3N9KA

F229a/e292s double mutant of exo-beta-1,3-glucanase from candida albicans in complex with laminaritriose at 1.7 a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n9kA00
2CPUA 2WMGA 2ZOXA 1W9VA 3FW6A 5A94A 3PZ9A 1MW1A 2YBTA 1TVNA 2CIPA 1RPKA 2Y8VA 3D5HA 4MNLA 3I3EA 1CBGA 4W5UA 3CMGA 3GNRA 3CZKA 2FHCA 2WVVB 1WDSA 1QPKA 4P8VA 4D6CA 1KQYA 1R7OA 2CKSA 3CUFA 2BS9A 5EFFA 3AISA 2WVSA 1HVQA 4B16A 2EXOA 4UOZA 4OBSA 3BMVA 1H0GA 4TTUA 4TOQA 1UWQA 2VRQA 1QNOA 1UQZA 1RP8A 1SR0A 1K9EA 6CGTA 1E3XA 4R5EA 1MQRA 5JIPA 1CGYA 1Q6FA 2UY4A 4BZYA 1J9YA 2OYKA 1BF2A 3GXMA 1PEZA 1G01A 3IJ7A 5CPQA 3WF1A 1GHSA 1QI4A 3POHA 4J3SA 3GXIA 3AZSA 4P7OA 2GSJA 1CXHA 2ZUUA 2V3DA 1V3KA 1X1NA 3WD4A 1M04A 3RPMA 3WDPP 4GXPA 2E8YA 1KFWA 5AY7A 1ISWA 3QHOA 5CXPA 1E0XA 3NIYA 1AMYA 3ZO9A 4GQQA 2Z1SA 2JE8A 1PZ3A 3AIEA 4KGLA 4GKLA 4A3HA 1WP6A 1TVPA 1JGIA 2Y8KA 3NCOA 3ECQA 1V6XA 2BFGA 2WHKA 2CNCA 5E70A 1XH0A 2ESCA 2XFRA 3J7HA 3L2LA 3UR7A 1QW8A 1BPLB 1JZ8A 3W6LA 1KGUA 5DT5A 1X6LA 1W9XA 1U33A 1JI2A 3WF3A 4AZHA 2X2YA 2J7BA 3AXXA 3MUZ1 2QV4A 3ZSSA 1BQCA 7CGTA 1V3JA 4EKJA 1GQKA 2Y5EA 5I77A 1HX0A 5BRQA 4DWSD 1JYVA 3DECA 2CHNA 4L4PA 4PMUA 1VFUA 2WXDM 3F5JA 1IV8A 1JZ3A 4W5ZA 5E6ZA 1HKJA 2VX6A 5A6KA 3ARWA 2VOTA 2W66A 1GW1A 1BYDA 5IFPA 1CIUA 1GHRA 3MUAA 3ZJ6A 3KL0A 1QHZA 1J12A 2YDSA 2V5CA 2JF6A 1LJYA 5GNXA 1GVYA 1JZ5A 4C7GA 4CU7A 2WHJA 1J18A 1FP8A 2WCAA 2GJRA 3M46A 2DSVA 2PWFA 1WPCA 3AZRA 3EDEA 4AD1A 1OWQA 4F79A 4CN1A 2O92A 4HP5A 3VIIA 2E9BA 2VL4A 3AHZA 2ZX8A 1V6VA 3CPUA 1BYAA 1JG9A 4FLQA 2V38A 3T2QA 3VGHA 2O9OA 4ZXLA 1HKIA 1GONA 5CGMA 2D3NA 2ZUTA 1AQHA 4M1RA 1EQPA 2EBNA 3BXWA 1N82A 4XZWA 4C7FA 3WL1A 2OSXA 1C91A 2DSKA 3GH4A 2FHBA 2G8ZA 2VX7A 1MFVA 3GH5A 1UD8A 4W8LA 4ZEPA 1V08A 2DSWA 5HXMA 1DWFM 2VZVA 4FMVA 1IT0A 2CXGA 3W4RA 5I3DA 3VD9A 4LYQA 1E73M 2WC4A 4L4OA 5A8QA 4IPNB 4M80A 2W62A 3WH9A 2XTKA 3WDHA 3LMYA 1EH9A 1BYCA 4W93A 1E43A 1W2VA 2UY3A 2QLYA 4W8AA 1ECEA 1B9ZA 2D0HA 3DHPA 3ARZA 4UZSA 3W82A 3SUVA 1D3CA 2VJXA 1W2PA 5CPTA 3OBAA 3W27A 3WF2A 1WNOA 2YA2A 1DEDA 2NW0A 4GPNA 1VBUA 2VNCA 2VQUA 2YDRA 4OUEA 1WDQA 3APGA 2DGAA 1PX8A 1CGVA 1VIWA 5JBFA 5A6BA 1CXEA 3SUUA 1E6PA 2DT0A 5DT7A 8CGTA 1E56A 1GOKA 1GQLA 1ESWA 3IJ9A 1KBKA 3CLWA 3KL5A 1U30A 4GQRA 5CGTA 5CPSA 1OBAA 2J4GA 3VGFA 5I79A 1JDAA 1V0NA 4OBRA 4IPLA 1MQPA 2DH3A 4JFUA 2J7EA 4KWUA 3IANA 5E6YA 1E9LA 2WKLA 3VTRA 1EXPA 2PI6A 4HMCA 5HOSA 2BHYA 2Z1KA 3CZEA 1KWGA 3WEZA 1MW0A 2YA1A 1V3IA 1GUVA 3K4DA 3OZOA 3AI0A 3GBEA 4JKMA 1HXJA 4PN2A 3LPPA 3HJEA 4ZE5A 3MUIA 4ACZA 3L4TA 1W9UA 2XUCA 1UHVA 1ZBWA 1A3HA 2D20A 5D9NA 4X9YA 3WD3A 3KWXA 1V6WA 1MXGA 4CVUA 2FDMA 2O9TA 2DT1A 2XG9A 1E6ZA 2G3MA 1JFHA 2BY1A 4X0VA 4B9YA 4BQ4A 1K9TA 2WC7A 3B8SA 1KCLA 3CHFA 1J01A 2PBOA 2G3JA 3U5YA 1XC6A 3M7SA 1F4AA 3WQ4A 1UH4A 2VR4A 1EHAA 1G5AA 4QLKA 4W84A 4HOWA 4BS0A 3F4VA 1EHNA 2DT3A 2VCCA 1UKTA 5CJ5A 3WBEA 5CLWA 3ZR6A 1UR2A 1NWTA 4AIUA 4H8VA 3WMSA 1JAEA 3IJ8A 1VFOA 1E70M 1GQJA 2GK1A 1ZBKA 4H8HA 1JFXA 1KBBA 4TTGA 2XWDA 4W8BA 1M01A 4U33A 4Q7NA 4P7RA 1BHGA 5D9MA 4H04A 1H0IA 3WUFA 1I1XA 4PTVA 4JCMA 1NM9A 5DFAA 1ISZA 1MWOA 1PBGA 2WLZA 4AZ7A 4UQDA 4CUCA 1SMDA 2CETA 4ZXOA 5CG0A 3CBWA 1QBAA 1C92A 1B1YA 4UQBA 1PX3A 2YL9A 2EPKX 3PZVA 2GJPA 3SCPA 4AZGA 3NSXA 3L4VA 3DYMA 5JUVA 1UR0A 5I78A 2VMFA 1FH7A 2FH8A 2JIWA 2XM2A 4JFWA 4IISA 1S46A 1CGUA 1WB0A 4LYRA 3O2LA 3F5KA 1QHOA 4UR9A 4AD4A 3K8KA 4E8DA 3WY1A 4CN6A 1WCGA 2EO7A 4EK7A 1JIBA 1UD6A 4RE4A 3TP4A 5BCAA 1UR1A 2YL8A 3E1F1 2EQDA 4HOZA 1GOMA 2OYLA 1BFNA 4RE2A 3CMJA 1H4PA 5KZ6A 2J7FA 1YQ2A 1UR8A 1UH3A 4ATDA 5JIWA 3HMCA 2W92A 4BQ5A 5D9OA 5CQ1A 1CGWA 1QI2A 3VNYA 1K6AA 2WM0A 4XUYA 3I3BA 1R87A 1C8QA 5A6AA 4UZUA 2PWGA 1F4HA 1BVZA 3WEMA 3AJ7A 1CGTA 4DUWA 4NF7A 1KXHA 3ZT5A 5ABFA 4K68A 5IHSA 4HU0A 1TUXA 1KXQA 1QNSA 2DH2A 4KMQA 1ZJBA 4AEFA 4QLLA 4UQCA 1B3YA 3AOFA 2WZIA 3NSNA 2VVNA 3PHAA 1V02E 2A3AA 4HTYA 3WFZA 3AFBA 4GI6A 3MANA 1HF6A 1NH6A 1B3VA 3BAWA 1NOWA 1QHPA 1W1VA 4M56A 3ZQ9A 1US3A 2GDUA 2FGZA 4PBGA 1ZBCA 2EPMX 2WBGA 4BF7A 3VX0A 3VOCA 3WENA 4XB3A 1RD6A 2J7DA 4DM1A 2XGIA 2VVSA 5ABGA 1CZ1A 2YL6A 3GZAA 1UQYA 4GZIA 3WDJA 1EQCA 5FIPA 2JF7A 3WD2A 2WMHA 2YIHA 3ARQA 3DC0A 2NT1A 4J3XA 2J77A 1ITXA 4W89A 1V02A 3UESA 1CXLA 2J8GA 4ZE4A 4PMOA 4FF5A 4AZCB 2FGLA 3U5UA 1D7FA 3VDAA 3WD0A 3IAQA 1XSIA 4Z2JA 4JAWA 5A1AA 1CXKA 2BHUA 2D0GA 3A3HA 4N0RA 1UZ4A 2XSBA 2ZIDA 3CO4A 2WVVA 4MB3A 1H1NA 4DWSC 2VURA 4HA4A 2CBVA 4TUFA 3AHVA 3K8MA 2CEQA 4LPCA 3BLPX 2BXZA 2BY0A 3PZTA 2XPKA 2WVTA 1NWUA 1Q6GA 1HJSA 1EDGA 1FOBA 1PAMA 1ITCA 2VX5A 3ZM8A 4MDPA 1SFSA 2D22A 1DTUA 1US2A 2XJ7A 4JKKA 3G6MA 5HBFA 2PWHA 4HZ8A 3W29A 4F9DA 2CERA 3LPGA 3WQ6A 3AS0A 1C90A 1EA9C 2XIIA 4DM2A 2YLAA 1W1PA 2ZUWA 2BY2A 3AZTA 1PZ2A 3CGTA 3DHUA 3MO4A 3WIJA 3WNNA 9CGTA 5A6MA 3VGGA 5DEZA 2QMJA 1UR4A 3D3AA 3CUGA 3VD5A 4D6EA 1B0IA 3AQUA 1JZ7A 4MTVA 1W9DM 3WMCA 4DWSB 3VIKA 1BGGA 4FLOA 4UOJA 4NI3A 1W3HA 1Y7VA 3PZIA 2EEXA 1TE1A 2J25A 5GPRA 5CLTA 1PPIA 1K9DA 4M8UA 1JNEA 1WAWA 2XGBA 2ZUMA 2VCAA 4PTXA 4PMNA 1WZAA 1J0ZA 4S3JA 1NOUA 2V3FA 1E6QM 3ARPA 1X6NA 2J7CA 