3N9KA

F229a/e292s double mutant of exo-beta-1,3-glucanase from candida albicans in complex with laminaritriose at 1.7 a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glucan 1,3-beta-glucosidase
publication title Carbohydrate binding sites in Candida albicans exo-beta-1,3-glucanase and the role of the Phe-Phe 'clamp' at the active site entrance
pubmed doi rcsb
source organism Candida albicans
total genus 152
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2010-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n9kA00
1H3GA 1PPIA 3GDBA 2X1IA 3SUWA 1GHRA 1KCLA 4CVWA 5BXPA 3VNYA 2CIPA 1JXKA 1ISYA 1H1NA 1MW1A 2VR5A 1R86A 4P7NA 4UQ9A 1JDAA 3OZPA 1JL8A 1KGXA 4M8UA 1V0LA 1UKPA 2D0GA 2WMFA 2E9MA 4XV0A 3WQ4A 4H7VA 5I6SA 1EO7A 1JF6A 5M03A 3TTSA 3GM8A 4GXPA 2XHYA 1UR8A 4ZXOA 3MMWA 2WNWA 3ALFA 2BVTA 2ZUTA 2YA0A 2D23A 1VENA 1U30A 1OGSA 4AZ7A 5A2AA 2WMKA 1X6NA 3WFZA 1E40A 2WHLA 3ZOAA 4TVUA 3PTKA 3NYDA 4U3CA 1Y7VA 2DH2A 4M81A 2J62A 2TAAA 5AC4A 1HNYA 2W4XA 2DSKA 1IV8A 3AIWA 1XCXA 2CERA 1GORA 1X1NA 3NJ3A 2EPKX 2OWXA 1JD7A 3WENA 3FNDA 1NOUA 5LA0A 4JFUA 3ZJKA 4UFJA 4W7WA 5A1AA 1EQCA 1E15A 1R7AA 3BGAA 2J77A 4MJ4A 1W3LA 4DM1A 1W3JA 3N1AA 2Y8KA 3BLKA 2X2YA 2F8QA 1UQYA 1XD0A 1UH2A 1MQRA 1QW8A 2XVNA 2BV9A 2G4FA 3AHXA 3CLWA 4QLJA 4U2ZA 4N42A 5DFAA 5CJ5A 4B15A 5FCZA 4HMCA 1WP6A 1EHNA 2EJ1A 5IFPA 2E0PA 3O2LA 4B3LA 1WDQA 2O9OA 2WCAA 1E1EA 4TX6A 1UKQA 3EDDA 2WW5A 5IFTA 3T08A 4P8WA 1BLIA 2W5FA 3MV01 1UKTA 4HZ8A 4MB5A 5IXEA 4UCFA 1CEOA 1LJYA 1FH7A 1V0NA 1FH8A 2E4TA 1FFQA 1QHZA 3HN3A 1V02E 1QHOA 2WZHA 4D6IA 1Q6EA 1ITXA 4GPNA 1XH2A 4PSRA 2YLAA 2BHZA 1F4HA 4BQ2A 1TE1A 1A47A 4MNKA 1DWHM 1UA7A 4J3SA 1BYDA 4CD8A 4EANA 3QHNA 2EBNA 3NCOA 1GJUA 2YLLA 4WK9A 1GW1A 3AZTA 1LL6A 2WKLA 3AHTA 4D6HA 1U2YA 4D6DA 1JI1A 4W7UA 4WKAA 1W2PA 4Q7NA 1PZ2A 2WMHA 1VRXA 5BXRA 2WWDA 3B9DA 3AS1A 1JF5A 3N11A 3ZJ6A 4PN2A 2JE8A 1BGGA 1CXLA 1EQPA 3GH7A 5LYRA 1E6NA 1H5VA 3MS8A 3CZGA 1HP5A 3W53A 1KBKA 3CZKA 4YN5A 2V5DA 2G41A 1P6WA 2ZX9A 4MJ2A 3PZVA 4D1JA 1CLXA 1CGVA 1EDGA 2BXZA 4RE4A 3CBWA 1V6VA 3QR3A 1B30A 2ZUSA 4AD5A 2O9TA 3SCWA 1BYBA 1ZBCA 3EMZA 2VI0A 2W63A 1UZ1A 2DSZA 5GNYA 3AMKA 1E6PA 5CSUA 1HVQA 3SCRA 4HOZA 4J3WA 4MB4A 4HMEA 1TZ7A 2WLZA 3IAPA 2DSWA 1XSIA 2WZIA 4R27A 1MXDA 3U57A 1UHVA 3WQWA 4KGLA 3SUUA 4JFSA 2OWCA 2PF0A 3CZJA 2VX7A 2QPSA 1PIGA 3WELA 1C90A 1B3YA 5A6JA 3KL3A 3QGVA 3VIHA 1B1YA 1CYGA 2WHJA 5DT5A 1QNRA 5JIWA 2Q8XA 5A6SA 5BCAA 3ARRA 1V08A 3L4UA 1C7SA 1EA9C 3U7VA 1J0JA 5BWFA 2PWDA 2NT1A 1DP0A 1SYTA 4U33A 3M07A 5JBFA 2XGBA 1BFNA 3WUGA 4RE3A 4WF7A 1IT0A 1WNOA 1JZ8A 2VRQA 3KZSA 2WBGA 3ZT6A 1GOKA 1K9DA 4AD0A 1E43A 2WC7A 2W62A 1G0CA 4NI3A 4W8BA 5BRPA 2YL5A 1TVNA 3AFBA 1DWAM 4OKDA 3CGTA 3GXIA 4ZXLA 3APGA 5AY7A 1E73M 2CNCA 2PWHA 4B16A 1IZKA 4HTYA 4CCEA 4J3XA 1KGWA 1VJZA 2VO5A 3N04A 1LQ0A 4F79A 1NQ6A 2XUCA 1EHAA 1BHGA 2F61A 5ECUA 1TCMA 1XYZA 3GTNA 4JIEA 1HN1A 4AD1A 4D6JA 3WIJA 5D9PA 4OOUA 1V3LA 1OB0A 3K1DA 1V6XA 2VVSA 2CHNA 1E5NA 5A69A 1KR1A 3RILA 3PZ9A 3VMPA 4BF7A 2WAGA 3DHUA 2WMIA 4PRWA 2DDXA 1HKIA 2JF7A 3UESA 4V28A 3I3DA 1GUVA 2JF6A 1U33A 1ZU8A 5JIPA 1W1VA 2OLHA 4DUWA 1J0YA 2JIWA 2PBOA 1C93A 1XHGA 3NSNA 1WPCA 1E6RA 3VKKA 4FLOA 2WCGA 2A3HA 4P7LA 3SCPA 2XFFA 1QBBA 3DECA 1W9DM 1OINA 1DWIM 4KMQA 3A3HA 3MSGA 1O7AA 4A4AA 3GYCA 3QHOA 4JKMA 5E6YA 2XVLA 2J8GA 3IJ8A 4PMUA 3N12A 1LG1A 1M7XA 1JDDA 1JDCA 4CN6A 4HU8A 3RPMA 7A3HA 2O9RA 2D24A 5FD0A 1V03A 2VCAA 4BZYA 1UD2A 2DT2A 3CIVA 3WF4A 1MXGA 3VVGA 3VDBA 1MW0A 1HVXA 3A6OA 2ZOXA 2PBGA 3VINA 2DH3A 4BQ3A 2RGLA 1J0ZA 1WZAA 4FLSA 3E1F1 2EPOA 4C7FA 3LPFA 4AEEA 3TOPA 5BYWA 1G01A 2J4GA 3M6DA 5A6AA 3ARXA 4H8HA 3WQ6A 2FHFA 1V3HA 2WKGA 1UD4A 3ALGA 3WUBA 3K8MA 4B9YA 4CVUA 1AQMA 4QLKA 5DEZA 3TP4A 1VAHA 4CGTA 3OA5A 3L2MA 2GFTA 4WJXA 2WM0A 2A3EA 2IXVA 5I24A 3WKZA 1PBGA 3M7SA 4BS0A 4GKLA 5I77A 4S3JA 4UQAA 4E8DA 1LWHA 1WE5A 1W32A 5HNNA 4AWEA 2WVTA 3MUIA 3ARWA 2VQUA 2DQXA 1BTCA 2FGLA 3TTQA 1QNOA 4MADA 3W24A 2JIEA 2V38A 3WDRA 3VO0A 4F8XA 1JNEA 4ATWA 1E6QM 1VBRA 4D72A 3WF2A 1LL4A 3WH7A 1G9HA 4NRRA 2VOTA 5BXSA 3CMGA 4CCCA 3NDYA 4Z2HA 1KB3A 1V0KA 2D1ZA 2X09A 4WKFA 3VX1A 3WBAA 3OIHA 4PTWA 1UWRA 2DEPA 3DYMA 3THDA 2E8YA 1BPLB 4ML4A 3AOFA 3CH9A 3GXDA 5A8QA 1UD8A 2VZVA 1QI3A 2V3FA 2O92A 1CXFA 5A6LA 3U5UA 1Q6GA 4ZE4A 1TUXA 4MNJA 1Q6FA 4HOWA 4UR9A 2BY1A 4B3KA 5EBAA 3GNOA 3SCNA 4AYSA 4U2YA 3VPLA 3CMJA 3FHAA 3ECQA 5GQBA 3UG4A 1RPKA 1TA3A 4AZGA 4ATDA 3UR7A 3VIOA 1AQHA 2ZX5A 1G1YA 3AICA 1J0HA 1GHSA 4W93A 1W1YA 3AYRA 5CPTA 3RM8A 3WMSA 5LA1A 2PI6A 4H8UA 2DT3A 1B90A 1GQJA 1V6WA 5A3HA 3WF1A 1HJXA 1GCYA 4EAMA 3DYOA 1RD6A 3HU7A 2VURA 4JHZA 1EOKA 3SCSA 2OSWA 4MTVA 1J0IA 3ZJ7A 2E9LA 1C92A 3WF0A 1UD3A 4UNIA 3WNNA 3WUEA 3BXWA 3UCQA 3VILA 4JFVA 1E0XA 1OD0A 3RIKA 3WF3A 3TA9A 2DSUA 1C8XA 3VIPA 2XIIA 4PMDA 3WUFA 4FMVA 2FGZA 1W1TA 2WVVA 4EKJA 1WDPA 1OIMA 1I75A 2WVSA 5I5RA 3WH6A 5E6ZA 1SMDA 3PZUA 3BC9A 5A6MA 2CCRA 4CD4A 2QF8A 4HMDA 1E4MM 3U5YA 4XUYA 5BROA 4DUXA 2WVVB 3NSXA 4MNMA 3AIUA 2BY2A 3VGHA 1VF8A 2VZSA 3VGFA 2CBVA 2XVPA 4D6FA 4X0VA 3D3AA 5AYBA 2B31A 3OGRA 1QI4A 4TXEA 2WZEA 