1G4PA

Thiamin phosphate synthase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
total genus 74
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4pA00
4JTHA 3P84A 4O1BA 3HGSA 1V5XA 3M7WA 4O4WA 2C6QA 2QR6A 1EWEA 3D0CA 1KM4A 2XFWA 4XTDA 5F4SA 4P2VA 1VLWA 1Y0EA 3Q37A 3SECA 3NOEA 1W5NA 3UQNA 4LT9A 2FJKA 5LNVA 2A1YA 3M9YA 1TPH1 1NF0A 1FDJA 1W5QA 2EF9A 2ZTJA 3G1FA 1C8VA 1KFBA 3W71A 4FXRA 5A8GA 1VRDA 4TR9A 3W88A 1GYLA 1DKWA 3M43A 1EEPA 1QOQA 3TU9A 4LVAA 3WK0A 4IQLA 2Y88A 4LC8A 2X1TA 1F5ZA 2BSLA 4MY8A 5AB3A 1I8JA 1A53A 3NPUA 2A7RA 3GXNA 3G1DA 1M7PA 5D2VA 2YW4A 5F2MA 4DBEA 4UMAA 1UBSA 4ZQMA 1QR7A 2Z0IA 5D2TA 4A22A 2I14A 3NZRA 3CQ0A 1DV7A 3K30A 4CNPA 3P8JA 5HJLA 1KLZA 2Z2UA 3R12A 4Y96A 3TW7A 1I45A 3LB0A 2X16A 1H1ZA 4IMEA 4K7VA 3UPWA 5CKSA 4UNLA 2QCMA 4W9TA 3RFAA 4NNAA 4LS0A 4UTTA 3E02A 3LCGA 2NV1A 1JCXA 1YTEA 2QDHA 5K9DA 4GJ1A 4K8HA 4RKAA 4DPQA 1QPNA 2DZUA 4WOQA 3W1NA 1B3OA 3GB6A 5FEZA 3E49A 3LHVA 2NWSA 4FNPA 1VJIA 1VPXA 2PC4A 4Y90A 3DZ1A 3OVRA 3E12A 2FTPA 3UXDA 1THFD 3UD6A 1O94A 3CEPA 5AOUA 3S1WA 4YCOA 3M5ZA 3G1YA 4EIVA 3W1UA 4PCFA 3GAYA 3I7RA 4FNTA 2YZRA 3Q58A 4O50A 2Y70A 1KFCA 2DZXA 2VFGA 4PTNA 1KFJA 2WSRA 2Y7EA 1IIHA 2ZZ4A 3BG9A 1OVDA 3QQ0A 3LHZA 4N4QA 5CPLA 3KRZA 3W7GA 2ZZ3A 5FEXA 5FI8A 5TQLA 4LWWA 2X1UA 4LTSA 1LROA 1EA0A 5CZ0A 3PBVA 1XDMA 1XXXA 3PG9A 2EKCA 4S2BA 3L5MA 4IOTA 2A85A 1ME9A 4NX0A 5G2IA 3UYCA 3ZWTA 5I3FA 3MMTA 2YYUA 1R47A 1GOXA 3HF3A 1WQ5A 3CT7A 4H3DA 1H63A 1OYAA 2H8ZA 4UR8A 3O8AA 1F76A 4UTJA 4QNEA 4MJZA 1W3IA 2JK2A 3N9SA 4O1DA 3W6YA 2DP3A 5D03A 4JX6A 1W54A 5K4XA 5C5YA 1K7EA 3LGEA 3O63A 1LDCA 1ZAJA 1OYBA 1SU5A 5LHEA 3W1AA 2XN0A 1VHCA 4IUOA 4TMBA 2KZHA 2FLIA 5D2XA 1KM1A 4YMZA 3IIVA 2JBMA 3HGOA 1G4SA 5HMSA 5AC8A 4R33A 2C3ZA 3QSRA 2QAPA 1EP1A 3QQ1A 4JYFA 3G0UA 3C61A 1K03A 2YFNA 3F03K 2Z6IA 4POCA 5FF0A 2NLIA 1W8SA 4MJMA 1MXSA 3NQMA 1ALDA 1YDVA 4Q32A 5D32A 4IXHA 2YGYA 3A5FA 4LY8A 3NXFA 4O1AA 3TR2A 5C54A 2ZA1A 2C16A 3STCA 2CZ5A 1JR1A 3HG5A 4O10A 4K8EA 3S6DA 5C55A 2E6YA 1S5VA 1TRIA 2QCDA 2ZZ6A 3QFEA 3OVPA 3HBLA 4NX5A 3G3MA 4OV9A 3GR8A 3DKJA 3GLCA 2YPIA 1UUMA 2WJZA 4LUIA 4OT7A 4N2YA 3B03A 2CZFA 4OV4A 4AHOA 2NX1A 5DCBA 4Z0JA 3M47A 1N8FA 1T0OA 2A21A 3M0ZA 3S5NA 3TNOA 3O6CA 5CPMA 4BI7A 1OHLA 1YXDA 1AL7A 3GKFA 4GWEA 5SWUA 2YXGA 4OBTA 3IEBA 1KW1A 3L5AA 1JRBA 3R89A 4FNRA 1GZGA 3W2LA 4HIBA 4WZHA 1JUBA 3BGJA 3DFTA 2QUVA 4Z08A 1SZFA 1OFDA 2NUXA 2RHGA 5F1UA 3WK2A 4AH7A 1OFAA 2VC6A 2PURA 1SZNA 4O1CA 1VLIA 4B5NA 3NQCA 3O16A 3FA5A 1L6SA 3KFTA 1TSIA 3VFLA 1RV8A 2GPTA 3NQFA 2CLKA 4UCGA 3N73A 4RLIA 4WY0F 1DL3A 4LV9A 5EMUA 4Q4KA 4HKPA 5EBUA 4JS3A 1BEUA 3O6YX 3NEVA 1Z44A 3FOKA 3KRSA 3HG3A 3GVGA 4O0KA 2Y85A 3UWYA 4GUHA 4N6FA 1Q3NA 1OF6A 2B7PA 4BI5A 3E9AA 2P0OA 1XKYA 4IPIA 3V1PA 4QIUA 1YLVA 3MYPA 4XKYA 4YWIA 3P7YA 2J9XA 1TQXA 1KM6A 5K2ZA 1YDNA 1FBAA 1AW1A 3G1AA 1TPUA 1WBHA 1OX6A 3QM3A 3TFXA 3GIYA 4GC4A 4DO6A 4O28A 2D73A 5CPNA 2DJLA 3W7PA 3KVMA 3FKKA 3W1MA 2TPSA 3TA6A 3TQ0A 2OX1A 4NXKA 3W22A 1GT8A 3B06A 1AG1O 3UZ5A 5F1VA 3CB8A 1QO5A 2ALDA 3KHJA 5KSWA 3C4UA 4O57A 2OT0A 1TTPA 3W73A 4FXSA 3NQ7A 4Z1BA 1EB3A 5F2LA 3VE7A 2C14A 4Z1CA 1DVJA 3FS2A 3T7VA 2VFIA 1VCGA 1O5KA 4QM1A 1NFBA 1GEQA 3KRUA 3O07A 4M7TA 1ZHAA 1TPC1 2C18A 4ML9A 4GFSA 1PIIA 4K37A 3LCFA 4MFDA 4JTFA 4MZ1A 5LKYA 3TV8A 3FFSA 5D38A 1YYAA 3TAKA 1J4EA 4BR1A 4HSOA 4EVZA 1VYSX 2YX0A 3BW4A 4ZL1A 4HNVA 5BW6A 1D3HA 5LGXA 1OF8A 5FESA 2Y7GA 1FCVA 4JIPA 1A5AA 4NT0A 3OG3A 1W56A 1FWWA 4LVBA 5TBOA 3C8FA 3C2EA 3BVJA 3U2OA 3W7KA 3KVKA 1K7FA 3CC1A 1YXYA 4UFMA 3W1XA 1FCUA 3RMJA 2VELA 2DZWA 4UNKA 1GVQA 4XTIA 3T4CA 1H7OA 1KBJA 3NAVA 3BLIA 4AB4A 3QZEA 3GKAA 2G96A 1CI1A 1Z42A 4RZ5A 2G97A 4L4LA 1I2QA 1GVRA 3GK0A 1FY6A 1IF2A 3LHYA 4DXVA 3FJ6A 3LI0A 1U5JA 5D09A 1OFBA 1VYRA 3BG3A 3SSJA 1GG1A 5EYWA 3CWOX 3THAA 3LHUA 4UMBA 4JX4A 4O16A 1AMKA 2WNZA 4NJKA 1QMLA 2VEPA 5G4WA 1TPB1 3CU2A 2ABAA 3WK3A 3LCIA 2I9EA 5L9FA 4E2DA 4R34A 2GQ9A 2YR1A 3G8RA 3IGSA 2CWNA 2B7QA 2Q8LA 3H54A 4G1KA 3CHVA 3IRDA 2E1DA 4JR5A 1TB3A 3P81A 2HS8A 5J5RA 5KZEA 2G5WA 3LOTA 4DBDA 3PBWA 1G67A 4BF9A 1K3UA 4A3UA 1ZJIA 3T44A 5AYYA 3OEXA 2RKXA 2J6XA 3LI1A 1VCFA 2WO5A 3C2RA 1X1ZA 4FO4A 2QCNA 2Y89A 3G3DA 1LOLA 1YPFA 1ML1A 3HQ1A 3W86A 2OZ0A 3W07A 4TU1A 5BMWA 1W5OA 4CNOA 3I7QA 1G4PA 4D2JA 5DY3A 1LBLA 1FWNA 3NQEA 2V2DA 3KX6A 2B0MA 3UWUA 1O95A 1TRDA 4JTSA 4S1FA 5ABTA 3A9IA 1W5PA 2GVJA 3PBYA 3R5EA 2WNQA 1SSGA 2QCLA 3NG3A 4WOZA 1FXPA 2WQPA 3F4NA 4JIQA 3HPXA 3VKJA 4NJHA 4GRSA 1S5WA 4U28A 1W37A 3B0PA 1Q6QA 4FIQA 3W7OA 1SO4A 3C3NA 3LTYA 4R7JA 3WJYA 1QO2A 1JCLA 3G24A 3IGUA 5FF4A 2NUWA 1XCFA 1M5WA 1S5TA 2DZPA 3EX1A 4MIMA 3CEUA 4P61A 5AHEA 4DO5A 1L2UA 3W7QA 3GZ3A 4O4VA 1HG3A 3TKFA 3S42A 1LYXA 1F05A 3A22A 4JD4A 3L68A 3LCWA 5C2XA 3ZFHA 4NZFA 4UXDA 4ADUA 2VENA 5FF7A 4AAJA 3DFPA 4OWGA 2C15A 2OJPA 1B4EA 2ZA2A 3N19B 4JDBA 2AQWA 1TREA 3W7JA 3KVLA 3MHGA 4FNUA 2VFHA 5AFDA 4JGDA 4JY9A 3QMTA 4LUJA 3HB9A 4AWUA 4PH6A 3A24A 4M7SA 4GXMA 1G69A 3NQ8A 3V75A 2C19A 1UUOA 5E1QA 4O52A 3CIWA 3R13A 1RD5A 1LM1A 3HGRA 3NM1A 1GPWA 1XBZA 2ZZ5A 