2QKFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Re-Establishing a Metal-Binding Scaffold with Full Activity in the Metal-Independent Kdo8P Synthase from Neisseria Meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
molecule keywords 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
total genus 81
structure length 251
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qkfA00
1O60A 4W9TA 3H54A 5AHMA 3W1NA 2ZZ7A 3OIXA 2Y63A 4YWIA 3M5VA 4QJ1A 3TV8A 1DJNA 4WOZA 5EBUA 4JTKA 1UB3A 1QO2A 3EXSA 1W54A 3ATYA 3FJLA 3KX6A 3W7QA 4RZ4A 3UWQA 4CNOA 5D2TA 3I68A 2YYUA 3QSTA 1JRCA 1FWSA 1YXYA 1DJQA 1EP1A 2J9YA 1MXSA 3C3NA 2ZZ1A 4A29A 3B4UA 3GZ3A 3TA6A 3SR7A 4GUFA 4CNNA 1B4KA 2A7RA 3W70A 4QAIA 3W7NA 1O95A 1VYPX 2NXHA 1ZALA 4Z08A 3CQ0A 3U2OA 3PUEA 4JTGA 3QZEA 3T44A 1D9EA 2A5HA 3GXTA 5D32A 2JK2A 1LOQA 1DKWA 3TDFA 4N9DA 4UFMA 5HR7A 3C2FA 4ZVJA 3O16A 3P8IA 2ZRVA 3IIPA 3TR2A 3KAOA 2ZA3A 1I45A 3FYOA 5CPLA 4DF1A 2E6DA 1EP2A 3NXFA 3RU6A 3EKLA 4PA8A 4I7VA 3A5FA 5FEZA 1XBVA 4OQVA 1HFBA 1JJKA 1W5PA 4ZZ9A 2DORA 1QOPA 3THQA 4UR7A 3NQEA 2A2IA 1KFBA 3MBDA 4JTLA 1DQXA 5AC6A 3QYQA 4LTSA 2FJKA 3PWAA 3PC0A 4UR8A 2QCMA 3W7LA 3LDVA 1WBJA 3BV4A 5CPMA 5EPDA 4R53A 3TC6A 1W1ZA 3IIVA 3FYPA 3MUXA 1GQNA 3N14A 1J4EA 2FQIA 1KLYA 2XN2A 3MBFA 5CPOA 2GQAA 4I7WA 2GQ8A 4LUJA 4AF0A 1W5MA 3CPRA 4UTWC 1QO5A 1QFEA 1FBAA 1FUYA 3GXNA 4NUWA 5F4WA 4MYXA 4NXKA 1T96A 2VEMA 3NA8A 3G22A 1VJIA 1SFLA 3DFTA 5U4NA 4JTTA 3PY2A 3C2VA 3WJXA 2YZRA 3IGUA 1XFBA 4FX7A 2HSAA 2IQTA 3FEMA 1LLWA 2O7QA 2ZRYA 4LT9A 4UTKA 1YYAA 4ZQNA 4AEOA 4NJIA 2NX9A 2E1DA 3NQCA 1WAUA 4O57A 5FF0A 4YLWA 1GTEA 1LBLA 1XBZA 2OCZA 1Q3NA 4DBEA 3EWYA 3QQ0A 1RQEA 3HF3A 5AHFA 4JTJA 4FF7A 3TKFA 1TJRA 3DGRA 3N34A 1Z44A 1JCNA 5K7JA 2QCCA 4ORMA 4WY0A 4KFPA 1B9BA 4LNYA 1PCKA 2FLIA 4O28A 2Y7DA 4NQ1A 3B06A 2UV8G 1SO3A 3LI1A 4FNUA 3JS3A 4FXRA 4ZQMA 1A5SA 3W2LA 4NNCA 3C2OA 2H3DA 5CGQA 3W72A 3CTLA 5F4SA 5U7SA 4A21A 5FI8A 1R30A 3C2RA 4IMEA 2GOUA 4HNVA 4IGHA 3PF3A 2ABAA 3UNDA 2VFFA 4NX5A 1KM6A 3GK0A 3GKFA 3P8JA 3BLEA 3NQAA 4DEFA 4GNJA 3NAVA 4JIQA 4GE8A 4GUGA 2B0MA 5EA9A 4LOCA 4BI6A 4NNBA 3CT7A 3P5ZA 1OFQA 1N55A 3M9YA 3CIXA 4ZQCA 1TPH1 4WXYA 1W8SA 1OK4A 1GWJA 3F1QA 4HN4A 1HTIA 1Q6OA 2PURA 1TTQA 3UZ5A 1TV7A 2GQ9A 3KOFA 2PRLA 1LCOA 1WXJA 5EY5A 3TJXA 3W87A 1GOXA 4UC5A 2EHHA 5T26A 3BW3A 2DP3A 1YXCA 1EUNA 2CZ5A 3S0CA 2QCFA 4GC4A 3SZ8A 3PVFA 2WNZA 2NLIA 4UFLA 3UQNA 4WX2A 1V7YA 3G1SA 1O4UA 4GFSA 2VFDA 2B7PA 4Z1AA 4N4PA 3G0UA 3TROA 5K9DA 4ADUA 3CEUA 3B03A 4ZQRA 4ORIA 1OFEA 2E09A 3NL3A 1LLZA 1VHNA 3DI1A 1U5JA 4AWTA 4BK9A 3W7JA 1OYBA 4LV9A 4KWVA 1P0KA 3HG2A 2ZZ2A 5C55A 3QSRA 3GAYA 4UTTC 1LRNA 4E0CA 3CB8A 3FKKA 4WUIA 3TFXA 4G1KA 4NJGA 4MZ1A 2NWSA 1OYCA 4LVAA 4WQ6A 4UMBA 2C16A 1RQBA 4QM1A 4RJEA 4GJ1A 4TO8A 3M6YA 2GPTA 2QJHA 1KV8A 1IF2A 5J5RA 3S5YA 4LVDA 1ZHAA 4LU0A 4P2VA 1R2SA 2DU2A 3O07A 4IMGA 1ZAJA 4HHPA 4IQLA 1ME9A 3Q94A 4LVFA 3L5MA 3N73A 1WX0A 3QH2A 3BW4A 3OHIA 3DFOA 3WJYA 1ADOA 3ZWSA 4UNKA 2A7NA 2EGZA 5KTLA 4FXSA 4Y96A 1WQ5A 1CX9A 1LYXA 2CW6A 4MJMA 3QJAA 2WOQA 1Y0EA 2Y85A 3JR2A 4D2JA 2QCDB 1JCXA 3DXIA 2J27A 1HG3A 5CSRA 2W6RA 4S1FA 5CZJA 2VEKA 1K03A 3RMJA 3F03K 5C2XA 1M5WA 3TMLA 5TQLA 3G24A 5CSSA 1ZY9A 2EPHA 4ICNA 3PB2A 2ZQ0A 2ZZ3A 3W83A 4S2CA 1F2JA 5D2XA 5AC7A 1I2NA 3L0NA 1ZAHA 3T78A 1W37A 2VEPA 3NM3A 1YTKA 1FXPA 1VHCA 4EOUA 4IMFA 1H50A 4CNPA 5I3FA 1JCMP 2VFIA 3L66A 4OU1A 3LCFA 1TTPA 3VI2A 3KVKA 3GDRA 2YSWA 3OVQA 1IXQA 4XBKA 1VGAA 4AHPA 3TAOA 2NUXA 2PC4A 4Q32A 3W7KA 1QPQA 5TBOA 3GYEA 3N9SA 5LNSA 3Q2DA 4ZL1A 3DFSA 2DZWA 2TSYA 3QPZA 2XN0A 1TJPA 4K6AA 1SW0A 1SPQA 3B05A 5L6UA 2BSLA 2YFOA 3N2XA 2BTMA 2QJGA 1M7OA 3CU2A 1O5XA 4M7SA 3LCIA 3R8RA 3T7VA 1KFLA 3HBLA 5L9FA 1X1OA 2TPSA 3M5YA 3P74A 5DN1A 3UPWA 4LC6A 1HO4A 1KV5A 3W75A 3W2JA 3ZFHA 1OF6A 1ME8A 4N6FA 1WV2A 4RK8A 2B7QA 2A0NA 3P84A 3UYCA 1MEIA 3W07A 3G8RA 2WSRA 1ZAIA 4X22A 1XCFA 1TIMA 1V5XA 1Q6RA 1TV8A 5D09A 6ALDA 3TC7A 2ZZ5A 3W7CA 4MVAA 4DO5A 3NQDA 4WZHA 2B4GA 2AQWA 4N9CA 5CZTA 2NWRA 3C4UA 1Z42A 4MYAA 1RZMA 3ZWTA 5BMWA 1VQTA 2H8XA 5D02A 2NXIA 3L2IA 2GVGA 4MZYA 1UJPA 2Q3OA 2QDHA 1PHWA 2QJIA 4O13A 3C52A 3PSWA 4GUIA 3QMTA 3BLIA 1OX4B 4PTNA 2H90A 2C18A 3S1UA 1Z48A 5CPNA 4O8RA 4TIMA 1OK6A 4UFKA 3TH6A 4LVBA 3BK0A 4M7TA 5DCBA 3GIYA 1W5NA 3UPBA 2C14A 4K39A 1HUVA 2VFHA 2A1YA 1SW3A 2WPBA 3NQMA 1PL9A 2C6QA 1IGSA 1VCVA 4E2DA 3GKAA 4L4LA 2YFNA 5KZEA 2WKJA 2ALDA 3QQ1A 4FNTA 3PBUA 5F4XA 3QEZA 4CQ9A 4FO4A 3TXVA 1KBJA 5DELA 1ZJIA 1OFDA 2ZZ6A 3DFPA 3DZ1A 3W1XA 5CKSA 3CLMA 2VXNA 3WK3A 3A22A 2FPYA 5HWJA 5AC8A 1H7RA 4MZ8A 3EXRA 2GVLA 4YCOA 4GBUA 1KTCA 2ISWA 3TUUA 3B8DA 2X1SA 4E2BA 1H62A 2C15A 3ELFA 1WYIA 3SGZA 4O14A 1FXQA 4JYDA 4K7YA 2Z6JA 2F7FA 1GT8A 3G1FA 3WK1A 1TPFA 1SQ7A 1GVFA 1ICPA 5A5WA 2ABBA 2Y6ZA 1LBFA 2WJZA 3LOTA 4AWSA 3O05A 3PG8A 1A50A 1UBSA 3W2NA 1BTMA 4LS2A 5K2ZA 3M16A 3H53A 1OVDA 4XZ9A 3EX6A 3WK2A 2V2CA 4I9AA 1SZFA 2YR1A 2QCLA 3W1TA 2H3BA 2E5DA 3USBA 2EKCA 5AB3A 3CM4A 3NQ6A 2J9ZA 3F4NA 4A3UA 1PVNA 5DY3A 4A2RA 3W23A 3EWUA 3OG3A 3PBYA 4IOTA 4KKXA 3C2EA 1QCWA 1WDWA 1H7NA 5J5DA 2X1RA 