2MANA

Mannotriose complex of thermomonospora fusca beta-mannanase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
302
structure length
298
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 130
structure length 298
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2manA00
1EH9A 1MVYA 3ARQA 3RO8A 2ESCA 3I3DA 1OGBA 5CSYA 5FCZA 3K4DA 3GH4A 3EDJA 3FXYA 3CZLA 3RM4A 4LYPA 1ITXA 3IAQA 4HA3A 1TUXA 1UZ4A 4ZENA 1C93A 1XD1A 4MB4A 8A3HA 4KMQA 1V6WA 1CYGA 2FGLA 2BS9A 3ZMRA 4GQQA 2G3IA 4FLRA 5HOSA 2E9BA 5CGTA 2Q8XA 2O9TA 3T08A 1QW9A 2D2OA 1ZBVA 1GORA 2J8GA 1ISZA 5A69A 1CGXA 5KEZA 3AI0A 2DT2A 4WIWA 5I3DA 1UKSA 4ATLA 3CIVA 2QMKA 2WVVB 3DECA 5CJ5A 3VNYA 3EDFA 1UR9A 1KWGA 3WENA 3WY1A 1UWUA 2XWEA 2V5DA 4M8UA 3WL0A 3L2LA 2ZOXA 2G41A 3TP4A 1MW1A 3ALFA 2PI6A 3L4XA 4WF7A 1PAMA 1ZBCA 2J62A 3OA5A 1MQPA 3F5LA 3W0KA 2J4GA 4GPNA 2XGBA 2OYKA 2EPLX 4CVWA 2XWDA 3MU7A 4QFUA 3BCFA 2PWFA 4YHGA 1PPIA 2NT1A 3VGHA 5I23A 2AOSA 1K9FA 1CEOA 1W9XA 4HPHA 4QAWA 4E8CA 1IZKA 2JIEA 3VDAA 1AQ0A 1UD2A 2Y24A 3MV11 2XFFA 2ZUVA 3TTOA 4ATWA 1OB0A 1VEMA 4UQ9A 1BPLB 2EBNA 2E8ZA 1OGSA 3FW6A 1CPUA 2BHYA 1PIGA 1W3JA 2VTFA 2VCAA 4H8HA 3SCRA 4QLJA 1EO7A 4W86A 4MADA 4PMNA 1FH8A 5GNYA 3VIPA 2BXYA 1UWSA 3WF0A 3WIJA 1RP8A 4Y7EA 1E71M 1GVIA 4AZHA 1M53A 2XJ7A 4D1JA 3BC9A 2E0PA 2G4FA 1PX8A 3CO4A 4AIUA 5DEZA 3TOPA 2VZVA 1VFOA 3WDJA 5ABGA 4Z2KA 3MSDA 3DYOA 3PZ9A 1QNSA 2DIEA 3MV01 4KRUA 2CYGA 1W1PA 1UOKA 4UFLA 2VVSA 2ZUNA 1QI4A 2WANA 3OG2A 3NSNA 5CLTA 1E4NA 5A2CA 1B3XA 2OSWA 4Q7NA 2WMHA 3JUGA 1HN1A 2YDRA 2EXOA 1UD4A 5EBAA 2J7DA 1UR0A 3WEMA 2VX7A 5KZ6A 2XIIA 5A8QA 4CCDA 4RL3A 5LA0A 1H2JA 3SUSA 3M7SA 4NRRA 5E6ZA 1UR4A 1EOMA 4MJ4A 4URIA 3CUHA 4FLSA 1GQKA 3ARVA 4LPCA 4AISA 5D9NA 3SCWA 4F8XA 1VFMA 1HX0A 4PMYA 3UCQA 1HL9A 1GJWA 1UR8A 4CD8A 1D2KA 3W25A 4ACYA 1E0VA 1DWHM 2VI0A 2BY0A 4LQ1A 2CIPA 2XIBA 3DYPA 1DP0A 1XH2A 3AXIA 1MW2A 5AC5A 1V08A 3OLGA 1BLIA 1V3LA 4UCFA 6A3HA 3FAWA 1PIFA 2YA2A 5A6KA 3O9NA 4JFTA 4D71A 2GK1A 1Q6CA 5I6SA 3VIMA 1BG9A 4CU6A 2YIHA 4DUXA 3MMUA 2WBKA 4MB3A 1E6SM 5CQ1A 3N11A 1ODZA 4JL2A 1E15A 3AROA 3MUAA 5FOOA 1I1WA 3AHXA 2JFEX 3WNKA 1BYAA 5I0DA 4JCLA 5IHSA 1J12A 4AD3A 2DQXA 5HPCA 2VQUA 2ZXAA 4UQEA 1W3KA 3CUIA 2WCAA 3GZAA 3AIEA 4OUEA 1C3FA 2BHZA 4PN2A 1W9VA 1XV8A 1GCYA 2CITA 2EPOA 3AICA 4GXPA 4OOZA 3AXXA 3AIUA 4GZEA 5E0CA 4HU0A 2GFTA 3CZEA 1VBRA 3VDHA 4DUVA 4Z2HA 1HVQA 3WNPA 5BYWA 3AIWA 2X09A 1KGWA 4B9YA 4PMXA 3UR8A 1V3KA 2VR5A 4AXNA 1UR1A 2DT1A 3MS8A 3APGA 1Q6GA 1B90A 1GW1A 3VGFA 2Y5EA 3IK2A 2A3EA 1BVZA 3ZSSA 4HMDA 1DWIM 3WDPP 4D6EA 4GI8A 3WF1A 1JZ4A 1WNOA 1JZ7A 2JALA 4AZBA 2PC8A 4HPGA 2WSKA 2MANA 4JCMA 1RP9A 1H3GA 1CNVA 1FA2A 4CVUA 1JAEA 1MQRA 3OLDA 2XFRA 2CKRA 2NSXA 5D4YA 2JF7A 3W26A 3GTNA 4Q22A 4U3CA 2FHCA 3O6AA 4AZCB 1UD3A 3WD2A 1YQ2A 4PYSA 1NM9A 1GQIA 2YKKA 2BY1A 3KEHA 4UOJA 3AS2A 4W84A 3ECQA 1US3A 4U5IA 1V3IA 1G1YA 1AVAA 1W9UA 4IUGA 3VINA 1WPCA 4L4PA 2CBIA 2FHBA 1CENA 2V5CA 2UY2A 3SCPA 1BYDA 5EB8A 1QHZA 1JI1A 1UYQA 2QMJA 3VKKA 4WKFA 3OGRA 1XSIA 3RJXA 2EEXA 4EANA 1JYNA 4H8UA 5EFFA 2VX5A 1W2PA 2DSWA 3W53A 3PZMA 1FP8A 3N15A 2HISA 1WE5A 4X9YA 4P7RA 4PTWA 2OWWA 4UFMA 1UWTA 3OGVA 3CZGA 1OWQA 1J10A 3T0DA 1MYRA 4W5UA 3EDEA 1OT2A 2YA1A 2YBUA 3B9EA 1MQQA 2X0YA 3ARZA 2J47A 2XFYA 3K1DA 2BNJA 1CXLA 3QGVA 1I75A 4PSRA 3AMKA 2YL5A 2W62A 3AHYA 3HN3A 2C8NA 1QNOA 3WQWA 3AHVA 4AC1X 1UQZA 1OINA 3HU7A 1OD0A 4W7VA 4JFUA 3ARTA 1NP2A 1JYWA 2UWFA 2WMFA 1V0NA 2D22A 1NWTA 1S46A 1W32A 3OIHA 3FHQA 1V0MA 3QHNA 5A6AA 2XVKA 4PCTA 3VIHA 4AD0A 3DC0A 3WH7A 4PMOA 3K8LA 4UNIA 1ZU8A 3D5HA 2QLYA 3UG4A 3VIIA 1O6IA 5ABFB 1MWOA 3AZRA 2BVYA 4P7OA 1G5AA 3WD0A 2DT3A 3GYCA 3ARWA 4H04A 1NOFA 3CHCA 2VNCA 3NIYA 1UH3A 4F9JA 1JNDA 1H5VA 1U2YA 4E8DA 4LYRA 1R85A 4WK9A 4W8BA 3I3BA 2DDXA 1W9DM 4A4AA 4MB5A 3LPGA 2IXVA 3K46A 1NARA 1E6NA 5A6BA 2EPKX 1NWSA 2UY5A 2X0HA 3GXIA 4FLOA 1E4MM 3ZO9A 3M46A 3SEPA 3ZM8A 5M5DA 2J7HA 4UZUA 3RM9A 5IHRA 3RILA 3L4WA 4JHZA 1PJ9A 1TZ7A 2W67A 4JFWA 1CGTA 4AZCA 1ZJBA 5A8PA 1E3XA 1XYFA 2WAGA 2PBOA 1H0IA 4PBGA 3S2CA 4DM1A 5A95A 2J7EA 2F2HA 3MKKA 4PMUA 1XH1A 1CGYA 2BVDA 1KWKA 3F5JA 2VO5A 1J0JA 4Z2IA 3THDA 1QNPA 2DT0A 4RE2A 1F4HA 3AZTA 1ZB5A 3WUFA 1HIZA 4CD7A 2YL8A 4CUCA 4Z2LA 2E40A 2JEPA 1FHLA 2J7GA 3LPOA 1LG1A 3T0AA 2NW0A 3IJ9A 3I3EA 5E0FA 4EK7A 3SUTA 3BSGA 2B31A 1JDDA 4DWSB 2DSVA 1C7TA 3IJ8A 4W89A 5FL0A 4IM4A 3PZUA 3A6OA 1KQYA 4AY1A 1GHRA 5I2UA 3VX0A 3WF3A 3WL1A 2VURA 4UZSA 4D6HA 1CLXA 1JI2A 4PCSA 5D9PA 5CLWA 3UG3A 1U30A 3ZQ9A 1UZ1A 2OYLA 1JF6A 1HL8A 1QPKA 1WAWA 5I77A 1JYXA 3VO0A 3WNMA 5GNZA 5M03A 1K9DA 1EDGA 1VBUA 1TCMA 4JIEA 3LMYA 5ECUA 3UETA 3AJ7A 1V02A 2DSZA 1LL7A 5IFPA 3AQUA 3CZJA 3M07A 1LG2A 4AD4A 3WBEA 1HKIA 5ABFA 4QDMA 2CPUA 1TVNA 3WH8A 4GO8A 4LX4A 1PX4A 2GDUA 2A3CA 5DT7A 1JFHA 1JZ6A 1HP4A 2XVNA 1OSEA 1JXKA 1EGZA 5C71A 3WDIA 5AYIA 3VILA 1EO5A 3AOFA 3VDCA 2WVTA 1V3JA 1KXHA 2F61A 3GXDA 7CGTA 2CBUA 2VMFA 3A4XA 3D3AA 2GJPA 1FHDA 3QHOA 2FDMA 1WO2A 3TA9A 3W38A 1XCXA 2PB1A 4MAVA 5BROA 2G3NA 3BCDA 3GBDA 4U2ZA 3UESA 3B8SA 2WW5A 4W7WA 1JIBA 1VEPA 1NP0A 2EO7A 3AIRA 