3LCLA 1YXCA 1VGAA 3OHIA 2Y6ZA 2NX3A 1NSJA 2ZA3A 3P5YA 4I9AA 4XZ9A 3JRKA 1A5CA 3M1ZA 4CCEA 2ZZ7A 3BW3A 4X3ZA 3PWAA 4FB7A 4IPJA 4BWLC 4AMAA 3QMRA 1ME8A 2GJLA 5DXXA 3CTLA 5KZMA 1NVMA 1GWJA 3LM7A 4RX0A 1W0MA 2A4AA 1D3GA 3DFSA 3WJXA 1ZALA 3BV4A 1YTKA 4MUZA 3W1LA 3NPXA 1OABA 5AC6A 4A2SA 2P10A 3TC7A 5HINA 2VEMA 5LZLA 3I68A 1F74A 4FX7A 3STFA 4NJGA 1I2RA 1WV2A 5AHLA 3NVTA 3ZR4A 4RR4A 3W74A 1Z41A 3G18A 1XBYA 4HT3A 4EOUA 1RZMA 2E68A 2X1RA 1OJXA 2DZSA 4M6PA 1L9WA 1LBFA 2Y7DA 3B05A 4GUJA 1TQJA 2FB3A 2VFEA 5K3VA 1IXPA 3TMQA 2VEKA 2QDGA 5T26A 4N9EA 1H5YA 3MO7A 3TSDA 3LCXA 2EAWA 5HWMA 5KINA 3A23A 3UXAA 3W2UA 1P5BA 1W3TA 1ADOA 1ICQA 5F4WA 3TK7A 3MI2A 3EKLA 5CGQA 5C6MA 1WXJA 3DH7A 4HN4A 2YDAA 4XBKA 3L65A 1PCKA 1VS1A 3LRKA 5AN7A 4MKNA 3PS7A 2Q8ZA 4FIRA 5IBXA 3C2VA 4XKYB 2YFOA 4MLRA 3DI1A 3O15A 5DY2A 1LRQA 4UTLA 3TIMA 3NQAA 3SW6A 4YXGA 1SZEA 3A21A 3FYPA 3IIZA 3G22A 3LBCA 4YLWA 4BK9A 2O7QA 3PM6A 4NNCA 3DENA 3LBMA 1WOBA 1UASA 3W1RA 1IXOA 3BG5A 3LX9A 4OU1A 3CPRA 5TIMA 4JYEA 2G95A 2W79A 4NUWA 1QOPA 4KKXA 4JTEA 3MBDA 4WY0B 4O8RA 5IBXC 2QUTA 5KTLA 2ZDRA 1AW2A 3AJXA 3GX9A 4K39A 3N3MA 3LLDA 3SIZA 5DCEA 3W7DA 5KMYA 3NQ6A 5CSRA 5DBUA 3ABRA 2GQAA 3FIGA 3SFKA 1Q45A 1RQEA 2Y62A 3W3OA 1T96A 4WQ6A 1SZGA 4RJEA 2QCFA 4XWUA 1TYGA 4MOZA 1TV7A 1AW5A 3I6RA 3LHTA 2J9ZA 3HPZA 2VFDA 1K7XA 4E38A 3E0IA 2QEZA 3RNDA 3TXVA 3VCRA 2C1HA 4ZQPA 3QH2A 1PHQA 3UWWA 1PE1A 1LTDA 5F2GA 3PUDA 3L5LA 4JX5A 1TV8A 2ZCGA 1OFOA 2OMAA 4WXZA 1JCMP 2ZZ1A 4JXCA 5D33A 1XBXA 4JTTA 5BMXA 1IGSA 2DJXA 4GUGA 5EY5A 5HUOA 4UFHA 3NPVA 1KLYA 5AHIA 5I3GA 3S0CA 4FEZA 3W72A 3LDVA 1YTDA 1EX5A 3W2MA 3GAKA 3BO9A 1JCNA 2A0NA 3KVJA 2PRLA 4L4MA 2ZRVA 3C52A 1ONRA 4HHPA 1JUKA 5CZTA 2Y63A 3PR2A 4FX8A 1TTJA 3B4UA 1H7RA 1BWKA 4IMCA 4PODA 4TO8A 3MJYA 3MI6A 2E6AA 4A29A 1H7NA 4PL1A 5DCDA 1XC4A 4WXYA 3PG8A 3S1UA 4GUFA 1G7VA 3W7NA 2J24A 3L0KA 4MZ8A 2ZYFA 3G1XA 3RLVA 4LVDA 1KM5A 3MW7A 3EWZA 1ZFJA 1KTNA 1TPFA 3GNDA 1VCVA 3P8IA 4O53A 1GYNA 1GTEA 3WFAA 3ABOA 4KFNA 1A50A 2E6DA 1LLWA 5CZSA 3NL3A 3BW2A 2YSWA 2X1SA 3PULA 5AYXA 2UV8G 3TH6A 1WYIA 1QAPA 3W7CA 3SGUA 1W1ZA 3Q94A 4JTGA 4GNJA 5AHMA 1KFKA 1W31A 2BLEA 4UMCA 1MEIA 1MO0A 3USBA 3TCEA 1XBVA 5AC7A 3QC3A 4C1KA 1H50A 4O11A 1R46A 5G5IA 1KV8A 4U4MA 1CW2A 3T78A 4N6EA 2FPYA 2ZZ2A 3W2KA 3QW4B 1XM3A 3C0JA 3GXPA 1VQTA 1UB3A 2RDTA 2E09A 4LV4A 1R2RA 4LVFA 4LRTA 3RF9A 2PRMA 1TTQA 1WAUA 4UUIA 1DOSA 4KWVA 1TPVA 4NJJA 1MZHA 5I3KA 1G4EA 1MEWA 3STGA 4JY8A 2GJNA 3W2NA 3NA8A 3L21A 3LTSA 4IJBA 4KFPA 1ZNNA 4O54A 3WK1A 5D30A 2H3DA 1K8ZA 3EWXA 3YPIA 4DEFA 4ZQNA 4NNBA 4AXKA 3M41A 1MEHA 1LCOA 3UZJA 4ZMGA 3DBPA 4YCPA 3VI2A 1P1XA 2E5DA 3P67A 3HO8A 4IMFA 1TTIA 4FNQA 1SO3A 3P80A 2WOQA 1FCQA 1K8XA 1S3HA 4UFLA 2NV2A 1T8XA 1IIGA 2W6RA 1OG0A 1VZWA 4JN6A 2QAFA 3G1HA 2VEIA 2FDSA 2ISSA 3T40A 3EWYA 4UC5A 1EPXA 1FDZA 4NZJA 3TAOA 3M16A 1WX0A 3W2JA 1LRNA 4DPPA 1G7UA 2FPTA 2JKEA 4A2RA 1WOAA 2Z6JA 3G0SA 1PVNA 3PB0A 4RXFA 4FNSA 4OHQA 4PA8A 4R53A 3GNNA 4ORMA 3P82A 4DQWA 3TUUA 4Q33A 5D02A 3TE9A 1TCDA 3U8GA 4I7VA 1XFBA 1A5BA 1OX4A 5U4NA 5KITA 4IWWA 3P62A 2EHHA 4LC6A 1OFPA 1KFLA 4Z1AA 3QF0A 3VNDA 3NYZA 3W85A 3DI0A 1EIXA 3W7IA 4X2RA 1J5TA 2QF7A 4HNTA 3QPYA 3T55A 4K7YA 2R94A 5LNWA 3B8DA 3HOJA 3P5ZA 3CM4A 1XDLA 3S5OA 5G1TA 3BLEA 1QCWA 1PHWA 2CFFA 5I3IA 3NL5A 2CLHA 3TC6A 4RCXA 1HL2A 1ME7A 5CZJA 5HWNA 4EWND 5K9XA 2WKJA 2QUUA 1DORA 3LV5A 4QJ1A 5G2WA 2A6LA 2H90A 3MUXA 2W0UA 3I65A 2Z1BA 1JCYA 3MP4A 4MZYA 2BX7A 2B7OA 5D37A 6TIMA 1I4NA 1FWTA 2QJHA 1TV5A 3GDKA 2NUYA 4HPJA 2V0TA 1TJPA 4C1LA 5BNKA 1B9BA 2ZRUA 3L0GA 2ZFAA 3M5XA 3VE9A 3ATYA 2H8XA 5EA9A 3OVQA 2QCDB 1F2JA 1KM0A 1TJRA 4K36A 3B0VC 1NAL1 1ZAHA 1H7WA 3UY8A 2JGYA 5D2WA 3FKRA 3PUEA 1LOSA 5DBTA 2ZRZA 2ZRYA 2Y61A 1OX4B 3GDTA 3OIXA 1JQXA 1UCWA 1JJKA 1SW3A 4XUGA 2EGZA 5E93A 4M6VA 3DHDA 3W7MA 3JR2A 3RK8A 5FF3A 3PVFA 4EF9A 1H60A 3S9YA 3C56A 3ZS4A 3GYEA 2RDWA 4AHPA 1MSSA 4Z1DA 1YPIA 3TJLA 3HG2A 4NJIA 2CZEA 3P60A 1K02A 4AHQA 3AO0A 2Q3OA 4N9CA 5CPOA 3UWVA 2F7FA 1QDSA 4ZQCA 4NU7A 3W7RA 1EUAA 1HFBA 1TPWA 3ZWSA 1HUVA 2CW6A 2TSYA 4JTJA 4JDYA 1KTBA 3L9CA 1X1OA 2CLIA 5L6UA 1KFEA 2FIQA 4RZ6A 4GE8A 3PSVA 1SW0A 3GDMA 1GVFA 1FCBA 3F1QA 1F6PA 5HR7A 1Q6OA 2QCHA 4ALDA 1L6YA 2HSAA 4Z0SA 3S5ZA 3GXTA 3NGJA 3SZ8A 3N14A 4UTUA 4HNUA 4ONVA 2V9DA 3OBKA 1SO6A 1QNVA 3FLUA 4ORIA 1DBTA 1F6KA 4X9SA 1GVOA 4PFMA 5AHFA 5CG7A 1H61A 8TIMA 1FUYA 2BWGA 1VHNA 2ISVA 4UTWA 3MWAA 1R2SA 1XUUA 2NZLA 1O60A 4ZQOA 4JTKA 4FX6M 4O14A 4UIOA 2PE4A 3QW3A 4JNMA 3TSBA 2NX9A 3EXTA 1FWSA 4I7UA 3SR7A 3ABSA 2DZTA 1LBMA 3W7EA 2V5LA 3LTPA 1JVNA 2YCEA 3WJZA 3DGRA 3BLFA 3IV3A 1JQVA 1SSDA 4O15A 2CLEA 2TYSA 3W76A 1GTHA 1YADA 2WNNA 1SR9A 5LNRA 1LORA 1RQHA 2NXGA 3W83A 3A5VA 4YL2A 4MYAA 3LRMA 3FYOA 5HWJA 3W1TA 1Q6LA 1H62A 3NM3A 2A2IA 3IVSA 3KAOA 2NXHA 1XUZA 3Q2DA 2GVGA 2FFCA 3W75A 3TDFA 1L6WA 1PS9A 4MFEA 1P4CA 2AGKA 3UNDA 2ATMA 3O05A 1M6JA 1SUXA 2XN1A 1RQBA 2ZBTA 2FPVA 3MYOA 4FF7A 1GG0A 3LXCA 4RZ4A 3WJWA 1EWDA 1OFRA 5G4EA 1KM3A 2QCEA 2PCQA 3EX3A 5HULA 1FX6A 3IIOA 1HO1A 4UTIA 1TO3A 3EWBX 3PC0A 3EX2A 5D2YA 