2HISA

Cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
312
structure length
312
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNAAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSNLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOMONAS FIMI FAMILY 10 BETA-1,4-GLYCANASE
publication title Insights into transition state stabilization of the beta-1,4-glycosidase Cex by covalent intermediate accumulation in active site mutants.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 118
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2hisA00
2D0FA 2XSAA 3ZSSA 4PCTA 5FCZA 3IJ9A 5I24A 3U7BA 4TUFA 2PWDA 2YA2A 2ZX8A 3BAKA 3WUGA 1V3IA 1FH9A 2YDQA 4AZ7A 1UD8A 1IZJA 3W37A 1CBGA 2WNWA 3VDAA 4EKJA 5C71A 1E4MM 1FH7A 3VILA 3RPMA 4JHOA 3TTYA 1GHRA 2EBNA 5KZ6A 1VAHA 1E4NA 2VCAA 3CZGA 3WKZA 1NH6A 1KGUA 1W1PA 1B3YA 3AZSA 4HU0A 1UQYA 1JYNA 1C3FA 1Z32X 3ALGA 1H1NA 2O9PA 2VC9A 3CUFA 4GO8A 3A47A 3VM7A 3WBAA 1W2PA 3AROA 4JAWA 2Y5EA 1U2YA 2WMFA 1HP4A 4QP0A 3RDKA 4D6EA 1W9BM 1JZ4A 1V6UA 3ARRA 4FLSA 4AD5A 1DWFM 3GXDA 3M7SA 1XCXA 2WC7A 4OZOA 1GORA 6TAAA 1JDDA 1G0CA 2VOTA 1TZ7A 3AHVA 1QNQA 1OWQA 1VB9A 1JNDA 4JFUA 4FF5A 5D9OA 3EDDA 1UR9A 4H41A 5I2UA 3QGVA 1H11A 1BYDA 1E6NA 2XSBA 3EMZA 1KGXA 3WL1A 4E4PA 2FGZA 2J7EA 4ZFMA 3WH6A 5BWFA 1EDTA 4PTVA 3RM9A 1W9VA 4HP5A 2BNJA 2ZUSA 3IJ8A 3NYDA 2V5DA 4UOQA 2UY5A 5E6YA 5I77A 3S6TA 2Z1KA 3BAXA 3WF3A 3T2QA 2BVDA 4D1IA 3WDJA 3QHOA 3ZJ7A 4UFIA 1EIBA 4TTUA 3BLPX 4W8BA 3N11A 1GUVA 2TAAA 4W86A 4W7UA 3BCFA 2WWDA 3NDYA 1K9TA 4UFKA 2OYMA 4DWSB 1E6RA 4ZEPA 3ZMRA 4BQ5A 1HJQA 4TVCA 2WCSA 3AXIA 1PZ3A 3PZQA 2GVYA 4QLJA 1V3JA 1S46A 2FH6A 2ZE0A 4JCMA 4GO9A 2G4FA 4NI3A 1E6ZA 2DT3A 3PBGA 3THCA 1B90A 4BQ2A 1J11A 4WJXA 1J01A 3MUAA 1ZBWA 2VTFA 4HMEA 2GFTA 2XGBA 2Y2WA 5BRQA 4AYSA 1HL8A 4UFJA 1D2KA 3VINA 2VMFA 2OSXA 5ABGA 4CCCA 4B15A 2JEPA 4LYQA 3L2MA 4HPGA 4ATDA 4DUXA 3OIHA 3PZNA 3WD1A 2J25A 1E72M 3SCQA 3A4AA 1B3VA 2XYLA 3WDQA 4CCDA 4JFTA 1D3CA 4LYRA 3VMNA 1OGSA 1BVZA 3CBWA 4HMCA 3ZSTA 1VRXA 1HN1A 2V3FA 3NCOA 4CUCA 2V5CA 2XGIA 2BFGA 4P7QA 1OIMA 5ECUA 5D4YA 1W1YA 4Z2JA 3SCPA 1KXHA 1DWGM 4PCSA 4MB1A 1VJSA 3S2CA 1DWIM 4U3CA 3WF4A 1UKQA 1UWIA 1OIFA 1OM0A 2QPSA 2WW5A 2IUZA 2DEPA 4P7OA 4WLCA 3PZVA 2VVNA 5BXTA 3AIBA 3VIMA 1UQZA 1R7OA 1C90A 4QLKA 1GOWA 2YLAA 4MNLA 3ARSA 1C93A 4W8AA 1H09A 3WUBA 3ARZA 4KMQA 5A6BA 1V02E 2WVVB 2J7FA 3RM4A 1E70M 5HXMA 2EPLX 2BVYA 2G3MA 5FKYA 4Q22A 4UOZA 3WIJA 5EFFA 2J79A 5FD0A 4CGTA 4AZCA 3IANA 3MUZ1 4PMXA 3U57A 2DH2A 3MMDA 3GXIA 1HF6A 2BXYA 3NSXA 5CJ5A 1H49A 2YIHA 3E1F1 4M24A 1Q6FA 3CZEA 4N42A 4GI8A 2BY3A 2F8QA 1OBAA 4JKMA 3CUHA 4F9JA 1VFFA 3VM5A 3VX1A 4UTFA 3K8LA 3GH5A 3AICA 1KR1A 8A3HA 1ESWA 3BSGA 2WMIA 4JFVA 4UQEA 3WDPP 5A69A 4HPHA 2JALA 3EMCA 1UD4A 1C8QA 2W4XA 1LF1A 2PWFA 3AHXA 4PTWA 3ZQ9A 1JZ3A 3PZMA 2WLZA 1GOKA 2CBVA 1E6SM 4P8WA 3ARTA 3RM8A 3HN3A 3MV11 1ISXA 3W38A 1I1WA 1TUXA 3ZIZA 2D3LA 1XH1A 3WELA 1OGGA 2VL4A 1MQQA 1NWTA 2WZIA 3I3DA 1JYWA 1VF8A 5CSYA 4J3UA 3AS3A 4WSJA 2GJXA 3WD4A 4U33A 3VNZA 3MSDA 5IXEA 2Z1SA 4AIOA 1BYAA 4GKLA 2WMHA 2VVSA 1QHPA 1Q6CA 1TA3A 3AYRA 2GK1B 2VX5A 5DEZA 2W92A 1W9UA 2VZOA 3HU7A 4PMZA 3W28A 3POHA 4PMVA 1E15A 2GSJA 1B31A 1E1FA 4H8VA 1VFUA 1HVQA 3UG4A 1SYTA 3PZIA 3VD3A 1U33A 2CCRA 1XV8A 5EBAA 3T09A 5AC5A 4CU8A 4M8UA 1C7TA 2WM0A 1SR0A 1C8XA 4NF7A 3GBEA 4DWSC 9CGTA 3MU7A 3VIOA 4YN5A 3N04A 4WK9A 3AFBA 2VCCA 3VD5A 4D6HA 1W3JA 1W3KA 3NIYA 5ABFB 1C91A 1PZ2A 1XYZA 3WNMA 4TTGA 3W29A 4XUYA 1VEPA 1RPKA 3ARUA 2VRQA 1MXGA 2CESA 4PMRA 1JD7A 1H41A 3JUGA 5IFTA 2C8NA 2G41A 1JZ7A 3CHFA 3VTRA 3BMVA 4ACZB 1TVPA 1HKJA 3U7VA 3CZJA 5A2AA 3OB8A 4ZE5A 5A3HA 1K9DA 3W26A 1QHZA 4RE4A 3VIIA 3SUWA 5D9MA 3EYPA 1E4LA 2EPNA 1JGIA 1UOKA 3OZPA 4GI9A 2J7GA 4NRSA 1JXJA 3T0BA 2CIPA 3AHYA 3CHEA 5CPTA 1B9ZA 1W2VA 1QI3A 3B9AA 5I78A 4RE2A 4U2YA 4GI6A 3APGA 5AYBA 4B3LA 3CZ8A 2YBTA 1TR1A 2DSZA 3AS1A 4GXPA 5JBEA 4JHZA 1DTUA 4EE9A 2PBOA 4OOUA 4JFSA 3U5UA 1VJZA 3W6LA 1F4HA 1MWOA 2BVTA 3AISA 3MS8A 1G94A 1ZU8A 1J18A 1UD5A 4L4OA 4W87A 4J3XA 2BY1A 4F79A 4CN6A 4L4PA 3DHPA 1E0VA 2WYSA 3BSHA 1R8LA 2O9OA 3UEQA 4PUEA 3BCDA 4E2OA 2JEQA 1M53A 5A6KA 4U2ZA 3AMCA 3TTQA 1ZBVA 2WMKA 1GOOA 1AQHA 1JZ8A 5I6SA 2VURA 3TP4A 1HKMA 5DFAA 2A3EA 4XX6A 5E70A 3WH8A 1KQZA 3CHCA 1KWGA 5D8WA 4OKDA 5A6SA 3WF2A 4UOJA 1I1XA 3HJEA 3QHNA 5DMYA 1UH2A 4AZIA 1FHLA 2J7HA 3WQ5A 4W89A 2E9LA 2X8RA 5E0FA 1CGXA 4PTMA 3AHZA 1JXKA 1GOIA 2CKSA 1KQYA 3SUSA 1CLXA 1BHGA 2ZUUA 1FFQA 1JF6A 4MAVA 5D9NA 3KE0A 3OGVA 5LA1A 2IXVA 2WCAA 3SCSA 4W5UA 4AY1A 4C7DA 5LA2A 4QFUA 4OBSA 5A8OA 5GNYA 4F8XA 2XJ7A 1VBUA 2V38A 1JFHA 3L4YA 1FH8A 2J7BA 4PUDA 3SCTA 3DHUA 3ARWA 1WZKA 3VMPA 5TD4A 3VIJA 4BS0A 1GQKA 4HMDA 1W3LA 5D8ZA 4TVUA 1MW1A 2ZX6A 4J28A 1UH3A 2WHKA 1NOFA 3UR7A 3W53A 2ZX5A 1WZMA 2CYGA 2VR4A 1TG7A 2E4TA 4HTYA 4MNMA 1SFSA 4W7WA 3RJYA 8CGTA 2QHAA 1KB3A 4QAWA 1GQIA 5BXRA 1CXLA 3WMCA 1UD3A 2WKGA 3L4UA 1EQCA 4UNIA 1W32A 1QNRA 2HISA 2PF0A 1E0XA 5LA0A 2CKRA 4LYPA 1TVNA 1W3HA 1CXIA 3HMCA 2PWGA 2XVKA 1HJUA 1UKPA 4X9YA 1Q6DA 3K1DA 2DQXA 1CXHA 3SCNA 4AD0A 2NW0A 2EPKX 3BH4A 2WB5A 1OT1A 