3W22A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-125
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
rcsb
source organism Trypanosoma cruzi
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w22A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w22A01
1G6CA 4IMGA 4P2VA 3TA6A 1QPOA 5E93A 4DELA 1SSDA 4JY8A 1TJPA 1R2TA 3DHDA 1HUVA 3UZ5A 1J2WA 4O10A 1NSJA 3C8FA 5K4XA 3GDKA 5HJLA 4IPIA 3W2NA 2C3ZA 4X22A 2A21A 4ZQNA 1XBVA 4Z1BA 5LGXA 1W31A 4BI7A 1BKSA 1C9DA 4NZJA 1O5KA 3TFXA 3I68A 1LORA 4GUIA 5G4EA 1PE1A 1JCMP 4RXGA 1D3HA 1YDVA 3KVMA 2GVGA 3IIVA 3JS3A 2ZZ7A 1OFOA 2WSQA 4O53A 2RHGA 4ADSA 3IRDA 5F4SA 3HMJG 1XCFA 3TK7A 1YADA 2VFEA 3G1YA 3LB0A 3STFA 4MLJA 5BMXA 5DCDA 3Q94A 2A85A 5CZJA 5K9CA 2NX9A 2QUUA 2ISVA 4JYDA 1LLZA 1VYRA 3RLUA 5I3FA 4PC8A 4MIMA 3LCGA 2WSRA 1LOQA 2C19A 2EAWA 2JGYA 1JRBA 2YSWA 4Y90A 4IWWA 4KFPA 1XBZA 3RK8A 1WQ5A 2GQ8A 1YPFA 3IVTA 3R2GA 5HWJA 2NX3A 1QR7A 1VHCA 3P60A 1W3TA 1OX4B 3QW4B 1PCKA 4MY8A 1ICPA 4UTIA 3W1QA 4L4MA 5EPDA 5TQLA 1W37A 5FF3A 3PUOA 2C14A 1JUEA 2NLIA 1SO5A 4JTKA 4JTEA 4XQ6A 3MP3A 4WOQA 2ISWA 3LXCA 4CNOA 1VCVA 1DL3A 2VEMA 1OFPA 2G96A 1XDLA 1GVQA 5KMYA 3THQA 2QCNA 2QKFA 1JQVA 1DORA 3TV8A 1F74A 3W88A 3WFAA 1SW3A 4FO4A 3NA8A 4NNCA 1LRNA 2QDGA 3CB8A 3W7QA 3EWUA 2R94A 4GWEA 3TQ0A 2YR1A 2YW3A 1GTEA 4FNQA 4ZQPA 4O14A 3B04A 3EX6A 4ONVA 4M5PA 3NVTA 2YZRA 4PL2A 5DY3A 4NT0A 3DFSA 2YYUA 3UPBA 2AAMA 3S5NA 1OX6A 1G4EA 2FDSA 3LXAA 1K8YA 2OMAA 3C2VA 4Y8FA 1KFBA 1FCQA 3P81A 1V5XA 3FJ6A 1BWKA 3Q2DA 3W1MA 3BW3A 3C2FA 2CLLA 2E5DA 3UD6A 3CPRA 2FLIA 2RDTA 1VPXA 1B4EA 2ZZ6A 4UTWC 2HTMA 2FQIA 3PG9A 3W87A 2RFGA 3PY2A 3PULA 5DN1A 3T7VA 5AN7A 4O0KA 3DI1A 2NXHA 4UFJA 3DAQA 2O7QA 3TC6A 3W7PA 2A0NA 3P67A 3N9RA 1JQXA 3FFSA 2B7QA 1FWRA 5LHFA 1KM0A 1A5SA 3CQ0A 1H7OA 1EP3A 3W1RA 1O94A 1QWGA 3O07A 1HO4A 1P5BA 4O50A 3OBKA 3QSRA 3DU0A 3E02A 3PAJA 1YDNA 1ZY9A 5D30A 3BG5A 3W2KA 1A5CA 2RDWA 4IXXA 2AQWA 4UFKA 1JCLA 4JXCA 4Z1DA 2ZZ3A 3W7DA 3MW7A 2NWSA 1FX6A 3TW6A 3MMTA 1OYBA 1WOBA 4OQVA 1K3UA 3W1TA 4JICA 2RDUA 1TTQA 1XUUA 2J27A 2J24A 3F4NA 4LV4A 4JDYA 3VE7A 1JJKA 2A6NA 4ZQMA 1J5TA 2B7PA 2H8ZA 2C6QA 1YTEA 1TTPA 2OT1A 3I6RA 1WAUA 5KTLA 2VELA 4PTNA 4UMAA 1ICQA 4JTFA 5HWMA 2OT0A 4Q33A 3O06A 2Q8LA 5HR6A 1H50A 4U28A 1VZWA 3W1XA 3S6DA 4O28A 1TPFA 4KWVA 1VS1A 2WNNA 1VR6A 1SZNA 2JK2A 5C54A 3DZ1A 3O16A 2NXIA 4PCFA 3PWAA 3KHJA 5E1QA 2VC6A 1OVDA 5K9XA 3W7KA 1IIGA 4FF7A 1MEHA 2YXGA 2PRMA 1KFKA 4CNNA 2QCGA 1K8ZA 5D38A 4Z1AA 1PIIA 4MFEA 2PC4A 5G1YA 1OK4A 2PURA 3C2RA 5AHMA 4AXKA 1VHNA 1R46A 3STGA 3PM6A 3TSBA 4FXSA 1KA9F 2CLKA 1G7UA 3CWOX 2JKAA 1GPWA 1Q6QA 3M5ZA 1TSIA 3LRLA 3TAOA 4UC5A 4E2DA 4DPPA 3MI3A 3LCLA 1DKWA 1KBIA 3LTSA 3N2XA 1WOAA 2Q8ZA 5AHLA 4QITA 2CLIA 2PE4A 3G1SA 4JDBA 1ME7A 3MHGA 2A4AA 4IXHA 3UWZA 3G1DA 4TMCA 3TJXA 2C1HA 2ZRXA 3CT7A 4MFDA 5MHBA 1KM4A 4GBUA 3EX2A 1O5XA 4OE7A 3PUDA 3BO9A 5FEZA 1FY6A 1EP2A 1WX0A 4RLIA 5G2IA 3GXTA 5I3GA 4M6VA 4FEZA 4JN6A 3B06A 4MY1A 4QJ1A 1M7PA 1RQBA 5C55A 1Y0EA 3FEMA 4Z08A 2X1TA 3A21A 4DXVA 3LDVA 2NWRA 4CLMA 3PG8A 1UB3A 4FX8A 1XXXA 1T96A 2DZSA 3GK0A 1G7VA 1IF2A 2VEIA 5E0KA 2V81A 3EXSA 4O12A 3O6CA 3L0GA 3NQAA 3GKFA 3GR8A 6ALDA 5TBOA 1RQHA 4BWLA 3DGRA 3NL5A 2B4GA 3U8GA 1SQ7A 3H54A 3JRKA 3L2IA 1LRTA 4DO6A 4AHQA 1LCOA 2TMDA 1VH7A 4AHOA 3W76A 3KFTA 3PBWA 3W22A 3TFCA 1EP1A 2XN0A 3UQNA 1VLIA 3MYPA 1SR9A 4KFOA 1GZGA 3TCEA 1SW0A 2NXGA 3IIXA 3NNTA 2A7PA 1TPUA 1CI1A 2D73A 2LLEA 5D2YA 3QFEA 1K02A 3QQ0A 4UCGA 1IXNA 3SY5A 3UWUA 1EX5A 1I45A 1YXDA 2QCEA 3P74A 3MHFA 3W83A 1LRQA 4HPXA 4Y96A 1H60A 1AW1A 2YYTA 5A5WA 1P1XA 8TIMA 3BVJA 3NXFA 1VGAA 2J9XA 2VFDA 5C2XA 4KWWA 4GC4A 3QPYA 2TYSA 1R2SA 4A21A 1PHQA 3LRMA 2ZRVA 3QJAA 3V75A 4NUWA 1BEUA 3QF0A 1H7WA 4HPJA 3OA3A 1TPVA 1K7FA 2DJLA 1KM6A 3TR2A 5K9DA 2B7OA 3LCXA 3M5XA 4BR1A 3S1XA 1GWJA 1YLVA 3MBFA 2C18A 4K8HA 1Q45A 3W70A 5D2WA 1SO3A 1SFJA 3M7WA 5AHFA 6TIMA 3A24A 2V82A 3GDTA 3LRKA 1Z48A 1W5OA 4JS3A 4PA8A 4RV8A 4HNUA 2XN2A 5DCBA 4AF0A 1AG1O 5J5DA 5D2VA 3W74A 5FF2A 3PBYA 1TB3A 3O05A 2ZZ4A 4M7TA 2ZRUA 1W56A 4NJIA 4O4VA 4XWUA 5HNRA 3BGGA 4PEKA 5KZMA 1Q6RA 4RCXA 1I2PA 3GKAA 1ZNNA 1P0KA 2A5HA 3F1QA 3CU2A 3NL3A 1FWSA 3GIYA 4LVBA 4RZ4A 3RLVA 5A8GA 3B05A 4FB7A 5C6MA 4WOZA 4GUHA 3W07A 5D03A 4MOZA 1GYNA 4QQ3A 3OEXA 3I65A 2ZDRA 3Q37A 3HPXA 4Y9AA 3P80A 3TROA 4O1BA 4FX6M 3IIPA 3LTPA 1UCWA 3QRHA 3O6YX 3P8IA 3WJYA 3QZEA 3TJLA 1KM1A 5FF4A 1FCBA 3MI6A 1UUMA 1SU5A 3NQCA 1OF8A 1M6JA 3M43A 3PS7A 4JYFA 2QCFA 1W0MA 2I14A 3EWYA 2C16A 5KSWA 3HG3A 4MVAA 5D04C 3LHUA 3KVJA 4E0CA 1GVFA 2PRLA 2X16A 2R91A 4O54A 3IEBA 4UTTA 3VNDA 4I7UA 1BWLA 1QAPA 5AC8A 3F03K 4UR8A 3SJ3A 3CEPA 4JTLA 1UASA 1NVMA 3W75A 1FQ0A 4FNPA 2EPHA 2Y85A 3BG3A 4OV9A 3TSMA 2E5BA 3TC7A 2A7RA 4ORMA 3TAKA 4IGHA 3P82A 1TPH1 5LNWA 3LCFA 3M9YA 1LROA 3EWWA 4QNEA 1QPNA 3NEVA 1J4EA 2VFHA 4XKYA 4WZHA 2CZDA 2G5WA 3QQ1A 1V7YA 1XBXA 3EX3A 2VXNA 4K37A 1C8VA 1TTJA 2ATMA 1W8SA 1DQXA 3NZ1A 5D33A 3G0UA 3RU6A 1OFDA 3A9IA 2A1YA 3ABQA 4XBSA 4M6PA 5DLCA 3MI2A 3LLFA 3EX4A 3VI2A 2WJZA 1TV5A 1TRIA 3AO0A 3P5ZA 4OBTA 3LI0A 