1V7AA

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords adenosine deaminase
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
total genus 143
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v7aA00
3URAA 2OQLA 1NFGA 1P6CA 4IGNA 2QS8A 2QVNA 2R1MA 4GZ7A 4IFOA 1FWJC 1BF6A 1EJVC 1UBPC 3DCPA 4RDZA 3MKVA 4XD6A 4M51A 3NQBA 4WVXA 1M7JA 2AQVA 4C6PA 4BKNA 2OOFA 1RA0A 2KAUC 4LCQA 1PSCA 4DNMA 4BJHA 1RK6A 2Z00A 4KF1A 4F0LA 1UMLA 3ICJA 3IV8A 4IFRA 4R7WA 1FWGC 1UIPA 4CEXC 5HMEA 4WHBA 1RJPA 4LH8A 4V1YA 4EPDC 1V77A 3UBPC 4CQCA 1RAKA 3MDWA 3HPAA 3T8LA 1QW7A 4GXWA 3OU8A 2PGRA 4H9VA 4OFCA 4UBPC 1KRBC 2GSEA 4XD3A 4CQBA 4KEZA 2I5GA 3IARA 4ICMA 4H01A 1YRRA 4QTGA 1XRTA 4IFKB 4HK7A 4GX9A 4KERA 3F2DA 4L6DA 2YZ5A 4KEUA 2R1LA 4GYFA 3LA4A 1PTAA 4C5ZA 3LSBA 3PNZA 3PNUA 1IE7C 4GOAA 1GKPA 3PBMA 1FWHC 4CEUC 1A5OC 4D8LA 1WXZA 1E9YB 3MPGA 1W1IE 3OVGA 4RDYA 1EJTC 1RK5A 4IG2B 4H9UA 2AQOA 4LAKA 2DVUA 4ZSUA 2ADAA 5CH9A 2XIOA 1GKRA 3KM8A 1NDZA 1FWFC 3ORWA 1EJWC 4RDWA 4XAYA 3WMLA 4KIRA 4H9MA 2HPMA 3URBA 3QGAC 3GU9A 3G77A 1A4LA 3TN5A 2IMRA 1YMYA 4H9XA 4HA0A 4DZHA 1EJXC 2EG6A 4C5YA 1EJRC 4XAZA 4RZBA 1ONWA 1J5SA 1QXLA 2W9MA 3WZ0E 3RHGA 3WYZA 3O0FA 2UZ9A 4IF2A 3QY6A 1M68A 2HQAA 3B0XA 5HMFA 2D2GA 4QROA 4C6MA 2QPXA 3GU1A 3IGHX 3UF9A 4C6CA 3S2NA 3S4TA 1P6BA 2QT3A 1O12A 2WM1A 3D6NA 1K6WA 4H9TA 4DI8A 3A4JA 3MJMA 2E25A 4LAOA 1FKWA 1V51A 1R9YA 1XWYA 4HJWA 1J6PA 4DLMA 1A5KC 4EP8C 2Z29A 2GZXA 4LANA 4V1XA 4CNUA 1NDWA 3CS2A 3E0LA 4NG3A 2E1WA 1ITQA 2HBXA 2VM8A 3RYSA 2PAJA 3TNBA 1K1DA 3S2LA 3CJPA 4C6NA 5FSDC 2R1KA 2VC7A 4LFYA 4LCRA 1J79A 2R1PA 1KRMA 2DVXA 2Q01A 1EYWA 4KQNA 3UR5A 3MVIA 2G3FA 3NEHA 1POKA 2D2HA 2HPIA 2Z7GA 3E38A 3JZEA 3AU6A 3E3HA 1O5RA 1GKQA 4B90A 2FTWA 4ZSTA 2Z2AA 2R1NA 2VR2A 3F4CA 4B92A 3K2GA 1S3TC 4DLFA 5AKQA 4DO7A 3ISIX 4YIWA 1FWDC 4C6DA 3S2MA 3LS9A 1RA5A 4C6FA 2Z26A 3TN3A 4IQJA 1FWIC 3MVTA 1YNYA 2GWNA 1A4MA 1FWAC 2HNHA 3R0DA 3IRSA 3URNA 2PGFA 4ERAA 4J2MA 2FVKA 3ITCA 1HZYA 4B91A 1YBQA 4P5UA 1EZ2A 4GY1A 4NP7A 3SFWA 3LNPA 4R88A 2FVMA 2A3LA 2P50A 4ERGA 3LY0A 1FKXA 1V7AA 3FDKA 3MDUA 4L9XA 2WJEA 4QSFA 4C6LA 3MTWA 2Z2BA 4HK6A 3S2JA 3AU2A 2VHLA 3C86A 3GRIA 3FDGA 3NURA 3DC8A 4J5NA 4MUPA 5G4HC 1I0DA 1FWCC 4G2DA 1A5LC 3HM7A 4G7EA 1P1MA 1KRAC 2GOKA 4QRNA 3TN4A 4CQDA 1EJUC 3GG7A 1V4YA 4H9YA 3UR2A 1J6OA 1POJA 2O4QA 1V79A 1K70A 5E5CA 4CNSA 2Z25A 2BB0A 2EG8A 2ANUA 1NDVA 2HBVA 4PCNA 4EPBC 4GC3A 2F6KA 4BY3A 1JGMA 5HMDA 4INFA 4WGXA 1XRFA 1ZZMA 5A6TC 4GBDA 2D2JA 4H00A 2GWGA 4J35A 2DVTA 3T1GA 1R9XA 4QS5A 2RAGA 4C6OA 3OQEA 1YIXA 3B40A 1XGEA 3T81A 4C6QA 3K5XA 2PLMA 2ZC1A 4I6KA 4C65A 4Z42C 2Z27A 3A3WA 3OOQA 4DYKA 4DZIA 3FEQA 4C60A 1ADDA 2ICSA 1FWBC 1A5MC 1NDYA 4H9ZA 4E3TA 1PO9A 2AMXA 3LSCA 4PCPA 3RN6A 3F2BA 2Z28A 2UBPC 4B3ZA 2Z24A 2EG7A 4IFKA 2YB1A 4C6JA 3GU2A 1R9ZA 2CZVA 4R85A 3GTIA 4LALA 4I6VA 2WJFA 3GIPA 1WXYA 1EF2A 4IGMA 1RJQA 3V7PA 4IH3A 3QY8A 1KRCC 4C6EA 4RE0A 2Z4GA 3E2VA 2YXOA 1RJRA 4HK5A 1ONXA 4C6IA 2YB4A 3N2CA 3F4DA 4GY7A 4IG2A 4PE8A 4LEFA 2BGNE 4AQLA 4KEVA 4F0RA 3F2CA 3OJGA 4GK8A 3RCMA 1UIOA 2VUNA 1I0BA 3TN6A 4PBEA 4GX8A 3EGJA 3K4WA 1PB0A 1DPMA 3A3XA 1FWEC 4XAFA 3O7UA 2P53A 3GIQA 1E9ZB 4F0SA 2Q09A 3GTFA 2FTYA 3QGKC 2I9UA 3E74A 3GTXA 2VC5A 3IPWA 4KESA 4DI9A 3GTHA 3MSRA 3ID7A 5FSEC 1YBQB 2OGJA 3SO7A 4GY0A 3E0FA 3GUWA 4LCSA 2WJDA 3OODA 3PAOA 1KCXA 4TQTA 2O4MA 5LXXA 1M65A 3HTWA 4QS6A 3LGDA 3BE7A 2Y1HA 4DIAA 3PANA 2FFIA 3IJ6A 4EPEC 3QY7A 3EWCA 4AC7C 4KETA 4NI8A 4XD4A 4C6BA 2OB3A 3IACA 4C6KA 3B0YA 4XAGA 3URQA 4PBFA 3LGGA 4G7EB 1ITUA 1EJSC 1A5NC 2OODA 2PUZA 4XD5A 3DUGA 4JOMA 3UPMA 1VFLA 3EWDA 4LAMA 4CNTA 4RDVA 4UB9A 4ERIA 4EPKA 3LU2A 3AUOA 3CAKA
chains in the Genus database with same CATH superfamily
1FHVA 4G9PA 3NZPA 2YL5A 1SQ7A 5FF7A 4KS0A 1KC7A 1MNZA 4RX0A 2FDMA 3UA3A 4JTEA 3CYVA 1LWJA 3QKZA 1KQYA 1LOQA 1PZ2A 2AQVA 5A6JA 4QNWA 2O7SA 2YL6A 3TTQA 3HB9A 4DNMA 4G8TA 3WDJA 1IR1A 3Q45A 4QLLA 5CC7A 1JVNA 2WHMA 1NOUA 2BZNA 4NAFB 3ZZ1A 1QU4A 2OJPA 4V1YA 3BLIA 4PTDA 1B57A 2XSBA 3OG2A 4S3KA 3VZXA 2XINA 5BMXA 1DJYA 1KRBC 2GSEA 5M1TA 3I10A 1W0MA 4LYPA 3GHTA 2ACRA 4ILSA 2H8XA 1K9TA 1TG7A 3BCJA 1UBSA 3NL6A 1TPWA 2XVPA 3QGVA 4O14A 5EMLA 3T08A 2YR1A 1J8VA 3OVPA 4RNJA 4K37A 3MSGA 2P88A 3PNUA 1GPWA 4QCFA 1DXEA 1F76A 3SSJA 1A5OC 3NVTA 3S3GA 1PKYA 2J74A 4O10A 1HG3A 1UR2A 3SUSA 4YMZA 3ORWA 4LPCA 1GCYA 4BA0A 4XAYA 2VFHA 4M3PA 3ZT6A 2DUAA 4GI4A 3KDNA 4L5ZA 2VDIA 2EG6A 5FAJA 3W82A 3DYMA 3CUHA 5TQLA 1AJ0A 3T09A 2NSXA 1US2A 4IQEA 4LSBA 1X6LA 1W1VA 4XX6A 3T0BA 2PPGA 1F8IA 2D20A 4PTVA 2TMDA 1EA0A 4WGHA 3SADA 3PAJA 3G22A 1LOLA 2Z1SA 2NWSA 3B9OA 3GAYA 3NQ2A 3SZ8A 1PBGA 4ROQA 4TTGA 2WMHA 1ME7A 2QJIA 5A8OA 3E0LA 1DIKA 5H8UA 1GW1A 2CLIA 4EAMA 1NARA 2B7PA 4ZXOA 3TNBA 4IJCA 3UWEA 5A1AA 5FSDC 2R1KA 2OZ3A 3GE7A 1J79A 1GVIA 5FF3A 5DMLA 1E3ZA 2OSWA 5JH1A 3SB0A 4WY0A 1EIXA 1W2VA 1G4EA 1C92A 3WD0A 2HPIA 5G1TA 3H2CA 4PB5A 4E4UA 4OOZA 3PFRA 3W75A 1L2UA 2Y0FA 2E8YA 1X6NA 4UTHA 3NQ7A 4O8AA 3P8JA 3DHUA 4Q8WA 1FH9A 4EF9A 1HJSA 3QV9A 4LRSA 3HOJA 1YNYA 4K6AA 2J78A 3IRSA 1TZ7A 