1YADA

Structure of teni from bacillus subtilis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
190
Chain Sequence
MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Regulatory protein tenI
total genus 70
structure length 190
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yadA00
3KOFA 1LBFA 1HFBA 4FF7A 5E0KA 1QDSA 4Y96A 5KZEA 4Z0SA 3N9RA 3TR2A 1I2OA 4LVGA 3GXNA 3FYOA 2QUUA 1YXYA 1EP2A 4NZFA 4BI7A 3JR2A 3NNTA 1P4CA 1JQVA 5CPLA 3C6CA 3HG2A 5LNVA 3IIXA 5CG7A 4ONVA 2NWRA 1FDZA 1FY6A 1VCFA 3N2XA 3LHYA 1H50A 5K7JA 1OHLA 3C2RA 1GQNA 4OT7A 5D37A 3FKRA 4Z0JA 4IOTA 1ZNNA 2DZXA 3MI6A 3NQFA 2FPYA 5FF4A 4RZ4A 4DQWA 1UASA 4MY9A 3PG8A 3WK3A 4XBKA 5HWJA 4EF9A 3LCLA 4O1DA 4ZQRA 1BEUA 1CW2A 4Z1DA 3KVJA 3LBMA 5J5DA 1WA3A 3MI2A 4JYEA 2YPIA 3A9IA 4MZ8A 1DQWA 2GQ9A 2NWSA 3NQ7A 3FIGA 2ZBTA 2NX9A 3R8RA 2QCGA 3P60A 3LM7A 3LCFA 4C1LA 2CZFA 3MHFA 4HPXA 3T44A 3M47A 1QAPA 2P10A 3PC0A 3TW7A 1JUKA 3C52A 2FLIA 2WO5A 3NQ6A 1EA0A 3SFKA 1MXSA 4J9JA 3MBDA 3TSBA 3Q37A 4KFOA 2YR1A 3B06A 1FQ0A 3QC3A 1Q6QA 1MEWA 1DV7A 2GQAA 4HT3A 2NUYA 4UFJA 1Z44A 4EF8A 2QKFA 1IXPA 1GPWA 2A6NA 4CQAA 1HTIA 2Y7EA 1JCYA 5LNWA 5LHEA 3T4CA 3PM6A 3HBLA 1H7WA 5G1TA 3LLFA 1I45A 3G1DA 3W9ZA 3T7VA 3IVTA 5C5YA 4PL2A 1LBLA 3G1VA 2ISVA 2C13A 2BSLA 4JTGA 3V75A 3G18A 1YYAA 3PWAA 3W1MA 4N9DA 5DBTA 2GQ8A 1G67A 2Y62A 5BMXA 4FIQA 3TCEA 1PL9A 5G5IA 1Z41A 3O06A 1ZALA 4QIUA 3A24A 1KM6A 3QPZA 3O6CA 3OG3A 3LRKA 1X8FA 1A5CA 2JKEA 2X1RA 4RXFA 1LORA 2Q8ZA 3UYCA 1H7RA 1U5JA 2E5DA 5BNKA 4UIOA 4RZ6A 3TE9A 4MVAA 4JIPA 2B7PA 4PC8A 1MSSA 3M44A 2O7SA 3TFCA 3B03A 1H1ZA 4AEOA 3IRDA 3BG9A 2ZZ1A 3W88A 4YXGA 1JR1A 3R12A 4WD0A 2X1SA 3NM3A 3C4UA 3DFPA 4AF0A 5HUOA 1BKSA 3NPVA 2ZRYA 3W7RA 4UMBA 5AN7A 4O54A 2ATSA 1SO5A 4M7TA 1IXNA 3DKLA 3UWWA 1JRCA 1K03A 3C2VA 3R89A 5DCBA 4UMCA 3MHGA 4FX6M 4WOQA 3QM3A 2J9ZA 2RHGA 1GJPA 3BPWA 3FFSA 1JCLA 1GEQA 3EX6A 2Y88A 5AHMA 1Q6OA 3N34A 4E38A 1QFEA 5D2VA 5LSMA 4FNQA 3QJAA 2YX0A 3C2EA 3G0UA 3P80A 3G8RA 4JDBA 4MKNA 1LYXA 5HULA 2RDWA 4FNUA 1OK6A 1FCQA 1QR7A 1SW3A 2Y61A 4DO6A 5KTLA 2Z6IA 3W6YA 5D02A 1H7PA 3C56A 4BI5A 1SO3A 2Q8LA 1K02A 3O63A 3P74A 1QPQA 5F2IA 1W8SA 5AC7A 1LRTA 1TTPA 5FESA 5F2GA 2QCDA 2IQTA 3PUOA 3EX2A 2NXHA 4UTLA 2DJXA 3W7CA 4DPPA 3E96A 4XUGA 3QYQA 2YFOA 5HWNA 1S5WA 1M7PA 1XBXA 3C8FA 4BK9A 3O6YX 1OVDA 2Y7FA 3LHUA 2QUVA 1G4PA 3RU6A 1R2TA 3A22A 3UZ5A 4N9EA 1OFBA 1OFAA 1N7KA 2CWNA 3A5FA 4YL2A 3ABSA 2G97A 4UFLA 1R2SA 4O16A 1OYAA 3GR7A 5LNSA 2KZHA 2ALDA 1X1ZA 1XBVA 4JX5A 1ONRA 2E5CA 4O14A 3B0UX 1OFEA 2J9XA 3W2JA 3A23A 2GOUA 1FX6A 4QISA 4OV9A 2ATMA 2A2IA 1P0KA 3O1NA 5HQEA 2ZZ6A 3LGEA 3NXFA 1TMHA 3KVLA 2V2DA 3BLFA 2DZVA 7TIMA 4R53A 2OCZA 4GUIA 4K36A 1RR2A 3W7OA 3NAVA 4DPQA 1DBTA 2DJLA 3PAJA 1W54A 1DL3A 4QQ3A 3RF9A 1QO2A 2VEIA 1P0NA 4Z08A 4LOCA 3G1AA 2Y70A 3TSMA 1YLVA 3OHIA 4WY0B 3W7DA 2R14A 4S2CA 3DFNA 2ZA1A 3T40A 3TAKA 3GK0A 3FJ6A 5D33A 1FWNA 1KM5A 4O4VA 3HGRA 1WOAA 1M5WA 3CU2A 4O1AA 2EKCA 2NLIA 3AJXA 3KHJA 3G3DA 1TPFA 2CU0A 3NOEA 4MPQA 3C2FA 4X9SA 3SGUA 1QCWA 2GPTA 2X2GA 1OYCA 1ZY9A 3G8EA 4H3DA 4DF0A 3HQ1A 1WAUA 1PCWA 4KKXA 3QH2A 4NJHA 1CI1A 2H8ZA 5E1QA 1NEYA 2FFCA 1ZHAA 2Y6ZA 5MHBA 3A5VA 1W1ZA 1GYLA 2A6LA 3P7YA 1XM3A 5J5RA 3HB9A 1DJNA 1VYPX 4JS3A 1OF8A 1VH7A 1RQEA 4IGHA 2E6DA 3KAOA 3U6WA 3MI3A 4GE8A 3UWUA 4MOZA 5FEXA 4YWIA 2CW6A 2LLEA 2DU2A 3SIZA 1PE1A 4KFNA 2E6YA 3UD6A 3FOKA 3QQ1A 3KRUA 2W79A 1UCWA 5K9XA 1QO5A 4NVTA 5I3KA 4UR8A 3LV6A 4WY0A 4RKAA 2YCEA 2Z0IA 2CLKA 3OVRA 4O57A 1O4UA 3HPSA 3MHUA 1P5BA 2J6XA 1WV2A 3IV3A 3L5AA 2HTMA 2WNQA 2VKZG 1KLZA 4O19A 1SSGA 4NT0A 4N9BA 1G69A 1T8XA 4MZ1A 5LZLA 3W7IA 1F73A 4S2BA 3NZRA 3Q58A 5LGZA 4PFMA 1JCXA 4AHOA 3S1VA 1TRDA 1W56A 4UTMA 3EB2A 5D03A 5F1VA 4IXXA 1RZMA 2E1DA 1PCKA 1KTBA 2VFGA 3MJYA 2YZRA 4N2YA 3M9YA 3QMRA 3W1UA 5D30A 1I2PA 3E49A 4KWVA 4DO5A 1P1XA 2QR6A 3KRSA 2FTPA 4XKYB 1VQTA 1XBYA 8TIMA 3FLUA 4ZMGA 1L6YA 3PSWA 3M7WA 1ZCOA 4JTIA 4LVFA 1TYGA 1VC4A 2ZYFA 3NQAA 4NUWA 3GYEA 1GYNA 3GR8A 4UXDA 4IMGA 3G0XA 2RH9A 5D2XA 1Y0EA 3UZJA 1TQJA 3UQNA 2VEMA 2ZZ4A 2HMCA 5FF7A 5H91A 4A2RA 1QMLA 4MFEA 1LBMA 3W07A 4Q32A 1ADOA 4UFIA 4TU1A 1FDYA 3U2OA 1KM2A 3OA3A 1C8VA 4HNNA 2C0AA 1JVNA 3P82A 2EF9A 1PIIA 2VELA 5F4SA 3I7RA 3TIMA 2A0NA 1RD5A 5D09A 1L9WA 1RV8A 3NQVA 4E2DA 4GRSA 4JTEA 2TYSA 4NZJA 5I3FA 5A8GA 1K7XA 2VFHA 1TRIA 4EVZA 5DCEA 2X1TA 3NPWA 1UJPA 3SZ8A 2E77A 4LNYA 2OZ0A 4O0KA 4D2JA 2NV1A 1K8XA 3ATZA 5AFDA 1A53A 4E0CA 3CM4A 3NR0A 2FB2A 3TQVA 3LCWA 5G2HA 3C3NA 4TMBA 3MMTA 3C61A 3THQA 1KTNA 4PCFA 4MLRA 1BTMA 2QCCA 4XTIA 1FWWA 3HIJA 4W9TA 1Q3NA 5CPOA 1OFQA 2QJIA 3NL6A 5C2XA 1SQ7A 1H51A 4XTDA 2H6RA 1F76A 5FEZA 1ZAIA 3SJ3A 4OHQA 1LTDA 4RCXA 2P1FA 3W22A 3EX1A 3HG3A 3NPXA 1OG0A 1RVGA 1QPOA 4N02A 3ELFA 4HN4A 1KFLA 2R94A 2V2CA 3O8AA 4Y9AA 5K9DA 3LCHA 1H63A 4LS2A 1GZGA 3GIYA 3LRMA 1X6UA 2GUUA 1LZOA 5HR6A 5AOUA 3P61A 1R46A 2B4GA 2CLFA 4ORMA 1EEPA 3M6YA 3P81A 2RDUA 2YW4A 3GAKA 1VLWA 1KFBA 3CWOX 3C2OA 3R5EA 2V9DA 1FWTA 5I3IA 4LY8A 3PVFA 3S5ZA 3PULA 1ZAHA 4UFHA 4JX4A 3RMJA 1QOPA 4OE7A 4JX6A 5E93A 2HS8A 1DQXA 1A50A 2FPVA 1W5QA 