3W22A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-125
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
rcsb
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w22A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w22A01
1U83A 2RH9A 3R2GA 4O28A 2CLLA 4DBEA 1TPEA 3KVKA 3TKFA 3PSVA 1TPDA 3KRSA 3UZ5A 1MSSA 1DQWA 4WY0B 5LHEA 5LGZA 5EPDA 1QO5A 4YCPA 1OX6A 1I2RA 2BTMA 1GVSA 4GE8A 1A5SA 1QNVA 3NR0A 4LT9A 1OVDA 3Q94A 1EA0A 3W83A 1VCFA 1EP2A 5F4SA 5KZDA 4XBSA 3GAKA 3TQVA 1FQ0A 3S5YA 5DN1A 3PBWA 3LXAA 6TIMA 2WNZA 5TIMA 4GUGA 4Y9AA 1YDVA 1XBXA 4WXYA 2V5BA 2Y62A 3PS7A 1OFAA 1XCFA 2C0AA 1SZFA 3HPSA 1H7PA 6ALDA 1LBFA 3M44A 5CSRA 3G18A 1W31A 3WJZA 3ABQA 1TJPA 4BK9A 4IWWA 3ZR4A 1GG1A 3HQ1A 1TRDA 2A4AA 2ZDRA 3BGJA 2B0MA 4LUJA 1SW7A 1TPVA 1DL3A 2R91A 1JCNA 2PURA 3TR2A 3C8FA 3CPRA 5CPOA 3DHFA 4UTKA 1TIMA 2Y85A 3MHGA 3H54A 1MXSA 3LHVA 3PUDA 3M5ZA 1OF6A 1YXYA 4R7JA 3LBMA 4UTTC 3W2NA 3L0NA 1BTMA 1TB3A 3BLIA 3IGUA 3P7YA 1IF2A 4H4IA 2ATSA 3HG4A 2WQPA 4Y96A 3NXFA 3IGXA 3NAVA 4XWUA 5CG7A 1XDLA 3O8AA 3T40A 4HIBA 3TQ0A 3IVTA 4IUOA 2B7OA 4UMAA 5CZSA 4X3ZA 1GVQA 3UPWA 4O12A 1QAPA 1R2RA 1N7KA 3DBPA 4ALDA 3FOKA 4KKXA 3SZ8A 3N14A 2G97A 1TTIA 1KA9F 4AF0B 3HPXA 3IIXA 3W7LA 4UR8A 1ZJIA 4XBKA 2A7NA 3NQ2A 5D02A 4TR9A 5IBXC 3W7NA 2GPTA 2EKCA 5D38A 3QEZA 2Y61A 2XN2A 1N55A 1DQXA 2CW6A 5MHBA 3TK7A 3W07A 1A53A 4CNOA 2EAWA 3DFQA 4UTUA 2ATMA 3EXRA 3P67A 2VFFA 1QDSA 5IM51 1HL2A 4N9EA 4BWLA 1K7EA 1P5BA 1XXXA 2WO5A 2E6DA 5G5IA 4NQ1A 1G7VA 5HR7A 3KVLA 1UBSA 4JXCA 1ME7A 2V82A 3OVRA 1VH7A 4YWIA 3FA5A 3LGEA 4FHAA 4RZ6A 4AWTA 3PAJA 1W56A 3A22A 4E2DA 2HSAA 3M41A 5G4WA 4HN4A 1Z48A 1QPOA 1QOPA 3W2KA 3WJSA 4AAJA 1UUOA 1JQVA 3P5YA 1F76A 1LRNA 3LHTA 4I7VA 1O95A 3S1VA 2J9YA 3S9YA 1JVNA 4I7WA 1UB3A 4N02A 2DZSA 5F1VA 4NUWA 2CLMA 3WK3A 1YADA 1ONRA 4JYDA 1VR6A 3W7IA 3G3DA 4PEKA 4NZFA 2Y63A 4OGZA 4C1LA 2WSQA 1W8SA 3TSMA 3TSDA 3HG3A 4GRSA 5BMWA 3W1MA 2X1TA 3ELFA 3GKFA 4CLMA 1VCGA 2E6YA 4RZ4A 4JTEA 1QPNA 4WD0A 3BG9A 1OYBA 4MYXA 4Q33A 4HNNA 2WOQA 2QJIA 2J24A 1L9WA 5G2HA 4AWSA 5HWMA 1M6JA 3NPXA 1K8ZA 2ZZ5A 5I3JA 2ZRZA 3TJLA 1VQTA 1LP6A 3KXQA 4R34A 5AYYA 1YDNA 2O7QA 2CWNA 3DKLA 5EBUA 4NJIA 1F73A 4Z1DA 3NQDA 4DO5A 4WZHA 1R46A 3V75A 3N9RA 5L6UA 3VFLA 4BI7A 1SW0A 2ZQ0A 5DCDA 5LGXA 3E12A 1IIGA 1FWSA 3O63A 3S6DA 2ZZ4A 4LUIA 4OU1A 2C14A 3C4UA 3HGSA 4S1FA 4IXXA 3G24A 1NF7A 1R2SA 1KW1A 5K4ZA 2NX3A 2C18A 1H1YA 1W37A 3HO8A 1VGAA 1ML1A 2BXVA 3CHVA 2Z6IA 1IXOA 4AXKA 2V8ZA 2PRHA 2X2GA 2JKPA 3RLUA 1MEWA 4HT3A 3LTSA 4UFLA 3S1UA 2C19A 1MEIA 3MMTA 3LCHA 1DVJA 3W72A 3W6YA 4CCDA 2FFCA 4UFHA 3BK0A 5TQLA 4FNUA 3N73A 4QITA 4OWGA 2ZZ3A 4EVZA 1Z44A 4DF1A 4ADTA 1G7UA 4FXSA 5F4XA 3WJYA 2A6NA 2QCCA 3UWQA 3W1RA 4Z1AA 2PC4A 5CZ0A 2TSYA 4MY1A 2DZXA 4ZQRA 4CQ8A 1XUZA 2ZZ2A 4JEQA 2QCMA 4DEFA 1OJXA 3EXTA 3G0SA 3DENA 4ONVA 3M43A 3B4UA 2C16A 4LY8A 3B04A 4RV8A 3IVUA 4OHQA 3L9CA 5F2GA 3TW6A 3MI3A 2TMDA 2BSLA 1NF0A 1MZHA 1SO6A 3W7JA 1A50A 3STEA 1O60A 4NVTA 3STCA 3MP5A 3W76A 1YDOA 1JCMP 1ALDA 5FESA 1RVGA 3HBLA 4O57A 4LW7A 5C5YA 5H2ZA 3IEBA 5HINA 1EIXA 4WY0F 1XBVA 4PL2A 2DZTA 3PWAA 3GAYA 1H7WA 4UTJA 5D2YA 3LCWA 2YXGA 3HF3A 3G8EA 1DJQA 4XUGA 3ATYA 4C1KA 5AC6A 2JKAA 4NT0A 1OFBA 4K7VA 3MHFA 1W3NA 5FEPA 1UUMA 3KAOA 1GYLA 3NQ6A 3T4CA 1TMHA 3W7CA 2CU0A 3EKZA 5D05A 4DPQA 3M7WA 3MO7A 3LI1A 1BWKA 1QOQA 4XQ6A 2P0OA 2VENA 3THAA 4AH7A 4O1DA 1IGSA 3N3MA 3TQKA 3RK8A 3THQA 4PCFA 1OFEA 3CTLA 3BW4A 1Z41A 3W87A 4UFMA 1XDMA 1TREA 4HSOA 2VFGA 3CIXA 1SW3A 1A5BA 3LLFA 2YPIA 2DZWA 4HPXA 5T26A 5LNRA 2X30A 3NQAA 2FB2A 3PR2A 5HR6A 4UMCA 1TPUA 1DOSA 3W7QA 1ICQA 1D3GA 2CLFA 3LCGA 1EUNA 3UWZA 1HO1A 5KSWA 3QQ0A 3S5NA 4QM1A 1BWLA 1LBLA 1XFBA 2NUXA 1JQXA 4WUIA 1VS1A 2C15A 3G1SA 1OYAA 3OEXA 3N9SA 5EKYA 4JN6A 3G8RA 1I2QA 4O11A 3WK0A 1I45A 2GUUA 5K9DA 4XTDA 1FDZA 3KRUA 2QCLA 1SO4A 2GVLA 4N9DA 3MP3A 3I7QA 3EWWA 3W7HA 1LROA 2RDWA 1A5CA 2B7NA 3OHIA 3VI2A 4WQ6A 3CC1A 2ZBTA 5LSMA 3HOJA 1OX4B 3W7DA 3NPWA 3STFA 3CQ0A 1HTIA 4HHPA 3E02A 3NZ1A 4MZ8A 3UWUA 1AW2A 3G1DA 1H62A 2G95A 5BRBA 3C52A 4LS0A 2JGYA 1QPQA 5KMYA 4HSNA 1ZFJA 3G1FA 3LBCA 1ZHAA 5K2ZA 2ZRVA 3LRKA 3I7RA 2ABAA 5CSSA 2AAMA 4FNTA 4FX7A 3SGZA 3M5XA 2QR6A 3MBFA 1HFBA 1EPXA 1GVFA 4O50A 3IGSA 2J88A 4YLWA 1K3UA 3TV8A 4JX4A 1M5WA 1T99A 4BF9A 1QO2A 2NV1A 3PULA 3W22A 1L6SA 3MBDA 5EMUA 5GVJA 4N4QA 4JTGA 3UXDA 3NQEA 3PSWA 1CW2A 2IQTA 1TTJA 4JICA 4Z0JA 4HNUA 2FB3A 4ADSA 4MY8A 3R12A 2QEZA 1P1XA 1AMKA 1TPWA 4IPJA 2QCEA 3E9AA 3LCLA 3DKJA 3INPA 4HKPA 3GVGA 2PCQA 2TYSA 5DXXA 1SZNA 2XFWA 5LZLA 5C6MA 4MJMA 3W2MA 4GUHA 3UQNA 1SFLA 2ZA2A 1DJNA 2NWRA 2A1YA 3UWVA 5A5WA 1I4NA 3W23A 2C6QA 4MUZA 5U7SA 4UFKA 5DCBA 3NL5A 1OFPA 2ZA3A 5EL1A 3LX9A 1V5XA 3GIYA 3EEGA 3SY5A 2E1DA 3TC6A 3T78A 4FEZA 1ZAJA 4QSHA 5AN7A 4FB7A 1K7FA 3GXNA 5I3IA 3LHZA 1GQNA 1KFEA 2RHGA 1QWGA 2FJKA 5LHFA 5U4NA 2A7RA 4MFDA 4IX2A 3M5YA 1ME8A 1SZEA 5CKSA 3NL6A 4FX6M 3QW4B 1JCXA 1KFBA 4AF0A 1OABA 3WK2A 1B57A 5H91A 4KFNA 3QPYA 2YFNA 1RQEA 2H3DA 3GYEA 2OMAA 4XZ9A 1S5WA 1FUYA 4JTLA 3M1ZA 3AO0A 4EIVA 4KWVA 1AG1O 1PV8A 3LCIA 