2NLIA 1A50A 4UQAA 3ENLA 1HL9A 1NM9A 4FAMA 2JQXA 4CD6A 3OVQA 1EZ2A 4JIHA 3LNPA 1XLKA 4TTUA 2E1DA 3BLOA 2VFIA 5C9WA 3T6CA 5BW6A 3UZZA 1X7FA 1OZQA 3G8EA 5AYZA 5C2GA 2YOCA 4OOUA 1Y5XA 2YCJA 1V5XA 3NURA 3NQGA 2NQHA 1E51A 1S3HA 2BX7A 4LQ1A 5IOBA 2OU4A 2GOKA 3MZ2A 3DBPA 4UNLA 3T8QA 2DSUA 4RV8A 4E2DA 2Z25A 1VENA 4JTRA 2ASHA 2XM1A 5E70A 4LBSA 4U2YA 1XLFA 4IPPA 3B97A 3CZLA 3ONBA 5PTDA 1R6WA 4JYDA 3WLNA 2OKTA 2A7NA 2QZRA 2OWWA 1TPC1 1KGXA 1JDEA 2PBGA 4CCZA 3AS1A 4J35A 1R9XA 3UWUA 4MG4A 1W1PA 1HTIA 1PWMA 3OQEA 2J8FA 4NAFA 4YLWA 5CGMA 4H8UA 4C6QA 5BOEA 4I9AA 4JN6A 2PGWA 4F2TA 3OOQA 1KXTA 1EHAA 2ON3A 3NSNA 2OXNA 1VFUA 2EBNA 2WJZA 1V3HA 5KITA 2Z28A 3OLEA 3VVGA 3PZTA 1EP3A 3CBWA 4C90A 3GU2A 3RITA 4S3CA 3BGJA 3GIPA 1LQ2A 1NF0A 2G3MA 4BQ2A 2BVYA 3D46A 4DO6A 2E6YA 3S46A 1QOPA 3W85A 4YTQA 4PH6A 5LNUA 4W8AA 4MJ2A 4TMCA 1I2PA 4MPKA 5I02A 4PMZA 3IVSA 5I3DA 4GK8A 1KM3A 4JNZA 4D6FA 3TA6A 2FH8A 4UTUA 3EX3A 4AMCA 3HPSA 1PB0A 3OIHA 4PUDA 4I8YA 1DKWA 4AEFA 2TSYA 4KCWA 4FO4A 3QGKC 4MWAB 3LTSA 4GG9A 1NJJA 5HJYA 1K8ZA 2Q3OA 2RH9A 1E0UA 1PIGA 4NAEA 4O19A 1CXFA 2EXOA 2VFEA 1F3TA 1QPRA 2ATSA 3SO7A 1OYAA 3CZKA 3GUWA 4I90A 1EP1A 2VZSA 3GY1A 5D9MA 1R3QA 2MUCA 4Y9MA 2PDCA 2Z1WA 4A22A 2B31A 1XLDA 1BXCA 1EQPA 5AHIA 1NF7A 4AC7C 4XD4A 3QLLA 4OWGA 3R43A 3ZXWA 5HQEA 3N3TA 2Y89A 3QTGA 2Y7DA 1O1ZA 3PVFA 2JFEX 3LU2A 3WH8A 1NY1A 2ZUNA 1UH4A 3TCEA 1WKDA 4JTCA 3TLLA 4N9BA 3J7HA 3VCCA 3MUAA 3MV11 1T0OA 2DSZA 3GDTA 1YADA 4RXFA 3KWSA 3LHZA 1G0CA 4W9TA 4WVXA 1D8CA 5LNVA 3BOLA 2HCVA 1XIDA 1DP0A 2KAUC 3WF0A 1PSCA 2UWFA 1FFQA 1MEWA 1DQXA 3SIMA 3ICJA 4Z17A 1QNOA 3M5XA 4GQGA 1P48A 3O15A 3QXBA 4W89A 3MANA 4UFHA 4S3GA 3WY1A 3AZRA 4ASTA 4NX0A 4FLQA 1TQXA 3OU8A 2OT0A 3OQ8A 1TR9A 1Q6FA 2I5GA 4GZEA 2VUYA 4JTAA 3LG3A 1SZNA 2WMFA 1XRTA 2C13A 2DIEA 2EGZA 1EA9C 4GX9A 4KRUA 3K4AA 3KAOA 2NQJA 3E0IA 4GVHA 1P4CA 1XYCA 3PZ9A 4CU7A 3UXAA 5GNYA 3FA4A 3USZA 5JBFA 3KTXA 3NEVA 3PBMA 1FWHC 4ZMGA 3MPGA 1QDSA 1ZNNA 1B3VA 2QJMA 3PWAA 3JUGA 4IG2B 2ADAA 1MW2A 2ZIDA 4XB3A 4FXFA 3NQ8A 2JK2A 1RBAA 4N9CA 4O53A 3URBA 3FA3A 3LQLA 5EMUA 3RPDA 3WBAA 4DF1A 3V4BA 4BI5A 3RRXA 1PYFA 1VHCA 3WYZA 1EL3A 1UG6A 3DU0A 1E4NA 3PTQA 3UJ2A 4MM1A 3QY6A 3P62A 2IQTA 2NX9A 3APTA 3VCNA 2XIJA 4WD0A 5JXQA 5I77A 4H9TA 4RE2A 4GPNA 2XFWA 1KFBA 1BYDA 1XYZA 2A6NA 1I60A 3FJLA 4MPQA 3UZWA 4M5PA 2XN0A 1DORA 2Z29A 3B9EA 3W70A 2CESA 2Q8LA 4NZFA 3NQDA 5J5DA 1V0LA 5IHRA 2W0UA 3FKRA 2F84A 2WWCA 4MOZA 2DW6A 2JE8A 5G2WA 4XBSA 1EDTA 4EE9A 1J4EA 3N14A 4M81A 4YTUA 2JEPA 1B3ZA 1EYWA 1N8IA 2EQDA 1XLGA 2D0GA 2QDEA 3EMCA 3TQ0A 3PJXA 3N12A 4NNBA 2X1IA 1UWIA 4O4VA 3DFNA 1E5JA 4IX2A 3PPCA 1S3TC 1IWPA 3EWZA 4GJIA 2HV5A 1VFOA 5IRPA 3MVTA 3WDQA 4MWAA 4JTIA 1H2JA 1SYTA 2CITA 1HFBA 1UA7A 3CL8A 1TELA 1TJRA 4PMDA 2A7RA 5DY3A 3LMZA 1W3IA 2NXIA 4AHPA 4ERGA 4GCXA 1RPKA 3F4VA 1VAHA 1Z9AA 3LHYA 4MUPA 3TP4A 1HNYA 3GO2A 4MWAE 5M5DA 2NQZA 7CGTA 5F4WA 1H50A 2V2HA 4D6DA 3M16A 3SCSA 1P1MA 4FR6A 4OBRA 3RPMA 4MB5A 4P7RA 3L12A 3MHGA 4QRNA 1PPIA 3O05A 4FXJA 1OEPA 4DRSA 4LC6A 5K4XA 2ZA2A 4RLIA 3IGSA 2QPSA 2V8ZA 3W2MA 1MUCA 2VT0A 2E9MA 2G50A 4TX8A 2ZUVA 1WUEA 4BZYA 4UQBA 4J28A 1IEXA 1BWVA 3KTCA 4AISA 1CGYA 3IUIA 1EBHA 4ZQOA 3AO0A 1RCXB 3FLUA 3S1UA 4GUJA 1OVDA 1J93A 3OEXA 1US0A 4HCHA 2CYGA 2A1YA 4C6OA 4Q33A 2CETA 1YIXA 2WQDA 4X61A 1D7FA 2ZE3A 1JAKA 4GA8A 3WG6A 3I3DA 2WZIA 3WF1A 2FB3A 4LGXA 1F05A 1TE1A 3NQMA 1TTQA 3W02A 3ZJKA 2IPWA 4HCLA 3AICA 3BMVA 1NDYA 3PB0A 3QR0A 4ZR8A 1H7RA 2HXTA 1SR0A 4WLCA 4IHCA 2V3DA 5C54A 2XG9A 4L80A 1SVDA 1I2QA 2CZVA 1FXPA 1OD0A 3IIPA 3CPRA 1TREA 1TMLA 3ABSA 3E2VA 4UIOA 1XRSA 3KS6A 3GNRA 4R33A 4W5UA 2XPKA 3BV4A 4IG2A 1LRQA 1XC6A 1J0ZA 4KMQA 4FNPA 2I7GA 2V3FA 5GJNA 3WQGA 2VX6A 3I65A 4BI6A 5CC3A 2VUNA 1AA1B 1YE6A 3PBUA 3GDBA 4UFIA 1DPMA 1Q6DA 1R3WA 1SJAA 2INEA 4AHQA 2FTYA 1L0PA 1TJPA 1XLJA 3PSVA 4O8RA 4WKHA 1MW0A 2V5JA 3IPWA 4BF5A 2ISFA 4M0XA 2J9ZA 1FBAA 3UW6A 3II1A 4B5XA 1MZRA 1XDMA 1SPQA 3DGBA 4O0ZA 4NY2A 4B4FA 2YJQA 2CZEA 1U5JA 3AFBA 3OODA 1ISYA 1W5QA 2UY5A 4TQTA 1F3EA 3APYA 4EPEC 3QSTA 2C79A 3MO4A 4DO5A 3U6WA 2Z0IA 1CXHA 3WN6A 4HHMA 2CLOA 3L5AA 2V6AA 4Y9AA 2NZLA 7A3HA 2PUZA 3VKJA 4X0NA 4UTLA 2XZ9A 4UB9A 4P8XA 3ABQA 4GACA 4EPKA 1TUFA 3KBNA 3BW2A 1EXPA 2QMKA 4IFOA 4J3WA 2WV8A 4BWLA 1CW2A 3P8IA 2PZ0A 2WCSA 4RDZA 3A24A 2PDLA 1XR2A 2CU0A 5A8GA 2C71A 4TIMA 2VGGA 2GOUA 1VYSX 2E5CA 3I7SA 1BAGA 5G4EA 1E55A 3U48A 3MSDA 3WK1A 3GKAA 2ZX5A 3WQOA 5LIYX 2V2DA 4GUIA 4DJDC 3HMCA 3PC0A 2QLYA 1FHLA 4E2OA 2WPGA 1HT6A 2XIQA 4CQCA 3DEQA 3CWOX 3JR2A 3N1AA 3ZLHA 1KV8A 1JCNA 3P14A 3VIIA 4KEZA 3TMLA 1JCLA 1U33A 3ANVA 2PDXA 2J8GA 4QTGA 5HXMA 1N7KA 3VPLA 5H8PA 4US5A 4FIRA 2OLHA 2YGYA 1QI0A 1XFBA 1MDLA 2XFFA 3G18A 3LA4A 4HIBA 4HKPA 2H3DA 2F8QA 1Q2RA 4OECA 1VJZA 3VIFA 2WO5A 4OUIA 3WQCA 2VCBA 3CHEA 3W7DA 2QDHA 5DN1A 4GH1A 3BANA 4GVGA 2IXUA 3C2FA 3VD3A 1DOSA 4A3RA 4JTDA 1OX4B 2BOEX 2DT3A 1Q5MA 1X1NA 3LLFA 1A4LA 3TN5A 1G6CA 5EGRA 5BNKA 3VDCA 3CIVA 3B9AA 1HP4A 1OB0A 1KBIA 4YWIA 3QHOA 2IKJA 1ZENA 1PJ9A 3PBGA 1BD0A 3P6LA 1KCKA 4NXSA 3SUWA 1EBGA 3C2OA 4HNUA 3PUEA 