2C7FA 1BQCA 1E6ZA 4D6DA 3PZQA 3VGBA 3WUBA 1MW0A 1R86A 3G6LA 1Z32X 3F5KA 4IPNB 1AQHA 4CD5A 4S3JA 2WYSA 4M82A 5E70A 4KWUA 5D9MA 1CGWA 2WCGA 1GOWA 1MXDA 3WELA 2BY3A 5HPOA 1MFVA 4AZ7A 1WDSA 1WDRA 1E73M 4QLKA 1LJYA 1TVPA 1V3HA 2UY3A 1EDQA 2V3FA 1ZJAA 2DGAA 3VIKA 2WWCA 1E3ZA 4AD2A 4PEEA 3UEQA 4HOZA 1JD9A 1GJUA 2WPGA 2XVLA 3WD4A 4DWSA 1J0ZA 1Q6DA 1Q4NX 2FHFA 3WH5A 1IV8A 1EQCA 4ZFMA 1E1FA 1JD7A 3PN8A 3WSUA 1JZ5A 2BV9A 2V3EA 4JFSA 4PSPA 1BG4A 4D6FA 1HJVA 4GQRA 3VD3A 1CLVA 3ZOAA 3ZT7A 2Z1SA 1OIMA 3T2OA 3VUPA 5BWFA 4AEFA 2W61A 1HJQA 4W88A 1KCKA 4B9ZA 4UR9A 1E6XM 3NJ3A 3SCUA 1GPFA 1SMAA 4XV0A 1CBGA 5LA2A 4MPKA 3VM7A 4E2OA 1HF6A 2ZUUA 5BCAA 1E72M 2D1ZA 2GJXB 2VOTA 4GZJA 4TTUA 2J78A 1DEDA 3L4YA 1XGZA 1V6VA 5F7UA 5E6YA 2WWDA 1FOBA 1AMYA 3ARRA 1MFUA 4KGLA 3VDBA 4J28A 1WZLA 5A8OA 4WLCA 3K8MA 2VRQA 2CCRA 1QI3A 3AIQA 3A47A 1KB3A 4JKKA 1HJSA 2WVVA 4UOZA 5CGMA 1H0GA 2XSAA 3FHAA 4JZ5A 1TMQA 1XHGA 4HMCA 2OSXA 2VZOA 3WQ6A 3W37A 3SCTA 1R8LA 4CCCA 1AQMA 4FK9A 2DEPA 3N9KA 2Y4SA 2E4TA 2VRKA 2X2YA 1K9TA 2CERA 4F66A 3SCNA 1DWGM 4XB3A 4UFJA 3AMGA 4J3WA 1ZBKA 4AZIA 3OGSA 1KQZA 5A3HA 3LPPA 4OJYA 1OBAA 3A3HA 3KL3A 1BAGA 2IUZA 3PTKA 4YHEA 3F4VA 3CZKA 4CN1A 2WLYA 5LYRA 3RMEA 1LL4A 5C8BB 1W9PA 1VJZA 7A3HA 5I78A 3AIVA 4FLQA 1ISXA 3W81A 4P7NA 1Y7VA 4U2YA 3PHAA 2ZUMA 1JL8A 3WDRA 2ZIDA 5DF0A 2PF0A 4M81A 2ZX9A 2VT0A 9CGTA 4F9DA 2VZSA 2HVMA 1QNQA 5HDRA 1CXHA 1TE1A 2RGMA 3BH4A 3PBGA 5GQBA 1KR1A 3OLEA 2VZTA 1UWQA 4W8AA 2JF6A 1EOKA 4HMEA 4HZ6A 1JXJA 3FY1A 2CNCA 4TUFA 4HZ7A 1HKMA 1ECEA 1KXTA 1EIBA 3AIBA 3S6TA 3WFLA 5AYBA 3QOMA 1L0PA 3N04A 2ZWZA 3VGEA 2EJ1A 1C7SA 4CKQA 3PTQA 1DTUA 4GZIA 4LXFA 2YOCA 1VB9A 1W1TA 4NSBA 2W91A 4ZEPA 1E0WA 2WC3A 3ARSA 4HA4A 2DPEA 2D3LA 1WZMA 5CSUA 1W9BM 2J79A 3CZ8A 4BQ5A 1IT0A 1WP6A 1ISVA 1CTNA 4AYSA 1JDAA 1BFNA 4ACZB 2CHOA 4Z2GA 4AD1A 3MUY1 2GJXA 3TTYA 5DFAA 2YLLA 1E56A 4ZXOA 1GOMA 1QOXA 2W63A 5EMYA 4Z2JA 5A6MA 3KE0A 3VD4A 5DT5A 1V6UA 2W5FA 5A6SA 3T2QA 3SCOA 3TTSA 4H2CA 1RPKA 2DSUA 3ZT6A 4BZYA 2WNWA 3NUKA 2ZUSA 5EFDA 3WBAA 2E8YA 1B2YA 4V27A 2J74A 1XRVA 1UR2A 2A3BA 3POHA 4BS0A 2ZX8A 3OZOA 3VD5A 3AMCA 1H1NA 4C7GA 1B0IA 1L8NA 3FAXA 1V6YA 2CKSA 1BGAA 3EMCA 3RJYA 2WZHA 1ISYA 1J0YA 2BFGA 1A3HA 1JZ8A 2WMIB 2VR4A 2O9RA 4AIEA 5CZKA 1GQJA 4NI3A 1F4AA 3BAJA 3ZSTA 3MUIA 4ZE4A 3L4TA 1EHAA 1DWAM 3LPFA 4AWEA 1UKOA 3BAWA 1R7AA 4WJXA 3ZJ6A 1E4LA 1UA7A 3BMVA 4DWSC 3CHFA 4U31A 5BXSA 1DWJM 5A2BA 2YDQA 2V38A 3EDDA 1J0KA 3T0BA 1E1EA 1Q6EA 4PUEA 3WF2A 2VC9A 2XPKA 3L4UA 1BSIA 1E43A 3DHUA 1ZL1A 2XG9A 4TVUA 3QR3A 3NDYA 4W5ZA 1OM0A 3W6LA 1UKQA 4H8VA 2XGIA 4MNMA 2V3DA 2FH6A 3VX1A 3SCSA 3SCQA 1WKYA 2DIJA 3WFZA 1E0XA 8CGTA 1E70M 2YA0A 2YL6A 2W4XA 5IFTA 4NRSA 4RE4A 5A6BD 1UWIA 5A1AA 1BF2A 4PRWA 3U5YA 2G3JA 4D6CA 2QPSA 4PTMA 4TVDA 2XSBA 5CXPA 4XX6A 1K6AA 3CLWA 2VX4A 2ZX6A 2XM1A 5DO8A 4LYQA 1VFUA 5I5RA 4FMVA 1PBGA 2G3MA 3VGGA 4B3LA 4CGTA 3B9DA 3CHDA 3VD9A 2XUCA 1EDTA 1IZJA 4W87A 3GH7A 1KXVA 3IANA 1SYTA 4W85A 3RM8A 1QI5A 2C0HA 3L4VA 1JNEA 3AYSA 6CGTA 4UOQA 2XVPA 4V28A 1LL6A 1R87A 4M56A 4WSKA 4AD5A 2WSPA 4ACZA 3U5UA 1DHKA 4NF7A 4AZ5A 2WCSA 4CU8A 5AC4A 2VQTA 4GIAA 3WEOA 2V3GA 5AY7A 1W3HA 4UFKA 3AHZA 1JYVA 1SR0A 4UQCA 3HMCA 2BXZA 2ZXQA 2J77A 2D3NA 4X0VA 3TONA 2O92A 1OT1A 2GVYA 4HOWA 5A8NA 2XTKA 3AS1A 4A3YA 1LWHA 5A8MA 2GUYA 3WMBA 3NYDA 3VIJA 2YL9A 1DWFM 4OKDA 2W92A 4A3HA 5BRQA 2VX6A 2YDSA 3AMDA 1XSJA 3VGDA 4QCEA 2EPMX 4P8VA 3VMOA 3GNRA 3AS0A 3WN6A 3AHTA 4AW7A 3AFBA 1VJSA 1KBKA 1QI0A 1E6RA 3PZOA 4WKHA 4JFVA 2AAAA 2WMIA 1HJXA 3GXFA 1JZ2A 2CESA 3SUUA 4CD6A 2D0FA 3HJEA 4H41A 3KL5A 3WDQA 3VU2A 2G8ZA 5FD0A 2CEQA 1O7AA 1LF1A 5FL1A 1W3LA 3W24A 1C90A 1KXQA 1WZAA 3NSMA 2QHAA 1WB0A 3UG5A 5E09A 2BHUA 3CPUA 1PX3A 1ZS2A 1V0LA 3B9AA 2CETA 1PZ3A 5IDIA 2JEQA 4UFIA 3RIKA 2ZICA 1CECA 2E3ZA 2PWDA 1J18A 4OBRA 4D6IA 1B30A 2VJXA 3VTRA 3ZT5A 1QHPA 3DHPA 1UKPA 3RPMA 4AZGA 3CTTA 1B1YA 1E55A 1G0CA 2X05A 5M3WA 3GNPA 1E40A 2Y8KA 4C7DA 1WCGA 4P8WA 3NDZA 5IXEA 2D23A 1QNRA 4MDOA 4M1RA 2WHMA 3BAKA 3WQVA 4KGJA 3CH9A 3BXWA 5JIWA 3PZTA 5CPQA 4B15A 1VRXA 5I79A 1B3ZA 1E6PA 1CZ1A 4MNJA 2AMGA 4NZCA 3ZR5A 4K68A 1W1YA 1FP9A 3VMNA 3MSGA 4MNKA 2YJQA 1UG6A 3TTQA 4AMCA 1GQLA 2GDVA 2PWEA 3CUGA 1B3VA 2F8QA 4W93A 2WZEA 1HXJA 3AZSA 1WZKA 3SUWA 1QI2A 4BCEA 2ZX7A 2QPUA 1X1NA 4GO9A 1XSKA 4UQDA 1QW8A 3WEZA 1UD5A 2GK1B 2OLHA 3EBVA 1OD8A 4D1IA 5CPSA 3SCVA 4U33A 1UD6A 4J3SA 4TOQA 3U7BA 5A2AA 3IAPA 1ITCA 4DWSD 2YBTA 2J7CA 1SMDA 1WDPA 3BSHA 1BYCA 1X6NA 1GOIA 2WMJA 1GUVA 2PWHA 4PMQA 1UA3A 2WK2A 1UD8A 3VIFA 1JFXA 1E4IA 1H09A 1HJUA 2JE8A 1JAKA 4EE9A 1GONA 3W27A 2ZXDA 3J7HA 2CXGA 3W6MA 1H11A 1E5NA 4CU7A 3A4AA 4PMVA 3AMLA 1HNYA 1GZJA 1OIFA 1V6XA 4KH2A 4M80A 3VM5A 1C8YA 4M24A 1H41A 4TX6A 4XZBA 1NOWA 1H49A 4R27A 4GKLA 1ZBWA 2X1IA 2WB5A 1XC6A 4JKLA 2WLZA 4ML4A 3WKZA 1J01A 1OCQA 1HKKA 1KGXA 1TG7A 4BQ2A 5DMYA 4HOXA 1EA9C 3BAXA 3N12A 4P8UA 2J7FA 2VVNA 2WKLA 4LGXA 4N0RA 1CIUA 3WQ8A 4TVCA 3WQ4A 5A6JA 3EMZA 5JUVA 2ZUTA 4U3AA 1M01A 5BRPA 2A3AA 2D0HA 3AS3A 4J27A 3A4WA 3ARXA 4BF7A 4DM2A 3PZGA 3OB8A 3BLKA 5JBFA 4P7QA 4UTFA 2DH3A 