1YADA

Structure of teni from bacillus subtilis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
190
Chain Sequence
b'MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein tenI
publication title Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 70
structure length 190
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yadA00
3O6YX 3HGRA 3LBMA 4JDBA 4G1KA 5BRBA 4KWVA 3MWAA 1ALDA 1VPXA 1MXSA 1TRIA 4OV4A 3DBPA 2FIQA 1P5BA 3BK0A 2NUYA 3F03K 2ZCGA 4MYAA 3TW7A 1N8FA 1I8JA 5DCBA 1W5MA 1TPFA 2ZA1A 3O16A 3HPZA 4LS1A 1EP2A 1Y0EA 1IXNA 3HGSA 2YXGA 1KBIA 3P8JA 3NL5A 3G18A 1SO5A 3E96A 5HWMA 3B03A 1YXYA 1LZOA 3R13A 1YTDA 5D09A 1THFD 3N9RA 1LCOA 2P0OA 3SZ8A 1AL8A 2X1TA 3IIPA 3OEXA 3EWUA 1VJIA 3GXPA 3LGEA 5CZ0A 1G7VA 3GXTA 4MJZA 1Z41A 3HOJA 2WNNA 1UUOA 4IOTA 4IGHA 3GAKA 2CLHA 2JK2A 4WX2A 4UTMA 3BPWA 3UPWA 3EX4A 2ABBA 1LOSA 3ANYA 4LS2A 5CPMA 3W83A 5HUPA 5AHFA 4OBTA 1OF6A 3QW3A 3L68A 3T44A 1W8SA 1VZWA 1EWEA 2QCMA 3MP3A 3W7OA 1W1ZA 2Q8ZA 1VYPX 5D33A 1W5NA 3PBVA 3SJ3A 4EIVA 1OX5A 3GR7A 5AC7A 4M7SA 3W2JA 3W76A 3DGRA 1S3HA 2ZZ1A 3W1PA 3O1NA 2GQ9A 2RH9A 3EX2A 3W70A 3S42A 1XDLA 2QCHA 2C14A 4C1KA 1FQ0A 2IQTA 2WNQA 4P2VA 2WPBA 1VC4A 4RKAA 4YXGA 1XXXA 2GVLA 1B3OA 4UTWA 5BW6A 2CZEA 1EWDA 1YDNA 3EWXA 6TIMA 4O53A 2G97A 4GFSA 2E6DA 4ICNA 1H61A 3QW4B 2WQPA 4O54A 4DO4A 3R5EA 3PWAA 5AHNA 1C29A 1W31A 3G1VA 2AGKA 4GE8A 3GYEA 1A5BA 3EWYA 1X7FA 1D9EA 3W7LA 3PAJA 3LERA 5BNKA 1L6SA 2BTMA 4O10A 4FX6M 1N55A 1VLWA 1H5YA 5FEXA 2CU0A 1YLVA 1R46A 3KXQA 3TX9A 3C56A 1K3UA 4RZ6A 3H54A 4RXFA 4CNNA 4KFNA 3NM1A 4NU7A 1PVNA 3EKLA 3O07A 4PL2A 2WNZA 1FDYA 4MY9A 1GG0A 4FXSA 1FWRA 4N9CA 1GTEA 4I7UA 2V5LA 3NZRA 3EWWA 3KVLA 1JCXA 1YDOA 3TAKA 2Y7FA 2R91A 4YLWA 5EBUA 5KMYA 4MY8A 5F2GA 3LRMA 4UTJA 5DBUA 1B57A 4ADSA 1KV5A 4OV9A 4E38A 2I1OA 2V9DA 3BLEA 3PBUA 4MLJA 3N19B 1DQXA 3QMRA 4WQ6A 5DBTA 3TDFA 2Q8LA 2Y6ZA 4O19A 2EKCA 3E02A 1BEUA 5CG7A 4HPXA 1O5KA 4JGDA 1FCVA 4IMEA 1WQ5A 4DBEA 2ATMA 2E1DA 3C4UA 3HPSA 2JKAA 1C9DA 4TIMA 2XN1A 1KM5A 2GQ8A 4LS0A 3UWYA 5I3GA 1TPDA 1TYGA 2ATSA 1YPFA 4EWND 1W5QA 2ZZ4A 4RK8A 4BI7A 1WYIA 5LHEA 1O5XA 1SO4A 3ZR4A 3TU9A 1HTIA 1WOBA 2YFNA 3OIXA 2ZFAA 1GYNA 1M7OA 2CLMA 1Q45A 3Q37A 2QJIA 1OYBA 5K4XA 5CKSA 1TO3A 3LLFA 4JYEA 1R30A 3CLMA 1DQWA 1D3GA 3GAYA 4JN6A 1WOAA 1LBMA 3TMQA 3CIWA 3P84A 3RLVA 4LVAA 2I9EA 3DFSA 2E09A 1QCWA 2Y7GA 3QF0A 6ALDA 4BFAA 1OFPA 3C2FA 4LRSA 1OX6A 3UY7A 4Q32A 4K37A 3DZ1A 3WK3A 1UUMA 4LT9A 1VHCA 5K9XA 4UTWC 3W1RA 1Q6QA 2QDGA 1WV2A 1TB3A 5IBXA 5MHBA 2TYSA 2EGZA 3BW2A 2DZWA 1UASA 3WFAA 3IIVA 3M43A 3C3NA 5K7JA 3Q94A 3UXDA 1LRTA 1XBXA 2OZ0A 3W7KA 4DO5A 1EX5A 3W1MA 4TR9A 2QF7A 1TPC1 1PHWA 2DORA 3BW3A 2FFCA 4WXYA 2ZZ7A 3L2IA 3MMTA 5FF0A 2GJLA 1Q6RA 2D73A 2ZA3A 8TIMA 1EUNA 3EX6A 3IEBA 1LTDA 3NQDA 3A24A 5L6UA 1R47A 3LHZA 2YSWA 3G0UA 3U6WA 1SR9A 2GQAA 1F73A 4N9DA 2KZHA 3TR2A 4Z1BA 3QRHA 3KRSA 1DL3A 1XKYA 4O1AA 4LC6A 1ZAIA 4DPPA 2YDAA 2ZDRA 4R7JA 1U83A 3LM7A 3W71A 5HR7A 3STCA 1A5AA 4LTSA 1GYLA 1TV8A 5I3IA 3TJLA 3SGZA 3B06A 4ZQRA 1ZAHA 3P82A 2VFHA 3CB8A 3LOTA 3QQ0A 4HPJA 1FCBA 1EPXA 4O13A 1VGAA 4N6EA 2CLFA 4BF9A 5G1YA 3M47A 2VC6A 4DO6A 3W1XA 3K30A 1HO4A 1S5VA 4WY0B 5DLCA 1UB3A 1GQNA 2BZNA 2V81A 3NYZA 3SI9A 4OE7A 5G4WA 1TQXA 4IUOA 4NZFA 3QYQA 4RX0A 4FX8A 4AMAA 5H2ZA 4MKNA 4IMGA 4LV4A 4JTKA 3WJZA 4JTIA 3PM6A 1ZENA 1I2NA 3WJSA 1H63A 4NNCA 2FDSA 1ME9A 4EVZA 1FUYA 3ZWSA 2QCDA 4NX5A 1VH7A 2CZ5A 1DHPA 3QPZA 4N4PA 3UYCA 3S9YA 3E49A 2NXIA 2YW3A 3NXFA 2ABAA 5D38A 2QAFA 3TSBA 5G5IA 3OVRA 3W1NA 5AYYA 4NXSA 3UZJA 3L0NA 3W7QA 2A6LA 3G1DA 2QJHA 1LYXA 1OVDA 3TQKA 3W7JA 4X2RA 1S5TA 2O7QA 3IVSA 2ZQ0A 2R94A 4O0KA 5EY5A 4JICA 4FO4A 1XDMA 4E0CA 4YMZA 4GNJA 1SUXA 2B7PA 3TK7A 5D2TA 1SW0A 1S5WA 2BWGA 4HIBA 1L6WA 1KW1A 3W2UA 1V7YA 1VHNA 5IBXC 3P74A 4QAIA 4JYFA 4UMAA 1QAPA 4TMCA 3M1ZA 3LCXA 3C0JA 3TFCA 4WOZA 1LOLA 4X3ZA 5F1VA 2VFIA 4FX7A 1SW7A 4ZQOA 1QPQA 3JRKA 2NWRA 4I9AA 1GPWA 3LV6A 4JTTA 3VFLA 1KM4A 1VQTA 3CC1A 5KTLA 3SIZA 1KM3A 1HO1A 1XC4A 3HF3A 1TJRA 4XZ9A 3INPA 4PL1A 4UTHA 2X1UA 1EP3A 3MHUA 1MSSA 3W1UA 5AHMA 4M6QA 5T26A 5FF2A 3TC7A 1SSGA 2FPYA 3TA6A 3W2MA 3RK8A 2NX3A 3W23A 5LGZA 4K7YA 2ZRXA 1Q3NA 4WY0F 3NPXA 3MI6A 2VELA 3LCLA 1O95A 1F6KA 3B0PA 3S1XA 5U7SA 4NJGA 3TQ0A 5C2XA 3QSRA 1ME8A 4UTUA 4KFOA 1DV7A 1YTKA 4O50A 2OT1A 1PIIA 3THQA 1A5CA 1W0MA 4JDYA 1Z44A 3L0GA 1TREA 4JY8A 4JTFA 2Y88A 1LOQA 4JY9A 1KFJA 2GPTA 2GVGA 2HTMA 2DJLA 1L9WA 2G95A 2CFFA 2HMCA 3NR0A 1DVJA 5E1QA 3G1AA 5F2IA 1XI3A 3CHVA 3IGXA 4GUGA 4I7VA 2J9YA 3NO5A 1IXPA 1C8VA 3HQ1A 4WUIA 5FEZA 1LM1A 4KFPA 3DH7A 3FKRA 1OABA 2FPVA 4Z1CA 3THAA 3TH6A 1ONRA 1TV7A 2V8ZA 3B4UA 4K8EA 4ML9A 3M5VA 4K8HA 3W3OA 1FDZA 2DP3A 2TSYA 4PTNA 3W7NA 2WSRA 1H7OA 2C3ZA 3N2MA 1JCLA 1VYRA 3VI2A 3QPYA 2Y7EA 3LXBA 4S1FA 5I3KA 4JX5A 3C52A 3KHJA 1H1ZA 3AO0A 1FWNA 3I68A 4MFEA 3NL6A 3W7GA 3GKFA 4A22A 1ML1A 3CIXA 3MYOA 4E2DA 4LV9A 3L21A 3O15A 4XBSA 3PSWA 2G5WA 4ONVA 3OG3A 2P1FA 3L66A 5LNWA 5FF7A 3NQ7A 2HS6A 1ZALA 2H8XA 4FHAA 3HO8A 1YADA 4QIUA 3HMJG 3U2OA 1GEQA 3LXAA 4UR7A 3R89A 1W5PA 3DAQA 4DF2A 2FB2A 5A5WA 2F7FA 