1G4PA

Thiamin phosphate synthase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 74
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4pA00
3C2EA 3G18A 1A50A 1WXJA 1GVQA 1G4SA 5K7JA 2DZWA 1H7NA 1ONRA 2OX1A 5IBXA 3I7SA 2GPTA 5ABTA 5IBXC 3MHGA 2CLEA 4O14A 5HMSA 1TPVA 2CLKA 1VQTA 3PSWA 1I2OA 2QJHA 5TBOA 2A7PA 2H3BA 3GXTA 5AHIA 1YPIA 3MYPA 1I2PA 1L2UA 1ZALA 1GTEA 4B5NA 2Y7DA 1F7BA 2QR6A 3C2FA 1GVSA 3OIXA 3N9SA 1PL9A 1I2RA 1XUZA 1RD5A 2C19A 2FPVA 4OHQA 2GVGA 1K7XA 2ZZ4A 4UMAA 3TJXA 2VFDA 3HPXA 3TA6A 3W1RA 3O6DA 3TFXA 2PRLA 2QCDB 4LTSA 4DQWA 4MOZA 1RQBA 4UTTC 2JKEA 2ZFAA 3PY2A 1WX0A 3P67A 3DZ1A 4POCA 3L67A 3NEVA 2TRSA 1F76A 3MI6A 1IIGA 1JQVA 5C2XA 2QCCA 2ATSA 2WSYA 4O13A 2TPSA 2GQ9A 3DBPA 3ZFHA 2Z1BA 4FX8A 4TX9A 4OGZA 4JX4A 3P60A 4NJGA 2ATMA 5KSWA 2E77A 2QAFA 5F1VA 1DL3A 1W3IA 3QPZA 1SR9A 1W1ZA 1WQ5A 3GNDA 1P5BA 2ZRVA 1KA9F 3NA8A 4K8HA 4ALDA 3VFLA 3W84A 3W2UA 2B4GA 4WOZA 5DCEA 3VI2A 4JNMA 4O1CA 3TKFA 2PE4A 1JUBA 2YPIA 3LTSA 1ZENA 3RLVA 3NQ8A 2W6RA 1FCBA 3LBCA 2H6RA 1LYXA 1HL2A 4AVFA 1Q45A 3W85A 3QPYA 1K7EA 3DFNA 2QCHA 3G1FA 4MIMA 2RKXA 2CFFA 5BOOA 1KTNA 2EGZA 4TR9A 1FDJA 1ZY9A 1OK6A 3W1TA 5LSMA 3E0IA 3P74A 5D2XA 3FEMA 1QPOA 4A21A 4YWIA 4JTSA 3BLEA 2A21A 3P84A 3IIVA 2C6QA 3ZWTA 5K9DA 1F6PA 3KRUA 3C0JA 3G0UA 4XZ9A 3M6YA 3TAOA 3ANYA 3FA5A 4Q33A 5DN1A 4IQLA 3W1LA 3JR2A 5K9XA 5F2GA 2FFCA 2BX7A 2A7RA 3UXAA 4GBUA 4LS0A 1AW5A 1YTEA 1FDZA 5DCDA 2CLFA 3QZEA 4JEQA 1PV8A 2VFFA 5F4XA 4FIQA 3CM4A 1R2TA 4NZFA 1G4PA 5BMXA 1LLWA 3DKJA 3GIYA 3FFSA 2G95A 4RZ4A 1OJXA 5LGXA 2WJZA 1YDOA 3P80A 3O63A 5CSRA 3LCXA 3BPWA 3M47A 3LERA 3LRKA 4AAJA 4U4MA 4JTGA 4UTLA 1P0KA 4GUGA 3O1NA 5G5IA 3SFKA 3ELFA 3EX6A 1FWTA 2YFNA 5HWMA 3FYOA 3C2RA 5IM51 5AYYA 2CW6A 4JXCA 2ABBA 4FHAA 2ZQ0A 5FF7A 2H8ZA 4JIQA 1XBVA 4MKNA 3SW6A 2NV1A 5LNUA 4I7WA 3HQ1A 4M7SA 2FB3A 2R8WA 3SI9A 3UWVA 2YDAA 2ZBTA 2RHGA 4GFSA 3FIGA 1GVFA 4BR1A 2X1TA 3NM3A 4N2YA 1TYGA 3W7EA 3NQAA 4UTWA 5G2HA 3NL3A 1AL8A 1W5QA 4AWSA 2NXHA 3G1DA 4HKPA 3UQNA 1A5BA 1ZAJA 3G1VA 1FCUA 5AB3A 4NT0A 5EA9A 5DY3A 5L9FA 5AHFA 5KZDA 3W71A 5U4NA 3P5YA 3MWAA 1TPH1 2VEKA 3B0VC 3SSJA 4N9CA 4NJHA 1OK4A 5MHBA 3WK3A 2YZRA 2Z6IA 3NM1A 4RCXA 1OABA 4BWLC 2NZLA 5A8GA 3W3OA 1E51A 1H7PA 3HPSA 3W2KA 5D32A 3PULA 3KVLA 3M5ZA 1TPB1 1QCWA 3NQ6A 2EHHA 1PHQA 1VRDA 4FF7A 2O7QA 5FEXA 5LHEA 3VE7A 3T55A 5DBTA 1HG3A 1SPQA 4NNBA 3W1PA 3WJWA 2Y7EA 1VCGA 4OU1A 3TJLA 4O52A 4GXMA 3H55A 4Z1DA 3DHFA 2NX3A 2C13A 1M6JA 4IMFA 3U6WA 2QCDA 4UMBA 1W5MA 3RF9A 1H62A 1SZNA 3W73A 1JCNA 1ME8A 3C8FA 1TPEA 3P81A 2E5BA 3V75A 3W2MA 3GDLA 1TTPA 5G1YA 3QSTA 1U83A 1G69A 2NWSA 1WAUA 1G7UA 1R46A 1KM6A 4LRTA 2C15A 4IX0A 1IIHA 5HJLA 3W7MA 1CI1A 4NX0A 3LI0A 4UTIA 1Z42A 2H3DA 5EBUA 1JCLA 2A1YA 3GB6A 4UNLA 2DZSA 1XDLA 2FDSA 4HSOA 1PHWA 1FWNA 5HUOA 2QUUA 2V5LA 1PE1A 3H54A 2CWNA 2DZPA 4LV4A 2R94A 2WO5A 1XI3A 3NPUA 1Q6RA 2ABAA 5K4XA 1TTJA 2QUVA 4JX6A 1TV5A 3O16A 4UMCA 3W1QA 1H7RA 1W8SA 3Q58A 5AYZA 2VXNA 2BWGA 2YGYA 4BI6A 1UB3A 1K3UA 3BW2A 4XUGA 2JGYA 3DH7A 5HWNA 1B4KA 2B7PA 4UNKA 3PM6A 3T40A 4NJIA 4ZQNA 4KWWA 4MUZA 3STGA 1XFBA 1GT8A 3F1QA 2OZ0A 3NPVA 2WSRA 4UXDA 5J5DA 2VC6A 5EYWA 3FOKA 3N14A 3TXZA 3ZR4A 5FESA 1JULA 4WZHA 3OA3A 3F4NA 4PH6A 4FIRA 1VH7A 4FNQA 2QCMA 5FEWA 2CLOA 5BW6A 3T7VA 3IRDA 2FLIA 3GKFA 1ICPA 4R34A 3LCFA 2FTPA 1NAL1 3UXDA 1I45A 1S5WA 1FWRA 3BGJA 3KVJA 3I65A 4Z08A 1DHPA 3W86A 3E96A 4LUJA 2EPHA 3IGUA 4GNJA 5D30A 3C56A 2GQAA 3MP5A 2I9EA 1H1ZA 1CX9A 4Y9AA 1EX5A 4XBSA 5HQEA 3ABOA 1JR1A 5HINA 1TV8A 3GNNA 3EWYA 4JN6A 3O15A 3RNDA 2A6LA 5F2LA 1QDSA 4KWVA 1ZAIA 3JRKA 2WV8A 1L6YA 1VLWA 3SIZA 4MY9A 3SGZA 3STFA 3HB9A 3UY8A 2YFOA 3IIZA 1KV5A 3IIOA 3DFTA 4O0KA 2ZYFA 1LLZA 1O95A 3RU6A 5SWUA 1FBAA 4P2VA 3G22A 4JX5A 3MBFA 2BSLA 1G7VA 3S5OA 3W76A 3W1NA 3QFEA 2Q3OA 3UPWA 2HS6A 1GZGA 1TPDA 4FO4A 3IVTA 2G97A 2X16A 4O4WA 4DO4A 4IOTA 4UFMA 6TIMA 3GYEA 3M5YA 2CLIA 2WPBA 4JYFA 4AWUA 1BTMA 6ALDA 3LHZA 4ZMGA 3S0CA 2W79A 2ISWA 1X1OA 1F5ZA 1F73A 2WQPA 4K38A 1AMKA 2V2DA 2QJIA 4EF9A 3CU2A 1JQXA 2Y85A 2CZDA 4R53A 1WDWA 3M5VA 4WUIA 2A0NA 3S1WA 2DZUA 1OVDA 3QJAA 4MZYA 4UR8A 3T4CA 2NUWA 3O6CA 5D33A 4EVZA 4GRSA 3GDTA 4MZ8A 1Q3NA 2X1UA 3L0KA 3O06A 1NEYA 1KBIA 2VEMA 1VR6A 4XQ6A 2QDHA 4MZ1A 1EIXA 5DELA 4IMDA 4ONVA 5KITA 3L5LA 4AB4A 3HG3A 4N6FA 4AEOA 4BFAA 4GUJA 2DZVA 1H61A 3M0ZA 1EP2A 4O1AA 3MUXA 3UWYA 2FQIA 3LRLA 4NXSA 1SO3A 1N55A 3BK0A 3U2OA 1TPFA 1B57A 4LWWA 4GUIA 3I6RA 1YADA 2CU0A 1TO3A 3DFSA 4HNVA 2YYUA 4JDYA 1ZNNA 3W74A 3P8IA 1YXDA 3M16A 4Y96A 3OVRA 1QOPA 1GYLA 4BI7A 1H7XA 3W7DA 4NX5A 1FWWA 1LCOA 4DF0A 2E09A 3CC1A 5HNRA 3W6YA 4O57A 4JTKA 3QH2A 1X6UA 2NXGA 1YDVA 4ZQPA 4UFHA 3SECA 3R2GA 4LW7A 1W37A 2EF9A 4ORMA 2AAMA 1SZEA 3TQVA 3O05A 3P62A 1P1XA 3AO0A 3GDMA 3G8EA 1MSSA 4OBTA 4G1KA 2JK2A 3BG5A 1FY6A 3OVPA 2H90A 4IMGA 4UUIA 2QJGA 4PL1A 2Z0IA 5I3KA 2ZCGA 2TSYA 5G2WA 4L4MA 4UTTA 4ML9A 3QRHA 2Q8ZA 3A5FA 4UIOA 4UFLA 2NX1A 3FJLA 3WK1A 4LRSA 3NG3A 2BLEA 4AH7A 5AC7A 1LORA 3TSMA 4I7UA 3W7JA 5K4ZA 2C14A 2J9ZA 5E1QA 1P0NA 1FCQA 1H50A 1TSIA 2WNQA 3LHUA 3KRSA 3SZ8A 