3QY8A

Crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
243
structure length
243
Chain Sequence
MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVMDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of YwqE from Bacillus subtilis and CpsB from Streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase CpsB
total genus 90
structure length 243
sequence length 243
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3qy8A00
2W9MA 2D2HA 3ID7A 3IV8A 4LANA 2XIOA 2UBPC 4C6QA 2DVXA 4C6NA 3QGKC 2OODA 4ERAA 4XD6A 4UBPC 1J6PA 4GOAA 1BF6A 3LA4A 2YZ5A 1ITUA 1RJPA 4H01A 4KETA 2KAUC 3O7UA 4F0SA 4LFYA 2Z26A 4KEZA 4CNTA 4IFKA 4ERIA 2Z27A 2EG7A 1FWHC 4INFA 2HPIA 3GG7A 2F6KA 4C6IA 4IF2A 3OOQA 3QY6A 2HBVA 1V51A 1YIXA 4C6BA 2GOKA 4DYKA 1E9YB 4DLFA 4GK8A 1KRCC 1RA0A 4IQJA 2FTWA 1PO9A 1A5NC 2GSEA 4P5UA 4EPEC 1A4MA 1EZ2A 1A5KC 4RDZA 4DIAA 4B91A 3ISIX 3T1GA 4C6OA 3A3XA 1EJWC 2DVTA 3GTIA 3FDKA 1A5OC 4GBDA 4PBFA 1A5LC 3ORWA 4B92A 1GKRA 2FFIA 2Y1HA 2HNHA 3LGGA 4H9XA 2AQVA 3TN6A 1K70A 2I9UA 4C6MA 3PANA 3EGJA 4RE0A 4KIRA 3E74A 3AUOA 2DVUA 2Z7GA 4DZHA 3GTXA 3AU2A 4KEUA 3SFWA 1GKPA 4H9ZA 4XAGA 1IE7C 3C86A 2E1WA 4DNMA 1J6OA 1O5RA 1EJUC 4KF1A 1XRTA 2QPXA 4C6DA 4H00A 2R1LA 3UBPC 5FSEC 5HMDA 3S4TA 4QTGA 3URQA 3MVIA 1P6CA 4H9VA 3URNA 4DI9A 3E38A 1RJQA 2R1NA 2Q01A 3K4WA 4C65A 4ICMA 4IG2A 4CNSA 2P50A 4V1YA 1ZZMA 3F2BA 2Z29A 3IGHX 1EJVC 4GYFA 2VUNA 4GY7A 4LAKA 4NG3A 4GX8A 4B3ZA 3F4CA 1YMYA 1XRFA 3MTWA 4LEFA 2GWNA 4HK5A 3OODA 5E5CA 1FWIC 3B0YA 4PCPA 3NURA 2OOFA 1A4LA 3GU1A 1P1MA 4G2DA 3QY8A 2HQAA 4LAMA 4IFRA 3S2NA 4HA0A 1DPMA 3GU9A 4C6FA 3E0LA 3T81A 3S2MA 2PUZA 4KESA 1ADDA 4EPBC 3URBA 1ITQA 2ADAA 4PE8A 1R9XA 1YBQA 3MKVA 4XD5A 4H9UA 4BJHA 4EPDC 4XAZA 2QVNA 4G7EB 1RK6A 4L6DA 4GXWA 3PAOA 2ICSA 3TN3A 4CQDA 4LCSA 3IACA 3S2JA 1PTAA 4IGMA 1NDVA 4BKNA 3PBMA 4IFOA 1M7JA 2BB0A 2EG8A 4IFKB 4PCNA 2G3FA 1P6BA 2Z25A 1R9ZA 2ANUA 3GRIA 4RDYA 4QS6A 2E25A 1HZYA 3MPGA 3B0XA 4ERGA 1FWEC 3GIQA 1KRAC 3OQEA 4I6VA 2R1KA 4YIWA 4D8LA 3F2DA 1V79A 1XGEA 2AMXA 4GC3A 3E2VA 4C6EA 4M51A 4XD4A 2P53A 3CS2A 1FKWA 2RAGA 4QS5A 3LSCA 3LS9A 1WXYA 4XD3A 4DLMA 5HMFA 3K2GA 2O4QA 3RHGA 3GIPA 3FEQA 2Z2BA 4CQBA 1FWCC 1EJXC 1FWDC 2IMRA 4G7EA 1NDYA 3UPMA 4H9TA 1JGMA 4LCRA 3CJPA 1UMLA 4WGXA 5CH9A 1KRMA 3PNUA 3LY0A 2A3LA 2Z28A 3B40A 2YB4A 3GTHA 2FVMA 1J5SA 1RA5A 1PSCA 1R9YA 4I6KA 3UR2A 3TN4A 3JZEA 3MVTA 4HK6A 1FWGC 2QS8A 2EG6A 2ZC1A 3TNBA 2OB3A 3DCPA 3OU8A 3LSBA 3D6NA 3EWCA 3SO7A 4HK7A 2Z24A 2WJEA 4V1XA 2VC7A 1V4YA 1UIPA 2WJFA 2I5GA 1I0BA 2R1PA 5A6TC 3GTFA 4H9MA 4CEXC 2WM1A 4NP7A 4LCQA 4QROA 1ONWA 4HJWA 2VM8A 4GZ7A 4KERA 4UB9A 4ZSUA 4JOMA 1FWAC 1POJA 3DC8A 3GU2A 3IPWA 5LXXA 4GX9A 1EJTC 4C6JA 3RCMA 4CEUC 3WZ0E 3RN6A 1K1DA 3IRSA 3E3HA 3MSRA 3E0FA 4C5YA 4TQTA 3AU6A 4F0RA 2YXOA 4Z42C 4C6PA 1FWJC 4WHBA 4E3TA 1NFGA 3S2LA 4LH8A 2D2JA 4KEVA 3UR5A 4B90A 4AQLA 2UZ9A 1KCXA 1EJRC 2PGFA 4GY1A 4C6CA 3NQBA 1NDWA 2Z2AA 5HMEA 4RZBA 3NEHA 4CQCA 1GKQA 4L9XA 3V7PA 3QY7A 4LAOA 1S3TC 3BE7A 1RK5A 3MDUA 3A4JA 1UBPC 4GY0A 2Z4GA 4ZSTA 3A3WA 2WJDA 4BY3A 2PGRA 3EWDA 3K5XA 2YB1A 4DI8A 4RDVA 1EJSC 1EYWA 3FDGA 4WVXA 3G77A 4RDWA 4C6KA 1POKA 1YNYA 3PNZA 3WYZA 3URAA 4NI8A 5G4HC 1V77A 1XWYA 4R7WA 4IGNA 4IH3A 1EF2A 2QT3A 4F0LA 4DO7A 4C6LA 1RJRA 4CNUA 4C60A 4IG2B 3UF9A 1FKXA 2GZXA 5AKQA 3DUGA 2FVKA 1QXLA 4QSFA 2BGNE 1A5MC 1KRBC 3IARA 3HTWA 4J2MA 4R85A 3TN5A 3ICJA 1FWBC 3HM7A 1VFLA 3N2CA 3IJ6A 4AC7C 2HPMA 1FWFC 3KM8A 2CZVA 2PAJA 4H9YA 4PBEA 1WXZA 2FTYA 3OJGA 1K6WA 4XAFA 1RAKA 3O0FA 3LGDA 3ITCA 1I0DA 2AQOA 3MJMA 3RYSA 3F2CA 2D2GA 4LALA 3R0DA 1J79A 4KQNA 3LNPA 2PLMA 1ONXA 4C5ZA 1UIOA 3QGAC 2VHLA 2OQLA 4J5NA 2OGJA 4MUPA 1W1IE 1YBQB 2Z00A 4EPKA 3WMLA 2Q09A 1NDZA 2VC5A 1QW7A 3OVGA 1E9ZB 3HPAA 1O12A 2VR2A 2O4MA 3F4DA 4J35A 1PB0A 4EP8C 3LU2A 4QRNA 3T8LA 4XAYA 4DZIA 2HBXA 4OFCA 3GUWA 3MDWA 1M65A 1YRRA 4R88A 1V7AA 5FSDC 2GWGA 3CAKA 2R1MA 1M68A
chains in the Genus database with same CATH superfamily
4G1KA 4QCFA 4LX4A 2XH0A 3E12A 1FHDA 5AHNA 3VI2A 1BF6A 4KETA 2O7QA 4QG9A 3AZRA 4E2DA 4I5XA 3P3BA 1F3EA 4E38A 3E1F1 2Z27A 1FWHC 4KPLA 4EAMA 3DHFA 3SCWA 3ARSA 1MFUA 4OKDA 1AL8A 2OEMA 3WQFA 1X8CA 4LUSA 2XH7A 2ISWA 3OZOA 1K9DA 1A0EA 1CLVA 2CHRA 3AMDA 3LCWA 1EWDA 4LJ3A 2X1IA 3V36A 2Y7FA 3WEOA 3WF3A 3ZS4A 3SURA 1PEZA 1LG2A 3M64A 1Q8AA 1KBKA 2Y1HA 1HKVA 2PDLA 2WSYA 3VDAA 3W75A 2I17A 5T91A 1WE5A 4WEVX 4OQVA 4ZQCA 3MYOA 4JIIX 1UR9A 2NWRA 1MI3A 3S4TA 4QTGA 4IZGA 3EKLA 4UTTC 1JI2A 4QBXA 3BLLA 4V27A 4LS1A 5KMYA 4NZCA 4RR4A 2Y4SA 1O68A 1ZZMA 2WZIA 3KBMA 3N3TA 1QHOA 3WLTA 4B3ZA 1YDNA 1W3IA 3LNMA 2VD8A 4FXRA 4TTGA 1VS1A 3ZMRA 3ZSTA 3GBEA 3KTSA 3VFCA 4PC8A 3BAJA 1LLWA 4CD6A 1PV8A 1J9YA 2NV2A 3VKKA 3WQOA 2GVLA 3DENA 2TPSA 5I3FA 1R9XA 3PZTA 2ZXAA 2WVUA 3SRDA 2QV4A 4AYSA 4YMZA 5HQLA 4NKCA 1LBFA 1LT8A 3KDNA 5TQLA 2YL8A 4RE4A 3IGXA 4NYUA 1GQIA 3I3DA 2VCBA 3LLFA 1TPEA 2JFEX 4DEFA 1T96A 1JDCA 4AIUA 3Q37A 1R9ZA 1R2SA 1VFFA 3CV6A 1FXQA 1FWEC 5EMUA 4EAYA 1MW1A 1E1CA 3SN4A 2VP8A 3P81A 5HULA 3SZ8A 3NG3A 1DE6A 3EWZA 2X05A 2JBMA 1IZJA 1WXYA 3JZUA 4XD3A 2AQWA 3E49A 3W7JA 4DUVA 