5HR6A 2NV2A 3BV4A 3C61A 3TUUA 4IXXA 4CNPA 4ADUA 2CWNA 2X16A 1J4EA 3HPXA 3L65A 4AH7A 1GVSA 3L5LA 3NQCA 1XCFA 4JTGA 1FWSA 3TMLA 3VE9A 1KTNA 4DXVA 3MI2A 3WK2A 3W7PA 1DOSA 3P5YA 5G2IA 3G8RA 1JULA 1JUEA 3EXRA 4IWWA 3NQGA 2RHGA 1FXQA 3W75A 1HUVA 3TSMA 3W1LA 2E5CA 4EOUA 1F5ZA 1TTIA 2O7SA 4KKXA 1NFBA 3TQVA 2Z6IA 4UXDA 3W84A 3WJYA 5D2YA 2W6RA 3KRUA 1G4TA 5F4WA 3GK0A 4EF9A 3VCRA 1GWJA 1CX9A 5FI8A 1HL2A 3LCWA 4UC5A 3HG2A 2PRMA 4Z0JA 3CEPA 3UWZA 4JTHA 4JX6A 3GDLA 1TCDA 2Z0IA 2H90A 5I3FA 5I3JA 3HGOA 3WK0A 4LNYA 2OCZA 3SY5A 3BLIA 3W7RA 1VCFA 5CZSA 3UXAA 4FIQA 4H4IA 4A2RA 2NXGA 2NLIA 1Q6LA 4QITA 1G67A 5I3HA 4O14A 3EX3A 3I6RA 4GC4A 1NF7A 2C6QA 3HBLA 1AW2A 2ISSA 3PULA 3GDKA 5LSMA 3KRZA 4CNOA 4YCOA 3O06A 1FXPA 1K7EA 3ABOA 1D3HA 2V82A 3W7DA 1QR7A 1W3TA 4ZQMA 1GVOA 5HINA 4JTEA 3C2VA 5D2VA 2OT0A 4OWGA 3V1PA 1G4EA 1A53A 1XBZA 4LVBA 3IGUA 1MEIA 3TE9A 4H6KA 4AF0B 3LLDA 1BTMA 3BG9A 2XN2A 3GIYA 3ABRA 4M7TA 3NEVA 3STEA 3R2GA 3W74A 1HFBA 4UTLA 3M44A 3G1HA 3LHYA 3NQVA 3KOFA 3QH2A 5CPNA 4LU0A 4DELA 3SECA 3N34A 1SZNA 3T7VA 5HNRA 3GZ3A 3SGUA 2ZRWA 4HN4A 4O1BA 1ZY9A 4H3DA 1LDCA 2ZYFA 3PUDA 5HMSA 4NJHA 5DCEA 2QUTA 4FXRA 3ATZA 3TSDA 2XFWA 2DZPA 4UTKA 2E68A 3S1VA 4IJBA 3G1YA 3LI1A 1OYCA 2CLLA 3T78A 4X9SA 1PCKA 2A85A 5HQEA 2TPSA 5L9FA 3C8FA 3NZ1A 4Z08A 3S5ZA 4IX2A 2X30A 2EF9A 5F1UA 2V5BA 4IXHA 2A7NA 2UV8G 3O05A 5KITA 1I2QA 3HIJA 3USBA 3NQMA 1EEPA 4A21A 2P10A 3MHGA 1ICPA 3FKKA 1SU5A 1DJNA 4BK9A 2DU2A 5J5RA 2HSAA 1W5OA 3LB0A 1M7PA 3UWUA 3LV5A 3W7IA 3TW6A 4RZ4A 1ZNNA 4AXKA 4XTIA 4AHPA 3FS2A 3IVTA 5K3VA 2WOQA 1SPQA 4OHQA 4UTIA 2BLEA 2QR6A 4Y96A 4CCDA 4WXZA 2V30A 3DKJA 4UFMA 3OBKA 1GJPA 3B0VC 5CSRA 1RD5A 4OQVA 5EYWA 3FA5A 3S5YA 4AHOA 2ZRVA 3M6YA 3BGJA 2VFGA 3PG9A 1QO5A 3UD6A 3EWBX 4CQAA 3P8IA 3O6CA 1OFDA 4JEQA 4WY0A 4LUIA 1SO3A 3KVJA 3HGJA 2JGYA 4HNTA 4O18A 4R34A 1SW3A 4UMBA 3TAOA 3W2NA 4CCEA 1ME7A 2A21A 3KVMA 5HULA 1B4KA 2NWSA 3P61A 3VKJA 2VFFA 3B8DA 1H7NA 3C2EA 5LHFA 3S1WA 1YDVA 3GKAA 1M5WA 1AK5A 1OFEA 2V2HA 3BGGA 7TIMA 1YXDA 2CW6A 4DPQA 3UY8A 3NL3A 1IIHA 1TPWA 1TPVA 1EA0A 2PRLA 2W79A 3KX6A 2J88A 2YW4A 5EPDA 2NXHA 3MO7A 1G69A 2NUWA 4O57A 1IF2A 4O28A 3PF3A 4XQ6A 1NVMA 3GX9A 4NT0A 3G3DA 5DY3A 2A4AA 3QEZA 1EUAA 1X1ZA 1BWKA 3OVPA 4CQ8A 1KM1A 3FEMA 1PS9A 3W86A 1WDWA 2NX1A 3LRLA 3DXIA 3A9IA 3N9SA 4XKYB 5FF4A 1J5TA 2YGYA 4RJEA 1R2RA 4GXMA 2A5HA 3N73A 1UJPA 1LRNA 3UNDA 2QEZA 5E0KA 4MYXA 4PC8A 3CWOX 2H3BA 3MP4A 1X8FA 4IMFA 5E93A 4E2BA 5AFDA 2FQIA 2DZUA 4RZ5A 4MVAA 4JIQA 5LNVA 1FCQA 4XUGA 1VYSX 1EIXA 3UWQA 3TJXA 3T40A 5H91A 3MJYA 4LWWA 3TFXA 4GUIA 3UWVA 3QSTA 1T96A 3IIZA 4O8RA 3NQ8A 1OHLA 3PC0A 4Y6GA 2YR1A 5LGXA 5HUOA 5DN1A 1OG0A 1GOXA 4LW7A 2FB3A 2BXVA 3MHFA 3DFOA 4GUFA 3OHIA 2OJPA 3NQEA 2ZRYA 1MEWA 4MFDA 5D2WA 1CI1A 1DORA 3B05A 2C19A 3L5MA 5AC8A 3G1FA 4DQWA 1GVFA 1SZFA 3DFPA 1W3IA 5ABTA 5K4ZA 3NM3A 3MBDA 1K02A 2Z1BA 1ZAJA 5D02A 2QCGA 5HJLA 3P7YA 4PA8A 3RMJA 3KAOA 1K8XA 1YXCA 1KTBA 4K36A 1JCMP 3CTLA 1AW5A 4JYDA 2PE4A 1H51A 2B7OA 1GG1A 2QDHA 1I45A 4K6AA 2EAWA 1JQXA 4UMCA 4PH6A 4LOCA 1WBHA 2BX7A 3TROA 4X22A 1TRDA 3W6YA 3LCHA 4N4QA 2G96A 3GDRA 1Z42A 3PVFA 2OMAA 1R2SA 4FNRA 1L2UA 1X1OA 1G4PA 3QC3A 4QNEA 3TKFA 4OGZA 3M41A 3JS3A 3NQAA 4LVDA 2RDTA 4LVFA 2HS8A 3LXCA 2QJGA 1JUBA 3W22A 3DKLA 2YPIA 1FBAA 1ZJIA 1G6CA 1FDJA 4BWLA 4HKPA 3P5ZA 3FYOA 3LX9A 2A7RA 3CPRA 3SW6A 4AWTA 5FEWA 5G4EA 1H60A 3NPUA 2WKJA 3HG3A 4U4MA 2RDUA 1ZCOA 4MPQA 4WJEA 3S1UA 1VS1A 4Z0SA 3I7QA 3EB2A 1FWTA 4FNTA 1XBVA 4FF7A 4CQ9A 2X1SA 2CLOA 1SFJA 2I14A 4WZHA 1J2WA 3O8AA 1H50A 1K7XA 3RU6A 2WSQA 2DZXA 2QCEA 4QNWA 4PFMA 3JR2A 5GVJA 2VEPA 1TMHA 4L4LA 4I7WA 4ZVJA 3WJXA 5AHLA 2NV1A 4MY1A 5AC6A 2VEMA 1QPRA 4FEZA 4CLMA 1MZHA 1KFKA 1TTPA 3LHTA 4TU1A 5F2LA 3ZFHA 3L5AA 1W54A 4M5PA 5D2XA 4U28A 1U5JA 3Q58A 1LLWA 4MZ8A 1VRDA 4O4VA 4Z1AA 2JKPA 1VCGA 2B4GA 1BWLA 3P60A 2Q3RA 3MW7A 1PV8A 2ZA2A 3RNDA 3W7EA 1B9BA 1TPB1 4AEOA 3TXVA 5AYZA 5KZDA 1OX4B 1QMLA 1XBYA 5DY2A 3W87A 4JX4A 4IPJA 3NQ2A 1XUUA 5KINA 3S5NA 4ZQNA 2JKEA 5C5YA 4O52A 3MBFA 4Y8FA 2Y85A 2C1HA 4GJ1A 1MO0A 4QQ3A 4ZZ9A 4K39A 1TTQA 2FJKA 3E9AA 3UZ5A 3LHWA 1N7KA 3FJLA 5FESA 4UFHA 4LUJA 1LROA 2A6NA 5TQLA 2WJZA 3W7HA 2H8ZA 3S5OA 2X2GA 4JTSA 2Z2UA 5LNUA 1I2PA 3W88A 1QDSA 4PODA 4MOZA 4WD0A 1QFEA 1MEHA 4YCPA 2V0TA 3DHFA 5LNRA 4UFIA 1H7RA 1T0OA 3H53A 4R53A 1KV8A 4O1CA 3LTPA 4YL2A 3ELFA 4IMCA 1OF8A 2QCLA 5LNSA 5HWJA 5EA9A 1PL9A 1OFAA 4TMBA 3QMSA 4ZL1A 3MYPA 2Y70A 4MZYA 5CZJA 3F1QA 3GNDA 4FNSA 3Q2DA 3TCEA 4ADTA 1FWWA 3V75A 4AHQA 5AYXA 1QPOA 4BI5A 3GR8A 1KFEA 2ZRUA 4BWLC 1G7UA 3W7MA 3M16A 1OFRA 3W2LA 4AF0A 3T55A 4GUJA 5G2HA 2EHHA 3M5ZA 1F7BA 1OFBA 5F4SA 5DCDA 2VFEA 5AHEA 4ALDA 1TPH1 1F05A 2WO5A 3DI0A 2YFOA 4OT7A 3N2XA 5BMWA 4O1DA 4RR4A 3I7RA 5CSSA 3UWWA 3B0UX 4XWUA 4O12A 1IXOA 1Z48A 1JJKA 1X6UA 5D03A 3M9YA 1ADOA 1P0NA 4FB7A 2VENA 5F4XA 3PBYA 2QCFA 3WJWA 4HHPA 3G24A 1JR1A 4NQ1A 3IRDA 1W37A 3R8RA 3FOKA 3RLUA 1XFBA 4ZMGA 5J5DA 4CCCA 1XUZA 3LHVA 1EB3A 1KA9F 1XL9A 3CWNA 2B0MA 4O16A 3G22A 2B7QA 3G1XA 1LRQA 4HT3A 4LRTA 2C15A 3A22A 4BR1A 1SZGA 4O0ZA 5CZTA 3LRKA 1SSDA 