2HVMA

Hevamine a at 1.8 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HEVAMINE
publication title The 1.8 A resolution structure of hevamine, a plant chitinase/lysozyme, and analysis of the conserved sequence and structure motifs of glycosyl hydrolase family 18.
pubmed doi rcsb
total genus 96
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hvmA00
2RGLA 1R86A 2BV9A 4TVDA 2CHNA 1HP5A 1V03A 1UKTA 1TZ7A 4J3XA 1UWRA 3D5HA 3F4VA 1FH7A 2UY4A 5E6ZA 3ARZA 3VD5A 4C7DA 5JUVA 5AY7A 2FHFA 3HN3A 3VD4A 1E0WA 1JNDA 3MV11 4P8WA 1GOOA 1C8XA 1H3GA 4B3KA 3TA9A 1V0LA 3QR3A 4MB3A 4PMDA 4M82A 5TD4A 1XGZA 1J10A 5I2UA 1MW0A 3M46A 3CMJA 3LMYA 1KQYA 2ZUWA 3SCTA 3WBEA 4ACZA 2B31A 4WKHA 3L4ZA 4H04A 3WDHA 1C90A 1V02A 1GQIA 4D6EA 3WEOA 5C8BB 2ZX5A 4Z2GA 2VQTA 2YDSA 1WPCA 5FIPA 1IT0A 4AZCB 4GQRA 4OUEA 1CECA 4X0VA 2F8QA 4XZWA 3CUHA 4LYQA 3CGTA 3WUBA 1UD8A 3RO8A 1M53A 2WC7A 5IFTA 1GORA 2ZUSA 1LWHA 4GZJA 3SIMA 2YIHA 2VI0A 4PUDA 4L4PA 4CKQA 4U31A 1JDDA 3WNOA 1MVYA 2XM2A 1E56A 4YN5A 1E6PA 3WF4A 2GJRA 1LF1A 3WDPP 2WMIB 1TA3B 1F4AA 2D0GA 3LPFA 1K9EA 3EDEA 4XZBA 5JBFA 3FAXA 2PB1A 3WBAA 4PN2A 5EFFA 3GH7A 4NI3A 4MNMA 4CN4A 4UZUA 5JBDA 2CYGA 2XGBA 1XSKA 5E09A 1ISZA 3WQ5A 2FH8A 5F7UA 5DEZA 1GJUA 5I5RA 2ZUUA 4TX6A 1KGWA 2A3AA 4GPNA 2VNCA 2WHKA 5BWFA 3MV01 3WELA 3HMCA 1GJWA 3WD1A 1OIMA 3ALGA 1GHSA 4UQ9A 3B8SA 6CGTA 1Q6CA 1CENA 2XIIA 1DWGM 1JL8A 3B9EA 1R8LA 4ZXOA 2QLYA 4D1IA 1B3VA 3WDIA 3T2QA 5ABHA 1O7AA 3NUKA 2E40A 4HPGA 5BROA 1G0CA 3WL0A 1JYVA 3AHYA 5DT7A 1V3HA 1OWQA 2JIEA 1B3YA 1BVNP 4AWEA 3CMGA 4FLQA 2E9MA 5EFDA 1ZB5A 2J7HA 1VAHA 3WENA 1UD3A 3TTOA 1UWQA 3W82A 1NWTA 4J27A 4KGJA 4UOJA 1LJYA 1DWJM 4WKAA 1E6SM 4ATDA 4GO9A 4U2ZA 1MFUA 4HMEA 3RJXA 1PEZA 4KH2A 1JZ8A 4WLCA 1SR0A 5BYWA 4C7GA 3WNKA 2UY3A 5CXPA 4PSRA 2XPKA 2Z1KA 5M5DA 3N11A 1M7XA 1PAMA 4HOXA 4V28A 3PZQA 1E6NA 3L4UA 1OCQA 2A3CA 4Z2IA 4P8VA 3BLKA 2QMJA 1GCYA 1E3XA 5I77A 3UG5A 5DT5A 4AYSA 1XSJA 4U33A 4WSJA 3A47A 4D1JA 1NARA 1W1VA 3PZVA 2WMGA 2W66A 2XVGA 3RDKA 1KFWA 4IPNB 3WF3A 4UTFA 3WKZA 5HBFA 3GXFA 1OD8A 1B1YA 1IZKA 2J7EA 3CZKA 4H8HA 4OBRA 2GDUA 2WSPA 5BXSA 5A8PA 5GNXA 1JF6A 3IK2A 4PRWA 1XD1A 1U30A 1OIFA 3VINA 4JL2A 4GXPA 5CLTA 3D3AA 1HKIA 1XH2A 2XYLA 1WDRA 2Y2WA 5E6YA 3SUWA 2G8ZA 4GI9A 3AHXA 3BAJA 3AHTA 3T2OA 3OGVA 1HJQA 5AYIA 1J9YA 3SUVA 4MTVA 2D24A 3U5UA 3WDQA 2A3HA 4PMYA 1DHKA 4LYPA 4TTGA 1GOQA 1X1NA 1JF5A 1NWRA 1XC6A 5CPSA 3UETA 4KMQA 2VVSA 2JEQA 1JD7A 3NCOA 3VO0A 3HJEA 1ISWA 1CEOA 3AICA 1KWKA 3F5LA 4HPHA 2EPKX 1GOKA 3GXIA 1V02E 3ARVA 5EMYA 2V3EA 1ZBWA 4B9YA 3CUFA 3WNMA 2OYKA 3N1AA 3KL5A 3WDRA 3EDFA 3GNRA 1HJUA 1CXHA 4EK7A 1KWGA 1D2KA 1VBUA 3PZNA 3VDCA 3SCOA 1UQYA 3NSXA 2OSWA 3I3EA 1H11A 3W28A 4HU0A 2PF0A 3VPLA 1HIZA 3QOKA 3NIYA 9CGTA 1QBBA 4XB3A 2WBGA 3T0AA 3A4AA 4MB5A 3ZJ8A 2D23A 4CN6A 4OOUA 5I0DA 2DDXA 3A3HA 1E0VA 4HA4A 4DM2A 2CERA 5BCAA 2V38A 1QI2A 2J25A 3AOFA 1GW1A 3WEMA 1JAEA 2W62A 4JKLA 5AYBA 3TTQA 4JFVA 1ODUA 2DSWA 2BY3A 3CZ8A 4D6HA 3AIQA 1BYBA 4TX8A 3FY1A 2VOTA 3AROA 3WSUA 1OGBA 2YDRA 4X9YA 3B9DA 2UY5A 1TE1A 4CGTA 4D71A 2G3MA 4U5KA 3QHOA 4F9JA 5AC4A 2XJ7A 1VEOA 2YL8A 4OBSA 2VX7A 4S3KA 3WH5A 1OINA 1PX3A 5HOSA 8CGTA 4IISA 5D9NA 1XYFA 5I23A 2EXOA 2XM1A 2OYLA 3SEPA 5A8NA 4F79A 4LGXA 4H8UA 4JL1A 4CD4A 3DHPA 4QLKA 4YHGA 1R7AA 2RGMA 1IZJA 3L2LA 4PTWA 3SCSA 4XX6A 1UR1A 2WHLA 3WH6A 1UUQA 1PX4A 1NOUA 3MMWA 3AI0A 5M17A 4HU8A 5HNNA 4ZENA 5D9PA 2V5CA 4GZEA 5CPTA 2VUYA 3MUAA 4FF5A 3WEZA 5KEZA 1GOIA 1E4LA 3U5YA 1QBAA 1H0IA 3AXXA 4AW7A 3AS2A 4D6DA 1K9FA 4KGLA 1Q6GA 3VVGA 1E6ZA 2Q8XA 5D8ZA 1PX8A 5JIWA 1V08A 1QNOA 1CBGA 3BCDA 4J3TA 2FDMA 3BGAA 3U7BA 1LL4A 1UD6A 4CD7A 2WVVA 5FOOA 4Y7EA 3EMCA 1B2YA 3VUPA 3ARWA 2VRQA 1E1EA 1EQCA 1GUVA 3FW6A 4BA0A 1V6XA 3AMLA 2YL6A 3EMZA 1E40A 3A4WA 2PWFA 3PZOA 3K8KA 3CTTA 4MJ2A 4PCSA 2J7BA 1HL9A 2GFTA 2D0HA 3GYCA 2W4XA 1W1TA 1CYGA 3ARSA 3VIHA 3OGSA 3N12A 2WHJA 4TTUA 4BCEA 5I78A 1CGYA 2J8GA 3LPOA 4PEEA 3II1A 3LPPA 2WM0A 4UQCA 2E8YA 1WO2A 4BQ4A 1EDQA 3WD0A 1LL7A 2CPUA 1J0ZA 1O6IA 1CPUA 3WQ8A 1UH4A 3CHDA 1GOMA 4R27A 2YL9A 5KZ6A 3OIHA 3I3BA 4KRTA 4OJYA 3BCFA 3SCNA 4QDMA 5A6JA 3O6AA 4BS0A 1UA7A 2BVTA 4W7WA 1W9DM 4EKJA 2MANA 2BY2A 1GNXA 4KRUA 3ZMRA 4DUXA 1KBBA 2EPLX 2JF7A 1BGGA 1HKJA 3CZEA 1GVIA 4F8XA 3A6OA 1AQ0A 1QW9A 4RL3A 3ARUA 1HJVA 4GIAA 3BMWA 4P7QA 4PMVA 1TVPA 3UEQA 4MB4A 2FHBA 3OLIA 3VIMA 1QNPA 4F66A 1JDAA 2XVKA 1JZ3A 3AISA 3WH7A 4DWSB 4Q22A 4ZE5A 1NP0A 4CD8A 3MMUA 3S6TA 4E2OA 2WLYA 5A2AA 3NDZA 3FN9A 3UR7A 4UQEA 3VD9A 5A8MA 3AHZA 1PPIA 4NRRA 3AXIA 4CVWA 2CBUA 2ZXQA 4UFKA 3BLPX 4PMOA 3ZO9A 1H4PA 1EOKA 2X0HA 2ZE0A 4DWSD 4UOZA 2WYSA 5A69A 2YBUA 5DMYA 1UQZA 2WCAA 1C3FA 2WZHA 2WVUA 4UFIA 5A6BD 4M56A 4IPLA 1ZBCA 2W67A 5LA0A 4CU8A 1AQHA 2G4FA 1JNEA 1LG1A 3KWXA 3ZSTA 4FLOA 1EHAA 3OGRA 2ZX8A 1MW3A 1V3MA 1WZLA 4P7RA 2EBNA 4L4OA 5CSYA 3BXWA 3CO4A 1GQJA 3HU7A 2CBIA 3VIJA 2QF8A 3L4YA 1Q6EA 3DYMA 1HP4A 8A3HA 1I75A 1EQPA 4DUWA 4B16A 2V3DA 1ZU8A 4B9ZA 4QP0A 2DEPA 2DSKA 1U2YA 3RIKA 1BLIA 2VCCA 4PTVA 4ZFMA 1UD5A 1Q6FA 4ACYA 5GPRA 1E6RA 4A3YA 4PMNA 4QFUA 4W8BA 1W9PA 3VGFA 