3W22A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-125
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w22A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w22A01
2VEIA 3EWXA 3C2FA 2QJHA 2DU2A 3G1DA 5LZLA 1KLZA 3VI2A 3A23A 2Y89A 1P1XA 1QAPA 3P5YA 1HG3A 3W2MA 4HN4A 1LBFA 5CPLA 4UNKA 1B3OA 1QO5A 3Q37A 1TTQA 1JVNA 1TPH1 1TPUA 4QNWA 3M5YA 1OYBA 3MI2A 3GDMA 4IX2A 2WSRA 3LHYA 4XTDA 1LLWA 5K7JA 4LV9A 5IBXA 1AK5A 5DCEA 3GLCA 1SO3A 3FJ6A 4S2CA 3TCEA 4JYFA 1ME8A 5AFDA 1H7WA 1L9WA 3CT7A 4IGHA 1GOXA 6TIMA 1VS1A 5DLCA 2VEMA 2QCMA 5I3GA 3A5VA 3W7JA 5A8GA 1BWLA 3JS3A 4UMBA 2NZLA 4JD4A 3W2JA 2J9XA 1R47A 3KVMA 3I7RA 3N9RA 2AAMA 4Z0SA 1VYRA 3RFAA 3UWVA 3BPWA 2B7OA 1FXQA 2VOMA 2DZWA 2ZYFA 1QCWA 5D2XA 2OX1A 1TPEA 3W2KA 3CLMA 1W54A 2CLOA 4MPQA 3IEBA 3LTPA 1YDVA 4KWWA 1QNVA 5IM51 1P0KA 3W1TA 3G1XA 3PWAA 3WJZA 4N02A 4HNUA 3IGXA 3W76A 4B5NA 3S9YA 1LM1A 3TX9A 1ZAJA 2B7PA 2DZUA 1OX4A 3MP4A 3GAKA 2WOQA 3OA3A 3LV6A 2CZ5A 3P8IA 1VPXA 4CCEA 1UUMA 1LRTA 2J27A 2DZVA 2C1HA 3G1AA 4OE7A 1B9BA 3C52A 2GPTA 2NX9A 3W2NA 1FX6A 3THAA 5I3HA 4FXRA 3W7OA 2J88A 1GVQA 4R53A 2ZZ2A 4E38A 4AHPA 2Y7EA 1P4CA 3TIMA 1KTNA 3NOEA 1EP1A 4PL1A 4LOCA 1TPB1 1FDZA 1WOBA 4JX4A 5I3JA 2H3DA 1ZAHA 3MYPA 3I6RA 2GVJA 1DL3A 1MSSA 3CTLA 2V5BA 5D2YA 4YLWA 5AYYA 3SECA 3QMRA 1YTKA 4AAJA 2ZZ4A 3TKFA 3DGRA 1KM6A 2QJGA 4LWWA 1OX5A 4GUHA 5CZSA 3NG3A 1TO3A 4LUIA 4QM1A 3MUXA 3TH6A 4K7YA 5F4SA 1OABA 4FF7A 3RNDA 3BGJA 2HSAA 4UTKA 4O8RA 5FF0A 2V8ZA 4FIRA 3LLFA 4XWUA 4R7JA 3T55A 3W74A 3D0CA 1I2OA 1KTBA 1XXXA 1YDNA 1MEIA 5DY2A 3GNNA 3P5ZA 5D30A 3HGRA 2ZZ1A 3MHFA 3FJLA 3THQA 3QFEA 4OGZA 5HUPA 3DFPA 4MUZA 3W7RA 3WJWA 3RLVA 4TR9A 1TV8A 1XBXA 2V0TA 1ML1A 1K7FA 1GPWA 3BW2A 3CB8A 2CFFA 4Z1BA 5HJLA 3N34A 3SSJA 4C1LA 4JX5A 1TQXA 2VENA 2EAWA 4WD0A 2YGYA 2A0NA 1JCMP 3W73A 2B4GA 2V81A 3QSTA 1G6CA 3C2VA 4AWUA 1CI1A 5CG7A 3ATZA 1MEHA 3I65A 4O1BA 4A21A 4LVDA 1D3HA 1OYAA 3C56A 3B0PA 1OJXA 1W5NA 2CLEA 3WJYA 4S2BA 5LGZA 3L68A 1A5SA 3SR7A 5LHEA 5J5DA 5KZEA 3FYOA 1O4UA 3B05A 3CPRA 2B7QA 5G4EA 2Z2UA 1W5MA 1DOSA 1UBSA 1H50A 4UFIA 1AMKA 1XL9A 5HULA 2ALDA 3HG3A 2H3BA 4LS2A 1UB3A 3W1NA 1F05A 1KFKA 1M7PA 4IMEA 4M5PA 4O0ZA 2CZDA 1ME9A 4CNNA 4QJ1A 1HL2A 2Y88A 4NZJA 3G0UA 2QCHA 3N19B 2B7NA 3TXZA 4KFNA 5LNUA 4WXYA 2C3ZA 4JIPA 5AYXA 2DZSA 4UTTA 5K9DA 3LTSA 3PBVA 5AOUA 1SR9A 2CLLA 1W5OA 3ABOA 2Y7GA 4XKYA 1ZENA 3BARA 4NNAA 3T78A 3LHZA 5HQEA 1QR7A 4GRSA 1A5BA 1KM4A 3SW6A 3HO8A 3NXFA 4XQ6A 4AWSA 3CM4A 2EHHA 4O11A 2V2CA 1XBZA 1ZY9A 2QCDA 2P1FA 3W1PA 1FCBA 1KFJA 2ZRZA 3L5MA 4ZL1A 4ZQCA 2BX7A 5D2WA 4AF0A 2OZ0A 4CLMA 3DU0A 3PBYA 4UXDA 3BW4A 1SO6A 3NGJA 3UWQA 4DXVA 2E6YA 3IIXA 2VFHA 2RDUA 1VCGA 3QM3A 3MBDA 4O19A 1GWJA 2A6NA 3HPSA 1I8JA 4QISA 1F76A 3IVUA 3NM1A 3NQCA 5D38A 1MEWA 5AHMA 2TRSA 3GZ3A 2ZFAA 3O63A 2JBMA 2E77A 4NZFA 5KMYA 3B0UX 4ORIA 3KVJA 1SPQA 2GQ9A 3KRSA 3OHIA 4BWLA 3W1AA 5G1YA 3DZ1A 4I7UA 1K03A 4EVZA 1T8XA 3W7MA 3O05A 3GDKA 2ZRWA 3R2GA 5IBXC 3MI3A 3TW6A 4JTFA 5L9FA 1OF6A 3UWUA 3U8GA 2QCFA 5EKYA 3W1UA 3LOTA 2QDGA 5DELA 3QF0A 4N9BA 1I4NA 2OT0A 4MYAA 3EXRA 5MHBA 1EPXA 1S5WA 5FEXA 4UUIA 3LI0A 5DN1A 4HPJA 2KZHA 1LCOA 2ATSA 3E9AA 4DELA 4X22A 3OIXA 3P84A 1QOPA 3M47A 4RV8A 4GNJA 4CQ8A 1U5JA 4ADSA 3W7QA 4PEKA 1K7EA 3CIWA 3G1SA 3LRKA 2WJZA 1KM3A 3FLUA 3UWYA 1DBTA 1RQEA 1LP6A 3PR2A 2BZNA 3JR2A 1GYNA 4YCOA 4O15A 2W79A 3BG5A 3FEMA 1X8FA 4OBTA 4DBEA 5BRBA 2OCZA 2H6RA 3TJLA 1LRQA 3TA6A 1K8XA 1HUVA 1TB3A 2ZA2A 2CLKA 2FPYA 3S8HA 1KBIA 2DJLA 3USBA 4FHAA 2RH9A 4UFJA 4RKAA 4X3ZA 2Y7FA 4K7VA 3G8RA 4QNEA 3W7PA 1XM3A 5FF7A 1GVRA 3I68A 2GQ8A 1TYGA 1IXPA 2CLFA 1K02A 4DEFA 3OVPA 4O18A 1XKYA 1VC4A 2A1YA 3A24A 1RQHA 4YXGA 4UMCA 2V30A 2WQPA 2EPHA 3CC1A 2BTMA 3N73A 4G1KA 4UTWA 3CHVA 4MY8A 4AEOA 5EYWA 3FIGA 3N2MA 3QQ1A 4DO4A 4X9SA 1F7BA 2YX0A 2PRMA 1KA9F 1KW1A 5AHLA 4AXKA 3QYQA 1ALDA 3HIJA 2FJKA 1XBVA 2XN1A 5AN7A 5AYZA 2OT1A 4O14A 2VFDA 5EPDA 1PHWA 4N9CA 4NU7A 2YPIA 3UZ5A 3IIVA 2C15A 4HNVA 4UR8A 3KFTA 4JTTA 3BK0A 4JNMA 2J9YA 1CX9A 1VH7A 2DORA 4M6PA 1TJPA 3EWUA 3KHJA 4OHQA 4L4LA 2QUVA 3TAKA 3LM7A 3T40A 1W3TA 4XZ9A 4K6AA 5KZDA 4UTMA 1HFBA 4O54A 4DF2A 2GJLA 1KM1A 3PBWA 1LORA 2YDAA 2CLMA 2GVLA 4MLRA 2ZCGA 4NVTA 2PE4A 3PULA 1KFBA 5DXYA 3DFSA 1X1OA 1AL7A 2WNQA 4MIMA 1WOAA 4JICA 2VEPA 1W5QA 2A21A 1H1YA 3NQAA 3O6YX 4HNTA 3S1VA 1VYSX 4BFAA 2J6XA 3K30A 3L67A 1Z42A 3S5NA 2ISWA 3R89A 3TW7A 3IRDA 3W1LA 3W83A 2VFFA 3W1XA 2E1DA 5U7SA 2VXNA 1I2RA 3EWBX 2OJPA 3WK1A 1BWKA 2P0OA 3OG3A 5CPOA 3FOKA 2ZRYA 2FLIA 4JS3A 4RXGA 5H91A 1G69A 2WSQA 2PCQA 2TSYA 1JCJA 2W6RA 3NPWA 3L21A 3G1VA 3O1NA 4O16A 1JRCA 2FB2A 3W7EA 1R2RA 4OWGA 3TROA 3NDOA 2Q3OA 2CWNA 3MWAA 4IMCA 4N2YA 3EEGA 3GB6A 1JUEA 3F4NA 1H63A 1G4SA 2B0MA 3TK7A 5KINA 4UTTC 1GQNA 1OFEA 3NO5A 3LXBA 4WY0F 3BVJA 3NL2A 3P61A 3IVTA 4MJMA 2QKFA 2J9ZA 2F84A 2X1TA 5AHIA 1JCLA 1E51A 1Z48A 5AC7A 2NUXA 1NEYA 2AQWA 5GVJA 3MJYA 4NJGA 4LRSA 2C0AA 4WUIA 3W71A 1R2SA 4RJEA 4HIBA 2X1UA 2XFWA 3DFOA 4FB7A 1EP3A 1PE1A 2BXVA 4JR5A 3E49A 2A7PA 3TAOA 1OFAA 1QPNA 3MP5A 5AC8A 3STCA 3LCFA 3NPVA 4QITA 