1E4IA 4Z2KA 1V6UA 1E6SM 1GVIA 4D71A 3K4DA 2VZUA 5JUVA 2J78A 3AXXA 4KGJA 5A8OA 2W92A 4U5IA 3ARVA 3GZAA 1PIFA 1QNPA 4CU7A 2XG9A 4HZ6A 1NH6A 3ARSA 5CXPA 1HKKA 5M17A 3ARYA 4AD3A 3VOCA 1ZJAA 3WMCA 5D4YA 3AYSA 4UZSA 1BF2A 5M3WA 1V3IA 4IPLA 2GJPA 3WNOA 2ZIDA 4FK9A 2ZUNA 1W9BM 3UR8A 1L8NA 2HISA 1E9LA 1TFVA 3ZMRA 3HMCA 3EMQA 3RDKA 2VMFA 1E70M 2OWWA 3OLEA 5AYIA 1NOFA 4M82A 4V27A 4EE9A 4QCEA 2W61A 4IISA 3SCTA 2X0YA 1W2VA 1UKSA 3VD7A 2G3NA 4PMRA 2J74A 3J7HA 1JI2A 3GNRA 1KXTA 1UWIA 4KRUA 3OB8A 1H11A 1M03A 5CQ1A 4UFMA 7CGTA 2VTFA 4CU8A 3VUPA 1BAGA 1DEDA 1PX3A 1E72M 1GOQA 2WMGA 2YDRA 2O9PA 3ARTA 4GINA 3NIYA 4LXFA 3DYPA 1CGUA 2Y5EA 4OBSA 2V3GA 1ECEA 2G8ZA 1CXIA 2D22A 4W87A 3POCA 3FN9A 3W28A 1NM9A 3BSGA 1E56A 1C91A 1JYVA 3N15A 5A95A 3IJ9A 1ISZA 5A6BA 1JZ6A 5CGMA 1EDQA 3MV11 2A3BA 4FF5A 2EPMX 4AC1X 1QNSA 1MYRA 2BHUA 2QMJA 3W38A 5CPQA 1E1FA 4GZEA 3BMVA 3WDJA 3M46A 2VC9A 3PZGA 5C8BB 1DHKA 1BYAA 2FDMA 2Y2WA 3T09A 1G94A 1D3CA 3L2LA 4ACYA 1CGXA 3CUGA 4W85A 3BAJA 4CN1A 3OZOA 2PB1A 1UR0A 2X0HA 2FH8A 4LYRA 3T2QA 3VIJA 2UWFA 2WSKA 3AS3A 2CXGA 4UFHA 4U3AA 2G3MA 3AIVA 4J7RA 2GK1A 3WDQA 4ATLA 1B9ZA 3EDFA 2E40A 2W91A 5C71A 4IUGA 1BVNP 1CBGA 5HPOA 3WQ5A 4AZ6A 1R7OA 2UY3A 1UWSA 2WXDM 1JFXA 1SR0A 2WHKA 1WB0A 4GZIA 4P7QA 2MANA 4FLRA 3W81A 1QNQA 3MMDA 4NRSA 2GJRA 4WIWA 4AD4A 1UR9A 1VFMA 3AIRA 4MB3A 4OUEA 3L4VA 3VX0A 1WZKA 2ZUUA 1XH0A 3BAWA 2BS9A 4M29A 1M53A 2QLYA 1C8QA 3KE0A 3GH5A 2BHYA 1E0WA 4MNLA 5CG0A 4AZBA 4HOXA 1H4PA 2YDSA 2CBUA 4QP0A 3O9NA 4A3HA 3WH9A 2JALA 3WD1A 1VJSA 1KXQA 2ZWYA 3VDAA 1NWUA 3N13A 3I3EA 4U5KA 3VGEA 5D8WA 1XCWA 1JZ3A 1K9EA 2J7DA 3EDJA 3QHMA 2YOCA 3BCFA 4YHEA 4IM4A 3MUAA 5M5DA 3EMCA 3EBVA 2YDQA 5CLWA 3A4AA 4GI8A 3AROA 4AIUA 2XM2A 3VU2A 3AS0A 1EDTA 3MUZ1 1R85A 4JL1A 5CPSA 4HA4A 5EMYA 1QVBA 1BG4A 2CITA 3VIFA 1KBBA 4CCDA 3THCA 2AOSA 4AMCA 1HJVA 2WANA 1V3JA 2XM1A 3MU7A 2ZUMA 3ARPA 5I0DA 2FHCA 3BAXA 1OGBA 4CD6A 3LMYA 4H04A 1HX0A 5FKYA 1XV8A 2A3CA 1FP8A 4TUFA 4HPGA 2PWEA 4XX6A 3II1A 4D6GA 4MAVA 2XFRA 5D8ZA 1MW2A 7TAAA 3PHAA 3NSMA 1PJ9A 1RH9A 1V0MA 1MFVA 1ZS2A 1ESWA 2ESCA 2ZXAA 3AMGA 1E4LA 3IK2A 3W29A 1BYCA 2XVGA 1MFUA 3AMDA 4P8UA 3WSUA 2WMIB 4Z2IA 3OG2A 4OJYA 2YJQA 1PEZA 1ZBKA 3WMBA 3VGDA 2EO7A 3POHA 1AVAA 1B3VA 4QLLA 2GDUA 4Z2LA 5BXTA 1NOWA 1VFUA 1CENA 3CUFA 4W5UA 3HJEA 3ARUA 2XYLA 1H0GA 4E4PA 3ZIZA 4EK7A 3CO4A 2CYGA 2UY5A 2BY0A 1WO2A 3K46A 2WLYA 3WDPP 1MQPA 4LX4A 3WY1A 4M56A 1NWSA 1ZBWA 3VD5A 5A6BD 5IHRA 2YKKA 1CGTA 3PZOA 2XVKA 1MW3A 3L4WA 1UR1A 1OM0A 2VVNA 1QBAA 1UH4A 4J28A 4AISA 8A3HA 1QI0A 5I3DA 2D0HA 5KZ6A 5IDIA 3CUHA 4R5EA 1HT6A 1EGZA 3SUVA 2E8ZA 1H2JA 4W7VA 2W67A 1RP9A 1ISXA 4A3YA 4OIFA 1NWTA 1GZJA 4PCSA 3N18A 1X6LA 1V3MA 1K9FA 2DIJA 4WSKA 3D5HA 1HJSA 1ZL1A 3WN6A 4BQ4A 3VGBA 5C70A 1KWKA 3IAQA 2CESA 3VD3A 4J27A 2WPGA 4W86A 1UWUA 4B9ZA 4PSPA 4HPHA 4TOQA 3W0KA 2D3LA 1CGYA 3CTTA 3W82A 3SUSA 3SUTA 1GQLA 1EXPA 1W9UA 2RGMA 4NSBA 4TTGA 4ZENA 1HJUA 3AZSA 4IPNB 4OBRA 2ZICA 3T2OA 1GPFA 3WNLA 2BVYA 1J9YA 3WD4A 4JZ5A 4Z2GA 1Z32X 2Y24A 3VIMA 4UTFA 3W25A 2WCSA 4UZUA 1BG9A 1AQ0A 1JYNA 4P8VA 1V3KA 5F7UA 3FXYA 2IUZA 3VNZA 1GJWA 1W3KA 3BMWA 5A2BA 2EQDA 4QAWA 2ZXBA 1ODUA 3LPGA 2GJXA 2VRJA 3PZNA 4AZCA 3TTYA 4JKLA 2UY4A 1CTNA 3W26A 3GXFA 1CXKA 3AZRA 2ZE0A 3ARQA 1V02A 2VNCA 2ZUVA 1EOMA 2FHBA 4UQEA 5HDRA 1GQKA 1BGAA 4PMQA 5I23A 3WEOA 1JD9A 3WD0A 3AXIA 4N0RA 1J11A 3OLIA 4AZCB 3OBAA 1E71M 1E3XA 2JFEX 1I1WA 1BVZA 1A3HA 4ZFMA 3F4VA 4JCMA 1K6AA 1E6XM 1H49A 4YPJA 2QV4A 4URIA 2BVDA 4GI6A 1VEOA 3WH5A 1TA3B 1QI5A 2XFYA 4GIAA 3ZSTA 4UQDA 3LPOA 3WQ8A 3VGGA 3FAWA 5KEZA 4CKQA 4F66A 1LL7A 1GVYA 2Z1SA 3PTMA 2E9BA 4PTXA 4GI9A 3WH8A 2ZUWA 2F2HA 3CHFA 4UFLA 1J01A 1KWGA 1OD8A 2OSYA 2J79A 1NWRA 1QI2A 2VT0A 1VB9A 4GO9A 1ZBVA 3CUJA 1N82A 3PZMA 1CXEA 2QPUA 2BY3A 1UWTA 1FA2A 3K4AA 1HIZA 4PTMA 4M1RA 5E0FA 1MWOA 3GBEA 5HXMA 4W89A 1HKMA 4MB1A 3RJXA 3W6MA 4ZEPA 4PCTA 3WEMA 3BAIA 2EEXA 2XTKA 2G3JA 3WFLA 4LQ1A 2C0HA 1ITCA 2J47A 2WK2A 2J7CA 4J3UA 1C7TA 2ZX7A 3VD4A 2CPUA 3RM9A 2BFGA 1HL9A 4DWSC 1HJWA 3SIMA 3K8KA 4JL2A 2YBUA 2WBKA 4H2CA 3VM5A 3RMEA 5FL0A 3ARZA 3I3BA 3PN8A 1NP0A 3W6LA 3AIEA 5CZKA 1E0VA 2GVYA 3KL5A 3FAXA 4BQ5A 4BCEA 1PAMA 2Y8VA 3RO8A 1QPKA 4F9JA 1UZ4A 3AHVA 3WNPA 1JZ5A 1B0IA 1GOWA 3RM4A 2J7BA 2DPEA 3VMOA 4RL3A 2CHOA 1EO5A 2EPLX 3VD9A 3L4TA 1PZ3A 2NSXA 4F9DA 1FH9A 2D2OA 5CSYA 2YL9A 2DGAA 5GNZA 4AZIA 3ZJ8A 1JZ4A 3B9EA 1J0KA 4JCLA 5DT7A 2X05A 1FP9A 2QHAA 3EYPA 2AMGA 1HP4A 4LGXA 3VIKA 3LPPA 2VJXA 1F4AA 3BAKA 4D1IA 1AMYA 1C3FA 4RE2A 2W66A 2ZXQA 1H0IA 1UUQA 2G3IA 1KCKA 3VDHA 3UG5A 2VZTA 1R87A 2DIEA 4WLCA 1E5JA 3CZ8A 2Y4SA 4QDMA 3GNPA 4UFKA 1NP2A 4UFIA 5E0CA 1XRVA 5CLTA 3SCQA 1RP8A 4XZWA 4E8CA 3S2CA 1JZ2A 1E6ZA 1D7FA 1WDSA 5DF0A 3G6MA 5ABHA 3NDZA 1W9XA 4MDPA 3VIIA 4WKHA 4J3VA 4UQCA 4CD7A 2XWDA 1O6IA 1W3HA 2V3EA 1W9VA 4PMOA 3TONA 3SCVA 1GOIA 1PX4A 5EB8A 2XSBA 4LYPA 3WBEA 2BNJA 3MMUA 4HA3A 2QMKA 1NARA 2E3ZA 4M24A 4P8XA 3KL0A 4TTUA 2ZXDA 4D6CA 3GBDA 4XB3A 8CGTA 1J10A 3UG3A 1WCGA 5E09A 5ABGA 1B3WA 4JFWA 3FW6A 3ZM8A 1ZB5A 4UOJA 1TR1A 1UOKA 2UY2A 1D2KA 3O6AA 2XJ7A 4HP5A 3AJ7A 5JBDA 4P7OA 2VX5A 