2WSQA 2Z6IA 1XBXA 5TIMA 1TPEA 3RLVA 5HMSA 4PFMA 1DOSA 2WSYA 4E38A 1GYLA 4JX6A 4POCA 4Z0SA 3NR0A 1F05A 1F76A 3W7EA 1H61A 1GJPA 4PL2A 4HT3A 1JCLA 5LNUA 4NJHA 1ME7A 4HPJA 2BX7A 1GTHA 3TU9A 1RQHA 3W85A 2V2DA 4RKAA 1T99A 3EWZA 1RPXA 4JGDA 4IX0A 4U28A 2RKXA 1JULA 3A9IA 4M5PA 1JCJA 1K7EA 1P4CA 2ZTKA 3W88A 4PCFA 3UXAA 4AXKA 2V9DA 4NZFA 4JD4A 2QCEA 3STEA 5I3JA 5I3KA 3L67A 1G4TA 3P80A 4MFEA 1SO6A 2C0AA 3DH7A 1OF8A 1TPB1 4N4QA 1THFD 4N9BA 4HNTA 3IVSA 4N02A 2A7PA 3MMTA 2KZHA 1J5TA 1NSJA 2VFGA 2NV1A 2J24A 2G5WA 1L6WA 4KWWA 1VR6A 3WJSA 4QIUA 3RLUA 2VKZG 2ATSA 4O4VA 3PB0A 3PUDA 2I9EA 3LI0A 4M6QA 1OFPA 3LHYA 1KFJA 3N19B 1LM1A 2Z1BA 3IVTA 1JUEA 2ATMA 2X2GA 1F5ZA 4K38A 2PRHA 1QR7A 1BWLA 2NUYA 5LKYA 1VCGA 1ONRA 4CQAA 2QKFA 1I2RA 1Q6QA 5K9CA 3THAA 3LBCA 3PULA 3M7WA 4O18A 4NZJA 2OT0A 1IXPA 3MHGA 5EYWA 3I6RA 3I7RA 5F2LA 1KM5A 3QC3A 2QDGA 1NAL1 3DKLA 2HS6A 1ML1A 1QWGA 3QM3A 4TR9A 5KSWA 1W5OA 1OG0A 1IXOA 3C6CA 4A2SA 2X1TA 4ZQOA 5HWNA 2QCHA 2EF9A 2Y7EA 2YX0A 5D37A 2QAFA 1JVNA 3GDTA 2I1OA 3S1XA 1EPXA 1ZCOA 2NUWA 4IX2A 4EVZA 4IMCA 2QUVA 1S5TA 5HQEA 5FESA 3MYPA 3IRDA 4JNMA 4O50A 4O53A 1GEQA 1YPIA 4I7UA 1I8JA 5LGXA 4MLJA 1OX6A 4N9EA 1FWWA 3LB0A 3HGRA 4K7VA 2E6YA 3A5VA 4MKNA 4XKYA 4QNWA 1LOLA 3W7OA 5D2YA 3KRSA 1TTJA 3I7SA 5FF3A 4FNSA 3FOKA 3PM6A 2P1FA 4BWLC 4YMZA 1VYRA 1RVGA 1O5KA 4PL1A 3S1WA 3MI6A 1RV8A 3PBWA 1G4SA 1PV8A 1QPNA 1SZNA 2OJPA 2V2HA 4DO4A 1P5BA 3OEXA 2TYSA 4H6KA 4IMDA 5DXXA 4OV9A 2RFGA 2ZDRA 5BRBA 3DENA 2QUTA 4ML9A 5AHLA 3V1PA 2CLMA 3DBPA 4FNQA 2QCNA 3IGSA 1ICSA 4JN6A 3DFNA 5DBUA 3HPXA 4M6VA 3LCWA 1L2UA 3YPIA 1L9WA 3STCA 3LCLA 4N6EA 1PS9A 1S5WA 4EWND 5LGZA 1LZOA 2CWNA 3TW7A 3JRKA 1FWRA 2Z0IA 3ANYA 1QNVA 1OFRA 3NDOA 1O94A 1XL9A 1YPFA 4X9SA 4U4MA 1MEHA 4IPJA 3UWZA 1DV7A 1MZHA 5G2WA 3U6WA 3W7HA 4YCPA 1IXNA 1TMHA 3LLDA 5HUPA 3HMJG 1D3HA 2A6NA 3HPZA 1LORA 4JTIA 4O0ZA 3WJWA 2R94A 3LHWA 3PBVA 1AL8A 2PRMA 5FF4A 3W22A 3DU0A 3KVLA 5K9XA 3S5ZA 4AMAA 5BNKA 5F2GA 5E0KA 2CLIA 1PIIA 3F4WA 3HGJA 3UWVA 4O12A 3HG4A 3W7RA 2FPTA 3NM1A 1XKYA 4FHAA 4XQ6A 4C1KA 1SU5A 4DELA 3RFAA 4Z1BA 4ADTA 1PCWA 4TMBA 1GVRA 1OABA 3SW6A 3L5AA 3SSJA 1DQWA 4Q4KA 4OT7A 3M43A 2ZFAA 3G1AA 2NV2A 1TRDA 1BWKA 1AW5A 4L4MA 4MLRA 2E5CA 4LRTA 1IIHA 3GDMA 3W6YA 4QSHA 1JQXA 5G2HA 1Z41A 4UFJA 5KZDA 1OFBA 3R5EA 1W3TA 2DZXA 4JTEA 3FKRA 2Y7FA 3HOJA 5FEPA 2TMDA 4X3ZA 4BI5A 4HIBA 3EEGA 1Q6LA 1FDZA 4OGZA 1S5VA 2PCQA 1LBMA 4QISA 3IIXA 1TV5A 3C0JA 2GUUA 3MW7A 3R89A 4MY1A 3EWWA 3B0VC 5EL1A 4CLMA 4O0KA 5F2MA 1R46A 1WOBA 1W0MA 2DZSA 2WO5A 1NF0A 5D04C 1TPWA 4O15A 3EX1A 4HSNA 3W84A 5BW6A 1JUBA 3LGEA 3LXBA 2RDTA 1TPVA 1H60A 3MYOA 2Y70A 3HB9A 5I3HA 4QQ3A 5G4WA 4NXSA 1K02A 3NL2A 3SGUA 3VE7A 1G69A 2X16A 5IBXC 1XDMA 1OJXA 4OWGA 3DFQA 4UTWA 4AF0B 1L6YA 4Z1DA 3QW3A 2YPIA 2DZVA 3MI3A 2OX1A 5SWUA 2HS8A 3GDLA 4RZ6A 1GG0A 2DZUA 5LNVA 1EA0A 5FEXA 1W31A 1FWNA 5CZ0A 2TRSA 1SO4A 4UFHA 4YL2A 3NQVA 5C5YA 2C3ZA 1VH7A 4LRSA 1SR9A 4JDBA 2J9XA 3STFA 3IGXA 1ICQA 2E77A 5LHEA 4LWWA 1SSGA 3P61A 5AOUA 1BEUA 4JIPA 3TSDA 1KM0A 1QPRA 2YCEA 3I7QA 3G1XA 5D2VA 3O1NA 3LXAA 3GVGA 2GVJA 4LV4A 2C1HA 1K8YA 1JCYA 2QEZA 2DZPA 2V0TA 1F74A 4UMCA 4XUGA 1GVSA 1JQVA 2ZYFA 3W1AA 5HWMA 1KFCA 3BO9A 4P61A 3NEVA 1FWTA 5KINA 3GLCA 2CU0A 3W9ZA 1AMKA 3CWNA 2CFFA 2YYTA 3W1MA 1AW1A 2CZDA 4QITA 4DF2A 3NPUA 3NPVA 3NYZA 3QMRA 4O11A 3W73A 4IWWA 1TQXA 5C54A 4UMAA 5AYZA 1G4PA 3LV5A 4PH6A 1OFOA 4H3DA 3NL5A 2VC6A 3NQ7A 3FS2A 1EX5A 1KBIA 1YDNA 5K3VA 3L68A 2A6LA 1VZWA 2FPVA 4ONVA 1SW7A 4QNEA 2J6XA 2C13A 2D73A 4JX5A 2X1UA 4K37A 1YLVA 3TQ0A 2F84A 3C56A 1H7XA 3L0KA 1KLZA 3C8FA 1VS1A 4JTSA 3TMQA 3LRLA 4N2YA 2A85A 3KXQA 2FB3A 1F73A 1RD5A 3W7DA 1H7PA 4UTHA 1YTDA 3TXZA 1FCBA 2VENA 5F2IA 5HJLA 2ZRXA 4X2RA 2FTPA 3M44A 3QFEA 4LVGA 1DBTA 5FF7A 3L65A 2XFWA 1KTBA 4XTDA 2CZFA 2OZ0A 3P81A 1TTIA 1TREA 3MWAA 3NL6A 4DPQA 1QAPA 1P0NA 1LROA 1H1YA 5AN7A 4AHOA 1JUKA 4DXVA 3T40A 4TMCA 3GNNA 3O06A 3W7MA 5DCEA 1KM3A 5CZSA 1SUXA 3D0CA 1C9DA 4NJKA 3ZS4A 3G1YA 4OHQA 3O8AA 2AAMA 2JBMA 4WD0A 2X30A 5D2WA 4J9JA 5H2ZA 3DHFA 1SZEA 5D03A 4Y6GA 3LHUA 3W7GA 1ZENA 1R2TA 3G1VA 4O1AA 5IM51 4O54A 3UWUA 1I4NA 3PSVA 4K8EA 4MY8A 2CLEA 2CLOA 1M6JA 5HULA 3HG5A 2JKPA 1NFBA 5D05A 3P60A 1KFKA 2QCDA 2ZTJA 1U83A 1WOAA 3FJ6A 2H8ZA 1JR1A 1WA3A 1GVOA 5LNRA 1C8VA 3NG3A 3VNDA 3W3OA 5HUOA 1VLIA 2VFEA 3LTSA 2BWGA 3AJXA 3LLFA 3ATZA 2ZA2A 2CLKA 1LOSA 1ALDA 4R7JA 5C6MA 2NX1A 1LRQA 1A53A 2E6AA 5LZLA 3W2MA 4RZ5A 1D3GA 3NGJA 5GVJA 4WJEA 2Y62A 5ABTA 3UWWA 3NQGA 1OFAA 1OX4A 3G3DA 2Z2UA 5E1QA 5DXYA 1TYGA 1FX6A 4UTIA 3FIGA 3NQ8A 3LCXA 5G2IA 1YTEA 3UXDA 2ZRWA 3TIMA 2YDAA 3B0PA 4LS0A 4LS1A 5IBXA 1DHPA 2VOMA 3BG9A 1DVJA 1K8ZA 5DLCA 3U8GA 3W71A 1P1XA 4O1BA 1YDVA 2DZTA 1FDJA 3T55A 5D33A 3H55A 3NNTA 1G6CA 1ZFJA 1T8XA 3G8EA 3RF9A 4AHQA 3GX9A 3NZ1A 2RDWA 3EX2A 5HINA 3LTYA 1Q45A 3MHUA 3G1DA 4GXMA 3OVRA 3GXPA 4HSOA 1LTDA 1RR2A 3LBMA 6TIMA 1DL3A 4CCEA 4O19A 3B04A 5EKYA 1F7BA 4FIRA 4ZQPA 2R8WA 2RH9A 1CI1A 1X6UA 4IXHA 1L6SA 2PE4A 5I3GA 1YXDA 5KMYA 3G3MA 3P62A 3A21A 2BLEA 3O6CA 1NF7A 2V82A 5G1YA 1CW2A 1FY6A 4C1LA 7TIMA 4MPQA 4UTTA 3SY5A 