2QKFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
251
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQGRRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Re-Establishing a Metal-Binding Scaffold with Full Activity in the Metal-Independent Kdo8P Synthase from Neisseria Meningitidis
rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transferase
molecule keywords 3-deoxy-D-manno-octulosonic acid 8- phosphate synthetase
total genus 81
structure length 251
sequence length 277
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2qkfA00
3NM1A 4U28A 4NVTA 1JCYA 1J2WA 2VEPA 4O54A 1W8SA 1KM5A 3NQ6A 1UBSA 4UMCA 1G4EA 3W1XA 1SO5A 4JGDA 3QF0A 3LI0A 1TTIA 4MZYA 2BTMA 1XFBA 1GG1A 2W6RA 2TYSA 4UTUA 4FO4A 4R34A 2HS6A 3DZ1A 1OFDA 1SW3A 1LTDA 3EKZA 3BVJA 1CI1A 1TPFA 1A53A 4X3ZA 2G96A 3MYOA 2EF9A 1EP2A 1XBVA 3C2VA 4ALDA 2C16A 3CQ0A 4N9DA 3GDLA 3S5ZA 2ISVA 5D02A 3N19B 3W2LA 2GVLA 4YLWA 4O11A 1VYRA 2FQIA 4UFIA 2NZLA 3W9ZA 1VHNA 1ZAJA 2C13A 4O1AA 1LRNA 3E12A 4YCOA 3PM6A 5LKYA 5AHFA 1TCDA 4HKPA 1EUNA 1EX5A 4FNUA 2QCEA 4AHQA 2A1YA 4GUFA 1KFJA 3G1AA 2CW6A 2RDTA 4FIRA 3P8IA 1RQHA 3TC7A 4C1KA 1OX4A 3BPWA 4N4PA 4UTTC 3USBA 4BFAA 3TSMA 3M7WA 1LYXA 1XBXA 4Z1CA 4M6VA 4WXYA 2GVGA 2AQWA 4RLIA 3R2GA 4JS3A 4ZVJA 5LHFA 1BKSA 2E5DA 4PODA 3VFLA 1DL3A 4BI7A 4GBUA 1A5BA 4P2VA 4LV4A 1QOQA 3NQGA 1H7XA 4DO5A 1H1YA 3LLDA 1PVNA 1KV5A 2OT1A 3BLIA 2FB2A 3KRUA 2Y62A 3DKJA 2J27A 3GX9A 1EA0A 2YFOA 2G5WA 1H7RA 4KFPA 4JX4A 3NL3A 4NT0A 4WZHA 1W3NA 2ZA1A 3C6CA 4ZQRA 1K7FA 3W2UA 4GUGA 4BF9A 3O63A 3IV3A 3UWYA 4JNMA 1OABA 5CGQA 5IBXC 2H6RA 5E0KA 5AB3A 1SO3A 1L2UA 1U5JA 3W22A 2AGKA 1KA9F 4UTJA 3SY5A 1TO3A 3M44A 3NXFA 2A6LA 1LRQA 3QM3A 4S2BA 3TQKA 3FS2A 4BWLC 1R47A 1ZALA 4HSOA 1KFKA 1W56A 1LLZA 1K7XA 2Y70A 2WQPA 1V5XA 3TCEA 1G67A 2WO5A 3T44A 3L67A 3STCA 2E09A 5LNSA 5KZMA 5G1YA 5F2IA 2GVJA 5LGXA 3W1LA 3TMQA 3E02A 5IBXA 3UWUA 1F05A 2DU2A 1JCJA 1ML1A 5D04C 1EPXA 2EAWA 2DP3A 4N9CA 2Y88A 1TREA 1K8ZA 3P61A 4E2BA 3L0NA 2VFDA 4AVFA 2OCZA 2Y7EA 1B57A 1WBJA 1VS1A 4DEFA 1FWSA 3KXQA 2BSLA 3LI1A 4K8EA 1RQBA 1Q6QA 2VFEA 1WXJA 4EVZA 2FTPA 3EWWA 1MXSA 3YPIA 2X1TA 5CZ0A 4YXGA 3IRDA 2FLIA 3TE9A 1WBHA 2NUXA 5HJLA 1TTJA 3HG4A 4Z1DA 3SGUA 1TQJA 1FCVA 1VPXA 1WV2A 1GWJA 2WNZA 4ADSA 2V9DA 3TDFA 2FPYA 3TU9A 4NXKA 3UZJA 1PCKA 1ME9A 1X1OA 3W7PA 3FFSA 4FXRA 4NJIA 1F76A 1KLYA 4WUIA 4H4IA 2BLEA 4O8RA 3BGJA 1K7EA 1IGSA 2YXGA 3O6DA 5U7SA 3W2MA 1KM4A 3IIPA 3UNDA 3C2OA 3INPA 3HIJA 3EWUA 3M5ZA 4OV9A 3W1NA 4DELA 2ZTJA 4Y9AA 4BI6A 4JTSA 3R13A 3QQ1A 2R94A 3W7JA 1ME8A 3KAOA 2VENA 1JRBA 1EB3A 4UFJA 3GXTA 4YWIA 5I3KA 5TQLA 2C19A 4UFLA 1KBJA 4NXSA 5ABTA 3S42A 2X1SA 4FB7A 3GR7A 1VLWA 2BWGA 3BG9A 3W83A 1PS9A 3NQDA 5BMXA 1V7YA 4OGZA 1GTEA 4UR8A 2QKFA 4OE7A 3MHFA 1F6KA 2O7QA 1XBYA 1O4UA 2C0AA 2A5HA 1EWEA 2NWRA 3TNOA 4JYDA 5AN7A 2VXNA 1VGAA 3P74A 3PBWA 4O14A 5HUPA 3T55A 3S1WA 2CLKA 2CLLA 2DZUA 3ATZA 3SFKA 2Y85A 3O15A 3QMRA 2YW3A 3SSJA 2R14A 4CNNA 1YDOA 2J24A 2JGYA 1TYGA 1SZEA 3LHWA 5LSMA 2A6NA 1GJPA 5AC8A 1W5PA 3O8AA 2V82A 4M6PA 4GFSA 1F7BA 1AW5A 1ALDA 2QJHA 3CPRA 2CZEA 1M5WA 1TQXA 1Q45A 2FB3A 4LUIA 4RCXA 3NPUA 4OHQA 2WSYA 1LZOA 1LOSA 1VLIA 5DBTA 1VR6A 3LXAA 3M47A 1WYIA 4TR9A 1LDCA 2QCNA 1SZFA 4UTIA 5E93A 3THAA 4J9JA 1QO2A 1LOLA 5F1UA 2PCQA 2OZ0A 2WJZA 1NAL1 3GKAA 3PBVA 3UXAA 5EYWA 1F74A 4QAIA 3MO7A 4UCGA 3W2KA 1G4PA 2YW4A 3G22A 1SU5A 3W70A 3UD6A 1PIIA 2Y63A 3C2EA 4W9TA 4PEKA 1AL7A 4R7JA 3NL6A 3HF3A 2I9EA 5KZDA 5G5IA 1YTDA 5LGZA 1TB3A 1M7PA 3OIXA 3GDRA 4NU7A 2AAMA 5AHEA 1SZGA 2C14A 3SR7A 1KFBA 3W7HA 3MBDA 3DGRA 1IXNA 1E51A 4GRSA 2CZ5A 4QISA 5IM51 4WX2A 2V2DA 1GYNA 1JVNA 2VFFA 3W7IA 2F84A 3UZ5A 1TRDA 1TPDA 1LLWA 1KM6A 4BI5A 1SO6A 2JKEA 5C2XA 1VH7A 4IMEA 1JQXA 3PULA 1ZHAA 3P5ZA 3W85A 4JTHA 1OX5A 1P5BA 3W1RA 1JQVA 4UTMA 4M19A 1TPVA 3STGA 5AC7A 2UV8G 3GXNA 3IIOA 1DHPA 1F2JA 3MHGA 3M1ZA 4NNBA 5LNUA 2Z0IA 4LVAA 4XWUA 1FDZA 5HUOA 3W7GA 1TPC1 4CQ8A 1R2TA 1TJRA 1H61A 2A7NA 4IJBA 1GTHA 1VC4A 1DORA 4Z0SA 3QMTA 3NG3A 3NPXA 2F7FA 3MI3A 2DZXA 4CNOA 2NV2A 4PL2A 3DFPA 3W88A 3LDVA 5D2TA 5J5DA 2NXHA 3UYCA 4LOCA 4O28A 3FJLA 5KINA 4JDBA 1ZNNA 2HMCA 5I3GA 3W2NA 3IVSA 1LBMA 3TQ0A 1LORA 1JCXA 2GQ9A 2ZZ4A 3LHTA 2QUUA 2J9XA 3W7MA 3MP4A 3LCWA 4FEZA 1OYAA 4UTTA 3TQVA 2I1OA 3B0PA 2C18A 2J88A 2E68A 1FXPA 1RD5A 2W79A 4TMBA 3OA3A 1J5TA 3HG5A 4K7YA 1XL9A 4NZJA 4JN6A 1NF7A 3ZS4A 2ABBA 4NUWA 3LTSA 4RXGA 3NDOA 2GPTA 2BXVA 2VFGA 3DXIA 1OFBA 3G0SA 1IIHA 2X1RA 2LLEA 4O17A 3CM4A 2CLEA 1XXXA 3I68A 4N6EA 1D3GA 4WD0A 3S6DA 5LNWA 4Y90A 5HULA 4Q32A 3NZ1A 4UR7A 2JKAA 1D9EA 1W31A 4ORMA 4UNLA 3IVUA 4JX6A 2WNQA 3JRKA 1G7UA 1OHLA 4IX0A 5HWNA 2ATSA 2Y89A 3FYOA 3MI6A 5FEXA 3W1MA 2QJGA 4JTKA 5K4XA 2DZSA 3S5NA 3EB2A 1OFEA 1YPFA 4ML9A 2FFCA 2ZRUA 1H1ZA 3LXCA 1XKYA 4HPJA 5U4NA 3PVFA 4A2SA 1NSJA 3KX6A 3HGOA 3LBCA 1W3TA 3BW4A 3TA6A 1KTCA 1GZGA 1LOQA 4QIUA 3UWQA 1ICPA 4JTGA 1TTPA 4FNPA 3TUUA 1YPIA 3UXDA 3E9AA 5CG7A 3UWWA 3VE7A 3TXZA 3LM7A 3THQA 1J4EA 1SO4A 1O5KA 4RV8A 3UY8A 1L6WA 3M43A 3OG3A 3O07A 3W7DA 2TSYA 3O16A 1B4EA 2B0MA 3QMSA 4KWVA 4R33A 1OX4B 4FX7A 4LW7A 2ZDRA 