3GU1A 3IJIA 4MF4A 4MLRA 3STCA 5A69A 3VM7A 1I8JA 2I16A 3B3DA 4HJWA 1AQFA 3BLPX 2CBUA 1Q63A 2O9RA 3CMGA 4ZOBA 3UJFA 3WKZA 4B4HA 4K68A 3G1YA 4I5RA 5IDIA 3A64A 4YL2A 1A3XA 3OYXA 3RJYA 2ZTJA 4LFYA 3VFCA 3TYCA 1DIEA 1UD3A 2XFRA 1IR2A 1OF6A 4LNYA 3WCZA 2XVNA 5KZMA 5AC6A 1VEMA 3S83A 5BMWA 3W72A 1BVWA 2Y24A 4DJDD 3M0YA 4Q8PA 1XLHA 5AKQA 1MFUA 4Z2HA 2WSPA 1CGUA 4C6FA 3GNOA 3VNDA 4F9JA 1HJUA 1S5MA 4J40A 2A3BA 3GXMA 4EX4A 3N9SA 4DELA 3HZ3A 4NJKA 1FY6A 3V5OA 4K36A 3URNA 3OVRA 3M43A 3EKGA 4FPSA 4GNJA 1XC4A 1WKEA 1HZYA 3UGVA 4R88A 1CTNA 3K8LA 1OC5A 4P7LA 3UWZA 4GQBA 1W8SA 1DYSA 4HK6A 2OGYA 4K2SA 2VHLA 3RR4A 3CT7A 1PZ0A 3M5YA 3HG2A 1XI3A 1WDQA 4DQWA 3M6DA 3MUY1 3XIMA 1K9FA 2W27A 4JIEA 5KETA 3MP5A 1R3SA 1VFHA 4XG1A 4LS1A 1EX1A 5LIUX 5A5WA 1W9XA 4LVBA 1XIHA 1HP5A 3RAOA 4PCNA 1G01A 5LSMA 3O1NA 5JBDA 4L4LA 2VELA 5HMDA 3L2MA 4Q4RA 3R7MA 3W84A 4E4FA 1EDQA 3UETA 3ARRA 2Y8KA 1KR1A 1ZZMA 2I1OA 1IYXA 5BRBA 2ZWYA 3N4EA 1EC9A 1EQCA 3T1GA 3W7QA 1W56A 4JL1A 1NP0A 1XGEA 4YPJA 2BBFA 4QQ3A 3EPNA 3V0SA 3SQSA 1A5SA 3RCYA 1QK0A 2YBUA 2Q71A 4J3SA 3UEQA 1ESWA 1CBGA 4R27A 3C61A 3DI0A 4JPGA 3UD6A 1IIHA 1J0HA 2VGIA 4CVUA 3VXGA 4I9JA 4FZIA 4NXKA 4GQRA 3O6YX 4DO4A 2Y8VA 1ZAHA 2BY1A 3H2EA 3TQPA 1ADSA 1RJQA 3KCLA 4RE3A 1HO4A 2WBGA 4C6EA 2ODOA 5FJTA 1W6TA 2DW7A 4Z2KA 1V0NA 1JZ6A 3PF3A 3AIEA 3Q4DA 4RZ6A 1DQWA 5D9OA 2YL9A 4XZBA 1OCBA 1ZALA 3I7RA 4UFKA 1K9EA 2PWGA 3KUMA 2X1RA 1H7NA 1OX4A 2X40A 2A3HA 3K8MA 1A5CA 1YTDA 3VKKA 1IEIA 4L1WA 3OGRA 3HQOA 3UG5A 4Q8MA 2GGHA 4XUGA 2ZOXA 3TYDA 2TPSA 3EAUA 4KFNA 2OYKA 1TO3A 4NZJA 4CCEA 1QHZA 2OZ8A 4CCDA 1KCLA 1QI4A 4EACA 1LWIA 5HUOA 1N55A 3A47A 3V1PA 5KZ6A 3S47A 3VD4A 1V6TA 1Q6RA 4WKFA 3RU8X 4QDMA 2W79A 4GRSA 4GNKB 5K3VA 5K4ZA 3SJ3A 1LORA 4Z1AA 2QCHA 2OEJA 3QKEA 1UC5A 2HE5A 3PFMA 2GQAA 3BCDA 2OODA 1WO2A 5MHBA 1XLBA 3XINA 4CNTA 2XHYA 5JIWA 1BFNA 3VUPA 4QIUA 3AZTA 2PLJA 2PTXA 3VU2A 1ADOA 1WPCA 4Z0SA 2DJXA 1EFZA 3URAA 4JX5A 4DUVA 1AMKA 2R1MA 5HR6A 7ODCA 1BG9A 1TYGA 3N25A 1JJKA 2B0MA 2CLFA 1KW1A 5A8QA 3EWWA 2QF8A 5DT7A 5IDZA 4LC8A 1UKQA 4LUTB 5FEZA 5EL1A 2Y61A 4IUOA 1OCJA 4YNGA 1XSJA 5HNRA 1G4PA 4Q7NA 3FJNA 3M0LA 4R7WA 1LLOA 3A5FA 4A2RA 1MXGA 1SO4A 4LH8A 1NFBA 2CLKA 4LY4A 1I6NA 4UNIA 1OWQA 1ZJAA 3QYSA 5B7ZA 1YDYA 1GYNA 1VRDA 3RLVA 3W26A 2J9YA 2I17A 3AJXA 3SCNA 3UZJA 3VE9A 4KIEA 4ACZB 2E5DA 4F4RA 3F2DA 1D3CA 1AFSA 4Z2GA 3BAKA 1ODUA 3N73A 4AX7A 2J9XA 1YYAA 1WZAA 2GJNA 4PB3A 3KZPA 2XIOA 2YW3A 4L61A 1UKPA 2GGJA 3WNPA 2ISVA 2HJPA 3USBA 3ABZA 3BUVA 2ZE0A 1XUUA 2KX9A 3OP2A 1PAMA 5CAHA 8CGTA 3EKLA 3RHGA 4AB4A 1XYBA 4PRTA 4IMDA 1MWOA 4G5DA 4R5EA 3U2EA 2AL2B 1YNQA 3QZAA 1T96A 3B0XA 5CBJA 3I3EA 1S46A 4H83A 2BODX 2E40A 4IXHA 4K8GA 3WD4A 4DI8A 1DJWA 4QSHA 4Y90A 4TX9A 4P61A 5I3IA 1V51A 3IJDA 4P8VA 3NQAA 2IQDA 3CUGA 3TFCA 1UYQA 1IHIA 1E1CB 2G41A 2EAWA 3R1ZA 1NQ6A 1ITQA 4DBSA 2HBXA 1K1DA 3N4FA 3FGCB 3WNKA 1S2VA 1J0JA 1B3YA 3VABA 4Y7EA 1RQBA 4XZHA 2VXNA 4H6RA 1UB3A 5CSYA 3QQ0A 4LU0A 5BU9A 2PTWA 1FHUA 2AAMA 1GNXA 1EGVA 1R0MA 1SZRA 1QWKA 3VD5A 2MANA 1P0KA 5SWUA 1D3HA 1D3GA 1RA5A 1DJGA 3M7WA 5LNRA 3TE9A 2BGSA 3TCSA 4HU8A 2O56A 4MJMA 1IEVA 5DRCA 4LVFA 2QDDA 3T7VA 1WX0A 3NWRA 5M3WA 3TWBA 4GH3A 1GEQA 4GY1A 5HQLA 5FEXA 2OEMA 3GC5A 1FHDA 4E2BA 2PDKA 2XN2A 2XH7A 3W29A 2OEKA 4IZGA 3TIMA 4AMAA 2WJEA 2VTFA 1JCXA 3WLKX 4C6LA 3G1DA 4MY8A 3DHFA 2Y8UA 5C6MA 2PDBA 4H7CA 1P7TB 2GUUA 2BFGA 4UQCA 4LAUA 1FRBA 2QCCA 2LLEA 3CLWA 4LBRA 2ZXQA 3TJLA 3ZWTA 5FIPA 1EJUC 1OT2A 3OYZA 1V4YA 4JN7A 1V79A 2GQ8A 4NZCA 1BTMA 4NRSA 1TTJA 3LHUA 1IT7A 1E9IA 2EG8A 1NDVA 2Y4SA 2UY4A 1F6YA 2PDIA 1KFEA 4I3GA 1RP8A 2VDHA 4JTJA 4FHAA 2PDWA 1R3RA 2RKXA 4LUTA 4Q8UA 3MWAA 1R2RA 5D2YA 4AWSA 3EWYA 3PPFA 3R4IA 3VOFA 3B8TA 4JCMA 3RO6A 1D7KA 1F8MA 3H22A 3HGJA 4FR1A 2ACUA 3BV7A 3OZOA 1WZKA 1M03A 2NUWA 2X05A 1CXEA 2ICSA 1FWBC 5EBAA 4H9ZA 2O9OA 4UTTA 1UZ4A 2DEPA 4KFPA 4R7OA 1C7TA 4J1OA 1E43A 1JR1A 3TSMA 1BWKA 4ACZA 1NP2A 2IKGA 3GTIA 3P5YA 4IH3A 5EFFA 1FWSA 4KBXA 5M2FX 1E9LA 5D03A 2C18A 4QG8A 2BGNE 4UUIA 4AQLA 1XPYA 4MKNA 1GOKA 4HNOA 3WLJA 3VGFA 4B5SA 2ZRWA 3M0HA 2WSRA 4H8HA 2WVVB 4AU0A 1XD0A 3QTPA 3TOYA 5A6SA 3R10A 3QPEA 4X9SA 2VD8A 3GYCA 3TSBA 4EK7A 2G4JA 1B4EA 1QMLA 5HOSA 5AYXA 3L68A 1BGAA 1Z48A 2AL2A 5CC6A 3EEZA 1CGTA 8XIMA 4RPPA 3PZGA 4O1BA 3VIKA 1UKTA 1VPYA 3OZPA 4PTNA 1TVLA 2I14A 3WJWA 2Y2WA 3R94A 2WPBA 2OGJA 3NQCA 2FGBA 4PCTA 4IIGA 3DFOA 3UY7A 2BVWA 1OZMA 1GPFA 4PB4A 4FNUA 4BEQA 2ACQA 1GQNA 3HTWA 1P0NA 4Q7IA 1E1CA 3UJRA 3OB8A 2X1UA 1Q85A 2ESCA 3RPTA 5I3JA 1AD4A 1XCFA 4YVXA 4UZSA 3URQA 5AC5A 4DXKA 1W9UA 1C3FA 3LGGA 3LYEA 4MWAC 4MY9A 5A8MA 3FGCA 1IEQA 3HFYA 1ICSA 1CDGA 1RZMA 4O18A 5ENLA 1IXNA 5C71A 3LLXA 2QUMA 3AUOA 4DBWA 2WSKA 4UQDA 3C0QA 4OV4A 4AG0A 4GD0A 3GSMA 4OBTA 1J9YA 1ZAJA 2ZDSA 3W7PA 1E15A 4JZ5A 1VZWA 7TIMA 2OQHA 1JZ5A 4JTLA 2EJ1A 2PD9A 3AHYA 4Q8NA 1K02A 1BQGA 1DTUA 4DYJA 4NJIA 2V67A 4Z08A 2DJLA 3H2FA 2VMFA 1VGAA 3A23A 4MKSA 4H6KA 5HNUA 2VRQA 1RCQA 1T8QA 2HSAA 4X2PA 3L0NA 1QW7A 2DSVA 4UBPC 2QXWA 1VD6A 5A6AA 1IIGA 2H8ZA 1UP0A 4GIRA 1RHCA 1KGWA 3MCOA 2PDMA 2D73A 