1O4UA 3LCIA 4UFMA 1KV8A 4K7YA 1IXQA 3LI1A 4UR7A 2EHHA 3NQGA 1H7RA 3BW4A 4LVGA 4AAJA 3PBUA 4BI5A 5AB3A 1TPC1 5DXXA 1VYSX 3DKLA 4O52A 4HHPA 2ZFAA 4ZQOA 5I3JA 5K2ZA 4Z0SA 3AJXA 3WJXA 4FNUA 1LP6A 5K7JA 2FJKA 4U4MA 2X1UA 3EXRA 3DFTA 5GVJA 2Y7DA 3NPUA 3FJLA 3TKFA 1VYPX 4AF0B 3UZJA 4LY8A 4HKPA 2GVJA 1Q3NA 4UTLA 1GG0A 1K7EA 3HOJA 2QAFA 4UTMA 3VKJA 4UTUA 3LM7A 1ME8A 2QCHA 1LBLA 3QM3A 3IIOA 2GVLA 3NQDA 3W1PA 1LZOA 2X1RA 4TMBA 3CLMA 3H53A 5HUPA 3A23A 1H1YA 2ZQ0A 1F2JA 4D2JA 1S3HA 4UTKA 3C61A 3ABRA 5KINA 3D0CA 2A2IA 1IGSA 1H7XA 4X3ZA 3S0CA 3UWYA 1WYIA 4GJ1A 3NOEA 3N34A 5AC7A 5IBXC 1UUOA 1L2UA 3B03A 2ZRZA 5DY2A 3MO7A 3T4CA 1TV7A 1XL9A 4NJGA 2FIQA 3CWNA 4E2BA 1SO4A 2DZPA 2ZZ5A 3DI0A 4ADTA 1YXYA 3CIWA 5HWNA 3G1HA 3RFAA 3UPWA 4Y6GA 3FYOA 5D32A 7TIMA 4LVDA 1FBAA 4BWLC 3FS2A 2E09A 1YYAA 4IX0A 2XFWA 3MWAA 1H63A 1H5YA 2V8ZA 2PRHA 2QCDB 2E6YA 3LHVA 4JTUA 1P4CA 3T44A 1S5WA 3OHIA 1LOSA 1A5AA 2ZTKA 3QMRA 5TIMA 4EOUA 1LLWA 4YXGA 3IV3A 3P7YA 1KFEA 3IVSA 2YFOA 1GTHA 3FKKA 4EF8A 4RJEA 1KTNA 4XKYB 4A2SA 5AYYA 2R14A 4JTHA 2ALDA 4LS1A 5H2ZA 3WJWA 2QJIA 4MJZA 3O6DA 4AWSA 3ZR4A 1RVGA 3TNOA 1MO0A 5FF0A 1ZCOA 3HJZA 5HR7A 3UNDA 1W3NA 2V2CA 4K8EA 1I2QA 3HGJA 5EA9A 3ELFA 3DHFA 3W7EA 3C4UA 3W7CA 4N9EA 2YFNA 5CGQA 1WV2A 1AW5A 1F5ZA 2CLHA 1TO3A 2HSAA 1W5QA 3M5YA 1EB3A 3W3OA 1ALDA 4LS2A 4MZ1A 3W1LA 4HSOA 3TW7A 1HFBA 3W23A 2G95A 2CFFA 1TPWA 4IX2A 1QO2A 1DQWA 3C3NA 3FLUA 1OX5A 5EL1A 3TMQA 4XUGA 1L6WA 3W7MA 3SSJA 3L68A 3M47A 3MP5A 1TV8A 2Z1BA 3W71A 1O60A 2YDAA 3DFOA 3KVLA 3NPXA 3HF3A 4BF9A 3MP4A 1TQJA 1QOQA 3L9CA 4DF2A 4NJHA 4POCA 5LNUA 3ANYA 3E9AA 3PSVA 5DELA 3W1NA 4FXRA 3LHTA 4NU7A 3B8DA 4RK8A 4ZL1A 4K38A 4LRSA 4IUOA 4CQAA 1Q6OA 3G1AA 2C0AA 3S1UA 1NEYA 3HG5A 2H90A 3WK1A 4LW7A 1KTBA 1Z44A 3GDLA 4IJBA 2G97A 4LTSA 3TSDA 5CPMA 5AFDA 2CW6A 1G4SA 3UWQA 3DBPA 4EIVA 4A2RA 4CNPA 4AEOA 1OYCA 2DORA 4I7VA 3PF3A 3G0SA 3R89A 1KM5A 3P61A 3LCHA 4QNWA 3M41A 4JY9A 2WSYA 4YCOA 5SWUA 1A53A 3MBDA 1MZHA 2WO5A 4LVFA 3G22A 3SI9A 5HULA 4NXKA 4ZZ9A 5BNKA 3WJSA 3NQ2A 3G8RA 3THAA 3CHVA 1D9EA 2DZWA 3LX9A 3S5ZA 5I3IA 3SGUA 4OHQA 5F2IA 1X8FA 1RPXA 3GNNA 3HGSA 1CW2A 4OGZA 4FNSA 4UFLA 2DP3A 3ZS4A 1X7FA 3QYQA 5IM51 1XBYA 5F2LA 3W86A 3M0ZA 3G1VA 2TPSA 2CLMA 2WOQA 4LT9A 3QMSA 5J5RA 2CZFA 3LLDA 3W7NA 4RXFA 3VCRA 2Z0IA 2ZTJA 3G1FA 1TTIA 2EGZA 1KW1A 2XN1A 3F4WA 2YGYA 1DOSA 2CLEA 3S1VA 1GT8A 3G0XA 4AMAA 4R34A 2Y89A 1PV8A 1WA3A 1K03A 5F1UA 3P62A 4IMEA 1YTDA 4AWUA 3S1WA 2Q3OA 5CSRA 3W9ZA 4UNLA 1WBJA 3LERA 2V30A 1XFBA 1XUZA 1KBJA 1JVNA 1FXQA 1FXPA 3G3MA 5F2GA 4ZQCA 2WNQA 3HQ1A 2Y6ZA 1TIMA 5LGZA 1F6KA 2GJNA 2JBMA 3NPVA 1AK5A 2Z6IA 4NJKA 1C29A 3RNDA 4O1AA 3GX9A 3S5OA 4JTIA 1MEWA 1DVJA 2VFGA 1LM1A 2WPBA 4O13A 2VFFA 4NQ1A 5KZDA 3SGZA 5AYZA 5HQEA 5G2HA 4N9BA 4O1DA 1LYXA 1OFEA 4O57A 5L6UA 4LNYA 1WBHA 4OT7A 5FEPA 1H1ZA 3TXVA 4DQWA 3DFPA 4R7JA 3FKRA 2NZLA 4TU1A 1IIHA 4YMZA 1G67A 1JCXA 2BWGA 1JULA 1OABA 1S5TA 2Y63A 1ZJIA 2V0TA 2QCLA 3NQ7A 1R30A 5D02A 5LZLA 4H6KA 1W1ZA 3NM1A 2CU0A 5D37A 5AC6A 1OYAA 2QAPA 1KFJA 3HB9A 4NXSA 2GJLA 1SPQA 4KKXA 5LNSA 5G1TA 3LHYA 3BG9A 3NQMA 4Q32A 3N19B 2WV8A 2Y88A 4HSNA 4MUZA 1H62A 1T8XA 3HBLA 3OVPA 1I4NA 4G1KA 3EWBX 2DZTA 4O15A 4WJEA 3S8HA 1SUXA 4CCCA 3K30A 4K39A 1LDCA 4TR9A 4C1LA 2NV2A 1ICSA 3L0KA 1F76A 1XM3A 2FPTA 2GQ9A 2QUVA 5CPNA 3I7SA 5C5YA 4CCEA 1MXSA 1JRCA 3BPWA 3H55A 5CG7A 2DZUA 3IGSA 4PL1A 3TQVA 2JKPA 3B0UX 3NYZA 1CX9A 1B3OA 3PVFA 4PODA 1R2RA 5FEWA 1ZFJA 3SECA 3NQ8A 4KFNA 3PB0A 4JNMA 2GQAA 3IVUA 3QSTA 4M19A 2Y7EA 1W5PA 1W3IA 2QEZA 4IMFA 1HO1A 2FPYA 2KZHA 3UXDA 3G3DA 1EEPA 1A5BA 4HIBA 4NNBA 1QOPA 1JUKA 3N73A 1FWNA 2OJPA 2F7FA 4ALDA 4JIPA 5FF7A 2VOMA 2H6RA 1SSGA 4IPJA 3B0PA 2E77A 1DBTA 4EWND 3NO5A 4GUJA 3N14A 2YPIA 5F4WA 1G4PA 1EA0A 3P84A 1ZHAA 1SZGA 4LU0A 1X1OA 2C15A 5HUOA 3B4UA 1Z42A 4R33A 4DEFA 4MY9A 4NZFA 5F1VA 1A50A 3QMTA 4GUFA 4QISA 1KTCA 3LHZA 1H7NA 3W6YA 4DBEA 3HG2A 1B4KA 1BTMA 1EPXA 3L21A 1VCGA 3I7QA 4DF0A 4N02A 3BV4A 4N4QA 2WQPA 3NG3A 2W79A 4WY0A 4RKAA 1SZEA 2V9DA 1HTIA 3STCA 4N6EA 3BARA 3GXNA 3E12A 5DXYA 5G5IA 1MSSA 1OF6A 3HGOA 3UY8A 1OHLA 3M5VA 2W6RA 3NZRA 1F7BA 3M16A 4UTHA 2QCDA 2Y7FA 1LBFA 1R47A 3USBA 4O18A 4ZVJA 3EWXA 2Y7GA 1FUYA 2CLFA 4IMCA 2WKJA 2E6DA 4JX6A 4RR4A 1PS9A 5D09A 3NQ6A 1GVRA 4MZ8A 1N7KA 3W2LA 3L0NA 3FYPA 2YX0A 4AH7A 5LKYA 2B7NA 3LBMA 2ZBTA 3LCWA 4O19A 1N8FA 3HPSA 1IXPA 2E6AA 1ML1A 3WJZA 2E5CA 4GRSA 3S42A 3NR0A 1NF7A 3BK0A 4UFHA 2OZ0A 1H7PA 2QCCA 3IGUA 1ZENA 1K8XA 2J9ZA 4UXDA 1HL2A 3GAYA 3CC1A 3KAOA 5HINA 4GXMA 3R12A 1P0NA 5AYXA 3ZWTA 5CZTA 4YL2A 4H4IA 5AOUA 1U83A 4LC8A 2DZVA 3OVQA 2CLOA 2ZRWA 4AB4A 1SW7A 2V5BA 3IIZA 1L6YA 4ML9A 5EYWA 4XTIA 1AW2A 3C2EA 1XC4A 3R5EA 3LHWA 4JIQA 1LTDA 1EIXA 4BI6A 2VKZG 1M7OA 5CZ0A 3HIJA 4HT3A 4LWWA 1U5JA 5EMUA 3W1AA 1XKYA 3HPZA 3O15A 1T0OA 2YW4A 3LTYA 3ZFHA 3W2MA 1EUAA 1RZMA 2ABBA 3KXQA 4OU1A 3NQFA 1GJPA 2W0UA 4JTSA 5U4NA 2CZEA 2QCMA 3N9SA 3BGJA 2NUXA 2ZZ1A 3DH7A 3TU9A 1RR2A 5EY5A 1FDJA 1FCUA 2J9YA 4QIUA 1S5VA 3QC3A 3UWVA 3KOFA 2IQTA 4UUIA 1TPEA 3PB2A 5D2XA 3YPIA 2E6FA 5FESA 2FPVA 2O7SA 3EEGA 