4N4PA 3PR2A 1KV8A 2CZFA 3W22A 2CZEA 1IXPA 2OMAA 3MP4A 4NJJA 3GXNA 1Z44A 1JRBA 1QNVA 2ZZ7A 3BLFA 3WJZA 4MJMA 2QCGA 4U28A 3P61A 4LOCA 1GWJA 1HO4A 1DJNA 1A5CA 1W3NA 4JGDA 1DQXA 3N19B 3IEBA 5U7SA 1G4EA 3C61A 4EIVA 1TB3A 4PCFA 4JY9A 1H1YA 8TIMA 3PBUA 3LDVA 3TU9A 2NX9A 3TMQA 3EWZA 1HTIA 2XN1A 3FS2A 3W7LA 1MZHA 1GG0A 2TMDA 3C2OA 3DHDA 3P8JA 3HPZA 4HT3A 1QPQA 3AJXA 1R2SA 1F05A 5DXXA 2XFWA 3NL5A 1TV7A 2ZA1A 4RX0A 1VHNA 4JTJA 4CQAA 3GK0A 1QAPA 2X2GA 3M41A 3RLUA 1GYNA 4PFMA 1F2JA 2I1OA 3PBWA 2DP3A 3NQFA 2FB2A 3A9IA 1D9EA 3IVSA 1LTDA 3WJXA 5CZJA 1KM5A 1VYPX 5FF3A 4FEZA 1H63A 5C54A 2QKFA 2NV2A 5C6MA 1J5TA 1GVRA 3S5ZA 1G67A 5DCBA 3R8RA 2ZRWA 2DZTA 1MXSA 2YW4A 3EWBX 4RZ6A 5H91A 5H2ZA 1SZFA 1MO0A 3W7IA 3HJZA 3NNTA 1YXCA 1ICQA 4Y6GA 2C18A 5D02A 1H51A 3D0CA 4MLRA 4UTHA 4IUOA 1FXQA 4M5PA 3U8GA 5AC6A 1ZCOA 5CPLA 3GDRA 1JJKA 1JCYA 4N9BA 4QNWA 3QMRA 2ISSA 3FYPA 5LZLA 4UTJA 4WY0A 5AYXA 1FCVA 4E38A 2V2HA 3W07A 3ZWSA 2A85A 4O19A 3PC0A 1S5TA 3L9CA 5CZSA 5DXYA 3O6YX 3KX6A 2CZ5A 4KFPA 4MYXA 3NPXA 3UWZA 4RKAA 2ZRUA 3S8HA 5LKYA 4HIBA 2GVLA 5KZMA 2X1RA 2HSAA 3M1ZA 1OX6A 3QF0A 3B05A 2GOUA 3G24A 1ME7A 2E6DA 1OF6A 4ADSA 4NVTA 1KFKA 4UC5A 1GPWA 4RLIA 2R14A 1SZGA 1VYSX 3G1AA 2FPTA 3QQ0A 5BNKA 2ZZ2A 3A23A 1TPC1 3E9AA 4KFOA 1UBSA 3GKAA 2KZHA 4YCOA 1KBJA 3BO9A 5G4EA 3H53A 2X1SA 4WXZA 3S1XA 3MMTA 4MY8A 1O60A 4CNNA 1LP6A 5E0KA 1MEWA 1HFBA 4Q4KA 4DELA 4N9DA 1OFBA 3FKKA 3OVQA 5I3JA 3EWUA 3PSVA 5D2WA 4BWLA 3SY5A 3WJYA 2F84A 1SSGA 2J6XA 3LM7A 3Q2DA 1AK5A 2Y89A 1TTQA 1VHCA 2ZRXA 2E68A 3A24A 4FNUA 4NXKA 1DV7A 1T8XA 3THQA 4JYDA 1N8FA 4O28A 4PEKA 1EEPA 1P4CA 1QO2A 3B8DA 1XDMA 1EWEA 3BARA 3GAKA 3GLCA 5L6UA 5CZ0A 1R2RA 4AHPA 1DJQA 4WQ6A 4X22A 4AWTA 2NXIA 3RMJA 3L21A 4O12A 4JD4A 4MLJA 1CW2A 1X7FA 3BV4A 1ALDA 1DORA 4WOQA 1ME9A 1R30A 1VCFA 3G1XA 1EUNA 1YLVA 1BEUA 3G1YA 4Z1AA 1M7PA 3EX3A 4WXYA 1VCVA 1T0OA 1EUAA 5K2ZA 2YXGA 1Q6QA 4ZQCA 1NF7A 2J88A 1WOAA 4AHOA 3LHVA 1LOQA 3N9RA 4IGHA 5AHNA 3L68A 3B06A 1K8ZA 2CLHA 1WA3A 2J24A 3TAKA 3B4UA 1ADOA 4H4IA 1O5XA 3TR2A 2GUUA 3G1HA 3NQDA 1C8VA 1J2WA 1KFJA 4HNTA 2EKCA 1KTCA 3EX1A 4M6VA 4W9TA 2PURA 1F6KA 2QF7A 1IF2A 4LS1A 3TV8A 3ABQA 5HR6A 3T78A 1SSDA 4MY1A 2NWRA 3W75A 4AHQA 5K3VA 3NPWA 4OE7A 2YSWA 3UZJA 4Y8FA 4Z1CA 3M43A 3LX9A 2J9XA 1DOSA 3KOFA 4RXFA 5T26A 4FNPA 4JIPA 3VNDA 1KM0A 2W0UA 4UTKA 4O16A 4S2CA 1S3HA 3N34A 3N2MA 4ZQMA 1O5KA 3G0SA 3QW3A 4JY8A 2P1FA 3G3MA 4XKYA 5LNVA 2ZZ6A 3KRZA 4GWEA 5K9CA 3IGXA 3STEA 3L0GA 3HGRA 1YTDA 4O18A 3FLUA 3I7QA 2VFIA 1OF8A 5D04C 3OHIA 3VE9A 3LXBA 2RDTA 3M7WA 2B7NA 4S2BA 5HUPA 3SJ3A 1XBYA 3DFQA 4NJKA 4JTIA 3W88A 1S5VA 5AHEA 1G6CA 4LV9A 3NDOA 4K36A 5D2YA 3NVTA 3TSDA 3Q37A 3CT7A 1RV8A 1KFEA 4MFDA 5D03A 3PUEA 5AFDA 3TW7A 4CCDA 1FQ0A 4GUFA 5F4WA 1HUVA 5G4WA 3C4UA 3S6DA 3MHFA 1XC4A 3B03A 2OT0A 4A2RA 1OFDA 3MBDA 2A2IA 2Y63A 2Z2UA 1HO1A 1DKWA 2XN0A 4RXGA 2CLMA 3LLDA 3KAOA 3KVKA 5AOUA 3WFAA 2HS8A 1GG1A 1RPXA 1M5WA 5LNWA 1PCWA 1W31A 2QCLA 3OG3A 1A5AA 4IPJA 3TE9A 3TQKA 2ZZ1A 3P7YA 5CPOA 1VLIA 3VKJA 5CGQA 3NQ7A 4K37A 2C1HA 3QM3A 2J9YA 1SFJA 1B3OA 3CTLA 3KFTA 5D09A 3LXAA 3S1UA 3BG3A 1QR7A 3EB2A 4WX2A 4JTUA 3MW7A 3TROA 5I3IA 3IIXA 5FI8A 2PRHA 2FPYA 2RDUA 1IXNA 3MI3A 3W7PA 5AHLA 1LRQA 4NU7A 1M7OA 4O11A 1OFRA 4AF0A 5A5WA 1JCMP 4QNEA 1FWSA 2OCZA 4FNRA 5AC8A 3CB8A 4MYAA 4TIMA 4UFIA 1LBMA 1JVNA 4DO6A 2VFGA 3ATZA 4QIUA 3W7KA 3TX9A 1I2QA 1V7YA 1JUKA 2PCQA 3W9ZA 2VEPA 3SGUA 2JGQA 4NUWA 3T44A 3UWWA 1K03A 2P10A 4LVGA 4RR4A 4YXGA 2RH9A 5CPMA 4QJ1A 1L6WA 3DI1A 4LNYA 4P61A 1QPNA 2VFEA 3PB2A 4E2DA 5CSSA 4Z0JA 3W1MA 3CLMA 3ABSA 1W0MA 3PWAA 4O17A 5D37A 3BLIA 4WY0B 3UZ5A 2D73A 5CZTA 4A2SA 3NQCA 4M19A 3GX9A 3EXTA 4JS3A 4ZL1A 1GTHA 1MEIA 3NQVA 3C6CA 1TRIA 4N9EA 2DORA 3W7CA 1WYIA 3PB0A 4UTMA 2IQTA 1VC4A 3PG9A 3R13A 3YPIA 3DGRA 3E49A 3C52A 2B7QA 5LHFA 2A7NA 4K6AA 3W83A 3FKRA 3ABRA 4RV8A 3HO8A 4NQ1A 2FJKA 4JTEA 3PG8A 4WY0F 1T99A 1GJPA 1WOBA 1NFBA 4JTTA 3A21A 3CPRA 2E6YA 1XXXA 1TREA 4O10A 3RK8A 3PAJA 1ZJIA 2JKPA 3S42A 5HWJA 3GR8A 3HG4A 2F7FA 3ZS4A 5EPDA 3I7RA 3W1AA 2TYSA 4C1LA 3Q94A 2E1DA 2RFGA 3LOTA 2YYTA 1TPUA 3W7HA 4RK8A 3IV3A 2ZRYA 1OYAA 1UJPA 3PUOA 1VYRA 1DVJA 4FX7A 3LV5A 3QSRA 2Y62A 5EKYA 4LT9A 4N6EA 1JUEA 1SW3A 3PUDA 4UFJA 3S9YA 5D2TA 3MYOA 1QOQA 1XCFA 2VKZG 1EPXA 1LBLA 2VELA 1SW0A 3GR7A 1A5SA 2Q3RA 1T96A 1XBZA 1X8FA 4O53A 3HGSA 3HMJG 1YPFA 5KINA 3W23A 4LC8A 4JTLA 1TJPA 2ZDRA 3CIWA 1W5PA 4GE8A 1PVNA 2Q8LA 5KMYA 1OYBA 1H7OA 1SO5A 3TMLA 4LVAA 1RZMA 3B0PA 1WV2A 3G8RA 3O8AA 4IWWA 4D2JA 2QUTA 1RVGA 3NXFA 3CWNA 3UWQA 3NQMA 2VOMA 4O0ZA 3BG9A 4Y90A 3LCGA 4GC4A 4LS2A 5EMUA 1TIMA 3LCLA 1QMLA 1TQJA 5HULA 1Y0EA 4FB7A 3PF3A 1A53A 3HGOA 4EOUA 3L0NA 3WK2A 1NVMA 4QSHA 3EWXA 4O8RA 2B7OA 3N3MA 3L5AA 2Y7FA 1QFEA 3EKZA 4HSNA 3MJYA 2C16A 4Z0SA 3TC6A 3K30A 4CNOA 4X2RA 2H8XA 3IGSA 3EXRA 4KFNA 3TDFA 4YL2A 4CLMA 4YLWA 2EAWA 1YDNA 4Q32A 5I3FA 4ADTA 3LB0A 3DAQA 4ZQRA 1LZOA 1W56A 3DFPA 4MJZA 2WKJA 3V1PA 1AG1O 1KM2A 4IXXA 2ZTJA 1H5YA 3CEUA 5E93A 3EEGA 1SUXA 2WNNA 3LV6A 4XKYB 2QCEA 5D2VA 5TIMA 1RR2A 3TIMA 2Y61A 3LHTA 