2QKFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
publication title Re-Establishing a Metal-Binding Scaffold with Full Activity in the Metal-Independent Kdo8P Synthase from Neisseria Meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
total genus 81
structure length 251
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qkfA00
1A50A 3PF3A 2V0TA 1KFBA 4RZ6A 1IXQA 3OVRA 4BWLC 1WDWA 3EWYA 4MUZA 5LGZA 3TXZA 3GYEA 3W1AA 1PCWA 4O17A 3TW7A 4RJEA 3KHJA 4FNRA 4Z1BA 3LXBA 3OHIA 1GOXA 2CLOA 2YSWA 4JICA 3VE7A 1XKYA 3FLUA 3M47A 3B0PA 2X1SA 4UMBA 4UTWC 3IVTA 3MP4A 4EIVA 1KW1A 3NQMA 3Q94A 4NJKA 4JTJA 3MHGA 4LC6A 4UFJA 3HGOA 5ABTA 4O54A 2HTMA 3BG3A 3TX9A 3O06A 1M7OA 5HR6A 3IIOA 3NQCA 3DFSA 2HS6A 4FXSA 3MBFA 3STGA 3WK0A 4A2SA 4EF8A 1O60A 1YPIA 3P82A 3LERA 3MWAA 4DQWA 3LDVA 1TPH1 3SI9A 3NQ8A 2C16A 2DU2A 3DZ1A 2YW4A 3C2OA 2XN0A 4UR8A 2JGQA 1TTQA 5LKYA 3EXTA 3PWAA 5BMXA 3F03K 1YLVA 2ZA1A 4JD4A 3NQGA 2GUUA 3CTLA 1LRTA 5EA9A 2BTMA 1MZHA 3PSWA 3W1LA 5D33A 1NVMA 1VCVA 4JGDA 5DBTA 2TMDA 3G1SA 3N34A 1OFEA 5FEZA 3S42A 4IGHA 4AHOA 4B5NA 2R8WA 4HSNA 5I3JA 4DELA 1G67A 1QDSA 1SPQA 1ML1A 3TR2A 1OYAA 3RLVA 2VC6A 3S1XA 1LZOA 3PC0A 3A5FA 1KFCA 4JIPA 4QSHA 3TE9A 3E49A 2CZEA 3NPUA 4TX9A 3YPIA 1XDMA 1ICPA 1SFJA 3LB0A 2DP3A 1GVSA 1LRNA 3KFTA 2RH9A 2B4GA 3PUEA 3N14A 3W7NA 1TMHA 3FA5A 3P74A 1GVOA 3CPRA 2VEPA 4O0ZA 4YL2A 1Z42A 3LTSA 3HGJA 2Y89A 1W8SA 5C55A 1I45A 1QFEA 3NQ2A 3M43A 5AHEA 3W1RA 2R94A 1CW2A 3O1NA 3C0JA 3VFLA 3S5YA 2YGYA 2BZNA 3HGRA 3F1QA 3LM7A 2A4AA 4O52A 1QOPA 1HO4A 1H51A 1BWKA 1CI1A 1F05A 4UC5A 1BKSA 3W9ZA 2YXGA 4WOZA 4BF9A 3F4WA 4KFNA 4AVFA 1QCWA 4GUIA 3QM3A 3PAJA 3KVJA 1X1ZA 4MYAA 2YPIA 4FHAA 3FKRA 3L21A 2YZRA 3FIGA 5EBUA 2X1RA 1VZWA 2B7NA 3W7JA 3FEMA 2YW3A 1TRDA 3HQ1A 3UZ5A 4IPIA 1OFDA 4ZQPA 2Y7EA 1FCUA 2OCZA 1LP6A 3DFPA 4C1LA 3TMLA 1VPXA 2V5LA 1QWGA 4UR7A 3CWOX 4ZQRA 4GUHA 3HG5A 2RFGA 3NG3A 1K7FA 3I7RA 3RMJA 4QISA 4L4MA 3Q2DA 4IMCA 2QCCA 2ABAA 1HL2A 1DQWA 2PE4A 4M7TA 2ZA2A 3A22A 3O15A 1L6SA 5I3HA 4EOUA 2BLEA 4JTIA 1KFJA 2CLLA 3O6YX 3M6YA 3W7KA 2C15A 4AWTA 1AL8A 2NWSA 3DFOA 3S1VA 1SW0A 1YXYA 4AF0A 2ZQ0A 3W7EA 3LHZA 1FBAA 4P2VA 3EB2A 5TIMA 1I8JA 3KVLA 1IXOA 2Z2UA 1EB3A 1B4EA 4O18A 1SO5A 4BFAA 5AC7A 3EWXA 5F4XA 3W07A 1RZMA 5AHIA 2H8XA 5LGXA 1SZFA 4GUJA 2ZZ7A 2E5BA 4Z1CA 2ZZ1A 4CQ8A 3TK7A 3R12A 4ZQMA 3SW6A 3G0XA 3IIPA 2YX0A 1JCLA 3OBKA 4UTJA 3ZWTA 3LTPA 1TTPA 2A21A 1W5MA 3L0GA 4N9EA 2TRSA 4N4QA 1OFRA 3L66A 3FJLA 2X30A 3Q58A 4UFMA 1H62A 5D03A 3QH2A 1K7XA 1F76A 3MMTA 1GT8A 5U7SA 1VLWA 2DZUA 2F84A 5CPLA 1N55A 5KINA 3N9SA 3LRKA 3LV6A 4QQ3A 4JYFA 1ICSA 2A7RA 1D3GA 5EPDA 5EYWA 1T96A 1W37A 5IM51 1KM1A 4AAJA 2V30A 4O28A 4DO4A 5AB3A 4GC4A 1GTHA 3LCLA 1THFD 1KTNA 4DXVA 1H60A 1RV8A 3NQDA 3V75A 1K7EA 3SZ8A 4OHQA 3G1FA 3ABRA 2V5BA 3LCIA 3LOTA 3PULA 4NUWA 4ORIA 4AH7A 4X2RA 4Q33A 5D37A 2AAMA 4U4MA 2ZZ2A 3FOKA 2O7SA 4DO6A 3C52A 2WSRA 3W1UA 1MEIA 1PVNA 2QUUA 1OX4A 3W84A 3MI2A 3G1XA 3TC6A 3RLUA 3M5VA 2Z0IA 2GJNA 4IWWA 5D2VA 4O1DA 2G96A 5DXYA 1SFLA 4JX6A 3LLFA 3BVJA 4LC8A 1DJQA 1GZGA 2WJZA 1XXXA 3RF9A 1AG1O 1QMLA 3IIVA 4N9BA 2J88A 5E0KA 3SFKA 4S2CA 3FYPA 2GOUA 4RXFA 2ISSA 1EUAA 2W6RA 2Q8LA 4H3DA 1OX6A 1R2SA 1ZAHA 3LHUA 3NM1A 3CC1A 1W5QA 2HSAA 3EWUA 3KAOA 2A7PA 1X6UA 1PS9A 1J5TA 4JEQA 1Z48A 2QCMA 2DZPA 4JNMA 1OYBA 2ALDA 3W7GA 1SW7A 2I14A 3FJ6A 2WSQA 4GUGA 4JY8A 4A2RA 1LRQA 5D2TA 2YR1A 1XDLA 3LI0A 1S3HA 1TPC1 4OGZA 4NX0A 3HPSA 1P0KA 1PIIA 4A3UA 4OQVA 4OU1A 1R2TA 3NQAA 1HUVA 3TKFA 2VFIA 4ONVA 2V82A 1FUYA 1NAL1 4JTGA 4GFSA 1K8ZA 4RXGA 2Z6JA 1HO1A 4CLMA 1MSSA 4GXMA 3LTYA 3O16A 1OABA 3UXAA 3GDLA 3HIJA 4M6VA 4UMAA 1TTJA 4N9CA 5AYYA 3G0UA 1XI3A 2VXNA 1UUMA 1V5XA 3H53A 1ZY9A 5DELA 1L9WA 4LT9A 3VKJA 3SGUA 3OA3A 3PBVA 4UFLA 5CSRA 3MUXA 1T0OA 1TPFA 5D02A 3QMSA 2CWNA 1XBZA 3QF0A 3IRDA 1I2PA 4IOTA 5LNSA 3KX6A 3Q37A 4JTSA 5AOUA 3E96A 5FEPA 4DF2A 1K02A 1ZAJA 1LTDA 1TRIA 3GNNA 4WZHA 1JR1A 4BI5A 4FNQA 2QJIA 1FWSA 1DBTA 1D9EA 4HNNA 3EX2A 1TREA 2W79A 2DORA 1I2QA 5EY5A 7TIMA 2VELA 2GJLA 3IGUA 4UNKA 5FI8A 4YWIA 2A1YA 4PCFA 3KRUA 1T99A 5HWJA 3MO7A 3IIXA 4JTUA 4O1BA 5LNUA 4O12A 3L67A 2NXGA 3ANYA 1VLIA 4OWGA 1OFAA 4ADTA 3IV3A 4LVBA 2IQTA 1DL3A 3GR7A 1P0NA 2R91A 3PG8A 4JX5A 3GNDA 1PL9A 3C4UA 3GX9A 3G3DA 5TQLA 1FWTA 5I3FA 3UZJA 2W0UA 4NQ1A 3BW4A 4LS2A 3DHDA 1H7NA 1XM3A 3WK1A 3ELFA 4R33A 1W3TA 3W83A 2EGZA 3HG4A 1O5XA 5K7JA 1LBFA 3W2KA 5E1QA 3LRLA 1H7RA 2Y7DA 2AGKA 4LVDA 3BARA 5AHFA 1EUNA 1OFBA 1Z44A 1AMKA 3UWZA 3LI1A 5A8GA 4O10A 4O57A 2HS8A 4DO5A 2I1OA 3UNDA 3LCFA 1LORA 1SQ7A 3PSVA 4DPQA 4TR9A 2NUXA 2QCFA 1Q6QA 3A21A 3W85A 4LVFA 3NQFA 1FXQA 3CIXA 3DHFA 2DZWA 5SWUA 3LCWA 1R30A 1F74A 3DFQA 4GWEA 3IEBA 4NT0A 3NL3A 3EX1A 3GLCA 3DFTA 3GXTA 1DJNA 5CGQA 2FDSA 1AW1A 2C1HA 5C2XA 2YCEA 1YTDA 1P5BA 3LHYA 4GE8A 4Z1AA 1NFBA 2XFWA 1J2WA 4BK9A 3L2IA 2QCHA 5H2ZA 3W1PA 4LNYA 3V1PA 1PCKA 4LVGA 3HPXA 5HJLA 2Y7FA 2Y70A 2E77A 5L9FA 4K8HA 5C54A 1PHWA 1I2RA 3KVMA 1HG3A 1CX9A 3A5VA 3A24A 3C2FA 3BG5A 3WK2A 4JDYA 4JTTA 2FTPA 5EMUA 1IIHA 3EX3A 2PRLA 3PBUA 3IIZA 4X9SA 4OT7A 1SO3A 4LV4A 4FIRA 