1V7AA

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords adenosine deaminase
total genus 143
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v7aA00
4LEFA 2DVTA 4UBPC 2P50A 3K5XA 2Z4GA 3HTWA 1EZ2A 3AU6A 1K6WA 3GTFA 3UR2A 2YZ5A 1FWDC 5FSEC 1JGMA 3MDUA 3AU2A 4IGMA 3S2JA 4WVXA 2PGFA 1HZYA 1V7AA 2A3LA 3CS2A 3URNA 4EPBC 3S2MA 4WHBA 3TN5A 1A5KC 3JZEA 3QY7A 4H9MA 4Z42C 3HM7A 2FTYA 4C6MA 2FTWA 3PBMA 3V7PA 5LXXA 1EYWA 3PANA 3T1GA 4GK8A 1V77A 4NP7A 4RZBA 4H9XA 1ITUA 4G7EA 3GRIA 4GC3A 3FEQA 3GIPA 2EG7A 4DO7A 2W9MA 3NEHA 4R85A 4R7WA 3IGHX 2HQAA 1S3TC 1DPMA 3SO7A 2Z28A 1NDZA 2VUNA 3GU1A 1A5OC 3S4TA 3GU2A 3ORWA 3O7UA 4EPKA 3E74A 3MKVA 1YBQB 3RCMA 2QVNA 3E38A 3UBPC 2RAGA 4XAYA 2R1MA 4C5ZA 1NDWA 4DNMA 2Z00A 4PBEA 1UMLA 2ADAA 3F2BA 3B40A 4E3TA 3LNPA 4B92A 2GWNA 1K1DA 2KAUC 4F0SA 2WJDA 4LAOA 1KRAC 2O4MA 4EPDC 2PGRA 4C6PA 3QGKC 3EWCA 2BGNE 4G7EB 1PSCA 1A5NC 4RDVA 3URBA 1WXZA 3F2CA 3RN6A 4KEZA 5HMFA 5FSDC 2WM1A 3UF9A 1XWYA 4P5UA 2HPIA 2EG8A 3K4WA 4J35A 4H00A 4IG2A 4L6DA 4QTGA 2QS8A 4LH8A 4GYFA 3A3XA 4LANA 4DLFA 4QRNA 1V51A 3F4DA 2Q09A 2AQVA 3URAA 2D2GA 4H9UA 4IH3A 4J5NA 1KRBC 5CH9A 4LFYA 1J6OA 2YB1A 4GBDA 2HPMA 2GZXA 1EJSC 4XD5A 4C6CA 3KM8A 4KQNA 1POKA 1A5LC 2Y1HA 4C6JA 3RHGA 3NURA 3MJMA 3GTXA 3IARA 3LA4A 4IG2B 2I9UA 4NG3A 4RDYA 3RYSA 2R1NA 4LALA 4GY1A 2GSEA 4D8LA 5AKQA 4ZSTA 4LCSA 2Z7GA 3QGAC 1A5MC 2FFIA 4B91A 1A4MA 3SFWA 3GUWA 1P6CA 1W1IE 2DVXA 4QSFA 2GOKA 4M51A 2VR2A 2UBPC 4DZHA 3WMLA 2WJEA 1I0BA 3LU2A 4C6QA 1RJPA 4GXWA 4XAFA 2E1WA 4PBFA 3GTHA 4OFCA 4C60A 4HA0A 4EPEC 2OOFA 1FWHC 2AMXA 4QROA 1M65A 2Q01A 3HPAA 1UIOA 2ANUA 3LY0A 4TQTA 3LGGA 1O5RA 3BE7A 4RDZA 1XRFA 3DCPA 4LAKA 2VC7A 1KCXA 2Z26A 3E0LA 4XD6A 4QS6A 3WZ0E 2R1PA 1E9ZB 4C6EA 2HBXA 4B3ZA 3N2CA 3GTIA 4C6FA 3S2LA 4I6KA 4C65A 3E0FA 4CQDA 4C6IA 1J5SA 1YMYA 3OVGA 3QY8A 1VFLA 1FKXA 1FKWA 4IQJA 1GKQA 4XAGA 2R1KA 1ONXA 4H01A 3EWDA 1KRCC 3T8LA 3FDKA 2FVMA 4V1XA 1NFGA 4CNSA 4ICMA 2Z2AA 3ID7A 4AQLA 2F6KA 5A6TC 4F0LA 3PNZA 1RJQA 4C6DA 4LCQA 4BY3A 1R9XA 3IV8A 2Z25A 4ERGA 4ERIA 1RK5A 1M7JA 2PAJA 4V1YA 4KERA 2FVKA 4DYKA 4HK5A 1ADDA 3QY6A 3NQBA 3E3HA 4GOAA 4GY7A 2OQLA 3O0FA 4KIRA 4CNTA 4C6LA 3OQEA 1GKRA 4XD4A 2Z2BA 3B0XA 3MVIA 5E5CA 3GG7A 3ISIX 1EJWC 4WGXA 4H9ZA 2DVUA 3LSBA 3WYZA 1RK6A 4CNUA 4INFA 4PCPA 2QPXA 2HBVA 2Z24A 4GX8A 4BJHA 1QW7A 1E9YB 2PUZA 4H9TA 1PO9A 2Z27A 3DUGA 1R9YA 1EJXC 3K2GA 3E2VA 2VM8A 1ZZMA 3IACA 4ERAA 2O4QA 2OODA 4DI8A 1FWFC 2G3FA 3URQA 3S2NA 3MTWA 1FWAC 4IFKB 4H9YA 1FWIC 3MSRA 1GKPA 2I5GA 1EJTC 3LGDA 3F2DA 3EGJA 1NDYA 3C86A 2QT3A 1V4YA 3UR5A 1POJA 1YIXA 3R0DA 4EP8C 4RE0A 1M68A 1R9ZA 4KETA 1FWBC 1EJRC 1K70A 5HMEA 2PLMA 2VC5A 3TN6A 2P53A 1J79A 1ONWA 4GX9A 1IE7C 3OU8A 1V79A 2YXOA 4L9XA 4C6BA 4HJWA 3B0YA 4YIWA 2Z29A 3TN4A 3GIQA 4C6KA 2OGJA 5G4HC 4DI9A 4JOMA 1XRTA 4R88A 3FDGA 1UBPC 3LS9A 1ITQA 3F4CA 4IGNA 4QS5A 2UZ9A 1RA5A 2OB3A 4AC7C 4BKNA 3OODA 1UIPA 3CJPA 4KEUA 4HK6A 4B90A 3A3WA 4IFRA 3T81A 4IFOA 4I6VA 3D6NA 4XD3A 3IRSA 4DLMA 4XAZA 3MVTA 2WJFA 1RAKA 2AQOA 4PE8A 3A4JA 3G77A 1BF6A 4KEVA 1PTAA 1EJVC 2D2HA 3MPGA 4CQBA 1RJRA 1FWCC 1J6PA 4F0RA 4KESA 1XGEA 3IPWA 1RA0A 4J2MA 4CQCA 2XIOA 2GWGA 1WXYA 1KRMA 4CEUC 3CAKA 2CZVA 2YB4A 3LSCA 4IFKA 1A4LA 2ICSA 4DZIA 1EF2A 1I0DA 4HK7A 4LAMA 1YRRA 4GY0A 1O12A 3DC8A 3TN3A 4DIAA 3MDWA 3ITCA 4RDWA 3OOQA 1P6BA 4C6NA 4GZ7A 2BB0A 2VHLA 4C5YA 3IJ6A 4H9VA 1FWJC 2EG6A 1P1MA 1YBQA 3OJGA 3TNBA 1QXLA 1PB0A 3UPMA 4LCRA 2R1LA 4C6OA 4UB9A 3PNUA 2HNHA 4IF2A 1FWGC 4PCNA 2ZC1A 1NDVA 4KF1A 5HMDA 2E25A 4ZSUA 1FWEC 3ICJA 3GU9A 1EJUC 1YNYA 2D2JA 2IMRA 3PAOA 4MUPA 4G2DA 4CEXC 4NI8A 3AUOA
chains in the Genus database with same CATH superfamily
1VGAA 3K5XA 4WOQA 2PU1A 3GKFA 3TX9A 4WQ6A 3WQGA 2OZ8A 4F2BA 4W8LA 4AISA 4B16A 4OECA 1EKOA 3LMYA 5K2ZA 1KKOA 2NX3A 1HX0A 4QM1A 4W89A 4Z42C 2R94A 3H4GA 2PD5A 4HA4A 3PBUA 4AU0A 1GHRA 2Z6IA 2AQWA 4BQ2A 3TA6A 3PZUA 2L5HA 3SUTA 4RZBA 1SJBA 2EKCA 8A3HA 1TMLA 5HNTA 1SVDA 3EX3A 3IGHX 2DUZA 1PWLA 1DPMA 4IP5A 4AHOA 1DJWA 3G1FA 3GXTA 2DORA 1H1YA 3P67A 3QLLA 2WSPA 2XTKA 2W63A 5HNNA 4C7GA 3SSJA 1D2KA 3T42A 2WMIB 1U1JA 2JIEA 1OQFA 1MXDA 1JGIA 4GIEA 3GH4A 2ZRUA 3L66A 5IBXA 4J4KA 1XISA 4E3TA 3BQ6A 4HZMA 4XIAA 4LAOA 4L5ZA 3GC4A 1JR1A 3EWCA 3C2OA 1A5NC 1OYAA 1X97A 4HHPA 3FGCB 3HQOA 1XX1A 4K6AA 3WJYA 3HQNA 4N9BA 1HVXA 3GNRA 4TMCA 5M1TA 4K8GA 3VCNA 2VEGA 4G1KA 3A3XA 4QRNA 3V18A 5ABFB 4NZ4A 3TW7A 4M1RA 2FPYA 5AC6A 5I07A 2VEPA 1NM9A 1Q6DA 5CG0A 2YB1A 1PUDA 3FKRA 4PA8A 3QC3A 4J3ZA 4FXFA 4H6EA 3V1PA 2PZ0A 5JQ9A 4Y9MA 3KUMA 1XP3A 1TB3A 3IARA 3DDMA 2R1NA 3B9OA 3ME3A 3VGFA 5BYWA 3VD4A 1QCWA 2Z7GA 4B91A 3AAMA 5H8UA 2PURA 3OW1A 3DAQA 3QZEA 3DC0A 4AXNA 4WJEA 1TIMA 2XSBA 3RM9A 1R30A 7A3HA 3IGXA 5BWFA 3BAIA 3SCOA 2AKMA 2NZLA 2UY4A 1DIDA 1CZ1A 3N11A 1T0OA 4IWWA 1GCYA 3GVGA 2VO5A 4V33A 1CGTA 3W1UA 1AZ2A 5EPDA 5EGRA 3S42A 3BSMA 4ECLA 2NXHA 1DXEA 1WAWA 3MSDA 4W8AA 2QXWA 4B3ZA 2VX6A 4LC8A 2OKOA 4C65A 2Y88A 4AEEA 2QUUA 4QFUA 1QAPA 3NDZA 4DBUA 2IKJA 3WNKA 1Q45A 1BTCA 1E3XA 1NELA 4PFMA 4W85A 1LWJA 1EGVA 3H7UA 4Q8PA 2OX1A 