5C5YA

Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
SDIKAVAQRALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIATVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNETIGFDMVKVCKQACSGNAKLKVIIETGELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAIYLDLADNILGNEWADANHFRFGASSLLISLLDTLGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Colwellia psychrerythraea (strain 34h / atcc baa-681)
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
total genus 95
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c5yA00
3W1UA 4YXGA 3TX9A 3LBCA 1ZNNA 1H7WA 3NQ2A 4ADTA 3M7WA 3EX3A 4GUHA 1FWTA 1KM4A 3T44A 1VYSX 3TROA 3W84A 2ZRUA 5DBUA 4DQWA 1WDWA 1ZY9A 3LRLA 2VFIA 2WKJA 1S5VA 2Z0IA 3DENA 4TIMA 2B7PA 4BF9A 3C8FA 2C3ZA 2DJXA 4WOQA 4UTKA 1MO0A 4LTSA 5FEZA 2I9EA 3W1XA 3QH2A 2GVJA 5C6MA 5DCDA 1TPEA 3UXAA 2ISSA 3NYZA 3A9IA 3KVJA 4Z0JA 3MO7A 4XKYA 4A29A 2QUUA 3UXDA 1S5WA 4HNNA 1XC4A 1W0MA 3BVJA 4LUJA 3UNDA 3MUXA 3ABRA 1YPIA 4JY9A 2V81A 3M41A 4MVAA 1FBAA 2H8XA 3QPYA 3S0CA 1BKSA 1KA9F 2O7QA 4N6EA 4PH6A 4KFNA 3OVRA 3CTLA 5AC8A 3ZWTA 3TK7A 3PG9A 4PC8A 2GUUA 2R94A 3NPVA 3KVLA 3W7RA 2FPYA 1H51A 1PV8A 3W07A 4M7TA 4UTTC 1SO5A 1K8ZA 1TPC1 1JCYA 4ADSA 3NO5A 2I1OA 3SI9A 3LX9A 4JN6A 3PUEA 1GVOA 2WV8A 3VE7A 4JTSA 2XFWA 4MPQA 2X2GA 3W75A 1TPB1 3R8RA 5FI8A 2V9DA 3B8DA 1QOPA 1N8FA 2C19A 3NR0A 4GNJA 3ZFHA 4UTUA 5LNSA 3L21A 4LOCA 3NQFA 3OEXA 4NXKA 1OFAA 1NFBA 1OFPA 3MW7A 3S8HA 1OABA 1LRTA 4Z1DA 4UFHA 3DFOA 3LCLA 2C13A 5K9CA 3DXIA 3HPXA 4XTDA 4AH7A 1Z41A 3SGUA 1OFBA 3MP3A 1J2WA 5EL1A 5G5IA 3M5VA 1P4CA 2Y7EA 2YPIA 3LHVA 2YSWA 1H7PA 1MZHA 2B4GA 1ZALA 1ZJIA 4O19A 3L68A 1IXPA 2RDWA 5CPLA 1MEHA 4LY8A 2JBMA 4JTGA 3GNDA 3LXBA 2CLIA 1MEIA 2ZCGA 3EEGA 3A24A 5BW6A 3VI2A 3NXFA 2NXHA 5LGZA 3NQMA 2CZDA 1XUZA 2GVGA 4UTHA 4TU1A 1HTIA 4DO6A 3CIWA 5DCEA 1W31A 1WX0A 1KFJA 3WJYA 1I4NA 1QAPA 1KTCA 2EAWA 3AJXA 1DJQA 4UUIA 4UIOA 3O16A 1XL9A 3TH6A 4LS1A 1B57A 2C1HA 4DEFA 6TIMA 3S1UA 2EF9A 5BMWA 4L4MA 1KW1A 1SU5A 3HF3A 4IMGA 1KBIA 4I7WA 1DHPA 3QC3A 3TIMA 4O1CA 3GDLA 3O8AA 2B7NA 5AHNA 3ZR4A 2IQTA 5CSRA 1X8FA 3WK3A 1EP1A 3BLEA 1JCLA 4OQVA 4TX9A 1ICPA 3W7MA 4JYFA 3C2VA 2QCHA 3PF3A 3S42A 1XBZA 4FEZA 4IMFA 2G97A 4PCFA 2Y85A 3STGA 3PBWA 2A0NA 4Q32A 1GTHA 1TV8A 1G7VA 2C14A 3G0UA 2FJKA 3FJ6A 4X3ZA 4UTIA 1XFBA 1ZCOA 2RH9A 1T96A 2A4AA 3SZ8A 3Q94A 3E49A 4M6VA 4LC8A 4GUIA 4J9JA 3UPWA 5EMUA 3VFLA 2E5BA 4Z08A 4QQ3A 1QOQA 3NL3A 4JICA 5AC7A 4GRSA 1LCOA 3G1YA 4JX5A 2OMAA 2ZZ4A 4AF0A 3EB2A 4O52A 5G2HA 1DQXA 1JQVA 3B0UX 2NX9A 3C2OA 1VYRA 2Y62A 2CLMA 2ZRYA 3PSWA 3S5ZA 1TCDA 3P7YA 3PUDA 1OF6A 2CZFA 1TB3A 2QCDB 4IX0A 4O17A 1BEUA 3KFTA 3FKKA 4A22A 2NWRA 5G4EA 1H50A 1W5NA 3EXRA 4AWSA 3BPWA 1W3IA 1OJXA 1PCKA 1OYAA 3LCGA 1PVNA 4JYDA 4M7SA 1GEQA 1KM2A 4IMCA 1U5JA 2QCNA 5SWUA 2A7NA 3N73A 4GUFA 4HNUA 1GVRA 4MFEA 1E51A 2ZQ0A 1SFLA 4D2JA 1C8VA 1PS9A 2ISVA 4KWWA 1GYLA 5D02A 1NAL1 1XDLA 2CFFA 3HG4A 4LRTA 3I7SA 4NJGA 4N9DA 1GPWA 3TR2A 4TO8A 3ABQA 4GWEA 1OFDA 2R8WA 3DI1A 2P10A 1GT8A 3G1HA 3NAVA 3KHJA 1LRNA 1G67A 2GVLA 1R46A 3NQGA 3E9AA 4NT0A 4PL2A 5D2YA 1OK4A 2OJPA 1LP6A 3O6CA 3QFEA 4UMBA 3UWUA 4NUWA 2NXGA 4MUZA 5FEXA 4HPXA 4NXSA 5D09A 5G2WA 4UTTA 2J88A 3BGGA 3W83A 4XZ9A 2C6QA 1EB3A 4C1LA 1UCWA 2NX1A 3MI3A 3HG3A 2ZTKA 5D2XA 2FB3A 4HSOA 2O7SA 1TPWA 1K8YA 3RNDA 1KM6A 3RU6A 1EP3A 4X2RA 3GDMA 3KRSA 3STEA 4K36A 1FY6A 4LC6A 1FWWA 2JKPA 3G22A 5HQEA 4DO5A 4M6QA 5CPNA 4JTIA 4Y96A 3MHGA 3C6CA 3LDVA 4DBEA 3P62A 1QDSA 3QSRA 3SGZA 5AB3A 1KV5A 4RXFA 1P0KA 3BV4A 3K30A 4LVGA 1VYPX 3PS7A 3FYOA 3Q37A 1LM1A 1ALDA 3AO0A 3KRUA 1I2RA 4RX0A 1K03A 1DOSA 3H55A 5FF3A 2TSYA 1AG1O 3LV6A 3P61A 3NG3A 3CEPA 3HQ1A 1TPUA 5DCBA 4N4PA 4CNNA 3M1ZA 4OWGA 1H60A 2DJLA 4HHPA 1MSSA 3FA5A 4UTMA 3PM6A 3THQA 3SFKA 3TAKA 5BOOA 2QUVA 1F74A 3PBYA 1QO2A 2X1TA 5I3KA 3QPZA 3JR2A 3IIOA 3MBFA 2GOUA 1ME8A 1TPFA 2HSAA 1CX9A 1OX5A 3IEBA 4OV4A 1YADA 4XTIA 4ADUA 4XUGA 3B04A 2G5WA 1JCJA 1LOLA 1Q6QA 4DF2A 5K4XA 1ZAHA 2NUYA 3NL2A 5HWMA 3STFA 1SZGA 5I3JA 4WY0A 3LRMA 1SO3A 5D2VA 4EF9A 3QW4B 5HNRA 5HUPA 1NVMA 1Q3NA 4IPIA 3M5ZA 2DP3A 4O14A 1FQ0A 2ATMA 3A21A 1OFOA 3FEMA 1VHCA 4NJHA 1XUUA 5EBUA 1FX6A 5F2LA 4M6PA 2CLFA 5KZMA 4FO4A 2C0AA 1JVNA 4JTEA 4AWTA 3WJWA 2Y88A 3L67A 1B4KA 3DGRA 4K6AA 1TPVA 2ZZ7A 4MY8A 1OFEA 5I3FA 1AMKA 4NJKA 1YPFA 1F76A 2BWGA 5EY5A 4O11A 5AOUA 4LV9A 3S5YA 3BARA 2A2IA 2LLEA 5G2IA 1KTBA 1QO5A 4UMCA 1FDYA 1BTMA 2X1SA 4O57A 3I7RA 1K7FA 3O06A 1O5XA 3ABSA 5D32A 3CB8A 4PEKA 2GQ9A 5DY3A 3JRKA 3L0NA 4LWWA 2H6RA 5AN7A 5F4XA 3OVQA 3L65A 1QPNA 3G8EA 3G8RA 4NJIA 3R13A 5D2WA 4DXVA 4HPJA 3W1MA 4KFOA 1QPQA 3O6YX 3QRHA 3W1LA 3W7JA 5EA9A 3C61A 3IVSA 4FNTA 1AK5A 4BI7A 2QUTA 2YYTA 2H90A 3M43A 3G1FA 1TPH1 4NX5A 5D2TA 2ZFAA 2E5DA 5KZDA 3PR2A 4MZ1A 2NZLA 2ZYFA 4K37A 1I2PA 1W56A 4LVFA 5AHIA 3UWVA 4UFJA 3G3DA 3RFAA 3P81A 5BRBA 1F7BA 3CIXA 1K02A 3PUOA 4K8HA 4HKPA 6ALDA 3LB0A 1P5BA 3FYPA 3LI0A 3HOJA 4Z1AA 3KOFA 2D73A 2OT1A 4LUIA 3DFPA 3TNOA 2V82A 1ML1A 1R2SA 1W5PA 2QEZA 5HULA 4A21A 2QCFA 4JR5A 1YYAA 4Z1BA 1JUKA 1C29A 1R2RA 4M19A 2Y7DA 3GVGA 3NGJA 3N9RA 4JTTA 3GR7A 4RKAA 