1V7AA

Crystal structures of adenosine deaminase complexed with potent inhibitors
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenosine deaminase
publication title Structure-based design and synthesis of non-nucleoside, potent, and orally bioavailable adenosine deaminase inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 143
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2003-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1v7aA00
3O0FA 4E3TA 1RJQA 3BE7A 2R1PA 4BY3A 4J35A 2I5GA 2DVXA 3ICJA 1K1DA 4IGMA 4IQJA 3E0FA 3B40A 3DUGA 4CNUA 2W9MA 5FSEC 1M68A 1M7JA 1NDWA 3MVIA 3OU8A 4RE0A 1QW7A 1K70A 3ITCA 3GRIA 1I0DA 3QY6A 3T8LA 4EPKA 2EG6A 3K2GA 4KIRA 1XWYA 4IG2A 2Z2BA 4H01A 1ZZMA 3UR5A 2FFIA 4QS5A 1O12A 2XIOA 3OOQA 4EPDC 2YB4A 2KAUC 2Z00A 3FEQA 2UZ9A 1UIPA 4QROA 1EJTC 3JZEA 1K6WA 3NQBA 2GWNA 2BGNE 4CEXC 1UIOA 3F4DA 3NEHA 3V7PA 4QSFA 1POJA 1E9YB 2D2GA 4LCQA 4CQDA 3UBPC 2G3FA 4CQBA 1A5NC 4G2DA 2Q01A 1R9ZA 1JGMA 4DZIA 2HPIA 1EJUC 3LY0A 4C6KA 4B3ZA 4QTGA 1GKRA 1FWCC 4C6JA 4C6DA 3GTIA 2R1LA 3A4JA 2E25A 3SO7A 4ZSUA 3TN5A 1J6OA 4DLMA 2UBPC 3RYSA 4C6NA 2Z27A 4GX9A 3IGHX 1V7AA 3IV8A 4RDYA 4G7EA 4F0SA 2QT3A 2HNHA 4C6IA 1GKPA 2VC7A 3MPGA 1A5LC 4L9XA 1FWIC 4CNTA 1S3TC 3URQA 4C5YA 3E38A 4IF2A 3GTHA 1YNYA 1NDYA 4H9UA 4BJHA 4GY0A 3IJ6A 4INFA 3T1GA 3E2VA 3UR2A 2Z26A 4NP7A 3GU9A 2FVMA 4LCSA 3HTWA 1V77A 1NDZA 4C6OA 3FDGA 4DIAA 3F4CA 4IGNA 4DNMA 4UBPC 1E9ZB 1PB0A 4DZHA 4KEZA 5CH9A 3ISIX 2HPMA 2FVKA 3IRSA 4R7WA 4JOMA 2DVUA 2YXOA 2QPXA 4GZ7A 4G7EB 3TN6A 2OOFA 3MTWA 4IFKA 1IE7C 3WYZA 4C6QA 2R1MA 4GBDA 1YBQA 2Z28A 5A6TC 3WZ0E 1RK5A 3ID7A 1EJSC 2OQLA 4LANA 1FWBC 3QGAC 3O7UA 3LSCA 2IMRA 3UF9A 4HK5A 4PBFA 3SFWA 4XD6A 2P53A 4LAOA 4DO7A 3AU2A 2HBVA 4V1XA 4D8LA 1UMLA 1V51A 4AQLA 1ITQA 3DC8A 4OFCA 4ERIA 1P6CA 4H00A 4IH3A 4H9TA 1ONWA 3F2DA 1EJXC 1W1IE 4KETA 1YMYA 3EWCA 4RDZA 2WJFA 3GU2A 3A3XA 4DYKA 2VM8A 4XD3A 4I6VA 1HZYA 3QY8A 5G4HC 3CAKA 1QXLA 4XAGA 3PNZA 4R85A 2PUZA 4GX8A 2O4MA 1ONXA 3KM8A 4IFKB 2GWGA 4PCPA 4B90A 4GK8A 3E74A 3GIQA 4ZSTA 4I6KA 4IG2B 4C6CA 4AC7C 3B0YA 3S2JA 4LFYA 2E1WA 4YIWA 2R1KA 5AKQA 1WXYA 2PGFA 3OVGA 1POKA 3FDKA 1XRTA 1RA0A 3PANA 1KRCC 3IARA 1EJRC 2QVNA 3F2BA 3GTXA 3PNUA 1FWJC 4B92A 1V79A 3GU1A 1EJVC 4B91A 2GSEA 1XRFA 2GOKA 3G77A 2PGRA 3RN6A 3A3WA 3K4WA 4C5ZA 4ERAA 1RAKA 1R9XA 1KRBC 2FTYA 5E5CA 1FKWA 4GOAA 2YZ5A 1P1MA 4HK7A 3LU2A 3OQEA 2F6KA 4BKNA 4KQNA 3URBA 4R88A 3S2MA 4C6MA 4EPBC 4XD4A 3LGDA 3E0LA 1KRAC 2I9UA 3HPAA 1A5KC 4TQTA 4RDVA 2WJDA 3DCPA 4XAZA 1FWEC 2QS8A 3S2NA 2EG7A 3LGGA 2O4QA 5FSDC 4M51A 3MJMA 3LS9A 4KERA 4LAMA 4NI8A 4EP8C 4J2MA 2VHLA 2Z7GA 4XAYA 4LCRA 4MUPA 2D2JA 1BF6A 3S4TA 1FWHC 4F0RA 4RZBA 1WXZA 3EWDA 4XD5A 3S2LA 4H9VA 4WGXA 4IFOA 3GG7A 3PAOA 3E3HA 4L6DA 3MDUA 4H9ZA 4Z42C 3N2CA 1PTAA 3MSRA 2ANUA 2DVTA 2VR2A 3WMLA 1ADDA 4PE8A 4J5NA 1P6BA 1FWDC 5HMEA 1RA5A 4CQCA 2WJEA 2D2HA 5HMDA 2GZXA 1NDVA 2OODA 4RDWA 4C6BA 2CZVA 4WHBA 4QRNA 4GY7A 2Y1HA 4PBEA 3MKVA 1J79A 1RK6A 1VFLA 4HA0A 1FWFC 1RJRA 2AQOA 4QS6A 4V1YA 3LNPA 3IACA 1XGEA 3LSBA 2PLMA 3TN4A 4C6FA 3URNA 3CS2A 4CNSA 4C65A 2VC5A 2BB0A 4UB9A 3CJPA 3EGJA 3TN3A 3D6NA 2AQVA 2P50A 2VUNA 3K5XA 2PAJA 1KCXA 1A5OC 1J6PA 3URAA 3GTFA 1J5SA 1EZ2A 2Z25A 1YBQB 1DPMA 3T81A 2Z2AA 3GUWA 1UBPC 3TNBA 2Z29A 2A3LA 1YIXA 3MDWA 4ERGA 2WM1A 3NURA 2OGJA 2EG8A 1V4YA 1EJWC 3ORWA 3F2CA 4LALA 1GKQA 3PBMA 4KESA 4XAFA 4C6EA 1PSCA 3B0XA 1KRMA 1PO9A 2HBXA 3LA4A 3R0DA 1FWAC 2ADAA 3UPMA 1A4MA 2Z24A 1RJPA 3RHGA 4HK6A 5HMFA 2Q09A 3OJGA 3QY7A 2RAGA 4KEUA 1R9YA 3QGKC 4GY1A 4DI9A 3OODA 4KEVA 2Z4GA 4GYFA 4ICMA 1FWGC 2OB3A 4LH8A 3GIPA 3HM7A 5LXXA 4WVXA 4LAKA 4P5UA 1A5MC 3RCMA 1ITUA 4LEFA 3C86A 4GC3A 2R1NA 1FKXA 4GXWA 4DLFA 1I0BA 3MVTA 4C6PA 1EF2A 2ICSA 4F0LA 4NG3A 2FTWA 4H9MA 2HQAA 1M65A 3IPWA 4CEUC 4DI8A 4H9YA 4HJWA 2ZC1A 3AUOA 2AMXA 1YRRA 1O5RA 1EYWA 2YB1A 1A4LA 4IFRA 4C60A 1NFGA 4EPEC 3AU6A 4PCNA 4H9XA 4KF1A 4C6LA
chains in the Genus database with same CATH superfamily
3R94A 3QKZA 3ICJA 2YXGA 1XG4A 3W7HA 3SW6A 5I06A 4AD3A 1HL9A 1AQFA 1ODZA 4AHPA 1FDZA 3WQDA 4IPNB 3EB3A 5FSEC 1EO5A 5I02A 3EX1A 3SN4A 4PMQA 3SCRA 5FEXA 4QBXA 3MVIA 3R13A 1W1A1 4FX7A 3BDKA 1E9LA 4CD6A 1M7PA 4Y8EA 2DJLA 4P7OA 2Q3RA 4DB7A 5IDIA 4EPDC 2VURA 3UERA 4HNVA 4Q32A 4IMEA 4PMYA 4S3DA 4XZMX 4J3TA 1G5AA 4BFAA 1IEQA 3SB0A 1A5BA 4CD5A 1L0PA 1NOWA 3TTQA 1EH9A 4PTWA 3HG5A 2YYTA 5IDZA 1TA3B 3PZVA 2VKZG 1YDNA 1WDWA 4NSBA 3C5QA 1R9ZA 2VFHA 4GGBA 4DQWA 1UP2A 1ZB5A 1TPWA 3UWQA 4RUBA 3N15A 4LBRA 1XPGA 5J5DA 1GKRA 5MKGB 3PG9A 4S1FA 2VVNA 2BXVA 3QHNA 3PS7A 3PZOA 3TN5A 4FR1A 2YZRA 6TAAA 5C71A 3T08A 1CW2A 1RCOB 3T40A 2IQTA 2P5NA 2OELA 4GBUA 3PTDA 3GDTA 3UJEA 4GIAA 3T4WA 3L4YA 1AZ2A 4MNJA 4YLWA 1KXVA 4PB3A 2BVTA 4J3VA 1R85A 1JZ6A 2CBUA 5EY5A 3DFHA 1A50A 3LQLA 3PM6A 3H23A 4HHLA 1VC4A 1HJSA 3NQFA 4LCSA 4NNCA 5HUPA 5D2YA 3L2LA 4M7SA 7TAAA 1SUXA 2BTMA 4DEFA 1JXKA 3SSJA 3B9NA 3VVGA 1AQMA 1T6MA 4HA4A 1E70M 4OU1A 1LOLA 4FEZA 1GG0A 2V5BA 4LS1A 3GSMA 2OLSA 4WUIA 1BFNA 1R3QA 1E0UA 4UFIA 3OGRA 2OYKA 2WMIA 2ZZ5A 1UWUA 1XDMA 3M44A 2IUZA 3NG3A 4NJHA 1W9BM 