5C5YA

Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (hexagonal form)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
SDIKAVAQRALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIATVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNETIGFDMVKVCKQACSGNAKLKVIIETGELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAIYLDLADNILGNEWADANHFRFGASSLLISLLDTLGHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Trading off stability against activity in extremophilic aldolases.
pubmed doi rcsb
source organism Colwellia psychrerythraea (strain 34h / atcc baa-681)
molecule tags Lyase
total genus 95
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5c5yA00
1OFEA 3M5ZA 3LXAA 3Q2DA 3OIXA 3P82A 1G4SA 3PB0A 4XBKA 3PUOA 1EX5A 3FA5A 4ZQOA 1WQ5A 4NJGA 1A53A 1SZGA 1WBJA 2YGYA 1TMHA 4JS3A 5C5YA 2X1TA 3GXNA 3BGJA 1TCDA 2ZQ0A 1O95A 3F4WA 3HF3A 3L67A 3C2EA 4FIRA 2G97A 3LXCA 1QAPA 4Y8FA 1JVNA 2EKCA 5KMYA 4HNTA 1KBJA 5FEWA 3HGRA 3S1UA 3PF3A 4UFHA 4ORMA 3MBFA 3W83A 4RJEA 4JTLA 3LV5A 5AHMA 3SGUA 1SPQA 3TAOA 3C56A 3FLUA 2R91A 3PSVA 4NJHA 3W2LA 3W70A 4FF7A 4RXGA 3QC3A 3CC1A 1L6WA 2QJGA 2NX3A 4QM1A 4ADUA 2CLMA 3GIYA 4AHQA 2F7FA 4NX5A 2ZCGA 4Z08A 1JJKA 5K3VA 1O4UA 3DGRA 1K7XA 1PCWA 2B7OA 1WX0A 3W3OA 3JRKA 3W72A 2V81A 4OV4A 2X30A 2DJLA 4NNBA 5LNSA 4Z1DA 3W22A 2QCDA 5I3HA 2E09A 3YPIA 1GT8A 5G1TA 3M5XA 2RKXA 3W7PA 3WK3A 3NZRA 2DZWA 2Y7FA 1OHLA 2JKEA 2AGKA 2FPTA 3HB9A 4JX6A 1ZENA 3WJZA 1ZAJA 4N9EA 2PRHA 4MYXA 2YYUA 3M5YA 2VFHA 3WK0A 3FKKA 5D2YA 4N6EA 3Q37A 4MZYA 4JTUA 2ZA2A 1TPEA 4ZQRA 5EYWA 3NYZA 2WNQA 4IMEA 1GTEA 1G6CA 4FNTA 5AN7A 1H7RA 1NEYA 3NM1A 1T0OA 3PWAA 1WXJA 1IGSA 3LGEA 4DF0A 3LTPA 3LHVA 5BMXA 1YTDA 2Y70A 1VYSX 4BI6A 2CZDA 4JDYA 4MZ1A 3C2FA 5DXYA 2H90A 4X3ZA 3I65A 2ABAA 3GR8A 2GJLA 2Y6ZA 4MPQA 3QMRA 1YXCA 4ORIA 3RLVA 1G67A 1EB3A 1MEWA 4JR5A 1ONRA 3TH6A 1Q3NA 3JR2A 2YPIA 4UMAA 3QFEA 4X9SA 5FF3A 4UFMA 4XUGA 4A29A 4G1KA 3TMQA 3QPYA 1KFBA 3PY2A 4UCGA 3TSDA 3NDOA 4OT7A 4TO8A 2AQWA 3FOKA 4AH7A 2OT1A 1H7OA 1QO2A 3EX6A 5KITA 3O06A 5HWNA 3EKLA 3HPXA 1OX4B 2GVGA 3O6YX 4XTDA 1OYBA 3QM3A 4CNNA 4JXCA 5LGZA 3R8RA 2QCEA 3C2OA 5D2WA 4UTTA 1KFCA 3O07A 4O4VA 4LS0A 1RVGA 5AB3A 4UTMA 1XC4A 3TK7A 3P74A 2BWGA 4CLMA 1X1OA 4MIMA 1VLIA 1TV5A 1WOAA 4ONVA 5LGXA 1ICPA 1F74A 3EXTA 1W1ZA 1TO3A 2WSYA 5H2ZA 5CSSA 3G8RA 3GKFA 4IQLA 4I9AA 3CU2A 5D2TA 2FDSA 1ZY9A 3KRSA 5LSMA 4EIVA 1C9DA 2FLIA 5C6MA 3NPUA 5E1QA 3GX9A 3F4NA 1TRDA 3U6WA 1KFKA 1ME7A 1IIGA 3NL6A 3W7EA 2C13A 4HT3A 2V0TA 3HQ1A 2VENA 3S42A 3P8IA 3TJLA 3W1RA 5FI8A 1HUVA 5C2XA 4Z1CA 3BW3A 4ML9A 5KSWA 3UZJA 3HG5A 4WY0A 1YADA 4DEFA 1F6PA 2EPHA 3TW7A 3W1XA 2CLKA 3P81A 1L6SA 3HG3A 4FX7A 3P61A 4CCDA 3HGSA 1EWDA 4K36A 1LRQA 3NVTA 1W5QA 1WV2A 1GVOA 5CPOA 1W31A 4JX4A 1KLZA 2W79A 1M5WA 2X1UA 3IV3A 1RR2A 1XL9A 4GUJA 1UB3A 1G7VA 2WOQA 3E9AA 3IIOA 2C15A 3KVLA 4IJBA 1PCKA 4LVBA 3MWAA 3W84A 3EWYA 4JTIA 5AC6A 5LNWA 4LC8A 1K7FA 3UWWA 2R14A 3G8EA 4R7JA 4JYDA 4R53A 3NQ7A 5D37A 5CPNA 1VCGA 2QCFA 1VZWA 3TV8A 1Z44A 5EKYA 1OFPA 1ZAIA 1YDVA 3B0UX 1LCOA 2QJIA 3LHZA 5LHEA 4OU1A 3GNDA 1LTDA 3T78A 1IXNA 5D05A 4AWTA 3NQ8A 1ZAHA 1TREA 1PHWA 5SWUA 3LCGA 4JTJA 4WJEA 3F1QA 3WJXA 4IMDA 1HFBA 2PURA 4KFNA 2ZZ2A 3DI0A 1AG1O 4DPQA 4PC8A 5LKYA 1K8ZA 3STCA 1GEQA 3S5ZA 5E0KA 1OG0A 3LHUA 1GVQA 1ZALA 3P62A 3W1TA 3PAJA 3UPBA 4UNKA 2FB2A 1AW2A 1SR9A 5E93A 5DBUA 2ZZ3A 1JUKA 3LHTA 3RLUA 3RF9A 3HBLA 3IGSA 1KFLA 1ME9A 1M7OA 1VCFA 2A7PA 2ZYFA 3L2IA 1LRNA 2TYSA 3C2VA 4A22A 3CEUA 3TQ0A 4BFAA 2VFFA 1W5PA 5D03A 3U8GA 2G5WA 4JD4A 4PFMA 1THFD 4IGHA 2XN0A 1L6YA 2NX9A 1MSSA 2GUUA 4S2CA 3UYCA 4FX8A 3KAOA 3HG4A 1SSGA 1YYAA 2WNNA 4N9DA 1KTBA 3KRUA 4JTFA 4NT0A 3LDVA 1KM3A 4PA8A 3FYPA 3IGXA 4ALDA 4H4IA 4ZQCA 1CX9A 1OFRA 4DF2A 5AHEA 1VYPX 2YCEA 1QR7A 1EUNA 1S5VA 2Y63A 3NL5A 3TE9A 2BLEA 4M6VA 4LU0A 1M6JA 2ZBTA 4O28A 1A5AA 2DZVA 4E0CA 4FNRA 1EWEA 1B9BA 2B4GA 4JTKA 5DN1A 4MFEA 1KW1A 3ZWTA 4W9TA 5HWJA 4WZHA 4Z1BA 4JIPA 3FS2A 5TIMA 2QCLA 4A21A 4GUGA 2QCCA 1SFJA 3LXBA 3HPZA 2DZSA 4M7TA 1UUMA 2X2GA 1SZFA 5DY2A 3UNDA 3CQ0A 3FKRA 1XM3A 4UTWC 2I14A 4BWLA 5TQLA 5D38A 4LV9A 1BWLA 1WAUA 1XFBA 2QDGA 1OFQA 3HJZA 5IBXA 3PSWA 3SY5A 3THQA 5AC7A 5D09A 1O60A 3UWQA 3ZR4A 5AFDA 3ZS4A 1I2QA 3PS7A 3IEBA 4GUFA 3W7MA 1H5YA 1EUAA 4Z1AA 2HS6A 3ABQA 4XBSA 5HWMA 4NQ1A 4R34A 1ICQA 2W6RA 3O6DA 3TC6A 1DQXA 3W7OA 4ZMGA 3GYEA 3O63A 1W3IA 3IIXA 1XUUA 2QCMA 1PS9A 3GXPA 3W1NA 2CW6A 3DZ1A 5U7SA 4IOTA 5H91A 2YZRA 1P5BA 3WK2A 2NWSA 3G3DA 1PHQA 4XQ6A 2B7QA 5G1YA 5D2XA 4NVTA 5L9FA 3P8JA 4E38A 1J5TA 1TTQA 2KZHA 1GYNA 1OYAA 1OFOA 4IMGA 1TPC1 3N19B 1QFEA 3QW4B 5F4WA 4I7UA 4WY0F 3UWUA 3K30A 2O7SA 4JYEA 1A5BA 3TMLA 2ZZ7A 5MHBA 4EWND 4HN4A 4FEZA 2FPVA 1GWJA 4JDBA 4O12A 2C1HA 2GPTA 4O8RA 4PH6A 4PL2A 1LRTA 1T96A 2YX0A 3CEPA 5DCBA 3NM3A 4U4MA 2I9EA 3HGOA 2CZ5A 4L4MA 4Z0SA 1QWGA 1K3UA 4J9JA 3P5YA 5FF7A 1QOQA 1TV8A 1YTKA 2FB3A 1KM2A 4CNPA 4OQVA 2Y7GA 3R5EA 4DO4A 3IVSA 2WKJA 3DXIA 4N4QA 2DU2A 5KINA 3ANYA 1GTHA 3FYOA 4KWWA 4CQ9A 1SO4A 4K6AA 1DORA 3LERA 1TPWA 2A7RA 4O18A 1F2JA 2GVJA 4HPXA 3DH7A 2QAFA 1S5WA 3W71A 1Q45A 4D2JA 5LNVA 1VHCA 3W2KA 