3W22A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-125
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-125
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w22A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w22A01
1H63A 1FCUA 4NQ1A 4MFEA 1AW1A 3EXSA 1JRCA 1VHNA 3P80A 3KHJA 3LXBA 5BW6A 4BF9A 2RHGA 1G4PA 2G97A 1OX4A 4L4MA 1OFEA 5KZEA 3OG3A 1FCQA 3MHFA 1ZALA 1PVNA 4E38A 3O6DA 3HG2A 3IIOA 1LORA 2QAFA 4IUOA 3RF9A 3HMJG 1TRIA 2E1DA 1TJPA 4UTWA 2AAMA 2CLMA 2OX1A 4RX0A 4IWWA 4BWLC 1WBJA 1X8FA 5K4XA 4WQ6A 5U4NA 2J6XA 3ABOA 1KTCA 2A7PA 2DZWA 1OABA 1K03A 1EUAA 4Q33A 1B3OA 1OFQA 5HR7A 1LM1A 3TXVA 5BRBA 3LHWA 5CPOA 5BMXA 3TKFA 4PCFA 3H53A 3S0CA 1TPC1 3GB6A 3O1NA 3DFOA 2JKPA 5AOUA 5DBTA 4I9AA 3C56A 2CZEA 3EWBX 4UTLA 2CLFA 3B8DA 3MP4A 4DXVA 3TDFA 3QQ0A 3M9YA 4XWUA 1ME8A 3NQVA 3PVFA 3EWXA 1YPIA 3UXAA 3L5MA 1OX6A 3P8JA 2FQIA 4MY1A 5DBUA 3W84A 1JVNA 5D2YA 4LNYA 3TQ0A 3SIZA 2B7OA 3NVTA 4HSNA 1BKSA 3QPZA 2R14A 1EEPA 3PAJA 3N14A 4KWVA 4JDBA 4NXSA 3VNDA 4JYEA 4XUGA 3L0NA 4FXRA 4MLJA 1W0MA 4I7WA 1DJNA 4C1KA 1QFEA 3EX1A 1KBIA 3PS7A 1H5YA 3GKAA 2WQPA 1NAL1 3CIXA 4O54A 1TPB1 4UFMA 5C55A 1VGAA 1UUMA 1JCNA 3R5EA 5CGQA 4IPJA 3FLUA 3E0IA 1LRNA 1D9EA 2E6AA 1ME7A 3DFNA 4N9BA 2X1TA 2Q8LA 3TK7A 2ALDA 4GUHA 3SECA 4RJEA 3O05A 1UASA 5DXYA 3TXZA 3F03K 2V5BA 3TIMA 2E6FA 1QO5A 1B9BA 4FNSA 4JX5A 1SZGA 4A3UA 1LRTA 2QCMA 2ZZ5A 2ZFAA 2E68A 3CU2A 1G7UA 3M41A 3DI0A 3GXTA 3GDMA 3T40A 3EX4A 4QQ3A 5HWMA 2YR1A 3P82A 1I8JA 1V7YA 1W37A 1TPH1 4IX0A 5CZTA 6ALDA 3NM3A 4N9CA 5G1TA 2H3BA 2V9DA 1G7VA 3L68A 1QWGA 3LHTA 4PA8A 2VXNA 3NL5A 2ZRZA 1HFBA 3W7PA 1XBZA 4E2DA 1TPUA 4HNVA 3T7VA 5AC6A 5LNUA 2B0MA 1A5SA 5FI8A 2FLIA 4WZHA 1ZJIA 4S2CA 3QYQA 3PBUA 4ZQMA 3TU9A 4HKPA 3QF0A 2C18A 3QSTA 4POCA 2Y7EA 3CM4A 3C4UA 1FCBA 2GVLA 3M5ZA 1YXCA 4UXDA 3N19B 1FXPA 4XKYB 4ALDA 1NSJA 2O7QA 1W5NA 2HS8A 1ICQA 3P62A 5IBXA 4HNTA 2HMCA 1JR1A 1SFJA 2HS6A 5CZ0A 4N6FA 3WJWA 3CWNA 1H51A 3DFPA 3C61A 1ZAIA 5HUOA 2QCNA 5K7JA 3MI2A 3QQ1A 2NV1A 1P5BA 1R46A 2QCDA 3I68A 1KM1A 3G1DA 1X1ZA 3P67A 2EKCA 5EY5A 3B0VC 2VFIA 3IV3A 3BV4A 4CQ9A 2NUXA 4UIOA 2JKEA 2H8XA 3W2UA 4NZJA 3RU6A 5CSRA 2UV8G 1Z48A 1TTIA 3W74A 1KFJA 3UZJA 5FEXA 3PBWA 3CWOX 5G1YA 3WJSA 3W2NA 3CEUA 2TRSA 3LCLA 3MBFA 1H62A 2ZA2A 2NWRA 1ADOA 5K9DA 2X1RA 3STEA 3Q94A 2ISSA 3IVSA 1EIXA 1RVGA 2A85A 1FQ0A 1N8FA 1G67A 2NXGA 1A5CA 3SGZA 1VPXA 5C54A 1OG0A 3N2XA 5D02A 1VHCA 3I6RA 4RZ4A 3WJZA 3W1NA 3O8AA 2J27A 4DF0A 1GJPA 1QMLA 3PC0A 2VFHA 3R2GA 1F6KA 3FYOA 2E5DA 2W0UA 2YX0A 5KTLA 3JS3A 1OJXA 4PL1A 2V8ZA 2BZNA 5G4WA 3G18A 2KZHA 4JYFA 5AHEA 1OYBA 3RFAA 3M5YA 3NGJA 2J9ZA 1PCWA 1KBJA 3A21A 4QITA 2NXHA 2NUYA 3TC6A 1YYAA 1O95A 1I2OA 3W2JA 4TU1A 1DHPA 3NAVA 4OQVA 4K8EA 1B4EA 1HO4A 4O12A 1ONRA 2E77A 1FWTA 3HO8A 2QUTA 3W86A 4NNCA 5C5YA 4PL2A 4R34A 1E51A 3NQMA 2RDUA 2ISWA 1H7XA 2WNZA 4JTLA 3O15A 1T0OA 3U8GA 4UMCA 1LCOA 4M5PA 1G4SA 4FX8A 3LRMA 3W73A 4N4QA 3W87A 2ZYFA 3OHIA 1OK4A 4M6VA 3NYZA 4CNNA 2XN1A 3TW6A 5K3VA 1J2WA 1I2QA 5FF4A 5LSMA 4KKXA 3KRZA 4JDYA 3PSWA 3EXTA 2V2DA 3NEVA 3I7SA 4BI7A 1JULA 1X6UA 1KM3A 3C2OA 3TCEA 3C3NA 2BSLA 1LDCA 3Q37A 3CTLA 2NX9A 1OYAA 3M47A 1PHQA 3W1RA 4QSHA 3M43A 5AYZA 2J24A 1Z44A 3EWWA 1ZNNA 3INPA 3OEXA 3QW3A 2PRHA 3LCXA 5F2GA 3G0XA 3MHGA 1TV7A 3VKJA 4LS2A 3M1ZA 3SZ8A 1M6JA 2WSRA 1LRQA 2ATMA 5EL1A 3QJAA 2GQ8A 2FIQA 5DCEA 2H8ZA 1PE1A 4CNOA 4GNJA 4NNAA 4Q4KA 2VEMA 3GDRA 1XI3A 4GUIA 1Q6RA 3DBPA 3U2OA 3V75A 3S5OA 4AF0B 4DO6A 4M7SA 3IVTA 4OV9A 2Z6IA 1EPXA 4MFDA 3GIYA 1FUYA 2C1HA 4GUFA 5E0KA 4JXCA 4CQAA 5AC7A 3QMSA 2NWSA 1GG1A 2F7FA 4A2SA 1AG1O 3FJLA 5SWUA 3W7DA 4JICA 4XTIA 3GXPA 3T78A 4UNKA 4FX6M 1LTDA 5K4ZA 2Y7FA 3BLEA 3HGRA 3S42A 2Q3RA 1PCKA 4MYAA 4EIVA 5J5DA 5L6UA 4HSOA 4LT9A 4JN6A 4UUIA 3GR8A 3NPUA 3TA6A 3NG3A 5GVJA 4UR7A 3W22A 4UTUA 2V2HA 4MYXA 4O28A 4RKAA 4ZMGA 3NM1A 4TMCA 1GYNA 2DORA 4UTHA 2P0OA 5D38A 1Q3NA 5C2XA 3BPWA 3G1YA 5G2WA 3DXIA 4O53A 1WV2A 4Y96A 3W70A 1LZOA 4LRSA 1ICSA 4FB7A 1GT8A 2RFGA 1KFEA 4MUZA 1GOXA 3PB0A 3A9IA 3NXFA 4QM1A 3C2VA 3OVRA 2ZA3A 1GVSA 4MZ8A 3LI0A 3EWUA 3W7HA 1N7KA 4FNQA 5D2XA 1VC4A 4BI6A 1Y0EA 1M7PA 1V5XA 2B7QA 3G0SA 1QOQA 3L9CA 3TSDA 3KVKA 3GAYA 4A22A 4ICNA 2ZTJA 4AHOA 4QIUA 5H91A 3STGA 2DZPA 4C1LA 2G96A 3EKLA 5AYXA 2Q8ZA 2DZXA 1JUBA 3QEZA 4OHQA 2NV2A 1VLWA 2ABBA 5F1VA 2CLOA 2E09A 1QPRA 2NXIA 5LNVA 3G1VA 4WY0A 5T26A 4FNUA 1K7EA 4PODA 2QKFA 3NA8A 3QMRA 5G5IA 4UCGA 2V0TA 3W1MA 3W71A 4JIQA 1OX4B 1DV7A 2Y88A 2V81A 1Q45A 3EKZA 1KFCA 4UTKA 5KZDA 1I2NA 1VYPX 3UXDA 5AHLA 3NQ7A 3S1VA 4GUJA 5D09A 1B57A 4N4PA 1Q6OA 1AL7A 2YYUA 1YXDA 1R30A 2CWNA 3WFAA 2GJLA 3MMTA 2YPIA 3KVMA 3LXCA 3TMLA 4WX2A 1AW5A 3S5NA 3NR0A 1GTHA 4LS0A 4QNEA 5FEZA 5A8GA 1TV5A 3PF3A 4JTIA 4MIMA 2XFWA 1W3IA 3A24A 1GQNA 1DJQA 5EKYA 2I9EA 3BG5A 4O14A 1FWSA 3L5LA 4NUWA 4HHPA 1TREA 1W1ZA 1XXXA 3GNNA 1YDNA 2BTMA 5EMUA 4M7TA 4S2BA 5TBOA 2YFOA 4UTJA 1OF6A 4K38A 5C6MA 2ABAA 4JTUA 1JUEA 4TO8A 3NL6A 1LBMA 1UUOA 4N9DA 4AVFA 3LM7A 3EXRA 1SW0A 5D33A 3UNDA 3OBKA 2TPSA 4O11A 1WBHA 2VEKA 5FF0A 5G4EA 4RZ5A 2JGQA 5EA9A 