5FF0A 4Q4KA 5TIMA 3R2GA 3QW3A 2BTMA 4ML9A 2X16A 3OIXA 2W0UA 3G0SA 1H7NA 3C0JA 1TRDA 3HIJA 2YYUA 5C2XA 1LBMA 3FS2A 4IOTA 2A6NA 1G7UA 4DO4A 5HWNA 2G95A 5DBTA 1EWDA 5LNWA 1Z44A 2ZRWA 2PRMA 3TV8A 1D3GA 1UUOA 3M9YA 3EXSA 1TJPA 1A5CA 1R2TA 4MZYA 3G1VA 4UR8A 4G1KA 4ZQPA 4IXHA 3TQVA 1GG0A 3HGJA 1M6JA 1W5OA 2ZA2A 3G18A 3W86A 3HGSA 1FWSA 4NZJA 2Q3OA 3O15A 4CCEA 4O4WA 1GQNA 1W37A 4YWIA 3P8IA 2ZZ6A 3NPXA 2ABBA 1VZWA 5BNKA 1H1YA 1H7XA 1T0OA 3VCRA 5D38A 5D03A 5F1UA 4JX6A 1DQWA 3U2OA 4QSHA 4P2VA 2CZEA 3B06A 1TTQA 1JJKA 4N9CA 4BFAA 3HB9A 4MKNA 4XBSA 2OCZA 3IGXA 2RDUA 4MYXA 1PE1A 3LM7A 1OK6A 5K9XA 2V2HA 2XN0A 4EF8A 2AQWA 3G1AA 1A5BA 4AEOA 1BWKA 1RQHA 3W2KA 2CU0A 2WJZA 3N19B 2RHGA 2TYSA 5FESA 1XBYA 2QCEA 3P84A 3OA3A 1LTDA 3W2JA 1IXQA 2YW3A 3GZ3A 3RLUA 2YFNA 2QCMA 5T26A 2A1YA 3TXVA 3WK0A 3C52A 5AC6A 3GNNA 1KM3A 3TJXA 4NZFA 1D3HA 1YXDA 2YCEA 3H53A 2CLHA 4POCA 1YTDA 1G6CA 1VPXA 3G1DA 1ZAJA 2E6DA 4K8EA 4MYAA 2QJIA 4UTLA 4ONVA 3HGRA 2J9ZA 3NA8A 4N2YA 1JULA 2JGYA 1LOSA 4MOZA 4OT7A 3NQDA 5LHEA 3TU9A 3LHUA 4CNPA 3TKFA 1AW1A 3W9ZA 1GTEA 3QMRA 5K7JA 4JX4A 3GLCA 5LNUA 4ZQMA 3NPWA 3QQ1A 5LNVA 3L66A 3GDKA 3SIZA 1WAUA 1VLWA 4O16A 3F1QA 2YGYA 4AHPA 1MXSA 4N4QA 2FIQA 4AVFA 1W8SA 1RPXA 1S3HA 3LTSA 2VEIA 1EPXA 1OF8A 2CLEA 2EGZA 3TFXA 1OX6A 1R30A 5LSMA 1TRIA 3PVFA 3BGJA 3B0PA 3WJZA 5I3HA 2DZVA 1F05A 3P82A 4IXXA 4GXMA 3HJZA 5TQLA 4QM1A 3HMJG 4HNTA 4FNRA 2YX0A 2Y70A 3C2RA 3MWAA 4HN4A 2ZA3A 1WQ5A 1EUAA 2FPVA 1Y0EA 3E96A 1HO4A 4MZ8A 2DZWA 3C2EA 2DZPA 1FXPA 4MJZA 1W5QA 1FDZA 2X1UA 4IJBA 3SW6A 4GFSA 4RCXA 3FKRA 4NX0A 1PL9A 2PURA 3YPIA 3G1XA 4K7VA 3N14A 2FTPA 5AYZA 4JYEA 1VS1A 3LRKA 4N6FA 1NSJA 1LZOA 4O0ZA 1FDJA 1VR6A 2GQ8A 3RK8A 3LTPA 3G1SA 2C16A 2XN2A 4GBUA 2CZ5A 3GIYA 1ZENA 1Q6RA 2X1RA 4OU1A 4S2CA 2Z6IA 3PBVA 1ICSA 2FDSA 4A3UA 4AMAA 1HFBA 2P1FA 3MMTA 4K38A 5DXYA 3M16A 3GK0A 2NLIA 5HWJA 3B05A 1KLYA 2Z6JA 3L0KA 5DY2A 4L4LA 3UZ5A 4A2SA 4Y9AA 3FLUA 1N7KA 1O94A 4RXGA 1OYCA 2GJNA 1HL2A 3WJSA 4JTHA 2C15A 4KKXA 3LHTA 3E02A 4I7VA 1OX4B 1OG0A 3M5YA 4DPQA 1ME7A 3VE9A 5L6UA 4IPJA 1X1OA 4FIQA 3TSBA 3W7EA 3W70A 4FHAA 3I6RA 1H62A 4WXZA 3FFSA 1A53A 3CLMA 3P60A 3MHFA 4I9AA 1XBVA 3DAQA 5AHMA 1AW5A 1G4TA 2VFFA 4B5NA 5F2MA 3EWZA 1M7OA 1ZAIA 3W71A 2FPTA 3V1PA 1OFQA 3NQ6A 4H4IA 1OHLA 3WK1A 2ZDRA 3IIVA 2EPHA 2A7RA 1GYNA 2HS6A 2TRSA 1TREA 3Q58A 4R7JA 5F4SA 4LS0A 1M7PA 3N2MA 3DFTA 2ZTJA 4R53A 3LGEA 3PULA 5H2ZA 1TYGA 2VXNA 4ZQNA 1VHNA 1KM1A 3P74A 3E0IA 4LV4A 3TSMA 1ZHAA 3NPUA 2A5HA 3QZEA 3TE9A 3LI1A 2NUWA 1K7XA 4QJ1A 1RD5A 1IIGA 3LOTA 4O1DA 1UUMA 5CZTA 2OZ0A 2VFHA 5U7SA 5CGQA 3L0GA 1WXJA 4U28A 1F6PA 1I2QA 4O18A 3G24A 4PODA 2JK2A 3OBKA 3CHVA 1SW3A 4CLMA 2FQIA 3EWBX 3OG3A 3UZJA 1K8XA 2V0TA 3KVKA 5EKYA 3IIXA 4ZZ9A 3MI2A 3QSTA 2Q3RA 3NQ7A 2DZSA 4ZL1A 3W7DA 2VKZG 3ABOA 3LLDA 1RQBA 4GJ1A 3UYCA 2GQAA 1YDOA 2Y7GA 3UY7A 4IMDA 4CQ8A 1O95A 1SO4A 2GJLA 3A23A 2J24A 1L2UA 2ZZ1A 5AHEA 3G3MA 5D33A 3W7QA 3PSVA 4AAJA 1G4SA 3HPSA 2QCDA 3QJAA 4IQLA 4DELA 3LCHA 2QKFA 1SPQA 4RR4A 1SW0A 1VQTA 2ZRXA 2QF7A 3EX2A 2QR6A 5E0KA 1GZGA 4GC4A 2F7FA 4YCOA 3CPRA 4LU0A 3TQ0A 2E09A 2WNNA 4AF0B 1XDMA 1QMLA 3W7NA 2V2CA 1T99A 1SFJA 1VCVA 4N9BA 3KAOA 1ICQA 3B0VC 2EHHA 1VCFA 1XCFA 4WQ6A 3TC7A 3ZWSA 3TAOA 2YR1A 2Y63A 1C9DA 1HUVA 1RV8A 5BMXA 4QAIA 4IWWA 2RKXA 3TDFA 1WOBA 1J4EA 2HTMA 3D0CA 3IIZA 3UWQA 2AGKA 1VH7A 4JGDA 2BZNA 4N9EA 4UFKA 2Z2UA 3QMSA 2WO5A 3HGOA 4YMZA 4O1BA 4RV8A 3W7LA 1DVJA 5HR7A 1A5SA 1GJPA 1TV7A 4UTWA 3NEVA 4AHQA 3BO9A 3NQAA 4UFIA 1Z48A 4JTUA 3W72A 3SR7A 3GAYA 1LDCA 3PB0A 1VC4A 4FX7A 4RK8A 3HBLA 2NUXA 4ORIA 3EX4A 1GOXA 3T7VA 3U8GA 3R89A 1KM0A 2J9YA 1JR1A 4ZQRA 3PC0A 3HO8A 3EWUA 5I3GA 2NV2A 4UR7A 1G69A 1DBTA 5C5YA 1UJPA 3MYPA 3OHIA 2BSLA 4ZQOA 4XKYB 3SJ3A 3DFSA 4HNVA 1IF2A 3EXTA 3HPZA 3P67A 2B0MA 1QCWA 1TSIA 3DBPA 4ZQCA 3UPBA 5EPDA 4UCGA 4O8RA 4CCCA 1OVDA 5AYXA 3UY8A 1I2OA 1CW2A 1X7FA 1QWGA 2HS8A 1VCGA 5MHBA 3W1RA 1OYBA 2DZUA 4DPPA 1W54A 4NNAA 3TMLA 4O12A 3I65A 1PCWA 3GB6A 3BG3A 4CNOA 4UNLA 3W7HA 3CT7A 3TJLA 1HO1A 1UB3A 5FF2A 4QISA 1WV2A 2QCLA 5J5DA 1LLWA 4Z1CA 3O6DA 1L9WA 4EWND 2P0OA 5A8GA 1G4PA 5F2GA 4O0KA 1EIXA 3W7OA 4WY0F 1UASA 4E2BA 4O28A 2E68A 3EWXA 3W73A 4WX2A 4M5PA 4NJJA 5U4NA 5KMYA 3N3MA 3UD6A 3B4UA 3WJXA 2YXGA 1H63A 5AFDA 4W9TA 4IUOA 1YLVA 4TMCA 3PAJA 5CG7A 4QNEA 3W85A 2RDTA 2J6XA 1DKWA 3TW7A 3S1WA 2ZA1A 4N02A 4RZ5A 3W7KA 4DF0A 5GVJA 3UWWA 3P8JA 2E5CA 3MHUA 1GWJA 1IXNA 4JEQA 3LCWA 4LVDA 3TUUA 3RMJA 3TMQA 1V7YA 3IRDA 5G1YA 4JY8A 1VRDA 4NU7A 1EEPA 3EKLA 4BR1A 1H1ZA 1KFBA 4H6KA 2JKAA 3LLFA 3QEZA 4NQ1A 1FWNA 2VC6A 3NQ8A 5CZJA 3LHZA 3U6WA 2I14A 5CPMA 1OFRA 2PC4A 4FIRA 4FNQA 3P80A 1T8XA 4UMAA 3W22A 4LVAA 5K2ZA 3LHYA 3LCFA 4GE8A 1QR7A 4KFPA 1GVFA 3BK0A 4BWLC 1A50A 5CSSA 3Q2DA 5D04C 2A7PA 2Q8ZA 1YXYA 3W2MA 5DELA 3GKAA 3T78A 2QAPA 4I7UA 4A2RA 3I7QA 3TCEA 4OBTA 2ZZ5A 1F2JA 1IXOA 2A6LA 3OVPA 4WD0A 2VFEA 3FIGA 2BX7A 3W1AA 3IV3A 5CPOA 4OV9A 2A85A 1V5XA 4LW7A 1HG3A 2H8ZA 1S5TA 3S6DA 2EKCA 3MI6A 3LCXA 2B7QA 4K39A 1JQXA 1YTEA 3PB2A 3QM3A 4JTLA 3QYQA 1X6UA 3PY2A 1W1ZA 4Q33A 3NM1A 2Z1BA 3V75A 3GYEA 3CWOX 3MBDA 4YCPA 4O53A 