3W22A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-125
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w22A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w22A01
2C0AA 2WPBA 4K6AA 3SIZA 2QCFA 1ALDA 4O52A 2X16A 3W7RA 1C9DA 2XFWA 4OV9A 5LKYA 2VELA 1DV7A 3NQCA 2E77A 2A0NA 1KTNA 1R2TA 5LNVA 3G1VA 5AHIA 4PEKA 1VGAA 2C15A 3G0SA 3W2LA 2NUWA 1THFD 2ZTKA 5C5YA 3PBVA 4CCDA 1I2OA 1WOAA 2C3ZA 2G95A 3L68A 4BWLC 5LZLA 3C2RA 4PTNA 4HHPA 4DO5A 1VYSX 4M6PA 5DY2A 1R30A 4M6VA 2DJXA 1LOLA 3EEGA 3W2MA 4HNNA 4HIBA 5FF3A 1Q6RA 1WYIA 2F84A 1B3OA 1MO0A 4UFLA 4Z0JA 4AHOA 2FTPA 1PCKA 3DU0A 1I8JA 4UC5A 3TMLA 3SJ3A 1V5XA 3YPIA 1LM1A 4GFSA 4TO8A 2EPHA 4ORIA 2QCMA 1PS9A 1WBHA 2NWSA 5I3HA 5EKYA 1PHWA 2X1UA 3ZWTA 1YYAA 3V1PA 4JN6A 5AYXA 2CZFA 4BWLA 1SUXA 1S5VA 3BLIA 2C13A 2GJLA 1YPIA 5A5WA 3LV5A 1MSSA 5F4XA 1LCOA 3B05A 3S1UA 3QQ1A 3W9ZA 1P0NA 1OYBA 2QCCA 2E09A 2ZRUA 4XUGA 3C6CA 5E0KA 3NPXA 3M44A 3DFPA 1O94A 3HMJG 1SZGA 1TPB1 4CQ8A 1SU5A 5KZDA 5G2IA 2ZQ0A 1JQVA 3LXBA 3LTPA 1WA3A 4H4IA 1L6WA 1IIGA 4MZ8A 4O28A 5C6MA 1EB3A 1WAUA 3PY2A 2B7PA 4BF9A 5G2WA 1SZEA 5DN1A 3T44A 1TPC1 3W88A 5TQLA 5HUPA 1Z42A 1K02A 1XXXA 3LLDA 5LGZA 4JTTA 3RNDA 2ATSA 1F76A 2V2CA 3LCWA 4QSHA 4NJGA 1D3GA 3NPVA 3QSTA 1K8XA 3E49A 3M9YA 3PULA 1LZOA 5H91A 3TJLA 2EHHA 1H7OA 2V5BA 4R33A 3IEBA 1N8FA 5DCDA 4MZ1A 2GVJA 4UMBA 2VENA 1OYCA 5I3JA 4LVGA 1HG3A 3UWWA 3LCFA 3W74A 2ALDA 5CG7A 1GG1A 4Z1CA 4IX0A 1Q6QA 4QITA 3O07A 4GBUA 2A7NA 4O10A 3LTSA 3KVKA 4JTUA 5D03A 2CLHA 1K7EA 3O6YX 3PC0A 5LNSA 4QQ3A 4KWVA 5MHBA 1YLVA 4LS1A 5HINA 4R34A 3W7JA 3CT7A 3PAJA 5AFDA 4JTIA 5AOUA 1LRQA 1EWDA 2V82A 1XM3A 4MYXA 1WX0A 1OFOA 3OG3A 2FQIA 2PE4A 4PC8A 1K8YA 4MKNA 1ME7A 2VOMA 2J9YA 1GWJA 2ZRXA 4IGHA 3QJAA 4GXMA 1ZHAA 3C2VA 1YPFA 4LUJA 1G7VA 1O4UA 2PRMA 1XBXA 3NXFA 3TROA 1EP3A 1WV2A 3ZR4A 4ONVA 4N9CA 3N2XA 3QQ0A 1A5AA 4N4PA 1G69A 3GKFA 2QJGA 4OE7A 3C4UA 1IXPA 3JR2A 5BNKA 2V2HA 1HFBA 4MJZA 3W7DA 4FF7A 4N9EA 3WJYA 1P5BA 1VCVA 3MYPA 2P10A 3H53A 2B4GA 2Z0IA 3PSVA 1QPQA 2VFHA 4EF9A 4JR5A 4UR8A 2QCEA 1W3NA 3FJLA 2FDSA 3TUUA 4IUOA 4RX0A 2WNQA 1H7PA 5FESA 2VFGA 3W2JA 3O6CA 3CLMA 1QMLA 3EX4A 3LERA 4ZQOA 3W87A 4MJMA 3W7QA 1KV8A 1SQ7A 4LWWA 1NF0A 4NJJA 1LTDA 4LS0A 3Q94A 3M0ZA 2WSQA 4HKPA 2E6FA 2GQ9A 5KZEA 3R89A 3LXCA 3CC1A 4ADUA 2RDWA 5K9CA 2WQPA 1XL9A 5FEPA 2E6AA 3N2MA 3P61A 1T0OA 3FS2A 1R46A 1CI1A 1RD5A 3R2GA 3NQ7A 1FUYA 1ZALA 2O7QA 2C6QA 3W7OA 2DZXA 4S2BA 2ISVA 3TQKA 4ZQMA 3SGZA 3KRSA 1MZHA 5CZ0A 3P8JA 2R14A 4O57A 1P1XA 2A21A 2VFEA 4NT0A 3W1QA 3RK8A 3EWYA 2VEKA 3WJSA 1H7WA 3LHWA 1L2UA 5EA9A 2GUUA 1K7FA 3IIOA 3IRDA 3ABQA 3IGSA 3S9YA 1HUVA 1FWTA 4UTWC 4ALDA 1VJIA 3KVMA 3MP3A 3TSMA 2ZA1A 5I3FA 3LGEA 3MJYA 1AW5A 4DQWA 2B7QA 3P62A 4WJEA 1ICSA 3EXSA 3NZRA 5K4ZA 5F1VA 2WOQA 1W5OA 1ZJIA 2I9EA 3T4CA 3DHDA 3VE7A 2Y85A 3NOEA 5D2VA 3G8EA 4RZ6A 4IWWA 1GPWA 1ICPA 3P81A 3UWZA 4UFMA 7TIMA 2JKEA 2B7NA 3MYOA 4D2JA 3UQNA 3CWOX 3GK0A 2H8ZA 4Y90A 2ZZ6A 1QWGA 3C52A 4TMBA 4UTWA 2FPTA 1KTCA 4NJHA 3NA8A 2NZLA 1XDLA 1VLIA 4ML9A 5D09A 3MWAA 5CZSA 4GUGA 2HS8A 3W86A 1A5SA 2DJLA 5EYWA 1U5JA 1KM2A 1YDNA 4QJ1A 1XDMA 3RFAA 3FKRA 3NGJA 2V81A 3W84A 2LLEA 1L6SA 2YR1A 2ZA3A 4U28A 3FLUA 3IIZA 3UWUA 3N9RA 4AHPA 2A5HA 3LCXA 3NL5A 2YXGA 1H5YA 4IJBA 4IMGA 3TSBA 2ZRYA 1BEUA 3S5YA 1LBFA 2RDTA 1OFDA 1N7KA 4K38A 1KBJA 3W7MA 3EKZA 3C8FA 3HG5A 3MP4A 3HQ1A 3EKLA 5D37A 5F1UA 3NPWA 1MEIA 3T40A 4DO4A 1NFBA 1FWWA 4UXDA 4UIOA 1JUBA 3KRUA 5GVJA 2E1DA 3NEVA 4XWUA 4QNEA 4PA8A 1OK4A 5HR7A 3G18A 3C2EA 3TE9A 3LRMA 1ADOA 2Q3OA 1DQWA 4FNSA 5AYYA 1JJKA 2FLIA 1I2QA 2I1OA 2B0MA 3CM4A 3KRZA 2WJZA 1XKYA 1VLWA 3NQFA 5T26A 1R2SA 3FYPA 4C1LA 4O1CA 4UFKA 2AAMA 3P84A 4GUIA 2X2GA 4CNPA 5CPLA 4IXXA 5AHMA 2DZVA 2Z6IA 2O7SA 4EF8A 2ZBTA 3N14A 4Q33A 1GVOA 1SZFA 3VNDA 1SW3A 5CGQA 4CNOA 4E0CA 4OHQA 4WOZA 3I6RA 1VYPX 2QR6A 3UWVA 1X8FA 3W1MA 3RLVA 4N2YA 3IVSA 2ABBA 3CEPA 4M5PA 3O1NA 2NX1A 5IBXC 2Y6ZA 2YFOA 2Y62A 4MOZA 4IXHA 1K8ZA 5EY5A 3KHJA 2QAFA 3PBUA 1AG1O 3TX9A 3DFSA 1RR2A 1W37A 4OQVA 4LTSA 3EWUA 4Y6GA 4JIQA 1W54A 3QMRA 3P7YA 3RMJA 4CNNA 1VHNA 3STCA 4UTKA 1KFJA 1FBAA 4PL1A 3INPA 1MEWA 5A8GA 3NQVA 1WDWA 3FEMA 3WFAA 1KM6A 2PRLA 5FEWA 5LGXA 3W23A 4YCOA 5G2HA 5CSRA 1QR7A 3UY8A 3N3MA 4Y8FA 2XN2A 5IBXA 3I68A 5KZMA 1GEQA 3GXTA 4Z1AA 4NNCA 2H90A 3QYQA 3PUDA 3UZ5A 2J24A 3M5YA 5K9XA 1JQXA 4NNBA 3UWQA 4DEFA 1TV8A 5G5IA 3S8HA 5HULA 3TAKA 1Q6LA 4AH7A 2QUUA 3DKJA 1YTEA 4LRSA 3MHGA 4UFJA 1D3HA 1Z41A 3FJ6A 4L4MA 4DELA 4XTIA 3W7HA 5HQEA 4FO4A 2H3DA 4LV4A 1BTMA 1G7UA 3UWYA 3PG9A 2QDGA 3R5EA 3HO8A 5D02A 1G4TA 1N55A 1QCWA 3LI1A 2HSAA 2A1YA 1LOQA 1FXPA 1CW2A 2NX3A 3MMTA 1FCBA 4MUZA 4IPJA 3NDOA 3PUOA 2ZZ3A 2R94A 1HO4A 3G1SA 2V2DA 2Q8ZA 4ICNA 3QF0A 5G4WA 5I3IA 4GUFA 1O5KA 2BSLA 3B03A 1OVDA 1SO3A 4AWSA 1P4CA 3L66A 5TBOA 3B0VC 2CLFA 4WZHA 2V5LA 2P0OA 3LX9A 4MYAA 4WY0F 2QUVA 1KM3A 3THQA 3LI0A 3VFLA 3GAKA 5LHEA 1UUOA 3DAQA 1LLWA 4FXSA 1E51A 3RLUA 4JS3A 2ZCGA 3DI0A 3FOKA 4J9JA 1S5TA 3EX6A 2Y88A 4BR1A 2OX1A 1QFEA 4DF2A 3W2KA 3WJWA 5G4EA 3WJZA 1JUKA 5J5RA 5FI8A 3MUXA 2NX9A 