4JTEA 3G0XA 2TMDA 1GVSA 2ZZ4A 4LWWA 3SGZA 3S5NA 5AC8A 4LT9A 4AAJA 2QCDB 1TIMA 2RDUA 4XKYA 3U2OA 3TSMA 5F2IA 4JEQA 5FESA 1TPUA 1GZGA 2VXNA 3UY7A 4GUHA 1ZCOA 2BXVA 1H51A 3DKJA 4Q33A 3NOEA 1RD5A 1FQ0A 4A3UA 5AOUA 1B4KA 3BG9A 3FJ6A 3KVMA 3EX3A 2DZPA 4GC4A 2DZTA 1BKSA 2B7PA 1W5OA 1X6UA 1NF7A 1EA0A 3W2NA 4UC5A 1F73A 4IWWA 3LI1A 2V5LA 2VELA 1FDZA 2I1OA 3P7YA 1W37A 3A21A 5CZ0A 1HO4A 1TJPA 3E49A 5K4ZA 5J5RA 1KFEA 3PM6A 3LHYA 4YCOA 2A0NA 3MBDA 5G4EA 3QMTA 5CZTA 4QITA 1R2TA 3P67A 4HSOA 4UFLA 3M9YA 3LI0A 4LV4A 4O0KA 5EL1A 3N14A 4NZFA 3GXTA 5AYXA 1EPXA 2YFNA 1JQXA 1QO5A 4HHPA 4O57A 3TXVA 3PG8A 1H7NA 4UTTC 2H8ZA 2OZ0A 5AYYA 2P10A 3OVRA 2J88A 5EMUA 2NV2A 4JTSA 3HGJA 1VH7A 4CQAA 1KLYA 1LBMA 2QAPA 3BK0A 4QSHA 3NL3A 3NR0A 3LLDA 1I45A 3TIMA 4I7VA 2DORA 1WDWA 4Y96A 3GDMA 1YTEA 4AXKA 1TQJA 3C2RA 4K39A 3BLIA 1A50A 3SFKA 5G5IA 4ZQMA 6ALDA 2A85A 4RXFA 4UTIA 3CLMA 4K8HA 4UFJA 3BLFA 4PODA 1ZJIA 3MO7A 1XDMA 4RZ5A 2O7QA 2XFWA 4UXDA 1J2WA 2NZLA 4JTGA 3CWOX 3ATYA 4HPJA 3T55A 3E12A 3MHFA 4WUIA 4MVAA 4S2BA 1RQHA 3JS3A 4GNJA 4LVFA 4OHQA 1IXOA 1FWRA 3OVPA 1LDCA 2XN2A 4I7WA 3G1YA 3LTYA 5FEXA 1SSDA 3S8HA 2Y7EA 2Z1BA 1LM1A 4XTIA 3DFPA 2JGYA 3LM7A 3S9YA 3PUEA 3W23A 4QIUA 4KKXA 4MFDA 1DJNA 3CIWA 3OEXA 1H7XA 3M47A 4O4WA 1SW3A 3N3MA 1H60A 2ATMA 4JNMA 3GZ3A 2QCGA 1DHPA 4UTUA 2TRSA 1FCUA 1LOSA 3A23A 4DF1A 4JY8A 2NWRA 2VKZG 3O15A 2V2HA 4ZQNA 3W7NA 1YDNA 3L65A 3NPVA 4AVFA 5F2GA 4TR9A 3STFA 1W5NA 3S6DA 2OMAA 4P61A 1TPDA 1Z41A 3VE7A 2C3ZA 5F4XA 3GDRA 4NJIA 1LOQA 3O16A 3UWZA 3W7JA 3G1HA 3M6YA 3B4UA 5K2ZA 1A5CA 2FFCA 1PVNA 4XZ9A 5HMSA 1VC4A 2GJNA 1T8XA 3S1VA 4K7VA 3LBCA 6TIMA 1Y0EA 2BSLA 1JUEA 1HG3A 1TPB1 4S1FA 2BZNA 4LTSA 2C18A 4X2RA 4M7SA 5IM51 2VEPA 5EPDA 1R2RA 1FWTA 1ZFJA 3EX2A 2BX7A 3LB0A 3G1XA 3SSJA 3B05A 5F1UA 3TA6A 1P4CA 3R89A 2WPBA 4IUOA 4TMCA 1KTNA 3DHFA 3DU0A 2X1SA 3M44A 1H62A 4TX9A 3L0GA 4AEOA 2NUYA 2ZA3A 1CW2A 2Y7DA 5D04C 1BWKA 1H1YA 4AWUA 3WJWA 3VKJA 4MUZA 4N9BA 2YR1A 1VLWA 1JCLA 2ZA1A 4LRSA 1G4PA 1VR6A 1U83A 2GQAA 3NQMA 1JR1A 1FWWA 3N2MA 5FF0A 4X22A 5DCDA 4DQWA 1CI1A 3G1FA 3TUUA 3FEMA 2V5BA 1LYXA 2NV1A 1OX4A 1DBTA 4YL2A 1FCQA 5FF4A 2JK2A 5I3FA 3QSTA 4E2DA 4LUIA 3ABOA 2J9XA 3TKFA 1JUBA 4QAIA 2CLLA 3KVJA 2CLIA 2Q8LA 5CPMA 4A2RA 5BMWA 1TTPA 2EF9A 3DFOA 3UQNA 2ZRYA 3I7SA 3G22A 4GE8A 1FCBA 2GVLA 2DZXA 1XKYA 5LZLA 1TTIA 1PL9A 1HTIA 4MKNA 3A24A 2PRLA 1P0KA 4RCXA 3MHGA 1D9EA 2XN1A 3EX1A 3W7RA 2H3BA 3S0CA 3E0IA 4KWVA 4LY8A 4ZL1A 4FNQA 4GBUA 3B04A 4HNUA 2C14A 2FPYA 5D2VA 3PBWA 3UWVA 2E6AA 5A8GA 1I2RA 3GB6A 3FIGA 4UR7A 4N6FA 1GPWA 1F6KA 4B5NA 2NUWA 3TCEA 5HR6A 4L4LA 1VYRA 3L5LA 2WO5A 2J9YA 3G1DA 4HSNA 3G0SA 2ZRUA 1EIXA 3G1SA 3KOFA 4UIOA 4NZJA 3SZ8A 3VE9A 1TPFA 4BWLC 1SUXA 3BV4A 3BLEA 1YXDA 3NQVA 3QZEA 4O14A 3HOJA 5IBXC 3PR2A 3P84A 5A5WA 2YFOA 1ME8A 4RV8A 3LHWA 3CHVA 3B0VC 4QISA 2VFGA 1VGAA 4IMFA 4MY9A 4OGZA 3UD6A 1LOLA 3GDLA 4WOZA 1G7UA 2VFIA 1KTCA 2VFEA 1QPQA 4BI5A 5D33A 4IX2A 2JKAA 1OYCA 3CIXA 3L68A 4AB4A 5HUOA 1H50A 4N4PA 5HINA 1AK5A 1C8VA 2RDTA 3MI6A 3MP3A 3QYQA 1D3GA 3W75A 3MMTA 1NVMA 3LCXA 4UTJA 4LC6A 5LHFA 2B0MA 1X7FA 4AWSA 3KVKA 2F84A 3PBYA 3TX9A 2Y88A 4Z0JA 1S3HA 2J27A 3W74A 2OT0A 2QDHA 2NXGA 3MJYA 3A22A 4ICNA 3KFTA 3O05A 3OVQA 4QJ1A 3GAYA 4JX5A 3TR2A 4AF0B 2ZRVA 4P2VA 2GQ9A 2QUTA 3NQ2A 5AHLA 3M16A 3TJXA 3H54A 1GVRA 3MUXA 1IXPA 4JICA 1H63A 3LOTA 2NXHA 3AO0A 3KHJA 4GWEA 3ABRA 4FB7A 5G2HA 3GDKA 8TIMA 1ML1A 3M1ZA 3NPWA 1FDJA 4QQ3A 4RZ4A 3ZWSA 1YXYA 4AMAA 3W7DA 5CKSA 5HR7A 4IMCA 4JGDA 1KM0A 1H61A 2QKFA 2YXGA 4BI7A 3HG2A 3W9ZA 4AHOA 1TJRA 3W87A 3W85A 1F76A 1NSJA 2WQPA 1QPRA 3L0KA 3SJ3A 3NQ6A 3W2MA 3O1NA 1XXXA 4FNUA 1DQWA 3NG3A 5AHFA 3MP4A 4A2SA 1KV5A 4IPJA 4YCPA 1WYIA 3IGUA 3R2GA 4LVAA 2E6YA 3GKAA 2CWNA 4K37A 3WJYA 1VPXA 3BARA 2A4AA 3L5MA 4TMBA 3GAKA 1B3OA 4NNCA 4H3DA 2WSRA 3GDTA 1KM6A 5TBOA 4MJZA 4N9CA 5CZJA 3LCFA 3LRMA 3V75A 4UR8A 3N2XA 1WOBA 2WJZA 1VHNA 4YWIA 3LBMA 1JRCA 3AJXA 4GFSA 2ATSA 1I2NA 2TPSA 1MEHA 3GLCA 1RV8A 5D32A 5F2LA 4O1CA 1YPIA 3SI9A 1OK6A 1I8JA 5HQEA 1V7YA 5AHIA 2A2IA 2A21A 1MO0A 3MI3A 3KX6A 3C52A 3OHIA 2Q8ZA 3H55A 2CZEA 1M7PA 1UJPA 2Z2UA 1FY6A 4K8EA 4EVZA 1ZHAA 2QJHA 3W1AA 4U28A 2W0UA 1XCFA 3WFAA 3MHUA 4O0ZA 4FXSA 3L0NA 1MZHA 2VC6A 3TU9A 3F03K 3LRLA 1FDYA 2CLFA 3R12A 1ICSA 2H3DA 3SR7A 3LLFA 1T99A 2FTPA 3STEA 3PUDA 1O5KA 4UMBA 3NZ1A 4WOQA 4C1KA 4GUIA 5CZSA 3NQDA 5FEPA 4R33A 5G4WA 1IXQA 4LNYA 4HKPA 2E68A 3INPA 2ZRXA 3QF0A 5DY3A 4IX0A 5EBUA 4ADTA 2CLEA 3PB2A 1O5XA 3M41A 1DJQA 1A5SA 3W1UA 3N34A 2J9ZA 3QQ1A 2Z0IA 4O16A 3S5OA 1W5MA 3R13A 2Y85A 2V8ZA 3PBUA 3T40A 3TQVA 1N8FA 2A5HA 1KV8A 1W3TA 3W2UA 3I68A 5C54A 4MOZA 2IQTA 1H7PA 3G0UA 1FWNA 4O53A 3NQGA 2G95A 1XI3A 3HIJA 4FXRA 5G2IA 1N7KA 5U4NA 3UXAA 3P5ZA 3W7CA 5I3GA 1LBLA 2J6XA 3M7WA 1GQNA 1Z48A 1LLWA 2DP3A 1V5XA 3DBPA 3STGA 3KXQA 4ZZ9A 2PE4A 2QF7A 2QR6A 3DI1A 4MLRA 4M19A 4MYAA 2FIQA 2ISVA 2Q3RA 3CPRA 3LX9A 3QW3A 4JN6A 4JY9A 3DKLA 4O10A 3DFQA 3LV6A 1W0MA 5AYZA 5I3KA 3C3NA 1AW1A 1KA9F 5HUPA 2C6QA 4MY8A 1OX6A 2TSYA 3EXRA 1DOSA 1Q6LA 1TTJA 1PIIA 1RPXA 3EWBX 4WXYA 5CG7A 4FNSA 3GNNA 4M5PA 1VJIA 4MY1A 3MI2A 3NO5A 3W1MA 1NF0A 