1A50A 2WSYA 2XN2A 5C54A 1ME7A 2ZZ6A 4JTJA 3SIZA 1XUUA 3F03K 2ZRXA 3NL3A 4LT9A 4WY0B 3GX9A 1ICSA 4I9AA 3EKLA 3INPA 1XI3A 3B8DA 5G4WA 1LZOA 3G18A 5AC6A 3GR8A 1W8SA 2E6DA 4POCA 4ADUA 4OU1A 4K37A 1AW5A 3C3NA 3R5EA 4ZVJA 1IGSA 3HBLA 1JR1A 2H8XA 3DFNA 3TNOA 1NFBA 4LS1A 4Q4KA 1G7VA 3TQ0A 5EMUA 4RXFA 3WK3A 1KM5A 4JTGA 2QJIA 1UUOA 5D33A 1GTHA 1ZCOA 5G2IA 5F1VA 1DKWA 4XBSA 2ZTJA 3S6DA 3STGA 4BWLC 1JUBA 3TDFA 3NNTA 3C8FA 3E12A 2VELA 3PB0A 3MHGA 4YWIA 4K8HA 5CPMA 3PM6A 4JYEA 4QAIA 5L6UA 3TXVA 5C2XA 1J4EA 2J24A 1FWRA 2ATMA 2OMAA 4ZQPA 4NUWA 1B4EA 3QC3A 4MZYA 4JXCA 1SSGA 1EUAA 5HINA 1VLIA 1LTDA 5D2TA 5D37A 4ALDA 1G4EA 2ZDRA 5KSWA 3SFKA 2YYTA 4N6FA 3EX4A 5HR7A 1HO4A 4LRTA 3TU9A 3U2OA 2PRLA 5HWJA 1SW7A 4JY9A 4Y96A 1OF8A 4BK9A 5LNVA 1SFLA 2WKJA 1WA3A 3VE9A 4OT7A 1YDOA 3TR2A 5F2IA 3GK0A 1FDJA 4CNOA 3PG9A 1OFPA 2BSLA 3HB9A 3ZR4A 3FFSA 3LHVA 3NQVA 3QMTA 2G5WA 3O07A 4M7SA 1LOLA 4O13A 3LRLA 2QUTA 5KITA 2Q8LA 1LBMA 1OYCA 2ZTKA 1LOSA 1TTJA 3RK8A 3W7KA 1S5TA 5I3KA 1F74A 3VE7A 4WOZA 5I3FA 4IUOA 4TO8A 4JN6A 4UFLA 4S1FA 5EA9A 1H7RA 3QH2A 3Q94A 3L5AA 4LNYA 3BO9A 4NT0A 5K4ZA 4FX8A 4DBDA 2RDWA 3PSWA 1RQBA 4A2RA 4JY8A 1KV5A 4AMAA 3DHFA 4Y8FA 3BLFA 5FEZA 1OFBA 4Z1DA 4TX9A 1O60A 2QAPA 1TV7A 3ZWSA 3BLEA 1FBAA 1K7XA 1XFBA 1TREA 1W1ZA 3S1XA 1FY6A 5LNRA 4UTWC 3LX9A 4MOZA 2NWRA 3ABRA 5K3VA 4NNCA 3M7WA 5D02A 1LYXA 4TMBA 2QR6A 1S3HA 1IXQA 1PL9A 2C13A 1Q6OA 4RLIA 2JGQA 4JEQA 4ADTA 1TIMA 4UFHA 2GUUA 3R8RA 2Y6ZA 1AW2A 2DZPA 3P60A 3MMTA 1OFDA 1R30A 3WK0A 1PVNA 3W7GA 3LV5A 4PC8A 2G97A 2PRHA 4GXMA 3W85A 1BTMA 1W5PA 1NAL1 1D3GA 2A5HA 1XBYA 1TPDA 4LVAA 3PS7A 4MFEA 2X1SA 1WBHA 1IXOA 5K4XA 1ICQA 1FWSA 4CCDA 1VHNA 2GQAA 3GXNA 5ABTA 2QCGA 3DI1A 3FKRA 3QSRA 4H4IA 3O06A 3EX2A 3NM3A 2QCCA 1T0OA 5DCBA 4LC8A 1OHLA 2TYSA 3NQDA 4DPPA 3YPIA 1TV5A 3W88A 4N9DA 4JIQA 1VCFA 1X1ZA 3UY7A 2YW4A 2HMCA 2H8ZA 3IIZA 1A53A 3ZS4A 1CW2A 4MFDA 3QEZA 2GOUA 4BF9A 3CEPA 4JDBA 3KAOA 3LXCA 4R34A 5BMXA 4P2VA 3RLUA 1ZFJA 2H90A 3WFAA 3NZRA 2CLHA 3RU6A 5EL1A 3UQNA 4GFSA 3HGJA 5SWUA 3TC6A 3B4UA 4GWEA 1VJIA 4HKPA 2ZQ0A 1EWEA 4ZQOA 3SI9A 1W56A 1WAUA 1TTPA 4CNPA 3M5VA 4GE8A 5KZMA 4IMFA 3CWNA 4NJIA 4A3UA 1OVDA 2NXIA 1F5ZA 3GKFA 2CU0A 3W7LA 2RDTA 3IIOA 1VYPX 4H6KA 1K8ZA 3EWYA 4PL2A 5TBOA 2QF7A 3TQVA 5G2WA 1H61A 1GT8A 3UZJA 4O52A 4HNNA 2A4AA 2NV1A 3QQ0A 4OV4A 4GC4A 1TRIA 1P5BA 4O0KA 1X7FA 4JTEA 1OFOA 3KRZA 2DZXA 3SJ3A 1PHQA 4Z0JA 3WJXA 1FWTA 2ZZ3A 1IIHA 3ELFA 3W7DA 4O28A 3SGZA 3N2XA 4RCXA 1GZGA 5G5IA 1XCFA 4O50A 3G0SA 3M9YA 2E5CA 3M16A 2R14A 3NPXA 1DJQA 1L2UA 1SUXA 1MZHA 2ZA1A 5F2GA 1U83A 3NQ6A 1QOQA 1B4KA 4I7WA 2IQTA 1FWNA 4JYDA 2XN0A 2BLEA 3W2UA 1UJPA 2CZEA 4HT3A 3W7IA 1GEQA 3W1RA 2E5BA 4UMAA 1F73A 4KKXA 1YPIA 2YZRA 5C5YA 1QFEA 4H3DA 4BI5A 1K3UA 4WQ6A 2R91A 3AJXA 4FXSA 3LGEA 5HWNA 5BMWA 5DY3A 1QDSA 3HOJA 2V5LA 2X1RA 1GVFA 3G1FA 3QJAA 3ABSA 3GIYA 3UPBA 3BLIA 1HO1A 5D2VA 2VFGA 3MP3A 2E6AA 2FB3A 4PCFA 3UXDA 5D05A 1VRDA 3DI0A 2GVGA 4KFOA 2NWSA 1XDMA 4LS0A 1C8VA 1QO2A 3LHTA 3LLDA 4FEZA 1F6KA 1THFD 3W2LA 2WNNA 1IF2A 1J5TA 4AWTA 4O12A 4Z1CA 4GBUA 3PSVA 3W7CA 4PTNA 1OFQA 3PUDA 1WV2A 4A29A 3C4UA 3ATYA 4ONVA 4NJKA 3KOFA 1VZWA 1F2JA 1V7YA 4MVAA 4CQAA 1LROA 4FNTA 1FCQA 3KRUA 1ZJIA 3OVQA 3DAQA 3WJSA 1KBJA 3QZEA 3HGSA 2FTPA 2Y61A 2NXGA 4AH7A 3OEXA 4PFMA 3ZWTA 2D73A 4EIVA 3B0VC 1YADA 2C18A 4CQ9A 3T44A 4O4WA 3NA8A 4MZ1A 1N55A 1EX5A 4N4QA 1O94A 3L66A 2TMDA 2C16A 4FNRA 1PCKA 3TSBA 1YPFA 1NVMA 1YTEA 3S1UA 4U4MA 5TQLA 3F4WA 2V9DA 4CCCA 1ZAIA 2Y7DA 1M6JA 2FDSA 2VC6A 4PH6A 2ZRVA 3G3MA 2I1OA 1JULA 1DV7A 1NSJA 3W86A 3H53A 3NQMA 1Y0EA 4RX0A 4FNPA 3IIPA 1NF7A 2E5DA 1EIXA 1KFEA 3GXTA 4TMCA 3UY8A 3TSDA 4JTSA 4K36A 2R8WA 3F1QA 4FNSA 4MY1A 1OFRA 2E09A 4LVFA 4IJBA 4BR1A 3HJZA 5BOOA 3W7NA 3C2EA 3W87A 3S5YA 4EWND 1W37A 1M5WA 2CLIA 4LTSA 2WV8A 4R33A 2G95A 3NZ1A 2E68A 1TQJA 3P8JA 3L0KA 4WY0A 1C9DA 3LERA 3M5XA 3S5OA 4RZ4A 2UV8G 3HG2A 1WXJA 4K38A 1WQ5A 3GNDA 2V82A 3LCGA 3DBPA 5CZ0A 4EF9A 2EKCA 5BW6A 3DH7A 3NAVA 2Y70A 4UCGA 1SO4A 1Q3NA 1Q6QA 3DFTA 2X30A 5D09A 3LI1A 1RVGA 3TE9A 1EEPA 4IWWA 1DORA 3NQ7A 3UPWA 1ICPA 2C19A 3M44A 4BI7A 3CWOX 5F1UA 2LLEA 1FCUA 3I7SA 1BEUA 5LGXA 1TPC1 1Z44A 2Z6JA 4YMZA 5FF2A 3IVSA 3HGOA 5LNWA 5J5RA 3W3OA 3TQKA 3HF3A 2Y63A 3MBFA 4QSHA 1FCVA 3MO7A 2DP3A 1O5XA 3BGGA 2FFCA 3LCWA 2FPVA 3PY2A 2PC4A 4RZ5A 2NX3A 4OV9A 2X2GA 2QCNA 4WX2A 4ZQRA 5DBUA 4O1DA 3EWWA 4FNUA 1DQXA 1QPQA 3QW4B 1X6UA 2JKEA 1DVJA 4M6QA 3N3MA 5HWMA 5H2ZA 4JTIA 4XBKA 5HR6A 1UASA 1M7OA 3L0GA 3C2RA 1I2NA 1YTDA 1V5XA 3NQEA 2V2DA 4P61A 1P0NA 1DJNA 2QCEA 2CZFA 1LOQA 4NXKA 1EB3A 2YSWA 3IGSA 4WOQA 3QRHA 5D04C 2Q8ZA 3JRKA 5HUOA 1B57A 1VGAA 1H7OA 4A22A 4QQ3A 4KFPA 3NR0A 3T7VA 3EKZA 4FO4A 3B03A 3NPUA 1ZALA 2E6FA 3EB2A 1FUYA 1QMLA 1LRNA 1Q6LA 4U28A 3N14A 1H62A 4ZZ9A 1T96A 3LCHA 1FQ0A 4JTHA 3FYPA 3W9ZA 2P10A 5HNRA 4IXHA 4JDYA 4ZQNA 3G1YA 3ANYA 2JK2A 2TPSA 3O16A 3TSMA 3GYEA 1SZNA 5CSRA 3KVKA 1G4TA 4J9JA 4UTIA 3HPZA 1KM0A 1OX6A 2G96A 2AGKA 1W3NA 1W31A 3BW3A 3W1QA 1HTIA 1PS9A 4GUIA 3M1ZA 3SGUA 4LU0A 3HG4A 1SZEA 4MYXA 3CEUA 3PG8A 4FX7A 