5RUBA 3C4UA 3K2GA 3N2TA 4GVFA 5CPTA 2HE8A 3WLPA 4IL0A 4MDPA 4K8GA 3KTXA 3NPVA 4IP7A 1MQQA 4LCRA 2RDWA 1RD5A 1FWWA 3LZ3A 1WDSA 2PI6A 1LF1A 3VKDA 3LY0A 2Z28A 3TQVA 4GFIA 5CKSA 4AD0A 3FJ6A 1JYXA 1E4IA 4I6KA 3AXIA 3B4YA 2ZRVA 4HK6A 2VRQA 2NWSA 4HTBA 2GDVA 3PTDA 3TR2A 5F7UA 3S9ZA 2P3ZA 1PPIA 2NUYA 4V1XA 2YDRA 3O06A 3WLNA 1DWAM 2EPMX 4RK8A 2E09A 5M17A 4LCQA 1ZL1A 1XJBA 2Q3OA 1C8XA 5F4SA 1R2RA 5A8MA 2FDMA 1QI4A 3SRFA 4WKAA 4YTRA 1JNEA 4J9JA 4MMWA 3RUBL 4PA8A 4IHCA 1L6FA 1XIEA 3NGJA 3HGOA 1S2VA 1U1HA 4KCUA 4GKLA 2V3GA 1A50A 1KM1A 2DZXA 2GVYA 2UV8G 3VZYA 3I6RA 2OMAA 2GJRA 3AU6A 1WZKA 2BMBA 3W1PA 4K3ZA 1G94A 4NU7A 1BVNP 2XFWA 4HB7A 5ABHA 4CGTA 4WK9A 3W71A 2VL4A 3MT1A 5LSMA 3MSDA 1EJRC 1FP8A 2E68A 3KHDA 1GOKA 4A3QA 4JTUA 2J9YA 1UKOA 1VPQA 4ICNA 1X39A 3AIEA 3A4WA 3A4JA 3IJLA 3Q2DA 3RMEA 3L0NA 2WJDA 1SQ7A 2QIIA 1GOWA 4JYDA 3KWXA 3S5SA 3CH0A 1Z8AA 4P8VA 3DFTA 4NI8A 3UXKA 1E3ZA 3BSMA 2Y0FA 5AHIA 1RJRA 3E96A 3A47A 2OWCA 5G4WA 1BTCA 2ZUNA 1XD1A 5DY3A 4JHZA 5I24A 4YHGA 4AIEA 5LIWX 4FIRA 2D1ZA 4Y8FA 1BPLB 4AY7A 1KBBA 1HJVA 2ZVIA 4IIBA 3WCZA 2WZTA 1GJPA 3VE9A 1E5NA 1F5ZA 3G22A 4DZAA 3KL0A 5E70A 3HJZA 4HNNA 3L2MA 2EXOA 5D05A 3BGAA 4GNKB 4BWLC 1PUDA 3WN6A 3O6CA 3NVTA 2J27A 1EH9A 2CCRA 3UZJA 4IISA 5BWAA 3T8LA 1E0VA 2PDUA 4GKTA 4DO4A 3M0MA 1MDRA 2ZRUA 1OZQA 4WUIA 2QPSA 1Y8BA 5T9CE 2QJNA 2QDHA 5H8UA 4NAEB 3WFLA 4H41A 2Q3RA 3FY1A 2Y7EA 2WKGA 2HROA 3BL3A 1GHSA 3MUCA 1AZ2A 2FZ8A 3HV8A 1YDOA 3GH4A 3QV8A 4RE2A 3W83A 5FF0A 3MZNA 4BFAA 3VD4A 5A8NA 1MNSA 1YADA 3F5LA 4CCCA 2ZRXA 2DFAA 1NJJA 5JQ9A 3WUGA 2ZADA 2A3AA 1LROA 4BHYA 3B97A 1ZPTA 2GVJA 5M5DA 4DYKA 4DRSA 4PTWA 3AHVA 2DT1A 1PKYA 1R3YA 3NYDA 3IS4A 3S42A 1TTJA 4DNHA 4MB4A 1R85A 4DIAA 1EHAA 4QHRA 2DUXA 1TIMA 3VDGA 2QDDA 2QPUA 1TSIA 3NSNA 2NLYA 3CQJA 1I2NA 4LVFA 4LVBA 1XLIA 5BWFA 3SRKA 3CPGA 3ORWA 1A5AA 3VIJA 4X22A 2DSKA 2XSXA 1HT6A 1G69A 3EGJA 4G6CA 4PUEA 2CLFA 4GACA 4UQBA 1QNQA 3EX3A 3N4AA 1LLOA 3G3DA 5CZKA 4AD4A 3ZJ8A 4LQ1A 5I6SA 3WDPP 3RK8A 1K8ZA 6A3HA 1PZ0A 4MKVA 1RBAA 5M2FX 3O0KA 1QO5A 2W79A 1ZBKA 4DAFA 2E9MA 5CG0A 4KCVA 3HF3A 2J8GA 4X9YA 4ICMA 3W38A 3LLDA 1W5QA 1RHCA 3C6CA 1OBAA 7REQB 1YLVA 2ON3A 3BLFA 5CGTA 1A53A 1EUAA 3CAQA 2QXWA 1TV2A 1T7LA 2INFA 1XIJA 3L2LA 2BOGX 4HHMA 1YDYA 4GYKA 2CXEA 1KV5A 3M6YA 3QY8A 4JHMA 4LAMA 1H60A 1H1ZA 3ZOAA 1NM9A 3T81A 4MIMA 3WJSA 2E3ZA 2WKJA 3AYRA 5CPQA 5JIPA 4O14A 1JF5A 5CCZA 4TIMA 1JIBA 4HPNA 4J40A 3PAOA 3TN3A 3K4DA 2J7GA 4WCJA 3IACA 4LCSA 1Q6LA 2OQHA 1OG0A 3TZNA 3CHVA 3STFA 1KTCA 2GDQA 2QMJA 3KS5A 3DC0A 2XVNA 3CZ8A 3M0HA 4ERGA 4I6VA 1Q6GA 1GPWA 2I7GA 3PJTA 3MJYA 4NAEA 1E6SM 1V6XA 1HN1A 1SFLA 5CG7A 4E5TA 2J24A 1G1YA 2CZFA 3UJ2A 3LMYA 1PX8A 3FSTA 4WJXA 5U4NA 3KXQA 2ONEA 3CWHA 3B8DA 1A3XA 1JGMA 4QLJA 3CJPA 4WGXA 1HGYA 1YE4A 5TF0A 1J2BA 3ZSSA 4WXYA 2PWFA 3NUKA 3PBVA 9CGTA 1XYFA 3WJYA 2YXXA 3JZEA 3ERPA 1YXYA 3LN3A 3OU8A 4AZ7A 1OYBA 3PFMA 1VBUA 3EWCA 3SO7A 4YYCA 3TW6A 1GOXA 3D0CA 1B31A 1I0BA 1KXVA 3WQPA 3WLKX 3VDHA 3HO8A 3B8WA 3VD5A 3EWXA 3W07A 1V5XA 4GZ7A 3VYLA 3EKGA 2IPWA 4IIGA 3IPWA 4F4RA 1JCYA 3SI9A 3CMJA 4D1IA 1G0CA 2PDIA 4CCDA 1TPC1 1GCYA 2CBUA 3V5FA 3WD3A 3WH9A 3QYSA 5LNSA 1PDYA 2WK2A 1R47A 1UR4A 1TWIA 2PDMA 3UWEA 1P0EA 1FWJC 1MRAA 2ZWZA 4E8DA 1UC5A 4HSOA 2FZNA 1UMYA 1XKYA 3B4UA 1UJQA 2ZZ2A 1A3HA 2ZQ0A 4ZO6A 3NEHA 4F0MA 3F4WA 2QNEA 1TPB1 1XYMA 2Q8XA 1GVYA 2YDQA 1KM4A 1EP2A 4LOCA 4R33A 2GK1A 3HPSA 3QY7A 1J0IA 3CYJA 3ZM8A 4ZSTA 1DWGM 3B8UA 7XIMA 3QOKA 5C0QA 3S6TA 1Q6OA 4JHOA 3WYZA 4ACYA 1ZHAA 4DELA 1WBJA 1CXFA 4AWUA 4IJCA 3AJ7A 1WAUA 3H8AA 2E40A 2X2YA 2OO0A 1FKXA 4LNYA 2P8CA 1WP6A 3GAKA 5CAHA 3MHGA 2BGNE 5K9DA 5DCDA 4UQEA 1XH2A 3II1A 2AL2A 3ALFA 2PSNA 1Q7MA 3JR2A 4H8NA 2V82A 3EOUA 3WQEA 3IJ9A 3HQPA 3KRZA 5DMYA 4EVZA 1KXHA 3P82A 4R34A 3F2CA 3E2QA 4C5ZA 2DP3A 4B5WA 1YPXA 1TV4A 3NGFA 2C91A 3WMLA 3B9AA 1A3WA 3RU6A 1F6YA 4FOJA 3VIGA 4O16A 2PBGA 3GXIA 2QCFA 1SGJA 1IR2A 3PPFA 4U4MA 4TR9A 1JUBA 4R88A 4XZ9A 2PLCA 3NQAA 4WLCA 1AVAA 2G3NA 4IUGA 1LL7A 5ABFB 1TWZA 1M68A 5AC7A 2X8RA 3PHAA 2UBPC 4XZHA 2PDXA 2O9OA 1B5TA 1IEQA 3WQDA 1XFBA 1F6KA 3BCDA 4KW2A 2DU2A 4XZMX 1DKWA 4EE9A 1GWJA 3LA4A 3KS6A 4C1NB 3WO8A 5HDRA 1HKKA 3R6IA 2OQYA 1TV5A 2B4GA 1LQ2A 2Z26A 3BC9A 4IFKA 1TV8A 3ARVA 2HPIA 3VNZA 2F6KA 2QVHA 4C7FA 2EAWA 2X0HA 2DIKA 1CXHA 2AMGA 1UQZA 3F1QA 4IPJA 4J7RA 4FLQA 4GK8A 4S2BA 4ICCX 3UZYA 1VHNA 3BZGA 1R3SA 2DZTA 3BLIA 3QM3A 3MY9A 1EIBA 4JICA 4KT2A 5A2BA 1QWKA 3SCRA 4Q7IA 5BXRA 5JVLA 3A22A 3N19B 4E6MA 1OYAA 3NWRA 1LWJA 2PURA 4NXKA 2DW7A 2RDXA 2POZA 2YBUA 4ZXOA 3MP5A 1N2VA 3CUZA 4HHPA 2GK1B 1LORA 1T0OA 2Y5JA 2QYGA 3WBAA 1YEYA 3LTYA 4KF1A 3ZFHA 2R1LA 3LQLA 2FZBA 3RITA 1D9EA 4GVGA 2W91A 2E67A 1CI1A 3UT0A 2PU1A 1F4AA 3OPSA 2NX3A 3VNKA 4JTSA 2X2GA 1JDDA 4Q8OA 4GYFA 3HG5A 2XVGA 2RGLA 4W7VA 3QEZA 3TXVA 4D1JA 1YMYA 2GFTA 4GCAA 5CBIA 1ISXA 3RM8A 2CBIA 3UXLA 1FWIC 2OSXA 5K4XA 3PUGA 1B1YA 3UZXA 3NQDA 1DYSA 5KSWA 2X09A 5BYWA 6TAAA 4MPKA 3VOHA 2BY1A 4JTQA 3AHTA 3SSJA 3TMLA 3UNTA 1XYAA 3AS0A 1XI3A 4E4FA 2XH4A 3EAUA 1DBTA 4F66A 4RUBA 1V0LA 4PEKA 3PR2A 3WNNA 3EXRA 3VTRA 2YYUA 1QPRA 4Q4RA 