1YADA

Structure of teni from bacillus subtilis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
200
structure length
190
Chain Sequence
MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Regulatory protein tenI
total genus 70
structure length 190
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 5.3.99.10: Thiazole tautomerase.
pdb deposition date 2004-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1yadA00
2P10A 2FPYA 3SGZA 1GEQA 1QPRA 1KTBA 5KSWA 3W86A 1SUXA 3PG8A 3UWWA 3NM3A 3NQ7A 4MFEA 1NAL1 2W6RA 5DCEA 1XI3A 1H1YA 3PM6A 4IWWA 1XCFA 5K7JA 3C4UA 3LCGA 2ZRVA 3W22A 2VXNA 4IXHA 5HQEA 1N7KA 4JS3A 5D05A 5D03A 4DBDA 1AL7A 3NAVA 5C55A 1J4EA 4O4WA 1O60A 3TNOA 3A24A 3W07A 1OG0A 2DZWA 3W7DA 1YDNA 5D2YA 2ZZ6A 3N14A 3AJXA 3NNTA 5AC8A 1TTIA 3HB9A 4ZL1A 3F4WA 1YYAA 3CB8A 3LHUA 5D33A 1Z48A 1TRIA 1DJQA 1T96A 2YR1A 4Z0JA 1G4SA 2FDSA 5LGXA 1PV8A 1MEIA 1MSSA 1P0NA 3MHFA 1VCFA 3M9YA 2R91A 2TRSA 4Z08A 5K4ZA 4MZ8A 1FXQA 3UY8A 4O4VA 1XBXA 1Q6LA 1UCWA 1XM3A 2ZQ0A 2VFDA 4ZQNA 2E6FA 5DLCA 3IV3A 1SO4A 2NWSA 1TSIA 2ZRUA 3DKJA 5AHMA 5CZJA 1OK6A 1TCDA 4A21A 4KFPA 4M7SA 3TJXA 3ABRA 1WBHA 4RJEA 4YXGA 5G2WA 4CNOA 2BTMA 3GYEA 4IJBA 1H7RA 1QO2A 2A4AA 2A7NA 4IMFA 1JRCA 4NVTA 4MY8A 3QZEA 4N9EA 3WJZA 5EMUA 3CHVA 3W7KA 4WJEA 3SR7A 1OFPA 4DPPA 3RU6A 2WSYA 1WXJA 4HPXA 3ATZA 1GWJA 4PTNA 1RQHA 3W75A 1G4TA 3DFOA 2UV8G 1G4EA 1B4EA 4OBTA 1FCBA 3LTYA 3UWUA 1YPFA 1IGSA 4GUGA 3GNNA 1ALDA 4JIQA 3W2UA 4UUIA 3GXNA 1ONRA 3FYPA 4UTWA 4NNCA 3CU2A 3G8RA 4NJIA 4N9BA 5I3FA 3W7MA 5DCBA 1GTEA 3F4NA 2VELA 4GBUA 3NL5A 5LNWA 2V2CA 4C1LA 2YZRA 3HG4A 4FNUA 4PL2A 3UZJA 3W84A 2Z6IA 3MP3A 1YADA 2EPHA 3NEVA 2QCDB 3H55A 1TJRA 1UASA 3DFSA 3PUOA 3B4UA 3PBWA 5G1TA 2E5CA 3P82A 3O06A 4RR4A 1IXNA 1GOXA 1R30A 4EF8A 4U28A 2H8ZA 5HMSA 2PRMA 1PL9A 2RDTA 4LVDA 1VYPX 3KRUA 3NQFA 1EB3A 3LCHA 3S5NA 3R5EA 2X1TA 4GNJA 3HJZA 3VFLA 2H3BA 3EWBX 3MI3A 4HT3A 4TX9A 5BMXA 5LNSA 5C54A 1W8SA 1XDMA 3CLMA 3VI2A 5KTLA 1WQ5A 5CZTA 5F1VA 2ISVA 4U4MA 2I1OA 3H54A 3NXFA 5K3VA 5FI8A 2QUUA 1FWWA 1R2RA 1H63A 1DQXA 4O1AA 2QJGA 4QSHA 2V5LA 3IIZA 1TO3A 3LBCA 3PS7A 1TPEA 2GQAA 4GC4A 3QW4B 3MWAA 2JGQA 4UTWC 2DZUA 1WV2A 3TXVA 3F1QA 1FY6A 5E93A 5DY2A 1SU5A 2GPTA 3LLFA 3SIZA 4AF0A 1OABA 5AYZA 3CM4A 1UUOA 4NX0A 4DF0A 4N9CA 2E77A 2WJZA 2YW3A 3T78A 4AH7A 1W3TA 4JYFA 3Q2DA 3C2FA 3OVQA 4GXMA 5AHLA 3C2VA 1HO1A 1YTDA 2A5HA 3EWXA 2Y85A 1VHNA 3DHDA 4IXXA 4JNMA 2AGKA 2YYUA 2Y63A 1XKYA 3P5ZA 1W1ZA 2ALDA 1QPNA 3B06A 3G1AA 4IOTA 4MJMA 4PODA 1ZALA 3C56A 1ICSA 3FKKA 5G2HA 3TX9A 2BZNA 1OVDA 3CIXA 2YYTA 3GKAA 1VPXA 4LY8A 1A5BA 1SPQA 1VJIA 1OJXA 3G22A 3W87A 2CLFA 3W1TA 4RZ6A 1WA3A 3TUUA 4UTLA 3EXRA 4JIPA 3EXTA 2QUTA 4WY0A 4HSOA 2J88A 3HG5A 3SY5A 1A5CA 1OYAA 3P67A 2AQWA 2J9XA 3HIJA 4L4LA 1H7NA 3W1MA 2QDHA 5DN1A 3HF3A 2GQ9A 4NXSA 4O1DA 3NDOA 1FDYA 1VS1A 1FDZA 5HWMA 2QCMA 1H60A 3SGUA 2TYSA 5E1QA 2CLOA 2OCZA 5HNRA 3QEZA 3S5ZA 3W7JA 4UFJA 1LOLA 3TK7A 1OFRA 2ZCGA 4IPJA 1F05A 2Y61A 4O0KA 1SFLA 4K39A 1XL9A 5I3HA 3U8GA 1W3NA 1SW0A 2QCLA 4O0ZA 5F2GA 3M1ZA 1WAUA 4O1BA 3GR7A 3TV8A 1EA0A 4W9TA 3LCIA 1LBLA 2Y7EA 2H6RA 2FTPA 1B3OA 2G95A 1SSGA 4AHQA 3O8AA 2A85A 2NX3A 2WNQA 4M6VA 1LRNA 4ORMA 3P5YA 3E12A 1I4NA 3QSRA 1ZHAA 3HGSA 3G0UA 3DENA 2VOMA 3KHJA 2FB2A 4Y90A 4MKNA 3MHGA 3L2IA 1AG1O 2ZZ2A 4FNRA 1KM1A 4RXFA 4MYAA 2WQPA 3KRZA 2NX1A 1G69A 1EPXA 1ZCOA 4FNSA 2Y7FA 3LX9A 1BKSA 1I45A 4K7YA 3M41A 2PURA 4KKXA 3P81A 3GXTA 3S5YA 3TW6A 2QR6A 3DI1A 4KWVA 4CCEA 4OV9A 3UPWA 3C6CA 4NJKA 4EIVA 4HNNA 3QF0A 3NZ1A 3M43A 3MYPA 2CLMA 5DELA 4ZQRA 3B03A 1F74A 4OWGA 4WD0A 4IMEA 2PRHA 2GOUA 3KOFA 2PE4A 4XTIA 1LLWA 1ML1A 1W5PA 2FJKA 1SSDA 2RH9A 1EX5A 3E49A 2X2GA 2E5BA 3G1XA 4JTIA 3T55A 3DXIA 3JR2A 3L0GA 4JICA 3ABSA 3QQ1A 4YL2A 2CLHA 3W2NA 4EWND 3PWAA 4IMGA 3O15A 1XUUA 4FX6M 1KTNA 1K8YA 2CW6A 5I3KA 2E6AA 5HUPA 4GE8A 4AMAA 2DZTA 2V30A 4FNPA 5U4NA 2XN1A 1BWLA 1H7PA 1QPOA 4MPQA 2VFEA 3UWZA 1GJPA 4NJGA 4NQ1A 4HPJA 2O7SA 3O05A 2Z0IA 3BW4A 5CZSA 4O1CA 1P1XA 4N6EA 3MP5A 4HIBA 5G5IA 3A21A 2V9DA 2A2IA 3WK0A 2CU0A 3CWOX 3W1RA 1FQ0A 4AWUA 1KM6A 3P61A 5TQLA 1JUEA 1M7OA 1K7FA 3GDKA 4NU7A 4OV4A 3NQEA 2ATMA 2NV1A 1GPWA 3HBLA 3OHIA 3QYQA 3LTSA 4O13A 3SFKA 3W88A 1GG1A 1NFBA 4AXKA 4WXYA 3DU0A 4CNPA 1KTCA 5D38A 1TIMA 2VEMA 3LLDA 2ZRXA 3PY2A 4MOZA 1FXPA 3I6RA 1C29A 4MZ1A 5SWUA 4CQ9A 3PSVA 3LXAA 5CSSA 1OX6A 2C13A 2C1HA 3N9RA 5HR6A 1TPH1 3M0ZA 4LU0A 1LTDA 2OMAA 3W1UA 2VEIA 4DF1A 2J9ZA 1NEYA 3W1XA 1Z44A 5FESA 1RQEA 4LUIA 3W7OA 4FX8A 2H8XA 4S2CA 2ZRYA 1HTIA 1VHCA 2ABAA 3MHUA 1RD5A 2C16A 3BPWA 5AYYA 1FWRA 3L66A 4XUGA 4JN6A 2CZFA 4JY9A 1SO3A 1OFBA 4H6KA 4LC6A 4AF0B 3LHYA 1O4UA 2YDAA 3E96A 1OFQA 4RV8A 2ISSA 4JY8A 2WSRA 3TR2A 3HMJG 1W5MA 3W7LA 4S1FA 2GUUA 1G7VA 1RV8A 3ABQA 5EY5A 3GAYA 2FFCA 5HWNA 2X1SA 3MW7A 1F76A 4O15A 1NVMA 1LOQA 4JEQA 4YWIA 3TC7A 1WOAA 4QQ3A 2E68A 3GDLA 1VCGA 1YXCA 2RHGA 1K3UA 1XXXA 1TYGA 2GVJA 2NUXA 2NLIA 1WBJA 1T99A 5ABTA 4OE7A 1TPB1 1DVJA 2E09A 3DFPA 4OGZA 5I3GA 1OX5A 1UBSA 1DKWA 1NSJA 2XFWA 1TRDA 5I3IA 4WX2A 4ZZ9A 3P74A 3Q37A 2V0TA 1TJPA 3USBA 4BWLC 2A7PA 1DORA 3N19B 