2HISA

Cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNAAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSNLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOMONAS FIMI FAMILY 10 BETA-1,4-GLYCANASE
publication title Insights into transition state stabilization of the beta-1,4-glycosidase Cex by covalent intermediate accumulation in active site mutants.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hisA00
5IHSA 5GNZA 2JIWA 2ZX6A 3WBAA 4CGTA 1LLOA 2CYGA 2CXGA 2X2YA 2JF6A 4PMNA 4UFIA 5M03A 2E40A 4IISA 4CD8A 4CVWA 1JDAA 3SIMA 2VVSA 3ZMRA 1BGGA 2VR4A 2E4TA 1V0MA 1C8QA 3MANA 2WVTA 3SEPA 2BFGA 2YKKA 1GVIA 3GDBA 1UZ4A 4D1IA 3CHCA 2VQUA 1UQZA 2A3HA 3SCOA 5KEZA 4GZIA 5JUVA 2WB5A 1GOOA 1CXLA 2ZX7A 4GI6A 4UFJA 5TD4A 1JD9A 2XHYA 1GQKA 2WBKA 3M7SA 1E4IA 3VGFA 4GPNA 3NIYA 1XH2A 3A47A 5IXEA 5FL1A 2XYLA 3W0KA 5LA2A 3VMPA 2QV4A 1PX4A 5EB8A 2A3EA 2V3EA 3APGA 4H04A 4TX8A 5DMYA 1QI0A 2XG9A 1JZ5A 4UOJA 4F9JA 3VM5A 3U5YA 1E15A 1GOMA 2GSJA 1KR0A 4CN1A 1LWHA 3ZSSA 3MUZ1 2BY0A 5BXRA 1XYFA 5D4YA 4B16A 2NT1A 3AIEA 2J78A 3GBEA 3VKKA 1UUQA 1ZS2A 4H8VA 4JFWA 3K1DA 1B3YA 4D6EA 4GO9A 2DQXA 1F4HA 1BVZA 2QMJA 1B3XA 1DWIM 3UR8A 1GOQA 4F8XA 5FCZA 1VIWA 1PZ2A 3ARXA 3UR7A 1H2JA 1EXPA 1GJUA 2IXUA 1NM9A 4UNIA 1OM0A 4XZBA 3SCSA 1FFRA 2V3FA 4JFVA 4AISA 3PN8A 1OWQA 1CZ1A 3PZOA 2DSKA 2WNWA 4LYRA 1A47A 4MNLA 5AC5A 1XCXA 5M17A 4TTUA 5ABFA 1UD6A 4YHGA 2A3BA 7CGTA 3WDRA 1HJVA 3MU7A 3VGDA 4D6FA 1J01A 4CD4A 4PBGA 2DPEA 2DDXA 4D6DA 3TOPA 3NSXA 4H41A 4DUWA 5D9OA 4AD5A 4D72A 3VIJA 4LGXA 5DEZA 4OIFA 4WKAA 2OYKA 4HZ7A 1EIBA 2JIEA 4GXPA 1E3ZA 1JFXA 2J7GA 4UFLA 1GVYA 3MSGA 3I3DA 4RE3A 3BAJA 1FA2A 1VF8A 3UEQA 3MS8A 4OBSA 2XWDA 2WWCA 3RJXA 5FL0A 3AS0A 3SCNA 2YBTA 1JZ7A 2WC7A 7A3HA 4NSBA 4U2YA 2CCRA 2VC9A 4JKLA 5ABHA 4W85A 3WDIA 2ZIDA 4P8XA 1M04A 4CN4A 2G41A 5D9MA 4ATLA 1BAGA 1W3KA 1WPCA 5A2BA 3ZJ8A 1CWYA 3BAIA 3IJ8A 5KZ6A 4F66A 3WQ4A 1PX3A 2UWFA 3WFLA 3CUIA 4H7VA 4PSPA 5BYWA 4EE9A 3MMUA 2WSPA 1BFNA 3AIRA 4KRUA 3N12A 5EBAA 3CHDA 3WDHA 2ZXQA 2HVMA 1HJSA 1K9EA 1Q4NX 2VX6A 3BMVA 1CDGA 1OGBA 3WELA 3HU7A 3WEMA 1DWAM 5A8NA 3A6OA 4MB3A 1E6ZA 3W82A 2J4GA 5BXPA 1UWIA 1XCWA 1R7AA 1HL9A 2D22A 2O9TA 1CGWA 1MW1A 1UR0A 1KXQA 4MB4A 3K46A 4HMCA 3LPFA 4UZSA 1JNDA 1UKSA 3WQ5A 3WDQA 3UG4A 4IPNB 3CUGA 1KXHA 3ARVA 3WH9A 4JHZA 3WBEA 2ZXAA 3WH6A 4PYSA 3RMEA 2J7HA 1K6AA 1J18A 3TP4A 4AMCA 3G6LA 1HXJA 2WAGA 1DHKA 3WENA 3WMCA 1HNYA 3MSDA 4H8HA 2EEXA 1E6SM 3W6MA 4DUVA 1JAEA 4AYSA 1N82A 1UH2A 4W5UA 1LL4A 4TTGA 1H0IA 3L4YA 5E70A 2G8ZA 3W28A 2E9LA 1KR1A 4U31A 4AD0A 5JIPA 1VRXA 3ARSA 3N04A 2XFRA 2FH8A 2V5DA 3AYSA 4HA1A 4W8LA 1R8LA 1VFOA 4Y7EA 1W9PA 2VX7A 3PHAA 5HBFA 3AROA 4QFUA 3U5UA 4CU8A 1JZ6A 4AC1X 1XSIA 2FDMA 2WCGA 4Z2IA 5I6SA 2J75A 3GH7A 5DFAA 3CPUA 5D9NA 8CGTA 1EA9C 2FHCA 1B90A 5E9AA 1HKJA 3AJ7A 1TA3B 3VDCA 4M82A 2VJXA 2UY3A 1EO5A 3F5JA 3ALGA 4TXEA 1OIFA 5A8QA 1FFQA 4HA4A 2WMJA 3WUEA 4V28A 1E5JA 2BVYA 4TVUA 1NARA 3HN3A 1H41A 4GI8A 5A2AA 3A4WA 1PEZA 3KL5A 1RP9A 5IHRA 4B9YA 4PN2A 3VIPA 1VBUA 2E0PA 3AMGA 3MV01 2Y24A 1E4MM 4P8VA 1V02A 3EDDA 3AHYA 1BHGA 1ZB5A 3GNOA 3GXDA 3JUGA 4J3WA 3GXFA 1QI3A 1OSEA 3KEHA 4WF7A 1TMQA 2BVTA 4QCEA 1XD0A 6CGTA 5JBFA 2G3NA 4MB5A 4MNJA 4P7LA 3VTRA 1HN1A 1JF6A 3PZTA 3ARTA 1LWJA 1HJWA 5BCAA 3VGGA 3K4DA 3FW6A 4GKLA 5AYBA 5I3DA 2EPNA 4JCMA 2VZSA 2CPUA 3RM4A 4D6CA 4CCEA 4PMZA 1E0XA 4JKMA 2Q8XA 4WLCA 4MB1A 2ZUSA 3AMCA 1JYVA 1HKMA 1PBGA 3W38A 2A3CA 2J79A 3WUGA 1JZ3A 1VEPA 2X0YA 1UD3A 3VD4A 4GINA 2WZEA 5BRQA 1GHSA 3T2OA 3AS2A 1UA7A 4V27A 5A6AA 1E73M 1W9BM 3AFBA 1JDCA 5CSYA 5HDRA 2G3IA 5C70A 1CXFA 3D3AA 3VILA 3F5KA 4PUEA 1HT6A 1BVNP 3CTTA 4R27A 1M01A 1UH3A 2JEQA 3VO0A 3T0AA 4ZXOA 3VMNA 4AIOA 1NH6A 2CBJA 4S3JA 2C7FA 1NQ6A 4JZ5A 3AXHA 4W89A 1F4AA 2CHOA 2J8GA 3DHPA 2XJ7A 3CLWA 4EKJA 2PWHA 1MQRA 1V3LA 2XVPA 2DH3A 2VZVA 4MDPA 3SCTA 4ATDA 1EQPA 1HP5A 2W92A 4JCLA 5IDIA 3ZIZA 4BQ5A 2YL9A 1UR9A 2AMGA 3W6LA 3SCVA 3WF3A 3AIWA 1QHPA 3BAWA 2CESA 5I79A 1KQZA 4CU6A 3CUJA 3AMKA 2DT3A 1XC6A 3GM8A 3AZTA 4CD7A 3TTOA 3N15A 3CGTA 2CHNA 4Z2GA 1QHOA 2WMIB 1BTCA 1IZJA 1CPUA 1B30A 3VGBA 1CBGA 1V0NA 4Q7NA 1AQMA 1CGTA 2YLLA 2NSXA 4J3XA 2VRJA 3T09A 1BYAA 4PMOA 4CUCA 5D8ZA 2WWDA 2IXVA 1BYDA 4HOWA 4C7GA 1V6YA 3AHXA 1KGUA 2WK2A 7TAAA 2WVVA 1JG9A 2UY5A 4W87A 4P7RA 3ARUA 1DWJM 1G5AA 2WC3A 2ESCA 2Z1KA 1UD4A 3ZR6A 1NP2A 1TVNA 3VOCA 3WNMA 4WSKA 2BHUA 2XM2A 4FLSA 1MFVA 1V0LA 5HNNA 4XV0A 1JZ8A 5BXTA 2OSXA 5CXPA 1W3JA 2IUZA 3AS1A 4AD3A 3UG5A 4W84A 1EHAA 3B8SA 1E3XA 3ZT5A 3ARYA 2CERA 1ECEA 2WPGA 4D6JA 3WDPP 4N0RA 3DECA 2YL5A 1KCKA 3PTKA 1M53A 3VIMA 4DUXA 3VGHA 2D0GA 2VNCA 3WF0A 3ZJ7A 1HKKA 5I2UA 4LQ1A 3CZEA 1V08A 4PCTA 3ZR5A 5I77A 1PIFA 1C7TA 2CKSA 1QNQA 4B15A 1WE5A 1A3HA 4N42A 1KGXA 4GO8A 3GH4A 5JBDA 4D71A 3K8KA 1I1WA 3I3BA 1BSIA 3ARWA 1NOWA 3W37A 4GZJA 3W24A 4OUEA 2XTKA 1JZ4A 5E0CA 3EBVA 3ZT7A 4J27A 3ZO9A 2ZWZA 3CZJA 1PAMA 2D23A 1UKTA 2WKLA 1UYQA 2VTFA 2VMFA 4U33A 1J0IA 1US3A 1W2PA 5CG0A 3CMJA 5CPTA 3THCA 2DSWA 4MNMA 4P7OA 4U5KA 1D2KA 1RP8A 3NJ3A 1L0PA 1GW1A 2QF8A 2V5CA 2VZUA 1KXVA 2GK1B 2E9BA 1IT0A 