1V7AA

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
349
structure length
349
Chain Sequence
b'TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenosine deaminase
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 143
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v7aA00
4J2MA 1R9ZA 4XD4A 1M7JA 3DCPA 4EP8C 3HM7A 4D8LA 2VC7A 4H9UA 4CNTA 2Z26A 4H9ZA 4RDWA 3WZ0E 1RJPA 2GWGA 4B92A 4XAYA 4C6LA 2EG6A 4LCRA 4PCPA 3MDUA 1ITQA 4XD3A 1FWIC 3GIQA 1E9ZB 1J6OA 3GG7A 2PGRA 3OOQA 3S2LA 4M51A 1J79A 4L6DA 3ICJA 2PAJA 2OB3A 4BY3A 3NQBA 1NDVA 4IG2B 3F4DA 5A6TC 3N2CA 2O4MA 2Z00A 2YB1A 2A3LA 4TQTA 1WXYA 1A4LA 2PLMA 4CNUA 4ERIA 3IARA 2PGFA 3EWDA 4RE0A 4IGMA 3S4TA 3URQA 3CS2A 4PBFA 4ICMA 4F0SA 1FWDC 2DVXA 3LGGA 2CZVA 4OFCA 3E74A 3AU2A 4AC7C 4R7WA 4C6DA 4KESA 2Z7GA 3AU6A 1EF2A 3UF9A 1W1IE 1FWHC 4XD6A 4CEXC 4XAFA 1V51A 1E9YB 3TN6A 2OQLA 1EJXC 4C5YA 1FWBC 4Z42C 2FTYA 1KRMA 4IGNA 3O7UA 2HQAA 4F0LA 1BF6A 3OU8A 4INFA 3DC8A 1FWJC 2UBPC 4IH3A 4CQBA 1FWEC 4JOMA 4IF2A 4DZHA 1HZYA 3TN3A 4XAZA 2PUZA 4GY7A 3E3HA 2Z28A 3E0FA 3GU9A 3SFWA 4LCSA 4KERA 3SO7A 1EJSC 4C6EA 4B90A 3MTWA 1KRBC 1RA0A 1GKRA 4RDYA 4EPBC 4GX9A 3QGAC 4LCQA 4DYKA 4EPEC 3WYZA 1V4YA 3C86A 1EJTC 4XAGA 2GOKA 4KETA 2Z2AA 4QS6A 4GY0A 3TN5A 3B40A 4C6KA 4WGXA 3MVTA 3DUGA 3RCMA 4C6OA 4C6IA 2E1WA 3AUOA 4DI8A 3QY8A 4GK8A 2G3FA 3UR2A 1NDZA 1XGEA 4B3ZA 3A3WA 4B91A 2W9MA 1ITUA 2FTWA 3B0YA 1YRRA 1FWAC 5HMEA 3MKVA 1ZZMA 3IJ6A 1EZ2A 1I0BA 4ZSTA 3RN6A 2Z29A 3GTHA 3LSCA 1J5SA 1XWYA 3E2VA 3BE7A 1J6PA 3MVIA 4LAMA 4I6VA 1RJRA 4G2DA 1KCXA 4QROA 5AKQA 4DIAA 3LS9A 2YXOA 3OJGA 1EJUC 2R1LA 2HBVA 4PE8A 2YZ5A 1NDWA 4QRNA 3HTWA 4IG2A 1FKWA 2VM8A 1YIXA 4LALA 1O12A 3A4JA 3V7PA 4J35A 4C6BA 3MDWA 1EJWC 1RK5A 3OODA 2Z24A 4V1XA 1GKPA 2VC5A 4HA0A 1KRCC 3PNUA 2QPXA 4C6MA 1WXZA 4NG3A 1NDYA 1GKQA 3LA4A 4NI8A 4P5UA 4H9YA 4GY1A 5HMDA 2OOFA 1UIOA 1P1MA 3R0DA 2EG8A 4HK7A 2ICSA 3QY7A 1QXLA 3K2GA 4IFRA 4EPDC 1UMLA 4C6PA 4H9TA 4LAOA 4DLMA 4QS5A 5FSDC 2VR2A 4RZBA 1UBPC 3F2BA 1IE7C 4J5NA 1EYWA 2AQVA 2GZXA 2WJDA 3LNPA 1FKXA 3FDKA 3GIPA 4AQLA 4I6KA 2WJEA 4KEZA 4UB9A 3UBPC 2ZC1A 2D2GA 1PB0A 5HMFA 1PTAA 4C65A 4EPKA 3GRIA 5FSEC 1UIPA 4DO7A 3MJMA 2VUNA 3O0FA 3S2NA 1ONWA 3ISIX 2Q09A 1A5MC 3GTXA 3LU2A 4H9XA 1A5OC 1A5KC 3K4WA 4ZSUA 2R1PA 4GZ7A 1PSCA 3WMLA 1P6CA 4CEUC 4DZIA 4H00A 4CNSA 3EGJA 4DNMA 1R9XA 1A5NC 2XIOA 4GYFA 4LFYA 1P6BA 3E0LA 1ADDA 4MUPA 2HPMA 1A4MA 1NFGA 2P50A 4NP7A 3PANA 1XRTA 2WM1A 2Z2BA 3S2JA 4C6JA 3NEHA 2R1NA 4C60A 1QW7A 1V7AA 2D2HA 2FVKA 2O4QA 3FDGA 3T1GA 2HNHA 3UPMA 3IACA 4XD5A 5LXXA 3KM8A 1V79A 3TN4A 3URAA 3ORWA 1POKA 3E38A 1VFLA 3QGKC 1RAKA 4QSFA 2QVNA 4HK6A 3URBA 2I5GA 3G77A 1K6WA 4UBPC 4IQJA 2OODA 3TNBA 3T81A 4BJHA 4GX8A 1RA5A 2BB0A 2D2JA 2YB4A 1V77A 1YNYA 4RDVA 3FEQA 3LY0A 1K1DA 1ONXA 1YBQB 2AMXA 2F6KA 3EWCA 1RJQA 4PBEA 2VHLA 2WJFA 4C6CA 3LGDA 1YBQA 2QT3A 4GXWA 4IFKB 4YIWA 2P53A 3JZEA 4IFKA 2GSEA 3ID7A 3IGHX 1POJA 1M68A 3F2DA 4QTGA 4KEUA 3GTIA 3GTFA 3ITCA 3MPGA 2Z27A 4CQDA 5E5CA 1FWCC 4E3TA 3IRSA 4ERGA 3K5XA 2DVTA 3CAKA 3URNA 3RYSA 3D6NA 4HJWA 4H9MA 1R9YA 3S2MA 3CJPA 2Z25A 1FWGC 1K70A 2KAUC 3IPWA 1YMYA 4L9XA 3GU1A 1EJVC 3F4CA 1JGMA 2Y1HA 2BGNE 4KIRA 4V1YA 3QY6A 1XRFA 4GBDA 2AQOA 4RDZA 2FVMA 2E25A 1RK6A 4LH8A 4WVXA 1I0DA 4PCNA 4KQNA 3UR5A 3F2CA 4DI9A 2QS8A 4KF1A 1EJRC 1O5RA 3HPAA 2OGJA 3PNZA 3OVGA 3B0XA 2Q01A 2EG7A 2FFIA 3PAOA 4R88A 4GC3A 4CQCA 4GOAA 2ANUA 2R1MA 2DVUA 1M65A 4C6FA 2Z4GA 4BKNA 3MSRA 3LSBA 4C5ZA 4LEFA 4HK5A 4H9VA 1KRAC 2IMRA 4C6QA 3IV8A 4ERAA 1DPMA 1FWFC 4G7EB 1A5LC 2I9UA 4LANA 2ADAA 4IFOA 4G7EA 3PBMA 3NURA 4WHBA 2HBXA 1PO9A 2HPIA 3GU2A 3RHGA 4R85A 3OQEA 1S3TC 5G4HC 4DLFA 5CH9A 4F0RA 3GUWA 2UZ9A 3T8LA 4H01A 2RAGA 4LAKA 4C6NA 2GWNA 4KEVA 2R1KA 3A3XA
chains in the Genus database with same CATH superfamily
2Q71A 2ZZ5A 4Y7EA 3DCPA 4P7NA 5TAOA 2OWXA 1FXPA 3V5FA 4B9ZA 1V3IA 4O13A 1Y7VA 2DIEA 1VBJA 2FZ8A 4A8LA 1MQRA 2OO0A 2QEZA 3L65A 5AHEA 2EG6A 4LCRA 1RP8A 4F2UA 4CCDA 4IMEA 3ZS4A 1MXSA 3WK0A 4M51A 1J79A 1HKVA 2Y6ZA 4HHPA 5C9XA 3R89A 3WCZA 4NUWA 4GYPC 3DX5A 1PIFA 3KE0A 2RGLA 2O4MA 1ML1A 2VWSA 2J75A 4O8AA 1WXYA 1Z41A 1LL6A 3UXAA 3L68A 1XC6A 4U10A 1V0KA 5H6HA 3GSMA 4OBTA 4FNQA 2DFAA 2I5QA 3TR2A 1CXKA 2YXGA 3E74A 4IX0A 3G1AA 3TMLA 4WCJA 3W1LA 3LHYA 3QOMA 3C2EA 3EX3A 3HV9A 1FWHC 3VD7A 4BEQA 3IAPA 4IIBA 3MYOA 1SSDA 3VTRA 4DUOA 1YTEA 1JQXA 4NZ4A 1S1PA 3T0TA 3NO1A 4C90A 3ANVA 1FHUA 2J7DA 1UH3A 1JL8A 1QK2A 2HE5A 2YOCA 3AYSA 4GGBA 1AVAA 5AN7A 1Q4WA 1XYCA 4RX0A 2XH4A 1UR4A 2WSKA 4I9JA 5FL1A 3PJTA 3HV8A 4U28A 5CAKA 1O6IA 1XQKA 3VCRA 4KWVA 2PB1A 4O50A 4S3FA 4H04A 4QLLA 1JEZA 5A8QA 1A5SA 3SEPA 2VVSA 4X3ZA 2Z2AA 3BH4A 3UGRA 3KOZA 2D73A 2WVTA 4GGHA 3W1UA 4Q8MA 3OVQA 3CAQA 4JFWA 3RCMA 4DI8A 2I57A 2XVGA 2GJNA 4GK8A 4DBEA 2G3FA 1NDZA 3W27A 1NSJA 2WC3A 4ZTXA 1JXJA 4JIQA 3IJ6A 2QV4A 1HQTA 3BLEA 1MFVA 3LSCA 3UXKA 1NJJA 3AXKA 1TTJA 3Q65A 4G2DA 1H11A 2O9OA 3TJXA 1DJXA 2G3IA 4UMAA 1OIFA 2PLCA 1LBLA 1RD6A 1UA7A 1QW9A 1OM0A 3KBSA 4DJDA 4YTTA 1PEZA 1I4NA 1QI2A 4UTTA 3JR2A 2YYUA 1VFOA 2VR5A 3UG3A 1EOKA 