3P80A 4M6QA 1J4EA 2HMCA 3O8AA 1AL7A 3DFTA 3IIZA 4EF9A 2A6NA 3ATZA 3N9RA 3RK8A 1I4NA 2Q3OA 5DCEA 4TIMA 5BW6A 1R46A 1HO1A 2ZTJA 4WD0A 4GRSA 1WBHA 3W7IA 2E1DA 4UNLA 2D73A 3IIPA 1JCJA 5I3JA 3ZFHA 5K9DA 3EWZA 3LCLA 1LP6A 1Q6OA 2DJXA 1FXPA 1H1ZA 3C0JA 1MEIA 3W2JA 5CSRA 5BRBA 3Q58A 5GVJA 3E96A 3A5FA 3I7QA 1JULA 3MYPA 2ZZ5A 4RR4A 3DFSA 1P0NA 2A7NA 4K38A 5LNUA 1OJXA 3LRKA 1W8SA 4O52A 1DV7A 3BW2A 5F4SA 2RH9A 3UWYA 1VCVA 4O17A 4UFKA 4O15A 3I7RA 3EWXA 2JBMA 4CQ8A 1NFBA 3NL2A 5EY5A 4OWGA 1GG0A 3OG3A 1OK4A 1UCWA 3ELFA 1BTMA 1XBXA 4QNWA 1UASA 3EEGA 3IIVA 4O19A 1SO6A 1G69A 2Y61A 1GYLA 3EXSA 2NX1A 5K7JA 1TPVA 3CB8A 3ABSA 1LORA 3M0ZA 3G3MA 1K02A 2BTMA 3B8DA 1XDLA 2R94A 1KBIA 3W7HA 4DBEA 3NPXA 1SU5A 4K7YA 1TYGA 3KRZA 3MP5A 3QRHA 3SIZA 4AHPA 4FNPA 1K7EA 1EP3A 2CZFA 4HNVA 2EGZA 1QPOA 4NUWA 3OBKA 3NXFA 1IF2A 2ISWA 3LCIA 3USBA 3GK0A 3MW7A 3FFSA 1AMKA 3PULA 1KM1A 4Q4KA 2QCNA 2OCZA 2CU0A 4LS2A 1SO3A 3NEVA 1ADOA 3EWUA 4LW7A 4WY0B 5AHNA 2VOMA 1KM5A 1F5ZA 3THAA 4O50A 4ZQPA 2A6LA 4PEKA 4O54A 2E6FA 3G1VA 5DELA 1QDSA 1GOXA 3Q94A 3PC0A 3OA3A 3RMJA 1O94A 2V30A 4WXZA 1XBZA 3TFCA 3M43A 4JYFA 2QUVA 1I2PA 1N55A 1LZOA 2V82A 1PV8A 2H6RA 4Y9AA 1XBYA 2ZFAA 1NAL1 3C4UA 1OFDA 5K4XA 2V2CA 3O6CA 1IIHA 2R8WA 1TPH1 1YPFA 3TXZA 1OABA 1X8FA 3IVUA 1FX6A 3P60A 5FEZA 3DAQA 2HTMA 2V9DA 2FJKA 5I3IA 2CLHA 3S1XA 4OBTA 1BEUA 3UPWA 4PL1A 3QQ0A 5BNKA 1DVJA 1SFLA 4EOUA 2RHGA 4PCFA 4MJMA 2X16A 5KTLA 1JQVA 5F2MA 1OF6A 2WV8A 2RDWA 3V1PA 2YSWA 4RZ6A 3WJSA 2ZZ6A 3DFNA 1VQTA 1JCYA 3BO9A 2C0AA 5KZMA 5D30A 3NAVA 1AW5A 3UXDA 4DBDA 5BOOA 2NLIA 2VFDA 3W88A 3S1WA 2QCHA 1SZEA 2UV8G 1G4EA 4BK9A 2P1FA 4MLJA 2P0OA 3TFXA 2ALDA 3EWWA 1MXSA 4CNOA 3GR7A 3NGJA 1R47A 2Z6IA 2VEMA 3WK1A 3A9IA 4PTNA 1TSIA 4O11A 2LLEA 3BW4A 1FWSA 3BG5A 3HMJG 3I6RA 2JGQA 1EEPA 1H7WA 3L66A 3QEZA 2AAMA 2CLOA 5C55A 1FXQA 1B57A 4Y6GA 1JCNA 3SW6A 3T4CA 4NNAA 1RQBA 4TU1A 4HNNA 5HJLA 5DLCA 3CT7A 4UTKA 2ISSA 1TB3A 1YLVA 3PG9A 4BR1A 3L5AA 1KFJA 5DXXA 3IRDA 2ZRWA 5L6UA 3H53A 3BVJA 3PBVA 3A5VA 3PVFA 4UUIA 5DBTA 3MYOA 4XWUA 1FUYA 1F05A 3W7LA 1ALDA 2VEKA 3SECA 3CTLA 2YDAA 3T44A 4O1AA 1QCWA 1W56A 2VEIA 1SZNA 3BGGA 1QOPA 4POCA 1SW7A 3RFAA 2ZRZA 4DPPA 1OX5A 3TNOA 3FJLA 1PE1A 3GVGA 3W7QA 3LCWA 4LVGA 4DO5A 1UUOA 4FHAA 4E2BA 4IXXA 2PRMA 4KFOA 1LROA 3DHDA 1K03A 1W54A 2PCQA 1X1ZA 2ZTKA 5ABTA 4WQ6A 3NQAA 5G2WA 1R30A 5D02A 3TQKA 2Y89A 1EP1A 4O1BA 5FF2A 3L21A 3TROA 2GQ8A 5T26A 3W6YA 3N73A 3TAKA 3VNDA 1S5TA 1FBAA 1K8YA 2DZUA 3NQFA 2YW4A 4ADSA 1LBFA 1FCVA 4NJKA 7TIMA 1SQ7A 4FIQA 2FQIA 1ZNNA 2E77A 4LUJA 4JTTA 4YXGA 1B4EA 3TDFA 2X1RA 2YYTA 3C6CA 1TQXA 5HNRA 3W76A 3W73A 3S5YA 3B0PA 2C16A 4H6KA 5HULA 1OVDA 4O13A 1Z42A 3QH2A 3E02A 4IPIA 4N02A 1TRIA 2RFGA 3W07A 4UFIA 3NQCA 3LCHA 1GJPA 1R2SA 1RQEA 3TW6A 4M6PA 3T7VA 3W1PA 1KM4A 4DO6A 4LVDA 3RU6A 1OF8A 2YW3A 1LLZA 4LRTA 2NUXA 3D0CA 2ABBA 2V2DA 1QMLA 2HS8A 3L9CA 1VRDA 1UBSA 1QNVA 3G24A 4NX0A 3C8FA 4JTHA 3NQEA 4MZ8A 1SO5A 2Z6JA 1L9WA 4Y90A 1VS1A 1W3NA 3W86A 4DELA 5CPLA 4UTHA 3W1QA 4LS1A 4NXKA 2H8XA 3W7KA 1RZMA 4KFPA 1AL8A 3BPWA 1DKWA 5KZEA 3VFLA 2GOUA 2J24A 2OX1A 4EF8A 1F7BA 1WA3A 3M5VA 2QUUA 3VI2A 1YDOA 1OFBA 1G4TA 2E5DA 4FX6M 4NJJA 1Q6RA 3TSBA 4CCEA 3NNTA 1D3HA 2PC4A 3QPZA 4UTLA 1QPNA 4RKAA 4O1DA 5CGQA 5LNRA 1P1XA 1I2OA 4N2YA 4XKYB 3UY8A 4CCCA 2CFFA 4AF0A 2NXIA 1C29A 3TC7A 3UZ5A 2A1YA 1E51A 1JRBA 1SW0A 3QJAA 3N9SA 1Q6QA 3RNDA 1OFAA 2HSAA 3B06A 1TV7A 3EKZA 2ZDRA 2EHHA 4UMCA 2WNZA 3QMSA 3B03A 3IVTA 1GVFA 2C19A 3CWNA 4OV9A 4JIQA 2WSQA 5KZDA 3LTSA 1K8XA 3EX4A 2B7NA 4IXHA 5F1VA 3W7GA 4YLWA 3NA8A 4Q32A 1GG1A 3EB2A 4OE7A 4NXSA 4FO4A 4RLIA 4WX2A 1DL3A 4YMZA 3VCRA 3C61A 4NU7A 4QNEA 3DENA 2OJPA 2QEZA 2JKPA 3HO8A 2Y62A 4BF9A 4GXMA 1XUZA 4ZVJA 4LOCA 2E5CA 2EAWA 4UTWA 5K9CA 4DXVA 4GJ1A 4C1LA 2ZZ1A 4RK8A 3QSRA 1JCXA 3HPSA 3G1AA 3W1LA 2G96A 1HL2A 2E5BA 5EA9A 1EP2A 4RX0A 1XBVA 3CM4A 3BG3A 3G18A 1JCMP 1U5JA 1L2UA 5K9XA 2E6DA 5J5DA 4HIBA
chains in the Genus database with same CATH superfamily
3BJFA 1YKWA 3MV01 4BZYA 2J7FA 3P82A 3PB0A 3U7VA 4F0MA 4XBKA 4ZQOA 2GGGA 3S2CA 1D2KA 1AH3A 2EJ1A 1E9IA 1TMHA 4JS3A 3R94A 1DJIA 2R6OA 4PUDA 5DFAA 1UC4A 1PKYA 3LXCA 4HNOA 4PMJA 1VFTA 3TYUA 5JIPA 2EKCA 2HPMA 5KMYA 4HNTA 1KBJA 3S1UA 3E74A 1MUMA 3W83A 5CSYA 5KZ6A 1Q2SA 1QTWA 4D1JA 2V3GA 4NJHA 3FGCB 4HJFA 1UOKA 4EWJA 3CK5A 2WCSA 4P7LA 1S2CA 4PBEA 3UEQA 1TV2A 3WQ4A 3CUJA 1FVPA 1WO2A 1OC6A 4Z08A 3DGRA 1D7KA 3JRKA 4WVXA 3BSMA 2V81A 3WQ8A 3VIHA 4C6KA 3D46A 4NNBA 1TE6A 4N0RA 2E09A 4HYRA 1Z7AA 4WSJA 5G1TA 3YPIA 3TEVA 3WUGA 2QVHA 3M5XA 3W7PA 3WK3A 2R1LA 3QV6A 1OHLA 1KC7A 4W93A 1XYBA 4GACA 3OW1A 2YYUA 3M5YA 2VFHA 2VHLA 2P3ZA 5D2YA 3NURA 4GQ0A 4N6EA 1J10A 4F2BA 3Q37A 4MZYA 5CQ1A 4WK9A 2ZA2A 1TPEA 3M7SA 2WNQA 3RGTA 4V1YA 4QDPA 5AN7A 3SQSA 1NEYA 3VIIA 5DRIA 4ZO6A 3T08A 3PWAA 1HKVA 1E0UA 1WXJA 4E3TA 1GQJA 1IGSA 3LGEA 1P1MA 3SY8A 1V0MA 4PSPA 3LHVA 3VGFA 4LXFA 5BMXA 1S3TC 4BI6A 4GABA 3M0XA 1I0BA 2X09A 2VRKA 4X3ZA 3I65A 5C9UA 3MY9A 3SRDA 4NSBA 2GJLA 2Y6ZA 2YIHA 3ZZ1A 2QUMA 1VF8A 4H2CA 1E15A 2WJDA 1EB3A 1BTCA 3ITXA 2XH2A 3T9PA 3NXLA 3JR2A 1ZCCA 4YHGA 1QUMA 5HQMA 4NYUA 4QQUA 4A29A 1GK8A 