4WY0F 2QUVA 4JEQA 4JTHA 3S8HA 4JTTA 5F2MA 1QCWA 2A1YA 1VZWA 4R53A 5CZJA 3W7GA 1ML1A 3HF3A 3W23A 2RKXA 3A23A 3QZEA 3ANYA 1VR6A 3EX2A 2GUUA 3W9ZA 1JCJA 3P74A 1HUVA 3ZR4A 1SSGA 4JTKA 3RMJA 4CQ8A 1SO4A 4AEOA 5HWNA 1VRDA 1QAPA 4PC8A 5KINA 3KOFA 1F76A 2QCDB 4Y90A 1DL3A 4RZ6A 2QCHA 3GXNA 2QJHA 3G1FA 1SR9A 2IQTA 3NZ1A 1LBLA 1ZAJA 4CCEA 2OMAA 2R94A 4DPPA 1H7OA 1FCVA 2V82A 5U7SA 3NQCA 3G22A 3W2MA 1W31A 3GX9A 3PG9A 1KW1A 1G4TA 1TTPA 5FESA 2VFDA 4JTJA 1AL8A 1SZNA 4FHAA 5D30A 5AB3A 2DP3A 4O0ZA 3ELFA 3PG8A 3EX3A 4PEKA 1A53A 1EA0A 3M0ZA 4ADUA 3DFQA 1H61A 1WX0A 3MWAA 3QFEA 5F4SA 4CCCA 3G8EA 4OV4A 3HOJA 2WOQA 1RQHA 4X3ZA 4Z08A 3MHUA 1XBXA 4GWEA 3EWZA 4AWTA 5I3IA 3BW2A 1SO5A 1KM0A 4ZQRA 3UWVA 4D2JA 3WK1A 1SQ7A 2DZUA 3GDTA 1XDLA 2ZZ4A 4M6QA 4O8RA 4WXYA 3RLUA 3H54A 4GBUA 3HG5A 4LV9A 2GJNA 1J5TA 1KM6A 2PRLA 3O6CA 3S1XA 5AN7A 1L6WA 1LLZA 3I7QA 5FF2A 2Y70A 4QJ1A 5HULA 4WXZA 3LTPA 3P8IA 3UWZA 3V1PA 4RLIA 1T8XA 4P61A 3M5VA 3DKLA 5CPNA 4H6KA 4X9SA 4TIMA 1ALDA 4H4IA 1LOQA 4MJMA 4ONVA 3LCHA 1SPQA 2C0AA 3W1PA 4AHPA 3RLVA 4UFHA 4NJKA 3FJ6A 2PE4A 4NU7A 3TE9A 2Y89A 3WK2A 3F1QA 4Z1AA 3BGGA 1XUUA 3R13A 3W7RA 2ZZ3A 1GYLA 3C6CA 1F2JA 1I4NA 3KVJA 1Q6QA 3BARA 2DZVA 2VFGA 2NUWA 3IIPA 2W6RA 1I2PA 1K8YA 3GLCA 1K8ZA 1K7FA 2I1OA 3N3MA 5K9XA 3BW4A 5AYYA 3S5ZA 4QAIA 2QJIA 1L9WA 1SZEA 1PS9A 2A5HA 4Y6GA 3THQA 3CEPA 2NX1A 4S1FA 4Q32A 4O4VA 1SSDA 1T99A 3DFSA 1TIMA 3MW7A 4AWSA 2EHHA 1SO3A 2YW4A 3LHVA 4GXMA 4XQ6A 2QCEA 1KLYA 1TQJA 2CZ5A 1KLZA 1NEYA 4O16A 1IIGA 5F1UA 2X16A 4OGZA 3RK8A 4UMAA 1JCXA 1T96A 2TMDA 6TIMA 1WQ5A 1K02A 1H50A 1YTKA 3G24A 4LUIA 4ZQCA 2QJGA 1EP1A 1XC4A 4M6PA 5DELA 4ZQNA 2A0NA 1WXJA 3S1UA 1UJPA 4AXKA 1WAUA 1OFBA 3O16A 4HIBA 1LOLA 2VEIA 4U28A 5FF3A 5IM51 1FXQA 4YLWA 3IVUA 1P0KA 4CCDA 2NLIA 1EWDA 4K37A 3GAKA 4MVAA 1I45A 4MY8A 3HPZA 1Q6LA 3SGUA 3TQVA 3ABSA 5AFDA 2C6QA 4LTSA 8TIMA 5TIMA 3G1HA 3KRSA 1KM2A 2FPYA 2YCEA 1O60A 2H6RA 1K3UA 3TJLA 3MO7A 2YDAA 3HBLA 4E0CA 3LRKA 5BNKA 2WO5A 3NL2A 5FEWA 2G5WA 3WJXA 1K7XA 3TAKA 2NX3A 3SFKA 1HTIA 4K39A 3E02A 3IEBA 3W83A 1KFLA 3E49A 3ZFHA 3DHFA 1CW2A 3GVGA 2ZRYA 4O0KA 2X1SA 3LERA 1TRDA 5DCDA 3LDVA 2D73A 2VOMA 2RDWA 1KTNA 1XBYA 1RR2A 1IF2A 3LTYA 2CLIA 4HNNA 1YTDA 2QDHA 3KVLA 3M44A 2CFFA 4IMDA 4EF8A 4BI5A 5CPMA 4WOQA 3W76A 4QNWA 3NO5A 2WJZA 3P7YA 1IXNA 1QOPA 5HUPA 3CB8A 4UC5A 2ZRWA 3O06A 3S1WA 3C2FA 3PUEA 4Z0JA 2HSAA 1O5XA 4FEZA 4JGDA 1M7OA 1TJRA 3NOEA 4LVDA 4O52A 4GRSA 3VE7A 3NPVA 2P1FA 1TPVA 4WD0A 3S9YA 4M19A 5G2IA 3BK0A 3TROA 5ABTA 3HPXA 2QCFA 3B06A 4MJZA 4NJIA 1N55A 1W5OA 2YW3A 2A7RA 2DZTA 3G1SA 3FOKA 1RQBA 2C15A 5AC8A 3N2MA 1C9DA 1QR7A 2EPHA 1DBTA 3C8FA 1QPNA 1TSIA 5LNRA 3DH7A 3LI1A 3NPWA 2QUUA 3O6YX 3DFTA 5A5WA 3N9SA 4RCXA 3IRDA 3NDOA 4K7YA 2V5LA 4DEFA 1WOBA 3HGJA 2CW6A 4LUJA 3DENA 5HJLA 4Z0SA 3L2IA 1GTEA 2CLKA 4JYDA 1EP2A 3L21A 5KMYA 5I3HA 2AGKA 4EVZA 4FNTA 4NXKA 4O1AA 1LYXA 4DF1A 3LBCA 3SY5A 2H90A 3DKJA 4EWND 1FY6A 3QH2A 1MO0A 3T4CA 3PY2A 3G1XA 2ZDRA 3CHVA 3BLIA 3THAA 1TPWA 4BWLA 1XUZA 1ME9A 1Z41A 4UTIA 1QDSA 2ZQ0A 3O63A 1G69A 4JS3A 5KZMA 3SSJA 2ZBTA 2FB2A 5BMWA 3WK0A 1XDMA 3SI9A 4DBEA 1S5WA 2BLEA 3W7OA 4XKYA 3BGJA 1LOSA 3GDKA 5F4XA 4IGHA 3ATYA 2GQAA 2J88A 3LLFA 1W3NA 3M16A 1TPEA 1XFBA 3BG3A 4U4MA 4GUGA 3DAQA 4AF0A 4Z1BA 1VS1A 4EOUA 3B03A 4UTMA 2V30A 3LTSA 5AHMA 4N02A 1O94A 4QISA 3G0UA 3NL3A 3NQDA 4JD4A 1MXSA 4O1BA 2C13A 2QEZA 3R89A 4X22A 3FKRA 2VEPA 4IQLA 4JY8A 3C52A 3F4NA 5I3KA 2CLHA 1PIIA 1JCMP 1LP6A 1FDYA 1MEIA 2RDTA 1H7NA 3S5YA 1FDZA 2DJXA 3ATZA 3MP3A 3PUOA 4CNPA 1PHWA 2A7NA 5DLCA 3B04A 3C0JA 2CLLA 4UR8A 3C2EA 2A6LA 3PBVA 2PCQA 3IIXA 1YTEA 3ZWSA 4W9TA 1MZHA 2WNQA 3SJ3A 4YCPA 2CU0A 3BO9A 4ML9A 4MZ1A 2H3DA 4KFOA 5H2ZA 2ZZ1A 2B7PA 3DU0A 4K36A 2QAPA 4ADTA 1IXOA 3A5VA 5D03A 3TC7A 3QC3A 1BEUA 2CLEA 1IXQA 4Y8FA 1TPDA 3FFSA 2QDGA 2A6NA 1HO1A 4LVAA 2ZTKA 3CQ0A 4RK8A 3G3DA 4IJBA 4YL2A 4WJEA 4Z1DA 1SW7A 4DO4A 1H7WA 2XN2A 3NNTA 4BFAA 1HL2A 4B5NA 3MI6A 1R47A 2JBMA 5LHFA 3IGXA 2DZSA 3W7EA 2EAWA 4AWUA 1H1YA 2F84A 1ZCOA 4AMAA 1WDWA 3NQ8A 1DVJA 3HGOA 3L5AA 3ZWTA 3WK3A 1S5TA 2Y61A 3F4WA 1MEWA 3B05A 3P60A 4RXGA 4O10A 1SO6A 1W3TA 3ABRA 1M5WA 1SU5A 4MOZA 1YPFA 2ZA1A 3MI3A 4ZZ9A 4IMEA 5LHEA 5EYWA 3PM6A 4LV4A 1OFDA 2CZFA 1IGSA 4MY9A 3D0CA 1OK6A 5KSWA 4LS1A 1UBSA 1OF8A 4JTFA 5CPLA 5I3FA 4AH7A 3W1TA 1DQXA 1WYIA 3GKFA 1U5JA 1ICPA 2X1UA 4K8HA 1OVDA 1IIHA 2W79A 2XN0A 4K6AA 5DN1A 1GG0A 4RR4A 3LV6A 1JCLA 4KFNA 3W7QA 3HJZA 1F05A 5TQLA 2DJLA 3R12A 1OFOA 3KFTA 4IMGA 3LV5A 3W1QA 3U6WA 3EB2A 4H3DA 3LCGA 3GR7A 2E5CA 4Y9AA 4O50A 5K2ZA 4O1DA 2Q3OA 2FJKA 1G6CA 3TW7A 2JK2A 3LB0A 1XKYA 4A29A 1W5MA 1F6PA 2EGZA 2Y62A 2J9YA 1TTQA 2Z2UA 3QW4B 1ZAHA 2Z1BA 4OBTA 3TMQA 4LU0A 4LRTA 3W1UA 5LGZA 4AB4A 2ZCGA 4CLMA 3B0UX 2R8WA 2R91A 4JX6A 1X7FA 4TX9A 3HG3A 3TH6A 5D37A 5I3JA 3L0GA 3SR7A 1AK5A 5D05A 1BWKA 3USBA 4JTEA 4A21A 4JIPA 4LC6A 4HPJA 3W2LA 1LROA 1KTBA 4K7VA 4A2RA 4ZVJA 3WJYA 1TPFA 3NQGA 3GZ3A 4XBSA 1GPWA 4PFMA 3OIXA 1K8XA 4AAJA 1QO2A 2ZRVA 1VYRA 1G4EA 4FO4A 1RPXA 2PURA 3CT7A 3R8RA 3C2RA 1TV8A 3UPBA 1UB3A 2FPVA 4G1KA 4OU1A 5G2HA 