1TQXA 4WOZA 3WFAA 4DBDA 4Z0SA 2ALDA 2WSYA 5KINA 5LNRA 5CZSA 2Y7FA 5C54A 3EX6A 4TMBA 2VEMA 1SW7A 1NF7A 1PHQA 1TTJA 5G4WA 2QDHA 5D05A 5K9DA 5F4WA 3VNDA 1CI1A 4R33A 3KRZA 2ZRZA 3NL5A 4JDYA 1R47A 1EP2A 2GPTA 3F03K 3W23A 3W1NA 4ZVJA 3HG5A 1RZMA 3UWZA 4XQ6A 3FJLA 1GG1A 1LBLA 4HIBA 2ABAA 4BWLA 5G1TA 3LERA 1WYIA 4U4MA 3LXCA 4WZHA 1IIHA 1P1XA 3IIPA 2E77A 3O63A 2YFOA 1YDVA 5IBXA 2B7OA 3MJYA 1K7EA 3TFCA 2OT0A 3BG5A 4Y8FA 3R5EA 3GXTA 3H54A 2W79A 1W3TA 4LT9A 2E6FA 3GXNA 4Y6GA 1Z42A 2FLIA 4MY9A 1KBJA 4S1FA 1K3UA 4P61A 1O4UA 4X9SA 3QQ0A 4ALDA 3W76A 3MP4A 5KITA 1W5MA 5D30A 5LHFA 1TTIA 2J9XA 4LVBA 4EIVA 3MYOA 2RFGA 2DORA 4O1AA 8TIMA 4JIPA 3TSDA 3INPA 3M44A 3C2FA 3NQEA 1VLIA 4RLIA 3CC1A 3THAA 4C1KA 3C4UA 2CW6A 4YLWA 4NNCA 1VJIA 4MLJA 1JCMP 3L5AA 4AWUA 3EKZA 4UFLA 4UNKA 1J5TA 4E38A 4MFDA 5KZEA 2Y61A 3G0XA 3GKFA 3GR8A 4K7YA 2Y6ZA 3L5MA 4O15A 5FF4A 5LZLA 3JS3A 4QIUA 3KX6A 1FWRA 3BLFA 4UTJA 3W87A 3W2UA 1SR9A 4XWUA 1THFD 1KTNA 1O60A 1XXXA 2DZXA 1F5ZA 2Q8LA 3T40A 2W6RA 4NNBA 3EX1A 1TTPA 1I45A 1WOAA 4ICNA 3UQNA 1ZFJA 3NM3A 5LKYA 1BWLA 3CQ0A 1FCVA 2YW4A 1F6KA 1H7OA 3PG8A 2QJHA 2C18A 3NQCA 3P5YA 3LCIA 3UWYA 3QMTA 4JNMA 3IGUA 2JGQA 2Y89A 1TJRA 3W88A 2BLEA 3W3OA 2WQPA 4BI5A 4IGHA 5TBOA 3W1TA 1DJNA 4CQ9A 3L5LA 2R91A 4PTNA 3GAKA 1KV8A 4JDBA 4JTJA 3W1PA 1XKYA 1Q6OA 1SQ7A 2DZTA 2E6YA 3IGSA 3A22A 2PRLA 1SUXA 3C3NA 3DH7A 3I68A 3FOKA 4WJEA 2WSRA 2WNZA 2VEKA 3TXZA 2VOMA 3BG9A 4O54A 3LHWA 1TV5A 2ZBTA 3M47A 1RQEA 3CU2A 1ONRA 2CLLA 4UTWC 1O5KA 3ATZA 4PA8A 1EWEA 3W1QA 2J27A 3W6YA 1KLZA 3GX9A 3DKLA 2E6AA 1JUBA 4QITA 3S1XA 5DLCA 3W2NA 3BW3A 4OHQA 4QNWA 2FB2A 3RLVA 4MLRA 1SZFA 4YL2A 5K4ZA 3BLIA 3WK2A 3E12A 4IMEA 1DV7A 2E1DA 5AHLA 3NZRA 3DI0A 1AW2A 4WXYA 3EWWA 4KWVA 4CCDA 1PIIA 4Y90A 3SSJA 3GDRA 2HMCA 2QCCA 1JRBA 4LRSA 1PHWA 1P0NA 2ZRVA 4X22A 4FX6M 3O07A 1U83A 5FF7A 3S5NA 5CKSA 2DU2A 2H3DA 1Q45A 3M6YA 1W3NA 4HSNA 1L6WA 1A5AA 4EVZA 2WSQA 4PL1A 1DORA 3BW4A 3W7CA 2BXVA 2JKEA 4JTFA 1LBFA 5HR6A 1Q6LA 3NNTA 3N9SA 3T55A 2FFCA 2NV1A 1EUNA 3KVMA 5AHFA 2V8ZA 4E0CA 3NDOA 2PE4A 2PCQA 2QDGA 3DFQA 2CWNA 3CWNA 1GVQA 5F1VA 1SO6A 2KZHA 3O1NA 4FX8A 1SSDA 1RVGA 5F2IA 1MEWA 3N2XA 1SZEA 4WY0B 4MJMA 3W7IA 2YDAA 1KM5A 1YTKA 3EWYA 4GUGA 1TO3A 4O4VA 5E93A 2AAMA 4LS2A 1G4EA 5FEPA 3S1VA 1JUEA 2NWSA 5KTLA 2UV8G 5D37A 2CLKA 1XM3A 4JD4A 1QFEA 3LV5A 1I2NA 4AB4A 1LLZA 3O05A 4HT3A 2V5BA 3ATYA 1TIMA 1VGAA 4O50A 5H91A 4ORMA 1TMHA 4ZMGA 5LGXA 1XBXA 5HMSA 1B4EA 3NL6A 3STCA 1KFEA 1H5YA 1ME9A 1TPDA 3BW2A 4FNSA 4H3DA 3NVTA 2ISWA 4JS3A 3S5OA 5IBXC 5CZ0A 5FEWA 5HJLA 4NVTA 3NQVA 2A21A 4MY1A 4XBKA 1FUYA 3ANYA 4MIMA 5DXXA 4UC5A 3IVTA 5A5WA 2V2DA 3B03A 3N34A 4FNPA 1AL7A 1GVSA 1OX4A 3M5XA 3A5VA 4S2BA 2NX3A 3TQKA 4DF1A 3DU0A 2ZZ3A 2NXIA 5E1QA 1X1ZA 3W74A 2QJGA 1JRCA 4EOUA 3S9YA 2F84A 1FCUA 4FXRA 3F4WA 1WBJA 4FNUA 3DFNA 1TQJA 3ELFA 5K3VA 1RR2A 4FF7A 1KFKA 1L6SA 1SZNA 1QPRA 2H3BA 1IGSA 5IM51 2VEPA 4IX2A 3USBA 1KFCA 2VELA 1B3OA 2WPBA 1JCXA 3DHFA 1QPOA 3SY5A 5AYYA 2CLOA 2TMDA 5DN1A 1WBHA 3A5FA 4UXDA 1LYXA 2R14A 3GDTA 3RF9A 1KFLA 1NEYA 1LOQA 1QNVA 1H61A 2XN1A 4AHOA 2V5LA 3MP5A 1SSGA 4CQAA 3W7GA 5ABTA 2VFDA 2V30A 3P5ZA 1H7RA 1YDNA 4OE7A 4RZ6A 3M0ZA 2G96A 3CEUA 3KXQA 4FB7A 3DZ1A 4BI6A 4RJEA 3PBUA 2QCGA 1EA0A 1B9BA 3LBMA 2TPSA 2X30A 3LXAA 1F73A 7TIMA 5KSWA 3R12A 4JIQA 4TR9A 3VKJA 3DHDA 4GUJA 1FCBA 4RZ4A 1D9EA 2WNQA 3PWAA 1FCQA 3F4NA 1ADOA 3TA6A 1LROA 2QAFA 3ZS4A 4OGZA 1M5WA 2WOQA 1LORA 2ATSA 1UBSA 5HINA 4AXKA 3W2LA 3LTYA 4BK9A 5L9FA 4UFMA 3TC6A 3C56A 1EX5A 1XI3A 4E2DA 4R34A 4WUIA 3NZ1A 2PRHA 3DKJA 2OX1A 3IVUA 3W7PA 4FXSA 3SECA 2VENA 5I3IA 2YZRA 1AL8A 3NOEA 4PFMA 1DL3A 3GXPA 2VFGA 1FXQA 3CM4A 5HUOA 4JTKA 4O10A 2ZZ2A 1I8JA 1LRQA 4JXCA 3L9CA 1NF0A 4O13A 5C55A 1N55A 1WA3A 5EYWA 3HG2A 3QF0A 5J5RA 1JCNA 3L2IA 1L6YA 4LNYA 3TW6A 3T4CA 1YXCA
chains in the Genus database with same CATH superfamily
3TX9A 3ZYZA 4IFKB 4ADTA 1XISA 2Q01A 4GUHA 1FWTA 3GDBA 1KM4A 5KZ6A 2ZWYA 4UOQA 1Q2RA 4O0QA 5DBUA 4R9OA 4DQWA 3RDKA 1IZCA 2VFIA 2JEPA 4H9VA 1S39A 2Z0IA 3C8FA 4WEVX 1GQKA 1NDZA 3QH2A 5BXTA 1KXVA 4X63A 2OO0A 3C2YA 3OQEA 4ZTYA 4XKYA 1REQB 3F4CA 2G3JA 4HNNA 1XC4A 4C5ZA 4HYVA 4JY9A 4MM1A 2H8XA 3S0CA 3FNDA 3GG1A 1QI0A 4PH6A 4KFNA 4DYEA 4GPNA 1R8LA 3ZWTA 2VUNA 1O5QA 2GUUA 4PC8A 2R94A 1Q8JA 3TYAA 1XIDA 1K8ZA 1TPC1 1JCYA 3GBEA 4ADSA 1H41A 4M6UA 2FZBA 4JTSA 5HBFA 3R8RA 5FI8A 2V9DA 3B8DA 1QOPA 4QJ5B 1EYEA 4NXKA 4AWEA 4F0HA 2EJAA 4BQ5A 3EDJA 3CMFA 3S8HA 2WHJA 3AU6A 3DFOA 2C13A 3CH0A 4ZO8A 5K9CA 3HPXA 4XTDA 1Z41A 1J2WA 1HL9A 1H4PA 1REQA 2POZA 1MNZA 3CYVA 2IPFA 1P4CA 3FCPA 3KZSA 3LHVA 4O19A 4KCUA 3NSXA 2CLIA 1IR2A 3EEGA 2WAGA 2G3NA 3BICA 5BW6A 3NQMA 4RDYA 3FHQA 3MZ2A 1UR1A 3PZIA 3ITTA 3BQ5A 4DO6A 3CIWA 2PGEA 1Z69A 1WX0A 3WJYA 1I4NA 1KTCA 2EAWA 1S38A 2NVCA 1DJQA 3ITXA 2PLKA 1UD4A 1C8QA 4B5WA 3QV7A 3H26A 4NAEA 6TIMA 1DJWA 5BYWA 4IMGA 3HF3A 3LZ3A 3FVDA 4LAUA 4I7WA 2F2HA 4ROQA 2Q71A 2B7NA 2J6VA 5AHNA 3ZR4A 5BRQA 1W3HA 2W91A 3VD3A 1QWKA 1EP1A 1ICPA 4JN8A 1OC6A 5JBDA 2AKZA 3XINA 4IMFA 1U1HA 3CV7A 3UP8A 4Q32A 3CIVA 3F2DA 1R3TA 3EOOA 4AZCA 4E4FA 2FJKA 3OYXA 2PTYA 4LB4A 