1BEUA 2YFOA 5CZSA 3T44A 2QF7A 2CLMA 3E9AA 3NOEA 4IMEA 1G7UA 4TMBA 5LNVA 4JR5A 1LOSA 3TCEA 4GNJA 3W1TA 4PFMA 5DCBA 4K7VA 1KFEA 1GQNA 2GVJA 4WXZA 1H7XA 4UTHA 3WJWA 3VCRA 5T26A 1H50A 1GVQA 3M5ZA 1GPWA 1KTCA 4RZ4A 3W75A 4PTNA 5CSSA 1ZFJA 2WSYA 1M6JA 3NL5A 4IMGA 4MFEA 3PB2A 4I7WA 1JULA 3TSBA 1I2NA 1L6WA 4ALDA 4RV8A 4O15A 4QJ1A 3KOFA 4EF9A 3W2LA 2Y6ZA 3GZ3A 3S5NA 4ML9A 2JKAA 4S2BA 3EXSA 3P61A 2NX3A 5G1TA 3OVQA 1MXSA 3HPZA 3KXQA 4GJ1A 4UNLA 5DCEA 3I65A 5G2IA 4HKPA 4ICNA 2FFCA 1VGAA 3DH7A 3G1HA 2V2HA 4UIOA 1YDNA 1GG0A 3OVPA 4DF1A 2ZTKA 4DBDA 4MJZA 2E1DA 2ZRXA 3ABSA 1T8XA 4O13A 4FEZA 2WPBA 1WXJA 4GBUA 1Q6LA 2VKZG 4D2JA 1F2JA 1TV7A 1AW2A 3I7QA 1X8FA 3HF3A 4WX2A 3W76A 3TFCA 4POCA 2QCNA 3QQ0A 1KTBA 4MJMA 1R2RA 2HMCA 4N6FA 4E38A 3IGXA 5HINA 3LHWA 1W5NA 4ADUA 4R7JA 2V2CA 2CU0A 2G97A 1OFOA 4M19A 3L9CA 4XBKA 4FF7A 3EWBX 2J9ZA 3HG3A 5KTLA 1M7PA 4RK8A 3N2XA 2NUWA 1LBMA 5I3IA 3P8JA 5G4EA 2OMAA 3G3MA 4AEOA 2B7PA 4FXRA 3MYOA 3NDOA 3I6RA 1TQJA 1I4NA 3P67A 4GRSA 4XTDA 5L6UA 1LCOA 2EAWA 3O8AA 1A53A 5FEWA 3ABQA 3OG3A 5U4NA 1YDVA 5EKYA 3TJLA 1O5KA 5HWNA 3R8RA 2Y62A 3TC7A 3NGJA 3M5YA 2VFDA 1AK5A 5D04C 3SR7A 4K39A 3HBLA 5E93A 3TXVA 2ZRZA 2QCDB 3FYOA 4Q4KA 1W5PA 1X1OA 5F4SA 5D38A 3RFAA 1A5BA 3L0KA 3W72A 3ATZA 1RVGA 2WQPA 4N6EA 2DZSA 2A6NA 4H6KA 3TAOA 1EP3A 1F6KA 3W88A 1NF0A 1NF7A 3G8RA 3CQ0A 3GR8A 3L5LA 1WOBA 5KZMA 3G0SA 3C6CA 2G95A 3E0IA 4PEKA 4BI6A 2PRHA 3DAQA 4HPJA 1GYLA 3B06A 4IJBA 3UWVA 2WV8A 3AO0A 4Z08A 2BXVA 1DKWA 4OBTA 3P5YA 4MOZA 2WOQA 2NWRA 3UWYA 4FNSA 1WX0A 1RQEA 3WJXA 4FIQA 2GQAA 3CT7A 2O7QA 2Y7GA 1V7YA 1DQXA 2C18A 4BR1A 3TH6A 4XZ9A 3TSDA 1P4CA 5GVJA 5AYXA 1VHNA 3DI0A 3QYQA 1TPB1 1FY6A 3HG2A 5LHEA 3O63A 3E02A 1NEYA 5K4ZA 1C29A 1K3UA 3BO9A 1JUBA 3NPVA 4RKAA 5D30A 3TJXA 1H61A 1W56A 1FCVA 1QPOA 1HFBA 2V9DA 1OVDA 3QPZA 4Z0JA 1EA0A 2PRMA 3MHFA 3W3OA 2ZFAA 1VYSX 1A5SA 1VQTA 3GB6A 1LOQA 1Q45A 3LCGA 4LUIA 1DV7A 1TB3A 2C13A 2X1TA 4XKYB 4FNTA 1QOQA 4JS3A 4LU0A 1VYRA 1DVJA 1MEWA 4O1CA 3HOJA 4I9AA 3GIYA 2FPVA 2FPTA 2C19A 4XBSA 1XBYA 3U6WA 3TQ0A 1ONRA 3S1WA 5G2HA 2J24A 2CLFA 4DBEA 1VHCA 1ZHAA 3B0VC 2LLEA 1TO3A 3DENA 4TIMA 4LTSA 2ZRVA 4JN6A 1LM1A 2J27A 1H7WA 4WXYA 1TTIA 3CHVA 4WY0B 2ZTJA 1VCFA 4Z1DA 1BWLA 3B8DA 1IIGA 5MHBA 4JIQA 5FF3A 3BW3A 5K2ZA 3SSJA 2NX9A 5F2LA 4UFHA 5BMWA 4UTIA 4MZ8A 5HMSA 3NEVA 4KWVA 3O6CA 4LRSA 5BOOA 2FPYA 1ME7A 1YXDA 1SSGA 1IXNA 1TQXA 4CNOA 4UTMA 1SO4A 1TSIA 3UQNA 1PV8A 1OYCA 3GKAA 2H3BA 1WYIA 1S5VA 5D2YA 2Y63A 3T4CA 1IF2A 4Y90A 1GJPA 4MZ1A 1PHQA 3TDFA 1OFPA 4CNPA 1LOLA 5DXXA 4Y9AA 3B03A 3UY7A 2J9YA 4XUGA 6ALDA 5F1UA 3UWQA 3TFXA 3QC3A 5EL1A 2PCQA 5J5DA 2Y61A 3R5EA 4HHPA 4UTLA 2ISWA 2GVLA 2WO5A 1IGSA 3W2UA 1J4EA 3STFA 3TV8A 1UB3A 1WV2A 2QDGA 3QPYA 4O1AA 3G1YA 2NV2A 5CZ0A 1Q6OA 3QW4B 1HTIA 1AW5A 4DF0A 3NPXA 4P61A 4QAIA 1TPVA 4AXKA 2E6FA 3NQEA 2NZLA 3ZWSA 3G8EA 3L65A 4R53A 3WJYA 4NNCA 3PB0A 4QM1A 1WOAA 3P62A 2YYTA 4NJHA 4O8RA 2VFHA 1KM6A 1KBIA 4LRTA 2EKCA 1VYPX 3SY5A 2A5HA 4UUIA 3JRKA 1W31A 2C14A 3CB8A 1QR7A 2YDAA 3CEPA 1FWRA 2OT0A 3UY8A 3B0UX 3S9YA 2CZFA 2CZDA 2KZHA 3GVGA 4Y6GA 5FEXA 2RHGA 3TMQA 5AC6A 4MVAA 1H63A 4MLRA 4JDBA 2ZDRA 3SIZA 2GQ9A 3GXNA 5BW6A 2X16A 2QKFA 4OV4A 3SGZA 2E6YA 4L4LA 5DBUA 1ME9A 3NQ6A 1IXPA 5FF2A 3W2MA 3C2VA 4IQLA 3EEGA 4M7SA 1RQBA 2ABBA 3UD6A 3IGSA 5FF0A 2Y85A 3LX9A 4HNUA 2NXIA 3LCHA 4JY9A 2WKJA 3LGEA 1FX6A 1KLYA 1FDYA 2X1UA 4XKYA 3LV5A 5CZTA 4NXSA 1UBSA 4IMDA 1TPEA 2CZ5A 1MEHA 1AL7A 3GAYA 3UWUA 2FB2A 2I9EA 5K9CA 3QMRA 3NZ1A 1G4EA 3GK0A 3W71A 4UTTA 2B0MA 3C2EA 1UUOA 3H55A 4Y8FA 1KBJA 1G4PA 3B05A 1QO2A 1ZCOA 3M44A 4S1FA 2XN1A 2QAPA 2DZTA 5CZJA 1N7KA 3S5ZA 1W54A 2H6RA 4E2BA 1F73A 3W7RA 3TA6A 3P8IA 2CFFA 4W9TA 1K8YA 4WY0A 1YADA 4MZYA 4LS0A 4K38A 4FX6M 3TUUA 4M6PA 3RK8A 1C8VA 1GEQA 2V2DA 3N2MA 5D2WA 2ZYFA 3SJ3A 1RD5A 4NJJA 4O19A 3W22A 2E68A 1K8XA 3W7HA 1KM2A 1JCXA 3NQ7A 4LS1A 4UTTC 1OX5A 3T55A 1B57A 3TNOA 1JCNA 1JRCA 3I68A 4A29A 4O11A 3UXDA 2QCEA 3PBWA 4HSOA 2J9XA 4N2YA 1VJIA 4NU7A 1OG0A 1W3IA 4YCPA 3ZFHA 3BK0A 1WBJA 3WJZA 3UYCA 1UCWA 2XN2A 4YCOA 1XUUA 1QNVA 3MW7A 3G1AA 4A21A 1RQHA 1ZNNA 3M5XA 3W1QA 3CWNA 3F4NA 3NNTA 1VRDA 2ZRYA 4JTLA 3L68A 3W7IA 1FCBA 2FQIA 3U8GA 1R47A 1Q6RA 2P0OA 3CIWA 1H5YA 3NYZA 5KZEA 1TJPA 4YLWA 5LNWA 1ALDA 1H1ZA 2RDWA 4FNUA 3C56A 2GPTA 4U28A 1W1ZA 3ATYA 3W23A 1XCFA 2V81A 4UFIA 3BPWA 4WD0A 1KM3A 1VC4A 2C6QA 3KRSA 5FF7A 3DXIA 1TV5A 4UMCA 1K03A 2EF9A 2QR6A 4WUIA 3N3MA 3M1ZA 1F5ZA 3P7YA 5AYZA 5KMYA 4E0CA 1KM4A 3TAKA 3DBPA 1W3NA 1WA3A 2ZZ3A 3NVTA 2CLIA 1OF6A 1DORA 4NNAA 4N02A 3QEZA 3W2JA 4YXGA 1JQVA 4MY1A 2NX1A 3M9YA 4K37A 4MY8A 3P80A 3P81A 4JTEA 1G4TA 3G24A 3PUOA 1WAUA 3WK3A 3N19B 1JCMP 2B7QA 1C9DA 4MPQA 3NM3A 3EX4A 4ZL1A 3DI1A 3QSTA 3BLFA 5HNRA 1YYAA 3PG9A 2VOMA 3P60A 1EX5A 2JK2A 4FX7A 2PURA 3L5MA 3THAA 3VI2A 3D0CA 3RU6A 3M16A 1VR6A 2WNQA 1LYXA 4IPJA 3O07A 3W74A 1M5WA 4AF0B 4JTFA 3BGGA 3CLMA 3W1NA 1O94A 5H91A 1S5TA 1NSJA 3IVSA 3M7WA 5FESA 5F2GA 5AHMA 1FWNA 4NZJA 5D09A 2ZRWA 1G6CA 3LLDA 2E6DA 3LHVA 1GVFA 4TO8A 2P1FA 5AHLA 4H4IA 3HO8A 3T78A 4KFPA 3PUDA 1FDZA 1W0MA 1A5AA 