUA 4H6KA 4QG6A 1WUEA 3FEMA 4WF7A 3CMJA 1VCFA 1BVNP 5FD0A 3VINA 4MTVA 2FTPA 3HG4A 1FX6A 3CH0A 1S2CA 1KM1A 1RP9A 4EPEC 3LYEA 3D47A 4B90A 3HPXA 1EPXA 5EPDA 3QY6A 1OSEA 4MAZA 1LLWA 3UJFA 5FOOA 1GT8A 1YTDA 2WWCA 5M5DA 5A6BA 4UZUA 1EJ7L 1CB7B 1GYLA 1PDYA 3LXAA 2NSXA 1R46A 3F4NA 8XIMA 1HFBA 4J1OA 4UOZA 4IGNA 2Z0IA 4OBTA 4WD0A 3WNOA 4B9YA 4Q32A 4YHEA 4IUGA 4AVOA 3B9AA 3ITLA 3TC6A 3KWSA 2VZTA 3RX4A 1T5AA 3SIZA 3BLOA 4ATWA 3NURA 5I03A 1QNOA 4DQWA 5JVLA 1T6MA 3TXZA 1UKTA 2ACUA 2BP1A 4LNYA 1QBBA 4GE8A 1GVIA 1Q4NX 3HM7A 3STPA 3PZUA 4CKQA 4F0RA 1LQ0A 1RQBA 4RK8A 2IQ0A 1B3YA 4LS1A 3G5EA 5J8LA 1QNVA 1NDVA 1W91A 5PTDA 3OQ8A 1ZRQA 1PX8A 3SFKA 2ZUSA 4B3KA 2WSQA 1L2QA 4MKNA 4KWSA 1E9YB 5A2AA 3K8LA 2X41A 4TVDA 2A3BA 4FNQA 1US0A 2DY3A 4IXHA 1H62A 2XVGA 3GR8A 4Z2GA 3L67A 4OUEA 1ME9A 2ZKMX 2UY5A 2WVVB 4XK2A 1Y5WA 1M7JA 3B8TA 4IP4A 8A3HA 5I6SA 1EEXA 3MO4A 2J8GA 3W71A 4ERIA 1S3HA 4MJMA 3LG3A 1SFSA 2XGIA 3OG3A 1LORA 4DWSC 2VC6A 4Y9AA 1DQWA 4JTSA 2WMFA 4WOZA 3FVMA 2Y5JA 3AU6A 4F9DA 1JZ3A 5D32A 3BZGA 1XRTA 4UNLA 3ARZA 4JICA 2CU0A 2P3ZA 1ZJAA 1TPB1 1SJBA 3BTNA 4QGCA 5M2FX 1W5MA 1RJQA 3QQWA 1HP4A 1MW0A 3HU7A 3OOQA 5HJYA 3T09A 2Q71A 3FK4A 4US6A 4YWIA 3WQWA 3MZ2A 3ENLA 4ZO8A 2Q6ZA 3SQMA 1J10A 3VIJA 4K8EA 4WOQA 3BCJA 3THCA 4C1LA 3WNKA 1M41A 4LCSA 4K3ZA 4CD5A 1G01A 4CQBA 5FF7A 5CKSA 3C0JA 1TMQA 2CLPA 1LG1A 5A6JA 3ZT5A 3KL5A 3CO4A 1OGBA 6ALDA 1UJQA 4LX4A 4L65A 1J4EA 4O8RA 2NV2A 3AHTA 4AZBA 1XYLA 1YX1A 3KBSA 4LV9A 2XU2A 6PTDA 2V2HA 4NNCA 1W5OA 4A05A 1HL2A 4XZHA 3O63A 3C3UA 1R9YA 1W37A 1N2VA 2WMIA 4OV4A 3E5BA 1V7AA 2AKMA 5BZAA 3GHTA 5JQ9A 3SFWA 2QW5A 3AIVA 3NDOA 1KKOA 3S46A 4PEKA 3LCIA 4QJ3B 3A3HA 1KBLA 4NIRA 2BX7A 4HPXA 1PYFA 3WF2A 5AB3A 1YPXA 4KEZA 1ADDA 1OFDA 1BVZA 2YCEA 3RGTA 3HV8A 5LNWA 2I1OA 4TUFA 1SR0A 5I5RA 3H7RA 3WLSA 2BZNA 3SAZA 5EMJA 1HUVA 4D2JA 1GQJA 3UD6A 4LUTB 4CNSA 4O15A 2E4TA 2GK1A 1THFD 5I7GA 4BQ5A 2IMRA 1Y7VA 4U2YA 3ICJA 4HNVA 1AK5A 2WJDA 3TMQA 4A4AA 2ABAA 1A80A 2VZOA 4IOTA 5E09A 3UP8A 4B2DA 2QDGA 2V5JA 3E6EA 4KCTA 1A0EA 2Y70A 3WD2A 4LF2A 1LL4A 1US3A 4ACZB 1YXCA 1SPQA 4PSPA 1TCDA 2V68A 2VI0A 1ZJIA 4AEFA 2W5FA 3QBUA 1XJBA 3V4BA 2JF6A 1OFAA 3VIGA 2XINA 3WLNA 2BGNE 5T9CE 3NWRA 3UT0A 4W8LA 4NYYA 4LS2A 3SN0A 2PUZA 3LTPA 2ATSA 3TYCA 1HN1A 1UZ4A 1MRAA 3EWUA 1A5CA 2O56A 3MTWA 3WBYA 1NDZA 1PXGA 3RJXA 1SQ7A 1BFNA 4IL0A 4H8UA 4BKNA 3TKFA 1UASA 2WHJA 4QM1A 3ARQA 4HKPA 1TUFA 2AKZA 3UCCA 2PA6A 3JU2A 1C91A 3V0TA 4UCGA 5I2UA 4ZR8A 4ZGYA 2X0HA 1G4PA 3BQ5A 3A3WA 4DI8A 3FGCA 4U5IA 4AQLA 1HO4A 4GIYA 4ZOBA 4JQ1A 4TX9A 4WKAA 2A6LA 4P7RA 4DWSD 4XIAA 4UC5A 2NT1A 2BWGA 2VC9A 3P5ZA 2ZZ1A 1EWDA 4JHZA 1JRCA 4NVTA 3M0LA 1Z32X 3OIHA 4PA8A 4LC8A 3A21A 1HTIA 3UCQA 4UTTC 4F0LA 2P8CA 4DIAA 3U9IA 2FZ8A 3LPFA 2VR2A 4Q4MA 3B8VA 3MBDA 2BXYA 4LNCA 1LTDA 2ZUUA 1BXBA 5T26A 2Y7GA 3PUEA 3V5FA 3ZR4A 1W1ZA 4DX3A 3AUJA 1UOKA 1UJPA 1NM9A 1ZL1A 