2HISA

Cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNAAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSNLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into transition state stabilization of the beta-1,4-glycosidase Cex by covalent intermediate accumulation in active site mutants.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords CELLULOMONAS FIMI FAMILY 10 BETA-1,4-GLYCANASE
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hisA00
1UYQA 3VIPA 3ZJKA 3VM7A 3MMWA 4UFIA 2X0YA 1E6PA 2UY4A 3UG4A 3WD3A 4QCEA 4KWUA 3WD4A 4D6DA 1XSIA 3W53A 4P7OA 4J3TA 4D71A 3A47A 2JALA 1VFOA 1CEOA 1J0IA 2E9BA 4ZE4A 3CHFA 3U5UA 4J3VA 2CYGA 1MQQA 2WMIB 4C7FA 1ZBKA 2XSBA 4P8VA 5A69A 1ODUA 5CJ5A 1JD9A 2QMKA 5LA0A 4AZIA 4LYRA 2A3HA 1J01A 2WNWA 3VIHA 2V38A 2DH2A 4W93A 4W7VA 4GKLA 1E5NA 3TA9A 3EBVA 2G41A 4JL1A 4RE4A 2A3AA 4ZXOA 2OSXA 4X9YA 1ZL1A 3VINA 3AZRA 3WQ4A 1R87A 4HMEA 1E5JA 1FHDA 1UKTA 1M01A 1EGZA 1DWAM 4PEEA 2RGMA 2XUCA 1UR1A 4YPJA 1GOKA 4WSJA 1ITCA 1UH4A 1W2PA 3WDHA 1MXGA 3UCQA 4HZ6A 4V28A 3PZOA 1WCGA 1ZB5A 2ZIDA 4R5EA 3ARZA 1GQIA 5JIWA 2YJQA 2WAGA 1EQCA 4GQQA 1BF2A 3TTQA 2QF8A 1OT2A 5LA2A 4CN4A 2CKSA 5CQ1A 3LPFA 1HX0A 3UERA 1TA3B 3ARYA 1WPCA 2ZICA 3VMOA 2UY5A 2ZXQA 3RJXA 3L4VA 2W66A 4TVUA 1QPKA 3VGHA 2VJXA 1UR9A 4CCCA 3BC9A 4UQBA 5A8OA 1I75A 1V0NA 2GJPA 5CGMA 3W6MA 2YKKA 5E9AA 4AIEA 2WSPA 4FLRA 1V0MA 1BG9A 4BQ3A 1AMYA 5LYRA 4NSBA 1CXIA 1Q6CA 2WHJA 4OIFA 3EMQA 3VX0A 5BXSA 4WJXA 4CD6A 3L4TA 3FW6A 1KFWA 1TUXA 2WKGA 3GTNA 4W88A 5E09A 4QLKA 2W4XA 1KXVA 1GVYA 2J78A 4PMXA 1JXKA 1OGSA 3LPPA 4BS0A 3WMCA 4HU0A 1XCXA 3CZKA 4QLJA 1X6NA 5IDIA 1NM9A 3KZSA 2D3NA 3D5HA 2XIBA 3BXWA 1W9DM 3IK2A 4IISA 2WWDA 4AD4A 2O9RA 1BPLB 1JIBA 5M5DA 3SEPA 4A4AA 3VMNA 4H2CA 4BQ4A 1UUQA 1DWJM 4EAMA 1NWUA 4M24A 1H09A 2WCSA 2DT0A 1EO5A 3WNKA 5C71A 2YA2A 1NOUA 4AZCA 2WCGA 6TAAA 4LXFA 5A94A 2PWGA 1CENA 3CBWA 1PIFA 4ML4A 1VJSA 3EDDA 1XGZA 1HL8A 3WDQA 4PUEA 3VIGA 4H41A 2CERA 1BLIA 3MKKA 2XVGA 2ZUSA 3CZJA 3ZMRA 3WL1A 1K9EA 1UR8A 5A6BD 4CVUA 1MWOA 4PN2A 3O2LA 1RD6A 2GUYA 1V3LA 5FL0A 2E9MA 4MDOA 3UR8A 3T08A 3WD1A 1WE5A 5D8WA 3I3EA 5GNYA 2DIJA 1EIBA 1BGGA 3W38A 4GO8A 2WCAA 1ESWA 2DEPA 3DC0A 1EDTA 5I78A 4F9JA 2OLHA 1KGWA 1EOKA 1QNOA 1QNRA 2J25A 3ZJ8A 2VC9A 1UD6A 4FMVA 4CD4A 1JZ5A 2G4FA 4F66A 1G01A 1CIUA 5BRQA 4UTFA 1GPFA 4DWSB 1W1YA 4LQ1A 5I6SA 3S2CA 1M53A 4AMCA 4JIEA 4TX6A 2QPSA 4LYPA 3HMCA 2V5CA 2D3LA 1QHOA 3AYSA 6CGTA 3POHA 2CHOA 2Y8KA 1KXTA 3DYMA 1H4PA 4W8LA 1W9UA 2WWCA 2D0GA 5HPCA 1I1WA 1K9TA 1WDPA 2DT1A 2PWDA 1W9XA 2YL6A 1GW1A 1W1PA 3SCTA 1VJZA 3AHTA 3CPUA 2PWHA 3LPGA 1Q6GA 1TVPA 1J0ZA 4AD1A 3RO8A 4YHGA 1QBBA 2BS9A 3W0KA 1JNEA 3OLEA 3J7HA 2QHAA 1E73M 3AHYA 2GK1A 1V3MA 1AQMA 1VFFA 3PN8A 3BAXA 5M03A 2VR5A 4PBGA 3RDKA 3CUGA 2BVDA 4W8AA 3NJ3A 2VRKA 3WH9A 1LL6A 2WXDM 1BYAA 1BHGA 1UR2A 2AOSA 4UQAA 3WN6A 2PF0A 4QCFA 1J0KA 2XHYA 2J4GA 1ISWA 5JBFA 5ABFB 1ISVA 2YDSA 3T2OA 4BA0A 3CIVA 3ZT7A 5CLWA 3MV01 1M7XA 1X1NA 4NI3A 4OZOA 3WNMA 3AROA 1CDGA 2ZUVA 2O9OA 3FXYA 2WHLA 2ZX9A 2NT1A 2EO7A 3MUIA 2VMFA 1ODZA 2W61A 1GQKA 2ZX7A 2BHUA 1C8YA 1BYBA 4L4OA 1PZ3A 1OIFA 2OYKA 2D22A 2TAAA 3BSHA 1UWUA 1AQ0A 1DTUA 3T0DA 1W32A 3WDIA 1VAHA 2ESCA 4JHZA 1QW8A 2ZWYA 3N15A 3L4XA 1HJXA 1EXPA 3WH6A 1UR0A 1OD8A 1U33A 3NSMA 1L0PA 5HBFA 3ARVA 5I3DA 2DSWA 2BNJA 4NRSA 1US3A 1MW3A 2EXOA 3CGTA 2BY0A 3AS3A 5JUVA 2ZX5A 2Y24A 2YIHA 1V02A 4J28A 1GCYA 3BAYA 3WF3A 4J27A 3OBAA 1CPUA 3AIRA 1H11A 3BMVA 1XYZA 3AMKA 3HU7A 1J0JA 2WVTA 3W24A 7TAAA 3VNYA 4P7QA 5I0DA 4P8WA 3PZNA 3GXMA 3UEQA 2Y5EA 1CBGA 2VX5A 3RCNA 3GH5A 1KB3A 1SMDA 1RPKA 3AXIA 1Z32X 5IHSA 1V3HA 4JHOA 3WF1A 3ARSA 2G3MA 1GQLA 4PMUA 1HIZA 1J18A 3WY1A 3W37A 4UCFA 1VFMA 3MU7A 1LWJA 3L4UA 1D2KA 5KEZA 1BTCA 5KZ6A 4W85A 1UWTA 1AVAA 3BCFA 3SCQA 1HKIA 4UQDA 2WANA 2XVPA 1MW1A 2J7HA 1KWGA 4GO9A 1NOFA 4X0NA 1E6NA 3B9AA 3NUKA 3VUPA 3WFZA 4CN1A 4Z2JA 3K8KA 1BYCA 3BAWA 1PAMA 2QMJA 2EPOA 4E8CA 2O92A 4F8XA 2Y8VA 3B9EA 2A3BA 1F4HA 4W86A 1BVNP 1GVIA 1WZKA 4B3LA 1KGXA 2BVYA 2DT2A 1BVZA 5I2UA 4JAWA 3SUWA 3ZSSA 1JYXA 3PZUA 3N04A 3ZJ7A 2V3GA 2VTFA 3WNOA 5JIPA 4Z2GA 1OBAA 1KQZA 1SMAA 3WDPP 2Y2WA 3OZOA 2VCAA 2VZVA 4PTMA 2EJ1A 1QI0A 1QNQA 5AY7A 5BXRA 1NOWA 2ZXDA 4CD5A 1XD0A 3ALGA 4UOZA 1VEMA 3THCA 3DHPA 1Q6DA 2W5FA 1HP4A 2D0FA 1JYNA 8CGTA 1XH2A 5HOSA 1FOBA 1V0LA 3APGA 1E1EA 3AXHA 1E0XA 1GOWA 2VCCA 3WL0A 1UQYA 1PZ2A 1G9HA 2XGIA 4GI8A 4MNJA 1UA3A 4J3XA 5BROA 1PIGA 1XSJA 2WHKA 4GXPA 5ECUA 3ARUA 2D24A 3ZO9A 5A2AA 2XVLA 4NRRA 4LYQA 4AC1X 1E15A 1E4MM 1OCQA 4OOZA 2BY1A 3BCDA 1YHTA 4W7WA 3W81A 1H0GA 3VNZA 2DIEA 1VEPA 3W6LA 1XYFA 1UOKA 2G3NA 1E9LA 4CU8A 2YOCA 1V0KA 4J7RA 3KE0A 4M1RA 2W62A 2CITA 3OGRA 3GDBA 3VIMA 2WVVA 4WLCA 3NDYA 5A6MA 1HJVA 5D9OA 2VOTA 3CHDA 2ZOXA 3K4AA 4HPGA 3SUSA 1EA9C 4Z2IA 5EB8A 2RGLA 2W92A 1R7OA 5FOOA 1E72M 1CYGA 3VIKA 3RMEA 2YA0A 1W9BM 3AIBA 3ZT6A 4MB1A 2X09A 1VBRA 3WD2A 2CBIA 5GQBA 4AY1A 2G3IA 5FCZA 4D6EA 2WLZA 1CGVA 4OBRA 4PSRA 4LX4A 3FAXA 4RL3A 3VDBA 1V03A 1QI4A 1W3HA 3MV11 4UR9A 2ZXAA 1BQCA 3MSDA 1V6XA 2FGLA 4ACYA 1SR0A 3HJEA 2V3DA 1IT0A 1E3XA 1E4LA 