4AXKA

Crystal structure of subhisa from the thermophile corynebacterium efficiens
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
TFTILPAVDVVNGQAVRLDQSYGTPLESALRWQEQGAEWLHFVDLDAAFNRGSNHELMAEITRQLDIKVELTGGIRDDASLERALATGATRVNIGTAALEKPEWIADVIRRHGEKIAVDIAVRLENGEWRTKGNDGGDLWEVLERLDSQGCSRFVVTDVSKDGTLTGPNVDLLRDVAAATDAPIVASGGISTLEDVLGLAKYQDEGIDSVIIGKALYEHRFTLAEALEAVEKLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENE
publication title Evolution of Substrate Specificity in a Recipient'S Enzyme Following Horizontal Gene Transfer.
pubmed doi rcsb
source organism Corynebacterium efficiens
total genus 82
structure length 235
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4axkA00
4MVAA 3G1DA 1H63A 3LTYA 2A5HA 3KHJA 3TSMA 3C2VA 4FEZA 4LVBA 3QPZA 4WY0B 4OV4A 1R30A 3W22A 1GVSA 1H62A 3CU2A 2TSYA 3JRKA 3M5XA 3NQDA 2J6XA 3UPWA 3W7RA 1Z44A 4PODA 5HUPA 2Y7FA 3L5LA 4O57A 5CZTA 5K3VA 1RV8A 1VRDA 4IMGA 1T99A 5LSMA 1O60A 4JEQA 2ZZ5A 2YFOA 3UY7A 1OVDA 1ME7A 3C2FA 3BO9A 3STFA 3TUUA 3GKFA 4XBSA 5AC7A 2J9XA 1G4SA 3W7GA 2NV2A 3HPZA 3P7YA 2NX9A 5C5YA 1EP2A 4BI7A 1W5OA 4JYFA 3B4UA 5AC8A 2H8ZA 2JBMA 3W1RA 2WNQA 3MI2A 3FYPA 3TV8A 2BX7A 1V7YA 3UXDA 3A24A 3NL2A 2R94A 4D2JA 2H3BA 4EWND 4HSOA 1KM5A 4EVZA 1UUOA 2VEIA 3NQ6A 3TE9A 3P60A 4NZFA 3L0GA 2OZ0A 4PEKA 1FWRA 3TH6A 1WYIA 4UTTA 1EP1A 4C1LA 5D30A 1DBTA 3A21A 4HSNA 1YTKA 4DO6A 4ALDA 4ORMA 5E0KA 5GVJA 1XDLA 1KV5A 3OEXA 4JXCA 3P81A 3HQ1A 3O16A 4Z0JA 3DKLA 3BLFA 5TIMA 2ZBTA 4DEFA 3OVQA 3N19B 5L9FA 1KFLA 3S42A 3L65A 1Q3NA 2GOUA 3FJLA 2QDHA 3IIPA 4MY8A 2OMAA 2ATSA 2FTPA 2EAWA 3BGGA 1JJKA 1PCWA 2QCDA 4A21A 2NUWA 2IQTA 1THFD 4M6QA 4NJGA 1SFLA 2ZA2A 3LCWA 1QAPA 1W31A 4ZQCA 2GJNA 1GT8A 3O07A 5DBUA 3ATYA 3QSTA 5AB3A 5J5DA 2ZZ2A 3G1YA 5LGXA 4X3ZA 1TMHA 4K6AA 1I2RA 2CLMA 2PRHA 3W83A 2JKAA 2GVLA 4CQ8A 3DHFA 4FF7A 3M9YA 3KFTA 4UFMA 4QNEA 3EB2A 3CEUA 2DZWA 3W7CA 3HGRA 1Z42A 1OYAA 3OHIA 5HUOA 4QM1A 4LS0A 1TPEA 3E0IA 3R12A 1EWEA 1AG1O 3T44A 1QOQA 4LS2A 3S5YA 4R33A 4GUHA 1G6CA 2Y89A 3I7RA 1DVJA 4QQ3A 5AC6A 3NPWA 1TO3A 3DZ1A 1KM1A 3G8RA 3MHFA 5HULA 3IEBA 3W7LA 4PFMA 4AMAA 4OV9A 2EGZA 3S1WA 3EWBX 4YL2A 1DHPA 1ALDA 1YLVA 4K8EA 5FEPA 3GDMA 4UR8A 1Z48A 4IJBA 1O95A 4OU1A 5AHEA 4AF0B 3THAA 3KVJA 1OFOA 3EXRA 2QUTA 4UIOA 5TBOA 1MZHA 4ZMGA 2WQPA 1K02A 4UFIA 1CI1A 1HG3A 1KFEA 4AHPA 3NNTA 5BW6A 3GX9A 1LM1A 2R91A 1WA3A 4MZYA 4KKXA 4Q33A 4PCFA 2QF7A 5F4SA 1VGAA 2KZHA 1BWKA 2Q8ZA 2X1TA 4N4QA 4LW7A 1H5YA 1TREA 2PURA 2QJIA 2FFCA 3SGZA 5BMXA 1C9DA 2ZRYA 3U2OA 1A53A 4S2CA 3VKJA 4O4VA 3TKFA 5K2ZA 3G1XA 5LNRA 4ZVJA 3S1UA 4NJIA 1GTEA 3CT7A 3MUXA 1HUVA 3ABRA 2JKPA 1J5TA 3DI1A 3WJZA 4XTIA 4ML9A 5CPLA 1KM0A 2VEPA 4Z1AA 2VFHA 5LHFA 4GUGA 3P5YA 1RQHA 4FNQA 4A22A 3C61A 5HNRA 2BWGA 3W1MA 3O1NA 5D38A 1H7OA 1TJPA 5AYZA 3U8GA 5FESA 3DFNA 2GQ9A 4RKAA 3TROA 5BMWA 1TPH1 4WD0A 3TXZA 2CZ5A 3F03K 3E96A 1IF2A 5I3JA 4RK8A 3NPUA 1LBLA 3L5AA 4JX5A 4O16A 5G4WA 1WBHA 1IXPA 3G1FA 3LHZA 3R13A 2YZRA 1AW2A 5G2IA 1FQ0A 2Y7EA 3NR0A 1JQVA 1E51A 2HSAA 5K9XA 1KFJA 4O8RA 2PRMA 1XBVA 1OYBA 2QUVA 2EHHA 3GZ3A 3UWVA 3LXAA 2B7QA 3ABSA 4UNKA 4QSHA 3NQAA 1XBZA 5BRBA 5K4XA 3MP3A 1DQWA 4O1DA 2WPBA 5AYYA 2FPTA 3WJXA 4DPPA 4O54A 4BF9A 3SECA 3DGRA 2CZDA 1H7NA 3F4WA 4X22A 3GKAA 2E5CA 4HT3A 4R53A 3W7KA 2QCCA 3OA3A 1I2OA 1VPXA 5CGQA 5AHFA 1WOBA 1CW2A 1OG0A 1DOSA 4N4PA 4DF0A 5KZEA 3R89A 3TNOA 3B03A 2DP3A 4CQ9A 1SSDA 3C4UA 3KXQA 2A7NA 5U4NA 1XL9A 2RDUA 5AN7A 3W7HA 1FDJA 2YCEA 3MBDA 1KM4A 1YXYA 1CX9A 4MJZA 4EIVA 1WDWA 3ZWSA 4UFLA 2YX0A 2XFWA 2P1FA 2E09A 2ZZ3A 4O4WA 1QDSA 3UWWA 3EXSA 1GYNA 4UTUA 3E9AA 2HMCA 4X2RA 3SZ8A 3NXFA 2VXNA 3EX2A 2RDWA 5FEZA 1GG1A 3PBWA 1SO5A 5I3KA 2WOQA 1JULA 5BNKA 1ZAHA 2Q8LA 1JUBA 1NF0A 5KZMA 3LM7A 4LY8A 2X1RA 2W79A 2J9ZA 3IGSA 2Q3RA 3NQCA 1MO0A 1OX4A 1D3HA 1VLWA 4X9SA 2ATMA 2J24A 3M0ZA 3MBFA 3UXAA 2VKZG 2ZZ7A 4HPXA 4K7VA 4PH6A 3W7QA 5I3FA 2GQ8A 4P61A 1FBAA 2H6RA 4TMBA 1VYRA 2Y61A 5U7SA 3S5ZA 4Z1BA 1TB3A 1K8XA 4JDBA 1JRCA 5DXYA 1W3NA 4WY0F 3LX9A 1L2UA 1BTMA 1KTCA 4GWEA 4HNUA 2O7QA 4A3UA 2A85A 1ZCOA 2JKEA 2AAMA 4LRSA 1PL9A 5H91A 2FIQA 1A50A 2XN1A 4ZL1A 3AJXA 3LLFA 1YTDA 1S5VA 1DJNA 3IIZA 4FX8A 1QCWA 2XN2A 1KBJA 2C6QA 1PCKA 3W7IA 4N9DA 3PF3A 2E1DA 3MP4A 1JRBA 1R2SA 3LXBA 5CPMA 1YXCA 2ISWA 2J9YA 3TC7A 1N7KA 2QJGA 2DU2A 1IIHA 3KRUA 4RZ6A 3DH7A 3TDFA 4JN6A 3PAJA 4FB7A 5G2HA 3GNDA 4XQ6A 2CZFA 2NWSA 1TRDA 5HMSA 5CSRA 4WOQA 3UQNA 3KVKA 4QISA 2NZLA 3STEA 1O4UA 3BLIA 5F1UA 3L5MA 4UTMA 3RK8A 5LHEA 2F7FA 3SFKA 2H90A 3LHYA 2NV1A 1TQXA 3GDRA 1F6KA 5J5RA 4G1KA 1FWNA 4E2BA 5D02A 2R14A 2CLLA 3CWNA 4H6KA 3QQ0A 3G0XA 3LERA 5D33A 1VCFA 4HPJA 1ZAIA 1EIXA 3LTPA 5C6MA 1L6SA 4LU0A 2E6AA 4LS1A 3W2KA 4ZZ9A 3L9CA 1LOLA 4GE8A 3RNDA 2A7PA 3QQ1A 5A8GA 2AGKA 4MLRA 1SSGA 1LZOA 2C3ZA 1T8XA 4BI6A 4CNNA 1W5MA 2RHGA 3S6DA 2H3DA 3ZS4A 3INPA 4PL2A 4A2SA 3PUDA 1FWWA 1IXQA 1ICSA 4O14A 6ALDA 4TR9A 5EPDA 5TQLA 3SGUA 3F4NA 3CWOX 4N9EA 5EA9A 3QW4B 4UUIA 1SUXA 1YPIA 4OGZA 5CZ0A 2Y62A 4NJHA 1YDVA 2LLEA 3RU6A 4W9TA 5DBTA 3NL3A 3WK3A 3C52A 2QCNA 4LC6A 4YXGA 4P2VA 4FNSA 1X7FA 3LCGA 5KZDA 3UD6A 3NZ1A 1F6PA 1OFPA 4JGDA 4HNVA 