2MANA

Mannotriose complex of thermomonospora fusca beta-mannanase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
302
structure length
298
Chain Sequence
ATGLHVKNGRLYEANGQEFIIRGVSHPHNWYPQHTQAFADIKSHGANTVRVVLSNGVRWSKNGPSDVANVISLCKQNRLICMLEVHDTTGYGEQSGASTLDQAVDYWIELKSVLQGEEDYVLINIGNEPYGNDSATVAAWATDTSAAIQRLRAAGFEHTLVVDAPNWGQDWTNTMRNNADQVYASDPTGNTVFSIHMYGVYSQASTITSYLEHFVNAGLPLIIGEFGHDNPDEDTIMAEAERLKLGYIGWSWSGNGGGVEYLDMVYNFDGDNLSPWGERIFYGPNGIASTAKEAVIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-MANNANASE)
publication title High-resolution native and complex structures of thermostable beta-mannanase from Thermomonospora fusca - substrate specificity in glycosyl hydrolase family 5.
pubmed doi rcsb
molecule tags Hydrolase
total genus 130
structure length 298
sequence length 302
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2manA00
1DWJM 3KE0A 1MW3A 2PWDA 1OIFA 1TA3B 5AY7A 3BCFA 1JDAA 1KR0A 3B9EA 3LMYA 5LA2A 2JFEX 1G1YA 3WFLA 3AIUA 1JL8A 1E4LA 4AZCB 2DSZA 1NP2A 4HTYA 1DWAM 4D6DA 2YL6A 4HU0A 3T08A 4MB3A 1UQZA 1OINA 4KGJA 5D9PA 4IPLA 5GPRA 1W1PA 1VFMA 3GNRA 5M17A 5BXRA 1B90A 1CYGA 1GNXA 3W28A 4GZJA 3VMOA 5M3WA 1FH7A 1DTUA 2ZXDA 4J28A 3AMKA 3CUGA 1PEZA 5BXTA 5KEZA 1WB0A 3OGVA 5CJ5A 3KEHA 3UCQA 1J01A 3VDCA 1SR0A 4HZ6A 4NSBA 4QFUA 4UR9A 4BA0A 4W93A 4W85A 1UWTA 4FF5A 3WH8A 2ZX9A 4B9ZA 2QMKA 1CNVA 1LQ0A 1E6ZA 4IISA 3K8MA 3NDZA 5HBFA 3MU7A 3WF4A 4LYRA 4UOQA 7A3HA 3OGSA 1FHDA 3AJ7A 1LG2A 3VX1A 5HPCA 2FGLA 5JIWA 3OB8A 3WD1A 3ARSA 4W86A 3K1DA 2Y4SA 4PMQA 1UR2A 1XH2A 1TR1A 1GHSA 3ZJ6A 3L4WA 2WVUA 1BLIA 3RMEA 2VVNA 4JHZA 2ZX7A 1C91A 4XZBA 1VEPA 1V6XA 2VURA 3WNPA 1XSIA 1HXJA 4HMCA 3TOPA 1I75A 5M5DA 4GXPA 1X1NA 4JKMA 1E56A 1JF5A 2YLAA 1B0IA 2VQTA 1IZJA 3FN9A 2WANA 5CG0A 3BAJA 3AHVA 1XD0A 2J7FA 2WVVB 1R85A 3CZJA 3WNNA 2G3NA 3T2QA 3VILA 2VCBA 4H2CA 4OBRA 2J7BA 5GQBA 2UY3A 1JI1A 5BCAA 2CNCA 2G4FA 1G5AA 4M8UA 1BTCA 1H41A 5F7UA 2OWXA 4WK9A 1QI4A 1B30A 5I0DA 1CTNA 2VZUA 3THDA 4OOUA 1G94A 2VNCA 1HIZA 1J10A 5E6ZA 1KQZA 2D0HA 3WELA 4KGLA 4D6HA 4ZEPA 2AMGA 3TTYA 5A8OA 1JZ4A 1NWUA 4P8XA 4W5ZA 1AQHA 4EAMA 1KGWA 1HP4A 1E5JA 2D3LA 3BC9A 3EDDA 4JCMA 1QNOA 3W6MA 1FOBA 3BAWA 2X0YA 3TTQA 2QHAA 3W37A 3VGDA 1UD2A 4PRWA 1EGZA 3DYMA 3WH6A 2GFTA 1H1NA 4F9DA 2EXOA 3E1F1 2DSVA 1TZ7A 4PUEA 2A3CA 4WKFA 1OM0A 3W0KA 2VUYA 2OSXA 3K4AA 4MTVA 3PTMA 3JUGA 5HOSA 3IJ7A 3VD3A 3W6LA 3EDEA 1ZJAA 4QLJA 1JFHA 1GONA 1UH2A 3L4ZA 3B9DA 2JE8A 3IJ9A 1EO5A 2DT3A 1TE1A 4UFMA 4R5EA 2XYLA 3VD5A 3MUZ1 2D20A 2WWCA 3IAQA 2FGZA 4V28A 1HP5A 4CU6A 3SCPA 2BY3A 1UR1A 2A3AA 3WMSA 4UZSA 1UWIA 2YA0A 2JIWA 1WCGA 4OKDA 3IK2A 4TX6A 3ZT7A 3PZVA 2E4TA 2O9RA 1E6RA 4CD6A 3VGFA 4DUXA 3SCNA 1VB9A 3N18A 3T0DA 4AZ6A 1OIMA 1H4PA 2CYGA 3MS8A 5A6JA 3U7VA 1C90A 2CIPA 1JAKA 1JZ5A 1ZB5A 2FDMA 4BS0A 1I1XA 1UKPA 1UZ1A 3M6DA 1GOKA 2QV4A 1H09A 3F5JA 1CDGA 4X0VA 3M46A 1E3XA 2O9TA 2X8RA 1HJQA 1GOMA 2WMIA 2CEQA 2ZUVA 3WBEA 2BNJA 2VX5A 4PUDA 4JAWA 3UG4A 4HA3A 1FP9A 2PBOA 1CWYA 4P8WA 1PIGA 5A6AA 1LL6A 1V3IA 4CN1A 5EMYA 2YBUA 5D9MA 1DWIM 1GW1A 3GXDA 1BSIA 5FKYA 1UWQA 1EIBA 1XC6A 1JYWA 3W38A 5CPTA 1R86A 2X09A 1L8NA 4ZENA 4MNJA 3ZMRA 1GORA 4JL1A 3AMGA 4B9YA 5HNNA 5I3DA 3AIQA 2CESA 1BVNP 1WAWA 4W8LA 3CZLA 3NUKA 2IUZA 1B3VA 3DECA 4U5KA 2UWFA 3SCTA 2NW0A 3M7SA 3RM8A 1GCYA 5AYIA 3EDFA 4GQRA 2PF0A 5A1AA 3EBVA 4J7RA 2XIBA 4LGXA 3BSGA 1U30A 2ZX8A 4GZEA 3BXWA 4URIA 5I24A 4H04A 3CUFA 1V02A 3W29A 1JZ7A 2RGLA 3VIJA 4Q22A 1C3FA 1V3MA 2WLYA 1FFQA 4AIEA 4ACZB 4IUGA 2FH6A 3ZSSA 4P8VA 2BY0A 4CCDA 4UQEA 3MUAA 3AHZA 4M1RA 2E0PA 3VTRA 1KB3A 5IFPA 3SUWA 4EE9A 4AW7A 1ZJBA 1CLVA 1J0IA 3SCSA 3MUY1 4WJXA 1W3KA 3AIVA 3L2MA 2VX7A 4HPGA 1J0HA 4BQ4A 4ATWA 2DIEA 4PMVA 2VCCA 2EO7A 2ZICA 1C92A 3RJYA 7TAAA 2DIJA 2VZOA 4PSPA 2WAGA 4GI9A 1U2YA 2TAAA 2AAAA 5A6KA 1OT1A 3AISA 4AEEA 2D23A 4HOWA 3VD9A 2JALA 1QOXA 1ISYA 2VCAA 2IXVA 3AS0A 5CLTA 2Z1KA 4TUFA 3PBGA 3DHPA 1US2A 3AXXA 2V3EA 2YA1A 3AMLA 2ZX6A 1CGYA 3RIKA 4L4OA 2O92A 3FAXA 4M24A 4HMEA 4CGTA 1WDRA 1MQRA 2J77A 3CHDA 4QDMA 3ARPA 5ABFB 2WMFA 4E8CA 3WY1A 7CGTA 3AIWA 4AZ7A 1JXKA 2HISA 4IM4A 3SCOA 1CBGA 1EO7A 4YHEA 3SEPA 2GJPA 4RE4A 3AS2A 1BQCA 4CN4A 3U5UA 1CENA 2W67A 4GPNA 5CSUA 1KBKA 3TTOA 1J0ZA 2X2YA 5FCZA 1UR8A 3N12A 1VFOA 2XFRA 3BLPX 5JIPA 2DQXA 4W7WA 4UQBA 2GUYA 1B3YA 3KZSA 2OSYA 3VOCA 1C7TA 1CLXA 1IZKA 1W9XA 2DT0A 1Q6FA 1W3JA 4BZYA 4PTXA 2WC4A 1BGGA 2BY2A 5FL0A 3VINA 3W81A 3AXIA 3QR3A 4AISA 2QMJA 3WSUA 3PZ9A 4C7DA 3VX0A 4WIWA 1ODZA 2J47A 5DT7A 1TFVA 2E9BA 4V27A 1GQJA 4PTVA 1C8XA 4FLRA 3LPFA 3AXHA 4FLSA 5D9OA 4TVDA 5D4YA 4ACZA 1ZU8A 2WMJA 1J9YA 3CH9A 2YKKA 5D9NA 2YA2A 1GQKA 2YL9A 1S46A 1C7SA 2BXYA 3PN8A 4HA1A 4RE2A 2DH3A 1XYFA 4D71A 4AD0A 3SCVA 3GTNA 4OBSA 3CZEA 3VDAA 5CGMA 3WENA 1MXGA 4BCEA 4BQ5A 2VL4A 1V6UA 1VJSA 4CD8A 4NF7A 2CITA 1AMYA 5A3HA 1V08A 1E4NA 2E8ZA 1PAMA 5GNYA 4CD7A 5E70A 4D1IA 3VNZA 1UG6A 1EQCA 2ZE0A 1DWGM 3UETA 5ECUA 5I23A 1QHZA 2FHCA 1JD9A 9CGTA 2GJXB 2JIEA 3QHMA 1MVYA 3ZM8A 1HL8A 2CBVA 3GH4A 1ZS2A 1B1YA 3AHYA 1EXPA 2GK1B 3LPPA 1NOFA 4JKKA 2WMHA 4CN6A 3VNYA 3CUHA 1W9BM 3PZQA 3F4VA 4J3UA 3GZAA 3TA9A 1E3ZA 1YHTA 4C7FA 1X6LA 