3QY8A

Crystal structures of ywqe from bacillus subtilis and cpsb from streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
243
structure length
243
Chain Sequence
MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVASDLVIAYGAEIYYTPDVLDKLEKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVMDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase CpsB
publication title Crystal structures of YwqE from Bacillus subtilis and CpsB from Streptococcus pneumoniae, unique metal-dependent tyrosine phosphatases.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 90
structure length 243
sequence length 243
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3qy8A00
4GX8A 3F4DA 5HMEA 1O5RA 3E0FA 4NG3A 3LU2A 2E1WA 1J5SA 2FVKA 1P6CA 1XGEA 4NI8A 3URNA 3FEQA 1QW7A 4CQBA 2PLMA 4XAZA 1FWBC 2HBXA 3S2LA 3K4WA 1ADDA 4RDYA 1ITUA 2PAJA 1NDWA 4PCNA 4CQCA 2QPXA 3MDWA 4LAKA 3B0YA 3WZ0E 2OQLA 2QS8A 2OOFA 4DIAA 3CS2A 1ONWA 1RAKA 1R9XA 3E38A 3ISIX 4KETA 1NDYA 1POJA 2O4QA 1FWAC 3GTXA 4KIRA 4DZIA 4R85A 2Z28A 1J6PA 4G7EB 4GK8A 1NDZA 3LSBA 4HK7A 2YXOA 1PSCA 3E74A 1UBPC 3GU2A 1HZYA 3WYZA 3B0XA 1A5LC 4GY7A 3PANA 3IARA 4PE8A 3QGKC 3T8LA 4C6LA 2HQAA 1NDVA 2Z26A 2DVTA 4QROA 4I6VA 4GXWA 1PTAA 4HJWA 1XWYA 1QXLA 2UZ9A 4C6BA 2AQVA 4BY3A 4J2MA 4IF2A 4GYFA 3UBPC 1A5OC 4GX9A 1O12A 1EJVC 2R1LA 1I0BA 4G7EA 4JOMA 3IACA 2VUNA 4UBPC 4XAFA 2GWNA 4CNSA 2OB3A 4DI9A 3ITCA 5CH9A 4C6EA 1RJPA 2VR2A 4OFCA 4H9TA 3C86A 2PGRA 1V51A 3A3XA 3E2VA 4GY1A 3GG7A 4EPDC 4ERGA 2R1PA 3ORWA 2FTYA 1KRMA 5G4HC 1K1DA 3AUOA 4C6JA 2P50A 3GU9A 3RN6A 1PB0A 2Q01A 3CAKA 4PCPA 1YMYA 3LA4A 4KESA 1FWDC 4LCSA 1KRCC 1WXYA 4P5UA 3OVGA 4HK5A 4IFOA 4DI8A 4DLMA 2KAUC 4C5ZA 3IRSA 3RHGA 2Z29A 4B90A 2Z27A 3SFWA 3TN4A 1ONXA 2EG8A 3QGAC 3TNBA 1UIPA 3E0LA 1RA0A 2BGNE 3BE7A 3IV8A 2EG6A 2RAGA 2W9MA 4C6KA 4LALA 1M65A 1FWHC 3TN3A 1UMLA 1M7JA 1JGMA 4C6OA 4HA0A 4DZHA 1EZ2A 1KCXA 2UBPC 4R7WA 4CNUA 4V1YA 3IJ6A 4Z42C 1EF2A 4WVXA 4IFRA 5AKQA 4V1XA 2BB0A 4EPBC 3ID7A 3GIPA 5FSEC 3LY0A 2Z4GA 3K5XA 1NFGA 1YBQB 1A4MA 4LAOA 1GKRA 1YIXA 4C60A 3MSRA 4RDZA 1ITQA 3MVTA 4LAMA 1DPMA 4CEXC 2OGJA 1EJTC 1XRFA 4PBFA 2Z2AA 3T81A 1P6BA 3QY7A 4GBDA 1A5KC 2D2HA 2YB1A 2R1MA 3EWDA 2AQOA 3GIQA 3GRIA 2XIOA 4QTGA 3OQEA 4HK6A 2QT3A 3JZEA 1EJXC 4IGNA 1I0DA 4YIWA 1WXZA 5HMDA 3GTIA 3OOQA 2DVXA 4KEVA 3MTWA 4J5NA 1YBQA 3V7PA 3UR5A 1J79A 2HNHA 4CNTA 3WMLA 4H9YA 4WGXA 4J35A 2ZC1A 3TN5A 4AQLA 1RK5A 3NQBA 4I6KA 3MPGA 2IMRA 1GKPA 4F0LA 2GWGA 3LGDA 1KRBC 4ICMA 1FWJC 2G3FA 3A3WA 4EPEC 1GKQA 3MJMA 4ERIA 4ERAA 2PUZA 1P1MA 3S2JA 2WJDA 2YB4A 3O7UA 1R9ZA 4C6CA 3OJGA 4XD5A 4H01A 4LFYA 1FWEC 1YNYA 2ANUA 3MDUA 2D2GA 3F2BA 2Y1HA 1A5NC 3UR2A 4C6FA 2EG7A 4QRNA 4GC3A 1RJRA 2YZ5A 3HPAA 4DNMA 4KERA 3R0DA 3DUGA 3RYSA 3FDKA 3CJPA 4H9VA 5E5CA 4LEFA 4C6DA 1PO9A 1YRRA 2WJFA 4LCRA 3S2NA 1EJWC 1A4LA 2WJEA 4WHBA 1EYWA 4DLFA 4E3TA 3N2CA 4H9UA 3PNUA 3T1GA 3PBMA 4GZ7A 4UB9A 4H9MA 2O4MA 4C6IA 1FKWA 3QY6A 2D2JA 2WM1A 3IPWA 4QSFA 3D6NA 4KEUA 4BJHA 3LSCA 2PGFA 4QS6A 1A5MC 3A4JA 4GOAA 3MVIA 1ZZMA 3KM8A 3URBA 3HTWA 4R88A 3AU2A 2VC5A 1V4YA 4C65A 4B92A 4CQDA 2VC7A 4BKNA 4IH3A 4IGMA 4RDWA 3UF9A 3EWCA 3S2MA 2FTWA 4XD4A 1XRTA 1J6OA 5LXXA 4CEUC 4XAYA 4MUPA 3PNZA 2GZXA 4F0RA 2I9UA 3LS9A 4M51A 2HBVA 5HMFA 4LANA 3F4CA 1V79A 4AC7C 1V7AA 4G2DA 3DCPA 1FKXA 3AU6A 3HM7A 2HPMA 3LNPA 4DO7A 1FWCC 3OODA 1FWGC 4L9XA 4B91A 3ICJA 2HPIA 4LCQA 3UPMA 2F6KA 1RA5A 4XD3A 4D8LA 2R1KA 3TN6A 2GOKA 4XAGA 2E25A 4PBEA 3GTHA 4IQJA 1K6WA 4DYKA 4XD6A 1BF6A 3GUWA 3DC8A 3RCMA 1E9ZB 2DVUA 2ADAA 4IG2B 4KQNA 4KF1A 1RJQA 4H00A 4IFKB 4EPKA 4ZSUA 4RDVA 3K2GA 4C6MA 3F2DA 3OU8A 2ICSA 4F0SA 1EJSC 4NP7A 5FSDC 3PAOA 4L6DA 3B40A 2CZVA 3E3HA 3O0FA 2VM8A 4RE0A 2R1NA 3LGGA 3URQA 4H9ZA 3S4TA 4QS5A 2Q09A 1POKA 2Z00A 4H9XA 4C6NA 1FWFC 3QY8A 4ZSTA 4C5YA 3G77A 1EJRC 3URAA 1R9YA 2OODA 2GSEA 4EP8C 1VFLA 1KRAC 1EJUC 4C6PA 2Z24A 1W1IE 4TQTA 2Z25A 3EGJA 3NURA 2AMXA 4IG2A 2A3LA 4GY0A 2Z7GA 1UIOA 1V77A 3NEHA 1RK6A 3FDGA 4IFKA 3F2CA 1IE7C 4INFA 4RZBA 1M68A 4B3ZA 2QVNA 3SO7A 3IGHX 1E9YB 2P53A 4KEZA 1K70A 3GU1A 3MKVA 2VHLA 1FWIC 4C6QA 1S3TC 2FFIA 2I5GA 4LH8A 2Z2BA 3GTFA 5A6TC 2FVMA
chains in the Genus database with same CATH superfamily
4GX8A 3SURA 4UTWA 1BTCA 1TPC1 4JDBA 2TPSA 3CIWA 5DY2A 1EC9A 1QI5A 1VRDA 5AHEA 4HMDA 3M4HA 4HZMA 1ADDA 2Y0FA 4L7ZA 4R34A 1NDWA 3MUXA 4E8GA 3MDWA 4GYKA 1A50A 1GPWA 4ACYA 2DSWA 2OOFA 4AFYA 4ZTYA 3GB6A 2OWCA 1HJVA 4CQ9A 1V6YA 4H04A 3E74A 1P1XA 1MI3A 3EOOA 2AAAA 3SY8A 1LG2A 1OABA 4MY1A 1I60A 1DIEA 1XYMA 3AS0A 2PWDA 6ENLA 4GI4A 1G67A 4RL3A 1XHGA 3PPFA 4XBKA 2VZSA 4DUXA 5EMJA 4D2JA 2D23A 4QHRA 3B9NA 4JOMA 3W2KA 4Z2IA 3TTQA 3RX2A 3QZ6A 2BMBA 1MO0A 1RY8A 3LBOA 4Z2GA 1OIFA 2J13A 3CH9A 3NO1A 5HXMA 3MHUA 1OF8A 3W82A 2E6YA 1YPXA 3ONCA 2DEPA 5G4HC 5H8PA 2A2IA 2AKMA 4IPLA 1OFRA 4KGJA 5A3HA 4BQ4A 3DGBA 5BXPA 2HRWA 3LBCA 4DBWA 5K4ZA 4YHEA 1E6ZA 2IKJA 1C8YA 2D0GA 3I4EA 3S47A 1PX3A 1J0HA 1RBLA 2HCVA 5B80A 2V3GA 3E6EA 1ZNNA 4DJED 4F4RA 4Y2WA 2WK2A 4ONVA 2FZMA 2XN1A 3I65A 4WXZA 1TMHA 4AIEA 4XIMA 5A6JA 4M1RA 3KX6A 1Q63A 2GGIA 3V1HA 3PPGA 2BGNE 4JTRA 5AZ1A 2RAGA 