2V2DA 2ABAA 4DF1A 5L6UA 1W1ZA 2OT0A 1RPXA 4JDYA 3NQ7A 1GEQA 2A0NA 3LHTA 2F84A 2JK2A 4PTNA 3W6YA 3UPBA 3FYOA 1GQNA 1ME9A 1TPWA 5FF3A 3PS7A 4MZ8A 4NVTA 5KMYA 1K3UA 3G18A 3BG9A 3N9SA 2I9EA 3LI0A 4LNYA 5AYXA 1FCQA 1P0KA 1OK4A 4QIUA 4JY8A 4XUGA 2GVJA 5FEXA 2ALDA 1VH7A 4JYEA 3RLVA 1H61A 4EF9A 5F2GA 1SO3A 1SQ7A 3Q58A 3GDLA 3O6CA 4POCA 1TRIA 1EP3A 3C6CA 1TPC1 1W5QA 2OT1A 2DZTA 5FEWA 3W3OA 1L9WA 1KBIA 3HG3A 4PA8A 3O05A 1DV7A 1LRNA 5D09A 2P10A 1H50A 4I9AA 2ZZ1A 1W54A 4GUIA 3VFLA 4JNMA 3G1HA 4NJKA 3W74A 2FB3A 3G3MA 5CKSA 3NL6A 2B7PA 5AHIA 3P8JA 2BZNA 4QITA 4S1FA 1G4TA 3W7EA 3HF3A 3NDOA 3QZEA 1JCMP 1NSJA 3W7PA 4S2BA 2Z6JA 3H54A 1G69A 4I7VA 3G0UA 5DY2A 1KW1A 3EWZA 1PV8A 1H60A 3G8EA 2FQIA 1F7BA 3HG2A 1QR7A 3FS2A 3DENA 1M6JA 4LRTA 4N02A 4UTWC 1KM2A 3HGOA 2VEKA 4IMDA 3B0UX 1K8YA 3LCIA 4A29A 2V2HA 4AHOA 4NX5A 2V5LA 4O11A 5LKYA 4YWIA 1I2PA 3IRDA 4IUOA 1QO5A 4UTLA 4N6FA 1SO4A 2WJZA 4UR7A 5LZLA 3BVJA 4HN4A 5I3HA 1W5PA 1OX4B 4JD4A 1N55A 1U5JA 1GVFA 4AEOA 1C8VA 1F5ZA 3P84A 2QAPA 3H53A 1TPB1 2X1SA 2NWRA 1ZENA 1F76A 3B0PA 3W7DA 1T0OA 1SZFA 3FOKA 3PY2A 5G2WA 4O1CA 2VFDA 5C54A 1B3OA 4CLMA 1LTDA 3RF9A 3W71A 3N3MA 4I7WA 3FIGA 2C16A 4LUJA 1ZALA 1A5CA 1XBYA 3KAOA 3CTLA 3HOJA 3CM4A 4Z1CA 5H2ZA 5K7JA 3O6DA 2BTMA 4WZHA 3YPIA 2C14A 2YR1A 2ZTJA 2ZRVA 1F05A 3LHWA 2NXIA 3EWXA 4UTJA 2TYSA 4GFSA 1XKYA 1B57A 3BG3A 1JCNA 3M5YA 5KSWA 4MIMA 3SY5A 3W1XA 2H8XA 1SR9A 3CIXA 2CLIA 2OJPA 1XCFA 3EWUA 3IIVA 4N2YA 3B8DA 4NJJA 1VLIA 3BG5A 2WNNA 4ONVA 3RFAA 2ZRZA 5D2TA 3GB6A 3TC6A 3QYQA 1FCVA 4AWUA 1W0MA 1UB3A 1I2QA 1OFDA 1W8SA 3PULA 4FXSA 4N6EA 2RH9A 4NX0A 5G1YA 3AO0A 2RFGA 3DXIA 3Q2DA 1KFBA 1W37A 3LCFA 1EEPA 1G7UA 3WJWA 1UASA 3CLMA 3QFEA 1JUEA 3TK7A 4FNRA 2HTMA 3L2IA 4TMCA 1I8JA 3LHVA 1QOPA 3VE9A 4PL1A 1O5KA 2E6DA 2QCHA 5F4XA 3MP5A 5MHBA 5F2LA 2FB2A 4O50A 1WOAA 2YDAA 2P0OA 3WK1A 4MFEA 2Y7GA 4NUWA 1K7FA 2E6FA 3ZR4A 4NZJA 3SSJA 4NT0A 3ABQA 1QMLA 4RJEA 1EB3A 1P1XA 5K4ZA 2JGYA 4RCXA 5KTLA 1JCLA 3VNDA 2EPHA 2C15A 2D73A 1SW3A 1LRTA 4NXSA 1AL8A 3MHGA 3W7NA 1AK5A 1GZGA 3L21A 3P5ZA 1XXXA 4ZQRA 5CG7A 1RZMA 3WK0A 4Y96A 1I45A 3NEVA 1G7VA 1NVMA 1MXSA 2CLEA 3DFTA 4IMFA 1BKSA 5IM51 3W73A 2Q3OA 2Z2UA 5ABTA 4I7UA 5A5WA 4UTWA 4DPQA 2I14A 4UFKA 2TPSA 3UWUA 1IXOA 2CWNA 1EUNA 2V5BA 3W88A 1H7XA 1OABA 2Z6IA 3T7VA 2ZCGA 1F2JA 1KA9F 3TQ0A 5D2WA 1TSIA 1A5SA 1MEWA 3GNNA 5EBUA 3P80A 1FUYA 2A7RA 3TIMA 5EY5A 2G96A 4WOZA 3T4CA 3SW6A 3EX6A 1V5XA 4GJ1A 4CCDA 3GVGA 4O0KA 2BLEA 5T26A 4MY1A 1ONRA 3DI0A 2O7SA 2AQWA 1EWDA 3GAYA 3KRSA 3JR2A 4Y6GA 4O19A 1IGSA 1K7EA 3TFXA 3ZFHA 4YCOA 1XM3A 2WSYA 3SR7A 2NXGA 1LBMA 1VC4A 1PE1A 3NM3A 2YFNA 2V9DA 2YPIA 5FF4A 5AHNA 4OBTA 1VR6A 3DFSA 4UXDA 5EKYA 3HGSA 2WSQA 3MWAA 1GJPA 3TMQA 2X1UA 3F1QA 5LNVA 3OG3A 3DFOA 2VELA 3T78A 4M7TA 1RVGA 5AHMA 5AOUA 2PCQA 4JTTA 3S1XA 3FEMA 1X6UA 1EX5A 3CPRA 2GQAA 2QAFA 5KITA 3NO5A 4ZQPA 4AWSA 1G4EA 3B0VC 2ZYFA 3MW7A 4B5NA 4M19A 4ADUA 3FJ6A 1SW7A 3QF0A 3QMTA 4KWVA 1PS9A 3PB2A 4AHQA 3QM3A 2DORA 1TIMA 2VENA 4R34A 3S9YA 1K03A 1JR1A 4NNAA 2C13A 3HG4A 1GVRA 1VS1A 4LV9A 5D05A 1P4CA 3LB0A 2C18A 2VFIA 5DCEA 3W85A 4FO4A 2G5WA 3NQ2A 1EPXA 3HIJA 1EUAA 3E12A 3PUOA 5HR6A 3UWZA 3EWYA 3GIYA 4AB4A 2HS8A 2OCZA 3TQKA 2CLHA 4NNBA 4JTEA 2DZXA 4BFAA 3W2NA 1DORA 2Y7DA 4FXRA 2Y88A 3QSRA 2QR6A 4MZ1A 5IBXC 1F73A 1FDYA 5HQEA 3S5OA 1KV8A 3SI9A 2CZEA 2TRSA 1SZNA 3W2UA 3NQFA 3VI2A 1S3HA 5F4WA 1LBFA 1LRQA 4LTSA 3R8RA 4FNTA 1QPOA 4FIRA 5HWMA 2EF9A 1GOXA 5DXXA 1A5AA 1BEUA 3O8AA 2A6NA 3C2OA 3E49A 5DCDA 1GYLA 2J27A 4AAJA 2B7OA 3P67A 4E2DA 2UV8G 4YCPA 2ABBA 3IV3A 3FFSA 2YSWA 4ADSA 1N8FA 3L66A 3MI3A 3PB0A 2V81A 4WQ6A 3PVFA 3HBLA 2VFFA 5CZJA 1S5WA 1SFJA 1R47A 3LXCA 4O0ZA 3LRLA 2QCMA 5CPOA 5LNUA 3MYOA 1SU5A 3LDVA 1ME8A 4UCGA 1Q6QA 1G67A 4HHPA 4MKNA 1VCGA 2G95A 2QJHA 3KVMA 3OIXA 1DJQA 4XTDA 3K30A 4LV4A 4DELA 3L68A 3SIZA 2VEMA 4QAIA 2CLOA 1M7OA 3O15A 3P74A 4GC4A 4NXKA 4JTFA 3UZJA 3UZ5A 2GPTA 1L6YA 4WX2A 4L4MA 1OJXA 1D9EA 1WQ5A 4AH7A 1WV2A 4MPQA 4CQAA 1ZAJA 4IX2A 2HS6A 3Q37A 3DU0A 2ZQ0A 1U83A 1NEYA 1G4PA 4TO8A 2GUUA 3KOFA 2C19A 3NYZA 3GXPA 1OF6A 2JGQA 5DLCA 1VHCA 4MUZA 1O5XA 1KFCA 4FNPA 2DJXA 5EMUA 3W7JA 2OX1A 1B4KA 2QCLA 5HINA 3W1QA 2VFEA 3S1VA 2QCEA 3GR7A 4IMCA 3BK0A 3HJZA 1I2NA 3MO7A 4GNJA 3CC1A 4Z1DA 4BR1A 1RD5A 4JX4A 3OVPA 1H7RA 3C56A 4R7JA 1MEIA 1XUZA 4QJ1A 3TW7A 2FLIA 3NVTA 3TMLA 4HNTA 3PSVA 1PIIA 3W7OA 1R46A 4TU1A 3WK2A 2YW4A 3DFQA 3QPYA 3W23A 1HO4A 2FJKA 4UTHA 3LV6A 6TIMA 3DFPA 3C0JA 1OF8A 1GVQA 3M41A 2BSLA 3NPVA 1TCDA 4RR4A 1DL3A 1H51A 1FCUA 2NUYA 3THQA 4IX0A 3L0KA 3G3DA 4IXHA 3W2LA 4OHQA 3QRHA 4IOTA 1RR2A 2VFGA 1P5BA 4L4LA 2ZA1A 4Z0SA 3DKJA 3G24A 3W9ZA 3CQ0A 1Z41A 2Y85A 4IWWA 4O1AA 3QMSA 3MI6A 3NQEA 1IIGA 1WBJA 1X1ZA 4MOZA 5AHLA 1LP6A 5C2XA 3BPWA 2Y70A 7TIMA 4LVAA 2YXGA 2X30A 1I4NA 3W87A 2BXVA 5IBXA 3T40A 2NXHA 4MY9A 1TPFA 3IIOA 4RXGA 1JQXA 3VE7A 5C55A 2ZZ6A 1YYAA 3W76A 2CW6A 3P8IA 1XDMA 1T96A 3NL5A 4RV8A 2YGYA 4OT7A 4LVDA 3NQ8A 1FWSA 3LBCA 2PC4A 4C1KA 3GAKA 3PBVA 3OVRA 1HO1A 1O94A 4RZ4A 3W72A 3WJSA 3C2RA 2NX1A 3G22A 4TIMA 2DZVA 2NX3A 1PVNA 3PBYA 1TTIA 4JYDA 1HL2A 2E68A 4BK9A 3EKZA 3L67A 2I1OA 3PR2A 