1UCWA 2E5CA 3CU2A 2VCAA 3LI0A 2J88A 4AZCB 2QLYA 4AWSA 4JNYA 2V67A 2FDMA 4XO7A 1XYFA 1V02E 1KFWA 1E5JA 3KX6A 4LRTA 5DCBA 1BFNA 1Y7VA 1MEIA 1UP3A 4O0ZA 3H55A 2DVUA 1XPGA 4W7UA 3OBAA 1Q8JA 3RRXA 4PTMA 2NWRA 5H8PA 4AWTA 3GXFA 4R9OA 4QAIA 3APGA 1FWFC 1RHCA 1VJZA 3UESA 2E68A 4YYFA 3BC9A 1S1RA 3I3DA 4IP4A 4RL3A 1CGYA 1RPKA 4UIOA 3KTCA 3B8WA 3JRKA 3N4FA 1POJA 3BAXA 3UWYA 3L67A 2O7QA 5FOOA 3W1MA 3SCNA 1VLWA 2E40A 1G1YA 3OU8A 4Q4QA 2G97A 1Q7ZA 1KA9F 3WF4A 2V3GA 1JG9A 1LL6A 5DRCA 2IW0A 3M7SA 3PZQA 3W71A 1V3KA 4N2YA 1I2PA 3LS9A 3C2RA 3KRSA 3QSRA 3TAKA 4AWEA 1G67A 4AUBA 2DJLA 3WH5A 3TYUA 3P14A 1VBUA 3CJPA 3VNLA 2V68A 1JF6A 4DNHA 4IFOA 1LG1A 1WDRA 2R8WA 3DHFA 4GE8A 5SWUA 1FDJA 4AH7A 1FCVA 4MY1A 3STPA 5AYBA 5CGTA 4DQWA 2NV9A 4BS0A 1Q66A 2D2HA 2PDNA 1J6PA 1TQXA 2PMQA 2CZVA 4D8AA 2IKIA 1UC5A 3WBYA 1Q63A 4PMOA 3HMCA 1V0LA 2CLPA 1JPIA 4W84A 2F6UA 3TLQA 3B03A 3MDWA 3ZIZA 4RZ5A 4RZ4A 2C15A 5AN7A 3VKKA 1Q2RA 1JL8A 3VM7A 3W3OA 1LRNA 1XUUA 3KHDA 5BWAA 4D9PA 5CAHA 3FFSA 3AYTA 2ZZ4A 4TUFA 3B4UA 4UFKA 4UCGA 4QQ3A 2E1DA 2E67A 2FGZA 3UA4A 2J7CA 2JALA 4TVDA 3PAJA 1EP3A 4ZQCA 1M5WA 2Q8ZA 4LF2A 3TIMA 3O15A 1YNQA 2ZKMX 3AS3A 4MG4A 3LG3A 5HINA 5CBIA 3P5ZA 4JTUA 1EZ2A 2QDEA 2XDFA 5LHEA 1Z3NA 4Q8MA 3GWQA 3MJYA 2I56A 2YDSA 1REQA 4D72A 1JGMA 1FH7A 2QCGA 3ALGA 3H7RA 2VCCA 1TRDA 3TJXA 5I3KA 5EU9A 3LCWA 1FHDA 3EX6A 1JYNA 4DY1A 5E0KA 3CZGA 4LS2A 2D0GA 2BOFX 1US0A 3EKGA 3OBEA 1XFBA 1XI3A 1VS1A 6TIMA 2DFAA 4MIMA 2Z28A 5E93A 1Q8AA 1Z41A 4G56A 5A6KA 3O7UA 3EOUA 4WDWA 1CCWB 5AHIA 3VUSA 3CV7A 3BW4A 4H83A 1CGVA 2P8CA 3GSMA 4US6A 2Q02A 4A05A 5HATA 5BNKA 2Z2UA 2X0SA 3Q65A 1XFCA 3GXDA 1Q4NX 3A9BA 4PUDA 4D8ZA 3UQNA 2HXTA 1MW2A 3W76A 2PGRA 4LYKA 1J01A 1B57A 1MUCA 3C2EA 3TV8A 2NUYA 3OVPA 3HGSA 4PTXA 3UF9A 5EFDA 5F4SA 3GFZA 3K4WA 4N02A 1H5YA 2GGEA 1CXEA 3N2MA 4O4VA 3KW3A 1RZMA 2PZNA 2ACRA 1F8IA 3F7JA 2BXVA 3BQ5A 4DYJA 4IIFA 3VGDA 3HZ3A 4LBSA 1UMYA 2GJRA 2VEKA 2XISA 1H1NA 4DM2A 4LUSA 3RX3A 4DXKA 3G24A 3HB9A 2OWXA 6REQB 2Z1WA 3NURA 1XPYA 4HOWA 1X39A 2H8XA 2VR5A 2AL2A 3QMRA 5DRIA 1E6RA 4QCFA 3VZXA 4Y6GA 4D8LA 1XIMA 3H7VA 3CQIA 4F79A 3QGAC 1VAHA 3QF0A 3THQA 1ZFJA 3VUPA 3LD5A 1AJ0A 3Q37A 1RCQA 3BLFA 4GCXA 1XBXA 1RJPA 5B7YA 1KFKA 4KWVA 3ATYA 2NT1A 1XBZA 1CW2A 2JF7A 4GG9A 4L9ZA 1ZRQA 4K7YA 4N42A 3UNDA 5DQPA 4US5A 1RQBA 2V63A 1XR2A 3G0XA 1YDYA 2VC7A 1QPKA 1YW1A 4AZHA 1LROA 1GZGA 4JTIA 3N3MA 3GZ3A 2JGYA 3R8GA 1R3YA 3HO8A 3IJQA 4P7QA 3PK7A 2XPKA 1CGUA 3ZWTA 4FR1A 3MWAA 3N15A 1Z7AA 4W7WA 3WDHA 4CNSA 4PUUA 5IHRA 4EVZA 1XD0A 1ALDA 3T2QA 4E2OA 4ZB0A 3W38A 3N6JA 3AHXA 4QE5A 4E2DA 4EAMA 3MUAA 2ZX9A 4W5ZA 1VF8A 2X30A 3QY6A 3CB8A 4QISA 3AYRA 2RHGA 4F4RA 1VLIA 4JX5A 4ZGYA 3CH0A 1QNQA 1GJUA 5CBBA 2VDGA 3ISIX 5M03A 4H9ZA 1IEVA 1TVPA 3MP4A 4IPLA 1VBRA 3W84A 2C0AA 1K7XA 1ENUA 3ARXA 3S1XA 5HUOA 4KWSA 1M41A 2YA2A 4IMEA 1XL9A 3CAWA 1W5NA 1GJWA 3NG3A 3ITOA 1UZDA 3RPMA 2ZC8A 1F3TA 3E02A 1IT7A 4F3HA 4IIGA 5CSUA 1XCWA 3LBCA 2VC6A 1BGGA 1S2UA 1U83A 2QCNA 3I6EA 4D1IA 4UCFA 3CK5A 3UR5A 2B7OA 2XIJA 4CD6A 1JAEA 1CX9A 3AXHA 2J9ZA 3E1F1 2YXOA 4HHLA 1HJXA 4ICNA 1MW1A 1Q6RA 2B7NA 3GS6A 4JYDA 4D6GA 4MFDA 3P84A 1CWYA 3ABRA 3FDGA 3IRDA 2Z1KA 3P62A 5JH1A 1B3WA 1OD8A 3GHSA 4BWLC 4HOZA 1V0MA 2GVJA 4QS5A 4OGZA 3AMKA 2J4GA 1ECQA 2ZA1A 3OODA 4PUNA 1EA0A 2ON3A 4B5TA 3ES7A 3HQPA 1LTDA 5C9XA 2WVUA 4LUSB 1U2YA 3GTNA 1SFTA 3Q67A 1U5JA 3F4VA 1VB9A 3CQJA 3WNNA 1EX1A 2UY3A 1QPNA 4XX6A 2TAAA 3GHUA 3CUXA 1MSSA 1TX2A 1AK5A 3TYBA 3W26A 1W0MA 3M0JA 1UP2A 4HPNA 2QCFA 4NAEA 4GHRA 1G01A 3FJNA 1G4EA 3IGSA 4FXJA 5MKGA 3NL2A 2QQ6A 1TZ7A 1A4LA 2CEQA 3R89A 1EDGA 1ODZA 1KTBA 2BNJA 3UG5A 1YRRA 2Y4SA 1TJ2A 1TE6A 2D1ZA 1BHGA 3LPOA 3ZXWA 5LYRA 2HTMA 2BB0A 2VHLA 1CNVA 3HMJG 1DWHM 2HVOA 3OJGA 3ZS4A 4BF5A 4UOQA 4JTGA 1I45A 3IUIA 1CTNA 1XDMA 3ZR6A 4HB7A 1I2NA 3T55A 1W1ZA 2C3ZA 2VEIA 5FACA 4KRTA 2Y6ZA 3W6LA 2V82A 1SW7A 1G7UA 2P50A 4LVAA 3A5FA 2WNNA 4RCXA 4JQ4A 3AWOA 5DMMA 5REQB 4BI6A 1L6YA 2YFOA 3EXTA 4O14A 3DKLA 1OSEA 1JDFA 3ZWSA 1VCFA 1JI1A 3VIMA 1PWMA 3DFPA 1IEXA 1LL4A 1E6XM 4H2HA 3S47A 2JKAA 4E8CA 1FTXA 5AVHA 1LDCA 5A6SA 1EYWA 3T1GA 1JZ4A 1F2JA 1UD5A 3ONCA 2EG7A 3W7GA 4V28A 4DO5A 4E4UA 3DECA 2VJXA 4FIQA 2VTFA 4HPHA 2X0HA 2OLHA 3TLLA 1QTWA 5J8LA 4P8XA 1VQTA 3TOPA 1ESWA 1CXFA 2YLAA 4U31A 3WJSA 2R1MA 2VC9A 5IHSA 1VKFA 1SUXA 3EDFA 4AX6A 4JQAA 3XINA 4DX3A 4A3UA 2ZIDA 2G4JA 1NF0A 1PZ1A 3ITTA 4TTGA 4X60A 1D3GA 4ATLA 1E1FA 3ARSA 1A3WA 2X8RA 2JBMA 3RLVA 1F74A 2A5HA 1Q6FA 4D6CA 2VELA 3SRKA 2E3ZA 5D9OA 3F2CA 1WZLA 8XIAA 1A5AA 1WKEA 1S2AA 2HPIA 4MKVA 4H00A 1RBAA 2X1TA 4PH6A 3TE9A 4IPNB 3R79A 4MF4A 3AMLA 3URAA 4HSOA 1XYAA 3RO8A 3SW6A 2WWCA 4IIHA 2PP3A 4ASTA 1CYGA 3KM8A 4N9EA 1BQGA 2HVMA 5LA2A 8XIMA 1JZ2A 2BXYA 2EGZA 1GOQA 4RNIA 5AZ0A 2BGSA 1KGUA 4WOZA 4GQ0A 1OADA 1LCOA 3PUGA 4AC1X 4Y8FA 1CDGA 4RDYA 5HWNA 3FEMA 1RH9A 4FNQA 3MYOA 2F7FA 3GKAA 1MWOA 4ZSTA 1MQPA 3GG1A 3GC2A 3VFCA 1YTKA 3AXMA 1VFUA 1BVWA 3INPA 4U2YA 1PYMA 2X1UA 5HR7A 2WJEA 1KBLA 1CENA 4Q32A 1JI2A 1WX0A 4WGHA 2H6RA 1PZ2A 4AMCA 2E1WA 5U7SA 2UY2A 5T9BG 3R11A 4NAEB 1I2RA 