2QKFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
publication title Re-Establishing a Metal-Binding Scaffold with Full Activity in the Metal-Independent Kdo8P Synthase from Neisseria Meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
total genus 81
structure length 251
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qkfA00
4LU0A 4NXKA 2ZBTA 1OFAA 2Y62A 1LRNA 1VRDA 5KZMA 3C8FA 1TREA 2BSLA 3MHUA 4WXZA 3C3NA 2NUWA 1Z48A 4AWUA 3HBLA 4HKPA 4Z0SA 2ZDRA 1YDOA 1EA0A 1T0OA 2VEIA 5HR7A 1FWRA 5AC7A 4LV9A 2GQAA 4G1KA 5BOOA 3HGJA 2QUTA 4PC8A 2W79A 2GUUA 3DFPA 1FQ0A 1T99A 2NWSA 2X1RA 3STCA 1MXSA 3N73A 1OABA 1H50A 3PM6A 1AMKA 3O1NA 4IWWA 4X3ZA 2B7QA 4WOQA 1GVFA 3NM3A 1J5TA 3NQ2A 4O57A 1NF7A 3NL2A 4TMCA 1G4PA 4DO6A 4UR8A 1G4SA 3EXSA 1QFEA 1JUEA 1X7FA 3P82A 3EX2A 3MBFA 3W7EA 1JULA 5F4XA 2WNZA 4IUOA 2DU2A 1J2WA 3SY5A 2V82A 3B0VC 2PRLA 2EKCA 5AC8A 1H7RA 3OHIA 2P1FA 3P5YA 3KFTA 2D73A 5AYYA 4NT0A 1EUAA 4DF2A 3WK2A 1GQNA 4HNNA 1FBAA 3IV3A 2Y88A 1T96A 5DY3A 1MO0A 4JY9A 2OT1A 4HNTA 1EX5A 4ML9A 3LV6A 5G5IA 3W1TA 1A5AA 3W7JA 4WX2A 1SFJA 5GVJA 1H60A 3I6RA 4UXDA 3P8JA 3H55A 3IVUA 2EPHA 1IXOA 2QEZA 1A5BA 4Y6GA 2I9EA 5AOUA 4AAJA 3HJZA 4MY1A 1FCVA 3L21A 2Q8LA 4MOZA 1B3OA 3LHTA 4AF0A 3TAOA 1JCLA 2Z6IA 1BEUA 5F2LA 4X2RA 3G3MA 1PV8A 4UMBA 3UWVA 3W2MA 2QAFA 1BTMA 1F2JA 3W83A 3QPZA 5LNSA 5D2VA 4LUJA 1K7FA 1O5KA 1MEHA 2Y63A 3KAOA 3TXVA 4KFPA 2Q8ZA 1Y0EA 3MI3A 4EF8A 1YXCA 3B05A 3C0JA 3IIOA 1QCWA 2VELA 3NL5A 1NSJA 3KVLA 1L2UA 3LBMA 5D38A 5LHEA 1TRDA 1HUVA 3FIGA 1DHPA 3M43A 3EWBX 4ADSA 3W1NA 1XFBA 5BW6A 1OFOA 3W70A 3LI1A 4RZ5A 2NXIA 1XBZA 4NNBA 3UY7A 1W3IA 3GAYA 3G24A 1TJRA 4K7VA 3LX9A 1OFEA 3GK0A 3HG3A 2QR6A 4DBDA 2YX0A 2WQPA 4FX7A 1ZALA 2WOQA 4UTTC 4FXRA 3TA6A 2G95A 1ALDA 1ADOA 1TPWA 3GDKA 1F05A 3QRHA 3TCEA 4NJGA 4O0ZA 3QH2A 3W23A 3MP4A 1MZHA 4AHQA 4LOCA 4K7YA 1DV7A 3KX6A 2O7SA 3QC3A 1HO4A 2A4AA 2NWRA 2IQTA 4TO8A 1KLZA 4JNMA 3H53A 4IX2A 2CU0A 3PULA 2V9DA 3CIWA 3PBWA 3GNNA 1P5BA 5DCDA 2Y6ZA 3L68A 3TQKA 4NNAA 3O05A 2TRSA 4JTTA 3G1FA 3HQ1A 2E77A 4RKAA 4M6VA 5CPNA 3R13A 4UTMA 2LLEA 3TFXA 3LERA 3MP5A 3W76A 1OFPA 3CB8A 4BK9A 5AC6A 4WJEA 1YYAA 4BI6A 3DBPA 4AHPA 2FQIA 1AW2A 4RZ6A 3IGXA 3L5LA 4RK8A 3O07A 3GKFA 1BKSA 2HTMA 2W0UA 2QAPA 1KM2A 2I1OA 4JEQA 4O53A 4AMAA 3LXBA 5K4ZA 3TMQA 3NGJA 3W7PA 5AHMA 3AO0A 2VEKA 5DN1A 3S1UA 5F2MA 2BLEA 5LGZA 3DFQA 3S1XA 3CEUA 5EBUA 3EWUA 3W1MA 2JBMA 1GVQA 1RQBA 3NO5A 3OIXA 3UWQA 1LZOA 2YYUA 3T4CA 1OHLA 2DZWA 1ME7A 5I3JA 5KZDA 5AHLA 2PE4A 5G4EA 4DQWA 2WV8A 1XDLA 4YXGA 4FEZA 5A5WA 3GR8A 4ALDA 2QDHA 3T78A 3W2JA 1A50A 4QAIA 3THAA 3NOEA 3WJWA 2B4GA 2RFGA 4HIBA 1QO5A 3LCIA 3HB9A 4BWLC 4DF1A 5CSSA 3OBKA 1FWSA 3PG9A 1HO1A 2V2CA 1ZFJA 2ISWA 3T40A 1OF8A 4ADUA 4FIQA 3F1QA 3K30A 4FX8A 4HPXA 5K9DA 4MZ8A 3JR2A 5HQEA 1VHNA 5DCEA 3BW2A 2RDWA 4MKNA 5AYZA 3NQ8A 3NPVA 3LXCA 1KTCA 4GRSA 3GB6A 1VC4A 3L9CA 3EX1A 2YFNA 4FNTA 1Q6QA 3NG3A 3TR2A 2E6YA 2XFWA 2YFOA 3LRKA 3KVKA 4Z1AA 5AHNA 4Z08A 2A7NA 2CLMA 3F4NA 3L67A 3NZ1A 5DBUA 5D2XA 3C56A 2H90A 2QCDB 4NUWA 4OGZA 3C2VA 3EKZA 3W1LA 3SGUA 2DZVA 5K4XA 2ZFAA 4O28A 2ATMA 5D09A 2CFFA 2YPIA 4O8RA 1VCVA 3C6CA 3TK7A 2J24A 3VKJA 4Y90A 1TV7A 1IF2A 3I7SA 4DEFA 3IGUA 1LOSA 4WOZA 2F84A 2A0NA 5FEZA 4RZ4A 3Q94A 1PL9A 2PCQA 2PURA 4O1CA 1QMLA 1KBIA 4JX4A 4XKYB 1HG3A 2J9XA 4R33A 2NV2A 2J9ZA 1TPH1 3WK1A 1WBHA 4BFAA 4O18A 3W22A 3KRSA 1JQVA 2QCCA 3O63A 3NQMA 4RV8A 3TFCA 3NVTA 2GVLA 3W74A 4GUGA 3GDMA 4LS1A 4N9EA 1GZGA 1TV8A 1FXQA 4NVTA 1R47A 5CKSA 5U4NA 3L65A 1ICSA 1XUUA 1M6JA 2RHGA 5TIMA 1YTDA 3SW6A 2RDUA 4GUFA 4U28A 3EB2A 1B4KA 1D9EA 2VEMA 2WSYA 4GBUA 3W7HA 4IJBA 3R8RA 2R14A 4HPJA 2C15A 1GYLA 2ZRWA 1OK6A 4O19A 1Z42A 5G1YA 2CZFA 2A7RA 2CZDA 3QMRA 3G3DA 3UWZA 1GTEA 3MWAA 2G97A 3I7RA 4UMAA 2XN0A 1WYIA 3ATYA 4A29A 2EF9A 1TPVA 2ZRXA 4FNRA 6ALDA 1TTQA 1P0KA 1XI3A 4DXVA 3NQ7A 2YYTA 2PRHA 3PB2A 4A2SA 1LORA 1G7VA 4PH6A 1CX9A 3LRLA 1VCGA 4EIVA 4UTWC 1B57A 2VFDA 5FI8A 3W73A 1KM0A 2C1HA 1IXNA 4RXFA 5BMXA 1Q3NA 4GUIA 2Y85A 4GWEA 1OYAA 3RNDA 1O95A 1JCYA 4DPQA 2ZZ5A 5KZEA 3N34A 1FX6A 5I3FA 1X1OA 2B7PA 2VFEA 1LBLA 4MYXA 1KFBA 1YTEA 3WJYA 2ZZ2A 3LB0A 5DELA 2Y89A 5FF0A 2Y7EA 3CPRA 4FNPA 4E2DA 4M5PA 4M6QA 3S5NA 2X16A 1XBXA 3THQA 4Q4KA 5D2TA 4ORIA 4HNUA 1GPWA 3PS7A 2CLOA 3P74A 4WY0B 2E68A 1SSDA 2YGYA 3TSMA 4K39A 1EIXA 2GVJA 1PVNA 1H62A 4PODA 3PVFA 2B7NA 1AW5A 3ZFHA 1W8SA 1AW1A 3ABRA 3UPWA 4RCXA 2VFIA 3W1RA 3W86A 2XN2A 4N4QA 1R46A 4K36A 1SU5A 4FO4A 3G1YA 1Q45A 1UASA 1AK5A 3NL6A 1LRQA 2P10A 1RPXA 2HSAA 4R34A 4AWSA 2A21A 4LVAA 1QPNA 1I2QA 1WQ5A 1L6YA 1TB3A 3W84A 3Q58A 4HSOA 1EPXA 4NZJA 1FXPA 1G4EA 1XL9A 4UFJA 3OA3A 2BZNA 4FXSA 3ZWSA 1SZNA 4ZQMA 1FDZA 5BMWA 3TDFA 3U2OA 3BPWA 3R12A 1W3TA 3P5ZA 1K03A 5D30A 4JTIA 2AAMA 2H3BA 2H6RA 1X1ZA 3DU0A 3MYOA 3ATZA 3L66A 3MBDA 4CQAA 1WV2A 4IPIA 1OFQA 3MUXA 1GVSA 4Z0JA 4BI7A 3PSWA 2WO5A 2BWGA 2QJGA 1EWEA 3LV5A 3DAQA 3N2XA 1TQXA 5D04C 2HMCA 1KV8A 3G0XA 1V5XA 4NXSA 4Z1DA 3W1UA 3IIVA 2ZZ3A 4C1LA 1KFCA 3TKFA 5D03A 3OVPA 3I65A 3C4UA 1TQJA 2BTMA 3B03A 4ONVA 1LOQA 1TV5A 3RFAA 5C5YA 2X30A 4DPPA 