2YIHA 2XWEA 1K9TA 1WZLA 1HL8A 1S46A 4TVDA 1VBUA 4OOZA 3VIGA 5I2UA 4AIOA 4PMXA 1ODZA 4L4OA 3B9AA 2CBIA 4W5ZA 3AIBA 1CGWA 4JHOA 2HVMA 5HOSA 1SMAA 1ISVA 3WL0A 4FLQA 3SCOA 3N17A 5E70A 5TD4A 2GK1B 3WEZA 2OYKA 4W88A 3SURA 3WD3A 4AXNA 3CZLA 3SEPA 3U7BA 1DWJM 2VCCA 2XIBA 3GH4A 4DM2A 2D20A 1Q4NX 2GDVA 1J12A 4YHGA 2J25A 1XH1A 2WYSA 1IZJA 1H09A 4WSJA 2DT1A 1G5AA 5A94A 3F5JA 4TX8A 1DTUA 3VDCA 5FIPA 1KQYA 3AISA 1VFOA 4HZ7A 1Q6DA 1LG2A 3S6TA 1Q6CA 2CKSA 3W37A 1YQ2A 2D0FA 4XZBA 1VIWA 4M80A 3DC0A 4CN4A 3BCDA 2NT0A 3B8SA 1B2YA 1JAEA 2JEPA 3ZT7A 1GQIA 4AEFA 1JG9A 1EIBA 1WAWA 4K68A 2YL8A 1TMQA 3OLGA 5A8NA 1DWFM 4AD2A 1B3XA 4H8VA 3ZR6A 1UQZA 4PMZA 5ABFA 1UD5A 4E2OA 1QOXA 4HU0A 3OLDA 2OSXA 3QOMA 3AMCA 4AZ5A 4AIEA 3T0DA 1LF1A 1OCQA 3UERA 2J7GA 1CZ1A 1GNXA 2WC3A 5D9MA 3KEHA 1KXVA 5DO8A 1E55A 3WDHA 5DMYA 2D3NA 1W91A 3N9KA 3PBGA 5ABFB 4CUCA 2VL4A 2CBJA 1HF6A 5HPCA 1I1XA 1LLOA 2WSPA 1KQZA 4GO8A 5I78A 2WB5A 2VCBA 1OT1A 2DT0A 1UA3A 1SFSA 4W84A 1JNDA 4DWSA 4Q22A 1KFWA 4L4PA 3FY1A 3OGSA 3NUKA 1XYFA 2WVUA 1LWJA 2WWCA 1QHPA 3F5KA 9CGTA 3AIQA 2PC8A 1FFRA 2GUYA 3VM7A 3EDKA 4DWSB 3A47A 4PMVA 4U31A 4MDOA 1BSIA 3PZQA 3W27A 4UOQA 3WD2A 2J75A 5A8MA 1UD6A 4ACZA 3AHYA 1CLVA 5A2CA 4PBGA 5EFDA 3VMNA 3AI0A 5ABEA 1JYWA 2YA1A 1OWQA 2VQTA 1B3ZA 2X8RA 4TVCA 6TAAA 1HKJA 1CIUA 3MUY1 3ZT5A 1E3ZA 4ACZB 2ZWZA 1W9PA 4JKKA 4GQQA 2YBTA 2VRKA 1VEPA 5LA2A 1QW9A 4MPKA 3RCNA 4CU6A 4J3TA 2Z1KA 3KWXA 4UQBA 1B31A 3PZTA 3OGVA 4HA1A 1WDRA 3ZR5A 2C8NA 2WHMA 3QOKA 4CD5A 1M01A 6A3HA 4LYQA 2CETA 1GONA 5I79A 4X9YA 3PZIA 4C7GA 3ZSSA 3DHPA 4ZE5A 4KH2A 1CWYA 4MAZA 3MO4A 1FOBA 1VEMA 1UYQA 4KRTA 1WZMA 4P7RA 4PYSA 2DSVA 1UH3A 1GOMA 2J7HA 4JFTA 1XSKA 2V5CA 1KGUA 4PEEA 2V3DA 1EH9A 3WDIA 5E9AA 1WKYA 1CECA 1VFFA 3JUGA 2YA2A 1E4NA 3T0AA 3BAYA 1XSJA 3MANA 3L4YA 1GOOA 4PUEA 4Y7EA 2JEQA 1XGZA 2CKRA 3UEQA 1XC6A 3WNMA 1UWQA 1ISWA 1OGGA 3AS2A 1H41A 3VTRA 4S3KA 6CGTA 4LPCA 3IANA 3L4XA 1PX8A 3BLPX 4V2XA 1UR4A 3WQVA 4KWUA 1HJQA 2OYMA 4BA0A 4PMNA 2VR4A 3G6LA 4NF7A 2J8FA 2VUYA 4JAWA 5A8PA 1OIFA 2ZX6A 3T0BA 3AMLA 3AQUA 1KR0A 2YL6A 3CUIA 3FHQA 2XGIA 2C7FA 4AY1A 3F5LA 1JXJA 1OSEA 4PTVA 2BXYA 5GNXA 3ZQ9A 4DUVA 2EPNA 1US3A 5EFFA 3MKKA 1CPUA 1OT2A 3ZO9A 2VX4A 2IXUA 1UG6A 4OZOA 3GXMA 3MSDA 1JIBA 1FHDA 2PWGA 2J7EA 1CDGA 3AHZA 5BRQA 4W8AA 4NZCA 5AC5A 3BSHA 4H41A 4AW7A 1C8YA 1CNVA 4QCFA 1W1PA 2GJXB 1TVPA 1JZ7A 5FL1A 3K8LA 2AAAA 2WMJA 4PUDA 2OYLA 2CEQA 3CHEA 3EDEA 1MQQA 2ZX8A 1KXHA 3T2PA 2VZOA 2XSAA 4GQRA 5D9OA 1FHLA 1OBAA 3RJYA 5CGTA 1YHTA 3WNKA 5A6KA 2J7FA 3SCUA 3CPUA 1J18A 4GZJA 4QFUA 3L4ZA 1XD1A 3CHDA 1US2A 2WC4A 3WL1A 5IHSA 2EXOA 5JBEA 4UOZA 1MVYA 1V6YA 5D9NA 3TTOA 3W4RA 2FH6A 3IJ7A 3A4WA 2A3AA 4D6EA 1M04A 1L0PA 1UR2A 3BH4A 2GSJA 1R8LA 1DWGM 1CXHA 3CHCA 3UETA 2XPKA 1JAKA 3A4XA 3PTQA 4DWSD 1JFHA 5GPRA 1JGIA 4PMYA 3AXHA 1UKOA 5HBFA 4C7DA 2VX6A 4Z2JA 5FOOA 3CZEA 4W8LA 4X0NA 1TG7A 4AZHA 1HXJA 2PWFA 1JYXA 1ZJBA 2NW0A 1BQCA
chains in the Genus database with same CATH superfamily
1H3GA 4QTGA 2PA6A 3TYEA 5BXPA 1JXKA 2W3ZA 4MVAA 4IFKB 1MW1A 2Q6ZA 1O5KA 1PDZA 2VR5A 1OFBA 3KFTA 3M5XA 3VNLA 3TC6A 3DG7A 3ITTA 2EKGA 2QXWA 1KGXA 1UKPA 3IGSA 3CYJA 2BGSA 4XV0A 4KIRA 3TTSA 4GXPA 4US6A 5TBOA 2XHYA 3REQA 3ALFA 2YPIA 4I9AA 3V4BA 4ERGA 1UASA 2ZUTA 1J8VA 3H26A 4XAYA 1K77A 1U30A 5I3IA 1PZ1A 5A2AA 1FDYA 1XQLA 1Y7VA 3DG6A 2R94A 3ZZ1A 2DSKA 4FXJA 3TFXA 3AIWA 4JTJA 1VQTA 1DVJA 2R1LA 4JIRA 3R25A 1XCXA 4YVVA 2Y8UA 1AL8A 3VYLA 3LM7A 2OWXA 4DBWA 3CQKA 3H23A 2P8CA 3ZLFA 4W7WA 1TPWA 4REQB 1EQCA 3N9SA 3BGAA 4PTDA 3VKCA 3N1AA 1IR2A 2Y8KA 1XM3A 3PBWA 1UH2A 1QW8A 4LC8A 3OJGA 3MCOA 4QLJA 1A5AA 4HMCA 1EUNA 5CPMA 3ZWTA 5IFPA 3IS4A 4FX7A 3ABSA 1E1EA 1W1IE 3UYCA 3EDDA 1K7EA 3DFTA 5IFTA 2OZTA 1MMFA 4R9XA 2W5FA 2OEJA 3USBA 3JW7A 3PNZA 1V0NA 3BICA 3S4TA 4IP7A 4YVXA 3PC0A 1FH8A 5CZJA 1FFQA 1EJ7L 4Y8FA 3GVGA 4PB5A 1MNZA 4IWWA 1XI3A 1ZRQA 1Q6EA 2HRWA 3E0LA 1WXZA 2KAUC 1XH2A 2C15A 1ALDA 3WLHA 3CHVA 3QZ6A 5HNRA 1U1UA 1TE1A 4XTDA 4MNKA 1DWHM 1Y5VA 4PR4A 5AHNA 3W84A 4CD8A 3NQDA 1FDZA 4ZOBA 4E3VA 3NCOA 4DXXA 2YLLA 4WK9A 1LL6A 3AHTA 1DJQA 4D6HA 1IE7C 3N6QA 2CC0A 1JJKA 3RNDA 5H91A 4Q7NA 3GU9A 3U2ZA 1A5BA 3CAWA 3N11A 3S2MA 2JE8A 1VLIA 4DZ5A 3GH7A 1QFEA 3CZGA 4ICCX 1Q65A 1PHWA 2G41A 1P6WA 3VE7A 2ZX9A 4E4UA 3PZVA 2HVOA 4C6NA 3M41A 4M19A 3VOFA 2BXZA 3GTFA 4RE4A 1B30A 3CQIA 4AD5A 3SCWA 2VKZG 3EMZA 4X22A 4C1NB 2VI0A 1C9WA 2DSZA 1TTQA 3VKJA 4JDBA 3LMZA 4HOZA 4HMEA 2OX4A 5D2VA 1TZ7A 3I4EA 2ASHA 3S6DA 2IW0A 1XSIA 4TIMA 4FSAA 2DZAA 3GC2A 3U57A 1O95A 5CZTA 5F4XA 4YCOA 1Z48A 3SUUA 5DMMA 1KM2A 3QPEA 4Q6XA 2ON3A 4QBXA 1KRCC 2DY3A 3TN4A 5DT5A 3USZA 5JIWA 5A6SA 3IIPA 4QEEA 1C7SA 3O15A 3U7VA 1J0JA 3EB3A 3MPGA 4WJEA 3M07A 4NZJA 2Y7FA 4HNCA 4BKNA 4PBFA 2YCJA 2C0AA 5C5YA 4WF7A 1IT0A 4PMJA 1JZ8A 5MHBA 4S23A 1BEUA 1GOKA 1H7OA 1GEQA 1OF8A 5CPLA 3C3UA 2YL5A 1TVNA 3OZMA 3LCHA 3UGRA 3WJWA 3KBVA 1TRDA 3TYUA 3IUHA 1UZHA 4J3XA 2VO5A 1LQ0A 4IG2A 1NQ6A 2F61A 2FFIA 4JIEA 4UXDA 4Q33A 3R79A 1AJZA 3NQ6A 3G1FA 2PP3A 4D6JA 3LG3A 5TIMA 3P0WA 1V3LA 4J2PA 1OB0A 5DMNA 3K1DA 1RVKA 1QU4A 4XZ9A 3GTXA 1RJQA 4DB7A 4BF7A 