2HVMA

Hevamine a at 1.8 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.8 A resolution structure of hevamine, a plant chitinase/lysozyme, and analysis of the conserved sequence and structure motifs of glycosyl hydrolase family 18.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords HEVAMINE
total genus 96
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hvmA00
2WMHA 3WH7A 1R87A 4ATLA 4PTWA 3GNRA 1QNPA 2EO7A 4U5KA 3WH5A 2F61A 5LYRA 1UR0A 3KL5A 1JAEA 3N12A 3VGHA 3VIIA 2XVPA 1KGUA 2O92A 3EDJA 4UFJA 1E40A 1ECEA 1K9EA 1MW1A 3SCNA 1PEZA 4CCEA 1FP9A 2VZOA 4KRTA 5GNXA 4BA0A 4UOZA 1HKMA 2ZX7A 5CPQA 3WQ6A 1B3ZA 7A3HA 4JHOA 3EDKA 1J10A 3EDDA 1G9HA 1W3LA 4OOZA 1CZ1A 1K9FA 3WD0A 4AEFA 1PIFA 4Z2GA 3PZQA 4C7GA 2E4TA 1JFHA 3BMVA 2OWWA 4KH2A 4W89A 4XUYA 5EMYA 2ESCA 3T08A 1JYWA 3U7BA 5KZ6A 2EPOA 4HTYA 1IT0A 2NSXA 4AC1X 2E40A 1E6ZA 1W2PA 4QDMA 3UR7A 4TTUA 4EK7A 1KCKA 4MPKA 4CVWA 2VL4A 3M07A 4ZFMA 3A6OA 4AWEA 1QNOA 3G6LA 5LA1A 3VDBA 2DSVA 2WWDA 2O9TA 3L4VA 1UWIA 1PBGA 1WP6A 2ZOXA 4EANA 3PZ9A 5AYBA 5A2BA 3WELA 4X0VA 4QFUA 2JF7A 1BAGA 3SCSA 5FD0A 4GQQA 4E8CA 3ZJ6A 2PWEA 3NDZA 2W91A 4GI8A 1CXKA 1V6YA 3K46A 3CMJA 1BG4A 3ZIZA 4GIAA 1JZ6A 3AMLA 4BZYA 1J0JA 1B2YA 1KBBA 1UWRA 1V0KA 4PMOA 2QHAA 1E15A 4U3AA 3AYRA 1CWYA 1JYNA 2GSJA 2J7EA 5IDIA 3ZOAA 1R7OA 2XJ7A 2BNJA 3JUGA 4PMNA 4YHEA 2D1ZA 3OLIA 2VUYA 3UCQA 4P8XA 3N15A 2O9PA 1ISXA 1EHNA 1B30A 3MKKA 1HP4A 3VIJA 1CXEA 2XWEA 1FOBA 1MFVA 2D20A 1WDPA 2BHYA 1KXHA 2C7FA 1JF6A 3UG3A 1V3JA 4JKKA 2WHLA 3A47A 4GI9A 3MMDA 3AMCA 4CN1A 1XC6A 2G3JA 3W37A 1QPKA 5EFFA 4AZ7A 3WDPP 2VI0A 4WKHA 2BY3A 1TE1A 4W87A 4DWSD 4KGJA 2WMGA 1W91A 1L8NA 4HPGA 1UZ1A 1B3WA 1RP9A 1XYFA 3OLDA 3QOMA 2WK2A 2XVKA 1XRVA 4CU8A 5ABGA 1W3HA 1WZAA 2PWGA 3VU2A 2XPKA 2B31A 3OZOA 1ZBKA 2XVNA 1UQYA 3WY1A 2QF8A 3CZLA 4X0NA 4XZWA 4NZCA 1CLVA 5CG0A 2GDVA 2DEPA 2YDSA 4AZBA 1KQYA 2WWCA 3UESA 3WENA 1KWGA 4RE4A 4HA4A 3CUGA 4NRRA 3ZR5A 2WNWA 1KFWA 3CIVA 3VTRA 4D6CA 1KGXA 1LWJA 2E8ZA 2D2OA 2WANA 3LPFA 2W67A 2VTFA 1OINA 2OWCA 3THDA 3AQUA 1E6PA 2PWDA 5CSUA 1W2VA 2ZWYA 4AZCB 1XSIA 4OIFA 2J4GA 4CGTA 1J0ZA 2A3EA 1A3HA 3IANA 3MUZ1 1GQIA 2GJPA 5BXTA 2JEPA 2EPLX 4DWSA 3VIHA 5AC5A 1UHVA 3GTNA 3GBDA 3SEPA 1HVQA 1HL8A 4UFMA 3PZOA 3WDIA 4XZBA 4E8DA 1DTUA 2V5DA 2WZIA 1X6LA 2JE8A 1RPKA 1QHZA 2XWDA 3GH4A 4QLLA 1ODZA 4MTVA 4TVUA 1KXQA 1PAMA 4V2XA 3KL0A 2FH8A 1OGSA 1BVZA 3PTKA 4JFWA 3GDBA 5I78A 1BYBA 4U31A 2AAAA 2PI6A 4PMYA 1UD3A 1V3MA 4M82A 1QI5A 3ARZA 2VJXA 4Z2HA 1WPCA 2JF6A 2YDRA 3AZTA 2X09A 4CD6A 2TAAA 3K8LA 5FCZA 1NP2A 3TONA 4H8VA 5I79A 4Q7NA 1M03A 1GOQA 3WKZA 1ISZA 3WN6A 4MB1A 1EDGA 1R86A 1W1YA 5HNNA 1CYGA 2WXDM 5A1AA 1MXGA 4AD3A 4HA3A 1J18A 2PBOA 1GOIA 2WAGA 4UQEA 1P6WA 4B3KA 1JZ7A 1NQ6A 1NWUA 1G1YA 2CBUA 3IK2A 4A3HA 5IXEA 1OCQA 5AC4A 2WYSA 1WZKA 3VM5A 1CECA 3FW6A 3PN8A 5E0FA 1V3HA 4HZ6A 1US3A 3AIQA 5E0CA 3SIMA 4HOXA 2Y5EA 4MNLA 3OGSA 3DYPA 1V6WA 3AS1A 3WQ4A 2J8FA 3L2LA 4M81A 2D24A 1ESWA 4AMCA 5HOSA 3TTYA 1M7XA 2J47A 3WNMA 1GHSA 4LYPA 4GXPA 3MSGA 3N1AA 4H41A 3NYDA 4XB3A 1E1EA 3AIRA 2BHZA 5A69A 3W27A 4EKJA 3W26A 1UWSA 4AZ5A 1EOMA 3CUJA 4NSBA 2VX6A 2QPSA 3VIKA 3W38A 3CHCA 1EIBA 1SR0A 2X1IA 2ZUTA 1XH1A 2WHMA 4DUWA 2CETA 1CGXA 2VNCA 3BAYA 2CPUA 4JKLA 2XUCA 2XIBA 4ZEPA 1XSJA 4J28A 4OJYA 1AQHA 2ZXAA 1ZU8A 3BAWA 4HU0A 4AD5A 2V5CA 1GOMA 3ZO9A 2WVVB 3POCA 1EQPA 2WSPA 2G3IA 4D1IA 1PZ2A 1RH9A 3GNOA 1B9ZA 3SURA 4P8WA 1GW1A 1G0CA 5ECUA 1UOKA 2J79A 4JCMA 1W1TA 3W24A 3WF2A 5CJ5A 4CCDA 3VGBA 4DM1A 4W84A 2G4FA 1BTCA 5KEZA 1B31A 2ZUSA 3TP4A 1UA3A 2J78A 3OA5A 3VGEA 3WNOA 1QHOA 1NWRA 3UERA 1V0LA 2YOCA 3RO8A 4UFIA 3HN3A 3VPLA 2G8ZA 4W8BA 4HMDA 3WH6A 3FN9A 3VIGA 3U57A 1BPLB 1FA2A 1BYAA 5I6SA 3AXHA 1SFSA 2ZUUA 3BAXA 4U33A 4F79A 3AZRA 2CKSA 4AZ6A 1E6SM 2ZE0A 1JD7A 2WVUA 3SUWA 1BQCA 1ITXA 2O9RA 3L4WA 2JALA 4MNMA 2FHFA 3NUKA 3UG5A 3B9EA 3AISA 3ARQA 1JIBA 2QMKA 3VVGA 1E6RA 1GVYA 1UH4A 4BQ5A 1E4LA 3EYPA 3W81A 1GOKA 1XH0A 3WF4A 1GUVA 3ZT6A 1TA3A 5A8PA 5JBDA 3AS3A 1NARA 1NOWA 1Z32X 1B3VA 3NSNA 3PBGA 2BV9A 2E9BA 2Y8VA 4CD4A 1V3KA 1C90A 3OB8A 1BGAA 5A6BD 5A6JA 2C8NA 2J25A 2GUYA 1RD6A 1BYDA 1OM0A 4W7WA 4GO9A 2W61A 1JYVA 1EOKA 2EPNA 4CD7A 3RJXA 2ZX9A 1NM9A 3UG4A 3AMKA 4MB5A 1UUQA 1VENA 1PX8A 4BF7A 1GPFA 5DFAA 4HMEA 1SMAA 4MDOA 3VNYA 2VZSA 1UKSA 1V6VA 2RGLA 2D0FA 2UWFA 4XV0A 2OWXA 3N18A 2BVTA 3KEHA 2ZWZA 1J0IA 5CXPA 3AZSA 1W3KA 4LQ1A 1LLOA 1Q6GA 1JZ2A 5DF0A 4FMVA 4ZXLA 3OLGA 1N82A 3RMEA 2YDQA 5BROA 3ARTA 5A6AA 1IZKA 4OOUA 4Z2JA 5GNYA 4W86A 4A4AA 1U30A 2QMJA 6TAAA 1OD0A 4B3LA 4AIUA 1VFUA 1VBRA 2DSZA 5M03A 4QLJA 1W1PA 1NWTA 3SUVA 1H09A 3IAQA 1TUXA 1Q6FA 5DT5A 2XSAA 2XTKA 2Y24A 3SCTA 4F9JA 3M6DA 3W28A 4UFHA 1KGWA 3W6MA 2YL6A 4PMZA 4WIWA 4JFTA 1ZS2A 4ZENA 3CBWA 1VF8A 2CBJA 2GJRA 4IISA 2DH2A 2A3HA 4J27A 1H49A 4F8XA 4NF7A 4HOZA 1FFQA 5A6MA 1WCGA 1LWHA 2Q8XA 1S46A 5I0DA 3VDHA 5LA0A 1BLIA 1J9YA 3K8MA 1J01A 1ITCA 4PTMA 1X1NA 3CH9A 3ECQA 4TOQA 5HXMA 2VRQA 4RE2A 1ISYA 3VIMA 4CN4A 3CTTA 1XCXA 3II1A 2A3CA 3CMGA 4J3SA 4LYRA 1JD9A 4BQ3A 2XVGA 1DWJM 2EQDA 1H11A 1PJ9A 4WJXA 1HKIA 4UZSA 5DO8A 