1G4PA

Thiamin phosphate synthase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
225
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
total genus 74
structure length 219
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4pA00
2QEZA 4EOUA 3NR0A 3LCGA 2FPTA 2RDTA 1KLZA 2ZBTA 2QUUA 3LRMA 3S1XA 5E0KA 4U4MA 4DF2A 3VE7A 5C5YA 2WNQA 2FFCA 1NSJA 3BV4A 3G1AA 4DBDA 4JGDA 1H7WA 3BG9A 3FJLA 3W75A 3PSVA 4N4PA 1LYXA 2QUVA 3S5NA 3NXFA 3BVJA 2BWGA 1MSSA 3P8JA 5G2IA 5FF7A 1TV8A 3DFTA 3L9CA 3TXZA 5GVJA 4K36A 1TCDA 1XCFA 5DCBA 1IXQA 2RFGA 2CZFA 1K03A 4Z0SA 3WK1A 2GVLA 3I68A 1J5TA 3HGJA 4XBSA 4LS2A 5KTLA 1RR2A 3GDRA 2XN2A 4BWLC 1CW2A 2QCEA 1G7UA 2R94A 1ME9A 5D32A 4AH7A 1GEQA 3DFOA 4WD0A 3LTPA 1OF8A 4LUJA 1J2WA 2BLEA 3ATYA 3CT7A 4FNSA 2VFFA 4EWND 1DL3A 2E5DA 3EXRA 2YX0A 4L4LA 2A21A 3KVJA 5HWNA 1FDJA 3BW4A 1SZEA 1VCFA 1EIXA 1EX5A 1EP3A 1VRDA 4JX4A 3P80A 1DQXA 3TMLA 1FWNA 1HFBA 4JIPA 4DBEA 1S5WA 4JTFA 4JX5A 4WY0A 4UTIA 1F2JA 3OBKA 4O12A 4XZ9A 3QJAA 3W9ZA 5C54A 3PULA 4ORIA 2BSLA 4IXXA 5HWMA 3C2FA 1FWRA 1YPFA 1SQ7A 2Z6IA 1JCXA 2YYTA 4PTNA 3S1UA 5BRBA 4Z1BA 4JTTA 4UIOA 2A0NA 4DO4A 3BGGA 4H3DA 1FCUA 3HG2A 1YTKA 3HB9A 1OFBA 4FX8A 5D05A 4J9JA 3MI2A 1BWLA 3G22A 4FO4A 4QQ3A 1TPC1 1GYNA 2DZTA 5KZMA 3PVFA 4EIVA 3W7CA 3P81A 1LRTA 1UCWA 3W1RA 2Q3RA 5HULA 2CLHA 1AMKA 3TAKA 1YYAA 5F2LA 2DP3A 4IGHA 3LDVA 2NX9A 3CHVA 1B9BA 4N6EA 3B05A 4O14A 1W5MA 4FNTA 3DFNA 4GC4A 5FI8A 4UR8A 1L6WA 3TSMA 3NM3A 3RLVA 3UD6A 4AMAA 4UTHA 1PV8A 4QIUA 3VFLA 5FF0A 4ZQNA 3NQDA 3FEMA 5D04C 3G1XA 3GDMA 5D2VA 3S42A 5A8GA 4IMCA 2DU2A 3FKKA 3W74A 3HG5A 3W76A 4OHQA 3KHJA 4WXZA 2QAPA 3B06A 4DO6A 1F6PA 3L0NA 2VKZG 4RKAA 4YCOA 5ABTA 5CPNA 3LBCA 3IIPA 3DBPA 1I2PA 5KZEA 4O1BA 4LVAA 4MJMA 1SSDA 4HPJA 4WY0F 3C0JA 4L4MA 2GVGA 2EPHA 5D2YA 1KW1A 1Z48A 1F73A 1ML1A 1U83A 2Q3OA 3G3DA 5DCDA 4AXKA 3C2EA 2B7OA 3LCWA 5E93A 1DHPA 5CPOA 3UWUA 1ICPA 2Y7FA 3GKAA 3AO0A 2YZRA 5CZSA 3NQGA 1OYBA 4UTWC 4O16A 1JRCA 1ZAIA 2CZDA 3DENA 3TA6A 3VCRA 4WOZA 3SJ3A 1YDNA 3SR7A 4HT3A 2KZHA 4GUGA 2GJNA 4X22A 3M7WA 3TH6A 3PSWA 2HS8A 4PCFA 3NL5A 2VELA 2X30A 3FJ6A 1KA9F 3LRKA 3LRLA 3TW6A 2AGKA 4NJHA 3DZ1A 1LOLA 1JCJA 3L5MA 4FEZA 4O17A 1BEUA 2OZ0A 2CLMA 4GUHA 5F1VA 2BX7A 5BOOA 3TFXA 3GAYA 2AQWA 3G3MA 3IGUA 3GDLA 4NNBA 4IQLA 4ALDA 4KFPA 3VI2A 2X1SA 2FTPA 3TAOA 2YW4A 1FWTA 4UTLA 3LX9A 5EY5A 3G18A 1D3GA 1TRDA 1W1ZA 5LNRA 3FA5A 1O94A 1T8XA 2ZA1A 3G1DA 1WOBA 1FBAA 5I3FA 2JKPA 4JIQA 4K38A 2CW6A 4O52A 1IXPA 3NQFA 3A5FA 5LKYA 2F7FA 5LNUA 4O1DA 1KFLA 3W84A 3NL6A 2ZRZA 3P8IA 3LV6A 2PRMA 3LERA 1M7OA 3M9YA 2Q8LA 3CPRA 3O05A 2V82A 1H5YA 3P5ZA 3DU0A 1YXCA 5HNRA 1OHLA 3G1SA 4AF0A 4QAIA 3NPUA 3TNOA 4RX0A 2Q8ZA 4GE8A 1H7RA 1TV5A 3R89A 3A23A 1ADOA 2R8WA 3FS2A 2BZNA 3GR7A 3TW7A 4K37A 5HWJA 2NV2A 4OBTA 1LOSA 3QEZA 4TMBA 1ZCOA 3R2GA 4MOZA 2Y62A 4UTWA 4OQVA 5G1YA 3QC3A 3CIXA 3HIJA 4X2RA 1IGSA 1EB3A 1SZNA 1VGAA 4IOTA 5KINA 4NZJA 1KM6A 1R47A 3G0XA 4JEQA 4O8RA 1W5QA 1QO5A 4O0KA 4RK8A 5AHEA 3HPSA 3QSRA 4JXCA 4PL2A 2E5CA 4BF9A 2B7NA 3STFA 4WX2A 1EWDA 3ELFA 4JNMA 3KRUA 3NDOA 5K4ZA 3EWBX 3P84A 1WA3A 3GXNA 2ZZ1A 1LDCA 1GG1A 4ZQOA 3LHVA 2FJKA 3E96A 2E09A 4P2VA 4R33A 1XDMA 3UZ5A 2JGYA 4RXGA 2G97A 4ADSA 1W3NA 3EX4A 4UCGA 3S5YA 3C56A 3W1AA 1L2UA 2XN0A 1C8VA 4M6VA 2UV8G 1TTIA 2FDSA 4XKYA 4WOQA 4PA8A 3G24A 4JICA 3UXAA 2X16A 2CLLA 1B3OA 3NEVA 3W7JA 4OV4A 3NQMA 1OFEA 2JKAA 4ZZ9A 2G5WA 4ICNA 3KVKA 3NOEA 4K39A 2BTMA 3W83A 4Y6GA 4MVAA 3NQCA 4JTLA 4MYXA 4NVTA 4O10A 4N4QA 4OWGA 3YPIA 5HQEA 1K7FA 2FPYA 4LUIA 5HINA 3UWQA 4D2JA 2ALDA 4LVFA 2DJLA 2JBMA 5CSRA 3FIGA 2YCEA 3GVGA 4E2BA 4RXFA 1V5XA 1TPWA 4Z1AA 1K8XA 5EYWA 3KRZA 3NPXA 1JCYA 3SECA 3A5VA 2PRHA 3IGXA 2YFNA 2QCNA 4JTGA 4FX7A 1TREA 4H6KA 3W7DA 1GVOA 5DCEA 4AVFA 4BI6A 2H6RA 4MY9A 4O19A 3P67A 3GKFA 1DJNA 5I3IA 5CSSA 1TYGA 1VLIA 2EKCA 2V0TA 1FCBA 1X8FA 1LTDA 4GXMA 4O53A 5F4SA 4JS3A 2CLIA 3LB0A 4ZL1A 4GNJA 1FQ0A 4YMZA 4NXSA 4JTEA 5AHMA 3TROA 2RDUA 3PUDA 4UMBA 2QCMA 1B4EA 3N73A 3C2RA 4ZMGA 3QZEA 3BO9A 4HSNA 5EL1A 2FB2A 3ATZA 1G67A 3G1HA 2ABBA 3O1NA 1KTCA 4KKXA 2C16A 2DZUA 4NXKA 3CTLA 2YFOA 3T55A 2WV8A 3TQVA 3V75A 1K7EA 2WO5A 3MUXA 3QH2A 4ZQMA 3HGRA 2QJHA 2ZFAA 3GXPA 3N9RA 1AG1O 4Y9AA 1TPDA 1AW1A 3T40A 5CKSA 4GJ1A 3P7YA 2QJIA 2RHGA 3INPA 2I1OA 4Z1CA 1W3IA 3BARA 3MP5A 2A4AA 2NUXA 1QCWA 2YSWA 2CLOA 4BI5A 3WJSA 3GR8A 2E6FA 4EVZA 5D09A 3S1VA 4BK9A 1FWWA 3QM3A 1TRIA 1KFEA 4UNLA 2QCGA 2G96A 3ABQA 1ME8A 1YLVA 2JKEA 1VCGA 1WQ5A 3BG5A 4JDYA 3MBFA 1W31A 3I65A 1BKSA 4Z08A 4XQ6A 1G7VA 1OX5A 1GPWA 2NWRA 4JTUA 3KXQA 5D37A 3FFSA 5D02A 2VFDA 1QO2A 3EX6A 3PB2A 1FUYA 3GZ3A 4HNTA 5DN1A 4IPJA 1TJRA 2CLEA 3L2IA 4FXRA 2ZZ6A 2A7PA 3L21A 4MFEA 3PUOA 2YXGA 5HR7A 4WQ6A 3W3OA 1GVFA 2QCCA 4KFOA 2E1DA 4AWSA 2V8ZA 4C1LA 3WJYA 4IX2A 2YPIA 1LLZA 5AHIA 3M0ZA 4TMCA 5AHFA 1OVDA 2TPSA 2ZZ4A 2EF9A 5LHFA 1W5PA 2ZTJA 3G1VA 4O57A 1IIGA 3LCLA 1AL7A 1I2NA 5FF4A 4FXSA 5LNSA 5L9FA 1LP6A 2NV1A 4QM1A 5G1TA 4A21A 1LORA 4XKYB 4ONVA 1AK5A 3W86A 4RCXA 3P74A 4O1AA 2V9DA 3TQKA 4FNQA 4NX5A 3N34A 2VC6A 3TR2A 2PE4A 3W1UA 1ZNNA 2ZRXA 