5HQLA 3NDOA 1BKHA 1EFZA 4TO8A 3AALA 5H1WA 4AH7A 2CZVA 4ZA0A 4MB1A 3EX6A 1EBHA 2PP3A 3EKLA 2FZMA 3HPXA 4AD5A 3K8MA 2E3ZA 3WLTA 4NRRA 3O6YX 1XPGA 3MVIA 2J66A 2DZAA 4DWSA 3V5OA 3OLIA 2PU1A 2QCEA 1KFCA 1CXFA 2CYGA 5AB3A 3P74A 3OB8A 1X1OA 4JNYA 3T05A 3LQLA 4G1NA 1EGVA 1WOAA 5LGXA 3EYPA 3EXTA 2A3HA 3G8RA 3VZZA 2P88A 2FDSA 1YNYA 2Z27A 3SRFA 3VGBA 4E5TA 2FLIA 2PDGA 5C6MA 3NPUA 6REQB 1XD1A 1X39A 3OO2A 3GHRA 3BJTA 4XAFA 2V0TA 2VENA 4S3BA 3S42A 2ZX5A 3TJLA 1HUVA 3VOJA 1WKYA 2RGLA 5BCAA 1AZ1A 2OYLA 3TYCA 3HG5A 1JXJA 1YADA 4DEFA 1F6PA 3W1XA 2CLKA 3P81A 1US2A 2AOSA 1L6SA 5A6MA 1HJQA 3E3HA 1IT8A 1TELA 5TD4A 4CCDA 4B16A 3VNYA 4ZCWA 3PZ9A 1GVOA 1TE1A 3GG8A 4OKDA 1FWIC 1HNYA 3AI0A 2PDNA 3IV3A 1RR2A 2CLPA 2V5JA 1UB3A 4MADA 4KT2A 5E5CA 1FP9A 3E9AA 4NI3A 3CNYA 5I00A 3FAWA 1JD9A 3G8EA 4PB3A 3VX0A 2HPIA 3GNXA 3KZSA 3AU6A 1AQFA 2F6XA 1EDTA 4UQ9A 1VZWA 1Z44A 1V3HA 2WVVB 3B0UX 1LCOA 1UIOA 5LHEA 2OQLA 3GNDA 1H0GA 3T78A 3VKKA 1BSIA 4RW3A 2YCLB 3DEQA 1TKKA 4AWTA 2OKTA 4JTJA 3M0IA 3EEZA 4IMDA 2GJRA 4HK7A 5CC5A 4CVUA 3DI0A 3C8NA 1B1YA 3S5ZA 3FEQA 3FVMA 4H19A 2CHRA 1GVQA 3IACA 4HGXA 1O7AA 4Q6JA 1XSIA 3PAJA 4L4PA 4LANA 1AW2A 5E93A 4DZ5A 2YB1A 5BOEA 1AQMA 3GHUA 1BG4A 3IGSA 2NT0A 4QJ3B 2CXEA 2OELA 3C2VA 4A22A 3TQ0A 1W5PA 2G4JA 4MDPA 1Q8JA 2G5WA 4PFMA 1THFD 2V63A 2XN0A 2EPKX 4KH2A 4N7QA 1N2VA 2MUCA 1V02E 3PTDA 2YL5A 3AYVA 4GY7A 3V36A 2PDLA 2Z7GA 3KAOA 3EOSA 1A0DA 4JTFA 1KM3A 3DC0A 4ZQCA 4GPNA 4DF2A 1R3WA 5AHEA 2YCEA 5EMLA 1QR7A 2Y63A 3NL5A 3UG8A 3TE9A 5CPTA 2ZBTA 3PPHA 1B9BA 4JTKA 1N8IA 2OEMA 1VPYA 4W9TA 1HVXA 4AZGA 2QLYA 4A21A 4LUSB 3VILA 4DY1A 1YDYA 1UR9A 2PZ0A 4QROA 1XM3A 4UTWC 5TQLA 1GOKA 1XFBA 3FX4A 1PYFA 4L64A 5AYBA 5C9RA 3PSWA 5M3WA 3ZR4A 2W27A 4IIDA 5AFDA 3ZS4A 4JFUA 6PTDA 2VM8A 3W7MA 4AD3A 2XGIA 1KXQA 2NQZA 3VMPA 1LF1A 3WKZA 1KRBC 5HWMA 1OIMA 1KWGA 3MKKA 2XYLA 2W6RA 3IJIA 2FHCA 5J04A 3W7OA 2ZUMA 4ZMGA 3NWRA 1U1UA 4QDMA 5TF0A 5HMEA 1W3IA 3MCNA 1XUUA 1YIXA 1E40A 1YNQA 2QCMA 4OUIA 3BQ6A 3E2QA 4WKAA 2NWSA 3GVQA 3M6DA 2DV0A 2BFGA 1PHQA 4XQ6A 3GFXA 2D3LA 4NVTA 2REQB 1J5TA 4NKCA 2V5DA 1OYAA 1OFOA 4FOKA 1TPC1 5BXTA 1NWUA 3CTTA 2ZUWA 3IRSA 2PP1A 4JYEA 4JQ1A 2YA1A 5MHBA 4HN4A 2Y5EA 4O12A 5G1MA 2C1HA 4PH6A 4O8RA 3NM3A 4U4MA 5ABEA 4DJDD 3QV7A 2CEQA 3BMWA 1QWGA 4J9JA 3W01A 3TLLA 4LB3A 1TV8A 1YTKA 2FB3A 4CCZA 1RBOB 2YJQA 4CEXC 1E56A 3POCA 3ICJA 5FACA 4DO4A 4HK6A 4PMUA 2OKOA 1WZLA 5KINA 3ANYA 1GTHA 4ACYA 3FYOA 1SO4A 3MZNA 3TTYA 1TPWA 7TAAA 1F2JA 2GVJA 4K2SA 4FMVA 3DH7A 5FL1A 1S5WA 1Q45A 3NGFA 3W2KA 3G0XA 1U33A 4S3FA 3WO8A 2ZZ4A 1VFMA 4QR6A 1C8XA 3SGZA 4GI9A 4LT9A 1XYCA 1FWAC 4FLRA 3AXXA 1T7LA 1TIMA 3UU0A 5FESA 4ZFCA 1TPUA 2W91A 2VUNA 2BXVA 2Z00A 1EA9C 1Q4WA 1Q6CA 4D8AA 4A3UA 1V0NA 4B9ZA 3PFMA 4OBSA 2PGRA 2OX4A 3BG9A 4GY1A 2DZPA 3W27A 2H9AB 2QNEA 1JZ6A 1V51A 4A8NA 3WLMA 2B7PA 3KZPA 1XQLA 3TVAA 4DIAA 1J0IA 4FAMA 2VT0A 2WHLA 2V5LA 3CHFA 5AC4A 2VCAA 1AJ2A 1O68A 2I1OA 3A21A 1P7TA 3E49A 2BOEX 5K4ZA 4L5ZA 3PM6A 4G56A 3PZNA 2A0NA 4YCOA 2W92A 1B0IA 3QMTA 5CZTA 4PTMA 1MMFA 4LUTB 1QHZA 1XLDA 2GL5A 5FOOA 2FTWA 2E9BA 3AAMA 1NELA 3TXVA 4UTTC 4AY8A 1BYCA 1PTGA 2OZ0A 5REQA 2TAAA 1E6SM 3W81A 2WMKA 2J88A 4V27A 1PX3A 4JTSA 2PGEA 2QHAA 3W00A 1UJQA 2HK1A 4G9PA 2QAPA 8A3HA 4YNGA 3TIMA 2QT3A 1G01A 3SCOA 4Y96A 2Y5JA 4IMAA 1TQJA 1NOWA 4GQRA 4UTIA 2XIMA 2X0YA 2RAGA 1VBHA 1DWJM 1ZJIA 4KWOA 3UZZA 3MO7A 1B30A 1N8WA 1ISXA 4RZ5A 1KRCC 2XPKA 1EHAA 1QOXA 4WUIA 4GA8A 3TP4A 3I3EA 2BY2A 1FWRA 2OQHA 3OVPA 3FGCA 2XN2A 5JBFA 1MYRA 1NJJA 1LM1A 2JGYA 2VURA 4D6EA 3PUEA 3CQIA 3ZYZA 3CIWA 3OEXA 3ZMRA 1MRQA 4GYFA 2Q71A 3PHAA 1DHPA 3BJSA 3GTXA 4UTUA 2I5GA 3A23A 3LBOA 5AZ0A 4JY8A 1TIWA 2VKZG 2O9OA 2V2HA 3L65A 2ZXBA 4H04A 5F2GA 4WHBA 1V03A 4IQEA 1TPDA 3VE7A 5F4XA 3D6NA 1MQPA 5EMMA 5CBJA 2G3FA 1UR1A 3GVWA 1XGEA 4QLJA 3VD3A 1KFWA 2C1IA 2EPLX 1Z89A 4GXWA 1VC4A 1XIEA 4K7VA 1Y0EA 3ZT5A 1JUEA 3W6LA 4PCNA 1HG3A 3LM3A 3XIMA 4D6JA 4LEFA 4LAUA 4P7RA 4M7SA 1RA5A 2VEPA 4DAIA 3KTSA 1XLFA 3GFYA 4DNMA 2AGTA 1B3VA 2JIEA 5IRPA 4IUOA 4TMCA 1KTNA 4W85A 2X1SA 3KCJA 1DQUA 1J12A 1J6PA 1V0KA 2Y7DA 1PPIA 3CMJA 3EBVA 4TXEA 2ZA1A 4X61A 2GQAA 2NQLA 1FWWA 2HE5A 4R9XA 5DCDA 3UZYA 4CN1A 4XZIA 5GJMA 5DX7A 2QGYA 3TUUA 1LYXA 2NV1A 3NZGA 5FF4A 3WDRA 2F6KA 4E2DA 3TKFA 4QAIA 5ABGA 4EP8C 2PWEA 3GNPA 3UR8A 5CPMA 1V3LA 3RIKA 4A2RA 3LPFA 3I10A 1KQZA 3KOYA 4TV5A 3THUA 3I7SA 3G22A 1E0VA 3EOEA 3M0HA 1XKYA 5LZLA 1JZ7A 2IS7A 3A24A 1Q85A 4M1BA 2P5NA 3BLDA 5GQBA 1P0KA 3MHGA 4OTKA 3W7RA 1TX2A 2VO5A 3S0CA 4LY8A 4WR3A 4GBUA 3J7HA 4F0SA 1A0CA 4O0QA 6REQA 3AFBA 1E5JA 4YN5A 2WK2A 4DUWA 2FPYA 1C7SA 5H6HA 2J6VA 4UR7A 3FIGA 1GPWA 3B40A 2NUWA 2WO5A 1EIXA 2Y0FA 4C65A 3G1SA 3ABZA 2IW0A 2R24A 3SZ8A 7ODCA 1MW1A 9XIMA 3BURA 1CXLA 4BF5A 3BLEA 4NZ5A 3NQVA 4FLQA 1A5OC 3P84A 3N9KA 1HZYA 4R88A 4LF2A 4HU3A 3I3BA 5AKQA 4IMFA 1F07A 3UD6A 3UXKA 1IR1A 2RDXA 3SUSA 2VFIA 1KTCA 3VD5A 3P93A 5BWAA 3AS2A 1TWDA 4C90A 1QPQA 3SUUA 2X41A 1N82A 4Q6XA 3SCTA 3L68A 5AYIA 3NDZA 5HINA 3IJDA 1AK5A 1K9EA 4XV0A 4LCQA 2ACUA 3W75A 3MMTA 3GH4A 4K3ZA 5LA1A 3AXMA 1TWZA 4UTJA 1H1NA 3C0SA 1EYWA 1XKJA 1FH7A 3IJ6A 1X7FA 2Z28A 