3QY8A

Crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
243
structure length
243
Chain Sequence
MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVMDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase CpsB
publication title Crystal structures of YwqE from Bacillus subtilis and CpsB from Streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 90
structure length 243
sequence length 243
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3qy8A00
4GX8A 3ORWA 2I9UA 3G77A 5CH9A 4AC7C 4DLFA 4DZHA 4C6BA 1FWBC 2QT3A 3PBMA 2O4MA 4DYKA 1J6OA 4LAMA 4IG2B 1FWEC 2DVUA 3OQEA 4IFKA 1ZZMA 4C6CA 2Z7GA 4C6QA 3ID7A 1FWJC 3DUGA 3E0LA 3FEQA 2Q09A 4L9XA 2UBPC 1K70A 2Q01A 1RJQA 1EJVC 4C6PA 2WM1A 1RA0A 1V79A 4WGXA 4LAKA 4QROA 2ANUA 2AQOA 3GU1A 3TN6A 2AQVA 2HPIA 4PCNA 3LSBA 4IQJA 4KETA 3UR2A 4CQBA 2FVKA 1ONXA 4KERA 1QXLA 1WXYA 2GWGA 4P5UA 3QY6A 2FTWA 3T81A 2E25A 4XAYA 4XD4A 1RAKA 3QGAC 4DZIA 2HPMA 4CNTA 4RE0A 3ISIX 4D8LA 4XAGA 4XD6A 4H9YA 4KIRA 3K2GA 4LAOA 2R1NA 3F4DA 1WXZA 2Z26A 3MDWA 3E3HA 1XRFA 4XD3A 4IGNA 2Z00A 4WHBA 3CAKA 1IE7C 2W9MA 3WMLA 3MSRA 2OODA 4DI8A 1P6CA 1V7AA 2GOKA 3N2CA 4C6OA 4H00A 1FWDC 4C6JA 3CJPA 4UBPC 4CEXC 4RZBA 4HK6A 4NG3A 3QY7A 3F2CA 4ZSUA 3PNZA 3DCPA 4H9ZA 1JGMA 4B90A 3IGHX 4RDYA 4DI9A 2Y1HA 3HM7A 4G7EA 5FSDC 2HBVA 1A4MA 4CNSA 4KEUA 2OOFA 1P6BA 1EYWA 2YZ5A 4BY3A 1UIPA 3LGGA 1ONWA 2Z2BA 4R7WA 1YRRA 2VC5A 2WJFA 4F0SA 5FSEC 1XRTA 4XAZA 2R1LA 4G7EB 1GKPA 2I5GA 1A5NC 1YMYA 1V51A 1DPMA 2ICSA 1J6PA 3UR5A 4QSFA 3UBPC 3K5XA 2DVXA 4LFYA 4CNUA 1XGEA 4H01A 4ERIA 2VM8A 4PBEA 3LNPA 3R0DA 3ITCA 4RDZA 1V4YA 3HTWA 4KF1A 2Z2AA 4CEUC 4PBFA 3IARA 3S2NA 4QS6A 4GX9A 2GZXA 1O5RA 1EZ2A 1FKXA 1NFGA 2YB4A 4BJHA 3GU9A 4C6DA 1M65A 3HPAA 4B3ZA 1EJRC 4GZ7A 3EWDA 2EG8A 2FTYA 4H9XA 2PAJA 1A5KC 2O4QA 2IMRA 4GXWA 1NDZA 3URBA 3IV8A 1S3TC 4GOAA 4KEVA 3O7UA 4LEFA 5AKQA 1QW7A 3S2LA 4F0LA 4ZSTA 4CQDA 1EJTC 5LXXA 2GWNA 3KM8A 3QGKC 4EP8C 2RAGA 3B0YA 1RK6A 2PGRA 2EG7A 1KRCC 3O0FA 4DNMA 3S2JA 4RDVA 3JZEA 4IFKB 4GYFA 2CZVA 4GK8A 4XAFA 3GTFA 1ITQA 2D2JA 4QS5A 1EJUC 2GSEA 4I6VA 4M51A 3MPGA 2AMXA 4HK7A 3E0FA 3OU8A 3FDKA 3A4JA 4I6KA 3URNA 4MUPA 1VFLA 1NDVA 4QTGA 4H9TA 1R9XA 1XWYA 3LA4A 3OJGA 3WZ0E 4LCRA 3AUOA 1POJA 1GKRA 3CS2A 1KRBC 4TQTA 4EPKA 4IFOA 1A5MC 3PAOA 3RHGA 3EWCA 3RCMA 1FWFC 3T1GA 1FWCC 1K6WA 2BGNE 4RDWA 3V7PA 1V77A 4NP7A 4NI8A 4LCSA 4J5NA 3TNBA 3RN6A 2P53A 3GU2A 3S2MA 2ADAA 4C6IA 1UBPC 4R88A 2Z28A 3T8LA 3GUWA 3S4TA 3B40A 4C6LA 1YBQA 3A3WA 3GTIA 2UZ9A 4H9MA 3B0XA 4EPDC 3MVTA 4YIWA 3LY0A 3E38A 3DC8A 2Z25A 1FWHC 3GIQA 3MDUA 4IGMA 3IACA 4C6KA 3TN5A 4B91A 1W1IE 3MJMA 1PTAA 3F4CA 3ICJA 2DVTA 3K4WA 3URAA 3BE7A 4GY1A 1YBQB 4BKNA 2R1KA 4F0RA 4DO7A 3IPWA 1UIOA 5G4HC 4C5YA 3IRSA 1EF2A 4IFRA 2BB0A 1R9ZA 4GBDA 1P1MA 2EG6A 2D2GA 2G3FA 4HK5A 4ICMA 3LU2A 4EPEC 2FVMA 1M7JA 3AU2A 4H9VA 2P50A 2PUZA 3UF9A 3MVIA 1FWAC 3LGDA 2E1WA 3GTXA 2Z27A 3A3XA 4C6MA 4C65A 3LS9A 5A6TC 3EGJA 2VUNA 3QY8A 1EJSC 1I0BA 1UMLA 4LANA 3UPMA 1FKWA 3GTHA 2QVNA 4B92A 4LCQA 1A5LC 3GRIA 4CQCA 1J5SA 1J79A 4OFCA 2KAUC 3SO7A 4PE8A 4C5ZA 1YIXA 2QPXA 1KRMA 4L6DA 1GKQA 4GY7A 4KEZA 4AQLA 1BF6A 1POKA 4DLMA 3C86A 2HQAA 1RJPA 2XIOA 4HA0A 2D2HA 4IH3A 5HMEA 3PANA 3OOQA 2HNHA 4V1XA 1NDWA 2VC7A 2WJDA 4UB9A 2PGFA 3D6NA 1PO9A 4INFA 1RA5A 1A4LA 3F2DA 4C60A 4G2DA 3PNUA 3OODA 4KESA 1K1DA 2HBXA 2VHLA 4R85A 1EJXC 5E5CA 4DIAA 1PSCA 1EJWC 4JOMA 1NDYA 3RYSA 1RK5A 4KQNA 4H9UA 2Z29A 2A3LA 3NEHA 3FDGA 3MTWA 4IF2A 1E9ZB 4J35A 1O12A 1RJRA 2OB3A 1ITUA 4EPBC 2VR2A 2Z24A 3GG7A 1HZYA 2R1MA 1I0DA 2R1PA 3NURA 3TN3A 4ERAA 2OQLA 4PCPA 1E9YB 4WVXA 4J2MA 1A5OC 4QRNA 1KCXA 4GY0A 4ERGA 1M68A 4LALA 4C6EA 2F6KA 3AU6A 2YXOA 3SFWA 2OGJA 4LH8A 3NQBA 3TN4A 5HMFA 4V1YA 4Z42C 3IJ6A 2ZC1A 2WJEA 3GIPA 2YB1A 1FWIC 4C6NA 4GC3A 1FWGC 3LSCA 3F2BA 5HMDA 3E74A 2QS8A 1KRAC 4C6FA 4E3TA 1ADDA 2Z4GA 3E2VA 4XD5A 2FFIA 4IG2A 3WYZA 3MKVA 1PB0A 2PLMA 3OVGA 3URQA 4HJWA 1YNYA 1R9YA
chains in the Genus database with same CATH superfamily
1HKKA 3ABZA 1AUSL 2Y8UA 2GVJA 4X63A 2YYTA 2O4MA 1H7WA 3AHTA 3TTQA 2FGBA 1R2TA 3RFAA 3GIYA 1VPYA 3E0LA 4ZQNA 2R24A 4AZ5A 4IIEA 2OO0A 4QGCA 3M0VA 2HXTA 2PDXA 3LGEA 2YW3A 3BVJA 3DGRA 3LHTA 2PE4A 2PDJA 4JDYA 2PSNA 5LSMA 4RE0A 3ISIX 3TEVA 1K3UA 1KFBA 3E12A 2JEQA 4D6JA 1QPKA 3MYPA 4LS2A 4IQLA 4BI7A 3ECQA 2CXGA 4IGNA 3RMJA 3O9NA 1QPOA 4IGHA 1XQLA 3M0XA 3SB0A 4BFAA 1VCFA 1CI1A 1J9YA 4C7FA 1MW3A 4RW5A 3DYOA 2NQ5A 3S47A 5G2HA 4C6JA 1E4NA 4CUCA 1P43A 3UA4A 1SMDA 4NG3A 5CSUA 2NV9A 1NWUA 3KCOA 4M24A 4A2RA 4UTWC 3NPXA 2ZA2A 3C0JA 2WSYA 3IGXA 4PB5A 3W7KA 3T78A 3ZQ9A 5TD4A 2A5HA 1AJZA 3IANA 3UPBA 2HISA 1XLKA 2OSYA 5F4WA 2QIIA 3ZR5A 2GVEA 3TWAA 4CVWA 4FS9A 1WDDA 3GAYA 1S5VA 3VO0A 1Z69A 5EBAA 2R1LA 4PMXA 1YMYA 3NTYA 1H7PA 3KP0A 3WQFA 3WO8A 1LQAA 4ORMA 2W5FA 3UG4A 1AH3A 1H5VA 2ZRYA 1PDYA 3W27A 1RQBA 3REQA 5M2FX 1OYCA 2W62A 1LBMA 2XVLA 3VNDA 1LUCB 1BVZA 1UZDA 2GPTA 2E6YA 3C0LA 2QYGA 2VVNA 3KE0A 1P7TB 3S1VA 3SRDA 4BJHA 2WMJA 4WJEA 4U2ZA 4D8ZA 1MO0A 2Y7EA 5IDIA 3W7OA 4GZ7A 3DHPA 2V5LA 3R0KA 2W27A 1S3TC 4ORIA 1ELSA 4K38A 4KEVA 2MANA 3BV4A 1OHLA 