1G4PA

Thiamin phosphate synthase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 74
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4pA00
1ADOA 4E2DA 3LTSA 3WJYA 2XN0A 4Y6GA 3NXFA 4XBKA 3ZS4A 3TUUA 4NX5A 1FCBA 1W1ZA 1TYGA 1PHQA 2Y89A 4FHAA 3QF0A 3M5ZA 3FS2A 1TPDA 1XBXA 2DZUA 3PUDA 2YYTA 2FB2A 3G1VA 3OVPA 3NQFA 3PUOA 2J9XA 1YLVA 4Z08A 4YCOA 1ZCOA 3DH7A 1BEUA 3NVTA 4K37A 3NPUA 1C8VA 3ZR4A 4P61A 4M6VA 4JTFA 4KWWA 4WX2A 5CG7A 1SFLA 4AMAA 4ADSA 1W3NA 4ZZ9A 2VEKA 1AW1A 1ONRA 2E6FA 4QSHA 3C2OA 1XDMA 3TMLA 2E6DA 4LVAA 5DCDA 4JD4A 3W1PA 4DF1A 4ZMGA 3L5LA 1JCXA 1ICQA 4FIQA 4M7SA 3DI1A 3HG2A 2Y62A 3RU6A 3DFOA 3B03A 4JYDA 2VELA 2R94A 1W3IA 1LYXA 3BK0A 3L2IA 4IXXA 3PS7A 3E12A 2GQAA 1Q6QA 3LXCA 3KFTA 3DFTA 1HL2A 1M6JA 5FF2A 5K7JA 2QJIA 1NSJA 4NU7A 4O1AA 1XBYA 2F7FA 3IGXA 4GC4A 3GYEA 3G0UA 2WQPA 1LRTA 2OT0A 4YLWA 4N6EA 5LHEA 1K8ZA 5D32A 3UXAA 1TPB1 4MUZA 4P2VA 1LZOA 1FDJA 2QAFA 3MYOA 3L67A 5A8GA 2EAWA 1G4SA 4GUIA 3BVJA 4IX0A 3DFQA 3D0CA 1UB3A 1HG3A 2C14A 2QUVA 3QSTA 4G1KA 5CKSA 5D05A 3R89A 4JIPA 1VCGA 2NX3A 2AGKA 2ZZ5A 1F5ZA 3UWYA 3W1UA 4K38A 1NFBA 1DQXA 2J9ZA 5LNWA 3TV8A 2B4GA 4WJEA 3P74A 3ABQA 4JTTA 3T78A 4D2JA 4UFLA 4TX9A 5AHIA 1OYAA 3FKKA 3UNDA 1FY6A 3GXNA 1QPQA 4ZQMA 1CX9A 3NQEA 5AHFA 2ZZ4A 3TXVA 4HNVA 4GWEA 5BMXA 1WYIA 3M6YA 4K7VA 5K9XA 4DBDA 3H54A 1C9DA 2VOMA 1A50A 4PC8A 1GVRA 1EWDA 5LHFA 1OHLA 5EYWA 3DKJA 2I9EA 3A5VA 2FJKA 1L6SA 5LSMA 5FF4A 3PUEA 3LCFA 1KM5A 1W5NA 3S42A 2A4AA 3W83A 5T26A 3CB8A 2FB3A 4MVAA 2NZLA 1MZHA 3KVJA 3LI0A 4L4MA 3LHYA 1UASA 3TCEA 2YW4A 4AHOA 2YGYA 1FX6A 3HGSA 3HO8A 3EKZA 1VHNA 2CLEA 2BX7A 2VFDA 3BW4A 3BARA 5DCBA 3EXSA 1F6KA 1GG0A 1JQVA 3ELFA 4PODA 4UTHA 4LW7A 4K7YA 3P61A 1ZAJA 1GVQA 3IIPA 3QQ0A 3SY5A 1TPEA 5FI8A 4O19A 3W7EA 2PC4A 1VHCA 3OVRA 3E0IA 1GVSA 1PCWA 1OX4A 1SQ7A 1VQTA 1O60A 1A5CA 3R13A 3B0VC 4AH7A 3W1NA 5AC6A 3E96A 4JX5A 3U6WA 5D2TA 4BI5A 1H61A 1NF7A 3SW6A 1XFBA 5AN7A 4S1FA 2A21A 3EWZA 4I9AA 2Y7DA 5KSWA 1DJNA 5U7SA 4RV8A 3P7YA 1NF0A 1N8FA 5D33A 4H3DA 3LV5A 1TPUA 4KWVA 4MKNA 2CU0A 3S5ZA 4UTLA 3TROA 5IM51 4TR9A 3DHFA 1T8XA 2QCHA 2VEIA 2C6QA 4CNPA 2VKZG 3BLFA 4O15A 2V81A 4GBUA 4AHPA 4FEZA 2CW6A 1M7PA 3A9IA 3WJZA 4LUJA 3QW3A 1KFLA 1D3HA 2ATSA 4M6QA 2R14A 1YPFA 4QM1A 2CFFA 3W2LA 1LBMA 5C55A 3QQ1A 3NQ8A 3NR0A 4WXZA 2QF7A 3M0ZA 4MIMA 3CM4A 2QDGA 3QZEA 5D38A 3CWNA 3PBVA 5F1VA 1JR1A 3PG8A 1S5WA 3LCLA 1KA9F 2I1OA 1XUUA 2XN2A 2ZRXA 3UXDA 3W7QA 1MEWA 3MW7A 3TJXA 3M41A 3M44A 3N19B 5AYYA 5D04C 3VKJA 1FCVA 4CQ9A 4XTDA 4JR5A 5SWUA 4NJIA 4O1DA 2QJGA 1OG0A 5TQLA 3LHWA 1LBLA 1H5YA 2VEMA 3LRKA 5FEWA 1GVFA 1RPXA 2HS6A 3LLDA 3E02A 2QCNA 5G2IA 1SR9A 4UXDA 2CWNA 5K4XA 2C13A 1QNVA 2H3DA 4EF9A 1LCOA 1JCNA 4CQAA 1RQEA 3LCWA 1DJQA 1SPQA 5HINA 3LHTA 4N9DA 4OGZA 2GVGA 3ABOA 4C1KA 4OWGA 3O63A 3PSVA 3F03K 5CPLA 1ICSA 3EX2A 3KAOA 3W1MA 2WSQA 3P62A 4TMBA 5FEXA 5LNVA 4JTLA 2WPBA 2JK2A 4JS3A 3GNNA 2J9YA 1M7OA 2X1TA 3EXTA 3T4CA 3G1DA 1F05A 1W0MA 3MP5A 2JGYA 4IMEA 3W7NA 4Q32A 1U5JA 3W2NA 1CI1A 1GTHA 2QCDA 4E0CA 1G6CA 1TV8A 2J27A 1TRIA 1F73A 2IQTA 2VFHA 1RQBA 3LLFA 4LS1A 4PTNA 1H7NA 3P5ZA 1VH7A 2CZEA 2GUUA 1YADA 4TO8A 3MHUA 5DCEA 1AK5A 2A7NA 4O52A 3G0XA 5HNRA 5TBOA 3BGJA 3MI2A 4YXGA 4Y90A 3HPSA 4UTJA 2O7QA 2WSYA 3L66A 3QJAA 2Y7EA 1B4KA 1WOAA 4YCPA 2VENA 3LI1A 3W84A 1JCLA 1JUEA 3OIXA 4ZQCA 1TPVA 3S1UA 5CZ0A 3QPYA 3NA8A 3O6YX 1EUNA 2FQIA 3GX9A 4N6FA 2DP3A 2NXIA 1I45A 4XWUA 4NXSA 2VXNA 3CIWA 3LCIA 4M7TA 1JCMP 3TNOA 1H7PA 1H7WA 4HIBA 3EWYA 5KITA 1KFJA 1OVDA 4L4LA 4LC8A 3SJ3A 2WNZA 1PIIA 3TW7A 3WK1A 3BG9A 3GDLA 3EEGA 3MO7A 4MJMA 2Y7FA 3N3MA 1K3UA 3FJ6A 3TW6A 4Y96A 4A2SA 2ABBA 3VE9A 3LXAA 3RMJA 2VC6A 5BMWA 5LZLA 2E5BA 5FF3A 5L9FA 2ZBTA 3TE9A 1YXYA 3W85A 3MYPA 3NAVA 4H4IA 2BSLA 1WDWA 3PG9A 2B0MA 5F2MA 3WJWA 3N14A 5EY5A 4UTUA 2NV1A 3HG3A 2I14A 3EWXA 5F4SA 2OX1A 4O28A 1G69A 3A23A 3B06A 3IIVA 1FWRA 1TQJA 3N9RA 4DF2A 1XUZA 1ZNNA 3STGA 4GFSA 2V2DA 2TSYA 3W72A 4JX4A 1XI3A 2ZDRA 2Q3RA 4MPQA 2A0NA 1VLIA 1S3HA 4MJZA 3M7WA 3PB0A 5G2WA 1VC4A 5I3GA 4QITA 1LROA 4AVFA 3LBCA 1TPWA 5HJLA 1W5PA 3CU2A 4LV9A 2Z6IA 2Q8LA 3S5NA 3W7HA 2EKCA 3MP4A 3PULA 5I3KA 1EP2A 3LBMA 4RR4A 4Z0JA 4OU1A 3LDVA 2E68A 1AG1O 2HSAA 2JBMA 2RKXA 3BW3A 5KTLA 4XTIA 3I7RA 1OFQA 3N73A 1EA0A 4AHQA 5LNRA 3W7GA 1DORA 1EX5A 1H7OA 2ISSA 3IGSA 1AL8A 1KFEA 3VI2A 5LKYA 2DJXA 3UD6A 4EWND 3TC7A 7TIMA 3W73A 1TJPA 2H6RA 3G8EA 3L9CA 3C3NA 3GDKA 4FNRA 4LTSA 4Y8FA 3W7DA 3QH2A 3S5YA 1O5XA 3EX3A 1MEIA 5HMSA 4LVDA 1P1XA 4O4VA 5DN1A 4H6KA 1G4TA 1UUOA 4N9CA 4FB7A 1SSGA 2RH9A 2X1RA 1SO6A 3IEBA 3VFLA 4UNKA 1H1YA 3VE7A 2A6NA 5DXXA 4GJ1A 1KBJA 3TU9A 2YPIA 3PC0A 3QMTA 1ML1A 3FLUA 1YPIA 3CLMA 4LRSA 4OBTA 2H8XA 3F4NA 4JTEA 1IXQA 4JTKA 2Z2UA 4S2BA 3ZFHA 2R8WA 1CW2A 4O17A 1UJPA 3C4UA 5D2XA 1W54A 3O1NA 3A22A 1AW5A 3DFPA 3ZWTA 3W75A 3OA3A 4K8EA 4TIMA 5J5RA 3I7SA 1G4EA 1QAPA 3W1RA 4XBSA 2Y63A 4XKYB 4BR1A 4CNNA 5D09A 2BZNA 2OZ0A 3HG5A 1KFCA 2ATMA 1YDVA 2C0AA 2E6AA 2A7PA 3BGGA 2X2GA 3PSWA 5F4WA 4Z0SA 3G3DA 4DO4A 1PV8A 1W56A 5DXYA 3S1VA 2C19A 2NX1A 2ZZ7A 5AOUA 1WV2A 2G95A 