3N9KA

F229a/e292s double mutant of exo-beta-1,3-glucanase from candida albicans in complex with laminaritriose at 1.7 a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
molecule tags Hydrolase
molecule keywords Glucan 1,3-beta-glucosidase
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n9kA00
2W66A 5DT5A 3CZ8A 5A8NA 1E71M 1KQYA 5GNZA 2XJ7A 2J7GA 3UETA 2DH3A 1GQLA 4AZ7A 2O9TA 2Y4SA 4UFJA 1X6NA 2DT1A 4JHZA 2BHUA 4ATWA 3GXDA 3PZVA 1BFNA 1Q6EA 3BAXA 4R27A 2VZTA 5JBFA 1KFWA 5A3HA 3DYOA 2YKKA 3FHQA 4TX6A 2PI6A 5GPRA 4D6IA 4V2XA 1KGWA 3W4RA 3WH5A 4UQBA 4OJYA 1EQPA 3QOKA 3UR7A 1PPIA 5BXPA 3TTOA 1UZ1A 1ZBKA 4CN1A 5CG0A 2YDQA 2OYLA 1J11A 5D8ZA 4K68A 4LYPA 3AS1A 2WZHA 5BXSA 2ZXAA 4PMUA 4P8UA 3SUWA 1WO2A 2JE8A 2WHJA 2FHBA 3ARVA 3FNDA 4IPNB 4JCLA 3N15A 2YA0A 4HA3A 8CGTA 3NIYA 2J78A 4S3JA 1C93A 5I0DA 1DEDA 1J10A 2WCAA 4W88A 2NT0A 1RD6A 1EHNA 1KB3A 2ZIDA 3J7HA 4W5UA 1EOMA 3BMWA 1H5VA 3SCQA 1H4PA 5A8MA 1E5NA 3L4TA 4JFVA 3VILA 1CYGA 3F4VA 2YL6A 1H0GA 1CNVA 3CMGA 2JALA 3OZPA 4NRSA 2QHAA 1QBAA 3ZJ8A 2E9BA 1GQJA 3RMEA 4X0VA 4DM2A 4RE2A 5CGMA 4TXEA 4U5KA 1G01A 4DWSA 1CXKA 1ESWA 1XYFA 4FK9A 3WBEA 5D9PA 5A1AA 1H49A 4B15A 3WH6A 1W9VA 7TAAA 4AZ5A 1L8NA 2IUZA 3VIJA 1WDSA 2HVMA 3W82A 3VMOA 2OYMA 2JIWA 1KCKA 5LYRA 3AHYA 4AZHA 5AYBA 2CCRA 2CHNA 2E4TA 2Y24A 5I78A 1UD3A 4AISA 2J62A 3CTTA 2WC4A 1D3CA 3OLIA 1VJSA 1E3ZA 1FFRA 2ZX7A 1LG1A 1JXKA 3GNPA 3AIVA 1VBRA 3WNPA 1JZ3A 1BVZA 3NDZA 3IJ9A 1XSIA 4A3HA 4HZ8A 2F8QA 4GKLA 4GZEA 2GK1A 3L4WA 3PHAA 1UD5A 4D6JA 4P7QA 1E4NA 1J0IA 4PUEA 2BY3A 5E0CA 3GXFA 4CCEA 2XYLA 3VIMA 3W28A 2VRQA 2VX7A 3GH4A 5BXTA 3GXMA 3W37A 3PN8A 1YQ2A 2XVKA 1E6QM 1V6YA 4CCCA 1IT0A 1VIWA 3LPFA 4D6EA 3AJ7A 3VIGA 4F9JA 3WFLA 3KL0A 3BH4A 2V38A 4IUGA 4AD4A 3WSUA 4PMYA 5BWFA 1UD6A 3ZJKA 1BGAA 3ZT7A 4CD6A 3WD0A 3ARWA 3ECQA 4AIUA 3M7SA 1UYQA 3ARPA 5DEZA 3I3EA 1FA2A 4F9DA 5D4YA 1GOWA 4HPGA 1LL6A 3CLWA 1FH8A 2VZUA 2IXUA 1OD8A 1E6SM 3BSGA 3PTQA 1UKQA 2E8ZA 1OINA 3DYPA 1TUXA 2J79A 2O9OA 1W9PA 1JG9A 2WZEA 2BVTA 2VX6A 2VQUA 4DM1A 2DPEA 2UY5A 4UQAA 3UERA 5I79A 1JI1A 2FH6A 2D20A 1VJZA 4HMCA 1GCYA 1UH3A 6CGTA 4HU0A 1AQHA 2CBIA 4GI9A 4F79A 2YBTA 2WKLA 1BHGA 2XWDA 2EXOA 3U7VA 3L2MA 5D9MA 1HN1A 3CZKA 3IJ7A 1XHGA 1MYRA 1M04A 1LL4A 1HKKA 1MQPA 4L4OA 4TUFA 2WK2A 1BYBA 1FFQA 5ABGA 1UKOA 2WVVA 3VO0A 2VUYA 2WWCA 1MWOA 3UESA 5A6SA 3II1A 4A4AA 4F8XA 3EDFA 1BTCA 5FIPA 2WKGA 2YL5A 2WLZA 3L4XA 1R8LA 2BXYA 3RPMA 4C7GA 1UD4A 4J27A 5IFTA 5CSYA 4GPNA 3OG2A 4MJ4A 4BF7A 4C7FA 3AHZA 4MB1A 3MANA 2VOTA 2FH8A 2J8GA 3ZOAA 4V28A 2JIEA 2EPOA 4LGXA 5EMYA 4MDOA 4AZ6A 4NSBA 1P6WA 1NWUA 2WVTA 1W3JA 3MMWA 4AWEA 4P8WA 3SUUA 3SURA 4JCMA 3IAPA 3GTNA 1ZBWA 2YLAA 2XG9A 1DWJM 5CPTA 1JD7A 1HP5A 4MNKA 3APGA 1V3KA 2OLHA 1KWKA 1GVYA 1K9DA 3S6TA 1UA7A 4LQ1A 1CZ1A 3T2PA 3RDKA 5A6BA 1UD2A 5HNNA 3O9NA 1CXEA 1HJQA 2G3MA 5FKYA 3KE0A 1QHPA 2G4FA 3WQ5A 4PSPA 4Z2IA 3VMPA 4AEFA 4HTYA 4OBSA 4UR9A 1UUQA 1B3WA 2CXGA 2WSPA 5A6BD 4JFUA 4AYSA 1HJSA 5M5DA 3DHPA 4AD0A 4ATLA 2J7EA 1BQCA 4JIEA 4AC1X 1CDGA 1UQZA 5FOOA 3KL5A 4J3WA 2WBGA 1GNXA 1CGXA 3RM4A 4M82A 2WVUA 4BS0A 2VZOA 4TTGA 2XFRA 4E8DA 5AY7A 3B9DA 2ZUUA 4E4PA 4H8VA 1SMAA 2D22A 2VMFA 3KWXA 1E15A 3WY1A 2NW0A 1W1YA 1J0HA 3VGDA 4ZEPA 4AIEA 4KRTA 4GXPA 2DH2A 5GNYA 2PWHA 1W91A 4MNLA 1L0PA 1QNPA 1UR9A 1UR1A 2YA1A 3ZR5A 1BSIA 1DWGM 3ALGA 3K4DA 4U33A 4P7LA 3OLDA 1QNRA 2CBUA 3OB8A 4X0NA 3MKKA 3RCNA 3GNOA 5IHSA 2VZSA 3N11A 2XTKA 4PN2A 4MB4A 3F5LA 4WKHA 1CXFA 4R5EA 2X2YA 1V0NA 4UQDA 3WDIA 2PF0A 1V6UA 5IXEA 4KWUA 1OIFA 2Z1SA 1J0YA 2VCBA 3WENA 3VGHA 3AMLA 3GBEA 3CBWA 1UZ4A 1WZKA 2WANA 1WB0A 5E6ZA 3WDHA 1ZBVA 4W84A 4NI3A 1JNEA 4D71A 1VEMA 4BQ5A 2VR5A 1E6PA 5AYIA 4B16A 1DTUA 4KGJA 3VD5A 1UR4A 1TCMA 2F2HA 2BY2A 4M24A 1RH9A 4HOZA 3VM7A 3ZR6A 3W24A 1GONA 4CGTA 3AS2A 4J28A 4BZYA 1GPFA 2IXVA 1E73M 5EBAA 4FF5A 1KBKA 5E6YA 1NP2A 2X1IA 2XSAA 1S46A 2VT0A 5A8QA 2ZUMA 1GQIA 2EPNA 1V02A 4D72A 4CD5A 4MTVA 1IV8A 4PYSA 3QHOA 1PZ2A 4CU6A 3CUHA 3WNKA 3WD3A 5CJ5A 6A3HA 3DECA 4JFTA 4B3KA 1KBBA 1GJUA 3CZJA 2XGBA 2WMIB 3T09A 3NJ3A 1U2YA 1BG9A 1E0WA 4H04A 4GI8A 4UTFA 1HJWA 2WC7A 3BCDA 3WF0A 1CGWA 4TVCA 4Q7NA 1AQ0A 3B8SA 2VVSA 4UFLA 3RJYA 2XUCA 4YPJA 1B3ZA 1OGSA 4RE3A 4U3CA 3U5YA 3U7BA 4KH2A 3MS8A 2OSWA 3SCOA 1TVNA 3N1AA 1H1NA 4DWSD 2OSXA 2OWCA 2CHOA 1UKPA 4BQ3A 1R86A 3SCRA 3WEZA 3BLKA 2J75A 3AMKA 2BS9A 5D8WA 5ABFB 1VAHA 2JEPA 2WLYA 3T0AA 1EHAA 1MW1A 3AHVA 5F7UA 2PBOA 2DEPA 2ZX8A 1DWAM 4Z2GA 1B3XA 4WIWA 1H0IA 3VPLA 3PZMA 4V27A 1JZ4A 1VENA 1C7SA 5JIPA 1GJWA 5DFAA 2O9RA 5BXRA 1B1YA 4AD5A 2VO5A 4ML4A 4JHOA 3ZSSA 4WK9A 1VRXA 4J3XA 4AD2A 1BPLB 4UOQA 1B90A 1EXPA 1OB0A 4FLOA 1XSJA 5JUVA 1WNOA 4PMQA 2VI0A 1HIZA 1SMDA 3A4AA 4UFIA 4RL3A 1NWRA 2YL9A 3GH7A 2BHYA 4J7RA 1GHRA 2YLLA 1OIMA 3JUGA 4ACZB 2Y2WA 1DWHM 2V5DA 4UCFA 1PX4A 3SUTA 2D23A 2BHZA 2QPUA 2FDMA 4AY1A 2ZXDA 4XB3A 4U2YA 1AMYA 1US3A 3VGEA 3ALFA 2D3LA 4MAVA 2AOSA 1GOQA 2D0HA 5A69A 1JZ8A 1E4IA 2CIPA 5HPCA 2W91A 1UHVA 4WKAA 1Q6GA 1QBBA 2UWFA 3VGBA 3IK2A 2J8FA 4WLCA 1V02E 3CGTA 2CBJA 4PCSA 2BXZA 3BAKA 2CKSA 3AOFA 4D1JA 