3TK7A 3VKJA 1TTJA 4N6EA 5BW6A 4O4WA 1GWJA 3EXTA 1TJPA 2YW3A 2A21A 5D2WA 2ZTJA 1HO4A 4O53A 5C54A 3S5NA 3IGSA 1XDLA 1ZFJA 3CTLA 3N19B 4ZL1A 3W85A 1O5XA 2R8WA 3LCIA 3WJWA 3PBWA 1LLZA 1W5OA 4HNTA 5LNUA 2ZQ0A 4LC8A 4TR9A 4RXGA 4LRTA 1ME9A 4K8HA 4IPJA 4UFKA 1ZAJA 2YYUA 1L6SA 3MWAA 1K7FA 2YXGA 3EWWA 3YPIA 3HGJA 3EWYA 3WJSA 3M43A 3MO7A 5DY3A 5FF0A 1MZHA 4DELA 4MY1A 3IIPA 4ZQMA 2DZTA 1GVSA 5CPNA 3N73A 5SWUA 4JTHA 2PRHA 1CX9A 5I3GA 4L4MA 5K4ZA 1SSDA 1WBHA 3G0SA 4JTSA 4O18A 1KM4A 4ZVJA 3M5VA 1A5BA 1ML1A 1OYBA 5IM51 3E9AA 3PBVA 3IIVA 3L0KA 1GT8A 3G1YA 3VNDA 4JGDA 3QSRA 4LS0A 3G24A 4H6KA 3UWQA 3IVUA 1DVJA 1KM1A 3OVQA 3W7EA 2CZEA 3SY5A 3W74A 1B57A 1YDNA 1JCJA 1SW0A 1YXCA 3PBUA 2GJLA 2EGZA 4HSOA 4K8EA 3STFA 3P84A 1LLWA 3MYPA 2V2HA 1TPUA 4K6AA 3W7MA 4XWUA 3W7GA 2QCLA 4UTTA 3N9SA 4JD4A 2TMDA 4JYFA 1KFEA 2H3DA 4M19A 4UTUA 4FNPA 1KA9F 1TQXA 3PB2A 3THAA 4DF1A 4HSNA 3VFLA 2YSWA 1R30A 1I4NA 1W3IA 1XXXA 4IX0A 4I7UA 5CSSA 1RQHA 4FNSA 3W2KA 5EMUA 2VOMA 2JK2A 2QAFA 3FA5A 3MP4A 1KBIA 4K7VA 4O15A 3W75A 2YGYA 3WJXA 1MEIA 4MIMA 2QEZA 5HUPA 3QMTA 1LRNA 2E5BA 4XQ6A 3DI1A 5HWMA 1XFBA 2A7PA 2QJHA 1YDOA 1I8JA 1UUMA 1TPWA 3TJLA 1YTKA 2CLOA 5ABTA 3JRKA 1FXPA 3EEGA 2NZLA 5G2IA 1AL8A 3UXAA 1O95A 3QZEA 3TFXA 2YFNA 5KMYA 1OK4A 1BWLA 1YADA 1XDMA 1AW5A 2I1OA 3PR2A 3GDTA 3LERA 4UTHA 4LV4A 1NVMA 3HF3A 1R47A 1Q45A 2CLEA 4JTJA 3GDKA 4CQ9A 4AHQA 2WOQA 2OX1A 1R2RA 2G96A 1HUVA 3MP3A 2XFWA 2ZZ7A 1QWGA 1MO0A 4NJJA 3L2IA 2Y7DA 1GVQA 5DELA 1AW1A 3P62A 3NYZA 1W5PA 4MUZA 4GWEA 1JQXA 2CLIA 3NG3A 3GDLA 5KITA 3EX4A 1U83A 3L0NA 1UUOA 4RX0A 3W2MA 4DBDA 1JUEA 4JXCA 2QCMA 1B4KA 2EPHA 2VEKA 4NQ1A 5DY2A 3BW2A 2JKAA 2Y7GA 4WZHA 3TX9A 1B3OA 3MYOA 3PSVA 1F5ZA 2QDHA 4RJEA 3P67A 3BW3A 4IWWA 1LROA 4N4PA 6TIMA 3LTYA 1TIMA 2ZCGA 1OX4A 3BLIA 1KBJA 2WSRA 4A2SA 2WQPA 4UC5A 1THFD 1OX6A 4YLWA 1TJRA 4PL1A 3KRZA 5D2YA 2G5WA 1OFPA 3LI1A 1VHNA 3ABOA 2QF7A 4N9CA 3PS7A 2WNZA 3CQ0A 3IGUA 3RLUA 4TMCA 1TTQA 2QJGA 1VR6A 2FJKA 2PURA 4OGZA 2UV8G 1HO1A 5BMWA 4AWSA 4JTUA 3B04A 2ZDRA 5DXYA 4EIVA 3DHFA 4EWND 3W7PA 4AXKA 3W2NA 4CCCA 5L9FA 1PV8A 1AK5A 3M1ZA 2QCEA 1F6PA 1PHWA 4S1FA 3ZWSA 4WXZA 4UR7A 3S1UA 5KZDA 1C29A 1OX5A 4JICA 1O94A 3CC1A 3TH6A 2VFDA 3KFTA 2W6RA 1KV5A 2BLEA 2QAPA 4OBTA 3NGJA 3NO5A 1TSIA 2Y89A 3LV5A 2RFGA 1X1OA 3F03K 3W23A 2E6AA 4NNCA 2V8ZA 5AC8A 1YTEA 3W7HA 2J27A 4A29A 3GDMA 3L21A 3W7NA 4YCPA 1F7BA 3CIXA 3E0IA 1C9DA 1LOSA 2VFFA 3B0VC 1I2NA 5I3JA 3NQGA 5HR7A 1QPRA 1K7EA 4O52A 1JCNA 3IIOA 4N6FA 3JS3A 3NQDA 1X7FA 2A85A 2JKPA 4GFSA 1MEHA 1VJIA 3EKZA 4BF9A 3IIZA 3QRHA 4JY9A 3STGA 2VFIA 3S5YA 3TMQA 4O1BA 4UNKA 1KV8A 1XUZA 4QNWA 3L68A 4O50A 3NVTA 4AVFA 3QFEA 1PS9A 1NSJA 1O5KA 4LT9A 3DI0A 5AYXA 4WUIA 4O17A 5A5WA 3P8IA 2C14A 2YDAA 3DU0A 2GVGA 3NDOA 3BK0A 3TC7A 1S3HA 4K38A 4RK8A 4GNJA 3KX6A 1VRDA 3DFOA 5D2TA 5AYZA 3U8GA 3L65A 3N3MA 1SZNA 1TPVA 2NUXA 4LW7A 3RK8A 3FKKA 3ABQA 1DKWA 4GUFA 3QF0A 2GVLA 1TCDA 3HO8A 1Z48A 1D9EA 1WXJA 3BLEA 2BWGA 3W72A 5LNRA 2GVJA 4GBUA 1SO4A 3TW6A 2HS6A 5F2LA 4NNBA 3IVSA 4MZYA 1L6WA 2AAMA 5D38A 1AL7A 1LM1A 3M0ZA 4MJZA 3STEA 3G1HA 2NXIA 3BW4A 4O8RA 4POCA 4IJBA 4Y6GA 2QCFA 5KZMA 1FBAA 1SW7A 1TV7A 5D05A 3GX9A 2XN0A 3DXIA 3QPYA 3W7QA 3DFTA 3NQ8A 4HNUA 4FNRA 4E2BA 4IQLA 2X1UA 3GNNA 1ICSA 3GNDA 1PHQA 2HSAA 3N14A 3DKJA 3HOJA 1KTCA 1L2UA 2PC4A 4MLJA 1W5NA 1XC4A 3W1QA 1F05A 4HNVA 3W7JA 1H61A 1G4EA 4K39A 3W7LA 1H5YA 3W70A 4XBSA 4JR5A 1PVNA 4MY8A 3TJXA 3WFAA 4JTTA 5DLCA 2TSYA 3NA8A 3TNOA 4U4MA 4OWGA 4TX9A 3TQ0A 3LRLA 1FWRA 2ZZ3A 1S5VA 5AC6A 4O10A 3NL3A 3TUUA 1H60A 1VYRA 3GKAA 3E12A 1YPFA 1DJQA 4QM1A 1B4EA 3LXAA 1M6JA 1EP1A 2EAWA 3LXCA 3TV8A 5CZTA 5CPMA 1SZGA 4NJKA 3CLMA 4LVBA 4JTLA 2VEPA 3CT7A 4FHAA 3WK2A 2P0OA 2X30A 1VCVA 2ZRVA 2W0UA 1ME8A 1ZJIA 3OVPA 4KWWA 1KFCA 1N55A 3DFQA 4ZQPA 2AQWA 4PH6A 4GJ1A 1N8FA 3GKFA 3VCRA 2CZ5A 1LCOA 1VZWA 3WK0A 1I2RA 1GVRA 5AHEA 1VCGA 3CIWA 2WV8A 5DXXA 3LLDA 5AHIA 2C1HA 3M5YA 1K8YA 4A21A 2I14A 1EUNA 1F6KA 1RQBA 3W1TA 2Y85A 3HMJG 3LHZA 2YYTA 2WPBA 3NL2A 3STCA 1FCVA 1XBZA 5EY5A 1TPC1 3TROA 1W3TA 3BV4A 4UTJA 4ZQOA 4Y90A 5AHLA 1D3HA 3HG4A 1XCFA 2V5BA 1HL2A 1ICQA 5C55A 1IIHA 2C16A 3F1QA 5EL1A 4FB7A 1S5TA 5AHFA 3TXVA 3B4UA 4MJMA 3DFSA 2ZRWA 1FCUA 3TC6A 3VE7A 3OBKA 4ADTA 2XN1A 2Y63A 2QDGA 2RDTA 1V7YA 1KFKA 1NF7A 1O60A 4Q33A 3T55A 4UUIA 4BWLA 1HG3A 1AG1O 3QMSA 4Z1BA 4ICNA 3CEUA 4LVDA 4CQ8A 3SGZA 1A5AA 2J24A 2C15A 1GTHA 5CZ0A 3BGJA 4Z1AA 3QW3A 3GZ3A 2NX1A 3W7KA 4IUOA 1TPH1 3L9CA 1V5XA 4R34A 3WJZA 1DHPA 4FXSA 1EPXA 2CLLA 4ADSA 4P2VA 3DAQA 1OJXA 2A7RA 3PY2A 3KVMA 5G4WA 4YMZA 2C3ZA 3I68A 3UPWA 1G4SA 4I7VA 1QPNA 4JIQA 5F4WA 1J2WA 1EWEA 3NL5A 1SFLA 1UB3A 4Q4KA 3L0GA 3W1LA 3I7QA 1SO6A 2C18A 1H1YA 3UXDA 3I65A 4QNEA 3QEZA 4WOZA 3M5XA 3SW6A 2DZPA 3OEXA 3GDRA 5FI8A 1W5MA 3S9YA 4ZQCA 3BG5A 2CZDA 4M6QA 1SZEA 1FWSA 1EP3A 1TB3A 4PTNA 2ZA2A 3G1SA 5F2MA 3BVJA 3L66A 2DP3A 4JN6A 5D04C 2VXNA 4I7WA 2FQIA 3PBYA 3P5YA 1JRBA 5DN1A 2V0TA 3IEBA 4LVAA 3VE9A 2ZRZA 4K37A 4YCOA 1Z42A 4LUIA 4FXRA 4QITA 2QCHA 3E02A 1H62A 1XI3A 3ABRA 4ZZ9A 1IIGA 3HPXA 4NX5A 3DHDA 1KW1A 2ZA3A 