1J0KA 2ZUVA 1V0NA 2YL8A 1JYVA 4D72A 4D6GA 5BCAA 3LPPA 3GYCA 4KRTA 1BTCA 2ZWYA 3IAPA 2WLYA 1LWJA 3WD3A 4MAZA 4CD8A 2ZXDA 2JIEA 2WPGA 2A3HA 2FGLA 4J7RA 3K8MA 1WNOA 4OUEA 1PIGA 4ACYA 4D6FA 1QI4A 1QI0A 4D6DA 3AXXA 2WZHA 4WF7A 4M56A 4ML4A 3UR8A 3VGHA 1KGWA 3N12A 3T2PA 1UWQA 4LX4A 2X05A 3AIUA 4J3TA 3QR3A 1JZ5A 1A47A 4UR9A 4YPJA 2ZXBA 2YOCA 3O6AA 4ATLA 3LPFA 1B3WA 5FL1A 3TA9A 4D6CA 2J8FA 3RILA 4AZGA 1KR0A 2XIIA 3W24A 5JIPA 1CGVA 3WQ6A 3F4VA 1SMAA 1GPFA 4MADA 4GQQA 4OJYA 2E9BA 5GPRA 3ZOAA 3SCWA 2O9TA 3SCRA 3VOCA 4H04A 1WAWA 1WP6A 3GNOA 5I5RA 1J0YA 1GZJA 4A3HA 4EANA 1QNSA 4D71A 1J9YA 2EQDA 4HZ8A 1PJ9A 2OSYA 1I75A 2FHFA 1US3A 4E8DA 1QBBA 4P8VA 4D1JA 2E8ZA 5JBDA 5M17A 2W61A 4P8UA 3BGAA 1ZBCA 3ARVA 5DF0A 1QPKA 1EH9A 2CERA 1E55A 4BQ3A 2JF6A 2EXOA 3UG3A 3WH5A 1B3ZA 4PYSA 2Y8VA 5A2CA 1PX3A 3AZRA 1W9XA 2VQUA 3VGEA 2YL6A 4P7NA 3ARXA 1BSIA 5A6AA 3MSGA 3IK2A 4BF7A 1OD8A 1ODZA 3AXHA 3GH4A 4TX6A 3AIRA 1LG2A 4H8HA 3AS2A 4V2XA 1E4IA 3QHMA 2ZX7A 5A8MA 3CMGA 1XD0A 2NSXA 3ZJKA 1R87A 3UERA 5A6LA 4EAMA 4MB5A 1W9PA 2XVLA 5ABEA 1ITXA 3ARQA 1Q4NX 3DYPA 3FHAA 4IPLA 3UG5A 4KWUA 5F7UA 2PWHA 4OIFA 3GTNA 1R86A 1EDQA 3WF0A 2WHMA 1V0KA 3QOMA 1UA3A 3CUGA 2J77A 3WN6A 1C8YA 1QHOA 4B9ZA 5A94A 5AC4A 3RIKA 2VRKA 1UYQA 4FLQA 3I3EA 3M46A 3B9DA 1UH4A 2E8YA 1WCGA 3GDBA 2WMGA 4AC1X 3EBVA 3AIWA 1V6WA 1X1NA 3EDFA 3PZTA 3G6MA 3L4WA 4W7VA 4M81A 2VR5A 1GJUA 1MFUA 2CPUA 1BG4A 2ZX9A 4TX8A 4MB3A 1VENA 4E8CA 2F2HA 4KRUA 1BVNP 1H5VA 2DT1A 2YJQA 1AQMA 1E40A 4U5KA 3LMYA 2XWEA 4P8XA 3ECQA 3OGRA 4NSBA 1EXPA 5D9PA 3MO4A 4HZ7A 1DWAM 2VRJA 2VCBA 3ZT6A 2YA1A 4BCEA 1OCQA 4GZJA 3A4WA 1AMYA 2DT0A 4DWSA 2J47A 4GZIA 2J7DA 1O7AA 3KWXA 3UCQA 1IT0A 3WNLA 2XIBA 3AQUA 3ZO9A 1E71M 1EDGA 1CDGA 3WUFA 1KXVA 5M3WA 5HPCA 3CGTA 1XGZA 2YL5A 2WSPA 4W84A 4PEEA 1NP0A 1V6XA 2GJRA 5A8PA 4AW7A 4JIEA 1QOXA 2WAGA 2J75A 2DIJA 3BAWA 4PMOA 4ZXOA 4HOWA 4PMDA 2XFRA 1CGTA 5A6BD 4UQCA 4Y7EA 1UKOA 1GJWA 1CGWA 1J10A 3AI0A 3PZUA 4DWSD 1ZBKA 1GONA 1CLVA 5FOOA 2B31A 1UHVA 1JDAA 4JKKA 1BAGA 3SUUA 2WVUA 4UQ9A 2XVPA 3WNNA 4QCFA 1UWSA 3MMWA 1HKIA 1X6LA 4J3VA 1G01A 2GUYA 4J27A 4AD3A 3AIVA 1R85A 1H0IA 1RH9A 1QNPA 7A3HA 1JZ2A 3CPUA 1KCLA 4CD4A 2XWDA 4PRWA 1MFVA 3WSUA 1P6WA 3GNRA 3PZGA 5A1AA 2WCGA 3NSNA 4HOZA 1E5JA 3CUIA 2WWCA 1WZAA 2WVVA 2ZXQA 4WIWA 1MW2A 1DP0A 2W63A 1A3HA 2W67A 1XYFA 4W5ZA 4UFHA 4UFMA 3DYMA 4TOQA 4JZ5A 4XZWA 2VI0A 4NRRA 2EO7A 2E3ZA 3MUIA 2X09A 1J0JA 4M80A 6CGTA 1XH2A 5HNNA 4PMNA 3VPLA 1HL9A 1E1EA 1LL4A 1QI2A 3ZR6A 1MXDA 3VD4A 1JL8A 5IHRA 3K4AA 1WPCA 1XSIA 1KFWA 5ABHA 2D20A 2XPKA 4N0RA 3L4XA 4V28A 1XD1A 3DC0A 2VNCA 4H7VA 3WDIA 1V0LA 3M6DA 1XRVA 3O2LA 1UKTA 1NQ6A 1HJVA 3WFLA 3F5JA 2WC3A 1CNVA 1M7XA 1E5NA 1LL7A 3OG2A 2AOSA 4PMQA 4D6IA 1PEZA 4KGJA 2OWWA 3PTMA 4PMUA 2OWCA 1WO2A 3LPGA 1RP8A 1UA7A 5CGTA 3F5LA 4MNKA 1UR4A 1UD6A 3OBAA 3SUVA 2WBGA 3CLWA 3VNYA 2BHUA 3PHAA 3WDHA 3FAWA 2O92A 1ECEA 1V3KA 1JAEA 4YHEA 3D3AA 4AD2A 2PI6A 1TE1A 3SUTA 1ZS2A 4XZBA 5BROA 5CPSA 2VX7A 5BYWA 2DIEA 2GK1A 3NUKA 4NZCA 4P7LA 2FHCA 4DUVA 1VFMA 1OD0A 4MJ2A 5GNXA 4Z2HA 3TTSA 1E0WA 4A4AA 3AS0A 2EJ1A 2YLLA 5I0DA 1BQCA 4PSRA 4UZSA 1OB0A 4CVUA 3WF1A 5LYRA 1EOKA 2J78A 2G3JA 2YBUA 4MPKA 3VVGA 1FP9A 2VX4A 4F9DA 1HJXA 3I3BA 1V3HA 4HU8A 4PN2A 1GOMA 1DEDA 4HA3A 5ABFA 2WVSA 1KXQA 1GVIA 4BA0A 2BHZA 2BXZA 3VMOA 3ZM8A 3FY1A 2BY2A 4AEEA 1B2YA 1R7AA 2WBKA 5FL0A 1VIWA 3LPOA 5JUVA 1TFVA 1JI1A 4Z2GA 1HJSA 1WDRA 4ACZA 3GH7A 5E9AA 3WD0A 2X2YA 1ISYA 2JIWA 4AZHA 3NJ3A 1CXKA 3WBEA 2G3NA 5EB8A 1OSEA 1BF2A 5A6MA 1NWUA 2XHYA 1W1VA 1E43A 1CTNA 1IV8A 4R5EA 3AMGA 4HZ6A 3KL3A 4M1RA 5DO8A 4MJ4A 4RE3A 5A2BA 3GXMA 4XV0A 2AMGA 4HA4A 1EO5A 3DYOA 4W88A 1NOWA 5E6ZA 3B9EA 3WNPA 1ODUA 3WH7A 3G6LA 2WXDM 1QW8A 2XM1A 1H3GA 1CZ1A 3VX0A 1W91A 2E0PA 2X1IA 2W66A 3K4DA 1J0HA 1CYGA 1E6QM 4S3KA 1K9EA 2OYKA 2CITA 5HOSA 2UY2A 3PZ9A 3SCVA 3ZR5A 1V08A 3L4ZA 1E73M 4GZEA 4UQDA 3WMBA 1MQRA 2ZUMA 4URIA 1WDQA 3SEPA 3ZJ8A 1J12A 4Z2KA 3BMWA 4AIEA 3CH9A 4AZ6A 5GQBA 4C7GA 3VGFA 1NWSA 2CNCA 2GDUA 2VZSA 3W82A 4R27A 3VIPA 3OLEA 4CD5A 1PPIA 5I3DA 2QLYA 4WSKA 1NP2A 4CCEA 3FW6A 4DM2A 4UZUA 1NM9A 1B1YA 2XG9A 3AJ7A 1KWKA 1HNYA 2D24A 2WMJA 2ZICA 5CSUA 1GQLA 1KBKA 4MTVA 5M5DA 1DWHM 1C92A 2RGLA 1KXTA 1BLIA 1XCWA 1CIUA 5A8NA 1GCYA 2CBIA 5CXPA 4X0VA 1UZ1A 1MVYA 5DT7A 3BAYA 1G9HA 1EO7A 4CD6A 5BXPA 4AD4A 1JD9A 1JFXA 1J0IA 1JAKA 1H0GA 2A3CA 4EK7A 3IAQA 2A3AA 4ATWA 3FXYA 4AXNA 3ALFA 1UWTA 1UZ4A 4CKQA 2YDSA 1KBBA 2BHYA 1BGGA 2VUYA 3N9KA 3CTTA 4CD7A 4J3WA 1PAMA 3GXFA 1XC6A 3WNKA 4B9YA 4IISA 1EHAA 2GJPA 1SMDA 5C70A 1JG9A 3W6MA 2XTKA 2VZTA 2J74A 4H2CA 4OOZA 3WQ8A 4BQ4A 4QDMA 2J4GA 1B0IA 2X0YA 3K8KA 2JFEX 4FLRA 3ZT7A 2E40A 3WEOA 2O9RA 2D22A 1DWJM 6A3HA 2XM2A 1JF5A 1LWHA 1PX8A 4AIUA 2WK2A 1E9LA 3WEMA 3EDJA 1JDCA 4YHGA 1ISWA 1QBAA 3MV01 3FHQA 3CHDA 4AMCA 5A6JA 1UR0A 3PTQA 2DGAA 5EFDA 1VEOA 3RO8A 1K6AA 3SIMA 2D1ZA 4FK9A 2OWXA 1WDSA 1HKKA 2CXGA 2GDVA 5I23A 2QMKA 5IFPA 3CMJA 3GBDA 5C8BB 2PWEA 3AMDA 4PBGA 1KCKA 3VD7A 4GINA 4Z2IA 1UR8A 5CQ1A 1LJYA 2V3GA 2D0GA 1JZ6A 2ZXAA 2OYLA 3PZOA 3ZJ6A 1W1TA 1WB0A 1ISZA 4IPNB 4UCFA 4PMYA 3BXWA 1HP5A 4U5IA 