3VGDA

Ctystal structure of glycosyltrehalose trehalohydrolase (d252e)
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
555
structure length
553
Chain Sequence
b'AYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLEAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 193
structure length 553
sequence length 555
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgdA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgdA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgdA02
1UWXH 3D2UA 2ZX6A 3SDCA 1RFDL 1M7IA 1A9BB 1P7KA 2GJJA 5IBUB 4PRHD 3VVGA 4FNLL 2N7BA 1UQYA 2COQA 3ALXA 3QDMA 4O02H 1OT2A 4NZTL 3C5JB 4S11A 3IB4A 4Q58C 5EWIL 3VFVA 4NUJB 3WY1A 3PN8A 1U91B 3OGOE 4UFKA 4YXLL 5BZWA 1EUUA 2R0WL 4ONHA 4NSKA 4P7RA 3TO2B 3CFEA 6TAAA 2HVMA 1G7PB 1TJHH 3LMJL 2G9HA 3X12A 1AGEA 3KPQB 4GW4B 4NQED 2VDPH 3SDXF 4DN3L 3SKJH 2CKSA 2DSUA 2HH0L 1NC4A 4QY8A 1MUJA 5A8MA 4ISVA 1A6TA 4PP1C 4ZTPL 4WNQB 2HVJA 5ESVB 1TITA 1XF3A 4JHAL 2X7LA 1PSKL 2L7UA 4M7JL 5ISZE 4FTVD 4WUUB 5DJYA 1LO2L 3U2SB 4YDIL 4JHWH 2V6HA 3V4PH 1A9EB 5LJYH 2YN5A 3OZOA 2HFEB 4YDLC 5EBGA 1MHPH 4BH8A 1M1SA 4PGDA 1I9RL 4XWGH 1QSED 5JBDA 1F6AB 3A0OA 4CL7A 1GOWA 3RY5A 1N5AB 3K8KA 5C3LD 5EU6A 4YN5A 3IJSA 3G6MA 3JTSA 4NHCL 2H8PA 4Y5XC 3GIZH 4CAGA 1G9NC 3ARGC 1RK0A 2YMXL 1PGRB 5IFHH 1JE6A 4JQIH 1NPUA 1P84J 3OAZH 4GXUN 2ZCKL 1NCCH 4HIIA 4M1CD 1ISXA 3CZNA 3BPLB 3AOFA 3NZHH 2F8OA 3WFCH 1F11B 2ICWI 5I8EA 2J5LC 1PBYA 1JV5A 3B5GA 3UTZA 3FRUB 4N8VG 3U6RA 3DDFA 2ZUWA 1U3HB 3O4LE 1OGAE 3BW9B 2HT3C 3WJJC 4HUWA 4XHQA 5IG7A 2IPKB 3FB8A 3EDFA 1MFDL 5T1KA 1H2JA 4WEBL 1ETZA 4YDKH 1ACYH 4JFXB 5HGHA 1DN2A 3QDGD 3ZKND 4PGCA 1N7MH 5ICXB 3F12A 3HI6H 5CJOL 4HUVB 2K3TA 4XP4H 4ZMAT 1E15A 1NQBA 4YAQB 2FEEL 2VVNA 3DGGA 3PHOA 3W0WD 1F3RB 1KN2H 1R34A 4QFUA 3ZKMD 1QR1A 1FSKC 4UQEA 2WAGA 2ERJC 4G3YH 3H2WA 3WDPP 2PUQT 5IM7A 4FN0A 4P46B 3VU2A 2Q3ZA 3W24A 4P2RA 5E6IA 3SE8L 1JI2A 1ZBWA 3NN8A 3F7VA 3V4VH 1TCRB 4A4AA 1EZVX 1KF9B 5JXAL 1JMXA 3FQNA 1BEYL 1UKSA 5B3JF 1Z32X 4KZEH 2X1OA 4Y4KB 4E0RA 4LPWA 2W59A 5E8NA 4HG4J 4G6MH 1W0VB 3V6ZB 3RL2A 3ARFB 4YXKL 1DWFM 1W0YT 1MJ7H 2O5XH 2VLRB 3IDNB 1ROWA 4FFZH 1DLFL 4FP8L 5D1XD 1QW8A 3IJHA 4G8FA 2EEXA 2B0SL 2XV6B 1UR1A 1RIVL 3F6IA 4L3EB 3OQ3B 1T2QL 5DLML 4BFIB 3JWNC 43CAB 3BAIA 3LQAH 4TVDA 1A47A 3VG0H 3EJRA 3FMGL 1CU4L 2VERN 2NW3A 2Q8BH 2PTTA 3RNQB 5KG9B 3VPLA 3WH5A 3O3UN 4P5KB 5JA9A 1LE9A 4OTXL 3BN9C 3JWDC 4JREC 3Q5OA 4DVRL 5C0BB 3DROB 3FFDA 5BZDB 4ODSL 3FOLB 2J62A 1E6ZA 1BD2A 4RGNB 4AIZA 3MRFA 3OJMB 3HB3D 4HS8L 3ULVL 3WHE0 2ZX5A 1UR2A 2YPKA 3L4YA 3QFDB 2WIIA 1CE1L 1WAAA 1WP6A 4JVUA 1Q6FA 3QJHB 5E9DE 1LHZA 2QSTA 3L5XH 4F7EA 1YN7B 2J7LA 2ZE0A 4AZCA 5LGJA 5FYJE 2WHMA 4LBEB 3K2UL 3N1FC 2AJ3A 3I6LD 1U8MB 4RQQB 1KIRA 4YR6A 3IU3A 3MRBA 1QHOA 2C3XA 1T5WB 4WU5A 4ZO8A 3NYDA 3C9NB 3KPPA 1D2KA 3A6BH 1Z5LA 3T4YB 4F66A 1U58B 4G6AD 4O51A 5D71H 3MJGX 3U7BA 3JXAA 3I3BA 5HPCA 3DX7B 3VXNA 5B38B 4KHTL 4D9LH 3HTLX 3GRWL 2RGMA 4Z0XA 2NSXA 2GK0B 4ZQKA 2Y07H 5AWNL 2DM4A 4FQLH 4R4FL 3QUYD 4HUNB 1A3LL 5CEYB 4LIQL 3IFNH 3LRSA 5A8QA 2F18A 2F15A 4U1IA 4JZNB 4LVNB 4OD2B 1U95B 4W5ZA 3DHMA 3IGAB 4GFTB 2PTUA 4JCMA 1HILA 1KB5H 1ZHKB 5T3XD 4Y5YB 4WV1B 3FB6A 4WUUE 3B5TA 1QSFD 2DQUL 2K1MA 4YHYB 3VXQB 1A6ZA 5T5NF 2I5YH 2H41A 3DPBA 3MJ9L 4GRWF 1ESWA 4P8XA 4ZD3L 4OCSH 5D1QD 5K9KA 5HSFA 4NN5C 3V0VB 1DTUA 4JFFB 5CEZD 5C0DA 5HHPB 4Z7NE 1W9XA 4LCWD 4RMUA 3H3PL 3QZWB 4N5EC 2VCCA 1NCTA 3KYOA 4KQ3H 1Q6EA 3IDUA 4JANB 5CP3A 3QXDA 3VFPA 1MW1A 3WFHB 3ZSSA 3O6FA 3ESUF 4MNHA 3K7UA 5D70H 4RA3A 1E3XA 3WENA 3GNRA 4PUDA 4ZTOH 4OM0L 32C2B 4XC1L 3DMMC 1JHKH 2X4OB 2DICA 2CBIA 1E1FA 1B88A 4DAGL 3TNNB 3OAUH 2YD1A 1BYDA 1QNQA 2FJGA 3LKRB 5FO9A 4HD9A 4YE4H 2XA8L 4PTWA 4M29A 5EOCJ 3UJIL 3VXRD 5EPMB 5DVMA 4O58H 2R23B 4U0RB 4WI8A 1H3WM 4I8DA 4UOZA 5L9DL 4Q7DA 4HC1L 1H3TA 1GOMA 3MOBH 2X41A 3EYFA 1RQ5A 2ARJQ 1QWNA 3E8UL 1W1PA 5ADOH 2GJRA 5AZEL 4YO0B 3GSOB 4QF1B 4JFUA 1R86A 5DUPH 4I3SH 2N7AA 3S97C 4JVPA 4CCCA 1QEWB 2A9NL 1KEMH 35C8H 5KAQG 1FJ1B 3O2LA 3OJ2C 3DYMA 4BCEA 1G7LB 5D5MA 1EH9A 4PSRA 3AXLB 2BNQA 1XH0A 1I4FA 2APWA 1ZXQA 2VRJA 3CTTA 5HGDB 1EFXD 4J4PD 4XBPB 4KMQA 5I6XB 4U6TA 2VLRE 3QUZD 3MRMB 1A1MA 1T66D 4P2QD 5BVJB 2YBUA 1GZQB 4HT1L 2Q86B 2WMGA 1FL3B 3L3IA 4L3EE 4F57H 1UT9A 4HAFA 2F19L 5GGVL 4I0CC 1WFNA 1NQ6A 4PY7B 2PYFB 4L8DB 1OW0A 4X6DF 1HSBB 3ARDC 4JGUA 1NKOA 2MHAB 4Z18A 1MEXL 1IT9L 1IC7H 4POZC 1CI5A 1PFCA 1UD4A 1R3HB 1MI5A 1H5BC 1GYAA 3RWCA 5C8JA 4FZ8H 4PJBE 3MNWA 1RJCA 4O02L 5ADPH 5FIPA 3JUGA 1HP5A 2NR6C 2W60A 4X99A 5DI8B 1JNEA 4R97B 3RDTA 5D7JA 2HJFA 4H20L 4RGNE 1CF8H 3FTGA 3L3HA 4Z76A 5MENA 3BPNC 4LCCB 1NDGA 5J6HB 5IMOA 2DBLH 5D72H 2VDPL 1OP5K 4Y7MA 5JPNA 2BVDA 5D7IB 1ISYA 4GZJA 3OJVC 1R46A 4K55A 3MMEA 3VXTB 2WV3A 1JZ6A 4HX1B 4PJGB 2IH1A 4ZAKB 2GFTA 5KSBB 4JHWL 4D72A 2BSTB 3V4PL 5HHQA 1MSPA 1XGYH 1GCFA 2XWEA 1MHPL 2J25A 1DQDH 1JK8A 1JGDB 1HHGA 4APQD 4XWGL 3DX9A 4JFQA 2FO4B 4IOFC 1KJVB 4PS4H 3HI5H 3T0BA 3FFCA 3C60C 4LSVH 1HOCA 4X8XA 3CFIC 1A7RL 2IANB 2PNDA 3TCLB 5D6DA 1NCCL 3KYMA 3LX9A 1S7RA 2CLRA 1QLRA 2QHRH 3NZHL 