3I7RA 4XX6A 3OA5A 2BTMA 4WGXA 1F4HA 3ABRA 2AAAA 5LA0A 4Y9NA 5JIWA 4GNVA 1YHTA 1DE5A 2DSUA 4IIHA 1JEZA 2FVLA 3PUDA 1MDLA 4PSRA 1ECEA 3M5XA 4R27A 3HPFA 5E9AA 2PGEA 1TZZA 1HJVA 5CZJA 1U5VA 2RFGA 2EF9A 1UWTA 1RZMA 3PZ9A 1OGSA 4KRTA 2YYTA 4IM4A 4CNOA 5A2CA 1NFBA 4NHVA 1Z69A 1I1WA 3CGTA 1MXGA 1A0CA 2ZX6A 1TPC1 5B7YA 5DCBA 3BG9A 4IGHA 3ZR5A 4CNPA 4JTRA 3ZZ1A 4GO9A 2DUAA 1DIKA 1CTNA 3BOXA 1E9IA 2J7HA 5HPOA 3K13A 1LOLA 2H6RA 4LVDA 3M6YA 1WDPA 2CBIA 4FO4A 3QOMA 1P6CA 3P2VA 1O68A 2E9LA 3KDNA 2CC0A 3PUOA 3TONA 2J7FA 4C1NA 4ECLA 1JI1A 4IICA 1YNPA 1TRIA 3BG3A 4XD5A 1Y8BA 3GG8A 4Z2HA 2V67A 4Q8OA 7REQA 3HIJA 2YXXA 3WF3A 5HMFA 3A24A 2GGEA 1ISZA 3GYEA 3RILA 1VBHA 2FB3A 2O7QA 3IK4A 1JG9A 3WKZA 2D2GA 3AYTA 4JL1A 1TB3A 4LALA 2ODOA 4X9YA 1EEPA 3BLEA 4WLCA 2ZRWA 3L4VA 3IJ7A 2QAPA 4RW3A 4WHBA 2J7DA 2DORA 3TFXA 4QLJA 4D8ZA 1FWFC 3FJ6A 1OX4A 1WZAA 2GFTA 3JZUA 2EBNA 3PZTA 2GVJA 2VOTA 4GJ1A 3TW7A 3R10A 4C6OA 4WX2A 4FEZA 1J6OA 5LGZA 2X2YA 3EEGA 1S1RA 3S2LA 2F2HA 2I5IA 3B05A 1DE6A 1P7TA 1K9TA 2FGLA 3C2VA 1KQYA 4PCPA 3DECA 1UR4A 1DJIA 4M3PA 3NXFA 3ZM8A 3M44A 2DPEA 4IP5A 5H2ZA 2WLZA 4LUIA 2ZTJA 4WDUA 4AB4A 3CB3A 4ZXLA 1HKMA 4I9MA 3H7VA 1UD4A 4CNNA 3NPUA 1TV8A 3NM1A 3A4JA 4O18A 4N9BA 4JQ2A 3B8IA 5CPOA 2FQIA 2ZBTA 4MWAD 3MKCA 1TVLA 2X42A 5CGMA 3N34A 3RR1A 1FWJC 4HCLA 1JGIA 3N13A 4LANA 4GY7A 3E2QA 3QPYA 2NQ5A 4UTWA 4UTTA 4EACA 4Z17A 3G6LA 2WSRA 1WXJA 4PMRA 2VENA 5AHIA 3W1RA 2GGGA 1ZNNA 1IR1A 2OO6A 3M64A 1ZFJA 4WJEA 1AQHA 2IKJA 3NQGA 3VIFA 4RNFA 1MMFA 1KM4A 3PANA 1U1JA 4DJDD 3GTIA 1M1BA 2YLLA 2CBVA 1PL9A 4N9CA 1OG0A 1RLCL 2V2CA 3TYEA 1V8EA 1J18A 3QXBA 3FAXA 4EP8C 3HPSA 2HS8A 3A5VA 3G0SA 3KP0A 2PC4A 4J4KA 1OCQA 1XCFA 3UXAA 2VZVA 4NG3A 1UC4A 2R9RA 2GLKA 1K03A 4UTLA 5HOSA 4IMGA 4GVGA 3KW3A 3TP4A 4U28A 3PC0A 2RKXA 4F3HA 3VNYA 3H2AA 1I45A 1IGWA 2QCEA 5JBFA 1FP9A 2C14A 1FWDC 2OSXA 1L6WA 3OYZA 1H2JA 5AHFA 4KERA 2ZRXA 1H5YA 1KCXA 3U3HA 3WDIA 5LIYX 1MW1A 5FEZA 3S9YA 4WXYA 1PZ2A 2NX9A 3BZJA 3GU1A 3GXPA 2PDPA 1UYQA 2ZE0A 4GUJA 2CHNA 3F03K 3OLEA 2BHUA 3ARPA 2PWHA 3VCRA 3BLDA 4KWUA 3RFAA 1Q2SA 1NJJA 1QPNA 3B8DA 1VPQA 1X39A 1TTIA 3PR2A 3VIKA 3GH7A 4HTYA 2KAUC 5KINA 3AJ7A 1FFRA 3L12A 3LS9A 4TR9A 1E9ZB 5A8PA 1UHVA 4H19A 3ITYA 3RM4A 3V5CA 1T40A 1ZY9A 5HNRA 1UWUA 4XBJA 2GYIA 2JFEX 1SSDA 1KKRA 4U4MA 3B4UA 1VIWA 1AH0A 3N25A 2J78A 5GNXA 3VMPA 4HYVA 4HCDA 1VEPA 8CGTA 2WVVA 5FACA 4AISA 3W7CA 1VJZA 1E43A 4QR6A 5FJIA 3WD1A 3GNXA 3N9KA 1ITUA 3CZJA 1DWAM 4EAYA 1GOQA 2EQDA 3THAA 3B8SA 4PUWA 4AWTA 3LRKA 5EMUA 1C8VA 4PMNA 3GG7A 2WSKA 4Q4OA 5I23A 4LBUA 2AL2B 1ISYA 1R30A 1V3HA 4MFEA 3NPWA 3HPZA 1E4LA 4HVXA 4ZCWA 3WMCA 4BS0A 1VGAA 1HGWA 3OLGA 4F2BA 1N7KA 2YFNA 3VM7A 2HK0A 5E9XA 4U2ZA 3EOEA 3SJ3A 4QE5A 4XZIA 3BW3A 2G4FA 4N7QA 3BG5A 5CC7A 3O1NA 1J12A 1SGJA 4GZJA 4URIA 2PMQA 3TEVA 3KXQA 3BDKA 1XD1A 2NUWA 1V02E 3GDBA 1XIDA 5CJMA 4BR1A 3F5KA 3V7PA 