3VD7A 4UFKA 1MW3A 3WMCA 1QI3A 2E9LA 1I1XA 1VIWA 1UQZA 1UH2A 4OUEA 2G3MA 4M1RA 3BGAA 2WSKA 2D3LA 3I3EA 5IHRA 3WQ5A 5BXPA 1H0IA 1E71M 1MVYA 2IUZA 4UNIA 1LF1A 1QI2A 2J7GA 6A3HA 4Z2KA 3MV11 3L4UA 3ARYA 1QI4A 2YA0A 2CERA 2YL9A 5F7UA 3U7VA 1FH7A 1UKOA 2PWFA 5IHSA 2WPGA 3BC9A 3F5JA 4D6FA 1HVXA 1V0NA 3FAWA 1CXFA 1XH2A 3T2QA 1W3JA 4UFLA 3GNPA 2ZXDA 3KWXA 2WLZA 3AROA 2UY3A 1OBAA 3GZAA 4PCTA 3VX0A 3AOFA 1D2KA 3VUPA 2BXZA 2VMFA 4ML4A 1GORA 2QLYA 3A3HA 1KR1A 5D9PA 3AIWA 3FHQA 2CBVA 1VEMA 4AXNA 1UR9A 2CBIA 2VX7A 1WDSA 3AMDA 5FL0A 3DYMA 2JIEA 3MV01 3OIHA 1JDDA 4FF5A 4P8UA 3ZQ9A 1AQMA 4AD4A 4J3TA 1X6NA 2E0PA 3MSDA 1M01A 1TA3B 3O6AA 4GI6A 3VGDA 4EAMA 1CNVA 4ZE4A 3ARVA 4UCFA 1EDTA 1PX4A 4GZJA 4D6DA 1R7AA 1GVIA 1ZJAA 2WKLA 4ZXOA 3T2PA 4AZCA 3AIEA 1CGWA 2VO5A 1DWFM 4A3YA 1JZ5A 1U2YA 2ZXQA 3WD2A 4JFVA 3D3AA 3DHUA 1UD6A 4TX8A 1OIMA 3CHFA 1GOOA 5I2UA 3PZNA 5BXSA 2WBKA 3OLEA 4IPNB 4QLKA 3WNLA 1CIUA 3FNDA 1E43A 3VD3A 1JDCA 1VFMA 3S6TA 2BFGA 2CITA 3QR3A 1V3IA 3T2OA 2OSYA 4W5ZA 2J75A 2JIWA 3ARUA 4BS0A 4HU8A 4H8UA 1OWQA 3M46A 1FFRA 3ZJKA 1E0XA 1EHAA 5IFPA 1YQ2A 4PTVA 4AD2A 5I3DA 1BYCA 2BVDA 3VILA 2FGLA 3PZMA 4YN5A 4LX4A 3MUAA 4HP5A 1DWIM 5AYIA 4W7VA 1W9DM 3CUFA 4H04A 3QHNA 3RILA 3UEQA 2XGBA 3VDCA 1KCLA 3MMUA 1CBGA 3GXDA 3AJ7A 1JFXA 4W8LA 1JI1A 1JZ3A 3W82A 2CYGA 1CLXA 2UY4A 2ZXBA 3ARXA 1E4NA 1H4PA 3CZEA 3WDRA 4MJ2A 1E3XA 3CUIA 4UQAA 3FXYA 4V27A 2EBNA 4B9YA 4W5UA 4Z2IA 1C93A 4D72A 1VJSA 1UYQA 3GXMA 5I24A 3T0BA 4GZIA 4D6EA 2VT0A 4ACZA 1VJZA 3WD3A 4Y7EA 1E3ZA 3SCWA 1HNYA 3N04A 4W88A 3B9DA 1HP5A 4TVCA 4F9DA 1OB0A 3WUFA 2WCGA 3CZKA 2DQXA 1US2A 3RM9A 1KXVA 4DWSC 1UWQA 4HMCA 5A6LA 2EEXA 1XGZA 3WBAA 5ABFB 3CHEA 4D6GA 2W66A 4P7RA 3W0KA 1HJVA 3CZ8A 1BFNA 1D3CA 1QHPA 5A6BA 1W9VA 4IM4A 5CLWA 2YBUA 1E70M 3WH8A 1UR2A 5A6KA 4WSKA 2A3AA 3WQWA 1QNQA 4N42A 3CLWA 5FIPA 3I3BA 3AHXA 2VR4A 4GQRA 4M8UA 3UR8A 1ZBVA 3WNKA 1LJYA 1J0HA 2X2YA 4PMVA 4R27A 1HX0A 3I3DA 1VEPA 3AS0A 3QHOA 4PSRA 1IV8A 3EBVA 1EXPA 3SCUA 3CHDA 4LXFA 5M17A 1LQ0A 1TR1A 5CGTA 4UQCA 4DM2A 4AIOA 1G5AA 3RIKA 5CPSA 3DC0A 5JBFA 3OG2A 2W5FA 2XVLA 2EXOA 1GNXA 5A95A 1CXLA 3AMGA 3LPOA 1MW2A 2GJXA 3RM8A 3ARRA 1F4AA 1EDQA 1BGGA 3F5KA 7TAAA 5A3HA 2WVVA 4D1JA 1TVPA 1UH3A 5I77A 2PB1A 1EH9A 4B16A 2FDMA 4LGXA 1G01A 2OYLA 1PPIA 1ZJBA 2CXGA 1E5NA 3MUY1 3VM7A 1E1FA 1MYRA 3EDFA 4JL2A 5EB8A 2J7FA 3AS2A 1Y7VA 1VAHA 2WZHA 3ZT5A 4U2ZA 2F2HA 4AZGA 2E8YA 5ABEA 1E5JA 2BY0A 5D9MA 2D23A 3VD5A 3BAJA 1B0IA 3B9AA 2WC7A 2BHUA 3PZUA 1QBAA 2Y8KA 4URIA 3T09A 2F8QA 3EMQA 4JFUA 3TTOA 4W93A 5HDRA 3J7HA 5A94A 1UA7A 1J0KA 1PZ3A 2X05A 3BMWA 4OBRA 4MAVA 2DT0A 1XD1A 2QV4A 4C7DA 1CEOA 4UOJA 1OIFA 2J7BA 2ZX6A 3VNZA 1R8LA 2Z1SA 1GHRA 2WW5A 4PMQA 3VDAA 3F4VA 4D6HA 2X8RA 2XSBA 1FHLA 2WHJA 2V3EA 1K6AA 3VX1A 1BHGA 1OGBA 2WMIA 4E4PA 4E2OA 5CZKA 1J0YA 1G94A 3E1F1 4WKAA 1NOUA 3VD9A 5D8WA 2WM0A 3BCDA 4GZEA 4GPNA 3K4DA 1WAWA 4D6IA 2WMKA 3TTSA 3TA9A 2NT0A 3VIPA 2YL5A 1M53A 2ZICA 3CO4A 2D22A 1V03A 3BAKA 3IAPA 1R85A 5TD4A 1CGVA 1AMYA 3PTMA 4S3JA 4B9ZA 4PEEA 3L2MA 4GINA 4H8HA 3BXWA 3N17A 1D7FA 2GK1B 3PZTA 1A47A 3CZGA 1HJXA 2J74A 1F4HA 3VO0A 4ACZB 2VZTA 1C8YA 4FLRA 2DIJA 3WQVA 4AD1A 1VB9A 1GQLA 8A3HA 3VOCA 3L4XA 2XYLA 2E9MA 1JF5A 4MDPA 5BWFA 2DT1A 4M29A 4ZE5A 1UWUA 1J11A 1HIZA 8CGTA 1VFOA 2WMJA 1C92A 1TMQA 1BSIA 4J3VA 5LA2A 4ATDA 3WNPA 1HF6A 2NT1A 1OT2A 4P7LA 4WLCA 5I23A 1NWSA 2JFEX 4TUFA 1QI0A 2EPMX 1W9UA 2VCBA 4P7QA 3TOPA 4YHGA 3AYSA 1JZ4A 4MADA 3WBEA 1JNEA 1LL6A 4M56A 3GXFA 1WZMA 1W9XA 3QHMA 1WKYA 2G41A 5I5RA 1UWTA 3A4WA 3VIFA 3VMPA 1LG2A 3DHPA 3MS8A 3U5UA 1TFVA 1E55A 4OZOA 3WEZA 2WCSA 1W1VA 5CQ1A 2HVMA 3WNNA 2VZVA 1MQQA 4DWSB 5FL1A 3L4ZA 4L4PA 5A8QA 1C7SA 2XFRA 5BRPA 4DUXA 2GJXB 1OGGA 4HOWA 2O9OA 1GCYA 1UD4A 3VMNA 2PC8A 3D5HA 5D9OA 1XSKA 4MNKA 5JIPA 1KQZA 3DYOA 3MUIA 4AW7A 1LG1A 5DT7A 5CLTA 3G6MA 2VQUA 2ZUWA 2ZUMA 1Q6DA 4AY1A 3ALGA 2FH6A 2CHNA 4WKFA 5A2AA 3S2CA 1H0GA 1VFFA 2DPEA 2UY5A 1KWKA 3EMCA 1AQ0A 1J12A 1L0PA 2DDXA 4PMXA 7CGTA 4XX6A 2ZX8A 4PYSA 3ALFA 4PMRA 4MNJA 2WHKA 3RM4A 1DEDA 2DSUA 2Y2WA 3VINA 3GM8A 1HKKA 2W62A 3WDJA 3GYCA 4J3XA 1GZJA 4MB4A 1OSEA 1UD8A 4OKDA 2DSWA 3WDHA 3W53A 1CGTA 1CGYA 3B8SA 3M7SA 4WK9A 5CSYA 1FP8A 2YKKA 3QOKA 1H5VA 4OBSA 1WO2A 1H3GA 2YJQA 1C8XA 3PZIA 1FHDA 2YLLA 2OYKA 3WEMA 1MWOA 1E73M 1KR0A 1DWAM 1W32A 4J3UA 1Q6EA 1VBUA 1VEOA 3ZSSA 1JYXA 2JEQA 1QW8A 2YL8A 3WDQA 1K9DA 1HJWA 1NH6A 5DMYA 2WKGA 1UD5A 1M04A 1KBKA 2WB5A 2DGAA 4UQDA 5C8BB 4W8AA 5D8ZA 3SUUA 1QBBA 3L4TA 3CPUA 2AOSA 2DT3A 5AY7A 4AEEA 2V3GA 1HN1A 2WC4A 1XYZA 5C70A 1JI2A 2ZX5A 4HA1A 2WVSA 1V3LA 4IPLA 1CXIA 3SCRA 2VC9A 3ZMRA 4MJ4A 5DEZA 2OSWA 2YIHA 4IUGA 2BS9A 5CPTA 3U5YA 3RPMA 4BQ4A 1LL7A 3O9NA 2W92A 5BYWA 1JZ8A 3WH9A 1JG9A 4TTGA 3LPGA 4CU7A 2YA2A 3IJ8A 1C3FA 1UR1A 3APGA 4P8VA 1V02E 3GBEA 1UG6A 1H2JA 4CD8A 2GDUA 1UD2A 3AHTA 2Y4SA 2XIIA 4CKQA 1I75A 1Q4NX 4KRUA 5FOOA 3WL0A 4PUDA 5A6SA 3KL3A 1IZJA 2WMFA 2X0HA 4CVUA 1I1WA 5GNZA 2VX5A 2FHCA 4V28A 1OD8A 3QGVA 3NIYA 2FGZA 2HISA 3N9KA 2XHYA 1H1NA 3WUEA 4FLQA 3EDEA 3MO4A 2EPKX 1U33A 1GJWA 1WZLA 2FHBA 1TG7A 1XCWA 4HZ7A 2XM2A 