1QNOA 2DSKA 1E3XA 5HDRA 1ZJAA 1CECA 3RMEA 3OA5A 2C0HA 3WDRA 1MW0A 3VUPA 3DECA 1L0PA 3BAIA 5CG0A 1AVAA 4C7FA 1HXJA 2CETA 3IJ7A 3N15A 4AZCB 2CHOA 1X6NA 3WEZA 3ARYA 1ZB5A 4P7RA 5E0CA 1ZL1A 2VO5A 3N13A 2DSVA 1L8NA 3WFZA 2J7CA 2YA0A 4KGLA 2MANA 3II1A 3W27A 1HVXA 1GOQA 4IM4A 3O9NA 2EPMX 2WMIB 1TMQA 1V3MA 3VD9A 2D23A 1FHDA 2BY0A 5FIPA 3WY1A 7CGTA 4LPCA 5HBFA 1CPUA 2UY4A 3AHTA 1JNEA 2W62A 3B8SA 3M07A 3FN9A 1GW1A 3D5HA 3VIHA 3THDA 4JKLA 1FFRA 1BPLB 3BAJA 1H2JA 3AIQA 3RCNA 3UESA 3VIKA 4AWEA 2VQTA 2V3DA 2AAAA 1NOUA 3VGBA 4S3JA 3NSMA 2ESCA 2XVNA 1UKSA 2GJXB 2CEQA 1C7SA 4AD1A 3AMKA 2Y4SA 4JFWA 4PTXA 1TA3B 1NWRA 3EDEA 4FLOA 3WUEA 1GHSA 1ZJBA 1D7FA 4DM1A 1HX0A 1MQPA 1V0MA 3CO4A 1EQPA 2YL9A 3F5KA 3FAXA 3VIGA 3WQ4A 3N1AA 1FA2A 2C7FA 2QV4A 2YKKA 1CENA 3WD2A 2VJXA 1V3LA 3TTOA 1M01A 2PBGA 1XSJA 1E3ZA 5BXSA 1H4PA 5EMYA 3ZT5A 1OT2A 5AYIA 3W81A 3POCA 2QF8A 1PIFA 3CIVA 4GQRA 4WKAA 1GNXA 4TVDA 1O6IA 2QPUA 2CHNA 1HT6A 3SCOA 5E09A 4CU7A 1AQ0A 4BZYA 2NT0A 3MMUA 4X0NA 2VZUA 1CGYA 4U31A 4CU6A 4FMVA 2X0HA 4LXFA 2DDXA 1WKYA 1J0ZA 4Z2LA 2FDMA 2G3IA 1QW9A 1YHTA 2Q8XA 1U30A 1E6PA 2FHBA 2A3BA 1US2A 5CGMA 4B16A 1BFNA 1G5AA 3TOPA 5GNZA 5JIWA 2QMJA 4W93A 1W9DM 2EEXA 1MW3A 1EHNA 1UR1A 2BV9A 5IHSA 2DSUA 5CLTA 1B3XA 2FH8A 3VGGA 2G8ZA 5AY7A 3CZLA 3W25A 1B30A 3UETA 2ZUTA 3T0DA 4Q7NA 2UY3A 3L4TA 3OZOA 1WE5A 2XFYA 4WKHA 3N17A 1FP8A 2DH3A 2IXUA 2F61A 3A4XA 4XB3A 4AEFA 5M03A 1F4AA 3MANA 3AMLA 4K68A 2YDRA 4A3YA 4HOXA 3J7HA 2UWFA 4ZENA 1LLOA 1PBGA 3WMSA 3W0KA 1LL6A 4OBRA 1IZKA 1OGBA 4PSPA 7TAAA 2EPOA 3KZSA 1GVYA 1CEOA 4B3KA 4KH2A 4DUWA 4CVWA 5CZKA 2D2OA 4ZE4A 3T08A 3VIFA 1UG6A 1GQJA 1CGUA 1UUQA 4ZXLA 1V02A 1QI5A 2XUCA 3KEHA 1V6VA 2Y24A 3WH9A 1EA9C 5HPOA 1JI2A 1N82A 4M29A 4W85A 2W5FA 2BS9A 3A6OA 4GIAA 3VKKA 1Q6GA 2JF7A 2ZWZA 1TCMA 3VU2A 2WKLA 3N18A 5CLWA 4CN4A 1UWRA 2ZOXA 1QVBA 3KL0A 1LQ0A 3A3HA 2V3EA 3BC9A 1PX4A 3MUY1 2WZEA 3EMQA 4W8LA 1M03A 2J62A 4UQBA 1HJWA 2VX6A 1UR2A 5BRPA 5JBFA 1BG9A 3K46A 3GM8A 3WENA 4CN1A 3FNDA 3VDHA 4MNJA 3WL0A 2VT0A 2CBUA 2DPEA 3CUJA 2WHLA 2WSKA 1FOBA 1HIZA 1Y7VA 2PB1A 1VFOA 4AZBA 2J8GA 3ARPA 5A8QA 1WDPA 3EDKA 2XFFA 3GZAA 4F66A 1WZLA 1XH0A 1YQ2A 3WQVA 5A95A 4U3AA 4MB4A 2Y8KA 4LQ1A 3CZKA 4UQAA 3T2OA 3WNOA 3KL5A 4AZ5A 3PN8A 4QLLA 2DSWA 4WKFA 4IUGA 5IDIA 4RL3A 2NT1A 1XHGA 1ISVA 3BLKA 1E6XM 3OGSA 3VGDA 2PC8A 1XSKA 1V6YA 4JL1A 2DT2A 4H8UA 4LGXA 2OSWA 3AZTA 4AISA 3RJXA 3L4VA 2WVTA 4J3SA 2D0HA 2E9MA 3WQWA 4GPNA 2VZVA 3QOKA 3NDZA 3OLDA 1OINA 5I79A 1RD6A 3SCUA 4V27A 3U5YA 1JYXA 1ITCA 1Q6EA 3PTKA 3MKKA 4HA1A 5CPQA 1EGZA 4JL2A 3VDBA 1G1YA 1UD2A 1CWYA 2ZUNA 1NARA 1DHKA 1JIBA 3L2LA 4TXEA 3GNPA 5KEZA 5DT5A 2WC4A 3AOFA 1E56A 2HVMA 3OLIA 2OLHA 1EOMA 4QCEA 1BYBA 4M82A 1MYRA 4UFLA 3AYSA 1K9FA 1VEMA 1BYCA 2JE8A 3OLGA 1BGAA 3W4RA 3VDCA 2WANA 4MDOA 2RGMA 3TONA 1M04A 1V03A 2D3NA 3VO0A 1UWUA 3AIEA 4JCLA 3SURA 1LG1A 2WHJA 2XVGA 4D6JA 1RP9A 2ZIDA 1CXFA 1CXEA 4MDPA 3T0AA 2ZUWA 1VBRA 2CBJA 2W91A
chains in the Genus database with same CATH superfamily
2XSAA 1LT8A 4R7OA 1J5TA 5C0QA 1K7EA 4TUFA 4H8NA 2DJXA 3QF0A 3BAKA 6REQA 3U2CA 4O52A 3B8DA 4AZ7A 1IZJA 1CBGA 4FXRA 1ZTVA 4EKJA 3BOLA 3HQNA 1E4MM 2WO5A 1KM0A 4JN8A 4Z08A 1GHRA 2EBNA 1E4NA 3SFWA 3ANVA 4HHHA 4DAIA 1W1PA 2HJPA 3T05A 5G2HA 4IMCA 4Q4MA 3OBKA 1VFTA 3IRDA 4US6A 2Y5SA 4GNJA 2PP3A 1YADA 4ZA0A 4M0XA 1S5MA 1IXNA 4IJCA 3QVQA 4BKNA 1W2PA 2OQHA 2FB3A 3AROA 1XDMA 3S5YA 3CYJA 4G1KA 3HZ3A 1W9BM 1AD4A 4Q8NA 3GG0A 4ZCWA 3ARRA 4M6VA 3I7RA 1FTXA 3R0KA 1XCXA 4OZOA 4FZIA 6TAAA 1G0CA 1QT1A 4DF1A 5DX7A 3MDWA 2VFDA 3VZYA 3EDDA 1S3HA 1UR9A 2OLSA 1E6NA 3V7PA 3VCNA 4DF0A 2PS2A 4Q32A 5BWFA 4PTVA 3DC8A 3IJ8A 3LUTA 3HF3A 1W6TA 1TJ2A 4UOQA 2UY5A 4Q8PA 5I77A 1U1UA 4NXKA 3BAXA 2BVDA 1S2VA 3WDJA 3B8UA 4IG2A 3MY9A 1UWAA 1EIBA 3GG8A 2WNQA 1L6SA 3BLPX 4LBSA 1JVNA 2PDCA 5U4NA 1TTJA 5AYXA 4GCXA 2OYMA 1E6RA 3B4UA 3JU2A 2VFFA 3DFYA 4WY0F 3PZQA 2GVYA 1V3JA 2FH6A 2ZE0A 4GO9A 2G4FA 4NI3A 3KTSA 5DY3A 3Q58A 2O4MA 2CW6A 4HMEA 4ASTA 4HYWA 5BRQA 1DE5A 2NUWA 3VINA 1W1ZA 3U2EA 2PRLA 2OSXA 3S1VA 4GQ0A 4ATDA 3OIHA 3QV6A 4QHRA 1RBOB 3WD1A 1Z42A 2P88A 3W7LA 3VC5A 5KINA 5FJIA 1TZZA 3VMNA 4N6EA 1BVZA 3ZSTA 3VUSA 5CC6A 1Z3NA 1HN1A 1M7OA 2V3FA 4GGHA 2V69A 4OT7A 4E4FA 1W1YA 4Z2JA 5LXEA 1KXHA 2VUNA 4PCSA 2AQOA 4OGZA 1TJ1A 1XLMA 2ZRZA 4C6OA 1KFJA 3UVAA 1XICA 1KRMA 2HRWA 5HJYA 2H9AA 3LU2A 4QR6A 3L5AA 1C90A 1GOWA 2YLAA 4XK2A 4W8AA 3HQPA 3SN1A 2J7FA 2EPLX 2H8ZA 4KCUA 1OEPA 1AODA 5HQLA 4Q22A 3EGJA 1TCDA 4EWND 3LI0A 3ZR4A 4J2MA 5EFFA 3CQIA 2EJAA 3PUGA 4AZCA 4RV3A 1RY0A 3GXIA 3NSXA 1F8IA 3E1F1 8XIMA 1OBAA 4DNHA 3VM5A 1VD6A 3VX1A 1RD5A 1QU4A 1SGJA 3GDLA 3AICA 1L2QA 1KR1A 1GOXA 3BSGA 2WMIA 5A69A 3UZWA 3MO7A 1C8QA 1QUMA 2FPTA 5C7VA 3W22A 3FEMA 5KITA 2WLZA 4MZ8A 2NVAA 1ME9A 3EWZA 3P8IA 4WRHA 5K2ZA 1TJRA 4MY8A 1TUXA 4XTDA 2OKOA 1YEYA 3WELA 2YX0A 2VL4A 1MQQA 4HKPA 1NWTA 4F0MA 1KC7A 5KMYA 5TF0A 1FDYA 1OX5A 4IP5A 3I3DA 4EVZA 1XC4A 3WD4A 4GVFA 4U33A 5IXEA 4AIOA 3LGGA 3MCOA 2ZTJA 1T40A 2VVSA 3EOUA 2IPWA 1VJIA 3PM6A 3F03K 1Q6CA 4US5A 2GK1B 2VX5A 4N9BA 2OQYA 3R4IA 5DEZA 1TWIA 2AMXA 3HU7A 4PMVA 4AWSA 