4OIFA 3EZ4A 1LLZA 5CGQA 1KRCC 3I10A 1OG0A 4MB3A 1WXZA 1SO5A 4O8RA 4P8UA 1TX0A 3TLQA 4F48A 3GQYA 1PV8A 3MP3A 3NVDA 3QY7A 5M1TA 1F8MA 1TMLA 4JFTA 4OTKA 4QCFA 3DG3A 4H9TA 2YR1A 1HP4A 1LRNA 1P1XA 2C71A 2OXNA 1MRAA 4J5NA 1W2VA 2QZRA 1UZ1A 1V3HA 3FDKA 4GA8A 4WDXA 3LV5A 3QQWA 4EAYA 2WJEA 4KEZA 4IIGA 1SZRA 2CHRA 4RW3A 1A49A 3O6CA 4ES4A 3MJMA 5E0CA 5L6UA 3ARUA 3BJSA 4UFKA 1QWGA 3B8VA 4PRTA 2INZA 3E02A 1MEWA 4R9OA 3V3WA 1T8XA 3EGJA 2V82A 2ZDRA 1R9XA 3IIPA 1Q7QA 2WNNA 4BQ4A 1ZAIA 2VX6A 3VMPA 3CMGA 3WQ4A 4MZYA 4AG0A 2Z0IA 4P61A 2OJPA 4TUFA 4PC8A 1NFGA 4FA3A 3PANA 3QYQA 2WM1A 1TPC1 2VC6A 4F79A 3AMKA 2CITA 4C60A 4DQWA 2XH0A 3PUEA 2GQ8A 3PZTA 4UXDA 2XJ7A 2AKZA 4OUEA 2D1ZA 1AL8A 2J6VA 2YDSA 4YNGA 2QVNA 1E51A 5FJUA 1BGAA 3N11A 4IM4A 4S3BA 1DEDA 5D37A 3DOPA 3WH8A 2WANA 1DIOA 3GYCA 1TUXA 1SW0A 4JYFA 4LVFA 5DMLA 1OVDA 2CU0A 5J8LA 3WK3A 1W9VA 2ZRXA 3U2EA 1UD2A 1OFBA 1AH3A 4PBEA 2NWSA 2V3FA 3DU0A 1ZFJA 5E93A 3QMTA 1SR0A 3DKJA 7CGTA 4LUIA 3CUJA 3VFCA 2IKJA 4WY0B 1A5BA 4H8NA 4NNCA 3TW6A 3CYJA 5D09A 3GNDA 1M7XA 2GUYA 2IKGA 2ZUNA 4KEUA 4QTGA 1EDQA 5A2CA 1K8CA 1RCXB 2GJLA 1GW9A 3UY8A 5BRBA 4WJ8A 5FJPA 1FCQA 3DG6A 1XICA 2WVVA 1O4UA 1E71M 2KAUC 1US3A 1EZWA 3ZJ6A 1M7PA 1CB7B 3E0VA 4AHQA 4V1YA 3CNYA 2E25A 2DT0A 3PPGA 3RG6A 1EJRC 3KBMA 4LB3A 3SDOA 4GNJA 1JYWA 1QATA 3PAOA 3S5SA 2FB2A 3EXSA 1SGJA 2DSVA 3QQ0A 4BF5A 3SQSA 1PAMA 3M0ZA 3BCJA 3BWWA 3W2JA 2X16A 1AJZA 3LSBA 4JKKA 3CIWA 2CLEA 4AZCA 4ERAA 3T4CA 1HJSA 3VGEA 2VX4A 4IPNB 1MUCA 2HBXA 3GHRA 1QO5A 3VYLA 1W8GA 1CENA 3NWRA 4JN6A 3WF2A 6CGTA 4JTAA 4WQ6A 1C7TA 2WCGA 2VFEA 1EPVA 3MO4A 3RLUA 1XDJA 4S39A 5HJXA 1K6AA 4KH2A 3EDDA 1IZJA 4DWSD 1W5PA 4FOKA 1HGYA 5T91A 1QT1A 4DBWA 3ZSSA 1ZB5A 3KBVA 3DHDA 4GINA 3TVAA 3W1RA 4EXAA 1W1TA 4G7FA 3LBCA 2XIQA 2O55A 3HGSA 2Z2UA 3NO3A 1E3XA 3GBEA 3W1QA 3TSMA 4XIMA 3W74A 3OG2A 4ROPA 2YB1A 5AZ1A 1UMYA 3FXGA 1UPPA 1K9TA 4KCVA 3PAJA 3WH7A 3UJ2A 5BOOA 3EB3A 1QDSA 3TNOA 2VRKA 4LBSA 5IXEA 4IGMA 3OIHA 4PBFA 2WMIB 4ICMA 4LX4A 5K9DA 4HYWA 1ZBWA 1VCVA 1U1UA 1HJQA 4FOUA 2OWCA 6REQB 2PDGA 5HJLA 1X8FA 2D3NA 3TCSA 4O1EA 1K77A 4NZ1A 2PSNA 3I7SA 5ECVA 3TUUA 2OQLA 4Q8WA 3S9IA 3UCCA 3W6MA 2EPHA 3EX4A 2C0HA 3SUWA 4PTDA 1L8NA 2YCEA 4AB4A 1VF8A 4AZGA 1V6WA 1VYSX 5HPOA 4JOMA 4B2DD 2G37A 2XFFA 2NT0A 2DUAA 4B5VA 4DN1A 3KRBA 1W1VA 4ZFCA 1OFRA 1NVMA 3LG3A 3TP4A 1KGXA 1GKRA 3CXOA 1TJRA 1KB3A 3WYZA 1PCKA 2PZNA 1N82A 1TR9A 3W7JA 5A8OA 5HANA 4A29A 3JS3A 3TKFA 2QCFA 3B40A 1ELSA 5I09A 5XIAA 3ZO9A 3TQ0A 4WGXA 1EXPA 5A94A 4F3HA 2GL5A 2QHAA 3TA6A 3QHNA 1QBAA 3CUIA 3HGJA 4LQ1A 4GQRA 1ZZMA 4ZL1A 2XVPA 1VPQA 2DQWA 1JULA 3CIXA 1XWYA 3E2VA 1RH9A 3A21A 1HX0A 3RR1A 2PDHA 2WPGA 2Y24A 4TX9A 3A4AA 2PRHA 4KS0A 4GI4A 1LJYA 5IHSA 1I2QA 1VRDA 2YCJA 3LHWA 1QBBA 4QRNA 3W7EA 4I7WA 3GD6A 4XIAA 1T7LA 1PS9A 5LA0A 3BTNA 3V7PA 3U5UA 3GKAA 2F2HA 4UTJA 5EB8A 3L0NA 1BVNP 1CXHA 2Y8UA 4BFAA 3WNLA 1GKQA 5GJMA 4PFHA 3R0DA 1SMDA 1GVRA 3AZTA 1FFQA 4DZ5A 2E09A 4WSJA 3VIPA 3NQMA 3H2MA 3JVAA 4OKDA 3W70A 3B8IA 2X0YA 4L56A 4WIWA 2E28A 1C8YA 4WD0A 1UJQA 1Q6CA 4I6KA 5FF7A 2FPTA 3UBPC 2ZC1A 1K03A 1UIPA 2W79A 3GC2A 1XBVA 1LCOA 2ZC8A 4N4PA 1LL7A 3KOFA 4UCFA 2NV1A 4PEEA 1HJWA 1P6BA 3E0LA 3YPIA 2OKOA 4YMZA 4PR4A 3RJYA 1XISA 2E5BA 3KRZA 1EC8A 3BAKA 3ELFA 3OA5A 3XIMA 4YN5A 2VFGA 4BI5A 4ICNA 5H1WA 1EDTA 1CDGA 3NSNA 1RQEA 3GAKA 4XD5A 5LXXA 2CEQA 2CBIA 4FS9A 3T0AA 3SCUA 4DPQA 5C9ZA 3OVRA 4AISA 5ABTA 2P3ZA 1K6WA 1JUBA 3SSZA 2O9RA 3U2CA 1XG4A 3LPFA 1DXEA 3LEPA 4HN4A 1JR1A 2HS8A 3GG8A 5EY5A 1W6TA 3LN3A 3UGVA 1GOIA 2O0TA 3G3DA 3KW3A 3MJYA 1UUMA 3ARVA 3D0CA 1XLCA 3ZWSA 3CV7A 4XSMA 4WY0A 1RY0A 4L5ZA 5BYWA 1ISWA 3MPGA 4J3WA 1SFTA 1OB0A 2YXXA 3VD4A 3H23A 4E3TA 2YZRA 3OZMA 4OUIA 2TPSA 3MU7A 4EWJA 3LDVA 4S3CA 4YVVA 5FF3A 2VZSA 2Y62A 3M0LA 4XX6A 1QNPA 1EGZA 4RE3A 1K70A 3BQ5A 5J5RA 4LW7A 3IPWA 4UTWA 4YVPA 1XL9A 1UD6A 4A8NA 1JGMA 4PL1A 3GNNA 4I9AA 4ZOAA 4F66A 3HF3A 4XKMA 4W8LA 2WWCA 4KCWA 2CERA 1L2UA 3LBOA 1VJSA 5FAJA 5FJRA 3POHA 3GDKA 4KQNA 2HXTA 1TSIA 3OIXA 2XIIA 4KF1A 3KUMA 1A3WA 3NR0A 4JIHA 1W9XA 5GNXA 3ITLA 1CLVA 1X38A 1IEQA 2AAMA 4WGHA 3TV8A 4R88A 4NL1A 1RUSA 1UC4A 1E4MM 4C6FA 2C16A 4JYEA 1W1YA 2QLYA 1GWJA 2AGKA 1DXFA 4JTJA 3H70A 1L8PA 3GHTA 1K9EA 2W67A 2HK1A 1O95A 5D2TA 1MUWA 1YDNA 3TH6A 4LWWA 2GQ3A 1VFFA 4E2DA 1PO9A 5JBEA 3GDMA 1EIXA 3TTQA 4O10A 3VDAA 5BW6A 2GQ9A 3MQTA 1J0HA 4JFVA 2XHYA 3PZ9A 3VXGA 5C9UA 3GC4A 1S5NA 4AY7A 2OLSA 4LVDA 1VEPA 3SY1A 1NFBA 3DI1A 4D6JA 1JUKA 3K46A 1R9ZA 3WMCA 2Q6ZA 1X98A 4Z2IA 2GSJA 1W3LA 5CBBA 3LRKA 1WUFA 2GWGA 3LTYA 3FCPA 4PCPA 3HMCA 1YEYA 3EDJA 8RUCA 2WVUA 4ZCWA 2YA1A 1M1BA 1FWWA 2GGHA 2EJAA 4JN8A 2DIKA 3OYXA 3TE9A 1VHNA 4FF7A 1X97A 3HBLA 2FZMA 2D22A 2VZVA 3CPRA 2BGQA 2PLJA 3UP8A 1BWVA 2VP8A 2PDMA 1JYXA 3EWDA 3OLIA 1AK5A 1HIZA 2E6AA 1GOMA 1EBGA 3LHZA 4XQ6A 1ZPTA 2WMIA 2BY3A 3TTSA 5BXPA 2CKRA 6REQA 3K8KA 3B8SA 3Q2DA 2I56A 3TN6A 4ACZB 3LERA 5HNRA 1PTGA 4Q8OA 4LY4A 4L9YA 2YA2A 1TMQA 2Y63A 1KGUA 4HA1A 3M0YA 3UWZA 3UETA 3CK5A 3WLKX 2V3EA 1AW5A 5HAOA 3V1HA 1E6SM 2WZEA 1OWQA 4JTHA 2YA0A 2QJGA 3V36A 5D9NA 3C3NA 1XP3A 