3WUBA 1ZBCA 3NSMA 1JNDA 1MW0A 1GQKA 2VQTA 3GH7A 5IFTA 1JDAA 3AHVA 1EO5A 1V6XA 6CGTA 3BSHA 2VVSA 2DIEA 1TZ7A 3NDYA 1DWGM 4L4OA 1LL4A 4P7NA 4PBGA 1UKPA 1WDRA 2J62A 1HL9A 5A8OA 5HPCA 1DP0A 4H2CA 4QAWA 1GJUA 3MANA 3T0DA 4GKLA 3WFLA 2GK1A 4PUEA 2VVNA 1E56A 3ZM8A 1E72M 2OSXA 3WL1A 3O2LA 4R5EA 3LPPA 3ZT7A 3CGTA 5D4YA 1B90A 4AZIA 4UQ9A 3WF3A 3KE0A 3GXIA 4ATWA 4TXEA 1XV8A 2ZUNA 3AXIA 1JXJA 1ZBWA 3K4AA 4P7OA 2VR5A 4RL3A 4Z2LA 3K8KA 1GONA 3N13A 4DUVA 1HXJA 1C8QA 2VURA 1V6UA 1MFUA 2D0GA 3PZVA 2OYMA 3BAIA 3EMZA 2D3NA 3BLKA 4AZHA 4JZ5A 1UR4A 3OGRA 2ZUVA 1B3YA 2C0HA 1SMDA 2VX4A 1PX3A 1UKTA 1UR8A 2XM1A 4HZ8A 3RJYA 4QCEA 2J8GA 4AIEA 3VGFA 5E9AA 1ISWA 2CHOA 5GPRA 3OBAA 2RGMA 2CKRA 1V08A 4WSJA 5EFDA 2ZIDA 3AICA 4B15A 1JL8A 4YPJA 3SUTA 4PCSA 2BXYA 4PMUA 2XFFA 3HMCA 3WQ8A 1E6QM 2PWHA 2V3DA 3ZJ8A 1JGIA 1MQRA 3SCVA 4Q22A 3CUHA 3W6LA 4KWUA 3TTQA 2XFYA 1CGUA 4LYQA 1RP8A 3DECA 3ZSTA 2PBGA 1QW9A 3BSGA 3MMWA 3POHA 5BRQA 3WUGA 1B3XA 1ISVA 1ODUA 3ARWA 3ZR6A 3KZSA 2OLHA 4NRSA 4AYSA 4CCCA 2VCAA 4BCEA 3RDKA 5ABHA 2WC3A 1BF2A 2G3NA 1O7AA 1KXTA 2UY2A 1FH9A 1Q6CA 1K9TA 2Z1KA 1MQPA 2QPUA 1HJQA 1HJSA 3AIUA 4WF7A 1W9PA 4JHZA 5FKYA 2W63A 4GO8A 3ZJ7A 1CXHA 2WBGA 2W4XA 1JAKA 2J7DA 3WF1A 3PZGA 4EE9A 4M24A 3A4XA 3FY1A 4JKMA 1WNOA 4UZUA 3WFZA 4KGLA 5E70A 4CU6A 4HPHA 3WD1A 3IJ9A 2J7CA 4QCFA 4C7FA 3WSUA 1ZL1A 3PTQA 1BG9A 5JIWA 5M5DA 3FAXA 1E6NA 5A8MA 2VCCA 1JXKA 3HU7A 4AISA 4D6JA 2CESA 5E09A 4U2YA 3CZJA 2GFTA 5E6ZA 4UQBA 4X9YA 3WEOA 3HJEA 1C91A 1W9BM 5BCAA 3ARPA 2WLYA 4UR9A 2IXUA 4PN2A 1CTNA 2WMIB 1CDGA 2VZUA 5C71A 2J7HA 1V0MA 3A4AA 1H41A 3RCNA 1QVBA 2BY2A 4F66A 1TVNA 1EA9C 1EQCA 4AD0A 5HPOA 3AHZA 2NW0A 1UKQA 2XG9A 1CENA 2AMGA 4CD5A 3GH5A 1HT6A 2EJ1A 2VRJA 4JCLA 1GOWA 4FK9A 3IJ7A 1E6XM 1HKJA 2X0YA 2YA1A 2CIPA 1E9LA 3BCFA 3AIVA 3AFBA 4JIEA 2GVYA 2E3ZA 4LPCA 5BXRA 3T0AA 2WZEA 4J3WA 3VKKA 4H7VA 3K1DA 3NCOA 4D71A 1HJUA 5CGMA 2BVYA 3SUSA 3WD4A 2A3BA 2DH3A 3WIJA 3WMSA 3VIOA 4QP0A 1FH8A 4TVDA 1PIGA 2YLAA 3AI0A 4TX6A 2PF0A 5JUVA 3NJ3A 4CUCA 4UOQA 1OT1A 5HBFA 2V3FA 3UETA 4W85A 1QOXA 4PRWA 4U3CA 2J77A 1KB3A 3AXXA 2VRKA 5D9NA 4FLSA 1E0WA 4J7RA 4PMDA 4U5IA 5A2CA 1CPUA 4CN6A 1VRXA 3AIBA 3VD4A 3PHAA 1E4IA 1MXDA 2V38A 4KMQA 3BH4A 1WB0A 4PSPA 3VMOA 4MAZA 4BQ2A 3LMYA 3THCA 5A8NA 4W7UA 1QNSA 4JFSA 4S3KA 5E6YA 4PTXA 3WF0A 2DSKA 1XD0A 3OZPA 3BLPX 4MB3A 4FLOA 3FHAA 2DT2A 1O6IA 5ABFA 3W25A 2BY1A 3W29A 3F5LA 1EO7A 3NSXA 4RE3A 9CGTA 2IXVA 5GQBA 5JBEA 1E0VA 1E4MM 1TCMA 1EGZA 3ARSA 2D0HA 3WMBA 3N11A 1SYTA 5M3WA 5EBAA 1NP0A 1GQJA 2YBTA 1ZB5A 3W4RA 4K68A 1QNRA 3SCPA 1AVAA 1BVNP 1WDQA 3VGGA 3AHYA 2MANA 1DHKA 1YHTA 2CCRA 3MU7A 1XHGA 1NOFA 3SCQA 2CNCA 4NI3A 1C7TA 2WCAA 2CEQA 1UZ4A 2VOTA 4UTFA 3L4YA 4ACYA 1B1YA 4M80A 3SCOA 2WVTA 4JL1A 2XGIA 1DWHM 3OGVA 4N0RA 1V02A 4JAWA 1WE5A
chains in the Genus database with same CATH superfamily
2WMHA 3WH7A 4MWAB 4PTWA 2VFDA 2C71A 1EEPA 1UR0A 1TPUA 2VFHA 3VIIA 1UPPA 3TJIA 4Q8NA 4NYUA 1EC7A 1IIGA 1WXJA 4GYFA 3OPSA 1Z3NA 4JTJA 3ME3A 3UVAA 2GUUA 3CIWA 3KOYA 4W4QA 4O1FA 2DFAA 2ZX7A 1XUUA 3NQGA 4HCLA 4O18A 4JHOA 1ICSA 1S5NA 1TPEA 1W3LA 2BOFX 4G7EA 4A3QA 3TSBA 1CW2A 2PTXA 4I7VA 4REQB 2XFWA 3W2MA 1VCFA 1PIFA 4Z2GA 3PZQA 2ZTKA 1YDOA 4XUYA 7REQA 5EMYA 3NL3A 3PSVA 4AC7C 1NF0A 2ODOA 1MZRA 5BW6A 4TTUA 3V5OA 4MM1A 1GVFA 4RE0A 3A6OA 4O1BA 4AWEA 5KETA 1P0DA 3VDBA 2GGIA 2DSVA 4HNNA 5E5CA 2NLIA 4ZQNA 1AJZA 1UWIA 1UBPC 1WP6A 4EANA 4TQTA 4X0VA 3IPWA 3ABOA 1Z44A 1BAGA 4J35A 4UTJA 2NXHA 4E8CA 3GXPA 3FSTA 2W91A 3WK2A 1V6YA 2L5HA 4IIBA 3LI0A 4AQLA 3ZIZA 3W2NA 3AMLA 1AUSL 4JR5A 1J0JA 1XG3A 3CAVA 5FAJA 3N3MA 3IUDA 3G1SA 4G5DA 4R88A 5AHNA 5REQB 3OQ8A 3H4GA 1OJXA 3ZOAA 1R7OA 2D1ZA 4DO7A 1FCQA 3SRFA 1ISXA 2F84A 4HPXA 3VIJA 1CXEA 4R3UA 1FOBA 2FPYA 2X41A 1U5VA 1TTIA 1WDPA 2BMBA 3C52A 4HHMA 8XIAA 4JKKA 4GUHA 3A47A 3HGOA 3TFCA 5DMMA 3MMDA 1D7KA 5K2ZA 3W37A 1QPKA 1D8WA 2BY3A 4ZR8A 3ZLFA 3FDGA 3WJYA 4KGJA 2Y62A 1SZNA 4HPGA 1L8NA 1B3WA 3L65A 3VNDA 2WV8A 3QOMA 3AJXA 1W31A 4RV8A 4O53A 3CQ0A 1XRVA 4D8LA 1TIWA 1WA3A 3EOUA 1H7NA 1WZAA 1F6YA 3VU2A 4RUBA 2XPKA 1VCGA 2CWNA 1UQYA 5AB3A 3EEGA 2ZBTA 3NEHA 4IZGA 5REQA 4N6FA 1CLVA 1XI3A 1BWKA 4AZBA 4AYGA 2VWSA 4B5TA 3ZR5A 3CUGA 1JPDX 2WNWA 5BOFA 4F3HA 2BVWA 2YYUA 1NDYA 4WX2A 4RW5A 2O55A 5D05A 1E6PA 5CSUA 1L6YA 4KFNA 4JIIX 4IXHA 1Y8BA 4XAYA 4AZCB 1QRQA 1L2QA 1XFBA 3B8IA 4HCDA 2A3EA 3GQYA 3MUZ1 1B9BA 2JEPA 3GDMA 1S2VA 2P8CA 4IIEA 1J2BA 5JMUA 5AC5A 3C2VA 7TIMA 1UHVA 4G8TA 4G1NA 7REQB 1R3TA 3W22A 3E02A 3PZOA 4J2PA 4Q4KA 1F9CA 2V5DA 3MC5A 2X1TA 5FF7A 2XWDA 3FEQA 4MTVA 3I6EA 4RZ6A 4Q4QA 4V2XA 3KL0A 4AAJA 4LAUA 4S3DA 2Y8UA 2AAAA 2PI6A 3MB9A 1VCVA 1X38A 1B54A 1K7XA 4KEZA 1QI5A 3ARZA 1IHIA 2HE5A 4C6BA 3R8GA 2ZQ0A 4MMWA 4IICA 3TONA 2Q3RA 4Q7NA 4PR4A 1W5MA 1GOQA 2BLEA 3WKZA 4ICMA 3WN6A 2BOGX 5G2HA 3EX2A 3UZYA 1W1YA 3H2AA 5HNNA 2ZDRA 5A1AA 4KETA 2PGFA 1VBHA 4JNMA 1H51A 4DHGA 1MXSA 2V63A 1OFEA 3S46A 4QEHA 3S6OA 3UWWA 4FX7A 2GQAA 1TWZA 1VLWA 2R14A 3TLLA 2YXXA 3FW6A 2P10A 3QV6A 1GZGA 1KRAC 3KUMA 1V3HA 4WY0A 2NWSA 2AQVA 2GVGA 2Y5EA 3S5OA 3LTSA 4GBUA 1EUAA 1UC4A 