4AXKA

Crystal structure of subhisa from the thermophile corynebacterium efficiens
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
235
Chain Sequence
TFTILPAVDVVNGQAVRLDQSYGTPLESALRWQEQGAEWLHFVDLDAAFNRGSNHELMAEITRQLDIKVELTGGIRDDASLERALATGATRVNIGTAALEKPEWIADVIRRHGEKIAVDIAVRLENGEWRTKGNDGGDLWEVLERLDSQGCSRFVVTDVSKDGTLTGPNVDLLRDVAAATDAPIVASGGISTLEDVLGLAKYQDEGIDSVIIGKALYEHRFTLAEALEAVEKLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENE
publication title Evolution of Substrate Specificity in a Recipient'S Enzyme Following Horizontal Gene Transfer.
pubmed doi rcsb
source organism Corynebacterium efficiens
molecule tags Isomerase
total genus 82
structure length 235
sequence length 246
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4axkA00
1Q3NA 1ZHAA 4EOUA 4LU0A 4FF7A 3W7KA 5LNUA 4AF0A 1U83A 3C2OA 1OABA 3M7WA 1LLWA 2UV8G 3TAOA 1GT8A 3FIGA 3NL2A 3UWUA 2YGYA 2EKCA 4DO6A 4HIBA 1B57A 4DBDA 1SU5A 5F2MA 4ZQCA 5EY5A 2ZQ0A 1H60A 2ZYFA 3B8DA 3W1PA 3S9YA 5SWUA 2V2HA 5BMWA 2VC6A 1G4TA 3P5YA 3ATZA 1T96A 3QMTA 2H8ZA 2YPIA 2V2DA 3SFKA 2HMCA 2A7RA 4YLWA 3PUDA 3IRDA 3C2FA 5KMYA 2G96A 3OHIA 3FJLA 4KFNA 1LBFA 3TU9A 1AMKA 5D02A 3NA8A 2OJPA 5AYXA 1OFOA 1HTIA 2CLEA 4JN6A 1TPFA 3LCWA 4O13A 2CLOA 4OV4A 2DP3A 3LI1A 3NNTA 5EPDA 4A2RA 2X1RA 1NF7A 3U8GA 2V81A 3UPBA 1VHNA 2E6AA 1DJNA 4O8RA 4UXDA 4GWEA 3E12A 4FX6M 3RLUA 1H62A 3TK7A 3W1AA 4E38A 1F73A 5D2VA 2Q8LA 3TE9A 4NZFA 2H90A 1KM5A 2ZZ6A 2OCZA 1VLWA 2PRMA 4JTSA 1DL3A 4HPXA 3MMTA 1PL9A 3CEUA 3TQVA 4OGZA 3TW7A 3R2GA 5D2TA 3G1HA 4QM1A 5FF4A 3UYCA 1ZJIA 4MVAA 4ADSA 3TXVA 1NEYA 4UNLA 2BTMA 4ZQMA 4O1DA 4NVTA 1FDZA 2EGZA 3OA3A 2C6QA 4JICA 4ADUA 3N34A 3THQA 3GDTA 1HO4A 2GQAA 3MI3A 4UMBA 5I3GA 4UUIA 2R94A 5BMXA 3P80A 3W75A 5LHFA 5EL1A 3GR7A 2DZPA 1P4CA 2ISSA 3L68A 5KZMA 4LUIA 3LRMA 5F1UA 2Z6JA 2V5LA 1SW0A 2PURA 1VCGA 1W5QA 1JVNA 1TMHA 3BG3A 3FEMA 4M6PA 3NEVA 1EWEA 1XCFA 4OU1A 3LTSA 1OK6A 4N6EA 3TV8A 3LCIA 3IV3A 2TSYA 1WYIA 2C13A 2PE4A 2QDHA 3TMQA 2ZTJA 4HSOA 3NPVA 2J27A 2Q3OA 4O18A 2YX0A 1T0OA 3P62A 1I2NA 1GOXA 4EWND 1KTBA 2YSWA 4LVBA 4U28A 1WAUA 3OG3A 4O28A 3HF3A 5ABTA 1K7EA 1S5TA 4X3ZA 3UXAA 3M5VA 3P81A 3IVUA 3W87A 2JKAA 3PY2A 1LDCA 3PS7A 1IXPA 2Y7EA 2GQ8A 1C29A 4IMGA 2R14A 1GG0A 4HHPA 3W72A 3FA5A 4N6FA 5LNRA 1JQVA 1D3GA 2P0OA 4O0ZA 3ZFHA 4FHAA 2IQTA 5K9CA 4UFLA 1K02A 4O15A 1EP1A 2B0MA 3GX9A 4HT3A 3DENA 3TJXA 4S2BA 2A85A 3LERA 1SO4A 1WV2A 3KVMA 1VQTA 4LTSA 1RD5A 2W79A 5D03A 1PHQA 3K30A 3NQ8A 1KM0A 2DZUA 1GVQA 3NPXA 4NNBA 2O7QA 3L5MA 3ATYA 1FBAA 5TIMA 3W7RA 4IQLA 4R33A 4YMZA 1VS1A 4S1FA 4JGDA 3C3NA 5H2ZA 3DI1A 4RZ6A 1JRBA 4S2CA 5IBXA 3WK3A 5D04C 3GZ3A 1OJXA 2QUUA 2VENA 3MBDA 3WK1A 1YPIA 3B05A 3NL5A 2VEMA 1EA0A 4MJMA 4FNPA 4K36A 1TTIA 2Z6IA 2TRSA 2NV1A 3MJYA 1F76A 3LCLA 4MKNA 3F03K 4RV8A 3UZJA 1AW2A 2B7OA 2J88A 3N19B 1ZCOA 2QCEA 1QPOA 3A24A 2RFGA 3KOFA 4ZQRA 5F1VA 1I45A 1TCDA 4EF9A 3G1FA 3ANYA 4YCOA 3P60A 3A5VA 1YTDA 1H7RA 4XQ6A 3W7MA 1QOQA 4DXVA 3M5XA 3T40A 1XBZA 4XZ9A 4G1KA 1BWKA 5AHMA 2GPTA 1OYAA 1XUUA 2VELA 3L0GA 4CQ8A 7TIMA 4U4MA 1XC4A 1XDLA 1CW2A 1VPXA 4UTTA 4JTIA 3RNDA 5BW6A 2A6NA 3W22A 4Z1AA 1XFBA 5KITA 5T26A 1H7PA 4GUJA 3G3MA 1DQWA 4UFHA 1F2JA 3WK0A 2QF7A 3TFXA 2Y63A 1SPQA 1PCWA 1QR7A 3WJWA 3E49A 3TX9A 1OX5A 3LRKA 3ELFA 5K4XA 3W7IA 1UCWA 1KFKA 4RLIA 3CTLA 2CLFA 4N02A 3M6YA 3LI0A 4BF9A 4DF2A 4QNWA 3L21A 1B4EA 1GTHA 4UTKA 3DHFA 4KFOA 3L2IA 3W70A 2E77A 3KVJA 3SJ3A 4KWVA 1PV8A 3PSWA 2GVGA 2A21A 3LHZA 1JJKA 1FCUA 1ICPA 3GVGA 2H6RA 4R53A 2FIQA 2VOMA 4PC8A 4MJZA 1DVJA 4RXGA 1XI3A 3E96A 1ME7A 4N2YA 1SO6A 1KTCA 1FWNA 1OF8A 3MP5A 3O07A 5LNWA 2FFCA 4Z0SA 1KW1A 2A7PA 5AC6A 3F4WA 4CNOA 3TKFA 1M5WA 5I3FA 3MHUA 2ZBTA 3IEBA 1TPB1 4FIRA 4LVFA 1KFCA 3A5FA 5HWNA 3W3OA 2A0NA 3TJLA 1G6CA 1WOBA 3GNNA 3NOEA 1Y0EA 2ZZ3A 4JTUA 2JKEA 2NX1A 3BG5A 3O6CA 1CX9A 2NUWA 1R2RA 2TYSA 4MLRA 1HFBA 3PAJA 3HIJA 3MUXA 2WV8A 3M9YA 3S42A 2QR6A 5LSMA 4LVDA 3NL6A 3W83A 3V1PA 2ZFAA 4QJ1A 2P1FA 3G18A 4O10A 2C16A 4PH6A 3C2EA 4MLJA 3RU6A 3IVSA 4Z1BA 1SZNA 2C18A 1W1ZA 1L9WA 1O60A 4WUIA 3EX6A 3NQVA 1RQBA 4I7UA 5FEWA 1RV8A 4ICNA 1QDSA 2H8XA 3G1XA 4WOZA 4X9SA 1LBLA 3E02A 4WXYA 6TIMA 3QF0A 3TROA 3BV4A 4E2DA 3L0NA 5EYWA 1F5ZA 4AWTA 1G4EA 4M7TA 3E0IA 3W2UA 3LLDA 3PSVA 2Y7GA 4N4QA 1Z48A 5D37A 3STGA 1M7PA 3QSTA 3LCFA 2QCDA 2CU0A 3NQAA 3M1ZA 3KRZA 3NQ2A 1QPNA 2DZWA 3O1NA 3PM6A 4RK8A 4UMAA 1GJPA 2AQWA 3DHDA 3EXTA 4NXKA 1TQJA 5C6MA 1TRIA 3C61A 3ABOA 3QMRA 3S8HA 2CZ5A 3UD6A 1ADOA 5AYYA 1ZENA 2ZRVA 5DCBA 2QCDB 4RXFA 5CG7A 1JCNA 3RLVA 1O94A 1BTMA 2E6FA 3VI2A 1QFEA 1DJQA 3U2OA 4BI7A 3FFSA 3TSBA 3WJXA 3W2MA 3BG9A 3G0UA 3M47A 5HUPA 3VKJA 1GWJA 2E5DA 3DGRA 4LOCA 1HL2A 1ZFJA 4O4WA 4UTMA 2QCHA 1JCJA 1RZMA 5DCDA 3PR2A 4AHQA 1A5BA 1TPVA 1NFBA 3W7JA 4AMAA 3S5ZA 2VFHA 4NUWA 1Q6OA 2ZRWA 3CIWA 1IXQA 1GZGA 1QWGA 2A5HA 4JD4A 1OK4A 3EXSA 4MZYA 2WKJA 4H4IA 4ORIA 1TPWA 3PBYA 1ZAHA 2CWNA 3QJAA 5AB3A 4NX5A 4N9DA 3NZRA 3B04A 2Z2UA 4OE7A 1ONRA 3BW2A 3VE9A 2QAFA 3LCGA 1VH7A 3HPXA 3PG8A 4XUGA 5D2XA 4PL2A 4UFKA 4AWSA 1K7FA 4PODA 5G1YA 5FI8A 3EWXA 5AHEA 5E93A 4OBTA 1VHCA 4GNJA 3CC1A 3N2MA 2ABAA 3PB2A 4N4PA 