1J2WA 4JR5A 2QUUA 1G7UA 4O17A 4Y8FA 1SSDA 3A23A 5BMXA 3HJZA 1EP3A 1R47A 3GNDA 3LHTA 3P5YA 2HMCA 3E0IA 1FCQA 3O6YX 2B7OA 3TSMA 4NJJA 2FB2A 3Q58A 1GG1A 3PUOA 3O15A 4XWUA 1FCUA 4RXGA 1R2RA 3QW4B 3BGJA 3BARA 1QDSA 3STGA 3VFLA 3W76A 1T0OA 5G1TA 3TX9A 1JRBA 5A8GA 1KA9F 5DY2A 3LRKA 3HQ1A 4CCCA 4HNUA 2BZNA 2VELA 4XTIA 3W1PA 1EIXA 3HIJA 1KM2A 1TB3A 2QF7A 3NPWA 1LRTA 2I14A 4O16A 4RLIA 1VC4A 4AAJA 5FEWA 4OE7A 4DO6A 3E9AA 3TSBA 4ZMGA 3E49A 2DJLA 1EWDA 4MOZA 2E5BA 4BR1A 4KFNA 3LCGA 4AVFA 8TIMA 1EWEA 3BG3A 1K7XA 1XDLA 3ZR4A 4Z0JA 2CLHA 1TRIA 2V5LA 4JTFA 3SFKA 4LUIA 4UNLA 3WK0A 3FLUA 1IIGA 3E12A 3TW6A 5G5IA 3EWBX 1EEPA 2LLEA 2NZLA 3M5XA 4O52A 4B5NA 1XI3A 1M7PA 3BLFA 4M19A 1B57A 4R33A 1A5BA 3EX3A 3MI2A 1A5CA 3KVMA 5LHFA 4R34A 5I3IA 2YW4A 3NVTA 3CHVA 3I65A 4OBTA 4IUOA 3LXCA 5AHEA 1NVMA 3W7IA 2V8ZA 2GJNA 3L5LA 3UZJA 1MO0A 4CQ8A 5KZMA 3S1VA 1GYNA 4JYFA 4WY0B 1GZGA 2XN1A 2CLFA 3W1LA 2ZRZA 4FB7A 3CWOX 4RV8A 3M5ZA 4Z1CA 3PR2A 3SI9A 2W0UA 2FIQA 4PEKA 4O10A 2RHGA 3IVUA 1UCWA 1TQJA 4MUZA 5MHBA 5D30A 3UD6A 3NOEA 1TPC1 1EB3A 4GRSA 1AW2A 1LP6A 3R13A 1HL2A 4NX0A 3TE9A 3M0ZA 2W79A 3C61A 3T4CA 5HR6A 3SECA 3CEPA 3UY7A 3VCRA 4FNRA 4MIMA 3ABSA 3TNOA 2Q8LA 5AYYA 2YXGA 2G95A 4LC8A 3W86A 4ALDA 4UFIA 1OX5A 4O4WA 3TFCA 2AGKA 2Y61A 2O7SA 3AO0A 2YGYA 3L0GA 2JGQA 3KRZA 1TO3A 3NPXA 3SJ3A 4JXCA 3BPWA 3GR7A 5E93A 2J88A 1VRDA 3GB6A 3N2MA 4EIVA 4RXFA 3V75A 3UY8A 1TPUA 1K8XA 3W1UA 4BFAA 3MO7A 1H63A 5DCDA 4O1CA 3B0UX 2E68A 3CIWA 3KRUA 3M41A 5LNWA 1EUAA 1SO5A 3R12A 2ZCGA 1QMLA 5H91A 3R2GA 4DPPA 2ZZ4A 4BWLA 2JGYA 4H4IA 1SZGA 4RX0A 4JYEA 3W1QA 2OT1A 1KW1A 4TU1A 4NT0A 3MP5A 4HPXA 2Y89A 4OV4A 1W5QA 2G97A 3KVJA 1AK5A 1W56A 4RCXA 1UUOA 3TAKA 1C29A 3L9CA 3MHFA 4UTJA 3MP4A 2JKAA 3G0SA 3PS7A 3IEBA 3S42A 2Y88A 2CLLA 2ISSA 3WJZA 3O63A 3G18A 3EX4A 3LRMA 3W2KA 3FA5A 3INPA 2Y7GA 3GR8A 1K3UA 1UUMA 2Q3RA 1W3IA 4UUIA 3Q37A 5CG7A 4ADSA 1GPWA 3RK8A 1ZNNA 1I2QA 1WBHA 3O6DA 3TQVA 3HO8A 3TQKA 1KTNA 1PE1A 1H1ZA 1A5AA 3W2UA 1S3HA 3VE9A 2R14A 2A4AA 4AB4A 1X1ZA 4DQWA 2DJXA 3M1ZA 1H7WA 5HNRA 1UASA 3MJYA 1SFJA 1XBYA 1KM1A 4GUJA 2RDUA 3OA3A 3OBKA 3P67A 3GDKA 3KHJA 1I2PA 3LV6A 2QR6A 2QCGA 3S8HA 5F1VA 1GVQA 1X7FA 4DBDA 3LX9A 2A21A 4FNPA 4HNNA 5BOOA 4Y9AA 3P82A 3MP3A 4MJZA 1N7KA 4XKYB 3LTPA 4K36A 5FF2A 1F6KA 4EF9A 5F1UA 4YXGA 3S5NA 4JY9A 3TK7A 4UTLA 3P7YA 2FDSA 3FFSA 1B3OA 3WFAA 2V30A 5LSMA 2VEIA 1N8FA 1XC4A 4IXXA 4CCDA 4S2BA 5K4ZA 1VYSX 3IV3A 3QRHA 5KITA 3QPYA 4XBSA 4NVTA 1H51A 1VPXA 4WY0F 4BI7A 3NZRA 4MFDA 2V5BA 4Y90A 4FIQA 3LM7A 3HPSA 3BW2A 2YW3A 1NEYA 2QAPA 3TCEA 3LCHA 3BG5A 3EWXA 4FEZA 3KFTA 1BKSA 4UIOA 3S6DA 1H5YA 1LDCA 1F6PA 2WNQA 3ABOA 4AWUA 3EB2A 3EXTA 1VLWA 3UWYA 5EMUA 2B7NA 1DORA 1PHQA 4PC8A 3HGSA 4KFOA 1FQ0A 3G1HA 3NQFA 5AFDA 3E96A 4JTUA 4UXDA 3PG9A 1QPOA 4JICA 4AH7A 1G4EA 2ISVA 3S9YA 3S5OA 2P0OA 4PODA 4NU7A 3NQ2A 2BXVA 4GWEA 3W74A 3GAKA 1I2OA 1QOQA 1TCDA 2EAWA 4MY9A 2H6RA 2WNNA 3LERA 1HO1A 3N3MA 1G7VA 4K8HA 3DHDA 1XUUA 2G96A 1XM3A 2ZA1A 3LHVA 5D38A 1MSSA 1AG1O 2ZBTA 2P10A 2OMAA 3K30A 4GUHA 4JX4A 2NXGA 2JKEA 3RNDA 2HTMA 5AHIA 1TPDA 2Q8ZA 4RR4A 5AYXA 4TX9A 1XUZA 2CZEA 4UCGA 3EKZA 3IIOA 4UTUA 2C19A 1VCFA 3N9RA 1E51A 3BVJA 4M6PA 3LHZA 3L21A 2R91A 3BGGA 4DF0A 4Q33A 1AL7A 3NO5A 2GJLA 3ABQA 4NNAA 1X8FA 3VKJA 1KM4A 1MEWA 1YADA 1FDYA 3SIZA 3IIZA 1XXXA 4JS3A 5K4XA 1TSIA 4UTMA 1OHLA 3ABRA 4WXZA 1YDOA 2E6FA 2FFCA 3TJLA 3W1RA 2ZRUA 1H7OA 5G4EA 3A24A 2NX3A 3G0XA 3HGOA 4JY8A 3E02A 3M47A 4IPIA 4A22A 4HKPA 3QMSA 4WOQA 1OYAA 4JEQA 1KFEA 4LY8A 4EF8A 3DI0A 3CC1A 2V81A 1W3NA 3OVPA 4BF9A 3QF0A 2WV8A 3PAJA 1K7FA 4JDYA 5DBTA 4LW7A 4O1DA 4FX6M 1B4EA 3DAQA 2WQPA 3HG3A 3DKJA 1FCVA 4IJBA 3W7PA 5AHNA 4JTHA 1G67A 4FX8A
chains in the Genus database with same CATH superfamily
5DQPA 3ZR5A 4MJ2A 1H4PA 3CV6A 3OIXA 2GUBA 3M5VA 2WC7A 3CMJA 1KBLA 2G8ZA 3VIOA 2BBFA 3MKKA 1HJUA 2GYIA 3ATYA 3KX6A 4RZ4A 3LYEA 3NO3A 5D2TA 2OX4A 1JRCA 1FWSA 1EP1A 4RL3A 1IWBA 2VGIA 3WF1A 4Q22A 3VD4A 3PZNA 3CQIA 3LGGA 3OYZA 1B4KA 4CNSA 3W70A 4LUSB 3W7NA 3WQWA 2WMKA 3K46A 3CK5A 2O9OA 2Y5EA 3WQVA 5CC6A 4QLJA 4UTFA 3H2FA 1J0JA 4I9TA 4J3SA 3TR2A 5A6BA 2ZA3A 3TP4A 3FYOA 5CPLA 4J2PA 2YLLA 3NYDA 4I7VA 1EC9A 3EWDA 1XBVA 4OQVA 1JJKA 1G0CA 4JL2A 4CD5A 3THQA 5H8MA 4UR7A 1Q85A 2A2IA 4JTLA 1EXBA 2BOGX 1WBJA 5ABGA 2BASA 3U4FA 2HXUA 3TC6A 1NWRA 1SFTA 2XN2A 4B3LA 3WF3A 3I10A 1MZRA 2VT0A 1W5MA 4XSLA 1IT7A 1SJDA 4UTWC 2XG9A 4J4KA 3I3BA 3AS2A 5F4WA 3EWCA 4MYXA 4D6IA 1T96A 1JAEA 1SFLA 4GNVA 1TWZA 2UY4A 3WNMA 2VTFA 3C2VA 3WJXA 2HSAA 3GVRA 4J3XA 2OEJA 4FALA 3FEMA 1LLWA 2O7QA 2ZRYA 1H0IA 4LT9A 1YYAA 4ZQNA 1GW1A 2VC5A 1AZ2A 4A05A 3NQCA 3WQ5A 4HU3A 1GTEA 4ZB0A 1WUFA 4MNMA 3CMGA 3KHDA 3AZRA 1RQEA 3HF3A 4W8AA 5C7HA 4JTJA 4QJ5B 1TJRA 1R3VA 1A4LA 1D8CA 1Z44A 4C6QA 4LUYA 4F0LA 4X61A 4ORMA 4AG0A 1GUVA 4WY0A 1B9BA 1PCKA 2FLIA 4PRWA 3RILA 4DWSA 2EQDA 2BFGA 2Y7DA 3LI1A 1XLEA 4ZQMA 1G1YA 2WCAA 3C5QA 2E28A 5CGQA 3WY1A 5F4SA 4JTCA 4A21A 5FI8A 1R30A 4WDUA 1FWEC 1XIJA 5IHSA 4DM2A 5AZ0A 1Q4WA 1PDZA 3GK0A 3SN1A 1CXFA 3NQAA 2FHBA 3DX5A 4ENLA 1CZ1A 3NAVA 4PUKA 1R9YA 2WW5A 4BI6A 