2WAGA 2HEJA 2DDXA 3UESA 3RPTA 5HMDA 3LHWA 2JF6A 3TKFA 2HROA 3VZZA 3B03A 5JIPA 3OYXA 4LUYA 5H8MA 2PBOA 3DUGA 1XHGA 3VOIA 2NLYA 5C9ZA 3VKKA 4FEZA 3W00A 4L80A 2DJLA 1OINA 3LZ5A 4IMEA 1DWIM 1W5MA 2NQJA 3A3HA 3B06A 1GKRA 4A4AA 2Q8LA 3GYCA 3LQLA 1ZFJA 2XVLA 3IJ8A 4PMUA 3YPIA 1JDCA 3GWQA 4HU8A 3TVAA 3RPMA 2HXTA 2VWSA 1Y65A 3NL6A 3QFWA 2X30A 4GWEA 1XCFA 5JH2A 2ZOXA 2QGYA 4AQLA 3IIXA 3VINA 3KM8A 2RGLA 3E1F1 3RCYA 4OECA 3BW3A 4N6FA 3WQ6A 2WKGA 2CU0A 1FWCC 1P43A 1H51A 1YNQA 2V68A 3JVAA 4CVUA 4QLKA 1POJA 1VAHA 4GVGA 3OA5A 1SU5A 5JMUA 5LNWA 2GFTA 3LHTA 4H7ZA 4JTGA 2WM0A 2A3EA 2ALDA 1PBGA 1G4PA 4BS0A 4S3JA 4UQAA 1LYXA 4MG4A 4H01A 2W79A 4NAEA 1RCQA 3TC3A 3ARWA 3F4NA 4EF9A 4POCA 2FGLA 3TTQA 2NVAA 1QNOA 4JQ1A 4MADA 4MMWA 3LCIA 3H4WA 2V38A 3VO0A 1LL4A 4GUHA 4JTRA 1G9HA 1R3RA 4Z2HA 3TYCA 1V0KA 2YYUA 4PTWA 5CCZA 2YXGA 4LEQA 2E8YA 1BPLB 4XZMX 3RFAA 2JKEA 3KS6A 1HW6A 3OBEA 3DCPA 3F4CA 2O92A 3U5UA 1Q6GA 5XINA 1F07A 4A3RA 2VEIA 4ADUA 4C91A 4ZE4A 3PNUA 2BY1A 1N8WA 3KRSA 3N2BA 3R43A 4AYSA 2R6OA 3VPLA 2VFFA 3ECQA 5BU9A 3L12A 1A5KC 1LWIA 3DX5A 3UG4A 1TA3A 4AZGA 3IIVA 1A0DA 4ATDA 3OW1A 3VIOA 3KUMA 1GTHA 1OX4A 1J0HA 4L56A 2PAJA 3RM8A 3WMSA 3LV6A 3WQOA 5LA1A 4H8UA 1GQJA 1V6WA 3WF1A 4RXFA 2PRLA 3LSCA 4L5ZA 4RLIA 3UZYA 4ZOEA 1RD6A 1PVNA 2ZBTA 1EOKA 2ZFAA 1XRSA 4MTVA 2OMAA 3C52A 1XPGA 1FWIC 3URQA 1UD3A 1XIIA 4GNJA 3W7OA 2ABBA 3R6IA 3G24A 1RA5A 4JFVA 3WF3A 3C86A 3E02A 4CLMA 1ZP3A 4ORIA 1IR1A 4AFYA 4K8EA 4LBSA 2I14A 4EKJA 1PYFA 5I5RA 5FACA 3WH6A 3U6WA 2GQ8A 2E6FA 3PJTA 5TNVA 1I60A 1KFKA 1ZZMA 2R14A 1EL3A 4XUYA 3SSJA 2BY2A 3VGHA 2XVPA 4LAKA 4DJED 3HIJA 3S2LA 3C8NA 1QI4A 1XDLA 4TXEA 1P6CA 2WZEA 1G7UA 3U4FA 3KW3A 1GVIA 4GMEA 2W92A 1MSSA 2O4MA 1DJWA 2XG9A 1R3SA 4LANA 4RZ4A 4D9PA 4YXGA 3R12A 4ZB0A 3H22A 2QCHA 4ZQMA 1VYRA 3LHZA 3VOCA 2BMBA 3A13A 1VHNA 5D4YA 3AYSA 4F4RA 1XLJA 4GH1A 3CEUA 3CT7A 1MUMA 2VOMA 4IPLA 1YNPA 4LVDA 4WEVX 4FK9A 2IKGA 1W9BM 2OO6A 3CPGA 5KTLA 2ZYFA 3EMQA 3RDKA 5JU6A 1XLKA 1RBOB 1V8EA 3OLEA 3SRKA 1NOFA 1J5SA 4V27A 4MGGA 2PDCA 4AWSA 4IISA 1TVLA 3SCTA 2X0YA 4E2DA 1JI2A 2A79A 3OB8A 1H11A 1TMLA 4KFPA 7CGTA 4K7YA 1R9XA 4XZIA 4KEUA 3LK6A 3DOPA 1EJRC 5EA9A 1DEDA 4XBSA 2WMGA 1KC7A 2QVHA 2O9PA 1X7FA 3ARTA 4GINA 3EB4A 3ENLA 2C1GA 1CGUA 2PTDA 5G1MA 1SO5A 4BK9A 2V0TA 1V79A 2G8ZA 2Z6IA 3BQ5A 3BSGA 4GVHA 3B40A 1XXXA 1C91A 1GGOA 3PTDA 1C9DA 2P0OA 1Q5MA 3RPDA 5A6BA 1JZ6A 1LCOA 3VOHA 5EBUA 3I7SA 3A12A 3W1TA 1FDJA 2QMJA 3W38A 5CPQA 3BANA 3WYZA 4C6JA 1WOBA 4PUJA 1BYAA 2FDMA 1F8MA 2BSLA 3L2LA 1JRCA 4LRSA 4W85A 4UTIA 1S3TC 1O5XA 1OFRA 3PBYA 1WXYA 4IF2A 3N4EA 2OU4A 1UP3A 1A4LA 3MTWA 3T2QA 3CMFA 3NDOA 3FSTA 3VIJA 3R1ZA 1NIUA 2WOQA 1U5HA 4U3AA 3TAOA 5AZ0A 3W7RA 3MWCA 2NQ9A 4ATLA 1PXGA 2JQXA 1SZRA 4IUGA 4RNIA 3UXKA 5HMFA 1ZCCA 2UY3A 1LUCB 3HZ3A 2EG7A 3KCLA 2CZVA 3DU0A 4AXKA 1PE1A 2NZLA 4NRSA 3QW3A 4FALA 2F9RA 4G9PA 4LVBA 1WOAA 5J5RA 2X1TA 2I56A 1WZKA 3LRMA 4DI8A 4OTKA 2FTWA 1O4UA 2BS9A 3MUXA 4M29A 4TU1A 3TK7A 3GH5A 4NUWA 4PB4A 3W86A 1Y5WA 4B2DA 4AZBA 1JPMA 3P74A 1MEIA 3U0HA 2JALA 3BV7A 2QJGA 4HKPA 4OQVA 2ZWYA 5CBJA 1NWUA 5KETA 4U5KA 3VGEA 1K9EA 2ZZ6A 3UR5A 2YOCA 1VFLA 2OEMA 3BCFA 4ZO8A 1EEPA 4YHEA 4JYEA 3MUAA 1CW2A 3EMCA 3EBVA 2FZBA 5CLWA 1N2VA 1IWPA 3QZEA 1Y0EA 5I02A 3AS0A 4GH3A 3QW4B 1THFD 2ZE3A 1R85A 5CJNA 4C90A 4HA4A 2NQ5A 5EMYA 3P60A 3PB0A 4CCDA 3O8AA 1UWAA 3S5ZA 3THCA 3O6DA 1AUSL 4ZOCA 1V3JA 3MU7A 3UJFA 1P0DA 4PEKA 1EUAA 5AYYA 1XW8A 3MO7A 2GDQA 5K9CA 2PDUA 3R0UA 4HPGA 4JTTA 1JUEA 4XX6A 3IJIA 3II1A 4MAVA 1HL2A 2XH4A 7TAAA 1WXJA 3NSMA 3E2QA 2XN0A 4FIQA 1RH9A 1V0MA 3SZ8A 1ZS2A 4YTTA 3H2NA 4GYFA 2I9UA 2VDGA 2ESCA 1XLHA 2ZXAA 3IK2A 3TOYA 1MFUA 1R38A 4Z2IA 2GGJA 5BMWA 1ZBKA 3MDUA 4QXIA 1AVAA 3ITOA 2GQ9A 3UGVA 3NQ7A 3P3BA 3GVQA 1QUMA 3WX7A 4FNSA 3UXIA 1H0GA 3LCFA 3ZIZA 3HBLA 2E77A 3S46A 3QYQA 4K7VA 3CO4A 3NTYA 2EPHA 2RDTA 4LX4A 3WY1A 3EX3A 2D2JA 3EAUA 3QJAA 4NU7A 1RJPA 4Y9PA 1UR1A 1XIHA 7PTDA 1OM0A 3BWWA 2OGJA 2VVNA 2YBVA 1QBAA 4J28A 4AISA 2D0HA 3TWBA 3GC5A 1XIDA 2NQZA 1EGZA 4C6MA 4C1LA 3AYTA 3NM1A 5KINA 1AH4A 1GZJA 3N18A 3KRZA 4K37A 4HK6A 1Q13A 1HJSA 1D3GA 1ZL1A 1V77A 4D8LA 5C70A 2YW3A 3IAQA 3DZ1A 3P8IA 1DXIA 3BGGA 3VD3A 2WPGA 4B9ZA 1UWUA 4HPHA 3W7KA 3CK5A 6TIMA 3TW7A 2PDPA 1RAKA 3P0XA 3SUSA 3A9IA 1EXPA 2ZC1A 1HJUA 3AZSA 1K8CA 4K1GA 2O55A 1GPFA 3WD4A 2REQA 2Y24A 4LNYA 3VIMA 4UZUA 4MZ1A 1BG9A 3WLTA 1AQ0A 3L65A 1V3KA 3FXYA 1W3KA 2OQYA 3EA3A 4H2HA 1XDMA 3VNMA 5A2BA 2EQDA 3NO5A 1RCOB 4O50A 3FLUA 1R2TA 4IMCA 3LPGA 2DUXA 4AZCA 3UNDA 1CXKA 1L6YA 2ZE0A 3ARQA 1V02A 1L8PA 1Q4WA 2R24A 2ZUVA 4GFIA 5BOEA 4V1YA 2HNEA 5HDRA 1OFAA 1JD9A 4H7CA 3WD0A 3C0QA 1XINA 3OLIA 1E71M 3OODA 2P5NA 1SFTA 3M4HA 4ZFMA 3F4VA 4WX2A 4M7TA 3M0ZA 4OBTA 1E6XM 4JEQA 1UUMA 1H49A 3UY7A 3W1QA 1D3HA 3LX9A 2AMXA 4URIA 2BVDA 1GKQA 1I0BA 3MYPA 1VEOA 4DO6A 2RDUA 3K4WA 3TJ4A 4B5VA 1Z8AA 3LPOA 5D2YA 3LHVA 1RALA 1EJVC 3VGGA 1EEXA 3E0WA 1GVYA 4QG9A 3EXRA 3S5NA 1YE4A 2F2HA 4IMDA 3CHFA 1RK5A 2QCNA 3GIYA 4LCQA 1OD8A 1NWRA 2VT0A 3ES7A 4HD5A 3U2CA 2JGYA 3HGJA 1N82A 3WK1A 3WLIA 5CSSA 1REQB 1CXEA 2HV5A 1FA2A 2B81A 1A4MA 2H3DA 1J2BA 