1B4KA 3EWYA 1YDOA 3QMSA 3LCLA 1O94A 3BK0A 1VRDA 1H7OA 4JTGA 5D2VA 4UNLA 3CQ0A 5C2XA 5HWJA 3I68A 3KFTA 4UCGA 4DELA 2QCHA 2E1DA 3P62A 1EEPA 1DQWA 1VR6A 3M47A 3BO9A 5LGZA 1JR1A 1S5VA 2I9EA 2VFIA 5KZDA 4M19A 3HOJA 3L5LA 3RK8A 4N6FA 1F7BA 1VYRA 1TQXA 1S3HA 3UYCA 1KBJA 2RDWA 1W0MA 1KBIA 4I7UA 4NNAA 3TCEA 3PBUA 3LTPA 5D04C 5LHEA 3GK0A 1M6JA 1SW7A 5CZ0A 3TE9A 3CEPA 1OFEA 3BG5A 4D2JA 3PF3A 4NNBA 1G6CA 4O10A 1P0KA 1THFD 2WSQA 4QIUA 4QM1A 3TC6A 1RPXA 4UTHA 2V2DA 3PR2A 2EHHA 2QCGA 4CLMA 3I65A 3G0SA 3E0IA 3N34A 2C14A 2ZZ1A 3FOKA 1W37A 4LVFA 4HHPA 2GVLA 4O12A 6TIMA 2C6QA 3GR8A 3HGRA 5MHBA 3NZRA 1ME9A 3QQ0A 4B5NA 5TIMA 2VFHA 1JQVA 4O50A 2JKPA 3LHWA 4M7TA 4TMCA 5J5RA 2YXGA 4IMCA 5EYWA 3TSDA 3IIVA 4JYEA 4XKYB 1JCLA 2BX7A 3PSWA 4DBEA 4E38A 5K9XA 2X1RA 4RLIA 3GDMA 5CPLA 5D2WA 3KVLA 2VKZG 1R46A 4K6AA 4UFKA 4LOCA 3L5AA 4ZQMA 4ZQCA 1O95A 4JTJA 2G5WA 5A5WA 3NO5A 3NQAA 5DBTA 3W7GA 4ZMGA 3HPXA 4UFLA 5F2MA 1JULA 3P80A 4O28A 4RZ4A 3KVMA 1GVSA 3TXZA 4FX7A 5G4WA 4JTFA 3EXSA 2J24A 1SZNA 1UJPA 3NM1A 4JTTA 5AN7A 1AW2A 3LRKA 2ZZ7A 1YTEA 3OBKA 5AFDA 2EAWA 1QCWA 3PUDA 1LBMA 1L2UA 4S2BA 4IX2A 4K8EA 4GRSA 3CPRA 4QJ1A 4O54A 5BMWA 1FWNA 3L65A 3NPUA 3GDTA 1X8FA 3M44A 2AAMA 1SQ7A 1L9WA 5C6MA 5D02A 1GG0A 1DBTA 2PCQA 2WO5A 3PG9A 4K8HA 2QCDA 1O5KA 4Z1DA 2A7RA 3TQVA 3HG2A 1H7WA 2F84A 3BGGA 1PHWA 1FBAA 1G4PA 2JKAA 1V7YA 4RKAA 3GKFA 2OJPA 1R47A 3B0VC 2Y7GA 3B8DA 3FJ6A 3ANYA 4A2SA 3C3NA 3KX6A 4MYXA 1JUKA 3G1VA 4G1KA 1RR2A 1MEHA 1YTKA 2HSAA 3KRSA 2Y70A 3WK2A 3TQ0A 4FNTA 3IVUA 3KVKA 2Q3OA 1OYBA 5K9DA 3Q94A 1LM1A 1I2PA 3TFCA 4Z0SA 2OX1A 5F4SA 2B7PA 3BVJA 3DFNA 2RFGA 1A5AA 4AWSA 1W5QA 3B0PA 4MUZA 1GZGA 1QO5A 3F03K 3W85A 4LVBA 3INPA 4WOZA 3BLEA 1WYIA 5FF0A 2YSWA 3PC0A 3GXPA 4DO5A 1BEUA 2FPTA 3QH2A 3QFEA 4LS2A 4N4QA 3S1UA 4A2RA 4YCPA 3M5YA 2DZPA 2QCFA 1JRBA 1OFAA 1SO5A 2Y62A 1ZAHA 5CPNA 1QNVA 3P8IA 1MZHA 2BSLA 1ICQA 1QOQA 3YPIA 3W7CA 5CSRA 3C0JA 4MY9A 5EKYA 1LYXA 3BG9A 5AB3A 3KXQA 5LZLA 4XZ9A 1PCKA 4J9JA 1JCMP 3LXCA 3CC1A 4WQ6A 3H53A 5LNRA 1LRQA 1B9BA 4UTIA 2WKJA 4WXZA 3T7VA 4O57A 3LV5A 4C1KA 5CKSA 1GVQA 1JJKA 1ADOA 4FEZA 1WOBA 2YX0A 2LLEA 2QJIA 1DHPA 3GDRA 1QOPA 3A5VA 1G7UA 1OYCA 4NUWA 4O11A 1XBVA 1KV5A 1X7FA 4NJJA 5E0KA 3W72A 3TMQA 1KV8A 4AWTA 5AHFA 4HNUA 1OF6A 4Z1BA 3G3MA 1QWGA 3W23A 1C9DA 1LDCA 1ZFJA 4NX5A 1D3GA 3QPYA 1X1ZA 2ATSA 3NQDA 3PB0A 4PH6A 4Z1CA 3LDVA 3S8HA 4XKYA 2CLKA 3G1YA 5HUOA 1KFLA 4BFAA 2V2HA 4JX5A 4O17A 3R13A 4X9SA 3UQNA 3W7EA 1Z41A 2QCNA 4QNWA 1Q6RA 3L9CA 2QF7A 2FLIA 1KFJA 4O8RA 3GIYA 3I7RA 4Z1AA 3EX2A 1X6UA 3RLVA 4RK8A 3VKJA 6ALDA 1AW5A 3UWQA 3P8JA 1F5ZA 3B05A 3W1QA 3LHTA 1H51A 3S6DA 2JKEA 2GJLA 2TSYA 3E02A 3FA5A 1R2TA 3M7WA 2DORA 4IMDA 4I7WA 3MUXA 3TMLA 3O6DA 2NXHA 3A22A 1DJNA 3DAQA 4UFHA 4WOQA 1ZENA 3IIPA 3HGOA 4Y6GA 3P84A 4R53A 3M5XA 1CX9A 3FYOA 4EVZA 3MMTA 4IUOA 4E2DA 5A8GA 3FIGA 2A1YA 1WX0A 2NV2A 2CZ5A 3EEGA 1IXOA 5D09A 4HN4A 4HNVA 3A23A 3W7RA 2O7QA 2ZA3A 2YPIA 3K30A 2DZSA 4H3DA 3B0UX 4LW7A 1W5NA 2HTMA 4R7JA 1K03A 1KM0A 5KZMA 1K7EA 3I7SA 1YDVA 1V5XA 4UC5A 3W9ZA 3ELFA 1PS9A 3UPBA 1T8XA 4DXVA 3ATYA 3W83A 4LWWA 1DOSA 4BWLA 2OT1A 3PUEA 5BOOA 3FLUA 3OIXA 4NJHA 3VE7A 5EL1A 3FFSA 3SW6A 4BI7A 3NQCA 2OT0A 4X2RA 2Q3RA 5AC6A 3DKLA 4OT7A 3IIXA 5D32A 2BXVA 3RF9A 1S5WA 3A5FA 3TAKA 3W7IA 4JGDA 4DEFA 1Q3NA 3C2RA 4RZ5A 5CGQA 3W2LA 1OX4B 2XN2A 4FXSA 3THAA 2QAPA 3GX9A 4UR7A 2WV8A 4JTUA 1IXPA 4K37A 2JK2A 4X22A 3O6CA 1L6WA 3MJYA 3T44A 1YLVA 1SZGA 3DFQA 3DGRA 1TTQA 4HNTA 3BV4A 1AK5A 3N9SA 4UIOA 1NF7A 2FQIA 4DF2A 2V8ZA 4ALDA 1E51A 2QAFA 2NUWA 1T0OA 4N9DA 2YFOA 4PFMA 1QMLA 3LI1A 3UD6A 1ZAIA 2TMDA 2DZVA 1QPQA 4UTTA 4TIMA 1VLWA 5F2LA 1EWEA 1DV7A 4Q33A 2GJNA 2ZDRA 5HINA 4HSNA 1TQJA 1QAPA 2QKFA 2D73A 3STFA 4AHPA 3V1PA 2C18A 2ABBA 3C61A 3IEBA 1Q6OA 4P61A 3NQ2A 5AOUA 5FEWA 3OA3A 2H90A 1LZOA 3W1NA 2EGZA 3S9YA 5CG7A 3GB6A 5BNKA 4O52A 3RFAA 1VC4A 2ZZ3A 4LVAA 4P2VA 1TTJA 5L6UA 2WPBA 1F6KA 2VC6A 3EWUA 4IGHA 5TBOA 4GUIA 2FPVA 4BR1A 4PEKA 1YPIA 4KWWA 1DL3A 3L68A 3MYOA 4XBSA 3UXDA 3A9IA 4ZQOA 3ZFHA 2ZTJA 3DI0A 4N4PA 5LHFA 4QNEA 2ZYFA 3LB0A 4PCFA 3NYZA 1WDWA 1MO0A 3LCWA 4CCDA 4GUFA 5FEZA 5G2IA 3NQVA 2GQ8A 3W6YA 1HFBA 5AHEA 3STGA 4FF7A 3NR0A 1AL8A 1O5XA 2CZDA 2ZA2A 1UUMA 1QDSA 5AHIA 3W2KA 1P4CA 2IQTA 5DBUA 4RCXA 1SFJA 2QCEA 1SO6A 3TAOA 2ZTKA 1SZFA 3UNDA 1I2QA 2JGYA 4QAIA 4ADSA 3DH7A 3IGUA 2G96A 1OFDA 3W1LA 2B4GA 2H3DA 2Z6JA 4NXKA 4K7VA 4BI5A 5CPMA 2ZZ5A 4Q4KA 3KVJA 1GVFA 1S5TA 3IRDA 2PC4A 5FEXA 1AMKA 3PAJA 4AAJA 3I7QA 2DJLA 2F7FA 3PBYA 1IF2A 4GUHA 1VZWA 3HPZA 1KA9F 4JDBA 4Y8FA 2YCEA 1GT8A 3OG3A 4A22A 4LVGA 1BTMA 3QM3A 2CLLA 3LXBA 1FCVA 4MIMA 4FB7A 4GFSA 1F73A 3TH6A 2DJXA 1H5YA 3G3DA 3HG3A 5F1UA 4UMBA 2DP3A 3UWYA 4LV4A 1W54A 4LRTA 4AHOA 4QISA 3DHFA 2HMCA 3NGJA 4KFOA 1JCJA 4GUJA 4GWEA 5KITA 1EP2A 2VFFA 4O18A 2X16A 3HQ1A 4JYDA 4KFNA 4YLWA 3QW3A 3QC3A 1UB3A 2V81A 3NOEA 5H2ZA 1A5SA 4LT9A 2Y6ZA 4POCA 2B7OA 1H1ZA 2TPSA 2HS6A 5D37A 3TSMA 1KFBA 1ME8A 3LV6A 2V82A 4BK9A 2NXGA 3LM7A 2EF9A 1U83A 1W31A 3HGJA 3W1AA 4M6PA 1XBYA 1C8VA 1LOSA 3QMRA 2XN0A 4Q32A 4K36A 3U6WA 4NT0A 4HKPA 1XBZA 1VLIA 