2D73A 5CG7A 3GXPA 2Q8ZA 1F6PA 2EHHA 3MJYA 3LHTA 1A5CA 2TPSA 1D3HA 1H7OA 1YXCA 2ATMA 2JKEA 4PL1A 4Q32A 1KA9F 2OT1A 4QIUA 1QAPA 3W87A 3R13A 2ZRUA 4LWWA 3STCA 3MI3A 1TJRA 3G1VA 4OE7A 4MYXA 3S0CA 4J9JA 3PS7A 3PVFA 2ATSA 4IXXA 2A2IA 2DJLA 3TQKA 1S5WA 4O0KA 4PA8A 1QPQA 1OF8A 4CCCA 2G5WA 1ZJIA 1SW3A 4UFKA 2NLIA 3HMJG 1KM5A 3S1UA 2VEIA 3O05A 4K6AA 2B7OA 3I7SA 5C5YA 5C6MA 4K36A 3W73A 1P1XA 4CCDA 2C0AA 4IMFA 1FDJA 1TPWA 1OJXA 3CU2A 3KRZA 4FB7A 4LY8A 1OX4B 1L6YA 2JGYA 1SO6A 3BLEA 3T40A 1TYGA 1UJPA 2QEZA 3E12A 5I3KA 2FLIA 1XL9A 1U5JA 3QQ1A 3GDMA 5HR7A 4A22A 3SECA 3N73A 3C2RA 3L5AA 3QW3A 4WOQA 1YTKA 2RKXA 3C8FA 3W70A 2E6AA 3FS2A 3LXCA 4NNBA 5F2IA 1JVNA 4UTUA 1X7FA 3QJAA 3ZR4A 2JBMA 4N4PA 2A0NA 2RDTA 4FX8A 2ZA3A 2Z1BA 5KZDA 4QNWA 2FIQA 3GDTA 1SZNA 3MI6A 1EP1A 3CM4A 3BG9A 1EP2A 2A85A 5DCDA 1G4SA 2Q3RA 5HWMA 5I3GA 3LRMA 4NVTA 4E2DA 3B4UA 1GYNA 3O6DA 4AWSA 2A6LA 2VFFA 3EWZA 5K9DA 5G4WA 2QDHA 1XFBA 4MKNA 5AC8A 1ICQA 4XQ6A 3H54A 1QO5A 3UPWA 2OZ0A 2H8ZA 5HULA 4AHQA 4X3ZA 1YPFA 1KFKA 1PE1A 1JUKA 4KKXA 3GAKA 1GWJA 1E51A 3GDKA 2OX1A 2E5CA 3U2OA 4XTIA 4AB4A 1QPNA 1ME8A 3P84A 4AHPA 3S5OA 3QSRA 4NX5A 1YTEA 4HNTA 3NPWA 3G18A 5HUOA 3BLIA 4LW7A 5FF4A 2ZCGA 1KM0A 4M6QA 5AFDA 3BGJA 4CQAA 2DJXA 2VEKA 1VH7A 4O14A 3VE9A 1EWDA 3TSMA 3A23A 3NR0A 5G5IA 3A9IA 2UV8G 4MIMA 3HGSA 1N8FA 3W7CA 5LHFA 3ABOA 2JKPA 4GUFA 2Y88A 2YYUA 3RNDA 2TYSA 5J5RA 4ZMGA 4RX0A 1ZAIA 4O4WA 5A5WA 3EKLA 1FXPA 2F7FA 2X2GA 4FNPA 5F2MA 4HNVA 4WY0F 4JTHA 3HJZA 3N9RA 2ZBTA 2YFNA 3EX6A 3IVUA 1G69A 5G1YA 5K9XA 3PY2A 1H7PA 4PL2A 3THQA 4K8EA 1FQ0A 3MP5A 4ADSA 2OJPA 3W1XA 2VENA 3INPA 5CPOA 2CLEA 3M41A 1EWEA 2NXHA 4IXHA 3UPBA 5KITA 4JXCA 4LV9A 3C61A 3LBCA 5D05A 4O16A 3QMTA 1QPRA 3UWWA 8TIMA 3JR2A 2WNZA 4CCEA 4XWUA 5F1VA 3M0ZA 1U83A 3PBYA 3PM6A 4LUJA 4N9DA 1DOSA 2PC4A 1I2OA 5D32A 4OV9A 5HQEA 1GG1A 1H1YA 1EEPA 4CQ9A 2TSYA 3EKZA 3USBA 3W7PA 4ZQOA 1LLWA 4KFOA 5CPMA 4UTKA 4C1KA 1Q3NA 2QCDA 3EXRA 5K3VA 3QFEA 4LVAA 1TCDA 4YMZA 4NXKA 3KVKA 3QZEA 4IUOA 3EWWA 4I7UA 4O50A 3TROA 2FB3A 3S6DA 1JCJA 2BSLA 1Y0EA 1TV8A 1KV5A 1G7VA 1F7BA 3WFAA 2CW6A 1LLZA 4JX4A 5DY3A 4HT3A 5DY2A 1WQ5A 3R2GA 1VCGA 3NXFA 1VS1A 3DFNA 3NQVA 3TQVA 3NZRA 3NL6A 3DKLA 1W5OA 1DHPA 2E5DA 1B9BA 1ZENA 4HN4A 1WBHA 2QCLA 3W7DA 4HIBA 3P5ZA 1SSDA 2QAFA 3LBMA 4IX2A 2ZZ5A 4QITA 4UCGA 2AQWA 4PC8A 3HB9A 4O4VA 1TPUA 3R89A 1JQXA 4Y96A 2BX7A 1SU5A 3LXAA 1LROA 1JUEA 3BV4A 3ZS4A 1OK4A 3W6YA 1R46A 1B3OA 4EVZA 1OFQA 4ORMA 1SZGA 3B04A 4G1KA 3GKFA 2WNNA 5F4WA 2DZVA 5KSWA 2C3ZA 3S8HA 2VEMA 5IBXA 2EPHA 4QNEA 1SR9A 4ZZ9A 5DLCA 2FJKA 4DEFA 4MFDA 4ZVJA 3JS3A 1ADOA 1TPDA 4KWWA 3W7MA 5CPNA 2A7NA 2E09A 4WJEA 2R14A 2V8ZA 3W86A 2H3DA 4MLJA 2QUVA 1XUZA 3PR2A 2VFGA 4MY9A 1O95A 1Z41A 4TU1A 4NJGA 2J6XA 4X22A 4AWUA 1XBVA 1UASA 2CLKA 3G1DA 5K4XA 3W1MA 4FO4A 5IBXC 2BWGA 3GDRA 2Z6IA 2GVGA 3MHUA 3QRHA 1EPXA 4JYEA 3NAVA 2DZXA 3STEA 5HUPA 3NA8A 1FWWA 3FFSA 4PH6A 3MBDA 1JRBA 4UXDA 4RCXA 1LDCA 3FKKA 3NO5A 4RLIA 5CKSA 1JJKA 1XBXA 1SZEA 4ZQCA 3W7OA 4I7VA 5TBOA 5AN7A 2RDUA 3W7LA 1L2UA 2GQ8A 4ZQNA 3DKJA 5LZLA 3AJXA 2ISVA 5LNRA 4O53A 2H90A 4LOCA 1RPXA 1FCQA 1XC4A 4BI7A 1KV8A 2QJGA 2QUTA 3DGRA 5G2WA 3WJSA 3T7VA 4RZ5A 4Z0SA 4M5PA 2VFEA 4TMCA 5LSMA 4NJIA 1BTMA 1KLZA 3CEUA 3LCXA 5BNKA 1O4UA 1YDOA 2ZZ6A 3W7QA 5AHNA 3NL2A 4RR4A 1JCYA 1RR2A 4EWND 5D2XA 3VNDA 4HPXA 2QJHA 4IX0A 4WQ6A 1B4KA 2NV1A 4K7YA 4DPPA 4BWLA 3L0NA 5DN1A 5BRBA 3BW2A 3OEXA 3TW6A 2CLHA 2NUYA 2Q3OA 4R34A 1GTEA 1OHLA 4NZFA 1EIXA 3DU0A 2ZZ4A 3W2NA 3G22A 3K30A 3TIMA 3C3NA 2P10A 4UTWA 1LBLA 3MYPA 3TU9A 4CNNA 1TIMA 1ZALA 4JYDA 4AMAA 1GVRA 6TIMA 1MO0A 4JTKA 4PODA 3MP3A 1SUXA 3OIXA 2QCGA 1OK6A 1KFLA
chains in the Genus database with same CATH superfamily
4PFHA 4GVGA 1IXQA 3OVRA 2FZMA 3H4WA 2WLYA 1BLIA 3TXZA 4HOZA 4FA3A 2R24A 4Z1BA 1RY8A 1JZ7A 3H2CA 6TAAA 5CC3A 3TA9A 1WCGA 4UBPC 3CO4A 3WBXA 1KW1A 4NJKA 4GZ7A 5I09A 3HGOA 2UBPC 3TX9A 3LBOA 1ZB5A 3MSYA 4B15A 1J2BA 1UA3A 3STGA 4J3VA 4EF8A 2R9RA 2V3GA 9RUBA 3EKGA 4YWSA 2R1PA 2BP1A 5XINA 5HJXA 3CQJA 2C16A 3DZ1A 2YW4A 3C2OA 2JGQA 5LKYA 4MDOA 3PWAA 3E0WA 4I3GA 1YLVA 3PWGA 4F0HA 3GDBA 2GUUA 4IIGA 5EA9A 2PU1A 1EPVA 1VCVA 3WQVA 3WQ4A 1ZSXA 2TMDA 5DBTA 1OFEA 3NOYA 1BRLA 4KQNA 4B5NA 4ZFCA 4DVOA 1QDSA 4EPKA 3EOUA 3RLVA 4C5ZA 3S1XA 3PC0A 2Y24A 3TE9A 4C90A 5C9RA 1XFCA 1XDMA 1ICPA 1OCJA 2PDGA 4G8TA 2DVTA 1P6CA 1R9YA 2RH9A 3EEZA 1TX2A 3N14A 3FA5A 3P74A 2XPKA 4WCJA 1E0VA 4PULA 1QNOA 4EPDC 5DO8A 2XU2A 1AUSL 1Y7VA 3HGJA 1OG6A 1XSIA 2Y89A 3VO0A 1XYBA 3K1GA 2IKGA 3NQ2A 3W1RA 2G4FA 3WDHA 3B9DA 5HBFA 1CW2A 3O1NA 3S5YA 4GIYA 3AHTA 3F1QA 3UCCA 3WQPA 2AQOA 1QOPA 4R9XA 1H51A 3OLGA 1X8CA 1CI1A 1VEOA 3N4FA 3F4WA 4QRNA 3HJEA 3QM3A 3PAJA 3IJIA 2Q02A 4AFYA 5EBUA 3W7JA 1OFDA 1LP6A 4GY1A 2V5LA 3II1A 1QI5A 3MUCA 3HN3A 4URIA 3W6LA 3LMZA 3RMJA 4L4MA 1XF0A 4LX4A 3SRKA 3UWEA 1L8PA 2OSXA 1YX1A 1V0KA 2PMQA 1P0DA 1XISA 3GH5A 1S1RA 5GJNA 3A22A 2PDCA 5A95A 3ABXA 2VM8A 4EOUA 2CLLA 4I6KA 1W91A 3M6YA 2VOTA 4PSPA 3BMWA 4ZENA 3V16A 5I3DA 2F9RA 1FBAA 3CGTA 1TG7A 1QI3A 2ZIDA 1I8JA 1IXOA 2VVSA 1A5LC 2QVHA 3O9NA 1SO5A 4JTRA 