1G4PA

Thiamin phosphate synthase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
219
Chain Sequence
b'HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 74
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4pA00
2J9XA 3P5YA 2ZA2A 3GDTA 3G18A 3FIGA 3G22A 1OFBA 2JGYA 4ONVA 1TPVA 1SW3A 3C52A 3WJYA 3UWQA 2NUYA 4LVBA 3TKFA 3P8IA 1OX4B 1IXQA 5AHMA 1SO3A 4HIBA 1CI1A 4JTIA 1TQXA 1UB3A 3G1AA 1I2PA 3I7QA 3KOFA 1NF7A 4GUHA 3GVGA 5LNVA 2X30A 4WUIA 1Y0EA 3OVPA 5HUOA 3LCFA 1GVRA 3W7EA 2XN0A 4BI7A 2H6RA 1ME8A 5LNSA 3B8DA 3HJZA 3GXNA 3R5EA 1EWEA 3BO9A 3LCGA 3IVTA 3PY2A 3SI9A 1GTHA 1SZEA 1NAL1 1LRNA 3H55A 4QQ3A 3O15A 3QQ0A 4S2BA 1L6WA 3LV5A 1XUZA 3I68A 3QYQA 1SO4A 1JJKA 1QFEA 2G5WA 3WJWA 3UWWA 1WOAA 2RKXA 3MP3A 2ZRWA 2B7NA 3GX9A 1F76A 3BLEA 3P5ZA 4O10A 4UFLA 5EL1A 3PS7A 4LW7A 4JTUA 4WQ6A 5EA9A 1MZHA 3E12A 3WJXA 4IXHA 2ZA3A 2VEPA 2ZRYA 3K30A 1MSSA 3EX1A 4CCCA 3W7JA 1G7VA 4UTMA 3BW2A 5LHFA 1LBLA 3M47A 1OX6A 1LYXA 2HSAA 2VXNA 1LRQA 5LKYA 3DENA 3OA3A 1FXPA 3BK0A 5A5WA 3W1UA 5D02A 3PBUA 4LVGA 4O54A 3M5XA 3ZWTA 4LVAA 4CNOA 2A6NA 1GPWA 4BFAA 2WSYA 2WV8A 4MLJA 1GJPA 4MZ8A 2Y63A 3NXFA 4ADSA 4UTWC 1SZGA 3TW6A 5BRBA 3NYZA 4CQ8A 1SSGA 4NJJA 3MJYA 1GG0A 4KWVA 4Z1CA 2YYUA 3UXDA 5E93A 1KBJA 2ZCGA 1JCLA 1B3OA 2ALDA 2GUUA 1LLZA 2CWNA 4LNYA 4QJ1A 4XTIA 2VFEA 5AHEA 1FX6A 4E0CA 3TCEA 3NOEA 1ICSA 2JKAA 1VHCA 4M7TA 3UZJA 3ELFA 3W7PA 3MBFA 5KZEA 4IX2A 1W5NA 2J27A 2F7FA 3S6DA 4HHPA 3QSRA 4AH7A 3A9IA 2DZTA 2C15A 1KFBA 3N73A 3NAVA 3GR7A 3L5MA 4JX4A 3S5NA 3SW6A 3VE9A 2I1OA 2J24A 5BOOA 3U6WA 3PG9A 1OYBA 1TPUA 2G97A 2ZZ5A 2DP3A 2E5DA 2ZDRA 3NQ7A 3W88A 5FF2A 4TMBA 3DH7A 1KM4A 3N14A 3NPVA 4DXVA 4PFMA 2Y7FA 1KFJA 2E5BA 3DHDA 3UY7A 2OJPA 3PUOA 3FYOA 4FNPA 3PSVA 4FHAA 2W79A 1OFRA 5FF0A 3EEGA 3F1QA 5D33A 4DELA 3Q2DA 3BARA 4FIRA 4A2SA 1SQ7A 2PC4A 4UTHA 1ZNNA 4XTDA 4LOCA 4CQAA 4M6PA 3LHVA 3KRUA 3RF9A 2J6XA 1L6YA 4O15A 5F2IA 4DBDA 3QRHA 4AMAA 4O50A 2C1HA 3HG4A 3OBKA 3BG9A 3TA6A 4ML9A 3EXSA 3O05A 4DO4A 3O8AA 4RCXA 3W7DA 4JTFA 2YR1A 5DCBA 7TIMA 3CEPA 5AYXA 3B0VC 4RR4A 3U2OA 3DHFA 2FB3A 5AC8A 2ZZ6A 3L67A 4LC8A 1IXNA 1FWNA 4RZ4A 3DFQA 3B4UA 1GVOA 2ZRXA 4LV4A 3W2UA 3M9YA 4UTLA 3W7GA 1W3NA 4ZQNA 3P7YA 3QMSA 2OMAA 1KFCA 1K8ZA 4AWSA 5G5IA 1WBHA 2A7NA 2JK2A 3O6CA 5HMSA 1K8XA 1SO5A 5TBOA 1RR2A 1R2RA 3TSMA 2ATMA 4O1AA 3W1LA 1WOBA 1P4CA 1H7NA 4LVFA 3C3NA 4Y8FA 4DBEA 3C2FA 3MYOA 1GYNA 1ALDA 3P84A 4E2BA 1Z42A 4UTJA 1QPQA 5F2GA 3MHGA 2EAWA 4WY0F 1TPH1 1A5CA 5L9FA 5IBXC 1K7XA 3NL6A 4ICNA 2R8WA 4JN6A 4JTLA 2E6DA 3QEZA 4FXRA 2CZEA 1KTBA 4NZJA 4CCEA 1GEQA 1XFBA 2NX3A 1WBJA 2CLOA 2C16A 3T40A 1YXCA 3OVQA 4HKPA 2BZNA 4O53A 2DZUA 3W7LA 2HS6A 1JUEA 5FEXA 4Q33A 4MFEA 2ISVA 3N9SA 3MI2A 3CB8A 3HG5A 4IXXA 5AN7A 3TJLA 2CLKA 5AYZA 3W74A 3W1XA 2X1RA 1AL7A 3EB2A 2OCZA 3TUUA 3L0NA 5KTLA 4Z1DA 3HG2A 4EF8A 4XZ9A 1K03A 3ANYA 3W1RA 1PCKA 5J5RA 2JGQA 2H90A 2V2CA 3MI6A 4N6EA 5D04C 3TFCA 3A24A 5E1QA 4W9TA 3NQ2A 4TO8A 5I3FA 1OVDA 1KBIA 4XQ6A 5K4XA 5AOUA 3NR0A 2DZWA 1K3UA 2V81A 2V8ZA 4DF0A 2JBMA 3QZEA 2R14A 1GYLA 2FTPA 4UMAA 3NQCA 4R53A 5DXYA 4H4IA 4NJKA 1VYSX 1THFD 1I45A 3G1XA 2YW3A 5AHFA 1TO3A 4UMCA 4RV8A 5DBUA 3CM4A 1UJPA 2RDUA 4WOZA 5G4EA 4I9AA 3R12A 3DXIA 4JTJA 5TIMA 3HGJA 4EWND 3TNOA 3BV4A 3S5ZA 3USBA 1IIGA 1FDZA 3OIXA 3DFSA 3SSJA 3O16A 4H6KA 1DQXA 1TJRA 4RZ5A 4JIPA 3UYCA 3B0UX 3O63A 1NSJA 3LB0A 3QFEA 3G1DA 2ATSA 2GQAA 3EWBX 1VC4A 4DF2A 5EMUA 3V1PA 1HUVA 5EBUA 5EY5A 1G7UA 3UD6A 1PL9A 1XL9A 3HB9A 1SZFA 2O7SA 3W7HA 1LRTA 1XBXA 1XCFA 4IX0A 4PCFA 1JUKA 1O60A 4WXYA 5CPNA 2NV2A 2C0AA 4POCA 1YADA 3WJZA 2BXVA 5DY3A 2Y89A 3O1NA 4OU1A 3S8HA 1N7KA 5KZMA 1A5AA 3BGGA 3UNDA 1AMKA 4K37A 4WOQA 4UMBA 4O52A 3EXRA 3FS2A 3NEVA 1F5ZA 2KZHA 1KM2A 1RQBA 1EIXA 3DZ1A 2QCHA 2TRSA 4QITA 3NQFA 3P67A 3S0CA 4UFKA 1TPEA 3C2VA 2E6FA 1P0NA 1S5WA 1ONRA 4MZYA 3C2OA 1CW2A 4JDBA 3W1NA 3JR2A 3L0GA 2GPTA 2WKJA 5I3JA 1GG1A 4CLMA 2HS8A 3QW3A 3HOJA 3M7WA 3DKJA 2NLIA 1W3IA 3L68A 4AF0B 1F2JA 4EIVA 4NNBA 4J9JA 1DOSA 2VEIA 4GWEA 4JS3A 3A21A 2V0TA 3LI1A 1VLIA 3T78A 1MEWA 1SU5A 1HL2A 1T0OA 1X8FA 4MOZA 4RKAA 1W1ZA 3MBDA 1DJNA 2ABAA 1I2NA 2G95A 3NQEA 4LC6A 3GKFA 2B7PA 1H62A 2X1SA 2RDTA 3LI0A 1W3TA 1IXPA 3C61A 1B57A 2DJLA 4C1KA 4GFSA 2PE4A 2Z1BA 2NXIA 3G0UA 3UPWA 2H3DA 4MLRA 1LBFA 4XKYB 4LT9A 4JYDA 3G1FA 3W76A 4CNPA 1KFLA 2CLFA 1GWJA 2ZYFA 3IV3A 4HT3A 2BWGA 5EKYA 1VYRA 4DPQA 3P61A 5C55A 3EX6A 2RFGA 5AC7A 5CPOA 1H7RA 4A2RA 4YL2A 3GNNA 1FCQA 3W3OA 2OX1A 5F4WA 5CZSA 1TPB1 3NQDA 5AB3A 4G1KA 1OK4A 2YDAA 3NQMA 3O6YX 2JKPA 2Z6JA 3DU0A 4ZQCA 4H3DA 5L6UA 3E96A 3W83A 3LLDA 2EF9A 3NPUA 4O11A 1QWGA 5HJLA 1O94A 4BF9A 1OFAA 3L2IA 3UWZA 3RK8A 1DJQA 3M5YA 1EWDA 3DAQA 3AJXA 3C8FA 1YYAA 3IIVA 3M44A 1WQ5A 5SWUA 1RV8A 3SGUA 4RJEA 2PRLA 4NJIA 1E51A 1Q6LA 2FJKA 4WD0A 3A23A 1O5KA 3LCWA 3QPZA 4K8EA 2ZQ0A 3CEUA 1BWLA 3RNDA 3STFA 1R47A 3G1SA 1TPC1 3BGJA 3ZWSA 1W5QA 1XC4A 1Q45A 3GNDA 1WYIA 2VFIA 3KVKA 4HN4A 3MO7A 2FFCA 1KM6A 2CFFA 4ZQPA 3LDVA 3A5FA 1CX9A 2QCDB 2WSQA 1FXQA 1GTEA 1N55A 3CIXA 4UCGA 3FA5A 5G1TA 3EWXA 4PL2A 1LLWA 5C54A 1HFBA 2YFNA 