4M7TA 4ZVJA 1JCJA 2JBMA 1YYAA 4GJ1A 5KTLA 1AW1A 1LOSA 3C3NA 3NR0A 3LHWA 4PC8A 3W7RA 5CG7A 4ADUA 4X9SA 2P0OA 1OG0A 3OBKA 1EA0A 5FEPA 4CCCA 4K8EA 1WBHA 3L65A 3W2LA 3G0XA 1FUYA 3JS3A 4QQ3A 1KFCA 3B0UX 5HR7A 2A6NA 1U5JA 2UV8G 2WNZA 4O4VA 1NSJA 2DJXA 4UCGA 5FF2A 3CIXA 1YTKA 3NL2A 4WJEA 4XTIA 1KM4A 5TQLA 2OJPA 4MVAA 4HPXA 3F03K 1XL9A 2E6FA 2E5DA 1VZWA 3PBVA 2VENA 1NF0A 4UR7A 4OT7A 1PS9A 4IJBA 3QC3A 4L4LA 1JCXA 5CKSA 4PTNA 4IX2A 1SFLA 3GZ3A 1OX4B 4K7YA 1Q6OA 1LRNA 1TPWA 1L6SA 4HPJA 1LM1A 3L5MA 2V81A 3HOJA 1I4NA 3BVJA 4K39A 4UTUA 1OFPA 4TO8A 3GDKA 1WBJA 2C3ZA 1UUMA 2G5WA 1LDCA 4J9JA 1H60A 1OFQA 1H7WA 4EWND 5DY2A 3GVGA 2Z6JA 1XUUA 2VFHA 4BF9A 4HHPA 1V5XA 3NO5A 3W87A 3UYCA 3MP3A 3TH6A 3UPBA 4CQ8A 3C2VA 4AF0B 4E0CA 5LNSA 3DI0A 3A5VA 2O7SA 4K7VA 1QWGA 3THAA 5G1TA 3UD6A 1XBXA 1KTBA 1K7FA 3TK7A 1ICSA 3LTYA 1VGAA 2DU2A 1RQEA 2PC4A 3R5EA 4UTWC 2QAPA 5G2IA 3KXQA 3KHJA 1OYCA 1XKYA 1KLZA 2VEIA 1DBTA 3S1VA 2V82A 3UNDA 4UFKA 4PA8A 3L2IA 3G1SA 1W5NA 1SO4A 4WD0A 1ZFJA 1LROA 4ZZ9A 1TQXA 3HG2A 1EP3A 1C29A 2LLEA 4XTDA 3TC7A 1GOXA 4DPQA 2I14A 2V5BA 3QYQA 1Z48A 4JTHA 4Z1BA 3LI1A 1VPXA 1L9WA 1KM3A 1EWDA 4DF1A 1W5OA 1ZAHA 1UASA 3M44A 4AXKA 3W7GA 3HIJA 5D05A 1KM1A 4DO5A 5C5YA 1XM3A 1BKSA 3W70A 3N2XA 1UCWA 3WK0A 1R47A 3LCIA 2Y70A 2JKAA 2GQ8A 5FF0A 4IMEA 2FIQA 3W72A 1K02A 1IGSA 4IPIA 3HG5A 1D3HA 4YCPA 2QDGA 3W1UA 4X3ZA 2BTMA 1G4TA 4DBEA 4DBDA 3E02A 4CQ9A 4JYEA 3NQEA 3BW4A 2NUYA 3GAYA 2C0AA 1OX5A 1TCDA 4HN4A 4ICNA 3CQ0A 4XWUA 4AMAA 4N02A 3PS7A 2A5HA 4PL2A 3NOEA 1THFD 3VCRA 2OT1A 4R33A 3LBMA 5BMWA 4RZ5A 3BW3A 4LUIA 3LRMA 4MFEA 3NZRA 1AL7A 4IMCA 1OFAA 4JDBA 4DF2A 1Q6LA 5F4SA 3TNOA 5KZEA 3LGEA 4JTFA 1IXQA 3SR7A 1FDYA 2DZXA 2J27A 1FX6A 3INPA 5F1UA 3ATYA 3EXSA 4OQVA 4LU0A 3HGJA 1F74A 2PRMA 1O94A 4NZJA 1GQNA 3WJSA 1OFOA 3PBYA 5AHMA 1GEQA 2E6AA 2B0MA 4ORIA 2ZA2A 1K8XA 3I68A 4DXVA 1PCKA 1C9DA 3EWWA 3TXVA 5DLCA 4N4QA 1VS1A 4O15A 1K8YA 1TMHA 4A3UA 3UWUA 3BGGA 4M6PA 7TIMA 2V9DA 1SO6A 1I8JA 3W7NA 3LHYA 2G96A 2GVJA 3M9YA 1B4EA 5D38A 2ZA3A 3MO7A 5EL1A 3R12A 3LCHA 2X30A 1TJRA 4H3DA 5I3HA 2ALDA 3IVUA 3NL6A 5LNRA 2BZNA 3L66A 3HBLA 2ISVA 3W2JA 3NYZA 4R7JA 4OV4A 4A22A 3DKLA 3HF3A 3TQ0A 1EB3A 1O4UA 3KVMA 3DU0A 3GXPA 2GJNA 3LTPA 4BI5A 4TMBA 4ZQOA 5I3GA 3N73A 1KFBA 2HTMA 2E5CA 3TW6A 3M5XA 5DBUA 4EF8A 2V8ZA 1SU5A 4O54A 1DQWA 4JR5A 4YMZA 1OX4A 3EKLA 1FXPA 1KFLA 3CEPA 4OWGA 5F2IA 2GJLA 3EX2A 4A29A 1QO5A 3PVFA 4LY8A 1JRCA 2AQWA 4TMCA 2QEZA 3DFOA 3DENA 5F2MA 1UUOA 3UY7A 5BRBA 1TRDA 3CHVA 4QAIA 4XBKA 4O50A 5J5RA 4QISA 4LVDA 1LOLA 4CNPA 2QCFA 4H6KA 2YX0A 5GVJA 5FEZA 4FXSA 3FJ6A 1BWKA 3NZ1A 1D3GA 3G3DA 4IXHA 2R91A 1X1ZA 3NQGA 1Z41A 2YR1A 3LLFA 3P5ZA 3NAVA 4KKXA 3LXCA 1IXOA 2DJLA 4NNCA 1J4EA 1SQ7A 4I7VA 3USBA 4JICA 3IIPA 3TUUA 4S1FA 3MHUA 3W1XA 4QITA 3QMSA 4TU1A 5C55A 3B04A 1VJIA 1LRTA 4M6QA 4PODA 1OFEA 2YCEA 1PIIA 4CCEA 2Y88A 4HNUA 3EX4A 4GUHA 3R89A 2ZZ5A 1TTIA 2BXVA 3QQ1A 3NGJA 5AN7A 3E12A 4LC6A 4FNSA 4QM1A 2V30A 4MPQA 1RQHA 4FNTA 5LGZA 1YXYA 2ZRZA 3A22A 3P82A 1EP1A 1MEHA 3TCEA 2NUXA 2V2CA 1SW7A 1BWLA 2ZZ3A 1QPRA 2A4AA 1N7KA 3DXIA 3MI2A 1AW2A 2AGKA 1KLYA 2NLIA 4LVFA 3W2NA 3TSBA 4DPPA 2YW3A 4O1BA 3RFAA 1B9BA 1OHLA 1W54A 2CLLA 3O07A 2WOQA 3S5NA 4O1DA 5CPNA 4FX6M 3OEXA 2Y6ZA 4RJEA 3S5YA 1KW1A 1ZHAA 1ML1A 2RDWA 2HMCA 5EY5A 1GVOA 4C1KA 1I2NA 3NQ2A 4NNAA 4OV9A 3F4WA 3W7OA 2Y7GA 4FXRA 4I9AA 3QW4B 4HNNA 2ZTKA 2V0TA 2WSQA 5FF4A 4BK9A 2XN2A 3CWOX 3TFCA 3QMTA 3W7QA 1LBFA 3LCWA 4DEFA 2QCNA 4E2BA 4LVBA 1W3TA 3QEZA 3STCA
chains in the Genus database with same CATH superfamily
1A50A 2FZDA 4MAZA 3SN0A 2DZWA 3C86A 1ONRA 1W1B1 5IBXA 2GPTA 3NDZA 3AIEA 4C6JA 4N0RA 2HVNA 1I2PA 3MV11 3RIKA 1ZALA 1GTEA 5FSEC 2Y7DA 4GGHA 4XZIA 4DB7A 2ZADA 1NM9A 2WVSA 1DXIA 4F8XA 2E25A 5BXPA 5HNTA 1PL9A 4HNCA 1XUZA 1ZB5A 4QLJA 2CITA 4UMAA 1GK8A 3TJXA 3HPXA 1YMYA 3IUHA 4LTSA 4DQWA 2ZX7A 5CAKA 4B15A 5FCZA 3MMDA 3P67A 5CPTA 7ODCA 3Q65A 1F76A 1VFFA 2QCCA 2X40A 2WSYA 3JW7A 3WF2A 2GQ9A 3ZFHA 2INZA 4TX9A 5CGMA 1HGYA 1KWKA 3V1HA 2OGJA 2E77A 5F1VA 3H6OA 2ODOA 4C6EA 1KXTA 1SR9A 3VD9A 5LA0A 4P5UA 3T4WA 4WIWA 3B9AA 4IIFA 1MI3A 1MUMA 3TZNA 1TUXA 4XSLA 4ALDA 2NV9A 3SGGA 3W2UA 4J35A 4XD6A 3AXHA 4RW5A 4KBXA 5H8MA 3LTSA 1W1IE 2I57A 3RLVA 2C71A 3NQ8A 1QOXA 2X2YA 3MVIA 3FY1A 1XIBA 2ANUA 4AVFA 5HANA 1ONWA 1HVXA 4UTFA 3G1FA 5BOOA 2EGZA 5D9NA 2XM1A 5LSMA 3E0IA 2ZX8A 3CQJA 1UKTA 4YWIA 3BLEA 2A21A 2W61A 2YL5A 5K9DA 1F6PA 2PLMA 3ZSSA 3KRUA 2XSBA 3ES8A 4XZ9A 3AALA 5DN1A 1UD3A 3ZVHB 4C6DA 3RX2A 4J1OA 3AMKA 2C1GA 3AC0A 5DCDA 1FDZA 1IZKA 4QS5A 1S46A 4JEQA 1PV8A 4P7NA 2AMXA 3IACA 1P43A 4FIQA 1QHPA 1R2TA 1VFMA 1HIZA 2P88A 1LLWA 2Q01A 2G95A 4WSKA 1OJXA 5LGXA 4ECLA 4PTMA 4AWEA 3O63A 1EGMA 1GPFA 2O4MA 2UZ9A 3VIJA 3DG6A 3LERA 2VM8A 4UTLA 3V5CA 2CNCA 4PFHA 4TVDA 2JIWA 3EX6A 2WC7A 5JIWA 4B2DA 4L56A 2IMRA 5FF7A 3GG0A 4PTDA 2NV1A 3PPFA 4PUJA 3HQ1A 3S3GA 2FB3A 5BXSA 3P6LA 4GZ7A 3HM7A 4GQQA 4LAUA 4XKMA 2RHGA 1HJXA 3W01A 1PIGA 2X1TA 3NM3A 1QNSA 1ZJHA 1TX0A 4DWSB 2OWCA 1VKFA 3NQAA 3DYOA 3AIBA 3EWCA 5AVHA 1W3JA 4US5D 3NDYA 