5AOUA 2GVJA 1RQHA 3B04A 1TQJA 1QWGA 3L9CA 2VEIA 3W7CA 1RQEA 1TSIA 3P81A 1TJPA 3BVJA 5D32A 2RKXA 2C16A 5KSWA 3QZEA 4UTTA 4FNUA 3NOEA 3W1TA 4NX0A 3GLCA 4RV8A 1OK4A 4LC8A 5EKYA 1H7WA 2EPHA 3VE7A 5BMXA 1LBLA 1QO2A 3T4CA 2CZDA 3RFAA 2VFDA 1F2JA 3PBWA 3HB9A 3PS7A 3WK1A 3BO9A 3H55A 4UNLA 3BG3A 2ZBTA 1OFQA 2Y7DA 1KM6A 2J27A 1YPIA 1PE1A 1VCVA 4W9TA 2YZRA 3DU0A 5K9DA 3P80A 4KWWA 3LCIA 2C0AA 4TO8A 2A1YA 2RDWA 3CU2A 4IQLA 4WOQA 2R14A 1AMKA 2Z6JA 2AAMA 1JRCA 2YYUA 4UUIA 2V2CA 1K8ZA 1LP6A 4S2CA 2X1RA 4GWEA 4O4WA 4MZ1A 1P4CA 3W1AA 4N2YA 2PURA 1RVGA 2C18A 3A5VA 3OVQA 4QSHA 3QQ1A 2ALDA 1WBJA 4GRSA 1YYAA 3A23A 1H7PA 5D04C 2J9ZA 3IVUA 3PSVA 4LVGA 3LTYA 3P62A 5AHIA 2W0UA 4N6FA 4Q33A 3ATYA 1FY6A 1KFBA 4FNPA 2QCNA 3E0IA 1T99A 2QKFA 4POCA 1PHQA 4UNKA 2PC4A 4JTJA 3W72A 2OX1A 1H1YA 5CPOA 3W9ZA 4IMDA 3LI0A 1WXJA 4C1LA 1W56A 3PY2A 1RPXA 1RV8A 5G1TA 4QM1A 5TBOA 4DF1A 2QAPA 3EWZA 4XBKA 3QFEA 4UFJA 1YTEA 4GBUA 1FX6A 1I2RA 1DBTA 1I4NA 4HNNA 3LBCA 4MLRA 1T8XA 1KBJA 5FEPA 1W3NA 5BOOA 3BW4A 2H6RA 1ZFJA 4XKYA 3O63A 4YWIA 4S2BA 1NAL1 3CM4A 1GT8A 3EEGA 4UFKA 1VLIA 1TPUA 2ZTKA 3UPBA 3PB2A 1G4SA 3LCFA 5EMUA 5AB3A 1GVQA 3TXZA 3OA3A 2A2IA 4UR8A 1XM3A 1K8YA 4ORMA 1H62A 4J9JA 3M7WA 4HSOA 3CQ0A 3FIGA 2FTPA 2ISWA 3F4WA 3L0KA 1IIGA 4O17A 3IV3A 4AWSA 1P1XA 1AG1O 2LLEA 2ZZ6A 1JRBA 3NQFA 1EP1A 4NJIA 1F74A 1AL7A 1LBFA 2CLEA 3TV8A 2Y62A 3GB6A 4N9EA 1SQ7A 4RCXA 1R2TA 3G8EA 4NNBA 3D0CA 4XTDA 4OU1A 4M19A 3GXNA 1O94A 1IGSA 2R8WA 2DZVA 3M0ZA 5CPLA 5D30A 3SR7A 4NUWA 1UCWA 5C6MA 4NXKA 1V5XA 4UTTC 1A50A 4JD4A 4TX9A 3ZWTA 1GVRA 1RR2A 1TIMA 1GTHA 3EXTA 4K38A 3DFNA 2ISVA 5G2WA 1KM2A 2QCCA 3FJ6A 3DI1A 1JCJA 4DBDA 5C54A 2DZTA 4AWUA 1E51A 4IX0A 1KFCA 3IGSA 4ZQCA 4EF8A 3BARA 1M6JA 2V2DA 1VR6A 3UQNA 1JVNA 5DXXA 3DFTA 4NVTA 2QUVA 1TTJA 3N14A 1A5SA 1SZEA 1WA3A 2E6FA 4R33A 3FFSA 2Y63A 4O15A 2AQWA 3E12A 2CLKA 1K7FA 2J24A 3GDTA 4O11A 4NJKA 2YX0A 4DF0A 1OYAA 3LDVA 3C6CA 3W73A 3EX1A 2DZSA 1ZHAA 3LCGA 3KFTA 3NA8A 1RQBA 4NJJA 5F2MA 3CT7A 4BI6A 1QOQA 1TPEA 4QJ1A 1QNVA 2PCQA 3EXSA 4JTUA 3NPWA 1O4UA 4M6PA 4ORIA 5EL1A 4PCFA 1GZGA 4RXGA 1I2OA 4AAJA 3QJAA 1KLYA 5HWNA 1PCWA 1QPNA 3DFQA 3PUOA 2GUUA 1AW1A 3SSJA 3HG5A 5D05A 1Q6OA 3F4NA 2NX9A 2YYTA 5LZLA 4JS3A 2QUUA 3FYPA 1K03A 1O60A 1F76A 2A7PA 3PG8A 4NNAA 4Y90A 3TC6A 3NG3A 2GOUA 3BG5A 3G3MA 4B5NA 1DKWA 1LORA 3QMTA 4N9BA 3TNOA 2VEKA 1ICSA 2Q3OA 3W2KA 2J6XA 4IPIA 3GNNA 4N02A 1P0KA 3KVKA 2JBMA 4JR5A 4HNUA 3TIMA 3LTSA 5TIMA 5K2ZA 4PEKA 1KTCA 1DJQA 3HJZA 5AN7A 3STFA 2YCEA 2J9XA 3M5YA 3C2RA 3G0SA 3GVGA 1H7XA 2ZRZA 4P61A 2TMDA 4FIRA 4LY8A 2FPTA 3NNTA 2VOMA 3RF9A 2WSYA 4A3UA 3U8GA 1JUKA 4MIMA 1JCYA 3NL2A 4UFLA 3NAVA 3VNDA 4D2JA 3NPVA 4JIPA 2NUXA 4M6VA 2XN0A 4DEFA 3SFKA 2FLIA 2VKZG 2ZZ3A 4Y9AA 2H3DA 1UBSA 3NGJA 4NZJA 2GJNA 2CZFA 4GUHA 4MUZA 2E6YA 1QOPA 3MUXA 5LKYA 1B4EA 1KM0A 3NDOA 1OX4A 1F6PA 3MI3A 1KFLA 3CEUA 3BLFA 3M5XA 2E5BA 2DJXA 3G0XA 3PR2A 3PB0A 3DENA 3W07A 2QCDB 1NSJA 3QM3A 1NEYA 4JXCA 3P67A 5A8GA 4A29A 3G1SA 4AB4A 1L6YA 2NZLA 3S0CA 2CLIA 4FNQA 2ZZ2A 3L67A 2PRHA 4QISA 3W85A 3N3MA 3MP5A 3I65A 5IM51 4JTLA 5KZEA 5CGQA 2JGQA 4AVFA 3I7SA 3AJXA 5U4NA 2B7NA 3FLUA 5KZMA 5C55A 2E5DA 1SFLA 1NF0A 2C13A 1WAUA 3W1QA 1JQVA 2ZTJA 1FCUA 4L4MA 1ICQA 3NQ6A 3ZS4A 1LLZA 4ZQPA 2E77A 3C2OA 1JCNA 1RZMA 3LHUA 1OK6A 2TRSA 4UIOA 4K7VA 2BSLA 5D37A 2ZZ5A 1IXQA 4A2SA 3STGA 2E6AA 5DXYA 3S6DA 4HSNA 2Y61A 4RLIA 5DELA 1OJXA 2Y89A 3O6DA 3A21A 4HNVA 3EKZA 5SWUA 3R12A 2F84A 4Q4KA 4MJMA 3IIOA 3S8HA 1TV5A 1WX0A 4Z1DA 3GDMA 2RFGA 4UCGA 5FF3A 1CW2A 1HG3A 3PUEA 3NVTA 5K9CA 2VXNA 3HG4A 3ABQA 3ABSA 1OFOA 4JNMA 1SO6A 3IIXA 3DHDA 2A0NA 2WV8A 1BKSA 3A5FA 1KLZA 3YPIA
chains in the Genus database with same CATH superfamily
2Y8VA 2X7WA 3HGRA 4JDBA 4LF2A 3VFCA 2C91A 2CIPA 4KWVA 1O7AA 5BRBA 1ALDA 1VPXA 4XKMA 1TRIA 3WLRA 1TWWA 1RH9A 3DBPA 5HQMA 2FIQA 1I1WA 3F03K 1KBBA 2ZCGA 3B3DA 3MSGA 3PZNA 1LL4A 5DCBA 1TPFA 1XLGA 2GGHA 1R7AA 1F3WA 2VUYA 4LS1A 1Y0EA 2VZSA 1IXNA 3ES8A 2YXGA 2PWHA 4H2HA 3E96A 4DNMA 3H21A 1YXYA 3FVMA 5E09A 3ORWA 1MMFA 2P0OA 1F9CA 1AL8A 3WX7A 1RHCA 1O12A 2PTXA 4LYRA 2ZUMA 3EWUA 1VJIA 2YLLA 3N6QA 3PZGA 4UQEA 1DE5A 4MJZA 1RP8A 3FDGA 3HOJA 1CLXA 4IOTA 4Q22A 3E0FA 1W1VA 4LANA 3LGDA 3UPWA 1US3A 1WE5A 3MSYA 1LOSA 2PUZA 2EEXA 3OZYA 4R85A 5AHFA 3TQPA 3WD3A 3T44A 4I3GA 4DJDC 2EJAA 1JI1A 1DXEA 4WGXA 2VT0A 2XM1A 3W6MA 2FZ8A 2Z1SA 2QCMA 4C7GA 2Q8ZA 4Q4SA 3TLLA 5M3WA 5D33A 4XSLA 1S38A 2BXZA 4GIAA 4JKKA 3GR7A 4MADA 1XX1A 3W76A 4L61A 1S3HA 3W1PA 2VX4A 2BASA 4LSBA 3LZ3A 1M01A 3W70A 3WY1A 2QCHA 4C1KA 3CH9A 1GW9A 4CN1A 2NV9A 3R0UA 3CV7A 4GYFA 2BY3A 4PUDA 3O6AA 4W87A 2PGRA 2CZEA 4IFKB 2PA6A 1OC7A 3G6MA 3VTRA 3WF1A 3R5EA 4DJEC 1NARA 1S2AA 4ZO6A 2WVTA 1V6TA 3GYCA 3WQDA 4QSFA 4R88A 1D9EA 3RGTA 3S5SA 3WNPA 4Q8UA 4PZVA 1A3WA 3GTFA 4S3FA 4MPKA 3H22A 2BTMA 3BAWA 4FX6M 1VLWA 3GHRA 2FH6A 3AIRA 2CU0A 1IQ8A 1W91A 4BF5A 1UOZA 4NYYA 2PLMA 2Y0FA 4ZR8A 1VFMA 3TX9A 1GOQA 1POKA 1VBRA 4CNNA 4ZODA 3AQUA 3BQ6A 4D6EA 4KFNA 1CGVA 3WIJA 4PL2A 1FDYA 1CTNA 2EKGA 3UERA 4N9CA 1TZ9A 3NO3A 3QY8A 2JFEX 4HD5A 4RE3A 1YKWA 