3DYPA 3VZXA 3NO3A 3WQ4A 1QNVA 1OYCA 3BLEA 4ZGYA 4AH7A 3N6QA 4QQUA 2V30A 4DBSA 3TTYA 2XIJA 2GJNA 1XRSA 3WNMA 1GHSA 4GXPA 4GC3A 3NYDA 3QZEA 4X2RA 1AW5A 3W70A 3L0GA 2DQWA 1UWSA 4UTUA 3VOJA 3IIPA 1EOMA 4DZ5A 2VX6A 3W38A 1KM0A 3AC0A 3CHCA 2R1MA 2X1IA 5CPLA 3S6DA 1JCNA 2YDAA 3WLLA 2WHMA 1ZFJA 1CGXA 3BAYA 4I7WA 4JKLA 4A8RA 5EMLA 3G5EA 4J28A 4OJYA 2QQ6A 4A05A 3MO7A 3HTWA 5TBOA 3QXBA 2G3IA 2JQXA 4PBEA 1RH9A 3E2RA 3SURA 1GW1A 1G0CA 1J6PA 1UOKA 2J79A 3MVIA 1XKJA 2ZRVA 1W1TA 3QMTA 4CCDA 3VGBA 1EZWA 4DM1A 2G4FA 4NZ5A 1BTCA 1B31A 3QZ6A 4QNEA 5FACA 4IQEA 2J78A 1ZP3A 3E12A 1QHOA 2YOCA 4XG1A 4EAYA 1ICQA 2G8ZA 2BG5A 4ML9A 3U57A 4MY9A 3ITYA 3WZ0E 1YBQB 5G2WA 2QEZA 5DRCA 3SUWA 1BQCA 4JQ2A 2O9RA 3CS2A 4MNMA 3UG5A 4IMAA 1Q6LA 3AISA 4CQCA 1RQHA 3QR0A 5JBDA 1HGYA 3NSNA 3PBGA 3UJ2A 5LIYX 1XX1A 2E9BA 4KW2A 5A6JA 1E9YB 1OM0A 3M1ZA 3KP0A 3U2ZA 1EOKA 1FTXA 3Q94A 3E5BA 3PJTA 1I8JA 3RJXA 3UG4A 1NM9A 4MB5A 4GIRA 3IVSA 1OVDA 5DFAA 1DIKA 4HMEA 1I9CB 4QIUA 3B8TA 2UWFA 2OWXA 2PPGA 2REQA 3KEHA 3WQDA 3TKFA 4IUOA 5HQMA 1I2NA 5DF0A 4AVNA 4ZXLA 3OLGA 4I8DA 3OA3A 1D9EA 4W86A 4C5ZA 2QMJA 5KZDA 6TAAA 4AIUA 1VBRA 3SY8A 4A2RA 4LVDA 4Q6XA 4EWND 2XSAA 3STCA 1KTBA 1KM3A 4F9JA 2Z2UA 5FI8A 2Q09A 3WLIA 1KGWA 3W6MA 2AGKA 1Q63A 3UR2A 3CBWA 3KM8A 4GUIA 1VF8A 2RDUA 2NXGA 2CBJA 3COTA 1DKWA 1Q6RA 3BSMA 4BY3A 3B9OA 4O10A 4KCVA 2A3HA 4GXWA 1FWJC 2R8WA 1F76A 1FFQA 1WXZA 2Q8XA 3HO8A 5I0DA 5LA0A 2YX0A 1XIJA 2A7PA 1H62A 4QE4A 5AVNA 4TOQA 3MBDA 1XRFA 4GYPA 4NZ4A 3VIMA 4C6LA 3IJIA 2H9AB 1XCXA 2CZFA 3ENLA 3II1A 3PB2A 3CMGA 4J3SA 1JPMA 3U8GA 4FXFA 4Q6JA 1RR2A 2EQDA 4NT0A 1M65A 4WJXA 1HKIA 4UZSA 4WXYA 5KZMA 2YZ5A 3E0VA 1IQ8A 2CLMA 1X7FA 3UNTA 4H9ZA 1WDDA 5FJIA 2VGFA 5I07A 3VKDA 1S2WA 3GXNA 1N7KA 3I3EA 3WQ5A 2E25A 1RUSA 1H0IA 1T41A 5I3GA 1W8GA 2IUZA 1QI2A 3DHFA 2J7GA 1QAPA 6A3HA 4Z2KA 3MV11 3IIXA 4DY1A 2CERA 2V82A 3RU6A 5IHSA 1V0NA 1XG4A 3RFAA 3FAWA 1CXFA 1KFLA 1XRTA 3EPMA 3KWXA 3L0NA 1XP3A 2WLZA 1FWNA 3CYJA 2GLKA 3AOFA 3GNNA 3HB9A 1GORA 3R12A 1JUKA 4UMAA 1KR1A 3NZGA 3GHTA 3R0KA 3CK5A 2CBIA 3E96A 3EWXA 4C6OA 4DAIA 3EA2A 3UXLA 2Y0FA 3HG3A 3ZYZA 4DN1A 1X6NA 1VBJA 4ERIA 3BQ6A 4J9JA 3VGDA 4QE5A 1EP1A 4ZQCA 3SRDA 2YR1A 4UR8A 1W6TA 2DIKA 2AKZA 1ZJAA 4H6KA 4AWSA 5HR7A 5GJNA 3T2PA 1X96A 3LBOA 1HUVA 1CGWA 4WD0A 4A3YA 1S5TA 1ZHAA 4UIOA 3DHUA 2SFPA 1XLDA 1LT8A 3ITXA 3IVUA 5I2UA 1UZHA 4ECLA 1OX6A 2ZYFA 3VD3A 3MYPA 1JDCA 3S6TA 2BFGA 3M5YA 4QG9A 3ARUA 3DENA 1OWQA 1FFRA 2D69A 1I4NA 2X40A 3N9SA 1EHAA 5I3DA 3HJZA 3B4YA 3CAKA 5T26A 5I03A 4BKNA 2J6XA 1RQEA 4LX4A 3IRSA 4L9XA 1DWIM 3NQEA 4H7CA 5FJTA 4B5WA 2JGYA 3UEQA 4IXXA 5T8GA 3MMUA 1SO5A 5H91A 3MMTA 2P8BA 1QJWA 2RDXA 4BR1A 4MHBA 1JI1A 7XIMA 1H7XA 1TJ2A 2UY4A 1I0DA 3DFTA 4JTQA 3UNDA 3ARXA 3GW0A 3MVTA 3WDRA 3CUIA 3EX4A 2OOFA 1KTCA 4P2VA 3V36A 1VQTA 1UYQA 3T0BA 1EPXA 4GZIA 4D6EA 3DCPA 4QROA 1QWGA 4Y7EA 4JTFA 1HP5A 4TVCA 2GGGA 3CMFA 4MUPA 4G56A 4DWSC 4NJIA 1UWQA 3Q67A 5A6LA 2GGEA 2EEXA 4E2DA 3P2VA 3LNMA 3ORWA 3GVVA 1Y0EA 4Q8WA 1F6KA 2YBVA 1RK5A 3NOEA 4FXSA 1AA1B 3FOKA 2QAFA 2NQJA 4J5NA 2I56A 3PAJA 5A6BA 1YNQA 3K2GA 1W9VA 4IM4A 4FB7A 3LNPA 5AVHA 1OYBA 3GYEA 4KEMA 1JQVA 1QNQA 4N42A 4HPJA 2VR4A 2QCLA 4JQ3A 1ZBVA 3C6CA 1LJYA 4F4RA 4R27A 5AN7A 1P43A 3O07A 4NYYA 2PLJA 4Q8OA 4A2SA 3EAUA 4ICCX 3T8LA 2FMOA 1BRLA 3CHDA 5M17A 3C56A 1ZNNA 3VI2A 1LQ0A 1K8XA 4FNPA 2ZZ1A 1G5AA 3RIKA 5CPSA 3DC0A 1GEHA 1V7AA 5AHEA 3WLSA 1CXLA 3AMGA 1MW2A 4MKVA 3RM8A 2B0MA 4DBEA 3GU1A 7TAAA 1E1CB 4D1JA 2AMXA 2J13A 1F3TA 1H1YA 1EYEA 1IXPA 1PPIA 1NELA 1ZJBA 4GIEA 1E5NA 3VM7A 1E1FA 1U22A 1MYRA 5LNSA 4L61A 3R7MA 2J7FA 1DVJA 4MZYA 4Z0JA 1F3WA 3ITVA 5J5RA 1LOSA 1KLYA 3MCOA 3W7OA 4KBXA 1WOAA 1XLLA 1LT7A 3GB6A 3OOQA 3TQVA 1TV7A 3B9AA 3LHZA 3QV9A 1KRCC 1QBAA 3T09A 2F8QA 2GL5A 4HQVA 1LROA 3EXSA 4INFA 5A94A 1UA7A 2W27A 3SJ3A 2X05A 5CH9A 1ADOA 3LENA 1P6BA 2BXVA 2DT0A 1H63A 4OWGA 1R46A 3RN6A 3W2KA 1CEOA 3MJMA 1Q66A 2J7BA 2FQIA 3VNZA 1XS2A 2ASHA 2Z1SA 1GHRA 2WW5A 3UP8A 3F4VA 3ERPA 2XSBA 1T99A 4LV9A 4ROQA 4YVXA 1XDLA 1DXIA 1SW0A 1ADDA 1POKA 1FWEC 4ADUA 2IQDA 2Y63A 4WVXA 3UY7A 3K4DA 5D04C 2O4QA 4YYFA 2ZA3A 4XZLX 1N8FA 2NWRA 4GZ7A 1ADSA 1ZTVA 4H9XA 3WK1A 1BF6A 1Q65A 1VD6A 1SU5A 1ML1A 1SO3A 4MVAA 3PFRA 1RV8A 3PTMA 4S3JA 1MUMA 2OVLA 3L2MA 1QWKA 3G1VA 4K7YA 4LBUA 4V1XA 3BXWA 3WLJA 2GK1B 4NAFA 3HGSA 3DKLA 3S1GA 3U4FA 2VZTA 2QCNA 1C8YA 5FESA 4FLRA 1XLBA 3CQIA 3WQVA 2V2HA 4AD1A 3BVJA 8A3HA 4LRSA 3R43A 3W1RA 3PPFA 1W3NA 3R0DA 4XZIA 3VYLA 4ZQOA 1HIZA 4LF2A 3O8AA 3VFLA 4ORIA 2CC0A 3RRXA 1OFOA 1Q6OA 1XCFA 2NT1A 3F4DA 1RBLA 2JFEX 2QIIA 1CB7B 3U2EA 3HPZA 1T5AA 4ORMA 1LL6A 1ZJHA 3GXFA 3W83A 3P0XA 2ZCGA 2PDIA 4DO4A 2ZKMX 2DUAA 1LG2A 3QTGA 4C90A 1TFVA 2FZMA 3AXKA 1UOZA 5KITA 4X9SA 3ZWTA 2WCSA 4A35A 5CSRA 5E93A 4H9TA 2H8XA 4QE1A 4DWSB 3L4ZA 3BLIA 1ZUAX 2XFRA 3LSCA 1NSJA 4R85A 2PSNA 4QSFA 1W8SA 1OGGA 2IKIA 1GQNA 4I8YA 2O9OA 1ZGDA 3W7KA 3BZGA 5D9OA 3DKJA 1OX4A 4PB3A 4JN7A 3LDVA 1TUFA 1S5VA 3BJFA 4L65A 4Y8FA 3STFA 5DT7A 2DZWA 3GHSA 3B8WA 4OBTA 2ZUWA 3S47A 2ZUMA 1Q6DA 3H12A 1IZCA 2FH6A 3S9YA 2UY5A 1J12A 2JGQA 2IW0A 4PYSA 