1I1CA 1MWAH 3N18A 3ZT6A 1TVHB 4XXCC 1HVXA 4IRSB 3NCFB 2WW5A 3VFRA 1DQJB 5D1ZB 1AP2A 5CINH 4NO0D 1M7DA 5C0RH 2X40A 4PJ8C 5C86A 5INCA 3PL6D 3D2UB 4G42A 4WFEE 5KSAA 2CLVA 3SDCB 1NUNB 1ACYL 4JFFE 1H4PA 3MLXL 4GQ9L 4DGVH 3HI6L 5ALBH 1CNVA 4BSWA 3QDMB 1A5FH 4I0PB 4YZFE 1XR9A 3A22A 1PZ2A 1JWSA 4IJ3C 1EBPA 1T0NA 3ZKSD 2XPGA 1CR9H 3CFEB 3O81A 4FQPA 3VH8A 1JAKA 3SUUA 4CBPA 2G9HB 4MJ6A 3X12B 4Z5RA 3AZTA 5MERA 1AGEB 1IQWH 4P23A 3V4VL 1IGIL 3ZE0E 1JF5A 1NC4B 3GMRA 4KZEL 4QY8B 1MUJB 5E8DL 2P8PA 4ISVB 1A6TB 3OKEA 4MA8L 4U7KA 3LRKA 4M6NH 3TF7C 2HVJB 1NGQH 3ZE2F 3NIDE 2C3WA 2X7LB 4G6ML 1T4KA 4UAOB 1DL7L 5DJYB 2ALWA 2UZIH 4OUUB 1UWTA 5IOPA 1OWRM 3HHRB 1RI8A 3BQUD 4U1GB 4TSBH 3TIEB 4BH8B 3MMWA 3TZVD 1GGIH 1DQTA 3HG1A 4PGDB 1MQKH 4K7PH 5F7EH 4RMWA 1E1EA 43C9B 1T03H 5EU6B 3LQAL 3ZYZA 3VG0L 4B16A 4Y4FC 1RPKA 6A3HA 2H8PB 2PXYA 3Q48A 2Q8BL 5ITBL 1KBGH 2OSLA 3RVWD 5FHAL 3OZPA 4OBSA 2X0HA 4WW2A 1SJVA 2IPUK 1I8LA 3FOMA 2D03H 3SJVD 5BVPH 1CLXA 5DD0H 3QH3A 5ISZD 5I8EB 1JV5B 2BCKA 4XMLH 3UTZB 3U6RB 1TQCC 2DLTA 1NFDB 4X7TA 1KWGA 4NKIH 2HVKA 3EDEA 4JFTA 2EXYC 2R9HC 4M6MH 4HUWB 4LL9A 3KE0A 3FB8B 5HGBA 5TJWK 1GOKA 3HR6A 1ETZB 3GXIA 4LHUD 3QG6A 3F12B 2BS9A 3QWOA 4WU7B 1HCFX 2XN1A 1YPZB 1D5BA 2Z91A 4N0CC 3DGGB 4PJXE 2HT2C 1HHIA 3PHOB 4D3CH 4JPKH 5LBSH 1QR1B 4AMWA 1TFHA 3OKLA 5D2NB 3VKKA 5DK3A 1CD0A 1CT8B 5D71L 3QULA 5IM7B 5E6IB 3NN8B 1KN4H 4NKMB 2JELL 3BZFB 2IEPA 1DUZA 3O4LD 3FQNB 1OGAD 4NC1C 4WHTA 1CCZA 4D9LL 2W9EL 4WCYH 3QQNA 4XNZB 2R2EA 4E0RB 5E8NB 1WDSA 3S6CA 3VFTB 4DW2H 1WT5A 2KL6A 3HCVA 5AYQA 3SCMD 3KNBA 2DQGH 3C09C 3RL2B 3HAEA 3IFNL 4JDTH 4LGSB 2F8VA 5LGHH 4ODWA 1WCQA 3OB0K 5CILH 2XZCH 3IJHB 4G8FB 1KTBA 3NFPA 4JRWA 4QNPF 4Y2DC 3BLPX 1K5NB 4PJGE 5IB4A 4KJYA 5FUCC 2OW7A 4DJMA 2WMPA 1OSEA 3PZTA 1TE1A 1IMHC 2I5YL 1B3YA 4XZBA 2YJQA 2NW3B 2PTTB 4P5TB 3MOAH 5CSGA 4OCSL 5J4MA 1KTLA 4XUYA 1LE9B 1J87A 2VZ1A 1HVQA 3G5ZA 2EE2A 3UPAA 4JFOA 4JKLA 3FFDB 3G6AA 2IANE 3DSNA 4PMDA 1G0XA 2AXFB 1CS6A 4C58B 2WP3O 4AIZB 3QG7L 3Q1SH 3WV0A 1JUFB 2YPKB 4WGVB 1BZ7A 3ZDXF 4AMKH 5EO9A 2VCAA 2WIIB 3CC5A 3TYGH 3HE6C 4CD8A 4BZ1H 3L2MA 1X4YA 4M8VA 4ZTOL 3CH9A 4LQ1A 5IB5A 1SEBA 4F7EB 2NYYD 2ORBL 3NCEB 4LMQE 4PLJD 4HZ6A 3WHXA 5BV7L 4JJHA 5LGJB 1G01A 1GHFH 1T80A 4L3CA 4ZPTA 4PRBB 3IU3B 4YE4L 1XCTA 1KYOJ 3W53A 2OYLA 4CVZA 3W6MA 1GXEA 3AHVA 3LPOA 3MO1A 4O58L 3THDA 4Y16D 1ZVHA 4MCYA 3NCOA 1JGEA 2GJ6A 1CLOH 3O3AA 3QDME 4O51B 3ULVC 1HIMH 4NRZA 2O61A 4I0KA 3QFJA 4GQPH 3MOBL 5GS0C 1TETH 3PV6A 1WICA 2CRZA 5FGBA 1OTTD 3BI9X 3BP6A 3SO5A 4M7KH 2CJUH 4Z0XB 5DUPL 3VGEA 1OCQA 4I3SL 2YUXA 5E9DD 4ZQKB 4GW1A 3AY4C 35C8L 3FKUS 5FYJD 5HDBE 3HAEG 3LRSB 3P4LA 5FKYA 1MCWM 1ZBVA 1NC2A 4U1IB 1LWHA 3LSOA 1YEIH 5DGRA 2G3NA 4CKVX 1HILB 2W0FA 1JTPA 3VIPA 5SWSA 3MRPA 1S7VA 1Q9KA 1HKJA 4L8SA 4U3AA 1VEMA 3LKSA 3B43A 1A6ZB 3B9KA 4PMVA 1HKMA 3U7AA 3L7FB 1JZ8A 3I9GH 4S1SL 1MF2L 4F57L 1HKLL 3WNKA 2PF0A 1J86A 5MHSE 5EU6E 5C0DB 4WGWB 3T09A 2EDXA 3HMCA 5JORA 3PDGA 3FL7A 1IC7L 4OF3A 2ZCHL 3KYOB 4AD1A 1RZ7H 4MWFA 3VFPB 2PYEA 3M46A 3O6FB 4FZ8L 4KKLC 4MS8C 2X4NA 4MNHB 5I24A 5ADPL 4Q9RH 5I71C 3FNDA 5D9NA 4F58L 4WUUD 2UZXB 3RA7H 3K2MC 3T4AA 5D96C 2C1PB 5MI0B 4NM8L 1HTYA 2ZWLT 2I9LA 3EOBB 4MVBD 1CF8L 1NFDE 4G8EB 4ZODA 2X70A 1SQ2N 4ZFZA 3VDAA 5DFVD 5HOSA 3LPWA 5FO9B 1BVNP 2DBLL 1CDBA 1KTDB 1DDHA 4OSUH 1FRGH 4GRLA 1I1AC 4HSQA 5BJTB 2Z1KA 1XAUA 5GS1C 4QRUB 4HBQA 4BZ2H 4YK4B 1ZBCA 1HINH 1A7NL 3SGJA 3VIGA 1T83A 1QOXA 3RP1A 3PXJA 1DQDL 2VRQA 4JFPA 4P2RE 4YEFA 3DO7A 3MRCA 4AY1A 1CIUA 1BSIA 2XWJB 4PS4L 1U3HD 2G60L 3EMZA 4GAFB 1TQUA 1EO7A 4LSVL 5D5MB 2AQ2A 3D9AH 4MNQB 2BNQB 1E28A 1CD1B 1FLRL 1AI1L 1E0OB 1EDTA 2VRAA 4JLRA 2H2PD 1C16A 2QHRL 4DEPC 2IQ9H 2G8ZA 1LO3H 4XVTL 4XTRD 1MWAL 3MSPA 1MH5B 4LLUA 5FXCH 1A1MB 3L3IB 4Q97A 2YKLH 2IBGA 5CINL 2J2ZA 4G8GB 3QUMA 3GSRA 4IRZL 3JWOH 8FABA 4I77H 4P46D 2IPUG 3TO4C 1QA9A 4DQOH 4J3OC 1DQLL 3EJYD 4JKMA 4LPUA 4XC3H 2Y06H 3IFOA 3KG5A 1K9EA 5DT1H 4PYSA 4L9LA 4LLAA 4Y4KD 4DGVL 5A6MA 5CQ1A 3RWCB 5C8JB 3LEVH 3MNWB 3KLAA 5ALBL 1A5FL 5GGVY 2BNRB 3KJ6H 4WHCA 2W60B 4X99B 3ARFD 5AAMA 2N56A 2W07A 2XZQL 2CLZA 5INDA 2EC9U 3RDTB 5ECUA 5CG0A 3OGCB 2VLRD 1BD2E 1CR9L 2AJUL 2HJFB 3QJFB 1I1FB 1IV8A 1LEGB 3FTGB 2ICEA 1RZKH 5F9WB 2R1XB 4GLRI 2YRZA 3L3HB 4Z76B 1D5XB 5MENB 5C6TH 4LKXA 4L3ED 4MSWA 3BKYL 2WNWA 3TA3A 5ICZA 1WAAE 3S37X 3MLSH 2EYSB 1WC7B 1IQWL 4CVXA 4FMVA 3OXSA 1BX2A 2NX5A 3QUKA 3B2VL 4LYPA 4NNYA 4M6NL 4CD4A 1KBKA 5DT7A 5FUZH 3PF2A 4TYUA 3UTQB 1ZA3A 3KYAA 5C0CB 2IH1B 2HISA 1KB3A 4MAVA 2JF1A 3R8BB 2I07A 1SBBA 2FGLA 3RWHA 5HHQB 3DURA 5JBFA 1KTKE 4PBXA 5EU4A 1GGIL 1WDRA 1HHGB 4LSPH 1MQKL 1UCBH 3DX9B 5F7EL 1RUMH 4JFQB 4RGND 2QADB 4AH2A 3ZLQC 4IIQC 4GMTH 3X3FH 3FFCB 3D5OF 4NM4H 1QBLL 4OZGF 4GSDL 1HOCB 1AKJA 15C8L 5EG6C 3WS6A 1KBGL 3T08A 1FNSH 4HHAA 4S1DD 3KYMB 1T89A 5C2UB 1S7RB 2CLRB 4PJBF 4GKNB 5DF0A 2D73A 5DD0L 4OD1H 4M8QA 2E9BA 3SQOH 3VFRB 4BQBA 2OCFD 4LEXH 3KS0J 5C0NC 2EPMX 2BSRA 2V9QA 4HUUA 4NKIL 4QGTA 4S1RL 4IMLA 1RSFA 4M6ML 1OSZA 4G42B 5KSAB 2CLVB 3O2DH 2CIKB 3GSNA 1KLUB 1UB6A 3ZZ1A 1A3HA 2ERJB 1YUHA 3RKDC 