2QF8A 3IAQA 4YHEA 3N17A 4JAWA 4OKDA 1CXIA 1LLOA 1GOOA 3A6OA 3MMUA 3WMCA 1FH7A 4TX8A 3PZUA 3WNOA 3ARRA 1HP4A 3WBAA 3EMZA 3T0BA 5E9AA 4J3VA 2G8ZA 3IANA 5EFFA 4ZENA 2EPLX 1ZB5A 3FN9A 3ZO9A 1V3HA 1U33A 5D9OA 3BC9A 2WPGA 1JYXA 4QLJA 1NP0A 2GJRA 1JFXA 3VD4A 1CTNA 2G3IA 1HVXA 3VD3A 1M03A 3SIMA 1ISZA 4C7DA 1LF1A 2XVGA 1NQ6A 1HKIA 5I24A 3CH9A 1LG2A 1C92A 2WHLA 3LPOA 3WDQA 1FHLA 1GW1A 1K9TA 4ACYA 4CVWA 3MV01 2XWEA 1UR0A 5A94A 3EDJA 5C71A 2GJPA 5LA2A 3PZGA 1IZKA 3L4YA 1QI5A 1KXVA 3MUAA 2WXDM 2GVYA 4UOZA 2FGLA 5FL1A 2QPSA 1MQRA 4OBRA 2BFGA 2CEQA 3AZTA 3NYDA 1Q4NX 1UG6A 4MB5A 3OIHA 1C8YA 1LWJA 1TFVA 1ISWA 3VIKA 5E70A 2ZWYA 4W8BA 2WB5A 3CZGA 1EA9C 2EBNA 4IM4A 4FLSA 5JBDA 3BAWA 4CVUA 3VDHA 5A6AA 2CNCA 1FH9A 1KWGA 2DT3A 3AS3A 1WPCA 1NOUA 1TA3A 2ZE0A 2VJXA 3WUEA 3EMQA 3AIUA 1JAEA 1XH1A 2D1ZA 1GUVA 4E8CA 1GQKA 2NT1A 2W67A 1WDRA 4A3YA 2EO7A 2J7FA 3WDPP 3FW6A 4YN5A 1E1EA 5HOSA 5IHRA 2Z1KA 2RGLA 5C70A 2J7CA 3PZQA 3FHAA 4CN4A 1R85A 1ZL1A 2NSXA 2V3GA 1C8QA 2XHYA 3OBAA 2PWEA 3K8KA 2DGAA 3SEPA 2EEXA 2YDSA 4D6GA 2VNCA 5M3WA 3RM9A 2ZICA 4DUVA 1E5JA 2VQTA 4WSKA 4HA4A 4Z2LA 2W5FA 3AHXA 1HL9A 1W3KA 3BLPX 1QW8A 2D3NA 3IJ8A 2BVDA 5D9NA 2CKRA 4P8XA 3OGRA 1H09A 1PIFA 1MXGA 3M07A 3DYMA 5A6JA 2VR4A 2GDUA 5E0FA 3T08A 1PAMA 3QHMA 2ZX5A 1VFUA 1V08A 1JL8A 4CD8A 1BLIA 2WMGA 4JFWA 3POCA 1H41A 2YBUA 2ZUTA 4HPHA 2CERA 3SCPA 2DSWA 4AZBA 5M03A 3AIBA 3WQWA 2J4GA 3OGVA 1F4HA 4DUWA 5LA0A 3AHTA 1UWSA 1E6RA 1JYWA 3RILA 1W2VA 1ITXA 4HOWA 4QP0A 4P7NA 3O2LA 1C90A 2J77A 1HJXA 4UNIA 3AYSA 5GQBA 1BVNP 1JI2A 1DWIM 4KGLA 4W86A 4HMEA 2XGIA 5I5RA 4EK7A 1E6NA 1QI4A 1OM0A 4NRRA 4BQ2A 1ITCA 2JFEX 1SYTA 4UQ9A 3WNNA 5I23A 2AMGA 3CHFA 1UWIA 2FGZA 2PWDA 1HL8A 1QVBA 5DT7A 3GDBA 1OT2A 2VURA 2D0FA 3TA9A 4AW7A 2BV9A 1AVAA 3AICA 2ZUNA 4MNJA 4AD3A 4CD4A 1BAGA 1MXDA 2VCAA 1WZLA 5A2BA 2ZOXA 5I2UA 1A3HA 4EKJA 1CLVA 1EGZA 1W1VA 1QPKA 5JIWA 5M17A 1PZ3A 3TOPA 2XIBA 3AMGA 3D5HA 1MVYA 2WMFA 3WD4A 3WELA 4D1IA 4DWSC 1C3FA 4MDPA 4Z2JA 4AZIA 3PZNA 3VIFA 2Q8XA 2YL8A 3MUY1 1WDPA 4FLQA 2EPKX 2O92A 1E70M 4XV0A 1YHTA 1Q6DA 3SCUA 1H2JA 1J0KA 4OOUA 2UY3A 1GVIA 3BSHA 3K1DA 3NSXA 4GI6A 2QV4A 1BGGA 1QW9A 1E40A 4QAWA 1W9UA 3W29A 3M6DA 5ABHA 2E40A 3N04A 3B9EA 2V3EA 2C0HA 2C8NA 1E0XA 1NOFA 4AD1A 2DSUA 3OA5A 3PTKA 4CN6A 3VINA 4QCEA 1XYZA 1V3LA 3AI0A 1SFSA 4Z2HA 1HKJA 2CITA 3L4UA 3AROA 1QNQA 1OT1A 1XH0A 3THDA 3MUIA 4OOZA 5EB8A 3WF2A 1G5AA 1XD0A 4GINA 4PCTA 4HU8A 1FP8A 2YDRA 4MJ2A 3UCQA 4ACZA 1CENA 1XCWA 3A4XA 2PB1A 3SCTA 1GZJA 2W62A 1E43A 3AQUA 1D2KA 1W3LA 2D0GA 5LA1A 3RM8A 3N9KA 4MAZA 1EO7A 1B2YA 3SCNA 1OGGA 2VC9A 1GOKA 5I77A 1B3YA 1TE1A 1CGYA 3UG4A 1JGIA 5TD4A 2ESCA 1J01A 1O6IA 2DDXA 2MANA 2ZUVA 3N13A 1BYAA 3WEOA 2Y8KA 1EDGA 3CMJA 5A6KA 4LXFA 3AIRA 1G0CA 2PWGA 2W61A 3ARTA 5CLWA 2OWXA 1EH9A 3LPGA 5ABFA 2C7FA 2XFYA 4UQEA 4P7RA 2YA2A 1C91A 2B31A 2VX5A 1UD8A 4WKFA 2DIJA 3NUKA 1WZMA 4HOXA 1I75A 3W25A 5HXMA 1HJVA 1FOBA 1JZ5A 1WP6A 1BG4A 3CUFA 3VIIA 1JF5A 3W53A 7A3HA 3VM5A 1U30A 3SUVA 4MADA 1UWRA 4LX4A 1WZAA 3GM8A 1KR0A 1E6ZA 3FXYA 2WAGA 3ARSA 4UZSA 3BMVA 2CESA 1ODUA 1CWYA 4PMXA 3L4VA 3CZLA 1HT6A 2ZWZA 2EJ1A 2J74A 4L4PA 5BRPA 3GXIA 2YIHA 3FY1A 1AQMA 3SCWA 4M8UA 2VRJA 3F5KA 3N12A 4UOJA 4AXNA 4S3KA 1KXTA 2XPKA 3WF1A 4PTWA 1VEPA 1SR0A 2YJQA 3BGAA 4PMRA 3VOCA 3MUZ1 4MB3A 1UQYA 1CGVA 3ZT5A 4B9YA 4XZWA 1MFVA 3AYRA 1BF2A 1TR1A 2VZVA 1K6AA 5A8PA 4Q22A 1UR2A 1JZ2A 5IFPA 4PRWA 4AZCB 4D6HA 3OZOA 1IZJA 1I1XA 4F66A 2OSYA 1KR1A 1EDQA 4B3LA 2A3CA 4DUXA 1MQQA 3AXXA 3A4WA 3VDBA 1XD1A 1JDAA 2WW5A 4W8LA 4CU7A 1W1PA 3ZSTA 5FL0A 1KGXA 4W7UA 3N18A 4UFMA 3UEQA 1CGTA 1WKYA 2GJXA 3AS0A 3LPPA 4EE9A 2BY0A 2X8RA 1QI0A 1US2A 1J9YA 4JFSA 4J3UA 4PMVA 2WHMA 5AC4A 4YHGA 3PZTA 4M29A 5FD0A 2DSKA 4KRUA 1RP9A 3AMDA 1X6LA 2X09A 1ZJBA 3HJEA 4W5ZA 3WUBA 1X1NA 4QLKA 4ZE5A 5A6MA 1V6XA 3EDDA 2BVYA 3FAXA 3WIJA 1B30A 5ABEA 1UKSA 1CGUA 1Y7VA 4AZCA 1M01A 1JDCA 2A3HA 3W26A 1KGUA 3VUPA 3PZOA 3POHA 2J25A 4P7OA 3EDKA 5EFDA 1V0LA 3W6LA 5GNXA 1UOKA 1QNOA 3VD9A 3ZJ7A 4W89A 1XSKA 3WD1A 1V6VA 4CD7A 1E0VA 5HDRA 1JNDA 4UFHA 4EAMA 2Y8VA 1UWTA 3VDAA 3CUJA 4PTMA 5A95A 4E2OA 2WCGA 2DSVA 3AISA 3DHUA 3I3BA 2A3AA 3VGGA 5BYWA 1DP0A 2WMHA 4H8UA 1E4LA 1W9XA 1PX3A 3D3AA 1WCGA 4CKQA 1E72M 1OWQA 3ARQA 1GORA 3U5UA 3VX0A 5CLTA 1N82A 4PMDA 1UA3A 2GK1B 2RGMA 3CPUA 1UKTA 2FHFA 1ISYA 2D24A 1XC6A 2WMIA 3CHCA 3PTMA 3UG5A 2E3ZA 1EIBA 3ARUA 3AMCA 3WQ8A 2XVNA 1LWHA 3GNRA 3S2CA 1BYCA 1E55A 3ZM8A 4QCFA 1EDTA 4OZOA 3M46A 2GJXB 3W6MA 2A3BA 4W7VA 2DT2A 3GZAA 5BCAA 3UR8A 4M81A 1JF6A 3WUGA 3WQ4A 3WDJA 4JKMA 3VVGA 3MSGA 3MU7A 3GYCA 4PUDA 1V3JA 1Z32X 3CHEA 4OUEA 2FHCA 1OCQA 2X05A 3ZJ6A 1OSEA 1PJ9A 5CPQA 3T0DA 2X0YA 3TTYA 3I3DA 3KZSA 3VDCA 1EO5A 3PZ9A 1HF6A 1KCLA 4PSRA 3LMYA 1VFMA 3ARZA 4ZFMA 2G3NA 4J3SA 4XX6A 4FMVA 1HNYA 4URIA 2VRKA 1VB9A 3BXWA 5A2CA 3WQVA 2GDVA 2AAAA 5CGTA 2W63A 1NWSA 1BYDA 2ZXQA 1VFOA 3HU7A 2WZIA 9CGTA 3UG3A 4PBGA 1NWTA 5BRQA 3VX1A 3WL0A 1JYVA 3VNYA 1FP9A 1H11A 1C8XA 4BQ4A 5FCZA 1XV8A 4W7WA 3VU2A 5KZ6A 3WEMA 1CBGA 3A3HA 3VGFA 1V0MA 1G94A 1V3IA 1W9BM 3VMNA 4TVDA 3TTQA 1J12A 