2HS6A 4UTLA 3W3OA 1FY6A 3NQDA 2QF7A 3L21A 1F6PA 3ABSA 3S5OA 1J5TA 2OCZA 2Y7EA 2J6XA 4ZQRA 2BXVA 3O16A 5CSSA 1XUUA 3V75A 2NXIA 1BWLA 1DKWA 4JDBA 1AK5A 1TV7A 3GZ3A 3W22A 1YXCA 2YDAA 3LHVA 4N02A 1TMHA 3TXZA 4JTFA 5HR6A 5DBTA 3KVLA 1VCFA 3R8RA 3TFCA 3M41A 1G4SA 3U8GA 1X7FA 4HSOA 1DORA 4M19A 4K36A 1KLZA 3FKKA 4ZQCA 3GXNA 3T7VA 6TIMA 4UTJA 3EXTA 2QAPA 2RFGA 3S1XA 5CPMA 2PURA 4RZ4A 3QEZA 1KLYA 2CW6A 3NVTA 3N19B 1IF2A 3NL3A 1VS1A 3EX1A 1DL3A 4FX8A 3LHUA 3O05A 1OK6A 3S1WA 3FA5A 4K8EA 3F4WA 3GAYA 4JGDA 1NEYA 4RXFA 3S6DA 3SR7A 2CLLA 4TR9A 1QPRA 4AWTA 1OF6A 3FYOA 3LV6A 4JY9A 3I7SA 4N6FA 1X6UA 1KFCA 3TNOA 3NPUA 2A85A 4ZQNA 4Y9AA 2CWNA 2PCQA 5F2MA 1XCFA 1A5BA 3CWNA 3QW4B 3R12A 3ANYA 4UTMA 1M7PA 2C19A 5D2TA 4EOUA 4ZL1A 1VZWA 2G96A 5AB3A 4QIUA 1RPXA 2A7PA 3STFA 3EWXA 1TRIA 3R13A 3C2FA 1TJPA 4O8RA 3PVFA 1GJPA 1XC4A 4UTUA 1OFAA 4IMCA 3S1VA 2Y63A 3DXIA 1TTQA 3PBYA 2NUXA 1XBYA 1ME8A 1RQHA 4MIMA 5AHFA 3TXVA 2VC6A 4O0KA 1KFBA 1HTIA 3HG2A 1GVQA 4NX0A 1F2JA 5CPNA 1W3TA 2IQTA 2RDUA 3LCGA 4IMEA 3QC3A 4HNUA 4WX2A 2JBMA 1EWEA 4GUJA 1SW7A 2RHGA 1M7OA 3STEA 4MY9A 1I2NA 3KX6A 3W1NA 3M16A 4I7WA 5FEXA 4TU1A 4X3ZA 1VR6A 3QFEA 1SO6A 4O0ZA 2QCHA 3TFXA 1KM0A 4PL2A 4YL2A 4Z0SA 3OA3A 4LC6A 1SO5A 3NQAA 3QM3A 3WK3A 4O14A 3W1UA 2B7OA 3W7KA 2QJIA 1NVMA 4NXKA 1S3HA 1TJRA 3IGUA 1ZENA 3AJXA 2Y70A 4JYFA 5AC8A 5AHEA 1FCUA 2V8ZA 3ATYA 1SFLA 1IXQA 3G24A 5HWMA 1I45A 3DFTA 3L9CA 4Q4KA 3W2NA 5KSWA 4AB4A 1CX9A 4FX6M 3TR2A 4YLWA 3A24A 5DBUA 3ZS4A 5D05A 5AHNA 2EF9A 1AMKA 1W1ZA 4EVZA 4R53A 4O18A 5EL1A 3HOJA 1WBJA 4G1KA 3NYZA 3W7EA 2EGZA 1Q3NA 2ZFAA 1YTDA 2WKJA 4LC8A 5EPDA 3JRKA 1ONRA 4JYDA 4O19A 1QO5A 5U7SA 2CZ5A 3A21A 4NU7A 3L67A 1RQEA 1YTKA 4OT7A 2YSWA 2Y7GA 1VQTA 1OFEA 2CLMA 2CLIA 3W1RA 3MBFA 1RV8A 4YWIA 1B4EA 6ALDA 1XBZA 5AYZA 5ABTA 3TSDA 4PODA 5KMYA 3UD6A 5K9DA 4RK8A 3GKAA 2GQAA 4CCCA 3SY5A 3DFNA 3DI1A 3O06A 3PUEA 4HNVA 4FNRA 4O4VA 4IOTA 1UB3A 3M47A 1OG0A 1XBVA 5LSMA 4NZJA 4M7TA 3BGJA 3PG8A 4NJIA 2ATMA 3B4UA 1VCGA 3M6YA 2A4AA 4NZFA 4MZYA 3BG5A 2ZRVA 3EWWA 5AHLA 5I3KA 1QOQA 2DU2A 1LDCA 4K7VA 4FIQA 3W07A 2V0TA 1FDYA 3W75A 3LDVA 3UXAA 3Q2DA 1FWSA 2YYUA 3DZ1A 2CLKA 1B4KA 2QUTA 3E12A 1OFBA 4GJ1A 1VH7A 5CKSA 1H1YA 5E93A 4AXKA 4QISA 3PSWA 3T78A 3O15A 1H61A 2A6NA 2VFFA 4K37A 3IIVA 5AN7A 1AW1A 2BTMA 4FIRA 1U83A 1DOSA 3ABOA 5HWJA 3W7IA 2CLEA 1G67A 2H8XA 1W5PA 5BRBA 2JK2A 2PC4A 1MXSA 1W31A 4MLJA 1TTPA 3VI2A 4A2RA 4LV9A 4RV8A 1LOSA 4WUIA 3IGXA 1J2WA 3G22A 5K7JA 3DKLA 4N6EA 2Y7FA 3SW6A 4Z1BA 4LUIA 4LS2A 4KWWA 4MPQA 4DPQA 1I4NA 3BV4A 1JCYA 1X1OA 1KA9F 1LORA 3I65A 4XKYB 3NQEA 2OT0A 3HB9A 4O1DA 2TMDA 4E2BA 3G1HA 4XKYA 5K4XA 1F73A 4JTSA 1XI3A 1KFEA 3BLFA 2W0UA 3PF3A 1QPOA 1YXYA 3A9IA 1R47A 5SWUA 2DZSA 3KFTA 4O15A 3B0UX 3KOFA 4LVBA 3W1AA 1S5WA 4FNPA 3B04A 3W1PA 1WOBA 2R8WA 3GB6A 1F7BA 4XBSA 1DHPA 1DQXA 2BZNA 1UBSA 2X1TA 4HT3A 4NJKA 2RH9A 2C18A 3LTYA 4WQ6A 3IVTA 4UCGA 2Y89A 4UFHA 3RF9A 2ZZ7A 1YXDA 2EKCA 2TYSA 4UMCA 1PV8A 3L65A 4WXZA 1TQXA 2E6YA 3EWBX 4MY8A 1PIIA 1SR9A 1DJNA 3TIMA 3TQVA 3WK0A 3D0CA 4XTDA 2ISSA 3G1XA 2H3BA 1DBTA 3LOTA 1VC4A 3W6YA 5E1QA 3W72A 3LLFA 3L5AA 3C0JA 1W3IA 3NG3A 4RZ5A 4K39A 1TV5A 4HSNA 2V9DA 3MI2A 3QPYA 4FNUA 1W5NA 3S5ZA 1F5ZA 4KFPA 4W9TA 3LHZA 1EA0A 3NQ6A 4POCA 4WD0A 2WNZA 1GTEA 4I7UA 2ZA2A 3QMSA 3OHIA 1LROA 4RKAA 4XBKA 3SSJA 1VYRA 1EP2A 4FEZA 5EMUA 3P74A 4O16A 3QSRA 3TCEA 2JGYA 1KV5A 3LCIA 4DF1A 4IPIA 3W7PA 3OVRA 2GPTA 1KM5A 3G8RA 3F03K 4M6QA 4YCPA 2VFDA 1K3UA 3NQ8A 3HPSA 3NNTA 4E2DA 4A21A 4R7JA 5DXYA 1ICQA 3BGGA 3TV8A 3TAOA 1JCLA 2PRHA 3MI6A 4AF0B 3EWZA 4JTLA 1TPVA 2Q3RA 3NR0A 4NX5A 3GDRA 5HUOA 3MW7A 4AF0A 3W7LA 4TIMA 4UFIA 5D33A 3G0XA 3PS7A 1TCDA 4MVAA 2BWGA 4UTIA 3BW3A 5HWNA 1JRCA 2NV1A 3G1FA 3MHFA 3TJXA 2ZTJA 3PM6A 4HPJA 3UXDA 3LB0A 4UR7A 4JTKA 1TIMA 3G1YA 1H51A 2FB3A 2EAWA 3EX2A 1ZFJA 2TPSA 2R91A 2D73A 4WXYA 3B8DA 4FNTA 1NAL1 3PB2A 2WV8A 3B0PA 5DY3A 3I7QA 5FEZA 2YW4A 1OFQA 3LHTA 2X1RA 5F2LA 2ZRWA 3Q58A 3GYEA 3EX3A 3TK7A 4LNYA 5F2GA 4HPXA 1J4EA 2FPVA 3G0UA 5BW6A 2WNNA 1R2RA 3MHUA 2DZTA 2J9ZA 4BK9A 3NQMA 1JR1A 3P5YA 4BI6A 4ADTA 4XZ9A 1ZY9A 1W5MA 5LNUA 3PWAA 5HMSA 1UJPA 3PB0A 1C8VA 2YFNA 5J5DA 5CZJA 3H55A 4NNAA 4L4LA 1G4PA 2ZZ5A 3HGJA 1F6KA 2CU0A 4P61A 4O4WA 3VCRA 4X2RA 1FX6A 3W7GA 1FCVA 4PH6A 1LBLA 4KFOA 2TRSA 1PL9A 4O17A 5KITA 1OABA 2WSYA 3OBKA 5DLCA 4IQLA 3W83A 1LYXA 4LY8A 2V30A 3L0GA 4QNWA 1Z48A 3M1ZA 4LVDA 3HF3A 5D2YA 1OX5A 5D2XA 2HTMA 1LRNA 3PBWA 3M7WA 4BI7A 3UZJA 4N9DA 2QJHA 5CPOA 3G3DA 1FDJA 2Z2UA 3DBPA 3EXRA 1D9EA 3BW4A 1VHCA 4X9SA 3CHVA 3HBLA 1TTJA 2ISWA 2FJKA 4P2VA 1DJQA 5C54A 3GLCA 4DBDA 4H3DA 1TPEA 1VPXA 4S2CA 5TIMA 4RLIA 1P0KA 1AL8A 4QM1A 3W76A 4CCEA 3W1XA 3A5VA 1G6CA 1A53A 3DFOA 3HGRA 1TREA 3P82A 3CPRA 3IV3A 3G1AA 5DCBA 4JIPA 1Q6OA 3DGRA 1JCNA 3QPZA 4A29A 3W71A 1KFLA 3CTLA 1F05A 3NZ1A 3W1LA 4MFDA 3DFQA 2TSYA 4RR4A 4GNJA 5U4NA 4N4QA 1LP6A 1TO3A 3LBMA 2CZEA 3DHFA 3OVPA 3ELFA 1SW0A 2QCNA 3C2OA 1KM1A 1TPWA 1I2PA 1KTBA 1EIXA 4AWUA 1ZAHA 3BK0A 3NQGA 2ZZ2A 1C29A 1XUZA 3GVGA 3TDFA 1OFPA 1ZAJA 3SI9A 2H6RA 5LHFA 3HGSA 