3EX6A 4O17A 3PBYA 4OT7A 4IPIA 3PWAA 3W1XA 1RV8A 4XZ9A 3UWQA 3VI2A 3A22A 4NNBA 3SW6A 4PH6A 4NVTA 3GK0A 1W5PA 3AJXA 3LBMA 3AO0A 3N73A 4LVBA 5BOOA 1LLWA 1Z42A 3I65A 4FNRA 3M5XA 4I7VA 3VCRA 3FEMA 4MKNA 4YXGA 1R2TA 3T44A 1QPOA 5LGXA 1JRBA 1YXYA 3EEGA 3UWYA 3ZS4A 3W85A 2NZLA 1VYSX 1X1OA 1H7PA 4IOTA 1EX5A 3NQ6A 1GWJA 3IIZA 3QMTA 1P4CA 2GVGA 4JX4A 4IXHA 4NX5A 3FKKA 2VFFA 2ZZ2A 2OZ0A 5LZLA 1MSSA 4FNPA 3W7NA 1DKWA 2FTPA 1FWNA 3W1AA 1OX5A 4GC4A 4LVFA 4O19A 2OCZA 2ZRXA 3FA5A 4OWGA 3UY7A 1KM4A 2B4GA 1VCGA 2JGYA 3M6YA 5K9CA 1TB3A 4YMZA 3BLFA 1BWLA 4WOZA 5LNSA 5E93A 1DORA 1FDJA 3TUUA 3UWUA 4JTGA 2VENA 4LW7A 5DXXA 1W54A 3STFA 4LVGA 4NT0A 3VFLA 2QCGA 3KXQA 3W6YA 1VH7A 3FYPA 4GFSA 3HPSA 3P61A 3S6DA 3ABQA 4ZQOA 3BW3A 3A5FA 4DPQA 4I7UA 2C14A 3W75A 3W7CA 1C29A 2ATSA 2X30A 4JY9A 1A5AA 3O07A 5HMSA 1R2SA 5CKSA 3L66A 5AHFA 2BXVA 3QM3A 3I7RA 2G95A 2CZDA 2X2GA 2FFCA 2J9XA 4MPQA 3PUDA 4IXXA 3VE9A 3BG9A 1L6SA 1YLVA 3LCWA 3LHYA 5DY2A 1OFPA 2LLEA 3NPXA 4BK9A 3UQNA 5AHIA 1TYGA 1GVQA 1S3HA 1ZFJA 5MHBA 1H1ZA 2WPBA 1OFAA 1SW3A 2TYSA 4J9JA 2YGYA 1UCWA 1VCVA 2Y85A 4P2VA 4WY0B 1FWRA 4NJGA 3UZ5A 1JQXA 3PR2A 4JNMA 3PSVA 2YYTA 3IGUA 2EF9A 2P10A 2ZZ7A 4FF7A 1A5BA 2E5BA 4WUIA 2YFNA 3K30A 1EB3A 3W72A 2WSQA 4N6EA 2YSWA 3P84A 2RH9A 3TX9A 2VFEA 1C8VA 1TCDA 1TMHA 2PRMA 4XTDA 5F4WA 3MYOA 3Q58A 3W7KA 3G8RA 1H60A 3LXAA 3UWWA 4PTNA 1XBVA 1YDOA 4O1CA 4HPXA 1LBFA 3W1LA 3MYPA 2B7NA 1QNVA 3W7IA 2A21A 2GVJA 3MBDA 3H55A 2WKJA 2PC4A 3FIGA 1I2RA 3LOTA 1YDVA 2C16A 1A50A 5J5RA 1FX6A 1VCFA 3DI1A 5D32A 5HQEA 1ZENA 4GE8A 4HT3A 4BR1A 3GDLA 1TO3A 4N9EA 3UD6A 4R33A 2GPTA 3GYEA 1JCYA 1B4KA 4E2BA 4UNLA 3HGSA 3P81A 4UMBA 3NQAA 4IMCA 4LY8A 4RV8A 1DOSA 1F73A 4UFJA 1NF0A 2O7SA 3TFXA 5LKYA 1GVFA 5CSSA 1EUNA 1JJKA 2Y7GA 3OVQA 4MZYA 3E96A 3CC1A 4FX7A 7TIMA 3TSBA 4L4LA 3TJXA 2VELA 4FIQA 1VJIA 3HG4A 5FEPA 1BTMA 4LC8A 3TFCA 5AHNA 4DBDA 1VQTA 1W8SA 3NZRA 1EP3A 2BWGA 2ZZ6A 1RD5A 1F5ZA 4GJ1A 2WNNA 4RXFA 5L9FA 3MJYA 2QF7A 2BX7A 1THFD 1KV5A 4AHQA 2YXGA 3UPWA 5F2LA 4X2RA 1SUXA 3W3OA 1PL9A 2HTMA 4NZFA 5F2IA 4HNUA 3LRLA 4UFLA 5IBXC 1F7BA 3HIJA 3L65A 1JQVA 2E6YA 2I14A 2FPTA 4ADSA 3TQKA 1YADA 1L2UA 3JR2A 5FF7A 4KWWA 1P0NA 3LX9A 1XL9A 3P5YA 1TQXA 4LOCA 3TSMA 3CPRA 3KAOA 3T55A 1W5QA 1TTJA 3W7MA 3IIVA 1XCFA 3NQ2A 4FXSA 1CX9A 1RZMA 3DHDA 1SZFA 5CZSA 1FWWA 4HN4A 1QPQA 3FS2A 3MUXA 3W88A 2Y6ZA 4O4WA 5KITA 3LHZA 4UTTC 3L67A 4O13A 1CI1A 1OHLA 4ZQPA 4DF2A 3M7WA 1F74A 4FIRA 1WA3A 4IX2A 2A2IA 4YWIA 1J4EA 4ZL1A 1AMKA 5HR6A 4UFIA 5D2WA 4N2YA 3W07A 2YZRA 1FBAA 2ZRUA 3EWYA 1U83A 1P1XA 3CLMA 3LHUA 2FDSA 2GQ9A 2AQWA 3B4UA 1GEQA 2E6DA 3TAOA 2VC6A 2QCLA 4IMFA 5CG7A 1PV8A 3TV8A 2Z6JA 1HG3A 3E9AA 5DCBA 3PULA 5LNWA 4DQWA 4O15A 2Y63A 1O4UA 3G3MA 2VKZG 5DY3A 4UTTA 3LCFA 3LCIA 5D2VA 2QCCA 3W7JA 3TNOA 3UY8A 3W2KA 2ISVA 1ZY9A 4ORIA 1OFRA 3KX6A 2TSYA 4LWWA 4NJJA 3OVPA 3E12A 1S5VA 1EWEA 3OA3A 1OYCA 2C3ZA 5I3GA 4TR9A 2OT0A 3LLDA 4XBKA 2OJPA 4NJHA 3QRHA 1IXPA 5E1QA 1WOAA 3BVJA 3QPYA 4O18A 5D04C 4ORMA 4JTSA 2WSYA 1L6YA 4EF9A 5HNRA 1KA9F 1GVOA 3NQEA 3L0KA 1KM5A 5EBUA 3DGRA 3TR2A 1VLIA 4YCOA 1KFKA 1KFBA 3W7LA 3RNDA 1RQEA 3HQ1A 3Q2DA 3PB2A 1XM3A 3G1AA 1JUKA 1NVMA 5EPDA 3N34A 1D3HA 3B0PA 3QSRA 1H7RA 3MP5A 3P5ZA 2A4AA 1NF7A 2C19A 3YPIA 4UFKA 2QR6A 1AW2A 3HB9A 3GNDA 2DU2A 1R2RA 5D2TA 1GZGA 3IGSA 1MEHA 3NQFA 1KV8A 4JR5A 3N9RA 5HINA 2OT1A 4UTWC 2Y7DA 4NX0A 4MLRA 3UYCA 1ZHAA 2Z0IA 2FB3A 3CIWA 1GVRA 4KFPA 5HWJA 1D3GA 1SFLA 4TMBA 3DZ1A 2V2CA 3KRUA 1O5KA 4OE7A 1DQWA 4DELA 2GOUA 1NFBA 4Z1CA 4DO5A 3STCA 2JKAA 4R7JA 3JRKA 1W56A 3LGEA 4O57A 2WV8A
chains in the Genus database with same CATH superfamily
4WDUA 3GR4A 3HQOA 4MFEA 2X09A 4FPSA 1JRCA 1VHNA 4FP1A 3P80A 3KHJA 4GYPA 5BW6A 2RHGA 1G4PA 2G3MA 3L4YA 4DUXA 3ZXWA 4CUCA 3VKAA 4Q4QA 1OFEA 2AKZA 3UGVA 4ZBCA 1R87A 1UH3A 3O6DA 5FSDC 3HG2A 1D8CA 2QULA 1JCTA 4XAGA 1TRIA 1B30A 3C3UA 4DI8A 4EKJA 5LA0A 2IKJA 4WQ6A 3ABOA 4AU0A 4AX6A 1KBLA 3C2YA 2DZWA 1QI0A 1OABA 4Q8VA 5AVHA 1B3OA 2VEFA 3TXVA 1JZ2A 2XH4A 3TKFA 4LPCA 1P0BA 1F07A 1UQYA 4W7WA 5AOUA 3EWDA 3SUSA 2CZEA 3EWBX 4E3TA 3W25A 4UTLA 2CLFA 3MP4A 3OTRA 2WKLA 1R3WA 2QYGA 3M9YA 4KH2A 1TVNA 1XLJA 3PVFA 3UXAA 2FQIA 5IDIA 1QWKA 5D2YA 3SIZA 4B3LA 2EPMX 4DI9A 2PDPA 3QPZA 3B8UA 5JQ9A 4MDPA 1EEPA 3TLQA 3N14A 3CUXA 4FLQA 4HU8A 4JDBA 3VNDA 4JYEA 2Q8XA 4LX4A 3ZLFA 4HZ6A 4I7WA 2Z2BA 3ABZA 1J01A 3NDZA 1XGDA 4A35A 4S3KA 1JD9A 2XZ7A 4R7OA 3WDRA 1S5NA 4LSBA 1QNOA 1UUMA 3THCA 1LG1A 3BAIA 4H7ZA 1KXQA 2Q8LA 3DHUA 2ALDA 3SECA 1UASA 4QE5A 4PUKA 4FNSA 1JNDA 1SZGA 3UG4A 3CU2A 5EFDA 2XH2A 4GO9A 4H7VA 3GDMA 3E0FA 4JTAA 2R1LA 4QQ3A 5HWMA 1HX0A 4IX0A 5C9WA 2DUZA 4GQBA 6ALDA 3U7BA 4EPKA 2H3BA 5ECUA 5EMJA 3NL5A 5AC5A 2ZRZA 2W63A 3W7PA 1O5QA 1TPUA 5LNUA 1A5SA 5AYBA 3O3RA 3C86A 2F2HA 1RY0A 3QYQA 3TU9A 3PPHA 3N2BA 2C18A 3QSTA 2J7CA 4POCA 4HTYA 3M5ZA 4UXDA 4XKYB 2AAAA 1NSJA 1EJUC 1W5NA 3QR3A 1ICQA 1SJDA 1R3RA 3P62A 3UA4A 3RDKA 4H01A 3CWNA 1N82A 5FSEC 3K46A 3IV3A 2Q71A 3SURA 1BLIA 1I1WA 3BV4A 3H26A 4CQ9A 1EYWA 1RJQA 4OECA 1RCXB 4UIOA 2H8XA 3CUIA 3U5YA 5CSRA 1OBAA 