1AW2A 1ZY9A 2FLIA 4UTWA 5CKSA 1PVNA 2BX7A 3LCXA 1C9DA 2YCEA 3HF3A 3NL5A 4O8RA 1GZGA 1JUBA 1I2RA 2A2IA 1VJIA 1AG1O 3GIYA 2WO5A 1LP6A 3W72A 3UPBA 4O28A 1VGAA 2YPIA 1X6UA 1RQHA 4Y90A 2CLHA 3F4NA 3QQ1A 4IMGA 3LRMA 1SSDA 2A5HA 3PBYA 4IPIA 3IGSA 3LOTA 4RX0A 1SW7A 1U83A 3BG5A 2CLLA 4KFPA 1QCWA 5DELA 4GUJA 4IPJA 3W7MA 4OT7A 4JIQA 4Z1AA 3IEBA 3ABQA 3LGEA 4NJHA 4YCOA 1W5OA 4GBUA 3WK2A 4O17A 5I3KA 3NL2A 2R91A 3TC6A 1I2QA 3PAJA 3IIXA 3E02A 2FPTA 1I2OA 1YTEA 2QCEA 3O07A 1LCOA 1VHNA 4WZHA 3W2KA 3W2MA 1F05A 1QPOA 2VFGA 5CZ0A 3PB0A 3PULA 3V75A 3TE9A 1YLVA 3FJ6A 2VFDA 4MUZA 1ADOA 3QH2A 3L5AA 1YTKA 4NUWA 3ATZA 4R33A 3ABOA 2QKFA 5CZJA 4YMZA 1IF2A 2V82A 3SGZA 3S42A 1W56A 5FI8A 3LV6A 2QAFA 4QNEA 1QOQA 1JQVA 5FF7A 3STEA 4DPPA 3VNDA 1S3HA 5K9DA 2NXHA 1AL8A 2OT1A 3T55A 3KAOA 4GUGA 5D2XA 1ML1A 4HPJA 1X1ZA 1YXYA 2Y7GA 4IMEA 3JRKA 4IUOA 1XKYA 4PTNA 1G67A 2D73A 4Y6GA 4Y9AA 3ZS4A 3VE7A 2GOUA 3GDLA 3HMJG 4AHPA 3NPXA 1FY6A 1DL3A 1JCMP 2W0UA 1TRIA 3QJAA 5D38A 5FF4A 1JCNA 3A22A 3Q58A 3LM7A 1GVQA 1L2UA 1B4KA 1MEIA 2BLEA 4AVFA 1KFEA 1LOSA 1F6KA 4UNLA 1KTCA 5KINA 1PHWA 3SY5A 3R13A 4IWWA 4K7YA 1H7XA 1SZNA 3LRLA 1LOLA 1TPDA 4K8HA 3NA8A 3CHVA 4AB4A 1FCVA 5LNRA 2EHHA 3DGRA 3OHIA 3W2LA 1W8SA 4O0ZA 5D05A 3PVFA 4WY0A 5D2YA 3NL3A 1A50A 1WDWA 4LRTA 3W75A 3TIMA 3I65A 2GJLA 4NQ1A 4O0KA 2GVLA 2H8XA 2PRMA 4UFIA 4I7VA 1YXDA 1Z44A 3G0XA 5K3VA 3W7QA 4O57A 2VFFA 3TC7A 1KM0A 3UY8A 1M6JA 1VCFA 2GVGA 2V30A 1RZMA 3P82A 3QF0A 3KRZA 2ZZ2A 1O4UA 5KSWA 2FB2A 5H91A 5HUPA 3S5OA 4A29A 4QSHA 3TXZA 4LWWA 5IBXA 2J9YA 1W37A 3THAA 3C2EA 4CCDA 3EWZA 5HR6A 5C5YA 1G4TA 2Q3OA 2QJGA 4X22A 2FQIA 4LTSA 3S9YA 3STGA 3LHZA 4O4VA 3IVUA 3YPIA 1LBMA 3NQAA 4JTKA 3MWAA 1P1XA 3EX2A 4O19A 3GAKA 4GJ1A 4N2YA 1EEPA 3FKKA 3GXPA 2QR6A 4N4QA 5LSMA 1OHLA 5DY2A 1OF6A 1JRCA 3O06A 4QM1A 3PBVA 4AF0A 1G69A 1TTIA 2Y88A 3NZ1A 2P10A 3SECA 2OZ0A 3M6YA 2WQPA 3LRKA 1TV7A 3W85A 4AWTA 3EWYA 4U28A 4ZQMA 4MZ1A 4HNVA 1GVFA 4JX6A 3I6RA 1LDCA 2Y62A 5LZLA 1DHPA 1TQJA 1B4EA 1QR7A 4NVTA 4GNJA 2X16A 2VKZG 4N4PA 2E5CA 3NPWA 3S1VA 1TV8A 4RZ6A 4MKNA 1KA9F 1PV8A 2BTMA 2RH9A 3C6CA 3M5ZA 3IGXA 4LUIA 3N2MA 1TREA 1H61A 1ZCOA 4MY9A 2VEMA 4O12A 1H7WA 1R30A 5TQLA 1ZJIA 3PWAA 2X1UA 3NGJA 2B4GA 4UTTC 3LBMA 4LUJA 1TSIA 2W6RA 2ZBTA 4FX8A 1R46A 3KXQA 4QNWA 3G1HA 2YSWA 1H7PA 5ABTA 4EVZA 4JD4A 3TXVA 3Q94A 3KVMA 5DCEA 3QPYA 2R94A 4TIMA 4AHQA 3TAOA 3DI1A 3UWYA 1W5PA 2GQ8A 1HTIA 4Z0SA 4BI5A 4OHQA 4ZZ9A 3RLUA 3MUXA 4FIQA 4L4MA 5DN1A 1SO6A 3TJXA 1TTQA 4UR7A 4MJMA 1KM1A 3B0PA 1G4SA 1VLWA 2QCNA 4OV4A 1EA0A 1L6SA 1FQ0A 2QF7A 1QPNA 1WV2A 3L5LA 4O4WA 3SJ3A 1NFBA 5CGQA 2DORA 1YDVA 3P8JA 1K7EA 1XDMA 3PBWA 5F4XA 4LS1A 3FJLA 5A8GA 3TSDA 2WNQA 1OX4A 3TMQA 3PC0A 3S1UA 4Z1BA 2ZZ1A 8TIMA 3EKZA 3HQ1A 5D30A 3FKRA 5HNRA 5KZDA 1TCDA 2PURA 1TV5A 3LLFA 4JTEA 4M5PA 4O14A 3EWUA 3NVTA 2QCDA 3N9RA 1WA3A 3LTSA 4ADTA 4JYEA 3RFAA 4UIOA 1Z48A 3BW3A 2CZDA 2AQWA 3KVJA 1OFQA 4EOUA 4UNKA 1OK6A 4FNSA 3TR2A 2PCQA 3CU2A 1EUNA 1QDSA 1GQNA 3LTYA 1ZENA 2A0NA 2LLEA 4FB7A 1GOXA 1XBVA 4JYFA 5AYYA 3KX6A 4AWUA 1H1YA 3W84A 2OT0A 1VZWA 1LORA 4XBKA 4QISA 3TW7A 1M7OA 1TJPA 3G1VA 3M43A 2A7PA 1SW0A 4LY8A 2ZTJA 2ZRVA 1BEUA 4BR1A 3DFNA 3M1ZA 5BMWA 5D32A 3ABRA 3T7VA 2XN1A 1EP2A 4FXSA 4HSOA 4GC4A 1SR9A 2ZZ3A 3GK0A 3MYPA 4MYAA 2YZRA 1IGSA 1JCYA 2E77A 3STCA 3S1XA 3G8RA 3N19B 1SPQA 5CPLA 4YCPA 2A6LA 2VC6A 3UWVA 1JULA 1FDJA 2XN2A 2ZRUA 3VI2A 2I14A 2QCMA 3TQVA 4JTSA 2VEKA 1XI3A 2QUVA 3PB2A 1EP1A 3P80A 4NNAA 1G4EA 3FEMA 2ISWA 1AW5A 1QPRA 1UCWA 2DZPA 4NT0A 2NX1A 1Q6QA 3R2GA 1SFLA 1VPXA 4JTTA 4M6VA 1UUMA 3LCIA 1ICQA 3GDRA 1ZFJA 3WK3A 3CWOX 1NEYA 2WNNA 2V5LA 1OX5A 5U7SA 3C4UA 1F73A 1YPFA 4Q4KA 3CQ0A 1FBAA 2I9EA 3B03A 4K7VA 2WPBA 2UV8G 1LOQA 1H63A 3KVLA 4JDYA 2ISSA 4U4MA 4TX9A 4E38A 5HULA 2CZFA 4O16A 1YPIA 2QEZA 1ZHAA 4GXMA 4FNTA 1JR1A 4UUIA 4A3UA 5D2WA 4ALDA 4EF9A 5I3GA 2CW6A 3G3MA 4I7WA 2AAMA 3SR7A 3A5VA 3GYEA 3ATYA 1KLZA 4N02A 4JNMA 3L66A 3MP5A 1DORA 2QCCA 2TMDA 1MEHA 4LRSA 2HTMA 4IOTA 2Y7EA 1OF8A 1FUYA 3M5VA 3B06A 2Q3RA 2NUWA 2QCFA 2P0OA 3W87A 4BWLC 1H1ZA 4ZQOA 5DBTA 3LERA 4UTKA 2WSRA 4N6FA 3G8EA 4HSNA 3OVRA 1H51A 1SUXA 3GAYA 2E6YA 5G2WA 3E0IA 3E49A 5D2TA 3KFTA 4O1DA 3ZFHA 1W0MA 4NU7A 3TSBA 2Q8LA 2TYSA 3LHUA 4RXGA 3BVJA 4Y96A 3F4WA 3W70A 2VFHA 4XBSA 1LROA 1BKSA 4ORIA 1KM3A 4OWGA 1K7FA 3QM3A 3INPA 3N3MA 1XBYA 3TK7A 1JCJA 4JY9A 4O1CA 5LGXA 1ME9A 2B7OA 3DFTA 3MHUA 4PC8A 4LV9A 3HPSA 3IGUA 1TPWA 3P81A 3QC3A 4BI6A 1GT8A 1HG3A 4L4LA 6ALDA 4FEZA 3FYPA 3TQKA 3SIZA 4LS2A 4OQVA 3MMTA 2Q8ZA 3FLUA 1P5BA 3IVSA 1DV7A 3CT7A 5C6MA 2YFOA 5FEPA 1J2WA 2Z0IA 5K9CA 3TH6A 2EGZA 3S5YA 4UFMA 4O13A 3PSWA 4NX5A 1ZAJA 5K2ZA 3GB6A 3RU6A 4MFDA 4BK9A 2E6AA 1FWWA 3EWWA 4K6AA 4N9EA 3QSTA 3T4CA 3UXAA 2B0MA 2NWSA 4OBTA 4TR9A 4OGZA 4X3ZA 3LXCA 3THQA 4GUFA 1H50A 1C29A 3W71A 4FX7A 4N9BA 4UTIA 3SFKA 3NQVA 1N8FA 3E9AA 4IGHA 3R8RA 2ZA1A 3KRSA 1X7FA 1O95A 3QMTA 3IIPA 5G2IA 5F2MA 2FIQA 3W9ZA 3HGSA 2V5BA 1FCBA 2A7RA 1EPXA 3W07A 2NV1A 5BW6A 3UZ5A 2C14A 3HGOA 3CTLA 2V2HA 3PM6A 2CU0A 5FESA 1OFOA 2JKEA 3Q37A 4PL1A 2A4AA 4FX6M 