5I24A 4U3CA 1EOKA 3VU2A 2ZUSA 4E2OA 4U5KA 4MNKA 4HZ7A 4JKLA 3N11A 4AY1A 1OD0A 4QFUA 4BCEA 2A3EA 3GTNA 1J0IA 1UKQA 1R8LA 1XCWA 3NUKA 3VKKA 2J74A 2UY5A 3BSHA 3ARSA 1FHLA 4AYSA 1FFQA 4AZIA 1NWSA 4PMYA 4CVWA 2WNWA 1NQ6A 5FL1A 1UD5A 3VDBA 1JF6A 3AYRA 4Z2KA 4LGXA 1V6YA 4JHOA 2C7FA 3KE0A 1KR0A 3SCUA 3TA9A 1CYGA 5A2CA 4MAVA 2XSAA 4UNIA 2ZXBA 2WCSA 3WFLA 2F8QA 2UY2A 1E1FA 4J3TA 1U2YA 3L4YA 4P7NA 1UA7A 1MYRA 3MV01 3ARUA 1J11A 1CEOA 5M5DA 4TVCA 1P6WA 2G4FA 4ML4A 4H41A 4WSJA 1CECA 4U2ZA 2W91A 4HOXA 2CKRA 5BXRA 4BQ3A 1VJZA 2OWCA 2YDQA 5BYWA 3A47A 3GXFA 2WZHA 3OGRA 3EDFA 4WLCA 4PCTA 1JNDA 4NZCA 2DDXA 3UEQA 5C70A 3BAXA 2WYSA 1XSKA 4MJ2A 2FH6A 3MSGA 1WZLA 1W1TA 3WQWA 3RJYA 4UFHA 2E9MA 1MQQA 3ARYA 1TCMA 1XYZA 1OSEA 4WIWA 5EFDA 4TX8A 1UYQA 3AIWA 3ZR5A 3GH7A 4MB4A 4C7DA 2YL5A 3CZJA 1GJWA 2PWDA 1J0YA 3EDKA 1EOMA 4PEEA 4LYPA 1V3HA 5AYBA 3WQ5A 1BVNP 4Z2LA 3PZNA 3KEHA 3WSUA 3WNMA 4QAWA 1RH9A 2VO5A 1HJWA 2X8RA 4V27A 1PIGA 3VIJA 3VUPA 3W24A 5DO8A 4WKAA 1VF8A 2C8NA 4AMCA 3FY1A 4WF7A 1QVBA 3UG3A 2A3BA 4IM4A 4OZOA 1E1EA 3S2CA 1LWHA 2DSUA 3CUHA 4MB1A 5IHRA 1EIBA 3N13A 1VEOA 1Q6CA 3GYCA 3N9KA 1C7SA 2XWEA 4HA1A 1TFVA 3PZUA 1H49A 2GVYA 1XH2A 4J3WA 4AWEA 4PUDA 4CD5A 4CCDA 5M3WA 3FAXA 1IZJA 1DHKA 1UG6A 2WSPA 3CUIA 2G3IA 3N18A 2C0HA 3PTQA 1CXFA 1QNPA 5I6SA 1TMQA 2YA0A 3T0DA 2WMKA 2VQTA 1JXJA 4FLSA 3BCFA 3SURA 4AIEA 2VX4A 1GZJA 2DQXA 1H09A 2E9LA 4URIA 1H3GA 3I3DA 3VPLA 3OG2A 4AXNA 3TTOA 3AIQA 3SCVA 5LYRA 3WEOA 1FP9A 3L4XA 4OOZA 3QR3A 3RM9A 3N04A 2ZUNA 2QPSA 3SCTA 1KCKA 2WW5A 2ZE0A 3RILA 4MJ4A 3VGBA 3BLKA 4W86A 1XRVA 3VIHA 3W37A 2JEPA 1WZMA 1XYFA 1C8XA 1FFRA 5C8BB 4GO8A 3W26A 1HJQA 4QDMA 3ZOAA 3MMWA 5I5RA 4CD6A 1ZBVA 2CBUA 2WCGA 3HU7A 3MUY1 1HNYA 1OINA 1ODZA 4ATLA 6TAAA 3NSMA 3FXYA 1HJVA 2A3HA 4EE9A 2BHZA 2J62A 4RL3A 2QF8A 2CCRA 1UD4A 2AMGA 2WWDA 4UFLA 4AW7A 1QI5A 2BY3A 5A8NA 4OKDA 3BMWA 3SCWA 3IK2A 4A4AA 3VD7A 1JZ6A 1KB3A 1TA3B 2E0PA 3OZPA 3VIPA 2XVKA 4PSPA 1BG9A 1UKPA 3VILA 3N1AA 1BLIA 2WVUA 4MDOA 1W3KA 1Q6EA 3WNLA 1MW2A 5FD0A 3RM4A 3T2OA 1I1WA 1O7AA 2FHFA 3WNPA 1HKKA 3QGVA 2WKGA 4D6JA 3MMDA 5FL0A 5TD4A 1KXTA 2ZX7A 2WC3A 2E3ZA 3A4XA 2WHMA 2XFYA 1DWJM 3WF0A 3PBGA 3N12A 1Q6DA 1G1YA 4AC1X 5C71A 4LQ1A 1ZB5A 1W9PA 4GO9A 2VZSA 1E55A 3WUBA 1UZ1A 2W63A 5A6BD 3CHCA 3WD1A 3RM8A 1DP0A 2WLYA 2ZWYA 1BTCA 3K8LA 2NSXA 2UWFA 1XGZA 3VM7A 5HDRA 2XVPA 5I0DA 4J28A 2X1IA 1XV8A 1BGAA 4DUVA 1H2JA 4CD7A 1C93A 2Y2WA 4JFVA 1E15A 4CD8A 2E40A 1C3FA 4OOUA 1V3LA 1ZJAA 4PSRA 5E9AA 2VRJA 4Y7EA 5EB8A 3AHYA 3AMLA 4Q22A 3WH6A 3B9AA 3IAPA 3GNOA 3A6OA 1HKMA 2EPNA 5E09A 1MXDA 2GK1B 4FLRA 3EMQA 4JHZA 2W61A 1E4IA 1AQMA 2VZOA 7A3HA 4U2YA 3LPOA 2CBJA 3UETA 1UD3A 1L8NA 2WMIB 1ISYA 4YN5A 3UERA 3AIRA 2PWEA 4X0NA 1CTNA 2VTFA 2X09A 3VDHA 3VX1A 4EAMA 4AZBA 5E0CA 5GNYA 1DWHM 1UKSA 1A47A 2VC9A 4P8XA 1VRXA 1E6SM 3T0BA 4QCFA 3QHMA 1L0PA 1HJUA 3ZJ7A 3VIGA 3CHDA 3WNKA 2BV9A 4MNMA 2E4TA 5AYIA 1VB9A 1HIZA 4OIFA 3VM5A 2VRKA 4GZJA 1CLXA 4D6FA 5DF0A 5IXEA 3CH9A 3BAIA 1E5NA 4PMZA 2GJXB 1E40A 5CZKA 3WBAA 3WN6A 5A6SA 1TR1A 2ZICA 5BXTA 1R86A 3MV11 1E72M 1K9FA 3AROA 3PTKA 1ZU8A 2YLLA 1ZL1A 3W28A 3VDCA 1JDCA 4U3AA 1MFUA 2OYMA 4PCSA 4JIEA 1WZKA 2OWWA 2WHLA 4AD0A 2RGLA 3RDKA 1XH1A 2BVDA 3BAJA 5ECUA 4D72A 3VD4A 5BRPA 2XYLA 2DSZA 1UWSA 1KR1A 3BAYA 5M17A 4D6DA 1B2YA 3MU7A 1W91A 1VFFA 4H7VA 2PBGA 1NWRA 3WDRA 4CU6A 4U31A 2X05A 2WMFA 2DIEA 3PZMA 1UUQA 5HPCA 4KH2A 1B3WA 3AMKA 5CSYA 2V5DA 4ATWA 3JUGA 4NSBA 2EPLX 1JYNA 3ARVA 1JZ4A 1V03A 4AZCA 4H2CA 1BSIA 2PC8A 2YBUA 4AD5A 1EGZA 3OIHA 3VGDA 2JEQA 4MAZA 4PMRA 4CU8A 1ZS2A 3T08A 2D2OA 3BH4A 1R85A 4JZ5A 3W81A 4HPGA 5BXSA 1M7XA 3K4AA 1CENA 1GORA 5E0FA 3OGVA 3WL0A 4FK9A 2ZX6A 4P8WA 3NYDA 3O9NA 4J3VA 4W7VA 2B31A 3ALGA 1M03A 2VCBA 4HA3A 1CGXA 5LA1A 3VMNA 4JCLA 3W25A 1Z32X 2WPGA 1B31A 4WKFA 3GM8A 4MADA 4YHEA 1VENA 1WDRA 4NRSA 3EMZA 1LQ0A 1GOIA 1RP9A 3ZSTA 2PB1A 1JL8A 2RGMA 1JD7A 2BVTA 4N42A 2O9PA 3L4UA 4V2XA 3RMEA 4XX6A 5F7UA 1GCYA 3ZT7A 1H41A 1LG1A 1VAHA 1XCXA 4PMQA 4DWSA 3L4ZA 3VIMA 4YPJA 2WK2A 4P7LA 1BYBA 5JBEA 4D6IA 1FH8A 2WZEA 3PZGA 5IDIA 4F8XA 2D24A 5BROA 1OGSA 3WDIA 4UCFA 4F9JA 4KRTA 5BXPA 4W88A 5ABEA 1W9BM 2XM1A 6A3HA 2WMJA 5HNNA 1VFMA 4PUEA 3ARXA 5EBAA 1LWJA 3OB8A 3FNDA 1DWGM 1GOQA 4M29A 3L2MA 1Q4NX 2YJQA 3WKZA 4D1IA 3EMCA 2OLHA 3AS3A 4H8UA 3RO8A 5DMYA 5A2BA 5LA2A 5JBDA 3BCDA 3ZIZA 1H11A 1OCQA 2HVMA 3GNPA 1WDPA 4EANA 2JFEX 1EDTA 4PRWA 2Q8XA 4UFIA 4NRRA 4B3KA 3AS1A 4GZEA 3W38A 8A3HA 1CNVA 2ZUVA 7TAAA 1B90A 4W85A 1UKOA 2W5FA 4TVDA 3CZGA 3TOPA 4QCEA 1XHGA 1OT2A 2J7GA 4M82A 4WJXA 5A2AA 1V0KA 4ZENA 1PIFA 2J75A 2J7HA 4AD3A 1KWKA 1OT1A 2V3GA 3AMCA 1UWRA 3WQ8A 4JFSA 3NDZA 2GUYA 4Z2IA 3OLDA 3VINA 1HVXA 1XSJA 1JD9A 1TG7A 4DUXA 4WSKA 3T09A 3AS2A 4W87A 3W0KA 3VVGA 3CHEA 2MANA 4PMXA 3TTQA 5HPOA 1FH9A 1J0HA 1JDDA 3MSDA 3SIMA 3QOMA 3VIFA 3EDDA 3PZOA 1AVAA 3CZLA 3S6TA 4PTMA 1W32A 5M03A 3OGSA 1VEMA 1CXIA 3VIOA 5ABHA 1V0MA 1UH2A 1V3MA 3FAWA 4QLJA 2VZTA 3KL3A 1QW9A 3AIBA 2OWXA 1GQIA 1VJSA 1ODUA 1E6NA 1FHDA 3T2PA 1LL4A 2W4XA 1E4NA 4A3YA 2DT2A 4CCEA 5A95A 3RJXA 3ALFA 