3N9KA

F229a/e292s double mutant of exo-beta-1,3-glucanase from candida albicans in complex with laminaritriose at 1.7 a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
b'AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n9kA00
3VGFA 3BAKA 5FL1A 3SUWA 4AD0A 4UZUA 1ODUA 3EDEA 2WLZA 4B3LA 4WK9A 3CUJA 1B31A 1J12A 1XD1A 1C93A 2YA1A 1M03A 2Y24A 3ARXA 4M29A 2BVTA 2J74A 5JBDA 3L2MA 3WBAA 1PX3A 4PMDA 4PMRA 4W8AA 4CU7A 2DQXA 2WYSA 4AD1A 4AZHA 1G94A 2XM1A 3AS3A 1BSIA 2CETA 2QLYA 1QBAA 4KH2A 1NOUA 1A47A 4H8HA 3VGHA 1MQQA 4AEFA 3NSXA 4DM1A 4ACZA 2J47A 3AS2A 2DSZA 4F66A 2EPMX 4OBSA 4C7FA 5ECUA 2J8GA 1H49A 3N13A 4PCTA 1BAGA 2PI6A 4B3KA 4Q22A 3VMPA 2BY0A 4M56A 1WPCA 3MV01 1TMQA 3T0DA 1VBRA 3PTQA 3VUPA 2EPOA 4UQAA 1MFUA 3WNOA 1SMDA 1P6WA 3WF4A 5A8PA 3CLWA 5A2CA 3AXXA 3F5LA 3I3EA 1J0YA 4AIOA 2WVVA 1H5VA 4LX4A 4BF7A 3VIKA 1W2PA 1UHVA 1PX4A 4BZYA 1LQ0A 1OB0A 3RDKA 4XZWA 3KZSA 2W61A 1C7TA 3AXHA 3HU7A 1JDAA 1V3KA 4EAMA 5E09A 1XC6A 3LPFA 4CGTA 1JXKA 2CBUA 3U57A 4IPLA 4MADA 1MW1A 2DT1A 4PMUA 1UH2A 4J28A 2VCCA 2OYMA 3AYRA 4XUYA 1SYTA 5GNZA 1GONA 1EO7A 1VEMA 2D23A 1HF6A 3AHTA 4DWSA 3DHUA 2FHBA 1EGZA 1WDQA 2FH8A 1BG9A 3AIQA 3WUGA 4KRUA 3WFZA 2VTFA 1YQ2A 4UQDA 2ESCA 5LYRA 3THCA 1ITXA 3ARUA 1SFSA 2BY1A 2UY4A 1HP4A 1V02A 4PCSA 4PYSA 3M7SA 1JZ6A 3IANA 1C7SA 5A69A 4P7RA 2YL5A 1NOFA 1JAKA 3GH5A 3BAIA 4WF7A 1KWGA 1C3FA 3BSGA 4FLQA 1ECEA 3T09A 1PJ9A 2YDSA 4ZE4A 2Y2WA 2WWDA 3MV11 3EYPA 4WKFA 2VUYA 2XVLA 3L4WA 4GI8A 1ESWA 1UWQA 1G5AA 1KGXA 1MVYA 1HL8A 2BY3A 4HA3A 3ZJKA 2W66A 4J3XA 2V3GA 2J7FA 1CNVA 4TTUA 4RE2A 3PZIA 4NRSA 3ZO9A 5CLWA 2J75A 2DEPA 1MXGA 2VX5A 1M7XA 2ZIDA 2YDQA 1B3XA 1JD7A 1G0CA 1J10A 1UA7A 4YPJA 2WKGA 1GW1A 4MB4A 2ZUMA 2G3IA 4CD6A 3TTQA 1HX0A 1JGIA 1QVBA 4RE4A 4D6CA 5I23A 1PZ2A 1R8LA 3VGGA 2XG9A 2GUYA 3A47A 1GQIA 2XGBA 4AZ6A 4DWSB 3RPMA 1NARA 2V5DA 1W3HA 1GOKA 1QHOA 2IUZA 3A6OA 3UR7A 4CKQA 1BYBA 2DT0A 3IJ7A 5HPOA 3OIHA 1J18A 4PTVA 2WMJA 4WLCA 4JKMA 1B3ZA 1C92A 3SCWA 1V03A 2BHZA 1W1VA 1CXEA 5D9OA 3NSNA 2D20A 2BFGA 2ZX7A 3NDZA 5I79A 1JZ8A 1QW9A 3KL3A 3U5UA 3WF2A 5D9MA 5JUVA 4MNMA 3WQ8A 1IV8A 4QLKA 5CJ5A 1GOWA 3D3AA 1FHLA 3SIMA 1NP2A 4XX6A 4MNJA 5LA0A 1OIMA 3BAYA 5I78A 4OBRA 4E2OA 2D2OA 5BYWA 2PC8A 2F8QA 2YIHA 1BFNA 4JCLA 2XPKA 4ZXLA 2YL8A 1PPIA 2WBGA 3VNYA 4L4OA 4M80A 3CGTA 3M07A 1KXHA 1WDRA 2PWGA 3RJXA 3AIRA 1ISWA 4PN2A 1KGWA 3OG2A 4WSKA 3IAPA 1JI1A 4W7UA 3AIWA 4JKLA 2A3CA 1OSEA 1J11A 4ACYA 1MFVA 4QFUA 1K9DA 3FAWA 4QP0A 1VBUA 1ZJBA 4JFSA 2G3JA 4W8LA 1BGAA 3PTKA 2VURA 1JF6A 1H1NA 4XZBA 1D2KA 3OA5A 1HXJA 4FF5A 5BROA 3B9AA 3NUKA 1KBKA 5LA1A 4LQ1A 5HXMA 3TTSA 3GTNA 1RPKA 5I6SA 1EHNA 3HJEA 4D6IA 2G3MA 4AIUA 5BXSA 1GVYA 2CKSA 4HMCA 3PZOA 2BV9A 3L4TA 2CEQA 2OLHA 1VEOA 2BY2A 5FD0A 1V02E 2XWDA 4PUDA 1C90A 2D3NA 3WEZA 1HJSA 2WHKA 1B3VA 3MUY1 1W3JA 5GQBA 1UG6A 4GO9A 4MNKA 1BGGA 3WH9A 3ARWA 3ZJ7A 3OLDA 5M03A 3DYPA 2X0YA 3VD5A 1NWTA 1US3A 4R27A 1HKKA 1W9UA 9CGTA 3SCVA 3N9KA 1PAMA 4BQ2A 4MDPA 1CECA 1ISZA 1OINA 5M17A 5A95A 1B30A 1B1YA 1EA9C 1UYQA 3IK2A 3SCSA 3WEOA 4H2CA 1UR2A 2CYGA 4U2ZA 1EDGA 3O2LA 3GXIA 3LPGA 2VX6A 3QHNA 3EDDA 1BVNP 3MMDA 1TZ7A 1VB9A 3OLIA 1ZU8A 4X0VA 1UR9A 2C0HA 3SUVA 2J62A 2WC7A 2GJXA 1JYNA 4CVUA 7CGTA 3MSGA 3NJ3A 1CGVA 4DM2A 2G8ZA 4RL3A 1J0JA 1WP6A 5GPRA 1E73M 5JBEA 3EDFA 2GFTA 2XM2A 4PMXA 3VM5A 3BCDA 2GK1A 4UFIA 5FIPA 3WD2A 5BCAA 5FOOA 1E72M 4FLSA 4P7NA 1N82A 1IT0A 4GI9A 1X6NA 2VR4A 5D8WA 4XB3A 2FHCA 4PMNA 2VMFA 4W93A 3APGA 5FCZA 5A8QA 4PMYA 4BQ5A 1HJWA 4HZ6A 3THDA 3CPUA 3VIIA 1MYRA 4TVUA 1JF5A 1JD9A 1V0NA 5JBFA 4TXEA 2VJXA 1R85A 3MS8A 3OLGA 4A3HA 1TR1A 7A3HA 3N17A 3ZJ8A 4ATWA 2V38A 4H8VA 2PB1A 3VX0A 3AIEA 1V3HA 2D24A 1UKOA 3KL5A 2ZICA 4GIAA 1NQ6A 2J77A 3B8SA 1LLOA 1KQZA 1H3GA 3W26A 3GNOA 5BXPA 3GNRA 2J7HA 5C8BB 2D1ZA 1BQCA 1B90A 2X05A 5KZ6A 3VVGA 3N11A 1KBBA 3ARPA 3ARSA 3AZRA 4E8DA 2VQTA 1MWOA 3VU2A 4DWSC 1KCKA 2DIJA 1CBGA 1S46A 1JZ3A 2WNWA 1CXFA 4OZOA 2XFYA 4P7QA 2ZUSA 1W32A 3ZOAA 1E5NA 4AZGA 1ZBVA 1E56A 2EBNA 3GDBA 2ZXBA 2JFEX 2QHAA 2XVPA 3T2PA 3PTMA 1H09A 3WNMA 3GXDA 2WMFA 2YLAA 2WBKA 5CPTA 4B15A 3VOCA 2JIWA 3CUFA 5M3WA 4UQBA 1UKQA 1FHDA 4CN6A 4UFHA 1KQYA 3T08A 2GK1B 4IUGA 3WDHA 1JZ2A 3ZMRA 1HN1A 3RMEA 3FY1A 4UQCA 3T0AA 4NSBA 2YL6A 1V0KA 1KR1A 3ZR5A 3GBEA 4M24A 1WO2A 4DWSD 3VIMA 3PZMA 3AYSA 1I1XA 1CENA 2WB5A 4NRRA 4A3YA 2D22A 5JIWA 2ZUWA 3VIFA 1JZ7A 2OYLA 4J3WA 2J78A 2GDVA 3F5JA 2OWCA 2YJQA 1E4NA 1Q6GA 3OZPA 3ZQ9A 1OIFA 4P8XA 2BXYA 2Z1SA 1EO5A 1E40A 1KR0A 2WXDM 1LWJA 2Y8VA 1LL7A 3B9EA 3W0KA 1LG2A 3WF1A 1UH4A 3AZSA 3VX1A 2WMIA 3B9DA 6CGTA 3WQWA 5CG0A 3AOFA 1E6ZA 5HPCA 1XH2A 3WUEA 1R86A 4MDOA 1QI5A 3ZM8A 3UEQA 4MJ4A 4JZ5A 2BVYA 2VZOA 1CXHA 5E70A 3AROA 2IXVA 3W4RA 4BQ4A 2E9MA 4PMVA 1HJQA 3GH4A 1CWYA 6A3HA 3VO0A 2XIIA 1UKPA 1O6IA 5CSYA 2J7CA 8CGTA 4KMQA 1A3HA 4WKAA 5DT5A 4ZFMA 2TAAA 3UCQA 5BRQA 1GUVA 3GYCA 5CXPA 5D9PA 1W2VA 5DO8A 2OSWA 4C7GA 1KXTA 1MW3A 1EHAA 1X1NA 1XYZA 4OOUA 1UR0A 4Z2GA 3AQUA 5A94A 1Z32X 4CUCA 1E4MM 5HNNA 1E55A 3AHXA 4AZCA 2PWFA 1GOIA 2AMGA 5DEZA 2ZUTA 1JI2A 1CDGA 1UD5A 1DTUA 