3S2LA 3AS1A 5D33A 3R5EA 1PKYA 1XH0A 3ZR4A 1S5MA 4DNMA 3FGCA 3L5MA 3SY8A 4LYKA 2ZE3A 2ZE0A 1BXNA 1XGZA 2WWCA 3N4AA 1KM6A 3KVLA 4N9DA 1F05A 1FDZA 4AEFA 2YCJA 4RNJA 1BYCA 1QK2A 1S2TA 2E77A 4QTGA 1OFQA 5LHFA 3V75A 5EKYA 4JIQA 1GVFA 1E3ZA 5CAKA 1J0JA 3W1PA 4MAZA 3WF2A 3BG5A 1OT1A 1XYMA 4RK8A 4IFOA 1KM2A 3SN0A 3H53A 2PDLA 4I9MA 2FHCA 3NQ6A 5D2WA 1XIGA 3E96A 5BYWA 3FAWA 2PP1A 2XIQA 4KWVA 3FJ4A 1FHLA 3XISA 1IZKA 4F48A 4TX6A 3GXIA 1EXBA 3TNOA 2XISA 4HNVA 2PRHA 4YIWA 4PL1A 1I45A 4LBUA 3AISA 4Q7IA 4JTFA 3UJEA 1JZ3A 3CGTA 3V0SA 4MJZA 2G0WA 3T07A 1FBAA 5FF0A 3AICA 2ZXDA 1W17A 4QLLA 2JGQA 3IPWA 4P7RA 4FLOA 5DMLA 3VDGA 4IFRA 5CG0A 4PEKA 4ZODA 3OVQA 1ZQ5A 4HNNA 3A3HA 3IVUA 1V3KA 3N19B 1KC7A 1VC4A 2W79A 1MEHA 3VIIA 4O11A 3EWUA 1OF8A 2ZRZA 4C91A 4B9ZA 4ADTA 3IWPA 2HNEA 3KHJA 2QVNA 1H49A 1UZ4A 2YDSA 3TYDA 3A47A 3SO7A 1AW2A 1PJ9A 1PXGA 3UXIA 5AHLA 1JCXA 4U31A 3VOCA 3VCNA 1I2QA 3HFTA 1H09A 4DLMA 2FTPA 2TYSA 5AC4A 4OV9A 4RNFA 3PANA 3W2KA 2VT0A 1NDWA 3F03K 1PO9A 1R87A 1RBAA 3EX1A 3NQCA 3QC0A 4WJXA 4DJFA 1RA5A 3U2EA 3VD9A 3NOYA 1IT0A 5HBFA 1Z9AA 4ZGYA 4ZR8A 3GC2A 3ZT6A 5D2XA 1L8PA 1PTDA 1LOSA 2CLPA 2G3IA 3M64A 3ARWA 4GLEA 2RKXA 4QJ3B 1TJ1A 1GPFA 1O95A 1JZ7A 4L56A 3KBVA 1OB0A 4ZB5A 1OCQA 3TN3A 4IOTA 4P7NA 4S3BA 1A5OC 3DC0A 3F4NA 4O16A 2J77A 4DUVA 3PG9A 1X6UA 4NNCA 2AQWA 2WZHA 3R6IA 2OEJA 3QSRA 3TOYA 3SFWA 1P48A 3P60A 3TN4A 1TFVA 5K3VA 1NF0A 2OR2A 3VM7A 2DZWA 5D2VA 1AMKA 1HVQA 3CL6A 4HTBA 2GDVA 3LHZA 3THUA 2V69A 3PC0A 3TX9A 4JY8A 4JHMA 2EGZA 5FJUA 4WDTA 2IW0A 3OA5A 3TYUA 3MY9A 4E3TA 2ZXQA 3A23A 2NV1A 4XD5A 3GR4A 4AWUA 4XTIA 3GO2A 1YNYA 3UGVA 3WL0A 4NZ5A 2QCDB 2ALDA 3GXNA 5I79A 3BCFA 3BC9A 1IWPA 1W2VA 4PMJA 3M0HA 4GE8A 2WVVA 4NX5A 3LHYA 3TE9A 4PRRA 2Z6JA 4IG2B 4POCA 1UR8A 3NR0A 4QLJA 3ATYA 4MVAA 1U1UA 4F9DA 5E1QA 3AC0A 1H0IA 5E09A 3W0KA 1ZPTA 2VGGA 1RA0A 2EBNA 3I6EA 4TR9A 2VC9A 3A4AA 5FF3A 1PE1A 3M5ZA 3G3DA 1ISVA 4PSPA 2HPIA 3SCWA 1B0IA 3UR2A 2D0GA 3BL3A 5GNZA 2FYMA 1XXXA 1HJVA 3OLGA 4V2XA 4GVIA 1QO5A 4NZ4A 3CV1A 2ZUVA 1G94A 3DKJA 3VC5A 1EF3A 4DF2A 1WXZA 1PVNA 5LNUA 3F4VA 2YOCA 1S1PA 1KBIA 4XD3A 1LRQA 4DAIA 1HL2A 4OECA 1SGJA 1P6CA 5GQBA 3T7VA 5C2GA 3P7YA 2BASA 4C1LA 5FJOA 1TA3B 3V4BA 4CD8A 1WB0A 4FLSA 1DEDA 4M29A 3U0HA 2V5BA 3N4FA 3QHOA 4B90A 4FNTA 3FOKA 3NQ2A 4QJ5B 4AD1A 4A05A 2DT1A 4FXRA 4IX2A 1JPHA 3VIGA 5K9DA 2PRMA 3IIXA 4CD5A 4YVXA 2VVSA 2VZVA 3GXMA 2YKKA 1E5JA 3GG1A 1H1YA 1HJXA 3RILA 3ITOA 3TC7A 2W3ZA 2V5DA 5EMYA 5A2CA 3NGJA 4Q8WA 3PHAA 4R9OA 4UOJA 1CGVA 1UWUA 2AGTA 1P7TA 5EYWA 3TROA 3CV7A 1XGEA 2VJXA 4GO9A 4XSLA 4PBEA 3B0VC 1ZBCA 3UW6A 2BDQA 3SM0A 4UTFA 5LZLA 3TOPA 1HF6A 3R2GA 2BOEX 2ZZ6A 3SCOA 4JHOA 5C7HA 2QJMA 2GZXA 3KL3A 4J3SA 1ZHAA 2XWEA 1B5TA 1FH8A 3BOXA 1K4GA 1BVNP 3KWSA 4KMQA 3STEA 3GXPA 3FXGA 3RLGA 2FTYA 3ARVA 1DTUA 1XI3A 1EBHA 1A5KC 1Q13A 2VWTA 4TTGA 2NT0A 1J0YA 1V6VA 5EMLA 2J25A 1CLXA 4OOUA 4I90A 2PDPA 3NYDA 1GWJA 5DO8A 3ANUA 1JZ6A 1RV8A 1E6NA 1TWWA 3POHA 2BXYA 3AS3A 4LTSA 1EDTA 2A1YA 5HNNA 5MKGB 4JN7A 4PB4A 3RO8A 3WENA 1T99A 2OG9A 3MPGA 1MYRA 1VRDA 2G97A 1SSGA 5KMYA 4NHVA 3DESA 1NDVA 4V33A 2PWHA 2IKGA 1TJ2A 3QV7A 4IJBA 2F6XA 1I75A 2Q8XA 1KWKA 4Y9PA 2E1DA 3VUSA 3VVGA 2D3NA 3RLVA 4JNYA 2WQPA 1KRBC 4GZEA 1KTNA 1MVYA 3ITXA 4UOQA 2WBKA 4XVEA 3HJEA 2PC8A 3FW6A 5I0DA 3GFZA 3T0BA 4NP7A 3STPA 4EIVA 1G4TA 2X0SA 5A94A 3PZTA 3ALGA 4DJEA 1QNSA 4CU6A 3MV11 3I4KA 1FWWA 4Y8EA 4CCZA 3PPFA 1GT8A 4Y9OA 1QOQA 4WX2A 2VZSA 2OZ0A 2JALA 5EMKA 3VAVA 3EDKA 2BHYA 4JL1A 3O6AA 3PULA 3F7JA 2PODA 5EA9A 1TREA 2MUCA 3GNDA 4WF7A 2ZX8A 3QKEA 5DRIA 4Z1DA 4MJMA 2H3DA 4ALDA 3HG3A 3SCTA 3K4WA 1ADSA 3DHFA 3GZAA 4A3YA 4F0RA 3SRHA 2W61A 2ZUTA 4C5YA 4JN6A 1QO2A 4F79A 1QHZA 1PCKA 3BMXA 1AQHA 1W37A 4DJFC 4KRUA 2D2GA 3LMZA 4HPJA 4M8UA 1QI2A 1NP0A 3NJ3A 3B8TA 2INZA 3A22A 4RZ5A 2ZDRA 4NJGA 3FSUA 3VKBA 4RCXA 2AAAA 3QY8A 1SW3A 4LOCA 1ICSA 1EPXA 4DWSD 3QBUA 3SUUA 4OFCA 3GR8A 3NDYA 2A3BA 3UA3A 1W5QA 1IHIA 3BJFA 4GY7A 4O1CA 4UQDA 1KBLA 3OQ8A 1D2KA 2E67A 1E4LA 3PWAA 1W91A 3TJLA 1JNDA 4ZQCA 3TV8A 3UNDA 4KESA 3FFSA 2J75A 2Y0FA 2ZRXA 3ZSTA 4W9TA 1EJWC 3GVGA 4HNUA 3S8HA 3WF3A 3NEHA 1W9PA 4Y6GA 3RJYA 2X7VA 4D2JA 4DUXA 1RJRA 2YA2A 2X2GA 5ECUA 3O15A 4LUIA 1OG0A 4UWMA 1UKOA 2R9RA 4PCPA 4XSMA 4AD4A 1FCUA 1XG4A 4A35A 1BYAA 5A6SA 2I14A 3OBAA 5CZ0A 2Q02A 3W29A 1Q7MA 3CEUA 2FH8A 1TO3A 2AKMA 1GVSA 2ZYFA 2X0YA 4C6NA 4Q8PA 3Q94A 3MZ2A 4PC8A 3ZJ7A 3MMTA 5FAGA 4ZL1A 2RH9A 4Z17A 2VMFA 3BLOA 3DI1A 1TTJA 5TQLA 4BQ4A 1ZAJA 1K8ZA 1LLWA 2WMIB 1OX6A 4IG2A 3QHNA 4FMVA 3JS3A 4JTAA 5HQEA 2E5BA 3CC1A 4F9JA 3L4ZA 1ICQA 1AQMA 1OFOA 2P1FA 1GK8A 4HOWA 3WBWA 1BXCA 3BLFA 1UKTA 3L68A 4W7WA 1GPWA 1C93A 3C56A 4LC8A 5J8LA 4MSSA 3VZZA 1HGWA 4W5UA 2DJXA 2YA0A 1EHAA 4IFKA 2Z7GA 4YHGA 3ID7A 4IIHA 1UR4A 1DWIM 4LAKA 2GSJA 3N6HA 1IEXA 3SQMA 1ZLPA 3TN6A 2FIQA 2FFCA 3FEMA 2YXGA 4YWSA 4CQBA 2FVKA 2V6AA 1FX6A 4EX4A 1M9HA 2X8RA 3LI0A 2Q71A 2IQDA 2NQLA 1R3YA 1TA3A 1KLYA 2XGBA 3ARPA 3RX3A 4GBUA 4PBGA 1QATA 4BCEA 4M82A 3L2IA 3H2FA 1X97A 4MJ4A 5G2WA 2QLYA 1IIGA 4WHBA 4I7WA 4DI8A 2ISVA 4C6OA 3DG7A 3CJPA 1GQNA 1UWSA 1VPXA 4YNGA 4GUHA 4AZCB 