5A8PA 2GJRA 1NWTA 2Q8XA 2D0HA 3SCVA 5CPQA 4AD5A 3PZQA 4PRWA 3AI0A 5ABFA 4AWEA 5HXMA 2VR4A 3W29A 1RH9A 2X05A 4M82A 3OLDA 4HZ7A 4N42A 1TE1A 1B3ZA 2JEQA 3POCA 4XUYA 4HMDA 1C8QA 1BGAA 1TG7A 4GIAA 2X1IA 4JCMA 1VEOA 3GBDA 3N1AA 1CXLA 1B3VA 1E6SM 5A8MA 1JF6A 5GNZA 3TTOA 3PTMA 2GK1B 2WBKA 3SURA 2C0HA 1UD3A 3VMPA 2X0HA 3KL3A 3VD9A 2GFTA 2EBNA 3A4AA 4FLSA 4X0VA 4AW7A 1HVQA 2WMJA 2DT3A 1NQ6A 3OIHA 5HDRA 1X6LA 3MO4A 3L4ZA 4D1IA 2DSZA 3CZLA 1HP5A 2DSKA 3VGDA 1HL9A 3PZGA 2ZWZA 3WFLA 5D8ZA 1JFXA 1MW2A 4XZWA 1WZAA 1JI1A 1NH6A 1FFQA 2VNCA 2E0PA 3WIJA 1JXJA 3L2LA 2WSKA 1GOIA 3ZR5A 1GONA 5E6YA 2VL4A 4EKJA 4AZ7A 2WW5A 4CVWA 3ZM8A 1UZ4A 3SIMA 1WO2A 2VX6A 5A6KA 2XG9A 1CTNA 4AXNA 5I5RA 1G1YA 2XWEA 2Z1KA 3WDJA 1IZKA 3DHUA 2CHNA 2EQDA 4UFMA 3ZSTA 1V6VA 4KRTA 1H3GA 3DECA 4PMOA 2EPNA 4F9DA 1UKPA 2D23A 3K46A 4UQ9A 1KQYA 2WZHA 4Z2HA 5ABEA 3U7VA 3QHOA 3SCPA 4NZCA 5CXPA 4MNMA 3MMUA 2CBVA 2J7GA 3OLGA 4PMYA 3IJ9A 2XPKA 4S3JA 2CCRA 1Y7VA 4J3SA 4DWSC 4E8DA 4B9ZA 3K4DA 2WC3A 1WNOA 1N82A 1XD1A 4ATWA 3ARQA 4YN5A 5DFAA 1UHVA 1JZ7A 3M7SA 1EHAA 1J0YA 1LG1A 4S3KA 3MUAA 3AHVA 1CZ1A 3W82A 5CZKA 2WC4A 3WBAA 3TONA 3N13A 2WZIA 3VOCA 5I24A 4U33A 3AZTA 3VPLA 3B8SA 4BZYA 3I3BA 4PSPA 1H1NA 3GBEA 1UD8A 5HNNA 3OLIA 2NSXA 3CZ8A 4HZ8A 1JL8A 1UQZA 2WMFA 2ZXBA 5DT7A 1LF1A 1E1FA 3VDAA 1UWQA 1J0HA 1NWRA 1BYDA 1H41A 1UZ1A 3WEMA 1V3KA 4QDMA 1CGTA 1QHPA 3TTYA 2A3CA 4WK9A 4DWSD 2V5DA 2VZUA 3OB8A 2VURA 4KH2A 3BAIA 1P6WA 5DMYA 1JAEA 3CHCA 3K8LA 1B0IA 2GVYA 5LA1A 4WKHA 2YBTA 3HN3A 4QFUA 5C8BB 1OGGA 1XSKA 5FIPA 3FAWA 3AFBA 1GJUA 2E40A 3SCNA 3ARRA 2CPUA 1UWRA 4BF7A 1TVNA 4B16A 2BY3A 1EDGA 5CPTA 4OJYA 4AIUA 4PMDA 4PMZA 2B31A 1OIMA 1B30A 3B9DA 3II1A 4C7GA 5EMYA 1WZLA 4V27A 2CBJA 3M07A 4JFUA 1HF6A 1K9FA 4QLLA 2WVVB 3D3AA 1V08A 4MAVA 2J47A 2PWEA 2OSWA 5A6LA 3QOMA 4PTVA 2BHZA 2WVUA 4E4PA 2VO5A 1NARA 4UQCA 4BQ2A 3BSGA 4TXEA 2PI6A 2DGAA 4HU8A 1E6XM 3CO4A 5CSYA 2BFGA 2WM0A 4WF7A 1HJSA 4HOXA 3G6MA 3GM8A 1OM0A 5IHRA 5EBAA 1C91A 4UNIA 4IPNB 2BHYA 1ZBCA 3W28A 1UH3A 2J7CA 1UWIA 4HA3A 9CGTA 5DF0A 4URIA 3EDKA 4JFTA 4WKAA 2J74A 2E8ZA 4HTYA 4PTXA 4HP5A 2BY2A 3NYDA 3OG2A 4W84A 4J3UA 3N11A 5A3HA 3A4WA 4DM1A 2FH6A 4TTGA 4AZBA 4IUGA 4TVCA 3OGSA 4ATLA 2DDXA 1JDDA 5D9MA 3UG3A 1S46A 3EDJA 3IAQA 2QPUA 3F5LA 4Q7NA 1KR1A 1B90A 3K8MA 1TA3A 1KR0A 5E0FA 3FY1A 3MMDA 3WEZA 3G6LA 1A47A 1ZBVA 4ZFMA 1TFVA 2FHCA 1MYRA 1CWYA 4HA1A 5BXPA 2DSUA 2AMGA 4FF5A 1QI2A 1MQPA 3ZQ9A 8A3HA 1HJQA 1B1YA 5AYIA 3ECQA 4TX8A 1QNSA 2PC8A 2HISA 2XJ7A 3AMDA 1B3WA 1HKMA 3SUVA 2YDQA 1UR4A 3W25A 3BGAA 4ACZA 4B3KA 2VQTA 3VD7A 3QHMA 3AJ7A 2G3JA 1VBUA 1DWGM 1UH2A 1JYWA 4HMCA 1W9VA 1PX4A 2ZX6A 4OUEA 3W26A 4AEEA 4H8UA 3AHXA 4AZCB 4D72A 4ACZB 3AS2A 1ZJAA 2CIPA 1W3KA 4CD8A 1H5VA 4M29A 1IZJA 1Q6FA 2YA1A 1JDAA 1RP9A 1JD7A 2FDMA 3QOKA 1XCWA 4CU7A 3LMYA 3VDHA 2VZSA 5A8NA 5FL1A 2VZOA 3OZPA 1PEZA 1VENA 5E70A 1JGIA 1UD4A 3GH4A 2GDVA 3VTRA 1JZ4A 1J9YA 3FHAA 3THDA 2WK2A 4CCEA 2PBOA 2C8NA 3QHNA 2W67A 4UOJA 2V3FA 5TD4A 5CSUA 1E4IA 3PHAA 3CUIA 2BXYA 2EPMX 1E55A 4HA4A 2CBUA 1OGBA 1B3YA 5BWFA 1WDSA 3RM4A 1HT6A 3ARXA 1XC6A 3M6DA 2XFYA 2VT0A 3MUZ1 1EDQA 3VIOA 2IXVA 3WUGA 4GZEA 2WMGA 5I79A 1FH9A 4M8UA 4H8VA 1E71M 2UY3A 5AC5A 3VGBA 4TOQA 2GJXA 1CXHA 1MQRA 4BQ5A 3T0AA 2CESA 4U3CA 1KGUA 4KGLA 3RM9A 5D9NA 1UD2A 3VX1A 3EMCA 3AS0A 2FGZA 1ZBWA 4GQRA 3AISA 4M56A 2WYSA 1W2VA 2A3EA 3RILA 4WSKA 5FKYA 2X8RA 1EH9A 1E70M 1OB0A 3PZMA 2E3ZA 1Q6EA 4QP0A 3LPOA 2PWFA 3PZTA 5JBDA 1W3LA 2XSAA 3WNNA 4HOZA 4GPNA 1GOQA 1HXJA 3ARWA 1H2JA 2VRJA 2VRQA 5M3WA 1HJUA 3AMCA 3MANA 3VGFA 5DO8A 2XTKA 3BAJA 4MB4A 1J12A 1K9DA 2WZEA 3AIQA 3GZAA 4U5KA 2XWDA 4R27A 6A3HA 3KEHA 2GDUA 4GZJA 1SFSA 3CUHA 1NP0A 5HPOA 2XGBA 3UESA 1B3XA 3VD5A 5IXEA 1DWIM 1OWQA 3N18A 3AICA 4AZGA 3WELA 4H8HA 3AQUA 1E0WA 4EK7A 2DPEA 3SCRA 1CXEA 3O9NA 4CN6A 1R8LA 4IM4A 2F61A 5A6AA 2EPKX 4LGXA 3UR7A 4Q22A 2HVMA 3FN9A 2YLAA 1EQPA 4PUDA 3E1F1 4XX6A 3VGEA 4P7NA 3ZT5A 3ARPA 2XYLA 1CNVA 3BLKA 1OSEA 3GNOA 3I3DA 5A8QA 3PTKA 1QNPA 3GNPA 1HKKA 1TCMA 1FA2A 3DYPA 1O7AA 2WVSA 1V6YA 3BH4A 3WQ8A 1GOMA 3K1DA 2ZUMA 2CKRA 2NT0A 4CKQA 3U57A 3ALFA 4D1JA 1MW0A 2XFRA 2CXGA 3NIYA 3VIIA 4B9YA 2F2HA 3ARTA 3T2QA 3ZR6A 3PBGA 2WBGA 4M80A 1WDRA 4MB3A 4UQEA 4OBSA 4EE9A 1V6UA 4UZUA 1B31A 1C7TA 1LG2A 1LWHA 2D1ZA 3CMGA 5E6ZA 3WUBA 3AIUA 4RE2A 4BCEA 1RP8A 1HKJA 4UFJA 3VU2A 4JKKA 3F5KA 4PCSA 4AEFA 1JFHA 2WLYA 3IANA 2XM2A 5I77A 2WKLA 2WPGA 2VZTA 3FNDA 2O9TA 4D6HA 2JIEA 3QR3A 4P7RA 1E43A 1XH0A 1E6RA 1UWSA 1BAGA 3F4VA 5M17A 2WMKA 5A95A 1A3HA 3UETA 4NF7A 1FFRA 2F8QA 3VM5A 3AHZA 4D6JA 1OINA 1QBAA 2WB5A 4QAWA 1H0IA 3VIJA 3TP4A 1E4NA 2D20A 2VVNA 3DYOA 2XVNA 1EOMA 1E6ZA 1OT1A 3PZVA 3SCWA 1JDCA 4PMRA 2FH8A 3EDEA 3F5JA 4W89A 5AC4A 3SCUA 1DEDA 1ZU8A 4UFKA 5CG0A 1FH7A 1O6IA 1QVBA 4H04A 4JZ5A 5AYBA 1BFNA 3S6TA 1UG6A 1V3IA 4Z2KA 4FLOA 1PX8A 4JKMA 1EHNA 2XM1A 4DM2A 4N0RA 2IUZA 3N17A 4U2ZA 1XRVA 3ZJ6A 3CLWA 3WNLA 5C70A 3NSNA 4JFSA 3VKKA 1LJYA 5D9PA 4UOQA 4AZHA 1CLVA 1YQ2A 1VB9A 3PZIA 4H7VA 3VGGA 4ATDA 2PB1A 3EMZA 1D7FA 1C8XA 1FP9A 2JEPA 1JNDA 1KBBA 4FK9A 3MS8A 4JFWA 1HVXA 3BMWA 3GH7A 