3KFTA 3FKRA 3M5XA 3NL5A 3A23A 1G69A 1OFPA 1U83A 1TTQA 3TV8A 3DU0A 1Y0EA 3EXTA 1I2PA 1AG1O 1M7OA 1QPOA 3UWZA 1DVJA 1VCVA 2GQ8A 3W7KA 3UWVA 1ICQA 3R12A 3WJYA 2YYUA 1KM1A 1F73A 4NX5A 4LY8A 4OQVA 2R8WA 1B3OA 1HTIA 3A22A 3H54A 3T4CA 1MSSA 3CU2A 1G4SA 3LXBA 3DHFA 1GG0A 3IIVA 4FNTA 3ABOA 4GXMA 5E1QA 5K7JA 3W7NA 2FPVA 3W1TA 1SW0A 4MFDA 4HN4A 5LHEA 4K38A 2CZDA 2B7QA 3EX1A 4P61A 4XBKA 2PRLA 1KM2A 4AB4A 3PUEA 4AH7A 4BR1A 3EWZA 1TSIA 3HJZA 3NQAA 3C2RA 1AL8A 1SQ7A 5DXXA 2ISSA 2YX0A 1OFQA 3N14A 2E5BA 3DKLA 3AO0A 3R8RA 2J6XA 1PHQA 2QCCA 1MEHA 4YCPA 2V2HA 1SSGA 3DBPA 1DJQA 3SZ8A 5D03A 3DH7A 3P60A 4IPIA 5F4SA 3MJYA 1CX9A 3TAKA 2NXGA 4ADUA 1ZENA 3JS3A 4PH6A 3CIWA 2QR6A 4O10A 3P62A 1FBAA 3BLEA 3NQ8A 4AHOA 2ZA2A 3QPZA 2QCDB 3F4WA 4ICNA 5G1TA 4XBSA 4PL1A 4TO8A 1TV5A 4NNAA 2GOUA 4X22A 3TW6A 4LT9A 3NQCA 1K8YA 4O1CA 2CLIA 2QDGA 4O50A 4UFMA 5EKYA 3KVJA 4ZL1A 4NJKA 2XN1A 4K7VA 2NXIA 4WY0A 1H7OA 3MUXA 3PBUA 1EUAA 1EP1A 1JR1A 1O94A 3DENA 1T99A 2DZPA 4OV4A 3TKFA 1VYPX 4Y6GA 4RJEA 3CEPA 1SFJA 1LBLA 2H90A 5D37A 4Q4KA 1K8XA 4PA8A 5C5YA 1W54A 3L9CA 2X16A 3LRLA 2FPTA 5I3HA 5EMUA 3M9YA 3P81A 3S1UA 2WOQA 3RFAA 4EWND 2QJIA 3DFQA 5D2XA 3NNTA 3N9RA 3A24A 3P80A 4O12A 4O13A 3NPWA 3IGXA 1NF0A 3S5OA 3S1XA 5HWMA 5FEZA 2E6FA 1FX6A 1Q6RA 1F5ZA 5BOOA 1A5AA 4NX0A 1XC4A 3O6YX 4MYXA 4XKYB 5FF0A 4ZZ9A 4LC8A 1QPQA 3GKFA 3QH2A 4UMAA 5DELA 3NA8A 3U2OA 1X6UA 1KV8A 4LWWA 1JUEA 3ZWSA 3OVPA 4Z0JA 3PG8A 4GC4A 1ME7A 1HL2A 1WA3A 1SW7A 4A2RA 3MW7A 2H3DA 4O0KA 3N2XA 1LM1A 2V8ZA 4WOQA 1ZFJA 1KFEA 1AMKA 3IGUA 3ATYA 2VFIA 3ZFHA 3HMJG 2RFGA 1IXQA 2RH9A 4RZ4A 1Z42A 2R91A 5G2IA 2QEZA 1O95A 4KFOA 1QPNA 2VELA 1A5SA 1GVOA 2E6YA 5MHBA 3G8EA 4IPJA 2ZZ1A 3NVTA 3BV4A 3E96A 3LCLA 3N9SA 1DQXA 1MEIA 4FF7A 1EP3A 2ISWA 3HPZA 2YDAA 3WK2A 3IVTA 2Y6ZA 4NZFA 5K9XA 2NV1A 3M5VA 4C1LA 1B9BA 1S5WA 3QRHA 1OFRA 3LTYA 5EL1A 1H62A 2ZZ6A 1H7PA 5DXYA 2NX9A 3L0KA 4PFMA 2VC6A 3QC3A 2XN2A 2DJXA 1OK6A 4O15A 1FCBA 2YYTA 3LX9A 2H8ZA 5G2WA 3WFAA 3TC6A 4UTHA 1L6SA 2GJLA 3HQ1A 4MLRA 1RV8A 5D05A 1OYCA 1WX0A 2ZA3A 4HHPA 3EX3A 2GUUA 2V0TA 3G24A 3GK0A 1QWGA 3KVKA 1O60A 3S9YA 4L4MA 3LRKA 3M6YA 1HO4A 4KKXA 2IQTA 3W7CA 5HINA 3O1NA 3CWOX 1VRDA 2WPBA 4MLJA 5TIMA 5D33A 3HO8A 1K03A 4S1FA 3CWNA 2YR1A 1FWTA 3F1QA 5AOUA 4JY8A 1XUUA 5G2HA 2ZCGA 1C29A 4FNSA 1I4NA 1JRCA 2D73A 4ZQPA 3S0CA 5CPMA 4IMGA 1T0OA 2HTMA 1XDLA 2VOMA 4EF8A 2Q8LA 2JGQA 3ABSA 1WAUA 1TPB1 2ZYFA 3ELFA 5F2LA 3PG9A 1LCOA 5DLCA 2TPSA 2NX3A 1X7FA 3STFA 3W84A 4RX0A 5BNKA 4JTTA 5F1VA 3G1YA 2CU0A 5J5RA 4X2RA 5HR7A 1GQNA 3T7VA 3PB0A 1OF6A 1ZJIA 1TPEA 4HNVA 4HSNA 1OFAA 3HGRA 4RXFA 1TV7A 3VNDA 4AEOA 2X30A 2E5CA 4JTJA 1G4TA 3DFOA 4IMFA 4AF0A 1ZY9A 5DCDA 4KWWA 2EGZA 3GXPA 4ONVA 2VFHA 2Q8ZA 3NQVA 5AHNA 1JUBA 2QCGA 4IOTA 1B4KA 5LNRA 3L5MA 3M5YA 2V5LA 4CCCA 1YXCA 4ZQOA 4M6QA 4MKNA 4M7TA 3NQEA 5I3JA 4Q33A 1KTBA 2CWNA 3P8JA 5FF3A 1W0MA 3G1XA 4WOZA 3SGZA 3G1HA 1FXQA 4N9BA 2EHHA 2C15A 1H50A 1GVRA 4ZMGA 5FF4A 1FQ0A 1XI3A 4MZ1A 2E77A 1RVGA 1KLZA 4KFNA 3G1DA 1PE1A 3GAYA 5CPLA 1JCNA 3FJ6A 5DBUA 3W86A 4O0ZA 5AHLA 3OVRA 3EWBX 3GIYA 4AAJA 4NNCA 3RNDA 1KFLA 1IIGA 3QW4B 2Q3OA 2DJLA 3IIXA 3FIGA 4O4VA 3BLFA 3V75A 3BO9A 1GT8A 4LTSA 4E2DA 3LCFA 4LV9A 4PCFA 4AHPA 1R2SA 1DQWA 2HSAA 2ZRVA 6TIMA 3EX4A 3LOTA 1VJIA 1KM3A 5K2ZA 3BGGA 3KVMA 3TFXA 1H63A 4O53A 1RR2A 5CSSA 4LVDA 1SUXA 3TFCA 1PV8A 4IMCA 3DI1A 3T78A 2RDUA 4A22A 2ZRYA 4Y8FA 1NFBA 1IXOA 3KRZA 3NPVA 2B7OA 4FIQA 1C9DA 4UUIA 5FEWA 5CZSA 2PC4A 5CZJA 4JEQA 1I45A 3PC0A 3GDMA 3IIZA 4QSHA 1P4CA 3LBMA 4UNKA 3QJAA 4AF0B 4DF2A 2H3BA 1EEPA 4MJMA 3L0GA 1LRTA 3HG3A 2Q3RA 5G4WA 3EX2A 1DV7A 1GPWA 3LV5A 1P0KA 3NL2A 4O4WA 2CLOA 4NJHA 1UUMA 4TIMA 2CLFA 4LS1A 4MVAA 3G0UA 4R53A 3WK0A 5T26A 3IGSA 2ZBTA 3FEMA 3DI0A 3E49A 3LCGA 3W72A 3DFSA 3HGJA 4DO4A 2YPIA 4PTNA 1S5TA 3TXVA 4GUJA 1AW1A 3TR2A 2X2GA 2P10A 4LS0A 3C0JA 2FDSA 1ICSA 1ZAIA 4E0CA 3SECA 4JICA 2ZZ7A 3C61A 3FKKA 3SIZA 4TMCA 3KOFA 3W7EA 3R5EA 1DKWA 3MMTA 1HFBA 4WY0F 3NGJA 3V1PA 3GDTA 4AMAA 1G6CA 1QFEA 4NJGA 3TJLA 4XTIA 3C4UA 4LC6A 1GEQA 4QQ3A 4QM1A 3VE9A 1WDWA 3WJZA 2BX7A 3HPXA 1QO5A 3C56A 2H8XA 2WSQA 3PY2A 3Q94A 1FY6A 3OBKA 1XM3A 4QNWA 3R89A 2QCHA 1H5YA 1T8XA 3OEXA 1Z41A 4JYFA 2ZFAA 1SPQA 5SWUA 4XUGA 2Y7DA 4QJ1A 1DJNA 3A21A 3FLUA 3K30A 1RZMA 1AW2A 1I2QA 4IQLA 5I3FA 2G95A 4RK8A 3PUOA 2DZVA 4FNQA 5D09A 1YTKA 2CFFA 4L4LA 1VHCA 1VZWA 1OYBA 3W6YA 3W2JA 2FIQA 1YADA 3PSWA 1X1ZA 2B7PA 4CCDA 2E6DA 2PRMA 4IGHA 4JD4A 2GQAA 1KTNA 3BW2A 3DFTA 3L5LA 5BW6A 2NX1A 5K3VA 3L66A 4XQ6A 3W7OA 1A5CA 4RKAA 1QDSA 3M0ZA 3W75A 3TAOA 3W7LA 4LS2A 4GUIA 1PHWA 2C1HA 4IX2A 4K36A 4YMZA 5CZTA 4UTLA 1BWKA 3C8FA 2RDWA 4EIVA 1OF8A 1LP6A 4DXVA 4K8HA 2JKPA 3HPSA 1D3HA 4JTIA 4FXSA 2QCLA 3MBFA 3HB9A 3QPYA 2P0OA 3TMLA 4O57A 2A21A 5HR6A 4LVFA 1R30A 4IXXA 3SW6A 1SZNA 4HNNA 3L68A 5L9FA 3PS7A 4DF1A 1EIXA 1KFCA 1OFOA 2DZTA 3NOEA 3WK1A 3O06A 3B0UX 4K6AA 2E6AA 3CC1A 1F6PA 1MZHA 4AXKA 3NYZA 3L21A 3KVLA 2Z6IA 1K02A 5TBOA 3PSVA 4JX5A 3ABQA 1ADOA 3WJWA 2PRHA 2YFNA 4JY9A 1AK5A 5D2VA 5AC6A 5BRBA 4DO6A 3LTPA 4RR4A 5K9DA 3D0CA 1WQ5A 2V81A 4OBTA 3G18A 3A5VA 4ZQMA 1OJXA 5D38A 1GVSA 3NQ7A 