2QKFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
251
Chain Sequence
b'MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
publication title Re-Establishing a Metal-Binding Scaffold with Full Activity in the Metal-Independent Kdo8P Synthase from Neisseria Meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
total genus 81
structure length 251
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qkfA00
4K8HA 1OF8A 3C56A 1O5KA 4A3UA 3M16A 4XBSA 1IXOA 1IXQA 1WA3A 4I7VA 5AN7A 3P60A 1TRDA 3G1DA 1A5SA 1AG1O 1H5YA 3B05A 2E1DA 4N9EA 4XUGA 5T26A 1P0NA 1JRCA 3S42A 1AMKA 2ATSA 1FDZA 2FPYA 5CKSA 1GYNA 1N8FA 1D3HA 2VFGA 5C55A 4HNNA 5EYWA 2C16A 3LLDA 1FCQA 4A2SA 4R34A 4IWWA 3SZ8A 1QMLA 4O50A 1ME7A 5HULA 3TJXA 5HWJA 2A5HA 3B06A 1P5BA 2DZXA 3GDKA 4RJEA 4Y96A 2QCMA 2VFHA 2QCFA 2C3ZA 5D37A 3TC6A 2OCZA 2YSWA 2WNZA 3MWAA 2Y6ZA 1IXNA 2ZTJA 4NJHA 1YDVA 3G1AA 4YCOA 1I2NA 3STGA 4ALDA 1GG0A 4UNKA 4AWUA 1SFJA 4MZYA 2TMDA 2GOUA 2ZQ0A 3W23A 2E68A 3W84A 5CPLA 3KVLA 4LS0A 2YCEA 5LSMA 4IGHA 2DJXA 4UTTC 2ZCGA 3W85A 1O95A 3HQ1A 4O1DA 2PRMA 4RZ4A 1UASA 3LTPA 1KM5A 3FKRA 1C29A 1GPWA 3QH2A 3UWYA 4E2BA 2QUVA 4M7TA 2B7PA 4N02A 3Q2DA 3GKFA 1SQ7A 1B57A 3CEUA 8TIMA 1K03A 1R46A 2F7FA 4AWTA 2C15A 3C3NA 1AL7A 4BFAA 2GQ9A 1SSDA 5TBOA 1OYBA 3GR7A 4O28A 2FTPA 4O0KA 5AHLA 5AHEA 3OG3A 1SO3A 5AYXA 3PWAA 2E6FA 4A2RA 3EWZA 1L9WA 1JUEA 2DORA 2X1SA 2Y7GA 3LXAA 4CCEA 1KFEA 1RVGA 1WOBA 4A29A 4OBTA 5LNRA 4MKNA 5G2IA 5FESA 4IMDA 1C9DA 1QCWA 2VEMA 1UB3A 3TK7A 3GAKA 2ISSA 1I8JA 2ZTKA 1YYAA 1YTEA 1K8ZA 1VJIA 5AHMA 4NXSA 3TCEA 2Y7DA 2BLEA 3DI1A 1L6SA 3M5VA 4GWEA 3CIWA 4YLWA 3SECA 1Q45A 5F2MA 2Y7FA 3NL3A 4TU1A 1KM1A 3BG9A 2J6XA 3EWWA 1JVNA 4QIUA 1YTDA 1XC4A 1YPIA 3O1NA 3G0XA 5BMWA 1O4UA 2OX1A 2EPHA 1QOPA 5A5WA 4DELA 1ADOA 1W5NA 5EMUA 1KA9F 1M7PA 2J88A 5DELA 4NT0A 1XCFA 2E5DA 3YPIA 4FXSA 4WXZA 4GUIA 4NX0A 2Y7EA 3HGOA 3N19B 2JKEA 1DL3A 1MO0A 1SFLA 1JUKA 3TFCA 2DZTA 3G3DA 4LTSA 4GBUA 3R89A 3W2LA 3LCGA 2NV1A 3S1VA 1W3NA 2TYSA 3TROA 1IF2A 4JYFA 1X6UA 4UTLA 2A6NA 1B4EA 4UTHA 2YX0A 3H54A 2WV8A 4FF7A 4GNJA 3ANYA 3CPRA 3LTSA 2HTMA 3IGUA 5L9FA 2NWRA 3WJSA 1DQXA 3T44A 1KTBA 1OG0A 2CLIA 3KRSA 2VEIA 3ZWTA 1TPFA 1PL9A 1G7UA 4NNAA 2ZYFA 3TA6A 3W7QA 1ZALA 4UMBA 1I2OA 4O10A 2WNQA 2WO5A 2I14A 1S5VA 1ICSA 4HN4A 4UNLA 3Q94A 3GXTA 3RFAA 4O14A 3TSBA 2YW3A 4AF0A 4DO6A 5I3IA 3W1AA 1G4EA 4OU1A 1JCJA 1TPB1 4RZ6A 5EPDA 3K30A 2ZFAA 1LLZA 3E0IA 1W54A 1YDOA 1ZENA 4O8RA 5FF7A 1FCVA 1V7YA 4D2JA 3DFSA 1N55A 4N4QA 1MZHA 3QF0A 3O8AA 3W7NA 1J5TA 1R47A 4O1AA 4E0CA 5CZJA 1Z41A 3OBKA 3UD6A 4MFDA 1OJXA 3RK8A 1UBSA 6TIMA 3RLVA 1MXSA 1L6WA 1TTPA 3W2NA 4E38A 3DENA 1GVSA 3NQ6A 2QUUA 2BX7A 1F2JA 3O6DA 2H8ZA 1K8XA 5C2XA 5FF0A 1DJQA 4PL2A 1P4CA 5EL1A 2R94A 3IVSA 1GYLA 2E5BA 5D05A 2QCDA 4I7WA 3TNOA 3W73A 1G6CA 3KFTA 4RXFA 5F1VA 3H53A 3LCIA 4M6PA 5DLCA 3HMJG 3QMTA 3BW2A 4IX2A 4ADUA 3TMQA 3NOEA 1OK4A 1XFBA 3NQGA 2NX1A 1F5ZA 2GQ8A 4JYDA 3W7DA 1FXQA 3GDMA 1A5CA 1UCWA 4YXGA 3TE9A 1YXDA 2A21A 3B0VC 3I68A 3NDOA 4MY9A 3EKZA 4FNSA 3P8IA 3LXCA 3P67A 4CCCA 1AW2A 4FNTA 4YL2A 1RPXA 4NVTA 2V8ZA 1TB3A 1WYIA 2NXHA 3I65A 2JGQA 2PRLA 3P82A 4Z1BA 3TSDA 5CPOA 3BLIA 3IV3A 1KTNA 3LHZA 2QF7A 4G1KA 2C0AA 3EWBX 3SY5A 3LM7A 2H3BA 3BGJA 3NZ1A 4IMFA 3CLMA 3GR8A 3A23A 3LCFA 5LNWA 4LUJA 3UPWA 1SZNA 3PUDA 1VHNA 5AC7A 2H6RA 1BEUA 1TSIA 4K36A 4R33A 4DBEA 5TIMA 1FQ0A 3FOKA 1JCMP 1I45A 3KX6A 3LXBA 4XZ9A 4UIOA 1FY6A 1TPEA 2CLEA 3DFTA 2AQWA 4LWWA 3TR2A 2WJZA 1AW5A 4NUWA 3P7YA 3THAA 4RXGA 3BV4A 3OVPA 3EX4A 4RLIA 4I7UA 1KLZA 3DFOA 5D2VA 2C6QA 1MSSA 2QAPA 4HKPA 4QSHA 2ATMA 3EX2A 4RR4A 3L0KA 2WKJA 3M7WA 1TPDA 4O0ZA 1SSGA 2J9YA 2I1OA 4FNPA 4CNPA 3S1UA 2RDUA 1TREA 2WSRA 5LZLA 4XTDA 4LV4A 3PR2A 4DBDA 3BARA 1YPFA 1XBXA 3VNDA 4PC8A 4ZVJA 1TRIA 5C5YA 3NQDA 4NJIA 5FEPA 1I2PA 3CQ0A 1KFKA 4OE7A 2V30A 3IRDA 1DBTA 2KZHA 4M19A 3RLUA 4LS1A 2PRHA 1H7OA 1ZY9A 4OV4A 3UNDA 1ML1A 3NQ8A 3W1TA 5F2LA 1B9BA 1LBFA 3W70A 3R13A 4IOTA 2YYTA 1F05A 5CZ0A 5G5IA 4DPPA 3ZS4A 3L65A 5ABTA 4FNUA 3UWQA 3EKLA 3GK0A 3OA3A 5BRBA 4O57A 2JKPA 1SW3A 1F73A 1VGAA 1HL2A 4DO4A 3LX9A 2JGYA 1W0MA 3KVKA 4FX6M 1U83A 1A53A 3B03A 2AAMA 3CM4A 2G97A 1OK6A 1W1ZA 3GB6A 3CIXA 2FB3A 3NL6A 4JY8A 3C2VA 2V2DA 2VEPA 3W1UA 1EIXA 2GQAA 4WY0F 3TXVA 4FX7A 4MY8A 4FIQA 4XKYA 4KFOA 4X22A 4O13A 5KZMA 5AYZA 3S8HA 1EWEA 4QQ3A 1TTQA 1LBLA 3QQ0A 1VYPX 4QJ1A 2GUUA 4UFLA 3MBFA 2PE4A 2YFNA 4TR9A 1RQEA 4GXMA 3M5XA 3NYZA 1HTIA 3NQMA 3UY7A 2A7NA 3M44A 3HPSA 4JTKA 2J27A 5LNVA 5F4SA 1OFBA 1TIMA 3T7VA 3W7CA 1LCOA 3SI9A 3MO7A 1HUVA 3IEBA 4IMEA 4ML9A 4QNWA 3H55A 2QJGA 3BLEA 1KM6A 4QNEA 1U5JA 3E9AA 1DQWA 1P0KA 2A0NA 4ZL1A 1WV2A 1RQBA 4QITA 4YCPA 4Z0SA 4K7YA 5K9DA 1K02A 5E93A 2Z2UA 4NX5A 3BLFA 3W07A 1IIHA 4EWND 4NZFA 4BI7A 4FEZA 2WOQA 5E1QA 1Q6QA 3KXQA 3SR7A 4WOZA 2Y85A 2LLEA 4UMAA 3BW3A 3GXNA 1LRQA 1RZMA 1VYSX 3IGSA 3O16A 2Q3RA 3W86A 5D03A 3UQNA 3UZ5A 5BW6A 1UJPA 3LHVA 4H4IA 1EA0A 4O4VA 3R2GA 1VYRA 5KMYA 4JTUA 3UYCA 3UXAA 4WJEA 2WNNA 2VEKA 2ALDA 3HG4A 4UCGA 3LTYA 3MJYA 2ZZ4A 4O54A 5HJLA 3MP4A 1GTEA 1H7RA 3U6WA 3QZEA 2B0MA 4DF0A 4NZJA 