1GOMA 3WLLA 4M56A 1BXNA 4PYSA 1C8QA 4CLMA 1UMLA 1LM1A 1JZ5A 3PB0A 1BSIA 4E6MA 4JQAA 1GEQA 4FNQA 1V0MA 3WLJA 3NVTA 2XGIA 4IFRA 1EBGA 5AZ0A 1I1XA 1G0CA 2C15A 4RLIA 3EMZA 5FSEC 1ZS2A 2Z4GA 3LY0A 3PR2A 3MI6A 4IJBA 1Q7ZA 1YIXA 4ATDA 4YVPA 5CBIA 1DPMA 2OQYA 4C1NA 2PODA 2V3FA 2X0YA 1GGOA 4ASTA 3T8QA 5A8GA 4UR8A 1XLFA 5F4WA 3LUTA 3MI3A 3N4FA 5EMUA 1X39A 1MDLA 4L6HA 1PX4A 4UNKA 1TA3B 4S3DA 1QCWA 1EZWA 5HMDA 3EEZA 1GG0A 2C8NA 2NQJA 1TE1A 3WLKX 1OT1A 1V3JA 1B54A 3T2PA 1YDNA 1GOIA 1XYBA 3G1SA 2GPTA 4GABA 3VK5A 5DCEA 1HKVA 2EBNA 3A3WA 3QC3A 1ITXA 1R38A 2ZZ6A 1EQPA 4IIBA 4PUUA 1FY6A 3HGRA 2JKAA 4PR4A 3IUDA 4QQ3A 2HROA 2QNEA 1AW2A 1W1B1 3SUUA 3P8IA 1YEYA 5HOSA 4JIEA 3P0XA 2YW4A 5JUVA 1I2OA 1A5NC 3V3WA 1CTNA 1XG3A 4JTDA 3QKZA 1Z3NA 1J18A 2ZUNA 4LQ1A 1HL2A 3P62A 4GJJA 3DYMA 1FDJA 3CL8A 4XKMA 1W9VA 3RYSA 5ECUA 1OCJA 5LNRA 4LB4A 4OUIA 1WAWA 2E5CA 5M3WA 1MFVA 3RCYA 1AD4A 1BSLA 3CQIA 1UJQA 4WKFA 3TYEA 4Q8PA 1W8SA 4S2CA 2OEMA 2QHAA 2CEQA 1UUQA 3ZR4A 3EB3A 9RUBA 3KAOA 1SFJA 1HXJA 4P8WA 1XH0A 3PM6A 3NAVA 3LCWA 2Y8VA 4DPPA 4LVFA 4JZ5A 4GVFA 3W7JA 4ZQOA 1EO5A 4JTQA 4IZGA 5C6MA 2TAAA 1GQIA 3NQDA 4GPNA 3TCSA 1J5TA 4D6HA 2DZWA 3T0TA 7REQB 3UG3A 1OQFA 1VGAA 2E1DA 1V4YA 2VDHA 3BAIA 4C65A 4MY9A 3CWNA 1YXDA 1ZPTA 2OWXA 4IMCA 4BI7A 4XZNX 1F8IA 4MNKA 5KSWA 1NWRA 2E67A 1US3A 4HMCA 3TLQA 1EX1A 1QHPA 4QGCA 3PFMA 2DGAA 4NY2A 6XIMA 3M0MA 1EUAA 3BOFA 4HYWA 2ZC8A 4IPPA 4JIPA 5E0KA 3UW6A 2HPMA 4HHHA 1FWGC 2NW0A 1TV8A 2HPIA 1YPIA 1F6YA 4UTUA 2QV5A 3DFNA 5I00A 4PTNA 3ZT5A 2X1RA 1E5NA 3OIHA 1E9ZB 4MJMA 3MV01 2DVUA 2ADAA 4E2DA 1QUMA 4PMQA 4A2RA 2Y5EA 1HKMA 3UNTA 4BQ2A 4P8UA 1PYFA 4AB4A 4NP7A 2BWGA 3WQOA 3OO2A 5AECA 3XINA 1ICSA 5D37A 2FJKA 5FA5A 3U6WA 3OVPA 1B2YA 3GAYA 3HA1A 1VFLA 3ARQA 1JFHA 4GMEA 3PZVA 4Q4QA 1TZZA 1MUCA 1F3TA 4AHPA 4A21A 3VCNA 4UQDA 5HJXA 4ZR8A 5MKGA 1CGWA 1UWQA 4Y9MA 1H0IA 3MV11 3UVIA 4UCGA 1R30A 1MYRA 3IIOA 1WDPA 3V0UA 4ACZA 3RJYA 3L23A 1UB3A 3M6DA 1YYAA 4F8XA 4UTWC 1R87A 2FVKA 5FF7A 4L1GA 2RDXA 1A3XA 5HBFA 1UWTA 2WVVB 1JZ3A 3K4WA 3ARTA 1CDGA 2P76A 2PWFA 5HQMA 2EO7A 4AD4A 4TXEA 2WSQA 1XBXA 1ONWA 1AFSA 3GXNA 1POJA 4MSSA 3KTXA 3W07A 1OFDA 3W6LA 3IVTA 1J96A 3VUSA 4DJDD 3LSBA 1RSCA 2YDSA 1QNSA 4Y9NA 3RLHA 3VGBA 4WCJA 1L0PA 2PDGA 5AOUA 2PWGA 4JTHA 4QROA 1E0XA 3KS5A 3FS2A 2I57A 3O06A 4TTGA 3N73A 2UZ9A 1D8WA 1K03A 4J2MA 3CWOX 4FSAA 2VURA 3CMJA 1A5OC 4YTRA 3SCTA 3ABOA 1CLXA 3GNOA 5A6AA 1F3WA 4O11A 3JW7A 1R3TA 4U2ZA 4HOZA 1R0MA 2PI6A 4KCVA 4WJEA 1NH6A 3FKKA 1UOZA 1UH2A 4WEVX 4C90A 1AZ2A 3SCRA 1Y5WA 1IXNA 1UR9A 4FEZA 4H9TA 4JY9A 1I8JA 3K1DA 5CBBA 1R2SA 1V3LA 1XI3A 2GVYA 1SFTA 5FJRA 1YDOA 3W2NA 1IZKA 1FXQA 4WX2A 3R43A 1CI1A 2QCDA 4U5IA 1EP1A 1KXVA 4IFOA 4O12A 3LD5A 3ABZA 2OYKA 3OG2A 1GCYA 5A8QA 4D8ZA 1U30A 3QOKA 2Z27A 3BC9A 3QXBA 1HW6A 1TWIA 4POCA 2PP3A 4KS0A 1XQKA 2FPTA 2C14A 3H7VA 4GUGA 2MNRA 2E09A 3K4AA 4IP4A 4Q4SA 1TWWA 4UNLA 1V02A 1CLVA 4FX7A 2F9RA 2QKFA 3VIJA 1RR2A 4FOUA 2PLCA 2AL2A 5AKQA 3T2OA 5HDRA 4QG8A 1YTEA 2QF7A 2ZX6A 1PDYA 2V8ZA 2QCMA 2CHOA 2AQWA 4MOZA 1R3VA 4AWSA 1ML1A 3N17A 1NWSA 3LNMA 2PRHA 2QAPA 5A6MA 2D2HA 2P3ZA 2YBTA 2QXWA 4K68A 4QXIA 5DMMA 2RDWA 4M3PA 3H2EA 1P43A 4FOJA 1SO6A 2I9EA 3S6OA 2OYMA 1P0NA 3LCXA 1B5TA 1SW0A 2G41A 4L4LA 5E6ZA 2ZC1A 2OO0A 2OKTA 2J88A 5DXYA 4KIEA 3R1ZA 4PSPA 2HSAA 3TSMA 3W38A 1H3GA 2PUZA 3AALA 5FIPA 1TPH1 3HG4A 4C6CA 3UWVA 1E1FA 3OJGA 4LTSA 4DPQA 3XISA 4AIOA 2ZX7A 1UWSA 4LFYA 3UY8A 2Y1HA 3ARSA 3M47A 1VEPA 4GZIA 4JTIA 4KERA 4REQB 4H3DA 3S5OA 1TR9A 3FDKA 3CJPA 1D8CA 2FGLA 1LOQA 4JIQA 3KHJA 4HSOA 3N2BA 3PFRA 4NQ1A 3W7GA 2GGJA 2GGHA 3I6RA 3R6IA 4Q8UA 3CUJA 4DF1A 3W70A 4E3TA 3TYAA 5FJJA 1VFTA 2QMJA 2JQXA 1XLIA 9XIMA 1PJ9A 3VCCA 3GDLA 4E38A 4YMZA 3D6NA 1SZEA 4W87A 4LVBA 2ISFA 4DEFA 4QS6A 4ZTXA 2ZRXA 5A5WA 2DSZA 1YTDA 4NZ1A 3BAWA 2DSKA 1G5AA 3BV4A 4NILA 4HU4A 3L0NA 1LQ2A 3I4KA 3AS2A 4L4MA 4PC8A 4PCFA 1GOXA 2IXUA 3GG0A 3DHFA 1OFAA 4Z1DA 5JMUA 1O95A 5ABTA 2A3CA 4PMVA 1Q7MA 2I5QA 2POTA 3RG6A 3G3MA 4MUZA 4LANA 3WJXA 3FXGA 3QLDA 4PUMA 3C8NA 1OFOA 2O9RA 3B04A 2WMIB 3OODA 3UPMA 3R7MA 3EDDA 1W3NA 4C7FA 4IQJA 3STPA 3FAXA 4P2VA 3AICA 4DYKA 4R7OA 1BYBA 4GFIA 1PCKA 2VMFA 1XPYA 1XJBA 1CGTA 2HWGA 3G24A 4U10A 4JX4A 2VZUA 2BXZA 3PSWA 3II1A 4JQ1A 3IJ9A 5D9MA 1HP4A 2QULA 2WMFA 4HPXA 1QNOA 1MXGA 4NIRA 3A12A 5F1VA 1SO3A 4B5XA 2Z0IA 4H9XA 1ZP3A 4C5YA 3MMTA 4UTHA 4XG1A 4JQ2A 3GVRA 1RCXB 3W1QA 1QPOA 3MUZ1 3QMSA 3VI2A 5CBJA 2YDAA 4X3ZA 2HE5A 2WQDA 2J77A 3GZAA 1M04A 2V3EA 1ZRQA 1OGGA 1RK6A 1NM9A 2G4JA 2NT1A 1H49A 4FIQA 4MZYA 1QI3A 3QPYA 1SO5A 2W91A 3LDVA 3E5PA 3GU1A 4XZBA 3WEZA 1TJPA 4HIBA 3PZOA 3N2OA 2ISWA 3BH4A 1F9CA 1XBVA 3FCPA 3GTFA 3VPLA 1EKOA 1XSIA 2J9XA 4P7OA 4CCDA 3NXFA 2PDYA 4RNHA 4P7NA 1XD0A 4NXSA 4O4VA 2Z6JA 1OGBA 4HU3A 4EAMA 3GFYA 2OQLA 4MMWA 2ZRZA 4CD4A 4OQVA 5A8OA 1IR2A 2AL1A 5CZ0A 4OIFA 8TIMA 1F8MA 2DH2A 1WE5A 4R85A 3N3TA 3WMCA 3SY1A 1XD1A 3V5OA 3NIYA 3ZSTA 1W9XA 2GYIA 2J6VA 3W7OA 1OCQA 3QGKC 2CBVA 2PWEA 2GDQA 4RR4A 1VH7A 4WQ6A 3WLNA 1LWIA 2JBMA 2PU0A 4Z0JA 4H7ZA 2ZUWA 3OBAA 1NELA 4MPQA 4AG0A 1RY0A 2FDMA 5K3VA 4S3JA 3MQTA 3JZUA 2Y85A 2FHBA 3PTMA 3HQNA 3WUGA 2ZRUA 