2WNNA 3TJLA 2V5BA 2G97A 2ZRZA 3VE9A 2X1UA 2FB3A 3STEA 5H91A 4DO4A 5CPOA 2YW4A 3NQ6A 4CQAA 5KINA 1H7XA 3GAKA 5KMYA 3CWNA 1GYNA 2NWRA 3G1SA 3QRHA 3TQKA 2ZZ4A 4MJZA 1TV8A 3TFXA 3FEMA 1EWDA 3CTLA 3R8RA 4WUIA 7TIMA 5DXXA 3TW7A 2KZHA 1I2NA 2NXIA 1LLZA 5K9CA 3IVSA 3VNDA 1EP3A 1VGAA 2A6NA 4JX4A 3M6YA 4UTUA 1PCWA 3NQGA 1TV5A 1EUAA 2BWGA 3W73A 4PC8A 3SI9A 3LGEA 3RLUA 3PVFA 4ZVJA 3ZS4A 1KLZA 4YMZA 3STCA 1KM2A 2FIQA 3TU9A 3GNDA 3N73A 1IIGA 4FO4A 2CFFA 1KFCA 4UTMA 1MEWA 4LTSA 2VENA 3LCFA 2E6YA 1CI1A 1TTPA 1AW1A 4XTDA 5D30A 2A21A 3S42A 2C3ZA 2WNZA 3SZ8A 1F6PA 4BI6A 4K38A 3FJLA 3M5VA 4ORIA 3W76A 4R34A 4FNQA 1QFEA 1U5JA 3EB2A 2W79A 1JUBA 3O6YX 2YFNA 4UFIA 1I2RA 3W7PA 2CLEA 1ICPA 3W70A 1GTHA 2CWNA 3WK3A 2VEKA 4PA8A 3PB2A 3NL3A 4IX0A 4UMCA 3S1XA 1KM3A 3DZ1A 1K7XA 3P60A 3NL2A 4O16A 5HR7A 3WK1A 2HS8A 3WJWA 3M5ZA 4LV9A 3UXAA 1EIXA 5DY3A 4JTLA 2PRLA 2ZFAA 4Y9AA 1J2WA 2ZA1A 1ZJIA 1FUYA 3N2MA 2A0NA 2J9YA 3QPZA 4JXCA 4RXGA 4X3ZA 3G1FA 3NL6A 4LUJA 5G4EA 3EWWA 5D2XA 4JD4A 2Q8ZA 3CT7A 1I8JA 1IIHA 5AHNA 1KM5A 4LNYA 4NZFA 5D2TA 4ICNA 1OF8A 1XUZA 3HO8A 1Q6QA 4MY1A 4DPQA 3MBDA 4ML9A 8TIMA 3IIOA 1TPVA 2VFGA 3SJ3A 1NF0A 3P7YA 1G67A 3L0NA 1W3IA 1GVOA 3W7QA 3D0CA 3BGJA 3NA8A 5C5YA 1H62A 1HUVA 4L4MA 4DO6A 4R33A 2B7NA 1FCUA 4CNNA 4M5PA 1CW2A 5L9FA 1A50A 4O53A 3S5OA 1HG3A 1MXSA 3W2MA 3NG3A 1LRTA 2VEPA 4NZJA 3EX1A 4XQ6A 4GJ1A 2Z2UA 4YCOA 1KLYA 4UNKA 3G8EA 3MI6A 4N2YA 1FWTA 1H61A 4AB4A 2A6LA 1VQTA 3TSBA 2QJHA 4UFMA 4CCCA 2J27A 4A29A 1GQNA 3MP4A 1YXDA 4IPIA 4M6QA 1VCVA 3BLIA 2YGYA 3N3MA 3G1DA 5HULA 5K4XA 3UY7A 3WJSA 3MBFA 3THQA 1JCNA 4WZHA 1M7PA 1LORA 4ADTA 2E6DA 4O14A 1QR7A 3L21A 3LCXA 3Q58A 1JCXA 1ZNNA 3MO7A 3C2EA 2E5DA 4UMAA 1LP6A 3GLCA 3OEXA 1HO4A 2R8WA 1IXQA 3LERA 1JVNA 1RQBA 3TIMA 1L6SA 2OZ0A 4H4IA 5HJLA 3U2OA 1KFEA 3NPWA 1OK4A 3DFTA 5FEPA 2ISWA 2C0AA 1Y0EA 2ZRWA 1TPDA 4RX0A 4UTTC 3SSJA 3V75A 4O19A 3G0XA 4UXDA 4OQVA 1P5BA 3ZWSA 4DQWA 3W1PA 4A3UA 2EKCA 3TROA 2B0MA 1F2JA 2JBMA 2WOQA 4MFDA 4AEOA 3W3OA 1TB3A 4LC8A 4AVFA 4JTKA 1KFKA 3O1NA 2Y7DA 5GVJA 3UZ5A 3S0CA 5IBXC 3R2GA 3RMJA 3S1WA 3IGSA 3R12A 1TPWA 4OHQA 1B57A 4FIRA 1H50A 2RKXA 4TO8A 1TPFA 3VCRA 3FS2A 2P0OA 1OHLA 1K8ZA 2Y88A 5BW6A 4LRSA 3B04A 2Y89A 3LHZA 4UTJA 1L6YA 3W74A 2CZEA 3TA6A 2R14A 2QDGA 3WJYA 3AO0A 5FF2A 2I14A 3SECA 4EOUA 3OVRA 5U7SA 1PIIA 1XC4A 1JQXA 3FKRA 3E9AA 1SZEA 3JS3A 1LROA 3L5MA 1KW1A 1FDJA 3C52A 1FX6A 4JR5A 4IQLA 4Y96A 1XFBA 3QMTA 5LSMA 3DBPA 1W56A 1D9EA 2J6XA 4MLRA 4MZYA 4MVAA 2X30A 4TR9A 4FHAA 3S1VA 1OX4A 1X1OA 1PVNA 3BW2A 4JTEA 1VYSX 3GZ3A 5LNVA 3IVTA 3QJAA 3C2OA 1TPUA 3R89A 3W7NA 2BLEA 5FF4A 3W71A 5J5DA 3O07A 4FIQA 1EUNA 1SR9A 1YXYA 4I7VA 5F2IA 1ZY9A 3EX6A 1PHQA 4LS0A 1N8FA 2RDUA 3C8FA 1TMHA 2C15A 3G1HA 2DU2A 1FCQA 3NQMA 5T26A 3ZR4A 3GVGA 5EA9A 3EX3A 3NQ8A 5G1YA 5FF7A 4UR8A 1PE1A 4XBKA 1VH7A 4JTHA 1M5WA 1RVGA 3G18A 3PBVA 5LNUA 5EBUA 3OVPA 3T4CA 3UWVA 5K2ZA 4E0CA 4XWUA 2W0UA 4PL1A 5DCDA 3M16A 2ZBTA 1FWSA 3O16A 3WFAA 2NX9A 3JRKA 4WY0F 2GVGA 1EP1A 1LBFA 1K8XA 2Z1BA 1BWKA 3W7HA 1TV7A 4JTSA 3N2XA 1A53A 3O63A 1OFOA 2NZLA 3ABOA 4MLJA 4ZQPA 1TPC1 4UTKA 3EWZA 3HPSA 2CLIA 4E2BA 3EX4A 3LI0A 4LS1A 4BF9A 5F4WA 3BARA 1Q45A 1TREA 5IBXA 5AC7A 1SW3A 1J5TA 4TMBA 1N55A 3NPVA 2P1FA 3EKZA 3L0KA 3ZWTA 2Q8LA 2QUVA 2B7QA 5LKYA 3LRLA 2DZXA 4WY0B 3BLFA 4JX6A 1ME7A 1ZAJA 3TDFA 5DXYA 1KM4A 5I3JA 3BG3A 2QEZA 2C19A 1D3HA 2R94A 3BW3A 3W2JA 1Z42A 1K02A 3T40A 4ADUA 4JDYA 4ONVA 5F4XA 1W5OA 3CIWA 4EF9A 3L67A 3G24A 3NPXA 3LOTA 2NUYA 4I9AA 3IGXA 1HL2A 2QCCA 4FXRA 4N02A 3PULA 3MI2A 3KAOA 3NVTA 1GVRA 1LCOA 1XDLA 5BRBA 5AYXA 5KZEA 4OU1A 3LRMA 1RZMA 3TKFA 3LHVA 3RNDA 4TU1A 1GYLA 5FF3A 3WJXA 5IM51 3QSTA 3CEUA 4QITA 3LBMA 5EPDA 1I2OA 3EKLA 4CQ8A 1R2SA 1JCYA
chains in the Genus database with same CATH superfamily
4OUEA 3NIYA 4OJYA 3I4KA 3VKDA 3W86A 1TUXA 3NM3A 3BOFA 2WKLA 2YBVA 2JF6A 5K7JA 3SY8A 2GGJA 2GGHA 1XRSA 4N7QA 5EMKA 1N7KA 1ELSA 4WVXA 1MFUA 5C55A 3I4EA 2WK2A 3M0JA 1BVWA 3W07A 3FY1A 3TN6A 2DZWA 2P5NA 2XFFA 3N14A 5AC8A 4K68A 4ZL1A 3CB8A 3ZVIA 1Z48A 1HL8A 1T96A 2PLJA 3MS8A 4Z0JA 4Q8PA 3WNOA 1QHPA 2ZX5A 1PV8A 4Q7NA 4JHOA 1JCTA 1VCFA 3M9YA 2XPKA 5CBBA 3E2SA 1V03A 3UY8A 4O4VA 1V0KA 1UCWA 5KETA 2OB3A 5G1MA 4QXIA 2J7CA 2E6FA 3IV3A 4QX4A 1SO4A 2ZRUA 2ZX6A 3DKJA 5DRIA 5E6ZA 5DT7A 3WUEA 1KC7A 1POKA 1UPMB 3NSXA 1GVIA 1CB2A 1V02A 4MB4A 5G2WA 2NV9A 3CPUA 1H7RA 1QO2A 2A4AA 4BQ5A 3ALFA 1JRCA 2FTYA 3IJIA 3URNA 4M3PA 1XSIA 1U1UA 4MGGA 4ZB0A 1UP3A 3SR7A 1EOMA 2OTDA 5AYBA 3ATZA 3W75A 1G4TA 3EMZA 2UV8G 1B4EA 3W24A 4OBTA 1UD5A 1WB0A 1DXFA 3CPGA 4GUGA 3V16A 1ALDA 2WMHA 1ENUA 3PHAA 3EMCA 2BVDA 2QNEA 3E0FA 1UWRA 4NNCA 5I3FA 3E0WA 2PAJA 1V0NA 3F4NA 3GU9A 2HROA 4E8GA 4NP7A 2DDXA 3CGTA 3IAQA 4Y9MA 3QY7A 1YADA 2VZOA 2QQ6A 1ITXA 1UASA 3VOJA 3PUOA 5G1TA 2E5CA 2RGLA 1GOXA 1R30A 1XC6A 3EYPA 1A5NC 4U28A 5CSUA 4LCQA 2H8ZA 1SJCA 1GOKA 2F9RA 3MUZ1 3R5EA 2X1TA 4AD0A 2WSPA 2G4FA 4YYFA 3MI3A 3EWBX 4XO7A 2F6KA 5BMXA 4LPCA 4Q6JA 4MWAD 1XDMA 1ZS2A 1VIZA 3P14A 3KM8A 2ISVA 5CEWA 3GXFA 5FI8A 1E15A 4I3GA 5ABEA 2QJGA 4TVUA 3CQHA 3PS7A 4GI9A 1QHZA 2XSXA 5I03A 