2HVMA

Hevamine a at 1.8 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEVAMINE
publication title The 1.8 A resolution structure of hevamine, a plant chitinase/lysozyme, and analysis of the conserved sequence and structure motifs of glycosyl hydrolase family 18.
pubmed doi rcsb
molecule tags Hydrolase
total genus 96
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hvmA00
3MU7A 1X6LA 1E4MM 4J28A 4BF7A 2GDUA 4AEEA 5GNXA 3VTRA 1JF6A 1OGBA 1SR0A 2D0FA 4UFLA 3L4VA 6A3HA 2CCRA 4PCSA 3TTYA 4E8DA 4IUGA 2VZVA 1H11A 5E6YA 1ECEA 3RJYA 4ACYA 2J74A 1LF1A 4HA4A 1WE5A 4IPLA 1FH7A 4AD3A 2XSAA 3DYMA 5HBFA 4TVUA 1GOQA 2VX6A 3IJ8A 3L4TA 3K8KA 1G5AA 4ACZA 4ATLA 3WEZA 4UOZA 1V08A 1JXJA 4HMCA 3T2QA 2PWFA 1B3ZA 3AOFA 1CGXA 4FF5A 4ZFMA 3OBAA 2J47A 2WMIB 3L4YA 2NW0A 1W2PA 3ARQA 1UWUA 4C7DA 3A3HA 3AMDA 3BAIA 4UFJA 2WSKA 4W87A 1A3HA 2G3NA 3WF2A 3CHDA 1EHAA 1TG7A 1JNDA 4MADA 3CPUA 4DWSA 1EXPA 3EDDA 4AIUA 3WD3A 5KEZA 4AZIA 4GPNA 1C8YA 2DT0A 4HU8A 3ZSSA 3VIMA 3WQVA 1GJUA 2UY3A 2DT2A 2X09A 4GXPA 3K8MA 1BTCA 1PPIA 5BXPA 4U5IA 1DTUA 4UNIA 3T0DA 3AIUA 3PBGA 4H04A 1AVAA 3CUFA 1HVXA 1CXHA 2AMGA 4Z2HA 4HPGA 1YQ2A 1RH9A 2CETA 2ZUSA 1UKPA 3WF0A 2ZE0A 4D6GA 3SCSA 2XVPA 1KXQA 2FHCA 1Z32X 1QBAA 3KL0A 1V03A 4FK9A 3TA9A 4JL2A 3EYPA 1FP9A 2C7FA 4MTVA 1Q4NX 1N82A 1V6YA 4PMZA 4JKKA 4W84A 1B90A 5EB8A 4WSKA 2YLAA 4KGJA 2G41A 2ZIDA 3BAWA 5D9NA 4EANA 1UZ4A 1JGIA 2OYLA 3WUFA 1CIUA 4OUEA 2EPNA 3BMWA 3PZQA 1XSJA 4P7OA 4UQEA 4CN4A 4ZE4A 4M82A 2WHKA 3UEQA 4AD5A 2X1IA 3AFBA 5CG0A 1EQCA 3CUHA 5FIPA 4LX4A 4DWSC 5A94A 4H2CA 3QHMA 3THDA 3WD1A 3B8SA 4W93A 3SUSA 2WC3A 4HTYA 3JUGA 4OBRA 2UY5A 1H0GA 3VVGA 1JZ3A 1V0MA 1ISXA 4TXEA 1E6ZA 2CKRA 4DWSD 1Q6DA 2DSVA 1WO2A 2VT0A 3ARPA 3L2MA 3THCA 2VX5A 3WH8A 4F79A 3WENA 2FHFA 4C7FA 4CU6A 2GJXA 4ZENA 1PIGA 3MMDA 3VDBA 3QHOA 3OA5A 1QPKA 3VM5A 4D6IA 4UQDA 2EPKX 2G4FA 4L4PA 3WMCA 2QPSA 4JFUA 2YIHA 1WPCA 4PUDA 2NSXA 3BCDA 1UQZA 2YDSA 2PBOA 4WSJA 1K9EA 4XUYA 1FH8A 1MFUA 4Y7EA 1H41A 1VF8A 1E40A 5FCZA 1E1FA 3AISA 1X1NA 4UZUA 5I79A 4UFHA 4GZJA 2PWGA 3J7HA 4CCCA 3BSHA 2WANA 1C8XA 4MDOA 2E9LA 4XX6A 4HOZA 4W7UA 2MANA 3WF1A 1NM9A 1JD7A 3AHYA 4Q7NA 1ZS2A 3VD4A 1C7TA 1V3JA 3SUVA 3POHA 5ABHA 2ZWYA 4D6DA 1IV8A 3EMZA 4D71A 1XH0A 5CSUA 5A6MA 4M80A 2YL6A 5JIWA 1QVBA 1R87A 1CENA 2G8ZA 1E73M 2FHBA 1E15A 3CZLA 1H09A 3DECA 1DWFM 4B9ZA 2PB1A 1H3GA 1XGZA 4OOZA 3VIKA 5HPOA 3IK2A 2BS9A 2J7BA 2XIIA 3CUGA 4JCMA 4X0NA 2VCCA 4H8UA 4GQQA 1O6IA 1CXLA 3GXDA 2YL5A 1E72M 2WVUA 1KCKA 4IM4A 4PN2A 4UCFA 1GJWA 4D6FA 1DWAM 1L0PA 1NWUA 1RP9A 1J11A 4J3TA 3ZJKA 1WKYA 3POCA 2DT3A 5CGMA 3N9KA 4PMDA 3WY1A 5KZ6A 3RJXA 4W8BA 1CDGA 4W7VA 3ALGA 1QHPA 2YA1A 1EOMA 3AMKA 1B1YA 3CZEA 7CGTA 1GW1A 3EDKA 3NCOA 1S46A 4CU7A 1O7AA 4OJYA 3ZJ7A 1XV8A 1DWHM 4LYRA 1JAEA 3GH5A 5D9MA 1PIFA 1K6AA 1MXDA 2WCSA 4ATDA 4H8HA 3WDJA 3EDEA 5LA2A 2X0YA 3UETA 4GI8A 2VMFA 1BVZA 3N04A 1OD0A 1R85A 1JIBA 4F9JA 1JFXA 2GUYA 3RM4A 1M7XA 5IHRA 3A6OA 1HF6A 3DHUA 5BYWA 3VGDA 4UFMA 1E70M 4CCDA 1F4HA 5FL0A 4AWEA 1V3KA 4N42A 1ESWA 5DO8A 4P7LA 3AYSA 1MXGA 4B9YA 2F2HA 1UWTA 5CJ5A 4AW7A 3WFLA 2E40A 2XGBA 4JL1A 3N12A 3RPMA 2UY4A 2ZX7A 3WNPA 1JZ4A 2D3NA 2VR4A 3VDHA 1E6XM 1QNQA 4WJXA 3VIPA 3U5YA 5ABFB 3WEMA 5D9OA 3QOMA 1HVQA 3OZOA 1FHDA 1AQ0A 4UOJA 2BV9A 2J7GA 3GM8A 4V2XA 3N11A 3RILA 4BS0A 1Y7VA 2DIJA 1VJSA 2V5DA 4D6HA 1F4AA 9CGTA 5GPRA 3ZSTA 1KXHA 2JEPA 4W7WA 3U57A 4PMOA 2BNJA 1CXIA 1GPFA 3VNZA 3BAXA 2W4XA 1PAMA 4CD4A 1V02A 4PMVA 3WD0A 4H7VA 1GQIA 2ZX9A 1E3XA 1CBGA 1D7FA 6TAAA 5BXTA 3TP4A 1PBGA 4AD2A 1GCYA 1L8NA 4M29A 4ATWA 1MW1A 3K1DA 2BXYA 3FN9A 2ZUTA 3BCFA 2EPLX 1QI0A 4YHGA 1CPUA 1MW0A 3MO4A 1EO5A 4F66A 3EDFA 5CPTA 4D6EA 3AROA 3KEHA 4JCLA 1UH4A 4QP0A 3UERA 1MQPA 2XFYA 4BQ5A 3WQ4A 1XYFA 4QDMA 3BGAA 1M04A 3WDRA 1W9BM 3D3AA 5A8QA 3AIBA 1V0NA 4WIWA 1DWGM 4D1JA 1GOOA 5I24A 2W63A 1HXJA 2YL8A 4P7NA 4PTXA 4FLOA 3FW6A 2CIPA 2CERA 2G3MA 3OIHA 1XSKA 1B0IA 2XWDA 3HU7A 2V5CA 4AZ5A 2WWDA 4A4AA 5ABGA 1HL9A 3CHFA 4CD8A 4W88A 3B9DA 1XYZA 4EKJA 2V3DA 4EK7A 2CESA 4RE3A 4NZCA 3PZIA 3CTTA 4E2OA 5A2BA 2JE8A 4U5KA 3L2LA 4CVWA 2CNCA 3VGBA 1GNXA 3DC0A 3AMLA 2GJRA 1TZ7A 2DSWA 1HJQA 1FH9A 1J0YA 1GHSA 3UG5A 4TX8A 3PZTA 2WKLA 2XWEA 2WMFA 1HKMA 1HKJA 3EDJA 5HPCA 3VD9A 1K9DA 2CEQA 2VNCA 1QI3A 4JAWA 5I0DA 3BAYA 3WQ5A 3MV01 1UD2A 2V3FA 2WMJA 1CXKA 2ZXQA 3ZJ6A 1US3A 4CKQA 1C7SA 1BHGA 1UD5A 5M03A 1CEOA 2ZUMA 5A95A 3PTQA 4M81A 2OSWA 2O9RA 2DSZA 1G1YA 2W91A 4U2YA 1V3HA 1W1PA 2Z1SA 3DHPA 2VOTA 4P8XA 4AY1A 1IT0A 5IFPA 4HPHA 4EE9A 1B3WA 4W89A 2DT1A 3VPLA 1H4PA 3CMJA 1E0VA 3GYCA 1MW2A 2G3JA 5CGTA 2VURA 3I3EA 3K46A 3WUEA 1C8QA 5FD0A 3W29A 2E4TA 5I3DA 2AOSA 5FOOA 3VIHA 2FDMA 2YBTA 5EMYA 2BXZA 5CPSA 3WDHA 1EDQA 3OLDA 3QR3A 3MUY1 1UR4A 4FLRA 3VIJA 1BYCA 5I77A 1KR0A 3FNDA 3AZTA 2OSYA 4ZEPA 2V38A 4H8VA 1EIBA 1NARA 3EMCA 2W62A 5BRQA 4UOQA 4X0VA 1KGWA 1KCLA 2UY2A 3PZUA 5I5RA 1WZMA 2PI6A 3N13A 5EBAA 3ARZA 4JFSA 2WXDM 5ABFA 2VZSA 1BSIA 2Y4SA 1FOBA 4DM1A 4GI6A 4AZ6A 5A6AA 2J8FA 1CLVA 3AHVA 1WDSA 1BYAA 2J62A 4MNKA 3WNMA 1M03A 3SURA 2V3GA 3ZT7A 1KFWA 3K4DA 1XH2A 4XZWA 