1HIZA 4M1RA 4LVFA 1FCVA 3W76A 4EXAA 3RJXA 2FZDA 4ZEPA 4QDPA 4PE8A 2JBMA 2EEXA 3WFLA 4WXYA 4LS1A 2WK2A 4EX4A 4J3UA 3GDRA 3R11A 2YCLB 5DRCA 4G56A 2B0MA 2G97A 1HJWA 4NILA 2YBUA 1W3NA 4FNRA 4ADSA 2VC5A 1ONRA 4O53A 3S1GA 4Y96A 2GVYA 1XLDA 1WA3A 2XH0A 2X1UA 1PSCA 3GVRA 4BQ5A 1PAMA 4WHBA 2Y8VA 4UR8A 2R8WA 4F9JA 3W70A 1BRLB 3AHVA 3WNPA 1B0IA 2DPEA 4NL1A 3VMOA 3W2MA 4RL3A 2INFA 5H6HA 3VD9A 1PZ3A 1XF0A 1FH9A 4IIGA 4DO4A 5F4SA 4XUGA 1GG1A 1VBGA 4AZIA 1JZ4A 2XH7A 4XAPA 1FP9A 4L1GA 3TNOA 1I0DA 4JTLA 5SWUA 3GQYA 2AMGA 2GGGA 1I4NA 2VJXA 3LNMA 4LU0A 1F4AA 2YCIX 3QMRA 2FB2A 4ORMA 4RE2A 1KD0A 1OF6A 1OVDA 3WLLA 5HJYA 1Q6RA 5HR7A 3JRKA 4WZHA 2J8TA 2G3IA 2PDFA 2J9ZA 2VZTA 1ML1A 4UFIA 3GU2A 3LLXA 1FWJC 5J5DA 1U22A 5DXYA 1YYAA 3QN3A 2YZ5A 2BGQA 5DF0A 1TWDA 2HBXA 3THAA 2R1MA 3VIIA 4WKHA 3HOJA 2XZ9A 4UQCA 4CD7A 5H1WA 2V3EA 1W9VA 2OZ3A 4IX0A 1GOIA 3QY6A 3WBEA 4JY8A 2BNJA 3BZGA 1OFQA 3VCNA 1RA0A 1CX9A 3EXTA 4TTUA 6PTDA 1O1HA 3N6HA 3T07A 1W1ZA 3W74A 5E09A 1B3WA 1EPVA 2GOUA 3FW6A 4JN7A 4WY0B 5EL1A 2UY2A 3QGAC 3QH2A 3O6AA 4G5DA 1XS2A 5JBDA 2YIHA 2PWVA 4HHHA 2VGIA 3JZEA 1RPXA 2E25A 2Y89A 2DZSA 4L4OA 1A53A 3W75A 3MCMA 4C6FA 3RMJA 3BO9A 4EPBC 2PGEA 1ISVA 1GWJA 3A64A 5TD4A 1XBZA 4IX2A 3STEA 5K2ZA 2GQAA 3SURA 4DY1A 2QV5A 4F0HA 1V51A 3CZLA 1ZP4A 3H53A 3DBPA 4M6PA 1Q4NX 5DY3A 3FFSA 1BXBA 2P1FA 2C16A 1XH1A 2RFGA 4S3DA 5EKYA 3NWRA 4WSJA 4DLMA 4Y9MA 4TX8A 1DTUA 1IHIA 4O8AA 2NUYA 1Q6CA 2CKSA 4DLFA 3GY1A 4IIDA 4IQLA 1ZJHA 3PAJA 4XZHA 3B8SA 1PO9A 4AEFA 1EIBA 1F8IA 1WAWA 3OLGA 4K68A 4DVOA 1S2TA 3CLMA 1B3XA 4PMZA 5CZ0A 3QQ1A 3EWXA 1Q8AA 2OSXA 2GVEA 3AMCA 1FCBA 2VGGA 3W22A 1ONXA 3W1LA 4YTUA 1CZ1A 1W5PA 1GNXA 3RR1A 3W7JA 5D9MA 1KFLA 1UC4A 4AVOA 3N9KA 1HUVA 2VL4A 5FI8A 3N3TA 1GVFA 1I1XA 1LLOA 1WDDA 2ISWA 4LJ3A 4H9UA 4C60A 1UA3A 1CT5A 1SFSA 4W84A 3PG9A 4DWSA 4F2TA 3V35A 1KFWA 3LTPA 3OGSA 1DIEA 5C54A 4MZYA 2VD8A 2HZGA 3TYZA 3AIQA 2PC8A 5LIUX 5BW6A 1XP3A 4ML9A 3N4AA 3M0MA 1ZGDA 1OYAA 3A47A 2DZPA 3IJDA 3I68A 1YKWA 4JPGA 2NV9A 3PZQA 3W27A 1JCXA 2J75A 1EWEA 3QSTA 3GHUA 4ACZA 4KEMA 5A2CA 4H6QA 3R94A 3B3DA 5D2XA 1TV3A 3AI0A 4KETA 3K30A 4UTTA 3RX3A 1RVGA 2YR1A 1VBJA 6TAAA 1R2RA 2HE5A 4UNKA 4XWUA 3U2OA 1KM6A 3ZT5A 3P67A 1VFTA 3S1XA 4JKKA 1TZ9A 2PD5A 3S3GA 4GQQA 4LYKA 3V18A 3UNTA 2VRKA 5LA2A 3W6YA 3EWDA 1YX1A 3M44A 2VEGA 3PZTA 4HA1A 3PAOA 1B9BA 4CD5A 1M01A 1I8JA 6A3HA 2CETA 4X9YA 4LCRA 4KH2A 3GKAA 2Z1WA 4AMAA 5DCEA 3W83A 4PRRA 4HSOA 4PYSA 4MJZA 1J79A 1XSKA 3EOSA 3H2FA 3S8HA 5F4WA 2V3DA 1EH9A 4G7EA 1E51A 1L2UA 3WDIA 3NM3A 5E9AA 6ALDA 3RYSA 1CECA 4K39A 1VFFA 2EF9A 1TWIA 3ATYA 3P7YA 1WKEA 3T0AA 1LT8A 1N55A 1XSJA 2FJKA 3L4YA 4O52A 4S3BA 4M6UA 1PKNA 4Y7EA 1XGZA 3E5BA 1CB7B 4TV5A 3WNMA 1PWMA 3AS2A 2VYOA 4S3KA 1F2JA 4FXFA 4LPCA 1XUZA 1VBHA 4EF8A 1UBSA 4F0MA 5T8GA 3CUZA 3GVWA 3P14A 1GKPA 2R9RA 2OYMA 5TQLA 2VFDA 3R10A 1SZGA 4PMNA 2VR4A 4NF7A 3WBWA 2VUYA 3PPCA 5A8PA 3T0BA 3O1NA 1POKA 3NL3A 1ZTVA 2QUNA 4XBKA 3FYPA 4PUKA 4UMBA 1TTPA 4DUVA 4A21A 3TROA 5DCBA 2EPNA 2GGEA 4C6PA 1VP5A 2WNZA 2ZADA 3GTIA 1CPUA 3MQTA 1UMLA 3ZYZA 2GL5A 2IXUA 2VX4A 1UG6A 3GXMA 1A5UA 2C79A 2NXHA 1CDGA 5BRQA 4NY2A 4NZCA 1FWBC 2ALRA 3C2VA 5MKGB 3M0YA 2NSOA 2H9AA 1PCWA 3TQPA 1W1PA 4TO8A 4NASA 4UBPC 5E9XA 4A3QA 2AAAA 2WMJA 4NZ1A 4K8GA 4XTIA 3CHEA 3T2PA 2XSAA 4RPPA 4MWAA 1E1CB 3QC0A 5CC6A 4JGDA 4DJDD 2RKXA 1PKMA 5A6KA 2J7FA 4JYFA 4GY1A 4QFUA 3L4ZA 2J13A 1XD1A 4HJFA 4JHMA 2Y7EA 2EXOA 5JBEA 1P0NA 3TTOA 3W1NA 2GWGA 3PG8A 3VFCA 3KTCA 1QK0A 2A3AA 4D6EA 2NLIA 5HA7A 1M04A 4BI6A 4ERIA 5D03A 3TN5A 4LVAA 1JEZA 2WNQA 3TR2A 3ANYA 5DXXA 3DH7A 2DUAA 3S1UA 3WQEA 4YTRA 3A4XA 1JFHA 4E6MA 4A3UA 4ZQPA 1ZNNA 4CQAA 4IQJA 3CXOA 4RXGA 2OLAA 1LQ2A 3HURA 5FOOA 3CZEA 5HATA 3N19B 1TG7A 1HXJA 2V69A 4XAFA 2MUCA 2NW0A 2FZ8A 4Q8UA 1PPIA 1EXBA 1EP2A 1EJWC 2X1IA 3SUWA 1GHRA 1F6PA 1KCLA 2CIPA 1CB2A 1ISYA 1H1NA 2HJPA 2FGBA 5T91A 1JDAA 1JL8A 2RJGA 1V0LA 3B97A 5I6SA 1JF6A 4LUIA 2D2GA 3IK4A 3GM8A 3MDWA 1UR8A 2WNWA 5AFDA 2DZUA 2BVTA 3MSRA 3KBSA 1IT7A 2YA0A 1VIZA 3G0SA 2Y5JA 3VAVA 3WFZA 1E40A 2WHLA 4TVUA 3REQB 3KCOA 2DH2A 3CM4A 2J62A 3CEPA 4OUIA 4RDVA 4YTQA 1IV8A 4H6KA 5PTDA 1A49A 3EX6A 2EPKX 4GUGA 5HWJA 2DQWA 4YIWA 2PP1A 3KOYA 1R7AA 1A5NC 3R8HA 4JD4A 1W3LA 4DM1A 2CLEA 3BLKA 3V3WA 2F8QA 1ZPTA 5HK4A 5JVLA 3THQA 4JEJA 2ATSA 5ECVA 2BV9A 3O7UA 3TQ0A 4U2ZA 2CW6A 4PH6A 5CJ5A 4Q7BA 5FCZA 1WP6A 2J9YA 1JQVA 2EJ1A 3FKRA 2E0PA 2O9OA 2A6LA 4RNJA 1X38A 5FJTA 5LSMA 4TX6A 4U4MA 1BD0A 1SJBA 4AX7A 1NFPA 2BOGX 3O0FA 3T08A 1H5YA 5HNUA 4HPJA 3MV01 5FEWA 3STCA 4HZ8A 4PZVA 2ZZ1A 5D37A 4QR6A 3W7DA 4QITA 2A6NA 1QHOA 5CKSA 2WZHA 4WJ8A 2FTPA 2PTYA 3SQMA 4PSRA 1V5XA 3DGBA 2Y88A 3M0XA 3TZFA 3VKDA 6XIMA 3R8GA 1A47A 1KM5A 1UA7A 4XZLX 3ITGA 3IVTA 4O10A 1JRBA 3QHNA 4DJFD 2PP0A 3TIMA 1GJUA 3D6NA 2WKLA 4F2UA 1RZMA 4O57A 4QE1A 1JI1A 3MZ2A 4MWAE 3VNJA 4AUBA 1W2PA 1PZ2A 1VRXA 5BXRA 1XR2A 1JF5A 1VCFA 3FVMA 1JCJA 1QOQA 2BB0A 1H5VA 4S3FA 1ZAHA 4RNFA 4GNVA 2V5DA 4QG6A 3L7RA 3PSWA 3E2SA 4MJ2A 4O54A 4D1JA 1O12A 2ATMA 1CLXA 5D32A 2HVNA 4GIRA 4FS9A 3CBWA 1F5ZA 1V6VA 2DZWA 3GG8A 1ZBCA 4ZZ9A 4JDYA 2V2HA 3W7GA 1GT8A 