2ZX5A 5GQBA 3VO0A 1JZ2A 1KXVA 1NARA 3SUWA 1CDGA 3TTSA 1JYWA 1DWIM 4GI9A 3W53A 1OIMA 3EBVA 3L4WA 4D1JA 3NDYA 3WH8A 1I75A 2NT0A 5GNZA 2BNJA 5IFTA 1JI1A 1B30A 2X0YA 1UA3A 4QP0A 4B3LA 5BWFA 1R7AA 3POCA 3KZSA 1DWAM 1WKYA 1QNRA 4IUGA 3WMBA 4KRUA 4AIOA 1ISVA 2ZWZA 4AZ5A 1EDQA 3O6AA 2J8FA 1QI0A 4HPHA 2VZUA 1E0WA 1GOOA 2J79A 4MB5A 1J0JA 1LG2A 2VUYA 1ISXA 2J78A 1SMAA 3VMOA 4D71A 1KQZA 1G94A 1OGGA 2VR5A 5D4YA 4UQEA 1CLVA 4W7UA 3A4WA 3SCNA 3WDQA 1J0KA 4U5IA 3AHTA 4PYSA 1QOXA 3AHXA 3HN3A 3AYSA 3SUSA 4CD4A 1UOKA 5D9PA 3CIVA 4TX6A 1OD8A 1W3LA 3OA5A 2XHYA 2JIEA 1IZKA 3AXIA 1WE5A 3FHQA 3U7BA 4XV0A 4XZBA 2IUZA 3PZQA 3UG4A 4JL2A 3T0AA 4M24A 2DEPA 4TXEA 3WH7A 3U57A 2AAAA 2VT0A 3WF4A 3MMUA 2IXVA 4E8CA 5I2UA 1LL6A 5I23A 2BXYA 4UFKA 2EPOA 1OGBA 3ZJ8A 4CN4A 2D0FA 5KEZA 2D1ZA 3SUTA 2O9RA 3FN9A 1E6RA 4B9ZA 1LL7A 3UR8A 4HMDA 4ACYA 5EMYA 5FKYA 2G3NA 3F5LA 4J3UA 2CBIA 2F61A 3WH5A 3CZ8A 3G6LA 3SEPA 1KGWA 2GFTA 2QHAA 1HJXA 1TA3A 1UR9A 2IXUA 1GNXA 3M6DA 1SYTA 3ZJKA 4KGJA 4TVUA 3CUJA 4JFTA 1XD1A 1E5JA 4UQ9A 4HMEA 1LF1A 3U7VA 3VMPA 1E6XM 3AIVA 3B9DA 4HU8A 1E71M 3A4AA 3ZMRA 2WB5A 4WK9A 3BC9A 1OM0A 3FHAA 3DYPA 4OJYA 4R27A 1AQ0A 2WAGA 2BVYA 2E8ZA 5AC4A 3SCOA 1NP0A 1LLOA 4ACZB 3EDJA 2WANA 4YHGA 1MW3A 3II1A 3THDA 1B3XA 5A8PA 1GJUA 1BG4A 1JF5A 1E3ZA 2ZXAA 2DPEA 1W1YA 4ZFMA 3WUEA 1MVYA 2J47A 3PTMA 4F66A 4UTFA 5FCZA 5A6JA 2CYGA 2CHOA 5D8WA 3SCQA 1EO7A 2X0HA 4AD2A 1EO5A 4D6GA 4CGTA 1JXKA 4PTWA 1FA2A 3RIKA 2XVGA 2A3CA 2AOSA 2D3LA 1CPUA 3LPFA 1NP2A 3K46A 1NOFA 3AMDA 1E0VA 1G9HA 5AC5A 3GBDA 3TONA 3N17A 3DYOA 4B15A 4AZ6A 3W6MA 2D23A 1HL8A 1D2KA 1UWUA 1GPFA 3UCQA 2WMIA 3GDBA 3MS8A 3BAKA 4WKHA 1CWYA 1QNQA 4MNJA 5A8MA 1W3JA 1V6UA 4GINA 5D8ZA 2F2HA 3THCA 3SCRA 3WQVA 1UD2A 3QHNA 4BQ2A 4E4PA 3BGAA 3RCNA 4AISA 1GOWA 2WWCA 3VD3A 2EJ1A 3WELA 2ZXQA 4P8UA 1J10A 1HP4A 4JL1A 4UFJA 1JAKA 1HP5A 4W7WA 2HISA 3OLEA 4RE3A 3PN8A 4HZ6A 3ARRA 2GJXA 4Z2GA 4LXFA 5A69A 2GDVA 1M53A 1B3ZA 3OLGA 1HT6A 3AMGA 4LX4A 4CKQA 4V28A 4D6HA 1H5VA 5FOOA 1JYXA 3N15A 4UQAA 3EYPA 4J27A 4BA0A 3B9EA 3WUGA 4M81A 1OIFA 1XD0A 1HL9A 3VGEA 3QOKA 4CCCA 2CITA 2ZX9A 3WNOA 4GI8A 4Z2HA 1YHTA 3UG5A 2YKKA 4S3KA 2YOCA 1KGXA 2V3EA 3TTYA 2CESA 5A6LA 4UFMA 5A3HA 3MKKA 2VI0A 2WSKA 1HN1A 4P7QA 3GXDA 2PF0A 1C8YA 2JALA 1WO2A 5ABFB 4J7RA 1GVIA 2QMKA 2Y24A 3AICA 2QPUA 2ZXDA 3M07A 3VNZA 1PX4A 1O6IA 5CSUA 3ARTA 4GIAA 4PMVA 1V0LA 4PMDA 5A8OA 2TAAA 3SCSA 1G0CA 1PJ9A 2WBKA 2W67A 3NJ3A 2Y4SA 3BSGA 3CTTA 1VBRA 1UWIA 2XFFA 1TZ7A 2XVNA 1E4LA 3AXHA 2OSWA 1QI3A 1QBBA 3K1DA 2DIJA 1UWTA 1C7TA 2XVLA 3OLIA 4UOQA 2XIBA 1BAGA 1OB0A 2OSYA 1E4MM 3ZT6A 2G41A 4MPKA 5LA0A 4AEEA 3AIUA 1VEPA
chains in the Genus database with same CATH superfamily
2YCLA 1MW1A 3QJAA 3F4WA 1H51A 4LBUA 3GNRA 2WVVB 3B8UA 4D6CA 1KQYA 4JOMA 3CASA 2CKSA 3KS5A 5EFFA 2BS9A 1HVQA 2L5HA 4LT9A 1PL9A 4IFRA 1H0GA 4TTUA 1QT1A 4XIAA 1SR0A 6CGTA 1E3XA 1MQRA 5JIPA 1H60A 1CGYA 1Q6FA 2UY4A 3P5YA 3N19B 4XZLX 1BF2A 3GXMA 3IJ7A 2YFNA 1GHSA 1QI4A 3Q65A 3NVDA 2Y7DA 4JTGA 4QITA 1SFLA 4AHQA 1XINA 1WXJA 3IIXA 1AQFA 3TSDA 2XH0A 5DRIA 3AZSA 3WDPP 4GXPA 4GGHA 4XO7A 3PPFA 1XIDA 3C0JA 5CXPA 2WJDA 1S2CA 4PFHA 3NO1A 3GIYA 2PP1A 3AIEA 1P1XA 1A5MC 4XBSA 1M68A 1N55A 1S2VA 4LVAA 4ZO9A 2FVMA 2HV5A 4OFCA 3R94A 1V6XA 2BFGA 1GG1A 3CV2A 1Q2SA 1UZDA 2ESCA 4K7VA 1FCQA 1WKFA 4IIBA 4PB4A 4NP7A 8XIAA 4C6IA 5DELA 2J7BA 3DFYA 3OVQA 3MVIA 2QV4A 4U10A 3ZSSA 1QR7A 2PZNA 2C13A 2Y5EA 4DPPA 2PAJA 3QV6A 3VC5A 5G2IA 4BKNA 4RNJA 5HJLA 5BRQA 4DWSD 1JYVA 3DECA 3MCOA 4H6RA 4L4PA 2WXDM 2XU2A 3TYDA 1IV8A 1AL8A 5E6ZA 2VX6A 4GBDA 1U5VA 2V63A 1LM1A 4M5PA 2Z6IA 1J6PA 3M41A 1GHRA 3P6LA 2RJGA 4CNTA 4U28A 1KA9F 2V5CA 1GGOA 2FMNA 1JZ5A 3LI1A 2WHJA 2G97A 4LUSB 3EOUA 2GJRA 3M46A 1G4EA 1V5XA 4JQAA 1SFTA 4F79A 2VGGA 3TQ0A 4HP5A 3VIIA 2E9BA 3I6RA 3AHZA 2ZX8A 4N4PA 4NU7A 3M44A 2V38A 3VGHA 3UPBA 3M0XA 3M64A 1HKIA 1PWMA 4KQNA 4FAMA 5CGMA 5D05A 4YTTA 3EX4A 1B4EA 1UB3A 2AQWA 3BXWA 1Z3NA 2YCJA 1ZJIA 2OSXA 2C19A 3TV8A 3VKJA 5HR7A 1IR1A 4JYEA 4NAEA 4C6CA 1MFVA 3IVSA 2I5QA 4W8LA 3CYJA 3KOFA 4ZEPA 4Q8OA 4YTRA 4C6LA 1IT0A 5IM51 3FA5A 3B4UA 3P5ZA 1EUNA 1XDLA 4LFYA 3E3HA 2GJLA 4IMGA 2GSHA 4F4RA 4W4QA 1QPOA 4IPNB 4GZ7A 3WH9A 3WDHA 3L9CA 1FWFC 1E43A 4MUPA 1Q3NA 4YJ5A 3UZYA 1FCVA 4MWAB 2D0HA 3CYVA 2V5JA 1GKQA 3G2GA 4KERA 3HF3A 4AUBA 3TU9A 3L0GA 4GPNA 1VBUA 3FJLA 3EB2A 2RDUA 4E4UA 3V1PA 1OCJA 1WDQA 3APGA 2DGAA 1DJHA 2C3ZA 4C6BA 4HJWA 2HEJA 1E6PA 3NURA 3CV1A 3GS6A 5GJNA 4HCDA 4N9BA 1GQLA 2OOFA 2ZZ6A 3GK0A 2DY3A 5GJMA 1ESWA 1YDOA 3PANA 3IJ9A 1U30A 2FVKA 5CGTA 2J88A 1OBAA 3LHWA 1GVQA 3N2MA 5I79A 4C6FA 1JDAA 5BU9A 1J8VA 1RCQA 4OBRA 4GNVA 4A35A 4JFUA 4WR3A 2QCDA 4AY7A 3LK6A 4MWAD 4BF9A 3VTRA 3BARA 1EXPA 5EL1A 1PIIA 3HV8A 1J2WA 4Q8VA 1L6GA 4G8TA 3OODA 4S2CA 2YA1A 1GUVA 1SW7A 2NWSA 1XQLA 3SFKA 1TE6A 1W5MA 1HO4A 3PPCA 3SJ3A 5HA7A 1A3HA 1SZGA 3WD3A 2OZ3A 3S46A 2DT1A 4I7UA 3MBFA 2P5NA 1LRTA 1QASA 4DZHA 3AJXA 4B9YA 3JZUA 1K9TA 1KCLA 4KWVA 1JPHA 3DKJA 1F4AA 1VRDA 1FDYA 4IWWA 1EHAA 1G5AA 4QLKA 3W75A 4GIYA 1K3UA 1GEQA 1R30A 2OO0A 3UR2A 