3A47A 2ZWYA 2E67A 3LD5A 5EBUA 5KMYA 4PGLA 4QE5A 3LRMA 2WW5A 1BVZA 1W9BM 4QAWA 1ADDA 2W61A 3W0KA 5A2CA 3ITTA 2V9DA 3WBWA 4AIOA 1VB9A 3BLEA 2WANA 2FGBA 3N19B 5HK4A 3QMRA 4WQ6A 2Y6ZA 4O19A 4S3BA 5CG7A 1O5KA 2WMFA 2X05A 3H2MA 1JNDA 1RA5A 2A3LA 3CL6A 1XLKA 4J28A 2JKAA 4TIMA 1KM5A 1YPFA 2ZZ4A 4BI7A 2YKKA 9CGTA 1F8MA 2WLYA 1X8CA 1MQQA 1GYNA 3EWCA 2CLMA 4ZENA 1P6WA 2DVUA 3VDHA 5K4XA 2UZ9A 1ZLPA 4Z17A 1ZP4A 2WQDA 1D3GA 3O3RA 4JN6A 1WOAA 1LBMA 5JBEA 3RPTA 4LVAA 3AIUA 2YDSA 1FWFC 3GZAA 4XBJA 6ALDA 1FH7A 4LRSA 2JE8A 2OLSA 3DZ1A 3CIVA 1EQPA 3VM7A 4D6HA 4AD1A 1Q6QA 3NEHA 2CITA 2TYSA 3BW2A 2DZWA 3THUA 1UASA 2CHNA 3U9IA 4CQBA 1Q8AA 3LM3A 3Q94A 1LRTA 1XIEA 3PJUA 1XBXA 4TR9A 4C60A 1TPC1 3WD4A 4F8XA 2D73A 8TIMA 3IEBA 1LTDA 3NQDA 3WLHA 4UZSA 3E2SA 1FWAC 3WMBA 5CC6A 2ZXBA 3KRSA 2H9AA 4H9YA 1BWVA 4LC6A 4KCUA 2YDAA 4JTRA 2OOGA 4S3DA 3UZXA 3WQFA 2XVLA 1U83A 5BCAA 1UMYA 5HR7A 3C8NA 1REQA 1GYLA 2PTZA 3BMWA 3K4WA 1EEXA 5I3IA 3SGZA 4ZQRA 1ZAHA 4Q4RA 1IT0A 4QJ5B 3CB8A 3LOTA 4PMUA 4WEVX 1EPXA 1VGAA 3II1A 4N6EA 3R8GA 5G1YA 5FACA 4DO6A 3K30A 2PDLA 4IT1A 4XZNX 2BHYA 4V33A 2WSKA 3T0BA 1EJXC 5G4WA 3EOLA 3QYQA 2ON3A 3M6DA 1GYMA 4U3AA 4MKNA 4LV4A 5EGRA 3EOOA 4QHRA 3DYPA 4NNCA 5LXXA 3ANUA 1WZAA 2V67A 3MDWA 4L6DA 1GOIA 4NX5A 3UG3A 2CZ5A 2WMHA 4N4PA 5JU6A 3R94A 3S9YA 3PUGA 1XLIA 3WF3A 3APTA 3IJ7A 1PAMA 1UOKA 3VIPA 1AD4A 4LFYA 5G5IA 3OVRA 3N2CA 3VGDA 4GCXA 2XH7A 4GIEA 4LUSB 3KDNA 1IE7C 2A6LA 3G1DA 2GJXB 2QJHA 4UQBA 4X2RA 3TN3A 1OQFA 1S5TA 1RY0A 4BEUA 4MJ4A 4J2PA 1ONWA 4JICA 4FO4A 4H9MA 2J25A 5A6SA 7XIMA 4QX4A 4YMZA 2B7PA 2JALA 1SW0A 1TWIA 3S9IA 1CXKA 1KW1A 1L6WA 3W2UA 1VHNA 2XFYA 1VBJA 4JYFA 1KXTA 1QAPA 3UETA 3M1ZA 1VFUA 4LUYA 3TFCA 2KX9A 4X3ZA 1SJDA 3VDAA 2FTWA 4I9AA 1XIDA 3LV6A 1JZ4A 3CC1A 1EJSC 3HF3A 1TJRA 4I9TA 3WH5A 3INPA 4PL1A 4UTHA 3UEQA 3W1UA 1EO7A 5AHMA 1DIDA 3PWGA 3AXIA 5FF2A 1SSGA 2FPYA 3QKEA 3DEQA 4LYQA 8XIAA 3FXGA 3VKBA 1EGMA 5LGZA 3S83A 1WDQA 5LIXX 1E3ZA 2VEGA 3MTWA 1F6KA 3B0PA 5U7SA 4PCNA 5C2XA 2DSKA 5IHSA 1DV7A 1OY0A 1W9PA 3SRDA 4JCLA 1PIIA 4MB3A 2J13A 4PUKA 4UQDA 4JY8A 3QGVA 4H9TA 1LOQA 1KFJA 5A94A 1UWAA 2KAUC 1TUFA 1GONA 2HTMA 2DJLA 1L9WA 2PFHA 5DMYA 2CFFA 2HMCA 2BMBA 3WQ8A 1DVJA 3BDKA 3B40A 5E1QA 3EGJA 3VO0A 4FOKA 1R9YA 4PUNA 1RCQA 3WH8A 1XG3A 2PLKA 1LWJA 2C7FA 3N1AA 3NO5A 4LBUA 3RYSA 4Z2LA 2WHLA 1C8VA 4WUIA 5FEZA 1LM1A 3RXZA 3RM9A 1V3IA 1OABA 3TH6A 1TV7A 4JQAA 1ISXA 3M5VA 2TSYA 4PTNA 3W7NA 1FRBA 2PZ0A 2WSRA 4HYRA 3R7MA 1VYRA 3VI2A 3QPYA 4ATWA 3I4KA 3URNA 2Y7EA 3LXBA 2VR2A 4S1FA 3IANA 3KHJA 1XLFA 4MFEA 4RPPA 1OADA 3KUMA 3VIGA 4A22A 1U1UA 3CIXA 1YEYA 3MYOA 4E2DA 3AZSA 4NZ1A 2G5WA 3GHSA 5DANA 2W91A 2BHUA 5LIYX 3DERA 2H8XA 1W9UA 1RBOB 3W37A 3PANA 2Y8UA 4L1GA 2HVOA 3MUY1 2FB2A 3G77A 3MMWA 3N3TA 4IFKA 3C61A 4IXXA 4G5DA 4CNPA 1J4EA 1F61A 4QLJA 1GVSA 1EO5A 1TR1A 4KPLA 1FWSA 3DUGA 1DOSA 3WQOA 4F4RA 1C93A 3P5YA 5MF5A 2GOKA 3BOLA 2X7VA 3EXRA 1GCYA 2VRQA 3NQGA 2RHGA 4TTUA 2OWXA 5E9AA 4Z2KA 1FXQA 3W75A 1HUVA 3TSMA 4GZ7A 1TTIA 6XIMA 3OA5A 2EO7A 1FWEC 5IFTA 1UH3A 2ASHA 2HPIA 3A3XA 1J0HA 1G4TA 5F4WA 3ARZA 5FI8A 3LCWA 5HNUA 5C9UA 3HPAA 4GXPA 3UWZA 1CDGA 1TMQA 3H7RA 3EYPA 5A6AA 1A5OC 3BAKA 5DMLA 2OPJA 3BURA 3MSDA 5I3FA 3CZGA 2W9MA 2OYKA 2OGYA 1I0DA 2REQB 6TAAA 2VTFA 1ODUA 3GE7A 2OCZA 5CZSA 4C6IA 1UR1A 1IT8A 4OOUA 4A2RA 4HA3A 4U10A 2MANA 4G8TA 1LT8A 1NF7A 2C6QA 4EANA 3HBLA 1AW2A 2ISSA 2P8CA 2QPSA 3PULA 1KGUA 4F9JA 5LSMA 3KRZA 3CAQA 3ABOA 3ZIZA 3R25A 2NQJA 3RR1A 5E6YA 3MKKA 2VCAA 1KFWA 3VU2A 5HINA 4G56A 4IQDA 2OT0A 4LVBA 3IGUA 1B3YA 4MAZA 1BTMA 2E4TA 2Y24A 3BG9A 2XN2A 3IARA 1EXPA 1TIWA 3ABRA 3W74A 4DM2A 3KS6A 3URQA 3PTKA 3NQVA 2ZADA 3OQEA 1DIOA 3SGUA 2VJXA 4O1BA 2A3EA 4E6MA 2O4QA 1KGXA 4H3DA 4A8RA 1CGWA 3OLDA 1XIMA 1XLAA 2WCSA 1TE6A 1J0YA 2QUTA 3CPUA 3I4EA 3ATZA 1QT1A 4UTKA 1PX8A 1R3YA 3R1ZA 3C3UA 4IIGA 2F2KA 1PCKA 5I79A 3CZEA 1KXHA 4B5TA 1H1NA 2D23A 2DUZA 2EF9A 3LNPA 2G3IA 3SQMA 2UV8G 1TV3A 1IEVA 1UPMB 3GHUA 4LY4A 1TMLA 4A21A 4CVWA 4AZ6A 2P10A 4JFSA 1ICPA 3FKKA 2OYLA 4EPBC 1DJNA 4B2DA 3NXLA 4XZWA 4B9ZA 2AMGA 2HSAA 3LB0A 1OCQA 3LV5A 1BYBA 3TW6A 3DOPA 3LA4A 1H0IA 4AXKA 2WAGA 3FS2A 3N4FA 3BAJA 4XZIA 3CUHA 4OHQA 4UTIA 4B5XA 4Y96A 2HDJA 4WXZA 4UFMA 1NTHA 3WQCA 2YXOA 1H5VA 3DESA 4OVXA 1W3HA 4AD2A 2G4FA 1CT5A 3ICJA 2D20A 1RSCA 2P88A 3EWBX 3VABA 4CQAA 3O6CA 1OFDA 2JIEA 2XZ7A 2PWVA 4OOZA 3PAOA 1P6BA 4O18A 3A4XA 1FVPA 4UMBA 3TAOA 3B9EA 1RBLA 1EDGA 3U2EA 3WCZA 3IGHX 4AD4A 2A21A 2NWSA 3VKJA 2OEMA 2CBJA 1S1PA 4WHBA 1RD6A 1H7NA 3BICA 3S1WA 3GKAA 2ISFA 2GFTA 2V2HA 7TIMA 1YXDA 3KBMA 3ITYA 3NL3A 1TPVA 4EX4A 4WVXA 3WNMA 2E9MA 3MO7A 1UKSA 1B30A 4MGGA 4O57A 4HCDA 3J7HA 1WAWA 3PF3A 4MNJA 4IIHA 3WQ5A 2EPMX 3SY1A 4LUSA 1U1HA 3TOYA 4FLQA 2E28A 3GX9A 1B54A 2HNEA 1EUAA 2GJXA 2XYLA 3AISA 1JGIA 5C0QA 4H9ZA 4RE2A 2FZNA 3SIMA 3KBVA 3AYTA 3A9IA 1J5TA 2PDCA 2YGYA 4RJEA 1R2RA 4IJCA 2OEKA 1VFLA 2INFA 1MXGA 3N73A 3A4AA 5E0KA 2WWDA 3SM0A 4QS5A 1QI5A 4E2BA 2OGJA 5AFDA 2FQIA 1XFCA 4JIQA 3VCNA 2QVNA 1VFTA 5GNZA 1EIXA 3T40A 5H91A 4N0RA 4GUIA 1DYSA 1DTUA 2YL6A 1IZCA 4R7WA 2X40A 1JZ3A 