4WQ6A 3UY7A 2Z0IA 2DORA 1Q6RA 3BPWA 5EKYA 1GEQA 4BR1A 3G8EA 2WJZA 5C55A 1FWTA 1TQXA 3SGUA 3ZR4A 1H7XA 1BKSA 1OFEA 4TR9A 4WOQA 3UQNA 3PWAA 3S1XA 1TB3A 4RKAA 1VZWA 1UUOA 5KSWA 4JY9A 3QH2A 4R7JA 3AJXA 5G1TA 1B4KA 1EX5A 4O19A 1K8XA 4J9JA 1Z41A 4P61A 1L6YA 2GUUA 4ZVJA 1EB3A 2A4AA 2DZVA 2JBMA 5CZTA 1SZEA 2DJXA 2X1SA 2FB3A 3L5AA 1KFBA 3W7CA 1OG0A 2HS6A 1PCKA 2B7NA 1KA9F 4ZQPA 1P1XA 1ZAJA 1OF6A 2QJIA 3LV6A 4AVFA 4DBEA 4OT7A 1YDVA 2QCGA 4MY9A 1SZGA 1YTKA 4AF0B 1GYLA 3QZEA 4IMFA 3W7DA 1OHLA 1YPFA 1D9EA 4KFPA 2ABBA 1A5AA 4BK9A 3DBPA 4K37A 5LNVA 1LRNA 4KWWA 4X2RA 4MYXA 3IIZA 2CLKA 3SI9A 5CZSA 4UR7A 2Z1BA 3PBUA 3UZ5A 4CNPA 3M41A 4FXRA 3MP3A 3N9SA 4MUZA 3N9RA 1KV8A 3S5NA 3L5LA 1HG3A 3PF3A 1JQXA 4IPJA 4A3UA 2BXVA 1PHWA 2ZRXA 4Q33A 3SY5A 3JS3A 1LBMA 1MO0A 4FNSA 3HG4A 4RJEA 3IIOA 3YPIA 2WNQA 3THAA 2VXNA 1ICSA 2RDTA 3DH7A 4UIOA 4ZMGA 5DELA 2Q3RA 3NQ6A 5D2YA 2CW6A 4NZJA 1O5XA 3QQ0A 1WOAA 1W3NA 3MW7A 5DXXA 2VFFA 2RDWA 4ZQOA 1Q6LA 5KINA 1KFEA 5G2WA 1SW3A 4BWLC 2I9EA 1K03A 1TV8A 3C56A 3TFCA 2WOQA 5F4XA 1KFJA 2WO5A 2FJKA 2FPYA 2NWSA 1TPEA 1M7OA 4XKYA 2W0UA 4HSNA 2VKZG 1BWLA 4MY8A 4K8EA 4GFSA 5I3JA 5MHBA 5BNKA 4MY1A 2KZHA 1W56A 5FF0A 1W3TA 1EWDA 1QAPA 4MFEA 4JTLA 4Y96A 5C2XA 3STFA 3WJSA 4XKYB 4K8HA 4NJGA 3E9AA 4TU1A 5F2LA 3IIXA 2V5BA 2HS8A 4B5NA 1FQ0A 2Y62A 4IWWA 2A7NA 1VR6A 2DZXA 1W8SA 2R8WA 2WNZA 4JYFA 3OIXA 3BK0A 3CHVA 4EVZA 5A5WA 2EPHA 1YYAA 2DZSA 3KFTA 1KM3A 4AXKA 1RR2A 3B06A 1XBVA 3W7EA 4X22A 5G4WA 4XBKA 4JTGA 4FNUA 2PC4A 4LVAA 4ZL1A 3SIZA 1LORA 1S5WA 1VGAA 1TIMA 3LX9A 4ALDA 4TMCA 1H5YA 4NJIA 4ADTA 3W1NA 3UY8A 2ZDRA 3M44A 2C15A 2A1YA 3GXNA 2DJLA 1EIXA 2WSYA 5LKYA 3G1VA 3GDRA 1LRTA 4MZ1A 1W5PA 1LOLA 3QMSA 4RCXA 1WBHA 2RKXA 2J9YA 1WBJA 1DQXA 5K4ZA 3P82A 4UTWC 3C8FA 5AFDA 2NWRA 4MPQA 1G4PA 5HQEA 1H7OA 4OQVA 4Q32A 1A5SA 2EHHA 3B0VC 4H3DA 3HQ1A 3QC3A 2VFDA 1OYCA 2H3DA 2EAWA 1JUEA 1QO5A 5L6UA 4LS0A 3LCXA 2XN1A 1EPXA 3QPZA 1EUAA 4Z1CA 1XXXA 2RDUA 4FX8A 2Y7FA 2G95A 1ZNNA 2A6LA 1NSJA 3NO5A 3GXPA 4CQAA 1W37A 1THFD 1FDJA 4O0KA 1DOSA 1WQ5A 1VRDA 2PCQA 4PEKA 5HUOA 1FWRA 2YCEA 4UTJA 3TA6A 3TXZA 3D0CA 1C8VA 3P61A 3TQKA 4FIQA 4IX2A 3MO7A 1YLVA 2JGQA 3W85A 4LWWA 3W7QA 1VYRA 5LZLA 2Y88A 3DXIA 1KLZA 3GLCA 3I7RA 1J4EA 3W2KA 4QAIA 1O4UA 3QQ1A 1W3IA 1TREA 3NVTA 3EX4A 3I7SA 1AW5A 4AHPA 4IJBA 3W23A 2ZZ5A 2YFNA 3STEA 5AN7A 3TIMA 3VNDA 4HNUA 1OFRA 1FDYA 3UNDA 3G1YA 1H1ZA 2R91A 5D09A 5E0KA 4LY8A 3MYOA 2XN0A 1S5VA 1W5NA 3A22A 5DBTA 3EX1A 3HBLA 5HR7A 4TO8A 5K9DA 1DV7A 4TMBA 4UR8A 2H3BA 4QITA 4IXHA 4M6QA 1KV5A 5DBUA 3EWZA 1TSIA 1LM1A 4FO4A 3L66A 3G1AA 3G3DA 1FXPA 1VYPX 2ZRYA 3FKKA 3SW6A 3DFPA 2JGYA 3TDFA 4JDYA 5FEZA 1I2QA 3LXBA 2Q8ZA 4LT9A 3P74A 4LRSA 1Z44A 3QFEA 2QCFA 4Z0JA 4WY0A 5EBUA 3UWQA 3LV5A 1G7UA 3QW4B 3SR7A 2CZDA 3GAKA 2F84A 3TR2A 1R2TA 4A2SA 2DZTA 5K2ZA 5CSRA 1V7YA 1GVFA 4Y6GA 3Q2DA 3CLMA 1O95A 4A22A 4WY0B 3P7YA 5HNRA 2E68A 4GUGA 2YR1A 3NZ1A 4IMEA 3LM7A 1DKWA 1HUVA 3R12A 3PG9A 1BEUA 5HMSA 4XTDA 1MXSA 5K9XA 3TH6A 4UC5A 1ZALA 4O14A 3UWWA 4IPIA 4AWUA 1SFJA 1KBJA 3IIPA 2FDSA 5H91A 3FS2A 4NXSA 1TPH1 1KLYA 3O15A 3W1LA 4DO4A 1UJPA 3CU2A 3LB0A 1OFPA 4FEZA 3W2LA 1WDWA 3EWBX 5BRBA 3NR0A 3B0UX 2ISWA 1C9DA 1JCYA 4O50A 4H6KA 4O16A 3WFAA 4UFJA 3W07A 1OFQA 2Y6ZA 3NQ7A 4O1BA 4JTKA 2VEIA 4L4LA 5CPOA 1LRQA 3GXTA 5LGZA 3W1UA 1N55A 3OVQA 2YYUA 1J5TA 2Y61A 3FYOA 1F7BA 4O1CA 5TQLA 4A29A 5AOUA 4ZZ9A 3NQDA 1XBXA 2QUVA 2QJGA 2NXGA 2W6RA 4JXCA 3N14A 5D38A 3EXRA 3GDKA 3NQGA 1H51A 3I68A 3S0CA 2X1TA 2CZFA 3DKLA 4DF1A 3ABRA 4P2VA 1PE1A 1EP2A 4TIMA 1QO2A 3NDOA 3C2RA 4LNYA 5F4SA 1P0KA 4IUOA 5CPMA 1YTEA 4IMDA 1ICQA 3GB6A 4UFIA 4CCCA 1K3UA 2YYTA 4GJ1A 3DFQA 1UUMA 3MHGA 4GUIA 3TW6A 2ATSA 1IIGA 1KM4A 2ZA1A 3NM3A 4DO5A 5DXYA 2D73A 3ABSA 2QEZA 1SZFA 3L0KA 3W73A 2X1UA 4Q4KA 3P67A 1L2UA 3TC7A 1JUKA 5CZ0A 3DKJA 4O54A 2YDAA 3HOJA 2BWGA 1FWWA 4AAJA 1FCBA 2ISVA 1U5JA 3HPZA 5A8GA 1LTDA 5CSSA 2HTMA 3KHJA 1ME8A 1MEIA 3F4NA 4GBUA 3W84A 4NJJA 3T4CA 5BOOA 3LLFA 3O06A 1MSSA 3OEXA 4ML9A 4PCFA 2ZRUA 3ZWSA 1IXNA 1XBYA 3NL3A 1X1OA 3R89A 3W2NA 3KRSA 1L6WA 3TNOA 5I3IA 1XKYA 1TPDA 1I2RA 1X8FA 3DFSA 3Q94A 1QCWA 2X16A 2ZA3A 3VE7A 2FTPA 3NQMA 1LYXA 2GVJA 5D30A 3PUOA 1A5CA 5AHNA 4MZ8A 3O16A 2V9DA 4FNRA 1X7FA 1FUYA 1NVMA 1VC4A 5F2IA 2I1OA 1RQHA 1GVRA 3LGEA 5DCEA 4O52A 2B7QA 3W7LA 2Y7DA 3PC0A 5G4EA 1F05A 2ZRZA 3SSJA 3DAQA 5FESA 2OMAA 3I7QA 3ZWTA 5FF3A 3Q58A 1GVOA 3UWZA 3NXFA 2J9ZA 1JR1A 3GAYA 1R30A 1LROA 2C1HA 3NPUA 3A9IA 5HULA 1H63A 1IF2A 2JKPA 3CQ0A 3JR2A 3BVJA 3I65A 3O6DA 3HGSA 3B4UA 3BO9A 5F2GA 2NX9A 4NU7A 2WQPA 3C0JA 1HO1A 2E5BA 4M6VA 3H53A 5K3VA 3S5OA 5F4WA 5HWMA 2WNNA 3B03A 3C2VA 3DI0A 4Y8FA 1OVDA 3TQ0A 4HNTA 1GTEA 2V82A 3HJZA 3W1TA 4LW7A 2LLEA 4GUHA 1D3HA 2G97A 5DN1A 1FWSA 2QCLA 3TCEA 3LRLA 4M5PA 4JTJA 3T55A 3VFLA 3RMJA 1V5XA 4OWGA 5CPLA 4FB7A 4O12A 4O11A 1LCOA 5DY2A 4E0CA 1I2PA 1I2OA 1YDNA 2V8ZA 1R46A 3C6CA 3NAVA 3LOTA 3DFTA 4OV9A 2ZA2A 2TPSA 3L9CA 4UTIA 1ME9A 4K7YA 3LHUA 1S3HA 3KX6A 5G5IA 1SR9A 1AL8A 3GNDA 4K6AA 2X30A 5CPNA 1P0NA 3BLIA 2FQIA 3O6YX 4NJHA 2CFFA 4DELA 3BARA 1UASA 2NUYA 3USBA 1W5MA 1R47A 2ZCGA 3G22A 5FEPA 2CLMA 1SFLA 4JEQA 2NX3A 