1XCFA 4JGDA 4D2JA 1YDVA 1I4NA 3LDVA 2C13A 4OBTA 2FFCA 1UCWA 4WUIA 3HOJA 4QJ1A 1SUXA 4JN6A 3IVSA 2P0OA 3KRUA 4HNVA 3DFNA 1ZAHA 1VYRA 4KFOA 1H7OA 3A9IA 1P0NA 2Y70A 3MO7A 3SR7A 3SSJA 2TPSA 2NUYA 3EX3A 3B4UA 3L2IA 3QFEA 3BGGA 3PBUA 4QNEA 3L5AA 3UWUA 4XWUA 3O15A 3VE7A 3W2NA 3PUEA 4E0CA 3TV8A 1W56A 5LNVA 3CQ0A 5HUOA 1XBVA 1TMHA 2I14A 2NLIA 1B9BA 2EHHA 2YDAA 5IBXA 1H7WA 2C6QA 3T44A 3W85A 5LSMA 3DENA 2QUVA 3LHVA 3QQ1A 3O8AA 4ZZ9A 3UY8A 2E6AA 1GYNA 4OU1A 1I2NA 5CSRA 5D32A 4Z1CA 1PE1A 3M9YA 1ICQA 3W9ZA 1OYCA 2Y7FA 1SO5A 1NVMA 1F6PA 5FF2A 3VI2A 2BX7A 1WX0A 4AXKA 5E1QA 3KHJA 2YCEA 4MPQA 3LCGA 4CQ9A 1SQ7A 3B0PA 4O14A 3DHDA 4GUJA 4AVFA 1U5JA 4ICNA 3PUDA 3UZ5A 1ZCOA 3W2LA 5EA9A 4IQLA 5CPLA 3WK3A 3OVQA 4UNKA 1QR7A 1S5WA 3HGRA 1VZWA 3NZRA 6TIMA 3N14A 5CPOA 4EWND 3S42A 3CIXA 3M0ZA 3IIZA 1DJQA 1K8ZA 4TX9A 1KM1A 2Q3OA 4IOTA 3A5VA 4JTUA 4QNWA 2Y7DA 1SZGA 2C3ZA 3B0UX 4M6PA 4U4MA 2OT0A 2ZA3A 1ZAJA 1NF0A 1AG1O 2RH9A 3CLMA 4ZQCA 4DF0A 4GXMA 2NXGA 5J5DA 2E5CA 5CZTA 4O4WA 4EF9A 3DFSA 1GVOA 3GX9A 1W54A 4LVBA 2ZRZA 1SO4A 2GOUA 4B5NA 5FESA 5T26A 1RR2A 2A6LA 3BVJA 4CCEA 3SGZA 1RZMA 1SW3A 3AJXA 2C19A 2FLIA 1BWKA 4XUGA 2WNQA 5BNKA 4ZVJA 4OV4A 3RF9A 1JRCA 3M7WA 4X22A 3LCXA 4IMEA 3P67A 1XXXA 1MSSA 4MY8A 2J88A 4RXGA 1R2RA 2ZTKA 1GTHA 2X1UA 4JTEA 4OQVA 2W6RA 1W37A 4Y8FA 1W5NA 5MHBA 3L0GA 3QMTA 5SWUA 1W5OA 5FEXA 1C29A 1XUZA 2DJXA 3W6YA 4K8EA 5D37A 4I7WA 3DKLA 4UCGA 3W7KA 1QAPA 2TYSA 5I3IA 4N6FA 1XKYA 4UUIA 3FEMA 4LVFA 1F76A 3DFTA 1E51A 1VQTA 3TJXA 4O11A 1PS9A 1KBJA 4IMDA 4CLMA 2ZTJA 3ABSA 1V7YA 1S3HA 1KW1A 1CW2A 4AB4A 4S2BA 3TQVA 4I7UA 2TMDA 2ABBA 1ZENA 5FF4A 2QCMA 2JGYA 3G1VA 3NM1A 1W1ZA 3P84A 1X8FA 3NPWA 4I9AA 3FFSA 3HIJA 3M6YA 4YL2A 2A6NA 1ICPA 4RJEA 2FIQA 2J9YA 2YXGA 1H51A 1FWNA 5I3HA 1I8JA 1R2TA 4LS2A 1KLYA 3HO8A 1FDJA 3NAVA 2A2IA 3QMSA 3KVJA 3LCWA 1DQXA 4RLIA 2YR1A 2V0TA 2NX9A 5IM51 2E5BA 4YLWA 4PL2A 3BG3A 4E2BA 2WSQA 1O4UA 5G2HA 3PUOA 2DZXA 4JD4A 1FWWA 3MP3A 1H1ZA 3QYQA 1SW0A 1KFLA 5D33A 4O0KA 3A21A 5E0KA 3ZWTA 1O60A 1JCNA 1HFBA 5G4WA 2E6DA 4GE8A 3FKRA 1TPC1 3CM4A 3CHVA 3LHYA 1OVDA 2RDTA 2A1YA 5DXYA 3SFKA 3LI0A 4O54A 3E12A 3KOFA 3R2GA 2QCEA 3INPA 5G1TA 5KTLA 2ISSA 3WFAA 2WKJA 3GKAA 1G67A 3R89A 2AQWA 4LC8A 4IMFA 1M7PA 3W2KA 4UFIA 2R94A 2ZA1A 3PWAA 1F6KA 3LTSA 3EEGA 3TSDA 3NDOA 3OVRA 4HT3A 4JIQA 3USBA 4UFMA 5HMSA 4OWGA 4JDBA 2QCDA 4UTUA 1VJIA 1TJPA 1YDNA 1A5SA 4JICA 4QM1A 4C1KA 4H4IA 5I3KA 3A23A 2NZLA 4MZYA 5D05A 3LHZA 4GFSA 1JUBA 4PEKA 1ME8A 3W71A 3BGJA 5EMUA 3G8RA 2FPTA 3I7QA 1H7PA 2QF7A 1GG1A 1KM4A 4HN4A 1GEQA 1H7XA 4JS3A 1YXDA 3B8DA 3CWNA 4HSNA 4UR7A 4XKYA 2Z1BA 5LNUA 3T7VA 2NUXA 4JTSA 4UFKA 4FHAA 1J4EA 1SZFA 3E0IA 1LBMA 3W7RA 1XC4A 4FNUA 3N9SA 3NEVA 3SJ3A 5EY5A 3W75A 4NJKA 5C54A 3GDRA 2VKZG 3LTYA 5LGXA 1OK4A 4K6AA 3PY2A 2Z6JA 4M19A 3IIPA 3EXTA 2CLEA 1WA3A 1L9WA 2B7OA 4LRSA 3SECA 1Z41A 1B4EA 3NYZA 2EAWA 4ZQPA 4MY9A 3FS2A 1M7OA 3W1QA 4YCOA 1OFDA 5DXXA 2CZ5A 3P60A 4YWIA 2QCGA 5FEPA 3GLCA 2UV8G 2E09A 4LV4A 3EX6A 1W31A 3QF0A 4O13A 2B0MA 1D3HA 1WXJA 1DJNA 3MI6A 4FNSA 4N9DA 4YCPA 3STEA 2ZQ0A 1VYSX 1F7BA 2PC4A 3NQVA 3UQNA 2X1SA 5FEWA 3S5OA 1EP2A 1PCWA 3HG4A 3QSRA 3SI9A 4M7TA 4NX5A 2CLIA 2FDSA 4BF9A 3LOTA 1PCKA 1OX6A 3PF3A 4WQ6A 1VH7A 1YADA 2ZZ4A 2ZRYA 3W7CA 3STGA 3EX4A 2VOMA 4CNOA 3TE9A 1OF6A 2GJLA 2QCHA 1NAL1 1VR6A 3Q2DA 3NQEA 3TROA 4O17A 4E38A 1H61A 4N6EA 3LHUA 1GJPA 3FA5A 1C9DA 3E9AA 2RKXA 4LNYA 5K9XA 1VLWA 1TPEA 2HS6A 3W7DA 3YPIA 4GNJA 1N7KA 3M1ZA 3NQFA 2OX1A 3NQ6A 5F1VA 1NFBA 5DY2A 3M16A 2FPYA 3S5YA 4Z1BA 3NL3A 1GOXA 2O7QA 4WY0A 3MHGA 3FOKA 3HG5A 5L9FA 1UB3A 3RLVA 3QPYA 1SZEA 1TPFA 4Q32A 3ANYA 8TIMA 2TSYA 5K3VA 4O1BA 1YXYA 2J6XA 3NPUA 4POCA 4MYAA 4A3UA 1OX4B 3LBCA 4XQ6A 2VEPA 3FLUA 2DZUA 1XM3A 4QITA 4UTHA 1CI1A 3MHFA 3W88A 1I2PA 1UUOA 3O16A 3G8EA 2YW4A 3A22A 3GYEA 4NQ1A 3PSVA 3GDTA 2WNNA 2JGQA 1KFEA 3W7QA 2FJKA 3W7IA 3GNDA 5HUPA 3O6YX 3M5YA 4O16A 1I45A 1SO3A 3TNOA 4BI5A 1EB3A 3Q37A 3JS3A 3O6DA 1DKWA 4RR4A 2GPTA 3D0CA 3G22A 3NPXA 5CZ0A 1DOSA 4O1AA 4JYFA 3DGRA 1FCBA 4LVDA 4EOUA 1FCQA 1R30A 3P81A 3W7LA 2OMAA 3M5ZA 2QCNA 1IXQA 1UUMA 3LCFA 2C16A 5HWJA 1LDCA 3GVGA 4UTJA 1JCXA 1JR1A 5ABTA 3TIMA 1GG0A 2XN1A 3S1WA 1K8YA 1G6CA 3MJYA 3S1VA 3F03K 3NNTA 4K37A 3S5ZA 3UWWA 3G18A 1W5PA 3GXNA 1P4CA 1TO3A 5LHFA 3BV4A 4K8HA 1A5CA 1P1XA 3OEXA 2CLKA 1TIMA 1VGAA 1K3UA 1SPQA 1SO6A 4O12A 2VXNA 3UXAA 3WJZA 1KTBA 4DO4A 2J27A 3CU2A 1TPB1 1KM6A 1W5QA 3LCLA 4MJZA 1QDSA 4R53A 3TUUA 5F4WA 4ZL1A 3TJLA 3VCRA 3M41A 1D3GA 1DL3A 3S0CA 3LRMA 4LC6A 1EP1A 2X2GA 1YPFA 1FCUA 5F1UA 4S1FA 1SW7A 1TCDA 4UIOA 4JR5A 3W07A 3N3MA 2Z0IA 1QPOA 3CT7A 1VLIA 3TU9A 1Q6RA 4XBKA 1LTDA 3PC0A 4O10A 1LRTA 3LM7A 5CPMA 3QJAA 2ATSA 2DJLA 2DZTA 3UXDA 3MI2A 4KWVA 3NA8A 1H7NA 2QCLA 1M5WA 1YTKA 3CC1A 1MEWA 3LCHA 3P7YA 1KM5A 3KVMA 2V81A 3RK8A 4NNCA 5CG7A 3GAKA 3V1PA 3BO9A 2Y7GA 2FPVA 3HPSA 1PHWA 3IEBA 1DVJA 2H8XA 1R2SA 4DELA 2R91A 4IX0A 1WDWA 3TMLA 3L0KA 2A5HA 4OHQA 4LS0A 3HF3A 1W5MA 1H63A 5EL1A 4IXXA 5LNWA 2C0AA 5D02A 3P8IA 4JYDA 2Z2UA 3O6CA 2A85A 1IIGA 1PHQA 5D2WA 1ZAIA 3RMJA 4EVZA 3BG5A 4CQ8A 