3W86A 4S2CA 5CPOA 4WUIA 3BO9A 5U4NA 4CNOA 1GWJA 3HGJA 1IIGA 4FO4A 1I4NA 2ZA3A 1GJPA 5D03A 1W5QA 5K9CA 2G96A 1R47A 5G2HA 1P0KA 2LLEA 4QJ1A 2HTMA 4JGDA 1SO5A 4RJEA 2PRHA 3DFSA 1XL9A 1H60A 1OFOA 1GOXA 3UWQA 4OV9A 3E9AA 1TJRA 4RCXA 3QC3A 4C1LA 2ZRZA 3NQAA 2AQWA 1TTPA 5I3JA 1V5XA 3TJLA 3FYOA 4DO5A 4MZ8A 4FNPA 1JJKA 2QDHA 3HGOA 3DZ1A 3JR2A 2NWSA 4UTWA 1HTIA 2Y70A 2Y6ZA 2C15A 2C18A 3HBLA 3W7LA 3GDMA 4NT0A 4O53A 4UCGA 3T55A 1MXSA 5D02A 4RXGA 3TX9A 2ABAA 1G7VA 2V0TA 5CZSA 1W5MA 4NNCA 2ZTKA 3S9YA 3EX6A 3W1XA 4MFDA 3B0UX 1OX5A 3EWUA 3GKFA 3TFXA 2QUUA 3LCHA 5EKYA 4NUWA 2W6RA 3NDOA 5K9DA 4A22A 2ALDA 4O10A 1D3GA 3G3MA 1ZENA 2P10A 3A5FA 2ZA1A 2CLLA 3DHDA 5E1QA 4KFNA 4BK9A 4QIUA 3OHIA 1LP6A 1SZGA 4WOZA 3G18A 3MMTA 4RLIA 4PH6A 4JY8A 4DQWA 2KZHA 4CCCA 4A3UA 4N02A 5HUPA 2CLFA 1VGAA 2J88A 3IV3A 3P8JA 3DFNA 4UTWC 4O54A 2CZDA 4GNJA 4O4WA 3S8HA 2CZFA 1LTDA 1SW7A 1LOLA 4O50A 5AHNA 3NL6A 1R2SA 3ANYA 1W31A 1ME9A 1ZJIA 3NPVA 1FQ0A 3O16A 4UR8A 5I3IA 3FJLA 3UWWA 4Q33A 1OF8A 2V2CA 4UFMA 2FIQA 4YMZA 1XBVA 2NUYA 3DXIA 3BPWA 1IXOA 2X1UA 2TPSA 1G67A 1QPRA 1GTEA 2W0UA 3NQCA 2CLHA 3BW2A 3GXPA 5CGQA 3UZ5A 3W7IA 1QPNA 3N2MA 1ALDA 1R46A 3SR7A 3O07A 3TMQA 4LC6A 1OYBA 3NL3A 3P84A 3DU0A 4DBEA 1I2QA 1VCVA 1XKYA 4FIRA 2EHHA 3L0GA 1H51A 4AWTA 3KOFA 4LRTA 3KRSA 2YXGA 1GEQA 4AAJA 4JNMA 4O8RA 1OFBA 3LRMA 5H91A 4O0ZA 3NPWA 2OMAA 1K8XA 4WY0B 3RLVA 2CLKA 2ZFAA 2NWRA 5DY2A 5DELA 3STEA 1TPH1 3KVKA 4QISA 5ABTA 5IBXA 3SECA 3MUXA 4JEQA 4UMAA 3TQKA 3FYPA 4LVFA 2DJLA 3CEUA 3CC1A 3LGEA 4O1CA 2PRMA 3UWZA 4O12A 3GVGA 3N9SA 3GK0A 3LHUA 4JDYA 1EP1A 4I7VA 4MLRA 4R7JA 3W22A 3RFAA 3MI3A 3PBUA 1QO5A 1A5SA 5LNUA 1RQHA 4UMCA 1VJIA 1BKSA 3W23A 3EB2A 5LGZA 1QOQA 1GYNA 5G1TA 5C54A 2VEPA 3UQNA 4ADTA 3CT7A 2A5HA 4ZVJA 3HF3A 1ZY9A 3O6DA 5FEPA 1Q6RA 3UY7A 4AWUA 1WA3A 2DZXA 2OJPA 2PCQA 4NQ1A 4OT7A 3G1XA 1KV8A 3LB0A 4BI7A 1DL3A 1LLWA 3EXRA 3KXQA 2YW3A 5IBXC 4K8HA 3EX4A 1D9EA 4UTKA 1FXQA 1WBHA 1KM2A 2O7SA 3NG3A 4MOZA 3M5YA 1P4CA 1RV8A 3NL5A 2VFEA 1EB3A 1OFRA 3L0KA 1I2NA 5HR6A 4DO6A 1YTKA 2V5BA 4ONVA 1SZFA 3G1AA 4KFOA 4X3ZA 4JICA 3BG3A 1S5VA 5EMUA 1B3OA 2A2IA 1BTMA 3TKFA 1U83A 1N55A 3NQDA 3GNDA 3STFA 3LV6A 3QEZA 2FPTA 3ATZA 3B04A 3UWUA 5BOOA 4Z1CA 1VCFA 4R34A 3I65A 5E0KA 4FX7A 2RDTA 4X2RA 1KFBA 1FXPA 3DKLA 3M5XA 1GQNA 1PS9A 3WJXA 1FCQA 3TQ0A 1YDOA 3IVUA 3M1ZA 3HQ1A 4IMDA 3W74A 1K7FA 3NQ6A 3V75A 4IJBA 1DKWA 1KLZA 3W6YA 4EOUA 5G4EA 4BF9A 1KV5A 1ME8A 1GVOA 4LVBA 4O57A 1OJXA 1A5BA 5I3HA 5AHMA 3CHVA 1JULA 1KM0A 4LS2A 5HQEA 2QJHA 3W87A 5C5YA 1JRBA 2C16A 4FF7A 3TA6A 3V1PA 2R91A 4JYFA 1WBJA 3G0SA 3UY8A 1VS1A 3G1SA 5AC7A 1FBAA 1L9WA 2V8ZA 4IPIA 5KZDA 1JVNA 1P0NA 1PVNA 3L68A 1H63A 3M16A 3W2KA 4DXVA 1QPOA 4JXCA 3C52A 4ALDA 1OF6A 1QO2A 1AW2A 3S0CA 5DLCA 5BRBA 3GAKA 4RZ5A 1X8FA 3O06A 4R53A 4HPXA 3WK3A 3NL2A 4WY0F 2A7RA 1VYRA 1I8JA 3NEVA 4UIOA 1ZFJA 1T99A 1TQXA 3SI9A 3I7QA 3GDTA 4RK8A 5D2WA 3L5MA 3CEPA 3T44A 5KINA 3UPBA 3L5AA 4XKYA 4Y9AA 1HFBA 5AYZA 2DORA 3B05A 2NX9A 5FF7A 2Q8ZA 1QMLA 4OV4A 2VFIA 4RZ4A 3GR8A 1FDZA 3C6CA 3PM6A 4GUJA 3W7OA 4OE7A 1T0OA 5G4WA 4Z1AA 3P5YA 3GR7A 2GVLA 4UFIA 3B8DA 3G8RA 4UR7A 3NQGA 1SW0A 1OX6A 2QCCA 1OK6A 5CZJA 2NUWA 2DU2A 3PR2A 5F2IA 4UC5A 3I68A 2GVJA 3W1AA 1HO1A 2Z1BA 3FOKA 1VRDA 1MEHA 4IMCA 4FNQA 4Q4KA 3QM3A 4K39A 1L2UA 1DV7A 5AYXA 2DZWA 1PHWA 4FXSA 2JKPA 3M47A 3ABRA 2Q3OA 2H3BA 4LS0A 5G5IA 2ZZ1A 3Q58A 4LY8A 2FTPA 3LCGA 2WV8A 1K7EA 1ZAHA 1PCKA 5C6MA 3OG3A 4RX0A 5AC8A 2FPYA 3HPZA 4PA8A 3VCRA 3R2GA 1Z44A 3U8GA 2TRSA 2WKJA 4LVGA 3R5EA 2WJZA 1TB3A 4EVZA 3C8FA 4IUOA 1LORA 3QPZA 4E2BA 4CCDA 3P8IA 4M5PA 2X30A 3C2EA 2ZRVA 5KZMA 3HMJG 4GE8A 3LRLA 1YTDA 5FESA 3JRKA 5D2VA 4IMFA 4X22A 3R8RA 1GT8A 2NLIA 3EWWA 1TREA 3P80A 3RK8A 1JCJA 1LRNA 2ZA2A 1YTEA 4M6PA 4O14A 1FCUA 2Y61A 4IPJA 4HPJA 4WQ6A 1TO3A 3NO5A 2YCEA 3GB6A 3P81A 2B7NA 1X1OA 4U4MA 4AF0B 4I7UA 3TAOA 1W37A 1XBZA 3M43A 1SO4A 4PEKA 4GUFA 3IVSA 4CCEA 3THQA 5BW6A 2G97A 3W2UA 4ICNA 3C2FA 1O5KA 1EPXA 4CLMA 1H7RA 2DZPA 3B0PA 3NGJA 3T40A 3BLIA 1QCWA 4M19A 1L6WA 2YYUA 3WK0A 3TQVA 3MWAA 3C61A 4QQ3A 1WX0A 1LLZA 3QYQA 1JQXA 1YYAA 3FEMA 5AB3A 1PE1A 2PURA 3IIXA 1Z42A 4O18A 4RZ6A 3IRDA 4AWSA 5G1YA 1F74A 2RDUA 1E51A 4WY0A 4WXYA 1ZAIA 3W1TA 3L21A 3G24A 4MY9A 2Z6JA 1K03A 2ZRYA 3TFCA 5DY3A 5LGXA 3MP3A 2P0OA 3PWAA 4TMCA 1H62A 3L0NA 3MI6A 3HIJA 1C29A 5CZTA 4KKXA 5FEZA 1AL7A 3THAA 4LV4A 1Q45A 3O6CA 2B7PA 2ZCGA 2QCDB 1TMHA 1OFPA 1KM4A 1OYCA 2ZQ0A 3ABSA 4XQ6A 3UWVA 4O1BA 3N2XA 2E09A 1OFAA 2YDAA 3C56A 1IGSA 6TIMA 4Z1BA 1G7UA 1EIXA 3HJZA 3NYZA 3TK7A 1XXXA 2DZVA 1G4PA 1IF2A 3GDRA 3QW4B 4QNWA 5A5WA 4JIQA 1QWGA 4ORMA 1P5BA 2ZZ3A 3F1QA 1Z48A 2C1HA 3QMSA 1R2TA 2Y88A 3DGRA 4UFJA 2BWGA 3PAJA 1SZEA 4PL1A 3AO0A 3H53A 4HSOA 4HNTA 4GUGA 1GPWA 4WZHA 1W8SA 4JTIA 3SGUA 4PFMA 3GIYA 1Q6OA 2CLIA 2D73A 1X7FA 4IXHA 4DEFA 1KLYA 4JTHA 5EL1A 5CPNA 2H8ZA 3UYCA 4IX2A 1KM3A 4ZL1A 4MZYA 4FNUA 1Y0EA 4UTTA 1HO4A 3RLUA 1PL9A 1SW3A 3W7PA 4RKAA 1HUVA 1XDLA 2FFCA 4IMGA 3NM1A 3QMRA 3SIZA 3HG4A 2ZZ2A 1ME7A 2WO5A 3S5OA 3TSBA 3CWOX 4EIVA 2ZZ6A 2A85A 1VYPX 