4KFPA 2GJLA 3MHUA 3G1AA 4XWUA 1ML1A 3FKRA 4O15A 3W2MA 3N14A 1WAUA 3CIWA 4ZQOA 4UFHA 3NA8A 4UMAA 1FXQA 3JS3A 3W1AA 1ZHAA 2B0MA 3M5ZA 3MJYA 4K8HA 3M1ZA 2WKJA 1P0NA 2FDSA 5EYWA 1MSSA 4AXKA 4UC5A 1KTNA 4IQLA 3T55A 4PC8A 1QFEA 3I6RA 4ICNA 1KM6A 3I7SA 5G4EA 3MYPA 4CCCA 1AW1A 4GUFA 1ZJIA 3W1PA 3H55A 4O1BA 5SWUA 4O18A 3M43A 4U28A 1H1ZA 4YLWA 2FPYA 3A5VA 1JUKA 1UJPA 3ABOA 2ZZ4A 3UNDA 3C2EA 3GXNA 1OFEA 2WNZA 1GWJA 1LOQA 4M6PA 4MYAA 5G5IA 1UBSA 3USBA 1Q6OA 2QUUA 2ZRUA 5CSSA 1QO2A 1OHLA 3LTSA 5FI8A 1GG0A 1W56A 3W07A 3HPSA 1KLZA 1B9BA 3W1LA 1J2WA 4K37A 1MEHA 3PSWA 4LVGA 4RLIA 3LCLA 2EKCA 3PG8A 4GBUA 3LI1A 2ZRXA 4UTKA 3BV4A 3IGXA 3FKKA 4DBDA 3L0NA 3O6YX 4AVFA 4LUIA 3B06A 2ISVA 1KFKA 5HWNA 3NZRA 3DAQA 5D32A 4DO4A 2E6YA 4XZ9A 3B05A 3M7WA 4HIBA 2DZPA 2WSRA 5LNWA 4IPJA 1QPQA 1GTHA 1OK6A 4HKPA 1PHQA 2ZA3A 1LROA 3W2JA 3C8FA 1WXJA 5F1VA 3BLEA 5DELA 3TX9A 2NUXA 1YTEA 3UWYA 4UNLA 3R5EA 3I68A 1A5BA 3Q94A 2RDTA 2W0UA 5HR7A 3G0SA 4HNNA 3V1PA 4WXZA 3UYCA 3GK0A 3EXTA 3GXTA 5D2YA 3LBMA 4Z08A 1NAL1 1B4EA 4RXFA 1FDZA 2A2IA 2WV8A 5F2MA 3I7QA 1OFRA 1SZEA 4U4MA 1HTIA 4E38A 1KTBA 2R8WA 3P82A 4K39A 2B7NA 3IVTA 3BGJA 1X1OA 3S0CA 1TV7A 2QKFA 5K9CA 3O06A 1YDOA 4JTSA 2V30A 1HFBA 3LOTA 1TPDA 4MLJA 1UUMA 5DCBA 1QPNA 3C3NA 4JTIA 3LRMA 1FX6A 4JTJA 3G1VA 2PE4A 3GDTA 4MYXA 3QH2A 3TW6A 1TQJA 1K7XA 1X8FA 3NQVA 4MFDA 3M6YA 4O53A 3MMTA 3KVLA 3RLUA 4K38A 4XKYA 1DQXA 4DO5A 5F2IA 3A9IA 1YXDA 3ELFA 3DBPA 3N34A 3CEPA 4JICA 1VYPX 2C1HA 1F74A 1VQTA 3B04A 3S8HA 5K9DA 1H7PA 2V82A 4M7SA 4ADTA 1S5TA 4ZQNA 5KINA 2DJLA 3W75A 4ZQMA 1R2TA 2A21A 5CZSA 1XC4A 1TYGA 3V75A 3W1UA 1QPRA 1TTQA 1XBXA 1SW0A 5HJLA 2YW3A 3EX4A 4KWWA 1QWGA 1OFQA 1Y0EA 4JTKA 1DKWA 2RKXA 3W1NA 1L6WA 5FF7A 1RQBA 3HO8A 3I65A 2CLFA 4JR5A 3BW2A 1ZY9A 1W5NA 3M44A 2GVGA 4WY0A 3NPXA 1VYSX 5AFDA 5LNSA 3EWWA 4IXXA 4BWLC 1LLWA 1OX6A 2NLIA 4IPIA 3NAVA 2ZTKA 3UY8A 3TA6A 3NGJA 2ISSA 3EEGA 1M5WA 1H7WA 3NM1A 3P61A 4M5PA 1NF7A 2QCGA 3DHDA 3LLDA 3LCXA 4O13A 1PHWA 4IMEA 4LC8A 4GUJA 8TIMA 3M5VA 3A23A 1IXNA 2E5BA 4XBKA 4UTIA 2E5DA 1GPWA 3NOEA 4FNUA 4RZ5A 3LHUA 2A6LA 3BW3A 1LCOA 3HMJG 2QCFA 4MJMA 5E1QA 1JCYA 5FF0A 1GVOA 3CB8A 1TTPA 1LORA 3P62A 2ZDRA 2X16A 5D2XA 4FX7A 2DZUA 4JTUA 3W86A 3HB9A 3TXVA 1LOSA 3ATZA 4QNWA 5EL1A 2CFFA 3PM6A 4Q32A 1YDNA 5CPNA 1OYCA 4OQVA 5D04C 1BWLA 4Q4KA 3W70A 1LLZA 4M6VA 1NFBA 1TJRA 1VHNA 4BI5A 3TJLA 3QC3A 3LCHA 3W7MA 1SZGA 3KX6A 4KFOA 3G1SA 3W84A 1YADA 2YYUA 3BARA 3PG9A 2XN0A 1D3GA 1ICPA 1EA0A 3OBKA 2VC6A 3BW4A 1SO6A 2PRLA 5D37A 4JTLA 4NNCA 4WJEA 2QCDB 3N2MA 1VJIA 3QMRA 4GXMA 1FWTA 4JIPA 3HPXA 1W3IA 4FX6M 2J88A 4Y8FA 3TFCA 2QDGA 1K8ZA 3NQGA 4GRSA 3LRKA 3EKLA 3A22A 1JVNA 1JCXA 4UMBA 3VCRA 3FA5A 4YMZA 3IGUA 1J4EA 4JY9A 3KRZA 2X2GA 3TAKA 1QNVA 3EX1A 3WFAA 4DBEA 3GDKA 3TQVA 5G1TA 3O63A 1AW5A 2YYTA 4EOUA 2A4AA 3LV5A 3HG5A 1OFAA 3S5NA 1XI3A 3QW3A 1TV8A 4JTGA 2V0TA 5D2VA 4Y90A 3FLUA 2V8ZA 3GR8A 1RQEA 3M16A 5FF2A 3NQMA 5D03A 3TSDA 3UWQA 4NU7A 3QJAA 1UCWA 5I3IA 3IIXA 4H4IA 3U6WA 1SPQA 4JTHA 3N9RA 3D0CA 1W3TA 2Y63A 4UMCA 2ZRWA 3GYEA 4A2RA 1TTJA 2Z0IA 4OE7A 3TSBA 4UTTC 4E0CA 4NQ1A 4N9BA 2V2CA 1ICQA 4O17A 2FPVA 4J9JA 4H3DA 1TV5A 4LVFA 5E93A 3E02A 4JS3A 4K36A 3TJXA 2CU0A 4TX9A 2TMDA 3STCA 3GLCA 4WUIA 4O10A 4CNPA 4AWTA 1ZFJA 1C29A 4O52A 3R2GA 4CNOA 1ZNNA 4FHAA 4DXVA 1KM3A 3W1TA 4K7YA 1OX5A 3N2XA 4OWGA 1TPUA 2B4GA 3TCEA 4EF8A 4Y9AA 1ADOA 4LT9A 1VCVA 5DN1A 5LGZA 1TPVA 1OFBA 2ZFAA 4AF0A 2DZSA 4IGHA 3N73A 4JIQA 3ANYA 5DY3A 3PC0A 2E77A 4N9CA 4BWLA 3A5FA 1Q6LA 1YPFA 3ZWTA 4XKYB 2A1YA 3WJYA 2WO5A 3PWAA 3STGA 1FXPA 2C0AA 3IVUA 1LDCA 3QEZA 3NG3A 2Z1BA 3TAOA 1XFBA 5BOOA 3SJ3A 3EX3A 3HGJA 2QEZA 4DF2A 1XUUA 1M7PA 4CCEA 3IVSA 4DQWA 2VOMA 4O12A 3M47A 1JCJA 1AL7A 4KFNA 3PBUA 2CLKA 2Y6ZA 1WX0A 3TU9A 4O28A 1VZWA 3RMJA 1FY6A 4JX6A 4UFJA 1Q6RA 3TR2A 5HWJA 5I3GA 4ORIA 1AMKA 4RX0A 2G97A 3LGEA 1R2RA 1H1YA 4LOCA 2W6RA 3PUEA 1Q45A 1FCBA 4WXYA 4FIQA 1KLYA 1LYXA 3CHVA 4LWWA
chains in the Genus database with same CATH superfamily
2XIQA 5EBAA 4MVAA 3E2SA 3KHJA 2J6VA 3OYXA 4BS0A 3SBFA 4OV4A 3CU2A 3BANA 1FWAC 1FHVA 4E4PA 1OCNA 3UPWA 4PODA 3QR1A 2YB1A 5CZTA 3ONBA 2J7HA 5LSMA 2HCVA 1P1MA 1O60A 2YFOA 2J25A 2RGMA 4MNLA 4CU7A 3STFA 2DQWA 3PPFA 4LCRA 5HMFA 5AC7A 2CBUA 2NX9A 2GVYA 1EP2A 4BI7A 1W5OA 3FJ4A 1XLGA 5J04A 4KCUA 1W1VA 2WNQA 3EA3A 3MI2A 1T41A 5FOOA 2BX7A 4HSHA 3L4XA 4L9ZA 5E6ZA 3ITVA 2POTA 5A1AA 3R43A 3A24A 2R1LA 2YKKA 4L56A 2HPMA 2H3BA 4HSOA 2QJMA 1UUOA 4P5UA 4UR9A 5EU9A 3TC3A 3TE9A 3P60A 3T0TA 4L80A 3L0GA 1FWRA 2EKGA 4J7RA 3TH6A 5DO8A 1IEIA 4UTTA 1EP1A 4C1LA 2VJXA 5D30A 1KR1A 2QNEA 2VRKA 1UWAA 2VVSA 4ORMA 1DJWA 5E0KA 3MSDA 1KV5A 3OEXA 4FALA 2YBTA 1V3HA 4UZUA 2GOKA 1BF6A 5L9FA 5CBIA 3S42A 3GS6A 1J8VA 4GOAA 1RJRA 4F2TA 4GYKA 2OMAA 1JDDA 2EAWA 1RA0A 1PCWA 2QCDA 4A21A 4OBRA 1KXQA 5ABFA 2FJUB 3NJ3A 3QV7A 4GA8A 3CL7A 3ATYA 3LENA 4HCHA 5AB3A 5J5DA 3G1YA 5LGXA 4HD5A 3VM5A 3IUIA 2PRHA 4HMEA 3W83A 2GVLA 3TONA 4MSSA 3EDDA 1U22A 4UFMA 1E3ZA 3CEUA 8A3HA 2DZWA 3HGRA 3ZMRA 5HUOA 3OHIA 5AYBA 1W3LA 1JL8A 4I5XA 2VX6A 4DHGA 1JDAA 1QNQA 3PZOA 3MKVA 4LS2A 3S5YA 4DAFA 2XDFA 1TUXA 2Y89A 1FKWA 