4AD0A 5BWAA 4NX5A 1RXOB 2EPOA 5F2IA 2YL8A 1WAUA 3QPEA 3MYOA 3OG2A 3BV4A 3FKRA 1KLYA 1LOSA 1TZ9A 2V81A 1EP3A 4BFAA 3AICA 2YSWA 1XIGA 4K39A 4GKLA 3IJ8A 1KV8A 4MM1A 3VD9A 4P8WA 1EJRC 2GDUA 7CGTA 3FS2A 3GNDA 2BVWA 5G2IA 5JIPA 1ZP4A 4J28A 3VKDA 5MKGB 1TE1A 2WMJA 4Q4QA 2HJPA 3ERPA 3G1VA 3GB6A 8XIAA 2FZMA 1ALDA 3CV6A 3L66A 3MQTA 3EKGA 3RITA 1WDQA 4XAYA 3L65A 3SUSA 4ONVA 1QNPA 1NWTA 3CUIA 4ML9A 1G67A 3NAVA 1HVQA 4XV0A 1PTGA 1KR0A 5C6MA 1XF0A 1AW1A 1QW8A 5HQMA 1AZ1A 3ECQA 5DF0A 3TW6A 3AYVA 3GFZA 5ENLA 5GQBA 3V16A 4HNTA 5A6KA 2I5QA 5BROA 2O9PA 3P7YA 3URNA 1Z44A 2R1NA 2DT2A 4LUTA 5KZMA 2KX9A 4HB7A 4HNNA 4GJIA 2F6XA 4MPKA 1L6FA 1GORA 3LU2A 4GH3A 2FJKA 3NXLA 1J0JA 3BVJA 3L5LA 3VIPA 2QF7A 3C4UA 4P2VA 1DWGM 3DGRA 4UXDA 4K38A 2QCDB 2X0YA 4MG4A 2O55A 1NWRA 4RE4A 4FHAA 3R8RA 1G69A 5TIMA 1HIZA 4ACZA 4H9ZA 2CLKA 4MWAB 4FNPA 5E5CA 3DFOA 5JH1A 3C2OA 4JHOA 4CUCA 3EWCA 4NP7A 3C5QA 4OT7A 2QUTA 3V0UA 1E9LA 3QW4B 2AOSA 3FKKA 2A0NA 3STGA 1YDVA 3B04A 4PTWA 2KZHA 3U2EA 1W3HA 1E1FA 3UR8A 3SCRA 1OFEA 1ZPTA 1W3IA 1I60A 4ZTYA 2MANA 2PRLA 2Y89A 3KBMA 3PJUA 3TQKA 1ESWA 3L5AA 1G4SA 4XIMA 1DKWA 4M7TA 1H7PA 3W22A 1ML1A 5IXEA 3TJXA 2ZWYA 1JI2A 3LCHA 1MUCA 4KW2A 3WSUA 2XJ7A 2WB5A 3T07A 5XIAA 5LHEA 4AD1A 3SQLA 4HZMA 4JCLA 4GACA 3WX7A 1NVMA 4L4OA 1ZCOA 3DHFA 3ZO9A 1L0PA 2C79A 5KTLA 3GBEA 4GFIA 3GD6A 1BGGA 2RHGA 4GY1A 2YGYA 2QULA 1GW9A 2Y85A 3C86A 3CZEA 3UPMA 3BLKA 2IW0A 3EA1A 1HL9A 1I2NA 3MCOA 1IGSA 1V6XA 2GUBA 1ZS2A 4XD4A 4IPPA 3BL3A 4Z1AA 4W84A 4K8HA 3WL0A 3R94A 3WUBA 1QPQA 3U5YA 1GVOA 3MSDA 2A7RA 2XFYA 5IHRA 4KEVA 4Z1CA 4KKXA 3KZPA 2FDSA 4F0MA 1M65A 3FA3A 3TH6A 1WDSA 4QXIA 4GINA 1I1XA 2DZXA 2P1FA 1PKLA 1B31A 1HJQA 1P43A 4GZ7A 3URQA 1CIUA 1SZFA 4DUVA 2VX5A 5BOEA 2BBFA 2DUXA 2WHKA 4IFKB 1UR2A 4CQDA 3NQVA 3WQCA 1FWRA 1PWMA 3ZLHA 2QJIA 2GJRA 3N2TA 2NUYA 1DWIM 1E0UA 4GWEA 2E8YA 3I3EA 3OLIA 3ARTA 4IZGA 1QOXA 1RCOB 3NZQA 3OZPA 2ZYFA 1H50A 5K2ZA 2QF8A 1V5XA 3C8FA 4Q4RA 4AZIA 2HXTA 1UMLA 4DF0A 3GVWA 1WCGA 4O4VA 3W0KA 1MFVA 1RD5A 1QHZA 4O13A 5G2HA 2IUZA 3S47A 1V3MA 3I3DA 1XBXA 1FWTA 4M19A 3QZAA 3W88A 4JDBA 1DJHA 3GFXA 3EX3A 2I7GA 4AY1A 2IKGA 2DIEA 4FALA 1M01A 2J24A 3T0DA 1NWSA 1HG3A 4RPPA 5FCZA 1TTQA 1O66A 1TTJA 3FYYA 2POZA 1IZJA 5D03A 1J11A 3ALFA 3MUY1 5CGQA 3LBOA 3HTWA 1CGUA 2QVNA 4LYQA 3ZVIA 5I3JA 4UFHA 5IBXA 4PH6A 4HYRA 4ZFMA 1GONA 1GW1A 2Q01A 4ZBCA 2VEPA 3W2NA 5DN1A 4J2PA 4UQEA 2BY3A 1ZBWA 3L23A 2BB0A 2CXGA 1KD0A 3PPGA 4AU0A 6TAAA 3CWOX 3M0XA 3KFTA 1V3KA 1JJKA 2AGTA 4ZXOA 3K8MA 2J13A 3GC5A 4QFUA 1MI3A 3G77A 4HJWA 1X6UA 4JEJA 2I5GA 3TA9A 3LCGA 2V2DA 3KM8A 3B0PA 5DT5A 1P1XA 3A47A 3FXGA 1C8YA 2OJPA 3H4WA 5FF2A 1MUMA 2BY0A 3N04A 3WJXA 1YNYA 3KLKA 3OP2A 4S3JA 3WLJA 4AVNA 2GQ3A 2B31A 2WOQA 3ZSSA 1JPMA 4JYEA 4JIEA 3TJ4A 4TVCA 3BANA 5EFFA 2CZFA 2GUUA 2JEQA 3W7PA 2INEA 1YADA 4HIBA 4I7WA 3WJYA 3P80A 5TBOA 1ZBCA 3C52A 4YU1A 5REQB 