2WHKA 3LHUA 4G1KA 3BW4A 2W62A 5D2WA 3GYCA 3NQ8A 4RCXA 3NTYA 4AX7A 3SW6A 5HATA 5CJNA 2DSWA 4JIQA 1LUCB 3KDNA 4AHPA 1VIZA 1CGTA 3N34A 3C5QA 1BVWA 4LBSA 3B8SA 3NR0A 1B4KA 1DJWA 2PDBA 4HN8A 4QRNA 1QK2A 2HDJA 1WO2A 1JRBA 2YJQA 3L7RA 3MBFA 3NPUA 2OYKA 3WEMA 2ZADA 2NX3A 4Y8EA 5G1YA 3QW4B 1W32A 1Q6EA 1DE5A 1VBUA 4BI6A 3ZSSA 4Z1BA 2JEQA 2O7SA 4NG3A 3SSJA 3C8FA 1K9DA 3DFQA 1XLMA 3TC7A 2WKGA 4H19A 4D9PA 1YBQA 4YYCA 1EJUC 2ATMA 2AOSA 2IKHA 2DT3A 4Q32A 2V3GA 3PBUA 2E28A 2WC4A 4LAKA 1TX0A 4GJJA 4IPLA 3STPA 4K3ZA 5DEZA 3G3DA 1KCZA 5XINA 2BS9A 3D46A 3U5YA 2DZUA 2Q71A 3DIPA 4CNOA 1TWDA 2W92A 4Y9PA 1JZ8A 3TW9A 3WH9A 1EF3A 4CU7A 2YA2A 2CLLA 2ZZ6A 1OC5A 1P4CA 3M0KA 1XYAA 4P8VA 3LLXA 1V02E 4ALDA 3GBEA 4IMDA 2F6XA 2P50A 3VCNA 1P5BA 2Y4SA 3FJ4A 4L56A 4S3GA 3KFTA 4KRUA 1Q4NX 4O57A 3DU0A 3QPZA 5A6SA 3KL3A 2X0HA 1LLZA 1XDJA 2AL2A 1FDYA 1F8MA 2VX5A 2W6RA 2PEVA 3KBJA 2HISA 1H1NA 3UZXA 4CCZA 3EWYA 3GIPA 4FLQA 4E0CA 1LRQA 2WZMA 1BWVA 1WZLA 1HKVA 1XCWA 3W85A 4IMGA 4HZ7A 3QLLA 4B2DA 1FVPA 2GWGA 3NSMA 1JNDA 1GQKA 1U5HA 4A29A 5IFTA 4JN6A 4DXXA 2HS6A 4GQGA 4XD4A 1DWGM 4L4OA 4C60A 1UKPA 3GC5A 2J62A 1T7LA 3I6RA 2YCIX 1ZRQA 4I90A 5EU9A 3NDOA 4QAWA 1GJUA 2HROA 1K7EA 3MANA 4O1EA 3T0DA 4OECA 1G7UA 1EGVA 4Z0SA 3WFLA 4B3ZA 2VVNA 5I3HA 3B4UA 3WL1A 4FOJA 2X0SA 3UXIA 4IFKB 3ZT7A 1V4YA 1B90A 4BWLA 4AZIA 2RJHA 1PUDA 1Y5VA 3CPGA 3KE0A 3OJGA 3GXIA 4IMFA 1XICA 3NPXA 1Q2RA 4QGCA 3CNYA 4MUZA 4P7OA 2W3ZA 4XAPA 2DW6A 3FJLA 1DJGA 3N13A 4DUVA 1PZ0A 2AL2B 1V6UA 1SJCA 2C19A 4FF7A 5G1MA 3BAIA 3EMZA 1TR9A 2E6FA 5D33A 3SIZA 4JZ5A 3OGRA 4LS0A 5IOBA 4XZHA 3VNMA 1PX3A 2OX1A 4HNVA 2QJMA 3RJYA 4LWWA 4LANA 1O5XA 3S5NA 3MWCA 2CHOA 3SN4A 3LBCA 2CKRA 4WSJA 2ZIDA 1JL8A 3SUTA 4S3CA 3B04A 2XFFA 3HFTA 1YX1A 2Y85A 3H7RA 3HMCA 3JZUA 3WQ8A 2DZVA 2V3DA 3ZJ8A 3GU2A 3W6LA 1EWEA 1VPQA 4H3DA 4TX9A 3DECA 1QW9A 1T0OA 3POHA 3IV3A 2FZBA 4F40A 5U7SA 1ISVA 3IUIA 3NGFA 4ZODA 1JDFA 1IWPA 3ZR6A 1JULA 1VR6A 4AYSA 1MUCA 4ZQRA 4BCEA 1VC4A 1OCNA 2WC3A 4X61A 1KA9F 1Z48A 1IE7C 2R1KA 1KXTA 1FH9A 1SSDA 2OZ3A 4TU1A 1K7FA 1K9TA 2XIMA 1MQPA 2QPUA 1SUXA 3GVGA 4JHZA 5HNTA 2VYOA 1WKEA 1CXHA 2WBGA 2DW7A 4UTIA 3NZPA 1JAKA 2NQLA 4IGMA 3FY1A 4RK8A 3PPCA 3VNIA 4BHYA 4UZUA 3VCCA 4L5ZA 3W2LA 3IJ9A 3WD1A 1LQ2A 2VWTA 2OGYA 5EY5A 2PDMA 3S4TA 4YMZA 1TMLA 3MWAA 4CQAA 5JIWA 1E6NA 1PO9A 2Y5SA 4OU1A 3HU7A 4AISA 1DE6A 2ZC1A 3EX1A 2Z0IA 1W5NA 1OEPA 2EGZA 3ONCA 3CPRA 3TAKA 4U2YA 2GFTA 4X9YA 2OEKA 3WEOA 2A7NA 1C91A 3ARPA 1P0BA 4HYVA 1QT1A 1CTNA 2WMIB 2VZUA 2G37A 5CBBA 2F6KA 1UJPA 3A4AA 4GI4A 3R8HA 4NNCA 3RCNA 3FCPA 3TSDA 4JIRA 3HMJG 2J9ZA 3FS2A 5HPOA 3PNZA 4XO7A 2B7PA 3GH5A 5EMMA 5CPNA 1VFTA 1HT6A 2VRJA 3EB4A 3DFOA 1A5CA 1RCQA 1HKJA 2X0YA 3PBMA 2CIPA 4B5VA 4B90A 1L6WA 2GQ3A 4FPSA 3T0AA 2G95A 4RXGA 3U2OA 4J3WA 3LYEA 4IGNA 1UWAA 1E1CA 2V6AA 3N73A 2BVYA 3SUSA 4LVFA 1KKOA 1S3TC 3WMSA 4QP0A 2QKFA 1UUOA 1FH8A 2YLAA 5CG7A 4HNOA 3MHFA 4GGBA 4HT3A 4HKPA 5JUVA 3OYZA 1EGMA 3NJ3A 2WKJA 4UOQA 1EJSC 2JKPA 3UETA 3FYOA 1ZPTA 2VRKA 3WQGA 5D9NA 4J7RA 3EOEA 5A2CA 5CPMA 1VRXA 3WLTA 6XIMA 3BH4A 4CNUA 3P61A 1WB0A 3BGJA 2FDSA 1Z41A 5A8NA 1FWHC 4W7UA 3S0CA 1JCMP 3BLLA 4ENLA 3OZPA 4XKYA 1GVEA 4GA8A 3CQKA 3R79A 5G1TA 3QVQA 4DXKA 5FEWA 1O6IA 3W25A 5EKYA 1M7OA 2J27A 3VK5A 3F5LA 4RE3A 9CGTA 4DF2A 1US0A 1TCMA 1E9ZB 3WMBA 3N11A 3IGUA 5DCDA 2C79A 1TPC1 3CM4A 2YBTA 3TROA 3NO5A 1ZB5A 1WDQA 3AHYA 3W7EA 2CNCA 3A12A 3L4YA 3HQ1A 4ACYA 3W2JA 1F3XA 5FJJA 3N3TA 5ECVA 1OX5A 2QW5A 4PUKA 3H2OA 1RY8A 2R1PA 1T8XA 1N8WA 1R87A 4JTTA 2VDIA 4HU4A 4CNNA 5BNKA 3KVJA 4IIHA 3SSZA 1KCXA 3UXKA 2F61A 5LYRA 1SPQA 3KL5A 3VCRA 1RD5A 4I3GA 2XVPA 3AUJA 3T6CA 4UFJA 3CLMA 1MW1A 3SCNA 2W79A 4GNJA 3CEUA 1S1RA 3RXZA 5GNXA 6TIMA 1HKMA 2PDPA 4ZVJA 3WQ6A 7A3HA 2VELA 1Z8AA 3WLNA 1J10A 2PP1A 3EDDA 2PCEA 1CZ1A 4L6HA 1K9FA 3K30A 1S2TA 3E49A 3UZ5A 4AEFA 2HWGA 2OOGA 2PTWA 3LHTA 2E4TA 1GKRA 1H7PA 3GTHA 1QOPA 3BMVA 4KH2A 2HQAA 3T08A 3U7BA 3M0JA 5KZ6A 2EPOA 3DHDA 3EKLA 3FFSA 1W2PA 3GDTA 3G8RA 1KCKA 1Y65A 4ZFMA 3RLHA 3STGA 3NWRA 2Y7EA 3G6LA 4E6MA 1CT5A 4WQ6A 2WWDA 1WYIA 3L4VA 3UCDA 2YCJA 1GOXA 1DQUA 2VC6A 2PDGA 3CAQA 3PZ9A 5AYBA 4O11A 3V0TA 2Y88A 4RJEA 2JF7A 5FD0A 5A8GA 1OFAA 1GYLA 1JCXA 3NPWA 5GJPA 4GI8A 3UGRA 1CXKA 4LAZA 3K46A 4H4IA 3W1AA 3M5ZA 2GQ9A 3GRIA 1TELA 4QAIA 1R3VA 1B2YA 1KBBA 1UWRA 4PMOA 1FWTA 4RDYA 3QQ0A 5EA9A 5FJOA 4PMNA 3GTXA 3BUVA 4P8XA 3N15A 4X60A 1B30A 3UD6A 2WSYA 2QGHA 3I7RA 1A0CA 1MFVA 1K02A 2I9UA 1FKWA 1LOQA 2C7FA 4IFKA 3KCOA 1XC6A 2G3JA 5EFFA 4AZ7A 3WDPP 2PWUA 4DWSD 3THUA 1RP9A 1TPVA 3WLHA 1VYSX 4A21A 2PWGA 3AWNA 1KM5A 2G3FA 4E3TA 3NVDA 4ZQMA 2XVNA 3H53A 2QUMA 1QTWA 2QF8A 3LUTA 2Z6IA 5CG0A 2VEFA 2Z2AA 4H2HA 2DEPA 2YDSA 3EOOA 2RH9A 4NZ3A 2WWCA 3WENA 4OE7A 3RCYA 3ITLA 2VR2A 4RE4A 4HA4A 5C0QA 1KFWA 3CUXA 3VTRA 4O19A 1KGXA 4ZO6A 3GHUA 2WANA 3EXRA 3OU8A 3UVIA 3TWBA 5I3FA 3THDA 3AQUA 4GLEA 2PWDA 3CASA 3MW7A 3QPYA 4BI7A 1FWFC 3M16A 4PUNA 5FSEC 4EF8A 1LORA 3ATYA 4OIFA 1KM1A 1GK8A 3BICA 1J0ZA 1A3HA 4WXZA 4XUGA 3VZYA 1B57A 1MDLA 4DWSA 2YXGA 3F2DA 4MY1A 1YIXA 5DY3A 3GE7A 1W0MA 1S1PA 3SEPA 1HVQA 2X7WA 