3CWNA 5C5YA 4BFAA 2BLEA 1MEHA 3R13A 3LHTA 4RZ5A 5G2IA 3HG2A 3QM3A 4AHOA 4JNMA 1AL7A 4MFDA 4CNNA 1FX6A 1LP6A 4PL1A 3IGUA 3AO0A 5AHLA 5EMUA 2J9XA 3UXDA 2YXGA 1KM2A 4O4VA 3IIVA 2C14A 3LTPA 2OZ0A 3LCHA 3EWWA 4K7VA 5EA9A 2VFIA 3W9ZA 3L67A 3G24A 4LRTA 4NX0A 3NQFA 2DU2A 4JYDA 4JX6A 4JYEA 3M5ZA 3GDLA 4LV4A 4EF8A 3NG3A 3FYPA 2FB2A 4BWLA 1O5KA 3DU0A 5AYZA 3F1QA 4IMCA 1K8ZA 1QPQA 3GIYA 2QJHA 1XL9A 5G2HA 1F6KA 3NM1A 4DEFA 4FNTA 1YADA 3HB9A 3TUUA 4AEOA 4R34A 1YXDA 3MP4A 4TX9A 3MI2A 5U7SA 1Q45A 4N9CA 3U6WA 3W76A 1DORA 1YXYA 5LHEA 4NQ1A 1QOPA 5FF2A 4I7WA 5DLCA 3CIXA 3EKZA 1OFBA 1FCQA 1LZOA 5HINA 1H50A 3FJ6A 1J2WA 4MYAA 1R2SA 3NPWA 4JTHA 2OX1A 2ZZ4A 4WY0F 1A50A 4PTNA 4C1LA 4JX4A 2HSAA 1W54A 1TRDA 1JCMP 2XN2A 2C19A 2J24A 1PIIA 3KRUA 4YXGA 1JCLA 3VCRA 1N7KA 2WSQA 3HMJG 5HR6A 4WJEA 3BW3A 3EWUA 4CLMA 2NXIA 3STCA 2OT1A 3BLFA 3W88A 4EIVA 1IGSA 1WA3A 2JK2A 1OX6A 4BI5A 4NNCA 3W1RA 3QEZA 4LS2A 1SSDA 3SECA 1TPC1 1I4NA 3GR8A 5IM51 4JTFA 1K7XA 3W1MA 3W71A 2GVLA 2O7SA 5DY3A 4MIMA 1OX4A 3LTYA 3CPRA 1TV5A 2WSRA 2Y89A 3N2XA 1ZY9A 2FLIA 3UPWA 3QW3A 4UTWA 3CM4A 4UFMA 1LOSA 3BGJA 3GYEA 4UTLA 4I9AA 1TTQA 3LBMA 2ALDA 1B9BA 1CI1A 3PB0A 4A21A 3LDVA 2NLIA 4JTEA 1OX4B 1TV7A 3UWVA 1YXCA 4ONVA 3LHWA 2TMDA 3WK2A 4DPQA 5KZDA 3HGJA 3NQCA 4XBSA 3G0XA 3PBWA 4QIUA 1MEWA 1AG1O 2ZTKA 1KM1A 3MWAA 5FEXA 3W7OA 3DZ1A 3I6RA 1ALDA 1I8JA 2NXHA 1FXQA 4YCPA 2CLIA 3T78A 4IX0A 2NUXA 1T8XA 3W1QA 3P5ZA 4DF0A 4LVGA 2F7FA 4PFMA 3WJYA 4YL2A 1TJPA 3MI6A 1SW7A 1PS9A 2VEKA 3M43A 1FY6A 5J5RA 5IBXC 1IXOA 3NYZA 4RZ4A 1NF0A 1GYNA 1G7VA 4D2JA 4JTTA 3T7VA 4K38A 4OHQA 4QQ3A 1VCFA 5LNSA 1EEPA 5AHIA 4M7SA 3B0PA 4FNQA 4DPPA 4Y9AA 4L4MA 2GOUA 4HPJA 2QCCA 3W74A 4Y90A 3TSMA 5AC7A 1W31A 4NT0A 2V0TA 2GQ9A 1JRCA 4JS3A 3QYQA 3KVLA 1KTNA 4LS1A 1X1ZA 4FXSA 3ABQA 1JUBA 2C0AA 2ZZ1A 2E5CA 5KZEA 1RQEA 2GJNA 3S1UA 3PULA 2OT0A 3EWYA 2WPBA 3C4UA 5I3KA 4HKPA 4YWIA 1SQ7A 2RH9A 5AHFA 1KM6A 3W7PA 5LGXA 2E1DA 2EF9A 5K7JA 5L9FA 1UBSA 3QPYA 4HNNA 3S1VA 3QSRA 4C1KA 3MYPA 3KXQA 4UTTC 4IXXA 5CGQA 5I3HA 1H1YA 3HPSA 4QISA 3S6DA 3LXAA 1Z42A 3P84A 5GVJA 3G1SA 2PRHA 1ML1A 3TSDA 1VJIA 1K8YA 2P10A 3NGJA 2PRLA 1P5BA 2ZZ2A 1XDMA 1A53A 3EX2A 2CLLA 3M16A 3PUEA 1FCVA 3HGRA 1GPWA 4JIQA 2NZLA 3KVKA 4JR5A 4GRSA 2QDGA 3H55A 4WZHA 2X2GA 3DFOA 1Q6QA 2AAMA 4QSHA 1JULA 2E09A 1EUNA 4O57A 5D2WA 4FX7A 1GVSA 3FOKA 2VFGA 4K39A 1SUXA 3QRHA 1XM3A 3W86A 1AK5A 4UTHA 2V2CA 4W9TA 1SO3A 2ATMA 1VYSX 4GUFA 2I14A 3R5EA 3P8IA 5D05A 2QCMA 1QNVA 5U4NA 1JCXA 1TPUA 2YW3A 4CQ9A 4MOZA 1G69A 3O8AA 4WD0A 3PBVA 3W2JA 1DHPA 1ZAIA 6ALDA 2A2IA 3G0SA 1T99A 1RVGA 1NAL1 3NQEA 4E2BA 3FKRA 3FLUA 1B3OA 4LC6A 5C54A 3MHFA 1LLZA 4JX5A 2QAPA 4UMCA 3W1XA 3JRKA 3A23A 2ZZ7A 3EB2A 3N73A 3BLEA 1E51A 2FPVA 4XTIA 5KTLA 2E6YA 1KFLA 2QCNA 1VCVA 4ORMA 1TJRA 4N9BA 3RK8A 1WX0A 2B7PA 3O63A 3RFAA 3P8JA 3W7GA 2YW4A 4BI6A 5HWJA 2BSLA 1QMLA 3CWOX 4NNAA 3LXCA 4KKXA 3LHYA 1LOQA 1TYGA 1W5OA 3INPA 5AC8A 3G1DA 4O17A 4HN4A 4I7VA 2B4GA 1TO3A 3W7HA 1AW1A 3HO8A 1M6JA 1IIHA 3EX3A 1H7WA 4N9EA 3V75A 3GDMA 4JDBA 3L65A 4HNVA 4WXZA 3IGSA 3OVRA 5FF7A 1QPRA 3OVPA 1PVNA 2RHGA 4Z08A 3ZS4A 1XUZA 2QKFA 2Y70A 4LV9A 2VEPA 3BW4A 1OFDA 5CKSA 3G8RA 1OYBA 3PVFA 1KBIA 8TIMA 1RPXA 3A21A 2AGKA 3R8RA 1H7NA 4JIPA 4O1AA 3HG3A 4WX2A 3M0ZA 1X6UA 4Z1DA 3Q37A 4AH7A 3S1WA 1H61A 4LUJA 2YFOA 4CCEA 2C3ZA 4RR4A 3LBCA 5CZJA 4POCA 3S5YA 2J6XA 4IOTA 3RF9A 1N8FA 3IGXA 3LHVA 2CLHA 3N3MA 3TMLA 2GJLA 3W7NA 2QUTA 4O53A 1W0MA 3M5YA 4RX0A 5HJLA 5D32A 4NJKA 1G4SA 3KAOA 1MZHA 1EP3A 3CT7A 1VLIA 1G67A 4QNEA 2YZRA 4M19A 3TAKA 3TC6A 3CEPA 1WXJA 3DFNA 3C52A 3SGZA 4UNKA 1DBTA 1L6SA 4DQWA 2Y85A 3SZ8A 3GKAA 4IGHA 3CB8A 2FPTA 2E6DA 3GK0A 3IVTA 4GXMA 2G5WA 2NV2A 4UTUA 2VFEA 1SSGA 3HG5A 2CZEA 3BGGA 5E1QA 4JY8A 3EKLA 1F74A 1TTJA 1GQNA 3UWYA 3WJZA 1GG1A 5TBOA 3T44A 4UCGA 1F6PA 3H54A 4CCDA 4XWUA 4GE8A 1OFAA 2XFWA 4GC4A 3EEGA 4PA8A 1YDOA 2V30A 3GKFA 3OBKA 1UB3A 3MBFA 3W6YA 1SO5A 5D33A 4LC8A 1TTPA 5J5DA 4AB4A 2BX7A 4ZQNA 3O05A 3HGOA 2BZNA
chains in the Genus database with same CATH superfamily
3WF2A 1W9DM 4EOUA 4LU0A 2G3FA 4AF0A 1OABA 3M7WA 1EC8A 4QGCA 3OBAA 3FIGA 1QHOA 4UOQA 5FAJA 5EMYA 1MVYA 2VWTA 1JZ6A 3ARWA 5F2MA 5EY5A 3VZYA 3RGTA 4B15A 2FZ8A 2ZYFA 5HJXA 5SWUA 4GCXA 3LQLA 2BG5A 5BZAA 3CL7A 1D8CA 3PZQA 3MSDA 3IACA 3QMTA 3SFKA 1RJPA 4NI3A 4YLWA 5TF0A 3IRDA 5A69A 4M6UA 3WUEA 2YCIX 3TU9A 1E70M 2OKTA 1OFOA 4J3SA 2CLEA 4JN6A 1TPFA 3GVWA 3LCWA 2XGBA 2DP3A 4M56A 5EPDA 4A2RA 2V81A 2YDQA 1UKQA 4Q7NA 3E12A 3G5EA 3QGAC 2BVWA 4PTWA 4GACA 4NZFA 2ZZ6A 2OCZA 4JIHA 4AC1X 1WZAA 4HA0A 4C6EA 1JD9A 3MMTA 5AZ0A 3CEUA 1IZJA 3ZM8A 1XYBA 4OGZA 4F9DA 2FHCA 3A3HA 3G1HA 3USZA 5FSDC 4D8AA 2HCVA 3AIBA 3ICJA 4MVAA 4MAZA 2PWGA 4UNLA 2BTMA 3EOEA 1LL6A 1KXTA 4D1IA 4O1DA 1GKQA 1CGWA 1FDZA 2VR2A 4MHBA 3KBJA 3E2VA 3DHPA 2OEMA 2X0YA 4UUIA 2R94A 1ISWA 2GUYA 2HXTA 4IFKA 1W32A 2IKJA 1W9VA 4LYKA 1TR9A 2CNCA 2Z6JA 2V5LA 1TMHA 4LAMA 3STPA 4M6PA 2X40A 3T8LA 1UW9A 2F2KA 1GJUA 2C13A 3P2VA 3QOMA 2P53A 3ARRA 2YB4A 4PUDA 2PTYA 4AVNA 2J27A 5D9MA 4O18A 1T0OA 3P62A 1I2NA 4J27A 2V3DA 3E2QA 2OTDA 1GOXA 2YSWA 4FLOA 4U28A 1WAUA 1GNXA 3V35A 5ABTA 2XSAA 