3VNZA 4L7ZA 2XZ9A 2OOFA 3SZ8A 5CG7A 4WJ8A 1TR9A 2JF6A 1EDQA 3H4XA 1CECA 5D2TA 1TVLA 4C1KA 3QR1A 4JX4A 4L64A 4ZA0A 2G37A 1HNYA 4OKDA 5HWJA 3UG8A 2TPSA 2VOMA 1R46A 1XLFA 1XIGA 4MHBA 2EXOA 3A6OA 3KTSA 3B9DA 2VVSA 1O1HA 2FTPA 3R8RA 4E38A 1R8LA 5XINA 4FR6A 4IXHA 3TC7A 1UWUA 1DJHA 5HOSA 3WF2A 3VABA 3W2NA 4B5UA 4XZLX 1YE4A 3I4KA 3H22A 4H04A 4CD8A 3LENA 3W81A 4AY8A 2Y8UA 1JYWA 3O6AA 2RDXA 3CUFA 4LCQA 1O95A 4FP1A 1O7AA 3EDEA 2FVKA 2YCLB 5CEWA 4CN1A 1CXKA 5F2IA 1ZNNA 2V2DA 3I6TA 4JZ5A 1IIHA 2WK2A 1D7FA 4KIRA 5TD4A 4NZ1A 3ARPA 4CQ9A 2OO6A 3C8NA 5FEPA 2PRLA 4AD4A 3TUUA 3VYLA 3SIZA 1UR4A 2GGGA 2EPLX 1HXJA 4GX8A 1BG4A 1XSKA 5HPCA 4H9TA 3TWBA 4DBEA 1BSLA 5DMLA 4PMDA 1FHLA 4GACA 4MVAA 3U2CA 3MYPA 2B4GA 2J7GA 3URQA 3S2NA 2XFRA 4GBUA 4H9YA 4W5UA 4ZENA 4Q4PA 1ZAJA 2PTXA 4WJXA 5FD0A 3GX9A 1ZHAA 1V4YA 3SUVA 4NRRA 1UB3A 1C3FA 4CLMA 3SCVA 3BOLA 4DELA 1KM6A 3VGEA 3OYZA 4YTTA 3OBKA 1GOOA 2E28A 3TNOA 4I5XA 3W6YA 4WKFA 2WHKA 3B0YA 5KZDA 4B5XA 2ZCGA 5JH2A 2INZA 2WNWA 5L9FA 1XIDA 1QNSA 2GJLA 1B9BA 5A6BD 5D02A 4PCTA 3WNLA 4I9JA 3BG3A 3RX2A 1GOIA 1A49A 3DZ1A 1SJCA 3LK6A 3NL6A 1E43A 4LUYA 2YYTA 5HMSA 1P7TA 1D7KA 2F6XA 2QCHA 5C2CA 4CNNA 1J0KA 1ZTVA 2DSZA 4UTJA 1O5XA 3QW4B 1I8JA 1J4EA 3EWZA 3DG3A 3WEMA 5BRBA 1Z48A 2O9OA 1N55A 1XYBA 1L2UA 4EXBA 1B3VA 1W5OA 3BAWA 5K4XA 4IMCA 1GPWA 1WZMA 1QI3A 2ZX5A 4IMFA 4KESA 3LHUA 2XVLA 1YDVA 4Q8WA 1ZJIA 3L0NA 3YPIA 2DSWA 2CZFA 1NAL1 4Z1AA 4WX2A 1W9PA 3G3MA 3II1A 4PZVA 1F3EA 3UGRA 2FZ8A 4Z1YA 3NIYA 4P7RA 1ZBCA 4MLJA 3S8HA 4PTVA 4DZ5A 2BHUA 2OGYA 2CHNA 3QXBA 3MSYA 4JYEA 4CCCA 1ISYA 3GFYA 5BMWA 5CGMA 2VGBA 3FAXA 4LPCA 4FLQA 4OTKA 4UTKA 3NPXA 1QPRA 4RE4A 3L4YA 4QJ1A 1FCQA 4QLJA 4XTIA 3ZQ9A 1XUZA 3M0MA 2IMRA 2X09A 4IISA 3MKCA 1UZ4A 5I3FA 2R24A 1W1B1 4ML4A 3W25A 2INFA 1WOBA 2SFPA 3ZZ1A 4RNJA 1FCUA 4LAUA 1FA2A 1R0MA 1VR6A 1SR9A 2OWWA 2WLZA 1W56A 2F84A 3DFTA 4O50A 1XXXA 4PMXA 1U1UA 4D6IA 4C6MA 3W82A 4TIMA 3CBWA 1S2TA 3BLKA 3SCPA 4UTUA 3A5VA 2ZWYA 3OZMA 3U0HA 3ANUA 1V77A 3COTA 3LMZA 3WMCA 2E6DA 3W7DA 2QGHA 4LC6A 2VT0A 4Q4OA 1S3TC 3T0TA 4H7CA 1LBLA 2VUNA 1GVEA 2YW4A 2E8YA 2J25A 3LV6A 3AYSA 1C8XA 2QVNA 8RUCA 3XISA 1H7NA 5I09A 1CBGA 3GNOA 1HP4A 2X2GA 3J7HA 1JDEA 2HE8A 3AIVA 1NDWA 1OGGA 5FEWA 1Z69A 4P61A 3E9AA 1LUCB 4WLCA 3SUSA 4NKCA 3BSHA 4B4HA 1KFBA 1CXLA 2Y62A 1LJYA 2ZUMA 3PBGA 3MCNA 4FXRA 2POZA 4A2SA 2P5NA 1GTEA 1Q6OA 2HPMA 3DESA 5EMYA 1GYLA 1UKPA 3TC3A 1Z32X 2AOSA 5AC4A 4AIEA 1E1CB 4JIIX 4GH1A 1T41A 3CIVA 4JHZA 3H26A 3TYCA 4NG3A 4HYRA 2VWTA 5A2AA 5I78A 2OSYA 1LT7A 2X1SA 4S2CA 5FAGA 4JX6A 3P5YA 4IPPA 2XFWA 1PX8A 2V5LA 4IQLA 2YA1A 5AVNA 4Y96A 2DVXA 2Q3RA 1ZGDA 3S5YA 4DZHA 2GK1A 2DV0A 2P0IA 3RPDA 1RP9A 4OFCA 1VCVA 4RLIA 2WJZA 4AIUA 2EEXA 4CN4A 1WPCA 1KD0A 2BY0A 3WN6A 3FA4A 5HXMA 3RM8A 2ANUA 4XZWA 3JVAA 4N9DA 4E4FA 3W7IA 3PJTA 3E49A 1S5NA 3PZNA 3HV8A 3WFZA 1FUYA 7TIMA 1AQFA 4C6FA 1XD1A 3NM3A 2WLYA 5FJOA 3WENA 4O15A 1E0XA 4LSBA 4JYFA 4MWAE 1YMYA 3FLUA 1DEDA 4LVGA 1TIWA 3VIJA 1E70M 2FQIA 4ICMA 3GB6A 5D2XA 3U2OA 4AQLA 4WSKA 1R87A 1IT0A 4JIQA 1BEUA 3H53A 3WLRA 3NQAA 4URIA 3T44A 1XGZA 3C0SA 2I16A 3UFYA 4FIRA 3VE9A 1AH4A 4M1BA 3CWHA 1X38A 4WY0B 2J7HA 1J9YA 3EDKA 4GOAA 4MDOA 3NSNA 3RFAA 1GQKA 2ZUNA 1R3SA 3T07A 1JPMA 3CZEA 3LGEA 3R13A 4NVTA 5EFFA 3OHIA 4MZYA 4A22A 3V3WA 4CNUA 2ZA3A 1P6WA 1QW7A 1L9WA 1CIUA 4O0QA 3IACA 4Z0JA 1XIEA 1F3WA 4Y9PA 3HURA 4DI8A 1X7FA 3GBEA 1KQZA 1E6QM 1FWAC 3AO0A 1DYSA 1P48A 3GH7A 1TV3A 1W32A 5BXSA 3OA5A 2RDUA 4FNSA 2QJHA 3KRBA 4ZBCA 4N6FA 4HSNA 1H7XA 3VOFA 5D2VA 2A4AA 4HYVA 1PHQA 4GCAA 1XC4A 3CEUA 1BAGA 3BGAA 4TOQA 4DJFC 5I5RA 3QPYA 3W4RA 2V5DA 4RE3A 4FOJA 3AISA 3QPEA 2Z29A 3TN4A 1WYIA 4U4MA 5A8NA 3HJZA 4BQ4A 4DI9A 2D0FA 2BX7A 4R88A 3EPMA 1JPDX 1HF6A 2GUBA 4XZBA 1TV8A 4J28A 2ASHA 5AHEA 4AMAA 1SFSA 3ZM8A 1EJ7L 3N9RA 4HNNA 5I0DA 3EDDA 2HJPA 1UD3A 1E1EA 3WLJA 2XN1A 1R86A 4XAZA 1IZCA 3VU2A 2V0TA 2PDHA 3MMUA 2Y7GA 3ZJ8A 2RJGA 3VKDA 4J40A 1A0EA 1RA0A 4ZXLA 3GXMA 2FZDA 5G5IA 1GOWA 3W07A 2WNQA 2Y2WA 2BSLA 1C8VA 2A2IA 4GUGA 4HK7A 1O66A 1OWQA 3ITLA 1XLDA 4AVOA 2OSXA 1JCXA 1B3XA 4NT0A 3PFMA 1FY6A 2XH7A 4O10A 2JKEA 2CW6A 3CUIA 2ZRYA 4FS9A 1P0KA 1QRQA 4JIRA 2V69A 4YTQA 1C91A 2QJNA 1ZCOA 1QDSA 3TYDA 4AB4A 4JTDA 3MP5A 2Q71A 1EBHA 3AHZA 4LNYA 1PKYA 3QM3A 1JDAA 2Y5EA 5EMUA 3R2GA 2QDHA 4GVHA 3FKKA 3TP4A 3ANVA 3WD3A 3RCNA 2PGEA 3GTFA 5BXTA 3ARZA 1OFDA 4NJGA 3S6OA 3AS0A 2EPOA 1TJ1A 1SSDA 1QHOA 2OQHA 4KW2A 3QTPA 4QG9A 2PGFA 4P2VA 1ONEA 4QR6A 4R9XA 2VX7A 3ITYA 4H9MA 1A5KC 3G8RA 4HHMA 4M80A 4LWWA 2VZVA 3PBMA 4Q7IA 2WYSA 2QUTA 4ZOBA 3GVWA 4MADA 5FJTA 3PR2A 1S5TA 1OF8A 1VC4A 2J7BA 3WQOA 1ONRA 2BZNA 2Y63A 1F05A 3SCQA 3KCJA 1XH1A 3W7KA 5FJJA 5JVLA 3G18A 1H61A 2W9MA 5H91A 1JYXA 5EBUA 2NX1A 4HSHA 1UD2A 3TCEA 1UPMB 4L65A 2C1HA 2XIMA 3WSUA 2ZUWA 2WMFA 3QGVA 1Z9AA 4J9JA 1Y0EA 1E4MM 2Y5JA 3G1XA 3P8IA 2ZX7A 1GYMA 2PWVA 1EEPA 1V6TA 1SZGA 2EPHA 1ITCA 2WMHA 1H1ZA 2QUMA 4GIAA 3OG2A 3RR4A 4RKAA 1HKVA 2D69A 3EOEA 2OO0A 2FPVA 3VKAA 3MWCA 2GOUA 4O18A 6PTDA 4HBKA 2E77A 2E6YA 3M0YA 1QK2A 4KS0A 3BUVA 4LH8A 1KWGA 1B3YA 