1YADA

Structure of teni from bacillus subtilis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
190
Chain Sequence
MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein tenI
publication title Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 70
structure length 190
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yadA00
3W1AA 2ZFAA 2P10A 3SGUA 3NQEA 1I2NA 1K7XA 4X3ZA 5CPNA 1Z48A 1DKWA 5BOOA 3LERA 4ONVA 1QOQA 2ALDA 5K9DA 3EWWA 4LUJA 2QCHA 1OK6A 3ZFHA 4Z1DA 2Q8ZA 5CPOA 2ZDRA 3GZ3A 4LC6A 1KFKA 5DY2A 4OGZA 2BLEA 2TYSA 4LRSA 3G18A 5HQEA 5HULA 4PL2A 3NM1A 3UZ5A 4RZ5A 5F4WA 3MP4A 2C16A 1UUOA 4O28A 1JULA 4DPPA 4MYXA 3KHJA 1B4KA 3BG3A 1O94A 5D2XA 5TIMA 3VE9A 3W6YA 1JRCA 1SPQA 2WO5A 3N2XA 4DBEA 2DZXA 3DFQA 4O50A 3PG9A 3P82A 1TPB1 4RKAA 1ZCOA 2WNNA 2QCMA 5DY3A 2FPYA 3PY2A 4PL1A 4UIOA 5HNRA 1H7NA 3PR2A 1FDZA 2YZRA 3HPSA 3GAKA 3LV5A 3KAOA 2PRHA 1M6JA 1DL3A 4NXKA 1G7UA 1FCVA 3LDVA 3OA3A 3B05A 4EIVA 4S2CA 3FFSA 1I2OA 2Y7EA 2Y89A 3MW7A 5DBUA 3P80A 4ADTA 4HPJA 3NQDA 3NPXA 1TTJA 4BF9A 2Z2UA 5A5WA 3B0PA 4AHQA 1LROA 1YADA 3EB2A 1XDMA 3NQVA 4Z1AA 4EOUA 2FB3A 3HO8A 1OFQA 3G0SA 2CZFA 5D03A 2NV2A 4HNUA 4XKYA 1R2TA 1H7WA 1QOPA 3G0XA 3OEXA 3PSWA 1GVRA 4Q33A 1L2UA 2X16A 3L67A 3PM6A 2OMAA 4MY9A 2ISSA 3W2JA 2ZTJA 1G7VA 1EUAA 1KFCA 3A21A 3M7WA 1MEHA 6ALDA 3GR8A 1LRNA 3BPWA 3PUEA 2YYUA 3EKZA 2C13A 2E5BA 3NPVA 4NX0A 3W22A 2WPBA 2CZEA 3LRLA 4JTUA 1IXPA 3NZ1A 1QCWA 4IJBA 3WJYA 4A3UA 3OIXA 1YTDA 2V5LA 1TTQA 3ANYA 3HMJG 4JS3A 4K39A 1TPWA 4C1KA 3W73A 1M5WA 3NO5A 2QCDB 3P5YA 1LORA 3N9SA 1F2JA 3IVUA 4PEKA 4O17A 1U83A 3ZR4A 4N4QA 1OFRA 1Z44A 4DEFA 1KM2A 2PURA 4GFSA 4M7SA 1A5CA 3QW3A 3F4WA 3NEVA 2NX9A 3TV8A 2QCEA 1G67A 1UASA 4B5NA 1B3OA 3TU9A 1SO5A 2OX1A 1VGAA 4XWUA 3TSBA 2YYTA 3N34A 5KZMA 1DQXA 3QZEA 1NAL1 4JTLA 4N6EA 3NQ8A 3O6CA 3NGJA 1DJNA 4TR9A 3UNDA 2X2GA 3I6RA 4XUGA 1H5YA 4LS0A 5DXXA 4O0KA 5EMUA 1ZALA 2ABAA 2CU0A 3QFEA 1KA9F 3BW2A 2JGQA 3W1QA 2CLIA 1XBYA 4GC4A 4O1DA 3CB8A 4P2VA 1YLVA 2Y62A 3W86A 1LLZA 4FNRA 1F5ZA 3DHDA 1OF8A 4BWLC 1KM0A 4GUGA 4MLRA 2A2IA 3PBYA 2NUYA 3QH2A 1VLWA 1THFD 1H7XA 4WJEA 3IVSA 5K4ZA 1AG1O 3F03K 1FWNA 1LOQA 3L0NA 4AVFA 3U6WA 3VI2A 3NR0A 4N9DA 4S1FA 4AWSA 2V30A 2ZZ1A 3JR2A 4N02A 4AHPA 4FXSA 2V2DA 5HWNA 3FYPA 3W1RA 2H3DA 4JTKA 4NVTA 2QCFA 1D9EA 5F4XA 1TPDA 4PODA 3EKLA 4MOZA 1KFBA 2JBMA 3S8HA 3UWVA 4BK9A 4P61A 2WNZA 2C1HA 3MUXA 4UTTC 2ATMA 1W5MA 4RLIA 3PBWA 1QO5A 5BRBA 1GVFA 4UTWC 2JK2A 4O18A 1W3TA 1M7OA 1IXQA 1P0NA 3LBMA 4UFJA 4TMBA 4AXKA 2NLIA 4GRSA 3C52A 4LVDA 2B0MA 3M5YA 3QSTA 3GXTA 1H60A 4BFAA 3LRMA 4HSNA 2GVGA 3VNDA 4XTDA 4GWEA 1C9DA 2QCNA 3LLFA 3MBFA 3GK0A 1EIXA 2A21A 3L66A 5AYXA 2VEPA 3W7LA 3GDTA 3W7QA 2EKCA 2FPTA 1JCLA 4DXVA 4O54A 3TSMA 4A21A 4LUIA 1S5TA 3RNDA 1TPEA 1B4EA 4DF1A 3HPXA 2ZA1A 4O53A 2C0AA 1IXNA 4NU7A 3UWQA 3FOKA 3O07A 3A23A 2ZCGA 2ZZ3A 1H51A 1AK5A 1DORA 4WOQA 3MHFA 1TRDA 4CNOA 3P84A 2A6LA 3B4UA 1ZHAA 3M43A 1C29A 1E51A 1PE1A 4LVFA 3KVJA 5MHBA 4JTFA 3G3MA 1A5AA 4IMDA 3SGZA 1P5BA 2DU2A 2G5WA 4NZFA 1Q6RA 1G69A 3L5AA 1BKSA 5LZLA 4O57A 3EX3A 3IIZA 4LC8A 1EA0A 1EPXA 1F74A 5D32A 3PC0A 1R46A 4NUWA 3RMJA 2OCZA 5E0KA 3N2MA 5AC8A 4FNSA 3NYZA 2NX3A 3KVLA 5BMWA 5K4XA 3DFSA 1JQXA 5AHFA 1TPFA 4HNNA 1ME7A 3W1NA 4JIQA 3GB6A 3HGSA 5HWJA 2Y6ZA 4QNWA 1KBIA 3G1DA 3TNOA 2E5CA 4A29A 2Y70A 1HO4A 3LLDA 5IBXC 2YW3A 2FLIA 2Q3RA 4A2SA 4UTMA 2AGKA 3KXQA 5DXYA 1OG0A 5D05A 4OU1A 3CM4A 4KKXA 3IVTA 1N8FA 3BV4A 4GBUA 3ZS4A 5F1VA 1PS9A 4M7TA 5G5IA 3RLVA 3PUOA 4FEZA 1NSJA 3UPWA 1R30A 2NX1A 4O1BA 3OVRA 4JEQA 1ZAJA 1H63A 1XI3A 3WK0A 1W0MA 1ICQA 3TW7A 1VYSX 3NG3A 1KM1A 1TPH1 1P0KA 2CWNA 3QRHA 4JR5A 4BI7A 4DELA 3PBVA 4UMBA 3QM3A 3A5VA 2I14A 2P1FA 4JTJA 3MI6A 4TIMA 5DELA 1OFOA 3SZ8A 4GJ1A 1QPOA 3EX6A 1W5OA 1FDYA 1ADOA 5CPMA 3LOTA 4NXSA 3N9RA 4N9BA 3SW6A 2D73A 3W3OA 5J5DA 4BWLA 4MKNA 4ADUA 1V7YA 2DZVA 1T8XA 4ORIA 3IGSA 3BLFA 4FXRA 5FEWA 2DORA 3BLIA 3CTLA 1O60A 3C2OA 3IIVA 3G1FA 2YFNA 3LCXA 1GYLA 3QMRA 4Y96A 3FKRA 2HSAA 1Q6OA 5I3KA 5F4SA 1TPUA 1Z42A 4MZ8A 4UXDA 2YR1A 4CQ9A 3KRUA 4FHAA 4DO5A 3N3MA 1QO2A 1JUBA 3W7DA 4IMGA 1NFBA 5AC6A 5F2GA 1TJPA 2FDSA 2JKEA 2VFEA 2J9XA 1QDSA 2VEMA 3TFCA 4M19A 3CU2A 2RDUA 3EX2A 1UBSA 5D2VA 2QCGA 4HNVA 2ZRXA 3EWXA 3A24A 1LLWA 4IMEA 2R94A 3M5ZA 1RV8A 2NUXA 1N7KA 2QJIA 1Y0EA 2VFGA 3IRDA 3DU0A 3W7IA 2UV8G 2DZWA 3TC7A 1L6SA 2E6YA 1OFPA 4XQ6A 1FCQA 4O1CA 3MJYA 3OVPA 1KTCA 5H91A 4HIBA 3QW4B 1HUVA 2VENA 3IV3A 3LXAA 3P5ZA 1X8FA 5D09A 1DBTA 2Z6IA 3GR7A 3INPA 4WY0A 3W7JA 4X9SA 1G4SA 2V9DA 3G24A 3L0KA 1XBVA 4N9EA 1RZMA 1YPIA 5D2WA 1TB3A 5CSSA 3NQ6A 1EX5A 1LZOA 1N55A 1O5KA 3NOEA 1KTNA 1PCWA 4L4LA 6TIMA 4HT3A 4OHQA 1SO3A 2NWRA 1YTKA 3FKKA 3G1XA 4E0CA 2EAWA 1W5PA 1XBXA 2VFIA 3IIXA 4IX0A 3TQKA 1XDLA 3S6DA 4RCXA 5I3JA 4UFLA 3FIGA 2ZZ5A 4NNAA 4YL2A 3HG3A 3S5OA 3NPWA 5D30A 5D38A 3BO9A 3MBDA 4UTUA 3C3NA 1K03A 1UUMA 3L9CA 4HN4A 3DHFA 2IQTA 1T0OA 4FIQA 4N2YA 2BTMA 4RX0A 3GAYA 3UXAA 2CFFA 4CNNA 4AEOA 3RU6A 4OV9A 2A4AA 3BARA 3PB0A 3I7SA 1QPNA 2YSWA 3TDFA 3M6YA 3LHVA 1A5SA 3M9YA 4JDBA 4GXMA 2CZ5A 5CG7A 4WXZA 1TV5A 