2BY3A 1RPKA 1TR1A 4A3YA 2OSXA 5LYRA 3AS2A 2BY0A 3UR8A 3LPFA 3GZAA 2CYGA 5GQBA 3CUJA 3N15A 4ML4A 5BCAA 4PMYA 2BY1A 3APGA 1EHNA 4URIA 5I2UA 3AIVA 2RGLA 4Q22A 1PZ2A 4PEEA 4NSBA 5A8MA 5IDIA 3WIJA 1E6RA 1QI4A 4W86A 3NDYA 1V6VA 3VX0A 2PC8A 1V6WA 2WBGA 1GOWA 1V3IA 2ZICA 1KGXA 5A6SA 3WH5A 1W32A 2IUZA 4AD4A 3WELA 1UD4A 1FHLA 2EPMX 3W24A 1DWJM 4HP5A 3L4ZA 3KE0A 4GIAA 1JYWA 5JBDA 2CHNA 1UWSA 3M6DA 4MB3A 4V28A 3LPPA 1NP0A 1UQYA 3WMSA 1X6NA 1ZU8A 3CIVA 1MFVA 3SIMA 4PCTA 2O9OA 3QOKA 1OINA 2W66A 4TUFA 4Z2LA 3WNOA 1KXVA 1ISYA 4W85A 3AHXA 3E1F1 3CHCA 3DYOA 3SCVA 4HA1A 4CGTA 1NOFA 1JDCA 1AMYA 1LQ0A 2FGLA 4LGXA 1PEZA 4J3WA 2BVYA 3ZT5A 3WBAA 1BLIA 3PZOA 1J12A 1W3LA 3F5JA 3DYPA 4RL3A 4RE4A 2A3HA 2GFTA 3GH4A 1XD0A 1UR8A 1MQQA 3ARVA 5AC5A 1E0XA 1EQPA 2DSUA 2Z1KA 1E1EA 4RE2A 1QI2A 2DSKA 4W5ZA 2DDXA 1J9YA 3VILA 1JI1A 4P8VA 3W37A 4PMUA 1E4NA 4UFIA 3WD4A 1WNOA 2JF7A 2XGIA 2WMKA 3ZR6A 3MKKA 4M8UA 3AHTA 4YPJA 3KL5A 3K8LA 4UFKA 2QPUA 3GDBA 5DF0A 4MJ2A 1FA2A 2J78A 1GOMA 1XSIA 3GXIA 3AIQA 3WD2A 5D8WA 2ZUNA 5D9PA 3BMVA 1HP4A 4D6CA 3VNYA 4KRUA 1JZ7A 2W92A 2YL9A 2A3CA 3AS0A 3AXXA 2WHJA 3T0AA 2JEQA 5E70A 5EFFA 4PYSA 2VQUA 5FL1A 4E4PA 4AZ7A 5AY7A 1BFNA 1UR1A 4XB3A 3CMGA 3VGEA 7TAAA 2BHUA 3BSGA 3VMPA 3OGRA 1HJWA 2WMIA 2A3EA 4MPKA 1C93A 3PHAA 2JIEA 4XZBA 2O9PA 4EAMA 3PTMA 4AD0A 1PZ3A 2O92A 3W82A 3MSGA 3S2CA 1EO7A 3CBWA 3L4UA 2EEXA 1MWOA 2WZEA 2W67A 4J3UA 1KWKA 2VI0A 2GK1B 3W6LA 1IZKA 2WW5A 4NI3A 1BG9A 1KQZA 1OIMA 1KR1A 5DFAA 1M01A 3RCNA 3SUWA 1DP0A 3W28A 3FAXA 3CUIA 2J7HA 3RIKA 1E6QM 4V27A 1J0HA 1UG6A 3PZGA 2JIWA 2YDQA 1VRXA 1JYNA 3UR7A 4BZYA 1D2KA 3ARYA 1TFVA 2BVTA 4JZ5A 2XTKA 1HX0A 4B3LA 1KWGA 2ZXBA 2ZUWA 1LG1A 1E3ZA 2E8YA 1VAHA 4D72A 2ZUUA 4AIOA 4PTVA 1VENA 3AIWA 5IFTA 3UCQA 4PTMA 3WF3A 1VFMA 3IAQA 1JZ5A 3ARWA 2J79A 2ZX8A 2IXUA 4MB5A 1TVNA 5C71A 2PBGA 1CECA 4GZIA 2UWFA 1ZB5A 3AZRA 3WH9A 5E09A 4D6JA 4PSPA 4GQRA 3UG3A 1M53A 3BLKA 1A47A 2Y8VA 4KGLA 2J7FA 4P7QA 2ZXDA 2XSBA 3FY1A 3ZIZA 1HNYA 1I1XA 3SUTA 2X2YA 4B3KA 5M5DA 1VFFA 1PX4A 3OB8A 2WKGA 4MDPA 1Q6CA 5IXEA 2QHAA 1W2VA 1WB0A 3GNOA 5A6BA 1BGAA 2VX7A 2J8GA 3T09A 1QW8A 1I75A 1LL4A 2PWEA 4B16A 3T08A 3OG2A 1OSEA 1XC6A 1UKOA 3VD5A 4UQ9A 1DHKA 2J7CA 3CGTA 5E6ZA 1BQCA 3W25A 3F4VA 1CYGA 4AZCB 4AD1A 1TVPA 1XH1A 1ISVA 1JI2A 1EDTA 2XJ7A 2TAAA 2GVYA 3PZNA 3ECQA 2PWDA 1UR2A 2GJPA 1UWQA 1EOKA 3W53A 1B31A 1DWIM 3BC9A 1DEDA 1J0KA 1UKSA 3U5UA 5CZKA 2FGZA 3WDQA 2VZTA 4OKDA 2XYLA 2E0PA 2BFGA 3PZVA 1ZL1A 3AXIA 1SMDA 1W3JA 3WBEA 3M07A 1FP8A 2J25A 1G0CA 3AHZA 4QLKA 1U30A 1GQJA 2E3ZA 1HJVA 4J27A 4BCEA 2VTFA 2XG9A 3G6MA 1JYVA 5CSYA 2OLHA 1E4IA 5DMYA 2WC4A 4WKAA 2YDRA 1E6PA 2WCAA 3WH6A 1GVYA 3BAKA 1WP6A 3HJEA 5E0FA 5JBFA 3FAWA 2HVMA 3W6MA 1VBUA 1SMAA 4KWUA 1B3XA 2OWCA 4PMQA 2EO7A 4MNLA 5E9AA 3T0BA 5F7UA 3ARRA 4HZ8A 1WDQA 4X9YA 4BA0A 3MS8A 2ZWZA 1NOUA 3MUIA 3VIIA 5HOSA 5LA1A 2Y5EA 3ZJ8A 3U7VA 2XHYA 3I3BA 4U33A 2GDVA 4CN1A 3AMCA 3VOCA 4K68A 1KBBA 4PUEA 4CVUA 3VIFA 4KH2A 1U33A 1TA3B 1CXEA 1CLXA 1UWRA 4MAZA 3SCOA 4TTUA 1EGZA 3CZJA 1ODUA 1QBBA 1E6NA 4AC1X 2OYKA 5JIPA 3VKKA 3AS1A 1NWSA 1BYDA 5BXSA 3CHEA 3A47A 4UTFA 3WNNA 3GXMA 2CXGA 2ZX5A 3RM8A 4NF7A 4DUXA 1HT6A 2WMGA 1LG2A 4J3SA 4PMNA 4DUWA 4Z2IA 2GK1A 1AQHA 1QNRA 3VMOA 3OGVA 3EMQA 3S6TA 2VRQA 1LL6A 1RP8A 2WBKA 1XD1A 3W0KA 1LL7A 2XFFA 4TVCA 1G9HA 1HKKA 3NYDA 2YOCA 2VVSA 1R8LA 3HN3A 1HL8A 1R7AA 3ARTA 1TE1A 3OLEA 3NJ3A 2XFRA 1E4LA 4JKLA 1TCMA 3WL1A 1B9ZA 1W1VA 4YHEA 3L4WA 1J0IA 4NRRA 4N0RA 1GORA 2E9BA 4XV0A 4JKMA 1H5VA 2WAGA 5D4YA 1OGSA 1GQLA 3CZKA 3MANA 4TOQA 5A8PA 3CZGA 1UH2A 3W4RA 3VUPA 3SCWA 1KB3A 1QOXA 4BQ3A 2WVSA 2EXOA 3I3DA 3NUKA 5I78A 1GHRA 4AEFA 1W9PA 5A1AA 3VMNA 2RGMA 2QV4A 2WC7A 1I1WA 1ISWA 2VJXA 1OIFA 2DGAA 1R7OA 3IJ9A 1W9VA 4H41A 4UQAA 1JZ2A 3TOPA 3GNPA 3RDKA 3NSMA 1UHVA 2XVKA 2ESCA 4JHZA 1FFQA 3W27A 2VUYA 4CD6A 4QCFA 2IXVA 4W5UA 3PN8A 1QNPA 1ZBKA 1UD6A 1LWHA 1Q6GA 1QNOA 3VIGA 1GUVA 2HISA 2CKSA 4J7RA 1OCQA 1JXKA 3SCTA 1W9UA 1W1TA 2WK2A 2J75A 2DQXA 1KGUA 1ODZA 1UH3A 4LPCA 3M46A 3PZ9A 4OIFA 5A69A 1UKTA 1CGVA 1VEPA 2B31A 2J7EA 1VJZA 2WHLA 1ITCA 4QLLA 4DM2A 2YJQA 3OZPA 3N17A 4MNJA 4AZCA 5AYIA 1CZ1A 2OWWA 4MB1A 1OGGA 2OYMA 4R5EA 3G6LA 3ZR5A 1OT1A 1V6UA 1ZJBA 2JF6A 1J01A 3FHAA 5GNYA 1UA3A 2WHMA 2OWXA 2VZOA 3IJ7A 4MAVA 3O9NA 4BQ4A 2VX4A 1GZJA 1PJ9A 5A2AA 1E56A 4PBGA 1HJSA 3CZ8A 4HMDA 1ZBCA 3A4AA 3IAPA 3MSDA 5I6SA 2BVDA 1B30A 4CD7A 3SCNA 2NT0A 4HU0A 2VC9A 1W91A 3AZSA 1WZLA 5LA0A 4MJ4A 3TTOA 1OD8A 2DH2A 1D3CA 2DPEA 3WQ8A 4UR9A 2A3AA 3QGVA 4D1IA 1BAGA 1E6SM 2VQTA 4M24A 4U2ZA 1GQKA 2QLYA 5FKYA 2X8RA 3W38A 2ZOXA 1J18A 4WKHA 3NSNA 3RO8A 1UR0A 1H1NA 4CU8A 3WFZA 1B2YA 1UA7A 3AIEA 3ARSA 3AI0A 1KBKA 3VD3A 3SCUA 1WDRA 1OB0A 1QI5A 1FFRA 1W1YA 4PSRA 5A3HA 3GBEA 3UG4A 4FLQA 2WB5A 2CHOA 2WYSA 3VINA 5HNNA 3WDIA 5CQ1A 1H0IA 1E0WA 2D24A 3FHQA 3IANA 3WDPP 3WL0A 1JZ6A 4UZSA 4CD5A 2ZUVA 1NH6A 4AZHA 4HOXA 1CGYA 2QF8A 5BWFA 2XIBA 2WWCA 1WZAA 1ISZA 1U2YA 1MW3A 4GKLA 1NOWA 4J3XA 4ZXLA 4S3JA 1LWJA 2F8QA 1JAKA 3WKZA 2XM2A 1VFOA 2WCGA 3NIYA 1TA3A 2YA0A 3WEOA 3KZSA 3B9EA 3GTNA 4HZ6A 3WSUA 1VFUA 2W61A 