2WSQA 1V51A 4MM1A 5I77A 3CL7A 4JR5A 3SQSA 1W54A 1ZENA 5CH9A 4WSHA 4X0VA 3S5OA 3IK2A 3EOLA 4KH2A 2C19A 4HCHA 1C7SA 1OT2A 4JEJA 3C2VA 3W0KA 1US3A 5CC6A 1QO2A 5CLTA 3E96A 2AGKA 4M6VA 2GLKA 5B80A 4DF0A 2WQPA 1ZLPA 5CPMA 1BWLA 3SFWA 2PLJA 1HFBA 1Q6QA 1KCZA 4AZ5A 5K4ZA 4UFIA 1LLWA 3R1ZA 4MAZA 3SEPA 1UJPA 1K8XA 4QJ3B 3F5LA 4OUEA 1HL2A 3BAYA 5A5WA 5C55A 1PKMA 3KHJA 5BOFA 1ZBWA 3VVGA 1Q6CA 5DT7A 3UR8A 1ZCCA 1H4PA 4TQTA 1P43A 2ABBA 4JPGA 4I9MA 1GW9A 3BE7A 1H3GA 4XISA 4B4FA 1KGWA 1VIWA 4KT2A 1K7FA 4LU0A 1R2SA 1R3WA 5PTDA 2WVVB 2WMIA 1XJBA 3AXIA 1U22A 4MNJA 1HKJA 3PTQA 3FK4A 3I3EA 3V16A 1DTUA 4PB4A 2YL8A 3BSGA 2OT0A 4JHMA 4NU7A 4QDMA 3AZSA 2WHJA 1KW1A 3EWDA 3PJXA 3W22A 3KL3A 4QLKA 2P8BA 3MUIA 3WLNA 4Q8UA 4DJEA 2C79A 5A6TC 5BU9A 1Z8AA 4UWMA 3LHWA 1KNWA 1R9XA 3N2TA 3W7OA 2OZ0A 4GVFA 1ADDA 1HP5A 4O13A 3ABQA 1QBAA 2HMCA 3PS7A 3PUEA 5G4EA 5A8OA 5EMKA 4LUIA 3JW7A 2DT0A 3EWUA 1YXYA 3KDNA 2VX5A 3LPPA 2UV8G 2BXZA 3HG2A 3AJ7A 4LAZA 5FJIA 4GZJA 2G8ZA 2BV9A 1SJAA 3QR0A 1TREA 3VZZA 4ENLA 4L56A 3SJ3A 4F8XA 3L5LA 2E6AA 3A4AA 3PWIA 4ZFCA 2VURA 4AYSA 3WEZA 4MWAD 1SM9A 4MB5A 1T40A 3MSRA 2GQAA 3BMVA 1UA3A 2OQYA 3HV9A 4PYSA 4N0RA 5MKGB 2PBGA 3VOGA 4UR7A 5LIXX 4NYUA 1JDCA 4K3ZA 2D3LA 1PYFA 2VDIA 3TYEA 1XLLA 3B04A 1K70A 3TQ0A 1I6NA 2CZ5A 4ROQA 1J79A 1PVNA 4MWAA 1JIBA 4AZ7A 2G3IA 3BW3A 1QI2A 4GVIA 2OGJA 1TPVA 3WD1A 2BY2A 3UPWA 3S9YA 2HWGA 3UA3A 2H3DA 1PCKA 4IGNA 1A5UA 4NL1A 1QU4A 1FDYA 2EF9A 1J10A 4UFLA 4NZCA 5DFAA 1XYMA 4HK6A 2XIQA 5KZEA 2DSVA 3N9KA 5MF5A 3IRSA 3C56A 2WMJA 3WLTA 3W7LA 2AAAA 3A4JA 2ONEA 4XSLA 1DJZA 2J7EA 3EXSA 4AZCA 4YS1A 4XUYA 3M41A 4JBRA 4CQCA 4HNCA 2QDDA 3AOFA 4UFHA 4PSPA 2PDXA 3HJEA 3GBDA 2WCAA 2QHAA 4DZIA 4Z2LA 3DBNA 3M4HA 2PD9A 4YCOA 5FI8A 3QBUA 5FF7A 4FMVA 2XSAA 3BARA 2C16A 3JUGA 1UWIA 1GQIA 3NPUA 1JZ8A 1S46A 2PWGA 4H9VA 2VR4A 5ECVA 5IM51 1XF0A 1JQXA 2W6RA 1XIHA 2R1LA 2OVLA 4JTHA 1K77A 3ABSA 3HGJA 3T0BA 5F4XA 3V1HA 1T7LA 2C13A 2BDQA 3W7QA 4O54A 1R38A 3R6IA 1ZPTA 5CQ1A 2D2JA 4EANA 1BG9A 3TW9A 4O1BA 2HISA 2ZTKA 2DVTA 4UBPC 2Z4GA 4ZB5A 3OG3A 5KMYA 2A3EA 4GGBA 3PTKA 2W92A 1CGWA 3OP2A 5H2ZA 2YZ5A 1EIXA 2C6QA 3H2NA 5FSEC 4O8RA 2V5KA 3EEGA 3VTRA 1A53A 2BHYA 3C2FA 4EPBC 3QY7A 4GQBA 5DO8A 2FTWA 4DPPA 1EUNA 2OFJA 3KBMA 4QEEA 5IOBA 4ZEPA 1DQWA 2VFFA 1TFVA 2YLLA 2XH4A 1VBJA 1CB7B 3O6CA 3JZUA 5IRPA 1OX4A 5C7VA 2BGQA 5G1MA 3DFYA 1E40A 3GU2A 2CBUA 2J27A 4JN6A 4DXXA 2V3FA 3UJ2A 3WX7A 3LM7A 4JD4A 1LORA 3PTDA 2HDJA 2GDVA 3B0VC 2HK0A 3VIPA 3PM6A 4UTFA 3NL5A 1HO4A 4ONVA 1K9EA 4PR4A 3VGHA 3SY8A 1LWIA 3L0GA 5FEZA 2WJDA 3WJZA 4KWWA 1UPPA 4I7WA 3L4VA 6A3HA 4QDWA 2E9MA 4NUWA 1QW9A 3EAUA 1B0IA 1YTEA 4CCDA 2E5BA 3G22A 2ACSA 3F4NA 1WDDA 2IXUA 3RM4A 2PWEA 3LM3A 7ODCA 3IIVA 2DZBA 3QPZA 2NW0A 4XO6A 3T78A 4GI8A 4XD5A 4KBXA 2DU2A 4C6JA 4GVGA 2WBKA 5TIMA 3G1SA 1ZALA 3V0TA 1UKSA 1DOSA 1X6NA 1P0BA 3LCFA 4ZE4A 3LTYA 4FEZA 4LF1A 4UNIA 3BLDA 1TTPA 1TZZA 1PBGA 3OA3A 4GYKA 2FFIA 3A21A 3QH2A 3NYDA 1TKKA 3NQMA 1GOXA 4QSFA 1JQVA 2W3ZA 5H8MA 3W2JA 1UR8A 1LQAA 3NDOA 1J96A 1EOMA 2IQ0A 3ZOAA 2PDMA 1UWAA 1KBIA 3KP0A 5I06A 4JTLA 1TWWA 3VXGA 4Q33A 5AHMA 4ES4A 3LDVA 4GD0A 1E51A 9CGTA 3FAWA 1JCLA 1OF6A 3GVRA 3WZ0E 1X8FA 1DWFM 4K37A 4PUKA 1AD4A 1E9IA 3TZNA 7ENLA 1EGMA 4IQJA 4S2BA 3BLPX 3LRKA 3AI0A 3BDKA 2A79A 5LGXA 4A8LA 3EMQA 1TA3A 4X0NA 4UR9A 1LUCA 1JCTA 1W2PA 2YDAA 3V36A 4KIEA 4F2TA 3BURA 3TTOA 1KXQA 3UXIA 5LIYX 3VD5A 1RXOB 5ABGA 4IJBA 3P60A 3O0FA 5CPLA 2CXEA 2Z2BA 2XSXA 3V35A 3WBWA 3ONBA 4Z1CA 4UZUA 3ZO9A 2QPXA 3LI1A 4LUTA 3AIRA 2C18A 4ORMA 5H1WA 2WMKA 3DFNA 1GVOA 1PO9A 1EO7A 1B54A 3MUY1 1QJWA 1XIIA 5M17A 1A3XA 1Q5MA 5DT5A 2OODA 4LX4A 4KGJA 5HNRA 1M7XA 1OHLA 3QV8A 3CC1A 2YR1A 3W7NA 4MMWA 1Y65A 1TA3B 4U10A 3ZSTA 5LNUA 1TTJA 2ACUA 5G1YA 3W2MA 3RITA 3VO0A 1MW0A 1EJTC 3KLKA 5I03A 3LGDA 3NPWA 1ZQ5A 1TWSA 1NDYA 6ALDA 1UQYA 3RO6A 2PF8A 3O6DA 3M0LA 1QNPA 1FBAA 1MYRA 1OCBA 1AD1A 1SFJA 4LUJA 3MI6A 3PUDA 1QNOA 3VA8A 2VZUA 4C6BA 1JD9A 1UD8A 2PDCA 4ZZ9A 2QKFA 4YIWA 3SCSA 3WDPP 3STEA 2A1YA 4HTBA 5AFDA 4JTAA 4PBGA 4TX9A 3RDKA 2YL6A 1UIPA 3T09A 3A47A 3K30A 3CL6A 2QZRA 4XV0A 3GC5A 3GYCA 3E2RA 7REQA 1KR0A 3M0ZA 2V6AA 1WBHA 3A4WA 2WJFA 3AIEA 1RAKA 1FCBA 2HV5A 2DY3A 3DFQA 1GTHA 4KEVA 1BF2A 1EJVC 3DYPA 4MUZA 4DO6A 3CXOA 3UU0A 5H6HA 1RJRA 5C0QA 4ILSA 2OEKA 3ABXA 3KXQA 4UMCA 1WXJA 2V3EA 2XIOA 3A4XA 3KBWA 1BKHA 3PB0A 3WLKX 1EDTA 1A50A 1L0PA 2JFEX 1KRMA 1MRAA 2PLKA 2WC3A 2FGBA 1ODUA 4YCPA 3LQGA 2FZNA 3EYPA 1GVIA 3VK5A 1XC6A 1YHTA 2ZE0A 3OB8A 1U1HA 4UTLA 3S1UA 4I5UA 1GG0A 2PDWA 5F1UA 1OFQA 3TKFA 1ML1A 1P1MA 4EIVA 1QXLA 2WMGA 3PTMA 4U5IA 4P7OA 4IPIA 2QCLA 2FFCA 1ZS2A 1TCMA 1U30A 4FX7A 4C91A 2AGTA 5F2LA 3NQCA 3WLPA 4GKLA 4Q6XA 3W01A 1B3OA 4CEXC 1EA9C 3LBOA 2WC4A 3FX4A 4IXXA 3M46A 1VPXA 1T8QA 3QMTA 3CTLA 4PMVA 1TYGA 2QUVA 1KM1A 1BXCA 4XB3A 4MZ1A 1RVKA 2W0UA 4K68A 1K8CA 3B3DA 5ABTA 3L23A 4O19A 1SGJA 4S3GA 4FA3A 1O94A 1V3IA 4HNUA 3WLMA 1F9CA 3W7CA 4WHBA 4NYYA 2WZEA 5D8ZA 2BOGX 4PMYA 1UWRA 1KBJA 5GJMA 1BYDA 2Y7FA 4GK8A 5BXRA 1XS2A 5J04A 3SN0A 2DZUA 1XSJA 3B8IA 3CUJA 1V3HA 