3VGDA

Ctystal structure of glycosyltrehalose trehalohydrolase (d252e)
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
555
structure length
553
Chain Sequence
AYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLEAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 193
structure length 553
sequence length 555
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgdA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgdA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgdA02
4XAWL 1QI5A 1QO3B 3HI6H 4P46C 3FO0H 3WJJA 1WB0A 3I9GL 4CNIB 4M61B 3PWLA 5LGJB 4UMGA 4XX1G 3U7WL 4I3RH 3I6KB 1FVCA 1MHHA 5I1HL 2LV4A 1FNSH 5GS0H 4F79A 4Y8AA 4S1SL 4G3YL 4AK1A 4OTXL 4L4JA 4XI5D 3S6CA 1HVQA 2VX6A 1D2KA 1TZIA 4KK8D 2QPSA 4OZFB 4KY1H 4J12A 43C9A 1CLVA 3RCNA 3SDXB 1F8TH 3MNWA 4XP4H 3WQ8A 3AHZA 4G9FE 5IEKA 4JGUA 1WSST 2A6IA 3AUVA 2QEJA 1PG7W 2ZCLH 1F2QA 4J3TA 1XGUA 1NOWA 2EC9T 4X7DC 4LKCA 1GGCH 4UTAL 5DT5A 2BK8A 1ONQB 4NO3B 4Y19E 1FFRA 1W2KT 1R46A 2QSVA 3BD5A 4OIAA 2ARJA 3N06B 4P2YA 1IQDB 2DF3A 2KL6A 2V5YA 3PV6A 3C5ZB 4CKQA 2CRZA 3CCHB 5F44A 4CD4A 1DANU 3HAEB 1FH9A 1W9UA 1RZ7L 2OS7A 4GZEA 1ERNA 1HSBA 2ERJB 1OAUH 1C16B 5F70A 5F93C 2FNBA 4BQBA 2FEDC 3CZ8A 4UQBA 1PEZA 3LPOA 4KQ4H 3IDJB 3QUYC 4UDUA 2OBGA 4LSQL 2D1ZA 4YHKL 1RUML 1ODUA 35C8L 2B2XL 2R23B 4LQFH 4JKKA 5FO8B 2Q6WA 1ZOXA 2CEQA 4H7VA 4Z7WE 5EBGA 4P3DB 4X0KB 4H20L 4JHZA 5DK0B 1U2HA 5AD0A 1ACZA 4Y7EA 5EBWA 4G9FD 8A3HA 3WY3A 3MLWL 2P8MA 4O2EB 1JPFA 3EDJA 1PGRB 3PQYB 3GSVB 4NZJA 4CW1A 5E8DL 4TTDC 3RVTD 2VZ1A 1BIIA 4P23D 1NPUA 2CDGB 4GH7B 5HHXL 1FSKC 2BY2A 3BUYB 3S37L 2F8QA 3IXTB 3DXAA 4CDHA 3IDIA 3M1BB 3W11C 1FRGH 3SPVB 4X4ZA 2UWEA 3G6AB 4OCYH 4TVSa 2XWDA 5JR1H 3UTTA 4JLRB 2OX5A 1X5ZA 5EU4A 1YEHH 5IFPA 5F9JB 4JFEE 2Q7NA 1DBAH 5DRNB 1QBBA 3ARDA 4DO5A 3PBGA 3R0NA 1XC6A 4WHTB 3TFKD 5JXED 1VFBB 3GNMH 1MFAL 2AXGA 3WXVH 4YX2H 1G9NH 1SEBB 1JNLL 4EI5A 3FQRB 1L0XA 3D85A 1Q94B 1UWEH 3VH8G 1MY7A 3BPCA 3WSQL 4Q2ZA 1OHQA 2OR8A 2XM1A 4PR5A 3DMMB 1V3HA 2DGAA 2YPKA 4S10A 4BSJA 3DTXB 5JW3H 