2Z28A 4AC1X 2VGBA 2X0YA 4GA8A 3UJRA 4D8ZA 5BOFA 3A47A 2OQLA 3QGAC 3GVGA 4KGJA 3LSCA 4L6HA 4D6HA 4HK5A 1DXFA 1A47A 3M9YA 4WDUA 1UMLA 2XIMA 5HQLA 3GUGA 5GVJA 2CZEA 2FGLA 3VIGA 1P6CA 4MB1A 4IH3A 2EKGA 4K8GA 3GVRA 3CTTA 4E4PA 1CBGA 3EWCA 2VZSA 3VD5A 4I6VA 3WDRA 5FL1A 4LYPA 1SGJA 4GKLA 1VP5A 3CAWA 3KBJA 2XTKA 2J24A 1OB0A 1XLDA 4Y9MA 4QDMA 1B2YA 2V0TA 3N3MA 4FLOA 4UTTA 5JH1A 3G6MA 3U5UA 1ZNNA 3B3DA 3QZAA 1E1CA 4HNOA 3GE7A 1LBMA 1XW8A 3NSXA 1XBVA 4BQ3A 4P8VA 1PIFA 3P61A 4JD4A 4UTTC 1L8NA 3TCSA 2NUXA 4P2VA 1R47A 3OGVA 1TIWA 1Q5MA 1K8ZA 1VYSX 4DX3A 4LAUA 1KBLA 3UA4A 1GOXA 1RH9A 4ATWA 4CQ9A 1CLKA 5BWAA 3KL0A 3MYPA 2PEVA 5C2GA 1V3LA 3KWXA 3T07A 3FFSA 3ZT6A 9XIAA 1IXNA 2QW5A 8A3HA 4Q4SA 2JGQA 1J0IA 4F9DA 1W9UA 3AZRA 3PUOA 3UG3A 4DJDA 1BF6A 3S4TA 2ZDSA 3BV4A 2A4AA 3BSHA 4L5ZA 3V36A 2YCLB 3OPSA 1PDYA 5CQ1A 2YCKX 2ZUUA 5E9AA 2VCAA 3H2EA 3SY8A 3TQ0A 4RDWA 4WHBA 4V2XA 1K9FA 4DJDC 1RP9A 5IBXA 1WE5A 1AL8A 1JPIA 3KBWA 3L0GA 1HXJA 4K3ZA 2POTA 3G5EA 2QJMA 3ZQ9A 1W1PA 4C6FA 4W7VA 2JKAA 4NY2A 3W07A 4UB9A 4CU8A 1GVQA 3EGJA 2W4XA 1DVJA 3O15A 3SRHA 3GFXA 1M01A 1NFPA 5KZDA 1ZJHA 5IBXC 3CUXA 3WNKA 4F8XA 3U2OA 3GAYA 1QDSA 4UQ9A 3L4TA 4UFLA 4K7VA 4HCLA 1SYTA 3WJZA 1EJWC 3M47A 3F2CA 1C7SA 3H2CA 1EIBA 4XAFA 3C2YA 1PSCA 1KRMA 1TPVA 1UZ4A 1MI3A 3ZSTA 4TUFA 4Q8OA 1EEPA 2HRWA 3OJGA 3LPGA 1DWHM 1XLLA 5E0KA 3E96A 1XFBA 2OKOA 3CLWA 5HUOA 3DXIA 2CHNA 4IISA 2WZMA 2VFEA 1V3IA 3KWSA 1NY1A 3EMZA 1A80A 2OB3A 3TQPA 3OB8A 4TMCA 4UTHA 1HGYA 4C1NB 5A2BA 2IPJA 4AIEA 1Z8AA 2Z1XA 2PDPA 1FKXA 4PRRA 3UA3A 5AC8A 3T0DA 2GVYA 1HQTA 3AHZA 3AUOA 1O5RA 1W3JA 1GOKA 4AZCB 2FB3A 1OD8A 4KWVA 4Z2KA 4EPEC 1OY0A 3MUCA 4AG0A 4GPNA 3HJZA 5HJLA 5EMUA 5L9FA 2BV9A 4E4UA 1ZBKA 4JY8A 2WCAA 3EDDA 5I00A 2YPIA 4XKYB 1PBGA 2ZX5A 4MADA 1CEOA 4JHMA 4E6MA 1ZL1A 2CLIA 1XQKA 3YPIA 1OK6A 2RKXA 2FH8A 3I4KA 1MW2A 5BW6A 5LIWX 1PKMA 1EJTC 1A0DA 3WK3A 3NQBA 3R79A 2W27A 4CEXC 2VNCA 3MYOA 5FEWA 4AIBA 1O6IA 3VIOA 3CWOX 1POJA 1FCVA 2J4GA 2D2GA 4ZQPA 4I90A 4S39A 4KCWA 3N9SA 4RXFA 3N2BA 2E9LA 1OINA 3WF3A 1JYNA 3WH6A 2J7BA 1S46A 2IXVA 1HP4A 2WZHA 3L7RA 1FXQA 1IXOA 4ZQNA 1MFUA 1ZP3A 4C6DA 1VRDA 2WNNA 4HU8A 1XC4A 4NASA 3MI3A 4FX6M 3GNOA 5CJ5A 1W5NA 1Q6QA 2AMGA 3LZ5A 3WL1A 3AS0A 3WLTA 3VUPA 1QPNA 3AO0A 2JF6A 3TYDA 1I1WA 1TPDA 1ZQ5A 5ECUA 1F5ZA 3RMEA 4HYRA 2FGZA 1TRDA 3USBA 4EXAA 3W7NA 1G7UA 5LSMA 3QJAA 1FCQA 3FK4A 1XIBA 5I24A 4BJHA 1EPXA 4GZIA 3WEOA 3RR4A 1O1ZA 3ZWSA 4C91A 3HG3A 4XBKA 4IGNA 3HURA 4UBPC 2GJPA 4JTFA 2FIQA 1J8VA 3IRSA 2INFA 4RW3A 3SIZA 5EKYA 1V6TA 4B2DA 1DIOA 1GVOA 1PKLA 2X05A 1ITCA 3G1AA 1B3VA 2BS9A 3TTEA 3U7BA 4Z2JA 4PBFA 3SFWA 5CAHA 2WAGA 4XD6A 4V1XA 4AQLA 2XFRA 4OFCA 3MQTA 4HPJA 1PX4A 4D71A 4ZMGA 3VNLA 2X30A 3LLXA 3U2ZA 2V3GA 4YTQA 1XLBA 2J78A 3W1PA 3G1SA 4ML4A 3EXSA 4RCXA 2Q8XA 4UOZA 3CLMA 1OCQA 3BW4A 4W5UA 4AWEA 2WNWA 3E74A 4M6VA 4PMUA 5H8PA 3K4AA 1F73A 1KTNA 3B0YA 1FFQA 3MUIA 4IJBA 2AKMA 4IUOA 2D73A 2QDDA 4S2CA 2ZXDA 5BRBA 4ALDA 2JF7A 1ADOA 1YX1A 3W7MA 4B9ZA 2DZXA 2VOTA 3B4UA 1MWOA 2PS2A 3EKLA 3U9IA 4GABA 1XIIA 3H2AA 1U1JA 2VEFA 2VXNA 2CKSA 5CBIA 1ZPTA 4ERAA 3AYTA 2OVLA 1Z6KA 4TMBA 2BXZA 3CH0A 4MJMA 3LPPA 4Q7IA 1QUMA 4BCEA 3RPTA 3UZXA 2A1YA 2J75A 1O4UA 1H7OA 1XD0A 2QS8A 1XCXA 3S2NA 5D30A 3CWNA 3W85A 1PKNA 3AZTA 3MJMA 3B9OA 2FHCA 1FX6A 4FHAA 4MUPA 4BI6A 4JL2A 3M5ZA 3EPMA 1FWHC 1OGBA 4FOUA 5IHRA 1W1ZA 3T4CA 1C8VA 2FJUB 4L6DA 2I7GA 2ZX8A 2XFFA 1WB0A 3PZMA 3O9NA 4ORIA 5T9CE 1MRQA 2CZVA 1LUCB 3VNZA 5BXSA 4FP1A 4HA0A 1FWFC 4C7GA 4CU7A 1QK0A 3PTQA 3P5ZA 3UJFA 4HGXA 2YL9A 1REQA 4S3CA 4XVDA 1J10A 1B57A 5CSUA 1PS9A 2QPSA 5FEPA 1R3VA 4JGDA 4DJEA 3TN3A 4XIMA 3NQGA 4A8NA 4C1KA 1CTNA 4HU0A 1YBQB 4Y2WA 4A05A 1GK8A 4M0XA 4ECLA 3VOCA 5A6AA 5SWUA 3WMCA 5CGTA 1JDDA 2OGJA 2OZ3A 4UXDA 1UW9A 3T2PA 2JIWA 4DJEC 5XIMA 2GVLA 2EPMX 4O19A 2HBXA 2VFIA 4WJEA 1QR7A 3OIHA 3RHGA 2GYIA 3PB0A 2WB5A 1SJAA 4CLMA 5D02A 1W1B1 1MMFA 1R9YA 2QAPA 2Y88A 3BGGA 3WLKX 5CG7A 4FA3A 4D2JA 3ABQA 3GIPA 3TE9A 1A5MC 1AJ2A 4P7NA 3LMYA 4N02A 2PWGA 1OCNA 4RV8A 4LEFA 1H41A 1IZKA 2B0MA 4C6PA 1TZ9A 1R38A 1VZWA 3IPWA 4HSOA 1EYWA 2YB1A 2PSNA 3AJXA 1S2WA 6REQA 3AU6A 4DF2A 1D3GA 2V82A 2VEGA 3N2TA 5A6KA 3A9BA 1GQIA 2PCEA 3N4EA 1M68A 4N2YA 1NDWA 3NQ7A 4PTDA 5G2IA 1ISZA 1U30A 2UV8G 4QE1A 4RE0A 4XZ9A 4YPJA 5A6LA 5FKYA 4OBTA 1H7NA 3QY6A 4FLRA 5REQB 2PU0A 3WQWA 1XWYA 2PLCA 1BGGA 1F3TA 3LRLA 3UR5A 1L6FA 3QC3A 3W27A 4A8RA 2TAAA 1K7FA 1V6YA 4HP5A 3VX0A 5K2ZA 4R27A 2PDCA 3GG8A 5I6SA 2BBFA 1E71M 3F4DA 4RX0A 1E72M 3WO8A 3CUIA 3H12A 1KBIA 3I68A 1J0HA 2TRSA 3JVAA 5DCEA 3P2VA 1U83A 1JAEA 4PMVA 3S0CA 1KFWA 3QV7A 3QYSA 3W2NA 3W25A 1XC6A 1X97A 2EJAA 4W8AA 3VABA 1TJPA 1VFSA 1UC5A 4GACA 1S5NA 3G1DA 5BROA 4DJFA 3SO7A 2VELA 1E5NA 4R7JA 4ZSUA 4TOQA 4MWAB 4LC8A 4LUTB 2MNRA 3F5LA 1F3WA 3FX4A 1H11A 1MVYA 3VDHA 1UR2A 1HO4A 3IGHX 4HZ6A 4RNFA 4JTSA 3USZA 3EWYA 5CEWA 3MPGA 2YL5A 5FIPA 4DJFC 3STCA 1V3HA 3R7MA 5LKYA 2VX6A 3W24A 3TA9A 2WLZA 1IIHA 3URQA 1I45A 3WEZA 1PKYA 1WA3A 2GSHA 2WSKA 3B04A 1CXLA 1C9DA 5BWFA 4YXGA 3DFSA 4Y6GA 1OX4A 3WLIA 5E0CA 3GU9A 3JUGA 3RGTA 2KX9A 4D6FA 5HWNA 3WH8A 5G1YA 