4YWSA 1E0VA 3WF3A 5DF0A 3HFYA 4CD7A 3AXKA 3FJLA 4LXFA 4XVDA 2ZYFA 2GUUA 4DJDC 3MC5A 1VRDA 1A5OC 3ARRA 1UWSA 1E4IA 1H5VA 2H8ZA 1OFRA 1ZUAX 3VCCA 4ADTA 3SIMA 1W9VA 4ZQMA 1AA1B 2R9RA 5J5DA 1XLKA 4ATWA 2Z00A 2QV4A 3O2LA 5TF0A 1GW1A 2GDUA 2CLEA 1LLZA 1PTGA 1K1DA 2QIWA 3VNMA 1DIOA 1KRAC 2C1GA 3ARTA 4G7EB 1UJQA 3CUHA 1XIBA 3URBA 1XLMA 3AMGA 2BY1A 3KFTA 5BCAA 1CXHA 3BH4A 4IT1A 1R7AA 5CPSA 3F4DA 5JIPA 3CAQA 3P93A 3OLGA 1HT6A 4UNKA 4OBSA 3I68A 3W00A 2XH0A 3M64A 1NIUA 1A5BA 3ARQA 4JTRA 2GZXA 2ISWA 2OT1A 5E9AA 1WDWA 4IL0A 2BVTA 1J0HA 3ITVA 1C29A 4M0XA 3BLIA 1Q65A 2GQ3A 1VYSX 4QX4A 3WDIA 2J13A 1HJUA 1VIZA 4M82A 2J9YA 5DCEA 1W91A 4MKSA 3UY8A 2DW7A 1HW6A 3UY7A 1EB3A 1NARA 3VOCA 5A6LA 4WUIA 4B9YA 4DBDA 1M03A 1AH3A 3L4TA 4GO9A 3TQVA 1S2CA 1K03A 4FNUA 2DQXA 3CZJA 2OZ3A 4JKLA 2CLIA 1PAMA 4GC4A 1YX1A 3QR3A 7CGTA 3T4CA 2YDQA 1A0CA 2XWEA 2WO5A 1NWSA 1TPEA 2RKXA 1W5PA 1JXKA 1O5RA 1PX3A 4O28A 4JNZA 3HOJA 3ITGA 1E4LA 3H24A 3UWUA 2AL2B 1HJQA 3VOIA 3E0FA 1IQ8A 1WB0A 3VIOA 3AALA 4UTTA 1JDDA 4E8GA 4GQGA 4ZQOA 3DKJA 1VEOA 1ONXA 3NQ6A 3VILA 4JTJA 2V2CA 1QK0A 4PTDA 2ZZ1A 1SQ7A 4DJED 1HQTA 1Y5XA 3MANA 1X6LA 4C6DA 4BY3A 4JFSA 4ERGA 1G69A 1P0DA 3KCLA 1BXBA 1ICPA 4I9TA 5AYIA 3NQBA 5LA1A 1YEYA 4P8WA 1OYCA 2OQLA 2PE4A 1DVJA 2WNZA 4JQ2A 1OZMA 3B0XA 2PGWA 5I3GA 3LSBA 3WYZA 4ACZA 5KZMA 1EOKA 2VYOA 4S3KA 1EEXA 1B1YA 5JIWA 4AEOA 1U5VA 2WM0A 3K2GA 4GXMA 2RFGA 4NJKA 2VGGA 3WL1A 3AZRA 1H41A 1I75A 3W72A 1W8SA 2TYSA 4GUFA 2ZXBA 4ZR8A 4RX0A 2WBGA 2B7QA 3OO2A 4KETA 1WDPA 2X05A 1TUFA 3BZJA 1EJRC 2NUWA 1VP5A 5EYWA 5HMEA 3TR9A 3TN6A 5CPNA 1IE7C 1V79A 4D6HA 1W37A 3GE7A 4HN4A 3UWQA 1HN1A 5AYZA 3GIQA 3RX4A 4HZ6A 5K9DA 4LV4A 1FWWA 1DXIA 4GO8A 3MUZ1 2CESA 2V38A 2QCMA 2P0OA 3THAA 4Z1BA 2I5IA 4QG8A 3FNDA 1XLAA 1KFEA 3A24A 1W17A 3T81A 3CB3A 4GQRA 3D6NA 1ITXA 3GDTA 2OOGA 3VNJA 3KVLA 1PX4A 3NQ7A 4HA3A 2V5JA 2YCJA 3UWZA 1GOKA 4G7FA 2FZ9A 1H60A 1YQ2A 5HBFA 1WQ5A 1WZAA 4H19A 4X9SA 4I90A 4UQBA 3LERA 4LY8A 1MZRA 4CU8A 1GVFA 4AX7A 5CKSA 4WDXA 3NZ1A 2TSYA 3C0LA 3AIBA 4HU3A 3DH7A 5DX7A 1I60A 3NQVA 3POCA 1ICSA 4EX4A 4FNRA 2NWSA 5REQA 4GZ7A 4B9ZA 5DXYA 1FWJC 2E09A 2JK2A 2CCRA 3LLDA 4PODA 4KF1A 1PXGA 3QLDA 4NASA 4LNCA 1OT1A 4ZSUA 3T4WA 1C7TA 4IPJA 4NNAA 4DWDA 2DZXA 2R14A 4FF7A 1V6XA 3I7SA 3W53A 3PZGA 3B8SA 4WIWA 2R91A 1NOWA 1KWKA 3TZFA 2H9AB 1TTQA 1H7RA 1IGWA 1PS9A 1J12A 5K9XA 4WK9A 2QJMA 3PZ9A 5BROA 3VD3A 4IQDA 3KLLA 4MWAC 3A13A 4WCJA 3R7MA 4BWLA 1QOXA 1HZYA 5AYXA 1BXNA 3URNA 1LBMA 1XCFA 4LOCA 3SADA 3GIYA 2RH9A 1WKYA 3G6LA 3NO3A 2EPNA 1RSCA 3MUCA 3PANA 4A6GA 3SB0A 4J7RA 4NAFB 1H63A 3ES8A 3UJRA 3AWNA 2CERA 4R7WA 3GG8A 1PTDA 1RCOB 2NQJA 3N19B 3VOJA 1ZP4A 3ZR4A 4JGDA 1AUSL 3PZOA 1W1VA 5XIMA 2WPBA 5TQLA 1JZ3A 2J47A 2RAGA 2P1FA 4W87A 2ZICA 4EK7A 4LW7A 2CYGA 1AQMA 1X1NA 2J6XA 4JNMA 3KWXA 1PIGA 4AW7A 4HD5A 4RXGA 3LNPA 4B92A 3SGZA 1D3CA 2WAGA 1P4CA 1VYPX 2WHMA 3EB3A 3N29A 3TONA 4C6PA 3A12A 1KFCA 1W1PA 4Z2JA 4M6PA 4HNVA 1TV7A 3ZR5A 5G2HA 5HWMA 3RN6A 1O6IA 1YTDA 2WM1A 4ALDA 3LHYA 3QMSA 1Q7MA 4KEMA 3N2OA 4GYFA 2CLLA 3GXIA 2AQVA 1GZJA 2ZDSA 1GG1A 1OB0A 5DMNA 5G1TA 1DE5A 2VGIA 1MZHA 1VFTA 4KQNA 4H3DA 1QMLA 3T6CA 5BOEA 3CIXA 4PRRA 4JKKA 3IVSA 3LA4A 2BLEA 2G50A 3GHRA 3GXPA 3NSXA 3CNYA 5FF3A 3HPXA 1P0NA 4A29A 2V5CA 1VZWA 1VFSA 3WK1A 3N25A 3EB4A 1OABA 4M5PA 1W1IE 1E6PA 4WXZA 3LCXA 1J8VA 3ZLGA 4LQ1A 4TO8A 2C7FA 1E3ZA 1HO1A 2I14A 4LGXA 4MJZA 4H41A 3AJXA 4MB4A 1EFZA 4NRSA 2AMXA 4AVFA 4GIRA 3VC5A 1Q2SA 1SZFA 3CYJA 4KMQA 3L7RA 1H0GA 4AIBA 2PTDA 4LAKA 4NSBA 4LVDA 4V27A 2GQ8A 1XICA 2INEA 3SM0A 1G0CA 1OK4A 3U6WA 1I4NA 3S2LA 5C9WA 3UETA 3VMOA 3KRUA 5GPRA 1ME7A 3SGUA 1FKWA 1MW3A 3U4FA 3QW3A 3PZTA 1NP0A 1H62A 5JXQA 3L68A 2FVMA 1LF1A 3LXBA 3SBFA 4D71A 3UGVA 4XKMA 2Z2AA 3VD7A 3ZFHA 3H70A 1P0EA 4XQ6A 3CYVA 1UR3M 1ADOA 4NJHA 5HPOA 2YCLA 2WVSA 2PAJA 1EIBA 1R7OA 2QR6A 2PTWA 2OEJA 4DYKA 1VBHA 1VHNA 2V81A 3SQMA 4BQ3A 4GZIA 1U5HA 1BWVA 2CZDA 3QV6A 4DZAA 1KXVA 1OC5A 5FCZA 1W31A 3TR2A 1RK6A 3VNIA 3NCOA 4KCVA 5LXEA 2CNCA 3HA1A 3ZJ7A 1KTCA 3NDYA 3WNMA 1SW3A 2A7PA 4AFYA 1RLCL 3U7BA 3UJSA 3W85A 4DHGA 3NYZA 2D0HA 5HUPA 1XRSA 1E73M 3WK3A 1C9DA 4H7ZA 1NWTA 3W2LA 1HKMA 2VZTA 4TVUA 2ODOA 1A80A 5AHNA 5I3IA 3M7WA 5DBTA 1S2WA 3OIXA 2Z7KA 2IQDA 2PC8A 1BGAA 4KCWA 3CHCA 2O9RA 4PB3A 2W91A 5T91A 4C7FA 2Y61A 3TROA 4DO4A 2VC5A 3D46A 4M24A 1V3LA 5CPOA 2W5FA 3M16A 3LCGA 2JQXA 3ELFA 5JUVA 5G4WA 3TWAA 1FP9A 1NP2A 3UWVA 2ABAA 3V5FA 1V0NA 4GI4A 5FA5A 1RA5A 4WEVX 4W86A 3UCDA 4S3JA 3MY9A 1J2BA 1RQEA 3UW6A 2IPGA 3UCQA 1H50A 4KEUA 3PB2A 3T0AA 2XIIA 3H2EA 3W02A 3T9PA 4A8RA 2E5DA 3O9NA 1FWTA 3W74A 1RR2A 3BOXA 5C9UA 3T2OA 4QIUA 4OV4A 2BTMA 2XZ7A 5CLWA 1G9HA 3DHDA 4G9PA 3FSUA 3VOHA 4GI6A 3MPGA 4JIEA 2GUYA 1YLVA 2VCBA 4D6JA 3IPWA 5GNZA 1G4SA 3FGCA 1V6UA 1WAUA 2YPIA 5IFTA 1MRQA 1R47A 3CAKA 2WOQA 3LSCA 3TEVA 3DI0A 1DWJM 5F1VA 3LPFA 3QQ1A 4LAMA 5CZJA 1MQQA 2REQB 3R4IA 3D47A 1K9FA 4YJ5A 3R10A 4O53A 2YIHA 3OOQA 1P6BA 4BEUA 2PP1A 4C6NA 4HNLA 4PCFA 3TXVA 4C5YA 2YKKA 3SCWA 1LG2A 1Q6EA 1IZKA 4C6OA 3PNUA 4PCNA 3MMWA 4HTYA 4UMAA 4K7VA 1P5BA 