4JAWA 4BHYA 2QV4A 4CVWA 3CL6A 5G4EA 3WDRA 4K68A 2HISA 4JNZA 4RDYA 1E6PA 3NTYA 4TMBA 4HA4A 5E93A 4JTQA 4TTUA 1FWGC 3LX9A 1BWVA 2OOFA 3V0SA 4JYDA 3QVQA 3EDEA 3KTCA 3ABSA 4E4UA 1H49A 1NP0A 2C13A 3VOGA 1N55A 3BGJA 1CENA 1TV5A 2CLEA 2CEQA 3LOTA 1Q66A 3NGJA 3VC6A 3MHGA 2PDQA 4A3YA 2V82A 2XHYA 3KBVA 4W93A 1VCVA 4O50A 3GW3A 4ZO7A 3SRHA 1P5BA 2GUYA 4O53A 1UWRA 1RK5A 3UQNA 3N4FA 3GXNA 3P6LA 5E6YA 3MW7A 5K3VA 4JIPA 1UR1A 3ZJ8A 2X1IA 9XIAA 2YXGA 3RLHA 4RDZA 1P6WA 3TAOA 2ADAA 4NZ1A 3POHA 4M0XA 4Z42C 1EO5A 2G41A 3L7RA 3E0WA 5EYWA 1Z41A 3PTDA 2WNNA 2O4QA 3AXIA 4B4FA 3QW3A 4S23A 4MJZA 4E2OA 5HJLA 5TAOA 4GQQA 1B9BA 3M0YA 2OODA 3IWPA 1XLJA 4LAUA 1TELA 2HZGA 3UXIA 2DT0A 1UD5A 4YJ5A 1HQTA 3HQOA 3V36A 5CZ0A 2Z4GA 5HULA 4U31A 3SBFA 2JK2A 3M6DA 2GSHA 1TCMA 2CXEA 1POJA 3UJSA 1ZCCA 3QHOA 1U33A 2TYSA 2YA1A 4M29A 1UOZA 4DEFA 5KZEA 2GWNA 3OODA 2VFHA 1I2RA 3A4AA 3U2ZA 1V3IA 3N17A 4OQVA 4GXWA 3V1HA 5D2WA 4XSLA 2XIJA 3MVTA 2VL4A 1MNSA 3TZFA 4CD4A 4J27A 3WF0A 2J66A 3MP5A 3WFZA 3AO0A 3CUGA 4BWLC 3QGKC 1UZHA 3O0KA 4P8XA 4NRRA 4DM1A 2WM1A 3QV9A 4AW7A 1IYXA 1J79A 2AL2A 5ABEA 2WJZA 4DNHA 4F8XA 2QPXA 4LY4A 1P4CA 3DX5A 1US2A 3CUZA 4LQ1A 3LRLA 1Y5XA 4C6MA 2PC8A 4DBEA 2D0GA 3EMZA 1YBQB 3S6TA 3EKLA 2YDSA 7TIMA 1S5MA 1S39A 1N82A 2YA2A 4NQ1A 3DFSA 3BQ6A 1ADSA 3MC5A 1H41A 2DH3A 5LIUX 5EGRA 3B0YA 4S1FA 1AL7A 4E4PA 1M7XA 1TWWA 4O10A 4UFIA 1KB3A 1UD3A 4UTHA 2QCCA 2FLIA 3LNPA 1AQMA 4QDMA 2DH2A 3F2DA 1GKPA 1EP2A 3S2CA 3LCXA 5KITA 4IPJA 3AXXA 5ABGA 4J3ZA 2GQ8A 5GJPA 1VENA 1S1PA 1GTHA 3W74A 2Z29A 4GRSA 3KOZA 1XRSA 3WYZA 4N6EA 4M8UA 1GKQA 1KTBA 1DXIA 3TDFA 1H7WA 4UTFA 1EH9A 4EXQA 3WLMA 3VFCA 5MKGA 4P7QA 3RLVA 3F2CA 3CL7A 1DIOA 5C71A 1G94A 1CB2A 2D2OA 3FJLA 5DCEA 1LROA 4R5EA 5FF0A 4AHOA 2OXNA 2YR1A 2GSJA 1XR2A 4RX0A 4ZOEA 5G1TA 3H7UA 2E9BA 4GNJA 3VK5A 2VELA 3GR7A 2E1WA 1RBOB 3CQKA 3MBFA 2F9RA 4Z1BA 4G1KA 5HBFA 4DYJA 3A6OA 4BQ4A 2WXDM 3QSRA 3V5OA 2XH7A 1F3XA 2FH8A 1MFUA 2W27A 1X8CA 3M7SA 1Q6EA 1FWNA 2XWDA 5E1QA 4MJ4A 4QEEA 5AHMA 3ZXWA 3T8QA 3IUDA 3W81A 1XDLA 2PURA 4Z2LA 3TNBA 3VNJA 3FNDA 1DXEA 4WJ8A 5D2TA 4AD3A 4KGJA 1EGVA 4NILA 3JS3A 4JTAA 2QCDA 3O7UA 2WMGA 3QMTA 1IQ8A 1DTUA 1KRBC 3WK1A 4NJKA 2EPLX 2BVYA 3UZWA 4HNOA 8TIMA 5EY5A 3W7DA 3AS1A 4INFA 4MWAA 1W3TA 4FX6M 3UYIA 4OBSA 5H8UA 2GGHA 2ZCGA 4TO8A 4HN4A 5BNKA 1UUOA 1CGTA 4DZHA 2O0TA 2MUCA 3A23A 2DQWA 3QKZA 3IIZA 3W70A 4LUYA 4X22A 4E2DA 4A35A 3FX4A 4PB3A 3UVIA 4KCUA 4KBXA 1CPUA 1DJGA 1VYPX 2RAGA 3IUIA 2FB2A 3NFUA 4R88A 1F3TA 3FLUA 3N2XA 4JTIA 2H3DA 2HEJA 3U48A 2PWDA 2VURA 1HJSA 3ZS4A 4QQ3A 2NX1A 3CYJA 3IACA 3LBMA 1U22A 2CLMA 4WIWA 2V5DA 1JYWA 2VQUA 2NUXA 3EWXA 3WNNA 2D1ZA 5LKYA 2PU0A 3GTXA 4B3LA 3UWEA 1AMKA 2WNWA 3PBYA 1WUFA 4I8DA 3CAWA 3I65A 3MSRA 1TMHA 4Q7IA 4MB4A 2TSYA 3GVRA 3LCFA 1VB9A 2W6RA 2QKFA 3W23A 3GNNA 3MSYA 3VKBA 4ZQOA 5BMWA 3IANA 1ZALA 1A5BA 1NOWA 3GNRA 3B0VC 1Q7ZA 