2YA1A 3SUUA 1MQPA 2VQTA 3AZRA 1XV8A 4PMDA 4ZE4A 3L4WA 3WD4A 1HJXA 3TONA 1VEMA 1LJYA 2WHKA 3AIBA 2W63A 5DO8A 1EHNA 3BLKA 3AZSA 3THDA 3NDZA 4UTFA 4FLQA 2ZUVA 1E70M 1J0KA 3VD9A 1BYBA 4KWUA 4UZUA 3HMCA 3VGEA 1BF2A 3D5HA 4AZGA 2YLAA 3AYRA 1JYWA 4HP5A 2CBIA 4M56A 1RH9A 4EK7A 3RJYA 5A6BD 4ATWA 1HX0A 1LL7A 2D3LA 2ZUWA 3K8MA 2Z1SA 4W7VA 5I23A 4PTXA 1JD7A 1JI2A 2ZICA 2WM0A 2WBGA 5BRPA 1GUVA 4CCCA 3DHUA 4URIA 2VX5A 1OD8A 3WEOA 1FH9A 3ARZA 1OT1A 4NI3A 4ZE5A 4KGLA 1GJWA 1V6UA 4FMVA 3O2LA 1G0CA 1FOBA 2GJXB 3OZOA 2J47A 4WK9A 5D9PA 3K8LA 1JI1A 4D1JA 4Z2KA 3U7BA 2E3ZA 3WH7A 5E6YA 3RCNA 1MXGA 4H2CA 2O9OA 1V6XA 4AIEA 1WO2A 2F8QA 3AS3A 3VIFA 4Z2JA 2DSUA 3BXWA 5EMYA 1CLVA 4LYPA 2PBOA 2PWEA 3WL1A 1OIMA 5E6ZA 4ZXLA 1W9XA 3KL3A 3IAPA 3EMCA 3OLGA 1QI5A 2XIBA 4FK9A 4CU7A 1GORA 4MDOA 2ZE0A 1G9HA 2FHFA 1C8YA 1QBAA 1KGWA 4UFMA 2GDVA 1HL8A 4CVUA 4WKFA 2D0FA 3WQ8A 2BXZA 2CBVA 4J28A 2CETA 1KB3A 1L8NA 1RPKA 2VI0A 1WDPA 4A4AA 3WMBA 2PWFA 3DYMA 1G1YA 2WHJA 2YA2A 5IFTA 5M5DA 1R7OA 4JFTA 5I78A 1W9UA 5DT7A 3WQ6A 1V6WA 2GUYA 1CECA 2WMFA 4ACYA 2WC4A 4M80A 2CEQA 2NT0A 3WH8A 3AHZA 3TTYA 3VM7A 4L4PA 1CTNA 1UHVA 3PTMA 4UFKA 1ZJAA 2ZXDA 4PMVA 4WSJA 3CUHA 1X6NA 5A6KA 1OB0A 4OOZA 1U30A 1ODUA 4MPKA 3VUPA 4WJXA 1CYGA 4D6HA 1VB9A 1WNOA 2YDRA 1WZLA 1QNPA 4U5IA 2VVNA 1J12A 2BY2A 2UY2A 2XGBA 4IUGA 5I24A 1W1PA 4DM1A 1GHRA 1U2YA 1WCGA 5ABEA 1CIUA 2J7CA 3EDKA 4BQ2A 2J7EA 5DT5A 4JFUA 2JE8A 3GNRA 1UA3A 1HJUA 3T2QA 2DT1A 2GFTA 2HISA 2GJXA 1TFVA 4TVCA 3ZJ6A 1ISZA 3GXIA 4FF5A 2DIJA 1EDGA 1D3CA 4QDMA 3VX1A 1H1NA 1E71M 2D0HA 1V0KA 4XB3A 2OSYA 1FHLA 1TG7A 2G4FA 2AOSA 1E5NA 3VX0A 1XD1A 4HMDA 4HA3A 5FD0A 3FAXA 3AQUA 3W29A 4TX6A 1UR2A 1H5VA 5A95A 3AHTA 2WMGA 2YIHA 3L4XA 4HZ8A 2GDUA 2WZHA 3CIVA 4PMXA 1G94A 3GXMA 1TUXA 4AIUA 1Q6EA 5A69A 1XYZA 1QHZA 2J8FA 5A2CA 3J7HA 4DWSB 5I0DA 5HPCA 1MW3A 3GYCA 1ISVA 1E9LA 4E8CA 5DF0A 2J77A 3PZVA 1EDQA 5I5RA 4UQ9A 1GQLA 4AD4A 1JFHA 3O9NA 3LPOA 3CH9A 1JDDA 2PF0A 2Y4SA 1WB0A 4AXNA 2WMHA 1M03A 1QI2A 1UR8A 1C91A 3OG2A 1UWRA 3IK2A 3U7VA 1OGGA 1E0VA 4JAWA 4WKHA 1EOMA 1S46A 1LG2A 1KWKA 4MAZA 3N17A 2QPSA 3VU2A 2PWGA 2OWCA 1ZJBA 4QAWA 1OD0A 3MUAA 3BAKA 2BHYA 3GTNA 1W3LA 1IV8A 2FHBA 2FH6A 3OLIA 4JL2A 5CGTA 1V02E 1V3MA 2WVSA 3NDYA 3AIQA 1QNOA 3WNKA 1V3HA 4W5ZA 1JNEA 3S6TA 3T0BA 3M07A 3ARQA 1NWUA 1JAKA 5A94A 2O9PA 5EFDA 4LPCA 3W81A 2MANA 1XRVA 3IANA 4E4PA 1QW9A 1E55A 3QHMA 3ARRA 3N9KA 3SCWA 3N1AA 3W4RA 4MJ4A 1Y7VA 3RM8A 1AQ0A 3L2MA 1Z32X 4C7DA 2OWWA 4UQDA 3SCPA 2OSWA 4L4OA 4CD5A 1E6QM 2Y2WA 2DSVA 1GQJA 2AAAA 4KMQA 3WFZA 3M46A 3OB8A 1GNXA 1I75A 3PZUA 2JALA 2J25A 4J3TA 4MTVA 4YN5A 3EMQA 3W27A 3MKKA 2RGMA 3WD2A 1MW2A 4ACZB 2ZUMA 4ZEPA 3CBWA 1R85A 1US2A 2PB1A 2XM1A 4K68A 2XSAA 1C92A 4AW7A 1BG9A 1UKQA 3VINA 4JHOA 2BNJA 3N13A 3CZ8A 3GNPA 1VFUA 1X1NA 1Q6DA 2JFEX 4UQCA 2ZUNA 4HU8A 1EQCA 3W25A 3VDBA 3PZMA 2WCSA 1SFSA 3FHAA 2DIEA 3B9AA 4F9DA 1JYXA 4PEEA 2WYSA 3VIOA 4CN6A 1BLIA 1KCLA 5D8WA 4YHEA 1B9ZA 3U57A 2A3AA 4Q22A 3MO4A 3KL0A 1TA3A 2WMKA 3AIUA 4MADA 3ZT6A 3VD5A 1MVYA 2NW0A 3VNYA 1LG1A 5LA1A 2WXDM 1J0YA 4QLKA 3S2CA 1GZJA 4BCEA 4PMYA 3SUSA 1J0JA 4OKDA 1CGXA 5GPRA 2D2OA 3GBDA 1CXKA 3RM9A 3AICA 1W91A 3BSHA 1UKPA 1NOUA 1O7AA 1ITCA 4PTVA 1QI4A 3FN9A 2WLZA 4LX4A 4P8UA 1W9VA 4LYQA 3RDKA 5JIWA 3BH4A 4AZIA 4AZ6A 2QHAA 2EQDA 1ODZA 1MWOA 3F4VA 5CGMA 3WL0A 6TAAA 1AMYA 3N18A 1J11A 4KRTA 1XH1A 3B9EA 5JBEA 2ZX5A 1ZU8A 2VX4A 3FXYA 3QR3A 5A6BA 2PI6A 3SUTA 4S3KA 1B1YA 1OBAA 4JKKA 1IZKA 2J62A 4XUYA 1WDRA 1AQHA 1UH4A 3PZGA 2ZXBA 4AD2A 3PZIA 3AIVA 1WKYA 3AOFA 4M1RA 3VDHA 4HOXA 4AZHA 3AMDA 1ISXA 3VVGA 5CQ1A 1XSJA 4PRWA 4F79A 3A3HA 2YBUA 2W67A 3OA5A 9CGTA 3EDJA 2BV9A 4R5EA 4AY1A 3II1A 3T08A 3QGVA 4GQRA 1HIZA 5F7UA 4XZWA 1E6RA 4W8AA 1NWSA 1E0WA 1ESWA 1FP8A 3NSNA 5CZKA 3NYDA 1H11A 3WUFA 1D7FA 3ZQ9A 3OLEA 1UR4A 1UD2A 5CJ5A 5HXMA 4DM2A 1JGIA 1TE1A 1TR1A 5ABFB 5LA0A 3AXXA 3W26A 4XX6A 2JEPA 2J7BA 2JF7A 4AZBA 1E40A 2W4XA 3UESA 1MW0A 3BC9A 1CENA 1E6NA 4AZ7A 1FP9A 5C71A 4DWSD 1UWSA 4MJ2A 1ISWA 2D20A 5A8OA 4UQEA 4QCFA 5CPSA 3VPLA 4J3SA 1W2VA 1UOKA 4JIEA 1PPIA 1QW8A 1ZL1A 3BGAA 3SURA 2DT0A 2XUCA 3LPGA 1DWFM 2WANA 2XVLA 1GOIA 3PZQA 5HOSA 1UWTA 2ZX9A 4X0NA 1B3VA 1BQCA 1E72M 4GIAA 1QPKA 4UOQA 2WMIA 3L4VA 4GI9A 4B3KA 3WNPA 1QNRA 2G3JA 2WHLA 3RIKA 4PMRA 2ZOXA 1DWHM 1K9FA 1DP0A 3MMWA 3EYPA 2E8ZA 2F2HA 2VCCA 1KQYA 4CD6A 3G6MA 1FH8A 3WD0A 1JF5A 5A6SA 4UR9A 3WEZA 3AI0A 1VFMA 3WD3A 5C8BB 3OBAA 2W61A 4MAVA 2EPOA 1WZKA 1J0ZA 3L4TA 3L4UA 3A4XA 4BQ3A 1H4PA 3UERA 3HJEA 4UQAA 1DTUA 2C0HA 3SUWA 3NUKA 1EOKA 2E8YA 1WP6A 3TTQA 2Y8VA 2F61A 1J0HA 1CGVA 4BZYA 1C3FA 1W32A 4Z2LA 2CITA 1PZ3A 4JFSA 3WQVA 1UG6A 1GOKA 1Q6GA 3OGVA 3WH5A 1OCQA 2VL4A 1O6IA 3QOKA 4KGJA 1NWTA 2CIPA 2GJPA 3MUIA 4LXFA 5HPOA 3CZGA 2YDSA 3FAWA 1VBRA 1EDTA 3AXIA 4B9ZA 2X0HA 1V3IA 2QMKA 2CBUA 5A3HA 1KFWA 4QLJA 3PZNA 2VOTA 4D6GA 2YL8A 4PUDA 2J74A 2G3MA 2OWXA 3VIHA 1B2YA 2UY4A 3CMGA 3QHNA 1CGYA 4E2OA 1XSKA 1PIGA 4OZOA 1UWQA 3W53A 4EANA 1KBKA 4GQQA 5LYRA 5ABGA 1HF6A 3OGRA 1HKIA 4M29A 1CEOA 4TOQA 2BVDA 2FGZA 2ZUTA 1GONA 3WF4A 2RGLA 2VO5A 2BXYA 5E09A 2XVGA 3BMWA 