1O68A 1KO0A 1K8XA 1EXPA 5H6HA 2DZTA 1GQKA 4NNBA 3S47A 4MNMA 1EC7A 3RLUA 1H1YA 5T91A 4MTVA 1OADA 5L6UA 1K9TA 2QPXA 1JR1A 4ILSA 2BXYA 4LUSA 2PB1A 4IT1A 4JEJA 1J2BA 4MWAE 3H4GA 1FWBC 3S1XA 1P0BA 1XLKA 3C4UA 3F5JA 4FF5A 1CB7B 2YLLA 1TKKA 1M7OA 4JQ4A 3AU2A 4JIQA 1WDSA 3TNOA 1V08A 2E40A 3QLDA 1QNPA 1FH8A 3N6JA 3SDOA 1IGSA 1YXCA 4IL2A 1YMYA 3MV11 4QHRA 2GQ9A 3PBVA 1C8YA 1QI0A 1RD6A 3EOEA 3NQ6A 1HIZA 2HJPA 1VR6A 3FVMA 3B8TA 2PUZA 1H50A 4PCPA 2EHHA 1FWWA 3THUA 3QR1A 1WUFA 4K37A 1BRLA 1GZGA 2WBGA 3MUY1 5C7HA 3F03K 1KFCA 3CYVA 2PTDA 3NSNA 1QNSA 2HZGA 2DZBA 1LWHA 1PIIA 1UD2A 5HAOA 4V27A 5D2TA 1C8XA 1VD6A 2H8XA 2FKPA 1FHLA 4R3UA 2JQXA 4J3XA 4V15A 3VNDA 1X96A 3I3DA 3OEXA 3LCGA 2A5HA 4U5IA 1FKWA 3W1UA 3CNYA 2VC9A 3C0SA 2WO5A 3VCNA 2CXEA 4GQBA 2ZC8A 4R88A 4L80A 1US3A 2HE5A 3VNMA 4K38A 1PE1A 3HGSA 3NA8A 4D1JA 1GGOA 4Q33A 4XUYA 1YPXA 5DT7A 1GCYA 1W6TA 4AB4A 4NYYA 2XWDA 1BG9A 3STGA 1SU5A 4XAYA 1AH0A 5DRIA 3E9AA 1JQVA 3WDJA 4IFOA 3HGRA 1G69A 4YTRA 1L6WA 4LVAA 3LK6A 2FVLA 2PI6A 1TA3A 5FJJA 3AIWA 5K4XA 1WYIA 2E9MA 2OODA 3GR4A 1MNZA 3MKVA 3DFNA 4RPPA 1MW1A 5MKGA 5LIKX 1E4LA 1MEWA 2EF9A 3N14A 1CDGA 3TN4A 1XHGA 2DEPA 3A5FA 2A3BA 1PZ1A 1O5KA 2WANA 4AD1A 3KVJA 3TTOA 2OZ0A 4JL1A 1I2QA 4YYCA 3GWQA 1EZ2A 3K13A 2G37A 3BJTA 1J0KA 5IXEA 3P8IA 2E6DA 3LI1A 3KE0A 3PHAA 3BMXA 1X6NA 3QN3A 1ZBCA 3MDWA 3WQ5A 1JI2A 1Q2RA 1V4YA 1GYNA 4MJ2A 3SECA 4QDPA 1NU5A 3B8WA 3KLLA 3P80A 1W3LA 1OHLA 2PD9A 3RFAA 4IQLA 5HMFA 1PYFA 4LVGA 1Q7ZA 3S2CA 1GWJA 5IOBA 1XSJA 4ENLA 3NPXA 1YW1A 3KRSA 3TJIA 4GY1A 5XINA 1JVNA 2VO5A 1TX2A 4M80A 1JFHA 3PZGA 2QGYA 4WVXA 3GYCA 3FGCB 4P5UA 5H8UA 3W00A 2P1FA 5FF2A 3SUWA 1A53A 1JYXA 3MO4A 2ACSA 4E38A 4DI8A 4M3PA 4DHGA 1UR4A 2CC0A 2OFJA 3WUGA 5I3FA 2VR4A 1G4TA 3QR3A 1M03A 3G1YA 1EJ7L 4A21A 4YHEA 3R10A 3V5CA 3BANA 3BE7A 4DYJA 3WX7A 3R0KA 2C79A 2V30A 2X0SA 4QM1A 3NL6A 1LP6A 1ZAHA 1XH2A 2CITA 1G01A 1EDTA 1SW3A 5F1VA 2YJQA 3QFEA 2O9RA 2GSJA 3AXMA 5A8MA 4MWAD 3WDHA 3ITCA 5AZ0A 5FF3A 3T8LA 4KS0A 4MLRA 1XXXA 4IUGA 2CLPA 4AVNA 1GOWA 3IJDA 2YBTA 3GY1A 3TU9A 3ARZA 5HJXA 2XVKA 2KAUC 1JZ3A 4ZOAA 3FEQA 2QEZA 4P8UA 1YNQA 4O16A 4O1EA 1ZBWA 1JCNA 1UH3A 1ZCCA 3EA2A 4CD4A 4FR6A 3P74A 1V6UA 2HXUA 1VRXA 5HXMA 2G3FA 4JX4A 1V0KA 2P8BA 2XU2A 1YLVA 3T05A 4JAWA 1B1YA 1CIUA 2F8QA 4B4FA 4S3EA 2NWRA 1DV7A 2B31A 3ZYZA 1OFBA 1XD1A 4PB4A 1UG6A 4DLMA 3PJXA 3T55A 2ZICA 3KAOA 4L1GA 1E5JA 3OW1A 3TJ4A 1XYZA 4RK8A 4MLJA 3MKKA 3XINA 3LTSA 1UQYA 2PWDA 1OK4A 3OZPA 3WLJA 4RDYA 1MO0A 2VCBA 1T99A 4QISA 1A5LC 4OBSA 1CCWB 1NIUA 2Y2WA 2YCLA 2OWWA 4B5VA 3DGRA 1UHVA 2CERA 3RPMA 3RO8A 4GY0A 1PVNA 3SRKA 2ATMA 1TQJA 3E2VA 5AZ1A 1BQGA 4AEEA 4WK9A 1D9EA 1V77A 1NARA 3RX2A 1R3TA 3UQNA 4C6OA 3LX9A 2WC4A 3UG4A 1W17A 1JZ4A 4MPKA 1FHUA 2PWEA 5JVLA 4GI8A 4PUNA 1F4HA 1R6WA 2C6QA 4Z1DA 5LNRA 4D6CA 3GHUA 1LZOA 1GORA 1Q66A 2FH6A 4J1OA 2DVUA 3GB6A 4CNPA 3VYLA 1FXPA 1GVFA 4GZ7A 3B05A 3NZRA 1AL7A 4US5D 1OCJA 4GUGA 2DZVA 3EMQA 6PTDA 5CPNA 3TH6A 4GVIA 2W0UA 3CUJA 3W1LA 4H83A 1QVBA 1IQ8A 4N6EA 5H91A 2WWDA 3IRDA 4X2RA 4M5PA 2PRHA 2I16A 4JXCA 1JQXA 4PUEA 3SGGA 1KM2A 1O66A 4N9DA 4LXFA 1EGZA 5LA0A 3BQ5A 3AQUA 4H9TA 3KRUA 3UZWA 1JPKA 3WKZA 1ODUA 3POHA 2WKGA 4GUIA 3THDA 3TYUA 3ITOA 2Y5EA 3VIPA 1PUDA 3PNZA 1EF3A 5FAGA 5FL0A 1OVDA 1Y65A 3VGDA 5DBTA 2VEMA 4H4IA 5M3WA 2WKJA 4RNIA 5F2MA 4C1NA 3AIEA 2E1WA 4JHZA 2CCRA 3EWUA 1NWTA 3W53A 4US6A 3W7PA 3N6HA 2Y24A 4RXGA 1TIMA 4WX2A 4EWJA 4AZCA 3LDVA 1HNYA 1S2VA 1XH1A 2GVEA 2XIIA 4RNJA 4AX7A 3D0CA 4JIPA 4FLQA 3EA3A 3A3WA 5I78A 5C2XA 1D2KA 4LQ1A 5AHIA 1R86A 1Q8AA 1BPLB 4ZBCA 3RNDA 4XKYA 6XIAA 3LGEA 5KETA 3GXDA 3COTA 4ZA0A 4XKMA 2NUYA 3VIKA 1R3WA 5D38A 1IEWA 1J0JA 5A3HA 4KCUA 4R9XA 3W28A 1F6PA 5ABTA 1XLFA 4H2HA 2XSAA 5AHFA 1G4SA 2O4QA 2C8NA 4S38A 3TQKA 4NI8A 1SO5A 3L21A 3GTNA 1EDGA 1I60A 3L66A 2VHLA 3ECQA 4GKTA 3DIPA 5TQLA 3EWDA 1PL9A 1KR0A 1IR1A 2BY0A 1KLYA 4ONVA 1W3KA 3HN3A 4PSRA 3MUZ1 4J5NA 2IS7A 4MPQA 1TV5A 5LZLA 4UTUA 2RUSA 4XAPA 4EF8A 1QO5A 3U48A 1RK6A 4OOZA 1TMHA 2FQIA 2VDHA 3DN5A 3NO3A 3ES8A 2WXDM 3ANVA 3VIMA 4LOCA 4RE3A 5F2GA 4JTGA 1X8CA 5DXYA 1CXIA 1TUFA 3CJPA 3ELFA 3S5SA 1QMLA 1EGMA 1BVZA 4JFUA 1UUMA 2P50A 4O4WA 5EBUA 2XN1A 3K5XA 2DJXA 5C5YA 3IIPA 4IOTA 5EMYA 4MYXA 1A5SA 2Z2AA 1QOQA 2W3ZA 3SQLA 4QP0A 4OZOA 1R2TA 2BDQA 5IHSA 1VBHA 5HA7A 5FEZA 1LL6A 1GKQA 5BOEA 3B0XA 1YPIA 5DANA 4MY9A 3UPMA 1V8EA 1DORA 2PDWA 3RR1A 4HK6A 3M6DA 4EAYA 3ZVHB 4QXIA 3A24A 2WVVB 3EWZA 4ZTYA 1JCYA 5G4EA 3VIIA 2HS6A 1UPMB 3WH5A 3UZ5A 1W9VA 1FWGC 3CMGA 1R3SA 3CL6A 3E12A 1UA7A 1I9CB 1JI1A 4L1WA 3N19B 2OPJA 2QCGA 4CNNA 1ISWA 3R8RA 1PZ3A 2FMNA 3AROA 5BU6A 5I3KA 4GINA 4QEHA 4G56A 4FLSA 1ITXA 5DRCA 3NAVA 4IFRA 3UXKA 5U7SA 3SUVA 1W56A 3S6TA 3VA8A 2RDXA 5IRPA 1Q6RA 1PX3A 2NLIA 3QW4B 3A5VA 1N8WA 4GQQA 4Z1AA 3ZXWA 2JIEA 3PF3A 4IQJA 4IGMA 3E0FA 3DUGA 3IVSA 2VENA 1GHRA 3MP3A 5TNVA 2DT0A 4QFUA 1NWSA 9CGTA 1T96A 1ONRA 3AISA 4B5SA 1FWSA 4LUYA 1OC5A 1Q85A 1ZZMA 1JCXA 3P93A 1SW0A 4AEFA 1O12A 1CGTA 3E1F1 1EX1A 4EKJA 5EFDA 4HKPA 2H8ZA 5AYIA 1THFD 3LLDA 4UCFA 3PBYA 3CU2A 2WC7A 4CNOA 2VRKA 4Q8UA 3CZLA 4H19A 1Y5VA 3HPFA 