1ZY9A 3O07A 4O15A 4NQ1A 3B04A 3W1NA 2C14A 2QCFA 1OFOA 3T78A 5KMYA 3HPZA 2FIQA 5HR6A 1OX4A 3DI1A 3STEA 1TPEA 3O06A 4AF0B 1EUAA 4O18A 2ZRYA 3LCIA 4NZFA 3PF3A 1VCVA 3H54A 1JQXA 1W0MA 3QSTA 3IVTA 3QF0A 5H91A 1ONRA 4NU7A 3IGSA 3MMTA 2WNNA 4YCPA 4Y90A 4UFJA 1XBYA 3FYPA 2OCZA 1LCOA 1GJPA 4CQ8A 3WJZA 4JY9A 1MZHA 1JQVA 3TC7A 1P1XA 5D2XA 1LOQA 3TK7A 5G4WA 3OVPA 3L0GA 3N9SA 5BW6A 4LVBA 4O54A 1EPXA 3Q2DA 5LNVA 2ZA3A 1DORA 3IRDA 2NXIA 4ZQPA 1P5BA 2VEMA 2VEPA 3A24A 3SFKA 2H3DA 2HS6A 2BXVA 2NZLA 5CG7A 1VJIA 4MZYA 2CU0A 5EMUA 2CFFA 3P60A 2Y6ZA 2LLEA 1TPVA 1K02A 1P0KA 4W9TA 3DAQA 2O7SA 3OHIA 3IV3A 2W6RA 4FNUA 2G95A 4IXHA 2NXGA 3EXTA 4MY1A 5AYYA 5U4NA 2PCQA 3GNDA 3HQ1A 4O4WA 2EAWA 3GAKA 5AB3A 4XTIA 3LXBA 3RFAA 4JY8A 5LSMA 4UUIA 4IJBA 3P61A 1FXQA 1LM1A 5FF3A 4A2SA 2GQ9A 3LV5A 5LGXA 1D3HA 5BMWA 4LC6A 1VQTA 2PC4A 2QCLA 3M44A 1K3UA 1R2SA 4DEFA 1LLWA 4GUJA 3TUUA 1FDZA 4JYFA 1ZAJA 3UY7A 1FY6A 5SWUA 2A85A 1XBVA 2NX3A 1PIIA 4S2CA 1PHWA 3KRSA 4HSOA 1K7XA 1MEWA 1O4UA 4JTHA 3NQEA 1UJPA 3EKLA 3PBWA 1G69A 3W1MA 2WNZA 2WSRA 3TIMA 3W2LA 4FB7A 1UUOA 5K3VA 3F1QA 1I45A 1G4SA 3W6YA 2QCDB 2EGZA 3MWAA 1WX0A 3LXAA 1N8FA 2IQTA 3SY5A 5A5WA 1G4EA 3RLUA 3SIZA 3MW7A 3TV8A 4LU0A 2XN1A 4FIQA 2W79A 3LXCA 4ML9A 1DBTA 1PS9A 1VLWA 4BI7A 3OIXA 3DGRA 5C55A 3CQ0A 4MLJA 4QITA 2J24A 3DKLA 4S2BA 1Q6OA 1QPQA 2QCDA 2NXHA 4PL1A 3B0UX 3F4WA 3IIXA 4AHPA 4H4IA 3CM4A 4LT9A 3H53A 5G2HA 3JRKA 3V1PA 2C15A 4IX0A 2DJXA 3QYQA 1DJQA 1T96A 1HUVA 4LV4A 5F2GA 2V2DA 3L67A 2Y88A 5AC8A 3PB0A 3EX1A 5FEZA 4KWVA 4TU1A 4CNNA 1H7OA 4LW7A 4TX9A 4WJEA 4R34A 1W3TA 3H55A 3IEBA 4UFKA 4C1KA 3UWYA 1ME7A 4IPIA 4UR7A 1VZWA 1KM2A 2WQPA 1WYIA 4NJIA 1OYAA 4DELA 3KVLA 3W2JA 2V2CA 1Z42A 2ZYFA 1FCQA 3C2VA 4WY0B 5EPDA 1GTHA 3LCFA 3N14A 4S1FA 2GOUA 3LGEA 4UTJA 5FEXA 1J4EA 1NVMA 1NEYA 2WOQA 5BNKA 4LVGA 7TIMA 4QSHA 4Q32A 1A5AA 2JK2A 3CWOX 1T99A 1D9EA 1YPIA 4JD4A 3WK0A 4Y96A 3LM7A 2Y7GA 1RQBA 5EBUA 1EP2A 4O13A 4NT0A 1SUXA 3W7QA 3STCA 1R30A 3KVMA 3L5LA 5G4EA 2DORA 1OG0A 2ZZ5A 3U8GA 4U28A 1JULA 3W87A 4NX0A 1KFBA 3U6WA 2DZPA 3A9IA 1LBMA 3NPWA 3DFPA 3G8EA 5EA9A 1OJXA 1UBSA 3CU2A 3M41A 5CZ0A 5TQLA 4IMDA 3TFCA 2C6QA 3HF3A 4OV9A 4JYDA 5D33A 1SSGA 5FESA 3GB6A 3L5AA 5I3JA 3BLFA 3W71A 3MI3A 3T7VA 3KFTA 1CI1A 1H50A 3B4UA 5E1QA 1M5WA 2CLFA 1QPRA 1TIMA 5K4XA 2Z2UA 3DH7A 3HMJG 1H51A 3FKRA 4DXVA 3LHZA 4LWWA 4M19A 4JDBA 3W1XA 1JCNA 2ZRWA 3NPVA 3O6DA 2QUTA 2H8ZA 3QPZA 1W5NA 2WPBA 3LTSA 1K8ZA 1OFPA 3ZR4A 1Z44A 3W7EA 3VKJA 2ZZ3A 3W7OA 3QW3A 3NGJA 2Z6JA 3GYEA 1JUKA 5T26A 4CCCA 3LI1A 1EWEA 1VYPX 4KFNA 4LVDA 1TTPA 2QDGA 1F76A 1W8SA 5H2ZA 3PC0A 2ZRVA 4LY8A 2Z1BA 3TKFA 1JUBA 1P4CA 1ZAHA 4ZQRA 3NZRA 4B5NA 3Q37A 1HO1A 3EWUA 1KM1A 1P0NA 1BWKA 1ZENA 1OFQA 3WK2A 1TJPA 2TSYA 5AOUA 4RJEA 2J27A 4UTMA 4NJKA 1AL8A 1QMLA 4N2YA 2RKXA 3S8HA 4TIMA 1R2RA 2D73A 3TC6A 2WSYA 3GXTA 3HOJA 2NUYA 3QW4B 4M7SA 1R46A 3B0VC 1H7PA 5D38A 1KTNA 2J9YA 4K8EA 4MJZA 4ZVJA 1GVSA 3M6YA 1TPUA 5AHNA 3W2NA 5LHEA 1TQXA 2VFGA 1TB3A 1JJKA 1H61A 1ZALA 4AEOA 3IIVA 3C8FA 3C4UA 2J88A 2H90A 3ZWSA 1IXOA 3SI9A 3C52A 4EF8A 1LZOA 5HJLA 4A3UA 3EEGA 2CZEA 1PE1A 4XUGA 3UXDA 2J9XA 2NLIA 3QQ0A 3W73A 3S6DA 4RV8A 1DVJA 4WXYA 4POCA 3PM6A 3W1PA 4Y8FA 2CZ5A 3HGOA 1SW3A 1GG0A 4AHQA 4OGZA 4JN6A 2Y7DA 3SZ8A 3USBA 5LNWA 2TRSA 3PR2A 4UMCA 1HL2A 4LV9A 5HMSA 2HMCA 3NQ8A 4MZ8A 5CZTA 3E9AA 4DF0A 4PC8A 1NFBA 4FX6M 3QFEA 1QWGA 3W22A 1MXSA 3GDTA 2Y61A 2R14A 1AW5A 4NJJA 3W7LA 5CPMA 4AAJA 1KFKA 3MHGA 2FQIA 3WFAA 3IIOA 1OF6A 3EWYA 3FOKA 1A53A 3R8RA 2E68A 2GUUA 1F7BA 2RH9A 3LHTA 3TJXA 4NNAA 1OYCA 4DF1A 3JS3A 1KFCA 1SU5A 3MYPA 3S1WA 4FNRA 4MLRA 2A7RA 3NQ7A 3PBVA 4JR5A 1Q6QA 3DHFA 4N6FA 3CLMA 1G4PA 3THQA 1VHNA 1THFD 3BLEA 5LZLA 2Y85A 2ABAA 3DI0A 3MHUA 1QPNA 3PBUA 5D03A 3OG3A 1OFRA 3O8AA 1RZMA 3QRHA 3B8DA 4I7WA 1GQNA 1ICQA 4IUOA 1U5JA 1OK6A 1K8YA 1QR7A 2Y70A 1OFDA 4JTJA 5I3KA 4K6AA 4JYEA 3ZFHA 2W0UA 1SZFA 4N9BA 4HNUA 2WKJA 3NYZA 3HG4A 3W85A 1I2QA 3OVRA 3UYCA 1O5KA 3SGUA 2P1FA 5TBOA 3NL2A 4N9EA 3JR2A 4MUZA 3G8RA 1ZFJA 3Q94A 6TIMA 4X9SA 4YXGA 4AWTA 3I6RA 1H7NA 1YXDA 3L0KA 4HNVA 4O11A 5AHLA 2ATMA 3M5ZA 5C6MA 1HO4A 3UPWA 4CCDA 2WJZA 5I3GA 3STGA 5D2WA 3IVSA 1IF2A 2WSQA 3BPWA 3NNTA 3P82A 2E6DA 4MIMA 4O4VA 4ADTA 1VS1A 3UQNA 1LRNA 2C13A 2A1YA 4KWWA 1OFAA 4O0ZA 1VH7A 1YXYA 4MYAA 4RZ5A 2I14A 1X1OA 4E38A 1TPFA 3QPYA 4O28A 3W7HA 3W1LA 3S5OA 3TU9A 2YDAA 3TE9A 3EXSA 1F74A 3BGJA 1E51A 1GOXA 3HBLA 4FHAA 4OE7A 2A6NA 5CGQA 2ZZ7A 5F2IA 2V5LA 5AYZA 3QMSA 4R53A 1I8JA 1I4NA 1VYSX 2A2IA 3GLCA 3ANYA 3O16A 1QFEA 1QNVA 2YR1A 4HPXA 3I7RA 4GFSA 4UTUA 1YTDA 4M6QA 1EUNA 1TMHA 4DPQA 4MZ1A 2AAMA 1W37A 2O7QA 4WZHA 4IMGA 3W7NA 3B0PA 5CZJA 3IVUA 3LTYA 4BFAA 1LRQA 4M7TA 1H1YA 2ISWA 3E49A 1ICSA 5DLCA 1ALDA 1FXPA 5DBTA 1M7PA 5F4WA 3WK3A 3DFSA 4DPPA 2VXNA 3VNDA 5HUOA 5AN7A 3UZJA 1G4TA 3M47A 3W7PA 4IWWA 4N02A 4P61A 2X1RA 4YL2A 1SR9A 2C0AA 3QMRA 5MHBA 4E0CA 1RPXA 2NWSA 3QMTA 1JCMP 3M5XA 4ADUA 1TPB1 1A50A 3KX6A 1H60A 2PRLA 3LHUA 4ORMA 3C61A 1NAL1 4PEKA 1I2OA 2ZRUA 2QDHA 5KZDA 2HSAA 4IMEA 3CIWA 1SO6A 1XI3A 1MO0A 3O15A 3PY2A 5DELA 1GVRA 