5U4NA 3LDVA 3R12A 4N9EA 3BG3A 3EWZA 4OQVA 3STEA 2HS6A 1YYAA 1GVSA 4LUJA 3FKKA 3P82A 3N9SA 4JTLA 2JGYA 3LCLA 3P67A 4UNLA 5I3IA 2YYUA 1W0MA 2O7SA 1FXPA 5TIMA 4MJZA 2NLIA 1H60A 4X2RA 2A6LA 3P80A 2NUWA 4GUJA 4IXXA 1JQVA 3VKJA 1W3IA 1O5KA 3PF3A 4GUFA 4UFKA 3NQGA 4XTIA 5C6MA 1RD5A 5AHNA 4O17A 3LBMA 1LDCA 4UTJA 3QW3A 4K39A 1OX4B 5LKYA 1KFLA 3VCRA 3P7YA 5F4WA 2DJXA 1YXCA 3W72A 1FDYA 3L2IA 2Y62A 4IQLA 2QAFA 1L6SA 4ORMA 3IGUA 4NNBA 6ALDA 1GYLA 4I7VA 1JCYA 2CW6A 2WO5A 3P74A 2ZBTA 3M41A 3L65A 7TIMA 3A5FA 3TV8A 1I45A 3UWZA 5BNKA 3NL5A 2Z1BA 4Q33A 1L6WA 3G3DA 4FIQA 3LBCA 4K8EA 4NX0A 5DCDA 1F6PA 5C55A 3GAYA 3P81A 3DKJA 3PUEA 4NXSA 3CIXA 2X16A 2A7RA 2GJNA 5EBUA 3W70A 2ZA3A 1JCNA 2RFGA 3DXIA 3V1PA 3EX6A 3NYZA 3A21A 4TIMA 3RMJA 4WXZA 1XDLA 3DENA 5K9XA 4ICNA 4O1AA 3S1WA 4N4PA 2Z6IA 2YFNA 4Q32A 4UC5A 3I7QA 3LRMA 3UNDA 4HSNA 4IMGA 1ZNNA 3ZFHA 3A22A 3GDRA 3G8EA 3M0ZA 2A7NA 1PV8A 2FPTA 3LHUA 4HHPA 1WDWA 1VCVA 8TIMA 4Z1AA 1EP2A 4WZHA 1JRBA 4YL2A 3GDTA 1IIGA 1TPWA 1UCWA 5DXXA 1Q6RA 2V2HA 3Q58A 2WPBA 3W7HA 2A85A 4LVBA 1WBJA 4ZQMA 4LW7A 4E2BA 4UIOA 1ONRA 1PIIA 2HS8A 5FEPA 5A5WA 3TFXA 3TMLA 4FNQA 2R94A 3MW7A 1KTCA 1J2WA 1GG1A 2EF9A 4Y9AA 4E0CA 4IX0A 4N6EA 3W23A 3MHUA 5FF3A 3G24A 3QPYA 1H1ZA 4AHQA 4O57A 4NX5A 2RKXA 1EA0A 1Q45A 3PAJA 5CGQA 4DF1A 3W75A 2YXGA 3GXPA 1DQWA 5LNSA 1TCDA 3AO0A 2YW3A 1JJKA 1QWGA 2DZTA 2I14A 3TUUA 3E96A 1A5AA 4MKNA 3W22A 1T99A 4HPXA 4JTKA 3L0NA 4UTLA 1VLWA 3RF9A 1H5YA 3G0XA 3NVTA 3O8AA 3IV3A 3TMQA 5EY5A 3PC0A 3M5ZA 1TMHA 4MY9A 4RK8A 4LC6A 3HQ1A 2ZZ7A 3L9CA 4NJHA 2VFEA 3PUOA 4M7TA 4NQ1A 5AB3A 3PB2A 1D9EA 1JQXA 4UR7A 3O15A 3SZ8A 1GVOA 1QPRA 3OVRA 1H7XA 1R46A 3MI6A 1JCXA 2YFOA 1OK4A 5FEWA 3C2OA 3C0JA 3P62A 3L5LA 4LY8A 4A2SA 2JKPA 4NJJA 2FIQA 3LTYA 3S42A 5CSSA 1N7KA 3EXSA 2C14A 4Z08A 3UYCA 3CQ0A 3NQFA 1IXNA 5HMSA 3NEVA 4UTUA 5AHFA 5T26A 4XKYB 1KLYA 5G1TA 2EGZA 4ML9A 3UWWA 3E02A 3T4CA 3H54A 3SY5A 3BV4A 4LV4A 2A2IA 3S0CA 4RZ6A 1EWDA 4M6VA 3LHWA 3M6YA 2BWGA 4DPQA 1OG0A 3TJXA 4D2JA 2QCDB 2ABBA 4DO6A 3GDLA 4MLJA 1C29A 1A5CA 2ZZ5A 4AF0B 1TRDA 4C1KA 1AG1O 3O6CA 4XUGA 1DHPA 2ABAA 1GG0A 3WK2A 1EUNA 1KV8A 3PBUA 1BKSA 4PODA 1VHCA 4IPIA 1TTIA 5E1QA 5E0KA 4DO5A 3VFLA 1TPVA 1AL8A 3EX1A 2ISSA 1K8YA 3H55A 1VQTA 4L4MA 1SW3A 1I2QA 3PVFA 3GVGA 4UTHA 3DFQA 1KM2A 4JTUA 5CZJA 1WX0A 3W84A 3KVLA 3VNDA 3KXQA 1O95A 2QDHA 2RHGA 1GJPA 1LLZA 4AVFA 5CPNA 4O4VA 4DQWA 2NV2A 2NUYA 2W0UA 3MYOA 4AB4A 2Q3RA 1SZGA 3LCIA 5FI8A 3FS2A 3CU2A 2ZRUA 4O10A 2VEKA 4EF8A 3B06A 4IMDA 1PCWA 1TSIA 2F7FA 1ZHAA 3HMJG 1SSDA 5F4XA 3NL6A 5CKSA 4AHOA 1S5VA 2NXHA 4E2DA 1SQ7A 1I2PA 3M43A 4TU1A 3STFA 3V75A 3O6DA 5F2MA 5D32A 4EOUA 3QPZA 1RV8A 3OBKA 1G67A 3KX6A 5DBTA 3LCXA 1RPXA 1VR6A 4IPJA 3UD6A 2Z0IA 3G22A 2WNZA 3A9IA 5D03A 1SZFA 2ISVA 3EXTA 4Y90A 1RR2A 1Z41A 3Q2DA 1L6YA 1TPFA 3LXAA 1YXDA 2Y85A 5F2LA 1SO5A 4PA8A 1G7UA 1RZMA 2NX1A 4FX6M 2JKAA 4GJ1A 3EX3A 1SU5A 4WJEA 1R2TA 3U6WA 1NF0A 2VFIA 5G2HA 3QMSA 3W1MA 4JX6A 2YCEA 4GUGA 3FA5A 5E93A 1H7PA 2HTMA 1XC4A 3NQ2A 4IOTA 4HSOA 4DF0A 5KTLA 4QIUA 2FQIA 3W6YA 1XUZA 4JGDA 1TJRA 2I9EA 5K2ZA 1H7NA 1YXYA 5K9CA 1JUKA 3UXAA 4RR4A 1LBLA 3TC7A 4BI6A 2C6QA 4O53A 3G1HA 1H51A 3NQ8A 1MO0A 3HG5A 1MXSA 2O7QA 1N8FA 3C6CA 3S5ZA 4M19A 1OK6A 4Y6GA 1GTEA 2QUUA 5AHEA 5LSMA 4UFMA 3E0IA 2VKZG 3B04A 3BG9A 1ADOA 5CZTA 2PURA 3LB0A 2QEZA 3GR7A 4ZMGA 4MZ8A 1FWWA 3HPXA 1AW1A 5FF4A 3DHDA 1QPOA 5FESA 2YR1A 1SW0A 1WYIA 1G4PA 3DKLA 4W9TA 3W07A 4KWVA 2QCLA 4LVGA 5LHFA 1SFJA 3ABQA 1KFCA 4O1CA 3GKAA 3C61A 3R13A 4YCPA 1YLVA 3TFCA
chains in the Genus database with same CATH superfamily
1XIEA 3I3DA 3EWXA 4GOAA 1UD4A 5DX7A 4UNIA 1C8QA 4HD5A 1JZ6A 2QJHA 1E4IA 1X96A 5LZLA 1KLZA 5CBJA 3VI2A 1SJBA 1P1XA 3OYZA 1UP2A 1QAPA 3OODA 2WW5A 1ESWA 3W2MA 1LBFA 1NDZA 5AC5A 4UNKA 3VKAA 3Q37A 2ZVRA 3HQNA 4D9PA 4PTXA 3D47A 1HX0A 1GZJA 3IK4A 3M5YA 2A3CA 2DH2A 2WMJA 2P0IA 3MMDA 1OY0A 4IX2A 2ZX8A 3ZZ1A 4JKLA 3ZO9A 5K7JA 2ZDSA 3W4RA 1ITQA 2X05A 3GVVA 4WVXA 3GLCA 3GHTA 4BQ3A 4ROQA 1BGGA 2QDDA 4JYFA 1EXBA 2V3EA 1KFWA 3U9IA 1H7WA 3CT7A 4ZO8A 1VS1A 1V3KA 3MCNA 3GFXA 3JS3A 2NZLA 3OBAA 1PZ3A 3N9RA 4Z0SA 1VYRA 1X1NA 4LF1A 3UWVA 3BPWA 3IAQA 1FXQA 2VOMA 4FI4A 2QVNA 4WKFA 1DQUA 4CNUA 5CPQA 4E8GA 1PPIA 3EOEA 4JN7A 2CLOA 4GLEA 3IEBA 2OEJA 4KWWA 1JZ8A 3UPMA 5IM51 4N02A 2WMKA 1XV8A 4I9TA 1J0KA 3BMVA 2B7PA 2BG5A 4H9ZA 4KRTA 4XZWA 2POTA 2WOQA 3OA3A 3LPOA 4QSFA 4WGHA 1MQRA 2VVSA 5M2FX 3LV6A 4IJRA 1ADDA 3WQVA 4CCEA 1UUMA 4AIUA 2C1HA 1B9BA 5MKGB 3AHXA 2GPTA 4TX6A 2HE8A 2HV5A 3W2NA 1RJRA 4LAKA 1HJQA 4HMDA 4A8RA 3ZVHA 4AYGA 3CQJA 2Y7EA 3TIMA 5BXRA 1EP1A 1JDAA 1XFCA 1EQPA 1WOBA 4JX4A 5E9AA 3F4DA 3MYPA 2GK1A 3N25A 2GVJA 3VGEA 3VINA 3WMCA 2X0HA 1A5OC 2XWEA 4YLWA 4K3ZA 3QMRA 2EJAA 3FAXA 4FPSA 3F5JA 2FGZA 3L2LA 2YXXA 1BF6A 1Q8AA 3NG3A 4YN5A 2B31A 3MO4A 3SJNA 1UWIA 3QHOA 2Z25A 3UFYA 4FF7A 3RNDA 2HSAA 4FIRA 3W74A 1FOBA 1I2OA 1KTBA 2VEFA 2GDQA 1HF6A 5DY2A 2IPWA 5HMDA 1V93A 3HGRA 1JZ4A 1RUSA 3DFPA 2OYMA 5HJYA 4TR9A 4B15A 1H41A 3OU8A 2ZX9A 1NTHA 4PUMA 4US5D 4EX4A 1S2TA 1K7FA 1GPWA 3VOGA 3BW2A 