5I24A 4EAMA 2GSJA 4JAWA 3OBAA 3T2PA 3CUFA 4KRTA 3BAYA 1G94A 4GI6A 3VMPA 1K9EA 3E1F1 2WHJA 4W7UA 1UH2A 4P8XA 1QBBA 1XH0A 1NH6A 2WHKA 4BQ4A 1D7FA 4ZE5A 1W91A 1I1XA 1V3MA 3WMCA 1C8XA 3SIMA 4AEEA 3ZR6A 3ZJKA 2OYMA 1G9HA 5BXRA 3M6DA 1JGIA 3ARUA 4WKAA 1QVBA 4GINA 1VFFA 3EMQA 3GBEA 4IISA 5JBDA 2Z1KA 1CGUA 3N1AA 6TAAA 2ZE0A 1B3YA 1GVYA 1ESWA 3CUJA 3OZPA 4MDPA 1VF8A 1TR1A 3ARPA 4YPJA 4WSJA 3WD1A 3VOCA 4HU8A 2WVSA 1B3WA 3PTMA 3G6MA 2VCCA 4MTVA 1JF5A 1XCWA 1OGGA 1EQPA 2BY2A 4OBSA 4IPLA 1J11A 4UQBA 2ZXBA 1J0IA 1GOQA 1PEZA 1UKTA 3EDKA 1M7XA 4S3KA 4E4PA 1U33A 4B16A 3N17A 3O2LA 1NOUA 3K4AA 2GJRA 3FN9A 4CN6A 2WC4A 3WD3A 1UH4A 3UERA 4RE3A 3W82A 3ARYA 4D72A 1VENA 4BA0A 5ABEA 1YHTA 3KWXA 2J75A 4ZXLA 3NSXA 5C70A 4MAZA 3W29A 2RGLA 2CBVA 3AYRA 5GNXA 5JBEA 1MXGA 1JDCA 1KR0A 2D20A 4CN4A 4XZWA 1HJWA 4MNLA 1N82A 1D3CA 3PZVA 1RD6A 1P6WA 3U57A 4CD4A 2E9MA 5LA1A 2ZWYA 3W28A 1C8QA 3GDBA 3QOKA 1E5JA 1LQ0A 3L4ZA 4J7RA 2YLAA 1CXEA 1TA3B 3ZJ7A 1QBAA 2WMGA 1FH7A 1VAHA 4H7VA 4GI9A 2Y8VA 4PTXA 1HT6A 3WH6A 1GOOA 3VNZA 4PMZA 4J3VA 3ZJ8A 4J3UA 2XHYA 1C91A 2WXDM 1SFSA 1BGGA 3RDKA 4F79A 1KFWA 3WNNA 5A94A 7TAAA 4D6JA 2FGZA 3KL0A 3NCOA 3BGAA 3EYPA 1LWJA 1QHOA 1B9ZA 1GOKA 2O9OA 4L4OA 4JHOA 1FH9A 1G01A 1BYBA 3WMSA 4B3KA 5ABHA 4U5KA 3VVGA 1CGVA 5JIPA 3GH5A 5E9AA 4V2XA 1E6QM 2EQDA 1V02E 2J7BA 5D9OA 3WQ5A 4HTYA 4UFHA 3THCA 1WDQA 2XVGA 2PWGA 3WF4A 1BVNP 2X8RA 4J3TA 1W1VA 3WNOA 2DH2A 3CHEA 3RCNA 1Q6FA 1GHSA 3UR7A 3MMDA 4C7FA 1J0HA 3BLPX 4J3XA 3WUGA 4EKJA 4X0NA 3CBWA 4UQAA 3MUZ1 3L2MA 5FIPA 4R5EA 5CG0A 4HZ8A 2EPNA 3AISA 2WMKA 1CXKA 2WBGA 4HA1A 3IJ7A 1NWRA 1MW3A 2J8FA 5TD4A 4DUWA 3VD7A 2CBJA 1GNXA 4QP0A 1V0KA 1KBBA 5BXPA 1VIWA 3WDHA 2BVTA 4PMRA 4JL1A 3II1A 1NWUA 3N13A 1JG9A 4TTGA 1XYZA 3WH9A 4OZOA 1H4PA 4PMDA 2WZIA 2PBGA 4FF5A 2CHNA 4AZ6A 1W2VA 2OWXA 4ATDA 4W8LA 3MO4A 1UWRA 1HP5A 2E9LA 1FFQA 1E9LA 3MANA 3DYMA 1HKJA 1ISWA 1FFRA 2WKGA 2IXUA 1KCLA 1M04A 1PZ2A 4JKMA 2A3HA 3CGTA 3QHMA 3U7VA 2VZUA 2XM2A 1J9YA 1BHGA 4M29A 1CWYA 5FKYA 4OIFA 1TFVA 2XYLA 5D8ZA 4CCEA 1VEOA 4HP5A 1CXFA 3WNLA 1US2A 3SUVA 1TA3A 3N18A 4P7LA 1B31A 3BAIA 4MJ2A 3T09A 3PZNA 2WHLA 1EXPA 3VIGA 1M03A 2D0GA 3POCA 4MB1A 2UY4A 2QF8A 2Y2WA 3K8KA 2TAAA 1ODUA 1NQ6A 3GXMA 2OSYA 2W66A 3CMGA 4BQ3A 2DSKA 5HNNA 1UHVA 1X6LA 4D6GA 1CXIA 3GM8A 1R7OA 3AXHA 4XUYA 3ALGA 2JIWA 5M17A 3ZIZA 2FH8A 3MMWA 1CDGA 4TX8A 4YN5A 1HVXA 1A47A 3FNDA 4N42A 4QLLA 3WUEA 2WVUA 1UQYA 2WM0A 2D24A 5HBFA 3VPLA 1LLOA 4QCFA 5GPRA 3KZSA 5D8WA 4PTVA 3OLIA 5BXTA 2O9PA 1RH9A 2VRJA 1BTCA 2QV4A 3GNOA 3BMWA 1UUQA 2ZUWA 1EHNA 4AIOA 1XD0A 5CPTA 2WC7A 2VUYA 2ZX5A 1JZ3A 3W4RA 5A6LA 1V03A 3PZIA 2VCBA 2OWCA 4TXEA 5HXMA 4PUDA 2NT0A 2VL4A 2J25A 1KGUA 3SURA 1C92A 3CMJA 4OOUA 3VIOA
chains in the Genus database with same CATH superfamily
3KZPA 3TOYA 4O16A 4ZFCA 3BURA 3RITA 2FVLA 3GH4A 4E2BA 1ZP4A 3RM4A 2WNNA 4C6KA 4JDBA 1VCFA 4R7JA 3IAQA 4F2UA 1UZ4A 2B0MA 1AH4A 1LOQA 2QUMA 4NHVA 1JGMA 2QEZA 2Y7EA 3A3XA 3P0WA 4AUBA 1XD1A 4GIEA 3S83A 4KMQA 1JPDX 1XISA 2FGLA 2BS9A 5F1VA 4ZQPA 4ICCX 3W7RA 2ZVRA 4RDYA 2R1LA 3DXIA 1QW9A 3N34A 2DZBA 1GORA 3TAKA 3K5XA 3SGGA 1CGXA 2DZSA 3NAVA 3ITLA 4K8EA 3E0FA 3UFYA 1W0MA 3CIVA 3E0WA 1Y65A 3DECA 4E4FA 4ZB2A 5C6MA 1EC8A 2NUYA 3LM3A 1Q8JA 3VNMA 3NPUA 3WY1A 2R91A 2XWEA 5DY2A 1K4HA 2G41A 3BJFA 1MW1A 1PAMA 1JCLA 1JUEA 4Y8FA 3F5LA 3M16A 5FJPA 3L9CA 1W1ZA 4Y9NA 4DO7A 2NQJA 4C1NB 4Q8VA 3SBFA 2PA6A 3QV7A 1YYAA 2XGBA 4CVWA 4GH3A 1XLMA 2L5HA 4UXDA 3NM1A 2AQOA 3G1FA 1MNZA 1G7VA 4QITA 5FEXA 3H12A 1PPIA 2NT1A 4MWAA 3Q4DA 2C1HA 2OPJA 1EC7A 3PWGA 1AQ0A 2PODA 3VZXA 2Y24A 4LAKA 1K03A 3ZWSA 1NAL1 3UWZA 3OQ8A 1WA3A 4LVGA 1E0TA 4ATWA 1OB0A 4DXVA 1ZAIA 2DZPA 1O95A 3MHFA 2OZTA 3GY1A 3FDKA 3M6YA 2OGJA 3W86A 5FJRA 3UJEA 4QLJA 1XIEA 1SZGA 1XL9A 2GSHA 4QE4A 4PMNA 1FH8A 3CEUA 2BXYA 3VIPA 3WIJA 1RP8A 1E71M 3ATZA 2VEGA 5CPNA 3EWBX 1DXFA 2ZZ3A 4MJMA 2ZZ6A 2G4FA 1PX8A 5CC3A 2C3ZA 1W1A1 2NWSA 1W56A 5E1QA 4DRSA 3BQ6A 3U0HA 1V7AA 1XINA 1NF7A 4GFIA 3WDJA 4FIQA 4EF8A 2PSNA 4Z2KA 3ES7A 4JQ2A 2OEKA 4KRUA 2DIEA 1YPXA 4A6GA 2CYGA 4O50A 1W1PA 4UFLA 3UG8A 4GACA 3CIXA 2X42A 2WANA 3B8DA 4Q4MA 5DQPA 3ITYA 1B3XA 3OO2A 1O1HA 4RPQA 1IEVA 3HB9A 5HNUA 1HN1A 4BWLA 3OHMB 3GTHA 4S3AA 3GU1A 1P48A 3WQOA 4CCDA 4GVIA 2DJXA 1M7JA 5I09A 2PTDA 4FXFA 4NRRA 1Q45A 3IIPA 2POZA 4JTDA 4NG3A 3LG3A 1PHQA 4S39A 1GQKA 4HMNA 4PA8A 2YYTA 2BP1A 3BSMA 5D9NA 5BU9A 2VYOA 3NL2A 1UR8A 3C5QA 1E0VA 1YPFA 1XW8A 1E9ZB 3OPSA 3LHZA 1DP0A 1XH2A 3W7QA 2Y62A 2DY3A 4UR8A 5G1TA 2YA2A 4C1NA 3H26A 1T8XA 2XIJA 4I8DA 3KLLA 3ZLFA 1Q6CA 3SI9A 1G67A 3SRFA 2YIHA 3QJAA 3LMZA 4DUXA 3NQ6A 4QS6A 3URBA 1ODZA 1H50A 3LGGA 1EBHA 4JY9A 2J9YA 2OT1A 3AHXA 2RJHA 6REQB 1BYAA 5I0DA 4JCLA 1ME8A 5IHSA 2JQXA 4XBJA 2EG6A 1VYRA 3TWAA 4UTJA 1IXOA 1ICQA 2QXWA 2G50A 3OA3A 4OUEA 1HFBA 1EYWA 2BHZA 4PN2A 1W9VA 1XV8A 3AICA 4HK7A 3LBCA 1B57A 4OOZA 1KM0A 3N4AA 3HV8A 4GUFA 4Z2HA 4RDZA 1KBIA 1LROA 1A5SA 1Q2SA 5CH9A 3W2KA 3EPNA 3O6YX 3VNIA 4JIHA 2X09A 1KGWA 3W1MA 1XPYA 4IT1A 3UY7A 1HGYA 3W84A 2IPFA 2RDXA 5T26A 4D2JA 2A3EA 1Q66A 4HMDA 4LSBA 4D6EA 4XO7A 