4ZGYA 3SSJA 4YWIA 5BRBA 4O15A 5A69A 1TCMA 3I7RA 5D9NA 1UWAA 4O28A 1CGVA 2DY3A 4DJFD 4AZIA 2OLAA 3A3XA 2QV4A 4MWAA 4W7UA 1KLYA 5D03A 1LT8A 4MTVA 1SW3A 3SADA 5BCAA 2VRKA 1MDRA 4BS0A 3Q67A 5D02A 2BP1A 4AXKA 2DZTA 3C2YA 1W0MA 4V15A 2Z1XA 2QYGA 3O07A 5B7ZA 1S2WA 3W3OA 1LUCB 1VLIA 1E6SM 4DAIA 6REQB 5LIXX 4B90A 3UZ5A 2IQDA 2DQXA 3H7RA 4OHQA 1XX1A 3W88A 4CD7A 1KFBA 4GQGA 3H4GA 4MF4A 4QAWA 5D30A 2YZRA 2W9MA 4ZFMA 4HJFA 3KTCA 4IJCA 4GQRA 2DU2A 3B0UX 2WV8A 1O60A 3DOPA 2OFJA 2ZICA 1TPEA 4V1YA 2WZMA 1TKKA 2ZRVA 1IEQA 1EF2A 5JXQA 2AGTA 2PGWA 3GTNA 3GHUA 4E4PA 1VFHA 1NFGA 4S23A 4RPPA 4RZ4A 3WD3A 3MSRA 1C9WA 1HP5A 2CKSA 1VD6A 3IJDA 1PE1A 4KWWA 2JIWA 3E0IA 1GWJA 4S3CA 3UFYA 4U2YA 5FJOA 3GIQA 3NFUA 3IVSA 1XBYA 3IIPA 4IIFA 1E3XA 3L21A 4HN8A 3TYDA 3SGUA 3GUGA 3KHDA 4FR1A 4HK6A 1DTUA 2WCAA 4WDUA 4AD3A 4YIWA 3AFBA 3L7RA 2X7VA 2WC7A 1Q7QA 1X96A 1ODZA 4B4FA 1UP2A 1P0BA 4AC1X 2VWTA 5C9XA 3PUDA 1JZ4A 3T78A 2ZCGA 3W1RA 2GWGA 4L1WA 5GPRA 1GG1A 3N6JA 1ESWA 1U22A 3PUEA 3UG5A 3ARZA 3P5ZA 1VJIA 2FZDA 2ISSA 3RK8A 2XG9A 4QG9A 4EWJA 3L4TA 5M2FX 4HA1A 5A8NA 2EG7A 1EDTA 2W92A 2YZ5A 1GYNA 1VFOA 2YL6A 3GFXA 4YTQA 3PZUA 5CZSA 1E6PA 3NDYA 1A47A 4I9MA 2GJXA 3UJ2A 2P0OA 4QNEA 3SIMA 3TW6A 4N02A 2VEPA 3CYVA 3PNUA 3WQFA 1SM9A 3LERA 2HK1A 4AXNA 5LXEA 1O1ZA 4H6QA 3KZPA 3ES8A 1XYCA 4Y9AA 3S83A 2QCFA 3GVQA 3PTDA 4W5ZA 3MANA 2PGFA 3K13A 1R3RA 4Q4KA 3A4JA 2VI0A 3K46A 1GVYA 3LG3A 7CGTA 3HPSA 3QKEA 3H2AA 4UTLA 3LQLA 1TUFA 4B92A 3WL0A 1JNDA 3OPSA 4MAZA 2Y7GA 1DXEA 3QYSA 2CW6A 4NX5A 4M51A 2A6LA 5J04A 1CXKA 1K7XA 3STEA 3C0QA 5HULA 4LYRA 1WZLA 1FH9A 1Q8AA 4MGGA 4B91A 1FOBA 4S38A 3G3DA 1RA5A 1LT7A 2JGYA 3B4UA 2GOKA 2VRQA 5A8PA 3GTHA 4FLSA 1BF6A 2X2YA 3L4WA 4Q8VA 3A4AA 1AQHA 6PTDA 2XFYA 5CC7A 3N6HA 2H6RA 2IKHA 4KRTA 1QBBA 4RDVA 2QCEA 1R47A 3UPBA 4TTUA 4XO6A 3LHYA 3RILA 1KCZA 4G1KA 3VDCA 4EAYA 4QDPA 4WSKA 3L68A 1BF2A 1DHKA 2GOUA 1H1YA 2Z00A 2EQDA 4AD0A 4LC8A 1YNPA 3URAA 4J1OA 2H90A 3A47A 1VHCA 3THAA 1XICA 5ECVA 3ABXA 1W1IE 4AF0B 3MUAA 4GY0A 2C79A 3EX6A 3FDGA 1YHTA 1OBAA 2Z1BA 1HN1A 2XTKA 1EBHA 1WPCA 3L5LA 3I68A 4KEZA 3J7HA 1M9HA 4ZBCA 5E09A 3N2TA 3VABA 5AHNA 4C6QA 3WJSA 1J0JA 3QSRA 4NZ5A 3CAVA 3EAUA 1OADA 3LPGA 3FEQA 1QW7A 4GBUA 1H7PA 2PLJA 2J9YA 5I3FA 1QK2A 4FA3A 4LYKA 4CQCA 4H6EA 1IGWA 1XIMA 2QS8A 3LCGA 1VBRA 1MW2A 3B8IA 4JKMA 2ZUTA 2O4QA 1QPRA 4HQVA 4XUYA 1N8IA 2VGIA 1FWAC 3S46A 4JXCA 5FI8A 5AYIA 3BMXA 1JR1A 2QCLA 2WHKA 2XFFA 5C8BB 1J6PA 3RAOA 3QTGA 2VC9A 2J6XA 1PSCA 5DRCA 1WKYA 5I24A 1HF6A 1A5LC 2OXNA 3GDKA 3SN0A 3WDIA 3SM0A 4PUKA 1Q13A 1NWUA 1U1JA 1TWDA 2YCLA 2QCNA 3AYRA 3KL5A 3DYOA 5TNVA 3NDOA 1DIDA 4BY3A 3EXSA 2G0WA 4QAIA 4EE9A 5CPSA 2J8GA 3W85A 4QLLA 1NSJA 4XZHA 2D1ZA 1QNVA 3IACA 5LIKX 4PTVA 1OX4A 4I9JA 3WFAA 1XLMA 1RALA 1VFFA 4RNFA 4FNTA 1R5YA 4HPHA 4OFCA 3C86A 3E2VA 4MWAC 3QV7A 3DHPA 3PTKA 3RRAA 3TTEA 2CLMA 3WNLA 1XDJA 1TR1A 1GZJA 2P50A 3B9OA 3N2XA 4XVEA 3MUY1 1PPIA 3B8UA 3KRZA 1QNQA 2Y8KA 8CGTA 2CKRA 1KR1A 2J47A 1OC6A 3STCA 3WEMA 4Z2HA 3APTA 4UQ9A 3GNNA 3U5UA 4CKQA 1SU5A 4WD0A 3DFOA 4F66A 1QOPA 3TW7A 1QI4A 2DZBA 3SUSA 4LX4A 4B4HA 1I9CB 4U28A 1W5MA 4LRSA 1H09A 2FJUB 2ZRWA 1U5JA 5A94A 2Y88A 1FX6A 3MCMA 1FWHC 1PAMA 2FGBA 4JL1A 2O0TA 3EX1A 3QSTA 4HA0A 3UG8A 5DQPA 1I45A 3QW3A 1ZFJA 5LSMA 3TKFA 2H3BA 5REQB 1MNSA 1Q5MA 1H7OA 3THDA 1YBQB 3WK3A 1ZP4A 2XPKA 1N8FA 4D6JA 2F2HA 2QGYA 4GO9A 1LORA 3FSTA 2OGJA 1OYBA 1XGZA 1REQB 2VFEA 1OD8A 4L4OA 1SFSA 4O52A 1A5UA 3OQEA 2PDIA 2ISVA 4AZCB 3TTSA 2V67A 3GTIA 3V35A 1XIIA 3UERA 2XM2A 3D47A 3NGJA 3FNDA 3V7PA 4N9DA 2R6OA 1J79A 1SUXA 2INFA 4H9YA 4JYEA 2E6DA 3OA3A 3UVAA 4LBUA 2P0IA 2OZ0A 2AOSA 3LV5A 1QASA 4F0LA 3LGDA 2OLSA 4QLKA 2G3FA 1GKQA 1SZFA 5HNNA 5A6KA 3IAPA 4I5XA 4JTFA 3ZXWA 2PRLA 5CAHA 4DWSC 5FF4A 1FWEC 3OYZA 4K3ZA 3NL5A 5CSUA 2C1IA 1DBTA 2OMAA 3W7NA 3H2CA 1M5WA 4IL2A 1AVAA 4LEFA 2QDDA 5CPOA 3VC6A 1WDRA 5A95A 4UOQA 1QOQA 4IP5A 1EYWA 2PF8A 1HL9A 3TW9A 1RD5A 3GBDA 1JDAA 4A3YA 4PRTA 1SYTA 3DYPA 3W2UA 5G2IA 3SY5A 3L2MA 2VKZG 5HPCA 1S2TA 3ONBA 5J5RA 2E6AA 4OOZA 2E9MA 3KUMA 8XIMA 3EX3A 2WO5A 4RK8A 5BRPA 1NTHA 4TO8A 3A9IA 4C7GA 3W7KA 3UXIA 4B16A 3UXDA 4XK2A 5F2GA 4RNJA 3LHVA 4UZUA 4DBDA 1J6OA 2WVSA 4WLCA 4NRSA 2XIJA 1E70M 4R7JA 7TAAA 1SZGA 1AODA 3W81A 3RGTA 3ERPA 2ABAA 3LNPA 4L9XA 3ICJA 1QOXA 3WDJA 4CQ8A 4D8LA 3GH7A 3SQMA 3TX9A 3KBVA 4PBEA 3HU7A 4M8UA 3R89A 1CXLA 4NAEB 4LUTB 3RR4A 4BF9A 2JGQA 4Y9OA 3WLIA 2VQUA 2P5NA 4OZOA 1W3LA 4A29A 2G50A 1UQZA 4HHMA 2QCHA 3PUGA 4MB3A 3W7HA 5BXRA 1W3KA 1LLZA 3W7MA 4C6NA 5KZMA 1DKWA 3CZLA 1H5YA 1JUEA 3W71A 3O05A 2GSEA 5A6BD 4WOZA 3WKZA 2Z24A 3O8AA 1XXXA 2Z25A 4R33A 3CT2A 5CEWA 1R2RA 2MUCA 2BVDA 2C3ZA 3GZ3A 2V38A 4CU7A 4YJ5A 1K7EA 1PCWA 3KBMA 4HA3A 1J0ZA 2WCGA 3GDTA 5FEWA 3USZA 4JN8A 4GIAA 3VZYA 2FFCA 1UBSA 4N4PA 4CCEA 1GOQA 4NZCA 1FWIC 4ZOEA 4IPJA 1LDCA 1X6NA 1W9PA 3WEOA 4ML9A 2VEMA 3WBXA 4AYSA 5A6TC 4AZGA 2J7HA 5EFFA 1KWGA 3M0ZA 3DFTA 1PHQA 2PBGA 1SJDA 4D71A 3VIPA 3H2OA 2GSHA 4FB7A 3AYTA 3EXTA 4ZE4A 4QIUA 4PA8A 1Q6FA 1BKSA 1FWBC 1W2VA 4UCFA 4Q8TA 1KFLA 4PCNA 3FW6A 1QO2A 3BCFA 4LGXA 3CS2A 3E38A 1NDYA 4M7TA 1QTWA 2EPOA 4ZO7A 3KOXA 3ZLFA 