3LLXA 3P5ZA 2X1IA 3AFBA 3WLRA 3SY1A 4U2ZA 3EB4A 1TPH1 1LL4A 5JIPA 1UPMB 1OK4A 4CNTA 3W6LA 3WIJA 3AUJA 1MNSA 4GZEA 1O66A 2IMRA 5EY5A 5HANA 5BYWA 1YXCA 2CBVA 2QCFA 3VD5A 3GO2A 4UQAA 2FZ8A 4UFLA 4NZ1A 4NRRA 4DUVA 3QQWA 1NP2A 4H2CA 4LANA 4GFSA 2Q01A 2VFDA 2G41A 1WPCA 1YPXA 1CNVA 3SEPA 2GSEA 1PIGA 1OFEA 3MMDA 3NL3A 2OGYA 3GSMA 2Q8XA 1VHNA 3DI1A 1U5JA 3WQ4A 1VEMA 4BHYA 4L1WA 5HOSA 3QR3A 1X97A 3QSRA 3GAYA 2PDPA 3P3BA 3WG6A 2XWDA 2HK0A 3BSGA 3NSMA 4MZ1A 4D6FA 1SGJA 1TFVA 1RQBA 4PSPA 4C90A 2YBUA 2FTYA 1XLGA 4CD8A 1HX0A 5J5RA 3S5YA 4LVDA 1ZHAA 1R2SA 1HN1A 4OFCA 3IK4A 4KIRA 4IMGA 1RXOB 5GQBA 1ZAJA 4CD7A 4IQLA 3Q94A 3WDQA 1OCNA 3BW4A 3W37A 1UOKA 3B0XA 3DFOA 2WHKA 4PUDA 3ZJ7A 3ZWSA 4UNKA 2A7NA 5ABHA 2EGZA 5KTLA 5EFFA 4WGXA 2CW6A 4XD6A 2IW0A 3A4WA 4WK9A 3WH5A 5FJUA 4E8GA 2QCDB 1W9PA 3WNLA 3OGSA 4IG2B 3MC5A 4NF7A 3AC0A 2F61A 5CSRA 5CZJA 3QPEA 2VEKA 1EFZA 1K03A 1BLIA 3RMJA 5C2XA 4BS0A 3HA1A 4GI6A 1IYXA 1ZY9A 4ICNA 3EEZA 4S2CA 3F4CA 1KKOA 5D2XA 3EAUA 3CHEA 3WH6A 2GJXB 2D23A 1HVQA 2VEPA 1NWSA 4GY1A 3NM3A 3EBVA 2PUZA 1VHCA 5I3FA 1JCMP 2X42A 2DUAA 1K8CA 2X2YA 4DWSC 2G3FA 4LBRA 4FF5A 1BD0A 1EIBA 3RCMA 1Y8BA 3UEQA 3GYEA 5LNSA 1ZP4A 4ZL1A 4R85A 1UC4A 3GW0A 1C93A 2XN0A 2QDDA 4B2DD 1TJPA 5AY7A 5CCZA 3APTA 3IV8A 4ZXOA 4F2TA 4QFUA 3N2XA 2BTMA 2VO5A 5DEZA 2QJGA 3F2DA 4CVWA 2HNHA 3R8RA 2PDGA 4XX6A 1D7KA 2YOCA 5L9FA 1XFCA 1X1OA 2Y5SA 3P74A 3UESA 4IGSA 3FAWA 2VZVA 1HO4A 1KV5A 3W2JA 1UD6A 4N6FA 2XIQA 4NI8A 1ZLPA 1PWLA 2HVOA 3P84A 1ZAIA 4A8IA 1XCFA 4F0HA 1Q6RA 2G3NA 5KEZA 4FR1A 3TC7A 4RNHA 4U33A 3LM3A 1M7JA 3GYCA 4MVAA 2B4GA 1E4NA 2AQWA 3URQA 3WUEA 4MTVA 1XYAA 4MWAB 2DSVA 2NWRA 1Z42A 2AMGA 4MYAA 1VQTA 5LA1A 3L2IA 2GVGA 4O1FA 2Q3OA 2QDHA 3CZEA 3STPA 3SO7A 1UWRA 5CJNA 4W7UA 3GZAA 5FAJA 3S1UA 5CPNA 2VGBA 4DJDC 1VPQA 4UFKA 3TH6A 4LVBA 1Z89A 3GIYA 1NH6A 4K39A 1UIOA 4URIA 2GGJA 5BZAA 3T2PA 1XIFA 3IWPA 1PL9A 2PDFA 1VCVA 3GKAA 1TE6A 2VZUA 1BQCA 5KZEA 3QQ1A 2ALDA 5IRPA 1GOOA 1IEIA 4JIRA 1K4HA 1ZJIA 2PGWA 3BMWA 1SJBA 1YE6A 7CGTA 1W3JA 1OC5A 2WKLA 1TWIA 3FVDA 1X1NA 2BVWA 4MZ8A 3AMGA 3BLKA 3EXRA 1RCOB 4C6PA 5C8BB 1OGBA 2BG5A 1UR2A 1V0LA 1VFSA 3UR8A 3WFZA 5A6KA 3B8DA 3ELFA 1WYIA 4FLQA 3SGZA 5JH1A 4O14A 1BYBA 3CUGA 1UD2A 3WK1A 4P8VA 4MB5A 4M0XA 3RPMA 2ZUSA 1GVFA 4D6DA 3LOTA 2DT3A 1LUCB 3DFYA 5K2ZA 3S2JA 1IHIA 3W4RA 1E0TA 1OVDA 4TTGA 2YR1A 1B5TA 2ASHA 4J3TA 2H3BA 3QZ6A 5AB3A 1YNQA 1NIUA 1Q7ZA 3F4NA 4A3UA 1U33A 5DY3A 2UZ9A 3ZM8A 3AWOA 1VB9A 3KLKA 3B8WA 3A4XA 1WDWA 1J6PA 4K1GA 2X1RA 2WSQA 1Q65A 2I9UA 1O1ZA 1TPEA 1WZKA 1A3WA 3RX3A 1DOSA 2WSYA 3W7EA 1GJPA 1FFRA 1EJXC 4LEQA 2YJQA 4FOJA 3W85A 2V2DA 3EWZA 4JGDA 4IX0A 4H6EA 1K7EA 3A3HA 1FH9A 1ZSXA 2VVNA 2POTA 1PEZA 4NZFA 1J93A 3QTPA 2DEPA 1QNRA 3L67A 1G4TA 3TCSA 1MRQA 2QIIA 4MFEA 3XIMA 3VNYA 1TPB1 2CZVA 1FWDC 4HCDA 1THFD 3BAXA 4L64A 5JVLA 1RD6A 5A6TC 1QI2A 4YTRA 2KZHA 4KWUA 1WDDA 2G5WA 2RGLA 4QQUA 1UQYA 1AJZA 3RLUA 5ABEA 3PUDA 2YDQA 2WMIB 4M6QA 3LHYA 2VGFA 2DW7A 1NP0A 1LM1A 3MSDA 5IDZA 2X2GA 5IDIA 2J7EA 2NUYA 4ERGA 1FHLA 2WZIA 3LS9A 1Q6QA 2J8FA 5K9CA 1PX8A 1ODZA 1P48A 1S5MA 1AD1A 5EYWA 1CLKA 4TV6A 1KM5A 1NAL1 1GZ1A 1LWIA 1CXIA 3THDA 5E0FA 1UR4A 1OG0A 4GI4A 1PUDA 4AEEA 2X1TA 1RSCA 3KEHA 3S1XA 3WQDA 2NUWA 3PWIA 4EVZA 4QJ4B 1MYRA 2PD9A 1S5TA 1S2WA 4EK7A 3IAPA 3IRDA 4JNMA 4I7UA 5LGXA 1NDVA 4N9EA 4K7VA 2BY0A 1KGXA 1A49A 2DQXA 3A5VA 1YBQB 4GINA 3CLWA 2AGTA 1QPKA 4K3ZA 3I7SA 3PJWA 2AL1A 4G2DA 4FNSA 3WQPA 3PM6A 4OZOA 3V7PA 1UZ4A 1X6LA 5JU6A 1RVGA 3S1WA 4DO4A 3PUGA 2OJPA 3HMCA 2OKOA 1P5BA 4QG8A 1W3HA 4H6KA 3LNPA 4IMDA 4GI8A 1UWUA 2RFGA 4AD1A 2YDRA 2ZDRA 3V16A 3BJTA 3DENA 1UP2A 4XG1A 3V1PA 2XIJA 4FNQA 3AMKA 3ANUA 2POZA 3DFNA 2C79A 4M6VA 4LJ3A 2Z1WA 1L2UA 3YPIA 1ISVA 2I7GA 4N6EA 4CU6A 3CV7A 2QDEA 3MSGA 1YDYA 3BH4A 2QHAA 2VEGA 3JRKA 3C8NA 2Z0IA 1QNVA 1JDEA 2W9MA 1ZTVA 1XL9A 4U4MA 4DUXA 2PD5A 1V08A 2DVUA 3MY9A 5G2WA 3U6WA 4EACA 2V5DA 1IXNA 2Y5JA 3LLDA 1D3HA 1M53A 3HPZA 1LORA 1PZ1A 3N6JA 2R94A 3LHWA 4GBDA 2D2HA 1XYBA 1BXBA 3KVLA 2BVYA 3T0CA 3T9PA 3S5ZA 4C5ZA 1L0PA 4JTRA 1XP3A 4MB1A 3UWVA 4O12A 4AZ5A 1W1TA 5GNXA 1VEOA 3NM1A 3QZAA 4FHAA 1A5NC 4XQ6A 3S46A 4OKDA 2VM8A 4ZODA 4Z1BA 3PJUA 1RCXB 1BYAA 1PCWA 2Z28A 5IOBA 3DC0A 3MU7A 3DECA 3MV11 2I16A 3CUZA 4G7EB 3T0DA 1TRDA 2E5CA 4KCWA 1NJJA 1EJVC 3PHAA 1Z41A 4UFJA 1G01A 1W3TA 4Q8MA 4ZSUA 4JTEA 4S3JA 1JF6A 2WLYA 5FEPA 4HNOA 3BZGA 4X3ZA 1VAHA 1FDZA 5FA5A 1TV4A 4EXAA 1TV5A 3C0JA 2GUUA 4RDVA 4MY1A 2PDCA 4JAWA 3B0VC 2VWTA 1WXZA 4QDWA 1WOBA 2SFPA 2DDXA 5CXPA 3R11A 2WO5A 1TPWA 4MB3A 3EX1A 4HSNA 2YZ5A 2PA6A 1ESWA 3BGAA 3LXBA 3ALGA 3UCQA 1GOIA 4DYJA 5HA7A 2YL8A 4HA4A 3NQBA 2CLPA 1K02A 4EXBA 3VE7A 2Z25A 4UTWA 4AC1X 2YPIA 3V5FA 3FW6A 4W88A 5SWUA 5EMJA 2HS8A 3NIYA 5JMUA 1GG0A 2DZUA 4OBSA 2J47A 4JNZA 2INFA 4KT2A 4UFHA 2YXOA 4IQEA 2IXVA 4Q7IA 3BCFA 2WM1A 3HQPA 4H9MA 1ADSA 1JFXA 3P0XA 3DOPA 1E9YB 3P61A 4JIPA 1WZLA 3TSDA 1QPRA 2VQUA 1E9ZB 1OT1A 4AIBA 1JCYA 4Q4OA 2FZNA 2GJRA 2P53A 3NEVA 2CU0A 1AMKA 3ONCA 3CWNA 3GBEA 2YYTA 4HMEA 1AW1A 2CZDA 3ARRA 4W8BA 1QBAA 3WMLA 3KBSA 3RLGA 4BF7A 4D9PA 3NPVA 4JQAA 4D6GA 