2QDGA 3P6LA 3PZIA 4MZ1A 4NNAA 3VD3A 2CCRA 5AC5A 2Z6JA 3PULA 4CU8A 2BP1A 1KV8A 4M8UA 4FNPA 2PDFA 1QCWA 1O94A 3MU7A 5EBUA 5E1QA 4YN5A 4FI4A 1IE7C 4H19A 2QGHA 3NIYA 5ABFB 1WBHA 1FWJC 4EWJA 3VI2A 4IMAA 1AZ2A 4IT1A 1VEPA 2VRQA 4JX5A 4PMRA 1JD7A 5IFTA 3VOGA 4GLEA 4JS3A 4FS9A 3CZJA 4KQNA 3G1VA 5A2AA 1Q66A 4GXMA 3BLLA 1O5RA 1O12A 1TSIA 4RE4A 5D9MA 3EYPA 4NRSA 4HNOA 4DPQA 1XLJA 3I7SA 3T0BA 1F74A 4WY0A 3UJSA 3B9AA 5I78A 1XM3A 3MC5A 1IEXA 4GI6A 3BVJA 5AYBA 2OT0A 3RUBL 3AS1A 3C2RA 2PP0A 3GNDA 1SZFA 3W6LA 1F4HA 2BVTA 3MS8A 4KKXA 3OTRA 2C1GA 1GK8A 2CLKA 4WZHA 4C6CA 2BY1A 4GJ1A 4CQDA 1YNQA 1GYMA 4ADSA 3U0HA 4Y8FA 3TYDA 1AH0A 4PUEA 3MKVA 3BCDA 3CQHA 2JEQA 3GHTA 1ZUAX 2RAGA 2BVWA 4DJDA 4IL2A 4U2ZA 6XIMA 1TREA 1A53A 3KXQA 3THQA 3QZ6A 4LVDA 3DFOA 3TTQA 1DIOA 1GOOA 1JZ8A 3RPDA 4IMFA 5I6SA 2ZKMX 4JTJA 2A3EA 1V51A 1KQZA 4OKDA 5A6SA 1T6MA 5CAHA 1I1XA 4YVXA 4PUUA 4Y90A 4S3DA 2PAJA 3TYZA 4Q8VA 1CGXA 3E12A 1OFOA 3AHZA 3LK6A 2CKSA 2I9UA 3SUSA 3KOFA 1EP1A 4DX3A 1VCVA 1X8CA 4AAJA 1PXGA 3OGVA 2IXVA 3CAQA 2HQAA 3MA8A 2E6AA 3L7RA 5T9BG 4AY1A 2FPYA 2V2CA 3OQEA 4OBSA 5A8OA 4O0ZA 4ECLA 5GNYA 1RCXB 4CQ8A 1JFHA 3L4YA 2DU2A 1QK0A 1KRCC 3SCTA 3VMPA 3PTDA 4IFKB 1ICSA 2FZ9A 3C61A 1DBTA 2RJGA 3ATZA 1GT8A 1F3XA 3G24A 3DUGA 1VHCA 2WHKA 2YW4A 4LH8A 3W53A 1TELA 3E96A 1S5WA 4DYEA 1VCGA 2VXNA 2E4TA 2OR2A 3CXOA 1NF0A 7ENLA 3GDKA 3HV8A 4MNMA 1R3VA 1R3TA 1IR1A 1W32A 1K8CA 3S6DA 5LKYA 4BEQA 3LCIA 3IGSA 3R79A 2XVKA 1Q6DA 4XZ9A 3IGXA 4GJIA 2EPKX 3BH4A 2WB5A 1J0KA 2DVTA 4NU7A 1JYVA 4D6GA 3LPPA 2FYMA 1EXBA 1UBSA 2ZWYA 2WLYA 1LWJA 3OBEA 2A3HA 3S47A 4WSHA 1WAUA 4Z0SA 2FGLA 1LOLA 1ZPTA 3CASA 2OFJA 4J7RA 4NHVA 1ZCCA 4OUEA 1JEZA 3C86A 1RQHA 2PDHA 2Z7GA 2ZE3A 5HAOA 2OEMA 4WF7A 4M56A 4ML4A 3UR8A 1KFKA 2FB2A 1LDCA 1UWQA 3E5BA 3PPGA 3R6IA 1ELSA 5HULA 4XBSA 3EXTA 4ATLA 2YOCA 1LWIA 3O6AA 3WJXA 2VFGA 3TA9A 3GU9A 3RILA 3OODA 4AF0A 4B3ZA 2XIIA 2DV0A 2V9DA 1OFQA 4IIHA 3A23A 4L9XA 2WSQA 2O9TA 3DI1A 1P48A 1EB3A 1CCWB 4RDZA 1GZJA 3QBUA 4D71A 1OC5A 4L61A 4QSFA 4MY1A 3DZ1A 1QBBA 1R6WA 4O15A 3KVMA 1NEYA 3RLGA 5JBDA 4KCVA 2FVKA 1TWZA 1QPKA 1O1HA 1EH9A 3O1NA 4IHCA 1A5UA 1N7KA 3UG3A 4YTSA 1B3ZA 1V4YA 4PYSA 3BTNA 2EHHA 2VQUA 3MQTA 3P8JA 3LLDA 5A6AA 3AIRA 1LLZA 4H8HA 4LB4A 1R30A 3DG3A 2PGEA 3AS2A 4UC5A 4L4MA 2IKIA 4AWUA 6PTDA 2ZX7A 4PUNA 1ONWA 4JXCA 3SFKA 1TYGA 3NPUA 3BCJA 3N34A 4I7VA 1XD0A 1R87A 2NV9A 1W9PA 2XVLA 2P10A 1ITXA 4C6BA 3DYPA 3FHAA 2C1HA 1EBGA 4OIFA 1N2VA 3GTNA 1VGAA 1R86A 1EDQA 5EYWA 1V0KA 1O60A 1UA3A 1VS1A 3CUGA 3GUGA 4LUJA 1VPXA 1TE6A 3SB0A 1C8YA 3MW7A 3H4GA 1UR3M 3TAOA 3KBWA 3TE9A 2BTMA 3EDFA 4ORIA 4W7VA 2QW5A 3ITLA 4XZHA 3VAVA 1THFD 4S38A 2ZX9A 4UMAA 1OX4B 1VYSX 4GACA 4E8CA 3TC6A 2F2HA 3E0FA 1IT8A 4KRUA 2Y7GA 3ICJA 3LV6A 3S2MA 1X96A 2YJQA 4NJJA 2DZAA 4LAZA 4U5KA 4ZBCA 1SFJA 2XGZA 2ZDRA 2HS6A 1SO5A 2C79A 3MO4A 3HBLA 1ICPA 1DWAM 1BVWA 2YA1A 4BCEA 4RZ4A 1EA0A 4GZIA 2PDXA 1O7AA 4C65A 2C1IA 3KWXA 3UCQA 4Y9MA 3WNLA 3ZVIA 2DZUA 2ZTKA 3BLOA 1E71M 4GWEA 4UTJA 3W9ZA 2ZZ1A 3MP4A 1FQ0A 1J93A 4JQ1A 4H3DA 4AHPA 5HPCA 4NJGA 3HIJA 2HPMA 3CGTA 4C6IA 1XGZA 2G37A 2RDTA 3T8LA 2WSPA 4W84A 1TV8A 3LXCA 1V6XA 4AW7A 1QOXA 2WAGA 2B7QA 1AK5A 1WX0A 4LUSA 4PB4A 1PZ1A 6ALDA 4DY1A 4UQCA 4XD5A 2NLIA 1M9HA 2XN0A 1JCTA 1MDLA 3PZUA 4DWSD 3QC3A 1R3SA 1ZBKA 4X63A 1G4SA 2HZGA 1FDJA 1JDAA 4DNMA 1BAGA 2WVUA 1I2PA 4QCFA 1N8IA 1UWSA 4HPJA 4B5NA 1LROA 1HKIA 3NVTA 1X6LA 4J27A 4KWSA 5F1UA 4ZQNA 1U5HA 4HU4A 1WUEA 4PFMA 1H0IA 3HGOA 3INPA 4YVPA 1JZ2A 5REQB 1DVJA 1E0TA 4CD4A 2XWDA 4LT9A 4PRWA 2GVEA 3WK1A 3PZGA 4NZ3A 4QG8A 2WCGA 1SJCA 2HEJA 2NQZA 5DANA 3CUIA 4BJHA 1KM6A 1P6BA 3STFA 3PFRA 4WIWA 1TUFA 4JNZA 4Y2WA 4IL0A 3ITCA 3AXMA 3QY7A 3V5CA 3DYMA 2VI0A 4I8YA 4DZHA 3WQDA 1NQKA 4DJEA 3S3GA 1IR2A 3VPLA 4HHMA 5IHRA 2A0NA 2W79A 4EPBC 2R82A 4V15A 4NX0A 2OEJA 4AX6A 4H7VA 4LNCA 3M6DA 1XRVA 4B4FA 2XZ9A 3DDMA 2IW0A 4K38A 1SZRA 1I0BA 1E5NA 3OG2A 3FJ6A 4C6JA 3F5LA 2HTMA 1B9BA 3OBAA 1UASA 2E6DA 3KTCA 3QM3A 3IGUA 2WQDA 2Z25A 4R7WA 4UTHA 1FKWA 5H91A 1YXCA 5FJRA 5EMKA 1JAEA 4JYEA 5CPNA 2Z1VA 1MMFA 4C6MA 1HW6A 2OZ3A 4DUVA 1XF0A 4MJ2A 3RX4A 3W7GA 3TWBA 3AU2A 1SSGA 3TTSA 2GGIA 4A4AA 4QEEA 2ATMA 3BG9A 5I0DA 3N4FA 4CVUA 3WF1A 2J78A 1EFZA 1G69A 3DFSA 1UJQA 4J3ZA 3NVDA 3REQA 4HA3A 1IEWA 5HUOA 4BA0A 2BHZA 3VMOA 5HINA 3ZM8A 4YYFA 4AEEA 4E2VA 1Q5MA 3TZFA 2J66A 3A24A 5FL0A 3F2DA 5JUVA 2R91A 3B0UX 1JI1A 4JIPA 3QZEA 2X2YA 2AL2A 7ODCA 4RK8A 6REQB 2B81A 4X9SA 4QXIA 1EEXA 1V6TA 1FCVA 2PTDA 5IBXA 2NV1A 4UR8A 3TW9A 1UIPA 4DJDD 4HZ6A 1XLHA 3KL3A 3MI6A 4MJ4A 5JU6A 3R89A 5A2BA 1EO5A 4LRTA 1MUMA 4E2DA 2H3BA 4Q8TA 2WXDM 2XM1A 4ZL1A 2OOGA 2GSEA 3GKAA 5LXXA 2PDWA 4OV4A 2X1IA 2W27A 1P7TA 1K9EA 4YCPA 1AD1A 5I3GA 4B5TA 2E68A 4BF9A 1KO0A 3TH6A 3T4WA 4UMCA 3FVMA 1DQXA 1MDRA 2HV5A 2ZUMA 4M6QA 3H21A 3SEPA 1BQGA 1Q63A 4AIEA 4C1NA 2ZCGA 4HCDA 3CH9A 4B92A 4AZ6A 3TXVA 1OCNA 4Q33A 3PNUA 3WLIA 3WJWA 4C7GA 9XIAA 5C6MA 1YNYA 2V5JA 2UV8G 2I56A 4KW2A 2PUZA 4UNKA 3TJLA 4R34A 5B80A 2WM1A 3DFHA 3LD5A 4WSKA 3RAOA 4CCEA 4DM2A 1OCJA 3M41A 4QSHA 1E1CA 1XQKA 4HMNA 2R94A 1HNYA 3HPZA 1KBKA 2ON3A 4MTVA 1XUUA 3MDUA 