3KXQA 1S5VA 4MUZA 3TW7A 3QZEA 2JK2A 4UTTA 5LNRA 4OT7A 3PG8A 3GZ3A 2KZHA 4ZQNA 4JDYA 1TTIA 1O94A 2WPBA 5EPDA 3UD6A 2G5WA 2DZSA 4UTIA 2E1DA 1QWGA 3E96A 2ZA2A 1LP6A 4N9BA 5LKYA 3G0SA 1X6UA 5HULA 1QOPA 4A2RA 1IGSA 2VFHA 3EWYA 3BW4A 1S5TA 1THFD 1NEYA 1SSGA 3M47A 1LROA 1UBSA 2ZZ7A 3L0NA 4O15A 3WJSA 3E49A 4MFEA 4LT9A 2VC6A 4WY0F 1JUKA 2BXVA 2DZPA 3GXPA 4H6KA 1GVRA 1EEPA 3TH6A 5C2XA 5AB3A 1K8XA 4O52A 3GXTA 1KV5A 4IPJA 4WD0A 4JTKA 2ABAA 4QQ3A 4AF0B 3N19B 3IRDA 1N55A 3LTPA 4KFNA 4XZ9A 5CZJA 4P61A 4JIPA 2YW3A 5AHIA 5EKYA 2Y61A 1JJKA 2A7PA 2V30A 3CTLA 3WJXA 2ZZ1A 3G1XA 4KKXA 1SR9A 1OX5A 1OFRA 4UNLA 3FKKA 3W7OA 2ALDA 3B04A 2H8ZA 2QCFA 3NR0A 5CGQA 3FYOA 3HGOA 1DORA 3G0UA 5HR6A 3NQDA 3S8HA 3CWOX 1JVNA 5TQLA 4JTGA 2CZEA 3E02A 2YSWA 4GUHA 5IBXC 4JTLA 4XTIA 4XTDA 1H1YA 4X9SA 4O1DA 2QJIA 3ZR4A 3HGSA 3STFA 4UMCA 3S9YA 3FYPA 3P61A 2WJZA 3UYCA 3F4WA 5H91A 3TXZA 1FWTA 3TC7A 3W1AA 4N02A 2VFGA 5FF3A 4BWLA 2PRMA 1LLZA 1MEIA 4I7VA 4GC4A 3ELFA 2DP3A 4MJMA 5BRBA 5AN7A 3UWYA 4PFMA 1EUNA 1Q6LA 1I2OA 2ZZ6A 1VYPX 2NX1A 3C2OA 4FX6M 4N9CA 3EWXA 1HTIA 5HINA 1LYXA 4H3DA 5G2IA 4FIRA 3NXFA 4KWWA 4MVAA 1OYBA 3QEZA 2GVGA 5AHEA 4NU7A 3EWWA 5J5RA 1JCMP 5TBOA 1KM3A 3B06A 5DCBA 4DBEA 3BG9A 2CLLA 4A21A 3MW7A 4LWWA 2E5DA 4JYEA 4O50A 3GR7A 3QW3A 5AYXA 3DI1A 3MMTA 1KTNA 1RVGA 3W2UA 4K38A 1EP3A 2V2DA 2CLFA 3EKLA 3W3OA 5H2ZA 1KA9F 4FB7A 1RV8A 2AGKA 5D2YA 1ML1A 4NX0A 2V5LA 5KINA 2FB3A 1XBYA 3NQCA 4MFDA 3W7GA 4UTLA 3I68A 3BARA 1GWJA 1QOQA 3GIYA 3VE9A 1L6SA 3PB0A 2GJNA 2X1TA 5K9CA 3GDLA 4LW7A 3W7MA 2YZRA 3C52A 3DFOA 5KITA 4J9JA 3N2MA 3O06A 5HNRA 3KRZA 3BLIA 1G4TA 5DLCA 5HJLA 1DQWA 3M5VA 4PCFA 3W72A 4UFHA 3EWZA 4LTSA 1ZJIA 5LZLA 3LXAA 1XDMA 2GQ9A 1LLWA 2C14A 4N2YA 2V5BA 1WOAA 2FB2A 3CEPA 3TQ0A 4QSHA 2ZRVA 4FF7A 4ZQOA 1K02A 1I2RA 3U8GA 3S6DA 3NQAA 4JTJA 3SIZA 4TU1A 3RLUA 5A8GA 5KSWA 1ME9A 1VS1A 2QDGA 1T8XA 1FUYA 4ZQRA 1WBJA 4LVGA 3QW4B 4NJJA 3ZS4A 4WZHA 2Q3RA 1N8FA 1F74A 4JY8A 5CZSA 4IMCA 4Q33A 1F73A 5F2IA 2NV1A 3LHWA 1QNVA 4W9TA 3TW6A 3HPZA 4CNPA 3N9RA 1KFJA 4Y9AA 2C18A 1OJXA 4UC5A 3LLDA 2VENA 3P80A 4UTWA 5U7SA 1FDYA 1ONRA 3A24A 4L4MA 4MIMA 1VCFA 4TR9A 2NXHA 3TC6A 3BLEA 3W87A 1K7EA 1OG0A 3PR2A 1BWLA 1TPDA 4R7JA 4QISA 1JRBA 4PL1A 4L4LA 3UNDA 3C61A 1DBTA 1SFLA 2G96A 3G1DA 1G69A 3T55A 1GT8A 5EYWA 3PAJA 4HHPA 4M7SA 4N4PA 4P2VA 3U6WA 2ISVA 1HL2A 1YPIA 4MLJA 4AHOA 3W1XA 5E93A 3G1HA 2QJHA 1FY6A 3C2EA 2ZYFA 1QPRA 4TMBA 4A22A 4LY8A 2OJPA 1U83A 1C8VA 4Y96A 5C6MA 1H5YA 3R5EA 1Z44A 3UPBA 4LUIA 4LRTA 4TIMA 1PIIA 3QM3A 1TTPA 3IVTA 3DZ1A 2HS8A 2E6FA 3LGEA 3PBVA 4CNNA 4DO5A 5HWMA 3P62A 1ZY9A 3QSTA 4WXYA 4ADTA 2JKAA 3VFLA 3H54A 1W3NA 1QPQA 1JQXA 1ZNNA 2WSRA 3TX9A 1KFKA 3HG2A 1TSIA 2DORA 3DHFA 4JXCA 5L6UA 3FJLA 2OZ0A 1OFBA 2OCZA 3TSBA 1ZHAA 3G1AA 5AFDA 4QIUA 3DI0A 1UJPA 1LM1A 3M44A 3L5MA 3W1PA 3HPXA 4UTKA 4PA8A 3BLFA 4AEOA 1OX4A 3M5XA 4PTNA 3DKJA 1K7XA 1RD5A 2V2HA 2JKPA 4IGHA 3DH7A 2H3DA 3LLFA 3SZ8A 4CCCA 4FNQA 3G1SA 4CCDA 4JX5A 5KMYA 1QO2A 4YMZA 3WK0A 1O5XA 3NQGA 3IGSA 4IXHA 4XBSA 4NZFA 2F7FA 4BR1A 2V8ZA 2ZCGA 2EGZA 3JRKA 1TPUA 3MYPA 1TYGA 4UFLA 1LOLA 3DXIA 2R8WA 4JTHA 4JTFA 3QQ0A 7TIMA 5AHFA 3BW3A 2CW6A 5C55A 2JKEA 4MLRA 5K2ZA 3A5FA 1W0MA 4ORMA 5K7JA 1IIHA 3C2FA 3HMJG 1RQHA 5G2WA 4IMGA 4JX6A 2QKFA 1AL7A 4OV9A 1LBFA 3BK0A 5FF7A 3TAKA 1JCJA 3IIXA 2CWNA 5DBTA 3V75A 3OG3A 2NX3A 1A53A 4OE7A 4NJHA 1VPXA 3EXRA 4RX0A 4S2CA 3VNDA 3W7NA 1Q6OA 1WAUA 1F5ZA 2GQ8A 1G7UA 4GJ1A 1TTJA 5F2GA 3ABOA 3UZJA 2ZRUA 2QUUA 4MZ1A 4O4VA 1IXPA 3FJ6A 1YLVA 3C2RA 1LCOA 5I3GA 4NJIA 1AL8A 1WOBA 2CLHA 5HWNA 1EWDA 4AH7A 1RQEA 3PBYA 2FTPA 2VFFA 5F4SA 1TRIA 1L6WA 4AWTA 3RU6A 3ABQA 1VHCA 4ZMGA
chains in the Genus database with same CATH superfamily
4M24A 4EAMA 1GQJA 5CBIA 2FH6A 1OFAA 4J3XA 1GZ1A 4Q8WA 1DTNA 4XG1A 1L8NA 5FAGA 3MHUA 2CXGA 3SAZA 1Z48A 5HANA 3F2DA 3K5XA 1EA0A 3VINA 2VEIA 4ZSTA 4ZBCA 1E6PA 4KCTA 3OBAA 2Q09A 3UJSA 3NWRA 4PC8A 2PFHA 3GE7A 3DFPA 1T99A 4D6HA 1OD0A 1CGYA 3PM6A 4X3ZA 3VD7A 1IEIA 1DTUA 1E1FA 4UR8A 1J0YA 1G4SA 2J74A 3EXSA 1QFEA 1JUEA 4WIWA 1X7FA 4E8GA 1BWVA 1GKPA 2R1NA 2DW6A 1J0JA 1HL9A 1W3JA 2J8GA 2P1FA 3P5YA 3KFTA 4NT0A 3WK2A 1GQNA 4LQ1A 5CZKA 3REQB 3IV3A 2P8BA 3TYAA 5DY3A 3DYMA 4C6DA 1EX5A 1VFLA 4GH3A 2X05A 1A5AA 1OM0A 1VEMA 2XISA 3K1DA 3PZUA 4NZ4A 2V3GA 1HF6A 3SRDA 4J3TA 2CHOA 3TWAA 5A8QA 6XIMA 2EPHA 2QEZA 5AOUA 4AAJA 2I5QA 2I9EA 4JZ5A 1JPHA 4MY1A 3L21A 3CV7A 1B3OA 2QIWA 1K1DA 1JCLA 4S3CA 3E0FA 5HDRA 3WF3A 2PLKA 6ENLA 1KWGA 3G3MA 3UT0A 3GC5A 3VD3A 4DNMA 2HISA 3W83A 1F2JA 4LPCA 1WE5A 4LUJA 1EYWA 3DUGA 3LA4A 4PULA 3TXVA 1MW0A 1MI3A 4RNIA 3C5QA 3EOEA 4OFCA 3LBMA 1L2UA 4KMQA 3EPMA 3EDKA 3KDNA 4JL2A 2DVUA 1HUVA 3FIGA 4G9PA 3M43A 5D9OA 3SQLA 5BW6A 3MKKA 4MJ2A 3FDKA 9CGTA 3PZMA 4RZ5A 2UY5A 1S2CA 5FJJA 1L2QA 1IEWA 3NO3A 3HN3A 2E0PA 1XIDA 3PBGA 3GTHA 2PZ0A 4DBDA 1RAKA 1BD0A 2OWXA 3SN0A 4A8RA 3AYVA 2WOQA 1QI4A 4A8NA 4IIHA 1ALDA 3VIIA 3QRHA 3TCEA 1NFPA 3FW6A 1ESWA 3MP4A 4L9ZA 4AHQA 2PU0A 4LOCA 3WBAA 3B8IA 3V1HA 2GK1B 4FR1A 2A4AA 3NDZA 4IL0A 4JNMA 3BLOA 4IX2A 2CU0A 3PBWA 4G1NA 4BF5A 5EMMA 1ISZA 4AZ5A 