4Z2JA 4WSJA 3L2LA 1E72M 3GDBA 1E71M 2WNWA 3WN6A 2X0HA 3L4UA 4D6EA 2O9OA 1TMQA 1O6IA 3MV01 2XVLA 1ZBKA 1RP9A 4P8UA 3LPGA 3GXMA 3BLKA 3G6MA 2YDRA 4YPJA 1D7FA 5CGTA 3ECQA 3BAYA 4JHOA 2XG9A 4CUCA 3MSGA 1MWOA 5I78A 4X9YA 1JD7A 3CO4A 1W91A 1QNSA 3BMWA 1NWSA 1LG1A 1WDPA 3MSDA 2Y2WA 3PZNA 1BGAA 1Q6GA 4D6GA 5IXEA 1OGBA 1OSEA 1KQYA 1CXKA 4U3AA 2CHNA 2WSKA 2WC7A 4W89A 1W9VA 1O7AA 3UR7A 5CPQA 4UFLA 4NI3A 1G9HA 1XRVA 1GOWA 1XH0A 1J0YA 4B3KA 5IHRA 4U3CA 1OB0A 2C0HA 1E15A 1E9LA 4AZ5A 3VD4A 5ABEA 4OJYA 3L4VA 2XWEA 4BQ3A 4MNMA 4RE3A 5A2AA 1A3HA 1HJSA 4A4AA 2W4XA 3CZKA 2OYKA 3T09A 2VMFA 2DSWA 1HKIA 1HKKA 4AMCA 5AC5A 1BYDA 1H0GA 1LF1A 3N9KA 2RGMA 5JBDA 4MB5A 1GVIA 2XVPA 4F66A 5C70A 2WM0A 1N82A 3APGA 2W5FA 5A2BA 2PWFA 4FMVA 4AZHA 4PMZA 1BAGA 1JFXA 3VGGA 4AEFA 3L4TA 2EPKX 4HPHA 1VJZA 1JNDA 3VU2A 1GQLA 2XTKA 3ZJKA 3A4WA 2PB1A 2UY5A 4DWSB 3OLGA 1WNOA 3W82A 3WNLA 3MMUA 3BAXA 1FH8A 2NT1A 1CXIA 1CXHA 2ZWZA 2YOCA 2QPUA 3WUBA 3ALGA 4PSRA 5AC4A 2WB5A 3WDJA 1WDSA 4F9JA 3EMZA 2WHKA 1TA3A 2VZTA 1ZL1A 3IAPA 4J3TA 1MFVA 1QI5A 4M81A 4NRSA 3WF1A 1W9UA 2VOTA 5E9AA 1GOQA 1PJ9A 1WZLA 4AZCA 4GKLA 4QCEA 3WH5A 2FH8A 1V03A 1CECA 2ZUMA 3GM8A 1FA2A 2VQUA 2WBGA 1QI3A 5JBFA 2PWGA 1CZ1A 2ZUWA 1V0NA 1EH9A 3ARZA 2YIHA 1Q6EA 2FHFA 1BVZA 2VR4A 2E40A 6A3HA 1QW9A 5DO8A 2AOSA 1KCKA 2CKRA 4M29A 3TP4A 4J27A 1E1FA 2BHUA 4B16A 2WC3A 1GUVA 2CCRA 1VFFA 2E9LA 3OZOA 3K8KA 1EA9C 4UOJA 3WQVA 4BF7A 3VMPA 4PEEA 1GJUA 4P7OA 1QPKA 4QLLA 3OA5A 3QOKA 1OGSA 1P6WA 5IFTA 3GNPA 2B31A 4ATLA 3WD4A 5FD0A 1XCXA 1ITXA 2VI0A 4WKHA 5A69A 4ZFMA 2ZXAA 4LYPA 5HDRA 3W24A 3AI0A 3QHOA 1E73M 3AFBA 4XUYA 4DM2A 1M53A 1US3A 2J79A 1KGUA 2YL5A 3MKKA 4A3HA 1J0KA 4WKAA 3VPLA 1L0PA 1H11A 1QNPA 4MDPA 4GO9A 5A2CA 1M7XA 3FY1A 4L4PA 1FP8A 4KRUA 2JEQA 3VIHA 4Y7EA 2J75A 3VMNA 2W63A 3O6AA 2J7EA 3S6TA 4R27A 4U5IA 4AIOA 2XM2A 2D3NA 2VRJA 2OYLA 1MXDA 1H49A 1E4MM 1G01A 3DC0A 4KH2A 2DPEA 2X1IA 4MB1A 4QAWA 2W91A 3OLDA 3MV11 3ARQA 3VIOA 1NWRA 1QI0A 2GDVA 1QHOA 3WD0A 3G6LA 5A95A 3CUJA 1UR4A 2WVVA 3PZGA 1G0CA 1VBUA 4QCFA 2PWHA 4AD2A 5I6SA 8CGTA 1FFRA 2EQDA 2WZHA 2EEXA 2WPGA 2QLYA 1PX8A 2Y8VA 4M80A 1RH9A 4HZ8A 1E43A 1ISWA 4TXEA 2DT2A 5E09A 1V0KA 3KL0A 1MFUA 2BVTA 4HMDA 4H8UA 4TTUA 4U31A 1GOIA 2VR5A 4PMOA 1NOUA 2G3JA 3VUPA 2XM1A 1UWUA 3AIBA 4HOZA 4PBGA 2VZVA 4ZXOA 4TTGA 1FH9A 1Y7VA 3FAWA 1QNQA 5EFFA 3T0AA 4WF7A 2CPUA 4D6JA 1HL9A 1LL4A 2VT0A 4AD4A 3SUTA 4PMRA 2W61A 2WMKA 2OSWA 1QBAA 2VJXA 1MW1A 2ZXBA 3WUEA 1PBGA 3ZT5A 5BRQA 3ARRA 1C93A 4D6IA 3BSHA 1KXHA 3WKZA 2BV9A 1E70M 3WMCA 1VFUA 1CGXA 5D8ZA 3O9NA 5LA0A 3QOMA 1TVNA 1VRXA 1JYNA 1EOMA 3M07A 1V6VA 1WPCA 5I79A 3VD7A 1CXLA 3T2OA 1ZBVA 1OT2A 3PZUA 1D3CA 4S3KA 3ZJ8A 1KCLA 1W9PA 2E3ZA 5BRPA 3DYPA 1V02E 4P7LA 4LX4A 3T2PA 3W26A 3AMDA 1HJUA 3WNOA 3PZTA 1E0VA 2F8QA 1GJWA 2W62A 3AIEA 4PYSA 1UKTA 4P7RA 1GQIA 3K46A 4DWSC 4M56A 3CPUA 1GVYA 2G3IA 3SIMA 4AY1A 4TOQA 1QHPA 8A3HA 4ATDA 2GJRA 5A6LA 1UWSA 4V2XA 5GNXA 1XV8A 1CGUA 1KFWA 4AYSA 4AD5A 1VEOA 2PBGA 4UFJA 4DUVA 1SFSA 1A47A 2GVYA 4NRRA 1EOKA 3CMGA 2J4GA 3RM9A 4P7QA 2YDSA 1W9DM 1UQYA 2CXGA 3BGAA 4D1JA 3VVGA 4Q7NA 3GXFA 4Z2LA 1KXVA 3VIKA 1UD5A 3NSMA 5DMYA 4ZE4A 1H3GA 2XSAA 4ACYA 3VIMA 5FIPA 1QVBA 1CGTA 4UFIA 3CLWA 1D2KA 1E6NA 5HXMA 1E0XA 4MAZA 3WUGA 4CCEA 6CGTA 1UKOA 3B8SA 2X05A 1MW2A 1MW0A 2NT0A 2PI6A 1DEDA 4U2YA 3CMJA 2OWWA 1M04A 4OOZA 3SUVA 1PX4A 1NOWA 3MMDA 1ZBCA 3WFZA 3WH7A 5IHSA 3KWXA 1QBBA 3ZSTA 3ARTA 1NM9A 1XH1A 1WE5A 1E55A 4WSKA 2J8GA 1R8LA 6TAAA 1J18A 4F79A 4D72A 4D6CA 1EDTA 3J7HA 4UTFA 2V3GA 3SCWA 1W3LA 3CHEA 2ZOXA 4QP0A 4TVCA 3POHA 2XWDA 4J3XA 3CZGA 2C8NA 3TTSA 4AWEA 1HJVA 1V6YA 4E4PA 4MAVA 1V3JA 5LYRA 5BYWA 1UD4A 1BHGA 2J7CA 4W84A 2JEPA 3PTKA 1B31A 1M03A 5ABHA 5CLWA 1E0WA 2WYSA 3NDYA 2OYMA 1FHLA 4P7NA 3ZT6A 1LWJA 3PZOA 2DH2A 3HU7A 1SYTA 1W32A 3LPOA 1JZ2A 1K9FA 2XJ7A 1WP6A 2ZUSA 5ABGA 3SUUA 2DGAA 3OG2A 1XSJA 4XB3A 3UEQA 1CEOA 3N13A 1HKJA 1VIWA 1I1WA 4LPCA 3WD2A 3CUIA 2ZXQA 4MB4A 3NCOA 2WHJA 1HVXA 5KZ6A 2ZX5A 4C7GA 4AZBA 2WHMA 3WQWA 3VM7A 5CZKA 4UFHA 1AVAA 4LXFA 1CGVA 5ABFA 2BHZA 2DT1A 4W87A 2CETA 3WNMA 1UR9A 4QLKA 4LQ1A 3B9AA 4PMDA 5A6BD 3EDKA 3A4AA 1ESWA 3AIRA 4PMXA 2BVYA 1XGZA 1K9DA 4W8AA 1VEMA 1KWGA 1OWQA 4AXNA 1E6PA 3F5KA 3EYPA 1RP8A 2VRQA 1E6SM 4E8DA 1H2JA 1MQQA 5I5RA 2E9MA 3EDJA 1ISVA 4XV0A 1NARA 4HOXA 5JUVA 5M03A 1MYRA 2XPKA 3D5HA 3FNDA 1J0JA 3SUSA 4FK9A 1BG9A 1H5VA 3FHQA 3ZO9A 1JF6A 1MQPA 4F8XA 1JZ6A 1C8YA 2WVSA 3ARVA 4XX6A 1NWTA 3AMCA 4MJ2A 1WZKA 3FXYA 3W27A 3U7BA 4PTMA 2VO5A 3ARUA 4EANA 5DEZA 5E0FA 1DP0A 3RCNA 3QGVA 3VIIA 4J3WA 1E4IA 1W1YA 5D8WA 1WZMA 1Q6CA 2WCAA 2EPLX 4PCSA 2PWEA 3K4DA 4UQDA 1H0IA 3WL0A 4JFTA 3ZIZA 2J62A 5EBAA 3NSNA 3OGRA 2YLLA 4PCTA 1YQ2A 1K9TA 4A3YA 3UG3A 1ISZA 3RPMA 1TG7A 3CHFA 5EB8A 1ODUA 4X0NA 3BH4A 1ECEA 2GSJA 3N04A 1UA3A 2BS9A 2GJXA 1PZ3A 3RILA 4PMYA 4AZGA 4CD4A 1W2PA 1J12A 4UZUA 2G8ZA 1KXTA 2GK1A 1E6QM 2WMIB 3WIJA 2Q8XA 3AS3A 1KGXA 1BPLB 1C8QA 4GI8A 1HF6A 3A6OA 1GHRA 1E6XM 1JGIA 1HT6A 2V3FA 1QW8A 2WMGA 4UQCA 4OUEA 1UZ4A 1TCMA 4JFSA 1F4AA 1UOKA 1Q6DA 4JFUA 4YHGA 2WHLA 5A6SA 3ZJ7A 3ZR6A 4W7UA 1VBRA 4H8VA 2VVSA 4AIUA 4W8BA 5A8PA 1SMDA 4JZ5A 3ARWA 5CQ1A 