1XRVA 4RZCA 1LEIA 1NBQA 2JEQA 2CDEA 3H3KA 1XR9B 5DFAA 1V0NA 4EIGB 3UCQA 5DJ8A 3NGBB 4P2YA 3P4NB 2BHYA 4D3CL 1YQ2A 1T0NB 4JPKL 2XPGB 3ZYOA 2VR5A 5E94A 5AY7A 2H1PH 3RZCC 1W3LA 3TA9A 4NRYA 3UEQA 4M61B 3RKPA 3VH8B 4B9ZA 5TQ0H 3V8CA 4MJ6B 2XY2A 4Z5RB 1OBAA 5MERB 3CFBA 4KZDL 4LYQA 1ZEAH 2D9QB 4QRRA 4AIOA 5TH2A 5I66A 2P8PB 4NBZB 4WFED 1UWGL 3OKEB 1QVBA 3F8UB 3VWJC 1XYFA 4DW2L 1KCRH 2C3GA 1KGCE 4JFFD 1HZHL 1QBAA 3FB7A 2R8SL 4YHKH 2BC4B 1JIBA 5IOPB 5LGHL 5DGQA 2XZCL 3CZFA 5E7FA 3HG1B 2GEEA 3D18B 2YLAA 3RIAF 4OKVA 2VN4A 4A6YL 4LCYA 3KWWB 3RU8L 1KCKA 2AVGA 3LKOB 4ZS7H 3U4BH 3HZ3A 1LILA 3T65B 3U30B 4LX4A 2PXYB 3MOAL 1JVKA 4XPHL 3R0NA 3WKNA 2AW2A 3U36A 1W2PA 5F3HA 3W38A 2RCSH 1PIFA 4CKQA 4KKAC 3FOMB 5D5ME 2BNQE 1E6JH 2N4IA 1Z0NA 2BCKB 4C59B 1CDUA 1V05A 1RULH 4DM1A 3HI1A 4W87A 1WB0A 3DX6A 4I48A 3NCYS 3QCVL 3Q1SL 1AQKH 4QHMB 4AMKL 2HVKB 3HPJA 4U5IA 4HUKB 2WVVA 5IMLB 1TMCB 4BZ1L 1KULA 2VH5H 5HGBB 2EDYA 4EN3C 3WFBH 4UFHA 5I78A 3LS4H 4GZEA 2DH3A 3QG6B 4MB4A 5HYJA 5EIIA 1GHFL 2DJUA 4A2LA 5GZOC 3V52H 3WL0A 1UVQB 3P77A 1SVCP 4R5EA 1EAJA 2XG4A 3RUGA 3SE9H 1I7ZA 1JHTB 2MPAL 3TLRA 5CEXA 1EEZB 1VADB 4DO4A 3OKLB 1UZ8A 4X0NA 1CLOL 5TE7H 1HIML 2BNRE 2Q7YA 1FFNB 3QULB 4POYA 1YEKH 2P5WB 3WUZA 4OIFA 3ROOB 1G7QB 1TETL 4EQ2A 1HNFA 5E7BA 2F5BH 4WHTB 3RAJH 2VKXA 1XIWC 5MENE 2CJUL 2R2EB 1NEUA 5FYKH 4W81A 3MSDA 1N5YH 5EO0B 3LKQB 2XFXA 2Z1SA 3POHA 1V6XA 4NWTL 1XF2A 3W11C 1RUKH 2J8UA 4ODWB 3RWDA 2A9MH 4J1UA 3ZDZF 1YEIL 5A6AA 2YD2A 5CEZL 4HIXH 3JV4B 4JAMA 3NFPB 4PJAA 4MA7H 3AIEA 5IB4B 1I85C 1WDPA 1KIPB 4PLKC 2GSIA 5GJTL 2QMKA 4G9DA 2GAZA 4XP9H 1FBIL 1II4E 4LSUH 5CMAA 3RVUD 3SY0A 2A1WH 4AL8H 1CL7H 4R2GD 4MDPA 2R4RL 3I9GL 3IS0X 4R90H 1KTLB 3DI3B 3V6FA 3SO3B 1F4AA 3FFCE 1T20A 3DX0A 5IT2H 2B4CC 4WEMB 1F42A 1KLGA 2NY3C 3A5VA 4PJXF 3S8WA 1JNHB 1PEWA 2RJMA 4QYOA 1RZ7L 3VRJA 1KCSL 1MXGA 1NAML 2DLIA 4C4KO 3WF2A 4L8CA 1XGZA 5CHNA 2YSSA 4PRAB 1QNOA 1GC1C 3N1GC 1IC1A 4DTGH 4LVOB 4Q9RL 4LOUC 3CC5B 4ZAKD 2HLAA 4TSAH 2AS5M 3JV6A 1J0IA 2OQJA 1BFSA 4KK9D 5IB5B 2WVUA 4D8PA 1T1WA 3WHXB 4RE4A 2YUZA 3BE1H 4F9PC 4UCFA 4HQQH 3BD4A 3BYYA 4LSSH 4KK8C 3T0DA 1DJSA 2H2SD 2Z93A 3GDBA 4ZPTB 5HPMB 2KDGA 1J8KA 3SCVA 1S78D 1FC2D 3P11H 1XCTB 4XCEA 1FRGL 3BAEH 2E7BA 3MO1B 4WFGE 4H26A 4PTMA 4MD0A 4MCYB 4U3XA 2GJ6B 2IAND 3O3AB 3L3DA 1UJ3B 4NRZB 2V5CA 3MU7A 4ELMA 4BZ2L 3QFJB 1HINL 4PIRF 4PJCB 3WH6A 4K9EH 4LDEB 4L1HA 4QXTA 3CPUA 3BP6B 5SX5K 4IRSD 5DHVA 4K8RH 5BV7C 5D1ZD 4AEFA 3ZKXC 2DQTH 5EN2A 1Z9SA 1UKOA 3C6SB 1I9JL 4XNXH 3RTQA 3EGSA 4ODXA 3LN4A 3LQZA 1NJ9A 4WVRA 4MNGA 4Y0GA 4ENEC 3BVWA 2VITA 2MCPH 2Y72A 1NC2B 3D2UD 3LSOB 3D9AL 2IFGA 1CDJA 3SDCD 5MEQA 4QCEA 3VD4A 3ZDYF 4M6OH 3IANA 3ULUE 4XCCL 5J11C 2VWEE 4OKDA 5SWSB 1YYLL 1Q9KB 2A83A 2IQ9L 3AFLA 3QDMD 2E5EA 5KZCB 1TQBC 3ES6A 3CMOH 3MRJA 3B9KB 1HXYA 1RK1A 3M6DA 3HG1E 3STLB 1NKRA 1JZ3A 4M5ZH 1TVPA 2YKLL 3RZWA 4TTUA 2GUOB 4NJ9L 1ZS8B 3MODH 5J12C 3UJTL 5GRYA 5DJDA 4HF5L 4I77L 4DQOL 1IEHA 1GPOL 3H7BA 5EUOF 2TAAA 3PTQA 4Z2IA 5JORB 3K4ZA 2ZXDA 1VFBA 1HL9A 4XC3L 5EB8A 4ZXBC 3AU1A 2Y06L 1NC4D 4MWFB 3CSYA 3ZT7A 2A3EA 5DT1L 5IK3A 1W72H 2PYEB 3O8XC 3QDJA 1FH5L 1ITBB 3L9RB 3T77B 4CDHA 4Z7VA 2X4NB 3P9WB 5KBNC 5KVDH 5F7LB 2J79A 4AZ7A 1HHHA 1U92B 1KXQA 3PXHA 5T33H 2GY7B 4PB9H 5FO7A 4TVSa 3T4AB 5B21A 4CADB 1MAMH 2I9LB 1TTUA 2X70B 4GIAA 1RZKL 4P4KA 1R75A 4H0HB 3FN9A 5HHVH 2E9IA 4ZUSB 3CUPB 4LAQH 5KTEH 5MHSD 3RGVC 5EU6D 1NCUA 4UT9H 5IW3A 1UFUA 5JNYA 2MOVA 3SCNA 3WF0A 1HXMB 5ACZA 5IIEB 1G84A 1NH6A 3C5ZC 5FUZL 4F15C 3AMKA 1EJ6A 2R0KL 2V2WB 1FV1A 3RY4A 3VSVA 1UD8A 4R26H 3C60B 1FIEA 2FIKA 3E1F1 3M8OH 3F5JA 6CGTA 1Z2KA 2CD0A 4XZUB 1UCBL 3DUSA 3UPCA 1RUML 1L9NA 2P5WE 4MXQD 5IVOA 3JVGC 1UR8A 3N0PB 4ZE5A 3TVMC 4NM4L 1C92A 4HKBB 5J0BA 4U7MA 1FNSL 5T1KD 2GQHA 4UV7L 4JLRB 3GB7A 4V2BA 4LLUB 3CHDA 1KJMA 1KXVA 2HLFD 4H0IA 3SQOL 1MJJB 4EEEA 1SFSA 4D6FA 4WI4A 3FO2B 3IFPA 2EEAA 2PF6A 5F6IC 1TPXB 1MOEA 1S9YA 2VAAA 1F4XL 4YFEA 3F4VA 1IEBA 1QA9B 3G5XA 3CCHA 4G8IA 4P2RD 5E6ID 3WN6A 4X83A 5TDOB 3HA0A 4GBXB 1SR0A 5I1GH 2GJZA 3TOPA 4BSVA 1KJ2A 3HZYA 1KCVL 1WUNT 4N1CA 5JHLL 4L9LB 3VXOA 4ZNEE 1F4WH 1UH4A 1X5XA 4JM2A 2XWDA 3KLAB 2HRPL 1X9QA 5CBEA 2QR0A 1JNJA 2IGTA 3IJ9A 5FCZA 1IAOB 4GO9A 2CLZB 3GSWB 3QXVA 3RX8A 5IQ9A 3UYRL 5HI3D 1JWMA 3IJ8A 2H1PL 3BEVA 3ARXA 3UG4A 2CR6A 1CICB 5TQ0L 1RAMA 4LKXB 3QUMH 5ICZB 3HFML 1IGFH 3D1MC 1LE5A 1TG7A 3DVIA 1PKOA 1KG0B 3OXSB 4KWUA 4HCRA 2QF8A 4H88H 3BXNB 3LH2H 2OLDA 1SMDA 1H1NA 4NNYB 2GCYB 4P5TD 3O9WB 3WFLA 5CIPA 2KPNA 1ZA3B 1KCRL 4NOFA 3KJ4C 1T1YA 2YRLA 3WQVA 2NXZB 4I18C 2I07B 3QIBA 2H3NB 4ZUWA 2GJ6E 1G9MH 4L29B 3WL9A 5KJRH 5EU4B 1B0WA 3H7LA 3QFJE 1BD2D 3RWIA 2PBGA 1CFNB 4AH2B 4HJJL 2Y2WA 3U4BL 2QPSA 3M7SA 3IDYC 3BWAA 5LYRA 1AKJB 2RFXA 3MRLB 4MNMA 1QVOB 4X9HA 1PZ5A 5B22A 4AZGA 4NO5A 1IGJA 2RCSL 4UINH 2ZUNA 4LCUB 4K7PY 2X4SB 4M1CC 3P0YH 3QI9A 4M8QB 2QHAA 3V6OC 3EKCA 1E6JL 3CK0H 2BVOA 3A4XA 4X6FA 3VIIA 1P6AB 4WKHA 5SWSE 4AZBA 2BK8A 3NCCB 1SY6H 1BVKA 4U1KA 5CJ5A 3CO4A 4YHZH 1MRCH 2OYKA 2VH5L 4GLRH 4U31A 3VNZA 4KUCD 3LS4L 1UB6B 1PBGA 1R85A 3PDOA 3C87A 1OAKH 