2V2HA 5AFDA 3PF3A 1SW7A 5D2YA 3LCFA 1W3NA 5LNSA 4YWIA 4AMAA 1O5XA 1TPC1 5HR7A 1M7PA 5BNKA 1FXQA 2ISWA 3UQNA 3KRZA 5AHEA 1KM5A 2Y88A 4FF7A 2ZRYA 4Y8FA 3WJXA 3YPIA 1WBJA 2OT0A 3M16A 1H50A 3CHVA 1PHWA 3PB2A 4UCGA 4TX9A 4DQWA 4IWWA 2A7RA 3R8RA 2ZA2A 5EPDA 5ABTA 1AW2A 4CQAA 1FWTA 1OX5A 2AAMA 1WAUA 2A5HA 2VELA 5HJLA 2AQWA 1A50A 3I65A 3S1UA 1A5BA 4RZ6A 5FF0A 1ZFJA 1QMLA 2JKAA 1H7PA 1I2QA 5DCDA 1EB3A 3Q2DA 1H62A 1FWWA 2ZYFA 2V0TA 2YCEA 4X22A 1QPRA 3CWNA 1S5WA 1OFEA 1KTBA 5TBOA 3QQ1A 1TV8A 3W2LA 3LHWA 3MP5A 3FLUA 4ZQNA 1DOSA 3WFAA 2G96A 1MZHA 4NJGA 4OE7A 2CW6A 3L65A 4WQ6A 5KTLA 3NA8A 1WDWA 2GQ8A 4ZL1A 4L4MA 3STGA 2EPHA 2ZTKA 1PV8A 5A8GA 4BR1A 4LS2A 2BX7A 3LI1A 3LI0A 1BEUA 2Y7FA 4O0ZA 1WOBA 1OK4A 1LDCA 3VE7A 3UXDA 1O4UA 3FYOA 3O6DA 4LW7A 3P60A 3TKFA 1LCOA 3NDOA 4DO4A 5F2LA 4FX7A 5LKYA 2B7OA 3EEGA 3Q58A 5AHIA 2GJLA 2BSLA 3AO0A 5F2MA 2DP3A 1X6UA 1G4TA 2ZQ0A 5FEZA 1XUZA 3UY7A 2E1DA 4MZYA 2CLOA 1XM3A 3C2VA 5LNVA 1JCJA 3B06A 1BTMA 1J5TA 2DZTA 1BWKA 4AWTA 1SZFA 4ML9A 1LRQA 1OVDA 3B04A 4AWUA 4Q4KA 3W7OA 3SY5A 3DZ1A 1QFEA 2TPSA 3SECA 1NVMA 3LXBA 1KFJA 5CSRA 2QDGA 1KV5A 1TRIA 3IEBA 3PS7A 4MY1A 2G97A 4JDYA 1TSIA 4JX5A 2W0UA 4EVZA 1HL2A 1LM1A 2GJNA 1D3HA 2V2CA 5F2IA 2Z1BA 5CPLA 4E2DA 3PULA 2HMCA 2XFWA 3DKLA 1IIHA 4POCA 4JYFA 4O4VA 1YPFA 1I45A 1L6WA 3P62A 3T55A 2V82A 4ZQMA 1HG3A 2E6FA 4WY0B 3V75A 4OT7A 1VJIA 2VXNA 2FIQA 1IF2A 3STEA 1J4EA 3P67A 3DXIA 1GG0A 2WJZA 4R34A 2A7PA 4IGHA 3W1MA 4NQ1A 4YMZA 1OFAA 2VFFA 2HTMA 4ZQCA 3TQ0A 4UFKA 3W23A 4KFOA 3NQCA 5KMYA 1KM4A 3ELFA 2ZRVA 4NJIA 2YDAA 3T4CA 4Y9AA 1FCBA 2H8ZA 4H4IA 1RQHA 2NWSA 2WQPA 5C54A 2EHHA 1B57A 3CEUA 1WXJA 4CNPA 4O16A 3Q37A 3WK2A 1SSDA 1OX4A 2O7SA 3NQ2A 1GT8A 3QJAA 5U7SA 3G1AA 3L5LA 3AJXA 4UTIA 4AAJA 3HGOA 3JRKA 3GIYA 4N6FA 3THAA 1VCVA 4CCEA 2FJKA 4LY8A 5I3IA 1JCXA 2QEZA 2A7NA 1QAPA 1JCYA 4D2JA 1WA3A 2QJHA 3G0UA 3MO7A 3JS3A 1ZJIA 1W54A 1LTDA 3LXCA 1I2RA 2DZUA 1JUKA 1TCDA 4NX5A 1RQEA 3DKJA 3F4NA 5LGZA 1IGSA 5D33A 5TQLA 2V5BA 2OJPA 3TH6A 1FY6A 3QEZA 1RVGA 5HINA 3KRSA 3FJ6A 4LVBA 3T7VA 1HFBA 3LRKA 4LV4A 2XN2A 3N73A 3S0CA 4KFPA 2CLMA 3DGRA 3E9AA 1YTEA 5KITA 3EXTA 3M47A 3W84A 1KM3A 5FEPA 1AW5A 3GNDA 1W5NA 3LM7A 3VCRA 3DI0A 3NQGA 3ATZA 4GNJA 1TTPA 5IM51 1KLZA 3ABRA 3W7CA 1JCNA 3GX9A 3G22A 1W8SA 4DF0A 2QUVA 1JVNA 1S3HA 5F1UA 5KSWA 1VRDA 3VKJA 1PCKA 3KX6A 1R47A 5EL1A 1EP2A 2H3BA 3MI2A 4MPQA 3C8FA 2CZDA 3LTSA 4O13A 3DFNA 5K2ZA 1FWRA 3TMQA 4O8RA 3HG2A 3O63A 2PC4A 1GEQA 3W71A 3W7MA 2RDTA 3LHZA 4YCPA 2GOUA 5CZ0A 3NL2A 1G6CA 3MWAA 3O8AA 2YW4A 4IXXA 3B8DA 1LOLA 4ZQRA 4FNQA 3H53A 3EX4A 1BWLA 2JGYA 2C19A 2WSYA 2BZNA 3UD6A 4K8EA 1YXDA 3B03A 4S2BA 3LBCA 4NJJA 4JIPA 4PTNA 1WYIA 2Q8LA 3DFTA 1OFBA 3QF0A 4PFMA 4JGDA 1SFLA 3LCLA 5D37A 4GUIA 4TU1A 4MFDA 1OYCA 5I3FA 3NXFA 4UC5A 4J9JA 3WJWA 4R7JA 3PVFA 5D2TA 3RFAA 1IXOA 5LHEA 3L68A 4FIRA 1SUXA 5H2ZA 1MXSA 4FB7A 4IQLA 3LCWA 2YGYA 3RK8A 1Z41A 2QCLA 3BW4A 1AW1A 3GKFA 1F6KA 2E09A 4Q32A 1RR2A 3O16A 3GDKA 4JTIA 3LHYA 3TC6A 3QMTA 5CZJA 3STCA 3W7NA 1MEIA 4UFIA 3G3DA 2YXGA 3OG3A 1OF6A 3EWYA 1XBZA 5D04C 1OJXA 1CW2A 4NT0A 3E96A 1UCWA 3EXRA 4JX6A 2YPIA 3FS2A 1KFEA 2B7QA 3C6CA 1XFBA 2QF7A 3WJZA 1XXXA 4JD4A 3W1XA 5DCBA 2TSYA 1FCUA 5DN1A 3KFTA 1OFDA 4UR7A 2C18A 3ATYA 3G1HA 5FESA 4UNLA 4ALDA 4Z1BA 2OT1A 5DBTA 4IPIA 4Z08A 1V5XA 4YCOA 5CKSA 1KFLA 1G4PA 3QYQA 3SSJA 5EYWA 1GWJA 4IPJA 2EF9A 3BGJA 3HGJA 5AHMA 4FNUA 1Q45A 2CLHA 2E68A 3UPBA 3R89A 3D0CA 5LNUA 1F73A 4NJKA 3S42A 3DAQA 2A6NA 3THQA 3QMSA 2GUUA 3G1YA 1R2RA 1TQXA 2NUWA 4I9AA 3GVGA 3W1LA 5LGXA 1WBHA 4RXGA 1TQJA 3LHUA 3E12A 2CLKA 1ME8A 5AC7A 1VC4A 3QPYA 3W2UA 1S5VA 3FEMA 3PBUA 1TTIA 4UTTA 4QJ1A 3U2OA 4MUZA 3ZWSA 1OABA 2PRMA 4ORMA 1KV8A 1WV2A 4UTWA 1Q3NA 4LVGA 1K8ZA 1OX4B 1GJPA 2B7NA 4QSHA 5G2WA 5G2HA 1WX0A 1QNVA 3OBKA 3W7GA 3UYCA 8TIMA 2QKFA 2VOMA 3IGXA 3RLUA 5G4EA 3CLMA 3CQ0A 1TJRA 4BI5A 4WX2A 4E2BA 3HG4A 4MLJA 4AB4A 4FX8A 4K37A 3NAVA 3M1ZA 2RHGA 4O1AA 2ISVA 3USBA 2ATSA 3NQMA 3M41A 2J9YA 1L6YA 5C6MA 5EKYA 2ZBTA 1TPVA 1W56A 1WQ5A 3R2GA 1C8VA 1ZNNA 2J27A 1GTHA 4DBDA 4YLWA 3TA6A 3W1PA 2NV1A 1ZAIA 2Y61A 3ZWTA 1VQTA 5DCEA 1X1OA 4FNPA 3A9IA 4TMCA 2R8WA 2XN0A 2GPTA 5AN7A 1QWGA 2H6RA 1VS1A 4A22A 1TYGA 4FO4A 4QQ3A 3UWYA 1H7OA 1XC4A 4RZ4A 4O19A 4LS1A 4QISA 5K7JA 1GYNA 3W2MA 1DVJA 4X2RA 4MIMA 3P81A 3SIZA 3EWZA 4K8HA 4QITA 3SI9A 4LRTA 2QUUA 1JQVA 3F1QA 4JTGA 1FQ0A 1KW1A 1FX6A 2RDWA 1SQ7A 3TXVA 5FF3A 4LTSA 3K30A 1KLYA 1ALDA 2NXGA 1YYAA 1VYRA 4KWVA 3BG9A 4NJHA 5BMXA 4ADSA 4JXCA 4LVAA 3SR7A 4NZJA 4QAIA 4LU0A 4MY8A 3BVJA 1R2SA 3U8GA 4O15A 3GDLA 3BLEA 3CIWA 4O14A 5K9XA 3TJXA 2B7PA 3ABSA 3RF9A 3S9YA 1EUNA 3TX9A 4UTLA 1ME9A 4WZHA 2Z0IA 3MYPA 4HHPA 3OVQA 4G1KA 5IBXA 4HKPA 5T26A 3WK1A 3W76A 2PCQA 1PIIA 2PE4A 1YXYA 4ZZ9A 1CI1A 5BW6A 1QR7A 4IXHA 2NZLA 4Z1CA 5L6UA 1RD5A 3TJLA 3L5MA 3R13A 3TUUA 2FPVA 1YDOA 3UWZA 3H54A 3EWBX 3L0GA 4WOZA 2X1SA 2J24A 2XN1A 3DFPA 1H1YA 3C2RA 1GPWA 1U5JA 2I9EA 1TV7A 3SFKA 1GVOA 1JUEA 5CGQA 3BK0A 1AL8A 7TIMA 1KM6A 5AOUA 3GDMA 1PL9A 3QPZA 1F05A 1MO0A 4NNBA 3HIJA 4OQVA 2VFDA 3P74A 4EWND 5AB3A 3DH7A 1F7BA 1TO3A 