1XWYA 1RQEA 3ARUA 4GZIA 5DBTA 1JF6A 2Y6ZA 3SY1A 3T05A 1KFKA 2OQYA 4GZEA 1W0MA 2WC4A 3IS4A 2R94A 1B0IA 3NR0A 3P3BA 4MLJA 4HNLA 1CGXA 1ZZMA 2CHRA 1TR9A 4PCFA 4AHQA 5KSWA 4L9XA 5IHSA 1NDWA 2JIEA 4MKVA 2OYMA 2PTXA 5CC3A 3THDA 5K9CA 2QS8A 2BSLA 2OEKA 2Y7DA 2DJXA 4H2CA 1ISWA 4FXFA 3YPIA 1F9CA 3O05A 3PBMA 3PM6A 5D09A 1CCWB 1E6QM 2CZVA 3VOJA 4GIEA 3JRKA 4D1IA 3ANVA 1D2KA 1UROA 3MHUA 4L61A 1HKWA 1FKWA 4IFKA 1Q45A 4KPLA 2PBGA 2NLIA 4Q8VA 2HQAA 4J7RA 1VJIA 2DZTA 1GQKA 3GM8A 4AYGA 1GOKA 2QCFA 4NZ5A 3MS8A 4XZNX 4AEEA 1EDQA 5D4YA 5AZ1A 2NVCA 1TIWA 1RPKA 1J8VA 2AAMA 4WVXA 2RGMA 4IQDA 5FESA 2QUNA 2VEGA 1ZENA 2CZ5A 2UY3A 4KRZA 4Q3MA 3OIXA 1KBIA 1SO4A 5AC6A 2Y4SA 3AYRA 4QCFA 2VOMA 4FX8A 4V1YA 4FF5A 5HWJA 4P61A 1HJXA 2ZC1A 3NSMA 1DVJA 2HCVA 5DXXA 1QRQA 2Q3RA 3TK7A 4Q8PA 1JDFA 5M3WA 4M6PA 2FPVA 4JKLA 2J25A 4EX4A 3ARXA 1CWYA 4H00A 3RR4A 3NEVA 2XVKA 3WH5A 5DCDA 3W3OA 3CTLA 2PDIA 3WQ6A 4NYUA 3MT1A 3DAQA 4W88A 3ITVA 1FBAA 1DIEA 3QY8A 3RIKA 2OKTA 3A22A 1AJ2A 1FWCC 4X3ZA 2QVHA 4QITA 3KCJA 4NY2A 3SDOA 4D9PA 3DI0A 3A3XA 1KTNA 3NM3A 2VRJA 1R87A 3ANUA 3PG9A 4I5XA 2XH0A 2W61A 4PUMA 3OHIA 3CHFA 4PUDA 2BV9A 4C7DA 3BAKA 5A8NA 2G97A 4AY7A 3U2CA 4B15A 2ZICA 3VDHA 3GVQA 4HPJA 3G1SA 2E6AA 3B97A 4HCHA 2J75A 4JNMA 2ABBA 2X1RA 4MADA 3T4CA 3TSBA 3DU0A 4BEUA 3E74A 3NYDA 1CW2A 3L9CA 1KM6A 5MF5A 1WKDA 4HMEA 3GS6A 1EDGA 1A5AA 3M5YA 4IGSA 4NUWA 5U4NA 4A29A 1IT0A 3CZKA 1F3EA 3M0JA 4S3AA 5F2MA 4IJRA 1PJ9A 1VEMA 3CBWA 3P61A 4IL2A 1JYXA 4CCEA 3CUJA 2QDEA 1GYMA 1X1OA 2PWEA 4XZWA 4DRSA 4CVUA 3CEUA 1JD9A 1PWLA 1LWHA 3W72A 4H6RA 4NT0A 4YNGA 3HJZA 2EO7A 1W54A 1Z48A 4QROA 4ZQNA 5JMUA 3VU2A 2EXOA 1J0KA 2GWGA 3WBEA 5BYWA 3UJEA 3C2RA 4JEQA 4L1WA 5REQA 1MNZA 3UJ2A 4FXSA 1BEUA 1OG6A 3QQ1A 1O94A 4ZE5A 4DNMA 1JZ5A 7ODCA 1Z8AA 3NOYA 4MFDA 1ZHAA 4D8AA 4CNUA 1KFEA 4A8IA 3NZ1A 1X98A 4IX0A 3P67A 1TJPA 2WKLA 4IPNB 3S2MA 4X2RA 3AZTA 1J93A 4B5TA 1UR3M 3NZGA 1ONRA 5CZSA 1F6YA 3DERA 3XINA 5KMYA 1GEQA 5IOBA 5LNRA 2XFFA 4K7VA 4ZZ9A 4PRWA 3W76A 2NXHA 3CB8A 4E3TA 3OJGA 3R6IA 2DSWA 4GY0A 4MNKA 1H1NA 1M7OA 1GG0A 1Z9AA 3TTYA 3TYAA 4LW7A 1BTCA 4JTLA 3OZOA 2W4XA 4LTSA 3QR3A 4O1BA 1VFSA 4YCOA 3LXBA 3WL1A 5BRPA 2CPUA 3Q65A 1UKPA 4B5WA 2E1DA 2FZNA 3O6CA 3KRSA 3MMDA 1H51A 1UD6A 3WELA 3BAIA 2QEZA 3ZOAA 1LWJA 2PTWA 3FY1A 1YTKA 2TAAA 3RX2A 1YEYA 1V0LA 5IFTA 3PJXA 3BK0A 1E0VA 3UJRA 3KTXA 3UWZA 3ZWSA 2C18A 1W9UA 4RZ5A 3UESA 2Z7KA 1BPLB 3C0QA 3SR7A 3N2MA 2VQTA 2JE8A 6CGTA 1RH9A 2Z24A 3S3GA 2WZHA 4MZYA 2OWXA 3H21A 3O6DA 4UTJA 5CBBA 4AH7A 1VIZA 3L2LA 1VD6A 2P8BA 3CWNA 4QJ1A 1QOPA 3CNYA 3S1WA 1D7KA 2WZIA 1MRQA 4QE4A 4PMDA 1MZHA 1SSGA 3EX6A 4Y6GA 1DWJM 2PF0A 3NG3A 3MZNA 3VNKA 1SJAA 4YIWA 4UUIA 4PTNA 5I00A 2RDTA 3I68A 1PIFA 1XSIA 4GBUA 3I6RA 4YCPA 3DG7A 1QXLA 2P76A 2XM2A 5CSYA 3TN6A 4HA1A 4MKSA 1OM0A 1VJSA 3BGAA 4ICMA 3K4WA 3JVAA 3WDHA 4L6HA 1VRXA 3VDGA 3P5YA 1F61A 1XLLA 