5EMJA 4B4HA 4WSKA 1ISYA 1RCXB 2QCHA 2GQAA 5E9XA 3LY0A 1ECQA 2VRJA 1JG9A 3L4XA 1FWCC 4DWSB 3LN3A 2DW7A 3THAA 2CZDA 2VX4A 4NL1A 3UVIA 3VGFA 1LYXA 3WLNA 4QR6A 3GHSA 4IJCA 1CYGA 1L9WA 3ARWA 4DUVA 4PEKA 3GW0A 4ZXOA 4UC5A 1IT8A 4AIOA 4NAFA 2QT3A 1E4IA 3CQJA 1GKPA 1UD5A 1OYCA 1WXJA 4PULA 3KTSA 4QNWA 3SCPA 3ZO9A 1XP3A 1SZRA 4A22A 3W7CA 2DZAA 1EP2A 3E2SA 1AMKA 1E0XA 2YKKA 4HOZA 3M41A 2XZ7A 1LUCA 1DWGM 4CN4A 4E5TA 2POZA 5B7YA 2VUYA 2WBKA 5I3JA 1TTQA 2CFFA 4DNMA 1XUZA 1VLWA 2CXGA 2YXOA 1TPUA 2HXTA 5AHMA 3N2OA 2DH2A 4CQAA 4C6QA 3WF0A 7XIMA 2GJRA 1BSIA 1YBQA 2Y70A 3LBOA 4K6AA 2AL2B 4HB7A 3LCHA 4BWLC 3K1GA 4WKAA 4RE4A 4ERIA 4H00A 2V6AA 3CXOA 1P6WA 1ONWA 2RH9A 3F2DA 2CBJA 4KETA 4WJXA 3UJSA 3CC1A 2YA0A 2NV9A 3AXHA 3D5HA 1VPXA 2INZA 3B8IA 4GUHA 3GDKA 3VE9A 1RQBA 1Z89A 1JEZA 1E6QM 1LT8A 3U57A 4GK8A 1EQCA 5A6BD 4C6CA 3AUJA 3ZJ6A 2HVMA 3A23A 2EAWA 3DHPA 2E28A 4KFNA 2G3MA 1TWWA 4UFJA 2L5HA 5K9CA 4JNMA 2J6VA 3B4YA 2QDHA 1VAHA 1E1FA 1RA0A 3PANA 4HMEA 2OSWA 4LRSA 2YDAA 4ZZ9A 5HANA 4B92A 3NO1A 5DMLA 4Z17A 4AYGA 3AJ7A 3N34A 3T7VA 1A0CA 2WOQA 2GOKA 2VWSA 5C54A 2C1GA 3BPWA 4I9JA 3QF0A 2PGRA 3ZIZA 1XIGA 5HWJA 3EDFA 3PR2A 4UFHA 4W93A 1A3WA 1SJBA 3W2MA 5RUBA 2B7QA 4LF1A 3RPDA 3UP8A 2NSXA 3WIJA 1NWUA 2F6KA 4KQNA 3TAOA 3T09A 2GDVA 3O6DA 3MY9A 4HTBA 2DDXA 5REQA 1OF8A 4TXEA 3HPAA 3WBWA 1A5KC 3NQMA 1LLZA 1ME8A 3VK5A 4RDVA 4W84A 1WKYA 4MOZA 4FZIA 1L2UA 1DJNA 2EG7A 1NF0A 2EJ1A 4KKXA 4EP8C 3GZ3A 1Z3NA 3AIVA 1KCLA 4UQBA 1Q3NA 2J88A 3BO9A 1LBLA 3AMGA 2WJEA 1V0LA 5HMDA 3CUHA 1SFLA 3DBPA 3EX3A 3H26A 4PSPA 3VNIA 1EB3A 2REQB 4QAIA 3DGBA 3DAQA 1E0TA 2PLMA 4CNSA 4C65A 4P8WA 4WXZA 4W7WA 4MWAA 4LUTA 5FJOA 3CZGA 2AQVA 2PURA 3PSWA 4BS0A 3KDOA 1U22A 4WSHA 1JD9A 3TP4A 4IIEA 3O0KA 1DPMA 4F40A 3T81A 4D6DA 2CPUA 2D3NA 2J47A 4Q4KA 3GR8A 4UQCA 3T42A 2VEKA 2EG8A 2ZADA 2F7FA 4KESA 4C6EA 2B7OA 3ZT7A 1FWAC 4UTLA 3I7RA 1AQ0A 4NZCA 3ZR6A 4Y9AA 1JDAA 2R14A 1KM0A 4JX6A 2X16A 3MBFA 5GJNA 1RHCA 4I9MA 4KEVA 2Z4GA 4O8RA 4KH2A 4HN4A 1GJWA 2X2GA 1HN1A 1BVWA 4WGHA 4U2YA 3WL0A 2UY5A 4Y9PA 1K02A 1G1YA 3BOXA 1K77A 3UNDA 1UH2A 1IWBA 3R43A 4CN6A 3BAXA 3FLUA 3WD3A 4F0LA 8TIMA 1NTHA 4E8GA 3ANUA 3S8HA 5LNVA 1YRRA 1GVYA 1IT0A 2IQDA 1JCLA 3GDLA 1E6XM 1C9WA 3DKLA 3PBWA 4WRHA 3L4WA 3T0CA 2QJGA 3IJ8A 1RZMA 3ABSA 3NPWA 1JXJA 3GW3A 3PY2A 5FD0A 1K1DA 3WBXA 3U3HA 5C9XA 4Q4MA 2QNEA 1HTIA 2PF8A 4Y90A 2W9MA 3HGJA 4MAZA 3W1TA 1DJWA 4M8UA 4FOKA 4OT7A 3GRIA 1K7EA 1TWSA 3B03A 1E9IA 2GJNA 3F5KA 4A8IA 1Z41A 1GQLA 1ZALA 7REQB 3MANA 3QBUA 2W6RA 4O0KA 3H24A 2JK2A 2VL4A 4US5A 3T8QA 3KFTA 1E3XA 3E5BA 1ICQA 1K6WA 2UY4A 3APGA 2PDJA 4HIBA 2D23A 2ZA2A 2YYUA 3BZGA 4LYRA 2QJJA 3ZLGA 2A7PA 5A69A 3TX9A 3OLGA 2WSPA 1R5YA 4PMXA 3FA5A 3EA1A 4XX6A 3W4RA 1JGMA 2BY2A 4RL3A 1A0EA 4HOWA 4BEUA 3EYPA 2R8WA 3W71A 1BYAA 2PDFA 2CU0A 2XN0A 1DXIA 1FP9A 4KIEA 1Q4WA 4DO4A 5D04C 1YADA 3BAWA 4GO8A 3BUVA 3TOPA 1V3MA 4HHHA 2GJLA 3TJXA 3NQVA 1DYSA 3NYDA 3VE7A 1AUSL 2GGHA 5CZJA 5BOOA 1QWGA 7CGTA 2DQXA 3L23A 2YIHA 1WQ5A 4M19A 3AAMA 1OJXA 4LPCA 3SY5A 4PTVA 2XH4A 1MNSA 1ZJAA 4U2ZA 3KZSA 4PN2A 2Q6ZA 3QMSA 4NX0A 3AYVA 1LF1A 1HKWA 2DIEA 3M46A 4ROPA 2Y8VA 2YL8A 3D46A 2NX3A 4DZHA 5CH9A 4WSJA 3BLEA 1JCMP 2VDGA 3RILA 4POCA 3O05A 3LXBA 1P5BA 2PDKA 1XBZA 2I1OA 2OOFA 2R9RA 3BMVA 5AOUA 1LJYA 3RRAA 5J8LA 3FV9A 2X40A 4J40A 1S5MA 1MFVA 4ZTXA 1AD1A 4UQEA 3M1ZA 2PP1A 4XZHA 1LWJA 5LNSA 2HBVA 5JMUA 4E8CA 5GQBA 4JEQA 4R53A 1F07A 1EJXC 5A6SA 2CLOA 2QAFA 3CK5A 1EIXA 3IUDA 3UPBA 3BK0A 1MZRA 2C19A 1AJZA 1EGVA 4DF1A 3I3EA 3N4FA 3VU2A 3NDYA 2YCJA 1CGYA 3NWRA 3FGCA 1S39A 4XK2A 1MQQA 2XIQA 4L4PA 2V81A 3S42A 3CIWA 3O07A 1CPUA 1XRTA 3CMJA 3DFTA 5FOOA 3NQCA 4XUGA 4JCMA 2EGZA 4ZB0A 4PMJA 3NL3A 3WH9A 2PDQA 2BHUA 2NW0A 4I7VA 4DRSA 2CZ5A 4BQ4A 3WF2A 3LD5A 3TLLA 4GI4A 5D2WA 4AY1A 1W31A 2QUMA 5DCBA 3DENA 5IFTA 1MXSA 3N2MA 1OZMA 1RAKA 2XVLA 3KOZA 3WQVA 4LX4A 3WCZA 1IV8A 3B9EA 5CLWA 3SN1A 3URBA 4HU3A 3RM8A 4Z1CA 1P0KA 1KGXA 3CHEA 3R89A 4QE5A 3LGDA 3E0LA 2IW0A 1SZFA 3FYOA 4DJDD 5A95A 4HT3A 3MSGA 3DCPA 4DXXA 2G0WA 5GPRA 2G50A 3W7KA 3D47A 3NVDA 2OGYA 2QDEA 5CJNA 4TVUA 3HFTA 1V3JA 2GGEA 2X42A 1GVSA 4UQAA 2D2JA 2DIJA 4RZBA 2QUVA 1A49A 1I4NA 1IIGA 1WNOA 4ZO9A 1KR1A 4JN7A 3QPYA 1LORA 1O60A 4UTKA 4AAJA 1GVRA 4KWWA 1ADDA 3AIUA 2ZUWA 4B3LA 4LY4A 3MU7A 2ABAA 1EPVA 3CZEA 1XV8A 1J79A 1VFLA 5EBAA 1HJQA 2V5CA 5GNYA 3P67A 4NJJA 4FNQA 3LM3A 4XZWA 1N7KA 3TWAA 5AYZA 2BB0A 1VBRA 1E51A 3GXMA 3DX5A 4DF0A 1KB3A 1I75A 2I17A 2A3HA 1J6PA 4X61A 4S3BA 6ENLA 3VILA 4YYFA 4MUZA 3VD3A 3HZ3A 2QJIA 3OVQA 4OKDA 1XLGA 3Q58A 2ZZ1A 2XGZA 4IXXA 4JX5A 5TAOA 3W7IA 3LA4A 2DP3A 5J5RA 3LPFA 2Z24A 3FA3A 1REQB 1GYMA 2RFGA 1BAGA 4PZVA 3UCQA 5G2HA 5CPLA 4AZIA 1ESWA 3QZ6A 4PL1A 3E49A 1RALA 4JDBA 4FPSA 2RDUA 5FESA 1VIZA 4PL2A 2QLYA 1SMDA 4DAFA 1PJ9A 1I0BA 4H9MA 2QCCA 2YDSA 1SQ7A 3V5FA 2Y62A 1MQRA 1IEIA 1N8IA 4KFPA 3SR7A 1WOAA 4X22A 2P10A 3WNMA 3VIJA 4FXSA 2G4FA 3SADA 4H8VA 4HTYA 4AY8A 2TSYA 1K7XA 1RVGA 1DJXA 1W2PA 1XLJA 5I77A 1S5TA 1OFRA 3UR7A 1VJSA 4HPHA 1Z32X 1C93A 2J27A 2PWHA 2Z2BA 3CHVA 4JTUA 3CH9A 2F6XA 1XF0A 3LCWA 4E2VA 4J9JA 4UZUA 1TSIA 