1RD6A 1US2A 5EFDA 4TX6A 1SFSA 1JF5A 2X0HA 3A4XA 5A6LA 5ECUA 4HA3A 3AYRA 2YKKA 1GOKA 1GOIA 3VGHA 3GH7A 1JDAA 1JG9A 3RM9A 1IZJA 1V3MA 5A6JA 1CTNA 2EBNA 4JFWA 2QMJA 5DT7A 4OBSA 4DUVA 3ARXA 3MV11 1CGUA 2PWHA 3O6AA 2XM1A 3UESA 2CBUA 1PX8A 3VO0A 1V0LA 4GZEA 1HP5A 4AISA 1UZ1A 1E5JA 1HKIA 1OWQA 2VO5A 1QHOA 1JYXA 2D0GA 4AZGA 3SCQA 5AC4A 4GINA 3WQ6A 3A4WA 3NDZA 3MUAA 1UR9A 1E55A 2XVNA 4OZOA 2WVTA 3WUBA 2XVGA 1C3FA 5CLTA 2VRJA 5CXPA 1MVYA 3AQUA 2CITA 1E9LA 1UWIA 4IISA 3LMYA 2WPGA 2Y8KA 5A8OA 2V3EA 1AQMA 1CXFA 3WMBA 3K4AA 2VR5A 4PRWA 2YBUA 1J0JA 2VZUA 4PMRA 3GNRA 1W9DM 2Q8XA 3VDCA 2J4GA 2EQDA 5GNZA 4WK9A 4TVDA 2D3LA 4M56A 4FLSA 1J0ZA 4U3AA 4U31A 4UQBA 4JFTA 5AYBA 4CUCA 4PTWA 4FMVA 3WNLA 2PF0A 3WUGA 1OM0A 4LXFA 2VVNA 2QMKA 1UYQA 3D5HA 4Z2JA 1UKQA 1UUQA 5A6KA 1K9FA 2VL4A 3CH9A 1E71M 1GONA 2C8NA 2WZHA 1JD9A 5C8BB 2JFEX 3OLIA 1H2JA 2WVVB 1WDPA 2CBJA 4Z2KA 1EDGA 1G01A 2GSJA 4NRSA 3EBVA 8A3HA 4E8CA 4GO9A 3LPGA 2BHYA 2D1ZA 4HMEA 1GVIA 3VX1A 8CGTA 2EJ1A 4BQ2A 1TMQA 1V6XA 1BGGA 1CGWA 4ZE5A 3SEPA 4CCEA 2EPOA 1QHZA 1NQ6A 4MB4A 1W9XA 2VCBA 4HZ7A 4LYPA 5HXMA 3BXWA 2Y2WA 4S3KA 1KXTA 3N18A 4QAWA 2WMHA 1HJUA 1WAWA 1B3YA 2NT1A 5A2CA 4Z2GA 1UD8A 2A3BA 6CGTA 2J7DA 2DEPA 5CPQA 5IHSA 1VEMA 4B15A 4C7GA 5JBEA 4ACZB 3F5KA 5M3WA 3AXHA 4YN5A 3VD7A 3WN6A 2DH3A 4CN6A 3II1A 1LLOA 1ITXA 1VBRA 2WNWA 2G3IA 4M1RA 2X05A 3WH7A 1WCGA 4P7RA 1J10A 4TTGA 5M17A 3BH4A 3ZMRA 2Y24A 1NP2A 3KL3A 3B9AA 3N1AA 5A8NA 2CBVA 1QW9A 3HMCA 2J77A 1HIZA 1CNVA 5DT5A 3VU2A 3VDAA 1OT2A 2BHZA 1V3LA 4QLJA 3VM7A 3TONA 4DWSB 4AMCA 1JZ8A 3VGFA 2D22A 1BYBA 2E9MA 4A3HA 1BF2A 3SCRA 5E0CA 4R27A 2D2OA 2FH8A 3GXFA 3O2LA 3OGSA 3FXYA 3MUZ1 2WSPA 1TUXA 1W3KA 1OBAA 1BVNP 2DIEA 1K9TA 3PTKA 1UD3A 3ZT6A 1P6WA 5BRPA 3M7SA 2VRKA 1KQYA 2WLYA 1ZJAA 3W26A 3KWXA 4QCEA 1XCWA 4QFUA 3VGGA 1CWYA 3WQWA 3MMUA 3AS3A 7A3HA 1VEOA 1HN1A 3T2OA 3ZO9A 3RMEA 1MYRA 1EA9C 3TTQA 5TD4A 3AMGA 2ZX6A 1V0KA 3WNKA 3LPOA 4AXNA 1JDDA 3SUUA 1E43A 1Q6EA 3VIOA 5JUVA 3QHNA 3MMWA 5HDRA 5ABEA 3AIRA 1NWRA 5C70A 4JIEA 4JHOA 2O9TA 3ZQ9A 1XRVA 1XCXA 3AJ7A 4LYQA 1VIWA 1C90A 1SYTA 5BROA 3ZM8A 1LJYA 4WF7A 1V02E 4F8XA 1C91A 4W8AA 2F61A 1ZBVA 3L4XA 2XPKA 2YLLA 2C0HA 4HOWA 3BAJA 3AICA 3TTSA 4F9DA 4J3VA 1JL8A 5DEZA 1EH9A 2D23A 2D20A 1YHTA 3CO4A 2D0HA 1W3HA 2JALA 3NSXA 4WLCA 5A6BD 4GI9A 2WM0A 4PMXA 4KRTA 3ARUA 4OOUA 2AAAA 1CGTA 5CLWA 1G94A 1VB9A 2FH6A 4UQCA 3ZOAA 5BXRA 4AZBA 2XVLA 4JFVA 4IPNB 3BLPX 3CLWA 4GO8A 3U7BA 1R86A 4WKFA 3SCPA 3PZMA 4L4OA 2GJXB 2WZIA 3GBDA 2WLZA 4LQ1A 1BPLB 4KMQA 4P8UA 1B3VA 1BG4A 1PX3A 2CBIA 4AYSA 1UOKA 4U3CA 1Q6FA 1JNEA 2ZXAA 4MNMA 1H49A 1ZBWA 2E8ZA 5I23A 3T2PA 3WF4A 4P8WA 2VCAA 5D8ZA 2WVVA 3F5LA 1JFHA 1WZKA 2BY2A 3ALFA 1C92A 1NWTA 4W8LA 1HJXA 2CPUA 1QNSA 2YA2A 3W81A 1E5NA 4AIEA 1MQRA 2XUCA 2W5FA 3OLGA 4ZXOA 1XHGA
chains in the Genus database with same CATH superfamily
3MU7A 3TC7A 4D2JA 1R3WA 5GNXA 3VTRA 4OE7A 2PF8A 2D0FA 1SR0A 4DXVA 5AVNA 1VZWA 3W83A 2X1SA 3MUCA 1H11A 5E6YA 4ACYA 4Z0SA 2J74A 1LF1A 4I9MA 4H83A 1WE5A 4AD3A 3NZQA 1W5OA 2C0AA 3NTYA 5CJMA 5CPOA 4YTQA 4ACZA 4AWUA 4S39A 1JXJA 1UZHA 1HO4A 2PWFA 1PHWA 2VFHA 1B3ZA 5DCEA 3AOFA 2WMIB 2ZFAA 1W2PA 3CB3A 1RLDA 1X6UA 3D47A 1YBQA 3CWHA 4O19A 5D2TA 3WQOA 4WOQA 4NZFA 2G3NA 1FWIC 2Z7GA 3GDMA 1E9IA 1TG7A 5AHFA 4C65A 2DQWA 3I68A 5KEZA 3GAYA 5FJJA 2DT0A 3H8AA 1FKXA 2UY3A 4DJFD 2GSEA 3K8MA 1BTCA 4GUIA 4A3QA 3TR2A 4ZB2A 3PBGA 1AVAA 4Z0JA 1XIFA 3RU6A 1W5NA 1HVXA 4N9BA 1H63A 4J4KA 4LAZA 1YQ2A 1RH9A 3K2GA 1X39A 3PANA 1OK6A 3WF0A 1SZRA 1TE6A 4NZ5A 4LALA 4D6GA 1L8PA 1K77A 4RV3A 2FHCA 1QBAA 4MKSA 1V03A 4JIHA 3ABOA 3EYPA 3QC0A 4MTVA 4BR1A 4GKTA 1Q4NX 2PDFA 3TYEA 4KEZA 4S23A 4MZYA 2G3FA 2GOUA 1TTIA 3THAA 5EBUA 2G41A 3GR4A 1TWWA 4CNOA 4L65A 1JGIA 1EP1A 3WUFA 1I9CB 1IIGA 1S2TA 4L7ZA 3PZQA 2VWSA 2Q09A 4CN4A 2R9RA 4AD5A 4BHYA 5CG0A 4QBXA 7REQA 4QROA 5A94A 4DZIA 4H2CA 1GJPA 2IKHA 2OQHA 3THDA 1J96A 5I06A 4JYDA 4JEQA 2H9AA 4RNHA 3P7YA 2FZNA 3RK8A 2AAMA 3UCDA 4AHOA 3NVTA 5FEZA 2PA6A 3DG6A 3JUGA 2PDUA 3TSMA 2UY5A 1JZ3A 3NR0A 2XDFA 3BLEA 1E6ZA 1YXCA 3M0XA 2DSVA 5G2WA 2PTZA 4B91A 5CJNA 4IUOA 3F4WA 1E9ZB 4F79A 1J5TA 3WENA 4DQWA 1Q2RA 1WUEA 2FHFA 5KSWA 2GJXA 2VD9A 1PIGA 3NOYA 2YYTA 4JTUA 1Z48A 3GWQA 4QG6A 4NHVA 1PB0A 4UQDA 4L6DA 1MEIA 2G4FA 3CIWA 1F7BA 2NSXA 4TX9A 3BCDA 1V7YA 2AKZA 4IWWA 5DBUA 1FH8A 1MFUA 4Y7EA 1H41A 2XZ7A 5AZ0A 1IYXA 1NDWA 1R9YA 3MCNA 1JEZA 3Q4DA 2ZKMX 4PFHA 4TMCA 3J7HA 5C7VA 4MDOA 4GLEA 3VA8A 2E9LA 4HOZA 2B4GA 3NGJA 1NM9A 4HNCA 1OYBA 3M4HA 1ZS2A 4AYGA 4C60A 4DPQA 4IMAA 5AYZA 5ABHA 2NVDA 4IL2A 3EMZA 4EF8A 5A6MA 1R87A 1CENA 2G8ZA 1E73M 4JQAA 5EYWA 3DECA 1DWFM 1JUEA 2GVLA 1F5ZA 4YWIA 1U5JA 3A21A 3TJ4A 2PB1A 5TQLA 3IK2A 1WQ5A 1R6WA 1HTIA 4E3VA 4I9AA 4GH1A 1NELA 1XUUA 5HMSA 4JN8A 4HYVA 3S2NA 2C91A 1A4LA 1W17A 3ELFA 4IM4A 3LCGA 1RP9A 2ZRZA 4DZ5A 3FKRA 4J3TA 1FBAA 5AECA 3POCA 2FVKA 4A8NA 3GVWA 3RJXA 4DZHA 1YDYA 2O7SA 4W7VA 3DZ1A 3SY8A 2R82A 5I3KA 3VOIA 3I6RA 1Y0EA 1EYWA 3SB0A 1B1YA 4HYRA 4OT7A 3HPSA 1S46A 1BWVA 3U9IA 3TFXA 1FWTA 3PG8A 1XV8A 3R0KA 4X2RA 1PIFA 3JZEA 2WCSA 4G56A 4H8HA 1EFZA 