4U3AA 3L4WA 3VDHA 1VFUA 3BH4A 2X2YA 3THCA 1MW2A 4UQBA 1W9VA 4AD2A 5CGMA 1HNYA 4DUVA 4JHZA 3VIPA 4AISA 1ISYA 3VKKA 2J77A 1BYCA 2WHMA 3JUGA 1CXIA 1V6VA 1CLXA 2J8FA 2XVLA 3PZIA 4D6IA 4BQ2A 1JIBA 1J0KA 2G3NA 2A3BA 2CKSA 1SMAA 5CPQA 2WZEA 4AIEA 3WDJA 1OT2A 4AZHA 2CETA 1VIWA 1X6NA 3SCPA 1YQ2A 2YA0A 4PMUA 2J7DA 1KCKA 1MXDA 5FKYA 4LXFA 4AZBA 1OSEA 1N82A 1Q4NX 4MADA 3ZR5A 1UG6A 3AFBA 5LA2A 3AZTA 4P7OA 4M8UA 1W2PA 2BVDA 3BSGA 3POHA 5DFAA 1JAKA 5JBEA 4AEFA 3CLWA 1VRXA 1W91A 3RM8A 4D6FA 2VR4A 1TR1A 4PSPA 1E9LA 4M29A 4MNLA 1V6YA 3AHVA 2EJ1A 2WZIA 2J47A 1RP8A 2D20A 2JFEX 3OLEA 4UFHA 2C0HA 3VD7A 4PMXA 2WANA 2GUYA 1CLVA 3BAWA 5HPCA 2OWWA 1LLOA 1JXKA 5BRQA 4P7LA 4J3UA 3WQ4A 2CIPA 4AZCA 4AZ5A 2BXYA 3WUEA 1GQLA 1K9TA 4JFSA 3PZUA 1HVQA 1OM0A 2YDQA 4NF7A 1A3HA 3ECQA 1TVNA 1EHNA 2W92A 1QI0A 3K1DA 1MXGA 4JAWA 1J11A 3VILA 2E8ZA 4N0RA 1QPKA 1MQPA 1TMQA 2Y5EA 1D3CA 2FHCA 3W27A 3FAWA 2ZX6A 1BGAA 4CCCA 3CBWA 2EEXA 4JIEA 4D6JA 2WPGA 4HP5A 2WKGA 3WUFA 3GXDA 4J28A 3MANA 3N9KA 2WMIA 1TA3A 2Y24A 2HVMA 1VJZA 5AC5A 4ZXLA 2IXVA 2WCGA 4OIFA 5I6SA 5JIPA 3AMDA 1WE5A 1DWAM 3DC0A 4HOZA 4PMRA 3RMEA 3IAQA 2ZUMA 1PIFA 2CESA 2PBOA 3AMCA 1KXVA 3CH9A 3WIJA 1UWTA 4JFUA 5A95A 3RPMA 4YHEA 3SCWA 4ATWA 1UR8A 2VCBA 4PMZA 4HOWA 5GNZA 5A6SA 3CUGA 3A4XA 4CU6A 1W3JA 3W29A 3CUIA 3SUTA 1V3LA 1B3WA 2UWFA 1MYRA 2ZXBA 3MS8A 5GNYA 1WCGA 2GJXB 2BNJA 1V6WA 5I79A 3ZQ9A 2FH6A 3SCVA 4H7VA 4CCDA 2WVSA 1B0IA 4WJXA 2ZX7A 1PZ3A 1UOKA 1CTNA 1W1PA 1E1FA 1HVXA 7CGTA 4M24A 5M3WA 3AIBA 3W24A 1LQ0A 2XSAA 3BSHA 4OKDA 2ZIDA 5CZKA 4NRSA 2VMFA 1J0YA 3VM7A 1W32A 3GZAA 2YOCA 3FNDA 2JE8A 5E70A 1W3HA 1JFXA 1KXQA 4H2CA 1IV8A 1G9HA 3WQVA 1JYWA 4OOZA 4S3JA 4Q7NA 5CG0A 1J18A 5FL1A 2VTFA 1RPKA 1GHRA 2CEQA 2DGAA 2DIEA 2XVPA 5LYRA 3VGEA 1LWJA 2J7GA 3CZLA 3FHAA 5IHSA 1BQCA 4E8CA 5FD0A 3IJ7A 1WDPA 3TP4A 3EMQA 1E3ZA 1GZJA 4UR9A 3AIRA 4MAVA 1XYZA 2EPMX 1VBRA 2VX4A 3T0DA 1E0XA 3M07A 1JYXA 3U57A 2ZUTA 2WMJA 4J3WA 1B3XA 1HJSA 1UKPA 2VL4A 1FA2A 3UR8A 3WN6A 1BYAA 2E4TA 2JALA 2W91A 1DTUA 3M7SA 1FHLA 3T09A 2D1ZA 4GQQA 4CVUA 3PZTA 1C7TA 1CXKA 1QI4A 3L2MA 2CHOA 1G1YA 2FGLA 2WLZA 3PZGA 3MU7A 4JCMA 1HX0A 1CGWA 1KR0A 2GK1B 3AXHA 5A8OA 3VDBA 5ABFB 1BG9A 1R87A 2J62A 2Z1SA 2VT0A 1R85A 2QHAA 3ZM8A 4MB1A 4GINA 5A6MA 2DT0A 3NJ3A 2DH2A 1PBGA 3NDYA 1KBKA 2WVVB 1WNOA 3E1F1 4TVUA 2J75A 1FFQA 4FLRA 1HJXA 1G01A 2WC3A 2WVTA 3WQ6A 1V3JA 4FLSA 3WMSA 4AC1X 3EDDA 4UNIA 2PC8A 1DP0A 1H2JA 2PWHA 2Y4SA 4D6GA 2PWDA 4N42A 1UWUA 2CITA 1WB0A 2VZOA 1J0HA 1C91A 2XIBA 3K8LA 4BQ3A 2DT1A 1J0JA 3W4RA 2EPNA 1QVBA 5E0FA 4W84A 1OGGA 3AIUA 1BPLB 2ZXAA 2NT0A 1BF2A 2J79A 1ODZA 3W38A 1E73M 4M1RA 4MPKA 2GDVA 1VFFA 2OWCA 2W5FA 3VGDA 1G94A 2PWGA 2D22A 1UKSA 1BVZA 3UESA 3VMOA 3WH8A 1H09A 4X0NA 1U33A 3VGGA 4GZIA 2XWEA 4CUCA 3CHFA 1J01A 1EOMA 4WIWA 1AQMA 1EIBA 1JZ4A 3W26A 6TAAA 2AAAA 1I1XA 1QHOA 3F5JA 5A6AA 4M80A 1BTCA 3PTKA 1UZ1A 3VU2A 1E71M 2X09A 3DYOA 3POCA 4AIUA 3BAYA 1B30A 1CGVA 4B15A 4A4AA 2NSXA 3QHMA 3WFLA 3N04A 4W7UA 2DSVA 2J4GA 4NZCA 3J7HA 4PTMA 3QGVA 1ZJAA 4HTYA 2WCSA 3DYPA 3RM9A 1P6WA 2E3ZA 2WB5A 4AD3A 3LPGA 1VFOA 1HKKA 2DPEA 1EDGA 1XCWA 1US3A 4H41A 3WY1A 3TTSA 1XRVA 2WXDM 2J7CA 2BHYA 1MQRA 4Z2JA 3W6MA 4AD0A 1J0IA 4H8VA 3W25A 3GH5A 5D9MA 5A6KA 2GSJA 2Y8VA 3WD2A 1K6AA 3THDA 3MO4A 2CBJA 3N18A 3VNYA 2BHZA 2E9LA 5BXPA 3W53A 2WNWA 1EDTA 1W9BM 1V3KA 2YBTA 3MSGA 1QI3A 4GKLA 4ACZB 2ESCA 3VDAA 1US2A 3N17A 4C7FA 3EBVA 4U5IA 3SCUA 2XSBA 1C8QA 3U7VA 1K9DA 1C93A 4EANA 2D3LA 1FH9A 1M03A 2ZX9A 4LX4A 1ZBKA 3OZPA 4Z2LA 1MFVA 1PIGA 3GNOA 1NQ6A 3TTYA 3ZOAA 1R7OA 2WMFA 1TCMA 1ZL1A 4FK9A 1JGIA 1QHPA 4UOQA 3GDBA 4KWUA 4MAZA 1CIUA 1JD9A 1WP6A 3OLGA 2D0FA 4R5EA 1RH9A 2PI6A 3WNPA 3L4VA 1B31A 4U3CA 1GONA 3K4AA 3N13A 4AZGA 1ECEA 1XV8A 5GQBA 2ZWYA 2VZSA 5CSUA 4AD5A 1E5NA 1W3LA 2PWEA 2BHUA 3OA5A 1W3KA 2XTKA 3WL1A 1ITCA 3VMPA 1QI5A 1W1YA 5A2BA 1Y7VA 3PBGA 3PHAA 1UZ4A 2AMGA 5C70A 4W86A 1CGTA 5FL0A 2XG9A 1CWYA 1NWSA 3B9AA 3RCNA 5IDIA 5BXTA 5HDRA 1EA9C 1VEMA 4HMCA 3KEHA 4ZEPA 3G6LA 2XFRA 3ALFA 2W63A 2D2OA 4HZ7A 4TVCA 2Y8KA 5BRPA 4MDPA 1JZ7A 1KGXA 3ARXA 4FMVA 3AS3A 3VOCA 3CHEA 4QLLA 4W85A 4WF7A 1E43A 3KZSA 3CPUA 3VTRA 1ISXA 2F61A 3AQUA 4EE9A 4Z2HA 4BF7A 1HF6A 4CN1A 1EO7A 4DM1A 3MSDA 5FCZA 3UG4A 1HKMA 2TAAA 1AMYA 2CXGA 3ZR6A 3DECA 2WSKA 3ZIZA 3GBEA 1L8NA 2O9PA 5M03A 1OBAA 1UH3A 4AXNA 4W93A 4DWSA 1E70M 5HPOA 1XHGA 3IJ8A 1ZBVA 1A47A 1UH2A 2VR5A 4MNKA 1WZMA 4W87A 3GXMA 4QCEA 5A6BA 1UA3A 2X8RA 4UFMA 1CGXA 1KGUA 2VZUA 5HXMA 1H0GA 2DQXA 1EO5A 1QOXA 3TONA 4HA3A 1JI1A 4XV0A 5DO8A 4QCFA 5D9OA 3PN8A 1E5JA 2OLHA 1CXEA 3OB8A 1MWOA 2XUCA 2XGIA 1KB3A 4CU7A 2BS9A 4IM4A 5E0CA 1VENA 3EYPA 2ZWZA 3W0KA 2O92A 3OZOA 4J7RA 1JYNA 2V3FA 4P8UA 4E4PA 3MKKA 3OLDA 1H1NA 2CCRA 4A3HA 3ZJKA 5BXRA 4MDOA 4ZE4A 4M81A 4V2XA 3VM5A 3DHUA 2VX5A 3K46A 1CDGA 2VRJA 1GOWA 1QNSA 1Q6DA 1EXPA 4W8AA 4B3LA 2O9RA 5EB8A 2BFGA 1F4HA 1DWIM 4W5UA 1TFVA 3EDJA 3W81A 4AZ6A 1JZ5A 2VCAA 1J12A 4ATLA 3ZJ6A 3SCQA 5A94A 1B90A 4D72A 1ZJBA 1UKQA 2JEPA 3FXYA 4J3VA 3VIKA 4UQAA 1QHZA 3GTNA 1X6LA 1HN1A 3QHNA 1CNVA 4TOQA 3AS0A 3CHCA 1NWUA 2DSUA 1UD4A 