3N19B 1K8YA 3S5YA 3H55A 4JICA 3W7RA 3UWWA 3TQVA 2BWGA 2NXHA 4OWGA 3W83A 5AYYA 3TSDA 5AYZA 3NQ7A 5FF4A 1TIMA 3NL5A 4JNMA 3HOJA 3HQ1A 3LHTA 4K6AA 3TMLA 2R91A 3O15A 2V8ZA 2X1UA 3WJSA 3PG8A 5FEXA 1K7EA 2E6AA 3R5EA 4U28A 5EBUA 2RFGA 4DPQA 2F7FA 2HS8A 4UTKA 4PC8A 2J6XA 2QUTA 3TK7A 3MP3A 3TFXA 4O52A 5CZTA 1GVQA 2C3ZA 1HO1A 4HNTA 3ABOA 1ICSA 2RKXA 1ML1A 3W2NA 3W07A 3W1UA 1YXCA 3M44A 2TMDA 3P8IA 1B9BA 3C61A 3GYEA 1AL7A 4CCDA 2VEKA 4AF0A 3FA5A 1G4EA 2TRSA 1T96A 3W70A 1W5QA 2F84A 4Y6GA 4QNEA 4UMAA 1RPXA 3DI1A 1DQWA 3G8EA 1K7FA 4M6QA 4OBTA 3UWUA 3BG5A 1VR6A 4RR4A 1FWSA 1MEWA 3TIMA 3NVTA 1SW0A 2DZPA 1GOXA 5GVJA 4WY0F 1UB3A 2VEIA 4IMFA 1JR1A 4DF2A 1XL9A 2V81A 4XBKA 3G1SA 2EGZA 4RXFA 5EY5A 4ICNA 3SJ3A 5LNWA 4PA8A 5EA9A 5I3HA 4JTSA 4K7VA 1RQBA 2Y63A 2ZRZA 1TREA 3S1WA 4K7YA 3LCGA 3P7YA 3QC3A 5K9CA 5G2IA 1LOSA 4JTTA 4JY8A 4MZ1A 4JYEA 1LRTA 3TAKA 3E02A 4JX4A 4K38A 4UNKA 3PWAA 2H8XA 1Q6QA 3W88A 4UFMA 3HB9A 1FBAA 3E0IA 4YXGA 3A22A 3C0JA 3L21A 2C14A 4UTHA 5LNRA 1X7FA 4KFNA 2GVJA 2CLEA 3W85A 1EWDA 4Z0JA 1NEYA 4Z0SA 1ONRA 2ZRWA 4CLMA 5HUPA 3W7KA 1H7RA 2CLLA 1CX9A 3QSRA 4IMCA 2HS6A 3LV6A 4FX6M 2OZ0A 3O05A 3PSVA 3HBLA 1JCMP 3NM3A 2QCCA 4AHOA 3TR2A 4UUIA 2ZZ7A 2ABBA 4UR8A 4I7VA 2ZZ2A 3IGUA 3G1VA 3HG5A 1LBLA 1P1XA 2JKPA 4ZQOA 4N4PA 4U4MA 2ZA3A 1FDJA 5FF2A 4I7WA 1LBMA 1SW3A 4FNTA 4JY9A 4BI6A 1VCGA 3KOFA 1H61A 1P4CA 1I2PA 1VCFA 1SO4A 2ZZ6A 2C15A 1O95A 1QPQA 3GXPA 1SZEA 2ZRUA 4CQ8A 3V1PA 3MHUA 1OHLA 3L2IA 3PUDA 3NL3A 4EF8A 5C55A 3B0UX 3MHGA 3W74A 4XZ9A 1HTIA 3CC1A 4GE8A 5KINA 3LTPA 1Q6LA 4K36A 4PCFA 3NL6A 4R53A 2WV8A 1EEPA 3KVMA 3O1NA 2QAPA 5L9FA 1W1ZA 1AMKA 3W75A 3BW3A 2DZSA 4DO6A 1L9WA 4R33A 2NXIA 3CWOX 2Y85A 4LWWA 3HGRA 1XUUA 3LCIA 1SSGA 2X1TA 2Q3OA 4LOCA 4QM1A 2A85A 3IIPA 4C1LA 4IOTA 5AHLA 1W31A 5J5RA 1VHCA 2QR6A 5E1QA 1SO6A 4ZVJA 3TCEA 1SZGA 5D02A 3UY8A 4RJEA 3ABQA 2Y7GA 1ICPA 3W72A 4M5PA 4O10A 3TW6A 1WOAA 2GQ9A 4A2RA 4WD0A 3O06A 1LP6A 5E93A 5C2XA 3T40A 2WKJA 3IIOA 3WK3A 3I68A 4M6VA 4XKYB 4ZQPA 2VFHA 1LYXA 5HMSA 1PVNA 3N14A 3FJLA 3HPZA 3LX9A 4I7UA 1VZWA 3LGEA 3KVKA 3GXNA 4UTJA 2A0NA 2X30A 3VFLA 3C56A 3W7EA 3LB0A 5LHFA 1KBJA 2E5DA 3E49A 3EWUA 5DLCA 4H3DA 3W2KA 2RH9A 3W1TA 2G95A 2WSQA 4W9TA 5HWMA 4JTEA 2B4GA 1SU5A 5G1YA 4Y90A 2QJGA 4MVAA 1VPXA 3S5NA 2YFOA 5G1TA 1TMHA 1F6PA 5AHNA 5KZDA 5U4NA 2DJXA 4WXYA 3HJZA 3TE9A 2C6QA 3STFA 3W9ZA 1XKYA 4GUJA 3P61A 4IUOA 1JJKA 5K3VA 5I3GA 2FQIA 2Y7DA 1K3UA 3DENA 1J2WA 3M0ZA 4AF0B 1VYPX 3GLCA 4MJMA 3S1XA 3NQFA 4H6KA 2GQAA 1VLIA 2LLEA 3GKAA 1D3GA 4KWWA 3TROA 2KZHA 2FTPA 1I4NA 1ZY9A 4N9CA 3MI3A 1FXPA 1GTEA 4AH7A 3B0VC 4PH6A 1SR9A 4WUIA 1OYBA 1A53A 5G4WA 1MSSA 4JTHA 3A5FA 4CCCA 4GUHA 1IIGA 4TO8A 3HF3A 4MJZA 1GZGA 3NQAA 4IX2A 4MFEA 3LTYA 2P0OA 3PAJA 1DHPA 3QQ0A 2W79A 1GQNA 3UZJA 1OX6A 1NF7A 4QIUA 1H1ZA 2BXVA 4O11A 5C5YA 5FF7A 3W7PA 2ZZ4A 2E77A 3GDRA 2DJLA 2VC6A 3P8JA 4JYDA 4HPXA 3C2FA 2QCDA 3DFOA 3EX1A 3W7HA 3GNNA 1XCFA 3CEPA 2J88A 2A1YA 3TAOA 3C4UA 4M6PA 1I8JA 1LBFA 3TXZA 2H90A 1OYAA 3NNTA 1X1ZA 3R12A 1W3IA 1FUYA 3S5ZA 2FB2A 3W87A 4E38A 3G8RA 5SWUA 3M5XA 2FFCA 1UJPA 2CLFA 2YX0A 3BGGA 4ZMGA 3MMTA 4RK8A 1ZAHA 2I1OA 1EP3A 4OV4A 2QDHA 2WNQA 4LNYA 2W6RA 3CT7A 5HR6A 2E6DA 4JN6A 5HUOA 1T99A 4UMCA 3CPRA 2O7QA 2PRLA 1ZENA 3EXSA 3T78A 3S1VA 1VH7A 1EWEA 4HSOA 2WOQA 2X1RA 2J9ZA 3Q94A 1EP1A 4O4WA 1GVSA 1SZNA 1SFJA 1W37A 3C2EA 2VKZG 2R14A 3I7QA 3NPUA 5CZSA 4MYAA 4NNCA 3NZRA 4O12A 4LT9A 3T44A 2QAFA 4GUFA 1F76A 2WSRA 1K8XA 3I7RA 4EF9A 1YDNA 1VHNA 3LCHA 3MYOA 3O6YX 1DV7A 4RV8A 1GG1A 4UFHA 2GVLA 5KZEA 1JRBA 4LV9A 1NF0A 3OHIA 2Z6JA 1PHQA 3M5VA 3DBPA 1K02A 4XTIA 5FI8A 4XBSA 5LSMA 1YDVA 3CIXA 1DJQA
chains in the Genus database with same CATH superfamily
3HJEA 4HMEA 4AUBA 2QUNA 1XYFA 4BZYA 3ZT7A 5CPNA 3THCA 3LERA 5H8PA 1HW6A 3ME3A 1NDVA 2NW0A 4DWDA 4D8LA 1A5MC 4Q8PA 1OK6A 2P8CA 4EK7A 4GMEA 4HA3A 3GZ3A 2BLEA 4DYKA 3G18A 3SRDA 4HTBA 5F4WA 3MP4A 3WF2A 2C1GA 1JULA 4MYXA 4I9JA 4WSJA 1B4KA 1DJHA 1J93A 1PWMA 3VE9A 1TX2A 2XSBA 3T1GA 4J28A 2YLLA 4OBSA 5DT5A 3N2XA 2F8QA 3AMLA 3H2CA 2YXXA 4JTRA 1G1YA 3DFQA 3KZSA 3RITA 2HEJA 4DJFA 3PG9A 1M65A 4J3UA 4U3AA 2REQA 3P82A 1B1YA 3VIKA 2L5HA 2QJMA 1ITCA 3ITXA 3PR2A 2YZRA 3HPSA 4V15A 3GAKA 3LV5A 2PRHA 5FACA 9XIMA 1RA5A 5EMLA 3OA3A 2E9LA 1W9VA 3RR4A 1A49A 3PBGA 3WQCA 2Y7EA 5AYIA 3P80A 4ADTA 3NQDA 5DF0A 2Z2UA 1BYBA 5A5WA 1GJWA 1LROA 1XDMA 4L5ZA 3K8KA 2FB3A 4CEXC 4EOUA 2BV9A 2NV2A 1XLAA 1Q7ZA 4CEUC 4JQ3A 3AIBA 4Q33A 1L2UA 2X16A 3PM6A 2OMAA 2D24A 2ZTJA 1P0EA 3B9AA 4P7QA 1EUAA 1KFCA 1S2UA 1LRNA 3GH7A 2WCGA 3EKZA 1W1IE 2E5BA 4NX0A 2WPBA 1TA3A 3NZ1A 4EXAA 5REQB 3OIXA 1YTDA 2V5LA 1UIPA 3HMJG 2ON3A 4JS3A 3WUEA 3B97A 4RDWA 1FWCC 4FOUA 3VMNA 3RRAA 1QI3A 5IHSA 4AZHA 3IVUA 5EGRA 1KNWA 3ZR4A 1UWAA 2AKMA 2PGEA 4M7SA 2OOFA 3PBMA 1RJPA 1A5CA 5BU6A 3QW3A 3NEVA 2O4MA 1UASA 3AI0A 3RLGA 3TSBA 3N34A 4UQEA 1K4GA 5A6KA 4L6DA 2FZBA 4NZ3A 3O6CA 3NGJA 1F4HA 4Q8VA 3BV7A 1DJNA 1WCGA 2X2GA 5FOOA 1H5YA 4LS0A 1XLGA 2DUAA 3SQMA 3LA4A 4CGTA 4AD4A 2CU0A 1KA9F 4AY7A 3HQOA 1S2WA 1D3CA 3SQLA 4R5EA 4JFTA 4Q8UA 3PJUA 4O1DA 4B2DA 