2CNCA 4ZL1A 5D05A 4J3XA 3N73A 1N8IA 5AYBA 4DBSA 2VX7A 1YBQA 2QJGA 1LJYA 2XVLA 4DJFC 3EX4A 1F6PA 3MUAA 1WO2A 5FAJA 4DO4A 4A8LA 1SUXA 3G8RA 1JUEA 2OR2A 2YLAA 3H4XA 4ZO6A 1EKOA 2QJNA 3PNZA 3R25A 3VE7A 4PBGA 2CLFA 4S3FA 3NVTA 2DW7A 1RCXB 3TW9A 1OFBA 1LDCA 3CPRA 4GUHA 1A5UA 4O52A 1R38A 1ME8A 4DBDA 3B3DA 1RD6A 3GY1A 1XFCA 3W1AA 2POTA 2W9MA 3ATZA 1CXLA 4LAOA 1NP2A 1VYRA 4GQBA 2C1HA 3BICA 1KWKA 4TX6A 1E73M 2Y5SA 3BOLA 1R3SA 4YS1A 3P0WA 1W1B1 3U6WA 3MWCA 1OF6A 4J3SA 3USBA 4ZB0A 4H6QA 3EPOA 4JZ5A 4WQ6A 1MQRA 1XYFA 3PZGA 3FCPA 1NQKA 2C1GA 1X7IA 2I17A 3W7HA 4JFTA 3RO8A 1OC7A 1P6BA 1GJUA 3TN5A 1XDJA 2CHOA 4GG9A 3CK5A 4M1RA 4QE1A 4L4LA 2WZMA 1JQXA 2OWWA 2Z1WA 3T78A 1NWUA 3V1PA 1JZ7A 6A3HA 4PTMA 3AROA 4I3GA 1E5NA 4NF7A 7XIMA 1PZ3A 3AQUA 4H2HA 3UXKA 4ZSUA 3MV01 1KM3A 2CETA 2GJPA 1EBHA 3UR2A 2EG6A 1E4MM 3LSCA 4HNCA 5A6SA 4NJGA 4LEFA 1Q2RA 1FRBA 2BY2A 1FDZA 1I0DA 5FSDC 2P53A 1CLXA 4JL2A 3HB9A 1NU5A 1W8SA 2V3DA 3H70A 1JZ8A 1LL6A 2NV1A 3RU6A 1B3ZA 1FA2A 3IAQA 4NAFB 4X9SA 1CX9A 3VM5A 3TYBA 4ROPA 1VBGA 3RRXA 4KH2A 4PTVA 4ZQMA 4LB4A 1DWHM 4F48A 4PBFA 3EWYA 3P74A 1TIMA 2OSWA 2OU4A 4FR1A 4JFVA 1RJPA 4AXNA 4QJ4B 1BKSA 1OINA 4YL2A 4L6OA 2NXGA 6XIAA 3WQ8A 4G5DA 1F74A 2BG5A 2YCJA 5CSSA 3GR4A 4B16A 3B0XA 5I06A 3FJ4A 2WBKA 4G8TA 4FNSA 1XG3A 2PDUA 3UU0A 2HV5A 4RW5A 2V3GA 4IIEA 5AYZA 3CV2A 4POCA 1VHNA 4ZQPA 1BQGA 4XD3A 1R7AA 2W62A 3VGGA 3CPUA 1GQNA 4NJIA 3PTKA 4ZO9A 2ICSA 2I14A 3P8IA 3QTPA 1HKIA 3DI1A 4C6JA 1O5XA 4X60A 4HU8A 1BAGA 1JAKA 3Q67A 2XTKA 3PF3A 4FS9A 3ITTA 1Y65A 1OFPA 3FN9A 1C8XA 2VFDA 3TC7A 3THUA 2EEXA 4LF1A 4GCAA 4GHRA 5FKYA 1EQPA 3SUWA 3WH9A 4WKHA 3URAA 1LP6A 3M47A 3C2EA 2DQXA 1S2WA 1GCYA 3PAJA 1MO0A 2D0HA 3PB0A 3HZ3A 1JPDX 1EO7A 4WRHA 4UMCA 4LVFA 1SW3A 1JZ4A 4QNWA 1R3TA 4PUUA 3QF0A 1VBUA 3H24A 3C3NA 4ATDA 2PSNA 3VC5A 3F4VA 1AMYA 3SM0A 2YX0A 3B9OA 1EX1A 2Q8XA 4PULA 1E5JA 3FGCB 4S2CA 1VAHA 1XCXA 4DELA 3NSNA 3LPPA 4R3UA 3OZYA 3CH9A 2QGYA 3IPWA 2XIIA 5FA5A 3W6MA 1UR8A 5L9FA 3CUHA 2FZ9A 1EGMA 4TQTA 5D8WA 3NOEA 4GXPA 3DG6A 3KDOA 4ROQA 3Q2DA 3W1PA 4B5XA 1O4UA 4Q8UA 2ISWA 2PD9A 2Q3OA 1PS9A 2QUVA 4Y7EA 3IVSA 4Q6JA 3AIBA 1JXKA 2EKGA 4EPBC 1VBJA 2X2GA 4FR6A 2ZZ7A 1JQVA 2XSAA 4E38A 2ACRA 2F8QA 3T40A 2QNEA 3AFBA 2DIKA 3NO3A 3S6DA 4NU7A 2Z1KA 3E2SA 4V2XA 5DLCA 4ZB5A 5HXMA 5HUOA 3C56A 2VEIA 1K6WA 3WENA 4PRTA 4B5UA 3N3MA 2ANUA 3VIOA 2QCLA 3KVMA 1H63A 1WDWA 3S5NA 3R2GA 1I8JA 1O95A 2R24A 4CN6A 2BODX 4XVEA 1PX3A 2PS2A 2R8WA 4AIEA 4WDTA 3TJLA 5GVJA 3B8UA 3WJZA 1QO2A 1JD7A 1FWAC 2HNHA 4AZ5A 3IVUA 1WOBA 3ZJ6A 3BUVA 3LHTA 1FHDA 1WNOA 3HFYA 5BU6A 2G0WA 3FSUA 2D3LA 1R2TA 1WDDA 2AL1A 2VD8A 3DBPA 2G4JA 5AKQA 5I3HA 3SCVA 1ZTVA 2QLYA 2OELA 2OLHA 3SRDA 2G3JA 5A94A 3CHCA 2OQHA 5I0DA 1ZJHA 1AODA 3S8HA 4ES4A 4GUIA 4QG9A 3BW4A 2PD5A 5GPRA 3IGUA 4A22A 3SECA 1FY6A 1Z42A 4ADUA 5LXXA 4LSBA 3NQDA 1K02A 4ZA0A 1A5NC 4N4QA 1X96A 4QEHA 