3R94A 1EA9C 1XFBA 4LQ1A 4U3CA 1BYAA 3VGHA 1GOKA 3UR7A 4UQ9A 2BOFX 4LC8A 1KD0A 3PNUA 4Z08A 2PD9A 3RO6A 2P53A 5KETA 1ZL1A 2OMAA 3AS2A 3TQPA 3EB2A 1DQXA 2WSKA 3QBUA 2ZRYA 3PSWA 1TCDA 3P7YA 3CUHA 1K70A 3CBWA 3LPPA 4O17A 2ODOA 1LT8A 5FAJA 3WMLA 1EH9A 5T8GA 1XLJA 1H50A 1W5NA 4KEMA 2D2JA 4UQBA 5A6BD 5HDRA 2WVUA 3VOHA 4HK7A 1MQRA 4JYDA 4TVUA 3PPCA 4M7SA 1KM2A 2KAUC 3N73A 4GUFA 4HNUA 1GVRA 2ZQ0A 1SFLA 1A0EA 1O5RA 1GYLA 2D0HA 2YCLB 5M17A 2CFFA 3HG4A 1HJXA 4N9DA 3CHDA 4GKLA 1KC7A 1V3KA 1J0KA 1OFDA 2GSHA 2P10A 4UR9A 3SY1A 2GVLA 4KWSA 3WLOA 1OK4A 3VIHA 1GOMA 1XIGA 2AL2B 3JW7A 1X6NA 5IFTA 2CLPA 2EEXA 5JIPA 3EPMA 4DI8A 4EAMA 4HPXA 2CYGA 2Z29A 5D09A 4EK7A 4XZ9A 1NFPA 4GH3A 1UHVA 1EB3A 5D8WA 3FVMA 1KB3A 4L64A 2FB3A 3GSMA 1VBUA 4HSOA 3RNDA 1KM6A 2FHFA 1EP3A 1UA7A 1FY6A 1SJBA 4CD6A 2JKPA 5LA2A 3N29A 4DO5A 5CPNA 2PI6A 1Q13A 3C6CA 3I4KA 3LDVA 1TG7A 3DOPA 3LG3A 3SGZA 1CB2A 2Y8VA 1VBHA 1I0DA 4X0VA 1K9FA 4LVGA 1SYTA 4GYFA 3PAOA 1K03A 4HZ8A 2BY1A 3WEZA 1AG1O 3LV6A 3HQ1A 1PTAA 1ADSA 1RCOB 4N4PA 2Y2WA 5FAGA 4UWMA 1V6YA 1H1NA 1EJSC 2CPUA 1RCQA 3THQA 4ATDA 1ECEA 4YVXA 5TNVA 1JXJA 3PBYA 5BU9A 3QPZA 3DN5A 1PXGA 1L0PA 2DSUA 3JR2A 3VDGA 4GVHA 3U48A 3A4WA 1IEIA 1R0MA 3GU2A 2YLAA 3IEBA 3T05A 4JIIX 4OV4A 4CCZA 4IIHA 4LPCA 4GVFA 4XTIA 6PTDA 3MJMA 3BLPX 1XSJA 5C9RA 4DJDC 1DTUA 1OM0A 3GHTA 5JBFA 4DXKA 2X1IA 1F61A 2IUZA 3GTXA 3DG3A 4QJ3B 3LRMA 1SO3A 3MWCA 4EF9A 1UOZA 3U2ZA 3FEQA 1Q3NA 4IPIA 3M5ZA 1US2A 5FA5A 1IWBA 1YDYA 1OFOA 2QJMA 1CB7B 1XKJA 4F2TA 3HTWA 3W38A 4DBUA 1PZ1A 2EPLX 4JTEA 4AX7A 3WJWA 2Y88A 3L67A 3DGRA 4K6AA 1R9YA 1Q85A 5EY5A 4O11A 2Q09A 4LV9A 3S5YA 5BOFA 1YW1A 5DMLA 3WUEA 5G2IA 2VVSA 4UMCA 4NAFB 1R7OA 3I7RA 1K7FA 3QKEA 4Q8TA 1MDLA 2O9RA 3L0NA 4LWWA 3M07A 2ZC8A 3L65A 3ANVA 2E25A 1DTNA 4MPKA 4NJIA 3R13A 2ZX8A 4HPJA 5AVNA 3EOEA 5AZ0A 2WBKA 4J3VA 2ZOXA 3SJNA 3M43A 2H90A 3AIUA 4XKMA 4NX5A 1EOMA 1JDFA 3TEVA 4RL3A 5D2TA 1RP9A 4IT1A 4BQ3A 4B2DD 4QE4A 3RPMA 2RUSA 6XIAA 4K37A 4PSRA 5AHIA 3ITVA 4IF2A 2Y0FA 3RG6A 4C5YA 3QY7A 4KEZA 4MB3A 1JZ6A 3T8QA 3PUOA 2TODA 1VIZA 3MTWA 4ZO9A 4S3GA 1A0CA 4LUIA 3WN6A 1W9XA 2V82A 1R2SA 1W5PA 3LYEA 4A21A 2QCFA 5ABGA 4WF7A 4PRTA 2WMJA 5FF0A 2E9MA 3QW3A 3WF4A 3WLKX 3MSDA 5A2BA 4Q4QA 2W0UA 1AODA 5EGRA 1H7NA 3OLEA 3N15A 1TRDA 2Z28A 5C2XA 3FS2A 1E4NA 3BC9A 3VGDA 1HF6A 2PA6A 2PRMA 5C70A 1D3GA 3FA3A 2VNCA 1EO7A 3EXSA 3GXDA 1RY8A 4UR8A 1SFSA 1Q5MA 3HJEA 2CXEA 4YTTA 1XLAA 1VPYA 3RUBL 3W86A 5E0FA 4WR3A 1YHTA 4O4WA 1GQNA 2A3HA 2PDIA 3TZNA 3H4XA 2BP1A 3P8IA 3SUSA 4S3KA 3NPXA 2I7GA 3GTHA 1TJ0A 1VZWA 5BNKA 1H1YA 3VCRA 3B8WA 2VX6A 3U2OA 2CZEA 1XYFA 1V0NA 4BFAA 3RAOA 4EP8C 1UP0A 4XBSA 2OCZA 2WC4A 3LM7A 4DUXA 4B5UA 4H7CA 1B3VA 3W2KA 1GVIA 1XLMA 5FESA 1XBYA 4AZCB 3W2JA 5FL1A 3TXVA 1XF0A 3C52A 3B9NA 3MSGA 1DWAM 3GNNA 2VRKA 5A8MA 3SY8A 1OG6A 3BAWA 3QZ6A 2WC3A 3H53A 3AXHA 1DWJM 1EJUC 3G1DA 4NILA 4UTLA 5CAKA 3DYOA 1MQQA 3AAMA 4GG9A 3H23A 2J9ZA 4IL2A 1N8IA 1LOSA 1VD6A 2GDVA 4OT7A 1GVEA 4Q8OA 3MCMA 1EC7A 1AW1A 3UZYA 1GTEA 2BVTA 1BVZA 1JAKA 1JZ7A 2O4MA 1IEVA 3SRFA 4MNJA 2Z25A 4PMNA 3VABA 3GTFA 4GZEA 4C7DA 2WVVB 4O16A 3F1QA 3ARUA 3DIPA 4N4QA 1UIOA 2RJHA 3OZMA 3HQOA 1WDPA 4AVFA 2DW6A 1IHIA 4GXWA 2CLEA 1R30A 5LSMA 3PVFA 3CTTA 4GZ7A 3WJZA 3P82A 5A6JA 2J25A 3WSUA 1ISZA 3HMJG 1E71M 4QS6A 2ZA3A 1LQ0A 1HO4A 4GFIA 2DZWA 2GJXA 5EU9A 5I5RA 4UQCA 4V1XA 1W5QA 4EPKA 4GFSA 3R11A 1TX0A 2ZUTA 2FTPA 1S2CA 3R58A 3QLDA 4JYEA 1UD8A 1FDJA 2GQ8A 3IS4A 3RK8A 2CBIA 3BAIA 3HFYA 2QVHA 3VOGA 4S2CA 3PBVA 4E3VA 2DSKA 1WZAA 3BLLA 1SJCA 5DXYA 3K46A 4JEJA 1KLYA 4G1NA 2BFGA 3H21A 3CAKA 3UZ5A 3MVTA 4L4LA 4AMCA 1TZ7A 1E6NA 2R82A 4CD8A 1HL2A 1XPGA 1K1DA 2P3EA 3PWIA 1BVWA 4GC3A 5DT7A 1V03A 3WLPA 2NSXA 2QJNA 5L6UA 4IPJA 4BZYA 1XYBA 3W7EA 4S3FA 3W70A 3FJ4A 3PZVA 4WXZA 2FFIA 1WAWA 3AZRA 2HK0A 4GVIA 3A4XA 1AW5A 4J3UA 3N1AA 4I6VA 4FOJA 5F2MA 2QW5A 3W53A 3LD5A 3W29A 1O1HA 4BQ4A 1ZRQA 3VUSA 4XK2A 3P14A 3IIVA 1W91A 4AYSA 3VD5A 4HPGA 4DYKA 1M7PA 2GJRA 1JF5A 3TJ4A 3LGEA 3PULA 5BXRA 2G3MA 3UF9A 5H2ZA 3PHAA 2VXNA 3ZIZA 1VHNA 4CU7A 1KM1A 1UD5A 1AVAA 2QMKA 2A5HA 2X8RA 3N2CA 2BODX 5I2UA 4GH1A 1K7XA 4AY7A 2BHYA 1RD5A 4O1DA 1EDGA 2PGWA 4IHCA 3UVAA 2VFHA 1UZ4A 3U3HA 1WXJA 1OEPA 3ECQA 4J40A 4O18A 4PODA 3W26A 3OBKA 1FRBA 2D22A 3OG3A 4PCTA 4CVUA 5C9WA 4QP0A 1EEXA 1BF2A 3UJSA 1JNDA 3ABOA 2GQAA 5ABFA 4NAFA 4J2MA 1HGYA 1O95A 4PUUA 4U2ZA 2QDDA 1UR9A 1VAHA 3GXFA 2Z1WA 1L2UA 3LSCA 3LPFA 5IXEA 2WM1A 5D33A 3ZLFA 3PSVA 2FZNA 3HPSA 2QCDA 3QJAA 4MF4A 4I9TA 1WKEA 1SPQA 1W3JA 1TCMA 1VQTA 1UW9A 4ZBCA 2PDBA 3MMWA 3EX2A 2VL4A 2F7FA 4YCOA 3CPRA 4LU0A 2E09A 4QSFA 4HOZA 1HJSA 1QMLA 3KRBA 5CPTA 3IJLA 4N9BA 3OA5A 2FJUB 2OTDA 3KAOA 4MKSA 2EHHA 3VX1A 1XINA 2QDEA 2IQ0A 2WMFA 1CGVA 5BMXA 4QAIA 3QQWA 1VFOA 3VGGA 3VU2A 2ZVIA 3R7MA 2QXWA 1CGUA 2OYMA 2P88A 3SQMA 4UFKA 3QMSA 4LAKA 3H8AA 3HGOA 1NARA 1TZZA 3W6LA 4PRRA 1DVJA 5HR7A 1VFLA 2WMIA 3R0UA 3W24A 4UTWA 3RM9A 4UFIA 3SR7A 2CETA 1F3EA 1V6XA 1LDCA 2P8CA 1VFHA 1VC4A 4ORIA 4C60A 2VEFA 3NYDA 1GOXA 2WLZA 2YZ5A 1VF8A 1ONXA 1QNQA 3F7JA 2UZ9A 3HO8A 3EWUA 1LUCA 5FACA 5I3GA 1NWRA 2R1NA 4KWUA 2NV2A 