3CHDA 4HMDA 1JIBA 1UWQA 2UY2A 1UR8A 3O6AA 1UH4A 5E09A 1NH6A 1OGBA 1JFHA 4AEEA 1NOWA 1UWUA 4JL1A 1TG7A 3HMCA 2XM2A 4JZ5A 1VFFA 2E9MA 2XVPA 4GO8A 2VL4A 3ZIZA 5CPSA 4PTXA 2PBGA 4UQCA 5DMYA 3EBVA 4JKLA 2WVVB 4PMOA 3AIEA 1J18A 3PBGA 5A2AA 1TMQA 4J3TA 4UZUA 2XVLA 4U5IA 5CZKA 1I1WA 4IISA 3T2OA 1QI3A 2DQXA 4NF7A 1D7FA 3WKZA 1B3VA 1W2PA 3EYPA 2A3EA 1ISXA 5I3DA 3NSMA 1VEOA 4CCDA 3WMSA 1V0KA 7CGTA 3QHNA 1R7OA 4ATDA 3WFZA 1NM9A 1CIUA 4JL2A 1CPUA 4Y7EA 1QI2A 3WMBA 1NARA 4GIAA 4PMZA 4OIFA 4X9YA 1KQZA 1GOIA 3WDRA 1E6XM 3NCOA 3AZRA 2E8YA 1ZJAA 4UFKA 1J0ZA 3WN6A 1LQ0A 2TAAA 1EOKA 4ZE4A 2DT0A 1ISVA 1R87A 2CETA 3NSNA 4WJXA 1E1FA 3WQ6A 1CLXA 2XIIA 2XSBA 4AMCA 4HZ7A 4LPCA 2GSJA 2VVNA 3G6LA 8A3HA 2ZXBA 3AXIA 3K8LA 3A47A 3FAWA 1KXQA 5KEZA 3L2LA 1KXHA 4M56A 4BCEA 1XGZA 5HBFA 1E4MM 1W32A 4ZXLA 2YOCA 3VIPA 3PZIA 4D6DA 3TONA 1GOMA 3VNZA 1JD9A 2HISA 3VIOA 2GUYA 1OD0A 1W9DM 4XUYA 1HKMA 1B0IA 2BY1A 4W8AA 2OWWA 1MW3A 4NZCA 1PIGA 1CXLA 1J0JA 2OYKA 3ZMRA 2WYSA 1MW0A 3MV11 1LL7A 5IDIA 2VTFA 3G6MA 2E9LA 5ECUA 3W27A 1FHDA 5A6LA 1V6WA 2WCSA 3THCA 3AIQA 4KMQA 1W1TA 1CXHA 1RPKA 2V5CA 2E0PA 3AXHA 3CZEA 4LYQA 1TVPA 5CQ1A 1JYNA 1PX8A 4W85A 2PC8A 4PMNA 2DIEA 2EPMX 4W87A 3SCSA 3TP4A 1WE5A 1RP8A 3NDYA 1QHOA 3MSDA 2WC3A 3BAYA 1PBGA 1V03A 1HX0A 1F4AA 3SUSA 5HPOA 1PEZA 4PTVA 3AIWA 1Q6FA 3WUFA 1M7XA 5BROA 4QFUA 1CEOA 3AZSA 3WNMA 3W38A 4JKKA 4H41A 2ZUSA 3BAIA 4FLRA 3K8MA 4N42A 4RE4A 3QR3A 2WNWA 2D2OA 5JBEA 2UY4A 2WMKA 1ZU8A 3MO4A 3SCVA 1E56A 1C7TA 1DWFM 3WH7A 4PEEA 4Z2KA 2BNJA 3ZT6A 1E3XA 1JDDA 2VX4A 5A8OA 5CSUA 3E1F1 1B9ZA 3RIKA 1H3GA 4H8HA 2ZX6A 2Y5EA 1ODZA 1TZ7A 1XRVA 3GBDA 4AIOA 4CUCA 2JF6A 1JAKA 1M53A 2JEQA 4P8VA 1B31A 3RJXA 3AFBA 4WSJA 1XH2A 2J7HA 4B9ZA 1G9HA 5DF0A 2WHKA 1CECA 3W0KA 4W93A 4QDMA 2ZUWA 1EQCA 3VIHA 2XM1A 4TTUA 2J7BA 3WH8A 3CO4A 2EQDA 2J47A 2QMKA 1G1YA 1O7AA 2QLYA 3HN3A 3U57A 4U3AA 2WSKA 3OLEA 3KEHA 4DWSB 2WBKA 1GHSA 4GO9A 4H2CA 4MNMA 3B9AA 1Q6CA 3WNLA 1WDQA 3BCFA 3DC0A 1K9FA 4H7VA 4HP5A 2CBVA 1W3HA 4GQRA 4N0RA 4XZBA 1ECEA 2WMJA 1MFUA 1XCXA 1E9LA 1QOXA 2V3DA 2F61A 2W4XA 2XFFA 1A47A 2O9PA 2GFTA 5C8BB 4GZIA 1DHKA 3T2QA 2X0HA 1MW2A 3GH5A 4QLLA 3EMCA 3WF4A 3WL1A 1QNSA 2VCCA 3VKKA 4TOQA 1JXJA 5DO8A 4BA0A 2DSZA 2G41A 1HJUA 4AZGA 1JZ6A 1QHZA 3CUIA 1ZS2A 3OGSA 1HXJA 2CYGA 3QOMA 3ZQ9A 3OLGA 3TTSA 3CUGA 2ZX9A 5I6SA 5CXPA 4GQQA 4U2ZA 4M80A 4MPKA 1VF8A 4ZXOA 3W81A 1OBAA 1TA3B 4M1RA 3CIVA 3K46A 2QMJA 1R7AA 1HVQA 4U31A 2PWFA 3KL3A 1V3MA 3L4ZA 3WD2A 2G3JA 1VBUA 3WH9A 3RO8A 4WF7A 2W92A 3ARYA 2J7DA 1ZBCA 4LYRA 4D6CA 2WWDA 6TAAA 3EDEA 1UH2A 3VD7A 1WAWA 2CPUA 1K9EA 3MMDA 4D6FA 3WF3A 4EANA 5AC5A 2WM0A 3K4AA 3ARXA 4HA1A 4IPLA 3QGVA 3BAJA 4HZ6A 2V3FA 1LJYA 2WVSA 4CU8A 1JZ7A 3F5JA 4GZJA 4TVUA 2JF7A 3VTRA
chains in the Genus database with same CATH superfamily
3M41A 4G56A 4DO7A 5DELA 3HFTA 3P62A 2HRWA 5GNZA 2J7GA 1LRNA 4F48A 2PAJA 2O9TA 4AX6A 4UFJA 2DT1A 4JHZA 2BHUA 1BFNA 1ADSA 4HSOA 3H12A 3A9BA 3C8NA 4MUPA 3NZRA 3DFOA 3FHQA 4TX6A 1P43A 1XGEA 1YDYA 4RPQA 3G1FA 1Q66A 1F6KA 3CV6A 4OJYA 3QOKA 3V5FA 3NR0A 2ZRXA 5CG0A 2FZ8A 5D8ZA 4Z1YA 1R46A 3GB6A 5CZ0A 1YDOA 2NXIA 2ZXAA 4XD6A 3SUWA 3BW4A 4XAFA 3GVGA 5I3IA 3FNDA 3P3BA 1C9DA 1JRCA 3N15A 4HA3A 2IS7A 1XF0A 3V4BA 3CAKA 4E38A 2OODA 5DRCA 1H7WA 5I0DA 1J10A 3TAOA 2WCAA 1RD6A 2MUCA 4W5UA 5AC7A 1EOMA 5I00A 3RLUA 3L4TA 2OQYA 1N55A 1CYGA 1H0GA 1QBAA 3W1TA 3S83A 4QSHA 4ILSA 3RO6A 1GWJA 4RE2A 4PUMA 1OX4A 1ESWA 4FAMA 2B7NA 3R94A 3GQYA 2Z1BA 1H49A 3H2CA 5GJMA 4XK2A 4RKAA 4BWLA 1WDSA 4HYVA 2OYMA 4GYPA 4QBXA 2JIWA 5LYRA 5C9UA 4AZHA 4HCDA 1FWRA 3LBMA 3SJNA 2E4TA 4XZHA 1UD3A 4GIRA 3I6EA 4BF9A 3CTTA 1G67A 1D3CA 3OLIA 4KCTA 1E3ZA 2ZX7A 5CKSA 1JXKA 3GNPA 3ICJA 1XUZA 5D02A 3IJ9A 1A0DA 1XSIA 4GKLA 5K3VA 1L6SA 3L4WA 5K4XA 4JDYA 3PHAA 1UD5A 4K8HA 4P7QA 3MJMA 3KUMA 4FNTA 2NX1A 2V2DA 3MP5A 4GYKA 4C5YA 4GGHA 2FFCA 2VX7A 1R9ZA 4FNUA 4O1BA 4BJHA 1YQ2A 3DENA 3GU2A 1AQFA 3AJ7A 4FR6A 3WFLA 2XINA 2DZTA 4AD4A 2Z27A 3W7OA 4CD6A 4HNNA 2Y7EA 4KFOA 1R30A 4DZ5A 4UNLA 1Q7MA 5BZAA 5CG7A 1FA2A 2ABAA 1GOWA 3D3FA 3UGVA 2NV2A 5AHFA 2IXUA 4IJRA 1H7NA 1E6SM 3MCNA 2E8ZA 4HHMA 1OINA 2O9OA 2PTWA 2OVLA 3LHYA 2BVTA 2VX6A 3QKZA 3W7NA 4PH6A 1OY0A 4L1WA 4L9XA 2UY5A 3QSTA 5I79A 2D20A 3DESA 3STCA 4HHPA 2Z1XA 4DB7A 1UH3A 2EG8A 3E96A 4OT7A 3IPWA 1EF3A 4H9XA 2DZBA 1LCOA 1NU5A 1FCQA 1BHGA 3ANUA 1RCOB 4NX0A 3LA4A 3L2MA 1BQGA 2C1HA 3CZKA 1MQPA 3BCJA 3WBXA 5BNKA 5ABGA 1BYBA 1UKOA 4O54A 4HQVA 5K9DA 3VO0A 4G8TA 3DFHA 2GWNA 4A4AA 1TELA 3EDFA 5HQEA 2YL5A 3UXIA 3RPMA 4J27A 6REQB 5FJPA 1XKJA 3MANA 2JIEA 4YYFA 3R13A 2OOGA 5HANA 4OWGA 2GGHA 4MDOA 2Z7KA 1VYSX 1VLIA 4AZ6A 4MFDA 1NWUA 3NFUA 1W3JA 4NQ1A 3MMWA 1BXNA 2X42A 4FNQA 1L6GA 1WA3A 4C1KA 4QGCA 3GTNA 3LZ5A 1X39A 1D3GA 4RV3A 4MNKA 4LQ1A 4A8NA 4LUSA 3RDKA 5A6BA 5HNNA 1CXEA 4AU0A 2G3MA 3S1XA 1WV2A 4ADUA 3NNTA 5AECA 3WQ5A 4PSPA 3WMLA 4O50A 5JU6A 3A22A 3GTXA 4UR9A 1UUQA 3PF3A 3MSRA 1M68A 3E2SA 3CAQA 3GK0A 2C91A 3DIPA 3ABXA 4AC1X 3CL6A 1CDGA 3E2VA 1CGXA 4BS0A 2E6DA 1SU5A 5BOEA 4TTGA 3BZGA 3VXGA 4UTIA 4MHBA 3L5LA 4E4PA 2OQLA 3HQ1A 3W74A 