3UY7A 1U83A 4ZL1A 2ZX7A 3S2JA 1PTAA 2DPEA 1R7OA 3LTPA 1P7TA 2Z6IA 1SW7A 1Y0EA 3RU8X 3T42A 4IMFA 4XQ6A 1PTGA 3UJSA 5CBJA 4IPIA 3NQ6A 4QS6A 2DZWA 4US5A 3DHPA 4N9CA 1UWAA 3O16A 3CL6A 2V5CA 2CLIA 2P0IA 2A21A 2YA0A 1JYNA 1FKWA 2QCCA 5D04C 3DFSA 1TB3A 1XLJA 4DBUA 2JF7A 4KEMA 3D3AA 1LRQA 4CQBA 4S38A 4C1NA 1FWDC 3BSGA 3CO4A 1IZCA 2XSAA 1NDYA 2YBVA 5DANA 1UMLA 3E0VA 4UOZA 1XH1A 1XUZA 1ECQA 5EMMA 3C61A 3O2LA 1SW3A 1QJWA 4EX4A 2A3BA 4JIHA 1UH4A 1JAKA 5K9XA 3O63A 5CSUA 4IOTA 4B3KA 4KWWA 1U1JA 1EC9A 3R8HA 2GGIA 2OB3A 1QATA 3L65A 3QR0A 3NNTA 2NQ9A 2BHYA 2EBNA 2ISSA 3SUTA 4M5PA 4Q3MA 3ZZ1A 5ECVA 1QFEA 3AUJA 2DJLA 2YJQA 4O57A 2IKHA 3WDHA 4WKFA 1UH2A 5C9UA 1QNVA 2JIEA 2EPOA 3AROA 2FHFA 2ZTJA 1JD7A 4IJRA 4QNEA 1O5XA 2HJPA 2F2HA 2X40A 1ZBCA 4WY0F 3R7MA 3CUIA 1DWIM 2OYLA 4UTWC 2BGSA 2XSBA 3R10A 1I45A 4FX8A 2V30A 3SDOA 2XGBA 5I02A 1LJYA 1Z9AA 3PZOA 4XBSA 4W8BA 3V0SA 1J0ZA 3P5ZA 3WDIA 3U2CA 3UXDA 1JULA 4A2SA 4QDWA 4UIOA 1AW1A 3TQ0A 5A8OA 2BY3A 4KEVA 2D2JA 4Z2JA 1GYNA 1TJ0A 2PGFA 1X7FA 3J7HA 2ZBTA 5EKYA 5E09A 3MHFA 3ZLHA 1RXOB 3NIYA 1GHRA 3W7NA 1MWOA 3ZR6A 1KQYA 3FKKA 1US2A 1Q66A 3NQFA 4GIAA 4WX2A 4B4HA 3PNZA 4HZ7A 2NT1A 5G4HC 2CKRA 5CSSA 4O17A 2A6LA 4N4QA 3SY1A 1XIDA 1G7VA 2XDFA 3AIRA 3HG3A 2REQB 2ZXQA 4B9ZA 4CCZA 2FVKA 4YTSA 3PBYA 1GUVA 1R30A 2QF8A 4M7SA 1VFLA 1UD5A 2FZDA 3NPUA 4MOZA 3CZLA 2CLHA 3KM8A 1GVQA 3CPRA 4FS9A 1D3HA 1XLBA 2WV8A 3PBWA 3CV2A 1S38A 5D32A 2Y8VA 1UP2A 3A3HA 3ITOA 4ILSA 3WF0A 5A1AA 4PMZA 4LB3A 3I6TA 5DF0A 1D2KA 1AUSL 2WMFA 3LGEA 1FH8A 4FPSA 2E5DA 3CAVA 3VKBA 4UR8A 3QTGA 2G97A 3LV5A 1ESWA 2HBXA 3MI6A 1H7OA 1EA9C 5BMWA 1XC6A 3AYVA 5KTLA 1GVEA 1GTHA 4UFKA 3STCA 3GQYA 1JPKA 3BUVA 1OGGA 3UY8A 1G7UA 1QPOA 2AGKA 2GJXB 4LANA 3B05A 1RR2A 4CU6A 3NXFA 4JTCA 5C8BB 1LYXA 2PZ0A 5A94A 3VXGA 3AIVA 1TO3A 4ZQMA 2Z6JA 5I3IA 3VIKA 4GOAA 3CZGA 1NP2A 2YZ5A 3DGRA 3SAZA 5ABTA 4Q4KA 2YLLA 1C92A 1FOBA 5T26A 3BO9A 1MXGA 1PKMA 1OYCA 1ONRA 4CNNA 4LSBA 1E9IA 4Q7BA 2ISDA 4PTVA 1E9YB 3LYEA 1CGVA 2LLEA 2QJGA 2GSEA 3T2QA 1ZFJA 4YPJA 4BZYA 4N9DA 2YL6A 3U8GA 4AX7A 3NXLA 1BAGA 4XAPA 1VRXA 1VEPA 2DVTA 5D2TA 3WJXA 3P6LA 1OABA 1CB2A 2GJLA 3MANA 3DAQA 5HJXA 4LVDA 2OCZA 1EBGA 5FAGA 5JBEA 1ZBWA 3GYCA 4NRRA 1VBJA 4FX6M 3RLUA 2I9UA 2ABAA 4L56A 5ABFA 1SR9A 3AUOA 3MUXA 1L6YA 3TYUA 4NUWA 3DGBA 4IP4A 2V5BA 1JPMA 1LCOA 3VDCA 5FESA 4Z0JA 3TVAA 5EFFA 1TWDA 1P6CA 3CB8A 4FK9A 4XVDA 2QDEA 3WDJA 2Q01A 2XH2A 1CBGA 4ZEPA 3SCNA 3TCEA 1XYLA 2P50A 4UMCA 5MKGA 3W7IA 6CGTA 3F2BA 1XGZA 1ME9A 3CU2A 2NLIA 2WC3A 1AD4A 4NASA 2ODOA 3ZO9A 3CIWA 4QEHA 2CC0A 3S6OA 1MSSA 3W82A 3GSMA 1QNSA 2WNZA 3NURA 4MNMA 3IIXA 3C8FA 1SO4A 2HQAA 3G3MA 1A0CA 1TIWA 1P0NA 2ZRZA 3EWWA 1DPMA 3VNDA 4C6FA 3CLWA 1HGWA 3URBA 1YHTA 5A69A 1QOXA 3DFQA 4L64A 1CGXA 1PYFA 3CWNA 4GC4A 1REQA 2A4AA 2PTXA 1JZ5A 4DXXA 3GC2A 1TPVA 3DIPA 3TROA 1M7JA 2BB0A 3GXMA 2WOQA 2PWEA 4R53A 5CZTA 3CQIA 5BROA 2D20A 3MPGA 4XUYA 5E0FA 1VB9A 3OW1A 3LPGA 3N1AA 4C6EA 1Y65A 3AS1A 3GIYA 4LWWA 4KRUA 3MWCA 3R11A 1FWCC 1EJXC 5E9AA 4UTJA 3DZ1A 3N9SA 4LYQA 2A3EA 3L7RA 4TMCA 3M1ZA 3BG5A 3BARA 4X63A 1QASA 2P10A 2H3BA 2FVMA 3AS3A 4ZA0A 4DM1A 1VCFA 4KCWA 1GEHA 3MCMA 4ZCWA 1S3HA 3VGBA 3WF1A 3B9NA 2D23A 3LXAA 3A6OA 3W6LA 1F74A 1GVIA 2D0FA 1MO0A 2WHKA 3KOFA 2XGZA 3MB9A 5A6MA 2R1PA 1EL3A 2X30A 2BBFA 1NELA 2PDBA 2DT2A 2Z1VA 1CIUA 2ZTKA 3D3FA 4JZ5A 5HA7A 3BOFA 2W67A 4W7UA 4DJEC 3R94A 4AVFA 2NXIA 4H8UA 1EJTC 4FIQA 4L65A 1Q5MA 2XU2A 1TRDA 5J5RA 2EKGA 4AY8A 5LIUX 5MHBA 1EOKA 1XLLA 4YU1A 1OJXA 4A3UA 2EQDA 4JY9A 4JXCA 4V15A 3B0UX 2VZVA 5HNRA 4HNVA 4NNCA 4JY8A 1XINA 3HV9A 3S2LA 1AMYA 2E0PA 2H3DA 1TTIA 2UZ9A 2QHAA 4CU8A 3FK4A 3AHYA 1XUUA 3GNRA 4HCHA 4ZFCA 3W81A 2OZ3A 4H8VA 4CQCA 1F61A 1Q6EA 2OVLA 3IANA 4N42A 3VNIA 4JFSA 3OQ8A 1MW0A 1RP9A 3QZEA 3CL8A 3B8VA 1XLHA 2FB3A 2VZSA 3NQ8A 3F5KA 2YB1A 3BANA 3RRAA 1YNYA 4Z2GA 3OGVA 4J1OA 1GTEA 3L4ZA 1J0JA 3R79A 2BOEX 2VFHA 1F8MA 4JR5A 3VGDA 1VFUA 4YTUA 3NAVA 3ATZA 5A6BD 2XPKA 1BGGA 2HMCA 4CCEA 5KZMA 4AEOA 3QRHA 4NAFB 5A6JA 1W91A 4H7ZA 1Z69A 4B4FA 4H6KA 3UR8A 2NQHA 1UR3M 3MJMA 3STPA 1S5TA 3L4TA 1UIOA 3BLPX 1OF6A 1RLDA 1CNVA 5IRPA 4J5NA 4Z2IA 2WBGA 2OKOA 1QW9A 1W1IE 1UWTA 4EPKA 4DWSB 4OUEA 2HTMA 3VK5A 5I78A 4CD4A 3MUY1 1DJWA 1OF8A 3QZ6A 5BW6A 3UETA 3ARRA 3W1MA 4GQGA 2CXGA 2NV9A 3EB2A 4Z1BA 4L4OA 3OTRA 2B81A 4DWDA 1OCJA 1S5WA 4QG8A 3DFOA 1LOLA 3PSVA 3N04A 1H2JA 4CU7A 4DBEA 3A4XA 2RDUA 5IHRA 4L1XA 3HPZA 3WD4A 4HA1A 3DXIA 4L4PA 4MADA 4GZJA 5G5IA 3IRDA 1UW9A 4GYPA 3FIGA 4CNTA 1EEPA 4L4LA 3V5CA 1DJXA 1ZUAX 4INFA 1J0HA 1HJSA 3P8JA 3TW9A 1PDZA 3GFYA 3VGGA 1QCWA 3VVGA 1V51A 2A7RA 4P7LA 3AJXA 1KW1A 1PTDA 1W1ZA 3BLEA 4DUOA 1VKFA 4P5UA 4RDZA 4B91A 5CPSA 1BRLA 2W3ZA 2EEXA 3L4UA 4DWSA 4MY1A 3MZ2A 4LU0A 3IJ8A 3FDKA 1G5AA 5C70A 3KP0A 2BHUA 5FJOA 2A0NA 3OBKA 4HSNA 4NIRA 2QQ6A 4ZB2A 8CGTA 4ZTYA 5E6YA 1XYCA 4YCOA 1MDLA 3REQB 2J74A 3C56A 2TSYA 4S39A 4Z1CA 1AQHA 4DNMA 1K8YA 4QLLA 4S1FA 1X8FA 3EB3A 2DEPA 1W54A 2UY5A 1YX1A 1T41A 3OP2A 5HMDA 3HG2A 1EDGA 5D9MA 2QCEA 4DBSA 3BSHA 3QOMA 5HINA 2EPHA 3FJNA 4PN2A 5LGXA 1CECA 1RBLA 2PFHA 1S5VA 3M0KA 5L9FA 1E5JA 3L4XA 