4IFKB 2QCGA 4NNAA 3APGA 1P7TA 3BGAA 1XDLA 1H49A 3VGBA 1V0KA 5I07A 2OO0A 1H5VA 1TIMA 1PKLA 1EXBA 3JVAA 4AHOA 2OYMA 3N2OA 1E9YB 3OVGA 5MF5A 1LM1A 4C1NB 3R12A 4N9EA 1LG2A 2V5KA 4L56A 1EJWC 2BHZA 4BI7A 1VFMA 4KIRA 4IIFA 1RH9A 3SGUA 4NI3A 4M6PA 1OFPA 4H9XA 2W3ZA 4HA0A 3IIOA 2DP3A 2JKAA 3WZ0E 5JMUA 3MWCA 3DG3A 1Q6GA 1M68A 1RBLA 2C91A 1MEHA 3RG6A 3NNTA 1ZBVA 2Y7EA 3UXIA 2PP3A 3W87A 1AD1A 3V18A 3AROA 1QNVA 5CXPA 2YFNA 1UR3M 3UFYA 3RO8A 3PUOA 3SDOA 1NWRA 1KBKA 2X42A 4WCJA 1JGIA 1Q6QA 3G1RA 2HEJA 1UH3A 2R8WA 3ARSA 3AYSA 1OBAA 3QF0A 5AZ0A 5XIMA 2A4AA 1W31A 5K9CA 2J77A 1ZCOA 3NEHA 3SN4A 2Z7GA 2B7QA 3NDZA 5HPOA 3JZEA 1H09A 4JAWA 2PDNA 2WVVA 4U28A 3TJ4A 2WSYA 1UJPA 4TR9A 1AG1O 1JEZA 2VFGA 4ZO9A 2ACSA 4B3LA 3VIGA 4PRWA 3E2SA 5G2HA 3KWXA 3C2EA 4AZCB 1R5YA 3KE0A 5A6LA 3AXHA 4CNNA 4MNMA 2Y6ZA 4ICNA 3E96A 4LWWA 1GVOA 4AIEA 3NO1A 1A4MA 1XISA 2ZZ3A 3U0HA 5D2WA 3JW7A 3FXGA 1ITCA 2JEQA 3W7RA 1TV2A 1WOAA 3K46A 4ML9A 2WVUA 1DQUA 4EXAA 1QK2A 2BSLA 4ZA0A 3THQA 2Q8XA 2BY2A 4BWLC 1CB7B 3EOSA 4DUWA 3AC0A 4YCOA 2E09A 2W67A 2NQ5A 2XIBA 4CD7A 4D2JA 5BZAA 4IMEA 6REQB 2PA6A 4PMQA 1RLDA 2PWHA 4FLSA 5KINA 1JAEA 3OG3A 4JIRA 3LCWA 3WO8A 4I9TA 4M7SA 1CX9A 1K70A 4JQ1A 2AMGA 4YJ5A 1TTIA 3OA5A 3VDHA 3BQ6A 2E0PA 3BSMA 2HNEA 3C52A 4EIVA 1Q13A 2VNCA 1QI3A 4QS5A 3E02A 3LXBA 2B7NA 2HTMA 3AMLA 1I2NA 1V6WA 3MUCA 3RMEA 4AIBA 4G56A 5C7VA 4I6KA 4QGCA 4Z42C 3W07A 3STFA 3KXQA 3V35A 1VJSA 3GNPA 3PUDA 5CCZA 4S3JA 2VEPA 2NW0A 3H53A 3P5ZA 3RN6A 1W5MA 1HKKA 2REQB 2EG7A 1W3KA 4IFKA 1QI5A 5I5RA 2ZYFA 4EAYA 4HGXA 2VWTA 3BL3A 3GG1A 2PI6A 3VZZA 1G7UA 1F4AA 3FYYA 1JYXA 3PM6A 1KXVA 2YCLB 4Q4QA 4HK5A 1RPXA 2RDXA 4NZ4A 5CZJA 1X1OA 2X30A 1HO1A 5L9FA 4C1NA 3N2TA 4KEVA 1SZGA 4MJZA 2FZMA 1VEPA 4PZVA 1EGZA 4W84A 4IP4A 4KWUA 3RRAA 3WBYA 2GFTA 1F3WA 4H6EA 2DT1A 3GDRA 3PG8A 3O7UA 5E09A 4B2DA 1ISXA 3OZYA 1R2TA 4AAJA 2DU2A 3M0VA 1TX2A 4C7GA 3W38A 4XKYB 3KOXA 1YPFA 1XHGA 4ZB2A 4HPJA 1IEWA 4PMVA 3KDOA 1CB2A 1DHPA 5D4YA 4PSPA 3WELA 5F4SA 1K8XA 3W1MA 3HQ1A 4MLJA 1GVFA 2VGFA 3WJYA 3ALGA 3KHDA 1C9DA 3EWCA 3WLSA 1KXHA 5AYIA 3HV9A 4IQLA 2C15A 4GCAA 1VBUA 4AWTA 4PBFA 1ITUA 4UR9A 4UTWA 1IGSA 1W3JA 2ZUUA 3EWXA 4W87A 3C0LA 1R85A 3RCNA 4H00A 4JD4A 3PB2A 1KFKA 1VLIA 2YLLA 3OHMB 4GZ7A 1EJVC 2FZNA 4FOKA 1QCWA 5XIAA 1ZLPA 3VMPA 1DVJA 4FF7A 3SJNA 2PWFA 1C9WA 4AZCA 1W1B1 1M7JA 2OOFA 2POTA 2YL8A 4LCQA 3KLKA 1B9BA 3F03K 4MB4A 1RK6A 1ZPTA 4N4QA 4BEUA 3W7KA 4JHMA 2IPJA 5D05A 4WXYA 3R8HA 1JPDX 2R14A 1W9BM 2OYLA 5HMEA 5BU6A 4TU1A 1E6NA 3HGRA 2PGRA 1KA9F 1IQ8A 4C7FA 4L1XA 3STEA 4HA1A 4YYFA 3GH5A 4JY9A 3PJTA 1HUVA 2PEVA 2Y5SA 4KEUA 6REQA 3KP0A 4YWSA 1BSLA 1PTAA 4H41A 3HBLA 3W2KA 3T07A 3L67A 4FNRA 3ONCA 2XIMA 4GABA 3I7QA 4TO8A 3LHWA 3GDLA 5TD4A 4H9UA 4GUFA 2AGTA 2YCEA 4H6QA 1GQKA 1Z7AA 4DYEA 3VIPA 5K9DA 2WC4A 4L9ZA 3UWQA 1I9CB 4FMVA 3N6JA 1SSDA 4GFIA 3WLMA 4RNIA 3LERA 4IOTA 1ONWA 1H4PA 2YYUA 1JRBA 4MFDA 3ZVIA 1TMHA 4MSSA 1E71M 2UZ9A 3WMCA 3FAWA 1QT1A 3FHAA 4MB1A 5DELA 4QXIA 2QPXA 4OU1A 7REQB 4WOQA 1F6KA 3QMTA 4H19A 4K38A 5KEZA 2YIHA 3QC3A 2REQA 3D6NA 3FX4A 3E2RA 2A21A 5CZTA 3VINA 2ZZ1A 2C0AA 3KL0A 4A8IA 1LZOA 3I3BA 4JQAA 1QPOA 1W3NA 2J88A 3QPZA 3L4VA 2GSHA 4CVWA 3T2QA 2XFYA 1LROA 3VOGA 4WJEA 2VOTA 2NV9A 2YDAA 2VZUA 4O16A 3VIHA 1MYRA 2YCLA 1F2JA 2Z1KA 3S1WA 5BXPA 2YBVA 5JVLA 4WOZA 3EA3A 1GYMA 3DBNA 4A8RA 3EX6A 2NVDA 3LX9A 1DL3A 4H4IA 5A2CA 4DXVA 2BTMA 3TR9A 3CZ8A 4KGLA 3RJXA 4NRRA 4AY8A 1O95A 1UZ1A 4BK9A 3BLFA 3L0KA 3GQYA 3H7RA 2DZSA 3GG0A 3BG3A 3W88A 4D8ZA 3CQJA 4JKMA 1PX8A 3LS9A 3EOEA 3LZ3A 4BQ3A 2CHRA 3L23A 4GUHA 5LNSA 1L8NA 2DUZA 3O6AA 4GIYA 2FZ9A 4IL2A 3S9ZA 1I1XA 4Z1DA 2BY0A 3MO7A 1CXIA 2QMJA 4WUIA 4QE5A 4CCCA 2EPOA 1Q7MA 3THCA 3OLDA 3O63A 4QSFA 2V68A 4LS0A 3DIPA 1IXOA 3W7CA 2Y88A 1OIMA 1GORA 1KBBA 3FDGA 3SW6A 4MKVA 2V30A 1KBLA 1M9HA 2CXGA 3T2PA 4FX7A 1DE5A 3BH4A 4QITA 4MNLA 1PX4A 3TYAA 4A3YA 1KBJA 5IFPA 2ZKMX 1AUSL 4NZ3A 3HV8A 5KZEA 3B0UX 3ITYA 2DV0A 3R13A 4IPNB 1GJUA 3E49A 4AH7A 4DJED 5RUBA 1LL6A 4JFUA 4CN1A 5A95A 3W7IA 3MJYA 5DMYA 3WDRA 3OGVA 5FACA 1S5WA 1HX0A 4K7VA 3WQ8A 1K6AA 1XKJA 1C29A 3VILA 2VURA 2WXDM 1W32A 1M53A 1UD2A 3FV9A 1O68A 3SECA 3GXFA 1SJDA 1XDJA 4FP1A 3L9CA 4LUJA 2H90A 2BXYA 5H8MA 3QQWA 3NO5A 4IMCA 3NXLA 5G1MA 4WK9A 3S1VA 1DXFA 4IXXA 3PBWA 2AMXA 4OVXA 5FJJA 4NT0A 1CIUA 2IKIA 3H12A 2WSQA 2G37A 4LOCA 5LA1A 4IWWA 1H3GA 4H3DA 1VB9A 4NILA 1DIOA 2W61A 1JDAA 3V0UA 2QNEA 4GFSA 1UA3A 1T5AA 3ARYA 4N7QA 1FDZA 3VFLA 3UG4A 4JFTA 1JPHA 1OM0A 3WUBA 2ZX6A 5BXRA 3HGOA 2TODA 2X16A 4N0RA 4UTJA 3WD2A 1A5UA 3KP1A 2H3BA 3ZM8A 5CG0A 4YTTA 2XU2A 3OJGA 2PFHA 3TNOA 3R11A 1UIOA 2DZPA 3LPPA 4F48A 4HMCA 4H2CA 2FDSA 3QRHA 3W7OA 3NIYA 1MQRA 4QX4A 3VNJA 3TYZA 2Q09A 4I7VA 1VJIA 3GTXA 4N6EA 3M9YA 3XISA 5AC4A 5HUPA 5BWAA 3N2MA 4JKLA 3OHIA 7REQA 2P3EA 1VYRA 5FSEC 4OBSA 1DHKA 2V63A 2Z2UA 3SRHA 5I78A 5FOOA 4A3UA 2O4MA 3TW6A 3IRDA 1M65A 5DT5A 2Y1HA 1KFWA 3MMDA 1Q2SA 4NVTA 2J66A 5LIKX 1VPQA 4TVUA 3CWHA 1K7FA 1E6ZA 2E5BA 3GKFA 5EB8A 1CCWB 3MU7A 4O52A 4S23A 2WHLA 4MDOA 1ZTVA 4NZ5A 4JOMA 3RFAA 5KTLA 1H7XA 1W3HA 4QG6A 