3NQ8A 3FA4A 3NOYA 1OHLA 4Y6GA 2YR1A 4MJ2A 5E5CA 5LGXA 1JXJA 3ZO9A 2O4MA 3BV7A 2HRWA 1VKFA 1OB0A 4P7QA 2FB3A 4PMRA 3MHFA 3DFOA 3NQEA 2ZUUA 5D2WA 5T91A 3UA3A 1R8LA 5BWFA 2YA0A 1QHZA 3PBGA 3GTXA 3Q45A 3LS9A 3NM3A 3WQGA 4LCRA 1K02A 4JHZA 4WKHA 3CZJA 3ARXA 2WZHA 4PTMA 3BLDA 3TZNA 4PA8A 3KAOA 1YXCA 4BQ5A 1AW5A 2OG9A 2QDHA 1JAKA 5XIMA 3O2LA 3L4XA 3L23A 4LOCA 3VGBA 3TROA 2E3ZA 2QW5A 3XIMA 2WHJA 4EPKA 2G96A 4DHGA 4C6LA 3BLKA 3CZ8A 1G4PA 3TKFA 3QYSA 3IUIA 4L1XA 1PKYA 4LVFA 3OYXA 3REQB 3LXCA 3V5OA 2GUBA 2QJGA 4DBWA 1G01A 2VDIA 4M3PA 1Z7AA 1FBAA 1ZJIA 4HMNA 3QFWA 3P5ZA 1ZQ5A 3FCPA 3NSMA 5G4EA 3NPUA 2RDUA 4MPQA 4WJEA 1FWHC 3T0DA 2O9PA 5BXRA 4Z0SA 5AC4A 1TV4A 3GH5A 4D1IA 2CLOA 4WZHA 1J2WA 3NSNA 3RR4A 1RAKA 5JBDA 1FH8A 3WJXA 4OTKA 3AI0A 2NV1A 2PB1A 2PD9A 4CNTA 1WZMA 3ZM8A 3OB8A 3FEQA 4XO7A 1QATA 3ZFHA 1W54A 4E4FA 4WR3A 2DUAA 1LLWA 4ICCX 4ATDA 3QV7A 1VRDA 3C86A 4O4VA 2OFJA 1BWLA 1XCXA 3GU1A 3JW7A 4L6OA 3W7EA 1KWKA 1OCBA 4GJJA 5DX7A 2NVCA 5AYZA 1UC4A 3MB9A 4ML4A 3GXFA 1WCGA 3QOMA 3NQ2A 1XUUA 4QFUA 3BOFA 2JKEA 4DM1A 2Z1WA 3S2CA 1R7OA 3EPNA 2PD5A 4Y8FA 1GOOA 4HSHA 2R1KA 2C1HA 1ONXA 4MNLA 4C6MA 1MQRA 5LA2A 3MWCA 3OGSA 4ROQA 1BYCA 4GY1A 1B3ZA 3LHWA 1I60A 2J7BA 2GDUA 3WDIA 4B90A 3WQ4A 2A6NA 2DZBA 2J77A 1KQYA 2REQA 3GQYA 4JBRA 4M80A 2X2GA 3LSCA 5ECVA 1Y8BA 3FYYA 3T05A 3CPGA 1W1TA 2O9OA 3E0LA 3B9NA 2W63A 3AS1A 1OZQA 4KF1A 4O1EA 1ITCA 1Y5VA 4UFIA 4O1CA 2PDJA 4ZO9A 2NW0A 1OF8A 1AQFA 2QCLA 1W6TA 3WLTA 3IV8A 2CETA 4WGHA 2B31A 3GIQA 2ZX9A 2A3HA 4ZL1A 1X1NA 3GTHA 2GDQA 3GNDA 4FNSA 3AWNA 4GJIA 3VD3A 2V3FA 4ADTA 4AHQA 1Z69A 1KFEA 4GIRA 3W7MA 1MNSA 3M16A 2IMRA 1UC5A 2EHHA 3T2OA 1PWMA 4GISA 4KGJA 5DCDA 1TPH1 3AALA 2OZ3A 2Y1HA 3DI0A 1ZBKA 4O1DA 3I7RA 5CSSA 1A47A 4DLMA 2OSWA 4DWDA 3U7BA 4W85A 2ACQA 2YCKX 5A8PA 2VDGA 4TOQA 3GC4A 1Y5WA 4QG9A 3VNYA 2QCFA 3WJWA 4HHPA 1YNYA 4XAZA 1JR1A 3IRDA 1H49A 1W17A 3RJYA 5TAOA 5B80A 3GR4A 4XV0A 4ZMGA 2ZUWA 3OO2A 2D3NA 3WD2A 4M56A 1EB3A 4FS9A 1KA9F 1XL9A 3W38A 1MFVA 4QR6A 4TX6A 2DFAA 3BLOA 1SZGA 3I10A 4M29A 2BODX 3HFYA 5CZTA 3LRKA 4GH3A 4CQDA 5AOUA 1WXYA 1V08A 4J35A 4GVIA 3H8AA 2Q6ZA 4YVVA 2PDMA 1E9LA 3RLGA 1TJPA 2RKXA 3A4JA 2C16A 2WMIB 3W28A 3ZJ6A 4UTTA 5CC7A 2HE8A 3ZSSA 2F38A 3N11A 5FIPA 1OK4A 4LC8A 1H7WA 3NGFA 2VOTA 4DZIA 2VFDA 1AH0A 2ZXAA 3PS7A 3S2JA 3MCMA 3H4GA 4Q3MA 4TX8A 4ZOAA 4GGBA 4F79A 3OU8A 2YZRA 3DX5A 3P80A 1PDYA 4CD6A 3ANVA 2QVHA 3CZLA 4FMVA 4KWWA 1UH2A 1QNRA 4WOQA 2DGAA 4H2CA 2D0GA 2R1PA 5HATA 2YYUA 4UUIA 4TUFA 3T81A 1LQ2A 1LP6A 1BVWA 3THCA 4O4WA 4EXAA 1A0CA 3P0WA 1P4CA 3HU7A 1G9HA 3LENA 1WBJA 4Z2GA 3A23A 1H7PA 1JPDX 4LVGA 3PSVA 5A6JA 9XIAA 3P62A 4EWJA 4N6FA 3GUWA 3N29A 1GVEA 3WL1A 1FY6A 2QCNA 3KRBA 3GXIA 4UNKA 1E70M 1R0MA 3OIHA 4IMDA 4XZLX 1JZ5A 2W27A 3EWZA 8XIMA 2X1IA 4UFJA 1AZ2A 1I4NA 1C7SA 2YCLB 3B8IA 1PXGA 1MWOA 4JQ4A 5HMFA 1W3NA 3BW4A 3UW6A 1X38A 2H6RA 2PI6A 3EAUA 1GT8A 4PMDA 4ZFCA 3EEGA 4C6KA 3R0DA 2ZTKA 3PB2A 1G4SA 1KKRA 1XRVA 4QJ4B 4UR8A 4AX6A 1XM3A 4CQCA 4JTDA 4LCQA 4S3KA 2UY3A 4FF5A 3MUCA 1U22A 4WDUA 3IJLA 4ZB2A 4Q7BA 3AICA 3BAXA 5HMEA 4LB3A 3NQFA 5LIKX 3RILA 1LBFA 2CLEA 5FL0A 3RCNA 3CNYA 3VK5A 3FHQA 3G8EA 4XTDA 3IK4A 4Q8QA 1LL7A 4YNGA 3ABXA 4EXQA 2Q02A 4NUWA 5ENLA 5C6MA 1R9XA 1FKWA 4UTTC 5ABEA 3L12A 1LL6A 1ENUA 3K4AA 3DFNA 4XAGA 4JTCA 5G2WA 2QCCA 1JCJA 2YXXA 4AWUA 4MB4A 2EQDA 3EDDA 3IGSA 1HQTA 2ACUA 1MZRA 2V2DA 1VR6A 3AC0A 4HB7A 4YHGA 2CHOA 2HK0A 2HISA 3N14A 1A5SA 1SZEA 2GK1B 4I8DA 4GI4A 4YWSA 4LYKA 4J7RA 3S4TA 1CIUA 3E12A 3BGAA 1AH3A 5I3DA 3SUUA 2RDXA 2HCVA 4I6KA 1J6OA 3C6CA 3NA8A 3CT7A 4RDZA 1XJBA 4XD5A 4YHEA 1QOQA 2BOFX 5ABGA 1TPEA 4QJ1A 1IGWA 2PCQA 3AZRA 4JTUA 1TVLA 3NPWA 1O4UA 4M6PA 4PB5A 4ORIA 3OGVA 2J8TA 7REQB 3QJAA 3PUOA 2X8RA 3CHEA 3REQA 2VZUA 1Q6OA 3F4NA 3V18A 1N8IA 2YYTA 8RUCA 2QUUA 3IRSA 4ICMA 3GXDA 2A7PA 4IH3A 5JH1A 3TC6A 3MSRA 4LNCA 3WLOA 4NZCA 1Q6FA 1NDYA 1LORA 3QMTA 3TNOA 3ALFA 4YIWA 2CPUA 4IPIA 5D9NA 4JR5A 3TIMA 3LTSA 3JZEA 1B90A 5GJPA 4AZCB 5K2ZA 3ZMRA 3VOIA 1GZJA 3F2CA 1J2BA 5JBFA 1BRLB 2BVYA 2J9XA 3IPWA 1R86A 4FIRA 4L4PA 3NNTA 3RF9A 1PB0A 4P7OA 1E56A 1JUKA 2GVEA 4D2JA 2P3ZA 1JAEA 2NUXA 2HV5A 4M6VA 3AOFA 2XN0A 4O0QA 3SFKA 2DZAA 1F07A 3RCMA 3ID7A 4HMCA 5C2GA 1XICA 3CB3A 3WDRA 5AYBA 3KP1A 3NGJA 2CZFA 1W2VA 4H1ZA 5LKYA 3NDOA 5A6BA 4PULA 2J47A 2VQUA 1KFLA 3M5XA 3V7PA 1LWIA 3G0XA 2DIKA 1TVPA 3M46A 3W07A 4W7WA 4JXCA 4A29A 3P67A 3WG6A 2PDFA 1L6YA 1E1FA 2NZLA 1L8PA 4FNQA 2ZZ2A 1BYAA 3R79A 1I75A 5GNYA 3QY7A 1TCMA 4GZJA 4QISA 9RUBA 1S2CA 4W8BA 2ZX8A 2D0FA 4JTLA 1XD0A 3UR2A 2V63A 3AJXA 4RDYA 4JN8A 1A5LC 3FLUA 5FD0A 5A1AA 1Z6KA 5C55A 1PUDA 2F2HA 1A4MA 2A3CA 3RX2A 4U2YA 1MVYA 3W1QA 1JQVA 4J3WA 4ERIA 1ESWA 4UIOA 4DYEA 2BSLA 4GABA 4NZ5A 4A2SA 3STGA 4RLIA 1OJXA 3SEPA 1JFXA 4RE4A 8A3HA 3ZVIA 3D3AA 2Z1XA 4BQ3A 4FSAA 3CV6A 4UQCA 1WX0A 4Z1DA 2WNWA 2ADAA 4O1FA 5LA0A 2OXNA 1YPXA 3NVTA 2PLCA 2L5HA 1IEIA 4B3ZA 3ZR5A 3PZIA 4KMQA 3DHDA 2A0NA 2WV8A 4GZIA 3HV9A 3PZTA 3YPIA 1B0IA 2OLHA 1MI3A 4ACYA 3O6YX 2XGZA 5BZAA 3MWAA 3QR1A 3SQSA 3V0TA 3WLNA 1MXSA 4P8VA 2V38A 4OV4A 2WVUA 1P5BA 1RCOB 