3A13A 5AC7A 1EH9A 3EWXA 3B97A 3KTCA 4DYJA 5LGXA 3TTSA 2CHOA 4GVFA 4ATDA 5JUVA 4M1BA 4Y9OA 4QQUA 4AD1A 3G0XA 3IIPA 4L1XA 4D6IA 2I5GA 2A21A 1W5MA 2TRSA 3VGGA 4N4QA 4C6JA 3RJYA 4ZXOA 1C8XA 2OWWA 4S39A 2I9UA 5D03A 4XV0A 3QH2A 1K7XA 3RM9A 3AYTA 4ZXLA 3MMTA 2OR2A 1GT8A 1OY0A 2W63A 4P7NA 2F84A 1FP8A 3PJWA 3LEPA 5CPLA 3QOMA 3WEOA 4H9TA 1ICSA 4E3VA 1T96A 4XZNX 3EA2A 3UW6A 4JQ1A 4AAJA 2V30A 4DO4A 4UWMA 4DXVA 1V77A 3GQYA 4PGLA 2GWNA 3WYZA 1S2AA 1CGVA 4XVDA 3VDAA 3G1FA 3LOTA 4NUWA 4X2RA 1R8LA 5ABEA 2ODOA 2WJFA 3BAKA 2X41A 2ZZ2A 3M0KA 4DO6A 2QULA 3C52A 1V79A 4WDTA 1MEIA 2XDFA 5C70A 4W7VA 4G9PA 5GJPA 4GI4A 2VCCA 3UXKA 3G1XA 4HYWA 3DC8A 2GJNA 3SY8A 5DXYA 1R38A 5DT7A 5CEWA 3P0XA 3GUGA 1DJQA 1XXXA 2IXVA 3IIVA 2J88A 3GFZA 5E0KA 1XX1A 3FYPA 1W3JA 2XFYA 1EUAA 4DI9A 4LALA 2D2JA 3WELA 2Q8LA 1UW9A 4H3DA 3NM1A 1ZAHA 4C65A 4S3CA 3B9NA 1X6UA 1PS9A 4JEQA 1AQMA 1PO9A 1Z48A 3ERPA 4AW7A 4BQ3A 3W7GA 6CGTA 2J62A 3CHFA 2YR1A 1XDLA 3LI0A 4NX0A 3HPSA 3TN3A 1P0KA 2WHLA 4B5XA 1CGXA 4JFWA 3GIQA 1GYMA 3WZ0E 3EOOA 3TKFA 4KBXA 2OSYA 1B5TA 1ONEA 2H9AB 4GHRA 4QLJA 3DG3A 3E5BA 4J40A 3LA4A 2VVNA 5DMNA 4ERAA 1NIUA 3G2GA 3F7JA 3GDLA 1TTJA 4U31A 2R1MA 3IANA 3G0UA 1XI3A 5CPQA 1UUMA 3H53A 2WAGA 1R7OA 1L9WA 1V4YA 4PN2A 4FMVA 3WQCA 1PKNA 2BS9A 3OTRA 5D02A 1WZMA 2E8ZA 4MM1A 3UJ2A 4Z2LA 5JIWA 3QF0A 5LNSA 3KX6A 1A4LA 3E96A 2HK0A 4XD4A 2I7GA 1ZAJA 1LTDA 1TRIA 3GNNA 9XIAA 1HGWA 4GCAA 2X09A 1RUSA 4BEQA 2YL6A 2DORA 1I2QA 2XVKA 3R4IA 2GJLA 3IGUA 2Z00A 2DT0A 4YWIA 2HPMA 5A94A 4H7ZA 1T99A 5HWJA 3UEQA 3ABZA 3PZQA 1R3WA 5JBFA 1ZBKA 1QI2A 1MVYA 3B3DA 4CVUA 4MJ4A 1P0BA 3VOIA 5EFDA 1VLIA 2D23A 1OFAA 4ADTA 3IV3A 1SJCA 1HQTA 4QS6A 1TWIA 4LBUA 3GNDA 1M1BA 3RMEA 4E8CA 1T6MA 1RLDA 3GS6A 3E38A 5I3FA 1U5HA 1NDVA 2W0UA 2OZTA 3DHDA 2PP0A 2ZXQA 2PLKA 2EGZA 1O5XA 5K7JA 3QTPA 3W2KA 5E1QA 3BMVA 1E55A 1QBAA 4HU3A 4YTRA 3LI1A 1NWTA 2HS8A 1KXQA 3LCFA 4DPQA 2DEPA 4TR9A 2NUXA 3CUFA 3WMBA 1VIWA 2PDWA 5SWUA 7XIMA 3NCOA 3SCUA 1F74A 4JHMA 3L4TA 4PR4A 4E2VA 3GLCA 3DFTA 1DJNA 1EEXA 3K8LA 3BLLA 1W1B1 4PMRA 3V5OA 3U2ZA 1F9CA 3AMGA 2DSWA 3NO3A 4Q4SA 4PUMA 1A80A 2J8TA 4RZBA 4LNYA 4QJ4B 1PCKA 2Y7FA 5L9FA 1E1FA 1S2UA 4EACA 1I2RA 3WBAA 1JZ5A 3BICA 5FACA 3A5VA 3A24A 3BG5A 3BOLA 4YJ5A 3QFWA 5FJIA 2PRLA 3PBUA 3AHYA 3FX4A 4OT7A 5I03A 1OT2A 1E4NA 2WMKA 2QF7A 3E9AA 4KERA 3NOEA 1EO5A 4IMEA 2HXUA 3HQOA 2YCLA 3U3HA 4JR5A 1EGVA 4ZA0A 4E3TA 4GZEA 1VJSA 5DCBA 4K7VA 3UT0A 4GY0A 1GQNA 3CS2A 3ZLGA 1J6PA 1J10A 2W9MA 3VCRA 3ALFA 4DLFA 3PTQA 4K8GA 3BQ5A 4B4HA 2W4XA 4LSBA 1GPWA 1F3EA 1KTCA 3K4DA 3GC2A 3KWSA 1JDDA 1IYXA 1ZFJA 1M6JA 4IMGA 4GGBA 4GYPA 1WKYA 4GXWA 1E9LA 4RV8A 4W8LA 4O15A 1V0MA 3W2LA 3F4VA 1BSIA 3HFYA 1XIMA 5TD4A 3BV7A 4ICNA 1BFNA 2Z1WA 3G1HA 1YDNA 4ILSA 1GHSA 3H2EA 4B3KA 2ZTKA 4L9XA 2PAJA 4XAYA 1ZJBA 1NU5A 1WXJA 3BANA 2I16A 4D2JA 3VINA 1F2JA 1XG4A 1JI2A 4HPGA 4RNJA 3TFCA 3LHWA 3P0WA 4IH3A 4WDUA 5JVLA 2G97A 4JNYA 4XBKA 2UY5A 4R88A 3EWBX 3MTWA 1V3MA 2OLAA 4RK8A 3N2XA 2NUWA 3BJTA 1LBMA 1FKXA 4G1NA 2WK2A 2HJPA 5G4EA 2OMAA 3G3MA 3RDKA 3S5SA 4AEOA 4D8AA 2B7PA 3NDOA 3BURA 4XTDA 1M41A 2E40A 3FHAA 1LCOA 2V68A 3O8AA 1RCXB 5U4NA 1GK8A 3TJLA 3VZXA 3VNYA 4Q8PA 3TC7A 3NGJA 2VFDA 3MKKA 2G3JA 3CV6A 3SR7A 4E6MA 5E93A 3V5CA 4CNUA 3TXVA 3HURA 4P8UA 3ZJ8A 4DI8A 4NAEB 5AVHA 1B3WA 4IL2A 1J6OA 3RFAA 3ITGA 3ATZA 1RVGA 2WQPA 4H6KA 3TAOA 1NF0A 4IT1A 4US6A 1NF7A 3G8RA 4KRUA 3UBPC 3L5LA 3CZEA 3CAKA 2DT3A 3STPA 1CZ1A 3QVQA 4FAMA 4PEKA 3DAQA 5CCZA 5ABFA 3ITCA 1GYLA 3GVRA 3CHCA 3L4WA 3UWVA 1B3ZA 2WV8A 3AO0A 3U9IA 1WNOA 3LNPA 2BXVA 2WOQA 3UWYA 4P8XA 4ECLA 1UD8A 1WX0A 4FIQA 4QLLA 5EU9A 2X0SA 3LNMA 1EJ7L 3DIPA 3AS0A 1Y8BA 3U2CA 5FOOA 3BLDA 1DQXA 1LWIA 4Q8UA 3TSDA 2WM0A 2ACSA 4LYPA 3IJ9A 2VDGA 4HQVA 4JN7A 3ZR6A 4ML4A 1UWRA 1E6NA 5K4ZA 1K3UA 1JUBA 2XVLA 3NPVA 3TJXA 3BE7A 4BY3A 1FCVA 4WF7A 1HFBA 2V9DA 3UR5A 1O5RA 3IWPA 4PCPA 1EJVC 2WCSA 1F3XA 3U57A 1EA0A 3MUIA 1VYSX 2C8NA 2PLCA 1N2VA 1VQTA 3E2VA 1EX1A 2HVNA 3WNOA 2JF6A 4PMVA 1OADA 1P43A 5KEZA 2X1TA 4XKYB 4DBWA 1US2A 4KIRA 4DXXA 4JS3A 4NIRA 1DVJA 1MEWA 1XQLA 4I9AA 3PZ9A 4NKCA 2FPTA 1H41A 1UH4A 2C19A 1J79A 2EJ1A 1AZ1A 1ONRA 2J24A 1ITQA 3T0BA 4DBEA 1VHCA 1QNSA 3COTA 2RDXA 3DENA 4TIMA 1OGBA 2QDDA 3S2MA 1BGAA 1H7WA 1PZ1A 4W84A 1FH7A 2WVVA 2DDXA 3MA8A 2BHZA 4H2HA 1BKHA 2NX9A 3NWRA 2X05A 2HQAA 3CQHA 4C6IA 1I1WA 1YIXA 4LB3A 2V3FA 2FPYA 1YXDA 3WLTA 1FP9A 4FXJA 3GO2A 3WH9A 1TQXA 1QBBA 1PDYA 1JXJA 3WH5A 4Q4PA 1J5SA 1OYCA 3GKAA 3WQDA 4B2DD 2H3BA 3G5EA 1E6ZA 4ZBCA 3BMXA 1KRBC 3RILA 1IEWA 3VOGA 4EXAA 3MANA 4CNPA 1OFPA 3VCCA 1LOLA 3LZ3A 3B03A 1W1VA 5A2BA 2D22A 4U5KA 1NOUA 4XUGA 6ALDA 1RP8A 5J5DA 1RVKA 4HHPA 4JCLA 4UTLA 2ISWA 4HCDA 1PYFA 1UB3A 5I7GA 3I3DA 3ZM8A 3QPYA 2NV2A 3UYIA 5CZ0A 1KKRA 4HGXA 1AW5A 4HA0A 3CLWA 4P61A 1KRMA 2E6FA 5C9WA 2NZLA 1H2JA 2P76A 1LUCB 3WJYA 3H7VA 3QV8A 4JFVA 3KM8A 1MNZA 2VFHA 4MDPA 4LRTA 3URNA 2A5HA 3KBJA 2C14A 4AZ7A 5HJYA 2ZWZA 5A69A 1QR7A 2CZFA 3H7RA 5FEXA 4C6NA 1FHLA 3UG8A 4R7OA 3TMQA 1H63A 4MLRA 3L7RA 1ISWA 1AQHA 1UBPC 4PMJA 1Q7QA 5BWAA 4L4LA 4J1OA 1EIBA 1ME9A 3W2MA 1BYCA 4M7SA 