3K30A 1LRQA 4O12A 3BO9A 4AWUA 4AH7A 5DCDA 3CEPA 1J4EA 3WK1A 3W83A 4WX2A 1F2JA 1W37A 1NF0A 1YXDA 3W71A 5K9CA 4CNPA 1WOBA 1OABA 3S1WA 1OFRA 3PF3A 1VPXA 4QJ1A 3MUXA 3TXZA 2FIQA 2V81A 3PG9A 1QOQA 4HKPA 3NEVA 3W1PA 1LDCA 1NFBA 3H54A 1JCMP 5L6UA 5IBXA 5I3HA 2NXGA 3BARA 3O6DA 1TV8A 1YDVA 2Z6JA 3EXRA 3R13A 2VC6A 3GVGA 2FDSA 3P8JA 2WSYA 4LV9A 1EB3A 5AYYA 3S0CA 1ALDA 3UY7A 4DO4A 3TDFA 3T78A 2E68A 3GAYA 4AB4A 1IXOA 6ALDA 3UWYA 2OT1A 4CNOA 4TO8A 1T0OA 2QUTA 3FYPA 5G4EA 3P5ZA 2PCQA 5AB3A 1OFDA 2E09A 4CCDA 3O16A 4OU1A 5CZJA 3OIXA 3TU9A 5EA9A 4UMAA 5HINA 4DBEA 4JY8A 5F4XA 5BRBA 4IMFA 4WY0F 4HIBA 1GVOA 2CLHA 3UNDA 5BOOA 1VLIA 4AHPA 2O7QA 4KFPA 4N4QA 2A1YA 2FB3A 5TBOA 3W3OA 1AW2A 5C6MA 1YTDA 1EIXA 4IX2A 1XUUA 1OX4B 4NXSA 3W84A 4OV4A 1ZENA 4M6VA 4LU0A 2PRLA 4TIMA 3TQKA 4O13A 1RPXA 2V82A 1WBJA 3W1XA 2CLMA 5K4XA 1FUYA 1SR9A 3PB0A 3KVKA 2OT0A 2ISSA 4GXMA 3PUEA 1OF6A 3B0PA 2OMAA 3LTPA 3W2UA 4Z1CA 1JJKA 1W31A 5KSWA 3NPUA 2Z2UA 3KXQA 3M16A 5EYWA 4WJEA 1H7NA 2F84A 4RV8A 4BR1A 3CWNA 2RKXA 3LHWA 4FO4A 3RFAA 4A3UA 3M41A 4QSHA 1Q6RA 2JGYA 4M7SA 3W87A 3W86A 1XKYA 4UCGA 1OFOA 1D3GA 4G1KA 2J9YA 1H7OA 4QAIA 3INPA 3VI2A 3USBA 2V30A 3S5OA 3O15A 3LI0A 3ANYA 5CSRA 3L67A 1IGSA 3QQ0A 3V1PA 3ATYA 3G22A 3L5LA 3B05A 2VENA 5HJLA 1ME7A 1ICPA 4JYDA 1GVFA 3MP5A 1LP6A 4NXKA 1QNVA 4IPIA 2ZRXA 1I2QA 1SZFA 4GUGA 1TV5A 1BWKA 2X16A 3SSJA 2ZRUA 4LC6A 2FPTA 2BX7A 2VFEA 3NZ1A 2JBMA 4CLMA 3O07A 3LHTA 4U28A 4PA8A 3SI9A 3D0CA 3GB6A 5U7SA 1LOLA 2DZUA 4RZ5A 3NQMA 3LDVA 3HG5A 1VS1A 3EWZA 4PEKA 3EWUA 3I6RA 1JUBA 1SFJA 4R33A 4B5NA 3HPZA 3IGXA 4MFDA 5HNRA 4FX8A 2H90A 4FX7A 2B7OA 4MYAA 4UTWC 3S6DA 2I9EA 1EX5A 1TPDA 1W0MA 3LCXA 4AF0B 4LS1A 2TRSA 1T99A 1GG0A 4O0ZA 5CKSA 1AMKA 1IXQA 4Y8FA 4LTSA 3HGOA 3TA6A 4JTFA 4IMEA 4IMDA 2J88A 4EOUA 3LXBA 1WX0A 5LHFA 5IBXC 1WDWA 4IXHA 4DF2A 4UTKA 1Q6LA 3MW7A 3NM1A 3FJLA 3DGRA 3DENA 5G1YA 1G7UA 1G7VA 4UTIA 1A5SA 3TKFA 2DORA 4CCEA 3Q2DA 3QSTA 3S8HA 4MYXA 4PODA 5CZSA 3GXTA 1G4TA 1TTIA 2B7NA 4GUHA 4NNAA 3LBCA 4HHPA 2NV2A 5CGQA 1B9BA 4HPJA 2TPSA 4JDYA 3RLVA 3N2MA 1M7OA 5H2ZA 1K3UA 4XZ9A 4LRSA 2B0MA 3W1NA 4NJIA 4ML9A 4AMAA 4CNNA 4OQVA 2EHHA 4FEZA 3UWVA 2PE4A 1FDJA 4M6PA 1SU5A 4JEQA 4WQ6A 3CB8A 4O1CA 4UTWA 2ISWA 3NQ2A 4AAJA 3AO0A 3G3MA 2E6FA 5LGXA 2D73A 1T96A 4A22A 5LKYA 3W1RA 3PUDA 2DZWA 4FNTA 3BG3A 3TAOA 3G1XA 3HJZA 2ABBA 2AGKA 4UFMA 5K3VA 2A7NA 5KINA 4L4LA 3A21A 1WYIA 3L5MA 1VGAA 3ZWTA 4GC4A 1IF2A 3F4NA 4K7YA 1FCBA 2WKJA 2WNNA 2QCNA 3NQCA 2CFFA 3GLCA 4NU7A 4X2RA 1F74A 1GG1A 1VYSX 5EBUA 2OJPA 2G95A 3H53A 3ZR4A 4IMCA 3LOTA 2ZZ5A 4BI6A 1GOXA 1LOQA 2Q3RA 2C6QA 4AWTA 2V5LA 3TSDA 1YPIA 3TMLA 1DORA 2Z1BA 5G2WA 4RR4A 2Q3OA 4R7JA 3DBPA 1VHCA 2NUWA 3RNDA 1EWDA 3UWZA 1KLYA 4DEFA 4FIRA 3GXPA 2H3BA 1TPEA 1WQ5A 4ORIA 3O05A 2ZTKA 3HGSA 5TIMA 5FF3A 5FF2A 4O11A 3I7SA 4JTKA 3M5ZA 5EPDA 1K8ZA 2C19A 4P61A 3EXSA 5EKYA 3LTSA 4ALDA 4GUJA 3S1XA 4BWLC 3BGGA 2ABAA 2BZNA 4JNMA 3UY8A 5HMSA 2F7FA 2NX3A 4C1KA 4O28A 4WXYA 5GVJA 3B8DA 2XN2A 3FEMA 4M5PA 3ZFHA 1E51A 1W3NA 4NJGA 5AHNA 3QW4B 4BFAA 1KM3A 1J5TA 2A5HA 3EWXA 3Q94A 3EKLA 3SECA 1TPB1 3LX9A 4RLIA 5F1UA 4DXVA 2H8XA 3ZS4A 2ZFAA 3LCGA 4XKYA 3R2GA 2WSQA 1JULA 3DH7A 4UTTC 3F4WA 3CPRA 3EX3A 5D32A 1FXQA 1DOSA 1G6CA 3EWBX 3WJYA 1UBSA 4H4IA 2PRMA 2R91A 3W73A 2JGQA 2GJNA 5DBUA 2DZSA 2BTMA 1H7XA 1XL9A 3NQEA 3DZ1A 2WJZA 1NAL1 3W2LA 2A4AA 4I9AA 5K2ZA 3MBFA 5TQLA 3C0JA 4ADUA 3SR7A 3LB0A 4UNLA 4NX0A 1SPQA 3LHVA 2QCDB 2ZZ2A 5T26A 1SUXA 3G1FA 4ZQNA 1KM0A 1TO3A 4LUJA 3H55A 3W76A 4LWWA 1EUAA 3UPBA 3W1AA 4X22A 1GTEA 2BXVA 4X3ZA 2B7QA 3CHVA 1KFJA 1TREA 3FS2A 5FEWA 5U4NA 5FEPA 3S42A
chains in the Genus database with same CATH superfamily
3KOFA 1LBFA 5M3WA 4DJDA 1PWLA 3A6OA 4MF4A 2CKSA 1J01A 4D6CA 2UY3A 3TR2A 2QUUA 3BCJA 5HBFA 3GVQA 5A95A 3RX4A 3C6CA 4HK7A 1XYLA 3VPLA 3GVRA 4X61A 3OZPA 2XHYA 4AZHA 1VCFA 3N2XA 1H50A 1PTDA 5GNYA 5K7JA 3VKAA 4WKFA 4OBSA 3TTQA 1GQNA 1TA3A 3FKRA 4Z0JA 4IOTA 2DZXA 3MI6A 3NQFA 3WLJA 2XWEA 4ZFCA 3PG8A 4MB4A 4C60A 4I9TA 2YDRA 1CW2A 4W86A 4QCEA 4A3RA 4HK6A 3OQEA 4QDMA 4Z1DA 1DE6A 4JYEA 2GUYA 3A9IA 3GFZA 1TWSA 3WF2A 3NQ7A 1EJRC 3FIGA 5E0CA 1HGWA 2ZBTA 3R8RA 4C6BA 3P60A 3RAOA 1W2PA 2CZFA 4XSLA 3T44A 5LA1A 4EXBA 4HMCA 1QAPA 1JUKA 3CL6A 1MVYA 3MBDA 3COTA 3MKKA 3QC3A 2NUYA 1LWIA 1Z44A 4EF8A 2OSXA 2VM8A 1GPWA 1HTIA 3N6HA 3OPSA 3T4CA 3PM6A 1H7WA 3LLFA 1UHVA 4ZFMA 3T7VA 1RBLA 3ITGA 4L80A 2C13A 3PWAA 3UXLA 4N9DA 5A69A 1QI5A 4H9ZA 1K77A 2G8ZA 3E3HA 2VJXA 3QY6A 4J28A 1AQMA 4LCSA 5I02A 3I6TA 2YL5A 1Z41A 2OSYA 3O06A 4D6JA 4IIBA 2WJEA 3VNZA 4EPEC 1NM9A 4RXFA 4Y8EA 5ECUA 4DWSA 4NZ5A 2PWDA 1O12A 1VENA 2XDFA 3TE9A 5CPTA 2B7PA 3B9NA 1MSSA 2ZC8A 3B8VA 4QP0A 3P0XA 1P7TB 1W2VA 3STPA 3W88A 2ZZ1A 3M6DA 4YXGA 4LXFA 4LSBA 2YA2A 3GIPA 4DWDA 4UMBA 1H09A 3TP4A 1IXNA 2PFHA 3CBWA 3OU8A 3DKLA 3UWWA 1JRCA 3C2VA 1WPCA 3TN6A 3NOYA 4WOQA 3A4XA 1E1CA 2RHGA 2XH0A 1GJPA 3H2MA 3QHNA 2CHOA 3AXKA 1GEQA 4AZ5A 5AHMA 1Q6OA 3N34A 1QFEA 1R6WA 2X40A 3I4EA 3G8RA 4MKNA 1RP9A 2ZXBA 2PDYA 1JPIA 4FNUA 3GZAA 2Y61A 1VIZA 4JL1A 1JF6A 1RCXB 2CETA 5D02A 3C56A 