4AFYA 4GGHA 1E9IA 1NY1A 3BOFA 1TQXA 2FHFA 4GMEA 1XLHA 5C2GA 4G8TA 1OZQA 1JPHA 3FS2A 1P6WA 1XLIA 5K3VA 4DI8A 3DC8A 4HHHA 4KCUA 4ICCX 4XAFA 1HGWA 4N0RA 2J6XA 3SY8A 1YLVA 4WRHA 1YRRA 3UG5A 3LD5A 1R0MA 2NVAA 3FDGA 4JTSA 3GNPA 3R0KA 4E8DA 4GYFA 1CDGA 3UR7A 2I5GA 4G56A 2FB3A 3W7DA 1EPVA 1H7PA 1T6MA 4PTXA 3VDAA 2WK2A 3V0SA 4JKMA 4NYYA 3RGTA 2F38A 5BXTA 2GK1B 2F2HA 1UQZA 5EMMA 3O6AA 1WAWA 4RPQA 4Q4PA 4X2RA 2FTPA 1OC6A 4REQA 3RX2A 3TTSA 2OWWA 4PMVA 2UBPC 2OZ0A 2V6AA 1PTGA 1B3VA 1JAKA 3W82A 4DPQA 1QAPA 5BU9A 3MUIA 4AHOA 2J7FA 1VFUA 2UWFA 3MPGA 3D0CA 3QHOA 3TYUA 2V5CA 4NJKA 1O7AA 2BXYA 2I17A 3OU8A 4DUOA 5JBDA 1L6GA 1QJWA 4J9JA 1XIGA 5H2ZA 3W7GA 1UD5A 5I2UA 3DYMA 3EYPA 3AIEA 3UWUA 3PP7A 2QPSA 3PSVA 3SUUA 1BG9A 1CXKA 3RG6A 1GNXA 8RUCA 4H7CA 4GK8A 2JKPA 1NFBA 3PPGA 3BUVA 4EPDC 2Z26A 3LPPA 2XDFA 1W1YA 4C60A 3SUSA 1UR9A 5LIYX 2F6KA 2VR5A 2ZA2A 3RR4A 1LOSA 1RK6A 2AKZA 4R7JA 5C6MA 5BU6A 2NX1A 1LRQA 1HF6A 4RZ5A 1JEZA 1ZBKA 3NGJA 5ABTA 3UWWA 3NQGA 3UGRA 3BICA 3G3DA 1D2KA 1Q2RA 2QJNA 3U2ZA 4UTIA 1LQAA 3G6LA 3LCXA 4Q8PA 4XK2A 5G2IA 3CQJA 4LS1A 4BQ5A 2INZA 1VBGA 1DHPA 3PNUA 2G0WA 1VFTA 2YB1A 3RXZA 3W71A 4ATWA 4R9XA 3RLHA 1AH4A 3H55A 1T8XA 3G8EA 4MWAD 3GX9A 3NZ1A 4Z42C 6REQA 5CBJA 2QJJA 1Q45A 3G1DA 1UR8A 2Q02A 3CUXA 9RUBA 1DL3A 3CZGA 3WBYA 4O19A 2PDIA 1F7BA 2CC0A 4FIRA 4WKFA 2R8WA 4IP5A 4GIRA 1QW8A 3VO0A 1CTNA 4GFIA 4PMJA 4FS9A 5I3GA 5GNZA 1YXDA 3G3MA 3P62A 5CLTA 4AVNA 3S2CA 1QI3A 3O6CA 3A6OA 4E3VA 5LXXA 1CW2A 1FY6A 2ZVIA 2HK1A 2OLSA 4EE9A 1S2TA 1XIHA 1OADA 4Z2GA 4LCRA 1J2WA 2O4QA 3DG3A 2QUUA 1EHAA 1RLDA 2VUNA 2REQA 3HJZA 1R47A 4S38A 1FCQA 4JEJA 1NOUA 5HATA 1A3XA 4XWUA 3O15A 5JXQA 2WVVB 3QW4B 3MT1A 3W76A 3QV6A 5G4HC 4QG6A 2W5FA 3TX9A 1KA9F 1U22A 1T8QA 3LRKA 3HQ1A 2BZNA 2YCJA 4F2UA 4HNCA 3VNLA 4HVXA 1TB3A 2VRQA 2CIPA 3U4AA 4KCTA 4GY0A 4MDPA 1LRTA 3WEMA 4HK6A 3RM9A 1RUSA 2VEFA 4IG2A 4M6UA 1W9XA 4IM4A 2JQXA 3RHGA 4QR6A 4AVFA 2XSBA 8TIMA 2WJEA 3UJEA 3N13A 3BG3A 5A2CA 3ZR4A 4Z0JA 2CLHA 4RV3A 1Q13A 3AMLA 4UNLA 3WK0A 3UU0A 4DX3A 3FLUA 1O1HA 3TW6A 2E0PA 3KBJA 3ZJKA 3M5XA 1XI3A 4D72A 1M7PA 4F79A 4J7RA 4M19A 3UYIA 3VILA 2BHUA 1A5BA 1DPMA 3EX3A 3CASA 3KVMA 5LHFA 3NVTA 3N2BA 4IUOA 3VMPA 1NVMA 2V8ZA 4XIMA 3L23A 3ZIZA 3L5LA 3UZJA 3AS1A 2R1MA 3MDWA 1C8XA 1KWKA 3S1VA 4JYFA 3REQB 4QCEA 4WY0B 3W1LA 4AQLA 3M5ZA 3PR2A 2FIQA 3UZZA 4AX6A 2RHGA 3IVUA 4OTKA 4WIWA 1HKMA 5MHBA 2IXUA 3UD6A 3NOEA 3C0QA 1KXQA 3K1DA 1LP6A 3N2OA 1HL2A 5I02A 2E4TA 4HU8A 1XC6A 5A8MA 3WN6A 1JCTA 3G6MA 3UY7A 3AAMA 3VCRA 5A2BA 1S2VA 3SCPA 2QYGA 4MIMA 2YXGA 4O4WA 2PTDA 2Y61A 3POCA 3Q67A 2QULA 3R6IA 4DAFA 4PB4A 2WJDA 3KL3A 3GR7A 1EGZA 2VWSA 1VRDA 4DM1A 4EIVA 1TPUA 3H2NA 3MO7A 5DCDA 4DJEC 3REQA 4AIOA 5LNWA 1EUAA 2DSWA 3M07A 2IS7A 5H91A 4GO8A 2E67A 4HZMA 2JGYA 1A0DA 3W1QA 1SYTA 2ZXBA 5A8OA 1GYMA 2Y89A 4EPKA 1D8WA 2G97A 4WSJA 3KVJA 1D3CA 1OQFA 1W56A 4RCXA 1TMLA 4ZO8A 3V5CA 3MP4A 3BJSA 5I6SA 3PS7A 1EH9A 2Y88A 5EU9A 3G18A 2DZAA 5A6MA 1X98A 5EFDA 2ONEA 5LXEA 1L8PA 1ONWA 4RPPA 3VOFA 2MUCA 2P3ZA 3EDJA 1K3UA 4TQTA 1XQLA 1I1WA 3RK8A 3AYRA 5CC5A 3H8AA 1I2QA 3HO8A 3JVAA 2OZTA 1PE1A 1A5AA 3W2UA 3PTKA 4AB4A 3B9DA 4DQWA 1W9VA 2OLAA 2OVLA 4B92A 1UASA 4XZHA 1A5UA 1SFJA 1PYMA 1UMYA 1KM1A 3BL3A 1R85A 1OC7A 3EMZA 1I2PA 1E0XA 2Z27A 3DEQA 1L8NA 4PN2A 3DCPA 3CT2A 5A1AA 3S8HA 1MQQA 4W5ZA 1GVQA 4XO6A 1J6OA 4IIGA 2D20A 3QLLA 4FNPA 8CGTA 5JBFA 4M1RA 5BOOA 4Y9AA 3P82A 2YL9A 1XJBA 4YTTA 1YBQA 3LTPA 5FF2A 3F5JA 3OLIA 1F6KA 3KRBA 2E9BA 4HHMA 1DJXA 4PULA 1B2YA 1T40A 7REQB 2XUCA 4UTLA 1FTXA 3BTNA 3OIHA 2PGFA 3PTQA 3WFAA 2V30A 1GOQA 4XD5A 1E56A 1DWGM 3GXIA 4PUJA 2G50A 4PTDA 1X8CA 3DBNA 4M80A 1VYSX 3IV3A 3M0HA 3K4DA 3EOUA 3VTRA 5A8NA 4XBSA 3MUY1 5HQMA 2XGIA 3WL0A 4NVTA 1H51A 1EJTC 3LSCA 1V0KA 3QKZA 4D1JA 4AXNA 3DHPA 4MFDA 2HXTA 4QEEA 4UQCA 1R3RA 3HPSA 3BW2A 4JN7A 4QCFA 2YW3A 4CQCA 3N18A 1NEYA 3LCHA 3EWXA 3KFTA 4FXFA 1RALA 3IUIA 4AD4A 1UD3A 2C7FA 3UCDA 3EXTA 1VLWA 3LQLA 3UWYA 2B7NA 4PC8A 1FQ0A 2WWCA 5FJRA 4PMUA 1JPKA 4AH7A 5AZ1A 1G4EA 3ARSA 3HQOA 3S5OA 2Y8KA 2PWDA 2XISA 3WUFA 3TEVA 3LN3A 1PKMA 2VDIA 1Y5VA 3AXIA 4UOJA 1DXFA 3CL8A 3JU2A 2FVKA 2H6RA 1QNPA 1CEOA 5A94A 3FJNA 1XINA 4H8UA 3UXLA 2FGZA 2XZ9A 3RNDA 1PIFA 4PUNA 3V4BA 1XUZA 2CZEA 2V68A 4UTUA 3LBOA 2R91A 4DBSA 4Q33A 1QWKA 3TOPA 3ABQA 4NNAA 1X8FA 3VKJA 4CVUA 1KM4A 2ZKMX 1CLXA 3M7SA 2CKSA 1MEWA 1YADA 3BMVA 1FDYA 4R9OA 1FWHC 3JZUA 2WXDM 1YMYA 2WM0A 2V38A 5I7GA 4P8WA 2E6FA 2AAAA 3AIWA 4IL2A 3SB0A 5ECVA 3UFYA 3N29A 3IJLA 3A64A 2PGEA 3UR5A 4AX7A 4C6LA 1VFFA 1XRSA 1HVXA 3AICA 1BKHA 4JEQA 1KFEA 3COTA 3DI0A 5AVNA 4YJ5A 2C1GA 2R1NA 2V81A 4K2SA 1V6VA 1HQTA 3T8LA 1K7FA 3T0BA 1PPIA 1J0ZA 1ZCCA 3DAQA 4GH1A 4TX8A 1M1BA 1J0HA 1FCVA 3N4FA 2YCLA 5FJIA 3E2VA 4H9XA 2HV5A 5DF0A 3F2CA 1O60A 3UW6A 3RO6A 5AHMA 3ONBA 1E5JA 2ZZ7A 2Y63A 3C0SA 2OYLA 4WOZA 4LALA 3F5KA 5EBUA 5CBIA 1UB3A 1QO2A 3UXIA 1X96A 3UWQA 4CNOA 4Q4QA 1G94A 4JNYA 3I68A 2YYUA 3QR1A 2ZZ1A 2OOFA 4M8UA 3W81A 3B4UA 3P0WA 2CXGA 1DWHM 2NQZA 2BXZA 3SR7A 2A7RA 1DJWA 6CGTA 1GQIA 1EF2A 1ZALA 3CQ0A 3U2OA 4XD4A 2GVYA 1V77A 3QZEA 1D9EA 1UW9A 