3LSCA 1XLLA 4F0MA 3DHDA 4W89A 1OF8A 1W9UA 3VVGA 1JDEA 4GUGA 2A2IA 3MUY1 4UCFA 2P88A 1CWYA 3AAMA 3IVSA 1AG1O 3F03K 1CXLA 3I3BA 1KD0A 4CUCA 4AVFA 4HYRA 3NR0A 4AWSA 3SFWA 3VKCA 5I09A 3B9DA 3W1RA 3REQB 3EOOA 3GDBA 4QE4A 1VFHA 4Y9MA 5F4XA 4A6GA 1JF5A 4PODA 4MADA 3MU7A 4M1BA 1V0LA 4BY3A 3BL3A 1Z89A 2IPWA 3PBWA 3ZSSA 6ENLA 4JQ2A 2G4JA 1QJWA 4QR6A 3LBMA 4TMBA 2BMBA 1F8IA 1VKFA 4GQGA 3WH8A 1H60A 1M68A 3MBFA 3M0YA 1XR2A 5I02A 4DXVA 4A21A 4RE2A 3PJTA 3CZEA 1NJJA 3RNDA 4QDMA 1B4EA 4DF1A 2VUYA 1V02A 1REQB 1J8VA 5CPQA 4YVXA 2ZZ3A 3N2OA 4Q8TA 2YBTA 2V3FA 1TELA 4N0RA 3P84A 1MUCA 2Q09A 1EO7A 3KTCA 3B4UA 4GXPA 2I5GA 3RUBL 1ZBVA 3MANA 3KVJA 1UR4A 2W92A 4IFKA 1A5AA 1A0DA 3CAVA 1AD4A 3WQOA 3TTEA 3BH4A 4UWMA 4ZCWA 4ZEPA 1S39A 5LZLA 4MB4A 1XLKA 4J3ZA 3B0XA 4M3PA 4LC8A 3IAPA 1A5OC 3WBEA 2QJJA 1PZ2A 3CHFA 3RMJA 3MSYA 2QULA 4I90A 4XVEA 4A3YA 1UH2A 1CT5A 1JQXA 4HNNA 3CL8A 3M7SA 4JIQA 4DJDD 4PCPA 4GOAA 3HV9A 4KWSA 4UQAA 1O7AA 3RLHA 5CGTA 2O92A 2V5CA 5IBXC 3FNDA 4L6HA 2FLIA 2Q3RA 3UR2A 1OG0A 1DIKA 5D05A 4OU1A 3CM4A 1UMLA 5AZ1A 1N8FA 3WF4A 1ZJAA 1PS9A 4ZOCA 3WH9A 1TE6A 4IIBA 2VRQA 1C9WA 2NX1A 4O1BA 3OVRA 1Q6CA 1XI3A 3MPGA 1DEDA 1VYSX 3TW7A 4PUJA 2PDWA 3QRHA 3ZQ9A 2QMKA 3CYJA 4LCQA 1DE6A 1A47A 1B90A 3TZNA 1FWHC 1T7LA 3VCNA 3SN0A 1OFOA 3L4TA 4X2PA 1ECEA 4FPSA 4GH3A 2DW7A 3WF0A 1W5OA 3GC4A 3KCOA 4YVVA 3WKZA 4HBKA 4MKNA 1P6CA 1V7YA 1PX4A 1T8XA 3PZMA 3IGSA 4ORIA 1P7TB 5G1MA 3BLFA 4FXRA 3EDDA 5FEWA 1KCLA 3FSTA 3G1FA 3LCXA 4JTDA 4ROPA 2PEVA 3FKRA 2HSAA 1Q6OA 5I3KA 5F4SA 1QT1A 5HNTA 1Z42A 1OC5A 1CGXA 4E5TA 1UOKA 4IFOA 3W01A 3CO8A 1E9ZB 4HA1A 2VUNA 3ARQA 5AC6A 3H26A 4B5WA 2JKEA 4Y9OA 1QDSA 3CV6A 4NI3A 3VKBA 2RDUA 3EX2A 3V0SA 5D2VA 2QCGA 1LF1A 2DT0A 1NY1A 2ZRXA 3EWXA 2EEXA 3FGCB 4R3UA 2R94A 2VJXA 2BG5A 2QJIA 2VFGA 3IRDA 3LGGA 3NSNA 1ZQ5A 1RUSA 4QS6A 4H9ZA 1CGTA 3WBXA 3MJYA 2XH0A 1FWIC 2VEGA 3ARYA 2PLMA 1X8FA 5D09A 1DBTA 2NSXA 3INPA 6REQA 2V68A 4JOMA 2WB5A 2PDQA 4M29A 2R1KA 3QR1A 1LG1A 2HV5A 1BXNA 3U7VA 1XBVA 1YPIA 1LQ2A 3NQ6A 3NO1A 3H2FA 3PHAA 1N55A 1KTNA 3CT2A 5CSUA 3BLLA 3DEQA 4L4LA 6TIMA 2HK0A 2FVLA 1SO3A 4M81A 3REQA 3G1XA 4E0CA 2EAWA 4PB5A 1AZ2A 1XBXA 3TOPA 3K13A 4PN2A 3KZPA 4AZBA 4V1XA 4UFLA 3IV8A 4NNAA 1WZLA 4H8HA 4QBXA 3HG3A 1DWJM 3PTQA 3AIUA 3F5JA 3FDGA 1BGAA 4RE4A 3MBDA 4UTUA 3PFMA 3CO4A 4FIQA 1FP9A 2VT0A 4PB3A 4HYWA 1J0KA 3P2VA 1VFSA 2VZVA 2DSUA 3PZOA 4CNNA 3TW9A 1K9FA 1TUXA 1E6XM 3PB0A 3I7SA 2YSWA 3M6YA 1V79A 1HVQA 1A5SA 3QOKA 4JDBA 4GXMA 2OODA 3VILA 3PF3A 1A0CA 5LNSA 4AMAA 1TPC1 1M7PA 3ZIZA 3UQNA 5AHEA 1KM5A 1CGVA 2ZRYA 3WJXA 1QPKA 2OT0A 1PHWA 2CBJA 4UCGA 4TX9A 4XD6A 3COTA 4IWWA 2A7RA 2OX4A 5I24A 1WAUA 1KB3A 2G41A 3T0TA 4Q4MA 3S1UA 2QPXA 4HU8A 3OJGA 1KCXA 2PF8A 1TG7A 3ZLGA 2JKAA 4CCZA 2ZYFA 2V0TA 3N3TA 4X22A 4U2ZA 4F0HA 3QZAA 4IGNA 4ZQNA 3WFAA 4H7VA 1MZHA 3B8WA 3MCOA 2CW6A 3L65A 2DIJA 2EG6A 5E5CA 5KTLA 2AQVA 2CETA 1WDWA 2PI6A 5A8GA 4HB7A 4BR1A 3MSGA 1ZU8A 4FLOA 1DYSA 3CZKA 2R1NA 1LDCA 3KP0A 1C7TA 1ODUA 1QW8A 2OSWA 7A3HA 3RN6A 3NVDA 1LCOA 3WQ4A 4UOQA 1VFTA 1MVYA 4BA0A 3BE7A 4FX7A 6A3HA 2PWUA 3GXDA 4S3BA 2GJLA 1DWHM 1KFWA 4J3WA 3GY1A 5F2MA 3AO0A 4GBDA 2PLCA 2XGBA 2D2HA 4HCHA 4ZBCA 1LWJA 2CLOA 4KBXA 1FH9A 1M7JA 1DJXA 1AVAA 3AQUA 4AMCA 3LS9A 3CAWA 3WD0A 4GIAA 1CGYA 1SZFA 4JKLA 4AWUA 1XLHA 3W7OA 3SY5A 2TPSA 3K46A 3LXBA 1KFJA 5CSRA 1N8IA 3N2CA 6TAAA 2QDGA 2G97A 1BG9A 4JDYA 5CZKA 3RHGA 4PMDA 1HL2A 3VOHA 2WM1A 2J75A 3KOXA 1TWSA 4FR1A 3NJ3A 3GH4A 2J78A 3TNBA 1OM0A 1IIHA 4O4VA 1K9TA 2V5DA 4XSLA 1Q7QA 1L6WA 3W53A 4ZQMA 2DEPA 1HG3A 2E6FA 1RP9A 4WY0B 1NQKA 4EACA 1VJIA 3AWNA 4JHMA 1R6WA 4GQ0A 2RUSA 4E8GA 4U31A 1PTAA 2P5NA 3GXIA 3TQ0A 4UFKA 1ONXA 2CESA 2ZRVA 4NJIA 1GUVA 2H8ZA 3ARPA 2NWSA 3VIIA 1UKPA 1UMYA 2QLYA 3GUWA 4DNHA 4FLSA 4YTQA 2DZBA 1E4NA 1SSDA 1DJZA 3NQ2A 3H2MA 3HQNA 3QJAA 4ATWA 4DYJA 3LSBA 3HGOA 3U2EA 1PX8A 4H2HA 3TN6A 4LY8A 2VQTA 3T8LA 4EPDC 3R7MA 3ORWA 1QAPA 1OINA 1E55A 4H00A 1WA3A 2QJHA 3G0UA 3R25A 2DZUA 3TYBA 1OD0A 1JG9A 3UA4A 5TQLA 3V0TA 3TH6A 3RCNA 3FJ6A 1HFBA 2XGIA 2XN2A 3N73A 2FZ8A 2WC3A 1YTEA 1GOOA 3DGRA 5KITA 3WO8A 2PSNA 5HMFA 4ZOEA 5FEPA 3LM7A 3GNDA 4J3XA 3QFWA 4PULA 1JZ8A 3NQGA 4AD1A 3ATZA 3VUSA 1CTNA 5AYBA 3WDJA 5IM51 1SJDA 2PP3A 3W7CA 3GX9A 4DF0A 1S3HA 1W3KA 3TOYA 2CXGA 3ITTA 1CGUA 5KSWA 2GLKA 3GC2A 2AL1A 4L56A 3KX6A 4GHRA 3NTYA 3WDIA 5EL1A 2W3ZA 4R9XA 4J4KA 3VDCA 5EMYA 2OB3A 1DXEA 3QN3A 1OC7A 2CZDA 3C8FA 3K4WA 3LTSA 3WH6A 1FWRA 3TMQA 4O8RA 3HG2A 4NKCA 4AVOA 4DBSA 3W71A 1OCNA 8RUCA 2RDTA 2X40A 2WJFA 4YCPA 2GOUA 5CZ0A 3VA8A 3O8AA 2VRKA 3LPGA 4JQ4A 3NSMA 1SFTA 4ZQRA 4FNQA 1E72M 2BZNA 3UD6A 2YZ5A 4JIPA 2VZUA 1BSIA 3DFTA 1OFBA 3PTKA 4CD8A 3CHDA 3D5HA 4TU1A 4LBSA 3S2MA 5I3FA 2YA0A 1NOFA 1UG6A 3RFAA 1PX3A 4DYEA 2BVYA 2XSXA 4IP7A 4J5NA 4LUSB 1HJUA 1SUXA 4FB7A 5I07A 1MMFA 3VKAA 2YGYA 1EC7A 3BW4A 4QEHA 3SUSA 3R1ZA 4F3HA 3GIQA 4I5XA 4Q32A 3PZTA 3BLKA 2NSOA 4DJFC 5MKGA 1UWQA 4H6EA 4Z2GA 2DSVA 3W29A 1VBJA 1A3WA 1RBOB 3OG3A 4DZ5A 1XBZA 2NQZA 5D04C 1CW2A 3H2OA 3I10A 2V69A 2HPMA 2VR2A 3B4YA 2ZUVA 3FS2A 1KFEA 3CUJA 4AC7C 3WJZA 4JD4A 