1A5BA 1DTNA 1O1HA 3MUAA 1FCUA 4HZ7A 2OB3A 3DFYA 4AC1X 4AC7C 3K8MA 5DY3A 5L9FA 5AHFA 2A3AA 4KPLA 1NWSA 3P5YA 4PCSA 2YCKX 4C6CA 5GJPA 3FDGA 1OABA 2NZLA 5A8GA 3HPSA 3KL3A 3WO8A 2O4QA 4WEVX 2DT1A 4L9ZA 4B4HA 1EF2A 5FEXA 4CU8A 4LANA 3WJWA 2C8NA 1VCGA 1GOKA 1LWIA 1TX2A 5CJMA 3AUJA 2DH3A 4MNKA 5I5RA 3SCUA 3DHFA 2NX3A 1K6WA 2QCDA 3GXFA 5DANA 1UD5A 3HFTA 4DLMA 3RLGA 7TAAA 1TTPA 5G1YA 3QSTA 4A05A 1DJWA 4PRTA 1R46A 4FLSA 1KM6A 4LRTA 2PLJA 3MUY1 1GJWA 1Q8JA 3CTTA 1IIHA 1NOWA 1B3VA 1UD2A 4UTIA 1Z42A 3QLLA 3GU9A 5DT5A 3CASA 2DZSA 5EB8A 4HSOA 1PHWA 4TTGA 1G0CA 1M7XA 1KD0A 1FWNA 1NARA 1VFTA 2V5LA 2EKGA 1YNYA 3F4CA 1E6NA 2DZPA 3EDDA 3U9IA 3BLDA 3NPUA 2F8QA 1NOFA 2Z25A 4ZCWA 1TTJA 4BS0A 1TV5A 1O6IA 3W1QA 4AZIA 2VXNA 5ABFA 3CYJA 4BI6A 1UB3A 1K3UA 3BW2A 4NAFA 3BCDA 2A3LA 5HWNA 1B4KA 1V51A 2B7PA 2POZA 3PM6A 3T40A 3MMWA 4NJIA 2GDQA 1IHIA 2VR4A 1OEPA 1GT8A 3F1QA 2OZ0A 2WSRA 4UXDA 4F9DA 5EYWA 1JULA 4WDWA 4WZHA 4IMAA 1UHVA 2WWCA 4FNQA 5FEWA 2CLOA 5BW6A 1TVNA 3GKFA 1XW8A 3E5PA 1NAL1 1IEIA 1XWYA 1XYCA 1S5WA 3KVJA 4H6EA 1DHPA 3E96A 4PMNA 5I06A 1XPYA 2IQ0A 1KQZA 4US6A 3AISA 4S3BA 1T41A 4ZSUA 1O5QA 3MP5A 4Y9AA 2PTZA 2QDEA 1DHKA 2F2HA 4H8UA 3ABOA 1UA7A 4L65A 3VGBA 5REQB 1DIDA 1TV8A 3EWYA 1KGWA 1MXGA 2XFFA 3W6MA 3SIZA 5HMFA 3SGZA 1B2YA 3HB9A 4HK6A 3VMNA 1KV5A 3IIOA 5IRPA 1UD8A 2BBFA 2ZYFA 4PE8A 1O95A 3GE7A 3UR8A 2FFIA 3N12A 3AXXA 4ZXLA 1U30A 3VOHA 3W76A 4HCDA 3NZQA 4CN4A 1GZGA 3VKAA 3N4AA 1TPDA 4FO4A 4CQDA 2X16A 3UESA 3OGSA 5C9RA 4C6PA 4DO4A 1TR9A 3WQ5A 3M5YA 4AWUA 2WMJA 1OIFA 3AICA 6ALDA 3SCOA 1V3KA 4NG3A 3ARWA 1GNXA 3B8UA 4F0LA 1F73A 3OG2A 4PSPA 4K38A 4GOAA 4HPNA 2QJIA 2POTA 3CU2A 3PZMA 5C9XA 3MCOA 2CZDA 1WDWA 4C1NB 1XIFA 1GEHA 5GPRA 4A3YA 4FXFA 4MZYA 4UR8A 4REQB 2PDLA 4V2XA 5CZKA 3PTDA 3I4EA 1EJUC 3ANVA 1XLBA 4Q8QA 3T08A 2FZ9A 1OT1A 3L0KA 3AS0A 1V08A 1NEYA 1KBIA 3GU2A 1BXNA 1O5RA 4XQ6A 1R7OA 2QDHA 1BSLA 3A3WA 1QU4A 5KITA 4DVOA 1LUCB 1KB3A 3G2GA 5CQ1A 4AB4A 4B16A 5LIKX 5I09A 4GKLA 1TA3A 1YX1A 1US2A 1VEMA 4O1AA 1Q85A 1SO3A 5BROA 1W3KA 4LWWA 4S3FA 3WELA 1VD6A 2CU0A 1TO3A 4HNVA 2NT0A 4JDYA 1E73M 4Q8OA 2HE5A 5IFTA 2ZC1A 3U5YA 1H7XA 3BLOA 1ITCA 2J8TA 1TWWA 4DF0A 2E09A 3CC1A 5HNRA 3W6YA 1H2JA 1RBOB 1EDTA 1XYZA 2YA2A 1YDVA 2P50A 2AAMA 2GGHA 3THUA 4EK7A 2PU1A 1B5TA 4F2UA 3POHA 3DHUA 3GDMA 3T0DA 3G8EA 4PRRA 3GG1A 2PODA 2PC8A 2JK2A 3BG5A 4S38A 1Q13A 3UJEA 3V35A 2ZCGA 1Z3NA 5G2WA 3KWXA 2DV0A 4LALA 2NX1A 3IK4A 3K4DA 5K4ZA 5E1QA 3RMEA 2RGMA 2WNQA 4QG8A 2PDBA 4X63A 1XCWA 4DYJA 1TE6A 3SZ8A 4N4PA 1KV8A 3EAUA 2CZEA 4URIA 4B3LA 1HJSA 4ROQA 4GI6A 1GONA 1OIMA 2FZBA 3RN6A 3GWQA 2WM1A 3WJZA 3HA1A 1GWJA 1K8CA 1DJNA 3TLQA 2J66A 3N19B 2XSAA 3WEOA 1TB3A 3UU0A 3QV6A 2G50A 4W7UA 1FH8A 2XN1A 3W7LA 4MJ4A 1MZHA 1GG0A 3HPZA 1QPQA 1ELSA 1R2SA 3MSGA 1TV7A 1B3WA 4RX0A 5C2GA 1UR0A 4MNMA 3DESA 2IKIA 3UERA 3UZZA 1M01A 3A3HA 2X2GA 3ECQA 3MSDA 4HNOA 3RLUA 1GYNA 3WD0A 4J5NA 2I1OA 3NCOA 2FB2A 3A9IA 4PCPA 2PDFA 3AXMA 1VYPX 4FEZA 5C54A 5CH9A 2J79A 5A8NA 1C90A 2Z00A 4GQGA 1DIEA 5C6MA 4D71A 1J5TA 5E9AA 4B5SA 3SRDA 2J4GA 2ZVIA 1G67A 3BAYA 3R8RA 4ZFMA 3V0SA 5H91A 5H2ZA 4XD3A 1SZFA 4GNVA 3NNTA 5JBDA 5D02A 4JFWA 4MLRA 4UTHA 4M5PA 5AC6A 4LAOA 4QNWA 2ISSA 4UTJA 3KBVA 3LPOA 4JNYA 4DAFA 2XUCA 3FVDA 1AH0A 5EBAA 2VDIA 5CLWA 3F2CA 4O19A 3UR7A 1E1FA 3FDKA 3O6YX 4U31A 1KBKA 1F3TA 3KX6A 2CZ5A 4DZIA 4KFPA 4MYXA 3NPXA 5TAOA 4JQ3A 2X1RA 3M1ZA 3G24A 1TFVA 4ADSA 1M3UA 4DBUA 1KFKA 2GK1B 2R1MA 4Z2IA 1SZGA 3UPMA 1XRVA 2WQDA 3G1AA 2XHYA 3I3DA 4WRHA 4E8GA 4H9TA 4KEZA 3M4HA 3IAQA 4HGXA 3E9AA 3CS2A 3GKAA 1EYEA 1P7TB 4WXZA 3S1XA 2V3GA 4PB4A 4CNNA 2EPKX 6CGTA 3KL0A 4DELA 4B3ZA 3TYDA 4N9DA 1UPPA 3FKKA 3PSVA 3VYLA 4UB9A 3DN5A 3UJRA 3WJYA 1AZ2A 4I6VA 1WP6A 5HATA 2Y89A 1TTQA 4QDMA 2VZSA 3E1F1 1Q7MA 4JYDA 2XVNA 2ZIDA 4L1WA 4ZTXA 3BARA 3GAKA 2NT1A 5M3WA 4WQ6A 3ZZ1A 1HKKA 2WCSA 2RGLA 1NFPA 4DIAA 4JIIX 4QRNA 3QOKA 4Y7EA 3LQLA 3LGDA 1V6VA 1TMQA 4DBWA 1R30A 2ADAA 2J47A 1EUNA 1MUCA 3W38A 5ABGA 4QJ3B 4WXYA 1VCVA 5K2ZA 2YXGA 1IT7A 1NF7A 2WMIA 1K8ZA 3TW9A 1KRCC 3KCLA 1S2UA 3NQBA 1KO0A 5BRPA 3TR2A 2ZXBA 4GX8A 4Q3MA 2FGLA 1KTCA 2YCJA 2DPEA 2QF7A 1IF2A 4K1WA 4YNGA 4YWSA 1SSDA 1BWVA 3CL8A 3OYZA 4WKHA 2VR5A 3BSGA 3GBEA 4RXFA 2V63A 5T26A 4JIPA 1NDWA 2W0UA 3TOPA 3WLKX 2HCVA 4IIBA 4DXKA 2VVSA 3QHOA 1LT7A 3SQSA 5LNVA 4WR3A 2FMNA 2ZZ6A 2OODA 5K9CA 3IGXA 2ON3A 3L0GA 3HGRA 1YTDA 5CPQA 3I7QA 2VFIA 4LNCA 5D04C 4DUVA 2RDTA 1MQPA 2VC9A 3M7WA 4HMEA 1Q5MA 1HL9A 4GYPA 3W88A 5CBBA 3NDOA 4K36A 3VIMA 1QK2A 3NVTA 3TSDA 2PDUA 1KFEA 1ZBKA 4MFDA 5D03A 5AFDA 5PTDA 1V3LA 5EGRA 4GUFA 1HUVA 2PDJA 1HVQA 4MB1A 3S6DA 1M9HA 3MHFA 4D9PA 4A2RA 2A2IA 2Z2UA 1HO1A 2FH6A 2G3IA 4QQUA 3KAOA 3KVKA 1DWIM 1F61A 2OYLA 5LNWA 1RXOB 1PCWA 2QCLA 4E8DA 3FA3A 1YPXA 3TE9A 3ZSTA 3P7YA 2QPXA 3GM8A 3TYBA 3NQ7A 3E3HA 4DXXA 1SFJA 3CTLA 3LXAA 3S1UA 1VIZA 4WX2A 1D7KA 3MW7A 2BGNE 2FPYA 2PWGA 1M7OA 2WM0A 2EQDA 1W1TA 3M64A 1CXKA 1JCMP 4QNEA 1R5YA 3LY0A 3PFMA 4QE1A 2GGGA 4DJEA 5H8PA 3W7KA 1V7YA 2D2HA 3OLDA 4TX6A 2JGQA 3UR2A 1CXFA 4H7VA 3SQLA 3UWWA 4C6FA 7REQB 