2CKRA 4NF7A 1LF1A 2OYLA 5M3WA 3PTQA 3IJ9A 1DEDA 3SCRA 1X6LA 3DYPA 2GK1A 4U2ZA 3KE0A 3VNZA 3LMYA 3CZLA 3NSMA 1ZBWA 3WD1A 4IM4A 3BCFA 1VJSA 3GZAA 3KZSA 1KBBA 2W66A 1W1TA 4QLLA 1WAWA 5BXSA 3VIKA 1EH9A 2FGLA 2EPMX 4MNKA 3QOMA 2VT0A 2DT2A 3ZSTA 2V38A 1KWGA 3NCOA 5CLWA 1JIBA 2XVKA 5AY7A 3UCQA 1ZBKA 3OZPA 4OOUA 3WNNA 3ZJKA 2D3NA 3WKZA 4ZENA 1JXJA 1W9DM 3FY1A 3L2LA 2W62A 3DC0A 3BAYA 5CLTA 4V2XA 4PTMA 4NZCA 1MFUA 2VURA 4ZFMA 2QLYA 1OT2A 1E1FA 1RD6A 5BWFA 4X0VA 1P6WA 1OGSA 2TAAA 3VD7A 1B3WA 3F5LA 1H3GA 4AEEA 3UG3A 2X1IA 1YQ2A 4PCSA 2B31A 4RL3A 3EDEA 4E8DA 1VAHA 4JL1A 1PX8A 1E56A 2EO7A 2J7FA 4BA0A 4OJYA 1AVAA 1UQYA 1FH7A 1UR1A 4NRSA 4KH2A 3PZ9A 1UKOA 1BPLB 2Y5EA 5GNXA 1QBBA 2DGAA 2GVYA 4PMUA 1W1YA 1NWRA 3BAXA 1U33A 2VUYA 4OBRA 4Z2HA 8A3HA 5A6MA 3WDJA 1GQIA 3BLPX 4TUFA 1H09A 2X09A 5GQBA 3ALFA 2WKGA 1HP4A 3SUVA 1E4LA 2XPKA 1WDSA 1HVXA 3TA9A 3TTSA 3WY1A 2PWDA 1CXIA 2XIIA 3AISA 3CZKA 4HTYA 3M6DA 1MYRA 1MQQA 3OLDA 1QVBA 1QNSA 4HU0A 5ECUA 4U3CA 4BF7A 1E43A 3CUFA 1JYNA 4AZCB 4HZ6A 4P7QA 2WLYA 3L4ZA 2YL6A 3VIIA 1VJZA 1GCYA 1E1EA 3WSUA 2XGIA 2WSKA 2V3DA 2BY3A 2DEPA 5GNYA 4A3YA 4W88A 3T2PA 3ZM8A 4BS0A 5FKYA 2PC8A 1M7XA 3FNDA 5A8PA 1W1VA 1J9YA 4HOZA 1E4NA 3WN6A 3VD3A 2Y8KA 4TVDA 4X9YA 2QPUA 2ZX8A 3WF1A 5EFFA 3AHVA 2C8NA 3PBGA 1HJQA 1R87A 2X05A 4WIWA 4W86A 3DYOA 4UQBA 1WZMA 1UWUA 2VZOA 5AC4A 3MMDA 3WF2A 3BSGA 1TZ7A 1VFFA 1E6XM 4C7FA 3KWXA 4J3VA 2BS9A 1SYTA 3E1F1 1EGZA 1BGAA 1G01A 5A6LA 5BROA 1OINA 6A3HA 1UZ1A 3N11A 3POHA 3UETA 1TCMA 1B0IA 1Q6FA 4UCFA 3EDFA 2YJQA 3IAQA 2O9RA 2XFFA 4YPJA 2CNCA 1JZ2A 2WVVB 4HPGA 2BHZA 1V6VA 4M24A 3BCDA 3EMZA 2VR5A 1K9DA 3ZOAA 2XSBA 1CNVA 3WMSA 4NRRA 2V3GA 3B9DA 4J3UA 1C8XA 2XWEA 4EAMA 4P8WA 1ZBCA 1R86A 2EPKX 1C90A 1LL6A 3SCUA 1GOWA 1MXDA 1CLXA 2DSZA 1WZAA 4M81A 1I1XA 4RE4A 4DWSC 3WQWA 1SR0A 1J10A 2D1ZA 2EXOA 4W7UA 1DWGM 3RILA 2XFYA 3OIHA 1JL8A 2PBGA 1CGUA 2EJ1A 3LPPA 4PMQA 4W93A 4GZEA 2DH2A 4RE2A 1TVPA 3CHFA 2W91A 1B3ZA 1XGZA 1FHDA 4DWSA 1BYCA 4AZCA 4UFHA 1C93A 4QP0A 1EO7A 1H49A 1YHTA 1V3JA 4M8UA 3I3EA 4B3LA 4AZ5A 1BG4A 3WUBA 1LQ0A 2WW5A 1KXTA 2VRKA 3K4AA 5FIPA 2W5FA 1GPFA 3WNLA 1VENA 1JXKA 3VDAA 4FLOA 4IPLA 4AEFA 4CCDA 2ZWYA 1CXHA 2XVNA 3MUY1 2YDQA 4P7NA 4U3AA 2WVUA 4AWEA 3IJ7A 1B31A 3VMOA 3OGSA 4CKQA 3ARPA 1NOFA 1PJ9A 5E0FA 4HPHA 2VCBA 3WNOA 4FLRA 4BQ4A 1VEOA 5FOOA 1Q6CA 1H0GA 1SMAA 4PTWA 3QHOA 4PSRA 2BY1A 2WCAA 1HVQA 5AYIA 4HMEA 3A4AA 1WDQA 1ZBVA 1SMDA 3VIGA 1XH0A 1CXEA 1W3HA 2O92A 4W7WA 2J7DA 5A1AA 2ZUUA 1C7SA 1E6PA 1ITXA 2EBNA 2D24A 4D6IA 2VZTA 3FHQA 2VRQA 4J7RA 2E9MA 1V03A 3POCA 3T0DA 5A8MA 3ECQA 1ISYA 3CO4A 5A6JA 3RO8A 2WZIA 5CPQA 2EPLX 2GJRA 3MV11 3SCQA 3WIJA 2YOCA 3O6AA 2OYMA 4UOZA 1QOXA 5CSUA 2OLHA 1UD8A 4W8BA 1V3KA 4ML4A 3GH5A 4ACZA 3CHEA 1XHGA 1NP0A 2WHMA 2X8RA 4AD1A 2YA0A 4H8UA 1K9TA 3AMLA 4A3HA 3RPMA 2VCAA 5IFPA 1UD5A
chains in the Genus database with same CATH superfamily
2JIWA 1UB3A 2PAJA 2ZX6A 1ZY9A 2Q3OA 5I00A 4H9YA 4M1BA 3M6YA 1WBJA 2HS8A 4Y96A 5M03A 3KP0A 1TX2A 3LBMA 3ONBA 1Q4WA 1BGGA 3H70A 3OU8A 3BANA 3MANA 4I5XA 2PCEA 2VFDA 2WVTA 2BXVA 3LHYA 4A8NA 4DZIA 2BFGA 1GVIA 1TWIA 1UZ4A 2CLPA 3OVPA 1UQZA 3TH6A 5KEZA 4GZIA 3CU2A 2DFAA 4H6KA 4XAPA 3KXQA 1IXQA 1JD9A 4HU4A 2XHYA 2R82A 3M7SA 4G7EB 1E4IA 1OFBA 2CZEA 2YFOA 3DH7A 4PMJA 1GT8A 5FL1A 3VKCA 2RHGA 3LLDA 5TAOA 3TZFA 2G3FA 4AC7C 1QI0A 3W2NA 2E5CA 1JZ5A 4P5UA 4MFDA 1DPMA 2I57A 1GOMA 2GSJA 2BY0A 2BG5A 2I9EA 5BXRA 5D4YA 2GDQA 2NT1A 1IWBA 3GBEA 4DJFA 3FGCB 4EX4A 1F4HA 4Z1CA 2QMJA 1L2QA 1MDRA 1MNSA 1DWIM 3BUVA 3HPAA 4HNVA 5HK4A 1PDZA 3G3DA 3UR7A 1H2JA 4WXYA 4FXJA 2QUNA 1ZP4A 3PAOA 4JFVA 4QJ3B 1OWQA 1CZ1A 3M0HA 3LGDA 4CQAA 3FSTA 1EUNA 6ALDA 2ZBTA 1A47A 1REQB 3LXAA 4MNLA 5AC5A 1XCXA 4NJJA 4YHGA 2Q8ZA 7CGTA 4D8ZA 3VGDA 4R7OA 4DN1A 9XIAA 1U5VA 3WX7A 4K8EA 5LXEA 3E74A 3PPFA 5D9OA 1EIBA 1EB3A 3GR4A 3L23A 4GXPA 3TXVA 2GQ8A 4ZO9A 3XINA 4I8YA 3DEQA 4UFLA 3VABA 1UJQA 1ZSXA 4RE3A 3MS8A 4OBSA 3EOLA 4ONVA 2WWCA 3RJXA 3W7CA 1XBVA 4FNQA 2WC7A 7A3HA 4NSBA 3QBUA 2CCRA 3LM7A 3GVRA 4QIUA 4LU0A 3FCPA 1QUMA 1VFTA 2ON3A 3WLSA 1EYEA 3ONCA 1FTXA 4ATLA 2OT1A 3BAIA 3UY7A 1F61A 5AHLA 4H9UA 5F1VA 3WQ4A 3WFLA 2OEJA 4PSPA 3P8IA 3MMUA 2WSPA 2PGFA 4KRUA 4YVVA 3CHDA 1FVPA 3SQLA 5E1QA 2HVMA 1HJSA 1Q4NX 3BMVA 1OGBA 2PUZA 1DWAM 4HNNA 5A8NA 4MB3A 1E6ZA 2J4GA 3MKVA 4MUPA 2WJFA 1UWIA 4KCUA 1EZWA 2IW0A 2WSQA 1K8YA 4Y8FA 1R7AA 3UWEA 1HL9A 4JQ1A 3V35A 2O9TA 3UZZA 3SDOA 3STFA 1TPC1 1AW1A 1KXQA 1YMYA 3K46A 4MB4A 4HMCA 3AU6A 4RUBA 3H55A 3WQ5A 3WDQA 3UG4A 3MI2A 1IT8A 4YYFA 3UYCA 1JCJA 4GYFA 2ZXAA 3RMEA 1K6AA 1O12A 4LALA 1HXJA 2VGBA 1Q65A 2E5BA 1HNYA 1XYCA 2E6AA 3W6MA 4DUVA 1JAEA 4HJFA 1LT8A 2OQLA 3V75A 3WZ0E 1ZJIA 3HG5A 4W5UA 1GEQA 1T5AA 5E70A 7TIMA 3W22A 2Z25A 4A29A 2REQA 4IMCA 1KR1A 4AD0A 3A24A 2XFRA 3N04A 2FH8A 2FJUB 2WO5A 1VFOA 1W9PA 5HBFA 3U5UA 1UJPA 2C13A 2VFEA 4FP1A 3L2IA 1LCOA 3WQDA 4R85A 5I6SA 2J75A 3GH7A 3IWPA 1SO6A 2QAFA 1OZQA 2QJMA 3K30A 2OX4A 1EA9C 4OQVA 1HKJA 2WKJA 3V1PA 3CT7A 4M82A 3FYOA 2ZDRA 5DRIA 1LBLA 5JH2A 4NJKA 1GVSA 4RR4A 2PS2A 1OIFA 4HA4A 2WMJA 1J6OA 5JQ9A 4Y9NA 1DJZA 