1HO4A 4A8LA 1H1YA 3IGHX 4X9SA 1H7XA 4DJFD 2V5LA 1BWLA 5C9RA 4AW7A 3MTWA 2GWNA 5FJPA 4GVIA 2E5CA 2ZKMX 3WD2A 3IWPA 3G1YA 2FVLA 4PL2A 4O8RA 2C1GA 4NJJA 1Q7QA 3DESA 2PUZA 4KESA 1ADDA 1G4EA 2PWVA 2ADAA 1VR6A 4QSHA 3WMSA 6REQB 2WZHA 3IIZA 3QPEA 1MQRA 4AVOA 1ZALA 3VGHA 4O4VA 4YL2A 4FB7A 3C2YA 2VQUA 3VOIA 1JZ3A 1T8XA 1DQUA 5KZ6A 3WELA 4XTDA 2WLZA 4A4AA 1VENA 4DUWA 3K1GA 1G4TA 2QCDA 3GC4A 4JQ2A 2BVTA 3TTSA 1R3TA 4H2CA 1PCWA 1EC7A 1I60A 4JX5A 5B7YA 4FEZA 1HUVA 3WL0A 3H7RA 2GUYA 5CPLA 4PR4A 2A3LA 3P0WA 1UB3A 6PTDA 5AC8A 4PB3A 2IQ0A 1W2VA 2XVKA 4H6QA 1QPKA 1SR0A 2GYIA 3RMJA 3EMZA 2GUBA 3EXSA 2FGLA 2JEPA 4FNPA 2QCMA 2ZA1A 4JKMA 3LSBA 4IMDA 5C5YA 1VFMA 3LHTA 4MAVA 1YNQA 3BLDA 4QAIA 2QULA 1TRIA 3G1XA 4X0VA 3W7MA 3WL1A 3E0IA 3KFTA 4J3ZA 5G1YA 3AIWA 1KV8A 1FA2A 3EX6A 5G2HA 3EKZA 3QSRA 4DF2A 1SJCA 3GXTA 3U57A 4DUXA 4Y8EA 1M7OA 1XBYA 4TV5A 2ZZ4A 1Q63A 3QHMA 1YKWA 3CL7A 3SW6A 3QKEA 3BOXA 4F9DA 1KWKA 4REQA 4URIA 1K1DA 3CGTA 2BLEA 1UUOA 4GGHA 4C5YA 4PTXA 2ACUA 4K37A 7TIMA 3TYZA 3W2JA 1S2AA 1M3UA 3SUVA 3I3BA 1FCUA 1OT2A 1UA3A 3ITVA 4C6CA 4MWAA 5FL1A 2W0UA 1Z89A 1XIBA 4O1EA 5LA0A 1C93A 4YTTA 1DJZA 2PF0A 2VR4A 1FUYA 5HWJA 3TONA 2WMKA 4DPQA 1SUXA 3RPMA 2QLYA 1LWHA 5GNYA 3QHNA 3G77A 1POKA 2JIWA 1NFPA 4JNMA 4KWUA 4JGDA 2PE4A 3U2ZA 3VIFA 6REQA 4FX7A 4OECA 1OFOA 3PVFA 3TOYA 3W1XA 4P7NA 4AC7C 5IHSA 4W5ZA 3QW4B 4JTFA 5AYZA 3GYEA 4EANA 4GGBA 1KKOA 2HXTA 1KLZA 5XINA 1TKKA 3ITCA 2VZUA 1EBHA 1OFDA 4B5NA 3FFSA 3VU2A 1OGSA 4LALA 1J79A 2VC6A 4HIBA 3P0XA 2DSZA 2D3NA 1XBVA 3M4HA 1VYSX 5DCEA 2B0MA 4CN1A 3CBWA 3PZ9A 5F2GA 3E2SA 2P5NA 3HFYA 1P48A 3HPFA 4PMRA 1I75A 1H0GA 3GBDA 4AIBA 3GR4A 4RJEA 1WZAA 4J3SA 1JD9A 1M65A 3N14A 1V7AA 2BODX 4K36A 3WEZA 5D09A 1J2WA 1HG3A 4IIEA 4OJYA 3MO4A 3EWUA 2GPTA 3M0VA 1X7IA 3VABA 1CXIA 3W7RA 1LUCA 3KBSA 4IMEA 3W3OA 3CUGA 3RPTA 4W9TA 4EF8A 2KAUC 3PAJA 1AFSA 3WLRA 3VIHA 1V3MA 1UD3A 2Z7KA 2D73A 4LFYA 1XQKA 3AYSA 3V1HA 5BXSA 5K2ZA 3NZGA 2J47A 2QAFA 1VPYA 3NDZA 2OEKA 3YPIA 4QITA 1KRCC 3GNPA 3NDOA 1PO9A 1A5NC 2EGZA 3OZMA 4LBUA 1NAL1 3HU7A 2F8QA 4E8GA 1MEWA 3UWZA 3LERA 3GDKA 4MUZA 3APTA 4B92A 3S5OA 1YXCA 7TAAA 1O4UA 3GY1A 3FJ4A 1OWQA 1K8XA 3TN6A 4XUGA 3K30A 1XYBA 3VMPA 3LI0A 2C3ZA 1JL8A 2XVLA 3HGJA 4LAUA 1BTMA 1BYBA 1EYEA 3W1TA 3G18A 3P2VA 4LYKA 1D3CA 3GNNA 3E38A 3VFLA 4I8YA 3OLDA 3EMCA 1K6AA 3G24A 1BYCA 2RHGA 2FMNA 5BRPA 4TX8A 4FLOA 3N34A 1KGWA 3TNOA 1X6LA 1MEHA 2WW5A 3LQGA 3TV8A 4YVPA 4O11A 4PCFA 1HJUA 3A12A 5A5WA 1B9BA 1SMAA 3TQKA 4W5UA 5E5CA 3UG3A 2A6NA 4YLWA 4XZNX 3B0YA 3SY8A 1V6WA 5DO8A 2XN0A 2ZUSA 3R25A 2V0TA 3S2NA 4JCMA 1XL9A 2ALDA 4HNCA 1DQWA 5AYBA 4GLEA 2J78A 4O1DA 2OU4A 3TE9A 2DZSA 4AD1A 3TFCA 3MKVA 1EJ7L 4ML9A 1ISYA 1US0A 2QVNA 1KFJA 2HK0A 5I3DA 4GXWA 3BTNA 1EXBA 4GISA 4UQCA 1UKPA 3OHMB 4S23A 1NDVA 2Y5SA 1KC7A 4IM4A 3UA4A 3UFYA 4QAWA 5A2CA 3PSWA 3B0XA 2GSHA 9XIAA 4S3EA 2R1KA 2PU0A 4C7DA 3GXNA 3KOWA 3UWQA 3ZIZA 4QCEA 1J4EA 2YLAA 4KH2A 1QVBA 4V2XA 2UWFA 5HATA 3ZLFA 3EXTA 4GJIA 2PTDA 1W0MA 1SM9A 2R6OA 3WH7A 2PPGA 4O1FA 2G3IA 4RXGA 1QWGA 4PMJA 3NZPA 4PULA 2OZ0A 1TG7A 3E5PA 3CEPA 1MUCA 4DXVA 4ZOAA 1CLKA 1QBAA 4D72A 1B4KA 4YCPA 4RZ4A 3GVGA 2GOUA 2QS8A 3LCHA 3GFZA 3DCPA 4GNVA 4N2YA 1K7XA 4N9EA 3OA3A 3CUHA 1KWGA 2Y7DA 3IIPA 3VKAA 3C3UA 5BOOA 1V4YA 3AISA 5A6TC 3BWWA 3GTFA 3CWOX 3W7OA 3LHWA 1X38A 3ENLA 4K6AA 3DBNA 1UUQA 2G3JA 1C7SA 4J27A 2BOFX 1VP5A 4PBGA 2OJPA 5A8GA 3LCXA 8A3HA 1EP3A 4C6JA 2RJGA 4S3JA 2BSLA 3L5LA 4WDUA 1W3HA 3WZ0E 4UR7A 4WJEA 4DN1A 3WF2A 1AJZA 1IIGA 2QMKA 3E3HA 3E0FA 2O56A 3GM8A 2Z2UA 4H6RA 3ABRA 4JX6A 4ZZ9A 3BQ6A 3L23A 4H6EA 2CLPA 4JFVA 3ZLGA 1OADA 1EZWA 4GMEA 1PKNA 2Y2WA 2WC4A 1A80A 4ML4A 3VO0A 1RALA 2DUAA 4L9XA 1A5CA 3H4WA 4IXXA 2ISFA 4QJ4B 4UTMA 3FHAA 3A3WA 4K38A 2R91A 1WXJA 3KZSA 2DSWA 1C7TA 2VYOA 4C6KA 2G0WA 4CD8A 1OB0A 3O6DA 5GNXA 1RBOB 1UD4A 1V8EA 4NX5A 4F0LA 1W1TA 2X41A 3CM4A 1DJQA 3VAVA 4E2VA 2OWXA 2GZXA 3KOXA 1K9EA 3G8EA 4M80A 2DDXA 4OT7A 4IP5A 1A5MC 2FZMA 2TYSA 2G41A 3ANUA 5DMLA 3TN5A 1XC4A 4UNKA 2V63A 3OLIA 4REQB 4AG0A 3S1WA 1KKRA 2FTYA 4Y9OA 5F2LA 3CZEA 4XAFA 1Z41A 1HL8A 2J9ZA 2NXHA 3R5EA 4JTTA 4JQ3A 4JFWA 2FQIA 4QISA 2WQPA 2YL5A 3FGCB 3FV9A 3CC1A 4OUIA 3LEPA 3DU0A 3U5YA 1UWQA 2Z00A 1Q6CA 1NDZA 1WKEA 2J77A 1HKMA 2CW6A 2ZX5A 2XM2A 2O4MA 3F4DA 4LPCA 1YPIA 4M3PA 3QQ1A 3TJLA 1LBLA 3GUWA 2VD9A 1UKQA 2BWGA 1LQ0A 1WDQA 2RJHA 5EGRA 3WQVA 3BJFA 3LOTA 2R1MA 1IGSA 2I9EA 3BQ5A 1E71M 2PTYA 2Q8ZA 3KZPA 3QGKC 3PF3A 3I10A 5CQ1A 1H09A 2JKAA 3KE0A 3NSMA 4GWEA 1ITUA 5CAKA 2I56A 3NL5A 2H8XA 4OU1A 3QQWA 3EEGA 1LL4A 1QHZA 2PB1A 2EG7A 2XUCA 5JMUA 3LLXA 3CV7A 2ZUUA 4J3WA 4CVUA 1A5UA 1S1RA 1EA0A 3CTLA 3KHJA 3OB8A 4FMVA 2XWEA 5GJPA 1JVNA 1R3VA 1X6UA 3LDVA 2L5HA 5DQPA 5KEZA 3FVDA 4O0ZA 5I77A 4Z2HA 1M01A 1OGBA 3DYMA 1K4GA 2CKSA 4PODA 3MU7A 1H7RA 5D2WA 3V35A 4AIOA 1E70M 4XIMA 5EYWA 5IXEA 1Y7VA 3PANA 3NA8A 2C0HA 1BQCA 4FNQA 4BCEA 1KBJA 3CB3A 3GTXA 3SJNA 4H9ZA 2WM0A 2EKCA 3EWBX 4HNUA 2E1WA 4CN6A 2JQXA 1JF6A 2FGBA 2UY3A 4S3GA 1XRVA 2NSOA 4D8AA 4IX0A 4NF7A 5FSEC 1JGIA 2OLHA 3SIMA 2PCEA 3MVIA 4DI9A 1VAHA 2OTDA 3H53A 3VINA 5CEWA 4WD0A 