2Y61A 1HL8A 4DZIA 1HQTA 4XZBA 5B7ZA 2XSXA 2BSLA 4E8DA 1DTUA 1Q13A 2WZIA 1NU5A 5FSDC 3W7JA 1X6LA 3CU2A 4QLLA 3GH4A 1ODZA 2P76A 3TYZA 1P0EA 2FH8A 3GG0A 1BVZA 1RJRA 2FYMA 5I78A 4A6GA 4KQNA 4JX5A 4UTTC 2ICSA 1IGWA 3W84A 1I2OA 1IEWA 4NJJA 2VJXA 4KIEA 1IEXA 1GVRA 3UGVA 1WPCA 2JF6A 2YDRA 4GY7A 4CD6A 1TCDA 2TAAA 4J4KA 3PC0A 4H8VA 3ZXWA 3VKJA 1VJIA 2OB3A 3LXBA 3LBMA 3DZ1A 1HKWA 2Z27A 4JN8A 4HA3A 2PBOA 1VZWA 2DZXA 1JZ7A 1NQ6A 1G1YA 4ZOBA 2F9RA 3MCMA 4A3HA 3VM5A 1IF2A 1CECA 4IIFA 3EOLA 4YCOA 3BLDA 1CB2A 2Z1XA 4Y9AA 2WNNA 3AIQA 4X2PA 5E0CA 1SVDA 3SIMA 1A5SA 3SR7A 4HOXA 1I6NA 4PTNA 4MNLA 3R10A 3OGSA 3AS1A 4IL2A 4YTQA 3LZ3A 4J3ZA 2D24A 2VOMA 4NZFA 1O5RA 4Z17A 3ABXA 3RHGA 3Q45A 3W7DA 1M3UA 4H41A 3AIRA 1W5OA 2VFIA 2VDHA 5A69A 1DHPA 2I5GA 3T0CA 4XSMA 3DG6A 2E77A 3W27A 1YTEA 3W26A 4EKJA 4FAMA 2QDGA 4AZ5A 5HUOA 1EIBA 3WG6A 4AY7A 3DBNA 4DUWA 3S9IA 3RITA 2CETA 1H5YA 4S38A 1Q7QA 2CPUA 1W3TA 2XIBA 1AQHA 2R82A 1ZU8A 3IIZA 5LIWX 1WXYA 2V5CA 2TODA 1FDZA 3JU2A 1X1OA 2C13A 2WVVB 3POCA 5C5YA 4M3PA 2WSPA 3IJ6A 3KRZA 1PZ2A 3GNOA 4JOMA 5ECUA 1JRCA 1S2AA 1WAUA 1SZEA 4DWDA 2ZUSA 3ES7A 2R94A 3TP4A 3WBYA 3WNOA 4XISA 3W7RA 1V0LA 4G9PA 2OEMA 3P81A 4NILA 3G1DA 2Z26A 3VPLA 4W8BA 4HMDA 3FN9A 3E74A 3IGHX 1J6OA 5I6SA 3P3BA 2EKCA 1JUEA 3BL3A 2H3BA 4U33A 4YNGA 1KRBC 2CU0A 3UXAA 4LNCA 3RX4A 1E6SM 2ZZ5A 2ZZ2A 5H1WA 2ZE0A 1JD7A 2AQWA 3K4WA 2JALA 3NUKA 3B9EA 3ARQA 1H60A 3EOSA 4BQ5A 5G4HC 3TOYA 3EYPA 1ZCCA 3CV6A 1XH0A 3EX3A 3AS3A 1NOWA 1PE1A 2BV9A 4LUYA 2Y8VA 1V3KA 5F2MA 1BGAA 1ONRA 3WLQA 3RRAA 5F2LA 2GUYA 4NAFB 4HHLA 4JGDA 1RD6A 2OLAA 3R1ZA 4GQ0A 2NVAA 4GO9A 3A3XA 2KZHA 2EPNA 3QV7A 1UUQA 5H8MA 1VENA 1PX8A 1SMAA 2R1LA 2PRLA 3RO6A 1K6WA 2RGLA 1EL3A 4HD5A 2Z4GA 3N18A 4XV0A 1E0UA 5JH2A 1NDZA 3AZSA 1W3KA 4GUJA 3BJSA 1LLOA 1JZ2A 1TREA 4HJWA 1N82A 1Z7AA 5BROA 3ARTA 4OOUA 4Z2JA 5GNYA 2E1DA 5CZTA 3LY0A 3GR8A 1M6JA 1U30A 1GGOA 1VFUA 2DSZA 3M0XA 2OXNA 2WJEA 5CKSA 3BMXA 2XGZA 1TUXA 2XTKA 2LLEA 2Y24A 3SCTA 1AH3A 3UZJA 3OBEA 1KW1A 1M1BA 3H55A 2YL6A 1DJYA 4PMZA 1ME7A 4G7FA 4ZENA 3BOXA 3W1PA 4RPPA 5LXXA 2CLKA 3CJPA 2GSHA 4IISA 4J27A 1H49A 4F8XA 4HOZA 2NQ9A 4S2BA 4JTIA 1WCGA 1BLIA 4DJFA 4UNLA 3OQEA 1O60A 3L68A 3CH9A 3ECQA 4GX8A 3RMJA 4ZB2A 2VRQA 1ISYA 3CTTA 3P67A 5D2YA 2A3CA 1REQA 4GH3A 1KFJA 3EB3A 1L6FA 5HMFA 4KEVA 2PLCA 5BZAA 4K1WA 3VD7A 3L21A 3Q58A 1NEYA 2E9LA 4QG6A 3TXZA 3UWYA 3FK4A 3N6JA 4WCJA 3QN3A 4HPNA 2PMQA 2OCZA 3B8UA 4I5XA 5AZ0A 4IGSA 5HANA 4GRSA 4F2UA 1KFKA 1YTKA 4PE8A 1MVYA 4UNIA 2HK1A 4Z1AA 4FXJA 3ABSA 3EWWA 3ARYA 4QG8A 1QI4A 2OR2A 4AU0A 2PWFA 4ZA0A 3BC9A 3F5JA 4D6FA 3T2QA 1W3JA 4L4LA 3HA1A 4HB7A 2ZXDA 4JTGA 2QCCA 3AROA 1KFCA 1O1ZA 3IGXA 3VUPA 3ZLGA 3AUOA 4Q8VA 3LB0A 3LN3A 3OP2A 5D9PA 2VDGA 4DRSA 4AXNA 3LTPA 2VX7A 4Q8QA 4P5UA 3AMDA 4FSAA 1DTNA 3WX7A 3DYMA 2JIEA 3KTXA 3MV01 3MP4A 3ZQ9A 3EPOA 1LBMA 5G5IA 3W7PA 2TMDA 3IIVA 4PTDA 2E0PA 3TMQA 3P80A 3QRHA 1VYPX 3MCNA 5FF4A 2R91A 3O6AA 4GI6A 1CNVA 4UWMA 1AJ0A 1PX4A 4GZJA 1GVIA 2WKLA 1HGWA 4ZXOA 4KCTA 1RAKA 4AZCA 2JKEA 1DWFM 1OX4B 1JZ5A 3UXDA 3BQ5A 4F0MA 4FIRA 3S5SA 5C7VA 3CHFA 5BXSA 4IPNB 4QLKA 3FNDA 1LP6A 3L5LA 2CITA 3IS4A 3QR3A 3T2OA 1I0BA 3R2GA 2JIWA 4BS0A 1QXLA 4H8UA 3M46A 1E0XA 1IIHA 1FXPA 5FF2A 1SO6A 1A5KC 4AD2A 2PDJA 4GWEA 5AFDA 3QH2A 4MJMA 1TO3A 3PZMA 4HP5A 5T9CE 4JTKA 2HTMA 3CUFA 3FSUA 4H04A 3PWGA 1EBHA 5J5DA 4V33A 3VDCA 3LXAA 1RBAA 1CBGA 1XBXA 3GXDA 1BKSA 2WJZA 2G5WA 2QIWA 1JFXA 5MHBA 3W82A 1CLXA 4YXGA 1H7WA 2ZXBA 4DBUA 1V7YA 1H4PA 1OK4A 3AO0A 3CZEA 1XLCA 4V27A 2EBNA 2V2CA 3KBMA 5FF3A 3I7QA 3TNOA 1BKHA 3W00A 5AYXA 4POCA 1SM9A 4AG0A 4C6EA 2C18A 2FFCA 3N04A 3B9DA 4M19A 2DJLA 3BLOA 5LNUA 5HUPA 1JVNA 3QFWA 2TRSA 3RG6A 4TV6A 3WK3A 4GVFA 4EWJA 3SDOA 3CO8A 3HV9A 4HMCA 2WQPA 1XGZA 3WBAA 5ABFB 4D6GA 4Q7BA 4AF0B 4HSNA 3QPEA 1QO5A 1HJVA 1DQXA 1GYMA 1QHPA 3NQVA 3USZA 1J5TA 2YBUA 1E70M 3E5PA 5A6KA 3SGGA 4J40A 3C0LA 4KF1A 1C29A 4ZTXA 3FVDA 1SR9A 4M8UA 3G22A 3KOZA 5CEWA 3W75A 3D47A 1HX0A 3V0SA 1REQB 1ONEA 3D6NA 5D38A 3QHOA 4PSRA 3QC3A 1E9IA 1IV8A 3EBVA 1EBGA 4ZBCA 5AECA 3GLCA 2RFGA 1AH4A 5CAKA 2NLYA 1M41A 4PCPA 1EX1A 4UQCA 3AU6A 4AIOA 2ZZ3A 5JBFA 4FOUA 1OCBA 4GUFA 2W5FA 3WJWA 1UC5A 2EXOA 1GNXA 5CZSA 3SZ8A 5A95A 3LPOA 5HJYA 1M68A 2GJXA 4XTDA 1F4AA 1EDQA 4FR6A 3TSMA 3QYSA 2H9AA 5I77A 2PB1A 1EH9A 3FLUA 1Q8JA 2OYLA 2Y7FA 3MUY1 2V9DA 1LOLA 5EB8A 4YTSA 3L0KA 1EF2A 4UTWA 3RU8X 3LCIA 2E8YA 3FV9A 4D8AA 3GY1A 5F2GA 5ABEA 1E5JA 1UW9A 2V67A 1ZCOA 3KCJA 1YDNA 1ZENA 2NUXA 4JY9A 4CEXC 2NX9A 4IT1A 2WC7A 2I9EA 4URIA 4C6MA 2CXEA 3EMQA 3TTOA 4W93A 3J7HA 1O4UA 4LS2A 1PZ3A 1KO0A 3LQLA 1J93A 4OBRA 1OABA 4MAVA 4BWLC 4Z1DA 1XD1A 4HNCA 3G1RA 4S2CA 3BG3A 4G6CA 6REQB 1OIFA 2ZX6A 1Q8AA 4PMQA 4D6HA 4LB3A 1J5SA 2WHJA 3VX1A 2XINA 1OGBA 2X1SA 1LQAA 1J0YA 1G94A 4DF1A 4FS9A 5CJMA 1KTNA 3QGAC 3TXVA 4GZEA 1L6SA 4GPNA 3TA9A 3VIPA 2ZICA 1X8FA 3ONBA 2D22A 1V03A 1PHQA 3BAKA 3G3MA 4NJGA 1AMYA 4G2DA 4PEEA 5DCEA 2NUWA 4GINA 4H8HA 3APYA 3M5XA 2CZDA 3UF9A 1D7FA 1PWLA 3PZTA 4UC5A 3CZGA 5IRPA 1HJXA 1F4HA 5XIMA 3KAOA 4RDVA 2ON3A 3UZWA 1GQLA 5CBIA 4UMCA 2XYLA 1LRNA 2MUCA 