4N4QA 4HJWA 5LA2A 1I2PA 2IPWA 3N04A 4HMNA 5XINA 1MNZA 5L9FA 3RNDA 1JQVA 2GUYA 5HR7A 3TCSA 1M7XA 1J93A 3E0IA 5C55A 4NZJA 3P8JA 4EAYA 5IHRA 4S1FA 1HF6A 5LNSA 1E70M 2ZZ5A 3PB0A 5FL0A 4N42A 2QJGA 4EF9A 4KT2A 3N12A 2ZX7A 3DHFA 3WNPA 1JZ4A 2D3NA 4F0KA 2HBXA 4NU7A 5LIYX 2QGYA 3TMLA 1DJIA 3U5YA 5ABFB 3OEXA 3QOMA 3W75A 1BKHA 2I17A 2FTWA 4UOJA 2J7GA 3HGJA 1H51A 4BS0A 3LD5A 1S3HA 4H3DA 3BDKA 3UBPC 3Q45A 2V5DA 9CGTA 3ZSTA 4K7YA 2BOEX 3U57A 4PMOA 2D2GA 2QDEA 3SECA 2BNJA 4KFNA 3NL5A 1GPFA 2W4XA 4HJFA 3WD0A 4US5A 3CLMA 2Z24A 3QH2A 2P3ZA 3FJNA 3E0LA 1CBGA 1D7FA 3MC5A 2OVLA 5BXTA 2I16A 1ONRA 1PKNA 1S5WA 1J2WA 1GCYA 1L8NA 4ATWA 3FN9A 2ZUTA 4HB7A 3UWWA 1YTEA 2H8ZA 4YHGA 5AKQA 1MW0A 4JQ4A 4YYCA 3UY7A 4IJRA 1EO5A 4HSOA 3SRHA 3NL2A 1Q6OA 1ZALA 3MUXA 5CC3A 1GT8A 3AROA 3LG3A 2FIQA 3UZYA 1PIIA 1FUYA 5I7GA 1WXJA 1ITUA 5U4NA 1DYSA 1XYFA 1P0BA 2Y7FA 1AZ2A 3H2EA 4ALDA 4GI4A 2ICSA 1DWGM 1GOOA 1IXOA 2YCJA 3B9NA 4NY2A 4YCPA 4GY7A 5IOBA 1GEHA 3JVAA 1NFBA 3TQKA 3OIHA 2OLAA 3P84A 2QF7A 4H6RA 4C6EA 2Y7GA 4AZ5A 3TOYA 1A0DA 3N2CA 3ATYA 3HG2A 3R5EA 1A5AA 1XYZA 1I0DA 2V3DA 2VEPA 2CESA 3UA4A 1HGYA 5D38A 3PR2A 1XYLA 2PMQA 3FGCA 3HFYA 2CNCA 2V63A 4QQ3A 4O1DA 2VC7A 3W1XA 4UTWC 2YB1A 1XP3A 3EDJA 4EXAA 4KEVA 2CEQA 2VNCA 4JAWA 4Q4OA 3WQ5A 4N4PA 2V3FA 3VE7A 1G4EA 1BHGA 4HCHA 1YRRA 4OBTA 4M81A 1CI1A 2O9RA 3QW3A 2A7RA 3ZZ1A 7XIMA 2IPFA 4P8XA 2C3ZA 2VOTA 1GQNA 1S2AA 4EE9A 4W89A 2DT1A 3AXKA 2GUUA 4Q6XA 4MVAA 3KOXA 2Z6IA 4LEFA 5A6TC 1M68A 3SQMA 7ODCA 3VI2A 1C8QA 2NXHA 2QV5A 3PNZA 1S5NA 1PS9A 3IK4A 2YBTA 5EMYA 4JNZA 3G24A 4B3ZA 3WDHA 2OKOA 3OLDA 2EPHA 1F8IA 3A9IA 3BWWA 4QAIA 4ZEPA 1NF7A 4H8VA 3GHTA 3VKCA 1F6YA 3QY6A 1UMYA 1F73A 3PZUA 1DIOA 1WZMA 3N13A 2F6KA 3O1NA 2G97A 2VDIA 1TZ9A 2YBVA 1DTNA 1OFEA 4JNYA 5AB3A 1DQUA 1YDOA 1BSIA 3S5NA 4FXJA 1FKWA 5A5WA 5AZ1A 4J9JA 4NVTA 4E3TA 2OFJA 2BOFX 1BYAA 3MZNA 4REQB 4RUBA 2QCHA 2VGGA 2V3GA 3ZT7A 1KFWA 2NXIA 4WJEA 1P4CA 2NWSA 2PWUA 3FDKA 3CO8A 1ZSXA 3THUA 4XISA 5LYRA 3FK4A 3GZAA 2QCDA 4AVFA 3HFTA 3FJ6A 1QCWA 2BY1A 3APGA 3CV6A 1LP6A 4BEQA 2RGLA 4Q22A 1BWKA 2PTYA 4PEEA 1BXBA 1RQHA 3WIJA 4WDTA 1QI4A 3NDYA 1R2TA 3RGTA 1AK5A 2PC8A 1WX0A 1V6WA 3QLLA 4RNJA 3N6JA 5MKGB 2PE4A 3IIXA 5HUOA 1XBXA 4GMEA 2ZICA 1J8VA 3W7MA 1KGXA 5A6SA 1IR1A 2Q8LA 2ALRA 1W32A 4PH6A 4S3BA 2OT1A 2V2CA 3WELA 1RZMA 4HTBA 3IGHX 3G1SA 3W24A 3O05A 1QK2A 3KW3A 4G2DA 4AQLA 1TJ2A 3KBJA 4GIAA 5JBDA 1MUWA 4ZO7A 4GIEA 4H1ZA 1GOXA 3R8RA 4C90A 4IMDA 1LBMA 2PWVA 3CIVA 3KCLA 2QS8A 1ZHAA 3NO1A 4N6EA 3N3MA 4UCGA 4TUFA 3L2IA 1F3XA 1TV4A 2A1YA 2R8WA 3MKVA 3TN5A 4NIRA 4C6KA 6REQA 5G4EA 3AHXA 5E5CA 3T7VA 3LCFA 4WRHA 4HA1A 1NOFA 4UXDA 2BVYA 3B0YA 3H7VA 3W76A 1GVSA 1S1PA 5D33A 1ZZMA 2A3HA 2H6RA 3WBXA 3UXLA 3URBA 1XD0A 1UR8A 2VR2A 3ABSA 4ZTXA 5AC5A 1E0XA 1PZ0A 1LT8A 1BTMA 2Z1KA 1E1EA 1Y5XA 2DZUA 3TTEA 1QI2A 3CB8A 3F4NA 4W5ZA 4M5PA 2DDXA 4P8VA 4PMUA 3QV9A 4M19A 2XGIA 2WMKA 1WDDA 4LUSA 2BDQA 4YPJA 1AJZA 1PUDA 5LNVA 2GJLA 2C13A 4DJEA 4E0CA 2EJAA 4C6OA 3MWCA 4O8RA 3NQVA 1XSIA 3GXIA 4JYEA 2ZUNA 3RHGA 3SAZA 2Z2BA 3BMVA 3PUDA 4FSAA 2YGYA 1ZENA 3VNYA 2XIQA 3DFOA 4LVAA 3S9YA 1G4SA 3LHYA 1NTHA 2JEQA 5L6UA 1UP2A 5E70A 5EFFA 4PYSA 2QR6A 2VQUA 4E4PA 4JTIA 4AZ7A 3TXZA 1TV3A 3DBPA 4XB3A 1TJ1A 3BSGA 3OGRA 1HJWA 4HNNA 1MI3A 2NZLA 4NX5A 2CLIA 1XIMA 4MPKA 3E5PA 3QJAA 3CK5A 3PTMA 1RY0A 3PPFA 3NZGA 2G50A 2O92A 4HHLA 3EPOA 3MJYA 3UXDA 2V5JA 3S2CA 1EO7A 2EEXA 3R10A 2XU2A 1MWOA 4DO5A 3MI6A 4ZSTA 2GK1B 1IZKA 2WW5A 4NI3A 1KBLA 3LERA 1BG9A 4L80A 1OIMA 1WOBA 1PKYA 4V27A 4E4FA 1T8QA 2YDQA 4LBRA 3UR7A 1RVGA 2BVTA 1QOQA 1Q4WA 3U2OA 1DXFA 4X3ZA 4DJEC 1KWGA 2ZUWA 3UA3A 3ENLA 4D72A 2ZUUA 3C4UA 3CL7A 4F2TA 2NV1A 3NPWA 1Q2SA 1DJZA 2J79A 4Y9PA 3P5ZA 4GRSA 3S1UA 1F07A 3W2JA 2UWFA 3AZRA 1VC4A 3WH9A 4D6JA 1UBSA 2GGEA 2WJDA 3UGVA 3GVRA 5F2MA 3WQDA 3UG3A 5LHEA 3D3FA 4H8NA 5F4WA 2OO6A 1A47A 3STFA 3UNDA 5JQ9A 4ZOEA 3R25A 4KGLA 1I8JA 5T26A 3MI2A 4DLFA 2XSBA 2OGYA 4IPJA 3ZIZA 1HNYA 3G0UA 3LBCA 5I3GA 2X2YA 4OWGA 1PTDA 3NQAA 1VFFA 3DIPA 1PX4A 5C54A 4RV8A 2WKGA 1Q6CA 5IXEA 4B90A 1W2VA 4E38A 1WB0A 5A6BA 1BGAA 2VX7A 2J8GA 1W3NA 1I75A 2V2HA 4KQNA 2PWEA 3T08A 4GWEA 4NASA 4IX0A 1UKOA 3VD5A 1VHNA 2PRLA 3AXMA 3W25A 1CYGA 4AZCB 4LVFA 4ZBCA 4RNFA 2OEMA 4LVBA 3PZNA 1POJA 3ECQA 1UR2A 3VZXA 3LHUA 2FJUB 1EOKA 4ZA0A 1B31A 3U4AA 5CZKA 4WXZA 4C6PA 2VZTA 3PZVA 2JQXA 1XM3A 4GUFA 4HSNA 2J9XA 2GOKA 4BWLA 3GKAA 1FP8A 2ZZ2A 1G0CA 4ASTA 4MUPA 3GAKA 3AHZA 1K7XA 3V3WA 1HJVA 1JYVA 3WLQA 2ALDA 5CSYA 1V6TA 2OLHA 3NNTA 2WC4A 2YDRA 3CHVA 3W2LA 4KIRA 4HNOA 4QIUA 3MVIA 2QQ6A 1KM5A 1OFAA 1GVYA 3HOJA 4NILA 2HVMA 4JY9A 2TODA 3W6MA 1VBUA 4E5TA 2EO7A 3PAJA 5E9AA 3LTPA 3ARRA 4IIEA 4HZ8A 1WDQA 1OK4A 2BODX 3MS8A 1QFEA 3FVMA 4KERA 2ZWZA 1NOUA 2PCEA 5HOSA 1QAPA 2XGZA 3EWBX 4G7FA 2HBVA 3O6CA 3TVAA 3I3BA 3VOJA 1F3EA 4GYPC 3OHMB 4PUEA 3MDWA 4KH2A 2WNZA 3DOPA 3GU9A 3URAA 1ODUA 1I0BA 4AC1X 4HZMA 4DXKA 3PWGA 5FAGA 1B9BA 2CXGA 2PRMA 3A24A 3KCOA 2WMGA 3S46A 1H1YA 3G3MA 3TA6A 3S6TA 1OX6A 1XD1A 1XFBA 2XFFA 4Q4PA 3H55A 5XIMA 3TC6A 3PJWA 4LS0A 1HL8A 1R7AA 3NJ3A 3ZYZA 1FWDC 2YZ5A 4JKLA 