4UR7A 4ZEPA 1DBTA 5B7YA 1ZSXA 3PTMA 4UB9A 3S46A 1BHGA 4JAWA 7REQA 1A80A 2GVYA 1E0WA 1V7AA 3B8VA 3P67A 1TSIA 3DBPA 4IQEA 5I06A 4ZB5A 3MCOA 4Q8VA 5AECA 3MZNA 3TWAA 1I2OA 1NJJA 3AMCA 3EZ4A 1QWGA 3T4WA 4ZOBA 2DZUA 4EKJA 1D8WA 3CO4A 3I65A 1EJTC 4CU8A 3ZJ7A 3W7HA 3TJLA 1UB3A 2FKPA 2NV9A 3SUVA 2F6KA 2WHMA 4QCEA 1GK8A 4C6IA 1J5SA 2RJGA 1HT6A 1V3JA 5A8GA 2CNCA 4GI6A 1F8MA 4O0KA 4KCTA 3W7OA 1UASA 3ES8A 4E2BA 5A8OA 2ZE3A 4PUMA 4MDPA 9CGTA 5KMYA 4NJJA 1GW9A 3B4UA 4AYGA 2Z2BA 1YLVA 3EA3A 3PN8A 2OYKA 1GOQA 4HCDA 2RDTA 1Z8AA 3TW7A 2ZA1A 4RZ5A 4DWDA 4Q8UA 2VC9A 3U2EA 4QTGA 1E4MM 3IJQA 3ZVIA 2HISA 1W3KA 3LCWA 2ZUVA 4LVDA 2Z7KA 2QPXA 3IRDA 5LIUX 1EEPA 3VZYA 4AC1X 4BR1A 1KFBA 4KQNA 2FHBA 4BF7A 1D8CA 3U6WA 4JTAA 1OFRA 3R10A 1X6LA 1T8XA 1R85A 3W22A 5AY7A 1RBOB 1RY0A 4GE8A 1QR7A 1GVFA 5EFFA 5LXXA 1JPDX 5D04C 3E2SA 2V3GA 1K9DA 1YXYA 3W2MA 1TUXA 3T78A 3KL5A 2QAPA 3TOYA 4A2RA 4PRWA 4DJFC 3SSZA 4P8WA 3WLMA 2CKRA 4WD0A 1DIKA 1CXEA 2A85A 2WLYA 4LW7A 2IPWA 2Z26A 3CAQA 1UQZA 4RDVA 3QM3A 2XIOA 1X6UA 1W1ZA 5JH2A 4ZFCA 4EAYA 4U3AA 4YCPA 2WSYA 4GI8A 5LNRA 3N17A 4L1WA 2Y7FA 5CZSA 3DG6A 2GSJA 1XX1A 2VEMA 1TTJA 2MANA 5D05A 5F4WA 4PB3A 4R33A 3AMGA 1U5VA 2ZRZA 5JIWA 3IUIA 3ZM8A 3NOYA 4M0XA 3DC0A 3UWZA 4XQ6A 1GG1A 4MTVA 4Q22A 2XWEA 2ABAA 4RNHA 4YS1A 4U4MA 4JNZA 1P1XA 2YFOA 1YDVA 1UR2A 4XAGA 3W02A 4K1GA 2YL5A 3PJUA 5ECVA 3BG5A 3CUFA 4LT9A 3OTRA 3IACA 3NWRA 1PJ9A 1EJVC 1GOIA 1K3UA 1V3LA 3R6IA 5IDZA 1EBHA 3BUVA 1K77A 2WVSA 3P3BA 2GOKA 5DQPA 5KITA 4D6EA 1TR9A 1CIUA 4W7WA 1CEOA 3FY1A 1DE6A 2BY0A 2XINA 8TIMA 4JIPA 2OO6A 2QT3A 3M44A 3NQEA 4FS9A 5T9CE 1XPYA 3AICA 4W4QA 5JU6A 3C4UA 4UQDA 1SJDA 2GGEA 3VDCA 1HJWA 3FSUA 3BLOA 4B16A 1JCMP 4AWUA 3EKZA 4QLJA 4LF2A 1ELSA 3SQLA 1UH4A 2Y61A 3G0XA 4BCEA 3GKFA 4GOAA 1KRBC 5HQMA 1A4LA 1CXLA 4DJEC 2XU2A 1JEZA 3JS3A 3PNZA 3NZQA 1FWRA 1T8QA 3PJTA 1YBQA 4DZ5A 1THFD 3PFMA 4I3GA 1GW1A 3KCLA 2DZXA 3W01A 8XIAA 1F5ZA 1EXBA 4HHLA 1PSCA 5IHSA 3IAQA 1PKMA 3EX1A 1QNOA 1TTPA 1I45A 1WOAA 1V0MA 1ZFJA 2UY5A 4GO9A 3CQ0A 1FCVA 1XDJA 1H7OA 3PG8A 2C18A 3NQCA 3JVAA 3AIVA 2HPIA 4HZ6A 4PULA 5TBOA 3W1TA 1DJNA 2R91A 3VGEA 1M68A 4JDBA 4MG4A 1XKYA 1AZ1A 1D3CA 1GZJA 1DWGM 1HVXA 1YE6A 4GQBA 3NCOA 4L56A 3VGBA 1EDTA 3K13A 4WJEA 2GVEA 3AXXA 3V4BA 4GQQA 2HVOA 2VOMA 4YPJA 3V16A 3GVWA 3LZ5A 2ZBTA 1CPUA 3JZEA 1EWEA 2BASA 3W6YA 1Z6KA 2PTZA 3S47A 5DF0A 3DKLA 2V5KA 3W2NA 3BW3A 5HJXA 3RLVA 4MLRA 4L4OA 1VFMA 5K4ZA 4RE2A 1DV7A 3IJDA 3NZRA 3EWWA 4CCDA 1HJVA 4RUBA 3ABXA 4Y90A 2VQUA 3SSJA 2VGFA 1K4HA 3FXGA 4U5KA 3ARWA 2H9AA 4M56A 4X22A 3O07A 2PWEA 1PWLA 4W5UA 1VFFA 4D72A 4QG8A 3QYSA 4GIAA 4ZB0A 3BCJA 5C7VA 3M6YA 4C6KA 1A5AA 2WZIA 2BXVA 1Q6LA 2PSNA 3NNTA 2FFCA 4ZGYA 1EUNA 4GZIA 5I79A 2PCQA 2QDGA 4HTBA 3RO8A 1E6PA 4H6RA 1SO6A 3AQUA 3EGJA 2J78A 2VWSA 1RVGA 2WW5A 3QR1A 3WQOA 3N2TA 5C7HA 2EG7A 2DT0A 4J5NA 2YDAA 3VINA 5D9OA 1YTKA 1RH9A 1Y5XA 3AIRA 1AQ0A 3D5HA 1CXFA 4AIOA 1G4EA 2XWDA 2NWSA 4X9YA 1XM3A 3T2PA 2DY3A 5HAOA 3QXBA 4IJRA 4E2VA 1MW3A 4ERIA 1J12A 5D8ZA 3BANA 1VGAA 3EPOA 1QXLA 5CSYA 4GHRA 1F9CA 5LGXA 5HMSA 1H5YA 3K2GA 4F0LA 3P0XA 5CZKA 2HQAA 1OZMA 3WH8A 2PWFA 2ISWA 2WNWA 3NQVA 3WZ0E 2ZVRA 4OOZA 6TAAA 5A5WA 2V2DA 3N34A 4FNPA 1AL7A 3GG8A 2HNEA 3PUGA 1MXDA 4K1WA 3A5VA 2NX3A 4DF1A 5E1QA 2QJGA 3UG3A 1JRCA 1FCUA 4MB4A 5HNNA 1WBJA 1X98A 3WLHA 1L6SA 1K6WA 1XLIA 1GHRA 4ATWA 3OIHA 2R1KA 3GFZA 1P6CA 1C8YA 3GC2A 2VELA 1E6QM 2VDIA 2WPBA 3GFYA 4R85A 4FLSA 3E5PA 4CQDA 4IMAA 4KIEA 2ACSA 4FF5A 5AYYA 1EJRC 1MW0A 1LYXA 1FH8A 4NZ1A 4PMUA 2R14A 3U5UA 3GDTA 1P7TA 5CEWA 2XVLA 3MP5A 3W7GA 4AVOA 2GDUA 2PTDA 3KHDA 4RZ6A 4UZUA 4IGNA 4HOWA 3M46A 2BY3A 1XLHA 3PZOA 4EE9A 7CGTA 2QCGA 4JFWA 1UQYA 2X30A 3R12A 4D6CA 4JQ1A 1QJWA 4TR9A 3RJXA 3DHDA 4GUJA 1FCBA 3UBPC 2D2GA 3V18A 4US5A 1ADOA 1FOBA 3UR8A 2EQDA 3S83A 2OZTA 1HL8A 4D6GA 1UBSA 1JYNA 4AXKA 1WDRA 5AZ1A 4UFMA 2DT2A 4MUPA 3WEMA 1XI3A 1AQMA 3WBXA 3M0IA 1VEMA 3DC8A 1E73M 3VYLA 3SECA 2ZE0A 1Q7MA 1LRQA 3DHPA 4ZE4A 1B2YA 1GCYA 4MJ4A 2OOGA 5C9XA 5EMJA 5ABEA 1FP9A 3HG2A 3QF0A 2QV5A 3K8KA 3GHUA 3TW6A 3ZVHA 4NYUA 4HMCA 1EZWA 3LBCA 1H7WA 1TVLA 3NQ2A 3CV1A 3EWCA 4ZOCA 1S2WA 1R3YA 3EMQA 3TROA 3TYDA 4CQBA 2FGLA 4G2DA 4BY3A 3UESA 3MSRA 2B7PA 3E2RA 3WH5A 4LTSA 5FEZA 3W1XA 2PBGA 5C6MA 5DCDA 3CYJA 6CGTA 1EOKA 2ISSA 4Z0JA 4R27A 4XZWA 4F9DA 4A29A 3IUHA 2QUUA 3UXDA 1TWSA 1S5WA 5TAOA 3UNDA 3ABRA 3M41A 4MVAA 4HU4A 2WHKA 2IXVA 1J6PA 4J4KA 2O7QA 4WKAA 1IEWA 3W7RA 2WK2A 3AYRA 3L4XA 3QGVA 3SCTA 1C8XA 3W07A 4M7TA 1CGTA 1H11A 2I1OA 4HYRA 3LX9A 3WLRA 3EBVA 1GYMA 5A6MA 2WMIB 5DT5A 4E8DA 4V27A 1MFUA 2X2GA 1TPB1 4BQ2A 3V0TA 4HJWA 3RM4A 3VNZA 1EJ7L 2C19A 1UH3A 4ZTXA 3L21A 3GG7A 4HA3A 4DNHA 3BCDA 1NFBA 3QN3A 2F6UA 2IQDA 4WGXA 4P8VA 4UFHA 3LCLA 3PZUA 3DXIA 3MKCA 1OFBA 4F3HA 3ARXA 5XIAA 3GH4A 4W8AA 3ZLHA 3BE7A 4GY1A 5G5IA 1Q4WA 1A47A 2W63A 2VC7A 2YSWA 4MMWA 2B4GA 1ZP4A 4JTGA 3LXBA 2ZCGA 3A24A 2GZXA 3LMYA 3O0FA 3M0HA 1XUZA 4JL2A 4UTHA 4L9ZA 4TU1A 3CUXA 1GHSA 4U5IA 5BROA 3BL3A 1FHLA 3ZO9A 1JCTA 4QROA 1QAPA 1XRVA 5CAHA 3BLDA 1BG9A 1XL9A 1GQJA 3L4ZA 1B57A 1E0VA 2C1HA 3PPHA 2XH2A 3K8MA 2VX4A 4DEFA 5CH9A 