4K8GA 1AH0A 1YXYA 3RCYA 3ARWA 1XD1A 1KBIA 1TV3A 5AHLA 3LCHA 3SO7A 1EJSC 4MAVA 4B90A 2WXDM 3ZFHA 2GOUA 4E2BA 1XC4A 3KBWA 3NQ8A 1LG2A 4ZGYA 1W17A 4O0KA 3DHUA 1XRVA 5HWJA 4I5XA 4CU7A 4D1IA 2EAWA 3TLLA 1F6PA 4AHOA 3T09A 2HS6A 2R6OA 1FHLA 3N4EA 3N2OA 2HNEA 3CMJA 4QE5A 5AC4A 2PEVA 4FMVA 1ZP4A 1NQ6A 4ICCX 1GOXA 5FF4A 4QQUA 2YCIX 1WKEA 3SY8A 5BWAA 1O7AA 1GPWA 4I6VA 3R5EA 2A7PA 1FY6A 4U5IA 1CLXA 2YL8A 2XFWA 2ZZ3A 1ADSA 5T9BG 3R25A 3QPEA 2I1OA 2JIWA 3T6CA 3SGGA 2VZUA 2J47A 3P93A 4LYPA 1OD0A 2PS2A 1Q3NA 1YIXA 1DJZA 5ABHA 5CSSA 3D46A 4DNHA 3R0UA 3W71A 3N6HA 1IT7A 2C0AA 5A5WA 1GNXA 1TQXA 3AMDA 3OYZA 4BWLA 5KINA 2A5HA 3KEHA 3B4UA 3ZR4A 2IKHA 1MMFA 3CWHA 4DPPA 1V0MA 1XCFA 1A0EA 3WQFA 2V5BA 3NQAA 2BS9A 4KRZA 3TU9A 1WQ5A 4J3UA 4JTLA 4AQLA 4NZ3A 1H49A 2YBTA 1F5ZA 1PTAA 2YL5A 3F4VA 3OW1A 4OGZA 4X9SA 1ZP3A 1NWTA 1XLJA 2OEMA 2OG9A 3S2NA 2WSQA 2Q09A 3NYZA 5CZSA 1OCBA 1XG3A 3EKLA 3I3EA 2J7FA 3QTPA 3AHXA 1KWGA 3PZUA 2VNCA 3E96A 3U0HA 2WZHA 2VGGA 1ESWA 1M7OA 2X42A 3VAVA 2YLLA 3ONBA 3GXMA 3OG3A 8CGTA 1V6VA 2GVLA 3T2QA 4JKLA 3ARSA 3F5KA 1VLWA 3NDOA 4RL3A 3T1GA 3BLLA 5LIWX 4BEUA 3F7JA 4LS0A 5CXPA 4GUJA 4I9MA 1FP9A 3URAA 4F0HA 5J04A 5EMKA 1VFLA 1M01A 1SO4A 4JR5A 4E2OA 3NOEA 1LTDA 1TTPA 1L6GA 1UUQA 3VM7A 1GQJA 4JBRA 5FEXA 4ZQPA 4BI7A 4BJHA 4GI9A 3FFSA 4M29A 1DYSA 2NQLA 5KEZA 4RUBA 5I3HA 2BOGX 3R7MA 1VCGA 3KVJA 4CN4A 3RFAA 2CPUA 4YHGA 4NJHA 3CUFA 2E1DA 5DBUA 3ITGA 1SM9A 1POJA 3R10A 5LIXX 1KW1A 4IZGA 2FZ9A 4YVXA 3ARXA 3WQ5A 1E5JA 3A6OA 3K5XA 1R3SA 2GVGA 4MY8A 5MKGB 1R86A 1BVWA 3MUXA 4XWUA 1PX3A 4AWEA 3CH0A 3GVQA 4LOCA 3MA8A 3NL5A 3VABA 2VFDA 4UTHA 4G56A 1QTWA 1PIIA 4HHLA 1FTXA 2C3ZA 3WD4A 4CCEA 2B7QA 1KFWA 4FO4A 1UOZA 3NGFA 3UCQA 4GKTA 3PPFA 2FFIA 1U1HA 1CYGA 3GK0A 3GBDA 4RR4A 3GS6A 1R5YA 2IW0A 1L6WA 2BVYA 2QCMA 2PA6A 3WD2A 4UFLA 4C5ZA 4M7TA 3ZLFA 3N9KA 3KX6A 3R4IA 3GX9A 2ADAA 1C8QA 3ARZA 3MI2A 2QCGA 1UQZA 4XZIA 2IQDA 1XLLA 2Q02A 3O63A 3QV6A 1XRSA 3ABQA 3D5HA 4AEOA 8TIMA 1VLIA 3CHDA 4DLFA 3OB8A 1QOQA 1Q6DA 1TPUA 4HYRA 1IT8A 3UJEA 4YTRA 3J7HA 4HMEA 1H7RA 5C2CA 2J8GA 1TQJA 3S6OA 2XIJA 5DXXA 1I75A 1BGGA 1GORA 1GTHA 1XFCA 4HTYA 3L4ZA 2PTYA 1W3JA 4PSRA 2PGRA 2C8NA 4WY0F 2WMHA 4ZA0A 2WQDA 1VQTA 1XIDA 1HVXA 2PAJA 2X41A 2J78A 3A64A 4BY3A 3NQBA 2PODA 4HNVA 3OP2A 3SN0A 3RITA 3IJIA 5AB3A 4LNYA 1Z6KA 4FHAA 2PLMA 4W84A 4DJFD 4JGDA 1XW8A 1TWDA 3W85A 2PE4A 3LGGA 2OKTA 2Z6JA 2WHMA 5FESA 4C6DA 5FEZA 2WNQA 4XD6A 1OC6A 4MLJA 4GXPA 3UY7A 4KCUA 3O9NA 4ACZA 1QFEA 2PC4A 1E6RA 8XIMA 1U83A 1FWJC 4GRSA 4NY2A 1R85A 3C0QA 1H61A 1BSLA 1EYEA 3VIIA 3T0DA 4TTGA 1MXGA 2WSYA 1XXXA 4Q8QA 3KS6A 3MZNA 4Q7NA 4KERA 5HBFA 4URIA 3TSBA 4C6EA 1DIDA 4HZ8A 4EANA 3QKEA 3THQA 4A2RA 1Y65A 4NJJA 4UR8A 5EFFA 2UWFA 3M41A 3T0CA 3NM1A 2WMGA 4PEKA 3EOUA 1B2YA 3EYPA 3VKDA 4IL0A 2ZZ2A 4FLOA 3L21A 3EPNA 3LPOA 3T07A 3V5CA 1JVNA 4W85A 1M5WA 5ABGA 1AH4A 2GGGA 5I7GA 2XINA 1VCFA 4S3DA 4CD5A 3MKVA 2FH6A 1G9HA 2OPJA 3FW6A 3M7SA 3WJSA 3EPMA 3WFAA 3C4UA 1P5BA 1EQCA 1TE1A 3VIFA 1CPUA 3TEVA 1QUMA 1DJNA 3DYOA 1LZOA 3CEPA 3OJGA 1PX4A 1G67A 1GG0A 2XTKA 2ZRVA 3IS4A 3PG9A 1KCKA 5K7JA 1X8CA 4HPHA 1MNSA 3EDFA 1NDWA 4JZ5A 5BRQA 4PL2A 3EA1A 4GQ0A 5LIYX 1UQYA 2VM8A 3CZJA 3BLIA 1OHLA 3MKKA 3IVTA 1YYAA 2P1FA 4QEEA 4ZOBA 3ZVIA 3OTRA 4KPLA 2XVNA 2OZTA 4S3JA 1AA1B 4PYSA 4R27A 4PH6A 4RJEA 4WK9A 3BGGA 5A2BA 4YJ5A 1CXIA 3S42A 4AUBA 2VR2A 3F2BA 3VOIA 1VD6A 1TJ2A 4ATLA 3DGRA 1DWJM 4A2SA 7TIMA 2VX7A 4B2DA 3OGSA 5HMFA 3LLXA 1IIHA 3CBWA 4QSHA 1YPIA 2DZBA 1DWIM 2OYMA 3LU2A 3KWSA 4H9XA 1TRDA 2IPJA 7REQB 4Q7IA 4PFMA 3H22A 1GEHA 3MW7A 4LVBA 3SIZA 1QMLA 4DNMA 1CXEA 5TBOA 3WL0A 3BZJA 3SR7A 1QOXA 3A12A 3S2JA 2CC0A 3DYPA 5DLCA 4DBDA 1WB0A 3UJSA 1V3JA 4CD8A 2XSXA 1UR9A 5BXRA 1JZ6A 1US2A 2ISSA 1WZAA 3WDJA 1POKA 1RP9A 4JS3A 1YDVA 3B9AA 3CGTA 3NUKA 3TYUA 3E12A 4ROQA 3G77A 1JCJA 3RPDA 5C2GA 2JEQA 2VX5A 1VIZA 1TWIA 3FEMA 5LGZA 2QAPA 4TXEA 3UXLA 1R8LA 4Y90A 3S9ZA 2PDQA 3CHVA 2ALRA 2DDXA 2FKPA 2CXEA 4HIBA 4GXWA 2GPTA 3T4WA 5CZJA 4GJIA 3IGHX 3THAA 3F2DA 3LTSA 2NW0A 4ADTA 4NYYA 2Z27A 1B5TA 5E5CA 4RLIA 4B15A 4K7VA 4H8VA 3QHMA 3RMJA 3URNA 4Z2KA 2GGJA 3WH9A 3W72A 5A6JA 3S8HA 3UWWA 1XI3A 3B0PA 5MKGA 4LYRA 3BV7A 4KIEA 2E5DA 1Q5MA 1W31A 1K4HA 3W23A 1G5AA 4O17A 4JIEA 3TA9A 2Y0FA 1EOMA 4KIRA 5IRPA 1KV8A 5IBXA 2Z1KA 3N34A 3G1FA 2WWDA 5CSRA 5E9XA 4A3RA 4GIRA 4TV5A 2OZ0A 3QSTA 3L0GA 3NZRA 1S46A 3WBEA 2IQ0A 4AD3A 5HWNA 3AXMA 4CQCA 1SU5A 2Z6IA 4AXNA 3NNTA 4W7UA 1EEPA 1T41A 2B0MA 1GONA 4RW5A 4MPKA 3IV8A 3NZGA 3MUY1 4QEHA 3WQWA 1QHOA 3QTGA 2DP3A 4CCCA 1DJGA 2IXVA 2VT0A 3USZA 3ITVA 3RXZA 4L80A 2ZZ4A 3A3HA 5LNWA 3OQEA 3BARA 1P43A 5LYRA 2VRQA 5DEZA 4BQ5A 3R79A 4F0RA 4H01A 1VS1A 5KZMA 3WDIA 4DWDA 3A3XA 5BXSA 4XD4A 9CGTA 5FAGA 4EP8C 1QR7A 4EE9A 1WKFA 5U7SA 3G0XA 1TX2A 3ERPA 2A6LA 3AO0A 2PDPA 1JF6A 1TJ1A 2PTWA 5CSYA 1O5XA 3G8RA 5D2XA 2W62A 3ZWTA 1VRXA 2ZUUA 4E38A 2NUYA 3AIWA 5I3JA 3WKZA 4KEMA 1PTDA 4PMNA 1A4LA 4JHMA 4CCZA 3LPPA 5CPNA 1IXNA 3KL3A 2WC7A 1QI5A 3NG3A 4F0SA 2DVXA 2WNZA 1Q6QA 2XIMA 3HPSA 4GO9A 1E0UA 3T55A 2DT2A 3NEVA 2DH3A 2OZ8A 3UF9A 5EBAA 1GUVA 