4L5FH 1LEIB 3TJEH 4UNTA 3V52L 3C6LA 4K71B 3ZKNC 3GKWH 3SE9L 1H49A 2O93L 3RWGA 3S7GA 5I1CL 1R3JA 2CXKA 2PYEE 4U1JA 3HG4A 5TE4H 4NRYB 4QWWC 5TE7L 4B15A 5TF1H 4WFFE 9CGTA 1YEKL 4N90E 3CFBB 2JF7A 3CLWA 2IALA 2GW5A 4FQCH 5EBAA 1SEQH 4QRRB 5DHXB 8A3HA 2F5BL 3RAJL 4N9OB 5TH2B 1E5NA 3FO0H 1UH3A 4G6FB 4OAWB 4URTB 4RMRA 1OTSC 5FYKL 4QDMA 1GQLA 1A8JH 3REWA 4U1HA 25C8H 5KAQF 1PLGH 1N5YL 5IESH 1YEJL 2J7BA 3FB7B 5E6YA 3H9YA 1RUKL 3FN0L 4U05A 4MAZA 1AGDB 1FVDB 2FZ3A 4K3HA 2CKRA 4OZFA 3FB5A 3Q6FB 3CZFB 3HRPA 4OKVB 3MUZ1 5E4IA 4K7FB 1OLZA 5D1XC 3O6FD 4LCYB 4GAYB 2JJSA 3O3BA 4FLQA 4JG1L 4KMTL 4LSUL 4NQTA 3SCRA 2A1WL 5HI5D 3V5HA 4AL8L 4J7RA 3C2SA 4D6GA 1UGNA 4LSTL 3W4RA 1RZIA 2DQEL 4JJ5A 5GGTL 5F3HB 1V0MA 4HIJA 5IT2L 4K94H 1MIEH 1VACB 1MCLA 4YH6A 1JJUA 3HE6B 1KGCD 3W26A 1PX3A 4U49A 2CQVA 1DBJH 1FYTB 4NC2B 1FH7A 3HI1B 2VSDA 1QNSA 3X14A 4IBLT 1UR9A 3BDYH 1T7XA 5C8BB 4HH9A 2D22A 4PJIA 2WVVB 1AGBB 4K68A 4GG8A 2NXYD 4TSAL 5DTFB 2E8ZA 3HB3C 5I1IH 1ECEA 1GZPB 4UBDD 3VX1A 1U8JA 2R2HB 3ABZA 2WBJA 4U1NA 3ARPA 3BE1L 4Y4HA 4IOSD 3DBXA 5DVKA 4Z7OE 3P11L 3VCLB 3VWKC 3FCTB 2BNQD 1LDPH 5FYJL 2W4XA 2VNCA 3V8OA 2HMIC 2NY0B 2Q7YB 3SCOA 3CSBA 3NCBB 2Y9RT 2VO5A 5IV2A 4X4YB 3V5KA 3T2PA 2EDOA 3WN5C 4HPOL 4G6AC 4LSRL 2YA0A 4I2XA 4UILH 2AJXL 1OAZH 2A77L 3S6TA 1IKFH 2F7QA 2G75A 2XFXB 5EORL 5JW5A 1UEYA 1XF2B 4XNXL 4JFEB 2NX5E 1KXTA 3TYFA 4PTUB 3IFLH 3RWDB 3OG4B 3QUYC 1S5HB 3DX8B 4J1UB 4Q0XH 4AEHH 4NKDA 4M6OL 3GM0A 4JKKA 1PYWB 3QCTL 1JRHI 1UM5H 4IDLA 5CJXA 3HC0A 4G9DB 3DSFH 3U1SH 2GAZB 4P3WA 4DN4H 2BNRD 4UFIA 3PWJA 5CMAB 2ESVB 3SY0B 4PD4J 4ODTH 1KPVA 5CUSH 4LK4A 4DFIA 3T04D 1WBZA 4M5ZL 3QDAA 5D7JD 3RDTD 2WZHA 3V6FB 4M48H 3UTTB 5MEND 1P1ZB 3OJDA 4KI5E 4YEEA 5D1QC 5FV1L 1CLYL 5I71B 2CRMA 5LQBL 2V2TA 2X4UA 4BQ4A 4PRNA 2WLZA 4GRMA 1I3GL 4L8CB 4EXPX 3VXPA 5CHNB 2YSSB 1EQCA 2WP3T 2WMIB 5L0QC 1MCEA 3U57A 4O2EA 5GGSY 2V3FA 4Q22A 5T33L 2C1OA 2HLAB 5D2LB 3ZMRA 5I77A 3ZQ9A 5TF0A 3JV6B 3TC9A 2OQJB 3HZVB 2APXA 4P3CH 3GMNA 1U8KA 4RAVA 1SMAA 1MAML 3WO4B 4D8PB 1T1WB 1V6VA 4UOJA 3BLKA 3VIFA 5JOFA 4WIQA 4Y19B 5HHVL 2OM5A 4X80H 2EDKA 1QLEH 3FFCD 2OYPA 4H26B 5GGQL 3SDAA 4LNRA 4HTYA 4U4BA 3CZGA 2JE8A 2J6EH 3L3DB 2Q6WB 4ELMB 4CUCA 3D52A 4OB5H 5HHMB 4XVJH 3U7WL 4TOQA 2HFTA 2O5ZL 4W6XB 1NUGA 4L1DA 4N8PA 4R26L 4QXTB 4TX8A 3M8OL 1O7VA 3RM4A 3NA9H 1VA9A 1U8QA 3DLQR 4TXEA 5DHVB 5DD3H 1GVIA 5EN2B 1T7YA 4J23A 1H09A 1KPRA 5H2BA 4NQSA 1PX4A 3U9UA 3EGSB 4ODXB 3J8F7 3LN4B 3LQZB 1NJ9B 1P9MC 2VL5A 4KK6D 1NMAL 4MNGB 4QRRE 5KSAD 5MEPA 1GGCH 1UYWH 5MEQB 4IEFB 2J88H 5JZ7D 2W91A 4WJ5A 1G6RH 3U5UA 3CPLA 4WFGD 3MUHL 2A83B 2XZAH 4M4PA 1GOHA 4ODVL 4MMZC 1JP5A 1RIHH 3ES6B 1XYZA 1RK1B 3PWUB 4J4PC 4JRXA 5F9OL 1CFVH 4E42A 4F3FA 2V17H 3GMMA 3QUZC 1J0HA 4W68A 5EOCL 1T6VN 5C2BL 5IB1B 2MCG1 3MO4A 4M7LH 1T66C 1ZTXH 3ARQA 5DJDB 5BRQA 3TTSA 3SDXA 2LU4A 3NH7H 5IROA 1VFBB 3NA4A 4K3EL 4Z2JA 1B31A 3SUTA 4ATDA 3AU1B 5EO1A 1NOUA 5DRXA 3CSYB 1ODZA 4R7NB 4CMHB 4B3LA 1F4WL 3AUVA 4P2CG 4Z7VB 5A2JH 4TVPE 2W62A 4U6VH 4ZUVA 4H1LH 4KPHH 2HKFH 3DYPA 2V7HB 1FYTE 4UQDA 2FJHA 5E9AA 1Q72H 4XRCA 1V8HA 4MDOA 2ITCA 3EDJA 3HG1D 5ABGA 5DHYA 2RR3A 4XCFL 1H8SA 3N12A 1RIUH 5KVEH 4NPYA 4G7YH 1IGFL 2W0LA 4GAJH 2AI0L 1RZGB 1XCQA 3D3VA 4IMKC 2K9UA 4OLYH 5HYJE 2CERA 2PXYD 3WLWD 3MLUH 4UOQA 3H9ZA 1FZKA 3S96B 3EYPA 4GUPB 3RUGE 2VRKA 1FV1B 4OCXL 4MQXD 5HVFB 1GQKA 1MFBH 4ALAH 3UG3A 1QI4A 5GQBA 5A16B 1G9ML 5M17A 5IVNA 4QLKA 3T8XA 4Z2KA 1WIOA 3EO1B 1UM6H 2DDQL 5DUBA 5CCKH 2WVTA 4MD4A 5CZVH 3RVVC 4NGHH 1UD6A 4C7FA 1A0QH 2ZP0T 4IHOA 4APQC 4UZUA 3MMUA 1CG9A 1MREH 3WIFA 1CD8A 2J4GA 2D1ZA 3KLHD 1OWWA 1XSJA 1QR4A 2X2IA 1NMCB 1G7HA 1GAFH 5FFLA 5I5RA 5GRUH 4JFEE 2J8UE 3DJ9A 4DO5A 2JK5A 1DWHM 2C4FU 2PW2B 2QPUA 1LG1A 2DKUA 3P0YL 1TUXA 4PJAE 1FNEB 4QRSA 4AQOA 3H53A 4X5LA 1IRAY 4U2YA 3IFPB 1DWJM 1HCVA 5GNZA 4PJ9A 1R5WB 3WH7A 3MRQA 4RAUA 1IEBB 1SY6L 3G5XB 2ESVE 3CCHB 3DMMA 4G8IB 4NN7C 2P5WD 5K9OB 1TJGH 4YHZL 1MRCL 1HQRA 2GJZB 2VLKA 1KJ2B 3HZYB 3PL6C 1CGXA 1OAKL 3VXOB 3UTTE 1RURH 2EO1A 4JM2B 1UA6H 4S3JA 4C83A 4QOKA 1B4RA 2RQ8A 5CBEB 2QR0B 3BO8A 3GKWL 3CUFA 4HWBH 4IDJH 2OTWA 4E5XA 5E1QA 4Z7UB 1JWMB 3BEVB 4P8VA 4OQ1A 5TE4L 4WW1B 1U33A 1XF1A 4M3JA 4DWHA 4ACYA 1DBMH 5TF1L 1TTFA 3P9LA 1TVBA 3AB0B 5ALCL 1OPGH 5D2LE 2ZX8A 3PTMA 2JF6A 2XQBH 4U1LA 4FQCL 1G1YA 4HIEA 2SEBB 2IMMA 5EBLB 2XSBA 4BM7A 3E2HC 4DFHA 4V1DB 5K9QG 1VJZA 1CQYA 25C8L 1PLGL 4Y19E 3L1OL 2A73B 1EO5A 1T1YB 3F5WB 4Q9QH 2F8XC 3QIBB 2P47B 3MXWL 1M53A 4RRPA 3WL9B 1FO0B 3I50L 4K23L 4ETQA 5HVWA 4EUPH 4ELME 5HHME 1CGUA 3RWIB 2ZNXA 3TZVC 1G0CA 3UPRA 5EH1A 3OMZA 4PJHA 3BWAB 1C1EH 2GJPA 1HH9B 3NACH 2RFXB 1J1XH 4FF5A 1RUPH 2IBBA 4OLZH 1PZ5B 2FBJL 4GKOA 4NO5B 4PJ7F 4RFNC 4MNGE 2XN9A 1E4IA 3RVWC 3ZHDA 2E7HA 1FP8A 2JLLA 3BGFB 3UJJH 2DQJH 3QI9B 3PGDA 1IEAA 2BVOB 4X6FB 4DZBA 1DBJL 3JSSA 1CGWA 4GW5A 5GSRB 5DMIH 4AD3A 2WZIA 2IAMA 4PY8J 2BFVH 4P4RB 4ORZC 1FQ9C 2GJ6D 3BDYL 4J3TA 4NWUH 4JRYA 3S35L 5BXPA 1BVKB 5DJ0A 3QFJD 1P7HL 1XR8A 2MWCA 5I1IL 3MRDA 2Y5EA 5DEZA 3PDOB 3N04A 3O4OC 4Y5VC 2E40A 4ORGA 4YLQT 3WNPA 1EHAA 2EIZB 4AYGA 3NPSC 4HOZA 