3GU9A 4DJDA 4M7TA 5BRQA 4MUPA 3LXAA 4MNMA 4WXYA 1K3UA 4REQB 4HPJA 3W37A 2O56A 3BOFA 3W2UA 1MDRA 4W7VA 3RNDA 2QCEA 1MI3A 1FHUA 3S1VA 1IXNA 1B2YA 4CCEA 3VZYA 1TJRA 1UASA 4AD3A 3GK0A 2PDBA 2PDLA 3CWNA 3O8AA 4YVXA 4DJFA 3NUKA 1UA7A 3E0IA 1Y5WA 3NQ2A 3S2JA 4WVXA 4HMEA 1XM3A 5HQEA 3LCIA 3MHGA 3SJNA 3UVAA 1ICQA 4XBKA 2BHZA 5ENLA 4K1WA 4IP7A 5LXXA 1QNVA 3OPSA 2WVVA 4E2BA 2VX4A 4YXGA 4H9XA 4WZHA 4MNKA 5JBEA 1KR1A 1S5MA 1A5SA 2O0TA 2ZXDA 4GNVA 4X2RA 3C0JA 3O05A 3LTSA 5E70A 5LNSA 4W88A 4O1DA 3TJLA 3ORWA 2GSJA 4EPKA 3NZGA 2Y8KA 3MKVA 1A5CA 1F6KA 3V5OA 3GDKA 1TQJA 3FN9A 1G94A 2XINA 1BQCA 3T2PA 2VFEA 3VDAA 2J7FA 1CLVA 2GDQA 3OLEA 2GJNA 2J9XA 1F8MA 4TVCA 1Z42A 2GVLA 1XLHA 4AWUA 4QJ5B 3B40A 4RNHA 3L65A 3O06A 2GWNA 4JIHA 5F2GA 1YYAA 5M2FX 1S5WA 1E0TA 1R3RA 1QFEA 2ATMA 4MGGA 4FHAA 5FSDC 4QE4A 1B3ZA 3BGGA 4YTUA 2PA6A 4PUMA 2ZFAA 1EQCA 2A7NA 4DLFA 4YU1A 1EHNA 1VH7A 3E5BA 3N2BA 2YGYA 4E5TA 4TX8A 2NXIA 3CH9A 3AIUA 1EQPA 5I02A 7TAAA 4MY9A 1IGSA 4B2DD 2YDRA 1J18A 4HCLA 1X6UA 5KEZA 3ENLA 4Q3MA 3KL5A 4HZ8A 4XBSA 3FA5A 2Z1XA 3B06A 4IUOA 1KFJA 4QSHA 2DZPA 1ZJAA 2XG9A 3TYZA 1MEHA 4A2RA 5C8BB 3U8GA 1J0YA 3WMBA 1EC8A 3CO8A 4V15A 3MMTA 2DIEA 5C54A 3BL3A 1ZAIA 3PULA 4WDTA 5GJPA 3SN1A 4S3DA 4C60A 4DAFA 4ROPA 4DVOA 2ZXQA 3TU9A 3MHFA 3PZVA 2AMGA 4JTSA 1FWHC 1XYZA 2NQ5A 4F9JA 4UTWC 4BQ5A 1GQNA 1HVQA 3CZ8A 3R94A 1R6WA 3EPOA 1C93A 2HBXA 4I6KA 4K36A 1BD0A 1G4PA 2IS7A 2X40A 3K8MA 3KOZA 4H6KA 4H6QA 1FKXA 5CJ5A 5FEXA 2CZEA 1VCGA 3T8LA 3QJAA 3GDLA 3RMEA 3I3BA 1SSGA 4PTNA 4Y7EA 3LQLA 2XFYA 2MANA 1JCYA 1FOBA 3DN5A 1ZSXA 3EOOA 5I3DA 1C90A 4QHRA 1JAKA 2Q8XA 2WPGA 4LYRA 4AY1A 4MB3A 4B3KA 5CC5A 1W8GA 4OE7A 5EMJA 4S3BA 2G4FA 1W3TA 4LS0A 3N17A 4XD4A 3TK7A 3IGUA 1JRCA 1EJWC 1G5AA 3CEPA 3B8DA 2A6LA 2BVYA 4M6QA 4INFA 2WV8A 1W3KA 1XBVA 3N1AA 4CQAA 1XBYA 3WLQA 1ZZMA 3PVFA 1E6SM 4DN1A 3GDMA 1GVYA 3NTYA 2G3FA 1AODA 2ZZ5A 4JCMA 2O9TA 3NQGA 5HDRA 2AAMA 3THUA 4JN8A 3UZJA 3OIHA 1KO0A 4OT7A 3C86A 1XH2A 1UR9A 2D22A 2R6OA 4Q4RA 6TAAA 2HS6A 5ECUA 3LLXA 4WSJA 3KBJA 5U4NA 4PL2A 1UYQA 2FLIA 4Q8OA 3FCPA 4JICA 1XGDA 2VUYA 3GYEA 5HJYA 1NFBA 5LNWA 4OUIA 2GVYA 2P53A 4DM1A 4J27A 3WQ6A 2YXXA 1Q4WA 1IEIA 2WVTA 2BP1A 2D73A 3GAKA 1UW9A 2RJHA 3L21A 4W8BA 4ZOAA 4U3CA 2EQDA 2Q6ZA 2XU2A 2BASA 3GAYA 3PSWA 4GMEA 4QNWA 2UZ9A 2AKZA 2OELA 2FH8A 4TX6A 3KZSA 4GLEA 3RJYA 3PWGA 1ELSA 1I2OA 4D6DA 1N8FA 2ZRZA 3NM1A 3T05A 1EP2A 1QBBA 8TIMA 2QJGA 4DWSB 1DQXA 4ZCWA 1UWTA 3MZNA 5D04C 5A6JA 5K3VA 3A3HA 3G1YA 3CUZA 1A3HA 4HMDA 3GDRA 4A35A 5KITA 3HFTA 3W1QA 3A23A 2DEPA 2DGAA 1XGEA 3VDHA 3FIGA 4WF7A 1PIIA 1AJ2A 2GWGA 4O12A 4LYPA 4GJJA 2YB4A 4IFKA 5M3WA 2A3AA 4KWOA 1S3HA 2O7SA 4MKNA 3AXXA 3E6EA 3M0IA 3DC8A 3PPFA 4M29A 5DEZA 4CU6A 4DJEC 3ZLFA 3MHUA 3WD4A 1OINA 4BF7A 4QNEA 3USZA 3MU7A 4FO4A 3QKZA 1T8XA 2QPUA 3LRLA 3WDRA 1KM4A 3DHPA 3ERPA 1ISZA 4IHCA 1UR1A 2D20A 3CL8A 3BLEA 1EJUC 2ZRXA 3TVAA 2WW5A 5LIKX 3PAOA 1LWHA 4WD0A 3WF1A 3FXGA 2FB3A 3NQFA 4MB1A 3IJDA 4HPXA 2O9PA 3V0UA 4W93A 2BS9A 4L1GA 3D5HA 1UUMA 3ZT7A 1REQB 1TPUA 2P3EA 1E55A 3WO8A 3HM7A 3N6HA 3PN8A 2CLMA 2EBNA 3EKZA 4ZO7A 4ZXOA 1M6JA 4NI3A 3GO2A 4NP7A 4JL1A 4H7VA 3GRIA 3LHTA 6ENLA 4EWJA 2PBOA 1QOPA 5A8MA 1PE1A 2XVGA 3MQTA 3LLFA 4HN8A 4KFPA 4PEEA 2VFGA 1W3IA 2HQAA 3GQYA 1TPDA 2IXVA 3WLLA 2ZDRA 3O63A 4TV6A 1YBQB 4ZQNA 5LSMA 1JRBA 4JEQA 5I23A 3EA1A 1BYCA 3WFAA 5BOOA 5IXEA 2E8ZA 4JTKA 4YNGA 4GUHA 4Y90A 1EWEA 2A3BA 3U4AA 4KRZA 4UOJA 5LIUX 2O4MA 1DQUA 1YPIA 3S6TA 4EE9A 3QGKC 2BGNE 1KCLA 1PSCA 4RDVA 3VKBA 5HMFA 2C91A 5D37A 3EX2A 5AY7A 4E8DA 4AF0A 2PWHA 2OWCA 4QTGA 1SZRA 2FGLA 3BMWA 3AC0A 1BPLB 4LANA 4B3LA 1B4EA 3FS2A 4Q8QA 3DGBA 1LL7A 3EWXA 3M44A 4Q8NA 1X1OA 1T6MA 3WF0A 1KRBC 4J3SA 4LFYA 2XM2A 4OZOA 2OCZA 3MV01 1ISXA 3W24A 4C6CA 4NXSA 1X98A 1POKA 3WH9A 4U3AA 1XW8A 4U33A 2E9LA 2VRJA 1M53A 4JTFA 2YYUA 4UOZA 5FESA 4JFVA 2XUCA 1IWPA 1R2RA 1JUKA 3C8FA 3QC0A 3V4BA 1F76A 3QZ6A 4LBUA 1VFOA 2KZHA 3G1RA 4L1XA 5E0FA 1QPOA 3U5UA 1Z89A 4XAFA 3SCUA 4PBFA 4QE1A 1BTMA 3C3NA 4TU1A 3PY2A 4UMBA 3QTGA 4YVPA 4O16A 4P7NA 1OCJA 3LY0A 1TPFA 4M81A 5CZTA 1IR2A 1ZAHA 4M56A 4NX0A 3I4EA 2X1RA 5C2GA 3E0LA 4QS6A 2I17A 2R1PA 2NSXA 3CASA 3TTYA 2YBVA 3N2CA 1BWKA 3R43A 1BRLB 2NQLA 2LLEA 4R7JA 2VVNA 4HKPA 4W4QA 1XIFA 1YDOA 4F66A 4I7VA 3CHDA 1VEMA 4AZGA 4OWGA 4KKXA 3QY8A 5KINA 3W86A 1OFAA 2Q3OA 1WCGA 3L5MA 1XKYA 4JHOA 2QVHA 4S39A 1IWAA 4DRSA 4FK9A 3VGBA 3UJEA 2J24A 2CFFA 3ZYZA 3ID7A 3EA2A 3KBSA 2WKLA 2J8GA 2PWDA 3W2KA 3DERA 2D24A 3H54A 3K46A 3H12A 4GPNA 4ERIA 1RK5A 1W3HA 3ALFA 4OIFA 4Z08A 1A47A 1Q85A 1MUMA 3IAQA 4O0KA 1XIJA 1KTNA 4GY7A 2QPSA 1OX4B 2FMNA 3WD2A 5HAOA 1JF5A 3MVIA 3PBYA 4JFTA 3GR8A 2BVDA 2CIPA 3RR1A 4F48A 1QW8A 1L8PA 3ITXA 2ZE3A 5CXPA 4AZIA 1SZEA 1Q3NA 4AYGA 5EL1A 1VFHA 4OQVA 4H1ZA 4GA8A 3V0SA 1TO3A 4AHPA 2O4QA 1RALA 3Q2DA 1CLXA 4Q8VA 4NZ3A 3MO7A 3WUFA 2CKRA 3NGFA 1NEYA 4BCEA 1S1PA 1BVZA 2WC7A 3B9NA 4WY0F 4Q4MA 2BVWA 4AXKA 1KKRA 2EJAA 4IMDA 3KOXA 3DYMA 4EXQA 3BANA 4Z2GA 2CLOA 5C7HA 1XLJA 3SQLA 4HJWA 1GPFA 1EF3A 4HHHA 3HF3A 2VFHA 2BBFA 1DJNA 3OLIA 3U3HA 5BRPA 