3S2MA 1BF6A 5EBAA 1LWHA 4P8XA 2F84A 3WUFA 2YCLA 5G4HC 2CCRA 1GONA 3QC0A 1JG9A 3MJYA 3A22A 1OADA 3OVQA 4FZIA 3VNIA 3SCNA 2ZRVA 3CZEA 5AHLA 4QCFA 3H54A 2BY1A 3K4DA 3MUXA 3DYPA 1H63A 3LOTA 3CIVA 1O12A 1ITCA 3AO0A 3KHJA 3AZRA 3VIPA 3HJEA 4IPNB 4AISA 4D6IA 2VQTA 3NPWA 3ZWSA 4AMAA 3W7DA 5CKSA 4EXQA 4IMCA 1KM0A 2QKFA 4Y9MA 4LYPA 4WKHA 4JFVA 4PMVA 4OZOA 1FFQA 3ZSTA 4Z2IA 3NQ6A 5IFPA 1LUCA 1T5AA 4I5UA 1RCXB 5CPQA 2QDDA 3MP4A 1ZTVA 4Q7BA 2Q8XA 4A2SA 3BC9A 3GW3A 2WZMA 2EQDA 3IGUA 3R2GA 2QZRA 3BXWA 4UQDA 1L2QA 1E4LA 2CWNA 4K37A 3W28A 2VD8A 3RR1A 1HJVA 3L5MA 4OBRA 2VEFA 1EJWC 4PUMA 1HJWA 2F6UA 3LRMA 1A4LA 3T2QA 4PUJA 2WJZA 3GE7A 3EA2A 5DRCA 2WVUA 1TUXA 3AJXA 2P8BA 3E5BA 1MEHA 2BG5A 1YPIA 4BEQA 2GGHA 5HATA 2VVNA 3MSYA 3RHGA 5HQEA 1V7YA 4HPHA 2A21A 4D8ZA 1XICA 1R87A 2WCAA 2YL8A 2Q8ZA 3R0DA 4K8EA 1ZHAA 2OZ8A 1ONEA 3W1AA 1GOQA 2W0UA 2PUZA 3CAKA 2VZOA 3MHUA 3DDMA 1V3MA 3L0NA 5GNZA 2PDPA 2EG8A 1FDYA 3KLKA 2CLFA 3HPFA 4L61A 1K6AA 1T99A 2FTPA 3E5PA 4UMBA 4UQAA 1HT6A 2UY4A 3NQDA 3IARA 3FXYA 4GIAA 5FEPA 4R33A 2X0HA 4PUKA 5DMLA 3FNDA 4QJ4B 3KBJA 4KCUA 1V93A 3CAQA 2E68A 5CC3A 1NWTA 4KWSA 3S47A 2CLEA 3M41A 1DJQA 1FTXA 2WB5A 4QG9A 1UWRA 4W8AA 1BGGA 3EKGA 2O9TA 4CU8A 4O16A 1W5MA 2HNHA 3PBUA 3TQVA 4DJEA 3TTQA 3RR4A 2IXVA 2PWFA 1KV8A 1W3TA 3W2UA 2WMJA 1NARA 2O9RA 4FXRA 5G2IA 1N7KA 1WP6A 5I3GA 1LBLA 4H7VA 1Z48A 1LLWA 1VJZA 1OT2A 5CEWA 2QF7A 2PTDA 1YMYA 4M19A 4MYAA 2ISVA 3LX9A 3QZ6A 4NI8A 4UR9A 4RE2A 5I3KA 4AD0A 3BDKA 3WFZA 1AW1A 2V5KA 5HUPA 4WJXA 3GTIA 4ZXLA 1FWGC 1POJA 3GU2A 2UY5A 1RPXA 4WXYA 1EO7A 2VUYA 1DJZA 1W1B1 4EXBA 4MY1A 2DVTA 5E6ZA 4M6QA 3A4AA 3ZR5A 1S2TA 3IIZA 5M1TA 3FDGA 3PBMA 3ATZA 4IJCA 4GIYA 2Q3OA 4GG9A 4FA3A 2CPUA 4B4HA 3W7IA 4ATWA 4HYWA 3V0SA 1RK5A 1CGYA 2D73A 5I07A 1X98A 4IH3A 4PMXA 1AZ2A 5I3JA 3EWZA 3R8GA 1MFUA 4NZ1A 3QTPA 2DJXA 1MEIA 1XSJA 3WF4A 1EYEA 3A5FA 1JULA 2GFTA 3ARYA 3OJGA 2DSUA 2D0GA 2A7NA 3RG6A 1OJXA 3ALFA 5F4SA 5FIPA 4O17A 2R82A 3I7RA 2JBMA 3NL2A 4H9VA 3OG3A 3ELFA 2H9AA 5EFDA 1SO6A 4QCEA 3VZYA 3WMSA 5K7JA 3CB8A 5BXRA 3ABSA 1Q6GA 1LG2A 3G3MA 1K02A 4NAFA 1YBQB 4MTVA 2D2JA 4QDWA 2VCCA 4ZB5A 1TYGA 3DHPA 3MP5A 3AHXA 4C7DA 4IQDA 5H8UA 1ZJBA 2CZFA 4S23A 4HNVA 1QPOA 3KTCA 3OBKA 3USBA 1IT7A 2V6AA 1OY0A 3DBNA 4LW7A 4QG6A 2MNRA 2POTA 2XSXA 3Q65A 2PFHA 2ZWYA 3JZUA 1FH8A 4O50A 4O54A 1BYBA 4MNMA 5DMYA 2VI0A 2ONEA 3R58A 3Q94A 4LUYA 4HP5A 3W02A 3OA3A 5D9NA 4DN1A 5FD0A 9CGTA 4J7RA 4PUNA 1XBZA 3TFCA 3B9OA 4WDXA 2IUZA 3G1RA 1JF6A 1SGJA 2H6RA 1XBYA 1NAL1 5M2FX 3GC5A 5DMNA 1YPFA 3AS1A 4M51A 4EK7A 2FHFA 3QR0A 3ARTA 5I3IA 2CLHA 4L9XA 3L2MA 4TVUA 5I5RA 3UPWA 1A80A 3UVAA 2TODA 2XWDA 1DVJA 1KRMA 1SFLA 5KTLA 3GC2A 1JQVA 4LH8A 5F2MA 4DX3A 1JDDA 1OF6A 4KS0A 3V1PA 3W26A 2YSWA 4JIHA 4GGHA 3BSHA 3MJMA 3BO9A 2XFRA 1W3JA 3AICA 4XBJA 1AW5A 3UXDA 2AKZA 1L0PA 3TN6A 4IJRA 2UV8G 3GWQA 5A6BA 4DYJA 4NAEB 4ZOBA 4CNOA 2EO7A 1MZRA 2Z6IA 2JF6A 2VEMA 3N04A 4IF2A 1DJHA 2HDJA 3AXKA 4GYKA 5HPCA 1FHUA 1TVLA 3LEPA 4MKVA 1Q7QA 2CLOA 4W89A 1B57A 3ZJ7A 1SYTA 1DJWA 4PRTA 2VR5A 1Q2RA 1ADDA 4UTKA 5HA7A 1KFJA 4URIA 3IRDA 2ZRWA 3TYDA 1B9ZA 1K4HA 4FXJA 1PZ2A 4K68A 4IISA 3AIWA 4UUIA 3MYOA 1ALDA 4IT1A 1UPPA 3L4ZA 2VZVA 3T44A 3PNUA 4L1GA 1JL8A 1QCWA 2YDSA 1R85A 4WSHA 3H22A 2HVMA 5CXPA 2J78A 4M81A 4PCPA 1SW7A 1HW6A 5ABFA 3LPGA 3KOXA 2ZRZA 1OX5A 3TNOA 3MTWA 1SM9A 3W7QA 3LCWA 4LVGA 4DO5A 1GW1A 3UCCA 2GJXB 2ALRA 3OIHA 4DBUA 3CZJA 3DHDA 2C7FA 2PCQA 5D4YA 1O1ZA 2ZTKA 2XIJA 3H6OA 1RP8A 1A47A 2WWDA 1VFFA 2Y89A 3L21A 3TROA 1R9ZA 3TAKA 1KXHA 3ZIZA 2DZUA 1LBFA 2VL4A 1VEPA 4FIQA 3CL6A 2UY3A 3EMZA 3TDFA 2G4FA 3AUJA 1NDWA 4I6KA 1KBKA 3W76A 3W73A 1PDYA 3S5YA 3SADA 3QH2A 4IPIA 4N02A 3USZA 3W07A 1NFPA 3EAUA 4UFIA 3LCHA 1R2SA 1SVDA 1RQEA 1E3ZA 4LVDA 1OF8A 3NSMA 3R8HA 1KXTA 1EO5A 3RX2A 1TWWA 1UKTA 2RUSA 2VC7A 4AZ5A 2HE8A 2J7GA 2V2DA 4PGLA 1MDLA 2CWXA 1XLIA 3S2LA 1QNVA 1R3TA 4F9JA 4AFYA 4W4QA 5A8QA 3UVIA 4WDTA 1OGSA 2D2HA 3ORWA 1Q5MA 4DELA 1OG6A 3W1QA 1DIDA 4LS1A 4NXKA 3VKCA 1ZS2A 3W7KA 4ZE4A 1RXOB 1DKWA 1I1WA 4M80A 1UR4A 1XIFA 2OX1A 1LT8A 2BXZA 4QBXA 2BVYA 3M5VA 3VMOA 3VI2A 1JNEA 2Z25A 1V6UA 1OFBA 4KRUA 4FX6M 4MKSA 1Q6RA 3C3UA 3TSBA 4H01A 3NNTA 4F0KA 1RK6A 3MWCA 2PC4A 4UTLA 4V33A 1QPNA 3ME3A 3WLLA 4AX7A 4JIEA 4GIEA 1I2OA 1LL4A 4XKYB 3UY8A 3AIBA 1NY1A 2W5FA 2A1YA 4ZB0A 2P50A 3GNOA 1HL9A 1Q6QA 3AIQA 2J8FA 3N1AA 2DFAA 4H7ZA 3ZR6A 1E4NA 4JIQA 1B3YA 2I56A 1CGTA 4IXHA 5F1VA 3VNZA 2WAGA 4YLWA 1GG1A 3EB2A 4OE7A 4RLIA 4XZLX 1L6FA 4AZ7A 2XFYA 4GZJA 5LIYX 4NU7A 3AU2A 4QNEA 2OJPA 3OU8A 4B3KA 2JKPA 4IFKA 3WH5A 1EZ2A 2W66A 4LOCA 2E5CA 4F48A 4DXVA 4GJ1A 4GVGA 3QSRA 3MB9A 3KCLA 2FVKA 2PWVA 4B5VA 3MO4A 3W1LA 3EOLA 3PBGA 1VBUA 3SFWA 1PIGA 3DFHA 1GUVA 3GO2A 1EP2A 4RX0A 4DM1A 4PRRA 5H8MA 2UWFA 3BMXA 1M03A 3MSGA 2IXUA 1OFEA 3M5ZA 3DFYA 1V08A 4J3WA 1G4SA 2YXXA 3PUOA 3FA5A 1WCGA 5H8PA 3GRIA 1WQ5A 1A53A 1SZGA 4IIFA 5C5YA 3BGJA 2YA2A 2ZQ0A 5CJNA 3F5KA 4FLSA 1O95A 3MQTA 3K2GA 3L67A 4H6QA 4MNKA 3AIVA 1JIBA 5TNVA 1FHLA 3E0LA 3XINA 4XO6A 5FEWA 3PF3A 4UFHA 4XZNX 3THCA 4FALA 1POKA 1XYAA 4L4OA 5CGMA 3SGUA 1SPQA 3TAOA 1US0A 1OCQA 4AY1A 3CC1A 3VUSA 4ADUA 