1I2NA 1UZ1A 4R7WA 1WBJA 3SCRA 2H3BA 4J3WA 3GNNA 3VABA 1DJYA 3DFPA 4J40A 1B3OA 2DSWA 4O1AA 3E38A 3WQPA 1PZ0A 3E6EA 1UHVA 2GUUA 4L64A 3VFLA 2OWCA 2PF0A 5U4NA 3BTNA 1S2UA 3PPHA 1B3YA 3QGVA 1D8WA 2WHJA 2Q8XA 3W9ZA 5IBXC 4W4QA 5BCAA 1OK6A 2FZ9A 1YPXA 2BDQA 3ITLA 4NXSA 5DRIA 3L4UA 2YFOA 2D2HA 4O0QA 2NT1A 1DP0A 2DVTA 3W2JA 3KOXA 4U33A 1TJ1A 2P88A 2QJMA 1SJCA 3UZXA 1AZ1A 5JBFA 3KS5A 4XSMA 3UFYA 2ACRA 3LEPA 2AGTA 5EYWA 1E43A 2W62A 3R4IA 5BRPA 1TJ2A 1QOPA 3GXIA 3QV9A 4RZ5A 5B80A 4ZTYA 2PWHA 4HTYA 1KGWA 1FHUA 3N04A 3TU9A 2XUCA 1EHAA 5C2XA 3LU2A 1LZOA 1MNSA 5I03A 1HN1A 4M51A 1FWSA 1Q2SA 4JOMA 3WIJA 4LRTA 4OOUA 5C9UA 2L5HA 3FYYA 1EX1A 1VFSA 2VVSA 3RX2A 1E5NA 4N9DA 3ABRA 5A69A 1LRNA 3RILA 1Q6QA 1IXOA 4WXZA 4IHCA 1Q6OA 3UWUA 3HFYA 1GUVA 1ZU8A 3DFQA 3SRFA 3NSNA 1RK6A 4ZVJA 2WCGA 4F0LA 4IXXA 1XRTA 4NNAA 4DYEA 2VEMA 4P7LA 4RW5A 2Z1XA 1FWRA 3GR7A 3HM7A 4LUTB 2GSHA 5C0QA 4KMQA 3GXTA 2RUSA 4NJKA 3MSGA 4DELA 2V30A 3CV7A 5E6YA 3L67A 3N12A 4AH7A 3S1WA 3CL7A 1JDDA 3GUGA 1TV5A 3WK3A 2O9RA 3GTHA 2VCAA 4YYCA 3DBNA 3WF4A 4C6DA 3FSUA 1LRQA 3VVGA 3VDBA 3A6OA 3CAKA 3T8QA 3BW4A 2OXNA 1LLZA 5FF7A 2CLMA 2QVNA 2DH3A 4BQ3A 1WZAA 2ZCGA 2EPOA 3LPFA 5BYWA 2V63A 5A6AA 3ARXA 4H8HA 4WRHA 1XFBA 2NQLA 3E74A 3WUBA 1TIMA 2I5IA 4DF2A 3VOGA 1AQMA 5DEZA 3L2MA 4WJXA 5I24A 4CEXC 1MO0A 2V8ZA 4GKLA 3WLJA 4E8DA 1NJJA 3RU8X 4NT0A 3CO8A 3SAZA 5J04A 4BF5A 4LY8A 4IP5A 2GUBA 3MCNA 4IOTA 1TUFA 2ZDRA 4F8XA 3ERPA 1AA1B 3WH7A 2DIKA 5BXSA 4CCCA 3LS9A 3LBOA 2DZVA 1WV2A 2D1ZA 4HCHA 1UWRA 3DYMA 1RQBA 2IQTA 4TR9A 2V5JA 4AWUA 4ML4A 1LT7A 5A8QA 3C0LA 1Z89A 1DJNA 1Q7ZA 4JNZA 3EOLA 3GVVA 1L6SA 1HG3A 5IDZA 2A21A 3SCNA 2QDEA 3WFAA 1ZHAA 3CTLA 1Q66A 4U2YA 1EGVA 3CMJA 5CC5A 1RPKA 1PTDA 2O0TA 2YGYA 2FPTA 2VD9A 2ZX5A 1G1YA 4WR3A 3AICA 3NVDA 4HYRA 2QGHA 2XN2A 3AYRA 5CPTA 2PI6A 4I9TA 3IRDA 3LHYA 4TMBA 4JIQA 3O16A 2ACQA 4WOZA 3DYOA 1RBAA 1OX4B 1AODA 3DKLA 4A8NA 3UVIA 1XKJA 2OSWA 3MP5A 3VI2A 3ZJ7A 4ICNA 4NKCA 2E9LA 1C92A 3H6OA 2IS7A 1FKWA 3QZAA 3BXWA 3AAMA 4I5UA 4KCUA 3NQMA 4RPQA 1E0XA 1OD0A 2DSUA 4I7WA 3V36A 4PMDA 3W23A 3K1GA 4FMVA 2FGZA 4X63A 1W1TA 3OG3A 3UPWA 1I75A 3UZWA 4ONVA 2PDYA 3C5QA 5E6ZA 2PD9A 5D38A 3B4YA 5B7ZA 3BC9A 5A6MA 1AD1A 1L9WA 3BOXA 2QF8A 5G1YA 4HMDA 1E4MM 3U5YA 3GUWA 4MNMA 3KVLA 2VZSA 1LROA 1WDWA 1O66A 3GAKA 4GXMA 4X0VA 4YTSA 1OZQA 4LBRA 1K03A 2B31A 2X41A 3OGRA 5TAOA 1K4GA 3ZXWA 3G1AA 3BG9A 2BWGA 4NX0A 2YCEA 1V6UA 4D71A 4XG1A 5FESA 3K4DA 3S83A 4AEOA 2J78A 3AXXA 4KGJA 5A8OA 2A2IA 1NU5A 2OG9A 1QNPA 4HZ6A 1NH6A 5CXPA 3NZPA 3V75A 2QKFA 3QVQA 1PDYA 3BG3A 1VZWA 4ZFCA 1TPC1 4GIYA 2NVDA 3KAOA 3WMCA 3UT0A 4EACA 4UZSA 1BF2A 1V3IA 2Z26A 2PU0A 2GJPA 3WNOA 4FIRA 1X8CA 1QO2A 1F3EA 3UR8A 3LI0A 3HMCA 3S5YA 1FCQA 3PWIA 4GC3A 3KOFA 5A6TC 1E70M 5L9FA 3FJ6A 1AJ2A 4M82A 3V5CA 2ZZ2A 5FF0A 2W61A 2BLEA 1UKSA 3VD7A 2FLIA 3J7HA 4QQUA 1OY0A 1PIIA 1YXDA 1KXTA 1UWIA 4KRUA 4Q4RA 4ZO9A 2GGIA 2R91A 4UFMA 4R34A 4Q4SA 1AFSA 3ITCA 1BAGA 2XISA 4JS3A 5F2LA 2PTXA 3CS2A 1DKWA 1ONEA 3MP4A 1FWTA 5H8UA 5M2FX 2YXXA 3DYPA 1PCKA 2Y5EA 1H1ZA 1G6CA 3ZR4A 4OBSA 5A5WA 3W28A 1TJRA 3POCA 3FN9A 1XYMA 2IPWA 4N4PA 3ONBA 1UIPA 1Z6KA 1JYVA 3N15A 3IJ9A 1EDQA 3MV11 2A3BA 3G3MA 4FF5A 4AC1X 4GA8A 2BHUA 3SRDA 3IUIA 3TYDA 3N2OA 3EXSA 1E1FA 3BMVA 3G18A 1KRBC 1W56A 4MM1A 2F38A 1HKWA 5FJUA 4ZQNA 1G94A 3NVTA 3RLHA 3T09A 1CGXA 1S1PA 3B0PA 3BAJA 2HBVA 4HU3A 2VXNA 1NY1A 4FXSA 1IGWA 3L0NA 2C19A 2X0HA 1EP1A 2O56A 4UUIA 3PSVA 3AIVA 4B4FA 4J7RA 3V0SA 1BVNP 1CBGA 4L1WA 7XIMA 4C6LA 2WXDM 3FKKA 3WBXA 4FR6A 2WHKA 1WB0A 1QNQA 2E6AA 4S3GA 3HG4A 1J96A 1K6WA 4G2DA 4KKXA 4QM1A 4KEZA 3AIRA 3FDKA 4XVDA 4MB3A 3DHFA 4MWAC 5T26A 3QF0A 4KS0A 2QAPA 4G7FA 1HGWA 2QJHA 3DKJA 1E0WA 2V2DA 4YJ5A 4O16A 3F4DA 4QP0A 4FOKA 5HINA 2R82A 3WD1A 4V15A 4IFRA 1B54A 4JX4A 2ZRWA 3P93A 3KRUA 4IM4A 4DYKA 3GE7A 2Z25A 2YDQA 1EPXA 3DFHA 5D05A 3W7MA 3KBJA 4GI8A 1JGMA 4AIUA 2XM2A 1KNWA 3VU2A 2Y5SA 4C6KA 5CC3A 4ICMA 5CPSA 3EWWA 1QVBA 2CITA 1FXQA 3EWZA 5FSEC 5CH9A 2ABAA 3PVFA 1Q7MA 3GYEA 4QNWA 2XM1A 3UBPC 3ARPA 2QAFA 3EWYA 2PDHA 2I1OA 3BAXA 1EWDA 1LOQA 1UP2A 1VLWA 1SW3A 2A3CA 1FWNA 4DPQA 3IEBA 4D6GA 3W1PA 3PHAA 3CWNA 4MY9A 3S1VA 3BLIA 1SFLA 1BYCA 1GVSA 1TWWA 1TB3A 4LB3A 1QWGA 2WMIB 3OG2A 4OJYA 2Q8ZA 4DJEA 2YJQA 1P4CA 1P0KA 1XIGA 1EKOA 3RR4A 1B3VA 2P50A 1QWKA 2GDUA 3W85A 5FAJA 2W9MA 3EX1A 1FWAC 1K7FA 4W5UA 3HJEA 3ARUA 5AHFA 3EPOA 3WLSA 4HK7A 4GXWA 3LBCA 3BLFA 3K46A 4MFEA 3RRXA 3JZUA 1NWSA 1ZBWA 3VD5A 5A6BD 1T41A 1CGTA 1CLKA 3L4WA 3SJNA 1A5CA 4YL2A 5I3JA 1UH4A 4XZNX 3KBMA 4GCAA 4JIIX 1OC6A 1TELA 3HV9A 4O8RA 4R5EA 3O6CA 3TZNA 4GYPC 2WJEA 3WQCA 1XFCA 2PDKA 1DL3A 2E8ZA 1H2JA 4DNMA 2BASA 1O5RA 1TWSA 3I65A 1NWTA 4WSKA 3D5HA 2GJNA 3VGBA 1ZQ5A 4J27A 2FPVA 4PSPA 4US5D 3RU6A 5C9WA 4GE8A 8RUCA 3KWSA 3SUTA 4NAFA 4NSBA 4YYFA 3P84A 3A3WA 4IPNB 3TJLA 4LNCA 2X7VA 3IGUA 4W9TA 3T2OA 4AHQA 3WNLA 4R7JA 5G2HA 1Z32X 3AC0A 2ZZ3A 1JPDX 4GYKA 4GQBA 1SPQA 5F7UA 2IUZA 1P0EA 1GJWA 3ONCA 4HNNA 2ZRVA 3C2EA 4FI4A 3UWVA 2ICSA 2C18A 4ROPA 3H24A 1JPHA 5D04C 3OOQA 3W88A 2YSWA 4JKLA 2UY4A 3W26A 2PDIA 4O13A 1ZAIA 2FHBA 3KTSA 3VA8A 2EGZA 