3WMBA 3CAKA 1FOBA 1HJWA 1SO5A 4IIHA 4HOWA 1EC8A 4K3ZA 3TC7A 4FLRA 5BRQA 3T9PA 3ZSTA 4KT2A 4ZFCA 4Q8VA 2XGIA 1GVRA 3VGGA 3O07A 4CKQA 3MT1A 2GK1B 4LB3A 4MZ8A 1XLMA 2RDTA 3CHFA 4X22A 4S1FA 2V82A 4ENLA 1RJPA 4EPDC 2FJKA 2BG5A 4MUZA 4GXWA 1V6XA 4RNHA 3VD7A 3GR4A 1F6PA 1RVKA 3QN3A 3NTYA 5CJNA 3PZMA 1X38A 1EDGA 1HVQA 1UWSA 1LWHA 4WDXA 1KGUA 1UZDA 3E2QA 2X7WA 4DBDA 3N9KA 2E28A 1S1PA 3VTRA 3UWVA 4B5WA 4DJFD 3M41A 4Z1BA 4R7JA 1XX1A 4CEUC 1LG1A 3AOFA 1X98A 5ABEA 1I4NA 1HJVA 2DDXA 1MXSA 1OYCA 3NA8A 1K8CA 3FIGA 5HJXA 1DJXA 4RW5A 1C8XA 1SW3A 2VEMA 4DN1A 5HPCA 4E8DA 3TYEA 1NEYA 2PE4A 2YKKA 4RZBA 4XIAA 4I8DA 1I2RA 4HHLA 4D6HA 3PWIA 1MNSA 3GC4A 3TXZA 3CQIA 2D2GA 3FVDA 3AHXA 2XWDA 3B4UA 2Z1XA 1GTHA 2O92A 2VFDA 4JTQA 3HJEA 2PURA 5GNXA 3QFWA 4MAZA 1RALA 4Q32A 4DLMA 1PIFA 3CK5A 4UOZA 3L65A 3SRDA 1XM3A 1JCYA 1B9ZA 2PBOA 1E0XA 3TQKA 1HVXA 2J75A 2PAJA 1KM5A 4ZE5A 2WANA 2D22A 4KQNA 2OWXA 4I7WA 4XTDA 3W81A 2G3FA 4FALA 4JTGA 3LCXA 2ZRXA 3PR2A 3UXKA 4XZLX 3QR1A 2XSXA 1Q6CA 1ZUAX 2R1NA 5C9RA 3N17A 3WBXA 3L4YA 3L4ZA 1OK4A 1VYPX 3AIRA 3GS6A 5DF0A 3SUVA 4QBXA 2INZA 3WQWA 4RL3A 1BRLB 1V93A 2HNHA 4WY0B 1V02E 5CPSA 4NYUA 1S5VA 3W7JA 4Z2JA 3PJUA 5M17A 3TLQA 2Q3RA 5LKYA 3SFWA 5K2ZA 5CSRA 1ONRA 3ZWSA 4IL0A 1NFPA 3VE7A 3IJ8A 3SN0A 1QI2A 4CQ8A 3M44A 1TWSA 4GYKA 5G4HC 5D9NA 1ENUA 4PFMA 4GHRA 1EO5A 3OBEA 3CO4A 4GIAA 4F0MA 1TV5A 5LA0A 2NV1A 1TVNA 1Y5VA 3MQTA 1HKWA 1PHQA 4N9DA 4JX4A 4ZO8A 2CZ5A 4MZ1A 2PCQA 3R0KA 2HROA 5DFAA 4AYGA 4GXMA 3U4FA 4DEFA 2XN1A 4GC3A 2YA0A 2BLEA 4L4MA 3GR8A 3IIVA 3ZLGA 4EOUA 4GBDA 2GK1A 1LUCB 1ONEA 4UFJA 3SCPA 4ZQRA 1PIIA 3O0KA 1BTCA 4AEOA 3T81A 3M7SA 1XIGA 1ZP3A 1OT1A 1REQB 3LRKA 2D3LA 2QUTA 4AXNA 4OT7A 1JQXA 1ISZA 1SM9A 1OX5A 2J24A 3NSMA 3DZ1A 4PCPA 1H7OA 1S5TA 3F2BA 1Y0EA 1EB3A 2UBPC 3WH5A 4AZ5A 1KM1A 2WKGA 3WK3A 2QV5A 1W54A 4C6JA 4O0QA 3W1UA 2J7BA 3DOPA 1PCWA 3CHCA 1PE1A 4PMYA 4TVCA 1C91A 1K7EA 1GEHA 3S2CA 4U2ZA 1QNSA 1A0CA 4I5XA 3OBAA 3VDBA 4RCXA 5D2XA 4AZ6A 3N2CA 1XCWA 3W7GA 3F4DA 3MYPA 2GGEA 1GVYA 5BRPA 3GDKA 3MMWA 3FCPA 2YXXA 4A3HA 5JQ9A 1N2VA 5HR7A 3WJSA 3QJAA 1AJZA 5LIXX 3QZ6A 2J7GA 4MGGA 3ARZA 4MFEA 1UUMA 4YHGA 1JXJA 2C0HA 3F4NA 4XAFA 2P53A 1E4IA 2E8ZA 4O1DA 5F2GA 5CPLA 4F0SA 3WD1A 4O28A 4QG9A 2RHGA 3O8AA 1OQFA 1JPIA 3BWWA 2VX4A 5I03A 4D6EA 4QISA 1O5KA 3QM3A 3ITLA 3WL0A 1UWAA 2PGEA 1V03A 1YPIA 4X63A 4GY0A 4JR5A 3M0ZA 1BKHA 1E4MM 3W7MA 1TR1A 1X6UA 3P80A 3UCQA 3PZNA 3TSDA 3EDKA 3WJZA 3ITVA 3HFTA 1T40A 3BGGA 4ADTA 3P84A 4BCEA 3C56A 3D3FA 2HRWA 3F1QA 4HTYA 1S2WA 3SIZA 2G95A 2JGYA 3CB8A 4HPNA 9XIMA 4NAEB 4H7VA 1FDYA 4DZAA 1R30A 1PTDA 2D24A 2NV2A 1FQ0A 3LOTA 4W85A 1O94A 2QS8A 1YW1A 1RY8A 4GUGA 3HPFA 3REQB 1BF6A 3TU9A 2V5CA 1C8VA 3CUZA 4LT9A 2QUUA 1TQJA 4LUYA 1CGWA 3NZRA 1UASA 3SCVA 3BW3A 3H2NA 1Q45A 1W9DM 1R86A 2Z00A 2VENA 4HU4A 3CHVA 4F0LA 1BRLA 1DJNA 1FWGC 2WAGA 4JTHA 4NJJA 1QUMA 3W74A 3EA2A 4H9VA 1KNWA 4OFCA 1W1YA 2C6QA 4W93A 3IK4A 1MW3A 3B8SA 4M1RA 4DPPA 1DIDA 2AQWA 1IV8A 3CZEA 2D0FA 4Q22A 3EPOA 1R3YA 2INFA 2VEGA 2Q6ZA 1GW9A 2A3AA 4R9OA 3TC3A 3KVJA 1Q4NX 3ARVA 4JL2A 1XJBA 1NWUA 3SCOA 3PY2A 1WA3A 4XVEA 3NZ1A 1WBHA 1WXZA 3O3RA 1E5NA 4U3AA 3GVRA 3LMYA 3W71A 2AQOA 4ZSUA 2DZTA 3GXIA 3KM8A 4GGBA 3IUHA 1EJ7L 4NIRA 1IF2A 1U83A 1XLCA 3C8FA 3GFZA 3GU9A 1GOWA 3BCFA 1EJXC 3IVUA 4PUKA 1LUCA 3CH9A 1PEZA 1WCGA 1WOBA 3LPFA 4UC5A 3S6TA 1X7IA 1GOXA 1DJZA 3W22A 1ZJIA 3AMDA 4TX6A 1REQA 1QAPA 3EYPA 5AVHA 4C6MA 2WMIB 4PMRA 1BYAA 4ZO7A 2V5LA 5L6UA 1XXXA 4EWJA 4LY8A 2WM1A 4GJ1A 5CLWA 3E0WA 2E25A 2QVHA 1BEUA 3VMOA 3VNLA 4MAVA 4FNTA 4WY0F 2J13A 2GZXA 4V1XA 3GH4A 3RR1A 3MS8A 2XH4A 1JUEA 1OC6A 4NG3A 4M29A 3RX3A 4RJEA 4ZXLA 3PHAA 4JQ4A 3UYIA 2ZQ0A 1W3LA 5C55A 1S38A 2AKZA 4S2BA 3EX2A 3KL3A 3FXYA 3CL6A 3E38A 2GGGA 4F8XA 1XYMA 4QQUA 4CQ9A 1L6FA 3TUUA 4M7TA 3H26A 2ZXBA 2BGQA 5FCZA 2GGIA 3QC0A 3S5YA 3PBYA 4DVOA 1HL8A 1R46A 2J7HA 1GQLA 1Z3NA 3TN3A 3MY9A 3AMKA 4AUBA 4FNSA 4CN4A 1BVNP 4UTWC 3W7EA 3K1DA 1V3IA 4AW7A 1FH8A 2J7EA 1KM6A 3KFTA 4B91A 1UUQA 1W8GA 4AYSA 4J27A 2D2OA 5E6YA 1GQIA 3UQNA 3NXFA 1FTXA 3IGUA 3DKJA 1V3MA 3S1XA 3NJ3A 4DZ5A 1UW9A 2DSKA 1MSSA 2Z2BA 1GHRA 1VCVA 1LDCA 2CXEA 3L2LA 4KWWA 2IW0A 3WH7A 5T8GA 1AK5A 4PCFA 4EVZA 2WVTA 4ZGYA 5T91A 3GXDA 3CLMA 4LUIA 5HK4A 4H9YA 3OTRA 3PBVA 2VVSA 3T40A 3GIYA 3AAMA 1TMQA 4BR1A 1A49A 3AXKA 1O1HA 5K7JA 3MCNA 3REQA 3CUIA 3MCMA 4D6CA 6TIMA 2F6KA 5HWMA 3S5NA 1SFJA 4WJ8A 3WUFA 2JBMA 1B90A 4GO9A 4Z1CA 1SO6A 3NFUA 2FIQA 2HE8A 3FKKA 2D69A 1PV8A 3A9IA 3PPGA 3G8RA 1UQZA 1KFLA 2DVTA 3DESA 4A4AA 4N02A 1CLKA 2ZX8A 4IP7A 3LPOA 3RF9A 4ZE4A 3ZSSA 3DN5A 4JTUA 4HZ8A 4DYKA 2QKFA 2YCKX 4N2YA 4B2DD 2FFCA 3VC5A 3LBCA 3SM0A 5ABFA 4B3ZA 2PP0A 1OFOA 4Q6XA 1E40A 3TVAA 1OGGA 3W86A 4JBRA 3VKBA 2OSYA 4Q8TA 2WJFA 4S3EA 3VMNA 2IPFA 2Y85A 1GVSA 1U5VA 1KRCC 2IPGA 3GC2A 2Z4GA 4JYFA 3LV6A 4B5NA 3DFYA 2VOMA 1DJQA 3THUA 3M47A 3T0AA 1BYBA 2SFPA 5KSWA 4K1WA 5ABGA 3NVDA 2G0WA 5CSUA 3NGFA 3ZVHB 2DSWA 1QBBA 3EGJA 4LRTA 3PTDA 2WLZA 1NTHA 3R6IA 4QEHA 3VKAA 4PL1A 4XZMX 1VEOA 1WKYA 3G1VA 4E6MA 1MVYA 3WENA 2I9UA 1IZKA 1JIBA 8A3HA 