1K7EA 4KIRA 1S5TA 4A3RA 2IKHA 1FKWA 2JKAA 3UW6A 4IF2A 1IXPA 2D0FA 2Y7EA 4IMGA 3CHEA 4N6FA 1JQVA 4QE5A 4QFUA 4PGLA 4FHAA 2IQTA 2P76A 3FHAA 4O15A 3GX9A 1AZ2A 1QI3A 3TJXA 4S2BA 2A85A 5D9PA 1WV2A 2IQ0A 3RG6A 4CEXC 4H41A 1VQTA 4LTSA 4E6MA 5D03A 1PHQA 3CPGA 1GVQA 3ATYA 2HPIA 3FYYA 4QCFA 4IQLA 1UKPA 3C3NA 1F07A 1BRLB 5IBXA 3Q45A 5D04C 4UQ9A 4TTUA 5DT7A 3OP2A 2VENA 3MBDA 3WK1A 4FALA 4H8HA 3B05A 1J11A 3THDA 4PMUA 3UETA 1EA0A 3LBOA 2Z6IA 1JZ3A 4IJRA 3F03K 4UNIA 1VD6A 5J04A 4PUMA 2NQ5A 2HWGA 2XIBA 4V1XA 1AW2A 4J35A 1XLBA 3F5KA 1ZQ5A 1QPOA 5F1VA 1TCDA 2YIHA 3LD5A 1XLAA 2WBGA 4EF9A 4R5EA 3CZKA 4DXVA 5AYBA 3GY1A 1XBZA 1CPUA 1B1YA 1BWKA 3WQPA 2GPTA 1QXLA 4KERA 1XUUA 1JDDA 1JZ2A 4CQ8A 4U4MA 4XIAA 2PGWA 2A6NA 4Z1AA 1XFBA 3KW3A 2VDHA 3NZGA 4UFHA 3SQMA 1VRXA 2QF7A 3WMBA 1PCWA 3WJWA 3BSMA 3E49A 1RY8A 2C1GA 2IXVA 1X97A 4JKMA 3TYZA 3T0BA 4ZA0A 2CLFA 4N02A 4AW7A 4M51A 5FJUA 4KMQA 3CZGA 3M6YA 4QNWA 3T9PA 4C7DA 3EPOA 2J7DA 2G4JA 3ID7A 2E77A 2J8FA 2QJMA 2GVGA 4FI4A 2A21A 3VIKA 3K1DA 3GIPA 1ICPA 1EZ2A 3DESA 1DVJA 5HQMA 1VEOA 2PI6A 4GMEA 2G50A 4RXGA 1XI3A 1B30A 3M0KA 3WLTA 2YA2A 4HQVA 4Z0SA 2QGYA 1WKDA 1HW6A 4Z42C 5I3FA 3MHUA 3M0JA 4FIRA 1EJTC 3WNKA 3H70A 5HWNA 1ITCA 3W3OA 4P7OA 4WSKA 3UBPC 5H8PA 1JDFA 4L9ZA 2VZUA 3E3HA 3SJNA 1HKMA 1MXDA 2NX1A 1CX9A 3WLHA 4MB3A 3L2MA 1FWFC 3CGTA 3P0XA 4QS5A 1H09A 4YVPA 3MC5A 2OQHA 1HT6A 4A35A 1EDGA 2GLKA 3MUXA 3RJYA 5H1WA 2WHMA 2ZFAA 2P1FA 2C16A 2YCLB 3RU6A 3N13A 1QNQA 2UY4A 3IVSA 4Z1BA 2E40A 3ZVIA 1SGJA 2C18A 3OGVA 2D3LA 1JDEA 3D5HA 1O60A 1PUDA 1YE6A 2QT3A 6REQA 4H83A 4WDWA 1NOWA 3M64A 3NEHA 3VKCA 1OZMA 1QDSA 4WOZA 2FFIA 3E02A 1OT1A 3QF0A 4EAYA 3BV4A 4QROA 4E2DA 4M7TA 3EWCA 3E0IA 3W2UA 2WVVB 3LLDA 2Y7GA 1HJXA 1V3IA 2ACSA 3APYA 1M7PA 3M1ZA 3NQ2A 1WDRA 2DZWA 4CU6A 1GJPA 3ARZA 4CKQA 1WAWA 2AQWA 1XIMA 3W27A 1IWPA 1G9HA 5DCBA 3AJ7A 4RXFA 3IARA 3RLVA 1BTMA 2E6FA 3I10A 1QFEA 2BGNE 3LNPA 1DJQA 3WSUA 2DVUA 3U0HA 3FFSA 4NIRA 4IP5A 4KCTA 1REQA 2AQOA 3TLLA 2XIMA 5JUVA 4ROPA 1GJWA 1GHRA 4DJDC 3S5SA 3UJRA 4GQ0A 1TPVA 3W7JA 1XV8A 4I8DA 1IXQA 3KTSA 2HPMA 1QWGA 4EANA 1OK4A 4PMOA 4H4IA 1TPWA 1DJZA 2QULA 3QJAA 3L4TA 5AB3A 2JF6A 2XTKA 4N9DA 3NZRA 4ZENA 2QAFA 1TVPA 4AU0A 1NDYA 2CKSA 4RUBA 1VH7A 3HPXA 4K8GA 4Y9NA 4AY7A 4UWMA 4LUTA 3EWXA 2R1NA 1VHCA 4KPLA 5HMDA 3CC1A 4N4PA 1S39A 2OO6A 2Z0IA 3UY7A 2DORA 2IPGA 2QV4A 5EKYA 4XB3A 3BLLA 3MCNA 3AYTA 3M0HA 1K9FA 3ZR4A 3SGUA 2R1KA 3UQNA 5H8UA 2DEPA 3L4WA 4PYSA 1OCNA 2XZ9A 3AJXA 1UA3A 1RK6A 5A94A 4ZOBA 1K8XA 4J9JA 1Z41A 4P61A 2BY3A 2GUUA 4JQ3A 1GVYA 1IZKA 1LF1A 4MMWA 4JEJA 1UQZA 1E6PA 1KCZA 4DVOA 2B7NA 1I6NA 1KA9F 3AIVA 3MU7A 1OF6A 2QJIA 3T2PA 4C6PA 1GONA 1W9XA 1YDVA 1ONEA 4MY9A 4JIIX 1AQMA 4CD7A 1OHLA 3NIYA 3RRAA 3VOJA 1XKJA 2HISA 3WD0A 2QQ6A 4BK9A 4K37A 3K5XA 3GC2A 3P3BA 4QE4A 4MYXA 3NDYA 2WLZA 2CLKA 4R9XA 3IK4A 2Z1BA 4LH8A 3MP3A 3B8UA 2Y4SA 3N9SA 5EMMA 3N9RA 2XGIA 4F40A 2J7CA 1OC6A 3T0AA 4JTQA 1YIXA 3SCWA 4A3UA 3WD3A 1RA5A 5DO8A 1PHWA 4YTRA 4Q33A 4CCZA 1ESWA 3SY5A 1JEZA 4FNSA 3HG4A 4F0KA 2WNQA 4ATDA 2INZA 2VXNA 5DELA 2Q3RA 2DT2A 3AIUA 1O1HA 1O5XA 3QQ0A 5DXXA 3W53A 1TWZA 2RDWA 4XZLX 4G7EA 4V27A 1GGOA 3GTHA 3U7VA 5B7ZA 1KFEA 5CLWA 2PD5A 2R24A 4RDZA 1HP4A 4PMRA 1EJXC 1K03A 4PMQA 3TFCA 1U1JA 2FJKA 5ABHA 1FHUA 2W0UA 1S46A 2POTA 4MY8A 4K8EA 4GFSA 3WD1A 4HPHA 5FF0A 2F6XA 2Z4GA 1C7SA 1EWDA 3OA5A 3R4IA 4LAZA 1UMLA 1UR2A 3WJSA 4XKYB 4NJGA 3VKDA 3D3FA 1GQIA 4B5NA 3CZ8A 4I8YA 2I16A 3EDEA 4NG3A 3GTFA 1NWRA 3OIXA 3BK0A 1H5VA 2EPHA 4N7QA 5A5WA 2DZSA 1KM3A 4AXKA 4JAWA 4I9TA 1OGBA 5G4WA 4AIUA 4GQRA 4JTGA 4FNUA 2NQ9A 1LORA 1KWKA 1BQCA 2VQUA 3V5FA 4ADTA 3VIHA 3W1NA 2ZDRA 4P7QA 2C15A 2A1YA 2JEQA 2VR4A 4ZSUA 3GH7A 3L23A 2VEFA 2DW7A 3WF3A 5DT5A 4JPGA 4MZ1A 3QR0A 1LOLA 3WMLA 2GDUA 4UTWC 1JFHA 2UY2A 2YDSA 2NWRA 5XINA 4EPBC 1FWHC 4BY3A 3SCTA 1G4PA 2NQHA 4Q32A 4PMDA 1M65A 1Q6CA 1OYCA 2H3DA 1QO5A 5L6UA 5CG0A 2I56A 3LCXA 4UZUA 2RDUA 3ME3A 2WBKA 4FOJA 2CKRA 3R94A 1E9IA 3NO5A 3OZMA 3GXPA 4GX8A 4JN7A 4O0KA 3CUJA 1CENA 1FWRA 1Q7QA 3LLXA 3ZO9A 1T7LA 2BOGX 4IGNA 1C8VA 1S2CA 3P61A 4FIQA 3MO7A 3EMZA 2JGQA 1J5SA 2NT1A 4XAFA 1VYRA 2F61A 1XGDA 3I7RA 4QAIA 1CNVA 1J4EA 3W2KA 1AMYA 4E4UA 5BXSA 4GYJA 3QFWA 5JVLA 4GIAA 3W23A 3APTA 5BU6A 3STEA 3TIMA 3REQA 3G1YA 3RR1A 1V6WA 2BVYA 6TAAA 4ZB0A 3W81A 2PDJA 3C0SA 4DLMA 3ARUA 5DBTA 5MKGA 3EX1A 2X09A 3TYEA 3WBAA 4TMBA 4ZR8A 4UR8A 4RPQA 2FH8A 4M6QA 4Q8MA 2WC4A 1O7AA 3V16A 3G1AA 3G3DA 3B97A 5I78A 4ERGA 1JPDX 1IEQA 4KF1A 3SW6A 4BCEA 1M41A 1E0XA 3TDFA 2QLYA 1K1DA 1UA7A 1ODZA 2Q8ZA 1JF6A 3GNOA 1AJ2A 4LRSA 1Z44A 4Z0JA 2CHNA 1XFCA 1KFWA 3LV5A 1J79A 3SR7A 2CZDA 1HX0A 3W24A 3NURA 3QXBA 5CSRA 4L9XA 2ZE0A 2FGBA 3KBVA 1QRQA 1YX1A 1WKYA 4YTQA 4Y2WA 2CYGA 4QRNA 5HNRA 3FEQA 3KS5A 4GUGA 1CZ1A 1N82A 4UB9A 3NZ1A 2P5NA 3VM5A 1BEUA 5ABFB 4XTDA 3QY7A 1MXSA 3UG5A 3TH6A 1NOFA 4UC5A 3DX5A 3UWWA 2PBOA 2FDSA 3ABZA 5D8WA 3FS2A 3E0LA 3DYOA 2VC9A 2DH2A 1GOIA 3W1LA 2PWFA 3IJ9A 5ENLA 2BOEX 3S3GA 3W2LA 1XLCA 2E1WA 3A64A 2F38A 4Z2KA 4D1JA 2OVLA 3WFAA 3NQ7A 1VBGA 1X6NA 1M1BA 3G2GA 1MI3A 4QE1A 1KRMA 3T6CA 1J5TA 2Y61A 3FYOA 4A29A 5AOUA 1XBXA 5A8NA 5D38A 2ON3A 