4HZ8A 3U4AA 1EBHA 2UV8G 1Z48A 3APGA 5BOFA 5FEXA 2DV0A 5G1YA 3W2NA 3QYSA 2TRSA 3COTA 1SFSA 3UPMA 2C91A 3TWAA 4L6DA 3DC0A 3CV1A 5K9DA 1XYLA 3STEA 2WCGA 4LEQA 4PFHA 4WKFA 2G0WA 3SGZA 2G50A 5G1MA 5C54A 1J0HA 3N2XA 1B2YA 1BTCA 5TD4A 1VHCA 1DIEA 1QPKA 3MMWA 4RZ4A 4P7LA 1UP2A 1PXGA 1GJPA 3R2GA 3FYOA 1FVPA 2E5DA 4PL1A 3KE0A 2BZNA 2GWGA 1BSLA 1QW9A 1QHZA 4D1IA 3NUKA 3IJ6A 1RHCA 4BZYA 1BKHA 2J9ZA 3NXLA 3DG7A 1O95A 4BF5A 4S3FA 3GXDA 4LAOA 4TU1A 4CQDA 4OQVA 4WHBA 4J35A 1RBOB 1HO4A 4XO6A 3HO8A 4AX7A 3HA1A 2YBVA 4JFVA 3BUVA 2VR2A 3O15A 3VZZA 3DYOA 1E0VA 4UMCA 5GJMA 4M5PA 4M24A 1CGYA 3DERA 1EQCA 4N4QA 2WJFA 3VGEA 3OHIA 2XFYA 4M6VA 3VIOA 4U5IA 3H21A 3W01A 3B97A 1I2QA 4KKXA 3AYVA 3I7SA 4C91A 1CYGA 1JULA 1X6UA 3VMPA 3ECQA 2PTZA 1XQKA 4GHRA 3Q37A 3CTLA 2X0YA 1KRAC 2YCKX 3T42A 3W1RA 5AYZA 3OEXA 1ZP3A 3WEOA 3ARQA 3MHGA 1TV7A 4GIAA 3H7RA 3VKJA 3M1ZA 3SZ8A 5I7GA 2WSRA 2ATMA 5EL1A 3QJAA 1RUSA 4C1NB 2GQ8A 3N04A 4Q4KA 4XIMA 3T05A 4ZOBA 5HQMA 4LNCA 1Q6RA 3U2OA 4DO6A 4AF0B 1XDJA 2BY2A 3K13A 4AQLA 2GUYA 3BOXA 3R0KA 5E0KA 3QMSA 2YL6A 4A2SA 1KKOA 4C60A 3T78A 3PPFA 2NSXA 4E6MA 1U1JA 3BLEA 5K4ZA 1JI2A 3S42A 1JDAA 4MYAA 4IIHA 4UQAA 2E9BA 5F7UA 5L6UA 3L4VA 3GR8A 3LBOA 4JQ3A 3NPUA 2BHUA 3WDQA 3NG3A 4E8GA 4UR7A 2V2HA 4MYXA 4RKAA 3HQPA 2CHRA 4MB5A 2P0OA 5D38A 2PDHA 1MQQA 1GHSA 1XQLA 4U3AA 1GT8A 2RFGA 1KFEA 1PTDA 1DXIA 3GTXA 3M0LA 4I8DA 4I5UA 4YVVA 1J6OA 1OZQA 4WSHA 4QM1A 3C2VA 2ZA3A 1GVSA 3WNLA 3EWUA 4FNQA 4HPHA 4IP4A 5D2XA 3VNZA 3BSGA 4D71A 3CNYA 4BQ5A 1M7PA 1PSCA 1V5XA 1V3HA 2Z27A 1VFSA 2B7QA 1FHVA 3GDBA 1QOQA 3L9CA 3TSDA 3M64A 4A22A 4ICNA 2ZTJA 1ZU8A 5H91A 4JHMA 1Q8JA 1MUCA 2QXWA 5AYXA 3QEZA 4OHQA 3R79A 5F1VA 4QLKA 4K8GA 1W8GA 4WY0A 4FNUA 1XIMA 2QKFA 1EJ7L 3QMRA 5G5IA 2CZVA 4IG2A 2OKTA 3W71A 2FGZA 4MMWA 1IT7A 5CSYA 2CNCA 3REQA 3S5SA 2V81A 1Q45A 4F79A 3VZXA 1KFCA 3BH4A 3AXMA 2ONEA 3UWEA 3H4WA 2EXOA 1WKYA 3AMGA 4JQ2A 3UXDA 3NQ7A 3S9IA 3S1VA 4B16A 2GJLA 1B0IA 3AHVA 4NZ4A 3V5CA 1DQUA 1TV5A 1TKKA 1DJQA 5EKYA 2PS2A 1R9ZA 1FWSA 3L5LA 1FWFC 3EMCA 1US3A 4YNGA 2P3ZA 2OPJA 1W1ZA 4ERGA 3VO0A 1M53A 1P0EA 1YDNA 2C1GA 5EMUA 4M7TA 5TBOA 4JTUA 1LBMA 3LM7A 3WBXA 5D33A 3TYBA 1X98A 3UNDA 3R43A 1GW9A 1WBHA 5FF0A 5G4EA 4JFWA 1E0WA 3ARSA 4NILA 2DZAA 4JTHA 2BHZA 4DNHA 3WL0A 4JPGA 2A1YA 1BYDA 2YCIX 3AALA 3QZEA 2V6AA 1Q65A 2HVMA 3W9ZA 1WDQA 3SCOA 5HNNA 2Z7KA 4PBFA 2WAGA 5BU9A 5HWNA 1F76A 1M65A 2QCDB 4Y90A 1LLOA 2QCHA 2QJNA 1CGVA 2QJHA 3G1FA 1NWSA 2IQTA 5DFAA 4H04A 3SY1A 1OGSA 2VT0A 2RGLA 1H7OA 2V5KA 7PTDA 4GYKA 3NQCA 3G22A 1W31A 1G4TA 4EXBA 1AL8A 5AB3A 3G6MA 4UR9A 1VENA 1H61A 1NM9A 2RUSA 3IJ9A 1FFRA 3LNMA 4ZTYA 3U2CA 5LIXX 2ZXAA 1EXPA 3WK1A 1IR1A 3FHQA 1SQ7A 3UP8A 1D2KA 4X60A 2X0HA 4WXYA 1E6ZA 2AOSA 7ENLA 4RV3A 1UWTA 1DE5A 3O6CA 5AN7A 2R82A 2WC7A 3JVAA 5LXEA 2V3FA 4AG0A 4JL2A 1LLZA 5FF2A 1FWEC 2VUNA 3EBVA 1A3XA 1HP4A 3SAZA 4WXZA 3LTPA 3UWZA 4NG3A 1GJUA 2DFAA 5CZKA 3VFCA 2OOFA 3LCHA 4DYKA 4C6DA 1IYXA 3MMUA 4NJKA 2P76A 2J79A 3FJ6A 4DWSA 3VA8A 3AXKA 5KETA 1MFVA 4BEQA 2ZXDA 1KNWA 3F1QA 1NTHA 4Z1AA 4GNVA 1AJ2A 2O9TA 4H9TA 5T9CE 3C6CA 2QJMA 1SMDA 1I4NA 3BARA 1VBJA 2VFGA 3LGGA 1M7XA 2W6RA 4UOQA 1X97A 3AQUA 4RL3A 3LLXA 2PLMA 1XLDA 3HV9A 4RNHA 5K9XA 4PEEA 3BW4A 4XUYA 2ZUWA 4PSPA 4AZHA 1I0DA 1DJIA 1BVWA 1L9WA 2V5JA 4KWSA 1SZEA 4Y6GA 4S1FA 1SSDA 4NI8A 4PN2A 4DM2A 1HKIA 5A94A 3WBEA 3BOLA 1ONWA 1E56A 3LHVA 3QOKA 3WX7A 1KLYA 1TQJA 1EDGA 1IIGA 3ZM8A 1FKXA 4KGLA 3W29A 2P3EA 5D8ZA 4PTMA 4F3HA 3GY1A 4X9YA 6TIMA 3VIHA 4G9PA 2QIIA 3R8GA 1EP1A 2FZBA 1XC4A 3W26A 4ZQNA 1UR4A 1BXBA 3S1UA 4LYPA 4PTDA 3T81A 2A3HA 3T8LA 1OT1A 2INEA 4L9YA 2VEIA 3C5QA 2WLZA 3IVUA 4CCDA 2WB5A 1K8CA 4K37A 3MANA 4GISA 1I45A 1AMYA 1UIPA 3TQVA 4AD3A 2DDXA 4LTSA 3KRSA 5HJYA 2YCEA 2VVSA 4JFSA 3TJLA 4S38A 5BNKA 2NV9A 3NL2A 2HXTA 3VNJA 5FEWA 3WJXA 1KBBA 2G3IA 4HP5A 3ZFHA 2IS7A 2DSZA 3FDKA 4MWAD 4ZTXA 2BVDA 1TRDA 3VOFA 2D73A 1B3WA 2QGHA 2VOMA 1XBYA 1QTWA 1RR2A 1Q4NX 3GIPA 4RPQA 2CLIA 1GKRA 3PPCA 1KRCC 4R88A 3WD2A 4UB9A 1XYAA 2XJ7A 4GXWA 4I3GA 1UD8A 5CPMA 2P0IA 2FGLA 1MYRA 3MKVA 3UJEA 1G0CA 1VFFA 3GXFA 3KRBA 2PWHA 2WJZA 3CHFA 4PMZA 3RILA 2GGJA 4ZFCA 3VDGA 3LGDA 3C2FA 4P7OA 2A3LA 2IQ0A 3PUEA 4Z0JA 2HSAA 1O5XA 3WUEA 1M7OA 1TJRA 4HD5A 3VE7A 3F5KA 3FXYA 3NPVA 1K77A 3D46A 3S9YA 3VD4A 3TROA 2IKIA 2BV9A 4M3PA 2C79A 2VZOA 3FVMA 3QGKC 2WWDA 2YJQA 3FOKA 1B9ZA 1CCWB 2HPMA 1CBGA 3L4WA 5JBDA 2C15A 2PLCA 1K1DA 2XIIA 5AC8A 4CNTA 3BAJA 4Z2KA 3OVGA 4GY7A 2YDQA 2HVOA 1DBTA 2V67A 4FK9A 5LNRA 3S47A 4JEJA 3NPWA 5A5WA 4W7VA 3WQEA 3IRDA 3OU8A 4Q7BA 4K7YA 2DPEA 4DEFA 2CW6A 1G01A 4H41A 4Z0SA 3AS1A 3L2IA 2CLKA 2ACQA 1E6SM 3SFWA 4GLEA 5KMYA 4EVZA 2VM8A 4FNTA 5A69A 4Y9MA 1FTXA 3WLJA 4F9DA 3L2LA 4Y2WA 4GYFA 4DF1A 1JEZA 2EPOA 3SY5A 5C9ZA 3DKJA 3PUGA 4EWND 3T4CA 1V3JA 1Y5XA 2ZDRA 3BLIA 1XUZA 4FR6A 1E1CA 1UWRA 3VGHA 2VVNA 4G6CA 5C71A 3WH6A 1G69A 4LF1A 2GWNA 2ZBTA 2C1IA 4DBEA 1S5WA 4NP7A 4P7RA 3USZA 4L4OA 4XKYA 2H9AA 3ALFA 4ZCWA 4LUSB 3T1GA 4IGHA 3ATYA 4OBSA 2GQAA 3LLFA 4J28A 3VIKA 4MF4A 4E8CA 3DAQA 4PCSA 3TOPA 1VS1A 3RXZA 4EOUA 3DX5A 