4MB5A 1JGMA 2OELA 2G50A 5CQ1A 3O16A 2IPJA 3WO8A 5GPRA 4C6QA 3U3HA 1SO5A 3B03A 4E8CA 2PWGA 1YTDA 3GFYA 3N9RA 2YA2A 3BCJA 4CU7A 2PTDA 1NQKA 4QROA 2INZA 4PBGA 3FJNA 4AC1X 4C6NA 1RP9A 3VD7A 1UKQA 1G7VA 2I5QA 1UKOA 2J7FA 4IGHA 1OCJA 3GD6A 3AYVA 2JQXA 2WMIA 2DQWA 3EX4A 3ANYA 4JTQA 4LS2A 3ITXA 4GI9A 3W83A 2I5IA 3F2DA 1OF6A 3QV9A 3HM7A 3CL8A 1CGYA 1PKMA 1XLEA 1RVKA 3CTTA 1MDRA 1OCNA 1C8YA 1UWRA 1W1ZA 2XJ7A 5CJ5A 3PBVA 3SJ3A 4EIVA 1OX5A 1BSLA 5AC7A 1TG7A 1Q6EA 3W2JA 1F4AA 1ZBWA 4HJFA 3DBNA 4ZOBA 1PJ9A 4CNUA 3VGEA 2NVDA 3ARSA 3AIEA 4P2VA 3OG2A 3BJSA 1NOWA 1IEQA 1VC4A 4W89A 2PU1A 5E0CA 1B3OA 4UTWA 1KRAC 2J7EA 1YDNA 3EWXA 1VJSA 3VIKA 4GFSA 2E6DA 3MKCA 3ISIX 4LF1A 1H61A 3QW4B 4A05A 4KESA 4O54A 1E4IA 4TVCA 1C29A 1W31A 2C71A 2QMJA 3PWIA 3N13A 3GYEA 4B5WA 4BHYA 4J1OA 4WF7A 4ERGA 1L6SA 2POZA 4XZHA 1SR0A 1UMLA 3Q67A 1OGSA 3SN0A 2YCLA 1Q66A 4A4AA 3QHNA 4NKCA 2VYOA 1K3UA 3VOGA 4OBRA 3PP7A 3SCOA 4MY9A 5BXTA 4FXSA 2Y8KA 3EMQA 1FWRA 1GTEA 1E4LA 1E43A 4P8UA 1B3VA 1PDZA 1BVNP 3LBOA 3R4IA 1AZ1A 1S2WA 1UKTA 3B9DA 5F2GA 1QI3A 3ZZ1A 4UTJA 5DBUA 3KOZA 1B57A 1W1B1 2XIIA 1JZ7A 4FLRA 2V5DA 3TDFA 1ADSA 2ZE0A 2XVKA 3E02A 1BEUA 1GKQA 4PUUA 3RUBL 2PS2A 4HA0A 3KBJA 1TR9A 1H2JA 2MUCA 3BWWA 1CNVA 3HPSA 2XN1A 1TPDA 2GWNA 4EWND 1W5QA 2ODOA 3K8MA 4YTQA 3Q4DA 5LHEA 3TU9A 3ZR4A 1HTIA 3OIXA 1M7OA 1Q45A 5D8WA 1LF1A 2GK1A 4JYEA 3CLMA 3WENA 1D7KA 3KBWA 1Q8JA 3P84A 3RLVA 2I9EA 1K70A 2Y7GA 3QF0A 5A8OA 3QV8A 1OFPA 5CXPA 1OX6A 2G3NA 4DJDD 4Q32A 4K37A 3KHDA 4LT9A 4W86A 5K9XA 4UTWC 1UWUA 3W1RA 2NT0A 1VP5A 1WV2A 1TVNA 3AIWA 5MHBA 3CT2A 4MUPA 3UPMA 3STPA 1KCXA 3WFAA 3IIVA 3FGCB 3M43A 1PX4A 3W7KA 7REQA 1E4NA 1PHWA 3TYCA 3L2IA 3NDZA 4UR9A 3VDCA 2GJLA 5HDRA 3IK2A 1Q6RA 4K68A 2OZTA 1NWTA 3TYUA 1R47A 2PDBA 3AHTA 1Z8AA 3G0UA 3U6WA 4LAUA 3AS3A 3I6EA 3CQJA 5BROA 1F73A 3M0IA 4N9DA 4WSJA 1UZ4A 3KCLA 3TA9A 1XKYA 2IKJA 4DJED 1HX0A 2ZOXA 3EWDA 4AZCA 2ZDRA 1BRLA 3LM7A 4X9YA 3HZ3A 3STCA 3UG4A 3TJLA 3B06A 4W93A 3P82A 3SCSA 2WVVB 4HPJA 4PB3A 1S39A 1Q2SA 3ZXWA 3AU2A 4QE4A 4BF9A 4E3TA 1SYTA 2IUZA 1HO4A 4US6A 1S5VA 4WY0B 5A6TC 4LAMA 2YLAA 3NYZA 4OE7A 3G1RA 3SI9A 3WEZA 3E1F1 5H8PA 2VL4A 5H2ZA 1QOXA 1PBGA 2X09A 4IMGA 4JTKA 4JTIA 3PM6A 4S3CA 1I2NA 4JNYA 1H63A 2FMOA 5TNVA 3URAA 1ME9A 2OWCA 5GJNA 3GTIA 1KWGA 4P7RA 3ZWSA 2FZBA 4HNLA 1DHPA 1AA1B 1S5NA 2PZNA 1XH2A 4M1RA 2NXIA 2YW3A 2IXVA 5C7VA 5D38A 3W53A 5FAJA 5RUBA 4HTBA 2GYIA 3HURA 3IUDA 3KLKA 2BDQA 1P7TB 3W1NA 5D9MA 3W02A 4NXSA 4G9PA 3W7QA 4XVEA 1BXNA 4KGLA 2ZQ0A 4GI6A 1XDMA 4INFA 4E0CA 2WZTA 4US5A 1U5VA 2YOCA 1A49A 1V7YA 4ZSTA 1VAHA 3D5HA 3RN6A 1GEHA 3MMUA 4WOZA 1LOLA 2QMKA 4ZQOA 4PMJA 3JRKA 3QBUA 4CKQA 1RK6A 3VOHA 4Q8TA 3LY0A 1S2VA 4H6RA 1KM3A 1AQMA 1XC4A 4AWEA 3CWHA 3MHUA 3V5CA 3QOKA 4W7UA 2EPOA 5T26A 3TC7A 3BJTA 5HAOA 2GDVA 3W2MA 3W23A 2NX3A 4K7YA 2ZRXA 1Q3NA 4WY0F 3MI6A 1EGZA 3AMDA 3LCLA 1O95A 5CSYA 5AKQA 3VNIA 3H2OA 3LU2A 1KGWA 4AY1A 3ZSTA 4HPHA 1FHVA 1YTKA 1LQAA 4J5NA 3FHAA 3D47A 3ARQA 1IYXA 4IISA 1B1YA 3L0GA 5JIWA 1ISWA 4L1WA 4JY9A 3DYMA 1V6VA 3PTDA 2GPTA 4CD5A 3TTEA 1OT2A 2G95A 3KLLA 2I56A 3NR0A 4M0XA 5JMUA 2PU0A 3G1AA 2XDFA 4EK7A 5F2IA 1XI3A 1SJAA 4TVDA 3CHVA 1WB0A 5FJJA 4I7VA 3T2QA 2WPGA 5BOFA 5I77A 1XLDA 1QW7A 4L64A 2PC8A 4JQ1A 3M7SA 3FKRA 4XD6A 3MU7A 5GJMA 3S47A 3AXXA 3K4DA 3CAKA 3B4UA 2ZUTA 3PZOA 3ZJ8A 3VD5A 2VZTA 1M04A 4XG1A 3N2MA 2HE5A 4PMNA 3TTYA 4PMOA 3ARWA 2OSYA 2ZXQA 1NJJA 1KXVA 4P7NA 2FTYA 2P5NA 1QI0A 1UWIA 2UWFA 5CAHA 4LV9A 3L21A 2EPKX 3PSWA 4GNKB 4PN2A 1J93A 2GVYA 2P1FA 3L66A 3TYDA 5FF7A 1EF3A 3NQ7A 4AZGA 3S1GA 1E4MM 3OJGA 3VNMA 1YADA 2IXUA 5CC3A 3COTA 2E25A 3U2OA 4PUMA 4GACA 4V1XA 3IJIA 4RNFA 4PMYA 1NOUA 4PYSA 4ZOEA 2GWGA 2NV2A 5FJRA 3BV4A 3BJFA 3G2GA 3HPXA 4KWOA 1ZZMA 3L5LA 3NQCA 3TMLA 3UJSA 4DXVA 4GYJA 4DB7A 3T6CA 4FZIA 4PBFA 3BZJA 1EDQA 1JULA 1JUEA 3BOXA 5A8NA 4EOUA 4ZE5A 2O7SA 5HXMA 3TWAA 3TQVA 4D8ZA 4GKTA 2V68A 3VYLA 4UXDA 2W6RA 3KRUA 4NY2A 2HVNA 4RW5A 3VCRA 4LEFA 1UZDA 3FSUA 1JDEA 3O7UA 3AAMA 3HG2A 4QG6A 3CEPA 1W1IE 4AD3A 3KWXA 3GDLA 4GYKA 2H90A 4PR4A 3DG6A 5M03A 3UESA 2QPXA 4XVDA 1QW9A 2XH4A 1MFUA 4NG3A 1HKVA 1UYQA 1Q6LA 5XINA 1BXCA 2FHCA 2PGFA 4U5KA 9XIMA 3I6RA 3LQLA 4GC4A 1EJ7L 1JDAA 1CXLA 4JTAA 3GDKA 4CNOA 4Y2WA 1H0GA 2V82A 3WBYA 4V2XA 3URBA 1QR7A 4ZQMA 3W82A 1V77A 2PWDA 2BGQA 3QTPA 1T7LA 4OWGA 3V1PA 4GH1A 4J3VA 4C5ZA 1A53A 4GVFA 4JKMA 2A79A 2Y5JA 3H7VA 4H6KA 3HA1A 1O1HA 4UTLA 3M44A 5CPNA 3QH2A 3AIQA 5I02A 3SECA 2OEJA 5HNRA 4HN4A 1LDCA 1W2PA 5DCEA 3VXGA 4RNIA 3HQPA 4MAVA 2V3GA 2DZPA 1WP6A 3KE0A 4PRRA 3F7JA 1U1JA 2CCRA 2DT0A 3RHGA 3FGCA 2A85A 1RA0A 2TPSA 2EG7A 3EZ4A 4LYPA 4PUJA 4Z08A 4ZGYA 4HMDA 2X30A 1HW6A 5F1UA 4HZ8A 4DI9A 3O05A 2W92A 1B3XA 1A3XA 1JF6A 4ASTA 4H8HA 4JOMA 1MW2A 2VHLA 1W5OA 3IAPA 1M7PA 4D6CA 3WBEA 4B91A 3W25A 5DEZA 4XTIA 1UROA 3IVTA 2WOQA 3UNTA 2P53A 1JYXA 1BGAA 2V30A 3DKJA 4E5TA 3EOSA 3ITGA 4H8VA 3B0VC 3M0MA 5EYWA 2WVVA 1RCXB 3P3BA 3GWQA 4A8LA 5B7ZA 1IV8A 1QO5A 5I5RA 3P8IA 4CUCA 5JQ9A 4YVXA 4WY0A 1SO3A 4F0HA 3PFRA 3HGJA 2JGYA 3EDKA 4GX8A 4HNTA 4J3UA 1D8WA 2XFRA 2VEFA 1E72M 3L4WA 4HJWA 