1RQBA 4XZLX 2ABBA 5FF0A 2OX4A 4EKJA 4B5UA 3AXIA 2FHBA 4H04A 4WSKA 3TYAA 5CLTA 3HU7A 2E28A 3GG0A 3FSUA 5CZTA 4ATLA 2J77A 2PGFA 1AL7A 1DJZA 1J18A 2DFAA 2FB2A 3UWUA 5CG0A 2Y5SA 3TN5A 5K9CA 3QMRA 4UR9A 1G4EA 3W71A 4HHLA 3C2EA 1W17A 3H55A 3WNPA 3AUOA 1QO2A 1T8QA 3GVWA 3GVVA 3M44A 2DPEA 3T6CA 3I4EA 5CZJA 1N7KA 1HKIA 1PTGA 4E2BA 8XIMA 1F73A 3GSMA 3TA6A 3P8IA 2WLZA 1K8YA 4WY0A 1YADA 4LS0A 3CJPA 3TUUA 1GZ1A 3RK8A 4F9DA 1BXNA 5D2WA 3M0XA 4DHGA 2XZ9A 1RLCL 1W1YA 2JF7A 3SJ3A 3NQ7A 1WXYA 2VNCA 1JCNA 1JXKA 4W86A 1VKFA 3UXDA 3CH9A 2X1IA 2J9XA 4ZTXA 3N18A 4IUGA 4AC1X 3ITVA 3PFMA 1W3IA 4YCPA 2OLHA 1BGGA 3BK0A 1WDPA 1WBJA 5BOEA 3OW1A 4DZAA 5IDIA 4YCOA 4CN4A 3H2AA 3PJUA 3PZUA 1WUFA 4HD5A 3LENA 3A4JA 2YIHA 3NNTA 5AC5A 3W7IA 2FQIA 3EWDA 1JZ2A 1YKWA 3AQUA 2BGNE 2D0GA 2BHUA 2P0OA 1H5YA 5KZEA 3CMFA 3C56A 4QS5A 5A8NA 4U28A 2V81A 3BPWA 4WD0A 1J9YA 2H9AA 3E0FA 3NDZA 1KM3A 3M64A 5DANA 2OOFA 1B2YA 2OQLA 3DXIA 1TV5A 4UMCA 4TQTA 1TCMA 4WUIA 1YW1A 1KKOA 3BSMA 5AYZA 1UKQA 4G7EA 2FH8A 4W7WA 1NWSA 3FW6A 1DORA 2PGRA 3RPTA 3SCPA 4YXGA 4FLOA 4TVDA 2OZ8A 1XGEA 1UOZA 2GSHA 1EZ2A 2GGJA 4K37A 3H4XA 1CWYA 3P81A 4PBGA 4IICA 1HKMA 3G24A 3WK3A 4NYUA 1I6NA 3F5KA 2HK1A 3N19B 4DM1A 2J7CA 2PWEA 2B7QA 1C9DA 3VXGA 1W3HA 3EX4A 4ZL1A 2O4MA 1YMYA 1YYAA 1EX5A 2WW5A 3VI2A 3THAA 3D0CA 4CNSA 1AMYA 1PKYA 1VR6A 3WLLA 2PDKA 5M03A 1TV4A 3OQEA 4HN8A 1M5WA 3TNBA 4LQ1A 4ZO9A 3WLIA 3PNUA 2O9OA 4JTFA 3IPWA 1S5TA 3IVSA 4B3LA 2QPSA 3VNZA 3M7WA 1JYXA 3WH8A 4OOZA 1UWIA 4IIEA 2ZUUA 2E6DA 2OLSA 3WUGA 4TO8A 5EMMA 3OIHA 1CDGA 5TNVA 3VUSA 4KFPA 5JH2A 1OGSA 1QU4A 4FOKA 1CGWA 1FDZA 3N04A 1XYMA 4HPHA 1YNPA 2G3MA 3UJRA 1A5CA 1SVDA 2ATMA 1KA9F 2OT1A 4QIUA 2DIKA 6REQB 4HHMA 4LWWA 2PD9A 1CIUA 2YBVA 2DUXA 4H8NA 1TMLA 1ITXA 3PS7A 4KGLA 1HN1A 4EE9A 2IS7A 2A2IA 2DJLA 3TQKA 4JKLA 4PA8A 2IPJA 3WNMA 1KC7A 2QYGA 1NWUA 4C7DA 3L4VA 2ZVRA 2VEIA 3O05A 3T0AA 3KBNA 4ASTA 4K36A 3W73A 4CCDA 5G1MA 4IMFA 3M46A 4I6VA 4L9ZA 3QYSA 1OX4B 2AKZA 4LY8A 2X0YA 1H1NA 1SO6A 3BLEA 1GVIA 4PZVA 1GEHA 2GGEA 2QEZA 4GABA 2RUSA 2DUAA 2E9MA 4JPGA 2XGZA 3CV7A 3EOLA 1NOWA 1XCXA 1Y5VA 1X6LA 3SECA 4S3AA 2V3DA 5FJTA 1DHKA 1HL9A 3QW3A 3K5XA 1YTKA 1VB9A 3QC0A 1LJYA 3LXCA 4NNBA 1EJSC 1IWAA 1F6YA 2JBMA 2P50A 3UNTA 4FX8A 3KTSA 5I06A 3T2QA 4QNWA 5JBDA 1SZNA 4H6RA 2C79A 4KMQA 1V03A 3CM4A 1IV8A 1GPFA 3LRMA 4NVTA 2C91A 5CPSA 4UQ9A 4AD2A 4AWSA 1YHTA 2A6LA 2VFFA 2Y0FA 4WJ8A 4MKNA 2QXWA 2OGYA 1RY0A 3ANUA 3H54A 1B9ZA 1QO5A 2OZ0A 3WQ6A 4AHQA 2XG9A 4PYSA 2AQVA 5EMKA 1RXOB 1P0EA 1P7TA 1ISVA 4I8DA 1E51A 3GDKA 2E5CA 4H8VA 3CT2A 1L6GA 5HMFA 1ZL1A 5A1AA 1YTEA 1Y5XA 3NPWA 3AZSA 3HPFA 1E4MM 1DWAM 5FF4A 3CZ8A 2WCGA 1R0MA 2C7FA 2HDJA 4Z17A 4TUFA 4DUWA 4TX8A 3FGCA 5E6YA 3W26A 3VE9A 1EWDA 3TSMA 4DWSB 5M1TA 4MIMA 1HJSA 5CAKA 1UMYA 1DWGM 4ZMGA 1NP2A 4LY4A 4RE0A 2WQDA 5IXEA 2F7FA 5D9PA 4L1WA 5CPTA 1UWSA 4D6DA 3MS8A 4WY0F 3UJSA 1J0ZA 3N9RA 3EX6A 1L8NA 3IVUA 4QX4A 2PDFA 2I5IA 5K9XA 1XLAA 2GLKA 4K8EA 3R7MA 4ADSA 3RIKA 3OJGA 1UP2A 3FN9A 5CPOA 5JIPA 3REQB 2VZUA 2NXHA 4HK6A 2CC0A 4GD0A 8TIMA 3JR2A 4PUDA 4XWUA 4MHBA 1OCNA 5I00A 3P3BA 3S6TA 3M0ZA 4MUPA 3PM6A 3AIVA 1XYZA 4N9DA 1DOSA 1I2OA 4OV9A 1R3RA 2DV0A 2POZA 3NJ3A 2TSYA 3W7PA 1IT8A 4ZQOA 3VC5A 4PUNA 1GQIA 5CPMA 4YVPA 1Q3NA 3QFEA 4NXKA 1JGIA 1W8GA 3EWWA 3BC9A 4NY2A 3S6DA 1Y0EA 1UROA 3N29A 1F7BA 1PX3A 2R6OA 2F61A 4HT3A 1QJWA 2YXOA 5E9XA 1UQZA 3TQVA 3DKLA 5FIPA 4H19A 1DHPA 1B9BA 3WNLA 1T5AA 1WBHA 1UKPA 3W7DA 4HIBA 1SM9A 2QPXA 2I56A 1PWMA 4IX2A 4TV5A 3ZSTA 4XZHA 1QW8A 2BX7A 3LXAA 1QK0A 3BV4A 1NQ6A 4AZCA 1MFUA 1GW9A 1R46A 3CAQA 4LXFA 5GNZA 5M17A 1TVPA 1Z32X 1VFUA 4G1KA 3GKFA 5KSWA 2DZAA 3TP4A 3S8HA 2J7BA 3B8IA 2EPHA 4X63A 4ZZ9A 3QZ6A 1DIEA 2FJKA 4DEFA 1E9YB 2HISA 4Q22A 3GC5A 2E09A 4B91A 3WD4A 1PAMA 2AMXA 3GG7A 2H3DA 2GJPA 1UC5A 2DSUA 3MZNA 3OVGA 3MDUA 3L23A 4NILA 2ZVIA 2YL5A 1UASA 1PEZA 1W3KA 5IBXC 3GDRA 2GVGA 4JYEA 3NAVA 4DWSC 2DZXA 3AMLA 3CL8A 2J13A 1XS2A 3FFSA 2WBGA 1VD6A 1JCTA 2OWXA 3MBDA 2DSKA 2QT3A 2J78A 3O6AA 4O0QA 5BCAA 4ZQCA 3JZEA 4I7VA 3QR3A 7CGTA 3ZMRA 5AN7A 2D69A 2Y5JA 3W7LA 4BF7A 2ZXAA 2PC8A 2ZUWA 2GQ8A 1PB0A 3AJXA 3ALGA 5LNRA 2H90A 1ZBWA 5ECVA 3SRFA 2QJGA 1PJ9A 3CQKA 4JIEA 4PCTA 3T7VA 4Z0SA 3N2BA 1TV2A 5LSMA 2A79A 4DO7A 4E4PA 5A6MA 4OKDA 1OC6A 4WKHA 2QUNA 4F9JA 3W7QA 3EDFA 5JBEA 3GIPA 3NL2A 3LM3A 1JAEA 3UU0A 2QJHA 4MB3A 2QF8A 2VRQA 2NV1A 4DPPA 1DTUA 2VZVA 3OEXA 4P7OA 1EHNA 2CLHA 1EIXA 3APTA 4YVVA 3G22A 1AD1A 2P10A 5J8LA 1UR9A 2YKKA 2TAAA 2X0HA 2BB0A 2PEVA 4JL1A 1ZALA 3C0LA 4AMAA 3FXYA 1MO0A 2YJQA 2WWCA 1SUXA 3OIXA 5T91A 1V02A 5AY7A 2WSPA 1KFBA 4QFUA 4RZ6A 1GONA 5AYIA 4BWLC 4F0MA 3QPEA 3N4AA 1E56A 4O17A 1GOOA 4RJEA 1KCZA 4D6JA 3KHJA 2NQ5A 1GVYA 2XM2A 2YSWA 3NO1A 3VE7A 2X1SA 4UTWC 4MKSA 1CECA 3V1HA 4EIVA 1XIJA 2IW0A 3Q94A 5C7HA 4JTJA 3MHGA 3KOXA 3WDPP 4GIAA 2UZ9A 4DWDA 2NQZA 2HTMA 3O06A 1M7OA 1GZJA 4RE3A 3FYYA 3IIOA 3NQCA 4GQ0A 2FVMA 4A3QA 4FXSA 3MBFA 2GL5A 4U2ZA 2E7FA 3P82A 2VGBA 4E8DA 1U33A 3SI9A 1R9ZA 1R5YA 4JD4A 3NQGA 3LUTA 1TV3A 3CWHA 1EC8A 5E6ZA 4QBXA 4P7RA 2W66A 3W1LA 4JGDA 1KR0A 4HSNA 4DELA 