2IKGA 3ZLFA 3P5YA 3W2NA 1BLIA 1FVPA 4IG2B 3ABRA 3MI3A 2H8XA 1W1IE 4GYFA 5CXPA 1YBQA 4QNEA 1RY8A 3BAYA 1G9HA 3BZGA 1J0IA 1JAKA 2IPJA 2A3CA 4J35A 5CG7A 1KBBA 2BHYA 2Z4GA 2VUYA 2TRSA 3N9KA 1FUYA 1DIDA 4GD0A 4CD7A 4KWVA 4J3WA 1XC6A 3OYZA 3KDNA 2GJPA 4E4UA 1JDEA 1YPXA 1KM5A 4KF1A 3W6MA 4B90A 1K6WA 3PWGA 1XL9A 4ZOEA 2GUBA 3R58A 4H2CA 1Q13A 3EOEA 4A8RA 4D8ZA 3EEZA 3NWRA 3K8KA 1XYCA 2JFEX 3C0JA 4LY8A 4C6NA 2D22A 5G5IA 5JXQA 2XM2A 2ANUA 3BE7A 3BMXA 3CAKA 1PX8A 4UTTA 1D9EA 1B57A 3C0LA 1QOQA 1PTAA 1QBAA 3MV01 2VELA 2J27A 3Q67A 1I8JA 2NQ5A 4U10A 1Q8AA 3CHDA 4AMCA 5A6JA 4M1BA 1X1OA 5EFDA 3SGGA 4O17A 4X3ZA 3USBA 1DXIA 3RO8A 1O5KA 1R47A 2QCMA 2BGQA 3N14A 1HKKA 1OFBA 2QMKA 5IFPA 3IPWA 4Z1YA 2H9AB 2QIWA 5T9CE 1XLFA 1IIHA 3NPVA 1GKQA 1KCKA 4YL2A 4LS0A 1Z8AA 1UR8A 2PC4A 4GKTA 3SQSA 3GZ3A 1DQUA 3HOJA 3ZJ6A 1W1TA 1ISZA 5AHFA 4UIOA 4UCFA 4EAYA 3A4JA 3BXWA 3V0UA 5BMXA 1WXJA 4U5IA 1E3XA 1CECA 2PDYA 3RMEA 1XRTA 1QNVA 1MW0A 3VUPA 1L0PA 2I5IA 2KZHA 4C7FA 2DVUA 4H9TA 2CETA 1LOQA 2PZNA 3CAVA 3F4NA 4AZCB 3ARYA 4JIHA 3E49A 2FIQA 1WKFA 3RPTA 4JN6A 2YA0A 4KGLA 5I09A 4PEKA 3EX2A 3ITYA 2WMIB 3VCCA 5LNVA 3TCSA 4POCA 2D23A 1FXPA 4KERA 2BY0A 2X30A 5FIPA 3WY1A 3VNKA 5AVNA 4R53A 4TX9A 3AHTA 3LBOA 3C8NA 1A3WA 1DXFA 3M07A 4MUZA 1GW1A 3VIHA 3W83A 3L67A 4JKLA 2PDNA 2VQTA 3RLUA 4GA8A 2X7WA 4UTLA 3M0IA 3QN3A 4LAUA 4XBKA 4M7TA 3W7JA 4HJWA 1MRQA 2P0OA 3GS6A 4NXSA 1PDZA 5FA5A 3AMKA 2Y4SA 3CHVA 5I3JA 1KCXA 4WCJA 4E3TA 2TYSA 3EDEA 4IIEA 4BY3A 2FKPA 2ATSA 3I65A 3SIZA 2VEIA 3E3HA 1MQPA 1PSCA 2EAWA 4O8RA 1QPQA 2NVDA 3FAXA 3WQ4A 1XIFA 2C7FA 4ORMA 3O6CA 4F2TA 1ZHAA 2HMCA 1M01A 3HGSA 3CTLA 1R38A 1GTHA 3ZT5A 2WJZA 1OT2A 5AYIA 2DUZA 1DORA 5TBOA 4ERIA 2QF8A 3CIVA 3YPIA 1LQAA 1OK6A 3RO6A 2QPUA 2CHNA 3OW1A 3SCOA 4ZQCA 2ZADA 4BZYA 2CZVA 3R1ZA 4X0NA 2VZUA 3W1QA 4ZTXA 2QEZA 3ITVA 4NYYA 5C2CA 1P0EA 3HPFA 4JQAA 2FDMA 3GAKA 4WJ8A 3NPWA 2E25A 4AH7A 3EXSA 1YHTA 1XLAA 1Y8BA 2NQJA 4K39A 2GQAA 4IX0A 4A8IA 2FHBA 4KRZA 2W9MA 3VKCA 3OIXA 4WY0B 3H23A 2PFHA 4GC4A 5EGRA 4DBWA 2QMJA 3ABOA 3LSCA 1XX1A 1ECQA 2PLMA 3QW3A 3S1GA 1PKMA 3URAA 3VGGA 2CLMA 4RJEA 5HWNA 3LHUA 2QCDA 4JTQA 4IP7A 3RK8A 4Q7NA 3SR7A 4LVBA 2ZZ4A 4H9XA 3C52A 1FP8A 1ADSA 1ZAIA 1W17A 3E9AA 3PJWA 3QKZA 4TU1A 4O1DA 1XLKA 1WOBA 2B7PA 1XUZA 3BDKA 4A3YA 3J7HA 1DPMA 2UWFA 1R9XA 1RVKA 1PBGA 3W0KA 1XPGA 2OODA 4OBRA 5LGZA 1OGBA 1P5BA 4ML9A 3KZSA 1GVYA 3UXAA 3EAUA 2PLKA 1EC8A 4DUWA 3A64A 4CVWA 5CZKA 2D2OA 3LENA 5FSDC 1G4PA 4FIQA 2VDGA 1XIDA 4DO5A 1M7PA 4DJED 1YTEA 2EGZA 4W85A 3VKKA 3O05A 1Q6GA 1ZAHA 5D32A 3FX4A 3UZJA 4IIGA 4XAPA 3OJGA 3TJIA 3VU2A 5CLWA 1PE1A 5BNKA 1QVBA 5T26A 5AYYA 3ENLA 2AQVA 3H54A 3LNMA 1AW5A 3QTPA 5C2GA 1XBVA 3NDOA 1FWFC 1UR2A 5BRPA 5FJTA 4HBKA 4G9PA 4QNWA 3EOSA 1YPFA 4F0LA 3ZVHA 1ME7A 3L5MA 3N29A 3M47A 1FDZA 1POKA 1FOBA 1HIZA 4MKSA 3NNTA 2J8GA 5A8QA 5F4WA 4PB5A 5H1WA 1TV4A 1YQ2A 3DKJA 2Y62A 4UQAA 2BMBA 2ZZ3A 4EOUA 3L2IA 1IYXA 4AZ5A 4HNVA 3W72A 2IQDA 4IUGA 5IDIA 1K70A 4XVDA 4NKCA 4RL3A 4IICA 2NX9A 4PA8A 1E6XM 4F0SA 3OGSA 2PC8A 2NV2A 1HQTA 1XSKA 2DT2A 2OSWA 3WBYA 4AISA 3RJXA 3WQWA 2E9MA 1TTIA 3H7UA 1SO3A 3QGAC 1OINA 1AZ1A 3BJFA 2RH9A 2OX1A 1ITCA 1Q6EA 3MKKA 4CLMA 1LRNA 5CPQA 1EGZA 1G1YA 2OO6A 1UD2A 1RR2A 3ABSA 1H63A 4KS0A 1VCFA 1MNSA 5K4XA 3E2SA 4LC8A 4XG1A 1EL3A 1XLBA 1RK5A 4PODA 3AOFA 4IGMA 1E56A 2FTPA 3OLIA 4Q4SA 4S23A 1DXEA 1P0BA 2L5HA 1VEMA 3UJ2A 1PHQA 3KVKA 3R2GA 4GRSA 4AF0B 3VDCA 3TONA 2CLLA 3SURA 1GQNA 4OTKA 1YRRA 1LG1A 2FVMA 2Q71A 2ZIDA 3GHUA 3GW0A 4K7VA 3TSMA 2FZMA 1CXFA 2C14A 4LAKA 4F0KA 1Q7QA 3IJ9A 2QULA 1EJXC 3QV9A 4CQAA 2PZ0A 3U7BA 4CNOA 2PWDA 1DJXA 2ZX8A 5E93A 3WUGA 1V3IA 3GFXA 1F05A 4I5XA 1PVNA 4JTAA 2WNWA 1EP2A 1GZGA 4FNQA 3VILA 5E5CA 3RPMA 3KBNA 5AHEA 2J8TA 2VCAA 3PPCA 3WKZA 1QPOA 1SO4A 1LTDA 1B3YA 3WJZA 2VEFA 1B4EA 5EPDA 4HU0A 1UQYA 3I4KA 2P50A 3PAOA 1XIEA 1Z32X 1UZHA 1H1NA 2AAMA 4EPDC 2O9PA 3VC6A 3MI2A 4GO8A 3C2YA 3MVIA 1YPIA 4IF2A 1TIMA 4WOZA 4WD0A 1KTBA 5I3KA 5JQ9A 3RDKA 2C19A 4AVNA 3E2QA 4AVFA 2ZQ0A 3NQVA 2HDJA 1DWFM 3OOQA 4IUOA 5CBIA 4ZOAA 3QLLA 3GXDA 5DBUA 3T78A 3P82A 2CZ5A 3LHWA 2B7NA 1OF8A 1QNQA 1VB9A 4HTBA 2DZWA 2BBFA 4N6FA 3OZMA 5D02A 1GVRA 1JNDA 3G1SA 4FF5A 5D9OA 5I2UA 3DGRA 3QGVA 1BYDA 4V33A 3WL1A 4E4PA 5ENLA 4FF7A 2J7EA 2KX9A 4G7FA 2F84A 1EJVC 4GJJA 4OU1A 3RM9A 2OEKA 4HP5A 1HUVA 2ZUSA 4AVOA 1R46A 3L23A 3W01A 8XIAA 3S6TA 3T2QA 1F6KA 3M64A 3LM7A 3G0UA 3ZJ7A 4UFIA 3CL8A 4W86A 3DX5A 3NDYA 3BJTA 2Z1BA 3S9ZA 1HJQA 2IQTA 1K1DA 4I9TA 2X2GA 2DZSA 3DG6A 4RDYA 2QS8A 4I6VA 3LA4A 1LM1A 2VYOA 2ADAA 4TV5A 4TR9A 4JYDA 3PBGA 1B90A 4BQ2A 1J11A 1ZBWA 4MLJA 1A3XA 2Y2WA 4UFJA 1D2KA 2VMFA 3H7RA 4JD4A 1XGEA 3THAA 3W6YA 4LUSB 2TODA 3L2MA 4ZR8A 4L9YA 2Q09A 3A4AA 1DV7A 3WDQA 1RA0A 2OVLA 3M0YA 3BPWA 3MVTA 1SJBA 1KW1A 3I68A 2XGIA 3VDGA 4P7QA 3P84A 4ERAA 1KTNA 3LI1A 2E67A 3SCPA 3CB8A 1DWGM 5HQMA 1K7FA 2P0IA 2FZNA 3S2CA 3EA3A 4QS6A 1YXDA 1OIFA 2QPSA 2WW5A 3B8VA 1V93A 2BX7A 4QJ5B 4WLCA 3PZVA 2VVNA 3BOFA 3FCPA 1TPUA 1AFSA 1OY0A 4XVEA 1R7OA 4JGDA 1IHIA 3EPOA 3TTEA 3GC4A 3UPBA 3PWAA 4L6OA 3ARSA 1C93A 5D38A 3UXLA 1ITUA 1I4NA 1TWWA 4J2PA 