2Q6ZA 1F61A 3BW2A 4GI4A 4NJJA 1T96A 1YXDA 2Q01A 1RY8A 4E2DA 4J40A 1J0HA 2DH2A 4GXPA 5GNYA 4YTQA 1L0PA 4GKTA 2FYMA 1BSIA 1DWGM 4U33A 4P7LA 5LHFA 3WJWA 1NAL1 3M16A 4H9ZA 3OLDA 2VEMA 1DIKA 4WOQA 1TTQA 3GNOA 4IG2B 1Q6RA 3N11A 4MB4A 3F5LA 2NV9A 1CXFA 3WDIA 2PF0A 4BY3A 1J0YA 1Z41A 1XLGA 1XIIA 3AMLA 3VGHA 1ONXA 3CBWA 3LM7A 3IIVA 5E6ZA 4JTKA 1Z44A 4W84A 4NI3A 4OBTA 4J2PA 3ATYA 2RDXA 3LLDA 1R3TA 4QSFA 4FALA 2Z25A 2ZKMX 4FXFA 1UR4A 1TCMA 2VM8A 4F3HA 2VEGA 3HPXA 4HOZA 3VM7A 3GHSA 1GONA 3SN4A 4BZYA 1E73M 3DDMA 3V0SA 1ALDA 1Q65A 5E6YA 5A8QA 3TTEA 1O5RA 1GQIA 4D72A 2INZA 3QHOA 3BK0A 3NPXA 3CUHA 3WNKA 2QJIA 1N8FA 3WD3A 4G7EB 1JDEA 4DO4A 2A3LA 4A8IA 4NAFA 3NJ3A 1E0WA 4H04A 2P8BA 4YVXA 1B54A 5CJMA 4XUGA 2V81A 4TVCA 1AG1O 4JN6A 1TSIA 2Z2AA 2VVSA 3EWUA 4YPJA 2QEZA 4MIMA 3E2QA 2OSXA 1TPEA 1XRTA 1V93A 2CHOA 3O07A 2P50A 2R1KA 2ZTKA 3M43A 5AYZA 2PSNA 3PS7A 2QCMA 4NG3A 3TJXA 4H1ZA 3NM3A 1XYAA 1MW1A 3AHVA 2PBOA 4WIWA 1H0IA 4G5DA 1A5MC 5G2HA 4XD3A 1VENA 3P67A 5DFAA 1YIXA 2O9RA 4ML4A 2OU4A 2Q3OA 3ZSSA 3AYVA 1D8CA 1IT7A 3URAA 4AD2A 1BPLB 1TJ1A 3SRKA 3SGUA 3UPMA 3FFSA 4FLOA 1SGJA 3A4AA 2R82A 5DCDA 3PWGA 1GVSA 1LOLA 2YL9A 1QNVA 3GH7A 2YB1A 2AQOA 5MF5A 1EEPA 1DWHM 2Y1HA 1TIWA 1PX4A 2QCDB 3W3OA 2ZXDA 4U2YA 3LHUA 1A5UA 1SZEA 3L21A 4XKYB 1S1RA 1KLYA 1Q6GA 3U0HA 3IK2A 4AVFA 1TPWA 4I6KA 3M64A 1N2VA 3T6CA 2CBJA 1W1IE 2AQWA 2CKSA 3AOFA 4WDWA 2OELA 2E77A 2XGZA 1QPRA 1XLCA 1XG3A 2HWGA 2WPBA 1VRDA 4TX8A 3WNOA 1E1CA 4Q4OA 1T6MA 5E9AA 4J3VA 5A6TC 4JTUA 1SSDA 2ABBA 5EFFA 3B0PA 4X3ZA 2EPLX 2OJPA 1U33A 3U48A 2WPGA 3BGGA 4QLJA 3QW4B 3GAYA 3P84A 2G3FA 3VD3A 3W84A 1Y5XA 5BMXA 4J4KA 4QROA 5CAHA 1GW1A 1TPUA 4H7ZA 3ZR4A 2DZUA 4PUKA 3DFNA 2DUAA 2GJPA 3SADA 3PC0A 3L4YA 2KX9A 4EXBA 3R4IA 2FGLA 4FHAA 3WQFA 2PS2A 2CEQA 2Z29A 3AZTA 2GGIA 1C8YA 4B4HA 4LT9A 1TFVA 2JKPA 1IXPA 2AL2B 3VIKA 3F2CA 2TRSA 2ZWYA 3CZGA 4C6OA 2J24A 4JYDA 3BAWA 4LF1A 2ZA1A 4MGGA 4B5WA 3N25A 4G6CA 2VFHA 3U8GA 4O13A 3EMQA 1XIJA 1XH1A 2D1ZA 4HK6A 3NPWA 2I16A 2W67A 1RLDA 3FYPA 4O1FA 3WDPP 1FVPA 1E1EA 3FJ6A 1DJIA 2Z1KA 1WXZA 2RGLA 4MJMA 3L5MA 3FHAA 4EPEC 4KS0A 2NSOA 2CLPA 4CN4A 2Y88A 3CJPA 4US5A 3PM6A 1C8QA 2XHYA 2YBVA 3SEPA 4WSHA 4D6GA 1SFLA 3RM9A 2YZ5A 1PCWA 3E0LA 4WSKA 1H1YA 4DJDC 3AHXA 4Z2LA 1BEUA 1HL9A 1W3KA 3BLPX 1OHLA 4J3ZA 3W6YA 3P81A 1DJYA 1MXGA 3M07A 3DYMA 5FF7A 1IQ8A 3T08A 1PAMA 2ZX5A 4I9AA 3STGA 3R43A 1F05A 2WMGA 4JFWA 4HPHA 2WJZA 3DFPA 3WK2A 4RZ4A 2NQ5A 4MKSA 2G4JA 3SCPA 3KVKA 3QRHA 2DZXA 4LBRA 4AZBA 4G2DA 4ZQOA 5M03A 4ECLA 1P5BA 1QK0A 3OGVA 6XIAA 3HA1A 4ERIA 4DUWA 5LA0A 4UTMA 3TAKA 1UMYA 3GC5A 5HMFA 1DJHA 2FB2A 4NVTA 2I17A 5FESA 1W2VA 3U6WA 1HJXA 1JPHA 3SSZA 4W86A 3RMJA 1K8XA 1BKSA 1QI4A 6ENLA 3TNOA 1SYTA 3WNNA 1LP6A 5I23A 4K8EA 4Q8UA 2Z2BA 2FGZA 1MDRA 2R1NA 1Q45A 3BOFA 3GDBA 5DT7A 2IMRA 1WXYA 2DVTA 2D0FA 4FPSA 3H2NA 3GDMA 3XINA 4MNJA 4AD3A 1BAGA 2G97A 1MXDA 1WZLA 5A2BA 4ZMGA 1OFBA 1GVRA 3G77A 3W7MA 4EKJA 1B4EA 1CLVA 3VOHA 4JTHA 3PVFA 3PBMA 3AMGA 1DE5A 3SAZA 1ZTVA 3BWWA 3W70A 3WD4A 3U2EA 1C3FA 1EJXC 1OZMA 3EWCA 4US6A 3VIFA 5LNRA 2E6FA 4FLQA 1OZQA 4ZL1A 4AF0A 3CQJA 3U3HA 3E2RA 4AMAA 1NDZA 2UY3A 1W5OA 1GVIA 3BSHA 3K1DA 3NSXA 1VBHA 4GI6A 1XP3A 1IXOA 2ZA3A 3W29A 4K1GA 2E40A 3N04A 3M0KA 4QDPA 3GD6A 4RZBA 1CT5A 1NOFA 2DSUA 5D2YA 3PTKA 4CN6A 5J8LA 4U10A 4HU4A 4QCEA 1XYZA 4C6BA 2PTZA 4Z2HA 1FHUA 2CITA 3AROA 5BMWA 3MUIA 3EXTA 4OOZA 3IIXA 5EB8A 1XBVA 1DOSA 2ZFAA 2PDNA 4AVOA 3TX9A 4PCTA 1FWSA 4LRTA 1MNSA 1ZJHA 4RW3A 1SW3A 1CENA 1XCWA 4HK5A 2PB1A 3URNA 5F2GA 4ZQRA 1W3LA 4JN8A 5LA1A 3RM8A 4MAZA 3TCSA 1J2WA 2UV8G 4YCPA 3M4HA 1OGGA 3MKVA 4I9JA 1CGYA 4NUWA 5F2IA 2ESCA 2MANA 3S46A 2ZUVA 3WLLA 2V82A 2ISDA 1FWJC 1XRSA 3AIRA 1WKEA 3OG3A 4H19A 3RF9A 4N4QA 1Z3NA 3FJNA 4QG6A 1C91A 2QIIA 4S38A 1WKDA 4DEFA 4FSAA 3KW3A 1S2CA 4YCOA 2VX5A 5KITA 4QEEA 4WKFA 2FGBA 1H7XA 1D9EA 3NUKA 1SJAA 2DJLA 5BRBA 1AH4A 4LY4A 4ZO6A 3CUFA 8TIMA 4MOZA 1VYPX 3RU8X 3SUVA 4H8NA 4MADA 3T0TA 2DZSA 4DF2A 4XTDA 3DZ1A 4DQWA 4QXIA 4GNVA 1GQNA 1DBTA 3PNUA 4O1EA 2POTA 3GM8A 3CB3A 3ARSA 3LHZA 4CQAA 3KBJA 1ODUA 4PMXA 2O7QA 3A9IA 1HT6A 2ZWZA 5HQMA 4R53A 1TPC1 4Y9MA 3CO8A 3KBSA 2EGZA 5BRPA 1F6PA 4C6MA 3EXSA 5BOOA 3OYZA 3FY1A 2VRJA 3NAVA 2B7OA 4UOJA 1GKPA 1V79A 3PBYA 3BLLA 3RGTA 4FXSA 3IVUA 3DX5A 3BGAA 5E0KA 3T42A 1Q6QA 3P8IA 2R94A 4B9YA 1MFVA 1L9WA 3TC7A 3B0YA 2FTYA 3GAKA 2ISWA 2PGWA 1TR1A 4FNPA 4XBJA 5A8PA 1X7FA 2A1YA 3MPGA 1UR2A 1R9XA 3TYEA 4BI5A 4AZCB 3QV6A 1IGWA 1IZJA 1YE4A 4F66A 1UCWA 2JKAA 4KCWA 1EX1A 3C2FA 4PUWA 2NWSA 5LGXA 2B4GA 2A3CA 3AXXA 3KWSA 3KVMA 4JICA 1XIDA 3H23A 4XKYA 1W1PA 3H21A 1KGXA 3H26A 3N18A 3G18A 4LVGA 2GJXA 4DO6A 3ES7A 3MI6A 2POZA 3UVAA 3LPPA 4EE9A 4B4FA 2F6UA 1XIEA 3GDKA 3N2BA 1DXEA 3B4UA 4A3QA 1QI0A 1US2A 3QZEA 4J2MA 5DN1A 3P74A 2ON3A 1XX1A 4M29A 1DV7A 3IIOA 3UCCA 4A05A 3RPDA 4XVEA 3DXIA 4JN7A 1X6LA 2CLKA 1ZJBA 1O5QA 4CQ8A 4GISA 1J5SA 2BVYA 1W3NA 1BTMA 2AL1A 2CC0A 3BW3A 1KKOA 3H4WA 1M01A 1L8PA 4C6CA 1KGUA 3VUPA 3E5PA 2PDJA 1A5KC 5AB3A 2GQAA 4P7OA 1V0LA 3W6LA 1G4PA 1UOKA 3MB9A 2XZ7A 4W89A 3WBYA 1BD0A 1XSKA 