1JI2A 2WKLA 4PUEA 2YJQA 3VIFA 4MNJA 2BXZA 5ABEA 3PTMA 1UWSA 2QMKA 3MUY1 1V0NA 3SUUA 2A3EA 4WSKA 1KXHA 1CXLA 3PZ9A 2WMHA 5A1AA 1RP9A 1V6UA 1NH6A 2VC9A 1KXTA 2J74A 1NP2A 2O9OA 3VD3A 1BYDA 3PTQA 3WF1A 1OB0A 4JZ5A 3ZT6A 3L4TA 3ZT7A 2WBKA 1E55A 1XH0A 1NM9A 2QV4A 1JZ2A 3EDKA 1E4NA 3VGBA 1UYQA 2VX6A 2XHYA 2X05A 4PCTA 3ZT5A 1HL8A 2VZTA 1W2VA 4AD1A 5ABGA 1WZAA 1C8YA 2BY0A 4J3SA 4JCLA 3GNPA 1GQKA 1WDQA 3CZGA 3WQWA 2D3NA 4W89A 4BQ5A 3IJ9A 4UCFA 3BAXA 4UFLA 3SURA 3AYRA 3WH9A 1NOFA 1V0MA 1NOWA 1MW1A 1SFSA 4PMQA 1RD6A 2AOSA 3MUZ1 2YA2A 4U2YA 3VIIA 1JG9A 5C71A 2DH3A 2CNCA 6A3HA 2YA1A 3ARYA 1TG7A 5I3DA 1BAGA 5CGTA 2EQDA 2V3GA 3BAIA 3NSMA 4JKMA 2NW0A 1CGUA 1OD0A 2WW5A 3WD4A 1SYTA 3ZJ7A 1W9UA 2O9TA 4PBGA 1JXJA 4TXEA 4JHOA 2VURA 4PYSA 5IXEA 1FP8A 2ZUVA 2XWDA 1ZS2A 1BG4A 1EGZA 2IXUA 1GVYA 3L4XA 3I3DA 2CKRA 2FGZA 3T08A 4E8DA 2XFFA 3BMVA 1ISVA 1UWIA 4HZ8A 2C8NA 3APGA 5ECUA 1G5AA 1B9ZA 1VF8A 3KL0A 4P7NA 2V5DA 4RE3A 4CD6A 4V27A 4JFWA 4W8LA 3NSNA 1UR0A 2BY1A 4LQ1A 1VEPA 4BZYA 4UFJA 1QNQA 1CZ1A 2E9BA 1UHVA 2EO7A 1XCXA 2WWCA 2YLLA 3WF0A 2VZVA 4TUFA 1XSIA 4P8XA 4URIA 2VQUA 3ARTA 3NYDA 2GJXA 4W5ZA 4HMDA 1UR2A 4RE2A 2X0YA 1L0PA 1BFNA 1PJ9A 2IUZA 3WD3A 1M04A 2QPUA 1BSIA 1XD0A 2DIJA 2J78A 5D8WA 3UCQA 1OGSA 1HT6A 1XH1A 1YHTA 3CZJA 3VIOA 1HXJA 1QW8A 3CIVA 2G3IA 3AIWA 3ARRA 3WNNA 1VB9A 1KCLA 4MJ4A 4EAMA 7TAAA 3RILA 1H49A 3AZSA 3IAPA 1S46A 4IUGA 2WAGA 1FHDA 1DEDA 4AD4A 1V0KA 2NT1A 1H41A 1WKYA 3WFZA 4NSBA 1FFRA 3VIGA 4WKFA 4AEEA 1VFMA 1LL6A 3PZMA 1FP9A 5CQ1A 1DWFM 3T2PA 3VNZA 4YPJA 2X1IA 1C92A 4AIOA 5I24A 3CUJA 1D7FA 3AMKA 2WC4A 2ZXDA 3G6MA 1TUXA 1M01A 3BAKA 1PZ2A 4ML4A 4F9DA 1KQZA 2JF6A 1C7SA 3W37A 4OZOA 2DSZA 3ARQA 2G41A 4W88A 2HISA 1Z32X 4HA1A 3WF2A 3QOMA 1FOBA 4WK9A 3VX0A 3ARPA 4JFTA 1UR9A 3WMBA 3KE0A 3O9NA 2UY2A 2JIWA 4QLJA 3AS1A 1OT1A 4CCEA 4D6CA 2WWDA 2C7FA 1HJWA 4CD5A 1W9XA 4AMCA 2F2HA 3AIVA 3RM4A 2VJXA 5DF0A 3AYSA 2OSXA 4Z2KA 1MQQA 1KR1A 1E4IA 1UKOA 4GO8A 2GK1A 5IHRA 2W61A 3O2LA 3M6DA 1BHGA 4AZ7A 5ABFA 3RJYA 3AZRA 3MUIA 3F5KA 4GI6A 1V3IA 2GJPA 1WDSA 3VMNA 5A2CA 5CJ5A 1E6QM 3BC9A 3WNLA 3FHQA 3UG3A 1JZ6A 4UZSA 2YLAA 5LA1A 3UERA 3OBAA 3WUGA 2VRKA 2DT2A 2WK2A 1LG2A 3GH4A 7A3HA 1JDCA 3VX1A 5A8QA 4W7VA 3GBDA 2DT3A 4DWSC 1FH8A 2PBGA 4GI8A 4QAWA 1WZKA 1DWHM 2OYMA 2VVNA 5A6LA 2OWXA 5E9AA 3S2CA 2XVNA 5D4YA 1UR4A 1WAWA 2QPSA 3VGHA 3W6LA 1E6XM 1VJSA 3SUSA 1ITXA 5CLWA 2OSYA 1E4MM 1UD2A 3SCRA 2G3JA 2ZOXA 2WMKA 1QNRA 1H5VA 2ZUNA 5EBAA 3N15A 2BVYA 2YKKA 1E15A 2J7FA 3AJ7A 3T0BA 1JFHA 3AIEA 4UQDA 3AMGA 5A3HA 4LYRA 1AVAA 2XFYA 3KL3A 2CBVA 3K8MA 1EH9A 1B3ZA 3WMCA 4LPCA 3IANA 1ESWA 3OG2A 2VO5A 4PTXA 1CXFA 4JKKA 4AZIA 3K4DA 4K68A 1E72M 2YL5A 1GPFA 2ZICA 4RE4A 1I1WA 2E0PA 3MMDA 2GVYA 1SMDA 3GM8A 5IFPA 2EPOA 4XUYA 4AY1A 4HZ6A 3TOPA 3ZSSA
chains in the Genus database with same CATH superfamily
2RGLA 4XKYB 3HQOA 1TIWA 1Q8AA 1X8FA 1QUMA 3QJAA 4NX0A 1UWRA 3D5HA 1FH7A 5E6ZA 4C7DA 5JUVA 5AY7A 2FHFA 3SDOA 4Z1AA 2EKCA 2NV1A 1JNDA 1RD5A 2R6OA 4BF5A 3FKKA 3PPHA 1IR2A 1ZPTA 2DZWA 4F0LA 4M82A 1I2OA 4KEUA 5I2UA 3QRHA 1RPXA 3M46A 3LMYA 4I9TA 1V4YA 1LQ2A 1OX4B 3IVUA 4ACZA 3VOHA 3IV3A 1C90A 3T8LA 1GQIA 1TPB1 3W7HA 3PJUA 4H01A 5C8BB 5T9BG 4L1WA 4OUEA 1GYNA 1NAL1 4LYQA 4PUMA 3WUBA 2Z29A 2VEKA 3RO8A 2Z1BA 3T4WA 3BQ5A 4NJJA 3ELFA 1EJRC 3OU8A 4ZR8A 2HBXA 2PDHA 2OR2A 2CLLA 3WO8A 4L4PA 4QISA 3BARA 3HO8A 1TTIA 3WJSA 4LBUA 1KRCC 2WMIB 3M5YA 3NM3A 5TF0A 3E38A 1EYWA 3GY1A 4XZBA 3TC7A 2A7NA 3W7PA 4TV5A 3H22A 3GH7A 3SN1A 1VJIA 4CN4A 4DEFA 1X1OA 5LHEA 5LIYX 1ISZA 5DEZA 2QCDB 1GJUA 4TX6A 1KGWA 3N4FA 2VNCA 3RHGA 5BWFA 3MV01 3LS9A 4H19A 5LKYA 4DNMA 4QSHA 1OIMA 4UQ9A 1GHSA 1XYAA 3B8SA 6CGTA 4PE8A 4IUOA 3APTA 1TWZA 1DWGM 2XIIA 2OPJA 3B9EA 4D1IA 3FVMA 3WDIA 4CQDA 1KFLA 1P0BA 4HPGA 3O6YX 3S1GA 3CB3A 4QHRA 4GG9A 4IQLA 2XSXA 1OWQA 4A3UA 4OUIA 2E9MA 2DIKA 2J7HA 4KGJA 4JIIX 4UOJA 3W86A 1N8WA 3WLOA 4GO9A 4UTMA 1WA3A 1MFUA 3RN6A 1PEZA 1SR0A 1GTHA 3FDGA 3WNKA 2UY3A 5CXPA 2GVJA 4PZVA 3CL7A 5M5DA 3MBFA 3N11A 1A3WA 4HOXA 3QVQA 1A5AA 2OODA 3IIZA 4O54A 1K1DA 3U0HA 3PZQA 1E6NA 2ZRUA 1KCXA 3IIOA 3BLKA 4O1DA 1IE7C 3TN3A 2I17A 2QMJA 2I16A 1FWAC 5DT5A 4AYSA 1XSJA 5AZ0A 3RXZA 1R0MA 3A47A 4WZHA 3O6CA 4QROA 1T6MA 4MLJA 3GB6A 3WKZA 3DOPA 4CNNA 3GXFA 3G1VA 3G1RA 1IXPA 5LZLA 4I5XA 5BU9A 4KF1A 5A8PA 4US5D 3QMSA 1JF6A 2P10A 1XD1A 4UTIA 3QGKC 1U30A 1OIFA 3VINA 2FJKA 2CLPA 1ITUA 1A5NC 1RCOB 4GXPA 3TSMA 4L64A 4EPDC 1XH2A 1XG4A 1PDZA 2R1MA 3CASA 3BJFA 4NAFB 1KFKA 3BPWA 3AHTA 1TPUA 3EB4A 5AYIA 3MWAA 5EY5A 1EC7A 2HK1A 3GFYA 4PMJA 4EWND 1PYMA 4LYPA 4TTGA 1X1NA 3EOSA 4V15A 1JF5A 1LRQA 2EG6A 3QBUA 3LN3A 1EJTC 3QV9A 5HMSA 1XLAA 3HJEA 4C6MA 4IFKB 4O8RA 3AICA 1LUCB 1GOKA 1K4HA 3GXIA 3SJ3A 3ARVA 2V3EA 4E2DA 3CUFA 3WNMA 3N1AA 4K2SA 2JBMA 3BOXA 4JY8A 1HJUA 3STFA 5FEZA 1D2KA 1GT8A 4GFIA 4FXJA 3W07A 2PF0A 1YX1A 4KCVA 4QE5A 3WQPA 3SRDA 4XB3A 3TFXA 1I9CB 4JYFA 2CWNA 3ZJ8A 2D23A 5D09A 3SRKA 4OOUA 5AHMA 3UJFA 3A3HA 4DM2A 1Y5WA 1L2UA 3RR4A 3N2MA 2V38A 2FTWA 1K7FA 2J25A 3FA5A 4F2TA 1FCUA 4OTKA 3C0JA 4AXKA 4EF9A 4IJCA 2W62A 4ASTA 4JKLA 4JFVA 