4LGXA 3SCOA 1XYFA 1UD4A 1JNDA 1OCQA 1V6VA 5CGTA 2NT0A 1UH3A 4AY1A 1W9BM 2YDRA 4P7OA 1H0GA 3K46A 1VAHA 1TE1A 5CPQA 4Y7EA 3VDBA 3QOKA 3BMVA 3JUGA 4PTXA 5I24A 4MB1A 4KWUA 3BAWA 3W6LA 1X6LA 1V6UA 2VCAA 4X0NA 1CGTA 4W7VA 2UY5A 3OLEA 4R5EA 2WMIB 4D1JA 1M04A 3W37A 3FXYA 1VEPA 3QGVA 4PMZA 2XVKA 3CHCA 1PX8A 3RCNA 3D5HA 1R7OA 1FFQA 1OD0A 1JXJA 2J79A 2ZUNA 4D1IA 2J7DA 3RILA 3BH4A 3AFBA 4AISA 2FH6A 4HPHA 3K8LA 4JAWA 3POCA 2J25A 5A6MA 3GXMA 4AWEA 3N18A 2FGZA 5HDRA 4ZE5A 3N04A 4LYQA 3PZ9A 1UD3A 2WSKA 3CZ8A 1U33A 4ZENA 1H0IA 2O9TA 4U3CA 4LPCA 3L4VA 3CIVA 1QI4A 2AOSA 1AMYA 4AZBA 1VFFA 2ZX8A 2DSUA 3E1F1 4CU8A 2PBOA 4FMVA 4JFTA 1L0PA 4JFVA 1ISXA 1XSJA 3WQ5A 3M6DA 3VDHA 4AZCB 4D72A 4PUEA 1I75A 2WAGA 2O92A 4P7LA 1EXPA 1W1TA 2W62A 4UQ9A 4W89A 4AYSA 2X09A 3A4AA 1JZ5A 4UTFA 1RP9A 4GXPA 1Q4NX 3ZSTA 5GNYA 5BXTA 4ATDA 3NCOA 2B31A 2GSJA 2JE8A 3W24A 3PHAA 1UKSA 3SEPA 5DT7A 1GNXA 4F79A 2MANA 3WD4A 3VDAA 3WNKA 3OZOA 1BPLB 2JEQA 1CGYA 2WVSA 3VMNA 3WUBA 1OGBA 4MNLA 3W81A 4PTWA 2DIEA 1UWIA 5BWFA 5FL0A 2CIPA 4W87A 4P8VA 3VIPA 5CLTA 3CMJA 1D7FA 3L4YA 4W86A 1M01A 2XTKA 1OGSA 4MTVA 3PZNA 4V27A 1G9HA 2GVYA 2VRKA 3WF0A 3AIVA 1FOBA 4PMQA 1GPFA 5FKYA 1UWTA 4P8WA 3AXIA 4WSJA 3FN9A 1W9VA 2ZX6A 1DWFM 1VJSA 1CIUA 4JIEA 4H41A 1TG7A 3VIGA 4EE9A 2OYKA 3UR8A 1QPKA 1XSKA 3VM7A 2ZE0A 4DUXA 3VIHA 3L4XA 1UQZA 4Z2KA 1NWUA 1FP9A 1VFMA 1NWSA 1XHGA 2D0FA 1GVIA 3UG4A 4PTMA 3RM4A 2EPKX 3EMCA 1WZMA 1K9FA 1MXDA 2WVUA 4Z2JA 3OBAA 2C8NA 4HOWA 1E5JA 3A4WA 4TOQA 1PIGA 1UZ4A 5M5DA 3ARRA 4MB5A 3RM8A 5AYBA 1J0ZA 1E6QM 4C7DA 3BLKA 1BYCA 2YA0A 1BYDA 3ARZA 1JFXA 2W5FA 2VQUA 3MUAA 4UQEA 2O9RA 3CBWA 5EBAA 2AAAA 1E1EA 2ZXAA 3J7HA 3MU7A 2QMKA 1PEZA 3VD4A 2VRJA 1J0IA 2VI0A 1HJUA 3WN6A 1UUQA 4W7WA 5CZKA 4GQQA 3VD7A 4HZ7A 2CNCA 1EIBA 1FFRA 3CUHA 5IHRA 4CCDA 1HL9A 3CH9A 2OSYA 3AMLA 3L2LA 2CCRA 1ZJAA 1V08A 3W27A 5A2AA 1PZ3A 3WKZA 5E0CA 1WNOA 3NIYA 2VZVA 3N12A 3PN8A 4HU0A 1HIZA 1RD6A 1C8QA 4L4PA 3G6LA 3K4AA 1GQLA 3T2OA 3NYDA 1CLXA 4H8UA 4HMEA 4BS0A 5I0DA 1HJXA 1LJYA 2WZHA 4V28A 5IHSA 4KGLA 2XJ7A 4NF7A 3WMSA 4M1RA 1IZKA 1CPUA 1XGZA 2FDMA 1HKIA 4HA4A 1OT2A 2EPLX 1XH0A 1C91A 3L4UA 1LWHA 4UOZA 2ZXQA 4HOZA 2CKRA 3POHA 4MPKA 3IJ9A 1ZS2A 2A3AA 2VR5A 3VKKA 5C71A 2EPNA 2PWDA 3CHFA 1KCLA 3CUIA 2QMJA 2XFFA 3S2CA 3WH6A 3PZQA 2JEPA 2DPEA 4PRWA 2CHNA 1WDPA 5E6YA 2Y5EA 1MQRA 3SUSA 1W9DM 4F8XA 1E1FA 3W29A 1EOKA 1QBBA 5E6ZA 2V3EA 2WCAA 1TVPA 1AVAA 5A8NA 1DEDA 1JNEA 1QOXA 1Y7VA 4CN1A 3VIOA 2ZWZA 1EOMA 4W8BA 5GNXA 1SMAA 3WD0A 4W85A 3UETA 1ISYA 1J9YA 3VIJA 4HA1A 4GQRA 3FNDA 1H11A 3BLPX 1Q6EA 2ZXDA 4S3JA 3AJ7A 4M82A 5A8OA 4W5UA 1FH8A 1J0HA 1LL4A 1R7AA 3WL0A 2OSXA 3VD9A 1FH7A 3BAXA 4JL1A 2WVTA 3GZAA 3CZGA 2BS9A 2Y4SA 5HOSA 2E0PA 2XYLA 2RGMA 4BQ3A 4HTYA 4IM4A 1DWIM 5ABEA 3AMKA 2WK2A 1V3IA 3HN3A 2QV4A 1B2YA 1BG4A 2XWEA 2E4TA 4DUVA 3ARYA 3TP4A 3ARTA 3O9NA 4CVWA 1OBAA 4AW7A 4TX6A 1UOKA 1CYGA 2WHMA 6TAAA 4ML4A 4CCCA 2VNCA 3CZKA 3LPOA 1KGUA 1V6YA 4OUEA 2VVSA 2BXZA 3BGAA 1KXVA 3RM9A 4OKDA 3VDCA 1QW8A 1JDDA 4GINA 1WZAA 3AICA 5CQ1A 5I77A 5ABFB 2XIBA 4PBGA 4DUWA 4U2YA 2E8YA 2EO7A 1MW0A 3WFLA 1H2JA 3KEHA 4TVCA 1Q6FA 1UR4A 1WB0A 1CEOA 1FH9A 4UNIA 4AZ7A 2GJRA 2XHYA 4A4AA 2XFRA 4AC1X 5DF0A 2Q8XA 4BA0A 4WIWA 2VOTA 3UERA 4GZIA 1DWGM 1W1PA 2JF6A 3M46A 4KGJA 5CGMA 2BVDA 1QI2A 1K6AA 5A6KA 1H41A 2UY2A 1TA3A 4AZIA 4AEEA 5C70A 4AZ5A 1YHTA 2Z1KA 2FGLA 1B3WA 4F9JA 2O9PA 4M8UA 1HVQA 2W4XA 3N15A 1E6NA 5D8ZA 3MUIA 1BVZA 4D6FA 5A6LA 2C7FA 3PZVA 4MJ2A 4JCMA 2EXOA 2IXUA 4KRTA 5E9AA 5A6JA 1ODZA 3KE0A 1HVXA 2XSAA 1H4PA 1DP0A 1VF8A 3II1A 3WD1A 1TUXA 2HVMA 3UG5A 3SCRA 1JYWA 4E4PA 1VIWA 1HJVA 1LG1A 1KFWA 3WBEA 1L8NA 5DMYA 1CXIA 3AISA 2WHLA 1QI0A 2J7GA 3T2QA 2WPGA 3VPLA 5E0FA 4JHZA 1TFVA 3MSDA 1GJWA 2QPUA 2Y8KA 3RO8A 5A6BA 2OWXA 2ZX5A 4AXNA 3AIBA 3MKKA 4GZJA 1FA2A 5F7UA 1E6RA 1QHZA 2JIEA 5KEZA 1LL6A 2UWFA 3AMCA 4V2XA 2V3DA 2DSWA 4S3KA 1XCWA 3WY1A 4HMDA 1O7AA 4FK9A 3WL1A 3DECA 5AY7A 3AI0A 1UD2A 3WDRA 3WNNA 1CZ1A 1OWQA 2DT2A 1CGWA 2GJPA 4HU8A 1PBGA 3U7VA 3WQVA 1E3ZA 3MMUA 4CD5A 4LYPA 1HP5A 4W84A 4W5ZA 2YKKA 1W9XA 2QF8A 3BC9A 3QHMA 4QAWA 5A6SA 4XV0A 1TA3B 1VFUA 4YHGA 1CGXA 3WQ4A 4N0RA 4UOJA 4CU6A 2ZUVA 3T0BA 3WSUA 5IFTA 3I3BA 2JALA 1V0MA 1XV8A 5DFAA 1C8YA 4URIA 3KL0A 1UKTA 4U33A 2O9OA 1TVNA 2CHOA 1G01A 3FW6A 1CGUA 4UZSA 3GH7A 1BHGA 5EFDA 1WZLA 1HT6A 3ECQA 1GOQA 4HZ8A 1I1WA 1E9LA 2NSXA 5AYIA 2A3EA 3CHEA 3UG3A 2VZUA 4J27A 3QOMA 1TCMA 1E3XA 4JFUA 3WD3A 3ZR6A 4J3SA 1VENA 2CITA 1EH9A 2G41A 1GOOA 1E15A 2CXGA 2X8RA 4OOZA 4IPNB 2E9LA 5A6AA 4AD3A 5A3HA 3W25A 4ZEPA 3DYMA 2VCBA 4Z2HA 1UD6A 1CXLA 4HP5A 1W91A 4J3VA 3K1DA 5ABHA 1E6XM 4CCEA 4HOXA 3TTYA 2NT1A 1GQKA 2WHJA 3MANA 1XCXA 1UWRA 4U31A 2EQDA 1RH9A 4BCEA 1DWJM 5EB8A 1F4AA 4ACZB 4LXFA 1W1YA 4QLLA 3ZT6A 1QNQA 3ALGA 1EDTA 1JAEA 3WH8A 4GZEA 4PMOA 1V3MA 3W82A 3MO4A 3PBGA 1GOMA 1ZL1A 4D6DA 4UR9A 3VGEA 1VFOA 4HPGA 2NW0A 3VMOA 4OJYA 3IAQA 1QNRA 4TUFA 3K8KA 3K8MA 4PEEA 2BHUA 2WVVB 1QHPA 4GO8A 3ZIZA 3U5YA 3WUFA 2D0GA 5A2BA 2ZOXA 1LF1A 1VJZA 2EJ1A 1OT1A 5I2UA 3FHQA 3WDJA 4EANA 2DT3A 2W63A 3S6TA 