3QW4B 2VYOA 4J3TA 1NU5A 3WDQA 1DJGA 2Z1XA 1PB0A 1QBBA 3WQ6A 2DZUA 3F1QA 1FY6A 2I9UA 2Y0FA 5E93A 1SU5A 2GPTA 4KW2A 4M80A 1UUOA 1G1YA 4W5ZA 4N9CA 3T78A 1H0IA 4QAWA 3GVQA 3OVQA 5AHLA 2GLKA 4KRZA 2HXUA 4R85A 3NZQA 4PMNA 1I60A 2DH3A 3DHDA 4RPPA 4IXXA 4ZB2A 2YYUA 3IWPA 3P5ZA 3AIVA 1W1ZA 2ALDA 4CUCA 3EDDA 1VFUA 2E9BA 3RN6A 1ZALA 1HJVA 3LU2A 5IDZA 4E3TA 4EWJA 4PTDA 1B2YA 3PZ9A 1WUFA 1WA3A 3EXRA 2PWVA 4WY0A 4HSOA 4GACA 2WC3A 5IXEA 3HFYA 3HIJA 2AKZA 1W9VA 2GL5A 3KL0A 4NIRA 3W01A 1E55A 2OSYA 2OEKA 3AWOA 1G01A 1VS1A 3A9BA 5LIUX 2QCMA 3PWIA 4PBGA 3SGUA 1ONWA 3AZSA 5HANA 3TYCA 1XLKA 4K8GA 4JN8A 1J96A 3S5ZA 3W7JA 3IRSA 4UFJA 2BNJA 2R1NA 4M81A 2QUNA 4IMAA 1SFLA 4C6IA 1WAUA 4ACZA 2Z25A 3SCUA 4YYCA 3WBYA 1B0IA 2Y7EA 3GTFA 5I7GA 2H6RA 1EF2A 2FTPA 1B3OA 4AHQA 2BY3A 1M01A 2NX3A 3AMKA 4GBDA 1ZHAA 2YCLB 3KOXA 2PFHA 4MKNA 4V27A 3L2IA 5I2UA 2I5IA 6A3HA 3UPMA 3CH0A 4FNRA 1NH6A 2E8ZA 3I10A 4MYAA 4PFHA 4Z17A 3KRZA 4C91A 2NX1A 2YDQA 1I45A 4DBWA 2PURA 2PDYA 4DUXA 3PBMA 3DI1A 4KWVA 4CCEA 1ZU8A 4WLCA 5AECA 1E0XA 4UQAA 4S3GA 2CLMA 3RX4A 3N1AA 2DIJA 4E4FA 3N04A 2GOUA 2PE4A 4TXEA 2X8RA 5EBAA 3LPOA 4A8RA 2BV9A 2GJXB 3USZA 1OCNA 2CLHA 4EWND 3O15A 4ZTXA 2CW6A 5I3KA 2I5GA 3ZYZA 4H9ZA 2WMIA 1BWLA 1H7PA 3WNKA 1QPOA 3LD5A 2IKJA 1XQKA 1YEYA 3G6LA 3GHUA 1W3HA 5I78A 3GTXA 3O05A 1IR2A 3BW4A 4O1CA 1P1XA 2BDQA 3S46A 1ECEA 4JKLA 2FMOA 5G5IA 2IKIA 2Z1KA 3CWOX 4AWUA 2D0FA 2GFTA 1G0CA 1E6QM 2XWDA 1IEQA 1UQZA 3QC0A 2PPGA 4OV4A 2HZGA 4OKDA 5C71A 1FWCC 2ATMA 2G3FA 3OHIA 1DJWA 1GG1A 1NFBA 2J4GA 3WH7A 4WXYA 3DU0A 1KTCA 1YE4A 2FJUB 2JIWA 1TIMA 3HFTA 3LLDA 1FXPA 3I6RA 3WIJA 3KP0A 1DIDA 2ZE3A 5DF0A 4JNYA 5HR6A 4UZSA 4LU0A 3RR1A 3GFXA 3LQGA 3W1UA 3LMZA 4MF4A 5FESA 5BRQA 1RQEA 4LUIA 3W7OA 4BY3A 6CGTA 2H8XA 2ZRYA 2HVNA 1WZKA 1RD5A 4V28A 2HEJA 3CYVA 1FWFC 4KRUA 1HJXA 4XUGA 3GTNA 4HOWA 1N8WA 3R43A 4AF0B 1O4UA 2YDAA 2OLAA 4RV8A 3PPCA 3TR2A 3HMJG 3BMWA 1HF6A 3W7LA 3UR2A 4S1FA 2GUUA 2VRJA 3NTYA 1Q6DA 3GAYA 1ZTVA 5HWNA 2HWGA 3PPFA 3TC7A 3UW6A 2DT3A 3HURA 1FA2A 1J93A 2GVJA 1SR0A 4JQ1A 1WBJA 1T99A 5ABTA 2OWXA 4XSLA 3DFPA 1TVPA 5CG0A 4W88A 4JOMA 4Q4OA 2G3JA 5DQPA 3OW1A 1BXCA 2XFWA 2XZ9A 4WX2A 4ZZ9A 4HYVA 3S9IA 2A7PA 3N19B 4AQLA 3QMSA 1U33A 3RCNA 2O4MA 1O94A 3LCLA 3B8TA 1VRDA 1VP5A 4YNGA 5D2VA 4F66A 5HWJA 4HMDA 3KFTA 4LX4A 2WMGA 1Q2RA 3VVGA 2D2OA 3P62A 1MNSA 1DQWA 3AIBA 5LGZA 1JR1A 1S5VA 3F5JA 2I9EA 3BXWA 4M19A 1Y8BA 3ES7A 2INFA 3EOUA 3RK8A 4C7GA 3WQFA 2V5CA 1PJ9A 1N82A 1XYLA 3LY0A 4NNAA 3TCEA 3LTPA 3KS6A 3MMWA 5CXPA 5EFDA 5LHEA 3GK0A 1TFVA 5CZ0A 3M46A 1B5TA 4D2JA 1X6LA 4O10A 3UVIA 1GVEA 4QM1A 5EB8A 4JIHA 4UTHA 4KEVA 3KTXA 9XIMA 1RCOB 2VR2A 3AYVA 3EMQA 1I0DA 2XVNA 1QI4A 4DXKA 3I65A 3AU6A 3N2OA 3E0IA 3N34A 4GK8A 2VR4A 4PRRA 4W8BA 4HA4A 4AISA 3WDIA 6TIMA 1Q66A 3HGRA 1LWJA 2D24A 3QQ0A 4H7ZA 5FIPA 5TIMA 2VFHA 1GKQA 2QDDA 1JQVA 1E40A 3VC6A 4BCEA 4JTCA 5J5RA 5A2CA 2WSKA 3IIVA 1JCLA 1VEPA 1F4AA 2PWDA 1XJBA 4GI8A 2X1RA 5K9XA 3EWDA 4CU6A 3QLLA 1O95A 4JTJA 1TE1A 4L5ZA 1RBOB 5DBTA 5B7ZA 1JZ7A 5AY7A 3AFBA 1SGJA 2DUZA 5CPTA 4QE1A 4CNUA 4WRHA 3CNYA 4AD5A 4RZ4A 4TOQA 3VNIA 1GVSA 3TXZA 4JTFA 5A8OA 4JTTA 3WBWA 4XB3A 1PKLA 3V0UA 2ZZ7A 5HNTA 1YTEA 2R1PA 5FSDC 3RIKA 1NDWA 3ONBA 4HGXA 1LBMA 2QYGA 4WDWA 4WGHA 4S2BA 3VGFA 3IJ6A 2WM1A 4AZ6A 2XVLA 2ZUVA 3M44A 1TR9A 1SQ7A 3EWCA 2E3ZA 1DBTA 4DXXA 2PCQA 4ZE4A 3T0BA 1PHWA 2JKAA 4JQAA 1E72M 5EU9A 3GIQA 3OGSA 2Y7GA 2O4QA 1C8QA 1QBAA 1TVLA 2G8ZA 1EHNA 1BAGA 4RNJA 2DQXA 4NZ3A 3FCPA 1IE7C 4EPEC 3MC5A 4DJDD 1F4HA 4JFWA 1NM9A 4RW3A 1YTKA 1UIPA 3KRSA 3WK2A 2J7BA 3TQ0A 4HTYA 4RDWA 4NF7A 2J25A 1LF1A 1L0PA 2OX1A 4CNSA 3VTRA 5F4SA 4QE5A 3DFNA 1A5AA 3FA4A 4MUZA 4Z2GA 1QO5A 4ZOEA 4KCUA 4NRSA 3WELA 3C0QA 5FJTA 4ZTYA 4PCSA 1O1ZA 3PC0A 4HNOA 1BEUA 5HAOA 2FPTA 3IJ7A 3QH2A 3VIFA 1XKJA 2PDCA 3MJMA 4V2XA 3KE0A 4A2RA 1ISXA 2Z2AA 1ZAHA 1QNVA 3W7CA 1CDGA 3UGVA 4MY9A 5AB3A 2A3EA 1NQKA 3CV7A 1KCZA 4WQ6A 3CC1A 1A5KC 1LRQA 4UTIA 2WKJA 1A80A 1DWAM 4Q8UA 4XIMA 5I07A 1DJXA 4XZHA 2ZC8A 3DHUA 1JJKA 3N4EA 1S1PA 4FEZA 1WOBA 2LLEA 3W02A 3U9IA 3GDRA 1QOPA 1CGVA 2BVYA 1OYCA 1R7OA 4D6JA 2R1LA 1EDQA 3IK4A 4WKHA 1EFZA 1KV8A 5AHFA 3TR9A 1QWGA 3W23A 2IPWA 3QZAA 3QPYA 5BXPA 4NY2A 5EGRA 3SGGA 3SY1A 4GY7A 1KFLA 1E5NA 4FMVA 3S47A 1O5QA 4QNWA 1Q6RA 3L9CA 1XYBA 2QF7A 3ZXWA 1ZJBA 3GIYA 4O8RA 1ZPTA 4HMEA 4ZO7A 1ZUAX 1UG6A 2WHLA 3RLVA 2P0IA 2VWTA 3BICA 1AW5A 4ERGA 4FS9A 3P8JA 1F5ZA 4IL2A 4WJXA 3B05A 4RL3A 3S6DA 3GC5A 2AMGA 3WLPA 3E02A 1D8WA 3M7WA 4CD5A 2YCJA 1YE6A 1XD0A 2PODA 5HDRA 3WQ4A 4Y6GA 3M5XA 4GZIA 4LBUA 3CV1A 3M07A 5A8GA 3VOCA 3KL3A 4YU1A 2G0WA 1W3JA 1GJWA 1REQA 4HNVA 1BVNP 2YPIA 3K30A 4LY4A 1V8EA 4H3DA 3B0UX 3DDMA 4PMVA 3AIRA 4B15A 1K7EA 1WZAA 1W3KA 7PTDA 2FZ9A 3AYTA 2JEPA 1PS9A 1HKMA 1T8XA 2WVUA 3ATYA 4LWWA 1ODZA 1X97A 3FLUA 3GVRA 3VE7A 5EL1A 1A47A 3FFSA 5CC3A 3SCPA 5AC6A 3E0VA 3WF3A 4HA0A 3A5FA 2VD8A 4NZ4A 4H04A 1Q3NA 1KD0A 5CGQA 4PTMA 4UQCA 2XN2A 4MSSA 3THAA 2F61A 2QAPA 4NAFA 1E9IA 4UR7A 4JTUA 4PMYA 5I09A 2JK2A 4X22A 3KBNA 3T44A 1XH2A 3BV4A 4UIOA 3BURA 3GVVA 1DXIA 4DF2A 4ALDA 1E51A 3KW3A 4XG1A 1V93A 4PFMA 