1YX1A 2XVKA 4CEXC 1F3XA 3EWYA 4TIMA 5FEWA 1KBLA 7PTDA 1KRMA 2BZNA 5I00A 1BEUA 2VFHA 2HQAA 5I79A 3PWGA 2GDVA 3WEMA 1VBUA 3SCRA 1OC7A 1WE5A 2EHHA 3ABRA 1V3LA 3FN9A 2VEGA 1XFBA 2TAAA 1EBHA 3N17A 3GNOA 3TMQA 3TFCA 2FDSA 5DELA 1E43A 2Y4SA 3C2FA 1JPHA 1BG9A 3CQIA 3R1ZA 1XYLA 2J4GA 3UR7A 3I7QA 4O11A 4AWUA 4HGXA 5A1AA 5FA5A 2ODOA 4JKMA 4KGJA 4Z1YA 2Z1XA 4C6KA 4MWAC 2EGZA 3UR2A 1U5HA 4BA0A 3WK2A 1GOQA 4RNIA 2JQXA 1J5SA 1V7YA 4HSHA 2W5FA 5A3HA 4QAIA 1X1NA 5BU9A 2V6AA 5KTLA 4JDBA 1K9FA 1KA9F 2V68A 3DKLA 1OFPA 2P76A 3S3GA 4PE8A 2ISWA 3N04A 4AHPA 4I7UA 5JQ9A 3PZOA 4MKVA 1TZ9A 4FX8A 4EVZA 2J74A 4DAFA 4V1XA 3GAYA 2BHUA 4XB3A 4C6MA 4WDWA 1PDYA 3RO8A 1UKSA 1VKFA 4UFIA 3HGRA 3GUGA 4IFRA 3VKBA 1XLMA 4WDTA 2NVAA 2VCAA 2ZVIA 2QJIA 3HPZA 3QQ1A 1JF5A 4RZBA 1UBPC 4Z17A 1VFTA 4AZ7A 5D2WA 3NJ3A 3GLCA 4DX3A 3IANA 4RPQA 1S2VA 2W27A 5JVLA 2IKIA 4GJ1A 1RR2A 1F6YA 4EWND 3KVLA 3TTEA 1R3QA 1DTNA 4I5RA 3DGBA 4JPGA 1ONRA 3TSDA 1WV2A 2RKXA 4GYPA 4HNLA 4ZVJA 7REQA 3GR7A 2FGZA 1TV8A 1QW8A 4MKSA 4UWMA 2RJGA 1A5NC 3Q45A 3RX4A 1FH9A 3WJYA 1TPWA 2Z2BA 1GTEA 1XIIA 4UCGA 5HQLA 3BMXA 1JCNA 1CGUA 3ZZ1A 3C8NA 2FVKA 3UWQA 5TIMA 3VDGA 2J7EA 4OV4A 2PDJA 4NASA 4B5UA 4JNYA 5I0DA 3PPCA 5LIKX 1N8WA 4AXKA 1GEQA 1AW1A 2V67A 4IP7A 4AAJA 5LNRA 4IQJA 2PRMA 3K4DA 4P2VA 1C9WA 3H54A 2J7CA 3NQCA 2BVDA 3VCCA 5A6MA 2V63A 5I3KA 3T05A 3P5YA 1NOWA 1YNYA 3FEQA 2ZA2A 3UA3A 3BSHA 1DE6A 2V9DA 2WO5A 5A6AA 1SR9A 4F2TA 1Q6FA 1SZEA 2DORA 3RLHA 4QFUA 1R47A 3CQ0A 1KFEA 2HCVA 3PULA 1EX5A 3D3AA 4ZE4A 4D72A 2V2CA 5D2VA 1LG1A 3HJEA 3IIVA 3VA8A 1N8FA 3CV1A 4J3VA 4MNJA 3I4EA 4CQDA 4DJDD 1THFD 4ERGA 3BDKA 5I6SA 2DQXA 4HP5A 1Q65A 3CZ8A 3PHAA 5D8ZA 2G4JA 4Z0SA 2XM1A 2ATSA 4H9MA 3JZUA 1W3IA 5IOBA 3ENLA 5TQLA 4IMAA 3BLFA 3GU1A 1BXNA 4DEFA 3CUGA 1HTIA 4NYUA 1HO4A 2WYSA 4UQEA 1SZFA 1OZMA 4JQ2A 2UY4A 3W6LA 3FX4A 2IXUA 3WQVA 4QP0A 1LLWA 4QAWA 3R11A 2F6XA 3U4FA 4YYCA 5IDZA 1R2SA 1VH7A 2NSOA 4JQAA 3UEQA 1OYBA 3D47A 3IIZA 1VFHA 2V5LA 1MO0A 2UY2A 1AMYA 3W00A 4AVFA 3CLWA 3KLLA 1GVSA 3GDRA 2IMRA 4XSLA 4CNOA 3E5BA 1XLBA 4B9YA 1C7SA 1E9LA 3BLKA 3WJZA 2F84A 4F2BA 3WH6A 3W28A 6TIMA 2VOTA 4MHBA 2O7SA 2W66A 3DFSA 1NWUA 2ZUSA 2YDQA 1TPVA 3M07A 1LT8A 1NARA 1Q4NX 3TYAA 1BF2A 3KRSA 1XUUA 3VC6A 4PMOA 1BTMA 4EF9A 4XUYA 2F38A 3MP4A 4I90A 3RK8A 4A8IA 3AXIA 4CNTA 2QVHA 5HR7A 4Q22A 4XAYA 5AC5A 3EA2A 1FWIC 2G5WA 3AMGA 4O1BA 3RPTA 2NX3A 3CWNA 2OEJA 4MB5A 4L6DA 2OB3A 1EWDA 3EKGA 1G69A 1U33A 1Q6GA 4KCTA 4M6PA 3WLJA 3N3TA 2A3LA 4KWOA 4GQQA 3PTQA 1HXJA 3IARA 1WA3A 3WNNA 2Y5JA 1XR2A 4IWWA 5IFPA 1JRBA 4JIPA 3VINA 4O1AA 4LEQA 1JQVA 4DF1A 4XAPA 1UG6A 4K8EA 4I8YA 4AYGA 2W91A 3RM8A 4NJKA 3W01A 3UNTA 1FWBC 2JGYA 3T2PA 3RM4A 3NDZA 3HO8A 3EMZA 4B4HA 1Z48A 4F0LA 2X30A 2VURA 1IWAA 4LXFA 5F4XA 4LC8A 2DT3A 5AHFA 2UBPC 3W82A 5E70A 4U31A 3A23A 2OOGA 4Q3MA 2O9TA 2IPFA 4GY7A 1REQA 3K4AA 2FH8A 2BBFA 4XTIA 5E6ZA 3U8GA 4YYFA 4YXGA 5F2IA 1KWKA 1XH2A 3S47A 3CUHA 1S39A 2BNJA 2JKPA 4D71A 1KR0A 3FSTA 2WHLA 3H55A 4IICA 3KTXA 4YTUA 2IQTA 1SPQA 3AS3A 1LQAA 3AROA 3WBAA 5C0QA 4DYEA 1W3KA 5BOFA 1H5YA 1BD0A 4QS6A 3WNPA 2NV2A 3TN5A 3DHPA 4PMZA 4ZXOA 5I03A 3DAQA 3W1AA 2ZCGA 1JFHA 3VVGA 3AHZA 4C6IA 3QY8A 4Q32A 5DCBA 3R8HA 2A79A 3C3UA 4GABA 1VYPX 3SN1A 4O1CA 3G3MA 5FJTA 4O4WA 5LZLA 3MVIA 2ZQ0A 4IX2A 3WLRA 3CO4A 3STCA 1HFBA 1OC5A 3NQFA 1W54A 4WKAA 3ARPA 5B7ZA 2E9BA 1SW7A 5XIMA 1EF3A 2HISA 2WW5A 4MG4A 3WLMA 3E2RA 2DZWA 2G3JA 3P61A 3DG7A 3NSMA 3KVKA 4Y9MA 1TCDA 1BVZA 1E4NA 3R0KA 2G4FA 3XINA 3FJ6A 1EJWC 1E40A 5HNUA 4AIOA 3WJWA 1NELA 2AOSA 2VC5A 3MSDA 4K36A 3PNUA 2FIQA 2V3DA 8A3HA 4JNMA 3U4AA 4FIRA 1PDZA 5AHMA 1KGWA 4JTFA 3CV6A 1KV5A 4R7JA 3SCWA 1UD3A 1TYGA 4WLCA 4W7WA 3G1DA 4IUGA 3PR2A 1CXFA 4N0RA 5TD4A 4AIEA 5HUPA 1BXBA 1IE7C 1D9EA 3L4WA 1SJBA 1R46A 3DFTA 3N4FA 1JYNA 3O6AA 5HA7A 3W6YA 1CNVA 1QWKA 4FLSA 1UH4A 4EPKA 3GRIA 3EA3A 4DO7A 1B4EA 2G3NA 1H50A 1UP3A 2QULA 4LT9A 2RDXA 4UFJA 1B3WA 5DF0A 4HCDA 3FJNA 3FSUA 1V93A 1IR2A 4K6AA 1EO5A 4K2SA 3SIMA 2Y7GA 1I1WA 5L9FA 1ALDA 1KM1A 2X05A 4MUPA 2GK1B 1R0MA 4TVCA 1XRTA 4ZO7A 5C9RA 4Q7BA 3LHTA 1XDMA 4B5WA 3CMFA 1J0YA 1M41A 1WPCA 3HOJA 4GVFA 3M16A 2QYGA 3KM8A 1LF1A 3LM3A 4B5TA 4XKYB 1J2WA 3RU6A 3A24A 2ASHA 2BWGA 2FB3A 1R3TA 3E38A 1D8CA 4ENLA 4NI3A 3O6YX 1XIMA 4LUSB 2PPGA 3HURA 3LXCA 1OBAA 3THUA 2CLKA 3LXBA 4GQGA 2QGHA 2HXUA 3QR0A 4GPNA 1G4EA 4ZEPA 5BNKA 5CJ5A 3ZYZA 4JTCA 2ZX6A 4UQ9A 4CNNA 4AH7A 3IAQA 1UKQA 5EMYA 4IPLA 1BFNA 3JZEA 3GNPA 1GYLA 3RGTA 1WDDA 1R7AA 4D6CA 5I3GA 5HMSA 1FDYA 2D24A 1Q2SA 1L9WA 4MY1A 2ZZ1A 3BICA 4P8WA 1LP6A 1Q6OA 1ZNNA 1W5QA 3AXXA 3VUSA 3WK1A 3RLGA 3RYSA 1EC7A 2E6DA 3ARYA 3LX9A 3ZT7A 5HR6A 1UCWA 2XWEA 3F4CA 4YWIA 4ALDA 2NX1A 3S1WA 3W0KA 1BKSA 3EXTA 5C6MA 4WR3A 1OGBA 1XX1A 1UZ4A 2YX0A 1RQBA 3QZ6A 3BVJA 1MI3A 4US6A 1SJDA 1OCQA 2EO7A 3EOLA 1S5TA 2E68A 3PNZA 5TNVA 2WZMA 1GJPA 3L66A 4JTIA 3WN6A 3MZ2A 3KTCA 1E5NA 4YWSA 3VO0A 2AAAA 1VPYA 2PU1A 3MSRA 3LD5A 4L4PA 3N6QA 4DELA 1E6ZA 3W37A 3RUBL 1TVLA 1ZRQA 1UWUA 6XIMA 1OF8A 2ZRYA 5M2FX 1SYTA 4AZBA 1DVJA 3N9SA 2W0UA 3CT7A 1EH9A 3NURA 4UQAA 1H2JA 1P0DA 4N7QA 