3L4ZA 2E9BA 3BAJA 1GHRA 1J01A 4Z2IA 2ZUUA 2EEXA 2X1IA 2VVNA 2VX4A 2VRQA 4QDMA 1E0XA 5D4YA 1Q6CA 4E8CA 1WZKA 1WE5A 2WC4A 1Q6DA 3EDJA 1W3LA 2PF0A 1UA3A 3OGVA 1JDCA 1HNYA 3DHPA 1BTCA 2WM0A 3SCTA 1QI3A 2X2YA 1NM9A 1UWUA 4CD4A 2WKLA 1HKJA 3FAXA 2CBVA 1W9PA 2BHYA 4UFMA 1ZBCA 3DC0A 4D6HA 4MAVA 1GORA 1G1YA 1QNOA 5CSUA 1OD8A 3WQ6A 8A3HA 4MAZA 4YN5A 1GQJA 2WW5A 3AZTA 4EKJA 3A4XA 4ZXOA 5BRPA 1E70M 1E6SM 4K68A 2WMGA 2XUCA 4TVDA 2YOCA 1GCYA 1XSIA 1BF2A 5TD4A 2WCSA 3WMBA 4GI6A 4F9DA 3SURA 2CESA 2XSBA 1JIBA 2CBIA 3UESA 5IDIA 2CBJA 1VRXA 1UWSA 2V5CA 3SUTA 2FHFA 1BLIA 3TOPA 1XRVA 3TA9A 2VO5A 5LA2A 2RGLA 3SCNA 3VD3A 1JYVA 4AIEA 3VTRA 3TONA 2UY3A 5BXRA 2WSPA 4X9YA 1F4HA 2J7EA 3CTTA 4JFWA 3WH7A 3DYOA 3ZT7A 4J7RA 5AC5A 3W28A 7TAAA 4H04A 3ARVA 1EQCA 4QCFA 4NZCA 5IXEA 4YHEA 4B16A 4QCEA 4U5IA 3AHZA 1UZ1A 2VL4A 1GHSA 3AHYA 2BNJA 2YLLA 3CMGA 2A3BA 3VNZA 4U3AA 3ALFA 2X0HA 5ABGA 1AQ0A 3OB8A 4QLJA 3BXWA 3WDPP 2PWEA 1E4IA 1PIFA 3GXFA 3QR3A 4PSRA 3F5KA 1NP0A 1V0LA 3NDYA 3O6AA 2OWWA 1V6XA 3I3DA 4GPNA 4JKKA 2E3ZA 2W91A 2XGIA 2DGAA 1JG9A 3CO4A 4B9YA 1SR0A 2F61A 3LPPA 5I3DA 1EDQA 2W92A 4MB3A 2ZX9A 2F2HA 4M81A 2YBUA 3MUZ1 3WNPA 4NI3A 2E8ZA 3A3HA 3IJ8A 4Z2LA 4UFLA 3AMGA 4D6GA 2WANA 4D6JA 4J3UA 1MQPA 3GNPA 1ZBKA 1JL8A 4AD2A 3CUGA 1D3CA 1E4LA 3EDKA 4GKLA 3VGBA 2D3LA 3AHVA 3QHOA 2HISA 2WZIA 3WMCA 1JYXA 2DH2A 2PWHA 5ABFA 1KB3A 4CN4A 3CHDA 4AD5A 4JL2A 1OGGA 1B0IA 1CTNA 4WJXA 2ZWYA 1KXQA 2G3NA 4UFJA 4CD8A 3WNLA 4N42A 3VILA 4JHOA 3W53A 1CLVA 2WMHA 2QPSA 2J4GA 2G4FA 2VZSA 1CXKA 3SCQA 4UFKA 2VX7A 3AIUA 4OIFA 1M53A 3F4VA 3GBDA 1V3JA 5EFFA 3RIKA 2XVGA 1NOWA 2CPUA 3GM8A 4RE3A 5A1AA 1JFHA 4FLOA 1DWAM 2A3HA 3LMYA 1ISVA 4D71A 4U5KA 3G6MA 1V6WA 1XH1A 1QNSA 1UR1A 3RJYA 4TTGA 3OGRA 3CZJA 2VZTA 3SCUA 2CERA 2D0HA 4Q7NA 4P8UA 3SUUA 5D9NA 2GDUA 1K9TA 5A6BD 3BMWA 4WKHA 5EMYA 3WELA 4FLRA 4AMCA 1AQHA 4UCFA 2J7BA 1ZBWA 3PZGA 1EQPA 5JIPA 5I5RA 3FHAA 4D6EA 2DSVA 1UR8A 1U2YA 2WLYA 1WAWA 3PZUA 1C8XA 1WDSA 1WKYA 3ZJ6A 1AQMA 3VGDA 1E6PA 3N1AA 1K9EA 3OGSA 4PSPA 3EMZA 3VINA 1MW2A 3MMWA 2WWCA 3ZT5A 2W67A 1GJUA 3CZEA 5CPSA 1NH6A 4TX8A 3TTOA 1ZB5A 5HBFA 3AMDA 2V3FA 2VT0A 1B9ZA 1HKMA 5AC4A 1DHKA 1BYAA 1V3LA 1E43A 3K4DA 1NWRA 4EK7A 1WCGA 1FP8A 4W88A 1E0WA 1UD8A 3AS1A 2YA2A 3KWXA 3EMQA 4H7VA 2GJXB 2E40A 1B3YA 5IFPA 2PBGA 3WIJA 3WENA 4UOQA 3CZLA 2WCGA 2DH3A 3EBVA 1E0VA 4LYRA 3BSHA 4IISA 2YBTA 3W6MA 3WEMA 1KWKA 3W38A 2WMKA 3BCFA 1W3KA 3ARQA 4B9ZA 1ITCA 3PZTA 4AD4A 1RP8A 1JZ4A 2DDXA 3SCPA 2WZEA 5A8MA 4CD7A 3WDQA 1DWHM 2YL9A 1IZJA 1GZJA 3ZSSA 3WH5A 1UQYA 1U30A 1US2A 3NSMA 4J3TA 1OM0A 1XD0A 1E71M 3WDIA 3AS0A 3U7BA 2VC9A 1R87A 2DSKA 2JF7A 2J8FA 3HMCA 3WF3A 4ATLA 2XVNA 1QNPA 1J0KA 2WC3A
chains in the Genus database with same CATH superfamily
3VGFA 3HQ1A 4N4QA 3DC8A 4YL2A 2OFJA 3WLQA 4MY9A 4YS1A 2WLZA 1T5AA 3A12A 3BQ6A 1OFBA 4E3TA 1U1UA 1JPDX 1J4EA 1YXCA 4F40A 1W8SA 5HR7A 5RUBA 4NZ3A 2Q01A 2DQWA 4FXSA 4PMDA 4PMRA 3DFQA 4C60A 2WYSA 4N9EA 4AZHA 3BO9A 2XM1A 2DZBA 1BSIA 4NIRA 5C2CA 5LHEA 1QBAA 4LBRA 3FEMA 3VGHA 4ECLA 4N9CA 2DSZA 1XPGA 3W1MA 3S5ZA 4OBSA 4GY1A 4CNPA 2R6OA 3SADA 2XH0A 1SJDA 1H49A 1XIJA 3C0QA 4PCTA 2CLMA 1LBFA 2PI6A 2J9XA 4Q22A 1VH7A 1FCQA 3NQBA 2ZKMX 3V35A 3DDMA 1WPCA 2Q3RA 3MV01 3ME3A 5H8UA 5K7JA 4BF5A 3NQ2A 2E5DA 4OFCA 2EPOA 4WRHA 3WBYA 4FI4A 3CLWA 3C52A 3F5LA 2RHGA 4ZA0A 4MYXA 4AIOA 2WVVA 1H5VA 1S2AA 5HK4A 1NDWA 1PX4A 4DQWA 3JVAA 3VKAA 3SRFA 3OVQA 3QZAA 1V3KA 4EAMA 2Z00A 5E09A 3JU2A 4RNIA 4X2PA 3E0LA 2CBUA 3U57A 4IPLA 3DFYA 2ON3A 4J28A 3AYRA 1MEHA 4XUYA 1SYTA 1GKPA 1EO7A 2F84A 4Y9MA 3VZYA 4DBEA 1R30A 1YXYA 4E5TA 2XH2A 3W6YA 1BG9A 3SQLA 2FFCA 1PZ0A 1ONWA 2QT3A 5LYRA 3THCA 2QUVA 3I7SA 2C18A 2BY1A 1KM6A 2WSQA 3TYAA 1AZ2A 3UZWA 4F3HA 1E9IA 1XL9A 5TNVA 1DXIA 5HUOA 3D6NA 1ECEA 1TX0A 1SZNA 3EYPA 4K7YA 4UR8A 4WKFA 3B0XA 2VUYA 4NZ4A 2C16A 3HURA 3AAMA 3LCHA 2B7NA 1G5AA 1MVYA 3FGCB 3PPFA 2QCNA 2J7FA 4Z42C 1CNVA 1YIXA 4RZBA 3GW3A 4FZIA 2VKZG 2VGFA 1AL8A 1QJWA 1JD7A 5EMJA 1UA7A 2TMDA 2ZUMA 2G3IA 3TTQA 2Q3OA 4EOUA 4C6EA 4RE4A 2FGBA 5DCEA 4GQGA 3T40A 1R8LA 3A47A 1PSCA 4DWSB 5A5WA 1WUEA 4HCHA 1W3HA 3RPTA 1GOKA 2IUZA 3A6OA 4CEUC 4XBJA 2LLEA 1PE1A 3DFOA 1EPXA 3OIHA 1EPVA 3EA1A 1RPXA 2PP1A 5F2LA 1KFJA 1UIPA 1S39A 3IS4A 3YPIA 1JZ8A 3U5UA 3NQMA 5D9MA 3A9IA 3GE7A 5JUVA 2ACRA 3UZYA 4QLKA 1GOWA 3D3AA 3SIMA 2BOEX 7XIMA 1YE4A 2V5BA 5CPOA 5BWAA 1A0EA 3QMSA 4MWAE 2D2OA 4H9YA 2PC8A 2F8QA 2YIHA 3ELFA 2JK2A 4JCLA 1YNQA 1EKOA 1SO3A 3N2OA 4AU0A 4QS5A 1WDRA 3FIGA 3T9PA 5AHFA 3AIRA 4QR6A 1ISWA 3MSYA 4LCQA 1ZNNA 1JI1A 4JKLA 1J11A 4QFUA 1K9DA 3G1DA 4FEZA 1VBUA 1FWEC 2G3JA 1BGAA 3G1SA 3AXKA 3O0FA 1YRRA 2NQHA 3OA5A 4QGCA 2BGQA 2P76A 2P3ZA 3B9AA 3NUKA 7ENLA 2CZEA 5HXMA 4IICA 2DU2A 3GU9A 2POZA 3HJEA 2OO0A 3CEUA 3SDOA 1UPMB 3HG4A 4ZQMA 5FD0A 2Z2AA 4ILSA 3DH7A 3TK7A 4MNKA 3DYPA 3W1PA 1M6JA 3VDGA 1LROA 3BOLA 5HWMA 2Z1BA 3ZWSA 2FYMA 3UWZA 1PWLA 1OINA 3ONCA 4ZO6A 4QEEA 1EA9C 1TJ2A 3MI2A 2B7OA 4NNAA 4AIBA 3T05A 2BB0A 2VX6A 3QHNA 1BVNP 2O0TA 3CT7A 1O1HA 1SO6A 6XIAA 2IKJA 3SUVA 1QPOA 3CAQA 4RXGA 1TPB1 4CVUA 3T0CA 