3CS2A 3I7RA 4PUJA 1E9ZB 3HQOA 3KS5A 5AC6A 3T81A 2D3LA 3BSHA 1R3VA 4Q4RA 3DZ1A 1KM1A 1QK2A 5M3WA 2C0HA 1DHPA 4H04A 4ZEPA 1J79A 5FEPA 3T4WA 3HMCA 4IJBA 4AF0B 1V4YA 3KLKA 2WW5A 3TYEA 1OFOA 5CPTA 1JZ2A 1PPIA 4UFIA 1PJ9A 1HG3A 5BROA 1KFEA 1N8WA 2NQ5A 1V02A 1YHTA 4CU8A 1WA3A 4MZYA 2VWTA 6CGTA 2XJ7A 2YB4A 3KW3A 4Q33A 4PCFA 3N9KA 5A8NA 1VGAA 2KZHA 3DBNA 4B91A 4MHBA 2I5QA 3F5LA 3O9NA 2OYLA 2ZRYA 1A53A 1QRQA 3G1XA 1NQ6A 4LAKA 4ZVJA 3S1UA 1PBGA 1WE5A 3VOHA 3AQUA 2JKPA 1J5TA 4LB3A 5CPLA 4QDWA 3R1ZA 5LIWX 1AZ1A 4GUGA 1J01A 2XYLA 3DOPA 5ABHA 1QUMA 4LUSA 1ODUA 1B3YA 2F6KA 4Q8VA 1PUDA 1FKXA 3TCSA 1TJPA 2DEPA 5AYZA 4M1BA 2AL2A 5FESA 2D69A 3ZIZA 1MZRA 5BMWA 3WQGA 2CZ5A 3E96A 4RK8A 1UR3M 3CMJA 2DSVA 4BZYA 4ZO8A 1ZP4A 3G77A 1PYFA 4O16A 1WBHA 1IGWA 2WCAA 3F2BA 1TUFA 2CLPA 1MRQA 2KAUC 4Q8TA 1SMAA 5JBEA 3NR0A 1DHKA 1VBJA 1W32A 5K9XA 4ZFMA 1P6CA 1E3XA 3WLPA 4BJHA 1TWZA 1OYBA 3GBEA 4TVCA 5BRQA 2PDKA 3RX4A 2EHHA 4XB3A 4KWOA 3RJXA 2P76A 5DMMA 4JQ2A 2QPXA 4JHMA 1FHDA 3TYBA 2AQOA 4KCWA 2VQTA 4NI8A 2ZX7A 1TR1A 1XJBA 3UPMA 2OZ8A 2QCCA 3N13A 1HJUA 3OA3A 1UC5A 2OQYA 3GFXA 1DIKA 1RH9A 5CGQA 1WOBA 1DOSA 3IRSA 2HPIA 5M1TA 2DP3A 5EFFA 3CQJA 2GSJA 2A7NA 4DJDD 3S5SA 3VIPA 1YXYA 1G94A 2QGHA 1ZPTA 4EIVA 1UP2A 4DZ5A 4DI8A 4UFLA 3BCFA 2P1FA 4C1NB 3RYSA 3S4TA 1QK0A 1F61A 1NOFA 1GYNA 2VMFA 4UTUA 1Q8JA 4J3WA 3SDOA 2VXNA 3EX2A 5FEZA 3M0MA 4EKJA 3T0DA 1E70M 1ZAHA 4K2SA 4DWSD 3LPGA 3AHXA 3PFMA 4F0MA 3BLLA 3IGSA 2J9ZA 5C9WA 1OX4A 4J3UA 3NUKA 1WZKA 2VKZG 4HZ7A 2ZZ7A 1TMLA 1XYAA 2PWDA 3W7QA 7CGTA 4Z2HA 2X40A 1XYBA 1PXGA 5JQ9A 1NP2A 5U7SA 1K8XA 4JZ5A 5DXYA 4MDPA 3LX9A 2QXWA 3RX3A 4L65A 1OD0A 1OGBA 3IAQA 1GKQA 1E40A 1PL9A 1A50A 2BHUA 1YTDA 1S5VA 4FX8A 1KBJA 3LGGA 4P7QA 3PF3A 1JRBA 1YDYA 4H2CA 3MV01 5A8PA 2ISWA 1N7KA 1LL7A 1OQFA 3GHUA 5GJPA 3TDFA 3PAJA 5G2HA 4XQ6A 2Y8VA 5E09A 1V0MA 2CZFA 2E8YA 1HN1A 1CIUA 4WOQA 1EJUC 3KVKA 4CD4A 1SM9A 1XX1A 1O4UA 4XO6A 3ONCA 3RK8A 5LHEA 3SFKA 4R7WA 3AZTA 4F9JA 3GDRA 1F6KA 1OIFA 1FWNA 2R14A 4U5IA 3CWNA 4H6KA 4HA3A 1ZUAX 5D33A 4D6GA 4XKMA 1UH4A 1VCFA 3N11A 1ZAIA 3LTPA 1L6SA 3U2ZA 3SSZA 3GG7A 4LU0A 2E6AA 4LS1A 3QY6A 3KBWA 4GE8A 4IMAA 3WEZA 3RMEA 1V6UA 3QQ1A 1J11A 3C86A 4LUSB 4DZAA 1T8XA 3A3XA 4BI6A 2H3DA 3OA5A 3MDWA 4NYUA 3OQEA 4TR9A 3WLRA 3SGUA 4N9EA 4OGZA 4GZ7A 1PZ2A 4NJHA 3DYPA 4WVXA 1QBAA 3RU6A 3K13A 4TQTA 5KZDA 1XIMA 3U4FA 3NZ1A 2XIIA 3D6NA 1T8QA 2VGFA 4JGDA 3VDCA 3F7JA 2IQDA 4DF1A 3VD3A 5L6UA 4UQAA 3ZT5A 3NQ7A 2JK2A 3W6YA 5BZAA 3UPBA 2DFAA 4TV5A 3FYOA 5FF3A 2XIMA 1HP4A 4GNVA 3BJSA 4C6NA 5KMYA 5DQPA 2OSWA 4DIAA 1FCQA 3AS1A 1P0KA 1H5VA 1IEXA 5FEXA 1ONEA 4JYEA 1GHRA 1H61A 1XLBA 3QY8A 3E74A 5F2GA 1SQ7A 3Q58A 2PF8A 4GJJA 3C6CA 3B0YA 3CAQA 2PGRA 5XIMA 2J62A 4KEUA 2P5NA 3W3OA 1XD1A 1L9WA 3IJ7A 4J5NA 1ISYA 1I60A 3O05A 5D09A 2P10A 4I9AA 1W54A 4GUIA 3WF2A 5DX7A 2FB3A 1JPKA 4S1FA 1G4TA 2QDEA 2DIJA 3PZTA 3TYZA 3W7PA 3H54A 2RDXA 3C8NA 1FWJC 3G0UA 9XIAA 3U0HA 3EWZA 1VEMA 3SCRA 4M0XA 1Q2SA 1BYAA 2FQIA 3TN5A 3HG2A 1RK6A 1M6JA 4CU6A 1RBAA 3TQPA 1K8YA 3LCIA 4A29A 4ERGA 3T0CA 4G8TA 5LKYA 1Q6CA 3N4FA 2EJAA 1KQZA 4KWSA 3FY1A 4R3UA 4UTLA 4FAMA 4M1RA 2BVWA 1KRAC 1UKTA 5DRIA 4DZHA 5DFAA 1OX4B 1U5JA 4B3LA 3PJUA 3WDHA 2Y24A 1GOWA 3N29A 5HDRA 3RRAA 2NWRA 2Z2BA 4W8LA 1T0OA 1SZFA 3FOKA 4WSKA 2VFDA 1QI2A 5C54A 4CLMA 1LTDA 5FACA 3RF9A 4EP8C 2ZUUA 2OVLA 4M81A 3KAOA 3HOJA 3BSMA 2O4QA 1S2UA 2WHJA 3OP2A 4JHOA 1SJAA 2ZRVA 4FI4A 3LHWA 2TYSA 4GFSA 3CT2A 1ZJBA 4KGJA 4AIUA 3ARPA 1V02E 3WH9A 3UR7A 3SY5A 3W1XA 3GHSA 2Z2AA 1SR9A 3W27A 1B5TA 3CIXA 4HA4A 5EB8A 1V77A 2GJRA 1EZWA 3CZ8A 2WHMA 3F4CA 3CUIA 5D2TA 3UGVA 2XGZA 1T40A 3RLHA 1BRLA 3TC6A 1W0MA 1E15A 3AFBA 1UB3A 4RPPA 1I2QA 4J3VA 2ZX5A 1OFDA 4FXSA 2J7GA 5IFPA 3WQWA 4N7QA 3FXGA 5G1YA 3AO0A 1XYMA 3Q2DA 4V27A 4FLSA 3LCFA 4QLJA 1EEPA 4I6VA 4QJ4B 3SUTA 5MKGA 1UASA 3QFEA 2VGGA 1JUEA 1Z7AA 3BV7A 2HTMA 2GUBA 2ZC1A 3FX4A 3VIIA 4PL1A 1LQ0A 3T8QA 3HM7A 1ZB5A 5F4XA 1NDYA 3V5CA 1A5NC 3LN3A 2ZUWA 2IMRA 3VDBA 3W29A 4KRUA 5A8OA 1GJUA 3SSJA 2HNHA 1EC9A 2EPMX 1K9TA 2WK2A 2ZVRA 1BLIA 1LG1A 1EB3A 5K4ZA 2DT2A 3H4WA 1W2VA 3ARVA 2EPHA 3IANA 4GH3A 2C15A 3KWSA 3MWCA 1SW3A 2BDQA 4NXSA 1AL8A 3CTTA 4W86A 2BHYA 2E1WA 1XLEA 2X2YA 3P5ZA 1XXXA 3KL0A 2G8ZA 1ZBKA 3HV9A 3PAOA 5CG7A 5FJPA 4GIRA 1NVMA 1W9UA 2CLEA 4XZWA 2CCRA 1E1CB 5IM51 3W73A 2Q3OA 1GK8A 1DJGA 2PTXA 4UTWA 1IZKA 1MWOA 3AISA 1EUNA 3LGDA 3T2OA 2V5BA 3W88A 2ZUMA 3CGTA 3VMOA 4GYPC 3T7VA 2EXOA 2ZCGA 2DVTA 1G01A 3GFZA 4AIBA 3NZPA 4PRRA 1MEWA 1IQ8A 3WLHA 4E3VA 3UZWA 1FUYA 2HK0A 3TIMA 2G96A 1XIEA 1UD3A 5XIAA 1UA7A 4NF7A 3FW6A 4KWUA 1N8IA 2XVKA 3DX5A 4C6JA 3B40A 5A6LA 5T26A 2O7SA 4U2YA 3OGRA 2XPKA 3GAYA 3JR2A 1E4LA 4DX3A 1K7EA 3A4JA 3TFXA 4EXAA 4A3RA 3IK4A 3EPOA 4NILA 5KETA 2CHNA 3SR7A 2NXGA 4MNKA 3WMSA 1BXBA 4I5UA 2D0GA 4OBTA 3PTMA 1RP8A 3SAZA 5A6SA 2DT3A 3OG3A 3T78A 1TWDA 5AHMA 2CITA 2PCQA 4S3DA 2CC0A 4XBJA 2NQLA 4BHYA 1KCXA 2ZYFA 3VOCA 1VB9A 3MW7A 4TTGA 1E43A 4GZIA 4M19A 4FXJA 2VZTA 4LY4A 1DWIM 3QM3A 2VUNA 5TNVA 4IFOA 1TIMA 3S83A 3S9YA 3IAPA 1K03A 1RBLA 3UA4A 1JR1A 4M8UA 3I6TA 4NNAA 3TN4A 3HG4A 3GQYA 1GVRA 1PKMA 4LV9A 5D05A 2C18A 