5DBUA 3DHDA 3PAJA 3PUEA 4X3ZA 1XBXA 1SO5A 5KITA 4K8HA 1VHCA 3BW2A 5DY3A 1NF7A 3F4NA 1SZGA 4LC8A 1WV2A 4UNKA 3LOTA 3KAOA 1SW7A 2QKFA 1H62A 3A21A 4RR4A 1X6UA 2ZTKA 4PFMA 2VFHA 1PHQA 3GNNA 5AYXA 3T44A 3HPXA 4QNWA 3W1TA 4PODA 3W7IA 2I9EA 1I2RA 1RQHA 2NX1A 2ZQ0A 4A29A 1DKWA 1S5TA 1SFJA 3NL3A 3W72A 5LGZA 3DKJA 1PCKA 1VYRA 1XM3A 3NZ1A 4TR9A 2YGYA 3MP4A 1NF0A 2E6YA 5TIMA 1N7KA 1MEHA 3TQ0A 1TV7A 1C29A 3BG3A 4R7JA 2VFIA 1GT8A 4JTIA 1YDOA 2ISVA 3I7QA 3Q58A 3CEPA 1OX4B 4M6PA 3TJLA 2GPTA 1FDYA 4YLWA 2OX1A 1WXJA 4MY8A 1OK4A 4A2RA 2A6LA 3W2MA 2B0MA 4NUWA 3O6CA 3UWZA 3NAVA 4GBUA 1TQJA 2GQ8A 3M43A 1KTBA 3SSJA 2GQAA 2Y63A 4RZ6A 2DZXA 3W7MA 2DZWA 3G0SA 1S5VA 3NQVA 3NQ2A 4TO8A 1R2TA 2HTMA 2X2GA 2ZA2A 3LHYA 4RZ4A 3MHFA 3LLFA 1LROA 1QAPA 2OT1A 1QDSA 3CEUA 1DOSA 4LRTA 4DO5A 3G1FA 4HN4A 4ZQCA 3SGZA 3C3NA 4XBKA 4CQAA 4BWLA 1SW0A 1YDVA 3VE9A 5I3HA 3HO8A 2QAFA 1L6YA 1RVGA 1PL9A 3MJYA 4NNCA 5K9XA 3UWVA 3M16A 3ZWTA 4UXDA 3MO7A 1T0OA 4I7UA 4UTTA 5IBXC 3GIYA 2C19A 4MPQA 2OMAA 5G5IA 1FCVA 3S5ZA 1TO3A 1TTQA 3HG3A 3PG9A 3R13A 5J5RA 3HJZA 3F03K 2J9ZA 8TIMA 1H1ZA 3NQAA 3HGSA 4FIRA 3I7SA 2H3BA 5F2MA 3N2XA 4CQ9A 4I7VA 1UUMA 1KM3A 1JRBA 1FWSA 5DY2A 1JCLA 1Q45A 4LS0A 5AC7A 1A5SA 1Q6RA 2A7NA 2J6XA 1JUEA 3FLUA 4WUIA 2H8XA 4E2DA 3L68A 2E6AA 3W7KA 1PCWA 5FEWA 2QR6A 2TMDA 1VPXA 3NVTA 3RMJA 1XUUA 3MBDA 2B4GA 4Q4KA 2OJPA 1Q6LA 3NA8A 4JTKA 4FNPA 4PH6A 3M5YA 3BK0A 3A22A 3NQ6A 5K9DA 3UPBA 2ZDRA 1V7YA 2NUWA 3D0CA 1Z41A 3W23A 1A5CA 4OU1A 3N19B 2QF7A 3THAA 1F05A 5EKYA 1TSIA 1XFBA 4LTSA 1AW2A 3O63A 5FEPA 3C2OA 1QPOA 2RDWA 4IMFA 3UWWA 3C6CA 1A5BA 1UASA 2A5HA 3N3MA 4UMAA 3SW6A 2OT0A 3P5YA 3S0CA 1EA0A 3N2MA 1BTMA 1RD5A 3WJXA 4RLIA 1XBZA 1GVQA 5FF2A 4XTDA 2XFWA 3E12A 1GYLA 2TYSA 1X1ZA 4EF9A 1KLYA 3W2KA 5CPLA 3TSDA 2ZCGA 3BLIA 2CLKA 1L9WA 4CCEA 4UTTC 1IXNA 4XWUA 2VEIA 1JR1A 2Y89A 4MKNA 1FX6A 4CNPA 1SO4A 1GTEA 3M1ZA 5F4XA 1SPQA 1YTEA 4NJGA 4A22A 2VENA 2Z0IA 3OA3A 3G1YA 2X1UA 3W7GA 1VC4A 1PVNA 4G1KA 4LOCA 1B4KA 3EX3A 3EX2A 4UC5A 2QJGA 2B7QA 4O1CA 3TMQA 1KBIA 2GVJA 3W7RA 1KFJA 1RV8A 4UTKA 3GK0A 1VR6A 3W2UA 3G0UA 3LLDA 3LBMA 2VFEA 1F5ZA 2ATSA 3CWNA 4Z1DA 1XXXA 5D30A 4K7YA 3PWAA 1EEPA 1H63A 1KV5A 4QJ1A 5DXXA 1OX6A 2EHHA 2V2HA 4HHPA 3OVQA 1XUZA 2V30A 1TTJA 2FB3A 3CC1A 1XKYA 4JX6A 3MI6A 5IM51 1LBLA 1W54A 3R12A 5AFDA 3S9YA 1W56A 1XL9A 3RNDA 4OT7A 4QISA 3EKZA 3GDKA 2ISSA 1DV7A 1KBJA 1O95A 3AJXA 3U2OA 2R91A 3EWXA 4UFMA 2C3ZA 1KM5A 1B57A 3LHWA 3W88A 4GRSA 4HNNA 3BW3A 4LRSA 3P62A 4MFDA 4Z0JA 5AC6A 1UB3A 4HKPA 2E77A 4HIBA 4UFIA 5D2TA 3TX9A 5J5DA 3NG3A 1TPH1 3KOFA 3GX9A 3EWWA 4AWUA 1HTIA 2DZSA 1O5XA 3ABSA 4UFHA 3MP3A 1C9DA 3UNDA 3EB2A 5DXYA 2YYUA 4CNOA 2CWNA 1WBJA 5BMXA 5KSWA 1RQEA 1KM0A 2B7PA 1IIHA 2X1TA 3O6YX 3ZS4A 2GJLA 4GWEA 3M5VA 1QOPA 2ZZ2A 3K30A 3NO5A 1XDLA 2V81A 2QCHA 3CB8A 3NM1A 2C18A 1XC4A 3W07A 3T4CA 1WOAA 5K2ZA 1SO3A 4JTSA 1GWJA 2F84A 1KM4A 4LNYA 1O60A 3ABRA 3RF9A 3TCEA 4M5PA 1QOQA 1OABA 4AHOA 1YADA 3IIZA 3DXIA 4CLMA 3L65A 4DQWA 3OEXA 2C1HA 3PG8A 2JGQA 3TXVA 5K7JA 3DFQA 3W1QA 5K9CA 4UFLA 1Y0EA 3B03A 1LBFA 1L6SA 2P0OA 4K7VA 1JVNA 2Y7EA 1Q3NA 4GUFA 4AB4A 1EP1A 3E0IA 1SFLA 3R5EA 5F1UA 4Q33A 3PS7A 1CX9A 1WBHA 3RK8A 5L6UA 4FF7A 3MYOA 3LCHA 2P10A 5HUPA 3RU6A 3W70A 1ZJIA 1H7XA 3UY8A 6ALDA 4O50A 1DQWA 4LS1A 1GZGA 3FYOA 1X7FA 1N55A 4BR1A 2DZVA 2VEKA 5IBXA 4YWIA 3E02A 2FPVA 3EWZA 1ZHAA 1WDWA 3L66A 1S3HA 4I9AA 1M6JA 2YW3A 4QNEA 2VOMA 5G2WA 1W5OA 3QQ1A 3WJWA 3LCXA 3TSBA 5U7SA 2FLIA 2PURA 1F6KA 3LI0A 2E5BA 3ABOA 1HG3A 3TDFA 4GUIA 4N9CA 1WAUA 1KV8A 2V5BA 3PBYA 4N9DA 1G6CA 5C2XA 1MEIA
chains in the Genus database with same CATH superfamily
5JBEA 1NQKA 3S1XA 5E0KA 3TC3A 3VE7A 3H2NA 4RDWA 5C5YA 3FYYA 4B5XA 4L80A 5LIYX 1O68A 3CQIA 2FTYA 4K3ZA 1H7WA 3BG9A 1ZL1A 4D6JA 3FJLA 2EJAA 3W75A 3VZZA 5CGTA 2WVUA 1DJWA 2OYLA 4A4AA 1VFLA 3GIPA 3NXFA 3BVJA 1S38A 1TUFA 2W61A 3P8JA 3VK5A 2YDSA 2DSVA 2Y0FA 2WXDM 1XX1A 4LNCA 5E0CA 1TCDA 4CQCA 4P7QA 2G3NA 5C0QA 1C7TA 3EDEA 3VGFA 3UJFA 1UC5A 2WC7A 4XG1A 3SBFA 3VIIA 4M6UA 1QI4A 4CKQA 2Y2WA 3OBEA 4IHCA 5KTLA 2XN2A 4BWLC 5EBAA 4J1OA 2R94A 1WAWA 5HJYA 3BJTA 3LTPA 1L6FA 5D4YA 3ATYA 3CT7A 3TWAA 1CT5A 2CBIA 4EWND 5A95A 4L4LA 4GYPA 4V27A 5HWNA 1TA3A 2GL5A 4P8XA 1EIXA 4X61A 1A5NC 1VRDA 4DBEA 3ARYA 2V69A 3OBKA 3UVAA 3SUWA 1QW7A 3BCJA 1AVAA 5C54A 1BRLB 2OFJA 3WEMA 3N12A 1FWRA 3CQJA 1JDEA 8A3HA 4O1EA 5H1WA 1JCXA 2YYTA 3PJUA 3S1UA 1E43A 4ML4A 4Z1BA 2XIJA 3H4GA 3MJMA 4MJ4A 4H41A 3ONBA 3QY8A 1FCUA 1KC7A 1YTKA 3RX3A 3HB9A 1OFBA 2J7FA 4YYFA 5D05A 2ZUNA 3NQBA 3WL0A 2BB0A 2B81A 2IPWA 1H09A 3CV6A 3LMYA 2QT3A 4JOMA 5A6AA 3BMVA 3P3BA 3V4BA 1YDYA 4S23A 5ABHA 3W1RA 1RPKA 1YYAA 4PTVA 2DP3A 4IGHA 2VCBA 3LDVA 1B9BA 4N6EA 4O14A 3EA1A 3URNA 4LUSA 1L6WA 2WWCA 3RLVA 5DO8A 4AMAA 1OT2A 1PV8A 5FF0A 2J79A 3NQDA 4HU8A 3I6EA 3G1XA 4P5UA 3FKKA 1M65A 3HG5A 4EP8C 4JTAA 1NTHA 4RKAA 3LNPA 4Q3MA 1Y5XA 1XIHA 3LBCA 1HW6A 6REQB 1I2PA 1V3KA 3FVDA 4MJMA 4OOUA 2BVWA 4WY0F 1DIDA 3ZJ8A 2WLYA 1KW1A 1Z48A 4WKHA 1U83A 2Q3OA 4Z2GA 3G3DA 1B31A 1IEQA 2VRKA 5E93A 1MNZA 1DHPA 1C9WA 5HPOA 3N1AA 