4Q8OA 4AHQA 4EPKA 3BAIA 1VFLA 4LBSA 1QW9A 3T2PA 2DQWA 3DN5A 1K7XA 2B7OA 3W72A 1LT7A 3W3OA 4L80A 1UPMB 3AS0A 4F0HA 3T0AA 3FVDA 2NQ5A 2QCDA 2AAAA 3FHQA 4CD5A 3NDYA 3NZRA 4YS1A 2BOGX 2DZWA 4LCSA 3WNKA 1TJ2A 1ZENA 3M0YA 1ZAJA 3WJZA 4F0LA 4N9EA 1JYNA 2PRHA 3N17A 1UROA 1ESWA 1X7IA 1DXEA 2JF7A 3OQEA 4HZ8A 4D8LA 1E6XM 1JFXA 1U22A 4PBGA 1MNSA 3SUTA 3OBEA 2KAUC 4IMEA 1G6CA 1H7RA 2WJEA 3LSCA 3MUZ1 4LYQA 4U3CA 4DF0A 5HBFA 4HD5A 4MZ1A 1KCLA 1REQB 2ABAA 3LLXA 5D9PA 2INZA 3QMRA 2E8YA 3GIPA 4IPLA 3TH6A 3W82A 4JTRA 4X0VA 1Q3NA 2RJGA 4BA0A 4UFMA 1JI1A 3PY2A 3ITOA 1QI0A 4TX8A 3TSDA 2Y2WA 3QZAA 1PB0A 1QO2A 5KITA 1C90A 4XG1A 2FJUB 4QFUA 1XCWA 4JXCA 5LGZA 1JZ5A 4DYKA 3U5YA 3W25A 1HGWA 1XC4A 2B81A 1SJBA 2BWGA 3PAOA 2ZX8A 4MIMA 1UH4A 1F74A 4CQBA 1TZ7A 4FSAA 2WSYA 1GEHA 4IQLA 1J9YA 2BS9A 3URAA 1ZY9A 3KRSA 5M17A 2HVOA 1XYZA 2EJAA 1YBQA 4EIVA 1A49A 5LA0A 2VDGA 3GX9A 3F4NA 1XRFA 2J77A 4D72A 3O0FA 1ME7A 3W7EA 3HQ1A 3OTRA 4H9ZA 5FI8A 3V1HA 3W1RA 5C2XA 4Z1CA 2P8CA 1XH0A 2Q01A 5GPRA 4XISA 3IJQA 1UWQA 4HA0A 1BVNP 1AH0A 2I57A 3TW7A 6XIMA 1TA3B 4QLLA 1W6TA 3H2NA 5GNXA 1EDQA 4JCMA 4NZ4A 2PC8A 2C79A 3WX7A 3HGSA 4PUEA 1EWDA 3NVTA 1C9WA 2XINA 3KS5A 5CPOA 4IFRA 5IDZA 1KLZA 4GX9A 1JPDX 2X1UA 1XL9A 2WOQA 3IIOA 2C15A 1PCKA 4KEZA 1V6WA 3MWAA 4I3GA 3PZTA 2D0FA 3UWWA 1HN1A 3BCJA 4R53A 3WH9A 5CPNA 4OECA 5EKYA 1OFPA 4B2DD 2WZEA 1M01A 2YCIX 1EC8A 3EB4A 1LTDA 1FWCC 4C60A 3H4GA 3NQ8A 1ZAHA 1UP0A 4DUOA 5SWUA 3L23A 3LCGA 4WJEA 2Y24A 2DW6A 4ENLA 1HFBA 5ECVA 3URBA 4QE1A 2ZADA 3VKDA 4DPQA 2ZUVA 5LKYA 1TWIA 3WLKX 2X8RA 3VM7A 1WKFA 3EA3A 1GEQA 3B9EA 4CVWA 4NAEA 1ZALA 1BAGA 1RH9A 3W1TA 4LAKA 4L6OA 1JPKA 4UNKA 4US5D 1CLVA 3SCUA 1SR9A 3KBVA 5DBUA 3SB0A 4MPKA 2VCBA 1KFLA 5JIWA 2TYSA 1PSCA 3CEUA 3M46A 2HK0A 4EX4A 3U8GA 3DHUA 2IKHA 3ZT7A 4IGHA 4BY3A 2YOCA 1W9XA 2GUUA 4Q4PA 1YE6A 2YBVA 4Q4OA 1K9DA 2CIPA 1XR2A 2EPNA 3DESA 1QNOA 4LAZA 4S2CA 3UYCA 1ZL1A 3QGVA 4N9DA 1YYAA 2WNNA 3CL7A 1KTBA 3KRUA 2QV4A 4PA8A 3F7JA 3IGXA 1CX9A 5AC5A 3CMFA 1VYPX 2J47A 1JGIA 3V7PA 2BLEA 4LEQA 4LU0A 1M6JA 5A6AA 3W38A 4O28A 1A5AA 5DN1A 4FNRA 4DAFA 5I23A 4Q8MA 1KW1A 4Z1BA 2J25A 1JPIA 3ENLA 1X38A 4AZCA 3HPZA 2DZSA 4M7TA 3R6IA 4OIFA 3ARVA 3PZIA 3URQA 2F2HA 3UNDA 3CQ0A 2I14A 1R9YA 4BWLA 3GBDA 3KP1A 5D38A 4LV9A 1BWLA 1R7AA 2QDGA 1BXNA 1OCBA 2DIKA 4F2TA 3THQA 1VRXA 5AC7A 1JDCA 1QW8A 3UWQA 1CEOA 5HDRA 2GVYA 1I2QA 2GWNA 2O55A 3PS7A 1QASA 4Y2WA 4GKTA 4DHGA 4Z1AA 1XRSA 2WWCA 4XBSA 3B8IA 2FGBA 4NQ1A 4E4PA 4Q8PA 3O6DA 1TVPA 1OBAA 3GYEA 3TWBA 3WLRA 1MQRA 1MNZA 1HIZA 4WRHA 4GNKB 1KGWA 1PS9A 3W1NA 3DZ1A 5U7SA 3I3DA 2Z1VA 5H91A 3EMCA 2Y8UA 3CH0A 3G3DA 4J3XA 4IGNA 5L9FA 3UXLA 1TTQA 2KZHA 3WEZA 1GYNA 4IMGA 4JFTA 2UZ9A 3WD3A 4IGMA 4WY0F 4U10A 3R0KA 2ZZ7A 1IE7C 5A2CA 3R25A 4EWND 2DVXA 3R7MA 3PTMA 1WPCA 2JEPA 5FCZA 2FPVA 1GWJA 3AJ7A 4JDBA 3LGDA 2YX0A 5DCBA 1QI2A 1EF3A 1K3UA 5FF7A 1QOQA 5BXSA 4CNPA 2XSBA 3QTGA 1EBGA 2WKJA 4PBFA 2FFIA 4N4QA 2DU2A 4L7ZA 4KWWA 2UBPC 3AOFA 3QGAC 4K6AA 3T0BA 4LYRA 1XLMA 3T0TA 3H4WA 3KL5A 1ODUA 1VHCA 5A6LA 2G3JA 3CV1A 1FWDC 2TMDA 5FJPA 4LWWA 2DUXA 2Q02A 1U5VA 4ERAA 1ONWA 3WQEA 8XIAA 2BY3A 3N2CA 5HANA 1I1XA 3L4YA 4AAJA 1E71M 4XKYA 3TSMA 4JEQA 3RAOA 2ZXAA 1R0MA 1GZGA 1EQPA 1ZCOA 2XIBA 4GUHA 1H51A 1RVKA 1JNDA 4B9YA 3SRKA 4ROPA 1VFHA 1V3JA 4FS9A 2WVSA 3FJ6A 2FHBA 4CN4A 4GC4A 4YPJA 2G41A 3L4VA 5IHRA 1W5OA 3CHDA 4FOUA 3W2NA 4UC5A 1F73A 3VA8A 3VU2A 2VELA 1FDZA 3MMWA 2VYOA 3II1A 1W37A 3P7YA 1BRLB 2WHJA 3E2VA 5CZ0A 4Z2LA 1IWAA 3CASA 2GLKA 3R43A 1AD4A 4GJIA 2GQ3A 3MBDA 3VDCA 5T91A 3M0VA 1UWAA 2V38A 3M9YA 3LI0A 4UFLA 4O0KA 1XLKA 4REQA 3VNKA 1VBGA 3GXTA 3S3GA 1EPXA 4DWSC 2ZICA 3LSBA 3WBAA 3HURA 1QJWA 2HBVA 2H8ZA 4RV3A 3OVRA 1V6TA 5EMUA 2NV2A 2ESCA 2HNEA 1P43A 2V67A 3NL3A 1H49A 1Z9AA 4X0NA 1UW9A 1EGZA 4I7VA 2OYMA 3O6AA 1CGXA 5A6BD 1HVQA 3QR1A 3SURA 3G6MA 3LPOA 4AXKA 3EPNA 3BLIA 3SFKA 5G5IA 2PWHA 3TOPA 1OINA 6ALDA 2A85A 2ZVIA 4RXFA 3GVRA 4PODA 1BVZA 3RCYA 4DJDA 1DXFA 2XFWA 2VGBA 4UXDA 2NZLA 2G3NA 3LZ3A 4HPJA 5CG0A 3T55A 3L4XA 3MHFA 3FCPA 3N18A 4ZOEA 4OHQA 1IXOA 2DUZA 4B5XA 3N6QA 2PDBA 3TN3A 4QIUA 1H7XA 5M03A 3LPPA 4HMDA 2ATMA 1ZGDA 3GZ3A 3NYDA 3MSDA 1EOMA 2EBNA 2DY3A 3TTEA 3O15A 3OLGA 4C6BA 3N4EA 4ZQNA 2ICSA 3NPVA 4AVFA 4TR9A 3UGRA 2YL6A 3S6DA 1I0DA 4XAZA 1TCMA 1Z41A 4NJIA 3UWZA 1E0XA 3W7JA 3QN3A 4AVOA 3ONCA 1Z8AA 3GXIA 4XZ9A 4DO7A 2ZE0A 2Y4SA 3LUTA 4AD2A 1T8XA 3S1VA 5LYRA 4V15A 2BSLA 3N11A 4HCDA 3NIYA 1UA7A 1XYMA 1GJUA 4I9TA 5DT7A 1X96A 3OBAA 2BX7A 3SSJA 3BL3A 1QT1A 3B05A 3G1XA 2DSVA 3CPUA 5F1UA 3TA6A 2WMFA 4XIAA 4E2OA 4TX9A 3M44A 3L0GA 5AVNA 1IZJA 5D04C 5BYWA 8RUCA 4IP5A 1H1YA 2Z26A 4NRSA 2QJNA 3GHSA 4N9BA 1VLWA 1Q4NX 1ZBKA 4QAWA 1OIFA 3BWWA 3T2OA 4H1ZA 4C6FA 1CI1A 3BCFA 5CSUA 4RNFA 1Q6FA 3QXBA 4D6FA 3POHA 1JDFA 1JYVA 3WQOA 4GHRA 3ZVHA 1BSLA 5FJTA 1AFSA 4WKFA 4C6EA 3W29A 2PBGA 3E1F1 2CLIA 3T0CA 2CNCA 2A3CA 4PCTA 3N29A 2GVLA 2Z29A 2DZXA 2XZ7A 4MJ4A 4OOUA 2PRLA 1F6YA 4ZTYA 1BG9A 1D9EA 2XN1A 3EX1A 4TUFA 2ZXQA 4KWVA 3VCNA 3OOQA 1F4HA 2PDFA 5IXEA 4JTAA 4HNUA 4B4FA 4PTWA 3UWVA 3GB6A 4Q8WA 1X8CA 1MQQA 3L5LA 1WDSA 2ZRUA 3KOFA 3VE9A 3LNMA 3CAWA 1TA3A 