1NARA 1H41A 3JVAA 2BASA 5DY3A 5A2AA 2IKGA 2GOUA 3EKZA 5HA7A 3CLMA 2QCEA 4PN2A 4UCGA 2F38A 1XGDA 4PUUA 2E0PA 3EOOA 5AVNA 3MV01 1UASA 1O1HA 1V02A 4ZQNA 3QVQA 4JTQA 3CQ0A 3GXDA 4J3WA 2Y7GA 3RFAA 1Q6RA 3O6CA 2ZZ1A 2CFFA 6CGTA 4O4WA 3C0JA 4MB5A 1R5YA 4MNJA 2ONEA 4L7ZA 5C7VA 3PZTA 1SU5A 3ARTA 3VDGA 1HJWA 5BCAA 2I1OA 2PMQA 5I3DA 4O19A 3ZVHA 3UJFA 4CCEA 4LW7A 2OB3A 1TPB1 3W00A 4MB1A 4IPJA 3L12A 4B90A 2A3CA 4M19A 4FX7A 3W2KA 5CBBA 4ORMA 3VD4A 4GINA 4IIBA 3EKLA 4E38A 4GISA 3T2OA 2P0IA 3AS2A 2AAMA 4V27A 2OZ3A 1R2TA 4QX4A 5HDRA 3NPVA 1J5TA 5C6MA 2OT0A 4ZVJA 3VILA 3LMZA 4R27A 1M01A 1UH3A 4NP7A 4RCXA 2TRSA 3M5ZA 3T0AA 3VMNA 2C7FA 4JZ5A 1RAKA 3LX9A 3M44A 4MLJA 2CHOA 4JTUA 4DPPA 3KOZA 2XJ7A 1N8IA 4IFRA 1MQRA 4H7CA 1EQPA 1HP5A 4JCLA 3OODA 1OEPA 3HGRA 3LRMA 1XLGA 4Z1DA 4MY8A 4XWUA 3HV8A 3WF3A 3Q2DA 3L0NA 2Z28A 5I79A 1KQZA 3OEXA 3CUJA 1K7XA 2DT3A 3GM8A 4XIAA 4LS1A 4GMEA 2JKAA 4Z2GA 1QHOA 1TPWA 2EAWA 3R12A 1UP0A 1CPUA 2HV5A 1LTDA 4GYPC 4EPKA 4J3XA 1M7JA 4E2DA 3T09A 5G2HA 3PY2A 3RX4A 4CUCA 5D8ZA 3BLFA 2DZVA 3I7RA 1VQTA 4YTQA 1QK2A 4HOWA 3WBWA 2Q02A 4P7RA 4QISA 3ARUA 1DWJM 2ESCA 4DJEC 2XH4A 1V6TA 3BWWA 3VOCA 3W7EA 1UPMB 3UXLA 3TSBA 1AW2A 1XLEA 2B7QA 3SR7A 3FKRA 1T40A 3WLKX 3UPWA 4AD3A 4DJDD 1S2TA 5G1TA 3UG5A 4W84A 1CB2A 4JXCA 4ZO8A 5AN7A 2Y0FA 4A8LA 3UZJA 1E1CB 3GHRA 3GG1A 4J35A 4QTGA 1TRDA 2YL5A 4ZOAA 3DFOA 2P1FA 3PTKA 1M53A 2VNCA 3WF0A 4JTLA 5L6UA 1IXOA 5I2UA 2YYTA 3DI0A 1ITQA 4JTCA 1V08A 2PWVA 4ZCWA 3FV9A 4UTWC 1PIFA 2CKSA 1QNQA 3BTNA 3GFYA 1OYCA 1WE5A 1FWWA 1KGXA 1QJWA 3I3BA 5T91A 1NOWA 5HATA 2GGJA 3W24A 3BURA 1YKWA 3EBVA 1OFOA 3CZJA 3NO5A 3GR8A 1WYIA 5T26A 5CG0A 3T4CA 2B7PA 1KKOA 2JKEA 4MNMA 4P7OA 4ES4A 2YCLB 2E9BA 5E5CA 2H90A 3C2YA 4QROA 3TONA 1VEMA 2OLAA 1LJYA 3I7QA 3TMQA 3AIBA 1H7NA 1ZENA 3VNDA 3CYJA 3AZSA 4FLQA 3JR2A 1IQ8A 5HMEA 3TYAA 3VD9A 5HUOA 5D02A 2CLKA 4AZGA 2V81A 3MWAA 1VLIA 1JYWA 3RJYA 1HX0A 4UTHA 3K8MA 2Z1SA 4O53A 5I23A 4PTXA 1JD7A 2WBGA 3TYBA 4FEZA 5BRPA 3GU1A 2C3ZA 3DHUA 2C19A 2VX5A 3QW4B 4YCOA 3WEOA 4LEQA 1GW9A 1XKJA 2NXHA 3WQCA 3ABQA 3VCNA 1RCOB 3O2LA 1JPKA 4P61A 1NDZA 2CHRA 3OQ8A 1TELA 3OZOA 3PWIA 1AH3A 1JI1A 1RUSA 3K8LA 4C6PA 2E3ZA 3P5YA 4BFAA 4LCRA 3KDOA 3QPZA 4PB4A 2FZDA 2F8QA 2Z24A 3G5EA 4AHOA 2DSUA 1QPQA 2QUUA 4XK2A 3DERA 5EL1A 3WL1A 4AYGA 1DIKA 5E6ZA 1W9XA 3QY6A 4U10A 3KL3A 3IAPA 1RSCA 1NY1A 3EMCA 5F1UA 3N9SA 4BF9A 2XIBA 4H9ZA 4IX0A 2DQWA 4LAMA 4MDOA 3EX1A 1G9HA 4RNJA 1C8YA 4IMDA 1QBAA 3NPXA 2BOEX 2GDVA 4B2DA 7REQA 5I06A 1AD4A 3WQ8A 2BXZA 1ONEA 2HXUA 2CBVA 3M9YA 4J28A 1ONRA 1F5ZA 4NI8A 3QQ1A 4HNUA 1TV8A 5DCBA 3ANYA 4A4AA 1S5WA 1XDLA 4DAIA 4YCPA 5CBJA 1A5KC 1SW0A 2ZA2A 1G1YA 4JYFA 5CJNA 4GJIA 3PJXA 5M5DA 1R7OA 4JN8A 2GUYA 1GKQA 3GG8A 4M80A 2X1UA 4R53A 3NURA 3WH8A 3TTYA 3VM7A 1CTNA 2A6NA 2ZXDA 4QE4A 3LM3A 4XTDA 4GBUA 1U30A 1S5TA 3M0ZA 1ODUA 4MPKA 3VUPA 1FHVA 3CQKA 1CYGA 1S5NA 2WOQA 3PAJA 5D2VA 4D6HA 4JTIA 4PODA 1VKFA 4EP8C 4ZO6A 5H8UA 1M6JA 2WPBA 1QNPA 3DG6A 3NQAA 4FS9A 4L1XA 3WQPA 4XVEA 4B3ZA 1IWAA 1TJ0A 3BG3A 1PCKA 3EWDA 1W17A 1W5QA 3CAWA 3DX5A 1EZ2A 1GG1A 4B4HA 5DT5A 4JNMA 4E8GA 3CEPA 4YTTA 3RR4A 3WQEA 1ZHAA 2DT1A 1QTWA 2HISA 4H9XA 2RFGA 4GI4A 3TA6A 3H4GA 2PFHA 3TC7A 1V0KA 3NYZA 2G4FA 1H7OA 3R10A 2ICSA 4E0CA 4GNJA 5FD0A 3FAXA 3AQUA 1YBQB 4K36A 4TX6A 1UR2A 1H5VA 3AHTA 2YIHA 4FHAA 5FJUA 4C1NB 3PS7A 3ICJA 1HKWA 3S83A 1Q6EA 1XYZA 3N4FA 1QWGA 2W6RA 3J7HA 1TPFA 4DWSB 1E9IA 3GYCA 3CWHA 1C9DA 1E0TA 1E9LA 1XPYA 2OOFA 4GYJA 2RJGA 1GQLA 4H3DA 1MO0A 4XD4A 2Y4SA 3OYXA 3QZ6A 5K9CA 3F2CA 4V1YA 3IK2A 4NYYA 3L9CA 3U7VA 4YYCA 4XO7A 1OGGA 2DVUA 4JAWA 1LG2A 4C6EA 4PUKA 1KWKA 4EXBA 3N17A 1XFCA 2OWCA 3W1LA 2ABAA 3ME3A 3BQ6A 1OD0A 1F6YA 1GVQA 2J6VA 4F48A 1JQVA 2FHBA 3QV7A 2FH6A 4JL2A 1V02E 3SRFA 1KBLA 4H4IA 3WNKA 5EU9A 4W5ZA 3T0BA 3IJLA 1POJA 5A94A 2V5JA 5EFDA 4R34A 3SBFA 1XRVA 1QW9A 1EUAA 1QDSA 5BU9A 5FF0A 1QT1A 3YPIA 1Y7VA 2QV5A 1GG0A 3DC8A 4NAEA 4WVXA 4E5TA 3SCPA 1H60A 2OSWA 4CD5A 2NXIA 3SW6A 4HYRA 3M4HA 3WFZA 1XYBA 2ZA3A 5D30A 3M46A 1I75A 2VUNA 5BNKA 3PZUA 3SY5A 2J25A 4JNZA 3MKKA 1MW2A 3H24A 4ZEPA 3CBWA 3RRXA 2XM1A 1ECQA 1KFJA 4J40A 3W7IA 2XSAA 1C92A 4AW7A 4HNCA 1UKQA 3RXZA 1EGVA 3VINA 4QAIA 2QZRA 2R1PA 3IRSA 3N6HA 1OYAA 2F6XA 1RQEA 3N13A 3PTDA 3V4BA 4HNOA 4CQ9A 4MWAE 4UQCA 2GUUA 3AAMA 2ZUNA 3PUDA 2VFFA 3LUTA 1EQCA 2YBVA 3R58A 4XD5A 3TQPA 1SFSA 2DIEA 5D2WA 1R3VA 1BLIA 1XBYA 1ZUAX 1B9ZA 5KZDA 4DQWA 3KL0A 4FNTA 2WMKA 4MADA 3C2OA 4S3EA 3ZT6A 1F2JA 3VNYA 3SADA 1QO2A 1MUCA 5LA1A 5MKGA 3S2CA 1IR1A 1GZJA 2NLIA 4GIYA 4OKDA 1CGXA 5LIXX 3IJ6A 5AECA 1YXCA 2Y6ZA 2R24A 3FDKA 1IXPA 3DIPA 4QS5A 1W91A 1UKPA 1WOBA 3M0LA 4PTVA 3FN9A 4Q8PA 4N9CA 4AZIA 1TZZA 2OMAA 5CGMA 3GHTA 6TAAA 2FZBA 3N18A 2VELA 3UWWA 1JUEA 4IFKB 3B9EA 4RNHA 3QR3A 2GQAA 3SUTA 3HG2A 1KM2A 3T05A 5GVJA 1TJ2A 1EA0A 4RV8A 3KBMA 1YLVA 4CEUC 1UH4A 2Z2BA 5KINA 4UMAA 1XRFA 4M1RA 1YPIA 3IV3A 4LF1A 3SB0A 3VZXA 1G6CA 2F6UA 4XAYA 4GLEA 2IQDA 3TJXA 1VH7A 4LT9A 1AG1O 2P5NA 1SZEA 1HIZA 4W8AA 1NWSA 1OC7A 1E0WA 1ESWA 3W1TA 3NSNA 3WMLA 5CZKA 2F6KA 1SW7A 4ICNA 4M7SA 3ZWTA 1O4UA 1TE1A 1TR1A 