5CJ5A 3WBEA 3K5XA 3HQNA 3LHUA 4RNFA 1GTHA 1GQJA 2CLFA 2NQZA 1ZBKA 3GTFA 1KBBA 4TU1A 2DZWA 5FEXA 4W8BA 3MW7A 3DKLA 3E96A 4U33A 3NPUA 4Q7NA 1J79A 3HPXA 3WUFA 4XUGA 4Z1BA 3TKFA 3KOXA 4JQ1A 3LENA 1G7VA 1T40A 2REQB 3GVQA 2Z29A 4GUIA 1MDRA 4JTAA 3OTRA 1MWOA 3IJ6A 3UR5A 1PBGA 2DIKA 4UQDA 4ZXOA 1AMKA 3CBWA 1QBAA 3O1NA 4Q4PA 4JS3A 5LNSA 2EPKX 1EWDA 4FNRA 5A6TC 2GJPA 1KC7A 2GQAA 3ITYA 4F0HA 3GG1A 4AX7A 2AQVA 3DYMA 2PDXA 5JUVA 2FH8A 2JIWA 3IJDA 1EP1A 1G6CA 4H9TA 3EAUA 1PCWA 4I9MA 3BO9A 4ERGA 2Z2BA 4UR9A 4QAIA 4E8DA 3RMJA 1WCGA 3WJXA 1RJQA 1GYLA 3TP4A 5BCAA 1QAPA 3BG3A 3E1F1 3HQPA 1J4EA 4N9DA 2HBXA 1ICSA 5KZ6A 1I6NA 3V4BA 3KS6A 2J7FA 3NEHA 1YQ2A 4NY2A 1UH3A 4ATDA 2Y5JA 4RDWA 4DAIA 4BQ5A 3LEPA 1R3QA 1KBIA 1TJ1A 3GB6A 4GCXA 1QI2A 3H70A 4HNNA 3UWZA 3VKAA 3A21A 4X60A 1AA1B 4UZUA 1F4HA 1BVZA 4DUWA 4FP1A 3M5XA 1A3WA 4K68A 5K9CA 4NYYA 1WOAA 3VZZA 3SGUA 4QLLA 1U5HA 3IV8A 4UQCA 2WZIA 1V02E 4HTYA 1XLLA 4ZCWA 3AFBA 1W5OA 3CL6A 3SM0A 4ERAA 3C0SA 2VEFA 4M56A 1US3A 3GFYA 6ENLA 1DKWA 3VX0A 4XB3A 1RD6A 4EPEC 4ZB2A 3EA3A 5D32A 1QDSA 2VDIA 5C2XA 3GZAA 4OUIA 4NXSA 3WDJA 3BK0A 1OC6A 1EJUC 3TN6A 3IIZA 3WD2A 1GTEA 3MUXA 3DC0A 1H62A 1OFDA 1LLWA 3TMQA 2J77A 2EHHA 1X38A 2RDWA 4PMOA 1A5CA 3NL6A 4JN7A 4WCJA 3VDAA 4E2VA 2ZDRA 3EKLA 3PBUA 4JAWA 5AZ0A 7ODCA 1CXKA 2D0GA 2HZGA 3IRDA 2YXOA 2VGFA 2QAFA 4W9TA 2XSBA 2ZIDA 3CO4A 3SGZA 2WVVA 4HA4A 2PCEA 3HPSA 4DJED 3EWWA 4TUFA 2BXZA 2XPKA 4HT3A 3EX2A 4FX6M 4XD3A 2VX5A 2O56A 3RRXA 1DTUA 3MJYA 1FWRA 4H2HA 3W29A 4A3UA 3IUIA 2Y6ZA 3WQ6A 3AS0A 2HQAA 1K8ZA 5KTLA 1EA9C 3CGTA 2BY2A 9CGTA 4NAFA 1YX1A 4GK8A 1FWGC 1K7XA 2QDDA 2BGQA 3THQA 3XIMA 5I3KA 3OQ8A 4D6EA 4DNHA 1I2PA 1B0IA 4C6DA 2QS8A 3NPXA 2V2DA 3WMCA 3R7MA 3W87A 1DOSA 5F4XA 1ADOA 2ASHA 3ABXA 4FLOA 1R3WA 2GLKA 4S3GA 2FZBA 4QHRA 1Y7VA 3NG3A 3PZIA 2EEXA 2DW6A 1TV7A 1L6YA 5GPRA 2Y1HA 4QIUA 2VFGA 5HQLA 3B40A 4PTXA 4F40A 1L2UA 3OBEA 3ELFA 4JN6A 2EGZA 1T99A 4HZ7A 4BFAA 3G1HA 4L4LA 3STEA 4AY1A 4PGLA 1OD0A 2Z26A 2EKGA 3PJUA 1J0IA 1UKQA 2XFWA 2X16A 2JKAA 5E93A 3S6OA 4IXHA 4ZO8A 1DE5A 4AZIA 1NWSA 3MP5A 2PF8A 1ZP4A 3VDBA 2ON3A 5DMLA 4XAZA 3KE0A 3TWBA 3VNDA 4ZFCA 1X1ZA 3TA9A 1CYGA 4O8RA 3AO0A 3DDMA 2F8QA 2UY2A 3A3WA 4K39A 4J3TA 4LUSA 1U2YA 3N73A 1NDVA 3WLIA 1UA7A 2LLEA 1Z89A 3DFNA 3NL3A 3GTIA 1KW1A 1J11A 3TE9A 2P0IA 1CEOA 4TVCA 1YXYA 2A79A 4U2ZA 2CKRA 2OQHA 1IQ8A 3NL2A 5DLCA 2RUSA 2PDBA 2QUMA 1JNDA 3W7NA 2WYSA 4JTIA 3MSGA 1WZLA 3DERA 1LBMA 4M7TA 4HSHA 3ARYA 4MB4A 2QEZA 4LALA 2YL5A 3LSCA 4HYWA 5AYBA 2INEA 1BVNP 3PZNA 4M0XA 3WSUA 1R2SA 4QAWA 1HGYA 2X8RA 4R85A 3UBPC 4IQLA 3W24A 2OZ0A 2VEPA 1F3XA 1IIHA 4UMCA 2C8NA 2QPXA 4IHCA 2VGBA 2PD5A 4RUBA 2E6YA 2VC6A 1E1EA 1BQGA 4JR5A 3S2CA 1EIBA 1J6OA 3N13A 3GG7A 3NDOA 1VEOA 1GG0A 2PDKA 3QV8A 2RDXA 3KXQA 1HTIA 2WSPA 4Q8TA 3N18A 4M6PA 1YNQA 4B92A 5I6SA 1R9XA 3A24A 3T0DA 2VQTA 1JXJA 4L6HA 3BCFA 1PO9A 2DQXA 4LYKA 3CPRA 1TO3A 2V6AA 3CM4A 1H3GA 4CQAA 4IX0A 3AIQA 1FP9A 3GW0A 3LU2A 3IPWA 2HWGA 4OOZA 3A9IA 3QR3A 3N04A 2KAUC 1TMLA 3P8JA 2ZKMX 5K4ZA 1XRVA 3NFUA 3VOGA 4QSHA 3CWHA 5C5YA 3BSMA 3N6HA 2WCGA 5FF3A 4K8GA 5DCEA 3WK3A 1ODZA 4ATLA 3NSMA 1HJVA 4NXKA 4EE9A 4RL3A 2ABAA 1UD4A 2IPJA 4UFLA 4GX8A 3W23A 4FXFA 4PZVA 4NZ1A 1YTKA 1RK6A 2XIQA 3BMWA 3SCWA 3IK2A 3QC3A 1UKPA 3HG3A 4O17A 3ZXWA 4KBXA 1W3KA 1Q6EA 5FD0A 3RM4A 5REQB 1I1WA 1O7AA 2FHFA 3WNPA 1R3RA 1ZUAX 5KINA 3K2GA 2E3ZA 3V5OA 3S9YA 3M6YA 3PBGA 1Q6DA 1EC7A 1QO2A 2X41A 4A3RA 4MLRA 4JNZA 5C71A 5DXYA 2WNNA 3T44A 4XKYA 3D6NA 5LIYX 4GO9A 1E55A 3WUBA 2Y8UA 2QXWA 4BY3A 4LVBA 1BTCA 5U7SA 1X7FA 2UWFA 2HE5A 1XGZA 3RG6A 3C86A 2X1IA 1W17A 3W85A 1BGAA 1O5QA 4DUVA 4CD7A 1C93A 5AKQA 3SZ8A 2Y2WA 4LB3A 4O50A 1E15A 4CD8A 2PDLA 1ZJAA 4F0KA 2ZTJA 3HIJA 3AMLA 3TNOA 3IAPA 3NZQA 3T4WA 3MY9A 1MXDA 2GK1B 3EMQA 4XAGA 2VKZG 5HAOA 1E4IA 4CNNA 2RHGA 1TV5A 4U2YA 3UETA 4D9PA 1L8NA 1ISYA 4YN5A 4X0NA 5BU6A 4XD6A 3LQGA 5PTDA 5I3GA 4AZBA 1UKSA 2PTYA 2PDCA 4LCSA 4P8XA 3CT2A 1E6SM 4FSAA 3TQKA 2VEIA 3QHMA 2Y7FA 1HJUA 2ISWA 3ISIX 3ZJ7A 5T9CE 3RHGA 2E4TA 3OO2A 1VB9A 5EGRA 2F6KA 1IWBA 4OIFA 1ZHAA 2FB3A 2VRKA 4GZJA 1MUWA 1ICQA 1GT8A 1E5NA 2GJXB 3WBAA 1O5KA 2HXTA 3DOPA 3IJQA 1E72M 4H9VA 3ZVHB 3HGSA 3WLTA 3H2FA 3UZXA 2CLOA 4QE5A 4HKPA 2YLLA 5EU9A 4AXKA 4P5UA 4IJCA 3H23A 4YLWA 4DXXA 4U3AA 4O1AA 1CCWB 3ZWSA 1DBTA 4JIEA 4EWND 2A1YA 4AD0A 2HSAA 4YTSA 3N2BA 3UQNA 3T9PA 3RDKA 2BVDA 3BAJA 2ATSA 4XAFA 1KR1A 2P88A 2POTA 4A6GA 2PDJA 1VYPX 3NA8A 1JRCA 1M7JA 4NVTA 3UWEA 1PKLA 4MHBA 1SUXA 3NZRA 2PCQA 3LOTA 2X05A 3TNBA 3W70A 1UUQA 4Q3MA 5HPCA 1B3WA 3I7QA 4REQA 4I5XA 2V5DA 4TR9A 3KCJA 3DFHA 3JUGA 4KESA 4RW3A 1XYCA 1JYNA 2R9RA 4S3CA 3JRKA 1V03A 4H2CA 2V5BA 3HPFA 4ZQCA 1QFEA 1EGZA 4MYAA 5MF5A 4BWLA 3HG4A 3VCNA 4CU8A 1L2QA 3T08A 3O15A 2D2OA 4C5YA 2X1RA 4HA0A 3OEXA 4JZ5A 2G50A 3MA8A 3W81A 3UYIA 4HPGA 5BXSA 4L64A 3T0CA 1GORA 1EEPA 5E0FA 1TPB1 3WL0A 4FK9A 4P8WA 4YVXA 4GE8A 3PBYA 4J3VA 1KM3A 1POKA 3C3NA 2B31A 5LHEA 3JU2A 1B54A 3D3FA 1EC8A 4GNKB 3VMNA 1FUYA 3IIOA 1Z32X 1WDRA 2P3EA 4AX6A 1VHCA 3TROA 1P7TB 1RP9A 3ZSTA 1JL8A 3L0KA 2PGEA 1W5QA 