3VNKA 2WKJA 3ONBA 1JZ7A 4IQJA 4Z1YA 2WSKA 2A6NA 5C9WA 3W7EA 3M0XA 1R3VA 1L6GA 4DBDA 1JAEA 4XKYB 2R1KA 3H70A 2P8BA 4U3CA 3BDKA 3T44A 1UD3A 4NYYA 3S9IA 1GQIA 3KCJA 5AECA 1US3A 3PFRA 3SSZA 1G1YA 3VINA 2R1PA 2UY2A 2IW0A 1BYDA 2P5NA 4HQVA 3BPWA 1XPGA 1Z89A 3O7UA 4WSHA 4UTMA 3OGRA 1XSIA 3PTDA 5H1WA 4KIEA 4LS1A 3MWCA 4EANA 2RKXA 3W53A 4DB7A 3PZMA 3GRIA 2CZEA 1ZLPA 1WE5A 2Z25A 4S1FA 1YE6A 2PDLA 4KESA 3TAOA 4P7RA 3PB2A 4YYFA 1DE5A 1VBGA 3ZVIA 2ZCGA 1J10A 1ITUA 5LGXA 3B9EA 1RVGA 4PUJA 1EX1A 2J47A 2XFYA 4M19A 3QGVA 1MSSA 3KTCA 1HQTA 2PD5A 2RDUA 3AMKA 4PUWA 5D2VA 3WQWA 2IQDA 4MHBA 3TW6A 3UXKA 1S2UA 6REQA 1JYWA 4OWGA 4IQEA 2WMFA 4ADTA 4FX7A 2HBXA 3RF9A 1EZWA 3URQA 1V0MA 3QHNA 5A6AA 4GH1A 4PMOA 4FHAA 3D5HA 4QE1A 5AYXA 3QV9A 5ABFB 3E2VA 3QQWA 2BVYA 3TN3A 4Q4KA 3DI1A 3P62A 3H22A 3ARWA 4HVXA 3QEZA 3L0GA 2D2GA 2F38A 5RUBA 1FWWA 3GIPA 2VGIA 4I5RA 2PGEA 2HCVA 2I9EA 2OQHA 4GXMA 4LCSA 1SFLA 4W8BA 3SN1A 2IXVA 1SM9A 3BMXA 2UY5A 4NXSA 1E4MM 4CNOA 3T8QA 3M46A 4N9DA 3ZM8A 4XKYA 4KEZA 5IHRA 1Z69A 1X38A 1BQGA 2W67A 4JFWA 4QJ1A 8RUCA 1AA1B 1E3XA 2PGRA 3V4BA 3RR1A 1DIKA 1KRAC 3O8AA 2PBOA 1WQ5A 3I4KA 4PBGA 5A95A 3JR2A 3MKKA 1F73A 1KWKA 2VO5A 3IIVA 1QNPA 1ADOA 4IICA 2FZDA 1F4HA 1ZB5A 3WUFA 5L6UA 4WOQA 5G4WA 3TYUA 3N2CA 2BWGA 4CUCA 4Z2LA 4H7ZA 2FTPA 2WZTA 2PLKA 2YXOA 2J7GA 3BW2A 1LG1A 3QYQA 4OFCA 5KSWA 3SUTA 4FP1A 5HATA 4DWSB 2DSVA 3IJ8A 2ZZ5A 4W89A 1TWDA 5DCEA 1AW2A 3HPSA 4K6AA 4ENLA 4WGHA 2X30A 3MC5A 4KCTA 3S4TA 3VX0A 1HO4A 4JICA 4UZSA 4L1GA 1LCOA 1CLXA 1JI2A 1TKKA 3UG3A 3REQB 3VYLA 3WLSA 1UZ1A 1JYXA 2Z2BA 3VO0A 2QIIA 5G2HA 5M03A 3R94A 3UD6A 4JIEA 3LMYA 4E3TA 1S5NA 4Z0SA 3AJ7A 1V02A 3C6CA 1TJ1A 3EWWA 3M07A 1LG2A 4Z1CA 4ALDA 5EMLA 3UR5A 3CUZA 3WBEA 5ABFA 1AG1O 1TRDA 4M6VA 1ADDA 4ZZ9A 1F9CA 2QCNA 4OECA 3RLGA 3P60A 4O0ZA 1B9BA 3V5OA 2A3CA 1F07A 5DT7A 5CBIA 3W1UA 1JZ6A 2XVNA 1JXKA 4GABA 1EZ2A 1LBLA 4CNTA 1I2RA 4QSFA 5C71A 1ENUA 2GUUA 2OVLA 2QDGA 4MWAD 5CZTA 1V3JA 2A21A 1R2SA 3A4XA 1VQTA 3TYAA 3QHOA 3W38A 3ID7A 3LX9A 5D03A 2Y7DA 2EJAA 2G3NA 3QF0A 4NKCA 2I5GA 1AFSA 2YCLB 4ADSA 1OZQA 4W7WA 3OODA 1S5WA 4TIMA 3OEXA 3ZFHA 5CKSA 3WUBA 3JZEA 1RJQA 1XLDA 1K4GA 1SJAA 4S3JA 2WYSA 2Z2AA 1M7OA 3N9RA 3G18A 1U1HA 3N3TA 2VFIA 3M44A 1Q6OA 3VNDA 4S3GA 1E73M 4O1EA 2XFWA 4L64A 1LJYA 3KLKA 3P82A 3T40A 3CYJA 3U2OA 2ZTKA 1TVPA 2GQ3A 4MM1A 3FLUA 2DGAA 1PDYA 3W7PA 3GR4A 4IIHA 4HOZA 2PDGA 3N29A 1NDVA 2WPGA 3WD4A 3QKEA 1Y5WA 4FOJA 4DWSA 1Q65A 2OELA 2NV9A 2FHFA 4H7CA 1EQCA 3M0ZA 1GJPA 1E1FA 3T07A 3WSUA 1QWKA 3C56A 1T8QA 4JFSA 4HSNA 3U2EA 4ZA0A 1KKOA 3RX3A 5CG7A 3ZOAA 3ZT7A 4AEFA 1TTIA 1KM5A 3WJYA 3BGJA 4W88A 1XYLA 2PDWA 4F2TA 4Q4PA 4LAOA 3REQA 1E1CB 5AHFA 2PZ0A 3VM7A 2ISWA 1TWSA 2VOTA 3W1QA 1GYMA 4GZJA 3HQPA 5E6YA 2WWDA 1AMYA 3LRLA 3GHSA 4F48A 4GA8A 4J28A 1WZLA 5A8OA 4WLCA 3TYZA 3K8MA 2VRQA 1QI3A 2H8XA 3AIQA 4DWDA 1KB3A 4Q33A 2ABAA 3MUCA 1HJSA 4ONVA 2ZVIA 3ABOA 2XSAA 3CAWA 1S2VA 3I4EA 3C0SA 2H90A 3PBMA 3SCTA 1WXYA 3EWZA 2ICSA 4LS0A 4Y96A 1K9TA 5DBUA 3NVDA 3G8EA 1DQWA 3GYEA 4RXFA 4F66A 1KLYA 1CT5A 3TNBA 4DJDC 5LIXX 1TRIA 1KQZA 3KBJA 3KL3A 3WLOA 3PTKA 3U6WA 2WLYA 3OHIA 2H9AB 3S6OA 1XG4A 2X40A 2YCLA 1W9PA 1VJZA 4C5ZA 3WLPA 2G3FA 7A3HA 3AIVA 5C0QA 5F2MA 4X2PA 4E5TA 3IS4A 4U2YA 1A5BA 3V35A 3WBXA 2Y85A 1JL8A 3M0LA 3VKBA 4PEKA 4K1WA 3BG3A 1EKOA 3SB0A 1YNPA 3WQCA 4F9DA 4H6QA 2WSYA 2VZSA 2HVMA 2GJLA 1VP5A 2RGMA 1ME7A 2VZTA 2I17A 3GS6A 3IIXA 3UZXA 4HZ6A 3UWEA 2V0TA 3CQKA 2RAGA 4PFMA 3S6TA 1L0PA 3VGEA 2I9UA 4MVAA 1DJXA 1JCJA 4CKQA 4DJEC 3RU8X 4GZIA 2YOCA 5HJXA 3E0LA 2W91A 2OX1A 1E0WA 4HCDA 1KTNA 1F76A 2DPEA 3LBOA 3CZ8A 1EP1A 1XF0A 1E1CA 3G3MA 3W1NA 3AYTA 2A7PA 3B8WA 1BFNA 5REQB 3TZNA 5M2FX 3TTYA 2Z29A 4V1XA 3CV1A 4LAZA 1QOXA 1QPOA 4Z2JA 5HULA 3CUXA 4ECLA 3VD4A 2W5FA 4GI4A 4HHMA 1H1YA 2ZA3A 3S46A 1SJBA 2WNWA 2PS2A 3ZZ1A 4JTEA 2Q6ZA 1OF6A 2E8YA 3ABQA 3S2LA 2O7QA 1LDCA 3ITCA 1B2YA 2J74A 1XRVA 4QNWA 2XIMA 3OZOA 2IQ0A 4LALA 3H6OA 3VD5A 1H1NA 2NQZA 1T7LA 4WY0F 1V77A 1DYSA 3TN4A 4XZMX 4NP7A 4BEUA 3NQ8A 2QJJA 3T4WA 1TUFA 4JTLA 2Z7KA 2H9AA 3O1NA 5I3JA 5BMWA 3LXBA 1DWAM 4FNUA 5CSRA 3LPFA 7REQB 1R7AA 4WJXA 4AHOA 3WJZA 1E4LA 1KCZA 5BXSA 5C2GA 4WEVX 1DWJM 3GDKA 4GX8A 1GEHA 3THQA 1Q6LA 1J0KA 1QJWA 2RDTA 4XQ6A 2EPHA 4NJGA 3WQFA 3LB0A 1SQ7A 3SR7A 5K2ZA 4YVPA 1ZL1A 1QPRA 2XG9A 4W5ZA 4H8VA 1PS9A 2V69A 2FH6A 4S2CA 4DAIA 5F4WA 1FTXA 3OVQA 1CLKA 4QJ4B 8CGTA 1E70M 3UWVA 3CXOA 3B97A 3BJTA 3U4FA 1TPVA 2F2KA 5A1AA 1BF2A 4HJFA 2QUTA 3S47A 2QPSA 5CXPA 1FWBC 1K6AA 4FOUA 1XRSA 2R8WA 4FZIA 1V4YA 1VFUA 5I5RA 4KW2A 1BVWA 1XLEA 3RX2A 3VD9A 1KM1A 1KXVA 3QW3A 4LUSB 3RM8A 4PCPA 3HQ1A 3AYSA 2INFA 3CMFA 4V28A 1DXIA 4EP8C 2Z2UA 4KRZA 3F4WA 4XD6A 3C52A 5SWUA 1IGSA 2PRMA 4O10A 4AZ5A 5F2LA 5G1YA 5REQA 4CU8A 4DAFA 4GIAA 1W3HA 1I2OA 3BG9A 1JYVA 3BVJA 3N6JA 4NZ1A 2J77A 1YX1A 4ZOBA 4X0VA 3TONA 5LNSA 3QPYA 4R9OA 5A8NA 1EJVC 3THAA 3NQAA 3VKAA 2HTMA 1K7XA 1DWFM 4OKDA 4XAZA 4A3HA 1G6CA 2YDSA 4LBSA 1FKXA 1XSJA 4QCEA 3LUTA 4PZVA 5D2YA 1BWVA 3WN6A 4IF2A 1IXQA 1JPMA 1T99A 1Q8AA 5TQLA 4OE7A 3OYZA 3A13A 3NTYA 3BUVA 3PZOA 4WKHA 