4JNYA 2CZFA 5A5WA 3UZ5A 3ABZA 3INPA 1UWTA 4B2DD 4E2OA 3LZ3A 1R3SA 2DSVA 1EGMA 2A3AA 2WMHA 2YCLA 4TR9A 4JX6A 2QGYA 4LJ3A 3S9ZA 3U5UA 5CLTA 1UA3A 2PZNA 2RGMA 3C3UA 2ZVIA 3LHVA 3CPUA 1UKTA 4TIMA 3VNDA 3W72A 3CHCA 4NAFB 3PTMA 3UG5A 2YCLB 2VFFA 3GNRA 3S2CA 4QCFA 2PTXA 4LUJA 4XG1A 2GJXB 3UYIA 2GUBA 3G24A 3UG8A 4GA8A 2DT2A 3GZAA 4D2JA 2GL5A 3TFXA 1L2QA 3WDJA 1VBJA 3VVGA 5DCEA 3MSGA 3ANYA 5DLCA 3TN3A 4S3AA 1Z32X 1EWDA 5I03A 3ZJ6A 4UTLA 1OSEA 1JPIA 1PJ9A 2YYUA 1KBIA 2QCHA 2X0YA 3PUOA 3I3DA 3VDCA 2ACRA 1HF6A 2G3NA 4IGMA 4J3SA 4O1AA 4FMVA 4FZIA 3LRMA 4O4VA 4EXQA 1K03A 2GVLA 1EJUC 4QITA 2GDVA 2QR6A 2VD9A 3O6CA 2WZIA 3TN6A 4LUIA 4ALDA 2PDUA 3A3WA 1EF2A 3BG3A 4BQ4A 1EBHA 1XV8A 3N6QA 4KCUA 3VU2A 5KZ6A 3WEMA 2WQPA 3A3HA 3O6DA 3WLNA 4J35A 3T8QA 1W9BM 1ICPA 1J12A 2HJPA 3CHDA 4Y96A 1XIGA 1YTEA 5FEXA 2X7VA 1UH4A 1ME9A 2HXUA 3G1DA 4JL1A 2XIJA 1RBOB 3LG3A 3FKKA 3LM3A 3O15A 4K3ZA 1XCFA 3N6HA 5EMKA 3LGDA 4M7SA 4N02A 4NY2A 4J3TA 5C5YA 1TV7A 2PE4A 1OJXA 2ZA2A 1YNYA 2QUNA 2VGFA 3R8GA 3WKZA 1W2PA 1XINA 4GH1A 3CL7A 4HSNA 4JGDA 4LUTA 3W7IA 1VQTA 3WMSA 7CGTA 1H63A 1A5BA 2PDKA 5G1TA 1TB3A 2E5DA 3W2UA 1CPUA 4Y7EA 4AFYA 2VWTA 3UW6A 1Z7AA 1RVKA 4PMZA 3EOOA 1Z8AA 4DZIA 1GOIA 3WDRA 1KV8A 1E6XM 1TJ2A 3HMJG 4MYXA 4UFKA 2PCQA 1J0ZA 1LQ0A 3C2YA 4H3DA 3RRAA 4DPPA 1O12A 3PTDA 1XYBA 2FLIA 1H5YA 2VVNA 2C0AA 4JIIX 2PC4A 4JTEA 2ZXBA 1OCNA 3M0HA 3K8LA 2Y8UA 1TTPA 2E67A 2ZZ3A 2P5NA 1XGZA 1KM2A 2YXXA 4QQUA 3VIPA 3PZIA 4EP8C 3PULA 2DQWA 4A29A 5JXQA 2ISFA 3N73A 3S9YA 1GTEA 1OFEA 1QAPA 1UJPA 2BY1A 3TN4A 1MW3A 1MEWA 4ERAA 3LOTA 1CXLA 2BTMA 1EPXA 1JGMA 2VTFA 4GHRA 2E7FA 5ECUA 1DQWA 4DJEC 3EWYA 4FOUA 2I56A 3TJLA 2WCSA 2CZVA 3AIQA 1R6WA 1W1TA 2R1LA 2E0PA 3AXHA 3CZEA 1T8XA 4KQNA 1DL3A 2CWXA 2E68A 2PC8A 4RNIA 4PMNA 3P0WA 2DIEA 5FJUA 3DI1A 1HQTA 4W87A 4DAFA 1JCXA 1RP8A 3MSDA 1O68A 2GZXA 2NVCA 3ITVA 3LI0A 3RU6A 4XISA 3U4AA 1EZ2A 1Q6FA 3CPRA 1M6JA 1VH7A 4QFUA 4JXCA 1CEOA 3OZMA 4JYEA 3K8MA 3QXBA 1EUNA 4RE4A 4RW5A 5TBOA 1SUXA 1UIOA 3UJFA 3TW6A 3XIMA 4AX7A 3CQKA 3L5AA 2RKXA 3MO4A 1ZU8A 4NJIA 2NLYA 1C7TA 3TUUA 3I6RA 1XLAA 5KZDA 1WUFA 1F3TA 2EHHA 1LOQA 3NQ7A 1H3GA 2PDYA 4H8HA 3M9YA 4GVFA 4TMBA 3RR1A 1TZ7A 1IYXA 4CUCA 4LF2A 1M53A 2ACUA 2JEQA 3Q94A 4P8VA 4IMGA 1B31A 4XZ9A 1PS9A 4NI8A 4B9ZA 4QDMA 3R79A 4OV4A 5DRIA 2XM1A 4P5UA 3CO4A 5HQLA 2OO0A 5LIXX 2EQDA 1RQHA 1G1YA 3HN3A 2GPTA 2WSKA 2XH4A 1TVLA 2WBKA 3QR1A 7XIMA 1Q6CA 3WNLA 5CC7A 1QW7A 4AWSA 1W3HA 1GEQA 3CH0A 4XZBA 3O7UA 1OX5A 1XCXA 3AUOA 3IWPA 2F61A 2PFHA 4IPPA 5DQPA 4HJWA 1I2OA 1OVDA 3TR2A 1RQBA 2DU2A 1QNSA 2VCCA 1JXJA 2VHLA 1HJUA 3CUIA 3OGSA 3TCEA 1HXJA 1JQXA 1QDSA 5I09A 3AJXA 4JEQA 4N9CA 1DXIA 4U2ZA 4M80A 3E0IA 2B81A 2QJGA 1OBAA 3CIVA 4GFIA 1HVQA 2PDWA 4N7QA 3AAMA 2H9AA 7ODCA 5DMMA 1CLKA 1OK6A 3EWZA 4LV9A 4PTNA 4GQBA 4OHQA 1RQEA 3R12A 2PLMA 1BWVA 4RE0A 1UH2A 1WAWA 1VCFA 2CPUA 4EANA 1DJXA 4HA1A 4HZ6A 3RK8A 4DRSA 1UR3M 2Y5SA 4GNKB 2FVLA 1JZ7A 4TVUA 4QE4A 3GHTA 5DT5A 2IPFA 3ZWSA 5A8NA 1E71M 2OTDA 2F2KA 3UETA 2DH3A 4IMCA 3AU2A 1YPIA 2Y4SA 4XTIA 1X6NA 1MDLA 1GVQA 3MSYA 2Y89A 1XKYA 3PZVA 3BAXA 1V51A 5LNUA 4R27A 4GWEA 3SSJA 5JBFA 3DUGA 4NJGA 1I2RA 1WXJA 5IM51 5C54A 5FA5A 4L9ZA 2PMQA 3QC0A 5GPRA 4D6IA 3IGXA 1SJBA 4WZHA 4HPJA 3WH5A 1EQPA 1XIHA 5HR7A 5BXPA 2J9YA 3TTOA 2IPWA 1WYIA 3HM7A 1UZ1A 4HVXA 3EKGA 1E9IA 1GEHA 2OYLA 4Y9AA 4K68A 3MI3A 4K36A 3EOSA 2E5CA 1SJDA 2WZHA 2QCDA 3APYA 2CZEA 3V1PA 1SJCA 4PMUA 4P8UA 4GACA 4Z1CA 2FVMA 2WHJA 2QCLA 3NDOA 4JCLA 5K2ZA 3R0UA 2AQVA 2YA0A 4HIBA 1TKKA 4S3JA 3R11A 1PKYA 2Y5JA 2D2GA 3QM3A 2D73A 2UZ9A 2XN1A 4GOAA 2ZIDA 1W8SA 2C15A 1FWBC 3SY1A 1H4PA 1A3XA 1WDDA 2YZRA 3NA8A 1TWDA 4JFVA 1UWAA 3F4VA 2YL6A 3OZPA 2DV0A 4GJ1A 1A4LA 2HPIA 4H7CA 3RMEA 3GXNA 4X0VA 2FMNA 3MKCA 5CGMA 4L80A 4U5KA 3NXFA 1XIBA 1G01A 3GYEA 1CXKA 4OV9A 1Q6OA 4FK9A 3WBEA 5A1AA 3NZGA 4JTRA 3BJSA 3EWDA 4QEHA 4WDUA 4CLMA 1OFAA 7TAAA 1I6NA 2IUZA 5FEPA 4DHGA 3NL3A 1QUMA 3VMOA 3FYOA 3AHYA 1KTNA 3BL3A 3DBNA 1A49A 3HGSA 3UA3A 2CCRA 5I78A 4AISA 2J62A 3S6DA 4Y8FA 2WC4A 1VJSA 5D2XA 3AIVA 3IIZA 4UNKA 3B8UA 3QYSA 4HZ8A 3RNDA 3E0VA 4IIEA 1EFZA 2JKEA 4I3GA 4L4MA 1HL2A 2BY3A 5E0CA 4PCFA 4CCEA 3VIMA 2VRQA 2VKZG 4XO7A 1VFSA 3NQVA 2SFPA 4QQ3A 3WFAA 1V6YA 1UASA 5AHMA 1IT0A 1S5MA 3LPFA 4D6EA 4LH8A 3N34A 4RXGA 3E0WA 3RLGA 1DJQA 2GGEA 4JIRA 5K4ZA 3M6YA 4IUGA 1TJPA 5EMMA 4PMYA 3H2OA 4NASA 3T0CA 2HTMA 4D9PA 3I3EA 4LFYA 4F2BA 4F9DA 4HPGA 3CLWA 1XLIA 2VZUA 4UWMA 1OD8A 2QUVA 4PUJA 2CLIA 4Q8PA 1IEIA 1TUXA 2J79A 3DHDA 1ONRA 2WZEA 2VQUA 1PKLA 1JPDX 5GJNA 4UQAA 1B9BA 4IG2A 5LIWX 3BG5A 1UW9A 4D8ZA 2QDDA 1PYFA 4KEUA 4IIGA 1EX5A 2AAMA 1MRQA 4LUTB 1GCYA 4NZ4A 4V1XA 1HZYA 6CGTA 2GVEA 5D30A 3VCCA 5F1VA 1W5PA 4GI9A 4F79A 2C79A 4R9XA 5F2MA 2XWDA 3LENA 3U7VA 1ADOA 3CXOA 3GLCA 3IJ7A 1XHGA 1MYRA 5C9ZA 1M04A 2WKJA 1PO9A 1LL4A 1RCXB 3I7SA 3QPZA 4MY8A 1KTBA 4TUFA 3TYUA 1UIPA 1FFQA 8XIMA 2E6AA 3COTA 4LBSA 4ZODA 3P7YA 2VUYA 1MWOA 5A6SA 2TODA 3SZ8A 1KM3A 1PYMA 3JW7A 1BTCA 1YYAA 5FIPA 4WHBA 2WKGA 1FDZA 1MEIA 2OCZA 4PB3A 3GVWA 2BXYA 1F74A 3B40A 1PHQA 1UD4A 4JQ4A 5IFTA 4A2RA 