2J9ZA 3B04A 4DQWA 4N9EA 4YL2A 3F4NA 3HG2A 2OT0A 5DY2A 3W71A 2CLMA 3I7SA 3QFEA 2PURA 4JXCA 2ATMA 5CPOA 1XBZA 3FA5A 2CZFA 4RZ6A 4Z1BA 1CW2A 3RLVA 4N2YA 1DBTA 1NEYA 4K39A 1SFLA 2Z1BA 3KRSA 3CT7A 3L5AA 4MPQA 3W1AA 4AWUA 3KHJA 3LCIA 3DAQA 3LCHA 2QUVA 4I9AA 2B4GA 3NZRA 4HNTA 5I3IA 1MO0A 1I2NA 1W3IA 1FCQA 4GE8A 3HOJA 2ZRWA 4JTUA 2KZHA 2A2IA 3W23A 5AYZA 3G3MA 1YXYA 5C6MA 2YCEA 3TW7A 5FESA 3CIXA 1H7NA 4XKYA 4GUHA 4A3UA 3OVQA 4BWLA 4DPQA 1H51A 1TV8A 2EKCA 2TMDA 3LHYA 4U4MA 1L9WA 3C2FA 1UASA 5EA9A 4FHAA 1W5OA 3NM3A 1JJKA 2V30A 1N8FA 4JYEA 3L65A 4CCEA 2WSRA 4FX8A 1I2RA 3GNDA 3C52A 1TPWA 3A9IA 3M41A 1RQEA 3EKLA 3GVGA 1M6JA 3UQNA 2DORA 4BK9A 2TRSA 3PBYA 4EOUA 3GNNA 3UY7A 4ORIA 1W5NA 5C54A 3AJXA 1GVFA 5LNVA 3NO5A 1KM0A 3TH6A 1IF2A 3B8DA 3GAKA 5EBUA 3LHVA 1Q6LA 1P1XA 1XUZA 4E38A 3BARA 2C6QA 3CTLA 1N7KA 4MFEA 4O16A 4I7WA 8TIMA 4QITA 2I14A 1X8FA 2OMAA 3P5YA 2B7NA 5G4EA 1JULA 3NEVA 3QEZA 3W07A 3LCXA 4G1KA 5D32A 3PB2A 1UJPA 4Z08A 4IUOA 3B03A 3W1PA 3TJXA 1HUVA 4ZQCA 2HS8A 3Q2DA 4X9SA 2GJNA 4HNUA 3Q37A 4IWWA 1TRIA 3H55A 3Q58A 4UTKA 2Y7GA 4UXDA 4N4QA 5AHIA 3I7QA 4WJEA 4UFKA 5EY5A 4CNPA 3RK8A 3TIMA 2OJPA 4M7SA 1VCFA 2QUTA 3BK0A 1FDYA 1O5XA 3QQ0A 5EPDA 2ALDA 2JBMA 3VKJA 1H60A 1ZAHA 1G7VA 3PWAA 1SSDA 1HO1A 4LRSA 3C3NA 2BZNA 1OG0A 2A0NA 1TJPA 4WXZA 1XDMA 3WJXA 2VEIA 4AWTA 1YDVA 3GYEA 4DBEA 2P1FA 2RHGA 2X1UA 3ZR4A 3B05A 3TK7A 1UUOA 2VKZG 1UB3A 5F2GA 2A7PA 5D30A 3EWXA 5K4ZA 4O1DA 4WQ6A 1JCLA 3M16A 5CPNA 1LROA 3WJSA 3LRMA 3HBLA 2ZQ0A 3HGSA 4GJ1A 4HIBA 2E1DA 3H53A 4MYAA 2J9YA 3MHUA 3W76A 2NWSA 3UPWA 3W1QA 5C55A 1PCWA 3NQMA 3GDKA 2C3ZA 4UTWA 1BWLA 4LUJA 2VEMA 2QDHA 4N02A 1Q6OA 1PL9A 3G3DA 4IMDA 1QR7A 4MZ8A 5HWJA 4A29A 5DY3A 1YYAA 3B0VC 2YZRA 4DF0A 4OT7A 2A4AA 2RKXA 3LERA 3I65A 1C8VA 3W1UA 2O7SA 2YGYA 4Y96A 5H91A 3QYQA 3PR2A 5FEPA 4CLMA 3EX6A 2FJKA 4MY8A 2Z6JA 3PF3A 1WOAA 4Z1AA 7TIMA 4MOZA 1LBFA 2A7RA 2XN0A 6ALDA 2QAFA 4O19A 1FCUA 5AFDA 4ADTA 1BEUA 1S5VA 2VEKA 3T40A 1W5QA 1JUKA 5KZEA 4LVGA 1TMHA 4TU1A 4GWEA 4JDYA 3LHUA 1W5MA 1TIMA 3I7RA 3B06A 5F4WA 4B5NA 5L6UA 3EWYA 4JR5A 3ZWTA 4K37A 2QF7A 4S2CA 2NUWA 3N2MA 3W3OA 3A5FA 4A21A 2Y61A 1ZCOA 4UC5A 5AHMA 4LNYA 1L6YA 4FNRA 4OU1A 5A5WA 3QW3A 3CHVA 1TPUA 1MEWA 3MP3A 4JTLA 4PC8A 4UTWC 3LB0A 3B4UA 1WOBA 3G1SA 1JCMP 3BG3A 4GNJA 4D2JA 3TSDA 1HG3A 1FDJA 3O6CA 4MUZA 3LHZA 5HMSA 4O1BA 2YSWA 3G1FA 3W7QA 3VCRA 1A50A 2QAPA 1VCGA 3MI2A 1THFD 5DCBA 2A85A 3STEA 5H2ZA 3F03K 5KMYA 1K3UA 3N3MA 1TPH1 3W87A 3ANYA 4LU0A 4N6FA 4RZ5A 5BMWA 3PUDA 1EWDA 3QZEA 4AWSA 1OVDA 3DFNA 3NQ2A 2WNNA 1YTEA 2Z2UA 1QPRA 4H3DA 3OHIA 1NVMA 1R2RA 3SJ3A 2ZRZA 3CLMA 4MY9A 1VQTA 3LV6A 3QSTA 1RPXA 2EPHA 1R46A 3S8HA 4XZ9A 2QCFA 3VI2A 5HNRA 2ZZ3A 4HPXA 3P7YA 1IXPA 4LRTA 4EF9A 4MJZA 5KTLA 1GOXA 3DHDA 3G1VA 3W7RA 2ZZ2A 4DPPA 3CEUA 4MY1A 3G8RA 5HQEA 3N73A 1QMLA 1DOSA 4TX9A 1FWRA 3QSRA 4M5PA 3U6WA 1YXDA 4CQAA 5FF7A 3GZ3A 5DCEA 3RF9A 3UPBA 3U8GA 1XCFA 1N55A 1GVQA 5CKSA 1OK4A 3SI9A 3GLCA 2JK2A 3O05A 3RMJA 1QNVA 4IXHA 2ZRXA 3L2IA 4H6KA 2ABAA 3GB6A 3RLUA 2PE4A 5LZLA 4UMBA 3S5YA 3NAVA 4I7VA 3GR8A 4LVBA 1YLVA 2ZTKA 4OWGA 1UCWA 1YDNA 3IEBA 4QNEA 2NLIA 4JTEA 4O52A 5GVJA 5AYXA 1Z48A 4NQ1A 4FX6M 3W73A 3P84A 1I8JA 4DBDA 2OX1A 4XTDA 4JIPA 3CB8A 3MYPA 4ZQNA 1W1ZA 1BTMA 3S1VA 3EXRA 4NJJA 2Y7FA 1VYSX 2DZWA 4MIMA 2G97A 4UFHA 4UIOA 4HT3A 4O18A 3TSBA 5DN1A 3TROA 3P67A 2WV8A 1FWNA 4WY0B 5FF2A 3I6RA 5FI8A 2V2CA 1GYLA 5F2MA 5K9CA 4POCA 5F4XA 4JIQA 3LLFA 2QCMA 1QAPA 5KITA 3N34A 3RU6A 4JTFA 3BW3A 1I2OA 2ZZ5A 3E0IA 1H7WA 3P82A 2QCDA 1T96A 1Z44A 5AYYA 1ONRA 5CSRA 3TX9A 1P0NA 3ABRA 1FUYA 2V5BA 5A8GA 3JR2A 1OX6A 3FYPA 1KW1A 3NQFA 3BG5A 1W37A 1QOPA 1S3HA 3MP5A 3EEGA 2XFWA 3WK3A 1QCWA 5D2YA 4I7UA 3G0XA 3PAJA 5D2WA 1Q3NA 1KBIA 4CQ9A 2CLHA 3NR0A 3MWAA 3LGEA 5KSWA 3FOKA 1SR9A 3EXSA 2NUYA 3W74A 2WKJA 2W0UA 1FWWA
chains in the Genus database with same CATH superfamily
4IIFA 3NM1A 2G3JA 3U57A 3OLDA 4O54A 3NQ6A 4RDZA 1UBSA 1HJWA 4UMCA 1DWGM 1S2TA 3QF0A 3LI0A 1TTIA 2YDSA 4BCEA 3GBDA 4XVEA 2UY3A 1QI5A 2D0HA 4IFKB 3W81A 4R34A 1JZ3A 4KRUA 1CI1A 1TPFA 5E6YA 2DUAA 3MYOA 4LYKA 4ALDA 4AD5A 3S5ZA 1NOWA 3N19B 4ERGA 2GVLA 4O11A 4UFIA 2NZLA 4GNKB 1KRBC 3E12A 5BXRA 4IF2A 3PM6A 4U10A 4YNGA 5LKYA 4HKPA 4QP0A 1EUNA 3VOJA 1KCKA 3M07A 2QCEA 2VC9A 1BF6A 2W3ZA 3P8IA 3BPWA 4N4PA 2PWHA 4Z1CA 3CO4A 1TCMA 3R2GA 2E5DA 3VFLA 1DL3A 2PDQA 4D8LA 5DMLA 2P88A 1A5BA 5HNUA 1QOQA 2G3NA 4DO5A 1PVNA 4FR6A 2J27A 4QG9A 4JFUA 2VCBA 2YFOA 2WMIB 2G5WA 4M29A 3ICJA 4WZHA 1HL8A 3AQUA 2ZA1A 3C6CA 5BXTA 3O63A 1RP8A 4EXQA 2H6RA 3T9PA 3BLKA 4XAPA 4UOQA 1XF0A 4GXPA 4ZXOA 1TO3A 3M44A 1F3XA 4S2BA 3GTNA 3FS2A 4XD3A 4L5ZA 1W56A 2KAUC 3E5BA 2A3BA 5FCZA 1QHPA 2E8YA 1G67A 2VD9A 3T44A 5JVLA 1FP9A 3L67A 3IJ8A 4Y2WA 1MQQA 2GGHA 5G1YA 3N11A 2WAGA 1R9YA 1V3IA 2DH3A 3N6JA 2G3FA 4WKHA 1ML1A 2Y0FA 1UD5A 1ZPTA 1K8ZA 3P61A 4GG9A 4NAEA 4E2BA 4M80A 4AVFA 1XV8A 2WW5A 3NGFA 4QCFA 2W66A 5GJPA 4DEFA 3KXQA 2W61A 1RQBA 2CHRA 1ZTVA 2FZDA 3KW3A 5BWFA 1HT6A 3WUFA 2NUXA 4DZHA 3WKZA 3UA3A 4AIBA 4OKDA 1EDQA 1TQJA 1FCVA 1GWJA 2FHFA 4ADSA 1U1HA 3OYXA 4E3TA 3AWNA 4O8AA 1L6FA 1PCKA 