4GUJA 4MOZA 3SGUA 3TNOA 1KLZA 1O94A 4UNKA 4FXRA 3BLEA 1G67A 2F84A 4PH6A 2ISWA 4MZYA 3PUEA 3FIGA 1LRQA 4IXHA 4TIMA 3MUXA 3NQGA 1SUXA 1SFJA 3O06A 4PC8A 3QPZA 3GDLA 3LV6A 1UCWA 3EX1A 3N2MA 1GEQA 4IMEA 4OV4A 5C2XA 4UTTA 1LZOA 5FF4A 4JR5A 1I2OA 2V30A 1TCDA 1WBHA 3DFTA 4K7YA 5DY2A 4ZZ9A 3PC0A 5D30A 2YDAA 3QYQA 1T0OA 2V2CA 4YXGA 4M7TA 1GYNA 3QSRA 3W7GA 2BLEA 1KM4A 3G22A 3KX6A 2DZUA 3GDTA 4AHPA 2VXNA 4AMAA 3GDKA 4QQ3A 1TPFA 1NEYA 4LS1A 1H7OA 4NJJA 1J2WA 3SECA 2ISVA 4OT7A 1JCJA 1JJKA 4M6VA 3DU0A 1FDJA 3QMTA 3W1LA 5HULA 3ZS4A 1FCUA 2R94A 2RFGA 1H60A 4Z1BA 3ABRA 2PRLA 1FXQA 2C13A 3L65A 1KM0A 3G1YA 2VEKA 3PM6A 4JTIA 4WOQA 1GOXA 2TPSA 1EB3A 2QAPA 2X1RA 1W54A 5D2WA 3W88A 4LC8A 3W86A 2DORA 4UTWC 4LNYA 3A5VA 3P62A 3HG2A 5E93A 3N2XA 1BKSA 1DKWA 3DGRA 3NQCA 3QMSA 3LOTA 4LRSA 1M7PA 3QZEA 1KM6A 1LOLA 4O54A 3QMRA 4JTFA 1C8VA 2Y7FA 5J5DA 5HUOA 3L0KA 4O8RA 3JR2A 3O15A 3F4NA 2NWSA 3EKLA 4R53A 1WBJA 4UFJA 4O15A 3TFCA 2JK2A 2EF9A 3HB9A 1MO0A 4U28A 4ZQMA 1SQ7A 1IXNA 2GQAA 1KV5A 1Q6RA 2ZRWA 4O10A 1NFBA 2A7PA 3G1XA 4LVDA 1XKYA 2G96A 4BFAA 1XI3A 5C55A 5CPLA 3WJWA 2R8WA 3CIWA 2JKEA 3W1AA 4JY9A 3PBUA 5D2VA 3TAOA 4JTTA 2Z2UA 4MYAA 3W7EA 3W74A 3USBA 2GVJA 3UY7A 2C1HA 5G2WA 2PE4A 4BR1A 3S0CA 3PUOA 3P61A 3O16A 1VHNA 4M6QA 4XTIA 1HUVA 4FIRA 3W7KA 5HWJA 3DFOA 1PCKA 2NV2A 3HMJG 4O4WA 4ORMA 3S5ZA 1P4CA 4WX2A 4O4VA 1OK6A 4LVGA 5KTLA 5IBXA 4IJBA 5HQEA 3MI6A 1RZMA 2QCNA 1X1OA 4E2BA 4ZVJA 1O5XA 2FLIA 3FJ6A 4L4MA 5FI8A 5I3FA 1VHCA 1EWDA 1VCVA 1JULA 1LTDA 1NVMA 3LTYA 2E5DA 1RPXA 5CPNA 2YFOA 4DELA 3A23A 1WDWA 1QMLA 3P8JA 2RKXA 1KTCA 1VZWA 4CQ9A 3T7VA 3LHUA 4TO8A 1OG0A 3OBKA 4MY9A 3PBYA 1TV5A 2Y70A 3F03K 1ZAIA 2QDGA 2DJLA 3KFTA 1SR9A 4UIOA 3RLVA 1QFEA 2WJZA 3TC7A 5A8GA 3I7SA 2QCDB 3Q2DA 5BOOA 1TSIA 3FKRA 2EPHA 4FX8A 3G1HA 2J27A 3CEPA 3MW7A 4GC4A 2WSYA 3BV4A 1TPH1 1FCBA 2CLOA 4HPJA 4O1AA 4O1BA 1YTEA 3LCXA 3FYOA 4HNVA 2J9XA 5FF3A 1ZENA 3BW3A 4S2CA 3UZJA 1P0NA 4P2VA 4MKNA 3GZ3A 5LNUA 4LRTA 1D9EA 4RK8A 5G2IA 4MFEA 5D33A 5CPMA 3EWYA 4OE7A 2Y7EA 3FFSA 2ZRYA 3RFAA 4FIQA 2CZDA 2V81A 4JNMA 3STGA 4MPQA 5CZJA 1JR1A 5AHNA 3VNDA 2Y7DA 4Z0SA 5DLCA 4A21A 3EWUA 3N19B 3JS3A 3WK1A 2BX7A 5DELA 2A21A 3ZFHA 3MHUA 3VE9A 4NNAA 3W1XA 3KHJA 4K37A 4JS3A 1ZALA 3E0IA 4UXDA 3LERA 4X9SA 3TJXA 2HMCA 4NX5A 4IMGA 5AOUA 4O53A 2H8ZA 1G4TA 3P81A 4ZQPA 1LOQA 3PG8A 4JIPA 4BI5A 4MVAA 1D3HA 3DXIA 4AHOA 2DZVA 1K03A 4GUFA 5KITA 2WV8A 1DHPA 1JRCA 3SIZA 3TFXA 1RQHA 1I2PA 2Y89A 2A0NA 4OQVA 4DF0A 4Z1CA 3P8IA 4NNBA 3LRLA 5F4WA 1OX4A 3GNNA 5FF0A 4A2SA 1HG3A 1H63A 2CLEA 1I8JA 5BNKA 3C2FA 3R5EA 4WOZA 5KZEA 2VEMA 1K8XA 5F2IA 3DH7A 3W3OA 3BARA 1FX6A 3UPBA 5K9XA 2YYUA 3KOFA 1TV8A 3NO5A 2OX1A 4LVBA 4JIQA 4DXVA 4NU7A 2B7PA 4O14A 3GNDA 2VEPA 4LC6A 2DJXA 3V1PA 3MWAA 3CWNA 3L67A 4N6FA 1H7RA 4O0KA 1SO3A 2FPVA 3W7PA 4A22A 1BEUA 2E5BA 1KM5A 1W5QA 1EP1A 1FWWA 4BI6A 1F6PA 2NZLA 3TDFA 1R30A 2D73A 4G1KA 3PG9A 2ZTKA 1YXDA 3CLMA 5AFDA 2V2DA 2QAFA 1PVNA 2GQ9A 1YLVA 3QRHA 3NZRA 1AL7A 2E77A 4IX0A 4DPPA 5D32A 3L5MA 2DP3A 2YGYA 3NL2A 4GUIA 4PA8A 2B7QA 1TV7A 2YX0A 3LV5A 3SI9A 4K8EA 2VFHA 3L21A 4JTJA 1TQXA 3FEMA 1LLWA 5KZMA 1J5TA 2OJPA 4GJ1A 5EY5A 3SR7A 2VELA 3QC3A 4QISA 3PY2A 3G1VA 1L6YA 3L5LA 4X22A 4UNLA 4NXKA 4NZJA 5K4XA 3W2LA 3U6WA 1UASA 4NXSA 2CZ5A 4UTMA 3PF3A 5E0KA 4CQAA 5AYZA 4NNCA 2W6RA 4EF8A 1EWEA 4OBTA 4JDBA 4UTWA 1S3HA 5AHLA 1RD5A 1W5OA 3S8HA 4UCGA 1TYGA 4IMCA 4U4MA 3KRZA 3C2VA 3OG3A 5L9FA 2A2IA 4JYEA 1B3OA 4I9AA 4FO4A 1SSGA 2E5CA 3W84A 2GOUA 5D37A 3QSTA 4BWLC 3RMJA 3JRKA 3C2EA 1WV2A 4JX6A 3QFEA 4IOTA 2R14A 1LDCA 1WOAA 5G1TA 4A29A 1WQ5A 1F7BA 2E6AA 3BGGA 3TCEA 1F2JA 4KFPA 4QJ1A 5D09A 4H3DA 3NPUA 5LNWA 3LRMA 1VJIA 1LORA 1OX5A 2HS6A 3IIZA 3HGOA 2PRMA 1VRDA 4O18A 1G4SA 4QNEA 3EXSA 1GPWA 5EA9A 3TUUA 4Q4KA 3Q37A 4W9TA 3TH6A 2OZ0A 5AYXA 1K8YA 1T8XA 2P1FA 3M0ZA 5F2LA 3DHDA 4O17A 5I3GA 4AHQA 1O4UA 3RNDA 3C3NA 1MEHA 4Q32A 1LM1A 5KINA 2YYTA 3O1NA 5AHFA 4MLRA 2YW4A 4ZL1A 3NM1A 4N9CA 1KM1A 1EP3A 4PL1A 5HJLA 3BLFA 3TXZA 2CLHA 3W85A 4JGDA 3B0PA 1K02A 2C3ZA 3OA3A 1TQJA 2W0UA 1DBTA 3LCFA 1XC4A 2QCGA 2OT0A 4MZ1A 4RXFA 5J5RA 2ZA1A 4JDYA 2B4GA 4MJZA 1OFRA 4M6PA 1AW1A 2FTPA 4QIUA 3CT7A 1OFDA 3A21A 4ZQOA 3M47A 1SPQA 3L66A 3T44A 2V5LA 3SJ3A 4I7UA 4ADUA 1O5KA 3QM3A 3ZWSA 1B4EA 3N34A 3EX3A 3H55A 1GWJA 1B9BA 2HTMA 4N2YA 3L0GA 3W7RA 3PB0A 2NX9A 1RQBA 2Y7GA 3W7OA 4UTIA 3W73A 1WAUA 4O16A 2ZZ1A 4KWWA 2Y6ZA 4K36A 3DZ1A 3UYCA 5F2MA 3GKAA 5EYWA 3H53A 3CB8A 1W5MA 4UUIA 1ME9A 3ANYA 1WA3A 3DFNA 3BVJA 2GJLA 2Q3OA 2TRSA 5E1QA 4XKYB 1UJPA 2WPBA 3W71A 3P74A 4PFMA 2Z0IA 3QJAA 4RXGA 1NAL1 1C9DA 4M5PA 2E09A 3P60A 3O05A 3W2JA 2QCDA 3Q58A 4DF2A 1XUUA 1XL9A 3VKJA 1YPFA 4WY0A 1VC4A 3B05A 1KFLA 4LU0A 1FCVA 1R47A 2DU2A 3B06A 2V9DA 1F05A 3NQ8A 3SW6A 1Y0EA 5LNSA 3DAQA 4EWND 1WXJA 1EEPA 1FCQA 3I6RA 3O07A 4GFSA 3UWYA 4LOCA 4A2RA 4K8HA 1FY6A 3G3MA 3NVTA 4GNJA 1XBZA 1VYSX 3WFAA 3M9YA 3C61A 1XM3A 3U2OA 1LRTA 2AGKA 4E0CA 1W1ZA 2QUTA 1KBJA 2QCHA 3S42A 2HS8A 3IIVA 3IV3A 3HG5A 3QF0A 1QR7A 1J4EA 2OT1A 3KVJA 3FKKA 4N4PA 2AQWA 4IPIA 4XKYA 3MYOA 7TIMA 3O6DA 