3HBLA 1DBTA 5LGZA 3BLFA 5LNUA 5DXXA 1MXSA 4JTHA 1JVNA 4NXSA 1LTDA 5DCDA 4GUIA 3R89A 3MW7A 1KM5A 2RHGA 2ZZ7A 4X2RA 2DJXA 3GXTA 3VCRA 2Y6ZA 1ZALA 5K7JA 3W1PA 1P0KA 1U5JA 1DKWA 4Q32A 3WJSA 1XXXA 1K02A 4DO6A 1FWRA 3W7RA 3L9CA 4WJEA 5HWJA 1RPXA 5F1VA 1PCWA 3W22A 4NZFA 4HNTA 1XM3A 1TTPA 4UR8A 1VS1A 1O5XA 1QO5A 5D03A 4WX2A 3DFPA 3H53A 4KFNA 1VRDA 5CZTA 4RLIA 3G0SA 3VFLA 3M41A 3GKAA 3B04A 1W5MA 4K36A 5KITA 5D2VA 3SZ8A 4DO5A 1S5VA 2NWRA 5AHIA 2A21A 2B7QA 3ABSA 3VKJA 1TYGA 4UFHA 5AHLA 1BWKA 1ME7A 4DF1A 3W7IA 4CQ9A 2E1DA 1M5WA 5HINA 1B9BA 5E0KA 3S1WA 3I7SA 1UASA 4UTUA 4PA8A 3F03K 4C1LA 3BW4A 4JGDA 3HGRA 5LHEA 3JS3A 1W54A 3LXAA 3OG3A 1Z41A 2C6QA 4TMCA 1PIIA 2VELA 5AC6A 3LXBA 4ZL1A 3OEXA 1V5XA 2ZFAA 4M6QA 3QW4B 2GJNA 1RQEA 2CLMA 5MHBA 2YW4A 4QAIA 1R2SA 3IIOA 1C8VA 4LS0A 1KTNA 4M7SA 4Z08A 3NM3A 3M16A 3KHJA 3P60A 4K39A 2QCLA 3W73A 2P1FA 4MYXA 3WK0A 5EPDA 1KW1A 5F4SA 4PH6A 1J4EA 3BLIA 1FWSA 3C0JA 4P61A 4HPXA 1R2TA 2J88A 3W1TA 3IRDA 1D3HA 5I3IA 1JRBA 4UTTA 4NJGA 2Y7DA 4PEKA 2QJIA 3TU9A 1HO4A 2C13A 2F84A 4DQWA 4A21A 3W7NA 4N9CA 2BSLA 3N2XA 1H7OA 4RXFA 2X1TA 4IMFA 5F1UA 1KFKA 1QAPA 5BMXA 1F74A 5U4NA 4XWUA 2DU2A 1T99A 1RVGA 3PR2A 3DBPA 2NUXA 1T8XA 4KKXA 3EX4A 2EPHA 3EKLA 3L65A 3CC1A 4D2JA 3LHTA 1KLYA 3W1QA 1M7PA 4P2VA 2Z6IA 4R7JA 3B05A 5FEWA 1Q3NA 3PUDA 1V7YA 1GVSA 3TV8A 1OFEA 3G1YA 3IIZA 1NF0A 3LX9A 2QAPA 1OFPA 4LVDA 4GE8A 1DQWA 1YDOA 1QMLA 5K4ZA 4XKYA 4IMDA 1FCUA 3NQ8A 1RD5A 1OFDA 3LCHA 5HR7A 5DLCA 1J5TA 5G4WA 3NM1A 1F7BA 4JX5A 4NXKA 3UQNA 1L9WA 4FNQA 3NQ6A 3ZR4A 2EKCA 1IIHA 4M19A 1DVJA 3TX9A 4YLWA 4N9DA 3NDOA 5T26A 4AHOA 1PHQA 3G24A 2A85A 1Q6RA 2NZLA 5HQEA 1A5BA 3LHWA 2AGKA 4FNUA 3H54A 2O7QA 4ZVJA 2G96A 2QDHA 4TU1A 1JCXA 4MPQA 1TIMA 4UC5A 3PF3A 1OJXA 4S2CA 3LCLA 5J5DA 2QDGA 2PRHA 3DKLA 5G2HA 4PODA 5CSRA 4JY8A 1G6CA 3C2RA 4AXKA 2VOMA 4I7UA 1FWTA 1WX0A 4MY1A 4IQLA 3W7KA 1A53A 2QUTA 2ABBA 2IQTA 2CLEA 2RDWA 1OABA 1LM1A 3TMLA 2H3BA 2DZXA 4MVAA 2YXGA 3W2JA 2C19A 4Z0JA 3EX3A 2ZRZA 5I3HA 1D9EA 1EX5A 2NX9A 1TTJA 1ZAIA 2Z2UA 1YTDA 2C3ZA 1KV8A 4O18A 3L0KA 1VYPX 3L21A 5D37A 1VH7A 3HO8A 3MHFA 5HWMA 2GQ9A 3HPXA 5BNKA 1WAUA 5LNWA 1EP3A 1KV5A 3DFOA 3GDKA 3LHYA 6TIMA 4K38A 5EYWA 5G1YA 2A1YA 4FNRA 1XDLA 1IXOA 3CIWA 5CPMA 1PS9A 4WY0B 4OE7A 1XUUA 1ICPA 4YWIA 1T96A 1EUAA 2V2DA 1LZOA 5FF3A 3TFXA 3MP4A 4KWWA 4WXZA 3C56A 1FDYA 2HMCA 1EB3A 3MI3A 2J9ZA 2E68A 2VENA 3WK1A 4AAJA 4AEOA 3RMJA 3M0ZA 2ZZ4A 2NXGA 4X9SA 2YX0A 3U8GA 3BG3A 4CNNA 2QJHA 1BTMA 4RK8A 2YYTA 4R34A 3NG3A 5AHNA 3GZ3A 1XBZA 1YDNA 5CG7A 1MO0A 1WXJA 3T44A 2WOQA 1QO2A 4NX0A 3W7CA 2TPSA 3D0CA 1VR6A 3HG3A 1TB3A 1X1OA 5AFDA 1OG0A 3TAKA 5HWNA 3P62A 4JR5A 2QUUA 4MJZA 1TRDA 3QMRA 3NQGA 3W1AA 2Y61A 3TQ0A 2FPYA 2Y70A 3AO0A 3W1MA 2WNZA 4O1BA 1W31A 5KMYA 3EXTA 1PE1A 3N34A 4FO4A 4DEFA 3NO5A 1K8YA 4A22A 1I8JA 2TSYA 3CWNA 4NNCA 3CPRA 3I7RA 2CLIA 1AK5A 1OYAA 4BWLA 4IMCA 1I4NA 2E09A 5CSSA 2FDSA 4ZMGA 3GR8A 5K9XA 1H5YA 4ORMA 3GLCA 3PG8A 2ZTKA 4MY8A 5IM51 4S1FA 1HO1A 3GDMA 4KFOA 1TMHA 3NNTA 4HNNA 4E2DA 2FPVA 1TPFA 3WFAA 4FF7A 3FOKA 2XFWA 1S5TA 4JTGA 4OV9A 1VQTA 3W7OA 1UBSA 1AW1A 3TDFA 2DZSA 1VCVA 4ZQRA 3NZRA 4GRSA 2DZVA 3HIJA 5FEZA 5H2ZA 5GVJA 3PUEA 1QNVA 3TROA 4UFJA 4JICA 4YXGA 4QIUA 3DI0A 1G4PA 4XUGA 3FFSA 3LBCA 1Q6OA 2H8ZA 2Y85A 1SFJA 1JQXA 4JXCA 1ZAHA 3RLVA 2GVJA 4ADUA 2QCGA 2X2GA 1VCGA 4HNUA 4JEQA 3W6YA 3CLMA 4UXDA 1F6PA 4IJBA 2V9DA 2CZ5A 3W2NA 3BPWA 5D09A 5F2LA 3HPZA 3UWUA 1NVMA 3G3DA 1D3GA 1QOPA 3P74A 2C18A 4LU0A 1UUOA 1OYCA 1A5SA 5C2XA 4MIMA 3W86A 3W23A 4B5NA 3O6DA 1H60A 3LTPA 2YGYA 2WJZA
chains in the Genus database with same CATH superfamily
4HOXA 2J9XA 4LAMA 1TKKA 3PWGA 1OFBA 4IIEA 4RPPA 3RXZA 3SM0A 4PMQA 5EMYA 3P8IA 1JPHA 1IXQA 1SO3A 3MA8A 4HIBA 2CITA 4JTIA 1UB3A 1I2PA 3MPGA 4GO9A 5M5DA 4WEVX 4C7DA 4GUHA 3U7BA 5LNVA 3BSMA 1C7TA 4PCSA 1AJZA 1GVRA 3IJQA 3W7EA 4BI7A 5LNSA 1HW6A 1J79A 2JF7A 3E2QA 3GXNA 3ITYA 4WSKA 3WUEA 3ARZA 1KXTA 3MVIA 4S38A 4DNMA 2J4GA 4S2BA 4IMAA 1HJSA 2VX5A 3VD4A 2FZ9A 1JJKA 4F4RA 3ARQA 5I23A 2RKXA 1UD6A 4UZUA 3VMNA 5B7YA 3WQ8A 4DXXA 5B7ZA 4O10A 3AU2A 3F4VA 5EL1A 4J3ZA 1UOZA 4ERIA 4QE4A 3VZZA 3SN1A 4UQAA 1MQQA 1PIGA 1MSSA 4JHMA 2CHOA 3MDWA 2JEPA 2QF8A 2YL5A 1UD2A 1IZJA 1HJXA 1LYXA 1XF0A 1A5MC 2A3HA 3DENA 3L4ZA 1FXPA 3BK0A 5A5WA 1RY0A 4F0MA 3RM8A 1BYCA 4R7OA 3AS1A 4KEMA 4LVAA 4CNOA 1P48A 3NFUA 3O7UA 1RALA 2X05A 3DIPA 2V5CA 3TW6A 3RX3A 1ADDA 5CAKA 3VMOA 5AYBA 3SQSA 4DWSD 3GO2A 4Y7EA 1KBJA 3LNMA 2G4FA 3FVDA 3FSTA 2P8CA 3GW3A 4GG9A 2D69A 2ACUA 3TCEA 1LT8A 4W93A 4V28A 1ISYA 1RCXB 1V6TA 3HU7A 3UR7A 2F7FA 2ACSA 4HHPA 3DG7A 3A9IA 4ZODA 1KFBA 2ZUMA 4Z2HA 3GR7A 3PG9A 5A6TC 2ZE3A 1TPUA 4TVDA 4Z2LA 3NQ7A 4PUJA 4RE0A 1TWSA 3N14A 5XIMA 4Q6JA 3ANUA 1CNVA 2XVNA 1J18A 3F4CA 4LUTA 2GJPA 2Y7FA 4C6FA 2CETA 3UY7A 1OZQA 2J75A 2OU4A 1XLKA 1Q66A 1OFRA 1KKRA 3EEGA 3F1QA 4LBRA 4XD6A 1GYMA 2VTFA 1OSEA 2VD9A 1SQ7A 3L4XA 2VMFA 2OG9A 2Z2BA 2DSUA 4QDMA 1ZJAA 3KRUA 1LL4A 3OZOA 3UVIA 1FH7A 3RCNA 3BG9A 3EXSA 3O05A 3GW0A 2AAAA 3W7DA 1POJA 2ALRA 1R3SA 7TIMA 3QKZA 3PJXA 2BBFA 3LA4A 5JIPA 