3G0SA 5AC6A 1TV7A 1OABA 1XBYA 2Z6JA 3TKFA 5BNKA 1I4NA 4ONVA 2NX9A 4O18A 3W88A 1SZEA 2W6RA 3N14A 4RV8A 1LOQA 5K9XA 1VCFA 2ZA1A 5KZEA 1RV8A 5G4WA 3LI0A 4MYXA 3W87A 2V2HA 1OX5A 1OHLA 2CLHA 3N34A 2W79A 4JTHA 5FF3A 2DZVA 3WJYA 5DBUA 3A5FA 3P81A 2JKAA 1G67A 1LOSA 3DU0A 2ZZ6A 5F4WA 3NA8A 3PG8A 3W7GA 1PVNA 3AO0A 2ZRWA 4JXCA 1TPVA 1H61A 3N9SA 1SO4A 3PG9A 2Q8LA 3TW6A 3LBMA 4MYAA 4NNBA 1SPQA 4WY0B 1SW0A 1FXPA 4LS2A 2ZRYA 3PAJA 2GPTA 5F4XA 5I3KA 4ORMA 4BK9A 3W9ZA 3BGGA 4XKYB 5CG7A 5HMSA 2EF9A 3W7PA 1S5TA 4ZQOA 5I3GA 3LRLA 2F84A 4GE8A 2G96A 4KFNA 1QO2A 4AMAA 4Z0JA 2IQTA 4LU0A 1CW2A 2QJHA 1O5XA 2ZA3A 3HGSA 1NFBA 2EGZA 1F76A 2OMAA 3P84A 3MI2A 2EAWA 4N9DA 1G4PA 3MMTA 2AGKA 2RDWA 1FX6A 3MP5A 4NNCA 3S9YA 1OFPA 4O17A 1PHWA 3NL2A 3HPXA 3IVUA 3PY2A 1VH7A 4UR8A 2QUTA 3M1ZA 2GVGA 1Z42A 3M5YA 1XKYA 5EKYA 2O7QA 1YXCA 4LNYA 4NJJA 2ZDRA 3LI1A 2VFIA 3GIYA 3C0JA 3W1RA 4EIVA 1PIIA 2W0UA 4ZQMA 4C1LA 3OHIA 1TPUA 4LUIA 2DJLA 3G22A 4JTTA 1DHPA 2CZEA 3TW7A 4BR1A 1VR6A 5EA9A 3LHUA 1WQ5A 2FPTA 2ZBTA 4WD0A 1SZGA 5KINA 1J4EA 3M5ZA 2Z0IA 2NUYA 3A22A 4S2CA 4BWLA 3TQ0A 4JIPA 3M9YA 3W7HA 1QFEA 2V2CA 3ABQA 4LVDA 2V0TA 2X1TA 3NGJA 3C6CA 4LV9A 4TMCA 1TJRA 2NUWA 3NQEA 3PS7A 1WXJA 4S2BA 3QEZA 4Y8FA 5L6UA 4MLJA 5HQEA 3GDTA 3OVQA 1DORA 5U7SA 3W7LA 2G5WA 4Q33A 5LHEA 2DU2A 5D38A 2BXVA 4MY1A 1NSJA 1R2SA 1GVFA 1H7NA 4N9CA 4YWIA 3TIMA 5LGZA 1LRNA 3NXFA 3QMSA 3W2JA 4UMCA 3QQ1A 4MJMA 3C2EA 3G24A 1ONRA 4JTSA 2ZZ3A 5AHIA 4BF9A 4JTEA 3QSTA 2DP3A 2E09A 3GYEA 3I7QA 1KTCA 4QISA 3LOTA 3T40A 4Y9AA 1RR2A 4WUIA 1WBHA 1YXYA 2QDGA 3PULA 2BTMA 3JRKA 3DFNA 2RFGA 4ORIA 5G4EA 4Z1DA 1TPWA 3ABRA 1MEWA 5DBTA 1SUXA 4MJZA 1JCXA 1AW1A 4TIMA 3W1MA 4KWWA 4JX4A 3QMRA 3GNDA 1JUBA 4JYEA 1M6JA 1JCLA 5LNUA 1H7PA 3I6RA 1C8VA 2YFOA 2VFEA 3FJ6A 3GX9A 4Z1CA 1XXXA 3IIXA 4HIBA 1H63A 3NQCA 4GUGA 1NF0A 5D2TA 4Q32A 1VCVA 4GJ1A 4AH7A 1X1OA 1M7OA 3HO8A 4K39A 3SFKA 3P61A 4EVZA 3C4UA 5FF2A 4AB4A 4OGZA 2FLIA 1BWLA 5F1UA 5SWUA 3PF3A 1DV7A 3S0CA 2CLFA 2E5CA 1IIGA 1SO6A 3W7JA 3NQVA 3TSMA 4W9TA 5K4ZA 1VLWA 4O53A 1I2QA 1D3GA 2X1RA 4K37A 3F03K 4AVFA 1GVOA 2A7PA 2E77A 5FI8A 3NG3A 4TO8A 3L5LA 5IM51 3L5MA 3R12A 3ZWSA 1NF7A 1TQXA 4UFJA 4TMBA 5K9CA 2X1UA 4IQLA 1LZOA 3EX6A 5AHFA 2YR1A 3W1LA 1D9EA 3NPUA 1ZNNA 3DFPA 1FWWA 5F2IA 2YGYA 4O15A 5DY2A 3RU6A 3UWWA 4P2VA 4AXKA 4AHQA 2E6DA 3W74A 4DEFA 4Y90A 1EUAA 1SZFA 3P80A 4IPJA 5CZSA 2D73A 2ZA2A 3QYQA 3NZRA 1K7FA 2J9XA 1FDJA 3NEVA 1T8XA 3VI2A 3SGZA 1JJKA 3CC1A 3NPWA 2CW6A 3BK0A 3IGXA 2GJNA 4HHPA 3HGRA 4AHPA 2PURA 1FWSA 3DAQA 4AWSA 1TPH1 1ZAHA 4HPXA 4N6FA 3HIJA 5H2ZA 1ZAIA 4JX5A 2B4GA 3IIZA 4XBKA 3NNTA 1ZHAA 4NJKA 2ZRUA 2FFCA 4C1KA 1GG1A 2C1HA 3KRUA 4PODA 3F1QA 1W3TA 1GVRA 3I7SA 5D2XA 3W1NA 4BI6A 2V5BA 3WK2A 1QNVA 4PFMA 3M43A 4X3ZA 1VRDA 3P8JA 1EP3A 3TMLA 3BG5A 3O6YX 4LW7A 5HR7A 1W8SA 4R53A 4RCXA 1FWNA 5I3FA 4OV9A 4ZZ9A 1EUNA 2UV8G 2DZWA 3GKAA 1X8FA 3MW7A 3O06A 2V5LA 3W2MA 1NAL1 1ZAJA 4AF0B 4M6VA 1W5PA 5DCBA 3WK1A 1YADA 3A9IA 1KLYA 2OZ0A 1FWTA 3CU2A 1VHCA 3BVJA 2ZRZA 2VKZG 3P62A 2FQIA 2J24A 5BOOA 1GWJA 4FB7A 2CU0A 3LBCA 1FDYA 3NL5A 1FUYA 2ZZ2A 3T78A 2EKCA 2C14A 4LVGA 4U28A 3TFXA 1TQJA 5LHFA 2C13A 2P1FA 4CNNA 1P1XA 3ATYA 2R14A 4K38A 4JX6A 1H1ZA 3MBDA 1XL9A 4GUHA 1KV8A 1PV8A 1ICPA 2JBMA 3EWYA 2QCCA 3ZFHA 3NQ2A 3UWVA 1DVJA 1W31A 4AHOA 3W7MA 4FHAA 2DZUA 2QKFA 2BSLA 4ZQCA 3INPA 1IGSA 5HINA 4JD4A 3G0UA 2CLLA 2QCDB 2CLOA 4POCA 4JTJA 2HS8A 3B8DA 1Q6OA 3FYPA 4PEKA 1R2RA 4LC8A 4N9BA 3HBLA 4MFEA 2GVLA 1LOLA 3MI3A 5J5RA 1QPRA 3OEXA 5AYYA 4QAIA 2A7RA 3B4UA 4UFIA 1XBVA 3LHWA 3I7RA 1TMHA 1ZFJA 1QO5A 3E96A 2TSYA 3N2MA 1W3IA 4J9JA 5D2WA 5DN1A 1YLVA 2VENA 3P5YA 5EBUA 5AB3A 3W76A 4JTLA 3S5ZA 3HOJA 3MUXA 1JQXA 2YW4A 3TDFA 3CTLA 3C8FA 3QW3A 3NQFA 1EP1A 3RNDA 3UWUA 3GZ3A 3QM3A 1O60A 3DGRA 4HSNA 1EP2A 2CLKA 3CHVA 1B4KA 2X2GA 1TPC1 1F6PA 1H60A 3U8GA 5CPNA 5G2WA 3SSJA 3LCLA 3CWNA 1M5WA 3W7KA 3MYPA 5H91A 2Y61A 2FJKA 2BWGA 5G1YA 1O94A 1MEIA 4EF9A 1OFDA 2QJIA 2CZFA 2RKXA 3L2IA 5AC8A 2WSYA 2OT0A 3LCHA 4NJGA 4ZQRA 2EHHA 5K2ZA 4O4WA 2QCEA 2WSQA 3EXSA 1W37A 3F4WA 1Q6LA 1HO4A 2ZRXA 3DKLA 5DXXA 3STEA 3TH6A 5KTLA 1W5OA 4H3DA 4UTWA 4L4LA 5K4XA 2JK2A 4KWVA 2QCGA 3GLCA 3O63A 3N2XA 2PC4A 3DXIA 3TX9A 3FEMA 4ZQNA 4AEOA 1EX5A 2X30A 3EWUA 3DH7A 4DQWA 3FS2A 3FLUA 1OYAA 1PE1A 1E51A 3E49A 4N4PA 3EX3A 2XN1A 4LVAA 3E02A 1OFQA 2OT1A 4PCFA 3G1HA 1XDLA 3EEGA 4X9SA 3B0UX 3WJXA 3BO9A 5FF4A 3HJZA 3LDVA 3SW6A 4LVBA 3WK3A 3HF3A 4Y6GA 4GUFA 5HUPA 5DXYA 4PTNA 3UXDA 2C19A 1PCKA 3S5YA 4A22A 4UC5A 4RK8A 3VCRA 1OFRA 2FB2A 4MUZA 3C2RA 1TYGA 4LRSA 1H1YA 1VQTA 1VCGA 4HPJA 4NQ1A 5D04C 2XN0A 3HB9A 1ZCOA 1Y0EA 4M7SA 4FXRA 4JICA 1OYCA 4IJBA 4HNUA 1UUOA 3ABSA 4XTIA 3IIOA 3W75A 3MYOA 2YDAA 3G1VA 5E0KA 3TXZA 4LOCA 3A21A 4MOZA 3OIXA 4MLRA 3GVGA 3WFAA 1G69A 1HG3A 3STCA 2ABAA 3N73A 3NQAA 4RZ5A 3U2OA 7TIMA 1UUMA 5D32A 2ISVA 1K7EA 3VE9A 1JCNA 4UTIA 1LORA 3HGJA 1H7XA 4JTIA 4JTGA 3NPXA 3G8RA 4YMZA 1Q3NA 1A5AA 3QFEA 3T4CA 3NM3A 3G1XA 4IXHA 1Z44A 3S5OA 2E6YA 2YXGA 1ME9A 3MHFA 4HNVA 4ADTA 3PUOA 3ATZA 1QPQA 4UR7A 4HSOA 1T96A 3MHUA 5A8GA 4XQ6A 3EXTA 1KV5A 3V1PA 