4IFKA 1K03A 2QUMA 3CH9A 3ARUA 2P10A 1DJXA 3WF0A 3CV6A 4LVGA 4RR4A 2RH9A 2VZUA 1UP2A 4D6GA 4QJ1A 1L6WA 3DI1A 2D23A 4LNYA 2OVLA 4QGCA 2ZWYA 2F61A 2Y2WA 2VFEA 3PB2A 2CZVA 2VRKA 1TWDA 1TWIA 1CB2A 4R3UA 4AD5A 3HZ3A 1NDZA 2YDQA 4JS3A 4ZL1A 1GTHA 2GJXA 3NQVA 1QW8A 3OGVA 4N9EA 1K70A 3W7CA 4UTMA 3S2LA 2BHZA 2WVVA 4WDUA 5HOSA 4NYYA 3W83A 3KBMA 3ABRA 4UOZA 2R6OA 2R1NA 4IJRA 5A6BA 3K8KA 3WUGA 3IARA 2ZUWA 1GJPA 1WOBA 3ITTA 4H8VA 1CIUA 3CPRA 2E6YA 4O10A 1OINA 5B80A 4DI8A 1RJRA 4FXJA 3HG4A 5EPDA 4ERAA 5HNNA 1J18A 2FHFA 2QIWA 3ZT5A 3LOTA 4Q8MA 4PUKA 4OBRA 1UJPA 3GC4A 1UC5A 4YU1A 3TC3A 2VP8A 3POCA 5I6SA 4FX7A 3LV5A 3QSRA 2Y62A 1F8MA 4N6EA 3PUDA 4UFJA 1UOZA 3BUVA 2G0WA 3ME3A 4AISA 1EPXA 3PZVA 1XPGA 3FEQA 1JDEA 1TUFA 1NH6A 1W91A 1XBZA 4O53A 3HMJG 4Z2KA 1BHGA 3CV7A 3CHDA 4JTLA 1J6PA 1AQHA 1XLIA 4W7VA 3AIWA 2ZDRA 2PEVA 3N13A 1W5PA 1PVNA 2Q8LA 5KMYA 1H7OA 1SO5A 1GYMA 3KLLA 2BODX 3KBWA 1IWAA 3ZJ8A 4IWWA 4IH3A 2FVKA 3NXFA 3CWNA 1JXJA 1UJQA 3UWQA 3NQMA 1BVWA 3BG9A 4Y90A 3LZ5A 4GC4A 4PGLA 3L23A 3LCLA 3G6LA 1Y0EA 1N2VA 4HSHA 4EOUA 1H0IA 3WK2A 1QNRA 1JYVA 4Z1YA 2GVEA 3K13A 4JFUA 7XIMA 1NVMA 2XINA 2DSZA 4O8RA 1QFEA 3UP8A 2HRWA 3TC6A 3FGCA 4KT2A 4X2RA 1DJZA 1HT6A 2OG9A 4CU6A 4KFNA 2C91A 3IAPA 1UWRA 1EX1A 4CLMA 2EAWA 1YDNA 4Q32A 3MANA 1XG4A 3ZR5A 1LZOA 3GW0A 4HNLA 4ZSTA 4IXXA 1KM2A 4I9MA 1R3QA 2PDIA 3LV6A 5D9OA 1NJJA 5TIMA 2VNCA 2ACUA 2QMKA 3TWBA 3LHTA 2Z7GA 4PUDA 4E3TA 1VJSA 3GRIA 5KTLA 4KS0A 3AIRA 3C3NA 4XZNX 1VFLA 3NXLA 3LHWA 3IJ7A 4KERA 3U0HA 2P0OA 2BOGX 1UKOA 3E38A 4K8EA 4EE9A 3W2LA 1SVDA 3V3WA 1SJBA 4M80A 1S1PA 1HJWA 3JS3A 4QQ3A 4AXNA 1KFCA 2WNZA 4NRSA 4O4VA 4AG0A 1NSJA 3N6JA 4MNLA 5JH2A 2OZTA 4FOJA 3CIXA 4ZE4A 4XTIA 2E5DA 3PBVA 1NF0A 3WBAA 2BXYA 1YNPA 4L4LA 5M17A 1S1RA 1JCXA 3EDFA 5CKSA 2J7FA 4PTNA 4IX2A 2G4JA 1XIMA 5XIMA 4G9PA 1GQKA 3HOJA 3SM0A 1ZP3A 2BG5A 1I4NA 3BVJA 4K39A 4KRTA 3GDKA 1UWQA 3TP4A 3KBSA 5EMLA 3LPPA 4J9JA 3H7RA 4KH2A 2V3FA 1EHNA 1XP3A 3BICA 3GVGA 1XUUA 2VFHA 4IUGA 4BF9A 3W87A 2V5DA 4FOUA 4CQ8A 4AF0B 4E0CA 4B5TA 1RAKA 3CHEA 4R85A 3FV9A 4UOQA 3CAWA 1KTBA 4BY3A 3TK7A 1S2AA 2OQYA 1VGAA 2UY2A 4R5EA 2GSJA 3R5EA 4EXQA 1R3WA 1BTCA 2QAPA 3T8LA 5G2IA 1XLHA 3KXQA 4G5DA 1RALA 1RHCA 5A2CA 2OU4A 1DBTA 4PA8A 4LEQA 1FWFC 5FJRA 1ZFJA 3GC2A 2VDHA 3KM8A 4AVNA 1TQXA 1EP3A 1C29A 2I5QA 5BU6A 2V5BA 3QR0A 1Z48A 3B9EA 2PD9A 4JKLA 1S2CA 4D6CA 4DF1A 3KWSA 1ZAHA 2MNRA 4TVUA 3M44A 2PFHA 3KDOA 4DO5A 3F7JA 1BKSA 3W70A 1UIOA 2Y70A 2VGBA 3AWNA 4M29A 4QXIA 3W02A 3O2LA 3GVQA 1X38A 1ISZA 1JD7A 1K02A 2J78A 3CPUA 3NGFA 1UWTA 3BQ6A 1PYMA 2VX7A 4FAMA 2ISDA 3QLDA 4DJDA 4CQ9A 3NQEA 5IDIA 2VRJA 4M51A 3GAYA 3PUGA 2C0AA 2JIEA 2QXWA 3PJXA 4ICNA 1EOMA 3C0SA 4Q7NA 3N15A 3VCRA 3GQYA 3EB3A 5BMWA 4RZ5A 2DW6A 2FJUB 2QLYA 3TLLA 1POJA 3W81A 2CC0A 1Q7ZA 2J7EA 1OFAA 4O1FA 1Q6LA 2XJ7A 3TNOA 1R6WA 4D8AA 1A3XA 3T81A 4JFTA 1GQLA 1FH9A 1FDYA 3QZAA 1FX6A 3ATYA 4DY1A 3HGJA 1F74A 4GQRA 3RM4A 3VU2A 1OFOA 3WH9A 1J0ZA 3DGBA 2B0MA 2G3NA 3VM5A 2CBIA 5DLCA 1VS1A 3KEHA 4JHZA 1TMHA 1RP8A 3BGGA 5JU6A 2V9DA 3W7NA 1B4EA 2ZA3A 4I9JA 3WLTA 4BQ4A 3LCHA 4YS1A 2ALDA 3AHTA 4Z2JA 3IVUA 3A4WA 5FA5A 3ZVHA 4J27A 1BF6A 1ONXA 3NYZA 1HN1A 3DKLA 3WSUA 2VUNA 4GG9A 4TMBA 4J3VA 3ICJA 2R82A 3AAMA 1BQCA 5G4HC 1ZPTA 2PD5A 3QV8A 5DBUA 1SU5A 1DQWA 5BRQA 2HQAA 3EKLA 3ZVIA 1A5KC 5JBEA 5C9ZA 3ITLA 3FA4A 1K1DA 3PVFA 4LY8A 3VCNA 4C6IA 1TZ7A 3DENA 3OO2A 4OJYA 4AZCB 2VC7A 2CYGA 5E9XA 1R86A 5J5RA 2O9PA 4LVDA 3URQA 3WQVA 1GKQA 4CNPA 3RX3A 4FXSA 8XIMA 4PMJA 2J7BA 3QV7A 3CMJA 1BWKA 1KRMA 3BJTA 3NZ1A 3OA5A 1MVYA 4XZLX 3G3DA 3UZYA 3SURA 2QS8A 3PZOA 4H9MA 1EGVA 2MUCA 1IT0A 2PBGA 4LBSA 1W9PA 2YJQA 3A3XA 5GJNA 4DWSA 4KKXA 2PWFA 2D0HA 3BZJA 1NWRA 1UP3A 4C7GA 1J4EA 1HGWA 4S1FA 2WZMA 4QITA 2W4XA 3B04A 3WQCA 1LRTA 1OFEA 3M0HA 2SFPA 1B90A 4CCEA 1J11A 2Y88A 3EX4A 1R3TA 4H83A 1BXBA 4GUHA 2ZZ5A 2OSXA 3BZGA 9RUBA 5AN7A 3E12A 3TVAA 2V30A 3FHAA 1EJXC 2W5FA 1DYSA 4EPEC 4FNTA 1UWAA 4GH3A 3GH5A 3H7VA 4DJFA 1YXYA 4NP7A 3P82A 1EP1A 2V2CA 2BVWA 1SW7A 3DX5A 3H8AA 8RUCA 1ENUA 3WQFA 2YBVA 3GNRA 5AY7A 1Q6FA 1OHLA 1MQRA 3S5NA 1UR4A 1IEQA 5CPNA 5G1MA 3PNZA 3CZLA 4RJEA 4RW3A 5C0QA 2I5IA 1GVOA 4PMZA 2W92A 4NNAA 1XIGA 3F4WA 1B1YA 2HE8A 3NZPA 1I0BA 3SQMA 2J7HA 5EMJA 2PGFA 4I9AA 4NAEA 4FA3A 3QW4B 1PB0A 3LNPA 4S3KA 1DE5A 2WSQA 3GSMA 4BK9A 1B9ZA 4HMCA 3TFCA 1LBFA 4IFRA 3DG7A 3E0VA 3LCWA 3K4AA 1NQKA 2QCNA 4RDYA 3QEZA 4GHRA 1GQJA 2ZX9A 3STCA 3C2EA 3WZ0E 4H1ZA 5K7JA 1H7NA 3QN3A 1S5NA 2R1LA 3I7SA 4HZ6A 3VOIA 5IBXC 2CLEA 1XRTA 3VINA 2E0PA 5HMSA 1TPVA 4UBPC 1IZJA 2QJHA 1WZLA 3CUIA 1F9CA 2INFA 2O92A 1F7BA 2Z24A 1NWUA 3C2FA 1GVSA 3S2MA 3OIXA 1CGYA 1I2RA 1Z69A 1QJWA 2GVGA 2ZZ4A 3W1RA 1PKMA 2XWEA 2QCDB 2WKGA 3VIOA 3MUZ1 3PY2A 1TG7A 4EANA 4POCA 5A6SA 5A94A 3AOFA 1IIGA 1JQVA 4ZA0A 3QTGA 2Z1BA 3P60A 1FKWA 2P76A 1PIFA 3SFWA 3UF9A 4IIGA 4FLOA 1E9YB 1KA9F 2FGBA 1RLDA 1MW2A 1BFNA 3P0WA 2J77A 3VFLA 3MS8A 2OEJA 2B4GA 4HP5A 4IPNB 4WOZA 1KQYA 4QCEA 4DLFA 1SMDA 1V77A 4PMOA 4HA1A 5REQA 1GOQA 5GQBA 3LBCA 5CAHA 1LYXA 3WH8A 2PDYA 1JZ2A 4D72A 1N8WA 