4KS0A 4H9MA 1RBLA 4P8VA 3B4UA 5CC7A 1R9YA 4AQLA 4C91A 4E8CA 2IXUA 4GXPA 3QMSA 3K1DA 2BDQA 1FWJC 1K8ZA 3WEMA 3NQBA 2QYGA 1WBHA 1ITCA 5TBOA 2YA1A 1BVZA 2VGFA 4LF1A 3M0JA 3OLEA 4O1AA 4NZ4A 4EAMA 4KH2A 3UA3A 2Z24A 3C3NA 4Y8FA 5I09A 3OBAA 3C2FA 4LUSA 4E2BA 3IWPA 2FGBA 4TTGA 3SQLA 1QPQA 5A2BA 1ZRQA 4WY0F 1TPH1 1OQFA 5L9FA 4W8LA 1K7XA 2IPWA 1LJYA 4FZIA 2Z7GA 4JN6A 3QEZA 4DLMA 1EEXA 2C16A 2OKOA 3OVQA 3T40A 2HS6A 1JUEA 4H6QA 4Q33A 1VFHA 4TTUA 4EX4A 4KQNA 4MFEA 1J2BA 3L2LA 3HG5A 5E0FA 3RITA 4IXXA 5AN7A 4LPCA 2FZ8A 3TJLA 5M17A 4RE4A 3OB8A 5ABHA 1A4MA 2X1RA 1AL7A 3DHPA 3EB2A 4K8GA 3L0NA 4Z1DA 3MSGA 2O4QA 2PLJA 4MKSA 1G9HA 1K03A 1CXHA 3ANYA 2NQ9A 2VWTA 2PDPA 4AYSA 1VBJA 3MI6A 4HN8A 4N6EA 3I6TA 4RPQA 1MUCA 5T8GA 2W67A 1JNDA 3EB3A 4G7EA 3WLTA 1OVDA 1CB2A 1BXNA 2ZXAA 1J6OA 1JPKA 1K3UA 2DZWA 4DF0A 1EYWA 3QZEA 4W87A 2R14A 3FXYA 4UMAA 5DXYA 3W26A 1B3ZA 3MCMA 4J2PA 5E6YA 4PBEA 2JF6A 1U22A 1E5NA 3ZMRA 1QPKA 1TO3A 4LALA 4RV8A 3D5HA 4C6NA 3ZJ8A 4GQBA 3IANA 5G4EA 3ZJ7A 3R12A 3DXIA 2HBXA 3BV4A 3USBA 4BA0A 1RK6A 3WQVA 3UGRA 1A49A 7TAAA 1XQKA 4ZOCA 4RZ5A 1GQLA 1A5UA 1UWRA 3BLOA 3G1DA 2ATSA 3GHUA 4V2XA 3AHVA 2BGNE 2GUBA 5DMLA 4D6EA 4DUXA 4R88A 1MDLA 4H7ZA 1SZFA 4D1JA 3W7HA 2E28A 1LRTA 2INZA 1XCFA 1ITXA 1JUKA 4WXYA 3GC5A 1V77A 2BASA 2J7EA 1RP8A 4MJ2A 2C0AA 3CYJA 3PPHA 2BXVA 1VFMA 3S8HA 1N7KA 1AVAA 4GQGA 4F66A 1A5AA 3BGGA 4XZHA 1AMKA 1V3MA 4O52A 2YBUA 4O1FA 1F5ZA 1JPDX 1EIXA 3EOSA 3UP8A 3NQFA 3WDJA 4UFKA 1TPEA 2UY3A 3C2VA 3CUZA 1VF8A 1J12A 3OZMA 1CW2A 1B3XA 4JDBA 3L0GA 2HPMA 4UWMA 4GGHA 1GG1A 4JQAA 1M04A 3DKJA 3GBEA 2Q8XA 1W3IA 1F2JA 2FMOA 3PZGA 1F07A 3OO2A 3VNYA 2V0TA 3LI1A 1WB0A 3J7HA 1MEWA 1JEZA 4R3UA 3T78A 4D6FA 1HL2A 1L8NA 1TWIA 1X8FA 2P53A 3VGHA 3MBDA 2VC7A 3OP2A 3WD1A 2G95A 4JIIX 4LC6A 3N13A 1CT5A 2RDTA 3LI0A 1IXPA 2DJLA 3URNA 4JOMA 3HJEA 4MLRA 3GC4A 1GEHA 4CNPA 3GDBA 2BWGA 3PPFA 5CPQA 3K8MA 4HNCA 1UC5A 3RHGA 2RFGA 1PX4A 4A2RA 3BH4A 1EBGA 3A4WA 3W3OA 1ECEA 1JDDA 1TPB1 3NQDA 1XIEA 1OK4A 4PUWA 3O6YX 4G2DA 2Z6JA 1CLVA 4PRRA 3LLDA 2XJ7A 3NPUA 1QWGA 1O94A 1SMAA 1TA3B 4REQA 2P88A 1XLMA 3GNXA 2WW5A 3RK8A 1TUXA 1CCWB 1DJQA 3WD0A 2DH2A 1EWDA 3DAQA 3AJXA 3C8FA 1KWGA 1EXPA 3M44A 2JALA 1SR0A 4RJEA 5HMDA 5HMFA 1L8PA 3A23A 4WD0A 3LCWA 2XIBA 5I24A 2ZQ0A 3IK2A 3RNDA 1GUVA 4N42A 3W37A 1HL8A 2PTYA 3OGRA 4HA1A 1XC4A 2YCJA 3AROA 1HX0A 3VK5A 2R9RA 3D3AA 4QLKA 3VKBA 1AMYA 1WDRA 4C6DA 5G1TA 3AYVA 5C54A 1HFBA 1YEYA 2YFNA 1AW2A 1ZY9A 2FLIA 4XZLX 2PGEA 1C9WA 1PVNA 2BX7A 2WANA 3A4AA 2GYIA 1GZGA 4NAEB 2WO5A 3UPBA 2C8NA 2YPIA 4ZFCA 5A6JA 3F4NA 3D46A 5C9RA 3PBYA 1PUDA 4IPIA 3IGSA 1SW7A 1U83A 1EFZA 5GNZA 4LCRA 2CLLA 4AD3A 3T0BA 1QCWA 3R1ZA 3H26A 3QHNA 4IPJA 3DERA 4OT7A 4Z1AA 1MFVA 4TX6A 3ABQA 4NJHA 4KCUA 3WNOA 3TC6A 4H6RA 1I2QA 4D8AA 3IIXA 2XUCA 3BOFA 2FPTA 1TR9A 2YOCA 1YTEA 3WLRA 3USZA 3W2KA 1F05A 1UPMB 2VR4A 3VM7A 1YLVA 4XB3A 3FJ6A 4MUZA 4LY4A 3L5AA 5H8PA 1W6TA 5CC6A 4P8UA 3ZJ6A 3AXKA 4US6A 2O4MA 4QE1A 5FI8A 1QOQA 1E4MM 3PBMA 1E9IA 1JQVA 4DPPA 3B4YA 5AVNA 5GJPA 1RBOB 2Y7GA 4IUOA 3FXGA 1XH1A 4PTNA 1G67A 4Y6GA 4XIAA 4Y9AA 4ZBCA 3VE7A 6PTDA 4YVVA 2DSVA 4OJYA 4US5A 3HMJG 2YBTA 1DL3A 1JCMP 3DEQA 2W0UA 1TRIA 5D38A 4E3VA 4GINA 2AQVA 1GPFA 1MEIA 1LOSA 1F6KA 4JHZA 1KTCA 2EJAA 1TE1A 1JYXA 1R9ZA 3LN3A 1H7XA 3LGGA 1SZNA 1TIWA 2HPIA 4K8HA 3V5CA 3IACA 2WCSA 5A94A 3W2LA 1NARA 3PVFA 5CLWA 4WY0A 2AMGA 5D2YA 4AIOA 1RH9A 1A50A 3W75A 3TIMA 3KBJA 4H2HA 4XG1A 1Q6DA 4I7VA 1E40A 3G0XA 4AZBA 3UY8A 4GYPA 1VCFA 3FDKA 1ISVA 3K1GA 1UBPC 3P82A 3QF0A 3NZPA 5FJIA 4JFUA 2OSXA 2FB2A 3S5OA 4QSHA 1N2VA 3L23A 3C2EA 3WD4A 5HR6A 4HZ8A 2QJGA 4LTSA 3IVUA 4QDWA 3CXOA 2FHBA 3QR3A 2GLKA 1Q63A 3YPIA 4IUGA 3MWAA 1ZL1A 3EX2A 1KRAC 1BLIA 1AD4A 3GXPA 4EPKA 2QR6A 1V08A 3WY1A 5FA5A 1E6NA 1A0DA 4JIEA 3W82A 2BY1A 2PC8A 3O06A 3QR0A 4AF0A 2Y88A 3NZ1A 2WQDA 1UMYA 4DNHA 1PYMA 2G4JA 2WQPA 3NXLA 1NDZA 3H6OA 3W85A 2HROA 3EWYA 4FOUA 4U28A 2WM0A 1XJBA 4XX6A 3LSBA 1GVFA 5H8MA 4JX6A 4YTSA 4JN8A 3K46A 5LZLA 1DHPA 3CT2A 3N6QA 1K9FA 4AZIA 3NPWA 2W63A 2VX7A 2VGGA 1CWYA 1HVQA 5JMUA 2DV0A 3SRKA 1WKYA 2RH9A 5BXTA 3C6CA 4LUIA 4XAZA 1TREA 3VOJA 3MUCA 3PNUA 4MUPA 5FL1A 3PWAA 2W9MA 1RJPA 1SFSA 2B4GA 3ORWA 4LUJA 5CGTA 4GI8A 4FX8A 3G1HA 5ABTA 1Z9AA 1IT0A 4KBXA 3KVMA 1R87A 1ISWA 3WUFA 2R94A 4TIMA 2DQWA 3T05A 1R3TA 3AU6A 4U3CA 3UWYA 4V15A 4Q8QA 4GIEA 4Z0SA 3ERPA 4ZZ9A 3RLUA 4WDUA 4FIQA 4QG8A 3AI0A 1FWHC 1E1CA 4M24A 4HU4A 3CBWA 1TTQA 1BAGA 2VDHA 1XKJA 2QCNA 2QF7A 3PPGA 3SJ3A 5CGQA 1GW1A 2WB5A 4JCMA 1EJWC 4HHLA 4LS1A 4D8LA 1CXIA 4MJ4A 5DT7A 4PUKA 3N04A 1N8IA 5HNRA 1GOKA 5KZDA 3SUWA 2PURA 3U48A 4RW3A 2C7FA 3N11A 4O14A 3JZEA 3NVTA 2QCDA 3ARXA 1W1VA 3LTSA 4I5XA 4ADTA 4JYEA 1JAEA 3CHDA 1UP3A 2PDXA 2FYMA 4IL0A 1SM9A 4B3LA 4PBGA 4AZCA 3BAYA 2J7FA 4LUTB 3CU2A 3EOOA 4NL1A 4B90A 1QDSA 1GQNA 3EPMA 1ECQA 1JDCA 2PTWA 4PUDA 1XBVA 4JYFA 1OADA 1WAWA 4P5UA 2OT0A 3WLSA 3VOCA 1E5JA 5ENLA 4B5VA 4QISA 1JDFA 1TJPA 3G1VA 2QXWA 1V6WA 3N4EA 1UZ1A 3WLKX 3CQKA 1KQYA 1SW0A 4LY8A 1BXBA 2ZTJA 3JVAA 4NZ1A 4Q4RA 1IR2A 3DFNA 1XYLA 3BXWA 5BMWA 5D32A 