2OLAA 1XISA 2BGNE 3NQ2A 4XD3A 3UR2A 3HIJA 2GWGA 1W6TA 1SYTA 2ZX6A 1EUAA 4V15A 3UWZA 4AB4A 2OCZA 2CLHA 3AMGA 3AU6A 3TNBA 3FCPA 3I10A 4M56A 4K8GA 1C8XA 2W61A 3LMZA 1D8WA 4MZ1A 5IBXC 1RUSA 1FDYA 1KV8A 3SI9A 3IJ6A 2QV4A 2E67A 2FZBA 4Q4OA 1D3CA 4LTSA 3VKCA 1A4LA 1QPOA 2BVYA 2A6NA 3C2OA 2B7OA 4CQBA 1E6XM 3APGA 1M04A 1RVKA 5AZ1A 4C6DA 2PU0A 5T9CE 4ADSA 1N8FA 3SRFA 4P8WA 2C1IA 3L66A 4I9MA 3VABA 3PVFA 2VFFA 1XF0A 4JFWA 1S5WA 4ROQA 1C7SA 3LXCA 3L4ZA 2QCMA 1CEOA 1H4PA 2G3FA 4JFSA 3UCCA 2CBVA 4CQCA 2DT0A 1Q6QA 4OKDA 3LPOA 2G50A 1E9LA 2GDQA 1I0DA 2XM1A 3AMCA 1F3EA 4YVVA 4LV4A 4DXXA 2O9PA 3BZGA 4QE4A 2BY3A 3MS8A 5EMMA 4WX2A 5A2BA 1OJXA 2FHBA 1E73M 3TYCA 3QV9A 2QIIA 4AH7A 1ISZA 1WV2A 4ML4A 4IX2A 1IV8A 2PC8A 2REQA 1U83A 1KQYA 4TO8A 1S5MA 2C19A 3U7BA 1UWQA 1OF6A 1RJPA 5FA5A 1VHCA 2ZXBA 5C2GA 1KFCA 2DJXA 3KBJA 5EMUA 3VNMA 8RUCA 4YTUA 1B4KA 2P88A 4B5SA 1V3LA 2VFEA 1ITCA 1NDZA 5HNUA 1I2NA 1C8QA 4GNJA 2AKMA 4BR1A 4D9PA 4JX4A 1TX2A 4YVPA 1AZ2A 3B9NA 2Q02A 3NVTA 1VBUA 2PZ0A 2OLSA 3CV1A 1NOUA 3H12A 3CV7A 1P6WA 1R46A 3AU2A 2YW4A 3SJNA 5CH9A 4MUPA 4AEFA 1SVDA 4UTHA 3LV6A 1XV8A 3D46A 6TIMA 3DFPA 1OF8A 3WQFA 1GVQA 4PTVA 4DYKA 3M7SA 1FCUA 1UR8A 4F48A 4IXHA 4GQRA 4OHQA 1JFXA 2JE8A 4RNHA 1S2VA 3PBGA 4F3HA 1V51A 4PYSA 1L0PA 3QTPA 3OLEA 1QHPA 3G24A 4GKLA 2Y85A 4O1AA 5GJMA 1WBJA 5AHLA 3N1AA 1LP6A 1RD6A 1RPKA 1ZBWA 1R9YA 2Y70A 1VFMA 3THUA 4JQ1A 5HPCA 1I4NA 4XSMA 1MUMA 2ANUA 3UESA 1R5YA 1TPFA 3IIOA 4RXGA 1V7AA 3VE7A 3CAVA 3TLQA 6PTDA 1FWDC 1YYAA 3W76A 1MW2A 2VM8A 2YGYA 2VD9A 1OZMA 3AZRA 3NQ8A 3O2LA 2PC4A 2PWFA 2OXNA 3CHEA 3UG4A 3OVRA 2ZDSA 1HO1A 3G22A 2A3AA 2NX3A 1BYCA 2YIHA 3BXWA 4S3CA 1BKHA 5FAJA 1HL2A 2E68A 4PRWA 3EKZA 4Q8MA 2I1OA 4KFPA 3G1AA 3FKRA 4HYVA 3W2MA 2FTWA 3CPUA 3JS3A 2QHAA 4K8HA 3VGEA 1D7FA 2VL4A 3EMCA 5EYWA 3AUJA 2W67A 3SFWA 1FA2A 3I7SA 4LBUA 5G4EA 3MYPA 1AW1A 1ZJIA 3ECQA 1V0LA 2GJPA 4YLWA 1XR2A 2ZZ4A 2IPWA 3GXNA 3UR8A 1TVNA 1A3HA 5I03A 2WNZA 2E0PA 1VAHA 4MYAA 1UBSA 3FVDA 1Q6OA 2QUUA 5CSSA 1QO2A 1A3WA 1W56A 1B9BA 4RLIA 9XIMA 5IOBA 2EKCA 3DCPA 2ZRXA 3UA3A 1J12A 4ICCX 4MTVA 1BYDA 1EJSC 4HNCA 1P43A 2G4JA 3O6YX 4C6CA 4LUIA 3RPDA 2ISVA 3REQB 4YVXA 5HWNA 4DO4A 3B05A 1GQJA 1PKNA 4IICA 1J10A 1MUWA 3DESA 2WZTA 4E8CA 3C8FA 1C3FA 5F1VA 2NUXA 4UNLA 4IGMA 4ZO6A 3Q94A 4QQUA 1YQ2A 2W0UA 4XISA 3G0SA 3V1PA 3AIEA 3GK0A 4J28A 1K9FA 5D2YA 4AW7A 1NAL1 2CPUA 3R0DA 2PWGA 1SZEA 2REQB 3V18A 3VILA 3UXKA 3FN9A 1ELSA 4Z17A 1FWFC 1TV7A 4GX9A 1EGVA 3KBMA 4C6BA 3ARSA 1ZL1A 1Q6FA 4PSPA 4WR3A 2ZUTA 1H2JA 1JEZA 4DBWA 3C3NA 1HVQA 3TOPA 3AICA 2PE4A 4ERAA 4MYXA 1TQJA 1K7XA 3NQVA 4H9XA 3GIQA 3MMTA 2DSUA 4TXEA 2G3NA 2Q09A 2PI6A 5JBDA 4ILSA 3DBPA 4Y9NA 2O0TA 4C6FA 1E0XA 2PCEA 3WLSA 2ZXAA 5HNTA 4B3KA 1VQTA 1KWGA 4M7SA 4ADTA 3VNZA 3ZLHA 4KCVA 2F38A 1R2TA 1XC4A 1TYGA 3F4VA 3V75A 1VKFA 5D4YA 1TTQA 2BS9A 2HV5A 5HBFA 4JIHA 2YW3A 4KWWA 1BPLB 1Y0EA 4JTKA 1BG9A 3M0XA 3W1NA 1TX0A 3VGFA 1SGJA 1XPYA 4XZBA 2CLFA 1EO5A 1ONWA 2I57A 3GVWA 1W5NA 4JTDA 1YEYA 2EPLX 4EXQA 1XFCA 3NSMA 4WY0A 4DJDC 3NPXA 3V3WA 4DUVA 4IXXA 1C93A 3H21A 2NLIA 3NAVA 1QTWA 1ADDA 3BOXA 3V0UA 1M5WA 1H7WA 4M5PA 5FL0A 2QCGA 3LLDA 1EDQA 3LCXA 1BWVA 2GGHA 3BJTA 4AZBA 2E5BA 4V2XA 2DZBA 3KZPA 2YBVA 3PZUA 4RL3A 4Y7EA 4BA0A 2Y2WA 4XG1A 1E56A 1OY0A 5H8MA 3HMJG 4IQEA 1JCYA 5FF0A 3BLPX 2ZDRA 2DZUA 3N18A 3HB9A 4C6LA 3TXVA 1VFOA 3OQ8A 4Q32A 1UD6A 1OYCA 3USZA 1QI5A 4Q4KA 3DDMA 1TJRA 1V0NA 4CGTA 1VHNA 3ES7A 3TJLA 3W53A 1HJSA 1GYMA 3G1SA 1TZ9A 1YADA 2ZUNA 1UQYA 2NSOA 1CLXA 2W92A 3VCNA 3OBKA 2VC6A 3FHAA 2PBOA 4NNCA 2PDMA 4WJEA 2WQDA 3N2MA 3WENA 1DJYA 3B97A 4GXMA 1RP9A 1OC5A 4JIPA 1W3IA 4FX6M 4US6A 1M41A 4Y8FA 1NH6A 2DDXA 1XH1A 3TFCA 4F8XA 1K8ZA 3CXOA 4CVUA 3WUEA 4UMBA 3HURA 3MO4A 3N6QA 1BQCA 2PTWA 3TAKA 3L4YA 2XIOA 3WFAA 2QYGA 2CHOA 3GDKA 3TQVA 3D3AA 3F4DA 2YYTA 2GK1A 4HCDA 3MCOA 1XI3A 1XLMA 1FVPA 1TV8A 4Y90A 1RQEA 3AIUA 3TSDA 3UWQA 4NU7A 1R38A 3UWEA 2OELA 1TTJA 3P2VA 3SEPA 4KPLA 4UTTC 2V38A 4K36A 3L4TA 3LA4A 3TJXA 1UZHA 3G1RA 2TMDA 1G0CA 4AWTA 1ZFJA 1C29A 2JQXA 1ZNNA 4PMOA 4C6MA 3BSGA 5HATA 2BV9A 1J18A 4K7YA 1F9CA 4DNHA 3D5HA 3N2XA 2B4GA 3TCEA 4EF8A 4BF5A 1P0DA 1TPVA 1OFBA 2X09A 3M4HA 4JIQA 3ALGA 4GZEA 5DANA 2GLKA 5IXEA 3KL3A 3A5FA 1Q6LA 1YPFA 2WZHA 4C6QA 4JQAA 5BXSA 3IVUA 5BOOA 3PPHA 4GVFA 1B90A 2QEZA 1WKFA 1XUUA 1E5JA 3IVSA 3KP1A 4ZSUA 1POJA 3DHUA 1BGAA 1H09A 3M47A 1JCJA 4F4RA 3FHQA 1ISVA 1R3TA 4TUFA 3TU9A 3IJ9A 2WMKA 3RMJA 2Z28A 4JX6A 1Q6RA 4MDOA 5HWJA 4WRHA 1WZAA 2G97A 1KD0A 1R2RA 2QMJA 3MA8A 4QR6A 4LYPA 4JKMA 2DT1A 1FCBA 4FIQA 3ZJKA 1KLYA 8XIAA 2WJDA 1LYXA 1VFTA 1Z9AA 2JIWA 2CKRA 1H63A 5ABGA 4LPCA 1OGSA 4A4AA 1TWWA 1XD0A 2A5HA 3C2VA 4PFHA 1FHUA 3O0FA 2E4TA 4WY0B 3F2DA 4WCJA 2YDQA 2J6XA 4XD4A 1PAMA 3W7RA 2YCJA 1TJ1A 3L5LA 1F3TA 1RV8A 1VRDA 2ZZ5A 3NZQA 1I1XA 1DPMA 1ME7A 2HEJA 3BO9A 3C2FA 1F4AA 1A5MC 3GKFA 5KEZA 3W7GA 3HPZA 3P7YA 4DUWA 3GTIA 2DSKA 4GVIA 3TYUA 2H8ZA 3W1RA 4C60A 2QLYA 2VZVA 4ZB2A 2JEQA 2W66A 1UWUA 3UXDA 1E9IA 3NL2A 4Z42C 4D2JA 5HAOA 4EWND 1IEQA 3M0IA 4EVZA 4GXPA 2OG9A 3RM4A 4F0HA 3NWRA 3RO8A 2ISFA 2TODA 3A21A 3CYJA 1YTKA 3QGVA 3ZVHB 3PUGA 3K8MA 4NHVA 