3PUOA 3TXZA 3O1NA 4FHAA 3LRLA 1PCWA 5DELA 4AVFA 3KOFA 3DFOA 3GDRA 4OGZA 5EKYA 2Q3RA 3I7SA 2GUUA 3MBFA 1G6CA 2CLOA 1Z48A 2HMCA 3LHWA 4X22A 3M6YA 3UWQA 2WPBA 3NQGA 2XN2A 2TRSA 1TPDA 2LLEA 3SJ3A 1KBIA 3QEZA 4XBSA 3EWWA 1OK6A 1O4UA 3LXBA 5FF2A 3S1VA 4JEQA 4RV8A 3JS3A 4O13A 3GR7A 4JYDA 5FEWA 3HG4A 2H6RA 1KV5A 4HSNA 3LERA 5J5DA 1AL8A 1OYCA 3BARA 3MP3A 1YDOA 1JCJA 1M7OA 2BZNA 1T99A 4HPXA 1QPRA 3M44A 2OT1A 5MHBA 2YYTA 4N9DA 3TMLA 1ZENA 1R2TA 1SW7A 3W84A 1P0KA 5BOOA 3BK0A 1KM2A 4PL2A 2BXVA 2V30A 1F73A 4PEKA 3L0NA 1AK5A 4CQAA 3C6CA 3GDLA 1I2NA 2RFGA 6ALDA 1BKSA 1DHPA 2QKFA 1RPXA 4LVGA 3MI3A 1DQXA 2YW3A 4S2CA 4UTMA 2V81A 1LZOA 2O7SA 1F7BA 2GVLA 4UFIA 4BWLA 3HPSA 1NEYA 3G0XA 2E5BA 1V7YA 1ZY9A 3C2OA 2B4GA 3NDOA 1X8FA 3DAQA 4UTHA 1J2WA 4LS2A 4N4PA 3PF3A 1KA9F 1IXQA 4ADSA 3W1PA 3L66A 3NPWA 4Y9AA 4RK8A 4DF0A 5H91A 3L2IA 4WD0A 2VXNA 3G1SA 5E0KA 2VFFA 3THQA 3N9RA 3MHUA 3INPA 4KWWA 3UPBA 1FWRA 1NF7A 1H51A 1VC4A 2WSYA 3NZ1A 3ABQA 1C29A 1N7KA 3RLUA 3P61A 3LV6A 1H7PA 3NQ2A 4PC8A 4QAIA 4NQ1A 2CLFA 2CLMA 3TSMA 1LLZA 5LHFA 1DQWA 3FJLA 3MHFA 4IX2A 3ELFA 4LS1A 3L67A 4CLMA 4Y6GA 2V82A 1RVGA 2E5CA 2ZTKA 4N9BA 2Y7FA 4O12A 3NNTA 3DFQA 1HO4A 3FEMA 5HR6A 3EX4A 2QJIA 1N55A 3LXAA 2FB2A 4GBUA 4CCDA 3DU0A 3STEA 3DFNA 4CCCA 3W1QA 1QPOA 1FDYA 3G8EA 1JRCA 3EEGA 5F2IA 1CX9A 3HGJA 1QPQA 3EXSA 2NXIA 2HS6A 1ICSA 2TMDA 4AWTA 3EX6A 2CLLA 1RR2A 3HJZA 2NWRA 1EP3A 4M19A 5U7SA 3EB2A 1GQNA 2DORA 5BRBA 4MPQA 3PB2A 4EF8A 2AAMA 3DKLA 2CZDA 3UWZA 3E96A 4M6QA 5DXYA 3QYQA 1I2OA 3B0UX 3NR0A 5EL1A 4HNNA 3C2FA 5H2ZA 4A21A 3F4WA 4AF0A 1SQ7A 1VH7A 2CU0A 3RU6A 4UFJA 5FEPA 3H53A 2A7NA 4K6AA 2J88A 1XL9A 1U83A 2OCZA 3IGXA 1X6UA 1PV8A 2JKPA 3G1VA 3IIXA 4QITA 3PBUA 3W23A 4WX2A 5LSMA 2J9YA 1VYPX 1TPEA 4XQ6A 2X2GA 3IVTA 1G4TA 5D05A 4UFKA 5G2HA 1R30A 1WA3A 5LNUA 4LRSA 3NL6A 3O6DA 3PSWA 1OFQA 3BGGA 1OFEA 2J27A 3O06A 1D9EA 4LW7A 3W7HA 3N2MA 1HTIA 3EKZA 4J9JA 3PAJA 1WBJA 3TROA 1GVSA 4ZQRA 1B57A 3ATZA 3QJAA 4QNWA 3R2GA 3P74A 3EXRA 4AWSA 1PL9A 4N02A 4UTTC 2ZRWA 3R8RA 1I2PA 3NQDA 2JGQA 2X30A 4LNYA 3QRHA 1WDWA 1B4KA 1C9DA 3BPWA 4JTLA 4IXXA 1VR6A 5DLCA 2GQ8A 3SY5A 1SFLA 3N34A 3QMSA 3IIPA 4IGHA 2VOMA 4WJEA 4ZVJA 5F4XA 2H3BA 1LRTA 1ZCOA 4UR7A 4Y8FA 3CIXA 3QSTA 1SPQA 3PY2A 1OK4A 3SGZA 4OE7A 2R91A 2F84A 4MVAA 2ABBA 2V5BA 4M5PA 3WJSA 4E0CA 1ZAIA 3W70A 1QWGA 4QQ3A 4MY9A 5IM51 4UTKA 2I1OA 1JULA 3MP5A 3NL2A 2BTMA 4DO4A 4I7WA 3CWNA 4H6KA 4JTUA 4MYXA 5K4ZA 4KFOA 1K8YA 1BWLA 3S5YA 1UJPA 2R14A 2ATSA 4LU0A 1W5MA 1DJNA 3TX9A 4MLJA 1TMHA 4CNNA 2ISWA 5KZDA 3KXQA 4AF0B 1SO5A 1LP6A 4WY0A 4TX9A 1FQ0A 1JUEA 2IQTA 4IMDA 4DELA 5HUPA 7TIMA 3SI9A 4OQVA 2V2HA 1BTMA 3S8HA 5GVJA 4O17A 1IXNA 4O0ZA 5LNSA 4RXGA 4QSHA 3EWUA 3HIJA 2A6NA 5G1YA 3NO5A 5D04C 3U6WA 5K9CA 2E77A 4TIMA 2B7NA 4NXSA 1LOQA 2R8WA 4TMCA 5AHNA 2C0AA 5I3HA 5I3JA 3TFCA 3B04A 3OA3A 2RDUA 1TIMA 3DHFA 3DXIA 2FQIA 3M5YA 2WV8A 4CQ9A 1OX5A 4BFAA 2V8ZA 3H55A 2ZQ0A 4QISA 4WUIA 1E51A 5CSSA 2A7PA 5AYZA 2QCGA 3HMJG 3S1XA 4BI6A 4E2BA 4AEOA 3M5VA 4JICA 3TQKA 4H4IA 1H1YA 2JKAA 1XI3A 1W3NA 1SFJA 4K38A 3TW6A 3CLMA 2V2CA 5DN1A 4CQ8A 4MY1A 5LGZA 2E6FA 4IX0A 2PRHA 4O19A 3N2XA 1EUNA 2GOUA 1GJPA 4ICNA 2HTMA 2DU2A 1DJQA 3LCHA 4GUIA 2C13A 2RH9A 3IVUA 2P1FA 2ZRXA 2WSQA 4ZZ9A 5A5WA 4NVTA 3QPZA 2EPHA 2QCCA 5K7JA 4ADTA 1QFEA 1EP2A 1FXQA 5EPDA 1KTCA 3W9ZA 3UY7A 4IMGA 2DZVA 4O18A 3TQVA 3W7LA 4UTWC 4DF1A 1H7XA 3ANYA 1ICPA 3NQVA 1X7FA 1O5XA 5HNRA 1P0NA 1Q6RA 3TJXA 3W87A 2VKZG 5HQEA 2A5HA 3LLFA 4LOCA 1A5SA 2QJGA 4JTIA 4DF2A
chains in the Genus database with same CATH superfamily
1YEYA 1ZJAA 4O1BA 1V5XA 3M7WA 2RGMA 1UQYA 1TWZA 1EWEA 1TZ7A 2WJEA 4P2VA 5F4SA 1Y0EA 3LG3A 2XSXA 2OQYA 2FJKA 5LNVA 4JNYA 1UQZA 2E28A 2A1YA 1UZ4A 3M9YA 1TPH1 4H9XA 1GOKA 4ZE4A 4ERAA 3W71A 2WZEA 4TR9A 4I5UA 4G7FA 1GYLA 1DKWA 3M43A 5T9CE 2DT1A 4Y9OA 4IQLA 1XFCA 2Y88A 1EZWA 3DEQA 2WCSA 3TOPA 1FWJC 4V1XA 2GDUA 3NPUA 3GXNA 3G1DA 4E2OA 1F6YA 5I00A 5F2MA 2YW4A 4EKJA 3OODA 1UBSA 3M0VA 3VXGA 1GQIA 1UA3A 4REQB 2I17A 1Z89A 3ARTA 2PDQA 1KLZA 1BYCA 3R12A 4Y96A 1R5YA 3W6LA 1QW9A 4DJFA 4K7VA 4DLFA 4JBRA 1E6NA 4W9TA 3KOWA 4W88A 1Y8BA 4LS0A 4HD5A 3E02A 3BOLA 3E2RA 5JXQA 3RU8X 1L0PA 4GJ1A 5FJOA 2QMKA 4DPQA 1QPNA 2DZUA 3QZAA 4WOQA 4H9VA 5LXEA 4TUFA 1K9DA 3W1NA 1B3OA 4GVFA 1LQ2A 1HL9A 1VJIA 4DJDA 2XFYA 1KGUA 4Y90A 1DTNA 1OGSA 5DO8A 3DZ1A 4C91A 1GORA 1V8EA 4PRWA 3WUBA 1YBQB 3CTTA 3NTYA 2BVWA 4F48A 2GGGA 1TCMA 1KD0A 4EIVA 1G94A 3K46A 1NARA 2OX4A 4C6NA 3Q58A 1XG3A 1E9IA 2DZXA 2I5GA 4PTNA 1KFJA 1XIIA 2ZZ4A 4DLMA 1OVDA 3LHZA 2QMJA 4LWWA 3EMQA 4J2PA 1KR0A 3V5CA 5LIXX 3WLJA 4HB7A 1YDYA 4PUWA 4B5XA 3EDKA 4A8NA 3UYCA 2A85A 4D72A 4LAZA 2YCKX 3M7SA 2W91A 1JL8A 3CT7A 2PDPA 3I3DA 2NQLA 4FMVA 3O8AA 4MJZA 5LIUX 3HFYA 3N9SA 3F2CA 4OOZA 1ECEA 2PC8A 5D03A 2QZRA 6CGTA 3F4VA 1HKMA 5I77A 2PS2A 4JX6A 1Z7AA 4KETA 5K4XA 4TQTA 4UQEA 4YVVA 1K7EA 3VNIA 1LDCA 1ZAJA 1OYBA 3JZUA 2GGJA 1H0IA 2VDIA 4OKDA 3VIFA 3NSNA 3VVGA 4GD0A 3A4JA 3KWSA 5I2UA 4IQEA 1KM1A 4LGXA 1WB0A 3UR7A 2WWDA 1R7AA 1EP1A 3QQ1A 2GGEA 3SCSA 4EPEC 2EPLX 2YFNA 