4UTTA 1CI1A 4P61A 5LNSA 1TJPA 4HT3A 3TAOA 1OFOA 3S5NA 1NVMA 4Q4KA 4LT9A 4MZ8A 3PM6A 4U4MA 1IXPA 3RF9A 1OVDA 1SR9A 2C18A 4DF1A 3R8RA 3VE7A 3W3OA 1KFLA 4BWLC 3KOFA 2QDHA 1JCYA 3QC3A 1KBIA 1S3HA 4IX0A 2QAFA 2P0OA 4O1CA 4JY9A 1R30A 2YYUA 2DZPA 3Q37A 4PA8A 4M6QA 3W1QA 4JTFA 1T0OA 3B0PA 1FBAA 2QCNA 3TAKA 3HG5A 3QW4B 3GAYA 3FA5A 5CSRA 1KW1A 3L5AA 1Z48A 2VFFA 3LHTA 4KFPA 3V75A 3E12A 4WXYA 3G3MA 3KRZA 2WQPA 1LYXA 1LP6A 4CQ8A 1KFCA 3W1PA 3G1SA 1QOQA 4QM1A 2R8WA 4OWGA 2P10A 3L0GA 3BG3A 3DKJA 1OF6A 1G7VA 3C2FA 5CPMA 4UTKA 4UFHA 3S1WA 1XBZA 2V82A 3PBUA 4X2RA 3M47A 4I9AA 2NV2A 1QR7A 3L9CA 1GTHA 3KVJA 4O52A 2TPSA 5G2HA 3PBVA 3TC7A 2XN2A 3UWZA 3PVFA 3WJWA 1EPXA 1FCUA 1K8YA 1ZJIA 1S5WA 2FIQA 4KKXA 4WZHA 2OJPA 4Z08A 3LHYA 3GDLA 5K3VA 3LRKA 3EWXA 5F2GA 1VLIA 1RD5A 1RQHA 5GVJA 2A6LA 1GJPA 1H62A 1KFJA 1NEYA 1KM2A 3DBPA 2CLMA 3PB0A 1OFEA 1CX9A 4PL1A 3DI0A 1VZWA 2A1YA 3EX1A 5HNRA 3L21A 4JR5A 5AOUA 4O11A 4CQ9A 2A85A 1KM3A 5KSWA 2X16A 4E2DA 4OQVA 3W2UA 2VC6A 3VKJA 4ZMGA 4JNMA 2YZRA 3NAVA 3ELFA 4MIMA 2XFWA 1GZGA 5DY3A 4FNQA 4ADSA 3OVRA 2Y89A 4WOQA 3JS3A 4ICNA 2B7NA 4JIQA 3W7OA 4LC6A 1LTDA 1WOAA 4EOUA 4L4MA 3MI6A 2Q3OA 5HUOA 4CLMA 3P74A 5D30A 4WQ6A 4IMCA 3DHFA 5CGQA 2FDSA 1T99A 2ZZ1A 2Y88A 4WX2A 2DZSA 2NXIA 2V81A 3JR2A 3MHGA 3G1FA 1AL8A 2O7SA 4UTUA 5HR6A 2H3DA 3LCWA 1LDCA 3NM1A 4NU7A 1XUUA 4DO5A 4UFKA 2YPIA 3LB0A 3W22A 2TRSA 2H8XA 3LV5A 3RMJA 3FJLA 3M41A 2G95A 3FFSA 3VFLA 1EB3A 1WAUA 3IVTA 3TU9A 3EXRA 2A4AA 3PSVA 1YTKA 3C52A 4O16A 3W2KA 1TV8A 1X7FA 1QPNA 1G4TA 3QPYA 1ALDA 3L67A 2Y63A 3MP3A 3LV6A 5MHBA 3SGUA 3L66A 4FIRA 4B5NA 1KM0A 5C54A 1QDSA 3O07A 3PC0A 5HWMA 3QSRA 1WX0A 2HMCA 2NX3A 3P5ZA 5CZTA 4BI5A 2VFDA 4CQAA 3W6YA 3ABOA 4UFMA 5HWNA 3TQVA 4UTJA 4DF2A 2BZNA 4K6AA 4AAJA 4RKAA 1JR1A 3Q58A 3UPBA 3IIPA 3N3MA 3WJZA 3C61A 1F7BA 1VS1A 3GXPA 3PBWA 1BTMA 1GQNA 1PHQA 3KAOA 2B7QA 5CSSA 1KBJA 1XM3A 4UXDA 2CFFA 1DOSA 2ZZ5A 1GT8A 1OX6A 4GFSA 2Z6IA 3DZ1A 6ALDA 2NUXA 5J5DA 2VOMA 2HS6A 4TX9A 1JRBA 4GUJA 2QEZA 1BKSA 5IBXC 5U4NA 2CWNA 1WDWA 5D02A 3UY8A 1HFBA 1LM1A 4O19A 1X1ZA 4CCDA 1ICQA 1OX4A 5FEXA 4R7JA 3F4NA 4M5PA 1W56A 3D0CA 1N7KA 3A5VA 3EB2A 5IBXA 2I9EA 3GNNA 4IMGA 2ABBA 3NPVA 3GDRA 1H7WA 4O1BA 3N9RA 1L6YA 1SO5A 4A21A 1H50A 3BPWA 3NVTA 3UZJA 2NWSA 1QWGA 5FEZA 3KHJA 4IUOA 1W5MA 3CB8A 3W7EA 1VC4A 3G8EA 2Z1BA 1TV5A 3FIGA 4GC4A 5BMXA 1W5QA 4IPIA 4NXKA 1R2TA 3W71A 2R91A 3W72A 3O6CA 2VELA 3T55A 3L68A 4GRSA 2WPBA 3ZR4A 1GOXA 2E6AA 3LGEA 3S1XA 3LLFA 5AFDA 4LY8A 1KFBA 4IXXA 1QAPA 1THFD 1TTJA 4H6KA 4MPQA 5K7JA 3TQKA 1LLWA 1BWKA 1LRTA 2QR6A 3NO5A 1DKWA 1OFAA 1F74A 4LVFA 2RH9A 1LROA 1XUZA 5I3JA 3HG2A 1Q6RA 2A2IA 3DHDA 3WK0A 3QRHA 3NR0A 1LBMA 3BW4A 3DFQA 1JULA 3CEPA 2H90A 3R5EA 4O12A 2HSAA 3PBYA 4K8EA 4DXVA 1MEHA 3LCXA 1XDMA 4MVAA 3LRMA 4N2YA 1I2RA 2QCLA 2VXNA 3KVMA 1DJNA 1L2UA 3HPZA 3C2OA 1HO1A 4Z1AA 2NLIA 5G1TA 1QPOA 4MZ1A 5DCEA 1JQVA 1J2WA 3FKKA 1TO3A 3TJLA 2Y62A 1F6KA 3PSWA 3G18A 5KITA 3W7RA 4PH6A 3HG3A 4K7VA 3TUUA 1GVQA 2PCQA 4FX8A 5EY5A 4EF8A 4N6EA 3SIZA 3S6DA 1XI3A 4JN6A 4WY0A 3USBA 1VPXA 2RHGA 3M6YA 3W7IA 5D2YA 2J9ZA 3A24A 1G4SA 3THQA 5I3HA 3TV8A 1PS9A 2NZLA 3SJ3A 5AHNA 1TCDA 5C6MA 2FPVA 1H51A 4DPQA 1EEPA 4JDYA 4JGDA 3PB2A 3NQ7A 3STFA 4LRTA 3L0NA 4ZQPA 5D09A 2NXGA 3CWOX 3M0ZA 1WBJA 1B3OA 3IIVA 4S1FA 3QJAA 2CZ5A 3LERA 1EWDA 1SW7A 2Q8ZA 2GJLA 3O15A 4UTMA 3G1YA 2RDTA 2Y70A 3AJXA 3PUEA 2GVJA 1OX4B 4FO4A 4JDBA 1K7XA 3CT7A 5KZDA 1AK5A 4JS3A 5DCDA 3FYOA 4RX0A 4UTWC 1A5BA 3QPZA 2QCHA 2ISWA 3W83A 4XWUA 1FWRA 5D33A 1PCWA 3O05A 4OT7A 3B04A 4JEQA 1FCBA 1A50A 1SU5A 2V9DA 1TTIA 5TQLA 5FEWA 1KM4A 2ZRVA 4FNRA 1ME8A 2ZZ7A 5LGXA 1YDNA 4OHQA 1V5XA 1GEQA 4HNTA 2B7OA 3W1XA 2CZDA 4UUIA 1K3UA 5LKYA 4CNOA
chains in the Genus database with same CATH superfamily
4KEMA 1XFCA 4XD3A 4XBSA 1NDVA 4A4AA 2CEQA 3PZMA 1HJSA 4I7VA 5AN7A 1C91A 2PDNA 2QV5A 3P60A 2BV9A 4H2HA 1HKVA 4R3UA 1XR2A 1JRCA 1AMKA 1FDZA 3NXLA 5CKSA 1N8FA 4HU0A 1TX2A 4HNNA 4LX4A 5DMLA 4C6PA 4Z17A 1FCQA 1QW8A 5GNXA 3CHEA 4KH2A 4LYPA 3RAOA 3SZ8A 3A3HA 4WJXA 4L9XA 1POJA 2VDIA 5HWJA 2A5HA 3B06A 3A4AA 2QCFA 2FGZA 5D37A 3TC6A 2YSWA 4IP4A 2E1WA 4YCOA 4H7VA 1C90A 1I2NA 4IFOA 1DJZA 5GJMA 3ALFA 4WKFA 3W23A 3W84A 5LSMA 1UWQA 3KTSA 1FWIC 3HJEA 2DJXA 4RDYA 2ZCGA 3S5SA 3OOQA 1UD8A 2CC0A 4EAYA 3ZJKA 4ZENA 5LA2A 4Q8PA 4RZ4A 3STPA 5DF0A 1UASA 3FKRA 1GPWA 4ZXOA 3AUJA 3U5YA 2B7PA 4YTSA 3DYPA 3CEUA 1I1WA 4S3JA 3P6LA 3GQYA 3PPGA 4KEZA 1SSDA 1V79A 1IZCA 4CQCA 5REQA 3KCOA 1SO3A 2XSXA 4HHLA 4HZ8A 1A49A 3SUSA 3DC8A 4J27A 3P93A 4DAFA 4IGNA 2DORA 3LXAA 6REQB 1KFEA 4A29A 5LNRA 3KRBA 4MKNA 5CSUA 4PE8A 2W5FA 3E2SA 1CGVA 1DIKA 2Y7DA 1O1HA 3M5VA 3NURA 2EKGA 4YLWA 5JU6A 1CGUA 2Y7FA 4IJCA 2VM8A 3PJXA 3MSRA 4GQGA 5M5DA 2D24A 1I0DA 1MQRA 4B2DA 2X05A 9CGTA 2DUAA 1NY1A 2J66A 3G0XA 4RPQA 2EPHA 2VZTA 4PTVA 1TVPA 5FSEC 1M7PA 4IICA 1BKHA 4JFVA 2Y7EA 3HGOA 4IISA 4RPPA 3RMEA 1PYFA 2JKEA 1DL3A 1MO0A 3GDBA 1JUKA 4ZODA 3TFCA 2DZTA 4LTSA 4GBUA 3R89A 1WZKA 1AFSA 4OTKA 1IEWA 3TROA 1IF2A 3IUHA 2FZBA 1X6UA 2FVKA 3EAUA 2VTFA 2QW5A 1W9BM 1B4EA 1NWRA 3PK7A 2J7DA 2YX0A 4AD1A 