1TZZA 3UGVA 3TQKA 4NNAA 4GIRA 2BG5A 2DGAA 4JIEA 3E74A 1BQGA 3G1FA 3ITCA 3VKKA 4J4KA 2ZUUA 3DC0A 4M6VA 4UTMA 4DJFD 1DYSA 4DWSC 4FXFA 3W76A 3CB8A 5AC6A 4WJEA 3AJ7A 5I07A 4JFWA 1UIOA 3H23A 3LQGA 1DQUA 3KOXA 4NRRA 3THCA 1BKSA 3ITXA 1JIBA 3H21A 3S2NA 1BXCA 2QAPA 2MNRA 5DRCA 2BGSA 1DJWA 5K4ZA 3RCNA 1EJUC 4UQDA 1W1TA 2VEKA 3S1UA 1X6LA 3P3BA 5LGZA 3DFQA 2XIJA 5EBUA 1GVQA 3UWQA 3OIXA 2ISDA 1FWHC 1LZOA 1OHLA 1PIFA 4ZOBA 4HB7A 3KBSA 3KDOA 5DMYA 4K68A 5DF0A 2VQTA 2WNWA 4OTKA 1A49A 2HVOA 2QDHA 1A50A 1N8WA 4QAIA 1ITQA 2JFEX 3B8WA 5C70A 2AKMA 3PG9A 2V2CA 2WZHA 1ZFJA 4URIA 3T40A 5K9DA 3TR9A 4HPXA 3R10A 5M1TA 1U1HA 4IPNB 4O1EA 1EC7A 2WHJA 3BW2A 4MKNA 4IF2A 2Z1KA 3NPVA 1DPMA 4GRSA 1VC4A 1B1YA 3L9CA 2OSXA 1UC4A 2AKZA 2QMJA 1JYVA 3ARZA 4PRTA 3LRKA 3V5OA 4O0QA 3WMLA 4Z1AA 1F6YA 3VKDA 2A7NA 3F4NA 3KM8A 4RNFA 4OGZA 1UD5A 4O8RA 3TK7A 5FA5A 5M17A 3PZOA 1IF2A 3I7SA 3CZJA 1LQ2A 1LOSA 3KTCA 4YTRA 3B40A 3SN1A 2A0NA 4RDWA 1MWOA 1UWSA 2VUNA 1YW1A 3FHQA 1QMLA 3UNTA 3HM7A 1PUDA 2IMRA 2J9ZA 1TPH1 1WBHA 4WVXA 4R5EA 2INEA 3M0XA 1JQVA 2QCCA 4GY7A 3F4DA 3WUGA 3EZ4A 4GO8A 2GVLA 3UJEA 4LS1A 4N9EA 1GZGA 4JCMA 3WFLA 2PWDA 1QK2A 5CKSA 2F6XA 3VNLA 4UR9A 4XKMA 3EB2A 1D9EA 1V77A 3KUMA 4MWAC 3W7HA 3K4WA 2C15A 1W9XA 1OK6A 3SCVA 5JU6A 4OVXA 1IR2A 5I23A 3AIWA 4UZUA 2OO0A 3MWAA 4W5UA 2XN0A 1WYIA 1FHDA 1HN1A 4FNRA 4L64A 4LYQA 1TTQA 1XI3A 4WKHA 5E9AA 3B8VA 4DXVA 4LALA 1VENA 1FWAC 1XQLA 1LORA 4ICCX 1GUVA 1CX9A 4EIVA 2XH4A 1Q85A 3FAXA 1N8IA 2C1HA 3L4ZA 3QOKA 4RXFA 5BMXA 1UWTA 4GUIA 5A6BA 4GWEA 1OYAA 1KC7A 4DAFA 3VNKA 2FZDA 5H8UA 1V0MA 3N34A 4QXIA 1VEOA 1X1OA 1LBLA 3OPSA 2PGFA 4EPEC 1OWQA 4J27A 2D0FA 3R25A 3S5SA 3CPRA 4M6QA 4H8VA 2G3JA 3GUGA 3D3FA 4DBUA 4B2DA 3PS7A 3P74A 2E68A 1BVZA 2YGYA 3TSMA 2UBPC 4R3UA 1DIDA 1XRTA 1EKOA 4HA3A 4I5UA 3VGFA 3PVFA 5HMEA 1BHGA 3ZFHA 3TQPA 2YCJA 1PTAA 5A6SA 2GJPA 4DWSD 5T91A 3ABRA 2H9AB 5J04A 4N4QA 1R46A 5BRQA 4FO4A 1TUXA 1OQFA 2HSAA 1VPYA 4ZOCA 1J6PA 3WLSA 2A21A 4Q8OA 3DESA 2BY1A 4A3QA 1WQ5A 1L6YA 1TB3A 1P7TA 3W84A 1G4EA 1PX8A 2BZNA 3RDKA 1JFXA 2HWGA 3DECA 1UD6A 3U2OA 4G56A 3R7MA 3EEZA 2PU1A 1PXGA 2YCKX 2EPNA 1WKEA 4JTIA 4X61A 2YB1A 3TJIA 4IFKB 3DU0A 4KH2A 3E3HA 3ATZA 3MUXA 3RLHA 3BMVA 1S3TC 3DAQA 1SM9A 4C6NA 1XDJA 5D04C 2HMCA 1KV8A 1SJDA 4ACZA 1V8EA 1V5XA 3UXIA 4Z1DA 1KRCC 4C6QA 3HJEA 3TKFA 3VOGA 3OVPA 4PFHA 1KQZA 2X40A 2ZKMX 3RFAA 1TV5A 3TEVA 2X30A 4JGDA 4D2JA 3TVAA 2C13A 2GDUA 3EDFA 4QJ1A 1ZBVA 3SDOA 3IVSA 3KRUA 4HN8A 1ZAHA 4KFOA 1H7OA 3A9IA 2Y70A 3IJQA 4QAWA 6XIAA 5I00A 2NUYA 4D72A 3H70A 3BMXA 5HMDA 4QNEA 4MKVA 3L5AA 1XJBA 2ASHA 4XWUA 1RBLA 3W2NA 1NP2A 3TV8A 1W56A 5LNVA 4HYVA 2WLZA 2DIKA 5FOOA 4LYRA 5IBXA 2C6QA 2FGZA 2QUVA 4XUYA 5CPTA 3O8AA 4XZMX 1TG7A 3UY8A 2EG8A 5D32A 3IK2A 4OKDA 4A35A 4GYJA 1JCTA 1F3WA 1UA3A 1F6PA 2ZIDA 2D2GA 2YCEA 4MPQA 4LANA 4PYSA 1C7SA 3B0PA 3DHDA 4MWAD 3PUDA 3QKEA 5HQMA 1ZU8A 3KBJA 4Q8UA 4PUDA 1EBHA 1V6UA 3F4CA 1BYAA 4MM1A 3IIZA 3SUUA 2OGJA 3AU6A 4IOTA 2VZSA 3NZPA 4Q8QA 1ZGDA 4JTUA 4AYGA 1SZGA 4V33A 3CQHA 1JPKA 1T7LA 4NI8A 5JXQA 3BURA 2RH9A 4IFOA 1AG1O 3CLMA 4ZQCA 5J5DA 5BROA 5CZTA 2BOGX 2SFPA 3V0SA 1TR9A 4EF9A 4ZO7A 3HQNA 3DFSA 2WBGA 4US5A 3WNNA 1QPKA 4LVBA 2GOUA 5D9MA 4DWSB 1R7AA 5T26A 1RR2A 1O5QA 3MV01 1RZMA 1HW6A 1SW3A 2VC5A 3AJXA 2C19A 2OEJA 3UR8A 4XUGA 4MNMA 1UR9A 4ZVJA 4FA3A 4QFUA 3IJ8A 1JRCA 2VX5A 3WNMA 4DRSA 3SRKA 3SURA 3XIMA 1ZP3A 2VX7A 1CLKA 1R2RA 1PZ3A 4WKFA 3L0GA 3WNPA 1KCKA 5ABFB 5SWUA 1OIMA 2E1WA 2VM8A 3NCOA 7PTDA 1XUZA 4JQ2A 3W6YA 1E3ZA 4K8EA 3ZJ7A 3BCFA 3DKLA 4IIFA 1AODA 4GZJA 1O6IA 3TJXA 1VQTA 1PS9A 4IMDA 4CLMA 1EC9A 2ZC1A 4REQA 3BJTA 3UCCA 5GJPA 3GHSA 4I7UA 2TMDA 4F0KA 1RCOB 2JGYA 2W61A 3P84A 4CU8A 5IHSA 4LAUA 2WC4A 3WF1A 3OGVA 4RJEA 2FIQA 2YXGA 1FWNA 2VC9A 2WM0A 1XS2A 3EMZA 2HVNA 1IEVA 4E8DA 3HO8A 1FDJA 4B5UA 1DQXA 2DH2A 2YR1A 3K2GA 2NX9A 4AYSA 1E4NA 1E40A 2WZTA 1RVKA 5G2HA 2DY3A 4KIRA 3UXLA 2BP1A 3STPA 2ISFA 2Z7KA 3WD3A 2Y2WA 3QZAA 1X7IA 2PLMA 1JCNA 4PMQA 4C7FA 5G4WA 3UA4A 5TAOA 1NY1A 3CM4A 5LYRA 3LHYA 1OVDA 4LJ3A 2VWSA 2RDTA 3MB9A 1CXKA 3WD2A 2A1YA 3DHPA 3E12A 1TV2A 1UKOA 2QVHA 2QCEA 5G1TA 3BOLA 1NDVA 2XGBA 3M0YA 3R89A 4MNJA 3GTXA 3QY6A 3V3WA 3T0TA 3ITGA 4Y9OA 3E2VA 3PWAA 1EO5A 4B16A 4US6A 3OVRA 1RBAA 3M64A 2XGZA 1RLCL 1W3KA 1VJIA 3HTWA 3AIVA 1KGXA 2WSPA 1E6NA 2PDBA 3RUBL 1CEOA 3BXWA 4C1KA 5I3KA 1FKXA 4MZYA 2WSKA 5DQPA 3OVGA 4LY4A 3GVQA 5C9RA 3I7QA 1S38A 3FAWA 1KM4A 1C8XA 1GEQA 1H7XA 4JS3A 3A3HA 4MWAB 3CWNA 4HSNA 3T07A 1R85A 1XH1A 4CD7A 2PBOA 1UZ1A 3H6OA 3NEVA 2HBXA 4NJKA 5C54A 4HOZA 3LTYA 4NAFA 4TX8A 5LGXA 2D0HA 4K6AA 4HU3A 3GVWA 4M19A 2E67A 2CLEA 3IACA 3BZJA 2O4QA 3VKCA 3LMZA 4JTRA 2EG7A 2WANA 1UWUA 2ONEA 4ZQPA 4Y7EA 5M5DA 4OZOA 2CZ5A 3RX3A 3W02A 3P60A 1MQQA 1BRLA 3VUSA 2E09A 4LV4A 3VOCA 3EX6A 1W31A 2B0MA 2PWHA 1WXJA 2ZQ0A 1F7BA 2Z27A 3NQVA 2X1SA 4XO7A 5FEWA 1PCWA 1R3YA 4UQCA 2A3BA 2CLIA 2XH2A 4BF9A 3S2CA 2ZX6A 3STGA 1OB0A 2YDRA 2HNHA 4CNOA 2HRWA 2G4JA 1I0BA 4F9JA 3IJLA 5A1AA 4CKQA 3NQEA 3TROA 2XHYA 4JNYA 3QGVA 3E9AA 3PPFA 1UMLA 3THUA 4JNZA 1XR2A 3YPIA 4GNJA 1TX2A 3NQ6A 5G4HC 