4ZQNA 3QQ1A 3NQVA 3CEUA 3W70A 4K6AA 1F74A 3P84A 3GXPA 4ML9A 1RV8A 4Y8FA 3B0VC 2CFFA 3NQ7A 1ICPA 2P10A 3L5AA 4CCCA 1GTEA 1RR2A 2Z6JA 4O13A 5ABTA 2VFIA 1WOBA 3NG3A 5DBTA 3EWZA 1GG0A 2JBMA 2ZRXA 4Z08A 1W3TA 3MP4A 4WJEA 3TIMA 1GZGA 5AC7A 3LDVA 1SZGA 3UXAA 3QW3A 2YZRA 3C2OA 1FWNA 4UTHA 4JTSA 5AHEA 1KFCA 2Y88A 2QKFA 1PIIA 1VLWA 5D04C 2J9ZA 3LTPA 4UFIA 3VCRA 4FNSA 3W1QA 2H3BA 1KM2A 3WJXA 1G69A 1W5PA 3M6YA 2A6LA 1M7OA 3GDRA 2ZFAA 4NJKA 1C29A 2XN1A 3TE9A 3MI2A 1VPXA 4GXMA 5SWUA 3BG3A 3BPWA 2NXGA 4JYFA 5HMSA 2GVGA 4UMBA 4RCXA 1KLYA 2ZRUA 3FYPA 1P0KA 4RZ5A 1ZNNA 3BW2A 2NLIA 1FDYA 1G4PA 3B03A 3FS2A 5K3VA 3UD6A 3VE7A 4NJHA 1EX5A 1L2UA 4Y6GA 1H61A 1TRIA 3AJXA 2W79A 4AB4A 3NGJA 4IQLA 3C0JA 4NX0A 1PS9A 3YPIA 1YTDA 2VKZG 5HNRA 1TO3A 4YL2A 2I1OA 3QH2A 1IXQA 1FBAA 1THFD 4QAIA 1W3IA 1H50A 3M5VA 4B5NA 3ABSA 2I14A 3I68A 3R13A 1JCLA 1B4KA 3S1XA 2QJGA 1KM3A 4N6EA 3BO9A 3A5FA 1TJRA 5AHIA 4EF9A 2QUUA 3W2UA 3C6CA 3EX2A 4DQWA 1JCYA 4DO6A 3HIJA 4LWWA 2X1UA 2Z1BA 4FNRA 3DI0A 1VYRA 3GXTA 5AB3A 4RR4A 3LLDA 4JD4A 1ADOA 4LV9A 1Q3NA 1GVOA 1OHLA 3TX9A 2I9EA 3EX4A 3L2IA 4TMCA 1KFKA 1WX0A 2DZPA 3GLCA 3W7MA 1R2TA 3G0XA 2YCEA 2NUWA 3S5OA 3GX9A 2X1SA 3P5ZA 2KZHA 4R33A 1KV8A 1T96A 3NNTA 3EWBX 4RKAA 1OFQA 1I2NA 1V7YA 4O52A 1Q6OA 4MIMA 3CWOX 3E96A 4TX9A 1YYAA 3KVMA 5FEZA 5D2XA 3UWWA 2E6FA 1YXCA 3MYPA 4ICNA 4YCOA 2GQ8A 2OCZA 3M16A 5DY3A 4AWUA 3A24A 3NPVA 2WSRA 4E38A 1PHWA 1LBMA 3ATZA 3LXBA 4RLIA 2CLKA 4JTHA 4K38A 3TMLA 1Q45A 4YMZA 2RDTA 4O0ZA 3I65A 4D2JA 3IVSA 2V0TA 1H51A 1OYCA 2ZCGA 4RJEA 1TTPA 5AC8A 1LOSA 4N9BA 1W5NA 2LLEA 2FDSA 1IIHA 3R89A 2ABBA 3RF9A 2V2HA 1Q6LA 8TIMA 3TAKA 2H8XA 2YW3A 4NJGA 1LCOA 2ZZ6A 2O7SA 4UTLA 1DORA 3F1QA 2VFEA 3UNDA 1VLIA 2CLIA 3LHYA 1JUKA 3LB0A 4JTKA 3E49A 3C2RA 3LM7A 4ORIA 4FNPA 5I3HA 2NXHA 1JUBA 2H90A 4O1CA 1JRBA 3P82A 2EGZA 1F6KA 1H5YA 1OK4A 3NA8A 3NQFA 4M19A 1AK5A 2Q8LA 4UC5A 5C54A 4ZMGA 3FJLA 2FIQA 4AVFA 1H7XA 3NEVA 3CU2A 3DFSA 2UV8G 1ZY9A 4UR7A 3FLUA 5CGQA 3W1NA 2Q3RA 2XN0A 3NM3A 3IRDA 1X1ZA 4FNQA 5G1YA 1QCWA 3O6CA 3TA6A 4POCA 2QJHA 4WXZA 5FF7A 1GJPA 3HJZA 4LTSA 4JTUA 3TMQA 2FPYA 3TROA 2BWGA 2WNQA 2BZNA 2ISSA 5K9CA 1N8FA 2CZFA 3W1PA 3TSBA 4GWEA 5LNVA 1A5AA 3DI1A 2EHHA 2QDHA 5DCEA 3NL3A 2E68A 4DO4A 3OIXA 1X8FA 3P80A 4TMBA 1PE1A 3SSJA 3R8RA 1SSDA 4JX5A 3HGRA 1SU5A 1PHQA 3ABOA 3PVFA 4AEOA 3SFKA 5I3KA 1OFOA 4CNNA 2NX1A 4DBDA 3TXVA 1XBYA 4ZQCA 3NYZA 1FWTA 1X6UA 3PBVA 1WYIA 1PL9A 1VYPX 3L68A 4MLJA 4IMFA 2WNNA 5TBOA 1GT8A 3OVQA 2ZZ7A 4O19A 2NUYA 5BMXA 5DXYA 1HO4A 3CM4A 4M7SA 4CNPA 3TW7A 4RX0A 3K30A 1W0MA 4OV9A 3O6YX 4LVFA 2QUVA 5FEWA 4EOUA 2FPTA 1OF8A 4FF7A 2ALDA 3PB2A 4A3UA 1H7NA 2CZEA 2NXIA 3RU6A 3EB2A 1TTQA 5FEXA 1CX9A 1G6CA 3B0UX 3IIOA 3S1WA 3GB6A 4IGHA 2YR1A 3T55A 5AHMA 1GVRA 2VC6A 1SO5A 1PCWA 3HGJA 3MJYA 3C56A 3GDMA 1G4EA 2RDUA 1NSJA 4S2BA 1ZCOA 1LLZA 1K7XA 2J6XA 1AW5A 4GBUA 2GJNA 4J9JA 1FWRA 2H6RA 2ZTJA 3W1TA 2JGQA 3A9IA 1S5TA 5HWNA 5LKYA 1S5VA 5BW6A 3NOEA 1ICSA 5D03A 3G1AA 2WKJA 5CZTA 4PODA 3EWXA 3LXCA 4H6KA 4TU1A 1ZAHA 3U8GA 3W1UA 1AL8A 4L4LA 1CI1A 4KFOA 1U5JA 4X2RA 3LI0A 3OVPA 1DV7A 3B8DA 1H1ZA 1F5ZA 4K39A 2ZYFA 1L6WA 4PTNA 4JY8A 3TU9A 2FQIA 3EX6A 3D0CA 1TPC1 3LHWA 5D2TA 5HUPA 4QNWA 4CCEA 3ZWTA 1KTNA 1QPRA 3F4WA 1KFJA 1YPIA 4IMDA 3W9ZA 3HPZA 1FXPA 4LVAA 1GTHA 3GK0A 2YSWA 1Z42A 5FF2A 1YTKA 1X7FA 5F1UA 3W75A 3NQMA 2A5HA 1TPB1 2A85A 1IXPA 1Q6QA 2VOMA 2QCFA 1EUAA 1KTBA 3BG5A 2X16A 3NDOA 4Y90A 5K7JA 3DFPA 2F7FA 4LV4A 1LYXA 4HNTA 2QF7A 3GR8A 4LS2A 1JUEA 1E51A 3GR7A 2VEIA 5DBUA 2Q8ZA 4P61A 5G4EA 1KBIA 3IIPA 3G0UA 3UY8A 2G5WA 2VFDA
chains in the Genus database with same CATH superfamily
2G3MA 4O28A 4DBEA 4JIEA 3DFHA 3KRSA 3V0SA 1EO5A 3W53A 1IZJA 2YOCA 5EPDA 5HJYA 1FWAC 3TC3A 4YTQA 3OZMA 1I2RA 4LCSA 1WUFA 1DWHM 5C7VA 3GSMA 2WWCA 5F4SA 5I7GA 1XJBA 4XBSA 3TQVA 3S5YA 3U7BA 5DN1A 1O5RA 3DYPA 3PBWA 3LXAA 3ANVA 1NDWA 4MG4A 5TIMA 4V15A 1AD4A 4GUGA 2FGLA 3P0XA 3HU7A 4J5NA 4WXYA 1YNYA 3PS7A 1VPQA 1FWGC 4KCWA 2Z27A 3H26A 1H7PA 1MNSA 3G18A 4Q8VA 3MUY1 4GQQA 4OECA 4XD5A 1ZBCA 1LL7A 1Q4WA 1GG1A 1TRDA 2A4AA 3GTIA 4Q7NA 3I6TA 1IEVA 3BH4A 4LUJA 1U1HA 1MZRA 1CXKA 3TR2A 2PGEA 5EMMA 5CPOA 4KCTA 4H01A 3DHFA 4PTVA 4UTKA 2BS9A 2Y85A 4HNLA 3H54A 1YXYA 4UTTC 3TTOA 1VEPA 2ATSA 4DAFA 1UZ4A 3GXFA 5CG7A 3TN4A 2FHBA 2FZDA 1HGWA 1VP5A 3PUGA 4FZIA 4UMAA 5CZSA 4IL0A 2R1MA 1GVQA 1UQZA 4YTSA 1N7KA 3N17A 4KKXA 3EMZA 3ZO9A 4MKSA 2GK1A 3HPXA 3K8KA 3W7LA 3ONBA 2XVGA 1Z6KA 4S38A 4TR9A 3SCWA 3W7NA 1DWFM 2GPTA 1FWJC 5D38A 3QEZA 2EPKX 4CN4A 2CW6A 1A4LA 3OP2A 3T2OA 1EF3A 3EXRA 3AMKA 3PZOA 5IM51 4QDPA 1EQCA 3QY8A 1K7EA 2INZA 4CVWA 4XD6A 3ITYA 1G7VA 1TWWA 2JF6A 3MCOA 2BOGX 6CGTA 2O0TA 3CZEA 4YTTA 3T2PA 4Q7BA 3PAJA 3A22A 1JFXA 3M41A 2OWXA 5JU6A 2AGTA 3LYEA 1QOPA 3W2KA 1BYBA 3SEPA 1M01A 1JQVA 1J0YA 5JBFA 4NI3A 4H7ZA 3JU2A 3S1VA 4YHEA 1JVNA 1JI2A 1LT7A 4GYFA 5F1VA 4E8GA 2GSHA 3WQVA 1VR6A 1M7JA 3UT0A 1RCXB 1MRAA 1AUSL 3D6NA 4Y9OA 3HG3A 1W1B1 2GZXA 3WIJA 2QVHA 3B4YA 2EG8A 1VCGA 1BHGA 1E9LA 1O66A 1KRAC 1OYBA 3E1F1 4MYXA 4Q33A 1ZP4A 4BEUA 4PMDA 4HNNA 4AWSA 