3GBDA 5JBEA 5TD4A 3KL5A 5A8NA 3AQUA 3W53A 1UYQA 1AQMA 3GBEA 4WLCA 3OBAA 1GPFA 1WKYA 3S2CA 2VTFA 3RO8A 3HN3A 1W1VA 1BG4A 1OGGA 2WZEA 3WBAA 3MUIA 3NSXA 1LJYA 1JDDA 2BY1A 1EQPA 4MDOA 1UD6A 1V3KA 5IDIA 1XD1A 3BAIA 3N11A 1LLOA 2YBTA 3BMVA 1QI2A 1LWHA 2EBNA 1CPUA 3IANA 4JKLA 3OLEA 3WF2A 3AHXA 1JZ3A 2XGIA 1HX0A 4JCLA 3ZR5A 1CGWA 4H7VA 2F2HA 1UUQA 1EHAA 4W5UA 2WCSA 1UWRA 3WEMA 3D3AA 4HU8A 1B2YA 2NSXA 1EDGA 3WD3A 5BROA 3EMQA 2ZIDA 1M01A 1JAEA 2WW5A 5AYBA 4KMQA 4Z2IA 2CERA 3FHAA 4FLQA 5A6MA 2J7GA 3VIFA 4FLOA 2D24A 3TONA 1WZAA 4IPNB 2BFGA 3I3EA 4PMUA 2CHOA 2XVKA 1XCWA 2WZIA 4AD3A 4OZOA 4B15A 3DHUA 4H41A 3VGEA 3AYSA 2YJQA 1V3HA 5E6YA 3PZMA 4JIEA 5BWFA 2E8YA 2ZWYA 1ITCA 3KL3A 4GINA 1U33A 1KR1A 1DHKA 2D1ZA 1UH4A 2VX4A 4UOZA 2QPSA 3GXIA 1V6WA 1UD3A 4AC1X 1EHNA 3WUFA 3WDHA 4U33A 2J8FA 4GQQA 1R7AA 4MADA 1HVQA 1JDCA 2BXZA 3MMWA 1JZ8A 1GZJA 1IV8A 5EFDA 1OBAA 4DWSA 4CCCA 1X6NA 3VIPA 2BHYA 3GYCA 1JG9A 2D2OA 2XFFA 4W7VA 2GDUA 4HA4A 4S3JA 4M82A 4KRTA 2FHBA 1XYZA 3U5YA 3CHCA 2CBJA 4U2ZA 3AZRA 4HP5A 1UA7A 4CU8A 4UCFA 4AD1A 2BVDA 4JFVA 3AZTA 2O9PA 2W66A 5BXPA 3PZIA 1JYXA 3ZQ9A 4UQ9A 1NP0A 1TUXA 2XUCA 2UY4A 5A8MA 1BF2A 5DF0A 1B9ZA 3AS1A 2J74A 4MPKA 3CGTA 4H8HA 1Z32X 4DWSD 1CXEA 4J3VA 2WKLA 5A94A 3ZOAA 2PC8A 2XVGA 4ML4A 3NIYA 1V0LA 1B3XA 2UY2A 3VGBA 3FW6A 1BYBA 1XHGA 2D0FA 2JF7A 2Y5EA 3MO4A 3EMCA 3AOFA 1KXQA 3UG5A 2XSBA 1TVPA 1V3LA 3BAKA 3I3BA 1DWHM 3VO0A 5CPSA 1DWFM 2HVMA 2YL8A 3BCDA 1K9EA 5C8BB 1RPKA 1BFNA 3WQ4A 1B3ZA 1NH6A 3RDKA 1UD8A 1R87A 3VDHA 1UKQA 2MANA 4KWUA 3OZPA 2XIIA 4W88A 2WXDM 2J25A 3CIVA 4N42A 4GI6A 3WQ8A 3K8LA 5DFAA 2OWCA 4N0RA 4GZIA 3WDRA 1UR0A 2YDQA 3A4XA 5I2UA 1ISXA 4B3LA 2ZUUA 3DYOA 1PPIA 4XZWA 2DEPA 3POCA 5E0CA 4CKQA 1R7OA 3WF0A 4MNLA 1GOOA 1VF8A 2WVTA 3WQ6A 3GNOA 1XSKA 1UH3A 3PHAA 2D0GA 3W25A 4GIAA 5A8QA 3VDBA 1HN1A 4OIFA 2VRKA 1WDQA 1F4HA 3CZ8A 3UERA 4EKJA 1E40A 3WMBA 2DSKA 1JXJA 3I3DA 1B3WA 5GNZA 4Z2HA 2EPOA 3WF3A 3WNKA 2Y24A 1AQ0A 1KBBA 2WSPA 4ZE5A 3W4RA 3OIHA 1CXFA 4CD5A 4HZ7A 4NZCA 4PN2A 4J3SA 2A3EA 2G3MA 1W3HA 3UESA 3NJ3A 2WK2A 4LYQA 3F5LA 1PX3A 4TX8A 4Z2GA 2J78A 4GO8A 3AZSA 3VIGA 1JIBA 1K6AA 1ZBWA 5HPOA 2CBUA 2F61A 1W1TA 1WO2A 2WKGA 3SCQA 4K68A 2VC9A 4CU7A 2ZUNA 1Q4NX 3U57A 3OLIA 5C71A 3WQ5A 1E5NA 3AICA 3WDIA 4JL2A 3AROA 1E1EA 3II1A 3WDQA 3O2LA 4ZXLA 2J7DA 4EK7A 3PTQA 1VAHA 3ARYA 3RM4A 4CVUA 2W92A 2Y8KA 3T0BA 1J11A 2VZSA 3THCA 1KWKA 2J7HA 1VENA 3AHTA 2DDXA 1CIUA 2DSUA 1JYVA 4YN5A 4E2OA 1BYCA 3CTTA 3WEZA 4CVWA 2VX6A 3WH9A 3NYDA 3N1AA 3L4YA 1JI2A 1QNRA 2EPNA 3QHNA 1HNYA 2EPMX 4AZIA 5FL1A 3ARXA 1OCQA 4Z2KA 2D22A 1PIFA 3A3HA 3CBWA 2XFYA 5DT5A 2A3HA 4PMNA 2OLHA 2JF6A 2ESCA 2V38A 1UHVA 3SCRA 3GH7A 1JNEA 3AYRA 1HJXA 1NQ6A 2A3BA 2C7FA 1SMAA 4MJ4A 4UQAA 4JFWA 3HMCA 5FOOA 3SCUA 3IJ8A 1OD0A 2WWDA 2CBIA 1PZ2A 4PTWA 5A6BA 2V5CA 5CSYA 1LL7A 3UR8A 2G41A 2QF8A 4DM1A 5CXPA 4MNKA 2XGBA 2ZUTA 3GH5A 1EDQA 1HKMA 1HJWA 4RL3A 5I77A 3L4XA 1V0MA 3VKKA 2EJ1A 2WCGA 3SURA 2WLZA 4BQ2A 2V3DA 3HJEA 3ALFA 3N15A 5LA1A 2V5DA 3A47A 3WDPP 2CKSA 3WL1A 4D6FA 2IXUA 4DUWA 4UNIA 2WBKA 1OD8A 2XHYA 5BXSA 3WEOA 2Z1SA 1UKSA 3VM5A 3MANA 1IT0A 1RD6A 3RJXA 3VGHA 1BYAA 2XVNA 4UFKA 1W2VA 3N17A 4TVUA
chains in the Genus database with same CATH superfamily
1SZRA 4AUBA 2DVXA 1O5QA 3T6CA 2E1WA 1G4SA 2PWDA 1MNSA 3PR2A 2B7QA 2YB4A 1WYIA 2PMQA 1KR0A 3B9EA 3LMYA 3EX6A 4BWLA 2JFEX 3UBPC 1W8SA 3M47A 3B0YA 4C6NA 4RZ5A 4IMFA 4HTYA 2Q02A 1DWAM 2E68A 2O7SA 2YL6A 4HU0A 1QPNA 3T08A 2XU2A 1UQZA 1OINA 3O06A 2YZ5A 1WBJA 1VLWA 2HBXA 1EBHA 1YBQA 3TC7A 3STFA 3W70A 3OP2A 3M0MA 3QQ0A 3VCCA 3U2CA 4FNSA 3UCQA 3N4AA 1D8CA 4QS6A 3VK5A 4HZ6A 4NSBA 4UR9A 5JMUA 4FF5A 3HMJG 4DYEA 2QMKA 4IIBA 3G1FA 2X1RA 2XFWA 2QJGA 4AF0A 1JCMP 4AY8A 7A3HA 2XDFA 3S0CA 1FHDA 4GKTA 3OO2A 1LG2A 3VX1A 1R3VA 3GFZA 3Q37A 3OB8A 3USBA 3ARSA 2NWRA 4W86A 3K1DA 4PMQA 3JS3A 2WVUA 1K02A 3RMEA 4JHZA 3GXNA 1E1CB 6XIAA 4XZBA 3WNPA 1VEPA 1V6XA 2VURA 4FX7A 1XSIA 1HXJA 4F0SA 1I75A 3IV3A 4JKMA 3TAOA 1T99A 3GU1A 1B0IA 3MDUA 4ZB5A 3PJTA 1VQTA 1ZZMA 4PUWA 3CUZA 4Q4QA 3FN9A 3M0HA 3VNKA 1XDLA 2J7FA 3HPFA 3CZJA 4Y9MA 4I9AA 3QQWA 2G3NA 3NL3A 3VNLA 1M7JA 4MF4A 3MMTA 4HK7A 1JI1A 4IUOA 4A8RA 5BCAA 2CNCA 2D2GA 1G5AA 2DZBA 3LERA 1H41A 1ONEA 5F7UA 1F61A 3TN3A 5I02A 4ZQNA 1G94A 5E6ZA 3WELA 4KGLA 2Y89A 3CS2A 3P5ZA 3TTYA 1BWKA 3MKCA 3SY1A 4QISA 3TSDA 3W6MA 5E5CA 1DXIA 4AQLA 5B7YA 3UZXA 3K2GA 3RRAA 1S3HA 1Z7AA 1LOQA 3L12A 3L9CA 2DW6A 2GFTA 3LX9A 3EWXA 4F9DA 2DSVA 4INFA 3W0KA 1X1ZA 2VUYA 3K4AA 4MTVA 4PUMA 1YDVA 5HOSA 3BWWA 4E38A 3BG9A 2B4GA 1UH2A 1XBYA 3B9DA 2C3ZA 1L9WA 4O11A 2DT3A 2OOGA 1TE1A 1ZJIA 3W1XA 3MUZ1 3ABZA 3APTA 1POJA 2WWCA 3IAQA 4IIDA 1A0EA 1UR1A 4H7ZA 1CW2A 4BEQA 4H19A 5FSDC 3WMSA 3LDVA 3PBUA 3TQKA 3UZ5A 1IIGA 2H8XA 3KCOA 2CZVA 5C54A 1E6RA 3WBXA 3I7RA 4IQJA 4AZ6A 5A6JA 1TREA 2GOUA 4W9TA 3DHFA 2CIPA 1JAKA 4JY9A 1ZB5A 1I1XA 2NUWA 4I9TA 3E9AA 4Q4SA 1F6KA 1KBIA 5DMNA 2CEQA 2HNHA 4PUDA 3UG4A 4HA3A 2PBOA 3IS4A 5CZSA 4ENLA 4JQ3A 3SM0A 1PIGA 1LL6A 3WJSA 2Z4GA 3BANA 4QE5A 4H6KA 1A5MC 1DWIM 3WLOA 4FOKA 1BSIA 1WKFA 3MHFA 1EIBA 1LQ2A 1XC6A 4RNHA 5CPNA 5CPTA 5LGZA 3S5YA 1L8NA 4C6FA 1ELSA 3OVQA 3ZMRA 