1VHCA 1QNRA 2UY3A 3H24A 3O6DA 4ZE5A 5CH9A 4ZMGA 1R3VA 4AMAA 4OU1A 5CSUA 3R6IA 2G97A 4Y9OA 3T8LA 2OCZA 1HL8A 4WSHA 5I06A 3SCNA 3WLOA 4O1DA 3NAVA 1EO7A 4A22A 3PP7A 1PKLA 1Q6EA 4D8LA 2Z26A 4NAFB 3G8EA 4RDWA 4WKHA 1AQFA 3OPSA 2XFYA 3CL8A 3HGOA 1ITQA 4CN6A 3GG7A 1GJWA 2FLIA 3V75A 1W9BM 4Q6XA 4PB3A 2R9RA 2NXHA 2E6YA 4N9BA 3MYPA 3O05A 4NVTA 2X40A 1QPKA 1SUXA 2Z00A 4CUCA 1XSJA 3MWAA 1KLZA 1VFSA 4YPJA 2AL1A 2NZLA 2XZ9A 3TJIA 4HSNA 4RNFA 2Y7FA 1PYFA 2F61A 4H8UA 4DZAA 3AS1A 3CS2A 1JRCA 5I3FA 3B9NA 4ORIA 1XYZA 3VC5A 5I02A 1GQLA 3DXIA 1J11A 4LVAA 4XBJA 1KXTA 3L4XA 3W53A 4OQVA 4XAFA 1V51A 4FNTA 3LXAA 3QGVA 2FTYA 4IGNA 5F1UA 1CBGA 4UQDA 2ZX9A 1K8XA 2HE8A 4HT3A 2ZUVA 5C9WA 3N6JA 2QCLA 7A3HA 1DWFM 5JU6A 3V1PA 4XAZA 1WOBA 3E3HA 3LM7A 4S23A 3T0BA 4JTUA 1TKKA 3EB2A 3S5OA 5AVHA 3LENA 4Z0JA 3TQPA 3F1QA 4S3EA 4ZBCA 3W22A 4X0NA 1VZWA 1B3ZA 5EFDA 3T40A 1KNWA 2YKKA 3VUPA 1RXOB 3WDQA 4BCEA 1D3CA 4QLJA 4RPPA 1R2TA 2GVJA 4Q4RA 2E6FA 5CPMA 5D02A 5EA9A 3WDRA 2ISFA 5K9XA 4H4IA 3EX6A 3TAOA 4PN2A 4TMBA 4QG9A 4S3AA 4B91A 2D69A 1Y5VA 3WSUA 2CLFA 4NNAA 3T78A 1ZJHA 2CWXA 2OT1A 4HPGA 2NV9A 4MOZA 5DT7A 1TWSA 3L2LA 3IJLA 5AKQA 1XLHA 4QDWA 1E0VA 1F3EA 1QNVA 2O7QA 4IP5A 5BCAA 3QLDA 3SRKA 4AMCA 5RUBA 2D3LA 5A6LA 4IJBA 1SJCA 3AJXA 3HPFA 2PFHA 4HA0A 4FXSA 3KOWA 5D2YA 4LGXA 3ITXA 4GYJA 1XBYA 3WLLA 4GVIA 3VIJA 2HROA 1I1XA 3C2VA 1UP2A 7ENLA 4HK7A 1BKHA 1QXLA 3K2GA 1DL3A 3QV7A 3CWOX 4MWAD 4O4VA 1FDZA 3GFZA 3SW6A 5C8BB 3ATZA 2P0IA 2IS7A 2J9YA 4GWEA 3N19B 3ABZA 4RNHA 4KWUA 4MKNA 4FIQA 2VUNA 3N2TA 3BAYA 2FHFA 3ISIX 4M8UA 3CAWA 4W4QA 1KTBA 3W1MA 4K7YA 4GNKB 4ZSUA 4XZNX 2PC8A 4XZWA 4EOUA 1PSCA 3WMLA 3DN5A 3P0XA 3F03K 3RILA 5PTDA 2Y8VA 1EEXA 1AUSL 3EB4A 3A22A 2IPGA 3AMCA 3UVIA 4AZCB 3BJTA 6PTDA 5BWFA 2GK1A 1KFJA 2BX7A 4EXBA 3TAKA 4E4PA 1E6XM 5HULA 3LYEA 1OK6A 4QM1A 3QYSA 1S2UA 4JTSA 2YLAA 1A3XA 3F5JA 4FAMA 4XZHA 4XKYA 2A3EA 4GCXA 2Y85A 4RV3A 4JTQA 3GVWA 2P3EA 2WAGA 4EF8A 4LUSA 1TTIA 3CL7A 1E1CB 3BG3A 3C52A 2DY3A 5M03A 2PF8A 4IPIA 2E9MA 4HA4A 1YW1A 1HGWA 2FPYA 1SVDA 2A1YA 1KBBA 2EKGA 3COTA 4DM1A 1BAGA 3VNZA 3WQDA 2VZTA 4HHMA 1UKTA 1O5QA 1PE1A 4N9CA 2QCEA 2ZFAA 4MIMA 3UPWA 1TB3A 5AYBA 2E8YA 3W1XA 5CPOA 1J12A 4P7LA 4FSAA 1FOBA 3FAWA 2VEKA 1KD0A 2PGWA 3DENA 3TWBA 2PMQA 3U9IA 2DSZA 3NO5A 4HA3A 1I8JA 2MANA 2ZX5A 2ZXDA 2GSHA 1FWGC 4HZ6A 4NX5A 1OGSA 1TCMA 3O15A 1YPXA 4MDPA 4QE4A 4F9DA 2DSUA 3A4WA 2REQA 2FVMA 3DFQA 4PCNA 1KXVA 1VAHA 2XM2A 3WG6A 4EIVA 1XKYA 5EBUA 5IFTA 3B0XA 4A6GA 1RPXA 5CC6A 1K7XA 3CZLA 1DWAM 2JF6A 4CU6A 4JY9A 3G1HA 4E6MA 4XV0A 4JTDA 3FKKA 4PTMA 4MNKA 1US0A 3BAXA 5FF2A 2AQWA 2JK2A 2B4GA 3VGBA 4K8HA 3RHGA 1VB9A 2XN2A 4CD4A 1ZCCA 3S5YA 4JQ4A 3GUWA 2X0SA 3VMOA 3OZOA 4C6NA 5JBDA 1SJAA 5DY2A 3LNMA 3UERA 2ZKMX 1Z44A 1H1NA 1FXQA 2VC7A 2JF7A 4LS1A 1JAKA 1PXGA 3PTDA 4WEVX 4X0VA 1UW9A 1Q8JA 4NAFA 1ZU8A 2G95A 4O14A 1WDRA 1E9ZB 4PMQA 3IUDA 2HTMA 1KFBA 2QV5A 1NTHA 3FV9A 5E9AA 4AD1A 1L2QA 5E09A 1OG6A 2CLLA 3LOTA 3MI6A 1JD9A 4O0QA 1AJ2A 4D1JA 2GUUA 3G1SA 3O06A 3SCPA 5A6TC 3N2BA 2OWWA 4IPJA 3P2VA 1TMHA 1UD4A 1X1OA 1HF6A 2C1GA 2GUBA 1KXHA 3VGFA 1Q85A 1XH0A 2Y61A 4OFCA 1ZENA 1WP6A 2J62A 5C71A 3W88A 4R7WA 1W8SA 5XINA 2WMKA 4HU0A 1U2YA 4FXRA 4C5YA 3U2ZA 4QJ3B 3VX0A 3O7UA 1ODUA 1BF6A 2BXZA 4PODA 1DORA 4L7ZA 4FLQA 2GJRA 4X63A 4IF2A 1VYRA 1XBXA 4GVHA 3H2AA 3TN3A 1ZBVA 3OA3A 2J8TA 1FRBA 1DTUA 1WDPA 4XZLX 3SFWA 3G6MA 2PDFA 4AZIA 1FCVA 2ZIDA 1CI1A 3QGAC 2IUZA 2DH2A 3I6EA 3N14A 1V4YA 2PWUA 3TFXA 2GOKA 3LQLA 1J18A 2DIJA 3VGHA 3ZM8A 2YBVA 1JDAA 2RJHA 4N4QA 1UHVA 1JPIA 3KWXA 4QX4A 1DQXA 2PWGA 3AUOA 1H09A 3EEZA 1XLEA 2Z1VA 3KS5A 3CB3A 4UOZA 1C90A 1F73A 4IQDA 3VGDA 2ZTKA 2Z29A 4AD5A 2VDHA 3VOJA 1KFCA 1RJRA 1QNSA 2R8WA 3W7QA 2YSWA 2J88A 2OO6A 3OQ8A 4MADA 1DBTA 3MWCA 2X1TA 3GE7A 2ZZ7A 3OGRA 1DJIA 3M0XA 4Q6JA 2ATMA 5FIPA 4NRRA 4IG2A 1FKWA 1FHDA 3M4HA 4UQBA 4Q4KA 4JX5A 3U6WA 3MDWA 2X8RA 4GYKA 3BMVA 2VZOA 4H6RA 1OCNA 3UG8A 1I2OA 1A3HA 3Q58A 4M7SA 3UESA 3CHCA 4WF7A 4F4RA 1B3OA 2KX9A 3PZQA 3I7RA 1G94A 3ONCA 4J1OA 5IHRA 4XTDA 1UD8A 3SCQA 4MSSA 1W3NA 4EPDC 1XM3A 2NVDA 1P48A 2C79A 3SUVA 4DLMA 2OQYA 3ALGA 4JFUA 1Q7MA 4M82A 2ON3A 1UWAA 1RV8A 1H7OA 3OHMB 4HN8A 1UWTA 4AFYA 3KDOA 6XIAA 3S0CA 4C65A 1H60A 2XIBA 4PMRA 1JDDA 1A50A 4LBUA 4XVDA 3ANUA 2E3ZA 3CL6A 3WBWA 1FH8A 1H1ZA 2XDFA 4OV9A 2WKLA 1O1HA 1PVNA 4JQ3A 1H51A 3KXQA 4JHOA 1WUEA 1EX1A 1QRQA 2JGQA 1ZBKA 1Y8BA 1HP5A 1H3GA 3OZPA 4GYFA 3M0HA 4CQ8A 4Q4OA 4OWGA 3QF0A 2OLAA 3L5AA 1V3MA 2P50A 1JZ7A 4MM1A 4M0XA 4K37A 1RZMA 1V7AA 3STGA 4S3GA 3UG5A 5I24A 5D9MA 4HKPA 4N6EA 4CVWA 3IACA 4Z1CA 5H8PA 3W9ZA 3CM4A 2PF0A 3KBNA 4QSFA 1JZ3A 4U2ZA 3WQCA 1M03A 1TELA 4IUOA 1V8EA 4CGTA 4IT1A 1E1CA 1C93A 3IGXA 4Q8UA 3VFLA 3TONA 2WJFA 1F7BA 4EKJA 3LGDA 1CGXA 4F0MA 2BLEA 2JEPA 1BYAA 1QASA 1TE6A 1DIKA 1OABA 4DJEC 1E6PA 3NFUA 3M1ZA 2BDQA 1UP0A 4H6EA 2UY5A 3NIYA 1J01A 5KZDA 4MWAB 1I9CB 3LMZA 1MDLA 4MGGA 1OEPA 1TA3B 3RAOA 3W87A 1KTCA 2A2IA 2FMNA 4HCLA 3C0SA 1D3GA 3E0WA 2OSWA 3UR8A 1ZSXA 3B0UX 4QIUA 3B3DA 1E0XA 1JCYA 5D8WA 4MB1A 1YHTA 3QW3A 3GDBA 2CBJA 3POCA 5I77A 3BLOA 