4JFVA 4O52A 2QGHA 2IKGA 3OP2A 3S0CA 7REQA 3KL5A 2GGEA 3WDQA 3F2CA 1YDVA 3N2MA 2FDSA 3VFCA 1AJ2A 2CEQA 1O7AA 4YCPA 5FL1A 3EOOA 4NVTA 1C90A 1KXQA 2Z27A 1WB0A 2E68A 5EPDA 3ZLGA 3WMLA 3CPUA 2Z1XA 1PZ3A 3QV8A 3B3DA 5IDIA 2JGYA 1WKEA 4IXHA 3T6CA 3SDOA 3PVFA 4RNIA 1A4LA 3GVRA 4TX9A 4FNQA 1GVRA 2ZICA 1H60A 4HJWA 2ZE3A 4LC8A 2Y1HA 3N73A 4WDWA 1RCOB 2J9ZA 1XYMA 2VJXA 1QHPA 3DHPA 4GD0A 2Y7GA 3CTLA 1FCUA 4CNNA 1B1YA 3KAOA 1FVPA 3NO3A 5G4HC 3CAKA 2Y8KA 1WCGA 5K9DA 3KRSA 4P8WA 1NFPA 6ALDA 2ZTJA 3TCEA 1YTDA 1Z8AA 4GKTA 4MDOA 5AYZA 4ZQRA 1W3TA 3CH9A 1JCMP 1Z6KA 2WNZA 2PUZA 3H2NA 3H21A 4WCJA 1FCBA 4LUSA 3M0KA 3W3OA 3H2EA 4K68A 4DBEA 1W1YA 4LF1A 3VMNA 3IJIA 4L1WA 2J9XA 2QT3A 2GDVA 1KRBC 4OBTA 3IJ6A 3CUGA 2F8QA 1JCXA 3V16A 3TH6A 1QI2A 1TSIA 4R3UA 2QPUA 1XSKA 3WEZA 2IPJA 4D1IA 2V9DA 3SCVA 4L80A 1UD6A 4JN8A 4J3SA 4IWWA 4TOQA 3IAPA 3W85A 2Y88A 3DZ1A 2YZRA 4DWSD 1SMDA 4L9YA 4WJEA 2Q3OA 1X6NA 1GOIA 2UBPC 4LRSA 1SGJA 2WK2A 2PP0A 2G0WA 2G37A 3H2AA 4A2SA 2IMRA 1F5ZA 4J40A 2V81A 4JBRA 3GHUA 3INPA 2CXGA 4FXSA 3H2CA 3E2SA 5BRBA 4CU7A 3FYYA 4PMVA 1EWEA 1HNYA 3NWRA 2VWSA 1H41A 4TX6A 3URAA 4KWVA 3FOKA 4OV4A 4H9VA 4JKLA 2W0UA 1IGWA 2ANUA 3WKZA 1J01A 1OCQA 1MO0A 1HKKA 1PDZA 4HOXA 1EA9C 3E74A 3N12A 3GX9A 2VVNA 4N0RA 4B90A 5A6JA 3B0UX 4U3AA 3FK4A 5BRPA 2SFPA 4J27A 1OC5A 3TMLA 4BF7A 4F0LA 3BW4A 3CH0A 4P7QA 5I24A 2QCMA 2GSJA 3OBAA 4R7WA 3K1GA 2WHJA 3GU2A 3MCNA 4P8XA 1NH6A 5C7VA 4LUTB 3OBEA 3KOYA 3GO2A 4DIAA 2A2IA 1G4TA 2QR6A 3ZYZA 1PE1A 3BCJA 5HWJA 1Q7QA 1JGIA 4ICNA 2NX3A 4WKAA 1QVBA 1VFFA 3GBEA 5JBDA 4I9TA 4FI4A 4JHMA 3CL7A 2P76A 1B3YA 2A1YA 4UMCA 1TR1A 4JTRA 4YPJA 4WSJA 3EAUA 3WD1A 4HU8A 3SECA 3I7RA 3SRHA 4OU1A 1JF5A 3KS5A 2BY2A 2VFDA 3KP0A 1Q4WA 1YNYA 4IXXA 2BOEX 4GJIA 2DUZA 4E4PA 1U33A 1RK5A 2GJRA 3A5VA 4MZYA 3R8HA 3WD3A 4LUJA 1UH4A 4RE3A 5I7GA 3W82A 3ARYA 5FSDC 3KWXA 3NSXA 2VEPA 1M1BA 4MAZA 4A8RA 3GAKA 3P7YA 5GNXA 2DZAA 1RCXB 1JDCA 4LBRA 1HJWA 1N82A 3KOZA 2C79A 1JUBA 3PZVA 1RD6A 3GVWA 1FDYA 1RY0A 2GL5A 1E5JA 2D73A 3L4ZA 1YADA 3AYVA 4A2RA 1TA3B 3LCGA 4E8GA 3ZJ7A 2E28A 4XZLX 2WMGA 1VAHA 4MKVA 3GHRA 4GI9A 2OZ8A 2Y8VA 3HPAA 3LD5A 2ZADA 6ENLA 4J3VA 3ZJ8A 3TVAA 2XHYA 3BW3A 3MPGA 1SFSA 1T0OA 1W5NA 4QJ3B 3WNNA 5A94A 1T96A 3MHGA 2YFOA 1PTGA 5BWAA 3FYOA 4N9CA 4D6JA 5AN7A 3A5FA 1QHOA 1XDLA 2O9OA 3RFAA 4JHOA 1OFQA 4B3KA 2GGJA 3AALA 4L7ZA 4KIRA 2PCEA 3N3MA 3GH5A 1UOZA 3JU2A 2DW6A 1Y5XA 1E6QM 4LOCA 4LUTA 3B0YA 4HTYA 4C1LA 1A5NC 2PWGA 4W9TA 3WF4A 2ZRZA 3THUA 4NJKA 2YB1A 4WXZA 4Q8TA 1PZ1A 3RCNA 3BOFA 4GGBA 4NIRA 4DYKA 2QVHA 4JDYA 3TN6A 4J3XA 3WUGA 3RX4A 3BZGA 3L2MA 1MRQA 4HZ8A 1LQAA 3EKGA 2XZ9A 3MQTA 2EGZA 2WMKA 2WBGA 4O1FA 4HA1A 1NWRA 4DZ5A 4QP0A 1KBBA 5BXPA 2YSWA 2BVTA 4AXKA 2OO0A 3II1A 4O4WA 1JG9A 1RVKA 3LN3A 4I6VA 3WH9A 4GLEA 3M7WA 4PMDA 4FF5A 2X16A 2NLIA 3FEMA 4GJJA 1RAKA 1UWRA 3BGGA 4QTGA 3AO0A 4I9MA 3E0VA 3QQ0A 3S1GA 1ISWA 1FFRA 1NVMA 3LGEA 1M04A 3DENA 1G4EA 1TTQA 3LOTA 3QR1A 2ZBTA 1GKRA 5FJUA 2NV2A 1SZRA 3TFXA 1KD0A 4QRNA 4CCEA 1DPMA 1VEOA 2DZTA 2E6YA 4EXQA 4V15A 1Y8BA 4ZQOA 4IIBA 1TA3A 3UBPC 3T09A 2VGGA 2YW4A 3OQEA 3E02A 3E12A 4AF0B 1EXPA 1S2WA 3N4EA 1M03A 5GJNA 3POCA 4MB1A 4KEMA 1J2WA 1XC4A 3RK8A 2J6VA 3ERPA 3LV6A 7XIMA 2W66A 3TQVA 4BQ3A 1ZSXA 1VC4A 5HNNA 2Q02A 1SU5A 4D6GA 1CXIA 1GYLA 3P81A 5U7SA 4CQCA 1TPWA 3CWNA 2ODOA 4TX8A 3KRUA 3P8IA 5BOOA 4CLMA 3FNDA 4LEQA 2WVUA 4RLIA 3I6EA 3MWAA 3LTYA 3MYPA 5HBFA 1W5MA 1TMHA 3TE9A 3KZSA 3R10A 3W1PA 2O9PA 1RH9A 2VRJA 4FX8A 3HPFA 4NJJA 3HG2A 2QV4A 3GNOA 1ALDA 1UUQA 2ZUWA 4XTDA 5CPTA 2VUYA 2ZX5A 1DQXA 4YU1A 5MKGB 4DF0A 2VCBA 1K70A 4LWWA 3V18A 2VL4A 2JK2A 3TW9A 4IIEA 1HGWA 1UBPC 1SW0A 3L5AA 4RW5A 5FEZA 1TB3A 3VIOA 1NSJA 3M0IA 1EH9A 5FAJA 1MVYA 3ARQA 5H8PA 4YJ5A 5K4ZA 1ECQA 5CSYA 1A5MC 1EB3A 1ITXA 1W31A 2NVAA 3WZ0E 1TUXA 4FS9A 2BB0A 4ZENA 1XLBA 3NOYA 3UZJA 2E6DA 4JIRA 1Z44A 4MB4A 1V6WA 1OEPA 4GQQA 3F7JA 3CASA 1SSDA 3FA3A 3RCMA 2Q8XA 3QZEA 4DHGA 1ZBVA 4PB3A 2J8GA 3HJZA 3SJ3A 1POJA 4GCAA 2PDMA 4I5UA 1OFDA 4IQLA 2F6XA 1R2RA 1UKSA 5BW6A 4JTSA 5CJ5A 2XDFA 3VNYA 2R6OA 4AF0A 1KWGA 2TMDA 4M8UA 4AB4A 3S5NA 3ALFA 1V7YA 2QCEA 2PI6A 2ISDA 2V2DA 3TR2A 1W5QA 1ZBCA 3OA5A 3W0KA 2J4GA 4GPNA 2XN1A 5GVJA 2OYKA 5T91A 2QF7A 3BCFA 3JVAA 1GWJA 3MCMA 1KV5A 2XIOA 5FJJA 2I1OA 3RG6A 5I23A 1K9FA 3FX4A 4AU0A 5LKYA 1MZRA 4E8CA 1IZKA 4JTTA 4DN1A 1UD2A 4P2VA 4R34A 4GQBA 4NYUA 3G0UA 1UZHA 2ZUVA 4Q7BA 4HK6A 3GZ3A 3TTOA 3I65A 1BPLB 1XIGA 4S3BA 2E8ZA 1TV3A 3R12A 1BF6A 3K13A 2BHYA 1PIGA 2PLJA 3USBA 4R9XA 1KW1A 5LNUA 1E51A 4O4VA 5MKGA 1EO7A 4NZJA 4W86A 3GG0A 3KDNA 4Y7EA 1GVIA 1Q7MA 2FFIA 3UT0A 2XJ7A 3S5ZA 2P0IA 1UPMB 2E0PA 4Q4QA 3EEZA 5DX7A 3CO4A 2ALDA 2HWGA 2PDCA 3MHUA 2FPYA 2EF9A 4B4HA 3H4XA 1VBJA 3D3FA 2FFCA 1XXXA 2PDKA 3MSDA 1QNSA 3MV01 4K7VA 3DERA 3E5BA 5C2CA 4CQBA 4A8LA 1UOKA 4FR1A 2ZRVA 2VVSA 3OG2A 4BKNA 1TX0A 1E4NA 1SJCA 1U1UA 4Q7NA 3O3RA 3JUGA 3QY7A 2J7DA 3WEMA 1J6OA 2VX7A 2GLKA 3BICA 5LA0A 4HIBA 4XG1A 5IRPA 4A3UA 5E6ZA 3CQIA 4X63A 3CUHA 1OFAA 3VABA 3ARVA 3V0SA 4Q3MA 2OB3A 2GVLA 4F8XA 1VFMA 3MCOA 4BJHA 3GTXA 4DQWA 3NQBA 3NZPA 4CD8A 