2V30A 3F4CA 5C8BB 5MF5A 1FRBA 2GJXB 3MKCA 4C7DA 3ARWA 4X22A 1XICA 3NO3A 3KTCA 2VEPA 1Q7MA 4IQLA 3CTTA 4J5NA 3WN6A 1JCMP 1VJZA 1IV8A 1MEIA 2RDTA 2VGBA 3WY1A 1EC7A 3AIBA 3PK7A 3WQ8A 4W8LA 2A7NA 2X7VA 1VEOA 3EMQA 3V36A 3RR1A 2NQJA 1WP6A 4GABA 2OZ8A 4UR8A 4HYVA 4B15A 1S38A 3T08A 3TA9A 3ZWSA 1XCXA 2YKKA 1E6QM 5PTDA 1V4YA 4I9JA 5C0QA 2NVAA 2FHFA 3TTOA 4LF2A 4MZ1A 1M41A 4JAWA 3H2FA 5H2ZA 2ZZ1A 1E1EA 2P50A 4YHEA 3WQOA 1XV8A 4ADTA 5A8MA 1SZRA 3V7PA 4AVNA 3FFSA 2A6NA 4O0QA 1ZTVA 2OEMA 3SUUA 1UD6A 5HATA 4YL2A 4WJEA 4P8VA 2VDHA 2XPKA 4DZHA 2RAGA 5DANA 2OWXA 1Q63A 1JZ6A 1HL2A 4RDYA 1YNQA 5A1AA 2JBMA 2DZSA 4JFTA 3W7EA 1VFMA 4V1XA 2EAWA 4GQ0A 2F84A 3OOQA 4ZA0A 4IZGA 3HQNA 1DVJA 3HGOA 2D1ZA 4ZB5A 2BVYA 4O10A 3EYPA 2BVTA 1W3TA 3WLPA 4H9MA 3W00A 4Q7NA 1VF8A 4B3KA 1YPFA 2YIHA 4ZZ9A 1I0BA 4ASTA 4EAMA 3M0IA 4CU8A 2VOTA 4HPNA 1V7AA 3PM6A 1JYNA 2XUCA 1SMAA 3R10A 1IGSA 4MY9A 3D0CA 4WCJA 4HHHA 2GFTA 5KSWA 4LS1A 4ZE5A 3FVDA 1GKPA 1UQZA 5GJPA 1FHLA 4A6GA 5CEWA 3KBMA 4CNSA 5CC3A 4K8HA 1OVDA 1X1NA 4CN6A 4K6AA 5A2AA 5DN1A 1GG0A 3H2EA 3LV6A 3W7QA 5EMMA 2PWGA 3LV5A 3EB2A 4H2HA 4Q6JA 4U3CA 4O50A 4W85A 1FWHC 3WF1A 1LWJA 2PTYA 3WLTA 1E0UA 1W5MA 2Y62A 1TTQA 1E9YB 4IQJA 1ZJBA 1ZAHA 4N0RA 3AYTA 3BJSA 2L5HA 3B0UX 3GVVA 2PDMA 1CXHA 3RO6A 3G5EA 3HG3A 3OBEA 3S2JA 1HZYA 3GG7A 1BWKA 3MUZ1 1IT0A 4HPJA 5CBIA 2RJGA 1E15A 1KTBA 1XG4A 1TPFA 1LJYA 2F8QA 2CBVA 3BANA 3OIXA 4QSFA 3RITA 2ZRVA 4KWUA 3VK5A 1M68A 4FO4A 3PZ9A 1RPXA 1C3FA 2WWCA 3BMWA 3C2RA 3LZ5A 1TV8A 3LNPA 1HL9A 5TNVA 3SQSA 1XPYA 4JTCA 1RCQA 1UH4A 4HB7A 1US0A 3PBYA 1TZZA 2J7FA 2D69A 3VCCA 2VEGA 3IJLA 1RV8A 3R25A 4XZ9A 4TVCA 5EU9A 4NNBA 3GXIA 3FGCA 1H1NA 3CZJA 4NVTA 3KLLA 1W5PA 1AQMA 3F2BA 1V08A 1XYBA 1CPUA 3GS6A 4YXGA 2POTA 1GVEA 4HU0A 4D72A 3W85A 2WBKA 4IOTA 1EX5A 3ARUA 1P4CA 3M0XA 4IXHA 4NX5A 2ZZ2A 3OYZA 1JYVA 1DP0A 5LZLA 1MSSA 2V63A 3M46A 5HPOA 2FTPA 4CVWA 1E9IA 3A3XA 2HV5A 4X0NA 1J8VA 1OX5A 5FA5A 4GIYA 4LVFA 4WKHA 1AZ1A 1OIMA 2ZRXA 3MSGA 1Z32X 4IIFA 3BLDA 1G1YA 4P8WA 1KM4A 5K9CA 3UJSA 4C6FA 3F5LA 3BLFA 4W4QA 4MTVA 1FDJA 3T0AA 2VENA 2IPGA 3GE7A 4LVGA 3VFLA 2QCGA 2WJDA 4RDVA 3KXQA 3APTA 1EO7A 3W6YA 1F9CA 4GFSA 3WQCA 3HPSA 4LANA 2VUYA 4J1OA 4ZQOA 3VKDA 4DPQA 3PZVA 3O07A 1FWCC 3M07A 5AYIA 3L66A 4MSSA 3OG2A 4LYKA 1MDLA 2G95A 2J8GA 2FFCA 3PUDA 3P93A 3BG9A 2FKPA 1QATA 4L9ZA 4Y9NA 3APYA 4WKAA 3SBFA 3LCWA 2DT3A 4AD1A 2LLEA 7XIMA 3GIQA 5ECVA 5H1WA 1ZFJA 3P14A 2OEKA 3ONBA 1SW3A 2TYSA 3WELA 4F66A 1FWRA 4NJGA 3LS9A 3WLSA 4PCNA 1JQXA 3KL5A 2FHBA 4DZ5A 2YYTA 3EWCA 2EF9A 4FF7A 4NASA 2PCEA 3K30A 3W72A 2WSQA 2V5CA 3N17A 1UWQA 2VFEA 3QFWA 4XBJA 4F9JA 4FXJA 3M0JA 3HU7A 2PBOA 3T2QA 3EPMA 2EKGA 3LXAA 3UWWA 1XBVA 4D6IA 1RAKA 2DVUA 4IIBA 4HPXA 1VJSA 3CPGA 3SCWA 2B7NA 1QNRA 2WKJA 2BGSA 1H0GA 5CCZA 3LOTA 3WNPA 3LPPA 3EOUA 1YDVA 4V28A 2BOGX 1K9DA 2IPJA 3LY0A 3DI1A 4GCXA 3GDLA 5J8LA 3RCMA 3K2GA 4R33A 2D20A 3EPNA 3GYEA 2QPXA 1JCYA 3HGSA 3REQB 1YNPA 4HU3A 2DVXA 4IGNA 4UFJA 3ZOAA 2A3EA 1T41A 2A79A 3CHDA 6CGTA 5LKYA 1EUNA 1JJKA 3MJMA 2QZRA 4FX7A 3TSBA 4L4LA 3IJ8A 4ZOCA 5DMMA 1FKWA 2VELA 4GZJA 4ZO9A 4O1EA 3RRXA 1LF1A 1BTMA 6A3HA 2GDQA 1RA0A 1UOZA 1VQTA 1W8SA 4RW3A 1EP3A 1SJCA 2PWEA 2VL4A 3TN3A 4JKLA 2QF7A 3SCPA 3CS2A 3AOFA 1OD0A 1VIZA 4AHQA 2XWEA 2C8NA 3NYDA 4X2RA 1SUXA 3ZT5A 3W3OA 1XR2A 2VZUA 2OSYA 3AMDA 1OD8A 5F2IA 4A8NA 1DE6A 3KBNA 1CZ1A 1F7BA 1UJQA 5LIKX 2YL8A 3VNKA 4ZB2A 4REQA 3LX9A 3O6AA 3TSMA 2BY3A 5CLTA 1SM9A 1W5QA 3OLIA 3IIVA 1N8WA 1XCFA 1SZFA 3MU7A 2J7EA 2VX7A 1DWFM 1BQGA 3GFYA 1EIBA 4MJ4A 3RCNA 3LHZA 3PFMA 3GVRA 3UF9A 2PDQA 4U2YA 4QE1A 4D6FA 4ZQPA 4Q8OA 3O9NA 4FIRA 4Z2HA 8RUCA 3B40A 2XVKA 1KCLA 1ZL1A 3K4DA 4N2YA 3W07A 1A49A 3ONCA 1V6UA 1U83A 1P7TA 2FDSA 3TONA 2QS8A 4GQGA 2BP1A 8CGTA 1GEQA 1XIGA 2E6DA 3TAOA 2QCLA 1AH0A 9XIAA 4K68A 1EQPA 4LAUA 1I6NA 2G8ZA 4ERAA 3VUSA 4DQWA 3GFZA 5A8PA 4O15A 3RIKA 3V18A 1TWIA 3SCNA 4DWSD 4FLSA 4UTTA 3UESA 2QCCA 3IRSA 5CG0A 5ABHA 4XZLX 3SB0A 4Z1YA 1E5JA 4FS9A 3NGFA 4NJJA 3RM4A 1S5VA 2POZA 3BTNA 2QUMA 4TR9A 2OT0A 3A47A 2OJPA 5LIYX 1XIIA 2ZE3A 1JGIA 4MDOA 4DUVA 1RK6A 5CPSA 2OQHA 1XLLA 2CLPA 1E9ZB 4JTSA 2WSYA 3L7RA 1E1CB 1W2VA 4GD0A 1UPMB 1RBAA 1KM5A 3DGRA 1KFKA 2Z1VA 3W7LA 4XISA 1RQEA 1JUKA 1NVMA 1D3HA 1H7RA 1AA1B 3CO4A 1EJVC 3MP5A 1O68A 2J7BA 3L4ZA 3RRAA 2C19A 3BQ6A 2W92A 1XH2A 3HB9A 1UKSA 3GNDA 1R2RA 3SCQA 3KUMA 5FJUA 1GZGA 3EB3A 3U9IA 4QJ4B 1S2VA 1KV8A 1KCZA 2OT1A 2Y7DA 3UYCA 1ZHAA 4TTUA 2OTDA 3CHEA 1GVRA 1ISYA 1D3GA 3DZ1A 3AMLA 3KRUA 1O5KA 3UU0A 3HN3A 2AMGA 1ODUA 1E5NA 3KTXA 3STCA 3HJEA 4R7JA 4C6EA 2Y5JA 3LGEA 1HJSA 1H63A 1XSKA 4NQ1A 4EWJA 4BF9A 3WQFA 1LQAA 1R3SA 3AXIA 4L4MA 1KGXA 4A8IA 5KZEA 1ZALA 3RAOA 1XGEA 1PVNA 3A12A 3IIOA 2QAFA 4L7ZA 2E1DA 4YTQA 2AAMA 2CLMA 1Q4WA 4IWWA 3FHAA 5XINA 4CQBA 1EF3A 4F40A 4PMOA 1OSEA 1BSIA 5U4NA 3K4AA 4NL1A 1KTCA 2A7PA 4ZOAA 1I9CB 3LPOA 3LN3A 1K03A 1W3LA 4WJXA 1R8LA 8A3HA 3UR2A 1EUAA 3R11A 1DWHM 5MKGB 1QI2A 1PEZA 3LHWA 5C2CA 2Q01A 4PCFA 3MDUA 1TPC1 3O1NA 1OINA 2PTDA 1KXTA 1EC8A 3D6NA 4PMNA 4M8UA 1J96A 3TDFA 5H8PA 1TE6A 3BWWA 4HOXA 4MY1A 