3WF0A 1B90A 4PMQA 3UWEA 3U4FA 3VIKA 3DC8A 3PR2A 5A5WA 1E73M 1ME8A 1NM9A 2Z2AA 1S5NA 3CHVA 2PTYA 4QISA 2X42A 1EH9A 1RPKA 4PSRA 4MY9A 4OGZA 3RRXA 1LOLA 2XJ7A 4WOZA 1G7UA 3GH5A 4BJHA 2VFEA 4KIRA 3MA8A 3S2NA 4BI5A 5D33A 1GHRA 4IX2A 2JKAA 1XV8A 5HUOA 1H50A 4N4PA 5E0CA 2NVCA 3MI6A 3OQ8A 1KR0A 1D3GA 4DVOA 3CQKA 4OOZA 4LC6A 3R1ZA 2VD9A 5XIMA 1V4YA 4AWSA 3KVKA 3PBYA 3TX9A 1S3HA 2J27A 4NF7A 2OT0A 3R0UA 3KFTA 4ICNA 3COTA 4IZGA 4QJ1A 1VBJA 5I2UA 3UZWA 4AF0B 2GQ9A 4NYYA 3TJXA 1VFSA 3L7RA 2CBVA 1GVRA 3GSMA 4FB7A 2PDUA 4RZ4A 4QQ3A 1P0EA 1YXYA 4C6PA 2YXGA 2R1MA 3FJNA 2WZHA 3W9ZA 4AHOA 1TJRA 5E0FA 3W85A 1NSJA 2GGJA 2HBXA 4Q8TA 1DQWA 1XLBA 5CGTA 3NG3A 1HXJA 4IPJA 1BGAA 4QS6A 4C6NA 4YCPA 5I77A 4BQ3A 3TWAA 4OFCA 2E6YA 2MANA 2ZUTA 3GG7A 3U2EA 3G2GA 3BARA 4TMBA 1DTUA 4NNCA 3VMNA 4H3DA 1ZBCA 3CUXA 3VUPA 1DTNA 3MUY1 2E4TA 5CZJA 6CGTA 3V75A 3ECQA 3N2XA 1WOBA 4JKLA 4KF1A 3WN6A 3ERPA 4CN6A 1I2NA 2TPSA 3UW6A 2QIIA 5F2LA 3CUGA 3WLQA 3SI9A 3GH7A 2VX4A 3KX6A 2YLLA 4AW7A 1M7PA 5FAGA 2FVMA 5E6YA 3MS8A 4EVZA 2QJHA 4U2ZA 1ZQ5A 4UNIA 3EWDA 3OP2A 4KETA 4O0ZA 4C5YA 3C0QA 4DZIA 1V77A 2VC6A 1DIKA 3LRLA 3KRBA 3R12A 2H3DA 2OSXA 3P14A 1W9UA 1VJSA 4MF4A 3STEA 3PUDA 4HA4A 5BU9A 2XZ9A 2CKSA 3BLKA 4WOQA 3PZVA 3VOIA 2E28A 5G4WA 3LK6A 4ERGA 3NSXA 2BGSA 3INPA 2BDQA 1P7TB 3AUOA 5DY3A 4IX0A 5CBIA 2VGFA 4ADTA 2OEJA 3PWGA 4MJ2A 1UG6A 3W1UA 5KEZA 1G94A 3ABXA 3N34A 3APYA 2J9ZA 2Z0IA 3D5HA 3S5OA 3GIQA 2Y85A 5T9BG 3VOCA 4FR6A 1N8FA 4UCFA 3NEHA 3WY1A 5C54A 4MOZA 2IQTA 3G0UA 3SSZA 2G95A 1JYXA 5I03A 3EMQA 3UXAA 1ITUA 3W7CA 4C6QA 7A3HA 2DP3A 3KOZA 3DBPA 3STGA 4ZZ9A 2PE4A 2J7HA 4D71A 2W61A 4MLRA 3PTQA 4RPQA 2Q3RA 4JY9A 4O10A 1E43A 2YZ5A 2YXOA 1WZAA 3SCPA 1VIWA 1OX6A 2TSYA 1X6LA 2HEJA 4LY4A 1H0IA 2QPSA 1PIIA 3EWBX 5CG7A 5I02A 4TQTA 3A3WA 2O9PA 3GNNA 4W8BA 2DUAA 4M5PA 3NO5A 1LQ0A 4NY2A 1CWYA 4JQ3A 3A4WA 1TMQA 1J2BA 4EF9A 2QVNA 1PXGA 1I4NA 4AIOA 3ZSSA 3SBFA 4WD0A 5E09A 3IGHX 4CQDA 4UNLA 1UKSA 3IIPA 2XDFA 4AYSA 1P6WA 1LP6A 2XIOA 3AMCA 3K1DA 1H1ZA 3C0JA 2BHYA 3PZMA 2ZOXA 3LU2A 3QOKA 1W1A1 3IK2A 3QOMA 4N42A 3I7QA 4YVXA 5GVJA 2E9MA 2WSPA 3DFSA 2Z1WA 2D0HA 1W1TA 2Q6ZA 3K13A 1DV7A 4NHVA 3K8LA 1GVEA 4LBRA 3UWYA 4A6GA 1UR0A 3ZJ6A 1DWHM 4DJFA 1FP8A 2HRWA 1OK4A 5LIXX 3KEHA 4LAMA 1UH3A 2IKGA 1FWJC 2Y61A 2XGBA 2NX1A 3T42A 1TPVA 4M8UA 2BTMA 3PPFA 3B8DA 1KBIA 3W7HA 1DXIA 2Z7KA 1BRLA 3NPXA 1AA1B 3WD1A 1PJ9A 4U31A 3QRHA 3SIZA 4FNPA 1WZMA 1QATA 2EGZA 1V6XA 2ISWA 3U9IA 2AL1A 3UR7A 1E6PA 1ADSA 1CZ1A 2QCNA 4Z2HA 2CU0A 1XWYA 1ADOA 5EFFA 4JAWA 5AHNA 3OZPA 5HOSA 2VOMA 1RP9A 2ZUUA 1F5ZA 2HZGA 3THAA 5JMUA 3S4TA 5A8OA 4PYSA 1IQ8A 3KM8A 2BODX 2A3AA 3WL0A 2IQDA 3H21A 1NH6A 2OXNA 4AC1X 5I3DA 1FRBA 2J7BA 2WZIA 3ARQA 4QHRA 4BF7A 2V30A 5JBDA 4ML4A 1OT1A 3KDOA 1R3YA 2JALA 1V6VA 1LZOA 3UF9A 1W2VA 3K1GA 5K4XA 2V2CA 3VDBA 4RE0A 3WENA 1TPH1 3TXZA 2BMBA 1X1NA 1OABA 2YCJA 1K6WA 3IVUA 1FX6A 3WLPA 2GYIA 3DAQA 4PE8A 2V9DA 1CDGA 2QPUA 4OBTA 4PL1A 2I9UA 1G9HA 3T8QA 3QKZA 1XGDA 4RPPA 2VMFA 1U1HA 3WJSA 2ZZ6A 3DFNA 5B7ZA 4AD4A 1V3KA 3KOWA 1VQTA 1JCYA 2AQVA 2C0AA 3U0HA 1PYMA 1WDRA 2OLSA 2NLIA 4HPGA 3W88A 2IKIA 4GH3A 4ICMA 3B8VA 1G4EA 4BK9A 2P1FA 3TFXA 2ALDA 1UA3A 3R4IA 4PTNA 1TSIA 3U2CA 2PF0A 2CHOA 3BW4A 3HMJG 2AL2A 1XISA 1FA2A 5B80A 2I5IA 6A3HA 1FXQA 1JCNA 3T4CA 4NNAA 4RUBA 4QG8A 1RQBA 4E6MA 1IEQA 4HNNA 1W3KA 2POZA 4JQ4A 2ISSA 3AIRA 1TB3A 1YLVA 1S2VA 3WSUA 5LXXA 3GXFA 3VGDA 1KCXA 3A3HA 4IP7A 3H53A 2A3BA 2JQXA 4NL1A 2PZNA 2QXWA 1Q13A 5DBTA 3N4FA 1F3XA 5C9WA 5XIAA 2NQ9A 1KGUA 3QR3A 4P7NA 2VEKA 3CTLA 2J74A 4O1AA 1XX1A 3ARXA 2X7VA 3BGGA 4S3GA 4POCA 3TNBA 3GR4A 3RFAA 2W4XA 1R5YA 4A3YA 1W9PA 2C91A 3FJLA 1QPKA 1B3XA 3CH9A 3BAJA 4Z2JA 5DMMA 2C8NA 4CU6A 2V5CA 1XH2A 4FHAA 4IXXA 4KFOA 1U1JA 1LROA 2BGNE 4YTRA 4LCRA 3WBEA 1LUCB 1XGZA 5ABTA 3DECA 5G2WA 4D6CA 4C6LA 5I24A 4LGXA 3TQKA 4IG2B 4O1BA 2IPFA 5FF2A 3WBXA 2GQ8A 5HNUA 1CB7B 3VNDA 3SRHA 5CCZA 1K8YA 4ADSA 2ISDA 3V16A 2PLJA 2WQDA 1JPMA 1HKMA 2FQIA 1I9CB 1VFOA 1YW1A 4XD3A 2E77A 3WD4A 3PK7A 2X1RA 2EXOA 4S38A 2PB1A 3GM8A 3T09A 4J4KA 1P0DA 5ECUA 1J0ZA 4FLOA 3VZXA 2OZTA 2D2GA 2RFGA 2QUNA 1GJPA 1GCYA 1HJUA 1KQYA 4M6PA 3T7VA 4QE5A 3FJ4A 3AHVA 4NG3A 1E6NA 2PLMA 1E55A 3UZXA 4KEVA 2NUXA 3TQPA 3D0CA 1RY0A 3WNLA 1QMLA 3GNRA 4Y7EA 1UBSA 3GW0A 1A4MA 2RGMA 5CLTA 3C8FA 4JTHA 2QIWA 3NQEA 4B92A 2Z6JA 5I09A 1E1FA 2F2KA 1W3NA 5FJRA 1E6ZA 2ZC8A 4AXNA 2H8XA 1RZMA 1AL8A 4DJEC 5T9CE 1CXIA 4GQBA 2VGIA 4XVEA 3VDAA 1S2WA 3GXMA 3VFLA 4EF8A 2Z1XA 3FXGA 4IM4A 4P8UA 1WA3A 2QUUA 4QEHA 2D20A 4KIEA 4LF1A 1RY8A 4K8GA 4NJJA 3H2EA 1V7AA 1D3HA 4YWSA 4RKAA 4IP4A 2XVKA 4KMQA 3AMGA 1EJRC 1UBPC 5LNRA 4AF0A 2NXIA 4P8VA 3GC4A 2VX5A 3UZ5A 1R3RA 4NIRA 1TWSA 3RNDA 3VKBA 2CHNA 3ID7A 3EKZA 5GJPA 2VRQA 3B8UA 1EZWA 1TG7A 5D8WA 2OGJA 2C1GA 2C19A 5DO8A 4U33A 1Q6EA 4HN8A 4F8XA 4V28A 3FW6A 5KZDA 1GNXA 3LTSA 4O8AA 1K8XA 3LZ5A 2I7GA 3MUIA 3WMBA 3RO6A 4JQAA 3W7GA 1EL3A 4Q32A 3MCOA 4WX2A 4NXSA 1TMLA 2G0WA 1DL3A 3KE0A 2GK1A 3C61A 3QGKC 3DENA 2XH7A 1KGXA 4OUEA 3HO8A 2Y62A 4BF9A 5D8ZA 4GXMA 1B54A 4IFOA 3MSRA 3TYZA 1CCWB 4C1LA 4RK8A 2CESA 4C7GA 4PTXA 1UZDA 1KNWA 2E5BA 1VBRA 