2P3EA 3W7PA 3FFSA 2EKGA 1HKJA 1F76A 1HN1A 2C0HA 2QUMA 2BLEA 1GVIA 2GL5A 1EC9A 1K7EA 1IGSA 3WDRA 3SBFA 5U7SA 5ABFB 3C2OA 3DECA 4NY2A 4DELA 2ZTJA 2CNCA 4BI6A 4DWSB 4US5D 2R94A 1ME8A 1PZ1A 1Q85A 4Q7IA 3BLPX 3KAOA 4GYPC 1MNSA 1JRBA 1EB3A 3T07A 2J6VA 3VIMA 3DHPA 2OFJA 1VKFA 2XWDA 1BRLA 3GH4A 1TA3A 1GKPA 4MADA 4UFLA 3S6OA 3S42A 2X1SA 1VLWA 3BG9A 1W2PA 4KPLA 3NQDA 3CV6A 2VOTA 2W91A 1GTEA 5AYIA 4OE7A 4EANA 1VF8A 3V0SA 1XBYA 1R3SA 1EJUC 1E6QM 2ASHA 3RILA 3TP4A 5AN7A 1VGAA 1E3XA 5EFDA 3P74A 3T55A 2CLKA 2DZUA 3SFKA 1DHKA 5B80A 3FAXA 2J24A 5FJOA 2JGYA 4KCVA 3T81A 1SZEA 3R43A 3WLIA 1KQYA 4BQ4A 4XG1A 3O8AA 1XRVA 1AW5A 3LN3A 3PZNA 1GOKA 1M5WA 1CB7B 2FB3A 4LUIA 4K1GA 5FJJA 1ONWA 2D3NA 1VBGA 1LZOA 1VLIA 5DBTA 1VR6A 2BHYA 3LXAA 2ZICA 3WIJA 4H04A 2QCNA 4UTIA 5E93A 1SFSA 1P0EA 3WDIA 3VGFA 5DMMA 4DBWA 2IXVA 1NAL1 4PEEA 1C93A 3UXAA 3BJFA 5EYWA 4AXNA 3CL7A 2BMBA 3G22A 1PJ9A 4LH8A 5C9ZA 4DX3A 4PEKA 5LYRA 1DJGA 2I9EA 3UGVA 4WGXA 5KZDA 1HKWA 2R1PA 3H24A 3UEQA 1TB3A 1FHVA 2C14A 1EPVA 4PMJA 3PJTA 1E51A 1AJZA 2CYGA 1F8MA 3LQLA 1JVNA 2UY2A 4CD8A 1W9DM 2XYLA 3UJSA 3U2ZA 5C2XA 3GTIA 2J78A 3ARPA 4C6EA 3OZOA 1OX5A 2WJEA 4FXJA 4GABA 4Q8TA 1U5HA 5AC7A 1DHPA 3AU6A 3MHGA 5LNUA 3WNPA 2Z0IA 5IHRA 3HQPA 1Q4NX 1FDZA 4CQ8A 3F2CA 4IJBA 1VC4A 2GSEA 2HVOA 3NPXA 4JPGA 4ZCWA 2F7FA 1HKMA 4IFRA 4R27A 5C2CA 2WPGA 2DZXA 3LDVA 4ICMA 5LA2A 1M04A 1US0A 2X7VA 1P1MA 1QI3A 5I3GA 2YL6A 3IVSA 1VB9A 2VT0A 4V15A 4L65A 4J3ZA 3EB4A 4JIIX 2GQ9A 5HMFA 1G9HA 1AZ1A 4DB7A 2QUUA 3W7MA 2AGTA 3MP4A 2X0HA 2G4JA 4UTTA 4LAZA 2C18A 2R1NA 2E68A 4PBFA 1UMYA 3IJDA 3VKKA 1TR9A 3D6NA 1J5TA 2UBPC 3OA3A 3HG5A 3VDHA 4KIEA 1QNQA 3R94A 2DT3A 4NZJA 3VXGA 1NF7A 2GGGA 1YW1A 4KEUA 3ZS4A 2OVLA 1NELA 5EMMA 4KCTA 5C71A 2GPTA 1YPXA 2BXVA 2VFGA 3DX5A 2X09A 3VD3A 3TTSA 2W63A 3TNBA 4Q8WA 3BE7A 1OFBA 1EJXC 4L64A 3WO8A 4O17A 3CM4A 2CLEA 3WLSA 4UWMA 1UKTA 1EFZA 2I17A 4NZ5A 3DFHA 1CLVA 1HJXA 4TTUA 3CPGA 4MNKA 4MNLA 3S9IA 2BVTA 1U1JA 4ORMA 2WNQA 1G7UA 1KGWA 2ATSA 4JTKA 5K4XA 2DZSA 3RPDA 2PLJA 3VMPA 3ITGA 4Q6JA 2Z7KA 4MPKA 1NSJA 4EE9A 3KX6A 3LBCA 1W3TA 3D3FA 3BW4A 4E8GA 2ZXDA 4LUSB 3GYCA 1KTCA 3RR4A 4QIUA 1TWIA 1FWFC 1ICPA 1TTPA 1YPIA 3VNZA 1WUEA 3UXDA 3E9AA 2REQA 4H00A 5D9MA 3CUIA 1MMFA 3F4DA 1PKLA 4RV8A 2J4GA 5LIYX 3M43A 1OGSA 3F5JA 1IT7A 3MMDA 5A8OA 4F66A 5A2CA 2B0MA 3EPMA 3PZOA 5IXEA 4QS5A 1EHNA 2DW6A 3UR2A 2ZDRA 2VM8A 4JNZA 3FKRA 3A23A 1G69A 1U83A 4GA8A 1TTQA 5BOEA 1E9ZB 2CHOA 3RJYA 1POJA 3GG1A 4IL2A 2IPFA 3UWZA 4XV0A 2PZ0A 4PSPA 4ACZB 3UWVA 4GI6A 3WJYA 2HE8A 2YYUA 3WLLA 1F73A 4NX5A 4OQVA 1RUSA 3VD4A 4Q7BA 2VP8A 4CKQA 1HTIA 3E5PA 3A22A 3UVAA 3UT0A 3OU8A 5A6LA 1GG0A 3IIVA 2PFHA 3R0KA 3FV9A 4AY7A 3BOXA 4YTTA 1ISWA 3NSNA 2VUYA 2B7QA 4EXAA 3U7VA 3VDAA 1YE4A 3NEHA 4WDXA 3EA2A 1TSIA 3C2RA 1K9EA 1SQ7A 1LF1A 5A2AA 2V63A 2YX0A 2OLHA 3N14A 1R9XA 3ZT5A 2AMGA 3BJSA 1BFNA 5AC5A 3IK2A 2ZE3A 3P60A 2KX9A 5H8UA 3MJYA 2WQDA 2HBXA 2O0TA 4EPEC 3JS3A 3NSXA 2QR6A 3ARQA 3P62A 1FBAA 5REQB 1GUVA 4UCFA 5M1TA 1KRCC 3KZSA 1LWIA 4ZSTA 4H19A 3THDA 5G1TA 3ARXA 4XBSA 3HQOA 3OGSA 4X22A 3TW6A 3W4RA 1K8YA 4IP5A 2WMKA 4PBGA 3M0VA 4K7VA 1E72M 4F9JA 4E4PA 4WY0A 1W1IE 2EO7A 5D8WA 2PF0A 3RO8A 2I56A 4OV4A 4X0NA 5HNTA 2DZBA 2E8ZA 3AZRA 4Q4KA 3M7SA 1IZJA 3BUVA 3ARZA 2V38A 3CS2A 4D6EA 1RJQA 4D6FA 3P81A 1PTGA 3VYLA 5D2XA 1BLIA 3A24A 3NPWA 1WE5A 3TW9A 3IGXA 1NF0A 3S5OA 3S1XA 3GFZA 2E6FA 3NO1A 3LENA 3K5XA 1XP3A 3NQBA 3ORWA 4NX0A 4ZZ9A 1F61A 5A6JA 3GKFA 3UYIA 4FA3A 4UMAA 5DELA 5KZ6A 3U2OA 1KV8A 4LWWA 1OY0A 2XUCA 4Z0JA 4GC4A 4ZE4A 1R87A 1A0DA 3AIWA 3EMQA 3MW7A 2BY3A 3N2XA 1ZFJA 4HU4A 1OIMA 2JEPA 1FWCC 3IGUA 3UP8A 2ZWYA 1IXQA 1Z42A 2R91A 1O7AA 3AICA 3PZVA 5A8PA 1O95A 2VELA 1TWZA 2O9PA 1TVNA 3U48A 3ITCA 3GU1A 1DQXA 1XRTA 3HPZA 5HATA 3WK2A 2PF8A 3IVTA 2EEXA 1ADSA 2XVKA 3BCDA 2BOGX 4NRRA 4C1LA 1I1XA 4W93A 1EQCA 1UHVA 1OFRA 3LTYA 2VX7A 3CH0A 4C5YA 2Q8XA 2NX9A 1OK6A 4O15A 2YYTA 3TC6A 1L6SA 4PCSA 4MLRA 1RV8A 3DESA 2XH2A 4PMDA 3EX3A 3UG3A 2GUUA 1QWGA 4L4MA 3LRKA 4KKXA 5HINA 2QJMA 3O1NA 1JD7A 3AUJA 2W4XA 3VKAA 3WUGA 3HV8A 1KGXA 1FWTA 3F1QA 1ZZMA 4JY8A 4IPNB 4B5WA 3POCA 5CSYA 1XHGA 4FNSA 4ZQPA 4X61A 4IMGA 5A8QA 2VTFA 4R7WA 5A6BD 3SFWA 5ECUA 4GINA 2ZYFA 1TPB1 3ELFA 5F2LA 3PG9A 1LCOA 2R1KA 2VRKA 3KDOA 3R11A 4KERA 1VIWA 2OG9A 2CU0A 4AEEA 1OF6A 1DWFM 4H01A 4HNVA 4HTYA 2WB5A 4AEOA 2X30A 1W32A 3C0QA 1ESWA 5T91A 3GXIA 1RY8A 2EGZA 2BV9A 2VFHA 2Q8ZA 3NQVA 1MUCA 2R6OA 4HHMA 5A8MA 5C9XA 4ZB2A 3U4FA 3WDQA 3M5YA 2V5LA 4E5TA 1K6WA 4M6QA 3SRHA 2EG8A 4QXIA 2WNWA 5I3JA 1EJSC 3NURA 2RGLA 3FEQA 1H50A 3T2OA 4C6OA 3WH7A 2I16A 1P7TB 1FQ0A 1XI3A 4MZ1A 4C7FA 2PU0A 1D7KA 1H5VA 3G1DA 1HF6A 1DWJM 4PRWA 3W86A 5T9BG 1K4GA 4O0ZA 4W84A 3EWBX 3NJ3A 4NNCA 3EMZA 4YVVA 1IIGA 1DJIA 3IIXA 4LV9A 1W1YA 4CD6A 1DQWA 2YXXA 2HSAA 5JIWA 3EDDA 1EF2A 2JQXA 1VBHA 3QC0A 1G5AA 3B8WA 2VGBA 1E6RA 4IGSA 5FSDC 1DXFA 3AU2A 4H7VA 3KDNA 4O53A 3N4FA 3QLDA 3ITYA 2WMHA 4ECLA 1TE1A 4HN8A 3VOHA 3TYDA 1XLKA 4D6CA 1XIEA 2Z2AA 2ZUMA 3HPAA 4IMCA 3T78A 3AI0A 3B8SA 1NFBA 1IXOA 1GYMA 3V1HA 3NPVA 2B7OA 1MW2A 2NV9A 1WB0A 1Z6KA 3GDMA 3L4TA 4I5UA 4UNKA 4MJMA 