4DXKA 3VD4A 1QNQA 2YBVA 3VIMA 2DH2A 3RO8A 3URBA 1DTUA 1WPCA 3G1HA 1AUSL 3CL6A 1AH4A 4ALDA 1H5VA 4Q6XA 1TZ7A 2E1WA 1W1PA 1S3TC 3WMSA 4QE5A 1OSEA 3GO2A 1VP5A 3G1YA 1R2RA 5ECVA 1KGWA 2FZMA 3LHUA 4MPKA 3Q45A 4QX4A 1ME8A 2PDIA 1A5UA 1O5RA 1R9ZA 5CXPA 5G4HC 1KRMA 3QKZA 4TV6A 1K8ZA 5EU9A 1QU4A 1GJPA 5G2HA 1WX0A 3WELA 1QNVA 3OBKA 2C91A 1LUCB 2QKFA 4WX2A 4DJFD 3BLPX 4GJJA 3BAXA 1UZ4A 3AYVA 4KWOA 1I60A 3EDJA 5C6MA 1W56A 4YTUA 3QGAC 4YLWA 3TA6A 1L6GA 1ZAIA 1LWHA 3A47A 3ZWTA 5DCEA 4FNPA 1JNDA 3QVQA 2F2KA 3UJSA 3VNLA 2GPTA 1EJSC 2H6RA 2JF6A 1XRFA 1VS1A 2XM2A 1N82A 1XC4A 4FR6A 4QISA 4ECLA 3OU8A 1GYNA 1U5VA 1DVJA 4HHHA 1EQCA 1B3ZA 1HNYA 1GVIA 4JTGA 4AZCA 1KW1A 4LF1A 2RDWA 1SQ7A 3TXVA 4TOQA 3BCFA 5BMXA 3BG9A 4NJHA 4PRWA 3H8AA 4ADSA 4LVAA 3SR7A 1I1XA 4MY8A 4Q3MA 3EBVA 2YIHA 4O1FA 3A3WA 4M80A 2DQXA 4AD0A 4XSMA 3SUUA 3CIWA 3TJXA 5BZAA 2B7PA 1DXFA 3IJDA 1WKYA 5I5RA 3M0LA 1EBHA 3WK1A 1PIIA 2E4TA 3WENA 2GQ3A 2XINA 4H9YA 1E3XA 3H70A 1QR7A 1W6TA 5ABGA 1QUMA 2ZE0A 5L6UA 4E4FA 1QHPA 5TF0A 3WMLA 1KRBC 1YDOA 1TWWA 3H54A 3ONBA 3J7HA 1H1YA 5CPSA 3SY1A 1IT0A 1GPWA 4OBRA 4CNTA 2ICSA 3G1RA 1F05A 2B31A 4GY0A 4OQVA 2VFDA 3P74A 5I7GA 3N6QA 4W84A 3DH7A 3EWDA 4LCSA 4DAIA 2EKGA 3E2RA 3H55A 3SCUA 3W83A 4B2DD 1WDPA 3R0DA 4BCEA 5AYYA 5AYZA 5KZ6A 3NQ7A 3WMCA 4H9MA 3HOJA 4K6AA 4ZB2A 3O15A 2V8ZA 2X1UA 3AXIA 4P8WA 3PG8A 5FEXA 1K7EA 2E6AA 1B3YA 4GI4A 4B4HA 3VC6A 4YTTA 2BBFA 4QLLA 3RDKA 2QUTA 3TK7A 4HP5A 4TX8A 5CZTA 3ARWA 3P93A 3F4DA 4HNOA 4AIOA 1NARA 1YXCA 4PEEA 1B54A 1B9BA 3BQ5A 3C61A 4C60A 4MWAE 1AL7A 1GKPA 3URNA 3FA5A 1G4EA 1EZ2A 2TRSA 3SCRA 5B7YA 3THUA 4RW5A 4Y6GA 1CLXA 3AU2A 4LEQA 2WQDA 5LA1A 4S3FA 3WFZA 1RPXA 2NQHA 1DQWA 4M6UA 4KRTA 1SJCA 3BG5A 1FWSA 2B81A 5DRCA 3EB3A 2BGQA 2Y8UA 3QV7A 4WY0F 4XUYA 1JR1A 4DF2A 4DX3A 1TR9A 1BD0A 5LNWA 4C1NA 1TIWA 4K7VA 5MF5A 3LCGA 3QC3A 3VOCA 1E9LA 3MSDA 4JYEA 2XWEA 3NUKA 5PTDA 3DFYA 1C91A 4UNKA 1FBAA 3U48A 4IH3A 3OYXA 3BAYA 5LNRA 2DVUA 3ZLHA 2PMQA 1BVNP 1F8MA 4GACA 3OZOA 5DANA 4Z0SA 1JPIA 4GIEA 4CLMA 2CLLA 4GKLA 4U5KA 2HS6A 4HNCA 3PSVA 4KETA 1OQFA 3E0VA 4WGXA 2I57A 2Z29A 1AH0A 3VOIA 3AHXA 4ATLA 4UUIA 2WWDA 2ZZ7A 3N12A 2QQ6A 1J9YA 3PANA 4NSBA 1O66A 2ZZ2A 4OUIA 4C6KA 4WGHA 3U3HA 4N4PA 3WLPA 4DXXA 4I7WA 1LBMA 1C92A 2R1LA 3UR5A 4JY9A 1VCGA 3VIJA 3KOFA 3GU1A 1P4CA 2BXZA 1SO4A 3WYZA 3LGDA 4V28A 1SYTA 1UR1A 4YHEA 2PWFA 3VGDA 3TYEA 1EKOA 1FRBA 2QGHA 3LQGA 3W74A 2YB4A 3II1A 5CJMA 2VX4A 5KINA 1A5KC 4I9TA 4K36A 4PCFA 1E0XA 3F5KA 4IUGA 2Z7GA 4R53A 4MWAA 1EEPA 2QAPA 5L9FA 2VC9A 1AMKA 5CAHA 5CJ5A 5M2FX 2X09A 4L9XA 2GSHA 4QJ5B 5HOSA 1MW3A 2YB1A 3UP8A 1UW9A 2Y85A 3HGRA 2I5IA 4MB5A 4QM1A 4C1LA 4AG0A 5AHLA 1W31A 1P1MA 5BWFA 4D6FA 2JIEA 7TAAA 2QR6A 1HGYA 5E1QA 3TCEA 1SZGA 4WDWA 3UGVA 2XH2A 3D46A 4RJEA 1I75A 4B5XA 3ABQA 4XAFA 2CC0A 3W72A 4M5PA 4XIAA 4B3KA 4O10A 4F2TA 2NT0A 4WD0A 1S2AA 3T40A 4HPGA 1X8CA 4M6VA 4XKYB 4ERIA 1KRCC 2VFHA 5HMSA 1HJVA 3LX9A 3LGEA 3IGHX 2X30A 5AZ0A 1EHNA 4H3DA 2RH9A 3LPFA 4KIEA 1SU5A 4IPPA 4MVAA 3LU2A 5KETA 1JF6A 2QYGA 1XLJA 5AHNA 2DJXA 3UW6A 4EXQA 1ISYA 1XKYA 4GUJA 5K3VA 1K3UA 3PJWA 3DENA 1J2WA 3DGBA 4AF0B 3OLGA 1L0PA 3S1XA 1UWSA 3MUCA 2GQAA 2LLEA 4Q4RA 4OOZA 3UZYA 4HOZA 3THDA 2C7FA 3GXMA 3B8IA 2F6UA 4EE9A 1GTEA 3MB9A 3CZLA 3U7BA 4GYPC 4JTHA 4HOXA 3EDFA 2G50A 5GQBA 3BOXA 4LJ3A 3EZ4A 4TO8A 4MJZA 1ITUA 2P0OA 4O8AA 1DHPA 2J7BA 3UZJA 2CZVA 3OGVA 1UZHA 3T0DA 2ZZ4A 3FY1A 4I8YA 1U30A 2PTYA 4HPXA 4H83A 4GO8A 5EMJA 2VX5A 4ERAA 1XCFA 4P5UA 2ZWZA 4LSBA 2V6AA 2CYGA 2Y2WA 1X1ZA 3EPNA 4S3AA 4KEUA 3VOJA 4DJEA 1FUYA 4FF5A 4GO9A 4E38A 5SWUA 1UJPA 1RVKA 4C7GA 2CLFA 2FJUB 4IT1A 4D1JA 3BGGA 3PZQA 4PUNA 4E3VA 3QY7A 5ABHA 1CPUA 1XISA 1S5NA 4OZOA 4C6PA 1CXEA 4LNYA 3WLMA 3L4UA 3VNMA 1MDLA 3T78A 1VH7A 5BXTA 4HSOA 3M0XA 1EP1A 4P7NA 3GTNA 1BVZA 5HNUA 5CG0A 3GFXA 3PPGA 3TTOA 2R14A 3R43A 2PDPA 4PTXA 3BURA 4LT9A 2QAFA 3GU9A 3QHNA 3MMWA 4HCLA 1F76A 2WSRA 3LCHA 4HZ8A 2XDFA 3K8MA 3N4AA 3N4FA 4GYKA 4AZ5A 1JRBA 4LV9A 3OHIA 2Z6JA 4U2YA 3DBPA 4BEQA 2EQDA 3W1AA 2QVNA 1RP8A 3IUIA 5HPCA 2P10A 3A12A 1JPKA 1GQJA 1EXPA 1DKWA 5BOOA 4ONVA 1J96A 3EDEA 3QYSA 1JYNA 4A4AA 4L1GA 4OUEA 3EWWA 4LUJA 3BTNA 4ZSTA 3PZIA 5FAGA 1MQQA 5HXMA 4Z1DA 1VEPA 5CBJA 1YNQA 3GBEA 2RGLA 4BQ3A 4OGZA 4LRSA 2D22A 4PL2A 3MTWA 3T42A 3VNIA 4CQCA 1B9ZA 4MAVA 5DMMA 3W6YA 1KBKA 2VR5A 1BQCA 3DHPA 3U0HA 1SPQA 3S2NA 5GNZA 4QSFA 4JAWA 2DZXA 4O50A 2A3LA 1IQ8A 4Q4OA 1TPB1 1Q8JA 2GZXA 5C0QA 2FPYA 4UIOA 4JIIX 4ACZA 4URIA 4OIFA 5LXEA 1M6JA 3T8QA 4AIBA 1IZCA 1PSCA 1E1FA 1FCVA 3LDVA 2C0HA 4QDPA 2UY3A 1JXJA 5GJNA 2GGIA 5A6SA 3SRKA 3KW3A 2Y89A 5JH1A 4HPJA 2WC7A 3NPXA 1IE7C 4BF9A 2KAUC 3B0PA 1V3KA 4RV3A 3V5CA 3GWQA 1POJA 4AZGA 4XKYA 3FCPA 1XHGA 5DX7A 4P8VA 3OEXA 3PSWA 2AMGA 2CCRA 2WMGA 3DIPA 3LMYA 2G37A 3M64A 4P8XA 1JYWA 2PDMA 4ICMA 3W2JA 1S38A 1G7VA 2EPKX 2H9AA 2HPIA 3IJ9A 2QMJA 3BPWA 2PDGA 3WF3A 2PD5A 3WNKA 2PF0A 2C13A 1M53A 2A3AA 3W22A 3LRLA 5I23A 4IJBA 4A3UA 2OKTA 4K39A 5HAOA 3O6AA 3W73A 3ZVHB 3NO5A 4MNMA 2QCDB 1SMDA 2QS8A 3ONCA 4GX9A 4J3SA 4PEKA 4EAMA 4O17A 4N4QA 1HT6A 1OFRA 4DEFA 4PSRA 3N6HA 