3T7VA 3FA3A 2OODA 3E0LA 3TOYA 4HSOA 1X98A 1SR9A 3GK0A 4MPKA 3MYPA 2E77A 3STCA 4BQ4A 3G8RA 5D9OA 3TN6A 1SPQA 1F8IA 1VBGA 3UWVA 5C0QA 3HPAA 3IK4A 1W91A 1B0IA 2YBVA 3GH7A 2XN2A 4WHBA 3WLNA 4JNYA 2ZRUA 3HQNA 2WBGA 3REQA 2VEKA 3P80A 4J27A 1SYTA 4AC7C 4P8WA 1G4EA 3WNKA 1KCLA 3FEMA 2ISWA 1PXGA 1YE4A 5HMEA 2VZUA 4OECA 2DZPA 1MUMA 3R2GA 1MW0A 4M6VA 1UUMA 3GDRA 2E9LA 3AALA 4DAFA 4LUSB 3C4UA 1F3EA 2OGJA 3CQ0A 1ONEA 3UBPC 2WPBA 3P0WA 1NFPA 5HULA 3SUTA 5JH1A 2I9UA 1ZHAA 2DIJA 1LWIA 5XIAA 2Y5EA 1OIMA 4X60A 4S3CA 1TWWA 4EF9A 4B4HA 4D9PA 2VEGA 3VD7A 1IEIA 2ZVRA 3G3MA 4FALA 7CGTA 3SR7A 4B4FA 4AXNA 2R1MA 1EYEA 3GYEA 1K6AA 1KLZA 4HCLA 1CTNA 2V3EA 3UZXA 1DORA 1F6YA 4HMCA 4DI8A 2NVAA 1GQJA 1CGTA 1OT1A 2V5JA 4XD5A 4V27A 2FH6A 4MSSA 1FUYA 4BWLC 3W87A 2QCFA 4MHBA 3VOIA 3G8EA 3OVRA 5FD0A 3HPFA 2CLPA 2ZKMX 3C5QA 3S6OA 1W17A 5G2WA 3ZFHA 1W0MA 4G7EB 2WHMA 3TSBA 1RLCL 3AJ7A 1JIBA 2PDIA 3BVJA 3FK4A 4RXGA 1XLDA 4Y96A 3WD3A 4TQTA 3W70A 2VFHA 3II1A 4OWGA 1TUFA 5CXPA 2HNHA 3N3MA 3TK7A 1IT7A 3DFTA 4PC8A 4UR9A 2GWNA 2HV5A 3HPSA 3GTHA 1H49A 4YVXA 2RJHA 4L56A 3WQPA 5EBAA 4BKNA 3MMTA 2Q8ZA 3FLUA 5I77A 1QRQA 4WJ8A 1DV7A 2QULA 1J2WA 3ARSA 1H4PA 5BRQA 4UFMA 4NRRA 5K2ZA 4MFDA 4BK9A 1AZ2A 2WXDM 2D1ZA 4K6AA 1XPGA 3GVWA 2Q01A 1UJQA 1GK8A 2NWSA 4OBTA 4X3ZA 4EXAA 5LA2A 1H50A 1C29A 1EXBA 4GNVA 1WDQA 3LG3A 4UTIA 1HXJA 3NQVA 1N8FA 3E9AA 4S3JA 4WDXA 1O95A 3QMTA 3IIPA 1UHVA 1WUEA 3HGSA 2V5BA 1P0EA 4AEFA 2W3ZA 1E9LA 1JG9A 4TVCA 2I57A 4LSBA 4OUIA 4F3HA 2JKEA 3Q37A 3G2GA 2A4AA 1FWIC 3VKKA 1QTWA 1V6YA 1T41A 4M80A 4IG2A 5LIUX 3BLFA 3UETA 1Q5MA 3LPFA 1EJSC 1XLHA 3IJLA 4FP1A 1K1DA 3TCSA 1LTDA 2RHGA 2ZZ7A 1JDEA 4F8XA 3B9EA 1X6LA 5K7JA 2OEMA 3LPOA 3THDA 1V0KA 1EDGA 4DO6A 1TZ9A 2QVHA 4WJEA 1OWQA 4XAFA 1RPXA 1UZHA 5FOOA 5CLTA 1VS1A 3LZ3A 1O5XA 4W84A 3H53A 5CZTA 4Q4PA 3LSCA 2IQDA 3G6MA 2VZTA 3GKAA 5DO8A 5D2VA 3T0AA 3GNRA 4ASTA 2A21A 3VKJA 4UFHA 4K2SA 1BWKA 3A6OA 4JEJA 3U4AA 5E0KA 1UASA 2XGIA 4PA8A 4C1LA 3CK5A 4KRTA 4ZCWA 3HGRA 2JFEX 4GGBA 4AEEA 1W54A 1PIIA 3ITTA 3OEXA 4M6QA 3QW4B 3V0UA 4REQB 4YIWA 2GL5A 1R2SA 3IIOA 1C8VA 4LS0A 1JPIA 1XYBA 3KHJA 2IW0A 4LUYA 2BHUA 3A13A 3H7VA 5EPDA 2UBPC 4P7LA 4PH6A 3EOEA 5HQLA 6CGTA 3H2NA 1R2TA 1VIZA 3B9NA 1JRBA 4UTTA 4NJGA 2XWEA 1FWFC 4U31A 2WC3A 2VWSA 2MUCA 4C6PA 4H8NA 4OOZA 1CGWA 2PB1A 3DG6A 4N9CA 2YL6A 3EKGA 3N2XA 3PZUA 4XD4A 3TLQA 3WMSA 4PTMA 1KFKA 3WH6A 5U4NA 2I7GA 1J01A 1EZWA 2NUXA 1T8XA 4ACYA 4DJED 4GCAA 2VO5A 2ACRA 1R3WA 1KLYA 4O8AA 1M7PA 4TVUA 1ISZA 1YQ2A 1Q3NA 3PUDA 4H9YA 5I2UA 2YA0A 4IJRA 1BVNP 2YXOA 1NF0A 1T7LA 1U5HA 4ATWA 1YDOA 1QMLA 4KWSA 4XKYA 5GPRA 4CNSA 4IMDA 1FCUA 3NQ8A 2AKMA 5DLCA 1J5TA 5G4WA 1F7BA 3NQ6A 3TWBA 1O12A 1E0UA 1IIHA 2WC4A 4TV6A 1EGZA 3WF1A 3W24A 1VFUA 1TFVA 1HT6A 5IRPA 2BGQA 4HHMA 1JGIA 1QK0A 2NZLA 4JNZA 1KKOA 5A6SA 2BS9A 3TYCA 2QDHA 4TU1A 3M07A 1JCXA 3SCTA 4HYVA 3LCLA 1HKKA 4XO6A 2V5KA 1NIUA 4YS1A 5CJ5A 4L6OA 1EIBA 3CYVA 4JY8A 1G6CA 1Z6KA 1FWTA 1WX0A 1XLJA 1XSKA 3W7KA 3IJ6A 1KQZA 3RJXA 2PU1A 4C5ZA 2ABBA 1J6PA 4XO7A 3UEQA 2RDWA 3O9NA 3BAJA 2YXGA 3W2JA 4Z0JA 1R3RA 4RZBA 1FWDC 4B91A 1MFUA 3BMWA 3GTIA 1D9EA 2P50A 3SCWA 2NX9A 2PD9A 4LH8A 3WUBA 1OC6A 2XVPA 2X7WA 1V3JA 4GX8A 2PDBA 3L21A 2A3EA 5LXXA 4UB9A 5D37A 4EXQA 2WWCA 4DY1A 5BXSA 2GQ9A 5FJJA 1MVYA 3KBSA 1KV5A 1Q7QA 3GDKA 5M3WA 2J6VA 5G1YA 2PMQA 1R6WA 1PS9A 3SFWA 4WY0B 4OE7A 3AZRA 4HCHA 1T96A 4DJFA 2A3LA 1QOXA 3MP4A 1PZ3A 3TFXA 4I9MA 1FDYA 4PMVA 5LIWX 4PMRA 3JW7A 1M65A 4DLFA 5CPSA 2ZZ4A 1ONXA 2JEQA 3HV8A 2FGZA 1BTMA 4MB1A 4QGCA 4A3RA 1PDYA 5GNYA 3VCCA 3BE7A 3VTRA 1MO0A 4IQEA 4L64A 2WOQA 2VUYA 3W7CA 2TPSA 2DIEA 1E4NA 2OYMA 5HWNA 2EEXA 2HNEA 4JR5A 4J3UA 3VNIA 3QMRA 3EPOA 1RHCA 5TF0A 2WK2A 3MUY1 3OVGA 3W1AA 3BOLA 3NTYA 5FKYA 2Y70A 3R25A 1XQLA 4R9XA 1PIFA 2AQOA 3EXTA 1LQAA 1PE1A 8RUCA 4M81A 3RU8X 3ZT7A 2PLKA 2WJFA 4KERA 3M0LA 3CPRA 1OYAA 3AIQA 3M0KA 4UTFA 2P76A 4ZMGA 3GR8A 5K9XA 2YCIX 4ORMA 1K9DA 1A3HA 3S83A 2ZTKA 1HIZA 1XIFA 3AYTA 4S1FA 4JFVA 1TMHA 5ABFB 4JIRA 5FL0A 2FPVA 1ZGDA 4Q8PA 3SY8A 2O9PA 1GZJA 1J5SA 4PULA 1UBSA 3TDFA 2DZSA 3LQGA 2J8FA 1W1YA 1CENA 2DZVA 5KZ6A 4W86A 5FEZA 5H2ZA 5GVJA 4UFJA 4JICA 2P3EA 4QIUA 1TCMA 3FFSA 5F7UA 3LBCA 2H8ZA 1PSCA 4PTVA 1NQ6A 1OD0A 3IJ9A 4KEZA 4HNUA 3MS8A 2WZHA 2GQ3A 4IJBA 2EG6A 2G3IA 3W2NA 2VDIA 1KXQA 2BXYA 3HPZA 3U3HA 3UWUA 1NVMA 2PDHA 1DWJM 4H9TA 3BAKA 2CPUA 4OKDA 1DIDA 1OG6A 3BMVA 2C1IA 1PAMA 1TX2A 3QQWA 4PMJA 2HJPA 1H60A 1QVBA 2YGYA 1ENUA 4JTCA 2ZA2A 3GDTA 4Q8WA 1AFSA 4HZMA 1K70A 4QCFA 2JGYA 1M01A 1TPVA 2PTZA 1SW3A 3C52A 2A3CA 3UWQA 3VC5A 4J3XA 1DWHM 3OW1A 2ON3A 1B5TA 2F2HA 3ME3A 1AH0A 2X30A 3JU2A 2XSAA 1Y0EA 3QGVA 3LCFA 3KOYA 2PODA 2XN0A 3OOQA 2UY5A 1I9CB 3WLLA 3HJZA 3IVTA 3SI9A 3ZO9A 1GTHA 1EQCA 1LRNA 3H55A 2HEJA 1AODA 4QQ3A 4AZCB 3WO8A 3LV5A 3PPCA 3E5PA 4PMYA 5EU9A 5A8OA 1QFEA 3FCPA 8XIMA 3G6LA 3A3WA 3E2VA 3UWWA 3IUDA 1WOAA 1BQCA 2ZRWA 2B7NA 3GX9A 4V1YA 1ZTVA 3P5ZA 3B9OA 3PS7A 4FS9A 3H2FA 4JTUA 3VIMA 3E12A 5GJMA 3WJXA 2ZA3A 2EPOA 5BWFA 5EMMA 2WVUA 1G7VA 4HYWA 1YNPA 5HPCA 3BW2A 5LHFA 3ES7A 4GMEA 2WC7A 3KE0A 