1LG2A 1R38A 1KW1A 1PB0A 3WD1A 4YYFA 3CL6A 1KBIA 4V15A 1DHPA 3QC3A 2IMRA 4O1CA 2IQTA 1X8FA 1EZ2A 4OQVA 2WYSA 4JYFA 3C2VA 1W3LA 1QI5A 1XBZA 3DECA 3N11A 3CHFA 2G97A 4GA8A 2Y85A 2PDQA 1OQFA 4B3LA 1DJZA 3LPGA 2A0NA 4OJYA 1FA2A 1TV8A 3CQKA 3C0LA 2C14A 3G0UA 4MGGA 3FJ6A 1ZCOA 3EWDA 1S1PA 2A4AA 2DSWA 3Q94A 4J9JA 5EMUA 2E5BA 4Z1YA 3E1F1 3NL3A 3SCPA 1LCOA 1PDYA 3G1YA 3UJFA 4JX5A 3NIYA 3SEPA 4C6MA 1WZMA 2ZZ4A 5XIMA 2R1PA 4O52A 1JQVA 3B0UX 2NX9A 1NIUA 3SAZA 3K4WA 3H2MA 2Y62A 3PUDA 1E9YB 1TB3A 1BEUA 3KFTA 3ITYA 4PSPA 4A22A 3EXRA 2ZUNA 3BPWA 1W3IA 4IGMA 2D0FA 1OJXA 3KOZA 5SWUA 1PZ2A 1NQ6A 4XAYA 3MC5A 3SCRA 1MNSA 3WF0A 2CWXA 3D47A 3NGFA 5I09A 3WDJA 4D2JA 1GJUA 1PS9A 2OQHA 1NAL1 4AZ5A 4NJGA 4AG0A 3E0LA 3ABQA 4GWEA 2R8WA 3DI1A 4TQTA 1GT8A 3AWOA 5FJOA 3MY9A 4HP5A 3AWNA 1G67A 1PX8A 4UOJA 2GGGA 3W27A 2ON3A 4PL2A 2OJPA 3AHTA 3O6CA 4UMBA 5CJMA 3UWUA 2VTFA 2D20A 4NUWA 5FEXA 1OCNA 1F6YA 4XV0A 3ONBA 1DHKA 4H9TA 3B97A 4KRTA 3CV2A 1SGJA 2C6QA 2D23A 3FDKA 4MNLA 4C1LA 8XIMA 5AYBA 4PCNA 5J8LA 2NX1A 3HG3A 2VT0A 1U30A 3WBWA 2YOCA 5MKGB 2O7SA 1K8YA 2OLAA 1NDYA 4P8XA 3KRSA 4S3JA 4BS0A 2EG8A 4LC6A 4QG6A 4I5UA 1I6NA 1S2VA 4ECLA 3KDNA 1UMLA 4JTIA 1X7IA 4DBEA 1QDSA 5AB3A 1R6WA 1IQ8A 1JD7A 3SGGA 3BV4A 4WSKA 3PS7A 1XFCA 4PUKA 3Q37A 4CN4A 3AO0A 2OXNA 4US5D 1DOSA 4W8LA 3K1DA 3NG3A 3E2QA 1TPUA 3NVDA 1E4LA 2V67A 1M03A 4OWGA 1H60A 4HHPA 4DVOA 1XIMA 3SFKA 4ZOAA 5E6YA 1XG4A 1PX3A 1ITXA 3GH5A 3IIOA 4CD5A 3MBFA 3NEHA 1JI2A 1EC8A 1AD1A 2HSAA 4EXQA 2PDFA 2NT1A 5FSEC 4ADUA 1JCJA 3TYUA 1ZAHA 3CZJA 2NUYA 2ANUA 1V6WA 4PBEA 3STFA 1UR3M 5I3JA 1ZBVA 3L4TA 3QW4B 4D8ZA 5I77A 1C93A 2DP3A 4O14A 1UC5A 1PZ3A 4PUDA 2VX5A 1AJ0A 4QR6A 3PK7A 1JYVA 4NJHA 1XUUA 3WFLA 4QLKA 3VD7A 4M6PA 2EKGA 2C0AA 2XJ7A 1QI4A 2JIEA 4JOMA 4A35A 2XGZA 1UWAA 1YPFA 2G4FA 4NJKA 5XINA 3TYBA 4LAMA 2D3LA 4NI8A 3BARA 5G1MA 1A5LC 2LLEA 1KTBA 1QO5A 3M0JA 1BTMA 1TELA 3AXIA 1XD1A 1CGWA 4TV6A 3O06A 4B2DA 3QOKA 2E3ZA 2QIWA 2XIBA 4PEKA 1OCQA 2H6RA 1TMQA 3OVQA 3G8EA 2J66A 4DJDA 3O6AA 4AIUA 1OD8A 2P76A 3H4GA 4KFOA 2AGTA 1QPQA 3O6YX 2XH0A 4C6JA 1C7TA 1NWTA 3IVSA 4GLEA 2QHAA 4BI7A 2RGLA 1RK5A 1C92A 4CNUA 4IIGA 1MQPA 4WGHA 3R0KA 1FKXA 4Q8PA 2ZFAA 3GUWA 1P7TB 2D3NA 4ROPA 1W56A 4LVFA 3G3DA 4JQ4A 3P81A 1MUCA 5BRBA 3KP0A 3KL0A 1P43A 3EMZA 1HZYA 1K02A 1PPIA 4AZIA 1UR4A 3OZOA 2VCBA 4Z1AA 3KOFA 3S2CA 2D73A 2OEMA 3DFPA 2EG6A 4GX8A 2ACUA 3L2LA 1PEZA 2VURA 3TVAA 1C29A 2Y7DA 3GVGA 3N9RA 4JTTA 1F4HA 3IUDA 3T07A 2X16A 2QIIA 4G6CA 3G0SA 3G6LA 1BLIA 2OU4A 1BFNA 4GZJA 3UGRA 1LBMA 3WDRA 3U7BA 1G7UA 3GR4A 4MWAE 1XH1A 5DBTA 1EWDA 2ZRWA 1TJPA 1U2YA 4UBPC 1QT1A 3G1VA 4G1KA 3TNBA 1FHVA 2Z1SA 4ZQPA 5B80A 1JPKA 2DDXA 3OLDA 1W9VA 2ZA2A 1FWSA 1TZ9A 4CCEA 1X96A 4DRSA 3VM5A 3T0CA 4YWIA 2WMGA 5EMLA 3T0AA 7XIMA 1H7XA 3RX2A 1NFGA 5D03A 5F1UA 1DIOA 4A8LA 3AMLA 3VNJA 2VGIA 1W2VA 4ZODA 4XZMX 3HB9A 4MKNA 4KT2A 3LEPA 2PWDA 2RDUA 5I00A 4MWAA 2PZNA 1OK6A 2XM2A 2OZ3A 3PPGA 5A8NA 4X61A 1BWKA 3MDWA 1RQHA 3N19B 2ONEA 4DZHA 4DWSB 2QCEA 6ENLA 1FWEC 1VIWA 1XW8A 4C6BA 2QJJA 2YFNA 1YMYA 2XVPA 2QCMA 5T26A 2VP8A 3TTOA 2DVTA 4MWAD 1KM3A 1XIEA 1M1BA 4S3CA 3Q67A 2WANA 2YCEA 3AZTA 1MRAA 1ZAJA 3VNKA 3A9BA 3R8HA 1V0KA 3HGRA 3N2OA 3N13A 3K1GA 4N2YA 4INFA 3UZZA 4HA0A 1W32A 5LHEA 1V79A 2NQ9A 3TKFA 2I5IA 3UJ2A 4R3UA 3GLCA 5LNUA 5LNVA 3L66A 3HPFA 1WAUA 1AJZA 1F8IA 1VLWA 1UBPC 4AHPA 3M7SA 1W8SA 1DP0A 4OTKA 1CZ1A 2VEIA 2W62A 2EGZA 4FLQA 4TX8A 3GE7A 3BGJA 4IXXA 3UPMA 3HJZA 5TQLA 2OLSA 4QM1A 4NZ3A 4HNTA 5CLWA 2Y70A 3C2RA 4M24A 3VC6A 1BWVA 4IM4A 2FZDA 3PZTA 3TN6A 3C2EA 3VIOA 2YCJA 5FCZA 4CD7A 3R1ZA 2WMHA 3A12A 2X1UA 1JZ5A 2VJXA 4RCXA 3L4WA 1CBGA 4C90A 4AY8A 3BOXA 4BF5A 4K7VA 3N14A 5CBJA 1U22A 3BJFA 5AYZA 1JNEA 1NSJA 4O0ZA 3URAA 4S3EA 3LQLA 3G1SA 2XN2A 4GBUA 1Z32X 1ZENA 5DMMA 1Q6RA 4OU1A 5REQA 3RHGA 1CT5A 2FDSA 4A3UA 3T0BA 4AMAA 2P1FA 4EPBC 3M16A 3GK0A 3B05A 5HNTA 1RVKA 3CAVA 2PP1A 4MJ2A 5DY2A 1O94A 4RXGA 1E5JA 4JTHA 2C15A 4ZCWA 3TLQA 1FWJC 4I7VA 4L9YA 1ITQA 4ZO6A 3M5YA 3POCA 3UR2A 4DPQA 3BMWA 2EO7A 4FIQA 4J3ZA 3TA9A 2WCAA 1R3VA 1WUFA 2OZ8A 2PDYA 1QI3A 3FFSA 1A53A 4I9AA 1XBVA 4HD5A 1G4TA 2VFFA 4B5NA 4YVPA 3FDGA 5FJIA 4I8DA 4IPNB 3C0QA 2FPTA 1EQCA 1LWIA 3KBVA 3V1PA 2BMBA 3NQ6A 4H4IA 1OHLA 1X8CA 3WK1A 2ZDRA 2EPHA 2A7RA 1I75A 1XHGA 1TREA 2G41A 5J04A 3N2MA 2ZTJA 1AH0A 4OBRA 3H70A 3AJ7A 2IPGA 1EXPA 3KBJA 5FJJA 1TYGA 2MNRA 1KCXA 3TSMA 3NPUA 4HN8A 4QJ1A 2GUYA 1UUMA 5CZTA 2J74A 3AS0A 4AVNA 5U7SA 3L0GA 4HOXA 3G24A 3AROA 3CHVA 4PMVA 1SW3A 3EOUA 2YCLA 3V7PA 4CU6A 3UZJA 3CWHA 4PUEA 4HHHA 3IIXA 3SDOA 3MI2A 3QSTA 3NQ7A 2ISDA 2VDGA 4ZL1A 2DSZA 5FD0A 4QE1A 1M53A 3LLDA 1RQBA 4FLOA 2D24A 3TN5A 4IMDA 2GJLA 2J24A 3N4FA 4Y2WA 3WNNA 3G3MA 2GGIA 1NTHA 4AAJA 4OUIA 3LM3A 4MWAC 4IQLA 2XTKA 3F5KA 4F40A 2F38A 2QKFA 4IUGA 4XZNX 1G1YA 4RR4A 4KRZA 2ZRXA 3B0XA 2WNNA 2WMKA 3IANA 4AF0B 1XDMA 2V2CA 4KS0A 1SFJA 1VCVA 1UWTA 3VDHA 1E9LA 1ZTVA 3N04A 4HPHA 3U0HA 4ZENA 2W61A 1ICQA 3B0VC 4AZBA 1VCFA 1XCFA 4WQ6A 3G77A 3TAOA 4F48A 2Y63A 3RLHA 3AMKA 3L7RA 2J7GA 1RV8A 4HMNA 2RKXA 3D0CA 3IIZA 3UWQA 2GQ3A 1IE7C 4JGDA 3EDKA 5I78A 2PBOA 4UQAA 2PPGA 