2CFFA 3EA2A 1D3CA 1H0IA 1J79A 3N34A 4A35A 3PBMA 1JCMP 2HVOA 2VQUA 1W9BM 4W86A 2XWDA 3QSTA 3WENA 1G6CA 4MWAD 1VFFA 1CI1A 3MWCA 1MEHA 4A21A 4AZCB 2AKMA 1D3HA 1V6WA 2NQHA 3C56A 1W5NA 4Q4RA 3B8VA 2BS9A 3VUPA 4S3AA 3SR7A 3AMCA 3THDA 1O4UA 3HV9A 4M51A 3W28A 3VDAA 1HJVA 1W5MA 2CXEA 4IT1A 4LYRA 4UFIA 2C71A 2PGFA 1ZJHA 1FH7A 2CLPA 3VTRA 3PBGA 2H3BA 1R9YA 3W1NA 1KFKA 3CYVA 4C6QA 2ZWZA 4CNNA 6A3HA 2ACRA 1UD3A 3G0UA 1CT5A 3MUIA 5GNZA 1C8XA 1MRAA 4KFNA 5LNUA 1OCNA 1QATA 5AOUA 2D2JA 1E1EA 2CLLA 2DPEA 3ABOA 3NYDA 5JQ9A 3DUGA 3BARA 1E4MM 2O55A 4JL2A 3LYEA 1R9XA 2ANUA 3UR2A 1AODA 1E56A 5H6HA 1E6NA 2EHHA 4Z42C 1V6VA 1XIHA 4X61A 3ITOA 2P1FA 3W1PA 1KFJA 4PBGA 2ZXBA 4EPBC 3R11A 3ZJ7A 3S1GA 2OSXA 1P0EA 1T7LA 1NM9A 1K9FA 2W61A 2E6YA 4IPPA 4AIEA 2HVNA 4HZMA 1E43A 3EGJA 2BGSA 2A6NA 2VYOA 1XRFA 3A64A 4QISA 1F76A 1C3FA 3IVUA 3AIQA 3NQCA 3W01A 2TRSA 4MNLA 1AJ0A 3O63A 4KW2A 1SPQA 5I06A 1TIWA 5G1YA 4I7UA 4JIIX 2GSHA 2EG7A 3BOLA 3KOWA 4EVZA 3W7MA 3REQA 1D8WA 4H9YA 3SB0A 4CU6A 2X40A 1R3SA 1BXCA 3DOPA 2WHLA 3UWUA 1JEZA 1GJWA 2QCFA 4LNCA 3BSHA 3F2BA 2PDIA 4QCFA 3VZYA 4MYAA 1K6AA 2CBJA 5FEXA 2GDUA 4W89A 3SCPA 1S2CA 2ATSA 1XLMA 1ZU8A 3E9AA 3KHDA 2JFEX 3BXWA 3VOFA 4RV8A 3CNYA 2XZ7A 1QPKA 1V77A 4PEKA 3LRKA 1V0NA 4MB5A 3UWYA 3WY1A 4BQ2A 4AY1A 1DBTA 4PUWA 1RQEA 1G0CA 4MWAB 3T08A 4O15A 3BG5A 2WVUA 4OBTA 1BG9A 2YB1A 1LRQA 2Q01A 3MV01 3OA5A 3GVRA 3GW3A 1K8XA 2ZA2A 2CLKA 2FPYA 3KOZA 3S8HA 3LQGA 2PP0A 4UFJA 4HMNA 1JFHA 4Q8VA 9CGTA 4QNEA 3W7PA 1V6XA 4AEEA 4DEFA 3OVPA 4O18A 4WR3A 5EB8A 1CTNA 3QV9A 4FLOA 3VIFA 3A24A 3FSUA 4W8LA 3AALA 4UMCA 3N73A 5CSYA 1JL8A 1Y5VA 4AEOA 2WMIB 2DZBA 1GOMA 1KW1A 3K8MA 3M7SA 3HIJA 2FJKA 1KBKA 3V7PA 2QYGA 5AYZA 1HP4A 3UZZA 5DMNA 4N9CA 2YPIA 1R3QA 5E09A 4UR8A 4DN1A 3KFTA 4JTTA 2MNRA 2J9YA 4LUYA 2DORA 1TJPA 3KHJA 4L64A 3T40A 3AU2A 3DCPA 8CGTA 2YL8A 2GDVA 4DAFA 1HFBA 4PRWA 4F66A 2GJLA 3PBWA 3E74A 1ODZA 5JUVA 3TN3A 1EEXA 2CLMA 2DW6A 1N82A 2WNQA 1XRSA 3E0FA 4MIMA 1A5UA 2YDRA 3F2CA 2GSJA 4YYFA 2A21A 6PTDA 4GVHA 4MG4A 4S3EA 2XVGA 3CIVA 3MZ2A 4ACZB 1OB0A 1WZMA 1WKEA 4HQVA 2IPFA 2ISWA 2Z00A 3R89A 1EF3A 1GQKA 2PDFA 2VXNA 1I2RA 3QLLA 3WQ8A 3OGVA 3SRDA 1P6BA 4RXGA 3GIPA 3UGVA 2TSYA 1BRLA 5T91A 4PMRA 5LYRA 3BCJA 3WLKX 2Q3OA 5IDIA 4MPKA 4N2YA 2BODX 1JUEA 3PFMA 4QEHA 5KINA 1EC7A 1GQNA 3LXBA 3N6HA 2XINA 3RN6A 1GUVA 4MJMA 4Q8UA 2J9ZA 2X1TA 4HOWA 2YCKX 3N4AA 2X8RA 5A8OA 2NUXA 2ACSA 3MJYA 1KGWA 4RJEA 3OG2A 4HIBA 2XFWA 4FB7A 2X7VA 1EP3A 5ABFB 4HTBA 2BXVA 4YVPA 5GJPA 2A7PA 2D3LA 1V6TA 2RJHA 3M0HA 1TZ9A 1QPNA 4AIBA 2WSYA 4U3AA 4EPDC 5C54A 1ME7A 2ZKMX 3ZSSA 3H22A 3RCNA 3SIZA 2ZUMA 3VM5A 2J77A 4WY0B 3GX9A 4HA3A 4I9AA 3WNPA 1IWBA 1E9ZB 3B8DA 3G18A 3U4FA 4WJXA 3USZA 3VGDA 5GNYA 2E6DA 3BAXA 4ADUA 1UR9A 2R1NA 4ZVJA 3H7VA 5FIPA 1NFBA 4J2MA 2HK1A 1R3TA 4JTGA 5G2IA 5F1VA 3S6DA 2ZTJA 3GXIA 4HU4A 3VIPA 2Y1HA 4DXXA 2Z29A 3T81A 4EACA 4L9XA 1LQ2A 3QY7A 2OMAA 2CBVA 3APTA 4RNHA 1VLIA 1KRCC 3KEHA 4QROA 2ZDRA 1D2KA 5KSWA 3EX4A 4C6BA 4HOZA 5HR7A 4NY2A 3N13A 3WBXA 2J47A 1K9TA 2NT0A 1SW7A 4Y96A 2NSOA 1DP0A 4G7EB 4GI8A 1QW9A 5LNVA 1SFLA 4B2DD 3M07A 2FZDA 5F2IA 1W8GA 3GK0A 1AQ0A 1Q13A 1OFPA 3HB9A 4FK9A 1RD6A 2IQDA 1OGBA 4I8DA 3OZOA 4MAZA 2ONEA 2QUTA 1Q2RA 3MCOA 1IT7A 4NF7A 1LOSA 2NLYA 3W7KA 4JHMA 3VE7A 3CL7A 2D20A 4WOZA 3LSBA 4HTYA 4HCLA 2NQZA 1H7RA 3S3GA 4XAPA 1EJTC 2WLYA 1QBBA 4FX8A 3UNTA 3M0JA 3AXHA 4EPKA 4H8UA 3PSWA 3SCUA 1RQBA 1Q4NX 1KV5A 3ALFA 3CHEA 3DHFA 4Y8FA 3T9PA 1IWAA 1OFBA 4TX9A 2VZOA 2VR4A 4ILSA 1GGOA 2QAPA 1TV7A 3BLEA 1NQ6A 4GQQA 1FY6A 4W7UA 3LX9A 3T0DA 3BJSA 4C5YA 3ABRA 2OSYA 1PYFA 4GKLA 5CAKA 4AY7A 2QR6A 5EBAA 3W6MA 2BASA 3SCQA 1DPMA 2R24A 4GHRA 1W1A1 2GUUA 3R8RA 3S9IA 2HZGA 1LG1A 3P60A 4A05A 4PC8A 1S2WA 1XLLA 1D3GA 4M82A 2RUSA 2C7FA 4GZ7A 2X09A 4LVAA 3PS7A 4BQ5A 3MU7A 4ZOEA 1WBHA 3BUVA 2G3MA 4IIFA 3HZ3A 2FFIA 4CCDA 1VHNA 4XV0A 1O12A 3KBJA 5ABTA 3IS4A 4LXFA 2R1LA 2XGZA 3DI1A 1Y8BA 1E6RA 3AYSA 4XZMX 3NM3A 3L4UA 1OHLA 1CCWB 4X0NA 1EJRC 1EC9A 1TV5A 1E1CB 1EJUC 4FZIA 1L8PA 3JU2A 3EDDA 2H8ZA 3IIZA 4QEEA 3QEZA 2GOUA 4RPQA 3KAOA 1O6IA 1XIMA 3E1F1 4P2VA 1OZMA 3L4XA 3RU6A 7ENLA 3TC6A 2D0FA 1RY8A 2PB1A 1J0IA 2HWGA 2WZTA 2WSPA 1W56A 1Z7AA 5A69A 3EB4A 4CNPA 5JU6A 3CWNA 4NJIA 1OVDA 2NXIA 1F5ZA 5ABEA 5L9FA 4PL2A 1VYPX 3TQVA 3L23A 5G2WA 1H61A 1GT8A 3CH0A 1Q6CA 3H12A 4O52A 4HNNA 2FZBA 5I02A 2A4AA 3MKKA 3WQOA 3CUHA 3T4WA 2GGJA 3PZTA 1PHQA 3EZ4A 4Z0JA 1I0DA 1FWTA 1IIHA 2VCCA 1S5NA 1XLBA 3VOJA 1W1IE 1XCFA 4H19A 1GNXA 4O50A 5CJMA 1HIZA 2VC9A 2E5CA 2DIEA 4Q7IA 3KS5A 1SVDA 3LZ3A 1SUXA 2JQXA 2ZA1A 5A8QA 1XPYA 3THCA 3TLQA 1YHTA 4I7WA 3XISA 1FWNA 2GUYA 2Z7GA 2NV9A 1V51A 3FJ4A 2E5BA 1OEPA 4F0RA 4GZJA 2OFJA 4KKXA 5C5YA 2WPGA 1T8QA 1WE5A 3DHPA 2RGMA 3FGCB 1CB7B 5J04A 4YWSA 1GVFA 2Z26A 3GXFA 3GIYA 3BLIA 5D2VA 1TWDA 2G3IA 1TMLA 1ZSXA 1KR0A 1VRDA 2BY3A 3DI0A 2XM2A 3WF4A 3O7UA 3A4JA 1XDMA 1JPDX 4XO7A 3LLDA 2ZUTA 1THFD 1K1DA 3W2LA 2E7FA 1IF2A 4K1WA 3VYLA 2FMNA 1U5HA 4GBUA 4JKKA 5CC5A 2ZUNA 4PRRA 1LUCA 1OFQA 3M0XA 3FY1A 3WN6A 3C4UA 4ONVA 5HJXA 4Y2WA 5AVHA 1BSIA 