5DY2A 1B3YA 3WFZA 2DT2A 1GOXA 4KCWA 3T4WA 4MF4A 1UW9A 3TLQA 2JIWA 3CZKA 4G7EB 5C9WA 3CMGA 4AC1X 1RA0A 2J6XA 3NPUA 5I03A 4A3UA 2CBIA 3QTPA 3EBVA 1V79A 2E9BA 3IANA 1I2PA 1OZQA 3DDMA 1UWIA 2UWFA 1E1EA 3WF4A 3WBYA 1QNPA 4NQ1A 2WNNA 3VNMA 3JW7A 3O6YX 3M5YA 4O16A 1SO3A 3B3DA 3MA8A 2DVXA 3LS9A 3LYEA 3EDEA 1EB3A 3Q37A 3K4AA 1U5HA 1Y7VA 3O6DA 1V02E 5CG0A 2GPTA 3G22A 3URNA 1WKYA 3WMCA 1NJJA 1R30A 2FHBA 2PWGA 3P81A 2OMAA 3M5ZA 2WMIB 4DI8A 1N2VA 1E6XM 5HWJA 2GJXB 1V3HA 3TIMA 1GG0A 2XN1A 3S1WA 1K8YA 2Q8XA 2P3EA 5I7GA 1GQLA 3F03K 4JIIX 1W5PA 3CIVA 1EZ2A 4I9MA 1PZ2A 4K8HA 1J93A 1A5CA 2CLKA 1SO6A 2PP1A 2VXNA 4MMWA 1KTBA 3BLPX 2J27A 1Q5MA 3B4YA 2HROA 1TPB1 3SJNA 4CCZA 2Q02A 4R53A 1U1JA 3TUUA 3N3TA 3GG0A 3TJLA 2QIIA 4V2XA 4MSSA 1JEZA 5IRPA 3SFWA 5ECVA 1YPFA 3CT7A 3PC0A 3QJAA 3UXDA 1NDYA 4KWVA 3QVQA 3WQGA 2C7FA 3E1F1 3MWCA 2V81A 1B90A 5AC4A 3V1PA 2XVNA 4AD3A 1VRXA 3HPSA 1PHWA 3QV6A 1DVJA 2D2JA 2H8XA 1R2SA 4DELA 5DMNA 4C1NA 1WDWA 3M7SA 1BG4A 1W5MA 4MJ4A 1M65A 3VZZA 2OU4A 4IXXA 4CQDA 5LNWA 2QYGA 1DWIM 2PDIA 3RMJA 2GGIA 1TMQA 4CN1A 4WDXA 1QXLA 3BG5A 1QT1A 3N9KA 4AVNA 2I16A 2XSBA 5CC7A 2W66A 2DIJA 1UROA 5LNRA 4OT7A 3THDA 3KL0A 4Q22A 4AEFA 4ERGA 3V35A 3G6MA 2GJRA 1RP9A 3H22A 4A3HA 1XHGA 2G5WA 3MUY1 1NWTA 2HK0A 4QX4A 1QWGA 3KE0A 4AD1A 2EJ1A 3A12A 4N9BA 1EZWA 4ZE4A 1PO9A 2ZDSA 2BNJA 3BANA 5CC6A 4R85A 3ISIX 1K4GA 1QOPA 1B5TA 4H9YA 4A2RA 5B7ZA 3BMWA 4CD4A 2VZTA 4Y8EA 4HNCA 1S2AA 4C6IA 2Q6ZA 3T0CA 1LROA 4LT9A 2VC6A 4WY0F 4YNGA 3CK5A 3RHGA 1LUCB 4AIEA 3UA3A 2R82A 1K8XA 1KV5A 1JGMA 3N2CA 1UOZA 3NIYA 4JTKA 3ZIZA 3IRDA 4M1RA 3LLXA 4ZTXA 3H7RA 5CZJA 3FGCB 4JIPA 1JI1A 1CGTA 3H12A 5EKYA 2WVVA 3EOLA 3KBVA 1BYDA 4KGJA 1WUFA 1XGEA 2W91A 5IXEA 4UNLA 4MNKA 3WDQA 3ANVA 3SADA 3BAIA 4XVEA 1X98A 1MFUA 2ZUNA 4JIRA 1QW9A 4GUHA 4C60A 3OBEA 4IIDA 2OWWA 3S9YA 3FYPA 2VR4A 3F4WA 1PAMA 3A4XA 1FWTA 1DE5A 3CHFA 3KOZA 1FWFC 2PRMA 1LLZA 1MEIA 1ITXA 3ELFA 2DP3A 2X7VA 4GLEA 1MYRA 3I3BA 3AS3A 3UWYA 4PFMA 1ZBWA 1I2OA 3ALFA 4G5DA 3NQBA 2YXOA 1HTIA 1NM9A 3GRIA 1US2A 5G2IA 4HVXA 4OJYA 4L4PA 1OYBA 1M03A 2YDQA 2AL1A 2P5NA 1Q63A 3ICJA 2INZA 4Q7NA 1V6TA 3CV6A 3ZT6A 2OQLA 4P7OA 3KEHA 1L0PA 3NYDA 4ZEPA 1WDRA 3S6OA 3OLGA 3QW3A 1RVGA 2IW0A 4K38A 4C5YA 4LBUA 2VCBA 1HVQA 5D2YA 4NX0A 1WZMA 2V5LA 4MFDA 4UTLA 3BARA 1A5UA 1QOQA 4HA4A 4HK5A 2QVNA 1L6SA 3PB0A 4Z2HA 1JNDA 1YNPA 1W9VA 3BLIA 1XIGA 4F0LA 3W72A 1O68A 3N1AA 5GNZA 4KEVA 1EJSC 1HJSA 1ZJIA 5LZLA 4DJEC 1GQIA 4XZLX 3TQ0A 3WMBA 2ZRVA 4ZQOA 1K02A 1DXEA 1I2RA 4XAFA 3HQPA 3NQAA 3SIZA 3RLUA 4LBSA 2PD9A 1ME9A 5HPOA 1T8XA 1FUYA 4ZQRA 4ES4A 5F7UA 3BUVA 3S9IA 4LVGA 3H26A 2UY3A 4XZNX 3WD4A 4JY8A 2ACRA 1VP5A 3RO6A 3TZNA 2VOTA 3UR2A 1AUSL 1F73A 2NV1A 3H2OA 3N9RA 3CHDA 1KKOA 2XFFA 1OJXA 1ITCA 5U7SA 4UTWA 3PNZA 4L4MA 4MIMA 5ABEA 1VCFA 1O12A 1EGZA 1K7EA 3PR2A 4U3AA 1SJAA 4R7JA 3W53A 4QISA 3AMLA 4QRNA 1OCQA 4QP0A 3U2EA 4OUIA 1GOOA 4PMVA 1PBGA 4S23A 3UNDA 2HNEA 4P5UA 1W2PA 3G1DA 4IIBA 3T55A 4ATDA 1J6OA 4N4PA 3LY0A 3VOIA 2CNCA 3HQOA 4AHOA 1QNSA 3G1HA 1FY6A 4NYUA 2ZYFA 4ZTYA 5BU6A 1RBOB 4BZYA 2OJPA 5MKGA 4JFSA 4LRTA 5E6ZA 3QM3A 3E2SA 2XVPA 3W26A 2Y8KA 2HS8A 2E6FA 3DZ1A 5D4YA 4CNNA 4CN4A 3DG3A 3H4WA 3P62A 4ADTA 2O0TA 4J2PA 3VFLA 1ZNNA 1RJPA 3DHFA 4JXCA 1WO2A 2QF8A 2Z00A 3G1AA 3W38A 2RJGA 3L5MA 3W1PA 2NVCA 2WWCA 4PA8A 1AMYA 1REQB 3OZYA 1OX4A 4PTNA 3T09A 1K7XA 1JDEA 1XG3A 1LWHA 4GYPC 4GABA 4CCCA 3LLFA 3KOWA 3VIPA 2V6AA 1XIHA 2DSWA 4RV3A 4M1BA 3B9AA 4IGMA 3WK0A 1O5XA 4IXHA 2PP0A 1CXLA 1R0MA 4JN8A 4NI3A 5DO8A 1TYGA 2F61A 2R8WA 4JTHA 4JPGA 2BV9A 5BXTA 2V5JA 4H2CA 4XB3A 2JKEA 2HXUA 2CZVA 3RX2A 3A5FA 4ORMA 5K7JA 4U31A 3RLGA 2QUMA 4DUVA 3MUZ1 3BGAA 4FXJA 4PR4A 5FF7A 1OC5A 5HOSA 3TAKA 5C9UA 3IIXA 1IWBA 3ABXA 2D20A 5HATA 5AY7A 1KRAC 5DBTA 1ZPTA 3VNIA 4GG9A 3V75A 3OG3A 1CGUA 4U33A 3WENA 3LSBA 2BODX 4WGHA 4AZHA 4RX0A 4S2CA 2VZVA 3S2LA 4Q6XA 2J7EA 1WAUA 2XVLA 3Q4DA 4PCNA 5LIUX 2GQ8A 4E4FA 2J77A 5F2GA 3CNYA 4ZO9A 3UZJA 2ZRUA 3ZQ9A 1IXPA 1KBBA 1H11A 4N42A 3C2RA 5I3GA 1AL8A 1WOBA 2CLHA 5HWNA 2VFFA 1WZAA 3RU6A 2VRKA 2W67A 1DWHM 2VGIA 4RNJA 2JIEA 4NZ5A 4LU0A 1LWIA 3MY9A 2ZBTA 1GJWA 1LRNA 3TC3A 4RPPA 1JFHA 2FHFA 2BSLA 4WXZA 4EAYA 2NUWA 3ALGA 2Y24A 4DJED 2DH3A 2CITA 3BAXA 4I9JA 3FVMA 4DY1A 2GQAA 4G1KA 4IP4A 1XYCA 5HK4A 2W79A 4FI4A 5LA1A 2GUUA 4I8YA 2X1RA 3STCA 3N73A 2QJJA 1O1HA 3WUBA 3O1NA 4IWWA 4YWSA 2B7QA 3NM3A 4DIAA 3CPUA 3T8QA 1Z6KA 1LWJA 1E6SM 4GQRA 4O57A 1XD1A 4DO6A 3C86A 3ZR6A 3QR0A 1RXOB 3EX2A 1JULA 5CLTA 8CGTA 3UPMA 1DJIA 3VVGA 4QEHA 4H6EA 4D1JA 2PRLA 4PEEA 3UGRA 5HXMA 3OHIA 3ZLHA 3WF2A 3WEMA 3UETA 4Y2WA 1O7AA 1FBAA 2Y88A 1E6RA 1MO0A 3OZMA 3SCWA 4S3GA 1UWAA 3MMUA 4F0HA 4ML9A 4ZB2A 5G5IA 1SFJA 1SJCA 3SO7A 1H60A 3OG2A 5BXPA 8XIAA 2P3ZA 1NWUA 4XV0A 5KZ6A 1IXOA 4U10A 1A5BA 4Y6GA 3HJZA 4P8UA 1FCVA 3GBDA 4MOZA 3TYUA 7ENLA 1KBLA 3WX7A 3WH7A 1DP0A 2OSWA 2Z6IA 1BEUA 1GOIA 5F2LA 1RPKA 1NARA 5A8OA 1PV8A 4IUGA 4DO7A 3UWVA 3W2MA 3MCMA 2QAFA 1BTMA 2WJDA 2G37A 1K7FA 1O5KA 2E40A 1MEHA 4KFPA 2Q8ZA 4EF8A 1YXCA 2PWFA 3IIOA 4CNUA 3M07A 3NL5A 2O55A 3WH9A 5LHEA 1TRDA 4HOXA 