2HSAA 3OU8A 5LKYA 2XSBA 4Y8EA 1E6RA 4IQJA 4IFRA 2WSKA 2OWWA 4LVGA 4DJDD 3BL3A 1FWBC 1KCXA 2VEFA 4UCFA 1VJZA 1LUCA 2A6NA 3AAMA 4ERAA 4MZ8A 4MLJA 4FLQA 1SZGA 2J78A 4HGXA 4DB7A 3NYZA 4CQ8A 1F3WA 2WZTA 4PCTA 3CZEA 4KWVA 2YYUA 2OZ8A 3REQB 4ILSA 1OGBA 1QNQA 4E8GA 4L1WA 2ZCGA 1LLZA 4LNYA 2VFEA 3ZR6A 3T08A 1FX6A 3TONA 5BYWA 5HXMA 3VNLA 3DFYA 3TZFA 2JKAA 1GVYA 2XIQA 3ELFA 3V1HA 3UPMA 1XIMA 4ZOBA 5M1TA 2VP8A 4S3KA 4HK6A 2YLLA 4BZYA 3L5MA 3S5NA 2OKTA 5BOOA 2E8YA 2ZZ5A 3MUZ1 3W88A 5FF2A 2HQAA 4LB3A 1KM4A 4CEUC 4KCWA 2PDUA 2KX9A 2VD8A 3DHDA 5AZ0A 2OJPA 2OPJA 3FYOA 4FNPA 4EAYA 1PZ2A 5D33A 1FP9A 1ITUA 4C6LA 4YNGA 4AY8A 4XTDA 4CQAA 3RJYA 1XYZA 1ODZA 4W88A 5F2IA 4O15A 3UCDA 3QRHA 1DJGA 2XPKA 3TA6A 2FZBA 2QGHA 4KCVA 3O8AA 4UQDA 3T42A 4JTFA 2YR1A 5DCBA 3RCMA 2PDWA 1QHPA 2GSHA 4RR4A 3U2OA 2FB3A 2ZICA 1U2YA 1ZS2A 1Q6FA 3CIVA 2VOTA 3CHCA 4RL3A 4GYJA 4WVXA 1W3NA 4R9OA 2PS2A 1EOMA 4ZQNA 3VKDA 4XBJA 3K8KA 4Z17A 3OYXA 3WSUA 2P5NA 3T6CA 2A7NA 2JK2A 5HMSA 1RR2A 2YLAA 5REQA 3FGCA 3T8QA 1S2UA 4LAKA 1NDWA 3NCOA 3W1LA 4UOZA 1WOBA 4GYPC 3U2CA 4LVFA 4DBEA 3MZNA 3FHAA 4F0SA 3MYOA 2DSZA 3P84A 4MNMA 1WKDA 4AWEA 1ZP3A 3URAA 2FTYA 3EDFA 2CYGA 3D6NA 1R85A 1A5CA 3ZLHA 1Q8AA 4ICNA 5A6KA 1WO2A 4I5UA 5HAOA 7ENLA 1WKFA 3S3GA 4NZJA 1GEQA 2NX3A 1DWIM 3RCYA 3PJWA 4O53A 4HKPA 4J7RA 2DZUA 2G3NA 4MNJA 4UQ9A 3CZJA 1A5OC 2ISVA 3RG6A 1TVPA 2X41A 4HZ6A 1UG6A 3N9SA 2X8RA 3CB8A 2VCBA 4M0XA 2GK1A 4IT1A 5C7VA 1ZPTA 3KOXA 4NG3A 3TUUA 4IG2B 3GUWA 4EF8A 4XZ9A 4XZWA 2MANA 1DJIA 4S23A 3EWDA 1M7JA 5J5RA 1XIIA 2Z25A 2H90A 2V2CA 4H6EA 3AXHA 4J3TA 3TFCA 1Y65A 1UQYA 4W9TA 3VAVA 4C1NA 5I3FA 3H4GA 4Q8MA 1R3YA 1UH3A 4U33A 2ZC1A 2JBMA 2FTPA 2ZE0A 3NQCA 4R53A 2YW3A 3BCJA 4Y9NA 5D8ZA 4UMCA 2AL2A 1X7IA 2RDUA 3P3BA 4I9AA 4DBUA 5TIMA 1FWAC 3TYDA 1IIGA 1E6XM 1XIGA 1CB7B 2EO7A 4H6KA 4JIPA 4HA3A 3O63A 2GJRA 2IPGA 7A3HA 3EWBX 1VC4A 5EMUA 3CL7A 3ZOAA 3BAIA 2PWUA 1G7UA 5CBIA 1UKOA 3HB9A 3GM8A 3TN3A 2QPUA 1WDSA 1KB3A 5CPNA 4JQ3A 2D24A 1MDRA 4MMWA 3T4WA 2O9TA 2R1LA 3RX2A 5TNVA 4WOQA 2YCKX 4UMBA 4H04A 1BTCA 3QV9A 3KCOA 1E71M 1RA0A 1KM2A 2AKZA 3VDCA 3CGTA 3GHRA 3DZ1A 5FCZA 2QCHA 2BG5A 3S0CA 1EX1A 1E73M 1JD9A 2C1GA 2X42A 1BHGA 2GPTA 2DZBA 1EKOA 2TAAA 2HS8A 8XIAA 4BQ2A 2BFGA 3NWRA 1RXOB 2CC0A 3UCQA 1R3VA 4P7NA 4FLOA 4HMEA 4KWUA 4J9JA 4C7GA 2VEIA 2WVTA 3A21A 1XLAA 4YYCA 1D7KA 3P6LA 4DWSA 4C6BA 1SU5A 1T0OA 4MOZA 3LMYA 4YN5A 1DJNA 2PLCA 1O68A 3CV6A 3ITVA 3OIHA 2B7PA 1H62A 2PGRA 2X1SA 3QV6A 3BAXA 3QC0A 4YTQA 3QY7A 3C61A 3UWEA 3WBYA 4GFSA 4W8AA 3DC8A 2OQYA 1LBFA 4XKYB 3G1FA 1KFLA 2CLFA 1MW2A 3IV3A 4HT3A 1VYRA 2R6OA 5AC7A 5CPOA 4GBDA 1MQPA 4BF7A 2VZSA 3F2BA 3U0HA 2WVVA 1Q85A 5I02A 2OX1A 5F4WA 5AB3A 2BGSA 3NQMA 1XC6A 2EXOA 2JKPA 4I3GA 3DU0A 5I6SA 5L6UA 3S2JA 3W83A 1OFAA 3L2IA 4ZB2A 3UWZA 4GYKA 1QBBA 1KGWA 3MMUA 1YE6A 4Q3MA 1PKNA 1RV8A 5I5RA 2BHZA 1Z8AA 2PDFA 1JZ5A 4NJIA 1E51A 3I6EA 1LL6A 2FJKA 3BUVA 3L4VA 4K8EA 5JXQA 1BWLA 1OCNA 3STFA 2ZOXA 3ZQ9A 3WQFA 3CWHA 1R5YA 4MB4A 1XYCA 2Z00A 2VFIA 4WF7A 1TZ7A 4OOUA 2FFCA 4ZQPA 3LDVA 3V36A 1KNWA 4IGMA 1FXQA 2BMBA 4UCGA 3EWXA 4PL2A 1LLWA 2ODOA 3CZKA 5CKSA 1VFSA 3U57A 1JUBA 1QI5A 1AG1O 3GIYA 3ZZ1A 3WL0A 4IP7A 4O28A 4PUUA 4D8ZA 3RGTA 3ANVA 1H11A 3LRMA 2A5HA 2AL1A 1N82A 3LOTA 1VEPA 5IOBA 3BG5A 8A3HA 4XAYA 5FIPA 3LGEA 1W5OA 5C2GA 3OODA 1XV8A 4FLSA 4RNJA 1EDTA 1IEQA 3KL5A 3RPMA 3GXDA 1P43A 1H41A 1VHNA 3W2MA 4ZENA 4C6MA 1GHRA 5CSUA 2VFGA 5M03A 3TE9A 1OCJA 3Q45A 3QH2A 1US0A 3E0WA 4PMUA 1CEOA 1K4GA 4LANA 3ATZA 2ASHA 3PHAA 4GVIA 3ABOA 1IF2A 1VP5A 2V82A 2NT0A 1W56A 3S42A 3LV6A 2QAFA 4W4QA 5LYRA 3V4BA 3WQ6A 3VNDA 2NXHA 4J40A 3T55A 4GUGA 5D2XA 1RP9A 1YXYA 2PWFA 2CBUA 4XZMX 4FSAA 4IMEA 3C0QA 5BOFA 4ZFMA 5J04A 2OLHA 3ZS4A 2GOUA 3BZGA 3GDLA 1DPMA 1UWTA 4HYRA 1FY6A 2BVTA 1JCNA 3A22A 3M7SA 3OLIA 2YA2A 2QUMA 1JI1A 2OZTA 1GVQA 1B4KA 4EPEC 3BZJA 1Z89A 2PU0A 3AXMA 3O2LA 1KR0A 3WQDA 4UNLA 3N18A 5JVLA 5EMLA 4A4AA 4U5KA 3S6TA 3CQHA 3R13A 4IWWA 2Y5SA 3FV9A 2BXZA 3HV9A 1LOLA 3L2MA 4FXFA 3VNJA 4J2MA 2NQ5A 2QDEA 3NA8A 3U2ZA 3TEVA 4G7FA 3OZPA 1RVKA 2EHHA 3DGRA 3OHIA 4O0ZA 2Q02A 1PX8A 3K8LA 1FWGC 4AZ5A 2GJLA 4NQ1A 4UFIA 2PRMA 2VVSA 1KO0A 4Q8VA 3TC7A 5A6LA 3SCPA 4AW7A 2HXTA 1VEOA 2DVUA 2J25A 1KWKA 2ZZ2A 1J0HA 1SJDA 4F48A 5KSWA 3M64A 4A29A 3Q65A 1ZJHA 3TXZA 1UR3M 3AHXA 5IBXA 4DYEA 3QBUA 3EWZA 1V79A 2FQIA 1DE5A 1VD6A 3STGA 3OJGA 2PSNA 4N2YA 1WUFA 2HK0A 3B9AA 1DTNA 3FKKA 1O5QA 2ZX7A 2E8ZA 4N4QA 2ZUUA 1TX0A 1QASA 3C8NA 1QI4A 5DY2A 1OF6A 1PO9A 3MC5A 1JRCA 3MO4A 4QM1A 5AKQA 3PBVA 4Y9OA 4H7CA 1TTIA 1JF5A 2P10A 4KMQA 3SECA 2V3GA 3N9KA 2OELA 3GXFA 1DJYA 5ECVA 4MZ1A 3S5SA 5CEWA 1LDCA 2I56A 2Y62A 4K1GA 4NVTA 3FX4A 2VKZG 1PBGA 3S1VA 1ZLPA 1TV8A 4G5DA 4MKNA 1KA9F 1LWJA 3PANA 3VDAA 1PV8A 3HFYA 1V3LA 4QS5A 3BQ6A 4RDYA 3N2MA 2FVMA 3NOYA 2VEMA 3CH9A 1W1PA 5TQLA 1ZJIA 3F5JA 2XFYA 3DFHA 4UTTC 3LBMA 1TSIA 3KBWA 3DOPA 3SB0A 2ZWZA 4QNWA 5IHSA 5DCEA 5JBFA 2OQHA 4AHQA 3GVVA 5D8WA 1J0IA 3CJPA 3LK6A 5EB8A 1XLIA 3AS2A 3VOGA 1BGGA 1JPMA 3KWSA 3UXLA 5HDRA 2QIIA 4Q22A 1EL3A 4MJMA 1KM1A 4EPDC 4NAFA 1G4SA 