1PBGA 1DWHM 3VDCA 4J3WA 4W87A 4F79A 4PYSA 1XV8A 1ISXA 2DH3A 1M04A 2BV9A 2J7EA 4ZEPA 3AIEA 3RJYA 4D6GA 5ABHA 4P7LA 2YL8A 1L8NA 4D6CA 4MTVA 1C3FA 1J11A 1GORA 4MJ2A 5A6JA 1LLOA 5I23A 3NCOA 4AZ5A 3WNPA 2BVTA 3KL0A 4AZ6A 4EANA 3O6AA 2WC7A 5BXTA 4PTWA 4W7UA 2D2OA 4AYSA 3W27A 4Y7EA 1R85A 1TR1A 1HNYA 1U2YA 5DEZA 3TOPA 3AOFA 3WKZA 1F4AA 1M03A 3VILA 1PX3A 1SYTA 1G5AA 1GNXA 3KWXA 3U5YA 4KMQA 3AMGA 1WDQA 4CUCA 4LPCA 4MB5A 1OD0A 1JF5A 2G8ZA 4AIOA 1ISZA 1CECA 4W8BA 1DHKA 3WQVA 4E2OA 1XHGA 2OWCA 1LQ0A 1UKSA 2X2YA 7A3HA 4B15A 1WKYA 3CMJA 5BYWA 1E40A 3WDRA 2VI0A 4GZIA 1WAWA 1BG4A 4CGTA 2VVSA 1JYVA 3N9KA 5ABGA 1CGUA 2VUYA 1ECEA 1V02E 4MNKA 3W4RA 2J75A 4HOWA 3WQ5A 4ZXLA 1ISYA 2IXUA 1FHLA 3WF4A 2JIWA 4RE3A 2PBGA 1FH8A 3GXFA 2AAAA 4CD7A 1C92A 1XH1A 4UZSA 2YL9A 2FHFA 1R7AA 1BSIA 4TUFA 2Z1SA 1KCLA 2OYMA 1LL4A 2E4TA 1QHZA 5BRPA 1W1VA 3SCOA 2OWWA 1J10A 3GXDA 2CETA 3VD3A 4IPLA 3RPMA 3WSUA 3RIKA 3MUY1 1QOXA 2ZUNA 3NDZA 4GINA 3GYCA 4HPHA 1R86A 3KL5A 4ZENA 1PJ9A 4PMNA 2XFFA 2VX7A 3EDFA 4DUVA 4U31A 4JL2A 4D6FA 2YLLA 4DWSA 3WH8A 1W1TA 2V3EA 2ZUUA 1WB0A 1JG9A 1I1XA 1U30A 1GQJA 5IFTA 1E0VA 1B2YA 2JE8A 4DUXA 3WUEA 4A3YA 5A6BA 2J7DA 1MFUA 3WH7A 2J7FA 3VD4A 3WH5A 3WF0A 4W5ZA 3QGVA 4TVDA 1VFUA 5EFFA 4DUWA 1GHSA 2VQUA 3VIFA 1VIWA 4ZE5A 1ZJBA 2J7BA 2JFEX 4MDPA 3SUUA 1JAKA 1E56A 5CGTA 1JZ6A 4C7DA 1ZS2A 5F7UA 3CUFA 4Z2LA 4UFLA 2J8GA 2E8YA 4P8UA 2YBUA 1WP6A 1V6WA 1JZ3A 4CCDA 2YL5A 1MFVA 1WZMA 4YHEA 3WF2A 3ZIZA 3VO0A 1Q4NX 1CXFA 1TZ7A 3BAKA 4JCLA 1KWKA 1KXHA 3CUJA 1G94A 2OSYA 3L4YA 1MXDA 1C7SA 5CLTA 3U7BA 2EEXA 2JF7A 4FLQA 1DP0A 3GNRA 1DWFM 3OA5A 1US2A 1CGYA 2BXZA 3SCSA 4KGJA 5A6SA 2CNCA 1GOOA 2W91A 1UKOA 1KBKA 1UA7A 1G0CA 3WMBA 4GI9A 2E9LA 4M81A 4V2XA 1W3JA 2J8FA 4U5IA 3VVGA 4CU6A 3T0BA 3A4XA 2DSVA 3L4WA 1CXKA 2JF6A 2VCBA 5GNXA 3WEOA 4UFHA 5A2CA 3CZEA 3WQ6A 2VX4A 4L4PA 4AISA 3N12A 4OOUA 3WENA 2ZUWA 1W91A 2UY2A 3M46A 5JBEA 1VRXA 3PZ9A 3WMSA 3OGVA 4MAZA 4P8XA 1EO7A 4JKLA 4XZBA 4K68A 1V3JA 2NW0A 1CGWA 5E0CA 3IJ8A 5IFPA 1K6AA 2YDRA 1C90A 2EPLX 4MNLA 1NWSA 5A1AA 2QLYA 4JFVA 2XIIA 4PCTA 4WIWA 3EYPA 4XB3A 3A6OA 1PPIA 2UWFA 1TMQA 4PMQA 5GPRA 1W9PA 3NSXA 4WKFA 2J62A 3A3HA 1AQHA 2WMHA 2WMIA 3WQWA 3WBEA 1FP8A 4XV0A 2FHBA 4MJ4A 1H49A 1HJWA 4AD0A 1CGXA 1GUVA 3FHQA 3AYRA 1IV8A 3PTQA 4A3HA 1KXQA 1JI2A 4OKDA 3RM8A 1JZ8A 5BCAA 2OYLA 2MANA 4U3AA 2GSJA 1GJWA 2J77A 2Y4SA 3ZOAA 2O9PA 2ZX8A 4MPKA 1ITXA 1MVYA 3AIWA 3WUFA 4GI6A 2J79A 1UKQA 3GXIA 5FD0A 3SUTA 1QW9A 5A2BA 1CLXA 1B9ZA 3AS1A 2WHMA 1C93A 2C7FA 2CEQA 1VF8A 2ZE0A 3BLPX 7CGTA 3AMLA 3AXXA 3CTTA 3T2PA 1LL7A 3IJ7A 4KRUA 2GJXB 1KCKA 3CHEA 1JZ2A 3CZGA 4D6IA 3UG5A 2XVKA 1E6QM 2W63A 1GZJA 5D4YA 2DQXA 4TTUA 1UD5A 3MSGA 1HN1A 3JUGA 4MADA 4W5UA 5CPSA 3IAPA 3WD0A 3CH9A 4U2YA 1QI3A 4PMVA 1GHRA 5DT5A 5EFDA 1D3CA 2OWXA 1E3ZA 3AIVA 3TTSA 2ZUTA 3AZSA 3T09A 4AD2A 2QV4A 1QI5A 4AD3A 1NP2A 3L2MA
chains in the Genus database with same CATH superfamily
3KM8A 1T8QA 3BLLA 3DBPA 4I5XA 1R9ZA 2X0YA 3BLOA 2CLKA 2ZDSA 3PFMA 1CLKA 4K38A 3KCOA 4YVVA 1XSIA 3W53A 4P7OA 5TAOA 4J3TA 3ZLFA 2MNRA 1HQTA 3NPXA 1CEOA 3L65A 2NLYA 4RPQA 2OMAA 3G22A 1A49A 4J3VA 4P2VA 3UYIA 3M1ZA 3DFYA 1KLYA 1UR3M 3E2VA 4Q4MA 2FFIA 5CJ5A 2GUBA 3PVFA 1E1CA 4EF8A 1CW2A 3CL7A 4LYRA 3APTA 3TSBA 1K6WA 3QFWA 2V38A 2DH2A 4W7VA 5ECVA 1E5NA 4RE4A 3H26A 5LIYX 4N9EA 2FZNA 2OSXA 4X9YA 3AZRA 4QNEA 3WQ4A 4JR5A 1E5JA 5K2ZA 1Q6OA 2HPIA 1ZAIA 2B81A 3BQ6A 1SQ7A 3GXTA 1D8CA 2QCNA 4ZMGA 1MXGA 4HZ6A 2ZIDA 1FY6A 3KFTA 1G4PA 4QJ1A 3IARA 3HO8A 5JIWA 3N2TA 2WAGA 2YW3A 3URAA 4CN4A 2CKSA 3B40A 3V1PA 1HX0A 3VMOA 3GC2A 4FR6A 4O1BA 4TU1A 4REQA 2WKJA 3GSMA 4US5A 4IJBA 2X30A 1JPHA 2X2GA 5I09A 2GWGA 7TIMA 3OODA 2TYSA 3W6MA 5D2WA 3STPA 5E9AA 4AIEA 2B7PA 3GNNA 3TROA 4UC5A 2PTXA 3RX3A 1PHWA 3QGAC 4G1KA 4BQ3A 2PP3A 4KEUA 3C8FA 4GH3A 5LYRA 4N9CA 3ONCA 1CXIA 1Q6CA 2WOQA 2G96A 4EPKA 1V51A 1VLIA 5BXSA 5JMUA 4WJXA 1GVRA 4ZSTA 1TUXA 4AFYA 3BK0A 1YW1A 3GTNA 3SN0A 5E09A 3ZWSA 1KXVA 1GVYA 1YTDA 2J78A 3HPXA 3ERPA 4PMXA 1TPH1 4KCUA 3LPPA 3WMCA 1MZHA 1XCFA 3CZKA 3LTSA 3SQLA 1X6NA 2J9XA 5IDIA 3D5HA 2XIBA 3QQ0A 4IISA 4H1ZA 1SFJA 4AD4A 1XG3A 3PPGA 3CIWA 1YTKA 2ATSA 2IQTA 4QM1A 1OFPA 2J66A 3N2OA 3S2NA 4BQ4A 4INFA 2YFOA 2X42A 2WCSA 5I3IA 3WNKA 1LBFA 5MHBA 1NOUA 4WOZA 4AZCA 6TAAA 3DCPA 2QF7A 4A8IA 4Q8OA 4ML4A 1KFBA 1VJSA 4DWDA 1T41A 1HL8A 4PUEA 1XPYA 3URNA 3GHRA 3CZJA 4FF7A 4EXBA 4JQ1A 3F2CA 1G6CA 1KRCC 3MHFA 3N2MA 2XH0A 1B5TA 4PN2A 3O2LA 1RD6A 2PAJA 1A5KC 1YBQB 2REQB 3LCFA 4WDWA 2ZRYA 3BSMA 4O15A 1SO6A 3I3EA 5GNYA 1J4EA 4L9ZA 3GG0A 4JTAA 4RDVA 2VM8A 1BGGA 4QITA 4FS9A 5C5YA 4QQ3A 4F9JA 2OLHA 3NXFA 2J25A 2G50A 2Y6ZA 2G4FA 1RZMA 1JR1A 4RCXA 4E8GA 1GPFA 1W1YA 3S2CA 2FVKA 1G7UA 4OGZA 4AMCA 1W37A 5HANA 3ZYZA 1Z3NA 1I6NA 3HMCA 2YXOA 4I3GA 1LQAA 1SZGA 3I7QA 3WFAA 2ABBA 3G1RA 3M0LA 2CHOA 3WLMA 1KXTA 1H4PA 4QDWA 4W8LA 2I56A 3RR1A 2DT1A 5FJJA 3PBWA 3VCCA 3BW4A 1W1PA 1YRRA 4GYPA 3CPUA 5DXYA 1S1RA 3A4JA 4RW5A 2Y89A 2O55A 3RO8A 1SO3A 5I3GA 2BS9A 3OLEA 5AHMA 5C2XA 3NTYA 2GK1A 4L7ZA 5M03A 1ZLPA 2VR5A 1V5XA 4QTGA 3QSRA 1YDVA 2BVDA 1K1DA 2HPMA 5HMSA 3QJAA 