2OI9C 3AHXA 3RWFA 1UWQA 2NR6D 4OF3A 4ZTOL 3FB8B 1AO7E 3VGDA 3FQWA 1X3DA 7A3HA 4PYGA 3RNQA 1I9IH 4XT1C 4BF7A 4HFUH 4HMDA 4XVTH 3QZWA 3GO1H 3QCTH 4UCFA 5K59F 1OT1A 4AMXA 1E5JA 3AU1B 5HHQB 1GUVA 4PTXA 1HH6A 4PGJA 2Y24A 2VLJB 5KSUB 1A3RL 1YEGL 1XCXA 4MQXC 4HIIA 4NO2A 2MQCA 1HQ4B 1HINH 4EKXA 4NOFA 3C5JA 3EYQD 3BVXA 3IJ9A 5M7QA 2OLHA 1YMHB 1KXVA 2CIKB 5F7FA 4OZIA 2OSLA 5FYJL 4WF7A 3L3IB 1CZ8H 3TESA 2ZP0T 4J3XA 3U0TA 5DGRA 2X1WL 2X41A 4CRPA 5C0JB 1H0DB 3GMOB 5FKPB 1VFAA 4HXAL 4OF7A 2C1PA 2W92A 4K7PL 2VLKE 2VB5A 3LHPH 5ESQB 1T04A 1LJYA 3DRTB 4E0RA 5D2NA 1CLZL 4BSVB 1QVOA 4PMUA 3BRGC 2QSCL 5EULV 3JV5A 1C93A 1UH2A 2ICWI 1CFQA 4LU5L 4OGAC 4P2OA 4YDIL 3HMXL 3KLAA 3BWAB 2E6QA 1T03L 3BAYA 1EGJH 3JV6A 4K94C 4GXPA 2ZX7A 2X2YA 4S0SD 2RGSA 3II1A 5HPMB 2GIYA 3LPFA 3DIFB 4Q0XH 5HDLA 3RA7L 5GZNC 5EUKB 4XNQA 2WCAA 3AIRA 2GTZB 5JW4M 2QLYA 3OLGA 4MA8L 2QV4A 3VFGH 2F15A 4ODXB 3PWPB 2AOSA 1BBJA 2DRUA 4CADB 1YN7A 4QTIH 4AZCB 3U46A 3ARTA 4ONGL 1Z9LA 3D5HA 4MADA 4WCYH 3UG4A 3VFUB 3DV6B 3NTCH 1HILA 1Q9WA 4FTVB 1Q9LB 1A4KB 3BVNA 3FTGA 4MNHA 5EFIA 1YUHB 4M6NL 4PJAF 2DJ4A 3O6MH 4RZCA 4ZSOA 3RZCB 3A21A 4MZ2A 4M5ZL 3CMOL 2DYPD 1DL7H 4GKZA 2EDBA 3LEYH 4LP5A 1ZLSH 1T1ZB 1BD2B 4TPRL 5D5MA 3FJTA 4M6ML 3NFPA 3U5YA 1KXTA 4PBWD 1EGJA 5JLZA 5T33L 4G7YH 2DL9A 1HXYB 5E2TL 3TN0D 4ZFOB 4IOFC 4ATLA 2BNQE 2Q76B 4CMMA 3SDDB 5IBTH 4WKFA 3AZRA 2Z92A 1U8LB 4G5ZL 4YN5A 3MJ8A 2X4SA 5IBUB 1M53A 4M3KB 4ZO8A 2UYLB 5K9KB 3CZKA 1YC7A 3WIHH 1FO0L 4QHNA 5DHYA 4ZFGH 3K81A 5EG6C 2X4PB 3MBED 4XZUA 5CJOH 3NSXA 15C8H 1FGNL 1X44A 2QHRL 4WFHE 3L3HA 3UTPE 5DR5H 2F58L 2OJZL 4HU8A 4RA3A 4S1DC 5FYKL 2P49B 1IAKB 3MXVH 3NACH 5C07E 5CBAB 3ULVH 3GMQB 4PRIA 3SKUD 3TA9A 4JJ5B 2YZ8A 3ZE2F 1M71A 2ORBH 4PJGF 4ERSL 2YBUA 2O9TA 2X9WA 4WJXA 5SX4I 4M24A 4WW2B 3BEVB 2VLRE 4FNLH 4NQUA 4BM7A 1UD5A 3L1OH 2XN9E 3HR5A 4N0CC 3GZKA 4NFCA 3SGKC 4TOYL 5FUZH 4OOZA 3KXFA 5E6ID 3IJSA 3S96A 1UB5B 4BH8B 3B9DA 3CVIH 1N5YH 4NP4H 4JY6A 3WO3B 1Q0YH 4HIHA 5IMKA 4RISH 2AK1L 3MLUH 1HYSD 3FRUB 5I66A 2AXHA 3BAJA 4HIEA 3WIHA 4PSPA 