4UMBA 4CCEA 3HM7A 3P8IA 2QCFA 4Y9AA 1ME9A 4UTIA 3VMPA 3VDAA 2PWUA 2VEIA 3BLKA 3CZ8A 3DECA 2UY3A 4IMFA 2ABBA 3GDRA 3VK5A 1GVIA 2EKCA 1TQXA 4IPLA 4EF8A 2PC4A 2WJFA 3B4YA 4XAZA 1L6FA 3OB8A 2WHLA 2BXVA 1Y5VA 3AXXA 3PBUA 3N3MA 5F1VA 3IJ8A 3RPMA 1BWVA 3CLMA 3S1UA 3LNPA 4EE9A 3WFZA 4UTLA 3W7RA 3CUJA 6PTDA 1Z41A 2X41A 1FCVA 3LK6A 5BXSA 4RDZA 4MYAA 5JBDA 2P8CA 4HA3A 4P8VA 4PBFA 2XIJA 3WD2A 3HG2A 3UWEA 4K68A 3S2NA 1SSDA 3LHUA 3EDFA 3SADA 3PZGA 3W25A 1TG7A 5F2IA 1J11A 3TQVA 3S42A 1W31A 3SGZA 1XIBA 3CWNA 3QV6A 3UXKA 2Y24A 4CD6A 4HPNA 2IMRA 4M6UA 2PWGA 5HULA 2JE8A 1ISYA 4FOJA 1VIWA 2X05A 4JYEA 2PTWA 3NNTA 5G5IA 4S3JA 1RD5A 4DJEC 1DXIA 5BWFA 3JZEA 2EPNA 1H1NA 3GW0A 4JFUA 4GK8A 4PUUA 1KXVA 3UT0A 1ITQA 3QGVA 3CXOA 1F6YA 4AHOA 4MUZA 2VOMA 2IPWA 1W1PA 2YFOA 4QG6A 4AD0A 1JF5A 1EWEA 4E4UA 1JJKA 3UEQA 4HNCA 2DU2A 2GOUA 5E0CA 5D9NA 2XFFA 3PJUA 1X7IA 4GMEA 1KWGA 1UB3A 4GNVA 1O5XA 3SCUA 4DJDA 2I57A 2XGZA 1POJA 2DZPA 3WF1A 1C90A 3BV7A 2Z7KA 3T0DA 5BOFA 1DQWA 4NI8A 1BRLB 3QJAA 3M6DA 2V30A 4JTSA 2P53A 1CXKA 4C6IA 1RY8A 2EO7A 4DYEA 2BOGX 4HU0A 4H9MA 1YDYA 3JRKA 2V81A 1N55A 1OQFA 1Z7AA 2RJHA 2BWGA 3O05A 3OBKA 1W1TA 1FWSA 4GYKA 4HBKA 1R3VA 2A7NA 5HPOA 3MJMA 2FZ9A 5AYIA 3L66A 1LTDA 3WQEA 1V02A 3HPZA 2R1KA 1KR1A 2NXGA 2VFEA 5G1YA 3ES8A 1FCQA 1Q45A 1CDGA 4GBDA 3TTEA 4S3CA 3GNXA 1KFCA 1KD0A 1UWIA 4H9VA 1ZL1A 3V35A 4XO7A 4F2TA 3GH7A 2Z27A 3M16A 2ZX9A 1UUOA 4FO4A 4PMNA 2H3BA 3PS7A 4FX6M 3IGUA 1ECQA 3T4WA 2VUNA 4DZ5A 4QDPA 3WX7A 1HP4A 1XSKA 3QZEA 1H5YA 3WK3A 4LCQA 2FZMA 1OX5A 3H2OA 1G69A 1AG1O 3ITGA 5AOUA 5A6AA 1V6WA 1BYDA 2XH4A 3C3UA 1DBTA 4AQLA 3BJSA 2XIOA 5C71A 1B30A 3UQNA 3P80A 5E6ZA 1UZHA 2DQWA 3OOQA 2FZDA 1UWTA 1MWOA 4FX8A 1I1XA 4GUFA 1S2AA 2PP0A 1ZJHA 1K1DA 4HYWA 3TQPA 2IPGA 5CEWA 1R86A 2BGQA 2VEFA 1M3UA 4CD4A 1FHDA 3FHAA 3KFTA 1NOFA 3N14A 1NDYA 1CXFA 2NV2A 4EF9A 1FP8A 1FUYA 4E6MA 4UQEA 2VQTA 4RUBA 1Z44A 2X1UA 3UCCA 2GVYA 3QXBA 1RUSA 2VO5A 5JIPA 5T91A 3NL2A 1L8NA 1KW1A 3R89A 4GNKB 1HUVA 2HE5A 6REQA 2ZRVA 2CERA 2ZICA 2Z0IA 5I3FA 2WJEA 3MUCA 1BTMA 1U5JA 4YL2A 3AAMA 3B8IA 1XSIA 2HCVA 3AIBA 3ES7A 1J96A 4UR8A 4GJJA 2XZ7A 1V02E 1KNWA 3S9IA 1HKJA 5I7GA 4B3KA 4Y96A 3WH7A 1W9DM 1SO4A 1IV8A 1L2QA 3QRHA 1ME7A 1A53A 1QPRA 1KM4A 4GQBA 4OTKA 3G0UA 2H6RA 1QOXA 4GIRA 1CGXA 3H4GA 1GZ1A 1Q7ZA 3BZJA 3NQ8A 5EFDA 2ISFA 3EX6A 5G1TA 3M0YA 2CKSA 3ZXWA 2G96A 1TV8A 2I9EA 5G1MA 1G5AA 4IL2A 3AOFA 2AQOA 2D0FA 2RJGA 1JDFA 2J27A 3O16A 4MZ8A 3O2LA 1FXPA 4P5UA 3M5YA 3S5YA 1G4PA 1XSJA 3NPVA 4FX7A 4V27A 1MW2A 4AZCA 4D8LA 4AD3A 1FDYA 4KGLA 2FJUB 3W7JA 4M80A 2Z26A 5JUVA 1P0BA 3PWIA 3RXZA 4B4FA 1MSSA 1EHNA 4ZE4A 1U1JA 3J7HA 1RY0A 1RZMA 3LNMA 1Q6QA 3H24A 1H0GA 1KTBA 3S1GA 3CB8A 4HVXA 3EA1A 1VENA 3FVDA 2WVTA 1TPVA 1PS9A 4HSNA 1MQRA 4HPHA 3H4XA 3N2BA 4MKVA 4YJ5A 1UUMA 4F3HA 1YLVA 4F0SA 1DTNA 2WC4A 2PPGA 3WF4A 3TCEA 1D8WA 1VBGA 2TPSA 3KTCA 1HNYA 3NO3A 3SI9A 3UR5A 3FYOA 7XIMA 2X7WA 1DJZA 1JNEA 3WQGA 4ERIA 5GJNA 4GGBA 4MY8A 3KUMA 4Q3MA 3K30A 4PMYA 3LXCA 1OCNA 3OLIA 5GPRA 2J8TA 3TYBA 1AH0A 2GJPA 1YNPA 1BYBA 2ZXBA 5A8PA 2HVNA 5ABTA 1LROA 3GLCA 2IXUA 3U48A 1EEXA 3ZVIA 3S6OA 4MKNA 2DEPA 3BAJA 3CO4A 4YMZA 4WCJA 2YBVA 3OIXA 4DWSB 4O0KA 4DJDC 3URBA 3GDBA 1CYGA 3BG3A 1Q6DA 1IQ8A 1MI3A 1QW7A 4U2YA 5BXTA 1G0CA 1S38A 4I9TA 3GTNA 2OU4A 2A0NA 2J7DA 3S5SA 3TC6A 4HYVA 5LIXX 4A29A 3QOKA 3WLTA 3AI0A 2CZVA 1V0LA 1V6TA 1D7KA 1OF6A 2HROA 1XD1A 2W92A 3LCGA 1WQ5A 4A8IA 2YIHA 2ZCGA 5E9XA 3M47A 3HPSA 3RNDA 3VGGA 4D1JA 3AIQA 2CC0A 2CLKA 1ZU8A 1DWGM 1PPIA 3WNOA 4GFSA 2ABAA 4OUIA 1JCJA 4AWTA 1I1WA 2FPTA 3WSUA 1OABA 4J5NA 1P1XA 4AIOA 4W85A 4GUGA 1MW1A 3S2MA 3RR1A 1DL3A 4IPPA 2J4GA 1QUMA 3O0KA 3VD4A 4UTMA 4MFDA 2GK1B 4JS3A 1GOQA 3WBYA 2EPOA 2X16A 4JY9A 3B8UA 2G8ZA 4IMDA 1W1IE 1WDPA 2QAPA 2O9OA 4L5ZA 4AHQA 1TJRA 3WQCA 1FTXA 1WAWA 3QTPA 1V0NA 2DIKA 1H3GA 3NM1A 5KITA 3ZS4A 5AB3A 4IP7A 2J7FA 2FVMA 3N4EA 4LPCA 2CCRA 1EYEA 5JMUA 3LGDA 4N0RA 2V0TA 2CHNA 1X98A 4MADA 2OJPA 3TTSA 5A6TC 1HKVA 1OINA 4Q4PA 4O15A 4U10A 4RJEA 1I0BA 1H7XA 1R2RA 1R3WA 1DYSA 2BXZA 3ZVHB 1XHGA 5C55A 1WYIA 2D24A 4JIEA 1J79A 3B8SA 3IAPA 4JTIA 1WKEA 2B81A 1A3HA 4FLQA 3P82A 4RKAA 3VINA 1E72M 4CQ8A 1RJPA 2OFJA 3IUHA 3NYZA 5JH1A 4E2DA 3BDKA 3NQDA 5ABHA 4P8WA 4HJFA 5CXPA 1PZ3A 1AW5A 4JL2A 4RE2A 3SY1A 2QUNA 2ISSA 1S39A 4LX4A 4WIWA 4TX8A 3TW6A 3W87A 2VELA 1Z48A 4UZSA 3HFYA 3WFAA 3M5XA 4OT7A 4DBWA 3UG8A 3L65A 2ZTKA 3N18A 4MPQA 1V3MA 4IMCA 5I2UA 5HOSA 4JX6A 4X0NA 3LHWA 4L80A 1GOIA 1XIIA 3G3MA 2FJKA 1T8QA 2X1RA 2C79A 1EFZA 4JN8A 4HSOA 3VE7A 1EL3A 3TDFA 3TWBA 4J2MA 2YGYA 5F4XA 1OBAA 3O63A 4ERGA 2I16A 4EAYA 2BVYA 3WEZA 1TZ7A 1UWAA 4P7LA 2H90A 4BI6A 3BAWA 4GIAA 4HZMA 4A3RA 2Y70A 3CZLA 2CLMA 1JXJA 2Z2UA 4CU8A 2XM1A 3UWYA 2CLLA 1L6YA 1TVNA 3CNYA 5CBBA 4HNOA 4GQ0A 1TV5A 4DO5A 1XH1A 3Q67A 4PMOA 1EBGA 1VJIA 5HPCA 1Z8AA 5E0FA 4C7GA 1GZJA 3THAA 4CD7A 1H61A 2WSRA 2E7FA 3ORWA 1Q85A 1IR1A 1VRXA 2PTDA 3T05A 1Q6RA 3WQ6A 4XZLX 3UETA 5F2LA 3STGA 4DZAA 4I5UA 3W71A 5K9CA 2HVOA 2CBJA 7TAAA 2XFRA 2Q09A 2XM2A 5GJMA 4O17A 3AS2A 3B4UA 2VYOA 1KM5A 5AC6A 3HV9A 2Y6ZA 4X22A 2AQVA 1X38A 3EZ4A 2CLHA 