3DFSA 2G8ZA 1J0JA 1WP6A 5CAKA 2ZVRA 5AECA 2QZRA 3UWVA 4C6DA 4HJFA 1FWJC 1TPFA 3VM5A 3BCDA 4LCRA 2XH4A 3PPCA 3HGRA 5FOOA 3BG5A 3V36A 2X7VA 4GI9A 3STGA 3U2EA 1LCOA 4XB3A 1LUCB 4N9BA 3VE7A 1DQWA 4W93A 4C65A 1WXYA 5FCZA 4MWAC 4PGLA 4BQ5A 1Y8BA 5KZEA 4HZ6A 2XSXA 4LRTA 3U4FA 4IJRA 1MDLA 2NXHA 1MYRA 5BMWA 3PG8A 1DJZA 1V0NA 3N73A 1XFBA 3MS8A 1IYXA 4DF2A 4A3HA 5G1TA 1TR1A 1XKYA 3NZ1A 2EG6A 5LGZA 1GYLA 1XIFA 5HINA 3QQWA 4O1CA 3AIEA 1V3HA 3RITA 2PTDA 3G0SA 1ADOA 1YXDA 3KL5A 2GQ3A 1M65A 1IR2A 3W26A 3LLDA 3GNRA 2JKPA 4LSBA 1SSDA 1B54A 3A3XA 5KZ6A 3ARSA 2WSYA 3UXDA 1MWOA 2DIJA 1ENUA 1IWAA 1DV7A 1CXFA 2ZUSA 3ZOAA 1ZBVA 1XWYA 1KA9F 1WV2A 2OEMA 2QHAA 4LYKA 3T2PA 3PTMA 4B91A 1H09A 3GU2A 2WMFA 3TYDA 4FOJA 4B15A 1VC4A 1KCZA 3VOCA 3CUFA 3LCLA 2PDKA 3MQTA 1ALDA 1FHDA 4UFHA 2GK1B 3WDHA 3E38A 1HN1A 2VC7A 4OUIA 4UQCA 4DVOA 1KR1A 3GBEA 5HUPA 3T81A 5F2MA 3PZMA 5JVLA 4QQ3A 3W3OA 4V1XA 1EEXA 1KC7A 4WDUA 4NRRA 3TJLA 4K8EA 2OLAA 2D69A 2BX7A 4ONVA 5FSEC 2PAJA 3F5JA 2J6XA 1K4HA 3DG6A 3KX6A 3P62A 3ZQ9A 1GYNA 3RF9A 1GWJA 2P10A 1EO5A 2WXDM 2Y8VA 2GOUA 1YPIA 1RA5A 4HK5A 1UH4A 3B9DA 1TPEA 2Y8UA 5LXEA 3HTWA 3AOFA 1LOSA 2HROA 1R86A 3R8RA 3IK4A 3ZM8A 4MJ4A 5E70A 1CXHA 2ISDA 2IPWA 3UA3A 1HJQA 5CSRA 1CWYA 4MUZA 1QU4A 4KMQA 4WKAA 2F2KA 3UCQA 2GWNA 2X40A 5D9PA 4I8DA 5DO8A 2OSWA 2IQ0A 4OOUA 4NHVA 2Z4GA 3WBWA 4KEUA 1UR0A 2HVNA 3K2GA 1Z32X 1E4MM 3WQFA 2YXGA 4LVBA 1E55A 3USZA 2HNHA 4PL1A 5L9FA 2PRHA 1XDJA 1Z44A 5DEZA 3SCOA 1A50A 1OCQA 3Q94A 3NQ8A 4AY1A 5CC5A 3H2NA 3BE7A 3D47A 2FKPA 2VGBA 1H0GA 1VHCA 3B3DA 3SB0A 4JN8A 3OOQA 3TC7A 3VDBA 4DO4A 3JUGA 3IIVA 1EGMA 1RJQA 4MB1A 3BAWA 3NVDA 4IOTA 5GJMA 2VCAA 2BP1A 3PSVA 3SAZA 4Y9OA 4PUNA 2UY5A 4R5EA 1M04A 1VJIA 2X7WA 4POCA 3UNDA 3CHCA 1F2JA 2HXUA 1OD0A 3MC5A 5SWUA 2TRSA 5FEXA 3IVTA 1R3TA 3OBKA 3BPWA 4DUOA 1BXCA 4C6JA 3K8LA 4JAWA 4M3PA 2J25A 5LIYX 5DX7A 3GXMA 4F4RA 4AWEA 4EACA 4IFOA 4WHBA 4OWGA 4LYQA 4DIAA 5CKSA 4DJDD 3PZ9A 2WSKA 1U33A 3R0DA 4LPCA 3THQA 3NPXA 4GC4A 4HPXA 3JZEA 4AZBA 3ITXA 2PWVA 3E1F1 1O5XA 2PBOA 2QIWA 4FMVA 1FWTA 3M6DA 3AU2A 3VDHA 4D72A 2O92A 4UQ9A 3NQGA 3PBYA 5GJNA 5MKGA 1ZALA 1RP9A 2IQTA 1F3WA 1Q4NX 4IGNA 3GXTA 3RCMA 5GNYA 4IWWA 4LUSB 4ATDA 2PRMA 3SZ8A 2QVNA 3PHAA 3LSBA 3H4GA 2L5HA 1XF0A 3P67A 1OCJA 3CLMA 1AA1B 1CGYA 4G8TA 3GDTA 3LHUA 1OGBA 3UCDA 1X98A 1L6FA 1AJ0A 1OZQA 1UWIA 1XYBA 5FF4A 3NXLA 4W87A 2DZSA 3VIPA 1EP1A 2KAUC 1OJXA 1BRLA 2XIOA 5HATA 5B80A 1NVMA 1PCKA 2PDGA 4V27A 4GIYA 2VRKA 4DXVA 5D38A 3WF0A 2ANUA 1RQEA 4Q32A 1FOBA 2A6NA 4E2BA 4C91A 1PWMA 5B7ZA 1W9VA 1KCXA 4GABA 2GUBA 4H41A 3PBVA 3P8IA 2PDWA 2OYKA 1XSKA 3VM7A 4PBFA 1F05A 4I8YA 2IKHA 4DUXA 1RQBA 4Q8NA 1NWUA 5EMLA 4MLRA 3TMLA 1XHGA 3C2YA 1S5TA 1KBIA 1K1DA 1K9FA 4Q8WA 1VCGA 4JQ1A 4Z2JA 3UJEA 1R9YA 1E5JA 3A4WA 1TRDA 2R14A 4IG2A 2J24A 3RM8A 3ABOA 5EBUA 3UU0A 3N6HA 2RJGA 3WBXA 3RR1A 4C7DA 4UR7A 3VZXA 1HKVA 2WJFA 2VQUA 4I9JA 4E3VA 1HKWA 4UQEA 1TIMA 3CBWA 3IEBA 2AAAA 3L12A 2ZXAA 5FI8A 2QCLA 3MU7A 2QMKA 1DE6A 3VD4A 4EPBC 2ABBA 1HJUA 1VD6A 4Q4RA 4KKXA 3QC3A 1LWIA 4KFNA 4YWIA 1VBJA 5C2XA 4GQQA 2QCCA 4HZ7A 2CNCA 2A85A 5IHRA 3GKFA 3W86A 5F4XA 1UZDA 1DXFA 2C19A 1TR9A 3VKJA 4DJFD 5CJNA 4A8IA 3JW7A 1QFEA 3TOYA 3PN8A 1OK4A 2JGQA 3K4AA 1PDYA 3B03A 4HMEA 2PTZA 4DNMA 3GNDA 5I0DA 1HJXA 1LJYA 2FVMA 1KM3A 1UP2A 2NUYA 2OOGA 2XJ7A 4NF7A 5LNSA 3CQHA 3ES7A 4GYPC 3DESA 3JR2A 4LFYA 3NOYA 5KTLA 2PURA 1C91A 3L4UA 3OP2A 4KWSA 4HOZA 3ZZ1A 2PU0A 1BWVA 3TAOA 3VZZA 2VR5A 3VKKA 3THAA 3GR7A 3SGUA 4O10A 1SZEA 1KCLA 3CUIA 4QDWA 3WH6A 3UGRA 1TTIA 3RLVA 3TYBA 4MYAA 4CQ8A 4PULA 3TWBA 3TFXA 5E6YA 1MQRA 4NL1A 1E1FA 4C5YA 4C6OA 3DFNA 1EJWC 4WX2A 1F3EA 3VKDA 3CB8A 3A24A 1TVPA 5A8NA 1DEDA 4OV4A 4WR3A 1RBOB 4W8BA 2GL5A 3O6DA 3UETA 4A8RA 4JICA 1J9YA 3P5YA 3VIJA 1DOSA 3FNDA 3A23A 3RG6A 3DFHA 4GWEA 3Q45A 2XFWA 3NTYA 4S3JA 2VYOA 4AQLA 4M82A 3KLLA 3BLLA 3W1TA 2YW3A 3VD9A 3BAXA 3GZAA 1R3WA 5DY2A 2E0PA 1FQ0A 4P2VA 4BQ3A 1DWIM 5ABEA 3HN3A 1B2YA 1BG4A 2E4TA 3BCJA 4GUIA 4M19A 1PUDA 2BSLA 4KW2A 2WHMA 3LUTA 1R9XA 3CV7A 3PJTA 2VNCA 2BXZA 4GH1A 2YZRA 4N6EA 1IT7A 4LY8A 5D03A 1JDDA 4GINA 3PULA 5CQ1A 1KV8A 5I77A 4JTQA 2V63A 5M1TA 3N25A 2VEPA 4N4PA 4PBGA 4GIRA 3T6CA 1A49A 3WFLA 4G7EA 2QUNA 2ICSA 1MDRA 2GJRA 4OBTA 4AC1X 1DIDA 5AOUA 5DF0A 2Q8XA 5D09A 5LIXX 4WIWA 4ZTYA 3T42A 6ENLA 3P5ZA 3M46A 4KGJA 4AF0A 1FWCC 1QPRA 3W1LA 1S5VA 4DN1A 3E02A 4AZIA 5C70A 3TJIA 1GKRA 1F74A 3NURA 2FGLA 4NAEA 3QFWA 1XLDA 3N15A 3MUIA 3WZ0E 2C7FA 3PZVA 2ALRA 4AY8A 5D05A 4KRTA 5E9AA 1NJJA 3DN5A 4IP4A 1HVXA 1TWZA 4HHPA 9XIAA 3SO7A 5GJPA 1VF8A 3M0VA 1DJHA 3XIMA 5I00A 3IUIA 1TUXA 1ZFJA 2HVMA 4R34A 3UG5A 4M0XA 3TW7A 4JTCA 1OFEA 1LG1A 4MY8A 5AVNA 1V4YA 5ABTA 1GQNA 2FTWA 3TQ0A 2GQ8A 1O1ZA 5D2XA 3AISA 2C15A 2J7GA 1T41A 2OOFA 1W0MA 4JHZA 3GHUA 2D2HA 1E6RA 2NV1A 2OCZA 2DSWA 4WVXA 4GI4A 4PCFA 4NYUA 4AVNA 4XBSA 3R0UA 1O7AA 4Q4PA 1L6SA 5CPLA 4PEKA 3ITVA 2R94A 4BR1A 1B5TA 2VGGA 3AI0A 4Y9AA 4L9ZA 1CGWA 1AMKA 2V5LA 3LY0A 1PBGA 3QGAC 1EXBA 2D2GA 3U7VA 3WQVA 4N7QA 1Z41A 1E3ZA 3GVGA 2NX9A 4CD5A 4LYPA 1PS9A 1HP5A 3UZJA 4B5TA 