1QNPA 4S3JA 4O16A 2A3HA 3TA6A 3IJ6A 3SJ3A 3OODA 3VX0A 4IIHA 4HT3A 1UR2A 2KZHA 3M7WA 3TH6A 3NL5A 4Q7IA 3FJ6A 5GNXA 5RUBA 2V63A 3USZA 1XG4A 2AGKA 1ITXA 2NSOA 1SVDA 1LOLA 3L5MA 4FEZA 1BEUA 1MW2A 3II1A 1F4AA 1V6UA 3TQPA 3GAYA 3SAZA 1FWHC 1U2YA 3GUWA 4JAWA 4IQLA 4NASA 4KFPA 2X1SA 2XUCA 2FTPA 3TAOA 2YW4A 3M07A 3NSNA 3G18A 1D3GA 1W1ZA 3FA3A 2ZA1A 3PTMA 4ROPA 3WLRA 4LBRA 4JIQA 3S3GA 1IR2A 2CW6A 3LD5A 3GTHA 5ABFA 4ZE5A 5LNUA 3O0KA 1DIOA 4O1DA 1KFLA 3VM7A 3NL6A 4UQBA 1EO7A 4MWAC 3KLKA 3CV1A 3GH5A 3GFXA 3LV6A 3W38A 2EKGA 4IFKA 2YXXA 3AU2A 4LYKA 3B8WA 3CPRA 1SJCA 4J2MA 1EXPA 1RK5A 4B9YA 5HNRA 1OHLA 3V0TA 4C6KA 3TNOA 1RLDA 2Q8ZA 3VMPA 3QHMA 5HNUA 3FS2A 2BZNA 1OADA 3GR7A 3ZJ7A 4HZ6A 4LAKA 4HMEA 1RLCL 1A0CA 4E5TA 3R2GA 3GQYA 5A8NA 3W4RA 1ZJHA 1GVEA 2OR2A 2GOKA 4WCJA 4LALA 1SZNA 1TMQA 1VGAA 4NAEB 3BAKA 5CEWA 1K6AA 1DIKA 1R47A 1QO5A 3AXKA 4RK8A 1IEXA 5CQ1A 5AHEA 1UWRA 4BF9A 1R38A 1EWDA 5HQMA 1KQYA 2UZ9A 3T9PA 4D6IA 5K4ZA 4JTRA 2A3LA 1WA3A 2KAUC 1RBAA 3PAOA 1LDCA 5IDIA 1RK6A 4D8ZA 1XLBA 2AL2A 3H21A 3LHVA 2FJKA 3E96A 3BANA 1XDMA 2BHYA 2CHRA 1PSCA 3UZ5A 4FXFA 4J5NA 1T5AA 5TD4A 1QHZA 3EX4A 2XVNA 3UCCA 4CCZA 4M6VA 1HJUA 2EEXA 2UV8G 4U33A 5DF0A 4S3CA 3VGEA 2POZA 4PA8A 3UXAA 1O1HA 3CPGA 1B3OA 1VJSA 1F8MA 3KEHA 1OFEA 4ZB5A 2G5WA 3VYLA 1XLKA 2BTMA 3W83A 4AUBA 3NQCA 1JAEA 3ARWA 1QBBA 1PX3A 4OWGA 1K7FA 2FPYA 4LUIA 1TJ0A 1KRAC 1JPKA 2DJLA 4IP4A 2DUZA 3UA4A 3FIGA 4E2BA 4RXFA 5DMMA 1V5XA 2J8TA 1K8XA 4IM4A 3WMCA 4WJ8A 3A5VA 3IGXA 1TWIA 3M0MA 4MB4A 2ISFA 4FX7A 4GMEA 3W7DA 3T42A 3QHOA 3MVIA 4MY9A 3KZPA 1DJNA 2V0TA 3BAIA 1FCBA 3IJIA 1LTDA 3EPOA 1OZQA 1F61A 5HNNA 4JTEA 3A64A 1S2UA 1WXYA 3LS9A 3PUDA 1IWPA 1UPMB 4UMBA 3QGKC 1TR9A 4ZMGA 3QZEA 2BS9A 3POCA 5EL1A 3VOFA 3AHYA 3H2AA 4LANA 4QFUA 5J04A 4IUGA 3VNMA 1J2BA 2DZUA 4EACA 4NAEA 3A13A 3CTLA 4H9VA 2MUCA 2YFOA 4H01A 3SUSA 2VGBA 2WV8A 3CHEA 2WO5A 3MUXA 3QH2A 4KIEA 2BVDA 3HGRA 4PMVA 2QJHA 1GVIA 5CJMA 1FWAC 4Y9AA 2DW6A 3SDOA 3RHGA 3T40A 5CKSA 4GJ1A 3O2LA 3P7YA 2WMJA 3INPA 4Z1CA 1TVPA 3MP5A 1BVZA 4BI5A 4YVXA 1A5KC 4EVZA 1E6ZA 4LYRA 4S3KA 2QCGA 3ABQA 1ME8A 3BG5A 4JDYA 1W31A 1BKSA 1G7VA 2CPUA 1GPWA 4LF1A 3KXQA 1ZB5A 3JZUA 3GZ3A 2ZE0A 4IPJA 1TJRA 2CLEA 4FXRA 4TQTA 2A7PA 3ZMRA 4MG4A 1KGXA 2OWXA 2YXGA 1MQRA 3W3OA 2WMKA 3MCMA 4X0VA 3PNZA 3WH8A 8XIAA 3M0ZA 5DX7A 1OVDA 2ZZ4A 4LYQA 3WL1A 2EF9A 4LX4A 3N15A 5LHFA 5FSEC 1WZLA 3DDMA 5FF4A 1F4HA 4TV5A 4XKYB 1UR4A 5TF0A 4PMXA 4XZLX 3AHZA 2V9DA 3D6NA 4NX5A 3N34A 4H9UA 2VC6A 3TR2A 4UOQA 3W1UA 1RP9A 1KXHA 4A3HA 1ZY9A 2ACSA 5H8UA 3WX7A 4N42A 4IGMA 3QPEA 4D6FA 1X96A 3WG6A 3B8UA 5REQA 1P48A 3HPZA 1CGYA 4AD4A 3QOMA 4H9XA 4HOWA 4WDXA 3N25A 4KESA 4IIGA 1MXGA 2CEQA 3GU9A 3B9EA 4NZFA 3LCIA 3H54A 4EXQA 3QSTA 3IVTA 3QF0A 5H91A 4NU7A 3MMTA 5A1AA 1HJWA 3CJPA 3EEZA 1LCOA 2X0HA 4HCDA 3KBJA 4JY9A 1MZHA 1JQVA 4WJXA 5H8MA 1LOQA 3AIUA 5G4WA 5C9ZA 3WQFA 3IAQA 4O54A 3W6MA 1EPXA 3SN4A 3JVAA 3VIGA 5LNVA 1IQ8A 2VEMA 1E15A 3SFKA 3R1ZA 4Z17A 2NZLA 4CD5A 1VJIA 4Q7BA 5GQBA 4LYPA 5EMUA 3RIKA 1EJXC 1SJAA 4HMDA 2PTYA 3CZGA 4IQDA 4FNUA 4M24A 3NXLA 3CQHA 4ZO8A 1JD7A 4WLCA 4X9YA 4ZEPA 1SZRA 1GQKA 4DZIA 3RFAA 2QVHA 1LQ0A 2XIMA 5LSMA 4IG2B 1FXQA 2WMIA 1LM1A 2XVLA 1JDCA 4AEFA 3M44A 4MMWA 3V7PA 2B31A 1OWQA 4XSLA 3XINA 3TYCA 3IGHX 1P6CA 3OW1A 2XM2A 3UY7A 4OOZA 1XGEA 1PHWA 3KRSA 4HSOA 3HFTA 1MEWA 3UWEA 3VNZA 1K1DA 1LT8A 3CO4A 1XICA 4FB7A 1UUOA 4ASTA 5K3VA 1QNQA 1R3QA 5M17A 3C2YA 3VCNA 3W6YA 1UOKA 2QCDB 4E6MA 2IQTA 3SY5A 3UZYA 5A5WA 1M9HA 3RLUA 2P53A 3LBOA 2XN1A 4ZTXA 2W79A 1PS9A 1J10A 2ZUUA 2E9BA 4L4OA 3OIXA 5FKYA 2YCIX 1I75A 3K4WA 1KCKA 4S2BA 1CXEA 4EPEC 1TV4A 2BOGX 3E2QA 2ACRA 2NXHA 2QJMA 3IIXA 3DHPA 4AHPA 4H4IA 4C6BA 5G2HA 3UNTA 3T8QA 4KMQA 1DJQA 1CGVA 3HN3A 4Q6XA 1XYMA 1S5MA 3KS6A 3PZOA 1H7OA 1YMYA 4R34A 3L7RA 2XG9A 3VO0A 4J3SA 4YPJA 3WLIA 4UR7A 4DBUA 1X6LA 2P88A 5EPDA 1R6WA 3LCFA 3GD6A 3USBA 2GOUA 4KRUA 1XIIA 2D2JA 2WOQA 4AY8A 4LY4A 3JW7A 4J3VA 3TYUA 4GG9A 1EYWA 2Z25A 4EE9A 1X39A 2JK2A 3KHDA 1BQCA 5IXEA 1YPIA 1D9EA 4JD4A 4Y96A 2Y7GA 4ZA0A 3KM8A 3RJYA 4M0XA 2D22A 1R30A 2DORA 3PANA 1JULA 3W87A 4CGTA 2PDLA 2DZPA 3NPWA 4IP7A 3CYJA 2OEMA 1MDLA 3VFCA 1W1YA 4RDYA 2C6QA 2WKGA 3HF3A 4OV9A 4A8RA 1X8CA 5D33A 4LXFA 3E2VA 1EJSC 5C9UA 3TOYA 5I3JA 3VIHA 3SO7A 3QY7A 2I17A 1JYNA 1JDFA 3K13A 1QPRA 1TIMA 3F4CA 4QE4A 3HMJG 2UWFA 1H51A 4LWWA 4M19A 1NH6A 2QHAA 4HK5A 3CHFA 4CNSA 3NPVA 3TTQA 3SJNA 4MADA 2ZUMA 4FMVA 1Z44A 4QRNA 1IHIA 2ZZ3A 4QE5A 3QW3A 3MUCA 1JUKA 5T26A 4CCCA 4FA3A 1VYPX 4KFNA 3NTYA 4LVDA 4QQUA 3TKFA 1JUBA 1P4CA 1ZAHA 4ZQRA 3NZRA 3Q37A 1M1BA 4GXWA 1HO1A 4NF7A 1VBHA 3F5LA 1DE5A 1GKRA 2PDMA 3WK2A 4H8VA 2REQB 4HSHA 3ZJ6A 2TSYA 4RJEA 2YL5A 3M64A 1TFVA 1QMLA 2RKXA 3S8HA 4TIMA 2AAAA 2D73A 4C6JA 2WSYA 1V3IA 3QW4B 2WYSA 4WKFA 1KTNA 1Q4WA 4MJZA 3LGDA 3W37A 3M6YA 2PPGA 4QLLA 3QTPA 2WCGA 4LUSB 4PEEA 1TB3A 2VNCA 4ATDA 2I57A 4AEOA 3N2OA 2J7CA 3ZWSA 4IIDA 3SI9A 3I4EA 3TYEA 1LZOA 3WNPA 3EEGA 1AD1A 4XUGA 3SSZA 4TV6A 1DVJA 1FHVA 3B4YA 2ZXAA 3W1PA 5FJOA 3V5FA 1B5TA 3SZ8A 1FWJC 5CGMA 4LV9A 2DFAA 4J35A 3E9AA 