3U7BA 3NO5A 2MUCA 3VOJA 3CH9A 4LUTA 3LPPA 4G9PA 1BXCA 4DJDC 2WYSA 1TPUA 5D03A 3G1DA 3NQEA 3M7SA 2YGYA 3OGSA 1VRDA 4LAKA 3LB0A 3IVUA 2P0OA 4A8NA 2BTMA 3WENA 3DI1A 2WLYA 3FGCA 1O60A 4U3AA 4JBRA 5DBUA 8XIMA 1TJPA 1E0UA 3KRBA 3HG4A 3GG0A 3NCOA 3VC6A 5CBBA 1Z7AA 4P8WA 4UR9A 2QJIA 1ZJAA 4LW7A 1J5TA 1DJGA 4UWMA 1OCQA 3KWSA 1R2TA 1OD0A 1Y5XA 2FLIA 3EDFA 5AYXA 4LVAA 2EG8A 4IFKB 3QLLA 4QXIA 4A22A 3UXIA 1ZCOA 3JU2A 1XX1A 2E25A 1HZYA 5A6SA 3NZQA 4YIWA 1T40A 1CWYA 2WVSA 3CS2A 3G1FA 1W3LA 4AB4A 1YTDA 5BRQA 3I6EA 4GE8A 1Z6KA 2DGAA 3FYYA 2IMRA 4YWIA 3H70A 4H9TA 4GVHA 4RXFA 1Q2RA 1T8QA 4Y2WA 3GH7A 3LBMA 4XSMA 2YL9A 1TV7A 2QCLA 1VCGA 3AC0A 4QGCA 1TTQA 5HQMA 3QR1A 1V0MA 1TZZA 1GK8A 4UTIA 4OVXA 1XLEA 4M19A 1HKIA 3FCPA 1OCNA 3WKZA 1RQHA 4JYFA 2GJXA 4PUJA 3COTA 4ZR8A 5E0KA 2A3CA 3W76A 3TYBA 5HANA 3WNOA 3RFAA 4N9BA 2J25A 3S46A 4JQ1A 1E55A 5JUVA 2GGGA 1DWHM 2BHZA 1L9WA 2DV0A 3S9YA 5FF7A 3W2KA 1HJQA 1I9CB 3L66A 3LM7A 4JOMA 5G4EA 1KD0A 2J7HA 3FJLA 1IEWA 1XLCA 1H11A 4RL3A 3WIJA 4LV9A 3KRSA 3RCMA 1RH9A 5FL0A 4BS0A 3FYOA 2B7QA 2I57A 1S5MA 2H9AA 1F73A 3LCFA 5AOUA 1UHVA 2HVOA 3NQVA 4YHEA 2QEZA 1Q8JA 1WDPA 2YCLA 4F0RA 2BY0A 4WY0B 3GC5A 1SZFA 3CNYA 1ZP3A 3LRLA 5DX7A 5FA5A 1Q45A 2OGYA 4XKMA 2HSAA 3GVRA 5XIAA 3VOCA 4ADSA 5AB3A 5J8LA 4DF1A 1NF7A 4I7VA 4XZBA 3QFWA 4ZOEA 1QHPA 4OHQA 1OFQA 4PRTA 5TAOA 5EU9A 4NZ1A 4P61A 4F9JA 4JTKA 3UJRA 3NEVA 2CWNA 1ZJHA 5REQB 4QIUA 3O07A 4UMAA 2XTKA 2DH2A 1W56A 3TR9A 3N9KA 5I5RA 4LXFA 3H54A 2D24A 3MW7A 4X2RA 3SQLA 4TV6A 4C6LA 3SGZA 2ZZ5A 3A9BA 1TMHA 4KS0A 3FA3A 1PJ9A 3NOYA 5C9WA 4GA8A 1KRBC 3IARA 2IS7A 3OVPA 3ICJA 1TQJA 4AEEA 4JFTA 4H9YA 2PAJA 5C2CA 2Q6ZA 1RLCL 1YXDA 2ZZ7A 3UWWA 3WQ8A 4GG9A 5FKYA 1Z44A 4UTWA 2C14A 2JE8A 5D38A 4W89A 3BCJA 5C54A 2V3DA 2V68A 1M03A 4OIFA 1U33A 3H2EA 3P93A 2PF8A 2YA1A 3ECQA 1I2PA 2HXUA 3BG3A 3R1ZA 1TELA 2V67A 1V3JA 2TODA 4ZOBA 4EACA 3OBAA 4FXFA 4KFPA 4J35A 3OG2A 3UJEA 2FHCA 3CQKA 4ONVA 2XINA 4RNIA 2E6DA 2VWSA 5LGZA 5FIPA 2RUSA 2OT1A 2V3FA 2D2HA 2G8ZA 3E9AA 4C6NA 3LHYA 1HF6A 3T6CA 1E72M 3OEXA 3DX5A 4UZUA 3BJSA 5FAJA 1U5HA 4LUYA 3M44A 3UYIA 1K8CA 3HPXA 1XS2A 1C8VA 2C18A 3IV3A 5DCBA 1L6GA 3T78A 1TVNA 4ERIA 1WB0A 4PH6A 1W8GA 3GG7A 3HN3A 4O53A 1PX4A 3CMGA 1G6CA 2PGEA 3S1XA 1PZ3A 2XIBA 4GO8A 2VCCA 1TWSA 4WF7A 3SCPA 4MF4A 4H3DA 1E4NA 2BDQA 1QNOA 3M0IA 5EB8A 1EZ2A 1BGAA 4GYJA 2VEMA 2VO5A 2ZUWA 3GDMA 4TO8A 5TNVA 1E0XA 4XZIA 2WMJA 3AXXA 4R7JA 4HSHA 1A5OC 4UQ9A 3N6QA 1UJPA 1XD0A 1GKRA 5D9OA 1EO5A 4PGLA 3LENA 1RQEA 2PWGA 3USBA 4DO6A 2HNHA 3LGGA 3T05A 2YX0A 3AS2A 3DH7A 4C6MA 1W9PA 1FCVA 5K4ZA 1E15A 4KIRA 3E74A 1KB3A 3AU2A 4KEUA 5AC6A 4Z17A 2NQ5A 1BXNA 3IAQA 4Q6XA 2NQZA 4IICA 2BVDA 3H23A 3WD0A 1EJUC 1ZAHA 1H49A 4UFHA 3UBPC 3EDEA 4Q7NA 1ML1A 3VX0A 5AZ1A 3LPOA 4MGGA 1HO1A 1E6RA 3MSGA 3OBEA 1TUFA 3T9PA 3AMGA 3PG9A 3RRXA 4K39A 2C0AA 3UVAA 3MCNA 3OLGA 3WLSA 1C29A 1S2TA 4NG3A 2J79A 4GH3A 4GIEA 2J4GA 3VM5A 5BU9A 1K4HA 3TTEA 3I65A 2CLOA 5I03A 5I07A 4G2DA 4IGSA 4JTRA 1LRTA 3EZ4A 1OSEA 1I4NA 4AZCB 2VFEA 4US6A 4MFEA 3O05A 2G95A 2XIIA 5FJJA 4EPBC 2GGJA 3ZT5A 4XD5A 1IXOA 3PUOA 2CHOA 3F4VA 1FH9A 3PS7A 3DYOA 1DWJM 4IGMA 4P2VA 1GQKA 5IOBA 3PBMA 3QC3A 2IPGA 1F07A 2Z25A 3E6EA 3QVQA 2C19A 3G1AA 3EMQA 2GQ9A 4O8AA 4RZ5A 3W6MA 1V79A 3ARZA 3QKZA 1XGEA 3E2VA 1H41A 4H8HA 3W7QA 3LSCA 2ISVA 3MI3A 1E4LA 1KQZA 4BI5A 1W37A 3IJ7A 2DSUA 2Y8KA 3FEQA 5AFDA 2DZUA 4G7EA 3A13A 5K7JA 3BAKA 4W84A 3HZ3A 1CYGA 2WCGA 1ISVA 4BK9A 3UXAA 3B40A 4IIFA 3VMNA 3GTHA 4CD5A 3VOFA 1GJUA 2GGEA 4K8EA 1GZ1A 4UMBA 2HV5A 5EFDA 1IZKA 1PSCA 3BICA 4GBUA 3QV7A 1TA3A 2HE5A 1FRBA 3TN4A 4GH1A 4MZ8A 1Q85A 2ZC1A 2KZHA 1EX1A 4HK7A 1FHVA 5KINA 2DQXA 3DERA 4GIRA 4CEXC 4DBWA 1XIIA 1OC7A 1ZGDA 2QCNA 4GFSA 1ONWA 1NQKA 4HJWA 2XJ7A 1DJHA 1BKHA 3H4GA 3VZZA 1E51A 2QGHA 2J66A 4F3HA 4Q8TA 2AKZA 1XLDA 2YCIX 3I68A 5HUPA 3CQ0A 3SCQA 1KXTA 3SM0A 3LCGA 1LRNA 3P67A 3P60A 1DJIA 4O54A 4YXGA 1BRLB 3BVJA 5TIMA 1W9VA 2GLKA 1UP0A 4EIVA 3B8SA 1VQTA 1O1ZA 2IW0A 3NL6A 4X0NA 4HU8A 1SFJA 5G2WA 1CB7B 3L9CA 3EA2A 3WUBA 3H2MA 4G5DA 1UOKA 3GR8A 4PB5A 1H50A 3KEHA 2PWHA 1UP3A 5ENLA 1MFVA 1DIDA 3RXZA 3WDQA 3IUHA 2QJMA 2Z4GA 3GLCA 3I7QA 4WIWA 1J11A 2WHMA 3NQ2A 4RDWA 3C0SA 1S1PA 2QUNA 4HPXA 3WH6A 3B03A 1UD6A 3GDRA 2ZA2A 4ZO7A 3KVLA 3T08A 3C0LA 3DUGA 1S2CA 4NI3A 1JFXA 3MCOA 3EEZA 5A8PA 3HM7A 3VUPA 1KFLA 1IXQA 1H63A 1ISWA 2CPUA 2OFJA 1LBMA 2GQ3A 3NFUA 4N0RA 3AFBA 5CPMA 1TWWA 4A8RA 4IMAA 4WY0A 3UZ5A 1G4PA 3CZJA 4A3HA 2E8ZA 4KQNA 3IIVA 1GNXA 5AYIA 3ONBA 2IKJA 4HNLA 2WPBA 4YVXA 4H7VA 1TFVA 4QDPA 2VX6A 2P1FA 3TDFA 8TIMA 5GJNA 2X1TA 2PS2A 4ZVJA 4DZIA 2J75A 3HA1A 4JKLA 1F76A 2OSWA 4U5IA 4AZ6A 4Z1YA 1WUFA 4CD7A 5FEWA 3H22A 1NQ6A 2IPJA 1A5SA 2GWGA 2OZTA 3R2GA 1W1A1 1W5NA 4UFLA 4C6QA 3FEMA 1DV7A 2YZRA 3F4NA 1S46A 2E28A 5CSYA 1MZHA 3SGGA 1F8IA 2EJ1A 3UNDA 1YE6A 2PP0A 4MB5A 4D6JA 2J7EA 4LAZA 5HWNA 1IWAA 4OV9A 1JPDX 3BAWA 3P7YA 4J3XA 1UQYA 1AG1O 1QOPA 3AAMA 5KITA 4D6HA 4HP5A 1BFNA 3NO1A 2Q71A 1WO2A 5D9PA 4KRTA 2Y63A 1Q3NA 2ZX9A 4QE5A 4HU3A 3OZYA 1RA0A 3WK2A 1X6NA 1CX9A 4E4PA 3M0XA 1QNPA 2BASA 2C16A 2FH8A 1O94A 3A3XA 4IL2A 