4QDPA 4GO9A 4DM1A 3BAIA 4TIMA 4EXBA 3OZMA 1VLWA 3GG8A 1JF5A 5REQB 3KTSA 3FV9A 2ZDRA 4ZR8A 1ZB5A 4FLOA 4GVHA 4H9MA 1TQJA 2QKFA 1GQJA 1Q4NX 3V1PA 2C18A 3VNYA 3LBOA 2Z27A 3T9PA 4GKLA 5D9MA 2GSJA 1EJWC 2XISA 2VMFA 3S9YA 3BLOA 3RFAA 1UD3A 1VC4A 2VVSA 4LVAA 1C9WA 1XGEA 2WPBA 2R1MA 2UBPC 1F6KA 1BWVA 4EKJA 1C90A 3EWUA 5AC4A 1CXIA 4MTVA 1OCBA 4WDXA 5TBOA 4BR1A 1ZRQA 1MUMA 4KWWA 4IFKB 1YDYA 3F2CA 3EOLA 4XBSA 2UY3A 4L6DA 3UXDA 3A9IA 4ZQOA 3ZFHA 2ZTJA 4QNEA 3GTIA 5EFFA 2QVNA 3NYZA 1HKWA 4J3ZA 3VGGA 1HFBA 3T4WA 3CZGA 1EC7A 3STGA 4ERIA 2HK0A 3NR0A 1RA0A 2BGNE 4G9PA 3VX1A 3H8AA 5AHIA 3W2KA 4RCXA 1V3HA 4WKFA 3SJNA 4IG2A 1SFJA 2QCEA 1ONXA 4M1BA 4L7ZA 3TAOA 2ZTKA 3VMOA 5PTDA 3MT1A 4WSJA 3P0WA 4JHZA 4ADSA 3D46A 2G96A 3IGUA 1OFDA 2H3DA 5RUBA 5JIWA 4C6OA 1RY0A 4H1ZA 4UQ9A 3OP2A 5M17A 3RM8A 2V5DA 3UG5A 2WZIA 2W92A 4IUGA 4B5UA 5HPOA 2I5QA 3PAJA 3WQWA 2F7FA 3ECQA 3RO6A 2XH7A 1P7TA 1GT8A 4LVGA 4JKKA 2HBXA 5D8ZA 1PKMA 3TZFA 4GFSA 2CLPA 3R25A 2EPKX 3E5PA 3UNTA 3UP8A 3VM7A 3G3DA 3HG3A 5F1UA 4UMBA 1VBHA 1UD6A 4LRTA 4AHOA 2HMCA 1Z32X 4GUJA 1RLDA 1EGMA 1EP2A 2VFFA 4GISA 1HKVA 1XLFA 4W7WA 4D72A 3CZJA 3NOEA 1ZP3A 3BOLA 1XLIA 4B2DA 1WPCA 3LV6A 2V82A 2GDUA 4X2PA 2NVDA 3QMRA 1LOSA 1VBRA 4K36A 3Q4DA 4HKPA 1VLIA 2G97A 4W7VA 2DSUA 2A3BA 5CPOA 5MF5A 3VX0A 3CMJA 3NQ6A 5KINA 2XU2A 3GAKA 4REQA 3CWNA 2V6AA 2WVVB 2NWRA 1PIFA 1UC5A 3FSTA 4PUKA 4FALA 4W85A 3ZQ9A 1AQMA 4MJZA 1TV8A 5I06A 2DT2A 3PZGA 3CTLA 1T6MA 3VUPA 1MUCA 2NXIA 1V3MA 4Y8EA 1X98A 4G56A 3B3DA 3DEQA 2BWGA 3W73A 3LGEA 4QQUA 3RLUA 4ZVJA 4MNKA 3GHRA 3BWWA 3I3BA 3TU9A 3GNDA 4FO4A 1IIGA 2CFFA 1MEWA 3KLKA 1CI1A 3S2JA 1FWDC 3S42A 1U5VA 1R8LA 3CT2A 1UWSA 3VXGA 2GK1B 4PTXA 3MO4A 1V02E 2Y4SA 4K38A 1UKPA 4B3LA 1WDSA 3W76A 1R6WA 1QFEA 4DJFC 3B9OA 3WD3A 2W79A 3EDEA 2YFNA 4GNVA 2W27A 3W7PA 1VFLA 1GTHA 5C9XA 3CZEA 4PA8A 4UMCA 1VPQA 1YKWA 3DZ1A 5TAOA 3OLGA 5HR7A 1TWWA 1OD8A 1QT1A 4PR4A 3UXAA 5DY3A 4ENLA 4MUPA 2ZA1A 2P53A 3FHQA 4AY1A 4F2UA 3W4RA 1XF0A 3NVDA 1NOFA 1RCQA 4QJ5B 1EJSC 1P6WA 4QROA 1NJJA 2BB0A 3NL6A 4FR1A 3EWWA 2WKGA 4RNIA 4ACZB 2BBFA 2HNHA 5IRPA 1IIHA 2WVVA 2VX5A 2HPMA 4MY1A 1V0LA 3IIOA 4BQ3A 3SAZA 1GONA 3RX2A 3BGJA 1E0VA 4L4MA 4DO6A 1P48A 2ZKMX 4CNNA 2HPIA 4M5PA 3QKZA 5GNXA 4KRTA 3GBEA 1YNPA 1MXSA 3SCQA 4AUBA 1WDPA 4XQ6A 2Z2UA 3BMXA 7REQB 1EXPA 3E6EA 4HCHA 4UNKA 3G8EA 3CZKA 1FWTA 2F8QA 1MW3A 2A6LA 1VAHA 3MP4A 1WDRA 4A6GA 4L6HA 3N3MA 1UROA 3G1DA 3UY7A 4KWSA 3TTYA 1CCWB 4LH8A 1PWMA 3KZPA 4XZWA 1XH1A 1Q7QA 2ICSA 4ADTA 4PUNA 2E6DA 4O14A 2R1KA 2G3IA 3OEXA 1ODUA 3U48A 1HO4A 3WH6A 2VT0A 1IZKA 3IJ8A 2YDSA 3U2OA 4YN5A 6TAAA 4CVUA 5FEPA 2ISWA 1QNSA 4FXJA 3ARUA 3PTMA 4UWMA 2X0HA 3V75A 2ZX8A 1MW0A 3G0XA 4GFIA 4IFRA 1A0CA 4TVCA 4OQVA 4AD3A 3H2CA 4DQWA 2OKOA 2EKCA 3T0AA 1HKJA 2WOQA 3S2CA 2CBIA 3UA4A 3H26A 3EA1A 3S1WA 5CQ1A 3PPGA 1JXJA 2P0OA 5I02A 4GQGA 3XISA 5AVNA 4LRSA 1K1DA 1FOBA 2DW6A 1WDQA 2ISFA 1L6YA 4GXPA 3BV7A 2I14A 4P7LA 3SECA 3R0KA 1QI2A 2POTA 5U7SA 3FKRA 4DIAA 3WLLA 3ITVA 3CUJA 1V77A 5FJJA 4X0VA 4KCVA 3H2NA 1D9EA 4DZIA 3T07A 2PDNA 3AS1A 4MVAA 1B54A 4TR9A 3PUGA 4C65A 3H24A 2CEQA 1OX4A 1X1OA 3BW2A 4RE0A 3GZ3A 3LSCA 3HMCA 3IVTA 3C2OA 3V35A 1CBGA 3ARPA 2DY3A 4FR6A 4G7EB 4D1JA 1IEVA 1M04A 4MWAA 1N8FA 3VNLA 2RDUA 3T42A 4NG3A 3NQMA 4YWSA 3CQIA 4XD6A 1KXQA 4GH1A 2VM8A 4U2ZA 4UR8A 3BAKA 1U1HA 4XSMA 4JTHA 4R3UA 1RVGA 5EBUA 3OVPA 3T4CA 4MNMA 2Q71A 3FAXA 5ABFA 3M16A 1FWSA 2JALA 3JRKA 3FXGA 4WY0F 1IT8A 3URAA 1EP1A 2VNCA 3LUTA 3WLIA 1BWKA 1TV7A 3N2XA 4H8NA 4Y9NA 1HT6A 1PZ1A 5M1TA 4C7FA 4XD5A 4ZQPA 1RUSA 5HMFA 1TPC1 5LYRA 4UTKA 3KDNA 4FPSA 2CLIA 3LI0A 1H49A 1V79A 3VUSA 4E5TA 3A4XA 1TREA 5IBXA 3APTA 1ITQA 3T1GA 5FSEC 1SJBA 2CKRA 3FVMA 4L80A 3ZWTA 2B7QA 1TX2A 4GD0A 3ICJA 2EJAA 4J5NA 3GC2A 1N8IA 2DZXA 1RSCA 4WY0B 4RV3A 3TTOA 2D2GA 4Q8WA 4MPKA 4D6CA 3TDFA 3DG6A 5DXYA 1KM4A 3VD4A 4QG6A 3VGDA 1TZ7A 2ACSA 5HQLA 5A95A 5J04A 1CENA 4JDYA 4ONVA 3G24A 3MUCA 3D3AA 3LOTA 3N2CA 5GJPA 1J6OA 4FXRA 4NI3A 3KAOA 3MI2A 3GU2A 1Q8AA 2VOTA 3GBDA 3NVTA 5BRBA 2FH8A 5KZEA 4OU1A 3LRMA 1RZMA 1TJ1A 3LHVA 3FNDA 3RRXA 3WJXA 3OOQA 5GJMA 3CEUA 4QITA 3GFYA 3UZYA 4CQ8A 2DUXA 3JVAA 2ZX7A 1F07A 1W1YA 1GEQA 1JPHA 1B9ZA 1XDJA 2QJMA 1QNOA 3T0CA 3PG8A 4PMZA 2YCLA 4MFEA 5DCEA 3BANA 1CGXA 1H1YA 2OO0A 3E0LA 2ZRVA 3PZNA 1F8MA 2VXNA 1XIMA 4IXHA 1HNYA 5DEZA 1AL7A 1A5UA 1IEXA 1KGWA 3BLPX 3NAVA 1J4EA 4LAKA 1O60A 3M4HA 2HV5A 1YQ2A 4PN2A 2FVLA 4H9VA 1C3FA 1LJYA 3AJXA 3UCCA 3HB9A 5A6TC 3TZNA 3LHUA 4JTAA 1F6YA 5D33A 1DJQA 1EDTA 2YR1A 2FDSA 3BSMA 1ISWA 4Y9OA 3RITA 1MSSA 3MHFA 4Z08A 4ROQA 5M03A 3RPMA 2CBUA 1HJQA 1KO0A 3WF4A 4ZQNA 5AHMA 4AIOA 4JNZA 5CZJA 1ISYA 3KCOA 4A21A 1RLCL 4M7SA 2XG9A 3TJXA 4HMNA 4RJEA 4YXGA 2IW0A 4HZ6A 4XVEA 4CNOA 3BJTA 3GYEA 4IMFA 1L8PA 4NVTA 4RE4A 4W8LA 1ZZMA 4XUYA 4WJEA 1TELA 3ZR5A 4Q8QA 5FAGA 4US5D 1JPMA 4PTNA 2UY5A 3E74A 3GO2A 1OGSA 3VDCA 3LTYA 3UWUA 1IGSA 4PUWA 1ZGDA 1MDRA 2OYLA 4JIQA 4UUIA 3FYPA 3SEPA 2DZAA 3NCOA 1DWHM 4DAFA 1VFSA 4EK7A 2E25A 2YB1A 2OZ8A 3GM8A 2WHMA 4GBUA 5LNWA 5C7HA 3H6OA 2V69A 1M3UA 3HG4A 3W84A 4G5DA 3SDOA 1OD0A 3MP3A 4DWSD 