4CCZA 4ICNA 2FH8A 1X38A 4V28A 4XZMX 4K2SA 3NXLA 1QOQA 3I68A 4AWEA 4ADTA 1JUKA 3H53A 1VFHA 4NL1A 3IAPA 2YLAA 3TJ4A 2CLEA 4MKNA 1FWGC 3RX2A 1V3KA 3UYCA 3GVVA 1I60A 1UA7A 2NQLA 4OGZA 1G6CA 3T55A 3O9NA 1HJQA 4UXDA 5EKYA 2CLHA 4MF4A 4ZTYA 4BEUA 5CPLA 3RLHA 1I2PA 3HB9A 3FX4A 3KE0A 1PE1A 2J6XA 3BMXA 4Z2IA 1FWNA 4AEFA 3ITLA 1A4MA 1B3WA 5A6BD 2WJEA 1HJSA 3PJWA 3RXZA 2QJNA 3KTXA 5XINA 2I7GA 3SRHA 2ISSA 1KC7A 1WKFA 4JNMA 3PY2A 3KL5A 1ENUA 1H1ZA 1VZWA 2CLFA 4M82A 3RM4A 4NIRA 3MJYA 4FX8A 3NPUA 4E8DA 3A24A 3B9DA 4NT0A 1ZHAA 4H8VA 3LXCA 2CFFA 1E15A 3PPHA 3HPSA 3GTHA 3EGJA 4L6OA 4KRTA 2PWHA 4MNLA 3HGJA 4LALA 3FEQA 4WD0A 1UR1A 1AJ2A 2GGGA 2CBUA 1SO3A 5J5RA 3W7JA 3MKKA 4XBKA 5IHSA 4WKHA 2X2YA 1ZFJA 3GTFA 4KWUA 4JX5A 4IPIA 2VCBA 4C6KA 3WENA 4A35A 1WBHA 3GBEA 2BSLA 1UZ4A 4DVOA 1WZKA 4R33A 4U4MA 1EB3A 2WANA 1T40A 4RCXA 4GGBA 3TA6A 1ZBVA 2IW0A 4IL2A 3UPBA 1JNEA 4D71A 1EGVA 5AYIA 2B0MA 4ZB2A 5C9XA 3B97A 1NF0A 4KGJA 1TWIA 2A79A 2F2HA 2BY2A 3ZR6A 3MWCA 2IXVA 3Q37A 3BQ6A 4FF5A 1TQXA 2X1IA 1S46A 2VT0A 3NOEA 2EPNA 4ENLA 4CD5A 2VR2A 4PYSA 3PFMA 3CNYA 1TTJA 4Q7BA 2QGHA 1VYRA 4GE8A 1CB7B 1WOBA 5HNRA 1P0DA 5CSRA 2QQ6A 2OKOA 3BPWA 2NVDA 3KS6A 2ODOA 5E9XA 1GZ1A 1W0MA 2XGBA 1IWAA 1W5QA 1YXYA 3QY7A 1BG9A 2C18A 3EWXA 4PTDA 4V15A 4ZQMA 3EOUA 1PIIA 3BCDA 3M0MA 1CGWA 1F9CA 3W2MA 2E09A 1U1HA 5FSEC 3DFYA 1SZFA 2NUYA 3RJYA 4IX2A 3O0KA 4RE3A 3CUXA 3U5YA 4Q8TA 5D09A 2Z6JA 3U7BA 5HWMA 4KH2A 3SCOA 2QV5A 4DWSD 1XDJA 3OVPA 3IS4A 3SCRA 2I1OA 3WLPA 3AMKA 5HMEA 5LNVA 5D8WA 5ABFB 1L2UA 1YX1A 2Q09A 4GZ7A 5XIAA 3G0UA 5LZLA 5F7UA 4Z2GA 2DEPA 2OQHA 3VPLA 1K77A 5H8UA 4GJJA 1JZ4A 2OZ3A 4WCJA 1HGWA 1B1YA 2VO5A 4JHOA 4MYAA 3N3TA 1FXQA 4J3XA 5I06A 4PL1A 4WQ6A 2ZZ5A 1WNOA 1YEYA 1EJ7L 1HIZA 5IOBA 1NWRA 1J79A 3KDOA 4J7RA 1A3WA 5CPNA 1OIMA 3AALA 2Y2WA 3MC5A 3MZNA 4DIAA 4ICMA 1FY6A 1T99A 2BHZA 2QPUA 2FDMA 3GWQA 2NLIA 4AY1A 4DZAA 3GFZA 3IRSA 2D3LA 4JTIA 3ITYA 3EEZA 1J5TA 3P5YA 1GOQA 5I07A 5CPMA 1NDVA 1FUYA 1DJGA 2W91A 4JTJA 5FF0A 4EIVA 4AAJA 1QBBA 4I7WA 2UWFA 2QF7A 1TV5A 4WLCA 3ITGA 3GFYA 5LNWA 1MI3A 3NEVA 3CGTA 3KOWA 2BXZA 4GBDA 2ZC1A 2AMXA 1KA9F 1MUMA 2PZ0A 2QF8A 7PTDA 3ZVIA 4JAWA 3N4FA 2Y62A 3TQPA 3PZUA 3UCDA 1K7EA 1HP4A 3GIYA 1UUOA 3WBAA 3T0BA 3KVLA 4PEKA 2QCCA 3IANA 4ZENA 2WJDA 4JD4A 3T1GA 1V3HA 5D9OA 3E12A 3VFCA 3CU2A 1JFXA 4ZA0A 1HVXA 3SIMA 4JQ3A 4O28A 5XIMA 1ISZA 4C7DA 3LI1A 3OTRA 1NQ6A 5I24A 1LG2A 3CH9A 1C92A 2WHLA 2PDQA 4HNLA 1K9TA 4CVWA 5LA2A 5LIUX 4MZYA 3PZGA 5TNVA 3MUAA 3OVGA 2WXDM 4AQLA 3LS9A 4UOZA 1US0A 2QPSA 3MVTA 4C6DA 2DZWA 3LTSA 3OEXA 4OBRA 3NYDA 1Q4NX 2HVNA 3KS5A 3OIHA 3S3GA 2C16A 4UBPC 1ISWA 4W8BA 1VFLA 2EBNA 2FJKA 4FLSA 4QISA 4LTSA 3HG3A 3UZWA 2CNCA 5HA7A 2I5IA 1KWGA 1JCNA 2LLEA 3AS3A 3GG8A 4MZ1A 1EWEA 1QWGA 2D69A 3AIUA 1JAEA 2V0TA 3M0YA 1GUVA 5G4HC 4JTQA 1DKWA 3V36A 4A3YA 3AUJA 2ZADA 1AW5A 2IQ0A 4WDTA 4YN5A 2FQIA 2OMAA 1IWPA 2J7CA 2ISVA 3DG6A 2A85A 5AYYA 3V18A 1ICSA 4O11A 3LY0A 3IARA 2NSXA 3HIJA 3OBAA 2PWEA 3UWVA 2EEXA 2YDSA 1E5JA 2W5FA 2D3NA 1L6WA 5D9NA 1H09A 3GO2A 3IV3A 1EC9A 3WJXA 3TIMA 4L7ZA 2GDUA 4DN1A 3R8RA 1VFUA 3FJLA 1V08A 4PFMA 1JL8A 1F3WA 3KRZA 4CD8A 3SGGA 3POCA 2YBUA 2ZUTA 3LLFA 2CERA 4WX2A 2P1FA 2PD9A 3GC2A 2Q8LA 1H7OA 1P7TA 2DSWA 4L1GA 2X1RA 2Z1VA 2PWVA 5AFDA 4C6LA 2J4GA 1F3EA 1F4HA 1LWIA 4I8YA 1XPGA 2RJGA 4GC4A 1JCYA 1Z9AA 4GCXA 2ICSA 4MWAE 3RILA 4IMEA 2F38A 4HOWA 2QCEA 6ALDA 3O2LA 4P7NA 1C90A 4FR1A 2CLMA 4IQLA 1YDVA 4GCAA 3V1HA 4H9TA 3AYSA 5GQBA 1JI2A 4JR5A 3S5NA 3IIPA 4KGLA 5F4XA 3QVQA 3FVDA 2VC7A 4CNSA 2XGIA 5I5RA 3TN5A 4GBUA 3C61A 5DY2A 2CZ5A 4Q8NA 4UQ9A 3CHFA 3GG1A 1UWIA 3LSCA 1QVBA 1VIZA 4FXJA 1M9HA 2GSHA 1ZAJA 1EP3A 3NQEA 2E1WA 2NXGA 1N8WA 2BV9A 3AICA 4KETA 3G1AA 3UZYA 2QDHA 3B4YA 6TIMA 4DYKA 5I2UA 2CLLA 3TR9A 4AG0A 3MT1A 1EGZA 1W1VA 3WZ0E 3LN3A 1QPKA 4LUSB 5JIWA 5M17A 1PZ3A 2V30A 4JIHA 2PD5A 3D5HA 3LRLA 2WMFA 4PCNA 4D1IA 4JIQA 4H2HA 4Z2JA 4IP4A 3FSTA 2YL8A 2G95A 2EPKX 3CV1A 3NGJA 3ES8A 4XV0A 3OVRA 2PRLA 1R2RA 5I7GA 3PANA 4B5VA 3LCXA 4I6VA 4N9DA 3LGGA 2DVUA 1C9WA 2RDWA 1N7KA 1XBXA 2QV4A 3ZLFA 1QW9A 3VZXA 4QAWA 2V3EA 2C8NA 3T78A 1XLEA 1KCXA 3CS2A 4AD1A 2QCNA 3OA5A 3GHUA 1ECQA 1SFSA 1OFQA 3OJGA 1FWFC 2ZRZA 1OT1A 3THDA 3KRUA 4YS1A 5CAKA 3R5EA 2V5KA 1XLFA 1XUUA 3VFLA 1G5AA 3JR2A 1RHCA 2I57A 1UOZA 3EX4A 3FJ4A 3TOYA 2YDRA 4MJ2A 1DQXA 3S0CA 4Z0SA 2XIQA 4N2YA 2W62A 1E43A 1FWCC 4IGNA 3QQWA 4UR8A 2P88A 3S42A 3N9KA 5AN7A 3A5VA 1Y65A 4ZO8A 3PB0A 1IWBA 1B2YA 5D04C 4DZHA 2PEVA 2VC9A 1GOKA 5I77A 3TSDA 4EWND 1V7AA 4POCA 1TE1A 3OZYA 5F1UA 5TD4A 1O6IA 2DDXA 5B80A 3N13A 1BYAA 3WEOA 4LXFA 4XZLX 5DMLA 1F2JA 2BZNA 5CLWA 3H7UA 3ARTA 2PODA 4V1YA 1NTHA 1EH9A 1GT8A 5ABFA 2XFYA 4UQEA 4AHPA 4UC5A 4P7RA 2YA2A 3NVTA 1PKMA 3MI2A 4XAPA 2A5HA 2GGJA 4RX0A 4GUJA 1PCKA 3FDGA 1I75A 3PBVA 5HXMA 3OPSA 1FOBA 1PDYA 1J93A 1PB0A 1JF5A 3TXVA 3C6CA 1U30A 1CCWB 1UWRA 4S23A 3UZXA 4LX4A 1D3HA 5JMUA 1WZAA 4AY7A 3KAOA 2OR2A 4UZSA 1KR0A 3BMVA 4FOJA 3LERA 3L4VA 3CZLA 3WQCA 2EJ1A 4GIYA 4IGHA 4L4PA 4L61A 3LCGA 1EUAA 3OO2A 2YIHA 4OFCA 1Q2RA 3TMQA 2XIMA 4JS3A 2GQ9A 4C5ZA 4Q4RA 