5DBUA 1V0LA 5T8GA 4LNYA 4DXKA 3TQ0A 2Z1XA 1E6PA 2O4QA 2B7OA 1BKSA 1PYFA 2J8FA 3MQTA 4XB3A 2XVPA 1M9HA 2I5GA 4V33A 3L0NA 1ZBKA 4CU7A 1DJNA 2Z1KA 4C1KA 3SADA 1QFEA 1UP3A 3EX1A 1KBIA 1K70A 3SSZA 3GKAA 2WQPA 3CIXA 3FAXA 3UR8A 5I79A 3RU8X 4QG9A 4UFMA 5C55A 1MZRA 3WD3A 4C6PA 1VGAA 4W93A 3IJQA 5CGQA 1D3CA 3M0YA 4QDPA 4IPJA 1V6WA 1L2QA 3E0IA 4GUHA 2HXUA 1V6XA 3QV6A 2E6FA 3TIMA 1QO5A 1UIOA 1LRTA 2ZFAA 1Q6GA 3M41A 3DI0A 3CB3A 1W1YA 4LXFA 4CQCA 2PDWA 3P82A 3URQA 3KL3A 3T0BA 4AY8A 5CZTA 3AI0A 1E6XM 1G7VA 3LSCA 3LHTA 4AIEA 2VXNA 3MUY1 1JFXA 1XH0A 1DXEA 7REQA 3N29A 2YBUA 2J7GA 3PBUA 2D24A 4HKPA 1W1IE 4C6OA 1FCBA 4B9ZA 1FXPA 1D7KA 2HS8A 4DB7A 3H4XA 5IBXA 4HNTA 2CERA 2HMCA 3SN4A 1ZPTA 3NSMA 2MNRA 1X38A 1KKRA 2V3GA 4N6FA 3C61A 1ZAIA 2QCNA 1NOWA 5I24A 4PMYA 1R46A 1KM1A 1W9XA 2VFIA 3BURA 1EL3A 2VJXA 4NAEB 4ZE4A 2QGYA 1R7OA 1K4HA 3W74A 1YRRA 3UZJA 1GUVA 3MPGA 3LCLA 2WM1A 3MBFA 1UMYA 1ADOA 2FTYA 1R0MA 3Q94A 3IVSA 1KC7A 1S1RA 1JXKA 1N8FA 5A2BA 1A5CA 1VPXA 1X96A 1P6CA 2WVSA 2PBGA 1M04A 1OC6A 1POJA 2CXGA 3GBDA 2QVNA 4MWAA 2J27A 3GM8A 3PC0A 4UTFA 2VFHA 2W0UA 4H19A 1LT7A 4DAFA 3JS3A 4J2MA 3TC3A 1OJXA 4HK6A 4B92A 3CK5A 4JYFA 1PKYA 4DJFC 1KBKA 1M01A 5AHEA 5BXRA 3NGJA 1QVBA 2J13A 3WYZA 1PCWA 3WQPA 1KBJA 3A21A 1KGWA 4QITA 1WUFA 4M80A 1YYAA 1LWIA 1TWWA 3NO1A 3W2JA 1DHPA 4WDXA 2W62A 1J11A 4K8EA 4ML4A 3VM5A 3FY1A 2PEVA 3W86A 5C5YA 4R34A 2RDUA 5FCZA 5DT7A 3U8GA 3GZAA 1G4SA 1VRXA 1XJBA 2CXEA 3W73A 5FOOA 2PDNA 1OK4A 1J2WA 5LSMA 3URAA 3E0VA 4QGCA 3PSWA 2V2DA 4MAVA 3OW1A 1EHNA 1KM3A 1JIBA 3TCEA 1LDCA 2I56A 2WZIA 1VB9A 1OYAA 2HK1A 1PHQA 3ZR5A 2YDRA 2CIPA 1GZ1A 1Z44A 3INPA 4TV5A 1HKVA 4FLOA 4DRSA 1XRFA 3QW3A 3G0XA 2QLYA 2PP0A 1M6JA 2GL5A 3TTEA 2FIQA 3ITYA 4CNOA 2VEMA 4HCDA 4AC1X 3GDRA 5H8MA 3ZZ1A 4CD6A 3OGVA 4GUIA 3DBPA 3ARXA 5CC6A 3KCLA 3IVTA 4GZ7A 3CV2A 4MFDA 2C1HA 4MNMA 4GUFA 3DOPA 4JXCA 2PSNA 1WUEA 4CQAA 3BDKA 2FTWA 1GG1A 5SWUA 3FV9A 1E4IA 4XTIA 2VI0A 4S39A 2FHCA 3EDJA 5T91A 2Q3RA 5J5DA 2EPNA 4HSOA 4JN6A 4QS6A 2PAJA 3OZMA 3TA6A 1W9BM 4UTUA 1B1YA 2GJXA 2DIKA 3ZVIA 4UQ9A 1V6VA 4UTHA 4PTVA 4GKLA 2B81A 1Q3NA 4Y9OA 3M4HA 4PB5A 3BPWA 2GK1B 3A4AA 3DXIA 1IEWA 2PWVA 4O53A 1WV2A 3E2SA 3FYYA 4CNUA 5E0CA 2VO5A 3VKBA 3BCJA 1XISA 3A9IA 1FA2A 4P8XA 3OVRA 4MZ8A 1N7KA 3BAXA 3P6LA 2UY4A 3MC5A 2ZC8A 1WKDA 1IWBA 1V3KA 3L2MA 2PWUA 4CCZA 4LCSA 1C91A 3SQLA 1AD1A 3KVKA 4QIUA 2DY3A 3H7VA 1ODZA 3OZOA 2DZPA 4Z2IA 2G96A 3EKLA 5FIPA 3DEQA 2ABBA 1QPRA 1EF2A 4PODA 4BY3A 3W1MA 1UD4A 4JIQA 2PA6A 2Y88A 2QV5A 3EKZA 4EANA 1R3VA 2O55A 3V0SA 1VYPX 3IACA 1GOOA 1C90A 3BMXA 4CD8A 4A4AA 4M81A 4DIAA 1BF2A 1JNEA 1ITXA 5C7HA 5BZAA 1Q6OA 2YYUA 3VYLA 4WX2A 1BYCA 3NR0A 1GTHA 2GVEA 2D2JA 2Y8VA 3PF3A 4JTIA 4MIMA 3AHYA 4FLRA 1BG4A 3W38A 2R24A 1JG9A 2AKMA 2D0GA 4NUWA 3PZGA 5CPTA 4UOJA 4A3YA 3SRHA 2YFOA 4DWSB 1OF6A 4KGJA 4K38A 1A3WA 5C6MA 3U3HA 3QHMA 4MNLA 2PP3A 4TO8A 2ZX7A 3S2CA 1SW0A 1TA3B 3W37A 3BJFA 1V0KA 4O11A 1K6WA 3NZPA 4RZ5A 2BY1A 2JGQA 4WY0F 1UA7A 2OELA 1VZWA 3V4BA 3GUWA 4LYQA 2CHNA 3H70A 2RKXA 4TXEA 4LYRA 2UZ9A 4ACZA 5G4HC 3VDAA 1YKWA 3AMKA 3P74A 3I4EA 2XFFA 3VVGA 3S83A 4HNCA 1SSGA 2G3JA 2PDYA 4JTKA 2I5IA 4OKDA 4WIWA 4AEOA 1NY1A 1W9UA 2WKGA 2ALRA 4PC8A 5KINA 5DF0A 1DYSA 4EP8C 2CBIA 5HPCA 3GXNA 4JL1A 1TR9A 3TYCA 4IIDA 1UKOA 3NZQA 1ITUA 4CCEA 2OMAA 1GK8A 3WDJA 1FCVA 3AIVA 4ATLA 5U7SA 1RK5A 4JOMA 3DUGA 3W2MA 5CBJA 5FESA 1XRTA 3ELFA 3PG8A 3EX3A 4PEKA 3QGAC 5CC7A 4ADUA 1WX0A 3I3DA 3QFEA 3SUWA 3I3BA 3N25A 3PTKA 4G1NA 2WOQA 1RQHA 4TUFA 5HMEA 3MHUA 4GWEA 4AWTA 1XD1A 4ZQRA 1F3XA 3GU1A 4AZIA 5CJMA 3GDTA 1XDLA 4M6QA 3H54A 3N15A 3AHXA 4GBUA 3HG5A 4LV9A 2GJNA 4C6BA 4JCLA 1WNOA 3S1XA 3IUIA 5H8UA 5HULA 2VGFA 3P8IA 4RLIA 2VCBA 4BEUA 2E3ZA 1JZ7A 4P61A 3DKLA 2R9RA 4H6KA 4X9SA 4R3UA 1LOQA 4MJMA 3FW6A 2QQ6A 8XIAA 3W1PA 1A80A 3UG8A 4J3UA 1FWBC 3UZXA 3BAYA 4NU7A 1JFHA 3JUGA 2Y89A 2XVLA 1E1FA 4PMXA 4XD4A 2F38A 1Y5VA 1XUUA 2OGYA 1RXOB 4A8RA 2REQB 1F2JA 2AMXA 1Q6QA 2ESCA 3FAWA 4H8HA 3Q65A 3E5BA 2NUWA 5JIWA 1K8YA 1OIFA 1K7FA 1W1VA 1CGXA 1W6TA 2ICSA 3N11A 2OGJA 3AWNA 5AYYA 3NURA 5DMLA 1JDCA 3S5ZA 1E40A 1D8WA 1R3QA 4G2DA 3THQA 3MA8A 4O4VA 1HXJA 1T99A 3TYAA 3O7UA 4DYEA 1TIMA 3MW7A 4AWSA 2EHHA 2DUAA 4GXMA 4L61A 4XQ6A 3B8TA 2QCEA 2CZ5A 3CH9A 2ZVIA 4D6EA 1KLZA 1NEYA 3UW6A 4LCRA 5BWAA 1TE1A 2OYMA 3BLLA 2TMDA 2OWCA 1WQ5A 4S3AA 1LUCA 4LUIA 4ZQCA 5TF0A 2QJGA 1RBLA 3C0SA 1WXJA 1UJPA 3HPAA 4GINA 1KO0A 1LOLA 4U28A 5FF3A 4TX6A 4FMVA 4WEVX 3F2CA 5CXPA 3GAKA 2VTFA 4MVAA 1JZ5A 2YLLA 3HPZA 3SGUA 3NJ3A 4HHMA 1J2BA 4NAEA 2FPYA 5LYRA 3HBLA 3LRKA 2WO5A 2UWFA 3T0DA 4H7CA 1UROA 3S3GA 1RLCL 4MPKA 3TAKA 5A6BD 1HTIA 1HL8A 3WLMA 1KFLA 3GVGA 1XF0A 2VQTA 3LERA 4GIRA 5DCDA 3LDVA 5I6SA 2RDWA 1XKJA 2ZX9A 4GI9A 2QDHA 1DEDA 1H11A 3QKZA 5AVNA 5REQB 1TX0A 4IMDA 4EF8A 5LXXA 1XC6A 2OEJA 4UQCA 3GHTA 4YHGA 3NO5A 2BDQA 4H8UA 1TV3A 3ICJA 4H00A 2GJRA 2ZRWA 4Q4OA 3O06A 3UG5A 2PDLA 4EPBC 5KEZA 1HP5A 4W88A 3PBMA 4G7EB 2CETA 2XM1A 4JGDA 3ITOA 3WQ5A 4LH8A 3OGRA 5BCAA 4GRSA 2RDXA 1FWGC 2ISDA 3BK0A 1VFUA 1A0CA 2QCFA 3B06A 4MJZA 1UUQA 3NCOA 