1K9DA 3ABRA 4PUEA 5E6YA 1I60A 1W3HA 2TODA 1TV4A 2R6OA 2FVKA 4DWSC 3BCDA 3R25A 2L5HA 1ICQA 3SN4A 2VUYA 1QI5A 2XYLA 1K3UA 1Z32X 1P43A 1YRRA 3GC4A 2G8ZA 1TWWA 3TOYA 1C90A 4H00A 3PZTA 1SZFA 3CUZA 3L0KA 1DIKA 2XG9A 3BGAA 3P67A 3TC7A 4GVIA 3BSHA 3DKJA 4O54A 2BWGA 1B3XA 2V69A 1LTDA 2HTMA 1MEIA 3LY0A 3RCNA 3WN6A 4QR6A 2WCGA 4F8XA 2JFEX 3W84A 5BOOA 3WLMA 1P7TA 4V1YA 2VYOA 3FAWA 1PEZA 3AXIA 3TNOA 4DJDA 1XKYA 1GPFA 1GVEA 3DFSA 3EDJA 1I75A 2FTPA 3N9KA 1U30A 2WMGA 2GVJA 4JFTA 4MZ8A 3GU1A 4S38A 2ZWZA 1E1FA 1NVMA 3S9IA 2WAGA 2I1OA 1RQHA 1EQCA 3WLNA 1MNSA 3DERA 5DCEA 3TTQA 3QQWA 1SFTA 2E0PA 1CWYA 1F05A 1MQPA 4WGXA 4MNLA 3F2CA 1XLKA 1EC9A 1HJWA 1H49A 3I7QA 1E15A 1Y5VA 3OB8A 3Q58A 3PHAA 1NFGA 1B3YA 4NI8A 3GAYA 2C1HA 3NPUA 3T2QA 1FHVA 4F0SA 3CQ0A 3VD9A 2WWDA 1R85A 5F2GA 3AUOA 3GHRA 4NU7A 2WQPA 5EB8A 2EG7A 4XSMA 2E5BA 1WPCA 5CLTA 5K3VA 4JFVA 3BANA 5F4WA 4P7NA 5M03A 2WMHA 1DWAM 1XINA 3TP4A 4WR3A 3HJZA 2J8GA 4LW7A 2LLEA 2E8YA 3WLRA 1R3YA 1ONXA 2HROA 4JTJA 1W2VA 3FCPA 4PB5A 1DHKA 1V5XA 4FB7A 1YQ2A 5DY2A 1I2PA 3H26A 1YDNA 4HK5A 2CERA 3UJFA 4NZ1A 4W84A 2TPSA 2ISFA 1F4HA 4J3TA 4UTIA 3BAYA 1V3LA 1SR9A 3GXDA 3UP8A 4I9MA 3AHYA 2VCBA 3BLIA 2D0HA 2FQIA 3O6YX 2CFFA 3PPFA 3BARA 4B2DA 1W5MA 1JI2A 2Y5EA 2ZCGA 5FEPA 3L2LA 1J6PA 3BLKA 4BFAA 4RZ5A 3HG2A 3QM3A 4DX3A 3EBVA 4JQ2A 1NP2A 4MFDA 4WLCA 4IFOA 1FX6A 1JPHA 2VMFA 2FZBA 4GJIA 4HK6A 5CSYA 4O4VA 3POCA 1JXKA 3B8VA 3J7HA 2FJUB 4E8CA 2WM0A 3G24A 1P6BA 2YKKA 2GFTA 4ECLA 3NQFA 2DT0A 4JX6A 3UG3A 4BEUA 2DZBA 4JHZA 3OO2A 3BXWA 2PWDA 1ZJBA 5D4YA 5AYZA 5LIWX 5ECVA 1E5JA 4PRWA 1VKFA 1D3CA 1F6KA 4LF1A 3WY1A 2ESCA 4B5VA 2Z1SA 3W76A 2OEKA 1YXYA 2OSXA 1PKYA 4I7WA 1E1EA 3CIXA 1UP3A 1L8NA 3QY8A 1J2WA 4MYAA 3UJ2A 4B4HA 4WY0F 3WL0A 4PTNA 1UG6A 3OLIA 1BG9A 4YXGA 5KETA 1JCLA 2DSWA 5A6MA 3H2FA 3I3EA 4GQGA 1N7KA 2WSQA 5HR6A 3URAA 4CLMA 3GW0A 4CQBA 3UZWA 2NXIA 3QPEA 1IGSA 4BI5A 1Z3NA 3W1RA 4X9YA 1EZWA 4WIWA 4LS2A 4S3AA 1SSDA 3SECA 1EH9A 3GR8A 3W1MA 2GYIA 2GVLA 2O7SA 4WVXA 2DUZA 1PJ9A 1OX4A 4NZ4A 3OLGA 4WSJA 3QLDA 1ZPTA 2E8ZA 1OCBA 4GYKA 5JXQA 3QW3A 4XZWA 4UTWA 4UFMA 4UTLA 2O9PA 3KWXA 3LBMA 4S3BA 1HIZA 1CXEA 4HZ7A 3LDVA 4JTEA 3SQLA 1TV7A 1W2PA 3UWVA 3SY1A 2W62A 3WK2A 4M3PA 4GY0A 3UR7A 3AMCA 1HVXA 5KZDA 3JU2A 3PBWA 3KBNA 2ZTKA 1BRLA 5FEXA 1GORA 5C2GA 3ZVHA 2NXHA 4JL1A 1FXQA 2NUXA 3W1QA 1V0NA 3EOLA 4DF0A 4IMAA 4PFMA 3WJYA 4GHRA 3COTA 5AECA 1TJPA 4TVUA 3M43A 5J5RA 1NF0A 3VKKA 4MADA 2NSXA 1GYNA 4D2JA 3T7VA 2XU2A 4K38A 4QQ3A 1VCFA 5LNSA 2D20A 4O1FA 3E5BA 2YXXA 3S2JA 4N42A 4DXXA 4GBDA 3RX2A 1HVQA 2VZOA 1W91A 3HPFA 2ONEA 1DEDA 2V0TA 2GQ9A 3IAPA 4GZEA 4OOZA 3LMYA 4FXSA 1B90A 1XG4A 2C0AA 3EA1A 2BVTA 4ZE4A 3HA1A 2YA1A 1RQEA 3S1UA 3EWYA 3C4UA 2X0SA 2XINA 5FACA 3LPFA 2RH9A 3ARYA 2GJXB 5AHFA 4HPGA 3W7PA 3GRIA 4FOUA 1EYWA 5L9FA 4RNFA 4C1KA 3KXQA 4UTTC 3EAUA 2C0HA 3GWQA 1PX4A 1H1YA 3HPSA 2XVPA 3CHCA 3TJ4A 1VB9A 1K8YA 2PRLA 4DAFA 2J79A 4L64A 1Q66A 2EPMX 3EX2A 4DNHA 2CLLA 1UC5A 3UA4A 3QY6A 1C8QA 1US2A 3EMCA 3RLHA 4WZHA 3MSRA 3DFOA 4LYPA 1RVKA 4O57A 4KCWA 2OQYA 3GH5A 3VNKA 4K39A 1UMYA 1SUXA 3Q67A 3CUGA 5I2UA 3VVGA 3LA4A 4AMCA 2GGIA 4GUFA 2I14A 3P8IA 4YHGA 2QCMA 1MUCA 2X2YA 3N17A 3M0VA 5FA5A 4S3KA 3VAVA 1GQLA 1GZJA 1JDCA 1FKXA 1RXOB 3W2JA 2AMXA 1ZAIA 3SB0A 6ALDA 3WF0A 4E2BA 2CCRA 2Q71A 5C54A 2F9RA 1OEPA 4JX5A 1CXKA 4DNMA 4QSFA 1E5NA 1PAMA 2PUZA 2FPVA 4XK2A 1FOBA 3UZXA 4XD3A 2XVGA 4ZE5A 2RDXA 3C3UA 4RPPA 4BHYA 4OVXA 3CBWA 2GWNA 3M4HA 3RFAA 3VIPA 3SBFA 5HNUA 2YW4A 2VR5A 5HWJA 3SUWA 4UBPC 3T0DA 4DWSA 3NO1A 3MVIA 4KKXA 1LOQA 1TYGA 1W5OA 4Z2GA 3MT1A 3G1DA 4O17A 3C0LA 4I7VA 1AW1A 1M6JA 1FWEC 4LX4A 4GIYA 2AAAA 4HNVA 2ZVRA 3FXYA 1C7TA 2FZNA 2ANUA 3UG4A 3IGSA 2BVDA 3OVRA 1FP8A 1Z69A 4ZFCA 3OVPA 4W7VA 4KW2A 2RHGA 3ZS4A 3BOFA 3VYLA 4LV9A 2BODX 3BW4A 4H1ZA 2PGEA 4TVDA 5CKSA 5I0DA 3TTEA 3TA9A 1F3XA 3R8RA 1Q7ZA 3RPMA 3BMWA 1A0EA 4JIPA 3Q37A 3AHTA 5J8LA 1TX2A 4LUJA 2ZXQA 2F6UA 4RR4A 3LBCA 3S5YA 3KBWA 4A8RA 3V3WA 3GG1A 1N8FA 1DXIA 4MDOA 2WSPA 1QVBA 3LHVA 3CHFA 3TMLA 2GJLA 4MWAD 3W7NA 9XIMA 4RX0A 5T9BG 4HCDA 5HJLA 4DBSA 4NJKA 5GNYA 4GOAA 2DY3A 3AIEA 3MZNA 1VLIA 4M19A 4JTCA 3TN6A 1EJ7L 2X7WA 9CGTA 3C52A 3SGZA 1B3ZA 2OFJA 2Y85A 3SZ8A 5CZKA 3CB8A 2E6DA 2QVHA 4UTUA 1OQFA 1SSGA 1LQ2A 3BGGA 3N15A 4X60A 1XQLA 4XKMA 2F8QA 2FMOA 3O3RA 4ATLA 2G41A 3WJZA 1XD1A 1SJDA 3ZJKA 1OY0A 3KTCA 1PTAA 4UCGA 1F6PA 3OBEA 1OFAA 4CN4A 2XFWA 4GC4A 4PA8A 4AFYA 4HA3A 1TWSA 2YDRA 3W28A 3VX0A 3N04A 1O66A 3PN8A 5J5DA 4PN2A 1EC7A 4G8TA 3WBYA 4NNAA 1W56A 1ISZA 1ZHAA 1N2VA 2I5QA 3W7KA 4FF7A 3GU9A 3LQGA 1U83A 1LLWA 1TX0A 4GO9A 3M0YA 3UWUA 3CPUA 2GVYA 1R6WA 2YZ5A 3W1PA 3S9YA 1CIUA 5BMWA 2VC6A 1W3LA 4A8IA 4H6RA 1JYNA 2V6AA 3ATZA 5E6ZA 2SFPA 2HMCA 2A7RA 4XZIA 3C2FA 4HMCA 2D3NA 5KMYA 2G96A 3FJLA 2BOFX 1LBFA 5D02A 3QYSA 3BLDA 3NA8A 5F7UA 4E5TA 4O13A 4C65A 2GK1A 4OV4A 1NF7A 3U8GA 3UPBA 1DJNA 4MG4A 4OBRA 3TK7A 4OJYA 4E38A 5D2VA 3WELA 4ZO8A 3TE9A 4M82A 2E67A 1KM5A 1PX8A 2WVUA 2PRMA 1XIGA 1KQZA 3AMDA 5A2CA 1BAGA 4JTSA 2CBJA 2XDFA 3WEMA 3BICA 2V5KA 4IHCA 2P3EA 5A6BA 1VIWA 3TQVA 2HNHA 3TW7A 3AWNA 3R2GA 3ZLFA 5D2TA 1DIOA 1EA9C 2GZXA 3UYCA 3C86A 