2DH2A 4FF7A 2VX4A 3WJSA 2PP1A 3VMOA 5T9BG 1V08A 3WLPA 1KTBA 1OG0A 3BCJA 3WBWA 2VEIA 1FHLA 1PL9A 4YHGA 4GQQA 3CHFA 3SADA 4JKMA 1CGWA 2ZE0A 4D8AA 2ZUMA 2WNQA 2I14A 3WQEA 1Q5MA 3I3DA 4DO6A 1OSEA 1JCJA 1TPB1 3A13A 3V5OA 1CGXA 2JFEX 3MVIA 2D0GA 1LWIA 5C7HA 5LIKX 1ZENA 5AKQA 5FF7A 4J3VA 1K6WA 2ZX5A 1GORA 1N55A 4N4QA 2IXUA 7ODCA 1A3HA 3K1DA 4E0CA 5CZJA 1Z41A 9XIAA 3KOXA 5REQB 1OJXA 4RDZA 3RK8A 1Z9AA 1UBSA 2WB5A 3RLVA 1UKQA 4Z2GA 4PULA 1M7XA 1UWTA 3NQ6A 3V1HA 3IJDA 4LCSA 1JYNA 3AYTA 5H8UA 1V77A 3WFLA 5GJNA 3XINA 2H8ZA 1K8XA 3FW6A 3S9IA 5C2XA 5FF0A 3MB9A 1P4CA 4R7OA 1W9UA 1D7FA 1GYLA 2D22A 4I5RA 3R8HA 3W73A 3KFTA 1FFRA 1Y5VA 3LCIA 4X60A 1W1PA 4M6PA 5DLCA 1PUDA 3HMJG 3QMTA 2PD9A 3BV7A 4GX8A 1OBAA 3NOEA 4ZA0A 2GQ8A 3IACA 5D9PA 3W7DA 3TE9A 4QS5A 3C8NA 3GXDA 1M03A 3P8IA 2WMHA 4C1NA 4FNTA 4YL2A 1RPXA 4NVTA 4PMQA 4PTXA 5CPOA 2C91A 3DC0A 1V0MA 3LHZA 2QLYA 2OLHA 3EWBX 1RXOB 2FH6A 3BWWA 3NZ1A 3A23A 3LCFA 1WXZA 1GOOA 1SZNA 1VHNA 3T6CA 1LUCB 2H6RA 1BEUA 3UCCA 4I3GA 4GX9A 2O4MA 3GBDA 4UIOA 2E67A 3PANA 5EMYA 3DFTA 3LPFA 2AQWA 4LWWA 5A6AA 3O7UA 4JFWA 3A4JA 1DIDA 3HQOA 1AW5A 3DERA 1GOIA 1RLDA 4Y9MA 3IK2A 2ATMA 1Q2SA 4RR4A 3L0KA 2WKJA 1SSGA 4H19A 1V8EA 3S1UA 4J1OA 4UNIA 1TREA 4XTDA 4U5KA 5IFPA 2WVVA 3WFZA 4GJJA 3BQ5A 3ZVIA 4DXXA 1NDYA 2Y5JA 4XB3A 5C9ZA 4ZVJA 1TRIA 1ISXA 1JNEA 4ES4A 3L12A 4N7QA 1I6NA 3CQ0A 1QPKA 3W0KA 4M19A 1DBTA 4NP7A 2PRHA 1H7OA 1GZJA 3W1TA 2WMKA 2TAAA 4FS9A 3KBWA 3R13A 2XJ7A 3N17A 4PYSA 5CZ0A 1VPQA 3V4BA 3ZS4A 4FNUA 2FVMA 4PUWA 5BRBA 4W5ZA 1Q66A 2JKPA 1SW3A 4V15A 1HL2A 3LX9A 4JFUA 2JGYA 3R43A 4ZCWA 3AXHA 3SRHA 1A0DA 2GGIA 3FDGA 4YYCA 1UZDA 3CM4A 2PP3A 3CZGA 3CUHA 4A3HA 3WDRA 2DV0A 3NL6A 3LNPA 1Q65A 4CEXC 1CCWB 4KWOA 1PZ2A 1G5AA 3SGGA 1B31A 3K5XA 3LENA 1JPDX 3RJYA 4FX7A 2PDMA 1T40A 3UBPC 4W7WA 4IGMA 4X22A 5KZMA 2HQAA 3WQPA 3I4KA 4JTRA 2ZDSA 2QUNA 3OODA 1LBLA 3QQ0A 1GW1A 4DBUA 3B8IA 4C1NB 4E8CA 4UFLA 2FKPA 1S39A 4B5TA 2VX5A 4GLEA 2VT0A 3QFWA 4H9XA 4Y7EA 3RO6A 3P0XA 3K1GA 4DB7A 4U3CA 2XUCA 5HJXA 3NQMA 2A7NA 1JL8A 3RCMA 1B5TA 2HROA 3LLXA 2UWFA 3WLTA 8A3HA 1OFBA 1LCOA 3MO7A 1DWGM 3H55A 1HKWA 2GGEA 2XH0A 4GIRA 1KM6A 3BCDA 1U5JA 4XD5A 2A0NA 4RNHA 2F6UA 5A8OA 2Z7KA 1SR0A 3RIKA 4L56A 1EGZA 5K9DA 3M0KA 1V3KA 3P0WA 5E93A 3W6MA 1CGTA 1Z8AA 4EWND 4NZFA 3RUBL 1KO0A 3HM7A 3GC5A 1UA3A 2Y85A 1XSJA 2XIMA 3PNZA 2Y5SA 1RZMA 3DEQA 4F9JA 5D03A 1JZ6A 3UZ5A 4CU6A 1UJPA 4H4IA 1G1YA 4MWAE 2J75A 4WJEA 2WNNA 4UCGA 2WVVB 3LTYA 3MJYA 5CJ5A 3ALGA 3IJ8A 3MP4A 4GY0A 1GTEA 4LALA 1H7RA 1CDGA 2YBTA 1EZWA 1TV7A 2Z6JA 5BNKA 1I4NA 3UG3A 3WQGA 3GY1A 3W88A 2ZOXA 2WQDA 2OFJA 2JIEA 5K9XA 1UKOA 1E1CB 1VCFA 2ZA1A 1EL3A 5G4WA 3WUEA 3O9NA 5A6LA 1OX5A 1B3ZA 1HJVA 2F2HA 3CPGA 4OUIA 1VAHA 2ZZ6A 4HQVA 3E5PA 3QR1A 1VFFA 5IOBA 1PVNA 2EG7A 4JXCA 3ORWA 4I9TA 3SM0A 3ZIZA 1SW0A 3PZVA 4B3KA 2YZ5A 3PAJA 4GI9A 4BQ3A 4X61A 5I3KA 3UZZA 1C7SA 3CZKA 2EF9A 5I3GA 1IEQA 4LU0A 1CW2A 4AX7A 1ONXA 1HKKA 1BAGA 2OMAA 2EAWA 2QYGA 4N9DA 3MMTA 3AXKA 4OVXA 2DT2A 2AGKA 3CASA 1XLAA 1FX6A 4JFSA 3MP5A 4NNCA 4MG4A 3S9YA 3PUGA 1Q7MA 1XIIA 4FXJA 4U3AA 7ENLA 3PY2A 2QUTA 1JYWA 3EDEA 2GVGA 3PFRA 5IRPA 4PRRA 1BVNP 1XKYA 2O7QA 4YPJA 5ABHA 4NJJA 3C0JA 1PIIA 2WZIA 1XYAA 3AS0A 4X0NA 2AGTA 4C1LA 3OHIA 4UQCA 3W29A 3WMCA 1TPUA 3G22A 1DHPA 4BR1A 3SFWA 3LHUA 9XIMA 1WQ5A 4JIHA 1QHPA 2Z0IA 4MDPA 1K8CA 4BWLA 2PA6A 4Y9OA 3EEZA 5BXTA 4PGLA 1OCQA 3TOPA 3VOGA 5CC6A 2V0TA 2X1TA 3WBAA 3H7UA 1GQKA 2G41A 3SAZA 2WVUA 1PIGA 1J0JA 5M2FX 3PS7A 2RGLA 1QNPA 3GUWA 1C8XA 4MLJA 2D0HA 4MB4A 3GE7A 3CQHA 4B3ZA 3GDTA 1DORA 2G5WA 1KGUA 3AWOA 2BXVA 1GOWA 1H7NA 1LRNA 4GO9A 1DWHM 3ITVA 3QQ1A 1CWYA 1Z89A 4MJMA 3CUZA 3VTRA 1ONRA 4JTSA 3OQ8A 2AAAA 4ZSUA 2PPGA 2E09A 4DWSD 2XH7A 2X40A 5DANA 4QISA 5LA1A 3LOTA 4DYJA 1P6WA 4Y9AA 1RR2A 3A4XA 1PJ9A 3CUFA 2W27A 1B54A 3WENA 3KZPA 1AVAA 1FTXA 1DQUA 3ABRA 1BFNA 1G94A 1MEWA 3DX5A 1RK6A 3A47A 1JCXA 3SSZA 4KWWA 5HNNA 3E6EA 4IH3A 3MUCA 4JYEA 1TUXA 3I6RA 3T8QA 4BS0A 3VMNA 3QKZA 3GX9A 4J3WA 3BC9A 2BDQA 2FZMA 1NF0A 1B1YA 3Q45A 3A9BA 1EJVC 3UVIA 4QCEA 2V5JA 3H7RA 2FLIA 3APGA 4Q4QA 4QDPA 2UY3A 1UKPA 1IIGA 1TELA 3W7JA 3NQVA 3MKCA 3H70A 3TSMA 4W9TA 1I0BA 5K4ZA 1VLWA 1D3GA 3CV7A 3NG3A 3L5LA 1US0A 5IM51 3GFYA 4CKQA 3R12A 1TQXA 1E9LA 1DJHA 3FSTA 1VEMA 3LA4A 2YR1A 3NPUA 3VM7A 4E4UA 1Q85A 5AC5A 1OT2A 5DMYA 3VUPA 3RU6A 2IKJA 4P2VA 4AHQA 2WWCA 3QY8A 2E6DA 3GG7A 1ZS2A 3KBJA 2PDCA 3U2EA 1HXJA 3WLQA 2PTYA 5H8MA 1E9ZB 3ZT5A 3NEHA 1J9YA 3MU7A 3ZJ7A 4FZIA 3VI2A 3SGZA 3WQFA 3BK0A 2F38A 4DX3A 3IGXA 4DJEA 4AHPA 3BAWA 2SFPA 2YCKX 4P7OA 3WLKX 2PB1A 4HPXA 2KX9A 2B4GA 3NNTA 4NJKA 2FFCA 2Z7GA 3WBEA 3WX7A 1BYAA 2C1HA 3KRUA 1WUFA 3F1QA 4PODA 5D4YA 3THDA 1GVRA 3I7SA 4BJHA 3T81A 3CAWA 3FY1A 3WK2A 4BI6A 1OCNA 4I9JA 3AIBA 1J0KA 4PFMA 4X3ZA 4MAZA 3OBAA 3O6YX 1W8SA 1FWNA 3PJTA 3WF3A 1OT1A 4OV9A 4MAVA 3WLRA 2GSEA 4NRSA 3AS1A 1M1BA 3O06A 4AD5A 2IPGA 1AQ0A 1NAL1 4AF0B 1P6CA 5DCBA 3WK1A 1YADA 3TR9A 1CLVA 1KLYA 2OZ0A 3V5FA 1KRCC 3CU2A 1VHCA 2ZRZA 3U57A 3TTYA 2FQIA 1R3VA 2J24A 3QOKA 4C6OA 3NGFA 3H22A 4L5ZA 1UP0A 3K8LA 1ITXA 1FDYA 4XSMA 4JTQA 1FUYA 