1RAKA 2WHKA 3QGAC 4PULA 1E6ZA 3OGSA 2V2HA 3MUXA 1A3XA 1JDAA 4XD6A 3QM3A 3VOFA 4Q7NA 3FJLA 2ZC8A 4GI8A 2HTMA 3CQIA 5F4SA 1Q8AA 3IGSA 3AHYA 1DOSA 1KQZA 3OHMB 3W1AA 3KL0A 3L4XA 2V9DA 1LDCA 4A3HA 4NJIA 1FWRA 2VDHA 4KT2A 1JUKA 3PBGA 4MWAD 4WD0A 1E1EA 2NVDA 1UOZA 3PP7A 3TW9A 1EDGA 1HT6A 4NL1A 3LHVA 4HU8A 2PDHA 4L65A 2RGMA 1JEZA 2DDXA 5FF2A 1MXSA 1UW9A 1TCDA 1JDCA 2XIBA 2C1GA 1PZ0A 3PTQA 3TYAA 2G41A 3FAXA 1NU5A 4GX9A 3CT2A 1O5RA 2DSKA 4JEQA 3FCPA 2V2DA 1SFJA 1KGUA 4OJYA 2PEVA 3GY1A 3QZ6A 1EJRC 1LBLA 3A4WA 3FYYA 5A3HA 4GOAA 4YXGA 3R8GA 4QE4A 1XBXA 1OZQA 4GC4A 1CXIA 3SUWA 2F8QA 4W84A 3E9AA 4GYPA 1V93A 2ISDA 3SUSA 5KTLA 3D0CA 3WH9A 3VPLA 1F4HA 4AIUA 4AZIA 4QNWA 4LY8A 3UNTA 4PRTA 4BF5A 3QTGA 4UZUA 4A8NA 1QU4A 1FHUA 3W2UA 1JI2A 5FL1A 1XYAA 4LYQA 5E6YA 4LY4A 2QGHA 3V36A 1R3TA 2CITA 4P2VA 3TAKA 4WSJA 4LS1A 3NEVA 1LBFA 4WSHA 1XWYA 2DT2A 4KCTA 1XRVA 3WZ0E 3VCRA 4B5UA 3HQNA 2TMDA 5I03A 3DU0A 4JKMA 4KCUA 4US5D 4PUJA 2GK1A 4JKKA 4PUKA 2EHHA 4D6GA 3GZ3A 3UY7A 4LCSA 4IP4A 4GPNA 2QVHA 3RO6A 5GVJA 4LUYA 5K7JA 3U7VA 4FAMA 1RHCA 1UBPC 1JPMA 3H7VA 4ICCX 3W75A 3NSNA 4RV8A 3NG3A 4E3VA 4C6LA 1EGVA 1TUXA 1RLDA 1NH6A 3MCOA 4EPDC 3MVTA 3MI3A 3LY0A 4NRSA 1ISWA 1KBJA 3GHRA 3VGDA 4E2BA 2PTZA 4AG0A 4FALA 3ICJA 2HJPA 2WCSA 2PDNA 3RX2A 4DBEA 3L23A 4B9YA 1OT2A 3AIWA 3EYPA 3KOWA 1O5QA 3R4IA 3WJWA 4ZQPA 3ZVHA 1P1MA 4FLRA 3NSXA 4C90A 3JW7A 1PUDA 2WNQA 1ZB5A 3NZGA 2HMCA 2BVDA 3UF9A 1OCBA 4MDOA 1NOUA 4ADUA 3DBPA 4TOQA 3O3RA 3UG3A 1MEIA 2C19A 2CPUA 1E6PA 2WANA 1B3WA 2EQDA 4TTUA 1WPCA 1FP9A 3AXHA 4ROQA 4K37A 5DELA 3H55A 1EXPA 3PTMA 1POKA 3C86A 1XISA 4LUTA 3MSDA 1YPXA 4HD5A 1WCGA 1GVOA 3CU2A 2DY3A 2HNHA 1XLFA 3IIPA 4IISA 1JZ2A 1ISZA 4NQ1A 4DBUA 5LA2A 4I7UA 3LZ5A 2FHBA 1C8QA 3AROA 1EP2A 4NZCA 4JQ2A 2GGIA 4PUNA 2CHRA 1S5WA 1LQ0A 3Q58A 3SUTA 4FIRA 2DZUA 1C7TA 3FJNA 4GKLA 2Z24A 1KGWA 4WVXA 1EP3A 4Z2LA 3PZMA 2NW0A 3AU6A 2YXOA 3ARUA 3NQBA 2ACUA 1AD1A 3JU2A 3NL5A 4GABA 3PZ9A 2PCQA 1DKWA 2PWFA 1FWTA 3T55A 3BSMA 3GVRA 3LCWA 3KBMA 2YB1A 1FWIC 5DT5A 1OIFA 2OX1A 1V3LA 1CT5A 3GUGA 4KWWA 1X1NA 2NZLA 4ZXOA 2BODX 3UVAA 3WCZA 3WF0A 1B3YA 1QNOA 4AYGA 4AVNA 2XSAA 3TR2A 1W8SA 3Q2DA 3QW4B 3PBMA 1TWIA 1Q63A 4LC6A 1J6OA 4MZ1A 1XM3A 2JEPA 1WNOA 1ZS2A 3BJTA 3ARSA 2O7SA 4HZ6A 3W07A 4C6CA 2FZNA 1L6SA 2YSWA 3K4DA 1A50A 1J12A 5I77A 2YCKX 4C6PA 5BRQA 3FLUA 4B5NA 3EX4A 1TTIA 4O8AA 1C3FA 4DYJA 3CM4A 3DFNA 4PCNA 2XH2A 4GJIA 6TAAA 2VZUA 5IHSA 2QUMA 4OWGA 3MA8A 3I65A 3ZJKA 4DZIA 1P0KA 4ILSA 4UTKA 1XIDA 4YCOA 1VBHA 5LHEA 2A3HA 3BLLA 2WZMA 5T26A 1SJCA 4JEJA 4UQCA 1EP1A 4K1WA 4LVBA 3M07A 3VNMA 3G18A 4PCSA 1E4MM 5AC8A 1TWDA 1V7AA 2YL5A 3GKAA 4NZ3A 4QXIA 2OT0A 5A8OA 1K9TA 2OKTA 4OHQA 3ALFA 4IT1A 4M81A 3CT7A 4G56A 4DUWA 2HBVA 3R12A 4B3LA 3SQLA 3EEZA 3W2JA 1DWHM 4P7OA 4A3UA 5FCZA 4NUWA 3TSBA 2POZA 1A5UA 4HN8A 5CKSA 4GYPC 1M5WA 4ZO6A 1W9VA 1IXPA 1U2YA 6A3HA 5CQ1A 3AMCA 3OG2A 4UQ9A 3NUKA 5XIAA 3UWWA 1W2PA 4MLJA 4MKSA 1Q5MA 1SW7A 3EOEA 3I3BA 4S3DA 1VD6A 5C7VA 3K1DA 4NAEB 1FKXA 2VRKA 2A6NA 3AXKA 3HPXA 2WQDA 2ACRA 4Q32A 1GTEA 1EC7A 1FHVA 3PZOA 2QCEA 2VI0A 4GQQA 3G1VA 4AC1X 4L64A 5CLWA 3AYTA 3IK4A 2D0HA 4JNMA 4C7DA 1KXQA 3W7PA 2QR6A 4QJ1A 2G4FA 4W8BA 3JVAA 3MP5A 1E6SM 4Y8FA 1QNVA 3IJLA 1YE6A 3EDEA 4IICA 2A2IA 1ITCA 3AZSA 4H3DA 3CV6A 1KFLA 4I6VA 1SJDA 4NT0A 3BTNA 5IRPA 2ZQ0A 3ONBA 4KIEA 3E0FA 1XS2A 2FVLA 3L4VA 3AXMA 4HPGA 1BF2A 4ZOBA 2BV9A 4ML9A 1EQPA 3NM3A 1EKOA 1X8CA 3EMQA 4RNHA 1JDDA 2ZX7A 3P2VA 4LGXA 2BVWA 3DFHA 3RHGA 3NQGA 4O1DA 1FWFC 3V7PA 1TKKA 2VXNA 4W4QA 3VIKA 3TNBA 4HA4A 2Y5JA 5FF4A 2ZIDA 1TPC1 2PF8A 1M7PA 3R13A 4LNCA 2X09A 4UIOA 1PDZA 3A3WA 4LYRA 3UYCA 1NQ6A 1W1ZA 2DT3A 5A69A 1TR1A 3PPGA 4M0XA 3H12A 2GQAA 4F0HA 4XG1A 1M41A 3QMRA 3T08A 1UC5A 3IACA 5PTDA 4NZFA 3TN5A 3WJSA 3F5KA 3KBSA 3W1LA 4AF0B 1G67A 3URAA 1UWRA 2NQZA 4UFMA 1YBQB 3KDNA 1LQ2A 1VFSA 4HTYA 1UIOA 1W1VA 4FNSA 3VM5A 2V3FA 3R8RA 2EG6A 4MAVA 3NL3A 2VD9A 5C9RA 4D8AA 4KPLA 1M7JA 1FWAC 4Y2WA 2E1WA 3CB3A 3N73A 3W7GA 6TIMA 4PMRA 4QX4A 3WNNA 8XIMA 5DF0A 4A6GA 1BD0A 2G50A 2BFGA 1PHQA 3VU2A 2PDYA 3GVWA 3NQEA 1ZSXA 3CH9A 3DH7A 1NWRA 5CBIA 4XAPA 3DFSA 4LUJA 4US6A 1K7EA 3LM7A 1WBHA 2YBTA 1JZ8A 3LCFA 2QJGA 2QKFA 3NQ7A 3LPFA 4EXBA 2BVTA 4IH3A 1E70M 3GNOA 2GUBA 5HA7A 4JTJA 2NT1A 5AZ1A 2EF9A 3W85A 3C2VA 3LXBA 4R34A 1WDWA 2OEMA 2NWRA 4DHGA 3F2DA 1KKOA 4K7VA 4AB4A 2ZZ1A 3G1FA 1JXKA 2Z1BA 4UTTC 3IS4A 5TF0A 4O13A 1ZBWA 3WLIA 1PSCA 1PEZA 2FQIA 1VGAA 3M44A 4JOMA 3HGRA 1RK5A 2FB2A 4MMWA 1R0MA 1CB7B 2VWSA 3FDGA 1R85A 3OVRA 4TVUA 2F2HA 1KLZA 2V3EA 1MDLA 1DWAM 1YPIA 3OZOA 1SU5A 3GYCA 2J47A 1IGWA 1HZYA 4TIMA 3T8QA 2R1PA 4BEQA 2VOTA 2H8XA 2X0HA 5H6HA 3PSVA 4REQB 3R43A 4UR9A 5CSRA 4MWAB 3EOUA 4FNRA 5HWNA 2V5KA 4HIBA 4YYFA 3QYSA 4O1FA 3IUDA 4V1YA 4W8AA 4DEFA 3W02A 3UJSA 1DV7A 3BGAA 1FWGC 2HVMA 3GM8A 1PX8A 1DJNA 3HQPA 4NYYA 3E0WA 3WNMA 2DH2A 2YL8A 1XG3A 2QJHA 1J8VA 2E8YA 4J2PA 3S83A 5D2TA 3T2QA 3ARZA 3EOSA 1PB0A 9XIMA 4MNLA 3WDRA 2RGLA 2OWWA 1ML1A 4TMBA 2C1HA 4ZENA 1M1BA 2I9UA 4UOZA 3BSGA 4AVOA 2W91A 4ATLA 3K13A 1YKWA 2WCGA 2E68A 2EEXA 4OU1A 1O60A 4EANA 4W86A 4GZIA 4NI3A 1PIIA 