1ESWA 4HMDA 2CBJA 3WQGA 4DWSC 1T41A 4RV8A 1J93A 3NUKA 2XISA 3BO9A 1TVPA 2C0HA 4A3YA 3S2JA 3GAYA 3H2AA 3OODA 1L2QA 3PB0A 4UOZA 2IPJA 1XP3A 1UWQA 4GI9A 2YCIX 4GYPC 5A6KA 1KM0A 2J9YA 1JR1A 2QUNA 3CGTA 3PC0A 2ZX5A 1Q6DA 5C5YA 2PDXA 2UBPC 3WUGA 3NTYA 3SRDA 3WLTA 4ZQOA 3SJ3A 4GIEA 2REQB 2BXZA 3DFSA 3G6MA 3HQPA 2B0MA 2HVMA 2V6AA 4NASA 3WO8A 2V63A 4GK8A 2HNHA 1JZ3A 4O8RA 1PO9A 4QBXA 1W9DM 3OJGA 2HJPA 3HURA 1VCGA 2YLLA 3H2EA 1B3WA 4DPPA 4LSBA 2C8NA 4NNAA 5FJRA 3F4VA 1PCWA 4ERGA 4CNOA 2OWCA 1S2UA 3GHSA 3T0DA 4PB5A 5J5DA 3I3EA 3SADA 4FZIA 3CH9A 1L9WA 4H19A 4CEXC 1G4PA 3JU2A 4GX9A 4P7OA 3JUGA 1GVYA 3WH7A 4H2CA 3B9AA 3KTXA 2VC5A 3S9IA 2NLYA 4M5PA 2FTWA 4JCMA 1IEQA 3WIJA 4IUOA 4QNEA 3W85A 3F5JA 1JFHA 2J6XA 1DKWA 4DF0A 3W7KA 5GVJA 2VCCA 3O7UA 1F3TA 1IXNA 4I6KA 4JEQA 4ZXOA 3TUUA 3TMQA 4H6EA 5G1YA 4H8VA 3EKLA 4H8HA 3OLIA 1H1ZA 4H6KA 3LLFA 3QEZA 1M04A 4JPGA 3AHYA 5CPMA 4FIRA 1RA0A 1YX1A 3LUTA 4ZB2A 5E5CA 5JMUA 4GGHA 1A50A 3Q2DA 3TW9A 3I10A 1Y65A 1B9ZA 5DELA 8CGTA 3GKAA 3ZLGA 2O56A 3IARA 3TCEA 1KBBA 2ZZ5A 1F2JA 2A6LA 3OVPA 3WDQA 3FIGA 2BX7A 3IV3A 1O66A 1V5XA 1S5TA 2EKCA 1JQXA 3CHCA 2F2KA 4Q33A 4IFRA 2HDJA 3GYEA 1XH0A 1QNSA 3N18A 4LGXA 1K8CA 4DBDA 3WFAA 4JTDA 2I17A 1AQFA 1V6VA 2POTA 4WSHA 4TMBA 1NF7A 3B9EA 3GVVA 2QDHA 3AIBA 3VA8A 3W6MA 1POKA 3KRZA 1IT0A 3V0SA 4AIBA 2XM1A 4JDYA 3W23A 1EP2A 3HG5A 4QFUA 3ARQA 3FJLA 2J7EA 4HIBA 1H09A 3ONCA 1XQLA 3LXCA 1UPPA 2OSWA 1IEXA 1IIHA 2E77A 1AMYA 2NQHA 3KE0A 4DJFA 2B7OA 1R86A 1XLCA 2JEQA 1A3XA 6XIMA 1QU4A 2C1IA 3E2VA 1KFWA 3KOYA 1Y8BA 1GNXA 4LYKA 5E09A 4S1FA 1DIDA 4P61A 4GQ0A 4DWSA 2YB1A 1HP4A 2GDQA 4XIMA 1XSKA 3SN1A 1TTIA 4WDTA 4AISA 2DT3A 4Q4SA 1XYMA 3AOFA 2DORA 2VZUA 1W8GA 1A5OC 3BOLA 1YQ2A 4W7UA 2AL2A 1VLIA 4RLIA 2CW6A 4YLWA 1ZBCA 2GJPA 2W9MA 4FOKA 3BV7A 4MLJA 3WQ4A 1H3GA 4MSSA 4UNKA 3ERPA 3OO2A 2XYLA 3EEZA 3EDFA 3GU1A 1ZU8A 2R6OA 5A69A 3L5MA 3T8LA 2PDGA 1NP2A 1IWAA 3BLFA 3TJIA 3AC0A 1SR9A 2GGJA 4FSAA 1O60A 3QV6A 4CN1A 1QI2A 3T40A 2W6RA 4NNBA 4KEUA 4NY2A 1BQGA 1W1PA 2E9LA 3UQNA 1IWPA 3NM3A 3K4DA 3BH4A 3ANUA 4G7EB 3WDHA 1V3HA 1DXIA 3P5YA 3LCIA 2PLMA 2WWDA 3IGUA 5BCAA 4RE4A 1TJRA 2VR2A 4V1YA 3W88A 2BLEA 3OU8A 1D7FA 3VMOA 4IGHA 1UP3A 2Z1KA 4AXNA 3BOFA 4N7QA 1W2PA 4PTNA 2GJXB 4J28A 5JXQA 4LYRA 1Y5WA 1LL7A 3WNMA 4JIRA 3LU2A 3KL3A 3ITLA 1YIXA 3R43A 4PCSA 1P6WA 5E9AA 2WNZA 3L4YA 3CMGA 3RM8A 2ZUSA 4OVXA 3LHWA 1TV5A 2J7CA 1ZB5A 4A8RA 1BSLA 1JFXA 3M47A 3RGTA 2HBXA 4WVXA 3A6OA 4LAZA 4F0KA 1HP5A 5GJMA 3WD0A 3ARZA 2E6AA 1JUBA 3GNXA 4QITA 5DLCA 4QNWA 3VNYA 2FB2A 4YL2A 4L4PA 3BLIA 3H2CA 3R79A 5T9BG 3E12A 2NVDA 4XVEA 1H5VA 4MNMA 3DI0A 1AW2A 4ZO7A 1J0YA 4GNVA 2A79A 1PIIA 3EPNA 2ZADA 3GDRA 3VC5A 2QCCA 4XD6A 4ES4A 3N4EA 3SCNA 4QAWA 1P0NA 3WNOA 2CBUA 1U83A 4P7LA 1Q6EA 1JGMA 5CKSA 2CHOA 5HMFA 2PD5A 1UPMB 2YB4A 4QE5A 1W3NA 1HN1A 2E67A 4HSNA 1L6WA 4EVZA 2VMFA 4PL1A 1GQLA 3TTQA 3AS1A 3RPDA 1C3FA 1YRRA 3ZT7A 1V93A 2ALRA 4XBJA 5HA7A 4E8GA 1XYLA 1E9IA 3BMVA 5AHFA 4E0CA 2J8GA 3V5OA 1RHCA 5C9ZA 4M51A 3CWNA 1PWMA 2XFYA 4TTGA 4HYWA 3QHMA 1XLDA 3AUOA 1Z3NA 2KZHA 1MW1A 4FX8A 1SSDA 4AC7C 2X0HA 4W84A 3N2XA 4AQLA 3ENLA 5DMYA 1CTNA 3PBGA 1PYFA 1SMDA 1Z7AA 4MAVA 4O4VA 3KCOA 2AAMA 2FGZA 3KUMA 5FEPA 2PDNA 1JUEA 4PMRA 2P5NA 2CLKA 4XZLX 1CENA 4PUWA 3II1A 4O8AA 1I2NA 1UZ1A 4ZA0A 1P1MA 2VZSA 4AB4A 4HT3A 4RW3A 2V5BA 3ATYA 1TIMA 3L2MA 4DUWA 5H91A 1XBXA 1B4EA 3NL6A 3STCA 1ME9A 1Q66A 3P93A 5ABHA 1ITCA 2Y4SA 4H3DA 5AVHA 1R9XA 2BNJA 1XGZA 2PUZA 5FEWA 4HK5A 4B15A 3GW3A 4WJXA 4DB7A 5GPRA 4MY1A 1Q4NX 5DXXA 4UC5A 4XO6A 5GNXA 5H6HA 4NAEB 4IG2A 3KW3A 2NXIA 5HMDA 3VIKA 3W74A 2WKGA 3S9YA 2RDXA 3THCA 1H49A 3DFNA 3QHOA 1TQJA 3GHRA 3OYZA 4FF7A 4GJJA 1KFKA 3UERA 4B3KA 3FAXA 2YA0A 1V4YA 4LUTA 1QPRA 2DVXA 1IGSA 1EBGA 5ECUA 1B3OA 1QPOA 2NW0A 3SIMA 1XG3A 2XZ7A 3ME3A 3XISA 2TMDA 1QK0A 5IOBA 5BWAA 1HIZA 1W1TA 1H61A 4CQAA 1Q2SA 2QF8A 3RLGA 2O4QA 3P5ZA 1H7RA 3MA8A 4Q6XA 3N2BA 4XZHA 4DBWA 2DZBA 3WQFA 3KXQA 4GQRA 4FB7A 2AQOA 3DZ1A 3GD6A 1DWIM 1GPFA 3OZYA 1DIEA 4RJEA 4BI6A 3PBUA 2D2OA 3QZAA 3HM7A 1B9BA 2TPSA 3DYPA 3V1HA 3BCFA 5HJYA 1NOUA 3LA4A 2D0GA 3VKJA 3HV8A 2WNQA 2VR5A 1FCQA 3NDZA 1LROA 4OZOA 2PMQA 2QAFA 1VBJA 2WZMA 3ZS4A 1LQ2A 1H0GA 1CLVA 1Q63A 3FX4A 1JDEA 3CHEA 3W2LA 3C56A 3QY8A 1Q6FA 2NQ5A 8A3HA 4FP1A 5C8BB 4LUTB 4NG3A 4L61A 3W7PA 1GOOA 1J79A 3PTQA 5I3IA 2ACQA 1ZGDA 3NOEA 3WLNA 1DL3A 3TTSA 3GXPA 2VFGA 2J13A 1FXQA 4HU3A 4JTKA 4LY4A 3DEQA 4O10A 3L9CA 5C55A 1QPKA 3FW6A 1KR0A 1GONA 3PZMA 1XLLA 5EYWA 3MPGA 5J5RA 3AI0A 5CQ1A 1L6YA 4LNYA 3OGSA 4YXGA 2O9PA 4EANA 2INFA 3UA4A 1HVQA 1TFVA 3FJNA 2G3IA 2ZRUA 3UJRA 1ZY9A 3DERA 3WLIA 2AAAA 2X42A 3LRLA 4IPPA 2YBTA 3RILA 2WKJA 1WZLA 4GXPA 4TIMA 4GVGA 1KBKA 4UTKA 1MO0A 2FVMA 2GVJA 1E70M 2C7FA 2V3DA 5D4YA 1TPEA 1TE6A 2V5CA 1S5MA 1FWCC 1JDAA 1JZ8A 4K8GA 4AD5A 1W0MA 1MYRA 1K9TA 3BVJA 3VNMA 2HBVA 3MUXA 1GUVA 3ZT5A 2V81A 4A3QA 1J01A 1FBAA 3QPYA 2QYGA 1J0IA 1JDDA 1KA9F 3WQVA 2V3EA 2FZ9A 4FMVA 3KVLA 2JE8A 1H51A 1PV8A 4PCPA 4UTTC 1SO5A 2V5DA 1GEHA 3NO5A 1MI3A 2JFEX 4JN6A 3CPUA 4D1JA 1GGOA 1O7AA 4IICA 4V2XA 1EX1A 3KZPA 2WZTA 3ARVA 3NR0A 4GNJA 