3VAVA 2J4GA 5JBFA 2NQLA 1OX6A 5LXEA 4NAEA 1DJXA 1AW1A 1KW1A 3CIVA 4ES4A 5CPNA 3DERA 3MV01 3HQNA 1M7XA 4NI3A 4XQ6A 2FLIA 5TF0A 4GNJA 4OZOA 2DVTA 2V0TA 1YBQA 3QY7A 3W7QA 2H90A 5CKSA 2ZUVA 1TRIA 3GDMA 3GKFA 1YADA 3CAKA 5FA5A 3PUDA 4GWEA 1ODZA 3PJWA 4QS5A 2ZX7A 2BHUA 1C8YA 4UTWA 4F2TA 1AQFA 3F4NA 3LSCA 1E51A 3G3MA 4L4OA 1PZ3A 4R7JA 4LWWA 1EJRC 2TAAA 4JNYA 4EX4A 1AQ0A 1R3RA 1W32A 3P2VA 3E49A 2ESCA 4JHZA 3ABQA 1QW8A 1IWBA 3N15A 3L4XA 3NQVA 4LUSB 1OK6A 3ELFA 3WH6A 3LRKA 1U33A 5KZEA 4DO7A 1L0PA 3PULA 2NXGA 3BJTA 3ZVHB 4N4QA 3ARVA 1XUUA 1OFRA 1QW7A 4DJDD 1MW3A 3B8IA 3CGTA 3W1XA 3EWWA 1M65A 2IKIA 1VR6A 3FJLA 2ZA1A 2YCEA 3GNXA 1WOBA 3L67A 3LOTA 7ODCA 4JYDA 3AIRA 3AMKA 1FCVA 4GVHA 4JGDA 2YZ5A 2BGNE 4P7QA 5I0DA 4NL1A 3GXMA 1X98A 3TXZA 5KITA 4QXIA 4IQDA 1CBGA 2G95A 2VX5A 1S5MA 1KB3A 3KHJA 2P88A 3AXIA 2OELA 1Z32X 1DJWA 3GG7A 3NZRA 1MMFA 2V82A 3H2FA 3EWCA 1GQLA 3RYSA 1J18A 1JRBA 4WRHA 1TV8A 2NV1A 4YYFA 1TWIA 1VFMA 1M3UA 5CC6A 4NJJA 3TYDA 5G2WA 2PZNA 3BCFA 1HKIA 2GWNA 1EEPA 3PG8A 1RPXA 1M1BA 2XVPA 3V3WA 2J7HA 4X0NA 3B9AA 5GJMA 1Q7MA 4Z2JA 5G2HA 3CUZA 3K8KA 2QR6A 4ZFCA 3MBDA 1TV5A 4J9JA 5F1UA 4LUTB 3EWDA 8XIAA 2F7FA 2EPOA 4E8CA 1S2AA 4XK2A 3GVGA 1LORA 4HJFA 3WLNA 5IBXC 1Z42A 3I6RA 1OZMA 1W6TA 3TW9A 3C0QA 4JOMA 3MUCA 5C9WA 1WZKA 4B3LA 2DT2A 3AC0A 1O1HA 2ICSA 4DO4A 2Q8LA 3OU8A 2ZYFA 3A5FA 4JQ2A 1OBAA 1LWIA 2E25A 2Y2WA 3GWQA 1IXNA 4CQDA 4R34A 5AZ0A 1KTBA 1OZQA 4R9XA 1NOWA 2RAGA 2ZXDA 3KHDA 3FIGA 3TZNA 1Q6DA 2W5FA 1H7OA 2ZZ7A 3PNUA 1XH2A 4TIMA 3TV8A 5HOSA 1FOBA 1E1EA 1LCOA 3AXHA 2VCCA 1UQYA 1G9HA 1TV3A 5HNTA 1UA3A 4J3XA 5HMEA 2WHKA 3W1UA 3LRLA 3VE7A 3E9AA 1EEXA 2FIQA 4AC1X 1E15A 1E4MM 2BY1A 2B7OA 1D3HA 4YCPA 3LUTA 1H0GA 1RHCA 3VNZA 3W6LA 3CNYA 3F4DA 1XYFA 4CQBA 3BOFA 1OX4A 2YOCA 2YX0A 3R12A 3Q45A 1A53A 2W62A 3MJYA 3GDBA 3VIMA 5AVHA 4E0CA 3NDYA 4C1NA 1QO5A 3W7RA 3K4AA 3GFZA 3HG4A 5C9XA 4MVAA 3W01A 4RX0A 5LGXA 2YA0A 4L4LA 1W9BM 4DPQA 3GC5A 3W1TA 1VBRA 5FJIA 4JHMA 2CBIA 1A4MA 4AY1A 2CW6A 2G3IA 5KTLA 2F38A 1R2SA 5XIMA 4NJIA 3HPZA 3FAXA 4RL3A 1QI4A 2FVMA 3ABSA 1BQCA 3H6OA 2BSLA 1SR0A 3HJEA 2V3DA 2QCHA 1E4LA 4BWLA 4HNUA 3SCVA 4LVFA 4NAFA 3CAQA 4PRWA 4IIEA 3OBEA 4BI6A 4O57A 4BY3A 4GBDA 3EXSA 5HXMA 1GEQA 1YXCA 3CASA 4G1NA 4IGHA 1TJ0A 1W1B1 1TE1A 1B3ZA 2JEQA 4XUYA 4IT1A 1C8QA 1BGAA 5AHFA 1TG7A 2QVNA 4GIAA 1XXXA 1VEOA 4D8ZA 4PZVA 3N1AA 1CXLA 3M0ZA 4XSMA 3N25A 4K8HA 3LCLA 3RLUA 1HZYA 4UR7A 2Z28A 3VMPA 2X0HA 2GFTA 4X0VA 2WMJA 5DY2A 1NQ6A 4O50A 5HDRA 3N14A 5D32A 2HCVA 3CEUA 5L9FA 2XZ7A 4YTQA 2DSZA 3CZLA 3VNKA 2R1MA 2WO5A 2Z7GA 4XAZA 3STEA 3IS4A 1UIOA 1LUCA 1U5VA 1JFXA 1VJIA 2ZC1A 2V30A 1JI1A 1NH6A 2OT0A 2QJJA 3L2LA 1GOIA 1B4KA 3WQGA 1QPOA 1W3TA 4CVWA 3F7JA 3ZM8A 5HJLA 1UZ4A 3SIMA 1WO2A 4MSSA 2VEPA 5A6KA 2FGBA 5HR7A 4AXNA 4FOJA 4LAZA 1C29A 2Z1KA 3CPGA 4JDBA 2CHNA 3RXZA 2VHLA 4KRTA 1H3GA 4PMOA 4DX3A 4F9DA 5LNSA 1N8IA 2PODA 2D23A 2A4AA 3K46A 4LV9A 3HV9A 1DIKA 4NZCA 1MI3A 3OLGA 3SFWA 4R85A 3K13A 3WLRA 3OVRA 5DBUA 2PLMA 3T9PA 4DI8A 1N82A 1UUOA 2R14A 3ARQA 3VZZA 2YCKX 1JZ7A 1AD4A 3UW6A 4B4HA 3MT1A 2PMQA 4XISA 4IP7A 3W82A 2Z2AA 3WQEA 2WC4A 5XIAA 1WKDA 2WZIA 2EHHA 3OLIA 2P3EA 4HZ8A 2WMFA 3GR4A 5BOFA 3VDAA 1NWRA 1QCWA 1TELA 3NVDA 1V3KA 1CGTA 3TTYA 2A3CA 5CZJA 4Y9AA 5CBIA 3F03K 1GT8A 1VP5A 4WK9A 4DWSD 1PO9A 4GMEA 1P6WA 4Z17A 1JAEA 3K8LA 2O7QA 4AX6A 3H7RA 4IGSA 2GVYA 3HN3A 4QFUA 1XSKA 4DRSA 1GJUA 2E40A 5EMKA 1TVNA 3KRBA 3NZGA 3R0KA 5CPTA 4OJYA 3FYYA 4LEQA 1POJA 5EMYA 1VS1A 1WOAA 1DIDA 1MEWA 2ZVRA 4JEQA 1K9FA 4JIQA 4NZ3A 1ICQA 2CLOA 2TRSA 1DTNA 5A6LA 1BKHA 3TN6A 4PTDA 2BHZA 4FIQA 3R10A 1D3GA 4BQ2A 4DJFA 2GPTA 1XYLA 4GLEA 4UTJA 4EVZA 5CSYA 3WLKX 1P48A 4WF7A 3EKLA 1F07A 3G6MA 4KEZA 5AKQA 5IHRA 4S3GA 1ZBCA 1SFLA 1NU5A 1K8CA 4URIA 3EDKA 3PJXA 3B4UA 2J74A 1JPMA 1AL8A 2G5WA 1R9YA 2QEZA 3T44A 1IIGA 2GJNA 4Q33A 1S1PA 3VXGA 1VQTA 3N11A 4FEZA 1OFOA 1IXOA 3A4WA 3SY1A 3D0CA 3GUWA 4TVCA 4XVDA 2BB0A 1ZSXA 1JDDA 3KLKA 3UG3A 3IAQA 1LUCB 2QPUA 1TQJA 3K8MA 1IIHA 3NL6A 1OABA 5BRBA 3FY1A 1OX4B 4PB5A 4AUBA 1MYRA 4KWWA 5BXPA 3NG3A 1XIEA 2AMGA 3SDOA 2QUVA 1ML1A 1N8FA 1MQPA 4US5D 3ZQ9A 1HJQA 3CAVA 3EWZA 1B1YA 1XWYA 3AMDA 3SUVA 1FRBA 4AVNA 3RGTA 2ACUA 3W25A 4ZQOA 2VQTA 2VXNA 3IIZA 1VBUA 4UNKA 3LCIA 2ABAA 3A3WA 5AECA 2EG8A 4JNMA 4FALA 3G1XA 2OLSA 3NL2A 1IT8A 4AEEA 3G77A 4H2HA 3AHXA 2IPJA 4ACZB 2CIPA 1M7PA 1W3KA 1H5VA 3VKDA 1Q6FA 4FNUA 4I9TA 4Q32A 1JDAA 1RP9A 1JD7A 3DAQA 3B8TA 4C5ZA 3CV6A 1O5QA 5A8NA 2ZZ3A 4FXRA 3SY5A 1VFLA 2WK2A 2PBOA 1VIZA 2C8NA 3IIXA 3MYPA 4L4MA 3I68A 3FDGA 3SECA 1L6GA 3CQHA 4E3TA 4Y90A 3TTEA 4NXSA 3CUIA 4IX2A 3LGGA 3MHGA 1QJWA 3RM4A 3EA3A 1EX5A 1FX6A 1HT6A 1XC6A 2VD8A 2C15A 3TFXA 3M6DA 4B5XA 3R8HA 3QY6A 4IIDA 3H24A 3N9RA 3VIOA 3EKGA 3TZFA 4GZEA 4MF4A 4M8UA 5I02A 1ZPTA 5AHNA 1E71M 4YTRA 1QNVA 4KWOA 4A05A 3T0AA 4JN7A 4U3CA 4RDWA 1FWJC 3S1VA 3EMCA 3QFEA 1REQB 1RBAA 4NZJA 1L2QA 1EJSC 3GVRA 4AF0B 1AJ2A 1A5NC 3AISA 4M56A 1W2VA 3NOEA 2A3EA 4I90A 3Q4DA 3W7KA 4NJKA 5BZAA 2HMCA 3OYXA 2OOFA 2OG9A 5BOEA 3EKZA 3O6DA 3URBA 1Y65A 2NQ9A 2VRJA 4GE8A 3AMCA 4Y9MA 4Q4OA 4JTFA 3GZAA 2FJUB 