2XJ7A 3VKKA 3W00A 1RK5A 3S2MA 1JPIA 4FNTA 3R7MA 2WZMA 2C79A 3CUIA 2O9PA 3MMUA 3DAQA 4L1XA 2CEQA 3ARSA 3WJSA 1KBJA 2D22A 3HGSA 5A6TC 2NXGA 1U1HA 4XAYA 1GOIA 1UR8A 1EOKA 2C18A 3GNXA 3NSXA 3A13A 4MZ1A 2DVUA 2QS8A 1EX5A 4N4QA 3TSBA 1A5LC 2BMBA 3S1UA 2OB3A 3I10A 2V9DA 5JBFA 1ZAIA 2Y7DA 4L5ZA 1M6JA 3I4EA 3TQPA 1DJZA 5XINA 4IGSA 1JDEA 3EOUA 1QTWA 3IIPA 3RX2A 1EIXA 1YNYA 5I6SA 4KWOA 2XIBA 5CBBA 3ITTA 2A3BA 3UY8A 3LENA 2X0SA 4JAWA 4K36A 3GHUA 1W1YA 3N15A 1W3LA 4U5KA 5CH9A 4LVFA 1F61A 2QJMA 4DYJA 1FWHC 3ZT6A 5BOOA 6ENLA 3UWEA 1GW9A 3VNZA 3WQEA 3WF2A 1MQQA 2E68A 2VEGA 2D24A 3P8JA 3UETA 1C90A 3QV8A 2HBVA 4K38A 2F6KA 2H9AA 4KETA 1BVZA 3N2OA 3A12A 3DC8A 1P48A 8RUCA 1ODUA 2EKCA 3WO8A 3RYSA 1VIWA 3DH7A 1J96A 1Q3NA 1Q6QA 2VCAA 3CZGA 3DFTA 2C91A 4W88A 2X30A 1DJHA 1RVGA 1DORA 4XD5A 4GNVA 1ICPA 1QW7A 5REQB 4BCEA 3PNUA 5D4YA 2XH0A 3N29A 4ERIA 3WEZA 5I00A 5FF2A 3HGOA 3LNMA 5LNWA 2DW7A 3HF3A 2VX4A 4TUFA 3GU2A 4UOJA 1CGUA 3I3BA 1A3XA 2DP3A 3TN5A 3PTQA 1EDTA 1VFOA 5AY7A 4RZ5A 5EFDA 3V0TA 2CBIA 2NX3A 3WLNA 2GWGA 2Z27A 1XSJA 3TVAA 2Q8XA 3TWBA 3PZUA 2XYLA 2OO6A 1XYZA 4RZBA 4REQB 4K68A 2GVYA 4EPEC 3BOXA 5FJJA 3EMCA 5HWMA 4XBKA 2OELA 2P50A 2RJGA 3L0GA 2IW0A 3DIPA 3NQEA 4NZ5A 4HOXA 2QCEA 2XFRA 2CZFA 5KETA 4QG8A 4PFHA 1EB3A 4WOQA 3QRHA 5HUOA 5JVLA 4KFPA 2ISDA 1Q2SA 4FO4A 3PZMA 3B03A 3NPUA 5I5RA 4HNLA 4GYPA 4YTUA 4O1FA 4U28A 1RBAA 2WMHA 2XH2A 3RX4A 3MANA 1XHGA 4IXHA 4ZQNA 1UKQA 3ANYA 3BV7A 2WK2A 3O16A 2VDIA 2WSKA 1W9PA 1SZNA 3WKZA 4P5UA 1KM0A 4AWEA 2AGKA 1W2VA 3CMFA 3BW3A 1JFXA 4GUIA 1M41A 4LU0A 3HG4A 1SZEA 4MYXA 4ZE5A 4HU0A 4FX7A 1BWVA 4R88A 2HS6A 4IP7A 2TODA 3EDFA 1YYAA 4F2BA 1V02A 1GOQA 4LUJA 3KLKA 2Q02A 3PJWA 1EQCA 4JTLA 1XH0A 2JGYA 3VD9A 3ARUA 1W0MA 2YBUA 4U5IA 2NLIA 3P80A 1BYAA 2VVNA 1JQVA 2R1KA 1W3IA 3VIKA 1S2AA 3KZPA 4UFKA 2VGGA 5C6MA 3OO2A 1F07A 1FWJC 3WH5A 6XIAA 1BSLA 2CHNA 4FLQA 1EYWA 2J74A 1ZCCA 1LDCA 4UTJA 3QW3A 4ROPA 5I03A 3GG1A 4LYQA 4EWJA 4Z17A 3L2IA 4GYFA 4IFKA 2BY0A 4IQLA 1HXJA 2XIMA 3WD2A 3IGUA 5DT7A 4XIAA 6ALDA 5DFAA 2CW6A 4MB1A 3ZVHB 3WH8A 2ESCA 4OJYA 1DXFA 1EPVA 1JGMA 5BNKA 3MKVA 1QOXA 2PTYA 4QE4A 2GK1B 4NXSA 2A7RA 4I9MA 5ABHA 5EBUA 1JCNA 5BU9A 3NYZA 3B97A 3RMJA 4WXZA 4O1AA 3S1WA 2ADAA 2PD9A 3QTPA 2W67A 3I7QA 3UNDA 4W87A 1KGXA 4UQAA 2OWCA 1EA9C 1D7FA 3LHUA 1RH9A 2FVLA 3TNBA 1ITXA 5JIPA 2GLKA 3GDTA 3EOOA 4XD4A 3CV7A 2V2HA 2WPBA 3H4GA 1SMDA 4LVBA 3UCCA 4FALA 3VOIA 3DX5A 4ZQMA 4LW7A 2V3FA 1X39A 1TWWA 2P8BA 4UIOA 3WF3A 1ONRA 1VFUA 4FNQA 1KTCA 3HFYA 2D0HA 4V15A 3W23A 3OTRA 3ZSTA 1H1ZA 3BAWA 1EA0A 4DO7A 1Q45A 1FH8A 5CGQA 1GEHA 4D72A 2JF7A 1K77A 1DQWA 5BYWA 5LNSA 2GJXA 4TTGA 2YW3A 1GONA 3E96A 2ZX5A 3FXGA 4I5XA 2ZC1A 4HZ7A 1VLWA 5LIYX 3H2AA 2VWTA 3IV3A 5EY5A 2F8QA 3PAOA 5E5CA 2HPIA 3M5ZA 2VJXA 3S6TA 3HQ1A 3GS6A 3WDJA 4NJHA 4NQ1A 1D9EA 1JQXA 3O3RA 1QPRA 3OVRA 1R46A 3OJGA 2J7CA 4J3TA 3L5LA 4A2SA 1UP3A 2JKPA 2FIQA 1B2YA 3LTYA 3U57A 5CSSA 1N7KA 3EXSA 2C14A 3GHSA 4KWSA 3DBNA 1DWGM 2A3HA 3BAYA 3CQ0A 1IXNA 3AIWA 3NEVA 3CMJA 4L61A 5G1TA 3CZJA 2BB0A 3AMGA 2A2IA 3RR1A 4NRSA 5CXPA 5BXTA 4E2OA 2F9RA 3EB3A 1RXOB 1OSEA 2R82A 1SYTA 3LHWA 3M6YA 1LL6A 4H7ZA 5FSDC 2YIHA 4D2JA 3S2CA 1FKXA 4HHHA 7ODCA 3MUAA 4OIFA 1QVBA 1A5CA 2WC3A 1W1TA 1JAEA 1M01A 4KCUA 3R0DA 2I16A 3O6CA 5LIKX 4XUGA 2A3LA 2V5DA 2ABAA 3CTTA 1UH3A 2VL4A 5D9NA 1NDYA 3BWWA 2XSAA 1BKSA 4PODA 1POJA 1VHCA 1EC8A 1VPYA 4R3UA 3RPTA 2PDYA 3CUJA 4UTFA 4GYPC 2E0PA 1AL8A 4JCMA 4AX6A 3VABA 2ISSA 3EMZA 4GD0A 4CQDA 1U1JA 3FDGA 3WDPP 4L4MA 1PIFA 4GY1A 4JOMA 2QHAA 5IHSA 4B92A 2BNJA 4PMZA 3LS9A 3DFQA 1WX0A 3UJRA 4C6JA 2BOEX 3GO2A 3REQB 3VA8A 2QDHA 2RHGA 3CAWA 3GG0A 4PMOA 2IKIA 8XIMA 3ES7A 4AB4A 1EF2A 1CXFA 4JHOA 3URQA 2F38A 3E2RA 1SSDA 4ATLA 1DHKA 3NL6A 3WL0A 5CKSA 1UG6A 4TVDA 4ZB5A 2NXHA 2DUZA 1I2PA 4D71A 1AZ1A 3V75A 1XC6A 1KXQA 2CZVA 3O6DA 5F2MA 4EOUA 1EGZA 3E38A 3KX6A 5DBTA 1RPXA 2Z0IA 3S2NA 2DT3A 4ENLA 3A9IA 1SZFA 5AZ1A 2NSXA 1BG4A 3Q2DA 2GJPA 3SN1A 4W5UA 1WZLA 1PEZA 2Y85A 1JZ3A 1UR4A 4Y9PA 4PUEA 4PA8A 3FA3A 1NDVA 3UG4A 3C0QA 3S4TA 2P3EA 3Q65A 4GJ1A 4TV6A 4WJEA 2QJNA 4KEUA 1NF0A 2VFIA 5G2HA 3AU6A 1NP2A 2PLJA 3IJDA 2YCEA 2NQ9A 1WUEA 2QF8A 1XC4A 3NQ2A 1DJYA 3ZR5A 1AH4A 1PTAA 1F3WA 3RIKA 3IV8A 2WKGA 3BLPX 4GJJA 1XUZA 3BMWA 1JCTA 4HK6A 1H7NA 4DHGA 2XFFA 1TUXA 1T6MA 2QV5A 3KBVA 3VUSA 1VAHA 1VP5A 1G01A 3HG5A 1MXSA 2WWCA 1N8FA 3F5LA 2PWUA 4M19A 2G50A 4Y6GA 2QUUA 2PGWA 5LSMA 1WDSA 3B04A 2PC8A 3ALGA 3CUGA 3GR7A 1J9YA 4MZ8A 1FWWA 3AHYA 5TAOA 2CITA 1B3XA 5FESA 1G4PA 4OFCA 1KWKA 1US0A 4HK5A 1J0YA 1KD0A 1KFCA 2BHYA 4O1CA 3C61A 1EJSC 2GGGA 3R13A 1YLVA 2J7HA 3WQFA 5HMEA 2PP3A 4CEXC 2XVNA 1TX0A 2QUMA 3DG3A 1NFPA 1HKKA 3G1DA 3E2SA 2D69A 1TV3A 2YOCA 1E0TA 5A6BA 3EWDA 4YTRA 3CS2A 1HG3A 4HN4A 5CPLA 1QO5A 1TPH1 1X6LA 1XLIA 3M0KA 4QNWA 2EPLX 3GDMA 2WSRA 3LHYA 5C2GA 3VD7A 4LV9A 4WDWA 2Z7KA 4DBUA 1W2PA 1AK5A 5DCEA 3ENLA 4CD8A 1P1MA 2AL1A 3NCOA 4RE2A 1MVYA 3QYSA 4S2CA 1ME8A 3QZ6A 1GOXA 2WM0A 3QOKA 3RILA 4GZIA 1BRLB 4HSHA 3R4IA 3W7JA 4X0VA 3FN9A 1NWSA 3ARRA 2P53A 4UMBA 2J7FA 4V28A 2J9XA 3AICA 