2QJMA 3GVWA 4M1BA 2QUMA 1W8SA 1B30A 2IPWA 2YGYA 4Q7IA 4DUWA 2C16A 3WLSA 3GXIA 4XZHA 1OCQA 2CZ5A 1NDZA 2IXUA 1AQHA 2BOFX 1U1JA 1XR2A 3QFEA 3CUZA 3F7JA 5FIPA 2WJZA 1F3EA 3R58A 3UA3A 7CGTA 1XX1A 1W3JA 2NX1A 4Z0JA 3S5NA 4Z17A 3HFTA 4ZXOA 4E8CA 4MB1A 3ALFA 4C6LA 3PWGA 2R9RA 1OHLA 2B31A 1US0A 3MS8A 3ZOAA 3N18A 1KW1A 3HV9A 3OTRA 4FLOA 3OP2A 1GZGA 3E0VA 1LLOA 3BGJA 3MKVA 5RUBA 5F1UA 1ONWA 2VDGA 3CZJA 3QBUA 2E25A 2PURA 1W1PA 1Y7VA 3VKAA 2CZVA 1BSLA 1S2WA 3FA5A 3O16A 1FHDA 4R88A 2WCGA 1L6SA 3KFTA 1RY8A 1AVAA 4YTQA 2B81A 3BCDA 3LGDA 3N73A 4LV9A 5EMUA 5EBUA 1IE7C 1MXGA 3VA8A 1BEUA 1TX0A 3O6YX 2YL8A 2Z1KA 1XG4A 2XH0A 2D0HA 2Y85A 1W91A 1OF6A 4QSFA 5CAHA 1PEZA 3F2DA 1WZKA 1XH0A 4HTYA 4QIUA 3MYPA 2BG5A 4XKYA 2XIMA 3P7YA 4D8AA 3M0XA 3V5FA 1QWKA 5K2ZA 1NP0A 1TPUA 2ZUWA 4EP8C 3TFXA 4GC4A 4LBSA 2D73A 5CPNA 4HP5A 1A5NC 2OX1A 4IP4A 3JU2A 3URQA 1GT8A 3SBFA 1PX4A 4LF1A 1RY0A 3SCOA 2WVTA 4AZBA 3CB8A 2ALDA 3WQFA 4O57A 1ITQA 4PTMA 3A47A 1E5NA 3PTMA 4XUYA 1Y65A 4DZHA 5F2LA 4Z1CA 3N04A 2PDGA 5HQLA 4HMEA 3N15A 4QM1A 1NFBA 4LUTA 1ZHAA 4G1NA 4GFSA 2ZXQA 2OLHA 3UR2A 3RR4A 3FFSA 5I7GA 2YX0A 3UJRA 2YB1A 5LGXA 1OF8A 3AYRA 1F8IA 5FESA 4X60A 3VKBA 2X7VA 1A5AA 3C2EA 3ARXA 3IV8A 3KVKA 1KCLA 4QDMA 1K7FA 4DRSA 1GW1A 2P3ZA 3NZPA 4B5TA 3OGVA 2DPEA 2VELA 2FGLA 5DF0A 1TV2A 4XB3A 3TTEA 4L1WA 1CI1A 1P48A 4RZ5A 3RX3A 3GK0A 1FY6A 5EMMA 4DXVA 2O9OA 3FJ6A 1U5JA 5D09A 3O0FA 1V03A 3RMEA 2D0GA 4PB4A 3CWOX 3VOFA 3LHUA 4O16A 1AMKA 3ARYA 4NZCA 1SYTA 1UWSA 1ZSXA 2J7FA 2ZC1A 4J2MA 1TPB1 1ZBKA 3CU2A 3WK3A 5A6JA 4H8HA 3VU2A 4E2DA 4GIYA 4GYFA 1K70A 2GQ9A 3SCVA 3T1GA 2GWNA 3AMGA 3SY1A 2B7QA 2Q8LA 3H54A 2Z1XA 3OA5A 2BXZA 2I16A 5J5RA 1JXJA 4GQRA 3LOTA 2J79A 5ABFA 1G67A 4BF9A 4A3UA 1ZJIA 4W8LA 1FP8A 2ANUA 3SUVA 1W1VA 2RKXA 4XD4A 2J6XA 2WO5A 3C2RA 2Y89A 1LOLA 1YPFA 3W86A 3W07A 3WEMA 4PBGA 2X40A 1W5OA 1EDGA 1PXGA 4CNOA 2WM1A 3CL6A 3FVMA 2POZA 1JZ4A 2V2DA 1RK5A 4JTCA 2B0MA 2J77A 1VPYA 3GIQA 1JCTA 4XO7A 4JTSA 3NG3A 3CV6A 2EXOA 3F4NA 2G3IA 4KEVA 5FSEC 1IZJA 1MXDA 1OCNA 4GI9A 3DUGA 4ES4A 7REQB 1Q6QA 4FLRA 2DY3A 1LQAA 1B1YA 1TUFA 1V6TA 5C71A 3IGUA 1SJAA 3G6LA 4S3CA 1IT8A 4A8LA 3W7QA 2WNWA 1HG3A 3S42A 1R3RA 3VO0A 4NZFA 4TVCA 3WBWA 4ADUA 4L56A 2VENA 2CYGA 3DFPA 1V3LA 2PWGA 2C15A 2IPGA 3N19B 3CQJA 3KVLA 3MHGA 4FNUA 5AFDA 4JGDA 4PH6A 4GXMA 2PTWA 4P5UA 4CU6A 1UUOA 1ZP3A 2OYKA 5E1QA 4O52A 3CIWA 2POTA 1P1MA 1LM1A 3HGRA 3NM1A 2QJNA 1VGAA 2VWTA 1UZ1A 5LIKX 4B4FA 3H2AA 1A5CA 3M1ZA 4CCEA 2ZZ7A 4QJ4B 2PWVA 1ME8A 2GJLA 2ZUMA 3CTLA 1GWJA 4PUDA 3SCQA 3CGTA 1D3GA 1YTKA 3W1LA 3NPXA 1BHGA 1R3WA 5HXMA 5LZLA 2PZ0A 3I68A 1V7AA 4FX7A 4BF7A 1KXTA 3STFA 2GJRA 3DGBA 5AHLA 2QF8A 2W27A 2BY3A 3ZR4A 4C6BA 3LLXA 3P0XA 5HPCA 1Q4NX 2GOKA 2EBNA 5A6BA 3PZMA 4EOUA 2X1RA 3L4TA 2DZSA 2X8RA 2CHNA 1L9WA 1LBFA 4Q4MA 2Y7DA 3BDKA 4RZBA 5PTDA 2FB3A 1WDQA 5K3VA 3TMQA 1RLCL 5T26A 4N9EA 1H5YA 3GFYA 2QPXA 4BCEA 3Q65A 1I75A 3A23A 3UXAA 4AW7A 1YKWA 1P5BA 2ZUUA 3U7BA 1IQ8A 1PZ2A 1ICQA 1SMDA 4JIEA 4PMOA 2J7BA 2PWFA 3MZ2A 4ASTA 1PCKA 2PP0A 3LRKA 2H9AA 5AN7A 4MKNA 3DOPA 3RYSA 4FIRA 2PDUA 5IBXA 1T8QA 1DWAM 1TIWA 3WX7A 1FHLA 4K68A 3U48A 2AGTA 1JYVA 2W63A 3UF9A 3SW6A 1W1IE 4YXGA 2ACRA 4DYJA 4DJFD 1XKJA 4DZIA 1SZEA 2J6VA 5KEZA 3A21A 3NJ3A 4CD8A 2O7QA 3FNDA 3PM6A 5FSDC 2JFEX 5A6MA 3SJNA 1L6FA 5EMLA 4JZ5A 3LX9A 3QVQA 4S39A 2O9TA 5TIMA 3AICA 2G95A 2W61A 4PSRA 4S3JA 4KKXA 3MBDA 1SJBA 4O8RA 2QUTA 1HZYA 2YZ5A 1UZHA 4GC3A 4PUKA 1PTAA 1UKOA 3UW6A 2FMNA 4K39A 4HOXA 3N3MA 1K4HA 4BHYA 1GW9A 3NCOA 3NQ6A 5CSRA 1UR1A 1W9VA 2GQAA 3ABRA 2QVHA 3FIGA 1RQEA 3A3HA 5EMKA 2Y62A 1JYXA 1TJ0A 3EWCA 2VR5A 5CBIA 1T96A 2NQ9A 5IDIA 1W9UA 2QCFA 4IGNA 1TV7A 4LCSA 2W66A 4KIEA 1PZ3A 3OVGA 4OOUA 4LF2A 1K7XA 5EFDA 3RX2A 5I5RA 3TCSA 1E4LA 2C1HA 2DV0A 4NP7A 3UWWA 5C9ZA 4JX5A 2JF6A 1JI1A 1UWAA 4WKFA 3T2QA 1OFOA 2I5QA 1UR0A 2IUZA 3N29A 3NYDA 5BMXA 3WELA 2A3AA 3THDA 3S0CA 2PSNA 1LWIA 3RITA 3IK4A 3R7MA 3SDOA 3LDVA 4KEMA 3RLHA 3S6OA 3NSMA 1FKXA 1UBPC 1UYQA 3AHXA 1JCNA 2VMFA 4P8XA 2PRLA 4L4MA 2BS9A 3EPOA 1UR4A 5C0QA 3HQNA 4AWEA 1ONRA 2JEQA 1JUKA 3PR2A 2VI0A 2GK1A 1XCWA 4W4QA 4PODA 8XIAA 1QI3A 2PI6A 4GUFA 3PFRA 1KM5A 2GDVA 2VC5A 1JZ6A 2HE5A 1KTNA 1TPFA 4LB4A 1AH0A 3WLLA 1VCVA 3P8IA 4D6EA 1GYNA 4C1NA 1A50A 1LUCB 3E5BA 1X7IA 3BW2A 3H2FA 3MVTA 1U5HA 2J7GA 3UG4A 5AYXA 1HIZA 4C7DA 1E5JA 2DUXA 4ZOCA 2AL1A 3LY0A 3PZVA 1UWIA 3Q94A 4GNJA 5AHMA 3SUTA 4ZO6A 2BLEA 5FJUA 3GH7A 3TCEA 2X1IA 3CUXA 3QC3A 1JPHA 4WSHA 1H50A 1QW7A 5DT7A 2NSXA 3ZSSA 1KV8A 3MKCA 2ZZ2A 1BPLB 1CCWB 3LM3A 3C0JA 2PZNA 3KP1A 1BXNA 1UB3A 1H41A 3EOOA 1JZ5A 5AECA 3FV9A 2OXNA 2D2GA 1W3KA 4LVFA 4LRTA 1TTQA 4KWVA 3CHEA 2E8YA 4NJJA 5H8PA 1KRBC 5I3KA 3OZPA 3BUVA 2EEXA 4KFPA 1GHSA 4F2BA 3L4ZA 3BMXA 3B8VA 3YPIA 1KBBA 4LEFA 1MEHA 3COTA 1TFVA 3UZJA 3PZQA 3BICA 3GNOA 3KOXA 5D8WA 3JVAA 3P67A 3HO8A 4AXNA 1TTIA 1WE5A 2Y5SA 3IK2A 3GG0A 1FCQA 3N6JA 1K8XA 1S3HA 1EC7A 1E9YB 4ZTYA 2OOFA 2W6RA 1AJ0A 4JN6A 4M56A 4X0VA 2FDSA 4UC5A 1EPXA 1VD6A 1ZBVA 4PN2A 4BQ2A 3K5XA 3TAOA 3M16A 3CT2A 3W2JA 1LRNA 1BSIA 2FPTA 1RCOB 4NIRA 