5JBFA 1PXGA 4J3XA 1MXSA 3GDTA 1NJJA 2Y61A 1AW5A 4NJJA 3ICJA 3RX4A 3UG5A 3ITTA 2P3EA 1KFKA 2VM8A 3IIOA 3EWYA 1A53A 1VFMA 3ARRA 2GUUA 1G94A 4GVHA 2RH9A 3LHTA 5I02A 4L4PA 5TAOA 1KCLA 3JS3A 2BG5A 3CLMA 1G4PA 3THQA 3FAWA 4GIAA 3OLEA 5FJJA 2ABAA 3DI0A 3O8AA 4NY2A 3PTQA 1O12A 1S2CA 1QK2A 3AZSA 1K9TA 2WB5A 1GQNA 4BJHA 2HISA 1W2PA 1DTNA 3BURA 1QR7A 2VR2A 4JTJA 1PIGA 3OZMA 2Y5SA 1SZFA 4N9BA 3NCOA 2YLLA 2XH2A 3W85A 2FVKA 3I3DA 2V5JA 1O5KA 2BFGA 3SGUA 2P1FA 4N9EA 3UVIA 3REQB 3Q94A 3R0DA 4K1WA 1VIWA 1GKPA 1IT7A 6TIMA 4YXGA 1U5VA 4AWTA 4XZNX 3RAOA 1PUDA 2XIQA 3N4AA 4DAFA 1VBRA 5AHLA 2PDBA 3KL5A 2VZSA 3F2DA 4XAYA 4G6CA 3A3XA 2XH4A 3NNTA 1OB0A 4ADTA 1R7OA 2C13A 2VX5A 2A1YA 2YDQA 1YXYA 2J7DA 4GY0A 1WZKA 1X1OA 1YIXA 1TPFA 4O28A 2O9OA 2YDAA 1V4YA 4BA0A 1W6TA 3VGHA 2WZMA 3BGJA 1C8XA 1X38A 2PS2A 2AKZA 4GIEA 2V3EA 2ZZ7A 2IUZA 2V5LA 4AG0A 3MZNA 5AYZA 1I4NA 4HA4A 3OA5A 3FK4A 3L4UA 3I7RA 4A35A 1YTDA 1EUNA 4DPQA 4MZ1A 4WZHA 1DJXA 4IMGA 4ATLA 5XIAA 4UBPC 2GGJA 3KE0A 4LBUA 5CZJA 3LTYA 2ZKMX 4M7TA 1BXCA 3CWHA 4C1NB 2ISWA 1M53A 4YTTA 1J5SA 3WLJA 4PBEA 3VNKA 4D9PA 3WK3A 4DPPA 2VXNA 4RE0A 2PTZA 3UZJA 1G4TA 3F5KA 3M47A 3W7PA 3WNLA 2FDMA 2PWHA 2X42A 4H9TA 4N02A 1SR9A 5JBDA 4ZXLA 1DWHM 4EK7A 3QMTA 9XIAA 4GK8A 4OIFA 1XLGA 4PSRA 2QGHA 4ADUA 1XPYA 3R6IA 1TPB1 1A50A 2OQHA 3C61A 3VGDA 2HXUA 1A4LA 5KZDA 8XIMA 1MO0A 3O15A 5DELA 1E6RA 5FJTA 3PUEA 1IZJA 2ZX8A 3O0FA 3CZEA 4DNMA 4Q4QA 1UZ1A 1OY0A 3UBPC 2X7WA 4CU8A 2FTWA 3K8KA 1PZ3A 1WV2A 3LOTA 3KAOA 5CLTA 1UJQA 2QKFA 4RR4A 3GNNA 5AYXA 5HA7A 3W7IA 1X6NA 4IP5A 4FS9A 3GU1A 1A5OC 4I9TA 2VHLA 3EMQA 3AIBA 3G77A 4TR9A 1RA5A 3TEVA 3M0JA 1TWWA 4JHOA 2CLPA 1KR0A 2OZ3A 1QI5A 2IKJA 3VA8A 3FGCA 2PTXA 3TQ0A 1MZRA 5LA0A 1KXQA 2I7GA 1M7XA 1AFSA 1ZQ5A 4AY7A 3EPMA 4XUYA 4ERIA 1DXEA 4YLWA 2OX1A 1WXJA 2OYMA 3GTNA 3S6OA 5HDRA 4A2RA 3VIOA 1R8LA 3O6CA 3Q65A 4OTKA 2QMKA 3NAVA 1TQJA 3S2NA 4WKAA 1KTBA 3GUGA 4RZ6A 2Y5EA 3ZR6A 3W7MA 1WE5A 2DZWA 3CMGA 1H5VA 2HBVA 1R3SA 4B3KA 1ZJBA 4WDTA 3LLFA 1QAPA 3AMCA 3QV6A 3CEUA 1D8CA 1FA2A 3G1FA 2ZIDA 4GFIA 3GG8A 3C3NA 4XBKA 3GNRA 2JQXA 1EJWC 2Q71A 1RVGA 4NZ3A 2VCCA 2OG9A 4R85A 5CSYA 4BEUA 4BF7A 1T0OA 3FVMA 5IBXC 2OMAA 1FCVA 3S5ZA 4B9ZA 1TTQA 3HG3A 3PG9A 3WLQA 5J5RA 3F03K 4NIRA 1OIMA 1WDRA 1MFUA 2EBNA 3P0XA 1UUMA 3LM3A 4Z42C 1VPQA 1JRBA 5DY2A 1JXKA 3F2CA 4LS0A 3UZWA 2J6XA 1KWKA 4UB9A 4Q8NA 4E2DA 2OWCA 4MNJA 1J11A 4C7GA 1PCWA 3KOXA 5FEWA 2QR6A 3LMZA 1AUSL 2PBOA 1ZRQA 1A47A 3ZIZA 1Q6LA 4PUNA 3IAPA 1X98A 3A22A 2HK0A 1W17A 1QUMA 2V3GA 1IR1A 3CZLA 1OCQA 3WQGA 1KBLA 1XQLA 3HFYA 1W9BM 1CNVA 2JF6A 3PPGA 5I6SA 1KGWA 4GD0A 4PMNA 2HEJA 1HP5A 1XFBA 4FSAA 4U31A 4DLMA 1J18A 2RDWA 4IMFA 4D72A 1XP3A 5LA2A 3N2MA 4H9YA 2J8FA 4RLIA 3E74A 3VIMA 5FF2A 4XTDA 4JN8A 1EF2A 4IFKB 4GPNA 1AD4A 1MQPA 3UYIA 4PUKA 1X1ZA 5G4HC 2VEGA 1X7IA 4HOXA 4B16A 1GOIA 1QHPA 2ZCGA 2CLKA 4NZ5A 1TCMA 2PDHA 1BSIA 3E3HA 2ZICA 1JR1A 1UR9A 4MKNA 1VBGA 3GFZA 3WD0A 1SPQA 1GQJA 4G56A 3G1YA 5I24A 3BGAA 1C8QA 2QJGA 2ZUTA 1H0GA 1KFJA 4JIIX 5CSUA 1Z8AA 3ZVIA 3S2JA 5BWAA 3VC6A 3CWNA 3WQVA 1EEPA 1E40A 1KV5A 4QJ1A 1OX6A 3VDBA 4HHPA 3OVQA 3WQ8A 3N2TA 3S5SA 3QLLA 2V30A 3KTSA 4M82A 2FB3A 2OOGA 2GQ3A 4HHHA 4F66A 1RXOB 2PZNA 4EWJA 3MI6A 3WFZA 2NVDA 1LBLA 5IM51 1TG7A 5AFDA 3S9YA 3RNDA 1XL9A 4QISA 1CECA 3EKZA 1JDAA 3N3TA 3OIHA 2GJPA 3MSYA 3WH7A 3LSBA 4KWUA 1P7TB 7XIMA 1KM5A 1B57A 3LHWA 4LRSA 3P62A 1AQFA 1R85A 1EOMA 4MFDA 1UB3A 3BL3A 3OLDA 3BCFA 3CBWA 1JGIA 2E77A 4JQ1A 5FAJA 1HKWA 5D2TA 3EMCA 5EMLA 3EWWA 5EMJA 2WVSA 3SQMA 1HTIA 4IGNA 2BXZA 1JYXA 4JKLA 3AMKA 1C9DA 3UNDA 5XIMA 5JU6A 2GK1A 5DXYA 4AD5A 2YYUA 4CNOA 2OVLA 3AYVA 1WBJA 2W5FA 2DW7A 4GWEA 4JQAA 4PTDA 1VEMA 1HF6A 3NEHA 2QCHA 3CB8A 3IJLA 3SQLA 2C18A 4PTXA 5C71A 1SO3A 3TCEA 3IACA 4TUFA 4AHOA 4O8AA 4CLMA 4LFYA 4L61A 4JKMA 3GC2A 5K7JA 3LEPA 3GVWA 3DFQA 5K9CA 1Y0EA 3B03A 1S3TC 4ZENA 1EOKA 1LBFA 2P0OA 2BY3A 1JVNA 2Y7EA 4K7VA 4DJED 1Q3NA 4GUFA 1EP1A 3ZVHA 3R5EA 5CC7A 2J74A 4Q33A 3LENA 2PDKA 5L6UA 5FA5A 3MYOA 3LCHA 1UMLA 2HPMA 1XPGA 3UY8A 4FR6A 4LS1A 1LWHA 1N55A 4BR1A 3OG2A 2HNHA 5JIPA 2DZVA 1FWBC 1N8WA 2VEKA 1E73M 2J8GA 4YWIA 2R6OA 3C86A 2YW3A 2XVPA 3JU2A 2R1MA 3DG6A 3H2FA 5I79A 2JEPA 3G5EA 3WF1A 3EGJA 5U7SA 1FHDA 2PURA 2E5BA 4B3ZA 1WAUA 4V2XA 1XJBA 1NDZA 3B3DA 1UBPC 3PBYA 3KBWA 3C8NA 1D7FA 2YDRA 1G0CA 4AD0A 2X8RA 3QR3A 2OYKA 3H22A 2FPTA 2Z1KA 2ZBTA 2QUUA 3LRMA 4DF2A 1MQQA 4LB3A 2WNQA 1HKMA 3TA9A 2OX4A 1UW9A 1NSJA 3G1AA 5AECA 1CXFA 3T81A 2HNEA 3S5NA 3UGVA 4AW7A 4ZO7A 2BWGA 4B5TA 4I9JA 5G2IA 1H0IA 1V77A 4K36A 1XCFA 3VNLA 5DCBA 4DYKA 1QHOA 4DN1A 2PSNA 2RFGA 5C7VA 1AJZA 2CZFA 2ACQA 4LAMA 1Z89A 3WLOA 2GVLA 2IPJA 4Z1YA 1C91A 4LS2A 4BF5A 2YB4A 1ME9A 2ZXQA 5D32A 1GEQA 3BOXA 1OF8A 5I7GA 4AISA 4LUJA 3FJNA 1J2WA 2BLEA 4W5UA 4R27A 4FNSA 1TWDA 1V7AA 4E8DA 1PKNA 1EC8A 2E5DA 3EXRA 3WH9A 2J7BA 4NG3A 2A21A 1FDJA 3BW4A 1SZEA 1VCFA 3AAMA 1FWNA 1S5WA 3K8LA 4JX5A 4F0SA 4UTIA 1YW1A 3CLWA 4ORIA 2BSLA 4IXXA 3GG7A 4C6FA 5GJNA 1SQ7A 2Z6IA 1HP4A 4JTTA 2A0NA 1EQCA 3BGGA 4KCWA 3HG2A 2WKLA 1S5NA 3CAQA 4V33A 4JTQA 2ZC1A 4C7DA 