4N6FA 3VE9A 4Q4KA 3OG3A 4LC6A 3UY7A 3VFLA 4XBKA 5EKYA 2F84A 5FEXA 3O63A 1W5MA 4UMBA 3CM4A 3S9YA 1OK6A 3G24A 1THFD 3A5FA 1X1ZA 1ME9A 2P1FA 3O8AA 4RZ5A 5CSSA 4JTTA 2CZ5A 5FI8A 1I2RA 1QDSA 3E96A 2CWNA 3NM3A 4NX5A 1VJIA 4WY0B 3C52A 1GOXA 2ABAA 3TUUA 1AMKA 2HS6A 2X30A 3NQEA 1DV7A 3SIZA 5I3HA 3FOKA 4YWIA 3WK3A 1MEIA 1QO5A 3PUEA 5BMWA 4B5NA 4DBDA 3W72A 2NUWA 3C6CA 3QH2A 1ZALA 5D05A 4WUIA 3TE9A 1QNVA 3W73A 2GOUA 3EXTA 3TQKA 4JEQA 4LVAA 3I7RA 3GDMA 1XI3A 4TO8A 4N2YA 2NX1A 4YLWA 1WXJA 1RD5A 4L4LA 4P61A 4MZYA 1W54A 2A7NA 4K7VA 2I9EA 2OCZA 4LUIA 1OFAA 1PVNA 4O0ZA 4NJJA 4WQ6A 2ZA1A 1KM3A 5DCEA 2ZCGA 2GPTA 3EWZA 4LUJA 1W5NA 4MPQA 4CQ9A 2E1DA 3BLEA 3W7GA 4QM1A 3MJYA 2VEPA 3QW3A 1E51A 2J88A 5BW6A 3EKZA 2BLEA 3DENA 5ABTA 3N2MA 3A22A 2HS8A 3ZWSA 3DXIA 2ZYFA 1NAL1 2ZRYA 3M1ZA 3S5YA 3LV5A 4M7SA 4N9DA 3UWWA 1EWDA 4UNKA 3QEZA 1PL9A 5AHEA 3C56A 4LRTA 5AHNA 3KX6A 4LV9A 3W7HA 3MYOA 2Y70A 2ZA3A 4CQ8A 4HNTA 4NX0A 5U7SA 3PSWA 3IGXA 5F2MA 2GUUA 2UV8G 4GNJA 4ZMGA 2WNZA 4O11A 1GEQA 5LHEA 3M44A 4OV4A 4NVTA 3HG4A 1M5WA 3EKLA 3BW2A 3CIXA 4N9CA 3EX1A 3LBCA 2R8WA 3OIXA 2OX1A 1YPIA 4MKNA 4UTJA 4AVFA 3CEUA 4DO4A 1ONRA 1TJRA 4JTJA 4MJMA 4N4PA 1NF0A 3STEA 5LSMA 3ABOA 2EF9A 1N55A 1UBSA 4LOCA 3GXPA 3C0JA 4S1FA 5LNRA 3U6WA 1DJNA 1OFRA 4W9TA 5HMSA 2QDHA 1QMLA 3W2UA 3NDOA 2JKEA 2P10A 2PCQA 2TRSA 4YCPA 3CTLA 5L9FA 2TSYA 3BLFA 3RF9A 1I2OA 2Z2UA 1VLWA 4GE8A 5KITA 2V2DA 4FIRA 1YXCA 2QJGA 3SR7A 4S2CA 3WK2A 1IXOA 1TRDA 2ZZ2A 1JCJA 4WX2A 3L5LA 4WXYA 3V1PA 4LS0A 2QUTA 1QPQA 1JR1A 4BFAA 3MHUA 1Q6LA 2C13A 4EF9A 2DU2A 4AHPA 4FHAA 5AHIA 4FNTA 4UFIA 1OFBA 3UXAA 1DHPA 4JX4A 5G2WA 3GDRA 2X2GA 2BZNA 1D3GA 4AWTA 2JGQA 1QCWA 4EVZA 5KZEA 3W7IA 4UMCA 3PBVA 1T99A 4O16A 4UTTC 3HGRA 4XTDA 3E0IA 1F6PA 2I1OA 3KRUA 1EWEA 4IOTA 5IBXA 1H51A 2YCEA 2VEKA 4S2BA 1I8JA 3GLCA 1VC4A 4IQLA 4WXZA 1TPDA 3P5YA 3Q58A 3L5MA 3NL6A 2ATSA 4HNNA 1F73A 1SO6A 1GVOA 4O17A 3RMJA 2QJHA 3PR2A 4RZ6A 3SW6A 4HN4A 5T26A 3TX9A 1K7XA 3GAKA 4TIMA 4UTWA 2V2HA 2V5LA 4O1CA 5BRBA 3NGJA 3T40A 3GVGA 1QPRA 4GUGA 4WD0A 4A29A 1JCYA 3R8RA 4Z1CA 1AL7A 1PCWA 2NV1A 4Z0JA 4FNRA 3T55A 3FIGA 1HG3A 3KRZA 3NAVA 4ZQRA 4A3UA 1B9BA 5LNVA 3LGEA 3SFKA 3TIMA 3GYEA 3O1NA 4A22A 1TREA 1FCVA 3JR2A 4JR5A 3W85A 3HO8A 4X9SA 3G8EA 4RX0A 4E38A 4H3DA 2BX7A 1DJQA 5CPOA 1OFQA 1NFBA 3NPWA 3W84A 1LOLA 2DJXA 3OVRA 4PFMA 5I3KA 3LV6A 2Z6JA 4ICNA 3L67A 5CZSA 4HNVA 3TXZA 3GNDA 2BXVA 4NNAA 4M6QA 3TH6A 4JYEA 4K6AA 2A6LA 4I7WA 4ADUA 3T78A 2FB2A 2X1SA 4UIOA 1TQXA 1I2NA 3TDFA 1WDWA 5EBUA 5K4ZA 4IMDA 3FA5A 1KLYA 5CKSA 2H3BA 1GYLA 2VFIA 4PH6A 4BK9A 1X6UA 1G69A 3G18A 3W7RA 3WK0A 1OG0A 4DPQA 1FWTA 1SFLA 1EUNA 4DO5A 3ABSA 1RV8A 3N3MA 4R53A 4I9AA 4C1KA 1AL8A 1Z41A 4GFSA 2BTMA 3B0VC 3GZ3A 1GG1A 3BLIA 1L9WA 1TYGA 1QFEA 1KM2A 1TMHA 2NUYA 1ZAHA 2VENA 3W7JA 1OX4A 4OWGA 3U2OA 3PC0A 3UYCA 3EB2A 2FB3A 3TMLA 1L6SA 4TX9A 1UJPA 1B57A 2Y62A 4O4WA 4MYXA 2ZA2A 3GR7A 3L5AA 2H8XA 4WY0F 1VRDA 2QR6A 1TPB1 2H3DA 5BOOA 1VQTA 2DZXA 3M6YA 4QAIA 5K3VA 3E49A 4K36A 3DKJA 2ISSA 1KV5A 2P0OA 1JCNA 1SZFA 1GVSA 3KVKA 5G4WA 1KFLA 1VCFA 2QF7A 2HMCA 4JTGA 3L65A 1RQEA 5CPLA 3W7LA 1LBMA 3QPZA 1KFCA 4QSHA 4J9JA 4O8RA 1XDMA 4FX7A 1FDZA 4FIQA 3L66A 5F4XA 2AGKA 5DBUA 3SZ8A 1TCDA 1JUBA 2J6XA 1YDOA 4JD4A 1ADOA 1G4TA 3DFNA 3NQVA 1ZAJA 4DF1A 3NL2A 3DFQA 4JGDA 4MLRA 1F05A 3P8JA 4ORIA 4X2RA 2EKCA 3A5VA 1KLZA 2B0MA 3R13A 2FFCA 1FDYA 1ZAIA 4JX5A 5D2TA 3C2OA 3ATZA 2BSLA 1YTKA 2FTPA 2E68A 3W7OA 3W1UA 3INPA 2Q3RA 3W2JA 4XZ9A 3GB6A 3KRSA 1O95A 4MYAA 1FWWA 3ATYA 4CCDA 3LOTA 1PHWA 2RH9A 5DBTA 1H61A 1GQNA 3G1XA 2Y61A 2RKXA 1OJXA 5H91A 3MUXA 3LXBA
chains in the Genus database with same CATH superfamily
4IMGA 1M65A 1SSDA 1TJPA 1QI2A 3IJLA 1SJCA 4O10A 1UA3A 5DF0A 4IPIA 2C3ZA 3KS6A 5CPTA 1DJHA 3MQTA 5LGXA 1B0IA 4YYCA 4BI7A 3WIJA 2VQUA 4TQTA 4MTVA 4X9YA 3EA3A 5DRIA 1M03A 4IFKA 5G4EA 1JCMP 1H41A 1YDVA 4F3HA 1JNEA 3V35A 2XFFA 2WBGA 4AISA 1HP4A 3AIBA 8CGTA 4AX6A 2VFEA 5ABGA 3STFA 5BMXA 4S3BA 2A85A 3LY0A 3H2NA 2QUUA 3WUBA 1M1BA 2ASHA 3WLRA 1TJ0A 2YBVA 3UVAA 5A2CA 1JRBA 4KRZA 1TJ2A 3FXYA 1P7TA 2V67A 3AIQA 1U33A 1QR7A 3MV11 4MY8A 1PCKA 1MFVA 5EPDA 3H2CA 3LA4A 1GKQA 3MP3A 2ISWA 4REQA 3VD5A 1DL3A 1XDLA 1JPDX 3THQA 3WEOA 1JQVA 1DORA 4HCLA 1F74A 3W88A 2ACQA 3WFAA 5DT5A 3NA8A 3GXIA 4JZ5A 3WF0A 3TLQA 3EWUA 1N8WA 3ITLA 1VD6A 4FNQA 5LXXA 3EX6A 4DLMA 3V36A 4ONVA 3NVTA 3NVDA 1EF2A 3FJ4A 3N04A 3L4TA 3RCYA 5BXRA 3PBMA 4GI9A 2YJQA 2ZWYA 3W4RA 2C7FA 3P81A 1V5XA 4IF2A 4HTBA 1BWKA 3W1MA 4PRTA 3BW3A 3TZFA 4DM1A 3F2DA 1JXJA 1Q13A 2RDTA 1VPXA 3UETA 4UTWC 3PP7A 1UBPC 1V02A 3W27A 4NILA 1TR1A 3T7VA 1AH0A 1TV4A 5MKGA 4DJFD 1FVPA 1MQPA 1TUXA 3CAQA 3DAQA 3TC6A 1NP0A 3CJPA 3P67A 4EXQA 1JQXA 4DIAA 1FWRA 5HATA 1A5SA 4GVGA 2VWTA 1HO4A 4O50A 1SGJA 3OBKA 3E02A 3I3BA 4QG6A 3PAJA 3RHGA 5CEWA 1YDNA 5D30A 3AC0A 3GXFA 4H1ZA 2E8ZA 3ARTA 2BVWA 2NQZA 4Z1DA 3R79A 3FGCB 3FSUA 3VK5A 2XZ9A 1FX6A 2Y2WA 2EO7A 3MMTA 4OQVA 2I5GA 1ZCCA 3RIKA 2J27A 4WDWA 2YA0A 3NGFA 3WH9A 4KCTA 3IV8A 5FCZA 3VIGA 2TAAA 3ZT7A 4AIOA 5HWMA 1DXEA 5E70A 4FP1A 3O06A 3RPMA 1BG9A 3A9BA 