1TIWA 4R27A 3KEHA 1N7KA 3SB0A 2PURA 1EZWA 4GZJA 3RG6A 1NP0A 1KM0A 2Z1VA 1B3XA 2NXHA 3UWZA 4AZGA 4L5ZA 2F2KA 2FTYA 4LAUA 3U6WA 1TPUA 4EK7A 2QULA 2DPEA 3MVIA 3USBA 5FF7A 4CN6A 3FYOA 4NNCA 4IM4A 1NSJA 1HW6A 3PM6A 1QPNA 2YXXA 4Q22A 2HVMA 3FN9A 2PDIA 3P0WA 3LERA 3E1F1 4XX6A 3QV7A 3ZT5A 3DU0A 2PEVA 2POTA 1H7PA 5F1VA 3GNOA 1A3WA 3V35A 1QNPA 1HKKA 4DPPA 1FA2A 4TV6A 3SJ3A 1O7AA 1VPXA 3UZXA 1VRDA 3OBKA 3SGGA 1BVWA 1W3NA 4ORIA 2YXGA 1MRQA 2OR2A 4CKQA 3U57A 1EA0A 1LOLA 3W6YA 4D1JA 1LOQA 1F3EA 3UFYA 4KERA 2XFRA 1RY8A 5E9XA 2F2HA 3CWOX 4MB3A 4LVGA 1GEHA 4FA3A 4O28A 4OBSA 2FZ9A 3WJXA 2I5IA 4MY9A 1R2RA 3B8DA 1QPRA 4KW2A 1REQA 1C7TA 4GIYA 2BDQA 1LWHA 2D1ZA 3WUBA 4PH6A 5T91A 4QE1A 4RE2A 4M51A 5J8LA 3VU2A 4PCSA 4AEFA 1N8WA 2XM2A 1KLZA 2WKLA 2WPGA 3FNDA 3CV1A 2WJEA 4C6KA 2G4JA 2FB2A 1S2UA 3B0XA 2HNHA 3GG8A 1KTCA 5BOOA 1SJAA 2ZBTA 4CLMA 3STGA 2OEJA 4EP8C 2YDAA 3W1LA 4HN4A 3MCOA 1P5BA 3V18A 3VIJA 3TP4A 2GOKA 4OECA 4DN1A 1X97A 3SCWA 4JTJA 4MKSA 4FPSA 1QAPA 2DY3A 4IP4A 1ZTVA 5I00A 2V5BA 3W07A 4DB7A 5F2MA 4JX6A 3D6NA 2F6XA 4H04A 1O6IA 3LTPA 2TODA 3S6TA 1XIBA 1GZGA 4FLOA 1CCWB 2C6QA 4JKMA 1OADA 2XM1A 1VPYA 2IUZA 4HT3A 4U2ZA 1TX0A 3CLWA 3WNLA 5AZ1A 3NSNA 2H3BA 1ALDA 1X1ZA 1LJYA 4OV9A 1CLVA 3PZIA 3VGGA 2PB1A 2CLPA 4HYWA 3MS8A 1DWHM 4N4PA 1I2NA 3FSTA 4ZO9A 3BANA 1TQXA 4H83A 4BWLC 2GVGA 3RJYA 4ZEPA 4FNTA 1Y5XA 1KCZA 4XAFA 2YL8A 3LNMA 4D6CA 1C3FA 1GORA 2SFPA 4DF0A 1WQ5A 3NCOA 3M5VA 3W7IA 3PWIA 1Q85A 2QCDA 4AZ6A 4EANA 3O6AA 1SSGA 3C2VA 4AYSA 1F2JA 4Y7EA 3EEZA 3BGJA 2OPJA 4JYFA 4LRTA 3VILA 2UZ9A 1QXLA 1YMYA 1R3VA 4QHRA 3KWXA 3U5YA 4O16A 4KMQA 3O1NA 2Y7EA 3AMGA 4DBWA 3A9BA 4MB5A 1OD0A 1JF5A 3NWRA 4CNSA 4W8BA 3N29A 3NDOA 4JN8A 1UB3A 4XG1A 3CWHA 3WDRA 2OX1A 3P93A 5DMNA 4RNHA 4CGTA 1CGUA 2QCMA 2VUYA 1FXQA 2C19A 1G69A 1QATA 4ADSA 3WQ5A 2IXUA 3NM3A 1FHLA 4HSNA 1MDLA 2JIWA 1FH8A 3GDRA 3DHDA 4EIVA 4IJCA 1OK4A 4UZSA 2FHFA 4XZIA 3HQOA 2A0NA 2G97A 4YLWA 4PODA 3D47A 1QHZA 4PCNA 4UBPC 5BRPA 1W1VA 4G8TA 4F0HA 4AVOA 3JVAA 3RPMA 1DIOA 3RIKA 4A8LA 1QOXA 2ZUNA 5A8GA 5FF0A 3KL5A 2W79A 1PJ9A 2V63A 3SZ8A 2E1DA 4J35A 3EDFA 4DUVA 1R46A 3DENA 1W1TA 2V3EA 2ZUUA 4Q8PA 1JG9A 1I1XA 2GGHA 3TSDA 3UA3A 4JTUA 4MOZA 3EOEA 1GK8A 5EMUA 4DZAA 2JE8A 2OZ0A 1FKWA 4C90A 4DUXA 3WUEA 3H21A 4A3YA 1UBPC 3IJ6A 4Q7IA 4Z0JA 3VD4A 3E5PA 3WF0A 4NKCA 4OBTA 3T40A 4NUWA 4DUWA 2Q3RA 3QYQA 4KWSA 3VIFA 4ZE5A 1JAKA 1E56A 2PS2A 9XIAA 1JZ6A 4C7DA 1W56A 3IRDA 5AN7A 5F7UA 5DELA 3CUFA 4Z2LA 1P0KA 3LCWA 4UFLA 4M6PA 4O0KA 2E8YA 2I9EA 1M68A 5BWAA 2J27A 1Q7ZA 1ZHAA 3PB0A 1UZDA 2YL5A 3LGDA 1TZ7A 5H8MA 4JCLA 1KWKA 3CUJA 4AWSA 5TQLA 4JD4A 2XINA 1VH7A 1XQKA 1PDZA 4UTTC 2JF7A 2PDXA 3GNRA 3GDTA 2E09A 3OA5A 2YW4A 1YKWA 3T55A 5A6SA 3MCNA 1HGYA 3M0YA 1BSLA 3CQ0A 4GI9A 2DJXA 2J8FA 1R3TA 3MP4A 3KOYA 3M4HA 4RXFA 4FI4A 3M5YA 2DSVA 3QVQA 3JS3A 3L4WA 4UFHA 2Y61A 3HJZA 4P5UA 1TWZA 2WSYA 4AISA 1XLCA 3WLJA 1T5AA 1PCWA 3H4XA 3WMSA 2OQLA 4MAZA 4KEVA 1J96A 3MZNA 4JKLA 4XZBA 3QV9A 1VD6A 4IL0A 3KTSA 1V3JA 1CGWA 5E0CA 2HS6A 3IJ8A 2WV8A 1WDWA 4F48A 1JRCA 5A1AA 1EUNA 3N73A 3H2NA 2H8XA 2J8TA 2XIIA 1PWMA 2PDKA 5E93A 3W7NA 4XB3A 3LU2A 2EJAA 5AHLA 1TMQA 4LV4A 2RDUA 2PD9A 3OA3A 1BXCA 4A35A 3VOHA 3SW6A 4O54A 2WMHA 2WMIA 4M7TA 1H1YA 2PDGA 3Q65A 1UC5A 1H49A 2XN0A 1I2OA 1EJUC 4UMCA 3MDWA 3RM8A 1JZ8A 2MANA 4L64A 1GJWA 3CB3A 3BGGA 2O9PA 3SRDA 3O16A 1AG1O 2CXEA 1ITXA 3RRXA 2C1HA 5F2LA 1ADSA 5C55A 2PDJA 1TV7A 2GGEA 3PSVA 8XIMA 3KBWA 4E4UA 2HBXA 5A2BA 1B9ZA 2WHMA 2CEQA 1VF8A 3G1AA 5I03A 4IUOA 2QKFA 1RAKA 3T2PA 2PGWA 4XD3A 1L6YA 1VZWA 3CZGA 1XIJA 5CC3A 1S2TA 4PB3A 4OTKA 2FJKA 1TTPA 1UD5A 3MSGA 5CPSA 3WD0A 3CH9A 4PMVA 4MIMA 5AYZA 3O6YX 4L9YA 1K8ZA 2DZUA 2DP3A 1EWDA 3AZSA 4S3CA 2GGIA 4RV3A 5JU6A 5DBTA 3UWEA 4AD3A 1NP2A 2OTDA 1UYQA 3ZJKA 3MMWA 4I7WA 4UFIA 4LW7A 2UY4A 3GG1A 3UG4A 1OY0A 3BV7A 4KWUA 1KFKA 3UBPC 1IEQA 1XS2A 3E2RA 1UW9A 4AWTA 5G1MA 5KSWA 4QE5A 2R91A 1TPC1 4C7FA 3QGKC 1EL3A 1WKFA 2XSBA 2JKAA 4P8VA 2BASA 4IG2A 4OE7A 1TJRA 2F84A 3LHYA 4PBEA 1JD9A 2PDYA 4GIRA 3LG3A 2QMKA 3KBJA 4KKXA 2XIJA 4GC3A 2A3HA 2C91A 1QWKA 4R53A 3HPAA 3RNDA 4GKLA 2G41A 2A3AA 1FWSA 5EPDA 3TC6A 1L8PA 1R87A 4HMEA 3VFLA 1M01A 3SBFA 1HTIA 1EGZA 1DWAM 2XUCA 1UR1A 4YPJA 4C6EA 4HCDA 4WSJA 1ITCA 1O5KA 3UCQA 2INZA 4DF2A 3SSJA 4O4VA 4D8LA 2E5BA 2J6VA 5FSEC 2YJQA 2V81A 1S5WA 1BWKA 1OT2A 4KCWA 3P82A 3L7RA 1SZFA 3UPWA 3LPFA 3NQDA 4QJ3B 1LTDA 3G1DA 3LLDA 4MYAA 2ZXQA 1J79A 5HR6A 3BTNA 3TC7A 3EB3A 1XLGA 4GCXA 1X96A 1QPKA 3MHUA 3VGHA 1I60A 2FQIA 3VKCA 1UR9A 3BC9A 5DCBA 5A8OA 2GJPA 1AJ0A 2YKKA 3WBWA 3HGRA 2QCFA 3NQ8A 1TPVA 2VEFA 4YWIA 1BG9A 2FB3A 3LLFA 4QQUA 4NSBA 1NAL1 3EZ4A 3VX0A 1AD1A 4NU7A 4YVXA 4FAMA 2QUMA 1FTXA 3UQNA 2DUXA 3FW6A 1KFWA 1E1CB 1W5PA 3LRMA 2WKGA 2AQWA 4MG4A 1Q3NA 2W4XA 3L5MA 1R5YA 5KZMA 3DC8A 4BS0A 1AH4A 3GVWA 5C9UA 1TX2A 3KZSA 1ZNNA 5I3FA 3GZ3A 5FJRA 3FKRA 1W9DM 5CSSA 3G0UA 1NY1A 1F5ZA 3CJPA 4S3DA 2OQYA 1BXNA 2O9RA 4MM1A 1OVDA 1BPLB 1JIBA 5M5DA 3SEPA 3VMNA 2OU4A 2NXIA 1UUQA 3LSBA 1XFBA 2QDGA 3INPA 1KKRA 4Y9PA 4Q8VA 1EO5A 1OQFA 5IRPA 1M5WA 4LC8A 3P8IA 1A4LA 3CBWA 1OFDA 3B4YA 4L56A 