4HA3A 4E8GA 4PC8A 2ZUMA 1M1BA 1OFDA 3CAQA 4O1FA 2WMIA 1LJYA 5G5IA 1A0EA 3DENA 1Y5WA 4AY7A 3HG4A 1S1RA 3Q94A 4DM2A 3BSGA 1NWTA 4ES4A 1L8PA 1XLEA 2R91A 4UTFA 3U9IA 1Q66A 2C1GA 4JTFA 3WK2A 1WDRA 4S3BA 1JYNA 2WZEA 2YFOA 4JS3A 3UPMA 5A8NA 3R58A 4Y8FA 5HINA 3WNLA 1OGSA 4IGNA 6XIMA 3EX4A 4HNVA 3OLIA 2V38A 1QOXA 1THFD 3GXNA 4U33A 3MBFA 1MFVA 4BF9A 2HS8A 1A3HA 1B31A 2ZA3A 4HMNA 3P61A 3ZR4A 4J3TA 4W7UA 1RLCL 2VL4A 1E0VA 4ONVA 1F61A 3PUGA 5A94A 1B0IA 3UY8A 1BYCA 2ALRA 1WDWA 4WHBA 3TV8A 4K7YA 4JCLA 3CEPA 5I3KA 1SJBA 5F2LA 1KWKA 2GJRA 2X7VA 4U5KA 3A13A 4XAPA 5CPOA 4ICMA 5E93A 1QASA 4WIWA 4ZODA 3W23A 3EOUA 3SUTA 1HKJA 2EF9A 4US6A 1GQJA 1V08A 3K8KA 5E0FA 3ZR5A 1AL8A 1GYLA 1GOQA 3BTNA 5CZ0A 3QV6A 5B80A 3O2LA 1W1IE 1HN1A 2QCDB 4RDYA 4LAKA 2DVUA 4HYWA 1BQCA 1VR6A 4P7OA 4X9YA 4M24A 1FX6A 1JYVA 4CU6A 3IIXA 2PDGA 1DTNA 4PUEA 3VK5A 1OX6A 4KEMA 2IMRA 3LEPA 1BSIA 1A47A 2IUZA 1ZRQA 2QIWA 3IAPA 3GYEA 3QV7A 3R25A 2PDPA 5C2XA 3O6DA 2NQLA 3PK7A 4OQVA 1HGWA 3NPVA 3G3DA 4Q7BA 1ZFJA 2FH6A 5GPRA 3CMJA 4Y6GA 2POZA 4QCEA 3HPXA 2QT3A 3AXIA 4GVFA 2VCAA 4HJFA 2PDJA 3B8IA 1R9YA 2EPKX 4A8NA 4H8NA 2HVMA 3KBSA 4DBUA 3EA1A 3BJSA 2FPYA 3Q58A 4JQ3A 1T99A 2VC6A 4TV5A 1QHOA 3PN8A 3EDJA 1XYLA 4GI6A 3S5ZA 3DDMA 3VIOA 2OLSA 5FEWA 2J6VA 2VM8A 3CASA 1IXPA 3S6DA 1TJ2A 2TRSA 1CLXA 1O5QA 2E68A 3WLOA 1LL7A 5I7GA 1KTNA 1EF3A 3CQ0A 3WIJA 4OV9A 2C19A 1WXJA 4QHRA 4HMEA 4XV0A 4PMNA 4MYAA 1UPPA 3ZVHA 2YSWA 5LHEA 4I9MA 1H1NA 3ARTA 4N42A 2ISWA 2PLCA 1V6UA 2V9DA 2OX1A 4IIDA 1H7PA 3M1ZA 4LYQA 1UR1A 3IANA 2BXZA 2ABAA 1B30A 1FWIC 3RUBL 4XZIA 3UG3A 1UR0A 5DLCA 5HMSA 4GINA 1D8WA 4FSAA 3GW0A 1E0WA 4B3KA 3W76A 1J96A 1AH0A 3BSHA 3DFHA 4TMBA 2YYTA 4HSNA 4GYJA 1UR9A 2CERA 4JYEA 3LY0A 1FKXA 1V7AA 3FDKA 3UCCA 1W9VA 1SO3A 9RUBA 1PVNA 1TPVA 3ZOAA 4J5NA 3VI2A 3INPA 1DV7A 1XUZA 1EOMA 5LA2A 1ZJHA 4UMCA 4JQ2A 2DGAA 5E6ZA 5TIMA 1BHGA 4JTTA 3FVMA 2PC4A 5DO8A 1UJQA 3T0CA 3MI6A 5E5CA 3Q37A 1GOOA 4AZIA 1SFTA 3VNZA 3N15A 3IV3A 4I7UA 3H23A 3WNNA 1SW7A 2XH0A 3S8HA 2VCCA 2C8NA 1JPKA 3E1F1 5AN7A 1V6YA 3N34A 3UNTA 1E73M 2TYSA 5A6TC 1LT8A 2H9AB 4WR3A 4ZCWA 4FK9A 3VGEA 3SRFA 1M6JA 3GZAA 3T42A 3B40A 1OSEA 8RUCA 3ABXA 4KFOA 4JGDA 3PPHA 2A6LA 4AWUA 4OE7A 5HAOA 3UXLA 3FEQA 4V15A 3UR7A 1LRTA 1XQKA 2BASA 3WFLA 3WLTA 4L9YA 1RQHA 4RE4A 4ECLA 4TVDA 1TWDA 1HKMA 3CHDA 5HA7A 2E9LA 3WQPA 3DFPA 3UR8A 3LCGA 3TMQA 3M0IA 3I6RA 4AVFA 1QPNA 4LALA 2QJGA 4IUGA 2EKCA 2ZVRA 4HSOA 4ROPA 3HO8A 3V7PA 4FI4A 3QY8A 3R2GA 5E0KA 2OCZA 1CNVA 4GI8A 4FX8A 1TJ0A 4OIFA 2V3GA 2QCDA 4XQ6A 3FY1A 1J2BA 4AZBA 1J01A 4Q4PA 3AIWA 4GMEA 5F2IA 2GPTA 4LJ3A 5FESA 5GJPA 3BOFA 2YA1A 5CLTA 1K03A 1IWAA 1OF8A 1TPH1 1VC4A 4AX6A 1T8XA 1ZQ5A 1Y8BA 3GFXA 2NSOA 1E0TA 4ZQMA 1YKWA 2FYMA 3ITGA 4CNPA 2PWDA 4NUWA 4Q4KA 3CYJA 2WJDA 3FAXA 5AY7A 3TH6A 4CN6A 2CIPA 2QUVA 4QS6A 1FWRA 2WW5A 3GXTA 3PANA 3PWGA 2FFIA 3IJ6A 2QGYA 3ARUA 5C5YA 4D1IA 4H8VA 4G1NA 2G3IA 4XAGA 1OK6A 4HMDA 3DUGA 2QCEA 3UCDA 3EWDA 1JDFA 2P0OA 4LAMA 4O13A 4UTIA 1JCMP 2I56A 5AOUA 1JD9A 4ORMA 3AIQA 1TKKA 3BO9A 1N8WA 3K30A 4U31A 4M6UA 1AZ2A 1BG4A 1FWJC 2R94A 1ZL1A 3RM9A 1E72M 4M51A 3ITXA 3DI1A 3BVJA 3TROA 4ATDA 3O9NA 4C6PA 1RA0A 3YPIA 1U5HA 3KRUA 3L21A 1EO7A 3S0CA 3QW4B 3WQ6A 3WFAA 4QAIA 4GLEA 4O1EA 2I5QA 3SY8A 4XTIA 4MADA 3V16A 2RDWA 4MHBA 2DIKA 1WDSA 3GDMA 2V2CA 3W9ZA 1KFCA 2NVCA 1MO0A 3F5KA 3GHSA 4XD3A 2E4TA 3FOKA 5FJPA 4H01A 3U7BA 4U3CA 3W1XA 3MV01 3UU0A 4KERA 3AISA 5IFTA 2D1ZA 4A3QA 4E4PA 1I2OA 3B0PA 2XWEA 4M8UA 3TTYA 1WQ5A 3MW7A 3CL7A 1SGJA 3GK0A 1B3WA 2ZZ6A 4IMGA 1Q3NA 2QCFA 3DHPA 4RR4A 1TRDA 2I57A 1J0YA 2X2YA 4HT3A 4QP0A 4UCGA 1JI1A 4XBJA 4N4PA 3UXDA 2ISSA 1Y7VA 4S3FA 2R6OA 1X1ZA 4DZHA 4C5YA 1EJRC 2H9AA 3G1SA 2GUYA 1QXLA 1VBJA 4EKJA 2WWDA 5FA5A 3SCTA 2J6XA 4IF2A 2V3EA 5ABTA 1SW0A 5LHFA 2L5HA 4QROA 1W1TA 5CAKA 3VOHA 4AY1A 4QNEA 4GC4A 2VJXA 1LBLA 4M6QA 5KMYA 2W66A 4UZUA 2QW5A 3SCWA 1KB3A 1FVPA 1XF0A 3RM4A 5FAGA 1J6PA 1A5KC 1E1FA 4EP8C 3ARPA 1L2QA 2PZNA 4CNUA 4U4MA 5CBBA 2BDQA 4V2XA 4HOZA 4LYKA 1FP8A 2VC7A 4OTKA 4LCRA 7ENLA 3POHA 4FXRA 3SQMA 3A4WA 1GOMA 4J3XA 6TAAA 3C2YA 1M04A 1PHWA 3UGRA 3VYLA 3U7VA 1XIMA 1F73A 3KOZA 3GAKA 3W3OA 1OD8A 3A6OA 1RVGA 1Z32X 4DLFA 4YIWA 2J4GA 1TUXA 1VBRA 3DERA 2X1TA 2A7PA 3IIZA 1AQ0A 4AZHA 4PR4A 5EMYA 3AMCA 4JDYA 3JS3A 3B9NA 1G5AA 3W0KA 3W7HA 2FVMA 1F9CA 2WMKA 3DAQA 3P67A 2PDFA 5BCAA 2FHFA 4H2HA 1RR2A 2XVLA 4L9XA 2VZOA 4DHGA 2YDSA 4XVDA 2RUSA 2ZCGA 3LN3A 3TYUA 3SEPA 2O0TA 3N29A 3HM7A 3W24A 4PMXA 1ITXA 2G5WA 2BVTA 1MI3A 1UP3A 4CNSA 2DZXA 1VLWA 3CIWA 4W7WA 4CNOA 1XH2A 1QRQA 2BB0A 2GJPA 3QVQA 4FNQA 3ERPA 4IICA 2ZWZA 3B05A 4BY3A 1E6PA 1ZAIA 2PF8A 1RD6A 4INFA 5C9ZA 2A3CA 5TF0A 1A3WA 1CZ1A 1XRFA 5BWFA 4K8HA 5TBOA 3RXZA 3WLHA 1TV8A 3BMWA 3VZYA 1GK8A 1EWEA 2RAGA 2CLHA 3QV8A 4J3ZA 4NNCA 5CQ1A 5FF0A 1XIJA 5CPMA 3OPSA 3BC9A 5I23A 2F6XA 5E1QA 2Z27A 2FPTA 4ZENA 1HW6A 1LOSA 2X41A 1VFSA 3GZ3A 4ZBCA 2X2GA 3LSCA 4GIEA 3KS5A 1XP3A 2QAFA 3LZ5A 1SJCA 1WAWA 1YTKA 4AF0B 2O9TA 2OTDA 4M19A 4HTBA 2VI0A 3WMSA 3W6MA 2DZVA 4JHZA 3A9BA 4O15A 2C14A 3MZNA 4C6IA 4QFUA 4PEEA 2X09A 5I00A 