1FWJC 5U4NA 1JQVA 3U5UA 2QCCA 2Q01A 3B0UX 3V1HA 1V79A 1H63A 2PB1A 3OP2A 3DAQA 2G3JA 2YDAA 1YTDA 1MMFA 4IQJA 1FRBA 4GACA 2ONEA 5KSWA 3QY6A 3SURA 1JULA 2E25A 3NQVA 4XAYA 3T81A 3ZYZA 4CNTA 4LV4A 2D69A 5FJTA 1E0UA 1QNPA 3A6OA 4WXZA 1W3KA 3MDWA 2OMAA 2YDQA 2FMOA 2W9MA 5I23A 4MTVA 2CESA 2RFGA 1LWHA 3HO8A 1FY6A 3MWCA 1GJWA 3CWOX 1V5XA 1ZALA 3G1YA 1CENA 4F8XA 5JBFA 5BU6A 3IV3A 4AIEA 3LCXA 3CZKA 3KOYA 4DI9A 3UERA 1OFDA 3W81A 2F7FA 1RLCL 3L12A 1H60A 1F8IA 2GGGA 5BROA 3LGGA 3TYZA 1ONWA 3W28A 3DHUA 1RH9A 4R7WA 3LCHA 3IUIA 1YRRA 3WLLA 5G2IA 3UJFA 3YPIA 1JPDX 1XCFA 1VB9A 5DX7A 1TYGA 1HW6A 4IIGA 1FOBA 3DFTA 2NVCA 5I06A 4H01A 1QI5A 3KVMA 2PDBA 3LPOA 3ELFA 4FNUA 4Y9NA 4QDWA 1CGWA 1W9BM 1AK5A 3VGEA 3LLFA 4XBKA 1HXJA 1VJSA 3GHSA 1JCMP 3WLNA 2QCMA 1KM1A 6CGTA 1NFGA 1XPGA 2V82A 1SPQA 3UU0A 2XVKA 1H51A 5E9AA 4GYJA 3VOGA 1XIHA 1VBUA 5D38A 1AL7A 4XZWA 1QT1A 2Z6IA 4JR5A 1OJXA 3DXIA 1A5CA 2RHGA 2A79A 6ALDA 2HXUA 2Y63A 4JQ3A 3NZ1A 4JTDA 2OZTA 2E6DA 4QEHA 4EKJA 2RAGA 4ZTYA 3K8MA 5DQPA 4GVFA 5C9WA 1ZJIA 4MOZA 2DPEA 1EGZA 3R10A 5DXYA 4DWDA 4J3TA 5KZMA 3RDKA 4MB5A 1WOBA 4O18A 5I3GA 1DJHA 2C0HA 3ABQA 2J88A 3AHZA 2GSEA 2XIIA 2OTDA 4C1NA 4WR3A 4XUGA 1A5SA 1XUZA 3C2RA 1K9DA 2QAFA 3FDKA 3L0KA 4MUPA 3PK7A 3WDQA 4L4OA 2FGZA 1K6AA 4NZJA 3WLQA 1E1FA 1JQXA 3S1WA 4AZGA 1PV8A 2C71A 1W3JA 2INFA 1MW0A 1TE6A 3K8LA 3T1GA 2XZ9A 4RDWA 1OM0A 3WK0A 3H23A 2PZ0A 3S5OA 3SCNA 5HJYA 1SR9A 3VDHA 2P88A 1NOWA 4AF0A 1JFXA 1F9CA 1YBQA 1W8GA 1OSEA 2DIJA 2CBUA 5AY7A 1OC5A 4D6IA 2WK2A 1LLZA 3GNNA 1J93A 2XGIA 3V5OA 1ZP3A 3U3HA 3VA8A 4N6EA 1VP5A 1DJIA 5HATA 3MMUA 2PBOA 3QW3A 2QIWA 1RSCA 1WAUA 3TYCA 1Y5WA 3M43A 3VE9A 2O55A 2V2CA 4W7VA 1VFUA 3HG5A 4RL3A 3UZ5A 4EPEC 1YTEA 2X1SA 4R7OA 1JCNA 3MI2A 1ZAIA 2QUVA 3PR2A 3N29A 5BMWA 2QZRA 1IT7A 1C8YA 4NJHA 4JTUA 1R8LA 5CZKA 2X1IA 3BSHA 1PZ2A 3B9NA 3IIVA 4B92A 3GRIA 1MZRA 2CETA 2ZA3A 4C5ZA 1MEWA 4F0MA 3KEHA 1TRIA 2QPXA 3MW7A 1DIOA 3CUZA 4KEZA 3VC6A 2XYLA 3B8VA 1NWSA 5C6MA 1KB3A 3MUY1 5LIWX 1ZJAA 4O0ZA 2PD5A 3VI2A 5CSSA 4A21A 2GYIA 3DG6A 4C60A 3BGJA 3GK0A 4F2UA 2A7PA 2V38A 1V6YA 4AFYA 3KRUA 2JK2A 4R27A 1WZKA 2VCCA 4DIAA 4MWAA 4G6CA 3RYSA 4N6FA 4LQ1A 3U4AA 1F74A 3CQJA 2XTKA 2VTFA 4IF2A 4JXCA 4H4IA 2C0AA 2PI6A 2GJXA 1G9HA 1V6UA 3SBFA 1I0DA 4NVTA 1UJPA 4NX0A 5F2MA 2KX9A 4UQAA 3UXLA 4DBSA 4DXXA 2WC3A 1W9XA 2H8ZA 4GY0A 4URIA 1NFPA 1QVBA 1YNQA 3HB9A 3VUPA 1T0OA 1FQ0A 1TVPA 1L2UA 4E0CA 3C8NA 2DQXA 2ZUUA 4JTLA 3W7MA 1H2JA 2ISWA 3IJ6A 4RW3A 4QQUA 5HMDA 1TTQA 1F73A 2QS8A 1IT8A 2Z4GA 4BHYA 4KRZA 2DIEA 4FIQA 1HO4A 3DFPA 1SFTA 2L5HA 4Q4KA 2PLMA 3UP8A 3P0WA 2D22A 3PBWA 4JQ4A 4GUJA 3WMBA 5CH9A 3LTYA 3TTOA 2DGAA 4K3ZA 3N34A 1XLIA 2HRWA 1KFWA 4W87A 2PDQA 3V18A 4FOUA 3VNLA 2ASHA 1XKJA 4KGJA 1VFMA 4Z2GA 1M7OA 4L9XA 3TJXA 3HIJA 1LOQA 3DDMA 1RJQA 2WM1A 1NEYA 3W1QA 4OQVA 3W00A 4H41A 4QROA 2WM0A 3PBYA 3ANVA 5D30A 1D7FA 1P5BA 2Y61A 4JTEA 3LUTA 4KETA 3WEMA 1WXYA 3ATZA 4US5A 1FH7A 1J0IA 1JUEA 5I5RA 4O53A 1QNRA 3LV5A 3HQOA 2ZVRA 3QLDA 1NWTA 3GKFA 3U2CA 4JHZA 1A80A 1JYNA 1W0MA 4J40A 4LAOA 3VIPA 1QBBA 4UTHA 3CAKA 1VQTA 3VTRA 4AWEA 3IJ9A 1K7XA 1BG9A 1HKIA 2X2YA 4DO4A 1EIBA 3QY7A 5F1UA 4K8GA 4CNNA 3PUGA 3A64A 1ZAHA 4YN5A 3FVMA 3SN1A 4F4RA 4PTVA 3ZIZA 3ZZ1A 4UFHA 5AYXA 1GHSA 4LT9A 1XRTA 1GQIA 5L9FA 4QSFA 2ZUSA 1GOMA 1WX0A 4LFYA 3WH8A 1SO5A 5I24A 3LBCA 3S9YA 4FXJA 3R0DA 3ITCA 4IIFA 4KRTA 1JCYA 5DEZA 2WPBA 4KFNA 1QR7A 3GWQA 1UP0A 1H7RA 3GAKA 3LPGA 4HCLA 4UC5A 3AIRA 2F38A 2J8FA 4IGSA 2BBFA 3GDLA 5AYBA 2YR1A 3BW2A 4C6DA 4X3ZA 3VILA 3QQ1A 3CZGA 2QULA 4AZ7A 4AU0A 1HIZA 2PTYA 1JZ4A 3HJZA 3G2GA 2IKJA 3CASA 4RE3A 2VEMA 1RCQA 2PWDA 3WD0A 3PVFA 5LXXA 1F3XA 3CIXA 4G8TA 4JQAA 3UXAA 2PGRA 1F8MA 3RLUA 7CGTA 4JFWA 3O0FA 3Q65A 3RIKA 1AJ2A 1M03A 5B7ZA 2JFEX 1UYQA 1ZNNA 4WKHA 2DSZA 2XFYA 3ERPA 4GCXA 1XH2A 2OWCA 2DORA 1BPLB 1AZ1A 2VGIA 3O6CA 3W7DA 1JCTA 4Z2KA 3PPCA 2VFGA 4HU3A 2I56A 1GUVA 1XC6A 2QJIA 1A5AA 5I3HA 4H9TA 4ECLA 1V0KA 5AVNA 2QUUA 3FA5A 4KWOA 3AUOA 3SGUA 3VIMA 4XZNX 1XR2A 2VL4A 1MRQA 4ZFMA 4MB1A 2PGEA 1SW0A 1CXEA 1Z42A 3AJXA 1K6WA 1V77A 3WQOA 5AECA 2AL2A 3KRBA 2J8GA 4CN6A 4DELA 4OKDA 5HMSA 4LXFA 1EH9A 3B8WA 1ZP4A 1LWIA 2ZFAA 4R88A 5BW6A 3CAQA 4LVAA 4JCMA 3M46A 1WKFA 1KFJA 3DC8A 1OYBA 2PLKA 3H6OA 1THFD 1XBYA 5XIMA 2QF8A 3LX9A 1KQYA 2DVTA 2P0OA 2VP8A 3WK1A 1ENUA 4CVUA 4NF7A 4JGDA 1AQ0A 4PTDA 4L1WA 2WMKA 4ZEPA 5FOOA 3QOMA 3GSMA 3LOTA 2JKAA 2NSXA 3QR3A 4HHHA 3H2MA 4WGHA 3MHFA 3LXAA 4MWAC 3CHFA 1E55A 4ZQMA 3W84A 4JYFA 2Y7GA 3LENA 5A6KA 3DZ1A 2HE8A 3WBEA 4B16A 4FNPA 1JGIA 5BNKA 1FVPA 2JKPA 4L9ZA 3DN5A 1XKYA 1TUFA 3NPUA 4PE8A 3B9OA 3KHDA 4QP0A 4WUIA 3AFBA 4DN1A 4H8NA 1G1YA 3EX2A 1WUFA 1CEOA 1E6RA 5HMEA 1TVLA 3OEXA 4DX3A 2NUXA 3EKLA 2YBUA 1DWFM 3P3BA 3H2AA 2QCGA 1IXQA 4QEEA 4MM1A 1TPUA 1R7AA 3TA6A 2MNRA 2Q6ZA 4H8VA 3S6DA 2ATMA 1DQXA 4KQNA 1VAHA 3AZRA 3S1XA 2ALRA 3XIMA 1FFQA 4ENLA 2CZEA 5AN7A 3TONA 2AL1A 4L4PA 3C6CA 1R2SA 1Q6GA 1KA9F 1SFLA 1GYMA 4JX5A 2Q8ZA 4GQRA 4W93A 4AYSA 1YDVA 3N15A 3BLDA 5AYYA 5A95A 3ITTA 3MKCA 3RM9A 2EJ1A 4FNQA 1TV2A 1DJQA 3ZT7A 4RPQA 1LUCA 4DRSA 1KRAC 3WD3A 3LLDA 2WNWA 3OZYA 