1FCUA 2GDUA 4PUKA 4QDMA 2EG7A 1I2PA 3KL0A 2H8ZA 2V5CA 3WENA 2BY0A 3UA4A 4TV6A 4O52A 3RM9A 3L2MA 1FWFC 1A5LC 2DEPA 3CAVA 2PTXA 1FDJA 3HG3A 4ML9A 3SQLA 3VKCA 1FCBA 3G1RA 4O19A 3FOKA 1TVPA 4TOQA 3WBXA 2CZDA 3AIBA 4C7FA 1WOAA 1WKYA 2Y5SA 1UH2A 1RHCA 2ZWYA 2RAGA 4LAKA 3EWBX 3WD1A 1PZ0A 3N25A 2GSEA 4PUJA 5IDIA 5LIUX 4PRWA 1M7JA 1FHVA 3G2GA 3R8GA 1VPXA 4QG8A 3EWUA 3ATYA 5DANA 1OJXA 1Q66A 4HNUA 5CZKA 2CLMA 2BGSA 1BYCA 3A9BA 4UR9A 2DPEA 3R12A 2AMGA 4JTRA 1IGSA 5EU9A 1C92A 3REQB 4U33A 3UFYA 3H12A 2DZAA 2VFIA 4M1RA 4ZTYA 4KRTA 3H2CA 4V2XA 1W0MA 3MY9A 3MI3A 3KVMA 1V6UA 2ZA1A 4IPPA 3DFHA 3H2OA 4HMNA 4U4MA 4K1GA 1HKKA 4BF9A 1ISVA 2Q3RA 2A21A 2VEMA 3LK6A 4AC7C 1Q45A 1B57A 2TMDA 3VZZA 3M6YA 4KFNA 4DWSC 3AU6A 3C6CA 4A35A 4B3LA 3DZ1A 1TVNA 4G9PA 3UYIA 3WQ8A 1LWHA 2WKJA 1S5MA 1UZDA 4QNEA 3PUOA 3WF1A 2BXVA 3OU8A 2ZRWA 3BCDA 1G6CA 4JTTA 1TV5A 3BXWA 5T26A 2Y7DA 1OF6A 3ITOA 5DX7A 3CO8A 4QJ4B 3WFZA 3DYMA 2CKSA 2H9AB 4GZIA 3UQNA 4UTIA 3VNDA 4EPBC 5DRIA 4WXZA 1AFSA 4GNVA 4M1BA 1CGTA 2P5NA 5H91A 2NWRA 3W38A 4QJ5B 5HQMA 4AVOA 4NJIA 4F0KA 2GFTA 4K39A 3LTPA 4ZR8A 2FGLA 1XIGA 1XD0A 1NH6A 5DMYA 5JXQA 2YBUA 1R38A 4ZQOA 4DRSA 2R94A 3DUGA 2WK2A 3DERA 1AODA 2NX9A 3NCOA 3ZJKA 1EA9C 1VEOA 4MYAA 4V33A 3UVAA 2HVNA 3RN6A 3PJWA 1E3ZA 1RY8A 1BTCA 1ZTVA 2GGEA 2A3CA 4XG1A 1OZQA 1H7XA 5MHBA 1CT5A 3CHEA 2OSXA 2NVCA 5KITA 4GISA 5D38A 4AEFA 4C7GA 2GLKA 4FEZA 5HATA 1TR1A 2J79A 3HA1A 4AF0B 2V5DA 5HNTA 3LLFA 4FX7A 1GVYA 3BLPX 1KFKA 2JIEA 5CEWA 4Y6GA 4JICA 5A8MA 3LQGA 4C6BA 1GK8A 3VZXA 1V08A 2X7VA 1U22A 3ABXA 3LCFA 3QSRA 3T7VA 1GOWA 5CQ1A 2W63A 1OFOA 4JTGA 1U5JA 2EG8A 3FK4A 4JTKA 1WBHA 1DHKA 4GQBA 4AZHA 5A95A 3P8IA 4LAOA 3P8JA 2R14A 4QS5A 5FSDC 1YE4A 3A13A 5LHEA 5C7VA 2HV5A 3TYBA 4M81A 2AQVA 2J27A 2Y5EA 1FKXA 2ZX8A 1UWRA 1TPEA 3IJ9A 4RK8A 1PUDA 2VGBA 3FVMA 5CJMA 1J10A 3TOPA 1T6MA 3VI2A 1BQGA 1UUOA 3GTXA 2Y89A 2AL2A 1GQKA 2PWVA 2DZUA 3WL1A 4H6KA 4Q4MA 4CEUC 4DZIA 2PP1A 3AICA 1XV8A 1CZ1A 2CLHA 1IR1A 2PURA 5EGRA 1IQ8A 3GY1A 2YPIA 4KT2A 1ADDA 2V5JA 4IIHA 2HPMA 3GXNA 3IJ7A 4GO8A 3H6OA 3PF3A 4OOUA 4M6UA 4XZ9A 1A47A 3NQGA 2HNHA 3UPMA 3IIXA 4AVNA 1VC4A 4PBGA 3URBA 1FX6A 4GIEA 4XZMX 2XG9A 4GH3A 3FIGA 3PVFA 1UR0A 2TRSA 3T81A 1RA5A 1MNZA 3MMUA 3IV3A 3RMEA 5MF5A 1XYBA 2WB5A 1QK0A 3P7YA 1KBJA 3PJUA 1X1ZA 1Z32X 3P5ZA 4U2YA 1BHGA 2G50A 4ORMA 4PRRA 3QZAA 5AZ0A 2ZX7A 4KBXA 1GQIA 3KFTA 3ID7A 1M68A 1XF0A 5K9CA 1JIBA 5FF0A 2VEPA 3GTIA 2XN0A 3NOYA 1KCZA 4QLKA 3NPXA 1FWCC 2VCBA 3PM6A 3LRMA 1E1EA 3O1NA 2J7BA 3BAJA 4PGLA 3C5QA 4TVUA 3D6NA 4MWAA 4UTLA 3S1XA 2A7RA 2E9LA 4AIUA 1TA3A 1ZBCA 5K3VA 4S2CA 4YS1A 4E8CA 4CVUA 4NZ5A 3TYDA 1ZALA 3NQ6A 5KMYA 3DFPA 3NXLA 1RK6A 3GIYA 2ZUTA 2L5HA 3SCTA 2X2YA 2OGJA 1YDYA 2PDNA 3I4KA 1TPDA 1KM5A 1F3TA 2NUWA 3AFBA 2MNRA 3ZIZA 1F07A 1HKMA 1Z9AA 3WD3A 2RDUA 3RPMA 3M5YA 5AHNA 2YW4A 3G1XA 3TC7A 2HMCA 4RE4A 1K4GA 1RBOB 3N12A 1GYNA 1QJWA 3BCFA 1YNPA 3G24A 3P82A 3HZ3A 1Q13A 4UNIA 5G1MA 5JMUA 4NT0A 1RQHA 2EJ1A 1LUCB 4H2CA 5EKYA 3HQPA 1E6NA 1OYCA 3LCXA 3MUIA 2QMKA 3QV9A 1HN1A 1UR8A 3BPWA 3QV8A 2BTMA 4MNLA 3VOFA 3MP5A 3VDCA 5KZ6A 2QUTA 4IMFA 5CBJA 3UZ5A 5G2HA 4L4OA 1GVEA 4JL2A 4H9ZA 3M0IA 3WZ0E 3GNRA 1WYIA 2WM0A 3QVQA 4JAWA 4HMCA 3UZXA 1KM4A 1XPYA 1YLVA 4AW7A 1NWRA 3REQA 1S38A 1JCXA 5BRPA 5CZ0A 4LY8A 4Q8NA 4DXXA 5FACA 4JEQA 1WKDA 1KC7A 5I5RA 1YNQA 4HB7A 4TVDA 4TX8A 4PUDA 4I3GA 1RBLA 1B30A 2CHOA 3C2YA 1H62A 3Q94A 4JN7A 2POTA 1FWDC 4ATWA 1TIWA 1LBMA 3ZQ9A 4UFHA 3VILA 5HDRA 1NOUA 3DFNA 1J93A 1WCGA 3LLDA 3C61A 2BOFX 2RDWA 2A7NA 3G1YA 1B4KA 3GG0A 3T9PA 4IH3A 4Y2WA 5AECA 3ALFA 3VKKA 3AALA 4N2YA 3HG5A 4IGHA 1CIUA 4AY1A 3WUBA 4KKXA 4L64A 4LBRA 4JTEA 4GD0A 3H26A 1HT6A 4JIIX 3FGCB 4I7VA 2AGTA 1HKWA 1UOKA 1W5NA 2H9AA 2QUNA 3KLKA 3W73A 3GXPA 3VIHA 1UR1A 5HQEA 1IEXA 1QHPA 4DYKA 3HMJG 1M53A 5GJPA 2OELA 3IUHA 1NQKA 5AY7A 2CBVA 4GLEA 2PCEA 3R43A 3AIVA 1GT8A 1LORA 3MVTA 4FI4A 1UBSA 4MYXA 3AZRA 1ZL1A 1XGEA 2FJUB 2NUXA 3H7UA 4GIAA 3AHVA 1DXIA 9XIAA 4RE2A 4R3UA 4ZO6A 1FWAC 1IXOA 3WIJA 4JD4A 3VE7A 3B04A 1KM0A 2D0GA 1LWJA 1QU4A 4Y8EA 3N15A 4B4FA 1TZ7A 5D9OA 1BXCA 3LS9A 1LT7A 3RIKA 3TYZA 1XDLA 3E6EA 4DXVA 1KCLA 4AF0A 3GG1A 2QDEA 3DBNA 3W7GA 2GVEA 2PDUA 3EWXA 5FJOA 1UKPA 1TV7A 3CPGA 4L6HA 1ZAHA 3OBAA 1QPOA 1ITCA 5DY3A 1T40A 1RK5A 3OODA 3W29A 1EFZA 4B5NA 3W76A 4KWWA 2VCCA 4UQCA 1FVPA 2ZE3A 5CKSA 4FNPA 3WUFA 1I6NA 3NSXA 4M24A 3AUJA 4L9ZA 1BSIA 4Y9PA 1FWRA 3W7PA 3M6DA 5REQB 3M5ZA 1ME8A 2J8FA 4JQ1A 5DMNA 4IISA 4C7DA 4UTUA 3B8TA 3M5VA 4PB5A 2VYOA 2NQJA 4UB9A 4W8BA 1F61A 4TTUA 3PZNA 3QFWA 4IIFA 1W37A 5BOEA 1V02A 1GVIA 1EC9A 1A5MC 4UMCA 1PZ2A 3PB2A 2QIWA 3TIMA 1PPIA 2A3AA 1GQNA 2EEXA 4IMCA 1LOSA 3V16A 4ML4A 3GR8A 3B9OA 4NP7A 4R7OA 4RZ4A 4NRSA 4Y9NA 1E1FA 2O4QA 4BQ3A 3UG4A 3F4NA 3CZGA 3G5EA 2QQ6A 4WSKA 4LVGA 2CBUA 3OEXA 1V79A 3GB6A 4MUZA 3ZOAA 4QG6A 3MBFA 5BROA 4JCLA 2QJHA 4FK9A 1WO2A 2V5KA 4UOQA 2OODA 4R33A 3B4YA 3TNBA 3A4XA 1NOFA 1EKOA 3VD9A 3EWZA 3U48A 1K1DA 3EWCA 3FNDA 1J0KA 2EQDA 3NXFA 4IFKB 1OD8A 4JNZA 1WBJA 3QEZA 2QMJA 3QH2A 3AQUA 4DO5A 1Z3NA 5LKYA 1XINA 3PY2A 2CESA 3RX2A 1HNYA 4A3UA 