1Y7VA 1VFSA 2Q3RA 1F6YA 3EX2A 1DV7A 2D2HA 3LV5A 1P0KA 3CHDA 4NJHA 1UUMA 1RK5A 3FJNA 3WQOA 3VU2A 3UJFA 5D4YA 1TV2A 1PX4A 1WDQA 2ZBTA 3DI0A 4MF4A 1MYRA 2XM1A 1M3UA 2WMJA 1Y5VA 2Q6ZA 2X2GA 2CPUA 4X60A 2ZZ7A 1XLFA 3B0YA 4P8XA 3FKKA 4RE2A 2PD5A 3KOFA 2L5HA 4P7LA 2PDNA 1HFBA 4AMAA 4HA1A 1QFEA 3AIRA 3QFWA 2PZNA 4XTIA 1O66A 2BXYA 4LC6A 4QQ3A 1J2BA 1WDWA 4C6KA 2A3AA 3HPXA 1QO5A 2H8XA 3Q94A 1EXBA 1EOKA 1FY6A 3BTNA 1GKQA 1H5YA 4JYFA 3AYRA 3OZPA 2WCSA 3GHRA 3G2GA 1Q6EA 5I02A 3FLUA 1CEOA 4IQLA 5XIMA 3FHQA 5I3FA 1XGZA 2DZVA 5FL1A 2FFIA 3TYZA 3PSWA 2B7PA 3UR7A 2ZUVA 3VMOA 1VP5A 4C6PA 2FMNA 4HK6A 3S1GA 5LXEA 8RUCA 1GNXA 3VKCA 1M41A 1UKSA 3PNZA 1O68A 2NX1A 1ECQA 1QDSA 5FL0A 3W7LA 5AKQA 4LS2A 4GUIA 1PHWA 2C1HA 3VUPA 1XG4A 4DNHA 2D2OA 1UD4A 4UTLA 1C3FA 4YN5A 5A6SA 3WLJA 4REQA 4K8HA 1D3HA 2Z27A 3EYPA 2PGWA 2OB3A 3TMLA 1B3VA 2A21A 5HR6A 4I8DA 1LUCA 4IXXA 4QJ5B 3L68A 1KFCA 3NOEA 1MW1A 2IXUA 2PMQA 1XYMA 3LM3A 3WELA 2E6AA 1MZHA 2YIHA 1UA7A 2Z6IA 1HL9A 4YTSA 4B9ZA 3WJWA 2PRHA 3E74A 2YFNA 2VZOA 1ODUA 1VJSA 4XD4A 1AK5A 4RNFA 5ABEA 1YDYA 1POKA 4JKLA 3D0CA 3N2BA 3ZR6A 4NF7A 3G18A 3UGRA 3DFYA 4PMYA 4MB5A 3CZGA 3NQ7A 3N2CA 4ZO9A 3A12A 4WCJA 4CU6A 4YL2A 4JXCA 2VRQA 2ATMA 2OEMA 4GD0A 2QYGA 3HA1A 4JAWA 1TELA 4I5RA 2XSXA 4GQGA 3PUGA 2AL1A 1XYCA 4OECA 2HBVA 4Z1BA 1CW2A 4HGXA 4DJFD 3L5AA 3DAQA 2QUVA 5I3IA 2G0WA 1MDLA 1I2NA 1W3IA 3HOJA 3W23A 5AYZA 2PTWA 2IW0A 2YCEA 3TW7A 3QQWA 2B31A 1XLLA 1H7NA 4GPNA 2GSHA 3B40A 4A3UA 3GVVA 5M3WA 3OVQA 3TC3A 4RE4A 2CLPA 1NQ6A 1AA1B 4U4MA 3IPWA 3C2FA 2Y5SA 4FHAA 1R3TA 3PWIA 2VEFA 3MZNA 3TN4A 1N8FA 4ILSA 3ZJ7A 4C1NA 3TR9A 3C52A 3M41A 1EBGA 2HV5A 1EQPA 4CEUC 1GQIA 4KRTA 3GVGA 2DORA 8XIAA 4PULA 4BK9A 3HTWA 4LEFA 4ATLA 4IISA 1KKOA 4IPPA 1UD8A 3OPSA 4RUBA 3UY7A 1GVFA 1KM0A 4J3SA 3TH6A 1IF2A 4ML4A 3GAKA 3RCNA 2UWFA 3LHVA 1P1XA 3ZJ8A 3CTLA 1N7KA 4I7WA 2VWTA 8TIMA 3A9BA 4QITA 2I14A 4XSMA 1YBQA 2X7WA 4NAFA 4XZBA 1MFVA 1EZ2A 5G4EA 2GGEA 2PCEA 2I5GA 3LCXA 5EMLA 4IUOA 3KUMA 3TJXA 4GY7A 4CCZA 1LT7A 1R7OA 1V3LA 4DWDA 4IJRA 4UXDA 1KO0A 5AHIA 3I7QA 1JPDX 1NP0A 4WR3A 1PZ2A 4WJEA 2AMXA 4UFKA 5EY5A 5A6TC 3ZT6A 3TIMA 4HOWA 1XLMA 4AZ5A 2OZ3A 2OTDA 3SCPA 5I09A 2VR2A 4GGHA 1P7TA 1E6ZA 2BZNA 1WAWA 3SUVA 1OG0A 3FX4A 2PP1A 3GXDA 3WJXA 4DBEA 1XYFA 2P1FA 1R8LA 2VCAA 1DE5A 3C8NA 2CXGA 1JXKA 1KXHA 1AQFA 2HEJA 2A7PA 5D30A 4O1DA 3SUUA 3M16A 1RK6A 3E0VA 3WJSA 2E40A 3V16A 1KRMA 3GIPA 4XO7A 4ZGYA 1JFXA 4ZBCA 1KGUA 1FKXA 3W76A 1BG9A 2DSUA 3HJEA 3UR5A 1B3YA 1QWKA 1PDZA 4ZE5A 1PCWA 1DWIM 4TVUA 1DJZA 2QS8A 2EPMX 4C7GA 3VA8A 1QW8A 1Q6OA 3G3DA 1QR7A 4DWSD 5H8PA 1MNZA 5DY3A 1I0BA 4Q8PA 5BXSA 1O1ZA 1OD0A 2VNCA 3VZYA 5TNVA 4KMQA 2A4AA 1XC6A 3QHMA 4RE0A 1FH8A 3QYQA 3BSGA 5FEPA 2EJ1A 4E4UA 4H6EA 1KB3A 5I24A 4GYFA 3CUHA 3PF3A 2F61A 3SN1A 4Z1AA 4MOZA 4MDPA 3CAVA 1PDYA 4XAYA 3U3HA 4MWAE 2XN0A 3BWWA 1NDYA 4O19A 1FCUA 2J7EA 2Z29A 1XLDA 3T40A 4UOJA 1JNEA 1Q7QA 4UQBA 4GWEA 4JDYA 4PCPA 1XISA 2XVGA 1W9VA 3F5LA 2IPGA 3EWYA 4JR5A 1V3MA 4IP4A 3N2MA 3MSRA 3PPGA 2GYIA 3IJ6A 3FJ4A 4DJDC 4FNRA 3TTEA 3TZFA 3MP3A 1TPUA 4JTLA 4KEZA 4JHOA 3G1SA 3ZYZA 3BOLA 2HXTA 3O6CA 3LHZA 1O6IA 4O1BA 2PEVA 5C0QA 5E70A 4OUEA 2QAPA 4L1XA 1H0IA 5HQMA 3STEA 3L4VA 3AMDA 1CXLA 3BCFA 5E09A 1YNQA 3UG8A 4N6FA 1QHZA 3SCSA 3V35A 1EWDA 2YDRA 3DFNA 1A47A 2WNNA 1GPFA 3KBVA 4Q4OA 4L80A 4X63A 3B8VA 3OHIA 1NVMA 3OGRA 3M46A 4MY9A 1VQTA 3VM5A 4HJWA 3LV6A 2EPHA 1R46A 4HPXA 3R0DA 4LRTA 3CJPA 5CC7A 4MJZA 2HNEA 5CC6A 3DHDA 2WLZA 3C3UA 4DPPA 2IKJA 4MY1A 5HQEA 3WQ5A 1FWRA 1RLCL 4HSHA 3ZVIA 1NWUA 4CQAA 5FF7A 3UPBA 1N55A 5CKSA 3SI9A 2CKRA 1QNVA 2VDGA 2ZRXA 3ZLFA 1YNPA 2ABAA 3RM9A 3RLUA 2PE4A 2PDIA 1J5SA 1YLVA 1XYBA 4F0SA 2ZC1A 3LPOA 4JTEA 4DUWA 4O52A 3WX7A 5GVJA 3GUGA 4GHRA 2FKPA 1NP2A 2OX1A 2ZE0A 1H09A 1W8GA 1A3HA 1EJTC 1LL7A 4M81A 3BDKA 3TROA 1FWNA 2OO0A 4WY0B 2TODA 3EAUA 2V2CA 1GYLA 1JXJA 5K9CA 3B9OA 4JIQA 4WVXA 4E6MA 3RU6A 3BZJA 3BW3A 2ZZ5A 3L2LA 5EGRA 3P82A 2YBVA 4TXEA 5AYYA 4MB4A 5CSRA 1T40A 3BAYA 3SN4A 4UOZA 3BL3A 1FUYA 5AZ0A 3JR2A 1OX6A 1KW1A 1WO2A 1V77A 1UWRA 3WK3A 4RW3A 1AJ2A 4XX6A 3AMGA 2GGIA 4DJFA 3G0XA 3O6AA 1H49A 4WDTA 4ZO6A 4D72A 4CQ9A 9XIMA 5HDRA 3NR0A 3A47A 3LGEA 5B7ZA 4LCQA 4C6NA 3W74A 1KXVA 1PZ0A 5GQBA 1Q6FA 2ZOXA 3JZEA 6REQB 4XZMX 1J2WA 3WLKX 1E0VA 3CH9A 3UG4A 1G4EA 3APGA 1SO5A 1E6SM 3S6TA 2J8GA 4HVXA 2DVTA 1GG1A 2WC3A 1KXQA 3VOGA 2W6RA 2TYSA 1GOIA 1EX1A 2PPGA 3BVJA 4X3ZA 1Y8BA 2EF9A 2C16A 5D8ZA 4N9DA 5D02A 2Y1HA 2GFTA 1VYRA 4DYJA 4L4PA 5C9UA 4JHZA 2FHBA 2ZIDA 3NXLA 4O1AA 2NQLA 4FLSA 3AIEA 1U1UA 3W6MA 2AKMA 1QNPA 4C6DA 3MQTA 4NSBA 1Q13A 4BFAA 1WKFA 3TSMA 2B81A 1XBXA 4WXYA 1EJ7L 2Z24A 2AQWA 4ZVJA 1UD2A 4PODA 1JL8A 4GBUA 5G4HC 3AHXA 4P2VA 3BJTA 1BTCA 4CVWA 2XIBA 3HURA 2FB2A 2PDYA 4KRZA 3DKJA 4JHMA 1EYEA 2QT3A 3AHVA 4LUSA 5DMYA 1TJ0A 3NL3A 4NT0A 1W3NA 3OHMB 3UWYA 1OCJA 4JN8A 5DT7A 5E0KA 1TZ7A 2HE5A 1QK2A 3FDKA 1UZ4A 1ZALA 5HMEA 1LWJA 3OYZA 1K7XA 2Y2WA 2WQPA 9RUBA 1XYLA 3N18A 4BJHA 3UZYA 1RPKA 2E09A 1HQTA 3EOLA 2C1GA 3G5EA 5KZMA 4JFSA 2GVJA 3NCOA 3E02A 3SCOA 5IBXA 1F3TA 1F05A 2BGQA 4L61A 1IWAA 8CGTA 2RJHA 3C0LA 3ES7A 5FA5A 