3AYTA 1W9XA 2QF8A 1OCNA 5A6SA 1S2UA 5L6UA 3BJTA 1SFTA 1TA3B 4YHGA 4HHHA 2HK0A 4UOJA 4GUJA 2ZUVA 3T0BA 3RFAA 2PGEA 1XV8A 5DFAA 1ICPA 2DZAA 3NQVA 4GVHA 1OYCA 3MCNA 1MI3A 2FJUB 2O7SA 2Y7EA 3ECQA 5EFDA 4O57A 3TMQA 2NSXA 2QCDB 1IQ8A 5HWNA 4UTTC 2J6VA 2NV9A 6XIMA 2W27A 3WD3A 1EJSC 3ZR6A 3ZVHA 3MTWA 2PGRA 4XAPA 4Q4QA 3B4UA 3W25A 3RMJA 3S5SA 2B0MA 1MUCA 1B4EA 2FZNA 3LN3A 4H19A 4J3VA 4GD0A 4H4IA 2FMNA 4CCEA 1NAL1 3KS6A 3TTYA 3MANA 3RRAA 3S5OA 2CLPA 3AU6A 2R9RA 1E0TA 2GSEA 3GIPA 1HL2A 1RH9A 2ZRUA 4BCEA 3P0XA 3E2QA 4ACZB 4LXFA 1FUYA 5BOOA 3DZ1A 2DUAA 2OZTA 1NDZA 3TWAA 4R33A 3WH8A 4PMOA 4XD4A 2PDMA 3MO4A 1TUFA 5D33A 3VGEA 4NXKA 4MWAB 4IMAA 3NZPA 4TUFA 2D73A 2SFPA 4M7SA 3C0SA 4FX6M 2PDLA 3FJ6A 1LF1A 4JNZA 2INEA 3FHQA 3QLLA 4UC5A 5TBOA 5HANA 4YIWA 1UP3A 2W63A 1ZQ5A 3P84A 2E9BA 2X1IA 2VVNA 1OG6A 1Q85A 4E8CA 3FA5A 4M6PA 6REQA 1WE5A 1Q6DA 3A5FA 5T9CE 3TE9A 3EDJA 5AZ0A 3UR5A 3PG9A 5JMUA 4OHQA 5H91A 1BTCA 1QI3A 4XUGA 4GQBA 4H9VA 4IPIA 1RV8A 1RCXB 3KVKA 4CNNA 3TTEA 1YPXA 3FSTA 1ZJIA 4D6HA 3H12A 5DY3A 4R53A 3B04A 1Y5WA 4S2BA 5CSUA 1F6KA 4O4VA 8A3HA 2X41A 4YN5A 3PC0A 3IIZA 3UW6A 3LHVA 3VI2A 3P82A 3V16A 3S2JA 4LVAA 2YOCA 1F5ZA 1GCYA 1XSIA 3S1GA 1FDZA 2PTXA 3EOSA 5TD4A 2WCSA 3Q2DA 4GI6A 4R85A 4F9DA 4ORIA 2GDQA 1TV3A 1W8GA 4PMJA 4O15A 3MZNA 3UESA 2CBJA 3EWYA 3N34A 3SN1A 1BLIA 3ITYA 1XRVA 2PLKA 3TA9A 3TUUA 4S3FA 1SW7A 3SCNA 3N9SA 4RZ4A 3TONA 5BXRA 4IQLA 4X9YA 1F4HA 4B4FA 5CBIA 1G4EA 1A0DA 4DO7A 1K02A 4E2DA 4EWND 4J7RA 5AC5A 4FXJA 3U2ZA 3S4TA 2YXOA 1PYMA 1QTWA 3W7HA 2PODA 3IUDA 4U5IA 3AHZA 1UZ1A 2WKJA 3M47A 2VL4A 5A8GA 1GHSA 3T44A 2YLLA 1DJIA 3LXAA 3IIXA 4IL0A 4JY9A 4U3AA 4JYEA 5AZ1A 5CGQA 1C29A 3A5VA 4XIMA 4JEJA 1XBYA 3PFRA 3BXWA 1MZRA 1SZFA 1V0LA 3O6AA 2OWWA 2DW6A 1V6XA 3I3DA 3QKZA 1NEYA 4WOZA 3LSCA 1TV2A 1SR0A 5I3DA 1EDQA 1F6YA 2FTYA 2ZX9A 4REQB 2ZTJA 3WNPA 2IQDA 2ZTKA 1XDMA 1XM3A 3IJ8A 5I3GA 4UFLA 4D6JA 4GUFA 3PBMA 3U6WA 2ZZ1A 4AD2A 3CUGA 1D3CA 3SJ3A 3EA3A 4GKLA 1Z89A 2G5WA 1JULA 4CQBA 5FJIA 3G5EA 4J9JA 3DU0A 3CHDA 4YTSA 3MI6A 1X7FA 4CD8A 2W9MA 3RYSA 1W1B1 3W53A 3L23A 2G4FA 4IP5A 3UXAA 3NL5A 1OC7A 3F4VA 3GBDA 1POKA 4UIOA 3GYEA 5EFFA 5T9BG 3NL3A 2CWNA 1U5HA 4FLOA 1DWAM 4GX9A 3LGGA 3SQSA 2VFHA 3N29A 1V6WA 1XH1A 3EWUA 1QNSA 2PGWA 1Q7MA 3P81A 3R7MA 2J66A 2VZTA 4PUWA 3SUUA 5D9NA 2INFA 2YCEA 1QWGA 5EMYA 1IEIA 4GNKB 3R1ZA 1ZBWA 4FIRA 1XLFA 3PZGA 1EQPA 1XIHA 2VELA 3FHAA 5F4WA 5I5RA 2VGIA 3A22A 4D6EA 3SY5A 2X0SA 1TELA 2DSVA 1WAWA 2CLLA 3IRSA 1C8XA 1WDSA 1WKYA 4EIVA 1IEVA 1AQMA 2XIJA 5TIMA 1GGOA 2YFNA 3N1AA 1GEHA 3DI1A 1K9EA 3GS6A 1C9DA 4QSHA 2HWGA 3FJ4A 3LCXA 3E9AA 5JQ9A 4WUIA 3S9YA 2W67A 3TSDA 3QSTA 4TU1A 4TX8A 1JR1A 1ZB5A 4HNUA 1SFLA 4QAIA 2V3FA 5KETA 1HKMA 5AC4A 2F7FA 4N2YA 3UF9A 4ZB2A 4EK7A 1WCGA 2X1RA 2XIMA 4PTDA 1QNVA 3QGKC 5DRCA 4IJCA 1E0WA 3HG2A 2PGFA 1EJVC 3I68A 3EMQA 1TWSA 3GY1A 1MUMA 5IFPA 4UTMA 5FEWA 3WIJA 4UOQA 2QJGA 1B4KA 3EBVA 1P0EA 3RX4A 4LYRA 1SVDA 2PF8A 2YBTA 3MB9A 1KWKA 2BXVA 3B9NA 1KKOA 2KZHA 3N2TA 3B8DA 2VFDA 4B9ZA 1SM9A 3GC4A 2DDXA 3G1VA 4FIQA 3BLFA 3IPWA 1TPVA 3EB3A 1GZJA 2H90A 2R1PA 4LUIA 1US2A 1OM0A 2VC9A 2J8FA 3WF3A 1BXNA 2I14A 4ATLA 2XVNA 3HGJA 2Z28A 4DLFA 2F9RA 1J0KA 1OABA 3EKGA 4JTIA 3BAKA 5FL1A 1YDNA 3TROA 4UZUA 3M0LA 3LHTA 4IF2A 1IT8A 2PPGA 3CUJA 1XD1A 4CNSA 3ARXA 1FDYA 1CB2A 4M29A 2J74A 3QPEA 5JBDA 4IMCA 3L2MA 4XQ6A 3RCYA 3GTXA 1V79A 3PBWA 4CU7A 4XTDA 3VFLA 4FNPA 1PKLA 3ANVA 3BLEA 4H8HA 1A47A 1S1PA 2Y7FA 3I6EA 4AEFA 3S1VA 4ACZA 2J47A 3AS2A 3C2RA 4C7FA 2JQXA 3KRZA 3RN6A 3W7MA 3N13A 2ZZ7A 4YCOA 1MZHA 1MXSA 1BAGA 2EGZA 3FYPA 2BY0A 1A5AA 3VNJA 3C2OA 5HQMA 4IXXA 1ZCCA 1VFTA 2BOFX 3M0JA 2FZBA 1MFUA 1SMDA 1P6WA 4IQJA 4CQ9A 1KFKA 5A8PA 4M6VA 1R0MA 3AXXA 3KWSA 4Y9PA 2OVLA 3TSBA 1M3UA 4IGHA 3VIKA 4L64A 3EEZA 1UHVA 4BZYA 4PCPA 1YEYA 3I6TA 4LBSA 1XKJA 3RDKA 2W61A 2ZA2A 1X8FA 3IIPA 2PDCA 3LPFA 4NYYA 4HPNA 4K8GA 3OA3A 2R1MA 3PPGA 2XU2A 3E5BA 4MADA 7REQB 2VCCA 2OYMA 2HEJA 2PU1A 4FNRA 4UNLA 3TU9A 1XYLA 3W7CA 1IHIA 4G1NA 1RHCA 1ZY9A 3FVMA 3R8GA 3E2SA 1XX1A 3EXTA 3TNOA 1VEMA 4XVDA 1PHWA 1I60A 1E1CA 2D23A 4Q8QA 1HF6A 1V93A 3BURA 4DBUA 2FHBA 1WDQA 5D02A 3TX9A 3B06A 1QWKA 3CB3A 3WUGA 3WFZA 4JQ2A 2GGEA 3B8VA 3ABXA 2V82A 4J4KA 1R47A 3U48A 1XYMA 4KCTA 2UY4A 3LHZA 4PCSA 4HBKA 4ZQPA 3DFTA 5FJJA 3TQVA 4NJJA 1JZ6A 4XZHA 3DX5A 2ZDRA 1W31A 1XLMA 3H6OA 1GVEA 3LOTA 3WK1A 3GH5A 2YYTA 4K1GA 1G67A 3QTGA 4WF7A 3LEPA 5IBXC 3L68A 1LQ2A 3N14A 2YDSA 3KUMA 3MV11 5K4ZA 3WK0A 5HNRA 4HYWA 4NX5A 1AD4A 3CPRA 4UCGA 4CNOA 4RDWA 4Z08A 1ESWA 1SW0A 1UWQA 1FX6A 1KGXA 1QCWA 1Q4WA 1H7OA 2OX1A 4NRSA 3M6YA 4PUMA 3LRMA 2VX5A 1M7XA 5KSWA 3ORWA 4AY7A 2YDQA 3GXNA 4MVAA 4HK6A 4RCXA 4JY8A 3H21A 1O60A 1GW1A 5E1QA 2Y6ZA 4Z1YA 1KM5A 4WJEA 5HQEA 1JGIA 1QVBA 3M0YA 1GZ1A 4TMCA 1JCLA 4ZQCA 2XGBA 4AZ6A 2V5DA 4LEQA 4C6KA 3UR7A 1QHOA 3GRIA 3N2BA 1UUOA 3OQEA 3ITCA 3IJ7A 3BWWA 1TMLA 3G24A 1VPYA 2EG8A 3CXOA 3Q65A 1GKQA 3KDNA 4JKMA 1B3ZA 3SGGA 3SCWA 3O7UA 3UPWA 2BHZA 4TIMA 2D20A 4LVDA 4ROQA 2P53A 2BFGA 2DW7A 2QDGA 2CFFA 4XKYB 1LYXA 3ENLA 3EKLA 1QK0A 1F73A 2R82A 