1N55A 3LZ3A 1W5OA 2O9OA 4HZMA 3VNLA 1OM0A 1R6WA 3G1SA 2ZX8A 3B4YA 3O0KA 2W9MA 1S39A 5DRCA 4H8NA 1A5UA 3DH7A 1EYEA 3E2VA 3DFTA 3GVWA 3NVDA 4RCXA 5A6SA 3K1DA 1XIDA 1WOBA 1A0EA 1VAHA 3QZAA 3WDPP 3B9EA 1GTEA 4JYDA 1EP2A 1QNSA 2ACRA 4NXKA 5CGMA 1NQKA 2ZC1A 1LYXA 2W3ZA 2VP8A 2PF0A 1FY6A 1MO0A 3OB8A 3MSDA 3S6TA 3N6QA 1UBPC 3BSMA 4A3QA 4UTIA 4DJDC 4J3ZA 2ZQ0A 4JS3A 5KZMA 1V77A 2VDGA 2FB2A 3TYUA 3SI9A 2OB3A 2QNEA 1A5KC 2VZSA 3BGJA 1LOSA 2Y1HA 4TVDA 2WNWA 5F4XA 3KOWA 3M16A 1TPEA 2I5QA 1XFBA 3VDBA 4JNYA 1GZJA 1MVYA 1TX2A 2JEPA 4D6HA 4Z1BA 3B03A 4UTMA 2VR4A 3LK6A 4J27A 3LTSA 4B2DD 5AHMA 3TEVA 4F48A 4QISA 2QEZA 1UR2A 4DJEC 3C52A 3EMZA 2CLHA 2XTKA 4H6EA 1LP6A 4KCUA 2XVNA 5A3HA 3AHTA 3S5YA 2PDBA 2PU0A 2DJXA 4CNPA 3CQKA 2PC8A 2J4GA 1KCXA 4RW5A 3WLIA 2P53A 4R9OA 3WFZA 3B04A 4KWOA 1CLVA 4C6KA 1YTEA 3ID7A 4UQEA 1C93A 4W9TA 2WNQA 3SJ3A 1B3VA 3A9BA 3BMVA 3UCCA 1HGWA 3KP0A 2DUXA 1P48A 5I06A 2VWTA 2IW0A 1GQLA 1H49A 1NH6A 4QDWA 3DU0A 3S2LA 4Z2LA 1IXOA 3WMBA 2YL9A 4HA0A 1BEUA 4TTGA 4YVPA 1IXQA 1GYMA 2FVMA 3U57A 3RN6A 2OODA 2QDGA 4JN7A 4WJ8A 2X40A 3G3DA 2Z29A 2HNEA 1E9LA 3K1GA 4Z1DA 5A6TC 1H7WA 2PUZA 1W17A 1GOKA 3MDWA 3SCVA 3IGXA 1EDTA 5A8QA 4AWUA 1H1YA 3LEPA 4F0KA 2AQVA 1WDWA 2ISFA 3L5AA 4OIFA 4YS1A 1S5TA 4C6CA 4GK8A 5C7VA 4B3ZA 5BXPA 4RXGA 1SO6A 2X2YA 2EJ1A 3GUGA 4MOZA 2ZA1A 3MI3A 2BVWA 3R8HA 3WQ4A 5LHEA 3FXGA 1LG2A 2Y5SA 5BROA 1OFDA 3DFHA 2XDFA 2V3EA 4WLCA 4C5ZA 4GOAA 3VIMA 1GW1A 5RUBA 5CPLA 5I3FA 3VNIA 3GKFA 5IXEA 1U5JA 1TV2A 2X1UA 3OBAA 3TYZA 4GMEA 1F8IA 1IIHA 2FZNA 4XKMA 4JZ5A 2W79A 3HV8A 4GGBA 4RR4A 1WKFA 1F05A 2VRKA 2DJLA 4L4PA 5CH9A 4ILSA 4H3DA 3LCGA 1WE5A 1X6NA 3LPGA 1M7JA 4O1DA 2Q3OA 3TW7A 1EZWA 3CL6A 1UR3M 4A29A 1CT5A 2CKSA 6PTDA 4L80A 4OBTA 3TMQA 4LU0A 1I60A 4LRTA 1WZMA 4W84A 3TLLA 1SR0A 5JXQA 2R91A 3TZNA 4JX6A 2MANA 3E6EA 4OFCA 1DJXA 3WUBA 1MMFA 1UD5A 5I3JA 4PRRA 3VIPA 4A21A 3ZO9A 2J74A 1JDEA 4US5A 4XX6A 2W5FA 3SIMA 4K7VA 4A2RA 2BXZA 4R7WA 3WJYA 4IL0A 1OY0A 4XBSA 2QDEA 4HSHA 4M1BA 4PFMA 2WPGA 4ACZB 5A6MA 1CXKA 3BAKA 4AXNA 2RGMA 4HTBA 1MQRA 2XFRA 2WZEA 1VYRA 1G4EA 1U1HA 1UG6A 2PURA 1TJ2A 5HK4A 8XIMA 3RM9A 2XGBA 3NSNA 5M1TA 1Z69A 4QE4A 3UPBA 4J2PA 4DXXA 3VOIA 2FFIA 4N7QA 5E0FA 3UEQA 3L23A 4Q4MA 4FAMA 4AWEA 1ZP4A 3EX6A 4O17A 4YTTA 3IGHX 2J25A 4B5SA 5C2GA 3UWQA 3A22A 2ZUTA 2WMKA 1GQIA 3BL3A 2GQ3A 5E5CA 3GK0A 4RDWA 3AJXA 3SUVA 4LVBA 1Z42A 3M5XA 2AL1A 1NELA 4YIWA 3T44A 4MWAE 1HGYA 4W87A 3UWYA 2NZLA 3RR4A 3VIGA 1H2JA 3IIZA 3SJNA 1JF5A 4CD4A 2PDUA 3POHA 1SGJA 4FNPA 1DKWA 2Z7GA 4QEEA 2CBJA 5GPRA 3T0TA 3R1ZA 2OCZA 2YA1A 2XSAA 4QP0A 3UY7A 1L8NA 3M6YA 3VKCA 5E93A 2Y2WA 2V68A 3H24A 3TUUA 4NRSA 4FOUA 3BSHA 1ZCCA 2GGGA 3GTHA 1Z8AA 4JQ1A 1BYAA 1UR0A 3QBUA 1VKFA 3P61A 1FP8A 2PI6A 1S2AA 3N4FA 1C29A 1JZ3A 2X30A 2W27A 4JY9A 2W61A 4ZSUA 3GU9A 1S2UA 1U5VA 5JVLA 3I7RA 3I10A 4MPQA 3VE9A 3WNNA 3GQYA 4ZR8A 1AODA 1L6SA 3VIIA 1YLVA 5DY2A 2QF8A 2BHYA 3DESA 5DMYA 2FVKA 2VX4A 4BK9A 3UQNA 3FN9A 5BRQA 1TYGA 1GVQA 5MHBA 5CJNA 1H1ZA 3EKGA 2JQXA 1UCWA 1WZLA 4B4FA 3FX4A 4WY0B 3UZ5A 4J3SA 3PR2A 3IGUA 1PWMA 4WUIA 2YFNA 1ITCA 1EB3A 4N6EA 2YSWA 1R9YA 5A2CA 3TX9A 3VD3A 3VILA 3OQEA 2XIJA 2PRMA 3MYOA 1H60A 3MCMA 3MY9A 3IV8A 4PTNA 1BAGA 4GC3A 1ZSXA 2BY0A 4NZ5A 3TOYA 3TYDA 2HPIA 3MYPA 4JHOA 3SDOA 4QTGA 1ZBWA 3OIHA 3VU2A 3MBDA 3FIGA 3DGBA 4UQBA 1I2RA 2C16A 1FX6A 1VCFA 4KF1A 4YYCA 1RALA 4ZGYA 5HQEA 2OYLA 3PTMA 1ZENA 3B9OA 4GE8A 1TO3A 2BB0A 3GRIA 4UNLA 2EG6A 3CHCA 1F73A 1W9VA 1HKWA 4KCTA 4TVUA 5EMKA 2DW6A 3OA5A 7TIMA 3PTDA 2PU1A 1UYQA 3TJXA 3H8AA 4EE9A 3T2OA 3SUTA 2Y24A 5E9XA 1VJIA 2QMJA 1OWQA 3A64A 4JIIX 4LC8A 3SGGA 1R3TA 2EJAA 5AHNA 2ZZ6A 3QHOA 4QCFA 1G9HA 1RD5A 1QNPA 4RE4A 3WZ0E 3EA1A 2AL2B 3HTWA 3MJYA 2BX7A 4RUBA 2YXGA 5F2LA 1MXGA 2PLJA 3CUFA 4IGSA 3LRLA 1F8MA 5IBXC 5AZ0A 4WRHA 3L65A 3CL8A 1T8QA 3KHDA 3BQ5A 3JR2A 5FF7A 1P0NA 2FJUB 3KWXA 7TAAA 3BICA 2WMGA 1TTJA 2GYIA 4D8AA 3NQ2A 1YMYA 4DBSA 1CX9A 3KBSA 3N6HA 3DHDA 4IJCA 4QG8A 4CVUA 4V15A 4HN4A 1QPQA 3CUZA 1Q6FA 2PD9A 1V02A 2Y6ZA 1Z7AA 5KITA 4WDTA 4UTTC 4O13A 1CI1A 1OHLA 2ZUNA 1F74A 1N2VA 4IX2A 1AMKA 2PDGA 1RD6A 1XRSA 1FBAA 4X61A 3AXHA 3CLMA 2GQ9A 1IEXA 2AQWA 1W91A 3B4UA 1XLKA 4WSJA 4J3VA 4MUPA 3FNDA 3N4AA 2VC6A 4PTWA 3FGCB 4IMFA 1PV8A 3TV8A 1HG3A 5DCBA 3PULA 3M7SA 2PTWA 3DN5A 5CBBA 3JZEA 1W1A1 1IR2A 3LCIA 5D2VA 3W7JA 1YDYA 2UY2A 1F3TA 3AICA 2ACUA 3UY8A 2QPUA 4MB4A 4ORIA 3O0FA 4GXPA 3E38A 4LWWA 3OVPA 3BJTA 2IPFA 1EWEA 1OYCA 2EG7A 1C7TA 5I3GA 3KM8A 4XAFA 4PYSA 5E1QA 4D8ZA 2I7GA 3ES7A 4O18A 3CZ8A 4Q4RA 4YTSA 4EF9A 3T9PA 1KA9F 1GVOA 5ENLA 1V8EA 2PTXA 3BLPX 3L0KA 5EBUA 3TR2A 1B3YA 4YCOA 2QHAA 2W91A 3RNDA 3PZMA 3BAWA 1CNVA 3DFYA 4HQVA 3Q2DA 1XM3A 2QW5A 1QBAA 5EPDA 3N34A 4EX4A 4LAZA 1TV4A 3YPIA 4F2UA 1AW2A 1VBHA 5E09A 4OVXA 2DU2A 4L65A 4PRWA 3IGSA 3NQFA 4JR5A 3WMLA 3N9RA 4MLRA 2FB3A 4O8AA 3CIWA 4Q8WA 4ZO8A 1REQB 1AFSA 4KFPA 4UWMA 4TMBA 3UERA 1JDFA 1DQWA 3THUA 2GOUA 2E40A 4XAYA 1W56A 1W1B1 4O57A 1FCUA 1V6YA 2CC0A 1J10A 3CMJA 2O4MA 4M51A 3ITGA 3QV7A 5BWFA 7A3HA 1GNXA 2HVNA 1X7IA 4ZXLA 1KR1A 3MTWA 3UZYA 