5EOQL 1G7IA 5I9QB 3DVNB 3CZFA 2F19H 5FM8A 3VXOA 3KPMB 3SE4A 1RUKH 5IVXE 3MGTA 2KZ1B 3VWKB 1IBGH 3QNYB 2VUYA 2WMIB 3AIWA 4K55A 4WFFE 4C7DA 4G8GB 2OJEB 3WMSA 1OY3B 2A77L 2WMPA 4WFHD 4RE3A 4V2BA 4HKZB 1VGKB 4P8UA 3WEXB 5D7IF 1OSEA 3QAZC 1T1XB 3SJVA 4WWKC 4PJBA 2WVUA 2M1KA 2PI6A 1T20A 1NP0A 4W85A 5GGUB 4KUCF 5ALBH 1A7RL 5MERA 1P7QB 1QPPA 4XPHH 4LKXA 2AJZA 2AXFB 4OKVA 1JYXA 1MY5A 5CP7B 1JV5B 1K3IA 4ZYKB 1GL4B 2WIIB 1FORL 4ODHH 3BH4A 2FL5B 4PRPE 4ZO9A 5LA0A 2YMXL 3BQUB 2XN9D 2WAGA 1D6VH 5TGBA 4V1DA 1VEOA 3OAYK 3QJFB 4HPYH 2ZOXA 2YHGA 4PJ7A 1V3KA 2X4NB 3LDBB 4XB7A 5CEYA 1ULVA 4JDVB 3H0TA 1CK0L 4YFDB 3TV8A 4PJXF 43CAB 4FMKA 5IHBA 4MDJB 4GSDH 5CSZA 3PHSA 1GGBH 2E27L 4TUOA 5I75B 3ROOA 5HGBA 2Z31D 5E4EB 4N90D 4B9ZA 4ACZA 1A6VL 4N1CA 3RUGF 4AD2A 1HP5A 1F00I 1A6WL 4KI5C 4YK4C 1GJWA 5E8EA 1HIMH 2B31A 5B8CB 5HNNA 4XMPL 7CGTA 3B6SB 2XTKA 2MNUA 1HZHH 2MANA 4MA7L 3O4OB 2ZCHH 4M7KL 3LKNB 1HJUA 2I26N 4AIEA 3NCCB 5IHSA 4Z77A 5FM5M 3S97C 4GT7A 3FKUS 1E4MM 4BZ2H 2BSED 2FX7H 3JWDH 2GAZA 2DMCA 2MMXA 3GHEL 4PV9B 3GSUB 2PTVA 2IH3B 4UQ2B 4Z7VB 4Q7NA 4KRPC 2R0KL 4WI7A 3KPOB 5J57B 4HA3A 4AL8L 3SE9L 5BWFA 3PL6C 4OLWH 4PRPD 1AD0A 1G9MH 3WIIH 4ELME 1YDPB 2P5WA 3HG1D 4AWEA 1OP9A 1S5HB 1WISA 3BAIA 2ZJSL 1JFXA 1F4YH 4HZ6A 2FRGP 2Z93A 3SURA 3TBVA 2D9QB 2AABL 2W67A 3ARSA 4JZOB 2Q7YA 1A9BB 1KBGH 4MSWA 2W0KA 1E27A 3G6DL 3BUQA 3ZQ9A 1NBYB 5I17B 3QUXB 5AG9A 3RIKA 3QR3A 1EEZB 2FIRT 3NYDA 1V7NH 4NCC2 3S4SG 3PGCB 4YWGL 2D9CA 5C09B 2EKSB 3LQZB 1K3ZA 4LPYA 4QHUA 4RCAA 1AGEB 2P5EB 2HJKA 4P8WA 5A69A 2ZUYA 4OCSH 5BRQA 4LYPA 3CVHB 5HY9B 2XZCH 4NX0A 4DGIH 5F9OL 1OM3L 2NY5H 1PJ9A 1M7DA 1H3VA 1DBJH 5TE6H 1KR1A 4JHWL 3EYUL 2VJXA 5CZKA 4XNXH 1ZLWH 4OCXL 3ZJ8A 3PZIA 4RMUA 3JBG7 2PYEB 3JZ7A 4JZ5A 1EJ6A 1T5XA 1CCZA 4FP8H 5DD6A 3B43A 3IU3B 1AH1A 5C0EA 1PIFA 1UQSA 2RGMA 5BW7A 1QLRA 4IOIA 4NBZB 1OAXL 1I1YA 3GGWA 4TNWK 5I0ZA 3MKKA 3TPUB 2E0PA 4I0PA 3W2DL 3VRJB 3W82A 2V5MA 4OD2A 2DS4A 1KGCD 3UJJH 1D9KC 1FFNA 3NIGE 2HLAB 4TQEH 1CTOA 4JR9H 5T1MB 1A6ZA 4MXQD 2FGLA 5I23A 2X6MA 2J4WL 