3RM4A 4Z1CA 2BVYA 4RX0A 5A6TC 4PTDA 3E5PA 5AHNA 4W9TA 3WIJA 1QO5A 5AB3A 3BJSA 4JPGA 5BMWA 3TC7A 1X98A 3JW7A 3KDOA 3MUZ1 3AJXA 4PUMA 3LZ3A 5CJ5A 3KOXA 1Q6FA 4PCFA 3M0HA 2BY3A 3WLNA 3M44A 4JIIX 4F9JA 1XIJA 1VFFA 1KRBC 1MRAA 3K8LA 3MUXA 1RXOB 2EG7A 3FYOA 1ESWA 1VHNA 4UQEA 3GVGA 1QFEA 4JYFA 1DJIA 1S2UA 4HPHA 2JALA 4I9JA 1UD4A 1MNZA 3ZQ9A 2BSLA 4S2BA 1YTKA 2NUXA 3HM7A 4O50A 3H2OA 1E6SM 1TQJA 2YZRA 3LM3A 4LFYA 3VOJA 2TPSA 3W38A 1ISXA 1I1WA 3R94A 3ZIZA 1F61A 2ZZ2A 3EB4A 3TUUA 3A3WA 4XD3A 1H62A 4DI8A 5HMFA 1XW8A 4B4HA 4IXHA 1T8QA 4J3UA 3R0UA 1T7LA 1KKRA 2BDQA 3CQJA 2R1MA 3MSDA 3OP2A 4LNYA 1M1BA 1FWDC 2Z1SA 1Q6QA 3IRSA 2A85A 3RXZA 3U2ZA 4GYJA 4DXXA 2QDEA 3EX6A 4RV8A 2AKMA 1EJTC 4JY8A 5LSMA 3W28A 1Q85A 1E15A 1E1FA 3ABQA 1S1RA 5EKYA 4H8VA 2ZRWA 3BOXA 4GYKA 1XDLA 1XV8A 1K02A 4NZ4A 3G1AA 1Q3NA 5EBAA 4YWSA 1I60A 1C8XA 2XIMA 9CGTA 3VIOA 4WK9A 3REQB 1BXNA 1XYZA 3WNMA 4TTGA 4XUYA 1MXGA 3KVJA 3CS2A 1O5QA 1JZ7A 3CHFA 3VTRA 1HKJA 3U7VA 4E38A 4KFOA 4HK7A 2AL2B 2Z28A 3I6EA 1K9DA 3VIIA 1E4LA 5HMSA 2GWNA 5AC8A 3NAVA 6XIAA 1JXJA 1R5YA 3CHEA 1B9ZA 1W2VA 3WQFA 1J2BA 4RE2A 4U2YA 1F3EA 4B3LA 2YR1A 2YBTA 2DSZA 4GXPA 1DJYA 1S1PA 4JHZA 1DTUA 4X61A 2PBOA 3HFYA 3U5UA 3TWAA 3SJNA 3CAWA 1ZU8A 3PF3A 1TKKA 1GEQA 1P7TB 4W87A 3GXTA 4J3XA 4BF5A 2ACQA 3VOHA 3UZXA 4L4PA 1Y5WA 4HN8A 3MWAA 3LG3A 4RNFA 4PB3A 5CPLA 5IRPA 3GR7A 3UEQA 3G3DA 3S5NA 3PG9A 3C4UA 4C1NB 2D69A 4O28A 2RHGA 3AMCA 1I2RA 2WMKA 4LVGA 3QSTA 1PV8A 2VURA 4L65A 2X0SA 3TP4A 4ONVA 1PYMA 4A2RA 3WH8A 3HJEA 2J7HA 4W89A 2AGKA 2X8RA 1E1CB 3M16A 4PTMA 3AO0A 2GQ8A 1KQYA 1I2OA 3NTYA 1S39A 2OJPA 1BHGA 3LQGA 5BZAA 1JF6A 3QRHA 2VHLA 5D9NA 4MY9A 1ZY9A 2NX3A 7TIMA 1MEIA 3SCSA 1FWAC 3GFZA 4I7UA 4IGSA 5LA2A 3UGVA 3CT7A 4F8XA 5EL1A 1YIXA 2XJ7A 5K9CA 1LCOA 1SSDA 1VPQA 1WZKA 2ALRA 1CLKA 3B0VC 1GQKA 1W3LA 3KRSA 2JK2A 3SZ8A 2ZX6A 4J28A 1KFBA 1UH3A 1NOFA 2ISSA 1YE6A 2GDQA 5D04C 2Q8LA 2ZX5A 2DUAA 4CNTA 2VR4A 4AHQA 1TJ0A 1MZRA 2ABBA 1SFSA 1GW9A 3DHFA 4H9YA 1IWAA 3OZYA 5BXRA 1CXLA 4IIBA 1XIBA 3WMCA 1UD3A 4JDBA 3L4UA 1EQCA 4O1FA 4UNIA 1QNRA 2HISA 2PF0A 5LA0A 2CKRA 4ZQOA 2R9RA 5K7JA 2ZRUA 3DESA 1HFBA 1CXIA 1S5TA 1VKFA 2ONEA 2PWGA 4X9YA 1ONXA 3K1DA 1CXHA 4AD0A 4JIQA 2ZA3A 3E0LA 5D2TA 3HG5A 2XZ7A 4RLIA 3W7HA 4D72A 4B5UA 1W0MA 3IWPA 1L6GA 1BTCA 2VWSA 7XIMA 4OHQA 1K3UA 4CD8A 2WJEA 2W6RA 3M0ZA 2NSOA 2WPBA 3M9YA 4NP7A 3R7MA 2V30A 5JMUA 2QUVA 3O07A 4MZYA 4DIAA 3UJRA 1QI0A 4H9UA 2WZHA 2YB1A 5HMEA 2W3ZA 1KGWA 4YTTA 3NQ6A 4YPJA 2ZXBA 4QITA 5FL1A 2J8FA 3UNDA 4IPJA 3TA6A 1V79A 3F4VA 1SMAA 4MADA 3IJDA 5GPRA 1R3YA 2CC0A 2E9BA 4OJYA 4MGGA 2R14A 3QPEA 2ACRA 4L80A 5AKQA 4EANA 1VYPX 4B2DA 2EQDA 1PJ9A 1I75A 2FHFA 1US3A 3STEA 2ZYFA 3ES7A 4D1JA 3LTPA 3SJ3A 3IIXA 4O57A 5RUBA 4FHAA 1LRTA 1EC7A 1EBHA 1TPB1 2C16A 4BQ3A 3F4CA 2IPFA 2JF6A 1ADOA 3G1DA 3WH5A 5A2CA 3AZRA 1SO6A 2YL6A 3N6HA 4P7NA 1NDYA 3MSGA 4WXZA 4IQLA 1OD8A 1QJWA 2A21A 3LGEA 4XIMA 3FS2A 3QKEA 1J8VA 5A8MA 4TMBA 1P0KA 4UCGA 7REQA 5TIMA 1G4TA 3MWCA 4HD5A 2YYTA 4WEVX 3ZJKA 3UERA 4EAMA 5AHLA 3SY8A 4G7EA 3MYPA 2E6FA 3ARQA 2QNEA 2DY3A 2OELA 4I5RA 3G8EA 2EKGA 3WQPA 2TMDA 4GXWA 2QJNA 1Q45A 3WF0A 3QOMA 3GQYA 3WN6A 5HJLA 4FAMA 4I5UA 5AC4A 5A94A 2QKFA 4FLQA 3I3EA 3RU6A 3B9DA 5A8GA 1WCGA 1TX0A 4AC1X 3QY6A 3AIWA 4YWIA 1X1NA 4DHGA 5MHBA 4LUYA 3HGRA 4C6DA 2VR5A 1MFUA 5LHEA 4MB3A 4QGCA 4YXGA 4GVGA 1HKWA 4ZQMA 2IQ0A 2YZ5A 1AQMA 1E40A 4JIRA 1SW7A 3QFEA 3MCNA 3LMYA 2XWEA 4INFA 4PUKA 4P8XA 1TV7A 4KCTA 1EXPA 1A5NC 1PCWA 1L6WA 2A6NA 2G0WA 3FJLA 3R12A 4GZJA 4PFHA 4PUJA 5G1TA 3H53A 3JS3A 2G50A 5G2WA 4JX6A 2XIBA 3AQUA 3SRFA 1HGYA 4WGXA 3FV9A 3WBXA 3DKLA 1VFHA 5M3WA 4HPNA 2QCDB 1XXXA 2WJDA 2YL5A 1W5PA 2GJRA 4LV9A 1S2TA 3APTA 3TZNA 3GVQA 3N73A 4AIBA 4HZMA 5LIKX 3SRDA 2BWGA 1K8YA 1SR9A 1BWKA 4O1EA 2HS8A 3BWWA 4LC6A 3N25A 4NT0A 1CGWA 4P5UA 3GIYA 3KBSA 1GONA 1IF2A 1EZWA 4AWTA 3KBMA 1I2QA 1CLVA 4Q8QA 4I7WA 3PY2A 1NY1A 3CIWA 4JKKA 5TNVA 4LV4A 2ZBTA 1A4LA 3GB6A 4FNRA 4I9AA 4UQ9A 3ZWSA 4NJIA 3WNNA 3ORWA 3UR5A 4FP1A 3MMWA 3UZZA 2GUYA 3O3RA 1UUMA 4ERGA 4W4QA 4DO6A 4Q4QA 5CBBA 1R85A 2XIJA 3SQMA 2AQWA 3COTA 3LN3A 7A3HA 3BLIA 4LCRA 3CPUA 3W85A 2H90A 3N9SA 1EJRC 2Y6ZA 3WSUA 1P6WA 3UVIA 5A1AA 2BODX 4HOZA 1T96A 4EXAA 3ES8A 1WZAA 1E9YB 1VBHA 2RDWA 3PJTA 2WVVA 2GVJA 2ZXQA 3T07A 1DP0A 2QQ6A 4XO6A 3LTSA 3W07A 1FWGC 3LZ5A 1HTIA 1XIIA 4UFMA 3CWHA 4XZWA 4GI4A 4NRRA 2EO7A 2E3ZA 4UNLA 3MUIA 3ZVHB 4O10A 2GGJA 1S5NA 3SSJA 1H7RA 1RQEA 3NFUA 4PULA 2QR6A 4QJ3B 1MSSA 1US0A 1JL8A 2PD9A 1WPCA 5AHIA 2XPKA 2XN2A 4N0RA 3L4XA 4K6AA 1XD1A 2VNCA 1V0LA 3CUXA 1L8PA 4IFOA 1JCLA 3O2LA 1UKTA 1ZZMA 3B8TA 3F5JA 2WC3A 4FXSA 1CNVA 3IIOA 1PEZA 2OWWA 2ICSA 4PMUA 3WLOA 4IWWA 2E5DA 3NQGA 3LPGA 3ZZ1A 1RP8A 5CGTA 1JQXA 5B7ZA 1WKDA 3G1HA 1UR4A 4XAYA 2WBGA 3VNYA 3B8IA 1DJNA 1QWKA 4DYKA 2ZRYA 2Q3RA 3WDHA 3BQ6A 4FNTA 2R1PA 1BKHA 4MOZA 4YIWA 2X1UA 3KTXA 4YHEA 3D3AA 4AD2A 1TE1A 2Y85A 4RZ6A 4XZBA 2GZXA 5CPSA 1AW2A 3EWDA 3A9IA 3NUKA 2FHCA 1SFTA 1X7IA 1OD0A 5H2ZA 4Z2HA 2E1DA 1T5AA 1P43A 2QXWA 3W1XA 2HPIA 2EJ1A 5IDZA 1F3TA 4PSRA 4HA0A 3WLRA 2WKJA 3L0KA 2QCFA 2HE5A 4C6EA 2X16A 3MPGA 5EMUA 3QEZA 