2OO6A 3TV8A 1YQ2A 4IIHA 1ZB5A 4HSHA 1A5CA 3B0XA 1JPIA 3SEPA 1U33A 5DMYA 1WOAA 4MYAA 1EOKA 5HWNA 2YGYA 2WC4A 3AXIA 2QCCA 3STFA 3PUOA 2O92A 2DUAA 4D6CA 4GXWA 2GDUA 2VR4A 4KCTA 3ZJ8A 4QR6A 1S5VA 2PF0A 4AD2A 1LL7A 3DEQA 1ZAJA 4B3KA 2CZFA 2G95A 4LBSA 1O12A 2BS9A 4KKXA 2V69A 1JCJA 3FGCA 1MQRA 5LNUA 3M5VA 2YA2A 4RV8A 4PMRA 1EWEA 4PRWA 5A8MA 4L9YA 1JRBA 4YCOA 2V5KA 3QFWA 3STGA 1DJXA 1EFZA 2JE8A 3GG7A 2DT0A 4GJIA 1BWVA 1UWRA 1PTGA 1Z42A 1K1DA 3BICA 4WDTA 2CESA 4Q8NA 3TUUA 2QW5A 1PEZA 1PB0A 2ABBA 4DJEA 4LCSA 2O7SA 3RO8A 2A7NA 1ONRA 2TMDA 3Q45A 1Y7VA 2KAUC 3RIKA 3IRSA 2CLLA 1PTDA 1PBGA 3CTTA 2QGHA 3TNBA 3ARWA 5C9UA 2ALRA 1UC4A 3EWUA 4XZMX 5IDZA 3CB3A 1NY1A 3ZQ9A 1KTBA 2EPHA 1R3SA 4J3WA 2WOQA 4QE5A 4J3TA 4B5SA 1GVQA 4O17A 1EZ2A 1HQTA 1WUEA 3GKFA 1DWAM 5JIWA 1VLWA 2Y70A 2C13A 2CZ5A 3PB2A 4EPBC 2GUBA 3SCNA 3H2FA 3VOCA 5FJUA 2GJLA 3M64A 3LCFA 5FL1A 2PFHA 4C60A 4NJGA 4HTYA 4F3HA 1VC4A 3W25A 3FXYA 5I0DA 2RJGA 1P6BA 4AD1A 4GBDA 1SGJA 1LTDA 2DZUA 2R1MA 3OVQA 2WWDA 3GNDA 3RMEA 2Z7KA 3JZEA 1KBLA 2XJ7A 3B97A 4TV6A 1JCMP 3VKCA 5FL0A 3CV6A 1XDMA 4Y7EA 3TQPA 1V0LA 2HNHA 1GW9A 4OU1A 3GWQA 3LHTA 1WKDA 3AYVA 3BZJA 4WIWA 5LYRA 3R2GA 1T8QA 3UR8A 4DWDA 1LQ0A 1HTIA 2OT0A 2VGGA 4FNSA 1FWJC 6A3HA 3P74A 1WBHA 4EPEC 4ERAA 1NP2A 3CHDA 2YB4A 3AAMA 2VFFA 4JTCA 1B4EA 3GXIA 1HT6A 1VB9A 3MDUA 3F2BA 3TWAA 1Q6CA 5KZEA 4AMAA 1UZ1A 5AC7A 4HCLA 3VD5A 4F0MA 3WD1A 2XVLA 4UMBA 4XO7A 3R0DA 1EA0A 3OGVA 1TPWA 3UJFA 3ARYA 1S2VA 4OOUA 1BD0A 4Z1YA 1ZAHA 1XF0A 2WJFA 3CZJA 4QCEA 2NVAA 4JL2A 3W29A 3NJ3A 4NZ3A 2WJEA 4DAFA 4QJ1A 1SO4A 1OEPA 2PDQA 3PBMA 2CBIA 2X16A 2GDVA 2D2JA 2JEPA 4KH2A 2FLIA 1ZCOA 1P0KA 1V0NA 4W89A 5HPOA 4H7CA 4JN6A 4G7FA 3CO8A 1MEIA 3SW6A 1TV5A 2Y4SA 4NF7A 2Z1VA 1XM3A 2D22A 1PWLA 4NJIA 3GY1A 4JIRA 4XD4A 4D8AA 4NT0A 2Z2UA 2GZXA 2ZWYA 1P48A 4QFUA 3LLFA 2E5DA 3F4CA 1OY0A 3BMVA 4J7RA 4JHOA 4J28A 1P4CA 5I2UA 4JHZA 3S1GA 4X9YA 5T9BG 1LWHA 4H2HA 5F7UA 4U33A 3QV8A 4ZQPA 1XSKA 3L5MA 1ZJIA 1G4PA 2DUZA 1IQ8A 3SECA 4F79A 4A8LA 4V28A 3BLOA 5MKGB 2PS2A 3HV8A 3M5YA 3T44A 2QZRA 1LOLA 1MUWA 3NNTA 1OYCA 4JYDA 4MKNA 4ACZB 5MHBA 1POKA 3LZ3A 1KQYA 2QAFA 1X98A 2X1UA 3N9RA 4EP8C 3WFLA 3DBNA 4R9XA 3VCRA 3BCDA 3VO0A 3N4AA 1J0KA 4MWAD 1UIOA 1X7FA 2OGYA 2WVTA 2G3MA 1VIZA 3RPMA 4U3AA 4IM4A 4XBJA 1XYZA 5T91A 3CB8A 3KL3A 3KCOA 4MY8A 3UP8A 3TJXA 4AH7A 1NVMA 2AGKA 2HMCA 2I5GA 4DXKA 2ACSA 3LMYA 3A23A 1J5SA 4HCHA 2CPUA 1P6CA 2J79A 1KR0A 1ZSXA 2BHYA 4BI6A 1V3KA 3VKAA 3CTLA 3WJYA 4CGTA 1XIDA 4DBEA 3REQA 1QT1A 2BBFA 2PAJA 4X9SA 3AHTA 2PSNA 2YBUA 2E68A 1AZ1A 4GH1A 4K36A 4US5A 2TRSA 3HZ3A 1B90A 1HKWA 3FLUA 3EWWA 2RFGA 1UWIA 2JKPA 3FJ4A 1KGUA 2YJQA 3BLKA 1MZHA 2ZUUA 4L56A 4MZ8A 4I5RA 2PD5A 1RHCA 1CEOA 1D7FA 1Q85A 4F2TA 3PZTA 5JU6A 3NQGA 5I6SA 3AIRA 2O9PA 3FX4A 3A9BA 5CZKA 2DVTA 3C2EA 5GNXA 3TDFA 2X8RA 4D6DA 2W62A 2ATMA 3ECQA 3EOSA 4JICA 3BQ5A 4JX6A 4RE3A 1B3YA 2G3IA 1TCDA 5DBUA 3N9SA 3BLDA 2I14A 3BSHA 2OR2A 1SJCA 4JEQA 1YDVA 4CVUA 1WXJA 5G4EA 3W1LA 3TK7A 1H0GA 2ZKMX 3I6TA 4AU0A 2VR2A 3W2LA 3ITVA 4B5TA 2BLEA 1V51A 4R53A 3AC0A 3R0UA 4R9OA 5I03A 1KQZA 5DY3A 3NZ1A 4TX8A 3W9ZA 2PTXA 3V0TA 3QF0A 4K38A 4C6JA 1LBLA 7PTDA 1VF8A 4NASA 3PWGA 2FQIA 4LAZA 1ADOA 4KESA 4DJEC 3VKDA 1G69A 5TD4A 5SWUA 4DWSD 1AH4A 2JK2A 1BYCA 2AL2B 1DTNA 4XKYA 3IIVA 3GC2A 4LRTA 3AJ7A 1CB7B 3ITYA 1RBAA 3E0LA 4N4QA 4AHOA 3GR7A 1ZAIA 3MO7A 4ZB0A 1JDEA 3JU2A 1QK0A 5AC5A 1XIFA 2B7OA 4LALA 3ME3A 1JUBA 4DZAA 4IUGA 3U2OA 4AY1A 3HFYA 4GVHA 4DXVA 4RXGA 4GI8A 3VFLA 3P0WA 2X1IA 2CBUA 1GONA 3N14A 2ZYFA 3BGGA 3QLLA 2NQHA 2F84A 1DQWA 3PVFA 4EANA 5C2CA 2EXOA 1D3CA 4TOQA 2YR1A 3LMZA 3U0HA 3LTSA 1XLBA 4HB7A 3HJEA 3RXZA 3KL0A 4L80A 1QVBA 3SUWA 3EA2A 2VFHA 4GA8A 3O1NA 2NVDA 4EWND 3JUGA 3WH6A 4HBKA 5IXEA 3FHQA 3UXAA 3AWNA 1M01A 3SIZA 2ZDSA 1XH2A 1PS9A 4QJ3B 2NX1A 3W75A 1PZ1A 4AD5A 2QMKA 3DG7A 4KFNA 3MPGA 4GRSA 1T40A 3LEPA 3B0PA 3H21A 1GZ1A 4WRHA 4Z2LA 3E02A 3MJMA 2ZZ4A 2A79A 4QEEA 1SW7A 2DSUA 3GG1A 1YNYA 2ANUA 3GVVA 2HTMA 1VZWA 2WAGA 5I06A 1GQKA 2A3BA 5T9CE 4DNMA 3G8EA 2XGZA 2ZXAA 1R3QA 4OBSA 3SCVA 2J25A 2E7FA 1J11A 3S1XA 1YRRA 1UKSA 3GO2A 2E6FA 5PTDA 2O9OA 5EMKA 3T0AA 4EXQA 3BW4A 1FWWA 3NZQA 4ZXLA 2OTDA 3EDFA 4E4UA 3N2CA 4WY0A 4TMBA 3VGEA 3CYJA 5C55A 4UNIA 5E70A 3FHAA 3M44A 4DUVA 3QY6A 1HL8A 2YX0A 1CCWB 1UOKA 1ZJAA 2D3LA 4KEUA 3WK2A 5BYWA 2ONEA 4IIGA 1VAHA 1EXBA 4GOAA 3MVIA 4PEEA 4AHQA 3CXOA 2X1TA 1V5XA 2VC5A 3NYDA 3L4XA 1VYSX 5CXPA 4MNLA 2E28A 3WJWA 1K8YA 2ZZ2A 3FV9A 1J12A 2FVLA 1DE6A 3RMJA 3Q37A 4I90A 5H2ZA 2WNNA 4L6OA 1PDZA 1K9DA 1UD5A 4W7VA 4G2DA 4LF2A 1VBHA 4PMUA 1H41A 1H60A 3TJLA 4AZ6A 3ABQA 2F6KA 1B9ZA 3G1VA 1VPQA 1CB2A 2QPUA 2E25A 1LL4A 1ISYA 1HJUA 1HNYA 2QR6A 3DC8A 3WLMA 4EVZA 4LS0A 2HISA 1JDDA 1CNVA 4LJ3A 4O0QA 2YW3A 4LNYA 1JL8A 4O1CA 2XN2A 4LUIA 2ICSA 1WZKA 1WDQA 3IGUA 1PZ3A 2C6QA 3I3BA 2DW6A 1L2UA 1UPMB 1HJXA 3WK1A 4RE0A 3VGDA 2UY5A 1E0VA 3QY8A 1OFQA 4FXSA 1SSGA 3NDZA 1JPHA 1WKEA 2BHZA 3VIMA 3AXMA 2VVSA 1E6QM 3BW2A 3GBEA 4W8AA 1PHWA 4CD8A 6ALDA 2EPKX 3NQFA 3QGVA 4Q22A 2PCQA 4ZENA 2PTYA 3W1PA 3LRLA 4L1XA 4OWGA 3VAVA 3WFZA 4CUCA 4IFKA 1IE7C 1NARA 3VGGA 3POCA 4CNPA 3QRHA 