5C7VA 5HMFA 1GVQA 2BY3A 1PKMA 4JOMA 1JCJA 2E09A 3AIQA 3TK7A 2VOTA 4JXCA 1G67A 2NXIA 2YDRA 1DJQA 3W1RA 2HXTA 2FZNA 4YTTA 4UTHA 5F4XA 4IHCA 1TE1A 2BP1A 2G3MA 3QHOA 4U4MA 4GA8A 1VEOA 1Y8BA 1FXPA 2YCKX 4S3KA 1UMYA 1PX3A 5EMKA 4HGXA 8CGTA 4IISA 1OC6A 5D9NA 4RPQA 1DXEA 5IRPA 1FKXA 4Q3MA 1AL8A 1XYCA 1GVRA 5D2VA 7PTDA 1UWAA 2OYLA 3SEPA 2ZVRA 4H8UA 4JL1A 1W1B1 4Q4OA 4YHGA 2A7RA 2RGMA 5FF2A 3C56A 3WJXA 1UR1A 2WHLA 4MWAC 1W5QA 1UUQA 2Y7GA 3GK0A 1PX4A 3AI0A 5DCDA 4DJFD 2V5CA 4GZEA 2VUYA 4FF5A 5KEZA 4IIFA 3P0XA 1E4LA 3U5YA 2XH7A 1SFJA 5C2GA 3UR5A 3VVGA 3WQCA 4HNCA 3ENLA 4U28A 4J3TA 3NQEA 4G9PA 3B0PA 1O5XA 3F7JA 1LL4A 4GJIA 4CD7A 4QITA 1VFSA 5FOOA 3ZXWA 1B2YA 5LIKX 3VUPA 3ARWA 4YVPA 3W1MA 3R79A 3JZUA 4TX9A 3NZQA 2PTWA 3HG3A 4UTTA 3PG9A 2OT0A 1CYGA 3RMJA 3AALA 4DLMA 2WHJA 1H7RA 3LPOA 1L6WA 3LPPA 2OO6A 4UQCA 1KM3A 3UA3A 1EDQA 1LL7A 2CPUA 3WQ8A 1GOMA 1OX6A 4LAUA 3SCNA 3K13A 2ZA2A 3D3FA 1JRCA 4BS0A 2PMQA 2BVTA 4W7WA 1K02A 4C5ZA 2A0NA 4EKJA 2BY2A 3NR0A 4KRUA 4NIRA 1TV2A 2EPLX 2JF7A 1L8PA 4JTEA 5JVLA 3S2NA 3HFTA 4HYVA 1FDYA 2H90A 4G7FA 2V2HA 3ARUA 5AHLA 3GIQA 2R1LA 3S5YA 4G6CA 4PMVA 1XKYA 3CIWA 2DVXA 1TVPA 1NQKA 2QCNA 1ZSXA 1XIDA 1XBYA 1Y5VA 1O94A 3PSVA 1WXJA 4E8GA 1QJWA 2XVKA 1JZ3A 1KTNA 3MY9A 3UWUA 2QJMA 3A64A 5C2CA 3DXIA 1NP0A 3HQ1A 3MMUA 2DZUA 3SY5A 1F76A 2ACRA 2NWRA 3FN9A 4H2HA 1PPIA 3QZAA 2Y7FA 2CBUA 1ZCOA 2ZXQA 1F74A 3ZO9A 1NDWA 2X0HA 2AAMA 2ZE0A 4DWSD 4LUJA 4UOZA 4DO5A 2WYSA 2YBUA 1UQZA 3SQLA 1QO2A 4UNKA 4IIBA 3B04A 4N9BA 5A6BD 1SZGA 2QPXA 4UTJA 3JS3A 4CU8A 2Z1WA 1XBXA 1AQHA 3KWXA 3OGRA 3KOXA 1RBOB 4L4OA 1KM5A 1YE6A 3SIZA 3CO4A 2CBIA 5TQLA 3EOLA 4LCRA 3BGJA 3LG3A 1I75A 3QY7A 1JVNA 3TYDA 3O8AA 4XSLA 1WXZA 4IJRA 1KW1A 3M47A 4MSSA 2VEIA 3HJZA 1ZUAX 4Z1YA 4Z42C 1JPHA 1P1XA 4PTVA 1TYGA 5LIUX 4ACYA 1Q6FA 1E6RA 4FHAA 2ICSA 3DHDA 4QFUA 5K3VA 4QG8A 4UIOA 2CWXA 1WV2A 2HPIA 3DUGA 3VGFA 3L2IA 1VFUA 5KITA 3ONCA 4TV6A 3P3BA 4FX7A 3N3TA 1IIHA 4AY8A 4D8AA 3JUGA 3RLVA 1V6VA 2XVLA 2RDUA 1J0KA 2G3NA 5HA7A 4IQEA 3KAOA 4FOJA 1SMAA 4K7YA 4AZHA 4FPSA 1VIWA 3SCPA 3CAKA 1JPKA 1OSEA 1KV8A 3VNIA 4I7VA 1Q4NX 3V16A 4GHRA 5LA2A 5GJNA 4XD3A 2I14A 1Q66A 4RNFA 2W0UA 3UBPC 1KC7A 3NZ1A 2FFIA 1Q13A 1VRXA 3RM8A 4F48A 3BJTA 4PSPA 1UZHA 3P61A 4TQTA 1XIGA 4PC8A 2EJ1A 1RP8A 2DORA 4HU3A 9XIAA 4LC8A 5D02A 3NQBA 2GUYA 2WJZA 3HGRA 1DQXA 3G8EA 5BRQA 5CZSA 4HT3A 4DPPA 4AZCA 4GUJA 2QEZA 4L6OA 4JPGA 4A35A 4QJ1A 3WUEA 1E9ZB 4JTSA 3PZUA 4NF7A 3NXFA 1Y0EA 3NDOA 1A3HA 3MQTA 1EHNA 3VILA 1T0OA 1MQPA 2R91A 3TWAA 1ZP4A 3CQIA 4DNHA 1A5BA 5ECVA 2ZX6A 1BGAA 1W5MA 3CBWA 2EEXA 4JNYA 4WDWA 2A21A 4D6JA 5I06A 3MANA 5AECA 4ES4A 2Y24A 4IH3A 2HVMA 2IXVA 3W85A 1S5VA 3FGCB 1PTDA 1D7KA 1XUUA 4KESA 4WJ8A 1XYMA 3C2EA 1UCWA 4QX4A 2YZRA 1PIFA 3CT7A 3W7NA 2PBOA 4IJBA 1KXVA 5G4HC 3WIJA 1T5AA 2ZKMX 4L9YA 3RPMA 1GVFA 1T99A 5XIMA 4ATWA 4IIEA 4PMZA 4HOWA 5A6SA 4HK7A 1A5OC 4NASA 1MMFA 1W3JA 3BSMA 3UF9A 2QT3A 4LUYA 1LLWA 1B3WA 1LBMA 2UWFA 3BK0A 1MYRA 5GNYA 2BNJA 1V6WA 4DJDC 4H7VA 4DBDA 1VPYA 4EXQA 1X1ZA 1PZ3A 1UOKA 2Z25A 1SZEA 4IMEA 3UT0A 3LERA 4A21A 4RDVA 2D2GA 1CLKA 3BSHA 1K8XA 5CZKA 3H2CA 3S4TA 2OZ3A 1W32A 1W3HA 1ME7A 1IV8A 3WQVA 1JYWA 4OOZA 4Y2WA 1I8JA 3GZ3A 4GOAA 5LYRA 3UGVA 4ICMA 4Y9MA 2L5HA 3FHAA 2YX0A 3CLMA 3QTGA 1WDPA 4RZ4A 3W7OA 6ALDA 3EMQA 3PFMA 4QSFA 4F0MA 1TZZA 3CXOA 4JDYA 1VBRA 2VX4A 1JYXA 3EA3A 4G1KA 4I90A 5C9ZA 3VCRA 4OV4A 3ABXA 1QK0A 1B3XA 2BWGA 1UKPA 5J5DA 3H70A 3R89A 3WN6A 1BYAA 2E4TA 1FHLA 2FZ8A 3RITA 2HJPA 1ZJHA 3FVDA 3TVAA 1RVGA 1F3TA 1QI4A 1EBHA 5C9UA 1G1YA 2FGLA 4XBSA 3PZGA 2FB3A 1REQB 3OQ8A 1OC5A 1CGWA 2GK1B 5L9FA 5HNTA 4GYJA 4EPEC 5ABFB 2J62A 3MP5A 4JTHA 2VT0A 3EKZA 4RK8A 3H2NA 4MB1A 4GINA 3PNZA 2DT0A 3NJ3A 2G5WA 2CZEA 2DH2A 3OVQA 4YVXA 1HZYA 1WNOA 2XGZA 5HWMA 3WYZA 3KWSA 1V3JA 4A2SA 4FLSA 1LYXA 1WOBA 3UJ2A 3EDDA 3QEZA 2GWGA 4CNUA 4MUPA 1OG0A 3RUBL 1O66A 1FWJC 3L5MA 3PK7A 2XIBA 4GNVA 3H54A 3R6IA 2NVAA 1R38A 2RJHA 3W3OA 1JCYA 1EZ2A 4ZSTA 1XR2A 1OGGA 3QPEA 2FYMA 1BWVA 4FEZA 1ITQA 3F4CA 1VFFA 2NQHA 2OWCA 2G50A 1G94A 3S1VA 1F07A 1BVZA 3UESA 3W23A 2HRWA 4Y96A 1GPWA 4GZIA 2IW0A 2XWEA 1HO1A 1J01A 4K39A 2PP3A 4DF2A 1AQMA 1S2AA 3MKCA 2OGYA 3ABOA 1R3SA 1X98A 2HZGA 4QXIA 2G4JA 4NI8A 1UZ1A 1Z42A 2X09A 4PA8A 2Z26A 1PWMA 3BV4A 1GTEA 4KCUA 3EXRA 5EU9A 1CGVA 1FDJA 3B8WA 3WFLA 3P2VA 3RAOA 2DSVA 4NZCA 4DBWA 1AD1A 3FX4A 4HTYA 1B54A 3RM9A 1VD6A 2E3ZA 4B5SA 3LPGA 2OO0A 3XISA 3LTSA 1XCWA 2A1YA 4C91A 4C6OA 3TYZA 5HWNA 4OBTA 2WXDM 1SQ7A 4GK8A 1ME8A 4AD0A 3STCA 1M68A 2OLAA 4QAIA 2DU2A 5D9MA 2GSJA 5HNRA 3WD2A 3U9IA 1K6AA 3ABQA 2VFDA 4XAGA 3THDA 2WZTA 3GNDA 4HNNA 3VNYA 4LEQA 4BI7A 2BHZA 2E9LA 3IUDA 4ZO8A 5BXPA 3UCDA 3W53A 2PUZA 2JGYA 3VC5A 4U10A 2F84A 1QI3A 3MDWA 2ESCA 1US2A 4K8GA 3QC3A 4RLIA 3EBVA 2W3ZA 4HHPA 4GQBA 1Q2SA 1W8GA 4LUSB 1CX9A 4DBEA 1QXLA 1C93A 4M1BA 4EANA 4WCJA 2ZX9A 4LX4A 2RJGA 3OQEA 5FJPA 3SAZA 3HPFA 3EX3A 4UOQA 1JCXA 1QHPA 3UPWA 1CIUA 1WP6A 3OLGA 5AN7A 4NL1A 1HQTA 8TIMA 3VNMA 3EWWA 1A4LA 3A4JA 4Z1BA 1V93A 3KP0A 2QUMA 5DMMA 1ZAHA 2FVMA 3G0SA 1MUCA 5GQBA 4KIRA 2MNRA 1OQFA 4AD5A 2XN0A 4NXSA 