2X30A 3P8IA 5LNRA 3QH2A 1O95A 3S5NA 1YDOA 4JDYA 4IMFA 3ATZA 3QW3A 3MBDA 2AQWA 2A2IA 3W2UA 2GQ8A 3CIWA 4AVFA 2F7FA 1GTHA 2I14A 1O60A 3W7NA 5C2XA 3BARA 3W7CA 4O1BA 5FF2A 1ZNNA 1UUMA 3Q37A 1W0MA 1GYNA 3F1QA 3E9AA 1L6YA 1EP1A 1HL2A 3SECA 1FWNA 4NUWA 1EUNA 3SFKA 1H7RA 2NV2A 3STGA 1OHLA 4S1FA 2XN1A 4MLRA 3GX9A 2E5CA 2J9XA 5FF4A 2WO5A 3EB2A 3LCHA 1TRDA 4JTEA 3OIXA 4AMAA 3E96A 5KTLA 1MEHA 2GVLA 5D30A 2QCDB 2Z1BA 4LT9A 5HNRA 3A22A 4O53A 4PCFA 4GRSA 1JCXA 1PHQA 2QCDA 1GZGA 1W5QA 4JX5A 3IVUA 3JS3A 3S0CA 2GVGA 2C14A 1TB3A 1SPQA 1XFBA 3PR2A 1GOXA 1H62A 1QPNA 3LHYA 4UUIA 4XQ6A 4IMDA 4DXVA 1W8SA 2QCGA 2E5BA 2YGYA 4GWEA 4AAJA 3UPWA 3W70A 3MP5A 1WXJA 4K8HA 5D38A 3LRKA 1H7NA 2VKZG 1QOPA 4B5NA 2DZWA 3MO7A 4LW7A 3CQ0A 3HIJA 1JUEA 2OZ0A 3C56A 5L9FA 3P60A 4OWGA 1ME9A 3KVJA 1RQBA 3GDMA 3UPBA 1T96A 4ADSA 4Z08A 3U6WA 1AW2A 2HMCA 4ZVJA 5BMWA 3FFSA 4ZQPA 4A3UA 1BKSA 3QMTA 1Z44A 4DF0A 2YPIA 4EWND 1JCJA 1IXOA 3G3MA 2JKPA 4NXSA 3QZEA 3NAVA 5F4WA 3UYCA 2CLOA 2FFCA 4O50A 5D04C 3SZ8A 3I7RA 1GYLA 3F4NA 1OJXA 2RKXA 3LCLA 1UASA 4DPPA 4AEOA 1B9BA 1L9WA 1SSGA 3BVJA 2BLEA 4FHAA 2P1FA 1YADA 3GDLA 1QDSA 4MFEA 1F74A 2E5DA 1OX4B 3TW7A 1AL7A 3CEUA 4FX7A 4FB7A 2BX7A 1BWKA 1KFKA 3U2OA 4O12A 1WQ5A 1OX4A 1JRBA 4LVAA 1OF8A 2KZHA 3LBCA 1V7YA 3LXAA 3L0NA 4FXRA 2QEZA 2NXGA 3A5FA 1FWRA 5G1YA 8TIMA 4UTTC 1NF7A 3MI3A 1QAPA 1TPFA 5I3GA 5H2ZA 2DP3A 1FCQA 2NWRA 4WY0B 2DORA 3DENA 1RVGA 4Q32A 3TQ0A 2VXNA 3QRHA 2ZZ1A 1IXNA 5D2WA 3TKFA 2A6LA 4WY0A 1X1ZA 2DZUA 3KAOA 4JICA 4JYEA 1IGSA 1H1ZA 4DBEA 1I2RA 5F2IA 3ZWSA 2WSRA 3L2IA 4E38A 1LBMA 1EUAA 2OJPA 2YX0A 4UMAA 3NL2A 4WOQA 5LNWA 2C16A 4JXCA 3UNDA 2YZRA 3E02A 1G4EA 3GR7A 2G97A 1TPH1 3CB8A 2VEPA 4JX6A 1PCWA 3CIXA 4LVFA 1RZMA 1LLZA 1FXQA 4GC4A 4RXGA 4O1AA 3VE9A 4UTTA 2CZDA 4A22A 3TC7A 2GOUA 3WK2A 1FQ0A 2VEMA 4O13A 3A23A 4JX4A 3NQ2A 3M5VA 3W1TA 2A7RA 5FF7A 2VEIA 2Q8LA 3GXPA 1NSJA 2FIQA 1Q45A 1TYGA 3TU9A 1TSIA 3CU2A 3BG3A 4N9BA 1SO4A 1GVSA 1H50A 3TMQA 1GVFA 4ZZ9A 2J88A 5BOOA 3O8AA 1JULA 3LM7A 2YW3A 5CZTA 4O11A 1SSDA 2GJNA 1QNVA 3L5MA 4H6KA 1HO1A 1OYAA 3DH7A 1H63A 2G5WA 1B57A 4U4MA 3VKJA 1EPXA 1OX6A 3TW6A 3LRLA 3GR8A 4Y96A 4ORMA 1ML1A 3ABRA 3OEXA 3P67A 5DCEA 4JNMA 1K03A 4KFNA 4A2SA 4NQ1A 3M5ZA 3W73A 5HJLA 2ZZ4A 4M7SA 2QKFA 2OT1A 5AC6A 4OGZA 3BW2A 1YDVA 1PVNA 1A5CA 4LOCA 3M43A 4PFMA 2X1SA 3N9SA 2ZDRA 1UCWA 3HG3A 5F4SA 4LRTA 1EEPA 2E6DA 1ZAIA 1Y0EA 4CQ9A 2ZYFA 3S42A 4UTHA 5KINA 1OFRA 4EIVA 3N34A 3THAA 2VFIA 2ZRZA 3HPZA 1KW1A 3H54A 3NM3A 3ZFHA 5IM51 4CLMA 4GUHA 4I7VA 4Z1DA 3N73A 3RU6A 3G1DA 5FF0A 3NL6A 1VRDA 1TQJA 3O6DA 3HJZA 3OVQA 3GIYA 4O54A 3GDKA 1IIHA 3UY7A 3KXQA 5G1TA 2FB2A 1TPDA 4OBTA 1LRTA 1W56A 3WJXA 1EX5A 2Y61A 1SZNA 2XN0A 1M6JA 3HGOA 3GNNA 1GG0A 3O63A 4GE8A 2W6RA 1K7XA 3GDTA 3IIPA 2OMAA 3BLEA 2NUYA 4JY8A 4UNKA 4RCXA 2YYTA 2NLIA 2DZPA 1T99A 3TA6A 1A50A 2C1HA 3L0KA 3BG9A 3WK1A 3HPXA 1O5XA 3K30A 4YMZA 5K3VA 4X22A 3C61A 4BFAA 5EBUA 2AGKA 1GQNA 1GVRA 5D32A 4JD4A 4JTGA 3T55A 1FDZA 1KBIA 1TPUA 5C55A 3B06A 4NVTA 2JGQA 3GNDA 3P5ZA 4AHQA 3HG4A 4QAIA 1DVJA 2UV8G 1PE1A 1KM4A 3L5LA 4OU1A 4UNLA 1M5WA 1H7XA 4I9AA 4TMCA 2ABAA 3BPWA 3NO5A 1JVNA 4TX9A 5DXXA 1H60A 4JTJA 5AC7A 1ZCOA 2JKAA 4JEQA 4C1KA 3M5XA 5BMXA 3TH6A 5DELA 1QO2A 4JTHA 3TC6A 4FNQA 1T8XA 4K7YA 4CQAA 2QCLA 4RJEA 4IX2A 4YXGA 2J27A 2CFFA 1TTIA 4HNTA 3USBA 1JCMP 4OV4A 1GT8A 3BO9A 4HN4A 4KKXA 3P80A 2FPYA 2YCEA 3SGUA 4BI5A 2NXHA 3FIGA 3C3NA 2W79A 2QDHA 3AO0A 3E0IA 4MY1A 3IIXA 4DO6A 5K2ZA 5L6UA 3W85A 2E68A 4LU0A 2Y7DA 3NM1A 2Z6JA 4ZMGA 1SFJA
chains in the Genus database with same CATH superfamily
2C0AA 4K6AA 1QASA 4O52A 2X16A 2WZHA 3EDKA 4IGMA 1Y8BA 3GNXA 2YCJA 3B8UA 1DV7A 2E77A 1KTNA 5DQPA 3M0LA 3CBWA 3CUHA 4QJ4B 3GW3A 4PEKA 1VGAA 1UWIA 5LA1A 4P8WA 1H0IA 1XD1A 2NUWA 2ZTKA 5C5YA 3I3EA 4CCDA 1I2OA 3L68A 4BWLC 3UP8A 4QLKA 3VDAA 1R30A 1JPKA 1P48A 1YIXA 2PDQA 1MUMA 3USZA 1B90A 1Q6RA 5ABEA 4PRTA 3RAOA 1EQCA 1B3OA 4TXEA 4Z0JA 4E3VA 4F48A 4IT1A 3GIQA 3GTIA 4IFOA 2FTPA 3DU0A 4UC5A 3TMLA 3SJ3A 3MKKA 1V51A 4C6CA 2QCMA 1WBHA 5EKYA 1PHWA 3GTHA 4NAEB 3ZWTA 2DGAA 3WBEA 1YYAA 1KXHA 1V7AA 3D5HA 1SUXA 3R0UA 1UG6A 2J74A 4PMJA 3KEHA 5F4XA 3KTXA 2PDIA 3W9ZA 5JIPA 1FWBC 4K68A 3M44A 1CENA 1Z9AA 3HMJG 3NGFA 5JU6A 4CQ8A 4G56A 1JQVA 2WHMA 1TR9A 4MZ8A 4O28A 4DY1A 3PY2A 2YDSA 3T44A 5HUPA 1Z42A 2V2CA 4MNJA 4NJGA 4UZSA 2ZE0A 3PULA 5H91A 1JDEA 1YPXA 2V5BA 3FY1A 4R33A 1KC7A 4G1NA 4MZ1A 4UMBA 3SUSA 4DHGA 4EX4A 1PAMA 1J11A 4XVEA 3G1RA 3W74A 3E2RA 1A5MC 4Z1CA 2G0WA 4IX0A 1ZU8A 4QITA 1QPKA 3ZT7A 3SO7A 3CHCA 1OZMA 3JZEA 4JTUA 1GOQA 1WZAA 3OZOA 2CLHA 5LNSA 1FWIC 4QQ3A 4KWVA 2G3FA 1YLVA 3GYCA 4P5UA 3W7JA 3QGAC 3AOFA 1BF6A 4JTIA 2XWEA 5HOSA 4JN8A 3H6OA 4K3ZA 1ODUA 1TA3A 2OKOA 4Z2HA 1OFOA 5H8MA 3GSMA 2FQIA 2J7EA 3QHMA 1BQGA 1TWZA 4NIRA 1JIBA 1GWJA 2D1ZA 4IGHA 1BSIA 1J0JA 4LUJA 3WUFA 3VKKA 4MWAE 3ZR5A 2WLYA 3NXFA 3TROA 1WV2A 4N9CA 3PTKA 1B3WA 2V68A 3EEZA 1IXPA 1ISWA 1HFBA 3W7DA 4HK5A 4FF7A 1BYAA 1VCVA 3GNPA 2P10A 4GOAA 2C1GA 2B4GA 2Z0IA 1EX1A 4P7QA 4EF9A 1T5AA 2CYGA 4UR8A 2QCEA 1BKHA 1UR1A 