4I90A 1L2QA 3TN5A 3AU6A 5FD0A 4ZO7A 4Q4OA 2BGQA 4AZIA 2EGZA 2VGIA 2XIOA 4U33A 3N34A 3THQA 2HBVA 1X96A 2GQAA 3N6HA 4UMBA 1NELA 3LMZA 1DJXA 5LHFA 5EL1A 2DZPA 4CQDA 4EX4A 1P4CA 1MNZA 1VBJA 1KRCC 2Z2AA 4YYCA 4M1BA 3ZT5A 4LUIA 3AZSA 5F1UA 1PYFA 1JVNA 3BG3A 3FEMA 1M7XA 1U5HA 4NAEB 3LTSA 3CV6A 4N6EA 6A3HA 2TSYA 3K46A 3OLEA 3TMQA 1MW1A 4XD4A 5E9AA 4IIBA 3NPVA 3OTRA 1XICA 4LAUA 3HM7A 3S83A 2PTDA 2X1IA 3OG3A 3RXZA 1XG3A 4FOKA 3LPGA 1B9ZA 3BQ5A 3UXAA 5D9NA 2JE8A 1A49A 4HK7A 3IVUA 3W87A 4LPCA 4C6IA 3TW9A 5GNXA 2GQ8A 3FDKA 3JZEA 4HHPA 3W72A 3GVVA 2AQVA 1VFFA 1PSCA 4O0ZA 1V8EA 5DFAA 5K9CA 2PTWA 1J9YA 1BVNP 4PSRA 4HT3A 1CGYA 3LERA 3GM8A 2REQB 3KVMA 4CD4A 4CVUA 2W79A 3N4AA 3K30A 1HL8A 3NPXA 1FBAA 1C91A 4R33A 2FGLA 4JGDA 5I00A 1ADDA 3WK3A 3GZ3A 1OJXA 5CSUA 1G1YA 3A4XA 1YPIA 1A80A 4DZAA 2VEMA 2O55A 5A6LA 4K36A 1TTIA 2BNJA 1F76A 3BCJA 1OM0A 4GZJA 1M9HA 3S47A 7A3HA 3UZJA 3WBEA 1UKOA 3A24A 4ZQRA 3KOFA 2XIIA 2BGSA 2D69A 3GXFA 3P60A 3A5VA 3VNIA 3W7MA 3EA3A 4JKKA 5A2BA 1QOQA 1BXNA 4JL2A 4XZ9A 4KGJA 3PBGA 1HZYA 1JZ4A 4C7GA 1GVIA 2VELA 3L4ZA 2IPFA 4FK9A 4CNUA 1UC4A 3VNZA 4UTTA 3KCLA 4MJ4A 2EXOA 2FHFA 1DE5A 3WQEA 1DQWA 2Y63A 1SPQA 4XZMX 3WKZA 4F2BA 4E8DA 3ELFA 5K4XA 3H24A 1UCWA 3CTLA 5DRCA 4LB4A 3NSNA 4RL3A 3L21A 1CLVA 1GTHA 4KFOA 2OZ3A 2ZC1A 4DWDA 4PUJA 2NSOA 1E43A 5A2AA 3LHZA 4LCQA 3PBMA 2YL9A 4PC8A 3CHDA 4WRHA 1R8LA 2IPJA 3V0TA 4A6GA 2HQAA 4XO6A 3E96A 3RPTA 5JIPA 2HJPA 3L7RA 5C9XA 1FWNA 3WIJA 3SRDA 2WC3A 1KW1A 2A7PA 3F4WA 3BH4A 5BYWA 3DGBA 3TKFA 1FWCC 2ZBTA 3IEBA 1TPB1 4NZ3A 2FH6A 2A0NA 2BHUA 5LA0A 3GNNA 3RCYA 3NOEA 1DE6A 2FVLA 2ZZ3A 1XHGA 1X98A 1HKKA 3SCPA 2PF0A 3O6CA 2NUWA 3WH7A 1UPMB 3N12A 3JZUA 2TYSA 2ZOXA 3KP1A 4PUUA 2Y0FA 3V0SA 4MLRA 1JZ5A 1W1B1 1IT7A 4HMDA 3VILA 1AODA 5JBEA 2F2HA 4XAPA 3AC0A 4A8LA 1EJUC 3KDNA 3S42A 3NL6A 2DGAA 4O10A 3C2EA 4B3LA 6XIAA 1OCQA 5AY7A 4BQ4A 4D8ZA 1J0JA 1UR0A 1XSKA 4Q4SA 3EX6A 4WUIA 3UVIA 2WCSA 3WO8A 4F0HA 3SO7A 3ONBA 3MZ2A 2H8XA 2PDXA 3DFHA 3W4RA 4HN8A 1HGYA 4X9SA 5I06A 1Y8BA 1W3JA 4LF2A 3UYIA 1F5ZA 3EPNA 1XC6A 1I0BA 1NDWA 6REQB 4P7LA 1R7OA 3QSTA 3LCFA 4QG6A 3B8SA 2CU0A 3NQAA 4DM1A 2VL4A 1ITXA 2WM1A 3UJSA 4UMAA 1BFNA 3FY1A 3EXTA 4AWEA 1BF6A 3ABOA 4R85A 4HZ6A 1RLDA 1ADOA 4HJFA 3I4EA 5CG7A 2FKPA 5IDZA 1VFSA 4NZCA 1O94A 3VI2A 1VFMA 1JD7A 1LWIA 1ITUA 5B80A 1UD5A 3A47A 3WJXA 1WE5A 3BG9A 3G0UA 3VKJA 1GWJA 3SCNA 1HL2A 4GKTA 4HNCA 1P1MA 2PWUA 3B4YA 1US0A 7ODCA 4H7VA 2YCJA 3PR2A 2DUXA 3VNMA 7CGTA 2W66A 2ASHA 3S5ZA 1W1PA 4PBGA 3MTWA 3T1GA 1Y5XA 4XD5A 1S1RA 5HDRA 2R82A 3U2CA 3B04A 3VDCA 3IUHA 3VE9A 2P88A 4P8XA 3LCGA 3OYZA 1K9EA 3PG8A 5D2XA 4UFKA 1K7FA 3U2ZA 4PODA 5G1YA 1FWDC 5AHEA 1BSLA 1W17A 1S2WA 3E1F1 4OBTA 5E93A 4GNJA 3N2MA 3UXLA 1DYSA 1WUFA 1ADSA 4W5UA 1Q6RA 3VC6A 4LAKA 3SGGA 1GEQA 1R9YA 1ZL1A 3TYAA 2CETA 1E40A 1CCWB 3B0XA 3THCA 4WOQA 1E3ZA 3PWAA 4RKAA 3UWEA 4W86A 4H9UA 5KSWA 1YE4A 4IPLA 3QH2A 4EPKA 1B4KA 1EX5A 3SCUA 2P50A 1F3TA 2WKGA 3F2BA 1PTDA 3W7CA 3L5AA 4W85A 3VGHA 2W63A 1CEOA 4XV0A 1PCKA 8A3HA 1E72M 4RE0A 4ZQPA 1ZS2A 3LV6A 4AVFA 3OODA 2QCGA 3V4BA 2WZHA 4C6LA 4M8UA 3QZEA 3CTTA 1YPFA 3W25A 4WDUA 2ABBA 5LNVA 1FA2A 2I57A 4AZ5A 4HBKA 1EIBA 3SI9A 3UZ5A 3N6QA 3M41A 1V02A 1KB3A 1M3UA 3MO4A 1KV8A 3S5NA 2Z29A 3UESA 1HG3A 3QV7A 4MJ2A 2BXVA 2ZRXA 1F3WA 1A4LA 1TJ0A 3AAMA 1XIDA 1MO0A 3YPIA 3AHVA 1C8XA 4UIOA 3TR9A 3WDPP 3R8GA 4MNJA 1CXIA 3NQ6A 3A4WA 1UR9A 1P6CA 4NZJA 4XSLA 2GGHA 1G94A 2VFFA 5IFPA 2OLAA 8RUCA 4ZQOA 2A3HA 3H4XA 4LXFA 4BWLC 2P0IA 3VNYA 3C56A 4NAFB 1VFUA 4IPNB 3S2MA 1A5NC 3OW1A 3VIFA 3P6LA 3PZOA 2NWSA 2FPYA 1TPEA 5REQA 3A6OA 1DPMA 3LUTA 2HK1A 1UOZA 3PNUA 4HSNA 1BWLA 1V03A 2QMKA 5LYRA 1LQ0A 1I9CB 2PWHA 5BNKA 3VU2A 1W3TA 4HA1A 5C2XA 3STFA 1D8WA 5F2LA 3IIXA 4HOXA 1F61A 3N18A 4PRTA 3FHQA 3WLOA 2DZXA 3CHVA 1BHGA 3L12A 1GKRA 2G4FA 4H2CA 3PTKA 4ZL1A 2FTYA 3SIZA 1TIMA 3LX9A 2C91A 3QHNA 1U33A 4S3FA 4Y9OA 3ZIZA 1NFPA 4UR9A 5GJNA 4YTUA 4GZIA 1ZBWA 2PDHA 3PPGA 3G1VA 1Q5MA 5FJRA 4MB4A 1JYXA 5I03A 3VD4A 4PZVA 3LGGA 1WBHA 3R58A 2RKXA 3R79A 1DQXA 5K4ZA 3P82A 2WYSA 1GK8A 4GH3A 3VGEA 5AFDA 2ALRA 4IIGA 4H9ZA 3VFCA 4J7RA 3HQ1A 4LS0A 3ZJ8A 4H6QA 4Z1CA 3CAVA 4FX8A 2QYGA 2G95A 1ISYA 3HFYA 2JALA 1ZNNA 2WXDM 4QLLA 5TNVA 1W37A 2PDYA 3OQEA 5B7YA 2PCQA 1BXCA 2YCEA 1WDSA 4UTJA 1RJQA 4K1WA 3TA6A 3QN3A 2BHYA 3D0CA 1T8QA 1YLVA 3W85A 1W9PA 2VOTA 2HNEA 3TOPA 3LENA 5LZLA 4K1GA 3GLCA 1ISVA 3VOGA 3WNLA 3NVTA 2Y1HA 4ZXOA 3PZMA 3I7SA 3KM8A 1OSEA 1DJYA 4AHPA 4IJBA 1BXBA 2ZZ5A 4KWUA 4DJED 3GE7A 3VNDA 5AN7A 4HNUA 1OFRA 2INFA 3UNDA 2XIJA 3QV6A 2XFYA 2GJXA 4IQDA 5E0KA 5H6HA 5FCZA 2OB3A 1K4GA 4PBEA 3VTRA 3LN3A 1IV8A 2ZUSA 1A5OC 2R1LA 3PUGA 4YU1A 2H3BA 3SN0A 3HN3A 3GQYA 4PTVA 4FO4A 1FH9A 4CGTA 1PWMA 4L5ZA 5DQPA 5HQLA 1GZ1A 4J4KA 4HB7A 2OG9A 2WK2A 4JDYA 3LXBA 4JTRA 2CBUA 7XIMA 4AUBA 4AD1A 2QCFA 3ERPA 4WY0A 3EOSA 5EBUA 3UWQA 3AIRA 4S3EA 2J78A 3ABXA 2G3NA 3MMUA 2ZX6A 4OZOA 5HANA 1O95A 1X8CA 3DN5A 2VZSA 1WDDA 1A5MC 3VGDA 3ZR5A 3P7YA 2PS2A 2YR1A 3LG3A 3QR1A 5BWAA 3LM7A 1DKWA 3GFYA 3WEZA 3HU7A 4QDWA 3MUAA 5HMSA 2CPUA 4HVXA 2IMRA 4O14A 4AWUA 1SFJA 3EGJA 1KBJA 1TPH1 4OIFA 1KLYA 2OOGA 5CC3A 1OFPA 