3DFNA 3WKZA 2QCHA 2RKXA 1ZY9A 3VNZA 3W1TA 4NAFB 1MFVA 3P74A 3EDKA 3IANA 3AI0A 3QGAC 1WB0A 1Y5XA 4A21A 3SCWA 4Q8PA 3P84A 4PSRA 3ZWTA 1TJ0A 3WX7A 3M6YA 2I16A 5LIUX 3TAOA 4Q33A 3L4XA 4ICMA 3W1LA 2WXDM 3TONA 4GCXA 4GBUA 4C60A 4R9OA 2Q8XA 1YTEA 4V28A 2CLFA 2E9BA 1SR0A 1FP8A 1EH9A 4AQLA 4CD4A 1GUVA 2VFFA 4NSBA 5JVLA 4KF1A 1V4YA 4NZFA 1QNQA 5BMXA 3GIYA 3FFSA 3ITXA 3L4UA 4RZ4A 2VRQA 2WJZA 3OLEA 4C1NA 3P80A 1K9DA 4LEFA 3BPWA 4AUBA 3M47A 3VUPA 3EYPA 4REQA 4AAJA 4U4MA 4JTGA 4GUGA 5DO8A 3GS6A 4W8AA 3BLLA 3ELFA 2IS7A 1J0JA 2XFRA 3MV01 2Z29A 7CGTA 1BVNP 2CKRA 2X42A 1CLVA 2Z27A 5LNUA 1LUCA 1MW0A 6PTDA 3A47A 2CBJA 4R9XA 5HNUA 1GVFA 3LGGA 4BR1A 1X1NA 3VD4A 3W7EA 4B91A 2QUNA 4UTWA 4HHMA 3GR4A 1AL8A 1WUEA 1W5QA 4AWSA 3G1DA 4HKPA 3UQNA 4LF1A 2J7DA 1J9YA 3H22A 3F5KA 4U10A 5E6YA 5KZDA 4GCAA 3WNNA 3WDHA 3ONCA 3MWAA 3URNA 3B0VC 3LMZA 3BMWA 3SSJA 4OOZA 1U1UA 4AFYA 2YZRA 2F9RA 3EA2A 1E51A 3WDRA 3L7RA 3W2KA 3PULA 3M5ZA 1TPB1 3V5OA 2OO6A 1F07A 1QCWA 3NQ6A 3KTCA 4JNZA 2AQVA 1PHQA 1VRDA 4FF7A 2O7QA 5M2FX 5LHEA 3VE7A 2WZIA 2Y7EA 4OU1A 3TJLA 4O52A 4OECA 3H55A 1R0MA 1IZCA 4I3GA 1E9LA 4DJED 4UMBA 3RF9A 1FWHC 2H9AB 1H62A 3UCQA 3W73A 1JCNA 7A3HA 3C8FA 3QQWA 5C9WA 5E0CA 1PX3A 2E5BA 5GNZA 3V75A 3W2MA 3GDLA 4MTVA 3SUWA 1U83A 4JQ4A 3V7PA 1G7UA 1IR1A 3O9NA 2C15A 2PDHA 5HJLA 2W63A 3CUGA 3FX4A 5D4YA 4NX0A 3GXIA 1C91A 2ZUNA 3R0KA 3VZZA 2CXGA 1QI0A 1XDLA 3FXGA 3LPGA 1BD0A 4HA0A 3T8QA 3HJEA 5HUOA 2QUUA 1MDLA 3L2LA 4QE5A 2PA6A 1PE1A 3H54A 2ZICA 2CWNA 4LCRA 5C7VA 4XK2A 1R38A 3WNOA 3BOXA 1Q4NX 3TEVA 4GIEA 2ABAA 4PYSA 4JX6A 3O16A 3AZTA 3H12A 2V38A 1VEOA 3PZUA 2YGYA 3WH7A 1EC9A 4MB5A 3Q67A 1JZ6A 3N6HA 2HEJA 4M1RA 3N25A 4CQBA 1RA5A 3CV1A 3TYEA 5CC7A 4MDOA 4KWWA 4MUZA 1UKSA 1JZ4A 1S5MA 4ZOAA 2FTWA 1FWIC 4HMNA 1OGSA 3WLIA 1PTGA 4ZO7A 3TXZA 3ZR4A 5FESA 3WY1A 4PH6A 1ITQA 3IRDA 2FLIA 2WC4A 1ICPA 3VIFA 4GKTA 1I45A 3BGJA 4IJCA 4Z08A 1V3IA 1BLIA 1WDPA 1JI2A 1E6ZA 4QEHA 5D30A 4HOXA 4GQBA 3C56A 2GQAA 1H1ZA 4HOWA 1C93A 5AKQA 3CNYA 1HNYA 4KETA 4CD8A 4U2ZA 3W29A 2Z28A 3O15A 5FJUA 3AUOA 2WV8A 1VLWA 3V5FA 4CD7A 2ICSA 2GK1A 3STFA 3W00A 1PPIA 2YFOA 1VFHA 1LLZA 4BCEA 3RU6A 5SWUA 1FBAA 4P2VA 4HCLA 1EZ2A 1D8CA 2BSLA 2X41A 3S5OA 3W1NA 3QFEA 2Q3OA 3UPWA 4LF2A 2HS6A 2C7FA 1MRQA 3IVTA 3LM3A 3NSNA 4IOTA 3W53A 6TIMA 3GYEA 4ZMGA 1E5NA 4E2OA 1X1OA 1F5ZA 4P8VA 1TKKA 2WQPA 1TVPA 3CIVA 1Y7VA 1JQXA 3T0TA 3FXYA 3RJXA 2TAAA 3T1GA 3S1WA 2DZUA 1OVDA 1POKA 2NUWA 3SSZA 2CPUA 1UWIA 5D33A 4RV3A 4AYSA 2X1UA 4PMDA 3O06A 3CT2A 1CGXA 1LF1A 4WSJA 4ZODA 1EGZA 4MZ1A 2E8ZA 1JPHA 1E4NA 1EIXA 1HKMA 1K9TA 4C6MA 4ONVA 4C5ZA 2R24A 3ZIZA 1I6NA 4GBDA 3GY1A 4RE0A 3M0ZA 1N55A 3BK0A 3N2OA 2OSYA 4GUIA 3I6RA 3H24A 3CHFA 2Z1XA 3GBDA 1GOWA 1YXDA 3R7MA 4KWSA 3JVAA 4YN5A 1X97A 4NZ3A 4BI7A 2PP1A 4GA8A 1CYGA 4JL2A 4JTKA 4QAWA 1RP9A 5CJNA 3QKEA 4ZQPA 3OQ8A 4LW7A 3G77A 2EF9A 5HDRA 3PNUA 4ORMA 4Y8EA 1JPMA 1P1XA 4INFA 1NDYA 1B3YA 3W26A 1TZ9A 4OBTA 1FY6A 2CESA 4UUIA 2H90A 4PL1A 5AVNA 4DZAA 2Z0IA 1RCQA 3N18A 1NOUA 2QQ6A 4L4MA 1ITXA 2Q8ZA 1WXYA 1VBGA 3T0AA 3WK1A 2BLEA 2VD8A 5AC7A 1LORA 1DXFA 3WENA 3W7JA 2C14A 3PTKA 1P0NA 4J3XA 1H50A 1TSIA 5HBFA 3MA8A 1P48A 3KRSA 3PR2A 2CZFA 3PAOA 2VEFA 3EB4A 3W22A 4N7QA 5I0DA 3TTQA 3GC5A 1Z44A 4TUFA 2HROA 2WJDA 1NY1A 2PWDA 1QNVA 5FACA 3T07A 1AH3A 1E70M 4U28A 4PBEA 3P61A 2CLPA 3D47A 1A5CA 1W3NA 3S2JA 3IEBA 5U7SA 4PCFA 4GLEA 3DOPA 3TU9A 2DSKA 1V02A 3XISA 3P8JA 3DHDA 4HT3A 2QGYA 4W5ZA 3OP2A 4KIRA 3PBGA 1XYLA 1VHNA 4FR6A 5H8UA 4CQAA 1QAPA 3B4YA 4PRWA 2O9RA 2UWFA 1D9EA 3AYRA 3H2MA 2XGBA 4UCFA 3WJXA 2DVUA 5FF3A 1H63A 2FHCA 1EQPA 3QBUA 1LQ2A 3N2BA 1CZ1A 1BYDA 4GD0A 5CSYA 5I77A 5ECVA 4L5ZA 3CPGA 4M8UA 1UH2A 4GVFA 4CCZA 2FZNA 3EWBX 2YW4A 1HKJA 2IPGA 4RZ6A 1HP4A 7REQA 4FS9A 2HNEA 1MO0A 3JU2A 3NYDA 1YXCA 2C18A 1XYFA 4K8GA 3WNPA 4UOJA 1FXQA 5FAGA 3T6CA 3ITCA 4X9YA 1JJKA 1JCYA 4N9BA 3QMRA 1VEPA 1J12A 1A0CA 2BY2A 2GDUA 2I7GA 3KOYA 4HTYA 2V2HA 1J5SA 4UZSA 3SEPA 1ONEA 3PC0A 1S5TA 1REQB 4DI9A 3OBEA 5CZSA 3QHMA 4HU8A 1RH9A 2G4FA 1PZ1A 3UWZA 4RKAA 2GDVA 1KWGA 3S8HA 1OX6A 3OOQA 3QF0A 3RR4A 2GOUA 4GPNA 4KEMA 4WK9A 1FWDC 5LIWX 3M46A 4HU4A 3ALGA 3MKVA 3QQ0A 5BNKA 2ZZ2A 3A23A 4KFOA 1UBSA 1FP9A 3KE0A 1TZZA 1O60A 1R87A 4G7FA 1WUFA 3COTA 3UZWA 1HFBA 3OVQA 3OZYA 3RDKA 5I3JA 1RSCA 3VNJA 3SY5A 3IJ8A 4IFKB 2J6XA 4W8LA 3Q2DA 5I07A 2XH4A 3C2YA 4FNUA 4S39A 1HKIA 2OOGA 1MZRA 1N8FA 1UZ4A 2EEXA 4PEKA 1EEPA 1P4CA 4F2BA 1XDMA 1EWEA 5L6UA 5CZ0A 5CGTA 1R2RA 4FPSA 4RZBA 2GJXB 3SN1A 1R9ZA 1Z32X 4JD4A 3VCCA 3AS1A 4YPJA 1YLVA 3GDBA 3G1YA 3EX3A 5HJYA 4DZHA 5JUVA 1T0OA 4AZHA 1P6BA 1Q6QA 4ZQCA 2J88A 1Z6KA 3N9RA 4IGHA 3B06A 2XG9A 3SAZA 3MWCA 3AYVA 3OODA 3NO3A 1O5XA 4IQEA 3Q4DA 2EKCA 3SCPA 4W9TA 4KESA 3MC5A 1SFTA 2IW0A 2P5NA 3V4BA 4MY1A 1I75A 3W75A 3E74A 5K3VA 3NPWA 3UZJA 2R1PA 4Y8FA 2J9XA 1K4GA 4NYUA 2DGAA 1XLDA 3KOFA 3GH7A 1XD1A 2VCBA 4FI4A 4FNPA 5A95A 2BGQA 4UTKA 2Q71A 2QIIA 4S2CA 2Z1SA 3N2MA 2EPMX 2D2JA 1YNQA 1ZS2A 1SFSA 5HMEA 4JY8A 1ZJAA 2WWDA 4ZOEA 1WCGA 3K46A 3SUSA 3UNTA 3OLIA 4JOMA 2E9MA 1WNOA 3EPNA 4S3DA 4KEUA 