1H41A 1CTNA 1M03A 4DWSC 1I6NA 1K8CA 1LJYA 3XISA 2PD9A 4ZODA 3GZAA 3K4AA 2VFDA 2J7BA 4D6JA 2VX4A 1NH6A 4LF1A 4AEFA 3LK6A 3MWCA 1IEWA 1Q6QA 1RY0A 4LB4A 3LNMA 1WXJA 2PBOA 3EWWA 3YPIA 1ECEA 1X39A 3TE9A 5HJLA 1EYWA 4PRTA 3QV7A 4Z1DA 1VPXA 1WV2A 1SYTA 3MTWA 1U2YA 3T0BA 2X42A 2HPMA 3DC8A 3VGGA 5I79A 4NXKA 3RITA 2OSWA 4Q4PA 1KLYA 1PBGA 5I6SA 2HWGA 3AISA 5LA0A 1XPGA 2Z00A 3CZKA 5LIUX 2YXGA 1QRQA 1EGZA 1WNOA 4W5UA 1H11A 1KM4A 1GQJA 5I77A 3EWUA 2J8FA 3CHFA 3M5ZA 3W1NA 1QBAA 4ZEPA 4IT1A 3R13A 3QQ1A 1GGOA 4KGLA 1OG6A 5D9OA 3ZVHB 7PTDA 4AVNA 2C19A 1EEXA 3SEPA 1KBJA 4NXSA 4FB7A 3GR7A 3VK5A 3WBXA 4ZENA 5BMXA 4OGZA 3NZQA 2XIJA 4IIHA 4UR8A 2O7QA 1O4UA 2BVWA 1AMYA 3ZJKA 2ZVIA 1VEOA 3LNPA 4JYDA 2GJRA 2JE8A 4PMNA 3TJ4A 3QXBA 3VIGA 5HUPA 3TLQA 3XINA 2QVHA 1IV8A 3PFMA 4AD1A 3VNMA 4ACYA 2YW3A 3SSJA 4PBEA 4AD4A 4ZB0A 3LHWA 2A6NA 4CN4A 5EMJA 1GJPA 5AC8A 4C5ZA 3HM7A 1UUQA 4F2TA 2ONEA 2V82A 3TTQA 3BMWA 3WQDA 3KP0A 2HROA 4NAFB 1MUWA 4L7ZA 2QJHA 1B30A 2CZEA 3EPNA 5EB8A 1FRBA 2J79A 1XICA 4OHQA 4I6KA 3M47A 1TMQA 1LDCA 3GH7A 1SZFA 5CJNA 3WH6A 3THAA 1QO2A 5F1UA 1SJAA 3PJWA 3II1A 2J75A 3VCNA 3AXXA 1F74A 4QAIA 2INEA 3MO7A 4UCGA 4OUIA 2VZVA 2YW4A 4WKFA 1SU5A 2IPJA 3VMNA 3ZOAA 3UD6A 2DEPA 2Y63A 4R7JA 2DDXA 4AYSA 4NU7A 3GDRA 2P50A 2AAMA 1CGYA 2IKGA 3W7HA 3MBDA 2JALA 1VEPA 3DGRA 4BZYA 1KCZA 4QISA 4M0XA 3VNJA 1K9FA 2DW7A 3DG6A 2E9BA 4IQDA 1ODZA 1J10A 3W7IA 4DZIA 1TRDA 1TPDA 1CGTA 3E2QA 3E2VA 3PJXA 4RPPA 5EBAA 3MUY1 5FJRA 3W0KA 1ZHAA 1PKMA 4CNUA 3A3WA 3PJUA 3W1RA 2PODA 1JZ8A 4GH1A 4G56A 1TPVA 1FWIC 2AQVA 4Q4SA 1LLOA 2UV8G 1C91A 4LYQA 3QHNA 1TA3B 2Z1XA 1NFGA 4LVAA 4X9YA 2EG7A 1BXBA 1JPIA 1I0DA 5GJNA 2PTDA 1R2TA 3GW0A 1H61A 5CLWA 4QLLA 2X1IA 1MWOA 5I7GA 2X41A 1DORA 2PDCA 3N29A 1E6PA 3RRAA 3GM8A 4F3HA 2ACSA 3R6IA 1HXJA 4CNOA 2CBVA 4GZIA 4JZ5A 4PL2A 3UBPC 3OLEA 4HA0A 2BOEX 3K8LA 2WKGA 3LG3A 3UYCA 4LOCA 4O28A 2W62A 3UETA 4JDBA 1ZNNA 4JTCA 2AOSA 2BXZA 4EAYA 1XGEA 4OOUA 3TTOA 1A49A 3AMKA 2ZZ4A 3SIMA 2J7DA 1Y5WA 1T8QA 1FVPA 3EDFA 4FEZA 3T05A 1OYAA 4JIHA 2CXEA 2GK1A 4LCSA 2C8NA 2ESCA 4REQB 1OT2A 4LEQA 2W79A 1VIZA 3FN9A 4MHBA 4E4FA 1S2CA 4AVOA 1GK8A 3UWEA 1FH9A 2ABBA 4RXGA 3NDOA 3DXIA 3PTKA 2DV0A 3G0SA 1IIHA 4WHBA 2QQ6A 1TMLA 4HA3A 1UP0A 1BSIA 3ARVA 3AZTA 3KWSA 4UR9A 1V3KA 1E0XA 1WKEA 4QDMA 3S6DA 1J18A 3OP2A 4Y90A 5HULA 3DDMA 3R7MA 2JKAA 1D9EA 4JX6A 2XVLA 2VQUA 4MSSA 4WJ8A 4IX0A 1W91A 3FYOA 5FEXA 3SN0A 3W1MA 1MQRA 3M0JA 2ACUA 3BC9A 1YPFA 2ZRUA 3LXCA 1X6NA 4NL1A 5EMKA 4GK8A 3USZA 3ITOA 2I5IA 4NKCA 4IHCA 3AFBA 3TA6A 6ENLA 3REQA 1CBGA 1GZGA 3UWQA 3EEZA 1RH9A 4FNPA 3TUUA 1DJWA 3M64A 1XLBA 4DXKA 3VNKA 2E9LA 6CGTA 1J4EA 2E7FA 3OG3A 4GI9A 4HYVA 3W7DA 2PLKA 1B4EA 2F9RA 2WHKA 4LW7A 2Z7GA 3HZ3A 1S5MA 5FKYA 3DU0A 3PP7A 2WVVB 2BDQA 1O12A 4V33A 3OODA 1Q2RA 4A8IA 1UH4A 1VCVA 1CIUA 1V6TA 3R12A 2VJXA 1P6BA 3URAA 1KM1A 8XIMA 3C2YA 1I75A 3ZZ1A 4JOMA 3CU2A 1G4SA 4I6VA 4Q4RA 4XZHA 7REQA 4FP1A 2OZ8A 3ABOA 4GXMA 3CGTA 1HP4A 4GVHA 1KNWA 2FPVA 3W1TA 3SCUA 1MW3A 4HN4A 1NY1A 2DT0A 1B54A 1BAGA 5KEZA 4XBKA 1Q8JA 1HKVA 2PRLA 1KM2A 1KRAC 2GSJA 3LEPA 1GOOA 1LQ2A 3HJZA 3COTA 1V6UA 4RL3A 1C7TA 2ISSA 1G94A 1OFQA 5JU6A 3AS0A 3DKLA 1E1EA 3AO0A 1E70M 2J6XA 1EL3A 4N42A 1SSGA 3R10A 4Z2KA 1DJQA 2AAAA 1L6GA 5D03A 1JDEA 5F4SA 4AC1X 4KQNA 4DI9A 3ABXA 3UPMA 3N6QA 4PMUA 3TAKA 4MUPA 1A5NC 1UIOA 2NXGA 2OWWA 3CIWA 3VNYA 1RA5A 1C7SA 4AHOA 2QCDB 2DFAA 4ICNA 1YIXA 4PL1A 2GOUA 5IDZA 1MRQA 2FTYA 1V6XA 2FH8A 3H4XA 1LG1A 4O50A 5F7UA 2DY3A 4IM4A 4PUWA 4NJKA 2XN1A 2PBGA 2GOKA 1JR1A 1T99A 3SB0A 2DZPA 3TKFA 4H7ZA 4PRRA 2OKOA 6A3HA 1SFJA 2WWDA 1S2VA 1NJJA 1DWHM 1K8XA 3EA1A 4PA8A 3ALFA 1Z89A 4MKSA 4BA0A 3VIHA 3VVGA 4CD4A 1RCQA 3EWDA 5HJXA 5I3HA 4IG2B 4EWND 2QJIA 3DFQA 3NNTA 4GZ7A 2C1IA 3P80A 2X05A 1R7AA 2I7GA 2WZMA 5FEZA 2OQYA 1FX6A 1A5AA 4LC8A 2OSXA 4C6BA 1N82A 4E2OA 1QPQA 3DG7A 3ZT7A 3QH2A 1VFMA 3H7VA 3TWBA 1J11A 5IFPA 3VZXA 1ME7A 1IGWA 5A1AA 4XIMA 3EWCA 1HL2A 1WA3A 4A2RA 3V7PA 2EQDA 4MJ4A 1XJBA 3WL0A 1AMKA 2VFIA 4RZ4A 5DANA 2WWCA 5G2IA 2QEZA 1UH3A 4AFYA 3CL8A 3MMWA 4KFOA 2XH7A 3UVIA 3GIQA 4Z2LA 2ZZ1A 3CQKA 3E96A 3CYJA 2QIWA 1MEIA 4OBSA 1GW9A 3AHTA 2XDFA 3O9NA 2ISWA 3OVGA 3SJNA 2WZHA 2OPJA 3U2EA 4LAMA 3KCLA 1OINA 3NOYA 3R8GA 5C9WA 1B9ZA 1F8IA 4NZFA 2Y5JA 2NV1A 4LAUA 2QDDA 3VOIA 1A3WA 4Z17A 4YIWA 1H62A 3RO6A 3BSHA 5DXYA 4PFMA 4HMNA 3WMCA 2XN2A 2DJXA 3LLXA 4GO8A 5D9NA 3WG6A 2VI0A 1XYAA 5AVHA 5G2WA 3WFAA 1FWEC 4UTHA 4ROQA 4GVGA 4QRNA 3M6DA 2V0TA 3GK0A 3S9YA 2DT2A 3K8MA 2D1ZA 3M6YA 2IQTA 1W1B1 4DHGA 3CWOX 1SJDA 3WEOA 1VRDA 2WPBA 5TIMA 5D33A 1OC6A 3NO3A 3CWNA 2YR1A 3AUOA 1JYNA 4S3JA 1PAMA 4RPQA 1XUUA 5G2HA 4CU8A 4M82A 1I4NA 1JRCA 4IIDA 3S0CA 2G41A 1FWJC 1T0OA 5BU9A 5ENLA 1XDLA 4EF8A 2Q8LA 4P8UA 1O5QA 1RP9A 5BWAA 1V3HA 2TPSA 2RGMA 3ARRA 3T7VA 1OC5A 1TPEA 4N0RA 1JNDA 1OFAA 3VM7A 3HGRA 3QLLA 4RXFA 3VNDA 1XH0A 2E5CA 2E4TA 1G4TA 1KBKA 4AF0A 1ZY9A 5CEWA 3DCPA 1WDSA 4KGJA 4KWWA 5T8GA 2PU1A 4ONVA 1EH9A 5CGTA 4FZIA 2HCVA 2V3GA 1EO7A 1JUBA 4LFYA 5CH9A 1XIJA 3BH4A 4HCDA 5XIAA 3UW6A 3WNNA 3MZ2A 1Z8AA 3L5MA 4YU1A 7XIMA 1D8CA 3NWRA 4B5VA 4ZQOA 1RXOB 4C6LA 