5HWMA 1K8ZA 2ZZ5A 3BWWA 2V3GA 2YCJA 1VIZA 2O7QA 5CXPA 4XD4A 1OCNA 4DUWA 2GVYA 4Z1DA 2Y8VA 2J79A 3N2OA 4NP7A 3VFLA 2ZUUA 1D2KA 3CJPA 1SW0A 5DCDA 3NDZA 1M9HA 1LWIA 4L1WA 1E6XM 2ZZ4A 4LUIA 2GDVA 1KO0A 3RJYA 2C14A 4S1FA 2C18A 1VEMA 3POHA 4ZO6A 3BSGA 2V8ZA 3H2FA 2Z7KA 3WZ0E 3IJ9A 2JKPA 1WDQA 3KLKA 3GVVA 1C9WA 3LTSA 1S2TA 3SN1A 2C19A 2IPFA 4RW5A 3MMTA 3LCHA 1E1CA 1EFZA 2Y8UA 4V27A 4CCDA 4UFHA 5DANA 3IS4A 3EDDA 4QITA 3QLLA 4NZ3A 1BSIA 2ZZ3A 6REQA 4DNMA 3EOUA 1G7UA 3UCDA 2OEJA 4M0XA 3UWQA 3FGCA 2E4TA 3IACA 4MY1A 1XUZA 4CD5A 2ZZ2A 3K4WA 3PPHA 2WNWA 3PTMA 1IZCA 3QPEA 4C1NA 4AYGA 3GYCA 4PCSA 1IR1A 1ITUA 2YL6A 1SO6A 4BQ2A 1LWHA 4ACZB 3W7JA 5HNTA 2NT1A 4NVTA 3UETA 1E0XA 1EGZA 3HZ3A 6PTDA 4O57A 4LW7A 4TTUA 4WY0F 1QI3A 1TVNA 4D6FA 1KQZA 3N15A 1XBVA 3WH5A 1H7WA 1GONA 1XPGA 2PBGA 4UTJA 5D2YA 4GNKB 1HJQA 3LCWA 1XH0A 1TMQA 4DJEC 5AC6A 1YMYA 2XINA 2INFA 3MC5A 4G7FA 2DDXA 3AMDA 1XIJA 3WMLA 3T4CA 1RCOB 1W8GA 2OODA 3H4WA 4DPQA 1J01A 1XLGA 4AH7A 4O1DA 3RK8A 2OG9A 3KW3A 4PCFA 1OFEA 3CTLA 3V5FA 2HBVA 2HE5A 1BQCA 3W87A 3KCOA 2J77A 4UFMA 1TREA 4HSOA 3CIXA 4XAZA 1D8WA 2Q71A 2YPIA 4I9TA 4HPXA 5CCZA 5HR6A 4UMCA 1TPUA 1JYVA 4AG0A 4LJ3A 3VGBA 4PB5A 4L6DA 5AZ1A 2CLFA 2BXZA 4QCEA 3EOOA 3UWZA 4IJCA 1NU5A 1UD6A 3QQ0A 1J9YA 3S5NA 1LBLA 2NUXA 4L6HA 2C15A 2QULA 2ZUVA 2BVWA 5E70A 3VNYA 7XIMA 2MNRA 3G8RA 4FS9A 2E1WA 2WANA 1BYCA 3KRUA 1GK8A 4ATDA 2QCLA 1SO4A 1JGIA 3DG6A 4PSPA 1TIWA 3MP3A 1G0CA 2GJXB 2ODOA 3EWWA 3SQLA 4D6JA 1V6VA 1W9DM 4UZUA 4AZ7A 4LF2A 3GFXA 3OHIA 1KGXA 4WQ6A 4YVXA 1JZ8A 3REQB 4P8WA 1ITXA 1HTIA 2EO7A 3M07A 3UWUA 4AVNA 3G1DA 1H62A 5BRBA 4AUBA 1M04A 1AFSA 1KRBC 1RJQA 4JHMA 3G1FA 4JN8A 4F0KA 4LGXA 3I7RA 3MA8A 2AAMA 3GNPA 2QR6A 8XIMA 1EPXA 1GVFA 1J0ZA 3QYSA 4JQ3A 1SM9A 4BZYA 3MBDA 4DX3A 5DEZA 5EMUA 4WSJA 4JTGA 5T9CE 3M0JA 1V6UA 1CW2A 3UFYA 2IQTA 1EO7A 3COTA 3AJ7A 2ZWZA 2W92A 4HNUA 4MY8A 3R12A 1TE1A 2QEZA 4LEFA 1CT5A 4WIWA 5CGTA 1P1XA 4C65A 4D71A 2QCEA 3E9AA 5JUVA 7TAAA 1GOKA 3INPA 2PCQA 4XAYA 2TYSA 5DXXA 5JVLA 1SZNA 5LZLA 4MJMA 5XINA 3W2MA 4GUHA 4TX6A 4IHCA 1SFLA 1QHPA 3R7MA 2NWRA 2BOEX 4YNGA 1QI4A 3EWDA 2C6QA 3U4FA 5FKYA 5DCBA 4KGJA 3NL5A 1OFPA 1QPKA 2HK1A 5EL1A 3LX9A 3GIYA 4S3BA 4ATLA 3L7RA 4C6JA 3SY5A 3OQ8A 1EJXC 1DXEA 1XIEA 3VK5A 1E0WA 5A3HA 4QSHA 4W88A 5AN7A 4FB7A 1K7FA 3LHZA 4D6GA 2RHGA 1H4PA 1KXTA 3CHDA 3LZ3A 4B5UA 2A7RA 3B8WA 3GHSA 4J3TA 1TG7A 3T9PA 5CKSA 3NL6A 4FX6M 1PTGA 1V4YA 2ASHA 3CMGA 4M6UA 1JCXA 1TE6A 3UG8A 3ABXA 2OMAA 2FGZA 2VZSA 3NTYA 1G01A 1WZKA 4EIVA 1Y65A 1OADA 4MOZA 3AAMA 1O94A 5LIWX 2F84A 3AIUA 1LRQA 1IHIA 4PTWA 4FMVA 2EKGA 4U5KA 4B90A 3RCMA 2E3ZA 3NQGA 3O06A 3UA3A 3MY9A 1W1IE 3N2MA 3EX1A 4OV4A 3F5LA 4UTTA 3APTA 3O0FA 4KQNA 1TCDA 1WBHA 4C7FA 1N8WA 2VEGA 5ABFB 1T0OA 4JPGA 4YXGA 3LEPA 3QSRA 3W7GA 3G22A 2YJQA 4DM1A 1H1NA 3NEHA 3ES8A 1UOZA 4QQ3A 3CB3A 1TPFA 3RX2A 1NEYA 4K2SA 2PWEA 1H7OA 4OJYA 3OTRA 2DIJA 2QDEA 3DU0A 1QI2A 1FDJA 5HULA 3ZS4A 3WQFA 3GH5A 3ABRA 2PRLA 1FXQA 4TX8A 4V1YA 3PM6A 3H2EA 4LBSA 5ABEA 1DJGA 4WOQA 3WLLA 4M1BA 2TPSA 2QAPA 1CGWA 1W54A 2DY3A 4LC8A 1MW0A 4CD7A 4LNYA 4NZ5A 3HG2A 3Q67A 5E93A 1O6IA 2VO5A 3N2XA 1DKWA 2XFRA 3H21A 1AA1B 3ECQA 4A8NA 3NQCA 3FXYA 3QMSA 1M7PA 1VKFA 5BCAA 1YNQA 3A6OA 4O8RA 1RVKA 1V8EA 3GU2A 3EKLA 1WBJA 1YE6A 4C7GA 2HXUA 4O15A 1CENA 2WC7A 1MO0A 1BPLB 1SQ7A 3PPGA 3D47A 3W02A 3PBGA 1QW8A 3PJUA 4B3ZA 4O10A 1NFBA 4QSFA 4S3JA 2G96A 1UBPC 1P6BA 1SFTA 3VD3A 2R8WA 3HQPA 3W1AA 4U3CA 4AQLA 1LQAA 3N2TA 3UY7A 3USBA 3OLIA 2XH2A 2C1HA 3PUOA 3FEQA 1Y8BA 3MSYA 4N0RA 1VHNA 1XLEA 1YHTA 3K5XA 5FAJA 1BWVA 4HZ7A 1P4CA 4WX2A 4A35A 2Y1HA 4LVGA 1AD1A 1J11A 4JKMA 3A64A 1X1OA 2P50A 4ZVJA 1O5XA 4L4MA 2C71A 3H7UA 4ZO7A 5I3FA 1VHCA 1ZSXA 4F79A 5JXQA 1DWAM 3QOMA 4QLLA 1E55A 5CPNA 4DELA 1RPXA 4CQCA 3A23A 4AW7A 4W84A 1QMLA 4QG6A 1IZKA 1F3TA 4WGHA 3A47A 2NSXA 3WLQA 1WP6A 4MY9A 1HKKA 3AIQA 1RA5A 4EXAA 4Z2IA 4LQ1A 5BYWA 1EPVA 1AVAA 4UIOA 4PMZA 1QFEA 1O5QA 2OWWA 5BOOA 2EPHA 1PKYA 3G1HA 1JL8A 3CNYA 2WSYA 3GFZA 3AFBA 4F9DA 2ZXAA 4HPJA 3FYOA 2GJPA 3UZJA 2PGFA 3UG4A 3B9NA 2L5HA 5LNUA 1RP8A 4LRTA 4TTGA 1EA9C 5G2IA 1P7TB 1A5NC 2Z7GA 2ZRYA 5IFPA 4E3VA 2FVLA 1YKWA 2VWTA 4EK7A 2FHCA 1JR1A 5AHNA 4ZEPA 1EGMA 2PDNA 3EWUA 1O68A 4XV0A 3N19B 4HK6A 3UGRA 4C6EA 3F4DA 3GWQA 2BX7A 5DELA 1ZJAA 4PFHA 5B7YA 1ZLPA 3SGGA 1IT0A 1CB2A 3KHJA 4K37A 1ZALA 4X9SA 3TJXA 5ECUA 1KWKA 2H8ZA 1G4TA 1HIZA 1JF6A 4ZQPA 3RO8A 3TZFA 4MVAA 3IPWA 2ZUNA 1K03A 2XFFA 5KITA 1FH7A 1JRCA 3SRHA 3TFXA 4C90A 4H41A 4XSMA 4Z1CA 3P8IA 4PUNA 3WLOA 1T8QA 1R0MA 4OKDA 4BQ5A 3ZT6A 4C6DA 2BASA 1CNVA 2WB5A 1HG3A 3GTNA 5HPOA 4RPPA 4PB4A 1UH4A 3SUSA 5HMFA 3FSTA 5CPTA 2D22A 1I60A 4H1ZA 1CLXA 3BQ5A 3VC6A 1ODZA 1NOUA 2EPMX 1FWEC 3DH7A 4JL2A 4DJDA 5XIMA 2QXWA 4DWSD 3BARA 5I78A 3KOFA 3BCFA 4WR3A 1TV8A 3NO5A 4JIQA 3VKBA 4DM2A 4NU7A 2B7PA 3FHAA 2VEPA 3LSBA 3CMJA 3MWAA 4AX7A 2X09A 3GUWA 1H7RA 3S2NA 5M2FX 2J25A 3WDJA 3TONA 2D2JA 1R30A 4UNIA 3BGAA 3HPAA 5LYRA 2EBNA 4FR1A 3LQGA 3CIVA 3W24A 1GYMA 3CLMA 4JIIX 5AFDA 1KWGA 1PVNA 1EZWA 4OBRA 3I3EA 4GJIA 3IUHA 4HB7A 4IX0A 4QDMA 