4M29A 2NVAA 1R47A 3KVMA 1EXPA 3B8WA 3I7RA 4H2CA 1CIUA 1ZS2A 2O0TA 1QCWA 1TPEA 1B3YA 3CASA 3W1TA 3TEVA 3VFCA 3RMEA 4B5NA 3S9YA 5I78A 4XAGA 1CWYA 4U31A 2DZVA 3G1AA 3PANA 3C52A 3T0CA 3EYPA 2DFAA 1RLCL 1RSCA 2J79A 4R53A 2R1MA 1NOWA 1MUWA 1R7OA 1GORA 4QG6A 3S9ZA 4PL1A 4LOCA 1VPQA 1BF2A 4B5TA 4JN8A 1KXVA 1TFVA 4KRZA 2H3DA 5I3JA 1DL3A 2V5BA 5D2YA 3RCMA 3FA4A 3H2NA 4H7VA 4FLRA 3GE7A 3SECA 4GYKA 3AC0A 1VEOA 1XCXA 3NDYA 1OX5A 4INFA 4M81A 4QM1A 3TH6A 4K7YA 3AIEA 1AZ2A 3LG3A 3AQUA 5IHRA 5KZ6A 4XWUA 3LLFA 4R7JA 3T55A 4C6CA 1XXXA 2J7GA 3MVIA 2VX5A 2XM1A 3LPFA 3GNNA 3P5ZA 2ZZ1A 3QKZA 1E6XM 1XJBA 3GC2A 4XO6A 4PCSA 4MNMA 4NIRA 3PN8A 3URNA 5HJLA 3SSJA 2EAWA 4GCAA 3HTWA 2YGYA 1WZKA 1QI0A 1WB0A 1TJ0A 3H24A 4UQEA 3WQ4A 5DMYA 1H1NA 3C2VA 4AWUA 3UXIA 4DZHA 1W1PA 3ATZA 3I65A 3VMPA 4O1BA 4LVDA 4M3PA 1XD0A 3BCFA 1OJXA 3WJYA 1Y5XA 5LGZA 1NIUA 4C91A 2Q09A 3CPRA 5G4EA 2FHFA 5M5DA 1UWQA 1UWSA 1DOSA 1UBSA 1H50A 1AMKA 4PUNA 5HULA 3LPGA 1MUMA 3PFRA 4LS2A 1UB3A 5FA5A 1M7PA 2PDWA 5BWFA 4BQ4A 4F3HA 3WLQA 3QVQA 1HL2A 4F0LA 4NZJA 1Q5MA 4IL0A 3B9EA 3TTSA 4E6MA 3OPSA 2C3ZA 1JNEA 4UTTA 4PMYA 3VX1A 4WKAA 4Q8WA 5BWAA 4JCLA 2Y7GA 4XKYA 5E0FA 4NNAA 1WKYA 1RA0A 4D6EA 3T78A 5HQEA 1TJ2A 1KM4A 3HO8A 3NXFA 1LWJA 2V2CA 3HV8A 3WDHA 1XBZA 1ZY9A 2PF8A 4HCDA 1FCBA 2ZRZA 4ZL1A 4YTTA 1S39A 4PN2A 2BX7A 3W82A 1Q7QA 3BOFA 2YJQA 4ZBCA 2VP8A 3NGJA 3WQDA 4WCJA 2CNCA 3V0UA 2RDUA 1M7JA 2OLSA 4N7QA 2OGYA 4YHEA 1JZ7A 2OZ3A 5AHMA 4ZTYA 1DWJM 1YMYA 2JBMA 3B0UX 5KMYA 4ORIA 1Q8JA 4LBRA 2GQ9A 3KRSA 3OHIA 2WVVA 1P6WA 3B8UA 1K03A 5I0DA 1JAKA 1T8XA 1ISZA 3K2GA 1UIOA 1ISXA 4CU7A 7XIMA 3E0VA 3TW6A 4DLMA 1XLHA 3CPUA 3RPDA 5EKYA 4IPNB 3LOTA 3CK5A 4D1IA 1FWEC 1I4NA 3EXRA 1EPXA 1HQTA 4IIHA 5A2CA 3VIMA 1OC6A 1WO2A 3IJ8A 3WUBA 1ISYA 1RJPA 4DELA 3P84A 1QOPA 5FAGA 4BEUA 3EOSA 4GNJA 1U5JA 3W7QA 1K7EA 3CIWA 3G1SA 4PB5A 2WJZA 1B3WA 2VNCA 2V68A 1C8YA 4E3TA 3Q4DA 2BZNA 4M56A 3JR2A 1GYNA 1U30A 4YCOA 1L8NA 3GU9A 3FEMA 5C9XA 3POHA 4DBEA 1FHDA 5BRBA 2OCZA 3PUGA 1XQLA 4L6HA 4NAFA 1PBGA 1Z9AA 2NVCA 3GC5A 4UCFA 5E6YA 3WUEA 1VFHA 4EANA 3JUGA 2RH9A 4QJ4B 3VXGA 2Y7FA 3TWAA 5FF7A 3I68A 4JQAA 1XQKA 1XKYA 1NQKA 4ZENA 4C60A 3MUCA 1ZRQA 4GZEA 4YXGA 2WQPA 2CHRA 4G1KA 4UTWA 1YE6A 3CHVA 4MY8A 1A80A 4PUKA 3FIGA 1V79A 2YX0A 1G1YA 2O9RA 2OGJA 3QYQA 4HA1A 2XN1A 4RW5A 2R9RA 3UZYA 4S3GA 4O14A 1PHWA 3KOYA 3AXMA 4D6HA 1B54A 4HNVA 1VB9A 1WKFA 4I5UA 3WX7A 1CX9A 3PHAA 3VU2A 4DNHA 4FOJA 4DJFA 3EWUA 4L4LA 1CPUA 2HPMA 1VBJA 2X41A 4ZSUA 5KZDA 4HBKA 4O54A 2YDAA 4C6DA 2Y8UA 4KIRA 1LUCB 2GVLA 4MLRA 1JDDA 3PULA 3DFSA 4GXWA 2AL2A 3P3BA 1S3TC 3TJIA 1A0EA 1WOAA 3SN0A 2HDJA 4H7CA 4AW7A 1W5QA 1TR1A 3O6YX 4HNTA 3GW0A 2INEA 1VYSX 1XISA 3D3AA 2FH6A 2J6XA 5GNXA 4TOQA 2VFFA 5U7SA 4AD2A 1E55A 1U5VA 3WK1A 1ZUAX 3OG3A 1XLCA 1FHVA 2FZ9A 3RRXA 4AD4A 2FLIA 4JS3A 2YA0A 3E3HA 1JCJA 3EKGA 4GVGA 3O1NA 1UA3A 3EBVA 4KF1A 3EEGA 3GB6A 1H63A 4OBRA 1G4SA 3SCTA 3TK7A 4UTTC 2D23A 3NO5A 3NL2A 3P61A 4XSLA 3IVTA 3PJTA 1BHGA 5FJPA 2C0HA 1I75A 1KNWA 2F84A 4C6NA 1FHUA 1JCLA 4Q8NA 1Z48A 3ARPA 3SRHA 5GVJA 4NJGA 1PKMA 2C0AA 4WUIA 3V1HA 1UIPA 2X1UA 1RCXB 1A5MC 3E49A 1OFAA 2XSXA 4NAEA 5AC8A 3STCA 5I07A 3LCFA 3NPVA 1EGMA 5JH1A 1IZKA 1A50A 1UPPA 1R0MA 3GSMA 2IKHA 3WNMA 4D1JA 5C9UA 3KBMA 3T8QA 4XKMA 5HK4A 2MUCA 4JTJA 1XUUA 4LT9A 3NL3A 3EKLA 3AIUA 3GVWA 3INPA 4J27A 3N2TA 2VTFA 4HMEA 2H9AB 1MZRA 3IJ7A 3GR8A 1LF1A 4J1OA 5KEZA 4POCA 4OU1A 5EMKA 1AW5A 3ZLHA 3C3NA 1UR1A 3R5EA 4S3DA 1JR1A 2Q71A 3DFNA 3OGRA 4H9XA 1G7VA 3R6IA 1QHOA 3WK3A 5D33A 1ZCOA 3U7BA 1JUBA 4LAOA 1JI1A 3C8FA 3E12A 3EPNA 1GHSA 3H4WA 5C7VA 5CPMA 4ACYA 4QAIA 3TXVA 1QNRA 4MJ2A 1J4EA 2J24A 1FWRA 3QY8A 2QVHA 1JF6A 3QC3A 4JXCA 2ZOXA 5HINA 2XG9A 1LTDA 4E3VA 3SFKA 2YYTA 3N17A 1HO4A 3RLGA 4LRTA 3TU9A 3U2OA 2PDCA 4FSAA 2PRLA 2FZNA 4GI4A 3ITLA 3TP4A 1UD2A 2WKJA 1ZBVA 2OQHA 3VE9A 1XGZA 1YDOA 2HXUA 3H2FA 3K5XA 3WLIA 2BSLA 3ZR4A 3SRKA 3LHVA 1DWIM 2G5WA 3U3HA 1BYCA 3LRLA 1BPLB 2Q8LA 4QP0A 1F74A 3RM4A 2OU4A 4LNYA 2PBOA 1R3VA 1NFGA 3W25A 1UBPC 4A2RA 3TYUA 1GPFA 1XWYA 4JTCA 1OC7A 3BLFA 2PPGA 1ZBWA 2PTWA 2PWDA 1O60A 1EJXC 1NU5A 1AJ2A 2SFPA 1H3GA 1E6QM 1TREA 1W1ZA 2ZVIA 1OCQA 4UTWC 4L4OA 3V5OA 1SR0A 4JBRA 4ERAA 2NWRA 5K3VA 4NNCA 2WMGA 2E3ZA 1LYXA 3IWPA 4IIGA 4B16A 4PE8A 1PL9A 1DXEA 4ATWA 1LWHA 1TIMA 2XIQA 4UFHA 4ZB2A 2Y6ZA 4Y9NA 2Y5EA 2NQLA 3MMTA 4RDWA 3ZIZA 4DJFC 1IT0A 4KQNA 5A2BA 2G97A 2PRHA 1OD8A 3W85A 2JALA 1BTMA 1NAL1 2A5HA 5A8PA 4MFEA 3QPEA 2FHBA 3LMZA 1ICQA 1Q7MA 3DG6A 4H1ZA 1FWSA 3A47A 3GXNA 1UA7A 3OZPA 1QNQA 4MM1A 4L1GA 1ISVA 4IFKB 2QCCA 1GKQA 3H21A 4FXFA 2ZWYA 2I5IA 4LAZA 1CGYA 3UY7A 3NIYA 2HMCA 4BJHA 4MFDA 4BF9A 4JDBA 3CHDA 3LXCA 4R34A 3TTYA 3WLPA 4U33A 1ZFJA 2H90A 4L6OA 3TW9A 4AD5A 5EL1A 1XG4A 3HGJA 1M04A 1QK0A 1VBHA 4L80A 4HKPA 4ZQOA 5FOOA 3SI9A 3KL0A 1TV2A 3W38A 1WAUA 5KZMA 3PZIA 4DPPA 4QDMA 1AH0A 3W7LA 2CU0A 5TBOA 2IPJA 2QF7A 5H8UA 2FZ8A 4HPNA 3QQ0A 4OV4A 3VVGA 1TRIA 1P5BA 4O0KA 3RR4A 3OB8A 4XVEA 3RITA 3BTNA 3E5PA 4H8VA 2ZZ3A 2BHZA 3W7DA 3ELFA 1PXGA 3VNLA 3STPA 1FKWA 4RCXA 3FK4A 5G5IA 3BJFA 