3W25A 4UIOA 1DWHM 2VI0A 3BJSA 2XIBA 4UTWA 1V08A 4IMAA 1V3LA 3HOJA 4S38A 3UPMA 4DO5A 5A6KA 4JFTA 1RA0A 4Y6GA 3HURA 2GK1A 1TJPA 4CU6A 5I3KA 2EAWA 4ZOAA 4HB7A 1JPHA 4Q4OA 4TMBA 3N11A 2ATMA 1E15A 2ACSA 4YWSA 4UTTA 3MUAA 1I1WA 3WNKA 3V5FA 4NASA 4IIFA 5XIAA 1F8MA 1EA0A 2NUWA 4AD3A 2DQXA 2VQUA 4O0QA 2KX9A 1FWJC 1C3FA 2Q01A 4DUOA 4NJHA 3A3WA 3I6TA 3AIUA 3E6EA 2OEJA 4LAUA 1VBRA 1HVQA 2GJNA 3WNPA 4MSSA 3DFPA 1FXPA 2GWGA 4C6LA 2BGNE 3QFEA 5BNKA 4PMXA 2VR5A 1THFD 2DT1A 3MS8A 1D8WA 1B90A 3M9YA 2KAUC 2FZMA 2V63A 4HU4A 3LZ5A 3PJTA 1DWIM 1AUSL 4GI8A 1JZ4A 3ES8A 1F2JA 4WY0B 4D9PA 2JALA 3ELFA 4FXJA 2PC8A 4AZBA 3DGRA 4LVBA 4OV9A 3GQYA 1MQRA 2O55A 1V8EA 1B54A 2NSXA 2R9RA 3W26A 2DVUA 1UZDA 2OXNA 4Q22A 2HPMA 2FHCA 5CC6A 1ZALA 4Y90A 3WD2A 4PYSA 3G3DA 1NM9A 4C65A 2YKKA 4W84A 1UMYA 2ZDSA 1AVAA 5FA5A 3KVLA 4L4PA 2CBIA 1CENA 2V5CA 5EB8A 3ZS4A 3H7RA 1QW7A 1JI1A 4C6MA 3VKKA 4MWAC 2MUCA 3PBYA 4Y2WA 2VFEA 4XSMA 3B03A 4X60A 2EEXA 1JYNA 4YVXA 4H8UA 2VC7A 1W2PA 1FP8A 3N15A 5E0KA 1A50A 2FYMA 3EOEA 4PTWA 2VWTA 4XZ9A 2GGIA 3CZGA 3LDVA 3LERA 4RE0A 4DPPA 4GY7A 2YA1A 2VOMA 3UXLA 2YBUA 3VOIA 4KF1A 4AQLA 2QAFA 3FJ4A 3STFA 4QS5A 1CXLA 4LCRA 4PSRA 2YL5A 3AHYA 5CGQA 3TMQA 2C8NA 1QAPA 2HPIA 1OINA 3JZUA 3ARTA 1NP2A 2UWFA 2D22A 1S46A 3EX1A 2DW7A 1W32A 3OIHA 3LZ3A 2XVKA 2Z6IA 2QDHA 4GVGA 5AC8A 3WH7A 2VKZG 1D3HA 5CCZA 1O66A 2WJEA 2V2CA 1AL8A 1O6IA 3MTWA 2C71A 5FF2A 3U9IA 3U3HA 4XD4A 4P7OA 3WD0A 2BDQA 4J4KA 2DT3A 4RUBA 1MDLA 1YXCA 3GXPA 3CT2A 4BWLC 3CHCA 2VNCA 1OYBA 1UH3A 5HMEA 4F9JA 1U2YA 3G24A 4A3QA 2Q8LA 1CX9A 1F6PA 1QMLA 3KUMA 3G0XA 4YTRA 1W9DM 1PSCA 4A4AA 1K7EA 1E6NA 4WY0A 5A6BA 2DZWA 1XIJA 2C91A 3F4CA 2G96A 3ZO9A 3DHFA 1F05A 3RPDA 4AVNA 5M5DA 2J7HA 4UZUA 3RM9A 1MUMA 3L4WA 4RV3A 1XYAA 1PJ9A 1P5BA 4B5NA 3VOHA 1LORA 4C6JA 4ZOEA 4S2BA 2AMXA 5GJMA 3TXZA 4B5VA 3AXMA 1REQB 3S2CA 1OADA 5T9BG 5FF0A 1OCJA 1XH1A 3H8AA 2BVDA 3F5JA 1J0JA 3FJ6A 1NDYA 2P3ZA 3AZTA 1KCXA 4JPGA 3PPFA 4PB4A 2YL8A 3TTEA 3VAVA 4QEHA 1XGEA 5CBBA 1FHLA 1SFTA 1W5OA 4C6QA 2DV0A 3LPOA 2NW0A 3IJ9A 3I3EA 4YTUA 5E0FA 3QZ6A 4EK7A 4L6DA 3QZAA 2H8ZA 1C7TA 1W6TA 4NUWA 5FL0A 4O54A 1TE6A 4DF2A 3P93A 1LOSA 3A6OA 5G1MA 3MY9A 2DZUA 3SJNA 1QPNA 2FGBA 2I5IA 3L2IA 5JXQA 3JRKA 3GG1A 2DJLA 1S39A 5CLWA 5LHFA 1UBSA 3ZQ9A 2OYLA 5I77A 1QPKA 1P6CA 2W3ZA 1OJXA 3QR0A 5GNZA 3VUSA 3OOQA 1OFPA 1L6WA 1RXOB 1K9DA 2PDJA 2V5JA 3B9NA 2OOGA 1XLJA 2G95A 3W1TA 1VBUA 4LY4A 1EJWC 3OU8A 4FSAA 3AQUA 3B05A 2ISFA 4O13A 1HKIA 4O12A 4JTAA 1EF2A 1TREA 1VCGA 2Q3RA 2CPUA 2OTDA 3EX6A 1TVNA 1PX4A 3S5SA 4KKXA 2GDUA 4IJCA 2BLEA 1JFHA 3EKZA 1HP4A 2QPXA 1EJTC 2OZ0A 1EGZA 4KEVA 4B5SA 2HXTA 1EO5A 5LNVA 4GVFA 3ONCA 3GXDA 2DZXA 4Y8EA 5JVLA 2QJHA 1XLAA 3ITTA 3D3AA 4D8ZA 1Q5MA 4H19A 2PURA 2Z7GA 3TA9A 4C6FA 3FEQA 5C55A 5EYWA 3T55A 4GQ0A 3BCDA 3UESA 3B8SA 4B4FA 4ILSA 1ZY9A 3E49A 1REQA 2WQDA 2C7FA 1GYNA 1NEYA 5LHEA 4UC5A 1BQCA 1E6ZA 4D6DA 3CS2A 3W88A 4GNVA 1MW0A 1R86A 3VZYA 2W79A 1Z32X 4IPNB 1TPDA 4GYFA 4M82A 4DF1A 1TPC1 2WCGA 1GOWA 1IEQA 2BY3A 4FNTA 4C1KA 1WDSA 4IP5A 4JIQA 1KFEA 3W87A 3Q37A 5CPOA 4DO4A 2INEA 1PIIA 2V3FA 3GVGA 2DUXA 3TLLA 4AD2A 1RV8A 1SO6A 1Q6DA 4MZ1A 1VFTA 4MYXA 3RGTA 3WO8A 3T81A 5FJTA 4ZFMA 4M6UA 3PN8A 2BV9A 2EG8A 2V3EA 4PSPA 1BG4A 1JRCA 5JU6A 1CLVA 1NY1A 5TBOA 5BWFA 2Q71A 4QDWA 4UB9A 2W61A 3Q58A 1HJQA 3W7MA 4KWWA 4B9ZA 6XIAA 4UR9A 1E6XM 3SCUA 4NT0A 1SMAA 4Q8PA 3QV6A 1L8PA 4MPKA 1HF6A 2ZUUA 5BCAA 2D1ZA 5DCBA 1JPKA 4ASTA 4O14A 2PU1A 1BWLA 4I5XA 4NY2A 2Z0IA 1K3UA 1FOBA 3CEPA 3FVMA 4KGLA 1P1MA 3MBDA 4ML9A 1MI3A 4CEUC 2WVVA 4UOZA 1GVEA 5G4EA 3FHAA 5LIWX 1Q6RA 2OSXA 3W37A 1R8LA 2DEPA 2E4TA 2X2YA 2CERA 3SCNA 5KZEA 4L4MA 3W7CA 2G97A 1EUAA 3TX9A 3OGSA 1M7PA 4BK9A 5A3HA 1SJDA 4OJYA 6TIMA 4DO6A 1GW9A 4DY1A 4YHEA 1MEIA 4MY9A 4CN1A 4UNKA 2E6FA 1JQVA 3H4WA 1LL4A 5C8BB 1UP3A 4HGXA 3O06A 3IARA 4XBKA 5D30A 4FLQA 3GC4A 2QZRA 2X2GA 3USZA 3W74A 2CZ5A 1AZ1A 4G2DA 1R3QA 2PF0A 4M81A 2ZX9A 3OVRA 3M4HA 5F2GA 3QY8A 3F2BA 3DKLA 1QNVA 1CXHA 3JS3A 3E9AA 3OLEA 1UWQA 4W8AA 4GNJA 1EOKA 3RAOA 1HKMA 4HKPA 3HPZA 3N04A 2ZWZA 4EXBA 3GDRA 1DTUA 1TVLA 3SW6A 1WXJA 3ARSA 2Z00A 2D3LA 4NNBA 2QULA 3MP4A 3UA4A 4PUUA 2A0NA 1DIOA 1J2BA 3TSDA 4MLJA 5J5RA 2ZYFA 3T4CA 4AD1A 3Q2DA 1ZCOA 4OQVA 5HWMA 4YL2A 4ZXOA 4KFNA 5EMYA 3KE0A 1V6UA 4WGXA 5JMUA 4H2CA 3R7MA 3DFHA 3AWNA 4HYVA 2FB3A 3E2RA 3WBAA 3NQ7A 4LCQA 1VD6A 4F0RA 1HG3A 5T8GA 4DXKA 2ZX8A 1UASA 1YNQA 2XN0A 4C7GA 1B0IA 1KFJA 3IIZA 1XYCA 1BGAA 1ISYA 1J0YA 2H6RA 3FDGA 3KS6A 4RXGA 4AHQA 4AIEA 5CZKA 1EC9A 4NI3A 3KBMA 3IRSA 3RHGA 1ADSA 3L4TA 4ZE4A 3EPMA 3P8JA 4RW3A 2E67A 4AWEA 3B04A 4F0MA 1XG3A 3EXTA 2XZ7A 4I7WA 3TJLA 3DG3A 4DWSC 3MKVA 2NQ5A 5A2BA 3D6NA 1UPPA 4L6OA 3LQGA 3C0JA 4KEUA 4LVDA 2XPKA 3L4UA 3LYEA 1I2PA 3G1VA 1LWIA 4NX5A 3W6LA 1OM0A 2JKPA 3U4AA 4BF9A 4PH6A 4QM1A 4MNMA 3VX1A 2DIJA 3MZNA 2CLKA 2YA0A 5XINA 2YL6A 3S6DA 5DANA 4NRSA 5A6BD 1UWIA 2BMBA 2G3JA 5ENLA 4GZ7A 1RBLA 4PTMA 3F1QA 2XSBA 4A21A 2VDIA 2VX4A 4XIAA 5DO8A 2CC0A 1JULA 1O4UA 1PBGA 2G3MA 3VGGA 3U2CA 1EDTA 1DJYA 3GH7A 2GYIA 4W85A 1RCQA 3C3UA 1QI5A 1JRBA 5K9CA 3MVIA 