1AW1A 2VD8A 3BANA 4M29A 4CLMA 1K4GA 5H2ZA 2EG6A 3NFUA 5MKGA 4J3VA 5LA2A 3W7QA 3RUBL 3QY6A 2HNHA 4F2TA 4ADSA 1OT2A 4P7LA 2FVKA 3HBLA 4TUFA 3FKRA 4EPEC 2EPMX 4P7QA 5KZEA 4YHGA 2MNRA 3QYQA 3WBEA 3FA4A 2Y7DA 3MSRA 3C61A 2VENA 1WKYA 2G41A 3W74A 4LSBA 3VIFA 2OT0A 3NGJA 3BO9A 3LV5A 1E55A 3F4NA 1W1VA 3CWHA 4Q4OA 2VZVA 3M5VA 3RPDA 1X1ZA 5BRPA 3NAVA 1EEXA 4N4QA 4O1DA 1OFDA 3TIMA 3P8JA 1GCYA 1Z89A 1FWCC 4FNQA 2FZNA 1G4EA 5FEXA 1U5JA 1XSKA 3CIXA 5JIPA 1GG0A 1VPXA 1F8IA 4PCNA 4LCQA 5CLTA 3G6MA 3NEVA 2VQUA 1LWIA 3ID7A 4XD5A 3USBA 4AY1A 4JQ4A 3GNDA 4WKFA 1EB3A 2BGQA 1VFFA 1MDRA 4IGHA 4WJ8A 1MSSA 3C3NA 4M6UA 4MKSA 3PWIA 7CGTA 1Z6KA 2ZX8A 3ALFA 2CW6A 4PH6A 3H26A 2Y2WA 3T78A 3KVLA 4J3XA 1FRBA 1XQKA 3VOIA 2GJLA 3BTNA 3Q65A 4X22A 3B8VA 3DOPA 1R5YA 4C6KA 1J96A 5LNWA 3GHRA 1DXFA 1SW7A 1TWSA 2ACUA 3G77A 3LXCA 3SN1A 3KVMA 5HQEA 4XQ6A 1YE4A 5HJLA 1NIUA 1DWAM 4D8ZA 2CZ5A 4YTRA 4PUUA 3INPA 3EXTA 1QW8A 4MPQA 2WOQA 3IEBA 2GZXA 3S2NA 4XTIA 5BRBA 1M04A 5TAOA 3TW6A 3ISIX 4CQ8A 5C8BB 5DXYA 3KRBA 3WQEA 3CPUA 3PNUA 4IJCA 1FWSA 3H70A 1YPIA 2WO5A 3VNJA 1P1XA 4HA1A 3HG2A 4LUSA 1V3LA 1TV5A 1CXIA 2OQHA 3SCRA 1H61A 1PDYA 3P84A 2VFFA 2PDQA 3GDLA 3RPMA 4GJIA 2P0IA 1LL7A 3O9NA 3V4BA 5BYWA 4RPQA 4TTGA 3LPGA 3RLVA 3KHJA 3E0FA 3IJ8A 3LD5A 1A0DA 3TH6A 4O0ZA 4YWIA 2QDDA 3APGA 3DFYA 3EWDA 2D2HA 4CD8A 2GDUA 4IH3A 1D3GA 1TSIA 4CKQA 2HPMA 5FOOA 4ES4A 4PUDA 2WMFA 4CVUA 1TJRA 1I1WA 5GNZA 1LRTA 4V28A 3TYCA 3NIYA 3VABA 2FGZA 4RW3A 4HSHA 4RDZA 3N9KA 3H21A 5F4SA 3L9CA 3UPBA 2Z28A 3EDEA 3KHDA 2EPKX 1U33A 1GJWA 1FWAC 3AWOA 4JY8A 4MYXA 3TUUA 1W1B1 3C0SA 3PJWA 1TV3A 3SRHA 1OQFA 1ZBCA 3U4AA 1VS1A 1DIDA 1SFJA 3VKBA 2HBXA 1KRMA 3GH7A 3VAVA 3AHVA 3P7YA 1EO5A 2VVSA 3NXFA 2DIEA 1TZ7A 1Q4WA 2PGRA 1UP0A 1QW7A 4DJDA 4NASA 4L1WA 1HL9A 3PK7A 2OELA 5HPCA 5K9DA 5LNVA 3M47A 2GPTA 4LEFA 4ERAA 1EJVC 1IT7A 2A7RA 4GFIA 1E56A 1E72M 4AF0A 4ASTA 1EA0A 1XPYA 2HVOA 3LPPA 1VKFA 2GVEA 3ZVIA 1FQ0A 1TJ0A 5EGRA 3W1QA 3CL8A 1B5TA 1XV8A 4ZB5A 1JXJA 2PAJA 4AVFA 4US5D 5AHLA 2VR5A 2PD5A 3PF3A 1EJRC 1T6MA 1GONA 1PYFA 4L7ZA 4C1NA 1C8QA 4FP1A 4ZO7A 3HGRA 3URNA 3I10A 5DRIA 1YADA 2VXNA 3PZVA 4DVOA 3VZZA 4JTRA 3W76A 9XIAA 3BLKA 1GPWA 2BX7A 1POJA 4M6PA 5C2CA 2C0HA 2A85A 2OJPA 1SMDA 1W1IE 3TTEA 2VX4A 2PS2A 3K5XA 2OZ0A 2J88A 1XISA 3VGFA 2BDQA 4Z42C 1ISWA 2H6RA 5GPRA 3MI6A 3OBAA 2RGMA 2GOKA 3NQMA 3VNKA 4B15A 1XM3A 3ANYA 5AC6A 1F6PA 4PMUA 4K6AA 1FCUA 2IPWA 2HS8A 2Y6ZA 1E6QM 2PWHA 4E2BA 1MQRA 1XYBA 4MWAD 4Q22A 3TZFA 4LYQA 1I2PA 2OQYA 3UWEA 4NNBA 4JEJA 5K7JA 5BRQA 1WKDA 3AYVA 1P7TB 1ODUA 1QASA 4HBKA 2VUNA 4LNYA 1BRLB 4NRSA 4TIMA 1A49A 1GG1A 4CCCA 1Q2SA 2Z6JA 3E0IA 2G3NA 1O7AA 2UY2A 3TE9A 3MP3A 3W1MA 4H9UA 3E9AA 2YZRA 3NA8A 1HJQA 2QGYA 3P14A 2W63A 5BOOA 4B4HA 4PB5A 3MKCA 3PPHA 3WF1A 3PZGA 3OVGA 4EE9A 4L1XA 1H7RA 4JKMA 1YPXA 1UB3A 4KGLA 4O15A 5E70A 2I1OA 3A5FA 4QCFA 5I06A 4C7FA 2FZ9A 4I7UA 3G1FA 3AALA 3KBWA 1AH0A 4HNLA 3N29A 3VKCA 1OC6A 2JKAA 1NDVA 2PUZA 3UT0A 4GHRA 4ZOAA 3IK4A 5M5DA 3FAXA 2VCCA 4HK6A 3O15A 3RR1A 4D6JA 2CESA 3TX9A 3OW1A 1NDWA 3W73A 2BOEX 3URAA 5E6ZA 3BV7A 1EJXC 1PIIA 5KMYA 5BCAA 2WLYA 3KS5A 1XR2A 4M5PA 2IXUA 1OF6A 3VC5A 5C71A 1QDSA 3D0CA 2YPIA 4OUIA 4Q8TA 4O16A 3R25A 3OHIA 1S39A 2CLPA 2XG9A 4HGXA 2AMGA 1I2QA 3WLOA 2DV0A 4JCLA 3IJ7A 3H7UA 4K2SA 3S8HA 3DEQA 3REQB 4HJFA 4NKCA 2V68A 4LPCA 3LGGA 3MHGA 3VKKA 2B7NA 3NCOA 3PANA 4GVGA 5CGMA 3LEPA 1YPFA 3FYYA 3CH0A 2DH3A 3GFXA 3VIOA 3I4KA 2RJGA 4TVDA 1TPH1 2GOUA 4LCSA 4M0XA 3GSMA 1A5UA 4K8EA 3GWQA 2V3FA 2QCMA 1NF7A 1KB3A 3DFHA 3AXXA 1E0WA 4PMDA 2WNQA 2A2IA 4U5IA 4JNZA 3E0LA 3P6LA 1GWJA 3KTSA 2NSOA 3ABRA 3FKKA 1K3UA 1F07A 1WDWA 3U9IA 4NIRA 1G4TA 2F2KA 4PSPA 3VMOA 4MAZA 4BQ2A 2A21A 4Q4SA 1J79A 4EACA 5K4ZA 4PTXA 2DSKA 4CNSA 3UZZA 2TPSA 4MB3A 4FLOA 4XBSA 3VFCA 3IJLA 4YL2A 1S2UA 2HK0A 3S42A 4GMEA 3W29A 4KS0A 1R3SA 5JBEA 3KZPA 1E4MM 3ARSA 1J2WA 1V77A 1NP0A 1ZAJA 4NAEA 3GR4A 4K68A 3SCPA 3I68A 3VGGA 3A9IA 1YHTA 3MU7A 1H7OA 1XHGA 3SCQA 4K8GA 1C7TA 2VC5A 2CEQA 2WSRA 3BWWA 3VC6A 4HK5A 3SCOA 4DYJA 2PURA 2WVTA 3T4CA 1V5XA 4JL1A 1A5AA 4XKYB 3W02A 3DN5A 4JAWA 3GK0A 1WE5A 2BTMA 5D2XA 3GNRA 4OTKA 3WH5A 2Z2BA 4AWUA 2DP3A 2WM1A 3HPXA 1JAEA 3N12A 1RJQA 3QW3A 1KGUA 3B06A 2DY3A 1E40A 1K9EA 3W71A 5JU6A 1FP9A 2VZOA 4OGZA 4KRTA 4BA0A 4UOZA 2Y1HA 4GYJA 3GXTA 5CPQA 3O0FA 3EDKA 3GFZA 5DMNA 3L23A 3WYZA 1OZQA 2C1IA 4TO8A 1RLDA 1JFHA 1U83A 2OWWA 4W89A 3OO2A 2ESCA 4B5SA 4EXQA 3V3WA 3TN6A 1V6TA 2IQTA 4HTYA 4H7ZA 3HQPA 3S9ZA 1IT0A 2NSXA 3RYSA 4AC1X 4QDMA 2ISDA 1X7IA 1O95A 4EK7A 2Z1BA 2JBMA 4N6EA 4CVWA 2VL4A 3M07A 3GTFA 3S3GA 2PP0A 1QNOA 5HMEA 3RGTA 4CQBA 3TMLA 1PCKA 3VDGA 3ATZA 2O9TA 1X6UA 4O8AA 2ZOXA 4DPQA 5A2BA 4WUIA 3B97A 3SCSA 1R3YA 3NDZA 1OC7A 3PUDA 1PVNA 5DBUA 3CMJA 4I5RA 1JZ6A 3SI9A 4MWAA 1TZ9A 2XH7A 1V0KA 4A3RA 2GGJA 1TTQA 3H22A 4HVXA 4O1AA 4QITA 2QJIA 2C3ZA 1E15A 4OT7A 2GSJA 3XISA 5IDIA 1MUWA 4YHEA 3JUGA 3KW3A 3W1LA 1NFGA 3UCQA 2O9PA 2ZRWA 3VA8A 1XL9A 3MKKA 3TVAA 1TV8A 1HP4A 3BE7A 1AMKA 2XWEA 5C2GA 4JTUA 4L9ZA 2D20A 3KS6A 1RY0A 4GE8A 1KXHA 4K8HA 1JF6A 1GT8A 1V3JA 2WHLA 5IBXA 4GI9A 3UYCA 