2VGBA 3PJWA 2C8NA 1AFSA 1K02A 2Z28A 3V5CA 1TA3B 3B3DA 2YLLA 2DVXA 1TTPA 2QCDA 2IQTA 2QHAA 3EX2A 1CB2A 3GTXA 4XUGA 2YFOA 1M7PA 1XBXA 3O6YX 1JDAA 1OSEA 3WSUA 5KEZA 1G4PA 1PDZA 1R2TA 3LY0A 5GJPA 1OFBA 3OTRA 6TAAA 3UF9A 3ABSA 2G97A 1R86A 4I8DA 1C9WA 3UP8A 4JQAA 4W4QA 3O0KA 2GOUA 2ATMA 3AIVA 2JALA 1KRCC 3O1NA 1M01A 1TIWA 4UOJA 2V3FA 4K68A 3KVLA 2VCAA 1UD6A 4R53A 2OCZA 4GUIA 4K36A 5MF5A 3W7OA 3NAVA 1WB0A 2WJFA 2DJLA 4PMNA 3VMNA 3WIJA 1YLVA 2EPLX 3A9BA 3DFNA 2ZA1A 4CNTA 3FJ6A 2H9AB 1S39A 2ZX6A 3CU2A 5EFFA 2EKCA 2CU0A 1L8NA 1HQTA 1E9LA 1WZKA 3DYOA 1F9CA 3G8EA 5AVNA 4DF0A 3WQ6A 2DSKA 1CI1A 5AC4A 1B3XA 1K8CA 1U22A 3ZVIA 2FFCA 2Z25A 3GVWA 5MHBA 4G7FA 3URQA 1XM3A 1GYMA 1E6ZA 3WLHA 1VYPX 1RQEA 3IS4A 4IQDA 2E6DA 3KAOA 3MI3A 2YZ5A 4MOZA 3D46A 5FIPA 3CAWA 3U4FA 3OLEA 4R9OA 2LLEA 3KBVA 1UZHA 2GVEA 3LNMA 1PZ0A 3BOFA 1EJTC 2E4TA 4NVTA 5CGTA 5I3KA 2Z0IA 2CLKA 4HBKA 1H11A 3RPMA 2QPSA 3VK5A 3PJTA 3QC0A 5E70A 2IXUA 4S3GA 1CXEA 2CYGA 1J9YA 1KLZA 4O19A 5A8QA 2I56A 4GYKA 2YCLA 4NT0A 5LIKX 3W7IA 2X7WA 3H2AA 5LGZA 2QUNA 4N0RA 4AEFA 1JCXA 2FVLA 1YE4A 3W01A 4IXXA 2YA0A 3HV9A 4BEUA 1M53A 1KTBA 4H8NA 2ZWZA 2YZRA 3M9YA 3N6QA 3GUWA 2XVLA 3QMRA 2GL5A 1V6TA 4LUTA 3F5LA 1W1A1 4XKYB 2FTPA 1ECEA 3E6EA 1XW8A 1ITUA 1V0KA 4HTYA 5C8BB 3FLUA 3UGVA 1L6YA 1LUCA 2OSWA 4Y7EA 1N8WA 3M7WA 1ZUAX 1VC4A 3HN3A 1SFSA 2D24A 3NQAA 1G1YA 1GYNA 4IF2A 3GR8A 4UXDA 4IMGA 3T0TA 3G0XA 2RH9A 1EGVA 1UR1A 3FDGA 1TX0A 4NAFB 4IM4A 2HMCA 2YL8A 3N2OA 1AD4A 4S3KA 5C9XA 2RJGA 3TZFA 3U2OA 1XRVA 4H9MA 3OYXA 1C8VA 4IQJA 4KGJA 2C0AA 1DWIM 2CCRA 1PIIA 1BQCA 4RPQA 3WO8A 5ECVA 3WF3A 1EJ7L 1RV8A 3NQVA 4E2DA 3U0HA 1US3A 4NILA 1W9UA 3HQNA 5A6TC 1JPHA 1MMFA 2OR2A 3C8NA 2FZ9A 4L4PA 4MB3A 2BY3A 3SZ8A 2E77A 1A5UA 3M0YA 5JBDA 2OZ0A 2F9RA 7CGTA 2NV1A 1XGDA 3UZXA 1A53A 3WH8A 2E1WA 3WDPP 3E2SA 3T81A 1IZCA 4MLRA 1BTMA 1TELA 1FH7A 4W9TA 2VX5A 1C90A 2QVNA 5CPOA 1H1NA 1SQ7A 1H51A 5C9WA 3V18A 4ZTYA 2XGBA 3IANA 4OHQA 4GG9A 1LTDA 4DYKA 1FH8A 3EX1A 3RX2A 1EGZA 1X96A 2P0IA 1RVGA 2BHYA 4ZOBA 1KFLA 3O8AA 1ZBKA 1H63A 3S6TA 4LS2A 3GIYA 3IUIA 1X6UA 3SRKA 5ABEA 5HR6A 3MQTA 4MKVA 4WCJA 3UETA 3P61A 4Q8UA 1GEHA 1PIFA 4ORMA 1TR1A 2WPGA 4WK9A 3TYAA 4J3TA 4UOZA 3R5EA 4KH2A 4P7QA 4ZR8A 4ZB0A 3K13A 4J2PA 3PULA 3RMJA 4JX6A 3RIKA 4AD1A 5AYIA 5A8PA 3OIHA 5EBAA 4D9PA 1W5QA 4LPCA 5A8NA 4XX6A 3NJ3A 4N6EA 5BW6A 1XISA 3A13A 5D2WA 1V79A 3HFTA 4ZSUA 4YHEA 2ZTJA 2D0FA 4TVCA 1NIUA 4LYQA 1M1BA 3B9AA 4ZL1A 4WDXA 5LA0A 4EP8C 1WXZA 4HNTA 3MSRA 1RPKA 2PF0A 4TR9A 4RXGA 4LRTA 1ME9A 2XIQA 3E38A 4L1WA 2J4GA 1U2YA 1OGBA 1LUCB 2YYUA 4YTQA 2EBNA 3E2QA 3C86A 3M43A 1V0LA 3ABXA 3UR8A 2HQAA 3K8LA 1B30A 4MY1A 3PTDA 2DZTA 3N73A 5SWUA 5K4ZA 4GHRA 5LXEA 1WBHA 3M5VA 1ML1A 5T8GA 1OYBA 3BICA 3L0KA 2ZUUA 3TYBA 3G1YA 3VNDA 1XG3A 2DSZA 1B90A 4LS0A 3CIVA 4CNUA 1IYXA 3NSMA 4KIEA 3UWQA 3IVUA 1DVJA 1KM1A 3OVQA 1PXGA 3TC3A 2Q6ZA 4DBSA 3SY5A 3HMCA 4I90A 3W74A 2F61A 1JGIA 4RW3A 3NIYA 4J27A 4WLCA 3WEZA 4BF5A 1CLVA 1POKA 3MYPA 1TPUA 2F6KA 3M0KA 4UTTA 2J25A 1HNYA 3N9SA 1OINA 4JD4A 5E6YA 5REQB 4M19A 2HZGA 3THAA 2ANUA 2VL4A 2YSWA 1U5VA 3BAYA 2R1PA 4PFHA 2OKOA 1RQHA 1TVPA 3W2KA 2VOMA 3IPWA 1S2TA 2W91A 1KBIA 3W75A 3WJXA 1IR2A 3QMTA 3VIIA 1RY0A 2BNJA 2IPWA 3CYVA 3WLLA 3TTEA 1ELSA 3A47A 2E5BA 3ARVA 3CQHA 3UCCA 5HWMA 2XM2A 1YDOA 4KCVA 4ZE4A 5TD4A 3RR1A 1YTKA 1H49A 4Z2HA 2CLOA 5ABTA 1C8YA 5H1WA 1FXPA 4MM1A 3QZEA 4C6QA 1OK4A 5IFPA 5M5DA 3OW1A 1NP2A 3GWQA 5CLWA 2ZDSA 1J0ZA 3PR2A 3GDTA 2W63A 2GLKA 3HF3A 2CLEA 4JTJA 4CQ9A 4V1YA 3OZOA 3MP3A 1V6YA 1S5MA 2A3BA 4FMVA 1AW1A 3P62A 3NYZA 2GVYA 4GWEA 4MUZA 4PB5A 3VNKA 3ZOAA 1JQXA 3KTXA 5BXTA 3NG3A 3EX4A 1E6QM 1U83A 4JIEA 4RX0A 1UA3A 3BV7A 4DBDA 5FJTA 1EJWC 3LK6A 4HU0A 1AQHA 3MYOA 5E0FA 4DWSD 1F5ZA 3ARWA 4P8UA 3ZVHB 1Q7ZA 5HA7A 1E0XA 3LTYA 3LPOA 5M03A 1KBJA 2WQPA 3K1GA 1OX6A 3R43A 1CGVA 3DERA 3LI1A 2OXNA 4GX8A 5FJPA 4R85A 3AYTA 4AY7A 2WNZA 3CQ0A 1EGMA 3BDKA 2UV8G 4JTUA 1TZ7A 1BD0A 3R94A 3CJPA 3APGA 1AK5A 3T0DA 4NRRA 4S1FA 3CHDA 3S1UA 4JICA 4XAYA 3TH6A 5A6KA 2D69A 2YXXA 1E1CB 1VD6A 3RRAA 1TSIA 4IPNB 2RFGA 4GBDA 1X1OA 4PMDA 3T07A 4KETA 3RX3A 4NNCA 4RUBA 4QSFA 4AUBA 4CD4A 2E0PA 4L56A 5CEWA 1UZ1A 4G9PA 1YTEA 1PBGA 3W7HA 1WNOA 3R0UA 3GDMA 2QJNA 3W7NA 5I0DA 2YCIX 1W9BM 3H12A 3NQGA 5AVHA 3KUMA 4N6FA 3NQDA 1X7FA 2IKJA 1W91A 2ZXDA 3TR9A 1VJIA 5JVLA 3QV9A 5MKGB 2PTDA 2JFEX 1BYCA 3B9DA 4XAGA 4O1BA 3WUEA 3E0WA 3T9PA 1DWAM 4U2ZA 4AVFA 3QFEA 1VIWA 4P7RA 4ATLA 1PS9A 1NSJA 1O5KA 4LT9A 3BMXA 4CU8A 4DLFA 3P8IA 3E1F1 4RK8A 3U8GA 3K1DA 3L65A 3LGGA 1TPVA 2PU0A 3WLQA 1HJUA 2NUXA 3POHA 4JHZA 3ABQA 4Q4SA 5GQBA 3P0WA 5LNRA 1XQKA 2GVJA 4NZCA 1SO4A 4IGSA 4NNBA 3IVSA 4M56A 3STEA 2NXIA 4O8RA 4POCA 1US2A 4IJBA 4C5ZA 5KZMA 2PDJA 4B9ZA 3DXIA 1FOBA 2ODOA 1KQYA 3NQ8A 4E2BA 5LIYX 2X1UA 3GNNA 4DJDC 1I75A 4HA4A 4J3UA 3BLOA 3WMBA 2PC4A 4MLJA 2QIWA 1PKNA 1F05A 3W7JA 1H61A 2MANA 4ROQA 2XSBA 2ZE3A 4YVXA 3W70A 3WQVA 3WLRA 4XBSA 4HMEA 4EK7A 3WFAA 2TSYA 4WSHA 4U4MA 1HXJA 2FGBA 3TQ0A 1FWRA 2ZZ3A 3NL3A 3PPCA 3GKAA 4M1RA 3MA8A 3E12A 2OZ3A 1YPFA 1DJQA 4QM1A 3LXAA 5A6SA 1M6JA 