2B7NA 4KMQA 5D05A 1UHVA 3QFEA 4EACA 3D3FA 4P7QA 1XLAA 1IT8A 4UZSA 4LH8A 2P10A 2YA1A 2FVMA 3KVMA 4HNLA 1V02E 4NNAA 1O5RA 4UOZA 1XLCA 3N12A 3UWYA 2GQ9A 1UR0A 3EWBX 3RX4A 1SPQA 4W8LA 2GQ3A 2HBXA 1KV5A 3EOLA 1H7WA 4K8GA 5I78A 4UQEA 4AY7A 3NOYA 1ISXA 1D3HA 3ISIX 4BZYA 5B7YA 5RUBA 2FZ9A 3EWZA 2YL9A 1BEUA 4GINA 3BMWA 4K7VA 4O0ZA 1EYEA 3CIVA 3OLEA 4JTKA 3O0KA 3NZPA 3QQ1A 1PV8A 1GVOA 4H8VA 3GYEA 3AUJA 3PG9A 1BXCA 3S1VA 1TX2A 3O63A 2WCSA 3FN9A 4B5WA 1EJ7L 4WY0F 5GJNA 2J75A 2D3NA 2HQAA 2Z26A 3WDQA 4MWAB 3S5NA 3TQKA 4HJWA 3RRXA 1B1YA 7XIMA 2CXGA 1MUMA 4AWUA 1PIFA 3VDAA 1B57A 2PTWA 2GK1A 1L6WA 1XDLA 4CU6A 2J7DA 1MW1A 1EJVC 3E0WA 4O57A 3IAQA 5HR6A 1EB3A 4DJFA 4UBPC 2PLKA 2A7PA 3CUGA 3FKRA 1P7TA 4XAPA 4GC4A 3H12A 3ITXA 1GQNA 4CQAA 1P5BA 4YPJA 3H26A 1IWPA 2PGRA 3CUIA 2RUSA 3FY1A 3IANA 3VM7A 1VEMA 2A3AA 1IXOA 3G22A 4C91A 3C2FA 1IEXA 4UTIA 4PCPA 4NXKA 3IUHA 2OSXA 3GHRA 1MEWA 4C5ZA 2QDEA 3KRSA 1BPLB 4C7DA 3VOHA 3DFHA 2EG8A 3KP1A 3QGAC 1UIPA 5C7VA 4UOJA 1RA0A 5H8MA 3U2CA 4B15A 1S5TA 2VTFA 2R9RA 3QHNA 2XH0A 2HE8A 4HPJA 1UJPA 3CM4A 1TTPA 5CKSA 4R7WA 3WQ5A 4Q4PA 4Z42C 5M5DA 4ENLA 4JX5A 1T0OA 2G8ZA 3QR0A 4IISA 5EA9A 3CUHA 1A4MA 3THCA 3T05A 2FMNA 3B4YA 2WVVA 3DIPA 2TSYA 4GYPA 3PN8A 1VCGA 4QP0A 3DGRA 1TV2A 5CC5A 3UPWA 3AIQA 2YB1A 3NM3A 4R3UA 1QWGA 3LM7A 1H50A 2Z1WA 4D1IA 1AQ0A 1VENA 3ARPA 3O6DA 2GVEA 5D2YA 5KEZA 3CZEA 3QVQA 4DXXA 2DVXA 3F4WA 3OOQA 1KBJA 3FJNA 3CUXA 3VMPA 1I2NA 3GSMA 1GVSA 4LB3A 1KKOA 1HUVA 4AQLA 3CHVA 2ISDA 1E55A 1W91A 5HQLA 5HNTA 2IMRA 2OOGA 1JCXA 2GJXB 1PKLA 2XSAA 1A5AA 3C2OA 1UG6A 5FOOA 2YCEA 4UTMA 5DCBA 3S2JA 5KINA 4MFDA 4W4QA 2DIKA 3WQVA 5CJMA 3QN3A 4JTAA 3UY7A 3NOEA 3W7PA 1C8VA 4QRNA 3GYCA 1H62A 1ZBWA 1WOBA 1O5KA 4IMDA 2EJAA 4DF0A 1VHNA 1ADSA 4OBRA 1VCFA 4YYFA 4PTDA 5E5CA 1EHNA 1QNRA 4X22A 5H6HA 4Z0SA 1UPPA 4ZZ9A 1YDYA 1U5VA 3RU8X 1AG1O 1A4LA 1EPVA 4PH6A 4GUHA 1FCQA 1IYXA 1HJSA 4KFPA 1AA1B 3LXBA 1DE5A 3IPWA 3G18A 3KBNA 4XZWA 2D73A 4EKJA 4XQ6A 3A3HA 4GLEA 3BOXA 4HHLA 2XISA 5FEZA 4RXFA 2ZXQA 2PU1A 4S1FA 4PUEA 2ZRYA 1ICPA 3U9IA 1H7NA 3IJ8A 2BFGA 1VYRA 3T09A 4HVXA 3LXCA 2B4GA 3WQDA 3N11A 2WHMA 4GQQA 1K4HA 3LS9A 1S2CA 2O7QA 1X7IA 2HBVA 4CNOA 3CO4A 3NL3A 3HGSA 4AWEA 4IQLA 4S3FA 1O94A 3CV7A 3WQWA 1SR9A 1FP8A 3ABRA 1LRNA 2R1KA 3TC7A 3WBAA 3PZMA 1OM0A 1LBFA 1E4LA 3P80A 4XD6A 3GUWA 3KOWA 3FJLA 4PTMA 1OFPA 2FGZA 3N25A 1IIGA 3PZ9A 4PN2A 3KLKA 3LBMA 1RJQA 4IUOA 4HNUA 2XH2A 4TUFA 2VENA 1KW1A 1Y65A 1JF6A 4MWAE 1GJWA 1TX0A 4S3BA 3RU6A 1J93A 3BK0A 3URQA 2VRJA 1WNOA 3F1QA 4WJXA 4AZBA 1LJYA 1RZMA 3UA3A 1MW0A 3CMGA 1EJRC 3SRFA 1DJQA 3HGJA 1T96A 3VIGA 3IS4A 2CZDA 4QSHA 1ZGDA 1UA3A 2XWDA 5FJTA 4NSBA 1KB3A 3GH5A 4IG2A 3UZZA 2GJNA 4RZBA 5D2XA 4OV9A 1RLCL 3QBUA 4NU7A 1VBUA 1U83A 2NT0A 3MUCA 3AMCA 1ICQA 2YYTA 4N6EA 3CL6A 1ZBVA 5AC4A 3Q2DA 1OCNA 1IZCA 2QJJA 2Z2BA 5CPMA 3VU2A 2H3DA 3KWXA 4O10A 5BU9A 1FWRA 3PPCA 1ZENA 4JGDA 4E2VA 3TH6A 1KXTA 3NZGA 2ZWZA 3TJ4A 1HKIA 2E9LA 4HPNA 5AN7A 5HA7A 4A3RA 1JGIA 2FZNA 3KDOA 3S6DA 3QEZA 4FF5A 4LAKA 3B0YA 1O66A 1E51A 4UFLA 1LQAA 4KETA 2ON3A 1GORA 1K8XA 3JS3A 2Y61A 3S42A 3MWAA 4GQBA 5CGMA 4Q7BA 3LHZA 2ZXBA 5ABEA 2V2CA 1OX4B 1UBPC 4LBRA 4MNMA 3CHCA 4GY7A 1Q66A 1E4IA 1RH9A 2QDGA 3U8GA 1TMQA 4XUGA 6TAAA 5JQ9A 4IQDA 4MVAA 1OVDA 1XWYA 3WY1A 4LYQA 1JYWA 1C7TA 4G7EA 4DJFC 1LCOA 3N34A 5LNWA 4JD4A 3EA3A 3MP5A 1QI0A 3C4UA 1QAPA 1H51A 4JPGA 2RGLA 1H4PA 2O56A 1DVJA 4AVNA 2YL8A 3ORWA 4O0KA 4V33A 4XZIA 4F48A 4RKAA 3RN6A 3EB4A 3B8DA 3N29A 1F6KA 4O16A 4GUJA 4QBXA 3AIEA 4E8DA 1JCNA 4LSBA 2NQZA 4DI8A 3AIUA 3B9DA 1EDGA 4GUFA 1MMFA 4FNRA 3L5AA 4UTJA 3GHTA 1BXBA 4IL0A 2YDRA 4K2SA 1XYLA 3L4UA 4OE7A 3VGHA 1W54A 4NRRA 5CSSA 2DZAA 2VCBA 2WPGA 1HVXA 4XSMA 1QU4A 1M7JA 3EX4A 3G1YA 1JGMA 3TSDA 4F0KA 5K9DA 1R85A 4XWUA 3SAZA 1GVRA 2ZA2A 3IRDA 4CNUA 1FCUA 4JTSA 4JTGA 4LC6A 1DWIM 2F7FA 7TIMA 4DUWA 4V1XA 5CJ5A 3WNPA 3MP4A 5XIMA 3KZSA 1KKRA 4A05A 2JFEX 2PZNA 1VP5A 4RX0A 3QQWA 5DELA 1Q45A 4W8BA 4GYPC 3SZ8A 4AEOA 4Z1AA 1F73A 2Z2AA 1BG4A 3DECA 4D6EA 3IIXA 3HOJA 3TZFA 4S3AA 3I7SA 1BRLA 1IIHA 5AHMA 4IXHA 3LHUA 1Z44A 3BAXA 3H6OA 1OINA 2PDCA 3F5KA 3WG6A 2BOGX 2VGBA 1DIKA 1QDSA 4FZIA 4EF8A 1KTNA 2GUUA 3FYYA 3ARVA 5DX7A 4IIEA 3TN5A 2XH7A 5EBUA 4AISA 3W7QA 1SFLA 1VRXA 5D33A 1AJ0A 4HSNA 5AYBA 3O6AA 3R94A 2I7GA 1GW1A 4ICMA 1JYNA 2VCCA 1BWLA 1LG1A 1DEDA 4Q32A 2NVCA 2BVWA 4E2OA 3SCOA 1C91A 1OK4A 4LUJA 3DKJA 3TQVA 4OBTA 3T6CA 4GC3A 4PL2A 1RJRA 4ZB5A 3EMQA 4MLJA 5DF0A 3MI2A 1OZQA 4ZO6A 2Q8XA 3CEUA 2TYSA 4C6DA 4Y8FA 5IFTA 5FF2A 4NVTA 1DQUA 3F4VA 3LXAA 1EJWC 3KW3A 2V5JA 3NO3A 4AVFA 4H9UA 1EIXA 3OHIA 4G6CA 4UB9A 1XQLA 3CLMA 4NZFA 1JPMA 2I16A 1OYAA 3W7RA 1E56A 2EEXA 2VUYA 4PFMA 5AY7A 1E15A 4HT3A 4ZFCA 2G3JA 3A13A 4PMXA 3P61A 1GOWA 1IEWA 5I3KA 1LUCA 2QPSA 4Q8OA 3ZMRA 1EX5A 4L4PA 3LCIA 1OGSA 2Q71A 2VC7A 3EWCA 3NG3A 3PBUA 3S2MA 3AIWA 5G4WA 4A8NA 1A0DA 4PODA 4O18A 5TQLA 1FTXA 4F0RA 3VOGA 4X0NA 4UTFA 4US5D 3TXVA 3GNPA 2PC4A 4H83A 3R4IA 1C92A 1IXPA 4AY8A 1V7AA 1E73M 1W1A1 3DCPA 2IXVA 5K9CA 5LNVA 3VOFA 1I2PA 2QUMA 1LBMA 4HYVA 3CQKA 2X2GA 3LPPA 3OG3A 1MNZA 3OQ8A 2EAWA 5A6SA 4EF9A 4NUWA 4LUSA 1JZ8A 3PBWA 3AMGA 