1BWLA 4DXXA 4O0QA 4G5DA 4E8GA 1UP3A 1W1IE 5KZMA 1GYNA 2DZTA 3PVFA 4EIVA 3QBUA 1ELSA 3W7CA 3ARSA 1LRTA 5XINA 1UZDA 5LIXX 1BXNA 5E6YA 3CHVA 3VX1A 3B05A 2E28A 1W5MA 4YHGA 4Q4MA 1LL7A 4AD1A 4UR8A 1PO9A 4OZOA 3GG0A 4ZR8A 2Z7GA 4RPPA 3TSMA 4I6KA 4JIEA 4QIUA 4Q8VA 4L65A 1MDRA 1DEDA 5D2VA 1KRCC 3VPLA 4IMCA 3APTA 3KHJA 2F38A 2QAPA 4DO6A 2XSAA 1EPVA 1KCXA 2QDDA 4C6QA 4YCOA 5ABTA 4BS0A 5CPNA 2J4GA 3IARA 2IKIA 4QG9A 3TN4A 1JI1A 1B3YA 2AMXA 4LVAA 1PZ1A 3H8AA 3A6OA 4L4MA 2PWGA 1W3HA 5D2YA 2D2HA 1ML1A 1J6PA 3TTYA 5DCDA 3C2EA 2B7OA 3IJQA 3VCCA 2EJ1A 4ENLA 2Y7FA 2YCLA 2PDJA 3GKAA 3NQGA 1JRCA 2ZVIA 1YDNA 1HJSA 3B0YA 3VD5A 3V3WA 4GUGA 4X22A 4NYUA 3PSWA 2HS8A 4PCFA 4V28A 1L6GA 2PDUA 3AXMA 2ZC8A 4NJHA 1BD0A 2IMRA 4O17A 3OZOA 2W9MA 3FJ4A 1J9YA 1HKJA 3TFXA 1B3WA 4C5YA 1UD6A 3KW3A 4C6EA 3UP8A 1F3XA 2WMIB 1R3TA 4I5UA 2OLAA 4U3AA 2W66A 5MF5A 2Z00A 3LX9A 1XDJA 1EHAA 3DOPA 5EY5A 1E3ZA 2XIBA 3AS3A 4LCQA 4GKLA 4BHYA 5LNRA 5C2CA 1Q6GA 1O94A 2I9UA 3AIVA 1RY0A 2EPLX 3SUTA 1IXPA 3NQFA 4AY1A 4Y8EA 4OBRA 1B90A 1IZKA 3HURA 3K5XA 3W84A 2ZRZA 3P8IA 4BQ5A 2D3NA 4KBXA 1VB9A 3WIJA 1VF8A 2PRMA 3LERA 2Q8LA 3R4IA 1BQGA 1XH1A 3OGRA 2VD9A 1H5YA 1HJQA 3VXGA 4EKJA 3WUGA 3GVQA 3AALA 4RX0A 3CL7A 3ENLA 3R89A 1OD8A 4PMYA 4AZHA 3IUDA 3FDKA 3PZ9A 4QEHA 3S1GA 1JYWA 3K1GA 4TMBA 1LOSA 3QEZA 3UR7A 4OQVA 5G1YA 3QC3A 2YL6A 3CNYA 3HIJA 1EB3A 4IOTA 5KINA 4OBSA 4NZJA 1KM6A 4JEQA 3SM0A 4F40A 3K4AA 4PL2A 2G3JA 4ACYA 2B7NA 3A3HA 5HXMA 5HPCA 4FLQA 4JNMA 3KRUA 3VNIA 3NDOA 1VFTA 1KBBA 5M2FX 2HXTA 1UWTA 1WXZA 1GK8A 3EWBX 4XKMA 3P84A 4MKVA 2C0HA 3ME3A 5D9OA 1GG1A 4WRHA 4IPPA 2E09A 3RG6A 3FY1A 4KF1A 3DUGA 1A3XA 4RXGA 2BNJA 3ZLGA 4D6HA 4EAYA 1L2UA 1C8VA 3S2MA 1W1TA 2PP1A 2TODA 4A3QA 2FDSA 2V3FA 4WOQA 4JICA 4V1YA 2X16A 2W92A 2CLLA 1R0MA 4MWAA 2JKAA 4HB7A 1E0WA 1EGVA 2J7HA 2WW5A 4JIRA 4JTLA 4MYXA 4REQB 4NVTA 4O10A 8RUCA 4F48A 4YHEA 5A6MA 3VABA 5HQEA 4Z2KA 3UWQA 4D2JA 1VFFA 2ALDA 2JBMA 3PPHA 5CSRA 1J01A 3UESA 1TPWA 3WBWA 4WEVX 1UD8A 3SECA 3GW3A 3MCOA 2FGLA 2QCNA 2ZE3A 1OQFA 4U2ZA 1UD2A 1BYCA 1AMYA 1KGUA 4H6KA 1XIBA 3DG3A 4QE1A 4LPCA 4AVFA 3BLPX 3MMDA 4CNTA 4O19A 1U1JA 3GKFA 3MA8A 2PWDA 4KQNA 1PKLA 5REQB 1UIPA 3VGGA 4JS3A 4EPDC 2CLIA 2HJPA 5A6KA 4ZL1A 4GNJA 3UCDA 2XJ7A 3TROA 1C3FA 3AIQA 4F0LA 3QR0A 4MHBA 1POJA 1UKSA 1GGOA 1QJWA 3IRSA 2HCVA 3BO9A 4HSNA 5DFAA 3IWPA 4NILA 2BV9A 1US2A 2FB2A 3HMCA 1PTDA 1KTCA 2C16A 2EPKX 4MB3A 2J7GA 1NIUA 4L56A 3N18A 2VX4A 4GCAA 1ADDA 2BGQA 1NDWA 1XLDA 3WLSA 3AYTA 3N9RA 4PTMA 1TPDA 1IT8A 2Z28A 3NO1A 2WHKA 1F9CA 3SCTA 3BARA 4CD8A 3P2VA 4G8TA 2QMJA 4B5WA 3QVQA 2WSKA 3DHUA 4JFWA 5BWFA 2BXYA 5A8MA 2JKEA 1VCGA 1WQ5A 2PFHA 1EEXA 4XQ6A 1RHCA 1OINA 3FFSA 1QO2A 2PAJA 4KETA 4HNTA 1B3XA 3CV2A 1BF2A 4TX8A 3N9KA 3L21A 4MFEA 3PUOA 4TVDA 5HR7A 4WQ6A 3K1DA 3UR2A 1EBGA 2QCCA 5AYBA 2E1DA 2V8ZA 1DQUA 1LLZA 5AHIA 3HZ3A 1Q85A 3AS2A 1W5PA 2ZTJA 3G1VA 1UWAA 3OYXA 4I6VA 5LNSA 1LP6A 2NV1A 5G1TA 3WDJA 2VZTA 3WQ5A 4RCXA 4FAMA 3P74A 1PB0A 4O1AA 2BVYA 2UY4A 1P43A 4HHMA 4NI3A 4PUDA 1VPYA 4GZ7A 3WKZA 1JXJA 2PODA 3V0UA 2BOFX 4J3WA 5A2AA 3WH6A 4MDOA 3B0XA 4EPBC 1Q2RA 3WH5A 3WQWA 2GDVA 4US6A 2OKTA 2C14A 1OFOA 3W01A 5LIKX 2EXOA 5KMYA 1M68A 2WCSA 1OX4A 3T2QA 5DT7A 1TPEA 3CMFA 4H9MA 3VMOA 2WBKA 2OQLA 3TJIA 1V3JA 3LG3A 1I0BA 3FHAA 2ZRYA 3PF3A 1VCVA 3ITYA 5CPQA 4XVDA 4GQGA 1RJQA 1ONRA 2WNNA 4DBWA 2BASA 3WUFA 3ZLFA 1XBYA 4W87A 3LU2A 2WMFA 4UQAA 3H70A 5FJUA 4NZCA 5D2XA 1ODUA 1TX2A 1OEPA 5JXQA 4UQEA 3L0GA 1E9ZB 3N9SA 3CZJA 1KO0A 2IQDA 4JZ5A 3BCDA 3A4JA 3Q2DA 2GYIA 5A6JA 1OT1A 3WCZA 1DORA 3IRDA 4Q7NA 4ZQPA 1P5BA 1E72M 2PTWA 5A8OA 4HPNA 4FOUA 4D6DA 3AU6A 5CG7A 4CU6A 5E9XA 3ARTA 2OSWA 5CBJA 3Q45A 1V0LA 2WJDA 4W9TA 3OHIA 1S2TA 3IV3A 3ZZ1A 2W6RA 2G95A 3BICA 4XZMX 3T05A 4MY1A 2PCQA 3O9NA 3WLHA 3XIMA 2VGIA 3VIJA 3GAKA 1FWEC 1HGWA 3L4ZA 2VZVA 3DC8A 1B2YA 1PDYA 2OZ8A 3URAA 3ZT5A 1U22A 3NYDA 4FLOA 3KS5A 4AYSA 1K3UA 1BAGA 4DEFA 2P3ZA 4XK2A 1REQA 2PI6A 2ZX7A 3TUUA 1FDZA 1ZAJA 3SQSA 2A85A 1CGTA 1FOBA 1K7XA 4L5ZA 2Y1HA 4JTHA 4PCSA 4L1GA 3CUIA 2WNZA 1WZMA 3M0XA 9RUBA 6CGTA 1XD0A 4X2PA 3WNOA 3C5QA 1VRXA 2IPFA 5DMNA 1BTCA 3SIZA 1NU5A 3TV8A 1E6XM 4LU0A 4X60A 1DBTA 1VLWA 4LB4A 4LGXA 3KBNA 2CNCA 5C55A 4QITA 4PRTA 3DKLA 1O5QA 1Q6OA 1XLLA 4LT9A 2PD9A 3WF4A 2C15A 5I09A 3CUFA 3ANUA 3UG3A 2OGYA 3IJDA 1R87A 4BQ4A 2V2DA 1VKFA 1E0UA 3N13A 4UZSA 5AC8A 2VGFA 3EX1A 3GHTA 3GVRA 4AWEA 4LW7A 4TX9A 3T0BA 3IEBA 3AWOA 4UFKA 3GS6A 3LA4A 3BLKA 2FGZA 1KM2A 2WQPA 5CH9A 1OYAA 1FTXA 3KVLA 2V2CA 1UUQA 1V0NA 3KTXA 3BDKA 3LGEA 4L1WA 1NEYA 2QIWA 2E1WA 3BAJA 3UJEA 4NT0A 3VKBA 1F07A 2WMHA 3L5LA 1M7JA 3QR1A 2ZZ5A 3U8GA 1KFBA 3H26A 3CZ8A 5BRPA 3DFPA 3G8EA 1WB0A 3M41A 3TFCA 2Z1XA 1EDTA 5I77A 1SSGA 1WKDA 1E70M 3RUBL 3DEQA 3EDDA 1WP6A 3T7VA 3VD4A 1CI1A 4AEEA 3B4UA 5E1QA 2CLFA 1O5RA 4LUYA 2W91A 4PBGA 2OSYA 4GNVA 2EG6A 1W32A 2Z2UA 3DH7A 4AZCB 1UD4A 1BXBA 4HHLA 4HYRA 3FKRA 3QGVA 4DXVA 2Q8XA 3LHZA 1PEZA 3GFYA 1M01A 4C1NA 4CVWA 2PC8A 5BZAA 2YKKA 3O6DA 1QVBA 2H8ZA 1W5NA 3LTSA 1K8ZA 1Y5WA 1LT7A 4IIBA 3ZR4A 2CZVA 2WJEA 2D23A 2OZTA 3W7OA 