4HNNA 1NP0A 3LCFA 2OT0A 3UW6A 3NGJA 3W76A 3VOHA 4JKMA 3VIFA 3QXBA 3APYA 2Y6ZA 3IJ7A 3RRXA 3NEHA 4OUEA 3V7PA 4NXSA 4QSFA 3ALFA 2ZX9A 4GISA 3MZNA 3MC5A 2ZE0A 3UBPC 1KBKA 3SM0A 4FIRA 1LRQA 1U5JA 2XSBA 2DT1A 5DY2A 4D72A 4DXVA 1L2QA 1QNQA 3TMLA 5ENLA 2ZCGA 3FJ6A 3CWHA 4UR8A 4DO5A 3EXRA 3BMWA 4GYJA 4QTGA 2PC4A 2DUAA 2R1LA 5CC7A 4O13A 4ZCWA 3UVAA 5CBBA 5AHNA 3W83A 3VGGA 5A6BA 3W1RA 1OFQA 4RW5A 1XUUA 4W86A 3ZJ7A 2EPOA 4FALA 3NVTA 4URIA 5HDRA 1PWMA 4GCAA 1V7YA 4G7EA 4F0SA 1QW9A 3WQFA 5AVHA 3VI2A 3QV9A 5A2CA 3BCDA 4NXKA 4MNLA 1CXKA 3E38A 1HUVA 4DBUA 3DG7A 1BKHA 1UB3A 4J28A 3B9DA 1EC9A 3HGOA 3JRKA 3OTRA 2R6OA 4H9UA 4HNLA 4GJ1A 4ZB2A 4NP7A 4Q8TA 3VC5A 1WKFA 2W91A 5HR6A 4AISA 1AW1A 3OIXA 1E0WA 3PUDA 1Q6LA 1F05A 1VPQA 5HULA 2XHYA 3W37A 3II1A 1PAMA 2QCDB 5HBFA 3OGSA 5CZSA 1VFMA 1W8GA 4MB5A 3WD1A 1QPRA 2NXGA 2DPEA 2H9AB 4UTFA 3WYZA 1AQHA 3M0KA 3WJYA 2VD8A 1ENUA 4ACYA 3AMDA 1TVPA 4TO8A 3D3FA 1Q6OA 1HW6A 1TWZA 1S2AA 1C29A 2Q8LA 3TW7A 4AU0A 4BZYA 3ARQA 7ODCA 3NM1A 5HNNA 2YOCA 1NELA 1PIGA 3BSMA 1TZ7A 1Q6CA 4JQAA 5M2FX 3VAVA 1OX5A 3M0IA 3HOJA 3DFOA 3FW6A 3A3XA 3ZVHA 1SJDA 4XD3A 4LW7A 3FAWA 2WVVA 4JTHA 2AAAA 1GT8A 4FNSA 2XISA 4PC8A 4HMDA 4C1LA 1TPH1 3A4XA 1XIEA 4K68A 5FJRA 2JEQA 3C56A 4I6KA 3GH4A 1DWIM 3WUFA 2PDLA 3GVVA 4HCHA 5D09A 4YIWA 1WAUA 5CSSA 3NPVA 2EXOA 5AKQA 4PCTA 4IQDA 2YL6A 1K8YA 4DBEA 4L7ZA 3G1RA 3W2LA 2E5DA 3TZNA 2DSUA 2G95A 3OG3A 4O10A 5DELA 3S5NA 4FO4A 1P1XA 3ARUA 1W32A 1ZUAX 4WR3A 2GGGA 2NZLA 1I2NA 3DH7A 1B3XA 2J9ZA 1M1BA 3AXXA 1RCQA 3K4WA 4B5TA 3OA3A 4ATDA 1H49A 1LROA 4D6EA 4GOAA 3W38A 3AMCA 3EKGA 3LBMA 1SFTA 3QSRA 3LU2A 1KV8A 2WVSA 3VKBA 1PX8A 4WXYA 3ONBA 2OEKA 3M43A 4IPLA 3GBDA 5FACA 1F2JA 5AYYA 2PP0A 1FWEC 3KHJA 4ZVJA 4NAEA 3U8GA 3VKKA 2ESCA 3W6LA 5CKSA 5EL1A 4F79A 1E6NA 1HKIA 1MUMA 1Y5XA 3W72A 3H7VA 1TPB1 3S2LA 4HQVA 4D1IA 4H9VA 4PH6A 3PAOA 4A3YA 4DBWA 2YA1A 2W67A 4M24A 4H7ZA 1BHGA 1XYBA 2Y7FA 4IMDA 3EB2A 1SSGA 2ZUNA 4S3FA 3CM4A 2J74A 2YSWA 1JUBA 2WPGA 4Z2IA 3FN9A 4NIRA 3PZ9A 4DJED 2VQUA 1OIMA 3IACA 4DWSA 2HVNA 2BVYA 5T8GA 5JBFA 1QHOA 3W7QA 4KRZA 4GCXA 1XPYA 4GIRA 2ZXAA 1O1HA 3VD4A 1VBUA 2PAJA 3U2EA 4UQDA 1A5OC 3WFZA 3FA4A 3UXIA 1ICSA 4IMFA 2Z25A 3O6AA 4K8EA 2DZWA 1ALDA 1WCGA 9XIMA 1NJJA 4B5WA 4DWSC 3ITYA 4G7FA 1VEOA 2WHJA 4ZODA 4UMCA 3M6YA 4S23A 2X41A 5C7VA 4PB5A 4GJIA 1CT5A 3ZT5A 3WLHA 4Q8MA 1E15A 1N8FA 2J6XA 3MWCA 3GKAA 2OEJA 3WLSA 4UTMA 3AWNA 5FJPA 4N9BA 4BF5A 2PLKA 4PMRA 5CSRA 3LUTA 5JU6A 4WY0F 1KFJA 2E77A 3DERA 4DI9A 4NF7A 4GYFA 1AW5A 3EAUA 4LH8A 3GFZA 4ZQRA 3NQDA 3SUSA 1CXFA 3C86A 1F4AA 4B9YA 1V0NA 3J7HA 4Q8WA 4DLFA 4E8DA 2EO7A 4QQ3A 3VD9A 3CPGA 5F2LA 3S46A 2O9TA 3NGFA 4P7RA 1K4HA 4IPJA 3G8EA 2AL2A 3WFAA 7ENLA 4M6QA 2GUYA 4BEQA 5TF0A 1WDRA 1DJHA 2I5GA 3IGSA 3L0NA 1C92A 1HVQA 2FTPA 2C91A 3UWZA 1UWTA 3PN8A 2VJXA 4I8YA 3UXLA 3OLEA 2V3EA 4HHMA 1OC6A 2BOEX 4F2TA 2F2KA 5I79A 4BA0A 3HA1A 3K2GA 4NUWA 1AH3A 5BMXA 2PBOA 2ZX6A 3KRZA 1S5WA 2HNEA 1DIEA 5HPCA 4FNTA 1HKMA 1B3WA 2XFWA 1TR9A 3CASA 4PMZA 4JCLA 5C0QA 3DG6A 3N6QA 2E5BA 3VDAA 3TSBA 4TTUA 1VEMA 4LCQA 4CQDA 3TONA 1JZ7A 1FDYA 1JDCA 4AW7A 2JKEA 1W9XA 5BYWA 4DJFD 4XWUA 2OTDA 2QPUA 4A35A 1KV5A 5ABFA 3NEVA 3RAOA 4QSHA 1TV8A 4X9YA 3FIGA 3CZKA 4GNKB 3RLHA 2WHLA 3KS6A 4KRUA 1MUCA 4HBKA 1FA2A 4BR1A 3LMZA 3HV8A 1RLCL 3FJ4A 3TYCA 3FYPA 1BTCA 3PPCA 4FAMA 2Z27A 4NRSA 5F2IA 3V1PA 4QDWA 1HVXA 3H4WA 2YDRA 4GJJA 4EX4A 2A3AA 3GO2A 4C6IA 3GVQA 3FXYA 3IJQA 4LEQA 4TX8A 3U4AA 3LRKA 4IL0A 2DZUA 3I10A 2ISDA 2DW6A 3BAJA 4CNTA 1CLVA 5JIPA 4MKSA 4NQ1A 2QV4A 2V9DA 1UBSA 3P5YA 4OHQA 3P3BA 3W26A 1OD0A 3BLPX 1PXGA 2HSAA 4ES4A 4PCFA 2Y8UA 1EZWA 4AWSA 2REQA 3WMSA 2HMCA 4W87A 1VEPA 4GI6A 1UKTA 1AG1O 3PULA 3C0QA 2PZ0A 1UH4A 2NT1A 4EACA 1B0IA 2BVWA 4LANA 1PTGA 4RKAA 1H7WA 1IZCA 2PBGA 3BG9A 3GH7A 5EMKA 1FFRA 3AXIA 5D9MA 1JPHA 2XZ9A 1BWLA 5EPDA 1W1IE 2OZ8A 3I3BA 1VFHA 2WJFA 2V5KA 1ZENA 2VM8A 2FZ8A 2A3CA 3GBEA 3EMCA 4ZE4A 1W1YA 3HFYA 1EDQA 3G3DA 3VMNA 3IVTA 3SI9A 5M5DA 2V3FA 1UKQA 3M0YA 4MZYA 3SAZA 4O50A 4XTIA 2CNCA 3CAQA 4XZIA 3FY1A 1W5QA 4A2RA 6XIMA 1XS2A 4IIBA 3L0KA 1S3HA 3IUIA 4U4MA 2W92A 4L4MA 2FDMA 4GG9A 1DQXA 2OCZA 2ALRA 4MIMA 3N04A 4F4RA 4IZGA 3HJEA 4AHQA 3KTCA 3CL8A 4IIGA 4UOQA 3RN6A 1VGAA 4H7CA 5CGMA 4IM4A 5BCAA 2Z0IA 2NXHA 4LT9A 4AF0B 3EPOA 3L5LA 4H6KA 2YZ5A 4QJ3B 2WKLA 4K1WA 5HMSA 4LNYA 2J7CA 2XVPA 2HS8A 1B5TA 4OGZA 2YA2A 4M56A 3QZEA 3AOFA 2J7DA 2AOSA 7REQA 3BG5A 1X7FA 2EPHA 4PUUA 4ZQOA 4I7WA 2ZDRA 1TMQA 3EXTA 4WF7A 4MFEA 1FRBA 3W1NA 4S2BA 3P81A 1W5MA 2PC8A 3O16A 5A6JA 3BAIA 1UA3A 3BLIA 5GNXA 2WV8A 4EE9A 3MB9A 4MZ1A 2E67A 4JYDA 3ARYA 4JZ5A 2ASHA 3ARSA 3SJ3A 2V2CA 1RJRA 4JTLA 3NJ3A 3TFXA 5JIWA 3AC0A 1YQ2A 4LVBA 1TJ2A 6TIMA 4UTIA 3QFWA 3WNPA 2VC5A 1ISVA 4JICA 4O4VA 3ARVA 2BY1A 4JKLA 5FCZA 3SUTA 3CO4A 3A21A 1WZLA 1KCXA 2XH0A 4QEEA 3URAA 3N12A 2BP1A 3ZM8A 3ERPA 3IWPA 2Y89A 4PUMA 1KFBA 5CZ0A 3HQOA 2NV2A 4LTSA 4R9OA 4LALA 2E6AA 2BX7A 4RV3A 4YNGA 4DBDA 1IHIA 4NZ1A 3JS3A 3U4FA 2X2YA 4AY7A 1O7AA 2X1TA 1J2WA 2DIKA 2PDUA 3P7YA 3K8LA 4AFYA 1IEXA 1GEHA 4IX2A 5LIUX 3HIJA 3BLDA 3Q2DA 2GDUA 3SRDA 4R5EA 2R1NA 