2IXUA 2NVAA 4H83A 4S2CA 4AXKA 2DT3A 2SFPA 4ZQNA 2I5IA 3WNMA 1UOZA 3EX4A 1W8SA 3ALGA 3FAWA 1G9HA 3EDDA 1NEYA 1ADSA 2R24A 1KCKA 1CT5A 1K70A 2OXNA 4LUIA 3ZJKA 2I1OA 5BXPA 2Z7GA 4DZHA 5B7ZA 3SFWA 1XLKA 4M7TA 3C86A 1I6NA 4QR6A 4JFUA 4EWND 4H4IA 1XF0A 2F2KA 2QPXA 3H7UA 3TYDA 4GPNA 2NXGA 3CAWA 1M7PA 4ENLA 4O1BA 1UC4A 2V38A 5K3VA 2XZ7A 3URQA 3NM1A 4NL1A 3C2OA 1QAPA 3LCIA 2ZE3A 5DXXA 3WLLA 3CUJA 3U5UA 3P8IA 1AODA 4E4UA 3VE7A 4CNSA 2CETA 3CT7A 3Q67A 2Z29A 4XKYB 3WX7A 1RQBA 1W31A 4P7QA 4GX8A 3F4CA 1P7TB 1PAMA 1HP5A 4DPPA 1K3UA 3THDA 1KGUA 3PJXA 5AVNA 3GKFA 4A3RA 4TUFA 3TTQA 3L21A 4KIEA 3N12A 3QLDA 3L5MA 2C6QA 3WEMA 4UFJA 3N6HA 4GCXA 5HJYA 3S2MA 4DF0A 3LMZA 3TJ4A 3A23A 4HOXA 3FYPA 1NOUA 5XIMA 4H9UA 2F6UA 1UPMB 4QM1A 3UCCA 3S2CA 4NSBA 1DXEA 2ICSA 3Q65A 4TVDA 3S1VA 2NQLA 4M29A 4U5KA 1X96A 1JUKA 4BKNA 1JQVA 1SSGA 4PCNA 2XWDA 2W4XA 2J7FA 4NAFA 5HR6A 1QNRA 1KRAC 1N82A 3QV6A 4M51A 3RLGA 1SJBA 2PDFA 4PSRA 1WAWA 3TXZA 3DECA 2R82A 1QW8A 2R14A 1L6WA 1PWLA 3PZVA 4ZXLA 5HBFA 5HNTA 5BZAA 2PLJA 3W29A 4FZIA 3FLUA 4O0QA 4L9ZA 3N13A 4MWAE 3OLEA 3M5VA 1R46A 3QPZA 4NXSA 2H8ZA 3UW6A 4HTYA 2WQDA 5C55A 3RO6A 4QEEA 2J9XA 2BX7A 1XHGA 1IEIA 3ARPA 3T2PA 3MWAA 2QKFA 3QFEA 3GXDA 4AYGA 3VIIA 4W93A 1TREA 2IQTA 3W87A 3G0SA 1M9HA 2V69A 4DJDD 1SJDA 2VMFA 5LNWA 3F5JA 4JCLA 5AC5A 1YQ2A 1MXDA 3DFYA 4LYPA 3GE7A 1FWNA 3HQ1A 3H2NA 4EF9A 1UCWA 2E77A 3CUFA 4IPNB 3LUTA 3HMCA 1QI3A 1AQMA 4A29A 4E3VA 3RN6A 1L2QA 1U1UA 4QP0A 7A3HA 1YTEA 4TQTA 6ENLA 1XDJA 5G2IA 1SJAA 3PWAA 3PZGA 4Z42C 4QDMA 4EXAA 5DEZA 4E3TA 3AXMA 5I3JA 3TA6A 4Z2KA 2B7NA 5C9ZA 4WKHA 4AQLA 4LEQA 4GY1A 1NDWA 3ANVA 3R0UA 1FFQA 1PZ1A 2J6XA 2XG9A 1GKQA 1ODUA 4AWTA 2VGGA 1X1OA 3A4AA 1Q7ZA 2JALA 3RR1A 1XCWA 5E6ZA 2PGRA 1GYLA 3PP7A 3P62A 1KGXA 2VZTA 4BF7A 2YFNA 4ZB0A 3CIXA 4IXHA 5PTDA 1WA3A 3URAA 5CXPA 3MBFA 1XFCA 3AXHA 4AD2A 3LM3A 3VX1A 1J96A 3U3HA 4IG2B 1TE1A 1WUEA 1KFBA 4M81A 3FA5A 3RJYA 1FHUA 1F3XA 3O3RA 3UZZA 4NT0A 4U3CA 1F9CA 1AQFA 3FNDA 1EPVA 3WMCA 4LVGA 3NR0A 1K6WA 1SO5A 4LF1A 4MWAC 2PDHA 5LA1A 2WWCA 2YKKA 3SSZA 1NH6A 5A6LA 3RAOA 5FEXA 3LNPA 2QCDB 3TEVA 4AZBA 1VYRA 4HCLA 4E8CA 1SFTA 4DJEA 3AMCA 2A3HA 3L4WA 1XLAA 4NHVA 1H3GA 2GSJA 4XB3A 3WMBA 1EB3A 1NSJA 4WR3A 3WFAA 3CEUA 3W7GA 3W37A 3T0AA 3OIXA 3DHUA 5A6AA 3ZJ6A 1K02A 1WQ5A 3WBXA 3TTOA 5BXTA 4OBSA 4ZQOA 3POHA 1FCQA 4E2OA 2WWDA 2DIJA 2E9LA 1IIHA 3T40A 3TFXA 1SZRA 1JYWA 1X97A 4Q22A 1RCQA 3EPNA 5LYRA 1BVZA 3SUSA 2PLKA 3O7UA 4I9MA 3V0UA 1I8JA 2FFCA 2PMQA 5BCAA 3ZQ9A 2HCVA 2PDKA 1VHCA 4IF2A 1V03A 3GB6A 4FXJA 4JN8A 3BAYA 1OC5A 1YIXA 1GPFA 1WDWA 3L4YA 3EOLA 4FLSA 3L2IA 2FTPA 4P8XA 4EPEC 1VJZA 4NZFA 1PHWA 4XBJA 4KMQA 1Z42A 2I14A 5T8GA 1K9FA 4BWLA 4Q4QA 1ZNNA 3UG5A 4DYJA 3VKCA 3PC0A 4PBFA 1NWUA 1XM3A 5K9CA 2OKTA 1DIOA 1XR2A 2FFIA 3NM3A 3IIOA 1MW3A 4O12A 3QBUA 4RW5A 1SU5A 2DZBA 4RE0A 2IUZA 2WANA 2PODA 2DVUA 2C7FA 3TQPA 4PMYA 4GUJA 1EF3A 1VBHA 5AZ0A 3G8RA 5LHEA 3WJWA 3IGUA 2XISA 4KFOA 1VGAA 3ABXA 3GTNA 4MM1A 2BNJA 3UEQA 3TTYA 2C13A 3UESA 1P0DA 4PRWA 4Q8MA 4W4QA 1W1YA 4RPPA 3C2EA 1ME8A 4QX4A 1RSCA 4XZLX 5IM51 1KTNA 2VUNA 2YR1A 3BMWA 3PUDA 2W6RA 2ZYFA 3SN1A 4HCDA 4ROQA 4HK5A 4OZOA 1TJ2A 2GL5A 3VKJA 1NFBA 4ES4A 1DXFA 1W9UA 4GUIA 1U30A 3TYAA 4W8AA 4K1WA 1P1MA 3GUGA 1E6PA 1TJRA 3POCA 3PB0A 3MHUA 2P8BA 3CPUA 3G0UA 5I7GA 2ZVRA 3RILA 5G1TA 2PDQA 1ZP4A 5D37A 1O5KA 4Y9PA 4XKYA 4L6DA 1RK6A 4L80A 4LRTA 4PTMA 1SO3A 3TMQA 3V0TA 2FYMA 3W53A 1WOBA 1IQ8A 2ANUA 1HVXA 4JD4A 2X7VA 2I5QA 4UQAA 3SCSA 2ACQA 2PRHA 4LUSB 2RAGA 3KVJA 3LS9A 5GVJA 1UD8A 2G4JA 3W00A 3VNJA 1F7BA 5HXMA 1WZLA 4HZMA 4GQ0A 5JU6A 1V7YA 2FZ9A 4Q4PA 3H6OA 2F6XA 3EB4A 2VX7A 3CO8A 3LI1A 1PE1A 4GXMA 2WJZA 2W27A 1KCZA 4IQDA 1YW1A 4UNLA 4UFIA 3MQTA 2QCGA 5LZLA 2R8WA 1Q13A 3MVTA 3CLMA 3W84A 1VYPX 3PTQA 1C8YA 1BF2A 1OX4B 2WJEA 3KTCA 4H19A 3QXBA 5CPOA 2WB5A 3G1VA 1K77A 2WM1A 2VM8A 3GXFA 4Z1DA 1I1WA 2E1DA 3GZAA 3N4FA 3DDMA 4IQLA 2F38A 2J88A 2HVMA 5L6UA 5LXXA 1O6IA 1OC6A 5KZEA 4CVWA 2NZLA 2FJUB 2ZZ3A 3S6DA 1MMFA 3OG3A 3ZXWA 3C8NA 2QZRA 5LNUA 1G67A 1IHIA 4E2BA 1RCOB 1E0TA 2VENA 3MSRA 4AH7A 3FHQA 5CZSA 3VGFA 1CLXA 3H7VA 3S5YA 2OLSA 2WSRA 1WCGA 2A79A 4NJIA 4LH8A 1GVFA 3UR5A 3EOEA 2G50A 4R3UA 1Q6FA 3C3NA 5F2MA 3TW7A 4UUIA 4W87A 1XCFA 1MUWA 2OYKA 2QIWA 3P61A 2VFGA 4Y9NA 3VD9A 4QJ5B 1VFOA 3PN8A 3VGEA 3RDKA 3GS6A 1IV8A 1KM2A 4HHHA 4Q8PA 3WLJA 1RK5A 4MZYA 1JCMP 2EJAA 1A47A 2DZPA 1XLMA 2YCJA 3EWDA 3UGVA 4M8UA 3UP8A 5DRCA 3TSMA 1GVSA 1M5WA 4K8HA 4DXKA 5A6BA 1EYWA 2FHBA 4IH3A 4AMCA 1XISA 2ZIDA 1B9ZA 1R5YA 3DI0A 3N4EA 1BWKA 4QSFA 1N55A 1JZ2A 3Q94A 2WNQA 2X42A 2G96A 3K4AA 2OWWA 3C2FA 1ZCCA 3SCTA 3E5BA 5TD4A 1XSIA 3SN0A 4AY1A 3G1HA 2V5JA 2E6AA 1E56A 3DFHA 3NQ7A 3NYZA 1TCMA 3OIHA 3THCA 3GX9A 3RPDA 3BAIA 4ASTA 4S3CA 4F40A 2WHLA 3T0TA 1SSDA 3H55A 1L6SA 2VFFA 3QPYA 3UERA 5MKGB 1XV8A 4F0HA 4D9PA 3G0XA 2Q09A 1W5MA 1ZU8A 3DHDA 1UZ1A 2QAPA 3PG8A 3IJQA 1RVGA 5JBFA 1EPXA 1PB0A 4PMDA 1JCLA 5C6MA 1EGZA 7CGTA 2C71A 3MDWA 3USZA 3U0HA 1AK5A 1KBLA 4US5D 4Z0SA 4JIQA 5EMLA 4M24A 5HPOA 3W28A 5ABGA 3S8HA 2TAAA 1DWFM 4WSJA 1HVQA 2W92A 1FX6A 4ERAA 2VOMA 4UBPC 4J3UA 1TZ7A 