5LA0A 1GTHA 1RA0A 2ACRA 3W26A 3OTRA 2ZE3A 4GWEA 2IPJA 5C9ZA 2J7BA 2JF7A 1XG4A 4DI8A 1Q2RA 2Z26A 2Z2UA 2BSLA 2W4XA 1DV7A 1FP9A 3GDRA 1XIDA 4M6QA 3R5EA 3CJPA 4DWSD 3FLUA 4FSAA 2D20A 4AFYA 1KFEA 3PJUA 3SZ8A 4MWAD 5AHFA 4QCFA 5FAGA 5HULA 1FWHC 3URNA 1QW8A 1ZL1A 2Q3RA 4MFEA 1WDDA 1JEZA 3SURA 4ICMA 2DT0A 2XUCA 2ZA1A 4F2BA 2VKZG 2ZX9A 4X0NA 1BQCA 3R2GA 3IRDA 3WQOA 3GU2A 1OADA 2WMIA 4ZQOA 2EHHA 2G3JA 2WHLA 3RIKA 1XLAA 1NFBA 1XW8A 4NNAA 1S38A 2R94A 4CD6A 3G6MA 1I2PA 3U9IA 4DLFA 3LK6A 3WD0A 4LAUA 1VFLA 1JF5A 2PDGA 3W7HA 2YB1A 3CL8A 3L4UA 4BQ3A 3UERA 2NSOA 1YNPA 3HJEA 3SUWA 3VOFA 1GJPA 2DORA 3TTQA 2X1SA 5EMKA 3W07A 1LBFA 4JFSA 3FFSA 1UG6A 1XXXA 3ZR4A 3SFWA 1O6IA 4TV6A 2V8ZA 3MUXA 2C0AA 4NASA 1PTAA 3GRIA 5HPOA 3RX2A 4QNWA 5DLCA 3FAWA 4B9ZA 2X0HA 1V3IA 1MUMA 3W7NA 3QY8A 4JHMA 1D7KA 1A4LA 3MCOA 4XZHA 1KFWA 4FOJA 3PZNA 4JGDA 4PUDA 1G4PA 1B2YA 3CMGA 4FB7A 1XSKA 4OZOA 1ME8A 3EWBX 1TTQA 1UWQA 4X63A 1KBKA 3TFXA 8TIMA 4YXGA 1CEOA 1KTNA 3DKJA 3UR5A 3NVTA 4ZFCA 3FYYA 2PDBA 3F4WA 1F9CA 2WNZA 2BXYA 5I3JA 5E09A 1OFAA 2EKCA 2XVGA 1YRRA 3DFNA 1YE4A 3GD6A 2YCEA 2OYLA 2VEGA 5M3WA 1I6NA 1U83A 3U3HA 2VEFA 3B4YA 3N2MA 3WLHA 1W1IE 4NAFA 1V4YA 3NSMA 4F0HA 3GXPA 2J9ZA 4IM4A 3H2MA 4DELA 1A80A 2VP8A 2XINA 4H00A 1F73A 2DZSA 3GS6A 4HZMA 5BXSA 1EH9A 3OVQA 2X0SA 3S9ZA 2V38A 1JIBA 3UCQA 4Q8OA 1AK5A 4OOUA 3WNNA 2FDSA 5C9UA 4O0KA 3H2NA 1RV8A 3MWCA 4MF4A 3FY1A 1SR9A 4O14A 3HMJG 4GJ1A 3T8QA 3LB0A 3BQ5A 1TREA 3IEBA 5CLTA 4PTMA 4NZCA 2VURA 4LVAA 1XI3A 4XUGA 1E1FA 4JPGA 4JQAA 1P6WA 3GFXA 3M64A 3W3OA 3F5LA 4AEEA 1BXBA 2VEMA 2F7FA 3F4CA 3W71A 2PRHA 1E56A 4PA8A 2O7QA 1FH7A 1XYAA 3TIMA 3B97A 5A6TC 1UKOA 5GNXA 3NL2A 1IE7C 3G0UA 3G18A 2I5QA 4XBSA 1SFJA 1OX4B 2BWGA 4S2BA 1FWTA 3WJZA 3BAXA 1NF7A 1U33A 2VUYA 4HJWA 4AF0A 3IJQA 1ICPA 4GC4A 5AHMA 3SJNA 3BLPX 4C6IA 3ITCA 1XIIA 3ALFA 1HP4A 1E4LA 4JTHA 1WDSA 3LHVA 5DBUA 5CPNA 1CXIA 2XIIA 1VIZA 4PRRA 1QVBA 1QNSA 1XLHA 2OODA 3CUFA 2YFNA 1JYNA 2O4MA 4P7QA 3M5YA 1TSIA 4TX9A 2YL6A 3VIIA 1GCYA 3WSUA 4H2HA 3UG8A 4GQGA 2BY3A 4KQNA 2AQVA 4A3YA 4W88A 3SQMA 1XRTA 5FKYA 3R8GA 2DV0A 1M7XA 3BV7A 2ZKMX 3O8AA 3FJ4A 3HB9A 1E4NA 1VYRA 4X9YA 3NO3A 5C5YA 2FTYA 1A50A 1FWBC 5EFFA 3AHVA 5I02A 1HJQA 2ODOA 4WIWA 4JIQA 3U6WA 4BF5A 1V5XA 2P76A 4UQBA 2GGIA 1UWUA 2BB0A 4B4FA 3GIQA 3BSGA 2KZHA 1W5PA 3RK8A 2FB3A 2ZRZA 3EXSA 4FNPA 3KHDA 4J3VA 3CHVA 4FALA 4GACA 2BTMA 1SJDA 5A6LA 1OINA 4LS2A 1UZ1A 1VCGA 3UETA 3VNJA 3IVUA 4XSLA 3Q58A 3IAQA 2O7SA 4CQBA 2CNCA 4HPGA 1ZLPA 3P67A 3E5BA 4DF2A 3BCDA 2VR5A 4DAFA 2RKXA 3GG0A 3WMSA 3UVAA 4J3UA 4G9PA 2XWEA 1ZBCA 2OZTA 4PFMA 4Q8UA 2H6RA 2P53A 2HS6A 5IDZA 3FSUA 1LL6A 4IJBA 4RV3A 1R30A 1CLXA 1JPIA 1Q6QA 2PP1A 3NG3A 5DN1A 4C6BA 2ZZ4A 3M1ZA 4I90A 3GDTA 2OO0A 5AHEA 2EXOA 4H9VA 3HQNA 3MCMA 1CGUA 1Q8AA 4W93A 3AU2A 1FWIC 3IIVA 5AYYA 4WCJA 1BVWA 1BYCA 3UJEA 2DZBA 3LOTA 3KRBA 4F40A 3QQ0A 2ZRWA 1RALA 1J8VA 3A3WA 3TCSA 1UIPA 2PDNA 4IPLA 4CCDA 2ZWYA 3WLLA 2XVNA 4J5NA 3MUY1 1KRBC 4P7NA 1TIMA 4E2BA 4U3AA 2VFHA 4CKQA 4J2MA 3S5SA 2GVGA 3LD5A 2VCBA 4AXKA 3NQ7A 1P0BA 3WNOA 4BQ4A 4DO6A 3UT0A 2YZ5A 5JH1A 1SMAA 1BF6A 3PUGA 2J6XA 1WDQA 1W0MA 1XH0A 1O1ZA 1ICQA 4W7WA 1AODA 4FNUA 2ZUUA 1E6PA 1N8WA 2NX1A 1G67A 4IGSA 3UA4A 3W7OA 2VRQA 1OCNA 2E9MA 3T0DA 4WSHA 2GJLA 4O18A 3GX9A 3W1NA 2WZIA 3NO1A 4JQ3A 4XIMA 2GJRA 5FJTA 4ZR8A 3LTPA 2GSHA 2XU2A 1JCYA 4LFYA 2OGJA 5HNTA 1TWDA 2OLHA 1UD8A 1SGJA 1EX5A 1V3KA 4ML4A 3GH5A 1FCUA 3QLLA 4LS0A 4B5UA 2X8RA 1TKKA 1QCWA 4Z17A 3PUEA 3FVDA 3GB6A 4QRNA 4H8UA 4N7QA 5RUBA 2H3BA 5IHSA 4FOKA 3WBAA 4Q4KA 6REQB 2CYGA 1SQ7A 4O15A 2Z1XA 5XIMA 1DKWA 2PDUA 3TU9A 4IISA 2L5HA 4CD8A 4L1GA 3R25A 1JPHA 1NQKA 1JCXA 1JDAA 4GABA 2VVSA 1QXLA 4RNIA 3QQWA 2VR4A 3ZMRA 2P88A 1TIWA 3RPDA 1S2WA 3R4IA 3TV8A 1U1JA 4JIIX 4IP5A 3T0TA 2XH7A 3S2MA 2VQUA 5KZEA 4GQBA 1P48A 2W0UA 1CXLA 4GI6A 3G1YA 4UFJA 1D8WA 4EACA 1GQKA 4Y90A 4I3GA 2G4JA 4ROPA 3G8RA 4PUWA 1JJKA 2X2GA 4PH6A 3GO2A 3FKKA 5IXEA 5TNVA 2PGRA 2QV4A 5F4SA 1FWDC 4GRSA 1KBIA 2A3EA 2NXGA 4H04A 2FPVA 4LVBA 4F9JA 1LBMA 3S5YA 3VM5A 1FXPA 3U5YA 1XLIA 1E15A 3GSMA 1KR0A 1LWHA 3ZSSA 5MHBA 1RQBA 1DJHA 4B16A 1OCJA 2J78A 1ZJHA 2W9MA 1PV8A 4GZ7A 3ZFHA 5C2GA 1UWAA 4D6EA 1BVZA 1B3XA 3CYVA 3UR8A 5M1TA 4X9SA 4F8XA 5FCZA 3PG9A 4YLWA 1VIWA 1DJXA 1M41A 1Z8AA 1EXPA 4WDXA 1GJUA 4AWSA 2IXUA 4UNIA 1OM0A 1W56A 3S0CA 3PN8A 2HTMA 4DJED 4LYRA 2QGYA 4IOTA 3D47A 1JCLA 4Q8NA 1X1OA 4JX6A 4MPQA 1HJVA 4PUMA 2QIWA 1TB3A 3CV7A 4NXKA 4QHRA 3NA8A 3R11A 2JQXA 5M2FX 4DUWA 1DORA 4LGXA 5DEZA 4OIFA 4FIQA 2REQB 3LDVA 4WKAA 2OYKA 1QATA 3IVTA 1YNYA 3BOXA 1RJRA 4CNNA 4MKVA 3MPGA 4LSBA 3R6IA 3SCNA 1X38A 5K9XA 1V8EA 2QCFA 3U2ZA 3V5FA 4DO7A 5BMXA 1M04A 4JX5A 1DQXA 3M16A 3OZYA 1U22A 2G41A 5D9MA 1BAGA 4IQEA 1WPCA 3ZJ8A 3TAOA 2GVJA 3IJ8A 1YDYA 4JQ2A 5KZ6A 3BSMA 2IKHA 3QF0A 5CEWA 1PX3A 3W2MA 3LXCA 4X61A 1J79A 3N12A 5EBAA 1PIIA 2VX6A 3W02A 1R3SA 3L68A 4XTIA 3WELA 3D0CA 3WEMA 2FIQA 1ZPTA 5LNSA 2PZNA 2OG9A 2VOMA 4IH3A 1RBLA 3EWZA 5D05A 4Q32A 3BGJA 1UW9A 4E3VA 3FXGA 3I4KA 1XINA 1UR0A 2OU4A 3LPFA 4WJEA 1JNDA 1ONXA 3TN6A 3CUGA 1MI3A 1KXHA 5BU6A 4JHZA 3RU8X 