3W2NA 3BLLA 4CCEA 1B4KA 3B8DA 3WUFA 2FZDA 1UIPA 3C2EA 1OGBA 1ITUA 4S38A 3RLHA 1AK5A 4FI4A 4Q8NA 3GH7A 1GGOA 1WDPA 3NFUA 3WLLA 2AL1A 2INEA 3WQEA 3AU6A 1IIHA 1TPWA 2ESCA 2PBOA 2YW4A 3APYA 4K3ZA 6XIAA 3MANA 1IF2A 1Q65A 1X96A 3HJEA 1P7TA 3D6NA 1UA7A 4XQ6A 4WDTA 1NVMA 4MDPA 5DY3A 3SUVA 2WKGA 4DWSB 4RUBA 1ZS2A 3UR7A 2NX1A 2Z7GA 3M0JA 2OOFA 3N9SA 1DPMA 4L9YA 5FF4A 1HKJA 4CD7A 4C6PA 2ZVRA 1LRNA 5LYRA 3UNDA 2QEZA 3QY6A 3NQBA 3GW3A 4HNOA 4PC8A 2PMQA 3CWOX 2H3BA 1X8FA 5E93A 3M4HA 3Q65A 2DZUA 4RZ5A 4MVAA 1FCQA 1NDZA 3XINA 2VP8A 3TVAA 3UWVA 3E5PA 1T96A 5DN1A 3AMLA 1TWDA 4E4PA 3P0XA 3APGA 2HXTA 2BXVA 4B16A 2DT1A 2OO0A 3S6OA 2ZRYA 3GBDA 3TYZA 1HJSA 1EL3A 1YNQA 1JIBA 1DORA 2C19A 2GUYA 1W1YA 3G1FA 4DQWA 1GVFA 5CPTA 2CZVA 1SZFA 4HCLA 3M0KA 3HPFA 4J4KA 2Z1BA 4D6DA 1ZAJA 3E3HA 1CGTA 5D02A 4OJYA 5HJLA 3P7YA 1BF2A 1K8XA 3NYDA 1KTBA 3FN9A 2HXUA 4C6OA 4GQQA 4L6HA 2B7OA 1JG9A 4GMEA 4PE8A 2EAWA 2ZXDA 1NWUA 2WJFA 4ZO8A 1FA2A 3QV6A 2QDEA 3W6YA 3LCHA 4HA1A 1MQPA 4G7FA 3TYAA 3GDRA 3CS2A 5CZKA 3MVTA 1X1OA 4GPNA 4QNEA 2WBKA 1XQKA 3P2VA 3E6EA 3L4YA 3N6JA 1KRBC 4IMAA 1JUBA 3PZVA 3UZWA 3DKLA 5I00A 4AVOA 1RJQA 3K5XA 3MCOA 1GVYA 3HV8A 2A7RA 5FEWA 5I23A 4AWTA 1H60A 4NAEB 3GUGA 2X0YA 1ZCOA 3T8QA 2VZVA 1JXKA 2VUNA 4DBSA 4KWUA 4X2PA 1UR2A 2GJPA 3S1UA 4UOQA 4FNTA 1NWRA 2X1SA 1SFJA 1P48A 1OGGA 2QCEA 4QNWA 4CGTA 2X2YA 4BZYA 4PFMA 5GVJA 4G7EB 3SCQA 1QK2A 5KZ6A 3VDBA 5AECA 5AC6A 2VEMA 5EMYA 1QPRA 4I90A 4CLMA 1CXIA 4UOZA 4TU1A 5F2LA 5IRPA 1U5JA 1MDLA 3WLIA 4IM4A 1GQJA 4JQ3A 3VC5A 3QR0A 2Q3RA 3AHXA 2ALRA 2Y5SA 3TW9A 4XD3A 3W29A 2Z2BA 1OX4B 1QMLA 3PJWA 3W87A 1WZKA 3QXBA 3CHDA 1DJHA 1ZJHA 5BYWA 2IPGA 1DWGM 2AKMA 1MO0A 3WFZA 4ZZ9A 3W4RA 4PUEA 1WUEA 3T42A 2FHFA 1Q7MA 4XAPA 6PTDA 1GOWA 4B2DD 3UZ5A 2BS9A 2JEQA 3WH6A 3VM5A 3DC0A 4GXWA 1LROA 1LUCB 4M24A 4PTXA 2WJZA 2D22A 2WC3A 2H8ZA 4JTSA 4DUWA 3IJQA 2WSPA 5LNUA 3MV11 2BVTA 1I2PA 5EMKA 1NM9A 1MEHA 3DHFA 4IQEA 2PF8A 1H7RA 1KV8A 1EXBA 1X6LA 3MPGA 4RNJA 3LTPA 3CH0A 3ELFA 4IMCA 2OWWA 1T40A 5LNSA 4LJ3A 5EA9A 1PL9A 1OFAA 1LQ0A 4TMBA 3QMSA 1CB7B 3IJDA 4LBSA 5IXEA 2DSVA 2XIJA 3MYPA 1R3RA 4MZYA 2WC4A 2FDMA 3EOEA 3Q2DA 1DXFA 7A3HA 3CGTA 2EG8A 5CEWA 1C8XA 5AYXA 2BG5A 3WN6A 1GVIA 4MB1A 4GI8A 1EIBA 1PYMA 2VFEA 3XISA 3CUGA 1CZ1A 4MDOA 3O0KA 4BY3A 4RR4A 1ISVA 1FHLA 4Y9OA 3UWWA 4XWUA 4O12A 3AUJA 4FR6A 2BY2A 4ZXOA 1UWTA 1W9XA 1X6UA 1HGWA 4P8WA 1ADOA 2OYMA 2VENA 5F4XA 3PBYA 4DX3A 1V79A 5T8GA 5A2AA 4LALA 1W37A 3UZZA 4FOUA 5J5DA 4A3YA 1IEXA 1G0CA 2VC7A 1W3LA 3LHVA 1F4HA 3V35A 3G22A 2B7QA 3G1XA 1LRQA 4HT3A 4LRTA 3SRFA 3A22A 1P1MA 3KL5A 4CEXC 2WVSA 1AJZA 3F5JA 1E55A 1SSDA 2HK1A 3WDPP 1RQHA 2I7GA 1YQ2A 3W7CA 2PWEA 1CPUA 3SCVA 1MW3A 3NOEA 2J79A 3W1TA 4DJFA 5BOEA 2QUNA 5EKYA 1LBLA 1P0BA 1F8IA 1QO2A 2CZDA 2VX7A 3RFAA 1S2UA 4WLCA 4A8NA 4LUTB 4BCEA 1J01A 3H55A 4UNLA 3SURA 3U57A 1GQLA 1PWLA 2J27A 3WUGA 2X41A 1TFVA 2WZMA 4L56A 4S23A 3OLEA 4KEVA 5K9DA 1M65A 5GQBA 3H70A 2C0AA 2RDWA 5LA1A 2Z6JA 3RAOA 2E1WA 1AQ0A 4GWEA 4MZ1A 1SJCA 4NRRA 3W1AA 1TJ0A 3OVQA 2ALDA 2BB0A 4GRSA 1Q85A 5D04C 1E0VA 3LTYA 4PRTA 3SCUA 2W0UA 4KEUA 4Q33A 3ZJKA 3ARVA 4FNPA 4W4QA 1T99A 2PCEA 1XC6A 4POCA 1HJVA 1H1YA 3AXHA 3JVAA 4PBEA 4QM1A 1DJXA 4HZMA 4AYSA 3WQPA 1IEWA 3QFEA 4H9UA 1FX6A 3QN3A 4DWSA 4LPCA 5A2BA 3DHPA 2DDXA 1T8XA 3V3WA 4F2BA 3E2QA 5BOOA 8CGTA 4B4HA 4KCVA 1C7TA 1VLIA 2R9RA 1WO2A 3CUJA 2ACRA 2J7CA 1HKMA 3OA3A 1K8YA 2O55A 4JPGA 4ORMA 1H62A 1E71M 3QPEA 2DQXA 3FIGA 2ISWA 2PDPA 4O17A 1P1XA 1AG1O 3VNKA 4C91A 1JRBA 3VMOA 3F5KA 1E1EA 5I7GA 3T0AA 4ZTXA 2HPMA 4N9EA 4NNBA 3D0CA 5DQPA 3GXNA 1QPKA 4KQNA 3M0ZA 1H4PA 4FP1A 4DJFC 1GVRA 3RO6A 1GTHA 5KEZA 3MZ2A 4U3CA 3GNPA 1UR3M 3DI1A 3KOWA 4DBDA 3ZOAA 3SFWA 1E51A 2CLPA 1XQLA 3LZ5A 4ZQCA 3BARA 1U5HA 3UQNA 5DXXA 2J78A 3WBAA 3DFTA 1ODZA 2QUVA 1TTJA 4D71A 5EU9A 4JFWA 1WA3A 3V5FA 4R33A 2WKLA 2Y63A 4O15A 2AQWA 1QTWA 2CLKA 1KQZA 2J24A 3LNMA 2V6AA 4HTYA 2O56A 5JVLA 2XGIA 3V36A 5E6ZA 3USZA 3ARUA 1WUFA 3LDVA 1ZHAA 4F66A 3I3BA 4NJJA 1SFTA 4BI6A 1BG4A 2BXYA 4BS0A 2W62A 1CXEA 2QJNA 3EXSA 4Q8OA 1KC7A 4I9JA 1CGXA 3BANA 2G3MA 3VOJA 3F4VA 1EH9A 3A3WA 1W1PA 1QPNA 3DFQA 1AW1A 3SSJA 4KWSA 3SQLA 4YYFA 5CG0A 2RJGA 3ZLFA 1SVDA 2YBVA 4JS3A 4S3JA 4DY1A 3FYPA 1K03A 1MUCA 3PG8A 4NAEA 3NG3A 4DYJA 4PTVA 3BG5A 5HMDA 4DWSC 2AQVA 2VEKA 1ICSA 3OZOA 3SCWA 4IP7A 3VGGA 1P0KA 3KVKA 2JBMA 3CASA 3SBFA 5G1MA 5TIMA 2PDNA 1B2YA 1DJQA 3HJZA 5AN7A 2YCEA 3G0SA 1H7XA 2ZRZA 4G7EA 4LY8A 1EJTC 3N04A 3N2BA 5CGMA 1POJA 4JHOA 3NL2A 4BJHA 4UFLA 3AMKA 1XRTA 1V3KA 4W8AA 2ZZ3A 1JPHA 1QW8A 4MUZA 3ZJ7A 1QOPA 3MUXA 1KM0A 1AVAA 5D4YA 1OX4A 2O0TA 5EFDA 1JI2A 3MI3A 3CEUA 4KCTA 2E5BA 4XAYA 3PNZA 1ZSXA 3SB0A 3GC5A 4G1NA 5XIAA 1Q2RA 3DENA 2QCDB 3ZYZA 1NEYA 4F2TA 1B3WA 3LUTA 3WLKX 4Y8EA 2PRHA 1X97A 2BVDA 3TN5A 3W85A 3T09A 4HU8A 2WXDM 3WLQA 4AIUA 3I7SA 1PIGA 1LUCA 5U4NA 3EMCA 1BSIA 2ZTJA 3GO2A 1FCUA 3ZS4A 4ZQPA 5HPOA 2XISA 2TRSA 4KRTA 2ZZ5A 1TWSA 1XIIA 5DELA 1KCZA 2G0WA 2ZX7A 4Q4KA 3FXYA 1BHGA 1EJWC 4UCGA 1T41A 3MT1A 5FF3A 4MNKA 4PRWA 3BXWA 5H8UA 1JD9A 4DRSA 3KTXA 4DIAA 1BKSA 1KLZA 1ITQA 