3WQVA 4LVGA 3TFXA 2C13A 4LANA 2WANA 4CNNA 3WNPA 4JX6A 1KV8A 4QEHA 3E1F1 1ICPA 1IR2A 5TNVA 1TV3A 2PDLA 1DVJA 1U30A 4FHAA 2E9BA 2BSLA 3OGVA 1CLXA 5HINA 5A94A 2PUZA 5CLTA 1CXIA 3ZSTA 3AWNA 3VX1A 2CLLA 3C2YA 4LXFA 4POCA 2ZUWA 5A6SA 1R8LA 5FJPA 3ES7A 4PEKA 5BWFA 4LC8A 5DFAA 4N9BA 2CBJA 3HBLA 5J5RA 2OYKA 2A7RA 3AFBA 1HL8A 3I7RA 1QHOA 3MTWA 3BOXA 3T0CA 4J9JA 4E3TA 2D2GA 1ONEA 1P7TA 3B9EA 2OEJA 4RL3A 3EMQA 1NOUA 4HYVA 4S3KA 3UJSA 5H8PA 1CB2A 3QW3A 1TMQA 3RNDA 4EPBC 4TTUA 2HK1A 2CESA 1EP2A 4ZGYA 2CLKA 4EXBA 2D69A 3CHVA 1TPC1 4GINA 2ZX7A 1RBLA 3U8GA 4MADA 5G2WA 1TE1A 4JBRA 3CWNA 4H9MA 3W7KA 2DPEA 3UA3A 1S5NA 5H91A 2IPWA 2Y61A 3VFCA 1MEIA 1WUEA 3RCNA 2WLYA 2J8GA 3MUIA 4XAYA 3BOFA 2OT0A 4NJGA 3LCHA 3GG0A 2CLPA 2EXOA 1KBKA 4O4WA 1TCMA 2QCEA 2WSQA 3BSMA 4UTFA 2J25A 1VEOA 1WKDA 3F4WA 4J5NA 3STEA 5C8BB 3I10A 4QHRA 1W5OA 2F6KA 2WJEA 1R3RA 5K4XA 1E9IA 1XYCA 3GH7A 4ZQNA 4AEOA 1H11A 3IAPA 1DJIA 4P7RA 3DH7A 1EJSC 2PLJA 3JW7A 4LVAA 2OT1A 3AROA 1UR4A 3VDAA 4Q7BA 3SW6A 3LY0A 5C0QA 3HF3A 4Y6GA 4GUFA 3CMFA 4TXEA 1FKXA 3UXDA 4W85A 3LD5A 3VCRA 3RYSA 1OFRA 4MUZA 3C2RA 1EDGA 4PB4A 4LRSA 4HPJA 1ZCOA 2I16A 1ISVA 1XGZA 4U10A 1UD4A 3ABSA 4XTIA 1KGWA 3P14A 3RO8A 4LH8A 3DN5A 1EJUC 3ZR6A 5CSYA 5E0KA 3TXZA 3A21A 2BP1A 1S2CA 3N73A 1BD0A 4E5TA 3CGTA 2V67A 1UQZA 2OKOA 7TIMA 1L8NA 3MCMA 5D32A 3F4VA 4OBRA 3VE9A 1JCNA 1GKPA 5IHSA 4JTIA 4W8AA 3G8RA 5I07A 1A5AA 1P7TB 4IXHA 4Z2JA 3S5OA 2ZWYA 3MHFA 3C0QA 3SN4A 3ATZA 1QPQA 4UR7A 1Q4NX 7CGTA 4GYFA 3TA9A 3WKZA 3GVQA 1TJPA 4HT3A 1OFOA 2MNRA 4LEFA 3VDBA 3RF9A 3N25A 2OSWA 1HNYA 3RRXA 1AQMA 2Z1SA 2Z4GA 2W9MA 4LSBA 1O12A 3KOFA 4PMNA 3GU9A 4IX0A 1S3HA 4D8LA 4F8XA 3E2VA 3GXIA 4O1CA 1JAEA 2ZWZA 5A8PA 3Q65A 3Q37A 3ANVA 1E5JA 4M6QA 3W1QA 2PWFA 1JZ4A 2QCNA 3H24A 1S1RA 1MXGA 1M01A 2P3ZA 1KW1A 1PZ3A 5JIPA 3N11A 3LHTA 4WXYA 4TOQA 1V03A 2AL2B 3B9AA 3ZM8A 3SCOA 3FGCA 1KFCA 4QM1A 4OWGA 2A3AA 3BG3A 1OF6A 2AMGA 3MPGA 2JALA 1X6LA 4AW7A 4NI8A 4TQTA 3PBUA 1ZJHA 3M47A 3TYZA 4H9TA 1ITQA 3ZSSA 4XBJA 5G2HA 3AU6A 2W92A 4G5DA 3WJWA 1EPXA 2VJXA 1ZJIA 2FIQA 5A95A 4L61A 2OJPA 4WSJA 4L9YA 5FJIA 2QIIA 4I5UA 5F2GA 2XSBA 4BZYA 1RQHA 1BGAA 1KFJA 3ARTA 4JOMA 2VURA 3W53A 2CLMA 3GZAA 4QDWA 3DI0A 5JXQA 3S2LA 3L21A 3URAA 2CKSA 2A85A 1KM3A 4AZ6A 3NAVA 3ELFA 1OG6A 4DUOA 3SCWA 3IJ6A 2B7NA 2FJUB 4JIQA 3SUVA 3W7OA 4OIFA 2NSXA 4EPKA 4JIIX 5I24A 3QV8A 2WC7A 3EPOA 4IMCA 4F2TA 1MFUA 4YNGA 2FDSA 2OVLA 2FHFA 1L0PA 1XICA 2VRQA 1BVWA 2Y88A 3AZSA 3KLLA 1J6PA 4Z2IA 1AL8A 2O7SA 3GXMA 3KTXA 4UTUA 5HR6A 5EU9A 3WQ5A 3RG6A 1G0CA 2BHUA 1EPVA 1XUUA 4DO5A 4YS1A 2YPIA 2TRSA 3UR5A 5FSDC 3FFSA 1P43A 3EXRA 1H1NA 2A4AA 3PSVA 4O16A 1X7FA 1QPNA 1EOMA 2WMGA 3L4XA 3E0WA 2CIPA 3L67A 1R38A 1GONA 1V6XA 2P88A 2Y63A 4HMCA 3BLLA 3LV6A 4FIRA 4AG0A 4D72A 3RX4A 5HWMA 2NX3A 1SJDA 2VFDA 1EC8A 4KRTA 4DXKA 3GW0A 4UTJA 2QMJA 4K6AA 5EMLA 3Q58A 4AY8A 2RGMA 4KGJA 3N3MA 2X7VA 1F7BA 3PBWA 4V33A 3DDMA 2PU1A 3QHMA 4GACA 4DZAA 3KAOA 1H49A 2J7HA 5HNTA 1XM3A 2WCAA 2CFFA 4AIUA 3IJLA 1GT8A 1OX6A 6ALDA 2XIOA 2X0HA 2VOMA 2HS6A 1KKOA 5CGMA 1BKSA 4YU1A 3EKGA 4XZHA 3JVAA 1ITUA 3GWQA 5FL0A 4HPGA 3UY8A 1NU5A 1LM1A 4O19A 4ZO9A 2WHLA 4CCDA 3L2MA 2V3DA 4AXNA 3VNKA 5FEXA 3OZMA 3VOFA 1R3TA 2YCIX 4EANA 4IMGA 4H8NA 2ABBA 5EMJA 4HCLA 1QATA 3CUXA 4O1BA 1L6YA 2JEPA 3NZPA 2NW0A 3PWIA 3NVTA 1QI5A 3UZJA 3WYZA 2PBOA 1HP4A 3XIMA 2ZADA 1HVXA 4NRRA 3AMDA 1LL7A 1JPHA 1Z3NA 3U7BA 3PZNA 4GRSA 1F3WA 2VX6A 2DSVA 3AMLA 1W1B1 2WPBA 4QGCA 1MRQA 1GYMA 4H01A 4LY8A 2NQLA 1KFBA 4IXXA 1B3VA 4MPQA 1BWKA 1MWOA 1OFAA 3ZVHA 2PS2A 4CD6A 3CH0A 1RHCA 1E6SM 1V7AA 4MWAC 3QRHA 2FDMA 3BW4A 1A5MC 3OW1A 2GGHA 4M1BA 3SBFA 1QT1A 2KAUC 3VK5A 4N2YA 1I2RA 4C6QA 1TWWA 1DJNA 1L2UA 3CAQA 4IQJA 3N4AA 4FR6A 3HPZA 4D6DA 1OD0A 2J6VA 1HO1A 2EJAA 4Z1AA 3T0DA 3T2QA 5HBFA 5DCEA 1IR1A 1Z69A 1JQVA 3FKKA 5BXRA 3TJLA 2GJXA 3PBGA 2PODA 3G18A 1BQCA 1TV4A 2EJ1A 4D71A 1TZ7A 4G6CA 4DVOA 5JBEA 1PIFA 1GVQA 5A2BA 3PAOA 3E2QA 1KRBC 2PCQA 4FX8A 1UOZA 4FOUA 1XI3A 4JN6A 5A69A 1YPXA 4ERAA 5D2YA 1W9XA 2BVDA 2QF8A 4ATWA 1WDQA 3D47A 2NQ9A 1PTAA 2GDVA 1R6WA 4LY4A 4HOXA 4ZE5A 3FXGA 1JI2A 4I8DA 2BGQA 1EEPA 2BMBA 1EDTA 3NTYA 4LRTA 1AODA 1UC4A 3EA3A 5MF5A 4NZ5A 3CB3A 1WBJA 5CAKA 2QPXA 4LCRA 3QJAA 4W7UA 1EWDA 2VRJA 4UTMA 5C71A 3A4WA 4LAKA 3PUEA 4GFIA 4WGHA 2GVJA 3AHYA 1VP5A 4P7QA 3AZRA 5KZDA 3ZR5A 4AVNA 4F48A 5FOOA 1ZPTA 4RX0A 3WLHA 4OT7A 3B04A 3M07A 4JEQA 4RNJA 4DO7A 2DZAA 1IWBA 1KM4A 4J3TA 1DJYA 5CG0A 2PDWA 7REQA 2QZRA 2VZUA 5LGXA 4UZUA 1GK8A 1V5XA 1GEQA 3W1XA 2CZDA 3IUIA 4UUIA 4CNOA 4R88A 4XD6A 2P8BA 4DJDD 1WDSA 4UBPC 4BKNA 4IPLA 1E4MM 2FTWA 4B5XA 4EWJA 1WA3A 3E38A 2ZKMX 3KWSA 4LCQA 1HP5A 3G1DA 1AG1O 2VEGA 3B05A 3UR2A 4F66A 3ZVHB 1NARA 4ZO7A 3S42A 3N3TA 3M0HA 1LJYA 2FPYA 4WGXA 1GYNA 3UZYA 5C55A 2VDGA 1FWFC 2YBVA 3LSCA 1IGWA 4HU3A 5CC5A 1XYLA 3ZO9A 1MW3A 4MWAB 4C5ZA 1P5BA 1WDPA 4ML4A 1LG1A 2QCMA 3AALA 3NQBA 2PLCA 4GC3A 3CYVA 3PZQA 2Y6ZA 1IXNA 3AJ7A 2ZTJA 4NJHA 4QE5A 3GTIA 3W26A 3MCOA 3AIEA 4PUEA 4ALDA 4UNKA 7TAAA 1I9CB 4MZYA 2TMDA 2GOUA 2ZQ0A 4B3LA 1E15A 4M24A 2E68A 1VFLA 2PSNA 4LS0A 3SRFA 4S3BA 4LUSB 