3TYDA 1GPWA 1SW0A 3IIPA 4MZ1A 2GL5A 1W1VA 2TSYA 4ENLA 2YW3A 4O52A 4J2MA 2RJGA 1Q45A 1H5VA 4C91A 1T41A 2VC5A 4R7JA 1JCLA 3C0JA 5A8PA 4IMCA 4HK5A 1JGMA 1W54A 5DQPA 1V5XA 1WKFA 3VUPA 3SCWA 2ZBTA 2WVSA 2CLPA 3NUKA 1XKJA 2PDGA 3G2GA 1W9PA 5LNWA 1V4YA 3TZNA 3W00A 1P5BA 3H2MA 1HQTA 3GHRA 4H9TA 1X7IA 1GYMA 3GNPA 3NSMA 2ESCA 4TV5A 1KW1A 1S38A 4QCFA 2O4MA 3LX9A 3OU8A 4J7RA 3O3RA 1OCQA 1OY0A 1GYNA 1H7NA 3LTYA 1XLCA 4KBXA 3H53A 2C16A 4LPCA 4LC8A 5G1MA 4FP1A 1LZOA 4TMBA 5A69A 2ZRWA 5KTLA 1XFCA 2V9DA 3QC3A 3N17A 1OGGA 4CNPA 1JPHA 3W72A 1AJ0A 5GNYA 4MAVA 2OWXA 2VZOA 3QPYA 1UOZA 1W1ZA 2VX4A 3W22A 5A2AA 1ZBCA 1R46A 5HQMA 4FNQA 2V68A 5I6SA 2VM8A 2CLKA 4I8YA 2H90A 1F2JA 3QR1A 1OFDA 2Z2UA 2BG5A 2VC9A 4WD0A 1W91A 3LNMA 4J2PA 3TTOA 1AFSA 1E9YB 5IBXC 3AC0A 4UR9A 3UCCA 3CNYA 1YDNA 4M24A 3E2SA 4AU0A 1J18A 1Z44A 3C0QA 3N4AA 5AHEA 5G4WA 3P3BA 4WKHA 1UR0A 1H1NA 1T7LA 3WFZA 3AIEA 3AI0A 1WDRA 3SJNA 5I3HA 4FLQA 5D04C 4NKCA 3VINA 5HNNA 5CQ1A 3S1GA 1H0IA 2H3BA 3HQOA 3M64A 1E0WA 2D24A 1NSJA 3NQGA 2FDSA 2I5QA 4GE8A 2VDGA 2ZUVA 2R91A 5IRPA 2Q01A 5BWFA 3B8DA 1WZAA 1F6PA 1ISZA 1MW3A 3C86A 4LJ3A 4GKLA 1NOWA 4EPDC 4ZXLA 1X7FA 4QRNA 1DJGA 2Y85A 2EG8A 1VFOA 3NIYA 3LHWA 1H7WA 3NM3A 3S2LA 1N7KA 3B9EA 1IEVA 1Z7AA 1RD6A 3GZ3A 4EIVA 1AW1A 1US2A 3LS9A 2GGJA 5A6LA 1G7UA 4HNUA 3VZYA 3AYRA 3BJFA 1AD4A 1GOKA 1GOIA 1JDAA 1RK6A 1M5WA 1EJSC 3BW3A 4B5TA 5JXQA 4A3RA 3MV11 5FA5A 1CGUA 2R1PA 4AF0B 3O6AA 4RNIA 3LBMA 2CBUA 2Z0IA 3A12A 5HUPA 3KHDA 4AISA 3GHSA 2VO5A 3W1TA 1ADSA 2D0GA 5AC4A 4OQVA 4GINA 4H7ZA 3M5ZA 2W9MA 3PC0A 3NDZA 3WQCA 3W1QA 2XVGA 2PZNA 1R47A 4H2HA 4O0KA 1E9LA 4PC8A 3W2UA 2ZRXA 1RR2A 1QATA 1WYIA 1MUMA 1FWWA 1AQMA 4PULA 4O1CA 2PDCA 4PRWA 1J0JA 4WDUA 4RW3A 3NQ2A 2BP1A 5GNZA 4WK9A 4IIBA 1L6WA 4AEOA 1KKOA 4U3AA 2NQ5A 2OOGA 1ZJHA 1G4PA 3B0UX 1XPYA 4XZHA 4F0LA 3USBA 3RLHA 4LXFA 2IPJA 4Z2JA 3PJTA 3RU8X 2C6QA 4MMWA 4UNLA 5A6KA 3HGSA 1FTXA 3CH9A 3NPUA 1X8CA 2WZHA 3LBOA 4MKNA 1LYXA 3G1HA 2Z27A 2GSJA 4CEXC 3UWZA 4E8CA 1GTEA 3LPGA 4W9TA 3BOLA 1IEIA 2BHYA 1GVIA 1Q65A 4CCEA 4ZE5A 1S2WA 4XD3A 4O54A 3NURA 1ME7A 1JUKA 4JIRA 1KFEA 1XDJA 1A5KC 4BI7A 1TSIA 4QAWA 2WMHA 1HJUA 1WAWA 1XLJA 5A2CA 2R1MA 1VCVA 1XIJA 3TCEA 4XTIA 6CGTA 3N2BA 4FX6M 2XIOA 3O06A 3CYJA 4Y90A 4ZO8A 4ACZB 2OT0A 3GYEA 4A22A 3BGJA 2OU4A 3G8EA 4GJIA 4CN6A 3WN6A 2DH3A 1VBRA 4A6GA 3QSRA 1HGWA 3WH7A 1WCGA 1J10A 3TW7A 4XAGA 3PBWA 1YBQB 3BURA 2Y24A 3LLDA 1NP2A 3KL3A 1WKDA 2GQ8A 3N1AA 3PPCA 1QW9A 3HMCA 1OT2A 2BHZA 2O0TA 4JDBA 3LUTA 1JZ8A 5DELA 2VFEA 3M0ZA 1UWAA 2D22A 1BYBA 4GX8A 2AQVA 3SCRA 5KZEA 3W7PA 5E0CA 3EWDA 2D2OA 4P61A 1OFQA 4ZQNA 4YVPA 1GVOA 1YLVA 1W3KA 1OBAA 4H9VA 4B92A 5I03A 1OHLA 5LIWX 5DCBA 1P6WA 1LRQA 1MUCA 2Z1XA 1ZJAA 1KBJA 1ZQ5A 3VGGA 2CHRA 1F74A 1CWYA 5D2XA 3ITOA 7A3HA 3DFNA 1VEOA 3RMEA 3P0WA 4GY1A 4PBFA 4WSHA 1VFLA 3HGOA 2ZX6A 4GYJA 4UWMA 3LPOA 2QVNA 4M1BA 3QN3A 1Q6EA 3H54A 3BE7A 3C0SA 4MJMA 3SBFA 1OQFA 2AGTA 1V77A 3TJIA 1NWRA 4DBWA 2Z26A 3RF9A 5C70A 1SJDA 3LGEA 2E77A 3LGDA 4JIPA 1UPPA 1XRVA 3ZQ9A 1A5UA 3AJ7A 4J40A 3AU2A 1SYTA 3ZM8A 1AL8A 1LJYA 5DRCA 4JTDA 2QUNA 3KTXA 4WF7A 1VHCA 3M16A 3LLFA 5I09A 3EKZA 1OC7A 2YLLA 5D2WA 3HURA 3CASA 1CLKA 1S2VA 4FNTA 2H9AB 3NQ8A 4C6BA 1JL8A 5A8GA 1EH9A 3LHTA 2HS8A 2D20A 4C5YA 3S2JA 2D0HA 4TIMA 2ASHA 4WLCA 4GI9A 2WM0A 4OOUA 2PLJA 5CLWA 4UQCA 3I7QA 4AZBA 3JR2A 1VGAA 3QFWA 1ZJIA 4H9YA 3OJGA 4GO8A 4WKFA 3W7LA 3NQFA 2GJXB 2P8BA 3GBDA 2PZ0A 2AL2A 3TMQA 4ZR8A 3B8IA 3MHFA 3DBNA 1AMKA 3S1VA 3HG4A 2IQTA 2CU0A 3V0UA 1DE5A 1NWTA 2J8TA 2X2GA 4KCWA 3PBVA 1QNSA 2PD5A 1XW8A 4AIEA 1MQRA 1LLWA 1RAKA 3M6YA 1O1HA 3LOTA 4LS1A 1JF6A 2Y6ZA 4UFLA 4BFAA 1BRLA 3W7RA 4AHPA 3TTYA 4E8DA 4HA4A 2W0UA 4NAFA 3DYMA 4FS9A 4NJJA 1THFD 3ORWA 5HBFA 3G0SA 4TVUA 2J9ZA 1EBHA 4JTGA 3TQ0A 2BZNA 3WLIA 4Y96A 4UOZA 2RAGA 2C71A 2NV9A 3LK6A 1CB7B 1CGXA 4ZFMA 3ID7A 1K4GA 2RKXA 1UWUA 5ECVA 4DWDA 4MYAA 3A3HA 3B3DA 3HM7A 3OVQA 3R8GA 2X1UA 1M7PA 1VYRA 3R79A 3BICA 1U22A 3EWWA 3PPGA 1O5RA 1TYGA 4RDVA 1JNDA 1CT5A 3CPUA 3WD3A 1XRTA 4GPNA 4GBUA 1A5MC 2QUVA 3VIMA 3WQVA 3BLDA 2YCIX 3UP8A 1BXCA 3BG9A 2TPSA 3A9BA 5HWMA 1P48A 1ICQA 4FEZA 5BXPA 3PUEA 3SO7A 2O55A 2VFDA 4I6VA 3ME3A 5BW6A 3AIUA 5D37A 4H04A 4BI5A 4HHMA 1O60A 3TW9A 2AMGA 3GTHA 3IACA 4Z2HA 4HPGA 1EEPA 1FDYA 3KM8A 2ZUSA 4GNKB 3WQEA 5GJMA 5KETA 4QISA 1KXQA 2XN2A 1WXZA 1Z32X 2PLCA 4UR7A 4S3AA 3QY7A 2VFGA 4JL2A 4DI9A 3PBMA 1V6YA 4LC6A 4JTFA 3ES7A 5K9XA 1W31A 4XO7A 5CSSA 2J88A 4WSKA 2RDWA 2YLAA 1DJQA 2ZIDA 3BAWA 4A29A 1CIUA 1FX6A 4OUEA 3BMWA 3T07A 2OOFA 2NQZA 1XSJA 4P7OA 3MHUA 4Z42C 4L1XA 5BOFA 3IJLA 3CUHA 5FIPA 2E7FA 4LX4A 5DMMA 4F0SA 3BO9A 3D6NA 1TRIA 4UB9A 5EGRA 4C1KA 3HIJA 2JK2A 5FJUA 3B8SA 3LDVA 3GXPA 3SUSA 2WC3A 4HTYA 1OX4A 1T99A 1XG3A 3W1NA 1V0MA 4I7WA 2GLKA 2CKRA 1Q6DA 4FA3A 4L6HA 3TQVA 5BOEA 2QJJA 5TNVA 5CZJA 4C7FA 4CU6A 2WO5A 1TR9A 2W3ZA 3QHOA 4G1NA 4ZB0A 4LVGA 3R43A 4JYFA 3WJZA 3VM5A 5AC6A 3OQEA 2A0NA 3N2OA 3M47A 3BZJA 4L9YA 1GVQA 4I5RA 4JFUA 1IZCA 4PUDA 3DAQA 2YDSA 4KCTA 1K9EA 2J24A 4NNAA 3C2OA 2WZTA 3L23A 1AH4A 1E1FA 1MDLA 3S5ZA 2FMOA 5I79A 3PSVA 3BG3A 3A3XA 