3EYPA 2ISWA 2WHJA 2NW0A 1BG4A 1X1NA 4O50A 4BZYA 1BKHA 1OFQA 2WLYA 2Y6ZA 5HBFA 2DPEA 1QOXA 2DSKA 5KZ6A 3W1UA 1QI0A 3OVQA 3VNJA 1SYTA 1DTUA 1UD6A 4O1CA 5TQLA 1UD4A 2XH0A 3NQDA 2QUVA 2QJGA 1YBQA 3N14A 3NQGA 3UR5A 1H51A 1VFLA 3MWCA 3R0KA 3W00A 4DBUA 1EFZA 4TIMA 4AVOA 2EEXA 2GL5A 3NDOA 5F4SA 1JGMA 3CYVA 2QIIA 4QEEA 1ZBKA 4IMDA 4UOZA 4W8BA 1WKFA 1FVPA 2H9AA 3IJIA 3WYZA 4GO8A 4CCCA 3N25A 4MPKA 3UR2A 3DFQA 1E4MM 3WQ8A 7REQB 4AD3A 1B3VA 1IIGA 1KM4A 3NM3A 4DO5A 5DXYA 2E7FA 4US6A 3HJEA 3ABSA 4AIEA 5HJYA 2WMJA 2X1UA 4KGLA 4TV6A 2DH3A 1JZ7A 2YDAA 3HOJA 4IIDA 4AAJA 3BLPX 5A8GA 1JYVA 1QK2A 3KHJA 4AY1A 4WGHA 3CO4A 1UUQA 3VDBA 5CAHA 3ZT6A 2BASA 3LLFA 3WQCA 4ML9A 1ZJAA 2EJ1A 2Z1XA 3R8HA 4KESA 3WQ6A 4H04A 3ZWSA 3NL3A 2WHLA 4C1NA 1JCTA 1XCWA 3W2NA 1X8FA 3Q94A 1UIPA 1QCWA 1US3A 2X16A 5A6SA 1A4MA 4YVXA 5AHNA 2ZXBA 1Z9AA 4LALA 1P7TB 3QZ6A 2V9DA 3DOPA 1X7FA 1FUYA 5F2IA 4MNKA 4E4PA 2YJQA 3BDKA 3BJTA 5FESA 2OMAA 4I5XA 3SCRA 5TAOA 2QUMA 2VX7A 1KNWA 1ELSA 1GVOA 2VWSA 1O6IA 5M17A 3QGVA 2JKPA 1IF2A 4L61A 2AL2B 1QNOA 4IP7A 1CGXA 4OUIA 3C0JA 3PFRA 1HO1A 4M24A 5LIXX 1SJAA 3H53A 4C90A 4ZOEA 1XLGA 3AROA 1JAKA 3BSGA 1O5RA 5CJ5A 3DI0A 4Y8FA 1XW8A 3VCCA 2OXNA 2V3FA 3TQ0A 3UR8A 3BE7A 3B0YA 1EBHA 1D3HA 4WDTA 5CCZA 4KH2A 3TCEA 3EDKA 4M5PA 1OADA 1DJIA 2X05A 2PLKA 1H1NA 1R46A 4Q8TA 3HZ3A 2WVTA 2ZA2A 3KZSA 3CQHA 1UROA 3WEOA 3GNDA 4Q8NA 2VNCA 4PCPA 2ICSA 1SMDA 1I1XA 1EYEA 3N2BA 3VIGA 4B5XA 5I3DA 3NGFA 1RP8A 1UASA 4JFSA 1ENUA 2YXOA 3USBA 1E0WA 1GKPA 3G22A 4Q4QA 5H8MA 5C5YA 8CGTA 3WNNA 3LHTA 1NTHA 3QLLA 4ERAA 4JNMA 4WCJA 4CNNA 4AQLA 3N2CA 2TAAA 1LP6A 4R27A 4S3DA 1V0MA 3UXDA 3IJQA 3UF9A 3IIVA 3LTPA 3DYMA 3WQOA 1XDJA 3LCHA 1M01A 2PC8A 5C9WA 4A4AA 3DC8A 3LNMA 4LRTA 4JNYA 2DV0A 1S3TC 3I3BA 5CJNA 3U4AA 4JYDA 4JYEA 3ZSTA 4HOZA 3M5ZA 4DZ5A 4B5WA 3GDLA 3H7RA 2XFFA 3NG3A 2FB2A 4BWLA 2PD9A 5BXPA 1O5KA 4F0LA 2NQLA 5DMMA 3GC5A 3ARQA 3T0TA 1K8ZA 1QPQA 3ARXA 1MQQA 2QXWA 1E71M 1XL9A 2YL8A 3WMSA 2PLMA 3NM1A 3AMGA 4DEFA 1JNEA 1QNPA 3WLKX 2XPKA 3TONA 4FZIA 5U7SA 4N9CA 3MV11 2QIWA 1QOPA 5FF2A 1MMFA 3I4KA 4FA3A 4NAEA 1FCQA 1LZOA 3DC0A 3FJ6A 3CJPA 3NPWA 1RBLA 2ZZ4A 2G3IA 1A50A 4GH1A 4JX4A 1W54A 1TRDA 1JCMP 4GJJA 2J24A 1PIIA 2DSVA 4BQ5A 1RD6A 2ZUMA 4W93A 3HMJG 4LCRA 1DTNA 2DSUA 1E55A 1XH0A 3STCA 3W88A 1WA3A 2JK2A 2JIEA 3QEZA 1V0LA 2WZEA 3IJ6A 7ENLA 2HVOA 1KR1A 3VOIA 4ATWA 3MCMA 4XISA 3K2GA 4MIMA 1UZDA 3LTYA 3CPRA 2IW0A 3N2XA 1ECQA 5DMNA 5FAGA 3BGJA 3GYEA 2REQA 3HQNA 3K4AA 3PB0A 1F8IA 3URNA 1XPGA 2ACRA 1QHZA 1OX4B 2TMDA 3BQ6A 4KETA 4DPQA 3HGJA 3NQCA 4XBSA 5RUBA 3GUWA 3U5UA 1ALDA 4YCPA 3T07A 4IX0A 3QC0A 3P5ZA 4K3ZA 4MGGA 3G6MA 5T8GA 2G3JA 2JF7A 1WXZA 3MI6A 1PS9A 4PB4A 2ZDSA 3HPAA 2O9RA 3N11A 3ZVHB 1G7VA 3UT0A 4OHQA 1POJA 4O1EA 5CGTA 9RUBA 4FNQA 4ZCWA 3TZNA 2GOUA 2MNRA 1E6SM 4HPJA 1J0YA 3TSMA 5E09A 4HZMA 3S1GA 4NT0A 2Q09A 3SRKA 5CPTA 3I3DA 2C8NA 4LS1A 1X1ZA 3ABQA 5KZEA 2QGHA 1JPMA 1KCLA 3NCOA 5IDIA 4HKPA 4EXBA 4LGXA 2YL6A 4I5RA 3FJNA 2V63A 4EPDC 1KM6A 3ZYZA 1L0PA 2E1DA 3WQVA 3DIPA 1IR1A 4G56A 3QPYA 4GABA 3MYPA 4IXXA 3A4AA 3MJMA 4QISA 1Z42A 3P84A 5GVJA 3O6AA 3QTPA 3D46A 3QKEA 1FH7A 3NGJA 1NDZA 1SFSA 1EOMA 1UWTA 1SZRA 1AQHA 1TV2A 1C8YA 1JL8A 3VDHA 3PUEA 4TOQA 3W6LA 5M5DA 1FCVA 2PDFA 1GPWA 2QV5A 4GRSA 3UA3A 3FK4A 3MA8A 3MSYA 3S46A 4FR1A 3UERA 3BUVA 1JIBA 4GY1A 2PTXA 4JQ4A 4GI4A 5C9ZA 2WPGA 3KBMA 5BCAA 1UKTA 4Q4PA 3W86A 2Z26A 2A3LA 2V2CA 4W9TA 3U57A 3WQ4A 3R5EA 2OQLA 1QNVA 3RMEA 4BJHA 5HMEA 2YW3A 4HNLA 4CQ9A 4F3HA 3KCJA 5AZ1A 5FKYA 3VUSA 1WKEA 3CLWA 1T99A 3AMKA 1NAL1 3NQEA 1R3QA 4YWSA 1WZMA 1PYMA 2GSEA 4Q8QA 3W82A 1IGWA 1R86A 4WJXA 2INEA 1W8GA 2J7FA 2QAPA 3MB9A 3A23A 3EB2A 3N73A 1E51A 4XTIA 1E3XA 1UWAA 5KTLA 1KFLA 3O0KA 2QCNA 3WFLA 4N0RA 4ORMA 1TJRA 4V2XA 3RK8A 2QDEA 3RRXA 3M46A 5I07A 1NM9A 4WJ8A 3W7GA 1OZQA 2ZUVA 2IUZA 2PLJA 1R87A 4XVEA 3FVMA 5HMFA 4HN4A 2MANA 3HO8A 1T6MA 3GO2A 3OLDA 1FFQA 3C0QA 3EX3A 3ITTA 3GDMA 2Y24A 3DG7A 4DWSB 1IEIA 2Z7KA 2WQDA 1CBGA 4ACYA 3E2SA 4HOWA 1BYBA 1PVNA 4RDWA 4HZ8A 4Z08A 3TNBA 1XUZA 2J7HA 2QKFA 1KGUA 2AL1A 2VEPA 3AMLA 5EU9A 4X2PA 1OFDA 1A5KC 4H8NA 4HTYA 2NLYA 2PP0A 3WNPA 4RE2A 3S2CA 8TIMA 1RPXA 1S5NA 1T40A 1WUEA 4O1AA 1EX1A 4XAGA 3HG3A 3POHA 2F6KA 1Q4NX 3M0ZA 4UOJA 4Z1DA 1V3MA 4POCA 1MDRA 2J6XA 1E6QM 4EK7A 3BOXA 1FP9A 1UWRA 1F4AA 2HZGA 3IGXA 1GOWA 1MWOA 1H2JA 2FZ9A 5I5RA 5A8OA 2QUTA 4O53A 1W0MA 3M5YA 5D32A 1CB2A 4BQ3A 1G4SA 4LBSA 3KAOA 3VA8A 1MZHA 2E25A 1GOOA 2DIKA 3TC6A 3MANA 3CEPA 4Q6XA 1WXJA 3DFNA 2OWXA 4RNIA 3SAZA 1PXGA 1L6SA 3KS6A 4PCTA 4DQWA 3GKAA 3W38A 1QI4A 1CDGA 2FPTA 3GK0A 3K4DA 3IVTA 5M1TA 3SY8A 2PMQA 3NDZA 4U31A 5E0CA 1UQYA 2XM2A 5C7VA 2CZEA 5E1QA 3BZGA 3EKLA 1TTJA 1GQNA 3B8WA 3EDFA 4HJWA 2ZIDA 5JBFA 3NOYA 1IT8A 4KEZA 4W8AA 3T44A 3WUBA 3H54A 1U1HA 3N2TA 2W91A 1CXHA 3H2MA 4XVDA 2OO0A 4Q7BA 2J7BA 3GKFA 3B3DA 3B9OA 3MBFA 5I23A 2R1PA 1XJBA 3U3HA 1P0BA 1Q65A 3T8QA 1Q2RA 1RCOB 4ZQNA 2BV9A 4MWAE 2O9TA 3O05A 3HGOA 1Q3NA 2QJNA 1XIIA 2ZUTA 5LNUA 1X39A 2UV8G 3TAOA 1GT8A 1X38A 3LSCA 3M0MA 4HU8A 2V38A 4DO6A 4HIBA 1I0DA 2A3BA 5CPQA 4DM2A 4DBDA 2QS8A 3VM7A 2ZQ0A 3B8DA 3VMOA 2V2HA 3DFYA 1UWIA 4KBXA 3P5YA 