2V68A 2NLYA 1IHIA 4IFOA 1TJRA 5A6MA 3DFSA 2FZDA 4WSKA 3P82A 4RR4A 1XLJA 9CGTA 1IXNA 3M0HA 1L6GA 5HMSA 4FI4A 3KP1A 4NAFB 1HP4A 1O7AA 3F4VA 1JYXA 3CYJA 1S2TA 2W61A 2PBOA 1Q7ZA 3S2NA 2XH4A 3ONCA 2PLMA 3VFLA 3H2OA 4KIRA 3R58A 1W8SA 5KTLA 4W93A 5F1VA 1R3YA 1IGWA 3IS4A 2I1OA 1VFOA 4ES4A 5K3VA 4JCLA 4KEMA 1LQ2A 3R10A 1H63A 4QSHA 2V5LA 3IIZA 4NKCA 3RCYA 3VGBA 5A6SA 1JDEA 5A94A 2INEA 4JN7A 4UTWC 4CN4A 4Q8TA 1H4PA 5A6LA 3M0VA 3BH4A 5DY2A 3SIZA 4AF0A 3CMFA 3H4GA 3CM4A 1A5LC 3AMLA 4JYFA 3RM9A 3Q2DA 3HPFA 4DZ5A 3C2FA 3VIKA 1FKWA 3FGCB 2PZ0A 3C2VA 4S3AA 1E9YB 3EWXA 2Y85A 1GZ1A 4AXNA 3A3WA 3ZT7A 2PUZA 1MUWA 1XS2A 3LN3A 4NAEA 5JBDA 1QPNA 4MJMA 4AZ5A 3OZYA 1CXLA 5G2HA 3TX9A 1OVDA 4LY8A 1VPXA 5JUVA 4PRWA 1A5BA 1MNZA 4QFUA 1OJXA 3G22A 3W87A 1Z8AA 2PSNA 4W5UA 4UTLA 4JIPA 3EXTA 3HG5A 3SY5A 1UZDA 1OYAA 5DO8A 2YXXA 3ZVHA 2WANA 4PUDA 1RBAA 4X61A 3NDOA 3ZT6A 1FDYA 1REQB 2OEJA 2VI0A 3KOZA 4KCWA 4LFYA 2DIKA 3A4WA 5HWMA 3TA9A 1H60A 3HJEA 1NARA 2ZX9A 4H41A 5IFTA 4ZEPA 5LIKX 1EDGA 1F05A 2Y61A 4GQ0A 4U10A 4O0KA 4K39A 4HQVA 5BWFA 1XL9A 2ANUA 4EP8C 3STPA 3WENA 4ZSUA 4LF1A 4O0ZA 5F2GA 3QV7A 8CGTA 3WDHA 3WMBA 4ROPA 3K1GA 3TV8A 2CZVA 4D1IA 4C6EA 2WZEA 3VDBA 2EPMX 2IKGA 1E0TA 1WKEA 4IG2B 3QR3A 1VFFA 1CXHA 3DYOA 3GQYA 4ORMA 1EQPA 3HGSA 3G0UA 1TMQA 3SN0A 2FB2A 4Y90A 4XZLX 2CCRA 2PWFA 3DYMA 1KM1A 4LAUA 5BWAA 4LYPA 3WD1A 4FNSA 5E9XA 1SYTA 1ZCOA 2Z1WA 2Y7FA 2WC4A 4KKXA 3P81A 5HJYA 2FVKA 4PSPA 1TUFA 3OA5A 4GJIA 1KGXA 4HNNA 1VBGA 2WB5A 1DTNA 3NZ1A 3QF0A 3TJ4A 2GWNA 1KXVA 4M6UA 3M43A 1TG7A 3UZWA 1F3WA 5DELA 3B03A 1F74A 4IMEA 2FHFA 3AI0A 3KOFA 4JEJA 5FACA 4XTIA 3UXLA 3E49A 4JTIA 3DXIA 1EZWA 1V6YA 1ZBKA 3PP7A 4JICA 4DJEC 4YL2A 3MUIA 3W2NA 1SM9A 5IHRA 4IIEA 4IMGA 3WBEA 1KTNA 3TN4A 4P8UA 5E9AA 6PTDA 3NYDA 5HUPA 3BCJA 1XYAA 4AMAA 2VZVA 2DZTA 2EKGA 5U4NA 1FWHC 3KTCA 1QHOA 2PF0A 2VFEA 4MPQA 7REQA 1GJPA 1W9XA 1PTDA 3TONA 4LBSA 4NQ1A 1AD1A 5HBFA 3GXIA 3OQ8A 4NRRA 3MZNA 1XYCA 4CEUC 1A4MA 3GH7A 2XIBA 3GIPA 4N6EA 3MP5A 5JU6A 2D0GA 5T8GA 3MU7A 2A2IA 3ERPA 3WK0A 2CU0A 1FQ0A 2A3AA 3P61A 5TQLA 3NURA 1Q6GA 1V3JA 3PJUA 4GQRA 4F9DA 1TWIA 4V33A 4AD1A 3HTWA 1YNYA 2NV1A 5GNZA 1KXTA 3PNZA 2B81A 4O13A 2Q09A 3VABA 3WQPA 5A6BA 4MAZA 4AYGA 4GZJA 4XZNX 2ZRXA 4B5WA 1NFPA 5SWUA 4CQDA 3PSVA 3U7BA 2XINA 3EPNA 5CSSA 1XRFA 3G6MA 2OWWA 2VCBA 3THDA 2C1HA 1EXBA 3T2OA 1TPH1 3VD5A 3M0ZA 3KEHA 4S38A 4IQJA 4DF1A 3GS6A 5XINA 1PZ0A 4I8YA 2J79A 4A3YA 5CLTA 3K8MA 4OOZA 1HTIA 2FVMA 2GUBA 2VD9A 3NZPA 3MHUA 3RILA 1S1RA 5AYYA 5F7UA 4N0RA 1A49A 2CZFA 4Q3MA 3UJFA 4JY9A 5CSYA 3TCSA 3LHYA 3E96A 2FGBA 3W53A 1HJWA 3OU8A 4RDVA 1G7VA 5CCZA 4YVVA 5EY5A 1XH0A 1XIJA 2FFCA 4M56A 3MW7A 2QUMA 3AXIA 1LOQA 1UWTA 1BRLB 4D6IA 2JE8A 2E68A 4YVPA 1VCGA 2XVPA 4DBSA 1YXCA 4AIEA 2RHGA 1K3UA 1XXXA 1T7LA 3SIMA 4EAMA 2NUXA 5FA5A 1KRCC 4OE7A 4AC1X 1DVJA 4A8NA 4CGTA 4PMXA 1JPIA 2WMIB 1TJ2A 5JXQA 3V36A 1TRDA 5I3IA 1A0EA 2NQ5A 1BSIA 4QEEA 2RJGA 3VFCA 3PJWA 1DORA 3EWYA 5H1WA 3WUGA 1RCXB 3BK0A 2GGIA 5C2XA 1CGTA 3I68A 1D7FA 1K8CA 2QCHA 3E5BA 2WCSA 3BO9A 4KS0A 4PCNA 1UD8A 5AZ0A 2PDBA 4ACYA 3N2TA 3L5LA 4N6FA 4B4HA 3BCDA 1G94A 1S3HA 3UYCA 1XD1A 2AL2A 5DX7A 2RDWA 4J3UA 3PBUA 3LPFA 4C6CA 1Q85A 1SW7A 3TE9A 3BG5A 3PF3A 2CHOA 2I17A 4NNBA 3N6JA 1P0KA 1C8YA 4QIUA 1RPXA 3UG8A 3PR2A 3GD6A 4KF1A 2XIOA 5C2CA 3FJNA 3MMUA 3QY6A 3AUOA 3G0SA 1DJIA 4AZHA 1LLOA 2C14A 4HNCA 4DLMA 2ZZ1A 4PMRA 2XSAA 4HOXA 2GVLA 3GR8A 4LGXA 1UBPC 4DJEA 3KLLA 1ME9A 4B5NA 1XISA 4UQDA 3WQGA 4O50A 4KPLA 4TMCA 2Y5JA 3QFWA 1EEXA 1FVPA 4JYEA 4XZBA 3PSWA 4CU8A 3GDMA 5CPSA 5D2WA 3KVLA 2VKZG 1R46A 4K6AA 4C1NA 3SQLA 4UFKA 4W84A 4ZQMA 3W6MA 2G5WA 5A5WA 4PB5A 5IOBA 1IWBA 2WCAA 3P3BA 3NQAA 4GYFA 3HPXA 3CUHA 1S5NA 4C5YA 3ITCA 2PDMA 3KVMA 2Y2WA 1FHUA 4WF7A 3RHGA 5G4WA 4C6FA 3EXSA 2J24A 4H00A 4UBPC 2OSWA 5AN7A 3RR4A 1IV8A 3LRKA 2UWFA 2CNCA 3PUDA 3LPPA 1L2UA 4H7VA 1YBQB 2D0HA 3WNMA 4UB9A 4GRSA 1B3WA 1GHSA 5JH1A 3NPUA 1X8FA 4CD4A 4XZMX 5C6MA 1XPYA 4I5RA 3A13A 2WO5A 3RRAA 1QW8A 4K8HA 4R7WA 2QCDA 3LENA 3FA3A 3EOOA 4UQBA 4Z1DA 1HGWA 4C7DA 2F84A 1FH9A 1ZLPA 1V7YA 4RKAA 4QLKA 1R47A 2XYLA 3B0VC 4B5XA 3AHYA 4DNMA 1UC4A 1L8NA 4C6MA 4DB7A 2ZUNA 1TX0A 1JG9A 1R85A 3PZMA 4DAIA 4A2SA 4PULA 2Q02A 3AALA 3C3NA 1UZHA 3KS5A 3NUKA 3N3TA 4DO7A 4K1GA 3WO8A 4FNTA 3KVKA 2Q3OA 3M6DA 4XBJA 1OYBA 1OC5A 4O0QA 3BL3A 3O7UA 1C91A 3BVJA 3ZLHA 1W5QA 3WF0A 3ARZA 4LVBA 3INPA 4DYKA 3LGGA 1WXYA 1WYIA 3VOIA 4JTDA 3FGCA 5FF0A 2YSWA 3N13A 4IJRA 2NT1A 1GOMA 4LS2A 1C7SA 1Q6EA 1QRQA 4WDUA 1OCQA 2OQLA 1KBBA 3DBNA 4CN6A 4YCPA 2DZPA 2PTZA 3P8IA 2BSLA 1GK8A 1QOQA 5CSRA 3C0JA 3PANA 5A69A 3QTPA 2FH6A 3KXQA 1EO7A 4XZ9A 3TN3A 2NQLA 3LXCA 2YL5A 2NSXA 3EEZA 6ENLA 1B9BA 1GOOA 4WXZA 3IANA 4XV0A 2V38A 5DRCA 3GHSA 1TKKA 3LV5A 1OT1A 1R3WA 3WY1A 3WYZA 2Z29A 4NYUA 1XBVA 1KV5A 4RDYA 1B90A 3P2VA 3ARRA 3TMQA 3CAVA 1OF6A 4Z1BA 4IP7A 2YA2A 1KR1A 3G3MA 3VD9A 1D3GA 3WQEA 1X1ZA 1BXNA 3NQDA 3LDVA 3S8HA 4XKYA 1YMYA 2CLKA 2FFIA 3MWCA 4BFAA 1W6TA 4MAVA 1W1TA 5DANA 2V2HA 4JX5A 3R13A 4X9SA 3RM4A 1Z41A 2QCNA 2AL1A 3CJPA 3TYEA 2FLIA 1KFJA 4ATDA 1KRBC 4DJED 2HISA 4Z1AA 