4S2CA 3LU2A 3G1XA 3VI2A 1P0NA 3TOYA 4MPQA 2QS8A 4OWGA 2POTA 5BOFA 4FNPA 3NPVA 4LRSA 2HEJA 1UZ4A 1CGTA 1K6WA 3LCFA 3SBFA 1I60A 4NJGA 5IDIA 5BXTA 3EPNA 4LVBA 3W7JA 4EOUA 4M6UA 3JZEA 2AL1A 4Q8MA 4RZ6A 4ZEPA 4JTFA 2XFRA 2W63A 4LW7A 3KDOA 2D2OA 2A7PA 4MDPA 1JZ7A 1W1IE 2G3FA 3VOCA 4QLLA 4PB3A 4W85A 5AHIA 3VTRA 1J5TA 4BF7A 3KHDA 4DM1A 3MSDA 5FCZA 3NXLA 2TAAA 1OFBA 3ZR6A 3ABZA 4J3ZA 2QAPA 1EWEA 3GBEA 2GUBA 4WVXA 1TWIA 3G1AA 1FWSA 1IYXA 4GJ1A 1YNQA 2ISVA 3OVPA 1JCNA 1E9YB 1O60A 3E96A 4S3GA 2QDEA 4LUIA 4W87A 4QCEA 2QCMA 1PCKA 2ABAA 3W76A 4GY7A 4XO6A 2E7FA 3KW3A 5AYXA 1H0GA 3TN6A 3TTEA 2DQXA 2E5DA 1VP5A 3NTYA 4WOQA 3W88A 4C6IA 2DQWA 3PN8A 1E5JA 3CWNA 1E0TA 2JK2A 1NFPA 1G7VA 1YDVA 5D2TA 3I68A 2XUCA 4BJHA 1SJCA 2RH9A 4OU1A 5E0CA 1D3GA 4R7OA 5C54A 1GYMA 3MTWA 3OZOA 3LK6A 5FI8A 2VD9A 2V3FA 3OLDA 1TV3A 3TYAA 5FEXA 3DFYA 4C65A 4GYFA 4UUIA 3M0JA 3HG4A 4JD4A 4FALA 3U2ZA 1OY0A 1GOWA 1OCNA 1QNSA 3KTXA 1F6YA 1EXPA 3H2AA 4W8AA 2BFGA 1F4HA 1DWIM 1R6WA 5G2HA 2B0MA 1KBLA 1X38A 4L6HA 2I9EA 3KS6A 2CFFA 3R1ZA 1RSCA 1V79A 1P1MA 5AOUA 4ZQMA 3SCQA 1QMLA 3NQMA 3O07A 4GX8A 3W2UA 3VKAA 1XRFA 2AQWA 4QBXA 3FA3A 2X30A 4R53A 3WQDA 4GGBA 3S42A 3VIFA 4MNJA 1EXBA 3KRSA 1UWSA 1MEHA 1L9WA 2A2IA 4EXAA 3SUUA 4WSKA 3HG2A 1CXLA 2WMHA 3TCEA 3QQ1A 3IRSA 1W5PA 3BWWA 5F2MA 1TV5A 3WF1A 4XZLX 1OB0A 5DLCA 4EXBA 3L4TA 1Q6OA 1RQHA 4DYKA 1E55A 1C9DA 3B8UA 3ZWTA 1NM9A 4WEVX 4NHVA 3B0YA 4Q8NA 1E4NA 3RX4A 1FXQA 2VX6A 2XHYA 3WLIA 4O1CA 4BEUA 2YZ5A 4TMCA 5ENLA 2BY0A 2NX9A 3GNPA 2CC0A 3AWNA 3FFSA 3LM7A 3W2LA 1GWJA 2D3NA 4NZ3A 3TKFA 3IPWA 4UCFA 1ZTVA 3QH2A 1NOFA 2OQHA 3AUOA 4CQ9A 1NOWA 1KFCA 3BOFA 1YKWA 4LAMA 1UASA 2ONEA 4JX4A 2PTZA 2DH3A 6A3HA 4Q6XA 3IIPA 2O7QA 4XZHA 5I3DA 5CGTA 5D2WA 3HGSA 4JKMA 3TLLA 3UGRA 1SYTA 4JTTA 3ZJ7A 3W1LA 2FZMA 4Z1DA 1W9UA 2PD9A 3PJXA 1JXJA 3TJ4A 3MMTA 2PDLA 3DC8A 2VURA 2BSLA 4D8ZA 2BOGX 4JIQA 4H9TA 3L4XA 2FGZA 2Y7EA 1ISVA 1GEQA 1K7EA 4HCHA 2OXNA 4I3GA 4RE3A 2WQDA 2A3LA 4JEJA 4W8LA 3NSNA 2ZRXA 4MYXA 4UFJA 1QNQA 1F05A 3EWYA 1Q8JA 1AW5A 3QZEA 3WLHA 1XYLA 4O19A 3W7LA 1R3YA 2YXXA 4C90A 3P67A 4GC4A 4C6JA 4N6EA 5AB3A 2PCQA 3NYDA 2WZMA 1SO6A 3EPOA 3TFCA 2X0YA 4XAYA 2E5BA 2KZHA 4HZMA 3WD3A 1M04A 1BSIA 2J78A 3UCQA 3RCYA 1M41A 2B7NA 2WKJA 4MJZA 3CIVA 2G3IA 1R9YA 3AIWA 5FJTA 3NL3A 4EAMA 1T8XA 3IAPA 1S46A 5H8MA 2HNHA 4AD4A 1V0KA 1WKYA 3LY0A 5C9XA 2BGNE 3VYLA 1KRAC 1FFRA 7REQA 1LL6A 5CQ1A 1DWFM 3T2PA 4Z0JA 2X1IA 4IL0A 3AMKA 3E2QA 2ZXDA 3G6MA 3EX4A 1M01A 2D69A 4ML4A 1PZ2A 2A85A 3W37A 2JF6A 2DSZA 2P1FA 2WQPA 3RR1A 4W88A 3KS5A 2VGBA 2HISA 1Z32X 3H23A 1FOBA 3ARPA 4JFTA 3R8RA 1UR9A 3VCCA 3IK4A 3WMBA 1XL9A 4BR1A 3BLFA 4BKNA 1N7KA 3PS7A 1A0CA 3MT1A 3NZPA 3SO7A 5T8GA 4CD5A 1L6YA 3NL2A 2F2HA 3DG7A 4Y9OA 2VJXA 3EA1A 2DP3A 7ODCA 2OSXA 2YBVA 2HCVA 3LMZA 3T81A 5IHRA 4D2JA 1IXQA 4AZ7A 3MUXA 3PWGA 4S38A 2KAUC 1M1BA 3ATZA 5DX7A 1AODA 1Q6LA 3W7CA 2ALRA 3F5KA 1TRIA 4R33A 1IIGA 3C52A 4O4VA 5CJ5A 1E6QM 1VBJA 2Y5SA 1TSIA 1JZ6A 3IVSA 2OQLA 3G3DA 2YLAA 1M7JA 1XLIA 3FYPA 3M6YA 3G1DA 2DT2A 3FDKA 4OGZA 1BEUA 4MWAB 4WDXA 3LHUA 3VKDA 4DWSC 2HPMA 4X60A 1FH8A 1YDYA 3I65A 1KM0A 2YXOA 4GI8A 4HKPA 3PAOA 1DWHM 2C3ZA 2VVNA 4J5NA 1JUKA 1JCTA 4ZFCA 3TAKA 5HJYA 3BG9A 2OWXA 1SO3A 5D4YA 5AZ1A 4MLRA 4RZBA 1WAWA 4YTRA 3VGHA 1EWDA 4WUIA 1WUFA 2WO5A 2ATMA 2I5GA 1UD2A 2YW4A 2PDQA 4Q4QA 1Q3NA 2CW6A 3M5VA 4H9XA 3THUA 2ZOXA 3VZYA 2INEA 1PL9A 2Y89A 3M5ZA 1QNRA 4GNJA 5RUBA 5EBAA 3USBA 2YKKA 5FEWA 4WR3A 4RJEA 1OJXA 1RV8A 3S9ZA 2ZC1A 2OGJA 3IGHX 2XFYA 4YXGA 1B3ZA 2X16A 1X8CA 3WMCA 2ZDRA 1I2QA 3IANA 4HN8A 4JTKA 4X63A 3KX6A 2X7WA 3O05A 2PGRA 3MI2A 2Q02A 3R12A 4LVFA 3HV9A 3EEZA 4UC5A 4RE4A 1I1WA 1VS1A 2Q3RA 3DIPA 5XIAA 3GM8A 1N55A 5FAJA 5KMYA 3LM3A 4YS1A 4NYUA 3S9YA 4HZ6A 1H62A 1KM6A 2X7VA 3PY2A 3PBYA 3CHVA 1VH7A 2BV9A 1ME9A 5E0KA 3L12A 1R2RA 2GGHA 4F2UA 1V03A 4JQAA 1UKTA 3HPXA 4IGMA 4J3XA 4LY8A 3V5CA 2UY4A 4K8HA 3HN3A 5IOBA 1G4EA 3C4UA 3UYCA 3LHTA 4OQVA 1GOOA 4WQ6A 1G7UA 4PBEA 3C2YA 4PUWA 3QR3A 4XO7A 1XGZA 3BW3A 1J10A 3L0KA 3CMJA 1KQYA 4TR9A 2NUYA 3SCTA 2NXGA 4C1NB 4WKHA 5HANA 1OCBA 3QSTA 1V02A 4D6EA 4HN4A 4RW5A 3WEOA 3OYZA 2ZX5A 4Z2GA 1H7XA 3KUMA 4EP8C 3THAA 5FIPA 4WDTA 1IT0A 4GQRA 1CECA 4X0VA 2EHHA 3PC0A 3QY6A 2VGGA 4XUGA 1U1JA 4ZO6A 3AWOA 4C1KA 1U83A 2ZUSA 3SIMA 4B91A 3CUZA 3SRFA 4PUDA 3ITGA 3GUGA 1UB3A 4DPQA 1ZP3A 4CKQA 3EWBX 4U31A 2P50A 2OOFA 3WNOA 2V5KA 5KINA 2XM2A 1M3UA 1F5ZA 1E6PA 3PF3A 2GJRA 5SWUA 1FWHC 4L65A 1EJXC 3B0XA 5M1TA 2QJGA 1G4PA 3EDEA 3W7EA 2QJIA 2PB1A 5EFFA 4L56A 4MNMA 4JTUA 5JBDA 2XGBA 4MFEA 1XGDA 5I5RA 3MVIA 1Y65A 5LIWX 4J35A 1RAKA 3HMCA 3DFTA 3VCNA 1GJWA 3WD1A 2WSYA 2ZZ1A 5BU6A 1Q6CA 1JL8A 5I3FA 4PB4A 4HJFA 5MKGB 3T2QA 5D03A 1O7AA 5BROA 1G0CA 3WL0A 2R82A 1JYVA 3T40A 3VDGA 1V3HA 1B3YA 4AWEA 5KETA 2ZDSA 1ZB5A 3O1NA 3WENA 5FESA 2PWUA 1KFEA 3W82A 1NWTA 4J27A 5EKYA 4AHOA 2INZA 2QKFA 3KP1A 4UB9A 3MB9A 1LJYA 1XBZA 4HMEA 4GUFA 4WLCA 5BYWA 3MO7A 2Z2BA 2XPKA 4B2DD 3S47A 3SQMA 1PAMA 2Z00A 2V81A 4KIEA 1TQXA 4WX2A 1GG1A 3QV8A 1NFGA 3OPSA 3IUHA 3UXDA 1GCYA 1E3XA 5I77A 2PDYA 2IKGA 2ISWA 3UG5A 1F3EA 