4WJXA 3GXTA 3TYEA 1OCQA 1DKWA 3TDFA 4NYUA 5HR7A 3C2FA 4ZVJA 4D6CA 3U3HA 1AA1B 1UZHA 2XU2A 2ZRVA 3IIPA 1I45A 3WH8A 3W6MA 3RJYA 4WSHA 5FEZA 2BODX 1JD7A 5KZ6A 2KX9A 3RO8A 3U7VA 1UH4A 1KFBA 1UROA 2FJKA 2EG8A 3PC0A 3W7LA 3BV4A 5EPDA 1FWJC 2ZE3A 3LK6A 3R0UA 3SFWA 3UWEA 1W1ZA 3IIVA 3FYPA 1UKOA 4Y9NA 4DVOA 2BS9A 4PMDA 1MFUA 1YW1A 1W2VA 3LPGA 2FHCA 2VZSA 3XISA 3FXGA 2GQ8A 4LUJA 3PTDA 4H83A 3C2YA 1ADDA 1V3HA 1B54A 1HKIA 4FMVA 4CKQA 1QFEA 4X9YA 4G7FA 4HZ7A 4NUWA 1ODUA 4LQ1A 4ZB5A 4RZBA 3CNYA 3EOOA 3HN3A 1GEHA 4LAZA 3DFTA 1XIDA 4JTTA 2RAGA 5IHRA 2GK1A 2YZRA 4DLMA 3IGUA 3SCWA 4FX7A 5I0DA 2IQTA 2E9MA 2PS2A 1K9TA 5FSEC 3CZ8A 1KD0A 1JL8A 4NJIA 1WAUA 4O57A 4Y9PA 4YLWA 3MZNA 5IXEA 1Q3NA 3MKVA 4XB3A 5EMKA 4DBEA 4ZTYA 3NSNA 3VNKA 3QQ0A 3GTHA 3PAOA 4BA0A 3TKFA 3N34A 4YU1A 5BXRA 2QCCA 3VVGA 3LEPA 1ZU8A 2UV8G 1SO3A 4PB3A 3OVGA 4FNUA 3VKBA 1LL6A 4FXRA 1A5SA 3W2LA 1BSIA 4NNCA 2H3DA 4E4FA 3QVQA 3W72A 4UQBA 2Z1SA 3NZGA 4IPNB 3C2RA 2G3IA 4PEEA 1H0GA 3V1HA 4IMEA 2GOUA 4CUCA 2ABAA 1W9UA 2OTDA 2A3EA 4JHZA 3R10A 5A3HA 4DEFA 5REQB 3GDBA 5EMYA 1JG9A 1UPPA 4GNJA 5CH9A 4GE8A 4P8UA 4GX9A 2W66A 4NNBA 2DVTA 3CT7A 1P6CA 1OFQA 3PZ9A 3M9YA 3SQSA 4ZQCA 4NZ3A 1TJ2A 5H8UA 5I5RA 1HTIA 1Q6OA 1GK8A 1TTQA 2CBUA 2PURA 2A79A 3UZ5A 1TV7A 1BYDA 1LCOA 5CLWA 2QPUA 3AU6A 1ZS2A 3BW3A 2DP3A 4XO7A 1EUNA 2CZ5A 3WDPP 4GC4A 3BV7A 1F4AA 2WNZA 2NLIA 3K4AA 4BEQA 1XX1A 2QMJA 3SCQA 3WO8A 3E0VA 2QJMA 2Z1VA 3B03A 4ZQRA 3VNIA 3LU2A 3VFCA 3FVMA 3S9ZA 5GJNA 3OB8A 1GOMA 3O7UA 3VZYA 1P0KA 3DYPA 4HCLA 1XIBA 3FKKA 3FHAA 2BDQA 1A0EA 4G1KA 4MJ4A 3WDIA 1IWAA 4BQ3A 2NWSA 1OYCA 3ZVIA 4WQ6A 2WJFA 1TZ9A 2V67A 4GJ1A 3V5OA 1VBUA 2PF0A 4KCVA 3G5EA 1FP9A 4NKCA 1KV8A 4I5RA 4QDPA 4P2VA 2X7WA 1F9CA 4JCLA 4D8AA 1WX0A 1UD4A 2XFFA 2OWCA 3HU7A 4CN1A 1UKTA 1ADOA 1VPYA 2OEMA 3CZKA 2WC3A 4B5VA 2VX6A 4MJMA 3QJAA 2WOQA 1E3ZA 4UZSA 1VFHA 2J7CA 4IGMA 3DXIA 3ZVHA 1V6TA 2WC4A 2W6RA 2X7VA 5DRIA 4ATLA 2E25A 5TQLA 3WELA 3G24A 4PCSA 3CO4A 2EPHA 3G77A 3B8IA 2IKGA 1F2JA 1S39A 5AC7A 1I2NA 3L0NA 3S3GA 1W37A 3GC5A 2CKRA 1YTKA 3DG7A 1ITUA 3UG3A 4OU1A 1TTPA 1Q66A 2YSWA 5AC4A 2BY3A 1H1NA 4EANA 1POJA 2PC4A 1CXHA 1XGEA 5TBOA 3Q2DA 3L2LA 2DZWA 4M24A 3CL7A 5H1WA 3QPZA 3D6NA 1HKKA 3H7UA 4GKTA 1SW0A 4Q8NA 3ENLA 1R3SA 4F4RA 3AQUA 5FKYA 1M7OA 3CU2A 1XW8A 5BWAA 4LSBA 3LCIA 1QW7A 4F48A 1EXPA 3M5YA 5DN1A 1C9WA 4LCSA 3WBEA 1WV2A 4RK8A 1CPUA 3HPAA 2B7QA 4WHBA 4X22A 1V5XA 1TV8A 1XISA 4S23A 2ZZ5A 2PZNA 1EL3A 3BAIA 1WDSA 2IUZA 3MKCA 5DMYA 1RZMA 5BMWA 5HQLA 2H8XA 4H9VA 4GQ0A 2NXIA 4MZYA 1UJPA 2VURA 4V33A 1PHWA 4O13A 1XH1A 4FP1A 3C52A 3IGHX 3WD1A 4HMNA 1AQFA 5HNNA 3EOEA 3M0VA 1OX4B 2H90A 1PZ2A 1Z48A 5BXPA 3ZVHB 3OGRA 1MI3A 4KGLA 3Q45A 2ACSA 5A6AA 1W5NA 4Y9OA 1XS2A 3KZSA 3LNMA 3MSYA 2A1YA 4XAGA 5D9OA 2OU4A 3NQMA 4E8CA 2XM2A 3HJEA 2P3EA 3OZMA 2FZBA 4FNTA 1V3IA 3B9OA 1VP5A 3BQ5A 1KBJA 3K8KA 3W38A 3B8SA 2ZZ6A 2QPXA 5CKSA 3CLMA 5C9UA 3A22A 5HWJA 2V3GA 4B4HA 2H9AB 1H7RA 4OUIA 3T07A 1P6BA 2AQOA 2IQDA 3AJ7A 2X1SA 3S6OA 1H62A 2VD9A 3VGFA 4ZOCA 1FXQA 2ZWYA 4JYDA 2G3MA 4K7YA 4ERAA 3G1FA 2W61A 4NL1A 1TPFA 3E0LA 3L7RA 1ICPA 5EGRA 2ABBA 5A5WA 2Y6ZA 1LBFA 2QVNA 2F8QA 3PG8A 5I78A 1LG2A 1BTMA 4LS2A 2BMBA 1JI1A 4GYJA 4GQRA 5M2FX 4XZ9A 2PDKA 1DYSA 1AH3A 5M3WA 2GGEA 1U30A 3AMDA 1DJYA 3GR4A 2EKCA 3USBA 3CM4A 4ILSA 3NQ6A 2J9ZA 3VA8A 4FPSA 3W23A 3PBYA 2Q6ZA 3P93A 2IKJA 1QCWA 1C7TA 3LMYA 1XBXA 1W6TA 3AHVA 4LBUA 1KGUA 1WZMA 1XCXA 3RLVA 2FTWA 3UJSA 1GYLA 4JX6A 3AHXA 4Z0SA 3WFLA 1F05A 2BNJA 1EZ2A 1VENA 1H61A 4HT3A 1JCLA 3ZSSA 5LNUA 1JIBA 1ME7A 2J25A 3B9NA 1RQHA 3FCPA 1RPXA 3A9IA 1P4CA 4GC3A 3W88A 4DZAA 5GNYA 3AHYA 1VJZA 4PCFA 1XLMA 3JZEA 9CGTA 2J7DA 1DE5A 5T8GA 1AJ2A 3R8GA 3R58A 5HDRA 1QATA 4DNMA 1ZUAX 5I3KA 2DFAA 4XVDA 5DFAA 1DJZA 1QUMA 2C0AA 4J3ZA 4N9BA 4S3BA 4HNTA 1ZZMA 3IVSA 4N02A 3MMTA 1NSJA 2VFGA 2WMGA 3WJSA 3RU8X 3WLSA 3V0UA 3PB0A 1P7TA 4QJ3B 1OFPA 3N19B 4KMQA 4E3TA 1Q6DA 1J0YA 3ZOAA 5TF0A 4H8HA 3A9BA 1F5ZA 3PNZA 2QZRA 1RBOB 1ONRA 2QKFA 1I2RA 1EZWA 3FV9A 3PULA 3M7WA 4LY4A 1IXPA 1UBPC 3MHGA 4HA0A 3I7RA 3TYDA 4TR9A 4V1XA 4HJWA 3RX4A 2VOTA 4HMDA 1TV3A 4QSFA 2QCHA 5I3DA 2YX0A 1JVNA 1K6AA 3GDTA 3CYJA 1BHGA 1EPXA 1ZCOA 3PZTA 4OVXA 5T9BG 4FLOA 3KLLA 1TCMA 5M1TA 1MW2A 3VOGA 1GEQA 1YPIA 4MLJA 1XH2A 1OX6A 5MKGA 1HKWA 1X7IA 3LB0A 1NOFA 3FHQA 5HMDA 3ERPA 2E6YA 3EDDA 4XKYA 3W7OA 2HE5A 3SJNA 4MMWA 1R7OA 2XH2A 2VC9A 1KC7A 1IZCA 2XPKA 4PMRA 4M51A 1DWJM 3EB3A 2P1FA 4WDXA 1VYRA 1O5KA 4Q7BA 3EGJA 1PV8A 4C6JA 2V2HA 2GDVA 1BTCA 1FKWA 3OEXA 2R1KA 4NASA 3TN5A 4XKMA 4TTUA 3MJMA 3AIUA 4WGHA 3WLHA 4BF5A 5AYIA 4ML9A 1WO2A 2CLMA 3DBPA 3PZGA 3DFHA 2QCNA 1Z9AA 2WZMA 3GNOA 4JN6A 1U5VA 3S2NA 2YDSA 3HPXA 3AU2A 4MB4A 4RE4A 4S3FA 1WB0A 3TZNA 3TJ4A 3LCLA 3GU2A 1KRMA 2FH8A 4WJ8A 3IJQA 3P14A 3VYLA 2P5NA 4EWND 1LZOA 4HCHA 3U5UA 1XYMA 3ANYA 1N8IA 4X9SA 3WMBA 3CQKA 1FH7A 3KW3A 1AL8A 2PRMA 1NDYA 1OGSA 4GZ7A 3DU0A 4AMAA 2DVXA 5BNKA 5F2GA 3FDKA 3F4WA 3TW9A 1WUEA 4DY1A 1XKYA 4DELA 1UH3A 3GFZA 1J2BA 3QKEA 4ADTA 1EQCA 1E1CB 1AQ0A 4LAOA 3SW6A 4MHBA 4MLRA 1HP4A 3EPMA 4LRTA 1POKA 2ZX7A 1DTUA 4JHOA 5A6JA 2P50A 