3WBAA 1BXBA 1FWGC 4KWVA 4AYSA 2WNNA 3KTXA 1J9YA 2NXIA 5E1QA 1PJ9A 5K9XA 1IIGA 3ARZA 3WUFA 1YMYA 4FF7A 4KRUA 3RXZA 2XGIA 2YXGA 2PRMA 1B9ZA 2MANA 2QCGA 1K8ZA 4Z1AA 1PIIA 4HA4A 4MFEA 5AHMA 1VHNA 1TR9A 3TSBA 2D0FA 1RPKA 3GTNA 3QXBA 3AS0A 1XYAA 1GPWA 3M5ZA 3DFHA 3TAOA 4E2DA 2Z1SA 3VNMA 4JBRA 3M0MA 3EOUA 3CV2A 2V6AA 3NDZA 1UD3A 1WOAA 3PBGA 1NFGA 3WQGA 2Q8ZA 4QITA 1J8VA 2R1MA 4IXHA 4DZ5A 1V08A 3G1DA 1EC9A 4MFDA 5MHBA 1QHOA 2P0IA 4Z17A 4OE7A 2EPKX 3BO9A 4JFTA 3KE0A 5FEZA 1J12A 1FY6A 2PDNA 4L9XA 3GXTA 5I3GA 4FEZA 1UR9A 4FLQA 2ACUA 4PMOA 4LPCA 1M7PA 1PXGA 4H9ZA 4D6DA 5C55A 4FALA 2E9MA 2FZ8A 4GHRA 3A21A 1JPHA 3GTHA 4LYRA 3LDVA 5A8PA 3WSUA 1REQB 1UB3A 1XXXA 2REQB 2XH0A 3WY1A 1T96A 2DZSA 5A6KA 1G7VA 1IHIA 1HGWA 4CD7A 2V81A 1C91A 4O12A 4PB3A 3O6CA 1TA3B 3NQAA 2XVGA 2QW5A 1NQ6A 2PP1A 3WL1A 3TNBA 3GR8A 3PNUA 3R25A 2B4GA 4CN6A 3U8GA 1RUSA 3L2IA 4PMQA 3WELA 4QLKA 1S2TA 3LG3A 2TMDA 4CCZA 3DCPA 3W76A 3KFTA 3W22A 1QHZA 5HMDA 1P0DA 4W89A 3AMGA 2XN0A 1O1ZA 1VLIA 3K4AA 4GGBA 1SW0A 2YDQA 3T2PA 1GQKA 1JDAA 3TTSA 1TPUA 1JZ2A 1EHNA 1CI1A 3M0XA 4A05A 2ZXAA 2GDUA 1QW8A 3QQ0A 3FJNA 3UWUA 1I45A 2Q8XA 2UY4A 4KRTA 2DVUA 3P74A 4HPXA 4Y96A 1X8CA 4CNSA 5ECUA 4PTMA 5A6JA 5A5WA 1VGAA 3E2SA 4F2BA 1F3XA 3QPYA 1EEXA 4UOJA 4A21A 1PHQA 2ZRVA 1PZ1A 3MUIA 2Z24A 1BEUA 1X6LA 3QF0A 3V3WA 1TPVA 4L6HA 1GW9A 1K7FA 2DJLA 4JTQA 2HE5A 1D7FA 3S1XA 3GS6A 1YLVA 3MBFA 2C18A 4GKLA 4UBPC 3W70A 1NU5A 1SFJA 1TVLA 5AHFA 3A24A 4U3AA 1W5OA 4MNLA 1BYDA 3DEQA 4P5UA 1XLDA 2I5IA 3SJNA 2VD8A 5DCBA 3APGA 5J5DA 2OTDA 3GVQA 4X0NA 1TB3A 3O05A 2ZRUA 1OADA 5HNRA 1V3IA 4PEKA 5KZMA 3MSRA 3GKAA 3NL3A 3F1QA 1ZJBA 5LYRA 3A64A 4PSRA 2ZXQA 1E55A 4RE4A 3OZMA 3B05A 2D2GA 3W07A 1IZJA 1A5NC 3V5CA 1GYNA 4NAEB 1DWGM 3I65A 3I3EA 5A8QA 4NASA 1ESWA 2HBXA 4FX6M 3IIPA 2QF8A 4WLCA 3W6LA 3KP1A 1KM1A 2NSOA 1BRLB 1US2A 5FF4A 1FCBA 4G7FA 1UUMA 4B15A 1OF8A 5I06A 2QLYA 2QCFA 1K9DA 3EWYA 3GUGA 2A3LA 1J0ZA 4D8LA 3PHAA 2Y24A 3EMZA 2VHLA 4XAZA 1JCTA 5LIUX 2R6OA 3S2MA 1UWAA 1NY1A 2XFRA 2HPMA 1FQ0A 2POTA 4YIWA 4H8HA 3TAKA 1JFXA 4IGHA 1E0WA 1M53A 3P82A 1TPH1 4S3EA 1I60A 5LNWA 3LCFA 1DJYA 4GIYA 4GIRA 3EWWA 5A8NA 3NEVA 2VFHA 2G5WA 1TUFA 1EIBA 1XBXA 1C8VA 1FHVA 1WZMA 3WH8A 5D33A 1PKYA 3G0UA 4DJDD 3VOCA 2Y0FA 5DLCA 3MI2A 1PTAA 4H9XA 4KGLA 1TRIA 2VGBA 1GOWA 1P43A 4MKSA 3LCIA 1KV8A 3TTQA 3DGBA 1CXKA 2EEXA 4UR7A 5BROA 4GLEA 3BW4A 4AAJA 3BSGA 3PZGA 5AB3A 1TPC1 3DKLA 2CNCA 2PZNA 1Q8AA 2YCLB 3T0AA 3AJXA 3NTYA 3DOPA 2WYSA 1XIBA 3EXRA 3DFTA 3VOHA 5GVJA 2Y7DA 4LY8A 4OBRA 2DIEA 3CS2A 3L4XA 1Q3NA 1GG0A 2XDFA 1K7EA 2OYKA 3OOQA 3S2JA 5EMLA 4TTUA 1CT5A 1W9DM 3GY1A 2QCHA 1LBLA 1CLXA 1R87A 4TTGA 2X1RA 4A8LA 3IJ9A 4LY4A 3WENA 3W81A 1E9YB 1H1YA 1VFFA 2FZDA 1F2JA 4D2JA 4UTKA 3AOFA 3Q4DA 2YL5A 1HNYA 4Q8UA 4EPBC 3REQB 2R1NA 5FJRA 1BPLB 1V6TA 2PC8A 3N13A 3TYDA 4NJGA 4US6A 5E9XA 2NQLA 4KERA 1XIJA 1ZUAX 2CHOA 1AJ0A 4E2BA 4I3GA 4ADTA 4QX4A 2J8TA 4BQ5A 4ZR8A 4R7WA 4QE5A 4Y6GA 4LVDA 3FS2A 1YYAA 3GIQA 2V8ZA 2PRHA 2QCDB 3T44A 4C6JA 1S5WA 3G2GA 5BU6A 3BAYA 3UG3A 4U5IA 2VRKA 3QMRA 4YN5A 1UD2A 1LLWA 4X2PA 2ZOXA 3PN8A 3EA1A 5HXMA 2BODX 1OZMA 1MZRA 3FKKA 2VRJA 5ABFA 3OG2A 1R5YA 1ZL1A 4DUVA 3EMCA 1YQ2A 4JTHA 1B3XA 5H2ZA 4A3QA 1CIUA 3WJWA 3WQWA 2QJIA 5GJPA 1JZ7A 3GM8A 3WEZA 1MO0A 5FF0A 4NG3A 2FJUB 3OIHA 3WDRA 2FHFA 3GSMA 1ELSA 4N9EA 5DANA 1AW5A 2CLHA 1QATA 4HTYA 3WNNA 4H01A 3NSXA 1EB3A 3KBWA 3MJMA 1ALDA 2G3JA 3O6AA 4HSOA 1PX4A 1KQZA 5REQB 3W23A 3N9KA 1TPWA 2PDBA 4IX2A 1QO2A 1OX5A 3TMQA 1L6WA 1K77A 3WZ0E 7PTDA 3W71A 2DUZA 1M9HA 1E1EA 2WAGA 3KVLA 4H9VA 1V3HA 3H7RA 4POCA 3E9AA 2Y8VA 3W1NA 1MYRA 3CMGA 4QSFA 1SMAA 4IISA 1V3JA 4ZL1A 5BWAA 2VR5A 2WCAA 5D8ZA 1R9ZA 1NEYA 4KEZA 2H90A 4Y7EA 3WK1A 1Q4WA 1KTBA 3T0CA 2VOTA 4LTSA 1C90A 4A4AA 5CPMA 1G4SA 4PB4A 4Q8NA 5A6MA 1TWSA 1OYCA 1BYAA 3R89A 4JTRA 1KM5A 3N2CA 3LCHA 4B3KA 4DYJA 4JY9A 2WSYA 1A53A 3MBDA 1H4PA 1EA9C 1MZHA 4PEEA 2WO5A 3AI0A 4LVFA 1R3VA 4RL3A 5HULA 3QV8A 1J2BA 2QVHA 3EOLA 5BNKA 5E0CA 1E5NA 1D9EA 3LX9A 4OHQA 5F2IA 3GNNA 5TAOA 3AXIA 3HGSA 2BBFA 3HQOA 3APTA 1OWQA 4OGZA 4ZCWA 3EA2A 1AQ0A 5IM51 1R3YA 3FA3A 1RD6A 2CLMA 3GC4A 3DX5A 1FWDC 3RM4A 3QMSA 2CZFA 4RXFA 1R7AA 3G1FA 3C0QA 1TTIA 4JN7A 3WLTA 1KW1A 1SM9A 2QNEA 2XN1A 1LQAA 2P8BA 5C9RA 1W9PA 4MAZA 3CQJA 2DQXA 3CH0A 3AFBA 4AMAA 1PV8A 4L9ZA 3O0KA 1K03A 2OEKA 5F1UA 2INEA 1CXHA 1YTDA 2W62A 4AWUA 1HX0A 4HPGA 1LJYA 4UNLA 1X39A 5GNXA 4H9TA 1D8CA 3B9OA 4PUWA 1X98A 2WZEA 1XFBA 3H4WA 3MPGA 1XUZA 1KBJA 1FXQA 2E8YA 1EDGA 1BTCA 3VKDA 3N1AA 1E56A 1F6KA 4ZOBA 1EHAA 4C60A 2J62A 4JTIA 5AZ0A 4C6BA 1QT1A 2YXOA 3U5YA 3D47A 5AVHA 2DQWA 2O4QA 3TCSA 3E38A 3AYVA 4NQ1A 2D1ZA 2PDLA 4N9BA 1H3GA 4ERGA 5CH9A 1W3KA 1LYXA 1S1RA 1V6XA 4O57A 3WF4A 4LNYA 4XK2A 3BOXA 4DQWA 3DFPA 4L64A 1NWRA 3FKRA 3WH5A 4IT1A 4YMZA 1LUCB 3AYTA 1MW1A 2CESA 1JULA 2Y63A 3GG0A 1OG6A 1WE5A 4I5UA 2IMRA 3NM1A 5D37A 3TWBA 2YCKX 4DXXA 4E8GA 2GJLA 5G1TA 3LHYA 3BG9A 4Q32A 4M29A 1Q66A 1E0VA 1UW9A 2WV8A 1T8QA 3ARPA 3L4YA 3OVPA 1W32A 2VCBA 4G1KA 3VABA 5A3HA 3K30A 4K39A 3RO6A 3MA8A 2O0TA 3L0KA 4PMRA 2IKJA 