4UXDA 1XLCA 2YXOA 2Z2UA 5G4EA 5BU9A 4O1AA 4MVAA 4AQLA 3MZNA 3QTGA 3U4FA 2WBKA 1VIWA 3LPOA 3SI9A 5FAGA 1TFVA 1HJSA 1WDRA 3TYEA 2YGYA 4HHLA 3L12A 5E9AA 2FMOA 2V67A 3QMSA 2SFPA 1H50A 2WNZA 2XU2A 4NG3A 3TW6A 1BEUA 3GVVA 1OSEA 1Z48A 1BF2A 5A6MA 2GYIA 2DZTA 4NY2A 1CTNA 3AMGA 1T0OA 3B4YA 1NDVA 4RE3A 3F7JA 3NO1A 2I1OA 4BI6A 3RFAA 4HA4A 3DYOA 3FA4A 4ICMA 1NOWA 3DFNA 5FSEC 3CMFA 3M0KA 1ZJIA 4FX8A 1CZ1A 3VX0A 1W91A 3VNMA 2JKEA 1L6FA 3JZEA 1VBGA 2OYKA 5HOSA 5FJPA 1JGMA 5ABTA 2UY2A 1FXQA 1F2JA 4Q8UA 3SY1A 1LORA 1UP2A 4GZEA 4GBDA 4UQDA 4F4RA 1WDQA 3ZJ8A 3E6EA 3BMWA 4R33A 2FMNA 1OC6A 1VYRA 3W1MA 1J96A 1HZYA 1TWSA 3VGFA 2CNCA 4XWUA 3AC0A 3M5YA 2BGNE 3CJPA 2YYUA 1KM2A 4AYGA 4CD5A 5AFDA 3M5XA 4I3GA 4FX6M 2VP8A 4GG9A 4Q4OA 3VCRA 1B1YA 3CYVA 1KWKA 5CSUA 1FWWA 1QPRA 3GVRA 3IJQA 5KETA 2ZA2A 1C92A 3N2MA 4XIAA 1NAL1 1KXTA 3RRAA 3ZXWA 3K1GA 3PWIA 1XP3A 5A8NA 2POTA 3R8RA 3IS4A 1FBAA 5FF4A 1UB3A 2JGQA 3GD6A 3R8HA 4CD6A 4AD4A 1JD9A 3LY0A 1JFXA 4KESA 3FXYA 3KAOA 3OEXA 1UWTA 1UZ4A 2YDSA 4PL2A 4B5WA 1PWMA 3TU9A 4EXQA 3GXFA 3LBCA 3WNKA 5AN7A 3P81A 1ONRA 1SMDA 3UXDA 1I45A 3RR4A 2VZTA 3G5EA 1TPH1 4BQ4A 2I57A 3N19B 3W2LA 4GH1A 4DWDA 2VD9A 1G7VA 5FJOA 2QDDA 1I0DA 6A3HA 3WLSA 1JF5A 2V82A 3L68A 1W3IA 4LYKA 4AIUA 3Q2DA 1YKWA 5IM51 1ISWA 3STCA 3FHQA 2HVNA 4YNGA 1VEOA 1TB3A 3TQPA 5F2GA 3QR1A 4FK9A 2OWXA 1WDSA 2CXGA 2GDVA 1KCZA 2REQA 5I23A 5HR7A 4JTSA 3CMJA 1XRSA 5C8BB 3EB3A 3AMDA 4B2DD 3SADA 5CEWA 1REQA 5CQ1A 5HANA 2V3GA 2D0GA 1W54A 2OYLA 4S3BA 4IPNB 2HBVA 4PMYA 3DI0A 4FEZA 1HP5A 2OPJA 1K77A 1YDVA 4C1KA 4NZFA 3QXBA 3OA5A 1EX1A 3HG2A 2C0HA 1F5ZA 2V2HA 2QT3A 4IMGA 1HXJA 4GUGA 1JPDX 3LERA 1J2WA 1EZ2A 1W1A1 2Y63A 5LZLA 4IGHA 1X6NA 2I5GA 1QASA 1RALA 2PDKA 3GK0A 4HCLA 1ZB5A 4DLMA 3S4TA 3JR2A 1VRDA 4WJEA 2INZA 3FSTA 1XDJA 3N13A 4N7QA 1P0NA 4KFNA 2MANA 4G2DA 2Y1HA 1AJ2A 3ME3A 2V5KA 1FHDA 3CH0A 4TIMA 1SPQA 3LB0A 4H00A 4ALDA 4ZO7A 3CWNA 1JCNA 3QV8A 2WZTA 2GGEA 3NQMA 3UD6A 4FA3A 4PR4A 4MM1A 3FIGA 4DZAA 1PKYA 4RCXA 5CKSA 1PTDA 3CIXA 4FNUA 5H8UA 4A8NA 1FFRA 4FPSA 1SZEA 3MHFA 4ZB5A 2V3DA 3EWYA 4DLFA 4XZIA 4QAIA 3NSMA 1OYCA 4I8DA 2CEQA 1KLZA 3BLFA 3GAYA 1JRCA 3DFTA 5J5RA 4AD1A 3CUZA 4WDWA 4PTXA 2EG6A 5I00A 4FLOA 3WUEA 1PZ0A 1ZJBA 1D7FA 5CPMA 4DM1A 1WUFA 5D30A 2ASHA 1IT7A 1V0MA 3CO4A 2YL9A 5LNWA 4Y8EA 2Z1WA 2CXEA 2VJXA 1V3LA 3HTWA 3TTOA 1XSJA 1H7NA 1KFEA 5BXSA 1H4PA 3LHTA 3TYCA 1PIFA 4TVDA 2IKJA 3WX7A 3DFQA 4YTRA 3VOIA 3P67A 4JX4A 5E09A 4CU7A 1AQ0A 4KFPA 4CU6A 4FMVA 2D2JA 5F4XA 3KLLA 3EX3A 4N2YA 4LXFA 3BL3A 2EG8A 3TJ4A 4Z2LA 3W1PA 1QW9A 9RUBA 3GTIA 1GTEA 2Q8XA 2G96A 4LJ3A 3GYEA 1VFLA 1BFNA 3MP5A 5CC7A 3TOPA 3NEVA 3GC5A 4DBUA 1W9DM 3PBUA 1F3WA 5BW6A 3WMLA 3PB0A 1EHNA 1UR1A 3WG6A 2FH8A 3T40A 2G8ZA 3T81A 3CZLA 3W25A 1OJXA 5D09A 2PU0A 2F7FA 2GQ9A 3CNYA 1NDWA 2XFYA 4WOQA 3MZ2A 4ZTYA 2DH3A 2VGIA 2HNHA 2Y89A 4XB3A 5M03A 3W75A 3MANA 4Q7IA 2A5HA 3W3OA 3BV4A 2XFWA 3UCDA 2PGWA 1ZP3A 4C5ZA 1NTHA 4E6MA 4IIFA 3TR9A 1CW2A 1QWGA 4L7ZA 4S39A 5CC3A 2RDUA 4K1WA 3A12A 1IXOA 3GR4A 4ZE4A 2FZDA 3ITGA 2Z7KA 1UG6A 3P14A 4JQ3A 4ZXLA 3NO5A 3FKRA 1QI5A 2PGRA 1F9CA 1EA9C 1J4EA 3G77A 4GH3A 1JI2A 4M29A 1PHWA 4JBRA 3WLLA 1EIXA 2YFNA 1XYLA 1X6UA 1LQ0A 1U1JA 4PTNA 2V3EA 4MSSA 3WLKX 3S42A 1RVGA 3VKJA 5FEWA 4WDUA 1NVMA 3EMQA 3ZYZA 3QV7A 4UQBA 3CV7A 4L4LA 4JTCA 3H2CA 1VQTA 5JBFA 1ML1A 1BG9A 4MKVA 3WENA 3M5VA 3P93A 2VEPA 3VDHA 4HJFA 2CBUA 2DPEA 3CUJA 1UPMB 5LIYX 3IARA 3QYQA 2PB1A 1VFOA 1ONEA 3VA8A 2XFFA 3CQKA 4C6QA 4F66A 1EKOA 3WQVA 4JTEA 1EUAA 2Z24A 3G1RA 3PN8A 2C3ZA 2NWRA 2CHRA 3WQGA 1XHGA 3BLKA 1Q4WA 2VFEA 5I07A 1UW9A 3W2KA 1E9ZB 4G6CA 4JL1A 3AZTA 4RR4A 5BOOA 2D0HA 3QOKA 1XIHA 3NDZA 2XN1A 3RLHA 1RD6A 4HYRA 3SCUA 2PDIA 4WDXA 5D2VA 4Z17A 4LEQA 3K13A 4QE5A 4MWAA 1ZFJA 4GZ7A 1CWYA 2DFAA 3SQLA 1DHKA 1FWIC 4TXEA 5KEZA 2DZVA 2WC4A 2GLKA 2HVMA 2OKTA 3FJ4A 3IJIA 4M82A 4UFLA 4D9PA 1K9FA 4MJZA 4ZO9A 1BYCA 1V7AA 3DHDA 4O8AA 1BGAA 4EPKA 4JICA 4MDOA 4A3RA 2VC5A 5A5WA 3KVLA 3VO0A 1MUCA 3T7VA 4HSHA 2XVGA 1RP9A 5FJUA 1CXEA 1WDDA 1VBRA 1EC9A 2CBJA 2D0FA 3C56A 3ZSSA 4PCTA 5FCZA 3P7YA 1OFEA 1U83A 2YDQA 2A1YA 4L9ZA 3W37A 4PCPA 3VDAA 3GSMA 3GW3A 5C71A 3S8HA 1Y0EA 3R5EA 1XG3A 2HVOA 2PDJA 2X1SA 2FZ8A 1TRIA 2A7RA 2GL5A 3E2RA 1TO3A 3QMTA 4GY7A 5FESA 1KGUA 4A29A 3T0CA 1D8WA 3RLVA 3RG6A 2HROA 2A6LA 3AZSA 1U1HA 4IOTA 3UWYA 2PSNA 2FJKA 3KP0A 2BZNA 4JTFA 7REQB 2VC9A 3CUFA 1Z9AA 3QLDA 1GPWA 3A47A 2PODA 3M6YA 1MZHA 3FSUA 4JAWA 1C29A 3LV5A 2ABAA 3IIPA 2Y5EA 2WMFA 4G7EB 1HP4A 1KFLA 4IZGA 1V6UA 4FLSA 3FJNA 3ZWTA 3MJYA 4IMEA 3LXAA 4JTIA 3UZ5A 1GORA 4NYUA 1JDDA 2VOTA 5GVJA 2CLFA 1FWSA 4NNCA 1B5TA 4H41A 4JR5A 3EMZA 1KGXA 1G6CA 4F3HA 1EYWA 2A7NA 3WH6A 3VKBA 5F4SA 2DZXA 1C8VA 2BNJA 3NYDA 3UPWA 2Z1KA 3TV8A 4HNTA 3WF3A 4GC3A 3NQ2A 4D1IA 1DHPA 4TTUA 4EP8C 1R2RA 1X7FA 3ONCA 3CPRA 4NIRA 1FCUA 3ZMRA 4BQ5A 3P0WA 2WCSA 3AXIA 4F2UA 3SDOA 5HA7A 1AA1B 2XDFA 4QLJA 1S46A 1E6ZA 2DT3A 2OB3A 5LHFA 3THCA 4UTIA 1GG1A 3MUAA 2VTFA 2GFTA 2OLAA 2XGBA 4AYSA 1P4CA 4IXXA 2R1KA 4DXVA 2O55A 5ABGA 4CCCA 4O16A 4B15A 2JEPA 5C54A 1OVDA 4HVXA 4LYQA 4HPGA 5EMLA 1TTPA 4DUXA 3RN6A 4MYAA 3PZNA 