3M46A 1X96A 2Z6JA 1PVNA 3PB0A 1FHVA 2FZBA 2V3FA 3BJFA 4ORMA 2ZX9A 4DQWA 4Q33A 4AEFA 3TE9A 4GQBA 3U8GA 4AC7C 1XFBA 1A5BA 1OX4A 5KITA 4IWWA 2CERA 2EHHA 4Q6JA 4AFYA 1E1FA 1OFPA 4TX8A 1T7LA 3NYZA 3QHNA 4NILA 4X2RA 3HV8A 3QPYA 1GVIA 2OEJA 2R94A 3B8DA 2YL6A 4H8NA 3WH7A 1R9XA 4HMNA 4FK9A 3BLEA 4Q8PA 5I3IA 3NL5A 1EEXA 1S5MA 4ZFCA 4Q4PA 4GX9A 1Q63A 2AOSA 3RM8A 3M0LA 3N3TA 5TAOA 1ZUAX 3FAXA 3U4FA 5REQA 2Z1BA 2XIIA 4C7FA 3MP4A 1DEDA 4GY7A 5B80A 4F2UA 3EPMA 3QV7A 2DW6A 4XZNX 4XD5A 3IJ8A 2D20A 4C1LA 5BNKA 1GK8A 2ZRUA 4PTWA 4FXJA 2QCDB 4HOWA 5HMFA 1TJRA 2WQDA 4K36A 3B0VC 1ZAHA 1U33A 4NHVA 4JFTA 2FZ9A 3MQTA 3UY8A 3FKRA 3PUEA 1US3A 4AY7A 4GI6A 2ZRZA 5JVLA 3GDTA 4Q8VA 5IHSA 3OIXA 1JQXA 2UY4A 3H2NA 3ZYZA 3RK8A 3PVFA 4EF9A 2WMFA 2JALA 1HJSA 1BAGA 4JL1A 3AIVA 3CNYA 3ENLA 4Z1DA 4INFA 2BGNE 1K02A 1WZMA 3P60A 1ZL1A 1XICA 4BJHA 1QDSA 3OG2A 4ZQCA 4JTQA 3FVDA 2CW6A 4JTJA 4MF4A 4D6CA 4IJRA 1GVFA 3F1QA 3MJMA 3GXTA 4UQDA 3NGJA 3B8SA 3VKDA 1EJWC 4L65A 1EZ2A 1XPGA 5JIPA 3OBKA 1TMQA 1EHNA 4ORIA 1DBTA 1LL4A 1PKMA 5A95A 2ISVA 1JZ2A 4N42A 4F9JA 4J3TA 2PFHA 1XUUA 1IWPA 4P7QA 3WUFA 3GXDA 4JTKA 4RV3A 4FX6M 2REQA 1AJZA 4O14A 3FHAA 2INEA 2XH4A 4I8DA 2CXEA 1CYGA 3BSGA 3KHDA 2NX9A 3EGJA 4I7UA 3VIOA 1LBMA 4GZIA 4GQ0A 3LTPA 1XLJA 2G0WA 3WJZA 4MB4A 3BLFA 5AKQA 3OYZA 1JQVA 4FA3A 4O15A 2GUBA 4EWJA 5DT5A 1XQLA 5LNRA 1LORA 2FHFA 1XLDA 2ZADA 1EC8A 4HU3A 1Y5VA 4YL2A 4IZGA 3MANA 3MA8A 3FYOA 3W1TA 2XU2A 1GCYA 1H62A 4W8BA 1C91A 3W75A 1RP9A 3PZTA 4WEVX 4PMNA 4MFEA 3CH0A 4PZVA 3O05A 5IFTA 4GIRA 1K77A 2G50A 1S2UA 4I9JA 2VYOA 2ZBTA 1MI3A 2OODA 3BL3A 1GG0A 1Q6CA 1J6PA 2YKKA 2FJUB 1A0CA 1CT5A 1TO3A 3PC0A 2E7FA 5D2YA 3TXZA 2HV5A 2PDIA 5DELA 3KOFA 1JI2A 3GDRA 4DAIA 4OGZA 2J78A 3M6YA 2WPBA 1LWHA 1ISZA 3W82A 1KBIA 4Q8UA 4JEQA 1TVPA 5LA1A 3GR7A 2H6RA 1KV5A 1Q5MA 4H9UA 3WBYA 2ZXDA 4IGSA 3LERA 1AL8A 1K8CA 1Q4WA 2INFA 3IS4A 1QNOA 3A6OA 1T99A 2YYTA 4N9DA 4HJWA 1TELA 1SW7A 3SRKA 5AC4A 5BOOA 4I8YA 1KM2A 2DH3A 1V93A 4FR6A 2V30A 3L0NA 4CQAA 3GDLA 1BKSA 1N2VA 2VUYA 1OZQA 3MI3A 2OPJA 4ROPA 3IJDA 5EBAA 4UTMA 1LZOA 1F7BA 4BWLA 2Q01A 3HPSA 4CEUC 1M53A 1VBRA 1ZY9A 2CXGA 5EMJA 3C2OA 2B4GA 5CZKA 4Z2IA 1MQPA 3IJIA 3GXFA 1J2WA 4FOUA 3RPMA 5HJXA 2PLJA 2VWSA 3AS0A 3OJGA 4ZE5A 4NAEB 5ABHA 4Y7EA 2DFAA 4HNLA 3NPWA 2FVLA 4N0RA 2ZUTA 1WXYA 2VXNA 4A35A 3INPA 3GW3A 1FWRA 2WSYA 1LT7A 1BQCA 2A3CA 4DWSB 1YHTA 1C29A 3RLUA 4BQ4A 1H7PA 3NQ2A 3KW3A 4NQ1A 5BXSA 2CLFA 5JBFA 5LHFA 4XAYA 4HPGA 4Y6GA 2V82A 1BG4A 2E5CA 2UY3A 4N9BA 1E55A 3DG6A 3NNTA 1J0YA 3VDHA 3BWWA 2QJIA 1N55A 4GBUA 3DU0A 5CSYA 3W1QA 3WNOA 4NZ1A 1JRCA 4W84A 3CBWA 3ARRA 5F2IA 3HGJA 3KLKA 1CXEA 5M17A 1GONA 4Q8MA 1ICSA 2TMDA 4X2PA 3EX6A 1CIUA 1PJ9A 2I56A 3HJZA 3VIPA 4OUEA 3CL8A 3UXKA 5U7SA 3RO8A 1GQNA 1UWTA 3SCWA 2AAMA 2G41A 3H26A 4Z2LA 4LALA 4G9PA 3MUCA 4M6QA 1KQYA 3QYQA 1I2OA 3ZJKA 3LZ5A 2OWXA 4QS5A 2PF0A 2ZKMX 1N8IA 3CUIA 3OO2A 2PB1A 3KCLA 1V51A 1E0WA 4QDWA 3T07A 5E6ZA 4AF0A 1VH7A 2J62A 2PODA 3IARA 2PDCA 5CCZA 1IWAA 2J88A 1EH9A 1U83A 4ZODA 1VBGA 1PV8A 3G1VA 3IIXA 2PDHA 3W29A 3AXMA 1VYPX 2FZDA 1SJDA 3VGFA 4HTBA 1UR2A 4R85A 5A6TC 4D6HA 4LRSA 1BG9A 1CLVA 3O6DA 3SAZA 1OFQA 3WH8A 3CASA 3CMJA 2D24A 3O06A 1C7TA 8XIMA 3N2MA 3EKZA 1QNRA 1ESWA 3ATZA 2QVNA 6TAAA 3P74A 2DQXA 3EXRA 5LIWX 3OPSA 3R8RA 2ZRWA 2DZAA 1I2PA 1V02E 4AD5A 1EXBA 4JKMA 4OBRA 2R82A 4KIRA 3I4KA 2ZIDA 4JTLA 2Z24A 2JIEA 4IXXA 2VL4A 3WO8A 1OINA 3PNUA 2GQ8A 3SY5A 4GINA 4IGHA 2VOMA 4ZVJA 2ISDA 1ZCOA 4Y8FA 5CC5A 1SPQA 3TONA 3NIYA 3KOZA 5FL0A 4MVAA 2ABBA 4L4PA 2J47A 2E3ZA 2ODOA 3W70A 3WL0A 4QQ3A 4MY9A 1E0XA 3B9DA 4UTKA 3MP5A 1HVQA 3NL2A 1OIFA 2BTMA 4I7WA 5K4ZA 4HSHA 4L80A 2I9UA 1ZPTA 1IGWA 4MJ4A 1E4MM 1FKWA 3O9NA 3S5YA 5C9RA 1FRBA 4CQDA 3UJEA 2WM0A 2YL5A 4NI3A 4AX7A 4CNNA 4ZENA 3UPMA 3KXQA 1REQB 1LP6A 4WY0A 3AU6A 1W3HA 4TX9A 2OQHA 4IUGA 3SCTA 1JUEA 3DDMA 4MNJA 2WZHA 1KCZA 1ISYA 4O0ZA 3OBEA 5D04C 3H2OA 4GPNA 3AC0A 3PAOA 2VCCA 2E77A 1XC6A 2B7NA 4NXSA 4TMCA 3K4WA 4F0HA 3B04A 4P7NA 3FGCB 3T09A 2RDUA 2Y8UA 3TYEA 3UZWA 3DHFA 2X09A 1OX5A 4H19A 4BFAA 2V8ZA 4E5TA 2OGJA 2QIIA 4F4RA 4M29A 5JMUA 4MUPA 3B97A 3GC5A 2QCGA 3VD3A 3FXGA 4EXQA 4BI6A 2WMJA 3CS2A 1PKLA 3TQKA 3QLDA 1BGGA 1H1YA 1XI3A 3T8QA 4EK7A 2BHYA 2FVMA 3DCPA 3R0DA 1RBAA 5DN1A 5LGZA 3WF3A 3CUHA 4O19A 2F2HA 3N2XA 5C9XA 3WQWA 1GJPA 1TZZA 2DZBA 4ICNA 5DMMA 3ITOA 1PTGA 2DU2A 4GKLA 2GGHA 3VGEA 4GUIA 4XKMA 3QGKC 2RH9A 4E3VA 2ZRXA 1X39A 1VRXA 3UETA 2QCCA 3AIEA 1PAMA 1QFEA 1P6CA 3ES8A 5EPDA 1XIFA 3W9ZA 8A3HA 4IMGA 2DZVA 1EJTC 4O18A 2DW7A 1A4MA 2AAAA 3W7LA 4L64A 1E4NA 3V16A 3CZKA 2F61A 5HNRA 1BGAA 1P0NA 5JU6A 3TJXA 3BAIA 2VKZG 2D3LA 4D8ZA 4WDWA 4PUJA 3A9BA 4C6CA 2J7HA 3BC9A 3ZZ1A 1XYBA 4AYSA 1XRSA 1OIMA 1ZCCA 3ARZA 2QR6A 3D0CA 2OSWA 4XTDA 3ECQA 3SECA 2ZDSA 1W5NA 2GDQA 4J1OA 1EX1A 3QN3A 4S23A 4U33A 1NF0A 3CQKA 1FDJA 4B4HA 1W5QA 3AYTA 1C8VA 4FXRA 1Q7QA 5I79A 1HVXA 1QBBA 1QOQA 4JOMA 3E1F1 4M24A 2X1TA 4MY8A 5AB3A 3P6LA 1I8JA 1A53A 2A7RA 3O0KA 1ZGDA 4ML4A 2F9RA 2Z0IA 4H6EA 5D2TA 3LGGA 1E72M 3ERPA 4R27A 3NZRA 3CQ0A 3P8JA 3SQSA 4O1FA 