4NHVA 3LB0A 1FOBA 1OG6A 1AH4A 2AMXA 3VZYA 4W8BA 2AAMA 1UOZA 4UZSA 2OWCA 1R2RA 5A94A 3VOGA 3B8UA 4OE7A 1P0DA 2FGBA 4DYEA 4EXQA 1IT7A 3NQ8A 3UYIA 3EX6A 1XBYA 1QT1A 2C7FA 3CYJA 2NX9A 3VFLA 1GVIA 3QPEA 3OG2A 3LTPA 4MKNA 3H6OA 1K70A 1XH0A 2EG6A 3W7RA 2HVOA 1TUXA 4XISA 5LIXX 1E73M 4Z2HA 4UIOA 3BAKA 4QS5A 2OQYA 3SURA 4YVVA 1EP1A 5K9XA 2W63A 2D3LA 1HF6A 3AS1A 3C8FA 3TLQA 2EPLX 2Q3OA 4KT2A 1J12A 4UFMA 3NDOA 3N4AA 1JNEA 3WBAA 1QFEA 2DSKA 1XDJA 2FZBA 4B5XA 3FSTA 1A5NC 4JTEA 3PTMA 3KBVA 3FKKA 4O52A 3Q94A 3UESA 3ZSSA 3G22A 1X7IA 3E6EA 5FF7A 2E7FA 3H53A 3NPUA 2WW5A 4ORMA 2O9OA 1JF5A 3NL5A 1BKSA 2ACUA 4L6OA 4C6NA 4IPIA 3VNKA 1XIFA 3W86A 3N9KA 3UGRA 3IV8A 8XIAA 1UKSA 5I3DA 4FB7A 3LLFA 4CVUA 4JFVA 3WK2A 2VOMA 2P3EA 3P6LA 4DZAA 4IXHA 4C5YA 3K46A 1H51A 2YFOA 2GFTA 5H8MA 2C71A 1VHCA 3LOTA 4HHPA 1LRTA 3ZOAA 2G8ZA 3W81A 3WQ8A 1NDYA 2BWGA 1SR0A 3LENA 4JPGA 1PDZA 2QCEA 2R82A 3L2IA 1NDZA 2RDTA 4U10A 3FDGA 3MI2A 2JE8A 3CUFA 1ZSXA 1PB0A 2ZRYA 4KEZA 3KHDA 4A3RA 4RNHA 3ABRA 4FX8A 4R7WA 3SN0A 3WLMA 2QCMA 4NAFB 4DN1A 1T5AA 3GDRA 3BLLA 3L9CA 1MW3A 2E6FA 4PRTA 2E5CA 3B8SA 2PDYA 2ACQA 5D37A 1OWQA 5BMWA 3W2KA 5XIAA 3U0HA 3WSUA 3POCA 4JQ3A 4M1BA 4O53A 1XCWA 3W84A 4HYWA 2YXXA 4C90A 3AFBA 4D8LA 5LA1A 3QHMA 2EEXA 3M0LA 3G18A 5F7UA 4X63A 4Z2LA 1I8JA 3FAXA 4WY0A 4WQ6A 4IGHA 1DOSA 1F3XA 2E0PA 5CSYA 1G9HA 2XPKA 2DGAA 1U1HA 2VD9A 3CV6A 3I7QA 1EQPA 2O4MA 2QMJA 1F74A 4HN8A 1US2A 4R7OA 4AD2A 4GUFA 4ZSTA 2ZRWA 3T78A 1JDEA 4U3AA 1RQHA 4JFSA 4UTJA 4DXKA 3S2JA 3V0UA 3WNLA 5A8QA 1WXYA 2PGFA 3OVGA 2QGHA 4Z0SA 3F7JA 1ZJIA 2XGIA 3CAVA 4XBSA 1FWJC 2VZVA 3G2GA 1IXQA 3QM3A 2WVUA 3GU1A 3OO2A 2C1HA 1CECA 5J04A 4WKHA 1F6KA 2JGYA 3HU7A 4F3HA 3G77A 3WF1A 3W23A 1U1UA 4JBRA 3TOYA 3W01A 1P7TB 1KKRA 3ZS4A 3LPOA 3VD7A 3CZJA 1U5HA 4QLJA 3NFUA 4BKNA 4NJGA 2V38A 2X7VA 1J96A 4K8HA 3W7EA 4CCZA 1KRAC 3GS6A 3RX3A 4J3SA 2FPTA 2G3IA 3ALGA 1MZHA 8CGTA 4Q7NA 3EEGA 4EOUA 4BQ5A 3CQKA 4QITA 4CGTA 1TV2A 1DP0A 4LCRA 3N18A 1XICA 2OKTA 4YWSA 4O12A 1TRIA 1Y7VA 2OLAA 2PWUA 1VENA 3CBWA 3DU0A 1TZZA 3AMLA 4LYKA 4ATLA 4Z42C 1H0IA 2A0NA 2ANUA 1O95A 2GZXA 4GE8A 2AKZA 1VLIA 3Q45A 1QI3A 3AHTA 3IAPA 4LF2A 3WDIA 3A12A 4V1YA 3UWEA 3OVRA 3UPWA 3DKJA 1XIJA 2EQDA 1TO3A 3W87A 4XSMA 1BTMA 3EBVA 3QQ1A 3WBEA 1JJKA 1P0NA 3EEZA 2VUNA 1US0A 3ABOA 1LQ2A 1MXDA 4Q7BA 1ZY9A 5F4SA 3KDNA 5H2ZA 3ITVA 3U5YA 4WZHA 5C9ZA 1B30A 3BOFA 5FI8A 2WM1A 4NYUA 1CX9A 3MMUA 1H5YA 4G1NA 4HMCA 3P0WA 5ABGA 2VFDA 3KW3A 5BXTA 3FJNA 3R0DA 1VPYA 4ACZB 1A4MA 3N13A 3QY7A 4HVXA 3T0TA 3IIVA 1U2YA 1BYCA 4E2DA 2DUXA 2BGQA 1XGDA 1T40A 1V02A 1JFXA 4HA3A 1TPFA 4TV6A 4XQ6A 4AMCA 4I7UA 2E3ZA 1E0VA 4UUIA 2QCDA 4U5KA 4K39A 3OLDA 4G6CA 4JS3A 2WZIA 2P8CA 2Y4SA 4M82A 2H9AA 4GXWA 4N4PA 4OTKA 1UPPA 3IGXA 4JYFA 3E0WA 3OZMA 2E9BA 3KL3A 4H9YA 1H63A 1YDVA 4AXKA 2CYGA 4IMAA 1LRNA 1BF2A 4S3JA 1GONA 1F3EA 1SM9A 3TAKA 2QZRA 4TIMA 4H9XA 2J8TA 2FMOA 4DZ5A 2RJHA 3O0FA 1S2UA 4QG9A 3PBUA 2DVXA 3ZMRA 3CTLA 3VOJA 3F4WA 4N0RA 3GXIA 4H8HA 2DT2A 1M7JA 2OX4A 2DSWA 2QIWA 2PF0A 5D2VA 1NH6A 1QW7A 2B81A 4UOJA 4LNCA 1VCGA 4FSAA 2J13A 4XZBA 3STFA 2ON3A 4PUDA 2XIOA 1O5XA 4Q4OA 3IAQA 3KVKA 2UZ9A 1UIPA 3W7JA 3S5ZA 1XQLA 2D0GA 3S1WA 2GWNA 1OFEA 4TX9A 4YTSA 1D3HA 4O1DA 2WZEA 2XJ7A 1QPKA 1KWKA 1RQEA 4PBGA 1E9YB 2O9PA 2FFCA 3W73A 2PDMA 2CKRA 4NJIA 1J93A 2Y7EA 4JTCA 4PUWA 4A6GA 3S9ZA 2CLEA 4JTIA 2D24A 3MMTA 2INEA 4LUIA 1CGVA 3UZYA 5I2UA 2WPBA 4S3KA 3R1ZA 1RBAA 5I23A 3SCNA 2V3DA 3N17A 3PP7A 1YTEA 3QOMA 1CI1A 1K9DA 4LU0A 4JFTA 4GQ0A 4OWGA 3UCDA 3UT0A 3EZ4A 4NKCA 4OOUA 3T2QA 1X39A 2WYSA 1GPFA 1V6WA 2D22A 4RPQA 1X6LA 4AD4A 3S9YA 4FIQA 3FVDA 3DYPA 2C1IA 1TELA 1YNYA 4FMVA 5BXRA 2OU4A 4INFA 3WUEA 3MCOA 2Y5SA 2PE4A 3KRBA 4TTGA 3S6DA 2VZOA 2PZNA 5E6YA 4YTTA 1ZRQA 2VWTA 3PZTA 4JIRA 2NQJA 4W9TA 3NXFA 4B5NA 4B5UA 2ZQ0A 1CXHA 3GG1A 2DSZA 4JTRA 4HPXA 2P3ZA 1IWPA 2BVDA 1J11A 1O94A 3TDFA 1XJBA 3P84A 3PUGA 3VINA 2WM0A 4K1GA 2PP3A 4Q8QA 4EF9A 2TMDA 1CENA 4G9PA 4MG4A 3LM7A 2WC3A 3RLVA 2CLLA 1CWYA 1ZTVA 3ZJKA 3CUZA 2ZZ4A 3NZQA 3PZIA 5HPOA 3DC8A 1UJQA 4MY8A 3PC0A 4H6QA 4GLEA 3G3MA 2V5JA 2QUUA 1KFKA 4M7TA 2ZOXA 4DYKA 2NV1A 4W7UA 3CAKA 2X1UA 3XIMA 1OGSA 4R85A 2J9YA 1GQNA 1NM9A 4XO6A 3THCA 1TTJA 1KWGA 3R12A 4MKVA 2JALA 3VKDA 1P0EA 3ATZA 4DVOA 3GKFA 4LVDA 4JTTA 4ZR8A 1M5WA 4IHCA 2ISFA 5CC5A 3TIMA 1UASA 4IIFA 3WD0A 1ME7A 3FDKA 3W70A 1KGWA 3PJUA 3V3WA 1TREA 4KMQA 5KZMA 2NT0A 1QHZA 2IKJA 1EJVC 3T0BA 3IEBA 5F4WA 1FVPA 2V5LA 3NNTA 2VR5A 1K6AA 4C5ZA 1DJIA 3LYEA 3GG0A 1UKPA 5I3IA 1SZEA 2FTYA 3T6CA 4W89A 1BEUA 4QIUA 1P1MA 4HK7A 5JH2A 3OQEA 5LA2A 1GTHA 3KP1A 5E70A 4B15A 4C6MA 4GNVA 3MO7A 1M04A 3C3NA 4UTWA 3REQA 1KC7A 5FSDC 5LNUA 4KERA 4Q6JA 3GVWA 4YCOA 3SFKA 2Z7GA 3BW3A 4JKKA 5E93A 4IMCA 5JQ9A 3FNDA 4Q4QA 1GJPA 1WXZA 4XD5A 2I9EA 2QJNA 3BLFA 4EAMA 3E2QA 3E3HA 4O0ZA 3TSDA 5FF0A 1UD4A 2VYOA 4NI3A 1M7XA 4UTWC 3MSRA 4U33A 3KCLA 7PTDA 2I5QA 4X3ZA 3PPGA 5HMEA 3FCPA 3TTSA 5HINA 1VHNA 2Y1HA 4PBEA 4JTQA 4ADTA 2P0IA 4QS6A 1RV8A 3WN6A 1XGEA 1HX0A 2DZSA 2QCLA 1EHAA 1H62A 4WOZA 1LOSA 1BQCA 4GUJA 4U31A 1SZNA 1SSDA 4I5UA 3GTFA 4GQGA 4LVFA 4CN1A 2XDFA 1H4PA 