2EAWA 3VIPA 5JXQA 3IK4A 4CD5A 4AU0A 2Y2WA 4BZYA 2ZVRA 3URNA 2P0OA 3H7UA 2A3CA 4V1XA 4RDZA 2AKMA 5C9ZA 3IAQA 3GH5A 4PMYA 4GJ1A 1XWYA 3VCRA 1LCOA 1VZWA 1I2RA 4KPLA 1GVRA 1VCGA 5DXXA 4AZGA 1BXCA 2I14A 2YYTA 1CXFA 5IOBA 2QUMA 1TPC1 3TROA 2OYKA 1EXBA 3W29A 3LM3A 3CUGA 4Y90A 1QW9A 1NDZA 2V5BA 3DN5A 1MDRA 2AMGA 4E2OA 4ML4A 5EU9A 3UG3A 3ZT5A 3BXWA 4EACA 3WYZA 4M6UA 4PZVA 4NSBA 1O5RA 5E5CA 3UWEA 3ZSSA 3TC6A 2V5JA 2XN1A 1Q8JA 4OTKA 4TXEA 4D6IA 2QYGA 2RDTA 1NF7A 4U5KA 3VKBA 2ZUWA 3T0CA 1AMYA 1O6IA 4W84A 2PWFA 1POJA 1A5AA 1XH1A 3EBVA 2C15A 3UJSA 3W7KA 1M3UA 4GZEA 3L9CA 3CZEA 3WJZA 4ADSA 5G4WA 2C3ZA 3I68A 4GVIA 1QPNA 1O7AA 1V3MA 3WF1A 2XG9A 4W5UA 4F8XA 3EKGA 3QKEA 4Q4KA 3L0GA 2C18A 2AMXA 1IT7A 3UXDA 4QNEA 3QEZA 1HL9A 2DZPA 5FI8A 3UJRA 3L12A 2XIMA 3DCPA 4YS1A 2CZDA 1Q4NX 4DWSB 1SZEA 1CNVA 2EPNA 2PLJA 5LIUX 1F61A 3K5XA 3BVJA 1DYSA 3SN0A 5D04C 1KKRA 2VXNA 2PDXA 2FQIA 2PDBA 3AISA 3TYUA 3P5YA 2PLMA 3WF0A 2V0TA 3OBEA 4QE1A 3GBDA 4YCOA 1A4MA 2PBOA 4CQCA 4QITA 2DT0A 1V0MA 1N82A 1XI3A 4AIUA 3HPXA 4J3WA 3KP1A 1RP8A 1LRQA 2F2HA 3HM7A 4AZ7A 4A35A 3M4HA 3USZA 4AH7A 5DCDA 3CEPA 4Q4MA 2G50A 4S38A 4UNIA 1J4EA 3WK1A 2P88A 1F2JA 1AZ1A 3GHUA 2NT1A 1OABA 2WMGA 3AFBA 3S1WA 2PMQA 3PF3A 4QJ1A 4Q4OA 2FIQA 4FOJA 1LL6A 3B0XA 2HE8A 3W1PA 5CCZA 1LDCA 1EOMA 4GCAA 2WHMA 5L6UA 2IW0A 4XISA 3G77A 1TV8A 3DBNA 1J0IA 3GVGA 4B90A 2ACQA 5AYYA 3S0CA 1ALDA 4DO4A 3W38A 2E68A 3GAYA 4CNOA 1T0OA 1BPLB 4EAYA 3W24A 4HU8A 2QUTA 4PYSA 4B92A 4CCDA 5LA2A 4IMFA 4UQCA 3GE7A 1J79A 3UNDA 1VLIA 4AHPA 4N4QA 1K4HA 1OX4B 2HXTA 4NXSA 3TNBA 3VZXA 3W84A 4EXAA 4LU0A 3TQKA 1XIFA 1W1YA 1WBJA 4NAFA 3W1XA 1I1WA 3GXDA 2X2YA 1P0DA 5J04A 3KVKA 3FDKA 1NWRA 1QI4A 3UESA 1H2JA 1KRBC 2PDCA 4ZO7A 4Z2IA 5MKGA 2EPKX 7A3HA 3IJ9A 1JZ4A 4ZO6A 1V7AA 4FO4A 4QSHA 3BAWA 4M7SA 4UCGA 2Q8XA 3SCUA 2ALRA 2DIKA 4ZODA 3MC5A 1YMYA 2R1KA 2V30A 1EOKA 3LI0A 1DIDA 5CSRA 5CGMA 1C92A 3VDGA 2OLHA 3QQ0A 4MB1A 1V6UA 3BAKA 1UWUA 5HJLA 1ME7A 1F3WA 2J8GA 1GVFA 1TX2A 1QNVA 3S83A 4GUGA 2XFRA 3GNXA 3SSJA 5JH2A 2XJ7A 3V0TA 2JBMA 4YTUA 3ALFA 2X1IA 2WSKA 2PEVA 1LOLA 4KT2A 4RZ5A 3KTSA 3HG5A 3SRDA 1VS1A 4PEKA 1FWEC 3N13A 4R33A 5RUBA 4RE4A 3VO0A 5HNRA 3VOCA 2OX4A 2XIJA 4E3VA 2CBUA 4L7ZA 3WFLA 3PHAA 1CT5A 1EX5A 2VZVA 1TPDA 3LCXA 3ONCA 4AF0B 1FWAC 1VPQA 3R1ZA 2PWUA 3M0LA 4GGBA 1ZRQA 1KO0A 1RAKA 3VGBA 1XSIA 4JTFA 7ENLA 3MSGA 4DRSA 1R3TA 4EOUA 4IJCA 5LHFA 4UTKA 4IXHA 1Q6LA 3MW7A 5CXPA 4RE2A 4ASTA 2WAGA 3M46A 5CJNA 1G7UA 3WQFA 4UTIA 2W61A 1XH2A 4D6FA 1A5SA 5GNZA 2FFIA 5JMUA 2DORA 3SRHA 1YPXA 4CCEA 3S8HA 4MNKA 1QNSA 3F5KA 3GFYA 4J35A 1TTIA 5CBBA 2B7NA 4GUHA 5DRCA 2YCLB 3LBCA 5CGQA 1VAHA 5A6MA 3SCQA 3N2MA 5H2ZA 2WANA 1RBOB 4XZ9A 2B0MA 2GGGA 4OQVA 1FFRA 1RK6A 5I03A 3UWVA 3UFYA 2PE4A 1FDJA 1CXIA 1BXBA 3KLLA 4S23A 2ZXAA 1UYQA 3CB8A 4UTWA 4FF5A 3DECA 3NZQA 2X0YA 1PAMA 3W25A 1SVDA 2OZ8A 4TX6A 4A22A 3W1RA 3PUDA 3CWHA 4FNTA 4GJJA 1WO2A 7ODCA 3TAOA 4E3TA 1V3JA 2AKZA 3LQLA 4L64A 4U2YA 5K3VA 2A7NA 3PZGA 5KINA 3VNIA 1DTNA 4L4LA 1WYIA 3PZNA 3SCVA 4GC4A 1KB3A 2ZIDA 3WG6A 1WP6A 3UZZA 4K7YA 2Y1HA 4N7QA 1JYVA 3QTPA 1O5QA 3VGHA 3NQCA 2V3GA 3GLCA 1M68A 2OJPA 4OUIA 3PTKA 4IMCA 4BI6A 1YE6A 4AWTA 1P43A 2V5LA 1YPIA 3AHYA 1DORA 2Q3OA 1X8CA 4Y9MA 3QGVA 1V3IA 2XZ7A 3VOHA 4GISA 1HP4A 3PWIA 1HJXA 4FIRA 4WVXA 2ZTKA 1XKJA 4O11A 3WBWA 1GVYA 3CT2A 2AOSA 5EPDA 4PUDA 3S2JA 2C19A 1NOUA 4ALDA 3LTSA 4JHOA 4BWLC 2GSJA 4V27A 4JEJA 5HMSA 1E71M 2I5QA 4Y2WA 3FEMA 2ACUA 4M29A 5AHNA 3EB3A 1J5TA 5H8UA 4JL2A 3LS9A 1V3KA 5JH1A 1HJWA 3EKLA 1OC6A 3WUFA 3EMQA 2D0GA 2PA6A 4HMNA 1J93A 3BSMA 4FSAA 2BHUA 3VNMA 2VX4A 3DGBA 4WJXA 2RGMA 4IJRA 2IS7A 1G9HA 5D32A 2J7EA 1O66A 3EZ4A 2QULA 4NI8A 1AH3A 1UBSA 3XINA 2XSAA 2PRMA 2NVCA 4FXJA 2DZSA 1H7XA 4DI8A 1PSCA 4JCLA 2BV9A 4MADA 3IV8A 3MBFA 1XIHA 2IPJA 4BQ2A 1KXQA 1ODUA 2JF6A 3QHMA 3CHEA 1JD9A 3NUKA 3BAJA 3N15A 4ZQNA 1KM0A 1TO3A 4LUJA 3U4AA 1EUAA 1UKPA 3PP7A 2BVWA 4C6NA 2PLCA 4PMZA 2BXVA 4X3ZA 4JTRA 2B7QA 3CHVA 4E4PA 2FH8A 3S42A 1GCYA 4MJ2A 3BOLA 1E56A 1HFBA 1E4LA 4Y96A 2QDDA 4ICMA 1JYWA 3N9RA 4LVGA 3V0UA 1YXYA 4NZFA 4J1OA 3JR2A 2XIOA 4EXQA 5CPLA 5EMYA 1NJJA 3VM5A 1RY8A 5FCZA 5CPSA 3IIXA 5CG7A 4ONVA 1FDZA 1FY6A 4M51A 5TAOA 4LY4A 1OHLA 1ENUA 3CUZA 4D1JA 3C2RA 2J8FA 5D37A 4AG0A 2FPYA 3BZGA 2I7GA 2PDPA 1UH4A 3RO8A 2BFGA 4MY9A 3WK3A 2FKPA 4XBKA 4PMUA 4K1WA 3KVJA 2IKIA 3LBMA 1EHAA 5JU6A 3SCTA 2YPIA 4MZ8A 4IZGA 3CZKA 2V3DA 1B31A 1XLMA 3M0XA 3CV7A 2VDHA 3LM7A 2FH6A 1BVWA 3GXFA 1XLDA 3IUDA 3MHFA 1QATA 2G37A 3M47A 3I4KA 2I16A 9RUBA 4KIRA 1H5VA 3NQ6A 3SFKA 3Q37A 2YR1A 5CQ1A 1FQ0A 1MEWA 1DV7A 4G5DA 2ZKMX 3OP2A 2GDUA 3QR0A 4L9ZA 5E9XA 1IXPA 3AIBA 4X9YA 1XP3A 3HBLA 2G3NA 3TTYA 1I45A 4QQUA 3W9ZA 5C5YA 1LBLA 1YYAA 3W1MA 5DBTA 4DUOA 2GQ8A 5BMXA 1AH4A 3H23A 1ZBVA 3VUPA 4D8LA 3EDDA 1ZALA 3A24A 1KM6A 1E15A 2PDWA 4INFA 4PRTA 2VGGA 2Q8ZA 3UYCA 5A6BD 1U5JA 2E5DA 2V6AA 4UIOA 3KCLA 5A6AA 3T09A 3M44A 3VKCA 3B03A 4Q7BA 1H1ZA 3BG9A 1UP0A 3ID7A 3FGCA 5CC3A 4NIRA 1FHUA 2X1SA 1R3WA 3DFPA 3EYPA 1BKSA 2BP1A 3NSXA 1FP9A 2NT0A 4L6DA 3V16A 1XLEA 3T8LA 4HPGA 2Z7KA 3R89A 