4LAOA 3RO8A 1XBVA 3CM4A 4TX6A 1UOZA 3BG3A 4ZSTA 1JCMP 1A3HA 2YBUA 3SGGA 3LNPA 1ZRQA 4PMNA 1R3QA 2GDVA 1JAKA 4YHEA 3H70A 4P8WA 3LXAA 4WIWA 3SQMA 1EX5A 5BXPA 4NJGA 5I78A 2INEA 1WBJA 2YGYA 1LLOA 3DG3A 3WLIA 2XSAA 3HF3A 1EIBA 3C2EA 4FIRA 5LA2A 4XD5A 3U2ZA 1QAPA 4Y8FA 1JVNA 4KWUA 4JPGA 1RSCA 1QNPA 1Z69A 4ORMA 3MBFA 7XIMA 5JBEA 3LA4A 4RJEA 4JTLA 3CV7A 5AHMA 3C56A 2R91A 4NAFB 3TTOA 1PAMA 4FF7A 1HP5A 4RXGA 1QK2A 3QC3A 3WUEA 1MW0A 4QM1A 2GUBA 4DZHA 1H11A 3GIYA 2F7FA 4Q4SA 4NX5A 1UH2A 2ZCGA 1JJKA 2JEQA 1O4UA 1PCWA 4IIHA 1V3IA 1WX0A 3CXOA 3M07A 1F3WA 4OV4A 5LNSA 4Z1DA 4I9JA 3W22A 3N6HA 3AYTA 1QNQA 2RKXA 5A3HA 2Y7FA 3H7UA 2FPTA 4JX6A 4MYXA 5CZKA 3KUMA 3QLDA 3FKKA 4G6CA 2DH2A 3WK0A 2PEVA 4FI4A 4S3KA 4RDZA 4RNIA 3VOHA 4JTUA 2F9RA 1JZ3A 5EYWA 4EPEC 2O56A 3AYSA 4GK8A 1GTEA 4FNTA 3V0UA 3NM1A 3WH8A 1YTDA 2Y70A 1VYSX 3ES8A 1CLXA 1RA0A 1QI3A 3C2FA 2H90A 3URNA 2GVEA 1FWHC 4P5UA 3U48A 2PD9A 1YXCA 4ORIA 3RLVA 1OZMA 1LQAA 1G67A 1OEPA 4W87A 1ONRA 3NZQA 2YPIA 5LIWX 3RPTA 4XUGA 1XDJA 4BKNA 4QTGA 1YE4A 3QPYA 1KFBA 3AMLA 4KEMA 4UCGA 4OT7A 5C2GA 2AQWA 1GQIA 3FOKA 4LALA 2OT1A 1H7OA 3O06A 1S39A 1UHVA 1OX4B 2PA6A 4XTDA 3VINA 4GQQA 1OYBA 4MB5A 4A8IA 1UR2A 3GFZA 3K5XA 3R8RA 3PP7A 1JF5A 3C2OA 4O4VA 3BUVA 4LS0A 1RVGA 4UTMA 4F4RA 1DHKA 3TK7A 3UR2A 2YB4A 4CLMA 3UJSA 1DJXA 1VLIA 1TV5A 1VPQA 2IQ0A 4NZ3A 5H2ZA 1EJSC 2OLHA 1JZ8A 2PSNA 4M24A 4I9AA 1ZBVA 2ZUNA 3B8WA 5D2TA 3QY7A 2O0TA 4M1RA 4RE3A 5LSMA 3QY8A 3PJUA 1S1RA 5E1QA 1TRDA 4NILA 2YKKA 3MMDA 3U6WA 2W9MA 1QNSA 4J2PA 1OD8A 1CTNA 2BBFA 6ENLA 1IIGA 3FSTA 1XQKA 3NL6A 3QLLA 1L8PA 1PDZA 5C9ZA 4PMDA 3TOYA 3P8IA 3WQFA 1EGMA 3UGVA 3SCQA 3BW3A 1CYGA 3BAWA 1FOBA 1XRTA 2PWUA 3WQWA 1TZ9A 3BZGA 3P61A 5XINA 3RM9A 1PX4A 4K36A 1LRQA 3QYSA 1W5QA 4E2VA 5ABFB 1W31A 1B2YA 2E25A 3WLHA 1M5WA 2ZDSA 3TZFA 2HXUA 3EPMA 4UQCA 3STPA 3KVLA 3A13A 2BHUA 3W84A 2ASHA 4JTIA 5AC6A 5LNWA 4LC8A 3H2CA 5FJUA 2R14A 1M68A 4R7JA 3NQ7A 2GDQA 2D3NA 5D37A 1CB2A 2QCFA 3UETA 4C6MA 1ZAIA 3ZT6A 3MDWA 4HMEA 2ZX9A 3LHZA 4OU1A 3CO8A 1PIFA 4H9XA 4A8RA 4L9YA 5JUVA 4PRWA 5LIKX 1OWQA 5D05A 5CAKA 1AH4A 5A6TC 1EXBA 2HJPA 3SCRA 3N25A 3P6LA 4J5NA 3WJXA 1E1CB 1NIUA 1ZPTA 1X97A 3EOUA 2ZZ2A 2DSWA 2ZXDA 3AHZA 4PC8A 3GQYA 3STCA 2QYGA 4TVDA 2ISFA 2XUCA 4EE9A 5E0KA 4AC7C 1UD6A 3EDJA 3WBYA 3TCSA 2OVLA 3MV11 4Z2KA 2PDCA 3VIOA 3AWNA 2VGGA 3CQHA 3RF9A 4I6VA 4B5WA 3L2IA 1IHIA 1NP2A 4BFAA 5D03A 3MCMA 1EX1A 2CXGA 4JD4A 4Y8EA 5LIUX 1UUQA 1XC6A 1VAHA 1ISWA 1TX0A 4FX8A 1U2YA 3VTRA 1RHCA 1US3A 4G5DA 4FOJA 1JDAA 4AY7A 1TFVA 4IIEA 4NT0A 1MW2A 5RUBA 4H4IA 2CITA 3F4VA 4E8CA 1PTDA 2QMKA 3RUBL 2PTXA 3OPSA 1E6QM 3IJ8A 3RM8A 3BZJA 3C86A 2DZVA 2R1PA 4E0CA 1EWEA 2B4GA 4C1NA 1F61A 4GOAA 1VP5A 4MFEA 4H9YA 3ZWTA 2X2YA 5BOFA 3RPMA 3VC6A 5LXEA 3MMUA 1IT0A 2QCLA 3CV2A 1BLIA 3I6EA 5EMJA 4WGHA 1NP0A 3LMZA 1W8GA 1UUMA 1BPLB 3AYRA 5DY2A 5CLWA 1EF2A 5FJIA 2PGFA 3LD5A 4B91A 3REQB 1D8WA 1WAUA 4HTBA 5IBXA 3AISA 4D6GA 4J3VA 1IZCA 4C7FA 4PCSA 5D09A 1O60A 2I5QA 1WNOA 4Y9NA 3VGEA 2WM0A 4GUFA 4IG2A 1H5YA 1MW3A 4B2DA 3QVQA 4IFKB 4NZCA 4GI4A 4BCEA 4R34A 2VWTA 3H2AA 3TC6A 3HQNA 1CXEA 1DQXA 4TTGA 3QFWA 2DH3A 3O63A 1UP2A 1OB0A 3VOGA 3IIXA 4RL3A 4ASTA 1XG4A 3C5QA 3GXPA 2WC3A 3B8SA 2YZRA 1P5BA 3WK2A 2WC7A 2BVWA 4JTDA 2QS8A 3M0KA 4UB9A 1BYDA 2B7QA 4UBPC 5G1YA 3P8JA 3PPCA 4E38A 1YPXA 4US5A 3NTYA 5F4WA 2ZE3A 3QW4B 4I7UA 1XFCA 3U4AA 2GJPA 3K30A 3TMLA 3AWOA 2OG9A 3K46A 1DJGA 2ZIDA 2GPTA 1W3LA 3AC0A 2IPJA 4DJFD 2I9EA 3HGOA 2CZ5A 3BE7A 3W53A 2V3EA 2XH0A 4OQVA 5A2AA 1HKWA 4L6DA 3IVSA 2Z1KA 5FAJA 3PJXA 3DUGA 2OGYA 2PI6A 4CQ9A 4GFIA 1YRRA 3ARSA 4O18A 1UP3A 4HPXA 3IUIA 2QAFA 2PDWA 5LNVA 3DG6A 1GVSA 1SZRA 1UKPA 3TW9A 1D8CA 4NASA 4C6CA 4GKLA 3R79A 1ISYA 2QCDB 3VC5A 1BWVA 1VENA 1IYXA 1HJXA 3F2DA 2B31A 2FZ9A 2X40A 3DKJA 1FWBC 1Z32X 4Q33A 1UWTA 2GSEA 4W88A 5AOUA 2ODOA 3B9NA 3EDDA 3A12A 3GU9A 5I6SA 1B4KA 2E1WA 4Q4RA 3S83A 2VOTA 2J8TA 1XLGA 4AQLA 3WEOA 2DZTA 1RCOB 1S2AA 1EKOA 5CC6A 4KRTA 1UQYA 3SCVA 4GVHA 4M6UA 3H4XA 5FA5A 1NQ6A 3LI1A 4HJWA 4JL1A 2OODA 1W1IE 5JXQA 1XS2A 1NDYA 1V79A 1LL6A 2A3LA 5JQ9A 3WQDA 2OOFA 4QITA 1R2TA 1JPHA 4HSOA 1FFRA 1AQHA 4HNLA 5EL1A 4HCLA 5EU9A 1ZP4A 4M56A 3IS4A 1JQXA 1ISVA 4HHPA 4B90A 3PG8A 1ZB5A 2WCGA 2OSWA 2D2OA 5AYYA 4U5IA 4C6IA 1GOWA 1J8VA 1CGVA 3H24A 5JVLA 1VH7A 1EPVA 1KLYA 2VJXA 3BK0A 4QSHA 1YX1A 4KBXA 3SN1A 1HP4A 1IEWA 1V8EA 2PTWA 3CWHA 3GDMA 3QHMA 4W5ZA 2NLYA 1A50A 4H6RA 2XH4A 1FH9A 3BLFA 1VFUA 1X6NA 1XDMA 1GQKA 2O7QA 1J2WA 3CWOX 3ATYA 1W17A 3E12A 1GKQA 3PJTA 4S2BA 4Q3MA 2BV9A 4GZ7A 3LTYA 4R3UA 1WKEA 4JL2A 1SSDA 1UD3A 2W62A 3S8HA 4XTIA 3DFPA 2D1ZA 1KB3A 3IANA 3A47A 3B0YA 3V18A 3WF1A 4KKXA 1GOOA 3M47A 1F3TA 4RZBA 1SW3A 3N3MA 1H60A 4JNMA 2QCGA 2WKGA 4GGBA 3MANA 1C3FA 1FCUA 1GKRA 2PAJA 3RX4A 1EQCA 2NWRA 3B3DA 3W7NA 1YDNA 3S6OA 3TYAA 4IIBA 2R9RA 3A64A 1W5NA 2PD5A 1P6CA 1WXYA 3WQGA 1OQFA 1PKNA 3GUGA 4I8DA 4PULA 1LOQA 3O16A 4L65A 3G1HA 5K2ZA 2RJHA 4H9MA 1ELSA 4M3PA 3PZQA 3RCMA 1XLEA 3LBCA 6TIMA 1A5UA 1UD8A 3MPGA 2GOKA 4S1FA 1D3CA 2QPXA 1FKWA 5IM51 3LG3A 5DF0A 4GCAA 2ADAA 3NUKA 2WANA 5AECA 1FWTA 1ZFJA 3IAPA 1DE6A 3EX2A 3LB0A 1DE5A 4JCLA