4JL1A 4YVPA 2I7GA 4CNUA 1MEHA 3BW3A 1OHLA 5G4HC 2CESA 2QZRA 2OB3A 1RCQA 4U5KA 3RLVA 1R3QA 3RM8A 5AYIA 3EDFA 4QEEA 2X40A 3BXWA 4MJZA 5JH2A 4H04A 3CUFA 3LRLA 1V02A 4DPPA 3W29A 1M7OA 2RGLA 4Q22A 1KFBA 2WLYA 3VCNA 3GSMA 4P8VA 2BY0A 3TWBA 1CB2A 4FALA 4QRNA 4C6CA 5IFPA 4IJRA 1P6BA 1XDMA 1AMKA 4MFEA 1TX2A 4KWVA 1ZJBA 1CLVA 1J0IA 5FJUA 3TN4A 2NUXA 2I16A 2J8TA 4OWGA 5BOOA 3EOLA 4NG3A 3G3DA 3E2SA 4IMCA 1ICSA 4S1FA 5ABTA 2ZICA 4PBFA 2CHRA 2ZKMX 5G2WA 3KW3A 3GU2A 3UD6A 2QVHA 2EKGA 1FWJC 2VZOA 3EB3A 4PSPA 4ZO7A 4GVGA 1P1XA 2TAAA 3FCPA 4O8AA 1AL8A 3S2LA 4YVVA 3FLUA 3XISA 4AEEA 3RPTA 1DIKA 2D23A 3NZ1A 4HOWA 3TVAA 3V5CA 3VD9A 1QOXA 3BE7A 5CLTA 2B7NA 5EA9A 2Z2AA 2YA1A 3UF9A 1MZHA 2XSXA 5I3GA 3NTYA 2J66A 3LOTA 1OC5A 4CCZA 2IKJA 4QDMA 3QFEA 4AIBA 1Q3NA 1EC9A 4E8CA 2AGKA 3T42A 3UR5A 4AFYA 1EYWA 2DUXA 4YHEA 3GNDA 1R3SA 5H1WA 1XQLA 4GPNA 5CJNA 3EB4A 3CLMA 3GVGA 2X2YA 1UR8A 3N12A 5JIPA 2GUUA 4EOUA 1EB3A 4W7WA 1EC7A 1TJ1A 2BGSA 3VOCA 4TV6A 3QMTA 1C7TA 1W3JA 2PZ0A 2FVLA 4PTXA 1BRLB 1BGGA 1ZAIA 1I2PA 5FL0A 5EMKA 1MSSA 3VX0A 4L7ZA 4RNJA 1F8IA 3G24A 4C1NB 4V27A 4PTVA 4FLSA 3UG8A 5D9OA 4UTIA 4ADUA 1J9YA 3CB8A 1GQKA 1S46A 3PN8A 3V3WA 1DIOA 3FSUA 3CPRA 1PE1A 3GTNA 5HMSA 3NWRA 4X22A 2PRMA 1EZWA 5KTLA 4XVDA 2VM8A 3SO7A 5A3HA 2E28A 1L6GA 5H6HA 1XLFA 3VNZA 4D1IA 1Q13A 2ZE0A 1HG3A 3S5SA 1OZQA 1T6MA 3UETA 5ECUA 3FVDA 4JQ1A 3C8FA 3GR4A 7TIMA 2FHCA 1VFHA 2GJXB 3ANYA 1E51A 1TV5A 3P8JA 2YGYA 4IX2A 4QITA 1FWIC 1R5YA 1RBAA 1OG0A 4XISA 3H2EA 5CZ0A 1KO0A 3W2MA 5CSRA 3AHYA 3PM6A 1VJIA 1BXNA 3UA3A 3S1GA 2P10A 3CUHA 4YCPA 4DELA 1SJDA 1U83A 2NLIA 4J40A 4X61A 3G1YA 2DIKA 2DZXA 2ACUA 4Z2JA 5AHMA 3NQ8A 3GDBA 4HIBA 4YVXA 1IEVA 2CLFA 3L4UA 4D6EA 4AXKA 4MWAE 1X97A 1O6IA 3W71A 1AW2A 3MV01 1ZBKA 1RP9A 3M0LA 3EA1A 4YPJA 2HV5A 3ECQA 2E09A 5H91A 3GDLA 2C18A 2OGYA 1MWOA 1RQEA 1TYGA 3TXVA 5I7GA 2Q6ZA 1W91A 1ME7A 1QNSA 1NWSA 3HPAA 4UNKA 1LG1A 4DPQA 4QJ4B 3A3XA 1KM0A 2AAMA 3QV6A 4ERIA 1KQYA 1CXKA 2CHNA 3KOZA 4FXFA 2PA6A 4CNPA 4BJHA 3I6TA 3ZLFA 1G9HA 1F76A 1QO2A 2NXIA 3W22A 5HMDA 2C0HA 4AZ5A 1YDYA 1YNPA 4C6IA 4K1GA 4G1KA 4OJYA 5E0KA 2PRLA 2XWEA 3RG6A 4BQ3A 4MNMA 1RCXB 1A3HA 2W4XA 2KX9A 5MF5A 1BYDA 3BO9A 1V7YA 1LF1A 2XVPA 3OVRA 2W5FA 2PWFA 1IHIA 4FMVA 3VKCA 4HB7A 4AZHA 4AEFA 4Q4MA 3KOWA 1GOXA 4M0XA 3VU2A 1GQLA 3WLRA 4K6AA 1G7VA 3KHJA 3BZJA 4HYWA 3HM7A 3BJTA 4KS0A 4HHLA 4RJEA 3BAXA 2CLLA 4RW5A 2NT1A 3H2AA 2DVUA 5FJJA 5HR6A 1FWTA 2X1TA 3RR1A 2ZWZA 4C6OA 4NP7A 2QCLA 3WUBA 3ALGA 3WDJA 4F9JA 4F0MA 3EMZA 1N7KA 4R34A 1K03A 2WHKA 3IAPA 4J3TA 4LBRA 2YCKX 5DCEA 5I09A 3UXKA 3KBJA 5CZTA 3BLEA 2JK2A 4GKLA 5L9FA 2A79A 2ZUMA 4ZOEA 1SM9A 2PWGA 3C3NA 3PULA 2Z2UA 5HA7A 2ZUWA 4XAZA 1V0NA 1EH9A 1TPB1 2XGZA 4D9PA 2OPJA 2E40A 4NNBA 4ERAA 3R94A 2EGZA 2BHUA 2FZNA 4OTKA 1EJ7L 2QPXA 5JVLA 1GUVA 3QKZA 2F2KA 3CTLA 3K8KA 3BCJA 3DFTA 1EA9C 3S6DA 1RJRA 4BF7A 5K9DA 4P7OA 2Y62A 4L80A 4X2RA 1P43A 2J9ZA 2YPIA 4MG4A 5FD0A 1FKWA 3FA5A 1ITXA 4WKHA 1PB0A 3PK7A 4GQ0A 4H3DA 5A69A 3CYVA 5AECA 3UFYA 5HR7A 3AFBA 2YL5A 1KGUA 2CLPA 1J0KA 4WKAA 3VPLA 4XAYA 3MYOA 3M0JA 4MDPA 2QJIA 1KBJA 4XKMA 1AW1A 4S38A 3VIHA 3GG7A 5D02A 2J75A 3VMNA 2VC6A 1YEYA 1Y65A 3CT7A 2YB1A 2D3NA 2VRJA 1MXDA 1H49A 1E1CA 1E4MM 2WKJA 4QAWA 4O19A 1XQKA 3OLDA 3U2EA 3VC6A 5D33A 3CQ0A 3P80A 3OIXA 2E6DA 3FS2A 4HYRA 2GDVA 4DJDD 5A95A 3PZGA 5I6SA 1R9XA 3QV9A 3RU6A 3MI3A 3ABRA 2WPGA 4F48A 3D3FA 2DW7A 3FYYA 4M80A 5J04A 4KWSA 2P8CA 1VLIA 4IX0A 1Z89A 5KZMA 1Q6RA 1LCOA 4U31A 1GOIA 3QV7A 2VR5A 3HPSA 4HNLA 4PMOA 1NOUA 2G3JA 3G0SA 2XM1A 2ZA1A 4YWSA 4ZXOA 1EEXA 2VZVA 4MJMA 1FH9A 1M68A 2VUNA 1Y7VA 5FJRA 4Q8TA 4UTUA 4DI9A 4DXVA 2BLEA 3U0HA 3B97A 3FSTA 3U48A 3CC1A 3B03A 2CZ5A 1IWBA 4FX6M 3UCCA 1FWBC 2NV9A 1TZ9A 3ARRA 1C93A 1EA0A 4PCFA 3BSHA 3SDOA 1ITQA 3WMCA 4NZ4A 5I00A 3O9NA 1LRNA 5LA0A 4IT1A 4UMBA 1H7NA 1LRQA 3K13A 4HNOA 4LB3A 5HJXA 3W7GA 5CEWA 5FF4A 1S3TC 3VD7A 3GS6A 4A3UA 4JTUA 1ZBVA 3O63A 3TTEA 4S3KA 1KCLA 2YXGA 5BRPA 1TQJA 3DYPA 5AC6A 1G4TA 1V02E 4LX4A 3AMDA 2PWUA 4R7WA 3N2TA 2ZBTA 3F4CA 1E0VA 5F2GA 4B5TA 1F9CA 4O1BA 1U1UA 1QK2A 1UKTA 3IJ6A 4FNPA 1GQIA 1OADA 4PB3A 4M56A 3WLHA 2G3IA 4AY1A 3CAKA 1QHPA 2GJRA 3R10A 4IP4A 3LCWA 5CAKA 4JYDA 1CGUA 2J24A 4AD5A 1PHQA 4UFJA 4I9MA 2F7FA 2R6OA 2NX1A 2BZNA 4DVOA 3W7MA 3KBMA 4NRRA 2J4GA 4ZSUA 4BF5A 3GIYA 4PZVA 3CH0A 1SGJA 3BGAA 4Q8VA 2CLOA 2QS8A 3E0WA 2ACRA 3O3RA 3MHUA 1PTGA 3UJRA 3G8RA 1EP2A 3MCOA 4S2CA 4ZE4A 1H3GA 2XSAA 4ACYA 4UTJA 1QVBA 3UPWA 2XISA 4UFIA 1E6NA 3HGOA 1E0XA 3NPWA 4GGHA 3MVTA 3RPDA 1QWKA 4PA8A 5DCBA 1GKPA 1H63A 2Z1WA 1JCXA 2H9AB 4L6HA 1DEDA 1TO3A 1R3TA 1K4GA 1NOWA 3MMDA 4JTCA 3WFZA 3TOYA 3SI9A 1GVEA 3ZSTA 2OFJA 1JJKA 1XP3A 9RUBA 1TPDA 5CBJA 2OOFA 1DIEA 3GFXA 3CQJA 4D72A 4Q8OA 3E3HA 1E0UA 2NQLA 3CHEA 2ZOXA 2A6LA 1XDJA 2XWDA 4J3XA 3UWYA 4NX0A 4JTHA 4AWEA 4E4PA 4C6QA 1X38A 1WUEA 4DB7A 4W84A 2HJPA 1XBZA 3GHSA 4HKPA 2BP1A 1EGMA 5GJMA 5ABHA 5CLWA 2DZUA 2R82A 1S1PA 3S8HA 2OYMA 2VEKA 3IIXA 4P7NA 5CZJA 2DH2A 3HU7A 3HG4A 3JRKA 4L9YA 1KM4A 2OKOA 2E77A 4NQ1A 1JZ2A 5AHIA 1ADSA 3P8IA 2VEFA 2ZUSA 1QO5A 1PDYA 3REQB 4HN4A 1XSJA 1CEOA 4O4VA 3CUIA 3L2IA 3NCOA 1FBAA 1BKHA 2WHMA 3LENA 3VM7A 