3R8RA 4WSJA 3FA5A 3NGJA 1IT8A 3VX0A 4F0RA 4L6OA 2F2KA 5I24A 4UTKA 2E77A 4JEQA 1V6VA 1N8FA 1XD1A 2NWRA 4EF8A 2P8BA 4UR7A 3TN6A 3EDFA 1OG0A 1XS2A 5LNWA 3A3XA 1H5YA 2CWNA 1J18A 3S1GA 4D6GA 4K39A 4XSMA 4IISA 1E9ZB 4ZB5A 3M0KA 4PTMA 3H2MA 3NZQA 2VC5A 3SUUA 3ZT5A 3N13A 4CD8A 3AS0A 1TX0A 3WQFA 3KVKA 1DXIA 1PZ3A 1R7OA 4CQAA 3LQGA 3E0FA 3VNYA 1DE6A 2ZX9A 1KCXA 1MDRA 3C6CA 1DEDA 3DFTA 1GONA 4ZQCA 5TAOA 1RXOB 2AAAA 2ZX7A 4F79A 3N4AA 3DHDA 3ABRA 5EBUA 1I75A 1PXGA 1M01A 1Q7QA 1B1YA 1FUYA 2ZXAA 3CGTA 3MHUA 4S39A 5G2IA 4K8EA 1MEIA 5DXXA 3WK0A 2X1SA 2OQLA 3EB3A 3O16A 1E56A 3G1AA 4ZO6A 1RV8A 1PYMA 1UBPC 3AMGA 3GVVA 3HPZA 3VDAA 1FWTA 3QEZA 4Y8EA 2ZUTA 3N6QA 3P0WA 3DXIA 1XQLA 1KKOA 5AHLA 1UMLA 4KCUA 3IV8A 4DM1A 5FF2A 3G0UA 4JTSA 2A5HA 4R53A 3VOCA 1RAKA 3MDWA 2DUXA 3POCA 3GVWA 2QPUA 4GI9A 4L1GA 4LVDA 3FYOA 2JIEA 4CQBA 2OELA 1KTBA 3P74A 1SU5A 5CBIA 3HA1A 3V5CA 4HK7A 4J9JA 2NQ9A 5F7UA 3ATZA 2NLYA 1PS9A 2QYGA 2R1LA 3OZMA 4GYFA 3WH6A 3KX6A 1YXCA 1E1EA 1VF8A 4F2UA 1UR8A 1V0MA 2J7DA 1M41A 2NT1A 3RNDA 1G94A 2VDGA 3BLKA 4ICCX 2R9RA 3AUJA 4ZTXA 3GR7A 1NDZA 5DX7A 2QDGA 1GZ1A 1A80A 1F7BA 1CEOA 1XIFA 3WMLA 4DWSB 1FWNA 1GTEA 3LXAA 3UVIA 1GVEA 1CT5A 2HPMA 3PP7A 3CU2A 4JHOA 1OYBA 2F7FA 1YNPA 2IKHA 4KRTA 4XAZA 1AJ2A 5LGZA 4BF7A 1NOFA 2W9MA 1B3OA 1AW5A 3WFZA 3DGRA 3LCLA 4GQQA 1H0GA 3FW6A 1XBVA 3AS3A 3CPGA 4QM1A 3LK6A 3DYOA 3OGSA 4D6JA 2W4XA 4OHQA 3D0CA 2PWUA 2WMGA 3MJMA 5D8ZA 2CNCA 2GJLA 4W7VA 3FJ6A 2ZZ2A 4LANA 4AF0A 3RGTA 4TV6A 5F2MA 1SFLA 3PZVA 1UROA 1WUFA 4WDWA 4BFAA 2E1WA 1O4UA 3AHVA 3SSZA 1XH0A 3LV5A 4RV3A 2VVNA 1RUSA 4QDPA 3EEGA 1M7PA 5FI8A 4PUWA 1M5WA 5CEWA 5AB3A 3B03A 2Z1VA 4GXPA 1EHNA 3U8GA 4F2BA 3EWBX 4NL1A 3TAOA 4F9DA 4FOUA 3ZQ9A 4W4QA 3FYPA 4Y9OA 4HNCA 2VR5A 1TZZA 4FXSA 3K2GA 1S2AA 2DY3A 1FWDC 1GJPA 4HPXA 4R9XA 2ZICA 1VIZA 3CQKA 4QE4A 4Y9NA 1UR4A 1X96A 3QLDA 2NXGA 5DEZA 3M5VA 1H51A 5C8BB 2ZVIA 3UT0A 2PGFA 2FVLA 3THDA 3BARA 1K8YA 5DCBA 2QAPA 9CGTA 7XIMA 1OFAA 3UWWA 2VC9A 1U1JA 4HHPA 1F5ZA 2BMBA 5MKGB 3H7UA 3TDFA 1UD4A 1AH4A 4L6HA 2WC7A 3NL3A 2VYOA 2TAAA 1A5LC 1KR0A 3A5VA 4Q3MA 4LV4A 4O54A 3OW1A 2W6RA 1AQMA 5CJ5A 1QVBA 4HVXA 1VIWA 1AZ1A 1OJXA 2DQXA 4E3VA 1W1ZA 1DWAM 4U10A 1ECQA 5D32A 1WNOA 4EPBC 1C7SA 4HB7A 1KLZA 2VEKA 1LCOA 3V75A 3QZEA 3H54A 1E4LA 3LCHA 1R8LA 2JALA 3TTOA 1Q8AA 5CKSA 4BQ5A 2FMNA 4MZYA 1VCGA 3LTYA 1JNEA 3MSYA 4PMUA 1B5TA 1Q6LA 2PLMA 3E5BA 2VQTA 3VNIA 4E0CA 2GJXB 2QF7A 3DFSA 1W9PA 3CMFA 1K9DA 4E3TA 1J10A 4UNKA 1EUAA 5H6HA 1FA2A 4F0KA 2A3EA 2ZFAA 1XSKA 2QR6A 1XLIA 5C9XA 3EKZA 3W1QA 3LM7A 1W3TA 1EEXA 1IT0A 4Q4MA 1EF2A 1EUNA 3T0TA 1JD7A 4YU1A 3LD5A 3KRBA 4JFWA 1RJRA 1ONXA 1DBTA 2YB4A 4ACYA 2KZHA 4IMFA 3W1RA 3CO8A 3F2CA 4Z2IA 1BWLA 3EMQA 3V3WA 1MXDA 3SR7A 1UQYA 3N6HA 4UOJA 4DWSA 4HU3A 4GISA 1RY0A 1J12A 3WQVA 1YTEA 1JQVA 2WZMA 3NDYA 3JRKA 5XINA 4XSLA 1OCQA 2QIIA 2F2HA 1A0DA 1GUVA 2FHBA 3GLCA 3R89A 3TA9A 4D71A 1JDDA 2Y7GA 4O12A 3NAVA 1TPB1 4P7NA 2DPEA 5CGQA 4RUBA 1K4HA 2HZGA 4Q8QA 3N2BA 4DI9A 4HPHA 2DIJA 4AWEA 2GDUA 3GTHA 2UY2A 5DMMA 1Z69A 1YBQB 1J0IA 3D47A 3ZFHA 2WZTA 5JH2A 4HOXA 4DB7A 5A6BA 4UOQA 1GGOA 3CV2A 4S3DA 2PODA 3ZIZA 1SUXA 1ZU8A 4MB3A 1SZEA 1UP2A 1YQ2A 3C5QA 2WQPA 3F5JA 2E9BA 3W25A 5B7YA 5BROA 4IIBA 2OT1A 1P6CA 1G67A 2QVNA 4JNMA 4MWAD 3TJXA 5FEPA 3HF3A 5D02A 4QR6A 8TIMA 2FZ8A 3DCPA 1JZ4A 2OLAA 4GBUA 4GYPA 5IXEA 2Y5JA 1ISWA 1CGVA 1S2UA 1QBAA 4KWOA 1K3UA 1NVMA 3G6LA 1U30A 1QNRA 3GW3A 2GVEA 5C70A 2PTZA 4HBKA 3M64A 2ZXDA 1PKMA 2BS9A 2FMOA 1NU5A 1E6XM 1CGXA 5HWNA 5MKGA 4ATWA 1TTPA 1B4KA 4X3ZA 3IARA 2ZZ4A 1AH3A 4PYSA 4KCTA 1GVQA 3HIJA 3A4AA 3QMSA 5AVNA 4GJJA 2BV9A 2ZUSA 1FCBA 3F7JA 1L6YA 4GOAA 3W7NA 2CLMA 2PWEA 3AHZA 5CG7A 2GVGA 4W88A 1TV4A 4MJ4A 5CH9A 1H60A 1H41A 4RDWA 3N3MA 3W83A 3K1GA 4C91A 4H9MA 5FF4A 1TE6A 3DG6A 2HDJA 3QGAC 3NSXA 1T6MA 3LI0A 3TQVA 2HK1A 3LI1A 1W5PA 5HANA 5EFDA 3LHTA 3A3HA 1XYAA 5KZDA 2R24A 5CPNA 2GQ9A 5F1UA 1ZB5A 2GSJA 2J8TA 1X8CA 3R0UA 3NYDA 3TC6A 4C6CA 3S2NA 2GJXA 3VO0A 3IWPA 1Z41A 1UC4A 1O12A 3N11A 4KPLA 4A21A 3A4JA 3GM8A 4WSKA 2XIIA 3WLIA 4A6GA 1FKWA 1JZ7A 3SURA 5JBEA 3WJXA 1XWYA 3HGSA 1UH2A 5I3HA 2OOGA 3WX7A 4IP5A 1HXJA 4NQ1A 1WDPA 1BXNA 1VH7A 4S38A 2X8RA 1TWWA 3NR0A 3WUGA 4ZQNA 1LRNA 4L65A 2V5DA 3VAVA 1U1UA 4AD3A 2WCAA 3TONA 2Q01A 4FIQA 3T05A 2G3NA 3KTSA 1CXKA 3EPMA 1JUBA 3IS4A 4XISA 1XIEA 3PG9A 2VX7A 1JRCA 3E6EA 4CD4A 3AIUA 1DWFM 5D38A 3CC1A 5T26A 2A2IA 2WKJA 3G5EA 5F1VA 1AMYA 4C6DA 4WEVX 3G3MA 4PRRA 4IQJA 3CZJA 4XK2A 4WKAA 2PP1A 1FFRA 4KWSA 3VUSA 1KKRA 3RMJA 1PX3A 3WLRA 5U7SA 1HJQA 1JDCA 4ERAA 1ZSXA 4GZIA 1CENA 3H4WA 1YBQA 3HURA 4P5UA 3LLDA 1BGGA 3R5EA 2GLKA 4LB4A 2Z1BA 4C1KA 3FNDA 5ECUA 3DC0A 3MUXA 2PRLA 5JU6A 3MTWA 4IPLA 3B8UA 2C1IA 1WB0A 2DT0A 3AU2A 3CZGA 3B8WA 3C86A 3WLQA 2QJNA 1JUKA 4J7RA 3OIXA 1D2KA 1L6GA 2CBIA 3BAJA 1KRAC 5IBXA 3JZUA 2PS2A 4F0HA 3BG5A 1G4TA 3H6OA 1PKNA 1Q6OA 5CC5A 3AYRA 4YHEA 4YVVA 2JKEA 4QJ5B 3PSWA 5FL1A 2VRJA 2WYSA 1F4HA 4JFVA 4YXGA 5HNTA 3ELFA 4HZMA 1MMFA 3B04A 3KVLA 1PTGA 3WDIA 4WGXA 2J47A 4YTSA 2Y62A 3EXRA 2D2JA 2BOGX 3NZGA 2C1HA 4XUYA 1JFHA 