2HJPA 1XGZA 3WDQA 3VIGA 5G4HC 4GY7A 2DZSA 3ZMRA 1FWRA 1W8SA 3QZAA 4CQ8A 1RSCA 1FDZA 3DZ1A 2MUCA 3N9SA 2IS7A 2GUYA 4A6GA 2Z6IA 2QT3A 4MDOA 3WK2A 3WD1A 4IHCA 3V0SA 1EB3A 1HKWA 4KFNA 4AY8A 3EA2A 3ITCA 1GJPA 2WCAA 5EGRA 3P81A 5G4WA 3T0TA 4PUMA 1JDFA 1SZRA 1KGWA 1EOKA 1QNOA 3GX9A 3W7DA 1CIUA 2BOEX 4A3QA 4LQ1A 4JIEA 3LBCA 3W2KA 4TX6A 2OX4A 2V5CA 2H8ZA 1QHOA 1OFEA 3AYSA 1W1IE 2PE4A 3POHA 3BO9A 3S9IA 2NUYA 2QXWA 1TWSA 3W72A 4HNVA 2Y62A 5HPCA 1WDPA 3B0YA 4HPXA 1W9XA 4LC6A 3UT0A 2HXUA 1VJZA 4UB9A 3AHTA 2AKZA 4C6LA 3LPGA 4MWAE 1W5MA 4QROA 5GVJA 3ITYA 1A3XA 3QR0A 3B9OA 1AH0A 3W0KA 4S2BA 2B0MA 1XDJA 5FJUA 1V3MA 2DZTA 1AQMA 4PFMA 4H6RA 1IEWA 1J5TA 2QZRA 4Q6JA 3W22A 4EF9A 3NXLA 4W8AA 3NJ3A 3HQPA 1LL6A 1BYAA 3DFOA 4UQAA 2NX1A 2Z27A 5LIUX 5XINA 3S1XA 3BW3A 2ZVIA 2NLIA 2OKTA 3UJFA 2YDSA 1H51A 4BA0A 3MKCA 2WZTA 3ZT7A 4M7SA 4HB7A 1Q8AA 4J2MA 3B05A 2VFEA 2QV5A 3AROA 1R3WA 1CDGA 2O9OA 3LD5A 3UJRA 3M5XA 2ZX9A 1UMLA 4MY1A 3MUIA 2VMFA 1GQKA 2WQPA 3OG3A 1AW5A 2PDMA 3S5YA 4CQ9A 1A5MC 1JCLA 2OYKA 2PLKA 2RJGA 2E5DA 1DORA 5U7SA 2ISFA 1VAHA 3U0HA 3V0UA 3HF3A 4LBRA 1UR0A 4GFSA 1OD8A 4WOQA 1HUVA 1YNPA 3CB8A 5HBFA 4A2SA 5LNUA 4ZOEA 4LCRA 2DSWA 4B4FA 2ZRUA 3K4WA 1RJQA 3JW7A 2BY0A 3LXAA 4NZ1A 3CL8A 1V02A 1GCYA 3BAYA 3WF3A 4J27A 1EBGA 1VFSA 5HQEA 3HU7A 3V16A 4HK5A 3VNYA 4YYCA 2A7RA 1PHQA 3PZNA 3P74A 3UEQA 2Y5EA 3GK0A 3RF9A 4S2CA 4PB4A 3RCNA 5FI8A 3E6EA 3GH5A 3S2JA 1SMDA 1C8VA 5IHSA 3ARSA 4DBDA 1KO0A 4PMUA 2DW6A 4X63A 3N6QA 3WY1A 5FEPA 4WXYA 3XISA 4ZCWA 3GHUA 1AVAA 4UQDA 4GOAA 1RVGA 4C6NA 4O1EA 4K39A 1MW1A 4GO9A 1NOFA 4JXCA 3NUKA 3WFZA 2V2DA 4RNJA 2PWVA 1I2QA 3OYZA 3GDLA 3LM7A 2W9MA 1BRLA 3KBVA 5FEXA 1K77A 1W5QA 3B9EA 2A3BA 1QPQA 3OZMA 1BVNP 2QAFA 4Q4SA 1B57A 3CUXA 5I2UA 4JAWA 2NX9A 2D2HA 3DFHA 4WGHA 3ZJ7A 4F0MA 3RAOA 2V3GA 4FB7A 5JIPA 4FXFA 4Z2GA 1KQZA 2C18A 3T42A 3WDPP 2VCAA 4IMFA 3TN5A 2EJ1A 1QI0A 1QNQA 5AY7A 4ICNA 3QW3A 4IX0A 2R82A 3P5ZA 4LY4A 1XD0A 1B4EA 4WSHA 1PL9A 3DHPA 3BE7A 4MWAC 3TYUA 3IK4A 5G4EA 2D0FA 3GYEA 4A8NA 1MDRA 4ZTXA 1XQLA 8CGTA 2E6YA 3CT7A 3WL0A 3M0MA 3HG5A 1HGWA 4OUIA 4XZLX 4JS3A 3VUSA 5HUOA 3FK4A 4HD5A 3W2NA 4NRRA 4LYQA 1OCQA 4ALDA 3W81A 5T9BG 4X2RA 4PCFA 3GU9A 2DIEA 3TQVA 5CEWA 9RUBA 4FNRA 4GRSA 1E9LA 4CU8A 1V0KA 4J7RA 1IYXA 3KE0A 3QTGA 4KESA 4XIAA 3OGRA 1Q2SA 4WLCA 5A6MA 3THQA 2R1KA 2W6RA 3BJSA 3BURA 3I4KA 3LY0A 4C1LA 1OF6A 2RGLA 1OYAA 1R7OA 3IGXA 5IBXA 3E38A 3VIKA 3CK5A 4XBJA 2X09A 3WD2A 4LAOA 4KEMA 5F4XA 1CGVA 4PSRA 1FWGC 4BI5A 4PEKA 3RPTA 1V03A 4UTMA 1PE1A 1PYMA 3NAVA 3MSDA 4ACYA 3QLLA 1ME9A 4C91A 7ENLA 3TCSA 1NWTA 3RLGA 2D0HA 4AD5A 5HNUA 1UPPA 3GC4A 4IXXA 4AWEA 3WZ0E 4K36A 1TIMA 3KDNA 3ZS4A 3H2EA 3W29A 3CQJA 1RH9A 2QIWA 1XIMA 1ZZMA 3KS5A 4N42A 4HMDA 1B9BA 2X1IA 2I5GA 1HFBA 1OFQA 1VHNA 3GBDA 3ABOA 1JF6A 5GNZA 3PTMA 1NDZA 3CH0A 5FJTA 2A7NA 5CJNA 1PKLA 3V75A 4DZ5A 2C0HA 1UD3A 3FV9A 5HWMA 3M0IA 4XZHA 3MQTA 4AW7A 1ZAHA 1HVQA 2ISDA 1T7LA 2Q02A 2YZRA 4REQB 3OIHA 4IP5A 3TJXA 3MO4A 3L4ZA 5AYYA 1Z6KA 2CLFA 3ENLA 3P7YA 1HL9A 3VGDA 3PZGA 3WFLA 5LGZA 5BNKA 2ON3A 4XZWA 1WZAA 4NYYA 3FYPA 1JXJA 4IOTA 4KQNA 3CIXA 5FAGA 4S3EA 2PCQA 4JTRA 4AZ7A 3VFCA 1IR2A 2VX6A 3AUJA 3W00A 2XU2A 1F3WA 4UFMA 5DY3A 3PSWA 3SN1A 1KNWA 1Q6LA 1KQYA 3OP2A 4Z2HA 2ZC8A 4MNMA 3MMUA 1ELSA 4ERGA 3TLQA 2AL2A 2ODOA 1Y7VA 4E3VA 1EGMA 4E8DA 3IUHA 3K4DA 1SM9A 3BARA 1XD1A 5B80A 3AU6A 4GXMA 4UCGA 3MWAA 4MKNA 3AHVA 3HIJA 2ALRA 1H7WA 1PV8A 2PTYA 5I24A 3N13A 4HPJA 4U33A 1GWJA 3P8JA 3B8SA 2GGJA 3I3BA 1H1NA 4PSPA 1UD8A 5HNNA 2NSXA 2XIQA 3CZ8A 1UQZA 3NQGA 3OPSA 1E9YB 5J04A 3R13A 1DQWA 1W1A1 4JDYA 1R3SA 3OQEA 1H41A 4DXXA 4QDMA 3LHZA 3UGVA 4DAIA 2XZ9A 3OB8A 2VURA 3RU6A 5C2GA 4BKNA 1K4GA 5DMYA 1A5BA 1FDJA 1B0IA 3JR2A 4WKHA 5C8BB 5K9XA 3P84A 4GD0A 5FIPA 5BMXA 1TCDA 3ARRA 1EZ2A 1A5SA 1CI1A 1XG4A 2BY3A 4B16A 1EDGA 4RZ6A 3SADA 4QEHA 2B31A 4O52A 3MO7A 3II1A 4GH1A 4Z1AA 1WZLA 4V27A 1JCJA 4FX7A 4Q6XA 2CBJA 3M07A 4I7VA 4X22A 3HPSA 2YCLA 4MAVA 1XLMA 2CZEA 4PRTA 4H9YA 4PTVA 3WQFA 2QDEA 4EPBC 1RA0A 3QKZA 1ZP4A 3T6CA 5AHEA 5FESA 2PI6A 1R2TA 4JY9A 4A3UA 2BFGA 2WM0A 4N02A 3CWNA 1MEHA 1GYNA 2IPWA 4YJ5A 4IPNB 4PA8A 2CHRA 4ML9A 5DCDA 2V5JA 3TYBA 4WKAA 1XISA 4UNLA 4GYFA 2E8ZA 4HTYA 1BEUA 4LU0A 3M0VA 4HP5A 4HYRA 3S8HA 3NYDA 2UBPC 4J3UA 2PP1A 2WNQA 3RK8A 1OJXA 4KF1A 4DM1A 2FH6A 1S2CA 3W7LA 1WDDA 1GG0A 5D9MA 2VKZG 1L6WA 1O4UA 3LDVA 1DJHA 3F5LA 4Q7NA 2QW5A 3H53A 3TYEA 1WX0A 2VGBA 3ZFHA 2L5HA 5KETA 4H7CA 5E0FA 1GVSA 2YB1A 3MMDA 2BX7A 1ZBVA 2ZRVA 4ZFMA 5KINA 4PUWA 3NQ2A 4PL2A 3M16A 1FWDC 4HIBA 3KDOA 1G67A 1DE5A 2CWNA 8A3HA 3STCA 4B2DA 5AFDA 4DXKA 1QNSA 2XJ7A 1B3WA 1HKMA 3B0PA 1JQVA 3MCMA 3BWWA 3UXLA 4A3RA 4B3KA 1V4YA 1PSCA 4LUYA 3A12A 2G3JA 1DWGM 1UH2A 1JYWA 3HZ3A 3B8VA 2X1UA 5CJMA 1W9VA 3RX2A 1KRMA 2OGJA 2ZX6A 2I5QA 3L66A 3VKAA 1QOPA 4US6A 4LOCA 1Y0EA 3R11A 1YNYA 5CZTA 1W1ZA 3DI0A 4M29A 1IZJA 1X39A 1KKOA 1KA9F 1K7EA 3FDKA 3QOKA 1XCWA 4FXSA 4WDUA 3LV6A 4C6DA 2EG6A 5EA9A 1Q6RA 3GVVA 4CNNA 2VZOA 3HM7A 1PEZA 3QW4B 3G1VA 1UD4A 3LA4A 3VTRA 3B8WA 3FHAA 3THDA 2JQXA 4RE0A 1IZCA 3TWAA 2FFCA 2PSNA 3GUGA 2QDDA 5TD4A 3O7UA 