4PYSA 2J7HA 1J18A 1R38A 4A8IA 2WZMA 4AMCA 2WAGA 2PCQA 2GLKA 3U2OA 1RK5A 5I07A 3OBEA 2HRWA 4JTJA 1LROA 3KWSA 5B7YA 1XLLA 2AGKA 1KC7A 2PRMA 3M0YA 1DOSA 3APTA 3VNLA 1H0IA 3DGBA 2G8ZA 1NU5A 3EGJA 1XIBA 3VXGA 3NQVA 5HR6A 3BL3A 3B06A 3H12A 1R8LA 4Y7EA 4AWTA 3UW6A 2QT3A 1YIXA 4CU8A 3O05A 4Q4MA 3KBSA 4AC1X 5G2IA 3DI1A 3O63A 1XSIA 2FDMA 2WCGA 3DG3A 1AL7A 3G1HA 3Q65A 5H91A 4Z42C 4F4RA 3OJGA 3UWZA 3CXOA 2VC7A 5D9NA 2POZA 1ENUA 3UD6A 1EP2A 4B5XA 3KUMA 5E9AA 3IV8A 1TA3B 1EC9A 4DB7A 5EMLA 2RJHA 2Q09A 4O1FA 1KM4A 4TXEA 2ISDA 1FDJA 2E7FA 4WXZA 3C5QA 1TTIA 2PLCA 3A64A 2Z4GA 1DL3A 3VIPA 3G1VA 5A5WA 1KCXA 3OBKA 1VBUA 3LHTA 2W79A 4RNFA 3EWWA 2Y24A 4KESA 1OJXA 4P8VA 3B0XA 2Z2AA 3GYEA 4XAFA 1ZB5A 1L6GA 1QASA 3HPZA 3GXFA 1F3XA 3ATZA 3NQ8A 4WF7A 3S6OA 4XAZA 3MZNA 3R0KA 1XD0A 4QCEA 4P7LA 1JF6A 4S3GA 1M9HA 5CZ0A 3MUCA 2NQZA 3N73A 4UNKA 4BK9A 4KERA 2ZTKA 4GKLA 1EXBA 1YTKA 2EPNA 4H9TA 2CPUA 1Z41A 4D6CA 3VAVA 4JKMA 2OR2A 5KSWA 5AFDA 3G2GA 1HKMA 1O60A 4IPIA 2J79A 1VEPA 2X0YA 4H1ZA 2WZEA 1GHSA 1VLWA 1GYMA 3AFBA 4XKYA 5CSYA 4DHGA 1JDEA 5C70A 4K1GA 1BVNP 3CTTA 3RRAA 4K1WA 3QGAC 1W1ZA 5EBUA 1GYLA 1K8CA 1NH6A 1OC6A 2GWGA 3DAQA 3AXHA 3HPFA 1GOXA 5AYXA 1DHPA 3RR1A 4S39A 1EX1A 2DH3A 4MDPA 2PE4A 4ATDA 1YADA 1OC5A 1M7OA 1IXNA 2W92A 4BQ5A 1KTCA 2J8TA 1UR9A 3W6LA 3WO8A 1FWCC 4HN8A 2CESA 2Y85A 3CC1A 1EKOA 3KOXA 3PP7A 3N6QA 4CU6A 2QDEA 1FUYA 1WKDA 1CW2A 1EPVA 3AMKA 3W7LA 1R9YA 3AZTA 3M0JA 4IL0A 1X98A 1TQJA 3DU0A 5A8GA 5CC7A 2CHNA 4FXRA 4LUSA 1PE1A 1CBGA 3KOFA 4Q7NA 3C86A 2YLLA 1UP3A 4O1CA 1GZ1A 3KRUA 3ITTA 4GX8A 4PMOA 1I8JA 1ZP3A 2WWDA 2X7VA 1BYDA 1V6YA 3EOSA 2WK2A 1YXDA 2UY5A 3MY9A 1MDLA 1EJTC 4WZHA 1G5AA 2PTXA 2Z1KA 3NQMA 4R88A 1MZRA 4WSKA 3QMSA 4HTBA 2XM2A 4FLSA 1WXJA 2OCZA 5HNNA 5BXTA 4OT7A 4ERIA 5HAOA 3WBYA 4YS1A 3M0IA 1IGWA 1M3UA 1V77A 3WLNA 5LZLA 4A3UA 3GTFA 2CERA 2H8ZA 2OPJA 4D8LA 4NZ3A 4EWND 1KCKA 1VBJA 2D0GA 4PTDA 3G1XA 3I6EA 4PCTA 4B15A 1A3HA 3XISA 4GO8A 5CAKA 3RITA 2XZ9A 3K8KA 3E3HA 3ARWA 3KLLA 2WSYA 3H2OA 3KZPA 4LUTA 2E68A 1L6SA 2NVAA 3ZT7A 3ZO9A 3KTXA 3W87A 1X8FA 2ZWZA 5LNUA 4NZ5A 1PAMA 1UMLA 4MM1A 2WKLA 4U33A 1EFZA 2PWUA 2XGZA 1W2PA 4W9TA 1K4HA 1DQUA 2FZ8A 1L8PA 2DSWA 4DO5A 1KCZA 2HEJA 4LAOA 3ABRA 1F3TA 2V5CA 4HSOA 1KXVA 5CC5A 4A2RA 1NVMA 2YA1A 3SUUA 2VQTA 1BTMA 1N8FA 3GXTA 2WHKA 4Q7IA 3JZUA 5DO8A 1LOLA 1EHNA 1RJQA 4MGGA 1XLFA 3HOJA 3THDA 1E70M 1GQNA 1TV5A 2A7PA 4FIRA 4UTTC 2ZC1A 1N7KA 4KWUA 1HQTA 3WLMA 1PDYA 3STPA 3P60A 3AYRA 2V67A 4WY0F 4HP5A 3UCDA 4M56A 1E0UA 1RH9A 2HK1A 5A6BD 1S39A 1LL7A 4BHYA 4TMCA 1JRBA 2P0OA 3KOYA 1XG3A 4F2TA 4PGLA 1JI2A 3KVLA 2WM0A 2ZC8A 1EWDA 2GQ9A 1OD8A 3B9OA 1YTDA 2V2CA 1SW3A 1RY8A 4NI3A 4ZQMA 4ZE5A 3MP5A 4CQDA 2VGIA 4FMVA 3R0DA 1G0CA 3EZ4A 5MF5A 1FOBA 5BWAA 3W7GA 1BRLA 5D9PA 4D1JA 4GVFA 4Z2KA 4H2CA 3EPOA 2O9OA 4I7VA 2CWNA 3AS3A 2PDFA 4EOUA 4Z2JA 4V33A 1CLVA 3LN3A 2PWEA 1W1B1 4LNCA 3GNNA 1J4EA 1T8XA 4L65A 4DXXA 4WY0B 2CLEA 3S1UA 3WLJA 4HNTA 3GE7A 1C29A 3EB3A 2DVTA 2ZE0A 4B5WA 4DF0A 4GBDA 1PWLA 2JBMA 4GA8A 5CSRA 1WXZA 4G7EA 1YPXA 3BICA 5CZJA 1KB3A 1L8NA 2VI0A 3WMBA 1XFBA 2PWFA 3DYMA 4GUGA 4GVHA 1QOQA 3L7RA 3QPEA 3CPGA 3A9IA 3WQ6A 3RPTA 1K1DA 1U5JA 5BZAA 1LWIA 4I6VA 3OVGA 2CEQA 4GH1A 2NT0A 4A6GA 2RDTA 3AHZA 1VS1A 4UFKA 2C16A 3U48A 2V5BA 3P61A 4GUHA 1MZHA 3MHUA 4RDVA 3HURA 1KNWA 4CNPA 4WJXA 1X1ZA 1PSCA 1A0EA 4BR1A 3UZ5A 2AL2B 3R43A 1WZLA 3WG6A 5AHIA 4XKMA 2XGBA 4IUGA 5I24A 3PR2A 4DM1A 3G1AA 3BG5A 1X6UA 1CIUA 2J7CA 4DX3A 3IK4A 2QJJA 1TV3A 4Q6XA 3ITYA 3P14A 2JE8A 3GNRA 3HIJA 4NJGA 1S2CA 3T2QA 3LCGA 3WK3A 1B9BA 1Q7MA 2HBVA 3H2AA 1ISZA 1IWPA 3GXIA 4FF5A 3LQGA 3SGGA 1EDGA 4OBTA 4QNEA 4DWDA 1H1NA 4LC6A 2D0HA 4XISA 1TG7A 4NG3A 3VC6A 2HE5A 2AOSA 4HMDA 2GVEA 3L66A 4HA3A 2R9RA 5HWNA 4TR9A 1K7EA 2PODA 3FJ6A 1VP5A 2WMGA 3L4XA 2BGQA 1OK4A 4POCA 4JX4A 1G94A 2B0MA 5T9BG 5A69A 1DIEA 2J8FA 2P8CA 5A2CA 4L5ZA 1S1RA 3DBNA 5I0DA 5HPCA 3N3TA 1ISVA 3WK0A 4E8CA 5DF0A 4O52A 5I7GA 3BCJA 4AD4A 1JFHA 3O9NA 1TRIA 3P62A 2WMHA 1M03A 2H9AB 1UR8A 2PZ0A 1C91A 2Q71A 3C52A 4Q4QA 1OX6A 4L9YA 3ABOA 1E0VA 4WKHA 4B5VA 1EOMA 1S46A 4HB7A 3W1XA 4MAZA 1PCWA 4OECA 5K3VA 2QPSA 3TX9A 3VU2A 4KKXA 2PWGA 2NLYA 1ZJBA 4QAWA 3NNTA 3TKFA 4LCQA 1DE5A 3MUAA 2H8XA 4HCLA 1W3LA 1IV8A 3TZNA 5CGTA 3MQTA 1V3MA 2WVSA 1H7RA 1QNOA 4ZOBA 4J3ZA 4HN4A 3S6TA 5FF7A 1XLCA 3ARQA 4GUIA 4JDBA 1JAKA 5I03A 2OKTA 4JTRA 4CNTA 3W81A 4GE8A 3V7PA 3GDKA 4IIHA 3TTEA 2Y88A 3G8EA 1E55A 3N1AA 4ZO7A 2QF7A 3RM8A 3L2MA 2OWWA 4UQDA 3B8VA 1OF8A 2Y2WA 3MHGA 3QMTA 3U2CA 2BGNE 2AAAA 4KMQA 4XSMA 1K3UA 3OB8A 4DJDA 1BKSA 1G4TA 1EJXC 1P0NA 1EEPA 4YN5A 2NUXA 3EMQA 4LJ3A 3SY1A 4ACZB 1KM0A 3WFAA 5AB3A 1R85A 3FYPA 3FVMA 1DIOA 1O68A 1CLKA 2YXGA 4JN6A 3A3XA 3IJIA 4UTIA 4DBDA 3LHUA 1A3WA 3CZ8A 1UROA 3SJ3A 4H83A 1AL8A 1P1XA 1F3WA 4ZQCA 4YL2A 2WCSA 3B9AA 5D09A 4CN6A 8XIAA 2VFIA 1UMYA 2A3AA 3MO4A 3GK0A 4S3BA 5D2TA 1TV4A 4N9BA 2WXDM 1J0YA 4LY8A 4QLKA 5LNWA 4A21A 3SUSA 5FF2A 3EA2A 5F2GA 5GPRA 3GBDA 4XD3A 3TCEA 1NOUA 1IEIA 1ITCA 1TJ1A 2Y1HA 5DBTA 1XLDA 1W9VA 4AZ6A 2QHAA 2EQDA 1ODZA 1MWOA 1UZDA 2I56A 4GY7A 2BGSA 3AWNA 1AMYA 4B5NA 