3OU8A 4L6DA 4WQ6A 1B3VA 3M0LA 2XYLA 3MTWA 4JFTA 1D3CA 4LYRA 4HN4A 1OGSA 5J8LA 2PTXA 4O53A 3LOTA 2ZA1A 4DEFA 2V5CA 1OIMA 1QRQA 1DOSA 5ECUA 5D4YA 2EPHA 1AL7A 2UBPC 2DW6A 4MB1A 1VJSA 1DWIM 1JCJA 1H60A 5C5YA 3WF4A 3GY1A 1OM0A 2IUZA 4K8EA 3SW6A 4Z1BA 1KBJA 3P62A 1EWDA 3C3UA 1LOSA 1WA3A 4NX5A 5BXTA 3KLKA 3UF9A 4L6HA 3W2MA 3EKZA 1V8EA 5LIUX 3H55A 3NGFA 4MNLA 4B5SA 3LLFA 1H09A 2P8CA 3WUBA 3ARZA 1V5XA 4HYVA 2Y61A 5A6BA 4GIYA 1CX9A 3UJEA 2WVVB 4DF2A 1P1MA 4XD4A 1RHCA 2G3MA 4QX4A 1R9ZA 1QPNA 3M5ZA 3A5FA 2J24A 3C6CA 5FI8A 1DJQA 3TN6A 2O7SA 3CEUA 1MO0A 2F6UA 1DQWA 3L5LA 3NXFA 3NPXA 3N2TA 2R6OA 1UUOA 2JBMA 4PMXA 2DH2A 2BXYA 1V7YA 2YIHA 3CC1A 4M24A 3CZEA 4GI8A 3UU0A 3NQ7A 3BARA 3OG3A 4KIEA 2Y0FA 4UTFA 4ZOBA 1XISA 1XLDA 3R0DA 5I06A 5DRCA 8A3HA 3G0XA 1MXSA 4JFVA 3O0KA 3WDPP 3KS6A 3L0GA 5EMJA 3EMCA 2OGYA 4OE7A 2PWFA 3N2BA 1JZ3A 1GOKA 2CBVA 3W71A 4AFYA 3NZRA 1TR9A 3HN3A 2VDIA 4UR7A 4HT3A 3PBVA 4OWGA 1YNPA 3SBFA 2D3LA 5EU9A 3TDFA 1XH1A 4NZJA 1OGGA 3RMJA 1GVQA 2RFGA 1X39A 1M68A 1JYWA 3TR2A 1VF8A 3AS3A 3HV9A 4WSJA 2GJXA 3SSZA 3LXBA 3VNZA 1IEIA 3VNDA 1BYAA 1UP3A 2WMHA 1H1ZA 3AYRA 3KCOA 3NL5A 1XGDA 4LB3A 4DVOA 1UZDA 1W9UA 1F73A 2VZOA 4PMZA 3C0QA 3POHA 2GSJA 3JRKA 1B31A 3W00A 4PE8A 1EPVA 1VFUA 2D2HA 1WKEA 1HVQA 3T6CA 3TCEA 3WJYA 5DN1A 3T09A 5U7SA 4ZMGA 1SR0A 4MWAE 4NF7A 3GBEA 4GOAA 1WOAA 3PG8A 2VCCA 1R0MA 2ACUA 4D6HA 1W3KA 2BGSA 1PZ2A 2AGTA 3W29A 3ARUA 4GVHA 1H41A 4QJ4B 4US5D 1DKWA 1W5QA 4RPPA 3H26A 4OVXA 1XPYA 3OB8A 4ZE5A 2OTDA 3QW4B 1QHZA 2I7GA 4ZB2A 3SUWA 1FHUA 1QO2A 2EPNA 1UOKA 3N2OA 3OZPA 3TEVA 4GI9A 3LHZA 2J7GA 3NOEA 1BRLA 2YXGA 3R11A 3APGA 3G18A 1EYEA 3CZ8A 3GTXA 1F76A 1TR1A 1DE6A 5JBEA 3LCXA 4WVXA 4XISA 4EE9A 2C0AA 2QJMA 4OOUA 3UG8A 1P1XA 3GWQA 2XH4A 1MWOA 4A3QA 3AISA 3FA3A 1G94A 4IFRA 1J18A 4L4OA 3D46A 4LEFA 1RJPA 1V77A 3UGRA 3URQA 4OFCA 2YXXA 2WYSA 3O63A 4O11A 4Z1DA 3ITTA 3R43A 1RCQA 4C6KA 3CLMA 1X97A 3RHGA 2PDBA 1RK6A 5A6KA 3WBWA 3GNNA 3NOYA 1ZBVA 3DEQA 4C5YA 3UWWA 4J1OA 1D3HA 3RNDA 3VNIA 4WXYA 1HKMA 5DFAA 4XX6A 3W2JA 2HK0A 3W7EA 1DYSA 2QJGA 3CHCA 1KWGA 4PRTA 5D8WA 2CLEA 3IUHA 3PC0A 3QHNA 5DMYA 4AZIA 4GGBA 1FHLA 1QAPA 2FJUB 2VEGA 2E9LA 5HWJA 4HK5A 5E0FA 3BQ5A 4H6KA 4Z0JA 3NYZA 1JXKA 1GOIA 5XIAA 3URBA 2ZUUA 3BV7A 1FFQA 2MUCA 2Q3OA 3UBPC 2YB4A 4MAVA 3ZFHA 4DJFC 4NJKA 1AJZA 1IGWA 2WCAA 4FB7A 4ZFCA 3OA3A 1JR1A 4C7DA 3V36A 3KCLA 1PO9A 1OCBA 4QFUA 5TAOA 4PL1A 1FCQA 3GRIA 2E5CA 4UTKA 4NNBA 4PUDA 4Q3MA 4HPXA 2YDAA 3EZ4A 1H7XA 5JVLA 5TD4A 4KEZA 4RNJA 1A5BA 5D8ZA 1VBJA 1MW1A 1D8CA 4LWWA 1YLVA 3CV2A 4YTUA 3OHIA 2QGYA 5BU6A 2CYGA 2EKCA 1TG7A 4HTYA 3WLHA 1J5SA 5CJMA 3RJYA 4K1GA 2QHAA 1GYNA 4QAWA 1GQIA 2WKGA 3H70A 3BUVA 5AVHA 1E0XA 2NQLA 4LYPA 1TVNA 1W3HA 3WQEA 3QYSA 2HWGA 4PZVA 1HJUA 1UKPA 2QCHA 1RCOB 4PMJA 2DQXA 3T4CA 1XIGA 2NW0A 1S2AA 3TIMA 3R10A 3VYLA 4HK6A 1LZOA 1V0NA 2YL8A 5BCAA 3WLJA 4E5TA 1LT7A 1BD0A 4YVVA 4KRTA 4GUHA 5D03A 1NJJA 3WD3A 3MHUA 2REQB 1PIIA 3RGTA 2ZXDA 2JIEA 2WPGA 1RPXA 3H2MA 3OVPA 4QM1A 3S0CA 1REQB 3K8MA 1E9IA 2J9ZA 1PIGA 4ACYA 1O1ZA 3WQOA 3ABZA 1U5VA 4EIVA 3BGJA 3RX2A 4KETA 2XINA 1OYBA 3N12A 1J79A 4LX4A 3M43A 2X05A 3DU0A 1JZ5A 1A47A 5HQEA 3GLCA 4UR9A 3TKFA 3IVUA 2R1NA 4BK9A 4AZGA 1KR0A 3W24A 5JIPA 5HR6A 3W02A 1CGVA 3WQ6A 4GQQA 3ZOAA 1GVSA 1WV2A 5FEZA 3SCRA 1H61A 3VOCA 4H04A 1WAWA 1JPHA 3W84A 3I10A 3GNOA 2PCEA 5GJNA 5FEPA 3RCYA 1J9YA 4HZ8A 2OSYA 4LCQA 4I90A 4CNUA 4BI5A 4P8VA 4S2CA 2ZC8A 5M17A 2W61A 4YYCA 3P74A 4GUJA 1ZBCA 3ARVA 5DF0A 3CV6A 1XIMA 1E55A 2EXOA 3MJMA 3KX6A 4B5VA 1NSJA 2X41A 3ID7A 2PPGA 3EPMA 2ZRXA 5T91A 1A0CA 4O0QA 1TMHA 3VGEA 4LF2A 4KT2A 1DJZA 4BF7A 1OABA 3AXHA 4LSBA 1YTDA 1I6NA 2AKZA 1VLWA 1Z7AA 2E6YA 3LEPA 1J6PA 4OV9A 1E4IA 3QHMA 1OYAA 3M0MA 3WK3A 2PF8A 3H4WA 4BWLC 1FKXA 1B4KA 2GSHA 3MMTA 4R9OA 5A6LA 3BLEA 3KWSA 2HK1A 2YBVA 5CZ0A 1Q4NX 2FLIA 3IIZA 1L6YA 4IPLA 2CLHA 3BW2A 4GX9A 2DUXA 2WHMA 3OVGA 4QQ3A 1XLEA 2J77A 4YMZA 3RIKA 2VRKA 3M46A 2PWUA 2E8YA 1N55A 1RSCA 3GDBA 3PVFA 4RNIA 1DTNA 3OPSA 3EBVA 4XKYA 1V6WA 3G6MA 3ITXA 3L4WA 4UWMA 1R3QA 5AZ0A 2Y7DA 2WZMA 2PGFA 1W8GA 4LY4A 3FA5A 2CPUA 2YCEA 3QSRA 1VENA 1XBXA 9XIMA 4R7JA 1TV5A 1BVNP 2IMRA 3C2OA 1JPIA 2DT1A 2YSWA 4C6FA 4R9XA 4CNPA 1Q6RA 1CB7B 3ECQA 4NSBA 2Z0IA 2QCLA 5D9PA 4HZ7A 2VRJA 2VCBA 4GY0A 5M1TA 4IMDA 2QCEA 1TV2A 1AMYA 3IV3A 4O1BA 4DWSA 3NL3A 2Y88A 2J47A 4MPQA 3V5FA 1Q8JA 1VIZA 2Y7EA 3ZO9A 1EDGA 4XO7A 1CDGA 3VNLA 2GQ3A 2Y70A 1KXVA 1A5SA 1XINA 5CJNA 4LUTA 1NP0A 2PU1A 3TLLA 4JIEA 2P1FA 4QDPA 2J75A 1DJGA 4ZO6A 2DIJA 4PMOA 4ZXOA 4HHPA 2ZDSA 4GVIA 4PBEA 1CGTA 3OQ8A 4ZQRA 3K30A 2Q6ZA 5A6BD 4Y7EA 1GJWA 3AI0A 3KM8A 5D2YA 3FKKA 4AY8A 1Q2SA 5FOOA 5EY5A 2YPIA 2DZPA 3SUUA 4MJMA 3LSBA 3PAJA 1G01A 2ZZ5A 3FYYA 2VWTA 4AD3A 5JH2A 1K8ZA 2FGBA 2GUUA 1SJAA 1Z69A 4Y9PA 4N9EA 3UJFA 1VH7A 4RNHA 1DIKA 2BOGX 3UYIA 3IIVA 4ZSUA 3GNRA 1A5MC 3NSNA 1E5JA 1SZNA 4JTLA 3H2EA 2WJFA 4LRSA 4M5PA 5XINA 1Z41A 3RCMA 1A3HA 4X2PA 3G1XA 4BR1A 4TOQA 1AQFA 3ERPA 4R3UA 1ZSXA 4DUOA 2X09A 1J0JA 4M80A 6CGTA 1XH2A 5DMMA 2NVCA 4E2BA 4PMNA 3W7IA 1E1EA 1LL4A 1QI2A 1MXDA 3V5OA 4HNLA 3AUJA 4AX7A 5CSRA 2RJHA 4H6QA 1XSIA 3BICA