1TWSA 3B0PA 4ZMGA 3LN3A 3GDTA 2AMGA 4ZVJA 2QT3A 1WP6A 1N2VA 5D04C 1VIZA 4FEZA 4E38A 2VZOA 1MUMA 2J7HA 4YVPA 4P8UA 1K9FA 4Q4RA 4GZJA 3OQEA 1QPNA 4AAJA 1ZZMA 1OK4A 2HSAA 3A12A 4PMQA 4JFVA 1M04A 1UR9A 4M1RA 1E73M 3EB3A 1VPQA 5FESA 3NVDA 3CHDA 1O6IA 4ACZB 3WUBA 4QG9A 4PMDA 4LJ3A 4AXNA 3PB2A 4CKQA 4AHPA 3I6RA 6XIMA 2YJQA 4FHAA 4X9SA 2ZX6A 3W22A 4IL0A 2HPMA 1UA7A 1OFPA 3P67A 2NVAA 3GVVA 1NF7A 4H9YA 4RR4A 4KIRA 4NIRA 2BMBA 3VOHA 3MU7A 1N82A 3RX4A 4WSKA 3TP4A 5FEZA 2OWXA 3KLKA 4GA8A 4DBDA 3LCLA 5FJPA 3F2CA 4FI4A 1B57A 1J01A 4MY9A 5LKYA 1OFBA 1TX2A 3AZTA 1A4MA 1O1HA 2VRJA 8XIAA 2CWXA 4JBRA 4PEEA 2UY5A 3LDVA 1CCWB 1I2PA 3OZPA 4FR1A 5I3DA 2DZTA 2CNCA 3W01A 2YLLA 4M1BA 4ZO7A 2XH0A 5C9ZA 3AS0A 4CNUA 3A24A 2VFFA 1XW8A 4H8HA 3WMCA 4YTUA 2OLAA 1D9EA 1O5KA 3LD5A 1EZWA 3VGBA 4EVZA 3UR8A 5CZSA 1RVGA 1J4EA 1MUCA 2B0MA 4GVHA 3WUGA 3WDPP 3M0JA 3MSYA 1US2A 2YYUA 4M7TA 1GOOA 4Q8VA 1TRDA 3IVSA 5RUBA 3L2LA 3HGJA 1F5ZA 4LUSB 4TXEA 2J9YA 4Y90A 2OT1A 5AHFA 1XJBA 2YCIX 3HMJG 4LW7A 4NXKA 3W23A 5KEZA 3WBXA 1RALA 1J5TA 3V5CA 4H04A 1LF1A 3BZGA 1A0DA 3KM8A 1Q4WA 2VX5A 4MFEA 3H22A 3B0YA 3M1ZA 1XCXA 4AD5A 3KWXA 3WJYA 2VZTA 4AY7A 4D9PA 2WC7A 3V16A 4GCAA 2Y88A 1EQCA 2F84A 1XLAA 1UD2A 2D1ZA 3W1XA 1CWYA 1CZ1A 1TMHA 4DXKA 1TPH1 3W2MA 4O10A 1E9IA 2VDGA 2PLCA 2PLJA 1NTHA 3VGHA 3THQA 2PDMA 1AW1A 1AH4A 4W89A 4M6VA 3PM6A 1OIMA 1GKRA 3CS2A 3VX1A 4UFIA 3RM8A 1TZ9A 5I09A 2OXNA 4J4KA 3SECA 3PZIA 1KM3A 5MF5A 3O6YX 2TRSA 3LQLA 3BXWA 2GDQA 2DZVA 1JCLA 1GGOA 3VNYA 1H1ZA 2WSKA 2WMGA 4BS0A 4PCFA 3D47A 1FWHC 3MDUA 3W7LA 2NWSA 1LRTA 4WK9A 3W1RA 5FF7A 3H2NA 1WDRA 3K4AA 4B91A 2QCDA 4Q4OA 3LBMA 2YL6A 3MP3A 4QR6A 4R3UA 3EWYA 1W9UA 1W54A 1OFAA 4QFUA 1MXDA 4S38A 2IXVA 4EWND 2PRLA 2VUYA 1GJPA 2BB0A 1ECEA 2VFIA 3LU2A 2VEKA 4J3ZA 1UH2A 2P50A 3ZFHA 5LGZA 3LQGA 3MMDA 2RDUA 1AD4A 4H2HA 1E4IA 2JF6A 4XO6A 3LS9A 4GISA 1DJGA 2J6VA 3OO2A 4IWWA 2RDWA 3IJQA 3PG8A 1EJSC 3VKKA 4BEUA 3EMZA 3TAOA 3FA3A 2V5CA 4PH6A 1W1B1 3LZ3A 3WUFA 3PJWA 1K8YA 2IS7A 3W6MA 5BCAA 1DJWA 4XKYB 1KRMA 2PF0A 1Y5XA 3B8DA 3AIUA 1ADOA 4HA0A 4MNMA 3KTSA 4PSRA 1GCYA 2VC7A 1JI1A 1B9ZA 1MNSA 2G3MA 3AYRA 5DT7A 4XZ9A 4HNTA 4JAWA 3FGCB 3PNUA 1WBJA 3KOXA 2VHLA 5A8NA 4YS1A 1EIXA 4KEMA 5J04A 3C2YA 1MQQA 4R7JA 4CNOA 5K4ZA 5HUPA 2OEKA 3U6WA 5FL0A 1H4PA 2GUYA 4A8RA 4J35A 1DHPA 3PJTA 3GS6A 2BY3A 3UZWA 4L7ZA 4M56A 3N6JA 1R7OA 1US0A 3GB6A 4WDWA 3CUXA 4DF0A 2TODA 5A8QA 1HP5A 2CXEA 3ME3A 4MYXA 3UFYA 2XN1A 3GDMA 2E09A 2OYMA 3ITLA 5CBJA 2JIWA 5AHIA 4J27A 3B3DA 1FA2A 1XQKA 4WKFA 3GBDA 6ENLA 2ZC1A 4AVFA 1XLDA 3DKLA 2C14A 1YADA 2NQHA 4E4FA 3H8AA 3TJIA 1XLCA 4JCLA 3CL8A 3H2CA 4U5IA 4E5TA 3TC3A 1IXNA 1G4SA 1KCZA 3MO4A 5E70A 4QHRA 3RG6A 2XUCA 3WYZA 3WY1A 4D6CA 3QPEA 1R9YA 1XFBA 3BW4A 5IDZA 1ME8A 4GX8A 3AMLA 4WZHA 5HNRA 3LLXA 1UD3A 3NXFA 3T0CA 1ZJBA 5MHBA 2IQ0A 4HHLA 1FDJA 3R0UA 4HKPA 3VIOA 5A6BA 3MB9A 5FKYA 2XVGA 4AZ6A 1EO7A 3ARQA 1C8VA 1H41A 4O12A 1J18A 2GQ3A 2Z1VA 1UASA 5JXQA 1ICPA 1RQHA 1BLIA 3FEQA 5TAOA 3W26A 5U7SA 5KZEA 3MANA 5MKGA 1O4UA 3AQUA 5BRPA 2J62A 3UCDA 1JVNA 3SCVA 3M7SA 3M6YA 4FSAA 1Z6KA 3FK4A 1TV3A 3G1RA 4IMEA 4ZOAA 3PB0A 1ONXA 4Q4MA 1ONEA 1JPIA 3QPYA 3QEZA 3W83A 3KW3A 3HZ3A 4YWIA 2CU0A 1ZBKA 5CPNA 2DP3A 3VKAA 3M0KA 3B04A 3G1SA 4GHRA 3GFYA 3WNPA 4M6PA 4I9AA 2GOKA 3V5FA 2DZXA 4Z0JA 5H2ZA 2SFPA 1XBVA 4UBPC 2WNZA 1Y65A 1BEUA 2BLEA 3MUIA 5DY2A 3WD4A 3W3OA 4U3AA 4OBRA 5FSDC 1F6KA 3PPHA 1PL9A 1ZCOA 1LP6A 5C5YA 4KEUA 3CUIA 1X96A 1EYWA 3WKZA 4NRRA 2ZWYA 1UIPA 4MZYA 3TA9A 2Y5EA 4NJJA 3UGRA 1OCJA 1RR2A 2I5GA 3CHEA 3PTDA 2DZBA 4WKAA 1GG0A 1CIUA 1HVXA 2OYLA 1CGYA 4LUSA 2QCNA 5FI8A 4GGHA 5CZJA 1DXFA 3TLQA 5I3KA 5TIMA 1T6MA 2Z2AA 5HQLA 4DQWA 2C18A 4CEUC 3HOJA 4E8DA 4YVVA 1IEWA 3IARA 4MNKA 1RCXB 2RDTA 5AC7A 4OUEA 1KFEA 4H7VA 1Q2SA 1ONRA 3UWUA 4I8DA 3O06A 5C2CA 3SGGA 1GVYA 1PYMA 2V8ZA 1TPDA 1U5VA 1ZCCA 4WRHA 2NQ9A 3SY5A 1GONA 4TV6A 4F0LA 3B03A 3OIHA 1QW8A 2GWNA 1PKMA 3QGKC 1JRBA 3TR9A 2WVVB 1XCWA 1KRCC 3TJ4A 5CC6A 3S2JA 3CPRA 1PWLA 4GYFA 2I7GA 4MGGA 4O8RA 1CX9A 4UCFA 2ZRUA 2PFHA 4U4MA 3ZWTA 2UV8G 3L0GA 3NQAA 1WO2A 4LRSA 5FD0A 1PKLA 3TKFA 1QPQA 4HK7A 3S2CA 3AALA 4H83A 2WLYA 1UD6A 1YDNA 1TTPA 5CGQA 3OJGA 5FA5A 1KCLA 1EOMA 3PAOA 4PTMA 3RCMA 1TPWA 3HURA 3W53A 1X6NA 2Y62A 1IR2A 1FXQA 4LSBA 1K7FA 4W8LA 4A8LA 3UCQA 4CLMA 3ABRA 3WQDA 1OC7A 3T8LA 3NCOA 4PFMA 3MUZ1 1JZ5A 1XPYA 5XINA 1C9WA 4X2PA 3E2RA 1NM9A 2WMIA 1X8FA 3E38A 4UNIA 3D46A 4FR6A 3G1XA 3LMYA 1CGTA 1L0PA 2Y7FA 1SR0A 2G4JA 4C6KA 4R9XA 4TMCA 3N12A 1PTAA 3EEGA 2WO5A 3MSGA 3OBEA 2YCEA 5LNSA 1W3IA 3WNKA 3W9ZA 3BE7A 3H2EA 1Q6EA 3IRSA 1R30A 4K8EA 3SW6A 5K4XA 3VX0A 4HMEA 4QITA 5CC3A 2WLZA 3PUEA 1OZMA 1V8EA 4QIUA 4UFJA 3CO8A 3QN3A 1OK6A 4XKYA 5TNVA 3MVIA 2BHUA 1WKYA 3W70A 4K36A 3AXIA 3Q37A 4C6MA 2YDRA 3WQPA 3P5YA 1VR6A 2UY2A 4WQ6A 3T9PA 2ZRWA 1LORA 1W3TA 1GEHA 4MG4A 3CLWA 1A5LC 2DSVA 4WOQA 4CQCA 3PWGA 3LTPA 3VIJA 4GI6A 3CZEA 2Y85A 4BF9A 1IIHA 1Q7QA 1NSJA 4QISA 3BG9A 2WV8A 1J2WA 3DYPA 5CGMA 2J13A 3B97A 1CLVA 1PAMA 4V1XA 2PGFA 3KTXA 3LRKA 3DFQA 1TQJA 1JYWA 4PMUA 5CJMA 5D4YA 1B1YA 3PFRA 1F6PA 3TVAA 5I6SA 1TSIA 1BQGA 