1ADSA 1L6SA 1B2YA 1FQ0A 4HK5A 1QPNA 1W32A 3L5LA 4O4WA 4PMXA 1NFBA 1A3XA 1XDMA 5CSYA 1F8MA 3VU2A 3TMQA 2V5DA 4S3FA 3H2MA 2ZZ1A 4P7RA 8TIMA 3HQ1A 1V0NA 3LLFA 1TV5A 1W2VA 4OVXA 3MUIA 2XSXA 3U7VA 4GZEA 3ALFA 1K77A 1WA3A 2I5GA 3WFLA 1CGVA 3RFAA 2DY3A 1J0YA 3VIKA 4AZGA 3CLWA 3BW3A 1GHSA 2QJJA 1TMQA 2CZDA 4Q4SA 4NAEA 1OK6A 4FNSA 3TR2A 1JZ6A 8CGTA 5A1AA 1EUNA 1XRVA 4B15A 3LTYA 3K2GA 2WWDA 3C0SA 2Q6ZA 4FB7A 1GOXA 3TYEA 5AYYA 4CNTA 4AWUA 4H8HA 3GR4A 3UR8A 3EA2A 1JFHA 5GNXA 1RCQA 1YBQB 3ZLFA 1EA9C 4XVDA 3EGJA 2A7PA 5MF5A 2FVLA 3EOLA 4CD8A 3M1ZA 4YHGA 2XN1A 4M51A 4FXSA 4Q4QA 1PYFA 3KHDA 2YZRA 4WKFA 3S1XA 3N19B 5CPLA 4YCPA 2A6LA 2WMIA 5ECUA 2XH2A 3DYOA 4LNCA 2A3AA 2DT3A 4JL1A 4JKKA 4LYRA 2I14A 2QCMA 2QUVA 1F61A 3ZLGA 4DJFC 3KDOA 4FMVA 4LX4A 5REQB 2GJXA 3FGCB 3S4TA 2DUAA 4NT0A 2NX1A 2OZ3A 1UA7A 3SGGA 1SFLA 3WK3A 1NEYA 2WNNA 1OX5A 1F73A 2NSXA 5A6BD 1UR8A 2GGGA 4M3PA 4IHCA 1FHUA 4RNFA 3WLMA 3VDHA 3B03A 1A5NC 1UWIA 3GTFA 2GVEA 3KVLA 4E38A 2CZFA 3GG1A 4MNKA 1W1A1 1PWMA 4WIWA 5AZ1A 4O16A 2NSOA 3CAVA 1JF6A 1WKEA 1JR1A 5D2WA 1S2TA 4ALDA 1UR4A 4HPNA 2OSYA 3E2SA 1P6BA 3E2RA 5I03A 2QW5A 4Q7NA 3BLLA 2WKGA 4GJIA 3A5VA 4D6GA 1MYRA 1XINA 3WH7A 5DFAA 3WQWA 1S46A 2JIWA 3MP5A 2QCCA 4ZTXA 2GK1B 2TMDA 1S3TC 1MEHA 5LIKX 1EQPA 2IKIA 1FH8A 1B3WA 3M5VA 4KT2A 2P0OA 1PTAA 1U1UA 3B97A 3MKKA 5DBTA 3LERA 4X2PA 5AY7A 3NGFA 1GKPA 3PTKA 6XIMA 1H51A 3GAYA 3E5BA 2DPEA 4ZXOA 3P14A 3VINA 2PWVA 3F4WA 1DIKA 4ICMA 3THCA 3VIIA 3H23A 1Q7MA 1XBYA 5FAGA 4HOWA 3OZYA 2B7OA 1E6SM 2AL2B 2YKKA 3IGUA 3P81A 2GGEA 3XINA 4BI6A 1Q6EA 4XZIA 3VO0A 1HG3A 5M2FX 4LBUA 3FYPA 4PTXA 1H09A 5C6MA 4QQUA 2YFOA 3W29A 2ZX6A 1LQ0A 3CAWA 1IWBA 1VJSA 4NF7A 1JZ4A 3TLLA 1DWFM 4ZE4A 4O13A 5DQPA 2F6XA 4IPLA 4NX5A 3GB6A 1MZRA 3RU6A 2OWXA 4QJ3B 4N9EA 3QSTA 1EZ2A 3RM9A 1UD4A 2DSWA 5HPOA 1BD0A 3THQA 4PUNA 4GY1A 4FX7A 2V63A 1PZ0A 3WMCA 4B9YA 1GOIA 3KRSA 2ISDA 1OD8A 5G2IA 3GU9A 5F2MA 3WBAA 2FIQA 3ARPA 1FCBA 1EPXA 5I78A 2NV1A 5BW6A 2V2HA 3PM6A 2WLZA 4NIRA 5FESA 2HWGA 3PZ9A 3GXMA 3WD2A 3NSNA 2CBIA 2DVTA 2CXEA 4FX6M 3QOKA 3AWOA 4F2UA 3HBLA 3NSXA 2GWGA 5DXXA 1MXSA 5E9AA 3WF0A 4JTHA 4E3TA 4LXFA 1X8CA 4NXSA 3DESA 2O9RA 5JUVA 5DCDA 3R89A 1AH3A 2DJXA 3GXTA 3VCRA 2Y6ZA 2PP1A 3HZ3A 1P0KA 4OBSA 3PZTA 1DKWA 3AYSA 1I1WA 4KWOA 4DWSB 2ZUSA 3CUGA 3L9CA 2O56A 1Z32X 1FVPA 5F1VA 4HBKA 1PCWA 4NZFA 4HNTA 1XM3A 5JBEA 3SDOA 1QO5A 5D03A 4KFNA 2DVXA 3BSGA 4UOJA 3VFLA 3VIHA 3VZXA 3M41A 1W5MA 4MWAD 4CU6A 1UC4A 3SZ8A 4DO5A 3GH4A 1S5VA 4B3ZA 5HANA 3ABSA 2B7QA 4UQEA 5CH9A 5AHLA 1QUMA 1D7FA 3W7IA 3KLKA 4PTDA 1M5WA 1B9BA 1HNYA 3LPGA 4EP8C 5IFPA 3S1WA 4UTUA 3MANA 3M0HA 2WVVB 1FWEC 5LHEA 3LXAA 2D0GA 3PFRA 3DYMA 3WMBA 1Z41A 1LG2A 4TMCA 3LXBA 3R8HA 1V5XA 2VZVA 3VNZA 4OTKA 3RMEA 2GJNA 4JL2A 2IXVA 3CPUA 3L4YA 1BSLA 3WLJA 3KTCA 3E0FA 5DMMA 1FRBA 3BANA 1FWSA 3C0JA 3H4XA 2J88A 3W1TA 1MNSA 4HTYA 5I3IA 2O0TA 4PEKA 2J74A 3E1F1 4RUBA 4DQWA 1MW3A 3W7NA 3TYBA 3KBMA 2BSLA 1UROA 1OEPA 3EA3A 4RXFA 4IMFA 5CBJA 3W6MA 2VGBA 5A8MA 5CZKA 1XYMA 3EMQA 5BXRA 2DU2A 3UESA 1RVGA 3PR2A 1A0CA 3WQCA 3EX4A 3ITGA 2OTDA 5GQBA 4QX4A 1GGOA 4JPGA 2F9RA 3EDEA 4B5UA 5IHRA 4F0LA 4R7JA 2ZWYA 5FEWA 3TV8A 3IIZA 4Q6XA 3VGBA 4GE8A 4B5SA 1QNPA 3AWNA 2A79A 4KW2A 4BJHA 1RD5A 1OFDA 4UNIA 1O1ZA 3LZ5A 4Q8NA 1NOUA 3A4XA 5DANA 3UQNA 1L9WA 3IJ7A 3K13A 4FNQA 3CMFA 2Z27A 1BRLB 1R8LA 4YLWA 4E2OA 1AA1B 3NDOA 1UKTA 4E5TA 4C6QA 1XW8A 2HK1A 3SN4A 1PHQA 1UD5A 2CHNA 3LHWA 2AGKA 4FNUA 2XWDA 4AIEA 4ZVJA 2G96A 4HTBA 2OOGA 4MPQA 4GQ0A 4S2CA 1L6FA 3T0DA 3VCNA 3VGFA 5J5DA 1YNQA 2QDGA 3DKLA 3S2MA 4PODA 3PK7A 3C2RA 2VOMA 1E9ZB 4I7UA 3AC0A 4HSHA 5BXPA 4H9UA 4IQLA 1L0PA 2Q09A 2IQTA 2CLEA 4AD4A 3LNPA 1OABA 1LM1A 5JU6A 1XRFA 4MVAA 2C19A 2VJXA 2ZRZA 3RUBL 2IPFA 4Q7IA 1TTJA 1XGDA 1YTDA 1E4LA 1FTXA 3BV7A 3WG6A 1KV8A 2NQLA 1CPUA 5HWMA 3EMCA 3HPXA 3RO8A 2WJDA 3CV1A 3DFOA 3WNLA 1HL9A 3RAOA 2GGIA 2DW7A 3R6IA 1GKRA 3HM7A 1UP2A 1YKWA 1IXOA 1FFQA 4C6OA 3KCJA 5ABGA 3VGGA 1ICPA 4YWIA 2AOSA 5FF3A 2V2DA 1CBGA 2IKGA 2DUZA 4WXZA 1UD8A 2HMCA 3AXIA 4GCXA 2KAUC 4ZXLA 3C2YA 4AEOA 5D9MA 3RMJA 4X9SA 3HMCA 1CLKA 3UA4A 1BYDA 4R85A 3U8GA 3BG3A 2QJHA 4WLCA 2CEQA 3TJIA 2YYTA 3N6HA 5AHNA 3V7PA 2DEPA 1YDNA 2D22A 1QO2A 4AYGA 1HQTA 3D0CA 1VR6A 3OPSA 3TA9A 3CV7A 3EBVA 1X1OA 3HG3A 5AFDA 3TAKA 4HMNA 3ZR5A 2CCRA 4MJZA 1VBUA 3ONCA 3XIMA 2QS8A 2W5FA 3NQGA 3MCNA 5D9PA 2Y61A 7XIMA 5CCZA 2FPYA 1DXEA 4IIBA 3AO0A 2YZ5A 3W1MA 5KMYA 3N34A 4FO4A 3NO5A 3IJDA 4L9XA 1K8YA 1BF2A 4EACA 4PB3A 1AK5A 1RJRA 2E09A 2XGZA 5CSSA 2FDSA 2ZADA 1H5YA 2GUYA 4MY8A 5IM51 4CD4A 1HO1A 2FVKA 3GDMA 3M6DA 3OG2A 5T9CE 2VR5A 4X0NA 4LYQA 3AMGA 2IPJA 4ZSTA 1VQTA 4FLRA 3W0KA 4CN4A 2GGJA 4ZQRA 3NZRA 4GRSA 1H1NA 5BU9A 3HIJA 1QNVA 4GVFA 1QU4A 4XUGA 4ATLA 3UR2A 1V6VA 5T91A 5I06A 1JZ7A 1SFJA 4IIHA 3RLVA 1AQHA 2X2GA 3RM4A 4NYUA 1VCGA 1M1BA 1PWLA 1ITQA 3CLMA 4NSBA 2CZ5A 5D09A 5F2LA 1UR2A 3TW9A 1OZMA 3AIBA 3MMDA 1VPYA 3EB4A 4JFTA 1UUOA 1OYCA 1E15A 3DDMA 1A5SA 3QVQA 4DWSC 3SY1A 4DN1A 4W89A 3SRDA 2YB1A 1TMLA 3QLDA 4H00A 4NAFB 3RRAA 4AVNA 4B16A 3G18A 3FIGA 3QHOA 2F8QA 