3C0JA 4DYJA 4EPKA 2G97A 1XPGA 4F9JA 1S2AA 1BQGA 1NF0A 3VE7A 2XU2A 3H4XA 4F0SA 4M1BA 1QHOA 2J78A 2CLHA 3PHAA 3E3HA 4MFEA 4AEEA 3LGGA 5A6BA 5EMLA 3WNOA 5LGXA 4QS5A 4K1GA 3RO6A 1E5JA 1S3HA 4H8UA 1IWBA 3M43A 3CPGA 2OWWA 1NAL1 1EJUC 1XSJA 5CGTA 5H8UA 1KM3A 1TV3A 3NURA 1XS2A 3M0XA 5FACA 1GTHA 2Z7GA 2DIEA 4J9JA 4TR9A 3UEQA 3GLCA 1KM2A 2WZTA 3KBJA 4B3ZA 1BYDA 3H8AA 1WZMA 4FS9A 2Y6ZA 3IGHX 3AO0A 1E9LA 2OT1A 1YE6A 4FIRA 1JNEA 1SZRA 2A85A 4MDOA 1RBOB 1HKKA 2VFIA 2GGGA 4NG3A 1GK8A 4TVDA 1L6FA 4JFUA 3A5FA 1R3WA 1I4NA 4H6RA 3KVJA 3D3AA 1S38A 3K30A 2J74A 3R25A 4JQ3A 2GFTA 8XIAA 4DIAA 1KFCA 2ESCA 1MRAA 2CC0A 3VD9A 4FF7A 3P84A 1G94A 4H6KA 5D9PA 1SSDA 4GK8A 1XLEA 2HEJA 3FGCB 1FDYA 1B9BA 1XLDA 4PE8A 1RVGA 3WMBA 4C6LA 2GGEA 4IT1A 3ITOA 1FP9A 2DZPA 2B31A 2D20A 3VKKA 4RZ6A 3W6MA 1EGMA 1XLLA 1DIOA 4B2DA 2BZNA 3G6LA 3GD6A 1SQ7A 1FHDA 3THUA 1FH7A 1G7UA 2Y62A 4FR6A 4HNOA 4MB5A 3ZFHA 4UTTC 3ES7A 4O1DA 1GTEA 5CH9A 4C6EA 4R27A 3KLLA 3UD6A 4O54A 2PDUA 4IX0A 3QHMA 1F05A 2ZQ0A 3FVDA 3W76A 2R1PA 4ZQMA 3EA1A 4K1WA 2J66A 2PCEA 1CECA 4E4FA 4G8TA 4NL1A 2DZVA 3VDBA 1PXGA 3B8VA 1YMYA 1S2UA 2EPLX 3RNDA 3FVMA 4GO8A 4D6FA 3M0HA 5A2AA 4A3UA 3RHGA 1FFQA 1M1BA 2FZBA 2R8WA 3M0KA 4PZVA 3NZRA 2B81A 2G96A 1W1ZA 3BE7A 3BOLA 1YX1A 3IV8A 4FNUA 1YPFA 3RJXA 1M65A 3MSGA 1CBGA 4YL2A 1I2QA 3NEVA 1UD3A 3I3EA 1ZU8A 5I3GA 4QISA 1XIBA 1DOSA 4J3SA 3EEGA 4G1NA 3PC0A 2VDGA 3B3DA 1IF2A 2H8XA 5BU6A 1UQYA 4WF7A 4BEQA 3K5XA 4YN5A 3UWEA 2IKGA 4TVCA 2C0AA 3G1RA 4IPIA 1BVZA 2VEGA 2J8FA 3KS6A 3W1UA 1ME9A 3T40A 4ATLA 1XV8A 4GYJA 1OG6A 1XUZA 3ZLGA 4I8DA 2ACQA 3T0BA 4KRUA 3GRIA 3MKKA 1JDCA 2XM1A 3WO8A 4IGNA 2PDKA 4XZLX 3GG8A 2VO5A 1XUUA 4ZQCA 2GLKA 2C16A 3QHOA 4Z2JA 4QITA 3TZNA 2E77A 3H4WA 3GC4A 3DBPA 4J35A 3H55A 1S1RA 1XLGA 3VVGA 5KMYA 1P0DA 1NWTA 4XTDA 5JH2A 1KRBC 4W84A 1QPKA 1RLDA 3H22A 4WKHA 4GXPA 1TG7A 3SB0A 4ERIA 1MQQA 3DU0A 1R9ZA 4FP1A 1TMLA 4C6FA 2HJPA 2V2DA 4NAFA 4GIEA 3H70A 3M1ZA 2ZFAA 3VNZA 4J3UA 3P14A 2V63A 5HJYA 4JKLA 4BFAA 4GNJA 4O13A 3F4NA 3T1GA 3ALGA 1CGXA 2WM1A 4M6QA 2HS6A 3HQ1A 4RE2A 3A64A 3NQ2A 3LSCA 4O4WA 3B05A 3HPXA 3ITGA 2PDWA 5A6LA 2WWCA 1N2VA 2E8ZA 5H91A 3LN3A 4J27A 4BKNA 3OZMA 4IH3A 5LIUX 2VX5A 1KFJA 3EWYA 4BF5A 3BLLA 4E8CA 2HVNA 3L67A 3L9CA 1XRTA 5G1TA 1WYIA 2PA6A 1EA9C 5JBFA 5C7HA 1W17A 4PMJA 1A5BA 3BWWA 4Q7IA 1FWNA 1EC7A 3MUIA 4IMFA 5REQA 2ZUVA 4XD3A 2JALA 3VC5A 1AJ2A 3TN6A 3GNXA 4AVOA 1C9DA 3AIBA 2XVKA 2KX9A 1H11A 2NWSA 3N2MA 5CAKA 1HX0A 2NXGA 3SRHA 1GYMA 3VD4A 3WD0A 1KCLA 3K2GA 2R91A 4GCXA 3WLSA 3ATZA 3ZS4A 3N9KA 2X09A 3LRMA 2CWXA 2NUWA 4AZCA 4H9ZA 3S4TA 4O50A 3VIKA 3EB2A 2ODOA 3DKLA 2EKCA 4Q8MA 1NU5A 3W4RA 4B5VA 2P8CA 3E5BA 2QCGA 3HF3A 5BRQA 3WLTA 2AMXA 3R8RA 2NV2A 4WZHA 3REQB 3T4WA 4DY1A 3WUBA 1A53A 1XBZA 1Y0EA 1KM5A 3VA8A 1E9YB 2Q6ZA 6XIAA 3B06A 1D3GA 4MNJA 2FH6A 3E2SA 2VHLA 4QEHA 3HG3A 3VIIA 1UASA 3TOYA 1ZJBA 1EL3A 1JPDX 1OC7A 1TIMA 3APYA 3MKCA 4LUYA 5HWMA 3UJEA 4U3CA 4UFJA 2WYSA 4ZODA 3PP7A 4JR5A 2YDQA 3CGTA 2ALDA 2CXEA 2PURA 3MA8A 1QPQA 1GVEA 2PEVA 1L6GA 4HTBA 5G2WA 3EOUA 4J4KA 3RPTA 3WZ0E 4PUDA 3G1XA 3CUFA 3YPIA 3O2LA 3HG2A 3TFCA 1WP6A 4DZIA 3AWOA 3UZYA 1K7FA 2CCRA 8A3HA 4RW5A 1DL3A 4HK7A 4HA4A 3TAKA 3NM1A 3NWRA 1VS1A 1ODUA 1RCQA 2ATSA 1UKTA 5D4YA 2Y7EA 3KWSA 2YBVA 4A35A 1OX6A 4Q6JA 1CXEA 5I3IA 3AS3A 4I6VA 1M53A 1BGAA 3FJ6A 1AL7A 3BG3A 1UD2A 3ZJ6A 1UROA 2PMQA 1E43A 3MT1A 5M17A 2F6XA 1TO3A 1Z6KA 3EPMA 5IHRA 1UMYA 4CNSA 5HQEA 3B8SA 1PIGA 5M1TA 3S9ZA 3IWPA 1JUKA 4XKYB 1VIWA 3GVWA 2XVPA 3AZTA 4GY1A 4NAEA 2QJIA 1Z48A 3V18A 3OYXA 3TONA 2EHHA 2DP3A 3C61A 3ARUA 4DWSA 2V5LA 3W24A 2AAMA 9CGTA 3CASA 1GQLA 1FWDC 1HVQA 5FF3A 3EX2A 5KTLA 1TUXA 2PD9A 2Y63A 1KM6A 4Q8WA 1MWOA 3OVGA 3BAKA 1EC8A 5BOOA 1E71M 5EBAA 3PULA 1XFBA 1AJZA 1YLVA 4LOCA 4WSJA 2XVGA 4JNMA 3V36A 3SFWA 2GJRA 5I3JA 2V3DA 2J24A 5I02A 1GYLA 3FA4A 1XISA 2BNJA 1XCWA 3UZWA 4AZ5A 2REQA 3D46A 3NTYA 3PZGA 2VZOA 1OX5A 1RUSA 3BUVA 3BDKA 1V8EA 2Z1KA 3MY9A 1UP0A 2W0UA 4C1KA 3QTPA 1X1OA 5BWFA 2WMJA 2J7FA 4H8HA 3CHFA 2CHRA 2OLHA 1AD1A 4I9TA 1GVIA 1WO2A 5HUOA 4ORIA 3O9NA 4ZL1A 3S6TA 3OW1A 3ITTA 3MVTA 4UXDA 2ZTJA 3VMOA 3U57A 2X30A 3CQJA 3W01A 1WDDA 4FNPA 2YCJA 5H1WA 2XIOA 1AMKA 2CETA 3P81A 1Q6LA 5FESA 1E6NA 2ACUA 4FI4A 3A5VA 1S46A 4IPNB 3F5JA 2LLEA 1NF7A 3VNLA 1LL6A 1UYQA 4EOUA 3VE9A 3GM8A 4PFHA 3AZSA 3AYSA 2CWNA 5CZJA 3HURA 3NQAA 1MRQA 3KXQA 3W87A 1P1MA 1BAGA 4WY0B 3CQHA 3O7UA 4N0RA 1CPUA 3L0KA 2Y24A 3TEVA 3FA3A 1TSIA 2QDHA 3RUBL 4HKPA 4IHCA 5IHSA 1WQ5A 3WMSA 4GKTA 4UMAA 1R3YA 4KRZA 3W86A 4N6FA 2J62A 1C3FA 4DX3A 3LK6A 1ZCCA 2PE4A 3FEMA 1UCWA 1CWYA 5LGZA 2G37A 3BW3A 4DLFA 4FX8A 3WDPP 3SN4A 4B5UA 1W9DM 4CD6A 4FHAA 3MCNA 3DENA 1NOUA 3L4VA 5LA1A 3C52A 1M7OA 4S3GA 1HJQA 4JTLA 2HV5A 2EF9A 4TVUA 4B5NA 3U3HA 5DRIA 1R8LA 3W72A 1A5MC 1V08A 4X63A 3DI0A 3OB8A 1ZBCA 3W27A 1KFEA 1UR2A 4ZA0A 1GT8A 3VIHA 4LAUA 3QOMA 4JDYA 3VD3A 2Y89A 3V75A 4JHMA 4F2UA 5LHEA 3SI9A 3AIVA 1XYAA 3BARA 3VZZA 2J7GA 5HMFA 3MZ2A 1XIEA 1G4SA 3W7DA 1OJXA 4ES4A 1NFBA 3NPUA 5DEZA 3VMNA 3UG4A 1ZQ5A 3C56A 4XAGA 3A22A 1IEVA 1ISZA 3UJRA 5C2XA 1LP6A 2JF6A 3OZOA 2E5BA 1WAUA 4JS3A 2CNCA 2WMHA 2W66A 