4YHEA 2XISA 5JMUA 1FWGC 2V2DA 4QX4A 3PUDA 2VD9A 3TQPA 2J8TA 3OHIA 1QJWA 5M3WA 3URQA 2OJPA 2CLOA 4GY7A 4Q4MA 2GJPA 1X6LA 4O8RA 4H9VA 4BKNA 3NZQA 3UXIA 3TTYA 3RLUA 1H62A 2PTZA 1F73A 2Q8LA 4OBSA 4Q4RA 3WQGA 1PZ0A 5C0QA 2GK1B 1KBBA 2PEVA 4DHGA 1DL3A 3V36A 4MKSA 3TZFA 2NVAA 4HPXA 2E9LA 1PL9A 2D2JA 3AUJA 3IANA 1Q6GA 3GW3A 1W1A1 5IHSA 4ZODA 1U2YA 5FF4A 1SVDA 2QNEA 4NAFA 3TXVA 1V08A 4ZQMA 1TE6A 4L6HA 4LCSA 4NVTA 4E4FA 2PDKA 3OA3A 2BY1A 3GZAA 1LL7A 2C6QA 4JICA 1DQUA 2AOSA 1EGMA 2E9BA 3E2RA 4G5DA 1AZ1A 4AD4A 4Q6JA 5I3GA 5BMXA 3P80A 3NSXA 3W75A 3GR7A 2ISSA 5BROA 3H2AA 1GQKA 1H0GA 3O7UA 4YN5A 3WLIA 3LRMA 1SW0A 4L4PA 1VCGA 1W5QA 5IOBA 2CLPA 3AXHA 4A3HA 4QJ3B 3S2NA 4C6NA 4JQ1A 1OK6A 4I3GA 3CK5A 3TV8A 1WYIA 3AS0A 3CUHA 3M07A 1W1VA 2D2HA 4INFA 4ZO6A 2ZTJA 3UGRA 2QF8A 3GR4A 4EWND 1QBAA 1KTBA 4LVBA 4X3ZA 2VRKA 1XYZA 2J4GA 3PY2A 3LEPA 3PANA 3GYCA 3MKKA 3E0WA 1GG0A 1J0HA 2PAJA 3FA5A 5LNRA 3RJXA 3VGGA 1D3GA 2P0OA 2V5JA 5CH9A 3L4UA 2GGGA 2WHKA 1K8CA 4UFLA 1K02A 4HU0A 3UG8A 5I24A 3F7JA 4L80A 2WW5A 1B3WA 1SO4A 2YA0A 1EEXA 1JAEA 4X0NA 1RD5A 3CQJA 2PF8A 3O9NA 1V02E 1HGWA 5IHRA 2ZUWA 3DI1A 4RZ6A 4AYSA 1EXPA 1QUMA 4Q3MA 1TA3A 2VX4A 3BAIA 3NL5A 2DW6A 2PSNA 3ECQA 2VTFA 3ENLA 4MJMA 1KCKA 5KEZA 1VBHA 4F79A 3MJYA 4QQUA 1LT7A 3LCLA 3H23A 3SFWA 1BYCA 3KP0A 4J28A 4K2SA 4RV8A 5C8BB 2B7OA 3FAXA 2J88A 3P14A 2QCEA 3N19B 3ANYA 4YCOA 1YTDA 3R0UA 1SJBA 1H7RA 4REQA 3WUGA 3M5XA 3T40A 5CQ1A 3GNXA 5AHMA 4ZTYA 3L0GA 3W26A 3ZSSA 5GPRA 3RNDA 1Q8JA 1TG7A 5GJPA 3EB4A 4AEFA 3W22A 5KITA 2B81A 4Q8PA 2Z25A 5AYIA 1SR0A 3GG8A 3WK0A 3QV8A 3TFXA 3DUGA 2XHYA 1HF6A 1TZZA 1NWSA 4FF5A 1OX5A 3LRKA 4S3CA 3W7IA 3WBXA 1KFKA 4RLIA 4LBRA 3LI0A 4DF2A 1B4EA 1DWGM 3LU2A 4QG8A 4GG9A 5A8QA 3L2IA 1VPYA 4J1OA 3W70A 3SJ3A 2QPSA 4KIEA 1KRAC 5FSEC 1JJKA 1FCUA 1UHVA 4B9YA 1V79A 4R53A 2FIQA 2VOMA 2ZVIA 3CMGA 3FDGA 3KLLA 2PDNA 1UZ4A 2IKGA 2A3AA 4O0QA 2XUCA 3MP5A 1V6XA 3ITVA 3CQIA 1R3TA 5HPCA 1UR4A 1M5WA 3SRHA 2G3MA 3MY9A 4MB5A 4L65A 1KFCA 5HAOA 3GFXA 2VC5A 2DSZA 4FAMA 3TJLA 3CV1A 4L56A 1Y0EA 4J3WA 1Q13A 2JKEA 4PUKA 2XVNA 1BPLB 4HSHA 3DHUA 4RE4A 1HFBA 1K6WA 3HIJA 3JVAA 3VK5A 4QBXA 2WV8A 5LSMA 4DUVA 4E3VA 4QJ1A 1VF8A 4PH6A 1KGWA 1R3RA 1XIJA 4NF7A 4Z17A 3DCPA 3LZ5A 1RY0A 1SZNA 3E0FA 1W1ZA 4EKJA 5BRPA 1TR1A 1FHLA 1QATA 3NQVA 2O0TA 3L4VA 7REQA 4I7UA 3ORWA 3ZJ7A 3FV9A 1LBLA 4WXYA 6TIMA 2MUCA 1VPQA 3L0NA 5EYWA 4G7FA 4AWTA 1G4EA 4BQ2A 4IIFA 4CU8A 4NZ5A 5D37A 4D6EA 3STGA 1AJZA 3RN6A 1S38A 2QCDA 4HP5A 4MTVA 2BXYA 3KRZA 1QPNA 3KHDA 4U2YA 3VOCA 3GTNA 4HYRA 4PTDA 3GUGA 2PDBA 4NXKA 5C6MA 1TRIA 3QMRA 3S8HA 2CZ5A 3UD6A 4A05A 1ZENA 2ZRVA 2PCEA 1ZSXA 1ISXA 4UQCA 4BI7A 2PDWA 4G6CA 1FWBC 3W2MA 3OGSA 3F2DA 5HUPA 1NIUA 2E5DA 3BJSA 4P8VA 4O8AA 4BF5A 4LOCA 1ZFJA 2QCHA 3FN9A 1JCJA 2XSBA 5DCDA 2E3ZA 4Y9PA 4AHQA 1WCGA 4J3ZA 1HKJA 4AMAA 2IQDA 4C6QA 1Q6OA 1OD8A 2ZRWA 1UR1A 3N2OA 1H0IA 3IGHX 2A5HA 4EACA 3VPLA 4JD4A 3EXSA 2QMJA 4MZYA 4ORIA 5A8MA 3MKCA 3WLPA 1ZAHA 3KLKA 5I02A 4JN8A 3WCZA 3SQSA 3DDMA 2CZVA 2AL2A 4WHBA 3UEQA 4RW3A 3QTGA 2CXEA 4AWSA 3BURA 3WMCA 1ZZMA 5FI8A 1UWQA 4G9PA 1AQ0A 3P0WA 3VUPA 4CNSA 3PB2A 4CN1A 4WQ6A 3AXMA 2RGMA 3AS1A 3PJXA 3SDOA 5AVHA 3G8EA 3ISIX 5C55A 1FWTA 1H7XA 1OFEA 4TR9A 1XIFA 1F9CA 2X8RA 4IUGA 1TB3A 3T09A 1VZWA 1UUOA 1VJSA 3OJGA 4GIEA 2VCAA 4R7JA 4LFYA 3WDQA 1Y5WA 5G1TA 1KRBC 2QDDA 3BAWA 4ZVJA 2W92A 1EGVA 3DYPA 4NRSA 2A4AA 1IEVA 2DZVA 2JBMA 5CZTA 2DJXA 1PX3A 2FB3A 1KFBA 2OYMA 1QBBA 4DUXA 3GVRA 2HK0A 1ZTVA 4MKVA 1P1XA 1Q63A 4NASA 2NVDA 4DBEA 4OT7A 3RO8A 1YTKA 3ZZ1A 5G1MA 1OIMA 4IMFA 4R9OA 1CYGA 3SIMA 3CYJA 1D9EA 2CITA 2YLAA 1FWJC 1WNOA 4KFPA 4LYRA 5E70A 1A5AA 1XD0A 3K1GA 3UCQA 3DBPA 3H8AA 4QJ5B 4YPJA 4KCVA 4FLQA 3EWDA 1LRNA 4KWWA 3B9DA 4X2RA 1S2VA 4QDPA 5IRPA 1J18A 4XX6A 4UR7A 5LIUX 4XO7A 4YJ5A 4CNPA 3L4XA 4NKCA 2Z27A 2PDGA 5CBIA 1JQXA 4XG1A 4IPJA 3WDJA 1OB0A 2XIQA 3OZPA 1NWUA 6XIMA 3UVAA 4DZHA 3I6EA 3JS3A 3QOKA 1QI2A 2XGZA 1BD0A 3OHMB 3IIOA 3THAA 1B54A 2RDTA 3DH7A 4CD8A 5C71A 2J7GA 1BWVA 4JIRA 3R7MA 2A79A 3CH0A 1R3SA 3AYSA 1RSCA 1A5UA 1W3NA 3MW7A 3AU2A 2OLHA 2PFHA 1Q6LA 4DYJA 4B16A 2V3EA 1OCJA 5E9XA 5G2WA 3MS8A 1C3FA 2XH7A 4IISA 4C91A 1DP0A 1TV8A 4NRRA 2WOQA 5F4XA 1TKKA 4F9JA 4DZIA 1KFJA 2RJGA 2VQTA 1M7OA 1O12A 4GVGA 2VKZG 2Y5JA 3MUCA 1F8MA 3SUUA 5I3JA 3CUIA 5MHBA 4PUNA 2KZHA 3NQBA 4PTMA 1TVNA 1FTXA 3MDWA 1QAPA 4MFEA 2W3ZA 5REQB 4K8HA 4TU1A 4XAYA 4J2MA 2WVSA 2V5BA 3CMFA 4J2PA 4LUYA 5HXMA 3A3WA 2Y62A 4W87A 4E2OA 4LUSB 3HV8A 2A7NA 2XH2A 1VR6A 4ZB5A 3VGBA 2WNZA 4QAWA 1YYAA 3KFTA 1JI1A 1ZJHA 1RR2A 4QTGA 5CC6A 3BTNA 1E73M 4JTAA 3IAQA 4L1WA 2NQZA 4LVAA 4L6DA 2HE5A 3KZPA 1MQRA 3S2LA 4ALDA 4TMCA 2C1IA 1H5YA 4NJIA 3AXKA 1GOQA 3M44A 3GXNA 3PTDA 2W9MA 3LPPA 2RGLA 5LKYA 3GDRA 1LJYA 4H19A 3QMSA 1B31A 2A3EA 2DVXA 1W1TA 1KXVA 1WBJA 3TN4A 3VDGA 2GQ3A 4YNGA 1K70A 3WG6A 1TZ9A 4D8LA 3MDUA 4PRRA 2OYKA 3K8KA 1PZ2A 5I7GA 5HQEA 4OQVA 1A5SA 2EHHA 3SCQA 4H3DA 3WZ0E 3QC3A 1XIBA 2D2OA 4A3YA 3CMJA 2VP8A 1CB7B 1KXHA 3G1RA 1EPXA 1UKSA 3QPZA 2DT3A 1MW2A 1XR2A 2IPWA 1VFHA 1V6VA 2A6LA 1GOKA 1NSJA 4IFRA 1A3XA 2RJHA 2BP1A 3RX4A 4CQAA 4C5ZA 1E0UA 4IL0A 1FDJA 1UZ1A 1DOSA