4DPPA 5D32A 3UU0A 1C92A 2YGYA 1PYMA 4PA8A 4PUKA 2YX0A 3SI9A 4NRSA 1XLKA 1CZ1A 4JTJA 2FVKA 1K4GA 4ZTXA 5KZMA 4A8RA 2JFEX 1J5TA 2OJPA 1F8MA 3MDWA 3UR7A 3PY2A 2BY2A 3L5LA 4X22A 4NZJA 1UZHA 2YCLA 2IKGA 5K4XA 3U6WA 2VCCA 3EOLA 1BSLA 4CQAA 4QRNA 4NNCA 4DJDC 2I5IA 4PBGA 4Q6XA 5D9MA 1UWAA 3T05A 4UTWA 5CQ1A 3N04A 1EHAA 4IIBA 4UOJA 1W5OA 4UCGA 4JCLA 1NOWA 1TYGA 3AXXA 3C2VA 4US5D 5G1MA 2E5CA 2IQ0A 3W84A 1XLJA 4HA4A 1XWYA 2X7WA 1TJ1A 4BWLC 3RMJA 1WKEA 1WV2A 2O4MA 3GXDA 1WUEA 1WOAA 1RLDA 3I3BA 1WB0A 1WQ5A 2E6AA 2I17A 3TCEA 1B1YA 3EDFA 2UBPC 2RJGA 3NPUA 3LRMA 1LORA 2PRMA 5CC5A 3QTPA 4O18A 2BOFX 3EXSA 2OZ0A 3JUGA 2P0IA 2VX4A 1O4UA 4JTRA 2WSPA 4DLMA 3RPTA 4KWSA 3C0LA 4B4HA 5A6JA 4XIAA 4IP7A 4ZL1A 4RL3A 1KM1A 4GFIA 1R5YA 3B0PA 5TF0A 3LCFA 3R43A 4MZ1A 4RXFA 4K1GA 4UBPC 5J5RA 2P8CA 2ZA1A 4FOKA 4MJZA 1OFRA 2PU1A 4GKTA 1ECEA 3CQJA 1AW1A 1XLAA 1QTWA 4M8UA 1OFDA 1X6NA 3A21A 4W8AA 3T44A 4UOQA 2V5LA 2CERA 4IIGA 1O5KA 4GACA 5BXPA 4HA0A 2OYKA 3EX3A 3H55A 1GWJA 3AYVA 4N2YA 3RPDA 3SN4A 2Z25A 3W7RA 1D7FA 4MWAE 2NX9A 3PB0A 4GYPA 2AL1A 4UTIA 3TOYA 4O16A 4KWWA 2IXUA 1TV4A 2Y6ZA 4GO8A 1TVLA 2GWGA 1OT2A 1EOKA 1E4IA 3UXIA 1W5MA 2GJLA 1E40A 4ERIA 4GGHA 1AH4A 1BQGA 2TRSA 2X7VA 1UJPA 3TNBA 1IEWA 1VFLA 4RXGA 4C6IA 1E4MM 1SJDA 2VVNA 3S9IA 2VCAA 3QXBA 1FFQA 4HYVA 4JN7A 2G3FA 3P60A 4YVPA 1ZPTA 4DF2A 1SR0A 3VKJA 1YPFA 3C86A 3B05A 1R47A 2WHMA 1C91A 3WBAA 3O07A 3R11A 2ZVIA 1QHOA 3SCTA 4PMQA 3NVTA 4GNJA 4JHZA 3R94A 3JZEA 4GIYA 3WFAA 1NP0A 3C61A 4E0CA 1KR1A 4DIAA 4HJWA 1OZMA 1KBJA 2HS8A 4J3ZA 4PTMA 1ISYA 1J4EA 2ZWYA 5CH9A 1OD0A 2WAGA 2Y8KA 4HU4A 2BMBA 2J8TA 4QDWA 5C9ZA 5C8BB 1YNPA 4NASA 3MYOA 4PUJA 3TTSA 3NQVA 3P84A 1RV8A 4LAZA 4ZFCA 2P10A 3L5AA 1RR2A 2Z6JA 3WD3A 2OWCA 3GH7A 3S6OA 1S2AA 4Z08A 2JBMA 3LDVA 2ACQA 3UXAA 3VA8A 1K9FA 1O1ZA 2PZNA 3BAXA 5BWFA 2WQDA 1FWNA 1VFTA 3KL3A 4B91A 5AHEA 1KFCA 1S5NA 1PIIA 1VLWA 2X2YA 9XIAA 1KM2A 3IRSA 1G69A 3IJ7A 1W5PA 3SCRA 3WQPA 2A6LA 1W9XA 2NLYA 3II1A 4C6CA 1C29A 4PCNA 4JKKA 3PFMA 4NHVA 4GXMA 3H2CA 5SWUA 3BG3A 3BPWA 1I9CB 1QXLA 5HMSA 4JFVA 2CBIA 2FHFA 3WLJA 1EJVC 1Q63A 2HV5A 4IM4A 3BW2A 2PSNA 4V2XA 1XSKA 2X42A 2FYMA 1L2UA 3WYZA 1H61A 4GQBA 2BVYA 3AJXA 3P3BA 4AB4A 1XLFA 4NX0A 5FCZA 2EG7A 4YL2A 4IISA 3QH2A 4QAIA 1H50A 4IP4A 4R7OA 3M5VA 3KL5A 1UR3M 2I14A 1B4KA 1KM3A 1V6WA 3A5FA 5AHIA 3IK2A 4RW3A 1S2UA 3VGGA 3JW7A 2Z1BA 3PZIA 2REQB 2A3AA 3GXTA 4HP5A 4AMCA 3KEHA 2PFHA 1Q3NA 1V0NA 3O9NA 2I9EA 3OBAA 2BGNE 3BLOA 1WX0A 1HN1A 2PLMA 3W7MA 3GLCA 1TMLA 3SB0A 1ISWA 1WDPA 4R33A 3H12A 3G6MA 3KVMA 3GTHA 3W00A 2QPSA 1E6RA 3CUZA 3I4EA 2OCZA 2VQTA 4UB9A 4LCQA 1LBMA 2GDQA 3LXBA 2PWHA 1Q45A 3I65A 1W91A 1MI3A 4DJED 2X05A 4F3HA 1OYCA 1PZ3A 2ZCGA 2G3NA 1QNSA 2PTYA 4U33A 1K1DA 1W5NA 4NL1A 1IIHA 5JH2A 1Q6LA 5HMDA 3T8LA 4IIHA 3F1QA 3M46A 3GW0A 4LYPA 4JTKA 3E49A 4ORIA 3TYUA 5I3HA 3U48A 4FLRA 1JUBA 2H90A 4Q4QA 4D9PA 2EGZA 6A3HA 2D24A 4XZWA 4Q8TA 4XBJA 3N25A 3N2BA 1H7XA 3CU2A 4UR7A 2XN0A 3V1HA 1YBQB 3IRDA 4I6KA 1RA0A 2YBUA 1NM9A 3GDBA 4D72A 5G1YA 2WLYA 1T41A 1JDAA 4HBKA 3H24A 1ELSA 3UZZA 2BWGA 1DJYA 3KBNA 2CITA 2BZNA 4ZE5A 1N8FA 2CZFA 3T6CA 3UG3A 2AL2A 4GWEA 5LNVA 2BV9A 4FXFA 2EHHA 4G7EA 4IQJA 3M0HA 5ECVA 4DO4A 2TODA 1YPXA 1X8FA 1RK5A 1X96A 3A3WA 3PVFA 3SFKA 2NX1A 4DBDA 1K4HA 5A2AA 1RJPA 1TVPA 2WBKA 3MVTA 4IMFA 2WNNA 2R24A 1GT8A 3U5YA 3OVQA 4D1JA 1JZ4A 2ZZ7A 3R0KA 2DZAA 3T0AA 4QEHA 1G1YA 1JYXA 1BGGA 3TW7A 4EAMA 4FOJA 5FEWA 1OF8A 3CMFA 2XVLA 4ZENA 3EB2A 3MWCA 4MWAD 1JF5A 1XLDA 3KCLA 3AZRA 3QV6A 1SO5A 4AD2A 3MJYA 4AZIA 4HA3A 2KX9A 3GDMA 3DHUA 4W86A 4H00A 1NSJA 1PAMA 2P5NA 4J35A 4J9JA 5A6BD 3CV7A 2JGQA 4EANA 5BW6A 2ZC1A 4PMRA 1DTUA 3BOFA 5CZTA 1HJXA 1XSJA 3B8VA 3EWXA 3GM8A 4HHLA 2Q8XA 2CBVA 2QT3A 3ZM8A 4CVUA 2GDUA 4X2RA 2VOTA 3OVPA 4K39A 2ZYFA 1E72M 3S4TA 4ZBCA 4HTBA 4CD8A 4Y9MA 3EX6A 1W9PA 2Z28A 2PB1A 3LHWA 1PB0A 1N2VA 2NVAA 4CCEA 3RMEA 1JDCA 4HU3A 5LA1A 4WSKA 4Q4PA 3BSHA 3ARZA 3HPZA 1NJJA 4LVAA 1OD8A 2YSWA 4M80A 4FF5A 2JQXA 2A5HA 2E67A 3MMWA 3AU2A 2QCFA 1B9ZA 1KTBA 2AQVA 4MWAB 1RUSA 3VNZA 3CWHA 3DIPA 1LYXA 2QF7A 3GR8A 3WMBA 1J0HA 1E51A 3GR7A 4DWSB 2QV4A 3MSRA 3G0UA 4FA3A 2VFDA 2DUAA 3BICA 2FH8A 2C91A 2QIIA 1XIGA 1W1TA 3KOZA 2J75A 2VT0A 4YJ5A 3TKFA 3UZ5A 4DHGA 3OOQA 3BMWA 3XISA 1GKPA 1QNVA 3NR0A 4LT9A 3UXLA 3Q94A 1EA0A 3BURA 2GL5A 4JCMA 4PRTA 1EP2A 1VFMA 3TN3A 3GAKA 3F2CA 2HNEA 3QC0A 4KEMA 1V3IA 3ZIZA 6ENLA 1Q6GA 1OFAA 4IG2A 3T0DA 3FGCB 6ALDA 1I6NA 2DSKA 1LBFA 3CZLA 5CSRA 2WW5A 5C9WA 1W17A 4BK9A 5E6ZA 4W8BA 4FP1A 4IWWA 5T9BG 4HU0A 2ZDRA 1DTNA 4BF5A 3R10A 1FWIC 2XH7A 1G5AA 3C5QA 4MAZA 1TPVA 4F0LA 2R91A 4ZB0A 2PURA 3DFYA 3KL0A 1Z3NA 2J7HA 4PZVA 1EJUC 3M7SA 1NFPA 3LHVA 1OF6A 3G77A 3W2NA 1BTMA 4R7WA 5A6TC 1TR9A 1IF2A 3P7YA 3UF9A 4DWDA 4Y96A 3CL8A 3TQPA 4JTQA 4XWUA 4BS0A 3PJWA 1J5SA 1XDLA 3O8AA 4HIBA 4IMAA 5I09A 3IVTA 4IUOA 2B7OA 4I3GA 4X3ZA 1JZ2A 3UPWA 3ZT5A 1OC7A 3OO2A 5JMUA 4F66A 1RBAA 3M0MA 2PF8A 2G97A 3ZR5A 1EBHA 4AF0B 2WHKA 3FA3A 3GFYA 3ONCA 2HPIA 4GH1A 1FVPA 4IPPA 5IBXC 3VIOA 3W28A 2Y61A 2XN2A 1W9BM 5MHBA 1DQXA 1UKPA 3N9KA 1JNDA 