1SPQA 3OYXA 4A4AA 5C9WA 1OT1A 1X98A 3TNBA 5JBDA 4ERGA 4CCDA 3SGUA 1BLIA 1TQXA 3PBMA 4H7VA 2FZDA 1RLDA 5A8NA 1ZBVA 1W5PA 2ZBTA 1ZU8A 3NXLA 3BOLA 4U3CA 2GPTA 5I3HA 2IKIA 2PDGA 4TVCA 4AH7A 3WLPA 1B90A 3OODA 4IGSA 1BD0A 2E4TA 2WWCA 4Q8NA 1E6PA 4KPLA 1ME9A 3H2OA 1GHSA 3TC7A 4GC3A 1KM6A 2GQ3A 1TCDA 3WENA 2XG9A 3GK0A 1Q7MA 2EBNA 4M81A 4AUBA 1PHWA 1FWRA 4K36A 2VCCA 1FUYA 2Z7KA 4E3TA 2YGYA 1WZAA 1XYFA 3WQGA 3RF9A 1YE6A 2VVSA 3B0UX 5LIYX 3FOKA 1W3NA 1UR3M 1AFSA 4P61A 1VBJA 1QPQA 5A1AA 3U7VA 1JD7A 3OU8A 3DECA 4D6JA 3UFYA 5I03A 4KIRA 4O1AA 5DEZA 3QQWA 4I9AA 1QATA 3CV1A 4LRTA 4EXBA 1SFJA 4NNAA 2XUCA 5HQMA 4Z08A 4MJ4A 3JZEA 3UWVA 3LI0A 3K8KA 2G3NA 3TYZA 2BGNE 2H90A 4R34A 1UIOA 1JDFA 3GXPA 3MZ2A 3WBYA 3FKRA 3HQ1A 1OZQA 1PPIA 3WNNA 2IKGA 1YTKA 3MMDA 1PYMA 3KUMA 3TZFA 1F76A 3QV6A 2ZXBA 4G2DA 3PFRA 1BSLA 3SCUA 4L65A 4AF0A 1LL4A 1DEDA 4ADUA 3FSUA 4HJFA 3MP4A 1YEYA 4WDXA 1KBJA 1UKOA 4OV4A 2YBVA 2OO6A 4FXJA 3CGTA 1ZFJA 5CZTA 4Q6XA 1Q6FA 4GIYA 4CU6A 3W7OA 3C2VA 3C2RA 4MDOA 1NVMA 1FP8A 3WG6A 5BXPA 1SJCA 4OJYA 5ABEA 4D8AA 4L9XA 1AZ1A 2G5WA 4A3UA 1KA9F 2WHKA 3HBLA 4GVGA 4H8UA 3WQPA 1S3TC 4YN5A 3VZZA 4BQ2A 1V5XA 3QKEA 3RUBL 3GM8A 1FTXA 1B3OA 4IF2A 3GTHA 1PCWA 1PHQA 3PPFA 1X1ZA 3WH7A 3MCNA 3OA5A 3UR2A 1NP2A 2FVMA 1J01A 2ODOA 2V67A 3IVUA 3GXFA 2GDQA 1L6GA 1W3IA 2ZYFA 3C3UA 3F4CA 1BWKA 3O6YX 2HPMA 3NZ1A 6CGTA 3LEPA 4JTAA 3M0HA 1H7RA 4JOMA 3STPA 3S1VA 3IANA 1I6NA 3S3GA 4L9YA 4G7EB 3K8MA 2A2IA 3GC4A 1KFLA 2Y5JA 4GO9A 4O57A 1DTNA 3O3RA 1KLZA 3OVPA 3MHFA 4MNKA 3BJFA 1L8PA 4KBXA 3OBAA 5JBEA 1VCVA 1DWAM 3LG3A 4IQEA 2QF7A 3ZFHA 4KWUA 4Z0JA 4ZL1A 3UG5A 3S9IA 1IEVA 3IK2A 4GXMA 2PDNA 1ZAJA 3WEMA 4LV9A 1VFTA 3KOFA 3QMRA 3LXCA 4MB3A 3KZPA 2A7NA 3L4ZA 3BICA 3TV8A 1OFDA 3R5EA 1XCFA 2XM2A 3DHUA 2DU2A 2RGLA 3SCTA 2WMKA 4ZENA 3W88A 1JZ8A 1QRQA 1RBLA 2O7QA 1TVLA 5D4YA 3ZJ8A 2Y7GA 3V16A 1OFOA 1KRCC 3IIXA 1XLHA 4DELA 3F2BA 1E4NA 4J3UA 4UMBA 1V79A 2OR2A 3DEQA 3MBDA 4JTJA 1C7TA 3SUUA 3P60A 1UOKA 5HJYA 3N11A 1OYAA 4FXRA 2PRMA 3LV5A 1ADSA 4FNPA 2E1DA 2X09A 2OSYA 5M03A 1BGAA 2QCNA 4J4KA 5LNWA 2W62A 1E3ZA 4AZBA 1W0MA 3V18A 3W3OA 3QGVA 4HPGA 3ITTA 3IJ9A 4NT0A 3LS9A 1SR9A 3A4WA 5EU9A 4GHRA 5I3GA 4JNYA 3F4NA 1H60A 4F0RA 1R3YA 1YKWA 4AMAA 2QUNA 4ZFMA 1ISXA 1PTAA 4WDWA 1AA1B 5ECVA 1QAPA 1DJGA 1QTWA 4KCVA 3NTYA 1DJZA 1HKVA 3CT7A 2AQOA 2OLHA 5LHEA 3LNPA 3KVLA 3CQHA 4NAEB 2DUZA 3H2NA 1UMYA 3WLLA 1PZ0A 3D6NA 2XVGA 4S3AA 2G41A 4L9ZA 3SCOA 1WDDA 1DJYA 2C0HA 1UR0A 3TUUA 3PFMA 2WK2A 3G1FA 3TK7A 4KGLA 1TV3A 3QV8A 3UR8A 4ROQA 3DDMA 2FLIA 2VRQA 4WLCA 4GI9A 1K3UA 1S2TA 5DMMA 1BVNP 3UEQA 2GK1A 4JIHA 4F9JA 1QHPA 3STEA 5G5IA 4F0MA 3RIKA 3DZ1A 1Z7AA 4LS0A 3ZZ1A 4KEUA 1RVKA 2Y7DA 4IMGA 2C18A 1WKDA 1HL8A 1HKKA 3UGVA 3ARTA 1IWAA 1LQ0A 4DUWA 1UQZA 1V6VA 1XM3A 5HATA 1YNPA 3EOUA 2ZVRA 2C15A 1ZAIA 1VYRA 2B7NA 3UZZA 5HOSA 3MVTA 1EF2A 4NG3A 3G8RA 1OF6A 5CLTA 4WIWA 4NZJA 4L1XA 3G0UA 2VP8A 3HO8A 2F38A 3S1GA 1NFGA 4E2BA 1E6RA 1EBHA 3EWBX 1UROA 1RJQA 2R1PA 3HQPA 3PZUA 5GNZA 4CQ8A 1YE4A 1Q8JA 4FF7A 1QBBA 1NOFA 4BWLA 2E09A 3G24A 3PBGA 1TTPA 2J79A 4GYKA 1RBOB 1EEXA 3G6LA 3EX2A 2BGSA 2VZTA 3DBNA 3C0LA 4H01A 1P48A 3GDBA 4EK7A 2IPFA 5G4WA 2ISSA 2FFIA 5I07A 2DFAA 3ONCA 2PRLA 3TJLA 5CPQA 4TU1A 2VT0A 2V69A 3GYEA 2R24A 3VGEA 1T8QA 4DUXA 1X38A 4ICCX 2ZRZA 3LCXA 3R11A 5D2XA 3NOYA 1KCKA 3BW2A 5LYRA 3B9AA 3ITLA 4IPPA 3LCLA 3GC5A 2IPGA 3BZJA 3L2MA 1P7TA 4AVOA 4J27A 4HZMA 1EJUC 4Y96A 2BOGX 2HDJA 3M16A 4ZOCA 1Q4NX 1W8SA 4HMNA 1A3HA 2FPYA 1HJVA 2BG5A 5C6MA 1B3ZA 1MEIA 3LRMA 3VNJA 1GOQA 5A8GA 4AD5A 1J6OA 3DYMA 4PMOA 3CEPA 1JYVA 4I5RA 3WY1A 3VIHA 1H1ZA 2V2HA 5AB3A 1V7AA 3QMTA 3OZYA 3GXNA 3GHTA 3QYQA 1EWDA 3SEPA 4QG8A 9RUBA 4F48A 2QXWA 4CVWA 3DFYA 5ABFB 2WSYA 1JIBA 3JR2A 4PEEA 2NX1A 5TIMA 1SMAA 4RR4A 3QQ0A 2AL1A 2ZZ2A 2OXNA 5C9RA 1QASA 1E1EA 1CXEA 2IPWA 1FHVA 4WOQA 4QJ1A 4GQRA 5BU9A 2V2DA 5ABHA 4IFKA 1XFCA 1Y8BA 3NQEA 3A9IA 2WHMA 3WMBA 3LHWA 2R1MA 4KWOA 1V03A 1EJSC 1FH7A 1WOBA 4E0CA 3QPZA 3ZLFA 2OQHA 2VI0A 4REQB 3VO0A 1ITQA 3UXAA 1KM3A 2FZ9A 3VCRA 2EPKX 3MW7A 2GVJA 1XISA 4ACZA 3SJNA 3KVMA 4FS9A 3VM7A 3ARPA 4M6UA 1OFAA 1HZYA 3VMOA 1QXLA 1RD5A 5EFFA 1LM1A 2OYMA 4LYQA 1IF2A 2PDHA 1ONXA 4HNTA 1XYCA 2R91A 4GFSA 3GIQA 1ZLPA 3WLRA 3S5OA 3GR7A 3I4EA 5D9NA 1W91A 4IG2B 4AC7C 2XYLA 3D3AA 1R7OA 1DIKA 4NZ3A 3A6OA 1WBHA 2DSVA 3O1NA 5DCDA 3P8JA 4X0VA 2E8YA 1EXBA 3RU8X 2PPGA 3M0XA 1UD6A 3GTXA 2Z1WA 3CQ0A 1N55A 3GHRA 4H1ZA 1XRFA 4GVFA 2BHZA 1NQKA 3TW6A 5I5RA 3LHTA 5E0FA 2QUTA 3KBNA 3EPNA 4IP5A 2VEPA 5A2AA 3R25A 3OQ8A 3UJ2A 3H7UA 3I65A 4FNUA 1T41A 1WO2A 4AZGA 3WD2A 3QLLA 3TEVA 3L4UA 1TWDA 4TQTA 4LUJA 2C3ZA 3JW7A 3VGHA 1VQTA 1AD4A 1EP3A 2WJDA 2XH7A 3E0VA 1DTUA 4ZOEA 3WDPP 3LQGA 3M0VA 5M17A 3VTRA 1CLXA 5K3VA 4Y7EA 4Q4RA 1TCMA 3GG7A 4I5XA 4O11A 3AS3A 3NQ2A 2FJKA 2ZRXA 2XGBA 2ABBA 2VR2A 4V28A 3XISA 1P6BA 1FWDC 2JKPA 4JR5A 4DWSD 3C52A 1EX5A 1W37A 4DO6A 2W79A 1CGXA 3QTGA 3HQNA 1DBTA 2DQWA 4FNRA 5CZKA 5E09A 4N9EA 3AWOA 4RZ6A 2BNJA 4QLLA 1HL2A 2X8RA 3EDKA 3IK4A 1OG0A 3OBKA 2DT3A 4YWIA 3TQVA 3URNA 2GLKA 1Z48A 3C2OA 4L56A 3UU0A 1EUNA 1KTCA 1EFZA 3RCYA 3CQIA 