1O95A 3CYJA 3HQ1A 2BXYA 4XK2A 4IP5A 3QH2A 3UWYA 3WNLA 3K8KA 2YXXA 3Q2DA 3GKFA 3RM4A 4A6GA 3M6DA 8TIMA 1K03A 3BUVA 2VGBA 4ZB5A 4Q4SA 4Y2WA 2E9LA 3PTMA 5TBOA 3GR7A 4O28A 1XIGA 1EGMA 5AHLA 5AHEA 4C7GA 3FVDA 4QP0A 1LT8A 1JUEA 2E8ZA 5H1WA 5BXPA 3RHGA 5I09A 2PWGA 1XD1A 3ME3A 1C9DA 1QCWA 2ISSA 1K4HA 4IIBA 1VJIA 1EBGA 5AHMA 1AUSL 4NXSA 2HV5A 2BS9A 2HXTA 4GWEA 3UA4A 3CIWA 4HMEA 1C3FA 7REQB 3W6LA 1UR0A 2CHNA 3WD0A 4TU1A 1KM1A 3BG9A 2J6XA 4YYFA 2D1ZA 3H4GA 4I5XA 4P8VA 4QIUA 3ID7A 4UCFA 1XC4A 3GFZA 3F2BA 1O4UA 3BAKA 5I02A 3BLKA 4WDXA 1UD6A 4YTUA 1ADOA 2VD8A 3OU8A 2J88A 1XSIA 3OA5A 4NT0A 3GNOA 3YPIA 4WXZA 4NX0A 2VVSA 1K9TA 4GVIA 2G37A 3W2LA 3H26A 4ZSTA 2I5IA 3S1VA 1W3NA 2QGYA 5D9OA 1UD2A 2GWNA 2A6NA 2WBKA 3THUA 1X1NA 3N2OA 4KEVA 1MW1A 5FJOA 2YCJA 3WD3A 3QV7A 3H54A 3ANYA 4S39A 4CQDA 4DHGA 2HTMA 2NWRA 1XRVA 4HN8A 1PYMA 3T44A 2CLIA 3TC3A 3T0AA 3KRSA 7PTDA 1NDWA 1O66A 4JTCA 4XX6A 1G7UA 2A3CA 2YA0A 4NNAA 4IPPA 1WO2A 4TVDA 4UMBA 5C9RA 1I2OA 2WO5A 1S5VA 3Q94A 3TSBA 2WXDM 1CXFA 1RCXB 5I3IA 1DJXA 1G4EA 3A6OA 1PKMA 4GKLA 5EPDA 2ZFAA 4QRNA 1YDOA 1UQYA 2Y1HA 1UWRA 3GNXA 4FXFA 4FA3A 3DFSA 2PF8A 3QF0A 4U33A 3W7NA 1J5TA 4HVXA 4O1AA 3OBKA 3UD6A 2D2JA 2BHZA 4JNZA 2FGBA 3AHVA 1TTPA 1GVSA 4S3AA 4KCWA 2QUUA 2RDXA 3N9KA 2DIKA 3GW3A 3LQLA 1F2JA 3O6DA 3SEPA 3W24A 3WQWA 5KEZA 1JXJA 2WYSA 2R94A 3IVSA 1JCTA 3W01A 3TNOA 5F1VA 3WIJA 3FNDA 4EXAA 3TMQA 3CWHA 1OK4A 1XFBA 3NQGA 4L1WA 1F5ZA 3BAYA 4JYDA 4TX8A 3CL6A 3GDMA 1A5CA 3CQKA 4YXGA 4JTAA 3I68A 2J62A 3NDOA 4MY9A 4D1JA 4BQ4A 3TCSA 4CN4A 2OSYA 3UJEA 4CCCA 1AW2A 3K8MA 2NVAA 1TB3A 2NXHA 2PRLA 3VGHA 3P82A 3BQ6A 1NDZA 1WE5A 3BLIA 3UJRA 4P7NA 5BWAA 4G1KA 2GOKA 1ZB5A 2PDGA 4CCZA 4DJDA 4IMFA 3CLMA 4AZBA 4ZO6A 4Q8NA 4LUJA 5ABGA 1O5QA 4PBEA 5DRIA 1TSIA 4K36A 3FV9A 2J7BA 4WIWA 3VCCA 1FQ0A 1JCMP 3LXBA 1FY6A 3RCYA 3KBNA 1XQLA 4ZTXA 2WJDA 3THAA 4L6DA 5E6ZA 1E4IA 2OQYA 3DFOA 5D2VA 2C6QA 1MSSA 4HKPA 3EX2A 3M7WA 3POHA 2I1OA 3QTPA 3DESA 4FNPA 4CNPA 3S9ZA 2WSRA 3WCZA 3BARA 1XG3A 1E6RA 5I0DA 3VM5A 4PC8A 1PTDA 5C5YA 3S4TA 1QNRA 2D0FA 3AMKA 3C0LA 5CPTA 5FEPA 3ERPA 1VBUA 1KFKA 3RLUA 2A3BA 2ACSA 4LS1A 3URBA 5CGTA 2GVYA 1ZY9A 3UNDA 2WHKA 2DQWA 3KS5A 3OYXA 5F2LA 3W70A 3AXMA 3RX3A 2DW6A 5ABTA 2QT3A 3EKLA 3GK0A 3NWRA 4DUVA 2ISDA 1X96A 3MANA 3LG3A 1F73A 1VGAA 4GXWA 3KVKA 4FX6M 1U83A 3WL0A 3DYMA 3WH5A 1XGDA 1PDZA 3CH9A 2AAMA 1RP8A 4AD4A 3PPCA 4H6EA 2OB3A 4JY8A 3D5HA 3FN9A 1EIXA 1WXYA 4OUEA 3WF1A 4WY0F 1OINA 1PWLA 4MY8A 4FIQA 4XKYA 5J8LA 4I90A 1H3GA 1EWEA 1MNSA 4LYKA 1TTQA 1VYPX 4QX4A 1XRSA 2GUUA 3U48A 4C6CA 1JNDA 4H04A 2YFNA 3G6MA 1TWZA 1UR9A 4LYRA 3URNA 1ZRQA 4PEEA 4PZVA 1XF0A 3M5XA 3NYZA 5T91A 4J35A 3RR4A 3UY7A 1GQLA 2HE8A 2PWDA 3SCUA 4XVDA 2Z27A 3OLEA 3SI9A 4C6MA 1HUVA 4ZXLA 3V36A 3EWDA 4AYGA 2P5NA 1NP2A 4QNWA 3N13A 4DWSC 3VCNA 3GFXA 3BLEA 3CV6A 2O92A 1DQWA 1P0KA 1RQBA 4YCPA 4K7YA 4NX5A 1UUQA 1P0EA 4FEZA 2WOQA 2DT0A 5E1QA 1Q6QA 3SR7A 4XD4A 3BW3A 5ENLA 4XZIA 3IUDA 1LT7A 2FZNA 3UQNA 3Q4DA 1UPMB 3LHVA 1EA0A 1XX1A 1US2A 5KMYA 2E4TA 4QJ4B 4IHCA 2CETA 2VEKA 1BXNA 1CLKA 5FJRA 8CGTA 3U6WA 2B0MA 4LUYA 3VIJA 4DF0A 1VBGA 2IW0A 2J8FA 4NZJA 3VNZA 1OABA 4HA0A 2YA2A 3N14A 4GK8A 1FH9A 3MKKA 1JDAA 1E70M 5KZEA 1RV8A 3LI0A 3W87A 4JTHA 2W79A 1KFWA 2QQ6A 1REQB 2DZVA 2OELA 2PCEA 5DBUA 3A5FA 3SJNA 1G67A 1LOSA 1ZP4A 5CBJA 2REQA 2PDPA 5F4WA 3NA8A 1GQJA 4NAFA 3PG8A 4P8UA 1IQ8A 2ZRWA 1E72M 2HE5A 1SO4A 3PG9A 3TW6A 2QULA 4UOJA 1IT8A 3XISA 4WY0B 4DZIA 2OWXA 1EGVA 4IG2A 1FXPA 4LS2A 5F4XA 1OGSA 3LPGA 3W9ZA 2WM1A 4XKYB 5HMSA 1S5TA 4ZQOA 2XIJA 2F84A 2G96A 4Z0JA 3BICA 4DIAA 1JZ3A 4UQDA 1O5XA 1NFBA 2EGZA 1A5KC 1EYEA 1F76A 1EEXA 3P84A 3UYIA 2VHLA 1G4PA 2FH8A 3UEQA 1OFPA 1PHWA 3NL2A 4YN5A 1VH7A 2YL9A 3M1ZA 1UWIA 2XGZA 4LNYA 5C70A 4H83A 3LI1A 3W1RA 4EIVA 1GOQA 4PRWA 4L80A 1WP6A 2QDEA 4ZQMA 3EDJA 4LUIA 4JTTA 1OC7A 2CZEA 2DQXA 1VR6A 4M82A 2IQDA 2ZBTA 4LB3A 1XWYA 3OHMB 1SZGA 1D7KA 3BMWA 2NUYA 2ZX8A 2V5CA 2PD5A 4JIPA 3QN3A 2YB1A 2ZUSA 4GH3A 4DAIA 1E5NA 3ABQA 4LVDA 3W4RA 4UZSA 4ILSA 3NGJA 4DJFC 2IQ0A 2NUWA 4KCVA 2R1MA 1JD9A 2PTXA 4IIDA 2V3EA 4DJFA 4Q4RA 4Q33A 4H1ZA 5LHEA 3LEPA 4GZJA 4PN2A 4MY1A 3VGBA 1NSJA 4N9CA 1D8WA 1GVFA 1R2SA 4R27A 3TIMA 4AX6A 1VBJA 5GQBA 5HMEA 1JFHA 1W3LA 1A5LC 1OB0A 3F4DA 3G24A 4RE0A 4LYQA 2CCRA 1UA7A 3GYEA 4HTBA 3RJXA 1KTCA 3AIUA 3C86A 5JH2A 3SQSA 3T40A 4ZB2A 1UKSA 3K13A 4DUWA 4XUYA 1WBHA 5XIAA 4WHBA 1YXYA 4CVWA 1V6UA 2BVYA 1OC5A 1WAWA 4V27A 3DFNA 2RFGA 5G4EA 2YL5A 2PI6A 2ZX6A 3B97A 2EEXA 2ACRA 4XIAA 4HA3A 3GNDA 2WJFA 1JUBA 3QV9A 4EACA 4A3RA 1JCLA 3M7SA 4C65A 4F9DA 2YFOA 1NM9A 3B8SA 4Z1CA 3M46A 3WLIA 4HIBA 1H63A 4DLFA 3NQCA 5D9NA 4Q32A 1VCVA 2E25A 5CAHA 1M7OA 4GVGA 5AYIA 3HZ3A 3KHDA 3TZFA 3CZLA 3HA1A 2P53A 1KXTA 4AB4A 4OGZA 2I5QA 1BWLA 4NZ1A 1UP2A 5SWUA 1DV7A 3S0CA 4MJ2A 3H4XA 4O53A 1I2QA 2HBVA 4K37A 3LM3A 1GVOA 4AIBA 4TO8A 3L5MA 3PBMA 1U1UA 1YHTA 1D3CA 1XC6A 4TMBA 3APTA 4DZ5A 1LZOA 4Q6JA 3DFPA 1A3XA 3RITA 1MUMA 2DDXA 1FWWA 2ZC1A 3KW3A 3QVQA 5F2IA 2YGYA 4O15A 5DY2A 2FMOA 4KRUA 1I1XA 3W74A 2DH3A 4Y90A 3EOLA 2I56A 3P80A 4IPJA 4YHEA 4ZFCA 2D73A 2ZA2A 