4C5ZA 2F38A 1LRNA 5A6TC 4E2BA 1HF6A 3VYLA 4OECA 1E4NA 2YBUA 4EWJA 1TR1A 5BW6A 2QGHA 4IPIA 5C7HA 1SO5A 4KFOA 3PN8A 5J5DA 1PVNA 2P3EA 1PKYA 4JTGA 2OT0A 5CPNA 1EJTC 3TUUA 5CJNA 2JQXA 4E0CA 3MO7A 5BOOA 2CZDA 3M9YA 2DSVA 1KCZA 3RNDA 3RG6A 5C55A 3NQ7A 3JR2A 1POKA 4PR4A 3E96A 4E8CA 3N6QA 4PB5A 4AZ7A 1PZ1A 4ADTA 3W7OA 5A95A 4LUSB 4I5UA 3PFRA 3TTOA 1PBGA 3TCSA 4OBRA 4PFMA 1PE1A 3LQGA 3R1ZA 1QHOA 4ICNA 2FJUB 1P7TB 2A1YA 3BURA 1LLZA 1IT8A 1UH3A 1MZRA 2PGWA 1BGAA 1M03A 5DRIA 1W1IE 2QDDA 5BU9A 2HE5A 4FA3A 4TXEA 4M82A 1X97A 3K1GA 2OEMA 1TPUA 4GC4A 1LF1A 1MEHA 2QIIA 4MF4A 3AISA 2CW6A 3HBLA 3P0XA 1CEOA 3O06A 1YDNA 5TQLA 3DN5A 2GDQA 2ZX7A 7PTDA 2YBTA 4HQVA 3SCNA 1E1EA 5D38A 1SMDA 1VPYA 2FGZA 4ZE4A 2Y88A 2PTDA 3LGDA 1CECA 3MV11 4JTTA 1S5WA 3BAYA 3KOFA 4XO6A 5JH2A 1QPRA 5AC7A 2WC7A 4GGHA 2VXNA 5HR6A 4BA0A 1P0EA 5CAHA 3D5HA 3KOWA 3KRZA 4MMWA 3QRHA 2B4GA 3QMSA 3ME3A 4K1GA 4MNLA 4WJXA 3BWWA 2QMKA 1HKVA 1IZCA 1VFUA 3CHDA 1BYCA 3EX2A 4IMDA 1TX2A 1Z3NA 3VABA 3CIXA 5FJJA 1V08A 2X16A 3LLFA 3NJ3A 2VEFA 5DELA 1E55A 4EPDC 4JY8A 2Z25A 2H9AA 3GWQA 1GVQA 1EP1A 2B0MA 4MYXA 1S3TC 3CQJA 4Q8QA 3H22A 4O1DA 5CC5A 3DXIA 2CLIA 4KIEA 1XQLA 4AWEA 2ACQA 4DBWA 3CQHA 4AZHA 2A4AA 2INZA 2ZX9A 2VDHA 3T2QA 3PAOA 1W3NA 2VWSA 5A6BD 1V3LA 5AN7A 3FJNA 4JFSA 1YPFA 3WZ0E 2HTMA 3PWGA 3PZMA 3WLQA 1ECQA 1RP8A 4DYKA 4MY9A 2Z1BA 3SGZA 3M0VA 3PZNA 2V5LA 4NASA 3AWOA 4LVAA 3M43A 3SZ8A 3IIPA 1X1ZA 1QPKA 2UV8G 5FEPA 4QS6A 4HNUA 1R2RA 3PZQA 1XGZA 4PMYA 3USZA 3W7EA 4UOQA 5EL1A 4BCEA 1E6SM 4TX8A 2HBXA 2HDJA 1QW9A 5FSEC 4KMQA 2R1LA 3AXKA 2IQDA 3PSWA 2AQWA 3ISIX 1W31A 1WPCA 1PEZA 2OZ8A 2H8XA 4BF7A 1V02A 5K9XA 5CCZA 3XISA 3JUGA 3KE0A 2ZRVA 3VE9A 3U5UA 2BOEX 2J79A 3KRBA 3MUZ1 1M53A 3VD4A 2R14A 1CXIA 5HR7A 3DZ1A 2AQOA 3M4HA 3UZXA 3CZLA 1I4NA 2BHYA 1U2YA 1PO9A 3VAVA 4AC7C 1QTWA 4JYFA 3WUFA 1JIBA 2BXZA 2BMBA 2XGZA 1UKSA 4DWDA 5HMEA 3W1UA 2WBGA 3GXTA 4QDPA 5JU6A 1N8FA 1KRMA 3T4WA 1IWBA 3EOSA 1NSJA 4MPQA 5RUBA 4M80A 1K6AA 2R82A 4GJJA 4W86A 3DIPA 2D2HA 5ECUA 1TO3A 5D30A 1J0HA 4ATLA 1KNWA 4LVGA 1A3XA 4NNBA 4E8DA 2ZXQA 2VGGA 3T6CA 4US5A 6ENLA 1J0YA 4C1KA 3VKAA 3LZ5A 3E2VA 3GDKA 1F76A 1ZGDA 4XG1A 1UKOA 2X40A 3HURA 1KLZA 1AW5A 3M16A 3N15A 3IVTA 3W38A 2WQDA 1EQCA 5FL0A 4PUNA 1FDJA 3AZSA 3P81A 1SJDA 3AHYA 1E71M 3PPHA 3KOXA 3F1QA 1OF8A 3KL3A 1GPFA 3L2IA 1MWOA 4TTGA 4R7JA 2J47A 1QI4A 1NFPA 2X7WA 1H1ZA 1C3FA 1D9EA 5LZLA 1XQKA 4DXXA 1W8GA 2FYMA 3RPMA 1AH3A 5EMKA 4KEMA 4GH1A 1EOMA 4JTCA 2J88A 4HK7A 5K9DA 2RGLA 1EDTA 4I9TA 3RN6A 1WX0A 1CXFA 4F79A 2CITA 1CLKA 2C8NA 4OVXA 4H1ZA 4PYSA 3EWWA 3OZMA 4H9MA 3KCOA 1WE5A 2DSKA 3QR0A 4YTRA 4NAFA 4L4MA 2ISFA 4C6QA 3WQ4A 3GFYA 3CO8A 3H55A 4RL3A 3QFWA 4Q8NA 4IFOA 1O6IA 1UR0A 2CFFA 3WEMA 4YLWA 2NWSA 1AQFA 2VMFA 1XKJA 1S5VA 4RXGA 3TROA 2UY2A 5D2VA 4R33A 5D9PA 1M9HA 4RE3A 2QCNA 4UQ9A 3QC3A 1TWDA 4EPKA 1A53A 1BTMA 1O5QA 1XLDA 1L9WA 3H6OA 