2J8OA 5B39A 1F45A 1F58H 3U9PH 4XP1L 3AJ7A 1GOQA 2EDNA 5EZOL 1R3JB 5DQJB 2DDXA 1NC2D 4HUMB 4U1JB 5C9JA 1J7VR 1KEGL 3QDJE 1LDPL 4Z7VE 2X09A 4YBHA 4HPGA 1KXQE 5D8JH 3VRLF 5IJVA 1UJTA 5SWSD 2YBRA 3W39A 2IALB 3WEMA 3UESA 2GITB 3MA7A 4XVUD 3VFNB 3OF6A 4UILL 2B20A 2Z31A 1OAZL 3B9KD 3CVHH 3LEYH 4G6KH 5L2KB 2WUBH 2ED8A 4JN1L 3REWB 3MBEA 4U1HB 1C93A 4H2CA 3KS0H 3BIKA 4P9HC 5J13C 1G5AA 4YQXH 4YHML 5AZ2L 2FZ3B 2UVEA 4KTYA 4OZFB 3SCMC 3FB5B 4AEHL 3VX0A 3DUUA 4RRPG 4P9MH 4H8WH 4IOIB 3D4ZA 3NFSH 1OAYH 2FECI 2PYED 3D6GA 1UM5L 1TMQA 4XXCA 4RSVA 1MW3A 3O3BB 1U8LA 4Q6IA 5D7LB 4WFFD 1D6VH 2EZ0D 3V5HB 3K1DA 3PTKA 4N90D 4TSCL 4YC2C 5CUSL 3FT4B 1HJVA 4PJ8A 4E4PA 3VG9B 3UAJD 3OB8A 4JQVC 5HVHB 4LXFA 1I7TB 3QEUA 4M48L 4HIJB 1JZ5A 2NMSA 2VXVH 4OFVA 2GVYA 4L9DA 4XI5D 1MHHA 4GRLD 2WINB 1Y6MR 2CKBH 4NQVB 3X14B 3V2AR 1V3HA 4JZJB 1AGCA 3OKDA 4QTHB 3SKOB 4PJIB 4U0QB 4PBWD 4GG8B 3QP3A 1E4XI 5C0IA 4P3CL 3WH8A 3UMTA 2H9GA 1TJIH 1U8JB 1FVEB 1A6VH 4MQ7A 2PBOA 2WBJB 4J6RH 4U1NB 3WL1A 3EOTH 1CXEA 2HWZH 3TPKA 2NYYC 4QKXB 5C1MB 1QPXA 1GIGH 6FABH 2YL9A 3MLTA 2WM0A 5C0GA 4Z7QE 2J6EL 3IAQA 5JDSA 4MCZA 4EK7A 3L5WA 1RZFL 4OB5L 2B2XH 4Y16C 1E4MM 3V5KB 4XX1E 3RJQB 2CHNA 2VTFA 4LCIL 3TN0B 1Q0XH 2DWEA 3VXSA 4M5YL 1NOWA 4C55A 1JN6B 4WWKA 3PGCA 2JJWA 3FQUA 3C8HA 3GJFK 5KS9A 2EC8A 5DVLA 2G75B 3RJDA 3MJ8B 1OTTC 4X6DA 3BAJA 1G1CA 2NZ9D 4N9GA 4XP5L 4XNMB 3WIHH 3TYFB 3I75A 3TJHD 3IJYA 1GGCL 1UYWL 3HC4H 5I75B 5EBWB 4Q74A 1RJZB 2J88L 4V1DE 4F8QA 1QTYT 2XG9A 1G6RL 3DRQA 5JBEA 2HN7A 2YZ8A 1C5DB 4AENA 1C5BH 4R3SB 2XZAL 4HKZA 2PWGA 1RIHL 3GZAA 3ILPA 4ACZA 1KPVB 3VXMB 1CFVL 1WBZB 2A0LD 4C56A 2V17L 2WUCH 2CESA 4Z9KB 2D0GA 4M7LL 1F97A 1ZTXL 4G5ZH 1CICD 2VR4A 3TA3D 4Z7OF 5K33A 1GHRA 1G94A 2HG5A 1W8OA 4GKLA 3S36X 1BJMA 2NX5D 2V2TB 2X4UB 4PRNB 3V5DB 4S2SB 1FL6A 4GRMB 4QO1A 3VXPB 5A2BA 3O9WD 4C4KT 1IT0A 3FQWA 5I23A 4U6VL 1FORL 4KPHL 1Y0LA 2HKFL 3V0WL 2H32A 3RGVB 1NM9A 2NXZD 4JL2A 4YHOH 4KRLB 3GMNB 1U8KB 2EPLX 1Q72L 1BPLB 2LAAA 1UACL 3C5ZB 3RM9A 2WANA 3EW3B 2XOTA 5C07B 5KVEL 3FN3A 3TV8A 2P5EA 4G7YL 4MVBC 4GAJL 5GGUB 3D25B 4IS6B 3W82A 1BJ1H 5HHOB 3ZR5A 5DFVC 4CD6A 3HN3A 4KI5D 4OLYL 1HHKA 4LNRB 1XCXA 1AKJD 1V0LA 2XIDA 3MLUL 4Z95H 3A23A 3F58H 3VGDA 1S9KC 2GSJA 1R5VA 3W29A 2X4RA 1ODUA 3VIKA 1I7UA 2XY1A 1OD8A 4ALAL 3TVMB 5L8LB 5HGAA 3LRLA 1U8QB 3BPLC 1M6OA 1URLA 3O45A 1J18A 1BYAA 1UM6L 3VNYA 4ATLA 3IDGA 5H2BB 5CZVL 5M03A 3U9UB 1A0QL 4KI5F 1A7QL 3TPUA 3D69A 1MREL 5HYIA 1WIUA 5MEPB 2F9BT 5L2KE 1DR9A 1AXIB 1U3HC 1INEH 4WJ5B 3BLBA 2E6PA 2W0KA 2NTSP 1X6LA 2LU7A 1FH8A 4JRXB 4D0BA 2H2PC 3GMMB 4XTRC 5I79A 4O4YH 1ZLVK 2VJXA 3ULUH 4RFEA 1DWIM 4PMQA 2ZWYA 1GL4B 5IF0B 2JALA 1EVUA 4B9YA 1MELA 3P73A 3SDXB 3Q3GA 2OWXA 3VFSA 3UTOA 1TJGL 2E6QA 3DRTB 5EO1B 5DRXB 4P46C 3BH9A 4QRRD 3S3SA 4M24A 3EJYC 5GIRB 1UWXK 2ZUVA 4WEUD 4NRRA 1RURL 4UDUB 1XD0A 1NGPH 4I3RH 4FQ1H 3MLZH 3TH2T 4HWBL 1DLHA 4Y4KC 4OLVH 3ZJ6A 5C3TA 1NDMB 4IDJL 1AO7A 3BD3A 4F80A 4XRCB 3MUGA 5LVEA 4NQEB 1FNFA 1UWSA 3CIVA 3ARFC 2ITCB 3MRRA 3NABH 4PJIE 4NPYB 5A8OA 3QUXA 2G2RA 2XQBL 4FFVD 5EC2A 3BRGC 2WVSA 5E2VH 2VX4A 2GKIA 3BAXA 1A4JA 4MLSA 1BWWA 1NMBH 2D7MA 4FOMA 3SE4C 4LPTA 2E9LA 5DSCA 4Q9QL 3EYQD 3T2QA 4JO3L 4A2MA 5CGYD 4TVPD 1QSEB 3TGXA 4AZHA 1D5ZA 3QHFH 1PJ9A 2X1WL 1XGTA 4EBQH 1FYTD 4L4VA 1DBKH 1EGJH 5DUBB 2VZOA 4MD4B 5C92A 5CSYA 3GRWA 4I2XE 4IHOB 2XN2A 2ZUXA 1CG9B 1UZ6F 1C1EL 5HY9A 3MV8A 3WIFB 4RGNC 2Q76A 1ZA6B 4MMXC 4OLZL 1G7HB 2ZPKH 4W8LA 2BSED 4MX7B 4MJIB 4PJDF 1FL5A 5IHZA 3OKOA 5HYJD 3L95A 3UZEA 4AWEA 1UQZA 2DMKA 2FX7H 4OQTA 3OGSA 1YEHL 4TULH 4S1DC 2L7JA 1CWVA 3UJJL 1UXSA 2EPNA 4QRPB 1ZVYA 4LU5H 2V38A 4WDIA 2BFVL 4S10A 2BSSA 3AQUA 4NWUL 4PUEA 4CN6A 3MJ9A 3UCRA 4MXVE 2OJZL 2NY0D 3MRQB 5JW4M 4RAUB 5E0FA 4X5WB 3IVKA 4FABH 3VXME 4WI3A 3W0KA 3ARZA 4ZUTA 1GONA 2PN5A 2WMJA 3PQYA 4ZDHA 1LD9A 3GI8H 3Q0HA 3MA9H 5DZOA 4C83B 4QOKB 4D6CA 3RUGF 3BO8B 3HNTH 2CYGA 4MAYA 5E5MA 4JFED 1F58L 3U9PL 2MQCA 1I8MB 4OGAD 4E5XB 5D9PA 2Y1VA 4I4WA 3CUIA 1WWAX 3CLFH 5I6SA 1XH3A 2A74A 5D8JL 1TVBB 4GKZA 4S0TD 4LVNC 4P8WA 3VIMA 4CRPA 4U1LB 2WCSA 4HIEB 3KGRA 2CDFA 1AGFB 2ESVD 4Y5YC 4WV1C 4G6KL 3EO0B 4BH7A 2XYLA 4TOYH 5EUKB 1KBBA 3H6JA 5C07E 3AREB 5GS2D 4JR9H 2A2QT 4W5UA 4UUJB 4B50A 4U6XA 3UTTD 2X1QA 2F58H 4M93B 1DWAM 2VISA 4YQXL 3CSPA 1JGUH 1JG9A 4PJAF 2CMRH 4ETQB 4P9ML 1FGNH 3F65A 5GZND 3NFSL 3WXVH 1E43A 1PAMA 5J89A 2YWYA 3VFGH 3QA3A 2CIIA 3GSVA 4LLDA 4BKLB 1S9WA 4OD3H 3NDYA 1D6VL 5IMMA 2J75A 3T1FA 4PY8I 1FC1A 4CU6A 4WHYH 3ZJ8A 4LRNH 3A4WA 5HDOA 3VFMA 3BX7C 4ZNCD 1UR0A 1VAHA 2XN9B 4G6JH 2M1KA 3ETBF 4Y19D 4NN6B 1OVZA 2RHEA 2ADIB 3P30L 4Q9BA 3UYPA 1IEAB 2DRUA 4DZBB 4M02A 2UV3A 4HAGA 3IF1A 1QI3A 2CKBL 2IAMB 3EYVA 4JRYB 4AMXA 3CHEA 5DJ0B 4OZ4A 5HHMD 3EZJB 4JRXE 2QV2A 4Y1AA 1JI1A 4MA1B 5T1LA 1C90A 3RBSA 5I9QB 1U8PA 3SPVA 5FO8A 4OIIH 2AJVL 1EERB 5I1JH 5KEZA 2IQAA 3SDXE 1I1WA 1NSNL 3EOTL 4ORGB 2HWZL 1R3LA 5B39B 2X1IA 3MPCA 3IXTA 2APVA 3ECBA 3S4SA 1GHSA 3UTSA 1X5ZA 2EECA 1LLOA 2G3JA 5C9JB 1Q0YL 3VD5A 3MREA 4HUXA 3S5YA 2QKIB 4LQFH 1KUMA 3IRZA 4X6BA 3M17A 1B3VA 4N0RA 3U0PA 4BF7A 3MA7B 