5EBUA 3C2RA 2YX0A 3NM3A 5L6UA 4RXFA 2YR1A 4DELA 4NZJA 3W07A 3ZWSA 1K8YA 2BXVA 4CQ8A 2DZTA 4NJGA 3FKRA 1FUYA 5FF0A 1OABA 2CLMA 1DOSA 4UTTC 4NX0A 3OEXA 4HT3A 1MO0A 3K30A 4UNLA 2OCZA 2DZSA 1FWSA 4AXKA 1EWEA 1TTIA 5HWJA 2GOUA 2V30A 3EX1A 4ORIA 1J2WA 2BTMA 1SZNA 4QAIA 4FX8A 2H90A 3O05A 3C0JA 2X1SA 2ISWA 3WJSA 2XN1A 1B57A 3A21A 1KTCA 3WFAA 1GZGA 3F4WA 4XZ9A 3UPWA 5DBUA 1N7KA 3PB2A 3C2VA 2E5CA 1BWKA 1A53A 4HSNA 2NV2A 1ZHAA 4ZQRA 1NEYA 1LOQA 3HB9A 4HNUA 3HGRA 2YFOA 4HKPA 3IIZA 4JN6A 3N34A 1F76A 4FNTA 3SGZA 2HS8A 3S6DA 3W7KA 4MLJA 4MY1A 2PRLA 4JX6A 2TYSA 4EF8A 5CPMA 2NXHA 3TDFA 1A5AA 1MSSA 4JY9A 1KFKA 4PL2A 3FA5A 2OT1A 2QCGA 4HHPA 4ADUA 4LUIA 1YDNA 2ZRWA 1Z41A 1KTNA 3TC6A 1VZWA 3W70A 4UTMA 3NQVA 2E1DA 1O95A 5BNKA 4LU0A 2JKEA 2F84A 3LOTA 3DI0A 4E38A 1OFEA 3DENA 4YWIA 4ZQPA 3LTPA 5F4XA 5HUOA 3INPA 4IOTA 1I2OA 1UCWA 2E5DA 1EP3A 3TR2A 2VFFA 2GPTA 4IQLA 1TV7A 3W7JA 1R2RA 1SO3A 4FX6M 3CIXA 5HWNA 5CSRA 1SUXA 3EKLA 1O94A 4UUIA 5E93A 4A29A 1JUBA 2JKAA 1B9BA 1X1ZA 2B7QA 1WXJA 4ML9A 1I2PA 3S1WA 4B5NA 1W3TA 3E49A 2A6LA 5CSSA 4YL2A 1SFJA 1OK4A 8TIMA 2V2HA 2QCLA 3GXTA 2B7OA 1JCYA 4NZFA 1TIMA 4W9TA 3LERA 3NQ7A 1TRDA 3DAQA 1UBSA 1KM6A 1DQWA 2QAPA 3W1QA 1WQ5A 5D2YA 3TSMA 4UTIA 5H2ZA 2C3ZA 2TMDA 1SU5A 4R33A 1VYSX 1W5OA 3B4UA 4A2RA 3MBDA 4LWWA 3LX9A 5AFDA 1KBIA 5EPDA 2GQ8A 1FWWA 1KM1A 4OQVA 4O0KA 2V82A 1OFDA 3W76A 1J5TA 4Z1DA 5GVJA 3W88A 2NUXA 5I3FA 3GZ3A 2J6XA 2WNQA 3M9YA 4AF0A 3G1YA 5HULA 1I2RA 4MY8A 3SFKA 3KRUA 4MFEA 1GG1A 4JTGA 4NJKA 3HOJA 4IGHA 3YPIA 1FWNA 4DF0A 4GRSA 1JRCA 3KX6A 3W2MA 1RR2A 2CLOA 4JTUA 3QSRA 3MJYA 1KW1A 4BWLA 1R30A 3W7CA 1TPFA 1NAL1 4NNBA 1QR7A 3GLCA 3W71A 4X9SA 4LT9A 3KVMA 3Q37A 3QRHA 4LOCA 3PBWA 1QOPA 5J5DA 3W2JA 1BWLA 5K3VA 3JS3A 2Y7GA 4N4QA 2PE4A 1IIHA 3P67A 2NXGA 2Y85A 5MHBA 1L6YA 4N4PA 4NXKA 3UZJA 2YSWA 3P60A 3FIGA 1K7XA 4AEOA 3TXZA 3DBPA 1H50A 3W9ZA 1EUAA 4ZQOA 2AAMA 5KZEA 2XFWA 1LM1A 1F6PA 1KTBA 2FPVA 1B4EA 3OBKA 4KFPA 3PBYA 4NJJA 1TSIA 4BWLC 1TV5A 2EF9A 1RZMA 2QR6A 2V9DA 3G1HA 4DPQA 3M5VA 3CTLA 3A24A 1YXDA 1ZALA 2VFGA 3EWBX 3G22A 1M5WA 3I6RA 3NOEA 3OVQA 4K36A 5K2ZA 3TH6A 3MBFA 3T7VA 2BLEA 2W79A 2UV8G 3O8AA 3TIMA 3P82A 3LHZA 1O4UA 1F7BA 1TCDA 2EGZA 1RVGA 1WAUA 4XUGA 2JGQA 4JTSA 4FNSA 1AMKA 3NQMA 4WOQA 1T96A 3SSJA 4GXMA 3NZ1A 3NPXA 3PVFA 3KHJA 1NVMA 2ZRUA 5HR7A 3L65A 3IGUA 2FDSA 3LCXA 1OX4B 1J4EA 3U2OA 2EPHA 3BV4A 4O11A 3CQ0A 1XCFA 3W7RA 1Q6LA 4O13A 3PY2A 4K6AA 2P1FA 4MZ1A 2A1YA 3Q94A 3G1FA 1IXNA 3MHFA 5AHEA 3W1LA 2QCMA 3LTYA 1H1ZA 3LXBA 4ZQNA 1LBFA 3LHVA 3CPRA 3HPXA 1VLWA 3RF9A 1RD5A 2V5LA 3SZ8A 3RNDA 1JUKA 4AB4A 4N9EA 1K02A 1DHPA 1TTQA 4N2YA 1X6UA 1YXCA 2CZ5A 3IIOA 1DBTA 4WD0A 3W3OA 2ZYFA 1SSDA 1Q3NA 2GJLA 1LDCA 2E6YA 2HMCA 3ATYA 5C2XA 4MYXA 4UMBA 2YFNA 3TAKA 3W7MA 4I7WA 3Q2DA 4O16A 5D37A 1TTJA 3QFEA 4U28A 1IXPA 4NNAA 2RHGA 3BLEA 2QEZA 1QFEA 5F2GA 2RFGA 4NVTA 3NZRA 3BG5A 2QKFA 3KVLA 2QUTA 3VNDA 2QCFA 3NNTA 4GUHA 4LNYA 5HWMA 2E77A 1V7YA 3S1XA 4A21A 1FDYA 5EA9A 5F2LA 3MHGA 4JYEA 1GYLA 4N9BA 6ALDA 4JTJA 3FFSA 1FWTA 4NJHA 4DPPA 1H7XA 2ZTJA 1DVJA 2Z0IA 1TPC1 1EEPA 3AJXA 1F2JA 4MYAA 4QNEA 4HNNA 2J24A 4POCA 2FLIA 1XM3A 1ICPA 3LM7A 3PF3A 2GJNA 4PCFA 4BFAA 3NQ2A 2ISVA 2QCEA 4JDBA 1THFD 1UUMA 4J9JA 5F1UA 5K4ZA 2WNNA 4UFHA 5LNSA 5DBTA 3O15A 5KMYA 4OHQA 3KRZA 3H55A 3TSDA 1WOBA 4HN4A 2RDWA 5AHLA 1LOSA 3GAYA 4BI6A 4TU1A 3STCA 4UFKA 1VPXA 2X16A 3IVTA 1LRQA 2GQ9A 4IWWA 3WK2A 4FXRA 5D30A 5TIMA 2WOQA 2G5WA 2WSRA 2YZRA 3USBA 1XC4A 1QDSA 1VR6A 3GKAA 1S5TA 3R12A
chains in the Genus database with same CATH superfamily
5FKYA 5FJIA 4IG2B 5BYWA 2PWGA 5DO8A 3LTSA 4X0NA 2Y5JA 5I00A 4W86A 3AS3A 4KBXA 4XBKA 4UQCA 1JPIA 3TUUA 4L4OA 1W1ZA 4W87A 1E1CA 4A35A 2Y89A 4LCSA 3QGAC 3RYSA 3OIHA 4LCRA 3VNJA 1ZBWA 3OVPA 3PUOA 2J9XA 1GQKA 1ZCOA 4H6RA 1WPCA 5E0CA 3ZR4A 3MC5A 1BF6A 5HDRA 4FS9A 4NF7A 1SFLA 2Z1KA 3PJTA 3NFUA 1WP6A 2E6FA 4QSHA 5CH9A 2E6DA 1EOMA 5DCDA 3W1PA 3ZOAA 4ZMGA 4KIEA 4R85A 5A8OA 4X9YA 2QLYA 4ES4A 1ICQA 4FIQA 3RU6A 2Y62A 2R94A 3ZJ6A 3UP8A 3LXCA 1E4MM 1EJWC 4NZCA 4NU7A 1XBYA 2F7FA 3IGHX 3IGXA 2NT0A 4AIEA 2WQPA 2OT0A 5D9NA 1J79A 1NARA 1K8ZA 3UXAA 1FDJA 1XQKA 1H2JA 2QAFA 2VUYA 5A8GA 2I17A 5M2FX 1Q4WA 3WQWA 2VQTA 2OPJA 3D0CA 1UB3A 3QV7A 2XH7A 3QSTA 4DNMA 3R89A 4S3KA 4HD5A 2NX3A 2AGKA 3T6CA 2EPLX 1F5ZA 4ZEPA 1TJ1A 4PMQA 1T8QA 1WXZA 3CUIA 5LNWA 2Z4GA 1Q8JA 1KFWA 3EDEA 4JTTA 1OT2A 4IZGA 5CBIA 3FKKA 3GXNA 1QPQA 2WM0A 1CX9A 8XIMA 1V51A 1TE6A 4GYKA 4JIHA 4ZCWA 3GY1A 4G6CA 1ZCCA 1JF6A 1A50A 4TV6A 4LUTA 4PTXA 1Q6CA 1EWDA 2L5HA 5EYWA 3DKJA 2I9EA 2OSXA 3ONBA 2FJKA 3R0UA 3AS0A 4CU7A 1KM5A 4RW5A 4EPDC 3HTWA 3HV8A 3OGVA 4D6CA 2XUCA 3K13A 1JZ2A 2FB3A 1XYAA 2BVDA 3LI0A 4ZOBA 1UASA 2PDIA 3ES7A 3UCCA 1GKPA 1NOWA 3WF3A 4Y2WA 1VHNA 3MDUA 2IKGA 3BOFA 2NQ5A 1F6KA 1JQVA 3ELFA 3NSNA 4K7YA 1Y65A 2X05A 1ZAJA 2F9RA 3K4WA 3IIPA 4C6QA 4PUWA 2G50A 1M65A 2XGIA 1AD4A 2VGIA 2JEQA 3UVIA 2HK1A 2FHFA 4PSPA 3H4GA 4C90A 1GVSA 1O60A 1A5CA 4GVGA 4B5SA 3R13A 4L1GA 3MKVA 1XIGA 2VQUA 5TF0A 1B30A 3U6WA 5D2TA 4BI5A 2IW0A 2AMXA 2DIJA 4DUXA 1DJNA 