5F2MA 3GD6A 3WK0A 5DY2A 3CZLA 4PMJA 1KBKA 3SGGA 2G95A 3N14A 4NY2A 1E15A 3EMCA 1EX5A 4TXEA 1FXQA 4PRWA 1GHSA 3VIFA 2X7WA 4XSMA 4B5NA 4NJIA 2FYMA 4AC7C 4IIEA 3H2CA 2QCCA 4MSSA 1QUMA 3NXFA 3TFCA 3TW6A 1OC7A 5D09A 4QDPA 4U5KA 3U2EA 3N2XA 3STFA 2AQOA 3G77A 3FOKA 1TWIA 4FB7A 5ABFA 1PTAA 3UZWA 3H2MA 2Y24A 5LA0A 3PZIA 1D9EA 2Z0IA 1MXSA 4CQBA 1TJ0A 5J5RA 3QV7A 2ESCA 3N13A 1NTHA 1SO6A 3SCTA 2DIJA 3MBFA 1UWQA 1XG4A 3LZ3A 2YCKX 3DI1A 5CJNA 1HJWA 1N8WA 4J3UA 4DPQA 1JCNA 3FY1A 1YXCA 1JNDA 4GY0A 3TN3A 4R3UA 4CVUA 2O92A 4ACYA 4RDWA 2DQWA 3ZVHB 1L6SA 3MA8A 2NV1A 3MZ2A 4TV5A 2NLYA 1VYRA 3WLIA 1AW1A 4GH3A 4S1FA 3T8QA 4E4PA 3G5EA 5E0CA 3Q45A 3U57A 4KPLA 3CLMA 3W7EA 1FWEC 3KL0A 2QMKA 4ZMGA 3VE7A 4JY9A 3WLOA 3O16A 1QI0A 3O6YX 3M0KA 1US2A 1KBBA 4XUGA 3RPTA 3UR2A 5HK4A 3NFUA 4S23A 1HKKA 3L2LA 2P88A 3I10A 2PDQA 1AW5A 3IAPA 4LVBA 1XDLA 2NLIA 4HP5A 3MT1A 2C0HA 4IGMA 4FX8A 1OIMA 2A3LA 3CS2A 2Z1VA 6XIMA 3IANA 2CHRA 2Y85A 3TN5A 1UG6A 4QQUA 5HJXA 1K7EA 2PU0A 4X9YA 1H0IA 2CU0A 2WZTA 3BICA 1UOKA 3FEQA 1N8IA 2VXNA 4YVVA 1IXOA 1XCXA 2DW6A 5FF4A 3W73A 2V3DA 1NDZA 4EKJA 3RRAA 2G41A 5F4WA 2UWFA 4QAWA 2PCEA 1V6YA 1HJVA 5D2YA 1V7YA 1OIFA 4JQ3A 4OU1A 2QMJA 1G4TA 2REQA 4UQ9A 3TAOA 1PKLA 3CZKA 1CB2A 1WOAA 2ADAA 3N4EA 1LLOA 1SW0A 4YTSA 3MI2A 2DT2A 2XIBA 2DSUA 4DUXA 3ARWA 2FVLA 3LHVA 3B8TA 4A3YA 4GUIA 4HGXA 5LKYA 4BI5A 1H7WA 3RLUA 2PFHA 3WH6A 6REQA 3EB2A 1LZOA 3BCJA 1VRXA 4P7LA 2BFGA 3FJ4A 3W87A 5I2UA 3SUUA 4PFHA 2O55A 1JZ7A 2Y8VA 4XZIA 3HG5A 5I3HA 1JPHA 4OJYA 2Y1HA 9XIAA 5C9ZA 3CAVA 3M5ZA 3GVQA 1XKJA 2YZRA 4ZOCA 2WXDM 2Z1BA 2P76A 4X2PA 3M5VA 1AG1O 1I1XA 1A4MA 3A64A 3L2MA 3BAJA 2JE8A 3C6CA 3OHMB 1KB3A 2PP0A 1NQKA 4R34A 5CZ0A 5DXXA 5A6AA 1WA3A 1OX5A 1AQHA 1P1XA 1TELA 4GZEA 1VPYA 3WQ4A 7XIMA 4PMNA 2J8TA 2ZX8A 1NF7A 1NH6A 3BMXA 3HPAA 1UIOA 3WLHA 1TTIA 4B5WA 3UYCA 3DCPA 3B9AA 1V6VA 2GFTA 4PMQA 2VNCA 4C6EA 3OLDA 1N82A 4AD1A 3I6RA 3AIQA 5E6YA 1MUWA 1QWKA 4C6IA 4FAMA 1TJPA 2WZHA 3G8EA 2YL5A 2GJPA 2W67A 2GL5A 4L6HA 2QYGA 5MHBA 3PF3A 3VIIA 2QAPA 3ARUA 3AS1A 1WV2A 1B4KA 5JU6A 1R3QA 3W6MA 1J11A 4F0LA 4IIBA 3S1GA 3CMJA 4PMZA 1PCWA 3W1LA 1RJQA 3DGRA 2ISVA 3NO1A 4JY8A 3W1NA 1NVMA 4KERA 3QV9A 3I7QA 2OLSA 3UXLA 3ARYA 2FMOA 3FV9A 5DELA 3IJIA 4Z1DA 1OK6A 4N9CA 3KOFA 4CNTA 4C6LA 3KEHA 1DTNA 4FLRA 1V93A 4UTWA 1C9WA 1JEZA 4LBRA 2BWGA 5D9PA 2D23A 4ML9A 4CVWA 3W29A 4S3AA 1PZ0A 1EXPA 1UR2A 2CBJA 3APYA 2Z27A 4F0MA 4CCZA 1EJXC 3PBVA 3E2VA 3TSDA 3K8LA 4D6EA 4XVEA 1W1YA 3PHAA 1VJIA 3L4UA 1UUQA 3MTWA 4IICA 4GXPA 4RXFA 5FL0A 3SRFA 4Y9NA 1L8NA 1SMAA 4H4IA 4R5EA 2NQ9A 1GKPA 1K8YA 2I5GA 2VFIA 2F38A 3WFLA 4B2DA 1E9LA 1ZL1A 1EHAA 4FI4A 3THDA 9XIMA 1WUFA 5FF2A 5ABEA 1VBGA 2PLCA 3R0DA 3WLSA 1SO3A 4EF8A 5E9XA 3PJWA 5KSWA 4K8EA 1L2QA 2NT0A 1TE1A 3VMPA 5G4HC 4JOMA 3VMNA 2XFFA 3M6YA 3QQWA 2OPJA 3RILA 1QHZA 4GABA 2GYIA 4O1CA 3T40A 3JU2A 3F4CA 3IIZA 3HGRA 1OVDA 4S3CA 4KFOA 3BVJA 4FNTA 2G3JA 2PI6A 3IUHA 4WRHA 3WQDA 4X22A 1U33A 1LBFA 2G96A 2PEVA 4QGCA 2CITA 1C8QA 4EAYA 3PPCA 1PPIA 2G3MA 1OC6A 4GUJA 3I65A 3GH5A 2A85A 5FJUA 3REQB 4BHYA 2GJXA 3WBAA 3M0XA 1GZ1A 2DDXA 4YYCA 3ZJKA 3N34A 2OYKA 4L4OA 4ORIA 1O12A 4LTSA 2DUAA 1O5QA 2XN2A 3MV11 3ZMRA 3CO4A 1KLYA 1RPXA 2EG6A 2OU4A 5AC7A 1OFOA 5D32A 2XVKA 5M5DA 4DWSD 1UH4A 2HNEA 2XGBA 4IZGA 2X41A 1K02A 3ICJA 4DJDD 1PV8A 3LN3A 3OZOA 1YNYA 2OKTA 5HQMA 1N7KA 2VENA 1GONA 4LEFA 1OM0A 3WJXA 1KQYA 2C8NA 4NF7A 3HPSA 3LV5A 2JEQA 3D3AA 1O60A 2X1IA 3UP8A 1HKIA 1LRQA 1R85A 1YADA 2A0NA 3ZSSA 1HL8A 1XHGA 3MDUA 1H49A 4UQCA 3WBEA 5HANA 3TDFA 5I3JA 1TPWA 3JZEA 1DJYA 1FQ0A 5L6UA 2WSKA 1TVNA 4FX6M 1ZY9A 3HU7A 4FNPA 4NZJA 2WWDA 1OGSA 3N04A 1HG3A 4RW5A 3R0UA 1FFQA 4GINA 3WG6A 2DJXA 4HOXA 1H51A 1MEWA 2PODA 4OBTA 3SECA 4YL2A 3O1NA 4DBSA 4YHGA 4TMBA 2F2KA 3B05A 4YN5A 3UBPC 2E0PA 1K9DA 3VINA 1X96A 4OHQA 4C5ZA 4AZ6A 1FWRA 3M6DA 4DNMA 2VFDA 4KRUA 5HQLA 2J62A 1TSIA 4PBEA 1UMLA 4R53A 3LOTA 3BJSA 3NSMA 4DF1A 3T7VA 3H2OA 1WXZA 3PJUA 1LM1A 3L12A 1V3MA 3F5JA 3SDOA 4FXSA 1LQ0A 2Z6JA 3EKLA 3SR7A 3SN4A 1E6NA 2CPUA 3C4UA 1X1ZA 4XAPA 2IQTA 2HXUA 1UH2A 2DP3A 1CXIA 3EWBX 4JTCA 4MWAB 2XH2A 5EKYA 3EWWA 4OV9A 1IEQA 3W7RA 2QAFA 3F4WA 4IG2B 1IYXA 5D05A 2QCDA 1F3XA 4GNJA 4FALA 1PL9A 4KWUA 2GSEA 4RV3A 5AB3A 4LCSA 1A5MC 4K38A 1AH0A 1DIEA 3GUWA 4I8YA 3PG9A 4NNCA 1GUVA 3TSBA 3WMLA 4C6QA 3THCA 4AIOA 4HT3A 1E6ZA 3G0SA 4EPEC 3CMFA 3KTXA 1OJXA 1F6PA 4EXAA 3BAKA 4Q6JA 4Y9OA 4Y8EA 2HK1A 1GK8A 5A95A 4GGHA 3OGRA 3GY1A 1V8EA 4PULA 3A9IA 3LCHA 3HPZA 9RUBA 1TWDA 4AVNA 1KCXA 2ISDA 4NJJA 1UC4A 4XD6A 3LEPA 3NZPA 3DBPA 1KCKA 1OD0A 4QITA 3CGTA 3PP7A 3WMSA 5TBOA 4FZIA 4U2ZA 3SRHA 1I2QA 1YDNA 2BOEX 3VIKA 1W2VA 2DZWA 2CHOA 3VCRA 1GKQA 3IWPA 4RNFA 2NVDA 3UPBA 1W3NA 4IX2A 2WKGA 1OZQA 1NFGA 2OTDA 1WZKA 5HULA 5LZLA 2BMBA 4OOUA 4JDYA 1M1BA 4CNOA 1GORA 1UHVA 1Q7QA 3F1QA 3ARVA 3CQHA 3SURA 1DIKA 5CC7A 2Z25A 3IIPA 5D2WA 1THFD 4O8AA 3B0UX 2CC0A 4B5VA 3G6MA 1RD6A 4UNLA 5CC3A 4J3XA 2Y7EA 3LTPA 4XKYB 4Q22A 2PPGA 3UG4A 4RPQA 4C90A 3NWRA 3UZXA 4PCPA 4BJHA 3WD0A 3EMZA 1X7IA 1E9YB 2PUZA 3DENA 2J78A 1V3JA 5FKYA 3WQ8A 