6CGTA 2O4QA 1LL6A 3FCPA 4J9JA 4E2VA 3P80A 5H6HA 3H24A 2V3GA 4UFKA 1YDNA 3Q65A 3AHZA 3IIOA 3G1XA 5EMKA 3V1PA 3B8IA 3HMCA 2BXZA 2ZXQA 3PFMA 4XSLA 3VOJA 5JH2A 3FIGA 1AH0A 4X9SA 3SFWA 1PYMA 5K7JA 2XTKA 3RXZA 5MHBA 1DJNA 4A3YA 3IUDA 1LWHA 1H62A 2Z4GA 2XH7A 5A8MA 1OVDA 3WMBA 3PJXA 1VRDA 2YL9A 2NXIA 2Q09A 4WVXA 3CL6A 3VGDA 2EPMX 1FX6A 4YLWA 4J3ZA 4C6NA 4E6MA 4AW7A 3H55A 3S5YA 2FMOA 3NQ2A 3C8FA 2HXUA 3EA3A 1SFJA 2AAMA 1KBKA 2AKZA 2AAAA 4N02A 1XJBA 3TU9A 1M41A 1JZ2A 3SUUA 3HJEA 1W1B1 3IVSA 3VU2A 4LB4A 1LF1A 1KFKA 5DY3A 5DBTA 1KO0A 5E09A 1ZS2A 1EEXA 4EWJA 3FVDA 3KBWA 4UFIA 2A5HA 3QPZA 4OBRA 4DJEA 4NJIA 3SQLA 5D37A 3RPMA 4LF2A 1O5KA 3FFSA 4HNNA 3N2OA 1GPWA 1PO9A 2J6XA 4UUIA 3GNPA 1XBXA 3NDZA 5IXEA 4QDPA 1QNRA 1KM4A 4ZQCA 1SUXA 1AH3A 4M1RA 2OGYA 3MYOA 2FLIA 4N6EA 3WQVA 3WFAA 9RUBA 5JIWA 3PZTA 5CPQA 1OYCA 5I79A 1I8JA 4X22A 1CZ1A 1XDJA 2AMGA 2WSRA 2VEKA 1FP9A 1SW7A 4X61A 4Q6XA 3MSGA 1S1RA 2YJQA 1QT1A 1UG6A 5AB3A 1TV2A 3H53A 1GQLA 4XISA 1SPQA 1G69A 2PGWA 3MJMA 2WZEA 3AZSA 5F1UA 3SUWA 2GGGA 1X1NA 4GO9A 5CJMA 4M1BA 4U33A 3QTGA 5HJLA 9XIMA 3G5EA 4HN4A 3RN6A 5A2AA 4E4UA 5EGRA 3VDGA 2J7CA 1EIXA 2VC5A 4GYKA 4DZHA 4FA3A 1UA3A 1LBMA 4JQ3A 1JFXA 1J8VA 4QQUA 1VFLA 4EE9A 1GONA 1KV8A 4LYKA 2QV5A 3T1GA 4H9TA 3A4AA 4HNVA 1PTAA 3WLIA 1V6XA 3GK0A 3MI3A 4DBUA 2PLMA 1NOWA 3WG6A 3DFSA 1JEZA 4R27A 1UCWA 4GKLA 2X1IA 2WLZA 1BRLB 4IP4A 5D38A 2AL1A 1Z42A 1KGXA 3ITVA 1F6KA 3EEGA 4GUHA 3CWOX 4P8UA 1CIUA 3OZMA 4TVCA 3CV2A 1CCWB 5JUVA 3LLXA 3QW4B 1M01A 2B81A 3B8TA 1T40A 1YXYA 5H2ZA 1GGOA 2PPGA 1TJ2A 1YRRA 5H8MA 3S2NA 4IGSA 1WDWA 2NXHA 1UMLA 4US5A 3VK5A 3PZGA 3L67A 2ZA2A 1GEQA 1Z41A 3TJ4A 5DMLA 1RJRA 4JAWA 4KRTA 4YTQA 3E1F1 4W7UA 4F0KA 4AVOA 5K4XA 4HNTA 3L7RA 1UROA 2WHKA 4BQ4A 2OX4A 2C16A 2BBFA 2HROA 4C5YA 1QO5A 3QPEA 4JX4A 2J66A 1G9HA 1FHUA 3PNUA 3R79A 4B3ZA 4GINA 2FJUB 1X6UA 3EMQA 4RZ4A 5FF4A 2Z1KA 1CGUA 1ESWA 4MDPA 4ADUA 2PP3A 3ARPA 2QCFA 4XVEA 3PTMA 1TJRA 4GY1A 4MTVA 1TMLA 1XLCA 1EQPA 4GUJA 4OBSA 2IPGA 1J11A 4CNSA 2QGYA 3VXGA 4H9XA 1J0IA 1GOQA 1PEZA 4JD4A 4MJZA 3W73A 2I7GA 3PJUA 1XIIA 2D2JA 1Q63A 1XLFA 4ZB0A 1TIMA 4OUIA 3V3WA 1X39A 4MUZA 2WV8A 4ROPA 4CN6A 3IV8A 2R94A 3ITGA 2QNEA 3DEQA 2P0OA 4N9EA 1VENA 5ABEA 3UVIA 2X1TA 2J75A 5C70A 3W29A 1KTCA 2RGLA 2GWNA 4W4QA 2CBVA 5JBEA 4A8NA 1MXGA 4CN4A 4MNLA 2AQWA 4GIRA 3U57A 4ZQMA 1H7XA 2Z1VA 2ZWYA 1J79A 4RDWA 3NZRA 4Y9AA 1CXEA 5DLCA 4H4IA 1J6PA 1BRLA 2CHRA 4QG6A 2OQYA 1X8FA 1HL2A 2I5QA 4H7VA 3FV9A 3QMTA 4PTXA 3ISIX 4DZIA 3VNZA 3PG9A 3A23A 1NU5A 1VGAA 2HQAA 2J88A 3RDKA 3EWXA 3IWPA 3P0XA 1IWBA 1DIEA 2P8CA 3V1HA 4QIUA 3SY8A 7TAAA 3HV9A 2O7SA 4IIGA 3KVMA 3KL0A 1D7KA 3EB3A 4XAFA 4IMDA 1B9ZA 1GOKA 4YVVA 4AVFA 3WJXA 2VDGA 4MLRA 4MMWA 3WMSA 1P7TB 2ACQA 4IHCA 3QSTA 4U5KA 3PSWA 4L1XA 1A4MA 2C6QA 5E9AA 4IG2B 4V2XA 1NFBA 4EPEC 2J7BA 3WQ5A 1FWAC 3THCA 1WDQA 3AC0A 3ICJA 3GC5A 2P3EA 2X8RA 3K30A 4J3TA 1W1VA 4RZ5A 5KETA 1A5KC 3BLDA 3S2JA 2DH2A 2FTWA 1Q6FA 1GHSA 1LYXA 2JKAA 1N2VA 4C7FA 1J0HA 5AOUA 3V36A 2RDWA 1R5YA 4UTUA 3BLPX 3GFYA 3KRBA 4R5EA 4XAGA 1ZCCA 2B4GA 2ON3A 3KTXA 1P0BA 2OU4A 3UPWA 4UWMA 3IJ7A 3R8GA 3SGZA 5TD4A 3A9BA 1V0KA 3S3GA 2EHHA 3C61A 4I6KA 2TODA 3FYPA 3G0SA 3PP7A 1GQNA 1XYZA 1TPB1 4Y9MA 2PBGA 1J93A 4PE8A 4DZAA 2XU2A 4AZ6A 1W2VA 2CLPA 1E0UA 4G56A 2E9LA 4A22A 1IEXA 1EGMA 5TAOA 4QNEA 4JKMA 1I6NA 4R7OA 3U7VA 1J9YA 1BHGA 3SY5A 5FEPA 1LZOA 4K1GA 3W83A 3VE7A 3B4YA 1CWYA 1TFVA 2XYLA 5LNRA 1XLLA 3TSMA 5HNRA 3LCLA 5D8ZA 1EEPA 4M6QA 3CT7A 3WNLA 3C0QA 1W1IE 3N18A 5HR7A 2PTXA 3DHDA 3PZNA 2ZDRA 3PUEA 1M9HA 1K02A 2Y2WA 1B4KA 3K8KA 1W5PA 1O68A 4DJDD 4XKMA 2OSYA 3GXMA 3CMGA 3MI2A 4OT7A 1NIUA 2DSKA 1UHVA 1X6LA 3RU6A 5J5DA 1MUCA 3ZIZA 3W7IA 2PCQA 3MMWA 1P7TA 1A47A 3B0XA 3NFUA 4N42A 1P1XA 4QLLA 4IG2A 2WM0A 2YR1A 5DCDA 1DORA 3DIPA 3OYXA 2WZMA 3VPLA 2O0TA 3TQKA 4JTJA 1KBLA 1LLOA 4QCFA 5GPRA 4JYDA 4CNPA 4PTVA 1ICPA 3W1XA 3L0KA 1BTCA 1X98A 5KITA 3IJQA 3TJXA 1OK6A 1FWFC 3ORWA 3WLHA 4AIOA 3TEVA 2NVCA 4PRTA 1VH7A 1MUWA 3PZIA 4QJ5B 2RFGA 1Z3NA 4K36A 4MKNA 5HXMA 1WDDA 3NG3A 4PUDA 3LRMA 2QCHA 4LT9A 1KGUA 1XUUA 2VM8A 4O1DA 3SAZA 3W72A 4DJED 1E9YB 3DN5A 1KFBA 3RO8A 3TYDA 1UR3M 3VFLA 5D05A 3PBVA 3G1YA 5FCZA 4FNSA 3EDJA 3FXYA 3CZLA 5I03A 2NV1A 4DYJA 4LYPA 4N4QA 2DVTA 4HA3A 4GBUA 2QCGA 1C93A 4H2HA 2OLAA 4FALA 3IEBA 1A5LC 3DU0A 4GUIA 1AMKA 2J24A 1NQKA 1TPFA 1TCDA 2YXGA 3ZMRA 1W17A 1EBGA 2G3IA 5HUPA 4FLRA 3HF3A 3Q45A 2O9TA 3CJPA 4GMEA 3HQOA 1OHLA 2D2OA 5I3IA 1FWSA 1QXLA 2VFGA 4X3ZA 1ISZA 1S1PA 5A69A 4JTUA 4HTBA 3W2LA 2DT2A 2HS8A 4PUNA 5I3DA 2CU0A 1XR2A 3LBMA 4GVHA 2OFJA 3SY1A 3LEPA 3V0UA 5CC7A 1UWUA 4FXRA 2V5DA 3WL0A 3L2LA 3TP4A 1RALA 3L4XA 4WF7A 3B06A 3LSCA 3QM3A 2J62A 3NPXA 1MQPA 4ES4A 2FMNA 3T8LA 1A0CA 1I45A 4JX5A 2EPLX 2XWDA 5HMSA 3CQHA 4QFUA 1IT8A 4DI9A 2F7FA 3LXCA 1R47A 4P5UA 4R53A 2I56A 4XUGA 1W9XA 4QAWA 3RCYA 3VDAA 4HPXA 3MV11 1O12A 2YCIX 5D2WA 2O56A 1VEMA 4UQ9A 1PKMA 4S3CA 4DJFA 1OGSA 4MFEA 1CPUA 7ENLA 1D8CA 2FZ8A 2VTFA 3UWYA 5I06A 5AC6A 3CL8A 1EP3A 4AEOA 2YX0A 4L65A 1IQ8A 4MADA 5GNYA 5IBXC 1UWSA 3PC0A 2NVDA 2Y63A 4PR4A 4S3DA 