3HQ1A 3O16A 3G6MA 3DKLA 1P7TA 2ZBTA 4Q8UA 3U5UA 3EPMA 2OFJA 1KFLA 4R85A 3L65A 4L4PA 1Q3NA 2GOUA 3FJLA 4WHBA 3QOKA 4IJRA 4PCSA 3QKEA 2FTPA 3VGGA 1E4IA 3WDRA 4DJFD 2QZRA 3UVIA 3TTSA 2PGEA 1R87A 2IPFA 2NUWA 4K1WA 3EOSA 2PA6A 2GK1B 3LCWA 1QAPA 1C90A 3VKDA 3O07A 4AY7A 1EL3A 3OW1A 1JI2A 1YBQB 2ZZ2A 4AZ5A 2JKAA 3WUFA 2ZWYA 3S6TA 1WDQA 3WF3A 3IARA 2PLMA 3KFTA 4HBKA 4QNEA 4IIBA 5H6HA 3AWOA 3R12A 3GRIA 4D6EA 1QOQA 1A49A 4R33A 7REQB 4QQ3A 1PEZA 4L1XA 1HJQA 2AMXA 3KHDA 2P50A 1PX8A 4PFMA 3BLKA 6ENLA 2P3EA 3GTXA 2F6XA 4B2DA 2OEKA 4F66A 2QMKA 3NZGA 5JU6A 3THCA 1ALDA 1YLVA 4UR8A 2QULA 1UG6A 4H6EA 5HANA 4EE9A 4EACA 5I06A 2PZNA 1LL4A 3B0XA 3KVJA 3BAKA 4ZR8A 3TN6A 1CI1A 3E2QA 2XIBA 3GX9A 4RE0A 4XAYA 4BQ4A 4C65A 1LWJA 1XYCA 4Q8WA 3W24A 3UETA 5F4SA 3WNOA 1BWKA 3OGSA 1KO0A 1H5YA 1TREA 2KX9A 3AYVA 2QJIA 2FFCA 1VPQA 2X0SA 4CD6A 3QTGA 1TFVA 3U2OA 1DP0A 3POHA 3CYVA 1L2QA 3MUXA 3VNIA 1PYMA 5I00A 4WKAA 1Y5VA 3WJZA 2YLAA 1R85A 3CL8A 4QE5A 1CGUA 1RQHA 4EAMA 3MMWA 4A22A 4H8HA 5HNRA 3VIKA 3WQCA 3ZVIA 3AHZA 5FJJA 3O1NA 4A8RA 1J0KA 2FHCA 3DFNA 4RDYA 1XG3A 2GQ9A 2GDVA 4AVOA 2C71A 3TROA 4WD0A 3CUFA 2ZE0A 4FOUA 3L5AA 1UBPC 2F2KA 4HOWA 1KKOA 4JX5A 1XS2A 1IXPA 2RAGA 3R13A 4W87A 5G2IA 4IP5A 2OQLA 2Y7EA 3W0KA 3NQBA 1KXVA 2AKZA 4IFKA 2MNRA 2B7QA 1FRBA 4UNKA 2IUZA 3UJFA 3C0LA 1X6NA 1DQWA 3CUHA 1LJYA 3SQLA 2WVSA 1GNXA 4O54A 4MJ2A 1AFSA 2CZDA 3EA1A 1RLDA 1CBGA 3GKAA 4R53A 3KOWA 3SY8A 3CZGA 1X8CA 4QJ3B 3OU8A 3CZKA 2VZOA 4IIEA 3EOEA 4N4PA 3NO3A 5KZEA 3R89A 2WC4A 3ITOA 4PCNA 3V5OA 5EMYA 3KXQA 2AGTA 2J13A 5HA7A 1OZQA 4IF2A 3FAWA 3UGRA 2RDUA 1P7TB 3QGKC 2YCEA 3MBDA 4IJCA 4W93A 1F8MA 1WDWA 4A35A 3S2LA 1ZGDA 2E09A 1HKWA 4AC1X 1QDSA 4W8AA 2IXUA 2VDIA 1ZBVA 4S3BA 5REQA 5JUVA 1UUQA 2RDWA 4AZ7A 3HQNA 3PBWA 2WOQA 1JULA 4GO8A 1NF0A 5KZMA 3LM7A 2X1RA 1EBGA 4D6IA 2W79A 3NQCA 1D3HA 1VLWA 2Y8UA 2XINA 2J24A 3WIJA 3CHFA 2ZICA 3TTEA 3K4WA 1LUCB 1S46A 4K7VA 3WQPA 4JEJA 3GW0A 3WY1A 2H6RA 1ZP3A 4JAWA 1A5LC 3WDQA 4JDBA 1ZJAA 3BAIA 2DY3A 3MMDA 1L2UA 1BTMA 1KTCA 1AD4A 4GWEA 1IWPA 2GSEA 2O7QA 2JF7A 2D23A 4YPJA 3P93A 2GGJA 2A85A 4HN8A 3URNA 1JDEA 4LRSA 1ZCCA 4FP1A 4L6OA 3PWIA 5H91A 3C5QA 1NDWA 3H2EA 3LLFA 2VEFA 3WBAA 3IIZA 3BTNA 4LJ3A 4PUWA 1XLLA 3W7IA 3E2VA 5JXQA 1KBBA 6TAAA 2DZAA 5CPMA 4XZMX 2D2JA 3E5PA 4KRZA 2XFFA 2V63A 5DMNA 2L5HA 4RZ6A 3DH7A 4JN6A 4FB7A 1H0IA 3CZLA 1J6OA 2ACSA 2NWSA 5HMSA 5CSRA 3D3FA 1OG6A 3SQSA 3ITLA 3BLIA 2PMQA 3L5MA 2WHKA 3POCA 2R9RA 4QE1A 3LHYA 3GWQA 1JFHA 4Q7NA 4ZGYA 3LUTA 3LERA 4QLLA 3RCNA 4S23A 4DN1A 4I5RA 2XGIA 4PRTA 4I90A 3L9CA 3TOYA 2PDHA 2A7PA 1T6MA 5I78A 5A8GA 2DPEA 3RUBL 1YE4A 1SSGA 2NSXA 2XM2A 4GIYA 4ZOEA 3S6DA 3PTDA 3INPA 3CWHA 4PL2A 1TKKA 5D9OA 4O14A 3DGBA 3F4NA 3TYDA 5EA9A 3QW4B 1YPIA 1HGYA 2Y62A 2JEPA 2LLEA 2CYGA 5LA2A 2W4XA 5DBTA 3WK3A 4YXGA 4P2VA 4FNSA 1X7FA 4JQ4A 4AYSA 1EKOA 3MANA 2ABAA 2YCIX 1CGYA 1Q8AA 4ATWA 1RPXA 4JDYA 3W02A 2FHFA 1GEQA 3LHTA 4PTNA 2F84A 2HISA 1ME9A 1U1HA 2UY4A 4MZ8A 1BTCA 4IFKB 3BG9A 3N9SA 3BLDA 3DG7A 4LNYA 2CWXA 4UQDA 5JH2A 2GVJA 4H9MA 3T6CA 3RLVA 4PBEA 3T09A 1Y8BA 4EF9A 4FOJA 1SO3A 1CYGA 3GDLA 4POCA 2FZNA 4OUIA 2DZTA 2ZX9A 2Y0FA 4PA8A 1MNSA 4B2DD 1DV7A 1Y65A 2ZZ1A 4P8VA 4X63A 3G1HA 1HL9A 2VCCA 1TE1A 7ENLA 3NL6A 4QITA 2VWSA 3UVAA 4QAWA 2ZIDA 3HF3A 4ECLA 3KTSA 2Z6JA 5C71A 1OWQA 1RXOB 5DY2A 1PV8A 5FL1A 4ZFCA 3FS2A 3CV2A 4N02A 3ZYZA 4UTWC 3HGOA 2VEKA 5REQB 3B0UX 1UWIA 2D3NA 2OZTA 3VNLA 4FLRA 4W5ZA 2V5LA 4B5VA 3GZAA 3IRDA 1QO5A 4Q4SA 2RGLA 3OVGA 2ZXQA 4HN4A 4UBPC 2PPGA 1FH8A 1W5PA 5I3HA 4AMCA 2J78A 1N55A 3SCQA 3WQ4A 4AEOA 2PD9A 5A6KA 2QAPA 4D1IA 1TPB1 2UY3A 3MT1A 2WZMA 4H01A 3GH7A 3A64A 3PN8A 4KH2A 4DO7A 4O1CA 3V5FA 1EO7A 4HMDA 1POKA 4QHRA 3OZOA 4I7WA 2WBKA 4LUYA 4LUJA 1A5CA 1XBYA 4LGXA 2JIEA 2Z7GA 3CM4A 5H2ZA 4GY1A 1SR0A 3O6DA 4WZHA 2WB5A 1JZ3A 1U30A 3ZSSA 2ZTJA 1GOQA 4I9JA 4UTJA 1SJBA 1Z3NA 1L8NA 2PLKA 2PDQA 1UWTA 2H8XA 2CLIA 3MZNA 4HYWA 4YN5A 4HOZA 3OODA 1CGVA 3NO1A 4A3QA 4PR4A 3IS4A 1VLIA 3BG5A 2WNNA 1KRCC 1GQIA 4MG4A 4ONVA 3RFAA 1PTAA 1E9YB 3PBMA 1TJ2A 2C8NA 3GB6A 3QYQA 4AWUA 3ZR6A 1EXBA 1W8SA 2D24A 4NX0A 3EDEA 1BGGA 2RFGA 1KFBA 2FZ8A 4EPDC 1W37A 3KZSA 3SO7A 3CLMA 4WK9A 3TK7A 2EO7A 4TMCA 4LBSA 1I8JA 4KEMA 3O0KA 5CLWA 3ME3A 4IIHA 3VK5A 5MHBA 4P7NA 4AZGA 2EPNA 4V28A 3WLIA 1CCWB 1XCWA 3GVRA 5CGTA 2P0OA 3WK1A 2E6FA 2J47A 4ZXLA 2A3CA 4NZJA 3V0TA 4NT0A 1QMLA 1E5NA 1LT8A 1ZQ5A 3PANA 2JGYA 3QV8A 4RCXA 5KTLA 1V08A 4G7EB 1JCLA 5A6JA 2HQAA 2FKPA 4LX4A 3TN3A 2OLHA 3FJNA 1AK5A 1GZGA 4S38A 3RAOA 3SN0A 5EMJA 1RZMA 1R8LA 4H9ZA 3DFTA 1MXSA 3VNKA 4Q8QA 1BKSA 1DIDA 1ADSA 4Q6XA 1B2YA 2R24A 4IPNB 4J1OA 4UFKA 2O9TA 1VEOA 2TPSA 2RUSA 2J7BA 5I6SA 2CERA 3QC0A 3EPNA 2BGQA 1S2AA 4AYGA 1RY8A 2I5IA 3ARQA 3SCOA 1JAKA 4E2VA 4B5XA 3JU2A 3WD3A 4S3JA 1KA9F 5D2WA 3GNNA 1CXKA 2PDWA 4HU8A 1WO2A 5EY5A 4WOZA 3ARRA 4NAEA 3SW6A 1TR9A 2ONEA 1V5XA 1BAGA 4GJ1A 3FAXA 2UWFA 4CCDA 4O0KA 2BLEA 3VOJA 1DTNA 4MY1A 1XLAA 2AQWA 1EWDA 4ROPA 1IGSA 3EEZA 1JD7A 1JG9A 4YCOA 1LLOA 1XM3A 2Z29A 3FSTA 1VC4A 1QI4A 2V9DA 2YPIA 1DWJM 3DERA 1JDFA 4KETA 3DFSA 1HKIA 3MWAA 2GDUA 4IP7A 3F1QA 3OB8A 1SZRA 2OEMA 2BNJA 3VKKA 