1ZTVA 5BU9A 1AVAA 1F05A 3TLLA 2ZCGA 3O7UA 2BHZA 3VDGA 2DT1A 3TWAA 1Q4WA 1L6SA 2IPJA 3W2KA 1KW1A 4PTNA 4H83A 3DX5A 3A4AA 4Q33A 1ESWA 2BVYA 5T9CE 4XZIA 4JY8A 3M0IA 2HK1A 1VEMA 3W84A 1OWQA 4IGSA 4HJWA 4WY0B 3EPOA 5DCDA 3ZXWA 3C5QA 1RP8A 2OXNA 1E6SM 1MQQA 5I5RA 5H8PA 6ENLA 1M5WA 3EDJA 4J5NA 1GEHA 1VGAA 3RYSA 3C56A 1MYRA 1BRLA 3FNDA 4JTEA 1A5LC 2P8BA 1CT5A 2OZ8A 3SUSA 3MP3A 4A3QA 3QTPA 1FWAC 3M16A 1JF6A 1MQPA 3QSRA 4F8XA 1JZ6A 4BY3A 3TV8A 4C1NA 3ARVA 1I8JA 4I90A 1LTDA 1A3WA 3E74A 2Y61A 5LXEA 1XYCA 3RCNA 3LQGA 1W1YA 1WZMA 1Q6CA 4J2PA 5LIKX 3K4DA 4UQDA 1H0IA 3LK6A 4JFTA 3ATZA 5AVHA 4AHOA 3B9NA 1SFTA 3NSNA 1KNWA 3B0VC 1YQ2A 2PURA 2V0TA 3O07A 4A3YA 1ZCCA 3LI0A 3RPMA 3BH4A 1XKJA 2Q8ZA 3HTWA 1UA3A 2BS9A 2GJXA 5FA5A 1R6WA 3U8GA 1PZ3A 3GQYA 4AZGA 4Y2WA 4CD4A 1W2PA 3V36A 2G8ZA 2P3ZA 2WMIB 1E6QM 4ZQMA 3SIZA 3A6OA 1XX1A 2AKZA 3GTHA 4NZ1A 1TB3A 2HRWA 5H2ZA 4ZVJA 3DDMA 2V3FA 2TRSA 5B7ZA 2WMGA 4K7VA 3F2DA 1TPC1 2FZBA 4MY9A 3DERA 1UOKA 4YHGA 2WHLA 5AYXA 3ZJ7A 3ZR6A 4W7UA 1VBRA 5C2XA 4AIUA 2IQ0A 3ARWA 5CQ1A 3GBDA 1VBJA 4HJFA 4B5UA 5A8NA 4HCLA 5K9XA 3DU0A 4RPPA 4WLCA 3LQLA 3S2CA 4P5UA 3PJXA 1RA5A 1TR9A 1OGGA 4OGZA 4CNOA 2BWGA 3EWCA 3GO2A 4EIVA 4MDOA 1V5XA 3S9IA 4DBSA 3DN5A 4NAEB 4EXBA 2ZZ2A 3GWQA 4ROPA 2WJEA 4H1ZA 3IANA 4JKLA 3WF2A 2BX7A 3R0UA 2XGIA 3WG6A 3IIOA 1HX0A 4JCLA 1ME8A 4H7VA 1UUQA 1YKWA 1UWRA 3F7JA 4P61A 3AC0A 5BRBA 1JCLA 1DYSA 5BROA 3EMQA 4FI4A 2OVLA 4FLQA 5A6MA 4NZJA 4O1CA 4HHPA 4ZO9A 3MUCA 2D24A 4RNIA 3PP7A 2GVJA 4YYCA 2BFGA 5FACA 4XD4A 4PMUA 2CHOA 3QSTA 3B06A 3VE9A 5LNRA 4AD3A 3OZMA 4M3PA 4OVXA 4K7YA 4H9UA 2E5DA 4JIEA 1ITCA 2XZ9A 2VX4A 5F2LA 2QPSA 4DF1A 3GXIA 2NUYA 1GWJA 4JHMA 3W7HA 1S2UA 2PGEA 5HQMA 5CC6A 1JDCA 3MKVA 4C6MA 1KM1A 2BXZA 3MMWA 1JZ8A 1SO4A 4IMAA 3N73A 4MVAA 3B40A 2PLKA 1IXQA 2BHYA 2D2OA 4HA4A 7PTDA 3H26A 4JTRA 4O15A 1UP3A 2CBJA 2XIOA 5DMLA 4HP5A 1UA7A 4PC8A 5D2WA 1OFDA 4RDYA 1TVLA 3RLUA 5CCZA 1XL9A 1HFBA 3AZTA 2Z7KA 3OZYA 4UQ9A 1TUXA 3HPXA 1L6FA 3C8NA 5DF0A 1B9ZA 5I3KA 3G1DA 3DI1A 2J74A 2PEVA 3Q45A 1H5YA 3CGTA 1R2SA 3OTRA 1Z32X 5A94A 3R1ZA 2JGYA 4JGDA 1L6WA 2QCGA 3AXKA 4KERA 3NIYA 1B3XA 3FW6A 1UR3M 2Y5EA 4NVTA 1JDEA 1VFLA 3EMCA 4G9PA 3N6HA 3UG5A 1F3XA 1V3LA 2PAJA 4DJDC 1DWHM 4LUYA 5CPSA 2HPIA 4GH3A 5C8BB 1RPKA 3PAOA 1BFNA 2HEJA 3HIJA 4AVNA 1NH6A 3RDKA 3ZFHA 5XIAA 1UD8A 4UTLA 4Q3MA 3L23A 2CLKA 4KWUA 3W74A 4W88A 4A2SA 2BG5A 3N14A 3O8AA 3I4EA 5C7HA 2OWCA 2WPBA 1Z41A 3A21A 3BG3A 4Q8NA 3CWOX 4GZIA 5G4EA 1YYAA 3WLIA 1TJRA 1K8XA 4ZQOA 5D09A 3N6JA 1PPIA 4XZWA 1FCQA 1QTWA 1R7OA 2ZZ6A 4MNLA 2R1KA 2VYOA 3VDBA 4ZQCA 4OIFA 3TJIA 4DZ5A 3SAZA 3CZ8A 3MP5A 3BW2A 2DSKA 3HOJA 4XQ6A 1PCKA 1B3WA 4Z2HA 4OHQA 2CZDA 3WNKA 4PFHA 1KBBA 4ECLA 2A7PA 1GT8A 4JTFA 2RH9A 4HZ7A 4J3SA 3IGHX 2FPVA 4WGXA 2G3MA 1W3HA 4YTRA 2QDHA 3LSBA 2YXOA 4MGGA 4LYQA 2OZTA 3O1NA 4PBEA 4Z2GA 2J78A 3EX3A 4EAYA 4GVFA 3WZ0E 4BR1A 2Z1VA 3NQGA 1Q7ZA 5C9RA 2WKGA 2RDWA 3LHUA 2ZYFA 4K68A 4ES4A 1ML1A 3I6EA 3U57A 1KV5A 3HG3A 3MUXA 3WQ5A 5C2GA 4ZOBA 1K3UA 2OT1A 4JL2A 1RPXA 4O14A 2QCEA 3AJXA 3HQPA 4O1EA 5IM51 3LHWA 2W92A 3LTPA 1QNVA 1SW3A 2DDXA 2E25A 3UYCA 1CX9A 3MZ2A 2P5NA 2AL1A 3CTTA 4CVWA 3WH9A 3QHNA 4AZIA 4DBEA 3B4UA 4H7CA 1ZAHA 4L4MA 4PMNA 2ESCA 1UHVA 3SCRA 4XBJA 2DU2A 4DJFC 5JH1A 1HJXA 1NQ6A 1B9BA 4A05A 1SMAA 3TAKA 3NGFA 3PFMA 2XN1A 2WWDA 1LL7A 2NV1A 1AG1O 4QJ5B 1KFJA 1P5BA 5CXPA 1D3HA 2E6YA 3QFWA 3PNZA 3GH5A 4XZ9A 1K6WA 1V0MA 1OX4B 3HJEA 3IK4A 2NX9A 1W3TA 4HD5A 3K30A 3MJYA 1WV2A 2CKSA 4XAGA 4D6FA 3GNNA 1U5JA 2NQ9A 4DUWA 2QV5A 2YYUA 3LGDA 2Z1SA 4O10A 3W85A 1RCOB 3K1GA 3R79A 1O66A 1NFBA 4NIRA 2V6AA 3F2CA 1Z3NA 3ABOA 4YYFA 4GX9A 3N17A 4TVUA 4LUIA 3GD6A 2R8WA 2V81A 4L61A 3GW0A 4B5WA 3NFUA 1M9HA 3A4JA 3WFLA 2QR6A 1V77A 4AZCB 1NP2A 4PL2A 4CLMA 2FYMA 1ZUAX 2OO0A 3IJDA 3T55A 1W1B1 1ZGDA 3CAVA 4MWAD 2PDHA 1TJPA 1EJRC 2H9AA 4IPLA 5DRIA 2R94A 1W1PA 3B8WA 8TIMA 1VFMA 1KCZA 3PC0A 5M17A 5BXRA 1CYGA 1YDNA 3VMOA 1FH7A 3QC0A 3AMKA 3CUGA 1PEZA 4L6DA 5G2IA 1XIGA 1JQVA 1VFSA 4FS9A 1WB0A 1TMHA 5CJ5A 1MEWA 1I9CB 2REQB 2B0MA 4MFDA 2PDPA 4CNNA 1J01A 3VZXA 3TYCA 4NY2A 4W85A 1MUMA 4PRRA 3WH8A 7ENLA 4B9ZA 5KINA 3M43A 3EGJA 1E6ZA 4CQCA 3E12A 3NDZA 3MU7A 4LYRA 5D2YA 1PYMA 3RUBL 3WBYA 5HPCA 5JIWA 1T8XA 3LMZA 1AA1B 3T4WA 1GYMA 3TH6A 4N9BA 3CB3A 4IF2A 2VVNA 4IXHA 1C91A 3FVMA 1DKWA 1XFBA 3M0XA 4GXPA 1JF5A 3CV1A 2VQTA 3GKFA 4KETA 2HVNA 4O13A 1IZJA 3F2BA 1J5SA 3BSMA 4HPJA 4LF1A 3REQA 2WANA 5CG0A 1R85A 4QHRA 2VCBA 4C1LA 4HU4A 4H2CA 6ALDA 1SO6A 4OBRA 4E5TA 2J7BA 5GQBA 4H6RA 4NX5A 2G4FA 1XWYA 1BTCA 3H21A 3OEXA 4WK9A 2V69A 1VR6A 3I6RA 1IXOA 1CTNA 2VZUA 3L5MA 3KX6A 4R33A 1KQZA 1O5KA 4GIRA 4D6HA 2AMGA 2UV8G 3QRHA 4P8XA 3N3MA 3NXFA 2ICSA 1HP4A 1E5JA 2G0WA 3BC9A 4JCMA 1QNOA 3PG9A 3W7QA 3ITVA 3UXIA 3W37A 1SZGA 2QHAA 3PJWA 1KRCC 3U4AA 1J6OA 1UD2A 2HWGA 2ON3A 3PB2A 4WY0A 5DMMA 3DYMA 1H1NA 4QTGA 4PUEA 2Y7EA 3PUGA 2A3CA 5FI8A 4GABA 3BL3A 1PZ0A 4M6PA 4Z1YA 3E96A 4JDYA 3IJQA 1MO0A 4XO7A 1YADA 3EDEA 4MYAA 4OBTA 4QLJA 4XTIA 3EKGA 4H2HA 2E6AA 3L4ZA 4R9XA 4ZMGA 2NQZA 4GYPA 3R58A 1DPMA 1EO5A 1BTMA 3U3HA 3KM8A 5A5WA 2WQPA 3PS7A 1T41A 4DJED 3FJ4A 3VD5A 2XZ7A 2EG7A 3W7RA 1F2JA 