4OUEA 4RV8A 2ZKMX 3LENA 1VIWA 1Q7MA 3P7YA 1HKWA 3IARA 4UZSA 3ARXA 3TROA 5IM51 1CGYA 3O7UA 4O1FA 4TR9A 3WL1A 2IKHA 4Q7NA 2E4TA 1AJZA 4C7DA 3T0CA 2FGZA 5CEWA 4JPGA 2V81A 1VEOA 1Q6FA 2WC7A 1NFPA 1B9ZA 2ATSA 4Q8WA 4M6QA 3GU2A 1HJWA 5DRCA 1ODUA 3W2LA 3K46A 3NQ8A 1K9EA 3W81A 4M24A 4MIMA 3CM4A 2QDGA 4IQEA 3PBVA 4PFHA 3PG8A 3PZIA 1YHTA 2C8NA 3UETA 2D2GA 3U2ZA 2PLKA 3TJXA 3M41A 3VKJA 1A0DA 1FCVA 2VC7A 4JR5A 1TKKA 4NJIA 2QJGA 4C6BA 1LBLA 5AECA 3C2YA 1GVFA 1NDWA 2R1KA 2HS6A 1EO5A 1MVYA 2VGBA 4OZOA 3PTQA 2QCNA 3T0DA 3S83A 1AZ2A 3I6EA 2DVXA 2MANA 1EGVA 3E2QA 2WLYA 4MDPA 4EF9A 1RQEA 2BXZA 2FDMA 3NXLA 4HA0A 3I4KA 1HW6A 1NOFA 4G7EB 3S9ZA 3S2JA 4DIAA 3EX2A 3L4WA 3KAOA 3GU9A 1JZ3A 3LMZA 4PUNA 3KW3A 5BU9A 2GWNA 2FMOA 3UWEA 3M07A 3MUIA 5LNVA 2YDSA 3CZJA 3OVGA 2O92A 3PZNA 1UWSA 3MP5A 3OLGA 2KX9A 4ZB5A 1EBGA 2QCDA 1A49A 2W9MA 2ZXDA 4HK6A 4JCLA 4NIRA 1OZMA 2QXWA 4GNKB 1UROA 1TRIA 2IPGA 2CXEA 3UYIA 2GYIA 3N4EA 1VFTA 2CZEA 2PTXA 1XCXA 1YADA 4TO8A 3MHUA 2F2HA 1PX8A 2A7NA 1J9YA 3TW9A 3VTRA 4O52A 4GKLA 4Z2HA 1F07A 3GHTA 5TBOA 5M03A 3HPSA 4UTJA 2O7QA 1WOAA 4YCPA 4U33A 3ZT5A 3W84A 1JL8A 1TWWA 1TPVA 4H01A 5CZ0A 4ACZB 4DJDA 5CSYA 3FNDA 2BY1A 4Q6JA 3CAQA 3V1HA 4L56A 4XWUA 3CPUA 4PZVA 2GJRA 3LCIA 4M7TA 2D22A 4PCTA 3NURA 1H7PA 3OQ8A 4HIBA 3PNUA 2FTWA 1G1YA 3KLLA 3R25A 4MF4A 3WK1A 4NZ1A 4AVNA 2Y7FA 2C1IA 4MWAB 4F2UA 1XLKA 1K3UA 3WDPP 5D8ZA 6XIMA 3TW6A 4Y96A 2ABBA 3VE9A 3LXAA 4C6FA 2W27A 1XIJA 1Q66A 2J4GA 3N15A 2ZBTA 3MYPA 3NAVA 4H4IA 2I56A 3KP1A 2I14A 1IT8A 4U2ZA 3V36A 4F0RA 3B06A 3RDKA 2XVGA 1CXIA 1TQJA 3N9RA 4XIMA 2V2DA 2TSYA 1XI3A 5AVNA 1QUMA 4ZB0A 1GQJA 4MPQA 1XG4A 3PPHA 1VLIA 1E0UA 3LYEA 4RL3A 3BC9A 2V38A 2PGFA 5HOSA 3FSUA 3L4ZA 3LBCA 4IL2A 2X41A 4LV9A 5CZKA 1QNRA 3W7HA 1UMYA 1S3TC 1EP2A 3WO8A 3LBMA 4JNZA 1Z6KA 4QLLA 4YVXA 3LDVA 2E68A 2JBMA 2RKXA 4LUSB 5HNNA 1GGOA 1E6RA 5KTLA 3I7RA 5LNRA 3RITA 1KCXA 2Z25A 1EX5A 2ISSA 1AL8A 1UHVA 1KFEA 3VI2A 4KEUA 1XRVA 5LKYA 2UY3A 4HOZA 3UD6A 3KWXA 2H6RA 3C3NA 3HQOA 4GZ7A 3GDKA 4Y8FA 1PTAA 2UZ9A 2Z1SA 3EX3A 4N9CA 1CLVA 3BSMA 5C9ZA 4QHRA 1SSGA 3WNMA 3VFLA 2A6NA 3UW6A 1QNPA 4AFYA 2G3FA 4LRSA 1IXQA 3NTYA 4S2BA 5D2XA 1W54A 4OKDA 3BXWA 3CHEA 3W75A 3OA3A 5HNTA 1RJPA 1JFXA 1YE6A 3W1RA 1A80A 1M68A 4GVIA 3CL8A 3V5FA 1YDVA 3SUSA 2X2GA 1MUWA 3VDCA 1PV8A 4U3AA 4WGXA 3S1VA 2C91A 4Y9PA 3U2CA 3N2BA 5CPOA 3BO9A 5U4NA 3WNLA 1E4IA 3KCLA 2ZA3A 1GJPA 4H9ZA 4H7CA 1EKOA 2G96A 2VURA 2ISDA 1R47A 1P0KA 3MSDA 4FLOA 3MT1A 1XX1A 2PRHA 1RA5A 2POZA 4JFTA 1K6WA 3SQLA 3T0TA 1KRBC 3BLDA 3ITVA 4C1LA 2ZRZA 2E67A 3TJLA 1DWGM 3ABXA 2NVCA 4Q8UA 2J13A 2NWSA 2Y70A 3UA3A 2C15A 2IQ0A 1Q7QA 1U30A 4GACA 3FK4A 1JNEA 3HQNA 3SUUA 1RJQA 4EWJA 3T55A 1MXSA 2ABAA 4C65A 3GIQA 2INZA 4NNCA 4UOJA 4IP7A 3PBGA 3GKFA 3QKZA 2QUUA 4RE0A 1HL8A 3NDOA 1G01A 3A13A 2VP8A 4REQB 3LK6A 5ABEA 3QR1A 5E1QA 3OHIA 1UWIA 1SZGA 3MMTA 4RLIA 4DQWA 4CCCA 2RJGA 3DFNA 4PUMA 2CIPA 2CZFA 5AHNA 3SCOA 3ANYA 3AXHA 3H21A 3UXLA 2PPGA 3TTYA 1L8NA 4W4QA 1R85A 4F0SA 4UR8A 3AZRA 1RBLA 2FIQA 4DWSA 2PTYA 4YWSA 1XBVA 2NUYA 1IXOA 2FYMA 1KD0A 5I3DA 1GTEA 3RRXA 2YBUA 3BW2A 3GXPA 3CYJA 1ALDA 4BF7A 4H7ZA 1MW1A 3NEHA 2QGHA 3DU0A 3CHCA 1I2QA 1VCVA 4WSJA 4DBEA 1RVKA 3USZA 2Z7GA 2BG5A 4LRTA 2YXGA 3VIHA 5H91A 5CC3A 4BF5A 1BAGA 1CTNA 3RLVA 4E4UA 3WF0A 2NWRA 4QISA 3BLPX 3MUXA 4JEQA 3FYPA 3LGEA 1E4NA 1DJHA 4O12A 1E72M 4DZ5A 2E40A 3N9SA 1EP1A 1U22A 1H49A 4UMCA 1RY0A 1QTWA 3UGVA 3SFWA 5C54A 5EBAA 4C6LA 4EANA 4ADTA 1P6CA 3CT7A 1PZ0A 3GG8A 4FAMA 3HF3A 5TAOA 1ZY9A 3O6DA 4RDZA 5FEPA 2E0PA 2OJPA 1UZHA 2ZUSA 4NQ1A 4OT7A 1GK8A 2P53A 4TOQA 4L6DA 4CQBA 3TLLA 1LLWA 4S3JA 3EX4A 5A6BD 3UFYA 2YA1A 4HU0A 1E70M 4LQ1A 3N3TA 2RGLA 3NG3A 3CZEA 3QV9A 3M5YA 1XJBA 1JI1A 3NL5A 1GCYA 2VFEA 1EB3A 3H12A 5CJMA 2PAJA 3EWDA 3C8NA 4GGBA 4MGGA 2DDXA 1V3JA 3JUGA 1ZJBA 3KBWA 1U83A 1GNXA 2YL5A 3B9DA 4IIDA 5BOFA 3GNDA 3STFA 3WCZA 3QEZA 3CNYA 5BRQA 4B92A 2D20A 4AYGA 5BOOA 1JZ8A 1OCQA 3I65A 1M7XA 1TR9A 2RDTA 5AZ0A 2O55A 3VD9A 4F8XA 1TUXA 4ZFCA 4JN7A 1CXKA 3RX3A 3UG3A 1MNSA 4FR1A 3MTWA 1K7FA 3L4XA 3WUBA 4LPCA 3V75A 1H41A 4IJBA 3O0KA 1R9XA 1V3HA 4EOUA 1V02A 4W7WA 5A6MA 1ME8A 1GVOA 4IMAA 3K4DA 1S5MA 4PB4A 3TP4A 4LS2A 5HQEA 1BYAA 1JRBA 5G4HC 2E1WA 4JYFA 4F0KA 1HKJA 1RP8A 4JOMA 2V5JA 1VBUA 5KZDA 2XISA 4PB5A 3QBUA 1FWBC 3GFYA 1MI3A 3S0CA 3GAKA 4C6EA 3NYDA 3QHMA 4R53A 3WK3A 1QW9A 2A7RA 1B90A 1VYRA 2OGJA 3RIKA 4HA3A 3N6HA 5E0FA 3AHVA 1CBGA 5D2WA 4L9XA 4PCNA 3CEPA 1PTDA 4PUJA 3NVDA 5KINA 3L5AA 3PP7A 5REQA 2YCKX 4DWDA 2XFRA 2OB3A 2EPKX 1NWTA 2NX9A 5GNXA 1RXOB 3KOWA 4DI9A 4ATWA 3ARYA 5G4WA 2GDUA 4PTWA 3VIIA 3MSGA 3WLPA 4W93A 1XLBA 4MPKA 2QCCA 1OK6A 2ASHA 3CS2A 1U5VA 4GI8A 2GVJA 3PFRA 3W1AA 1IQ8A 1RK5A 2Z1BA 4KEZA 1W2PA 4CD4A 4IMCA 1L2UA 1DV7A 1WKYA 1DTNA 4FXSA 3WMSA 3ABRA 1UW9A 2H3BA 5G5IA 2FZBA 2WW5A 3Q58A 3LCGA 2WV8A 4Q6XA 1PZ2A 2CERA 3OG3A 4RX0A 2Q8XA 1V77A 1ZPTA 3VCRA 4PMJA 1PO9A 3V0TA 3U8GA 1KC7A 4PCSA 4BQ3A 4LVGA 3R5EA 3GH4A 4HHLA 3GU1A 3C8FA 3IJ9A 3H7RA 1TVLA 1UD4A 1PDZA 1YTDA 4GJIA 4QJ5B 1PXGA 3CV1A 3R8RA 4GYPA 3VC5A 2OYMA 