4GRWB 4WO4A 5LA0A 3OHXB 4NCDA 3ZTJH 3LS5L 1K8DA 2Z31B 3QEGH 3OZ9H 1ORSB 1PVHA 4ELKA 4ZSOA 5I6XC 1CLZH 2PO6A 1B3XA 4OGXH 2PKDA 4H0GA 3BIKB 4PR5B 2K7QA 3BUTA 4W4OA 4E41A 5T3ZE 4ATWA 1K9TA 4GXVH 3G04A 4O2CB 3WIHL 3QPXH 5EOQH 1LEKB 3HC4L 4PLNC 1K6QL 2GTWB 3GH4A 4UTBH 3W28A 3DUUB 3RI5K 2VDRH 1JDDA 1XCWA 2W38A 2OLHA 3MNZA 5JXEA 1C5BL 3QDJD 4W7VA 1REIA 2NY7H 3MRNA 3TTYA 1MCOL 1E5JA 5DJZA 2R1WA 4Q6IB 4HWUA 4PREA 3STBA 1VIWA 4TUJA 1C12A 1VESA 3K8LA 4BQ2A 1MLBA 1OOAA 2WUCL 4IUGA 1OT1A 3LQMA 4BJLA 2BNUB 3UZQA 4I5BA 4QGYA 4J28A 4R2GC 4P4KD 4R97C 3RPKA 1V7MH 2YA2A 2B31A 2V5YA 2W1NA 1MHHB 4M62H 3BDBA 3CBWA 4MJIE 3VJ6A 4LF3B 5C0FB 1JTTA 1F8TH 1OAXH 1OIMA 1AGCB 2QTEA 1EVTC 5GISL 1OD9A 1WFTA 4P3DA 3RZCA 5LGKA 3L4TA 3CX5J 4QRPE 5JTWA 1GZJA 2VZSA 1YPZF 2H9GB 1K3ZA 4X9GA 4MQ7B 4ZAKC 2OL3H 3BPOB 1KV3A 3VXRB 4KK9C 3CGTA 5B3JE 1HEZB 4PCSA 2VXTH 2Z92A 4PJFA 3NAAH 1NLDH 2VLKE 2XACC 4FNUA 4PV8A 5B8CB 4R4BA 1QLFA 4EI5A 2H2SC 3MLTB 5C0GB 1S78C 1XEDA 4QOKE 4Z95L 4FQQA 1B2WH 3F58L 3H0TB 3KDMB 2P7TA 5JDSB 3VM5A 4MCZB 3L5WB 1WAWA 1AC6A 4HKXA 3B8YA 5H35A 4U1MA 3R0MA 2YPVH 2DWEB 3VXSB 4U33A 2AJSL 2CIPA 1JRHL 4JM4H 4WWKB 3PGCB 3KPTA 1MJ8L 1Y18A 1E6OH 4X6DB 4NBXB 4IRSC 5D1ZC 4N9GB 5ABEA 2J7CA 2PWFA 3I75B 1DVFA 3P0GB 4FNLH 4F7PB 3BGAA 4KVNL 2UYLB 1BQHA 3DRQB 3FT3A 2CDGB 3SDCC 4JM2D 4YXLH 1ZWIA 3R06A 3PGFH 5E2TH 2R0WH 3KPLA 4OV6F 5FGSA 3ILPB 4ACZB 2VXSH 4JZ5A 5MEOA 4O4YL 4I0PC 3ULUL 4UIKL 2WBWB 4XNUL 3IXAB 3DV6A 3SKMA 1LWRA 5I76B 1E4XH 2J78A 2ITDA 4MDIA 2J8GA 2CRYA 3BKCH 3K46A 3VIJA 3W81A 1MY5A 3MUAA 2AEWA 2LU3A 3K80A 4Q2ZA 1PSKH 1FL6B 2VB5A 1V03A 4XX6A 3P4OB 2XN9E 3BISA 2XWTA 5CD5D 2H45A 3TBSA 1NGPL 2N1KA 3FQWB 4I3RL 4PTXA 1MRFH 1XSKA 4FQ1L 1Y0LB 4OLVL 2YN3A 4J8RA 4O5LH 4Z77A 3QIBD 5IW6A 1I9RH 5M3WA 5HJ3B 3B9DA 1Q9WA 1LGVA 4UAOC 1Q9LA 4TVUA 4E8DA 5CSZB 3QXWA 4OCRH 4WTWA 4JRYE 3QPQD 2GFBA 3NABL 1ES0A 1T22A 2WWDA 3BH8A 2P5EB 1A1OA 4KJQD 2Y6SD 4OZGA 3NFNB 2YRPA 2E6JA 1N6QH 1HHKB 1OSPL 5E2VL 3U4AA 1F2QA 2ZUQB 1ZT4A 1NMBL 1FNLA 3KAAA 1JHLH 1R5VB 2X4RB 4FRWA 1I7UB 1B3WA 1UM4L 4X5XB 1I85A 5HGAB 4PRIA 1LO0H 2H32H 4F7MA 5GNYA 5C08A 3QI9D 3CZEA 3S37H 3O45B 1KCUL 4MJ5A 2CUHA 3BN3B 4EBQL 3PZNA 2X0YA 1EGJL 2OS7A 2ZOKA 3IDGB 2OBGA 1R33A 3NOIA 5CJBA 4OV5A 2GY5A 1QQDA 1MFDH 2ZJSH 4WENB 2KH2B 3TPUB 3D69B 3EMQA 1FG9C 2DTSA 4D6DA 3KPNA 3GMLA 2YPLA 3AC0A 1VF8A 2ZPKL 3JTTA 1BQHG 1ZT7B 3KL0A 5J06A 1EEUA 1K2DA 4TULL 4NN7B 3C6LD 2EDBA 4W6WB 1ZHNB 4D0BB 4LU5L 5CS7A 1DANT 4RFEB 5IHBA 3HKFA 1MCKA 5TDNA 2HLFC 4M6AA 1XC6A 3WFZA 4HWNA 3P73B 5SWQA 3Q3GB 4JO2H 3VFSB 4KH2A 2NY1B 3WD3A 2V5MA 1BQLL 1OP9A 2F53A 5D2NC 4YGVA 3BH9B 5M5DA 1HWHB 5E6IC 2Z0BA 3SE3A 4UT7H 3GH7A 5I1KL 5I19H 1G7JB 5J6GA 2VLJB 2Y5TB 1DLHB 2BX5A 3T0EB 1AQDA 2B0SH 2O9OA 1AO7B 3OL2A 3RPIB 3QBTB 4DGYH 4J12A 5ICYA 3MJ6A 1GNXA 5I8CA 5IBLD 5KN5B 1I3UA 3S35X 1E4JA 3FMGH 3QUXB 1CU4H 2G2RB 3B2UD 3LPGA 5JMOC 1RD6A 3ZSTA 2A3HA 3ZR6A 2B1HH 5EC2B 3AXXA 4HFWA 3BSZH 4TOYL 4OTXH 1PX8A 5EU5A 2KQNA 4JR9L 3MYZA 3BQUB 4D94A 1MHCA 4JFZH 3RY6A 2F58L 4P5TC 5DZLA 1X5HA 2DQDL 3RRQA 3BCDA 1W0WA 1JGUL 5EU7E 5FF6A 1BOGB 3KPRA 5KANI 3DX1A 2P4AB 3OKNA 2CMRL 3N17A 3HZMA 1XGTB 4M4RA 1FGNL 5GS0H 1N64L 3WXVL 1FZJA 2YC1A 1IGTA 3Q5TA 3VXSE 4D9QE 1CENA 2YUVA 3TH3T 4LRNL 4X6DE 4XPBH 4FXGA 3SJVB 1EMTH 1FL5B 2WBJD 2P8MB 3INUL 3L95B 4ZXBA 4Y4HD 4G6JL 2VN7A 4PG9B 1EZVY 1IQDA 2CO6B 4U6YA 3VGBA 1JYNA 4PP1D 2FO1A 3PWLB 5DMKB 5I18H 1TIUA 1OB0A 3F7RA 3RHWF 1ZK9A 2D7PA 3AS0A 4QRTB 4WDIB 3GJFH 2BSSB 3GNOA 1UWEL 2D3NA 3ARRA 4LHUB 3IVKB 3GRWH 3AMGA 3N1QC 1AXTH 1HHJA 1YY8A 4ZUTB 4C56E 5IB3B 4W8BA 5AWNH 1GQIA 2VCBA 1XD1A 2H26A 4R4FH 4OIIL 4BK5A 1LD9B 2HJLB 4YHLL 2FD6H 2FE0A 3QXUA 4RL3A 3PDDA 4R4ND 1V02A 5DJXA 4MAYB 2Y23A 4NIKB 1KOAA 2QQNH 2W9LA 3TIDA 3HPLB 3HC3H 5JHDA 1MHEA 4RE2A 1UB5B 2NY5C 4UNUA 4ZD3H 3CHFA 5BRZA 3QEGL 3SCMB 3OZ9L 3V95A 1HX0A 1CLZL 4DGIL 2CKNA 1GGUA 3ZT5A 2IBZX 2P5EE 2Q8AH 5SWZA 2HT3D 5D9SB 1CDCA 3H3PH 4U6XB 2X4PA 1IJ9A 1NBVL 4GXVL 4NUGL 3SBWC 1VPOL 3QPXL 1NCBL 3D0VA 1E4WL 5F97E 4ZFGH 5ESAB 2Y7QB 3UBXG 4K2UH 2XICA 1US3A 4D71A 5D6CA 4XH2A 3QA3B 3GSVB 4LLDB 1P2CB 4YBQC 4OFIA 5IMMB 1RPQA 3S9DB 1CBGA 3O6FC 4DAGH 1MAJA 1DSFL 4KDVA 4NNPH 3U0TA 4HZ8A 4MHHI 5EFFA 1B0GA 1KTRL 5HI5C 5C07D 2XA8H 1OM3H 3UETA 5MI0C 2MSPA 2OSWA 4XNQA 3K3QA 1P7QB 2VQTA 5F3BA 1IL1A 4MDJA 5DC4B 4HC1H 2HRLA 3IF1B 1JWUA 1MWAA 5ITFB 2D7OA 3SDAD 3F6LA 1PW3A 1F8TL 4E8CA 4PRHA 1QPPA 5EIQA 3EYVB 1ORQA 3AMLA 1YNTA 2AMGA 4OZ4B 3RWFA 4UNVA 1WQVT 5T1LB 4LVHB 1J11A 1VBUA 1U8PB 1ZV5A 4YK4C 5FO8B 4NFDA 2IQAB 2XSAA 2BOCB 2NXYC 2OL3L 3X11A 4NZRH 2GT9B 4UBDC 3GSUA 2VXTL 3VMPA 1R3LB 5EB9A 4NZFA 3NAAL 3IXTB 4GMSL 3S4SB 4OCLC 3UTSB 3ZE2E 3UDWC 3EHBD 2GIYA 1XMWA 2DT3A 4M7ZB 3MREB 1C5CH 4HUXB 1ZLVH 5L88L 1B2WL 1MFNA 2VLJE 1ZLUK 5JPMA 3AHTA 1M01A 3RWJA 4X6BB 3M17B 1EQPA 1ITCA 5EZLA 1CZ8H 3H9HA 3T0EE 3HE7A 1AO7E 5IGXH 3ULVE 4N8VA 4KAQL 2FECL 5KW9H 4JM4L 4JRXD 1F5WA 1UENA 4ELKB 4ZSOB 5F7DA 2PO6B 1CGTA 4N0FA 3UO1H 5EUOA 1MEXH 1IT9H 4L8BA 1UWRA 1E56A 1F4HA 1MFVA 4MXWL 3L5IA 3W9EB 2NQCA 3LPPA 3EUUA 3CNKA 4P57A 