2RGMA 4Q4MA 1JD7A 2BVTA 3QY7A 3WLLA 1XC4A 2O9PA 3L4UA 4GVGA 4V2XA 1UPPA 5F7UA 1GCYA 3ZT7A 1LG1A 1XCXA 4PMQA 1BXNA 4YPJA 1BYBA 5JBEA 3PZGA 5BROA 3O0FA 1W9BM 2XM1A 6A3HA 5HNNA 4ZOCA 2QCNA 5EBAA 4MZYA 4NZFA 3H4XA 5FJJA 5TQLA 1DWGM 4M29A 3L2MA 1Q4NX 4D1IA 1TQJA 4H8UA 3RO8A 2GGIA 2PGRA 4JPGA 5I06A 4WY0F 5LA2A 5AC8A 4MSSA 1P0NA 2DZVA 5AECA 1XUZA 2J27A 1DV7A 2JFEX 4YWSA 1JPDX 2X1SA 2HS6A 2BODX 1CNVA 4UBPC 4R33A 4GH3A 3O05A 4TVDA 3CZGA 3S5OA 4FF7A 2J75A 1KWKA 2V3GA 3NDZA 3QN3A 4PUJA 3W2JA 1A53A 3OBKA 4XISA 1H1ZA 3LGDA 3ABZA 1HVXA 5LGXA 4MM1A 3TAOA 2TODA 3QFEA 2PURA 4NJHA 4DUXA 4IPJA 1C29A 3FV9A 3VVGA 2X1TA 3RCMA 4B5VA 5K9XA 2XH4A 1N8WA 1UJQA 1ZAIA 4P2VA 3TTQA 4WOQA 1JDDA 4ZQRA 2PDNA 1H7PA 1RCOB 3QOMA 3BLEA 5HQEA 3EDDA 2CHRA 1Z48A 1GQNA 6PTDA 2NXHA 3OGSA 3N34A 2DZXA 5AZ1A 5FI8A 1V0MA 4WX2A 4XO6A 1VCVA 3GTXA 1QW9A 3AIBA 1VJSA 4RXFA 3Q4DA 1E6NA 3B8WA 3PS7A 3BL3A 1A49A 1TWZA 3WBWA 1OC5A 2DT2A 4CCEA 3LN3A 2NVCA 2QZRA 3OQEA 5GQBA 1H7WA 1Y5WA 1CDGA 1XLBA 1K4GA 2QYGA 3FJ6A 4R9OA 2IQDA 4S3BA 5DN1A 4HD5A 3L4WA 3KAOA 2WV8A 3GKAA 4LBRA 1UA3A 4B3LA 5D33A 3GU1A 3PM6A 4HQVA 4WOZA 3WMBA 1SM9A 4AIOA 1ZPTA 3S2NA 1S3TC 3TYUA 4DAFA 1K6WA 1E0WA 4IP5A 2OFJA 3LTPA 4MB5A 3UNTA 1WDDA 2Y61A 2AL2A 3RU6A 1XBZA 1WUFA 1R38A 1ISXA 3G0UA 4GFIA 3TAKA 1ENUA 2A6LA 3W1AA 3QPYA 3KOYA 3FCPA 5F4SA 5H6HA 4Q4SA 4W7UA 1TWSA 4LSBA 3HFTA 5CBBA 1KNWA 1WYIA 4MIMA 1G67A 4CD4A 1XFCA 1XDMA 3DX5A 5D9PA 4JBRA 3ZFHA 4QJ5B 3CIVA 4GG9A 1O4UA 2FDSA 1DJZA 1R2TA 3TTEA 1Q13A 2XHYA 1WE5A 2VFDA 3U7BA 3DG6A 1TTQA 1F74A 4U4MA 4C1LA 1DJXA 4XAPA 1QW7A 2VT0A 3MMUA 4E8CA 3R43A 5I23A 4UFKA 2BASA 3VNJA 4TV6A 3SR7A 2XSXA 4CN4A 2D0FA 3R79A 2C1IA 4O8AA 3QY6A 3CC1A 3BOXA 4WXZA 1SZEA 2ZA2A 4RZ6A 3EWYA 2QHAA 4ORMA 1TPEA 3Q2DA 1GVRA 3GXNA 4G9PA 4PTNA 3ZJKA 3BW3A 4PUWA 3QQ0A 2A3LA 1LQAA 3CUJA 3VZYA 3QC0A 5REQA 1EFZA 3P81A 3QLLA 4HU8A 2OPJA 3N14A 3Q58A 2CZEA 4WDXA 1AQ0A 2WAGA 1QATA 4CQDA 4KCWA 1WXZA 4AG0A 2FYMA 3O8AA 4JEJA 3BJSA 1S5MA 1LLOA 3QRHA 1EYWA 4KWOA 4C6NA 4YHGA 2W79A 2W6RA 4KFPA 3GG0A 2PWVA 5DRCA 4N2YA 2ZXAA 3UZZA 4ZFMA 5A8GA 3CO8A 1UBSA 1MVYA 3RK8A 2R82A 2HK0A 2FJKA 4F66A 3OYZA 3K4WA 4S3DA 2CHOA 4AD2A 3WQOA 4D6GA 1P6BA 4PTWA 3RIKA 1N2VA 3PR2A 2A3CA 3W1LA 1CPUA 1KV8A 1E0VA 4H7CA 3N17A 2XH2A 1HL8A 1Q7QA 3VKCA 4ICNA 1UWUA 1GPFA 1VHNA 3UCQA 5G4WA 5KMYA 4LY8A 1F3TA 2IKIA 3LLDA 5A8MA 3PJWA 4GC3A 1W3JA 3CS2A 4KIRA 4GINA 3BGJA 3WQVA 1GOXA 1LT8A 4JYDA 2HS8A 3WELA 4QDWA 1UW9A 1J10A 4QROA 3GX9A 1HP5A 4W7WA 3G3MA 5LNVA 4LUYA 3FKRA 2GJXA 4Z2GA 1U83A 5DMNA 4LXFA 2QNEA 1SO3A 3P0XA 2FVLA 4O1FA 5H1WA 1PVNA 3UWYA 2X7VA 1O1HA 3UJSA 1BKSA 3BE7A 3I4KA 1BKHA 2OCZA 4GX9A 4OU1A 2QJMA 3FJ4A 3PP7A 4NX5A 2FGBA 1TB3A 3W1QA 4JY8A 3W1PA 2ONEA 4WRHA 1EBHA 2CITA 1GYMA 4Z2HA 3UG5A 2QQ6A 3TJXA 3R4IA 4TMCA 2OKTA 3W2LA 1KGXA 5HMDA 3M0HA 3GAKA 2C1HA 3KDOA 3TTYA 5A6LA 3KOWA 3MKKA 2VI0A 1UOZA 1C8YA 4AWUA 1UROA 1V79A 1WO2A 2QIIA 5ABFB 3KVLA 4C6PA 1GVIA 2Y24A 3AICA 1FVPA 3M0YA 3M07A 1O6IA 3PFRA 4GIAA 4PMVA 1ZLPA 2J66A 1TV3A 5A8OA 1BTMA 3V0SA 2QW5A 3W74A 2E28A 3NJ3A 3L23A 3BSGA 5MKGB 2J9YA 1TV2A 1Y0EA 3CTTA 1UWIA 1G4PA 2E5DA 5D30A 5C9ZA 4E2BA 3ZLGA 4HYRA 1TZ7A 2XVNA 1E4LA 4L9ZA 5D2WA 1QI3A 1QBBA 1Z7AA 5D03A 2DIJA 3GR4A 3IIVA 2X42A 2CC0A 2OU4A 2IPGA 3OLIA 4IIGA 4H9YA 2IQTA 5HUOA 4EPKA 1RLDA 1A50A 3R11A 7PTDA 1JULA 3N6QA 2G41A 4MPKA 4ENLA 4AEEA 3SAZA 1PV8A 3S0CA 3LBOA 3LM7A 3WQFA 1W9VA 5I3IA 3PZ9A 1TVNA 3JS3A 4HK6A 4MNLA 3I3EA 3FVDA 1ONEA 2IS7A 1RK5A 2PDQA 3W1RA 3CMGA 1WDSA 1QPKA 1P7TA 5K2ZA 1GKRA 3TWAA 3IACA 3VC6A 2XISA 1F8IA 3AISA 1BD0A 2WVSA 1DQWA 2IQ0A 2EXOA 3Q37A 2ISDA 2G5WA 1H1YA 4A29A 4GOAA 3AUOA 5G4HC 4TOQA 3PPGA 5J8LA 1UWQA 4IGHA 3MB9A 3ERPA 3TQVA 3BQ6A 2QR6A 1LZOA 5LXXA 4R5EA 1EJVC 3M5ZA 4BZYA 1TRIA 4FNUA 3MDUA 4L9XA 3VCRA 1G01A 3POHA 1S2UA 1P43A 4JQ2A 4LNCA 3S1VA 3GXIA 4UTHA 4P7OA 2ZUUA 2V3DA 3RFAA 1V3KA 2CU0A 1M04A 3H22A 4UTJA 3BICA 2PC4A 4FOJA 2NXGA 2E8YA 3QHOA 4Q33A 2WQDA 1GPWA 3WLQA 3UPWA 5I02A 1GVFA 1MZHA 4KGLA 3AYTA 4GKLA 5G1YA 4B91A 1TVPA 2Y8KA 3NCOA 1IR2A 1T7LA 4F3HA 5T8GA 5MHBA 2HRWA 1REQB 4RKAA 4RXGA 3L2LA 1TPFA 1JZ8A 1KGUA 4M51A 1HG3A 2PLCA 3KRBA 5FSEC 1IXQA 2FB2A 3HO8A 5CZTA 1IT7A 3CT7A 3MUZ1 3A5VA 3SY5A 3CQKA 4PE8A 5FF2A 1V3JA 4EKJA 1GQKA 5I77A 1HX0A 3QVQA 4WD0A 2CHNA 1R5YA 5FJOA 4PMUA 1WDWA 1VFUA 3GUWA 5XIMA 5HATA 3UA3A 3RRAA 1JZ3A 2WSQA 3OJGA 5A6KA 4JD4A 3GXPA 3ARWA 2PU0A 1I2QA 4GYPA 1OYBA 2GGJA 3MUAA 3P62A 3ZJ6A 4CNSA 3KL0A 1J12A 1T96A 3LB0A 4GKTA 4HYVA 4WJEA 1UPMB 1GVYA 4C7GA 4CU7A 3T05A 1J18A 3ES8A 5FF7A 2PWFA 1XUUA 2TPSA 3WX7A 3P93A 4AD1A 2ZC1A 1OK4A 4CN1A 3GQYA 3TW9A 1QU4A 3CPUA 1RALA 3W01A 2Z25A 2G3FA 1PUDA 3T2QA 1RBLA 2H9AA 3LUTA 2ZUTA 3OG3A 3CNYA 4C90A 1EQPA 2EBNA 4O11A 2YYTA 4MUZA 4MWAC 3M0LA 5FACA 1N82A 1U1JA 4IMFA 3UWUA 4C7FA 3WL1A 4ZB0A 1C91A 2I16A 1KM0A 4H9XA 5BRBA 2UBPC 2FHBA 5G5IA 2VX7A 4L6OA 5M1TA 3HFYA 2CW6A 1F73A 1Q8JA 1FCBA 3O7UA 1DWFM 2GVGA 3GAYA 3IWPA 1J93A 2DUXA 3NQDA 1U1HA 3FJNA 5I3DA 3VD9A 1O5RA 1RPXA 4UMAA 2WC4A 3ITLA 4HVXA 2TMDA 2XTKA 4IP7A 3NQ2A 