1EJVC 4ZB0A 4J4KA 3GTFA 1GW9A 2PDXA 3T4CA 1AFSA 5H8MA 4CQ9A 2HBVA 3CASA 1PXGA 4S2BA 2QDGA 1WCGA 3VABA 3AU6A 2YCIX 4LUSB 3Q58A 4AC7C 1ZJHA 3SCNA 3N18A 2Z27A 3T0DA 3FA4A 3MS8A 3PUOA 1C90A 2PLJA 1UKPA 3M6DA 1GOKA 4DY1A 1NDWA 1QOPA 1VCGA 2O4MA 1E3XA 3B8TA 2O9TA 1HJQA 2WMIA 4A8LA 3WBEA 4I6KA 1A5BA 1CWYA 3KRUA 1OABA 3MWAA 1XIFA 4P8WA 5AOUA 5A6AA 4HNVA 1H7RA 1V3IA 1JPIA 4O0KA 4ORIA 4UTTC 2QUTA 1IZCA 1GW1A 3GXDA 1VBHA 1AD1A 1B57A 5D04C 3TW9A 1SJAA 1FWSA 3W38A 4ZENA 4CEXC 3GIQA 1KRBC 5HNNA 1XIDA 3WLPA 1BVNP 4B2DA 1WAWA 1SO3A 3W6YA 1FXQA 3CZLA 4WSHA 5C9UA 2IUZA 4XTDA 4TV5A 2UWFA 2DQWA 1ICPA 4OQVA 4YTQA 2JKPA 3M7SA 1QPRA 4ZQRA 3LYEA 4JN8A 4GQRA 2PF0A 4N7QA 3ZR4A 2ZX8A 1Q2RA 2A21A 3UCDA 1MMFA 4POCA 3G1SA 5I24A 1TJ2A 3FV9A 3ITYA 2TODA 1JZ7A 2F84A 4LBUA 3G22A 1WQ5A 1HL2A 4NAEA 3NPXA 4AIEA 2PD5A 4CCDA 4UQEA 4MLRA 2NQJA 2JGQA 2OQHA 3ZS4A 1J96A 3VTRA 5FJIA 2V5KA 5KZDA 4UB9A 1RALA 4FO4A 4O0ZA 3H23A 4AW7A 4MIMA 4G1NA 4O16A 3L2MA 1J79A 4Y9PA 1ZFJA 2VFDA 4LS0A 4N9DA 2Y88A 4PMVA 4Q8QA 2VCCA 2EO7A 1C92A 1Z9AA 3HGSA 4IFKB 5DRCA 5F4WA 3BJSA 1O1ZA 2WAGA 4GI9A 2VDGA 4P2VA 2AAAA 2CC0A 2BGQA 4DJFA 2I5GA 2GGEA 4PMJA 2FVKA 5CBBA 3L65A 3N9SA 3E02A 1VFTA 1ISYA 2OLAA 4NZ5A 4WD0A 4TUFA 4DQWA 5MKGB 3DHPA 5HJLA 1US2A 4Z17A 1CGYA 2OODA 2ZRVA 1VP5A 4NJKA 2O92A 3K4WA 4CGTA 1WDRA 4GWEA 2VWTA 4MHBA 4Z1BA 3UPMA 4ZGYA 2QAPA 4GIYA 7CGTA 3RLGA 2SFPA 4YWIA 5CH9A 3SCOA 1CBGA 5TIMA 1VS1A 2GJPA 4RE4A 3AS2A 1BQCA 3U5UA 2PPGA 3QH2A 3QZAA 1XIMA 3TTOA 2ZTKA 3W73A 1J0ZA 1DXFA 4ZODA 3R0KA 4O0QA 3UJFA 5C5YA 3BLPX 4M6VA 1OX6A 1EWEA 3SFKA 2GUYA 3U2ZA 3TSMA 2BDQA 5DXYA 1ZP4A 5LNWA 4DRSA 3BDKA 1C29A 1BXCA 3F4WA 1ZP3A 2C1HA 3W81A 3GAYA 1DJGA 3AXIA 3S1VA 3CV6A 3S4TA 4Q4RA 3PZ9A 4RUBA 1W3IA 2J47A 1TFVA 4LS1A 2E9BA 4EACA 3LPFA 3AXHA 2GL5A 1FWGC 3LBMA 4TVDA 5D4YA 4ACZA 1ZU8A 2Q01A 3CH9A 5D9NA 3NQ2A 2YA2A 4HK6A 2BXYA 4RE2A 4NHVA 1TWZA 4D71A 3E2RA 4AD0A 2ZRWA 2OTDA 4OBSA 3QLDA 3CZEA 3VDAA 3WENA 1EJWC 1MXGA 4AX6A 1HKVA 4BQ5A 3U4FA 4CD8A 4PGLA 3JZEA 2ISFA 3N6QA 5HNTA 2HSAA 1E4NA 5GNYA 1TV2A 1WAUA 1R2RA 1EQCA 4DX3A 4V33A 1DWGM 2C91A 5I3FA 5I23A 4JNYA 1QHZA 1H1YA 2PWVA 3QPZA 1AJZA 2PP1A 3QHMA 1MVYA 1HL8A 3RNDA 2CBVA 3OA3A 2P88A 1SPQA 1EXPA 3LLFA 3CIWA 3NL2A 1RVKA 4XWUA 3F4VA 2FZ9A 1QMLA 1QOQA 4J3UA 3GZAA 1UW9A 1A3XA 4S3FA 1GK8A 1GVRA 4C6BA 5G1TA 4WQ6A 4WRHA 3P67A 1HTIA 3N4EA 3KAOA 1IQ8A 2X0HA 2Y63A 4E2BA 3LBCA 4BEUA 1VIZA 4YMZA 3KBVA 2XH4A 4IGMA 4ONVA 3GXMA 2O7QA 1WXJA 4ZA0A 3T8QA 2YDRA 5CGTA 4GCAA 1AJ0A 2ODOA 2A85A 3NPVA 2DZWA 5I78A 3V0UA 2I5IA 1JD7A 1JGMA 3LA4A 3DKLA 1PCWA 3THUA 3R89A 2I9EA 1FCBA 3KOYA 3TN5A 4S3DA 1RJPA 2PTWA 3V7PA 3MSDA 2Y2WA 3OQ8A 3WX7A 3T40A 1OSEA 4PEKA 4LVAA 3DGRA 1OY0A 2WSKA 4U3AA 3FEQA 2YDAA 1O7AA 1EGVA 3LGEA 5CPQA 4JTTA 3NQFA 2V63A 1E15A 1E9LA 1VRDA 3VD4A 2GOKA 3PBVA 4Z42C 2TMDA 4Q7IA 1W1ZA 3FGCB 3W87A 1YMYA 1W8GA 1Q6LA 4A4AA 2HROA 3GHTA 1MRAA 1UP0A 3QM3A 1R3YA 3S9YA 1MRQA 1ZNNA 3VOFA 5AC5A 3BURA 3N9KA 2RGMA 5C70A 3V5OA 4PUJA 3APGA 3HB9A 1RJQA 5A2BA 3M4HA 4LRTA 3NZQA 4PMZA 1BAGA 3VGGA 4KWWA 1OX4A 4FNRA 1JNDA 1P4CA 2NQ5A 4KCWA 1KFEA 3A4WA 4F0HA 2PB1A 2UY5A 4FEZA 3UA4A 3KOFA 4DWSB 2C13A 3SRHA 1WNOA 3W82A 1LDCA 3WNLA 3G8EA 3GTIA 5F2MA 1K70A 3P60A 2YOCA 3SQLA 3L68A 4RW3A 1MXSA 1O95A 1XIHA 2QJNA 2VZTA 2Z26A 3DHDA 4REQB 1ZL1A 3GKAA 4AVFA 4N4QA 4NRSA 3V1PA 1DQXA 3QMRA 3WF1A 5E9AA 1GOQA 1XCFA 4AZCA 1HO4A 3MHGA 3HG2A 1CECA 2VFIA 2XN0A 2VQUA 2WBGA 3CV2A 3GRIA 8XIMA 4E8GA 2YSWA 4XIMA 2POTA 3SRFA 2FHFA 4WJEA 3TZNA 5EMUA 1Q7QA 1YNQA 1KCKA 1TV4A 3NGJA 1AK5A 1Y5WA 3NEVA 4M29A 2QJMA 4G7FA 3GNXA 2RDXA 3OZOA 2REQA 1KLYA 2DZTA 4UOJA 3WQVA 1SSGA 4LAZA 4ZCWA 1H60A 3G18A 4GY0A 1JULA 3GNPA 4ATLA 3WD4A 2X42A 4KWOA 2E6FA 4JTDA 3NNTA 2HTMA 2NZLA 3UZYA 4LYPA 1E73M 3HFTA 2VFEA 4A3HA 2QCDB 1H11A 1OX5A 1QNPA 2Z24A 1M7XA 4RK8A 4L4PA 1FP8A 4KRUA 3KVMA 3MQTA 4Y7EA 4N6FA 5T8GA 1VKFA 1UB3A 3QW3A 1EJUC 3C61A 4XUGA 3O6AA 2IMRA 4U5IA 4AIOA 2XM2A 2OYLA 1RY8A 1CB7B 3MTWA 4LWWA 5KITA 1N8WA 5CJMA 2X1IA 1KFLA 1Y8BA 1XLKA 3MCMA 2W91A 2ZE3A 3NXLA 3ARQA 3UWWA 4ZO6A 2V5BA 1MNZA 3WD0A 3CUJA 2Y7DA 4A3RA 1NDYA 2GWNA 4E6MA 1VBUA 1DJQA 1NDZA 2PWHA 1FFRA 3BTNA 2EAWA 5AHNA 2EEXA 2HXTA 2VC7A 1PX8A 1RH9A 3HFYA 3Q94A 3GAKA 2QT3A 2BVTA 3GX9A 3W07A 3VE7A 2VOMA 1E9YB 1SJCA 1TCDA 4H8UA 4TTUA 4YL2A 4BKNA 1LBFA 3RMJA 4UMCA 3QV8A 3FAWA 1UPPA 3T0AA 2PDKA 4D2JA 5DELA 4FZIA 4QAIA 1T7LA 5G5IA 1LL4A 4AD4A 4PRTA 3QR0A 4GG9A 2QKFA 3RHGA 3ENLA 4K37A 5G2HA 1FRBA 5IOBA 1QBAA 3ANUA 1Q66A 4NASA 2ZXBA 1PBGA 3OJGA 4D6IA 1KTNA 3WKZA 2BV9A 1E70M 3LCHA 3A3WA 5KZEA 1VFUA 3GC4A 1CGXA 1RUSA 4YXGA 1XXXA 2I5QA 1TVNA 1JYNA 3M07A 1SZNA 5I79A 2OMAA 3APYA 1XISA 3NZPA 1D3CA 2NXHA 3A22A 4QXIA 4AEOA 3O15A 4ZTXA 2HQAA 5E93A 5CBIA 4KT2A 1PKMA 3G0UA 2VENA 1IT7A 2BB0A 3SSZA 4J9JA 2F8QA 5I3JA 1GJWA 2DY3A 4YNGA 3W7KA 2H90A 2Y0FA 2ONEA 2FFCA 2CZEA 4EPEC 4DWSC 4LUSA 3SRKA 1FDJA 4C6JA 1Z42A 5B80A 1QWGA 1H51A 3DFHA 3EKLA 5TQLA 4N2YA 4V2XA 3IUDA 4G5DA 1VEOA 2PBGA 4DUVA 5IDZA 1OYBA 1ZRQA 3MDWA 1SFSA 2GVYA 3FKKA 4GRSA 1K8CA 1R2TA 4GUIA 3RM9A 4P7QA 1W17A 5HNRA 2YDSA 2CZFA 4NL1A 2FB3A 4IIEA 3IRDA 4TQTA 3GIPA 4Q7NA 4Z2LA 