4R3UA 4MIMA 4US5D 4C65A 2OG9A 3LDVA 3Q67A 5DRIA 2WHJA 1SMDA 4D8AA 5A6MA 3QMRA 3G1HA 1AW1A 1PDZA 1UPMB 1C93A 1YX1A 4WX2A 1B54A 1GG1A 2YA2A 3PTMA 5E9XA 4I6VA 3VCRA 1UD8A 3VC6A 4LVGA 1B3XA 4IGMA 2ZA1A 4S2CA 3WEOA 5E0CA 3CH0A 4UMAA 1PCKA 3C2VA 1CI1A 3H2AA 3H70A 5D2VA 3QSRA 3E5PA 1OCNA 4ADUA 3WF2A 3COTA 3FSTA 1XLAA 4RZ5A 3ES8A 1YXYA 1UWRA 4MNJA 4UCFA 4Z2LA 3B9DA 4PBEA 4Q8OA 4V33A 1I45A 2DZUA 4IGHA 2WCGA 3EXTA 3IVTA 4IGSA 4PGLA 4XO7A 5J04A 4FF5A 2G4FA 1E6QM 4O57A 1R38A 1TFVA 1LLWA 1A5BA 3QPYA 3GBEA 1KWGA 3W2UA 1S2CA 1OFBA 3WF3A 1HKVA 1GT8A 1KCZA 2E7FA 2BP1A 2C16A 1C90A 3T44A 3H24A 3WDPP 4P8UA 4LCSA 3PAOA 1DWGM 4LBUA 4M6VA 3LCIA 2WNNA 1P0DA 3EBVA 4DIAA 3BE7A 2JGQA 4KETA 1XL9A 1JCJA 2PF0A 3SI9A 4C6BA 2OB3A 1W91A 1EJSC 1P0BA 2PD5A 3VNMA 4W86A 1E6SM 3EMZA 2YXGA 1LBMA 1NFGA 6A3HA 3VD9A 1G7VA 4IPJA 3Q2DA 2FZBA 4WF7A 4PBGA 1Z8AA 1EPXA 4B5TA 4XD6A 3ME3A 2Z6IA 4JEJA 3L0GA 2OMAA 2PDUA 1TSIA 1J0KA 1JCTA 4NJGA 2PB1A 3W01A 3IGXA 1H11A 3VNKA 4DJEA 4IFRA 1XKYA 2XVGA 5AECA 3NCOA 3UBPC 1PWLA 5I2UA 3BPWA 4GE8A 2VD9A 3MI2A 4W8BA 1XG3A 1W17A 3NPWA 3C3UA 3A12A 5EKYA 3TKFA 3O6CA 1Q6EA 4O1AA 2VP8A 2A85A 1I1WA 3W28A 3AYTA 5HATA 3M4HA 4DX3A 5A2BA 4ATLA 4AD4A 4OGZA 1GG0A 4NYYA 2X0HA 1J11A 4D6IA 3EB2A 5G4WA 3GTNA 4W8LA 4ZFMA 5BOOA 3ATYA 1TWIA 1EJTC 4ZB0A 2Q02A 3C3NA 2YW4A 4PTXA 4GGHA 3JU2A 2XZ7A 3L5MA 1UOZA 3B4YA 5DBTA 1XICA 1EGMA 3G77A 5J8LA 1OINA 1OFQA 4L64A 3BLLA 3UZXA 5DXYA 6CGTA 3O0FA 5GJMA 1EYEA 4ZVJA 1HIZA 5HMFA 5LYRA 2QJHA 4KCVA 3NDOA 1RSCA 3OA3A 3H55A 4JY8A 4LW7A 2WM0A 3LM3A 2ZADA 4I5UA 5D33A 3W1NA 1WP6A 4LAOA 4PA8A 3N19B 2O7QA 1Q4WA 5H91A 3WL1A 3DYPA 2CHNA 3TOPA 5F4XA 2CLLA 1SR9A 5AC8A 3KW3A 4Y2WA 4AIUA 3CUXA 1MRAA 3S2LA 2GVJA 2V0TA 1KRMA 2QCMA 2FPVA 2XTKA 3MVIA 1HF6A 1XV8A 3PJWA 2G96A 4RK8A 5AC7A 2P1FA 2WK2A 3E3HA 1O5RA 4LAZA 4CLMA 3CV7A 3M46A 3VOJA 4B90A 4O0KA 2VR2A 1NELA 1L6SA 3TXVA 3F4CA 1L6WA 1BF2A 1SSGA 1MQQA 3IJ9A 4V28A 2OZTA 2WB5A 2Z26A 4RPQA 1V3JA 3VIJA 2J25A 6XIAA 1SMAA 2CPUA 1V3KA 1S5NA 3R0DA 3SGGA 1XIBA 4J2MA 1CXLA 3NO3A 1FXQA 3L66A 4QDWA 5C0QA 3BOXA 2HWGA 1VRXA 4GVIA 4EWND 4JX6A 3PTKA 3ZMRA 1TPEA 3WBEA 3CPUA 4QE1A 3H4XA 1QO2A 3CV1A 4BQ4A 2CHOA 1Q8JA 4S3AA 2DORA 3ZLFA 1GHSA 4NHVA 4YTRA 5I3FA 3TEVA 3DC8A 3QHNA 3CWNA 3UZ5A 1G69A 2YZRA 3TTSA 3W6LA 3ECQA 2DZAA 3AWOA 4ZOCA 4F3HA 4Z1YA 3BICA 3CEUA 3RLUA 1K77A 2VQUA 3GG7A 4UQEA 1VKFA 1J6OA 1UKOA 1POJA 4U5IA 2ANUA 3BZJA 1NAL1 4ML4A 5G1YA 1M7XA 4DJFA 4MTVA 4QAWA 2PRHA 4MY1A 2BVDA 3UZYA 1GJWA 3A21A 3CAWA 2ZZ7A 1JI2A 5DANA 2QQ6A 5FKYA 4DZIA 1ADDA 1HGYA 1XH1A 1A5MC 1AODA 3MC5A 4AIOA 1JL8A 3WEZA 3F4WA 1AVAA 5I3GA 5FL0A 1JPMA 1HQTA 4R85A 3MP4A 3GH7A 1LBFA 1FCQA 4WXZA 3G1XA 2Y7FA 5H2ZA 1R87A 4E5TA 3ITTA 1H0IA 2FKPA 4QJ4B 2F61A 1DWIM 3KBVA 2MNRA 1TIWA 3ZJ6A 1BKSA 1KM4A 1WYIA 2VRKA 4TXEA 2YCIX 1VBHA 2EPHA 3KOWA 3SY1A 3SCRA 3FJ4A 2HVOA 2P8CA 4IJRA 4MDPA 2WHKA 4KGJA 3IJLA 4AEEA 2CC0A 1VP5A 4RXGA 4XZ9A 4Q4SA 3NQVA 2OFJA 2PDHA 3B8DA 2CBJA 1H62A 2P76A 1W5NA 5A6KA 3E74A 3EZ4A 4ZEPA 4KESA 3KLLA 2HVNA 2UV8G 4ZOAA 3ID7A 4UTTC 5BXTA 2HMCA 4AZGA 2VX5A 3IK2A 1EPVA 3KBJA 3AS2A 1QTWA 3S42A 2G3JA 1JF5A 1XPGA 5K9XA 2YBTA 5LXXA 4YCPA 3D3AA 1NWSA 1UCWA 1YDVA 3ZYZA 1ZCCA 2CKRA 3TTEA 2YDRA 3BURA 3U5YA 3B0YA 1ECEA 2PDQA 5CZKA 2FJUB 5D9PA 3W00A 4AVNA 5A3HA 4LYRA 3H2OA 3KRSA 5TNVA 3UJEA 3ZO9A 4IM4A 2XGBA 1RQEA 1G9HA 1IZJA 6ALDA 1A5AA 5GVJA 3M0JA 1H7WA 1LQAA 2J7FA 3KL5A 3TJIA 3O06A 1TRIA 2EPMX 3VGHA 3E0VA 4OZOA 4KKXA 1W37A 3WQDA 2PC8A 2IQ0A 1DJHA 4UWMA 5C9UA 2CZDA 4HSHA 1YPXA 2ZZ5A 4HD5A 3GWQA 1EKOA 3I4KA 3IJ7A 4KH2A 4OJYA 4QJ1A 4ZL1A 1KV5A 4CEXC 2CZFA 1V02A 4D9PA 2WNZA 3RIKA 5CPTA 3MB9A 4EXBA 5A8PA 3AXMA 3S6OA 2WMJA 1PDYA 2GQ3A 3P0XA 3ARWA 3STPA 1Z6KA 2WBKA 3M0MA 2BNJA 3AWNA 3CM4A 2X0SA 4KRZA 5HQMA 4LUSB 4LV9A 4JDBA 3QQ1A 4WRHA 3WQ4A 2YZ5A 3NL5A 3P60A 3P7YA 3R8GA 4C5ZA 3LSBA 4DAIA 2WVSA 1Q7ZA 4F66A 3T4CA 1JNDA 1D9EA 3CXOA 2XYLA 2VEFA 1X97A 2ONEA 3VX1A 4IMAA 1E3XA 1RK5A 3LXCA 3CB3A 4PUMA 3VKCA 4X60A 1ZY9A 1EZWA 3SY5A 3WD3A 4B15A 5AHEA 1PL9A 1RCOB 3VM5A 2WOQA 1XYFA 4IX0A 3FFSA 1OIFA 3ARXA 1C8QA 1YE4A 3UJSA 5D37A 1S2TA 4FOJA 3NOYA 3WH9A 1JXKA 4HNTA 2JKPA 3WQ5A 1QPQA 1OABA 2B7OA 5AHFA 2XVKA 2E6AA 2QCLA 3UF9A 1E70M 3AXXA 1HJXA 1R47A 4Y9PA 1MZHA 1U1HA 4ZQPA 4DWSC 2P0IA 5DBUA 4J3UA 2PTDA 4GWEA 1RD5A 2AKMA 3NM1A 4RZ4A 4MVAA 4AD1A 4CUCA 1P1XA 3G0SA 1M3UA 1UD6A 1JFXA 2Q8ZA 3E12A 3OBKA 4XO6A 3W37A 1RP9A 4H7ZA 4N6FA 3T78A 2R1PA 5EMKA 1O6IA 4HYRA 3KOYA 1OY0A 2NX3A 3N18A 3NPXA 3TW7A 4ZSTA 2Z2AA 1YDOA 3GD6A 3KCOA 4DF0A 5DY2A 4DY1A 1GZGA 4NSBA 1VFFA 3R79A 4IIEA 4AD0A 1Q65A 4ZTYA 4PN2A 2GWNA 2GVYA 1TV7A 2RJHA 1KTCA 3DECA 5FJOA 5T9CE 1V8EA 1ICQA 2EEXA 5C7HA 1UWQA 1PZ1A 3ANYA 3VGDA 4HZ6A 4X2RA 3RLHA 2ZC8A 2A3LA 1VHNA 3K4DA 3PZUA 1ODZA 3MDUA 2ABBA 3SQLA 3L4TA 1NOWA 1XGDA 2FGZA 3T2OA 3AALA 3S2JA 4G1KA 4GYPC 3PS7A 3WF4A 3FN9A 1LQ0A 3KOFA 4GNVA 1O5XA 2AOSA 3ARQA 3WSUA 1VPXA 1KQZA 1XLLA 1L9WA 3V0TA 1EH9A 3MMUA 1R7AA 4B9YA 4CQDA 3LRMA 3UR2A 4WZHA 3FK4A 3K13A 2O4QA 4HU0A 4YYCA 3H7VA 2VZVA 2CFFA 3NYZA 4A35A 4LNCA 4PL2A