2IMRA 4W93A 1W2VA 2PTZA 2NUYA 3N4AA 2UY3A 3AXKA 1TTJA 3BZGA 3DHPA 3GC2A 2DJLA 4KFNA 3W82A 1TWIA 1OCBA 4I9AA 5CPTA 3NXFA 3W7LA 3R8HA 3W7GA 3TR9A 4Q4RA 5BW6A 2VNCA 2VQUA 1SFJA 2BB0A 4HGXA 1CW2A 3LHVA 1CGVA 4S3AA 3RF9A 5A6BA 4C60A 2H8ZA 2R24A 2DT0A 3BW4A 4R88A 5DT7A 1E56A 2PUZA 4F0RA 3CLWA 1WUEA 2FMOA 3QR0A 4OE7A 1KRCC 2OVLA 4S2BA 3PWIA 3VGFA 1SO5A 3GDLA 3WLHA 1S2AA 3RR4A 4IPLA 2GUUA 1MQPA 4LW7A 3W72A 3KUMA 4HB7A 5L6UA 3H2MA 4IMDA 3IANA 1VYRA 1G7UA 5GJPA 1EZWA 4ECLA 1SVDA 5C2CA 3BDKA 4HMCA 3LHYA 5HOSA 6REQB 2BHYA 4AHPA 2Z1KA 3CZEA 3IJIA 4WJ8A 3S9ZA 3S5SA 1KWGA 3WEZA 4UTKA 4B5TA 2QDEA 4M6UA 3GBEA 4PN2A 3R89A 3MUIA 1ZBWA 2D20A 4GXMA 4X9YA 1MXGA 4CVUA 4JY9A 1LROA 2D2GA 2O9TA 3EEGA 5EY5A 4X0VA 2WC7A 3TN5A 2PBOA 2G3JA 5I09A 2VR4A 3EXSA 3G1FA 4I5RA 4W84A 4Q4KA 3STPA 1EHNA 3OVPA 2VCCA 4XZHA 5CLWA 1ZAJA 3ZR6A 1UR2A 3WMSA 3L2IA 1ELSA 4RDYA 2C91A 5LKYA 1YW1A 3GG8A 4O1CA 4NILA 2GZXA 1H7RA 1OABA 4G1NA 1JFXA 3PB0A 2H90A 4A2RA 2VOMA 4JXCA 1DIKA 4P7RA 4QM1A 2IW0A 4LWWA 1I1XA 2ZZ5A 1TSIA 4HCLA 4MJZA 4JICA 1M3UA 1XBXA 4MKVA 3ATZA 5IRPA 7REQB 3DGBA 3HQ1A 5IOBA 1KM4A 2G95A 2WLZA 1SMDA 2EG8A 2GSEA 1PTDA 1C92A 4PA8A 5HWNA 4AC7C 1EF3A 4UQBA 2BG5A 3G18A 4RDVA 3WO8A 3SCPA 2X30A 4AZGA 4LS1A 3NSXA 3L4VA 4UWMA 3SRDA 1UR0A 5I78A 1FH7A 2V5LA 2XM2A 4IISA 5H8UA 3PB2A 2WSYA 4LYRA 3F4DA 4EWJA 3O2LA 3VNMA 4Z08A 1KTNA 4GYJA 3WY1A 3LRMA 2NX3A 4DJEC 3KRUA 4E3TA 2NLYA 4PUKA 4YXGA 4QE4A 2CWNA 1RA0A 1K1DA 1XLGA 2OYLA 3GC5A 5HULA 3KVKA 4RE2A 3CMJA 1H4PA 1RZMA 5H8PA 5D2TA 4GUFA 3HV9A 5JIWA 2W92A 1CGWA 4L1WA 4XUYA 4V33A 5A6AA 1JQVA 3CQHA 3W7OA 4XD4A 2PWGA 4PFMA 1E9ZB 3WEMA 2DZBA 3ZT5A 5ABFA 1XLJA 4HU0A 3BLFA 1UBPC 4KMQA 4UR7A 1T5AA 4J3ZA 5CJNA 1KO0A 1B3YA 3AOFA 4FPSA 4BWLC 4EX4A 4IJBA 4R7WA 3RX4A 2OEJA 4GI6A 1OYCA 1B3VA 1NOWA 5MKGA 2NQHA 4K2SA 3ZQ9A 2FGZA 2EPMX 4BF7A 3ENLA 3R8GA 4IOTA 1KRBC 1W3IA 2YZRA 4DNMA 2J7DA 4DM1A 2EG6A 4ADTA 2YL6A 5HWJA 1UQYA 4GZIA 2ZRVA 5FIPA 3OIXA 2WMHA 2YIHA 4JNMA 4XKMA 5FF4A 4D8AA 4W89A 1V02A 5LIUX 3U3HA 5DCDA 2V9DA 2FGLA 1D7FA 1H7OA 1VH7A 1FWIC 3TJ4A 5BOFA 4Z2JA 4KRZA 3QYQA 3QQWA 3S9IA 4MB3A 4DBUA 2VURA 3G5EA 3G24A 2CBVA 2BSLA 3WJZA 3PPHA 1RJRA 4B3ZA 4RV8A 1Q6GA 2V67A 2C16A 1W8GA 3ZM8A 1ITCA 4O0QA 4AY8A 1SFSA 2D22A 1US2A 1QOQA 3RITA 2PWHA 4HZ8A 1OVDA 4PMJA 3QGKC 2CERA 3EEZA 4RR4A 1E9YB 2Q71A 1C90A 1AUSL 1XJBA 1FDZA 3IGUA 2YLAA 1PZ2A 3DHUA 3W86A 2Z28A 1P4CA 1M65A 5EBUA 1XLFA 2XZ7A 2DW7A 2E1WA 1KCZA 4F0MA 2FFCA 3AQUA 5C55A 2NZLA 3BPWA 1BGGA 4UOJA 1EGMA 4NI3A 3M0VA 5LGZA 3L21A 5TIMA 4WDTA 4M8UA 2VCAA 2C79A 3MI3A 5J5RA 1REQA 4HU3A 4IZGA 4PMNA 1KM2A 1WZAA 3W7HA 3ARPA 5EYWA 4U3CA 1UP0A 3HBLA 1PZ1A 3VU2A 4GJ1A 2ZUSA 4DVOA 4U5KA 4DJDA 4MNKA 4FXJA 1EL3A 4MKSA 5D2YA 3QSTA 3UXKA 2F2KA 3V3WA 1R8LA 1XCWA 4KIEA 1H5YA 3W22A 1NELA 4AYSA 5AYZA 3PUDA 3PUOA 3DC8A 4PMYA 5FL1A 1UD5A 1JF6A 3AYRA 4FOKA 1PTAA 1V6YA 4JHOA 3USBA 1KR0A 2PMQA 2XSAA 4Q7IA 1Q63A 1MXSA 2PZ0A 4UNIA 2ZXBA 4WDUA 4IQJA 4Q32A 3WFLA 4J40A 1OY0A 4P7NA 2Y7EA 3MV01 3ARUA 3WJYA 4OQVA 5AFDA 3TA6A 1P6WA 4ML4A 2A21A 4H41A 2G4JA 2QULA 4Q4OA 1OFPA 1DIOA 4HOXA 4AF0B 4BQ3A 5C2GA 2OWCA 2QGHA 3GY1A 5BYWA 3GXFA 4H19A 1X8CA 4MJ2A 3SN1A 3EXRA 1RBOB 3S3GA 3WQWA 3QFWA 1MQQA 1TCMA 5AHEA 1AG1O 1OSEA 3Q94A 4IG2B 1XRFA 1W1B1 3IARA 1R3VA 4C7DA 1G4SA 3BVJA 1A80A 1W1A1 3HPAA 1GJWA 4PCFA 4TIMA 3EA2A 1FWEC 2FTPA 4LYPA 1CB7B 3WQ5A 1SJBA 2DV0A 3ZLFA 2VO5A 2NV1A 2V2CA 2VR2A 1ZZMA 4HNOA 5AHIA 3T81A 5AHNA 4WKAA 3ITOA 2PTXA 2J9ZA 4DHGA 3UG3A 5DY2A 1UMLA 1LWHA 3VUSA 4YS1A 4XK2A 1EJ7L 2VFHA 4O57A 3EOLA 2XWEA 3CQJA 4LBSA 4HA1A 3NWRA 4CCDA 1Q4WA 1IGSA 3FAXA 5FJIA 2J8TA 3RGTA 5FJUA 2G3IA 4BI7A 1Q6QA 2VP8A 4NZ5A 3N9RA 3PTQA 1JCLA 2PDHA 5JMUA 2YA0A 3GDKA 3WK1A 2XN1A 2VX4A 3WLPA 4DYEA 3QMRA 1XYAA 4JTQA 2FZMA 4AU0A 3ONBA 3OG2A 4AXNA 3GSMA 1J5TA 1K8CA 4IFOA 2ZUNA 5KZEA 3QZAA 1K03A 4NJIA 4UNKA 2XDFA 1RV8A 3BLKA 2Z4GA 3W37A 1OQFA 2JEPA 3BJTA 2AQOA 5C8BB 4GO8A 3W26A 1HJQA 1JPKA 3MMWA 5HMSA 3UVIA 4CD6A 1ZBVA 3HU7A 1RLCL 3NQMA 6TAAA 3R58A 2A3HA 4POCA 2IKHA 3FYYA 4AYGA 2QF8A 3I7SA 4Q8WA 6REQA 3H2OA 2WWDA 1QI5A 4O1DA 1W8SA 4ADSA 3EX3A 9XIMA 4A4AA 3EWBX 1JZ6A 1KB3A 3PUEA 3VIPA 3OZPA 1BG9A 3ME3A 3CAQA 5C7VA 4ZOEA 2BMBA 1BLIA 3MC5A 3LCWA 4MDOA 4YTQA 3WNLA 4JX6A 4MF4A 3QGVA 2RDTA 1FHUA 4QG6A 4H00A 1H50A 4I6KA 4PCPA 3A4XA 2WHMA 3S2JA 3UY8A 2HJPA 5FEPA 3IV3A 3SECA 1XISA 2DUAA 3GHUA 1A5KC 3EB3A 4EXBA 1ZB5A 2YCKX 3GD6A 1W9PA 2YXXA 3UP8A 4ZBCA 1VFLA 1V7AA 1DPMA 4DPQA 1DORA 1SO6A 3SQSA 3UXAA 3QXBA 1VCFA 1H2JA 5D2VA 5AHLA 1X39A 4JQ4A 3T40A 5TBOA 3CMFA 4RPQA 3JZEA 4HZMA 5EMLA 1H61A 7REQA 4Y7EA 3AHYA 4Q22A 3WH6A 3BUVA 3BG9A 5E09A 4XSLA 1TREA 4NZ3A 4NZ4A 2NVDA 5HNTA 3W3OA 1UD3A 3FGCB 1JUEA 1GYNA 3RNDA 4K36A 1UUMA 3LCIA 3UERA 2PWEA 1CTNA 1JR1A 3VDHA 4C6MA 3VX1A 1KFBA 3L0NA 4G2DA 1P5BA 3THAA 1EJRC 3LYEA 1A47A 2VC9A 4LCRA 1VRXA 1KRAC 1AD1A 1EXBA 3PBMA 3W76A 4C6OA 2Y70A 2YDAA 1FBAA 4XVEA 3NZPA 2PRLA 2BV9A 4MY8A 1KFLA 5AYIA 3UCCA 1HIZA 1QWKA 2GQ3A 1NDYA 3CB8A 1YIXA 3HGRA 3CH9A 4QXIA 3KRSA 3MHUA 5G1TA 3KOZA 5BXTA 2CLMA 