1YEDA 5CPSA 2BVUA 1FG2A 3PGFL 5E2TL 2PETA 3HMWH 2R1WB 5DJZB 4JN2A 4H20H 4Z7WF 2VXSL 2LAGB 2FIRT 1C12B 1BBJB 4IM8A 5B4MD 1MLBB 1OB1B 1N3NB 4CU7A 4I5BB 1AQMA 1JFHA 1E4XL 2W0PA 1WCGA 3F7YB 3RDTC 5D7JC 4HXAH 4AQ1B 4BELD 3L4XA 3BKCL 5T3ZD 5ABHA 5F9WC 4NO2A 5FYLE 4EXKA 4LIQE 5D93B 3SJVE 1SJHA 1AR1D 2YD8A 3IK2A 1XGRB 4YHGA 3VJ6B 3KPSA 4RGMB 2FH8A 1ND0B 3RVXD 7A3HA 1B4JL 2EXOA 2FGZA 4R0LA 1MRFL 5IQ7L 3IJ7A 4O5LL 2ZIDA 3E6HB 4HZAA 1K85A 1J9YA 5E00B 1PG7W 1HDMB 1T7ZA 3MGOB 4OCRL 4F7TA 2APFA 4RMQA 4EDXA 3VXUA 1R5IA 2LVCA 4PP2B 3NVQA 4DWSA 4JDVA 1AVAA 1ZB5A 4MHHG 1A7RH 3I2CH 4PGBA 3WUWG 4PV8B 3PQYE 4HZ7A 1N6QL 1V3LA 4EI5B 2QADC 4C7GA 3IETA 3VD7A 4X4MA 1YHTA 1J01A 1QBBA 1EJOH 4MJID 1JHLL 1WZLA 2J47A 4HKXB 4F9LC 5F71A 5IFTA 5A6LA 5GJSH 2BVPB 4KDWA 4QNPE 3P40A 5D6DC 5IB2A 1LO0L 3OGRA 5FKAB 1B2YA 4RNRA 1BGXL 4QRPD 3S37L 1PD6A 3MLVH 1HJQA 4C7DA 3WS3A 1J05A 1Z9MA 2X2HA 3VE0A 5IJKA 2AP2A 2BVQA 4PJ9D 2JEPA 2ZJSL 4XCNA 4UQAA 1N8ZB 5BXFA 4UQ3A 1ZGLM 3MLXH 1DVFB 1KB9J 3WDRA 4GQ9H 1UWQA 5DMGD 2R1YA 3TESA 3AVEA 2VLKD 4KK6C 4JCLA 3OPZL 7TAAA 2O5YH 3FT3B 5KSAC 1ZWIB 5JZ7C 4QOKD 1MQPA 1Q4NX 4MYWB 3KPLB 2WXDM 1HXKA 4QXUL 3M1BA 3G5VA 4DCQA 2V5DA 2ICWA 3QQ9D 4N68A 3VW3H 1A7OH 1CGVA 1IC5H 4QT5A 5MEOB 3ZDXE 3DV6B 3ZYIA 1ZJAA 3NGBC 5F89A 1IGIH 3MJ7B 4LLMA 2WZEA 5EFDA 2ED7A 2ITDB 4JO2L 4MDIB 1X5YA 2D31A 3CMJA 2W9DL 5E8DH 3I02A 2MKLC 1FO0H 2JB6A 4MA8H 5LAXA 3MCLH 1KR0A 4JGJA 4Q2ZB 2AV7A 1DL7H 4UT7L 5AG8A 2E4TA 3ARED 2XWTB 4W93A 5DK0A 2OK0L 5DUMH 3TBSB 5I19L 4G80A 1H9VA 4FQXA 3VWKA 3WY2A 2BP3A 1C7SA 3SDYH 5C0EA 4J8RB 3QWRA 1B0RB 3GMPB 1OARL 1V5JA 1I3RB 4DGYL 2FYVA 1Q9WB 3ULUC 3SDDB 4NZUH 1Q9LB 1TR1A 2VZ3A 5E2WH 1CGSH 3WN5A 5J3HD 1T1ZA 5IEKA 1ES0B 4XHJD 4Y1AE 1A1OB 4OZGB 5ITBH 4UU9A 1GOOA 1TQVA 1HKIA 4YPGA 5FHAH 2B1HL 5FL0A 1CXKA 5E0CA 4PJCF 1RP8A 3BSZL 5KVGH 3F62A 3X3GH 3N15A 1RJYA 4PJBB 2JB5H 3QEQA 5HYSA 3GKZA 3U30C 4JFZL 5D8WA 2PXYC 2XN9D 2OWWA 3UTSE 2EABA 2WBKA 3RWEA 2CGRH 4NHUB 4PRIB 1D9KA 5C08B 4LEOA 4WW2C 4MQXC 4NO3A 4D6IA 5BWFA 2H6PA 3POCA 4M9OA 1I8LC 5GS0L 3VUPA 5FM8A 3U82B 2ZOKB 2IAMD 3TBTB 5GNXA 1LNUB 4OV5B 1QSFA 2XNAA 3RNKB 4JRYD 4PJHF 5FGRA 4GI8A 1MCBA 3BVTA 3KPNB 2DLFL 4ZSOE 1JPGA 2YD9A 5FOJA 2YIHA 4O9HH 1AHWA 4XPBL 1EMTL 4E41E 4OLXL 4JEGB 3OKKA 3KLHC 1K2DB 4DZ8B 5F88A 1TZGL 4D2NA 4NBYB 1T1XA 3CFCH 3GHBL 3BAWA 1KB5B 3LXCA 2EDHA 3QHNA 5I18L 2A6DB 4X4XB 1Q6DA 3F5LA 4DUVA 2JELH 3BZDA 2FRGP 1DFBH 3GUTA 3C08H 4EVNA 5F9DC 3GO1L 3CH1A 1MPAH 1A21A 4XBGA 2EH7L 4HGWB 2W9EH 5GGSA 2DSWA 2WYSA 3RDKA 2EYTA 1AXTL 2F53B 3QSKB 3OF6D 5HYEA 4TPRH 2Z31D 4M43H 1T3FA 1JYXA 4PBVC 2FD6L 2B4CH 3MBED 5J6GB 1X4XA 3N13A 2ENSA 3N9GH 2X4QA 2ZOLA 4V2CB 3VI4F 4X8JA 1WFOA 2QQNL 1H15A 1JPST 3BMVA 5DWUL 5JMRA 1HIZA 4OI7A 1KNOA 3HC3L 1J8HA 4G7VH 5ICYB 3WEZA 1GC1H 3DO3A 4X9YA 1DQQA 3QAZB 2OW6A 3L6FA 1V3JA 2DYPA 4GS7B 4HV8A 1V6YA 2A3CA 3WMSA 2JIXA 1KWKA 2VDNL 2OTPA 2UUDH 1Q6CA 1P9MA 3QXAA 1WBXB 2R0LH 2EDEA 2JJUA 2Q8AL 5HYSG 4PJFE 3N1PC 1MVUA 4MA3A 5I1HL 1R3IH 3ZO9A 5FF6B 3KPRB 1MCJA 1U0QA 3QG7H 3SO3C 4ZFGL 2E9WA 3GBLA 5F1IA 3NDZA 4K2UL 1FZJB 1GJWA 1EFXA 4BA0A 3HMXH 3KPMA 1F2XK 3UTPE 1IBGL 1IGTB 3D51A 1L7IH 4MJ2A 2ORBH 5BV7H 4NNPL 4P2QA 4CVUA 4LRIA 1JGVH 4FXGB 4LVOC 1EDQA 3QQ3A 5EU3B 3BP4B 2IWGA 1OM3L 4N5UA 4BQ5A 5BXTA 1QFWM 3BVNA 1DE4A 4U6YB 3VGFA 4D6EA 12E8H 1NBYB 1S9XB 3AIWA 3VINA 5CSBA 5F7NC 4UR9A 4YHNA 4HP5A 3ALWA 2WC7A 4RDQG 5TFSL 5DS8A 3GJEA 4D0DB 3P4MA 4XVSH 1UJ3C 1DCLA 1F6FB 5K59F 3VXSD 4D9QD 2FBOJ 4WWKD 3R1GH 3BP7B 4NZRL 1EEYA 5FGBC 4CN4A 4UQCA 4LPCA 5DJXB 3WD1A 3MROA 4OF8A 3WBDA 3GNPA 1OAQL 3VI3F 4H5SA 4YDJA 4TTDD 3TIDB 2B39A 5KOVC 4XPFH 1C5CL 4OJFL 5JHDB 2R4SL 1WK0A 3E3QE 3DXAA 1MHEB 1CK0L 1CN4A 1CZ8L 1WKYA 5IGXL 5DD6A 4S1SH 1MF2H 4EOWL 5BRZB 1HKLH 5E5RB 2X4TA 5KW9L 4HJGA 5KS9F 2D0FA 4W7UA 1P84K 3AYSA 4AK1A 4C56D 4L8SC 4XVUC 3UO1L 1DP0A 3PIQA 3B9KC 2VLLB 4OZGE 2D24A 4OLWL 4EI6B 2ZCHH 4PJXB 1SYTA 4PMOA 3VFOB 5J7CC 3D0VB 5CZXD 5HI4D 3IDIA 3ZTNH 4RISL 5L2JB 1T21A 5D6CB 1OCWH 4F58H 4R2GB 3EFDL 1J5OH 2E7LA 3HMWL 1JPFB 4NM8H 4PRIE 4ZOBA 3DTXA 4MADA 3TEUA 5C08E 4M8UA 1H0IA 3U0TB 2DQFB 3FRPG 1KENH 3X17A 3CDFA 2P42B 2EO9A 4HLZH 4GXPA 2EZ0C 3U46B 5F9JA 1B0GB 1XGUA 2OYMA 2PWDA 2UVFA 4F7CB 5I17B 4HXAL 3UAJC 1C08A 2ARWA 3PL6A 2P5ED 4LLYA 4XNQB 2AJZA 4KJWD 3RJYA 1IL1B 4MDJB 4JFYA 1K3IA 3JUYA 4AM0A 2ZSWB 2OTUA 1CLVA 1MWAB 5JO5A 3GBDA 1BIIA 1A7NH 1QRKA 4XI5C 1BF2A 5GRVL 1AIFA 1G0YR 5JW4N 1ORQB 2W65A 4L4TA 1B1YA 3QIUA 4FS0A 1D6EA 3Q2CA 1I8KA 5BXRA 3BDXA 4HG4K 2V3EA 2G60H 2NW2A 3O2DA 3OX8B 4ZFOA 4QLRA 3X11B 1T83C 1B30A 2HJKA 3UX9B 2VSCA 2X89A 5IVXF 2CITA 3GSUB 3OV6A 2F53E 4N0UA 4QRQB 3I2CL 1FLRH 1R3KA 1AI1H 1RZJC 2VIRB 2WWMD 1FZMA 3GMQB 4XVTH 3LMYA 5JPMB 4FQ2L 1EJOL 3RWJB 1NGZB 3TV3H 4M1GH 1CFQA 2IJ0C 3H9HB 3LCYA 1GCYA 3HE7B 4F37K 4LKCA 3AS1A 3CZLA 5GJSL 4N8VB 1V3MA 4MTVA 5I8OL 1ZGLA 3TH4T 5C9KA 5BS0A 4X98A 3L5JA 4IRZH 5F7DB 1IFHH 3MLVL 2UY2A 4N0FB 5C0JB 1DQLH 1K4DA 5EUOB 4L8BB 4UT6H 4PCTA 1M7IB 1HQ4A 1P7KB 1RJLA 4J3VA 1Z3GL 1TPXC 1QFPA 2NY1D 2O26U 3WQ6A 4JDZA 3UP1A 2NZ9C 4XP6H 3VFVB 3EJQA 