2Y2WA 5D4YA 1J5SA 3NGFA 3T2OA 1SFSA 1H1ZA 2PWUA 2QCMA 3RFAA 4NNAA 4CU8A 1YTEA 2QDHA 3ES7A 3DYPA 2XVGA 3AXXA 3LHVA 1Y5WA 1VP5A 3BMWA 4LYPA 2PC4A 2OLSA 1W1A1 1DJYA 1NQ6A 3E12A 3LD5A 2ZE3A 4YNGA 2XZ9A 5JBDA 1THFD 2VX6A 3LPGA 4FS9A 3M0YA 3S1WA 3EMZA 3G1YA 3VZXA 1E0VA 4EPBC 3VD9A 1JD7A 1RD6A 4FNTA 4O50A 2Y70A 5A6KA 3MSGA 3P2VA 2P50A 2Y7EA 3BG9A 3MSDA 3EWDA 3BMVA 3C86A 3OLDA 1DJIA 5FI8A 1GOIA 2PDXA 1RBLA 1K9TA 1YW1A 2C71A 1EA0A 1XXXA 3N4EA 3RRAA 2EKCA 3WMCA 4CNTA 4IOTA 3ZWTA 4NX0A 3MMTA 2YYUA 1J11A 4D6JA 3HF3A 4AZIA 4H3DA 1J96A 1H63A 1OYAA 4UR8A 3VILA 1IHIA 2JK2A 2VX5A 4DM1A 2EG6A 4LBUA 5HDRA 4GISA 3L4YA 5AVNA 3LGEA 3EAUA 2VO5A 5EGRA 3O63A 5BCAA 2XM1A 5IFPA 2XN0A 1PB0A 2WC3A 3BTNA 2KZHA 4HHLA 2FLIA 6ENLA 2EJ1A 4ENLA 5CBBA 2ZWZA 3W02A 1UPMB 1DJGA 1G4SA 3VC5A 1ADDA 4R33A 3QSRA 2QAPA 3G0UA 3I10A 1MNSA 2RJGA 1Q6GA 3OB8A 1MRAA 1EJ7L 3N13A 3F03K 5FF0A 4MJMA 1ALDA 1YDVA 4IXHA 1EJUC 4C6OA 3A5FA 1NIUA 4O1AA 2ZA1A 3HG5A 4KGLA 3NDYA 4K8EA 1AZ1A 3GYCA 4JTRA 2ZZ6A 4NX5A 3HBLA 4OV9A 2FVKA 1CWYA 3SY8A 4OT7A 4NL1A 1VFHA 5DCBA 1N8FA 1QI4A 2A21A 3ME3A 3TNOA 4B5SA 5CPMA 4E8DA 3FAWA 2NVAA 4GWEA 4Y8EA 3U2EA 4HBKA 2AMGA 3R89A 5HNUA 3ITCA 4HIBA 4WZHA 3RM4A 2NUXA 4IPNB 1Q2RA 3SCRA 3XIMA 1HJWA 3VM5A 1MZRA 1OFAA 3WY1A 2VC6A 1SZNA 4O1CA 3V5OA 4DYKA 2EG8A 3DHPA 4B5NA 2PBGA 2BOEX 4L7ZA 4PEEA 1TWIA 3LZ3A 2J74A 2OEKA 3VFLA 1GOOA 3VNYA 2GPTA 2CLKA 3OQEA 4UCGA 3GUWA 4RLIA 4WY0F 2QULA 3T0AA 3EKGA 4HKPA 1PKYA 4JS3A 1Z44A 3FOKA 1GOWA 2Y8KA 4B2DD 3RO6A 2O9PA 1E40A 3QY6A 2YL9A 3UWYA 3IJLA 4N6FA 1Q3NA 3CO8A 4ZSTA 4M6UA 1JNEA 2PD9A 4IPIA 2ZX5A 1OM0A 3ZT7A 5CQ1A 5BXPA 1WNOA 1ITXA 1QOXA 3LS9A 4IICA 2Z1VA 5C9WA 4S38A 1YDNA 4HK5A 3GIYA 4DO6A 2DJLA 3KVMA 3W1MA 2TPSA 3OYXA 1XW8A 3W22A 3UZ5A 1OT1A 1XLCA 2V3DA 5KSWA 4EACA 2KX9A 3WNMA 3EDFA 1DIDA 1TTPA 2NQZA 3NQ7A 4ACZA 3AALA 3PPFA 4X61A 2WB5A 4E2VA 3EPNA 5BXRA 4I9TA 1VCGA 1O5KA 1GEQA 3O07A 2Q02A 2C18A 1PIIA 4K37A 3LCFA 5DRCA 5LKYA 1N8WA 5D38A 4XZWA 1J4EA 5CC3A 4BR1A 3RILA 4A8IA 3HQOA 2FTYA 4ZL1A 3ARPA 4DZAA 1CGXA 2WVUA 4E8GA 4IMAA 1D3HA 4XD3A 4UOJA 2Y7GA 3FCPA 4JIPA 1W56A 3CHFA 2GSHA 1MYRA 3BVJA 4AD0A 4LH8A 3QQWA 3WNNA 1V02A 4U5IA 1E3XA 1Q85A 3RLGA 3RMJA 5CBJA 4XISA 1M7JA 3CZEA 3S2MA 5A1AA 2YCLB 1H7OA 4WDUA 4AB4A 2R24A 1XP3A 1Z42A 2WHMA 4LAUA 1I6NA 1GVRA 4CNUA 1IF2A 1QK2A 3GBDA 2YXXA 5C2CA 1OFBA 4XV0A 3VUPA 3Q67A 3S3GA 3THAA 2WNZA 1QMLA 3TTSA 5G4WA 1Q6FA 3VAVA 4HNOA 1W1B1 4R34A 5TD4A 2YR1A 4RW5A 3G8RA 2CWNA 3STPA 3QTGA 1VFFA 1FWEC 4G1KA 3CHVA 1TB3A 4QP0A 3KZSA 5KZEA 2G5WA 3UESA 4RNFA 3V35A 5TF0A 3PBWA 1K3UA 1W6TA 4J3VA 4GHRA 1X1NA 5AYYA 4UBPC 5A69A 2PGEA 3A13A 2PU0A 4UWMA 4ZBCA 1KB3A 1RJRA 4I5RA 2QCNA 4KMQA 3T4WA 1DWHM 3CZLA 4TU1A 5H8MA 1LBLA 4HCDA 5FACA 1BVZA 5I0DA 2V3EA 1FWGC 5D9MA 3UWUA 2XPKA 3BQ5A 1OC5A 3IJ9A 4LJ3A 4Y9NA 5ABTA 4S1FA 2AKMA 3REQB 1W5PA 2V63A 2QIWA 2Z25A 1XD1A 2GVJA 2PDLA 3R5EA 9RUBA 1VAHA 1SSGA 4WOZA 3FDGA 2WQPA 1BYBA 3HPXA 3VKJA 4NJHA 4JKLA 2O0TA 1S5WA 1V3JA 4U28A 2FHBA 3B0PA 3MZNA 5JBEA 3C3NA 2RAGA 1K9EA 1QO2A 1XRVA 4RNIA 5FF4A 1XCFA 4P61A 5AHEA 3K8MA 5A8QA 3QHMA 4TV6A 3TKFA 2V38A 3DYMA 3A22A 4Q3MA 3UR5A 3GFZA 4PCTA 4AUBA 1HJUA 4GCAA 3NZGA 4UXDA 1GVYA 4WGXA 4UOQA 5G4HC 4REQA 4HHHA 4OWGA 3JW7A 4IT1A 4F3HA 3ARSA 2OJPA 2ZA2A 1TREA 2WKGA 2VVNA 3GIPA 4AD2A 4LUJA 2CWXA 1VEOA 4M7SA 3WD1A 2FDMA 1Z32X 2YXOA 3GNRA 3WMBA 3R13A 4QQUA 2XUCA 4ZO8A 1XBZA 3CWHA 3OHIA 3ONBA 1UH3A 2NX3A 1NSJA 2ZA3A 3KDNA 4I9AA 3CIVA 4MPKA 3B4YA 1EYEA 3N9KA 3ICJA 4X3ZA 3S5SA 4IPJA 3WG6A 1ELSA 4AIEA 5DXXA 5GPRA 1EQPA 2WMKA 3GHUA 4Z2JA 2IPJA 1JNDA 3WJXA 1JEZA 3BV4A 3MU7A 3O3RA 2HNHA 5AC6A 2X0SA 4A2SA 3TC7A 2VEMA 4A3RA 1I2RA 1WV2A 3L2MA 4HT3A 3I3BA 2E68A 1GYMA 3N11A 4G7EA 4M6PA 1IR2A 3B05A 4X0NA 4NAFA 2MUCA 3MO7A 2GJXA 4H00A 4NKCA 3LCXA 3UZZA 3UP8A 1REQA 5CPQA 5HNNA 4PUMA 4XVEA 5F4WA 3S2JA 1YE4A 1B31A 1I9CB 1KRCC 2VX7A 2VRJA 3DC0A 1IWBA 3APYA 2YDQA 4GYPA 1J2BA 1WXJA 2DQWA 4XBKA 3L65A 2D1ZA 3GWQA 1UD4A 5DMNA 3J7HA 1LJYA 3OHMB 2D3NA 2Q8ZA 3R8GA 1QASA 2PWEA 3A4XA 4AX6A 4K3ZA 3QOKA 3NQAA 2OWWA 3V4BA 4D71A 3NOYA 3BCJA 1DJXA 2YLLA 3FYPA 3IIZA 4BK9A 3LBCA 4JTDA 4NNCA 3DENA 3GXMA 3WD0A 3LBMA 3H7VA 1ZB5A 1UASA 2NVCA 3WD2A 4E6MA 1H11A 4B5UA 3CAVA 4PMXA 3CPRA 4TXEA 4A05A 4QGCA 4NUWA 3G77A 4JTEA 4HPHA 5HOSA 4HQVA 3REQA 3HU7A 5IBXC 2EKGA 4EPDC 4DZ5A 1V0NA 3D3FA 3GX9A 3OZYA 4PGLA 4MG4A 3WDRA 4IQDA 2PGFA 4MDOA 3H12A 3NQBA 4QE1A 5DCEA 5DBUA 3SCPA 4PCSA 3SFKA 2IS7A 3M0MA 2G8ZA 1B54A 3UA4A 2XWEA 4WQ6A 5I07A 1KQZA 1UMYA 4MOZA 1POKA 4KBXA 3MV01 1AW5A 4Q8TA 4WRHA 2J9ZA 2VFDA 4PSPA 3AZRA 3TXVA 3VCRA 3V7PA 5IDZA 3ZMRA 3AROA 5LYRA 3AJ7A 1W9DM 1AJ2A 1KCKA 4HPNA 4WXZA 5J8LA 2C7FA 2ZZ1A 4JXCA 3POCA 1XBXA 3AISA 2PDYA 1IGSA 4AY1A 4QLLA 5EY5A 5HUOA 2QV4A 5HNTA 2XINA 1EX5A 3BSMA 3ZJ8A 4LCQA 3W2MA 4B15A 4RDZA 3BO9A 5FJJA 3SN0A 2A0NA 3KVJA 1Q8AA 4MDPA 5CZTA 5DANA 3B4UA 4XZIA 1CGWA 1C9WA 2ZUVA 4IMCA 2QV5A 3KWXA 3MJYA 3WL1A 2E6AA 1H7NA 3KM8A 4PL1A 4G56A 4E3TA 5KZ6A 3S1UA 2ZX8A 3W7NA 1MRQA 4Q8OA 2WVSA 3KS6A 4LVDA 1VB9A 2W5FA 3MW7A 