4AU0A 3WDJA 1W3NA 1FVPA 1XYLA 4RE2A 4F2TA 2FDSA 4IUOA 2WNQA 2AKMA 1SJCA 1V3KA 3UJEA 2AOSA 3CLMA 3PZGA 3QOKA 3VTRA 4MJMA 1SQ7A 1GQKA 2WSQA 4HKPA 3A4XA 4F0LA 1AJ2A 3CC1A 2P3ZA 1GZ1A 5K9CA 4KPLA 3WUBA 3R4IA 4KEVA 1R46A 2E25A 2QYGA 2XWDA 1OZQA 3WKZA 3R2GA 2NQHA 1FUYA 2WMJA 2Z1WA 1ZALA 2J25A 3BJTA 3LYEA 2DZXA 2E0PA 2FH6A 4PBEA 2XVKA 3SGZA 3ABZA 5B7ZA 2R14A 4O57A 2A21A 1J0ZA 3L4XA 1XLHA 3W1QA 2QHAA 3QR0A 3WJSA 1H7WA 1GPFA 1HP5A 2GUUA 4AZ5A 3IRDA 1HUVA 1FWTA 3UYIA 4H2HA 3KVMA 3TSMA 3T9PA 3HZ3A 3MJYA 1GOWA 4OVXA 2B7QA 3P62A 3ITXA 3NZRA 4JIHA 3QHNA 5F1VA 2IPJA 2GJRA 1ZJIA 2Y85A 1IE7C 3NOEA 1S39A 2XPKA 5REQA 1GPWA 3SGGA 3VD4A 4IIDA 1KRMA 2JEPA 3DN5A 3BMWA 3UZXA 2OGJA 4PMDA 3MYOA 5A3HA 2H8ZA 2W5FA 1P7TB 2DDXA 5E70A 4UTWA 1LWIA 3QV6A 4QG9A 1MDRA 2OB3A 2NZLA 2YDRA 2CNCA 3UU0A 2HS8A 3SCWA 1YDNA 1XDMA 3FKRA 5A6AA 1UP2A 3T6CA 1L6SA 2ZA3A 1ELSA 4PTWA 2Y8VA 2C0HA 3UWUA 4AHPA 4DI9A 3LCXA 4IMGA 3TSBA 2ZRYA 3S5YA 3SRDA 3ZR6A 1R9YA 1N7KA 1GJWA 3C8FA 3HG5A 3MP4A 3SAZA 1CT5A 3KBWA 3RLGA 5CGMA 3MCNA 1E5JA 3ARWA 1PSCA 2FYMA 1JUBA 3TN6A 3I4EA 4QNEA 2GLKA 4PA8A 4S3DA 2FMOA 3LRMA 4L4OA 4J3ZA 4FNSA 5AYYA 2I1OA 1LWJA 5EBAA 1H5VA 1XS2A 3NQFA 1OT2A 1R2SA 4C1LA 3SCTA 4FLSA 3P84A 5C70A 2X2GA 3V16A 1EOKA 4IXXA 4L1XA 3RXZA 2DZVA 4H7ZA 4V28A 1L6GA 3SRHA 1TE6A 1WDQA 3B9AA 2ZBTA 3CQHA 1WDDA 1GVOA 1SZFA 4V15A 5CGQA 4E0CA 4QBXA 2DQWA 4OHQA 4HMDA 1UH4A 2BY3A 3GH7A 2WCGA 3I6RA 2QR6A 3ME3A 3W1MA 2V69A 5HATA 1Q6EA 1EO5A 3ARPA 1E0WA 4MTVA 2PAJA 5DEZA 3KL0A 3R6IA 4NKCA 3AROA 3IJIA 1O12A 2GFTA 1GYMA 3TX9A 1VBGA 1RR2A 1JL8A 3ITTA 2PS2A 4KRUA 2J8GA 3CLWA 5A8QA 3EWUA 4AD2A 4JIQA 4JAWA 3CZLA 3PJUA 1W54A 1I9CB 2NT1A 4CNNA 4GQRA 3SQMA 1VHNA 3T2PA 4PL1A 3INPA 1V3IA 4FALA 4XZBA 3WFAA 3IWPA 5FEWA 5EGRA 3OGVA 1JZ5A 5LXXA 4CN4A 5IBXA 4C7DA 5KZMA 2ZKMX 4MWAC 1PZ2A 3ARUA 4GGHA 2E9BA 2J24A 4GY1A 2OVLA 4DEFA 5G5IA 3S8HA 3WH5A 1XIHA 2VGGA 2VL4A 3VNKA 1S5MA 4FLRA 4P8VA 4XIMA 3DKJA 1YTEA 4UFJA 3MHGA 5DRCA 1D3HA 1A5UA 3RDKA 4AX7A 4XTIA 1TV2A 1LL7A 2CZVA 4FO4A 4PB5A 5B7YA 5CC5A 2WCAA 3F2CA 4GQBA 4X0NA 4NZCA 3V5CA 3WLHA 3R1ZA 1E72M 1CW2A 3CMFA 4TUFA 2O4MA 3GG7A 3CAWA 1REQB 4EXAA 4CN6A 4MUZA 5LIXX 4IPJA 3NWRA 2D2GA 3CQIA 1NDVA 3PUOA 2ZZ3A 3U0HA 1HO4A 3RHGA 1M7XA 4Q8VA 3IAPA 4B3KA 2YCKX 1CBGA 1TUFA 4K1GA 1W1IE 3IJQA 2CLFA 4J27A 2XFYA 4IQEA 4MYAA 3U4FA 1JNDA 3GXIA 4LQ1A 4WY0F 3T09A 1H09A 1RA0A 3LI0A 2OYLA 4JTQA 2ANUA 4FXSA 1E51A 2JEQA 3RLUA 4JS3A 1FH9A 3E0WA 4BQ5A 2Y24A 3OQEA 3VAVA 1Q4WA 2POZA 1UKQA 5I2UA 1F07A 2OX1A 3WJWA 2GGHA 2FVLA 2VCAA 4LUSA 3CL6A 1TZ9A 3VIJA 3WJZA 1WNOA 3GVQA 3MZNA 2E3ZA 2HS6A 2P0IA 4UTLA 1Z8AA 1X97A 5GNZA 2QF7A 1WDPA 3L21A 1F6PA 3ALFA 1XRVA 2J6XA 1R3SA 4ECLA 1JZ4A 2NXIA 2PLCA 5FAJA 1FFQA 3GZ3A 4LF1A 3WQWA 4KERA 1YXCA 3LHVA 1KNWA 2C8NA 1PTAA 4JTFA 3RO6A 3EAUA 5IHSA 3VKBA 4XZNX 1VP5A 2ZX7A 2QGHA 2XUCA 3HFYA 1R3RA 3B0YA 4ACYA 4HSOA 4M19A 3QR1A 5GNXA 1G01A 2WHJA 4KEZA 3HQPA 1O7AA 4GJJA 3EOSA 6TIMA 5H1WA 1MWOA 3EXTA 4ZFCA 3M7SA 2INEA 3HPAA 1UP3A 1DTNA 4RZ4A 4P7NA 1KCXA 3NVTA 1IF2A 4KS0A 1BYBA 1DL3A 3AWNA 5EMMA 4JGDA 4H8HA 4JHZA 3KL3A 3SR7A 4X2PA 4AWTA 4EAMA 3LV6A 1OF6A 3I7SA 1KRBC 2A85A 5I07A 1XCFA 1A5BA 1ZS2A 2VGFA 2WMKA 2PMQA 4JFUA 3TC3A 1XLBA 4ICCX 1RPXA 3STFA 4AZCA 4IP5A 4QSFA 1GJPA 1XC4A 2ZWZA 3L23A 1EYEA 2XH7A 3M0HA 1OFAA 5HBFA 2Y63A 1GKQA 7ODCA 3AYRA 3WD0A 1D2KA 3B3DA 2WNWA 3BJSA 2NVAA 4MIMA 1JAKA 2HCVA 3HG2A 1AH0A 4KW2A 1F2JA 5CPNA 5ABHA 1W3TA 2QJMA 1P0DA 4KF1A 5C7HA 4KCUA 3FEQA 3W1NA 2XM1A 4R88A 1B3VA 4L6HA 5FEXA 1VR6A 3QFEA 1SO6A 2XIMA 2MANA 4OBRA 3TFXA 1KM0A 1TFVA 4YL2A 2Z28A 3N6HA 1MUWA 3OA3A 2EQDA 3NQAA 3QM3A 4B5WA 2WWCA 1V0LA 3WK3A 1ONEA 4KETA 5ECUA 2OO0A 4NXKA 2OQLA 2DUAA 1S3HA 4Z2JA 1ZENA 3RCNA 5E0CA 3S2CA 1SFLA 2VQTA 3DFTA 3L9CA 3VNYA 3LPPA 2IXUA 3MSYA 4RZBA 3CGTA 4GCAA 4YLWA 3A24A 4DLFA 1FWAC 1AMKA 4O18A 4H9MA 1CLKA 3ZJ8A 4G1KA 5CBBA 3W7EA 1EC7A 3RJXA 2EGZA 1Q3NA 1YTDA 4LC8A 4HTBA 5EPDA 3M64A 4JYDA 2E1WA 3UZZA 3SQSA 2Y7GA 3CUGA 1OFEA 2CLMA 4L5ZA 1OGGA 2Z00A 2IKJA 3W1RA 3MBFA 4YWIA 6ALDA 2VR2A 1Y7VA 2BHZA 4FLQA 3TSDA 1EJSC 2IW0A 3CJPA 5AKQA 5IXEA 3N4FA 2ZUNA 4HNVA 4FNRA 4O4VA 2EO7A 4XISA 3DG3A 3T07A 4E8DA 1OG0A 1XBVA 5LSMA 3C86A 1AH3A 1A80A 4CD5A 4UB9A 3VXGA 4MWAD 2GK1B 1F3TA 2PCEA 1VCGA 3URNA 3M6YA 1E0XA 4K2SA 3BG5A 4GXWA 2ZRVA 1W2VA 5AHLA 1QOQA 2DU2A 2VRJA 4YHGA 1VAHA 4BS0A 4FIQA 3E0FA 1FDYA 4A3HA 1X7IA 3KZSA 1VFSA 4E6MA 3VC5A 1B4KA 1UD8A 1Q85A 1OFBA 4GJ1A 4B9ZA 3VX0A 2OU4A 4QISA 2YXOA 1R7OA 1UPPA 3PZVA 2GVEA 3A3WA 3TN4A 1AW1A 1GVIA 2BTMA 1B31A 4H00A 2YL6A 1E3XA 1W5PA 3DECA 2XU2A 1WKDA 2JK2A 2J7DA 2PC4A 5LIUX 3EOEA 6A3HA 3RUBL 4WUIA 1J2WA 1VFOA 3O0FA 4HNCA 4TOQA 4Z1BA 3UR8A 1PTDA 4DPQA 3QV9A 1JCYA 1LORA 3K4DA 4XKYB 3W00A 2YB4A 1F73A 3BLFA 1KFEA 2ICSA 3COTA 3PF3A 1YXYA 4BEUA 4NHVA 3A9IA 5ABFA 1TJ2A 4B5SA 1NM9A 2R8WA 1WP6A 3BMVA 2PWEA 3GB6A 4XBSA 3L7RA 3ARYA 1UBSA 1N2VA 1AODA 3DX5A 2OYMA 3IVTA 4UCGA 3RF9A 2ZZ7A 2EKCA 2P76A 3AIEA 2QZRA 3EWBX 1LG2A 4QE1A 4MY8A 4RDVA 3GZAA 2BB0A 3TQVA 3AICA 3WK0A 1W3HA 1Z3NA 4XTDA 3W29A 