5B7YA 4AYSA 3TR2A 2QIIA 2VC6A 3NSXA 1VF8A 4QSHA 4IJCA 2CZEA 4YNGA 4A8LA 3LB0A 2DP3A 1J8VA 2B4GA 3PUEA 1UP0A 3W7NA 4AXNA 3VNKA 3ARRA 2VEPA 4O0ZA 4UOJA 4PTVA 3ZZ1A 1XLBA 3N15A 2QMKA 3ARQA 3SFWA 1W8SA 3GU2A 1DWHM 4YPJA 1QFEA 4XVEA 3QXBA 2IXUA 4DLMA 1O5QA 3VFLA 1E3XA 2YGYA 1Q63A 4LH8A 5ABHA 2A4AA 1XQKA 3EOEA 2PDPA 4DUXA 1JPDX 2Y4SA 4UC5A 1I0DA 4DJEC 3G6LA 3I10A 1XD1A 3KDOA 4MNKA 4WOZA 2J8FA 4BF9A 4DJDC 3KHDA 4KFNA 2WHKA 5BZAA 1X1ZA 2OELA 2E9LA 3FKRA 3M07A 2YZRA 1VZWA 3B4YA 3FEMA 2YW3A 3BCJA 3UZ5A 1Q6DA 1HJVA 1S2WA 2OCZA 2CLPA 4C1LA 5HMEA 4GIEA 3VD4A 1F3TA 1QWGA 3O0FA 4UR7A 5LA2A 3IAQA 3HG5A 3I7RA 1ONWA 1TJ1A 2QCCA 1OIFA 3MVTA 1DQWA 1EC9A 1S2CA 4M7TA 2ZA2A 1L6SA 2HBXA 4D6FA 5I3HA 1KFJA 2J6VA 2NWSA 3V3WA 2WWDA 3GHTA 3S1VA 1S1PA 1YXYA 3PHAA 2BVDA 2ZQ0A 2G50A 3LHZA 1UA7A 3EB2A 1NY1A 1PIGA 2FMOA 3KVLA 2Z2UA 4O18A 3V7PA 2VWTA 1V6YA 3C0QA 4BFAA 1V93A 1UZHA 1OIMA 4NP7A 1SZFA 4G7FA 1G5AA 4CD8A 4CQ8A 1V8EA 3SW6A 1Y65A 2YX0A 1JCLA 4UTJA 4FR6A 4N9EA 4ZTYA 3GM8A 4IFKB 3SRDA 4WKAA 1ISZA 3L66A 6A3HA 1Q8JA 3FJLA 4ACYA 2QQ6A 4QLKA 3MU7A 1QPKA 3BAXA 3UZZA 1WE5A 1VLWA 4BJHA 4C91A 5T9BG 3N9SA 3WD3A 4M6UA 5CBJA 2A7RA 4TTUA 1W37A 5IM51 1KM1A 2FTWA 3SQSA 4AVNA 4O28A 1GTHA 1QATA 1THFD 4H41A 3WD2A 1RV8A 4N42A 3PN8A 4OHQA 5IFPA 3ABRA 1OC7A 1W9XA 1A5UA 2WVTA 5FJUA 4AH7A 5D37A 4D72A 4TVCA 2O7SA 1R86A 3UETA 4A8IA 2HE5A 1OX4A 1ZCCA 3CZJA 3MI2A 1X96A 3M5VA 2ACUA 4M56A 4IWWA 4K1WA 4J3WA 1KXTA 5D2VA 4AD4A 5A3HA 1Z69A 4O8AA 3VIFA 2OPJA 4JX6A 1FHUA 3LLFA 4LC8A 2WCAA 2EBNA 2WJZA 2ACRA 3RF9A 3EZ4A 1QMLA 3AJ7A 2Y8KA 4S2CA 3U7VA 2GOUA 4F2TA 1S2TA 1NWRA 1PX8A 1YNQA 2JFEX 4CD7A 1OX6A 1K9EA 2HSAA 3EWUA 4GCXA 3KAOA 4L6DA 2VGFA 1J5TA 2QCMA 4P5UA 2P0IA 4JNMA 4QG6A 3ZT6A 1OYBA 1IR1A 1QK2A 3EPOA 4MWAD 1SW7A 4M51A 3MO4A 2Z26A 4GUGA 4LCQA 4A2RA 4E2OA 3ZO9A 7TAAA 3FVMA 1VP5A 3WDQA 4IFOA 2CYGA 3H24A 2WZHA 3TN4A 2Q09A 4M29A 1R2TA 4MTVA 1HUVA 4HZMA 4OIFA 2VFIA 4ONVA 4KCWA 2V82A 4EPEC 3CYVA 1MSSA 3N13A 4GXMA 3PBMA 3LTYA 3TLQA 5HANA 3UXAA 4UMAA 2VXNA 2DW6A 1V5XA 1LG1A 5DELA 4LT9A 3OA3A 3PBVA 3CZLA 3MVIA 4FPSA 4UFLA 2VCBA 3PZNA 3MUXA 1LQ2A 1T0OA 2EG7A 1AH4A 1HP4A 3GUWA 4CU7A 2WZIA 2ZX7A 4N7QA 3C0SA 2XJ7A 2Z1VA 1XBZA 3M0HA 3N2CA 3U7BA 2OTDA 4XG1A 3IRDA 1I2PA 4KEMA 3SURA 1PTAA 3WLOA 4J3TA 4DF2A 4NZ3A 2VYOA 5DFAA 3L12A 1OEPA 3T81A 3N6HA 2J7GA 2PODA 4GVHA 1D9EA 5HPCA 4Q8NA 3MUZ1 3N12A 2C71A 4QDPA 5EY5A 1FH8A 2OQHA 1K70A 4PEEA 2XH2A 4HYVA 5CZKA 4PCFA 1UD5A 1ZUAX 1D3CA 2Q6ZA 3MO7A 4O1BA 1O66A 1LL4A 3REQA 2DZBA 3VC6A 3BWWA 4O12A 2PDBA 3POHA 4Q4OA 3ANYA 4OWGA 2J79A 4ACZB 4LGXA 4FI4A 1YPXA 1CEOA 1P0NA 1AJZA 3VGBA 4KWUA 5HQLA 2WC3A 3GX9A 4AIBA 1RD6A 1FWTA 4XX6A 4XAGA 4LS2A 1HKVA 1H7NA 1XM3A 3NVDA 1OBAA 4IP4A 3RX2A 1EOMA 3HG4A 1LBFA 3LPPA 4JEJA 4Z42C 1H7RA 3WL1A 5I77A 5AHFA 1YEYA 1CGUA 1V3LA 3N1AA 5A8GA 1Q2SA 3ARXA 2I1OA 3PSVA 1B54A 1Q6QA 3W85A 3BCDA 1E6SM 4LVFA 2DIJA 4MWAC 3LCWA 1XPYA 3SJNA 5DQPA 2GUYA 3DFQA 3D5HA 3NL3A 3GXTA 3RO6A 3MCNA 5CGQA 1AW1A 2C1HA 1A49A 4KETA 1YTDA 1EOKA 4KIEA 1TZZA 1A5OC 2XFWA 4BK9A 1MUMA 2QCHA 5H2ZA 3W1PA 1M65A 4LVGA 3T4WA 2E25A 2E77A 2VUYA 1B3VA 1OB0A 3KVMA 2RAGA 2ZUVA 4PMDA 2BXZA 1IGWA 1OWQA 3QKZA 3CL7A 3PANA 3KCLA 5CZSA 3FY1A 3H2MA 2WC4A 4WJXA 1G7UA 4E4FA 2D2OA 7A3HA 3DEQA 3W1TA 1IT7A 4PFMA 4DUVA 3VGFA 1Q13A 3LQLA 2INZA 1A0EA 1H50A 1QTWA 3H8AA 3QGVA 1DJYA 1SJAA 3R0KA 3PZMA 3ANVA 1MUWA 4PTNA 3CH0A 1CENA 3NL5A 4MFEA 3WQ5A 4I7WA 3OODA 2YLLA 1L6WA 1EF3A 4HB7A 1W6TA 4OBRA 2EXOA 3DN5A 5G1TA 1MXSA 1TWDA 3WQFA 4GJ1A 5DCEA 3HV8A 2BG5A 2V2HA 4UIOA 1GG0A 5D9NA 3OVPA 4OFCA 3PTKA 4EAMA 1T8XA 2HBVA 4FEZA 4HZ6A 3WQGA 2VO5A 1Q6LA 2VKZG 1TV7A 1AW2A 4N0RA 1BG4A 2QCNA 4BQ5A 4MJMA 4E38A 1C93A 1KBKA 4MNLA 3CAVA 2J25A 4C6BA 3UA4A 2CU0A 3SGGA 4AZBA 1TR1A 3C8NA 3FVDA 3L9CA 4Q6XA 5GQBA 2J9ZA 5KTLA 1M7PA 4GC3A 4OBSA 1XH1A 1OGGA 1VFOA 5AC4A 5I3IA 2XSBA 3GTIA 3P8JA 1JPHA 3CXOA 4Q8TA 3RO8A 4A3HA 4FXRA 1TQJA 1XDJA 3P67A 4GRSA 3AIEA 2GZXA 1GQLA 2QIWA 1F4AA 3EGJA 1PIFA 2FDMA 1A53A 3AHVA 3KLLA 2PDJA 1O5KA 4W8BA 3R8RA 2DVUA 1O6IA 3W00A 3WBYA 2ASHA 2QCDB 3FYOA 4Q4KA 1W5PA 1J12A 1X1OA 5F4SA 5D38A 3L0KA 3EMCA 2VL4A 2VR2A 1F6KA 3W88A 5H6HA 3FJNA 3CQ0A 2AKMA 2VC7A 2QNEA 5KZMA 3F5JA 3NIYA 1V08A 4BI6A 1JF6A 1ZRQA 2PRHA 1BVNP 4AMCA 2W5FA 4X60A 3B8SA 1QASA 4RV3A 1YRRA 3VX0A 2VURA 2WM1A 2WMJA 3SN0A 2WB5A 2OO0A 4OBTA 3UVAA 4V15A 1W32A 3DG7A 1Z8AA 3GYCA 2J66A 4YTUA 1RQEA 4RPPA 3VKDA 3WJXA 4DJFD 2GVEA 2J47A 3IARA 2Y7GA 2ZXDA 3U48A 2OYKA 4DX3A 2C18A 2BDQA 1IZCA 3K4AA 4XZ9A 1P4CA 1VHNA 2J4GA 4XO6A 3E2SA 1FY6A 1TZ7A 1E4IA 3T2PA 3O63A 2R82A 1JDFA 1C29A 3BO9A 4GI8A 4RKAA 2WXDM 1W1A1 1W56A 1J0HA 3WH7A 1QPOA 4W93A 4LAOA 4Z0JA 3QLLA 1TELA 4S3BA 3HFTA 3MHFA 2ZFAA 1A5SA 3LY0A 3UR2A 1D2KA 3RCYA 2Y8VA 1VFFA 3LCGA 1TB3A 4QE1A 2ZKMX 4DZIA 4W87A 4LU0A 2F2HA 1VYRA 4F79A 3CO8A 4AVOA 5M5DA 3KP1A 3VZYA 3D3AA 1LF1A 1KQYA 4BF5A 2FPVA 1NARA 3S1WA 3TQ0A 5G2HA 3N6QA 4XISA 1ZHAA 3B0VC 1KXVA 1YDYA 2QZRA 5C71A 1MMFA 1SFTA 4LTSA 1M9HA 2NQLA 4S38A 3ID7A 4HU0A 1RBOB 2ZTJA 1VCFA 3OB8A 2FJUB 1IIGA 1EYWA 3GH7A 3NURA 4JIQA 