3VIKA 1UD5A 3NSMA 3N2BA 3BJFA 1A5AA 3MWCA 1PHWA 3NVTA 5HXMA 3UZZA 4AHQA 5F4SA 4CCEA 2E5CA 5AB3A 3LN3A 4UWMA 2Y70A 3BPWA 1DJWA 2POZA 3QR1A 1PVNA 2PZNA 4DO5A 2PI6A 4U2YA 2HDJA 2RKXA 4A35A 3CMJA 1ENUA 2GSEA 2OWWA 4IZGA 3SUVA 2OLSA 4AVOA 3CJPA 4L64A 1G67A 2C79A 1RHCA 4YS1A 3WH7A 5IHSA 1NM9A 3E0IA 1I45A 4JIHA 2ZVRA 3WJXA 4LSBA 2J8GA 1OK4A 5IBXA 3DBNA 4D6CA 3J7HA 4UTFA 3KOXA 2Y85A 2OJPA 1IEWA 3EEZA 1KRMA 1OFOA 3C3UA 1TPVA 3TTSA 1PTAA 4J2MA 4MAVA 1V3JA 2PTYA 2IQDA 1BHGA 1DVJA 5C55A 1B31A 1M03A 3FJNA 3UXAA 4IFKA 4GXWA 3GG8A 2F6XA 4QG8A 1FHLA 4KFOA 1EP1A 3ZT6A 1LWJA 3KTSA 1SYTA 4Z0JA 3LPOA 1K9FA 1VCFA 5HAOA 4QIUA 5AHFA 4N02A 4XB3A 5MKGA 2ACQA 2V2HA 3N13A 1HKJA 1VIWA 4X2PA 1I1WA 3WD2A 1M1BA 3S46A 2BXVA 2V67A 4C7GA 1A80A 1XW8A 5J8LA 4LF2A 3WBWA 3KLKA 3N2CA 4K2SA 3LCGA 3GDMA 1R46A 3OHIA 4E0CA 4W87A 2CETA 3SR7A 1UR9A 3LRMA 3B9AA 5A6BD 3DFSA 2PU1A 3TYUA 2DJLA 2RDUA 3UZWA 4PMXA 1WXZA 1XGZA 4W8AA 3RAOA 3PUEA 3BLLA 1E6PA 4CEUC 3TE9A 1VPQA 1TV7A 2CW6A 2VRQA 1ADDA 3N3TA 1PTDA 1ISVA 1OFRA 2PDIA 5BMWA 4AU0A 3TW7A 5M03A 3PFRA 1EJTC 1YPXA 3F03K 3H2NA 1J0JA 1GTEA 3SY8A 3QF0A 4FK9A 4WHBA 1BG9A 1H5VA 1VBGA 1PKNA 1HW6A 2HNEA 1C8YA 4KIEA 4I7WA 3AMCA 1A0CA 1WZKA 3FXYA 2VO5A 1EL3A 4EANA 5E0FA 4MMWA 3UGRA 2RAGA 1K7XA 1YTKA 2EPLX 4PCSA 4LTSA 3PWIA 1JCJA 1AQFA 2J62A 3BMXA 1MEIA 2ZC8A 4ZB2A 4MZ1A 5BWAA 5EBUA 1ISZA 4QQ3A 5EB8A 1ECEA 2WSRA 1XLCA 4UC5A 4GMEA 4E4FA 3RILA 4TMBA 3WMLA 1J2WA 3SQSA 1KXTA 4YCOA 2QDDA 3TQ0A 3UQNA 2C0AA 1GHRA 3JW7A 3CAWA 1JGIA 8XIAA 3V0TA 2D2HA 4OUEA 1TCMA 4QNWA 3GZ3A 2Z2BA 1F4AA 1GVFA 4JFUA 3VXGA 3ELFA 3MB9A 4HBKA 4H8VA 2VVSA 1K1DA 5A8PA 1L6YA 1DORA 3ITTA 1EF2A 3KL5A 4PL1A 3AQUA 3ERPA 2NXGA 2WJFA 3WQFA 4QG9A 1I0DA 1L2QA 3BARA 1YW1A 4QJ3B 3W7LA 2PTZA 1WKYA 5EGRA 3TA6A 4LY4A 2ABBA 1W1VA 1I60A 4H4IA 2VFGA 1VHNA 1BEUA 2WZEA 1JDDA 1LJYA 4IPJA 1EXBA 2V5JA 2ZZ5A 3U2OA 1V7AA 3N11A 4GK8A 2J9YA 3BMVA 4LAKA 3VOHA 3N4FA 1QI2A 3CNYA 2EBNA 1CPUA 5AHLA 3A5FA 4LFYA 3TNBA 3WJZA 4UTMA 3S5OA 5K4ZA 3OLEA 3AHXA 4IMGA 1CGWA 4L65A 4LT9A 1EHAA 4B5XA 4W5UA 4C65A 4GI4A 4AG0A 3D3AA 1B2YA 4Z08A 1EDGA 3FGCA 4XO6A 1M01A 2PGRA 1JAEA 4LV4A 4Z2IA 2ABAA 2J7GA 1KM6A 4FLOA 2XH2A 3T78A 4IPNB 2QVNA 2UBPC 3I3EA 3U6WA 2WZIA 3M1ZA 4OZOA 4B15A 4NJJA 3AYSA 1PS9A 3H2OA 5EU9A 4XKYB 1JCYA 3PZMA 4RNFA 5BWFA 3KL3A 1U33A 5EL1A 3YPIA 1XS2A 3DKJA 3QZEA 4AC1X 4H6EA 2A5HA 1CLKA 3W1PA 1VYRA 1W0MA 1IV8A 4PODA 4DWSA 3PPCA 4CCCA 3DFQA 3VIPA 5HUPA 1JG9A 4W7VA 4S3JA 3A64A 4S3EA 1KLZA 2FHBA 1SFJA 3CHCA 3MT1A 2NVDA 3O16A 3INPA 5LNUA 2OEMA 4UCFA 4G56A 3I65A 4REQA 4E2DA 1XFCA 1P6CA 2CFFA 5HINA 5BXPA 3C6CA 1JYXA 3ZWSA 5A8MA 1BF6A 1LOLA 3EXTA 3ITGA 1DJNA 2I17A 1ITUA 4MZYA 4J3VA 5EMJA 4IFOA 3C2RA 4DO7A 3A9BA 4ML4A 3VGBA 2UY2A 3ES7A 1XPGA 1FHUA 2PDWA 4IGNA 1TVPA 3FXGA 3I3BA 2B81A 3W3OA 1DWFM 3GU9A 3BCDA 1K9EA 3IJIA 4R7OA 3WQ4A 3PF3A 4X9SA 5H8UA 2ALDA 2MANA 1UZDA 1Z6KA 1U1JA 7REQB 3UR2A 1XLAA 3CIVA 5F1UA 4N42A 3UVAA 4GI6A 4ALDA 1FUYA 3C2YA 4Y8EA 2QCDA 5FAJA 1ALDA 2KZHA 5HATA 2ZUUA 3W75A 2FPTA 3DYOA 3KWSA 5E0CA 4CKQA 2VEGA 4E4UA 3H8AA 3FIGA 3W23A 4C5YA 5M2FX 4GIAA 2C6QA 3KUMA 1LLWA 5JXQA 1G4EA 3UERA 1E40A 3I3DA 2OEJA 1SU5A 1EJXC 2EPOA 3WF3A 1XLMA 2G3FA 2WSPA 4ZE5A 3UWQA 3OIHA 4CD5A 3SFWA 4PN2A 2A3EA 1GZGA 4LUJA 4W4QA 3NJ3A 3SY5A 3FX4A 4DO4A 4GO8A 3VIGA 4AHPA 2VGGA 3LSCA 1UMLA 1W1TA 3SCQA 3C2EA 2ZUNA 3LGGA 2G95A 3OLIA 5C71A 2F9RA 1YIXA 4O54A 3AROA 1E1EA 3II1A 2QCHA 1P0EA 2J7DA 4EK7A 1E0TA 1IT8A 2WNNA 4CVUA 3T0BA 2ANUA 2PODA 1Q8AA 1VENA 3AHTA 3W00A 1XUZA 1CIUA 2DUAA 1Q8JA 2BBFA 4HA0A 1K8ZA 1EPVA 2EG8A 3N34A 2VX6A 3VC5A 4QQUA 3TDFA 1U5VA 4LNYA 3UZJA 4IXXA 3OODA 2EPMX 3ARXA 2Q71A 2D22A 2BOFX 3KRSA 3L5AA 5DT5A 4JR5A 4LRSA 3W1RA 5G1YA 1KC7A 2V38A 2F6UA 3N19B 3M9YA 4OFCA 4IIFA 4MJ4A 4TO8A 3SJNA 1OD0A 2PP3A 3A5VA 3QYSA 1PZ2A 2D2JA 4PTWA 2V5CA 5CSYA 3D47A 1TPEA 4MNKA 4RPQA 4RL3A 1EYEA 4JN7A 5I77A 2FZ8A 3CUXA 2EJ1A 2WCGA 2V3DA 3ALFA 3HQNA 5LA1A 3A47A 4K3ZA 3WDPP 3C0QA 3WL1A 3LBOA 4RXFA 1DJYA 3OBKA 4UNIA 1OD8A 4JNMA 2A7RA 3TJ4A 3GVVA 1IT0A 1TTIA 4KBXA 5LKYA 4JN6A 3KS5A 3DXIA 3W1AA 2PDCA 3EWZA 4MY1A 3AWOA 1DWJM 1MW3A 3M41A 3EWUA 3EAUA 4HCDA 2WO5A 1OIFA 2Y7FA 5AY7A 3BCFA 1JDAA 3O6CA 2VGIA 1G1YA 3AIUA 1J6PA 4PTDA 4NNAA 1M6JA 3UPBA 2DSZA 4GOAA 3R12A 3N9RA 2CWNA 3PPHA 4B3ZA 2H8ZA 3TYEA 2F38A 3B0PA 4IFRA 3AUJA 4MB3A 5BOEA 4KGJA 4LUTB 5GPRA 2OX4A 4LNCA 3T7VA 1GNXA 5ENLA 3FOKA 3GDTA 4UIOA 3SZ8A 2QXWA 4J28A 1RLCL 1US0A 3WK3A 5BXTA 4DHGA 2ZA3A 2F6KA 2H6RA 2DZSA 4RV8A 5K9CA 4Z0SA 3LTYA 4QFUA 3OG3A 4W93A 1Q63A 2NLYA 1X1OA 4F0KA 4R9OA 2VKZG 4D8ZA 2ZX9A 2G50A 1CNVA 4LC8A 5I07A 2ZTJA 4TX9A 3K8MA 3VKDA 5HBFA 2Q3RA 5FEXA 4K38A 3AJ7A 1DE6A 3BW4A 1NF0A 3WD1A 4NZFA 2Y4SA 1GQNA 1UR2A 1XH2A 1ZHAA 3ZJ6A 2O4QA 3L4WA 1XI3A 1BLIA 3G0XA 2ZX7A 3Q4DA 5CC7A 1P48A 1RK6A 4RR4A 5M5DA 4U4MA 1E56A 5AHEA 1S5VA 5AZ1A 3W1MA 4HPNA 3AHVA 3LUTA 3WNNA 4GBUA 3T2QA 3VILA 4QR6A 2UY3A 5K7JA 1A5UA 3TJXA 3SADA 1LBMA 1QXLA 3XINA 4PB5A 1QI4A 2MNRA 1B30A 3PUDA 5I0DA 4IQEA 2PC4A 3THDA 4OOUA 3VNJA 3PJUA 1EFZA 2VNCA 3IGSA 1NY1A 2D0HA 1Z8AA 1JZ4A 1NWUA 2Y1HA 3KFTA 2G5WA 3TUUA 1KGWA 1X96A 4GX8A 1FOBA 2HXUA 4ADTA 