3XISA 2FFIA 3U2ZA 2PBGA 4JL1A 3N4AA 1M53A 3EWBX 4ADSA 1GEHA 3UERA 1PTDA 3DHUA 3W70A 1J5SA 2J7CA 3UY7A 4YVVA 1YBQB 4GYKA 3A4JA 1Q6FA 2CHRA 3HFYA 2IKHA 1OFEA 3VOJA 3GK0A 1GW1A 3O6AA 3UJRA 3FXGA 1ZALA 1A80A 1EIBA 1ZBKA 4FXRA 1GZJA 1V02A 3TJ4A 2G95A 2GDQA 1TPWA 3HPFA 3U4FA 4O0ZA 1IYXA 3WLLA 1JGIA 2DPEA 1DV7A 4J2MA 3QC3A 3USZA 4M29A 1WPCA 3WQWA 1HO4A 2WMHA 1E1CA 2IQTA 3ZXWA 4L1GA 3E2RA 1KLZA 3H53A 3PULA 1HJVA 2BOEX 1R5YA 4FLQA 5DCDA 2OR2A 3NSNA 3FJ4A 3L2MA 4DUXA 2REQB 5IOBA 4GK8A 4JTTA 2YBVA 3VKBA 1R86A 3S3GA 3HQ1A 2E77A 5CPNA 2LLEA 4MAVA 3AS0A 1DWAM 3MP5A 1OFPA 2CYGA 1F8IA 1VBUA 4BI6A 4I6KA 4NRSA 4F66A 3CYVA 4GC3A 1S2UA 4AHPA 3EOSA 1AW2A 4E6MA 3IGXA 4Z17A 3S6TA 1S2WA 5T9CE 2W0UA 3M0KA 5BRPA 4JEQA 3ZM8A 1GORA 4KRUA 1JDFA 4F4RA 3W6MA 3NGJA 5AHMA 3V36A 1PPIA 4XAYA 3CEUA 1XLCA 3EWUA 4LCRA 3W1MA 2JBMA 3NO5A 2PODA 1CGWA 1ME7A 3VIOA 2PE4A 2XGIA 2OLAA 1XDLA 1BSIA 3THAA 3NOEA 3WJWA 4W8AA 3LCIA 4DF1A 3WQ6A 5M2FX 3OBKA 1HO1A 4I9TA 4AD5A 1OF8A 4FIQA 1W17A 3K30A 3UP8A 4LF1A 4MZ8A 3JR2A 4O8AA 1KXTA 2C71A 2EXOA 4FS9A 3W82A 1OY0A 2XTKA 4L6HA 1E71M 5AYZA 3NQ8A 4JKKA 4CVWA 4DYEA 3GB6A 4BEQA 1RUSA 3EX1A 4GKLA 4QG8A 4IIEA 3TR2A 1F3TA 5AECA 4J3UA 1IEXA 4L6DA 4GX8A 4R9OA 2ZXQA 2J78A 5AHNA 4Z08A 4GMEA 3NZ1A 2AMGA 2OOGA 5DBUA 1GVIA 4Q4OA 4PRRA 5D2XA 2H90A 2QCDB 4GNVA 2ZOXA 2ZFAA 1C93A 4O28A 3VOHA 2ATMA 2CFFA 2BXYA 1CLVA 2YPIA 1VCVA 3C6CA 1FA2A 4ZE5A 3VTRA 1PWMA 3KHDA 4F79A 2CLPA 3Q94A 1PL9A 5D9NA 4GZ7A 2IUZA 4O1CA 4Y9PA 1KBIA 1HG3A 1PJ9A 2NV2A 3WY1A 2JF6A 3WK1A 1FHUA 4BFAA 2X41A 4C6FA 3WL0A 5CAKA 1JYNA 2WPGA 3NQMA 2ZICA 1UP0A 3NURA 1CYGA 1H3GA 3NVTA 3GDMA 4NVTA 1MW1A 1R47A 2HCVA 4HP5A 1J9YA 1XUUA 2C1IA 1XH0A 2RHGA 2ZUSA 4GVFA 5REQA 2RDUA 2DQXA 1JDCA 2R1KA 5M03A 7XIMA 3H2FA 2VEMA 4NYYA 1UQYA 4IJBA 2DW7A 2R14A 3B9EA 3UZZA 3WL1A 2XH7A 1EBGA 1GYLA 2ZRWA 1EPVA 4JAWA 1RALA 5G1YA 2WK2A 2A7RA 4CN6A 4JN7A 3OQ8A 3VYLA 3QMRA 3G3DA 1FWDC 3UWZA 5FAJA 1FH9A 1GTEA 1J8VA 5REQB 2PGRA 1TPVA 4P8XA 1P0KA 2PGEA 4WLCA 3IUDA 1LL7A 1QHZA 4F9DA 3PB2A 4Q6JA 4HZ7A 2EG6A 1QVBA 3KLLA 4J3SA 1MRAA 2VFDA 5FI8A 3V0TA 1HX0A 1A3HA 3RO8A 1FWGC 1IXNA 3CWHA 3SCRA 3GDBA 1Q3NA 3SRHA 2Y85A 2F2HA 1O95A 2YKKA 3IJIA 1O5RA 1QNOA 2E25A 2ZZ5A 5KZEA 4GI9A 2B7PA 1KFBA 1QK0A 4GNKB 3LB0A 2BY3A 4LXFA 5DELA 1IZKA 2Y7EA 1Z69A 4FNPA 4IMAA 2X16A 1QOXA 3AMKA 4AZBA 4HNUA 4GX9A 2EBNA 4WY0B 3DEQA 3BLKA 2G3IA 2XG9A 3ITYA 2NLYA 1H62A 4PODA 3POCA 3KL5A 2ACUA 1R38A 4E5TA 4EXQA 1UIPA 3S2JA 3O7UA 2I17A 3WD0A 3N25A 4JQ4A 2VFIA 3W1RA 3FN9A 1TCMA 4K36A 1SU5A 3G1YA 3WCZA 3VC6A 2P10A 1RPXA 2GVYA 4HA0A 4QG6A 3AMCA 3NZGA 1HGWA 2C79A 3IJ9A 5I24A 5JIPA 4DYKA 3N6HA 1TFVA 5A69A 7TAAA 3Q58A 4Q4PA 4NZJA 4RDZA 1XL9A 4HMDA 4UFJA 3FX4A 2YL8A 1LQ0A 4QJ3B 3GS6A 1EL3A 1HXJA 2X0HA 3MCOA 1R3RA 1FDZA 5BMWA 3TDFA 1CNVA 3BPWA 1M68A 4WSHA 3RM8A 1M04A 3GD6A 1GGOA 1XQKA 2KAUC 2POTA 5CLWA 2H3BA 2H6RA 2PC8A 4WSKA 3VGGA 1X1ZA 2PDYA 3AYRA 2W63A 3GVRA 3MBDA 4CQAA 5ECUA 1GVSA 4PBEA 2WO5A 3KWSA 2QJGA 1EWEA 4U5KA 3LV5A 7REQA 1TQXA 3AISA 4H9UA 4BEUA 1W91A 3GHUA 4NXSA 3UESA 1Q7ZA 1EF3A 3CAVA 2W27A 3W1UA 1CXFA 1GCYA 1E4IA 2CIPA 3BH4A 2J8TA 4XAPA 3I65A 3C4UA 2BTMA 1M41A 3B03A 5C5YA 4GCXA 4I6VA 4KF1A 1YDVA 1I4NA 5A8NA 4MPKA 3QV7A 3AI0A 4LUSA 4F48A 3IV8A 2IS7A 4JN6A 3MO7A 2O9RA 4HK7A 1XIEA 3B4UA 4UOQA 2ZXAA 3RXZA 1ZCCA 4W4QA 2DFAA 5AZ0A 3PUEA 4CEUC 4E0CA 3EA1A 2FJUB 4AD4A 5HUOA 2I14A 3A3WA 3WSUA 1H7WA 4DI9A 3W85A 4R7WA 2VUYA 3DENA 2I5GA 4EP8C 4ZZ9A 3PBMA 4WDUA 2E6AA 1JZ8A 4OU1A 4FZIA 4EANA 2O56A 5CSRA 4WDWA 2QV4A 3QLDA 3M9YA 4TQTA 1ICQA 3W9ZA 1OYCA 1SO5A 4UQ9A 1QWKA 1NVMA 3H7UA 4PUMA 3VI2A 5HAOA 4GGHA 4AXKA 3KHJA 1LG1A 4DJDA 3ARPA 5LA0A 4CQ9A 1E72M 1YNQA 3AHYA 2QJNA 1F61A 3GVVA 1QBAA 1U5JA 2OGYA 3WK3A 1XISA 3M46A 3OVQA 2DT3A 1QR7A 3AXXA 1DWGM 1TA3B 1VZWA 1RLDA 3A9BA 3HU7A 1MFVA 1XRSA 2BFGA 1KM1A 2I7GA 3A5VA 1KFWA 1ECEA 4QNWA 2Y7DA 5GJNA 4EPKA 1WNOA 1K77A 2C3ZA 4Q4MA 4PUKA 2GWNA 2QW5A 1V4YA 2PMQA 4W5ZA 3HZ3A 1MQRA 1NF0A 3WH6A 4GXMA 5LIXX 2DVTA 3GNOA 1CDGA 3VDCA 2VL4A 1EHNA 1GVOA 4D71A 2D22A 4LEQA 1SO4A 1BYBA 4B5NA 2O9PA 3C3UA 1EXBA 2A6LA 3BVJA 3ES8A 1NOFA 2WJFA 2OSYA 1S5MA 4M3PA 5BNKA 3RMEA 4L9YA 3M7WA 4H8HA 4IMEA 3GTNA 3P67A 1XXXA 4NY2A 4RXGA 2Z1WA 3MSYA 2ZTKA 1GTHA 4UWMA 4HZ8A 3WLRA 1W37A 2WAGA 1W5NA 2OO6A 1W5OA 3WQFA 1C29A 2OYMA 3MS8A 3WH5A 5D37A 1QAPA 5DANA 4N6FA 2PDPA 4LVFA 3DFTA 5DT7A 1KBJA 3KLKA 3ABSA 6PTDA 2YBUA 3O0FA 1UD4A 3WQVA 4S3EA 4PMNA 4AB4A 3VC5A 2FGLA 3TQVA 2ABBA 2D23A 3VGEA 3TW9A 1C92A 3NM1A 3SY8A 1W1ZA 1X8FA 4HGXA 2FVLA 3HIJA 3MV11 1XYAA 1ICPA 2ZADA 1HJQA 5I3HA 3JZUA 4LB4A 1I8JA 1PKLA 2WHLA 4ZA0A 4JQ1A 1GNXA 2A2IA 4B4FA 2NSOA 2Z4GA 3PZTA 1VFHA 1E4LA 2OFJA 3BCJA 3WQ5A 3BG3A 4LUTA 1OG6A 4QS6A 1O4UA 2XH0A 3PUOA 1K9TA 5PTDA 1FWWA 1H1ZA 1QW8A 1SW0A 3QYQA 4NAEB 1R3QA 5D33A 1VJSA 3NZQA 5ENLA 3ZWTA 3ZT5A 1EJTC 1O60A 3QTGA 1TV4A 1HKVA 4LAKA 2E6DA 1BSLA 3GG7A 3FKRA 1QATA 3VDAA 5A6KA 3TNBA 4W8LA 2NQLA 2VWTA 1E5JA 1ADDA 2ISSA 2WKJA 3WQOA 3FA3A 4LC8A 3WDJA 4IMFA 3WQ4A 4GQ0A 1F6KA 5JIWA 3TSDA 4EPBC 5BYWA 4JIQA 1ECQA 3OGRA 9RUBA 5HMSA 