3DFOA 2VELA 4M7TA 2J77A 3RR1A 1D2KA 1X6UA 1I0BA 2WC7A 3NO5A 4AWSA 1G4EA 2GSHA 2WKGA 2WWDA 3WUBA 4ADUA 3BQ6A 3QF0A 4KWVA 2YCKX 3MZ2A 1M01A 1RCQA 2DORA 3A3WA 3KL5A 3OHMB 4IQDA 5FCZA 5TAOA 3U2CA 1VS1A 2OYKA 3LB0A 2VFIA 1KGXA 2OO6A 2PWUA 5DCEA 4DB7A 2G5WA 1EPXA 3V35A 2VRQA 3WZ0E 4AQLA 3B8UA 3PUOA 3PZGA 5HR6A 1UIOA 4EANA 4AFYA 3TQKA 2IPJA 3AYRA 4NNBA 4JTEA 3E6EA 3KDNA 4BFAA 1VFUA 1DORA 1XIDA 2Q71A 3TVAA 3WDPP 3S5OA 3CUZA 2TRSA 1XLFA 3KWXA 4WKFA 1SZNA 1EZ2A 4AD1A 3VI2A 5F4WA 4C6KA 3E38A 1V6TA 4FIRA 4D1JA 5LXEA 2R82A 4A8LA 1A5AA 1BEUA 5TD4A 3BCJA 2WAGA 2VRJA 2J27A 4EPBC 4C6IA 4LUTA 1J2BA 1EDTA 3FFSA 4UZSA 3QXBA 1I9CB 5PTDA 4J4KA 4WQ6A 1RY0A 5CZJA 2RJHA 3AC0A 4MB5A 3PJXA 1W9XA 3E0FA 1W9BM 5CPOA 3SN4A 3LDVA 1ME8A 3N2OA 4ZB0A 4HHPA 1YMYA 1CLVA 2V67A 2OODA 4CQDA 3M0JA 1DJQA 4XTDA 4MKVA 3SIZA 2VEMA 2H9AA 1JD9A 3P74A 4NXKA 2YL9A 4JTFA 3UZ5A 3BWWA 1L6YA 2PDFA 3CASA 1UR2A 1P48A 3VAVA 3VO0A 1WQ5A 3SURA 1DWHM 3VDGA 2YDSA 1ZAJA 4PB4A 2HS6A 4MF4A 1NOWA 3FA3A 4KBXA 3DU0A 5C70A 3AIQA 2GUUA 4GD0A 3GXPA 2YCLA 5HPOA 1GW9A 3IV8A 1UP3A 4LSBA 5CBJA 2O55A 2YDRA 4FNPA 3IPWA 4MM1A 3W7JA 1M03A 3B9EA 4DYEA 2O56A 2P3ZA 3R25A 2X7VA 3RCYA 3BK0A 3VIFA 5C7HA 3HJZA 4NY2A 4MB1A 3ZLGA 2XG9A 4ACYA 3C56A 4ES4A 4QJ1A 2NVCA 4DWSA 4JCLA 2XISA 4EXBA 3WFZA 2FLIA 4CNUA 2VCAA 1XIFA 3TMLA 3WD0A 1PIIA 4JL1A 4PZVA 3LQLA 4TU1A 2P8BA 4WGXA 1VFHA 4B5UA 3UG5A 3F2CA 2FJKA 3B8VA 4XIAA 1CB2A 3C0JA 3S6OA 3UP8A 3NDZA 2FZ9A 3M41A 2O9OA 3NPVA 4NAEB 1XLHA 1DL3A 1HJVA 1H51A 1OCQA 3THQA 3W2LA 1W1PA 3LZ3A 4L6DA 5GNZA 1RR2A 5T9BG 2WMGA 3VIHA 1R86A 3CHDA 4Z0SA 3W9ZA 4IWWA 3NQEA 1V6YA 1IIGA 5C2XA 3A4XA 3BPWA 4KS0A 4J3SA 4ZODA 2VO5A 4LVAA 3R8GA 5T8GA 1R3RA 1ESWA 4WJXA 1GOMA 2BXVA 2NXHA 3MDUA 2EPKX 3EMQA 4MMWA 3JZUA 4ZSTA 1B0IA 5GNYA 2CW6A 4RV8A 4AXNA 4OT7A 3S2CA 2PWHA 5CPQA 4QFUA 5IFTA 3LBCA 3S2MA 4C1KA 2ZKMX 1S2CA 3ZJ8A 1O94A 3WJSA 1EC7A 3VKBA 1CZ1A 4TIMA 2DZVA 3CUGA 4PTWA 2YLLA 4YTRA 4G9PA 1GOKA 3ARXA 3RN6A 3MHUA 1ML1A 1O68A 3AYSA 3KP0A 4C6EA 3WQDA 5I7GA 5CJNA 3W1AA 4PMDA 4LYKA 1ZHAA 4AU0A 1XIHA 4PCTA 1PKYA 4ZO9A 3UJ2A 2YL6A 1MSSA 1VRXA 4MNJA 2PTYA 1XYFA 4IQLA 1QFEA 3URAA 2V3EA 4ICNA 1V93A 1O66A 4CCCA 3VIGA 4GUFA 1J9YA 1X1NA 5DMLA 3BMXA 3UXIA 3ABOA 2BVDA 2ACQA 2V68A 1OFEA 1JGIA 1GWJA 3H2MA 1QI0A 4M6PA 5G5IA 4D8AA 2WLZA 2ACRA 2J7CA 2QPUA 3HPSA 2IS7A 2QW5A 4BQ3A 1MEHA 3PSWA 4LVGA 1BQGA 5CAKA 5A94A 2Z26A 4GBUA 3LI1A 5FJRA 1NQKA 4FPSA 4UTKA 1S1RA 4GVGA 3UFYA 2FZMA 4DBDA 1DXFA 3VIOA 2YA2A 3H4XA 2PDGA 3F5JA 3B06A 1ECEA 3W37A 4C7DA 2JF6A 5D32A 4XZ9A 2EG7A 4Z2GA 2HXUA 4HIBA 4OJYA 4IPJA 4HKPA 3W2JA 1WXJA 2H9AB 5DELA 3URBA 3UWYA 3R5EA 4BCEA 5HR7A 2PLCA 2VDGA 1ENUA 4HYRA 1UKQA 3GXTA 3RXZA 4IIFA 3UEQA 3IJQA 4E3TA 1MNZA 2HDJA 2A2IA 3T07A 3I7QA 3CH9A 4U4MA 4C5YA 1W9VA 4K39A 1KTBA 2R8WA 2AAAA 1M9HA 4KESA 2HVNA 4J2MA 4OECA 4HNLA 5DEZA 1XWYA 4RDWA 1HFBA 3U9IA 5BU9A 5M2FX 4LQ1A 5DCBA 2PDBA 1NARA 1HNYA 1FX6A 1PIFA 1XRTA 4WSJA 1OD8A 1A4MA 3GDTA 3QH2A 3TW6A 1X8FA 4MFDA 4O53A 3M6YA 1C7TA 4A3YA 3RLUA 4DWSB 1DQXA 1HGWA 1FWBC 1CXEA 1XCXA 3ELFA 2Z4GA 3CQIA 1VYPX 4IM4A 4AY1A 2QDDA 3B04A 2PWVA 1KBLA 1H7PA 1XG4A 4ZQNA 5KINA 1E0VA 2DJLA 3ZSTA 2I5GA 4XIMA 4ZQMA 4K1GA 1M7JA 3NCOA 1SW0A 1DJZA 2PS2A 5DF0A 2QJJA 1OFQA 2X0HA 2VD8A 1HW6A 4WIWA 3N2CA 1U5HA 3TWBA 5FF7A 1RQBA 3I65A 3GU2A 1MRAA 4E5TA 1P0EA 1XSIA 3GSMA 4M29A 4ZTXA 4INFA 1VYSX 3EWWA 2ZTKA 1MW1A 2Z7KA 3WQ6A 4GI8A 3KTXA 3NGJA 4NZ4A 2X1IA 3T8LA 5BRPA 3BAYA 5CEWA 3OLDA 4BF7A 2PDYA 4O13A 1PHWA 4IMEA 4LC8A 3K4DA 2DUAA 3OZYA 4QRNA 1Q5MA 4XBKA 4M24A 5CCZA 1O7AA 5CLTA 3LHUA 3QGAC 1SJCA 2WJEA 1LCOA 4MJMA 1EJXC 1GVOA 1LORA 3WMLA 4FX7A 4PB5A 3WF1A 3S2NA 4IGNA 3C0QA 1LOSA 4L5ZA 2WHLA 5EL1A 3PM6A 4PTMA 5CPNA 4OQVA 5D04C 1BWLA 1KNWA 4AZHA 1QT1A 4M6VA 1NFBA 4QTGA 1AVAA 3OZPA 3W7MA 1SZGA 8XIMA 3PZ9A 1Q85A 2OTDA 5IRPA 2YYUA 3PG9A 3L23A 3N2BA 4XV0A 1EA0A 3GVVA 3BW4A 3N12A 1JNDA 2WMFA 3P0XA 2VI0A 2QCDB 4D71A 4D6HA 1CXIA 3LS9A 4YHEA 2PF0A 3CHCA 2J88A 5ABFB 4PE8A 3ZJ7A 1Q2RA 2VEGA 3NQGA 2WM0A 4GRSA 1U1UA 3EKLA 2VT0A 4Q7BA 1WDPA 1C8YA 4W85A 4QGCA 4YMZA 3W82A 2A3BA 2OWWA 4QLKA 2PGFA 1Q65A 1J0IA 2A4AA 3H24A 3HG5A 3LV5A 4HK6A 3LBOA 4AUBA 2EG6A 5CJMA 1O1ZA 5CJ5A 4H4IA 1SPQA 3N9RA 1M53A 3N4EA 4XZNX 1W3TA 1KGWA 3NGFA 3E2RA 3GYEA 4W88A 3TSBA 5LA1A 3EKGA 3T0AA 4RZBA 1V3IA 2FPVA 4J9JA 3RJYA 1W9PA 5E93A 1HKKA 4TTUA 2CU0A 4TX9A 2GQ3A 3K5XA 4FLOA 1JZ8A 4X0NA 2XVLA 4RW3A 1ISXA 1XDJA 1KM3A 2ON3A 2R6OA 1OX5A 4OWGA 1ADOA 4LT9A 4PMVA 5LGZA 1KCKA 4L61A 2DZSA 4LEFA 1IHIA 3WNLA 3N73A 3ANYA 1RJQA 2E77A 4CVWA 4N9CA 3GNPA 3KOYA 3VOGA 1XQLA 4BWLA 3GIPA 2WO5A 3PWAA 3STGA 1FXPA 4B4FA 2E9LA 4PMQA 3QEZA 3NG3A 2XIJA 3QYSA 3TAOA 3WLTA 3AMKA 3HGJA 1UKOA 1XINA 2NQ9A 4CCEA 2XH0A 3R94A 2VOMA 3UZXA 5HK4A 4LB4A 4KFNA 1ITQA 3JZEA 1WX0A 4O28A 1V0KA 4XVDA 4XD5A 5I3GA 4LYQA 4ORIA 4RX0A 2AL2B 4LOCA 1W3KA 2Y1HA 3ITXA 1TV4A 2C7FA 1GKRA 4IG2A 3MVTA 1V3KA 4AX6A 3SCSA 5I07A 3LD5A 3LTYA 2PSNA 5T91A 4LVBA 1UR9A 3M6DA 3MQTA 3SIMA 3W22A 1H62A 3JRKA 3M5XA 3SUVA 3NQDA 4HZMA 3VMPA 3DC8A 3VXGA 1CDGA 3GTNA 5HUPA 1HKVA 4O57A 3UZZA 1I1WA 3AWNA 4AD0A 3CJPA 4IMGA 1T99A 