3SO7A 3WFAA 1JG9A 4MKVA 5CZSA 3M6DA 3PULA 3MB9A 2Y24A 2UV8G 1XLAA 2FYMA 1WUEA 3TH6A 1QAPA 3SGUA 4JTGA 4DN1A 3O2LA 1TR1A 1W31A 3HPFA 4KW2A 1MO0A 2DSWA 1XLFA 1H0GA 4BY3A 5AC7A 2Z4GA 2IKIA 2FKPA 3JZEA 1BYAA 1W2VA 2WSPA 4IP7A 5GJPA 6PTDA 2BHUA 4AIBA 1SMAA 1T6MA 3W2KA 1MNZA 1XM3A 4I9MA 4JCMA 4W7WA 1B0IA 5LXXA 5T9BG 3RF9A 1I1XA 1QVBA 4HU4A 3WUEA 4UUIA 2IKGA 3KTCA 1DOSA 3ITLA 3H23A 1MZHA 2DSVA 1UR9A 1DIOA 1G4EA 1MEWA 2PTDA 3WQCA 3TTOA 3SEPA 4JY8A 1E6SM 1C8YA 1A0DA 4DEFA 4NNBA 3B40A 3M41A 4AXKA 3AHTA 3WSUA 1TKKA 4ZB0A 1EO7A 4UQBA 2Y4SA 4YCPA 2P0IA 1P1XA 1KXVA 5AZ0A 1TV4A 2VRQA 4IMFA 1SO3A 1FFQA 3CV1A 1T8XA 1IIGA 2SFPA 2QAFA 2ISSA 1KO0A 3T40A 3T0CA 1IZKA 1KBKA 1FDZA 3D6NA 3WQ6A 4FZIA 3DBNA 4DPPA 2OZTA 2PGWA 2C8NA 4PA8A 4Y9PA 1JPIA 4HCHA 4HCLA 3P82A 1W9XA 5D02A 1S39A 2XIOA 2ZUSA 2I5IA 4CN1A 2P3EA 2WLZA 4Z1AA 3OQ8A 3RM9A 3W7IA 4K7YA 3P5ZA 1M3UA 1VBUA 1PHWA 2CFFA 2CLHA 3TC6A 3CO4A 2HEJA 3ZVHA 2FH8A 3JUGA 1QATA 4HN8A 2EPNA 4MWAD 5K9XA 4EWND 4QLJA 2WKJA 4E4PA 2QUUA 1M41A 3LV5A 1WO2A 1EL3A 3AWNA 4MB3A 4YTRA 1E9LA 4AZGA 1JCYA 3N6HA 2ASHA 2BX7A 5D37A 1I4NA 1R38A 1FWTA 2QJHA 2G37A 3W6MA 4MJ2A 3QGAC 2AQVA 4KRZA 2WSKA 1B9BA 3BLOA 3VABA 4N7QA 3L0GA 4TV5A 2H8XA 3L4XA 5BU6A 1MW1A 2OO0A 2DVUA 3W24A 1F2JA 3OOQA 4F0KA 2JGYA 3IJ6A 3URNA 2Y8VA 1UD8A 2Y61A 1F3XA 2G3JA 3I6EA 4IG2A 1UR3M 2GYIA 5I23A 4XUGA 1YE6A 5E93A 3VGBA 2P5NA 3DHDA 1XINA 4RE4A 3VPLA 4ATLA 4PUUA 3W7MA 3BXWA 2HPMA 4PUNA 1HX0A 2Z1SA 1H49A 5A6AA 3ZS4A 1CZ1A 2A79A 1PBGA 5AYBA 5HK4A 2YCLA 4BEUA 3AO0A 3CJPA 4HZ7A 4DXKA 2F7FA 3O7UA 4GK8A 4GGHA 2DGAA 4KWUA 3E2VA 3GU9A 4AG0A 3KBSA 4J40A 5E0FA 3PSVA 3AIUA 4WK9A 1B3WA 2HSAA 3GY1A 3WNPA 3VDGA 4FOKA 1NWSA 3SZ8A 3N14A 4ONVA 4MWAA 2V9DA 3FLUA 4R7OA 4DJFC 2XIBA 1GVOA 2WW5A 2WC7A 5AHFA 1FUYA 2ACQA 2BWGA 4MB5A 2QPSA 3OBAA 4LXFA 3MWAA 2NZLA 4S3EA 4CVUA 1U1UA 1TJ2A 2HBXA 4PB3A 2FHCA 4JNMA 1Q66A 2QPUA 3EXTA 1FWSA 2OKTA 4AD3A 1XLHA 4GQGA 4F79A 2DZTA 3W7EA 4QRNA 1HL8A 2YCEA 3DGRA 3EDEA 1R0MA 3DHUA 1KXHA 7ENLA 3BQ6A 1SR9A 3QY7A 1RQHA 4FOJA 3LN3A 3W83A 1Q65A 3WLRA 3N1AA 3CQIA 2VZTA 2A2IA 3KAOA 2NXHA 1QNSA 3Q2DA 4PCNA 1GQJA 3RG6A 4BZYA 1OQFA 2AGKA 2ESCA 4L61A 1QHOA 2Q8XA 1H4PA 2VC7A 1M6JA 1SUXA 1RQBA 1L8NA 1R3SA 3Q45A 4RZ4A 3WJWA 1EWDA 1OSEA 5G4EA 3MCOA 4GYPC 4WR3A 3WLHA 1V3IA 4HZ8A 5HULA 1FX6A 3EX2A 5DEZA 7TAAA 2C0HA 2Q3RA 2WYSA 4LNCA 3MBFA 2CLOA 1PWLA 4QTGA 1BFNA 3LHWA 1IR1A 2YIHA 3QEZA 3WQDA 3EWWA 1O4UA 3LXBA 5FF2A 3S1VA 4RV8A 3JS3A 4O13A 3KL3A 1UHVA 4JYDA 2HVNA 3CYVA 4DVOA 5FEWA 5FD0A 6XIAA 4HSNA 3BARA 2G3NA 1YDOA 1JCJA 1M7OA 1IT7A 1QPRA 3S2CA 4Q4OA 1ZZMA 4GO8A 5MHBA 2WANA 1F4AA 2CBVA 2W67A 1NM9A 3IUDA 3WLQA 2FGBA 1E6RA 4FI4A 2BY2A 4S3AA 5MF5A 2CC0A 3IGHX 5BYWA 2YW3A 3WQGA 2O7SA 1ZRQA 4HGXA 3SSZA 1V7YA 3NDOA 1HNYA 4N4PA 4K1GA 1K1DA 4GYJA 4QE5A 3F5KA 3PF3A 1ENUA 4NAEA 1NQKA 3H2MA 2R1MA 4LX4A 3WF0A 4Y9AA 5H91A 1ZP4A 3L2IA 4WD0A 5BOEA 1DJHA 2F8QA 5B7YA 2VFFA 3I6TA 3N9RA 3MHUA 1BQGA 2OOGA 3M07A 4KWWA 4M82A 1VC4A 5A3HA 3B8IA 2RJHA 3ABQA 4MAZA 1MQQA 3P61A 4HMDA 1YNPA 3LV6A 4QAIA 2EPOA 2J8GA 4WGHA 2BB0A 5DQPA 2ZC8A 1AZ2A 1JDFA 2J7EA 3F5JA 2ZTKA 4V15A 2J75A 2Y7FA 4O12A 1AD4A 2CBIA 2VD8A 4CQBA 4GO9A 1YPXA 4EPKA 3HPAA 4QXIA 1ISWA 1IEVA 3STEA 5I06A 2E9LA 1NP2A 3C0LA 2OTDA 5CJNA 1QPQA 3P3BA 2NQJA 1M03A 4AWTA 2PWHA 4H04A 2CLLA 2VD9A 4LBRA 3VZYA 2X0YA 2QHAA 3EB2A 3MY9A 1VFUA 3ZQ9A 5BRBA 3T6CA 4MPQA 3PB2A 3PK7A 3FN9A 4IFKA 2CZDA 2A3HA 3WDHA 1UWUA 3E96A 3ANUA 3NR0A 4HNNA 1C3FA 5EU9A 3C2FA 1O12A 4ZO9A 4ATWA 3GTIA 3WYZA 2CU0A 3SRFA 3RU6A 1JFHA 2FTWA 4FSAA 4UFJA 1MWOA 4UZSA 3TN5A 1V0KA 3WF1A 3IGXA 2OCZA 3VIHA 3PBUA 4Y9MA 3DG7A 5C2GA 3W23A 1DJZA 2PDMA 4XQ6A 3IVTA 4UFKA 1HP5A 2BNJA 2O4MA 4YIWA 2CESA 1UUQA 4LAOA 1D9EA 4QS6A 2PP3A 3A4AA 4LW7A 5ENLA 5E09A 4J9JA 1MFUA 4LANA 3NEHA 1WBJA 3PAJA 2D2HA 1F3TA 1UR8A 1AQFA 2PDFA 2XYLA 4HK6A 4NZ3A 1TG7A 3WBEA 1UW9A 3QKZA 3NQDA 3BAWA 2JGQA 4LNYA 3G5EA 3QRHA 3BAYA 1B4KA 1RP8A 5CJ5A 1EOKA 1EOMA 2Z1WA 4UNIA 5FL1A 3TYDA 1Z6KA 3ARUA 5IHRA 2HK1A 2ZICA 4WJEA 1WKFA 5E9XA 3KOYA 4KWOA 3C8NA 4JKKA 1OEPA 3SGZA 1XYFA 1E1EA 3QXBA 4U10A 4B2DA 4M5PA 2ACSA 1ZAIA 2ZX6A 4RPPA 1QWGA 3B9NA 4PTDA 4XSMA 1JULA 3SCNA 6REQA 2DVTA 3OZOA 3VMOA 1HW6A 4DO4A 3DX5A 4H6KA 5IRPA 4H9YA 3VCCA 1K8YA 5GNXA 2PEVA 2Z7GA 4LSBA 2ATSA 2J7CA 1DJNA 1CB2A 3TX9A 3VNZA 1W1TA 4MLJA 1TMHA 2ISWA 3WEOA 3GM8A 4AMCA 4Y2WA 5KZDA 3E0FA 3UCDA 5I02A 4IMDA 4OQVA 1XSKA 5GVJA 3WQ8A 4ZO7A 4C90A 1IXNA 3E0LA 1LT8A 5LNSA 4IISA 1NU5A 4L4OA 4QSHA 3EOEA 4C5YA 5DMYA 3I4EA 4KT2A 5H8UA 2AQOA 4TIMA 3TWBA 1BF6A 1LOQA 1I1WA 2OQLA 5AHNA 3VMPA 1ISXA 2WVVB 3EB4A 3TFCA 5AY7A 3OA3A 1TIMA 3LK6A 4IL2A 3DXIA 3FSTA 3WFZA 4LY4A 3K8KA 3H55A 2OFJA 4U3CA 5T8GA 4QISA 1QNPA 1CXIA 3OU8A 4XAGA 4PYSA 1GZJA 4DB7A 3AU2A 1FHUA 1UH2A 4YS1A 1MUWA 3TW6A 1BRLA 3FHQA 3RCMA 4EANA 4LYKA 4DI9A 4MY1A 4JQ4A 1XYMA 2GZXA 4A3YA 1QHZA 2GOUA 4DM2A 4NRRA 1BVWA 1KWKA 3N4FA 1DJQA 4LB3A 3FGCA 3R43A 4LUYA 1E73M 1B2YA 2X05A 1PX3A 3N25A 2WSQA 4ERGA 4PMDA 2TODA 4Q7BA 5A5WA 4AU0A 2BVTA 5HANA 5K7JA 5JIWA 1EP2A 1FXQA 