2XVLA 1OFBA 4INFA 4CEXC 4GNKB 3UF9A 1UIPA 1V6YA 4BI5A 4HIBA 3SAZA 3GVWA 7TAAA 4TVCA 1S2AA 4QISA 4C65A 1M01A 5EL1A 4CLMA 4O0KA 5F2MA 1CBGA 3WDHA 2GGGA 3KCJA 1HP5A 3AS0A 3E3HA 2J13A 3SDOA 1C8YA 1NF0A 2YA0A 4O15A 3ZT5A 3W84A 3N1AA 3ZZ1A 2RDTA 3WLTA 2PAJA 5FJTA 3GQYA 3UZXA 3UG8A 4DJFC 2Y70A 4LUSA 2QMKA 3HB9A 5I3HA 1R8LA 3CJPA 5XINA 1G69A 2X16A 3WD3A 2R24A 3DFQA 4G7EA 4Z1DA 3QW3A 3BWWA 4ZA0A 3AZSA 4AY8A 1B0IA 3TTEA 3VGDA 3MB9A 1SO4A 4YL2A 3NQVA 3N2TA 3OQEA 3OPSA 1HJSA 3UPMA 1CCWB 3VKCA 1SR9A 4IISA 3WF4A 3STFA 2E77A 3VABA 3WLLA 1K9DA 4GABA 5AOUA 1VFOA 1E1EA 3LXAA 3GY1A 2VQTA 4LV4A 2C1HA 4M1BA 2QEZA 2DZPA 2V0TA 5FJOA 2OQHA 4XUGA 1GVSA 2ZYFA 3ANVA 3OYXA 1C7SA 1KFCA 1F07A 1FWTA 3GLCA 3S6TA 1MNZA 3NJ3A 4QRNA 3L12A 4XZNX 3NYZA 2Y1HA 5C9ZA 4O11A 1UMLA 3QHNA 2REQB 4CU8A 4IWWA 3NOYA 4IP4A 5C54A 2PI6A 5AYZA 4PH6A 2OPJA 3IJ7A 4H3DA 3MCNA 3Q65A 2VC6A 1KBIA 2A6LA 1J11A 4ONVA 3VC5A 4ZBCA 3GG7A 1SW7A 2A3AA 3GXMA 4QNEA 3S2MA 5ECUA 4C6FA 3LA4A 2D73A 3FYYA 5FOOA 3SCNA 3TQ0A 2F84A 1H7XA 3VKDA 5GPRA 4QAWA 3E38A 4EP8C 1KLZA 3GXFA 2OSXA 3LRLA 4GA8A 2WBGA 2A85A 2WPGA 1RA5A 1TWSA 3SN0A 4Z2HA 3TZFA 3OO2A 2BOFX 1YTDA 4DHGA 3TXZA 3MANA 4TVUA 1VIZA 3RAOA 5CPQA 3AISA 3KBVA 3PZQA 4ZOBA 1A5KC 3TQPA 3GU1A 3L65A 2XFWA 2CZFA 1UG6A 1W9BM 3MWAA 3NL6A 1LROA 2QS8A 2L5HA 2NT1A 4HA3A 5CZSA 1SUXA 3QY7A 4ACZB 1Y5WA 2PDUA 3KP1A 2JBMA 3GXDA 4U10A 2R6OA 3EKGA 4HBKA 2ZXAA 1SZEA 4O0QA 2EPKX 1HKVA 2DT2A 4Y6GA 4GI9A 1FFQA 1ZENA 3THCA 4O1AA 2OXNA 2HVNA 4NAFB 3IAQA 4QG9A 2CLEA 1M6JA 1BYCA 3HG5A 3KOZA 3QOKA 4WKAA 2PTWA 3R0DA 3RRAA 3UXKA 1C90A 2CERA 3P60A 1KFKA 1U83A 1WOAA 1JR1A 2IKIA 3M6DA 4LYRA 1MQPA 1WE5A 1C8VA 3NG3A 3VNDA 3W00A 1W1IE 4I6KA 2VYOA 2VFEA 2J6VA 2HPMA 4XBJA 3ATZA 3ITTA 2GWNA 4AEFA 1ALDA 4ZSTA 4LFYA 2Q71A 3ARQA 4A3YA 5LZLA 5I24A 3W2MA 1UP3A 4YN5A 1JD9A 4NZ5A 2ICSA 5GVJA 2DPEA 4WJEA 4DJDD 1IWPA 3E6EA 1OX4A 2QUMA 2D3LA 1IT0A 2XJ7A 5E1QA 3FIGA 3NQ8A 5HNUA 2ANUA 4LS0A 3B40A 3D3FA 2RJGA 1DVJA 1HZYA 4Z2JA 4NILA 1F6YA 2AL2A 2BV9A 1FDJA 4LAMA 3NNTA 1G6CA 4Y9MA 1A3HA 3RJXA 3KCOA 2YCLB 4HU0A 4GXMA 3GH5A 3OVRA 4TV5A 5CSYA 1RR2A 4I6VA 6TIMA 4DNHA 2RH9A 1CI1A 2VD8A 4PMXA 3OHMB 4JTDA 2PE4A 3M0YA 4IJRA 4XISA 5C70A 2BLEA 2VNCA 2FYMA 1NF7A 5G1YA 4HN8A 7TIMA 3NDZA 1UJQA 1UR0A 1E4IA 4GX8A 4PR4A 4Y8FA 3A23A 5BMXA 4MNJA 1M04A 3GNDA 4HA1A 3E0IA 4YTSA 1UC5A 2FB2A 3Q58A 2WHJA 3PUOA 3E2SA 2FGBA 1N8WA 3BGJA 3STGA 1LL7A 4GH3A 1JRBA 2NQJA 4RDWA 1H5VA 3DYOA 2VELA 3K8LA 2CNCA 1BFNA 4QLKA 2QF7A 4YTQA 2J79A 3TYBA 2QGHA 4K68A 3WCZA 4RLIA 4BQ4A 4H8VA 4AAJA 1DP0A 4OE7A 1HL9A 3TSBA 5FJJA 1W17A 4BR1A 3F5LA 2QGYA 2C71A 4EKJA 4GISA 4FAMA 1EWEA 2GUYA 3H21A 3CUFA 1TRIA 2V5LA 4JTFA 4ACZA 1L6FA 2J7HA 2PLKA 4AD2A 1IIGA 4E4UA 3NFUA 1EEPA 5AKQA 2NZLA 4B5NA 2PWUA 1WCGA 1SJAA 1IR1A 4Z1YA 1B57A 4L56A 4BKNA 5JUVA 1MQRA 3R7MA 1MUCA 4A6GA 1M41A 7PTDA 1S5NA 1PSCA 3VKAA 5I3IA 2GDQA 1E72M 1ZB5A 2YW4A 4W7WA 4OBTA 2X0HA 4J2MA 4REQB 4W8LA 2VI0A 4XV0A 4JOMA 3W7IA 3DUGA 1B1YA 2BHZA 4PCPA 1MO0A 1RA0A 4CQ8A 3VKKA 1GYNA 2ZUMA 4YNGA 2CLFA 2ZRZA 3SN4A 1W8GA 3CZLA 4CN6A 4O10A 1TQJA 1V93A 1OM0A 4MADA 1S2UA 5D30A 1TPC1 1EB3A 1AW2A 1K9FA 2JIWA 2CBIA 1JZ6A 3BOLA 5AC5A 3PK7A 4QLLA 8A3HA 3A12A 3WBWA 2FZ9A 4FNRA 4GIAA 1V6UA 2Q8LA 3T4WA 2CHRA 1HL8A 3VX1A 1GJUA 3L4XA 3TFCA 2AGKA 3GHTA 4RW5A 3H70A 2NLYA 3WD4A 2V69A 2JGQA 1FWIC 3NPXA 3BAJA 1K70A 2J88A 1VBRA 3GB6A 2W4XA 4RXFA 3B8VA 4NY2A 1HT6A 4BFAA 1XRVA 1RP9A 3L2MA 3SUVA 3KRUA 4UOQA 3M41A 3S9IA 1LUCA 2IKHA 3EPOA 1JPMA 4C6EA 3R2GA 3J7HA 1CGYA 1JFHA 5LIUX 4RX0A 4MWAC 4TU1A 4NT0A 3MP5A 4HPXA 1WZAA 3B0YA 4CN4A 2PF8A 1BWVA 3MUAA 1C29A 3L9CA 4AC7C 4UTJA 2JKAA 3T0AA 5JIWA 1PX4A 2WBKA 3BURA 3VIFA 2CLLA 3QHMA 3O63A 2AOSA 1Q5MA 3W2KA 2ZWZA 2TAAA 4ZR8A 5TD4A 2ALRA 1RK5A 5T91A 4P7RA 2XSXA 3Q37A 5CG7A 4TVDA 4GGBA 1OCBA 1BQGA 1GPWA 2BGNE 4DWDA 1WBHA 1H1ZA 3LY0A 2A4AA 2YA1A 5I00A 4B16A 1EYWA 2PDJA 3TYAA 4GUJA 3OA3A 3GDKA 2D0GA 3AXMA 3ORWA 1S38A 3WF2A 3MUZ1 1FKXA 4A8LA 4CGTA 2QV4A 3ECQA 5CC3A 3LX9A 2IPFA 3I3EA 2A21A 3BJFA 1V3JA 2PTXA 3MP3A 4HK7A 3RRXA 4BCEA 3ZYZA 3GTIA 1H3GA 3CHDA 4R5EA 4XKYB 2X8RA 1ITXA 2ZXQA 4K36A 3PFMA 4XAZA 3V36A 4P7QA 4EF9A 5CEWA 3DIPA 4DO7A 3OW1A 3CB3A 2Z00A 5F1UA 4IQDA 4B5SA 1XYFA 4L80A 3S5NA 3TK7A 3E0FA 5CC7A 1ECQA 2VEIA 1XC4A 4PSRA 1F61A 1Q8AA 3OA5A 4IXXA 2ISDA 1KNWA 3EA1A 3UERA 1BPLB 5K4ZA 5KITA 1PAMA 4KEVA 1F3WA 1VPXA 3NZRA 4LYKA 2R1PA 4O1EA 3UZYA 1M7XA 4H8NA 4EAMA 2Z7KA 2YA2A 4S3EA 3SBFA 5HNTA 4BZYA 2V63A 1MDLA 2DW6A 3S6DA 1R3YA 4C1NA 2NSOA 2IPGA 5GJPA 3ARPA 5DANA 1EDTA 3EB2A 1UUQA 1DORA 1PHQA 3G1HA 3LMZA 1TE1A 3PG9A 3L4UA 4JICA 4FK9A 3R1ZA 4GD0A 2PMQA 2J4GA 3P2VA 3A3WA 2BXVA 2Z1KA 1E0VA 1RJRA 1GVYA 3N15A 2VR4A 4XAYA 3FK4A 2BGSA 5C0QA 3N3MA 1XUUA 2G96A 3IPWA 2ZA1A 5M5DA 4C6IA 5D38A 1TUFA 3UBPC 1AG1O 2ZBTA 3OZOA 4A8NA 1REQA 5AYXA 3N12A 5J8LA 1XGZA 1XLBA 2C19A 3VIIA 3N9RA 2HRWA 1W1A1 3GE7A 4DF0A 4D71A 1XSKA 3ME3A 3NO5A 1E0UA 1XF0A 2PU0A 4UQ9A 3EPNA 2OEKA 4L9XA 2RGMA 2TODA 2PC8A 4JS3A 2VR2A 4UTMA 3BANA 5D9NA 1OHLA 2W67A 3H24A 4WXZA 1YDOA 5HJXA 2P0IA 3W1RA 3BLDA 4C6BA 