2OGYA 3BL3A 1W9PA 3LZ3A 2J9XA 3NZRA 4L4OA 4JIRA 1FDJA 3VMPA 4ENLA 3ITGA 3BURA 3PJUA 3E0FA 5AC4A 3CC1A 3ABZA 4DN1A 1S5MA 1FWSA 4A8RA 1L6GA 1E0UA 3DAQA 3CIVA 4N6FA 1CTNA 5LA0A 1AH0A 4C1KA 3W28A 1HF6A 2VCBA 4XAGA 3TVAA 3VNLA 1DJGA 2E40A 5CQ1A 1FRBA 4WVXA 3QQWA 4B2DD 3M43A 3P8JA 4AC7C 3S47A 3BG5A 4LW7A 4R53A 4RCXA 1W1VA 3WNOA 3LBOA 3GHUA 4PSPA 4KRZA 3GYCA 1EUNA 2V3FA 1VB9A 1DE5A 4G2DA 3SURA 1CYGA 3VIFA 1QBAA 4UOQA 1C93A 1JPMA 3WBXA 4M6VA 1XV8A 3ITXA 2VKZG 3P62A 3QY7A 2OLAA 5BOOA 4MNLA 5IXEA 4S3DA 4IQEA 4KWUA 3NL5A 2YOCA 2EKCA 2OG9A 2C14A 3WN6A 3GIQA 3ITCA 2O56A 4ZB0A 2P1FA 3E0VA 7A3HA 3ATYA 4DUXA 2Y2WA 5IHRA 3MBDA 5GNZA 2VGIA 2QCCA 2G8ZA 1TVNA 3LMZA 5BCAA 4AHOA 2DZUA 3M0IA 2Y8UA 3INPA 4CD5A 2OOFA 1EO5A 4JD4A 3G0UA 4C91A 3GHSA 2QCDB 4JTJA 2HS8A 1PB0A 1Q6OA 1M68A 4R85A 3FYPA 1R2RA 1FOBA 1LOLA 4G7FA 3WMBA 4QAIA 4BHYA 3UCQA 1XBVA 3LHWA 2ANUA 4GH1A 3O2LA 1QO5A 3N2MA 1W3IA 4Q4OA 1CXLA 2CERA 1QK2A 1GPFA 5DN1A 2VENA 5EBUA 3CV1A 3OQEA 3L4ZA 3ICJA 4NAEB 5AZ0A 2VZVA 3K4WA 3ITTA 3P3BA 3ZLGA 3TDFA 2CBIA 2V5KA 1GOKA 3NQFA 3AZTA 1EP1A 1FWDC 2Q02A 4FLOA 3F2CA 4C5YA 4B5WA 3GZ3A 3QM3A 2Y0FA 3WF0A 1IZJA 3IJ7A 1MQPA 3B8VA 1UP3A 4B4FA 1B4KA 2X2GA 2QJMA 4NSBA 4AY7A 3N29A 1CENA 4GBDA 1SFTA 1CXEA 3VKKA 5HMDA 1KWGA 2AQVA 5G1YA 3ENLA 3CTTA 3N04A 1OFDA 2QJIA 4XZWA 1J0HA 3L2IA 4QLJA 5I3DA 2WSYA 3GNRA 5EFDA 1JDEA 1E3XA 4NF7A 4B91A 3EXSA 2ZRXA 3MUY1 5DXXA 3PWGA 1ECEA 1E4LA 4H3DA 3I4EA 1A0CA 2JK2A 5B80A 3LNMA 1KXHA 3DXIA 3TX9A 2XIIA 2X30A 3CZEA 3BAIA 4DQWA 3TEVA 4Z2LA 2O0TA 3FLUA 3VZYA 1E51A 3WF4A 1OFQA 4PCFA 1AD1A 1XDLA 3W02A 1KQYA 1K6AA 2OWWA 3WJXA 1J96A 3BO9A 4LFYA 5FF4A 3LDVA 3WK3A 1W1YA 4JHOA 5FKYA 4PTNA 4R5EA 3SUWA 4JNYA 4DI8A 4ICCX 2Y5EA 1LWHA 1M7JA 3IARA 1HQTA 1HJQA 4GZEA 1VQTA 4NQ1A 1V6WA 1XS2A 2XN0A 3EB3A 3RRAA 4PRTA 2VWSA 1Y0EA 5I2UA 4M7SA 4JICA 2BODX 5CEWA 3SIMA 1UUOA 3MS8A 2PGRA 1AMYA 3MO4A 1W3HA 3IIOA 4TVUA 1PKNA 1B30A 2C1GA 2VC5A 3W75A 3ITYA 2YDAA 1QTWA 3FYYA 3G1VA 4JL2A 1R7AA 3T4WA 3B8UA 4H6RA 4MOZA 6TAAA 3U4AA 1G69A 5FD0A 5DMMA 3STCA 3NQAA 3U2OA 3WL1A 1TWSA 2W61A 5C9WA 5FJJA 3F2DA 2ISVA 3H6OA 1EOKA 2PTWA 3HGJA 1H7XA 3V16A 4IMAA 2PLKA 4JTGA 5FL1A 1XLFA 4CEUC 3IWPA 2YXGA 5I23A 4HNVA 1T96A 3MHUA 4S38A 3F5JA 4D6HA 4J4KA 3HQNA 5I6SA 4HZMA 3P2VA 3R6IA 3KP0A 1IZKA 4RNIA 1RCQA 4MZ8A 3PM6A 4U4MA 1EQPA 1LF1A 2EO7A 1SR9A 2PDUA 3JUGA 4DF1A 3VA8A 3W3OA 1QOXA 1JCYA 1X98A 4GISA 1OGBA 5KETA 2WHMA 2P0OA 3OLDA 2YYUA 4PCTA 3S2MA 1H0GA 3F5KA 3GAYA 3GD6A 5CSRA 3L5AA 1Z48A 4KFPA 4KT2A 4JQ1A 3G3MA 2PDBA 3KRZA 3W00A 1LP6A 1Q2RA 3APYA 4DLMA 4WSHA 3W1PA 3G1SA 3DOPA 4GZ7A 1M53A 1BYDA 5FCZA 3C2FA 3S1WA 1V6YA 2V82A 4KPLA 2NV2A 4BY3A 2C79A 3IAQA 3VKDA 2RJGA 1NWUA 3K4DA 1GJWA 3PBVA 3TC7A 6XIAA 4UQEA 4KKXA 1TJ0A 3UW6A 2VC9A 2QJNA 1TMLA 5K3VA 4W84A 3EWXA 2VEFA 2VNCA 5HK4A 5GVJA 3I6EA 4Q8OA 1BYBA 5JH1A 2J7GA 1OFEA 4PL1A 3TJ4A 3EA1A 4L1GA 1W9VA 2A1YA 3EX1A 5HNRA 5AOUA 1LUCA 1RBOB 2J78A 1V93A 4JAWA 1XLDA 2X16A 4XO6A 1W8GA 4E2DA 3CQIA 5EB8A 1YX1A 4JNMA 3FJNA 4MIMA 4QS6A 1GZGA 1YBQB 5DY3A 5EFFA 4FNQA 4ADSA 5HATA 1R3YA 3WY1A 4WOQA 2BXZA 3JS3A 1VIZA 3WZ0E 4LC6A 1V0LA 2Q3OA 3P74A 4C6DA 1GCYA 5CGQA 1T99A 2EPLX 2XIQA 3PZGA 2GSJA 3MHGA 4HBKA 4FPSA 2XYLA 1BG4A 1GOMA 2D2HA 3NM1A 2YJQA 1MW0A 4UFKA 4PSRA 3FDKA 3MV01 3BLOA 2H8XA 4AU0A 2G95A 2J7EA 4LAUA 3VC5A 3LGDA 1I75A 1D8CA 5IDZA 3TU9A 1XLKA 3WLSA 1SMAA 3PNUA 4FOKA 3C52A 3WQ8A 3R25A 3GUGA 3ZYZA 1DEDA 4J40A 1G4TA 2CKRA 2ASHA 3AMGA 5HNUA 4B5NA 2VWTA 1CGYA 2XG9A 1S3TC 4F79A 4EX4A 3UPMA 3H2FA 1WX0A 2HMCA 2IPFA 4WCJA 2DFAA 1WZLA 2BASA 4N42A 3CMJA 4J7RA 1KRAC 4JQ4A 3T05A 1U22A 4JL1A 1ZJBA 3R10A 1L8PA 2HBXA 3UPBA 3WJZA 1ZUAX 2QUMA 3C61A 4MKSA 5JBFA 2X7WA 1PHQA 3KDOA 2WZEA 3PPHA 1KBJA 4UXDA 5CXPA 2ZZ5A 4Q22A 3UVAA 1NJJA 2NUXA 5J5DA 1F4AA 2Z2BA 4TX9A 3VNIA 4GUJA 4M8UA 3NFUA 1E73M 1QWKA 1PXGA 2Z25A 2CWNA 5D02A 5KZ6A 2EPOA 4B5VA 2ZE3A 2XVPA 1R85A 1SGJA 3UG8A 3ARVA 1IWAA 4M5PA 4PUJA 3EB2A 3PZ9A 2VO5A 3HFYA 3NPVA 3IV8A 1H7WA 2WPGA 3VPLA 2DVUA 5CC7A 4LF2A 4FR1A 2VL4A 1Q6DA 3BPWA 2VR4A 2GUBA 1UPPA 1QWGA 1W5MA 2XZ9A 5FJUA 4DM2A 3MMWA 3W7EA 3G8EA 2Z1BA 3FIGA 5BMXA 1W5QA 2VP8A 3W72A 3COTA 3CK5A 2E9MA 3GVRA 3IRSA 3ZR4A 5EMKA 3LGEA 3S1XA 3LLFA 5AFDA 1BPLB 2BGNE 2W66A 3CUGA 1WNOA 3GBEA 3AYRA 1V0KA 3VKCA 4LVFA 1XUZA 2A2IA 1KB3A 1HZYA 3DHPA 3NR0A 3MZ2A 3DFQA 4GVHA 3VIKA 2HSAA 3PBYA 3C3UA 1E1CA 4MVAA 3VDHA 2XWEA 3KVMA 2OX4A 3C2OA 3T8LA 1IT7A 2FTYA 2PDXA 5G1TA 3NDYA 1A5NC 5HA7A 2XGBA 3PSWA 4YVXA 5FJTA 4MNMA 1RJRA 3W7RA 2Q09A 1A4MA 2DUZA 3N1AA 3MUAA 2AOSA 4K1GA 2Z2AA 3S6DA 3L7RA 2RHGA 3W7IA 2J9ZA 4MB3A 3R11A 1AH3A 2AMXA 4HYRA 3SCQA 1PS9A 4PCPA 1TCDA 5DRCA 5AY7A 5C6MA 2FPVA 3CXOA 3ARPA 1H51A 4DPQA 4GNVA 1XRFA 3W25A 5HQLA 4PUMA 4AEFA 4NG3A 3SCPA 3TZNA 4F0LA 5HPCA 1EF3A 1LL4A 4ZQPA 5D09A 2NXGA 3CWOX 3M0ZA 3B9NA 4E4PA 3N4FA 2DGAA 4D6CA 4ERIA 3O15A 3L4TA 3AICA 2OR2A 3G1YA 4FK9A 1ZQ5A 4CVUA 3M64A 2PDJA 4XZLX 4GCAA 3SN0A 4HK7A 1K7XA 4PMJA 5BU6A 4US6A 2E28A 1TZZA 2J4GA 3WNKA 4UTWC 1A5BA 2QCHA 2H9AB 2ISWA 3W83A 3ITLA 1PCWA 1FCBA 1A50A 5BRQA 4IM4A 2R1LA 1ME8A 