5AYXA 5CSUA 1XBXA 1E4IA 1KC7A 2EPMX 4IZGA 1TTIA 1MUMA 2DW7A 4NQ1A 2EKCA 1OGBA 4H00A 5BWFA 4BR1A 1YIXA 2FPTA 3G24A 1EF2A 4I8YA 4F3HA 4XKYA 4D8AA 4HKPA 4MUZA 1GTEA 3LENA 1EDQA 3L0GA 5D05A 3EPNA 3WUGA 2A21A 2A85A 5CZ0A 2W0UA 4HNNA 3VGBA 4TOQA 2GJXA 1GOXA 2VFIA 4KGLA 2QCCA 3WLIA 1TPWA 4DF1A 3RCYA 1MSSA 2FGZA 3NO1A 1ZBWA 2DJLA 4I6VA 1U83A 3A22A 1EP3A 4AHOA 4JBRA 3N6JA 5TBOA 3RILA 4WSKA 3S4TA 5FKYA 4Q8NA 1Z69A 3W2JA 2Q8ZA 3PTDA 4QP0A 3LPOA 3PZTA 1E0TA 1W3LA 1JPIA 3IIPA 1P7TB 1GOQA 5F4SA 2J13A 2VRQA 5HMDA 3VGFA 3CV7A 4MFDA 1TPEA 1K9DA 3H12A 3AIQA 4GVIA 2ACSA 4WUIA 3NQ6A 3CUHA 1Z41A 3UESA 3ME3A 5KMYA 3VD5A 3BG3A 2G3FA 3AICA 2F6UA 3B3DA 2E7FA 3UXIA 1UROA 1RUSA 2F61A 4N6EA 2EPKX 4LGXA 3S3GA 5G5IA 4HU3A 1FWBC 3M41A 3THAA 1O12A 1EQPA 3DH7A 2PPGA 4PUDA 3VGEA 4P7NA 4NI8A 3ARPA 2Z25A 4HK7A 2XYLA 4WDTA 1J8VA 1OSEA 4MHBA 4LBUA 3W88A 1RCXB 3P3BA 3WJWA 3GNPA 1S2WA 1TCMA 4YXGA 3S5OA 3DYPA 2YYUA 1V6YA 3GRIA 3K1DA 2ZUMA 2GL5A 1P6CA 4YVPA 3H7UA 2Z29A 2PD5A 2NT0A 3ALFA 1FCQA 2VP8A 3RN6A 1KTNA 3WMLA 2VC6A 4I8DA 3ZR6A 6REQB 3T2QA 4KT2A 2CLEA 1V7YA 2HK0A 2WSRA 4EE9A 1V6UA 1RD5A 2I16A 1YX1A 5FACA 3QR1A 2YCLB 3KOFA 1FWEC 4QX4A 1KCXA 3KTCA 2BTMA 4H6EA 3STFA 4BCEA 2P10A 3H2AA 3RFAA 4JKKA 1UWAA 3F5KA 3SRHA 1ECQA 2WLYA 2X40A 3VNLA 5I77A 4H9UA 3QN3A 4LALA 2Y7GA 2O9TA 1HKVA 1QRQA 1RQBA 2DUAA 3VOGA 1SO5A 2XIMA 3BOXA 4O1DA 1BAGA 3F4VA 4GVFA 5M17A 2WMKA 1A3HA 3LBMA 5CSRA 4NF7A 3S6OA 2F8QA 1TKKA 4D6JA 5MF5A 4HVXA 3R58A 4PL1A 3UGRA 1QBAA 4QAWA 1X8CA 3RU8X 3QLDA 2FTWA 2VVNA 3DYOA 3HBLA 1LYXA 2XVNA 4DHGA 1TR9A 3DI1A 3M64A 2AQOA 1XLFA 3HG3A 2JKEA 1JDCA 1W31A 3PUGA 2INFA 4PMRA 3NPVA 1D7KA 1E9IA 5HATA 3F5JA 4W89A 4GUHA 1ZU8A 5B7ZA 2E67A 5AYBA 4JZ5A 1UG6A 2ALDA 4H19A 1ITUA 4M19A 1PX8A 1EHNA 5I06A 4GY1A 2ZA3A 2GQ3A 2OVLA 4KFOA 3ZJ6A 4JFSA 2VEKA 2OCZA 1OCJA 4AH7A 4UOQA 1VB9A 3CU2A 3UNTA 1SJBA 1C8XA 3VNDA 2QQ6A 1HVXA 3BMWA 1PBGA 4WD0A 4EWND 3KRZA 1ISXA 1MUWA 1JCNA 1M04A 2BV9A 1TJ2A 3R25A 4XKYB 3NOYA 4HMNA 4D6GA 5ABHA 3M9YA 2C71A 1Q7QA 4RV8A 4AZ5A 3WNPA 3IGUA 4RDYA 3HFYA 1ME8A 2YYTA 2WC7A 3MP5A 3LS9A 2H9AA 1TR1A 3W7PA 1U2YA 3TOPA 3CPRA 4OVXA 1PX3A 2A6LA 4FX6M 4GVGA 1KM5A 3KW3A 3UR5A 1EP2A 1R3YA 2P50A 5LHEA 1ZP3A 2KZHA 3WQVA 4GA8A 3FX4A 1U22A 1LQ0A 1I0DA 1UKSA 2X2YA 2V2HA 1E40A 2VI0A 4GZIA 4IMDA 1WAWA 1PZ1A 4G7EA 3R79A 3EWXA 4UTTA 3MC5A 3VNMA 1ECEA 2HROA 3HG2A 1QDSA 3QPEA 2B7NA 2HS8A 3O05A 1C92A 3W2LA 2YL9A 3N2CA 1R7AA 1KM4A 2FMOA 1WUEA 1KCLA 2OYMA 5AC7A 2E4TA 3TYAA 3IUDA 3UCDA 3I4EA 3RR4A 4PC8A 3SCOA 2OWWA 3WLTA 2PA6A 3E2QA 3PBUA 1JULA 3M0KA 4L80A 2VFGA 1XIDA 2VX7A 3M7WA 3GKAA 3KP0A 4YWSA 3UVAA 3NQBA 1GQJA 1SU5A 2V6AA 4IIFA 1AFSA 5CG7A 5A6BA 2Q71A 1T40A 3KXQA 1A5AA 1MFUA 3N4EA 2J7FA 3WH5A 4W5ZA 5U4NA 3HURA 5D2TA 3QM3A 3G3DA 2ISSA 4TVDA 1I2PA 2BVWA 3ITLA 1GHSA 3BLFA 1VIWA 3ITGA 1ZJBA 3DOPA 4C6PA 4DO5A 5AHIA 3SUUA 3R1ZA 1VYSX 2D2GA 1ZS2A 3TR9A 2RFGA 4O19A 1DBTA 2DVXA 4P8UA 2YBUA 4HGXA 1WP6A 1RLCL 3GFYA 3KBNA 4DI9A 3GIPA 1AUSL 3O8AA 1WZMA 3VOFA 3WF2A 3UCCA 1CXFA 4ZVJA 3OO2A 2WNZA 1G94A 2OSYA 3SR7A 1FXPA 1OX5A 1NVMA 3LHWA 4XBKA 1DP0A 5I07A 3I7RA 4L6HA 5DMMA 3N2BA 2DZAA 4HNLA 4B2DD 1P6BA 2W91A 1RR2A 3PJUA 4PCPA 1G0CA 3UF9A 4M81A 4IL2A 1UJQA 1US0A 1F05A 4U5IA 3C2RA 4CU6A 3T0BA 3A4XA 1KM1A 4RNIA 4FXJA 3U2ZA 4M5PA 4O13A 3WEOA 2PDBA 5A2CA 1H5YA 2X0SA 4WJ8A 3I6EA 4B92A 3TWBA 1RJRA 4TX9A 4JIRA 3LYEA 3DFPA 4L4PA 1QFEA 4OOUA 2ZUWA 3M46A 3G18A 4V1YA 2NQHA 3KAOA 1Q8JA 5IFPA 2R1NA 1NWSA 3EX2A 1T0OA 5T8GA 3SI9A 1E0UA 5A5WA 2QLYA 4JTGA 4JFVA 3AWOA 4WIWA 4O18A 3PAJA 3RX4A 4EPDC 3A6OA 1PPIA 3MI3A 2Y1HA 2P0IA 3T1GA 4YS1A 3WQWA 3WBEA 3MMTA 2PC4A 3QTPA 1GUVA 4IMEA 1UOZA 1XFCA 5FJPA 4GQ0A 4XD5A 3TMLA 2C1IA 3CMFA 4A3HA 4OKDA 3N19B 1KM2A 4U3AA 1PYFA 1H7XA 3P67A 3ZOAA 4P61A 3OQ8A 4E2BA 2FTPA 3M0HA 1KM3A 1MVYA 4Y9OA 1UKQA 3KWSA 3GXIA 3W1RA 2XN2A 1U1UA 5HUPA 2J24A 2AGKA 5EYWA 5A6TC 2CZDA 1LBMA 4M1BA 3UG8A 5CH9A 1MO0A 1KCKA 1RQHA 3CHEA 2I7GA 4D6IA 3I6TA 2XVKA 4LYKA 4DNHA 1Q5MA 1E6QM 2W63A 1GZJA 4TTUA 1HN1A 4W5UA 2NZLA 3IAPA 4LCQA 1WBJA 1JUKA 5DT5A 1D3CA 1IXQA 2OWXA 1E3ZA 3AIVA 4ZQMA 3U4AA 4LT9A 2OZTA 4WZHA 2ZFAA 3GQYA 4YL2A 1O1ZA 1QK0A 3T09A 1QI5A 3ZR4A 4IFKB 3VM7A 3O6CA 4AHPA 3EX6A 1XBVA 3C5QA 4NZFA 1E6PA 1EJTC 4JQ4A 3S83A 1I8JA 3WK3A 4HTBA 2FZBA 4J1OA 1SJCA 5EBUA 4D71A 1PTGA 1O66A 1VFOA 1J0IA 5C9RA 2C13A 4ZE4A 4XUGA 4C65A 4Y8EA 3U5UA 1XIGA 3GR8A 4MWAA 5D03A 1L2UA 2WMIB 3SRKA 4GUGA 1ZBKA 1SJDA 3R0DA 5A69A 3HQ1A 3QC0A 4C1KA 3VABA 4HHPA 4KPLA 3TAOA 4DQWA 5CBBA 2CZ5A 3W1AA 4O53A 4HBKA 3OVPA 4ZO6A 2WNWA 4QAIA 4W93A 3DN5A 3HB9A 3EBVA 5IM51 1PTAA 3PK7A 1U5JA 4Q8MA 1F73A 5C7VA 1ZL1A 2QJMA 3QMTA 2NUWA 3C2FA 3T8QA 3VINA 2CLLA 1FHDA 1IE7C 1UKTA 4PEEA 2RGMA 3KOXA 1W2PA 3WDHA 5HULA 3C0JA 2EF9A 1ZB5A 4QBXA 4HNOA 4R5EA 2X1SA 3ARZA 1GQIA 4XO7A 3ICJA 3EOOA 1EQCA 4GQQA 4R33A 1BF2A 3NQ7A 3TTQA 2I17A 2QF8A 2Y7FA 5LA2A 4DO6A 1NF7A 3CEPA 2QUNA 5CQ1A 1O94A 4B5TA 1VFTA 2ZICA 1DXEA 3RMJA 4ROPA 8TIMA 3UZZA 4K7VA 4LNCA 5ABTA 2BBFA 1K02A 1SVDA 3RJXA 4AQLA 3W9ZA 1BTMA 4Z1DA 2R8WA 2W66A 2VJXA 1JCYA 3MSRA 2BXVA 2EG7A 1V0NA 