1RA0A 4E4FA 3AMCA 2VI0A 1PSCA 1UASA 4YJ5A 3KLLA 4ONVA 4JDYA 2QPXA 3O05A 1UZ1A 4H6QA 4I6KA 1Q85A 1XYFA 1UMYA 1S3HA 2XVKA 4O13A 1KBLA 4L6DA 4CU8A 3FJ6A 1YYAA 1G6CA 4IG2A 2Z24A 4KESA 3HPFA 2B31A 2I17A 3OZOA 5F2IA 2HXUA 3WY1A 4B5XA 4LEQA 2B4GA 4XZWA 3MPGA 1XLKA 2GDVA 3I4EA 3ZS4A 2QZRA 3UESA 1IXNA 1NFBA 1KWGA 4NRRA 1IXOA 1ZAHA 3CIVA 5LHFA 1UROA 1FWDC 1R9XA 2D2OA 2E8ZA 3V18A 4A8NA 1GVQA 1OINA 2PTZA 3IARA 2FPTA 1W2VA 2ZWYA 1TPFA 4N9BA 1OADA 3S2LA 1TKKA 2J4GA 2PDWA 2YFNA 3GUWA 4CGTA 5CC5A 3IANA 1OCJA 2GJPA 5BXTA 1RVKA 2P5NA 3MY9A 1AG1O 5EMUA 3GAKA 3WFAA 4GH1A 2EPLX 3B0YA 3N2CA 3N19B 1DL3A 4S1FA 1HFBA 4DLMA 3NNTA 4S3BA 2HBVA 2Q3OA 2QYGA 3GTNA 3GBDA 5KSWA 2GSEA 4UFMA 3AU2A 3WDIA 6ENLA 4PBFA 1JCLA 2FJUB 4FNUA 3H2MA 2PTYA 3QR1A 3N4AA 1RPKA 3A24A 1QHZA 4TVUA 1IWBA 1PAMA 2G96A 3R58A 3M4HA 1OGSA 1TTPA 9RUBA 5SWUA 4FHAA 3VOFA 1BYBA 1EC8A 3OEXA 4PMYA 2EF9A 1UD3A 4ROPA 4C91A 1V3MA 1LBLA 1H1ZA 3M7WA 3C2FA 2X09A 1JQXA 1EC9A 3K8LA 4Q4RA 5FCZA 1NP2A 1JPHA 1B4EA 5I79A 3IJDA 1M03A 1R9ZA 1EDGA 1YNYA 3M0YA 2DZSA 3O6CA 1CYGA 2WXDM 2TYSA 4LS1A 4WEVX 4AD3A 1J18A 2QCDA 1HL2A 5BWAA 4UQEA 1P6WA 2PU1A 2EAWA 4PRRA 3IK2A 2BP1A 3F4CA 5AC4A 3OVRA 4JD4A 2WYSA 1WZKA 2AKMA 3LHVA 1A4LA 1M5WA 3PN8A 1L9WA 1OYAA 4LUTA 4H9VA 1ZAIA 2POZA 3F03K 1ZSXA 4F0SA 3MI2A 5DXXA 1V6WA 3EWBX 3L2LA 1XLGA 1ESWA 1EIXA 3EWCA 5TF0A 2QT3A 2ISWA 1XFCA 3R11A 4AMCA 3M43A 4N9EA 5HOSA 5HMDA 1XW8A 2QR6A 3N1AA 4PMJA 1EXBA 2XZ7A 1Q45A 2BHZA 4M6VA 3D3FA 5EMJA 2DZBA 1BQGA 7PTDA 4ZFCA 2DVTA 4NSBA 2QPSA 3VIKA 1SR0A 2ZUTA 2X7VA 2QUNA 1MNSA 5AHIA 4MKNA 5KTLA 4UXDA 5IBXC 2H8ZA 2VNCA 3MUCA 4ZEPA 2A4AA 5ABTA 1XSJA 1A5LC 4HU0A 3W9ZA 4AD5A 3ZO9A 4JBRA 3NQ6A 4DAFA 1EQPA 3PFMA 4D1IA 4AFYA 3DBPA 5D37A 2VHLA 1DV7A 4JCMA 3UA3A 4XWUA 4Y2WA 3W24A 3WF2A 5CJ5A 2QUUA 4B5UA 4W84A 3LHWA 5KEZA 3ABZA 3ZZ1A 4N02A 4ZQPA 1UA3A 1PTDA 3UERA 1PKYA 3RO8A 4XD3A 3MI3A 4UFIA 1F73A 4H9YA 2Y7GA 1BPLB 4EVZA 1FA2A 4L80A 2NV2A 3W7CA 1PL9A 2WQDA 3AXHA 1SFSA 2ZUUA 3BAXA 2PWVA 3P5ZA 2YCKX 1FWGC 3MKVA 1TMHA 4F79A 1XBYA 4R33A 1SJBA 2XISA 3MZ2A 5JXQA 2WVUA 3QM3A 1ITXA 3N9RA 3P82A 1M7JA 2FHFA 1VRDA 2EHHA 4YLWA 1E6RA 2ZE3A 1UH4A 1WUFA 2ATSA 4PFHA 3JW7A 4GJ1A 3H23A 3EGJA 3WF4A 2FTPA 3L5MA 3W2UA 1YNPA 3OVQA 1NARA 1Z32X 1B3VA 3DFSA 4MWAE 1JCJA 4CD4A 1C90A 3OB8A 4C6QA 5A6BD 1O94A 4PUMA 2C8NA 2J25A 3M0IA 3BGGA 2XH2A 2J9XA 3E6EA 1THFD 4I9MA 1BYDA 3UJSA 4O0QA 2QCDB 3GDKA 4CD7A 2R24A 2ZX9A 3GW3A 2VKZG 4HK7A 1UKSA 5TNVA 4MLRA 3IGSA 3SY1A 3O7UA 4F48A 2BVTA 2ZWZA 4DJED 1J0IA 5FJPA 5CXPA 4Y9OA 4EOUA 5CCZA 4XAFA 5I00A 5HNUA 3FX4A 2ALDA 4FMVA 3WQPA 4K37A 4Y96A 3HQNA 4UTMA 5A6AA 4A4AA 4B3LA 5M03A 4O0KA 4F0HA 4QLJA 2O0TA 2YSWA 2UV8G 1H09A 2QAPA 1Q6FA 3NQBA 1XC4A 5LSMA 4Z08A 3M0LA 3W01A 4QJ4B 3VNLA 3B0XA 2F7FA 4JFTA 1ZS2A 4JS3A 1HW6A 5CSSA 1GYNA 2FLIA 3NQAA 3SBFA 3LA4A 4KCWA 5A6MA 1LWHA 4GFSA 4RV3A 1J9YA 3VKAA 3S1XA 1ITCA 1NFPA 4PTMA 1X1NA 4FOKA 3R94A 2P88A 4IQJA 1DJQA 4LAMA 1UCWA 5HXMA 2CWXA 3MTWA 1AL8A 3GG1A 3TC3A 5XIAA 1FWIC 3RR4A 4JDBA 4LW7A 3RAOA 4LYRA 2ACSA 1JD9A 4BQ3A 2RDWA 2XVGA 3DFPA 3NQFA 2PZ0A 1XUZA 4XZNX 1H11A 1PJ9A 3NQ2A 3LLFA 5D32A 1MW3A 1KD0A 3WMCA 1I60A 1UH2A 3N2OA 1W3IA 3RK8A 3UWUA 2REQB 4LT9A 3KTCA 5IHRA 3EB2A 2C0AA 1LF1A 4WOQA 3C2RA 1SQ7A 5F7UA 2OT1A 2XIQA 4QS6A 1UKOA 2WPGA 1HVXA 5LZLA 1XH2A 4MFDA 1UIOA 2PD9A 3CHVA 3E2SA 3TA6A 1VHNA 1VPYA 5H8UA 1OBAA 3VX0A 2BXZA 2VMFA 4ML4A 4M7TA 5HR6A 3BZJA 3FJNA 2QLYA 3A3HA 3W1XA 3U6WA 3BW2A 1IT8A 4I9TA 3VE7A 3FHQA 1UR9A 3K1GA 2FZ8A 5BOEA 4MIMA 3BDKA 3O1NA 1JDDA 4FF5A 1AQMA 4AD4A 4Q3MA 1A0EA 4PULA 3G0XA 1M01A 2V2DA 1ZY9A 3BOFA 3S2MA 3UW6A 3EA1A 2VFEA 4EAMA 3ZFHA 4ZE4A 3ARVA 2P53A 4LFYA 4UCFA 1PXGA 4D6DA 1R7AA 4N4PA 1TPDA 1TJPA 3LU2A 3U0HA 2W9MA 2OODA 4ILSA 2QCHA 2Y70A 3LRKA 1ZJIA 1U2YA 3A21A 1PS9A 4YCPA 3WD2A 3FGCB 4JFVA 3UFYA 1K4HA 2V5JA 3PZNA 1K8ZA 4GK8A 2E67A 2WBKA 3GNXA 3OLEA 4AIBA 4NU7A 3TYEA 5AHMA 4Q7IA 1E43A 2NVCA 4LY8A 2C1GA 5CPOA 4DJDC 3RLUA 1L2UA 1V3IA 4JPGA 2OSYA 4RR4A 4EPBC 1LM1A 4DZAA 1AFSA 1SZFA 3PAOA 1SW3A 3Q2DA 4IJRA 4N9DA 1MO0A 1BYCA 2BVDA 2R9RA 4BEUA 1MZHA 1XIDA 3GIYA 3QKZA 2GUBA 4YN5A 1A80A 3MUAA 3CV7A 4XVEA 5AYIA 4W7VA 1W9DM 1TPWA 3KBNA 4WRHA 2VEMA 1ELSA 2XGBA 4L1GA 4QS5A 5D30A 4EP8C 3LX9A 1ECQA 4DX3A 3QY8A 2CYGA 4NVTA 1KNWA 3BCJA 3NM3A 1DBTA 4MJ2A 3FXYA 4JEQA 4B9YA 3E2VA 4W5UA 3DESA 3N2MA 4Z2IA 3GXMA 4DJDD 5I24A 2PDHA 4GXMA 2VT0A 3H7VA 4IX2A 4ACZA 1VJZA 3WD3A 1E3ZA 3SCWA 5TQLA 1W17A 3GUGA 1U1UA 4F9DA 1OB0A 2NX1A 2DQXA 3RM9A 4GISA 1F3EA 3CHEA 4R7OA 2NQ5A 4WGHA 2W66A 3FA3A 1R0MA 4P7RA 4R7WA 4LUIA 3W0KA 2VGIA 3CZ8A 3KDOA 4NAEB 1D3CA 3TK7A 1HO4A 3UJEA 1GKQA 1A4MA 5CLWA 1ZLPA 3CEPA 2HEJA 3WH8A 4WSKA 5AOUA 3W87A 2A3AA 3WQWA 4ZMGA 4IQDA 3CLWA 5FIPA 3I3BA 2CHRA 3ITCA 4GQRA 4NQ1A 3PULA 4MZ8A 1QU4A 3KP1A 3OIXA 1VEPA 3I3DA 3P74A 2HNEA 4LB4A 1TX2A 4LXFA 4J1OA 3TW7A 3MZNA 1TR1A 3UBPC 2PP3A 5CGTA 3U3HA 3LK6A 1RA5A 1T96A 1AODA 1TB3A 2XVLA 3P60A 4L9YA 1E51A 1XDMA 2D73A 3TYDA 1BGGA 2VEKA 5A3HA 2WVVA 1UH3A 2A0NA 4B16A 1R9YA 2FDMA 4LGXA 5L6UA 4MF4A 3DGRA 4F0KA 1QCWA 1FHUA 2VGGA 4WR3A 2CZEA