2FPTA 1XM3A 4KWSA 4IPPA 3H2OA 4CCEA 3BPWA 3IGSA 2HCVA 3B0UX 3NYZA 1U5VA 2XYLA 1WZAA 3PVFA 1R2RA 5CLWA 1ZFJA 3R94A 3Q65A 5CBJA 3M0HA 3QSTA 3K8MA 4LUSA 4AC1X 1W3IA 2QEZA 4MJ2A 1KGXA 4IMFA 2KZHA 1A5BA 1U22A 2CXEA 1A80A 1FWNA 1CB7B 2OJPA 1V6VA 2F7FA 5FF7A 2DDXA 3ISIX 5JUVA 2E25A 4LALA 2JQXA 2JFEX 2BY0A 4LF2A 1UIOA 1TELA 2YA2A 5JQ9A 3B4UA 1Z42A 4R33A 4DEFA 4D71A 1EDQA 2BGNE 1KRBC 3T09A 1ITCA 2X1IA 4GUFA 1KTCA 1IE7C 1ITXA 4OIFA 4G56A 4UOZA 1H09A 4AX7A 2ZIDA 3HG2A 3L21A 2SFPA 3I7QA 3CL7A 4GNVA 1F07A 1JDFA 4I9JA 2V9DA 1HTIA 4UZUA 3GXNA 1OF6A 1W91A 3HGOA 1KFWA 3SN1A 3VGHA 3QYSA 1KR0A 3NZRA 4HP5A 3AXHA 1KQYA 1UR4A 3EAUA 3LMZA 1KKOA 1GQIA 3RYSA 4IMCA 2PUZA 4XVDA 1N82A 1R9YA 3NQ6A 5HANA 1YPXA 2HXTA 2HEJA 3L0NA 3L12A 2PWHA 2YX0A 4AH7A 4I6KA 3POCA 4FS9A 2VUYA 4Q7IA 1UZDA 3B9AA 1IXPA 2E6AA 1DPMA 4YTSA 4DUXA 1IT8A 3S4TA 3WMLA 5BXTA 3IJQA 3S42A 1LLOA 3CYVA 1POKA 2QCCA 4CN1A 2WLZA 2J9ZA 3ALGA 3A12A 2PBOA 4W4QA 2XH4A 3CC1A 3WQ5A 1C8QA 1J0IA 3R12A 1P0NA 4GI4A 4GY1A 4NI3A 5FJJA 1XPGA 1JIBA 3E2VA 3T9PA 5AOUA 3WUEA 3LK6A 4F0LA 4AB4A 3LSCA 3IIZA 1E5JA 4NSBA 3QKEA 3LS9A 4S39A 4HN8A 3ZR5A 2OOFA 1BLIA 1ITQA 3QBUA 1EIXA 3IPWA 4BI6A 4DHGA 3MKKA 1U5JA 1AJ2A 1Y8BA 4GMEA 3BCDA 4ZSTA 4KIRA 3HPZA 4ZXOA 3O15A 1T0OA 4H2CA 2YW4A 3ZXWA 2X0SA 2CBJA 2XPKA 2ABBA 2PZ0A 4JTSA 2Z26A 1XRTA 4JCMA 4D6IA 2QCMA 2NUXA 3VNJA 3UA3A 4Q6JA 1J01A 4GI8A 4JFVA 4CD6A 2JF7A 5EY5A 1FDJA 1S5VA 4AXNA 3R58A 5D2XA 3YPIA 4N6FA 3VE9A 1KXVA 2PA6A 4Q4KA 4C6MA 2TODA 3KWSA 1ZBVA 1LWJA 3VFLA 3P0XA 5FEXA 3O63A 2WCSA 3WD3A 4UMBA 5A6BA 3O8AA 2P1FA 4FXFA 3GH4A 4EPDC 3HFYA 1EQPA 5IXEA 1RP9A 4L1WA 4JTTA 4DXKA 2CZ5A 2WHLA 1I2RA 1QDSA 4WY0B 2ABAA 4UWMA 3ABZA 1TZ9A 5D8WA 1E6QM 3MZ2A 1DV7A 3KDOA 1EOKA 4YWIA 3WK3A 2VM8A 4CUCA 3PUEA 4B5NA 4AY8A 2WMKA 2WQDA 5BCAA 2XVLA 1ZALA 1QNSA 3VILA 2A3BA 3HPFA 5AC5A 3DECA 4WUIA 3GHUA 3C3UA 1ZTVA 4JQ1A 3WNPA 3EXTA 4LVAA 2AL1A 5M5DA 2WVVA 4EANA 3KBNA 2NX1A 1V02E 4Q8OA 4L4LA 4LUTA 3ZT6A 3H6OA 4P61A 2XM2A 1JXKA 3VNZA 3GRIA 3BQ6A 4WQ6A 2IW0A 4HYWA 4J40A 3CZLA 3E5PA 2GPTA 4HMEA 4JFWA 2E1DA 1R9XA 3W7GA 5FD0A 2VEPA 3QW3A 4URIA 1E51A 3EKZA 3TN5A 3N2MA 1QI0A 5CJ5A 2WC4A 3M1ZA 3LV5A 5FAGA 1EC7A 4O8AA 2WWDA 3SY8A 1DJIA 2JIWA 1XWYA 4LRTA 1A4LA 1D2KA 2QDDA 2OLHA 3ID7A 4GX9A 5U7SA 2GUUA 2WMGA 4P7OA 5LHEA 7XIMA 5I23A 1EXPA 2XG9A 1M5WA 3IJ7A 4IL0A 3OIXA 1H5VA 5HQLA 1H2JA 3H22A 1A0EA 3STEA 5LSMA 2BFGA 3LZ3A 5LNRA 3QHMA 4PTXA 1OFRA 2D2OA 5HMSA 3T6CA 2PCQA 2TRSA 1EZ2A 2Z00A 2TSYA 6CGTA 3RF9A 4BCEA 3PPGA 3E0WA 3UA4A 2PU0A 3CUGA 1VFMA 4S2CA 2GUBA 1M7JA 1TRDA 4WX2A 3MMWA 3M4HA 3LNPA 1F4HA 1UP2A 4WXYA 1E72M 3NFUA 4Q8PA 2QUTA 3MHUA 2DU2A 4AHPA 4DNMA 3RRAA 3TOPA 1WDRA 4ZBCA 1OFBA 2PGFA 1DHPA 3VKCA 5G2WA 3GDRA 1QCWA 2WJDA 3VM5A 3ENLA 4UMCA 3HGRA 1EL3A 3E0IA 2J7CA 3OLIA 2Z7KA 1XYLA 3LU2A 4WXZA 3P5YA 3Q58A 1UD8A 1F73A 2HDJA 1GONA 4BEUA 4M80A 5AECA 5T26A 2WMIA 2AMXA 3PFMA 2GJXA 3GXDA 5BRBA 2OKOA 4TX6A 4GH3A 4GUGA 1JCYA 3R8RA 1PCWA 3NAVA 4R3UA 4A3UA 2Z1KA 3SFKA 2OFJA 3V0SA 1M68A 1OGBA 1Q6FA 1TREA 2V5KA 4PCPA 3E1F1 1FCVA 4L4OA 2FVLA 3AS2A 3W85A 3PFRA 4X9SA 4RX0A 2X8RA 4W86A 4MDPA 4RDVA 1AA1B 3W84A 2ISDA 3BSMA 1U1HA 3DDMA 4PFMA 4DBWA 3Q67A 2Q09A 3NCOA 5IFTA 2ZC8A 4HNVA 3TXZA 3EOEA 4NNAA 4NRRA 2A6LA 1VFUA 5H8MA 3T78A 2X1SA 4FLOA 3TDFA 3R8GA 1KB3A 1Y5VA 3LZ5A 3DHUA 3WLJA 4IMDA 3UF9A 1KLYA 2G4JA 4HU4A 2VFIA 4PBFA 1IT0A 4KPLA 3G18A 1OG0A 4LBUA 1XD1A 2CBUA 3ABSA 4U31A 1AJZA 4WJ8A 1JPIA 3N3MA 1OC6A 3UERA 3VGEA 3AYSA 2E67A 4C1KA 4GFSA 3B0VC 4A35A 1HJSA 1ZAHA 2I5QA 2PDKA 4J3UA 7REQB 1HZYA 4ZOAA 4L80A 2B31A 3DBNA 3U2OA 3OZYA 2PU1A 1J0KA 2ZE3A 3UBPC 5I78A 5CZKA 1PX3A 2Y62A 2PTYA 4ZB5A 2H8XA 3WN6A 4WY0F 1VRDA 3ONBA 1HKIA 1TPB1 1EF3A 2H3DA 1YE4A 2PWUA 2XVNA 2VL4A 4H9YA 1PKLA 4QAIA 4K36A 3M7SA 4YHGA 1JCNA 4W5ZA 3GG1A 4HZMA 5E5CA 4JTGA 1QBBA 3WLHA 2DSUA 3OJGA 3QY7A 2DIJA 1EBGA 3VDAA 3K1DA 4TV5A 4QJ4B 2DW7A 4FX7A 3L66A 4UZSA 2AGKA 4ICMA 1ADOA 1QNRA 3NQVA 3EPOA 1JD9A 4DF1A 3NL2A 3P8JA 2V3EA 4ZXLA 2EKCA 3A5VA 1KLZA 3A4XA 5D2TA 3ZJ8A 4EX4A 4TOQA 2WHKA 3SM0A 3HURA 1XSKA 2XUCA 4JQ4A 1L8PA 2FYMA 4ZO7A 2R24A 3KRSA 3M0YA 3LOTA 1PHWA 2V5DA 3AZRA 4MWAC 4P2VA 3HMCA 3CQKA 3WF3A 1XYBA 1J2WA 4IGSA 3MSGA 3W2NA 5AYBA 2J7HA 3STPA 4LUYA 1LL7A 3B9EA 3CAVA 4C65A 1GK8A 2FTYA 4B5XA 2CHNA 4NZJA 3I68A 1LORA 3VGFA 1D3HA 3KVMA 3IIVA 3ARXA 3IRDA 5F4SA 3HMJG 1XCFA 4G7EA 3VFCA 3LB0A 3VZYA 5CPQA 5CZJA 2NX9A 2ISVA 1VYRA 4PC8A 4MIMA 1PPIA 4RE3A 4IWWA 4YVVA 3RK8A 1WQ5A 2GQ8A 4EXAA 4GI6A 3IVTA 2I57A 3P60A 1XQLA 3OGSA 3QW4B 4UR9A 4ZE5A 1ICPA 4Y9MA 4LSBA 1R3SA 4V2XA 3PUOA 3S5SA 4PULA 1QTWA 3R0DA 1XV8A 4JTKA 1EGVA 4E4UA 3GW0A 4JTEA 2PLMA 3CZJA 3SN0A 4HZ8A 2QS8A 1XYCA 3LXCA 1E73M 1MXGA 1TIWA 1OFPA 4U5KA 5KMYA 3R10A 4J3TA 1TE1A 3EWDA 4HOWA 4NNCA 3OVGA 2PP3A 4ZQPA 4F0RA 1IZKA 3PZVA 2YZRA 3TA9A 5DY3A 1BGGA 1WAWA 2YYUA 3UPBA 2AAMA 4YVXA 4OFCA 3LXAA 4C6FA 1D3CA 2OMAA 4Y8FA 1DWAM 2XIIA 1ONEA 4MNKA 1PO9A 3UZWA 4CU8A 3C2FA 1XYZA 2E5DA 2P76A 4WVXA 2OWWA 1B4EA 4TV6A 5KEZA 2HV5A 2ZZ6A 4M1RA 4GCAA 2HTMA 3PG9A 2RFGA 3PY2A 3AHVA 5AN7A 