1PZ2A 1UWUA 3LI1A 3KCOA 2GDQA 3ONCA 1W8SA 9CGTA 2Z1BA 4TVCA 1V6YA 1KBKA 2GGIA 3H23A 1SFSA 1SMAA 2HWGA 4NJKA 4S39A 4N2YA 1AH3A 1R2RA 4A6GA 4GQBA 3GXTA 2FZ9A 2O4QA 1V6TA 1IT0A 3HOJA 2AGTA 4XBJA 4M7SA 1R46A 1R3VA 4NI8A 3B0VC 4QTGA 4ACZA 4ZVJA 3PFRA 4J3ZA 3W2NA 1GJUA 2GSHA 2VFGA 1JJKA 4G7EA 3C4UA 2J88A 4W5ZA 1TR1A 1X97A 3EOEA 4A3UA 3W81A 4PCPA 3W73A 4RV8A 4YYCA 1Z32X 4WXYA 3LY0A 4JTDA 3ISIX 3HGOA 1CLXA 1N8IA 4OGZA 5A6LA 4ZCWA 5TNVA 3T1GA 2TRSA 1UOZA 2E9LA 2Q02A 3SN1A 2HMCA 2WC4A 1O6IA 1CTNA 4PC8A 3N11A 4ZFCA 4FX6M 3QFEA 1QWGA 2PDNA 3W22A 2AKMA 4NZ4A 1QATA 3VOCA 1WCGA 3W7LA 3O3RA 1YNYA 3R43A 1OBAA 1PKMA 3N2CA 1F7BA 4E4FA 4UOJA 4NNAA 3S1WA 3MYPA 3TWBA 4FNRA 4MLRA 3GSMA 3IV8A 4JR5A 1I1WA 1Q6QA 4KIRA 3IUIA 1XRVA 4HZ7A 1T8QA 4PZVA 1VHNA 2I5GA 1THFD 3BLEA 2QPSA 2Z1WA 4I7WA 1IWAA 3IPWA 3IANA 1K8YA 3DERA 1ZBKA 4UNIA 1XLEA 5BXPA 5DQPA 3ZFHA 4LQ1A 1W3LA 4HNUA 3VOHA 1HL9A 3UYCA 2IW0A 4R3UA 2D0HA 3DFYA 3APYA 3ZVHB 3JR2A 3LGGA 7ODCA 3FCPA 4MAVA 5M3WA 4GZIA 3I6RA 3CHCA 3L0KA 2H9AB 3KP0A 4LUTA 3PP7A 3RO6A 3TZNA 2WJZA 3FAXA 4PUMA 3STGA 2PWVA 2Y24A 4M80A 1IF2A 1UWQA 1XCWA 2E6DA 3MO4A 4MIMA 4O4VA 4UOZA 1CXHA 2HK1A 1VS1A 4KWWA 4O0ZA 4B90A 2XWDA 4MYAA 2D69A 1YBQA 4RZ5A 5LIWX 2HPIA 3QPYA 4PUJA 1JPMA 3HBLA 2JE8A 4FHAA 3S9IA 3TTEA 4HOZA 1AA1B 4C6DA 1RY8A 2IXUA 5A6TC 2J75A 3QMSA 4R53A 1VYSX 2WHMA 1BSLA 2A2IA 3GLCA 4J27A 3EAUA 1XLHA 1UKQA 2YR1A 1B30A 3BAYA 4HPXA 4GFSA 4UTUA 3R7MA 1E9YB 3W82A 4M6QA 1OCBA 1Q6EA 1TMHA 3NSMA 3U4FA 1AQMA 2AAMA 3H7RA 1RBOB 2QW5A 3IVUA 4MNMA 3PTKA 2FVMA 4N7QA 1FXPA 5DBTA 2X41A 4WDWA 3WMLA 4NP7A 1TIWA 3VNDA 5BRQA 2R1PA 2V67A 3H4WA 5G1MA 4Z2IA 4JKKA 4YL2A 3QMRA 3DESA 5MHBA 2VMFA 8CGTA 1DJYA 5IHRA 2CXEA 2VWSA 3H2EA 1HGYA 5CPSA 3KCJA 3LHUA 4ORMA 1EZWA 1M04A 3RILA 4F0HA 1I2OA 2V68A 2ZRUA 4XAFA 1K70A 1SO6A 4DM2A 3PY2A 3KUMA 2IPGA 4PE8A 1GVRA 3DHDA 2XZ7A 4LSBA 3GH7A 1XBXA 1SO5A 4BQ3A 1VHCA 4US5D 4CEUC 3F4NA 1FHUA 4LC8A 4W8BA 4UNKA 3WNNA 4C6CA 1SW7A 1SYTA 4IQEA 1GZ1A 4LAOA 3A21A 1QWKA 3WEZA 2ZTKA 1TELA 2YJQA 4OUEA 1AZ2A 1RQHA 2NX1A 2ZQ0A 4HYVA 4A8NA 1QBAA 3L23A 3W72A 5LGZA 2POTA 1VYRA 5A2BA 2BOEX 2DEPA 3IJ8A 3RR1A 3U4AA 3SUVA 3BJFA 5TIMA 5A2CA 5FL0A 4DZAA 3U2ZA 3TYAA 3G1RA 4HTBA 3ERPA 3BJSA 3BG3A 2ISVA 3I7QA 1BYAA 4LCSA 2QV5A 4C6IA 1HNYA 4MY8A 1WKEA 3B97A 2DZBA 2A6LA 2OO0A 1OCJA 1IGWA 1V3MA 5E0FA 4HU3A 4GBUA 1J6OA 2GQAA 3NUKA 5BCAA 2PLKA 2Y63A 2DZXA 4GNKB 5C9RA 3NQVA 3NQ2A 4JQ2A 1R2TA 2HTMA 2X2GA 5HNTA 1XD1A 4RZ4A 1EIBA 3MHFA 1LROA 1UH2A 1JFHA 1S2WA 3GHUA 2OT1A 4XD4A 1E56A 4LRTA 5HMDA 2HE8A 1CPUA 4ZQCA 1EJTC 3VILA 4DWSA 2G50A 2ZWZA 4BWLA 1SW0A 3VE9A 1XINA 4F0RA 1KXTA 3R0UA 1L6YA 4GX8A 5K9XA 4U10A 3UWVA 3M16A 3MDUA 3N4EA 5DRIA 1ZBVA 3MO7A 4Q8WA 2RJHA 3OLGA 5G5IA 2XVKA 3R13A 4AU0A 3CPUA 1V08A 3CH9A 8TIMA 1IZCA 3HGSA 3TVAA 2PDWA 2XIOA 4CQ9A 1E6SM 3OQEA 1FWSA 2PP3A 5JVLA 1JCLA 1AODA 2VX6A 5AC7A 2A7NA 5E9AA 1JUEA 3FLUA 2DVTA 2E6AA 4XAGA 4B91A 5CZKA 4CD6A 3W7KA 3A12A 3PWIA 2TMDA 3V1HA 4PCNA 4HYWA 3SY8A 4IGSA 3AFBA 2OWWA 5FOOA 4JTKA 4PH6A 3GC5A 3RX2A 4AVNA 2WBGA 2ZVRA 3T2OA 3ECQA 2NUWA 1V7YA 2YZ5A 3W23A 2FZDA 4IISA 2OKOA 1GHSA 3THAA 2DY3A 4HNLA 1F05A 5I3DA 1IE7C 1TSIA 4LCRA 2BHUA 5CCZA 3GO2A 3ABXA 1AW2A 3O63A 3TNBA 3QKZA 1UASA 4JN7A 1S2AA 4Q4OA 4WSJA 2OT0A 2ZXDA 3T4WA 2YA2A 3OOQA 4QLJA 1BTMA 1GVQA 3BSGA 5EFFA 5I00A 2W27A 3HPFA 1H11A 1GYLA 4FZIA 1TJ2A 6PTDA 1EJ7L 4GVFA 4B5VA 3UXKA 5A3HA 3WNMA 5CPLA 1YNQA 3TSDA 2XINA 4AD2A 3CXOA 4CCEA 3GTIA 1E4LA 1U1HA 4CNPA 4QBXA 3SCOA 1GTEA 3RRXA 1TZZA 1YTEA 4A22A 3EA3A 3APGA 3W7GA 4G1KA 1B4KA 3EX3A 2B7QA 4O1CA 1NFGA 1KBIA 2GVJA 3PZIA 4CD7A 4ICCX 4UTKA 3W2UA 4B3LA 3G0UA 3CUZA 3TOPA 3LBMA 2VFEA 4Z1DA 3PWAA 3WDRA 1EGZA 2EHHA 4Y9PA 3N6HA 4ZFMA 3W02A 2DT0A 4MF4A 3CC1A 4GOAA 2G41A 1A5UA 4JX6A 4JL1A 3OVGA 1W54A 3R12A 4OT7A 4XD3A 1ZCCA 1KFWA 1KBJA 3AICA 3EWXA 4UFMA 2QDEA 3GXFA 3W88A 3H2OA 2C8NA 1RVKA 3VVGA 2WHLA 2GVYA 2WJFA 4KGLA 4HIBA 2VDGA 4UFIA 3TX9A 3KBVA 3NG3A 4AWUA 1GOWA 1O5XA 3U0HA 3PJXA 1Q6FA 2XZ9A 2QULA 3GY1A 1KNWA 4PN2A 5BMXA 2X1TA 4LEQA 1QOPA 4L64A 2XISA 3NO5A 1TMLA 4H8HA 5JMUA 3T4CA 3CL8A 4JTSA 4IG2A 1PIFA 1TA3B 2WMGA 4DYJA 1K4GA 1O60A 3ABRA 3UR5A 2CKRA 2CXGA 3VUSA 5DMYA 1H4PA 1FKXA 5C8BB 3WFLA 3W1QA 3C0LA 1L6SA 3UA3A 4H19A 1SFLA 2F6UA 3ES8A 3MKKA 2DV0A 1WBHA 4N0RA 3VZXA 3RU6A 1EDGA 2HRWA 4QJ4B 1ZJIA 1UWIA 2SFPA 2CHNA 3MB9A 1DQWA 4O50A 3VOJA 1GZGA 1QU4A 3RLGA 6ENLA 4UR9A 3AUJA 4INFA 5IBXA 4QR6A 3EWZA 1ZHAA 1VFHA 4REQA 4C6MA 5ECVA 5G2WA 5IFTA 1W5OA 1UC4A 4AX6A 3LCXA 4JIHA 1F6KA 3LI0A 1ISVA 1WDQA 3M6DA 3TDFA 5ABFB 3T0CA 3GWQA 2UY5A 1XRFA 4YU1A 2X40A 4K1GA 2J62A 3PWGA 4N9DA 1DHKA 4JYFA 1AQ0A 4KS0A 4EOUA 1UA3A 2XHYA 1MXDA 1PTAA 3GE7A 1A3HA 1KLZA 3RPTA 1BWVA 3MMWA 4U4MA 1EYEA 3UG8A 2FFCA 1T7LA 4DBDA 2VTFA 1J0HA 3RMEA 2QUVA 2FZNA 4F9JA 4KEVA 4HCLA 5HJXA 5FF7A 3K4DA 3MANA 3P93A 1ISYA 3TXZA 4OJYA 3FXGA 2R24A 5D8ZA 4Y9OA 4DUVA 1F3WA 5AYIA 4UQDA 4CUCA 1ITUA 5A6BA 1GPFA 1K6WA 2TAAA 4Z0SA 3I68A 4XBSA 3RXZA 4PSPA 1RR2A 3GDRA 4XISA 2QCEA 3MTWA 4WD0A 4GC3A 3LN3A 2I5IA 2OSXA 1JIBA 