1C8XA 1NP2A 3EWWA 1TREA 1HKVA 1J0YA 1LRNA 2ZA2A 3S6OA 3MKKA 1FCUA 1AD1A 2Y61A 3W28A 3MVIA 2OZTA 5HNUA 3GB6A 1XGZA 1VFOA 1PYFA 4KPLA 1W37A 3AI0A 3WQ5A 5IFPA 4GUFA 3I4EA 3DDMA 1UUQA 1GOKA 3CMGA 1S1RA 3SJNA 2GOKA 1O5KA 4U10A 2JALA 1E9YB 3M0VA 3NGJA 2PDYA 4UOQA 1QCWA 2YYUA 3MV11 3ZVHA 4MJ2A 2QMJA 3E3HA 1YYAA 3FEMA 4LYPA 1OT1A 4RZ6A 3IRDA 5G1YA 3GR4A 4IFRA 4WY0A 3L21A 1K03A 4G56A 4PMYA 1JAEA 3AICA 4TMCA 4QCEA 2GGGA 4H6EA 3GW3A 3M64A 4D8ZA 3HM7A 4D8AA 1YNQA 5CZTA 4ZOEA 3CLWA 4D71A 2IMRA 1UP0A 3THAA 2BNJA 7XIMA 2QCDB 5BXTA 2Y5SA 2E9LA 3LPGA 4CD5A 4EAYA 3UWVA 5HMDA 1TWDA 3PPGA 3EBVA 3QHNA 5CGMA 4HTYA 1AQ0A 3C56A 1EBHA 1IGSA 3KTSA 2QIIA 3LQLA 3B9NA 3NYZA 3TK7A 1G4PA 4KCTA 3GDRA 3QW4B 1XLLA 2FZDA 4R7OA 3SBFA 2ZZ3A 3AYTA 1OCJA 4XD3A 2Y88A 1SJDA 4UFJA 2Y0FA 2BWGA 3WUGA 3ENLA 3SCRA 4HSOA 2CITA 4D6FA 2ZX6A 3SUVA 4WZHA 3SGUA 2EJAA 3GIYA 4L7ZA 1Q6OA 4W8LA 1ZBCA 4JTHA 5CPNA 2H8ZA 3UYCA 1KM3A 3ZSSA 3U0HA 1Y0EA 3VGHA 4MB1A 1PKLA 2ALRA 4YJ5A 3S46A 1HUVA 5CPQA 3GIPA 3PTKA 4H19A 1ME7A 2R6OA 1DXEA 3S5OA 3CWOX 1EF3A 3NOYA 1PWMA 2A85A 5EBUA 3GFXA 4MADA 3OA5A 3OODA 1O5RA 2XIQA 3SQSA 3E5PA 1HNYA 4XZWA 4AU0A 5IHRA 2J75A 4I5XA 2IXUA 1ITXA 3BLLA 1WDDA 4NJGA 5FF0A 4UTTC 3OEXA 5JUVA 4HT3A 3K30A 2UY5A 1FWSA 4OTKA 3GVQA 1W1PA 2XZ7A 6A3HA 2RAGA 5HWJA 2GOUA 2ZVIA 1RHCA 3JW7A 2Z2AA 4PN2A 4FX8A 2H90A 2ISWA 1B57A 1UOKA 2GGEA 3A21A 5A6TC 4JTAA 3PB2A 3H70A 1AMYA 4H8UA 1FRBA 1Y5VA 4HSNA 2PUZA 5ECVA 1D8CA 1XIMA 4GBDA 4DAFA 4XO7A 2PC8A 3FA4A 1PX4A 1J6OA 3FA3A 4HNUA 2YFOA 3IIZA 3BZGA 4JN6A 1F76A 2NLYA 3MMWA 4FNTA 2VRQA 3TJ4A 3DIPA 3NIYA 2PDQA 3TZNA 3VYLA 1MSSA 1WKEA 2INFA 2OT1A 4M6UA 3WL0A 4P8UA 4HHPA 1TJ2A 1YDYA 4HHMA 3TC6A 1O95A 1A4LA 4KCUA 4WK9A 3LOTA 3EGJA 2GK1B 2J8GA 5CBJA 3INPA 4IOTA 1I2OA 1UCWA 1LQ0A 1QATA 7REQA 3CT2A 2VUNA 5G1MA 1TV7A 2P8BA 4Z2LA 1RSCA 1SUXA 4Q7BA 3EKLA 2AMGA 4A29A 1A5MC 1XPYA 4LNCA 3TYAA 4OECA 2VCBA 2B7QA 1I2PA 1EZ2A 3N04A 2XIBA 3FHAA 2Z00A 4NSBA 4QP0A 4B5NA 4XKMA 3E49A 1UH3A 2D2OA 2OTDA 4YL2A 5CSSA 1SFJA 2V2HA 2QCLA 3GXTA 3VO0A 3V0UA 4W9TA 1TA3A 3LERA 1BF2A 3NQ7A 2FZMA 3KOZA 4UOZA 3HMCA 3T2QA 1EXBA 1DQWA 2QAPA 2RUSA 4E2OA 4TTGA 3LU2A 4UTIA 5H2ZA 2TMDA 1LG1A 1SU5A 2OSWA 3BV7A 3GYCA 2JIWA 3KBNA 1EDQA 4PTDA 3MBDA 3LX9A 5AFDA 1KBIA 5EPDA 5I6SA 2GQ8A 1MW3A 2PTZA 1DP0A 4O0KA 1OFDA 4L4PA 1PB0A 4DXXA 4C7GA 3W76A 4IF2A 1VAHA 5GPRA 3W88A 4B2DD 2ZUUA 4A4AA 4AF0A 5HULA 1ONWA 1W3KA 3KRUA 4NJKA 2V3FA 3HOJA 1O1ZA 4K3ZA 1EQCA 1JRCA 4EAMA 2WMIA 3KX6A 2CLOA 1KW1A 3MUY1 1R30A 3W7CA 1TPFA 1QR7A 3W71A 3G2GA 4G7FA 1LLOA 3WDRA 2JF7A 4XAFA 3COTA 1TR1A 4IP4A 4LOCA 2OKOA 1BXNA 3T0AA 3WSUA 2IQDA 5K3VA 1M01A 4YS1A 2Y7GA 1LQ2A 3SN4A 2NXGA 2ON3A 4XD4A 1W1VA 1EDTA 3MKCA 2QJJA 4E6MA 3P60A 3MU7A 3TXZA 4NI8A 1EUAA 1QJWA 1VF8A 3DC0A 4ZQOA 1LM1A 4DWSB 3PZGA 4AY1A 1ADSA 4NJJA 3PBYA 2HISA 1TSIA 1QBAA 2YA0A 2OOFA 3G1HA 3CTLA 3H2CA 2VDHA 4QFUA 1ZALA 1E3XA 1V3IA 1M5WA 5T9BG 3T8QA 3TTQA 1G5AA 1ODZA 5K2ZA 3T7VA 1W9UA 2UV8G 3VUSA 4MTVA 3BMXA 4S3BA 3P82A 2OQLA 1O4UA 3KL3A 4H9XA 2BVYA 1RVGA 1XD0A 4GO8A 4JTSA 1R3TA 3NQMA 2ZE0A 3WN6A 1XYBA 1M1BA 1E9LA 4GXMA 3NZ1A 1GOWA 4HPHA 3H6OA 1TWIA 2ZRUA 1T5AA 3SCQA 1OX4B 3BV4A 1OC5A 4GQRA 1GKRA 4O11A 4K6AA 1J11A 4TV5A 4BKNA 1S2AA 1F3EA 2Z24A 1V08A 4QLKA 3QY8A 5AHEA 2IKIA 2D0FA 1XS2A 3UG8A 3LHVA 2PDCA 4JQ1A 1ISWA 1E56A 2VZVA 5FD0A 4YTRA 3RF9A 4QG8A 4S3AA 2O9OA 3GTHA 1DHPA 1GQIA 2VVSA 4N2YA 1XC6A 3W3OA 3AOFA 3VNKA 2WB5A 4MYXA 4UMBA 4Q8PA 3CHDA 1Q63A 4L1WA 3TAKA 3ITTA 4OBRA 4ZXLA 4I7WA 2CKRA 4O16A 1AJ0A 5J8LA 3TC3A 3BLEA 3WLTA 1QFEA 4LFYA 2RFGA 3BG5A 3NZRA 3VM7A 4F0HA 2QCFA 4AD0A 3SDOA 4GUHA 5IXEA 4AD1A 2VZTA 3MMUA 5F2LA 3AALA 4JYEA 3SCSA 3GXDA 1HXJA 1FOBA 1DYSA 1RPKA 4R3UA 4W5UA 5T8GA 3OYZA 5C9WA 4TQTA 3T2PA 2Z28A 2VT0A 4QNEA 4GFIA 4POCA 3TYEA 2FLIA 4BY3A 4BS0A 4GIRA 5FJPA 3GXFA 4PCFA 1X39A 2WANA 3KBMA 3Q65A 1THFD 4W85A 5IRPA 4FMVA 3M0JA 3FV9A 2WNNA 2OELA 3RMEA 4F2BA 4XAGA 4X61A 4HN4A 2RDWA 3BJFA 3GRIA 2EPMX 5C2GA 4AD5A 1UIOA 3CBWA 1BLIA 3DN5A 3GAYA 4ZXOA 3BSGA 2BVTA 2WSPA 2V68A 3WBXA 2OGYA 3H23A 3VK5A 5D30A 5TIMA 3HJEA 2FKPA 4E8GA 2R1LA 3USBA 2YOCA 1KGXA 5I2UA 2Z29A 3EKGA 1VR6A 3GKAA 1ADOA 3IS4A 2D0GA 4DJFA 1IEXA 3WJYA 4B2DA 4GX8A 3R0DA 3ZS4A 1DJXA 1ZGDA 3GSMA 5DT7A 2QJNA 2PI6A 3THDA 1TYGA 4PULA 3M0KA 1TPDA 2YYTA 1GUVA 1E40A 1US3A 1DJIA 1H0GA 1YLVA 4Z08A 7TAAA 1EJRC 3VIPA 1V79A 3NVTA 5REQB 4YTQA 4XB3A 2YL6A 3WQOA 2WLZA 9XIMA 2DSVA 2W61A 3NPUA 1XV8A 4Z1YA 1KB3A 3APYA 1ISZA 4JTFA 2CEQA 3A4XA 2OR2A 1PSCA 3U2EA 4H00A 4HZ8A 1A0EA 1W3NA 2VEKA 1AW1A 1ONRA 3ITOA 4AZCB 3GNPA 4IPLA 3HFTA 1OC6A 3K5XA 3L5LA 1WZAA 1PEZA 4M51A 1Q6EA 1JCXA 3EZ4A 3IUHA 1BRLB 3DI1A 3T42A 1LUCA 4JYDA 3B03A 2VELA 1LYXA 4MB5A 3L2IA 2AL2A 1NDYA 1GJWA 2QJMA 1N2VA 3DFTA 4EXQA 3GVVA 1M6JA 1F8MA 3RXZA 4O1AA 1N82A 4JL1A 3G0UA 1U1HA 2EKGA 1E3ZA 2Q02A 5LHEA 5D32A 1TPB1 2JQXA 4U5IA 1FHVA 3MYOA 2XVPA 3WNKA 3VX0A 4GUIA 1DWJM 1Q8AA 2JIEA 1FHLA 1EDGA 2FVLA 3BCDA 5FACA 3W1UA 3RM4A 2ESCA 3V18A 4K38A 4GI4A 1UD3A 2J9ZA 4CVUA 1KNWA 3CUGA 3F2DA 3T78A 4D2JA 