1KR0A 5J5DA 4H01A 4OBRA 5LXEA 3L0GA 4UTHA 3A64A 3TJIA 3RR4A 1W9DM 2OPJA 4DVOA 5C71A 3W1NA 1JZ6A 1JPHA 3AQUA 2PBOA 4M1RA 4M6VA 2WXDM 3M5ZA 4FF7A 4IUOA 3OOQA 3QY6A 3AMLA 1PBGA 1M7XA 4MWAB 1WKFA 5D2YA 4JNZA 1W1VA 3N2OA 3TC7A 3PTKA 1BSIA 3G1RA 1TMLA 3Q58A 2WZEA 1QU4A 4LF2A 1P4CA 1UR1A 3AYTA 1OY0A 2Q8LA 3PZIA 3QGVA 1EQCA 1XBXA 4MPQA 4FO4A 4B5TA 4D6GA 3M16A 1RPXA 1EJWC 2XN2A 3TWBA 1JXKA 2RH9A 1EXPA 2VI0A 4GUFA 4HYVA 1JCXA 2BFGA 4DJFC 3IGSA 3Q4DA 2CWXA 4DX3A 1GKPA 4KBXA 4U2ZA 4GIYA 1AW5A 5DELA 2GJPA 5CLWA 2H90A 2ZICA 1AA1B 1B3ZA 3HBLA 2ZWYA 1W3TA 4KRZA 4ATWA 2NW0A 2AGTA 2QUUA 1LG1A 1RJQA 4WXZA 1DIEA 3RG6A 1F6PA 2PDJA 3P5YA 3SQSA 2ZZ6A 2PZNA 2VUYA 4UTKA 4PB4A 5HNNA 3N6JA 5FJRA 3DG3A 1QK2A 3MMDA 4ZTXA 4F48A 1TX0A 4LEFA 5GNZA 4AXNA 3ABQA 1VPXA 5GJMA 3ZR4A 4PCPA 4PL1A 2O9RA 2OOFA 1R3RA 1E6XM 1DOSA 4IFRA 1CGYA 3KDOA 5JIWA 4DM2A 3GU9A 1D3GA 4LNCA 1XRSA 1ADOA 4RX0A 1LWIA 5LNVA 1NOFA 2Y62A 1IGWA 3W6YA 3C0QA 1B30A 3WQ5A 1NARA 1GJWA 3OYXA 1JPIA 1BSLA 1PL9A 7REQA 1B90A 3AHZA 5A3HA 2VELA 3NZRA 3KCJA 4IFOA 4F2UA 1BVWA 2HS6A 3MS8A 1H7NA 3O1NA 4ZOCA 2HK1A 1FHLA 3GIQA 1ZB5A 4L9YA 4AD5A 1Q6QA 3NVDA 1RD6A 3F2DA 2IKGA 3BG9A 4FOKA 3WQGA 3M43A 3C5QA 5F4WA 1ALDA 4TX6A 1VC4A 4AUBA 1EC8A 3THAA 4Q8QA 4J3VA 4DLMA 1D8WA 1VIWA 3U4AA 1ELSA 1GVOA 2B31A 1HJXA 3PUEA 2WSKA 3UPMA 3TJXA 2QUMA 3GHSA 1V3IA 5CC3A 2QUTA 3W7HA 4O28A 4FLRA 2DSVA 4F8XA 3S5NA 4I7UA 4KCTA 3MA8A 2FPVA 4O10A 2PDWA 4D6FA 5DLCA 3N18A 5I06A 2WO5A 4IJBA 4ZO8A 3UJFA 1PS9A 1FWGC 4DBDA 4HYRA 4M6PA 1F05A 1L2UA 2DW6A 3WLQA 2CZEA 1IYXA 5D4YA 3WNPA 3W72A 3ABZA 4W7WA 1FDJA 2VC7A 2WVVB 4GJJA 2WJFA 1U5JA 2I5GA 5LIXX 5F1UA 5DBTA 2TRSA 3H4XA 3IVSA 5CJNA 5FF3A 1Q6RA 5EPDA 2VT0A 2W63A 3HB9A 3SECA 1CXLA 4YN5A 1DXIA 4UB9A 1QDSA 4YWSA 1POJA 2VKZG 4JTAA 3UYCA 3QMTA 4LV4A 3VDBA 1Z32X 1GG1A 2GVEA 2ZX6A 3N9RA 1FQ0A 3TAOA 3LPFA 1LLZA 1OX6A 2FPTA 3DKLA 4PSPA 4RNHA 1RV8A 1US3A 3UR7A 4B15A 1NFGA 1QOQA 2J8TA 4RV3A 4Q4OA 5BMXA 2BZNA 4B90A 3NQMA 4DWSC 1KCXA 1KFEA 2IQDA 2GDUA 1FDZA 4UNIA 1V6YA 1CDGA 2VGFA 2CNCA 4IQEA 1UBPC 1UZHA 3GFXA 2O0TA 1OX4A 4D6DA 1TVPA 4ORMA 3K5XA 5HNUA 1QBBA 2QUVA 4AZHA 1IWBA 4DI8A 2JKPA 2YA2A 3VUSA 1EJSC 1TX2A 2FH6A 1N8IA 4JQAA 2CBVA 2E5BA 3FVMA 3LHZA 1K9TA 1WV2A 1HW6A 1DEDA 4MYAA 4R9XA 1ECEA 1VD6A 1S2WA 3GDTA 4PUWA 4C60A 4BI6A 5AKQA 3M41A 3W7PA 1SZNA 2FMOA 3TP4A 4PMUA 3T07A 2V3EA 3R13A 3XIMA 3N2CA 2FKPA 1FWFC 1SVDA 3PJUA 1WXZA 2G3MA 1SPQA 3V75A 1PWMA 4AU0A 4JKKA 2BV9A 4YS1A 4GD0A 1VFSA 4MJMA 1XIMA 1BEUA 1Q65A 2PLMA 3AIQA 2WZMA 1E1EA 1DP0A 2OQLA 4C7GA 3JUGA 4MUPA 2BGQA 2W5FA 3TYEA 1A49A 3TCSA 3FW6A 3IJDA 4FNUA 1JQXA 4KWVA 4HN8A 1TPH1 4A6GA 5FD0A 1E9ZB 2QJHA 2F61A 2VR2A 2AL2B 2X1SA 3VCCA 3IJIA 1ZLPA 3U4FA 4AWEA 4RNFA 3PY2A 4GUHA 1AH0A 4D71A 1VEOA 3H12A 3EX1A 3TX9A 5A2AA 1XIFA 1NY1A 3NOEA 1DE5A 1LOSA 1A4LA 4J28A 1XQLA 3UG4A 3S47A 3ID7A 3M07A 3TIMA 4I9AA 5EL1A 4MG4A 1GQJA 3MSYA 4P7OA 3B3DA 1JAEA 1KFKA 5ECUA 3N2XA 4I9JA 1OFBA 3BW3A 4L6HA 5KZDA 4O15A 2X1UA 3DG6A 4L5ZA 5CPNA 3AZSA 4JIPA 2TMDA 2XIQA 3W24A 3OVQA 3LHUA 1BLIA 1RCXB 3M5YA 3RM4A 1TA3B 4G56A 2CLLA 2OR2A 3ABSA 1UZ4A 1LP6A 4HNTA 1EHNA 1TPWA 2ZDRA 5TBOA 4JNYA 1YNPA 1W1B1 4NJKA 3BURA 5AHEA 3V1PA 3LZ5A 3PJWA 3W9ZA 1QPQA 3GTIA 4DYEA 3MI2A 1THFD 2CERA 3KCOA 4ZMGA 3LRKA 3UWVA 3GNXA 4HOZA 4UTUA 1QI0A 4PUDA 4L1WA 3BDKA 5FCZA 1PIIA 2BY2A 2CIPA 3IK4A 4AHQA 4H00A 1KM6A 1R7AA 2G37A 4ZFMA 3IEBA 5D2XA 3DBPA 1GW9A 3GHUA 5REQA 2R1NA 5AN7A 1ODZA 4TVUA 2IKIA 4D6CA 2XHYA 4JN7A 3SGUA 2V6AA 5FJTA 4HA3A 5FEZA 1RVKA 5G1MA 4NYYA 3A21A 3N2MA 3KBJA 2DIEA 4L6OA 1EX5A 3MP4A 3PPCA 4HVXA 2V2CA 1BHGA 1UPPA 3KBNA 4NX0A 7ODCA 2DJXA 3QW3A 1ZENA 1TJ1A 2UY2A 4JTIA 4UCGA 3GAYA 3MKKA 3EA1A 1AQ0A 4AF0B 3GKAA 1J10A 1R38A 5C2GA 1JI1A 4IMCA 2VFDA 3ZJ7A 4H1ZA 3R4IA 2VDHA 1RY0A 4CN4A 3WQWA 2XFRA 2NX9A 3ZT7A 4MY9A 3A5FA 2G3FA 1TV3A 2BS9A 1H7WA 2EPLX 1R87A 3D46A 2PWDA 1VEMA 4GXPA 2Y24A 5H1WA 1V02A 1KFWA 2A7NA 4U2YA 4MKNA 1TR9A 4QS5A 1UZDA 3AXKA 4PMQA 4AMAA 1T5AA 4ADUA 4O18A 3ANYA 5BRBA 5HMFA 3R12A 2O4QA 3BOLA 1T99A 3GIPA 2Z2BA 2XFYA 2FJKA 2C8NA 3SFKA 3W1AA 2E6YA 3I7SA 1UYQA 3T4CA 1BG9A 2OG9A 2RKXA 2J7BA 5HPCA 3PFRA 5D2VA 3ARTA 2ZRWA 4FNTA 4HHLA 1GEQA 1GOMA 5I23A 4POCA 4H2HA 1H4PA 4F79A 3CT2A 3BV7A 5H8MA 4NQ1A 4M82A 1B3OA 4O0KA 1CXKA 2ZDSA 3ME3A 1ZAJA 2NV1A 3W85A 2FPYA 3I4EA 4BQ2A 4BQ5A 4UTTA 1LQAA 1O95A 2NUXA 2INEA 2VEKA 4OTKA 1H7PA 1X1ZA 1XPYA 2AOSA 4R27A 3DC8A 4RNJA 2Z1XA 1O66A 3K46A 1J0YA 2BVWA 2EPKX 3LTSA 3VIMA 3AZTA 1GG0A 4R7OA 5C7HA 2PA6A 5H91A 1EKOA 5CC6A 4KWOA 1V93A 1ITCA 4LGXA 3ZVHA 1Y5VA 4MJZA 4N4PA 3OZPA 1HL9A 3SJ3A 1I2QA 2ZRYA 3TWAA 4DWSD 2AKMA 1X1NA 1UH3A 4C6PA 3O8AA 3WQ6A 1IEVA 4MJ4A 5D8ZA 3PM6A 3W1LA 2X1RA 2R94A 2WMIB 3WBYA 1E3XA 2MNRA 1W9XA 1NWSA 3VCRA 3W7KA 1PXGA 3NQBA 1OCBA 2QW5A 4F2TA 4O1AA 1UD2A 4CNOA 2EHHA 4IPPA 1KA9F 1S3TC 2QCHA 5EMKA 3M0YA 3O6YX 4UFMA 3NTYA 4BY3A 1IR1A 1TPDA 2ZA3A 4PMXA 2O9TA 1B2YA 1KTBA 3M47A 1XWYA 3LK6A 4HMEA 1R3WA 4K7YA 1ENUA 3F03K 1EF2A 1PIGA 3WD1A 1ICPA 3FN9A 4DO7A 5BU6A 2Y88A 3EOOA 2A7PA 2HISA 3VMOA 4PTNA 5DRIA 5CGMA 2YSWA 5B80A 1DJNA 3IJ6A 