1IV8A 4MZYA 1TRIA 3N6JA 4S3AA 4DPPA 5LA0A 1EGVA 4LH8A 1OIMA 5I78A 4IFRA 4V33A 3FDGA 5XIMA 4E8GA 4OBRA 4DWDA 4E2OA 4QJ4B 1D9EA 1W17A 5TAOA 4ZO9A 3P60A 5CPMA 1Q2RA 3TJ4A 2YL8A 1AZ1A 1PPIA 3VNYA 1KM0A 2ZRZA 4ZB0A 4M80A 3CGTA 4Q33A 1XRFA 1ZRQA 4C6IA 3BOXA 3TA6A 4ICNA 2QJIA 4JR5A 3LHWA 3CV2A 4X61A 3G18A 3AIWA 4JDYA 3MA8A 4ACYA 4PBEA 3KCLA 4QP0A 3FAWA 2PDYA 1P6BA 4ZQOA 4JFSA 2V9DA 3PTKA 1H1NA 1W37A 4XZBA 1L9WA 1WKFA 5G4WA 1HXJA 4FNTA 4UB9A 2PDJA 5BROA 4US6A 2C13A 3GC5A 4PB4A 1SZRA 4FF7A 3MDWA 5DMNA 3TTSA 3GTNA 2HBXA 5I6SA 4AEOA 3L66A 3VCRA 4O50A 4FB7A 4US5A 3KOZA 4LANA 2VOMA 3GG8A 5B7YA 3RGTA 2G3MA 4AIUA 3H7RA 5BXSA 1GVYA 3PZOA 3L4TA 1K8YA 1DVJA 2A21A 1V02E 5EGRA 2XWDA 1C90A 1XICA 2D3NA 1ZTVA 1C9WA 4MFEA 2V2DA 5BW6A 3H2AA 1XLKA 4L4LA 1BGGA 3IRDA 3OLDA 4PR4A 3LTYA 1NWTA 1US3A 1JCJA 1HKKA 4A21A 3LLFA 2VFIA 2QCEA 9CGTA 4Y8EA 2CLIA 2UBPC 3Q67A 1CECA 5C2GA 4AX6A 4XISA 3EA2A 4H8NA 3IK2A 3SCSA 2CYGA 1S5WA 1EL3A 3RO6A 1EDGA 3O2LA 2RDUA 9RUBA 1XPYA 2R1NA 3PUOA 3EDDA 1KRAC 3MMDA 1CB7B 3M43A 2XIQA 4X0VA 1UR9A 2QEZA 2J62A 1FRBA 1TV5A 2ONEA 2ZQ0A 2V81A 1QPNA 3G0XA 4DM2A 4HN8A 5JBEA 3EDFA 1THFD 2XM2A 4LUTB 5FF3A 5FIPA 1G69A 4FLSA 1N82A 1W3NA 1QOQA 1DE5A 1X6NA 2VR4A 4CNTA 4PMNA 3APGA 2QR6A 1Q13A 4IIGA 5A8QA 1ITQA 1YMYA 5FACA 3W2KA 2Z25A 3FYOA 3OPSA 1UZHA 5K9XA 1YTKA 3KTSA 1WDDA 2VJXA 3SRDA 1OFAA 2ZDSA 4I5XA 1A5KC 2PB1A 1UIOA 4K8HA 4XWUA 5CZ0A 2D24A 4MKVA 3MCMA 2W6RA 3B8SA 1LLOA 1KQZA 3WYZA 1H3GA 3W7DA 2J7HA 3PR2A 1BQCA 4LS0A 1B90A 2X05A 3KHJA 1Z48A 3AZRA 4E8DA 3BW2A 2VQTA 3VU2A 1YX1A 4DWSC 1HQTA 1CBGA 2DJLA 2WNWA 4OZOA 2CZ5A 4P7QA 1W32A 3U2CA 3W1RA 2B4GA 1E56A 2Z1VA 2EBNA 4EPEC 3GDBA 1DIEA 1GTHA 2JFEX 1HGWA 3CQKA 3QY7A 3GXDA 3ISIX 2HDJA 4IFKA 2QAPA 4Q8VA 2E6DA 3NO3A 2JIWA 2R1KA 4UQBA 2ISFA 2BODX 4CN6A 3UYIA 4I9AA 3T08A 5H1WA 3BSMA 3ZMRA 3N6QA 2RUSA 3CIXA 4NSBA 2O4QA 4GG9A 4S23A 3VIMA 1NF0A 3AYSA 2YSWA 1J96A 4R88A 2C3ZA 4GY7A 4Z0SA 2E6AA 5AN7A 1KLZA 4HA0A 4A3YA 2D22A 2ZRVA 4G6CA 5JIWA 3PB2A 2ZUWA 4J3WA 3EX3A 2J78A 1TVLA 3A21A 1E4NA 3BZJA 1Q6GA 3GR8A 5AVHA 1US0A 1OIFA 4DAIA 4H9ZA 3UQNA 2Z1SA 2YCLA 3FXGA 3CS2A 3HB9A 4XD5A 1JCXA 3AXMA 3WF1A 2ZA3A 3AZSA 4JGDA 2WMIA 3V3WA 2OZ3A 1VCFA 5CG0A 4LF2A 3HV8A 4ROPA 1NQKA 4MDOA 1QI5A 9XIMA 3UEQA 1GEQA 2AKZA 2BVYA 1I9CB 3LYEA 4RK8A 4BQ4A 3C0JA 3GH4A 4Z0JA 6A3HA 3M0IA 3GNNA 3VO0A 2V2HA 1UKPA 2XIIA 3HG5A 4HTBA 5CSYA 2J7CA 8CGTA 3S9IA 1A3HA 1JUBA 4ZFMA 2TAAA 4E4FA 1C8VA 1L8PA 1W2VA 3NFUA 1X1NA 3TAKA 3R58A 4ADUA 3C0LA 1J5SA 4GYJA 2PEVA 3AQUA 5A94A 5HNNA 4AZCA 4HSOA 1SO4A 4HMNA 3GC2A 3UYCA 2AMGA 2ZUTA 3B8UA 3ID7A 1V6VA 1M1BA 2ZC1A 1UH3A 3UXKA 3R5EA 2Y89A 1AFSA 1Q6QA 5F4SA 4NAFB 1W9BM 4OGZA 4N9DA 2PDUA 1M68A 4XAFA 4UXDA 1VAHA 5CPQA 4MZ8A 3MI3A 2OGYA 3PPHA 1HUVA 3L0GA 1VLWA 3QOKA 4Q8OA 3BMVA 1Z69A 3QY6A 1DORA 3SRHA 2WOQA 3W6LA 4ADSA 3V5OA 1ZAJA 4X0NA 3IWPA 1CGTA 3NG3A 2Y5JA 3V18A 3FDKA 3QGVA 2QJNA 3UJ2A 3B8WA 4XZNX 2VDGA 2W3ZA 2I5GA 4O19A 3T8LA 4AB4A 1FFQA 4P61A 1SSGA 2E6YA 2J79A 1YDOA 4GVIA 2NLYA 3AO0A 5LSMA 3LI1A 2ZADA 5DBTA 3BH4A 3PUDA 3IARA 3CYJA 4YTTA 4HT3A 4O17A 2Y1HA 5DELA 3GR4A 1OX6A 4JTUA 2X16A 2FGZA 4ZE5A 1K70A 3NAVA 4KIEA 1LBMA 1UD3A 4MF4A 4ZENA 2O9TA 4RKAA 3CIVA 3STCA 1VFFA 2ZX8A 1XBZA 4CU8A 1TV8A 2X1UA 2TODA 4JIQA 3IGHX 4WQ6A 4XAGA 1XSJA 3WQ5A 4FAMA 1GG1A 5EA9A 2HJPA 1OFPA 2NUXA 2ZYFA 1EXPA 1W1TA 3KP0A 4O54A 2W62A 2TYSA 4AYSA 2X09A 2GGIA 3A4AA 1A5SA 2A6LA 3W72A 5K2ZA 1XLHA 3ZSTA 3ZLGA 2YCJA 5BXTA 3I4KA 3E49A 3HQNA 2JE8A 2WO5A 2FZ9A 2E67A 4F79A 2MANA 4NG3A 3BLIA 3WD4A 3VDAA 3MP3A 3RXZA 4J2MA 3BICA 1BPLB 2JEQA 3WMLA 3VMNA 4MNLA 3QY8A 1V7YA 3R4IA 3TLLA 2Y7DA 5HMSA 1Y0EA 5HJXA 2V68A 4W86A 3W7PA 2XTKA 4GIEA 1Q65A 2GVYA 1TSIA 3AIVA 4IMDA 4QXIA 1K03A 4DJEC 3V5CA 2YGYA 2O56A 1UWTA 3AXIA 4O13A 3FN9A 1POJA 3BANA 5AC6A 4HQVA 1HFBA 1DWFM 2IPGA 4WY0F 3UR8A 4AVOA 4Q8TA 1ZP3A 1QPKA 3REQB 4HKPA 2OQHA 4JTAA 1UQZA 1V77A 4GBDA 1FP9A 3O16A 3HQPA 3PAOA 2D0FA 4M51A 3UG4A 2EPHA 4PTMA 3AYVA 2V30A 3EMCA 2GLKA 3F03K 4AC7C 1MXDA 1U1HA 2UZ9A 2QIIA 1OFOA 1PIGA 1I2NA 1IXPA 5FJTA 1W5MA 5LHFA 2FTPA 3HPSA 4A2SA 1U5VA 5AYBA 4MHBA 1E6QM 3LCFA 3BLKA 1J79A 1W5PA 3L5AA 1LLZA 3DHFA 4RNHA 1AQFA 2GVLA 3SQMA 4Q4SA 4LUTA 1AK5A 2O9RA 5EBAA 3DAQA 2IMRA 4UTKA 5J5RA 2O55A 1Q66A 4F0LA 1J0IA 3EOEA 4L80A 3GTIA 3CQ0A 4HNLA 3D0CA 3NXFA 1UUQA 4W7WA 5G4HC 3WLNA 4ZMGA 5CZKA 3VD7A 1EIBA 1FFRA 3CUHA 3UD6A 3LD5A 1HL9A 3L2LA 5I3IA 5AFDA 5A2AA 3WKZA 5E0CA 3L7RA 1ME8A 2HS8A 2R8WA 3NIYA 4AWUA 1RVKA 1RD6A 3UR2A 3P6LA 4ZGYA 3W1XA 3NYDA 4ZSTA 5I02A 4V28A 5LZLA 4DELA 2PWUA 3MY9A 3WMSA 4RX0A 4M1RA 3RLUA 3LGDA 4KERA 2FDMA 3F1QA 1OT2A 1OF8A 4DYKA 2EPLX 1XH0A 3HO8A 1VGAA 2RH9A 4RZ5A 3NO5A 4UOZA 2ZXQA 1FKXA 4RW5A 3POHA 3IJ9A 3MKCA 2A3AA 3GDLA 2EPNA 2V0TA 4ERGA 4IPPA 3PNUA 3CHFA 3S2CA 4H7CA 1FBAA 1YADA 4EF9A 2OTDA 2JEPA 1F3XA 4LRSA 4V1YA 2DPEA 4LB4A 1JUKA 1W9DM 1EOKA 3GDKA 3URNA 5E6ZA 4QDPA 2V3EA 1GOXA 1AVAA 3GHRA 3UVAA 3GD6A 1JNEA 3B0YA 4Q8PA 2PZNA 3W01A 2ZWZA 1I45A 1MNSA 2Y5SA 3APYA 1ISYA 4ZTXA 4JQAA 5AB3A 3BLPX 3G1RA 2E6FA 4M1BA 3T4WA 4XIAA 