3UG8A 4JEQA 3OJGA 4OFCA 3V16A 3WNKA 3PZMA 1OVDA 4Q6JA 3PTQA 4XBSA 4BQ2A 4IGSA 1G4SA 4GIEA 2NV2A 5FAGA 4H7ZA 3H70A 5C5YA 4GLEA 4JYFA 4U5KA 3E1F1 4E6MA 1G9HA 4H7CA 3FYPA 3TV8A 1V7YA 3PJWA 1GQLA 2DVUA 1FWCC 2R94A 4Y9OA 3VMNA 4F0SA 4DUOA 1WKYA 2QIWA 3WKZA 1E6RA 1EF2A 3GHRA 3RLGA 1S5NA 1ZS2A 3B8WA 2OZ0A 1T7LA 3CZJA 4FR1A 3GG1A 4PEKA 1FWIC 1JAEA 4W7WA 1B3XA 4X61A 1QXLA 1XDLA 4JXCA 3BUVA 3P81A 3CO4A 3BLFA 3V7PA 4DEFA 1EJRC 5A8QA 3CUXA 3EMZA 2X41A 5C7VA 1I6NA 3RG6A 2QDHA 4F2BA 4RPQA 4MY8A 2ATSA 3S1GA 4JQ3A 1F3XA 1DJIA 3BGGA 1JJKA 3KCJA 4NI3A 2VX7A 1THFD 4M6QA 4NJGA 1SFLA 2ZA2A 4LCSA 3M46A 3U2EA 4ZQCA 2GJNA 4TX8A 1RHCA 3MUCA 1K4HA 4K6AA 3SY1A 1I2RA 2CLMA 3GTHA 3ZOAA 4CQ8A 5RUBA 3DHFA 4FF7A 3M9YA 2VURA 3MU7A 3GXDA 4M51A 3C2YA 5LXXA 3W7CA 4ZTYA 1OYAA 2X8RA 1KCLA 4QM1A 1AG1O 3T44A 3BJFA 5FJUA 1DIOA 1G6CA 1HZYA 4XZIA 3TJ4A 6XIMA 1DVJA 2NW0A 2GFTA 3NPWA 3QQWA 1KCZA 3G8RA 3TLLA 3W7LA 3IEBA 3B9OA 2NT1A 1VBHA 4JN8A 3S1WA 3EWBX 4H8UA 4GQQA 2WXDM 3FXYA 3AHVA 3GDMA 3ID7A 5HQMA 5C9ZA 1O95A 1AJZA 4OU1A 3THAA 4ACZA 4GK8A 1PZ1A 5J8LA 4RUBA 4UIOA 4CKQA 1W91A 1PIGA 3SRHA 1GHSA 4AHPA 3NNTA 2R91A 5HMDA 3H7VA 4EAYA 2TAAA 4PUNA 5HMEA 4LW7A 3H26A 2PURA 3PWGA 1JXJA 1REQA 2HWGA 5FD0A 3SGZA 5BMXA 1JYVA 1K8CA 1YNPA 1Y5WA 4S2CA 1R3SA 3OYZA 1QNPA 1JZ6A 1EPVA 2A79A 4HK5A 4Z2JA 3VX1A 4V1YA 2HVMA 3ABRA 3AHYA 4QP0A 2R1MA 4XTIA 5HJYA 2ZUVA 1DQUA 1KM0A 2VEPA 2V6AA 4Z1AA 2E8ZA 2WCGA 3VGBA 5LHFA 4ZCWA 1XGDA 3PTKA 2IPGA 3WELA 1RK5A 2BWGA 4AIEA 4LNCA 3U8GA 5I3DA 1UMYA 4W89A 4RKAA 3AZSA 1MI3A 3VFCA 1U2YA 3IJ8A 3FDKA 3MC5A 5I3JA 1PTDA 4GNKB 3I6EA 5FJTA 2QGYA 2OEJA 3L2LA 4L6HA 1X97A 3G1FA 1HKMA 2V5KA 1QWKA 2YZRA 5AC5A 2Z00A 4FZIA 4ZBCA 1AW2A 2OOFA 3CUJA 2YOCA 3QHOA 5JIPA 4UNIA 2P53A 1FP8A 3L7RA 2E28A 3VYLA 3GZ3A 3HFYA 5BRBA 5K4XA 5AYIA 4O1DA 2WPBA 1CGTA 5AYYA 1EHNA 3WH5A 2A3HA 4MB4A 3WJXA 1UROA 3VUSA 3SECA 1O5RA 4X22A 4HT3A 3GXIA 3GH5A 3W7KA 2OPJA 4H9TA 3VX0A 2F61A 4XAFA 4QG8A 1VPXA 2HXTA 5AZ0A 1OG0A 2XVGA 4C5ZA 4GI9A 3KE0A 4UQ9A 1XLIA 1A5KC 3Q4DA 1SSDA 1E71M 5U4NA 4LCQA 3W7HA 1FDJA 2J8TA 1KM4A 1CX9A 4MJZA 2GGGA 3VKAA 2XFWA 1BF2A 4O4WA 3TTOA 1GEHA 1ZSXA 3AXXA 3UWWA 3ENLA 2HMCA 3QN3A 1A0DA 3SZ8A 1GG1A 1SO5A 5I3KA 5BNKA 1QW8A 3Q45A 4H9VA 2WKLA 2PP3A 5BYWA 4HZ6A 1MO0A 4X9SA 4QS5A 2ATMA 1OCBA 3WEMA 3UXAA 4HPXA 3MKKA 4PH6A 2ZE3A 3WQ8A 2GQ8A 5GPRA 4TMBA 3EYPA 1VYRA 3S5ZA 4I6KA 1TB3A 1UJQA 3GC2A 4HA1A 4U2ZA 1W3NA 1PWLA 4R88A 4CN1A 1NY1A 3GE7A 4WY0F 2WBGA 1KFWA 3THDA 4HNUA 3QPEA 4G56A 1DXIA 1WDSA 2ACUA 3OPSA 1ZCOA 4D72A 2XN1A 4ZL1A 2VTFA 1EOKA 1DEDA 1DJNA 1X98A 4RW5A 2C6QA 1BRLB 2E1DA 3HN3A 3MP4A 5CSUA 4ACZB 1YXCA 2PUZA 1L6GA 2J9YA 3TC7A 2FGZA 5E0CA 2QJGA 4GISA 3KRUA 3OBEA 5MKGB 1JZ5A 1EJWC 4JIEA 1EHAA 3GNDA 2D22A 1W2PA 5HOSA 4Y9PA 3E0VA 3WDIA 3CMGA 1IR2A 5F1UA 3ZXWA 4UTMA 2QVHA 4DJEC 1REQB 1TQXA 5J5RA 4G1KA 3ARUA 4E2BA 2BXYA 2CLLA 3N3TA 1RCOB 2B81A 3HZ3A 3WQ5A 2A3LA 2GUYA 2QVNA 1EIXA 4HTYA 1KR0A 4UQCA 3W2KA 1OCJA 1UP0A 1B30A 4WDTA 4A3HA 4MLRA 3BCDA 5B7YA 4HK7A 2J75A 1U5VA 2C3ZA 5C9RA 4CNNA 1N82A 1MQQA 4A2SA 5AC4A 4AG0A 1FWWA 3AXHA 5TQLA 1E4MM 3CWOX 2SFPA 3UCQA 4UUIA 1SUXA 2Y8KA 1H3GA 3WQOA 2ZWZA 1WKDA 3IACA 1WXZA 1VP5A 2G3JA 4LAMA 2WM1A 1O6IA 2PB1A 4W9TA 3TTYA 5I5RA 2QCNA 3IWPA 4XAGA 4LC6A 1UZDA 3LCGA 3UD6A 1F6PA 1OFPA 1J6PA 4MWAA 1GQKA 3SADA 4RV3A 1W1ZA 4DRSA 2J7FA 4HMNA 1HL8A 1GQNA 1TPWA 1YPXA 3PS7A 5LA0A 4NVTA 3G18A 5KZ6A 3WNNA 4IFRA 3LI0A 4EWJA 1OK4A 4QIUA 2ALDA 6A3HA 3T08A 2YXXA 4ZE4A 3RU8X 4EPKA 3O6CA 1TRIA 4MPKA 1Q6EA 4CNSA 1IT8A 3L4VA 2WWCA 5A69A 1NM9A 1W5QA 3SM0A 4DM2A 3NVDA 5FEWA 1GVYA 3AALA 1RALA 1KBIA 1KXTA 3LK6A 3MSYA 1LG2A 3VU2A 3W28A 4OBSA 3LSBA 3WN6A 3VFLA 4JNMA 4NJKA 5B7ZA 3W74A 2HK1A 2VUYA 1HX0A 2BZNA 4DLFA 4JFVA 2PDCA 1IT7A 4QEHA 3HV8A 1JCMP 3I3EA 1NSJA 1PTGA 3WMCA 3DHPA 1TJ0A 3CL6A 4HHMA 4S2BA 1G69A 4IL2A 1TVPA 1GKPA 1FWGC 3M0VA 4HU0A 4P7RA 4R27A 1F7BA 1UOZA 3DENA 2V3DA 4JL2A 4KEZA 2UY5A 5A6MA 1KM2A 2D2OA 3P14A 3COTA 3FV9A 1XC6A 3E0LA 2V2HA 1V6WA 3HTWA 2FGBA 3WCZA 3WH7A 1I2PA 4IUOA 4OZOA 3KOZA 1SO4A 2WJZA 2QV5A 4UR7A 5LZLA 3BVJA 4OTKA 4C1NA 4JD4A 1JXKA 3FYYA 3SCNA 1C8VA 3EOUA 1F5ZA 4C7GA 3P84A 4WJ8A 1US2A 1IEWA 3VCCA 4UQEA 4V1XA 2J7EA 2X1SA 1ZENA 3W7DA 4M6UA 3AIVA 1SFSA 3CPGA 3QR0A 3PY2A 4JKLA 1B3OA 3W71A 2XGBA 2C16A 3VA8A 1ZALA 3IUHA 1IR1A 1IT0A 1HJWA 4PTXA 1HQTA 4Z1CA 3N6JA 5K7JA 1MYRA 3GO2A 2PDPA 2BTMA 3YPIA 3WH6A 1XSJA 1F05A 1EJVC 3MJMA 4UOJA 1XKYA 4ICMA 3BG3A 1JCNA 4HPGA 5C9XA 3WF4A 4MIMA 5I24A 1UWRA 4B16A 1GORA 1XCFA 3LU2A 3AIWA 4N2YA 4FR6A 4GVHA 5A2AA 2D0HA 4OOUA 1MW0A 1NFGA 2MUCA 2ZRZA 4JFTA 3WD2A 3PULA 3EA2A 3KLLA 3L2MA 1Q66A 3DXIA 4Z2KA 3VINA 3W4RA 1G7UA 4QROA 4PUDA 2P0IA 2VR4A 4QBXA 5E0FA 1QOPA 3HU7A 1QATA 1UYQA 1O5KA 2E6DA 2QCHA 3DFHA 3MP5A 5F2LA 2FB2A 2DV0A 1WP6A 4GCXA 4AD2A 2V3FA 2Y7GA 1XLDA 2EQDA 3ZR4A 3ABQA 1LQAA 3RHGA 1P0BA 4RJEA 5C9UA 1E4NA 1P1XA 2J4GA 3F5KA 3RILA 4GYJA 1E72M 3GU1A 1F6YA 2DW6A 2BOFX 2W91A 1B3WA 4DUXA 3VNDA 4Z2LA 3WBYA 4Y8EA 3BMWA 1LRTA 2ESCA 3BLOA 3MHGA 4GY7A 3W7NA 3ABZA 1HT6A 3AS3A 3L21A 4V33A 4DJFA 4MWAB 3ITCA 4Y96A 2W3ZA 2VC5A 1G7VA 2PDIA 1OT2