4ZOBA 3T2QA 4QJ5B 1QPNA 5BXTA 1PKNA 1W5QA 1HO1A 4IFKB 1RQBA 3VNMA 2W67A 3DN5A 3ZWSA 4WDWA 1V7YA 3W7IA 3KCLA 1QBAA 5FSDC 3B9AA 1NEYA 1IV8A 3KRUA 4RZ5A 2PDLA 1YE4A 5I3DA 1UKPA 4NZJA 1H7XA 4GH3A 2C19A 1NJJA 1BLIA 1KD0A 3CEPA 1XL9A 5GJPA 3TMQA 3TFXA 3GDBA 2V2HA 3APGA 3CV1A 2PWHA 2VFDA 4HP5A 2VNCA 5K7JA 5HR7A 2OX4A 2OJPA 2CIPA 1W37A 1ALDA 1KBKA 1ZBKA 3MKVA 5JBEA 4BR1A 4S3EA 2NV9A 2IPWA 5G5IA 3BLIA 1AH3A 4UFHA 3GFZA 5XIAA 3F4DA 3CWHA 4JTTA 3KOZA 3NPWA 1UH4A 3P8JA 1EWDA 2J7BA 4TMCA 1T7LA 1EEXA 3F5LA 1CXHA 1GZGA 3B8WA 3NYZA 1JD9A 1UUMA 4IWWA 1DWGM 1Q3NA 3VD7A 3NVDA 2GK1B 1Z9AA 4N9BA 3NUKA 2QJGA 2A3HA 3HN3A 1Z69A 3WD4A 3UYIA 3WYZA 3GXDA 1F61A 3MHGA 3T42A 3VUPA 1P7TB 3IK2A 3T08A 4PB4A 4RV3A 5AFDA 5E6YA 1NDVA 4W86A 1YNQA 4W5UA 4A4AA 1EH9A 3UYCA 3POHA 2BG5A 3VNJA 2VOMA 5FAGA 4TIMA 3TNOA 1I0BA 4EX4A 2XWEA 2A7RA 4P8VA 1XC4A 1TPUA 1VBJA 1NOFA 2C0HA 1JYXA 1B30A 5L9FA 4JIHA 5E1QA 1MSSA 4IMEA 4PMOA 1I6NA 4R5EA 4ERGA 4H41A 2FTYA 3G1DA 1O4UA 1IR1A 3LENA 3GQYA 4BI5A 4D9PA 3CHEA 2OG9A 4XVDA 5LIYX 3QZEA 1H1NA 1P6WA 2XIMA 2ZE3A 1H63A 4BQ5A 3DI1A 5BWAA 1KRCC 1PUDA 3IJIA 1EP3A 4YLWA 3T0DA 5A2CA 4L65A 1UP3A 4ROPA 3CAQA 4F9DA 1SZNA 2YOCA 2Z29A 3S3GA 3QJAA 1JD7A 3CC1A 1ONXA 2OPJA 1W6TA 5CGQA 3LCLA 2INEA 3OZPA 3B9EA 1WDWA 4BA0A 3AZRA 2PGEA 2WNZA 3D5HA 2GUYA 1ZTVA 1LRQA 2J8TA 1V6WA 3HIJA 4B9ZA 1PX8A 2WB5A 4X60A 4LYPA 3N19B 2X0SA 3MW7A 3G0XA 4E2BA 4ILSA 3PJUA 1W2PA 1H1ZA 3RM9A 1RVKA 4JFTA 3E12A 3G0SA 4JCLA 3N18A 1MEHA 4PMNA 5AVNA 1Q6OA 5D2WA 2ZIDA 1UUOA 1OC5A 4WDXA 4J3VA 1A80A 4A2SA 2G4FA 1QO5A 4I7WA 1UR3M 4KWOA 5BZAA 1W1YA 1JF5A 3LOTA 5U4NA 1A5KC 3UWWA 3LM3A 4EK7A 3NL6A 1V93A 3AHYA 1UD6A 3W73A 4PUNA 3WLHA 3RLVA 3VFCA 4EXBA 3ZJ7A 5LNSA 4J5NA 2SFPA 3MYOA 4FLQA 3V5CA 1BFNA 5CCZA 1JEZA 1B3WA 3EDJA 2OU4A 3ZOAA 4M82A 3L2IA 5DCDA 2I5IA 3C6CA 4CD5A 3KOFA 2PTZA 1JQXA 4ALDA 4WR3A 4MLRA 5G1YA 4HZ8A 5GNZA 4G56A 1E1CA 1FWTA 4ECLA 1WDSA 1YXCA 3U5YA 5EKYA 1KTCA 1RP9A 4LWWA 2BOEX 3V16A 4UWMA 1DJHA 3BL3A 1M6JA 1Z32X 2PDBA 5IM51 4IQEA 3E0VA 3OBEA 1P0EA 2VEIA 3SCQA 3ENLA 1FVPA 2CLOA 5K4XA 2QEZA 1GVFA 3GR8A 5TAOA 3KVLA 1B3OA 3MU7A 3PJXA 5K9XA 4FO4A 3WUFA 4YTTA 4QG6A 2FZ8A 3HPZA 2EJ1A 3HMCA 1W56A 1JJKA 3HTWA 3IV3A 1JULA 3M16A 3AU2A 1E6RA 1O7AA 2WSPA 4WSHA 4NJHA 4PCSA 4MJZA 4C1LA 3UWUA 6CGTA 4RCXA 3CU2A 2BY2A 1VPYA 1WA3A 1KO0A 1HIZA 1V79A 4QJ4B 4RE4A 1FKXA 4DO7A 4LCQA 1XINA 2OYLA 3R11A 3RM8A 3W00A 3WF4A 3FAWA 2VVNA 3C2RA 1ZHAA 4ZOAA 1E1EA 3CNYA 5FEPA 2NXIA 3TWBA 3C3NA 4UC5A 5ABGA 3K8MA 4IG2B 4GE8A 4OECA 3TJIA 1OZMA 4B2DD 3DFYA 1EEPA 5DO8A 4WUIA 4QDMA 5T26A 1KLZA 2WZEA 2WJZA 5LKYA 4H1ZA 2ZX8A 3LB0A 5LA0A 2WPBA 5F2IA 4NZ4A 3KTSA 1KBBA 3AI0A 3BCJA 1ISVA 2WNWA 3GVGA 4FLOA 2WKLA 4UIOA 3VX1A 1XW8A 5D2TA 5AYYA 2TODA 3SO7A 5HANA 3LCHA 3VINA 2XH4A 3IJLA 1JCTA 5D32A 2ZVRA 2BXYA 4AX6A 3VNYA 4LU0A 1RPXA 4DUOA 3PBGA 4CN1A 3WELA 3E0FA 3HQPA 4MKSA 2DUXA 3GW3A 2CFFA 2PLMA 2FH8A 4XAZA 4O1BA 3P93A 3CH0A 3UQNA 1IGSA 3RLUA 4C1NB 2XSBA 3TYBA 4RDYA 1U1HA 1DXIA 3L65A 3HBLA 5G2HA 1TV7A 5GJMA 4LPCA 4BF7A 3S5YA 4GXMA 3SUVA 2VZVA 2CLIA 1XCXA 1JZ6A 5C5YA 5T8GA 1ZL1A 4JN7A 4A3QA 1DYSA 3NO5A 4G7EB 5CSYA 3GU2A 3BJFA 4PULA 2NLYA 3G8RA 3CBWA 2G3NA 1JYVA 5HATA 3ZVHA 1CGYA 3IARA 2RHGA 4YTUA 5J8LA 3VDHA 1K9FA 3TVAA 1L9WA 3U4AA 4KT2A 4M7SA 4DM1A 1QXLA 1G1YA 4HZ7A 4BWLA 3IVUA 2QJHA 2AQVA 1JCYA 3W7CA 1RV8A 4JY8A 4JTJA 3WIJA 5EB8A 1NQKA 2WC3A 1AL8A 3R12A 4AZHA 5I7GA 2VCAA 1F07A 1V6VA 1XCFA 2IS7A 1PZ0A 4Z2KA 4LVGA 3H53A 1K6AA 4EPDC 4MB1A 4ML4A 3ANVA 2W6RA 1Q6QA 1GUVA 3RLGA 3MMUA 3AUOA 3VKJA 3UWZA 3LV6A 3BSGA 3R8GA 1IEIA 1TRIA 2DPEA 4FXRA 3E2RA 1R6WA 3TTOA 3NSNA 1XRVA 2WHJA 1I2RA 1A49A 4HK5A 3JRKA 3NQVA 1W1VA 2XGBA 3LPFA 1TJRA 2FPYA 1UA7A 3RFAA 2BX7A 1EHAA 2UY3A 2YLLA 3IGXA 3ZM8A 3INPA 3W2MA 2RGMA 9XIAA 3PBYA 1W32A 1UZDA 2EG6A 2V81A 2XDFA 3MJYA 4LW7A 2KZHA 3TN3A 3C3UA 1US2A 4OVXA 4AIUA 3GH4A 4WXYA 4DZHA 3EOEA 1BRLB 2UBPC 1T8XA 3L66A 1HFBA 3VOJA 3U7BA 2G5WA 2HK0A 2W79A 3GIPA 4HU8A 2NQ9A 3UA4A 4JFVA 5AVHA 2V5BA 3CK5A 2WKJA 1KA9F 1GKRA 3GXTA 4KGLA 3V0SA 3P2VA 1F3EA 1L8PA 1SR0A 5K2ZA 4HU0A 4IMAA 1K8CA 4CNNA 3K1GA 1EJTC 1FHVA 3SGZA 4JAWA 5DT7A 2VYOA 4QTGA 2C71A 2QT3A 4QX4A 1JIBA 1EJXC 5HINA 5CPNA 4M80A 4KEVA 4LXFA 2QJNA 2ZUMA 3G0UA 1ONEA 3M46A 3KFTA 3XIMA 3SSZA 2VOTA 3IK4A 1IT7A 3VNDA 2DSVA 1GNXA 3SCPA 1TTQA 3BLEA 4O1AA 2ZA1A 3AROA 2XIIA 1ZY9A 2ZE0A 5FCZA 3GS6A 3UR2A 1X97A 2VGFA 5C9ZA 3HFTA 1RP8A 2W27A 4PB5A 1ECQA 5I09A 5ABHA 1QRQA 1B3XA 3B03A 5EFDA 5GNYA 2ZDRA 3PY2A 3OA5A 1CIUA 1V6XA 2RDUA 2J7CA 1CX9A 3AXHA 4LVAA 5EU9A 5IFPA 4GGBA 1FKWA 1QWKA 2BHUA 3ZYZA 3CZ8A 2DT1A 3FOKA 1BVWA 1OD0A 3M0LA 1T6MA 2DZSA 3MP3A 2WLYA 1ZZMA 3C8FA 2R24A 2HVOA 2OCZA 4R88A 1BWKA 4Q3MA 5EMYA 2JIEA 4KBXA 4RDWA 4LUSB 2WM0A 1KFWA 3PNZA 3O6CA 1CXIA 3OP2A 3W23A 4XB3A 2R94A 1EDQA 4DYEA 2W5FA 4ORMA 3JVAA 2P88A 4EIVA 2EPMX 4LV9A 3AU6A 1KNWA 1B3ZA 1PWMA 1HO4A 3N13A 3LI0A 3FSUA 3WUEA 1F76A 5FD0A 4D6IA 1K6WA 1J2WA 1W9BM 1Y8BA 1K9TA 4GVIA 2H9AA 3W26A 4M0XA 4MPKA 1TTJA 3UCQA 1C8XA 2NWRA 3MHFA 5HMSA 4ZSUA 3RDKA 3ZLHA 4O1EA 4F0HA 3ANYA 1X6UA 2QCDB 4L6DA 4YU1A 2WSRA 4KW2A 2OEJA 1PVNA 2Y5JA 