3LBMA 1XIGA 2TAAA 4GOAA 2O9RA 4JNZA 1NQ6A 3VIFA 3VUSA 2NUYA 3TWBA 4MYAA 3TW7A 2Z1VA 1I8JA 4GKLA 1QK0A 1E9ZB 4FXFA 3HGSA 1FWBC 2QJJA 2J74A 1KBIA 3P8JA 3NL5A 3G18A 4B5SA 5HWMA 3F2BA 1PZ3A 4YTRA 3TZFA 1QNSA 5CBJA 1VFFA 3GU9A 4GO9A 4H9VA 4OUIA 5C71A 1THFD 4D6IA 2X1TA 2CNCA 3PPGA 4QDMA 4I5UA 1E40A 1XIBA 3DFYA 3GXPA 3EB3A 1P6CA 4QCFA 3BUVA 3GXTA 1TWZA 1UUOA 3GAKA 4V28A 3KZSA 3SO7A 2JK2A 4WX2A 4UTMA 3FSTA 2D3LA 4AC7C 4GINA 4HPNA 5HUPA 4CD4A 2DT2A 3OYZA 3QW3A 1IWBA 3L68A 1AQHA 1W8SA 2ACSA 1HGYA 1XH0A 3UFYA 2J75A 1UD5A 1VZWA 4LUTA 3WLPA 2EBNA 2Q71A 1VYPX 2WBGA 2CWXA 1W5NA 2OQHA 3TTQA 2QPUA 3WSUA 4ZFMA 4M7SA 2DUXA 1Z9AA 3DGRA 1W8GA 2DV0A 2ZZ1A 2RH9A 3EX2A 1OG6A 4F9DA 2ZICA 3S42A 2XIBA 1XDLA 2C14A 1Q7ZA 4H6QA 1FQ0A 4QJ3B 5B7YA 2QGHA 3RJXA 1R85A 2WNQA 3V1HA 4R9OA 4YXGA 4GO8A 5HOSA 4HK5A 1ZRQA 1EWDA 2DIEA 2ZDSA 5A8QA 1DQUA 4O53A 2G97A 4RE0A 2WQPA 4BF7A 3PWAA 3WELA 2D2JA 4JFVA 4FPSA 2R82A 3A12A 1XLHA 3EEZA 1A5BA 1ECEA 1CLKA 5BRPA 3WQWA 3W7LA 4CVUA 5AZ0A 3LERA 1KRMA 4O10A 3GG1A 3QZAA 5FEXA 6CGTA 2NLYA 2V5JA 3PTMA 7ENLA 3KXQA 3L4UA 1E6QM 1V93A 2C79A 3H54A 4GIYA 4D9PA 1V4YA 2O9TA 2Y2WA 1J18A 3NM1A 5FJOA 3S46A 2VC9A 2V69A 2WNZA 3U2ZA 1MUWA 1GG0A 3O9NA 2ANUA 3ES7A 3VKCA 1A5NC 3C0LA 1JCXA 1YDOA 1JYNA 3MCNA 2Y7FA 2R91A 4YLWA 1S46A 3RM8A 4L7ZA 2J8FA 1E6SM 4PCTA 1KV5A 2VM8A 4QXIA 1HVQA 4E38A 2I1OA 3N6HA 4YTUA 1V02E 1C9WA 3PBUA 2XSBA 4MLJA 1DQXA 2Q8LA 4AQLA 4HPXA 4ZB0A 4CN4A 1J79A 4F0RA 4HNCA 2WMKA 4L9ZA 4OFCA 1FCVA 5DRCA 3FY1A 4IMEA 1WQ5A 3E0WA 4DBEA 2ATMA 2E1DA 4MKVA 3C4UA 3BCFA 1QNOA 4MWAB 2GQ8A 2QGYA 3UWYA 1TYGA 5A6BD 4RK8A 4UQAA 3RCYA 2XSAA 1O5XA 1SO4A 2YFNA 1DJYA 3V0UA 1OYBA 4Y9PA 1TO3A 1PIFA 1R30A 1GNXA 3CIWA 3N4EA 3DFSA 2E09A 4N7QA 3C2FA 1M03A 1M9HA 4PB4A 4GGHA 1XSKA 1UUMA 3IUHA 1VHCA 3EDEA 5LIUX 2QDGA 4M6UA 5IBXA 5LXEA 1IT7A 1XF0A 5A95A 3LYEA 3UXDA 3W1MA 1OD8A 4YS1A 3BW3A 2FFCA 2ZZ7A 1PKLA 5FF0A 5DT7A 1MXDA 2ZA3A 1EUNA 4S3GA 5IHRA 3A24A 2YSWA 1ZB5A 1XINA 1SR9A 4R5EA 3TP4A 2OTDA 3H2EA 3VIMA 3BSMA 3L4TA 4Z1BA 3QRHA 1WXZA 3B8TA 3TONA 2PTWA 3W71A 3P6LA 4QDWA 1Q5MA 1TV8A 4Q8MA 4H6EA 4F48A 2VFHA 2CERA 3QQ0A 4ZTYA 2C1IA 4O13A 1XIJA 1YMYA 3CBWA 2VC6A 4IZGA 1HP5A 1OM0A 2E40A 3ME3A 4EPEC 1GQNA 4PTWA 4LAOA 2BZNA 1UA3A 3SCPA 3ABZA 4IUOA 4NZFA 2J7HA 1MRQA 4RX0A 1OIFA 3WJZA 5A6LA 2UBPC 1ZENA 5E70A 3AHVA 2GJRA 3WJSA 1FWJC 1I6NA 4M8UA 2FDSA 3GHTA 4EVZA 1FUYA 4B15A 3TN4A 1O5RA 2QCDA 5FJPA 1VH7A 3WH7A 1GJWA 3QPZA 3UYCA 3BSHA 3B9AA 3E49A 2WMJA 1PTGA 3KDOA 1R3SA 3BMVA 2ABAA 3EOUA 3K8LA 1V51A 2IPFA 3CZKA 3TSBA 1K4HA 3QQWA 4CCZA 3UZJA 3L0NA 4J3XA 2BOGX 2XWEA 1RUSA 3EB4A 3W7JA 2QS8A 2O7QA 3H7UA 4O0KA 5M2FX 1TZZA 3MUZ1 1RPKA 1SUXA 4MSSA 3TK7A 5D2TA 2VR5A 1S5WA 4HIBA 5IBXC 3P74A 1M53A 3LEPA 3C0JA 1XPYA 1SFSA 1FTXA 2BHZA 1PKNA 5F1VA 4FX7A 1SW7A 4WDXA 2NWRA 4O8AA 1GPWA 3RX4A 4JTTA 3VFLA 1KM4A 1VQTA 4GVHA 3SIZA 1HO1A 3N18A 1BTCA 2W67A 4A8IA 4KT2A 3T1GA 5CPSA 2XH0A 1C91A 3UVAA 3WUBA 2YL5A 4URIA 4UB9A 3FV9A 4NHVA 3EDJA 3IJ6A 2YCIX 3NPXA 3S1XA 2WM1A 1ME8A 1JZ8A 4KFOA 3AS2A 4S39A 4BQ4A 2PP3A 2D1ZA 4O50A 1Q4NX 2OT1A 1J0KA 5REQB 5I07A 1A5CA 1TREA 1R3QA 4XD4A 1EZWA 4PCPA 4JTFA 1EC7A 1EJRC 2Y88A 4BEQA 1Z89A 2XPKA 5IDIA 3H2CA 5J8LA 3QGKC 3CL7A 4IHCA 2NT1A 1LJYA 4S3EA 2TODA 5M5DA 1K6AA 2OR2A 3WD0A 3OPSA 3T9PA 2J9YA 1EOKA 3ARTA 1ZUAX 1ZGDA 4KFPA 3DH7A 1LLOA 4XZBA 1NDVA 2FPVA 4HPGA 2VVSA 3THAA 2QJMA 1ONRA 2V8ZA 3EBVA 4ML9A 4K8HA 3W3OA 1FDZA 4Q8WA 1UH4A 4J2MA 3CMGA 4GNVA 1RXOB 2C3ZA 5H1WA 5GNXA 3H2NA 5DMNA 3DIPA 4W5UA 1KBKA 2V3DA 3W7GA 3WDJA 2BGSA 2FJUB 2VR4A 3GKFA 1ML1A 4KBXA 3EKGA 1AJ2A 4H01A 4XBSA 1MW0A 4ONVA 3OG3A 2CXEA 3KOXA 2BV9A 1W9VA 5LNWA 4HVXA 2HS6A 1ZALA 1K9FA 3HO8A 3VZXA 4Q7IA 2IW0A 2PDYA 5FAGA 4U5IA 1GEQA 1K77A 3R89A 3AS0A 2XM2A 3DAQA 4DF2A 2EXOA 3GDBA 5CJNA 1DTNA 3PPCA 5CGTA 1SGJA 1SM9A 2CYGA 4JHMA 3TUUA 1YX1A 1VFSA 4ADUA 5E9XA 2X16A 3L65A 2VNCA 5T9BG 1CGUA 1JD7A 3WL0A 1XCFA 1Q4WA 4JTGA 3VE9A 1XGEA 4IFRA 3MI2A 3WK2A 1JDDA 3A4WA 2D0HA 3G8RA 2YCJA 2QIWA 5AYIA 4IWWA 1E1CB 4XO6A 3EA2A 3R58A 1TJ2A 4KKXA 4DO7A 1NFBA 1KKOA 1HP4A 1CXHA 3RM4A 2Z6IA 3W84A 1MNZA 3WJYA 2F6KA 3GK0A 4DN1A 4EF9A 1GWJA 4PFHA 1CX9A 1HL2A 3PN8A 4UC5A 2CXGA 2Z27A 2PRMA 4JTHA 4DNHA 3AIBA 4JX6A 2HEJA 3WUEA 1TCDA 2OKTA 2PDIA 2Z0IA 3TJIA 1NP2A 2W66A 1DXIA 1EYEA 1K9DA 3ARPA 1XYCA 5I3JA 3WK0A 4JAWA 1Q6CA 4X61A 3W7RA 3UXAA 5EMMA 3FVDA 4Q4OA 2VI0A 1HT6A 4WKFA 2DVXA 3CYJA 1G67A 5I3HA 4O14A 3OHMB 1TELA 4U2ZA 3EX3A 3I3DA 3NTYA 2FZMA 4GD0A 1HJQA 1M41A 1S5MA 2ZUNA 4IF2A 4EAYA 4WJXA 4J3SA 3LGGA 2PODA 3KS5A 3O06A 1FXPA 1K7EA 1D3HA 1HJUA 1WKEA 3AMGA 1KXQA 4HYWA 3WEOA 3VZZA 5BXPA 4QGCA 4LQ1A 4JTEA 4MWAA 5D2VA 3O0FA 4XISA 1VBGA 2JEPA 1A80A 1MEIA 3TE9A 3WF2A 3OBAA 2YIHA 3LLDA 1ZCCA 2YJQA 2QXWA 3CK5A 1EFZA 3STEA 3GH4A 1C8QA 1HFBA 1ECQA 1TA3B 4F2UA 2PGEA 1XP3A 3GZ3A 1I1XA 1GW1A 1E0XA 1ZY9A 2PP1A 3PUDA 3VGHA 4FXRA 3TSDA 2XFWA 4I9MA 4IJBA 1VIZA 1D3CA 3G1YA 4G2DA 4HU3A 3LG3A 2VD8A 1XDJA 1OYCA 2CLLA 2W4XA 3DG3A 4X9SA 5L9FA 3C8FA 2PDQA 3QLLA 3S5ZA 4IX2A 2V5BA 3FX4A 4IXHA 1NOFA 1FHUA 1OBAA 5KITA 1I2QA 4US5D