2PURA 4IM4A 1V08A 2HBVA 2NX9A 3TV8A 1G67A 2GOKA 2WZTA 1B3OA 2OX1A 1BRLA 2O0TA 4XWUA 1EJWC 1XIBA 3A3XA 2X0YA 2Y0FA 4Q4SA 3QZEA 2CPUA 4JTLA 3WNNA 1V03A 3UERA 2XH7A 1H09A 1DJWA 2YCLB 4XUGA 1IEVA 1TMQA 2NT1A 1A5NC 1DIDA 1RY0A 3VK5A 4W7WA 2JQXA 4DHGA 4IMAA 2JGQA 3N25A 4XKMA 3JVAA 3CH0A 3VMPA 4F0LA 1XBYA 3S9ZA 1XYAA 2HBXA 4LX4A 4FNRA 3QV8A 5E0CA 3ZO9A 4BWLC 3AALA 4DIAA 1U1JA 1VLWA 3TYZA 1WUEA 3CUXA 1LOQA 3L0NA 2Q6ZA 3V36A 2D20A 4S1FA 2V30A 1M01A 4FXSA 2V2DA 5HWNA 4JTKA 1DWIM 3VIFA 2QCFA 3BICA 1TPDA 1D7KA 4C65A 2JBMA 3UWVA 1MNSA 3M0MA 3CV1A 2VP8A 2C1HA 3WD1A 3AYRA 1CXFA 1EA9C 4W7UA 2XFYA 2VD9A 4AXKA 2NLIA 4X9YA 2YOCA 2B0MA 2CHRA 3WQWA 4BFAA 1E6PA 3VNDA 3K2GA 4XTDA 1RK6A 2QCNA 3GK0A 3WD3A 2A21A 1H41A 5AYXA 3W7LA 7XIMA 1YX1A 4IGSA 2FPTA 1V0NA 2A3CA 4O54A 4LUIA 1B3XA 1E56A 4B90A 1GKQA 3FJNA 4GH1A 1IXNA 3UWQA 2P76A 3A23A 1V93A 1AK5A 1XQLA 5BYWA 3RM4A 5BRQA 1M04A 1DIOA 2A6LA 2YDSA 1EHAA 4PYSA 1IT8A 4MDPA 1ZHAA 4LB3A 3GFYA 1E51A 1EX1A 2G5WA 3QR0A 1BKSA 1Q6DA 5FD0A 1XGZA 4O57A 3O0KA 3CB3A 3SCWA 1EA0A 1F74A 2FHCA 3AICA 3PC0A 1W1A1 3QXBA 4B92A 4JNZA 1PEZA 2OCZA 4I6VA 1K1DA 5E0KA 5AC8A 2NX3A 4LY4A 3W02A 1E71M 3NFUA 5AHFA 1S1RA 3UXKA 3O2LA 1WZAA 3W1NA 2CBVA 3GB6A 3TZFA 4DY1A 4YS1A 2Y6ZA 1E70M 3G1DA 3I6EA 3VO0A 2GYIA 1B0IA 2DUZA 4KRUA 3LLDA 2YW3A 1Z32X 1A3XA 2AL2B 2AGKA 3UEQA 3KXQA 5DXYA 1I1WA 4H9UA 1GOQA 1UP3A 3T4WA 3WH7A 3QC0A 4KKXA 2XM1A 3IVTA 5F1VA 2ZX7A 4M7TA 5G5IA 3BDKA 1UKQA 3OPSA 4L61A 4PMNA 4K1GA 3AIQA 3WF1A 2D0HA 2VZOA 3BXWA 3UXIA 5HPOA 4J1OA 4JEQA 1ZAJA 3VPLA 2QUMA 4UOZA 3B9OA 3NG3A 3CQJA 1ESWA 2V3EA 1KWKA 1XIGA 5XIMA 2WYSA 3A5VA 2I14A 1TVNA 4G7EB 4A3RA 4JTJA 3MI6A 4L4PA 3V1HA 3SZ8A 3WLJA 1Q6EA 1B3WA 1FDYA 5CPMA 3LOTA 4QTGA 3QGKC 1CB2A 1QW9A 4NXSA 1VIWA 3HU7A 1FHUA 3FAWA 4N9BA 5FL0A 5FSDC 1EJTC 3W3OA 4GD0A 3E5BA 1BSLA 1A5LC 4F9JA 3KLKA 2DORA 2NVAA 3C2OA 1QVBA 1PYMA 2XJ7A 1GYLA 5GJMA 4AD2A 4S23A 4LPCA 1R7OA 4R88A 4UQ9A 3WDHA 1TPUA 3LNPA 2YR1A 4WVXA 4W87A 3UPMA 4GI6A 1JUBA 3BJTA 1W32A 2XIJA 4ZB5A 1NFBA 4WR3A 1W3HA 4NAFB 1TJPA 2FDSA 2J9XA 5ENLA 2VEMA 4CN4A 2PC8A 3KUMA 2BY1A 2RAGA 3VGBA 4HNVA 3VCCA 5I6SA 4KCTA 3VZYA 4ZA0A 2WC4A 2V38A 1LLWA 3AC0A 2PDBA 4INFA 3RXZA 3W7IA 2CKRA 1ISWA 3TC7A 5ABEA 3AS0A 1L6SA 3M07A 2E6YA 1LT7A 4XQ6A 4HCDA 4G7FA 4AW7A 1HUVA 3PFRA 2Z6IA 4D6IA 2BY3A 1PZ1A 4C6OA 5HQLA 1P48A 4NZ5A 1G4SA 2V9DA 4H41A 3UNTA 1QBBA 3L0KA 1NWTA 4N9EA 1XLDA 1HKMA 3WH5A 2XTKA 2OVLA 1LJYA 5HK4A 3KRBA 3AYTA 4OHQA 2PP0A 2NWRA 4C5ZA 1PKNA 3OYZA 4DO7A 4LF2A 2BS9A 3IIXA 4IX0A 1XDLA 4L1XA 2E3ZA 4RCXA 5I3JA 1E3ZA 3QTGA 5HATA 1EEXA 1XINA 1E5NA 4YL2A 2WSPA 3UG3A 4C90A 3PWGA 4E8DA 1IZKA 3MDUA 4J40A 1WZMA 5D30A 3EOSA 5D38A 1E6QM 1BXBA 1K03A 1XJBA 3L9CA 4B4FA 4REQB 1RLDA 3DHFA 1T0OA 4UOJA 4H1ZA 2FVKA 1GQIA 4KW2A 2JIWA 3GAYA 1RD6A 4NP7A 3W82A 2CFFA 1MI3A 3VNZA 2PDNA 4IP5A 4OV9A 3PTDA 1BAGA 3O0FA 3SN4A 4G2DA 2A4AA 3BARA 3OVGA 1SM9A 4HU3A 4GNVA 3VKDA 2YBUA 2ZXDA 1ZS2A 2DZAA 1SW7A 1P43A 1EPVA 1FXQA 2BHYA 4GI9A 3KRZA 2Y88A 5HANA 1HGWA 3PP7A 1R8LA 1WBJA 1XLFA 5A8MA 3T2OA 1X38A 2OG9A 3B8VA 3PB2A 2WMIB 2ZVRA 2GK1B 1AW2A 1FWTA 1OX5A 1XYLA 2GJXB 3BLDA 4DUOA 4MWAC 1EFZA 4RZ6A 1ZZMA 1E1EA 5FF0A 4XX6A 1H7PA 2ZWYA 1KCZA 5DCDA 1CBGA 3Q2DA 1FWWA 3C2YA 1T5AA 3CGTA 2YCEA 5JBDA 3AMDA 1S5WA 1VENA 2FH8A 3S2LA 3I4KA 3QQ1A 1TV8A 3AUOA 5ABFB 2BOEX 2EJ1A 3MP5A 3FLUA 4JCLA 1DOSA 3HA1A 2X05A 4OE7A 1Y8BA 3NA8A 1OCJA 1EGZA 2FTYA 3DUGA 4HMCA 2EPHA 2ZTKA 3MMDA 4PB4A 4LS2A 4F66A 2PTWA 3EMZA 3LI0A 1BEUA 2Y7FA 1WKFA 1OK4A 2PDKA 4PBGA 3VE7A 3CHCA 3FYOA 1YPXA 2VD8A 3TKFA 1UBPC 1K4HA 3RM9A 2RJHA 4F2UA 4FLRA 3ABXA 3NDOA 5F2LA 4H19A 5LKYA 2B7OA 4XK2A 3MUAA 2CITA 3EEGA 3Q58A 1UD3A 4AC1X 3L4YA 2DP3A 2X0SA 4NZCA 5FEZA 2E1DA 2INEA 1HKKA 2W5FA 4MZYA 1E6RA 5LNVA 3CUHA 4HYVA 2GGGA 4YIWA 4AXNA 1BTMA 2WNWA 4RDYA 2PU1A 1SMAA 3VAVA 1J5TA 4PRTA 3B8TA 1BWKA 4CVUA 4AWTA 4ML9A 1OVDA 5GJPA 4Q4KA 2XIIA 3PZVA 3NYDA 1QFEA 1YQ2A 4FK9A 1RSCA 1RPKA 4ROQA 1LM1A 3GG0A 4MWAD 4OECA 5XINA 5CPLA 1ONEA 4E2DA 2OWCA 3PULA 2OLSA 1QK2A 2XFWA 4KCVA 4POCA 1X98A 4JYFA 4EP8C 1YPFA 1X97A 4XISA 1BXCA 3G77A 3BSHA 1I45A 2HNHA 1EDTA 4KCWA 4GVFA 3V75A 3FA3A 4GGHA 3ITCA 5D4YA 1POKA 1J4EA 5BOFA 3DXIA 1GG0A 5BROA 2A7PA 1JZ5A 1EDQA 3EEZA 2VFFA 3GQYA 4MB3A 4ZQCA 3ARUA 4ZODA 3NQCA 5KMYA 4X60A 2YDAA 1FCBA 2ZOXA 4Q7BA 4D1IA 1KQYA 3P0WA 4O16A 3Q37A 4KCUA 1A4MA 2CHNA 3K4DA 4DJEC 1GT8A 3C5QA 5U7SA 3G1AA 1AFSA 4KRZA 4UTIA 1W1YA 1Q5MA 4LAUA 2ESCA 4QG9A 2Z2AA 4N6FA 3THAA 2ZC8A 3RG6A 4WKHA 4Y7EA 3RM8A 2Q01A 1JCXA 5AVHA 3H23A 3LY0A 1VBRA 2P3ZA 4QP0A 2XG9A 3OODA 1JUKA 2PD9A 4M24A 3DKJA 1IGSA 3B9NA 4X61A 4F40A 1FY6A 3QEZA 1RVGA 1XH1A 2YCJA 3LRKA 3S0CA 4ZXLA 4RUBA 2CLMA 3E9AA 4ZENA 3I3DA 3BAJA 3VCRA 1ISZA 1CECA 4NI8A 1Z6KA 3ABRA 1F3WA 3QHOA 3G22A 2QUVA 1JVNA 1VRDA 4NYYA 3VKJA 1PCKA 4S3KA 4XIMA 4RPQA 3CUFA 5A2BA 3MC5A 1F07A 2VGIA 1F61A 4O13A 1XIFA 3CL7A 1GEQA 3AROA 5JQ9A 3ZJ6A 1OGBA 5A8PA 1QRQA 2FZDA 3NL2A 3MVTA 3E1F1 4JFWA 3EX4A 2JGYA 4E2OA 4JZ5A 3DG6A 4HJWA 3SURA 2PUZA 5JU6A 4NJJA 1XGDA 3APTA 1QASA 4YPJA 5I77A 4DJED 2OFJA 