2X0SA 2PWGA 3FJLA 4CCCA 2QT3A 3BSHA 3QM3A 5CAHA 5EA9A 3AHYA 4Q7NA 4NAEA 3VD4A 1P7TA 1C7TA 1X96A 4ML9A 4H4IA 1HKWA 1SFTA 2Q3RA 5LGZA 4WEVX 5CSUA 1TREA 1KD0A 1DKWA 2I9EA 4M80A 5J5DA 1J5SA 1XIHA 4G9PA 1TQXA 4LV9A 4YWSA 1W37A 1JCYA 2DUXA 3LI0A 4QJ3B 2BSLA 4OOZA 1IHIA 3CU2A 3FGCB 2CLOA 4ADUA 2J7BA 1TWSA 4JCMA 3BG5A 3GXDA 3PUOA 1LM1A 2YL5A 3TLLA 4UCFA 4LS2A 3TC3A 3E96A 4D6FA 4GFSA 1XF0A 1NWUA 3TKFA 3O07A 1J11A 3ZJKA 3WLLA 2PLKA 4F2BA 4Z1AA 1R2RA 2GGGA 5KZ6A 3RITA 3KLKA 2WM1A 4LUTA 3MJMA 3TV8A 4UUIA 4JTJA 4Z08A 1G69A 4OJYA 2R1NA 4ZTYA 1TMHA 2BWGA 1JAEA 4A2RA 1ONWA 1BXNA 2UZ9A 4JNMA 4ZO6A 4KWVA 1PWMA 3WDJA 3EX6A 2X0YA 5FJRA 2HPMA 6PTDA 1BVZA 1OD0A 1R85A 3F7JA 4I5UA 3HV8A 2C15A 1TTQA 4RPPA 4ZODA 3VGDA 5B7ZA 4CCDA 1F4HA 3QGAC 1A4MA 1V3KA 1LTDA 2F2HA 7PTDA 4KEMA 1K1DA 2E40A 2XGBA 3IRDA 2UY4A 3ZVHA 3WX7A 2VR4A 4WR3A 2XIJA 1QNQA 4WJXA 3TYCA 4QSHA 4PUMA 3CS2A 3QR0A 2ATSA 3PNUA 2GPTA 4LWWA 3LCLA 4HPNA 3ZXWA 1AQ0A 3MCMA 4LB4A 2YW4A 3N11A 1OZMA 2NX1A 3KXQA 5EMUA 1XLDA 2DIJA 1L6SA 2EF9A 1Y65A 4PCNA 2ZC8A 4W7WA 2QCDB 3H2FA 1CXIA 3FXGA 3I7SA 2I14A 3VNZA 3FA3A 1XLLA 3NQCA 4GVIA 3PWIA 3OHIA 2PSNA 4Q8OA 3FVDA 2E5BA 2NX3A 4DBSA 1V93A 1GQIA 2ZX9A 3UJEA 4IHCA 2XINA 2VEIA 4G6CA 2GQ9A 3W9ZA 1PBGA 1OX5A 2BB0A 4DYJA 2BXYA 1ELSA 1PHQA 2V6AA 4FNPA 1O4UA 5K4XA 2ACQA 1RK5A 3B0VC 3HMJG 1RHCA 2JGQA 3U0HA 3EDFA 1EA0A 1YNYA 4D6EA 5FACA 3B9OA 3W2KA 3KEHA 5HWJA 1A5SA 3IGSA 1AODA 4QP0A 3RUBL 5AFDA 3WQ4A 2DZVA 2ISSA 1L2QA 1KTCA 3WDRA 1W9BM 3ITTA 3D3AA 4WCJA 2ZQ0A 4ZFCA 3REQA 1V0NA 3S5YA 2W63A 2YL8A 4LEQA 1XYAA 4PTXA 4IMGA 4FOUA 4B5UA 1KV8A 5FEPA 1KFLA 3FW6A 2CERA 2G3MA 3H7RA 1XSKA 4QE4A 1EGVA 3HU7A 1HL9A 5CC6A 1UJQA 4W88A 3B9DA 3F2BA 3S6OA 6REQB 1W3IA 1VCFA 4KS0A 4EKJA 3GVGA 3TEVA 5I00A 4JY8A 4NZCA 4AWSA 3L66A 1OC6A 3KCJA 5D02A 4AY8A 1SW7A 5I07A 4U5KA 3OBKA 1GNXA 3GR8A 3DC0A 3AMLA 2GJRA 4WXYA 3YPIA 1SVDA 3DU0A 1FH9A 3PZTA 1JPMA 1UBPC 3KRZA 1QI3A 3GDKA 3BAYA 4TV6A 2VC6A 2OEKA 2WMJA 4JTEA 4QS5A 3RCYA 3BLIA 4LUSB 1Q63A 5TAOA 1CEOA 4IFRA 4V15A 1GG1A 5A95A 2OSWA 3DI0A 3NL6A 1G1YA 1UMLA 3S2MA 2V69A 1ZAIA 4U2YA 1W1PA 1H1ZA 1XI3A 4IGHA 3QEZA 3VPLA 4DBEA 3QPEA 3IGXA 4I7UA 3GYCA 3W7QA 4JGDA 3I3EA 1YIXA 2GJNA 2INFA 5FD0A 3R89A 5FF4A 1A5NC 5FOOA 1W56A 3HPXA 1U1JA 6XIAA 2BXZA 4KEUA 3U2EA 3QLDA 5CPSA 4FIQA 5E0KA 1SZEA 3VIJA 2GUBA 5I77A 3SW6A 4JTAA 3CQHA 3W73A 1VFTA 1NARA 2W62A 3SFKA 4JD4A 4UOQA 2AL1A 5I5RA 3V36A 3SJ3A 3ARZA 4JFSA 2WXDM 3TXVA 5AN7A 3I4KA 4CNTA 3Q94A 1XJBA 1CLVA 5BRBA 3N2MA 3AHVA 1WDSA 2J62A 3QYSA 4V33A 1G4TA 1M03A 3SURA 4OFCA 1UASA 3T1GA 1XH2A 4XZWA 1RPKA 3U4FA 2OG9A 1TR1A 2PGRA 3M0VA 3AS2A 2BY0A 3W1PA 3LPFA 4Q8TA 5GQBA 1JCNA 1TX2A 3K30A 3N15A 2ZZ1A 5LIUX 5BCAA 3LV6A 4PMYA 2QUMA 1EHNA 4URIA 3WLOA 3BUVA 4IIDA 5EL1A 1SU5A 1PZ2A 1EZ2A 3IGUA 3L5MA 5C2XA 5IDIA 1E6RA 2Z7KA 2YXOA 3S1XA 1DJNA 2OODA 1GOWA 1V3IA 3O0KA 3RX3A 1M41A 2FYMA 2EG6A 2L5HA 4H19A 3VNLA 3UPMA 4JQ1A 1VPXA 2G5WA 2Q3OA 2KZHA 2CWNA 5MF5A 4J3ZA 1UD4A 1RCXB 2CW6A 4HP5A 4UNKA 3AWNA 2E25A 3KE0A 2IMRA 2PDMA 2OELA 2CHNA 2NQHA 3M6DA 4YVXA 3LPPA 1NP0A 4LANA 3WMSA 2WSYA 1E0UA 1ZU8A 1WXYA 4DF0A 5HATA 2ONEA 1MFVA 3P5YA 5DY3A 2O9OA 1US0A 4IF2A 3QOKA 1GTHA 2EG7A 2F6UA 1OINA 2VFFA 2W66A 4XBJA 4C1NA 4MKVA 1KXVA 1ISYA 4W85A 2Q8ZA 3C2FA 1KCZA 3CHCA 3DYOA 2QXWA 1AMYA 2D2JA 4OV9A 4F2UA 1DORA 4YTRA 4LRSA 5DX7A 1VBJA 1J12A 2FPYA 2QCLA 2QKFA 4RL3A 4RCXA 4RE4A 3IIOA 3GH4A 1QWGA 2C1GA 3S3GA 1MQQA 1TQJA 3URNA 3VNJA 5LNRA 4PUWA 2HK1A 2HVNA 2DSKA 3FA5A 4Q32A 1J9YA 4UFIA 1F6KA 5CAKA 3MP5A 3UZZA 4ZSUA 4MWAA 2HZGA 4IPPA 3GDBA 1QPRA 1H7XA 3TJXA 5E9XA 1GOMA 5E1QA 3T0CA 3WD2A 1D8WA 5D9PA 1UC4A 4H01A 4FR6A 4KRUA 3N2XA 2YL9A 3ZVIA 2A3CA 2D2HA 1N55A 1EGMA 3AS0A 3V4BA 2DJXA 3T0AA 5CGQA 3M0MA 3KRBA 1Q13A 4ECLA 1FWFC 1SZNA 3H22A 3FIGA 1S2CA 2BHUA 3VMPA 1ML1A 2OZ3A 4DX3A 2ZZ6A 4K6AA 2WMIA 2C18A 5M2FX 3RO6A 1C93A 1TPUA 1PTGA 4XZBA 2O9PA 8RUCA 1ZP4A 2E28A 3W82A 3MSGA 1EJVC 3ABQA 4P5UA 4JTTA 3CXOA 1B5TA 4HT3A 4J3UA 1T5AA 1OCNA 4C5ZA 4WGXA 4QITA 4JTSA 1HFBA 4FXSA 3G1DA 1ONEA 1QXLA 3RIKA 3QZAA 1J0HA 1NDZA 2OJPA 2X16A 4BZYA 2BLEA 2MNRA 3OO2A 1H61A 4B3LA 4XO6A 3HTWA 1RY8A 3FV9A 3GY1A 1KM2A 4AIOA 3UU0A 2G37A 3QW4B 1NDVA 1KRAC 3WF3A 3KBNA 1AUSL 3WCZA 1VFHA 1XG4A 5IDZA 4MWAD 3W70A 3EOSA 3LCXA 4MB5A 2PBGA 1ZB5A 2ISFA 4XAYA 4OTKA 3EAUA 4CQDA 3UNTA 4PSPA 3EPMA 1IXPA 3BLKA 4JTQA 4OVXA 1TPC1 2J7FA 4GABA 3RRAA 3FY1A 4WX2A 4XK2A 2XISA 1P6BA 5C0QA 1SUXA 3MDUA 4YLWA 4G5DA 5M5DA 2FZ9A 4Y6GA 1SQ7A 3P93A 1TWZA 4MDPA 3SQLA 3KZPA 1S2UA 4H9ZA 4NUWA 2YCEA 4EP8C 3T09A 3KVJA 2RJHA 4CQCA 1QW8A 4UTMA 1JCJA 2WNNA 4HGXA 1KBIA 4UQ9A 1T40A 5LSMA 2J7CA 1BQCA 3F4VA 3WO8A 3GK0A 1TVPA 3N9RA 3TU9A 3EB4A 2XH0A 2VUNA 5C9RA 2GVYA 3NEVA 4FNSA 1XWYA 3ZWTA 1UWQA 3HBLA 5CBJA 4IP7A 3BC9A 3GXTA 1J0KA 2EKCA 3U5UA 3PPHA 2FGZA 3F1QA 3WDQA 2E0PA 1K7EA 3WBEA 3GUGA 3M07A 2BTMA 2J25A 2F84A 4XKYA 1VS1A 2E3ZA 3KDNA 3BW4A 3E38A 2VTFA 2GQAA 5DMYA 3PP7A 4K8HA 4E8GA 4WKAA 3W2MA 1WDWA 1E6PA 2TRSA 3U2CA 2E6YA 1WP6A 3HJEA 4DAFA 2DVUA 4ZOBA 1W1A1 1B3XA 4NT0A 2GWNA 5F7UA 3IIZA 3P60A 5EMLA 1VFSA 