3OHIA 3VE9A 3LXBA 1BQGA 1M7JA 3BMVA 1HP5A 2B7NA 3F4DA 3L4VA 1DE6A 4NJKA 4H41A 2WAGA 3E0FA 5AHEA 3JUGA 4BA0A 4GYPC 4LV9A 2BS9A 4PTVA 5D2YA 4GGBA 1RV8A 4X61A 2DT2A 2XTKA 4YYFA 5I00A 3WMLA 3HU7A 2Y5EA 1EC7A 5FJTA 1JZ5A 2WMKA 3LLDA 3FGCB 3WFAA 3CMGA 2HS8A 3H70A 4NF7A 1M5WA 4H9ZA 4LXFA 4H9YA 3M0KA 1JI1A 1NIUA 3VKJA 4WHBA 1UYQA 1ZL1A 4ERIA 1EPVA 2XVPA 4AD1A 1B3OA 2E28A 4ZOBA 2WHLA 1U1JA 2PCEA 3GHTA 1S2WA 4E5TA 2NQJA 1E6PA 3EB2A 1RJQA 4JTUA 3TROA 5FI8A 2PRHA 3UXLA 1O1ZA 1W9UA 3MI3A 5AHLA 3LA4A 1LRQA 3W4RA 4O11A 4AF0A 5A5WA 4Y9NA 4J3WA 2OCZA 1AD1A 3QVQA 4C90A 2IKHA 3H2EA 3XIMA 4DO6A 2VFGA 3ATZA 2XVKA 3U4AA 3TX9A 1WE5A 1I2QA 3LNMA 1JUKA 3E2SA 3N3TA 1KCKA 4PULA 4ILSA 4ZO8A 4YXGA 1UBPC 3NVDA 3I10A 3UR5A 2ZX5A 2QJJA 4Z0JA 3CLMA 4DWDA 1W0MA 1N8IA 2CEQA 4WY0B 3UZ5A 2D73A 4A2SA 4M19A 3EXTA 3ZLHA 1TV3A 2QMJA 3B8WA 1VF8A 1J79A 5T91A 2DORA 2OELA 3PG9A 5FAJA 2O56A 4Q4RA 2R1KA 1DJHA 5T8GA 3E49A 3C52A 1EZWA 5LHFA 4K6AA 3UETA 3VGEA 3QHNA 3WLOA 4Q7IA 3CJPA 3EOEA 2QYGA 3AMLA 3HO8A 1V0NA 3TJIA 2FJKA 4JTEA 3EGJA 1T99A 2AOSA 1P0DA 3E0LA 4I6KA 1TJ2A 1NFBA 1XXXA 4AIBA 1TREA 2UBPC 2JKPA 3SCRA 5HWJA 1U1HA 3SO7A 3GR8A 2F7FA 4DYKA 4Z2GA 5GNXA 3R58A 2XIIA 2BY0A 4C1LA 4W93A 3SCSA 2RFGA 3IV3A 1JF6A 2ZRYA 1EJVC 1EA9C 4CNSA 1VYRA 4Z2HA 5M5DA 4ZE5A 5EKYA 3T0BA 3WN6A 4ACZA 1JUEA 4IPLA 2XU2A 2W67A 3S9YA 3MYOA 2VKZG 1HKVA 1LBLA 2VELA 1SW0A 4E6MA 2VWTA 1A5SA 2QVNA 3GR7A 1X8FA 5I02A 2ZDSA 1XYBA 3S46A 1YPFA 4J2PA 2GWNA 4LC8A 3CH0A 2YBUA 3PTMA 4EXBA 3CUZA 3CIWA 3PWIA 3WDJA 1OYBA 3WF3A 1JPKA 1US0A 1GQIA 5A6LA 4D2JA 2QUTA 3ARRA 4XO7A 4HJFA 1UWUA 1J10A 2IQDA 3QY7A 4LS2A 1TIMA 2GGJA 2ONEA 1TQJA 5HULA 3RX4A 4CGTA 2E7FA 1OCNA 4RUBA 1UZ1A 2NVCA 3HGOA 3O0KA 3L0NA 2WANA 2X0SA 1JNDA 3GFYA 3N3MA 3EKZA 3MJYA 2C16A 2X8RA 4J7RA 3U2ZA 4CNOA 1GW9A 2H8XA 2OSWA 4DNHA 2D2OA 3TDFA 2EG8A 2OO0A 4JL1A 4ADTA 3LB0A 3DAQA 3DFPA 3AU2A 3I3BA 4UQAA 3WLMA 2FYMA 1EC8A 1W2PA 1M68A 3CEUA 4BHYA 1QI2A 5BOEA 4AZCA 2WNNA 2NSOA 3U48A 3QZ6A 2PF8A 5JMUA 4GY7A 1UR8A 4XIAA 4ZVJA 1JCJA 2J74A 1YYAA 4Y9OA 4J3SA 1LOSA 3NURA 1G1YA 3QFWA 1O68A 4Q8UA 1QTWA 3H2NA 3W7RA 3UCCA 1V3HA 2F6KA 2NQZA 4X9SA 3CZEA 1OG0A 3UW6A 3OBKA 1EA0A 4CCCA 1WBHA 1LWHA 3G0XA 1W1VA 3CQIA 4M24A 3B0UX 3PZNA 5HR7A 2UV8G 1CGVA 3GYCA 4S3AA 4DYEA 3NL2A 3KCJA 1RA0A 4WJEA 5FL0A 4X0NA 4MVAA 2E6FA 4WLCA 4UR7A 1PS9A 1C8QA 3KCOA 1JYWA 3GO2A 4IICA 4QE4A 1SFLA 3GZ3A 4K7YA 3IGHX 4TTUA 3K4WA 2OQLA 1L6SA 1LM1A 4I90A 3AROA 4TO8A 4F2TA 1P0EA 4MKSA 1UUMA 1PZ0A 1DTUA 1Q6DA 4EWND 3W28A 3MP3A 3TH6A 4M1BA 3UPBA 4IQDA 4IGSA 2C79A 3J7HA 3GFXA 4QG9A 5LNSA 3AMGA 5G1TA 3GIPA 4EX4A 1R3RA 1H09A 1Q65A 1H41A 3B0YA 1A80A 3MZ2A 2DDXA 1UR2A 4AY1A 4AX7A 1ZBVA 1OYCA 1XKYA 3H7UA 1XLMA 2PDCA 3LBOA 1TR1A 2WPGA 3S1VA 2V82A 3EMZA 1W5NA 3MDUA 3WQ6A 2VGFA 1XCXA 4C6NA 1SO4A 1S39A 3MQTA 4GY1A 2LLEA 3TC7A 4XAGA 4DPQA 2I14A 1V0LA 1W9BM 1VPXA 4U3CA 1L9WA 4LY4A 3HFYA 1W5OA 1E4IA 1UASA 4AXKA 3HIJA 5D05A 1KM1A 5C5YA 1XM3A 4M6UA 4ZB0A 4NI3A 2GQ8A 1MXDA 4IMEA 3HG5A 4YCPA 1ADSA 1YBQB 4JEJA 1JGMA 3IV8A 4X3ZA 4CD5A 3BWWA 3GHSA 3E02A 1WPCA 4JYEA 4DJDC 3E2QA 1OX5A 2YB1A 3OPSA 3DC8A 3IK2A 4HN4A 4XWUA 4AMAA 2AL1A 4LCSA 2V6AA 3WF4A 3PS7A 1ZGDA 1THFD 4NAEB 4R33A 1ISVA 1JFHA 4LBUA 3TCSA 3BW3A 4LUIA 1DJYA 3LRMA 3CB3A 1HW6A 5C70A 2P53A 3VIIA 3F5LA 5E70A 3GG7A 5KZEA 1XINA 2WW5A 3OGRA 4XBJA 4B5XA 2I56A 4IGMA 2J27A 3INPA 5F1UA 5IHSA 5JBFA 3N11A 4NZJA 1GQNA 3ALFA 5AHMA 3PBYA 4ORIA 3I68A 2P8CA 4DXVA 1PCKA 1AJ0A 4N4QA 2A3BA 1K8YA 2X1IA 4MWAE 3B97A 4M6PA 7TIMA 2GVJA 2GGEA 3M9YA 5D38A 3MO7A 3NO1A 1P6CA 4IPPA 4JIRA 3BDKA 4F66A 5MKGB 5FJJA 4BQ5A 4DRSA 3NL6A 4N42A 1KKOA 4I5UA 1YE6A 4DNMA 2QT3A 3W2JA 4PB3A 3NTYA 3HF3A 4B9ZA 3W37A 5HK4A 1EDQA 3DU0A 3GXPA 2CHRA 1EBGA 4BI5A 4D1IA 4ZQOA 2V68A 5A8PA 1KCZA 3LYEA 3L2MA 4PMUA 4WJ8A 4O54A 4JR5A 5CXPA 1OX4A 4C6QA 4Q8WA 2WJEA 3EX2A 4OTKA 4DX3A 3GVWA 5CG0A 4TMCA 1DXEA 3VILA 2Z4GA 3VMPA 3ZJKA 4AVOA 4YVPA 5BRBA 4GISA 4P8XA 4A8RA 3CHVA 4IISA 5A2BA 4O50A 3R4IA 4P7OA 1Q66A 4H00A 5E09A 1XKJA 2QCFA 4H6KA 2YX0A 1O7AA 2PBOA 5FD0A 3FJ6A 2NQLA 3P14A 2R91A 3M0IA 2XH2A 1D3CA 1GVIA 3NQGA 1A49A 2YR1A 3P5ZA 1OT2A 4BEQA 4IQJA 3VGFA 3LXCA 3QOMA 4DWSC 3RCNA 2DJLA 1SQ7A 3VIGA 4CNTA 3S6TA 1HQTA 1UWSA 2D3LA 4TU1A 1P6WA 4LYPA 4ZOCA 3M07A 2W9MA 2VYOA 4R7OA 4HYVA 4LAKA 1PIIA 2NVAA 3GD6A 4UR9A 4YIWA 2PDNA 2QJMA 3BCFA 1UMYA 1AJ2A 4HPGA 4R88A 3A64A 1J2BA 3SADA 1CCWB 4FNSA 4MPQA 4M56A 2AMGA 1A0EA 1UQYA 3TCEA 2E4TA 3WQEA 1D8WA 4NZ4A 9CGTA 1VBRA 1QPRA 1QT1A 3VXGA 1AW2A 1UROA 3CAVA 3TSBA 5HPOA 2XIQA 5DRIA 1MRAA 3O07A 2WOQA 2PSNA 4S3GA 2H9AA 4RE3A 3OEXA 3WLPA 3EOSA 1ML1A 2RDWA 5EY5A 5B7ZA 4D1JA 3MKCA 3W7OA 1CXLA 2YOCA 4FXRA 3SIMA 4HNNA 4RPPA 2HK0A 4E4UA 2ZTKA 1PUDA 5I03A 3ARTA 2V0TA 1YKWA 3QGKC 3CWOX 4B5UA 5A6MA 3WNKA 1GHRA 1YIXA 4E2BA 4LVBA 4QJ4B 3VPLA 3TQPA 1WXJA 4TVCA 2ZC8A 2WHMA 1G4SA 1EEXA 3WLLA 3V0UA 3VOGA 4MDPA 6ENLA 3MHGA 3K8LA 2O0TA 3WUFA 2CLKA 3PSWA 3SB0A 4P8UA 5TBOA 3GXTA 1Q63A 3EWDA 2VUYA 1L2UA 4BKNA 4B5NA 1BGGA 2FMOA 1E0WA 2HVMA 3VOJA 4LAMA 1K9EA 2OR2A 