1J11A 1FWNA 4RW5A 4QJ1A 3E0WA 3FXYA 1D3HA 4JKKA 2FKPA 3GVVA 2X30A 3LTYA 4L9ZA 2FPTA 1RPXA 5AHNA 4QXIA 4QR6A 2AQWA 1EEXA 1WV2A 3VDHA 4AZHA 1KA9F 4US5D 2FTWA 4RZBA 5CQ1A 4PRWA 4F79A 5REQB 3A3HA 2BOFX 2YBUA 3OA5A 3BPWA 1PTDA 4AY1A 2DIKA 1OYBA 3T08A 3QGVA 4GQRA 4E4UA 1TMHA 1FP8A 4RJEA 4LV4A 3OLEA 3TEVA 1UBPC 3PPGA 4PFHA 4GGBA 2OXNA 4DM2A 1JGIA 4IFOA 5ABFB 4AVOA 4NZ4A 3QM3A 1B3OA 2DJLA 3HG3A 2JEPA 4HYVA 3NTYA 4GKTA 4E2VA 1FY6A 4LOCA 6XIAA 1E40A 3UESA 3U8GA 1CENA 2MNRA 2YGYA 4C6FA 4EPEC 5C71A 1EC8A 1GZGA 5A8OA 1JUBA 4LV9A 3TVAA 1FBAA 1DXIA 1KBJA 4O13A 1X7IA 1NF0A 4GJJA 1UOKA 2WZTA 3O7UA 4Q8VA 4JIEA 1PPIA 1Q7ZA 4JNYA 3BGAA 4I6KA 3R13A 4KBXA 4J4KA 2P8BA 5CZTA 2XVLA 3NFUA 3PZQA 4KETA 5HOSA 1UWTA 1B3VA 2ANUA 1TYGA 4S2CA 4AH7A 4L1WA 4UOQA 4UTUA 3L4VA 1NAL1 3WNPA 1QNRA 4PMRA 3QZEA 2ZOXA 3C61A 3V5OA 3G1RA 2XIMA 1X39A 4RZ6A 3MMWA 1Y5WA 2E8ZA 4E3TA 2VCCA 1KQYA 4I5UA 5CPMA 3KTCA 1JRCA 4JTFA 4JOMA 4LYKA 5A6SA 1FQ0A 2EPHA 3WEZA 1QMLA 5C8BB 2W61A 1YXYA 2C14A 4O8RA 3S1XA 1J0ZA 2QW5A 3A4XA 3N14A 3KLKA 2C0HA 3MSYA 4LWWA 2QKFA 4EIVA 1H1ZA 4BI5A 2F61A 4R9XA 5FSDC 4BZYA 3PB2A 1GVOA 2QCDB 4Z2LA 2ALDA 1GOKA 4PR4A 2VL4A 4JBRA 5GJNA 3DFPA 3QOKA 1E1CA 2CC0A 1TPH1 3CZGA 3PNZA 5PTDA 4K8HA 1VBRA 1EDTA 3EB4A 3EWYA 4YTRA 4DYJA 2CBUA 4IHCA 2G96A 3TQ0A 3GHUA 2QUVA 2VOTA 3BARA 4D6GA 4UTLA 2PP0A 4CNOA 2BVWA 2G3MA 3QHNA 4JTSA 3QRHA 4E2OA 1XBZA 2YXXA 2D69A 4GQQA 5LYRA 1O94A 4AG0A 1HF6A 3C2FA 3Q37A 3DENA 4TOQA 4HD5A 4ZB2A 3G3MA 4M6PA 3PJWA 1GONA 2RGLA 2B4GA 1K6WA 2XZ7A 1NELA 2CKRA 4NF7A 3PTQA 3B03A 1X6LA 1FRBA 2YCLA 3K13A 4S3AA 3BE7A 1J2BA 4HHPA 3CZLA 4LRSA 1DJWA 5DXYA 3W7RA 2PD5A 1VJSA 3OVRA 4X2RA 3STEA 3GZAA 3KZSA 2W66A 2NV2A 1WAWA 1JUKA 2FGLA 2PU0A 4MNKA 3S5ZA 2ZFAA 3CQHA 2DT2A 2VDGA 4C1KA 3NCOA 1DIDA 5CLWA 2XVKA 5AY7A 1ZBKA 3W83A 2NV1A 3WKZA 1A5CA 2NQ9A 1EF3A 4AEOA 3AUOA 1W9DM 4ZTXA 1ZQ5A 1A53A 1GVFA 2W62A 3DC0A 4JTEA 1EF2A 3QJAA 3DZ1A 3QC3A 3E6EA 4V2XA 3GU9A 4ZFMA 2QLYA 2A3LA 3UBPC 4IIDA 5BWFA 4X0VA 5CG7A 1IZCA 4JQ4A 1NDYA 3UG3A 1X96A 4O4VA 4PCSA 3I7SA 1MRQA 3LXBA 1RXOB 4GYKA 4BA0A 1I0DA 1AVAA 3LENA 4OJYA 1RZMA 4TO8A 1BPLB 4K8GA 2Y5EA 4G56A 2DGAA 1UUMA 2GVYA 4PMUA 5DMMA 1AD1A 2W27A 1I4NA 3AALA 5D03A 3PPHA 4OBRA 4Z2HA 5KITA 2PTDA 3WDJA 5GQBA 3KDNA 2WKGA 5IBXA 1HVXA 4K39A 3ZWSA 4S3FA 3WK2A 2PWDA 1L6WA 3CT2A 3AISA 1TPDA 1Q7QA 2TYSA 5K2ZA 4DXVA 3KVKA 4HU0A 5ECUA 2FJKA 1IYXA 3EA3A 1XPGA 4U3CA 2QEZA 1IF2A 3HQPA 3T44A 3UWVA 4DF1A 2WLYA 1KFBA 2ACSA 3BG9A 1G4EA 2WSKA 4O1AA 2DEPA 3B8DA 5GNYA 3VC5A 1IIGA 5LIWX 3ZLFA 3O0FA 1Z44A 3M0VA 3IGUA 1W1VA 4HOZA 3WN6A 1H1YA 2V63A 1LUCA 3F2BA 5HJYA 5HQMA 2C8NA 1C8VA 3PBGA 1R87A 3A13A 3FX4A 2YX0A 1RQHA 4W86A 3TYZA 3LZ3A 1WZMA 3NR0A 4MKSA 3QV6A 3QSRA 1P0DA 4AX6A 3E38A 5HJXA 2C18A 1VFFA 4Y9MA 3S2NA 3SI9A 1E6XM 5T8GA 3KWXA 2G0WA 3KW3A 3T78A 1EGZA 1BGAA 4ZTYA 4GC3A 3EAUA 2Z0IA 4WGXA 1B0IA 2HXTA 3BVJA 1Q6FA 4UCFA 1ADOA 1FWJC 3IARA 1MSSA 2YJQA 2O9RA 4PEKA 2XFFA 2YW3A 4Q33A 4YPJA 2WVVB 1TWSA 2IQ0A 2NVCA 4GQ0A 1V6VA 4M24A 3L67A 3EMZA 3RLGA 4KCWA 1K9DA 2XSBA 2ZZ3A 3PBUA 2FPYA 2O0TA 3E2QA 4QJ4B 3UQNA 4A3RA 4P8WA 1UP2A 1BEUA 2EPKX 3DFHA 2CU0A 4KF1A 3D3FA 2P10A 4I8DA 3SCUA 1GOWA 1AJ0A 4M81A 1VCFA 1RR2A 4IQLA 4FOUA 1B4KA 1SJAA 1Z3NA 5EY5A 2EJ1A 4PMQA 3H6OA 4GZEA 3S1VA 4RE2A 2PDXA 3WYZA 2W91A 3GKAA 3NQFA 1JCNA 4DWSA 2ISSA 3PG8A 1EBGA 5B80A 3TJ4A 1KFKA 4UFHA 4QP0A 2NWSA 3TJIA 4FX6M 4MWAA 1YHTA 4M8UA 3RU6A 3LLFA 4FPSA 1QRQA 3I3EA 2A1YA 4AZ5A 3WUBA 3K4AA 2W5FA 1GPFA 3WNLA 3C4UA 1JXKA 2E77A 4AEFA 1CXHA 1T8QA 2YDQA 2WVUA 3IJ7A 1B31A 3VMOA 3OGSA 1XUUA 3H22A 4O1DA 3ARPA 3W73A 4HPHA 1Q6LA 3LQLA 3A21A 1KFCA 4FLRA 1WKFA 2Z1VA 4NZFA 1FCQA 5FOOA 2OEMA 3CB8A 2JKPA 4PTWA 2ZZ6A 2BY1A 5AYIA 4HMEA 1I60A 1ZBVA 5AC8A 1PS9A 1W3HA 3G0XA 1EPXA 2GPTA 2GGGA 2A79A 5KETA 4RDYA 4Q4PA 2BOGX 4C90A 2VZTA 4J7RA 4IXXA 4HK6A 1V03A 2UBPC 3POCA 3GAKA 1TTJA 3ECQA 2HZGA 5ABTA 2DJXA 1OFRA 3URAA 3LLXA 5CPQA 2EPLX 2R1LA 3A22A 3WIJA 3OZMA 4UOZA 1XJBA 3G1SA 3SSZA 2IKJA 5D38A 4W8BA 2DZTA 3NXFA 1HW6A 1RK6A 2XISA 2H3DA 1HKVA 3CHEA 3S8HA 1XHGA 5E93A 3CUXA 3IS4A 4AD1A 2YPIA 3DFYA 3RHGA 2PDMA 3LI0A 2R14A 5H2ZA 1K9TA 3NPWA 2HQAA 2TSYA 3C2RA 4Z2IA 4H6QA 1PO9A 1GGOA 3COTA 1LOSA 4CGTA 3FOKA 2X2YA 4PMNA 1CCWB 2JF6A 3W7JA 2Z27A 2OLSA 1EBHA 4HK7A 1UIOA 3JZEA 4CVWA 2NQLA 3SIMA 1M65A 1OABA 3MDWA 2CLOA 5C9RA 3L65A 5HNRA 3SFKA 1C8QA 2QCNA 3SEPA 5JU6A 4QSFA 4C6OA 3GDBA 1V51A 3CHCA 5JUVA 4LEFA 1GOOA 1WKEA 4HQVA 3URQA 3LRLA 5EPDA 5TD4A 1BWLA 2QJNA 3ORWA 2WBKA 5DMNA 3NPUA 3VGFA 1OVDA 5DCDA 3EWUA 2HBXA 3W84A 2Y63A 3N3MA 4DNHA 4OUIA 4WGHA 1SSDA 3W74A 4Y9AA 2XYLA 2YSWA 3HTWA 4CEXC 3VMPA 1HO1A 2PDIA 3GLCA 4KPLA 4REQA 2V3EA 4TX8A 2DZUA 3FEMA 2WQPA 4DJFC 3W1UA 2XG9A 2ABBA 1SO5A 4IIFA 1V79A 3SN0A 3EPNA 3MUZ1 4RPQA 3HV9A 5T9CE 3A23A 1XYFA 1AJ2A 3S6DA 2QAPA 3MBFA 4MJMA 3VKKA 1UUQA 1R0MA 4JTGA 1ZS2A 3E96A 3LZ5A 4JFWA 1B3YA 4UTJA 2XN0A 4GY0A 4GO9A 5J8LA 1Z6KA 3ARXA 1R3QA 1GPWA 1J96A 1HTIA 3K1GA 2YZRA 4XZBA 3SCSA 1FFRA 3UZXA 2V3FA 4ZBCA 3EB2A 4MUZA 2J9YA 3TWBA 2DSKA 3DCPA 1T0OA 4JIPA 2WNWA 4KRZA 3H23A 3P2VA 