4YPJA 3S46A 4UMCA 3MHGA 4FX6M 1XIEA 2J9ZA 2WMHA 3MVTA 3H6OA 3DYPA 4J40A 3UJFA 2PS2A 2QZRA 2XIIA 3H2EA 1JYNA 4GXWA 4E38A 5A6JA 1HJSA 4G6CA 5M1TA 3QJAA 3G0UA 1LYXA 4H9UA 2RDWA 1IT8A 3WEMA 3ME3A 1OK6A 1QR7A 1SW3A 4E8DA 5DF0A 3SB0A 3TOPA 2JE8A 4JHMA 3IUHA 4GI6A 3VD5A 4C6JA 3AI0A 4U3CA 3V1HA 4C1NB 1BQGA 2PDUA 1MW1A 4Q8PA 1K9FA 4WGXA 3M0IA 1W8SA 2ESCA 5AC7A 3L4TA 2XH7A 1XYAA 4QE5A 4FLRA 3AMCA 2NXHA 2DJXA 4DPPA 3QYQA 5DMNA 3SCWA 1S5WA 4PGLA 2GUBA 2V3EA 4I8YA 5IHSA 3S2CA 4BK9A 1OVDA 3VGDA 2Y7FA 3LHUA 3BLDA 4MPKA 3RU6A 2FHCA 3A22A 1OGGA 2GZXA 4N9EA 1ISZA 2HEJA 4UFLA 1R2SA 4WKAA 5LNSA 2KZHA 1DJZA 1X1ZA 6REQA 4JX5A 3B0UX 2YBVA 4G8TA 1EH9A 3VD7A 4D6HA 2WYSA 1ZLPA 1D2KA 1VFLA 3LGEA 3S2LA 3NXFA 3QLLA 1KGWA 1MYRA 4AYSA 1RR2A 3WDIA 2OFJA 4LUYA 4QQ3A 3MZNA 2DW7A 4HOWA 3ZT6A 1F4HA 1K70A 1E6XM 5D9OA 2X09A 3TWBA 3W4RA 2CHRA 3FV9A 3DG6A 1IEQA 3GK0A 2OWCA 5D33A 3WD2A 1FWNA 2DZAA 2E7FA 3K8MA 2P3ZA 3QZ6A 4O1AA 2NLIA 3KHJA 1UPPA 3MSYA 3NOEA 3SGUA 5LXXA 3I3DA 4ATDA 1LG1A 1ZP3A 1PCWA 4KKXA 1EL3A 4AQLA 5FL0A 1ZHAA 3CPUA 3FNDA 4D72A 3A5VA 1W1ZA 1GYLA 3DG7A 5CC6A 3RYSA 2IQ0A 1YDYA 2R9RA 3HB9A 1DJNA 1VH7A 2VEGA 4NI3A 2B31A 3WQPA 3WMSA 3U6WA 4GE8A 2O92A 3MPGA 5BXRA 5FEXA 2DU2A 3NDZA 1PE1A 3TVAA 3WQWA 3UD6A 3FOKA 1VEPA 1E6PA 3QQ1A 4L9YA 4BY3A 2V69A 1QO5A 5A8OA 5HXMA 4CN1A 3HU7A 3FVDA 3LV6A 1MDLA 4RKAA 1DXFA 4B5UA 4ERAA 1E0UA 1O4UA 1U5HA 2ZOXA 3HPSA 2DH3A 5BWFA 1P5BA 2J6XA 3IV3A 1AODA 4GQQA 3AMGA 2EJAA 3H8AA 4MZ1A 3TQPA 5LZLA 1SYTA 3NZRA 2PAJA 4PFMA 1EQPA 5D03A 5F1VA 3G6LA 3JVAA 4R5EA 1PCKA 2VFGA 3MJYA 4YJ5A 4FALA 1CZ1A 1GQKA 4AD3A 1YBQB 3W1UA 1WDPA 4WJ8A 2E8ZA 3KRSA 4EE9A 5JUVA 5C7HA 4K2SA 2DPEA 3PZVA 3VA8A 4AZCA 2G3MA 3KOXA 4JTIA 4A8LA 3VIJA 1C7SA 4PE8A 3BZJA 1ZS2A 1W9DM 3H2OA 1UR2A 2PUZA 3UZWA 5D2XA 3WQOA 3WH6A 4DUVA 3IJ7A 2F2KA 1I60A 2VEMA 4A2RA 2PDQA 2XINA 3AU2A 4Q32A 3VCCA 1FDYA 4PMJA 4FP1A 3OA3A 2FVMA 1JVNA 2EF9A 4JKKA 2VELA 2A0NA 1G0CA 1X97A 4GRSA 4B3LA 3DUGA 4NZJA 3CAVA 1R7OA 3NGFA 1K7XA 1TRIA 4EVZA 3TWAA 2V68A 2O0TA 2HK0A 3CMFA 1BHGA 4ACZB 1SGJA 4ES4A 1GOKA 4NAEA 4O0KA 5AFDA 4E0CA 3ZLGA 3NR0A 3UG5A 3LCWA 2YL6A 3ZJ8A 5G2HA 4TMBA 3MMTA 1TE1A 3C61A 3THQA 3OBAA 4W93A 1W1TA 4BJHA 5BXPA 2FMNA 1P48A 1OFQA 4I6VA 3SJNA 1T8QA 4XTDA 3WZ0E 1E43A 3SJ3A 3KOYA 4MUPA 1LL4A 2XH2A 3MVIA 1QPOA 3ELFA 1NELA 3KBSA 2AL1A 2NSXA 4Y9AA 3QV8A 4P7LA 2HPMA 3R58A 2GUUA 3K4AA 1ZBCA 3P81A 1FWGC 1QJWA 2TAAA 4UQAA 1DEDA 2RDUA 2YW4A 3WLKX 3GAKA 4H6QA 1FKXA 3N2CA 1SMDA 3CWOX 2V9DA 2CBIA 1DHKA 1FWTA 1V3LA 5HOSA 1L0PA 4F0LA 4MB5A 4JX4A 3LPPA 4OE7A 3WUBA 5E93A 4H1ZA 3PZQA 1TV3A 3NTYA 4JQ4A 2POTA 2FPVA 2VQUA 3TK7A 3VKJA 1GWJA 3NDYA 4US5A 2YW3A 4QG9A 4QS6A 2DSWA 1Z8AA 5DANA 1EFZA 4JFWA 4Q4QA 1HO4A 1CXHA 2VC5A 4KEVA 3VOFA 1XDLA 3N19B 1A5KC 4UR9A 3DEQA 1UZ4A 2WVUA 5GPRA 4XO6A 3KEHA 1LLZA 1W5OA 9CGTA 2OO6A 2E28A 4A3HA 3BQ6A 4UFKA 2GJXB 4GCXA 4IIGA 2EPOA 3MWAA 4LAUA 3EWWA 3YPIA 1JGMA 3W82A 3EWYA 1VJZA 3MO7A 4E8GA 1UBPC 1W1B1 3IIPA 4GZIA 4AZIA 4ZQMA 3TA9A 1Q63A 2VZSA 2X05A 3DG3A 1LQ2A 2P50A 3G0SA 4JTSA 4O18A 4ZVJA 1US0A 4IISA 1A5BA 2OVLA 3VNJA 1DIEA 2O9OA 3A3WA 4YYCA 1JDEA 4GVFA 4H6KA 5AZ0A 1PX8A 1VEOA 4PEEA 1J0YA 3PBUA 4K8EA 3ES8A 5FJUA 3ORWA 3STFA 1IT0A 3P84A 2ZUNA 2V2HA 4K6AA 3W7MA 3UCDA 1IWBA 3BAIA 2CBVA 2TMDA 2PTXA 3KBJA 2FZMA 5AECA 4UTUA 4F9DA 3VAVA 4MWAA 1TQXA 3PB2A 1WE5A 3R0KA 3VFLA 1R30A 4IX0A 2PTYA 4FNSA 3KL3A 5BYWA 1UKSA 5EMUA 4DUXA 4K7VA 3ZXWA 3V0SA 1QWKA 5BRPA 4GZJA 1MEIA 1XIMA 3PN8A 4GZ7A 4PUMA 4MDOA 4XZWA 1EX1A 1HW6A 3CPGA 3DI1A 3UVAA 4PUWA 1I8JA 1UUMA 3TJLA 2WVVB 3AHTA 1I0BA 3SQSA 3JRKA 3EEGA 3QFWA 1SJBA 3TFXA 3KWSA 2YFNA 5KMYA 2HRWA 3VMOA 1YADA 1RLCL 3TW9A 3BWWA 3AXIA 4LV4A 3VIKA 3GDKA 3C0SA 1R2RA 3SUUA 1MUWA 1TV2A 2XGIA 2VC9A 1QWGA 3VABA 3KTCA 4H7ZA 3MJMA 1MO0A 2VP8A 4H7CA 3CZGA 2Y7DA 1MW0A 2CLIA 4BCEA 1RHCA 4C6LA 3ITLA 4HYWA 4NZ1A 2QCMA 4CKQA 2NW0A 3RDKA 2EKGA 3BW2A 4ERGA 5FAJA 1BYAA 2HBXA 3D5HA 2OODA 2QDHA 4RJEA 1F3XA 3BW3A 4N4PA 6TIMA 3VIFA 3ISIX 2XUCA 4A8IA 3N04A 1GOWA 1OT2A 3BGAA 3BLIA 4W85A 1BSIA 4A2SA 4UC5A 4YLWA 5A2BA 4JTQA 1TJRA 5D2YA 1XLKA 3R4IA 4BA0A 1UMLA 2DSVA 3MT1A 3ANUA 1VHNA 4H9XA 4N9CA 3PS7A 3FY1A 3GQYA 4XKMA 2E9LA 2QJGA 3PJXA 5CBJA 5DXYA 3ARQA 1S2WA 3DHFA 4EWND 3AC0A 1KWKA 3W2NA 1L8PA 4CCCA 3WQDA 3T4WA 3M1ZA 1F8MA 1F6PA 1QBBA 1PX4A 4WXZA 4UR7A 4CU6A 4S39A 2RUSA 4B2DA 3VYLA 3FAXA 3AUJA 2QAPA 3WBAA 1NTHA 1OCBA 1HX0A 3KL5A 4ILSA 2Y89A 1MFVA 1UH2A 1XYMA 1Z9AA 2GDVA 2OTDA 1XLAA 3JU2A 3GU2A 1I9CB 3REQA 1OBAA 2V8ZA 4PMQA 2IPFA 4KMQA 3QY8A 4A29A 2WZMA 4YCPA 2V5DA 4H41A 1NWTA 3CIXA 3E0IA 4GH3A 1C9DA 3B0VC 3NQBA 5I3JA 4Q22A 2NQZA 3G5EA 4O52A 2A79A 1KNWA 2ADAA 4PTWA 4C6DA 2A85A 2JKPA 1RJQA 3EKZA 1WCGA 1A5NC 3U7BA 3S5YA 4JQ1A 1KV8A 3JZUA 4O50A 4QE4A 2C1GA 2WCGA 3N29A 3D6NA 4GGHA 3WLMA 3DI0A 2QV4A 5A5WA 3SCOA 3DU0A 4CQBA 2GVGA 3ZR5A 1OEPA 4K38A 1RA5A 1VRDA 3IRSA 3SAZA 3N3MA 1SZNA 5JBEA 2BVDA 1EZWA 4P8VA 1R9YA 3QF0A 3HO8A 4K3ZA 5IFTA 1G94A 4QX4A 1BTCA 3VM7A 4A8RA 3RUBL 4HN8A 4HHMA 1V6WA 4ZB2A 1QHOA 1S2UA 1L6WA 5D38A 1AL7A 1NU5A 4KF1A 3M0ZA 3AWOA 