4UQEA 1GQKA 2AQWA 3ABXA 4PMQA 5I23A 4EWJA 3EOEA 2VHLA 3B05A 2G5WA 3BK0A 4PBEA 5K9XA 1J11A 4AZCB 2CXEA 2POTA 1E3XA 3BDKA 1I1WA 1DHPA 2X40A 1GG0A 3N14A 4JCMA 1K6AA 1VYSX 2NUXA 3N2MA 2G3FA 2QV4A 2VGFA 3FVDA 3FEMA 3WH5A 1SO4A 1L6WA 1KTCA 5GVJA 3WQ8A 4O1DA 5ABTA 4CKQA 2QCCA 3W1UA 3C2YA 3PTMA 3WH8A 2DVXA 2W6RA 3STGA 1YADA 3NQGA 2E1WA 1TV8A 4RKAA 5DBUA 4LAUA 4DPPA 1ZBVA 4JTDA 3CUJA 1RXOB 4O1FA 1QPRA 4H3DA 4JQAA 1J5TA 5E0FA 1S5MA 1BF6A 4JTSA 1JUKA 1HKMA 2PTZA 4MB1A 3W6MA 3BAIA 4I90A 2G3JA 3NQ8A 3S9ZA 2J7CA 1LTDA 5EMKA 3RGTA 2OODA 1V7AA 1HL9A 1EA0A 4DBDA 2WBKA 4H2CA 1PYMA 1XIBA 5FL0A 3ARZA 1L6FA 1DOSA 5HWMA 3MWAA 4HMNA 4IXHA 3W6LA 4HK5A 1YBQA 1E0VA 4BEUA 4DNHA 4N6EA 3UCCA 1F3XA 1AJ0A 3LRKA 3PJXA 3GRIA 3QC3A 1UZ4A 4G8TA 4DIAA 1DPMA 5I3KA 2PLMA 3R7MA 2J7BA 3UU0A 2CHOA 3L4TA 4Y9AA 2GYIA 2NSXA 2D2OA 1KKRA 4QHRA 4A35A 2IKJA 1ADDA 3E2VA 4DN1A 1I2QA 2BXVA 3B9EA 4JCLA 3PS7A 2OLSA 3AXMA 1Z69A 4LGXA 2A1YA 3IGHX 3LPPA 1FX6A 1QT1A 4GUJA 3NZQA 4A8LA 3BAKA 3GR4A 4ERAA 5K7JA 2B7OA 1U5JA 3E9AA 3ABZA 2ZXQA 3LCGA 2VUNA 2QYGA 3VDHA 1KCKA 3UG5A 4AG0A 2DIEA 4WLCA 3MBFA 2Y4SA 1EC8A 5D02A 1NP2A 1XRVA 3CL8A 5CLTA 4KFOA 4ZOAA 1RP8A 4XZWA 1TSIA 3WBYA 3A9BA 3KRBA 4E8CA 4O17A 1PS9A 2ZRZA 1E6ZA 4PUMA 1D7FA 1WDSA 3G6MA 3NDZA 3OP2A 4MDPA 3NYZA 5BWAA 1O6IA 1W3HA 1ELSA 4PMOA 3SCVA 5EB8A 4KCVA 3QLDA 4LYPA 3P5ZA 3RK8A 4JXCA 4HA3A 2OEKA 1NARA 2VELA 2E3ZA 2QCGA 4NJGA 3URAA 3SADA 3G1HA 4NJHA 1WCGA 3P6LA 3R5EA 5ABGA 2QQ6A 3PPFA 4JFWA 4NYUA 1ZB5A 4GVFA 1W1B1 3UZ5A 2ZZ4A 5D09A 3G22A 4JQ4A 2XWEA 1K9TA 1G4EA 4JBRA 4H6EA 3H8AA 4TVDA 2D73A 1VBUA 4YU1A 3P62A 4PMXA 4UCGA 3B9OA 2WKJA 3NXFA 1HO1A 4CQ8A 2ANUA 1RY0A 1T5AA 3GO2A 3G1VA 4M5PA 1S5NA 3MBDA 2HVMA 5HOSA 1SMAA 3WL0A 3N17A 2YB1A 3IUDA 3W3OA 2GK1B 2OYKA 4W88A 1OK4A 2RHGA 4X61A 3HQ1A 1BWVA 1ZSXA 3U7BA 3R13A 1K70A 1DWJM 2Z2UA 2XIBA 3GH4A 3S5SA 2GDVA 4G1KA 4YHGA 1YPFA 1JULA 1XLFA 4Q8PA 5HNTA 3B8VA 3LCLA 2G50A 2DT1A 1FWEC 3F5JA 3VDCA 1VFOA 2BP1A 3NQCA 4NIRA 3SY5A 1U5VA 2HNHA 3DDMA 2D0FA 3BG5A 4XZBA 2PGFA 3W72A 1NTHA 3VKAA 3CH0A 5A8NA 4HNTA 3AWOA 4ECLA 1DXEA 3B0UX 4H8VA 3ZR6A 5ABFA 1IIHA 1UD5A 4DWDA 1UR3M 2F6XA 2VFIA 3OLDA 4MZ8A 1KKOA 3QM3A 3UERA 3CB3A 1KXVA 5AB3A 3C2OA 3R2GA 4HN4A 4CUCA 2V5KA 2CBJA 4IIFA 3NG3A 2WSPA 3H2MA 4GO8A 3TSMA 2GLKA 5I78A 4Z17A 2BG5A 2VCBA 4O11A 3U3HA 2XIJA 3E49A 3MHFA 4BFAA 3FY1A 3H2AA 2WVUA 1LWJA 3AXKA 3APTA 1QHPA 2VC7A 1TO3A 4PB3A 1SW0A 4MOZA 1FFRA 2GUYA 3URNA 1CCWB 1UBPC 4KT2A 4DWSB 2VEKA 4GJ1A 5G5IA 4U31A 4MFDA 2QIIA 3XINA 1MEHA 3MP3A 5ENLA 5CPNA 1CLVA 4PBGA 1YTKA 3CV1A 1J4EA 5ABEA 3PWGA 4J3ZA 3TN3A 4RDYA 3NO1A 7TIMA 4LUTA 4N9EA 1OQFA 5FF4A 3WQGA 2YA1A 2BOFX 1YEYA 3V1HA 3QGKC 2X8RA 3VNDA 1GVEA 4TVCA 1MZHA 4HCDA 1FUYA 2X1RA 2NX9A 1E3ZA 4ACZB 2PUZA 1HFBA 2Q02A 1W9PA 3MHGA 1DXFA 3UXAA 3T0CA 4UTHA 1B31A 4CEUC 3ZWSA 3OGVA 2Y7GA 4AHOA 4P2VA 1GONA 1UOZA 3PZIA 3DHPA 4EOUA 3QV8A 1RQHA 3SR7A 1VEMA 1UYQA 1T7LA 2NX3A 2V6AA 4LW7A 3AWNA 1GOMA 4JTFA 2J7HA 4CQDA 2HTMA 2V5CA 1KGUA 4PEEA 4ZTXA 3NPUA 4GHRA 3EPMA 3FJLA 1WKYA 1A3WA 3MVTA 5HULA 4H9ZA 1QMLA 3CV6A 1RSCA 3IIOA 2B7QA 2CKRA 4B92A 4ZL1A 4G7EB 3GKFA 1OCBA 3GG0A 3W87A 3QLLA 1H41A 1P5BA 3IV8A 3NQBA 4XQ6A 2PRHA 2V9DA 3BLPX 4V2XA 1RQEA 3WQVA 4LOCA 1AH0A 1HJQA 3M47A 1X1OA 1EFZA 4BA0A 3MHUA 4JAWA 4HNOA 4RX0A 2ZX6A 4Z1CA 4GZ7A 1TMHA 3A4JA 3FHQA 1YLVA 2PE4A 2C7FA 5DLCA 3FDGA 3F5LA 1JXJA 2Y1HA 1T99A 2C14A 4PTVA 1Y8BA 1YE6A 2BXYA 3B8UA 1XISA 2WNNA 2ONEA 5EFFA 1ICQA 3ZO9A 5DCDA 3WCZA 3MSDA 1KFEA 4AYGA 1JIBA 4J4KA 3N3MA 1W54A 1ZAJA 1FWFC 4HN8A 2A4AA 4HHLA 5AC5A 2J24A 2QCLA 4X2RA 2P0IA 4QCFA 4I3GA 2GJXB 1TYGA 4B5UA 3K8LA 2ISDA 1H7WA 5AYZA 2H9AB 1VH7A 4GCXA 4LVGA 2Y70A 1KXHA 1BSLA 5D9OA 1EZ2A 1QASA 3CQ0A 3TEVA 5HQMA 1R30A 2JKAA 3UPBA 5D30A 1ICSA 1J18A 3SFKA 1L2QA 2QJNA 1SZEA 3KHJA 3WL1A 5IHSA 2AKZA 1KBLA 2E67A 2OX1A 4MWAB 3M0VA 1V6YA 5D9NA 3DG3A 1W17A 2NV2A 4PFHA 2FH6A 3A4WA 1OX5A 3LENA 2PZ0A 1L0PA 1IT8A 2GSJA 4RV8A 4LUJA 1W1A1 1CXHA 1XC4A 3UETA 5LGZA 2XPKA 1T8QA 3LZ3A 4Q32A 4DWSD 3BV4A 2J6XA 3AXHA 1UKOA 3UA3A 3WK2A 2RJHA 3BSMA 1AQFA 1OX6A 2P8BA 4AZHA 1YTDA 4DXVA 1Z3NA 3GDBA 3RN6A 4CVWA 3VNYA 2PGRA 3W2UA 3AO0A 3P81A 3E0VA 1FQ0A 5BNKA 2HXUA 2I17A 2OO0A 1O1ZA 2NXIA 2Y6ZA 1R86A 5D2TA 3S2NA 5FEZA 4GFSA 3OZPA 4FX8A 5HUOA 1OHLA 3WQ4A 1EO7A 3HPZA 3G1RA 1HQTA 3MMWA 1XQKA 3W7PA 4ZODA 1IEXA 2Z4GA 2X7WA 1JUBA 4CNNA 5EMLA 3BOLA 1OCNA 1PWLA 4Q8NA 4IMGA 1VENA 1A50A 7REQA 4AZ7A 3PBMA 4B3ZA 3ZOAA 3GDTA 3PTKA 2WSYA 4U3CA 3QEZA 4M81A 4KWSA 2TAAA 5AC4A 3H2EA 1Z9AA 4DYJA 3B8WA 1OG0A 2CERA 1X1NA 4L1XA 4UNLA 3NJ3A 1I2RA 1JD7A 2J27A 3WENA 5LA0A 4JFUA 5LZLA 3SI9A 4UFJA 4UWMA 4DJEC 2J77A 4MJ4A 1GJPA 2ZC8A 4PCPA 2X2YA 1UQYA 1XD0A 1MQRA 2G4FA 3EKLA 3AHXA 3CLWA 4N42A 4A8RA 5DFAA 1RR2A 5I7GA 4EIVA 1F05A 3AUJA 4B15A 4GVIA 3GIPA 1EHNA 2JGQA 1EZWA 3O2LA 4UTMA 1WDQA 1WAUA 4FNTA 4C5YA 2WW5A 3TQVA 3AALA 3FGCA 1BLIA 3LN3A 4MB5A 5IXEA 4UCFA 3SGUA 2BTMA 4UTKA 4FNUA 3BJTA 4HSNA 1QHZA 3ZVIA 3HN3A 3LXCA 1T96A 3MYOA 3MVIA 4D6IA 3IPWA 1ITXA 4GPNA 4OV9A 2XDFA 2YLAA 4JTHA 2OKOA 2HE8A 3UJEA 1GEHA 5HQLA 4N9BA 3E0FA 3Q2DA 4J3SA 