4C6IA 3TN3A 3DYPA 3ZLHA 1OYAA 4D9PA 1MQQA 3UNDA 2ZC8A 3NQEA 4A8NA 4HNVA 3ES8A 5BMXA 1WYIA 2VZOA 3M6YA 4K7VA 3KEHA 5J04A 4DBDA 3H54A 3THUA 4HYVA 3UEQA 5FL0A 2PCEA 2OFJA 5I03A 1R9YA 3POHA 5LHFA 1TX2A 3WFLA 5DMYA 4GA8A 3A5VA 2Y24A 1L6SA 2ONEA 3LCFA 1CB2A 2NSXA 3ZVIA 4Q4OA 4E8DA 4J2MA 4MVAA 3KVJA 4L4MA 3MSRA 4AHOA 1XYFA 3F2CA 2R24A 3EXSA 4UTHA 4PODA 5BCAA 1WDPA 4LW7A 1W9DM 3QQ0A 4CEXC 1TPEA 5FI8A 4RZBA 3W7EA 2JE8A 7ODCA 2DT2A 2PC4A 1VHCA 3CO8A 1IZKA 4U5KA 4RNHA 3B0VC 5CC5A 1XIIA 3HPAA 3PWGA 3URAA 1EXPA 3W1NA 2QPSA 3J7HA 1P7TA 1H61A 1NF7A 4KH2A 3VGGA 1V4YA 1QI0A 4S1FA 1E0WA 1P43A 4MUPA 4I9AA 4OOUA 5U7SA 3AIEA 3T1GA 3KBJA 4UZUA 2Q09A 4MKNA 2CU0A 3AISA 3C0LA 3CAKA 2YDQA 3DHFA 2VEIA 1ESWA 4L6HA 3WMLA 4AHPA 1MWOA 3ANVA 4O15A 1ITQA 2CW6A 1M7PA 1XLJA 1XSIA 1OCNA 4BHYA 5ABFA 3WJZA 1JD7A 1VP5A 1D3HA 4DZIA 4ZBCA 1E5NA 2OLSA 2CFFA 1LBMA 2V5DA 3NO1A 1XLHA 3NR0A 2QF7A 4GIEA 1DWIM 5D38A 3CWNA 2PTDA 2F2KA 3W02A 5F1VA 2J77A 1S5WA 1KA9F 2I1OA 3MCMA 3ARTA 4Y8EA 2XN2A 1PTGA 3W7QA 2VZUA 3M44A 1FWHC 4XTDA 4DY1A 5TD4A 4XAPA 5SWUA 1KBLA 4JFVA 4JHOA 1ZJAA 1QNSA 1XFCA 1VEMA 1RPXA 1R38A 3LLDA 3E02A 4QLJA 5G2IA 1XRFA 3SADA 4NAEB 3FVMA 3WNNA 1SR9A 4UXDA 2CWNA 4ZODA 1QNVA 3II1A 1LCOA 4EP8C 4EKJA 5GJMA 3UR7A 3VCCA 5HINA 4N9DA 2W92A 1UD8A 2GVGA 1GJUA 4OWGA 5LIUX 4Y9MA 2FJUB 5CPLA 5FJUA 5GQBA 3V7PA 1B3YA 3DFHA 2G0WA 1YRRA 3W1MA 4RNIA 3R7MA 4ZOAA 3U4AA 2JK2A 3GFZA 4JS3A 4JKKA 3GNNA 1M7OA 3ISIX 2X1TA 3RX2A 1W0MA 2VX7A 3IAQA 1TVNA 4Q32A 1G6CA 2XJ7A 3V5CA 2IQTA 1H7NA 3P5ZA 2GUUA 3FDKA 5DCEA 3O3RA 3GG0A 1B3XA 3G0XA 3WEOA 1O1HA 1MQRA 2G37A 2WSYA 3L66A 4Q4RA 1B4KA 2VENA 4H9MA 7ENLA 3DHUA 3S1UA 5AY7A 1BXBA 3AIQA 5E9AA 1H3GA 3RR4A 3GX9A 1YMYA 4N6FA 2GJXA 4FOKA 2DP3A 1PPIA 1OD0A 1JCMP 4KRZA 3IJQA 1H7WA 3EWYA 3UJRA 5KITA 4LC8A 1PIIA 3GDLA 1CPUA 2VDIA 3WEZA 3MO7A 3GTNA 1XWYA 3N3MA 5DFAA 3UZWA 4A2SA 1XGEA 5LZLA 3B8WA 3QKEA 2F38A 4A8RA 3EOUA 3BAJA 1A4MA 1NELA 2VYOA 1R3WA 1SJBA 3WJWA 3QY7A 3C0SA 5EY5A 1P0EA 3GXMA 2NV1A 2O0TA 4LUYA 3EWXA 4QE4A 3ZJKA 1FWRA 3K8MA 3PTDA 4DF2A 1XUZA 4GFSA 2HWGA 4HSHA 4DBWA 1DQUA 2HDJA 1SMDA 2CPUA 3WMBA 3SN0A 4FSAA 4ZSTA 4B90A 1TUFA 3BJSA 4H9UA 5I3GA 2V3EA 5HJLA 4QDPA 4XZLX 2Z6IA 4I8DA 2J8TA 3MP4A 5I3KA 1EZWA 2O56A 5H6HA 4J5NA 4RR4A 4Z0JA 2WSKA 3BCJA 4DO7A 2BHUA 3BW3A 3N73A 1OFQA 3G5EA 4AHQA 3W7GA 2XPKA 2X7VA 3KZPA 3MB9A 1Z32X 2X40A 1HIZA 2ZUWA 7TIMA 3W73A 4PCPA 2WC4A 3CUJA 1GORA 1XQLA 4MWAD 3W7DA 2DGAA 2PLCA 1MEIA 4LVDA 4O4VA 1Y8BA 2VD8A 1G4TA 1UUOA 1PKYA 3ZZ1A 1MQPA 2RH9A 2X1RA 3GVWA 2AOSA 3IEBA 4UNKA 4FLSA 1H1YA 6XIAA 1NM9A 1XIFA 4MJ4A 1YPIA 3CLMA 4KWUA 2Z2UA 2R8WA 1UJPA 3MMDA 5CGTA 3ZWTA 4A6GA 4K8EA 4KGJA 1S2TA 5J5RA 2HZGA 1FWJC 3S2MA 4YYFA 1G4EA 1Y5XA 3D5HA 3CUHA 4XKYB 2BZNA 2W4XA 3HG5A 1KFCA 2ATMA 2C0AA 3BGGA 3L12A 4XVDA 5F4WA 4F9DA 5BOEA 4WKAA 1ZSXA 5DXYA 3RCMA 3LA4A 3LUTA 2NX1A 2ZZ7A 2G95A 2GJPA 3VAVA 3QZ6A 3HGJA 1OC7A 2XGBA 2Z27A 4FO4A 1E6SM 4JIIX 1WKFA 2XVLA 3L2MA 1B3ZA 1XIHA 2PF8A 5G2HA 4QJ1A 4JGDA 4RJEA 3M0XA 4NYUA 3CUFA 1XL9A 2PDNA 3DFSA 4ILSA 3E9AA 4RCXA 3QC3A 1NQ6A 4V28A 3VDGA 3EDDA 4ZO8A 2QULA 4YNGA 2AQWA 4BQ5A 3AHZA 2WBGA 3FYOA 4DO5A 2YL8A 4MZ8A 2FHCA 3U3HA 2PDWA 4FNPA 1BGAA 1JJKA 3APTA 3DZ1A 1ITUA 1HTIA 4U2YA 4B9YA 1E43A 3KCOA 3HBLA 3W7LA 1US2A 4QX4A 4O53A 4UCGA 3SY1A 5D02A 5C7HA 1G7VA 2V0TA 3W38A 3D3FA 3TWBA 4AZIA 3EX6A 3W1XA 2G3JA 1UZDA 3TFXA 2W5FA 3LCHA 3RCYA 4J3UA 5K9DA 1C7SA 5LA0A 4XISA 2Y8UA 2ALDA 1LJYA 4GO9A 2VRKA 1D3GA 3G3MA 2P10A 4DZHA 2ZA1A 3UNTA 4KFNA 1LG2A 3BAXA 1KXVA 1PYMA 1O68A 4N02A 5HUPA 2CLFA 1VGAA 1QHPA 3P8JA 4O54A 4O4WA 4QCFA 1B3WA 1QK0A 4R5EA 4O50A 3NL6A 3W26A 4OVXA 2FH6A 3R58A 3NPVA 3O16A 5I3IA 1J0ZA 2V2CA 2WHJA 4UFMA 2BODX 3DBNA 5A8MA 1JD9A 3KM8A 1XGDA 4C60A 3W24A 2TPSA 2J7FA 3VZXA 1UKSA 1QPNA 1R46A 4C7FA 1XKYA 3L0GA 1R3SA 2EXOA 3KOFA 3KRSA 1GEQA 2XGZA 4F2TA 4O8RA 4GCAA 3NPWA 4Q7IA 1DHKA 3U48A 1SZRA 1Y5WA 2OMAA 1K8XA 3PBMA 2CLKA 1GW9A 2ZFAA 3STEA 2XH2A 2GLKA 3TQKA 3L4YA 4LVFA 3CEUA 3CC1A 4GINA 4GNVA 3N9KA 4O1CA 1J0KA 3GK0A 3LHUA 3ZJ8A 4JDYA 4I7VA 4R7JA 3W22A 3RFAA 1QO5A 1A5SA 3V35A 4X2PA 1W1A1 1Z8AA 1DWFM 3W23A 4WJ8A 1QOQA 1R8LA 2NW0A 3PZVA 3M6DA 2D24A 4ZVJA 3FJNA 2WYSA 4LAZA 4ACZA 1CXEA 1P0DA 4YVPA 2Y8KA 2YB1A 2EJ1A 4AWUA 1WA3A 2DZXA 1OGSA 3GUGA 3BWWA 3WLHA 5A6JA 1DL3A 3EXRA 1UR0A 2YW3A 4KMQA 4K8HA 2YCLB 1D9EA 1DJWA 3TTEA 1FXQA 3BMVA 3T8LA 3GD6A 2VHLA 5I07A 3L7RA 1I2NA 1IGWA 2HVMA 4DO6A 1ZZMA 4HZ6A 4ZSUA 1ITCA 1JXJA 5BWAA 4C6DA 3HPFA 4ONVA 4KFOA 4JICA 2GSJA 5EMUA 1B3OA 5MF5A 2PBGA 2VC5A 3CQJA 5A94A 1BYBA 1WB0A 1N55A 3CK5A 3MDWA 4KRUA 3R0KA 3EOLA 2FPTA 5LIXX 3UWUA 2BBFA 4NL1A 3WF4A 1OD8A 3B9OA 2D3NA 5A8NA 5E0KA 1BVWA 1PDYA 4NHVA 1FXPA 3DKLA 2DSKA 3AWNA 3U9IA 1FCQA 2X09A 1BSLA 3TQ0A 1GHRA 3SB0A 3TYCA 5C7VA 4JTCA 4LEQA 2Q01A 4WIWA 1D7FA 1DKWA 1SYTA 3PZ9A 3W6YA 4GY0A 1SVDA 1UD6A 3AQUA 5G4EA 4BF9A 1BPLB 4K1WA 1KV5A 3AHYA 4GZIA 4PSRA 1A5BA 3VOIA 2WVTA 3IACA 1VENA 3CHVA 1JULA 1KM0A 1WCGA 3S47A 5C5YA 2C16A 1CCWB 3V1PA 3QLDA 5KETA 2R91A 1WBJA 2PWFA 1VS1A 3G1SA 2WQDA 2A3LA 