3BW3A 5AHIA 3PZMA 3BJFA 2E5CA 1EB3A 3UWYA 2X1UA 4HJWA 1BLIA 4Z2JA 3CJPA 3M0VA 1EQPA 3TYEA 4OVXA 1EJVC 1WDWA 2BODX 4JEJA 1H7PA 4EACA 5CG0A 3KHJA 2QCDB 4ZB2A 1XRFA 1RPKA 3O07A 4P7RA 3HJZA 1OFDA 1H41A 3W7LA 1M3UA 5A6KA 1EGVA 2D0HA 4HOXA 5FOOA 2HEJA 3RLVA 4PB4A 1JGIA 2ACQA 5C55A 4WJEA 3UJRA 2F6UA 1ECQA 1MEIA 4GXMA 6A3HA 1EPXA 2ANUA 1O68A 3MUAA 5IM51 1TFVA 3QC3A 1AQ0A 1RVGA 2O92A 4KFOA 4AWTA 4ADUA 3PTMA 4DJED 3SURA 3VKJA 2OQHA 4HJFA 1B9ZA 4H2HA 4PCTA 1CB2A 1JDCA 1NEYA 3UJFA 1P4CA 2J9XA 3TQKA 4FP1A 4QJ1A 1MDRA 4NILA 5G4HC 3EOSA 1LUCA 3UWUA 1ZCOA 3RRXA 3S1UA 1OX4B 3K30A 1XS2A 4Y8FA 4X60A 1F74A 3ZXWA 5HWMA 5CPLA 3VDHA 1JCMP 3VK5A 5BMXA 7TAAA 1K8YA 3P62A 3WQPA 1ZLPA 2PTDA 2J9ZA 5FKYA 4Z2HA 1ITXA 4FF5A 3CHFA 1QNQA 5HJYA 1YXDA 3DFYA 4GUIA 3W26A 2VC9A 2YCLB 4C6LA 3L5MA 5D4YA 3GIQA 1PZ3A 1OT1A 1K02A 1U1JA 4S1FA 1XGDA 4MTVA 1GW1A 2LLEA 4KWSA 4H7CA 3F4DA 5D30A 1OGGA 4DXKA 3GZAA 4TQTA 4GUFA 1VGAA 1IEVA 1B54A 4M19A 2R91A 1FBAA 5GJNA 2ISDA 4BK9A 4BR1A 4RE0A 4MVAA 3FVDA 1MW0A 2YIHA 4M5PA 2GDQA 2CZVA 1G4TA 4UTMA 3FS2A 2X7WA 4ZZ9A 3M7WA 2QJNA 1ZY9A 5G1TA 3KBJA 4J28A 3AMLA 3BOXA 2J13A 4ZODA 1E9YB 1XUZA 4Z42C 4O53A 5GQBA 3CQJA 1MUMA 3WLNA 3EPOA 3L23A 3WELA 1QPNA 3KCOA 3W1TA 3NPVA 3FJLA 2NLYA 1HZYA 1UPMB 1QPRA 4D6FA 3CUZA 2XN1A 3H2NA 3WNKA 3BG5A 1GCYA 4HNCA 2DW7A 2Q8LA 4H83A 2ZBTA 4DJFC 2A4AA 4DB7A 3BW2A 3R58A 1RA0A 3FGCA 2DW6A 3GFXA 3HN3A 3MO7A 7XIMA 1GVFA 1ICQA 3APGA 3W75A 2QPUA 5KSWA 1OSEA 1LYXA 1MYRA 1PHWA 1XJBA 1J0JA 2XVLA 1LQ2A 1XQLA 2V0TA 3LCWA 2QAFA 3U57A 4YTSA 1ITUA 2FTWA 3B0YA 4K38A 1R2RA 1IXPA 3GH4A 3IK2A 5HMEA 4ZSTA 4PSPA 1G01A 3BE7A 1MQPA 1J6PA 1J4EA 1HW6A 5GNYA 2VEFA 3ZT5A 1R3WA 1QPQA 3TOYA 2IPWA 1P0KA 1SO3A 1SO6A 3WF4A 1C8VA 3S6TA 3ZT6A 3W7KA 1ZGDA 3AZSA 3VOCA 2HBVA 5HUOA 1F6KA 4QR6A 5CCZA 3TTOA 3P74A 4AWSA 2RH9A 1JCTA 5CC5A 2P10A 4M56A 4J35A 8XIAA 3NPWA 4P7OA 3AWNA 4W5UA 3R2GA 2QPXA 3VNKA 3W3OA 4YU1A 1UKOA 3O2LA 4NF7A 2BG5A 3OHIA 4NI8A 2F8QA 1W3TA 3S83A 1UWIA 4X61A 3LZ3A 1XIFA 3SN4A 3W02A 1J9YA 4UMBA 4AX7A 3GXIA 2DZSA 4PA8A 1HJXA 5A6BA 2BVTA 3KP1A 3QPZA 2PLKA 3W7NA 2GZXA 7ODCA 3ZJ7A 3TQVA 5REQA 3CPUA 2D2GA 3LUTA 3WY1A 3MMTA 1IZCA 5CPTA 3RDKA 4FNRA 3QZEA 3M44A 3W1NA 4NNBA 1B9BA 3PFRA 3QFEA 3HG4A 2AKMA 3H7RA 3TK7A 1NY1A 3EX1A 3C2OA 3CTTA 1HKIA 1PCWA 2I17A 3PUGA 1XYMA 1ME9A 3CTLA 4S2BA 3UZZA 2RHGA 5LSMA 3CLMA 1DIEA 3L4VA 4B16A 1A5UA 1A4MA 1DJQA 4M3PA 1ZHAA 1KKRA 3W2KA 4ZB5A 4H3DA 4C6JA 2D2HA 4NJGA 2DJXA 3MCOA 4J3TA 3W1PA 2WCAA 3AXHA 4REQB 3S1VA 4V15A 1PHQA 2WOQA 1IIGA 1RAKA 2BV9A 3K8LA 4HK6A 1PYMA 3AIRA 3C2RA 1P0NA 3ZLGA 2OVLA 3S2CA 1V5XA 1WZKA 1YBQB 3MSGA 4LAZA 3HFTA 4NIRA 2QJJA 2I5IA 2BOEX 3MUZ1 2D23A 4OHQA 3INPA 3MUCA 2QDHA 1I60A 3NL6A 3R13A 3OBEA 3SB0A 4IFKA 3IK4A 2C1HA 2ONEA 1OT2A 1CLKA 2OYKA 1EP3A 2VI0A 3GXFA 4GH1A 3VD3A 5B80A 3N4AA 2H3BA 3TZNA 4O28A 3S2MA 3C0JA 4MB4A 1VP5A 3HG2A 4P7QA 5CG7A 1ZJAA 4OT7A 4Q8VA 4L9XA 2ZVRA 4PMVA 5DRCA 4PCFA 3LCIA 4PTXA 2V81A 3B9EA 3WLTA 4MMWA 1BG4A 3GNXA 3QRHA 4BI6A 2FJKA 3DEQA 2YL9A 4RDZA 3NL2A 2QCDA 3V0SA 4FR1A 3GO2A 4W89A 1DE5A 4GFSA 3HPAA 3UD6A 1QI4A 1RVKA 2WLZA 1XYFA 2FHBA 5FJIA 5E6YA 1ADOA 4GC3A 4BQ2A 1REQB 4JDYA 3CZEA 3VIMA 2HVMA 1JXKA 4R53A 3EEGA 3AHTA 2PZ0A 4ACYA 4G1KA 5I2UA 1CGYA 1MFUA 4AU0A 4FXJA 4V27A 2BASA 1XSIA 4QQ3A 1QAPA 1TUFA 5HNNA 2PDIA 3H2EA 1Z89A 1W9DM 4ONVA 3H4GA 4DY1A 2HPIA 4ECLA 1OIMA 2Q3OA 1AL7A 4DUWA 3WX7A 4LV4A 3FA5A 2UZ9A 3CIVA 2V2DA 3WH5A 3FHAA 3VNYA 3LHUA 1F8IA 1OX4A 4JXCA 1VBHA 3VNMA 1PKYA 5AYYA 5H2ZA 2O56A 2ACUA 2VR4A 1TO3A 3BL3A 1RJPA 4PUEA 3ZJ8A 2QF8A 1M6JA 3STPA 3MDUA 2YCLA 1J6OA 3NQ7A 3OOQA 4LB4A 4HOZA 1W5OA 4OBSA 1XHGA 3F5LA 1VFUA 2F9RA 6ALDA 4MPQA 4W5ZA 4XO6A 5GNZA 4D2JA 5EMJA 1UA3A 3W7MA 2GYIA 4HNOA 4E5TA 2PGFA 5M17A 1FQ0A 1MW1A 2ZA3A 1UJPA 3QR1A 3S4TA 3IRDA 2VXNA 3PFMA 3W7DA 3QPYA 2C19A 3P6LA 5G2WA 1T99A 1IEWA 1TWWA 1PIGA 3FLUA 3QW4B 3MMDA 1JI2A 3K1GA 4ATDA 4A21A 3QJAA 3GR4A 2ZXAA 3L7RA 3DI0A 2PDKA 4H41A 2B31A 3NGJA 5HK4A 5C5YA 1D3HA 4D9PA 4NSBA 2F7FA 3T44A 3GU9A 5I78A 4KMQA 2DUXA 4H7VA 3L2IA 3WLPA 5JUVA 3VNJA 4XAGA 2QUMA 1IF2A 2CYGA 2PU0A 4GY0A 4PMYA 3M0JA 4ZO9A 4N9EA 1OFEA 1OX6A 1Z8AA 1F05A 4Q4PA 2BP1A 2VTFA 4Z1AA 5DMMA 5CBIA 1YRRA 2EF9A 2QNEA 3LMYA 2G8ZA 3SECA 1EZ2A 1GZ1A 3OBKA 2VVNA 1A5AA 3GW3A 3W24A 3W86A 3IUIA 1V6TA 1JAEA 3R94A 2YXOA 4IXXA 1EJUC 1ISZA 2PWEA 2ZYFA 3V0TA 4FALA 2RFGA 2WZIA 3AIQA 3BV4A 2WHKA 3HFYA 5G4EA 3N73A 4MWAE 4I9TA 1O12A 4PCSA 1JNDA 3KOXA 2PWDA 1Z7AA 3BGJA 3DESA 3I68A 1Y5WA 3JW7A 1XLFA 4GIYA 1HKJA 4NG3A 5GPRA 4DF2A 3M47A 3VX1A 4GY1A 3WQOA 3N13A 2DUZA 5DT5A 1B3VA 2PI6A 4GMEA 5FD0A 4DHGA 1EYWA 3ABSA 1FUYA 5JH2A 1V6YA 1MQQA 4ZOCA 4L1XA 4EAMA 2YCKX 3O0FA 4CLMA 1XIBA 3PJXA 1VJZA 4G6CA 3LI1A 3EWWA 1JZ2A 4HU3A 1HVQA 1ODZA 3GZ3A 2QF7A 2EPKX 3PS7A 3W7HA 1BRLB 4A05A 3UZYA 4IIEA 1WDSA 2R1NA 3M0KA 3ZVHB 2XZ7A 1W32A 1F3WA 4O57A 4DWSB 1G0CA 4S3KA 3WLIA 3L5LA 3PUDA 1ONEA 3L12A 3M5XA 4NAEB 1DWHM 3K8MA 4REQA 3ORWA 1EP1A 2ACRA 1OADA 3RJXA 1WNOA 3EBVA 3PC0A 3TJLA 5F2GA 1TREA 1K3UA 5FJJA 2ZE0A 4H19A 3B9DA 4GX8A 4IMDA 1C8XA 3S6DA 