4R5EA 3WLHA 3P67A 2VFFA 2OVLA 5T91A 1XXXA 2Q01A 4LAKA 3WG6A 4HOZA 3OA5A 4XAPA 2E6DA 1QVBA 1Q85A 1UC4A 4N42A 1T6MA 1M3UA 3KVLA 2VJXA 1UBSA 4AEFA 1ME7A 2V82A 3VKDA 4G8TA 4YWIA 3FA5A 3LGEA 4FHAA 4QBXA 4MNKA 1HJSA 1W56A 5G4WA 1Z48A 1Q4NX 2PWUA 4J3VA 4AAJA 3PANA 4OTKA 3WBEA 3LHTA 4I7VA 2E0PA 3L2MA 1UR0A 2J9YA 3T81A 4CU8A 4I7WA 4NUWA 2CLMA 3WK3A 4G9PA 2VRKA 1TWSA 3G3DA 2GVEA 3ME3A 1OGBA 2O56A 2Y63A 3LMZA 2QJMA 3RGTA 1W8SA 4GRSA 3AHXA 3W1MA 3ELFA 5E0FA 5BMWA 4G1NA 5BRQA 1RPKA 1Q6DA 5FJIA 1ZB5A 2E6YA 1GOQA 1V02E 3W25A 2E7FA 3D3AA 2OXNA 1QPNA 2CHOA 1GKQA 2VTFA 2PDLA 2IS7A 2WOQA 2NV9A 5G2HA 1L9WA 4MWAC 2VURA 1M6JA 6XIAA 1DPMA 4M81A 5CAKA 2ZRZA 3TJLA 5I3JA 1VQTA 3MKCA 3ZT7A 1YDNA 2DFAA 3DKLA 4LAMA 4R27A 3WFZA 2XIQA 4XZLX 1F73A 2UY3A 3NQDA 3EB3A 4WZHA 1R46A 2POTA 4BI7A 4ML4A 3QGAC 5AVHA 2PDWA 3E12A 5LGXA 2BVTA 3OLGA 2VGFA 5I5RA 3LD5A 3O63A 1XLLA 3R0UA 4OU1A 4H2CA 3HGSA 3G24A 1VIWA 4WJ8A 1M68A 2QW5A 5K4ZA 3N18A 5LXEA 1WO2A 2J6VA 1VGAA 1ML1A 2Z6IA 1IXOA 3CO8A 4ERAA 4XK2A 1Y7VA 4HT3A 3VPLA 4UFLA 3S1UA 2OQYA 5TQLA 3N73A 2DUXA 4EVZA 1FWDC 1Z44A 1Q6FA 4DF1A 4A8LA 1W1VA 5F4XA 1KKRA 1V79A 8A3HA 4ZQRA 2OZ3A 1UR8A 5C0QA 3NIYA 3G0SA 2DPEA 4ONVA 5EMJA 3R4IA 4HU8A 2W62A 5A6KA 1NWSA 2C16A 3TLQA 4G7EB 3B04A 4HVXA 3IVUA 4EPBC 2BSLA 4F40A 1A50A 3AS2A 4J7RA 1YDOA 1JCMP 1ALDA 3TYAA 3AIVA 4YN5A 1J6PA 3HBLA 4DNHA 2PGRA 1LT8A 5JBEA 1EIXA 1OCBA 2VX5A 4PL2A 2Q6ZA 3O2LA 3T08A 3OQEA 5CAHA 3TYZA 3CAKA 5LIYX 3RCYA 2YXGA 3WD1A 3HF3A 1HW6A 3ITXA 1HQTA 4UQEA 3ATYA 4C1KA 1OFBA 4OUEA 1T40A 2HDJA 3B8IA 1BVWA 1W3NA 1UUMA 5GQBA 1GYLA 3OGSA 1V08A 3GNXA 3WDPP 1QOQA 4P7NA 2VENA 3B9EA 1IGSA 3UVAA 3N3MA 4GINA 3RXZA 4LAOA 3VMOA 4JOMA 5D8ZA 3KOWA 1V3JA 3LN3A 3BAWA 4AZCA 3NQBA 4DO7A 3H8AA 4NZCA 3UJ2A 3SRFA 5EGRA 1SW3A 3LLFA 2X30A 4MDOA 1F3WA 1CLVA 2CBJA 3LCGA 3PZMA 5KSWA 2Y0FA 2DVUA 2WCAA 4QM1A 1BWLA 1W9UA 1XFBA 5EB8A 3ARTA 1JQXA 4CD6A 1VS1A 1WKFA 3N9SA 3CS2A 4JN6A 3LPPA 3WK0A 1EJSC 2VMFA 3UEQA 3KLLA 3ZZ1A 3EDKA 2OKTA 5K9DA 3WH7A 1KXQA 3VVGA 2WZIA 2OQHA 3D5HA 5CZKA 4REQA 5AC5A 1QU4A 4AC7C 3LK6A 1PTDA 1CLKA 3VI2A 4PSRA 1J0IA 4KPLA 3STFA 2NQ9A 4HHPA 4FSAA 3IJ8A 2E40A 4CEXC 1L8PA 3GTFA 4F2TA 3TOPA 4RNHA 2G95A 4H04A 4JQ2A 3ITOA 4LS0A 4RDZA 3WN6A 3R79A 1QPQA 1IEIA 4HSNA 4JHOA 2CXEA 4GVHA 2ABAA 5HBFA 4FNTA 2PDXA 4FX7A 3N1AA 3SGZA 1TX0A 1HFBA 2QGYA 4GYPC 3WCZA 2HISA 3LU2A 2WC4A 4JX4A 4X60A 2ZXDA 4BF9A 1QO2A 3AXHA 5MKGB 2NV1A 3PULA 3K4AA 1L6SA 1W3JA 3N12A 4N4QA 3UXDA 1VJSA 3NQEA 4Z17A 2VZTA 1U33A 3S2CA 1YX1A 4JICA 1GGOA 2E8ZA 2FB3A 3WLSA 4ADSA 1CBGA 2HZGA 4LPCA 3LCLA 3DKJA 3EOSA 1PSCA 1BYAA 3UR5A 1R3SA 2O9OA 3GVGA 2G8ZA 3H4GA 4NSBA 4FK9A 4GVIA 3F5JA 2J7EA 1NWRA 2Y24A 5A5WA 3UWVA 3L4UA 3W23A 1MQQA 4MUZA 5U7SA 5CJNA 1EC8A 4WGXA 3NFUA 1NDZA 3TZNA 1V5XA 2D2OA 4RPQA 3UPMA 1NARA 4C5ZA 2E1DA 3TC6A 4Q8WA 1BXCA 2BP1A 3E0FA 2QGHA 4XB3A 4F0SA 1A3WA 5LHFA 5C9UA 2IKJA 5U4NA 3DN5A 3TVAA 3WY1A 1IT8A 4IX2A 2OSWA 3M5YA 1ME8A 1SZEA 3ITLA 3ITCA 2PF0A 3QW4B 4WEVX 1KFBA 1NTHA 1OABA 2F8QA 3G2GA 1B57A 4J40A 1E1FA 5H91A 3WK2A 1RD6A 3QPYA 1PIGA 1S5WA 3NJ3A 3AUOA 4JTAA 3HURA 2OLSA 4LYQA 2G3JA 2X40A 1PV8A 3W4RA 5A6SA 3GHRA 3EPNA 5A6MA 2GUYA 4UNKA 4FXRA 3BLEA 3GU1A 4CU7A 1FHLA 2ISWA 3FIGA 4LH8A 4IFKB 3WO8A 3PPCA 4TIMA 3KP0A 3URNA 4PC8A 4HSHA 4IMEA 1GEQA 1FP9A 2W27A 5FF4A 2R1LA 2V30A 4M82A 4D1IA 4ZZ9A 3QYQA 3RM4A 1GYNA 1YDYA 3RJXA 1ISZA 1AQFA 4W7WA 4AIEA 3VIIA 4CD4A 4S3EA 3WLRA 4AMAA 4GZEA 2WZTA 2DQXA 4ERGA 5BXRA 5BU6A 4ZTYA 4M6VA 3QMTA 3W0KA 2R94A 2OLAA 5HNUA 1H60A 5I00A 8CGTA 3VCNA 1KFWA 4W89A 1S2VA 3DECA 3PNZA 4L4PA 5CSUA 1RXOB 3WNOA 1GOXA 4OOUA 1EB3A 3W82A 4B5VA 3AHTA 5D2WA 4KGLA 2C7FA 1KBBA 4EP8C 3P62A 4LALA 1BKSA 2PDGA 3DGRA 2CEQA 1IWPA 4ATWA 3FXGA 4DAIA 2H9AA 3VABA 4DUOA 3QZEA 4M51A 3M0YA 2OZ8A 3KTXA 3KTSA 1AJ2A 3TJIA 4DWSC 3SCVA 4AEEA 4US6A 4NAFA 1B3XA 3VKKA 3NCOA 2A79A 2EF9A 3AZTA 4QHRA 4ZQMA 3WUEA 1XIMA 3V18A 4KRTA 5GNYA 3WLIA 1GZ1A 1BKHA 3DUGA 1BTCA 2ZRWA 1UWTA 3GH4A 3G1XA 2I57A 4LVDA 1XKYA 2XH0A 1HKVA 1E0TA 3CIWA 1SJAA 1DQUA 4JY9A 1EZ2A 4LNCA 2PWDA 3VGHA 4MYAA 1N82A 5G2WA 2AKMA 2PE4A 1AZ1A 4BR1A 3S0CA 3FN9A 3O16A 2ZC8A 1PYFA 4FIRA 5HWJA 1Q6CA 3DFOA 1PCKA 3N6JA 2NV2A 4O4WA 1UKTA 4HMDA 2Z26A 4O4VA 3ITVA 1GQJA 4UR9A 5CG0A 5KTLA 3VIGA 5HQEA 3MI6A 1RZMA 2EPOA 4Z2LA 4KEZA 2QCNA 4DN1A 3NYDA 2FLIA 3FJ6A 3TP4A 3CH9A 1AQHA 5FI8A 1VCVA 5F7UA 5FOOA 1XHGA 3LTYA 2WSKA 3O6AA 4URIA 2ANUA 1EYEA 1F3EA 4P7RA 2ZX7A 4BQ3A 4GBDA 1OINA 3FAWA 3WNPA 2RKXA 4QROA 3B97A 1KTCA 3EWCA 1XRVA 3LHUA 2CXGA 2C79A 3QKEA 3PBYA 5KEZA 2PI6A 1PIFA 4P7OA 3KFTA 2WM0A 1Q6EA 1JFHA 3N4AA 3OIHA 5A8GA 1TSIA 4FX8A 2X8RA 2YCIX 1A80A 4LUSA 2J62A 1UZDA 1TPH1 1R8LA 4O1AA 1YTEA 2J9XA 2WM1A 5B7ZA 5FF3A 3BW3A 4H9TA 3AOFA 1ZTVA 4P2VA 4AD0A 4A3HA 1D9EA 1X8CA 3ZXWA 4HNOA 1P6WA 4GIAA 4KH2A 1CIUA 1EC7A 4FIQA 4XZHA 4JNMA 3STGA 2VYOA 2PLCA 4Q8QA 1TJ2A 4H7CA 2Y7DA 3MCMA 2XSXA 1DWGM 1QRQA 1V0MA 4PMYA 1EX1A 4WCJA 1V6TA 3JS3A 2FVMA 3WK1A 5DMYA 1UR1A 1XRFA 4NNAA 2FH6A 4UXDA 4CGTA 3GW3A 4NX5A 2JIWA 2D2GA 3P81A 3OB8A 4BI5A 3ARRA 1TWDA 4MUPA 