3G6MA 5AC7A 1CECA 2POTA 1NWSA 1EJVC 3EA2A 4HOWA 1P0NA 1PVNA 3L68A 1S2UA 4WKFA 1OIMA 4DM1A 1UZ1A 3M16A 3WQ6A 1QPOA 2VR5A 1OF6A 5DLCA 3NL2A 4AUBA 1I8JA 1P48A 1VEPA 1O66A 2WVVB 2DT0A 3OW1A 3L5MA 4GQGA 4IH3A 1W3LA 4ZFMA 5CC7A 4Y9AA 1I0BA 4L1XA 3WQGA 1GYMA 2XU2A 3BOXA 4OV4A 4KWSA 2VFIA 2WJFA 3BH4A 3REQA 1FDZA 3W7OA 1P6BA 4KEMA 5EU9A 1T0OA 3AU2A 1SFTA 4Z1AA 3GR7A 4CD7A 2AL1A 3B8DA 3G8RA 4JTDA 2DU2A 4UC5A 3I68A 4W8AA 1HO1A 2CZVA 1MEHA 3AIRA 4RE3A 5A69A 2VI0A 3AUJA 4D1JA 4LCQA 5AYXA 1DJZA 2JKPA 3M47A 3GZAA 1P7TB 2Q3OA 4H41A 4LS0A 4CU8A 3FW6A 1MYRA 2PDXA 3DCPA 5HK4A 2GDQA 1K7EA 2OWXA 4TUFA 2FPYA 1FVPA 4ERGA 3WZ0E 4YPJA 3R2GA 2GVEA 2WJZA 4EVZA 4IUOA 4Q3MA 1LORA 3D46A 5IDIA 1GQLA 4GQBA 4K8GA 1HGWA 2ZRVA 2PDUA 3HMJG 4KW2A 1LWJA 1F8IA 2NLIA 4GQQA 4REQA 3H26A 4GH1A 1PKMA 3MZNA 1YTEA 4JZ5A 3M4HA 2WMKA 5B7ZA 4ZENA 4WQ6A 3UPMA 5BXRA 2VCAA 3AMDA 1XH1A 3CQKA 3M43A 1SO4A 2OO0A 4A8LA 3IRSA 1TZZA 1B3VA 2WBKA 3UERA 5BW6A 4Y9NA 3E2SA 4ICNA 4LF1A 1EJTC 1IEIA 3C2FA 3B0PA 2WAGA 4AIOA 5D9PA 4M19A 3A47A 2VOTA 3MWAA 2WZEA 4C6MA 2Z7KA 4PMXA 4QQ3A 1WX0A 2EO7A 5BRPA 1IV8A 1JZ6A 4AZHA 2WZIA 1JQXA 5AB3A 2PURA 4EXBA 1W9VA 5DEZA 1YW1A 5I02A 2F8QA 2XINA 1ZAIA 2FMNA 3ZR6A 1C8YA 3G24A 2ZDSA 5AZ1A 1ADDA 1PZ3A 5A2AA 4D6HA 4ZE5A 3EPNA 1H62A 1A5UA 3MI6A 3EOEA 2YBVA 2UY4A 4RDVA 4ECLA 3S5SA 3M7SA 1JPDX 1NDVA 1JPHA 3AJ7A 4Z2KA 5FEZA 1A5LC 3TA9A 4LV4A 3AIVA 3SO7A 4W89A 1YEYA 3O6CA 4GISA 4WJXA 1BG4A 3A64A 2ZQ0A 3ABSA 1RCOB 3N2XA 1OFAA 1FWCC 2YDAA 1CT5A 2DV0A 4Z1BA 1VJZA 4I6KA 4H1ZA 1EIXA 3HJZA 4C6PA 4JIQA 5B80A 4RE2A 1P5BA 4HK5A 1Z48A 1C3FA 5HPCA 4OOZA 3DGRA 1V6XA 4GI6A 3AO0A 3H53A 4HNTA 4YYCA 4TVCA 2GJXB 1UP2A 4QROA 2FGBA 1DWHM 3MO4A 4RPPA 2D73A 1X7FA 4H7VA 2WZHA 1JZ4A 1JPMA 2Y1HA 3WLOA 1VBJA 1HO4A 1SW3A 2ACQA 1R3VA 1MW0A 1SMAA 2ZZ2A 5CBBA 2VEFA 4IFOA 2ZZ6A 3GW0A 3C2RA 2NVDA 5L6UA 5JBEA 3ARSA 1X97A 4KETA 4I5UA 1KQYA 4DELA 3W25A 3W07A 2JFEX 3ZWSA 1OBAA 4FOJA 5A2BA 3PHAA 4AIUA 1ZB5A 3GC2A 1FUYA 2CLMA 4I6VA 4B3KA 3FX4A 3VU2A 1UKTA 1MO0A 4UNLA 2OCZA 4L5ZA 1EWEA 3ALFA 1CLXA 2ZIDA 1PUDA 1TTIA 1YBQB 3MS8A 3ALGA 3KS6A 4RDWA 2BTMA 4CCZA 1MMFA 2E3ZA 4DJDD 3C0JA 2DZAA 1BXCA 2ZUMA 1JCTA 1GONA 2NSOA 4AX7A 3W53A 2F61A 3F4WA 4XZ9A 3UPWA 1I9CB 5DBUA 1N7KA 1HVQA 5LIKX 1HJUA 3UF9A 1A53A 2NV2A 1V6TA 1ZHAA 3PPCA 1C90A 3UZXA 3HGRA 4RNJA 3N34A 3S6DA 4QDMA 3V5OA 2PRLA 4JX6A 1E55A 3TDFA 5E9XA 1A5AA 4PMDA 3U7VA 3UG4A 3FA5A 3IJ7A 4ADUA 4ENLA 3N12A 3W29A 4LUIA 2MNRA 2ZRWA 2FVMA 1Z41A 1O5QA 2VMFA 3WF1A 1DIOA 2TAAA 4UTMA 3GBEA 2E1DA 1LL4A 4ZTYA 5LA2A 1OFEA 4E3VA 1J5SA 4ZQPA 4F0LA 4IQJA 1UJQA 5DMMA 3TR2A 2GPTA 5A2CA 2E9BA 1R2RA 3ZO9A 4RV3A 5CSRA 4UUIA 1LF1A 1TMLA 5E93A 3VPLA 1JUBA 2JKAA 1B9BA 1WXJA 4ML9A 1M3UA 3E6EA 2XDFA 2P50A 1W3TA 5C9RA 1AA1B 3VGDA 1IWAA 4XSLA 1JCYA 1E9IA 1TIMA 2BDQA 4I9JA 4LBSA 5C9UA 3W1QA 1WQ5A 3W82A 5D2YA 1PKNA 3WDIA 3NZQA 2C3ZA 4AIBA 4F79A 1VYSX 3B4UA 4A2RA 1U1UA 2WCGA 2C7FA 1FWWA 2REQB 2NUXA 5I3FA 1DXIA 1A5OC 1HT6A 3GZ3A 2J6XA 1RJRA 1CENA 1HQTA 3SFKA 4MFEA 1KCLA 4DF0A 2B81A 3YPIA 4IGHA 1R9ZA 3E0WA 4P7NA 1RALA 4B5VA 3IPWA 2IS7A 1RR2A 4QJ4B 1NQKA 1HJXA 4JTUA 2IUZA 3ORWA 2Z1XA 3W01A 4HMCA 2Z1WA 4LAUA 4B5UA 5HJYA 3Q37A 4AVOA 1POKA 1S1PA 3ITYA 3R11A 1REQB 3IANA 1Q7ZA 4I3GA 3AIUA 1W2VA 3CZKA 2CHRA 2ISFA 4JQ4A 4A3QA 1YE4A 5EMJA 3E0LA 1EOKA 2HRWA 8A3HA 3P67A 1EX1A 1EPVA 1L2QA 4N4PA 4NXKA 4KS0A 1GEHA 4P5UA 5MKGA 5GJNA 3W9ZA 2ANUA 4C6OA 5KZEA 3I3DA 1F6PA 1KTBA 3OBKA 2INEA 4L65A 1D2KA 4HTBA 2V6AA 4QE1A 3LNPA 4MNJA 1H1NA 3M5VA 3N2OA 1FWIC 3N4FA 2PD5A 2QZRA 3OVQA 1R3QA 2A3EA 1XLFA 2QDDA 3U5YA 5HXMA 1XW8A 3UVAA 4IL0A 3CZ8A 1Z69A 1EC9A 2EGZA 3CB3A 4DJED 4FNSA 1XYMA 4WOQA 4GK8A 2OQYA 3AROA 3KHJA 2PA6A 1NVMA 1GKQA 1N8IA 2YIHA 2DUZA 5KEZA 4GPNA 1B31A 3HA1A 3CQ0A 1KWKA 2D1ZA 1KGWA 3H4XA 3W7RA 3GBDA 1Q6LA 2IPWA 4O13A 2DW6A 5ECUA 2A1YA 3G1FA 4J28A 1JFHA 3PJXA 3W1LA 5DQPA 2QCMA 2HNEA 1H1ZA 3LXBA 4AEFA 3A3HA 4J27A 5LXXA 3M0LA 4RPQA 3SZ8A 4J1OA 4N9EA 3RM8A 1X6UA 4DWSD 2CYGA 2ZYFA 2P3ZA 2GJLA 3ATYA 4HA4A 1VPQA 1S5NA 4G5DA 1TTJA 2BS9A 4U28A 1XLMA 2E7FA 1IXPA 3LNMA 2X0HA 2XWDA 3HU7A 1BKHA 2OQHA 2V69A 3WBEA 5F2GA 3AMKA 4S3CA 5CLTA 2VGGA 1A3HA 3UR8A 3NNTA 1BFNA 4LNYA 3S1XA 2ZXBA 1K1DA 5EA9A 3AHXA 1VJSA 1GYLA 6ALDA 2WVSA 2QMKA 1FWTA 1H7XA 5PTDA 1RCXB 1J8VA 1XIBA 2BHZA 2NQHA 1EEPA 4C6NA 5CJNA 4MYAA 1Y7VA 2J24A 4QJ3B 3O9NA 1E6NA 3SCUA 3N17A 3VZYA 2G3MA 3WD1A 1JGMA 2GJNA 2YA2A 4JDBA 1JPKA 3WH6A 3IWPA 5F1UA 4UFHA 2O9RA 5DBTA 1IT0A 2PB1A 3PPFA 1JF5A 1JZ5A 1WOBA 4QAWA 3L4VA 3MPGA 2FTYA 3KDNA 1OB0A 1X6NA 4D6DA 3H2FA 1VPXA 1RLDA 3KL5A 2X16A 1WUEA 4GCXA 3WK2A 1X8CA 1XINA 2EG8A 2G5WA 2WSRA 3BLOA 1XC4A 1P6WA 2WMHA 2XM2A 3TYBA 1S5TA 3ZLGA 1XIDA 3IAPA 1NJJA 3BZJA 2XN0A 4Y6GA 1I1XA 3KL0A 2ODOA 2PF0A 2VNCA 2ZADA 1FCBA 1E1FA 5DX7A 2XTKA 1LQAA 3QF0A 3M5ZA 3FS2A 1XBXA 4B3LA 3G1VA 4HNCA 1J0JA 2NV9A 3WH9A 4YCOA 1BEUA 1W1YA 3CYVA 2UBPC 2GK1A 3PNZA 4K37A 2C1GA 4UR9A 3POCA 3TOPA 4PB3A 1DTUA 1UOZA 4M6VA 1UPPA 3REQB 4ERAA 4MMWA 2QV5A 4FA3A 4WX2A 5CG7A 1NU5A 3AZSA 4AMAA 4ZZ9A 3N6JA 