4XIMA 4GGHA 1TWIA 1UIOA 3GSMA 2BG5A 1YDNA 4DJED 2V69A 4HNTA 2B7OA 4E4FA 3TW9A 4MGGA 1K3UA 5LKYA 3M0JA 3MKVA 4WR3A 2ADAA 1JZ5A 5GPRA 4A3UA 3M16A 2XFFA 3IJIA 3R0UA 1GGOA 4GGBA 1IXOA 2E0PA 3GC2A 4Q8WA 3AIQA 1TRDA 3WQDA 1A5SA 3A3WA 4N9EA 1A5OC 2ATSA 3TNBA 4HMDA 2ZIDA 1NWTA 1ZGDA 3RILA 3RM8A 4NYYA 4XAPA 2QNEA 2C16A 5E9AA 4R34A 4IWWA 2GJPA 1QMLA 5XINA 4I6VA 5HULA 3TJXA 1YQ2A 1FVPA 4RJEA 4Y96A 1IT0A 2G3MA 4OBSA 1HJWA 2OCZA 2WNZA 3A64A 3ITOA 1YDVA 4J3XA 4G7EA 1GG0A 4AWUA 4D8ZA 4E8DA 3TWAA 1KBBA 1QASA 2OOGA 2PGEA 2YCLB 2V3GA 1T5AA 3VD9A 5CPLA 3KVLA 4AQLA 4DI9A 4IGHA 1J5SA 1Q4WA 4UTTC 2YLAA 1F9CA 4RDWA 2EPNA 3CL8A 1C29A 2QUVA 4M7TA 3VGFA 1ODUA 4N02A 3HV8A 1SQ7A 1B57A 3ARRA 5CCZA 1IWPA 3FAXA 1R46A 2F7FA 1RBAA 4WDUA 5MKGA 3S2CA 2C15A 5RUBA 1AL7A 5C7VA 2NQZA 4QTGA 2VRKA 2G50A 1OYBA 4P7LA 4W88A 4NASA 3OG3A 4PMXA 2GQ3A 2NQ5A 4GXPA 4F40A 5CPSA 4A2RA 3QKEA 3OG2A 3RPMA 2X1SA 2Y7GA 3QLDA 3TONA 1WOBA 4OBTA 1UIPA 3K2GA 3SCVA 1DHKA 1ZSXA 4IMDA 1UH2A 3BMVA 2VEMA 1WDDA 1UB3A 2VI0A 3OPSA 1NFPA 1K8ZA 1W91A 3TCEA 4B5UA 4V1YA 3DI1A 3FJ4A 4AIEA 1B0IA 3CO4A 3SECA 5F2MA 3NL3A 3EWWA 2C8NA 1RA0A 1UBPC 2WAGA 1E1FA 2W3ZA 1YTDA 4GYPC 2XVLA 3O1NA 5BMWA 2OX1A 1FWBC 3AIWA 5A5WA 3V0SA 4DELA 4ZOAA 2PZ0A 3GU1A 5EMUA 1KA9F 2O55A 1KXQA 2BNJA 3LUTA 3CQJA 1XCFA 2E5DA 1B90A 4O8AA 3OZPA 4RDVA 5A6TC 4ZFMA 3G6LA 2YB4A 3G3DA 3LCGA 3AHXA 2NV1A 1FFQA 2TYSA 4JYFA 4HK5A 3VD7A 2XHYA 1PX3A 4UTHA 1L2QA 2WV8A 4GNJA 5CC3A 3CPRA 3IGUA 5L9FA 2Z1KA 1DQXA 1HL9A 3KBMA 3GR4A 3OGSA 1A0EA 1IEVA 1TPFA 4G7EB 5DQPA 4A05A 1ZLPA 2ZYFA 1YW1A 4O10A 1GUVA 5EGRA 2X2YA 4HN4A 4UNLA 3RFAA 1O6IA 4O14A 4C6EA 2WC4A 4AF0A 1AJ0A 1V3LA 3B0XA 3M0LA 3OYZA 5E70A 4OU1A 3QY6A 3K30A 3E0IA 1WDRA 2XSAA 3MY9A 4O8RA 1CB7B 4BCEA 5JBDA 3RGTA 1FCVA 1V7YA 2X41A 4D2JA 1R9ZA 1S1PA 5MKGB 2QVNA 3O8AA 1R47A 3WLJA 1JPIA 1V02E 1PAMA 1XD0A 3ARXA 4GA8A 4BEUA 4QG8A 4PMYA 2WZHA 1MXSA 1L6WA 3N15A 3W2NA 2FFIA 3DENA 1PBGA 4Q7NA 4W8LA 1RAKA 3VD4A 1HJXA 5CBIA 3WQCA 4W93A 4PL2A 4LPCA 1ISZA 5EL1A 3AYSA 1X39A 3WLLA 4W4QA 4HGXA 5D05A 4I7WA 2DSUA 2R1PA 4JCMA 4GVFA 4ZBCA 2Q8XA 3BW2A 4IX2A 4ADUA 3PTDA 4FLRA 4A35A 2NX1A 3LN3A 1JFXA 1FXQA 1AZ2A 2PU0A 4GG9A 3B0VC 2A21A 1UROA 3GM8A 4K8GA 4Q8VA 3SRKA 3EKZA 4GIEA 3LXCA 4KS0A 2V8ZA 4ATLA 3I65A 2JGQA 1EJXC 4Z1BA 3TSDA 1S2WA 3IV3A 2POTA 3W82A 3BJTA 4PMUA 2QF7A 4TX6A 4M29A 2C0AA 3SY5A 1AQHA 1RK5A 3BGJA 1SJAA 1VFSA 3UXLA 2PDIA 1XINA 3UPWA 5AC7A 4GI6A 1Y8BA 4GPNA 1UWAA 2CZVA 4L6HA 1TR1A 4R33A 4DBEA 2WVTA 1QI4A 3I6TA 3WUBA 3KX6A 2YL8A 2CLEA 1VF8A 1ZU8A 5M1TA 3S46A 1JXKA 4R7WA 3MZNA 4U5IA 4QR6A 3H2AA 4RXGA 3BV4A 3OVPA 1KLZA 3DFHA 2XINA 4QEEA 4AZ5A 4QSHA 1NQKA 1DWAM 2R6OA 5LXEA 4LJ3A 4O0ZA 3SCSA 5LZLA 2XWDA 2Z1VA 3T42A 1BVZA 4DBDA 1YPFA 2PDFA 1XRTA 1XBXA 3VNDA 3THCA 3NQDA 4NJIA 6CGTA 3ONCA 2NQHA 2V30A 2VCCA 2POZA 3E5BA 4S23A 1ML1A 3O3RA 1B9BA 4IOTA 2YYTA 1F05A 3U2ZA 4DPPA 3B9DA 3UWQA 1OZQA 4JKLA 3OA3A 3KOYA 3H2MA 2NVDA 4MNJA 1W0MA 4Z2KA 1A53A 2D23A 3B03A 4P5UA 4FP1A 4B90A 3AXXA 3OGRA 1K4GA 1XIHA 1W1ZA 3GB6A 3CIXA 4IP7A 4K2SA 1CXHA 2V2DA 2VEPA 1XLEA 1TR9A 1E40A 4H8VA 4RV3A 5M3WA 3TXVA 1E6XM 1JZ8A 1XIFA 3AHZA 4O13A 3S8HA 1XG4A 3M4HA 1ZJAA 2V5DA 3ARZA 4HMNA 4QQ3A 5A6JA 5D9MA 4Q7IA 1J0ZA 1U1HA 4QJ1A 3T0BA 3KBVA 3H7VA 1RQEA 3L2LA 2INZA 1R9XA 3FSUA 4GXMA 1C8YA 3OLIA 3NZQA 4TTGA 1W1TA 4GHRA 1XGEA 3M44A 4W89A 3EOOA 4GY7A 5F4SA 1HGYA 1TIMA 3T7VA 3W7CA 4XVEA 3BAJA 4FMVA 3U9IA 3ZQ9A 2QJGA 2EG6A 4QNEA 3E9AA 2XVGA 4AEEA 1WV2A 3EOSA 3M0VA 1K02A 2Z26A 3BLFA 1NELA 3W07A 3QR0A 4BI7A 1V6TA 2VD9A 3KXQA 3WQ6A 4WOZA 4UMAA 1NQ6A 1LRQA 1DXFA 3W86A 1YKWA 2AL2A 2R82A 5BW6A 3EWCA 5LYRA 1R9YA 4O4VA 3MDWA 3R2GA 4MPKA 4JTUA 3UYCA 1QK0A 2PF0A 1YE4A 8XIMA 1UC5A 3HG4A 2ALDA 2WCSA 4ZOEA 1K70A 5J04A 4O54A 5HJLA 3TN4A 5AYBA 2Q01A 3NCOA 2BY1A 4CN6A 2J13A 5AC6A 3TKFA 1XBYA 3AC0A 4WJ8A 3AOFA 4ONVA 5FAGA 1SZEA 2W6RA 3PZIA 4RV8A 1MUWA 4V1XA 3M0MA 4MYXA 2V2HA 3FAWA 2CLHA 5FF3A 2WSKA 2ZXQA 2JKAA 4U2ZA 3DU0A 1UZ4A 1N82A 3H2CA 1F8IA 1V3IA 4INFA 3VKBA 1TPVA 4HNCA 3N9SA 3GH5A 2Q8LA 3MWCA 1KCLA 4HNLA 2WNWA 4MYAA 4NNBA 2IUZA 5BXSA 2FMNA 1NH6A 5M03A 2Y4SA 4YTRA 2O9TA 2GK1B 2ZC8A 3UG5A 1TX0A 4BK9A 1UH3A 4C6FA 4DBWA 3W7PA 3LRLA 4KFNA 1X38A 3H21A 4AMAA 3CUJA 2QJHA 3HGSA 3U2CA 4DYEA 3V0TA 1LQAA 4D9PA 2PLMA 4MWAD 5C9UA 3QLLA 3S83A 1E71M 2YDQA 3RM9A 1ZL1A 3SN1A 4A3QA 1T6MA 1QNSA 1X7IA 3IVUA 2OODA 1RUSA 3IJ9A 4HU8A 5EKYA 2X42A 1YXCA 3VZXA 3GIYA 3OJGA 1NP0A 4ECLA 3EZ4A 3UP8A 2W0UA 6XIMA 1K9FA 1QVBA 4ZR8A 3TW7A 5EA9A 1PO9A 1W1IE 3AXIA 4KESA 2F6XA 2FPTA 3VC6A 2FYMA 4FOJA 4YVPA 1J6OA 1Q6EA 4WLCA 4A8NA 4EE9A 1XQKA 2XISA 3M9YA 4RE3A 2V2CA 4S3CA 3CZ8A 3BXWA 2DUXA 1TJRA 4MB5A 1WXJA 4ZOCA 1U2YA 1H41A 2E8YA 3FX4A 1IEXA 2BY0A 2GGJA 4HA4A 3D6NA 3OVQA 2D20A 3DHUA 3TLLA 3REQA 2DU2A 5D38A 2XGIA 2PWVA 3CT2A 2R24A 4JPGA 4YWIA 2X8RA 4AD0A 4G8TA 1XYFA 1ELSA 4E8GA 4NHVA 3C2EA 2ZZ3A 4BF9A 2YXOA 4JTEA 2DP3A 3UT0A 3I7QA 3WDIA 4QQUA 3VKAA 1EJTC 3EMCA 4QFUA 2C1IA 4WUIA 2QDGA 5A2CA 2NSOA 3L4WA 1ZBWA 2BTMA 2TODA 4Z1DA 1TPWA 5LIYX 3EMZA 1VENA 2O9RA 2GYIA 1SUXA 4KWSA 2QVHA 1AW1A 4TIMA