4QDWA 1WAWA 4ERGA 3SCQA 1SFLA 5D37A 4GQQA 4EWJA 1XLCA 1WO2A 4HA4A 3NXFA 4UC5A 2WJDA 3WLHA 4R7JA 4WSKA 5A1AA 5EMMA 4HPNA 3GVRA 2PTZA 1MXSA 4IQLA 3LCWA 2OQYA 3RILA 4IL2A 4C91A 1AW1A 3GKFA 1F6KA 4PZVA 1RR2A 3O16A 3GDKA 4L7ZA 4JTIA 3LHYA 1TVLA 3VINA 4LH8A 3TC6A 3WD2A 4NAEB 3LUTA 4Z42C 1XYMA 4GVIA 4C6QA 4RE0A 2FGZA 2WLZA 1OF6A 5ABFA 1OJXA 3GW3A 1UD4A 3E96A 1UCWA 2YPIA 2B7QA 4LCRA 1XYBA 1XXXA 1DHKA 1XD0A 2WCAA 4KS0A 4J2MA 3S1GA 1H4PA 4GZIA 3TQPA 3KFTA 1OFDA 4IP4A 4UR7A 3ATYA 5FESA 4UNLA 1GZ1A 2OT1A 1B3VA 3MWCA 5DBTA 4Z08A 2Y4SA 4YCOA 1KFLA 4L65A 4YYFA 1VJZA 1G4PA 2QW5A 4YHGA 3SSJA 5EYWA 3BOLA 4Z2LA 3HGJA 2GSJA 5AHMA 2W67A 4L9YA 1Y5WA 2CLHA 3UPBA 3R89A 3KBWA 5LNUA 3S42A 4D6JA 5AY7A 4MKVA 3RAOA 3QMSA 2ZX8A 3KL0A 1UH4A 4KT2A 2J8GA 1V4YA 3GVGA 1QNRA 5TAOA 1TQJA 2IMRA 3E12A 3E3HA 4WJ8A 3W2UA 2PP1A 3RPTA 1S5VA 3FEMA 2QGYA 1R3RA 4FXJA 1TFVA 4QJ1A 3U2OA 3CH9A 4MUZA 1UROA 3ZWSA 2CEQA 3UU0A 3O3RA 1KV8A 1U1HA 1WV2A 1JYVA 1Q3NA 1OX4B 4QSHA 3H4WA 3T81A 5IOBA 4UNIA 1XW8A 2VOMA 3RLUA 3VOFA 3CLMA 1XH2A 3H2AA 1IEQA 3HG4A 4AB4A 4X0NA 2BOFX 3PZ9A 3OHMB 3M1ZA 4O1AA 2ISVA 3USBA 3B8UA 3NQMA 3M41A 3SY8A 2XVLA 3GW0A 1L6YA 4H8UA 5EKYA 1GW9A 4W7VA 4AZ7A 1HP4A 1ZNNA 4GXWA 1QNPA 3BAWA 2Y5SA 4W8BA 3A9IA 2R8WA 2XN0A 4QCEA 4CKQA 4AY8A 3UWYA 4RZ4A 3SADA 3WNMA 2C71A 1GEHA 1UP2A 5K7JA 5LIXX 1KC7A 4X2RA 2YL6A 3P81A 3SIZA 3EWZA 4K8HA 3ITGA 4QITA 3OBEA 1U5HA 3AIWA 3K30A 1G0CA 1KLYA 1ALDA 2NXGA 1EIBA 4KWVA 3WSUA 2D2OA 2Z1SA 1J01A 3STPA 4JXCA 2YDQA 4AX7A 4QAIA 4LU0A 1ZP4A 4IHCA 4DZHA 4GABA 5T9CE 3B9EA 4JFUA 4YJ5A 3WLQA 3GDLA 4DBUA 3KCJA 2FMOA 3FAXA 2YCKX 1CXKA 3S9YA 3RF9A 2J7DA 1IYXA 4UTLA 2Z0IA 4IG2A 3MYPA 2INFA 1G94A 4G1KA 2XIMA 1F9CA 1UQZA 1VBGA 5M03A 1E9YB 2R82A 2F6XA 3GSMA 5JIPA 4IXHA 1F4AA 4D6EA 3TJLA 3GHSA 2FPVA 3ZMRA 3ZOAA 1XWYA 3EWBX 4UR9A 2XVPA 3DFPA 1XLIA 3T0AA 1JNEA 2BHZA 1U5JA 3FV9A 1TV7A 1XQKA 3CZ8A 3KTSA 3BK0A 1ZP3A 2W4XA 1AL8A 3M0VA 1OT1A 2EJAA 5AOUA 1FVPA 1WDSA 3F4VA 4NNBA 3HIJA 5CC7A 1TO3A 1K8YA 4OJYA 1XSJA 5A2CA 3S5YA 2UY4A 2VI0A 4JICA 2G8ZA 3W7RA 3V18A 2BWGA 3LPOA 3PZGA 2WLYA 4A3QA 1MFUA 1ZTVA 1TIMA 4QROA 1V8EA 2JALA 2OZ8A 3WJSA 1GCYA 3TYAA 3BZGA 3AHYA 3R5EA 1NIUA 3WBWA 1CB7B 2Q8XA 3ITVA 1LWIA 3DG7A 5M5DA 1GVQA 4C6MA 4AX6A 2J66A 1ICSA 2RKXA 7REQA 1ML1A 4G1NA 3W07A 1PBGA 1O6IA 3LN3A 4IIDA 2TMDA 2WCSA 2AKZA 3P8IA 4W85A 3HFTA 3LBOA 4CU7A 1JDFA 2QDEA 3GYEA 3K5XA 5FA5A 4S39A 4WK9A 1BGGA 4XZNX 3SCTA 2PWEA 5CC6A 1T96A 4ZE5A 2GDVA 2F84A 4QNEA 4UMAA 3G8EA 1K7FA 1JZ7A 1VR6A 1BYCA 2R9RA 4BQ5A 2XIOA 1SW0A 4GX8A 3VU2A 3WL0A 3IWPA 1V6WA 5BXRA 3ECQA 4BKNA 2VEIA 2G3JA 3G1SA 2EGZA 4RXFA 4QJ3B 4F48A 2V3GA 4PA8A 1NOWA 4JTSA 1FFRA 3CTTA 3UESA 3R0KA 1RJRA 3P7YA 3RYSA 5G2IA 5A6AA 4MZ1A 4YU1A 4AIUA 4JX4A 4K38A 3N18A 3PWAA 4NRRA 3C0JA 3L21A 4GQBA 4UTHA 1XF0A 4KFNA 2GVJA 2CLEA 3AISA 3W85A 2QDDA 2OWXA 5T9BG 2WJEA 1BHGA 4Z0JA 1ONRA 2ZRWA 3IJQA 3W7KA 3SGGA 1H7RA 1DTNA 3WEMA 3QSRA 4IMCA 3LV6A 4WEVX 1ONWA 3POCA 3HBLA 1HKJA 1EL3A 1BWVA 4LANA 2PDJA 3KE0A 2ABBA 2J13A 3R94A 1FTXA 3IGUA 2J7EA 5HA7A 1LBLA 4S3JA 1P1XA 5D8WA 4XVDA 4C6DA 2KX9A 1MYRA 1XIEA 3KOZA 2HDJA 3GHTA 1SW3A 1TUFA 3APYA 4BI6A 4HZ7A 1I2PA 3OLIA 4MF4A 2ZZ6A 2WBKA 3N1AA 3EOEA 1O95A 3GXPA 1V77A 9CGTA 3AMCA 3V1PA 3UG5A 5CGMA 3WBAA 2D69A 3VUPA 3F4CA 2J77A 4EF8A 3B0UX 4WHBA 3CC1A 4L9ZA 1CXHA 4GE8A 3LTPA 1TKKA 1UC5A 2A79A 2WV8A 4JCMA 4ZGYA 2CIPA 2EPNA 2ZUMA 3DERA 3RR1A 2NXIA 1CZ1A 3CWOX 2VGFA 1UD6A 4H6RA 1BPLB 4QEEA 3LCIA 1SSGA 2Q3OA 4MG4A 2PDHA 3VD7A 1VFUA 1QBAA 4NZ1A 3C3UA 4IOTA 2X0HA 4ZR8A 3CMGA 2ZC1A 4ZVJA 3ALGA 5GPRA 2JFEX 2VX6A 3UY8A 4ZB0A 3GG7A 2PZ0A 2A3BA 2Z26A 2OZ3A 4DZIA 3CXOA 3TW6A 1W17A 2FZ9A 2GQ9A 4DVOA 1QI0A 3S2JA 1LYXA 1PVNA 4I7UA 1VZWA 3GXNA 4PTMA 4UTJA 4UQBA 3C56A 3W7EA 3LB0A 1UWRA 1KBJA 2OEMA 3W2KA 4W9TA 5FKYA 5HWMA 4C6LA 1F6YA 4JTEA 2B4GA 5G1YA 3EPOA 1VPXA 3S5NA 5FL1A 4O1EA 5G1TA 2P50A 1EXBA 5KZDA 5U4NA 1BG4A 1IWAA 3ERPA 3HJZA 1OCBA 3DECA 4ZO9A 3TJIA 3L2MA 1NH6A 1W8GA 2QVHA 2FQIA 2Y7DA 4MGGA 4MNKA 4IIHA 1VYPX 3GLCA 1I9CB 3U2CA 4J27A 1C8XA 4XZIA 4P7OA 3TROA 2KZHA 1I4NA 2VRJA 3MUIA 4PH6A 1SR9A 1L2QA 3OP2A 1JAKA 3BSGA 4YN5A 3RJXA 4CCCA 2WHLA 1VFMA 4TX6A 2CWXA 3HF3A 3MUZ1 3QLDA 1GZGA 3NQAA 4IX2A 4MFEA 1ZBWA 3JZEA 3QQ0A 4P7LA 1BF2A 1ECQA 1UD2A 2BXVA 5REQA 4O11A 5FF7A 3GDRA 3PPHA 3SQSA 2VC6A 1ADDA 4FZIA 3BCJA 3ZYZA 1JGIA 1U2YA 3W7HA 3CEPA 4TTUA 3C4UA 4A8NA 4M6PA 1RCQA 1OYAA 3MS8A 2HVNA 2OZTA 3W6MA 1IHIA 1W3IA 3T0BA 3NDYA 2VURA 1SFSA 3DX5A 2FFCA 2WZEA 1GZJA 1FWAC 3Q65A 1ZAHA 3G2GA 1KXTA 1EP3A 4OV4A 1HL9A 1NQ6A 1FWDC 1DWAM 4DBWA 5HR6A 1EDGA 1JAEA 4JFVA 4W8LA 4UMCA 4PMUA 5H8MA 3EB4A 1UR2A 1TJ0A 1IEIA 1XYZA 2J9ZA 5CH9A 1M41A 4O4WA 1GVSA 2VYOA 4GKTA 3M4HA 3C2EA 1XG4A 3DDMA 1A3HA 5CZSA 4MYAA 4WKFA 4O12A 1HP5A 3OQEA 2O9OA 3OLDA 3UCCA 5D9OA 3C0QA 4LBUA 3PK7A 4EF9A 3I7RA 4GYFA 3MYOA 2CBUA 2ACUA 1DV7A 3CQIA 4XO6A 2I5QA 3NIYA 1AZ1A 4LAMA 1Y5XA 3U57A 3DC0A 2J7CA 2FVMA 1NF0A 3M5VA 1K02A 5LSMA 2QT3A 1OX6A 3PAOA 3VDGA 2O9PA 4C6IA 1BF6A 2QXWA 2ZFAA 3SGUA 3NQEA 5C9RA 4X3ZA 1Z48A 1Z7AA 5FJTA 5H8UA 3TONA 