1RBAA 2O7QA 2A0NA 3TZNA 1FTXA 4DJFA 2B7QA 1XSIA 1O94A 1QWGA 1EJUC 1P5BA 1P0BA 5A6LA 2DSKA 3QSRA 3A3WA 4DVOA 2PLKA 4P7NA 3HA1A 4RNIA 2OZ3A 1Q85A 3BTNA 5HNTA 1IEXA 3CHEA 2NV9A 2HK1A 3TONA 1K3UA 1WP6A 3CHDA 4IFKB 1PWLA 4HYRA 4XV0A 1IR1A 3FEQA 1XUUA 2XZ7A 1RSCA 2OU4A 4LV4A 3TTYA 5EGRA 4AD2A 2H8ZA 2C6QA 4S38A 1TTPA 1P6BA 2OT1A 3I6RA 4H83A 5KTLA 3PANA 4UMAA 1ICQA 1AH4A 4GQGA 3UZYA 4LAOA 3ZJ7A 1CBGA 2Q8LA 3F5LA 3FY1A 4U28A 4EAMA 3PTMA 3SIMA 1A3WA 2BDQA 3DZ1A 3O16A 4PCFA 2VC6A 3QTGA 3W7KA 2YXXA 9CGTA 4IP7A 1PUDA 3M46A 4A8IA 3WD2A 4CNNA 1ZBKA 4IZGA 1M04A 4REQB 5DMMA 4AXKA 1VBRA 2QMJA 4AZIA 1R3TA 1IGWA 5HNNA 3PM6A 3BE7A 3MMUA 1KA9F 3OLEA 3RX3A 2VD9A 2JKAA 2OLAA 2OOGA 4HK6A 4OECA 1ISZA 3LRLA 4UC5A 3MI3A 3LCLA 1DKWA 1KBIA 4PRRA 3W53A 2V5JA 3C86A 1EJRC 1QW7A 3G1SA 5XIMA 3F7JA 3ABXA 4TMCA 1HQTA 2HPIA 4B2DD 5LXEA 4XZHA 3SGGA 4DBSA 2C1HA 5GNYA 1KM4A 2OODA 1IEVA 3WNKA 3TW9A 3EZ4A 3K13A 3PUDA 4Z2IA 1UPPA 3MMDA 2FMOA 4RLIA 1IQ8A 1O1HA 3KBJA 2V63A 3K2GA 3PPHA 5MKGB 3R1ZA 2EPNA 2X1TA 1E3XA 4D6FA 3CL8A 3V5FA 4KCWA 4BHYA 4DXVA 2WM0A 5M1TA 4P8VA 1XR2A 4FX8A 4D8AA 3NDYA 4MJ4A 2VEIA 3GKFA 3RCMA 2VQTA 4BWLA 3NL5A 1B3WA 4G5DA 1SQ7A 1JYWA 2EG8A 4KWOA 3JRKA 3OLDA 1LRTA 3XISA 4DBUA 4DO6A 4WJXA 3IK4A 4CD4A 1VH7A 3O7UA 3UQNA 3N2BA 1SR9A 1GZGA 4Y9OA 1O5QA 2A7PA 4J3SA 1DJXA 2D73A 4UQEA 5D2YA 2XWEA 1IXNA 1LL6A 5TNVA 3CYJA 3ITVA 4YTTA 3W83A 1UQYA 5JVLA 2DZBA 3ES7A 1H60A 1GKRA 1AW1A 2J7GA 1F6YA 1P1XA 8TIMA 2ZVRA 3BVJA 3NXFA 4KT2A 2J9XA 3CPUA 3BQ5A 4GC4A 1R2SA 1K6WA 2ZKMX 4NUWA 3UR7A 1BSLA 1DTUA 1YRRA 5A6AA 4FZIA 1HL8A 3WLNA 2VX7A 4BR1A 4K8HA 1Q45A 1YBQA 3IARA 3M7WA 3GC2A 4HU3A 6TIMA 5I77A 1C7SA 2G3NA 1Z48A 1I6NA 3FCPA 4RV8A 1E6NA 3SCVA 4IMAA 4XAYA 3TLLA 2D24A 5C70A 2CBVA 2V3DA 4I90A 2ZZ4A 1W56A 4NJIA 1Z32X 4O4VA 2IKIA 1UH4A 3U2ZA 1K4GA 4RCXA 1I2PA 3IUHA 2RGLA 3OZOA 1FWSA 3GIYA 4LVBA 5A8GA 2NVDA 1A5MC 2D0HA 2IXVA 1J5SA 2OO6A 4MOZA 1JZ6A 2OSXA 3Q37A 3HPXA 3P80A 1POJA 4HGXA 3N6QA 5JBEA 3KTSA 1I0DA 3LTPA 4RPPA 3P8IA 4GGHA 3QZEA 1QHPA 4W93A 1AQMA 3MI6A 3MSYA 3P0WA 3CUJA 3NQCA 4DJFC 1M6JA 1E9LA 4PTVA 3PS7A 3CHFA 4XD5A 3CLWA 4DAFA 1OBAA 3HG3A 1I9CB 4QHRA 3KVJA 4E0CA 4QS6A 3PNZA 8A3HA 2X16A 3HFTA 2R91A 2CC0A 1QAPA 3GQYA 4WK9A 3UFYA 3CV6A 4PCSA 4ZO6A 2D2HA 3WCZA 3SJ3A 3BLPX 3KZPA 3CEPA 1UASA 1UC5A 2F6UA 1XHGA 3N4EA 4OV9A 5HNUA 1VBHA 4ORMA 3RG6A 2VX5A 3M9YA 1LROA 3AHXA 2WANA 1T7LA 4XKYA 2WJEA 4J2PA 1RLCL 3AIEA 4DYKA 1W1PA 5I0DA 5FSEC 1Z6KA 1E0TA 2EPOA 3A9IA 3ABQA 4XBSA 1CXEA 1CPUA 3EX4A 3VI2A 1CNVA 3PWGA 3LI0A 3D3AA 3S6TA 1QI5A 1LT7A 3IAQA 4DJDA 4JHOA 4F40A 2EHHA 3SFWA 1H7RA 4LYPA 4LVGA 3PBUA 2J7DA 3DYMA 1VYSX 2FMNA 4HHPA 2CETA 5I3JA 2PWVA 4NY2A 3WJXA 4FNUA 1LP6A 3W82A 2J7EA 4U4MA 5F7UA 4ZB0A 3IUIA 3GU1A 3FJLA 1VYPX 4JIHA 4UTFA 3ZOAA 2YCIX 2J8FA 3HOJA 2OPJA 3BJFA 4H19A 2QAFA 4UTMA 4XD3A 3LM7A 1FHUA 2DY3A 1EO5A 5LA2A 1YIXA 3IIOA 3UJEA 3W1PA 1LZOA 4ZA0A 5C2CA 2R1KA 2G0WA 2Y1HA 3H53A 4MNMA 1JDCA 3LQLA 3B0XA 3C61A 2W9MA 2EQDA 3ABRA 1NWUA 1HW6A 3MTWA 4MB5A 2A2IA 1G0CA 3S0CA 3UWYA 4Z2GA 3M0KA 5D9NA 1QASA 1FKWA 1UUOA 4JL2A 2XSAA 3CUXA 3MO7A 5JBDA 4HCDA 4Q3MA 3CZ8A 4Z1YA 1SO4A 4XBJA 4UQDA 3RM8A 5HWNA 3WQDA 4MSSA 4KBXA 3VD7A 4BWLC 4E6MA 3MWAA 3U0HA 1H5YA 1F3TA 2CERA 2E6YA 3LHVA 4JTUA 2XHYA 1UG6A 1UP3A 1GVYA 4RDZA 3OHIA 3GVRA 1UC4A 2ZTKA 5TIMA 3FAWA 1E6ZA 1N2VA 1J79A 8XIMA 1FP9A 1OB0A 3P7YA 3V7PA 2YFOA 4EF8A 1KTNA 4AMCA 3VMOA 5AYYA 4DI8A 1QNOA 4FR1A 3VX1A 4ATWA 2YB1A 2ALDA 4LS1A 3PUGA 1WXZA 3RX4A 4MJZA 2FHBA 4LCQA 1LWIA 4OJYA 1ZCOA 3HJZA 2GK1A 4DO7A 1I2QA 3HGJA 3W7CA 1VKFA 1WKDA 2QJMA 5CGQA 4PCTA 1CGUA 3UG4A 2HSAA 2QXWA 4AD5A 1VFOA 2VT0A 4QAWA 4FR6A 3E2QA 3KCJA 4G2DA 4LS2A 1JI2A 3A3HA 1UH2A 1CGWA 1RVKA 2YDRA 1DQWA 2BHZA 3FLUA 4IHCA 1JD7A 3SSJA 5BU9A 3M47A 3MP5A 1TV8A 1X97A 2Z1BA 2XIBA 1J11A 3UXLA 2YDAA 2ZUSA 3MP4A 2WKLA 1QOQA 4JTAA 5DELA 2DSVA 1PKMA 8XIAA 3GVVA 3EYPA 4L65A 1UWUA 3B8UA 3VD3A 1DE6A 1QI3A 3S1UA 3HG5A 4GJIA 2W91A 4LW7A 4PTWA 2PEVA 3GDLA 4IJBA 2G97A 2NQ5A 1N8IA 3U2CA 2PTWA 4CQCA 1FWJC 4HD5A 2VR2A 4F9DA 1PX8A 3UWQA 1TE6A 2VZSA 4CNPA 1VB9A 4I7VA 5C0QA 1PDYA 4B5UA 3P61A 1RK6A 2ZUWA 4QNWA 4YCOA 4Y9NA 1Q7QA 4KQNA 3LN3A 1YDYA 5T8GA 1J10A 3G22A 1JAEA 1QWKA 3NQ2A 4MPKA 1XSJA 3G8RA 4YVPA 1BSIA 3SUSA 3URQA 3IACA 2PGEA 3BZGA 1IYXA 2X42A 2DZWA 3ECQA 3SGUA 1X8FA 1RPXA 1CW2A 2W3ZA 4FNSA 1BD0A 1X7FA 1PEZA 3RDKA 2RUSA 1TWZA 5F2LA 5FJPA 2TPSA 1NDYA 1ZPTA 3GFXA 5J5RA 1NQKA 3UG5A 2F8QA 3VCRA 3PZ9A 4H8UA 4HMDA 2EGZA 3U7VA 2VDIA 4HJWA 3TN6A 5ABFB 1E43A 3F4WA 2YGYA 1UP0A 2QPXA 2Z1VA 3QHOA 5KETA 2VO5A 1WA3A 2QGYA 5EMKA 1Q65A 1XISA 3VNLA 3VIPA 3SADA 2PDJA 5IHRA 5CSRA 1E9ZB 3W9ZA 3ZT5A 2V30A 1FWFC 2PTDA 2IQ0A 1FXPA 5F2GA 2Y6ZA 3F5KA 9RUBA 5LGZA 2JBMA 2IXUA 4NJKA 4ROQA 1AD1A 1XLJA 4AZ5A 5FAJA 3H24A 1C8YA 2J66A 2NVAA 3S5OA 4JAWA 2VFGA 2BY3A 4B91A 1KR1A 2FZ9A 1U1JA 2P88A 4DJDC 4O13A 1JI1A 2JEQA 5HQEA 4XB3A 3ZR6A 1OFEA 5L6UA 4CD5A 3L4VA 1UJQA 4OT7A 5FEPA 2WC3A 3H2EA 4LB4A 4P7RA 2G3IA 2PCEA 1JYNA 1GQLA 2V0TA 3W25A 2QCLA 1U30A 5LZLA 2VGFA 4NYUA 4QEHA 3HV8A 1ADDA 4N42A 