3UG8A 4AWEA 1F6YA 2XVNA 4Y6GA 3BLPX 3KW3A 3CZ8A 5D05A 3GX9A 3V5FA 3W7QA 1E0VA 4FNRA 4FOUA 4HNCA 2HV5A 2ON3A 2V67A 1A3XA 4S3DA 2BXZA 2HSAA 3N14A 1J2BA 3HOJA 1XC4A 3VIHA 2BVTA 3EDFA 4K39A 4D1IA 4PMVA 4F9JA 5PTDA 5IHRA 2R1NA 1PVNA 1JZ6A 3TNOA 4I9MA 3TJ4A 1PKLA 2UBPC 4Z1YA 3N25A 1S5VA 2TODA 4O10A 3QGAC 1EPVA 3TN5A 5M2FX 1B4EA 4LCQA 1LLOA 5EGRA 1PPIA 5EFDA 4DXXA 4AD2A 4P5UA 1R8LA 3LXCA 5CZTA 5CPMA 2IPGA 4LUTB 4NJKA 2YXOA 3CLMA 2VEPA 3CT7A 5AY7A 2W0UA 4KRTA 4M82A 4LX4A 3U57A 3F4CA 4QLJA 1P6WA 4I6KA 1KFCA 2NQJA 3BOXA 3RLHA 4ZQPA 1N8FA 3GKFA 4HQVA 3WK0A 3ITOA 2GGJA 3U48A 5AHEA 3CIWA 2WV8A 4AY1A 3P93A 3AYVA 3M5YA 1EUNA 3VDHA 1F6KA 4E2VA 3D3FA 1OT1A 1AUSL 3STCA 1G5AA 1FCVA 1XBZA 3ARRA 3BV4A 3OA5A 4UTJA 4ZQOA 2ZXQA 1OCJA 3BE7A 1MZRA 1KRAC 1IIHA 3F1QA 3H2CA 2VHLA 5I3DA 2QGYA 1C93A 1TCMA 4LBRA 1RD6A 2YB1A 1C8QA 1UP2A 5I24A 4UZSA 4NG3A 1GK8A 2D23A 2FGLA 3QBUA 3WMLA 4AIBA 5C2CA 1WDSA 3PFMA 1J6OA 3SURA 1E55A 1V7YA 1KFKA 4Q33A 1HL8A 4HNLA 4V28A 2DT3A 5G4HC 1V93A 4HK5A 3KE0A 3P2VA 3CEUA 4LVDA 2Y4SA 2DUXA 2J24A 4XZHA 1GTHA 4Z1AA 1RA0A 4HZMA 2QJMA 3W02A 3VX1A 4IUOA 2INFA 1V5XA 3OO2A 1DHPA 3GTHA 2O56A 1KCZA 2A7RA 3PY2A 3CQIA 4YMZA 3GTFA 1G4SA 4I7VA 2YL9A 4JIQA 5F4WA 5CBIA 1W8GA 1PKYA 3SCPA 1EWEA 1UB3A 3ARSA 1KKOA 1A0EA 3LBOA 2WCSA 2NQLA 4C5YA 1PWMA 2FZ8A 3HTWA 2EXOA 3LSBA 1W5MA 1GOIA 4ZQCA 3BG5A 4JKMA 1V8EA 4HOXA 3QN3A 1T7LA 1FWSA 4RNIA 1K4GA 4US5D 4HA1A 4HJWA 8CGTA 3L66A 2DP3A 3AHZA 4JN6A 3EOLA 4I7WA 2PSNA 3EWDA 1IEXA 3PBYA 4FR6A 4KWOA 1X39A 5DN1A 4B16A 4URIA 1C91A 5A2AA 7REQA 1Z42A 4JFSA 2OEMA 4GJIA 4GABA 2GGEA 2QCHA 3E02A 4Y9NA 3APTA 1KW1A 2BMBA 3K30A 4O12A 5DMMA 1WKYA 4U10A 3W53A 5A6BA 1UWQA 1KR1A 1UROA 3WH7A 1W37A 3GC5A 1NF0A 4B3ZA 1IHIA 1OFRA 1VPXA 2E9BA 1DJHA 1MUMA 3TXZA 3H70A 4G56A 4QG8A 1MXGA 1GHSA 3NEVA 1NFBA 4U3AA 3H54A 1JCMP 5IBXA 2NXGA 3BARA 3O6DA 4DB7A 3EXRA 3R13A 1ZP4A 2WSYA 4LV9A 4CNSA 2G4JA 3TDFA 3T78A 5B7ZA 6ALDA 1D3CA 4S3BA 1BG4A 3ITTA 4JFVA 2V5CA 4H8HA 3P5ZA 3ZQ9A 5AB3A 4UQEA 2E09A 3O16A 4IIDA 3MV01 1QNOA 4OU1A 5CZJA 5HQLA 3OIXA 3P3BA 3EDKA 3CO4A 4JY8A 2DT1A 1K9EA 4O8AA 4HIBA 1V6XA 1GVOA 5DEZA 1FP8A 3B97A 2OLAA 2O7QA 4KFPA 3PUGA 2FB3A 4I9JA 3EWCA 5C71A 3W3OA 1AW2A 3VNLA 3S9ZA 3L2MA 1XUUA 2UY5A 4U5IA 4M6VA 4TIMA 3SBFA 1PZ2A 4O13A 3WMCA 2D2GA 4ZA0A 2CLMA 1FUYA 1AZ2A 1IZJA 1SR9A 3M07A 1EBGA 3PB0A 3PK7A 2OT0A 3DC8A 4GXMA 1OF6A 4ZOCA 3W2UA 1KRMA 3SUSA 2VRJA 3CV6A 3M64A 3RU8X 4PBEA 2Z2UA 4CCZA 1XF0A 3ARPA 3ITVA 5EYWA 4RV8A 3LD5A 2RKXA 1EKOA 4LJ3A 1N2VA 4F66A 2G3JA 2VI0A 3W86A 2E67A 4WDUA 1VBRA 1H7OA 2XVGA 3O15A 2I5GA 4KEUA 3RCYA 2X8RA 3TEVA 3GC2A 3AUOA 3ATYA 2ZUSA 1RK5A 3LLXA 1KCKA 3B05A 3MP5A 1SJCA 1J11A 1SZFA 3AHVA 1TV5A 1BRLB 3QR3A 1BWKA 2X16A 2ZRUA 5E09A 2RGLA 2QPUA 2VFEA 1KGUA 1A0CA 3O07A 4XO7A 1VEMA 3EA2A 2FZBA 1L2QA 2CHNA 3CH9A 1DQUA 3I6EA 1FHDA 3ZLHA 4DZHA 1XLJA 2J62A 3WCZA 4NAEB 3UBPC 4MFDA 3ZVHA 2H90A 3VVGA 1R87A 2DQXA 2B7OA 4MYAA 4UTWC 2I9EA 1OQFA 2OLSA 2TRSA 3GYCA 3KM8A 2Y8VA 4R3UA 3O6AA 1IXQA 3WF4A 4LTSA 3HGOA 3GXMA 2J88A 5IBXC 1D7FA 1TJ1A 2D22A 5CSYA 1TUFA 3NM1A 4IFRA 4PBFA 5G1YA 1REQB 1G7VA 1BKHA 4GQRA 1BGAA 1ITXA 3QY7A 1EF3A 3Q2DA 1IEWA 4MYXA 1LJYA 3QGKC 4KRZA 2DEPA 5CZSA 1MRQA 3GXTA 1EDTA 1J0HA 3UPMA 1L6FA 4XD3A 4DJDD 4HPJA 2TPSA 2Y0FA 4EPDC 3RLVA 4JKLA 1M7OA 3BCDA 1VJSA 4TVUA 3W1NA 1GZJA 4MDPA 1JZ8A 1RJPA 1EYEA 2EHHA 2A3EA 2OQHA 3H22A 1SU5A 4JEQA 4WQ6A 3M0HA 1E72M 4G2DA 2Z4GA 3CUJA 2D73A 3S4TA 3AYSA 4PTMA 2Z24A 2A3HA 3RCMA 3MZ2A 3BG3A 3G1XA 3FYYA 2GDQA 1IEVA 1XLCA 2X0HA 4MSSA 3T2OA 3U5YA 1Z89A 3A21A 4H9VA 3L5MA 1E6SM 1VGAA 1IF2A 4ZGYA 3ZZ1A 2WKJA 4FR1A 3GFXA 3EEZA 4AISA 1GG1A 1VYSX 5DO8A 1FVPA 1JZ5A 3H53A 1GOXA 2Q3RA 2F6XA 3TSDA 3ERPA 3N2BA 2Z1BA 2Z1KA 1IWPA 1VHCA 3S2NA 1Q65A 3B40A 3UW6A 1EWDA 3UWZA 1KLYA 3BL3A 2XFYA 1TWIA 1TPEA 1SZRA 1JPKA 1WQ5A 4ORIA 3O05A 3MMDA 3UG4A 4GFIA 2O4QA 1Q2SA 5XINA 3PWGA 3I7SA 4JTKA 4RPPA 1QXLA 1K8ZA 4D6EA 4EWJA 2CKRA 3EXSA 4GUJA 3W6MA 3S1XA 3T2QA 2BZNA 1GGOA 3H7RA 4ZSTA 1J6PA 5GVJA 4O28A 4PRRA 5FKYA 4OZOA 3K4DA 1E51A 2PGEA 4NJGA 3ZFHA 3QW4B 1KM3A 3CASA 3DFYA 2R82A 3N4FA 4QHRA 3Q94A 3SECA 1W1VA 4ZOEA 4IQEA 1TPB1 3RGTA 4NRSA 1AQFA 3LX9A 4GO8A 1XYFA 4RLIA 2D20A 4LUSA 3O9NA 2QIIA 3OGVA 3ZS4A 3BLKA 4XKYA 4Q3MA 3DH7A 3F4WA 5DFAA 4BHYA 2YKKA 3PNZA 3FXYA 4KCWA 1JZ7A 3WJYA 2PZ0A 1U1HA 3VCNA 5FSDC 4PMOA 4X63A 1DXIA 2W62A 1GPFA 1MW3A 2GWGA 3RR4A 4GC3A 5K2ZA 2GWNA 3C0JA 4ADUA 2WMFA 4UNLA 4C7GA 1JL8A 1ISXA 3G1FA 4IP4A 3PPHA 4Q4PA 3H55A 3W76A 1ONXA 3W1AA 4C1NA 2P5NA 2PWGA 1TMQA 5JIPA 5E0KA 1LF1A 4MWAC 1GW1A 3OGRA 5KZEA 4CUCA 1I2OA 2AQVA 1M7JA 3GXNA 4BI7A 5HPCA 4R7WA 1P4CA 1ZJAA 3HG2A 4YN5A 4PN2A 4FLOA 5LNVA 4H04A 4AZCB 4NYYA 2NWRA 6PTDA 3HZ3A 4PMRA 2WK2A 3RILA 1U1JA 1Y5VA 4OT7A 4GIYA 2WC4A 3W27A 1M7XA 1ZNNA 2Z1WA 2FGZA 2PWVA 2GYIA 1PYFA 2VT0A 4R7OA 4C6PA 5HWJA 3QYSA 4QEEA 2OGYA 5GJMA 4EF9A 3LCLA 2XH4A 4O1DA 5B80A 3V3WA 3GTNA 1BEUA 4WSJA 5FJJA 1WA3A 3MI2A 3WBEA 1DQWA 1YEYA 1QI3A 2GQ9A 2NWSA 5ENLA 3GHRA 5H8PA 3SY1A 3ARTA 4GKLA 2NX9A 4KW2A 2QCGA 1RUSA 1W9PA 4C1LA 3ZMRA 