1D8WA 5EMJA 2WHKA 4EXBA 4JN7A 3WJYA 2CBVA 4LVBA 3TKFA 3QXBA 1MUWA 1TQXA 4ZTYA 4E4FA 2C79A 3KOFA 3SBFA 4X61A 1SZRA 4WUIA 3OVPA 3UVAA 4WKHA 3O0FA 1ME8A 1QI2A 3B8DA 1EWEA 3WH8A 2FHCA 4F0HA 1DJXA 4DJEA 3AMCA 3O15A 2EJ1A 3QQ0A 1KD0A 1XHGA 1NU5A 4HVXA 3I68A 3QYQA 1SO4A 1Y8BA 4U2ZA 4C6CA 2VX4A 3KL3A 4DM1A 3MP3A 4CD5A 1LF1A 1F76A 3BLEA 3LS9A 1SFTA 3OGSA 4H8VA 3W53A 3SUSA 2PWGA 4WQ6A 1WZAA 4GLEA 2PDLA 4IXHA 3MU7A 4HOZA 3C0LA 4UTMA 2RUSA 1YDYA 4LCQA 3MVTA 3TN4A 2XZ9A 3UYIA 3KRBA 4QCEA 4ZO8A 1LRQA 3OA3A 3QZ6A 5D02A 3W1UA 3PBUA 1DWGM 1US2A 1KGUA 3GS6A 4CGTA 1EF2A 4PEEA 1MI3A 2G37A 1UZDA 2D3LA 1UD3A 4FOJA 1JGMA 1XG3A 2WMIB 3GTXA 1JYWA 3WIJA 4J5NA 1GJPA 1W8GA 3NXFA 4DXKA 4Y2WA 3U2EA 1NH6A 5BRBA 1PKYA 1SSGA 1B30A 1TG7A 3PN8A 1EBHA 3WLHA 4LYKA 3MJYA 4Z1CA 1Y7VA 4J28A 3COTA 2I5QA 1B3OA 1JCLA 2GUUA 4Q8UA 4QJ1A 4XTIA 4E4UA 1EO7A 3THUA 4QAWA 3UZZA 2GJXB 2NVDA 3CPGA 4JQ4A 3NOEA 1ICSA 1B90A 3A47A 4M7TA 3W7PA 3OLDA 1EGMA 1XCXA 3MSRA 2J27A 2SFPA 3S6DA 3QSRA 3WDIA 1V7AA 3U4FA 1LLOA 3GE7A 1R7OA 2C15A 2POZA 4RE3A 3N73A 4GKLA 3NAVA 4JX4A 4RE2A 1XR2A 1OYBA 3LM3A 2G97A 2DP3A 1XS2A 2ZDRA 4H1ZA 3ZXWA 2HXUA 4DXVA 3B3DA 1RA5A 4PFMA 1W3JA 1KFJA 2E5BA 1NOFA 4H01A 1ESWA 4FHAA 2PGWA 1O6IA 2PP0A 1DQUA 1F4HA 4DELA 3BARA 4FIRA 4A2SA 2PC4A 4UTHA 3GYCA 1E56A 1OM0A 4LOCA 3NDZA 5HNNA 3RF9A 5C71A 3I4EA 3LY0A 1L6YA 3B0XA 5H1WA 3AIUA 4AMAA 4O50A 2C1HA 3HG4A 4ML9A 2P8BA 2BOEX 4DO4A 3H2AA 4GYFA 4M1BA 3BJSA 3I4KA 2OX4A 3CEPA 4QFUA 3GWQA 5LA1A 1IE7C 1S2WA 1Y5WA 3DHFA 4ROQA 5AC8A 2PDMA 1IXNA 1FWNA 3HN3A 4RZ4A 2VC9A 1GVOA 2RJGA 3W2UA 3WNNA 3GUGA 4UTLA 2WBKA 3W7GA 4B2DD 2J66A 2FZNA 5G5IA 1CXFA 3O6CA 4KEVA 1K8XA 5AYIA 5IFTA 2OYLA 1E1FA 1R2RA 2HVMA 2VDGA 3P93A 3IS4A 3NDYA 5BWAA 5ABEA 1GYNA 3NZGA 4IPNB 5I0DA 4QEHA 1IR1A 4IL2A 4UTJA 1W9PA 1W9DM 5ABFA 3WF3A 2W66A 5IBXC 3NL6A 4Q8OA 4JTLA 2E6DA 4FXRA 2H9AA 3WFZA 1KTBA 1EJVC 4KETA 4CCEA 3AUOA 1XFBA 1XIBA 1WBJA 3KBVA 2E0PA 4EWJA 2CLOA 4PMDA 1YXCA 2BZNA 2W4XA 3W7LA 4ML4A 3SCUA 4J3WA 4J3VA 1BSIA 5I79A 1W9BM 1DIEA 2DIKA 1QNSA 1UWAA 2CLKA 1Q2RA 5AYZA 3W74A 5DRIA 1W3HA 1HGYA 4PZVA 2OCZA 5KTLA 2TODA 3GFZA 3CH0A 2J7BA 3HG2A 5A2AA 2Z29A 4XKMA 3DGBA 1PCKA 4WCJA 3A12A 1FKWA 5D04C 3VX0A 4ZB0A 2PFHA 3N2TA 3NQ2A 4TO8A 1OB0A 4AD0A 3Q4DA 4F9JA 1DYSA 1KFWA 3B0YA 3R94A 5K4XA 5I00A 5AOUA 1E43A 2V8ZA 3MV01 4PUMA 1VIWA 2XGBA 2ICSA 1E1EA 3WBEA 4H4IA 3W28A 3G1XA 4I9JA 4YTTA 2OEJA 3SAZA 3EYPA 1JFXA 5AHFA 3SCOA 5DBUA 3MWCA 1NWTA 2OLSA 1UJPA 3PZNA 2GOKA 3RPDA 4JTJA 4EWND 2D2JA 4Q7BA 3VKCA 5CAHA 1OCBA 1GJUA 2D20A 3EPNA 3G77A 3SSJA 2VC5A 3O16A 4BY3A 1LQ2A 3ARYA 1W9UA 5HK4A 1DQXA 3W02A 2PF8A 1V93A 3UYCA 3B0UX 1NSJA 3QFEA 2GQAA 4IISA 2DT0A 1HF6A 3V1PA 3SIMA 2NQJA 1HUVA 5BROA 3GXIA 5EY5A 1NTHA 3UD6A 2J47A 2ZX8A 1T5AA 3T2OA 2ZIDA 1KC7A 4PCFA 3M4HA 1O60A 4I8DA 4B5WA 4I6VA 1E6PA 1YADA 4POCA 4IJCA 4OU1A 3LLXA 5KZMA 3ARRA 4L4PA 3DUGA 2YDQA 4K37A 4MDPA 3MJMA 3CZ8A 1C92A 3EXRA 3FS2A 2INFA 4XUYA 1N8WA 1Q8JA 2TRSA 1UQZA 4QITA 1S2VA 1UH4A 3P67A 3UGVA 1IV8A 4GH1A 5CJMA 3VM5A 4Q4MA 3C2OA 1VENA 4DJDA 3FJNA 4DZHA 2WKJA 5I3JA 3HOJA 2NLIA 3L68A 2NW0A 2ZXBA 2XG9A 4EIVA 1EPVA 5BRPA 4NNBA 3M46A 2PDCA 4JS3A 2AGTA 2V69A 1JNEA 1WCGA 3QFWA 4RKAA 1GZ1A 3H8AA 1UKQA 2ABAA 2ZUWA 1I2NA 3S9IA 3NQEA 2QGYA 5J8LA 1B57A 2Z1VA 3VUPA 1Z7AA 2PLMA 2PE4A 2NXIA 2J13A 3B8SA 3MT1A 5GJNA 3QPEA 2XM1A 4JFWA 4JYDA 2ZX5A 1GWJA 5EKYA 3EX6A 3N17A 3F4DA 3FVMA 1DE6A 4YWSA 4YJ5A 1FCQA 2X7VA 5CZSA 4G1KA 5JIWA 3VYLA 2YDAA 4RW5A 4Q8TA 1FA2A 4H3DA 4JTRA 4ZQCA 3APGA 1C3FA 3E96A 2EF9A 4O11A 4BF9A 3SSZA 1XD1A 1WZKA 5CC3A 2Z7KA 4MWAE 3IAPA 5B80A 1GOQA 1P7TA 1S1PA 3M5YA 3IUHA 3IIVA 1WQ5A 2OR2A 4WJXA 3SGUA 4GQRA 2BNJA 4MAZA 1KBBA 3SO7A 3PFMA 5BOEA 3QPZA 3CEUA 1R47A 3G1SA 4GI4A 4Z2GA 3BGJA 3VD5A 3ZWSA 1FP8A 1W5QA 2F61A 2OYKA 1Q45A 3GNDA 4QHRA 3CMJA 1J10A 3KVKA 4HN4A 1L6GA 1KM6A 2CFFA 1CX9A 5JBDA 4L65A 5JH2A 2INEA 1GOMA 4G56A 1GTEA 4LAOA 3FA5A 4S3DA 3SCVA 4UTWA 3L7RA 3HF3A 4O8RA 1XSIA 1UYQA 1GOOA 4KIRA 1I2RA 4GHRA 4BS0A 4NZ3A 3W72A 4L4OA 1J8VA 1L2QA 3AIRA 4PMZA 4GZIA 4IMGA 1POKA 4PCNA 3O3RA 2VQUA 4XIMA 3LENA 3R8GA 3TTSA 2WYSA 3W7MA 3IEBA 3AYRA 3P2VA 1ZBVA 4YCOA 3H2CA 1E55A 3A64A 4O17A 4QTGA 2R91A 2OB3A 1NOWA 3VIPA 2ZX9A 3NVDA 4NKCA 2QCEA 3O07A 1LCOA 1X6NA 4WZHA 5CZ0A 3PB0A 3PULA 5D4YA 5MKGA 2VFDA 3POHA 2Z2AA 3WQOA 3LU2A 4ZSUA 4D6CA 4AC1X 2VCCA 2Y8KA 2QKFA 5CZJA 4YMZA 3SGZA 5C7HA 1AH4A 3E3HA 3CL6A 2ACQA 4HNLA 4QR6A 3STEA 2FMNA 5K9DA 3AMLA 4GVHA 3HA1A 4ZB5A 5T9BG 2OSWA 1ML1A 3KTXA 2NLYA 3R4IA 3WQ5A 3E6EA 1XKYA 4ZO9A 4U5IA 3M0XA 4JFSA 4X63A 3GU1A 1X96A 3NPXA 3AIEA 1B31A 4AD2A 2W61A 3Q58A 3LM7A 1L2UA 2BLEA 3MSDA 4QXIA 1A0EA 5KINA 1PHWA 3SY5A 7ODCA 3UF9A 1V02E 2OEKA 2ADAA 3ZT5A 5HJYA 3Q67A 3ZJKA 3QGKC 3KCLA 3TOPA 3NL3A 2DUXA 3UW6A 2WMJA 4O0KA 2GVLA 2H8XA 1YXDA 1WXZA 4QDPA 5K3VA 3W7QA 4O57A 2VFFA 3V5FA 2NVCA 2QJMA 1M6JA 1R86A 1IQ8A 1BVWA 2GVGA 2V30A 1JYNA 3KRZA 3PZOA 1FOBA 5H91A 3SN0A 1IEXA 1ZP4A 4XSLA 1F9CA 4HMDA 3THAA 2EG7A 4CCDA 1EJXC 5C5YA 2Q3OA 4X22A 3UG3A 3LHZA 4O4VA 3WF2A 3G5EA 5C9ZA 2DT2A