4XX6A 4XKMA 1BG4A 4H9UA 1Q65A 3E49A 2BG5A 1LM1A 3ENLA 3CUGA 3NURA 3SSJA 4ERAA 3CIWA 1X7FA 2ZZ5A 3L4YA 1KCXA 2CEQA 3VKJA 1A5BA 4EWJA 3PZVA 1EB3A 1UCWA 1PIGA 4LH8A 1V3IA 5KETA 1VCVA 5FIPA 3T09A 1XLMA 3RCNA 1GQKA 2AAMA 4I9JA 2E5CA 4YTTA 3WELA 3KDOA 4BQ2A 1ADDA 2CBIA 1RP9A 5H8UA 3HGSA 3N04A 4HJWA 4L61A 2DV0A 5DMNA 3IJIA 1OADA 3S0CA 3R79A 1J0KA 4DZHA 4LBRA 3EPMA 9RUBA 1SVDA 3VFCA 5I3IA 1XIJA 1K03A 1VH7A 3OG3A 4LBSA 5DCDA 4YYCA 1KBKA 3VIHA 3O8AA 2G3NA 1AA1B 3G6LA 3OW1A 4R33A 2UBPC 3G1HA 1RCOB 4J9JA 1VBJA 3NVTA 3H4WA 4GFIA 4FXSA 2CZDA 3APGA 2A7RA 2QJJA 5I78A 1IZCA 3QPZA 5EPDA 1AMYA 4CQ9A 4V15A 5C9XA 2YLAA 5E0KA 1W5OA 1SYTA 2GWGA 3TUUA 3FJ6A 2Y5SA 4XAGA 3UXDA 3ZM8A 2XWDA 3BLIA 4CQAA 1XDMA 4N9CA 2POTA 3M41A 2Z00A 1T40A 1IE7C 3WMLA 2NUYA 1RBOB 4JTGA 1BRLA 3VD7A 2WMHA 4GINA 4PODA 1E9LA 1K77A 3POCA 4CEXC 5HINA 4LYPA 1UD8A 3R11A 1JGMA 1WKDA 3A9IA 4AXKA 2WXDM 3V3WA 3M9YA 1GTHA 1EOKA 2QDGA 1DJXA 3E0IA 2OQYA 2QHAA 4QDMA 2Z2BA 1UQZA 5C9UA 1J2BA 4G5DA 4GD0A 4QM1A 1L6WA 3VFLA 1FH9A 4G7EB 1GKPA 4AEOA 1S1RA 3EXRA 4DUOA 1E0XA 2XVNA 2ZX5A 3C61A 3UBPC 2VM8A 4WY0B 3FHQA 4Q22A 3EKGA 1UC4A 1SMAA 2OO6A 4O50A 5CPOA 1MRAA 4NYUA 3B05A 1DJYA 1UR1A 3VXGA 2GUUA 3TFCA 2VR4A 1F7BA 4ZO9A 1J0ZA 1Y0EA 1K8XA 1XLHA 1WE5A 2FB3A 4GXPA 1QAPA 1LWJA 3GVQA 4MIMA 2XIMA 3EWDA 4J1OA 2W0UA 1WA3A 4MY1A 5EMMA 2OSXA 4LEFA 1N8WA 3BAXA 4N7QA 4UR7A 1ODUA 4NSBA 1QJWA 4A3QA 1QRQA 3RMEA 5D03A 3VDBA 2HV5A 3FA4A 1XL9A 4QBXA 4IFKB 1NAL1 4BZYA 3QSTA 4DPQA 2D2JA 3RLHA 3UG5A 3W72A 1SM9A 1DVJA 3VKCA 5BOEA 3H7UA 2WHMA 4BQ5A 2V3GA 4ZOCA 2JQXA 3SCRA 2GQ8A 3FIGA 5CLTA 1SJBA 3S3GA 4IXXA 4K2SA 3MV01 3U2OA 5DANA 2GFTA 1V6XA 1M53A 5D02A 3II1A 5A6JA 5CJNA 3N9SA 2GVLA 3W4RA 4HB7A 2DFAA 2C6QA 2LLEA 4ATDA 4UCGA 4JIHA 4A22A 2BS9A 2UZ9A 3KRZA 3OYZA 3VMNA 4L6OA 4HU4A 2J9XA 1UPMB 4PTXA 3EB4A 5BXRA 3B06A 5SWUA 1UWQA 2PDFA 4FF7A 3L4UA 1AZ2A 1BWKA 2A85A 4GWEA 1RQEA 4WLCA 3APTA 4ZTXA 1VHCA 3R25A 4HA1A 4HK5A 3WH6A 2C8NA 4XQ6A 3ARYA 2F9RA 3OYXA 3QR0A 3SCQA 5BZAA 2WWDA 3V1PA 1OVDA 1TJPA 2KZHA 1XLLA 4S3AA 3WJXA 1XLGA 2GVGA 5LNWA 1XD0A 1HKMA 1P0NA 3CTTA 1LL7A 1J0HA 1OFEA 3W6LA 5H91A 3HMCA 2KAUC 3WH5A 4B5TA 3NA8A 2Z1WA 1EDQA 4L6DA 2ACQA 2HK0A 4TX9A 3A9BA 3BLPX 2D2HA 1Q6CA 2PD9A 2CLEA 1VF8A 3FY1A 4JYDA 4Z1AA 1XC4A 3P74A 3HGOA 1UD4A 1Q2RA 3AMGA 3CEPA 2QW5A 3EA3A 3RPDA 1B31A 1ITXA 5D32A 3WDIA 3L0NA 3P0XA 4IQDA 1XYFA 3I7RA 3MKKA 1EJXC 2Y8VA 4H6QA 4W88A 2GGEA 2H9AB 1W1YA 1F3TA 4PUDA 2HEJA 5BMXA 4HCDA 3GHTA 2PWEA 4O57A 5CJ5A 1KXHA 1TCMA 1JR1A 1O12A 1ITUA 2QJNA 2O9PA 4IMAA 1VCGA 4Z2IA 3T2OA 1XIFA 2QCLA 3ITVA 3MHGA 1CB2A 2HK1A 3TMLA 3CH0A 1HFBA 1M68A 1RVKA 4LALA 4JD4A 1LLOA 3IIZA 1E71M 2BY0A 3AWOA 4HYRA 2WKJA 1WDQA 1Q66A 3NL6A 3CV2A 4H19A 2WMFA 3SIMA 2YL9A 4GC3A 1A47A 2QV4A 3LSCA 3P61A 3ANYA 4A4AA 1I6NA 3VKDA 3BAKA 4CN1A 2FFIA 1XYBA 3IIOA 3O1NA 5HWMA 3GH4A 3CPUA 3DGBA 2ZDSA 3URQA 3UWVA 3USBA 8TIMA 1SZGA 4DWSA 5H8MA 1DIKA 3PZNA 3WLKX 1NFBA 2F61A 2OOGA 2OZ3A 4DLFA 5EY5A 1VZWA 2AOSA 3PY2A 1ALDA 3W1UA 3SUVA 1LG2A 3MI6A 1BVWA 4QG8A 3P14A 5FEWA 3SN4A 4EXQA 4LV9A 4HPXA 4OOZA 4GXMA 2DVUA 1TZZA 3UR7A 1EO5A 4FPSA 3E6EA 1NELA 1G7VA 2ZZ3A 1K70A 4S3EA 5GNXA 4I8YA 4TVDA 1U22A 3KXQA 4JICA 1IEQA 4HOZA 1IGSA 1CPUA 3PAJA 3GU1A 3GXDA 2ZOXA 2FHFA 2C13A 3WN6A 3W88A 3G24A 1E51A 5IHRA 2R8WA 3HQ1A 3NXLA 2C15A 4KH2A 4U33A 2FTWA 3FS2A 1OEPA 2Z1XA 5LIKX 4ZFCA 2GJRA 3BUVA 2E9LA 2CZ5A 7ENLA 2O0TA 2NX1A 3GDKA 4ASTA 4X2RA 1B90A 2PZNA 2G37A 4S2CA 5FJIA 2ZZ2A 5F7UA 5ABGA 4YLWA 1TX0A 4E8GA 4Q33A 4JNZA 3LB0A 4ZSUA 3PNZA 3TYEA 1QK0A 2EPKX 4K39A 3BAYA 4G7EA 2I1OA 2XG9A 4E4PA 1VHNA 4Q4SA 4MPKA 7A3HA 3L5LA 4LNYA 1GQJA 2J78A 3N2MA 4WY0A 5C70A 5JIWA 1P6BA 1LT8A 4S39A 3F4WA 4GH1A 2BX7A 4E2OA 1VBRA 4HMNA 4BI5A 3QMSA 3M0MA 1WZMA 3N2XA 2VQUA 2D20A 4J3UA 2ICSA 1J6PA 1PWMA 1JD7A 4FP1A 3K5XA 1S2VA 3TSMA 5CAHA 2WZEA 2VX4A 6REQB 1CW2A 1V4YA 1XGDA 1EA9C 3BW3A 2W6RA 1UZ1A 3N9KA 2ON3A 3QHMA 3MZNA 2WHJA 3H21A 4AEEA 2W63A 5AC5A 3UWZA 4ZQOA 3GQYA 4H9XA 3C3NA 4GO8A 1OD8A 3ZJ8A 3PTKA 3IEBA 3K8KA 1EEPA 3MO7A 1WXJA 2A3AA 3GC5A 1XP3A 2J6XA 2OYKA 3CYVA 3Q45A 2QPSA 1W32A 4ZB2A 4YTRA 4CN4A 3QZAA 1Z89A 4IIDA 3W82A 1QHPA 4G1NA 4XAFA 5JU6A 4QQ3A 5JH2A 4F66A 1L6GA 4IJRA 1REQB 2O9RA 4QS5A 1KM0A 3WQ4A 1OYAA 3GNPA 1I2NA 2AMXA 1XINA 4KW2A 4RPPA 9CGTA 3BQ6A 3WLHA 4ONVA 3EDDA 2QNEA 4N4PA 3TQ0A 4S2BA 3CZJA 3SAZA 3QV9A 1DE5A 2EKGA 1P0EA 5M17A 3R1ZA 4XISA 4EPKA 4F0KA 1A5MC 3OTRA 4NY2A 5T9CE 3W7EA 2BSLA 3A13A 3N9RA 2PU1A 2BY1A 1FWCC 2FDMA 1I4NA 4GH3A 2B7QA 1HJUA 3RN6A 5CCZA 5C2XA 5LYRA 1VLWA 4UMCA 5KZ6A 3ZOAA 2CW6A 3B40A 4K1GA 4LS0A 4H7CA 1DE6A 5HK4A 3U7BA 4HZ7A 2WZIA 5A6LA 1Q6OA 3GIQA 3HG4A 3JUGA 3RCYA 3MWAA 4QE1A 1S46A 1O1ZA 3C0SA 2WOQA 3QFEA 4UTTA 1TPEA 4FXFA 5D8WA 1R47A 3U4FA 1X6LA 3EWWA 3NGFA 3XINA 4WDXA 4ZOEA 2XJ7A 2PUZA 2X40A 5ABEA 3CK5A 5DY3A 2Y8KA 1NQKA 5EGRA 3QC3A 4JFTA 4GRSA 3T2PA 5CPMA 3KVJA 4OZOA 1UMLA 2FGLA 3KZSA 5D37A 3QV8A 3EA2A 3MMWA 3OGRA 3G1DA 3GE7A 2I5QA 1GKQA 3BGGA 1UKSA 8RUCA 3KS6A 3AO0A 3NFUA 1YYAA 3WLOA 2H9AA 1I8JA 3WD1A 3AMKA 2WVSA 3GHUA 2PP3A 2QMKA 1E0WA 3NIYA 4MB3A 4INFA 