2CU0A 4AZGA 2QAPA 2G41A 1KFJA 3HB9A 4NXSA 2QULA 4KKXA 2BNJA 3NQMA 1QI4A 3K8LA 1H62A 1T8XA 2DW6A 3EWBX 2DZTA 2F61A 4WJEA 3BLOA 1SUXA 4CCCA 5E9AA 3PPFA 2CPUA 1TMQA 3K1GA 4C6DA 3IRSA 3VKAA 3URAA 2QUVA 5C5YA 4PUUA 1HJQA 1RJRA 1MXSA 1JRCA 4CU7A 4WDUA 2DZUA 2YA1A 2JKPA 1E70M 1CX9A 1B3OA 3NQ8A 2GQAA 1BF6A 2FKPA 3VOFA 4Y9PA 3UXDA 3G3DA 3QR1A 1EEPA 4JFSA 5A8MA 4HIBA 1JUKA 3N73A 4HHMA 3FNDA 1XG4A 1PZ2A 4IPJA 5E6YA 4DUWA 1NOWA 3B0PA 3BAJA 4J5NA 5LIWX 1XIFA 3L4UA 3N14A 3VIIA 5F4WA 3BC9A 3P84A 4MNJA 2ZX6A 2C15A 5C2GA 4MY9A 4NZFA 3BURA 2GSEA 2X0YA 1A50A 3QMTA 4Q4OA 2XGBA 1H7NA 3R6IA 3UXIA 2VYOA 1B4KA 3V18A 1VCGA 1LG2A 3BV4A 4N4QA 1SZEA 2V38A 4N6EA 3BARA 3E12A 5G5IA 1DP0A 1MSSA 1ENUA 3UY8A 2W6RA 3GUWA 1F7BA 4H7ZA 4UTHA 2QCDA 4I9MA 3USBA 1UOZA 2J25A 1GOKA 4MMWA 5KZ6A 4GPNA 3WMCA 1EO7A 1UWIA 2E6DA 2J47A 4JX6A 2CXGA 1PS9A 3W00A 5D09A 1Z8AA 4JTDA 4PMNA 2CBIA 1QNQA 3AHYA 5CSYA 2ZVIA 3LCWA 1R6WA 1ML1A 1CLKA 5C7VA 4GRSA 3LQGA 2JEPA 3OU8A 3W29A 1ZS2A 1ZENA 1K8XA 3BMXA 3S6OA 4UXDA 2PWGA 3FN9A 1XRSA 5HINA 4GXMA 1XIMA 3ZWTA 3D3FA 3C5QA 4NZ1A 5EFDA 4YL2A 2BGQA 2VR4A 3NZGA 2DZVA 1PZ0A 2ZRWA 3WNOA 4M56A 4OVXA 2ZUTA 4ML9A 3AUJA 2VGIA 5EYWA 1OCNA 3LHWA 1A5LC 2ICSA 1HJWA 2ZADA 1QK0A 2BS9A 1HL9A 1P6CA 1B31A 5CZ0A 2PWDA 4LWWA 3GG8A 5HPOA 1JZ8A 4UQBA 4Q4MA 1XYMA 4B90A 2J8GA 1Q2SA 2IQDA 4GNKB 2IPJA 4D6HA 3LTYA 3ZFHA 3W2MA 1EUAA 3WO8A 1GJPA 2W0UA 4F9JA 4LUSB 4HSHA 3A4AA 4AU0A 1XLEA 5U4NA 3F4VA 3N9SA 1GOMA 4XG1A 3TU9A 2FZMA 3VNKA 1RR2A 1MW3A 2WMHA 2EXOA 2J7FA 4S3CA 4QIUA 3AS3A 3PTQA 1TPEA 1LT8A 5FESA 3SAZA 2O7SA 2PDIA 2WZIA 3BGAA 1ZBCA 1OT2A 2DZAA 4XBKA 2F38A 3NIYA 3D46A 3UG8A 3NZPA 3SURA 1VPQA 2DSZA 1W5MA 3CXOA 3DG6A 4V28A 1OK6A 5CBBA 3A5FA 4W8LA 1VAHA 5FI8A 1FFQA 4ZB2A 2CWNA 4AD1A 1VJIA 1Q6EA 3TUUA 4PUMA 2NT1A 3NQEA 3WFLA 5HPCA 2XVPA 4EAYA 1W9VA 3FOKA 1XRFA 2BMBA 4BS0A 1KBLA 1MEIA 5BMWA 2FZNA 2HROA 3GIPA 5E6ZA 1Z69A 3UJRA 4GIAA 2Q02A 3CV1A 4K2SA 3KCLA 2OEMA 5D05A 3UCDA 1EJWC 1ZQ5A 1GGOA 2PD9A 3W73A 5AYIA 2GOUA 2DT0A 1Z89A 4JEQA 3I7RA 5JH2A 3GDMA 1XI3A 1XD0A 4N2YA 3IJ6A 3CGTA 2GYIA 4YLWA 2OWCA 1WXJA 2J4GA 4MZYA 2A7NA 3BANA 2I9EA 1PVNA 3EPMA 3LUTA 4JIEA 5AKQA 1MUCA 1J0JA 4NJJA 4PZVA 2ZA1A 2ZCGA 4QLLA 7TAAA 3NURA 3QGKC 4EWJA 1F8MA 4L1GA 4CQ9A 1DIDA 1R7OA 3F2CA 3MJYA 4NZ3A 1W3HA 3EEZA 4JNYA 3DENA 3ZWSA 2PFHA 3SCUA 1IV8A 2ZRYA 3S5YA 1UMYA 2DH2A 1FH9A 2QQ6A 3EMQA 2NQJA 3N2TA 5CC7A 1ODUA 3ANVA 1DTNA 3VA8A 1GJWA 5BXSA 4JL1A 4CD8A 3GH5A 2F2KA 3W7HA 4K1WA 2Y70A 4WCJA 4JCLA 3SRDA 4C6KA 4HNTA 5DMYA 5I00A 3G5EA 1EH9A 5F2MA 3KTCA 4GNJA 5FA5A 3HQNA 4O11A 1DEDA 1IWPA 1CYGA 3H7VA 1JDDA 3V1HA 5ECVA 3UCCA 3M44A 3HG4A 2HNEA 3T05A 3BW2A 3CIXA 4KH2A 3WL0A 4N9CA 3EX1A 2OX1A 4H9MA 3QV7A 4BZYA 3RLGA 4HJFA 1S46A 3FAXA 3QZAA 3ABOA 2EF9A 1N55A 3GXPA 4S1FA 3WQCA 1DJNA 3MT1A 2QDHA 4JKLA 2XH2A 3IJDA 3W2UA 2UY5A 4P8UA 5FJUA 3WQFA 4DWSA 5IHSA 3GU9A 3DN5A 4PMVA 3BLFA 1RY8A 2ZX7A 4EPEC 1W6TA 4FXJA 3QV9A 1VIZA 2J6VA 1YXCA 5CG0A 5JH1A 1UQZA 3WK2A 2E1WA 1JCJA 3RITA 2OKTA 2DEPA 3UW6A 5CSUA 4F8XA 1LG1A 1EKOA 3KL3A 2YDSA 3CB3A 1JR1A 2CIPA 4H04A 1Q6LA 2YBUA 1AQFA 2YIHA 3KOWA 4JX4A 3GBDA 3WUGA 3F2BA 4EVZA 3W7IA 1KGWA 1T99A 4U10A 5DT7A 1WDQA 4UTTC 1V77A 1PIFA 3A4WA 2G4FA 3KRUA 4JQ3A 2WVVB 4XO7A 3PZIA 1H51A 1RCOB 4S2BA 2WJFA 1CWYA 4XKMA 1ONXA 2UZ9A 1TPDA 4LUTB 2ATSA 2J75A 4LQ1A 2XSBA 1YEYA 3FX4A 1ISWA 2QJHA 4HHLA 3T40A 3A47A 1QPRA 1NWTA 2E9LA 4WD0A 4A29A 1KBBA 4BQ4A 1FRBA 3T4WA 4Z0JA 4QCEA 3V0UA 1QU4A 5J04A 5LA1A 1IEWA 1B3YA 4MB1A 2YKKA 3VVGA 1GOOA 3O1NA 3UZZA 3R4IA 2F2HA 3JR2A 4XD6A 3G8EA 3KWXA 3I3DA 1RA5A 1DJQA 3SQLA 4DUOA 1CEOA 3NPWA 3JZUA 1LOLA 2DJXA 3OVRA 1E6PA 1SFSA 1WKYA 4S3DA 1BQCA 3TYEA 3HQPA 2BXVA 1K6AA 3UR2A 5A95A 2FGBA 4K6AA 4WHBA 1Q6CA 2DGAA 4CQBA 4UIOA 1KBKA 1PBGA 1I2NA 1GW1A 4IG2A 1WDWA 3TJIA 2FDMA 5BRPA 1A3HA 7CGTA 3G1RA 4PMZA 3FA5A 5EBAA 1WDSA 3THCA 4Q8MA 2PP0A 4C5YA 3UR5A 1HKJA 1XW8A 3XIMA 5B7ZA 1E4MM 1X6UA 1F4AA 4DPQA 2QIIA 4GXPA 4DO5A 1CECA 1XDJA 5GNZA 1HJVA 4WR3A 4JEJA 4R53A 3SRHA 3PTKA 4FF5A 2BTMA 3AHZA 1GG1A 3BLIA 3AZSA 2D20A 1KM2A 1TMHA 2NUYA 3G77A 2QUMA 1XIIA 1XPYA 4YU1A 1BG4A 1OX4A 1MDRA 3OO2A 4OWGA 3EB2A 2WZHA 3FYYA 1V3LA 3TMLA 4WGHA 3AIVA 3ONCA 4MYXA 4L1XA 2ZA2A 1UKQA 1RCQA 3L5AA 3EKGA 2QR6A 3MO4A 3M6YA 5K3VA 2Z25A 1GNXA 4ASTA 2P0OA 2DVTA 1GVSA 1CGXA 1YHTA 2QF7A 4HPHA 4GK8A 3GNRA 2PD5A 3CZEA 1QRQA 1FWAC 1KFCA 4QSHA 3MVTA 4E4FA 1XDMA 4ECLA 5F4XA 3WNMA 3HM7A 5DBUA 2WMIB 4B5VA 4H8VA 3AZTA 1AH3A 1YDOA 2GJXB 3DFNA 2XIMA 3OYXA 1VFHA 3MSDA 1CB2A 1FP8A 4JGDA 4MLRA 4RW5A 5CAHA 2B0MA 2PLJA 2FFCA 1ZAIA 2OG9A 1GCYA 3AXMA 3O9NA 3ATZA 4JQ2A 3AXKA 3W1UA 1GHSA 1XGZA 4W85A 1TFVA 1W2PA 3W2JA 2WSPA 4XZ9A 4MYAA 1UKOA 2DUAA 4Q8WA 1WKFA 4CCDA 2Y61A 2RKXA 4HK7A 5H91A 5A94A 3LD5A 5AYZA 4Z2JA 2GGEA 1QPOA 1R2TA 1S2UA 3UZ5A 3ZLFA 1P0EA 3BJTA 4GXWA 2PDPA 1AZ2A 2A21A 2VDGA 1H49A 3HZ3A 4Z1BA 3H2FA 5E0FA 1W31A 1Q7ZA 4M8UA 1BKSA 3AYRA 1O5KA 1FKXA 3TFXA 4GUIA 1NIUA 4RXGA 2GVGA 3LBOA 3JS3A 1OFOA 4O53A 2RHGA 3OPSA 4ADSA 3OHMB 2PGRA 1YADA 3B8VA 2OYLA 4MLJA 4QGCA 4JYDA 1E1FA 2VNCA 