1FDJA 3NYZA 3MV11 3FX4A 3AROA 1TIMA 4ZSUA 4NNCA 2C6QA 2Y89A 1ZU8A 1XX1A 2EJAA 1KM1A 3QPZA 3VDCA 1MFUA 3G1VA 4E5TA 2ZRYA 3C0QA 3I6TA 3LXBA 1DXIA 1XH1A 5ECUA 4D72A 3VOIA 5BRPA 1UMYA 1UWSA 3NGFA 3LCHA 1B2YA 3MYPA 1AW5A 4NJKA 4O54A 4WGXA 4PB3A 1XBVA 1QMLA 3GW3A 3FA3A 3WK2A 4CU6A 4U31A 1ZQ5A 4HNUA 1FWNA 4OV9A 3L66A 2Z27A 4KH2A 4JHMA 1F2JA 3OU8A 1JJKA 1KM6A 1F9CA 5FA5A 3OP2A 4I90A 3GDTA 1OFAA 2EPLX 4IH3A 5D02A 1YKWA 5F4WA 3A12A 2PC8A 2GUBA 3RLHA 4AD5A 1ONRA 1R3TA 3UJFA 4ERIA 3VGDA 2IPWA 1XIGA 3BZJA 3MP3A 1TMHA 4DIAA 5AVNA 2QUNA 1LYXA 4L5ZA 1GVOA 3K4AA 4H9MA 4B5XA 1NJJA 3OGVA 1EYEA 2ZX6A 4I9TA 2EAWA 3A64A 4NQ1A 4A8LA 2GPTA 3O9NA 2PLMA 1KKOA 3ANYA 1NFPA 3AU6A 3VOJA 4C1NB 2VYOA 3W25A 3U2OA 1I4NA 2WPGA 3M5YA 4WKFA 3GM8A 4YHEA 1XLAA 1VENA 4NRSA 2ODOA 3EMZA 1LQ0A 1BSLA 2PB1A 3C6CA 1S39A 1WOBA 2Z2AA 1P0BA 5C9WA 4YCPA 4JGDA 3FOKA 4N42A 3E38A 2JQXA 4XX6A 1XIFA 2HE8A 1VAHA 4ES4A 3ABOA 3L67A 1TX0A 2O55A 3PC0A 4FR6A 3VZXA 2CLPA 1FH8A 4NAFB 4JDYA 1OGSA 2VWTA 3L5LA 5HUPA 2W3ZA 5ABEA 3TIMA 2WMJA 1VFMA 5D2XA 3LM3A 4CNUA 1V7YA 3OA3A 1VIZA 2YJQA 3WKZA 1NSJA 4L7ZA 4XSMA 1L6SA 1DJGA 5DMYA 3TMLA 2DZUA 3BCDA 3MDWA 1H11A 1TYGA 4DJFA 2HVMA 3R25A 2YCIX 3Q45A 4GYPC 4K37A 4HPNA 1EDTA 1EUAA 4JQ3A 4PRWA 4GFSA 4D8LA 3DGRA 1AH4A 4PC8A 3AS1A 3W38A 3BJFA 2ACRA 2W5FA 1MMFA 5B7YA 3N2TA 1XHGA 1OT2A 4CLMA 5A2AA 1XDJA 1VFTA 4WJXA 1V0KA 1PIFA 4AD3A 3AMCA 4I8YA 1UWRA 1DL3A 1Q8AA 4JFSA 1Z69A 4Z2IA 3EWZA 2XIMA 3K1GA 1XSJA 3WQGA 4Y8EA 1TPC1 1TG7A 1FCUA 4DLFA 3T09A 4GY7A 2VHLA 4LV4A 5HQMA 3CHEA 4H4IA 5CEWA 1KFKA 2PODA 1BF6A 5HPOA 1FH9A 2H6RA 2ZRZA 3A13A 2PS2A 1ZRQA 3SIMA 4UTMA 3TCEA 5HJYA 4E38A 3CZLA 3S6TA 5TNVA 4PTMA 3KRZA 3VIOA 4AF0A 2GGEA 3G1DA 3W2KA 3KLLA 2OWXA 1TJRA 4LC6A 3TUUA 4O4VA 1GVSA 3MPGA 4Q6XA 1FHDA 4L1XA 4FR1A 4KETA 5DCBA 2CZFA 4R9XA 1S2WA 4IG2A 1YADA 3ALFA 3EZ4A 2OZTA 2ZX5A 4B4FA 2HDJA 3U2EA 1JYWA 1R3YA 4M7SA 4GI9A 3EBVA 4D1JA 2VFEA 3NDYA 3WH8A 4L80A 1Y5VA 5GNZA 5J5DA 2WZMA 3DEQA 1D8CA 4QP0A 5BWFA 3TYAA 1XIHA 2R91A 3M43A 4IXXA 2AGTA 5T26A 1TCDA 1ISVA 2PGFA 2WZTA 5JXQA 4AZ5A 5H2ZA 3TVAA 4HPHA 2VZUA 3B0PA 4XG1A 3QMTA 2J79A 3QQ1A 2VUYA 2FJUB 2Q01A 2J78A 1NTHA 2FPTA 1G94A 3LS9A 1GVEA 3BLDA 5D4YA 1MI3A 1CLVA 1X6UA 1ALDA 3A4WA 3SCNA 3WDQA 5FSDC 2YW3A 4PYSA 1QOXA 3HN3A 3AYSA 3SUSA 4YCOA 4JEQA 5B80A 1AH0A 2WJZA 3R1ZA 4TX6A 1OD8A 1PSCA 3TYZA 4LF1A 3QF0A 1MO0A 1PE1A 4TXEA 2DVUA 4H3DA 2VD9A 3GIQA 2IXVA 1LL6A 2BXYA 4K8EA 1PS9A 3L5MA 4EF8A 1YYAA 2EPOA 1RD5A 1RY8A 5LIXX 1JDEA 3LY0A 2O9RA 1E6RA 4WSHA 3UR8A 4O52A 4DX3A 4ORIA 3E2VA 3H6OA 4PTDA 3CZ8A 1UIOA 4GY1A 1IEVA 3G6LA 3SEPA 1KGWA 1UR9A 2IXUA 3EOOA 2HVNA 1SYTA 4TVUA 3URNA 1X1OA 4LUIA 3LLXA 4J5NA 4JFTA 4NASA 4HMEA 1X8FA 3U7VA 3VMPA 1E6XM 1BVWA 5J04A 1OFBA 3LBCA 1B5TA 4FNTA 1ZY9A 1WA3A 3UG8A 3DI1A 2E8ZA 2X40A 1SQ7A 2OZ8A 3N2CA 4L9YA 1NP0A 3EDJA 1Q66A 4LS2A 3II1A 3FVMA 2ZDSA 2V68A 5A8PA 1GJUA 1BG4A 4FS9A 1MSSA 1EWEA 4EPDC 4LC8A 4KFOA 3WUEA 3R13A 3BQ5A 2J47A 3GRIA 3PTMA 4HU4A 3P7YA 4UTFA 5FCZA 5A6JA 4XKYB 1VGAA 2CYGA 4ZL1A 3OVGA 9RUBA 3ZVIA 3SCQA 4C65A 1EO7A 2HK1A 1EO5A 3HJZA 3PY2A 4JYFA 2Z24A 3LPFA 3K46A 3W6YA 4QJ3B 1G9HA 1MRQA 4H83A 3QW4B 1WAUA 4DELA 3COTA 3FGCA 3W73A 4Z17A 2VGIA 5BZAA 1XS2A 3BAKA 3S8HA 4DUOA 1DQXA 3R12A 2GWNA 4WKHA 4AFYA 1CWYA 4O18A 4OWGA 4RPPA 3SSZA 2VFIA 4KWWA 4ADUA 1KKRA 3G22A 3PWAA 4NT0A 3SCRA 3O07A 1UD2A 3QHNA 4BQ2A 2WWCA 2EJ1A 4ZVJA 4YL2A 3P82A 1VBHA 1R3SA 3OW1A 1F05A 2ZZ7A 3OLEA 4DEFA 2OX1A 4M3PA 3W1XA 5A69A 1M53A 2Z7GA 3EX6A 1HT6A 2OQYA 3TSBA 4LX4A 4CKQA 3UJRA 1LRQA 2A0NA 2V81A 4UQAA 3ID7A 5CPOA 4J27A 1R47A 2YB4A 1XD0A 3IJLA 3I68A 4BI5A 3QOKA 5D38A 3LMZA 4CCCA 2Z1WA 3QH2A 3JW7A 3UXLA 3SRHA 1YHTA 2YOCA 3RYSA 3U48A 5HK4A 4DF1A 1PDYA 1Z8AA 4YU1A 4ZSTA 4FNSA 2C71A 2CESA 2Q3RA 2ICSA 4WDWA 3FA4A 2WSKA 4A05A 5I03A 4J7RA 2ZXDA 3DG3A 4EVZA 5CSUA 3QTGA 3Q67A 4HNCA 2MNRA 4DF0A 5IDZA 1G0CA 2Y4SA 4YNGA 1VPYA 2QJIA 3M16A 2VELA 1B3OA 3EOEA 4MOZA 5CBIA 2Y5SA 1BWVA 4IGSA 3VFCA 3AXHA 4KS0A 4LUTB 1TTPA 2VEMA 1C7TA 2XVLA 5HR6A 4REQB 4UOQA 3NQGA 2E67A 2XIBA 1BAGA 2WNQA 3GO2A 1ZFJA 1Q45A 3ZT6A 2QUVA 5LHFA 3AIUA 1LP6A 1VEPA 2CPUA 2ZOXA 5XIAA 3WZ0E 1DHPA 3BWWA 3BOLA 4I9JA 4XZNX 3GHTA 2WKJA 4C1NA 3D5HA 2GQ8A 4INFA 1OG6A 1CBGA 5HJXA 2PRMA 4W5UA 3CZKA 2FHCA 4P8VA 1F6YA 1OZMA 1LCOA 3E0FA 4ICMA 1A5OC 3CUFA 4WEVX 3WJSA 1XYBA 2V0TA 4LV9A 3C2VA 4OBSA 3W1TA 2VRQA 1GEHA 1QNOA 3BCJA 1Q7ZA 1DJQA 1SGJA 3MCNA 3NOYA 3KW3A 1O60A 5M2FX 1J9YA 5FEZA 1PEZA 3W7QA 4IQEA 2C15A 4DJDC 1EP2A 4J3SA 4H9ZA 4S3EA 3AUJA 3FSTA 2FZ9A 2XZ9A 1CXHA 3P60A 1X1NA 3WD4A 4GHRA 5DANA 3RPMA 1KBLA 5AY7A 1ISWA 3IGSA 1E0XA 5DBUA 3G77A 3N6JA 2XIJA 4GQQA 2Z1SA 3P84A 2JE8A 2BZNA 2G37A 4A3HA 3B8TA 4S23A 1FTXA 3N2XA 3TOYA 4O1EA 5BWAA 3WK0A 1QK0A 3T07A 2CNCA 1XH0A 4E6MA 3J7HA 3UR7A 5F2LA 3MHGA 3W6LA 2WJEA 1ZCCA 1RBAA 1X6LA 5DT5A 1RQBA 2PP3A 1JI2A 1TZ9A 4AZHA 2X2YA 1O95A 4HNLA 1OADA 3QZEA 4UTLA 4Y9PA 4TMBA 3W7IA 2P3ZA 2I17A 1FKXA 5ABTA 3F7JA 1BQCA 4GMEA 7CGTA 4BHYA 1JRBA 4GH1A 1F3WA 2YYUA 1XIEA 3F5JA 3TXZA 1HKJA 2W66A 1GW1A 3H7VA 1BYDA 