2GJNA 2ZDSA 3UGVA 1JVNA 1LT7A 5M17A 2NQHA 1UD6A 4QGCA 2VYOA 1A5NC 3MU7A 3VE9A 1J01A 4KIEA 4CD4A 2DPEA 2DDXA 3NQBA 3TOPA 3M41A 3NSXA 4H41A 4Y6GA 2RDXA 2PRLA 4IQDA 3L0KA 2C1IA 3VIJA 3GW0A 4QS6A 5G4WA 1RVKA 3PBVA 4Z0SA 3MSRA 2CLIA 3RCYA 1FA2A 2IMRA 5K4ZA 2Y89A 4PCPA 5FL0A 1H5YA 3PSVA 5I3FA 2QXWA 4RZ4A 2DY3A 4JTTA 2VC9A 4O1EA 3VOJA 4JKLA 5ABHA 2GVLA 5CH9A 2CZVA 3SECA 2PDJA 4W4QA 4CN4A 1TVLA 3OHIA 2RUSA 1W3KA 4GH3A 5A2BA 3CMFA 4ALDA 3FIGA 4PL2A 2ASHA 3BZGA 3HG4A 2UWFA 4ICCX 4EE9A 2VGFA 1YTEA 4Y9OA 4PE8A 1K9EA 1RY0A 3BW3A 1CDGA 3HU7A 5AKQA 4DPQA 3A6OA 3W82A 3R8HA 1IHIA 1MNZA 1XCWA 1P7TB 2C1HA 1KM5A 2DZWA 3WLTA 4E4FA 3CWNA 2VHLA 3TLLA 2D22A 3QR0A 2E09A 3LSBA 3OHMB 1CGWA 3LERA 3KBNA 2UV8G 4JICA 1G4SA 3VZYA 1JPDX 4YJ5A 1UKSA 3ITGA 3NQCA 3TWAA 3EOUA 3WBEA 3V16A 4EF8A 3W1AA 3RN6A 4B91A 1DHKA 1R6WA 3AWOA 1PZ1A 3N2CA 2ISWA 3MSDA 4H8HA 2EEXA 3HM7A 1E6SM 1KO0A 3KCLA 4I9JA 3NEVA 4ZZ9A 4IQJA 5AOUA 1UH2A 1LL4A 1UOZA 3BLIA 1FWFC 2V5LA 4TTGA 3DKLA 2KX9A 1B54A 3FJLA 3L4YA 3W28A 2FLIA 2E9LA 1TPEA 3K5XA 4U31A 2QDDA 5JIPA 3ARSA 3P7YA 1SUXA 4OVXA 3PHAA 4HK5A 3AROA 4DBSA 3CB3A 1PKNA 2V6AA 4KS0A 1X97A 5DFAA 4TV5A 3W7KA 2RH9A 5BOOA 3CPUA 3V18A 1D9EA 2FHCA 3AJ7A 3GUWA 4EF9A 5H8PA 3VDCA 2VJXA 2UY3A 1J5SA 1EO5A 2FZNA 1U5HA 3HGOA 3MKCA 3F5JA 3ALGA 1XS2A 3O6DA 2QVNA 3NQ2A 5H1WA 3UP8A 3TOYA 1E5JA 4B92A 4TVUA 3HN3A 4GI8A 3A4WA 2I16A 1FCBA 1Q6OA 4M0XA 5IHRA 4B9YA 3E2RA 4A2SA 2DW6A 1E4MM 2I5GA 1MEHA 3DHDA 1KM6A 3P84A 3PBYA 4NT0A 1PL9A 2BVTA 3LCLA 3LEPA 4QEHA 2G3NA 3S5OA 1HN1A 4YIWA 2E28A 1XM3A 3E0LA 3K4DA 4LAKA 4ECLA 1HFBA 5LSMA 2Y8UA 5DRCA 3FEQA 3RM4A 2QGHA 1FWAC 4DBWA 2Q8XA 4WLCA 1TUFA 3EEZA 4KFNA 4ML9A 1JYVA 3PVFA 4EWJA 3O1NA 1PBGA 3W2LA 1H61A 2V5KA 1PKMA 1U1UA 1UD3A 4RZ5A 5IRPA 2YDAA 4MY9A 1E73M 5A6AA 1PKYA 3D3AA 4PUEA 4FNSA 1SZGA 3UA3A 4I5RA 4HU3A 4M6UA 3VO0A 3CL6A 3S3GA 1F05A 3P6LA 4W89A 4DVOA 5FEXA 1RHCA 3CLWA 2OKOA 3T55A 2PWHA 3BDKA 4ENLA 5J5RA 3JW7A 1V3LA 5LIKX 2VZVA 2R8WA 3GHSA 3ZZ1A 4IG2B 1O5QA 2YL9A 3LYEA 1SFLA 4UMCA 2AMGA 1JR1A 1S1PA 3BOLA 3SCVA 4I9TA 3QTPA 3ELFA 4KEUA 3AIWA 1QHPA 3BAWA 4IMEA 4IUOA 1YW1A 3NZ1A 4BEUA 4BJHA 1Y5XA 1XC6A 4CD7A 5L9FA 4NILA 4LC8A 3CGTA 1BTCA 1IZJA 4XZMX 1OX5A 5U7SA 2O4QA 3PC0A 1UZHA 1V0NA 1AQMA 1F6PA 4HIBA 3JU2A 4JYDA 2VRJA 3R94A 3M0KA 1BYAA 3NL3A 4M3PA 2IXVA 3ES8A 3QFEA 4C7GA 7TAAA 4GYPA 4W87A 4G2DA 2WC3A 3ZR6A 3CK5A 5JMUA 2CW6A 4G7FA 4RK8A 1I2OA 1LDCA 2VDIA 2BHUA 2YB4A 1MFVA 1V0LA 3AJXA 3NVDA 4JEQA 2YW4A 2OSXA 2V2DA 5CXPA 8XIMA 2GOKA 3RMJA 3MVIA 4DJEA 1OY0A 4WEVX 1NSJA 1YX1A 3SAZA 1KKRA 2ZTJA 3B8SA 4Y2WA 3IPWA 4G8TA 3ZT5A 4NZJA 4XQ6A 2WJDA 3USZA 2D2HA 3FJNA 4WHBA 2WPGA 3WDPP 4N0RA 3DECA 1P6CA 2OZ0A 2C71A 4DUXA 1OZMA 1HKKA 1DVJA 3LCIA 3CZEA 5HR7A 1I2NA 4V1XA 3EXTA 5I77A 4L6DA 1WQ5A 4DUOA 1OHLA 1LRQA 3M47A 1NEYA 3HGSA 3GH4A 3KOWA 4D71A 1XYMA 1I1WA 1BSIA 3W37A 2FZMA 4OUEA 4FR6A 1JZ4A 5E0CA 5G1YA 4UTWA 3W86A 1QR7A 4J27A 3NZQA 3OP2A 1OFEA 1UKTA 2X42A 3C2EA 2PDYA 3H26A 2CLHA 1H7WA 4S38A 5HMSA 2OGYA 5CPTA 4RLIA 5AC7A 1RP8A 1MEWA 3NJ3A 3BLOA 1XR2A 4LBSA 5AYZA 1TX0A 2GK1B 3KVJA 3WD4A 1HJXA 5ECVA 4KWWA 5LHFA 3IVSA 3SGUA 2W63A 3BLKA 3NDZA 2ZUVA 2V30A 1J0KA 1BYBA 1R47A 1YPFA 3DOPA 3HMCA 5HJLA 3VGEA 1BF2A 3D5HA 2YLAA 2C1GA 2I9UA 2CBIA 2WNQA 4EK7A 3WLOA 1OCBA 4JD4A 4F3HA 2OTDA 2D3LA 3LHZA 1QU4A 1VPQA 3UU0A 4W7VA 4QG8A 4NX0A 2ATSA 1GUVA 5D32A 1IEXA 2XH0A 4CCCA 1QK0A 5LGZA 4K7YA 4Q4RA 3CQJA 4HA0A 3LI1A 3UXAA 1GJWA 4O10A 4KWSA 1OK6A 1V6UA 4EAYA 3CAKA 1XIJA 2TODA 2ISFA 1TWZA 1KRCC 4WK9A 3PANA 4RDWA 3WH7A 3D6NA 5E6YA 1MXGA 1V6XA 4AIEA 1FCVA 1WO2A 3GC4A 9XIMA 6REQA 3QW3A 2PBOA 3BLEA 3REQB 1OIMA 3NZPA 1VHCA 2MUCA 5LHEA 3NOEA 4Q4OA 3STCA 6ENLA 3R0UA 1QI5A 3SO7A 4FK9A 4FZIA 4IL2A 1GORA 3OQEA 5K7JA 2B7NA 3GC2A 4IJRA 3ZLGA 3KRZA 4GY1A 3FA4A 1KGWA 3N2BA 1HL8A 4CVUA 1TMLA 2D0FA 4K7VA 4F0SA 2GYIA 2PDWA 2YCIX 4O17A 1K8ZA 2WHJA 4R3UA 1EP1A 2YA2A 4WD0A 5DT7A 2WNNA 4Q4SA 4UTMA 4GXMA 1I45A 3EXRA 4YVPA 4XBKA 2QCGA 1XKYA 4L4PA 1VBGA 1UHVA 3PTMA 2Z6IA 1ZJAA 3M0XA 3CUHA 4M6VA 5D2YA 5A6KA 4OOZA 1NIUA 4AMAA 4QG6A 1VYSX 3WJWA 1VB9A 1WNOA 2VXNA 2XIQA 1ZAJA 2GQ3A 2PLJA 3ERPA 1W1PA 4HT3A 4GXWA 1UCWA 3MP4A 4LUYA 1WCGA 1W6TA 4BQ2A 1R9ZA 3MW7A 3KBJA 2J7EA 1DJQA 1AQFA 2VD8A 4FA3A 4NVTA 1Q85A 4P2VA 5LKYA 1Q2SA 1UA3A 3PFRA 2O56A 1DXFA 2GJXA 3DFSA 1KLYA 4TVCA 1YE6A 2E1WA 3A4JA 3BO9A 1Z89A 2G5WA 1D3CA 4QDMA 3UWUA 3VX1A 3CTLA 5AZ1A 1E71M 3HF3A 4XB3A 2OSYA 1FHLA 2R91A 3OG3A 1O95A 5AC6A 1P43A 4Q6JA 4MZ8A 3VNMA 1PTGA 3VCCA 2R1KA 4HGXA 3UY8A 2B81A 2GDUA 2WZHA 1K7FA 1UC5A 2ZQ0A 1QPNA 1LM1A 2G50A 1TUXA 1QHZA 4WUIA 4ORIA 4OV9A 1RVGA 2OJPA 4BI6A 4FXFA 2J77A 3PZVA 4AVFA 5I5RA 4UQ9A 1FWSA 3LPOA 3IUDA 1O66A 4ZSTA 3KBVA 4AXNA 6TIMA 2VDHA 3NZGA 1OFPA 3SRKA 1SO3A 1K8XA 1UWRA 5IM51 2I17A 3I6TA 4OV4A 4C6JA 3BMXA 1K4GA 2PTWA 3FA5A 2AL1A 1JDFA 2FQIA 1Y8BA 4D8AA 3URBA 5SWUA 4CCZA 3PBMA 1R2SA 3NDYA 2FVMA 3LNPA 4EPBC 1V3HA 3E2SA 1JNEA 2DU2A 1ZCOA 3M07A 1NWUA 5FEWA 5GJMA 1DQWA 4G1KA 4IZGA 1HL2A 4PCNA 3T9PA 3IANA 4E4PA 3ZS4A 4ADSA 3T6CA 3C2VA 3QHMA 4NZ1A 3N9KA 2PTYA 3W4RA 1P0KA 1GVEA