2PF0A 1VC4A 2OZ3A 3W72A 1H41A 2PGEA 3VGEA 3CZ8A 2FZMA 1QI2A 4S23A 2V3FA 3WEOA 4E4PA 3UCQA 3S5ZA 1F5ZA 1VF8A 2FGZA 5DX7A 1GJUA 3QMSA 5C9WA 4RKAA 1EP2A 3P74A 1MVYA 2QUMA 4IPIA 3OVRA 3WZ0E 1ZJHA 2D2HA 1FA2A 4YHEA 1DJGA 4M6QA 1UKSA 3NQ8A 1US0A 3FV9A 2HWGA 3NNTA 4ZXOA 3TP4A 1ICQA 3TAOA 2YL5A 1FP9A 1DIOA 4AF0B 2I5QA 3WY1A 3WH8A 4JTLA 1TPVA 4PMQA 1HVXA 3NR0A 3R25A 3GDRA 5DO8A 3MW7A 5HUOA 3W7LA 4FF5A 5CXPA 1C8QA 1O66A 3BW3A 2IKHA 2WVTA 3P0XA 4HPGA 3G1FA 4AXNA 3TJXA 3S9ZA 5FJUA 2ZTJA 2O9RA 4QQUA 1SM9A 2CEQA 1F4AA 2DVUA 3AJ7A 1RJRA 1ZFJA 2R91A 4IICA 1RA5A 1E6QM 3B8DA 4TVCA 1YKWA 3M4HA 4LAKA 2VVNA 1ISVA 4ZFMA 4O0QA 1E40A 3LHTA 1PPIA 5CGTA 1WKEA 5F2LA 2ZRWA 3Q58A 2PPGA 4IIHA 4C91A 1CB7B 4LNYA 2W62A 1AZ1A 2FPVA 3G0UA 2YCLA 3ZLGA 3NQMA 3SRKA 5FJIA 4REQA 1ITCA 1ZY9A 4J35A 2FZ9A 1EDTA 1VFTA 2OFJA 3TYCA 4B16A 3FSUA 4JQ4A 4M80A 2FGBA 1G4PA 3U2CA 3HGJA 1FWJC 1DIKA 4DN1A 3W7GA 3FHAA 3DGBA 3THCA 3LPGA 4PH6A 1LBLA 5C8BB 3S47A 1FWHC 3M07A 3CPUA 3O6AA 1UWQA 4YNGA 2TRSA 3LD5A 1OSEA 1OABA 3TYAA 3EOUA 4IQLA 4L7ZA 1LYXA 4QNWA 1Z48A 2YB1A 3HF3A 5A8PA 4HA4A 2WVVB 4JQ2A 3PP7A 3AHZA 1FDJA 2Z2UA 4LAOA 1D9EA 3BW4A 1VHCA 1V0NA 3HBLA 3SB0A 2ISWA 4B3LA 5C54A 1VJZA 4L56A 1DXEA 4QM1A 1DIDA 1G6CA 3QC0A 3TQPA 1NFPA 2SFPA 1QOXA 1XISA 8XIAA 5DCBA 4DB7A 4A29A 3DFQA 1WAWA 1B3ZA 2XVNA 1LP6A 3QOMA 2CZEA 1MYRA 1SW0A 4W8BA 2QCNA 4H19A 1ITUA 3C2OA 2VX7A 3VIPA 1V6UA 4JPGA 3REQA 1V6TA 2DQXA 2OLHA 1OFPA 2H6RA 3SQLA 2ZE3A 3P8IA 1UOZA 1WXYA 1YDOA 4IMFA 3AAMA 2WZMA 1KGUA 1WDRA 4DM1A 2XH4A 1OD0A 2A2IA 4TX8A 3W2UA 1KBBA 3CIWA 4AVFA 2QW5A 3AUJA 3T0DA 4U10A 2OSWA 3W7CA 4O1BA 5FF2A 4KEMA 2W9MA 1UUMA 3WNMA 1W0MA 3VMOA 2VC9A 1GVEA 4JNZA 2J7GA 4RE4A 2EKGA 3ZJ6A 3W0KA 1ZRQA 5M2FX 1FRBA 1VFUA 3UJRA 1H7RA 2BY2A 1OHLA 2QGYA 3SUVA 2IKGA 3GX9A 2R82A 2GGGA 2A3BA 5FJTA 2E5CA 5C71A 5FF4A 2ACSA 4AYGA 4JKMA 2P8BA 4DUWA 5KTLA 1EKOA 4L9XA 2GVLA 2WBKA 5D30A 2QCDB 4LT9A 3A22A 1PHQA 1GZGA 2Q01A 1TZZA 1RP9A 2HVOA 2GVGA 2G50A 1XFBA 1SPQA 2PDNA 4Q8TA 2Q09A 3PR2A 1GOXA 1H62A 2PGWA 4UUIA 4XQ6A 3MA8A 3B4YA 2ZUMA 5BOFA 4GWEA 3QN3A 1Q7MA 3W70A 2G3JA 2VKZG 4B5NA 3H7RA 2INZA 6CGTA 1X6NA 1HIZA 2QIWA 3ITOA 3HIJA 1JUEA 3B0XA 1RUSA 2WC4A 1ME9A 1RQBA 3K5XA 4ZVJA 5BMWA 3NDZA 4NZ3A 4IMAA 3VNMA 5JUVA 1BKSA 4CU7A 4DF0A 1JCJA 2CKRA 1H49A 3GXFA 2JKPA 4NXSA 3WQEA 3GUWA 3NAVA 1B30A 3G2GA 5D04C 3K8LA 3IJ8A 2RKXA 3LCLA 1UASA 4DPPA 1E6PA 3UG4A 5M17A 2BLEA 3W38A 4RW5A 3VGHA 4HA1A 4UQ9A 2Y8KA 4B90A 4HQVA 3AWOA 3TW7A 1E4IA 4FX7A 4BA0A 4FB7A 3GNOA 3LK6A 3U2OA 1OX4A 4PCSA 3PPFA 2O92A 4HA3A 4YVVA 4FXRA 1UR0A 1KWGA 4XZMX 3A5FA 1YNPA 1KR0A 8TIMA 1JPHA 1UJQA 1NF7A 1E1CB 3I4KA 1MI3A 3OZMA 2GJXA 2QPSA 3VM5A 4I8YA 1RVGA 3W02A 5B80A 2VC5A 1IXNA 4D6GA 2DSKA 2A6LA 4WY0A 4AZBA 2DZUA 2X8RA 1I2RA 4E38A 3ZWSA 3L2IA 2OJPA 1EUAA 1XLFA 1VJSA 3GQYA 3RM9A 1IEIA 3AHYA 2REQA 4JTRA 1XGZA 4AY1A 4LUTB 2YZRA 3GR7A 3CB8A 2VEPA 3CQJA 4LVFA 3H4XA 3U2ZA 4E2VA 4GC4A 9RUBA 4A22A 1NARA 3TC7A 3W25A 3CH0A 1V6XA 3A23A 2HNEA 3TVAA 3W1TA 5FF7A 1VIWA 1ADSA 1NSJA 3PHAA 1TSIA 1C92A 1IWBA 1EFZA 3CU2A 2E9LA 1GVYA 1SO4A 4DVOA 4PN2A 5HDRA 3PNUA 4B5UA 4F40A 1P6BA 3ZJ7A 2J88A 2YKKA 3GNRA 4H6KA 1HO1A 2PBGA 1XSKA 3DH7A 1H63A 4FI4A 5JH2A 3A3HA 3BQ6A 4EXQA 3WUEA 4LAMA 4HSHA 2ZXQA 3GW0A 4Z2KA 1ML1A 3ABRA 1XR2A 3OEXA 5DCEA 4Q7BA 1TMQA 3M5ZA 5FJRA 2YLLA 2J7CA 1ZP4A 4NG3A 4LOCA 2VR5A 3TCSA 4LNCA 2ZDRA 3HG3A 2E6DA 4CQ9A 2ZYFA 4D6DA 3GBDA 1OFRA 4EIVA 3N34A 2G3NA 4IP7A 2VFIA 2ZRZA 1HKMA 3H54A 1CXKA 3D46A 4I7VA 4WGXA 1UZDA 3G1DA 4NZ4A 1TQJA 3O6DA 3GDKA 4IFRA 3KWXA 3UY7A 1LRTA 1SZNA 3HGOA 1GG0A 2E8ZA 1UW9A 2YL9A 3QVQA 4Q7IA 1F8MA 3FVDA 2PDPA 2X05A 4FPSA 4JFSA 1FFRA 1O5QA 2D0FA 3BLEA 4C6EA 2WPGA 3WLMA 1UD2A 1HGWA 4HHHA 3KDOA 1UHVA 1T99A 3L0KA 3PZ9A 2Z7KA 4YMZA 4DJEA 5E9AA 1PWMA 2AGKA 1HJUA 1HF6A 5D32A 1RSCA 2VI0A 3BAIA 4JD4A 1Q63A 1FDZA 1HXJA 1TPUA 4F0SA 5C55A 3B06A 1A0DA 4EWJA 2JGQA 2WK2A 3HG4A 2W27A 2UV8G 1PE1A 1KM4A 3L5LA 4KCTA 1M5WA 1H7XA 2A3EA 4KESA 1QATA 3ONBA 3H24A 1RAKA 5FJPA 3PAOA 5AC7A 3B8IA 2Q8XA 3TC6A 3SUUA 3CAVA 4ZEPA 4K7YA 3WLTA 5CEWA 3II1A 4NI3A 3MS8A 1JZ3A 4YXGA 2J27A 2CFFA 1MMFA 1JCMP 5A94A 4XZIA 3SN4A 3BO9A 1HJQA 2FPYA 4BI5A 3FIGA 2HNHA 3E0IA 3AO0A 1UKPA 4MY1A 1QJWA 3IIXA 1FHUA 5LIKX 3V0UA 4A8LA 4B5XA 5K2ZA 2VNCA 4NAFB 1E55A 2MNRA 3WBAA 2HEJA 3SIZA 3S6TA 3W7RA 1C9DA 3DG7A 2XFWA 5LKYA 2VELA 1NWUA 1RBOB 4ZB5A 1R2TA 5LNVA 2C15A 1K70A 3OHMB 1XRFA 2V3GA 3W2LA 3KWSA 4G5DA 3PBVA 2C3ZA 4H01A 3KHDA 4BJHA 4BHYA 4PTNA 4HHPA 5CJ5A 1U33A 4M6VA 4NYYA 5EMYA 2OWXA 1Y65A 4WEVX 3FN9A 4HNNA 1ADDA 5FF3A 1O68A 4XIAA 1WCGA 1MO0A 1TJ1A 3GH5A 3KBNA 1LF1A 3TLLA 1PCKA 1I8JA 3BAJA 3BOXA 1V5XA 3UETA 3UESA 2EPHA 2AQVA 1UKOA 1UOKA 3V1PA 2PWVA 5AYXA 5A6BD 3BLIA 1IEWA 2C13A 3EA1A 2GJLA 3I6TA 4QDPA 3POCA 5A5WA 1C90A 4GY0A 1A5OC 1MSSA 2EG6A 1LCOA 1C8YA 3S1UA 1U1HA 3C6CA 1UZ4A 4HOZA 3A6OA 3S46A 3FA4A 1TPB1 1QNOA 1IZCA 4PCNA 3EB3A 4H4IA 3WLPA 1KGWA 1L6WA 3AIBA 1IIGA 4HU4A 1DJIA 3GWQA 1JXKA 2B7PA 1SZEA 4MADA 3N2TA 3W88A 2BODX 5FCZA 1HKKA 1EOMA 4DJFD 4I8DA 1JDDA 1K9FA 