2XN2A 5BMXA 1EGMA 2ANUA 3WLKX 3R0KA 1DV7A 4MGGA 4GUGA 1TWDA 1HL2A 1ICPA 2FPTA 3WF3A 1TRDA 3HA1A 1BTMA 1IZKA 4H8HA 2GDUA 3TR9A 1F3WA 3RF9A 2G96A 3C3NA 5GNXA 3BOLA 5CC6A 3SSJA 1UPMB 1Q7QA 3LUTA 2B7QA 1UIPA 4JL2A 3D3AA 4XZIA 3STPA 4K1WA 1HKIA 4CQCA 2XYLA 5KTLA 3MHGA 2G8ZA 3K5XA 3BAJA 3OGVA 2BBFA 3TC6A 1OCJA 4MTVA 5DRIA 3U5UA 3FXGA 3V36A 1LM1A 4IXHA 1OYAA 3W00A 3RGTA 1XC6A 4NT0A 1GQNA 5EMJA 2F9RA 2DW7A 4N02A 2A5HA 3VO0A 4YYFA 3S8HA 1ISWA 4AC7C 4PTNA 2OELA 2EPKX 3G24A 4B9YA 4UTTC 3CNYA 3WDRA 5PTDA 3KL5A 1O5QA 4NZ1A 1KWGA 3PZNA 3LBOA 3SCOA 3BANA 1DXIA 1H11A 4ECLA 3W28A 3VPLA 4RPPA 4JBRA 3AUJA 1R3WA 1YPIA 3BICA 3QOKA 5EA9A 3A4AA 2DDXA 1PKNA 4Q6JA 3PBWA 5BCAA 3GC2A 2E25A 4NKCA 1ONRA 3AOFA 1GW1A 3WEMA 1JAEA 4KRZA 3IGSA 1RALA 5AYBA 3TTQA 3V3WA 4J1OA 2VDIA 3GAKA 3N9RA 2V68A 4X61A 5CPMA 4KCTA 3UNTA 3B9DA 1R5YA 2UY5A 4O1BA 1DXFA 4LS2A 4D71A 2Y7DA 1DBTA 1NU5A 3RLHA 1ONWA 1BKHA 4N4PA 4GACA 4RNHA 3WH5A 1OINA 3M0KA 1XUZA 5CC7A 5I23A 4JN7A 5B7YA 1UW9A 2XM1A 2CLOA 3TUUA 1JPMA 1ELSA 4GIRA 2QCEA 2RDWA 3DHPA 3W1UA 4QLKA 3C2FA 1YADA 3T42A 1R7AA 2FMNA 1F3XA 5F4SA 4PTWA 4D9PA 1F73A 4XX6A 4ZMGA 2HXUA 3WH6A 1GZ1A 1NOUA 3MMWA 1QTWA 2V8ZA 4J4KA 1TKKA 1ZAJA 3M0ZA 1RJRA 3MUAA 3UJRA 1NTHA 1QBAA 1H0IA 2YB4A 4NXKA 4D6DA 2G0WA 4DF1A 2ZRWA 1Q6GA 4KGLA 2PTXA 5D8ZA 1PX8A 3UXAA 1XM3A 4K8EA 2DZVA 3CAVA 3UWQA 1VKFA 3P93A 4LALA 4R3UA 1UD6A 3T44A 1LOQA 1TTQA 4XD4A 3E9AA 1V6XA 2YL6A 5IBXC 1E40A 2PWFA 3CTTA 4MJ2A 4PCSA 3W1AA 5DY2A 3GYCA 1TJ2A 2QCLA 4ZO9A 3N12A 3PB2A 4INFA 4LSBA 1IQ8A 4TTUA 4UMBA 5I78A 1DJWA 3GLCA 1BSLA 4G8TA 4PULA 2WM0A 1R3VA 5DMNA 1OYBA 4MIMA 3H4GA 1VHCA 3BLLA 2JQXA 3WD0A 3QKEA 4AWSA 3CV1A 1J0ZA 1O6IA 1CPUA 3EKGA 3C86A 4DN1A 5JU6A 6REQB 1U22A 3TW7A 4OJYA 3BCFA 2Y70A 3URBA 5A6JA 3LSCA 4ZO7A 3OHIA 1W9DM 1U1HA 5CKSA 4GZ7A 2NVCA 1GNXA 1HGWA 2I5QA 1KBBA 1LBFA 1SJBA 3ZWSA 3XIMA 3T4CA 4MOZA 2OQYA 3E02A 3A6OA 1FKWA 1AQ0A 3SADA 1MSSA 1IWAA 4RL3A 1RY8A 2XIMA 3BMWA 3SY8A 4ZTXA 5JQ9A 1VLIA 1QNPA 5J5RA 1DJYA 4HPXA 1H63A 3AISA 2P3EA 4Q22A 2Q8LA 1C9WA 1SFLA 4CD8A 3UY8A 2B81A 2C91A 3CV7A 4XZ9A 3UR7A 3R11A 3G1HA 4B5NA 3VD9A 4NRRA 3EOEA 4UFKA 1R3TA 1H4PA 2NVDA 3GDMA 1FWTA 3A23A 3IVTA 5CPOA 5DMYA 1RUSA 4XBKA 2WZHA 2Z4GA 4UFIA 3OZYA 4R7WA 3CQKA 1ZBCA 2GQ3A 2DV0A 4MF4A 3WCZA 1JNEA 4AVOA 2ZX8A 1V3MA 1WZLA 1F6PA 2EBNA 3T8QA 5LNUA 2G97A 2VHLA 1HKWA 3BXWA 3HQNA 3AO0A 3QLDA 1XISA 1HP4A 5CPLA 3WFAA 5JH2A 1S3HA 1T40A 4B16A 3B06A 4B9ZA 3M41A 3QFEA 4QP0A 4IG2B 3MKVA 1BLIA 2HQAA 2VCCA 3UD6A 3GYEA 3WBYA 1UD5A 4ZVJA 4PMNA 2ZE3A 2HV5A 4W8BA 3LQLA 2Y8UA 4U3AA 3BH4A 2X2YA 3F4DA 1W9VA 2J66A 3AXMA 1EBGA 5CGMA 4DUVA 1WAUA 1TWSA 1A5MC 4JHZA 3VIPA 4AISA 1ISYA 2CLEA 6ENLA 2ZRVA 2GQ8A 1BYCA 4Q4MA 1CLXA 3PZIA 4RR4A 5H1WA 2GOKA 3OO2A 2XH4A 4DXVA 4EVZA 4KW2A 4Q8OA 2CKSA 3QSRA 3D47A 4LV4A 5CPQA 1OT2A 1TELA 4OVXA 4PMUA 2H9AB 4K37A 2J7DA 1KCKA 4A8LA 4UTKA 5REQA 3RX3A 4GC3A 1UG6A 1W2PA 1A3XA 3POHA 3W2KA 3FK4A 4AEFA 4DO4A 1XLKA 3DESA 3OP2A 1OC7A 4ZOAA 3SQSA 3BG5A 4DB7A 4M29A 4MNLA 3UZXA 1A49A 4IGNA 4EF8A 3AHVA 2WZIA 1W5OA 3PBVA 2D20A 2PE4A 3QQ0A 4AFYA 3P5YA 4GVGA 1XLEA 4P7LA 1OF6A 2PDUA 3WQ4A 5DELA 2BXYA 2DZSA 4JFSA 4ZA0A 1NEYA 2PTYA 3H2MA 3TJXA 1QI0A 1MXGA 4E0CA 3L0NA 1TMQA 2C71A 2Y5EA 1HFBA 3W27A 2ON3A 3FAWA 4HPJA 2R1NA 3KOZA 1BF6A 1QWGA 2J9ZA 4O18A 4HP5A 1Q4WA 3WUFA 4J28A 3DH7A 5BZAA 1TA3A 1LOSA 1T41A 3V35A 4ZXLA 5JIPA 3EKLA 4AF0A 4PMRA 3H24A 2CESA 4DI9A 3OHMB 1YE4A 1XIEA 3NEVA 1UWTA 3P60A 3GWQA 5A95A 3A5FA 2IPFA 4AYGA 3CT2A 4F0SA 3SCWA 5G4EA 1UR8A 3URAA 5GNZA 3W83A 3KBNA 3A4XA 3NZRA 4CU6A 4O28A 2BZNA 4G2DA 5HQEA 2ZXBA 1XLCA 1SPQA 2GJXB 3VFCA 5I79A 1A80A 2FH6A 3TWBA 4WJXA 2ZX7A 4Q8VA 3C0LA 1CTNA 4LV9A 3VOIA 4M24A 1LQ0A 4MY9A 3KLKA 1XIMA 3GNNA 4FR6A 5K9DA 2AL2B 3QQWA 1BXNA 3VM7A 3VE7A 5AHEA 3GZAA 1LWIA 3EAUA 1JFXA 1KXQA 4HK6A 3L7RA 2ISFA 1J18A 1R9XA 3UZ5A 2VTFA 1RPKA 3QGAC 3LDVA 4YWSA 4BK9A 1LWJA 4NAEA 3V0SA 1DJGA 5IHSA 5DRCA 1DIKA 5FD0A 3TP4A 1GZJA 1V5XA 4MAVA 1P48A 4LUTB 1JCLA 1RBLA 1YDNA 1KFBA 4AY7A 1E0XA 4US5A 3INPA 4O53A 2P8CA 4V33A 3HM7A 2ZUTA 1UMLA 3GXNA 1S2WA 3GC4A 3BLIA 3NL6A 4TIMA 2E6YA 5F2GA 2D1ZA 4NUWA 2OKOA 2V9DA 1H7WA 2VENA 3IJIA 1HX0A 1KR0A 5A8OA 3FSUA 1BG9A 1R87A 1SO5A 2Z1SA 2DJXA 4G5DA 2E68A 2WNZA 2QHAA 2PDFA 2P53A 3KCJA 1KM4A 2QXWA 2WV8A 4O10A 1KBKA 2X1UA 4TVUA 2J75A 2B4GA 4FLRA 3ITTA 2VEPA 3N2XA 2H8XA 2PD5A 3WMSA 2BGQA 2PC8A 1YDOA 2PWHA 1H2JA 1H7PA 4D6GA 4N42A 3V1PA 1WB0A 2VZOA 3KVLA 1QNVA 1J0HA 1C91A 3CYVA 4R88A 1O4UA 2PP0A 2GSHA 4WRHA 1PCWA 3MJMA 3KBVA 1FDZA 4Q8WA 1FRBA 1ICSA 2EPNA 2PDJA 4YMZA 1G4SA 1QVBA 1P7TA 2EG7A 4W84A 4IP4A 1BPLB 2JKPA 2WJDA 5FF4A 2JKAA 1ODZA 3W38A 4A2RA 3SM0A 2GDVA 4JNZA 3VGDA 5G4WA 3LGEA 1UKSA 4ORIA 3VMOA 4QQUA 3WH8A 1IF2A 3HG5A 1U33A 3VGGA 1GKRA 1FUYA 3GHSA 4YVVA 2IQTA 1W5NA 3C0SA 4WHBA 4LH8A 4RKAA 2VDGA 1FWNA 4FNUA 1QHOA 1BRLA 3TE9A 4LS1A 3M5XA 3Q65A 4HVXA 1BTCA 4IIGA 3PTKA 1Q5MA 4RV8A 2J6XA 4IMCA 3T1GA 3GVQA 2XDFA 3R94A 3CH0A 2YDAA 2GWNA 4AMAA 1B30A 1U5JA 4B15A 4A4AA 4N9DA 5CJNA 2NSXA 3N04A 1DJXA 4H6QA 4A8IA 3JW7A 3P62A 4H9UA 4PTMA 2YSWA 