4GNJA 4IT1A 3GW3A 2OOGA 2QR6A 3NPWA 4F2BA 2V81A 3WY1A 3H2FA 9RUBA 1RAKA 4UTLA 4ZE4A 3OO2A 3GXPA 1HTIA 3SR7A 5A6KA 5I79A 1W32A 2JK2A 3W2MA 2BXVA 1JDAA 1UROA 1N7KA 4QJ1A 2PC8A 8RUCA 1W3KA 3T55A 4PUUA 3WBEA 1HFBA 1PYMA 1OHLA 3PWGA 1GORA 4MSSA 5FACA 4CQAA 2WSQA 5FEPA 3GHTA 1QK0A 3GVVA 3W7CA 4MHBA 3QV9A 2VTFA 4QRNA 4NNAA 2WMHA 4OFCA 1M53A 1QRQA 1Q6DA 5CLTA 3W86A 3DOPA 4HMNA 4QQ3A 3CHDA 4A8IA 2D69A 1EDQA 2W9MA 2IPFA 1Z48A 2XIOA 3KBWA 4NRSA 3ZVHB 2W62A 2OODA 1WNOA 1AMKA 4XD6A 1CCWB 4NZJA 1L0PA 1EDTA 3RX4A 1VH7A 2ACSA 4FSAA 2JGYA 3W2NA 4AISA 4QE1A 3OHIA 4JQ4A 1AL7A 3BW2A 4UCFA 4F0SA 3CQHA 1UWIA 1OFPA 1R3QA 5D30A 1W6TA 4KEZA 1DVJA 1V6UA 4GI9A 1EWEA 4Q32A 4WSKA 1PIFA 3TC3A 2PD5A 1BYDA 3JW7A 1AH3A 1XDMA 1S5NA 4C6BA 3WH5A 3WDRA 4OV4A 4DLFA 1OFRA 4IQJA 4GQBA 1OK6A 1A4MA 1A5KC 3DFNA 3DN5A 1HX0A 5E1QA 4PZVA 5BNKA 4PMOA 4MJ2A 2YFOA 4ZE5A 2ESCA 3W7DA 1EFZA 4UTFA 3LBCA 3WBWA 5E0CA 3ITYA 4PMNA 1M41A 1ZSXA 3ITLA 4GABA 4ALDA 3B0VC 4XVEA 8XIAA 5EA9A 1TCDA 2V5KA 2OX1A 1KLYA 4MVAA 3W22A 3ELFA 1JRBA 3EDJA 3QN3A 2W61A 1UA7A 3UQNA 4M6UA 2ZCGA 3MMTA 1B3YA 2UY4A 4H9VA 4MB1A 4OWGA 4Q8VA 2VEPA 4M1BA 3ITTA 2OX4A 4K68A 5BOEA 1R8LA 1O1HA 3V4BA 5HOSA 1OT1A 3P14A 3RJXA 4WDTA 4HBKA 1JYVA 1MRQA 3MBDA 4MWAD 3U2OA 5C9XA 3UCDA 1NU5A 3WLHA 1BKSA 3FOKA 4FHAA 1XPGA 3W02A 4XK2A 1J12A 3VIPA 4YNGA 4LT9A 4GI4A 4LYRA 5EBAA 3A24A 3E0LA 2VOTA 2FGZA 1GOQA 1F2JA 4PE8A 1W5PA 1IT7A 3WFZA 4EPDC 4NJHA 3UU0A 5AC4A 4KGJA 1SFSA 1VBRA 1J93A 3ES7A 1L8NA 4XBKA 4AZ5A 7PTDA 2F9RA 1D7FA 3T44A 4L4MA 1P6BA 3WUFA 1KM5A 4DZ5A 1OM0A 4C1KA 4RDYA 4YTQA 4V33A 3IAPA 4HKPA 2GUUA 2C15A 4AZCA 1EGVA 5JXQA 2P53A 1DJYA 2JGQA 1D8CA 3VD7A 3EA3A 1FY6A 2XVPA 3UVIA 3ZR5A 5M3WA 5A95A 1ME7A 5EMYA 2OZ8A 2VC9A 3ITXA 5CJ5A 4B16A 3V3WA 3VNYA 4Z1AA 4DAIA 3P80A 4KGLA 4FALA 1UWRA 5D9NA 1JZ8A 2J62A 2ZFAA 3WNKA 1RP8A 1UWSA 3CIVA 2Y89A 1SZGA 3ARYA 3TA9A 3MO7A 3N73A 4B5XA 1N8WA 1UR8A 1W3JA 2H9AB 4BR1A 2CBJA 4Q8WA 4Q8NA 2X0SA 3SY5A 4FOUA 1XYZA 2G4FA 1J18A 3BW4A 4GJ1A 3D6NA 1N8FA 1TVLA 1NVMA 5HUOA 1VZWA 2CEQA 1M04A 2PD9A 2RDTA 2WHJA 2CZ5A 3S0CA 4H9MA 1E1FA 1JEZA 2PDNA 5I3KA 4K7VA 4AEFA 3GG1A 3RCNA 3FX4A 1H62A 3QJAA 5AHLA 4HYWA 3MUZ1 2YDAA 3GNOA 4KERA 4ZSUA 1MNZA 4YVVA 5J04A 4MFDA 3GU2A 4QNWA 3AHXA 4ZQRA 2P76A 4HN4A 1JRCA 2XIMA 3R8RA 3ZT6A 1JZ4A 1CGTA 4CEUC 1UKTA 3W4RA 4HPHA 3IRSA 2DZAA 1GOIA 1K7EA 5GQBA 1WX0A 3ZWTA 2JEQA 3I4KA 5LHFA 3VM7A 3M9YA 2ZZ1A 2VX4A 4M0XA 1TUXA 1ZTVA 2WAGA 2YW4A 2AAAA 3IUIA 4G8TA 2O92A 4QLKA 1AW2A 4KFNA 4B5UA 2WCAA 1R86A 5CZJA 1DTUA 4N7QA 1JCNA 3TC6A 1MUMA 3NQGA 3JS3A 5F4XA 5C7VA 3KAOA 4LAOA 4IWWA 4JPGA 4NZ3A 4AZIA 1DHKA 4N6FA 2WVTA 1IWPA 2YXGA 1LL6A 1XW8A 3OA5A 3FDGA 4OBTA 3AICA 5HAOA 3B04A 5I3HA 3IUDA 1NTHA 2POTA 1RZMA 4R7WA 4J4KA 1VJSA 4IGNA 2CLMA 4ZODA 1JJKA 1MW2A 4QE4A 1JG9A 5AHFA 2YOCA 1GYMA 3SADA 4J2MA 3V5OA 5LKYA 3H26A 2VR5A 2DUZA 2C1IA 3FSUA 1XP3A 1RPKA 3W25A 5IFTA 3O0FA 4JTDA 2YCKX 3LGDA 3CV1A 4Q4SA 4WOQA 2AQOA 3M5XA 2VWTA 2VCAA 3STEA 1J01A 1MYRA 4U31A 2CZDA 3QGAC 4IMGA 4OOUA 2VVNA 1KM3A 2OGJA 2WMIA 5I0DA 1T6MA 4GUGA 2BXZA 2REQA 4ORIA 3THUA 3XINA 3CXOA 5M1TA 2PDPA 3PULA 2ZC8A 4EWJA 2A2IA 3ITGA 3L67A 4J2PA 3BV4A 4BEUA 1BXBA 3HPAA 1NP0A 3VCNA 3TSBA 4AAJA 3HJEA 4X2PA 1IXNA 4UOJA 4UC5A 3GG8A 2YDSA 4MKSA 1VF8A 1TTPA 1YRRA 3B9OA 4JEJA 3B9DA 1OX5A 3SUUA 2PTZA 1U2YA 4IIDA 1NWRA 3KBVA 2DVXA 4GZEA 5DFAA 3H21A 4R5EA 4ZO9A 4CKQA 5E93A 4HZ8A 4CNPA 1PKLA 2VDIA 4HGXA 3BLOA 1SO6A 4DJDA 1NIUA 3FAXA 3K13A 3MC5A 1DL3A 3U2EA 4EXBA 1E73M 4BQ4A 2GGHA 1PHQA 2CU0A 1ZQ5A 2D2OA 3ATYA 1R0MA 3ARWA 3RX3A 1KR1A 4TTUA 4ACZB 2HBVA 4ZENA 4BF9A 2VURA 3D47A 1U22A 4I7WA 1E6NA 4Y6GA 3KP1A 1UUMA 5D33A 4HOWA 3AWNA 2FTWA 3GWQA 5A8QA 3ARQA 3W74A 1ICSA 3S9IA 3T1GA 4I5UA 3FKRA 1AJ2A 3TYCA 3W26A 4B3LA 1F3WA 3BMVA 4O4WA 3CHEA 4Y9MA 2XFFA 1BWVA 4RZ6A 3UGRA 4GBDA 4JEQA 1A5LC 3QHOA 4X60A 3VIOA 3KLKA 5AECA 1IT0A 3VNLA 1SYTA 2GQ8A 1CXEA 1JNDA 1OEPA 1ZJIA 2Y8UA 5AVHA 3C2RA 4MDOA 4XAGA 3UWUA 2E8YA 3KOZA 3NL3A 2BXYA 4GQQA 1Q2SA 3T0BA 4HU4A 2E7FA 1BD0A 3URNA 3AI0A 2CESA 3TLQA 3KCLA 3O9NA 3WNLA 2AL1A 3TLLA 4TOQA 4IG2A 4JN6A 4A35A 2QDGA 2Y5EA 3S83A 2BG5A 4LB4A 3KX6A 3REQA 4E0CA 1G4SA 3H24A 1HNYA 4GI6A 3S5ZA 2DQWA 4GHRA 4B5VA 4PCTA 1IXPA 1JXJA 2PDGA 2W66A 1ISZA 1DTNA 3GU1A 2Y7GA 4RPQA 3NZ1A 4OE7A 3SBFA 3RO8A 2YCEA 5AYYA 3PPGA 3W0KA 3GZ3A 1D7KA 4H7CA 1XG4A 1ITQA 4X3ZA 1CENA 1YBQA 5HMSA 4D8ZA 4BJHA 1LUCB 3WF4A 3DFPA 3T8QA 4G7EB 1C9WA 4CQDA 3BLKA 2F7FA 4L7ZA 4OGZA 2GJNA 1IF2A 4PUKA 1BG4A 2PP1A 2EPNA 4NNBA 1DHPA 1VLIA 1VBGA 3UPBA 5IBXA 3GRIA 4GQRA 3TK7A 3W1UA 1GZGA 1EEXA 2HNEA 4D8LA 4Z2LA 2J7DA 6XIAA 2AMXA 1BQGA 4S3DA 1ZS2A 4ZB5A 4TVCA 4PUMA 4O1CA 4UXDA 4NZ5A 3T09A 3CUXA 2HZGA 1VFTA 3F7JA 4WRHA 1OK4A 3FS2A 3MUAA 3QSTA 4U10A 3ZVIA 4GYPC 1KCLA 3C0JA 4XZWA 5D02A 3PK7A 4Y7EA 3UWYA 4O50A 1V3LA 3H2OA 1CGWA 3QMRA 1F4HA 1LTDA 4JIEA 4EXQA 1AH4A 3PBUA 3JRKA 1UG6A 1O5QA 1R9YA 4AFYA 3E0WA 4DHGA 2DORA 1G01A 2EG6A 4AHPA 1P1XA 1OD8A 4V28A 3S3GA 2Z24A 5SWUA 2PDCA 4WGHA 4QROA 1CW2A 5D8WA 1FTXA 2X16A 1L8PA 4Q33A 2XIJA 4D6IA 3CK5A 4FP1A 2PWUA 5ABEA 3RNDA 1FCBA 2ASHA