1MXGA 4H9UA 1GW9A 4U2YA 3W25A 3PWGA 3I6EA 1XYLA 4W85A 3E02A 3M47A 4GVHA 4A22A 4HHLA 3QMSA 3JUGA 2PTZA 4ES4A 1VFLA 1ONEA 3VIHA 4C7GA 1QT1A 4BF9A 2O9RA 1LG1A 2XGZA 3AXHA 2I57A 5DBTA 2DUXA 4FX6M 3GH4A 4IJBA 2Y8UA 1QK2A 3MSRA 1MWOA 1CB2A 1ITQA 2CYGA 3ISIX 4FX8A 4W9TA 3H54A 1XRTA 1ZJAA 4YWIA 3R8HA 4QJ1A 3TV8A 4CNUA 1DJNA 2WCSA 3K8MA 4C6OA 2GOKA 5EB8A 3EXSA 1W54A 3W7QA 2CETA 3BAYA 4H6RA 3WKZA 1YXYA 2J9YA 3GZ3A 2DIEA 2WVSA 3K1GA 3TA6A 4G6CA 4Q8TA 4XZIA 1V51A 4GUFA 4CNNA 4AISA 1F8MA 1KFWA 1O95A 4PUEA 2NXHA 3GM8A 4Z08A 5J04A 5CGTA 3H26A 1GORA 4M56A 1TIWA 3UETA 4EXQA 4MAVA 2JK2A 3E0WA 4GVIA 4C6NA 1F4HA 4XSMA 7A3HA 4C91A 3DHUA 1HJQA 2YCKX 4P7OA 4JIHA 4DF1A 3M0XA 3RU6A 3EKLA 4PA8A 3A5FA 3W02A 1W5PA 4JZ5A 1GJWA 2DGAA 2WHMA 3NQEA 1KXHA 3CAQA 4MF4A 1E6NA 3BC9A 3MBDA 1DQXA 4U3CA 1CB7B 4H9TA 1Z7AA 3PWAA 4EX4A 3LDVA 5CPMA 4AZCB 1LT7A 3MUXA 1GQNA 5CJMA 1KLYA 3MBFA 5CPOA 4I7WA 3N4EA 3GD6A 1W2PA 3EA2A 4HSHA 3S2LA 1F3TA 1QO5A 2ZICA 3B9EA 3VOIA 3GXNA 3O3RA 3U2CA 4JQ3A 4IQJA 4PB5A 4NXKA 4HPHA 3NA8A 3G22A 3NVDA 3N3TA 5D9MA 1AMYA 2WKGA 3SCSA 2PLJA 4IH3A 1EBGA 4H41A 3OOQA 3TONA 3N25A 4UTKA 4QGCA 1ZBWA 3I3DA 3VIPA 1V3MA 1FWCC 3A4AA 2E1DA 5FF0A 2JEPA 1XBZA 5D9PA 2Z4GA 3A13A 4F66A 3EWYA 4FF7A 2NQLA 1CXEA 4HZ8A 1JCNA 4GG9A 3USZA 4KFPA 2GDUA 1XD0A 1FHVA 1HGYA 2HNEA 3B06A 4NQ1A 3RR1A 1I6NA 3JS3A 3AIQA 5BCAA 3I6TA 1LLOA 4JIEA 4Q4MA 1M3UA 3L4ZA 5I23A 2ZUVA 1UOZA 4HNVA 4C6CA 3UNDA 2VFFA 1FOBA 3QYSA 4NX5A 1KM6A 3GKFA 1HJXA 4PGLA 1MW3A 3FA3A 4JCMA 1OWQA 4GUGA 4LYQA 2B0MA 3FGCA 1JI2A 4LOCA 3SUTA 2FFIA 2EEXA 2BP1A 3CIXA 4PTVA 4WXYA 1RPKA 1W8SA 1GWJA 3F1QA 3DG6A 4IMAA 2ZUNA 2ODOA 3SIMA 2DUZA 3KM8A 1GKRA 2PRLA 1WXJA 4DN1A 3TJXA 4HP5A 1GOXA 4UC5A 4Y7EA 2JF7A 1XYCA 2JE8A 4W89A 3S0CA 1NDWA 3SCRA 5FL1A 2ISFA 5JBEA 3W24A 4F2BA 1JZ3A 3UQNA 4WX2A 3VGBA 1V7YA 3G1SA 1O4UA 2C91A 1XHGA 1U1UA 3O0KA 3THUA 2B7PA 4Z1AA 1EGMA 2Z29A 2J77A 1OSEA 3KTXA 1LLZA 1WDQA 3VD7A 3NUKA 3VU2A 1OYBA 4W84A 5E6ZA 1G9HA 3HG2A 2ZZ2A 5C55A 4PCTA 3CB8A 4WUIA 4NJGA 4LVAA 1QHPA 4UMBA 2ZX5A 2C16A 1JPDX 3VNZA 1NARA 3M6YA 1R6WA 2FJUB 2NW0A 3UJ2A 3U48A 4DJFA 3QFWA 3PBGA 1IF2A 1E6PA 3GNXA 3T42A 4XAPA 4ZO6A 1FRBA 3O07A 3VIGA 4D6JA 3WL1A 1ME9A 2WMFA 4LVFA 3N73A 2GL5A 4QE4A 2WCGA 3OLDA 1JDAA 3TTOA 1UA3A 4XZBA 3EZ4A 1FHUA 4DJED 4B2DA 4FXSA 4V15A 1KWGA 2DH3A 4A3QA 3KTCA 3BLLA 4D2JA 1BVNP 3FSTA 1JCXA 4ZEPA 1XICA 3LSBA 1QNSA 1EJUC 1E55A 1HNYA 2J27A 3VNJA 1W91A 1HG3A 3VM7A 5E5CA 3F4DA 2YBVA 3L4VA 1XCWA 2P88A 5FSDC 1M5WA 3TMLA 1TX0A 4N7QA 3HM7A 4L4PA 1F3XA 2ZZ3A 3W83A 2VX5A 3K2GA 1ZAHA 1S1PA 3T78A 2EXOA 4G9PA 4KWOA 3W01A 2FZDA 1FXPA 3AALA 3HURA 4EOUA 4IMFA 3B8UA 1H50A 3VMOA 2VFIA 3LCFA 3VI2A 3KVKA 4OUEA 3GDRA 3WSUA 4XBKA 1VGAA 3TAOA 4GIEA 1B30A 5XIMA 1IQ8A 3W7KA 2I56A 1W3LA 4GYPC 3N9SA 3T8QA 3U0HA 3DFSA 3TA9A 2ADAA 4H1ZA 2TSYA 4Q8UA 4B15A 5I77A 4K6AA 3CAKA 3GHSA 1XD1A 1I0BA 5L6UA 1UA7A 5HJYA 3OGVA 1V02A 3BOXA 2WZHA 1TG7A 4NP7A 3FAXA 4RDYA 4DI9A 1O5XA 3T7VA 3HBLA 1ISZA 5A6BD 4NRSA 2IPWA 3T2QA 3UPWA 4LB3A 3E2QA 3H4XA 4H7ZA 1ME8A 1TR9A 2A0NA 3UYCA 1MEIA 1TIMA 5D09A 6ALDA 5HPCA 3MCOA 3W7CA 4DO5A 2XVNA 4N9CA 4HYRA 3BAKA 2RDXA 3ZWTA 5CPTA 1V0MA 3GC2A 5D02A 1RAKA 2VCAA 2QJIA 3H2OA 3QY8A 3TN6A 3LPOA 3PSWA 4GUIA 3QMTA 1EKOA 3BLIA 4O8AA 1GGOA 3WBXA 4O8RA 4TIMA 4JKLA 3EMQA 2D1ZA 2VJXA 3BK0A 2NQHA 4M7TA 5DCBA 4JL1A 4MUPA 3U7BA 5BXSA 2VFHA 2J7GA 2WPBA 3BDKA 4A3RA 3KP0A 7ENLA 1HJVA 2C6QA 4S3CA 4JPGA 4ZENA 1GQJA 5F4XA 3AYSA 3QEZA 4CQ9A 1OFDA 3DFPA 3DZ1A 3QBUA 3FY1A 4H2HA 2C0HA 2FPYA 2XVPA 3IJ9A 4HQVA 1JGMA 1QI5A 2GVLA 1GCYA 4NHVA 3ARTA 3BLPX 3AZTA 4DZ5A 2ISWA 3KZPA 1PDYA 3VXGA 1AZ1A 2Z24A 1J12A 2C15A 4DWSB 2WVUA 1IEWA 2Z6JA 2F7FA 4XD3A 2NQ5A 4H9ZA 1RP8A 3URAA 3H2MA 4AWSA 1KCKA 2ZVRA 1UBSA 1OIFA 1E6QM 3E1F1 3M16A 4HTBA 1NQKA 2X05A 4HB7A 2DT0A 2F6UA 2FMOA 4IIDA 4Q6JA 4I9AA 1SZFA 2QCLA 4X0VA 3FX4A 2PLCA 3W1TA 7REQA 2O55A 3S47A 1XSIA 2E5DA 2WMIA 4HU4A 1QNQA 4WKHA 2DIKA 1A5LC 1TVLA 1U2YA 4A2RA 4B5TA 3EWUA 4H04A 1XYZA 4QTGA 4HMCA 3UGVA 4IOTA 4IIFA 3C2EA 4BJHA 5J5DA 3G2GA 3F7JA 1ONXA 4L4OA 2Z6IA 4WDWA 2OO6A 1C91A 1HW6A 5FIPA 5HMSA 4NG3A 5BOFA 5FJPA 2R9RA 3GNRA 4GHRA 3NR0A 4YYFA 4NJHA 4KRUA 2BX7A 4HPJA 3FSUA 2F2KA 3GUWA 4P7NA 1SFSA 4U28A 2RKXA 1JULA 1JCJA 4FLSA 4KH2A 2ZTKA 2ZXDA 3WH7A 2VVSA 4I90A 3F4VA 2V9DA 4FLRA 4JD4A 2QCEA 1MXDA 1FH8A 4AYGA 3STEA 1K77A 7XIMA 3DH7A 5LIKX 1OF8A 4KIEA 1GONA 2ESCA 1UKPA 1J5TA 2NV1A 1ZPTA 2J24A 1L6WA 4KWWA 2KAUC 2HROA 4B9ZA 4Q8VA 2INEA 2ATSA 4A8RA 2I9EA 4HOWA 5I09A 3LI0A 2P8CA 1TJ0A 1S46A 1UD8A 4JN8A 4KW2A 3NO1A 4ZFMA 3RUBL 2VZTA 3AMCA 3CBWA 4K38A 2PRHA 1QR7A 1BWLA 2ZADA 5LKYA 4KRTA 1VCGA 4CQAA 4GZIA 4BQ2A 4C6MA 3ZQ9A 1DWIM 2PU1A 3K4WA 4O18A 4NZJA 1GQKA 4E4PA 1AFSA 1K1DA 3M0MA 3MV01 1QWGA 3QM3A 1H11A 1R9ZA 5H6HA 4LF1A 2XH4A 2EBNA 2BVTA 4LNCA 4PE8A 5HWNA 4ZQOA 1O5QA 1NTHA 2Y7EA 4LH8A 2QAFA 5C71A 1TA3A 3H4GA 2WZEA 2XH7A 2I1OA 4AZ7A 2W91A 3N2CA 5A6SA 1DQUA 4IMCA 3AUOA 5HQEA 3MYPA 3VGEA 4O50A 2GLKA 4DBUA 1ECEA 2BY1A 2XIBA 4KERA 1FWWA 5C7VA 1W9DM 5E09A 3SURA 4QNWA 2HCVA 3KRSA 1TTJA 2BY2A 4MM1A 3QGKC