1D8CA 5FF3A 5GNXA 5K2ZA 4UFHA 3P6LA 1KGUA 5HMSA 3S46A 3NEVA 4LRSA 3GWQA 1CTNA 1IEQA 4DUOA 4YYFA 3EDJA 1ME7A 2XH0A 5A6BD 2PTWA 2GOKA 3CV1A 4UTMA 3W24A 3WUBA 3UQNA 3EOSA 4NF7A 1UR0A 1ADSA 2ZUNA 3ZT5A 1IF2A 4J4KA 1GJPA 4UZUA 2PBOA 5DXXA 3ZT7A 3CAWA 2Y8UA 4Z2JA 2PCQA 4HOXA 3R5EA 3HMCA 2D2HA 4PCSA 3W2UA 2WNWA 2BOGX 1A5MC 4O1AA 5FAJA 4DF0A 1R3QA 1E1CA 1EJTC 4LUYA 5HNTA 4AXKA 1CBGA 1Q7ZA 3ZWSA 2JIEA 4DJFC 1PDZA 3PB0A 3NXLA 1S3TC 1JZ3A 1WOAA 1I75A 3P62A 2RJGA 4O8RA 3QHNA 3AMCA 3NEHA 1A0CA 1KBIA 3N2TA 4CEUC 1T40A 4UUIA 2VCAA 2YDAA 2TODA 1FWRA 3UY8A 3AIBA 4HMNA 2KZHA 4Y6GA 3FHQA 2BBFA 1LT7A 2OZ3A 3BAIA 4MVAA 1HKJA 1BQCA 1AH0A 1E43A 4CD5A 2ZDRA 3SIZA 3GXNA 2CBJA 4V28A 5BW6A 4OV4A 1ZP3A 3SGZA 2E6YA 5DBUA 3NQ6A 1IXPA 4IQLA 2REQB 3LX9A 1WDSA 3WLMA 4PTMA 4QHRA 3AWNA 1FDYA 2X1UA 4H83A 5E9AA 3LV5A 3LS9A 1XIBA 4NXSA 1KXHA 2INFA 4IMDA 4EXQA 4LCRA 3GAYA 3DHUA 3A4WA 2WVSA 3GK0A 4UTTA 5DT5A 5EMLA 4R7WA 4Q7IA 4Y8FA 1ZCOA 3R10A 3DBNA 3ITYA 2DZTA 3N25A 1ITUA 1W54A 1EJUC 4CN6A 3W7RA 1AVAA 4W9TA 4AWEA 1F61A 1HJXA 2ACQA 4MZYA 3UXIA 3R43A 4K38A 3GC4A 4FX6M 3E0VA 5FL0A 2HVOA 4REQB 4AX6A 1RD5A 3URBA 3AU2A 3VVGA 3LSCA 4L6OA 1KM2A 5C2GA 4LS1A 1OX5A 1B57A 4KEZA 1HNYA 2W27A 4HA1A 3I68A 4O11A 4LYRA 1QNRA 1UIOA 4ZE5A 1AFSA 2J75A 4ZGYA 3RU8X 1FWFC 2OKTA 1VJIA 1CGTA 1S5MA 1OG0A 3N9KA 3VD3A 1IWBA 3CTTA 2E9BA 4RPQA 2BMBA 1LQ0A 3O7UA 4IGMA 3OO2A 3MW7A 1E6QM 4LBSA 4DAIA 3CWNA 3F4NA 2OU4A 2ZRYA 1ZS2A 3L68A 3U8GA 3TTOA 2GSJA 3NYZA 2PDMA 3SDOA 3TYDA 1ALDA 1E0UA 2A3HA 4FNUA 2GPTA 3VZZA 4ROQA 3W23A 4P7QA 3KL0A 4I5UA 4IG2A 3D6NA 2C6QA 2PTXA 3KRSA 1K03A 3WLNA 3H2OA 3MMUA 2QR6A 2ZADA 4J3ZA 2NLYA 3N3MA 3KWXA 5KMYA 2Z7KA 3GU9A 4XAZA 1KFWA 1WA3A 4LUTA 1OF6A 5HQMA 2UY4A 3QQWA 4NNAA 4NAFA 3W2JA 1EJWC 3OLDA 4NZCA 4YTSA 4Z2KA 4JTEA 1G4TA 2PDLA 3CUZA 3B9OA 1Q6GA 3I6EA 3XIMA 1UR4A 2QVNA 5HNRA 4L7ZA 1XIFA 3P60A 3AUJA 2JK2A 2HVMA 4FX7A 3L5MA 4JTDA 3FCPA 1E6PA 5LIYX 3RU6A 4ES4A 7PTDA 3WQEA 3O07A 5HOSA 1NJJA 4AF0B 2DSZA 1NSJA 4PMOA 1HJQA 5FESA 1TA3B 4XKMA 1FWNA 3SCWA 3FDGA 4NZJA 1G6CA 1DP0A 1RJPA 3LHVA 1KGWA 1V3IA 4H1ZA 5DEZA 2P1FA 5AHLA 5EGRA 2CWXA 3ZVHB 4BZYA 3RCMA 3UESA 3MT1A 4D6EA 1S46A 2ANUA 3GBEA 1A5AA 2D73A 5CG7A 2EG8A 3GXPA 1REQB 1R3YA 3KDNA 4AD3A 4WK9A 3MJYA 5CXPA 2TPSA 3ZQ9A 1D3HA 1JFHA 5BXPA 1M53A 1LQAA 2BVYA 2XISA 4HMCA 2PP3A 3LPFA 1PKLA 3BGAA 1VIZA 3G1VA 4WKFA 3EB3A 2OEJA 3VA8A 3RN6A 3SUUA 3PVFA 4YYCA 3IUDA 4IXXA 4U3CA 1QPQA 1DJWA 5HDRA 4CCCA 2G5WA 3WFZA 5CBBA 4NRSA 1SW3A 4A8NA 4UFKA 2NLIA 4PBEA 3EWCA 3N4EA 2ZXBA 3S1UA 3RHGA 4HSHA 3V35A 4LF1A 3TYBA 5HNUA 3H4GA 4L6HA 3M4HA 4YIWA 3IAPA 3BUVA 1Q8AA 1ZPTA 1ENUA 5LIKX 3CU2A 5BYWA 3KRBA 1L6YA 2X2YA 3WF4A 1XYCA 2ISDA 1EZWA 3ZXWA 4W4QA 3BAYA 1IZKA 4JCMA 3ZJKA 2QJNA 4KW2A 4MWAE 3QQ1A 1D8WA 1QT1A 4C6LA 4FSAA 3CB3A 3L5AA 5CC5A 2VD9A 1QI0A 3W70A 5REQB 1JD7A 4W5UA 1JVNA 1FA2A 4N4PA 2A0NA 2CKRA 1C8YA 2JE8A 2Z1BA 4UNIA 2PDIA 2O55A 2DQXA 5CC6A 3QHMA 3VIIA 1OZMA 4JTCA 1AZ2A 1EP2A 2QV5A 1J01A 3EPNA 3O3RA 3CIVA 5A8PA 1G4SA 5I3GA 4HCHA 1PWLA 1OCBA 1XFBA 4GNKB 1ICQA 2H8ZA 4X2PA 2ZX9A 2G3FA 4WIWA 1JUKA 2HV5A 2AL2B 3GAKA 2A3CA 1PTDA 2PF0A 1MRAA 4TV6A 3HQPA 4MJ2A 3U2OA 4XTIA 4AB4A 4HMDA 2G37A 1ME8A 1UWQA 3ECQA 4NX5A 4HNTA 3G18A 5HUOA 4GQQA 3RR4A 4AY8A 3BLIA 1E40A 3QBUA 2ZCGA 2V6AA 1MXGA 1IT0A 3RX4A 3H70A 5CSYA 2XTKA 3A23A 3CUHA 2UV8G 3APGA 1MNSA 4KRTA 5CSUA 3ABOA 3RG6A 3RNDA 4ERGA 3T0TA 4O4WA 5A5WA 3LPGA 3VMOA 5D4YA 1KCXA 4HNVA 1JL8A 1GKQA 1RHCA 1DXEA 5HMDA 1O68A 3OQ8A 2ZBTA 2E4TA 1K1DA 5A6SA 3VGDA 3SCVA 1XLDA 3MP5A 3MJMA 3QR0A 5A8QA 2VENA 4L65A 3INPA 5FSEC 4XAFA 3N2OA 2VGGA 2ZC8A 5MKGB 4JXCA 3LBCA 3CPUA 4MADA 4O16A 4IQDA 1TWZA 3UWWA 4JFSA 3A64A 1E6RA 4IM4A 2RJHA 1U83A 3PBYA 3VM5A 5XIAA 1Z6KA 1EDGA 1SGJA 4GK8A 1H1YA 1EEPA 3CUGA 4CQ9A 4J2PA 3T9PA 3AIWA 3EKZA 3USBA 3R94A 3BQ6A 4WHBA 2CPUA 3AYVA 1LL7A 4GX8A 1WPCA 2QCDA 5K3VA 1E6XM 1JDAA 1QHOA 2PDYA 4I7UA 1E9ZB 1TMQA 1JCJA 3B9EA 1HGYA 1TV8A 1KV5A 1KQZA 3H12A 1G7VA 2WJEA 5A2CA 2CW6A 3GHUA 5DY3A 2WMIB 3R2GA 4ATWA 1V3KA 1VS1A 2B31A 4I90A 3NZRA 3NL6A 2VX5A 1E71M 3OG2A 4F66A 1IE7C 4GA8A 1W5OA 4Z1YA 4HN4A 4RNIA 2BY1A 1JYWA 2P3ZA 2BFGA 1SSDA 1UWUA 4XD3A 2NQJA 4QTGA 2ZE0A 1WUEA 2ZZ5A 2Y2WA 4DYKA 4PC8A 1W9PA 3S2LA 3R89A 1VJZA 2ZUSA 1SU5A 1LROA 4JQ3A 1DJXA 4A3YA 1TKKA 3OPSA 4KRZA 3W6YA 1Q5MA 3BAJA 1A5NC 3BL3A 2YZ5A 2CIPA 2A3BA 5D9OA 1EQCA 4ORMA 5TAOA 1SZGA 1GQKA 2DZVA 5F4WA 2CHRA 3KBSA 1CXIA 1SR9A 3T09A 1QRQA 5DLCA 1K9TA 4US5A 1DWJM 3PPFA 2HE8A 4KWWA 5CPNA 1PBGA 4CU6A 3GBDA 3TYZA 3W86A 4GISA 3QV9A 1XUZA 2GK1A 2Z24A 1UZ4A 3AYSA 2VFGA 4MY9A 3G77A 2J6XA 4J2MA 4YTQA 1MW3A 1XBVA 4AWUA 1C7TA 4DZHA 2CLKA 3GTHA 1ZGDA 4I5XA 3GHRA 1Q6CA 6PTDA 1ELSA 3STEA 5HUPA 3NA8A 3HM7A 1AODA 3VD7A 4RCXA 2PTDA 5TF0A 1Y5WA 3FKKA 4XIAA 1TE6A 3NO5A 4RLIA 5CKSA 1XBXA 2R1KA 1GW1A 4IQEA 1ZBCA 1F8IA 4AISA 5TBOA 2WANA 3KBWA 5I23A 2D0HA 4HVXA 4L56A 3DKJA 4FLSA 5LZLA 4GY7A 3VCNA 1IQ8A 1XC4A 4BI7A 1KV8A 2PI6A 3CZGA 4RZ5A 4R3UA 4YHGA 4GMEA 2YCIX 3C3UA 1JNDA 1EL3A 3TTEA 4XSLA 2ONEA 5BU6A 1NM9A 1O4UA 2PA6A 4D6HA 1KRAC 4ZO7A 3QY6A 