1QMLA 4IQEA 1RPKA 5LNVA 1YQ2A 2O9TA 1QWKA 2QV5A 3E02A 3L5AA 2B7OA 1EWDA 1JUBA 4OBSA 1UP3A 2HDJA 3G1AA 1BFNA 4JTCA 3TIMA 4JX4A 3E2SA 4IUOA 2A3LA 1PX4A 3TFXA 1OWQA 2ZVIA 4LAUA 4DWSC 4EPBC 4BF7A 1HJQA 1OG6A 3L2MA 2NQJA 3FYPA 4WY0F 3NWRA 1LCOA 1HQTA 4D72A 3KL5A 3M7WA 1VKFA 5M03A 3KRSA 4AMCA 4IXHA 3SQSA 1KV5A 2CLOA 2GL5A 3E5PA 4MJ2A 4AX6A 4G1KA 3WIJA 3WEOA 4KWUA 2VENA 3EWXA 4IZGA 4S3GA 3CHVA 3EXTA 2NX9A 3RGTA 5C54A 3A5VA 1SZEA 4C1KA 2DH3A 2CLIA 4Y7EA 2RDXA 3RAOA 4LB3A 3W1TA 2Q3RA 3IJDA 1F07A 3ZMRA 5AHEA 3R58A 2EAWA 2CWNA 9XIAA 4CU7A 2V63A 3BWWA 3UWQA 1BKSA 1WUEA 2O7QA 1OFRA 1XIMA 1H7OA 1SZNA 2FLIA 2NXHA 1DQUA 1ZFJA 4ADSA 3DUGA 1H62A 3BARA 3N6QA 1U1HA 4P61A 2QUTA 5TBOA 1T96A 2ANUA 1W56A 4GQGA 2QGYA 3W74A 5EU9A 3ZLGA 2ZA1A 1JG9A 1QXLA 1Q6FA 5K2ZA 2QDEA 5D9OA 4KCVA 2AKZA 3B9DA 3VMOA 3OGVA 3K2GA 2R1NA 1W1A1 5DLCA 2WZTA 1QFEA 3JR2A 2UY4A 3QH2A 4IPNB 2Q8LA 4RZBA 4HK6A 1DHKA 3BOFA 4G7FA 3IGHX 4RDYA 4O14A 3KCJA 3W76A 3EXSA 3PZQA 4S3KA 1B3VA 3S5NA 5JVLA 4NKCA 3M5VA 2WB5A 2YZ5A 4XB3A 5B80A 1W5MA 4EACA 4H6KA 1BGGA 1CNVA 4M7SA 4YU1A 2B4GA 2DUZA 1TJ0A 2IKHA 4GUIA 5DCBA 3AHVA 2FH6A 1TE1A 4J3XA 3K46A 5FJRA 4YCPA 2P76A 4AZBA 1R6WA 4J3VA 5ECVA 5GJPA 2C1IA 4XZBA 5T8GA 1UH3A 1R3SA 3SSZA 3W7HA 3WLRA 2VEGA 5J5DA 3NO5A 1YXDA 4YPJA 1NVMA 2Y2WA 1PIFA 3F5JA 1CTNA 1HN1A 1QI0A 4ZA0A 1J10A 4QNEA 2PAJA 2J7BA 5DBTA 1JRCA 1GOWA 3W1MA 1Q3NA 1KBBA 1REQA 2DUAA 4CNPA 5HDRA 1TMLA 3B9EA 1QI4A 1YTKA 1RK6A 3W7NA 1UR0A 2VCAA 1ZRQA 3ZT5A 2V68A 1D3HA 4IJCA 3O6DA 3G0SA 2A3CA 1LG1A 2DZAA 5DBUA 4BWLA 4GG9A 4PCTA 1YE4A 1XICA 4OIFA 1XDLA 2OKOA 3ZSSA 4AD2A 3H70A 1VYSX 1R9XA 4Q8UA 2REQB 1UOKA 3LA4A 1WDSA 1JIBA 3GXFA 4O0QA 4LCRA 3RR4A 4M5PA 3VNKA 1JD9A 3U8GA 4LF2A 1V08A 4LEQA 3VNJA 2WJZA 1K9EA 4KCWA 1LOLA 5AVHA 5AHMA 3NSMA 2PDCA 2ADAA 4WEVX 2Z28A 3GUWA 2E6FA 2HS6A 5KINA 1Q4NX 2GGJA 1OX4B 1D8CA 3O07A 1UUQA 2XH7A 4QSHA 1YXCA 1QCWA 3APYA 2VRQA 5A5WA 4RE4A 4ZB0A 3VNZA 1UR3M 3MUAA 3PN8A 4GY1A 1AL8A 2WYSA 5L6UA 2PGWA 2OLSA 3U2ZA 4DM1A 3LRMA 5G4HC 1EF2A 1HL8A 3KCLA 4MLRA 4RZ6A 3DHDA 5M3WA 1TV4A 1MQPA 3CAVA 1I60A 3GTXA 4FF5A 3A3XA 4XBSA 2CBVA 3W86A 3GW3A 4N42A 4P8XA 5A8GA 1M6JA 2Y89A 3CWHA 4LANA 3UPMA 3GTHA 5LA1A 3AIEA 3P62A 4UQBA 1MXGA 1VLIA 3P93A 3SZ8A 2FMNA 1RXOB 3CL7A 2W66A 1U33A 4M19A 4R5EA 3LI1A 1BF6A 3R94A 4GVGA 1EX5A 3H26A 3E2QA 5I00A 1N7KA 1H50A 3AIVA 2E5DA 4LVFA 5I07A 2P3EA 2QQ6A 2WJDA 4O19A 4UB9A 4Q7BA 1QBAA 5HAOA 5CZTA 1NARA 1VFTA 1DORA 2JF7A 4BQ3A 3OODA 3RF9A 3EWBX 3WLJA 2JKEA 5A6MA 4CCDA 3BQ5A 5EB8A 4LVGA 4OE7A 3M0ZA 3AYSA 3A4XA 1G01A 1XYLA 3MCNA 2CKRA 2OQLA 4LF1A 3W7IA 1E9YB 4QRNA 3SDOA 3L7RA 4FOKA 4GIEA 3U57A 3N25A 1GVQA 1C29A 2XFWA 2PMQA 5HMFA 1Q6LA 3OZMA 2DUXA 4NU7A 2OCZA 4ROPA 3KVKA 3HV8A 4GNJA 5FAJA 5IOBA 3F2BA 4NNAA 4O28A 4HMCA 1AVAA 1F3EA 2OVLA 3C8FA 2INEA 2B7NA 3INPA 4NAEA 3UD6A 5LA0A 2Y4SA 3VD5A 3MHUA 1XRSA 2FPVA 5HWJA 2DT0A 2VNCA 4XWUA 2Q3OA 3QLLA 4NNBA 3MBFA 3PBVA 2VX6A 1PX3A 1UHVA 4JTQA 4M6QA 3QKZA 4WXYA 4N02A 5DN1A 4LAMA 1HG3A 1PBGA 3VZXA 3LM3A 1FWEC 1QHOA 1KV8A 3WQ8A 4RNIA 1B3ZA 4B2DD 1X39A 2W4XA 4C6QA 3E5BA 4RXFA 3UZZA 4IHCA 4MNJA 3SJNA 1EGMA 3R7MA 4ZBCA 3D5HA 5CG7A 1IWAA 1DWJM 1G7UA 4TO8A 4M3PA 4WJ8A 3LERA 4Q4QA 5BOOA 1T7LA 4UTJA 1E0TA 2O92A 1DIDA 4D71A 1T41A 1JAKA 4L4MA 2IPFA 3H54A 5D9MA 4LUTB 2QPUA 1VEPA 3E3HA 3ABOA 3EDJA 5C0QA 1R38A 4NASA 2X1TA 7PTDA 8A3HA 3NQFA 4I5RA 3AMDA 2A21A 1GYLA 2E9MA 3G6MA 7REQB 1CXHA 3BCDA 2VD8A 5LNRA 3PF3A 2GQ9A 2A3EA 2E0PA 5EFFA 1ESWA 3WBAA 1EA0A 2Y1HA 2IQTA 4I3GA 4AZHA 3QFWA 1VFFA 4PFHA 4CNSA 2OOFA 2C91A 3EPNA 5HXMA 4BY3A 3CMGA 4KS0A 1US3A 1XFCA 4IPJA 4N4QA 1E6XM 5FSEC 3U9IA 3VOIA 3B9AA 2YX0A 2I17A 1S2WA 2DVXA 5A8MA 4LVDA 2WW5A 3GX9A 1W3HA 3WMSA 3THCA 4WDUA 3ZLFA 2QXWA 2HZGA 4AW7A 2YZRA 2R14A 3HPFA 2NX3A 3MJYA 3KBJA 2Z1KA 3UZYA 4BWLC 1YX1A 1QWGA 2OQHA 1IZJA 3BANA 3BPWA 4J28A 3W7CA 2X42A 1AQFA 3DEQA 4YHEA 3GU9A 4JZ5A 3S9ZA 3TU9A 1JF6A 1EX1A 3UY8A 4XK2A 4YTQA 4GXWA 1NDZA 3IV8A 4J7RA 3NZPA 1A49A 3OPSA 5AKQA 2CHOA 5DMMA 2DJLA 4DAFA 2IPJA 3OLDA 4KFPA 4ZSTA 3RU8X 1JPKA 2BOFX 3COTA 4EP8C 3QQ0A 4D6EA 4S1FA 3MT1A 1F76A 2PS2A 3EAUA 2EG7A 3WQ5A 4GKTA 4W7UA 1RBLA 4QE5A 2REQA 4H2CA 4YTSA 3GTFA 2GJNA 2GSHA 3SR7A 2A6LA 4HOXA 2FDSA 1UROA 1GOXA 1B4KA 1A0EA 1PYFA 2BGSA 2JBMA 3WDHA 4Q8OA 3URNA 3A4JA 1DXEA 1XBZA 2VGFA 3WQWA 1I2OA 1VFLA 1BSIA 3T6CA 3VIFA 4V28A 2R91A 1I9CB 4REQA 5REQB 2QEZA 3A21A 4D1IA 4IX0A 3CUHA 1RD6A 3F5LA 3D3FA 3L21A 4TQTA 1LZOA 3OVPA 3R8HA 1OX4A 4PN2A 1WZLA 3BMWA 2FZBA 4HP5A 4ML4A 3EMCA 1F2JA 1X1ZA 1BWLA 2XSBA 3N1AA 3GU2A 1V7YA 2TAAA 3LCIA 2OSWA 4BA0A 1MNZA 5HR6A 3RU6A 1VS1A 4HZ8A 2WSQA 4ZXLA 1O68A 2QCHA 1TIMA 5EBUA 3FXYA 2BNJA 3FNDA 5CC5A 4HNLA 1TV7A 2Z25A 3STCA 1XV8A 4IGMA 2XHYA 3WLPA 3KS5A 1QNQA 5IM51 5LXEA 5HJXA 3F4CA 3LRLA 2O56A 3WG6A 1LL6A 5A2AA 4Z0SA 2YW4A 2WKGA 1UD5A 4UXDA 4QCEA 3CIVA 1P4CA 4IP5A 1F3WA 4OBTA 3GG0A 3DBNA 4FA3A 3P81A 4ICMA 4EXAA 1T5AA 4B4HA 2WCAA 1FCBA 3AU2A 1MZHA 3LV6A 4Q8TA 4HGXA 3W6YA 1M7XA 1JDEA 1UKPA 1GZGA 5ENLA 5DFAA 1IWBA 1SO6A 2V5JA 4L4LA 2XPKA 4Z08A 2VKZG 4HCHA 4UMAA 3VZYA 3W2LA 1TPFA 3TQKA