1FP9A 1S39A 2PDGA 3S47A 1ZUAX 1ECEA 2YX0A 4WK9A 3LQGA 4HZ8A 3IUHA 4WHBA 4JCMA 1EP3A 2EQDA 1A49A 4JX4A 3TW9A 1XIGA 2VQUA 1HFBA 5C70A 3S2CA 1W91A 3C2FA 1YPFA 4MB1A 3QV8A 5BRBA 2FZ8A 4DO4A 3OBAA 2YCJA 1UH3A 4I9MA 1I6NA 1P0EA 4HTYA 3S83A 4D1JA 1XGDA 4J9JA 1CGXA 3MI2A 4Q4SA 2ZADA 4DHGA 3G22A 4FO4A 4QS6A 4QQ3A 3I6TA 3W53A 5LYRA 3P81A 1UCWA 1ZTVA 4DNHA 2ZX9A 5HULA 2CLHA 3WF0A 4UQCA 3VDHA 4F4RA 2NX9A 2WVVA 4FNTA 4HNCA 3SCSA 5FI8A 4E8CA 3QY6A 4PMUA 5C9WA 4GI6A 4V1XA 3NM3A 3ZQ9A 4C60A 4W84A 1Q13A 5D04C 3ZR5A 4DAIA 3GBDA 5A8GA 2DU2A 3W74A 3W76A 4OHQA 7CGTA 1JI2A 4Q8TA 4WXZA 4B5SA 3L0NA 2VKZG 3DBPA 4DJEA 3M0KA 3BQ6A 4E2OA 4HPJA 1ITQA 3S4TA 2EPHA 1IEWA 2QS8A 4RUBA 1QNOA 2O9PA 1H2JA 3LCWA 4UTFA 3UWUA 5M1TA 2AQOA 3WSUA 3ARQA 4UTWC 2E9MA 1MYRA 2CETA 2CZDA 3DENA 1BYBA 1GW9A 4WOZA 1DE6A 2DSZA 2OPJA 3KL3A 4DY1A 1XISA 1EQPA 3UZXA 2X30A 4KEMA 2PBGA 4GYPC 3DZ1A 4G1NA 1JCJA 3R25A 1QW9A 2A79A 2OZ0A 4P8WA 2CLMA 4ZO6A 2P50A 5BOOA 2AQWA 3G3MA 5AZ0A 1JPHA 4H6RA 3GNPA 5CC3A 4ALDA 1U1UA 2W62A 1TE1A 3VI2A 2YLAA 5I06A 4AIEA 4IFRA 4Q22A 1CGWA 4TXEA 2CC0A 5D9MA 3FA5A 1T8XA 5I07A 3DFHA 3G1DA 3LPOA 3WMBA 1PAMA 3KLLA 1BPLB 1W1PA 3SRDA 4O52A 5LKYA 3A5FA 4WDUA 3RYSA 2F7FA 3TR9A 2BY1A 4WVXA 4M29A 4HU4A 2QIIA 2V82A 1T41A 3P5ZA 3IS4A 4MWAE 1YXCA 3SADA 3PN8A 5E5CA 3G1SA 4AF0A 2VRJA 2YBUA 3AMLA 1H7RA 3VIKA 1ADOA 2R8WA 1DWIM 3TW7A 4K37A 3HQOA 2HROA 5AC4A 3RCMA 1ZCOA 3OPSA 4MOZA 2IQ0A 3V18A 2Y62A 3GBEA 1E4MM 3CIXA 2PWFA 4CEXC 3W29A 5MKGA 2EG8A 4NHVA 3G0XA 4O8RA 4R7WA 4O0KA 5F7UA 4J3TA 3WLKX 3QSRA 2E5CA 3QZAA 4WX2A 3ELFA 1RCOB 4HZMA 1XGZA 3BAWA 3CV7A 5KZ6A 1KD0A 2FZBA 2ZZ1A 4H2HA 3BMWA 2BMBA 4ZQOA 2RDXA 2XSBA 5GNZA 4DWSC 4GH1A 3RM9A 4ADSA 2J25A 1E1FA 4CN6A 4NSBA 4UCGA 3S5YA 3C56A 2XN0A 3KBMA 3GXIA 4S3GA 4H6EA 4L7ZA 1OD0A 1ECQA 1TTIA 2DIJA 3OLIA 5I23A 2IKHA 3NEVA 3W7JA 1UHVA 3NQMA 4P8UA 4ICNA 3NOEA 4H04A 3UR8A 4K39A 4MVAA 5BOEA 5B7YA 3PPFA 1K77A 4N4QA 3YPIA 5HINA 4YTQA 2NVCA 2XVGA 4GH3A 4LVFA 4PMRA 2YXOA 3GVGA 1K9DA 3BV7A 3N4FA 4Z1AA 4MDPA 1V79A 3KRZA 5EYWA 2FH8A 3NPXA 1JCYA 4AYGA 2PRHA 5I78A 1B3VA 1LLOA 1HKVA 3STPA 1XYFA 1TREA 1GVOA 3R11A 1DJZA 4O1FA 2W4XA 2H6RA 4FK9A 5CSSA 1GONA 1PX8A 1TYGA 1VLIA 2EKCA 2VDIA 4J28A 1XC6A 1EHNA 1X8FA 1J8VA 4DJEC 5F4SA 3LB0A 3MUIA 4YMZA 1FQ0A 2PGRA 2X2YA 3ARZA 2YL8A 3ZM8A 3DCPA 2RDUA 1LJYA 3CT2A 4GI4A 3AHXA 2QCMA 1B4EA 3N73A 4AIOA 4DJFC 2EG7A 4Y7EA 5IRPA 2OQYA 1G67A 3ATZA 4XZBA 3O1NA 3WDIA 2EO7A 4KKXA 1HKIA 3BE7A 3WQPA 4C90A 3KP1A 3R58A 1YE6A 1B0IA 3QXBA 3BC9A 3PJWA 3T55A 3V75A 3RCNA 4PBFA 4Q4RA 4AZ6A 3GXPA 1BHGA 4DJDC 1TVNA 1AW1A 1NFPA 2HVNA 5IHSA 1A5LC 2QJIA 1H49A 2ISDA 4GBDA 2I1OA 2A4AA 2VZUA 3HPAA 3T6CA 2NUXA 3C0QA 3WJSA 3RPMA 3GR8A 1YKWA 3SB0A 3WYZA 1FWWA 3QM3A 3WLMA 4UNLA 3ANVA 1GZJA 1UG6A 1SJBA 2D2OA 1UKOA 3MBFA 3I65A 2J47A 1JAKA 4JTUA 2NWRA 5D37A 2GLKA 2CERA 5D02A 2VFDA 1AJ2A 3PB2A 2P0IA 1FUYA 4RNFA 3EB4A 3PZNA 3MS8A 3MV11 1W1B1 4EXAA 2GSEA 1XQKA 3H7UA 3B9NA 1UR0A 3B9AA 2QJJA 4WR3A 1GVFA 1UP0A 4AWSA 4IX2A 5C7HA 4DWSB 4F2UA 4TMCA 3MSGA 2TPSA 4HCHA 1GQLA 1AZ1A 1E4NA 3H2MA 4MNKA 2XYLA 3AZTA 1I2NA 4JFSA 3WBXA 4JBRA 2I5QA 1HIZA 2QPUA 3TQKA 4FNQA 3MY9A 3VNJA 2AMGA 2PE4A 3WNKA 1ZNNA 1KXVA 5HQLA 3O07A 4O15A 3BSMA 4NQ1A 4GLEA 4NL1A 1PZ0A 4C5ZA 1NOUA 4XVEA 3FV9A 4AX7A 5D9NA 2FIQA 3ITVA 2OO6A 3AMGA 1BLIA 3DI1A 3STEA 3VKCA 2YIHA 3MKCA 3O06A 1R9YA 4PMZA 3RITA 3KTCA 4ROQA 2NQJA 1EUAA 2NQHA 4JPGA 4O18A 4H7ZA 1K9EA 3TONA 2DSWA 3AXXA 3TN6A 1E9IA 3IGSA 1J0ZA 4Y90A 4UFJA 3ZYZA 3FYPA 3NDYA 1US3A 1GJPA 4US5A 3WJZA 3V0SA 4DJDD 4YVPA 5DRCA 3I10A 1P1XA 3T0AA 3EZ4A 3TK7A 1OGGA 4GQRA 1QNSA 2FYMA 3HA1A 1LF1A 5BW6A 2AL1A 2WK2A 2R1KA 2ZA3A 2NXIA 2VEPA 3PNUA 3LSCA 3G6LA 4MZYA 2CU0A 2CFFA 1BGAA 2I56A 2VJXA 1TPVA 1E4IA 1K02A 2VDHA 3DAQA 3MKVA 3P0WA 3K8MA 3F4DA 3UXLA 4IXHA 4FI4A 5AYYA 1FH9A 2O56A 1RH9A 3AZRA 1W1VA 3T09A 5AKQA 3CYVA 2MANA 3FHQA 4C65A 4H1ZA 2PZ0A 1PKYA 4UUIA 4IJBA 3P61A 3P6LA 5FF3A 2RAGA 1PYFA 3QTGA 4HP5A 5BMWA 4DXKA 4XV0A 1VQTA 1E5NA 2QCLA 2E40A 1R2SA 5PTDA 4GUJA 4QDPA 3TTOA 5SWUA 1PIIA 2F9RA 3NQEA 3MMUA 1C7SA 1G69A 3TIMA 3W2LA 4UCFA 4H00A 5CC6A 3F1QA 1V93A 3ARXA 2VVSA 4QXIA 1DJIA 4NAFB 1V3HA 2EGZA 2KX9A 3MWAA 5ENLA 1ENUA 1N8FA 5FACA 1G4EA 1W9VA 5EMKA 1RJPA 4IH3A 4FIQA 4ML9A 3LXCA 4QJ5B 2D0FA 3RRAA 4XZHA 4MLJA 1QXLA 2QCDA 3B0UX 4IJRA 2E3ZA 1IYXA 2DQWA 3CM4A 4Q8QA 3XISA 4GISA 2D0GA 1MW3A 4KCTA 3PZVA 3JRKA 3QQWA 1XCXA 2WAGA 1NWSA 2DJXA 3QYQA 1EXBA 4LV4A 1BGGA 1HZYA 2Y88A 2QYGA 3W27A 4JTCA 3PB0A 4FR1A 5FEZA 4GIYA 4TU1A 1UD3A 4CNNA 4GYFA 3SRHA 1ZBWA 1F6YA 1W3TA 3H55A 2DPEA 1NY1A 4XIAA 1BF6A 1FWIC 4RE2A 3VD3A 4G7FA 3WLLA 4DX3A 5BU6A 3NWRA 1WYIA 4NJIA 4L9YA 4DELA 3W2JA 2BDQA 1DXFA 4PMQA 1FCQA 3C2VA 4WY0B 1GTHA 3N14A 5FEXA 4IQJA 4UTJA 4AXNA 1J4EA 1DXIA 7TIMA 2JIEA 2R1LA 4Q32A 1TE6A 3REQA 1YQ2A 5D8WA 3MC5A 1T99A 1W3JA 1VFSA 3TN3A 1WKFA 3UCQA 3DBNA 2V5DA 5JH1A 1LQ2A 1SUXA 3W7QA 3STCA 1BKHA 3KVMA 4HA3A 1CYGA 3H6OA 3QN3A 2FKPA 4YVVA 1LBMA 3EOSA 4W85A 3PZGA 4B92A 4ILSA 1OJXA 3CU2A 4I8YA 5CZ0A 4W89A 1BG9A 1RUSA 3NZGA 4FLRA 2JIWA