5D9OA 3SCSA 3UGRA 4O8RA 3VIFA 3SUTA 1LRTA 3ZWTA 2ASHA 3U48A 5I5RA 4KWUA 4YS1A 4CN4A 3L2LA 4L9ZA 5ABFA 1T41A 4O1FA 4PEKA 1KRAC 5JH1A 4DN1A 4I9AA 3NPVA 3AMLA 2F38A 5U7SA 2YSWA 1B3VA 3NEHA 2J9ZA 1M68A 4NYYA 4KPLA 1HGWA 2QJMA 5CPTA 2VC6A 4HMEA 2Q3OA 1XIJA 5E93A 2VFGA 4LVDA 3PS7A 1TJ1A 1HGYA 5GQBA 4MAVA 3UZJA 3KBSA 4HHPA 2WANA 3ZR6A 4US6A 3Q94A 5HMEA 5KITA 1F74A 1FHUA 3SRKA 3L4YA 4YYCA 4UMCA 2F8QA 3WH5A 1XYFA 3AHXA 1OB0A 1TVPA 1Y5VA 2QPXA 1FUYA 3UGVA 1FQ0A 3N6QA 2UV8G 5BNKA 4YVVA 1XLJA 4MIMA 4GZJA 3GTXA 1UR4A 2J27A 2PZ0A 3RPDA 1XR2A 4AMCA 2NZLA 3TAOA 3TSBA 4Q7NA 1QW9A 1XKJA 1NOWA 3PANA 3KE0A 3Q4DA 1D2KA 3O3RA 3MS8A 1TJ0A 2UY4A 4IMGA 5GVJA 1PTAA 5EYWA 2VEFA 1TELA 4BWLC 4DO4A 2VX6A 3TOPA 1JZ2A 1M41A 1H5VA 1KXHA 1FHLA 4OTKA 5IRPA 2BV9A 2Y5SA 4O8AA 3RX3A 2PDNA 3LGEA 1BQCA 2HVMA 3DC0A 4DI9A 1LLWA 4LS2A 3WNNA 1KBIA 2FHCA 3M5ZA 3S9IA 3TC6A 1TB3A 3WDHA 4BK9A 5DFAA 3LRKA 5DBTA 3EKGA 4MDPA 2ZX9A 5XINA 3NSMA 1OK6A 1BGGA 2JF7A 5F2MA 3OVRA 3NGFA 4PMYA 2DJLA 2Q01A 2C1GA 3R58A 4LEQA 5FJPA 1R2TA 1WXYA 4TV5A 2W61A 2D24A 2NUYA 4K6AA 4YCPA 4DLMA 2WQPA 3H2NA 2PBOA 3C0SA 5KZDA 3KDNA 4S3KA 2XHYA 2V5CA 5D2VA 2FIQA 2L5HA 2IW0A 3JR2A 4IOTA 4UQAA 2CLPA 4LS1A 4V2XA 2VXNA 3Q58A 2X40A 2OEKA 1DQXA 4I7UA 5C71A 3L0GA 1UC5A 1O5XA 5DMLA 2ZXDA 2XIQA 3BQ6A 3HPFA 3E9AA 3LTYA 4YNGA 5CPLA 1VEOA 3NQ6A 2X41A 2ZZ3A 3ELFA 2CBJA 3CZGA 1NQ6A 2YXGA 2Y2WA 2B0MA 3KP0A 4P7LA 1DXFA 1PKMA 4NJJA 4RDZA 4JTUA 1NP0A 4CEXC 3OGRA 4PBFA 3WNMA 1L8NA 2YXXA 4K8EA 1XP3A 1OIMA 4URIA 4Z08A 2DIJA 1X38A 4N42A 4GD0A 5CG0A 1IHIA 4MG4A 1NIUA 2ZX5A 3UNDA 3AHZA 5DN1A 2BGQA 4WGXA 3E49A 1ELSA 1VCVA 5I3HA 2GJPA 4ZQRA 1K02A 4NAFB 1RK5A 3KOYA 2F6UA 4I6KA 1X6LA 2CLEA 2QVHA 5EGRA 4HNCA 3W1NA 3SRDA 3GAKA 3W1AA 3W7EA 5TBOA 3WK0A 4DZ5A 3AMKA 3R8HA 3BV7A 1J2BA 2GVGA 2FHFA 1S5WA 2CLFA 3W02A 3EPOA 1GHSA 1TA3A 4IJRA 1TTIA 4Y96A 4A22A 3NQCA 2POZA 4IICA 2FKPA 4PUWA 1K77A 3NPXA 3U2ZA 3BTNA 3TR2A 4H9VA 2VL4A 3WH9A 1DWJM 1VFSA 2E9BA 3SCWA 4LY4A 2X7WA 3CL7A 3WLOA 2Q3RA 3FA5A 3VYLA 3TYUA 1ME8A 1JI1A 1OSEA 1YTKA 3O15A 4HMNA 3UWQA 1KGXA 3M0VA 3BXWA 4GZ7A 4C6IA 5HAOA 3I3DA 3D0CA 1TZ9A 3GNRA 3WCZA 1C29A 2RDTA 1W5PA 3O16A 4HGXA 1B31A 3USBA 4V27A 3GIYA 4GHRA 1ITCA 1EXPA 5BOFA 1E72M 5I07A 3BZGA 2ZZ7A 5ENLA 5LZLA 3KM8A 1VJSA 1R86A 3AISA 3R79A 4H2CA 1N82A 3KCJA 1TV4A 1KFKA 4M29A 2BASA 4DO5A 4CU8A 1H61A 3EPNA 1OFEA 4TU1A 3A6OA 5HWJA 2C7FA 4Q4OA 3IGSA 2MANA 2PDJA 2O55A 1O6IA 5F1UA 2R14A 4AC7C 2BDQA 1RCOB 3HM7A 3DDMA 3I10A 2Z6IA 4HZ6A 3QR1A 3VM5A 1YW1A 1E4NA 7REQA 4RUBA 4J40A 5CLWA 4B9YA 4ATWA 5E9AA 3RCMA 3W37A 2HNEA 5DXXA 1F6PA 1O5QA 1JXJA 4KF1A 1F5ZA 1VKFA 1W5NA 2A1YA 3OU8A 4YTSA 1EGVA 4FXJA 4LF1A 2R1NA 3EMCA 1CENA 1KWKA 3WN6A 4KWSA 3GDRA 5AC6A 1FXPA 1FWFC 3KBWA 5F4XA 3TA6A 1R9YA 3WDRA 3SN1A 3PJTA 3K8LA 2WSYA 1QR7A 3EGJA 2XZ7A 2VX4A 1M7PA 3TCEA 3EBVA 2A0NA 3W7LA 3PZQA 3AOFA 3MB9A 5D04C 2QUNA 3BANA 1W3JA 2X05A 2PDXA 4JEJA 1TQXA 2X42A 1MVYA 4MJ2A 4GVGA 2PP1A 1W9UA 3QM3A 1Q6RA 1OG0A 3GXMA 1T99A 4WVXA 5CG7A 1SMAA 2VD9A 1WV2A 3OLIA 3LU2A 2JKEA 5AHIA 4NI8A 1JPKA 1Q6DA 2HXTA 2IKIA 3SR7A 3URNA 1G4EA 3NSXA 5EMMA 2DT2A 3CIXA 3TMLA 1JRCA 1M03A 4GFSA 1JZ7A 1FCBA 1ITUA 2DFAA 1A3HA 1ISWA 1J9YA 2X1SA 1BKHA 3P82A 3B8TA 3PPHA 2OZTA 1IT0A 5IDIA 4X2RA 1R9XA 2F2KA 2VELA 3VNIA 2EPNA 2NX3A 3WF3A 3DFPA 4GUIA 1B4KA 3O6YX 3MMWA 1LWJA 1NDZA 4ZXOA 3MBFA 1R7AA 2XUCA 4AZ7A 4DHGA 4RJEA 1WCGA 2C18A 1E0UA 3VOIA 3TP4A 4MHBA 4YWSA 5IOBA 3ITLA 3AJXA 1W3HA 1CT5A 3AQUA 3ANUA 3W83A 1OCBA 3NL2A 3VNKA 3VKBA 3AXXA 1F3XA 3WQ4A 4TX9A 1QJWA 1E9IA 4UQBA 1GPFA 1U1UA 5A1AA 1ZUAX 2YA0A 3IIZA 1PZ2A 3UBPC 4DWSB 3BVJA 3V5FA 1GEHA 2A4AA 2UY2A 3WJZA 1TPDA 3ZO9A 1TWZA 4DF2A 1J01A 1E4MM 3T0CA 2PDFA 1X8CA 1QNPA 3VIOA 2ZZ1A 3E2QA 1WB0A 2BY0A 3UU0A 1KRMA 1IXQA 1KXQA 2REQB 1U5HA 4J3ZA 2DORA 1HKJA 3QH2A 3TQ0A 3GU9A 4GISA 1UZHA 7A3HA 4DNHA 2YLAA 3WF1A 4H8NA 4LT9A 3C2VA 5J5DA 3LA4A 1B0IA 1RQHA 3HQOA 2DT3A 3S2CA 3W1MA 1K9EA 3PBVA 2HXUA 4PB3A 2CU0A 4GCAA 3T9PA 4W85A 3P6LA 5F4SA 4DQWA 2DDXA 3TTYA 1RD6A 2NQLA 4JTEA 3MWCA 2CITA 1LYXA 3SGGA 3NQMA 1K3UA 4UFIA 3UCDA 2DJXA 4W9TA 1UR8A 3DZ1A 4RPQA 4XV0A 3FFSA 5CZTA 2YIHA 2RKXA 5HK4A 2NXHA 3P67A 5AYZA 3PSVA 4C6OA 1KCXA 2IPFA 1KV8A 1WBJA 3IJ6A 4AIBA 3W84A 3QZAA 2Q8ZA 4BEUA 2FB2A 3ID7A 3IUIA 1OF6A 2BODX 3G5EA 4QE1A 3CT7A 3NQEA 3MZNA 5CC3A 3S5SA 2GL5A 2Y8UA 1Z8AA 4GGHA 4LAMA 3DFSA 4KCWA 3ZT6A 3ZT7A 3EDKA 1ZALA 3OGSA 2YCIX 4LY8A 2VQTA 1J4EA 3R10A 4ZMGA 1DWHM 3GC5A 4JFWA 1VR6A 3NR0A 5TF0A 1BVNP 2PB1A 1WXZA 3UESA 5C0QA 4QQUA 3UR5A 4OJYA 1FWSA 3C5QA 3V1PA 3WENA 1WUFA 2OX1A 3NQBA 1MZRA 1EP2A 2W63A 5C9WA 2WHLA 3PWAA 1GHRA 2VWSA 3HV9A 4HNVA 4Z17A 2WJDA 1AW1A 5E0FA 2VDIA 3IJQA 2FDSA 4XD5A 1I1WA 1SJAA 4XTIA 3ZVIA 4YXGA 3COTA 4U5KA 1DV7A 1DJGA 4MM1A 1FA2A 3DESA 1FRBA 3N4EA 4K39A 4KEMA 1V0KA 1W5OA 4W93A 1C90A 3HPAA 4Y6GA 4G9PA 1ME7A 4RNIA 3BJSA 3DUGA 3ATYA 2YPIA 1AQMA 1A3WA 2OELA 4GZEA 4XISA 4U31A 4QDWA 3TE9A 4CVWA 1AH0A 3S2NA 4I5UA 3TC3A 2C1HA 1W1PA 4K8HA 4WHBA 1XRSA 4JCMA 2Y7DA 3CMFA 5BROA 4F2BA 4QSFA 3S5ZA 4ADSA 5FAJA 1RQEA 3BURA 4AAJA 2PDHA 1HG3A 2WMGA 4REQA 3KVKA 2B7QA 2OVLA 2BVTA <