1BYDA 3PWAA 3KBNA 2EBNA 1NEYA 4FAMA 3W73A 5D2WA 1M7OA 2YW4A 1QCWA 4WKAA 3H21A 1UC5A 2WMHA 1AW2A 3NXLA 3LNPA 1IWBA 3B9DA 3ZJ6A 4IIBA 3NGJA 4PFMA 1S39A 5I3GA 1BGGA 2AL1A 3T40A 1AZ2A 1EQPA 4QX4A 2WQPA 1KBKA 4YN5A 5CBIA 1ITQA 5CEWA 4RZBA 4PA8A 3EOOA 3K5XA 4LS2A 1BQGA 2ZVIA 1C8VA 1E0TA 1TPDA 3QR3A 4AY7A 4ZO6A 2G4JA 2ZUSA 3THUA 2HK1A 4BJHA 4HHPA 3H2OA 3AMKA 1AD4A 1E6PA 1XX1A 4PL2A 9XIMA 4F48A 4MB4A 2MNRA 4Z1AA 1QAPA 4GI4A 2DW7A 4R27A 1MXDA 2ZA1A 3WQWA 2J9XA 4DHGA 5C2CA 1UMYA 4TX9A 3QMTA 1I2OA 3UPMA 4WVXA 1C90A 3KL3A 1SQ7A 3N2TA 1CYGA 3CAVA 2FVKA 3PB2A 5LGXA 1R3TA 4NXKA 4EXBA 3ARRA 4HGXA 1EA9C 3LB0A 2PWDA 3DI0A 3O3RA 1RCXB 2J66A 1SYTA 1T0OA 2XGBA 1BFNA 3N25A 2A7PA 4OU1A 1LM1A 4R7OA 1WNOA 4BY3A 2VRQA 2WBGA 2XIOA 2WC7A 2CLFA 1G0CA 4NI3A 4W8BA 1EC7A 4GC4A 3AFBA 1DWAM 4OKDA 3CGTA 3CWHA 1F7BA 1E73M 1H61A 1ZJIA 2TRSA 4B16A 3DFYA 4CCEA 4F79A 1BTMA 3BVJA 1KW1A 3HGSA 3GTNA 3FX4A 1TCDA 2Z7KA 2WM1A 1TTJA 4AD1A 1UPPA 2EHHA 1AW1A 5D9PA 4DI9A 2IKHA 1KR1A 4PCNA 3L5MA 1YTEA 2WMIA 4PRWA 5FEPA 4V28A 4WDXA 3OEXA 4JTCA 2PF8A 4MIMA 3LTSA 1W1VA 2OLHA 4DUWA 3COTA 1J0YA 5FJJA 3CU2A 1C93A 4C6CA 4NX5A 3M16A 4XBJA 1E6RA 3UJRA 2Z00A 3VZXA 4FLOA 3HGRA 2ZDSA 3VOJA 5C2GA 4YNGA 3SCPA 2XFFA 4I6KA 1QBBA 5H8PA 4JTAA 1W9DM 5KZEA 3OHMB 4JN6A 1V6TA 2DFAA 1MEWA 3NPVA 4PTNA 3UCDA 1ECQA 3QHOA 2PPGA 2NUWA 1SSDA 5EMJA 1NVMA 5AZ1A 3MMTA 7A3HA 2D24A 3LXAA 5FD0A 4BZYA 2AL2A 1WUFA 1UD2A 2DT2A 4B91A 1ZENA 1OG6A 3W71A 1MW0A 1HVXA 1YDVA 4CCZA 4QAIA 1W8GA 2PBGA 2ZZ5A 3FA3A 3W2NA 2XGZA 4FLSA 3IGXA 4C7FA 4AEEA 3TOPA 4QS5A 3W2LA 4HT3A 3M6DA 3SBFA 2FHFA 1V3HA 3P5YA 3ALGA 1KO0A 3G0XA 1XIFA 4CGTA 2Q71A 4O4VA 2IXVA 2Q3RA 3SSZA 4S3EA 1BXCA 2PEVA 1LWHA 2WVTA 2VQUA 1H7RA 1TV7A 3FA5A 3W24A 3CASA 5C55A 3UA4A 1JNEA 4ATWA 3PFRA 3N34A 4D72A 5EY5A 5K3VA 1TREA 3VUSA 2VOTA 3SECA 3GIQA 3CMGA 1KB3A 2BBFA 3TLQA 4WKFA 3VX1A 3OIHA 4BI5A 1M65A 3I6EA 3THDA 2OCZA 2C6QA 3CH9A 4AF0A 4JNYA 1I9CB 6REQA 2VZVA 1QI3A 3T55A 1RD5A 4Z0SA 2EG6A 3ZLHA 2ISFA 3SFWA 4NZ3A 1CXFA 5A6LA 3IVSA 3C2FA 1TUXA 1V93A 3H7UA 2PLCA 4MNJA 4P61A 4HOWA 3ATZA 4B3KA 5FF3A 3FS2A 3HMJG 4M1BA 4AWTA 4C5ZA 5KITA 1SFJA 2QDGA 3FHAA 4E4FA 3ABOA 3TAKA 4O4WA 1GHSA 2HDJA 4GJJA 4W93A 2QUTA 4MUPA 4QJ1A 2DZXA 2QCDA 1B90A 2IQDA 3STPA 5A3HA 4L7ZA 4I9JA 1HJXA 3N2XA 1KV5A 5IBXA 4IP4A 4EAMA 3HU7A 1SZNA 2VURA 4X9SA 3TUUA 1XDJA 5AOUA 1IXNA 2YZRA 2QT3A 4CQCA 4UNIA 5HAOA 3WNNA 2VEFA 1TPH1 2AQVA 4IGNA 3VILA 3RIKA 2ZTKA 3PJUA 3M0HA 4GUFA 2WVVA 4H00A 4F0RA 1WDPA 4HU4A 4EXQA 2WVSA 3A22A 1SMDA 1WX0A 3PZUA 4HHMA 3S9YA 3IRSA 5J8LA 5JH1A 3IIZA 2O4QA 3I4KA 3TQKA 3I6RA 3B0YA 1H62A 4DUXA 3AIUA 2OJPA 2PRMA 1VF8A 3VGFA 1DJGA 5AYBA 2DVUA 3KVJA 1Q7QA 1ZLPA 3V16A 4Q6JA 1E4IA 4LSBA 3NQAA 5LIKX 4EWND 1IEVA 1DJIA 4EAYA 3D0CA 3ARVA 3HPFA 8XIMA 1PIFA 3FK4A 3O6YX 3ARSA 2QCEA 3ARYA 4EVZA 3TDFA 3B4UA 1EJTC 3NEVA 2TSYA 1ZJAA 3P82A 4FPSA 5M3WA 3PR2A 3QTGA 2HWGA 4XISA 3VC6A 2BGNE 2ZIDA 2ZUNA 1L8NA 2HISA 1E9LA 5LKYA 4Q8TA 3IACA 1FHVA 2VMFA 1IXQA 2OWWA 4DRSA 5AHLA 4EE9A 1N7KA 2V82A 4QCEA 3F7JA 4GX8A 1W2VA 2G3NA 4PMRA 2J74A 5G4WA 5DBTA 3HPSA 2C1IA 4BWLA 1M03A 2LLEA 5CQ1A 5I3FA 2VTFA 3P2VA 4RZ6A 1ME7A 4WD0A 1E72M 3NQ2A 3QY7A 4ZB2A 1S3HA 4NJJA 4L65A 4LXFA 5LIYX 3TX9A 4MYXA 4N9CA 4W87A 1LBFA 3B04A 1UROA 3T7VA 1P7TB 3UR2A 4CQ9A 1R3QA 5CGMA 4LV9A 4KIEA 4XO7A 3M1ZA 1QNSA 3LGEA 1M7PA 1XIMA 3RG6A 4Y8EA 1WUEA 2WJZA 2VC9A 1W5QA 1VC4A 3HQNA 3PZGA 3EA2A 4IJBA 5C8BB 2Y2WA 3LYEA 1T8XA 1XRFA 4F0KA 4OFCA 4NNCA 5DY2A 3S5OA 4ACYA 4CN1A 2A5HA 2X42A 3OZOA 3KDNA 2PB1A 1UR0A 3M5ZA 4JIHA 2VDHA 2FH8A 4LYRA 4JTUA 4JTKA 3ZVHA 4EPDC 2UWFA 2WSKA 3AS3A 2CXGA 5LNUA 5LXXA 3UJSA 1SO6A 1TZZA 3QQ0A 2GK1A 3KVKA 2I5QA 2E40A 5C71A 1IEQA 1XPYA 5HPOA 4LALA 1LOSA 1GK8A 1KTBA 1R7OA 3FJ4A 1UWSA 1JFXA 5FSDC 1RBLA 4GZIA 3IJ6A 4P7QA 4N2YA 2MANA 4FLRA 3BARA 3MJYA 3MMDA 1J6OA 2GJRA 4Q8MA 4GNKB 3LD5A 4AD4A 1UR9A 2YB4A 1YDYA 3ZS4A 3PP7A 2PDWA 3L4VA 2Z6JA 2Z27A 4FR1A 4XIAA 3VX0A 5AHEA 2ZUUA 3RLUA 4GKTA 1C8QA 4DX3A 3KE0A 2C71A 3MC5A 4Q4KA 4J9JA 4MNLA 5CG0A 3OPSA 4HOXA 2YDSA 3QFEA 4A3HA 3BLLA 1A5MC 3BGJA 1KXQA 1TWZA 4RE0A 3U2EA 1D9EA 3VDAA 3N13A 3I3EA 5HJXA 1UCWA 1XCWA 1JZ3A 1UB3A 4GISA 1XLIA 2J7DA 3EDJA 1AK5A 1ME8A 5DMLA 5I07A 1KFBA 5M5DA 2PTWA 1GQNA 4L9YA 1JCMP 5U7SA 3A4AA 3C6CA 3PUEA 3GNDA 5FF2A 1EDTA 3TXVA 3MUZ1 3T8LA 2XSXA 4JL1A 2HK0A 3QPZA 4IPPA 1BG4A 3VIFA 1OFDA 5I09A 3TYAA 3W7EA 2WSRA 3A21A 2YYTA 4AMCA 2WANA 1K7XA 3KOZA 5I0DA 4AAJA 5CAKA 4YS1A 3XIMA 2FHCA 2WV8A 3OQEA 2E5CA 3GXPA 3M6YA 4CD6A 5BU6A 3W02A 3C3NA 4LS0A 1HX0A 3EA1A 1A3XA 5FKYA 2PZNA 1TQJA 4K1WA 3TFCA 1FP8A 4TUFA 3Q94A 4IGMA 3TH6A 3TTEA 5XIAA 1DJZA 2PDNA 4KERA 5HMSA 2B7PA 3A5VA 2F6UA 4LF2A 1PJ9A 3GHTA 1MFVA 4O19A 4UMCA 4GY7A 3L68A 3W29A 3AMDA 4PUWA 3T0TA 2QNEA 2B7NA 1YMYA 4JTEA 1PEZA 4WGXA 4V33A 3KOWA 3WMBA 2F6KA 2EO7A 3POHA 4QLLA 4QJ3B 2DJXA 5BXTA 3ITYA 3SB0A 3WJSA 2RDWA 5FAGA 1GZGA 2XYLA 1VHCA 4GGBA 4IH3A 2VEPA 4GYJA 4R53A 4MLJA 4GG9A 5EMUA 4S2CA 2BY0A 3QR0A 5F2IA 5AC6A 1WO2A 1K4HA 2WLYA 3B0XA 1SUXA 2EG8A 5IHRA 3UF9A 1BVWA 1VPQA 2ODOA 4N4QA 2O7QA 5KZ6A 5IDIA 1W5NA 1XLLA 1K3UA