3ITCA 3WEOA 3FEQA 3T05A 4M8UA 3CO8A 4DJFD 2HK1A 1LL7A 2VOTA 3SRFA 5B7YA 3PC0A 5A8MA 3AHXA 1F3EA 4GACA 3TSBA 4KFOA 4IFOA 1W3JA 3Q4DA 2Z1SA 1Q6QA 5IXEA 2QKFA 2A6NA 4CQAA 2Y7EA 5LHEA 2Z26A 1E9ZB 4JTDA 2EPMX 2WVTA 1JI1A 3IVTA 3G1VA 2ISVA 3V75A 2BSLA 4PUNA 3G18A 1OZQA 1W6TA 2BHZA 2YJQA 4YWSA 1EDQA 5HATA 4IICA 1LG2A 2NLYA 4Q8MA 1V6VA 4RDYA 2Y62A 2HISA 1ZCCA 4FIQA 2HXUA 3MCMA 1PL9A 2J47A 2QJJA 4M0XA 4QIUA 3QPZA 3LRKA 1A5CA 1NOFA 4DHGA 3EMZA 4PRWA 3FX4A 1H7RA 1YRRA 5BNKA 4RZ6A 3DC0A 4HJFA 3CQJA 1A5MC 1OCNA 2EG7A 2W3ZA 4FK9A 4AEOA 3IRDA 3N9KA 3IAPA 2UY2A 4HPHA 4AVOA 1FWHC 1XHGA 4YTRA 4H9YA 4MWAE 3ONBA 3NM3A 3C4UA 4CD6A 1GJWA 5AN7A 1XLHA 2VCCA 4M7TA 2OEJA 5HK4A 3TN4A 2E8YA 1KBKA 3C0LA 5HANA 4F0SA 3BPWA 1JCLA 3EX6A 2Y88A 3AS2A 5D2VA 3B4YA 2YX0A 2R1MA 3C2EA 4JZ5A 3D47A 4JDBA 5C9UA 4R9XA 5EMMA 1J5SA 5T9BG 1FCQA 1DJWA 4GI4A 3TJIA 1XPGA 2Z6IA 3W6YA 5CAKA 4ZO9A 1H7PA 3E5PA 4BI5A 4S3AA 4DM1A 3IJ6A 1Q6DA 2FMOA 1SO3A 4HU4A 2Q8LA 5C2GA 3O63A 3P74A 3N18A 2A3AA 1BVZA 5DMYA 1BG9A 5AKQA 1AVAA 1XLBA 4DJEC 5FJOA 5FESA 5F2GA 1J0KA 4UTLA 3OOQA 3CAKA 3R7MA 2WWDA 3W26A 5HWNA 1NWUA 3C8FA 2OYMA 4Z17A 2IUZA 1JCTA 2QUVA 3VDBA 4DUWA 1PKMA 1QW8A 1PZ3A 3SO7A 5EMJA 2CWNA 1OFAA 2WLZA 2J7DA 3SGGA 4W8AA 4Y9PA 2ALDA 2CIPA 1ONRA 4O14A 1T41A 3A23A 5BWAA 1FX6A 1ITCA 2WXDM 4QXIA 4OV9A 1QPKA 1KXHA 5HQEA 5BU6A 1QW7A 2J13A 1HKMA 3BJFA 2BGNE 4ZB5A 5TNVA 3ARXA 1TMHA 3RITA 3MKVA 2V2DA 4XAZA 3WLOA 7TIMA 2JIWA 4DPQA 2HJPA 3WQ5A 3PAJA 1NARA 1W54A 1DL3A 4MNMA 4W5ZA 1QO2A 3RF9A 1P0NA 4LOCA 3G1AA 2VO5A 1GW9A 4DBWA 3OHIA 4WY0B 3W7DA 3KBWA 4S2CA 3T40A 4WIWA 4IIFA 1KM5A 2H9AA 4HPNA 1SJDA 1WOAA 4L1GA 3G3DA 4GYPC 3ABZA 1TPFA 4X9SA 4MPQA 1QCWA 1UKOA 2X2GA 3S3GA 3LU2A 3T0AA 5E6ZA 1ZY9A 4H3DA 4QG6A 1WAUA 3HPAA 4NJHA 4HZ7A 2ZC1A 1NEYA 3NO1A 4LYPA 4AD4A 3CQKA 4I5RA 3P7YA 8A3HA 3IACA 5J5RA 4QGCA 1XFCA 6XIAA 3AWNA 3VGGA 4DJFC 3UWUA 4YWIA 1YIXA 2CW6A 1QASA 2E6YA 3IGHX 3JUGA 3VC5A 4QEHA 3KRUA 5K9XA 2GJXA 3TYDA 1UPMB 1B0IA 2MNRA 1J12A 4B2DD 1OIFA 3HFYA 3OVRA 4FLSA 4LF1A 3MHUA 3L7RA 3L5AA 2G4FA 4ZCWA 2HTMA 1Q6CA 1XDJA 1KCLA 4QAWA 2WNWA 1SSGA 4N9BA 3VOJA 1F73A 3AICA 3GTIA 4XIAA 4S2BA 3R0DA 5CJ5A 3IJQA 4AHOA 3S1VA 1CENA 1TRDA 2XU2A 1NDVA 4I5UA 1EF2A 3IWPA 2GJRA 3EB2A 2E1DA 2J66A 2OKTA 4AIEA 3EB4A 4N2YA 4CQDA 3WDHA 3SDOA 4NF7A 1I2PA 3AAMA 4DO5A 1P1XA 4X60A 1FTXA 1EYWA 1VQTA 1XGZA 5FJIA 4D6DA 1YX1A 1XBYA 5I09A 8XIAA 3VNYA 3APYA 2WMIA 3PZ9A 4NUWA 2VURA 3GYEA 3HA1A 5D8WA 3CB3A 3AQUA 1TQJA 3EMCA 4EX4A 3UQNA 3O3RA 2ZZ4A 3BSHA 3U5UA 5H91A 1LBMA 4OOZA 2J79A 4IG2B 5ABFB 1MXDA 4W7UA 3CGTA 4HNNA 2NQHA 1S2VA 5D8ZA 5F4SA 3TIMA 1A0DA 3ZR6A 1L9WA 5D09A 1NOWA 4Q4RA 2WBGA 4JTEA 1UZDA 2TYSA 5HNNA 3ZLFA 5A8GA 1JPDX 2OPJA 2GSHA 1W3LA 3BMWA 2X1TA 3NPWA 1WKEA 4LNYA 1YW1A 4D2JA 3SCRA 3ATZA 3EPMA 4TQTA 2FB2A 1ODZA 1IV8A 4IL2A 2ZVIA 1IWAA 3C3NA 3RM9A 1KTNA 1HKVA 4H2CA 3SQMA 1B3YA 1MWOA 1Q3NA 2Y24A 5C2XA 2H6RA 1F76A 3B8UA 1ZAIA 3N11A 2WZEA 4FXFA 3RJYA 3WQGA 1QNPA 3W22A 1EJXC 4MAZA 3NPXA 1OG0A 2ACSA 4LFYA 4W88A 2DW6A 1NWSA 4HN4A 1HGYA 2R94A 2EO7A 2V2CA 4F3HA 2O4MA 5K9DA 1GZGA 3I3BA 1LZOA 4MTVA 4RL3A 5BZAA 2OELA 1R46A 4AW7A 2B4GA 2CLFA 3IARA 1WUFA 4GY7A 4WRHA 1JF5A 1FHVA 1O1ZA 1Q6FA 1ITQA 1JDDA 1VLWA 1KFBA 4UQDA 1RSCA 3URAA 4MKSA 3D3AA 1R7AA 2J77A 1P0BA 3GC4A 4LY8A 4XAPA 2Y5EA 3S5ZA 1ZAHA 1TR9A 5I00A 4KESA 2F6UA 1IQ8A 3H2FA 4UOQA 4H6RA 4YVPA 1H0GA 1A50A 2Q71A 4JIIX 4GQ0A 4QLKA 2DIJA 3A4WA 3W0KA 4J5NA 3DDMA 3GY1A 1KBBA 3EXTA 4J3SA 3WNOA 4AD0A 2A21A 2VD9A 3SIMA 3ZJ6A 5DQPA 1TVLA 4O53A 5C54A 3S5NA 3IGSA 2RJHA 1WDDA 2VZUA 1GNXA 3G1RA 3URBA 3W85A 4PUEA 1O5XA 1T5AA 2R8WA 1S46A 3LCIA 3K8KA 1Q8AA 3PBWA 4FA3A 5LNUA 4IIHA 1BF2A 2ZQ0A 4C6CA 2VR2A 3RM8A 4K8HA 1MUCA 1ZAJA 1TMLA 1K7FA 2YXGA 3IJDA 4YHGA 2DZBA 2WMIB 1Z6KA 2JIEA 5DY3A 1MZHA 2D2HA 4DELA 4LEFA 1GVSA 2R1LA 5CPNA 1W1IE 4L4MA 3RG6A 1SSDA 4F0HA 4PCNA 4XB3A 1KM4A 4KS0A 3AMLA 1MW2A 4AY8A 5IM51 3IIVA 2VRKA 3WL1A 3KOZA 1Q13A 3QSRA 1BGGA 3VZZA 4D71A 3UR2A 2EJ1A 3DIPA 3W7EA 3DHPA 1YDNA 1W3HA 1JCJA 1YXCA 2GJLA 2EGZA 4HSOA 3OQ8A 5LYRA 2RDXA 4XWUA 2HWGA 3UCQA 2Y8KA 1Y5XA 2PP0A 4EPBC 1QNQA 1UR9A 4JYFA 1KFEA 2H3DA 4CGTA 4GXPA 4FNPA 4RZBA 4C6KA 2UWFA 4V15A 4HSNA 1J96A 3GR4A 2JK2A 2QAFA 3FA5A 3A4AA 3MP4A 7TAAA 2CLPA 3GIQA 2YGYA 2QEZA 3NYDA 3FW6A 5HUPA 1QI2A 3AIRA 2J8TA 1LRNA 3FSTA 4XQ6A 1C7TA 1E0TA 1TPWA 5G2IA 3ZO9A 1O95A 1BWLA 2E3ZA 3RO6A 1UH3A 2YBTA 2PU1A 3T08A 1ZL1A 4GIRA 3A4JA 3ALGA 3ITYA 1DP0A 4UTHA 3H2NA 1B5TA 1R47A 3QOKA 4XD4A 4AHQA 2WOQA 3WNPA 3WX7A 2G96A 5HNTA 2VYOA 1FWDC 2XFWA 2ZZ7A 2PD9A 3U2CA 4ERIA 2ZX7A 3A64A 3EGJA 2EEXA 3L2IA 1GVQA 4S3JA 2BGSA 5DELA 1W5PA 5I77A 1VKFA 2OWWA 3GDLA 4GIEA 3WQEA 4LAZA 3L0NA 4WKHA 3W2MA 4WDTA 1JUEA 3SY8A 1M9HA 2VEKA 5DY2A 4F40A 2JKAA 3TX9A 4WZHA 1B3OA 2F8QA 3P67A 5TF0A 3BUVA 1OX4A 1N8IA 1C8XA 3S1GA 1THFD 3DHUA 3WUGA 1RBAA 3GNOA 3OLGA 3KRZA 7XIMA 1OFPA 5FAGA 2X7VA 2QLYA 3B9OA 2QF7A 3Q67A 5HQMA 4AFYA 2XIBA 3UJ2A 1VR6A 3BCFA 2PURA 1BVNP 4OGZA 1HO1A 4AWSA 3GXIA 4EIVA 2HCVA 4CN4A 4CD7A 3EAUA 1KD0A 4HD5A 4GMEA 4WGHA 4AXKA 3W7PA 1SMAA