1BWVA 3S5NA 3AUOA 3NQ6A 1KFKA 2X0YA 1XPYA 3VGDA 2GPTA 1XLLA 2ALRA 5I03A 2FPYA 4PRWA 3IUHA 1JPMA 3LCLA 3TEVA 2EXOA 2AQVA 4WKFA 1OM0A 1GZ1A 4B91A 3S1UA 3NO5A 1V79A 4H9YA 3JUGA 3H22A 3G1VA 1IE7C 4Y8FA 3VD3A 3W6LA 2PDGA 1JFHA 5AZ0A 2QW5A 2JE8A 4PE8A 3IJ9A 4UFMA 3IV8A 3P14A 4R5EA 2XYLA 2PGFA 3LXBA 3NOEA 4DXKA 4J35A 2D20A 3MJMA 3VKAA 1D7KA 2FGZA 4GJIA 4LB4A 3XIMA 4BHYA 4CU6A 1A5CA 2ZZ4A 3SBFA 3SCPA 4EPKA 3T1GA 2BY3A 3AO0A 2XIMA 2NX3A 2G97A 2PCQA 1UWIA 2TSYA 2JIWA 3GFYA 4OKDA 3IK2A 4TX6A 3ZT7A 1R3WA 1Q45A 2I1OA 3PZVA 3B0XA 4CD6A 1FHVA 5HANA 2WZTA 1H4PA 5ECVA 3CAQA 3DEQA 1I2QA 3FJ6A 4H9MA 1LUCB 2E1DA 2FDMA 4D8LA 4BS0A 2G96A 1UZ1A 2QV4A 3TYAA 3F5JA 1CDGA 4X0VA 3M46A 3BZGA 2QIWA 3KS6A 4DZHA 1GOMA 3N2OA 1WDDA 5K4XA 2BNJA 2VX5A 3P93A 4K8HA 3FKRA 3O0KA 2EPHA 1TJ0A 4B5VA 2FTPA 4GUFA 4LS2A 3BLOA 3ONCA 4CN1A 1J93A 3L7RA 5EMYA 4WOZA 1AZ2A 2YW4A 1TWSA 2YFOA 5FKYA 1BKSA 5REQB 4PB4A 1JYWA 1JRCA 1R86A 2O0TA 3K5XA 3AMGA 4B9YA 3ITCA 4MUPA 4HMNA 3KVLA 1I2OA 3NUKA 3DECA 3IIPA 3SCTA 2NW0A 2NSOA 1GCYA 5A1AA 3EBVA 4J7RA 4HCHA 3W02A 3ICJA 2GQAA 3WQOA 3BSGA 1U30A 4JIRA 4KFPA 3BLIA 4XD6A 1KKOA 2JKEA 3H4XA 3VNDA 3CU2A 2RHGA 5U4NA 1C3FA 4N9CA 3WYZA 4UMAA 3DGBA 2FH6A 2W0UA 3ZSSA 2PSNA 3MUAA 1ZCOA 3C52A 3NR0A 2E0PA 4H01A 1KB3A 3WK2A 4NJIA 2W9MA 3SUWA 4EE9A 4R7JA 3CL8A 4B2DD 4M6UA 3SCSA 1RQHA 3MUY1 1F7BA 3AIVA 2VX7A 3B8UA 4BQ4A 1XINA 4ATWA 1X8FA 4WXYA 2DIEA 3EXRA 1UMYA 4RE0A 3QGAC 1LYXA 2BODX 1IGSA 1HGWA 3STPA 3LCFA 3KVKA 5A8GA 4FAMA 4B4HA 3RJYA 7TAAA 1B54A 2GQ3A 1XLBA 5A6KA 1FDZA 3RN6A 3AISA 3EZ4A 4XKYA 1EUAA 5CPOA 1D9EA 4QROA 4M1BA 1RVGA 4EPDC 2JALA 1S5NA 4RZBA 3AXXA 2V3EA 3AMLA 3RIKA 4F0LA 3FAXA 4M24A 5BZAA 4HMEA 2ASHA 1MQRA 2J77A 3GUGA 4GLEA 3UJEA 4YU1A 2BOEX 3ARPA 1FWRA 1RA0A 5ABFB 2WMFA 3KZPA 2OKTA 3R2GA 2A3LA 4FNUA 4AZ7A 3KP0A 1JXKA 4IM4A 1YXYA 4DJFD 2QIIA 3SEPA 1SZFA 3GR7A 2ZA2A 3W2LA 2W67A 3F4NA 1GGOA 5HWJA 5CSUA 4ZFCA 1KBKA 5IRPA 3BICA 4LEFA 1YPIA 2DZVA 1VYSX 1XBVA 2ZRXA 2XFRA 4LCQA 4HYVA 2DQXA 3S47A 3WLNA 1VD6A 3GY1A 2GJNA 2INEA 3BLFA 5C9XA 3WLSA 2IPWA 2FTYA 1W31A 4RDVA 1CLXA 1IZKA 1Y5VA 1Q6FA 3COTA 5G1MA 3LD5A 3QZ6A 1T96A 1KM2A 2WC4A 2BY2A 1TTPA 2P76A 1P0KA 3TN6A 3DESA 2PDLA 3WSUA 4WIWA 1ODZA 5MHBA 5DT7A 5FF3A 3TQVA 5LNSA 1GQJA 1C8XA 4FLRA 2ZZ3A 3EKZA 4B92A 6REQB 3HG5A 3OOQA 2FTWA 3OYZA 2YKKA 1S2CA 4LYKA 3U9IA 2YL9A 2WV8A 1C7SA 4HA1A 1ONWA 1XYFA 3MW7A 2E67A 4DZIA 3SCVA 7REQA 4HVXA 2Z7GA 5CGMA 4QE1A 5LHEA 4BCEA 4WR3A 1VJSA 3HPZA 4EX4A 1AMYA 4XD5A 4R85A 1PAMA 5HNUA 5E70A 3R8HA 3W7IA 4XIAA 2OO6A 4PFMA 3LRKA 1TIMA 2CLEA 1XLIA 4H9ZA 3ZM8A 2TPSA 3AAMA 1YPFA 4IWWA 2V30A 1ZS2A 5A6TC 5C7VA 1AJ2A 1B1YA 1SFLA 2X16A 4OU1A 5T91A 3B9OA 3LPPA 4MKNA 4OV9A 1NOFA 4JKKA 4DBUA 5K2ZA 4CN6A 3LLXA 5K3VA 3QGKC 4XZHA 4TU1A 2J88A 3UYIA 1JQXA 1TQXA 1S5WA 2XN2A 2OZ3A 5CAHA 3NQMA 1W3NA 3MBDA 4C7FA 1KTCA 1X6LA 3OU8A 1E72M 4FP1A 3H12A 3WN6A 7ODCA 4FHAA 3IUIA 3W7DA 2O9OA 2A0NA 3W2UA 2VFHA 2XVLA 4JYFA 4WDXA 4P8UA 5HK4A 1VPXA 3BLKA 3G6MA 3SN1A 1JUBA 1A5OC 3MCNA 1O5RA 3BAYA 4JHOA 3M0VA 2C1GA 2XG9A 4J3ZA 4CUCA 3QN3A 3W7CA 1Z69A 1F07A 1XLHA 4X9YA 3HGRA 3N29A 2DORA 4PR4A 3ORWA 4WY0F 3DG3A 1WDPA 1CCWB 3QVQA 1BGAA 1NAL1 1Q6GA 5IXEA 2DFAA 3R43A 3I68A 1OFBA 4CNTA 1AODA 2QQ6A 3UR7A 2J6VA 2V2DA 4UFLA 2IKHA 1OFPA 1XH0A 4JTKA 4B3KA 3MA8A 5IHRA 4TIMA 4JQ4A 3P61A 1O5XA 4LW7A 2EHHA 1KKRA 2P53A 3DH7A 2C16A 3LY0A 1TWWA 3EWBX 4FIRA 3DOPA 4WDTA 1H61A 3DC8A 3RRXA 5A2AA 4Q6JA 4C91A 3T09A 2VMFA 2DSWA 1HKIA 1HKKA 4AMCA 3S1XA 4X3ZA 1H0GA 4B90A 4DBDA 5JBDA 1H7PA 4MB5A 1GVIA 3WO8A 2GGJA 4Q8WA 1N82A 2IQTA 3NA8A 3P0XA 1EEPA 2VD8A 5I3HA 2FB2A 1W37A 1JFXA 1ZSXA 1F73A 2OR2A 2ZRYA 2GJLA 3L4TA 2EPKX 4HPHA 4LALA 1VJZA 3ZJKA 2BOGX 1Q5MA 3H2FA 2AL2B 4HNCA 3UXDA 4O1DA 5LIUX 4AWTA 2WZMA 1DHPA 5DQPA 1EP3A 4LEQA 4LY8A 3B0UX 1HZYA 2V5LA 3KRBA 4GQGA 3PANA 4PSRA 2VDIA 3THAA 2WB5A 5AC4A 2P1FA 4I5XA 3UVIA 3TLQA 7XIMA 2P50A 2IS7A 4ILSA 3CEUA 4DJEA 1MFVA 1QI5A 1UUOA 3CEPA 4IQLA 4XD3A 4M81A 2LLEA 1W9UA 2A1YA 3WJWA 3H7UA 3OW1A 4XAFA 4L56A 1QU4A 1V03A 2FH8A 5F1VA 1FA2A 5JBFA 2C15A 1R9YA 5LHFA 1YTEA 4OT7A 2J13A 3ARZA 4LUTA 1OG6A 2J9XA 3BQ6A 2VR4A 4ASTA 1QW9A 1FWHC 4OE7A 1GEQA 4RZ4A 4LU0A 3R8RA 4C60A 1TPWA 5HUOA 4B16A 1X8CA 2CCRA 3PWAA 2E9LA 2Z25A 1RR2A 4E3TA 2PLMA 2YYTA 1KRAC 4DLMA 2BSLA 3DG7A 1XLDA 2W79A 4PEEA 4GFSA 1QPKA 4QLLA 3B4YA 2HK0A 3W7JA 3QOKA 1OGSA 1WUFA 1XG4A 5IFTA 5HWNA 2AQOA 1XCXA 2YCJA 1EWDA 4JTGA 5FJTA 4ZFMA 3CWHA 5HDRA 4XUYA 3S2JA 1L0PA 3TW6A 1L8PA 2JEQA 4C6DA 2VGFA 1VCVA 2W63A 1TIWA 2J7EA 3A9IA 4AH7A 1PKLA 4ICMA 4IJCA 2DPEA 4MB1A 3W1QA 3L5LA 2NVAA 3MV11 4FXJA 4F0RA 1QI0A 1QHOA 3S3GA 1TTJA 4PUNA 1UR4A 3GVQA 2R1MA 1VHCA 3BK0A 4AD2A 1WOAA 3R6IA 2OCZA 3G1AA 4HZ8A 1ISWA 4TXEA 3KL0A 4HMDA 1QPQA 3NVDA 4US5A 3UWZA 1XJBA 3V5FA 1F3EA 2WSYA 3L67A 1UWUA 3AIBA 2QCMA 5DY2A 4X60A 2YCLB 4UNLA 3GR8A 2CPUA 4D6JA 2VT0A 2QUVA 4Y90A 1G6CA 3HGJA 3JR2A 4ZTYA 1LLZA 2W61A 2WMKA 1HQTA 5HWMA 4XZMX 2ZADA 2VJXA 4GYPC 2DV0A 1Y5XA 2GQ9A 3WUEA 3ZT5A 3LM3A 5BRQA 1V93A 4MZ8A 4NT0A 3M0YA 4DI8A 4BI5A 3LHYA 1O60A 1XYAA 5D8ZA 4L1WA 1VRXA 2Z6IA 1GVOA 1V6VA 2WM1A 2VEPA 2FLIA 1CXLA 4JX5A 3LTSA 3M64A