4DPPA 4BA0A 4N9CA 1SJCA 1LRNA 3VIIA 3IV3A 1UW9A 5TF0A 2Y5EA 3BOFA 3P8IA 3U7VA 3UXKA 1MRAA 4YXGA 3FOKA 2DY3A 1QWKA 3AMCA 4HPXA 4K68A 4CVUA 3KFTA 3Q67A 4KW2A 4IMFA 3QXBA 3UPWA 1AH3A 4S2CA 3VXGA 4XIMA 3GC5A 1Q7MA 1NWSA 1BYDA 4LRTA 4FR1A 3ZFHA 1SSGA 2RUSA 4UTFA 3GXMA 3T42A 4O1FA 4Y9OA 4DY1A 1W8GA 1LRTA 4NF7A 3JZUA 5BMXA 2FMNA 4IFOA 2YB4A 3I7RA 3U3HA 3M0JA 3QMTA 2DP3A 3W0KA 4TVCA 1HKKA 1Q6QA 4ZL1A 2FZBA 3WLKX 2YOCA 2CZVA 1AL7A 2X41A 1OZQA 1KA9F 1E4LA 3GU1A 1N8IA 3WL1A 1BD0A 4TO8A 3KBVA 3LQLA 1B9ZA 2HNHA 1TKKA 3L4WA 4NRRA 2E9BA 4JKMA 4DELA 2WAGA 1K6WA 3N3TA 4TOQA 3VNMA 1SGJA 4XBKA 1KB3A 2GWGA 3W6YA 5A1AA 2QV4A 1FCQA 3LNPA 1TPVA 2OX4A 5E93A 2PEVA 3DUGA 1OIFA 1R7OA 3IJ9A 1W9VA 4H41A 5HNRA 3OOQA 3TOPA 1L6YA 4LY4A 4Z1BA 2XVKA 1Y5WA 2EAWA 4MG4A 3IJDA 3TNOA 3E49A 4WQ6A 2IXVA 3LXBA 1QNPA 1UD6A 5HA7A 1A0EA 4DJFC 1QNOA 2I1OA 4F48A 1SW3A 2HISA 1U1UA 4Z1YA 3HQNA 3F2DA 1W9UA 3G1FA 3VFLA 1LOSA 2DQXA 1KGUA 4O53A 1UH3A 4OIFA 1UKTA 2B31A 1VJZA 4DM2A 3GFXA 1ZLPA 4MB1A 2A6LA 1U5VA 3ZR5A 1PCKA 3ITGA 4ICCX 8TIMA 5JH1A 3WBWA 1LDCA 2GGIA 3S5OA 2HCVA 1PO9A 4EX4A 1GZJA 1PJ9A 1E56A 3R8HA 4PBGA 3P6LA 1I2NA 2A85A 1MEWA 3OVPA 4RE0A 3GXNA 4CD7A 2NT0A 2DZAA 1WZLA 4X22A 2R6OA 4AC7C 4MJ4A 3N25A 3LN3A 1OD8A 2DH2A 3WQ8A 4JHMA 3NL3A 4R34A 1VP5A 1O5QA 2QAFA 1E6SM 2OZ8A 1O12A 1GQKA 5FKYA 2X8RA 2ZOXA 4IJCA 3NSNA 2E67A 1X1OA 4H9MA 5LIXX 3WQPA 2BGNE 2A2IA 4ERIA 3ARSA 3K5XA 1KBKA 1U1HA 1UUOA 1QI5A 1W1YA 4PSRA 2I9UA 3GBEA 5FESA 2WB5A 2CHOA 1ZCOA 3WDIA 4RJEA 1RCQA 5K7JA 3IANA 3WL0A 2POZA 4K38A 1RQEA 4NX0A 1O5KA 1CGYA 2AMXA 4QDWA 3PFRA 1PVNA 4HBKA 1YXYA 2QDDA 5FJTA 5KZDA 2O56A 4S3JA 2F8QA 1JAKA 1V79A 3WKZA 4I5XA 1QOPA 2XM2A 2YA0A 2ACSA 3FX4A 3PS7A 4BK9A 2W61A 3CC1A 5EFDA 3B8VA 3ZLHA 4TX6A 1SFSA 1JF5A 3A4XA 3KTSA 4GX9A 4HA3A 3TYAA 2YKKA 1YYAA 3GNDA 2F2KA 4GD0A 4QNEA 5A6JA 2Z6JA 1CTNA 4AWTA 2PAJA 2ZZ3A 2Z1VA 4A8LA 4OBSA 4LTSA 1P1MA 2YR1A 3QBUA 2PWHA 2XM1A 2P0IA 4NXKA 2E6AA 3M5XA 2X42A 2E1DA 3M9YA 5FF3A 1HKIA 4X9SA 1SO5A 1Z3NA 4H6QA 4XSMA 4IXXA 1ZNNA 1GGOA 1C8VA 4O1EA 2J6XA 1UR9A 4HCLA 4HKPA 4OZOA 3WUBA 3G77A 2C19A 1XC4A 3LY0A 4O4WA 5CXPA 4HNLA 4KWSA 1X98A 2YCKX 4QTGA 3GIYA 4FIRA 1Z8AA 5A8OA 3B8UA 4UTTA 3K4AA 2VR5A 2QIIA 5HJYA 2VZUA 4R88A 3GNRA 4PBEA 3E9AA 1S39A 2RFGA 4MUZA 4TVDA 2D3LA 4FLSA 1ZAHA 1QPOA 1RCOB 4UQBA 3QZ6A 2QNEA 5AYBA 3TH6A 4PTWA 3WNLA 2AL2B 2PF0A 1OM0A 2HROA 5HULA 1UKQA 2IS7A 3W7EA 3S83A 1K8CA 2LLEA 3OLIA 2CLMA 1H2JA 2CBJA 1ITQA 5EPDA 2Z25A 5HNTA 1XLKA 5CG7A 3TQPA 4GO9A 4HMEA 3U2ZA 1BGGA 2A7PA 3QKZA 4KCVA 4ZMGA 1W9XA 3UG8A 1BRLB 1A5BA 3CM4A 3BGGA 4LYPA 5HXMA 2NLIA 3BXWA 4S3KA 1B3YA 2NT1A 4NAFB 3UT0A 4Z2GA 4PRRA 3OG3A 1K7FA 2J7DA 2DEPA 5CPQA 3CWOX 1UIOA 5M3WA 4JBRA 4YN5A 3VD7A 1NDYA 1ZRQA 3WLHA 4IQDA 4M1RA 4WDWA 4DBUA 1Z9AA 2DUAA 4Q8VA 3UYCA 4TTGA 4X2PA 3BH4A 3ZMRA 1V8EA 3B9AA 4ROPA 5A8NA 2CBVA 3HB9A 4YNGA 4PZVA 5LHFA 1PCWA 4U10A 4AMCA 3W2NA 3ITXA 3B04A 1FXQA 4A21A 4A3HA 1BF2A 1SO3A 1QT1A 4R27A 3BTNA 4JOMA 2ZTKA 3O2LA 3PB2A 3FXYA 3MUZ1 2WSPA 4YYFA 4M7SA 4R53A 3VK5A 4B5SA 3W7NA 4Q7BA 1VPYA 4GCXA 3EXSA 3GFZA 5AHIA 1BVNP 2DIEA 4L56A 3PTKA 3L67A 1AW5A 1Q66A 1UD3A 1M7OA 3M7SA 3OW1A 3KWXA 2HS6A 2JKEA 4EVZA 1XCWA 4NJKA 1WBHA 3GKFA 1EL3A 1XIGA 3MMUA 4B5XA 2PTDA 3RLUA 1KM3A 1HN1A 3KVKA 3HV9A 2FLIA 2EHHA 2PGFA 3W85A 9RUBA 4XZ9A 3BJSA 1RJPA 3WNKA 4IGSA 9XIAA 2QGHA 4CQBA 3HQ1A 2VOMA 3EXTA 4E6MA 3MMWA 1AH0A 3LLXA 2I5GA 1XIBA 3F03K 3DC8A 3E5BA 2O9TA 4LYQA 1VIWA 4L4LA 2YXGA 5BROA 4JTHA 3B05A 4YTTA 2EKGA 3GD6A 3L4XA 3BAJA 3AICA 3TTSA 3ABZA 4F9DA 1RLCL 3IUDA 1H50A 4KF1A 3L7RA 3EEGA 1W3HA 3A3WA 3PTDA 4ERGA 1MZRA 2E6DA 3TSBA 1U83A 3H24A 4O1AA 4FB7A 1G94A 2QEZA 2NV2A 3ZOAA 2V8ZA 4O14A 5K3VA 2D69A 1YPIA 3BLPX 4BY3A 2Y5SA 1OF8A 3SCPA 3PZMA 4HHPA 1R3YA 3M0IA 3BCJA 3VZZA 2WZIA 3STCA 4KMQA 2REQA 1BG4A 5CZTA 1UOKA 4U3CA 1VYSX 2DU2A 2HJPA 4UC5A 4MNMA 1H49A 2HXTA 1WUFA 2JBMA 1H62A 4RK8A 5D8ZA 2WVVA 3R6IA 1E1CA 4V1XA 3ALFA 2GVJA 4R3UA 3T44A 4ILSA 2YA2A 3NA8A 4XIAA 1WA3A 2W5FA 2XIMA 4XAPA 4ZVJA 3QV6A 4OHQA 4XZLX 4DBDA 4J28A 2HV5A 2DW7A 4BF7A 2GDUA 3A4JA 1OGBA 4Q8UA 2Y8UA 2CCRA 3QVQA 4NAEB 4PCSA 4IUGA 2VZVA 1P7TB 3HPZA 1ECEA 3KRSA 4IPLA 3NWRA 2XSAA 3D46A 3DXIA 4QJ5B 1FHUA 1OFPA 1YXDA 2VX6A 3IJ8A 2OZ0A 3C6CA 3LCIA 4N9DA 3S8HA 4ATLA 1V08A 3TYUA 1VRDA 3E3HA 4HMCA 3T2QA 3PUGA 4EPEC 1M6JA 3EX2A 1EJTC 3T4CA 3OBAA 2J47A 3W7IA 3GX9A 1X38A 3ITCA 2PTWA 2NW0A 3MBFA 3BZGA 4WY0A 1NFPA 4QM1A 3P80A 3B0XA 3W1UA 2XSXA 3BL3A 3H4GA 2WSKA 4W87A 1A3HA 4IP5A 4O0QA 4KWOA 4Z17A 5ABTA 1EHAA 3M0HA 3TAOA 3CL8A 3EDDA 1J6OA 3ITYA 4NG3A 1E0TA 3C8FA 4AZIA 1MDRA 4B5VA 4HU8A 3WQGA 1KFCA 3ZSSA 1GJUA 4GZ7A 2HSAA 2ZRUA 4GXPA 4LUTB 3S9ZA 4K1WA 4U5IA 3T0DA 3V7PA 3CT7A 1CXHA 5RUBA 3QV8A 4LBUA 1XBVA 3VE9A 2ZE0A 4AXKA 3SCSA 2XVPA 1IE7C 1LQ2A 2DVXA 4QDPA 5LIKX 2FKPA 1FDZA 1TCDA 3U48A 4IGNA 1TX0A 4FK9A 1SSDA 2C7FA 3BOXA 5F4XA 1R3QA 4PMZA 4XG1A 3EKGA 4EXQA 4DJDD 4PTDA 1B90A 4HCDA 1Q6LA 3KOZA 5D9NA 4EANA 1UZ4A 1KKRA 3RR4A 1R0MA 3BVJA 3VFCA 2HDJA 4MOZA 1UB3A 3W71A 4UQEA 4M82A 4ZQCA 2WHKA 2FQIA 2RH9A 3UEQA 2X1IA 3ZVHB 3CV2A 