5C70A 1KTCA 4H2HA 3UY7A 1ECQA 3TQVA 4DF1A 1MMFA 1H7XA 1V3HA 2X42A 1X7FA 2OYMA 5E9AA 5HQEA 4JHMA 3SFWA 3PP7A 3LLFA 2YA0A 4H9ZA 2BV9A 3GTHA 3PNZA 4CN6A 1T5AA 1W9BM 4L1XA 4I6KA 3HGSA 4O4WA 2C6QA 3AHVA 2PAJA 1KM4A 2XFWA 2Y5JA 5CH9A 4D6IA 4GABA 3ZVIA 1XGEA 3NOEA 1JF6A 3C3UA 2CNCA 1EF2A 3UQNA 3AZSA 3HN3A 3UEQA 4JHOA 4WSKA 4MSSA 1NOFA 4JNZA 2VCAA 3MDWA 4JIIX 1EJXC 5M5DA 1XLKA 2ZTJA 3G1FA 2HCVA 3UXLA 5A8GA 1VRDA 2ZE0A 3W88A 4LVAA 3USZA 2BSLA 5T91A 1DXEA 4L5ZA 1TVLA 3KTXA 3GC2A 2VT0A 1GZ1A 1M7PA 2YCIX 4FLQA 4MHBA 4HA4A 1X8CA 3KZPA 3LPOA 3E74A 1CGYA 3WMLA 3C2YA 1XIEA 2HISA 2I14A 3K30A 4CNPA 5HJLA 1R3VA 4MM1A 3LB0A 1QBAA 2EG7A 2X16A 3LENA 2D22A 1MW2A 5CKSA 1UPPA 5A94A 1U30A 3VIMA 4EXAA 3OLIA 4UTTA 3GHRA 3LCGA 2HROA 1Q13A 1JCXA 5K9DA 1KFWA 2VR2A 4RKAA 1J10A 3E38A 1W8GA 1E6PA 1W1YA 2OO6A 2C79A 4GX8A 3GB6A 3SQMA 2NWSA 2W9MA 2ISFA 1VPXA 5LA0A 3ORWA 3UXDA 1RCXB 1C90A 3CEPA 5H1WA 4BS0A 5AOUA 4DBUA 2QDEA 1ODUA 3W1UA 1V4YA 4L9XA 1ITCA 4KCWA 4HA0A 4AQLA 2VFGA 2WSRA 3G6MA 1IIHA 3N2BA 5CPLA 3W7GA 5FEXA 5TQLA 1RJPA 4LTSA 4YWSA 2BVDA 1LROA 5CZ0A 1UJQA 1UD3A 1XDMA 3UT0A 3PG9A 1O7AA 4GA8A 4S2BA 1XLIA 5I3FA 3QY8A 4HYWA 2ICSA 1GOXA 5FAGA 1WQ5A 2GJPA 4UTJA 1F76A 4D1JA 4QNEA 4C6PA 2G4FA 3T2PA 3W6YA 2DVXA 1PSCA 1EA9C 1HKKA 4Q22A 1UROA 3GNPA 4KPLA 3T0TA 4IL0A 4GI4A 4XAPA 1GGOA 1SU5A 4W8AA 5LHEA 1A3HA 4GXPA 1VHCA 4C60A 4IUOA 5DFAA 3U57A 4TMBA 3WCZA 4WDTA 3IIVA 2JBMA 3HGOA 3OZMA 3W0KA 5HMSA 2DT2A 1CLXA 3C61A 5BU9A 4U2ZA 1K03A 3UFYA 1YIXA 2Z6IA 4POCA 4U2YA 4DXXA 1YX1A 1PO9A 1PYFA 1E0UA 4A6GA 2HJPA 3M64A 3KBJA 3RAOA 5C54A 3TR9A 1RK6A 4H6RA 1V6YA 1VEPA 1TZ9A 4O10A 1E6ZA 5C55A 1SJCA 1W32A 1TRIA 2QCDA 1KNWA 1TE6A 3OVPA 3G3MA 3N6QA 3GR8A 1DQUA 2YPIA 1UUMA 4LUIA 1G5AA 3ZR5A 2Q71A 3B03A 5EFFA 2CZFA 3UNTA 3ZJ6A 4OV4A 2D23A 3W53A 4AHOA 2CHRA 3QR3A 3CV2A 3TZFA 2NQ5A 3AMLA 1V3KA 3BJSA 1T0OA 3M47A 5A2AA 2QNEA 2E9MA 3M0ZA 5A6SA 4D6GA 1PIFA 2Y5EA 3O6CA 1FWFC 3THUA 2XISA 5A8OA 1UIPA 3GKFA 5SWUA 2YXGA 4OBTA 3IEBA 3W4RA 1JRBA 1ZBCA 3E0WA 2BY0A 3CB3A 1JUBA 4Z08A 3SRDA 4BQ3A 1SZFA 2EO7A 2RHGA 3WK2A 5ECUA 5M03A 2ZXAA 1HJQA 3NQCA 3VKCA 4B5VA 1RV8A 3NQFA 3IJ7A 1VF8A 3R25A 1H1NA 2OYLA 4IIEA 3AMDA 4Q4KA 3V18A 4OJYA 3NEVA 1RBOB 3Q4DA 1F61A 3GVGA 3PUGA 1Q7ZA 2VJXA 4GUHA 2XG9A 1UOZA 4O0QA 4B5WA 3WFLA 3E9AA 1NH6A 2P0OA 4C6FA 1XKYA 3V1PA 4Z42C 1YLVA 5AVHA 3VFCA 4PMUA 3AS3A 4YWIA 3LPPA 3CV7A 1HXJA 1FBAA 3HA1A 4DIAA 2PF8A 4GBDA 1WBHA 4O28A 3W7PA 1OZMA 2RGLA 1WCGA 4NXKA 1XISA 1QO5A 4ROQA 4S3GA 3CUFA 3GNXA 2OT0A 1XIGA 2V5DA 1ADSA 2PD5A 4KQNA 1S3TC 3TC3A 2Z27A 1EB3A 3E6EA 2WZIA 2ON3A 3VE7A 2C14A 1DVJA 2CHOA 2E8ZA 3FS2A 4M7TA 1TPC1 4QAWA 1VFTA 4MZ1A 1OY0A 1JGIA 3TV8A 2O9RA 1YYAA 4HSOA 4EVZA 3M0HA 1VYSX 4L9ZA 2ZOXA 3BW4A 1ODZA 5CPSA 3P93A 5A8NA 1UWQA 3GFXA 7XIMA 3H8AA 3AIWA 2IKHA 5CEWA 2V5JA 1FCVA 4ZOAA 1AH3A 1TJ1A 2DUZA 4NT0A 3OG3A 2V6AA 4R3UA 2VP8A 4LVBA 5TBOA 3GU1A 3C8FA 2Z28A 3CC1A 4GI8A 4UFMA 3W1XA 4LAMA 2GFTA 3NDZA 1GVQA 4XTIA 1NFGA 1A5UA 3AOFA 3T4CA 1KBJA 3QZEA 2P8BA 3VOCA 2DT0A 1OG6A 4G8TA 4KF1A 2G97A 1MFVA 1I2QA 3LHYA 1PYMA 1XQKA 1VYRA 3BG3A 3WLKX 3SSJA 6REQB 5EYWA 3E5PA 3FY1A 2Y1HA 3MVIA 4UMBA 4JX4A 1BTCA 3SRHA 4GNVA 4NJKA 2OSYA 1JPKA 3LCIA 2XTKA 5L9FA 1QXLA 3GQYA 2V3GA 1J8VA 5FA5A 1GNXA 2WHJA 3IRDA 3CL7A 3P81A 2HS8A 1NJJA 4DBDA 2A3EA 3SURA 1FH7A 2VZOA 2VC9A 4PMQA 3T44A 1AQ0A 3PZGA 3PPHA 3APGA 2ZXBA 4A4AA 3LI1A 3BLKA 1X1ZA 3PBGA 3EEZA 1KGXA 2NLYA 1B90A 3UG5A 5BMWA 3D47A 1G4PA 1ONEA 4D2JA 3EA3A 5DY3A 5HMEA 3I3EA 2NQHA 3EA2A 4CU7A 3NQEA 1O95A 2CITA 3A3WA 1TRDA 3DERA 1C93A 2FZ8A 4S3DA 3A9IA 4RNHA 3WBXA 3M0JA 1MDRA 2QCLA 1FXPA 4ECLA 3N17A 2IW0A 3C5QA 4GRSA 1UMLA 2XHYA 3V3WA 4FIQA 1XRTA 3VD7A 4R7JA 3WJYA 4CUCA 4DUVA 3VIJA 2NUWA 3EX1A 1M5WA 1S5TA 2DZPA 4MIMA 3CEUA 2OZ8A 4DO5A 1L2UA 1E70M 4K8GA 3GZ3A 4O4VA 2OEMA 5CC7A 3VCNA 3KCOA 1LYXA 3PJWA 1F05A 4JD4A 3TWAA 1U1HA 4RE0A 1D8WA 3LCWA 2D0FA 4URIA 1EFZA 4ZXLA 4OTKA 5FF7A 2RDXA 1P0EA 1B4EA 3POHA 4JDBA 2AQWA 2ZUNA 3W7JA 2VFHA 1NELA 1V0MA 4JY9A 3NO3A 3LA4A 4DX3A 3KRBA 3A24A 1G69A 5I09A 3H6OA 4Q8WA 4IPLA 1XYZA 2BASA 2C19A 4AY8A 4RW3A 2JE8A 3FJ4A 1GPWA 2QJJA 2WZMA 1A5KC 1RALA 3T8LA 1L2QA 1JYNA 4CD6A 3ITGA 4RE2A 3BE7A 1JDCA 4XZ9A 3BLDA 3JRKA 3VIGA 3L7RA 4US5A 3BW3A 3P0WA 3PWAA 5FJIA 1JYWA 4FB7A 4IIGA 4BWLC 2JQXA 4GIEA 4AMAA 2WAGA 5KZMA 1LG2A 1NVMA 4RX0A 2A4AA 4AZHA 1WDRA 4M8UA 4MUZA 2VEFA 4J35A 1F74A 1NDVA 4CQCA 3H21A 4HA1A 1J01A 4E4UA 3GVQA 5GNYA 2VX4A 5BZAA 3NVTA 1Z41A 1XBYA 3BSHA 5GJMA 4F0SA 5CGTA 4KEUA 2R1KA 1P0BA 2VGFA 2DT3A 4GUJA 1TQJA 3B8WA 2VFEA 3AIRA 4EAYA 4DY1A 2OKOA 2QDGA 2VEKA 1NOUA 3VDCA 5HWMA 3T81A 5KINA 2PPGA 3W2UA 1XWYA 2QDDA 4YVXA 1GPFA 2YCJA 3WLIA 1ADOA 3TK7A 3MI2A 4CCZA 1OBAA 5FJRA 1DXIA 5GQBA 3EKLA 4Z2KA 4R7WA 3EMCA 5CGQA 3DN5A 4P7LA 3LPFA 1BXBA 2YDAA 1J0ZA 3WLOA 3LNPA 3CAWA 3WKZA 4MTVA 3DESA 3C2VA 4XKYB 2YFOA 4MLRA 3DI1A 3H24A 2XGIA 4IJCA 3EYPA 3AHZA 2ONEA 3PZIA 4MAVA 3PTDA 1OGBA 3G22A 5C7VA 3B9EA 5JH1A 2YLAA 5FJTA 1A5LC 3H7RA 3W1RA 3ALGA 4OU1A 1QOPA 1DE5A 2OG9A 4ICMA 3PBMA 2EPKX 1BVNP