4L9ZA 2WCSA 1P6WA 4POCA 5MHBA 3WK0A 1KM2A 1US3A 1Z3NA 3WY1A 3TTSA 2J7CA 2WNNA 3U2OA 2X42A 1MQRA 5AHNA 4Z2JA 3W6MA 3V18A 4H8VA 1TVLA 4XD5A 1CT5A 2RFGA 4DJFA 4PL1A 2HBVA 2ZZ6A 4FB7A 1NY1A 2Y8VA 4DIAA 2VM8A 3R13A 3MO4A 4C6PA 1YIXA 2OX4A 1O95A 4GY1A 4GISA 2HMCA 1EDTA 1V3KA 3BVJA 1KBIA 1DVJA 4GKLA 3QF0A 4ACZB 4NZFA 2FFCA 3N17A 4C7FA 4F4RA 3PUEA 2Z2UA 4ERIA 4C6LA 1VGAA 1C8QA 1DJZA 4O4WA 4HYWA 2D3LA 4C6QA 3R58A 3OZPA 1BKSA 1MFVA 3U48A 3ZOAA 3PVFA 1R7OA 2WMFA 2OU4A 4FK9A 1ZL1A 4L1XA 3GDBA 4PL2A 4MAZA 3FJNA 2D0FA 1RH9A 1ADOA 3K4AA 3N13A 4RDYA 1XV8A 2VZSA 5CSUA 2J9YA 4BWLA 1QW7A 3KCOA 1W3LA 2PWEA 1FWFC 1NF0A 3T78A 2XTKA 3VMPA 1W1YA 4C6EA 4UTUA 2OKTA 2AMGA 4W86A 5FL0A 2F2KA 2QDHA 4JQ2A 3B9AA 3CB8A 2VD8A 5HDRA 1A0DA 4DY1A 2O4MA 1WQ5A 2PC4A 2WSQA 1AH4A 3MJYA 1FCBA 3E2RA 2OVLA 3QZ6A 3EXSA 4TVCA 4DJED 2Y5JA 3ARXA 4PRTA 3DX5A 1G69A 1E43A 3CEUA 3W01A 2F61A 1MXSA 3AQUA 1VFHA 2GVLA 4IL2A 1HF6A 3HPSA 1JQVA 3ABRA 1C8VA 2CXGA 3NGJA 2QZRA 3FCPA 3ZIZA 2VWSA 3MC5A 1UH3A 3NG3A 4DWSA 5HPOA 3IJ8A 4GFSA 1A47A 1UH2A 4MNKA 1WZMA 1OFDA 3OVGA 3T0CA 4G56A 3TXVA 5A6BA 2X8RA 4UFMA 2FGBA 2FQIA 1XLLA 1NSJA 1RHCA 2C14A 4HA3A 4GBUA 4KEZA 2QUTA 2PRHA 5DO8A 5D9OA 3G18A 2PRMA 2D2JA 4GLEA 4HSOA 3LHWA 1CXEA 1Q6RA 1XRSA 4GXWA 1B4KA 2QGYA 5C6MA 3BUVA 4L5ZA 4AH7A 3HPAA 3W0KA 1JYNA 2BB0A 3QR0A 3RRXA 3TZNA 4HNTA 4E4PA 3MP4A 1H1NA 1GZGA 3UWWA 5BXRA 2ZZ2A 3B4YA 1RQEA 4V2XA 2E1WA 2QUNA 1R46A 3DHUA 2VX5A 3C2RA 4CQ8A 2O9RA 1TFVA 3BL3A 3EDJA 1JZ5A 4JTQA 4QGCA 5FJJA 4ZQPA 3MUCA 3I7QA 5EMLA 5A94A 1ZJBA 3KFTA 3FXYA 4HSHA 1QHZA 1X6LA 4RZ5A 1U5HA 4TOQA 3QHNA 1CNVA 1XQLA 3FYOA 3MI3A 2YJQA 3R43A 4S3DA 2BXZA 5ABEA 2QMKA 5K9CA 2A3EA 2G37A 3NPWA 1KXHA 3PZ9A 4QE4A 2IPGA 2XFWA 4H6RA 3HMJG 1N8FA 2I9UA 1KXTA 2J74A 1NP2A 3LI0A 3VD3A 3E0LA 1I2PA 3WQEA 1TTJA 3PTQA 1F61A 3ZT6A 1R30A 2PDCA 3P8IA 3DEQA 4E2BA 4UMCA 1UYQA 2VZTA 1EEPA 2X0SA 4GH3A 1A5SA 1W2VA 3ANUA 2IQDA 1P6BA 4W9TA 3UFYA 3EX2A 4J3SA 4JCLA 1GQKA 2I57A 3CZGA 2AGKA 4BQ5A 3IJ9A 2AQOA 1WUEA 4DAFA 3BAXA 3SURA 1TB3A 1V0MA 2EGZA 4Q8TA 5H6HA 2DZPA 2PDMA 3BW2A 1RD6A 3JU2A 2X1RA 2PA6A 4REQA 3VIIA 1SSGA 5C71A 4FX6M 2D2HA 4H3DA 1TCDA 1TG7A 4H6EA 3VAVA 2TRSA 2Z6IA 4F0HA 2V3GA 4LOCA 2VP8A 4B92A 1OK6A 3MI6A 1V51A 3NA8A 3O7UA 4H9ZA 4PYSA 4RUBA 4Q32A 3FYYA 1IEXA 1IXNA 2FTYA 2ZUVA 1EGZA 4LVGA 3GVRA 3I3DA 4AQLA 2W6RA 3OVRA 4E3TA 4E8DA 3BMVA 3SJNA 2E28A 4HZ8A 2V67A 2C8NA 3APGA 3QYSA 4NQ1A 1M9HA 3A22A 2V5DA 4XD6A 4ERGA 3BW4A 3PPFA 1M6JA 4CD6A 4V27A 4JFWA 2FDSA 1EJSC 1ONXA 2BY1A 3MP3A 1VEPA 2EO7A 1XCXA 3H12A 2YLLA 3T6CA 3WF0A 2VZVA 1UP2A 4IP7A 3P14A 2Q01A 3WJZA 3TSBA 1DTNA 4W5ZA 1HO4A 4IP5A 4HMDA 3RCMA 1UR2A 2ABBA 3U3HA 1BFNA 1PJ9A 2IUZA 1EEXA 1XD0A 4C6FA 2MUCA 4IPPA 1QT1A 3Q67A 4DYEA 2QNEA 3QPZA 4MY1A 2RKXA 1XICA 1YHTA 1LLZA 3CZJA 4Q8PA 5BMWA 2OT1A 1AJ2A 3TIMA 1MNZA 2QDDA 3R4IA 4UCGA 3MYPA 7TAAA 4XVDA 4KPLA 1X97A 2NT1A 1H60A 4JS3A 1K7XA 3BGGA 4WKFA 2OLSA 1ECQA 1VFMA 1FP9A 4AHQA 3C3UA 5D38A 4LU0A 1C92A 3PG8A 3DENA 1TUXA 3MBDA 1KQZA 3UG8A 4I6VA 4KBXA 4OZOA 1R47A 3OEXA 5IM51 1JQXA 4CCZA 4HA1A 2Z0IA 5FEPA 3O9NA 1ZAIA 4QLJA 3AS1A 3KXQA 3ZR4A 1OT1A 2NUXA 5HR6A 2WWDA 4R9XA 3ONBA 2BOEX 2C7FA 1HJWA 3DFNA 1W9XA 3QM3A 2OTDA 1MRQA 3W84A 3RG6A 1KR1A 1E4IA 4GO8A 2PF8A 3LEPA 4O16A 3M6DA 1K4GA 1J4EA 1YEYA 2PPGA 3LV6A 5AFDA 3GDKA 3AZRA 3A21A 3KOYA 1C29A 3WLJA 3CMFA 3DCPA 3B4UA 3FHQA 4US6A 5HWJA 3UG3A 4UZSA 2NX1A 5B80A 4GBDA 5LA1A 3UERA 4O17A 3WUGA 3VNLA 2VRKA 1YBQA 3E3HA 2WK2A 2XH0A 3VX1A 4CQBA 4S3FA 2GUUA 2WJFA 1H7NA 2DT3A 4IXXA 2PBGA 4C1LA 4LAOA 2R8WA 9RUBA 1I45A 3WJWA 2OYMA 1LT7A 4F2BA 5E9AA 3S2CA 3QTPA 1R2TA 1UR4A 4I8YA 3GSMA 3M1ZA 3W6LA 1VJSA 3SUSA 1X96A 1ITXA 3SCRA 2NUWA 3SY1A 2G3JA 4E6MA 2UZ9A 4MWAD 1S3TC 1SSDA 1H5VA 2CLKA 3DKLA 1E15A 3LCGA 4ZOCA 2REQA 1LBLA 1GW9A 5A3HA 2GSEA 1IHIA 3OYXA 4LYRA 3N6JA 3CO8A 3W7DA 3KL3A 3UR2A 1NVMA 1EH9A 3STGA 1QWKA 3F2DA 4FZIA 4KEVA 1JR1A 2H3DA 3P74A 3WZ0E 5EL1A 4GUHA 3N2CA 3S2MA 4JKKA 4AZIA 1ZNNA 2YL5A 3BLOA 1QPQA 2NWSA 3MMDA 2GVYA 1A53A 4LBSA 2EPOA 5DCEA 4PB5A 1VCVA 3TOPA 1TX2A 3DFSA 3CWOX 4EPKA 2RHGA 3VFLA 1R86A 4TVDA 3W9ZA 4X2PA 1XINA 2P3ZA 4LCQA 4LJ3A 4TO8A 4TU1A 2XH2A 2W79A 1TZ7A 3F4VA 3VD5A 3ARZA 3A9BA 1E0WA 3VNDA 3MV11 4FR1A 2V5JA 3KCLA 1H3GA 4ZL1A 2NQ5A 3LCWA 3MCMA 1IWBA 4PMDA 1XXXA 2ADAA 3F2CA 2GYIA 4UBPC 1MW0A 3M0VA 2OJPA 1YPFA 3CV2A 4C5YA 1ONEA 2E77A 3LGDA 4H04A 1ALDA 5IBXA 2VQTA 4ZQCA 1WPCA 4AZCB 4ICCX 3CUXA 2A6NA 3HIJA 3B8VA 5B7ZA 3CGTA 3DG3A 1UD8A 1YTKA 1M53A 1H51A 4IQJA 4XIAA 1LWHA 2ZBTA 2PRLA 2CZFA 3TA6A 1FCQA 3B3DA 1MVYA 4MZ1A 4GNKB 1E56A 4YN5A 1LF1A 3WDPP 4M6QA 3AC0A 2D0GA 2A4AA 1S5TA 3N4AA 1K9EA 3W7MA 2IKHA 1XQKA 2YCLA 3FAXA 1H1YA 3A3XA 3CL8A 1W1ZA 3WBAA 1HTIA 5D05A 2VFFA 4NI3A 3NQGA 4UZUA 2UV8G 3RLUA 2CYGA 3WQ5A 2ZA1A 5F7UA 2V82A 2Q71A 1JCMP 1TPVA 2ZUUA 1DJIA 2A3AA 3UJEA 4EAYA 4GPNA 4EACA 2WHKA 3WELA 1AK5A 2OMAA 3ALGA 1PB0A 1R8LA 2WOQA 4H7ZA 1B3VA 4ML9A 3NUKA 4LTSA 5LHFA 5CZTA 5C7HA 5GJPA 4HSNA 5DT7A 2JIEA 4DVOA 1BVNP 5AHFA 4AEOA 5EFDA 1VAHA 1UWQA 4MJMA 4LB4A 3S9IA 1XFCA 4PUJA 3GR4A 3GDTA 2PLKA 