2WMGA 3C2OA 1ENUA 2MUCA 1CNVA 3TMLA 4LVAA 4DF1A 4QG6A 3OU8A 2ZX7A 4MHBA 1T40A 4C5ZA 2XZ9A 1PZ1A 3B97A 4M7SA 3HG2A 1E5JA 4H2HA 3DFOA 4B16A 1W3IA 3KZSA 1ECEA 3BK0A 2R1NA 1C93A 1W32A 3D6NA 3PS7A 3E12A 1Q6QA 3KFTA 3C5QA 1C8QA 5FF2A 2QJIA 5EB8A 3GYEA 3TEVA 6ENLA 1LRTA 4HP5A 1KR0A 4YLWA 4N6EA 4P2VA 1LZOA 3L67A 1G4SA 1FWFC 4DJEA 4GKTA 3BVJA 5CKSA 2QUVA 3WBWA 1VBHA 4AQLA 3PJUA 2GSEA 4JIPA 1VCGA 3RG6A 2O9TA 2W63A 3ARZA 2CBVA 3OLIA 1DQXA 4AEEA 1JYWA 3WYZA 3H7UA 3TV8A 4JFWA 3ABQA 3L23A 4UFLA 1G0CA 2YJQA 4TX9A 5AHIA 3T9PA 1FY6A 4GX9A 1GVIA 2BY2A 3WENA 4GWEA 2CETA 5K9XA 1FHUA 8RUCA 5HAOA 1R5YA 4CN6A 5BWFA 1C9DA 4UBPC 2VOMA 3NZPA 4C1NB 1OHLA 3LEPA 4H83A 1F3TA 5LSMA 1Z89A 5FF4A 3D47A 4QXIA 2PSNA 1UR3M 4IM4A 4B5TA 1NDZA 3MY9A 1ONEA 5T26A 3CB8A 2NZLA 4PBEA 2XVKA 1FX6A 3HGSA 3HO8A 4DBSA 3AZTA 2CLEA 3SGGA 6REQA 4L64A 2VFDA 3EB4A 3BARA 5H8PA 2G4JA 5DCBA 4C6KA 4Z42C 1GG0A 2J7EA 3C86A 1V6UA 4IGSA 3P61A 1E1EA 4J3XA 4QGCA 1EJSC 2ZVRA 1GVQA 2DSUA 3UR2A 1UA3A 4EPKA 4LALA 2A3CA 1OX4A 1VQTA 3AMCA 2PDFA 3CV2A 3URNA 3AXMA 3E0FA 1VFLA 3FYYA 2PFHA 3PTMA 1QU4A 3SW6A 1XFBA 2A21A 2P88A 3EWZA 2Y7DA 4ATLA 1QNOA 4XK2A 3MZ2A 2IXVA 3N2TA 3EB3A 1NF0A 5D33A 2PLMA 1TPUA 3EDFA 3CXOA 1KXQA 3S5ZA 2WNWA 4UTLA 1T6MA 5E09A 3SRHA 3KLKA 3V16A 2C6QA 3CL6A 3GHSA 4CNPA 2VKZG 3BLFA 4GBUA 5M5DA 4GY7A 4FEZA 4E2VA 4CU6A 4LUJA 2PDLA 3QW3A 1XSKA 2R14A 2EBNA 3SAZA 5CAHA 1YPFA 1XH0A 1U1JA 4QEEA 4NYYA 2PWDA 5JH1A 5E6YA 2ZUTA 2YDRA 1FH8A 1E0VA 2ZRXA 1XRSA 3UXDA 1MEWA 3MW7A 1TWSA 3N19B 5AYYA 3K2GA 5D04C 1V93A 4C91A 1JDAA 2P5NA 1H5VA 3ARPA 2W3ZA 1VB9A 4V27A 2R1MA 4LAKA 2CBJA 1QW7A 2J7DA 4H9VA 4JIEA 2X42A 5TQLA 5IOBA 5CPTA 1H5YA 3LRKA 5FEWA 1FP9A 1HL9A 4J7RA 2WCAA 5ABGA 3ZR5A 4ROPA 3ZLFA 3URQA 5JH2A 5K4XA 3QR0A 2H3DA 1JCNA 4CQAA 4FZIA 3TQPA 4TTUA 1TIWA 3E1F1 3SRDA 3GG7A 5CSUA 3LHTA 1M9HA 3ABOA 1U5HA 1UBPC 3GTFA 1WKDA 3PSVA 1UR8A 1ICSA 4HMEA 4NZ3A 2QHAA 1NP0A 2WSQA 5I06A 3CO4A 4CN1A 1IYXA 2Y8VA 4OJYA 5FA5A 5FEXA 4JTLA 2WPBA 5I7GA 3EXTA 2PTWA 4J3TA 3VIFA 3VX1A 2JGYA 4PUDA 1U5JA 3AYRA 3W2NA 1GTHA 4PEEA 2PLJA 3GNXA 1X38A 5HJXA 1TV8A 2J27A 1UZ4A 2ACRA 1F73A 4A05A 2VFHA 3ITCA 4H8VA 4LS1A 4PTNA 1VH7A 1AK5A 1W3JA 3QGKC 5HNRA 1WZMA 1LT7A 3WEMA 3BGJA 3MI2A 4YXGA 4Y90A 1NWRA 2Y7EA 4P7LA 2BHYA 1TZ9A 4J3ZA 4FF5A 4CN4A 3BAKA 4ZQCA 4AZCA 1A3WA 4IHCA 4V33A 3QPYA 3O6YX 1EUNA 2FQIA 2I5GA 4LH8A 1CGTA 1WDQA 3R8HA 2GWGA 3F5LA 1EC7A 4NXSA 1BRLA 2VXNA 3CIWA 3TOYA 3PZUA 4O1EA 3BMWA 4F0MA 1OVDA 4L4LA 4G8TA 4PUUA 3EEGA 1UD5A 4MJMA 2OYLA 2VRJA 2OOGA 1E0XA 1HKMA 1V0MA 2HE8A 3RMJA 1KXTA 2VC6A 1XH2A 2E5BA 5FF3A 5GJPA 3ZIZA 5L9FA 4V15A 4DRSA 3MA8A 2DT3A 4QG9A 4D1IA 1UG6A 2YCJA 2BSLA 1V7AA 1WDWA 2B0MA 5F2MA 3N14A 2EG7A 4UTUA 3HG3A 4ZR8A 1UKPA 2DIEA 2OX1A 2PD9A 1V03A 4O28A 1G69A 4IPPA 3UESA 1LT8A 3STGA 4JX4A 2ZUNA 2ZDRA 1GOMA 4WSKA 4XZMX 1AQHA 4ZTXA 3I3EA 4IIFA 2ACUA 5G2WA 2BY0A 4QITA 5AYIA 3RPTA 1LROA 4AVFA 3ZQ9A 1TPWA 4J3WA 1W5PA 4P7QA 1K70A 3S5NA 3PULA 5M1TA 4FALA 3WBAA 4IIGA 4G9PA 3T4WA 3MJMA 4Q22A 4F66A 4AZBA 2HSAA 2EPOA 3UXIA 3GC4A 4IJRA 2YXOA 4IQDA 3H7VA 1DORA 1H7OA 1XIEA 2VD9A 3IGSA 1UWAA 3P0XA 4XUYA 1TE1A 4EWND 2GL5A 3L9CA 3OBEA 4LBUA 4US6A 3WQEA 3QVQA 3QH2A 3S5YA 1O5XA 2RDXA 5HMSA 2XIIA 4H6KA 1SJCA 3N13A 5JU6A 4PTMA 4MSSA 2PDGA 2QS8A 1SO6A 5MKGB 3WDJA 4GJ1A 1KBJA 4Q8OA 3QMTA 3PC0A 4GMEA 3VD3A 3FLUA 1KGUA 2CKSA 3IK2A 4OBTA 1H0IA 1TVPA 5ABHA 2H8XA 3F4NA 4JTEA 3N6QA 4JTKA 3RGTA 3C4UA 3VKKA 1AW5A 4NZ5A 4D72A 3I7SA 1V0LA 2Y63A 4XSMA 3W0KA 2OZ0A 2D69A 1OSEA 1BQGA 2A7PA 3PSWA 4DI8A 3G3DA 1MDRA 2OODA 4LAMA 3LG3A 5AOUA 1WV2A 5EGRA 3HV9A 2CESA 4S2CA 4WUIA 4CNOA 4QS5A 1HGYA 2BMBA 1IIGA 1I4NA 2BP1A 5D03A 5AC5A 3S2CA 3AMLA 4PRTA 4WF7A 3BAIA 3WQCA 5RUBA 4NRRA 1SO5A 3EA1A 3WF2A 4PMZA 3N2CA 1JG9A 5AYBA 3UWQA 5DT5A 1TJRA 4RUBA 1Q2SA 3NQAA 5H8MA 3W27A 1OZQA 4XZIA 5IHSA 4BJHA 3JR2A 2XVNA 1DWAM 4UWMA 4HU8A 3OZOA 3BOLA 4UTWA 4Q8MA 4AZ6A 4TVUA 2C18A 4AW7A 4UQBA 3G77A 4W88A 4NT0A 4LB4A 4RXGA 1RH9A 3VOCA 3DC8A 4JCMA 1F4HA 2BOGX 4UB9A 3F4VA 3HN3A 3S9YA 4MFDA 3B0UX 1OX5A 2PWEA 5EKYA 4NUWA 4H9YA 4A22A 2R82A 1SR0A 3FEQA 3ZMRA 1ZENA 2FZ8A 3CAWA 1XYZA 3CGTA 4L80A 3OZPA 4BK9A 3SN1A 4LEFA 4AZ7A 1TFVA 4A3UA 3QPEA 1MRAA 4NAEA 4UQAA 1DEDA 2Z1VA 3CMFA 1QVBA 1LTDA 1SW7A 1LOLA 1R2SA 1W31A 1ME9A 2DQXA 3WQ8A 1TJ0A 1ZJIA 3KWSA 3FJLA 3QTGA 4Q33A 4H04A 3M0YA 1F3XA 4YMZA 1CGXA 3BPWA 2X1UA 1UWUA 2W0UA 3WLSA 3I10A 3UZ5A 5CGQA 4JEJA 2OEMA 3SR7A 3O07A 3TMQA 1OYBA 3NL3A 5JBFA 1BGGA 1H51A 4AWTA 3HZ3A 3P14A 4JNMA 4A8IA 3LRMA 4LAOA 1E6PA 1BQCA 4V2XA 4GQ0A 4I9MA 5DY2A 1TPH1 3KVKA 5IBXA 3SECA 1MW2A 1DJGA 2DJLA 1M04A 1POJA 2PRMA 4LY4A 3R94A 3SY8A 4GOAA 4MLRA 5F7UA 2J6VA 3R4IA 3OTRA 2VX6A 1ISXA 4NG3A 4FLQA 2IPJA 3H22A 2AQVA 4HBKA 4CD8A 4DX3A 3U5UA 3UQNA 2A5HA 2XM1A 4DN1A 4LYQA 1CB7B 3AIWA 4BI7A 3KXQA 2J7HA 1P0BA 3E2VA 1WBHA 1KM2A 1Q13A 5EFFA 2O7SA 1AH0A 1CDGA 3IUDA 2RGMA 1RV8A 1OFRA 3DOPA 3L0KA 5HR6A 1UR4A 1B2YA 2D0HA 1YTKA 1Q6GA 2OZ8A 3LGDA 3M46A 4HMDA 1YNYA 2V5CA 4JAWA 1S5VA 2A2IA 3TKFA 1MRQA 2G3IA 4BEQA 1IHIA 3LV6A 3ATZA