1B1YA 2BBFA 4ERAA 1U1JA 4FXJA 3NQFA 4GKTA 4LNCA 3BMXA 2WZHA 4URIA 4YWSA 2OB3A 1OFPA 1UA3A 1VEPA 3MW7A 1J0JA 1OABA 2XIMA 1B0IA 1LRTA 5A2AA 1HKJA 1XV8A 3SGUA 4AH7A 3PBMA 1R5YA 1AD4A 1LQAA 1BSIA 3M5VA 1F3XA 4D6IA 5C9UA 1H7PA 1ZALA 1MRQA 1Q6GA 3L68A 5EMYA 2RDWA 1MEHA 2WJDA 4LY8A 3GZAA 3GRIA 4D6HA 4D8AA 2CCRA 2GUBA 3V36A 4HCHA 3OQ8A 1BVNP 5B7ZA 1OD0A 3VI2A 4JTQA 5LGZA 2CZDA 2GVGA 4DXXA 4F2BA 1HTIA 1ZLPA 3C86A 1MXGA 1XIHA 1PKNA 1KFJA 3UJEA 3AJXA 4UUIA 4UIOA 3O16A 4LS1A 4PZVA 2FZ8A 4S3DA 5EB8A 5HOSA 3FSTA 2IKIA 1QNPA 3LNMA 1LUCB 3SCQA 5JVLA 4LB3A 2EF9A 3S1UA 3DDMA 5BMWA 3SUUA 2AOSA 1SU5A 3NFUA 4ZE5A 2X7VA 1ZBKA 2WZEA 3O8AA 1J10A 3WUFA 5CSRA 3HQNA 3WK3A 3BLEA 1JCLA 4TX9A 3W7MA 2CHNA 2YDRA 4B5SA 2EPKX 3S42A 2NT0A 3QVQA 4FEZA 4FR6A 1P0DA 2OQLA 1TIWA 3G2GA 4NRRA 4PCFA 5A1AA 1OBAA 4H1ZA 3PBWA 2QULA 4B4HA 1WXYA 3H7UA 4DJFD 3CAWA 1G7VA 2PF0A 2ZX9A 4IP5A 3Q65A 2PFHA 2J75A 4UTIA 1JZ4A 2J79A 2RH9A 1T96A 4HK6A 3O9NA 3SZ8A 4AD3A 2GGHA 3MSYA 1VFTA 2ZXQA 3E49A 4OOUA 3SRHA 1AZ2A 4IL0A 3UPWA 4J2PA 3H7RA 4QQ3A 2PS2A 1VB9A 2BGQA 4EACA 1M01A 3VX0A 4XAZA 1BYBA 4LJ3A 5G2HA 3O3RA 4H2HA 5LA1A 3C2OA 4A05A 3L4VA 3L12A 4WIWA 2HROA 3GUGA 1F3WA 2V38A 2CZFA 3EA2A 2QCDB 4IX0A 3FKKA 4C6LA 1VRXA 4HPNA 4L65A 4Y9OA 1VFUA 4G7EA 4AWSA 1QHOA 4XUYA 2CKSA 1OGBA 1PCKA 1OYAA 3LCGA 2BS9A 3EB3A 1D2KA 4Q6JA 1U5JA 2QCNA 1QW8A 2F61A 2VZOA 3MUY1 4MFEA 3PZQA 4PMJA 1C8VA 2ISVA 8RUCA 4LEQA 1XDLA 1LWHA 3I7SA 4QCFA 3TR2A 1AA1B 1I1XA 4Q8NA 1DJYA 4P7NA 5KEZA 5M5DA 4HNCA 1XD0A 4G8TA 1SM9A 3KHJA 2ZUUA 2VM8A 3AHVA 4GGBA 2PAJA 4NT0A 3K8LA 1LP6A 1H0IA 4ACZA 3QFEA 2C91A 5LXEA 4MUZA 3RXZA 3VZZA 2V5JA 3DX5A 4R7WA 3VKCA 4UTTA 3BGGA 3W83A 1JDCA 4HBKA 1UCWA 2Z1XA 4QDPA 4GYKA 3MI3A 2PB1A 3CK5A 4AW7A 2XSXA 4LALA 5D2XA 3SCOA 3UCQA 1R3SA 2P50A 3RYSA 3GDMA 4K36A 4D6JA 1FWWA 1EFZA 3G22A 1RLCL 2WB5A 1HX0A 3P62A 3UWEA 1KV5A 4E6MA 4LEFA 4Z2LA 1VYPX 1HGWA 1ALDA 3I3DA 3N6QA 1I2RA 4RX0A 1RJPA 1ZJHA 1BGAA 3NSNA 5FF3A 1OSEA 3S6TA 3P61A 5HANA 3UCDA 3CB3A 4CNNA 3M1ZA 3W37A 1MSSA 3FA5A 4UTMA 4RDZA 5FOOA 3TAKA 5BOOA 4XZIA 1F74A 1BG4A 4P5UA 2W3ZA 4L9XA 4TOQA 2GOUA 1ME8A 3EMCA 3VXGA 1TPFA 3H2NA 4X60A 1OX5A 1YADA 2FH6A 4XUGA 2G5WA 4HU0A 4EPDC 3ZJ6A 1LOLA 3DCPA 1QNRA 3R0DA 3WF2A 1ISXA 3NL2A 3ZVHB 5HWMA 2FYMA 3J7HA 1SZGA 1IZKA 4WY0A 5I7GA 4IIEA 1RBAA 3GU9A 3I3BA 5HNRA 3CUJA 5HUPA 1NVMA 3GQYA 3E74A 3N4AA 2I9UA 2EBNA 5AYIA 1E3XA 3LQGA 3FEMA 5A6AA 1VHCA 2E8ZA 2QPSA 3D3FA 5EBUA 1WO2A 1FX6A 5F2LA 1UWIA 3T9PA 1OZQA 4FO4A 4AWTA 3CXOA 1B4KA 4MY8A 2HEJA 5I3FA 4NYYA 2BWGA 5A3HA 5LIXX 4L6OA 4LANA 2RGMA 3VNLA 1HKWA 5IHRA 3APYA 2DQWA 4H9ZA 1FDYA 4B3ZA 2X1SA 4O57A 4KBXA 1OIFA 1M7JA 1O5XA 5D32A 3OW1A 3UFYA 2GQ9A 3JRKA 3CNYA 5AN7A 4R7OA 1FH9A 1QPNA 4MAZA 3KWSA 4JL1A 5HMEA 3TYEA 3G8RA 1R3RA 4C1NB 3W1LA 3W7JA 1ZBWA 2I16A 2QUTA 2YYTA 1Q7QA 2OLHA 2GK1A 3G1FA 3LGGA 2PTXA 5A8QA 4XAFA 1O12A 2R1MA 2WM0A 4J7RA 4Q7NA 4J3TA 1XGEA 3IJ6A 1QATA 3DGBA 3UCCA 3ZQ9A 1VEOA 3RFAA 4L7ZA 1EYWA 5D9NA 3WD4A 3VFCA 4JFVA 1WXZA 5FKYA 2VO5A 4PMOA 4HKPA 3DESA 1P5BA 3HOJA 3ZXWA 5A94A 1KXHA 2OT1A 1OADA 4JFUA 2QEZA 4GYPA 3GS6A 2XVNA 4HCLA 1UROA 2W5FA 4JR5A 4Z1BA 1YYAA 1JUKA 3GBDA 3NGJA 2TAAA 2OQYA 4RKAA 1TJ2A 5TIMA 4YTQA 3R2GA 2BTMA 4ML9A 3OIXA 5GNZA 5A6BA 1IZJA 2YYUA 5ENLA 3MV11 2ESCA 4R88A 4DO4A 4UCFA 5LNWA 1Z44A 2J8FA 3TV8A 3M9YA 4E3TA 4AD1A 1RBLA 1KWGA 1B3ZA 4GJIA 3SN0A 5FJUA 3GTNA 3TQVA 4IQDA 2ASHA 1GG0A 3HGJA 2EXOA 1M6JA 1NOWA 3G18A 2G3FA 1FWAC 2Q3OA 3O15A 1JXKA 3URQA 1W37A 3VOCA 4C6CA 1T40A 2ZZ6A 2H9AB 4K68A 3T0TA 1T0OA 5D38A 4JX6A 4QSHA 2IW0A 2QPUA 4P2VA 3B06A 1TTQA 1A5NC 1YNPA 1JJKA 4N9CA 2X7WA 2VDHA 4EXBA 3IGXA 1PE1A 2BHZA 1SFTA 2V2HA 4HA1A 2AQWA 1A5BA 2W67A 4GCAA 1WNOA 3VD4A 5HPCA 2CU0A 2WJZA 4WSJA 4C6EA 4LYQA 3VGFA 5CC3A 3P84A 1LTDA 4S3AA 1IXQA 2E0PA 2YW3A 3BGAA 2ZDSA 3GZ3A 1W1YA 3RCYA 2A1YA 3WK0A 1AJ2A 4XB3A 3W81A 4NZFA 4TXEA 3T1GA 2CLHA 1YTDA 1G6CA 1VPXA 4K8EA 2E6DA 5FJPA 5DEZA 2YCKX 3NA8A 1X38A 4MOZA 3NQDA 3P0WA 1P48A 2PLJA 2VX7A 3VKBA 3W9ZA 3KTCA 3CUGA 3QMRA 3T08A 3LPOA 2IKHA 3NPWA 5DFAA 1E1CA 3CMJA 4HSHA 3GDKA 4G5DA 4K2SA 3SIZA 5AKQA 3VMNA 5BOEA 4JKKA 1FH7A 1OY0A 1XC6A 1ENUA 1OX6A 2RAGA 9XIAA 2WQDA 3B0PA 3A3HA 4JHOA 1F05A 4LFYA 2J4GA 4KESA 1DJHA 4D1IA 1UMYA 4FNRA 2YX0A 5H8PA 4H04A 1EUAA 3E96A 4QXIA 3RMEA 4G7FA 3H7VA 3MMDA 4DUVA 3BTNA 2DZPA 4MJZA 3QGKC 1FDZA 4IJBA 3SW6A 3OBEA 1DXFA 3YPIA 3G1XA 4LXFA 2DQXA 1OCJA 3AYTA 1VS1A 2IKJA 4N6FA 4ZR8A 4DBSA 2OODA 3IJ9A 3LTPA 3WF1A 3T6CA 1CWYA 2E40A 1EKOA 1E3ZA 4IJCA 2P8BA 2Z6IA 2GWGA 1HFBA 4NZ4A 4W5ZA 2NLIA 5HWJA 3MUZ1 2Z6JA 4Y9AA 1QHPA 4DHGA 3FLUA 1E9ZB 1O6IA 3MCNA 4X0NA 2YA2A 3WJSA 4HU8A 4KKXA 1JL8A 3E02A 1BD0A 1OX4B 1OG0A 1E0TA 1UWRA 3WQEA 1U1UA 1N8WA 5BZAA 3TSBA 1WZKA 4Q7BA 1KRAC 4FHAA 4CD4A 3NQBA 2YXOA 2ZXBA 4PFHA 1H62A 1V0LA 3CLMA 3MHFA 2DT1A 2Y5SA 4Y9NA 1TWZA 2Y8KA 5CBBA 3EWZA 1ZAIA 3EDEA 3W71A 1TA3B 3ITOA 3WKZA 1OFQA 2CC0A 1Y5VA 1GYNA 5E0CA 3MMUA 1PAMA 2HS6A 2FH8A 4KIRA 3ZR6A 2TRSA 5A6TC 3PPFA 4EXAA 4R7JA 4Q4PA 5F4SA 1UYQA 5I07A 1NU5A 1CDGA 2CXGA 5HQLA 4LV4A 1ZHAA 3TE9A 3LI1A 2NUWA 3GO2A 3NZPA 3USZA 3LOTA