1LTDA 3E6EA 1U1JA 4B5WA 4S3DA 1R7AA 3W71A 3M0KA 3BLDA 5IOBA 3CZGA 1XGDA 1AJ2A 4KIRA 5HOSA 1R2RA 2XYLA 4HTYA 1QXLA 1FWFC 3AMKA 2WK2A 1V3IA 3QMTA 3DERA 2QUUA 3ARYA 4MM1A 4UTWC 1OBAA 1DPMA 2OZ8A 3W00A 1U22A 1V6YA 2H9AB 2C1HA 1PVNA 3E2VA 1JPKA 3PK7A 1Q63A 1A3WA 1F9CA 4RDZA 4DUWA 1BF6A 5J04A 2EO7A 1H51A 2QGYA 2A1YA 2WQDA 1H2JA 3BLOA 3NZGA 4TVCA 3C4UA 1Q6FA 4LAUA 1FH9A 4WSHA 3W70A 1XBXA 1K6WA 5K9DA 4S3BA 3UY8A 1W1PA 4GXWA 1X39A 2BVDA 3BW3A 1K6AA 1H41A 4JX6A 4LC8A 3QMRA 3QV9A 4Q6JA 1YHTA 1Q45A 3EXRA 4JYDA 4BI5A 4G1KA 4M8UA 1HVQA 1AH0A 5D8ZA 1BVZA 3BZGA 3GUGA 2Z1WA 3LHYA 4MJ2A 3TW9A 4AYGA 3QR1A 5A6JA 4JX4A 1REQA 3CWHA 2E1WA 1H4PA 3RU6A 4BKNA 4BWLA 3S0CA 3WD1A 3T55A 3SCRA 2NX1A 4E4PA 2P88A 4KS0A 4NP7A 2YXXA 4DNHA 4Q4KA 5H8PA 4GJIA 3MUXA 2QDDA 5E0FA 4WOQA 1TFVA 1XG3A 4CQCA 2W0UA 3RO8A 5A6BA 2DFAA 3E0IA 4AXNA 5C9WA 2JIEA 1R3RA 1RCQA 1OX4B 2DZWA 1BD0A 2V5KA 2V3DA 2VEFA 1LDCA 4S3KA 4KEZA 3WY1A 2X42A 4OQVA 3W7KA 1W1A1 2VDHA 2I56A 3DECA 5AY7A 4QNWA 1FWDC 2AL2B 4AH7A 1K8ZA 3MMUA 2H8ZA 4Q7IA 2YKKA 3QHMA 4QAWA 3V7PA 1E9ZB 1Q3NA 1CGXA 4FNUA 3WQ4A 2AMXA 5HJLA 3VOIA 3F2BA 3QFEA 3TDFA 1W56A 3MP4A 3WSUA 3I3BA 3GFYA 3WLJA 1C8YA 4URIA 1ZP4A 1Q8AA 4U33A 2BBFA 3FW6A 1I1WA 1P5BA 4ZOCA 2A3EA 3ANYA 2HRWA 4J27A 3RK8A 2J88A 3NZRA 1VENA 1X96A 1O4UA 1LZOA 5A6AA 1QRQA 4AD3A 5A3HA 4GISA 2VCBA 1UD6A 1CXLA 4HP5A 1W91A 4Y6GA 3K4WA 1X8CA 4D9PA 3GFZA 3LS9A 3LXBA 3UWWA 1E6XM 2GVEA 4HNVA 4B5VA 4G9PA 1OF6A 4U31A 4UMAA 3REQA 4GCXA 4JTSA 4HNOA 5EB8A 1Q7QA 5AHEA 1VYPX 3KW3A 4DXKA 1TB3A 4Z1BA 3WG6A 3TZFA 3ZT6A 1BWLA 1WXZA 4L9XA 4GZEA 1S3TC 4K39A 3W82A 4OTKA 1GOMA 5I09A 3HJZA 3EX4A 3KM8A 3CC1A 2WSRA 3HV9A 1R9ZA 3K8KA 4XK2A 3WJZA 1P0BA 3W1UA 1HG3A 3ZIZA 1I2OA 3QEZA 5BOFA 2HS6A 2ZOXA 2OODA 3L67A 3KCOA 3WDJA 4IGMA 2DT3A 3UP8A 1E51A 2ZZ3A 4LBUA 1SUXA 1J01A 1SO5A 4Z2IA 2ZUUA 2EEXA 1BQGA 4PRTA 2GGJA 2VX4A 2VRQA 5D4YA 1E0XA 4KESA 4DZHA 1WZKA 1LQAA 3KLKA 1W3LA 3FKKA 2PF0A 4LW7A 2P8BA 1UA3A 3NWRA 2E68A 4HB7A 4UBPC 1JDCA 3A9BA 2X2YA 2Z2UA 1UWUA 2OKTA 3BV4A 4UTHA 5C6MA 3NOEA 1UB3A 1UASA 2Y70A 1IEQA 1GORA 1QNOA 4KWVA 1V5XA 5DCDA 2PDPA 3WQ6A 3NQFA 1OYAA 2QAFA 3W7IA 1GQJA 2WZTA 4EKJA 5BRPA 4NU7A 1E70M 4K68A 2WMGA 3PJWA 3VABA 1TV7A 3H2CA 4K37A 2GVGA 3FKRA 1JRBA 1N8WA 1UW9A 3SURA 2XSBA 4JIIX 1Z9AA 3SUTA 1GW9A 3TOPA 2VO5A 3VNIA 3DGRA 3OTRA 3VD3A 2QDHA 3LBCA 4AIEA 3VTRA 4MPQA 2WSPA 3ZT7A 3L9CA 3W28A 7TAAA 4H04A 2GVJA 3UPMA 4NZCA 3SR7A 4YHEA 3W7JA 1CLKA 3C3NA 1P48A 1RVGA 1TWDA 3AHYA 3E0VA 3G1FA 1OFRA 1T99A 4RLIA 1GVQA 3CMGA 2A3BA 3LBOA 3M1ZA 4A35A 3ALFA 4A3UA 4L6DA 5ABGA 1W5OA 3OB8A 4QLJA 2PWEA 4G7FA 1PIFA 4PSRA 3F5KA 5C9UA 1NP0A 2E3ZA 2W91A 2XGIA 2DVUA 1FWBC 1JG9A 4O0QA 4GZ7A 1QW7A 3LPPA 3UWYA 2RKXA 3V5FA 2OELA 2F2HA 4M81A 2YBUA 5IBXA 4NI3A 3A3HA 3AMGA 5I3KA 3UPBA 3GNPA 1ZBKA 1U5JA 3MPGA 4KCVA 1JUEA 2D3LA 2E28A 2Q71A 3H54A 3CEPA 2HISA 4LTSA 2ATSA 3GVWA 1KB3A 1HZYA 4CN4A 5DMLA 1LRQA 2ZWYA 3FS2A 2G3NA 4UFJA 3WNLA 2BZNA 4N42A 4LAKA 2V8ZA 4S39A 1CLVA 2QPSA 2OPJA 4O52A 3QN3A 2CLOA 1CXKA 3SCQA 3H53A 2VX7A 3LX9A 4I9MA 1M53A 3GX9A 3IJIA 4E2VA 4LALA 2XVGA 1NOWA 4C1KA 2YYUA 3NPVA 4EPDC 2A3HA 1ISVA 4D71A 3E96A 3CJPA 4U5KA 3G6MA 4LJ3A 4IIEA 2XISA 2PDQA 3MHGA 2POTA 3VNDA 2D0HA 1XDLA 4P8UA 2DUXA 2GDUA 1K9TA 5D2VA 3QC0A 3MJMA 4WKHA 2FVLA 2C6QA 1W6TA 5LKYA 4AMCA 5BZAA 2J7BA 4DBSA 4RJEA 4QG9A 5JIPA 4FX8A 3TXZA 1VHNA 1SGJA 1Q6OA 2XH7A 1UR8A 3B05A 3W22A 5FF2A 2WLYA 4GXMA 3S42A 2IKIA 3I6RA 2FZ8A 4HHLA 3FSUA 2REQB 2E77A 1E6PA 1EEPA 1TCDA 2PCQA 3K1GA 1EJRC 3OGSA 2VEIA 2PP0A 5G2WA 3VINA 1NTHA 5CPSA 4K7VA 1NH6A 1XCFA 1OX4A 2XINA 2PD5A 5HBFA 3AMDA 4JHMA 3LK6A 1DHKA 3TW6A 1ECQA 4PUKA 4UTJA 3WLOA 1LRNA 5M2FX 3OIXA 1FP8A 1KFCA 3QW4B 3KWXA 4FX7A 1RZMA 2B81A 4H7VA 2GJXB 5D2YA 2E40A 1B3YA 3WENA 3CM4A 2W79A 2NWRA 3TYZA 1J93A 4JTTA 3MHFA 1OC6A 4BFAA 4Y90A 1KD0A 5IDZA 2Y63A 1OVDA 3PZTA 1RP8A 1TTQA 2WZEA 5A8MA 2YCKX 1KRBC 4ZO7A 1U30A 5FEZA 3HMJG 4DZAA 1E71M 3AS0A 1TO3A 3U7BA 1JDEA 2DSKA 2JF7A 1OQFA 2QDEA 3HMCA 3SI9A 4HK7A 4AWSA 4LVGA 3SUWA 1ODUA 3EDEA 3H4WA 1VFLA 1YNPA 4MIMA 1C93A 1M03A 5D2TA 2BVTA 3GSMA 1JPHA 3ITLA 3U4AA 4ASTA 3STPA 4B4HA 4W8AA 4H9MA 1WAUA 2A4AA 4IQDA 4S2CA 4RNFA 1O12A 4S1FA 3AS3A 2CETA 2QLYA 4KH2A 8RUCA 3W23A 1NOUA 4GFSA 1YDVA 4DM1A 3OU8A 4YYFA 3FJLA 4F66A 4ML9A 5ECUA 2J8GA 2QUTA 2PMQA 2ATMA 4B3KA 3NL6A 3VMPA 5F2GA 5KZMA 4M56A 4RPPA 2WZMA 1XFCA 5CCZA 1TMQA 3T0DA 1VBRA 5HMEA 4UQAA 1FCBA 3WF4A 4L6OA 5A2CA 4J5NA 3I3EA 1J0YA 4I5RA 3H2EA 4BF7A 3UJFA 3FGCA 5C9RA 3NEHA 1OB0A 1GVRA 1C7TA 1DQUA 1N2VA 1JDAA 5AKQA 3KHDA 3WLIA 3MWAA 4JTHA 1TPH1 4D2JA 3CU2A 1ZUAX 4H83A 4OVXA 1JXKA 2QCFA 3PAJA 4I7VA 1MW1A 2DT1A 4PMUA 1UH2A 7TIMA 3TNBA 1GONA 3G3MA 4HYRA 3GWQA 3QQ0A 2ZE3A 3KVLA 1DHPA 4C6LA 1JCMP 4GCAA 4C1NB 2VFEA 3G1AA 2GSHA 2V67A 1DIOA 3DHUA 4DWSA 3EWZA 4C90A 4YXGA 3ES8A 3W7GA 1OFDA 1XLBA 1IE7C 4KRUA 4Q3MA 2VTFA 1J2BA 1YQ2A 1ZGDA 2WJZA 2ABAA 2ISSA 1ITXA 3ARUA 1SFSA 1WQ5A 4ERAA 1V02A 5CBJA 3M7SA 3M16A 4IMEA 5A69A 1MEIA 1NOFA 1VKFA 4Z17A 1CI1A 4NZ5A 1BTMA 3PP7A 2PDNA 1S1RA 4FLQA 1DXEA 