4G7FA 1EKOA 1CIUA 5U4NA 4F2TA 5IFPA 1SSGA 2I56A 3KBSA 4C1KA 2YDSA 2RAGA 2JF6A 6XIMA 1LJYA 3W1UA 5DBTA 3BLLA 1O94A 6XIAA 1QOPA 3WLKX 2WCAA 3AZRA 1WPCA 3KBNA 2GJNA 3N25A 1P0KA 3EDEA 4ICCX 4QRNA 2O92A 5CH9A 1A0CA 2VL4A 1TKKA 3CIXA 4QS6A 2D69A 1V6VA 1BYAA 4O0KA 3GHSA 4FLQA 4DYKA 2O9OA 1GONA 1VKFA 4H6QA 2PDUA 4PBEA 3ATYA 3VOFA 1AQHA 3PBVA 4M1RA 2R1LA 1TPWA 1QJWA 4N6EA 4XZWA 4UC5A 1KFEA 1YLVA 2Y0FA 4OTKA 4YTUA 2DSKA 2PWUA 3V5CA 1YMYA 2B4GA 2I7GA 4PUMA 3E0VA 4B90A 1BXBA 4XTIA 1UD8A 2E6DA 1V08A 2DSWA 4AMAA 4MKNA 3R5EA 3W4RA 4XQ6A 3W7CA 4M1BA 3VI2A 3M0JA 2PSNA 1QK2A 1ZAHA 4L4OA 2Z0IA 2ZRUA 3LCXA 3VYLA 4DRSA 3LMYA 1EH9A 1KLZA 3LXAA 1NDWA 2R8WA 3D0CA 2AL2B 2QLYA 1ZGDA 1A0DA 1KTCA 4W8AA 1B9ZA 4XBKA 5C54A 1Q65A 3ARZA 5I3HA 5AOUA 3SUVA 1D3CA 1MEIA 3M5VA 1W2PA 4IJRA 3W27A 4MZ1A 1TJ2A 4AIBA 3R2GA 1DEDA 1IWPA 3M0MA 5HWMA 2PLKA 3WMLA 2YDRA 1EGVA 1O5XA 4OUEA 4CEXC 4J4KA 2HPIA 1PX8A 4JTSA 1VIWA 1XPYA 1CXEA 3SUUA 1E51A 4JTHA 4JTJA 1HL2A 1GOKA 3CV7A 1KBKA 3KL5A 4S38A 2JK2A 3CIWA 5JU6A 3MP4A 3MT1A 3LHTA 3DFQA 4IPPA 2F6XA 2W0UA 4LANA 2DH3A 1KV5A 2J7EA 4ZMGA 4KEZA 1XM3A 1DYSA 5E6YA 1E9LA 2WKLA 2C14A 3TJIA 4KCTA 3KVMA 1OFRA 3N4EA 1OFOA 1X96A 4DBSA 5FEWA 1U1UA 1DXEA 1MW0A 1V3IA 1XYMA 5LXEA 1F3EA 3AI0A 7TIMA 1D3GA 1HXJA 3AWNA 3LPPA 3HJEA 4UUIA 4I3GA 3GZ3A 1AJ2A 3LZ5A 3UD6A 4JDBA 3KWXA 1GK8A 1I2OA 2XG9A 1Q2RA 1YTEA 4EOUA 1JFHA 4OGZA 4LAMA 3NQVA 2BY1A 4BQ4A 3PG9A 1IEIA 3G0SA 4JIPA 3CHFA 1RR2A 1XC6A 3M7SA 1UH4A 4HOWA 4E4FA 2DT3A 1UKTA 4RV3A 1W31A 4Y9MA 4H8VA 2NQJA 1JAEA 1UCWA 3PAJA 1VFOA 2P8BA 1E70M 1SW0A 4TTGA 2OKOA 2XWDA 1ZENA 1M01A 1BHGA 1SSDA 3VNIA 5D9MA 4D8ZA 1QPNA 2A7RA 4H04A 2J9XA 3TFXA 4PTVA 3O0KA 3UWVA 1KLYA 2V2HA 1KTBA 1VR6A 4LOCA 2PGWA 4CUCA 5CG0A 2EPHA 3RX3A 4L4MA 4N9EA 3ZZ1A 1PX3A 2YL9A 1E0TA 1F6PA 3UA4A 4N02A 1UP3A 3IVTA 4LAKA 4IGNA 4GC4A 4HTBA 3XINA 4LS0A 3HTWA 4FX7A 1JCNA 3KP1A 2R94A 5LIWX 3O6YX 2ACUA 2VUNA 4JFWA 1S46A 1CGUA 4BI6A 4Q8MA 3F5KA 1S5VA 3C8FA 3E74A 1QHOA 4AD4A 3K8KA 4O0ZA 1GW9A 3G1RA 1KRMA 1M6JA 4CN6A 2EO7A 1Y8BA 2ZZ1A 1UD6A 2AMXA 3GTHA 4YYCA 4ZB5A 4HOZA 3PBWA 1Y5XA 5K9DA 3R0DA 1ONXA 2Y7GA 5LSMA 1UR8A 3W07A 3WLSA 2E6FA 5D9OA 3HM7A 1XLIA 4US5A 4K38A 3TX9A 5AB3A 1NEYA 3PULA 4XZMX 1R87A 4O16A 1C8QA 1LBLA 4CQ9A 3VKDA 4K1GA 3AJ7A 2OQLA 4NF7A 3P74A 3NO5A 5IHSA 4RNIA 3KTXA 2DH2A 4NI8A 2V82A 3E6EA 3S2LA 2PRHA 3EPMA 2VVNA 3PHAA 3C61A 3WFZA 5L9FA 2EG7A 3MANA 1HF6A 1NH6A 2V30A 1QXLA 3GNDA 1W6TA 1F5ZA 1FWWA 4UNLA 5EKYA 2GDUA 4PBGA 1ZBCA 1VC4A 2WBGA 3H2AA 1XPGA 1MUMA 1V51A 4LUTA 3DU0A 1CX9A 2XGIA 1A4MA 5ABGA 4DXVA 3QGAC 1OFEA 1EQCA 3UYCA 4GQGA 2JF7A 3V5FA 2I9UA 3H4WA 1CXLA 2J8GA 4FF5A 4AZCB 2QCCA 2DP3A 3W7JA 2E5BA 4XAYA 1FXQA 3IAQA 1HO1A 3W7DA 2BHUA 4QJ1A 4N0RA 2XIOA 3BURA 1UZ4A 4TQTA 3EGJA 2OXNA 1H1NA 4FIRA 4HHHA 1FQ0A 3AHVA 4F0LA 3M9YA 1NFGA 4LJ3A 1NWUA 3DIPA 1HJSA 2DZAA 1FOBA 1PAMA 1DTNA 1XKYA 4JKKA 3ICJA 5BOOA 4QEHA 4F9DA 2ZZ4A 3LPGA 5TAOA 4DM2A 1BRLB 2ZUWA 3WNNA 3WIJA 3MO4A 4H9UA 5A6MA 4MMWA 1VPXA 2OG9A 1UR4A 4E0CA 2GGGA 2GYIA 3CUGA 4DJFC 1XFBA 3FDGA 3VD5A 5C7HA 4JTFA 1A4LA 2QJJA 2WJFA 4MTVA 4QSFA 1W9DM 4DWSB 1RY0A 4A8RA 3SQLA 5I3FA 1ZJHA 3B0UX 1W3HA 2J25A 1JNEA 4DYJA 2OGJA 1IEWA 4IQDA 5G2HA 1UC5A 1FWHC 1J0ZA 1NOUA 2V3FA 1EJXC 4MY9A 2J7CA 5I24A 4YYFA 2VENA 4E2OA 2PU1A 3H4GA 1I60A 1X98A 3N11A 4UTWA 3HMJG 4BCEA 2A3EA 3GTNA 1K8XA 3VNKA 1MZRA 3NUKA 1U22A 3VKKA 3MKVA 3BSHA 1YEYA 3ARSA 2A6NA 2WNWA 4CVWA 4X3ZA 5CBJA 1AZ2A 2TYSA 4Z2KA 3CEPA 2C7FA 1T8QA 5A2CA 3SN0A 4MAVA 3G1YA 1SR9A 1FX6A 1L8PA 3C2YA 2ALDA 3I65A 1CLKA 4RDZA 5EA9A 4WZHA 3L4YA 1VLIA 3G8EA 3H55A 3STFA 1MYRA 1ICPA 2NV9A 2HNHA 3HB9A 1RQHA 4WSJA 4DBDA 1US0A 2W91A 3NL5A 3RPDA 3G0XA 2YDQA 3A47A 4NNAA 4WLCA 1FWBC 3EDFA 4PCTA 1HGWA 1XWYA 4NZCA 3UEQA 5C70A 3BAXA 1UWAA 1QCWA 2FH6A 3E0WA 1W1TA 2P76A 3RJYA 4UFHA 4MY1A 1EX5A 1B4KA 5EFDA 4QG9A 4TX8A 4Z42C 3T1GA 2J24A 3E0LA 3HGJA 4QBXA 3KTCA 2H9AB 3GDRA 3ITGA 3F2DA 3EDKA 1EOMA 2BOFX 1V3HA 2YCEA 4OV4A 4Z2LA 3KEHA 2OB3A 1JGMA 3WNMA 1W37A 1HJWA 3C2OA 3VIJA 4CNPA 3VUPA 5CPMA 2PDPA 5DO8A 3W7PA 1V8EA 1B9BA 1VF8A 4FB7A 3R0UA 4AMCA 4Q7BA 5DQPA 1QVBA 2EF9A 4NUWA 3T7VA 4MZ8A 4IM4A 3RLVA 3TW6A 2DSUA 4MB1A 4A8NA 1YDVA 3S5ZA 5DY3A 3GYCA 3TLLA 3N9KA 5CC3A 2F38A 3PZUA 4AWTA 2GVYA 1XH2A 4AWEA 4CD5A 5M3WA 2Y85A 3M0ZA 4GCAA 3CU2A 3UFYA 3H26A 3CQIA 1LOQA 2C0HA 4ZODA 1CXFA 1QNPA 2AKZA 4MLJA 1XLMA 2WMKA 1E0UA 4FLSA 3SURA 1GZJA 3EPNA 1YXCA 1OF8A 3W7EA 4URIA 1K7EA 2JGQA 3VPLA 2BGNE 2E77A 5LYRA 3WEOA 3KCOA 3L4XA 3RM9A 2QPSA 3F03K 2WW5A 2ZE0A 3RILA 3LSBA 3FS2A 4EXQA 3M1ZA 4W86A 3EXTA 1WZMA 1XYFA 1C8XA 1FFRA 1SJAA 4QDMA 4F48A 3WJWA 4R34A 2I5IA 3MUY1 5CPNA 3FXYA 2ZCGA 3GFZA 1NVMA 4X61A 3CB3A 1PYFA 1C9WA 2J62A 2CCRA 2AMGA 1ITUA 1OG0A 3K13A 2BY3A 5A8NA 3IUDA 3THUA 4EAYA 2H3DA 4HPJA 4B2DA 1EJWC 3VD7A 3W84A 1TA3B 4IFKA 5FJRA 4Y9AA 4RZ4A 7ENLA 2QAPA 3ES7A 2VD8A 1RHCA 4IT1A 3EWCA 4O1BA 3TJLA 3NOEA 2PA6A 2WVUA 5SWUA 3T2OA 4HPXA 3B05A 5CC6A 2WKGA 1YNPA 5FAGA 3V1HA 4D6JA 3MMDA 5FL0A 3DH7A 2ZX7A 3FXGA 3MSYA 3FSUA 2XFYA 1DWJM 3N12A 1G1YA