3G0SA 2PTXA 2XU2A 4OOUA 1ITCA 3UVIA 2R14A 3NPXA 1Y65A 1L2UA 4S23A 5D8ZA 1LT7A 5F2GA 1VJZA 1CECA 3NQ6A 1QOQA 1B4KA 2GJXB 3FAWA 3R1ZA 5GPRA 3W2UA 1UJPA 4HT3A 1ECQA 2CZEA 4IL2A 1F73A 3N4FA 2YZRA 1QFEA 4H3DA 4BI5A 4WQ6A 2J8GA 4FXSA 2W27A 4GVFA 3PTKA 1UD8A 1US2A 2V5LA 2X1RA 3G1FA 2E9BA 4QDWA 4YTSA 5A6KA 2VFGA 1CB2A 2E6AA 3H2MA 1RK6A 4GX8A 2V63A 2GVGA 1CXLA 4LEQA 4UQCA 2NWSA 1KBBA 4P8WA 3HA1A 4EXAA 3VIOA 1C8VA 5H8MA 2GSEA 3IJQA 2E67A 3QFWA 2PDJA 1Z3NA 2E25A 1J8VA 2VZVA 4IQJA 2OEKA 4ICMA 3VOCA 3PSVA 2FGBA 4MJ4A 4ZCWA 4A29A 4NJKA 4QLKA 3VKCA 3L4VA 1D7KA 3LNPA 3KOFA 1UH2A 1ECEA 2GOKA 4NZ4A 1FCQA 1MYRA 4Q4OA 3KBNA 2FTPA 4JKMA 2WMFA 2PDNA 3V4BA 3KP1A 4R85A 3ARZA 3OEXA 4E4FA 3B0VC 4X60A 5A6BD 4ICCX 3ZLGA 3ICJA 2AMXA 2X7WA 4AISA 4LYKA 4CQ9A 3T44A 3NDZA 2I17A 4LAUA 5CC6A 4PUDA 1O94A 2C16A 4JHZA 3LK6A 1YTEA 4CCCA 2ACQA 3DFHA 2PDLA 4UR9A 1A49A 4PH6A 1JULA 5LA2A 3H2OA 2PS2A 2W91A 2CPUA 3CZLA 4RX0A 4FNPA 3T2PA 3GXTA 5F7UA 4ZFCA 2R8WA 4H01A 3VD4A 1OGSA 1OFRA 4IJBA 2PF0A 3HJZA 2Y8KA 4EWND 4AFYA 2I5GA 2NW0A 1XLFA 3V5FA 3II1A 2J66A 1TQJA 3L0KA 3WNLA 4DAIA 3M5XA 4B5WA 3VGBA 1KRAC 5BXSA 2PAJA 3WMSA 5A6LA 3GNDA 2V82A 3LCGA 4C6MA 3DBPA 3CT2A 5BW6A 4QR6A 2CBUA 4FAMA 3QC0A 1SO4A 3CQKA 1UJQA 4GO9A 2ZUUA 2I56A 4IWWA 2DIKA 4C6IA 3NQ7A 4Z2IA 3M44A 4BI7A 4UQBA 3CWOX 3I7SA 4XBJA 4XZBA 1Z44A 4YMZA 2V3DA 4ZOBA 5J5RA 1E40A 1V0MA 3MBFA 4Q3MA 4HYWA 1QJWA 1O5XA 2FFCA 1DE6A 4TXEA 2FPVA 1RP8A 4W85A 3PY2A 2PC4A 3LZ5A 2QCNA 3V3WA 3FSTA 4JIEA 4O1DA 2PDXA 2OOFA 4FNUA 1QPQA 3WF0A 1SMAA 2JKEA 4M6QA 1E9YB 5CPSA 2HRWA 1EHAA 3IGHX 1W6TA 4NXKA 3AHTA 3IGSA 1GJUA 4KGLA 1B57A 2PP1A 3IJ9A 4A22A 1XIIA 4Q6XA 2CHOA 3RO8A 1ZALA 2E6FA 1FUYA 1QMLA 1LRNA 3AWNA 1IV8A 3S2JA 1ZLPA 3N14A 4I6KA 2XHYA 4ZZ9A 3OHMB 4MMWA 3FYPA 2P10A 1HKWA 5HNRA 1BXBA 3GYEA 5CSRA 2DT0A 3C2YA 2IQ0A 3W24A 4UTIA 3N4EA 2G96A 3T0AA 1ADSA 4HYVA 5EFFA 3W1QA 4C7DA 4JTQA 4HB7A 3M1ZA 1REQA 3BCDA 2PCEA 3CEUA 5U4NA 3LDVA 4N9EA 4CN1A 4OQVA 4QXIA 1W9VA 2JIWA 5I77A 1GVSA 2E8ZA 3B0YA 4IISA 4IGMA 4E4PA 3FKKA 3D5HA 3EAUA 1BXNA 1RP9A 3P67A 5C71A 2YYUA 3N9KA 5TIMA 1SM9A 1H60A 2A6LA 3GH4A 3AS2A 3VNKA 4KEZA 4GUJA 2GGIA 4XZIA 3K8LA 2YCJA 4PSRA 1CXEA 3NQGA 3CAKA 5I24A 3K1DA 2O4MA 1K4GA 5AHNA 3T1GA 4O17A 1CGVA 1P0DA 1C91A 4W4QA 3QR3A 3SDOA 4IUGA 3VCRA 3GNPA 3AHZA 1IEQA 1X8CA 2P76A 2DJXA 2UWFA 3CQHA 3C3UA 1YBQA 1GYLA 1L0PA 2Z1KA 2ZBTA 7TIMA 3NL5A 3L2MA 4ZO9A 1X38A 4NX0A 1E73M 4DUWA 3P81A 3DKJA 3CIXA 2X16A 2UY5A 4JFTA 3OW1A 4PB3A 2ZA3A 1E6PA 1V3JA 1P43A 4DWSA 4O8AA 3DENA 1MI3A 5K9XA 2PWVA 3NSNA 4N4PA 2Z6IA 3P14A 2YFNA 2GGHA 4FR1A 5B7YA 3N12A 3A22A 2Y8VA 6TAAA 2B81A 1W3HA 1FFQA 1K9DA 9XIMA 5E0CA 1QRQA 2PDKA 2QJJA 3G77A 1HJWA 4X2PA 1IIGA 3H2EA 2YA2A 1UUQA 4JQ1A 3Q58A 2DSUA 1RLDA 2PZNA 3GNOA 4G5DA 1IWPA 1E6SM 4YHGA 3W7HA 2A85A 4J4KA 1V3HA 1WBJA 4IPLA 5A5WA 5FEPA 3TMLA 2CERA 3VDCA 4O0QA 1J2WA 2EF9A 5A6SA 4E0CA 4N6EA 5FF3A 4L56A 1K70A 5FJUA 2OODA 3UR5A 1VIZA 3LUTA 3VC6A 3AO0A 4WEVX 4YPJA 2OYLA 2I14A 2ODOA 1BLIA 4MKNA 3L7RA 1I1WA 3KL3A 3WLMA 1H5YA 4JEJA 3TMQA 3PC0A 1E4NA 3DFYA 4AUBA 4MY9A 2ZZ7A 3L9CA 1V3IA 5AB3A 4Z2KA 4QJ3B 1JCXA 4PYSA 2YFOA 1OK4A 1KKRA 2OWXA 3P62A 3MJMA 3S42A 2J6VA 1XLDA 3UYCA 1JXJA 4M1BA 1FRBA 2FJUB 2XGIA 4XKYB 1KLYA 2EGZA 2PDQA 3UWWA 3T4CA 3H54A 1J0ZA 1QI4A 5IFPA 4ZFMA 2XIOA 4OBSA 4RZ6A 4IIDA 4I5RA 3KW3A 4D6GA 2ALRA 4IICA 4US6A 1EYEA 4B5XA 3DG7A 3SCOA 4DPQA 1OG0A 3VDBA 2ABBA 4DO6A 4DJFD 3WQGA 3MMWA 2IUZA 3ARYA 4PUJA 3GDBA 2OX4A 1KKOA 3F4CA 2VWSA 1GG0A 2QZRA 1V0LA 4QTGA 1EUNA 2BOGX 2OO0A 4IPIA 4AZHA 1GKPA 3TOPA 4Q8OA 1F8MA 4MSSA 3WD4A 5EMMA 5E0KA 4DO5A 4DM2A 3VFLA 1TPVA 3RCYA 3GTXA 4UWMA 4Q4MA 1W17A 1K8YA 1O1ZA 4RW3A 3W6LA 3H55A 1VQTA 1SW3A 2WVVB 4NZ1A 3GVGA 3WNKA 1DJIA 3CQIA 4DVOA 4Z1YA 3W84A 4FOUA 1LLZA 1CLKA 4BHYA 3UZXA 4O4VA 4DQWA 1A47A 5HNTA 3FS2A 3S5SA 2J25A 2V69A 3GVQA 3ZR6A 2VEKA 4EF8A 3CH9A 1XLAA 5G1MA 1TSIA 4HU8A 3QZAA 5M03A 5F4XA 3RG6A 4TU1A 3STFA 3WD1A 4E8DA 2VRQA 2Z4GA 4QE1A 1VR6A 4IPJA 4A3QA 1H5VA 3GTHA 3R58A 2WNZA 2ISVA 3SQSA 1RR2A 2OTDA 7TAAA 1TPFA 3LXAA 1SO5A 2QPUA 3WQWA 2BP1A 2V3GA 3BZJA 5AVNA 1MW3A 3U6WA 1CLVA 4NAFB 3AHVA 3OLEA 4JX6A 4A8LA 4GUGA 4ASTA 3H2CA 1H7PA 1VBRA 2HTMA 1UWUA 1WDDA 4DF0A 4Y9OA 2HROA 4AZ7A 6XIMA 1KCZA 2FQIA 2QW5A 3IJLA 3PZNA 3W6YA 4JGDA 4F0KA 1TJRA 1JYNA 1YXYA 5K9CA 1JUKA 1DWHM 2INFA 3AAMA 1ZBCA 4RR4A 3V16A 3G1HA 5T8GA 1H51A 3NQ8A 4AX7A 1MO0A 1CYGA 4F8XA 4R27A 1MNZA 1GTEA 3C0SA 1HKIA 4DWSC 4UFMA 1ONXA 1ZPTA 3E0IA 3KWSA 3W0KA 1WP6A 3LB0A 2CXGA 3HPXA 1AW1A 1KQYA 4U3CA 1QPOA 3KDNA 4RUBA 3HJEA 1V02E 3WLHA 4W9TA 3GXDA 3OVGA 2VGIA 4KWVA 4CNTA 3AS1A 3ABQA 1YE4A 3GKAA 4C1NA 2DV0A 3TFCA 2VEIA 3MV11 2OWWA 3JZEA 4DUXA 4AU0A 2AL2B 3ID7A 1ZL1A 2Y89A 5AYIA 3V18A 3P5YA 1QHZA 2IXVA 1B3OA 3DECA 1TTQA 1JVNA 2YLAA 1V6UA 1TPUA 4RDYA 3KCJA 4CD4A 3VIJA 1OYBA 3MI2A 3QY6A 3GFZA 4XTDA 3BL3A 1OGGA 1TA3A 5IBXA 1Q6FA 1TKKA 3OP2A 1A4MA 4S3JA 5RUBA 4ZE4A 1XSIA 1SO3A 3T6CA 5IDZA 3FVDA 1FWFC 3FJ6A 4P7OA 3TCEA 4KCTA 3NSMA 4D6IA 1GOWA 6TIMA 5DLCA 3B3DA 2QCMA 3WUFA 1P6CA 2OEMA 