3RNDA 2ATSA 1F76A 3LCWA 1FHDA 1UUQA 3NPVA 3QSTA 1K8XA 1KGXA 3ISIX 4D1IA 1LZOA 3TJLA 2EHHA 4XAYA 3TYBA 4WDXA 2GVJA 3N4EA 3UW6A 3UWWA 3LCFA 2ALDA 3K8MA 5LXEA 2J77A 1Q6QA 4IM4A 3VDBA 1VB9A 3KVKA 3KRBA 3RN6A 3EPMA 1K7EA 3PC0A 4GHRA 3TYEA 4KT2A 4R34A 1MNSA 3B8VA 1ZZMA 1TA3B 5DT5A 1XM3A 1KXTA 1H2JA 5HANA 2PE4A 1G0CA 4PC8A 3ARVA 4D6JA 2RJGA 2J9YA 4Z2IA 4U5IA 3OP2A 3URQA 4PTMA 3PZNA 1O4UA 1O6IA 3RGTA 2QVNA 4IGSA 4GINA 3THDA 4ONVA 2AMGA 1V79A 3UXKA 4X61A 1A5AA 2IS7A 4AEFA 3PWIA 1UR3M 3GDBA 3GKFA 3WNPA 4B9YA 4H9UA 2VHLA 1B3YA 4DJDD 3S83A 3ZZ1A 4GZJA 1KWKA 2V5JA 2WMFA 2J7HA 2FHFA 4Z17A 1CXLA 5DMLA 3FJLA 3W6MA 3LPFA 4CQCA 3CAKA 3H2NA 4XBJA 4RX0A 1L0PA 2PWGA 1H7PA 2PDLA 3TJ4A 3LERA 4ZQOA 3W87A 2OLSA 3W7QA 2I7GA 4LWWA 1NF0A 1LTDA 4MSSA 5EFDA 4LS0A 1NWTA 4QP0A 1UR8A 3Q94A 3M0ZA 4R85A 2E6FA 5KZEA 3MQTA 4IGNA 1QHZA 5A6MA 4JKLA 3BSHA 4ADUA 2RDWA 3L2LA 2WQPA 4P7LA 2E6AA 2GOKA 3P61A 2ZIDA 3O7UA 3VOJA 4DBSA 1GKRA 4MDOA 3LY0A 3PFMA 2GGJA 5H8UA 1CZ1A 4GYPC 2ISVA 2QNEA 3TQKA 1W1VA 1N8IA 4B4FA 1PIFA 1MZHA 2VFEA 3HQNA 5I00A 1DQUA 4M24A 4M3PA 4LBSA 1K7FA 1V6WA 4MB1A 3DG6A 5XIAA 4ALDA 1OEPA 1T41A 2ZA1A 1POKA 4DQWA 4WJEA 1M68A 1K8CA 3EXSA 2WW5A 4GY7A 4L65A 3O0KA 3KP1A 4GVIA 2WOQA 2EEXA 4J3UA 1R86A 2R1KA 3AALA 3PFRA 5EB8A 3DHDA 5REQB 3T4CA 4HZ7A 4ZXLA 3AHTA 2UBPC 4YWSA 1XIJA 3T4WA 3ARZA 1ZBKA 2YA0A 3P81A 3AMCA 4DJFA 5HMDA 1E4MM 4OECA 2GVYA 1V0MA 4Y90A 2ZZ6A 1S2UA 1NTHA 1KTCA 1PZ0A 3NA8A 1U2YA 1XDLA 1VLIA 3MZ2A 4ML9A 5D09A 3U9IA 5CZSA 4GUGA 2JQXA 4XZHA 1WZLA 4O1FA 1U5JA 2BMBA 4QJ1A 2V81A 1IR2A 1QI0A 4Y9PA 4E4UA 3NL5A 1O1ZA 4IJBA 1BEUA 4D6FA 2PDFA 1YX1A 3DBNA 1UR2A 1KBJA 1TMLA 2VP8A 2VC7A 4JTCA 3T40A 3T81A 3CQKA 3BAKA 4J3WA 1FWWA 4UIOA 1XYFA 5A8OA 2B31A 4IJCA 1OK4A 2QIIA 2IQ0A 3T05A 2PFHA 3FSTA 4I6VA 1PO9A 2Q3OA 2FLIA 1I2QA 3NJ3A 3R43A 2P88A 3WQ6A 1IWAA 4DXXA 3WEZA 2WJZA 2FZ8A 3GS6A 4MNLA 4C6MA 3VZYA 4CD6A 5T26A 3DHPA 3FYPA 3WDHA 2Z4GA 1J6PA 5CBJA 2CXEA 3MVTA 3CV2A 3VCNA 4DJDA 1EZWA 2CITA 1HJVA 4GFIA 1ONXA 4EF8A 3N14A 2ONEA 2FH8A 3B9OA 3MY9A 2BGSA 1LT7A 2UY4A 1J9YA 3S1GA 3Q67A 3RLVA 1C7SA 2BGNE 2ABBA 4NZ1A 3GO2A 5FD0A 2ZDSA 3SUTA 2YFOA 3EWDA 3W53A 4UNIA 1FWFC 1AG1O 4X9YA 4CD4A 3QV7A 3N18A 3VGFA 4CCZA 2ZX6A 1W1YA 2JIEA 4EAYA 3P7YA 3WDIA 3WF1A 3RMJA 4GPNA 3STCA 2D0HA 1KFJA 1FBAA 1MEWA 5A8GA 1WDWA 2D3NA 3FEMA 5LGXA 4H7CA 5G2HA 5CSRA 4AWEA 2B81A 1J0YA 3VDHA 4Y8FA 2XN2A 3SRFA 2ZX9A 2UY3A 4Z1AA 1GQLA 2V3DA 5JMUA 4L9YA 3DYMA 1LG1A 1OC7A 2O56A 3P2VA 2ZXDA 4IPLA 4Z42C 4LX4A 4HPNA 5IDIA 2WMIA 1E6ZA 2CHNA 5MKGA 3BQ5A 3A3XA 1Z41A 2V38A 4U2YA 3N9KA 4L4MA 3J7HA 5I24A 2H3DA 4LV4A 1BTMA 3UWYA 3ZOAA 3AXMA 1JYNA 1XC6A 4DWSD 1N55A 2HROA 3LI1A 1NJJA 3AMLA 2HSAA 4U2ZA 3CL7A 1V3MA 3JW7A 2NX3A 1VD6A 4DAFA 1EBHA 3VFCA 3H7VA 3NDOA 1CGYA 3OPSA 1R87A 2XGBA 4J40A 5FA5A 2Z2AA 1XLEA 5G4WA 4GUFA 2DV0A 3NZGA 4NY2A 4AWSA 4DX3A 1XD0A 5TBOA 1BWVA 1EF2A 4V27A 2BDQA 5AZ0A 4GJIA 4QAWA 3F2DA 4GBDA 4YU1A 2Y5SA 4BQ4A 3VFLA 4XAZA 1F3XA 1YW1A 3DI0A 2PDGA 3V1HA 1OCJA 1BF2A 4Q8MA 1A4MA 4MF4A 1S1PA 2QULA 4LUSB 4DI8A 2X0HA 2Y88A 4EPBC 3W2KA 1TWDA 3WNNA 5G4EA 3UJFA 2Z27A 4HMCA 5FI8A 4DRSA 5J5RA 2QDEA 3MSRA 1WPCA 3ZYZA 3NQDA 3SADA 4F4RA 4HZ8A 2O9TA 3S5OA 1J5TA 3EKGA 4QTGA 3O16A 4AD1A 3V75A 4AD3A 3KM8A 2YLAA 1TJ0A 2PWDA 1AK5A 3W22A 1MW3A 2YDAA 3ES7A 4N02A 4GD0A 1E6NA 1OWQA 3TXZA 4YN5A 4DM2A 5I7GA 1AMYA 5HR6A 4ROQA 1GZJA 3R8RA 1G4SA 3OO2A 2CBIA 2W3ZA 1DORA 2J13A 5FACA 3IJDA 1Q2RA 2PUZA 4K36A 1KLZA 1VFHA 3EA3A 3FKKA 3WLSA 1PZ3A 4MHBA 3IAQA 4R7WA 3AZTA 3AHVA 2WANA 3CS2A 4PMRA 2QAPA 4Q7NA 1FTXA 4R5EA 3PBGA 3QEZA 2CW6A 2W66A 3DIPA 3N19B 2VYOA 4E2OA 1QK2A 3S1WA 1J79A 3FA5A 3F2BA 1TWSA 2Y5JA 5D9NA 1OG6A 3AQUA 2GGIA 1F4HA 1W9PA 2CLLA 2ZXBA 2OSYA 3PJXA 2ZUTA 3OVGA 2BFGA 1ONWA 3FYOA 1QRQA 3TNOA 3H2OA 1PJ9A 2PCQA 5F2MA 2XSAA 2F6KA 2VX5A 3CWNA 3AIVA 4XD6A 1VZWA 2G96A 4AZCB 4QXIA 1V02E 4QIUA 1KR1A 1XLKA 3EWXA 1TRIA 1ZBVA 4HBKA 3PVFA 3R94A 4UTUA 2XIJA 2WC7A 3S1VA 4Q8WA 3N12A 2PWUA 3PBYA 2NUXA 1HJWA 1XBYA 4P7OA 5A69A 4DWSA 1RQHA 4BQ2A 1CGUA 4GI4A 1KCZA 4F3HA 5CQ1A 4NX0A 5GJMA 4FOUA 1PX8A 2Z1XA 3QC3A 4WX2A 2JBMA 1K4GA 1SW7A 5FAGA 1T8QA 5AY7A 1M7OA 1W1B1 5AZ1A 1RHCA 4J3XA 3M16A 1XCXA 4GA8A 4CUCA 4TU1A 4X3ZA 1PIGA 4P8XA 4PMOA 4LEQA 1XSJA 4O0ZA 4H9YA 1NIUA 3ZVIA 4HB7A 3WQDA 3WN6A 2HXUA 4FSAA 5EMJA 2OOGA 3W7KA 1CLVA 3UEQA 2VEFA 1NVMA 3WL0A 4MM1A 1Z6KA 1TJRA 3IGUA 4GVHA 2Y70A 5AHEA 1FCUA 1Q66A 4XZLX 3ATYA 3W4RA 2XH2A 2CHOA 5KSWA 4M56A 1CX9A 3VU2A 3MTWA 3TR2A 3PJTA 1CXIA 3IJ7A 5D05A 1GW1A 4PCPA 1W1ZA 4R53A 3I3DA 5EL1A 3H2CA 3RPMA 3NYZA 2OO6A 2ZFAA 3R79A 3T08A 2GSEA 3JRKA 2HPMA 1K9EA 4O19A 1ONRA 1OT1A 3A21A 3MSGA 3L67A 1RQEA 4OT7A 1GW9A 1VQTA 2NQ5A 1S5NA 1C7TA 5FL1A 1RV8A 1B4EA 1BRLA 3TTQA 5ABTA 4LGXA 2WMHA 3UD6A 3U4AA 3GKAA 3W27A 4IP4A 4QEHA 3DFNA 1U5HA 3PUEA 3F4DA 1VBRA 1K9DA 1E6SM 2R1PA 4IOTA 1UB3A 2C91A 1D8WA 5HQLA 3M47A 4MKVA 3S2NA 3VIFA 1VEOA 4NJIA 2A4AA 5AVHA 4MZYA 3EWWA 3JU2A 1FWGC 5I3KA 1EC8A 2HPIA 3W07A 3PJWA 1GOMA 5I78A 3URAA 3UXAA 4IG2A 4BY3A 1NOFA 2DIJA 4UWMA 4XUYA 3CMGA 