1P43A 3T09A 2C1IA 3FEQA 1VFHA 4ZE4A 2Y2WA 3NVTA 3IJDA 3HFYA 1TIWA 3L4WA 4GI8A 2HBVA 1I2QA 1FKWA 2ZZ6A 1HL8A 3CAVA 2XZ9A 1KM1A 4HA3A 2QJMA 1EZ2A 2W66A 4J3XA 3E74A 4AMAA 3PZIA 4GOAA 2GJNA 5CLWA 2NX3A 5JH1A 2ZIDA 1Q2SA 4HGXA 1B3XA 3CHVA 3ITGA 5HJYA 3HA1A 4YVPA 2Z6IA 1G0CA 1GVOA 1J10A 2WNQA 2WKGA 4MB4A 4O1EA 1HX0A 4D6CA 4GRSA 3P80A 1P7TB 2EJAA 3VGGA 2XG9A 2GUYA 1J2WA 1H61A 1GQIA 2IS7A 3RPMA 2GPTA 1H7NA 1EC7A 1R3QA 4GKTA 2Z27A 3R0KA 2DT0A 5HPOA 3TLQA 3RLGA 4PTVA 1Q8JA 4MZ1A 2WMJA 4WLCA 4GMEA 1C92A 5C9ZA 3A3WA 2A79A 4G56A 1O94A 1W1VA 5D9OA 3NSNA 3KZPA 4F0KA 4BY3A 3NDZA 3O0KA 5I79A 2PUZA 3KL3A 2QV5A 5DCBA 3M7WA 4ICMA 1G4TA 3EZ4A 3G1HA 3MT1A 5CJ5A 1FHLA 4BF9A 4IX2A 4ZVJA 3TYEA 4QJ1A 5G1MA 4MNJA 1V51A 4H9TA 3KCJA 4QEHA 3W85A 3TN3A 4FA3A 3WCZA 3STFA 3BOFA 3H26A 5FESA 1BFNA 1LORA 1I0BA 5I06A 2Z24A 3URQA 2WBGA 3K13A 3W7EA 4L4OA 4FXRA 3V0TA 3M07A 3AUOA 1A5NC 2G37A 4S3GA 1W5QA 4NKCA 3QKEA 3OG2A 4WSKA 3OBEA 3VOHA 1KTBA 2A3CA 1OSEA 1MFVA 4DX3A 3F7JA 4W8LA 2VURA 4QE1A 3URAA 5C7HA 1OY0A 4ZBCA 3HF3A 1LUCA 1KBKA 1TPDA 4L1XA 1JQVA 1RPKA 3FYYA 4YTQA 5FAJA 2PLCA 2HTMA 3QM3A 3FX4A 3O1NA 3R2GA 3ABZA 4HMCA 3PJUA 3DBNA 2BV9A 3W2JA 2OLHA 1NIUA 2Q8LA 2YX0A 5D30A 1XIMA 2FB2A 3WEZA 3OQ8A 4HU4A 3LM7A 1HJSA 2WHKA 4NZFA 2REQA 1B3VA 3MUY1 1W3JA 3VA8A 4GO9A 4D8LA 5CZJA 4I6VA 3WH9A 3ARWA 2DV0A 5M03A 2X0YA 3LRKA 3LU2A 3Q4DA 4R27A 4A3RA 1W9UA 1EIXA 2OZ0A 3GVQA 3SCVA 1IXNA 3ZXWA 1PAMA 5EPDA 4BQ2A 1DJXA 2MUCA 3BK0A 5M17A 5A95A 4NNBA 4GACA 2C14A 3MVTA 5CEWA 1UYQA 3V0UA 3GXIA 3LPGA 1VYRA 1TZ7A 1VB9A 3OLIA 1ZU8A 4A22A 4HJWA 3QPZA 2WC7A 3SFWA 1O68A 2GJXA 3CV6A 3MSGA 2VWTA 3NJ3A 1CGVA 4RL3A 4ZOBA 1JCNA 3EKZA 4B5XA 4O8RA 1E73M 1F7BA 3JRKA 4XZ9A 2GK1A 1W1IE 3R11A 2MNRA 4UFIA 3WD2A 1NFPA 1E72M 2VEKA 1A4LA 1IT0A 3QQ1A 5I3HA 2Q09A 3MYPA 5D8WA 3WLMA 2FHCA 1S2TA 2VMFA 1R3YA 3GZ3A 1DYSA 4DJEA 1HJWA 4GGHA 3KBJA 1EJTC 3THDA 3CPUA 5IRPA 4LV9A 3VIIA 4TVUA 4TMBA 2X1TA 1JD9A 4GBUA 5JBFA 3BVJA 1UOZA 4AFYA 4PH6A 1DJQA 1DBTA 3QH2A 7A3HA 3N17A 4A29A 4JTGA 3GG0A 3ICJA 3VX0A 1FWNA 3TR2A 4EXBA 1UKOA 2CLEA 1NQ6A 3GNOA 5BXPA 1WKDA 5C8BB 3KAOA 2WQPA 4QJ3B 2V2CA 1I2RA 4GX8A 4GE8A 1WOBA 4MWAD 1H1ZA 4Z1AA 3VVGA 5CC7A 1KBBA 1GPWA 3BG9A 2OT1A 4EF8A 4XO7A 1A3XA 1S46A 3QYQA 3HZ3A 2E09A 2XFYA 1F61A 3QRHA 1W1ZA 1ONEA 4F0SA 4OE7A 3PJXA 4QS6A 4I3GA 4UTUA 4TR9A 1VZWA 3G2GA 5EYWA 5F1UA 1EFZA 3WNMA 3UZXA 3CL7A 5DBUA 5CPTA 1NU5A 1QK2A 4XD6A 3W1QA 1T7LA 3DENA 5G2IA 4HSHA 1XG4A 1JZ2A 4IXHA 1EX5A 3FOKA 3ONBA 3T0AA 2YL6A 5CAHA 2Z26A 3MVIA 5G4EA 4M24A 1WO2A 1Y65A 2PTWA 1I1XA 1CENA 1KKRA 2WB5A 3F2CA 3DG7A 1YW1A 1NFBA 4MJZA 1SU5A 1EX1A 4B2DA 3ABRA 3VIFA 3WK3A 3OHMB 2OYLA 1K8XA 3DG3A 2GDVA 2YJQA 4R3UA 2ZRWA 4L1WA 2BXYA 1ICSA 1K7XA 1KLYA 1E40A 1LWJA 3KRBA 4C1NA 6CGTA 3M0ZA 4C6MA 3E2RA 2O7QA 3W83A 1XH2A 3TCEA 2Z29A 3WLPA 3MW7A 1WOAA 4L5ZA 4CNUA 3TCSA 5DXXA 2WV8A 3MJYA 2VZOA 3GG1A 3AROA 3O6CA 3W4RA 4D8ZA 2PDXA 4PMVA 1KRMA 5F2IA 4H6QA 4X63A 5DT5A 3IGXA 5BRQA 2HNEA 3GYCA 1KFBA 5CXPA 4C7GA 5HR6A 1EHAA 3B8TA 2P5NA 5CJMA 1XYZA 3F4CA 4U4MA 1FCUA 3F4DA 4GVFA 4OECA 2P1FA 4CUCA 2DZTA 3QR0A 1GOIA 1JI2A 1CDGA 1UD5A 1VFSA 4LGXA 2RJHA 1AW5A 1XYFA 4JTDA 1UD4A 1EBHA 1TX2A 2QGHA 4JTKA 3B0UX 3IV3A 2VR2A 4LUSA 3ZLFA 1TWIA 1TE1A 3TVAA 1IXOA 2RAGA 5I24A 4KWUA 4DJDC 3TV8A 2GYIA 3MWCA 4XVEA 2HSAA 1M7PA 4W7VA 1P7TA 1EF3A 4UTWA 1ME7A 1N8FA 4O11A 2H3BA 4D1JA 1V7AA 3FXYA 1VEPA 1AL7A 4XG1A 1AW2A 2FLIA 4PMZA 2XVKA 4H9UA 3D5HA 3OHIA 3QTPA 3H2FA 3H24A 2ZUNA 1KNWA 3BQ5A 4D1IA 2J7DA 1MRAA 1XW8A 2JKAA 1VPQA 3FLUA 3UCCA 3TFCA 1ZZMA 2FH6A 4O0ZA 1E9YB 5TQLA 3N18A 1EJ7L 2FFIA 5HDRA 3N04A 4IMGA 2F6KA 1TJPA 1AD1A 3CZ8A 2A2IA 2VD8A 2I16A 3I10A 3LG3A 3L4VA 1V8EA 3LERA 5D2WA 1CT5A 4JFTA 4W9TA 3W88A 4PUEA 1T40A 3GDRA 1I75A 4EAYA 4E38A 1A0CA 4H3DA 1JZ5A 1R38A 3NM1A 4GXPA 2NSOA 4US5D 4RDVA 4ZOEA 3UZ5A 5PTDA 5LGXA 4HYVA 3NCOA 2GSJA 4G2DA 4FR1A 3PB0A 3TN4A 2A5HA 2OXNA 3E12A 5XIAA 1GNXA 2ZZ2A 3WNKA 4IIFA 4IIBA 3W1AA 2WVSA 3LZ5A 3H23A 4PTWA 5BWFA 3HG3A 1NSJA 4QE5A 5FL0A 3PS7A 3LQGA 4FP1A 2AQWA 4P8VA 2P3EA 4PL2A 5CLTA 3CMJA 1D7FA 3L4YA 1DIKA 4ZZ9A 1OGSA 4MTVA 3PZNA 2OU4A 4LOCA 1G9HA 4X22A 3I65A 4PMQA 3WJYA 2H3DA 1XRTA 4P8WA 3JS3A 1ICQA 4MJMA 4QSFA 2R24A 4DPQA 2ZX6A 1VJSA 1CIUA 1TG7A 3OODA 4EE9A 2YZ5A 3O3RA 4E6MA 3VIHA 4W4QA 3Q58A 4Z2KA 4YVXA 3HPAA 5AYYA 1GVIA 2HK1A 3RM4A 1VCVA 2EPKX 2OQLA 1FCVA 2GGGA 3R12A 5K3VA 3OBAA 4HOWA 5MKGB 1UZ4A 3IVUA 4EVZA 4WZHA 3CIWA 2J9YA 5M5DA 1JQXA 3CWOX 5A6TC 1GK8A 1YDYA 4MB5A 3SN0A 1GG0A 1J0ZA 4DJFC 3CK5A 2J9ZA 1ME9A 1BYCA 3W1NA 5LIUX 1BYDA 3ARZA 1JFXA 8XIMA 4QJ5B 3MUAA 3R10A 1VQTA 4AHQA 1E1EA 1TQXA 1PEZA 3NQAA 2QCHA 1U83A 2VRJA 3TEVA 1EP2A 2P0IA 1VYSX 3TJXA 3ZLHA 3IVSA 1BRLB 3NGJA 2I7GA 2IKGA 3CUXA 1Z42A 2EG7A 3C8FA 3O06A 1FWHC 2OSYA 1KFEA 2PS2A 3M9YA 5BOEA 3W27A 1N55A 1VLIA 2PLJA 4M7TA 1ZJHA 5H2ZA 2VZVA 3N12A 1HIZA 4L4PA 1GQLA 1ADSA 2DJXA 1CLXA 1XP3A 5G5IA 3L2IA 3CUZA 4HNTA 4KT2A 4O28A 2WZHA 5IHSA 4KGLA 1YKWA 3U3HA 2QUMA 3SIZA 1WBJA 3NL2A 3OZMA 1IZKA 4YU1A 1XGZA 2C71A 3W84A 4HA4A 4DF0A 1BWKA 3SY1A 3W7QA