3LS9A 4GUFA 2WV8A 3TYCA 2F61A 1RQHA 1J8VA 4DF0A 4NNBA 2XM1A 5F4WA 1OX4A 1HKIA 3GNNA 1R9ZA 3T07A 1I8JA 2BHUA 4RE4A 2PDHA 1Q5MA 4DJFC 4XKMA 2VEMA 5F2IA 4QJ5B 1P0BA 2XH4A 1VRXA 2WHLA 4ENLA 3W3OA 3BMXA 1FX6A 3UPBA 1L6GA 4WDXA 4DXVA 2P3ZA 2DJXA 2R6OA 4GVFA 3S2MA 1JDEA 2FTWA 3PBMA 3W7PA 2E5BA 1KM5A 4H6QA 1H3GA 1JAKA 3VX1A 3K8MA 3QHOA 1FWWA 2NZLA 3TDFA 2G0WA 2D73A 4E8DA 4G1KA 3WNNA 4IIFA 3SO7A 2BB0A 3P93A 2ZTKA 3PTQA 3SN0A 2QAFA 2GQ9A 3NZRA 3QRHA 1UOKA 1SFSA 3QN3A 1B30A 4L5ZA 4IPLA 1U5HA 4CUCA 1A4MA 3IUIA 3NL2A 3E2QA 3V0TA 1KCXA 3SSZA 2FMNA 1TV7A 4RNFA 4K8EA 1J10A 2C1IA 2VFHA 1I75A 1TQXA 3FEMA 4S3AA 2BODX 3R8HA 4GKLA 1LLWA 1UD2A 1RJRA 3QGKC 1OG6A 2VELA 4Q6JA 4QISA 3SIMA 3ZJKA 4YWSA 2YZ5A 1UASA 4NXSA 2VD8A 4UTMA 3PF3A 3CHFA 4I6VA 4C91A 3CT2A 3URAA 4E2VA 1M03A 1EWEA 3AROA 2RJHA 4D8LA 2AOSA 4H9UA 4S39A 1QJWA 1EJ7L 2PPGA 4LBUA 1JPDX 3M0LA 1NDVA 4IMCA 2QZRA 1B90A 3KRZA 3R25A 5BWAA 5HDRA 4C6QA 1B3OA 1AZ2A 4X2PA 1DJHA 1SSGA 2W9MA 4Z42C 3TW9A 5D37A 1JD7A 3QSTA 1LG1A 4EKJA 2B81A 4CCZA 3JRKA 3KTCA 2YB1A 1Z7AA 2R14A 1LDCA 1S46A 1FKXA 3FVMA 4QJ1A 1D7KA 4H3DA 4PE8A 1VJIA 1EDGA 2QUNA 4LAUA 4DZAA 1L2QA 7A3HA 3T1GA 1GPWA 3TUUA 4PYSA 4W9TA 1K8YA 1EJWC 1PX3A 1T8XA 5M3WA 2P1FA 3M0ZA 5F2LA 5FJOA 1UQYA 5GJMA 4MF4A 5I3GA 4AHQA 2G4FA 4S3CA 3RNDA 1R7OA 3JVAA 4Q32A 1K8CA 2QMKA 4MLRA 4GZIA 3E5BA 2F6KA 1EP3A 1R3TA 4NAEB 2OGJA 2NQHA 4HN8A 1K02A 2C3ZA 3OA3A 1TQJA 2W0UA 2QCGA 1XP3A 4L80A 2ZICA 3VOJA 1XKJA 2EJAA 2FTPA 1I0DA 3B0XA 3CZGA 4AY7A 1XX1A 2D1ZA 2G4JA 1SPQA 4B16A 4B15A 3ARPA 1UH3A 4I7UA 4H8NA 3QM3A 3SJNA 3ZWSA 3Q4DA 1B4EA 3N34A 1B9BA 3VOGA 1EF2A 2HTMA 1P48A 1MDRA 2JE8A 3WDQA 3MV11 4LCRA 3W7OA 4XVDA 1WAUA 1ZGDA 4W87A 2XDFA 5AZ0A 3AC0A 4JKLA 7REQA 4P7QA 5HATA 1TZZA 3BVJA 1PX4A 1REQA 2BY0A 4ZCWA 3W71A 3P74A 3T42A 4AD1A 1J2BA 1QBBA 2Q09A 2PUZA 4M5PA 4AFYA 2E09A 2QCDA 3Q58A 5AC4A 1XL9A 1VC4A 1KFLA 4LYRA 5FJRA 3VTRA 4O1FA 2V9DA 4QGCA 1TA3B 4KETA 3DAQA 2Z00A 1HT6A 2J8FA 1ISVA 1V7AA 3CAQA 2XZ9A 4RNJA 2ACSA 2DT1A 3AISA 3L12A 5CGMA 1UYQA 1XM3A 2DGAA 1DIKA 2MUCA 1LRTA 2AGKA 1C3FA 3N6HA 1UA7A 4GABA 2QUTA 2QCHA 3IV3A 1S1PA 4GH3A 4KEUA 3UCCA 4PN2A 3FKKA 2C8NA 3URQA 4IPIA 7TIMA 4B92A 3O6DA 3SCQA 2YDSA 4RDVA 2HBXA 4HHMA 4K6AA 1F74A 3FX4A 5DO8A 3EPMA 3B0VC 1P1MA 1OQFA 3AHZA 4CCCA 1GTEA 4O13A 4MHBA 1BGAA 2QJNA 4BJHA 3NG3A 2R82A 5DBTA 3EWZA 4I9MA 1SZGA 1EDTA 3DYOA 1IYXA 1GEHA 1VF8A 1JZ3A 4HPGA 4CEUC 3VU2A 3UG5A 3A13A 1H2JA 2QKFA 5D04C 4UFIA 1V0LA 3KUMA 1UR2A 3W1QA 4X61A 2H3BA 5CJMA 1UP2A 4KRUA 4JTDA 2VDGA 1R85A 4Q7IA 3GDRA 1ZU8A 2ZFAA 2XN1A 2NXGA 4JYFA 4ES4A 1UIOA 3AXKA 2GVGA 3AYTA 4UMBA 4F0HA 5I2UA 3POCA 4H9VA 4RZ5A 4LF1A 4K3ZA 4V28A 1G4PA 1XYCA 3FS2A 2BDQA 3UD6A 1Z89A 1LL4A 3UNTA 1TRIA 2I5QA 4OUIA 3GTXA 3UCQA 3C0JA 4HZMA 1E9ZB 2OEKA 2OKOA 2Z1VA 2YIHA 1FBAA 1THFD 4LYKA 5I02A 3ABSA 1OZQA 3R13A 3S1XA 3VUSA 1VBRA 3OYXA 1TJRA 4EF9A 2QUUA 3W2UA 1POKA 4YHGA 5C9XA 4DO6A 3CZKA 3UR2A 4L9ZA 1ITQA 1F6YA 2P76A 2VEFA 1VBJA 4TXEA 4LXFA 3LLDA 2INEA 1ADOA 1GVOA 1OHLA 4JIHA 3L2IA 4TMCA 3MMUA 2DZPA 3G0XA 2YCEA 3S5OA 4F9JA 2WPGA 2YA1A 3P5ZA 1UZ1A 1CYGA 1KV8A 3C2YA 1HL9A 3BOLA 1Q6OA 4MIMA 3E96A 1YYAA 5FEZA 3AUJA 3CL6A 2GQ8A 5DY3A 4AWUA 3NPVA 3PZNA 3ATZA 2CKSA 3ZJ8A 2CLKA 4JTHA 4K38A 4GOAA 4YTRA 2VQUA 4D2JA 4CKQA 1LL6A 3FY1A 2V0TA 3IVSA 5A95A 2IMRA 2ZKMX 1GHRA 1GVEA 4A3QA 3V0UA 4L4OA 3GG0A 1TTPA 1DWJM 1XW8A 3SBFA 5E0CA 4N9BA 3BSMA 2LLEA 2FDSA 3GRIA 1B2YA 1JIBA 3RF9A 2V2HA 1XYLA 4JL1A 1G94A 1IT7A 3E74A 2BGQA 1LCOA 2ZZ6A 4UTLA 4GQRA 2DT3A 2VD9A 3MVIA 2CLIA 3LHYA 1JUKA 2J7GA 3G1RA 3C2RA 3CHCA 3LM7A 3ALFA 4JAWA 4FR6A 1KR0A 1RY0A 4LUTA 2WJFA 1H5YA 2EJ1A 3NA8A 4ZSUA 1XG4A 4UQBA 3T8QA 1Q7ZA 2FIQA 1L0PA 1ZY9A 3FLUA 2I16A 5CGQA 2QDDA 1EH9A 3NM3A 1GQIA 1WKDA 3VD7A 2GGIA 5REQB 4I8YA 4B3LA 1QCWA 4MNMA 3TA6A 4XIMA 2QJHA 2VDHA 1GJPA 3HJZA 3W38A 3AS0A 3TMQA 2FPYA 3EKGA 2ZUSA 5J8LA 4GPNA 5K9CA 3W1PA 2XG9A 1RLCL 4ZXLA 4YU1A 3E2SA 1XD0A 3SCOA 3VIHA 3AYSA 2WZHA 3RG6A 4WKFA 4TMBA 4YVVA 1KRMA 1PE1A 2OGYA 1B3YA 3WH6A 1ZCCA 1AJ0A 3HGRA 1BVNP 1SU5A 5E5CA 1LUCB 3HQOA 4AEOA 5I3KA 1JGMA 4ZQCA 2VGIA 3EGJA 3NYZA 1FWTA 1WYIA 1OGSA 2PDIA 4EXBA 1WE5A 1UH2A 2NUYA 1HO4A 1EXBA 3O3RA 3SCPA 4M7SA 4JTCA 4CNPA 1OEPA 4RX0A 5HXMA 1W0MA 1TR1A 4OV9A 4EOUA 5EFFA 4GQ0A 1C7SA 1ONWA 4FF7A 3PB2A 1S2CA 4A3UA 1QHZA 2CZEA 3RU6A 9RUBA 1TTQA 5IXEA 1G6CA 3CGTA 3IIOA 3GB6A 3T55A 2RGMA 3GIPA 5EMKA 3HGJA 5H8MA 2RDUA 2OO6A 1I0BA 2D0FA 4GBUA 1TCMA 5LKYA 1S5VA 4O1EA 3WDHA 3NOEA 4INFA 4HPHA 2WKJA 4PODA 2VC5A 3LPOA 3WENA 1VJZA 3W1UA 3VZXA 3WQ4A 4AU0A 5DRIA 8RUCA 4X0VA 2QS8A 1UPPA 2XUCA 1L6WA 5C71A 3TU9A 5CBIA 3IV8A 1TPC1 4GI6A 5D2TA 4PULA 1GW1A 1V0KA 4QNWA 3F4WA 4MB5A 1YPIA 4RV3A 3ZMRA 4IMDA 4AD5A 2C0HA 4PEEA 3GK0A 3RRXA 4CQBA 2EEXA 2QIWA 1XD1A 3W75A 4MDPA 1DJIA 4QG8A 1VENA 2VOMA 3BUVA 4PR4A 3BG5A 1SMDA 1BRLA 4KCVA 4YPJA 4HNTA 4ZB5A 1JUEA 2VEIA 5G4EA 3SUWA 1KBIA 3UY8A 2G5WA 4N7QA 3CLWA 2RH9A 3HPFA 4AD3A 5AYIA 2CLLA 1TPEA 3PSVA 1TPDA 5FJTA 2F6UA 1MSSA 1DQWA 4WY0B 5LGZA 1QO5A 1OX6A 3BCJA 1QBAA 1GVSA 1HP5A 1A5SA 4KRZA 