3CXOA 3DZ1A 3QZAA 3E12A 2DZAA 5GPRA 3B8WA 1PEZA 4ZCWA 4Q4PA 1XV8A 4YVXA 5E93A 4AXKA 1HKJA 4XSLA 3T78A 3N25A 4YTUA 3EMCA 4K37A 3U5UA 2BY1A 3IIVA 3XISA 1L6FA 3BLLA 3R58A 1W1A1 3MUY1 5C2GA 4FIRA 4PMZA 3T2OA 2CLEA 3A9BA 1TVPA 4G7EA 1MXSA 1W31A 2X0SA 3UG5A 4GI9A 4MLJA 5JBEA 3VI2A 2XINA 4RV8A 3IGXA 4Q4QA 3G22A 5K7JA 3DKLA 2Y7FA 3SW6A 4LUIA 4LS2A 1JCTA 1CTNA 4KWWA 4Y8EA 1AUSL 4C6FA 3TYZA 1J01A 1E73M 2GJPA 2TMDA 3VNJA 5ABFB 4XVDA 2X1IA 3ZT6A 4YYCA 1QPOA 3TZFA 3KFTA 3B0UX 4J5NA 4LVBA 4D6CA 3W1AA 3D3FA 3B04A 1WOBA 3GD6A 4RNIA 3AI0A 1DHPA 2E40A 3LENA 4HT3A 2X1TA 3UCCA 3L12A 1CNVA 3QFWA 2RH9A 2TYSA 3OLEA 3M0MA 3U2EA 4H8VA 2E6YA 4QCEA 1XLAA 1SR9A 1DJNA 2NVDA 1JDFA 1HP4A 5D8WA 4PUJA 3KZPA 1DBTA 3W6YA 5E1QA 3LLFA 1UWRA 4AISA 5T9BG 3DESA 4XO6A 1C93A 2PZNA 2L5HA 4Q8QA 2J47A 4FNUA 3WYZA 4W9TA 2QJNA 3LHZA 4AVNA 4POCA 4EANA 4HYVA 4PRWA 2ZA2A 2W63A 2G3MA 1VYRA 4FEZA 4ZTXA 3MB9A 2ZVRA 4HD5A 3PZOA 3OYXA 5J8LA 3VNZA 4LBUA 4DF1A 1GONA 2BS9A 3EDEA 2GPTA 1W3JA 1K6AA 1XJBA 4YCPA 4LUYA 1K3UA 3S9IA 3S2MA 2MUCA 3HPSA 2PDCA 1W1PA 4A21A 4E2DA 1UH3A 1S1RA 5DXYA 3TV8A 4H6RA 2XISA 3NO3A 2W61A 1OQFA 4MPKA 4W88A 4NX5A 1PKLA 4F0HA 3WLKX 2BWGA 1XYAA 4PMNA 3QTPA 5CSYA 5HWNA 1JRCA 4IF2A 3I10A 3WMLA 3RMEA 2ZXAA 4HPJA 1DJYA 1TR1A 4R9XA 2VGIA 4CN1A 1E9IA 4XKMA 1TIMA 3G1YA 2FB3A 3PZTA 2EAWA 4BF7A 2ZUUA 4CNUA 2D73A 3QLDA 4IL2A 4Q22A 4WXYA 1R6WA 1W9DM 3ITVA 4FK9A 2Y5EA 4UTFA 3MT1A 3EX3A 3UJ2A 3TK7A 2YCLB 4S39A 1I60A 3AS1A 4REQB 1R2RA 3ZIZA 1W9UA 5JBFA 2EXOA 3P5YA 4NZ5A 4QE5A 5C9RA 4ADTA 3QBUA 1R8LA 1W5MA 3PWAA 1W17A 3PUGA 4GH3A 5J5DA 4S3KA 2BASA 3TJIA 4L4LA 1VFFA 2ZZ5A 3DC0A 3RPTA 4P61A 4O4WA 4X2RA 1FX6A 1FCVA 4NL1A 4W4QA 4J7RA 4O17A 4KIRA 3KBJA 3WD1A 2WSYA 3C0SA 4H9TA 3WF3A 3GVRA 3ENLA 2X2YA 1T6MA 3L0GA 3A4JA 3TN5A 5D2XA 2HTMA 2QMKA 3PBWA 3WF2A 1F9CA 1KKOA 3T0AA 4MB3A 4ZA0A 3VCCA 1J8VA 4KMQA 4GO8A 3EXRA 3M6DA 1B0IA 4WLCA 1JD9A 3WF4A 2FJKA 3H8AA 1DJQA 3GLCA 4H3DA 1HT6A 4PMYA 9XIAA 4RLIA 1P0KA 1B1YA 3W76A 4CCEA 3W1XA 3KOXA 2WM0A 1A53A 3B8SA 3ABXA 3CPRA 3BSGA 5E6YA 1UZHA 1RY0A 2JALA 4MFDA 3W71A 3CTLA 3NZ1A 1JI1A 1ZGDA 2JFEX 4JFVA 3GVVA 3F5KA 1GOOA 3LBMA 3DHFA 3REQB 3PPCA 1KTBA 2CHRA 3AIWA 3IJ9A 4W93A 2ZZ2A 1C29A 1XUZA 5LHFA 1HKIA 2X30A 3QH2A 1O95A 1KQYA 4G9PA 4JDYA 3XINA 4ZB2A 1U30A 3TEVA 2ACRA 3CK5A 3MBDA 4IIEA 2OQHA 3OGSA 2GQ8A 3GXMA 4HYRA 3PWGA 3ITLA 5GNYA 4AY7A 1R3VA 3BARA 5I02A 3Q37A 3LN3A 1V4YA 2Q02A 4UR9A 1X1NA 1L6YA 4KGLA 1EP1A 1E3ZA 1FWNA 2HK1A 1EUNA 3SFKA 1A3XA 3PZMA 5DMNA 3STGA 1AA1B 2WHLA 3ID7A 2PWFA 4A8IA 5M03A 1BPLB 2J9XA 1RXOB 3WMCA 2WO5A 3LCHA 1TRDA 1Z7AA 4EPKA 1HVQA 5DF0A 1MEHA 2ZUWA 2OELA 4AIOA 2Z1BA 4H9VA 3VK5A 5HNRA 4HYWA 4PCFA 2F2KA 1JCXA 4JX5A 5E6ZA 4JEJA 1CGXA 1TB3A 3MVIA 4V1XA 2WLZA 3LHYA 3G6LA 1LQAA 4AZ7A 3V5FA 1GGOA 4IMDA 4DXVA 1ZL1A 1IEVA 1ZUAX 3OYZA 4WSJA 4QG6A 2J7BA 1HKVA 4FXJA 5EU9A 3MO7A 1SMAA 5BRPA 3UT0A 2DSZA 5I0DA 2OZ0A 1WE5A 3C56A 3KL5A 5G1MA 3ZVHA 3P60A 4IIBA 2ADAA 3KVJA 3GDMA 3U6WA 1AW2A 3NZQA 4XSMA 2FZDA 1EHAA 4NF7A 1Q6DA 3PTQA 3FFSA 3AYSA 1Z32X 4LEFA 1KFWA 1Z44A 3EYPA 5JVLA 1ITQA 4EWND 2X0YA 4AD5A 1HW6A 1IXOA 3G3MA 4M51A 3IUHA 1R5YA 2W4XA 2BHYA 1DWIM 3UYCA 2F8QA 1A3WA 1AJ0A 3W82A 1GOKA 4O50A 3I7RA 4RW3A 4NASA 1PBGA 3F4NA 4IPNB 4PSPA 2PGFA 1L9WA 3BVJA 4FHAA 4LAUA 4FZIA 3SBFA 4UQAA 4QX4A 3W01A 1XPGA 2J75A 4GZEA 1E1EA 2O9OA 1RVKA 1OX4B 1AL7A 3CEUA 3CUZA 1BWKA 3ZLFA 4O12A 5HJYA 3VIGA 1WQ5A 1TV4A 2Z26A 3KTCA 3UA4A 1IR1A 3VMNA 3LXAA 4QROA 3EBVA 3TZNA 2CBJA 2GJXB 1LL6A 1LQ0A 3H2EA 1TKKA 1OGBA 5H2ZA 4DIAA 1E1FA 2CBUA 4WY0B 1BLIA 1O1HA 3KP0A 1JGMA 5I23A 2VXNA 1EJ7L 3TKFA 4JICA 5F2IA 4DNMA 2REQB 3BTNA 4UMAA 3CO4A 3FJ4A 3NL2A 5LNWA 3N6JA 4JIRA 2C16A 6ENLA 2XH0A 2P8CA 3ZM8A 1TPH1 1UWSA 4B2DD 5A1AA 1K77A 3APTA 3CIXA 2J78A 1FXQA 4RXGA 4UTTA 4O1AA 2FVMA 1IV8A 3R0KA 2GOUA 3WK2A 1FQ0A 1AD1A 3M5VA 3ZJKA 4C7GA 2XIQA 3UR2A 3E74A 3VGBA 3AXXA 1Q45A 4B15A 3UA3A 2A3CA 4PTXA 3BG3A 4N9BA 1GVSA 4WK9A 1XH0A 3AIRA 3LM7A 3AU2A 3D47A 5CZTA 1SSDA 1OYAA 1CB2A 4I5XA 2G5WA 1B57A 4U4MA 3CV7A 2BVYA 3VKJA 1EPXA 3TW6A 3LRLA 3GR8A 2OODA 3BH4A 4KFNA 4JL1A 2ZZ4A 4M7SA 3ORWA 4OGZA 1ECEA 1YDVA 3VX1A 1A5CA 1B54A 4FR6A 3UBPC 3KBSA 2X1SA 2YOCA 3N9SA 4PGLA 4TV5A 5F4SA 1EEPA 1ZAIA 1Y0EA 1XIDA 3MCMA 1HX0A 4KWOA 4AIUA 1YMYA 1W2PA 5D9MA 3WL1A 5IM51 1KBKA 2EPNA 4AIBA 4QDWA 2DW7A 3NL6A 1VRDA 3NXLA 3QZ6A 1HZYA 1CEOA 5G1TA 4OBTA 3W28A 1W56A 3WJXA 2OEMA 1AQFA 1ECQA 3TONA 2XN0A 2AAAA 4FP1A 2I5GA 1OADA 3O63A 4GE8A 3OJGA 1B3XA 2PA6A 1BFNA 3HURA 2NUYA 1DE5A 4JY8A 4XG1A 2YYTA 4GIRA 3GU9A 1DYSA 2ACUA 5BROA 1A50A 2C1HA 2GDVA 3BG9A 3S4TA 1M3UA 1R3WA 5K3VA 5AYBA 3MJMA 4O8AA 1GQNA 3DC8A 4GI8A 3FNDA 4JTGA 1IT0A 2OKTA 2X42A 1IYXA 4NVTA 1RY8A 3L4YA 4GO9A 3LMYA 3GNDA 4AHQA 1DVJA 4OU1A 5GQBA 1VBUA 3F4VA 3QGVA 2ABAA 3BPWA 2WZTA 4D71A 4GKLA 1H60A 1ZCOA 2JKAA 4JEQA 5CSUA 1AQ0A 3M5XA 5BMXA 3TH6A 3UPMA 1DHKA 1HKWA 2F9RA 5DELA 1QO2A 4JTHA 4FNQA 3STPA 3MPGA 2PC8A 2Z2BA 4HU8A 4CQAA 2QCLA 1WKYA 3USBA 1AH4A 3BLDA 4OV4A 2PDJA 1ZSXA 1XX1A 2ALRA 4GGBA 3C3NA 1HQTA 4JN7A 2W79A 