2GUBA 4OWGA 4JDBA 5LIWX 4B3ZA 4ROQA 2PWEA 1YDNA 4JICA 4QM1A 3V18A 3LHZA 1EHAA 3AAMA 4DUOA 4S3AA 4OOUA 1Z89A 4L56A 3BGJA 5EMUA 5TD4A 3G8RA 1QHPA 3N2BA 4LBRA 4U3CA 5EMJA 3OIHA 4MAZA 2D2OA 1TJ1A 2XVKA 3RG6A 2PDUA 1JYWA 3B8DA 4XKYA 3W00A 3T7VA 1C8QA 4HA1A 3DOPA 3CLWA 2FMOA 4FHAA 1SZFA 5C2GA 2GGGA 1XC4A 4FNUA 4GOAA 4F8XA 3GDRA 1PKMA 1OC7A 2R1LA 1AZ2A 1OK4A 1NU5A 3PY2A 1ISWA 2Z6JA 4B92A 3EXTA 3CASA 3ZSTA 1ENUA 4HCDA 4C7DA 2I9UA 2GGJA 2B7OA 4LRSA 3SECA 1Z41A 3LPOA 3NYZA 1DIKA 3I6TA 1FP9A 5DEZA 3BAWA 3MCNA 4LGXA 4IGSA 3W1QA 3OJGA 4QDWA 1OGGA 3CH9A 4KIEA 4JBRA 4YWIA 5FEPA 1JXKA 3WLQA 1W3HA 3F2BA 1D3HA 4N9DA 1VIZA 3STEA 5CJ5A 1J0IA 1FHLA 4AFYA 3CTTA 4P7QA 2PC4A 5MF5A 1AZ1A 4M7TA 3TTEA 4NX5A 4NL1A 1PCKA 3PF3A 4MUPA 4B91A 2ZE3A 4WQ6A 1YADA 4GVGA 2ZRYA 2OVLA 1E0WA 3W7CA 1V7AA 3F5JA 1GVYA 3UVAA 4FAMA 3OTRA 3TE9A 4AZCA 1E9YB 1VR6A 3QR1A 1J18A 1I75A 2F38A 1XLGA 4KQNA 1X8CA 1GJPA 3FA5A 4H01A 2FHCA 4LNYA 3DC8A 3W7DA 3L4TA 1GOKA 3M1ZA 3M16A 2FPYA 1GOWA 4Z1BA 3GG8A 5GPRA 4RW5A 3ARUA 3HG5A 2EPKX 2CWXA 4HNOA 1E6QM 2TSYA 5K3VA 4O1BA 4AU0A 4POCA 1XLFA 2VEPA 3FLUA 1V03A 4J28A 4B5SA 4UTHA 4BJHA 1CI1A 3W88A 4Q8TA 1UUOA 3G8EA 3RILA 2YDSA 3A22A 3GYEA 3LU2A 2JGQA 1KRMA 1KFEA 1V0LA 3E5BA 1QHOA 3WDHA 7ODCA 3VD9A 2PWUA 1LJYA 1KR1A 1GVEA 1UH3A 4RR4A 3D0CA 5A8PA 3M0IA 2PDWA 4IPPA 4EOUA 1LT7A 3T0DA 2FVKA 4C90A 2VZOA 2C16A 1LDCA 5ABTA 1QNRA 3U0HA 3EGJA 5JQ9A 3LEPA 5CQ1A 3RYSA 1D8CA 3MJYA 5EU9A 4L5ZA 1C91A 4QROA 3M0MA 2ZXDA 1X38A 1KD0A 1Z9AA 1H0IA 1XIFA 4AY7A 3BOXA 3CUGA 1P1XA 3OEXA 1K3UA 3WZ0E 5E0FA 3GY1A 5EFDA 2J8FA 6REQA 3AZRA 3BSMA 4ZXOA 3V5CA 4DO4A 1C7TA 1NP0A 2VC7A 1KM6A 1W5QA 3LCLA 4H6QA 1E0VA 3EMCA 5F4WA 3L4VA 3UJFA 3VCRA 1TJ0A 2NVDA 2RGLA 4S1FA 1SW7A 3OODA 2PB1A 1VLIA 2B31A 2CESA 1OCJA 2UY4A 3LM7A 5CPMA 2DJLA 1A47A 1LL6A 3MI2A 4CQCA 3NA8A 2QCLA 1YTKA 3CC1A 1A0EA 1K9DA 3LCHA 4G8TA 1ODZA 2I56A 3RK8A 4C6CA 5CG7A 2YCLA 1XSKA 1ZJHA 3DYOA 3RCYA 3GZAA 3T2OA 4X63A 4ZXLA 3CUJA 1YX1A 4F2BA 2R91A 1P0BA 2A5HA 4M8UA 1GW9A 3CHCA 5DRIA 4QG9A 1TWZA 4GVIA 4INFA 4KEZA 3GSMA 1PHQA 3DIPA 1MNSA 1S5VA 2ZC8A 3TW7A 4DZAA 2G3FA 3BAYA 2JK2A 4UTTA 4BKNA 3WG6A 1QBBA 3GZ3A 3AUOA 3D5HA 4ZQNA 1TX0A 1TTIA 2WPBA 5E9XA 2DZSA 3P6LA 2AL2A 1Q6CA 3B8UA 1V0KA 1ELSA 4C6KA 3R6IA 4KW2A 1U5VA 3WLJA 4MGGA 1X6UA 5HULA 1E9LA 4PB4A 2XWEA 2A3AA 3EWYA 3EA2A 2XYLA 3BJSA 1M9HA 2ZZ7A 4MFEA 3GR4A 4IPLA 4UQAA 4TTUA 1JUKA 4LSBA 4YYCA 2QPSA 2CBJA 5AB3A 3LK6A 2VRQA 3GXTA 2ZXBA 3OB8A 2FZMA 4IPJA 2R9RA 3VD4A 2XUCA 4QQ3A 3LTPA 4KFNA 3C0SA 3RRAA 5A2CA 2YW3A 3GC2A 3CS2A 3RGTA 3CTLA 5FJRA 2J7GA 1L6GA 1OFRA 3U3HA 4I3GA 1SYTA 1JNEA 3NR0A 5CGQA 2PGWA 2VJXA 3HGOA 2WVSA 1ZJAA 1EQCA 2VI0A 2Y8UA 5TQLA 1LLOA 1TKKA 3MMDA 3E02A 5IBXC 3T2PA 4XTIA 4X9SA 4YHGA 3F5LA 2QJIA 3DX5A 4C6EA 3KZPA 4DBWA 4YTUA 3NGFA 3JU2A 3PJUA 2VFGA 2E28A 3VABA 4BWLA 2G4FA 5BRBA 3VGDA 3JVAA 1T5AA 2GLKA 3W37A 1J10A 1VYPX 3C2OA 1V08A 4N9CA 1W9UA 1IT7A 5HINA 1LYXA 4B9YA 4ECLA 1E3XA 1V3LA 1JAKA 4ML4A 2E9MA 3QEZA 2GVGA 5AHEA 3FV9A 5DMMA 2GGHA 4NU7A 3EWWA 3PTKA 1GYMA 5TBOA 1KM3A 1KCZA 3BG9A 2ON3A 3VCCA 1AA1B 2TODA 1VBJA 4A21A 1XF0A 1UHVA 5A6MA 3GFZA 2YBTA 4JYEA 8RUCA 1VB9A 1T41A 3GR7A 4MTVA 3DI1A 4JQAA 3DERA 3SB0A 4ZCWA 1XSJA 4HU4A 1CENA 3SCTA 4RZBA 4A05A 1EP3A 2V2DA 4ILSA 3W3OA 1BYCA 4EX4A 5H2ZA 1WB0A 2POZA 3DG7A 2FB3A 1MXGA 5A6BD 4WRHA 5H8PA 5GNYA 1CLXA 2YCIX 3GIYA 5AC5A 1XRVA 3FYYA 3GFXA 4HNLA 4LFYA 2A3HA 1UR2A 5K9CA 3O0KA 1O66A 2YZRA 3C52A 3N2MA 2VX6A 3PPCA 5HBFA 4D6FA 3EKGA 4UCFA 2RAGA 4B2DD 1CTNA 3UCQA 1JZ6A 1R9YA 2NQHA 3LXAA 2GQ9A 3APTA 2C14A 3QV8A 3R0UA 3ENLA 5C0QA 3AHTA 3TLLA 3S6DA 4JTJA 4WK9A 5A8GA 2V3EA 4BQ2A 3V7PA 3LPPA 3IUHA 5HPCA 1N8FA 1F74A 1MNZA 5CZSA 5A95A 1KB3A 4Q33A 1JXJA 3GWQA 3MPGA 1P6CA 1FP8A 3B0XA 1PSCA 2VDHA 3BE7A 3HPZA 4QCEA 2DT0A 3DFHA 2PDLA 4H8NA 3BLEA 3PJTA 3NO1A 4TVDA 2Y5SA 3N12A 1WDPA 1KCLA 3C61A 3MVIA 3ITLA 1XH2A 3ONCA 1LG2A 1DIEA 1GT8A 5EYWA 3PAJA 4HHPA 3U6WA 5FIPA 3IK4A 3W1XA 1F3XA 2QJHA 1B3XA 1ADSA 4IFRA 3VA8A 1B0IA 1U83A 1C8VA 3IJ6A 1H5YA 4QCFA 4JTCA 5LIYX 3UPBA 4LUIA 1KGUA 1PIIA 2NT1A 1J0KA 5D8WA 4K1WA 3LGEA 1OD8A 4DO5A 5HWMA 1PX4A 3IGHX 1ZY9A 1UR8A 2JKAA 1CXEA 1W3NA 1JQXA 1KFKA 1TSIA 1ZJBA 3NXLA 2OZ0A 3VD5A 3KTXA 1V93A 1OFBA 4DBSA 2OTDA 2FZ8A 3E0VA 4HZMA 5TNVA 1LM1A 1CGVA 1X96A 4UTKA 2Q01A 4AEOA 3AZSA 4HQVA 4W7WA 1VFFA 4PTVA 1D8WA 1RD5A 4HJFA 4OBRA 1A5NC 4IGHA 3XINA 1J0ZA 3SZ8A 4L9XA 4DWDA 5JH1A 4FNQA 1EX1A 3G1SA 1K9EA 3PZGA 1UKSA 2FDMA 4CCDA 2BBFA 1BLIA 3NQGA 3VFCA 2F7FA 2PDXA 2V8ZA 1PDYA 3WF0A 2FZBA 4UFLA 1YNYA 3DXIA 1PWLA 1XLJA 3GFYA 4F0SA 3KS5A 3BW3A 2V5KA 3ID7A 3WDIA 3WEOA 3C2FA 3HMJG 1RQHA 4IMGA 1KRBC 2EQDA 2A79A 1LBFA 1MDRA 4AY1A 3AS2A 3BK0A 1V0NA 3FA4A 2WVUA 1R3SA 2EO7A 2P50A 4JCLA 1E15A 1P0EA 3MO4A 1PTGA 1XYLA 2YA2A 4NJHA 3EXRA 4QLJA 1Q6OA 1F5ZA 4HOWA 4GIEA 1WXYA 1G7UA 4LB3A 3ABOA 2QUUA 1J11A 2XIIA 3FJ6A 4GHRA 4R27A 1YLVA 1S1RA 4US5D 5M3WA 3U5UA 4LF2A 2D1ZA 4P7NA 4GH1A 5F4SA 3F7JA 4E8CA 3E38A 4E3TA 3CJPA 4NXKA 4UB9A 5C7HA 4WKAA 1UPMB 2J13A 4QTGA 3N04A 3AIRA 4N0RA 1VRDA 4LYPA 2QMKA 1TREA 1P7TB 