4J40A 3WLRA 1US3A 2XTKA 3UWQA 5CGTA 4Q7IA 3K5XA 3MVTA 2VDGA 3S4TA 3LHTA 1H51A 1FHDA 3QR1A 3CUZA 2IS7A 3FA5A 5HMEA 1XSKA 1R2TA 1QPKA 3ME3A 5H8UA 4I7WA 3RGTA 1Q6FA 3VIPA 2YL8A 1H09A 3A22A 3A6OA 3DAQA 4C6JA 5C9ZA 1ZENA 3IIPA 3VO0A 4DRSA 4E8DA 5C9WA 1MMFA 4R53A 4AIBA 4Y9PA 1CX9A 1YPXA 3FYOA 1S3TC 3FHAA 3POHA 3MMTA 1V3IA 1ISVA 1ADSA 1IXOA 4HN4A 3M0XA 3W7RA 2ZA3A 3QZ6A 4J28A 3MV01 3Q65A 4HPNA 4LW7A 3UJEA 1KM0A 2WWDA 4WKAA 4LUTB 5KZMA 1H11A 1VFMA 2O9TA 4RUBA 4DXVA 3UPBA 3K2GA 3WLQA 3W83A 3ARYA 3PUEA 3PTDA 3ZJ7A 4PMDA 3I6EA 4BI7A 3NQCA 1CWYA 1FFQA 2OT0A 1XGDA 2Q3RA 4EXQA 3GSMA 2ODOA 5D32A 1WKYA 2BXVA 1R9YA 3PJXA 3C2RA 4D71A 4RZ5A 3CV6A 1H41A 3WQVA 3S2LA 4FXSA 1PZ2A 3L4YA 2VRQA 4K37A 2WYSA 3AS0A 2XFRA 3DFQA 3SRHA 1EX1A 3N9SA 3WZ0E 1NF7A 2FQIA 3HZ3A 3DOPA 2V8ZA 1TV3A 4N9DA 4HOZA 1AZ2A 2PWHA 2TMDA 2WQDA 2DZVA 1QPQA 5LIYX 1EWEA 1DV7A 1PPIA 1POJA 2PDHA 3C5QA 4B5SA 3NOYA 1QAPA 3GH5A 4QR6A 2ABBA 3O2LA 1FTXA 3LG3A 2QZRA 1UWUA 3IEBA 4F9JA 3ID7A 5FEWA 3OA3A 4JFVA 2VJXA 2EGZA 5BXTA 2XIJA 3GB6A 3L4UA 4O52A 4QRNA 5DMYA 1TVNA 4P2VA 1TTJA 3T05A 3DC0A 2VC6A 3UG4A 2YL9A 4DN1A 2AKMA 1J0IA 1DL3A 4JIRA 3TOPA 1WO2A 2X42A 2XDFA 4B91A 2RGMA 3DI0A 4N4PA 4NASA 4DWSC 4NHVA 4PCFA 1NP2A 1QWKA 1WDWA 2ZUMA 1MO0A 4CCDA 5FEZA 3NQVA 2GQ8A 3W6YA 4YTTA 3LNMA 4US6A 3EPOA 3WG6A 3ZLFA 4CEXC 3UF9A 1A3XA 1TA3A 1UUMA 1YNQA 3QLDA 3QV9A 3LPGA 1V6UA 3CHFA 1SZFA 3UNDA 1I2QA 3PPHA 2YCKX 2JGYA 1HW6A 4YHGA 1P1MA 4JL2A 2QT3A 2B4GA 1UOZA 1KBKA 4MWAC 3PZQA 3QVQA 4BI5A 2ZZ5A 3KVJA 1CGWA 4Z2IA 2W91A 1E1CB 1S5TA 5FEXA 1V08A 4JFTA 2E1WA 4AAJA 1TZZA 2HDJA 2Z26A 3OGVA 3PBYA 1W2VA 4GUHA 2QMJA 4Q7BA 4JDBA 1E4IA 4Y8FA 2YCEA 4A22A 4KESA 3HV8A 3QM3A 2CLLA 1FRBA 2IPGA 1U30A 4I5UA 3WKZA 4FB7A 1F73A 1US0A 2VEFA 1XW8A 5T9BG 5D9OA 1RK5A 3WNPA 1EBHA 4J3SA 3OTRA 2J7DA 3VDGA 3UWYA 4LV4A 4GX9A 4KFOA 3RUBL 1NQ6A 4LEFA 4IIHA 4GWEA 4CQBA 2BHZA 1PIGA 4P7OA 3R11A 4JYDA 3QC3A 2V81A 5H2ZA 2B7OA 3N4AA 3BQ6A 3TSMA 3N6QA 1ME8A 1XQLA 4ML4A 3M64A 1A5MC 3LM7A 1UWQA 3HGJA 2J47A 1U5HA 1J6PA 1C8VA 1AH0A 3WFLA 1JZ5A 2XN0A 1TV4A 5E5CA 1XBZA 2WNNA 3DX5A 5H91A 4B5TA 3AJ7A 3WMSA 4DVOA 3VU2A 3QHNA 1BVZA 3CQKA 4H01A 3RXZA 4Q6XA 3G1SA 3TQKA 3UWEA 1EPVA 3FEMA 1N2VA 1V6TA 2VTFA 5DXXA 1S2UA 2QF8A 3WH5A 1XYZA 2W9MA 2DUAA 3IVSA 3M0LA 3VNDA 3FYYA 2AGTA 3FK4A 3QBUA 3ZLGA 1JAEA 4XZIA 3SCTA 3SI9A 1UOKA 4YMZA 1NDZA 2QS8A 2FIQA 4O1EA 2OX4A 4E8CA 2VENA 3LCFA 5I5RA 2QLYA 4F0LA 2C3ZA 3F4DA 4BI6A 2Z4GA 3FJLA 4ORIA 4R34A 4ZCWA 3WQ5A 3EB2A 1VENA 1WXZA 1JUBA 1JEZA 3LEPA 1XIBA 5EMYA 3VMPA 2CLEA 4ILSA 3UFYA 3W70A 1JDAA 3WK3A 4IH3A 4OFCA 2DVUA 3PB2A 3S1XA 1K7XA 3P60A 3NL2A 4O16A 2HS8A 3WJWA 4L4OA 3BZGA 4JTLA 4HN8A 1K77A 2ZFAA 4Y9AA 4X60A 2DVXA 4AX7A 1FUYA 3TYZA 4PMJA 1LL7A 2V3EA 2J9YA 4MKSA 4RXGA 2PDIA 2H9AA 2J66A 4GCAA 4N42A 4JD4A 3WLSA 3CT7A 1E6NA 1S38A 4Q4MA 4NZFA 5D2TA 3UZZA 4B90A 3U7VA 1XUZA 1Q6QA 4DPQA 4ML9A 4NAEB 4LF2A 2VDHA 4BKNA 3BDKA 3SJ3A 1NF0A 1G67A 3UZXA 3L0NA 1W3IA 3W7QA 3NA8A 3TN5A 2D3LA 3PFMA 2W66A 4J2PA 1RA5A 3OG2A 2OGJA 1MXGA 1MQPA 4JQ2A 1CW2A 5L9FA 1A50A 1J0YA 4O53A 3VDHA 4YCOA 1DJYA 3CB3A 4YTQA 1KLYA 3CBWA 1H61A 4LYRA 4AB4A 1VQTA 2QJHA 4ZB5A 4CCCA 4AZCB 2PC8A 4A29A 2GQ3A 2OOGA 1YXDA 2YGYA 3GNOA 1IQ8A 5K4XA 3JW7A 1O6IA 2WJEA 3THQA 1JCNA 1EJRC 2E28A 2VURA 2R9RA 1LORA 4TX6A 1F61A 1DQUA 3SUSA 4Z2LA 1DPMA 5EMLA 1ZNNA 1YW1A 2E5DA 4UMAA 1EJUC 1CGUA 2OOFA 1E73M 4HZ8A 1RQBA 4GYPC 3QKEA 1KFEA 1TE6A 3WN6A 3W37A 2YLAA 3UR8A 2CETA 4UTTC 3QV6A 3SSJA 2CXEA 3BAXA 3AZRA 2OG9A 4ZXOA 3QTGA 4A3UA 4AX6A 1EHAA 3ITXA 2JBMA 4MFDA 4A4AA 1UPPA 4LC8A 4AVFA 1KFKA 1TZ9A 3QR0A 1UZ1A 1S2AA 3UZ5A 3R12A 4FIRA 4BF5A 2F2KA 2RKXA 2WLYA 3GNXA 4MB1A 1TPFA 3FS2A 1GORA 3AQUA 3QGKC 1W1A1 2Y88A 1DWFM 3B04A 2Y89A 3LHZA 3AIQA 3W74A 4I9TA 2CZEA 3TA6A 1DE5A 4GXWA 1RP8A 3OVRA 1XC4A 1KRMA 5M2FX 3JS3A 1HKKA 3L5MA 1KW1A 4AC7C 3QY8A 3GXDA 2A79A 2ZXAA 4JR5A 4OECA 4Y96A 5LSMA 3DBPA 1W56A 3OHMB 1XYFA 1H3GA 2J6XA 2BXZA 3OZOA 4MZYA 4XAZA 4H2HA 5DMLA 2PGEA 1M03A 4FHAA 2D69A 3URQA 3S1VA 4ZA0A 1VYSX 1LL6A 2R6OA 1UWAA 4C5ZA 3W0KA 5J5DA 1C7TA 1EUNA 1AQ0A 1GCYA 4I7VA 3W81A 1S2VA 3EX6A 4LS0A 3G1HA 5T26A 4B92A 3ARQA 1Q8JA 5A1AA 5EA9A 1Y7VA 2ZXBA 1PE1A 2GJXA 1HJUA 3ARSA 3PBVA 1UR0A 4E0CA 4XWUA 5DCDA 1TR1A 4HK5A 1UH4A 2ZBTA 4IPPA 2UY4A 3RCMA 1K8XA 3CV2A 3O63A 1OFOA 1UR1A 3U2ZA 3OZPA 3UEQA 3CZLA 3B0YA 3IK2A 4L9ZA 1Q6CA 4US5A 1XIHA 4S39A 3Q45A 5JH2A 3B8VA 1BF6A 4BF9A 3KDOA 3V0SA 4LBRA 4DY1A 1J5TA 3DCPA 4XAPA 4HCDA 3EKZA 3L0KA 3WX7A 1XYMA 2Q8LA 2QUVA 2YXOA 3MDWA 5LKYA 1S2WA 1BFNA 3BLFA 1K6AA 2C0HA 1ZAJA 5BU9A 3FJ4A 4G8TA 1ZL1A 1E6ZA 3UJ2A 1FHVA 2C19A 1D3HA 4LYKA 2C71A 3B8UA 4IGMA 4AY8A 3F2DA 1SFTA 3BTNA 3F7JA 4JL1A 5CGMA 2ZXQA 4ZXLA 3L67A 4EE9A 1V3KA 1SMAA 1PX4A 3PULA 1GVRA 3B8IA 1KGUA 4CCZA 1W1B1 3T0DA 3RNDA 3DECA 4ZGYA 4GYPA 5FJUA 1H2JA 3LBMA 1I2OA 3EKLA 3VZZA 1R2SA 2XM1A 3D47A 1JCYA 4YS1A 2FPYA 9RUBA 3SGZA 1QPRA 3E2VA 1KTBA 5KSWA 3UWWA 3NQ7A 3G77A 3TTEA 2W6RA 3S83A 2VX6A 1NTHA 3PM6A 1R9XA 1XCFA 4S3CA 4HVXA 4MMWA 3BQ5A 3C4UA 4NSBA 1M53A 3LCGA 1JGIA 3W22A 4HPHA 3WNLA 1UD2A 5HQEA 1SZRA 