4BI7A 1J5TA 2QW5A 1K6AA 2ZRWA 3PG8A 4GJ1A 4LB4A 3USBA 4ZB2A 2PTZA 3I7RA 1EPVA 4KFNA 4HQVA 3K13A 1C8YA 1NSJA 3QFEA 5A69A 5CBJA 1YIXA 3NR0A 2WHLA 3MP3A 1M68A 3TMQA 4MJMA 4GYPC 3S6DA 4O1AA 3FHAA 4EF9A 2PLMA 3KE0A 3NZRA 2XGIA 4M6UA 3B97A 3VX1A 4RK8A 4UC5A 4HJFA 1V02A 3PC0A 1X8CA 3OGSA 4IJCA 1TMHA 4G6CA 3U7VA 3D0CA 4PMRA 2DUXA 3SY1A 1PEZA 3UT0A 3PPHA 3GNPA 3BTNA 1IR1A 1ME9A 2YL9A 1HL9A 3ZLHA 1A0DA 2X42A 3H2AA 1RD5A 1IZJA 5T26A 2ZVIA 1UZHA 3C3UA 4I3GA 3W1TA 5CGQA 3WCZA 4B90A 3N18A 2IKGA 4EACA 1SPQA 3N4AA 4I6VA 5D33A 5DLCA 2ZUUA 3VKJA 2RUSA 3GLCA 3L4XA 3T0CA 4F0HA 4UQDA 5A1AA 3PPGA 2PCQA 2J77A 3MSGA 1YKWA 5RUBA 4Z0SA 1HUVA 4QCEA 1KV5A 3FJ6A 4J2MA 3W7PA 3VX0A 4MPKA 3AROA 2Z1SA 1XLCA 4E6MA 5T8GA 2VD8A 4FOUA 4RW3A 2I5QA 4HPGA 4PC8A 3AICA 1M7OA 2EHHA 1W3JA 1UUOA 2QULA 3H21A 3WUGA 1MFVA 2ISSA 1VENA 1P7TB 3RG6A 3KCOA 3IJ6A 3RXZA 2FHFA 3T0DA 4MDPA 3TNBA 4B15A 2WSYA 3NA8A 3GNNA 4LEQA 4QLLA 3DFSA 2HNHA 4IF2A 2NUXA 2F2HA 1D8CA 5HMDA 1OCQA 3H4WA 2E25A 1K4HA 1SZNA 5CPTA 1FVPA 5CAKA 2J66A 4IUGA 1VHCA 1LP6A 1GWJA 3B8VA 4GYPA 2YBUA 3BV7A 1W9XA 4Y9AA 2PRMA 4NI8A 3BPWA 3AUOA 3S5SA 3VM5A 4I7UA 3HTWA 4IIDA 4O57A 5CZSA 1FH9A 3R0KA 3WL0A 4JXCA 4PCSA 3WBXA 3WH7A 4NXKA 5A6MA 2QF7A 1FX6A 1FWSA 3UXKA 1TZ9A 4K8HA 3AU2A 1V7AA 3DYOA 1R2TA 4B5SA 3Q58A 4IGHA 5TNVA 3UR7A 3CV1A 3G1AA 5GVJA 5AHLA 2VOTA 2J8FA 3B9EA 3RMJA 8CGTA 1SMDA 4G7EA 4GC3A 1QO5A 4JKMA 1GGOA 3TOYA 3QQ0A 3CV2A 3E74A 3MKKA 4BA0A 1W1TA 1NJJA 4LT9A 1DWIM 2WSRA 3WQ5A 4D2JA 1G7VA 1C92A 3KS6A 5BMXA 3L9CA 1O1ZA 3NZQA 2DSKA 3K4AA 5AOUA 1XLGA 3SUWA 3DU0A 2KAUC 4WDUA 2FH6A 3UZ5A 3Q4DA 2FPTA 4NZFA 3FSTA 1FRBA 1GEQA 3S46A 5A3HA 3SAZA 3RK8A 3WH8A 4DYEA 1F4AA 3FXYA 1XWYA 1AJZA 4J35A 1WP6A 4IG2A 1L6FA 3UJFA 4L6DA 1JVNA 1EC9A 2NVCA 4OBRA 2F9RA 4XZMX 1H09A 2CLFA 4J5NA 1T5AA 2IKHA 3S5ZA 1J6OA 4IMGA 3UYIA 1EJSC 2XGZA 3K1DA 1ZB5A 5D9NA 2EO7A 4DEFA 1A5LC 3ZJ6A 4FF5A 3RHGA 1LT8A 1W5QA 4AAJA 1XINA 3BG9A 4A8IA 3RYSA 4BF9A 3S3GA 1IIGA 5DANA 2X2YA 3OVRA 1M01A 1EC7A 5C5YA 2X7VA 1V5XA 2UBPC 4NAFA 3CLWA 1EYEA 4HIBA 1B5TA 1YXDA 1UOZA 3LBMA 5HR6A 3DG6A 3W1RA 7PTDA 4D1JA 2YBTA 4CN6A 3HPFA 4QROA 1M65A 1SU5A 3ZVIA 3LGGA 4X61A 4RDZA 1YPXA 3BLOA 1E9ZB 3GXNA 1JUEA 1ZBKA 5EY5A 3GTIA 4L80A 1F7BA 1DKWA 2OMAA 2YSWA 1UD6A 3L0KA 4YWIA 2ZWZA 2G3NA 3DFOA 5T9CE 3DIPA 1QI4A 4ZL1A 4XKYA 3F5KA 3CQ0A 4Q4SA 1KXTA 2GVGA 2A3CA 3IVTA 4Z2IA 2F6KA 2HE5A 4X3ZA 3E5PA 3S0CA 3DX5A 1JPKA 4AHQA 1M04A 1GYNA 1GT8A 2E4TA 3E3HA 1LOSA 1ZP3A 3VGGA 3P0WA 1I9CB 2YXGA 3FYYA 1GKRA 2B31A 3P82A 4M8UA 4WGXA 3KBNA 3TQPA 1ZJBA 3STGA 5I7GA 2YJQA 5I79A 3RLGA 1NOFA 4BR1A 1QI5A 3U5YA 2VM8A 3ZVHA 4ACZB 2BG5A 4O4WA 3BGJA 4IFKB 4JAWA 1S39A 4Q8TA 3F2DA 1B90A 1OYBA 1JFXA 3GHTA 2PDPA 1PIFA 1QWGA 3W7JA 4JCLA 4EP8C 4N4PA 1GVQA 4X63A 1FWBC 4JQ1A 1PZ3A 5ABHA 3UEQA 1H2JA 3QYSA 1EGZA 1DXFA 4CGTA 1SFLA 1SO5A 2ZOXA 4LYQA 2QIIA 3EEZA 3E0VA 4HYWA 5K7JA 1HTIA 2DH3A 2E9BA 3W83A 4JTTA 3K8KA 1XG3A 2VEFA 2IUZA 5HA7A 3NO5A 3LXCA 3C2YA 2ZUTA 1WNOA 2VL4A 1MNSA 5KTLA 4ADUA 5AC5A 5E6ZA 1K9TA 3RIKA 4XD3A 4FSAA 1Y5VA 2ACQA 1XLEA 2PDKA 4PSRA 5TAOA 4AG0A 4WR3A 1D3HA 2CWXA 1BKSA 3CPRA 4PE8A 1K8ZA 3SY5A 5KZ6A 3R5EA 1KM5A 2B81A 3W1AA 3HQ1A 2GQ9A 1RCXB 3CT2A 3APTA 1WXYA 5FJRA 3AIWA 3C61A 4PTWA 2W27A 5EMLA 4A8NA 2JEPA 4RV8A 3XIMA 4MJ2A 3DEQA 1EF2A 4C1NB 3QRHA 2FZBA 1KXHA 4MJ4A 5EB8A 1FHVA 1L6WA 2GJXB 2NX9A 1OGBA 2QEZA 3TSMA 3VAVA 3MO4A 3LNMA 3AS2A 3UPMA 4LCRA 3BLLA 4A4AA 3UG3A 4DB7A 1FWGC 3C5QA 2HROA 3EWYA 4DWSA 5FJPA 1UR0A 2HRWA 3EBVA 2VI0A 3OZYA 2W61A 3CT7A 3P6LA 4XWUA 1MNZA 3HIJA 3W70A 2PRHA 2YA0A 2VWSA 1VEPA 3VC6A 4AD0A 5C6MA 3FA3A 3SI9A 3BCDA 1SJDA 1V0KA 4QXIA 1BYAA 3AU6A 4YMZA 2PWFA 1DORA 4K1GA 1M9HA 3TTQA 1E0WA 1Q6GA 1B9ZA 1AVAA 1JZ5A 4ZO6A 2Y70A 1RP8A 4MOZA 5BW6A 5HNUA 1EH9A 1TV2A 1TUXA 2OX4A 2XJ7A 4ZTYA 3CIWA 1F6YA 3O07A 4HNOA 3P8JA 3GIPA 3P80A 4R85A 4HA1A 1EO5A 1L6GA 3SO7A 2I57A 1NY1A 3L4ZA 4BZYA 4L9YA 3RCMA 4NZ5A 1DBTA 3E38A 1QNRA 3IIOA 4H8HA 4HMCA 4G8TA 4HMNA 1W1A1 3H8AA 4NNBA 1QASA 2VQTA 3TJ4A 3P74A 1CT5A 3F2BA 5A6BA 5A2CA 4JTQA 4JL2A 3LRMA 2A7RA 1UBSA 4EPDC 3W1PA 1Z44A 2GPTA 4GFIA 1JZ6A 3BK0A 4J3TA 4R33A 4KEZA 3UZYA 2FHCA 4P5UA 1ME8A 4LRSA 2EG8A 5I24A 4MTVA 4MYAA 2VP8A 5GNYA 5D03A 3K4DA 4RUBA 1JCJA 1DHPA 3BJFA 4CKQA 1RVGA 4C7DA 2DH2A 2HCVA 3TXZA 3VIGA 3KWSA 3GNXA 3V75A 4UQAA 3IVUA 4US5D 1M3UA 4RPPA 3BJTA 3MBDA 4IL2A 4ZQPA 5CCZA 2ALRA 2J75A 3UERA 3VI2A 3N73A 4AF0B 3MJMA 3GTXA 1GOMA 5CZKA 3O3RA 3RGTA 4GY1A 4AD2A 3G0UA 2YX0A 2ZADA 3EPNA 1E56A 4R7OA 2EPKX 3WUBA 1P6CA 4JFUA 4DWSC 4M51A 5D9MA 5BZAA 1GQLA 1TG7A 1WDQA 3VD9A 1DL3A 1I0BA 1PKNA 3KZPA 2W66A 3H2FA 4PL1A 6CGTA 3TYAA 3GTHA 1XH0A 1XYLA 4HA0A 4MFEA 1OFPA 2VD9A 4PGLA 2I1OA 2Q01A 1T96A 2HS8A 4PMUA 3TJIA 4HNTA 3KRZA 3VDBA 2BODX 2B7PA 2Z26A 2J74A 3POHA 3GUGA 3F03K 1VJSA 4C1LA 2X16A 4FLOA 6XIAA 5D8WA 3AYVA 4NILA 4A3HA 4U28A 3H6OA 1VD6A 3R58A 3OTRA 1YPFA 2DZTA 1AMYA 2R1KA 4PN2A 5JBDA 1KRCC 1T99A 3FDKA 3WNOA 2ZZ3A 7REQB 3LUTA 2NXGA 3KVKA 4QP0A 4GJIA 3SRDA 1FDZA 1QR7A 4ADSA 3VNYA 1W9BM 2XWDA 3M47A 4LY4A 2NQHA 3BCFA