3OA3A 1NF7A 2P8CA 1OFDA 2XPKA 2ALRA 2RDTA 4PTWA 4PR4A 1VEPA 2YJQA 1SM9A 3CQ0A 3EWWA 3N4AA 4KWSA 1UQYA 4JTDA 3ZT5A 5D38A 3LBOA 3NZQA 1UB3A 3KFTA 3QJAA 4BKNA 4Q22A 1JZ2A 4NKCA 5IFPA 4PRWA 2GLKA 3H2EA 3PJUA 4D6HA 5F4WA 3S47A 3PK7A 3OZOA 3ABSA 3S2MA 1OF6A 5BU9A 1KD0A 1KR1A 1LBMA 4WJ8A 4N6EA 3VDBA 3AWNA 2DZVA 5KINA 3O8AA 4R88A 2WW5A 1A5AA 2GDQA 5DANA 2A4AA 4XAZA 3H55A 3VOIA 1W56A 4UFMA 1IEVA 3UEQA 5HULA 1S3TC 2PUZA 4F2UA 2XDFA 1NY1A 3VE9A 3W2KA 4NNAA 4CQDA 3U2CA 2VC6A 3WLIA 2WHMA 3A13A 3V3WA 1X1ZA 3DOPA 5AC4A 3MCOA 4Z1DA 3AMDA 1ZGDA 3SFWA 1J6OA 1A5LC 3WUBA 5KETA 4GABA 4QLKA 4BI7A 1V6XA 2J9ZA 3BLOA 4DWDA 3VNMA 1O1HA 3B05A 1UKSA 3P5ZA 4YLWA 1O5KA 1Y7VA 4AZCA 3BOLA 5FAGA 4HMNA 3E3HA 5EFDA 3H4XA 4Q6XA 5H2ZA 2VXNA 3VD9A 4EAYA 4A2SA 1RZMA 3KCOA 4RPPA 1AW2A 2Z2UA 1K02A 2PA6A 3I3BA 5BYWA 4RR4A 1T41A 3LU2A 5DCBA 1HW6A 4O57A 1VS1A 1PX3A 4CKQA 4PUNA 1OC6A 5J5DA 4CEUC 2FHFA 3CWNA 2X1UA 4RDYA 4PMJA 4I9MA 3CHVA 3EB4A 3V75A 2DUXA 2WMIA 4S3EA 1S5NA 2E3ZA 1EIBA 4KERA 3WQ8A 2DORA 2XVNA 2Y70A 2HVOA 1AD1A 2DUZA 2Z26A 4OZOA 3W6MA 1TPH1 3FEMA 2A3BA 2YCEA 1VFTA 4XIAA 4Z1BA 5BCAA 2OGYA 3GS6A 3HURA 4M81A 1K8CA 5C2GA 2HSAA 3WQ4A 1J4EA 2HK1A 3MU7A 1TX2A 3GYCA 3OBKA 3MHGA 3CHEA 4OUEA 1OCQA 2F6XA 2UBPC 2WM1A 5GJPA 2X05A 3MHFA 4Q8QA 1EA0A 3W1AA 5CPQA 4H9VA 3P6LA 1DIEA 3H7RA 2YR1A 3TTYA 1RPXA 1EC7A 1PTGA 3LMYA 3UWZA 4F2TA 4LY8A 1HKWA 2OEKA 4ASTA 4XX6A 4YYCA 3SGZA 1HNYA 1TWWA 4K8GA 1VB9A 3KXQA 5G1YA 3S5ZA 1VPXA 3SN0A 2AAAA 2PDMA 2XZ9A 2HBVA 1NWSA 4QM1A 4L1XA 4I8DA 2GWGA 3UG3A 4MSSA 3SI9A 2J8TA 1TV8A 3VNYA 1H61A 1FP9A 1H11A 2Y61A 2EF9A 1W8GA 4AB4A 1CBGA 3OVQA 3FV9A 3VGFA 3WO8A 1Z69A 1M65A 1T7LA 3TYDA 3S5YA 3BARA 3GXTA 2NZLA 4U28A 3OODA 4DBWA 3LCWA 4LU0A 4C1LA 1VP5A 4C6EA 1X6UA 1N8IA 4WR3A 3VDGA 3G1XA 2FKPA 1SVDA 2H8XA 1HTIA 4K1WA 1ZQ5A 2XVPA 3V35A 4A22A 2PBGA 4HSHA 4JPGA 1O95A 3CYVA 4B2DA 1VC4A 3THUA 3IEBA 4TV6A 1XW8A 1J18A 2XVLA 3W76A 2ZRUA 3GKFA 3S5OA 3B9NA 4IISA 1AMKA 1QI3A 2DQXA 4DO5A 5AC6A 4NF7A 1D7FA 1VLWA 4GVIA 4AF0B 1B3VA 3QPYA 4KWVA 1E9ZB 2VENA 2A2IA 3NSMA 4JOMA 5CC3A 2ZRWA 1V0KA 4TMCA 4ATDA 2YW4A 3WFZA 1NM9A 2PGRA 4O4WA 3FCPA 1QI2A 2OX4A 3Q65A 3UXAA 3EPOA 4GRSA 1NARA 2A6LA 3CC1A 4X9YA 1SO4A 1MEHA 4IX0A 1G4SA 1UPMB 2P3ZA 2PGEA 3GNNA 3L23A 2E8YA 1KKRA 4XD5A 6XIMA 1AL7A 4ZTXA 2I14A 2P0OA 3WN6A 2ATSA 3GSMA 4L56A 2OOFA 4A3RA 3E49A 4ZE4A 3L9CA 2H8ZA 2O55A 4WJXA 1FBAA 4IIDA 3WQ6A 1XICA 1KCZA 2XSBA 2HPMA 4HZ7A 3BURA 3QYQA 2WNNA 1JCMP 4X2RA 1G69A 1UBPC 5CEWA 3Q45A 4QJ4B 3KOFA 3AXIA 1T0OA 3A47A 4DNMA 2ZRYA 3UZJA 4C91A 4QTGA 1KXHA 1E4MM 2Q8ZA 4GQGA 2VFEA 2EJAA 3V16A 1R5YA 3W2JA 2X1TA 3TONA 2VEKA 1GOMA 1JD9A 2FJUB 2HISA 3FXGA 4IMFA 3W1UA 4B91A 3DFSA 4EXAA 3QF0A 1B0IA 5DXYA 1IR2A 1J0JA 2WYSA 4GC3A 3H54A 1LL7A 4Q3MA 3W27A 4ZGYA 2QCFA 3KBVA 3UR2A 4PBEA 3THCA 4KMQA 5G1MA 4RXFA 3AU6A 1CXHA 1RPKA 1XLDA 2V5CA 4H6RA 3GU1A 4H9YA 1TVPA 5CQ1A 2FFIA 3W7CA 3IRDA 3SCSA 4H6KA 1WE5A 3N2MA 4DBUA 3I7QA 3BAYA 1HX0A 3WYZA 5EBUA 1O60A 3SUSA 4H9UA 1PEZA 2V67A 3W07A 3WUFA 4DBSA 3AZSA 3HFYA 1S1PA 4YVPA 2FZ9A 4QJ3B 1QPQA 3KBMA 1W5MA 2OT0A 3KX6A 4YNGA 4R9OA 5JBEA 4IIBA 1YRRA 1QMLA 4L6DA 1FWWA 4QG8A 4PEEA 3TFCA 3O1NA 3ZT6A 1KFKA 1TV4A 1LOSA 5G4EA 3ZLHA 1P48A 2VFDA 3E1F1 3ABQA 2Y85A 1M3UA 2ZX6A 2Y5EA 5D2WA 3QFWA 2HROA 3TWAA 1ODZA 2PCEA 1JAKA 4EPKA 1P0NA 5FF2A 1G9HA 1X8CA 1CECA 3W0KA 2QZRA 4Q8WA 2DZAA 2EPHA 1YBQA 2GOKA 3VKAA 4Y90A 2QMKA 1O7AA 5CZJA 3KEHA 2H9AB 3B9AA 1MUWA 4QE5A 1YADA 3TH6A 1GK8A 2CBVA 4ONVA 4N0RA 4KPLA 1XBYA 4IQJA 1ECEA 3GHRA 3M5XA 1QOXA 2W4XA 2V5BA 2XFFA 2JGQA 4RNJA 5C8BB 1WBJA 2WV8A 1EIXA 5MKGA 5HMDA 2VDHA 2RHGA 1UZDA 3FA4A 1E1CB 3G1SA 3TK7A 4GVHA 4HN8A 1JZ6A 3ZQ9A 3OLGA 5DBUA 1KRAC 2V5LA 5CZSA 5I6SA 1GKQA 4MPKA 3O16A 4F0LA 2CW6A 1UMLA 3G1HA 4LVBA 3NL5A 2PDLA 5HJYA 1R7AA 1XYLA 3HQOA 3P82A 3SRDA 2PWFA 3KL3A 4F0SA 1V3MA 2GVJA 3UWEA 4LC6A 3DFQA 3B06A 3HTWA 3ARYA 5AVHA 1Q13A 3TSBA 1GG1A 2WWDA 2BB0A 3RRXA 4EF8A 2QW5A 4O0QA 1K9EA 4FIRA 4EX4A 1OABA 4B5UA 4HHHA 5JVLA 4G7FA 3MBDA 3F5JA 4RNFA 1I2NA 4XBSA 1K4GA 3EB3A 2GOUA 1EL3A 2OZ0A 2W66A 1JCLA 2WO5A 3CZ8A 3S4TA 1U83A 3U4FA 3ABRA 2B7QA 4HT3A 4MWAA 1KQYA 2PP1A 2XJ7A 5M2FX 1GQLA 4Q33A 2VEFA 4AZ7A 2VGGA 4DJFA 4DXKA 1EP1A 3GXDA 3S8HA 1S2TA 1K70A 1KFWA 5A3HA 3DYOA 2YKKA 2OPJA 5E93A 2H3DA 2BLEA 4V2XA 3ZWTA 4FF7A 4Q4QA 4IGSA 3W4RA 1F5ZA 1OCBA 1ZRQA 2BOEX 4Q32A 3FOKA 1RBAA 3UR7A 1GPWA 3DERA 4CNPA 3GDLA 3QZ6A 3R0DA 3HGRA 3OOQA 3LDVA 4CN1A 3KLKA 2AGTA 4Q4MA 4LYPA 3W1NA 3PG9A 3B8IA 5BXSA 3G1RA 4REQA 3B8WA 4EVZA 1YDNA 2Z4GA 3W7QA 1JULA 1RVGA 3ARVA 2FHBA 4IPNB 4TV5A 3VUSA 3BV4A 8CGTA 4HTBA 3NIYA 4S3GA 3TMLA 4GXMA 3NOYA 2J78A 3MVIA 1NFBA 3C52A 1DEDA 2NT0A 4Q8MA 4C65A 1LDCA 2PTYA 3JRKA 5EA9A 1EHNA 3J7HA 3T4WA 3AO0A 4J1OA 3CEPA 3BMWA 3LXAA 3BICA 1OC5A 1E5NA 3GX9A 4IPJA 2GVGA 3VILA 5T9BG 1DIOA 1CNVA 2OO6A 3CMGA 2JALA 3BTNA 1KM6A 1EBGA 4NRSA 2QHAA 3QZAA 3ZJ8A 5FEZA 3V0UA 1X7IA 1GQJA 4GFSA 4DM2A 1AZ1A 2J88A 3H2AA 1Z6KA 2NQ9A 1XYFA 3CASA 3HZ3A 5D9PA 2HEJA 4B15A 1WQ5A 1OYBA 4AZ5A 1L8NA 3VIJA 1UJQA 1ZUAX 2WZMA 2HVMA 3R0KA 4B5SA 