4DB7A 5LA0A 1B4KA 2YB4A 3WSUA 4K7YA 1VENA 3OGVA 5DN1A 5CGMA 2VX6A 2NUYA 1GTEA 3DU0A 2D3LA 2ZZ4A 3W2NA 3TIMA 3RYSA 4DYEA 1DTNA 3W37A 3N3TA 1LBLA 3MYPA 4Q4QA 3TU9A 1TIMA 1GVRA 1I60A 2PZNA 6TIMA 1WO2A 1E3ZA 2OGJA 5LIWX 4RDVA 4PODA 4H2CA 3VDBA 1A50A 3ISIX 2V0TA 4OTKA 1SZRA 3LMYA 1CB7B 1G9HA 1HT6A 2CXGA 1WDWA 3WEMA 3NYDA 3GYEA 3A4AA 5FAGA 1AJ2A 3W1AA 1PCWA 2D2GA 3TW7A 1P6WA 4X9YA 2F2KA 1GOXA 2CLOA 2FZDA 3D3FA 4JICA 4UMBA 4C6OA 3IVTA 3JW7A 3MP4A 3N6JA 3NQMA 4GVIA 4LC6A 4UFJA 2BNJA 4MB4A 3WL0A 1Q66A 4Z2GA 2VWSA 1KRCC 4WGXA 3BG3A 4QEHA 4RDWA 3SUSA 3SQLA 4M24A 2AOSA 3DFSA 4U10A 2HS6A 5ECUA 4A2SA 5BOFA 1DEDA 3SQMA 3MWAA 4DQWA 1VFMA 1V3HA 5A6JA 3UG5A 1FTXA 4UR8A 2XN0A 1TTQA 4PUUA 3OHMB 1XH0A 5BMXA 3F03K 3UCQA 1KBLA 8RUCA 1RJRA 3CTLA 3PUGA 1MZHA 3C2YA 5D33A 1XIIA 3N34A 5FEZA 1J0KA 2O9TA 3S42A 2E8YA 3S9ZA 3HPAA 4AHOA 4RDZA 2R8WA 1G67A 2Y1HA 1SPQA 1PUDA 1ML1A 1EYEA 3WMSA 4LYKA 3VIGA 3WUFA 1LZOA 4JIPA 1KFCA 4ZB5A 3ARPA 1TE1A 4TX9A 3W28A 5I02A 3YPIA 5CJMA 1LRNA 3KFTA 4IQJA 1XG3A 4I9JA 2INEA 1XSJA 3A3WA 1TMHA 4AY7A 4FS9A 1GVOA 3CPRA 4H9ZA 3Q67A 4MB1A 2GSEA 4YL2A 3WCZA 3PPHA 4QJ3B 1F3WA 3LTSA 2Z27A 5KZ6A 2P5NA 5C55A 4DNMA 4KWOA 5E09A 4H7CA 4QE4A 2PCEA 3K4WA 3VTRA 4PRRA 1XIDA 2R94A 4D6CA 2P88A 5IOBA 4Z2HA 2BZNA 3HGRA 1WZKA 4O52A 1HO4A 2C0HA 2BY3A 2F8QA 1F05A 1I1XA 1Z3NA 5JQ9A 2O0TA 2YXGA 1ONXA 4GO9A 4M1RA 3FAXA 4QCFA 1OZQA 4GUIA 3IRSA 4JFTA 1BD0A 3KVJA 1H49A 3DX5A 4PRTA 2YPIA 1TVLA 4MYAA 2PWFA 3L21A 3FIGA 3P14A 4GI6A 3TC3A 4F4RA 4U5IA 3HQ1A 2PU0A 4IPIA 4ZQPA 2Y7EA 3PJTA 1U22A 3AS1A 1FCUA 3QV7A 2YXXA 3SRHA 1YQ2A 1RJQA 3CWOX 2OYMA 4GUHA 4AX7A 4MPKA 3GNPA 3NG3A 3S83A 5GNYA 1MYRA 3VIMA 5HNNA 1VBRA 2OKOA 2HROA 3D46A 5EMJA 5FCZA 3EDDA 4BCEA 2R1LA 4FR1A 3K1DA 3VM7A 4JL2A 3O15A 4XUYA 3CK5A 3O6YX 5E0CA 1C90A 3W7KA 3CUXA 1F07A 2C15A 4AWTA 1AL8A 1JPKA 3VD9A 1SW0A 2CZVA 2QMJA 4AF0A 3W7EA 8A3HA 1MDRA 5TIMA 3RITA 1EB3A 3T0CA 7ODCA 1TA3A 1N8IA 3MDWA 2CEQA 3USZA 3DYOA 5JU6A 5F4XA 3W07A 5CLWA 1RZMA 3OOQA 3KS5A 3R79A 2H8XA 1B30A 3ONBA 4GUJA 2ZZ7A 4QG9A 4Z1CA 2ZZ1A 3BLPX 3FXGA 4ZQMA 3WF3A 2FZNA 3ZWTA 3S2CA 1BF2A 3LTPA 3AOFA 1TTPA 3FSTA 1CPUA 3L0GA 1REQA 1O1ZA 2VZSA 4NL1A 5C8BB 1FWAC 2HWGA 4GLEA 1VPQA 1F76A 5T9CE 1EDQA 3ITTA 4EWJA 1E9IA 3AU6A 2XVGA 2VRKA 1N55A 2A3LA 4M81A 3LRKA 3LV6A 1J11A 3OU8A 4JYFA 3UA3A 3MSRA 1D3GA 5EPDA 4HNOA 3GHSA 4XBJA 1EXBA 3QZAA 1VFHA 2X40A 4GYKA 1L6FA 2PUZA 1KTNA 3VDGA 1H60A 3NQDA 5I5RA 3V75A 3I4KA 1K7EA 2PTYA 4PMXA 3WF1A 3PULA 4ORIA 1RAKA 1V7AA 4Q33A 4Q8MA 2AAMA 4U4MA 3FOKA 4KT2A 3W1UA 2WSRA 5FL1A 3W29A 2QUUA 3AROA 4DAFA 1K77A 3W84A 2HEJA 3TC6A 2Z0IA 4BEUA 3IK4A 4O1DA 2G96A 2XINA 3BVJA 1GZGA 2ON3A 1AG1O 3KL3A 4PTWA 1Q4NX 4D1JA 2ISSA 1AA1B 3MV01 4W85A 5REQA 2W6RA 2WPGA 4CQDA 1XKJA 4IGSA 1R2SA 2GVYA 1C3FA 3VUPA 4C1NB 2A7PA 2YA2A 4WLCA 2Z2BA 2DZPA 4OUEA 2ALDA 2NV9A 2I14A 2F38A 4H6EA 4JY8A 1LRQA 5D2TA 4GQGA 4Q4RA 4E4UA 3E6EA 3RUBL 2OEKA 5DRCA 4Y8EA 1NDWA 4A3UA 3WLRA 3EBVA 4HNLA 3NQAA 1N82A 4C5YA 4EK7A 2VC9A 1FUYA 4JTGA 1BQGA 1K8ZA 3C5QA 3RR1A 3ARSA 2Z6JA 3IJLA 1HO1A 4CLMA 3MQTA 2X8RA 1M68A 3OLIA 4IIFA 3PZIA 1GHRA 5AYYA 4F2UA 3E74A 1ZY9A 2EG6A 3A3HA 5IDZA 3VKJA 2V5JA 5CSRA 1UZ1A 3BJSA 1XYFA 1W9BM 3BDKA 1T41A 3UVIA 2V5DA 3QMSA 3WLJA 1B0IA 4P8WA 1S5NA 4IOTA 3Q37A 2HNHA 4HNCA 3T8QA 1FHVA 2Z28A 1RCOB 2O9RA 4AZ5A 3PPGA 3KBVA 5DMMA 4Y9NA 4BI5A 1JR1A 1BPLB 1NFPA 4FNQA 3DESA 1DBTA 1W1TA 4HNNA 2VX7A 4ZB0A 2XYLA 4BQ4A 1TREA 1HP5A 2Y5EA 5IRPA 3UZXA 7TIMA 4UNKA 5FI8A 4Y9PA 2A1YA 2G0WA 3IIXA 4GJIA 5LNUA 3ZIZA 2PLJA 1XR2A 2I57A 4NRRA 4AEFA 1BWVA 3TCSA 3FV9A 4LVBA 3TQPA 4PBFA 1DL3A 1SR0A 2R91A 1AQ0A 2FKPA 4IPLA 2FZBA 3JU2A 3EDEA 2P3EA 5TQLA 1KR1A 1EBGA 3DGBA 4H9YA 3UZJA 3BW4A 5I6SA 1UQYA 4R33A 3W83A 1QVBA 4CKQA 1CLVA 9CGTA 3R6IA 2Y7DA 4LVDA 3BARA 1EUNA 1Z44A 2PGEA 1O1HA 2GFTA 4O57A 1JIBA 4DO5A 3VX1A 3IS4A 1AQFA 1SQ7A 2WMIA 4J3UA 3WF0A 3NQFA 3CIXA 3DHFA 2DZWA 4LEQA 1R30A 5JMUA 2GGIA 3LU2A 4JAWA 4GWEA 2F6UA 3NSNA 4NT0A 4ZODA 1J93A 1RCQA 3UG4A 1R6WA 2PDQA 1DJIA 3LHYA 4GE8A 4Z1AA 1J2WA 1S39A 3L2IA 3AISA 4HZ8A 3V1PA 1JPMA 1TWWA 2FVKA 3HPXA 2YB1A 2MANA 5A8MA 2Y70A 3BJFA 2CXEA 1L2QA 1HG3A 4GINA 4H8UA 3C2FA 1TVNA 3E0LA 2FTPA 5EMUA 1IIHA 2FZ8A 3RLHA 4C6QA 4J7RA 4LV4A 4FIRA 1WDRA 2OEMA 2YFOA 4V2XA 2CLMA 3GXMA 1Q85A 3A47A 5LNVA 1XH2A 1LOSA 2EEXA 1KCLA 5ABFB 4GNJA 5D9MA 3WX7A 1KFEA 4WXZA 3WEZA 1H7XA 1I9CB 3WJWA 2QGHA 5T26A 3M5ZA 2PD5A 2XSAA 1RALA 4XD6A 2WSYA 3B8VA 3A12A 3PB2A 5EBAA 1JULA 3TSBA 4X0VA 1FVPA 4IL0A 4ALDA 2OQYA 4M80A 2Z29A 4AZIA 1CXKA 4EF9A 1TR9A 3Q4DA 2Y6ZA 3GZ3A 4J5NA 5B7ZA 2JKAA 3EXSA 2NX3A 4RE2A 2F6XA 4QDMA 3HPZA 4CVWA 3SAZA 3W02A 4UNLA 3NFUA 3I65A 5G2IA 2FFCA 2V3EA 4DF1A 1BHGA 1KGXA 1RK6A 3AWOA 2E1DA 4GYPC 2WPBA 3UERA 3LN3A 2OYLA 1GKRA 3I7QA 1X8FA 4WX2A 5F7UA 3W76A 3K8MA 3S47A 1ZBVA 4POCA 2QHAA 1R2RA 2HMCA 3IGXA 5A6TC 1H5VA 1W5NA 4F40A 4ADUA 4R7JA 3K2GA 2XUCA 1OFOA 4M19A 3NZPA 1N8WA 1FWGC 4FF7A 3IUHA 1FWJC 1XLLA 4A6GA 4LNCA 1Z9AA 5D8ZA 1H0IA 4K2SA 2HPIA 3AYRA 2WVVB 3ZYZA 1GQJA 3PWIA 4JKMA 4ICMA 4LAZA 2NW0A 5FEWA 3ABQA 3M0LA 3DHPA