5D32A 1DE5A 2WJZA 1PZ2A 2XIJA 4DBSA 1J5SA 2I14A 3QW3A 1MYRA 2ZUTA 1MDRA 4M29A 1H5VA 4IP7A 4LGXA 1DQWA 3JU2A 4K2SA 4JQ2A 3VMPA 1LG1A 1R7AA 2FYMA 2PWVA 3MA8A 1XIMA 2Y63A 3AIQA 1CGUA 1JPMA 1TWIA 4P8XA 1G4EA 2J8GA 5CPSA 3QGKC 3G0XA 3VNYA 5AC5A 1B54A 3BSGA 1K8CA 3DG3A 1Q65A 1PCKA 1ECEA 5DO8A 1UYQA 3CL7A 4MGGA 4ZGYA 2Z1BA 3IJIA 3WK1A 3AXKA 2XVNA 2H3DA 3M0ZA 2GOUA 1GUVA 2HQAA 2GVGA 2MANA 3H2MA 4Y9NA 2J9XA 4HZ7A 2G96A 2XIBA 2Y85A 1TYGA 2V8ZA 1OEPA 2ACRA 4EVZA 4GFIA 3UWYA 3AICA 4YTUA 3LZ3A 3NUKA 4C6LA 3SCSA 4CCCA 3M0MA 4AIUA 1KXTA 2HCVA 4JTKA 4WKFA 3TYEA 3CIVA 3R0UA 3KCJA 4FXFA 3PJTA 3BLKA 3G1VA 3KXQA 4PFMA 2WMJA 2WMFA 1E55A 1TE1A 1RP8A 2QQ6A 3IGUA 3DI0A 3BVJA 1H2JA 3HPXA 2P0OA 1EA9C 1GVEA 2YB4A 1SVDA 2VMFA 4GZEA 1DL3A 5EMMA 4UCGA 1S38A 2CLFA 2QHAA 4BF9A 2F2HA 1C3FA 3AYRA 1A3XA 4JY9A 2A79A 2QYGA 3DESA 3N1AA 1EWEA 4QX4A 3CHCA 3QTPA 3M5XA 4CQBA 2GJXB 3FHQA 3LHYA 1I2RA 2V63A 4O17A 4HNUA 3VDBA 1JYWA 5LGZA 1C8QA 2UY3A 2HPIA 4H2CA 3H22A 2H3BA 3MSDA 4I3GA 1VBGA 4PMNA 1XYMA 5CPTA 2E25A 4RZ4A 5D8ZA 4MM1A 3TSMA 3BAYA 2LLEA 2ZZ6A 4MYAA 2YW3A 3NM3A 1BYDA 2UBPC 3UZJA 2QMKA 4PFHA 2VFFA 1VIWA 3A13A 2XH2A 1KD0A 3THQA 1DKWA 3CT2A 4W8LA 3TCEA 1G0CA 1XLIA 3VM5A 2HNHA 2IQ0A 1J9YA 4YU1A 3EB4A 2QULA 3WJXA 3N9RA 2KZHA 1KQYA 3LV6A 1W3HA 4HU4A 1X1OA 2NQZA 3E2RA 5A5WA 1HO1A 3WNOA 3IJ6A 4M1RA 1UP0A 1MW0A 2PTWA 4W5ZA 3PSVA 2CBVA 3HTWA 4UFKA 1MEHA 4LC6A 3IJLA 3A3HA 5D05A 3OP2A 3GAKA 1UWAA 3ZR4A 4ZFCA 1XSKA 4LY8A 1ONEA 1GZ1A 2W61A 3DFPA 4JIIX 1QNRA 1QI4A 4ADSA 5K7JA 2QV5A 3UWWA 1UZ1A 5GJPA 3MTWA 1IE7C 2E68A 1WV2A 4IICA 2XN2A 1W9PA 1V0MA 1W9DM 2FHBA 3WZ0E 4JNZA 4CD7A 3FYYA 1XIHA 2YX0A 3O7UA 4TV5A 2IMRA 4AYSA 1D7FA 4XZLX 4LAOA 1JZ5A 2Z1SA 2ZRVA 3HPZA 3L65A 3TYAA 3ES7A 4BHYA 1EL3A 4JTDA 2VGFA 2ZA3A 3B0VC 3GU2A 3P14A 4GGHA 4XSLA 2PD5A 4CKQA 4OVXA 4XAGA 1JZ2A 3RM9A 2YFNA 3DHDA 1W2VA 4YVPA 4H04A 3RO6A 2HK0A 3NR0A 4LJ3A 2AGKA 1XINA 4X9SA 3DI1A 2PTZA 2R1KA 4F0HA 4G1KA 4U28A 1IYXA 2F6UA 1HT6A 1LQAA 1MSSA 2TYSA 4Z1BA 3BCFA 3ABZA 2VGGA 3NYZA 1W1VA 4RE2A 3W0KA 2C16A 4N7QA 3IARA 5AC6A 5EGRA 4DM2A 1F61A 3NOEA 4WY0B 5F1UA 3T0AA 1F9CA 3W1MA 4HD5A 1Y5WA 3V4BA 4PUJA 4PGLA 3BCJA 1GW9A 1LLOA 4OECA 4JFWA 3FEMA 3BXWA 4AHOA 3LHVA 1R9XA 4E2OA 1VJIA 5E5CA 3RDKA 3DC0A 3HMCA 1XIDA 3BQ6A 1ZP4A 1ZCOA 1TTIA 3RMJA 1ZGDA 2W66A 1JPDX 2I9UA 2E6YA 4TX6A 1YXDA 4HPNA 2WSRA 5I0DA 3EWXA 5AFDA 1O5QA 3T44A 4MJZA 2QR6A 3N73A 4F2UA 3QEZA 2ISVA 4W88A 4Y9OA 1QW8A 3ANYA 4Q8PA 5EYWA 4O14A 2D0FA 1KW1A 1Q6GA 1HKJA 5GJMA 4N6FA 5H1WA 2CLHA 5CPOA 3HG2A 2QCFA 3K30A 4KWSA 4XTDA 4PE8A 5DBUA 1UWRA 4CQCA 1RA5A 1VFOA 1FCUA 4MMWA 1NDVA 3W1XA 8RUCA 3P0XA 1JRBA 2HROA 4P7LA 4GY7A 6ALDA 5C9UA 1TJ0A 4A2SA 3UWUA 3S5YA 2CLMA 3EOOA 3V0TA 3LSBA 4O54A 1KFEA 3CS2A 1EHNA 3RJXA 3L5AA 1VH7A 4LBSA 4KW2A 2QF8A 4PTNA 1KBBA 3MSYA 3M07A 5A6MA 3VCCA 1A5AA 3GFYA 3AS2A 1H1NA 1QK2A 1JCJA 2V68A 2VC6A 3VX1A 3AI0A 3ZLHA 3RLGA 1P4CA 1G7VA 4UMAA 3ZR5A 3NCOA 5TBOA 3O06A 3V1HA 3VUSA 1K03A 3MHUA 4RZ5A 1RJPA 2JEPA 4XV0A 2YCIX 3WQ4A 3VFCA 3ARRA 2CWNA 2B7PA 1YYAA 2FZMA 2WCSA 5CCZA 3W29A 6A3HA 5KZEA 1QWKA 2PGEA 2NQ9A 3HM7A 2WMGA 2FB2A 4FK9A 4GH1A 1ITUA 5T26A 1DXEA 5HNRA 1WZKA 1GOMA 3R4IA 2ICSA 1M65A 4BK9A 1J0ZA 4EWND 1K4GA 1A4LA 3QH2A 4FI4A 4C60A 4DWDA 3L67A 4WEVX 4J3WA 3TC3A 3SCVA 3W6MA 5D8WA 4KF1A 4ZOBA 1OIFA 1FDJA 3TR2A 4J2PA 4ZO8A 1UD3A 4RLIA 3CHFA 4O0QA 5CGQA 4IP4A 2CLKA 2PDIA 3BGAA 1X6UA 4CNUA 4TVDA 1DE6A 1XKYA 2P88A 2NVAA 4PTXA 2O55A 4HZ8A 1XKJA 1L6SA 2VDIA 5CJMA 4ICNA 3F1QA 3Q67A 2FZNA 5EA9A 1BXNA 4EPKA 1TR1A 2I5IA 3TYBA 3BH4A 1JGIA 1XYAA 1JL8A 1T8XA 2ZUMA 4W4QA 2ZTJA 1X1NA 3FS2A 4IIHA 2CIPA 2C0AA 3W1AA 3GX9A 1S5VA 5D33A 3SY1A 5CG0A 8XIMA 3KEHA 4IWWA 5BRQA 2NQ5A 1UR8A 3VXGA 3CIXA 4LB4A 4KFOA 3TXZA 1C91A 3AYSA 3H4XA 1R8LA 1UC4A 1UZDA 3SZ8A 4IJRA 1TV4A 2Q01A 3INPA 3VOIA 2P76A 4QAWA 1EOKA 3OBEA 4WCJA 3PWAA 4C6KA 4NU7A 1XLAA 4BF7A 4YHGA 1Q6EA 5K9DA 1W3TA 1V02E 3G1XA 4C6JA 3GTIA 1WPCA 3A4JA 3VPLA 2RHGA 4S3GA 3N2XA 4DUOA 3RCNA 3ATYA 4MZ8A 3QR0A 1M53A 3IV3A 4AVFA 3RYSA 3MUXA 1KGUA 3TMQA 1DHKA 4HA1A 5BNKA 4IIDA 1LCOA 1Z42A 3R8HA 3G1HA 1GPWA 4JQ1A 2VFGA 3W6YA 3VC6A 1M6JA 3JZUA 5AY7A 3GLCA 3KX6A 5AHEA 2X1RA 1FWIC 3LXAA 3TKFA 5HNUA 4H3DA 1Z44A 4YMZA 1XL9A 3T1GA 5AN7A 4NILA 1JUKA 1Q2SA 4LAZA 3BLOA 2GL5A 1LDCA 1XYLA 1GYLA 5A8OA 3EWWA 1J18A 1E6SM 2AQWA 3WD4A 4OIFA 2GUBA 3WQCA 2E8ZA 4GIEA 4F0KA 1EUAA 1RK5A 3QC0A 1B4KA 2ZIDA 3VZXA 1SFSA 3Q4DA 4D9PA 3W2UA 2PFHA 5T9BG 2MUCA 1R3RA 2P53A 1EA0A 3A64A 2CHOA 5G2WA 5KTLA 5EMLA 1NAL1 3TR9A 5DF0A 1NQ6A 4GMEA 2WCGA 3QY8A 5DMNA 5G4HC 3TROA 1S1RA 1GG1A 1OFPA 3CUGA 2RDWA 4QCFA 1MUWA 2WSQA 5E6ZA 4HOXA 3CV2A 3KM8A 4B90A 2ZUSA 4XG1A 1HFBA 4ZQCA 3V75A 3HPSA 3MHGA 4LFYA 4NVTA 4XIAA 5E1QA 5FA5A 2VGIA 1XDLA 2FDSA 3HV9A 4MF4A 2NUWA 5DMYA 1R0MA 1KXQA 3C0JA 1UP3A 3W7DA 1H7PA 4FOJA 2QVNA 2ZFAA 3PNUA 1LTDA 2CEQA 3AIBA 4GZJA 2B4GA 3PVFA 2GSEA 4XO7A 3UYCA 3BG3A 3MMWA 4NRRA 2OZTA 1H61A 5C55A 1E6ZA 3BWWA 1EKOA 3IIZA 1TMLA 5CC6A 3BL3A 4TR9A 3GH5A 3IIOA 1EOMA 2DV0A 3KOYA 4UNKA 4RJEA 1Q63A 3WQOA 3S2MA 5KEZA 1WZMA 3PG8A 2ATSA 3LHZA 3EOSA </