4GMEA 1E6SM 1SUXA 4U2ZA 5HNUA 4KH2A 1JZ8A 1Z89A 3L65A 2CLIA 2F6XA 4C7GA 1NF7A 1J8VA 4PSRA 3XINA 3QLLA 1M7XA 4M3PA 3EWCA 3G77A 3P7YA 3R8HA 4BF9A 3VKJA 2E67A 4V28A 1GGOA 3L4UA 5D32A 4X9SA 1OCQA 4UTLA 4Z2IA 3CS2A 5CAHA 4P8VA 4Q8UA 4RE0A 4JN6A 4MMWA 3HQPA 5I03A 1GJPA 5A5WA 1VIZA 3GKAA 4U33A 4LAKA 1NARA 1PXGA 1W1VA 3PZVA 4YJ5A 2WMGA 4HHHA 2W66A 3CQ0A 2YCJA 1WDDA 1ZZMA 4UTFA 5HBFA 1B1YA 1XLBA 3LCXA 4ONVA 4OBRA 4ADUA 1GVOA 3VNJA 3NQ2A 5BXSA 1KRBC 1J2BA 4G7EA 3IRDA 3UZYA 3W1QA 4PRWA 3W2NA 3QR1A 4DAIA 2AQVA 4LF1A 4DLFA 4XQ6A 4GYKA 2ZTKA 5GJMA 2V30A 4I7UA 1WDRA 5E6YA 3SUWA 1BWLA 4GI9A 5FF3A 3AHXA 3DBNA 4DX3A 1HJQA 3E5PA 3EOUA 1J9YA 1OG6A 1SGJA 4PFHA 1K8CA 2A3HA 5J8LA 4PMYA 1GOQA 1H61A 4H9YA 1XLMA 3DKJA 1NWRA 2PAJA 4H83A 5CPSA 4L4LA 4KMQA 2V2DA 2VVSA 1JD7A 4M6VA 2DUXA 4JTJA 3MW7A 4XTDA 1CEOA 2WM1A 3F5LA 4HCLA 3E74A 5EMYA 5HATA 2OYKA 4RV3A 3EDFA 3GG8A 3GNRA 4K3ZA 4R85A 4EK7A 4RW3A 1LQAA 3NSXA 2OSWA 3I3EA 4CNTA 4HU0A 3TXZA 3CC1A 2PTDA 3ITCA 1SO4A 2WBGA 4XWUA 1EUNA 1JUBA 4MB5A 4CN6A 4IOTA 3EGJA 2VUNA 4WJEA 1E0VA 4DJDD 2CERA 3RNDA 5FJOA 1QO5A 2BGSA 1F7BA 3QPYA 1VYRA 3E5BA 1L6FA 2DSWA 5TBOA 4HCDA 4QDPA 3S46A 3B0VC 1VRDA 1T8QA 1ZENA 2C1GA 4TX8A 3C2OA 3H2FA 3AROA 2PDNA 1UR3M 1OGBA 5I09A 3FJ4A 4X9YA 3E49A 4QDWA 4NILA 2ZRYA 3NGFA 4GRSA 1QK2A 1UROA 2VEFA 4GJJA 1ZLPA 4U5KA 5AC4A 1GVSA 5E9XA 3R8GA 2YL8A 2VX7A 4EX4A 5F2IA 3NQAA 4K1GA 3ANVA 1XYFA 8XIAA 5A8NA 2YB1A 4F79A 2BDQA 4LGXA 1TPH1 4CD4A 1WKFA 2Y61A 4DXKA 3T9PA 2ZCGA 5CG7A 1JUEA 3SCSA 2F6KA 4AB4A 2Z1VA 3SN4A 1LRNA 1NELA 3LV5A 1VCFA 1MUMA 1Q7ZA 3O06A 3TNOA 1VPXA 4ZENA 5D9PA 5CPTA 1E1CA 2ISSA 5DBTA 2INFA 4V1YA 4DO6A 2XN1A 3S5NA 3AS2A 5FAGA 3UZJA 3WMLA 4P2VA 1E6ZA 3G1FA 3G0XA 3OW1A 5JIWA 1XIFA 3R25A 5EMUA 2V63A 1QNOA 1SU5A 3BCDA 2POZA 2FDMA 3U7BA 3IJDA 2DFAA 1VBGA 2VWTA 5FACA 3S0CA 3EMCA 3VOGA 2IPWA 4UNLA 1E1EA 1EQCA 3ID7A 4BA0A 1DE5A 3EMZA 1PDYA 4EWJA 3K8KA 2J7BA 1HL9A 4PODA 2D0HA 2W4XA 4YCOA 3ARSA 4IGSA 3VIHA 3LRMA 1EJVC 2VFEA 3CM4A 4IX2A 4IX0A 1CGYA 2J8GA 3EOOA 3F4WA 2OCZA 3VKCA 1ZRQA 2D73A 4JYEA 5A8GA 2XZ9A 4XK2A 5LGXA 5C5YA 3HB9A 4NZ5A 3TLQA 4L1GA 1UH4A 2J88A 4R27A 2YL9A 3I3BA 2VFHA 4KRTA 3M16A 2YCIX 4QDMA 4K6AA 3F2BA 4HHLA 3EPMA 3O6AA 2LLEA 4A8RA 5MF5A 3LNPA 5HK4A 3P6LA 3HURA 4DUXA 3W74A 1HKJA 3CZEA 2GQ9A 1ZALA 2PURA 4F8XA 3SI9A 3H4WA 2XISA 4FNTA 4LBRA 1A5LC 2GZXA 3IS4A 5K9XA 3LENA 2XINA 1HJVA 4GIAA 3GTFA 3LGGA 4XAPA 4GIYA 3C5QA 3ITOA 2X1TA 2CLMA 3UEQA 3TSDA 1OFQA 1PYFA 2FHBA 3VIMA 4ZZ9A 5HJLA 1JDAA 3R5EA 3WH7A 3B03A 3K30A 1TJPA 3GR7A 1UOZA 3S6TA 3ITXA 4E2OA 4B90A 5A2AA 1O12A 4J2PA 3NDZA 4GIEA 3LXBA 1PHWA 3AHZA 5A8MA 2PGEA 4PCFA 3L21A 5FJRA 3S1XA 1SVDA 3FJLA 3L23A 1EOKA 3GD6A 3YPIA 1RCXB 3WX7A 4DUOA 2WCAA 1C3FA 2WVUA 4M56A 4IPLA 4IMFA 5I07A 3G1SA 3LYEA 1LG1A 2EF9A 3ZSTA 4FLOA 3E2SA 1EHAA 1XP3A 5FSDC 4P7RA 3GRIA 5CSYA 4WY0A 3VIJA 2GVEA 2QF8A 3L4YA 3IV8A 1EKOA 4C6CA 3DYMA 3L66A 1YNPA 3GXTA 1EPVA 2ZADA 3DI0A 1EQPA 1FWGC 4DUWA 1ZU8A 5LXXA 1E9IA 3ES7A 1DORA 4R34A 2DEPA 4XAFA 5H8UA 3UZZA 1KTCA 4AAJA 1IT8A 3ZVHA 3PSWA 5BNKA 4B4HA 4A3YA 1W9PA 1X39A 2QAFA 3ZVIA 2PLCA 4GUIA 5IDZA 1MW2A 4UQBA 2NQJA 3NZGA 4AD2A 1E51A 2GGIA 2VGFA 3W70A 4LNYA 4JTAA 2J77A 2IS7A 5AC6A 2WHMA 5HMDA 1CXIA 3PANA 2NV9A 3TN4A 3GDLA 4O13A 2BG5A 1KNWA 4AIEA 2WZEA 4XKYA 2YA0A 1MXDA 3TQ0A 5FKYA 4AZBA 1N82A 4HYRA 1WBHA 3KTSA 3ZR5A 3AFBA 1W31A 1W3NA 4M8UA 3QN3A 4GVFA 5LNSA 3CLWA 1K03A 1DQWA 1DJHA 4D6FA 2VR4A 1TR1A 2BOFX 3TNBA 4DRSA 2OEJA 1V6YA 3TEVA 1OX4A 1XC4A 2AKMA 3W72A 2JFEX 3OLEA 4UFHA 2C0HA 3VD7A 2WANA 1PTAA 3L5AA 3WLQA 1CLVA 3WJYA 1NFBA 4H9VA 3WK1A 4AZ5A 1GQLA 1K9TA 1XDLA 1T7LA 1V7AA 2YDQA 3DI1A 4JEQA 4OE7A 1TVNA 2YCEA 2W92A 3UXKA 3K1DA 2VC5A 4DWDA 1J11A 1QPKA 1S1PA 3N25A 2ZRZA 1D3CA 2FHCA 2J27A 2TODA 4CCCA 1UBPC 5CAKA 3PBUA 2WKGA 3UXLA 3GXDA 3N9KA 2GGEA 2WMIA 3ABSA 4F0KA 3TH6A 1LP6A 4LY4A 5AC5A 2HVNA 1HGYA 5CZJA 4OIFA 1OFPA 5I6SA 1WE5A 1DWAM 1P5BA 3DC0A 3NO1A 2QDGA 1F9CA 4HOZA 1AH3A 3SW6A 4YTQA 3RMEA 2ZUMA 3AMCA 4IPJA 3C8NA 2QYGA 3EWDA 1AZ1A 1X6UA 4JFUA 1OVDA 5C0QA 3GFZA 1QASA 1Q2RA 4UXDA 4YHEA 2QCDA 4HJWA 2VCBA 3O15A 1AA1B 4N2YA 1YPXA 2ZZ3A 1TPEA 4K36A 2WNQA 3SUTA 1V3LA 5LSMA 3D46A 1WCGA 4ERAA 3ZQ9A 1IGWA 2ACQA 4CCDA 1XJBA 1E1FA 7CGTA 4B2DA 5M3WA 3W24A 1XWYA 1JJKA 3RPDA 2XSAA 3V0TA 2ZIDA 4LVAA 4NRSA 3QY8A 4PR4A 2QUUA 1DYSA 4O11A 2X40A 2YOCA 4Y6GA 3FNDA 2JE8A 5E70A 1FWRA 4O0KA 3SFWA 3AU6A 4JR5A 4H2CA 4NP7A 1G9HA 1RXOB 4O50A 4Q7NA 5CG0A 5FL1A 1RZMA 4JIRA 1GHRA 1HW6A 5CPNA 2XVPA 3K2GA 2O55A 4QNWA 4PGLA 7REQB 2J7GA 3CZLA 5DMLA 5C55A 1BQCA 1GKPA 3O16A 1JULA 1MO0A 4XG1A 1E3ZA 3AIRA 4KWWA 2IQ0A 3N6QA 4WDUA 3GQYA 2EPMX 3PM6A 4GH1A 4R7JA 4KFPA 3M07A 1GOXA 1J79A 3U57A 2G95A 3KLLA 4X3ZA 1HJSA 1SFTA 2C16A 3UR8A 3M0HA 1LOLA 2JALA 2W91A 3FKRA 3CYJA 1DTUA 3P82A 3T09A 4GQQA 3WQFA 1C7TA 1CXKA 3UJSA 3L2MA 4DJFC 2GLKA 2I5IA 2WLZA 2OZ0A 3OG3A 1OFOA 3GKFA 1SM9A 2GVGA 1NDVA 1QCWA 1R85A 1SW3A 3QC0A 4NNCA 3R7MA 3UZWA 3ZM8A 3R0DA 4M19A 4OECA 1CW2A 3N4EA 4JQ4A 1KLYA 1QU4A 2YGYA 3NDYA 4QRNA 1K70A 2WVVB 3I6RA 3E1F1 4E4FA 1FFQA 3A12A 1VFLA