1AA1B 3N9SA 2BVYA 1RD5A 2C19A 2KAUC 4H9VA 4OHQA 1K7XA 1QI4A 2VFDA 3TA6A 3VDCA 3MU7A 5BOFA 3O6DA 1F4HA 3R0UA 2DUXA 4UTTC 2ZFAA 1WX0A 3DZ1A 1JZ7A 3NEVA 2TRSA 4F3HA 3MI6A 2OWXA 1ODUA 2ATSA 4JFSA 1W9VA 2TPSA 3R94A 1E3ZA 3DBPA 2PGRA 1XIIA 4OGZA 2VR2A 2ATMA 1RCOB 2QAFA 1W3IA 1P1MA 1W1ZA 3ZXWA 5IOBA 1JD9A 1RJPA 3AIQA 3GNDA 2ZRVA 4UZUA 4MB4A 2XPKA 1EJWC 3GNOA 1MQQA 3S4TA 3E2VA 1VB9A 4H6QA 4CEUC 4K8HA 4O1EA 1XIHA 3W84A 5DCEA 3VI2A 4JNMA 4O1CA 1CECA 4L4PA 4WKFA 5AYBA 5HPCA 2H6RA 2WSPA 1HL2A 2A79A 1K7EA 3CZ8A 2HNHA 4MIMA 3IJQA 2CFFA 4Q6JA 4L6HA 3JZEA 1RLCL 4TR9A 1FDJA 2OZ8A 5D8ZA 4MM1A 5D2XA 1SJAA 2ACSA 4ZENA 1MW1A 1LG2A 1QPOA 3MTWA 2NLYA 4F0MA 2FGZA 1G9HA 3IIVA 4LB4A 2WMHA 3BGAA 2PWVA 4RL3A 1FWBC 3PZIA 3BLPX 4J40A 3APGA 3FA5A 4IQLA 5F2GA 5K9XA 1XRSA 2FFCA 2YA0A 4D6FA 3WCZA 4BQ2A 4LS0A 4HOZA 1CXHA 3QZEA 3BJFA 2QDDA 3AHXA 3UG4A 3B40A 5F4XA 3C0QA 3KL5A 2HJPA 3DKJA 6TAAA 1OBAA 4FOKA 8XIAA 1PSCA 1H4PA 2VD9A 3LRKA 5I3DA 4F0SA 1ZU8A 3RG6A 1MFUA 2CHNA 4XZHA 4U33A 5G5IA 3SFKA 2V5JA 2YFNA 2JEQA 2HZGA 3RRXA 4MMWA 1AJZA 4JXCA 1PDYA 4YVVA 4FHAA 2ZQ0A 1V6UA 4QS6A 3Q45A 1LLOA 4MKNA 5C9UA 4PUMA 4I7WA 3D5HA 2WCAA 4IFOA 4M7SA 2R8WA 3SI9A 1EFZA 2YDAA 2ZBTA 1EXBA 2WMFA 4JHMA 1W1PA 3EMQA 3PZ9A 1E4MM 3NL3A 2Y8VA 4GYFA 1XRFA 2NXHA 4H8HA 4HK5A 5CJ5A 4A4AA 4XAYA 2NQ5A 1ZAJA 4HD5A 3VX0A 4ICCX 1A4LA 1CB7B 3W71A 1Q6EA 1QBAA 2VEKA 3WH6A 4YTRA 4NJHA 1OK4A 3GG8A 3GU1A 3NM1A 1TVLA 4BWLC 2EPOA 3BMXA 3HV8A 1S3TC 4HZMA 4Y9PA 3WQ4A 3KVLA 2EHHA 4AEEA 4L6OA 1OC6A 1OC5A 4GIYA 5DBTA 4QG6A 1SPQA 3W1PA 2PS2A 1GVEA 4M82A 4KCWA 3B0XA 3CO4A 4H8NA 2OLAA 4RPQA 4IMFA 3U6WA 1LQAA 1W5MA 5C71A 3VIPA 4W87A 5CC3A 1JPDX 3P81A 4BQ3A 1G69A 3FAXA 3L4YA 2VO5A 1CDGA 1W1YA 1JAKA 1PTDA 3W7MA 2MANA 3REQB 3IS4A 2B81A 3LI0A 2H3DA 1JCLA 4DN1A 2A1YA 3GB6A 4UNLA 1ISXA 2FDSA 3CUJA 4WDTA 1BVZA 3MVTA 1O12A 4LSBA 3AZSA 4DZ5A 3OB8A 2BHYA 3BTNA 4ZO9A 4H9UA 4LV4A 5HAOA 3OIHA 2O9TA 1XI3A 5J8LA 2PDQA 4GZEA 5K4XA 4UQBA 4UMCA 4RNIA 1H7RA 1W8SA 5LXXA 3Q58A 5AYZA 4C7FA 2BWGA 2PWHA 1S38A 3L12A 4XUGA 4UNKA 2WLZA 4AD2A 3DUGA 1U5VA 2ZWZA 2ZXDA 3LZ3A 4C6BA 1XFBA 4R27A 3NPVA 3E2RA 2VC6A 3FOKA 3N14A 3OA3A 3F4NA 1DJGA 3RHGA 3UVIA 1VH7A 3CXOA 3H21A 2QCMA 4GX9A 4LH8A 4WVXA 3T7VA 4I8DA 5I23A 3VGDA 3VGHA 2FTPA 5A8OA 3APTA 3A9BA 2VZTA 1ADDA 3KOXA 3UVAA 3W86A 4DO7A 1DPMA 3IGUA 1XHGA 4B92A 2XZ7A 2I9EA 3THCA 4EACA 1HJVA 4LQ1A 1KC7A 1EX5A 1REQA 3D3FA 1BAGA 3R8GA 5M03A 4HB7A 1U22A 1LT8A 4JQ2A 4KWVA 2QV4A 4GYKA 3JRKA 1JAEA 1GOMA 1L6YA 1WAWA 1NFGA 2EJAA 5LA1A 3N2TA 5CLTA 1XF0A 3UY8A 3BXWA 2BVTA 3IIZA 1HKWA 3B8IA 4O0KA 4RE2A 3RM8A 1AQMA 3G22A 4JX5A 3MBFA 2CWXA 3WBXA 1FHVA 2CETA 4HU3A 1L6FA 2G97A 5TF0A 2VURA 1SM9A 3ARYA 1ECQA 4UFMA 2WPBA 4JYFA 1BTMA 3WL1A 4CD6A 3GW3A 3HPAA 4CVUA 5EFFA 1UH4A 3PPHA 1PTAA 4FSAA 4E2VA 1B3XA 4EF9A 2Y85A 3WQ8A 4R53A 3M5VA 2QV5A 4WUIA 2A0NA 2PP0A 2WJFA 2YLLA 1GKPA 1V79A 3QJAA 1XYMA 4X0VA 3WEMA 3T4CA 2ZUMA 4GRSA 4MZ8A 4C5YA 2VEMA 1VR6A 4S23A 3AMCA 5DELA 4IMDA 3KLKA 2C0HA 4LCQA 1QWKA 1HJUA 4DUWA 2XIOA 1A3WA 3HG3A 1L2QA 5H6HA 5KZ6A 4AEOA 4BFAA 4GUJA 2DZVA 1EP2A 2JQXA 3MUXA 3R25A 3LRLA 3VAVA 3WDIA 1Y65A 4TV6A 3O3RA 4L64A 5DX7A 5GNYA 3QYSA 1YADA 3E0WA 4P8WA 1YEYA 4ZB2A 2YYUA 1ZNNA 4G7EB 4H2CA 4Y96A 4MJ2A 1XIEA 4BF5A 3W24A 1QOPA 5DMLA 3W7DA 2D2GA 1LCOA 2QW5A 4O57A 1WKFA 2GL5A 3QH2A 1X6UA 4PMXA 3DIPA 2NXGA 4V15A 4MHBA 1W37A 1Q2RA 5JXQA 3DFHA 1SZEA 5AZ1A 4PUWA 3O05A 1GW1A 2OQHA 3AO0A 3UG5A 4PUEA 4GVIA 4LX4A 4G1KA 1JYNA 2Z1WA 3OVPA 2QJGA 4NIRA 2TSYA 4AD0A 1EHAA 1CT5A 4ML9A 3ID7A 4UFLA 2FVLA 3MPGA 4LRSA 3NG3A 3TSMA 2OPJA 1M04A 1FCQA 5I24A 1C3FA 4ZR8A 5M1TA 1Q6GA 3FJNA 3MP4A 4I9TA 1PEZA 3ZT6A 4NJJA 3BQ5A 4WSHA 2VMFA 4Q4QA 4MJMA 2QCGA 3VM7A 2ZVRA 1S2VA 1DQXA 4JGDA 3E5BA 4GXWA 1G4EA 3C61A 3H2AA 3GNPA 1M41A 4XD4A 3VUSA 3TMQA 3WMSA 4WKAA 2J6VA 4C6LA 3MY9A 4IP7A 2IKJA 5DXXA 3GHUA 2XFWA 2DSUA 4JTJA 4L1XA 2IXVA 2Y5JA 1QNPA 3GK0A 3SRFA 1PJ9A 4JN7A 2PDWA 1MMFA 1F2JA 3BE7A 3PBWA 2DP3A 3OW1A 3WQPA 3IVSA 5CZJA 4LYRA 3FW6A 2QKFA 2VDGA 4OOUA 2WVUA 2DSVA 4U2YA 4MNJA 1JL8A 3DDMA 4Q22A 3WBEA 1PKLA 3VD5A 4CNUA 5DCBA 3WD1A 3K1DA 1VENA 4FMVA 5EMYA 2ZRWA 3WYZA 2PWEA 3EMCA 3V0TA 2YCLB 2AL2B 4V1YA 4QX4A 4UWMA 1UP0A 3W7IA 3HJZA 2OKOA 4KCTA 1H51A 3D0CA 4IUOA 1C92A 3H2OA 1ZCOA 2BB0A 3WDQA 5LZLA 5TNVA 4WY0A 2VHLA 5AYXA 2A3HA 3U2EA 1ZBCA 3AQUA 5IDZA 2XH7A 3ZWSA 3WEZA 4GMEA 5DF0A 3L9CA 5DXYA 4Q4OA 3STPA 1E0TA 3ZLFA 3C0LA 2D0GA 1L6GA 1DJIA 3W25A 3H23A 4HIBA 3B05A 2DIKA 1RUSA 1ME7A 1I0DA 4QLKA 4NVTA 4UC5A 3VA8A 4RLIA 2Y1HA 1JDDA 1VYSX 3G1RA 4KMQA 2FPTA 3MO4A 2EG7A 4AIEA 1TPC1 4GVGA 2DZBA 4LFYA 4YCOA 1KBJA 5G4EA 4F40A 1LP6A 5E0KA 2QPSA 1OFBA 1GZJA 5D2WA 2BVDA 3DYMA 4W5UA 3LM7A 3L4ZA 4JKKA 3QKZA 3V16A 2EPNA 4QLLA 2ZRXA 1CNVA 2E68A 3A24A 1DV7A 3RYSA 1T8XA 4GK8A 3THQA 4O28A 3APYA 4B3KA 3B8DA 3GLCA 2P0IA 3TN4A 4AD4A 4QR6A 4X22A 1IGWA 3H4XA 4AWTA 1LQ0A 4G6CA 3RMJA 1W1A1 2OXNA 3L21A 4G1NA 1CW2A 7ENLA 1DORA 4WOQA 1ME9A 3FNDA 1XLFA 1QW7A 1X96A 3S6OA 2ALRA 5XINA 3LHVA 1R8LA 5AHNA 4IHCA 3QY8A 2CLHA 1WA3A 2J24A 2W62A