3TTSA 5EB8A 4OUEA 5C2CA 4AWUA 1Q6EA 2ZDRA 1TWWA 4ACYA 2DSKA 3TYEA 5HR7A 2W9MA 3G1RA 5AC7A 1DXIA 1TV3A 4C6BA 5BOOA 1KKRA 3HGJA 2QUTA 1WKFA 2GSHA 3LUTA 4ATLA 2NWSA 1HKKA 1OGBA 4M56A 3OW1A 1O1ZA 4WOQA 1GVFA 4QR6A 4XK2A 2CHNA 2OKTA 4KCUA 1J5TA 3NQ2A 3R58A 4TMCA 4ACZB 3MBFA 3GXIA 3T81A 4IG2A 5DT5A 2WNZA 1MUMA 1J2WA 3SY5A 5CC3A 2V82A 3UYIA 4B5TA 1H7RA 4XSMA 2VGGA 1PZ0A 5AYYA 4GI6A 4DF2A 1UP3A 4HNNA 2DIEA 1T96A 5IFTA 1VD6A 1EJXC 3AHVA 1Z7AA 4JY9A 3F2CA 2OT1A 4MG4A 1TJ2A 4HNTA 4IISA 3LV6A 2QDEA 3W29A 1MRQA 3NDYA 3I6RA 4UXDA 5A6AA 1IT0A 3C2YA 3MVTA 1NWSA 4PMRA 3P8JA 3H55A 4DZ5A 4CEXC 4UQEA 1A4LA 2Q8LA 1DJGA 3LHTA 2WLYA 4AF0A 1A0DA 3TN3A 3ERPA 3TAOA 1FHVA 3H4GA 4ASTA 4WR3A 1VBHA 1XYFA 4YPJA 3CGTA 4X2RA 3QHMA 5GJMA 3ZO9A 4H9TA 4G6CA 4UMBA 3QPZA 5LNSA 1Z3NA 4I5RA 5D2VA 2BVWA 4Q4SA 2Y63A 3CB3A 3KAOA 2V67A 3L4XA 3UR5A 1BKHA 3ARTA 1M1BA 1E73M 3C0JA 1QCWA 1NSJA 5AYBA 2DV0A 1GOMA 5ABHA 5I02A 2XIQA 1DHPA 1UZDA 1L6FA 3S46A 3W1NA 1XFBA 3CUHA 2WYSA 3V4BA 4C6PA 4BQ5A 5E0CA 2F6UA 1OFOA 1RCXB 3F5KA 2NXIA 2WXDM 4NNBA 2PTYA 4BS0A 3RN6A 3GAYA 1ITUA 3J7HA 2RGMA 4K7VA 5C7VA 2QR6A 4RUBA 2YX0A 4AZ7A 4FX7A 4G7FA 2P88A 5FJIA 1XV8A 2L5HA 3PTQA 3TA6A 3GDKA 1F05A 3GW3A 3ITVA 3WQCA 2O92A 2V5CA 2WC3A 3E0WA 1MZHA 3GU9A 1HT6A 4NKCA 4HPHA 4IL2A 1ONWA 1WCGA 2VO5A 3NTYA 1XFCA 2NWRA 4CD6A 1D2KA 3ONBA 2V9DA 2VP8A 3CIWA 3GNNA 1P5BA 2Y6ZA 2CEQA 3OLIA 2WMGA 5BOFA 4JTQA 3SCOA 1V3JA 2TRSA 2WBKA 3ECQA 3FY1A 4S3FA 4RKAA 3ARYA 5CGTA 3R13A 3QY8A 1CPUA 4ERAA 3SN4A 4J1OA 3LERA 4MB4A 4BK9A 3UR7A 4C91A 1YYAA 1WZKA 4GPNA 4BHYA 4NZ3A 1BXNA 2Z1VA 3BOFA 3L5LA 4REQB 1V3KA 4OOZA 3O07A 3EMQA 2HTMA 1KM2A 2I1OA 4O53A 4AMAA 1PZ1A 4KEMA 1KCXA 1Z32X 3TMQA 1S5NA 4E4UA 3TOYA 5DN1A 4H41A 3WQ8A 1V6VA 1CGXA 3LNMA 3K46A 2BLEA 3S1XA 2OZTA 3B8TA 4FALA 2YYUA 3T4CA 2DZWA 4AX6A 5I3JA 1UG6A 5G4EA 4DQWA 2WV8A 5I77A 4YIWA 5A5WA 3GR8A 2DEPA 1CZ1A 3ZVHA 4LCQA 1K6WA 2RFGA 4HIBA 2ZX7A 5CSSA 4FLSA 2B81A 4UBPC 2GSEA 5FJUA 2ISWA 3L2LA 3F1QA 3BWWA 1ZBCA 4LH8A 1E0UA 1VEPA 3QXBA 1VHNA 1QJWA 5DCEA 5JVLA 2RDWA 4A4AA 1JF5A 3OYXA 3JUGA 2NQZA 3ZT7A 4AWEA 1GKQA 1KTCA 2YFNA 4FNTA 1R8LA 3KBNA 1SR0A 3I6EA 4Z2GA 2E6YA 3WN6A 2YFOA 1H49A 3KVKA 3ZLGA 3RPDA 3RRXA 3KBWA 3WLTA 1HKJA 1HP4A 3L67A 4GZEA 4JOMA 3EKZA 3W1LA 4DVOA 1OINA 2DZVA 5K4XA 3VIHA 3ZSSA 4DZHA 3UWEA 4QHRA 2J24A 3VKJA 1JG9A 1Q13A 3WIJA 2WB5A 2XSAA 2Z7GA 1MW2A 3IGUA 3N11A 2CKRA 4BCEA 2PCQA 2PURA 1JYXA 4DHGA 3CV1A 4JX4A 2G3MA 2DUXA 2J9XA 4R33A 4O18A 3W22A 1N82A 3KRSA 1QW7A 2VGFA 4RV8A 1I1XA 3TFCA 5EMLA 4KWOA 5KETA 1TV8A 1W8GA 1FXQA 4NP7A 4NAFB 3UBPC 4D6DA 1UD3A 5U4NA 5TIMA 5C8BB 1YTDA 3IAPA 2IXVA 4IJRA 4U28A 1B4KA 2WVTA 1UYQA 2WSYA 3D6NA 4GBUA 4IJCA 5DFAA 3QC0A 3R8RA 1HKIA 3N2OA 2BMBA 2ACQA 4LX4A 1BRLB 4YS1A 1OT1A 1A5OC 1E0XA 4WGXA 4RDYA 2VMFA 5DX7A 1HP5A 2G97A 4JFTA 4F0MA 2X8RA 4TUFA 4H9ZA 2EF9A 4A29A 2ZRXA 2FH8A 4LAZA 3NQ7A 4PCSA 2YYTA 4PTWA 3ARWA 2PRHA 2GUYA 1FFRA 3SGGA 4A2SA 4PH6A 3LRLA 3H24A 1VCGA 2E7FA 1B57A 1YE4A 4UTWC 2GQ3A 3I3EA 4XD6A 1KM0A 2PDMA 1AJ2A 3M0VA 2WMFA 3UEQA 3GH7A 3NSXA 3GH5A 1XIIA 3RNDA 1JCYA 1Q8AA 2HQAA 1FX6A 5I3FA 3U7VA 1B9ZA 1FWEC 4FOUA 4MYXA 1YTEA 2JF7A 3WJYA 2ZZ2A 1H2JA 5LA2A 5I6SA 2Y89A 3E5PA 3CZGA 1XBXA 4Q4KA 5D2TA 5A94A 4ORIA 4CVUA 1GPWA 1SGJA 5FKYA 2CLOA 4NHVA 1SSDA 3L4YA 4ZFMA 2CXEA 1KXQA 3PWIA 1PVNA 5A3HA 1Q2RA 5JMUA 1XLKA 2HPIA 1AW1A 2DSUA 3UPWA 4XZBA 3S1GA 1XLAA 4GVHA 3URBA 1Q45A 1AK5A 4V27A 3NL6A 1LRQA 3LPGA 1W1A1 4LVAA 1I2QA 1ZSXA 2F8QA 4I8DA 1NTHA 2Y5EA 4QBXA 5EMKA 1QU4A 3OA3A 4AZIA 5I3DA 4FXSA 2IXUA 2ESCA 2W62A 3HV9A 1IR1A 3R12A 4H1ZA 1W3TA 4M80A 5D30A 2G0WA 2HEJA 3W25A 2J6VA 4S38A 3POHA 1WV2A 1R3WA 2VEGA 4IPIA 4QDMA 4BI7A 3UZWA 3EOUA 5FL1A 2BWGA 1F4HA 2IKJA 3N2XA 3QY7A 3G0XA 4PMJA 1WZLA 3OLDA 3IIVA 1KO0A 2ZZ3A 1KFCA 2C1GA 5D03A 1TQJA 1GHRA 4FMVA 1P6BA 3N6JA 4ONVA 1LOQA 4DPPA 1CXHA 3T8LA 3REQA 2F6KA 1DJXA 3BV7A 1S1PA 1VYRA 5A8MA 1TVLA 4HMNA 3TOPA 3SR7A 3ZJ6A 3SSJA 2TPSA 2QXWA 3L2IA 4AY8A 3BGGA 4DAIA 3LBOA 3UWUA 5BCAA 3O15A 3SCUA 4MWAE 5CPQA 3TONA 2V63A 1EJ7L 3R94A 1VF8A 1XBVA 2NLIA 1B9BA 3C0LA 4GINA 4AZ6A 1Y5XA 5LSMA 2BVYA 1S39A 4L1XA 1GYNA 4B5VA 4GIYA 4C1NB 4Z1CA 1V3IA 3KP0A 4GQQA 2Y7FA 2WHMA 3QGAC 2NSXA 3E0LA 1WAWA 1MW3A 5FF2A 2BX7A 5HNTA 4GXWA 4P7LA 1RHCA 3LCGA 7CGTA 4LAMA 2OQYA 4GUJA 3GM8A 4ICNA 3W2LA 1H1NA 5EA9A 2OG9A 1Q7QA 2VD9A 4UNKA 3DFYA 3R0DA 3BLLA 3HGRA 6TIMA 1W1YA 2MUCA 5CPOA 4EWND 3S42A 3CIXA 1DJQA 4ZENA 4TX9A 4KCVA 3SIMA 2Q3OA 3FK4A 2NT0A 2V68A 1MVYA 2VT0A 4PMUA 4UNIA 1PEZA 1W2VA 3AU2A 2VURA 2OT0A 2ZA3A 1ZAJA 4DF0A 3H8AA 2FTWA 1R3TA 4O4WA 4YU1A 3GX9A 1W54A 2ZRZA 1TMLA 5FESA 2GK1A 2PS2A 4E4PA 4UTFA 3QR3A 2ZE0A 3UZXA 4J35A 2FLIA 2BDQA 2WZIA 1BWKA 2Y5JA 5CGMA 2WVVB 2WNQA 4OV4A 4Q7IA 3URAA 4KRZA 3VILA 1A3WA 5CSUA 4MY8A 2J88A 1CXIA 2X1UA 4OQVA 2W6RA 3RJXA 4Y8FA 5MHBA 3ITTA 3EAUA 3QN3A 5H1WA 4I7WA 1DHKA 1CIUA 3EPOA 1XKYA 4UUIA 1F76A 2GGEA 4O11A 1WUEA 4K3ZA 1KW1A 3AXIA 4HK6A 3V5FA 1FWCC 3RM4A 1ZENA 5FF4A 2PAJA 3P93A 3G1VA 4F40A 4H7ZA 4I9AA 3FFSA 1F07A 2A6NA 3UCDA 1H51A 3R43A 3NAVA 3KVJA 2XFYA 4W7UA 4W85A