4DLMA 4AWEA 1UZ1A 3UJEA 2ALDA 1U1UA 3S5SA 2QCHA 2WMFA 1X96A 2R1PA 2Z27A 1ZBCA 5CPOA 2ZDRA 3M0IA 4IZGA 3S4TA 5HMEA 1KFKA 5DY2A 3OZYA 2Z28A 2TYSA 3ARTA 4GG9A 5HQEA 2YCIX 2F61A 2WKGA 2E25A 1UUOA 4O28A 2VVNA 2BHUA 3BG3A 1WNOA 5D2XA 1JRCA 3UF9A 4LUTB 3JU2A 3AUJA 1KR1A 4RKAA 4KQNA 5E6ZA 1ZCOA 1REQA 3WQEA 4PL1A 1S2CA 4CU6A 1H7NA 4FP1A 4P8UA 2C1IA 2D23A 4RNJA 1FA2A 3AIRA 4AY1A 1CIUA 4W5ZA 2XSAA 1DL3A 1J10A 3BMXA 1G7UA 4MDOA 4KF1A 4S2CA 3FFSA 4QS5A 1I2OA 3NZQA 5DBUA 1JZ3A 1JZ4A 2WMJA 3RO6A 1R5YA 1WB0A 3IRSA 4GYPA 1W9DM 5GNXA 1YADA 3EB2A 4B5TA 4Z1AA 3BAIA 3HO8A 1GOWA 5CJNA 2CZFA 3VNKA 7ENLA 2J62A 5D03A 1R2TA 4PR4A 5D8ZA 1H7WA 3P14A 1QOPA 3G0XA 1US2A 2MNRA 4H2CA 1GVRA 2ISSA 3A21A 4R9OA 1MEHA 6ALDA 3GR8A 3ZR6A 2VZTA 1TX0A 2WVVB 3CZGA 3NPVA 2PLJA 5BXPA 4JTUA 2VZSA 2XIBA 3ES8A 2OPJA 2NVCA 4HZMA 3GUGA 4C1KA 4J3VA 2VHLA 3P5YA 1HXJA 5CLTA 3P0XA 2DVTA 3WQGA 3IACA 4GK8A 4QHRA 2IXUA 4DN1A 3N9SA 1F2JA 4Q7NA 4GFIA 1Z8AA 1Z44A 4A8LA 1NWRA 4C7DA 5FJIA 4GFSA 1GGOA 1FH7A 2IQDA 3VIPA 3T2PA 4V33A 4B5NA 1R3TA 4A05A 1SO5A 4JPGA 3CHEA 5KZMA 3TWBA 1PDZA 1DQXA 3QBUA 4MJ4A 2VGGA 3SCPA 4RNFA 3N29A 1NAL1 2OKOA 1FFQA 1R85A 3FXYA 3I6RA 5C7VA 2OXNA 4AZ6A 4O0KA 1GPFA 4JL1A 5E0FA 3EOLA 3RGTA 5EMUA 3DYPA 1J11A 4M56A 1ZALA 3WIJA 5EBAA 5DMYA 4B3ZA 1JPHA 4JKMA 3W1QA 3UCDA 4G9PA 2DQWA 3ZT6A 1P7TA 4IIFA 2CLIA 4GC4A 4P2VA 3CB8A 2VVSA 1YLVA 5JMUA 1F5ZA 2E8ZA 1ZJBA 4EAYA 3ZM8A 4MLRA 2J8FA 3QH2A 1THFD 4C6FA 1V3LA 4WJEA 3TA9A 1ZSXA 1V0KA 3VI2A 1EC9A 4N9DA 2ZZ1A 4XZHA 3CLWA 2H3DA 2IKJA 3SEPA 5FCZA 1D9EA 4F9DA 1M3UA 3FGCA 1D2KA 3EKLA 1KFBA 2Z00A 3HN3A 3S8HA 4BK9A 4B5SA 4P61A 2WNZA 1AQFA 2OQHA 3U5YA 5HMDA 4L64A 2ATMA 1W5MA 2E7FA 3FSUA 1GJUA 5BRBA 4E4UA 4DUWA 2W27A 1MXGA 3CUGA 2JK2A 4O18A 1IXQA 2ZUNA 4GRSA 3M5YA 3QSTA 1ZCCA 3GXTA 5FIPA 1TMLA 4LYRA 5T91A 4HSNA 3UZXA 1X6LA 3LLFA 5RUBA 3M0HA 4PMXA 1UWTA 4GYJA 1EIXA 1XIMA 1V3HA 1OIMA 3GDTA 4N42A 4C6EA 1EBGA 3W7QA 1JCLA 3K1DA 3TSMA 1UWUA 2MUCA 3A4WA 2BOGX 2OO0A 1E1CB 3TYDA 7ODCA 2EPMX 1S5TA 3UGRA 1K77A 3KBJA 1JI2A 1TJ2A 2ZA1A 2C0AA 4NU7A 1XLEA 4O53A 3O07A 1DORA 4PMQA 3MHFA 3GFZA 5DQPA 4GY1A 2WKLA 3GNXA 3B40A 1MUWA 2GDQA 3CMJA 3M43A 5DT7A 4OFCA 1Q66A 2ZE3A 1AMYA 1C29A 1PE1A 4LVFA 5MHBA 4JTFA 3WLTA 3G3MA 3QOMA 4IMDA 3SGZA 1Q6RA 1G69A 1R87A 1RALA 2J7FA 4J2PA 4B5UA 4TVCA 1NP2A 1EPXA 3FVDA 1W1B1 3W28A 4ATDA 3JUGA 3W0KA 4NUWA 3S83A 2PGWA 1XH0A 3N2MA 4FNSA 3D3FA 1XICA 3KVLA 5BMWA 4LYPA 5K4XA 3DFSA 4XD3A 4W8AA 1R0MA 2I9UA 1YBQB 3EDKA 3HGSA 2Y8VA 2ZDSA 3S6TA 3DESA 5LIYX 3GIPA 5HWJA 2E67A 1KBIA 3KCLA 2E5CA 3OA5A 4A29A 1PXGA 5A8NA 1GONA 2Y70A 1TA3B 4MUPA 2P8BA 5ECUA 1R3VA 1EQPA 4A2SA 2Z24A 4UTMA 4HN8A 5D9MA 3AZTA 3USZA 4DUXA 1TVPA 4IJRA 3BV4A 3E2VA 4GBUA 2BVTA 2TAAA 3RLVA 3PUOA 4B9YA 4FEZA 1NSJA 4US5A 3UPWA 3RIKA 1R30A 1VEOA 3WDQA 3NOYA 3ARVA 1H63A 1Y65A 1W0MA 3BMVA 4LB4A 1KM1A 2I56A 1P0KA 2CWNA 4BI7A 3PBVA 4DNMA 5C9WA 1EF3A 4UMBA 3QM3A 2P1FA 3HFYA 4TIMA 4MNLA 1KXVA 1BVWA 1ADOA 1LG2A 5BU9A 1Q13A 1RBAA 1UA7A 3SW6A 4BWLA 2R24A 4ADUA 2DZVA 4UQDA 5C9ZA 4NZ4A 2BVDA 3BLIA 3CTLA 4QAWA 3IIVA 3GG1A 2GSEA 1XS2A 4GVHA 5LA0A 4MZ8A 2WZIA 4UXDA 2HVMA 4EANA 4JQAA 5E9XA 4XO7A 4AU0A 3VC5A 1HF6A 1QO2A 3OB8A 3W7DA 1O1HA 4IMGA 5B80A 1EJVC 2D3LA 4Q8QA 5F2GA 2VFEA 2VM8A 5E6YA 4N7QA 2FZNA 3F2BA 3DYMA 2DPEA 8XIMA 3CPGA 3UJ2A 3PPFA 3AHZA 4IMEA 1UA3A 3M5ZA 5JBFA 2NUXA 4M8UA 2UV8G 3SB0A 3U2ZA 1OFPA 3VDHA 1DIEA 3OVPA 5H91A 4HIBA 2OO6A 2VENA 3LXAA 4HD5A 2POZA 4WY0A 4E2VA 3W7JA 5AKQA 2DW6A 4RDVA 1MRQA 2FDMA 1RZMA 1R9XA 1EX5A 2W9MA 1LZOA 1O5KA 3NOEA 2ZX6A 4R7WA 3TN4A 1PCWA 3WQDA 3ARZA 3CZJA 1YTKA 3FKKA 3R11A 2G4FA 3OZPA 3TEVA 3FIGA 2ZZ5A 1UPPA 3VOGA 4Y2WA 3NPWA 5CC5A 3BO9A 3C3NA 4HN4A 4RL3A 3LPPA 4IIEA 4IFKB 4N2YA 2QIWA 2PAJA 4HZ6A 4RX0A 2X7WA 1QHOA 1TE1A 3UXAA 1Z9AA 1N2VA 2WANA 2O55A 3LENA 2YKKA 3M9YA 2CZ5A 5CG7A 1E1CA 2V2HA 1VJSA 5D2YA 3LCFA 1FKXA 3MZ2A 1W3NA 3CNYA 1KRAC 2ZXAA 1FWEC 1LLOA 1O5XA 3V16A 3W26A 2ISWA 3S47A 1B30A 2UY5A 2GJRA 4KPLA 4FF7A 4MKSA 3CHVA 4PBFA 3EA3A 1E0UA 4DQWA 1TR1A 3LK6A 3QY6A 3R8RA 4G56A 5J04A 1PO9A 3WQ5A 5HJLA 4WJXA 1A50A 1A5BA 2FGBA 3G6MA 1QMLA 1HQTA 3D3AA 4QQUA 2WPGA 1OADA 3MJMA 1QPRA 3CWNA 8XIAA 1KTBA 3UBPC 4DM1A 3W2LA 5TNVA 2WAGA 2G96A 3ABZA 2UZ9A 4NJGA 4U5IA 1YBQA 4K3ZA 3EPMA 1GOKA 1E6SM 2GQ8A 2VO5A 3ISIX 1K8CA 4JIEA 1PV8A 3GVVA 1GORA 1PZ3A 4D8AA 4ACYA 4O0ZA 3FHQA 3VGEA 2X2YA 2WHMA 3P60A 1XLBA 4I9MA 1FHVA 4LUSA 5D9PA 3ZR5A 3A4AA 1QOXA 4DO4A 3K1GA 1P0DA 4KGJA 6CGTA 1J0ZA 8A3HA 2VR4A 1TJ1A 4H9TA 1OEPA 2Z4GA 1V02E 1G4TA 3UY7A 1KXHA 4XD4A 3E38A 2GL5A 1XM3A 1U33A 4LYKA 5JH2A 4PE8A 1G01A 4F4RA 2NVDA 3VM5A 3B04A 4NASA 1YKWA 3DZ1A 3TC3A 3TTYA 3SECA 1JPDX 3IEBA 3VXGA 3PS7A 3GH5A 1G5AA 4FLQA 1F3TA 2W0UA 4EVZA 1E43A 1OY0A 1D3HA 2V2CA 2ZXQA 3KTXA 4S38A 5F2IA 2Z1BA 2PA6A 1C90A 1UZDA 2HMCA 3DKLA 1E6NA 3T55A 4TUFA 2GGHA 2GWGA 6REQB 3H2NA 1B5TA 2VXNA 2FIQA 1IF2A 3STEA 3P67A 2WJZA 4R34A 4IGHA 4NQ1A 4GA8A 1AODA 3W23A 1K70A 5AC5A 2VDGA 1KM4A 3ELFA 2VQUA 3NZPA 4F2BA 1RQHA 5C54A 4CD5A 3ZZ1A 2VOTA 3R10A 3CEUA 2J79A 4AYGA 5A2AA 3A9BA 4CNPA 2J74A