1EQCA 2XZ9A 3CEUA 1F3TA 1FWNA 4QEEA 1ZP3A 4UTKA 3CPRA 1A3WA 2ANUA 1L9WA 1R3SA 4PFMA 3H70A 4FAMA 4Q8NA 3EX3A 4LNCA 3VVGA 3BV4A 1ISXA 3T4WA 2ACUA 3P74A 1CCWB 2IKGA 2VT0A 3ARPA 4GCAA 1Z6KA 3CYVA 2VX5A 3WH8A 1EWEA 3M44A 2XH4A 4ZGYA 4S3FA 4GC4A 2WQPA 3MMDA 3VDBA 4O50A 1C29A 1QPKA 1JUBA 2P1FA 4D6IA 2EPKX 4JDYA 2QPSA 2YIHA 4YL2A 1UQZA 1KRBC 1NVMA 3CQKA 3KVMA 3WFAA 4FI4A 3C0LA 1UUMA 4XUYA 1OFOA 4M0XA 2Z1BA 1E40A 3MI3A 3AISA 1X1NA 3W7KA 3F2CA 3GRIA 4AVOA 4FZIA 3CV7A 3S47A 2WANA 3IVUA 3URQA 4JX4A 4XX6A 2MANA 3WF1A 5T9BG 4HD5A 1JD7A 4YIWA 4AY7A 3SUVA 2ZWYA 3M43A 1P0KA 1IV8A 1XH0A 2NUXA 1TJ0A 2YL6A 1QVBA 3UY8A 3RX2A 1Q85A 2FHBA 1E15A 1K02A 1FXPA 3CAQA 3R94A 2G96A 2DZXA 1SFLA 1H3GA 1XGZA 2HWGA 3VIKA 5HPOA 1DJWA 2BS9A 4JICA 4X0NA 2VCCA 2X1TA 4XWUA 1FWRA 2GQ3A 1PDZA 1E72M 2WVUA 4PN2A 1IEXA 1DBTA 1GJWA 5FF0A 1DWAM 1L0PA 1OJXA 4DO4A 5LXEA 4HQVA 5K9DA 2DT3A 2R1KA 2POTA 3S42A 4XVDA 3EGJA 4YVVA 2O7QA 4W8BA 1W5PA 5AHMA 3EZ4A 2VELA 3ALGA 1IGWA 2NQ9A 4LAKA 1KFJA 4RZ5A 1EC8A 2YA1A 4HHHA 3W7HA 3A23A 3W7DA 2ADAA 3GDRA 3NCOA 4GG9A 5I3FA 4CU7A 2PDBA 3MT1A 3ZJ7A 1DWHM 4LYRA 3CAWA 3DG3A 4GXWA 2E1WA 4GY0A 5H2ZA 3RPDA 3STEA 4NNBA 1PSCA 3OQ8A 3UETA 1ZFJA 3T05A 3RLVA 2VMFA 3NZRA 1JFXA 4Q4RA 3RM4A 3ZS4A 5HMFA 3C2RA 5BWAA 4GJ1A 3A6OA 1RD5A 3DHUA 5BYWA 4UFMA 2KAUC 4HVXA 4O13A 1ESWA 1EYEA 5DO8A 3AYSA 1MXGA 2X7VA 4PE8A 1HO1A 4AW7A 5BNKA 4NJGA 4JL1A 1SM9A 4XTDA 3H26A 3VDHA 3UWVA 3S0CA 4LBSA 2QCEA 3WEMA 5D9OA 1HVQA 3USZA 4MLJA 3FYYA 3OZOA 1FHDA 2OR2A 3CUXA 3TE9A 3GM8A 3RILA 5EMMA 3WBYA 5CH9A 5EU9A 1P43A 1F4AA 2AGKA 3OODA 2JEPA 3GG1A 3WLSA 2VFIA 2YYUA 5CZ0A 3MZ2A 3HZ3A 5EY5A 3UWEA 3GDTA 4CD4A 3VCRA 1RXOB 3ZR4A 4X63A 1ECQA 1RVKA 2V2DA 1EBGA 1V7AA 2I7GA 2VP8A 4LCRA 1XLIA 3B03A 4M29A 1XLFA 1L2UA 1MW1A 1QRQA 5FF2A 1HKVA 2PURA 3BCFA 1K3UA 2EPLX 2PRHA 1XLGA 3MYOA 1OVDA 1QI0A 1CPUA 8XIMA 2ZRYA 2QJNA 4F66A 1ALDA 4WY0F 1TJPA 4ERAA 3NO5A 1TJRA 1UIPA 1D9EA 4JCLA 1BEUA 4OGZA 3UERA 4BQ5A 4QDMA 3BGAA 1WKEA 1M04A 1XR2A 4QQUA 3KOFA 5H8PA 1FRBA 5A8QA 3AIBA 4D1JA 3N73A 3W1AA 3VUSA 3MVTA 4MYXA 4QR6A 4P7NA 1UCWA 3I10A 3KVLA 3GR7A 4LUIA 1EC9A 3EXRA 1B0IA 4O1BA 1GVRA 5CKSA 1TWIA 2ZRVA 2V5CA 3TNBA 1NU5A 4C1NB 5ABGA 3CHFA 2RDUA 3NFUA 4RE3A 4F0RA 1BVWA 4E2OA 2I57A 2JE8A 5A2BA 2Z2AA 3R0DA 1KFBA 1QDSA 2OXNA 4GNJA 3L2LA 4CVWA 3T9PA 1R3VA 1TZ7A 4UTIA 1HJQA 5G5IA 4PL1A 4TX8A 3UG5A 3GTFA 4GGBA 3LM7A 4RKAA 1B4KA 2XWEA 2WMFA 1B4EA 5AOUA 2YFNA 3VD9A 4BWLC 1K9DA 4K8EA 1EC7A 3UVIA 3MV01 1UD2A 3V18A 2ZXQA 3ZJ6A 1US3A 4IICA 4C6CA 4KRZA 1C7SA 4L9ZA 4H9UA 1UD5A 4A8IA 4MWAB 1B57A 5F1UA 2DSZA 4C6IA 5HNUA 3DX5A 1DHPA 1GG0A 3DHPA 4IFKA 4AY1A 3E2VA 1IT0A 1X8FA 1Z69A 3G1XA 4NP7A 5IFPA 1B3WA 1H4PA 3S4TA 3SI9A 3EOLA 2DZPA 2ABBA 1MW2A 2G3JA 5CGTA 3H6OA 1K8XA 2OKTA 3C56A 5DCDA 3WUEA 3W29A 1XIIA 2F6XA 2E4TA 4US6A 5I3DA 2VWTA 1LUCA 2AOSA 3VIHA 3H2NA 5JMUA 1MEHA 3DI1A 4QSFA 3BSMA 2VENA 1KR0A 1O1ZA 3AZTA 4POCA 2BASA 1FWCC 1WBJA 1H7PA 2O4QA 2I5IA 2Y70A 2PDYA 5BRQA 4WDXA 3WJSA 2WNQA 1DXIA 4X0VA 4C6QA 1KGWA 2QJMA 3OTRA 3ZWSA 4EPBC 5EBAA 3FFSA 3SN4A 3SGZA 3LSBA 4XQ6A 1FOBA 3WLRA 3I4EA 5HMEA 3WJXA 3MB9A 5F1VA 3N4FA 3IVTA 3UZXA 3WNMA 4PA8A 3SRDA 2ATMA 4AH7A 1RSCA 3FYPA 4MFDA 5T8GA 4A3YA 2OSXA 3IV8A 4FX7A 3UR8A 5G1TA 3FS2A 4YU1A 3CUJA 1P0NA 4ML4A 4Q4QA 4XD6A 3ATZA 1N8WA 5C2CA 3M5YA 5A8MA 1UP0A 1IR2A 5C9ZA 1AJ2A 3EX4A 1YPFA 1FWEC 4UR8A 3CAVA 3T8QA 2AKMA 1BQGA 2IUZA 1R9ZA 1SJBA 1WAUA 4IG2A 1HZYA 3CEPA 3LZ3A 4DO6A 4Q8WA 3L4ZA 4XD4A 1TIMA 2PDKA 4AX6A 1EPVA 1JYWA 4ZB5A 1UWSA 4MB3A 1PYMA 1BF6A 4O12A 3PM6A 1RBLA 3GB6A 3FEQA 2GVEA 1EKOA 3W02A 2PLMA 3TYZA 4FO4A 3FSUA 3E1F1 1EZWA 3SCVA 3IIVA 3L5AA 1LQ0A 2FGLA 2A5HA 4LGXA 4J3WA 3HQPA 3ZT5A 4D9PA 3PVFA 1BLIA 3LB0A 3TN4A 3TJLA 3N34A 1NJJA 3O7UA 4XKYB 2DSUA 1BKSA 3MW7A 3N6QA 4M51A 4I3GA 4RE2A 4IXHA 3W74A 1E4NA 3L68A 3W01A 3WD4A 1WNOA 3T40A 2IPGA 3W84A 3MY9A 1I2OA 2NXGA 4O28A 3PBYA 4HNVA 4M8UA 2INZA 3ICJA 5KINA 1XICA 2FZDA 3U6WA 5DF0A 1FHVA 4PUKA 2J78A 2Z00A 5C5YA 1XLEA 4BKNA 3AIQA 2B7OA 4DUOA 3GS6A 1VYPX 1JZ7A 5C9WA 2W92A 4Q3MA 2ZYFA 3F4DA 3NQEA 2FVMA 2XN1A 4NJIA 3AXXA 2WHJA 3VOFA 5FL1A 4PUUA 1BFNA 3B8TA 3LRKA 5REQA 3NZ1A 3CMGA 1VCGA 7TAAA 1JPIA 1JCMP 2A3EA 1YNPA 3B8WA 3PHAA 4EAMA 2GSHA 1PZ3A 1SO4A 4AD0A 4A05A 3V1PA 2WPBA 3L4UA 4KPLA 3U8GA 2WZEA 2W67A 3MKCA 1EF2A 3TIMA 2VI0A 2WSRA 3TZFA 1LQAA 1D8CA 3W87A 3UVAA 3HO8A 3FSTA 3N4EA 2CLHA 5DFAA 1EJXC 1M01A 3CL6A 3FAXA 3CUIA 2J7HA 5TBOA 1UP3A 1XDLA 4LFYA 2JIWA 1KV5A 1UZDA 1D2KA 3ARYA 3CIXA 4JZ5A 1DOSA 4GVFA 1RBOB 1HX0A 3SM0A 2ZXBA 2Y1HA 2E8YA 3MP4A 2NVAA 3PAOA 4PTVA 1VENA 3E74A 3Q65A 2ZE3A 3UCQA 4PTMA 1VFMA 3IAQA 3ARWA 5CPMA 3G5EA 3GG7A 2ZX8A 4ONVA 1TVNA 5C71A 3WJWA 2PTXA 3CAKA 4GZIA 4QE5A 4DB7A 2NQJA 5E09A 5I3IA 3AYTA 1R3TA 3W1LA 3GG0A 1XLMA 2HMCA 4R33A 4RW5A 3GNNA 4QJ1A 1A50A 1I1XA 3SUTA 4D8ZA 2C1IA 3OB8A 2DZSA 4AVNA 4GA8A 2A3LA 3LXAA 1KLZA 2GGHA 3COTA 3V5FA 3UXAA 1LL4A 4R7OA 4DLMA 1OSEA 1XC6A 1DHKA 1S1RA 1VKFA 4GUJA 3CGTA 5E6ZA 2V5KA 3QY8A 2CC0A 1YTKA 3MWAA 2PDJA 4AD1A 5HINA 2GDQA 2F38A 1DPMA 1XH1A 1Z42A 4JTRA 4JQ3A 2BMBA 1JI2A <