3H2AA 1CGYA 1JXJA 1OVDA 3CAWA 4ACYA 1VCFA 2VR4A 4HYWA 1UMYA 3F2BA 3U9IA 5KZDA 2WZEA 4H9YA 1EDQA 1FQ0A 1EGVA 4LX4A 3WQ8A 3LNMA 4AYSA 6TIMA 4HCHA 1YE4A 5D9NA 4Y9AA 1YDVA 3VILA 2WZMA 1CGTA 4F0RA 2V5BA 2Y62A 2SFPA 4B5WA 2C0AA 1SZFA 4HOWA 2W4XA 2Z4GA 4S3GA 1BAGA 3M44A 3EMCA 1W31A 2RAGA 5D9OA 1CCWB 3ID7A 5EFDA 3HQ1A 4AY8A 3BGJA 4A3YA 2RUSA 2J74A 4MPKA 1JCNA 1LWJA 3GC5A 3CPRA 3VM7A 2UWFA 2CZVA 3Q65A 3PUDA 1IR2A 1N8IA 3M5ZA 3THCA 3LBMA 2ESCA 1XICA 4TOQA 3IGUA 3K8LA 4H4IA 2OSYA 1R3VA 3NXFA 3IGXA 4HZ8A 3SQSA 2R1KA 3PAOA 4O8AA 1UD5A 4UTFA 3NURA 2V63A 2V5CA 4IG2B 5DX7A 1OCJA 4EAYA 4XAGA 1WXYA 2VUNA 4DBWA 2PDJA 3C0QA 5A1AA 1XIBA 4ALDA 3FOKA 1XYZA 3SZ8A 3N14A 1TTIA 4Y8EA 3LBOA 4EXQA 1CWYA 4XUYA 2VCBA 3L4YA 4UR8A 1T7LA 2A7NA 4TV5A 3NQ2A 1UROA 2XGZA 2EKCA 1BLIA 3W07A 1A53A 4OFCA 4CNOA 2EAWA 4WLCA 3MUZ1 3QHNA 3DFQA 2B31A 1CB7B 4G6CA 3AIWA 4G56A 2J7DA 2P88A 2F2HA 1QDSA 1HL2A 4N9EA 3DGBA 5JBDA 2WO5A 4GYKA 2E8YA 3SUVA 4W7UA 3KS5A 4WDWA 3KOXA 1E4LA 4KIRA 5HR7A 3VFCA 4JXCA 4M24A 4AZGA 3RCNA 3OVRA 4RZ6A 2VDIA 2ZXBA 5LIUX 4E2DA 2HSAA 3AMCA 2XIOA 3WJSA 4R85A 1VFHA 1LRNA 4D6DA 1O95A 3EPOA 5M5DA 3S9YA 3GS6A 2EQDA 3OZPA 1UB3A 4N02A 2DZSA 5A94A 1EIBA 1YADA 2BY3A 3PHAA 4EPEC 4NY2A 4L9YA 1QNQA 4NZFA 4TVUA 1XV8A 4OGZA 2VZOA 3CHEA 3LGDA 5FA5A 1R3YA 2WSQA 4C1LA 2DT0A 3TSDA 4RDYA 2X1TA 3GKFA 3GVRA 1K77A 2PDQA 4RZ4A 1HJWA 1LUCA 5HA7A 3A3HA 5CSYA 3CH0A 2J7FA 2QJIA 2J24A 4B5XA 1VB9A 1DXFA 3T09A 1CGVA 2D3NA 1M65A 4WDTA 3KXQA 5AYYA 4E4FA 1XH2A 3CUGA 7REQB 2PGWA 5L6UA 1TWZA 3AI0A 4H9XA 2FGBA 4W7VA 3ZQ9A 3AZSA 2VZUA 3U2ZA 1IIGA 1FWSA 1NY1A 3T0TA 1UD3A 1GOIA 2GUBA 2WVSA 3VDCA 3E2RA 4WVXA 4PCPA 3KDNA 2NQLA 3VD5A 4IXXA 1NF7A 1R2SA 4TV6A 3K13A 2BHZA 3CAVA 3VKAA 4JBRA 5CEWA 3WKZA 1W37A 1YBQA 4AXKA 2PRHA 5TD4A 3TWBA 3CV6A 3Q45A 3N4FA 6XIMA 1GORA 3W6YA 1WZLA 3H22A 1NQKA 3BK0A 4ZODA 4MADA 5I77A 4QLJA 3H2NA 4FXSA 3T4WA 4JQ4A 3WJYA 2A6NA 3UWEA 3RN6A 3W1RA 2PC4A 1JYNA 2DZXA 4JEQA 2QCMA 4DEFA 1OC5A 3BC9A 3DENA 1DIDA 3IARA 3KBVA 3UVIA 1XGZA 3NGFA 1XLMA 4NKCA 3B4UA 1OIFA 3G6LA 1XS2A 3SRKA 1P7TA 3ARXA 1UD8A 5CC6A 1JPKA 4OHQA 4UQAA 3L9CA 3WSUA 1E43A 1NF0A 1MZHA 4NYUA 3STEA 1O60A 3W76A 4M3PA 4QE4A 5FESA 2XFYA 5H2ZA 3IEBA 3VIMA 2YB4A 5IOBA 3V5OA 3E6EA 1IGWA 3CPUA 2DZTA 3KWSA 3GAYA 3O7UA 4C6NA 3G8EA 4TVCA 1DJQA 2PP3A 4PUDA 4S23A 2CHRA 3TWAA 3GHTA 4NT0A 2GGEA 2PDUA 3MHFA 2QNEA 4XO7A 3KAOA 1ZP3A 3NQ6A 1MXDA 1TMHA 4Y9NA 2CU0A 3EKZA 3M7WA 3MO7A 1BWKA 2R1PA 4CNUA 3VD4A 2P0OA 4QTGA 2JIEA 5E9XA 3FNDA 3THQA 1RHCA 2YXXA 2XJ7A 3AIBA 3WEMA 1LF1A 1VFUA 2WMGA 3DHPA 3BW4A 1Z41A 4J27A 4YS1A 3SCUA 1F9CA 1TWIA 1J96A 1YRRA 3KHDA 3NQAA 3PR2A 2FB2A 3WD0A 1DOSA 4AZBA 1ICQA 4OVXA 1D3GA 1E6QM 1EUNA 1HO1A 3S1GA 4KBXA 4CN1A 5HAOA 3MU7A 4ZOCA 3G1SA 1POJA 3OEXA 1FWHC 1AODA 5EKYA 4L61A 1KC7A 1I45A 1FDZA 3GUGA 3ZVHB 2PS2A 1EHNA 2GVLA 4N9DA 5H8PA 5HPCA 3I7QA 3GIQA 3DC8A 4K1WA 3W7HA 1LROA 2POZA 2RDWA 3WUBA 1PZ1A 5LSMA 2UZ9A 3HOJA 2DUZA 3W7DA 3CQ0A 3WNMA 3E02A 3NZ1A 4MZ8A 4IFOA 4IUGA 2HK0A 3ANUA 3EA2A 3HFYA 4XZBA 2CNCA 3A9BA 3EBVA 2JGYA 4NI8A 3RM9A 1ZFJA 3I10A 1ZHAA 3NO1A 5K2ZA 2YDRA 4P8VA 1E9IA 3WELA 2PDMA 3BTNA 3ISIX 4UQDA 3MBFA 2XVPA 4O50A 3IGSA 1A0CA 1VFSA 2J88A 4YLWA 1K3UA 2WXDM 4IP5A 3P0WA 1F4AA 1UKSA 1T99A 2VX6A 3U7VA 3VIFA 2WVVB 3W22A 2OEMA 2DSUA 3H2MA 3BAYA 4JEJA 3OU8A 2PDBA 2HPMA 5FACA 1TTJA 3ITTA 1A5LC 3PZ9A 1R3QA 1TPWA 5H6HA 1W3KA 2XFWA 1ZJBA 5C6MA 1KCLA 3P14A 1JD9A 2ZA2A 1DJNA 2WVVA 3SFWA 1I4NA 4J1OA 3M0VA 5C70A 3RLHA 4BQ4A 2OOFA 4BKNA 3VIKA 3EEGA 3FAXA 1IEXA 1RH9A 4RDWA 4PMVA 3T78A 1SZRA 3AWOA 4FEZA 3PJTA 1ZAJA 3MO4A 4BA0A 3GXNA 5I3IA 1K9EA 2VP8A 1KFEA 3VZZA 4AZ6A 5I79A 1C7TA 3AXMA 4F48A 5XIAA 3DG7A 4PRWA 1FRBA 1E6PA 1FKWA 4D8AA 4JNYA 2GYIA 2TAAA 3WQGA 4AF0A 3AMLA 3E5PA 2YFNA 3PWIA 4TQTA 1RQEA 2H3DA 4HTYA 1B5TA 3QFWA 5LIXX 3M1ZA 3SQMA 3AO0A 3QOKA 3WEOA 1HX0A 1LQ0A 4AZ5A 1AG1O 3BLPX 3LCIA 4GUJA 3ZVHA 1OWQA 3WBWA 3C0SA 3SGUA 4B2DD 4ROQA 3AXIA 3UYIA 4PH6A 2PTDA 4MZYA 3PUEA 3RHGA 1OGGA 3B8SA 3CUHA 4IXHA 3MUXA 3PZUA 1SUXA 1C93A 3HTWA 3GDLA 3QR3A 4E3TA 4ZA0A 1OIMA 3DFTA 3UR8A 3PC0A 1OT1A 2YDAA 1YW1A 2R9RA 3TR9A 2PDYA 2V2CA 1SYTA 1E3XA 2BLEA 5I03A 3MKKA 3EYPA 4Q8MA 2DZUA 3GDTA 4MJ2A 4AHPA 1LQ2A 1QOXA 1DIOA 3URBA 3A12A 3WFLA 4LS1A 4Q8OA 1AMYA 4NJJA 1TZ7A 3SECA 2ISVA 4OT7A 1JCJA 1JJKA 4PB3A 2HVNA 3W1LA 1DJZA 1UP0A 2RFGA 4R9XA 2ZX8A 2XIIA 2GJXA 2NQZA 2J7CA 2C13A 1KM0A 3G1YA 1WDDA 2VEKA 4F2UA 3UBPC 1WZMA 3W86A 3VGDA 3VZYA 3ARQA 3A5VA 1A0EA 1BFNA 3EEZA 3WL1A 1WAWA 3L23A 3FV9A 2IUZA 3MSGA 3LOTA 2PCEA 2VX7A 4Z2GA 2DVTA 1PX8A 2WCGA 2HROA 1LOLA 3QMRA 4B2DA 4R88A 3ES7A 1C8VA 3JR2A 3C8NA 5KZ6A 3R8GA 3S9ZA 4R53A 5BXSA 2HNHA 3WL0A 1JXKA 3REQA 3TFCA 3VM5A 3AALA 3HB9A 1U22A 1ZUAX 3SCSA 1IXNA 2GQAA 4PGLA 4F0MA 1UWSA 2QF8A 2EPNA 3SUUA 3U0HA 2A7PA 1H0GA 4XZIA 4BFAA 3KWXA 3GQYA 5E09A 3MS8A 5CPLA 2Q02A 2JKEA 3PBUA 3HN3A 3I6EA 4JTTA 2Z2UA 4LFYA 3W7EA 3W74A 4DUXA 4D6CA 2DVXA 3B9OA 1JZ5A 2Y2WA 4GX8A 4US5A 2YL8A 4IIEA 3RLGA 4XTIA 1HUVA 3W7KA 2CYGA 1XQKA 1TX2A 1UWIA 3OHMB 1C8YA 2JEPA 4IJBA 5BXTA