3NQEA 4MB1A 2IQ0A 3GXFA 3A6OA 3AOFA 4Q33A 2PTYA 3SGZA 1SR0A 3G1HA 5GNZA 4DY1A 1FXQA 4N9BA 1EC7A 2EHHA 1JPKA 4R5EA 4J3XA 3BANA 3MVTA 5FF4A 2EPKX 2GUBA 4IJCA 1RVGA 4PR4A 5CJ5A 1TG7A 1CGXA 5REQA 4GJIA 3B97A 3FJ6A 3CYVA 4HJFA 1S39A 5LA1A 1IT0A 3PPFA 3OVRA 1WP6A 4YTQA 4AAJA 3MANA 1KFLA 4G8TA 2Q3OA 3FIGA 3LGDA 3LCFA 4MWAB 4GC3A 3AALA 4AHPA 5EFFA 1VFHA 6TIMA 1WDRA 3LOTA 2J25A 1V6YA 2WHJA 3N12A 1R6WA 7TAAA 1VENA 3BAJA 1VJIA 4C6FA 1GONA 5K2ZA 3MMUA 4ZXLA 4F0MA 3TFXA 1UWSA 3KL0A 3W02A 4GJJA 1E5JA 5CSSA 4B5XA 3T8QA 1SUXA 2OEKA 1PV8A 3WLPA 4LSBA 2F6UA 2RDUA 1ELSA 4Y8FA 4CEXC 4MM1A 2PDXA 2J7CA 3BLOA 5FEWA 2PC4A 1I45A 3PC0A 2FJUB 2WM1A 2IKHA 4DF2A 2H3BA 1P48A 3UZZA 1GCYA 2WJDA 1DJXA 2CLOA 4LS1A 3BAWA 4R53A 2F2KA 3UG5A 1E6XM 2XIQA 3H2AA 3LCGA 3BMVA 1MFUA 3KWXA 3L2MA 1FHLA 1UKPA 4GUJA 4QQUA 3TXVA 2FH6A 1QPKA 4J3TA 2P10A 3XIMA 2PWGA 1UQZA 1ZAIA 5G1MA 4TV6A 3KBJA 3RHGA 3KBMA 4NG3A 1CENA 1DKWA 4H9VA 2FGLA 2POTA 3NDYA 3R5EA 3NGJA 4JTDA 1HVQA 3H70A 4R7OA 1GZJA 2AL2A 1GEQA 2VVNA 3VE9A 1ZJBA 4YTRA 3WJZA 3WBYA 3RCMA 4QE1A 3C56A 3PY2A 1M01A 3R89A 2QCHA 3OEXA 1Z41A 3QKZA 2ZFAA 1SPQA 7ODCA 3L4YA 5SWUA 4XUGA 4LF2A 2GQ3A 4RDVA 1JZ4A 5CC5A 1I2QA 2EPLX 1RVKA 1ISZA 1IWPA 4US5A 2J77A 4ATWA 3AIVA 4RK8A 3PUOA 3UXLA 5D09A 1YTKA 3K1GA 1VHCA 4NP7A 3F7JA 2FVLA 5HMDA 3W6YA 3W2JA 2FIQA 1YADA 4DJDD 2CIPA 1X6LA 4ATDA 4CCDA 2NVDA 2R1MA 2PRMA 4IGHA 3MU7A 4JD4A 4NZ1A 2GQAA 3DFTA 3TJIA 5BW6A 5K3VA 2YBUA 1A5CA 3M0ZA 1GQLA 3M0IA 2NLYA 3S2LA 1NU5A 1ZP4A 3QGKC 4EX4A 3H7RA 2QPXA 3A3HA 1HKKA 5J8LA 4LYPA 3STPA 3VIFA 3THCA 5CPSA 2JKPA 4NRSA 1W9UA 2HJPA 3QPYA 1DP0A 1JAEA 2P0OA 3E2SA 4LVFA 3TN3A 1R30A 3SW6A 1SZNA 3E6EA 2PGFA 3PS7A 4DF1A 1EIXA 1Z32X 2DZTA 1OFOA 4C60A 3WK1A 1LL4A 5LIKX 4WGHA 1EZWA 1MW0A 3DUGA 4FALA 3CC1A 3GTXA 3L21A 2QPSA 4W89A 3PSVA 1HJVA 4ERIA 3H21A 5A6AA 4JY9A 3CZJA 1CPUA 4C91A 5D2VA 2DSZA 3LTPA 1J0ZA 2V81A 2XSBA 3QZAA 3MCMA 4MJ2A 1OJXA 3B9AA 4ZB5A 4GIRA 5CG0A 3WF0A 4AX6A 4IMAA 3HG2A 5A6MA 1E4IA 2DQXA 4KS0A 2PURA 3O7UA 5TAOA 5CPOA 1TWWA 1XBZA 5HQLA 4HK7A 3BAIA 4QROA 4DNMA 1BVNP 5JBEA 1SVDA 4B3KA 2DSVA 3W82A 2PDWA 4RZ6A 3KEHA 2WHMA 4H83A 1DBTA 3K4WA 1NEYA 4AWUA 4MPQA 4QLKA 3KHJA 4RW5A 4I9AA 3CBWA 1NM9A 3A4JA 4JTUA 4M6UA 1WZKA 2V5JA 3EZ4A 4CQDA 3KLKA 4BWLA 1H51A 1MVYA 2TMDA 4RV3A 1UASA 1DYSA 2XGBA 4H9UA 4QS6A 3UCQA 1XLGA 4EXBA 2VC7A 1UIPA 3L65A 3EOOA 4FX8A 1X38A 3C86A 1RQEA 1EGMA 4D6DA 3EKLA 3PN8A 1M1BA 3GG8A 3KL5A 1GKRA 4ZFCA 3UJEA 7ENLA 2DUZA 3GNNA 1W5NA 5LNVA 3DYMA 5EBUA 1Q6LA 1JYXA 4UQCA 3N2OA 3BARA 3H2EA 3VD9A 1XIBA 2PDUA 1QVBA 4O16A 3LBOA 5EU9A 5XINA 3WQPA 3W26A 1YHTA 4B5UA 2B7NA 3LZ3A 2BOFX 1JULA 1EF3A 5AZ1A 4M3PA 4GX9A 1LT8A 3U5UA 1TFVA 3QOMA 4XD6A 2A3LA 5AY7A 3Q2DA 2GJNA 4HNUA 4Q8QA 3Q37A 4LUTB 3WBWA 2Z1KA 2XGZA 1W3HA 3FGCB 1QJWA 1FFRA 3ONCA 2OWCA 4CNPA 1AH3A 4DVOA 1JAKA 3QR1A 3VUSA 4M7SA 1VCFA 3QQ0A 5EPDA 2ALDA 1B0IA 3VKJA 1KCLA 4B4HA 4Q3MA 2G50A 2DIEA 2A0NA 4WXZA 5BXPA 2GDQA 3UU0A 5E5CA 3N1AA 2IUZA 1YDVA 3A64A 1BRLB 2RHGA 3ZR4A 3E2RA 5K4ZA 3EWXA 6XIMA 1BYAA 5FAGA 1JCLA 7REQB 5CPNA 3I4KA 4L9YA 3R58A 1LROA 1PX8A 3BMXA 1W1VA 3AAMA 4QEHA 3HGSA 1J6OA 3AXMA 3GD6A 1J6PA 4GJ1A 4IIBA 2GWGA 3H53A 5ABFA 4MAZA 1M65A 2NWSA 4HTBA 4YVPA 1AD4A 3UPWA 2P8CA 2E28A 1J96A 1VJZA 1XYZA 3MUIA 2BY2A 3GDKA 2C3ZA 1IEXA 1BWLA 4PTWA 3T09A 4Z2GA 4DXXA 4QEEA 4N02A 3VAVA 4IMDA 4X2PA 3ZJ6A 4B5TA 1V0KA 1YYAA 1E1FA 2YZRA 4DF0A 2I5QA 1WDPA 1E9IA 3W1UA 2J74A 4I3GA 2O7SA 4NYUA 3UCCA 3K46A 3EX6A 2FJKA 5CZKA 4PMXA 3S3GA 4NAEB 3ME3A 5TD4A 1NARA 4KWUA 3E38A 1WKDA 3S2CA 1V7AA 3SUSA 1XS2A 1XIIA 3MUAA 5AFDA 3ITVA 1UWAA 1W5QA 3VIJA 5KZEA 1NDZA 3CZ8A 4WEVX 4FLQA 3BV7A 3LHUA 3AZSA 3V0TA 2NSOA 4L56A 3B06A 3WD4A 2QF7A 2GDVA 3A5FA 4A21A 2Y61A 5CBJA 4AUBA 5A5WA 2PWDA 4JTAA 3LB0A 1ITUA 2VMFA 1FDJA 3BSMA 1W3JA 4AYGA 4MUZA 1I9CB 3W38A 5HMSA 2OEJA 3G1FA 3W7QA 5C7VA 1YEYA 1DXIA 2J66A 1V0NA 1VCGA 1IE7C 1PKYA 5KETA 1BYCA 4F8XA 3DOPA 2PP0A 1R3RA 1PUDA 3F03K 1CLXA 3BOFA 1K3UA 2X0YA 3R25A 3N3MA 1TPH1 3FK4A 2PC8A 3GG0A 1QATA 4PMZA 1V4YA 4HMDA 4H3DA 1R2RA 1UR2A 1NIUA 4FR1A 3CLMA 1BQCA 3PPHA 5PTDA 4DRSA 1NWSA 3OW1A 1E9LA 4XZ9A 2QCFA 4XSLA 2C7FA 2QGHA 3FVDA 1QW7A 2QXWA 2ZZ2A 3CL6A 3CEUA 5BOFA 4TX9A 1C8QA 1YXDA 1IR2A 3GZ3A 5DCEA 3RF9A 4TTGA 3U8GA 1XCFA 4JTQA 2OYLA 1HP5A 1GVQA 1OK4A 3MUZ1 4S3BA 2JK2A 3O05A 3VC6A 1A5OC 3PBMA 3RMJA 4Y8EA 1S3TC 4IXHA 3L2IA 5E6ZA 4N7QA 5LZLA 5LIWX 3S5YA 2R1LA 2AKZA 1M68A 1E71M 4LVBA 4J27A 1YDNA 2X8RA 3N15A 4QTGA 4S3FA 4IFKA 2NLIA 4JQAA 4FSAA 1Z48A 3GDBA 1QI4A 1E73M 3P84A 1I8JA 1R3VA 1XLAA 1CXEA 3GG7A 4NASA 2BODX 4ZQNA 1FHDA 3EXRA 3WCZA 2Y7FA 4MIMA 1XLJA 2ZUUA 3VX0A 4HT3A 4OFCA 4XK2A 5HANA 3WQVA 5DN1A 1A5LC 4GISA 1S5NA 3KTSA 1SMDA 3IJQA 3MB9A 3ITTA 3IARA 2VL4A 3WL1A 1QAPA 5KITA 4YHEA 4F48A 3CNYA 4M24A 1XRSA 4UNIA 3ABRA 4P7OA 1FP8A 2V6AA 4TV5A 1U22A 4ZFMA 4IIGA 1I1WA 3QV6A 1S3HA 3B0XA 4GIEA 4E3VA 2XFWA 1GZ1A 5D2YA 2QW5A 4RDYA 3KOZA 4I7UA 4XAGA 2NQHA 1E4MM 1Q7ZA 4GH3A 4IUGA 4KWSA 1A80A 4HYRA 1OT1A 1IQ8A 4UB9A 4P7NA 3TYCA 2W0UA 1RCXB 1FWWA 4U28A 1Q5MA 1UWIA 3F2DA 1V0LA 3ANVA 1TE6A 1A5MC 4GY0A 5B7YA 1PXGA 