1OM0A 4JS3A 2XFYA 4DBDA 3AIEA 1PSCA 1HZYA 1UMLA 4M8UA 5CAKA 2I57A 4BF7A 1US2A 2WBGA 4QDMA 2GUYA 2ZICA 5D2YA 2OQYA 2BHYA 4LAZA 4TTUA 4HP5A 1Y65A 1JDFA 3F4WA 1YYAA 2XJ7A 2WAGA 3NEHA 4YPJA 1K9DA 3NO3A 1P0NA 2R91A 4MZ8A 2PGFA 1FXQA 1XBXA 1Q6LA 1NWUA 2D2JA 2ZQ0A 2VFDA 2Z7GA 3BLLA 1TSIA 3TLQA 4TQTA 1LT8A 3ABXA 4F0MA 5CC5A 3UJSA 1WBHA 3WL1A 3H2MA 2Q8XA 2BP1A 4IJBA 4Q22A 1W1VA 2BGQA 1KCXA 2A7NA 2REQB 2OKTA 4MY8A 3WJZA 3CHVA 2WW5A 4J4KA 1OFPA 3RU6A 4BS0A 3SUWA 3ZIZA 1WXJA 2GDVA 1GWJA 1SVDA 1RQHA 3BUVA 1QUMA 1PO9A 4GX8A 3DFOA 3LK6A 2YBUA 1FCBA 2POZA 4QLJA 1YPFA 1VBUA 2WPGA 2WHJA 4P7NA 1X6NA 4GA8A 3W2UA 1ONRA 4M24A 2CC0A 2CIPA 3CU2A 3G8RA 3VA8A 3WBXA 4AEEA 1JD9A 1XRVA 4HCLA 4F0RA 4JPGA 3ZM8A 3AMGA 3WH9A 4CNTA 1B1YA 4E2OA 2FZ8A 3NL5A 5FAJA 4U31A 4C1LA 1UA7A 2YDRA 4DUVA 4GY0A 2YZRA 3FDKA 4KIEA 1B3VA 4WIWA 3NEVA 2X40A 1NWTA 4JHMA 2FHCA 3B4UA 3PBWA 5ABFB 3O06A 5ECUA 3JZEA 4XKMA 3O0KA 4RE3A 4EF8A 2PRMA 3RJXA 1PL9A 2RDTA 1XLBA 4LVDA 1VYPX 4OZOA 2KAUC 3NQFA 4F3HA 3LCHA 3S5NA 4GNJA 2HQAA 3AHXA 2H3BA 4HT3A 3G1RA 4TX9A 3VGHA 5C54A 3CLMA 4QBXA 1QW7A 4ICCX 3WUFA 3H54A 3PZOA 4GMEA 2QUUA 1OBAA 1DQXA 4O1AA 4ZFMA 1TO3A 1BRLA 1TPEA 2GQAA 1XG3A 4AIUA 2JGQA 4M1RA 2XGIA 3TC3A 1WV2A 5FJPA 4Q8VA 2Y5SA 4LJ3A 4LAMA 4EPBC 4M0XA 3WLJA 2QDEA 1OABA 1Q13A 3KHDA 4GZEA 3ITLA 4GIEA 2E77A 3VNKA 1W3TA 2FGZA 4EACA 3ZJKA 2GVYA 4GXMA 4C60A 3AXXA 1YTDA 1DTUA 1VHNA 2BY0A 2WMFA 3IJ9A 4JNMA 1IWAA 1LUCB 2PU1A 2Y63A 5JMUA 4JAWA 3KOWA 3WD0A 3B06A 3G1AA 4IOTA 1MW2A 2IUZA 1NFGA 2O55A 3FKKA 1NY1A 1UP2A 2BZNA 1E0UA 2YYTA 3IJDA 3GZAA 5AVHA 3WNNA 1VJIA 1SPQA 4RZ6A 3VC5A 3TQPA 3TUUA 4C6PA 5A3HA 2J88A 3P67A 4L4LA 2QDHA 2PU0A 4ZENA 5DN1A 3HF3A 2Z1VA 2X1IA 2IKHA 2X05A 3SN4A 2CLOA 3OQEA 2GGGA 2OCZA 3QEZA 3TK7A 1OFRA 2ZCGA 4NZ5A 1P6CA 4PUMA 3U8GA 1RBLA 1W3NA 1SW0A 4W87A 3WLMA 4O1BA 3GR7A 3T8QA 3HN3A 4J1OA 3GU1A 2CBJA 1CLVA 4W9TA 2OWCA 4Y7EA 2V5JA 3LCIA 2X0YA 3VZYA 3SUVA 2VEGA 4R5EA 4F40A 3GG1A 4S3KA 2A85A 4Z2HA 4QCEA 5I6SA 4WCJA 1CEOA 2WNQA 1ZBVA 4M6VA 3QSRA 1I4NA 1M9HA 2WHKA 4XIAA 1UHVA 1ESWA 3MHGA 1FWJC 1H1NA 2FZNA 2ZZ2A 4D6FA 4GH3A 3E3HA 1MVYA 2WQPA 3DGBA 1G69A 3EAUA 3LX9A 2PA6A 1BKSA 3M41A 4KETA 3CZ8A 1V51A 3S5YA 5XIMA 3WLKX 3CAQA 2QR6A 3SQSA 1EC9A 2E9LA 4EIVA 1PKNA 1DIOA 3CTTA 4PUJA 5TNVA 1Z3NA 3F2BA 4TVDA 2C8NA 4GVGA 4WD0A 2X7WA 4A8LA 1NOUA 2OEMA 1LLWA 1ML1A 1W5PA 2VO5A 3MKKA 4LUSA 3PBGA 4A05A 2FJKA 2PDGA 2WVSA 3N9KA 3RLGA 1SSDA 3MY9A 2X2GA 2E5BA 4A3RA 3AS2A 3JR2A 3QQ1A 1UR4A 1XUUA 4FX6M 1K8YA 4GJJA 1PYFA 5GQBA 3U0HA 2E6AA 4GE8A 2XSBA 3VM5A 4FNPA 1W8GA 2XN1A 3TP4A 5MKGA 1JAKA 2ESCA 4FAMA 1UW9A 4NJGA 3POCA 2OO6A 4BA0A 4HPJA 3FSUA 2IQDA 2O0TA 1TWDA 2O7SA 1RP9A 2UY2A 5CZSA 3ES8A 4H19A 2J8TA 3GW3A 3A21A 1R9ZA 2G37A 2TAAA 3WL0A 1W9PA 1W3LA 2HXTA 3R8HA 1WNOA 1FWAC 1K4HA 3GDKA 1AQFA 5FCZA 4NU7A 5CH9A 1K70A 1R3RA 3NQEA 2Z24A 3KUMA 1GPWA 3HBLA 1E4LA 3B9EA 4LCSA 3LTSA 3W88A 3BSGA 3R7MA 4AXKA 1KXHA 2DPEA 2VGIA 5D38A 2ZVIA 1RHCA 1OB0A 4MOZA 1C29A 1QI0A 4CQ9A 1E5JA 3T8LA 4H6RA 2J62A 3VIMA 4KCTA 2PZNA 3EKGA 4XAFA 1H0GA 3U4FA 2OMAA 4KQNA 4WDTA 4F0SA 1ZSXA 1Z44A 1X39A 4FX8A 4S2CA 4IP5A 1AZ1A 2VUNA 2C16A 2HK1A 4MB5A 3L66A 4M51A 4DBUA 3K8KA 3SRDA 2WMKA 1SO3A 4QDWA 1E9LA 3QPEA 4H6KA 3WQCA 4LC6A 3MDUA 1XGZA 8RUCA 4JY8A 2WSRA 2QJNA 4A35A 1W5MA 2O92A 4BQ2A 2EG8A 1F76A 4YWIA 3H21A 1WOAA 4QQ3A 4WHBA 3EBVA 1D7KA 3GDLA 3V3WA 3GH4A 1TYGA 3GTHA 4JKMA 5GPRA 4DI8A 4XAYA 3VKBA 1JYVA 2E09A 3TWAA 5I3GA 4ASTA 5FKYA 2J75A 2OLHA 1OX5A 3C3UA 3L4XA 3SADA 3N18A 2WMJA 5AYIA 4E4PA 5C7VA 3Q37A 5I0DA 1TJPA 1HKIA 1EGVA 5B80A 4HPGA 5EMMA 3IAPA 1P7TB 4JTGA 3CQ0A 4B5VA 2QPSA 5CAHA 4UCGA 2QW5A 4M82A 3LQLA 1VR6A 2QV4A 4LNCA 1SJAA 1WZLA 3CS2A 3WDRA 4GYKA 2VFIA 2UZ9A 4HTBA 4ZSTA 3CWHA 1FWEC 1JZ4A 3F4CA 1VYRA 1TQXA 3GG0A 4ZBCA 3U2EA 4I7UA 1MRAA 3C0LA 5D04C 3CEPA 5H6HA 1OFEA 2YL6A 3F5KA 1NWRA 1SFSA 1THFD 1KKOA 2P3ZA 2WSQA 3QGVA 1EIBA 1M1BA 4AFYA 2PTYA 1OADA 2EHHA 2YZ5A 4XD3A 2GVEA 1BF2A 2ISDA 3T6CA 2A3LA 5JQ9A 3LMYA 3A47A 4DYJA 1W37A 5DFAA 4HHPA 4O12A 5MHBA 2XGZA 3NZRA 5G4HC 2VCCA 1UR8A 4Q4QA 1W9UA 1AD4A 3AIWA 3LHWA 4M7TA 4YJ5A 4P7RA 2RDXA 4XKYB 1R3TA 4DBEA 3GY1A 2O9PA 3KZSA 1KKRA 4F8XA 4AZGA 4ZQCA 4XO6A 3NO5A 1GNXA 3CH9A 2ZE0A 4UFLA 4FOJA 5CZKA 3O3RA 3P80A 3AU2A 4O28A 4R88A 4S3DA 1SZNA 1UJPA 3C2YA 4HJFA 2EPNA 2O9OA 3PZVA 1AW2A 4RZBA 1UYQA 4ICMA 3WH8A 4PTWA 3H2AA 2WBKA 1Z9AA 4PB4A 5FL0A 3RMEA 4M29A 3MVIA 3MTWA 4O54A 4LYQA 4NZ1A 3CMGA 1FWNA 3NO1A 1E1FA 2Z2BA 4AD2A 2AAMA 1L9WA 3W25A 3ZSSA 5D02A 1AQHA 3ABZA 3TQVA 3HG2A 4PB3A 3BGGA 2PI6A 1FBAA 3VMNA 1G4PA 5ECVA 3KBVA 3GKFA 3GDBA 2OJPA 4XAGA 3RPTA 2WLZA 4IT1A 2W4XA 3W82A 3B8DA 4L4PA 5HMDA 1GKRA 3H2EA 3FJ6A 4CD6A 4WK9A 3CUXA 2VL4A 1S46A 4MYXA 2WZTA 3BSHA 1NDVA 4G1KA 5AC5A 1RR2A 1MEHA 2HSAA 3RYSA 3THUA 1G9HA 3IVUA 1QNRA 4HNLA 2IXVA 3Q94A 1LM1A 4RDZA 3TFCA 4ZFCA 2CXGA 4IGNA 5IDIA 4AWSA 2G3MA 2PDUA 3F03K 3W85A 1QVBA 4WOZA 1T5AA 2J6VA 3L4WA 4YIWA 1EGZA 1QI3A 2BG5A 4N4QA 2DFAA 2O9RA 1JRBA 1IZCA 1OFAA 2QCFA 3PTKA 5CPNA 1LQAA 1MZHA 1ICQA 3YPIA 2GWGA 5EKYA 2SFPA 3BG9A 4GY1A 4JIEA 1DP0A