4EK7A 5CLTA 2E68A 1V03A 5ECVA 4B2DA 4QS6A 1SFJA 2VRKA 2QCFA 5BU9A 3PTDA 3FHQA 3NQCA 2PU1A 3HJEA 3H7UA 3T8QA 2A0NA 4XO7A 3B9EA 3G1VA 2O0TA 2WM1A 4QG8A 3G0SA 2D22A 4J3SA 2ISDA 2BG5A 3MKVA 1WOAA 2G95A 5LZLA 4W8AA 2VCBA 3C2RA 3CB3A 4FAMA 4M6PA 3BSMA 5DY2A 3W2MA 4HZMA 4QJ3B 5IDZA 4G7FA 4L4PA 4ZOAA 4HIBA 3CTTA 4HA0A 1XYMA 2F84A 1P0EA 4AHOA 3QKZA 4C1NA 1ZJAA 3Q4DA 3ARXA 1KO0A 1LM1A 3YPIA 3E2VA 4GFSA 3LU2A 4TO8A 2GGEA 2NWSA 5I3HA 1CIUA 3UNTA 2PTZA 2X1UA 3OU8A 1JZ2A 5MF5A 2CZFA 4AX6A 4BWLA 1S5VA 3MUCA 1Q65A 3UERA 3LV5A 3B05A 4L64A 3CV6A 3QQ1A 2EJ1A 1OYBA 2QCCA 4Y9NA 1CYGA 3EB4A 3DFPA 1O94A 2R1NA 2XVLA 1QW8A 1NDZA 4RPQA 3ITYA 1BXNA 4D8ZA 2ZQ0A 1K4HA 4IPPA 3LXBA 3LTPA 3GC2A 2W92A 5KEZA 5M1TA 1A0EA 5DN1A 3GFZA 5TQLA 2XGZA 1K02A 4AYSA 1M7JA 2ZC8A 3LLDA 1CXHA 5LGZA 5HPCA 4JQAA 4UQEA 3GG0A 1NH6A 4QSHA 5C9UA 2X40A 2ZWYA 3VDCA 3M9YA 4LYRA 1V93A 3IEBA 4ZOCA 2Z1SA 3IACA 4YTQA 5DCDA 1HL8A 1ZBCA 2ZX8A 4DAIA 1MW2A 1OYCA 3FAWA 3TYUA 1ODZA 4C6KA 4LVGA 2FTYA 1HG3A 2DH2A 3OLGA 1UA7A 3UR5A 5CG7A 4OIFA 4ERGA 1NQ6A 1UQZA 2YA2A 1XG4A 3QY6A 3RX2A 2RGMA 3VOCA 4GBUA 4PYSA 4O10A 3LTSA 2IMRA 2XFRA 3NEHA 3WDPP 3SCUA 1XYBA 5D03A 4A4AA 3O6YX 2NQJA 2WYSA 5MHBA 1T7LA 4OJYA 3CNYA 3PAJA 2VVSA 1EWDA 2NQLA 3ERPA 4WSHA 1FWDC 1UR9A 3BCDA 3TA9A 1K8YA 3VIKA 1ME7A 3L4VA 2VOMA 3WNLA 2I16A 1E70M 3QJAA 1E43A 1YPFA 1XLCA 3VZXA 3WELA 3WBYA 2VWTA 1G7VA 3RU8X 3T0CA 3CV1A 3OG2A 2VZTA 1R0MA 2R9RA 3AYVA 1EP3A 3N2XA 3QQ0A 1TWIA 3T1GA 3AMKA 1PZ1A 3WLOA 2QJGA 2QDDA 3JR2A 5BNKA 4N9EA 3BGAA 1RH9A 4C5ZA 1P5BA 3H26A 3PSVA 1QPQA 4JR5A 4JCMA 1BG9A 3PANA 2FJUB 3URBA 3VIMA 4Q4SA 1MUCA 3VGGA 3AIUA 2PD9A 3V4BA 3A64A 3EX4A 5A8MA 1KV8A 2BOEX 3F5LA 5BXRA 2X7VA 3W24A 2NW0A 1UMYA 2GQ9A 3R89A 3S2LA 4FR1A 3LXCA 4AEEA 1XL9A 5FEPA 3N2MA 1ZQ5A 3FS2A 1CI1A 1POJA 3C5QA 2VGBA 2O7QA 2C6QA 3W7OA 2DT3A 1QBBA 4ZQMA 3FDGA 3KRSA 3CZEA 1RPKA 3SCRA 5CZ0A 3P8JA 1P1XA 4NT0A 3UG8A 1EL3A 4QEEA 4IHCA 2QUNA 3ABQA 5H6HA 3S9YA 2DH3A 4UTWC 2IPFA 4YIWA 5I79A 1AW5A 4Y9OA 2AKZA 2WZIA 5DMYA 3F4CA 7PTDA 1W5OA 3VE7A 1X6LA 3AFBA 3T0TA 5CC3A 3P14A 4F79A 5D2VA 4GCXA 1FP8A 4IWWA 3UWZA 7TIMA 2JE8A 2JKEA 2B7NA 3VZZA 4D2JA 4HCDA 3GY1A 3GK0A 2BV9A 4IFKA 1QWGA 4TMBA 1VRXA 5HPOA 3EZ4A 1WUFA 1AQHA 4P7RA 2QVHA 1UP0A 3KOYA 4UOQA 2CETA 3CASA 3GXDA 3MWAA 3RJYA 3W86A 1RCQA 1A5SA 2IPWA 3GTNA 5EYWA 2GWNA 3MUIA 1U1UA 1KM2A 4YVPA 3RFAA 3NGJA 3B9DA 4PEEA 2LLEA 4GQQA 4U28A 4OTKA 2BNJA 2XHYA 1LLOA 4KEUA 3V18A 3LEPA 2XVPA 3PN8A 2RDTA 2WCSA 1F3WA 4FLOA 5BXPA 3E38A 2PDMA 5JH1A 3HQ1A 4XAFA 5D37A 3UXIA 3NPWA 1J0IA 5FKYA 4DO4A 1DPMA 4H83A 4AW7A 5GVJA 5I3DA 4MMWA 5HR7A 4X60A 3NVDA 4LF2A 3XIMA 4JQ3A 8RUCA 1DQWA 4Z2LA 4ZO8A 3BMXA 4CD8A 3GHSA 5E9XA 3VMPA 3CM4A 3TLQA 3E2QA 3KRZA 3CUXA 4GZIA 1FH7A 4O1CA 3SCQA 2OEKA 4TTGA 1J0KA 2AAMA 4W86A 2WC3A 3CUIA 3GG1A 5CPLA 3RM8A 5HNTA 3VA8A 4YTRA 5A8NA 1YNYA 4B91A 4Q33A 1SJDA 4CVWA 1PXGA 1IT8A 4ZO6A 4K8GA 3VOHA 4WOZA 4JTAA 1VYPX 3UWVA 1DJWA 1XP3A 5AECA 4C6BA 4N2YA 4TX6A 3CEPA 4M5PA 3WUGA 3O1NA 3KS5A 2NX1A 5IBXC 2Y6ZA 2Y62A 4MOZA 4KWSA 1K8ZA 4DBWA 3MSDA 5EY5A 5C0QA 2XJ7A 3QXBA 3SJNA 3SDOA 4JFTA 1W37A 4LTSA 5IRPA 3A13A 4CVUA 2HK0A 4Y6GA 1MW1A 1E0UA 3NTYA 2XDFA 3WIJA 1CGTA 3NQVA 5AC4A 1JPMA 2ACQA 4YCOA 2VT0A 3UY8A 2HZGA 1TG7A 3I68A 3APGA 1GEQA 3GXTA 1BHGA 3EMZA 5E0FA 3VINA 2GL5A 2VDHA 2WMIB 1JD7A 3UWQA 3R11A 3VUPA 5MKGB 3F5JA 2PP3A 5HULA 3TAKA 1OINA 1Q6LA 4HZ6A 4AH7A 4LRSA 5EFFA 3FJ6A 3NSNA 4DELA 4H7VA 5HXMA 4EACA 5BWAA 1ENUA 5HQEA 1XYCA 1QT1A 5XINA 2VQUA 1RJPA 4J1OA 3KLKA 1QCWA 3RCYA 4HPHA 1TZ7A 4MWAA 4WR3A 3AC0A 1UWUA 2A1YA 1LOQA 1FXPA 1FCBA 3UXLA 4ZOBA 1W8GA 3G1SA 2V2DA 1QNRA 4UBPC 4Y9MA 4YYFA 2V6AA 2Q8ZA 1Z69A 2DIKA 5I3IA 3B03A 1OVDA 4MB4A 1KB3A 5HQMA 3IARA 1XLIA 3B0VC 3ECQA 4WZHA 2V5LA 2P0OA 4A05A 5FSDC 4DUOA 3THQA 3UWEA 4XV0A 1KXQA 1JYVA 3GAKA 7REQA 1A3HA 1UUOA 3DAQA 1LLWA 1ZB5A 2ZCGA 2F6XA 1S5TA 3EX6A 4BR1A 1UQYA 4H8UA 4MG4A 1UC5A 2PSNA 1JUKA 3MUXA 2NX9A 4OZOA 1EDGA 3ABSA 4ZR8A 1XLDA 1S46A 4GYJA 2WWDA 2Y7EA 5CPSA 5BXSA 5CSSA 1XUUA 1WO2A 1TIWA 3H12A 1DKWA 1BWLA 1EC9A 3UJSA 4JDBA 1TV7A 2DZBA 1TMHA 3WQ5A 4IH3A 5DBTA 4LBRA 3KVLA 1VCFA 3TFCA 3WO8A 2J62A 2WJEA 3W81A 4XD4A 4PBFA 1SJBA 3B9NA 4CEXC 3GFXA 5T8GA 2NLYA 2BBFA 6TAAA 3GXNA 1CXFA 3WLRA 3TTSA 4OUEA 4FS9A 3H2FA 3CHEA 5A6KA 2A3AA 4UTJA 1ZP3A 3JVAA 4QFUA 1NDYA 3SIMA 3S1XA 4RDZA 2O4QA 5C7VA 4XK2A 3V5OA 2QT3A 4ZENA 3CUFA 3NL3A 4ACZA 1VS1A 4D6HA 1DIEA 4FX8A 1EJRC 3LHUA 2OPJA 2XTKA 1BD0A 1E4LA 1PYMA 4K8EA 3F4WA 3GAYA 1MW0A 1NEYA 5C9ZA 3S6DA 1VEMA 5RUBA 2GQ3A 3CZGA 4TR9A 2Z29A 1QPRA 2PDYA 1W32A 1E9LA 2A3HA 3IUIA 4N6FA 3NPUA 4ZQNA 2CWNA 3KE0A 3DHUA 3QW4B 3ANYA 5CJNA 4UTMA 1FOBA 2RJHA 1M7PA 2C19A 2OZ8A 1JZ7A 5D2TA 4OFCA 4E3TA 4EOUA 4AUBA 3GHRA 2VDGA 4RNJA 3R13A 5BYWA 3C2FA 1TJPA 4GYKA 4O8RA 3W37A 2FVKA 3ZSSA 4NILA 4ATWA 3DXIA 3UGVA 1TTQA 4DWSB 3N2BA 1OC6A 3D6NA 1ME8A 2OLAA 1C91A 5AHFA 2DT0A 1JF6A 3HV8A 3MMWA 1GVQA 1UA3A 2RDUA 3LCGA 3WMSA 4IMEA 4GUJA 2VO5A 3STEA 3KX6A 4I7WA 1UPMB 1K6WA 3VD7A 2QCHA 3IGHX 4PL2A 3KUMA 1JZ8A 1HGYA 2ODOA 5CH9A