2YDAA 2HJPA 3LPGA 1AQMA 1V77A 4LRSA 1RJQA 1ZJBA 5AYXA 1YBQA 3W7CA 4YIWA 3AS2A 1H0GA 1ZQ5A 4W87A 3UNDA 1QO2A 3N3MA 4FZIA 3WF3A 3L9CA 1B1YA 3VMNA 3ITCA 3WNOA 1Z42A 3A9IA 3HQOA 3QLLA 4JHZA 2X1RA 2VGIA 3IRSA 1E55A 3CAKA 3VNIA 3RCNA 1U30A 4GKLA 3PPHA 3BG9A 2QR6A 3SJNA 2CLIA 2VQTA 1OY0A 5LNSA 3GHSA 4MJ4A 1R9YA 4OOZA 3HQNA 1IT0A 4KRUA 5G5IA 2B7NA 5C70A 5CPQA 2ABAA 2V38A 2Y1HA 3CT2A 2ZADA 2CLOA 3PSWA 2B81A 4LAUA 3TW9A 4ADSA 4WVXA 2DZTA 3KZPA 4DI9A 2QS8A 1O5RA 1ZUAX 3ABOA 1KKOA 3WLSA 5CAHA 4W9TA 2PDWA 1KXQA 2WNWA 3WF0A 5CJNA 5G1YA 3WDHA 1AQHA 1B3YA 4GVGA 3MMWA 2X2GA 4DJDC 2TODA 3Q37A 1ME7A 1KRAC 4DVOA 4C6QA 4UTTC 2J6XA 3GXDA 2I9UA 2ALDA 3PBMA 3WFLA 3CASA 1WZMA 2G96A 1XCXA 5AC6A 2PBOA 3EXRA 2A85A 4RXFA 4CQAA 4O18A 9XIMA 2QDDA 3NQDA 4KEVA 2R1KA 4J3ZA 4W7VA 1W9PA 3U2OA 4WOQA 3B8DA 5AFDA 1JPDX 1P7TB 1JJKA 1O60A 5EMMA 4YLWA 1TV2A 4HHHA 4BS0A 3IGSA 2ZRUA 3AS0A 1YDOA 2BHYA 2WZTA 1A5CA 3ITTA 3OZYA 2VOMA 3CU2A 1BWKA 3NZPA 2BVWA 1DJWA 5M5DA 4UNKA 4GHRA 2RDTA 1O94A 2W4XA 2H3DA 1NDVA 3JU2A 3VOHA 3N2CA 2Z7KA 1FP8A 2H6RA 1F4HA 2V3GA 4ERIA 1RLDA 5JIWA 1TV4A 1GZGA 3TJ4A 1E72M 2J77A 4FNSA 1EJ7L 2FTPA 3AU2A 4Z08A 3VM5A 5DO8A 4HZMA 2QCHA 2ABBA 4KESA 4XUGA 1MW3A 1DHPA 3CZKA 4QGCA 1V02E 5CPSA 4WRHA 1VBRA 3EOEA 4QITA 3Q4DA 4TMCA 5K4ZA 1EJXC 3BSMA 1S1RA 1SW3A 1VENA 1UD5A 3KAOA 2P8BA 4INFA 1QNOA 3K1DA 1F76A 2QUVA 1SMAA 2ZDSA 2D2OA 4CQBA 3FY1A 4ZQCA 1HJUA 4FX6M 1MSSA 4DZHA 4MDOA 1JDFA 3H53A 4ZENA 2QUUA 2NQHA 3U5YA 3EDEA 4BF7A 2JE8A 1EGMA 2YYTA 3W07A 4DAIA 3ZR5A 4DJEA 3OVPA 1FWSA 1IWBA 1EL3A 2QPSA 3USBA 2F2KA 4EPEC 3DH7A 1H5VA 1HL9A 2PWHA 3T2OA 3GTNA 4CN1A 3V5OA 2PD5A 2W9MA 3I65A 3GYEA 4ZXLA 1E56A 1X7IA 3KRUA 1HO1A 5LNUA 4WX2A 4TR9A 3KL5A 1JUEA 3CC1A 3EDKA 1WZLA 2CW6A 3PZVA 1JNEA 4HPJA 4JL1A 2YDRA 1W3HA 1OFAA 4MZ1A 1KCXA 3WMSA 4F9JA 4AD0A 4QBXA 1SSGA 1ISXA 2R1LA 4MFEA 1L6YA 2PDXA 3QR3A 1AD4A 1NFPA 2ZUMA 4NHVA 4LALA 4L65A 3RRAA 1HL2A 2NLIA 3FA3A 5BZAA 2OX4A 3QMSA 3BK0A 4D8AA 3AYTA 4PMDA 3I6RA 4XZBA 3TXVA 3AAMA 1PL9A 2XUCA 1PKNA 5J5DA 4WXYA 1KQZA 4NZJA 2XH2A 3LA4A 5D32A 3FKRA 3ECQA 5HOSA 2OOFA 3IJDA 5DBTA 1LM1A 3WDPP 1FWTA 4J27A 1KLYA 1D8WA 1UMLA 4LPCA 4JY8A 4ASTA 3BGAA 3TROA 3CUXA 3E1F1 3WLQA 1NWSA 2OFJA 4B5SA 4AYSA 1G1YA 1W56A 3BOFA 2REQB 2EPOA 3GIPA 3I3DA 3V18A 2PWFA 2PD9A 4AX6A 2FHCA 2V8ZA 3EKZA 4MJMA 2HK0A 1AZ2A 3ARTA 1IHIA 4TO8A 4Q33A 1WXJA 4HYVA 3WO8A 1A5KC 3UWEA 4GZ7A 2EPNA 3V35A 3BW4A 5HPCA 4CNSA 1QOPA 2J24A 2XIOA 3SCOA 4XK2A 1VR6A 1GHRA 3R8RA 1SZGA 1X96A 3II1A 1BRLA 4OECA 3FDGA 1ZAJA 1W1PA 1K9DA 3WQEA 3ZVHA 4GG9A 3WUGA 5I07A 4DWSA 3W4RA 2OX1A 4RZ6A 4NXKA 4NAEA 2XGIA 4L1WA 3O3RA 5HINA 1O1ZA 3G0SA 3DC0A 5BMWA 3K13A 2OSYA 3FXYA 4CD7A 5HXMA 3W7OA 4N02A 1I45A 2A3HA 3A47A 4QISA 5D03A 2QGYA 2DZXA 1Q6LA 3SAZA 4UOJA 3HIJA 4FOJA 1V03A 1X6UA 5AC8A 3W2NA 2XSBA 5EYWA 3TXZA 1CGWA 2EKCA 3DHFA 2DT1A 1EHAA 4LC6A 1WAUA 4K68A 3WUEA 1AZ1A 1RD5A 1UR2A 4E8DA 1GJUA 3VE9A 3P81A 2VDGA 1JZ8A 1OINA 2WBKA 4L6OA 4UR7A 4C1KA 2NT1A 2PP0A 2CWNA 1T5AA 2X0HA 1JYVA 3KCLA 4JFSA 2JKAA 1EIBA 3WEZA 3PZGA 4GBDA 1TTQA 4LH8A 1I0DA 1U5VA 5C54A 4RZ5A 1W1ZA 3MCNA 3QXBA 1V0NA 1P0EA 4IJCA 5KETA 1SFJA 2Y2WA 2Q01A 3ZMRA 3CEUA 4GOAA 3ZLHA 2R1MA 3E0IA 2DVUA 4Y96A 3Q67A 2Z4GA 4MNMA 3P67A 1X6LA 5ABFB 3ANYA 4HK5A 3SZ8A 4XBKA 3PBYA 1PWMA 3UCDA 1DPMA 5T8GA 4P8XA 3H4WA 4G7EB 4LANA 4J2PA 5CLWA 3DECA 3VU2A 3S1GA 1MVYA 3AJ7A 4LYKA 3UYCA 4NX0A 1UC5A 5K4XA 2PRLA 4G5DA 1G7UA 3L4YA 3RNDA 1CCWB 2GWNA 4OZOA 4AZ5A 2GQAA 2Y7EA 2EPMX 1OQFA 3TW7A 3HM7A 4ZFMA 3SJ3A 1IWPA 1YPFA 3SADA 2CZEA 1P7TA 4P8VA 4H1ZA 3KP0A 2E77A 4A4AA 3IIOA 3OLEA 3V4BA 2ZUWA 2XSAA 3UPBA 4IQLA 1B31A 1EXBA 1LDCA 2O9PA 4YTQA 3UXDA 2FMOA 4NKCA 5K2ZA 3I3BA 3AOFA 4LF2A 4IG2B 5EMUA 2Y88A 3BUVA 3UXIA 1L6FA 1MRQA 3IVSA 5A8GA 4PTVA 4D6EA 3DDMA 2PDLA 2B7OA 2ZTJA 3AHYA 3PWIA 2C13A 3KTSA 4US5D 1E70M 4DBUA 5C7HA 1YKWA 4J4KA 4MAZA 3MHFA 1TIMA 1EDGA 2CCRA 1TPFA 3HQ1A 4HBKA 2ZWZA 1W2PA 1EF2A 2C6QA 3F4WA 2X1IA 2C1IA 1XH1A 4TX6A 4QCEA 2XWDA 3PTKA 2HWGA 2JFEX 1GGOA 4S38A 1F4AA 4J7RA 2D20A 1CXLA 4F40A 3SRFA 5DQPA 4PTNA 1S3HA 3ARRA 1QVBA 2PUZA 1MXDA 1VIWA 1MEHA 4CU8A 1AMKA 1CTNA 1TZZA 1K7EA 2R24A 1DJHA 3MCMA 2OU4A 1EHNA 3SUTA 3DFOA 1WAWA 4GX9A 2E4TA 1XIHA 3UZWA 4LCQA 2ZOXA 2UV8G 9RUBA 3C86A 3BO9A 4NQ1A 5FEPA 3WMBA 2QDGA 2OT0A 1X7FA 1IZKA 3H21A 2E1WA 1ZS2A 5AOUA 4J9JA 3W83A 3SUUA 4B3ZA 2EBNA 4UTWC 1RBAA 2CETA 3H7VA 2ESCA 5LA1A 3N9RA 3E5PA 3P60A 3FAXA 4WDUA 4LAMA 3NVTA 1S2TA 3PB0A 5H8MA 5A8PA 3IEBA 4M80A 1R6WA 1W9UA 3VNLA 1C9DA 5DCEA 4H6QA 2VFFA 2PCQA 2CLPA 4AZ6A 1JZ4A 4D8ZA 4KGLA 4E4UA 1F9CA 3HTWA 2Z1WA 3UT0A 3WJXA 1GZJA 1K7FA 3A4JA 2WLYA 1S2CA 3B97A 1YQ2A 4RKAA 2Z24A 2DJLA 2WJZA 1K8ZA 4DM2A 4LUJA 2QW5A 1OFQA 2FGBA 2CFFA 1VJIA 3B06A 2POZA 2HVOA 4H9YA 1I2NA 3QHOA 5HMDA 5SWUA 2FFCA 2G41A 3NQVA 4Z2GA 1LL4A 3UW6A 4HQVA 3V0UA 3EX2A 5D04C 3SRHA 4AIBA 3RX3A 1V0LA 3NL3A 1TWZA 2XGZA 3IWPA 3LNPA 4HZ7A 3PK7A 2ZXQA 1PB0A 2HZGA 1Q8AA 5KZEA 3BANA 2DZVA 3PG8A 4W8AA 5CZTA 4ZQNA 3WD0A 1O5KA 1GOKA 4LNCA 3QC0A 2W92A 1A5OC 3FA4A 3K4WA 4PUMA 3KCJA 2QJMA 3GXTA 4H00A