2FZMA 3OTRA 3HFTA 2VCCA 1J12A 4JGDA 4H8NA 1XFBA 1ZJAA 3H26A 3CHEA 5BU6A 4W7WA 3DZ1A 1OFDA 3NYDA 2G96A 4YYFA 2IKIA 2V5CA 1ZU8A 1EP2A 1Q6DA 3C2VA 2OKTA 4HNOA 2DH2A 3GDLA 2VURA 3KCJA 3NVDA 3PHAA 1UA3A 2FQIA 4QR6A 1VHNA 1PKNA 1ZAJA 1LRNA 1EKOA 3N9KA 4F40A 4LPCA 3CUGA 5AHFA 5CC3A 4KETA 1REQA 3ZQ9A 1UPMB 1UPPA 4FNUA 2D69A 4W7UA 3G1AA 2CW6A 4FIRA 3URNA 4C1KA 1OX4A 3W6LA 3USBA 3M7WA 2SFPA 1AH4A 4CQBA 4WDWA 4JS3A 4L6HA 5LHFA 4HZ7A 1EJVC 4EACA 5TF0A 3GW3A 4LV4A 4A8RA 2ADAA 3NQGA 3LLDA 3BLDA 1T41A 2YCLA 1GOMA 1DPMA 1H7RA 4MGGA 1OCBA 9CGTA 3W37A 4F4RA 3LZ5A 3GFYA 4K68A 4NHVA 1EBHA 1T7LA 1JD9A 3W2UA 4BF9A 4MMWA 3I4EA 2D3LA 1OABA 4HBKA 5CGQA 5IBXC 1KR0A 3GH5A 1U5JA 3QPEA 2AGKA 1V8EA 1KA9F 2WBGA 3SY5A 4DAFA 2A6LA 2ZX5A 3LUTA 3TQKA 4BWLC 1KFKA 3MA8A 2EPNA 3P6LA 1CXKA 2ANUA 1V5XA 4QG8A 4KESA 4LBRA 1JPMA 3WF4A 1E9YB 4ZOCA 3STCA 3GWQA 4HMCA 5LNSA 5F2IA 3U7BA 5LGXA 3SCQA 4YYCA 2OOFA 1YRRA 3UWUA 2DU2A 2E25A 3VNLA 3F5KA 1EPXA 3KOYA 2P3ZA 1Z9AA 5JBFA 2DP3A 1GHRA 3CWHA 3QYSA 3L0NA 1ISYA 1M7JA 2PDPA 3EB3A 4CGTA 1KBLA 4EK7A 1N8IA 1BXCA 2Y7EA 1J79A 1B57A 1WBJA 1A0EA 1VS1A 2BSLA 3LI1A 4K8EA 1C92A 2VFEA 1X8CA 4EVZA 2FTPA 1UP3A 1DTUA 5M03A 3IRDA 2W27A 3KOXA 2FLIA 4LB3A 4WF7A 1DE6A 1TTJA 4DO7A 2DUXA 1C90A 3SGUA 1JDFA 3TDFA 3H7UA 4M1RA 3HPFA 5HJYA 1K9TA 3N04A 3UZJA 1J0KA 2INFA 3TCSA 3KRBA 4FXRA 4IL0A 4DLFA 4NJIA 4FOJA 2PWFA 3ZLHA 1ZGDA 4H4IA 4O8RA 3BGJA 4HNCA 1R3QA 3FHAA 4ZTXA 1UWTA 3Q67A 3O6DA 4PMVA 1ITQA 4ZOBA 3W2MA 6XIAA 3DC0A 1NDWA 4QG6A 2DGAA 4UBPC 4AZCB 2G37A 1PB0A 4A4AA 3W7JA 2YLAA 4W8LA 2VENA 3VPLA 2OWXA 3UZWA 3GXTA 1KWGA 1OM0A 5ABTA 4BS0A 3OZMA 3MY9A 2BGNE 1PS9A 1V7YA 1ZBCA 2XH4A 2ALRA 3L4WA 4U33A 1F6KA 2QMJA 1GW1A 2XFRA 3AC0A 5DT5A 2A5HA 2WMGA 1JGIA 1BQGA 3BXWA 3IV8A 4XZLX 3S1WA 5CCZA 2Y85A 4ICCX 3O15A 3QMRA 1J8VA 3OOQA 3W01A 2P5NA 3W00A 1XKJA 3AHYA 3VO0A 4H9XA 4M6PA 4GFSA 1F7BA 1M7XA 1RBLA 4HU0A 3I6TA 2PLMA 3DHUA 4S3AA 3RIKA 1XIMA 4PUMA 2DSKA 3NPUA 4GYPA 3T8LA 4PZVA 6REQA 2FYMA 1WXYA 4J9JA 5FOOA 4F0KA 2WJZA 2YDQA 1B5TA 5IHSA 5I3DA 3PBVA 2BY0A 2Y8KA 4HPGA 3W2KA 4U3AA 1S2AA 1VPQA 2HISA 4B3LA 1PIIA 1AL7A 3P0WA 3NZGA 2GUYA 3NL6A 1JFHA 2VGIA 2ZX6A 1NWRA 3RM4A 1S46A 5A2BA 1YTDA 1M7PA 3OIXA 5AHEA 3FA4A 1KFBA 1ITXA 1V08A 4O1FA 1F9CA 2PI6A 3M0HA 3OBEA 1GORA 2F84A 3GO2A 1SO6A 2JKEA 3WNLA 2GJXA 1HNYA 3FXYA 1S38A 1JQXA 1YKWA 3PULA 4BEUA 3P5ZA 3W85A 4GZJA 4BF5A 1P5BA 3QTGA 5BRQA 1OC7A 3STGA 3GXNA 3IIOA 1XCXA 4G9PA 2DVUA 2WK2A 4NNBA 4INFA 3APTA 5HUOA 1TPC1 1TJRA 2A7NA 3B9EA 4Z0SA 3QMTA 3CT2A 3OA5A 3MI3A 4NILA 1UR1A 3PZQA 2V3FA 2ZUSA 3W88A 4WSJA 2WSPA 2H9AA 5D2TA 2VRJA 4IH3A 2NXHA 3C0SA 4GGBA 2MUCA 3U2CA 4R9OA 3FJLA 3W2NA 1CDGA 4GQ0A 3HQNA 1LORA 1JCXA 4MAVA 4AC7C 5H8MA 4D9PA 1BVWA 1AVAA 3NTYA 3LCWA 1UP2A 1A5KC 2I1OA 3RRXA 4JQ4A 1UROA 1KXTA 4MDOA 3OG2A 2J88A 2WHLA 1RD5A 4QLJA 3RX3A 3AWOA 4TMBA 5HAOA 4RNJA 4CVUA 4Y7EA 1XL9A 4H6RA 2X40A 4US6A 4Z1YA 4NUWA 1VFUA 4DM1A 3KBSA 5CBBA 1PTAA 2W9MA 1TWDA 1JYVA 4F0RA 3PAOA 4N6EA 3VIIA 4LQ1A 1T6MA 3VD5A 2VUNA 3WBAA 3DEQA 5LNWA 2X2YA 3SY1A 2RDXA 1JI2A 2BG5A 4YJ5A 4PTDA 2DIJA 5CJMA 1QASA 3B8UA 4UNLA 3IVUA 4UQAA 3JRKA 1J0IA 1GOQA 1OHLA 1V03A 2Y89A 4Y9OA 3MI6A 1WKYA 1WPCA 4ZO8A 1OFEA 2FFCA 3MDUA 3RMEA 1BXNA 3M4HA 4HPJA 3WQWA 5U4NA 3PVFA 4A2SA 4C6JA 5FJUA 3GVQA 3U9IA 1LOQA 3SADA 4HOZA 1BVZA 3JUGA 5J04A 4JTGA 4KIRA 2UZ9A 2CETA 1XH1A 3MC5A 3UWWA 1PYFA 3VE7A 3THQA 1QI0A 3VGBA 3NZPA 3UY8A 2ISFA 4HOXA 1QNRA 4F79A 4KWVA 4R33A 4C6QA 3AMLA 3AYTA 2D24A 1UYQA 3M5XA 3WNOA 1OFPA 4KCUA 1MXGA 2VEGA 3TV8A 2XSAA 1Y0EA 3EXTA 3L4XA 1I2PA 1AG1O 2GVEA 2Q71A 4S3GA 4HZ8A 1DVJA 4GIYA 1UD6A 2GQ8A 3WEMA 1XPYA 1ICQA 2HDJA 3ITXA 3D5HA 1TKKA 1UOZA 4LY8A 2R8WA 1P6WA 3H54A 3T4CA 2D2GA 1RCOB 4IFOA 2XIIA 3H4GA 3LXBA 1DWAM 2HZGA 4FNTA 2P53A 3KL3A 4IPLA 4WRHA 1XD0A 2D0GA 3A4WA 3EX1A 1W9XA 4P61A 1ZRQA 1K4HA 3EA3A 5DF0A 4AB4A 9XIAA 1YQ2A 3PUEA 4AH7A 4BR1A 3UZXA 3EWZA 3NQAA 2BHUA 5CBIA 1BYBA 5DXXA 5E9AA 2E5BA 1LQ0A 3GC4A 1PHQA 2QCCA 1MEHA 2V2HA 2POZA 1CYGA 1KWKA 2A3EA 2HVNA 1R9ZA 4ADUA 1PO9A 3H2FA 4PH6A 1V0MA 4HQVA 3BLEA 4U3CA 4B92A 1QNOA 3H2CA 3NQ8A 1OEPA 3QPZA 3F4WA 4WIWA 5C70A 4HA4A 1UKQA 1YBQB 1TV5A 4TO8A 4LT9A 3NQCA 4O1CA 2CLIA 5EKYA 2XGIA 3QZ6A 4PB5A 3D46A 3KVJA 1JZ6A 4ZL1A 3RUBL 1CT5A 3E0WA 4ZTYA 1BSLA 3PBUA 1EP1A 1EUAA 2OXNA 1VYPX 3CV1A 1GVYA 5D37A 2BP1A 3P93A 5C5YA 3MT1A 5JXQA 1EHAA 2VC5A 1W54A 4OIFA 3PWGA 4QFUA 3VDCA 3L9CA 2X16A 3PZ9A 3LRLA 4KEMA 4C1NB 2FPTA 1OZQA 1JYWA 5EMUA 5MKGA 1YMYA 3S1UA 3BCJA 3RFAA 4GFIA 5GNXA 5C7HA 3MSYA 4PCNA 3JVAA 2FZ9A 4O12A 1OD8A 4RE3A 4AZ7A 2V67A 1EC8A 1HKIA 2BASA 1Q6RA 1F5ZA 2JF7A 5BOOA 1AD1A 1JEZA 1H2JA 3O6YX 1XIGA 3GTFA 4AX7A 2NVAA 2D23A 2PDKA 1K77A 1EIBA 2H3DA 3IUIA 1JGMA 3MS8A 2ZX7A 4EPDC 1IYXA 1OGBA 2V8ZA 4WOQA 4DBSA 3ATYA 3ZFHA 2UY4A 2RFGA 3WMSA 3OIHA 1QBBA 3DYOA 3N4EA 2IQDA 1GVOA 2E6YA 1FOBA 5FJTA 3NVTA 1SGJA 3LCLA 4LALA 4S3KA 2FGZA 2PTXA 4OTKA 2F6XA 3M0YA 4DUOA 1X1NA 3WH8A 3GC5A 1XR2A 3N2TA 2YDAA 2QV5A 2Y6ZA 1FWGC 5K9XA 4TVDA 1QI2A 1IT8A 4AG0A 3MKVA 1B9BA 1S5WA 1D3CA 3TVAA 2ZZ6A 2PLCA 3SM0A 3H2OA 3UERA 2ZADA 4QAWA 2VC6A