5T1DH 4P57B 3TJHC 1YEDB 2O5YL 3SCWA 1AD0A 2XZQH 4AD0A 5BZWB 4GBXC 1QFOA 2VLJD 3KPRE 5F96H 4ONHB 1F3DH 2AJUH 2AK4A 4JN2B 4NSKB 4FFWD 1OM0A 5I74C 4L9LC 5FYKU 5ISZA 3T0ED 2X1XR 4EZMA 1AO7D 1A7OL 1IC5L 1VHPA 5E5UB 5EDXA 3ULVD 4YHPA 3VD9A 3VW3L 3BKYH 2WCAA 5FIEA 2A0LC 2AEQL 5GXBB 5ELIA 3QUXD 5JQHC 2R56L 1FO0L 3B2VH 4FXKA 4NO2B 1HK6A 3MCLL 5J1AA 5KSUA 1CICC 1XF3B 2CBVA 3SKNA 1MFCH 5BW7A 3TA3C 2HP4A 4EQ3A 1YA5A 5DUML 2NPLX 2PB1A 3WQ8A 4R0LB 2FHFA 3SDYL 1QFUL 3ULVF 4FNPA 1TNNA 1OHQA 3O9WC 4UZGA 1KIUA 4IM4A 5GHWL 1G0DA 5HHNA 3OR6A 4NZUL 2YFNA 1HH6A 4TQEL 2XKSA 1CGSL 5E2WL 5AYIA 2NXZC 4EDXB 3VXUB 3IJSB 1R5IB 3JTSB 1QBLH 1BWMA 4GSDH 1BGGA 1FA2A 15C8H 1VFUA 4DWSB 1RK0B 2YL5A 4PGBB 5I2IA 5FAAA 1HJSA 1YMMA 2D7TH 2ZSVA 3MFFA 4HIIB 1C8QA 1A7PH 1W2VA 3B8SA 5KVGL 3X3GL 2XRAL 5FYLD 3BUBA 4LDLB 2JB5L 4KI5C 1V02E 4J3UA 4XWOD 1RZ8A 1ODAA 3ZDZE 4AW7A 3WS6C 4PJEF 1VB9A 4BQ8A 3PNWA 4X4ZA 4NKQB 2CGRL 5IB2B 3OLIA 1T89C 5JHDE 3CZSA 4RNRB 1LK2A 4MS8D 1AE6L 4S1RH 1K8IA 2XUCA 1HJUA 3WS3B 1J05B 4PYHA 1QBML 3K81A 3VE0B 5IG7B 5BRZE 4XCNB 5T1KB 1HL8A 2LTQC 4OLUL 5BXFB 5HGHB 4UQ3B 4PGCB 5FYJU 3OR7A 4ZO7A 4HMDA 2R1YB 4O9HL 5BRPA 3PQYD 1KCLA 3MACH 4F9JA 3FQXA 4E2OA 3CFCL 2C3VA 4MAYD 3G5VB 1YDPA 2D0HA 4DCQB 2WWKO 1B90A 2FX9H 2HKHL 4QT5B 4P2RB 4K71C 2VUOA 3SHSA 3F7VB 1DFBL 4KZDH 4I1NB 1KSRA 3C08L 3QIWA 4EANA 3PABA 4LLMB 2L0DA 1MPAL 4PUBL 4DKAA 2XWBA 4PYGA 1JZ4A 1UWGH 1V7NL 3OSKA 5GGTA 5FCUL 1WBYA 4WTZG 4OLEA 4TPRL 1OLLA 2AV7B 4M43L 1A4KA 2XTKA 1HZHH 2V3DA 1NL0H 2R8SH 1YMHA 2XTJB 2B4CL 4G80B 4FQXB 1A22B 3N9GL 3NMEA 2V5RA 4U6HA 4HDIA 2YS4A 2MQ0A 4A6YH 3ILQD 4Z2HA 4G7VL 3RU8H 4HH8A 1GC1L 2P46B 4R96A 5IEKB 1JNNH 1S8DA 3WEXA 3S5LG 4KQ4H 1JF1A 3SCTA 3HS0A 3ZOAA 4UU9B 4XPHH 4YPGB 1A6AA 4B5EA 3AIBA 1RJYB 1L0QA 2L4OA 3QO0A 4PJ7A 4FFVC 3QEQB 2R0LL 2J8HA 3RILA 1GOIA 2RGLA 1R3IL 3ZDYE 1S7QA 1HI6A 2MFNA 4NFBA 1BD2B 3WXWL 1D9KB 1P7QD 3QCVH 4LEOB 3MRFB 2Z8SA 3EYQC 4OF7A 2H6PB 1RUAH 4AD4A 1MJUL 1EA9C 1QKZH 1R47A 2XNAB 3HMXL 2D3VA 4AZCB 1L7IL 5JW3H 3HNSH 1NCAH 1U91A 4Y1AD 5T1LD 4JFVA 3LV3A 1AHWB 1JGVL 2AJ3B 4WUKH 5EUOE 1ZMYA 1KIRB 4YR6B 2MPAH 3OKKB 2ZKHH 1ZLUH 3MRBB 3VM7A 4GRWH 5F88B 1K9DA 1TZIA 4WU5B 3KPPB 5DURD 4ODHH 3BVXA 12E8L 1Z5LB 1CDYA 4OJYA 2J7GA 3W37A 1D5MA 3UTSD 4IPNB 1BLIA 2XQYK 2EXWD 5F1NA 5DR5H 3GXNA 3HG2A 3IKCA 4LARL 4EVNB 1YYMH 3VXNB 2AEIT 5T3XH 5ESVA 3CH1B 4XMPH 5GGSB 1A3QA 5E4EB 1GGBL 3OXRA 2NY0C 4WO4D 4XVSL 3U2SA 4NWTH 1T3FB 2VLME 3R1GL 5LWYL 4FZEH 2PO6D 5FM5O 3G6JF 1PY9A 4KRMB 1UR4A 4E41D 4Q6YA 2JJTC 1F6AA 1W72A 5CEZH 3BEWA 5F7HA 1SM3H 3BCFA 3B4NA 1U8NA 3KPSE 3WIIL 4TVCA 3FB6B 5HBFA 1KNOB 3B3IA 4XPFL 1J8HB 5GJTH 2AV1A 4OGAC 2IG2L 5A6KA 1FBIH 1DQQB 1XH2A 5JXED 3L6FB 2DYPB 2R4RH 4HV8B 5K9KB 4KY1H 4OZIF 1YQVH 3PV7A 1VDGA 2EE9A 3V7AG 3VGGA 2JIXB 2P8LA 3VXUE 3JZ7A 4BQ9A 3QXAB 4JIEA 3IAPA 1MVUB 4MA3B 5IBTH 1FFPA 4CN1A 2YOCA 3QXDB 1KCSH 1NAMH 5HGGS 1JXJA 2CEQA 1MCCA 4YX2H 4X4ME 3ZTNL 4Q9CA 1ZGLP 1K9FA 1WSST 2YD4A 3S34L 2IPKA 3ZHLA 2A6JA 4WKAA 5F1IB 1S46A 5EMYA 1NCDL 3U4EA 5CLWA 4JFXA 1OCWL 3MBXH 5IBUG 2I60H 1J5OL 2IPTL 1SJXA 1BF8A 1E9LA 1OAUL 3CXHJ 3O6AA 5GZNC 5IXEA 2Z4QA 3RZCD 3WQ4A 1KENL 3WFEH 2FJGB 2PCPA 4UTFA 5FEBA 4M1RA 3WO4C 1GPFA 1TCRA 4PGJA 2WLYA 1J1PH 4EI5D 2NXYB 5ID1A 3EYFB 4KROB 2A38A 2WZPD 5IWLC 1IGCL 5JOEA 1MCHA 3BYTA 3V6ZA 1BFTA 2ZCLL 4AISA 2YUWA 1H0DA 3P4MB 5F1SA 3UTPD 1NP2A 3U7VA 3IDNA 1RY7B 3H8NA 1I9JH 5M7QA 1NARA 3GSXA 1QHZA 4PJFF 5EA0H 1MCDA 5ID0A 3MROB 1I4FB 2CCRA 1QOKA 43CAA 1W8NA 5SV3A 4W85A 4H5SB 4YDJB 3K1KC 4QHLA 4XCCH 2VL4A 1DVFD 3VD3A 5JR1L 4KVCL 3LAFA 1YYLH 4XAWH 2BXYA 4YPJA 2NY4B 2EO7A 3SCPA 1EOKA 2XTJE 3RNQA 3SQBA 4MB5A 5JIPA 3OA5A 1A6UH 3CVIH 3TV3L 4M1GL 3HG3A 5DD6B 3LIZH 1I3VA 4NJ9H 1VKXA 2YXFA 5C0BA 3UJTH 3D5HA 4CD7A 3W27A 4LAJH 1IFHL 4HF5H 1FDLL 1GPOH 1EDGA 3PIQB 3QYCA 4UT6L 4LPVA 4HPYH 4JO1H 1MI5B 1X5FA 1OIFA 1E4KA 1FH5H 3IDIB 3QEQE 4XP6L 5T1DL 3BRFA 4GZIA 1YN7A 3O6LH 5T3ZL 3OKMA 1T7WA 5CAYB 5D7JB 4LBEA 4JHZA 4QHKJ 5F96L 3UZVB 2EDLA 5JLZA 4GG6F 4CMHC 3NIFF 1NDGB 2X2YA 3K74B 3SDDD 1T5WA 5IMOB 5F9JB 1XGUB 2OR9H 3C9NA 2CNCA 5JPNB 1U58A 4PMUA 1KT2A 4CVWA 2AJZB 2MNUA 2BOBA 3MMEB 4JFYB 3QR3A 2ZWZA 5B38A 1MFCL 2R0KH 5JO5B 1Y6KR 1BIIB 1FE8L 1U6AL 4QCIA 4X9BA 5IFPA 1AIFB 5CSUA 3T3PF 4L4TB 1EXPA 1YJDH 3MZGB 4QAWA 2GK0A 3QIUB 4WI7A 5A6BA 4YFLF 1AMYA 5FD0A 4PG2A 5D7SL 4QLLA 1D6EB 1JK8B 4HJ0C 1XF5A 3SN6N 1SY6A 4PRID 3TT1H 5C08D 4OD2A 3WJLC 3TONA 4PMXA 2NW2B 4ZFOB 4XNYH 1ZE3C 2HJKB 1A14L 4LFHD 3RX5A 5B3NA 3S36H 1IZJA 1J10A 4UV7H 2D7TL 1L7TH 2X10A 2ZNWA 1A7PL 1QLRB 1FZMB 4JZOA 4HU8A 1QD0A 3SOBH 1CFQB 4N0YL 3V0VA 1CQKA 2NY3D 1AP2B 1CXFA 4LKCB 1NMCC 4LNVA 5HHPA 1ZGLB 3WELA 1M7DB 2OXHA 5BS0B 1J8HE 1P4BH 1YN6A 1F4XH 3NIGF 5I3DA 3BD5A 3GXFA 5INCB 4JANA 1ERNA 4GO6B 2W67A 2ZUTA 4LP5A 1RJLB 1CE6A 1KCVH 3LHPH 3RVTD 3RI5F 5JHLH 4ZENA 2ADJA 1PQZA 2F53D 3U7YH 4BSWB 4LLQA 3GSQA 2HRPH 2AQ3A 3MACL 5ILTL 1JWSB 3NCMA 1AD0B 3AISA 4TX6A 3SKUD 3UYRH 2AK4B 2GDVA 4F33A 4JM2C 5C71A 2FX9L 2YHGA 5F8RC 3O6MH 1QUNA 3D0LA 3HFMH 3B6SA 4P23B 3WY4A 2DB8A 1ULVA 2XG5A 1KYOK