3ERPA 3OW1A 3SN1A 5AYBA 1JJKA 3LCIA 2Y24A 2FZDA 2HNHA 1F76A 3NQMA 1LG1A 3P8JA 1VBRA 1LZOA 3WNPA 1BVZA 3NDZA 4A3HA 4UTUA 2F8QA 2GK1A 4ML9A 4QAIA 3L12A 4D6JA 3SY8A 1E4NA 3GNDA 3MYPA 3W86A 4DPQA 2REQB 1U5JA 3G1VA 4Y9PA 2NQZA 3GXFA 2C1GA 2XYLA 3W28A 1AW1A 4Y2WA 3W37A 3KVJA 2XVKA 2A7NA 1E6QM 4Q4KA 4NXKA 4CCCA 1VIWA 4JIPA 1EJTC 1O1ZA 4S2CA 3P0XA 3VIGA 1ZP3A 4NYYA 4F9JA 3KL0A 4YVVA 5BWFA 2AL2A 3ZJKA 2XFWA 4NZ3A 3ISIX 4KEVA 1SFJA 3ECQA 5FEWA 1FKWA 4AIUA 3EZ4A 1TUFA 2G50A 1M7PA 3ARPA 4OU1A 4Y6GA 3S1UA 4UMAA 3RG6A 1R3YA 3NO5A 1SZGA 1P1MA 5LIKX 3PP7A 1BWLA 3BSGA 1UKQA 4WXYA 1IIHA 1DHPA 1W9PA 4V33A 3ME3A 4DM1A 1A5NC 4WRHA 1UP0A 4GG9A 3A3XA 2FH6A 3C2EA 2R14A 4KIRA 1VJZA 4JTGA 4G1KA 1C8VA 3HO8A 4C6IA 2YBTA 3EXRA 2WKLA 2EXOA 1EP2A 6REQA 3APTA 1ZSXA 1EEXA 2O56A 4J5NA 3NPVA 4EOUA 2DIKA 1HKKA 3M44A 4L4OA 1I0DA 3G1YA 1XLLA 2WK2A 3N2OA 2VWSA 3KTCA 3QV7A 3N9SA 2WVVA 4UTHA 2WWCA 3UESA 5AC8A 5FSDC 4N9BA 1WDWA 3CM4A 3N4EA 2WLZA 1R8LA 3UR5A 3DG3A 9XIMA 1Q6LA 3HG2A 3R1ZA 1IHIA 5CSYA 4GPNA 2OB3A 4MB1A 3ZOAA 2J8GA 5I02A 4JTSA 1TPVA 2VYOA 4LGXA 5EMYA 2XN2A 3WJSA 4NSBA 1P6WA 2WVTA 2P10A 1R3WA 4GXWA 4XSMA 3SURA 4JCMA 1W3TA 3D0CA 3K13A 3CEUA 1Q8JA 5HUPA 1SFTA 2XG9A 1DWJM 3TYZA 3HQPA 2OLHA 1KWKA 1GVYA 1K9DA 3S6TA 4KT2A 2ATMA 1CZ1A 3T2PA 3QTGA 3W2LA 5KTLA 1OC7A 4GY7A 4HPXA 4NZ1A 4MLRA 1ITQA 5FKYA 2IQTA 1GYMA 2G4FA 4PA8A 3VMPA 2G37A 4HTYA 1BXBA 4OBSA 1PUDA 4AHQA 4LYKA 5M5DA 2HCVA 4AD0A 1ME7A 1BQCA 4LSBA 1NVMA 3VOJA 4MUZA 4JIEA 2JGYA 3GG0A 4J3WA 1MZHA 2WVUA 5K9CA 3G2GA 2XFRA 5DMNA 1OADA 1QJWA 1W17A 1VD6A 4O0KA 1A53A 2ZUUA 3MY9A 3KOYA 4M0XA 2C13A 1SMAA 3QSRA 2VMFA 3KWXA 5CCZA 1W1YA 4MPQA 4F0MA 5KZEA 1OYAA 4ZEPA 3DGRA 1ADDA 4HU3A 4NZJA 1UR9A 2X40A 2PU1A 4IFRA 3T9PA 3ALGA 1QNRA 3RCNA 1A50A 2VZSA 4US5D 4R5EA 4G7EA 3PNZA 1V6UA 4X22A 1M7OA 1OX6A 1ZALA 1OIFA 2DJXA 2PP3A 4K7VA 1XLMA 1BSLA 4LB3A 2QDEA 3F4CA 3CMFA 3W87A 1WB0A 5DXXA 1TREA 4YTTA 1QO2A 1OX4B 5AYXA 4BQ5A 1TRDA 1RALA 3P93A 1BRLA 1Q85A 4B16A 1QATA 4S1FA 4PULA 3GR4A 3FS2A 3REQB 4M24A 4DF1A 2NX9A 4I5RA 3W24A 3VZZA 4CGTA 3AS2A 4J28A 4IIFA 4TQTA 3WQPA 1KBKA 2XSAA 2ZUMA 3A21A 2IKHA 2W9MA 5L9FA 3QH2A 1QR7A 1IV8A 3LGEA 4L6HA 3D46A 5HAOA 4CU6A 3VA8A 3FGCB 3OHIA 5CJ5A 4INFA 2PU0A 3EAUA 2PDHA 4JFTA 4B3KA 1KBBA 1YW1A 4H6EA 1ZY9A 2R1MA 1GJUA 4ZQPA 3IUHA 5CC6A 3T09A 1U2YA 4GI8A 4UTFA 1HJWA 2E28A 2H3BA 2WC7A 3WF0A 4IHCA 3TLLA 1YTKA 2PDIA 4QNWA 4NJKA 4UFLA 5FF4A 3ENLA 2XUCA 1B3ZA 1R3VA 4HBKA 4U3CA 3Q58A 2OSWA 1TVNA 1IGSA 1H1NA 1NJJA 2HXTA 2OWCA 1MSSA 4BQ3A 3EEGA 5I3FA 3T44A 1R86A 3URBA 3FA5A 1M5WA 3WEZA 3RITA 2QJHA 4ZSUA 3LLXA 3VKJA 2JEPA 4LCQA 3T0AA 4DAIA 3KLLA 2ZX8A 1DWAM 3QW3A 3GIPA 3PZMA 3RX3A 5JIPA 2QKFA 1GJWA 5BXRA 1DYSA 4AD5A 4GUGA 3QMSA 1VRXA 1MRAA 2PDPA 3ANVA 2REQA 4UOQA 3NEHA 1B90A 1EXPA 1Q8AA 1OB0A 5JUVA 5B7ZA 4PMQA 2VI0A 3DFTA 1SMDA 2Q71A 4UFIA 4YU1A 1A5OC 3I4EA 4HGXA 3UXLA 2BHYA 4RZ6A 2G96A 3IJIA 1GVOA 1GHRA 1EKOA 1Q4WA 2YLLA 3UJ2A 1LRTA 3JUGA 1K1DA 3C0QA 4UCFA 1VPQA 2PLCA 4PFHA 3SUTA 4DXVA 2D23A 3FKRA 4B92A 4OUIA 1YXCA 4GY0A 4JBRA 3SRFA 3VGEA 4MAVA 1XLKA 2D0HA 5A69A 1JZ8A 1E4IA 3CPGA 2CIPA 5HPCA 4AWTA 2V63A 4QS6A 4WKAA 3VGBA 4H83A 4EPDC 1LUCA 1V02E 4S3BA 1U5HA 2ZVRA 3KM8A 5ABTA 4PCSA 3E74A 4D1JA 4WGHA 3IAQA 4YHEA 3LYEA 3N17A 1IE7C 4FOKA 1AODA 1CXIA 1TRIA 3GR7A 3A6OA 4DXXA 1EYWA 2YFOA 1FH7A 3HPAA 1J8VA 3N2XA 2G8ZA 4E3TA 4ZOAA 1ZB5A 3SY5A 3FN9A 3XISA 2WNZA 3BC9A 1JYXA 3UFYA 1NP0A 3VD4A 1CTNA 3W88A 4LW7A 1M03A 3FSUA 4QHRA 1XIMA 3WG6A 5U4NA 1M1BA 5T8GA 4YJ5A 1QOPA 5D37A 1HKIA 2ADAA 3LPOA 3WDQA 3MDUA 1FHLA 4ACYA 4R34A 3MV01 1UR0A 1ELSA 2Z28A 5A94A 5F2LA 3EDJA 5C71A 4OTKA 1IZKA 1BF6A 1F8IA 2BGSA 1KXVA 2W6RA 4RNHA 3BJTA 3SB0A 4N9EA 2GVYA 5FL1A 1KW1A 1FTXA 3QKEA 2BFGA 4IJCA 3H22A 3W01A 4MB5A 1LWJA 3KP1A 4ADSA 1EJRC 4AY8A 1AL8A 2WB5A 1EA9C 4IM4A 3TVAA 5BWAA 3PUGA 3NURA 4LNYA 2H6RA 3QMTA 3M5ZA 3VDHA 1YTDA 1WPCA 1TA3A 4Z08A 2ZE0A 2G5WA 2VJXA 3WUEA 4HYWA 2RH9A 1G7VA 4XWUA 3PAOA 3MUXA 1LYXA 4E8CA 4XVDA 1GQKA 1X96A 1FCBA 3PPFA 5REQB 3E0FA 1RA5A 2PF8A 4DELA 2EO7A 1S5WA 3FW6A 5C70A 4N6FA 3PZQA 4CNNA 1R85A 1ZL1A 1IZCA 2X16A 2V3GA 1AH0A 4DJFD 2OLAA 2ZZ4A 1GW9A 3K8KA 2VNCA 5M3WA 2VQTA 1TPDA 1GKRA 4HA4A 1JPMA 1QW8A 3IJ8A 2P0IA 2X1SA 2CKRA 3OGRA 4P8XA 4JQAA 1YPXA 3UWYA 5A6JA 1PTAA 2VR4A 4YXGA 1ZENA 5E0FA 1TPFA 3W02A 1I0BA 3KDNA 2RDUA 4IMDA 1THFD 2W79A 3HPFA 4UTWA 3FIGA 5CBIA 2V2HA 1AFSA 1RSCA 3VE7A 1QU4A 4OE7A 3IVTA 4DI9A 1VJIA 3AHTA 4O19A 4NNCA 3LNPA 3RR4A 1R47A 1P1XA 1WOAA 3UNTA 4IF2A 1E6RA 1ITXA 2HMCA 1I9CB 4DJFC 3GY1A 1POKA 5AZ1A 2IKIA 2E25A 3IJLA 1DWIM 3FVMA 3FDKA 3MP3A 4S39A 1E6NA 4FEZA 3QBUA 4NRRA 1A80A 4BQ2A 4PB4A 3QV8A 1W5NA 3LCFA 2PWDA 4ORIA 3HV8A 2Z7GA 1OT2A 2VURA 3TA9A 1AVAA 4HHLA 3GW3A 4CD4A 1DVJA 2AKMA 4O12A 2VCAA 3P2VA 4KFNA 3VAVA 1A3HA 1PKNA 1CW2A 3EA2A 3K1GA 3TOPA 2XIBA 3MUCA 5FJOA 4WY0A 3M1ZA 1MVYA 5G5IA 3WELA 1SO6A 4DWSC 4MDPA 4AZIA 4E3VA 3AXKA 2Z24A 2VGBA 1E70M 1YHTA 5T26A 1Y0EA 2Q02A 3W1LA 3SCUA 1H2JA 2QAFA 5SWUA 1L6YA 2V5JA 4M3PA 2ZQ0A 1BGGA 1XLBA 1TO3A 3SECA 3FA3A 4I7UA 1W9UA 2VD8A