1JEZA 1DHKA 1V6YA 3LCGA 1D7KA 2WSRA 1LOQA 2C19A 1UR0A 2YSWA 1UHVA 4DWSC 1XBZA 1YPFA 4AZHA 3ZQ9A 4CGTA 4RDYA 4UTIA 1UH3A 3BUVA 5FKYA 4EP8C 1W37A 5FF3A 2C14A 4IPNB 1V51A 3QVQA 4WOQA 3SCNA 1VFSA 4CNOA 4EKJA 1PIGA 2VEMA 2BP1A 1R38A 2Y8KA 2BOFX 4KCUA 3AICA 4XZBA 3UZXA 4FO4A 3KOYA 1LRNA 4HNCA 4D9PA 3W7QA 2R94A 1ISVA 2E4TA 4GWEA 2YR1A 2YW3A 3KLLA 3GTXA 4PUEA 3U5UA 4NT0A 3IJ8A 3DFSA 4JKKA 3KEHA 3RR1A 5M2FX 1KKRA 2L5HA 5EMMA 2X0HA 1KFBA 2PSNA 3SY1A 2OX4A 1FCQA 2A3CA 1B90A 3FJ6A 3Q2DA 2C79A 3KW3A 2CLLA 3LMYA 3UNTA 2ZX9A 3UD6A 5C9UA 2FLIA 2GDQA 3KOXA 2OQHA 3E2RA 3TYCA 2OQYA 4F0SA 3W87A 4Y8EA 1GJUA 3DI1A 1HVXA 4UFJA 3WLOA 5TF0A 2BHUA 1W9XA 4DZAA 2WC7A 4OKDA 4ZO8A 3FFSA 4HZ6A 3OQEA 3CQ0A 2XIJA 3W1RA 5HAOA 3OGVA 5G1MA 3DU0A 4ZTXA 1HGYA 2J78A 3DHPA 3E3HA 1ZY9A 3BG5A 4GX8A 3W2KA 3UPMA 2FGLA 4D72A 4UFKA 1JCLA 1EJ7L 1UKTA 4JXCA 1KRCC 3W7DA 3MW7A 4XAFA 2NWSA 1Q6GA 3RPDA 3TW6A 1OYBA 3W1TA 4JICA 3MB9A 5BOFA 1BHGA 4ERIA 2RDUA 3I4KA 3OYZA 3UJ2A 1NFPA 1OT1A 3CPGA 4G7EB 1JJKA 1A3XA 4ZQMA 1K70A 3UXKA 4PSPA 4JNZA 3EB3A 3SQMA 1YTEA 4PRWA 3ITYA 4PTNA 3L2LA 3WDQA 4JTFA 4Q33A 4H7VA 1VZWA 6TAAA 3S6DA 4O28A 4B3ZA 1TPFA 1VS1A 1EGMA 1VR6A 1SZNA 5C54A 4NIRA 3GDBA 1TMLA 4GC3A 3FK4A 3QGVA 4RDWA 2WVTA 1ZRQA 2P50A 3QLLA 1F8IA 3WKZA 2J74A 2PC4A 2PURA 3C2RA 4F0HA 5IFPA 1UD4A 2W66A 1S2VA 3I6TA 4JPGA 2CLKA 1G7UA 3CWOX 4ZSUA 1K1DA 4DPPA 4HU0A 1F3EA 1LQ0A 3H12A 3K8KA 3RGTA 3LTSA 4EXBA 3UR8A 3N2XA 1W1A1 2CLIA 3WDIA 4JDBA 1ME7A 2A4AA 3MHGA 5CAKA 1EJXC 3AIRA 3VOIA 3URBA 2ZRXA 2O4MA 4X63A 3SUWA 1O5XA 1G5AA 4F4RA 4B2DA 4WKFA 1UKSA 1EP2A 2E9BA 4B5TA 4PBGA 2BY2A 4JN6A 3VCCA 3B06A 1IEIA 2FFIA 4PMJA 1RQBA 3FEMA 3CL6A 1XICA 4CLMA 4GBDA 2VUNA 2OWXA 3PG8A 1V8EA 3A13A 4LEFA 4TUFA 3PJUA 3GK0A 4XSMA 3EXSA 4LXFA 1V4YA 3L0GA 4B3LA 4IQJA 4AZCA 1VEOA 3BAKA 6ALDA 1RQHA 2XINA 3DGRA 4OUEA 5CPSA 1C7TA 2GGIA 1QXLA 4RNHA 4AC7C 2CHRA 2V69A 3E0FA 3H54A 2WK2A 5CJNA 1A5OC 2Z27A 3VPLA 1RY0A 4YNGA 1LCOA 5C7HA 4R5EA 1HKVA 3PBWA 3TFCA 1CDGA 4D6GA 1MUMA 4ZOEA 1SVDA 1O7AA 1W2VA 1E4IA 4ROPA 3MYPA 4LANA 4KFOA 4DI9A 1AQHA 1JZ5A 4MF4A 2I16A 1FWEC 3S9IA 4CKQA 3HN3A 4GD0A 2X7VA 1HP5A 1K02A 1EJVC 4UCGA 3SY5A 1P6WA 4HB7A 2GGJA 1YXDA 2QCEA 3MHFA 3UGRA 4GABA 1LRQA 4A8RA 4DY1A 3VU2A 3COTA 4HNLA 4AZBA 1YNQA 1NP2A 1VFTA 3N17A 4B4FA 2TYSA 2WXDM 2EJAA 3LRMA 1C3FA 3KS5A 1G01A 1H7WA 2CKSA 4HPJA 3FSTA 4GQRA 1KM6A 5K9DA 5A69A 3LCXA 1XS2A 3M5XA 2WKGA 4R9XA 5D2WA 2OXNA 2PWEA 3ZIZA 3N25A 3GDTA 2V82A 1X38A 3LRKA 4D1IA 4L56A 4JS3A 3EGJA 5LA0A 4PA8A 4HNUA 3UESA 2XN2A 2E40A 4HVXA 1OIMA 4AF0A 1IEQA 2OR2A 1AG1O 2NT0A 3W74A 3PBYA 4M7TA 4GYJA 4WF7A 4XWUA 1KCZA 3BGGA 2BY1A 4S3JA 3T42A 2J77A 3PJWA 2A5HA 1P0KA 2DSWA 2WSKA 2P3EA 3SCTA 4CVUA 3VAVA 4RZ4A 3RLVA 3VGBA 4PTDA 4FB7A 5C6MA 4WOZA 2WPGA 1V3KA 3OEXA 4OOZA 4Y9AA 1TG7A 3ZLGA 3TROA 4O1BA 4ML4A 4Q6XA 3TVAA 3QRHA 1C93A 2VX6A 3IANA 3WJYA 1RH9A 9XIAA 1C9WA 4K3ZA 4RPQA 1Z7AA 3SN4A 3N15A 2MNRA 2XJ7A 3MVIA 3M43A 1Y5XA 2I14A 1XRVA 5LIYX 4WKAA 2YB4A 2C16A 1DJGA 5DEZA 5KSWA 4OUIA 2ISFA 3LEPA 3MY9A 3LHUA 4QJ5B 4XIAA 1Z3NA 4IQDA 3PZNA 4GYPA 5EU9A 2NSXA 4I7UA 1BWLA 1XIEA 4R9OA 1WZKA 3AU6A 4UR8A 4C6EA 4JTLA 1NVMA 3W75A 1EZWA 2QJNA 2Y85A 3BG3A 3AIWA 4YS1A 4LYQA 3TSMA 3TC7A 2A7RA 1BWVA 2C0HA 2WMFA 4QNEA 1QPNA 1J4EA 1AVAA 2CZDA 3QQ1A 1V7YA 3EX3A 2VXNA 1TV3A 3OBEA 1KCXA 5DMLA 1J93A 4R27A 2DT2A 1OFDA 1F3WA 4M6PA 2EPLX 2BG5A 5A6SA 3P93A 3CAWA 5GJNA 1AD4A 1TV5A 1RP8A 3AO0A 4OBTA 4G1NA 1UIPA 1DIOA 1O4UA 5EB8A 2OB3A 2QJJA 3B97A 5IDZA 4GVIA 3VUSA 3TN4A 5CGTA 4GOAA 4B9YA 4LAUA 1E6SM 4F79A 3KL5A 3RRXA 3MC5A 2AOSA 4BI5A 1L6FA 1YBQB 5T9BG 4P8XA 4ZQOA 1R3WA 3VINA 2J79A 1K9EA 1JGIA 1UR8A 4J3VA 2FJKA 1JFHA 3VDHA 2X1UA 4M6UA 3PAOA 3NPUA 1DIKA 2H9AA 1A5KC 2HISA 4HKPA 4FAMA 2GVJA 3LSBA 4C6IA 4IFRA 3VKJA 1ME8A 4GISA 1KXTA 2GVLA 3NQDA 4S3GA 2YLLA 1FWCC 3WLLA 3GG7A 3MCNA 2ZQ0A 1S3HA 1EJSC 5KINA 2W63A 4QCFA 3D0CA 4ZFCA 4X3ZA 3CO8A 4O1EA 1WYIA 2PTZA 5IBXC 2V5CA 1VF8A 2Z4GA 1L2UA 1E1CA 3K5XA 2VC7A 4PUKA 3S3GA 1XL9A 3WYZA 3CWNA 9XIMA 1Z9AA 1B3ZA 5D9PA 5CC5A 3M07A 2QMKA 5ENLA 2DZPA 2GLKA 6XIAA 1WUFA 2VI0A 3G1HA 1SJBA 2O9PA 1ODZA 7TIMA 2QZRA 1QPKA 4E5TA 3RUBL 2QIWA 3E0VA 4H8NA 3QN3A 4IX0A 3LPPA 1H63A 4ZE4A 1UOKA 1JF6A 3JW7A 1E15A 1KCLA 4C91A 1LOSA 3MANA 4LJ3A 1JNDA 4FPSA 4XZLX 4YXGA 2PDGA 3LNMA 3IV3A 5AZ1A 3ITGA 3L2MA 3VYLA 1H0GA 3TYBA 5AVNA 4XKYB 1VRXA 1WB0A 4GZIA 1EC8A 1VBUA 3BH4A 6REQA 2BB0A 5RUBA 2R82A 1T40A 3V16A 1E0XA 3BAWA 3ZR4A 1KWKA 1RVGA 1BXNA 2R1PA 2D3NA 3UNDA 3I4EA 1I1WA 2BHYA 5EA9A 3ELFA 3DHFA 4ACZB 4GINA 3W7EA 4IJRA 3WMSA 2YFNA 3H4GA 3TEVA 1F5ZA 1X6NA 1TO3A 2DUXA 1W5QA 1PZ3A 4E2VA 3IUDA 5AC4A 3W3OA 1OC5A 1FWHC 5BYWA 4MZ1A 1KD0A 3TW7A 1HFBA 1SMDA 1L0PA 4MWAA 5EL1A 3GNXA 2P3ZA 4W7WA 4F2TA 3W7MA 1T5AA 3L68A 5DQPA 2HK0A 3UU0A 2WHMA 3VD4A 1FOBA 1O60A 3DFOA 3NPXA 3HF3A 1KGUA 4QE1A 1TQJA 3VC5A 1TZ7A 1TX2A 3K4DA 3ANYA 4D6CA 4FXRA 3LHTA 1TV2A 4LB3A 1JAKA 4S3FA 2C8NA 2W5FA 2E0PA 4K38A 4LRSA 4CQAA 5I6SA 1Q6OA 2C0AA 2DH3A 3U48A 3OZPA 1XLBA 3TSDA 3SCPA 5AFDA 5D9OA 1LL4A 4EIVA 4A2RA 2DORA 3G0SA