3W75A 4AXKA 5DQPA 5EL1A 3R4IA 3SQMA 1D8WA 2WSPA 3IIOA 1B3OA 1V0MA 3UYCA 2YGYA 2P76A 3C0LA 1AMYA 5IDZA 4D9PA 2B4GA 1TE6A 4G9PA 4OIFA 4ERIA 3EMQA 3PAOA 3IJDA 1Z7AA 3IWPA 1QUMA 2R1LA 4CD6A 1EBHA 2VC5A 1GG1A 4W88A 3TQ0A 3IVUA 1QK2A 1DL3A 3GS6A 4RXGA 3LCGA 4JQAA 1OGSA 4GZ7A 2W27A 4LVDA 2DFAA 3WO8A 2WNNA 3BXWA 4U4MA 5HJYA 4DBEA 4N7QA 1JGMA 4Z1CA 1Y5WA 3F2DA 2JK2A 4M6VA 3NFUA 4KWVA 4H2CA 5DRCA 1JCXA 4IQLA 1AK5A 1NWUA 2DT0A 4RJEA 4QNWA 4LAMA 4DYEA 3VOIA 2VGIA 5C71A 2YA2A 3C2YA 3WLQA 1LP6A 3FEMA 4LXFA 2PWGA 1XIHA 4GY0A 2P8BA 4KFPA 1CENA 1NDWA 2I14A 3EDDA 2POZA 5MKGA 3S2MA 3ANVA 2CERA 1BLIA 3OTRA 2XVGA 5REQA 1YXYA 3OEXA 3USZA 4DJDC 1Z89A 4HNTA 1MZRA 2A79A 1H7NA 3UXKA 5FL0A 2E9MA 1QWGA 3T08A 1PDYA 4OQVA 2DUZA 1RK6A 1VBHA 2DIJA 1AH3A 1EIBA 4GO8A 4L1XA 3LGEA 3N4AA 1ESWA 2DEPA 3DC0A 1K4HA 5I78A 1QNRA 2EAWA 3S47A 3L0KA 3ZJ8A 7PTDA 2VC9A 1UD6A 4UUIA 1JZ5A 4F66A 1O95A 4EAYA 4LS0A 1DOSA 3L68A 4X60A 3MBFA 4UTFA 2CLIA 4U28A 2XH4A 3WQDA 3ZWTA 4GBUA 1LRQA 4LYPA 4NNAA 1XM3A 3DG7A 3M47A 4IJRA 2D3LA 2CLMA 2V67A 4A21A 3G8EA 6CGTA 3MKVA 4A29A 1F6KA 3A21A 2NWRA 3UJSA 3LZ5A 1PWLA 1XI3A 2YL6A 3NZ1A 4K8GA 3Q2DA 3CAWA 3SCTA 3S46A 5LZLA 3R0UA 2PP0A 2PWHA 3PR2A 4Q4PA 1KRAC 1Q6GA 1TVPA 1J0ZA 1WXZA 4XTIA 3GIYA 3VDGA 1QBBA 1KM6A 1WXYA 4S3BA 3J7HA 1F9CA 3AHYA 4IWWA 4GXWA 3BAXA 1FWTA 3DDMA 4ZO7A 4BEUA 3RDKA 1QASA 1H60A 1C9DA 3WH9A 4IFRA 1R0MA 4WY0B 1LZOA 1BHGA 2AOSA 4DUOA 3WN6A 4RKAA 4RZBA 2PF0A 2OEKA 1J0KA 1NFGA 3VKBA 1DIEA 4L6OA 5CLWA 4GQBA 1X1NA 5C54A 5I3HA 2NT1A 1HG3A 3FKKA 3WBXA 2NX3A 5FF2A 2X1TA 1BYBA 4M3PA 4H9MA 3N4FA 1YYAA 3QMSA 1OIFA 3BSHA 1UWUA 3C3UA 2Z7KA 1DTUA 3T0DA 3WDIA 3W1QA 2ZWYA 1HJXA 1EXPA 4L1WA 3NEHA 1LDCA 3NSMA 2TMDA 5I3DA 2BNJA 2Y0FA 4XKMA 3CS2A 2ZZ4A 3A24A 2EXOA 2YBVA 3DFSA 5CZSA 3AS3A 2ZX5A 2Y24A 1S3TC 1XKYA 2YIHA 2H9AB 4J28A 3FS2A 4N9BA 4KIRA 4JIIX 1CPUA 5G2IA 1H11A 3BMVA 3C61A 4O14A 1XYZA 1XINA 4MWAB 2QAPA 3E5BA 3ES8A 1VFHA 2WVTA 1GYMA 3W24A 7TAAA 3MVTA 3NZQA 1YDNA 3HOJA 4BHYA 4B5SA 4RZ5A 1DJZA 3E2SA 1V3HA 4ZOAA 4AY7A 1AJZA 1FKXA 4ICMA 1XLKA 1T6MA 2E6FA 3RPDA 3V5OA 3RITA 4XBSA 4GUIA 4UCFA 1LWJA 3L4UA 1BTCA 5KZ6A 4Q7BA 1W54A 1DHPA 3SCQA 5K9CA 2PRHA 4DYJA 2WANA 1G4EA 4AHQA 1KWGA 3TJLA 1E6NA 3WQCA 1TB3A 4CN1A 1OYCA 4RNFA 1PCKA 3BVJA 4Y8FA 5L6UA 5F2GA 3D46A 1PAMA 5CC7A 3AYVA 3TNOA 2O92A 2Y8VA 2AGTA 2X7VA 3SGZA 1F4HA 5D09A 4W86A 3LI0A 1GVIA 1NFBA 4HCLA 3H2MA 1O68A 2V8ZA 1KGXA 4O17A 3SUWA 3ZSSA 3VC5A 4LANA 1TTQA 3N04A 3QC3A 4YTSA 1A80A 3GAYA 2YPIA 2VTFA 3CO8A 1XRSA 3K1GA 3TN3A 1S5VA 3TH6A 1OFAA 4PTMA 3LBOA 4JIHA 2YFNA 3DEQA 4LNYA 1M6JA 5BXRA 1J6OA 3BLEA 1BRLB 4TMCA 4FP1A 2E5CA 4UOZA 3THCA 2Q3OA 2R6OA 3ID7A 1HP4A 1JYNA 3KVKA 4PE8A 3APGA 2RDTA 1ADDA 1IF2A 4QSHA 4MNJA 4F2BA 4GXPA 3ATZA 5A2AA 2XVLA 1MNSA 3MPGA 4OOZA 1SFTA 3H4GA 3WQPA 4W7WA 3E12A 1EJXC 1DJQA 2Z1WA 1EC8A 4G5DA 1L9WA 4NJHA 1UOKA 4UXDA 3BZJA 1HO4A 3NEVA 3P80A 2GSEA 3CYJA 1IEVA 5D04C 2O0TA 1R47A 1BWLA 3AU2A 1HJVA 3CTLA 4LTSA 3T7VA 2C3ZA 5D9OA 2E6AA 2VOTA 3H7VA 2ZOXA 1F7BA 4HPGA 3SUSA 1EA9C 5EB8A 3PC0A 3UY7A 1E72M 4L65A 2B7QA 1CYGA 5AC8A 4S1FA 3RMEA 1P0EA 5H91A 3AIBA 2WQDA 3N6HA 4MB1A 3ZT6A 5KZDA 2AL1A 2GQ8A 4E2VA 1WXJA 2WLZA 1F76A 4LX4A 5DANA 3MV11 4UR9A 4ENLA 4BF5A 2ZXAA 1V6XA 2FGLA 3M44A 1UC4A 3W1PA 4IIGA 1IT0A 1E3XA 2QS8A 5AOUA 5A8PA 4F0LA 2Q8XA 3FSUA 5CPQA 3LCXA 3QPYA 3FVDA 1OG6A 2RKXA 1ONXA 3AI0A 2E68A 5ABFA 3MYOA 3S1WA 2VR4A 1TWDA 1X7FA 2X05A 4HZ7A 4I7UA 1XGDA 3EWYA 3POCA 2O4QA 4R9OA 3FEQA 2BWGA 4J2PA 1YTEA 1E6SM 3TTOA 3ZZ1A 4E4FA 1KV5A 1Q45A 2WBKA 3SURA 4WY0A 4AAJA 1X38A 3VD9A 1K7FA 2EBNA 3A4AA 4FLSA 6TIMA 2ADAA 3APYA 2DT3A 4EPEC 2ZDRA 3EXRA 1X6LA 1XW8A 2DZWA 4D1IA 3SM0A 3NQFA 2NQJA 2H6RA 2DSKA 2HTMA 4LS1A 5D8ZA 1MW2A 2QUUA 4WEVX 4GJJA 2CZFA 3EAUA 2VNCA 3WIJA 2X41A 1P4CA 4XTDA 2WSKA 4IQEA 4JX5A 2E6DA 1SZEA 1GONA 1EJVC 4LF2A 5E6YA 1AW2A 3H4WA 1KBJA 1M7OA 2XG9A 1CTNA 3TK7A 4BJHA 1AL7A 4J4KA 5I5RA 2XWEA 1WKEA 1IZKA 3DHUA 2EQDA 1XRFA 2Y5SA 2QDHA 1V6VA 1GVQA 1UKPA 1RLDA 1NDYA 4DJDA 3QHOA 3TAKA 3OIXA 3T0CA 4PMYA 4S3JA 3T81A 3OHIA 2O7SA 3P6LA 3GHSA 1NEYA 2WC3A 3W7MA 2LLEA 1TPFA 4GYJA 4LUIA 4UWMA 2PDQA 3M7SA 4Q8WA 4ZOCA 1EHAA 1J0YA 1S38A 4S3KA 4GABA 2PDFA 3GY1A 3TONA 3MI2A 3VOCA 3AZTA 5FEZA 3VPLA 5E1QA 3GBEA 5B7YA 3ANYA 1LBLA 4AYGA 4R3UA 4K37A 2ZXBA 5D33A 1LF1A 1Z48A 1E1FA 3W86A 1UWQA 4CNPA 6ENLA 5C7HA 1UZ1A 2WSQA 3WEMA 3ABRA 1QHPA 3IGHX 4G7EB 2W3ZA 2Z1BA 1I0BA 1NJJA 2V5DA 2VZUA 4BFAA 1MRAA 3BAIA 5HNRA 4Q8TA 4OV4A 3CHCA 2Z24A 4IMGA 1GKPA 5LA1A 3FAWA 3AFBA 3FA5A 3EX4A 3SCNA 2CPUA 2QCLA 1UWRA 2X7WA 3O15A 4EOUA 1XYMA 2P3ZA 4ZB2A 3PB2A 4RLIA 1S2VA 4AIUA 3S1GA 4TQTA 1KBIA 2DZVA 4PMZA 1W5NA 3S0CA 3B9DA 2WJFA 4C7GA 1R6WA 3WJZA 3V36A 4QLLA 3D3AA 2J47A 3QEZA 5K3VA 2OSWA 3AALA 4S3AA 4Y2WA 3QOMA 2PDPA 4E4PA 3MUXA 1A5UA 3BCJA 3BPWA 1NARA 4UQCA 2GQAA 3KOWA 2CWXA 3BSGA 2VOMA 1XYBA 1LLZA 3R6IA 2FKPA 2DGAA 1EJ7L 4HU8A 4O1FA 3CO4A 5DCEA 4UTKA 3PS7A 1XGEA 4QJ4B 3TX9A 3UWUA 1HJSA 4HOXA 5D2VA 3UWVA 1EGVA 1OM0A 4AF0A 1C91A 1OC5A 2NWSA 3H70A 2BHYA 2J7CA 4HA3A 9CGTA 5DF0A 4JFTA 1TVLA 2ZZ1A 4KIEA 4XAPA 4HHMA