4GUGA 5CZ0A 2TYSA 4US5D 4XZHA 4AIUA 4Q32A 1HKVA 3TK7A 2YCEA 3BLFA 1PHWA 3CQJA 2Y70A 4UMBA 3TV8A 1VFOA 3SQSA 5ABGA 2Z24A 1XICA 4MY1A 1U1JA 3CIWA 1QI4A 2PDNA 4YTTA 2KZHA 1TIWA 5CLTA 5U4NA 3MBFA 2OSWA 3LXAA 2A4AA 3WK0A 2YDRA 2EXOA 5EBAA 1DXEA 1UR0A 3N9SA 5KZ6A 4JXCA 2XIIA 4DBWA 3GW0A 5LZLA 4IL2A 3H2OA 2YFNA 4JTCA 3SUSA 1JCNA 2WPBA 3F03K 4FLSA 3M43A 2AKMA 4QR6A 2Y7FA 3T7VA 4RZBA 1L9WA 1GJWA 1EJRC 1D2KA 1ONEA 1GG1A 4HCHA 2CIPA 3DGBA 3W75A 3SSJA 3FKRA 4EPKA 3DYPA 4B92A 4CEXC 3AXIA 5AC5A 4I8YA 4UCFA 5CEWA 3UWQA 1XIFA 4WR3A 3FAWA 1EPXA 2QCLA 4LNYA 3O9NA 1QUMA 1OFBA 4D71A 3L68A 3QRHA 4O1CA 3IUHA 4GOAA 2PWUA 2QCDB 4O17A 3VIMA 1BG9A 2FZ9A 3HTWA 1ZAHA 3MMUA 3DUGA 4HHPA 2WBKA 4MB3A 1E6SM 4ORIA 4J2MA 4JL2A 4NQ1A 3AROA 1KM3A 4M7SA 1AZ2A 3UJSA 3V0TA 4PCNA 1J12A 3DI0A 3P84A 4UQEA 5LNWA 1OG6A 4O28A 2WCAA 3AIEA 1ICSA 1M5WA 4DNHA 1GCYA 4LVAA 4GXPA 4H1ZA 3DC8A 3L12A 4IFOA 1XKJA 3QMRA 4GZEA 4HU0A 4UR7A 4DUVA 4KCWA 5BYWA 4ZBCA 3VC5A 4JN7A 4B9YA 3UR8A 1V3KA 1ITQA 1AK5A 4K38A 1GW1A 1H7OA 4QHRA 4R88A 2OQLA 2IPWA 3IK2A 4IMCA 3EXRA 3GAYA 3WDPP 1RR2A 1S2CA 3TWBA 1ZJHA 3WF1A 2WQPA 1ZGDA 4FNRA 3LHWA 1A0DA 2XINA 4HNCA 3A21A 2P10A 3CWHA 3ME3A 4JCMA 1RP9A 1H3GA 1CNVA 1FA2A 3OLDA 4JR5A 1R30A 1EJUC 2JF7A 4LRTA 4AZCB 4WDTA 1YQ2A 1EJ7L 2WM1A 3G8RA 5ECVA 3WLLA 1YTKA 1XX1A 2BY1A 1T5AA 3AS2A 4UOJA 4O1BA 3ECQA 1V3IA 1W9UA 4IUGA 4RZ6A 1WPCA 4JTQA 2VENA 3E96A 5AZ1A 4Q8MA 2FHBA 1U5JA 5AC7A 1VYPX 4DX3A 1QHZA 2PP1A 1UYQA 2YW3A 4WKFA 2R1MA 1I60A 4G5DA 1N7KA 1RK6A 1V51A 5EFFA 1R46A 1FWRA 2HISA 1XP3A 5DRCA 3W01A 3H2MA 3QQ1A 1LBFA 2A7RA 3TSBA 1UWTA 5BU6A 3OGVA 3T0DA 3W07A 1XBYA 4D8LA 1MYRA 4W5UA 2QCDA 3EDEA 1OT2A 4GQGA 3BOLA 1MQQA 2X0YA 3ARZA 2E5BA 3K1DA 2BNJA 2QIWA 4XBSA 1I75A 2V5LA 1XIBA 1YTEA 3HO8A 5CC5A 1M3UA 4RNFA 4AC1X 1VFSA 1UQZA 1OD0A 2OEMA 3HU7A 4W7VA 4JFUA 4C6CA 4XTIA 1WKDA 2HS6A 1NWTA 2VEIA 3P61A 3W02A 3QN3A 3VIHA 4AD0A 2NZLA 3W22A 4N7QA 3DC0A 2ZFAA 4TQTA 3K8LA 1VLWA 4UNIA 3DESA 1ZU8A 2QLYA 4LV4A 3UG4A 2D2HA 4JTFA 3GG7A 1G5AA 4LFYA 3GYCA 4X2RA 5FJIA 4DXXA 1NOFA 4PCFA 5KTLA 1JNDA 2VELA 3WLMA 1C29A 4LYRA 1K6WA 1R85A 5TF0A 4WK9A 3M47A 3I3BA 2DDXA 3OVGA 1H7WA 1ZQ5A 3H7VA 1POKA 4KWOA 4MB5A 3LPGA 3F2DA 2X1RA 1BD0A 1WOBA 2EPKX 1NWSA 3N6QA 2X0HA 3FKKA 2PDIA 4FIRA 3SEPA 4RX0A 2C13A 4NI8A 4JHZA 4AWTA 1XQLA 1CGTA 4AZCA 3GKFA 1LRTA 1SO3A 3EOSA 4Z1BA 5A8PA 4UTWC 4LUYA 4RV8A 2WAGA 3CO8A 4L5ZA 1H0IA 4NU7A 4DM1A 2J7EA 4RPPA 2AL2B 2F2HA 5EL1A 1WUFA 1CGYA 4Z2IA 3N4FA 2VEFA 3COTA 3R1ZA 3GXTA 4ZQNA 1HIZA 4Q8OA 2HVOA 4UTKA 3LHVA 4UTTC 4I90A 2WSQA 4ZB5A 4LUIA 2ISSA 2JEPA 1GZGA 1IF2A 2Y89A 2QVNA 4QX4A 3T0AA 4GISA 3BLLA 3VKJA 3GNXA 4IJRA 1JDDA 1OFRA 2YGYA 4LW7A 3UF9A 4M51A 4IM4A 3PZUA 2Z1BA 3WF3A 4Q8NA 3GVQA 3UU0A 3R6IA 4IFKB 4PCSA 5L9FA 1KKRA 1U30A 3L65A 1XFCA 3C2RA 3I7SA 4EX4A 5HQLA 2QUUA 1EDGA 2A79A 4N2YA 3NQCA 5G5IA 3UETA 4J35A 2NQHA 3OIXA 4JYEA 5D04C 3CZJA 3FJLA 4BEQA 4AG0A 4AD4A 4GC4A 1AQFA 3KHJA 3R0DA 4QDMA 4YS1A 3GDMA 4GO8A 3V75A 4K8HA 2XGZA 1FXQA 3DKJA 4L6HA 1RA5A 1P4CA 1OSEA 3MW7A 2BTMA 1KBJA 3GUGA 3AU6A 4IMEA 3HM7A 5AYIA 3VILA 2OG9A 1LP6A 2WVTA 1KXHA 2F61A 4RJEA 2CBUA 2VGBA 2VMFA 1O5XA 2GJPA 1FHDA 2FDMA 1WO2A 1XCXA 2FZNA 3P6LA 1XGDA 1FWDC 2PB1A 4MAVA 3GBDA 3HFTA 4U2ZA 4DJFD 3RYSA 2WW5A 1MEHA 1RHCA 2RUSA 1EJXC 1JIBA 1NP0A 2EO7A 1QK0A 2F6UA 1IHIA 2VEMA 3R58A 2AL2A 2ZRXA 3UZ5A 1XIMA 3PAOA 3PZQA 3G6LA 3IJLA 3F5KA 1AQHA 4CD5A 4M5PA 3IVUA 1YE4A 3UCCA 3UZYA 1K7FA 5D9MA 3WBWA 1CGWA 1MXDA 4C6IA 1WXZA 5HPOA 3C2YA 1MFVA 4AZ7A 4HNUA 1WDRA 3A4JA 1X7FA 2PAJA 1V3HA 2UY3A 1K1DA 1ZJAA 1KA9F 3VIKA 1YW1A 1E3ZA 4PEEA 3UEQA 4OTKA 1JD9A 4CCZA 1GVSA 8TIMA 3NOEA 4HT3A 1J0ZA 1IV8A 2HV5A 4TR9A 1JD7A 4HD5A 1A80A 2YDAA 4LEFA 1LT7A 3VD3A 4PULA 1P0KA 2Z1SA 3T2OA 1CI1A 3QC0A 4JTIA 4IFKA 2V68A 3GG8A 3PS7A 5C5YA 1GPFA 4BR1A 1Q85A 2QKFA 3MSRA 3UGRA 4BI5A 1KTBA 5LA2A 3CLMA 4JQ4A 2FIQA 1E72M 1VBHA 2RH9A 2E6AA 3GDTA 1ZP3A 1N8FA 3L4YA 1DEDA 3WK2A 1XGZA 5F7UA 3VZZA 2DFAA 1Y0EA 5B80A 1WAUA 1Z48A 3ARRA 1MFUA 3VDBA 4JQ1A 3TC3A 2CCRA 4JKKA 3MP5A 1TMQA 3RLUA 3WQ6A 4Q8UA 1WX0A 3AJXA 3BO9A 3LENA 4CCCA 1AQMA 1I4NA 4FK9A 4P61A 3N9KA 1ZTVA 5J8LA 3AUOA 4J3WA 3WQEA 3C86A 1G7UA 2XN2A 2YCKX 1X97A 2BXVA 1QASA 1OBAA 3A3HA 1H63A 3URNA 3PWIA 2F6KA 1NFGA 3NQVA 3ATYA 5LYRA 3IGXA 3W7OA 3RMEA 3MSYA 3C4UA 2NXGA 2ASHA 2PDPA 3W9ZA 5I78A 2C15A 4YXGA 1ISXA 3W81A 4P7NA 4LVFA 1DV7A 3S5OA 5TNVA 1VLIA 2ZUMA 4JTHA 4HN8A 2VT0A 4ZO6A 2V8ZA 1R0MA 1YPIA 5HDRA 5HQMA 2VDHA 4I7UA 4EPBC 3EPOA 3C2VA 5E9XA 1MMFA 4QGCA 2CNCA 1M6JA 4HNOA 3N25A 1SZEA 3L21A 1ECEA 2XSXA 3NZQA 3AIBA 3WFLA 5HA7A 1JVNA 2H3DA 5MF5A 2ZZ1A 2EJ1A 1S5MA 2YYUA 4Y9OA 3PTQA 3NQFA 3GVVA 2A6LA 4RK8A 3EA2A 1W1TA 3UPBA 4Z17A 2I16A 2E25A 2WC3A 4HA4A 3R8RA 1WZMA 2J79A 4M7TA 1TPEA 4I9AA 1IT0A 3DFOA 3LK6A 3CHVA 1TQXA 4C6BA 3EX3A 4KFPA 4ACZB 4U4MA 4Z2GA 3MUY1 1LTDA 4L9ZA 5IOBA 1GVOA 2YLLA 1L2UA 4GIYA 3PPGA 3P5YA 5CSSA 5DT5A 1TWWA 1IR1A 3RNDA 3SCOA 3TTSA 2R14A 3WQDA 3EKLA 3TNOA 1RPKA 2DSUA 4NZ4A 4BZYA 1DOSA 3MUXA 3WLNA 3CK5A 3NQDA 3O0FA 1FWEC 5EFDA 4LV9A 1J4EA 5A5WA 1PXGA