3GXMA 3HFTA 1EL3A 4Z2LA 3T09A 4JD4A 1JG9A 2WCGA 3CHFA 4P7RA 3RFAA 2GGEA 2DZWA 3UCQA 2ZYFA 1M53A 2VURA 4MKVA 5D2XA 3PJUA 3PTDA 1OM0A 3CLMA 1W54A 3UR8A 4MPQA 3LTPA 1QU4A 1MUCA 1GCYA 3G1XA 3PWAA 4WSKA 3IGXA 4Q6JA 5AZ0A 1LM1A 2J4GA 4Q8QA 3TX9A 2DZUA 4F9JA 3MP4A 5E70A 4OOZA 4H83A 4NAEB 3VGHA 2Y0FA 3I6EA 1W3KA 3VIIA 4DI9A 3THAA 5I3HA 1SJDA 3W7OA 1C93A 2ZZ2A 3UVAA 2D1ZA 4AHPA 2EEXA 1LLOA 1TPB1 3QGAC 3ORWA 2VUNA 1MW0A 3TR9A 1ZAHA 3I6RA 5BRPA 3CTLA 5AC4A 4WDUA 4RE3A 1TUFA 4U10A 5AYYA 3EWCA 1XIFA 4WDXA 1YTKA 5LXEA 2YCIX 2ZZ4A 1KM6A 4LWWA 1KQZA 1TO3A 5A8MA 2XVKA 4LUIA 3GC4A 3MUXA 5FD0A 4WSHA 5C9WA 4J2PA 5F4SA 3PK7A 3BGJA 4UTKA 4O8RA 5A6MA 4OTKA 1XYCA 1MEIA 3ZM8A 1UOKA 4J7RA 3FJLA 3THQA 3R43A 2P8CA 3RLVA 3WJWA 1TV8A 1XBXA 1UZ4A 1KXHA 4Z1BA 1A0DA 3FHAA 4QS6A 3N18A 3RM8A 4NP7A 4C1LA 2WBKA 2AGTA 3AWOA 4WD0A 4MADA 4LJ3A 2QUNA 4DYEA 4IG2A 3W73A 2B4GA 1S2UA 4RDVA 2V81A 3WMBA 2FVKA 2YDQA 5CG7A 4CN4A 4L4PA 3H7UA 5BCAA 3B0PA 1TMQA 4W7VA 2BY1A 4S2BA 1E72M 3L68A 3WYZA 5BROA 3GH7A 4EE9A 5J5DA 4KGJA 3B05A 4KMQA 2B7QA 1QXLA 3L4YA 4IFRA 4KPLA 2QDEA 4NHVA 2ALDA 1W32A 3WSUA 4H9MA 1KB3A 3T07A 1F05A 4B3ZA 1TCMA 2CZDA 3N19B 3UP8A 4ML4A 2DZSA 5K9DA 3F4VA 4WIWA 2QNEA 3LTSA 4HK7A 4MNJA 1OZQA 3CUZA 1W5OA 4QFUA 1ZENA 2AKZA 4HYRA 5JBDA 1A5BA 1AD4A 3WD3A 4XQ6A 2J13A 1HW6A 2XSBA 4GACA 3ZXWA 3WNOA 5BOFA 1RJQA 2QCDA 5FJIA 3GTNA 3L5MA 3D3FA 5D2WA 1SZRA 1DYSA 2OZ0A 4AF0A 3FVMA 4CLMA 2VRJA 3DU0A 1XF0A 3PBYA 3BW4A 1SO6A 4GGHA 4KWUA 4QHRA 3HPFA 3TC3A 3IIXA 2VFHA 3CAVA 1RCOB 3K46A 3SAZA 3MS8A 4HA0A 3QM3A 3QR0A 4JQ3A 5GQBA 3MVTA 4XK2A 4NI8A 4H00A 3GZ3A 3NQBA 3AI0A 4IP4A 2E77A 4NZFA 1CXHA 3KVJA 2WJEA 4LUTA 4BWLA 5CBIA 3SO7A 3DZ1A 1JPHA 4A4AA 5AECA 5JIWA 3OLGA 1HGYA 3B9OA 3ITVA 2ZRWA 3R2GA 5IBXC 3MI3A 4LBUA 4AMCA 1YIXA 5EMYA 1OF6A 3CV2A 2OXNA 3WF1A 3U8GA 3B40A 2QDGA 5DELA 3M64A 3QF0A 1CBGA 2UY2A 2HVMA 1R8LA 2OT0A 2OSWA 2GL5A 4Q8TA 4Q7NA 3DYPA 3H8AA 3MCMA 1GVEA 2ZE0A 3LEPA 1MW1A 2VC7A 2HXTA 1E15A 1XIGA 2DSVA 5HDRA 2O9OA 1PO9A 4ADSA 3WELA 3QHMA 4KCWA 3K4DA 3FLUA 3AYVA 4LCRA 2GJRA 1UW9A 1IEXA 1LP6A 3PR2A 1TE1A 1NELA 3IACA 2WB5A 3QKEA 4GKTA 1XH2A 1GVIA 1JNDA 3RXZA 3ECQA 2W79A 3D46A 2W66A 1QBAA 3ARXA 3U2EA 3VILA 3BQ5A 4GYJA 3TA6A 4LH8A 2XIJA 3AZRA 1IEIA 1HUVA 1TB3A 3FJNA 2RAGA 5CAHA 1UWTA 3UEQA 2YCLB 3PPFA 5FKYA 4MF4A 3HMCA 1XM3A 1GVRA 1E3XA 1IXPA 3QTGA 2CLFA 1VC4A 1ZP4A 2GUBA 2A1YA 3WH9A 2D2OA 2V30A 2E8YA 3GHRA 3CC1A 4JFSA 3TTOA 1DIKA 1IEVA 4X9SA 1F7BA 4A8NA 5AHLA 4AXKA 5C0QA 3RRAA 1XBVA 5AN7A 2OT1A 1OCBA 1UYQA 5EPDA 4GH1A 1XICA 4NU7A 4NZ3A 2G4JA 3ANUA 3O6AA 4EKJA 3UZ5A 5JBEA 4IP5A 3UJ2A 2BBFA 2C15A 4NG3A 2WJFA 3FV9A 3BK0A 4JNMA 3WDRA 4M6PA 2QUVA 1B30A 3TAKA 3TZFA 1W3TA 4IIEA 3PNZA 4K6AA 4UTMA 1Q65A 2W63A 4DF2A 1KM1A 2DSZA 1CNVA 5LA1A 2AAAA 2FTYA 4NVTA 3PWIA 2PWFA 1I60A 2IXUA 3RDKA 4HP5A 1X1OA 5BOEA 2HNEA 1XD1A 3CO8A 5D9PA 1H1YA 4H8HA 3S1VA 1FWIC 3SGGA 4BFAA 3K30A 4Y8EA 3BC9A 3MTWA 3S5NA 2J62A 1XDJA 2BVYA 1F3XA 3A3WA 3W1XA 2E1DA 4PMNA 2VGFA 2OJPA 3EWBX 1BWKA 5EGRA 3G5EA 2DVTA 5CPOA 1GVYA 3TYBA 3OLDA 2ZRYA 5LXXA 5H91A 1PUDA 1G69A 2WSQA 2PCQA 3NPWA 4O16A 1O5RA 3G1VA 4EXBA 2FB2A 2JIEA 1R2RA 2DSWA 3TROA 2X42A 4OWGA 3NDOA 2CWNA 3MWAA 4IMCA 3IAPA 2AQOA 4FMVA 4CVUA 1VBGA 1XPGA 1OFEA 4YVXA 1YNPA 4RL3A 1KRBC 2EJ1A 1W9DM 1UOZA 2QKFA 1VF8A 1XRVA 1SFTA 5AHIA 4HPGA 2VCBA 2JE8A 2I9UA 1R5YA 4LRSA 3VX0A 3W71A 3DFOA 1KC7A 5CGMA 3J7HA 4KERA 4QITA 2XN2A 2ZZ6A 4PUUA 1MW2A 1X98A 2ZRXA 3H4XA 1F3TA 1ICSA 1R87A 2ZE3A 4C6KA 2QXWA 3MUY1 4UBPC 3RJXA 1XI3A 4DX3A 1TR9A 4QLJA 4K37A 2BXYA 4G1NA 3HBLA 1F9CA 1GZ1A 3TQ0A 3UF9A 4EK7A 4RXFA 3BAKA 4AG0A 4CEUC 2QJIA 1UUOA 1BVNP 1DKWA 4XBSA 5DT5A 3STGA 4BWLC 3TDFA 1UKSA 3NNTA 3QV7A 2EO7A 2VELA 3PB0A 1VFLA 1PJ9A 3HU7A 3MHGA 2PWGA 3PM6A 4J5NA 5L6UA 3N04A 1B4EA 4AZ6A 5D2TA 5D37A 4ALDA 1G4EA 4DWSD 3WBYA 1FFRA 1UWRA 1UKTA 1OC5A 3EDEA 4QCEA 3FHQA 4JY9A 3MZNA 4RDZA 3V0SA 5AYBA 3T0BA 2OPJA 4J40A 1WA3A 2QIIA 3UW6A 4XIMA 4JTDA 3VD3A 3C86A 3NO3A 4DZAA 4AY8A 2QIWA 5CEWA 4GFIA 4EAYA 4BF5A 5GJNA 2PLMA 3QMTA 3GG7A 1J10A 3O07A 4C6FA 4GPNA 4M7SA 1LOLA 4CD6A 4O13A 3KM8A 2FVMA 3AZSA 4RPPA 1OYCA 3SCWA 4IH3A 4UOQA 1TTJA 2EPMX 5DMLA 1ZZMA 2G41A 4U2YA 5I3FA 1L6GA 1MQPA 5IXEA 2V5KA 4TO8A 4JN6A 4UQDA 4LGXA 3L5AA 1W3JA 3BO9A 3ITCA 4NT0A 4AVNA 4F48A 5K4ZA 4FS9A 4A8IA 2PLKA 2DUXA 1MFUA 4PTDA 3PPGA 5FEZA 2PFHA 4PMJA 3LGGA 4G8TA 4MWAE 2CC0A 4PTMA 5AKQA 1O66A 3WIJA 3ZWSA 3QQWA 2YL5A 1Q6GA 1VBUA 2NQJA 1XFBA 5LNRA 1MWOA 4KS0A 1REQB 3KDOA 4YNGA 3TA9A 4FLSA 4O1EA 1DWFM 5ECVA 4A3HA 5CJ5A 3BURA 3KTXA 3AYTA 3R94A 1Q6OA 3N3TA 4ADTA 1CXKA 5DEZA 2Y4SA 4C7FA 4M8UA 2HEJA 4KBXA 1R30A 2G37A 3WK0A 1PVNA 3KS6A 3SURA 1DE5A 1XBYA 3F5KA 4IJCA 1E70M 2X1SA 1FTXA 4B5SA 1EX1A 1RALA 1UD6A 1TWIA 2GQAA 4MB4A 4HVXA 2J75A 4CQBA 2QCGA 3FKRA 3QSRA 3IJIA 1UR3M 1T0OA 3O2LA 4P7LA 4LC8A 5HNUA 3DDMA 1YBQB 5DQPA 3YPIA 4JIQA 1LQ0A 4CNSA 3EDKA 1A53A 3ZS4A 1CW2A 3MSRA 4BS0A 1RBOB 1XYAA 2YLLA 2J78A 3RLUA 3WFAA 1E0UA 1CZ1A 3UQNA 4Z2JA 1XLKA 3B4UA 4GWEA 1VJIA 3AROA 4DWSB 3B9DA 3WLJA 1LL4A 3PZGA