2J7HA 2YDSA 4L9XA 4L6HA 1UC5A 2OXNA 2VHLA 5I07A 2NT1A 4ZXOA 5JH2A 5CGTA 3PNZA 4RX0A 4BWLC 4UBPC 1WBJA 4DBUA 1X8FA 1XLAA 1IWPA 1ZJAA 1WXZA 1IZCA 1W1PA 4IUGA 3FA3A 4Q33A 1AQFA 1OFQA 3MO4A 2VNCA 2WJEA 3KOYA 5CPOA 5CQ1A 3S0CA 3GB6A 1AQ0A 3DFOA 3V35A 5DBTA 1OCNA 4I9AA 4JNZA 5A95A 3B8DA 1W3HA 3QQ0A 5I3DA 1KRBC 4XWUA 1ME8A 3VOGA 3A4WA 3NQVA 2J77A 1JPIA 3EWXA 2ZXQA 3SN0A 5IOBA 3CL7A 4KQNA 5I02A 3EGJA 4ZFMA 3MSRA 5I09A 3EA3A 4QCEA 3NVTA 4HSNA 1QXLA 4R85A 2R14A 4KWVA 4MADA 1UKTA 3PJTA 4XUGA 4FXRA 4MLJA 1W0MA 4NSBA 3A4JA 1H5YA 3WUFA 4QAWA 1NAL1 1JF6A 1XS2A 4M29A 4GQQA 2ZIDA 4O54A 3S9ZA 2UY3A 5IFTA 3R5EA 4TQTA 1DWIM 4MGGA 4Q3MA 1LRNA 1D9EA 4N9BA 3DFNA 4WDWA 3RJXA 3QV8A 3O05A 5DXYA 1UOKA 3F03K 2WHMA 2V5BA 4B9YA 1TWSA 2F6XA 4A3UA 2QCMA 2ZZ5A 3LD5A 3PJXA 4C7GA 3VGBA 1IEIA 5E70A 1BHGA 3T40A 2ZX6A 3H2CA 1QHPA 1MI3A 1V7YA 2GUBA 1YEYA 3NM3A 5G1TA 4YPJA 4Z42C 1QWGA 4GI6A 3AS3A 4PMJA 4E2DA 3T7VA 1E72M 5AC6A 3ZYZA 2DH2A 2WCSA 1US2A 4S2CA 3WH7A 4ZQMA 3QF0A 1QUMA 4GACA 3C4UA 2YXOA 2ASHA 2GVLA 1E71M 1PZ3A 3N19B 3F4VA 4ALDA 2VGIA 1I1XA 4EPDC 4IIEA 4M56A 4ZB0A 3V16A 6REQA 2HS6A 5CZ0A 1QASA 3QY6A 3WJWA 4QQUA 3IJDA 5HUOA 4ZO6A 5A8OA 1JZ8A 3GG0A 5K7JA 3MI2A 3QQ1A 1ZBCA 1PPIA 2QCDA 3I68A 3RLHA 2D3NA 5EY5A 2IKHA 2OYKA 3PTQA 1POKA 2JKEA 4NZJA 4B2DA 4DJFA 3HPFA 2DEPA 2WXDM 1KFJA 3PJUA 4XZWA 3BCDA 1EZ2A 3CWOX 1BF6A 3CEUA 4GJJA 1H62A 2ZA2A 1BRLB 4LBRA 1CEOA 2X1RA 2ZUUA 1ISXA 2ISSA 1EIXA 4XO7A 1RVGA 1FQ0A 3TCSA 3EDDA 3E1F1 4H2CA 2CWXA 4US6A 4DUWA 5AZ1A 3ERPA 4G7FA 3WJZA 2Z25A 4DF0A 5CJ5A 1PZ0A 3RM8A 2V8ZA 5G4WA 3G18A 3NZGA 1V51A 1OYBA 3RFAA 3M5YA 2WW5A 2ZWZA 3TC6A 3Q4DA 3URBA 3AYRA 2XIBA 3NAVA 1EPVA 3W28A 4CU6A 1MWOA 3RX2A 2X0SA 1B4EA 1FP9A 5ABFA 2E77A 4HMEA 3A6OA 2QUTA 1E43A 3CAKA 3SEPA 2DGAA 1R86A 3NQMA 2ISWA 1H7XA 3UG3A 1HT6A 1Y7VA 3VCNA 4JTLA 4GH1A 1W3KA 1T0OA 2XM2A 1RJPA 3U7VA 3FJNA 3W87A 1XH1A 3VX0A 2ZYFA 4CNNA 5K3VA 3N13A 3CAVA 3KRZA 4JDYA 4BI7A 2CKRA 3C2OA 3C3NA 3VOCA 4IPNB 2NX9A 1S3TC 4QSHA 3M43A 4AZGA 1DWAM 3EWWA 1ZNNA 2JIWA 3ZJ7A 3EOLA 2PRHA 5F2GA 2QVHA 2VD8A 4LS2A 4UCFA 1XLMA 1BYBA 4K1WA 3N3TA 4IICA 4GNJA 4DNMA 1V3LA 1BGGA 1VBRA 3V75A 1L6FA 4M7SA 4OV9A 2Z6IA 4LALA 3NSXA 4X63A 3GIYA 3KDOA 1IZKA 5AC7A 2NWSA 2F7FA 3WFLA 4KS0A 4F2BA 2HWGA 4JICA 4F0RA 4UNKA 2Y7FA 2WANA 3HGRA 1J6PA 1PCKA 1J0ZA 4QJ5B 1PTGA 4LT9A 1NWRA 4UUIA 1GOWA 3BLKA 3E0WA 5HAOA 4G7EA 3I6EA 3W22A 2ZUMA 4O28A 4L6OA 4ZMGA 1GYNA 2DORA 2FZ8A 4C90A 2ZKMX 1NWTA 5B7ZA 3AU2A 4DX3A 4S3JA 3MKKA 1XLCA 5G2WA 1L8PA 4NZCA 3H6OA 3FDGA 2VDIA 2E1WA 1LZOA 2GDUA 4LRSA 1PYMA 3VM7A 2Y8UA 4FB7A 4MUZA 4G8TA 4M0XA 3PB0A 1SVDA 3CV7A 3LI0A 3W7HA 1EBGA 3VOJA 1RSCA 2JIEA 1VC4A 1YBQB 4BI6A 1Y0EA 3DG3A 2BGQA 3W0KA 2J66A 4GJIA 4IFKB 1PB0A 4AHOA 1ESWA 5FAGA 1KQZA 3DYMA 4QHRA 3KWSA 2Q8ZA 2DZXA 1JUBA 2XZ9A 3RX4A 3W24A 4Q8PA 3G1VA 3VGGA 1K7EA 3CUHA 4IF2A 3NA8A 4UCGA 2V0TA 1YQ2A 5KZDA 2JF7A 2JFEX 3M0MA 1NU5A 3LQGA 5AHLA 1UR8A 5JMUA 3N18A 5HOSA 5HMDA 4N4PA 3UYIA 1SYTA 3MWCA 3WFAA 5E6YA 1GOMA 4U33A 5EFFA 3KVMA 3LXCA 1WCGA 1AW5A 4ZSTA 3S5NA 2R1MA 1EDQA 1MW2A 4QNEA 5FEZA 4GVGA 1KRMA 1W3IA 3A24A 1GQNA 4NYYA 2I9EA 4DVOA 1LL6A 3UCQA 4IG2B 4O14A 3BGAA 5EMYA 3F5JA 4HK7A 5HXMA 1TREA 3QVQA 5HNTA 3UGRA 1QI4A 1P7TB 2FVLA 1Y65A 2ABAA 1JUEA 3H2NA 4IFKA 3NL6A 1UUOA 1NJJA 3HURA 4N9DA 3OGSA 1XSJA 3GW3A 3OBKA 2TPSA 1V6TA 2Y8KA 1Y8BA 2OX4A 3VTRA 2OZ3A 4C1NA 5EA9A 3ITLA 4JEQA 1A4LA 5CZJA 1QK2A 3TVAA 3W7GA 2AL2A 1XSIA 3HF3A 4C5YA 3WMCA 2F9RA 3ANYA 5I77A 4QRNA 5DO8A 4E4PA 1P1MA 1VR6A 4HCHA 3M0HA 1E73M 1HUVA 2PZ0A 1A0DA 5D4YA 2GLKA 3H12A 3RMJA 3ALGA 1VRDA 1EEXA 1QAPA 2WZTA 3GH7A 3GH4A 3KOFA 2J75A 1YNYA 1VP5A 2UY5A 4RZ6A 4H9UA 5T9BG 1OT2A 1SR9A 3NZ1A 2WHKA 3E0LA 1YE4A 3L12A 1ZAJA 1EC9A 2R94A 1EOKA 4LJ3A 3EB4A 3GX9A 4OBRA 3PG9A 1KW1A 1UP0A 4KIEA 3FCPA 2VFDA 4JTJA 4FHAA 4ICCX 4KEVA 3GWQA 1GHRA 1VEMA 1A53A 4D6CA 4DJEA 3M0ZA 3RO8A 1EA0A 3MWAA 1S5MA 5F4SA 4CCCA 3GNPA 4OV4A 3HOJA 1HJWA 4X3ZA 4DLFA 1XBXA 3EWZA 3BW2A 1EA9C 1SO5A 3CO8A 1J79A 1KM0A 3UWVA 3ARRA 2DZUA 4V1YA 3SRDA 2ZZ4A 3RLUA 1QNQA 1CGUA 1KM6A 4J7RA 2PRLA 3LMYA 2ZOXA 3NWRA 1L6WA 3I7QA 2Y70A 5BRPA 1UPPA 4GZIA 2X41A 3DC8A 3QXBA 3TR9A 1T8XA 2HCVA 3M5VA 3CQJA 5FL1A 2J8TA 5CPNA 3EDFA 5ABEA 2HBXA 3ANVA 4TIMA 1ALDA 4H4IA 1JPHA 3RPMA 1SPQA 4AHPA 1V0NA 3RLVA 4UFHA 4HNOA 4A3RA 3TE9A 1R5YA 3R13A 1TFVA 2XH7A 1E55A 2ZZ3A 1GYLA 4L64A 2DZVA 2GSJA 1P43A 3GLCA 1VFLA 3N3MA 2HROA 1ZQ5A 4D1JA 4QAIA 4LAKA 1XG3A 3BV7A 2QJIA 1PS9A 1AQHA 5M17A 2NX1A 4Q32A 4FA3A 2PP1A 3BE7A 4M82A 1GVIA 1Q2RA 3GXMA 4GY1A 4IIGA 2DSUA 2IMRA 2OQLA 4JFUA 4L5ZA 2QPSA 3RK8A 1ZRQA 2IXVA 2OLAA 1EXBA 4AC7C 2NQ5A 2ON3A 1FWAC 1H50A 3CV6A 1A5LC 1UD2A 1JXJA 2B31A 2YCLB 3VD5A 1QHOA 2A3AA 3UXLA 1O6IA 1FXQA 1R3YA 1T6MA 3KP1A 2FGBA 1E3XA 4MY8A 4F0LA 1Q6LA 5CAHA 3ABSA 1DTNA 3JU2A 1F3EA 8TIMA 3G1HA 1KM2A 3CAWA 3GHSA 3GHRA 3MO7A 1J9YA 1GQKA 2ZADA 1UHVA 1PIFA 4K39A 3IEBA 4O0KA 3QN3A 3W81A 1KTNA 1LT8A 1NARA 2PB1A 4A8LA 3WBAA 1IF2A 3LTYA 1YTDA 3CPUA 4GH3A 3M44A 1O1HA 2CFFA 3ZSTA 4DZIA 1TMLA 4BI5A 4WOQA 1CGTA 3A3WA 3W76A