4M6QA 2OO0A 5AYXA 4A3QA 3TTQA 1IIHA 3SSJA 1RV8A 4JKMA 1C7SA 1IEVA 2W92A 3LERA 3PB2A 1XI3A 2OPJA 2BOFX 2RDWA 2E67A 4NL1A 1CDGA 1BSLA 3U7BA 1W1VA 3M7WA 5L6UA 1OY0A 1UIOA 2XM1A 1VLIA 4OZOA 3SCQA 3OVQA 2C0HA 1TQXA 1H1YA 4EIVA 1RJRA 2PB1A 4L1GA 5B7ZA 1K8ZA 4ZTXA 3IJIA 1G7UA 3E0VA 4O19A 1BF6A 3MKVA 1S2TA 5M17A 3W29A 1ODUA 3U8GA 3NZRA 4DF2A 3UWWA 3QFEA 3QJAA 4B2DD 1ZUAX 4U3AA 4R34A 4JFUA 4CCCA 1H11A 4JOMA 5TNVA 3SCOA 4UFKA 4U5KA 1KA9F 2C1IA 1Q8AA 4V27A 1TTPA 1JNDA 3WY1A 3TFCA 3AI0A 1K1DA 2P10A 4RR4A 1E15A 2VX6A 4Y9PA 1EUNA 3MI3A 4QHRA 2BY1A 4DHGA 4AIBA 4MLRA 2HPMA 3VVGA 4AEOA 4LUJA 4BI6A 1LOQA 5HA7A 2OYKA 3VNDA 3R0KA 4M6UA 1NFGA 4X61A 5F2GA 4UQDA 4JY9A 1U5JA 1QT1A 4HK5A 1K4GA 1TPFA 4C7GA 5CG0A 1Y0EA 5XIMA 1BVWA 4CD7A 2A2IA 4PMUA 1ITCA 2DZPA 1T0OA 4OFCA 3E2RA 3M0MA 4UTWC 2A3CA 5HWNA 4IJCA 3VOIA 2DSZA 4YWSA 3W7GA 2ALDA 3TCEA 1L6YA 4DJEC 1PCWA 5K7JA 2B7OA 2VGFA 4D8LA 1OHLA 2EG7A 2A7NA 1KC7A 3IRDA 3T8LA 1E40A 2FZDA 5H8PA 3VIIA 1TWSA 3MP3A 2GJNA 4HHHA 1HVXA 3T55A 2V3EA 5EKYA 3A12A 2B81A 2PDBA 1HKKA 1K7XA 4Y90A 4UNKA 2J7CA 5A6MA 3ORWA 5D02A 4IT1A 3VGEA 1R8LA 3WQVA 3E3HA 3HO8A 1H7XA 1TWZA 1IXQA 1UWQA 3UZJA 2VCAA 4MVAA 4GABA 3CS2A 4G1NA 2HE8A 1QW7A 1S2VA 2QQ6A 1FQ0A 4O1EA 1HP5A 5C70A 3O15A 2WVSA 3BAXA 4O1FA 4GVHA 4GPNA 3AIRA 3ITGA 2JF7A 1W9BM 3MJYA 1OZQA 4EAMA 2PDXA 4M24A 1VKFA 4ERGA 9XIMA 1BG4A 5C0QA 5BXSA 1W2PA 1JYVA 3NCOA 3B0UX 3UFYA 1ONXA 4RCXA 3DC8A 3QHNA 1RK6A 1EFZA 4AF0B 2JEPA 1AZ2A 3K2GA 4HN8A 3KUMA 3WMBA 2AMXA 1K4HA 3GVGA 3DYPA 5CLWA 5HATA 1XISA 1LYXA 3B06A 2DZUA 3P14A 1GHSA 4C6FA 1H7OA 3RAOA 1JRBA 4LFYA 1JF5A 1J0ZA 2GVYA 1MYRA 4LUSA 1K9FA 2Z6IA 4DXVA 1J0IA 4NSBA 1FXPA 1E0TA 3PZOA 1IEQA 1LL7A 3W6LA 4FLSA 3SI9A 1DYSA 4IWWA 2D24A 4PMZA 1EJUC 1JCMP 1XLKA 1V77A 3E0FA 3G18A 4GI4A 1PHWA 1FDYA 4IP7A 3QQ0A 3VILA 3CT2A 4PB4A 4N6FA 3MB9A 3MDUA 4C6KA 1VPXA 3UGRA 2V30A 1FFQA 5KZDA 1UCWA 3QV7A 3G22A 4GBDA 2WMHA 5CGTA 1JCYA 1Q6QA 5A1AA 2WHMA 1CNVA 1D3CA 2BLEA 4K7YA 1W5NA 1XICA 2OZ0A 2A85A 3K30A 3IUHA 2JGYA 4XZMX 4RDWA 2Z7GA 4KESA 1C7TA 4UCFA 3BXWA 3UVAA 1MXSA 2PWVA 3WG6A 1WBHA 2XZ7A 3UW6A 3BLLA 2QYGA 4DLMA 2PPGA 3NEHA 1B30A 4AZGA 4DJEA 4UTUA 1DJQA 2Y7EA 1Q65A 2G8ZA 1MUWA 3MUCA 3BMXA 3WQ5A 1XLHA 1X6LA 2NVAA 4HHMA 3EB4A 1KR1A 3CASA 5EBAA 3H2FA 3FDKA 4WY0B 1KCLA 1EHAA 4QSHA 3MUXA 2AQVA 3QM3A 4D6FA 4HHPA 2G5WA 3IGXA 3KOYA 5D2XA 4GISA 1EX5A 1KW1A 1XBVA 4EVZA 3LNMA 1VCGA 3MANA 3WMSA 1AVAA 4XBSA 1FWSA 3DCPA 3E0LA 4YN5A 5JXQA 1RR2A 1RY8A 3GDTA 3QY7A 3L21A 2OSYA 4JN8A 5CLTA 3HQPA 3CMGA 3S5OA 3OBEA 1V79A 5DMYA 2J77A 1UD8A 4UZSA 2PLKA 1DJNA 1WV2A 1NH6A 1LRQA 5GNYA 1TVPA 3GW0A 4MAVA 3BJFA 5DXYA 2Q8LA 2WM0A 3LV5A 4DWSB 4IH3A 2B7QA 2VC5A 2PDHA 3RK8A 2VTFA 3S2NA 4GUFA 3VKCA 4L64A 5D9OA 2WSPA 4OJYA 4HP5A 2Z2AA 4E3VA 2EAWA 4JBRA 3N6HA 1FWIC 3EGJA 1I75A 2GPTA 3AWNA 3EDKA 1TJ0A 2X7VA 3OU8A 4PZVA 4V33A 2NQ9A 5LXEA