5KVDH 1ZS8A 4GKNA 3A67H 3ARFC 1MFNA 5E7FA 1UC6A 3MJ6A 4M1RA 1WBXB 5KZCD 1GAFL 1RZKH 5CG0A 1A7OL 1TVBA 5B38G 2HRLA 1KELH 3DX8B 2AJUL 3WDIA 2EPMX 4HUXB 1E6JH 1CXIA 1NGWA 2ZX8A 1NMCC 4X7TA 3TVMC 2F54B 2HT3D 1KIQA 2FYVA 4CVZB 3GM8A 3CDGB 2DIBA 5IK3A 1GQIA 4L3CB 5C92A 2KH2B 2VH5H 3F5WB 3BP7B 3REWA 3QNXA 1VGEL 4BKLB 5EU6A 1N8ZA 4X9YA 2YKLL 4UOJA 1P5VA 3AYRA 5FUOL 1V0KA 1JI1A 4M7LT 5B21A 1Q8MA 4LCCB 3C60C 5JXAL 1HX0A 5F21B 2ADFL 2YA1A 4JDTH 2RFXB 4G9DB 2IXUA 1DLHB 1QSFB 5HJ3A 4DUVA 1ZGLB 3RY6C 2A6DB 5TPWL 1LD9A 1PIGA 3SO3B 1H3PH 3TBWB 3HU7A 3ARGC 2OSWA 5I74B 2CBVA 1W0WA 4KK5D 5IOPB 2DQHH 3P3YA 1BP3B 4ENEC 2R9HD 5I8CB 3AIBA 4APQD 2P7TA 2CR6A 3U0PB 3MV7B 5DD3H 4POZC 1QFWL 2DLFL 1KTKE 1T22A 1Z6JT 2IAMD 3A6BL 2Y5TB 3ZKMC 4JFWA 3VIPA 3U48A 4K8RL 3TIDA 5AWNL 1HNGA 1LK2A 1JZ5A 1H3XA 1QRNB 3GMNA 3UG3A 1LK3H 5FV1L 1XR9B 2VXSH 2B0SL 3TLRA 1JK8B 2BJML 3GJEA 3W9EA 5HVHB 2EDFA 3BIKA 1G94A 4M7LH 5IB4B 2KDGA 3QCVL 3WF4A 4EUPG 3JVGC 3QNZA 3QWRA 1MJ8H 4ORGB 4ZAKC 3P4OA 3V0VA 3TNMA 4LSRH 4P4KC 1AXIB 1HI6B 5IQ9A 2EH7L 4FG6D 2AS5M 2NXYD 2B4CC 3ILQC 4I77L 2NNAB 5GJTL 3HCVA 4Z78B 2X89D 4I48B 2YPLB 3AMLA 3NIDE 5ESAB 3WF1A 5FKAB 3MGOB 4ATDA 4NN5B 4R3SB 3R1GH 1HSAA 3WD4A 3RTQB 3VXQB 5C0RH 2G5RA 1A2YA 5J06A 4XHJD 4D0CB 4HWEH 5HHPA 3KL5A 1ORSA 2DQGH 3WIFB 4X6EA 1JUFB 1N64L 2JF7A 2VURA 2GJXA 1LO5A 2ITDB 3SE8L 1AP2B 2NZIA 5DD5H 1IEBB 4E5XA 4LBEA 2ZWZA 3WQ5A 2QMJA 2VDMH 1YEDA 3P9WB 4UZUA 4XUYA 2VWEC 4WGVB 2CRMA 1NFIA 2EXWD 3CSYA 4ODSH 1F2XK 5BO1L 1KGWA 2EYTA 2J79A 3BRFA 3K8KA 1UCBH 1MHCB 3QPQD 4XPAH 3SQOH 1KCSH 1PY4A 4YPGB 2XWTB 5DMGD 5KAQF 3O41A 5HGDB 4Y1AE 2C3VB 4JZNB 1RUPL 1MJ7L 5DMKB 1UR4A 3QOMA 1LNUA 5B39B 4GG6A 4LLAA 5JO5B 4KPHH 1YPZE 1UJ3B 3PZUA 5I79A 1XF5A 3LS4H 5J89A 2QMKA 3NPSC 5F1OB 3KPSE 1Y6KR 4R9HA 3OR7B 4K7PX 4ZOAA 4H8VA 5IB2A 3MRKA 3ZTNL 2YXFA 1A1MA 3TWCH 1KIPB 3IS0X 1NC2D 4HULB 3RM4A 2CSPA 3WDJA 1RPQA 4UFJA 2FCBA 4ZUTA 4Z95H 4L4VD 3L3DB 3QB7C 4U6VL 4CBPA 3IT8D 1NL0H 3JTSA 5HI4D 5TE7H 1AIFA 3HE7B 1JGEA 3MOBH 2VYRE 1FH8A 1YJDH 4XPGH 4NCDA 1BFOA 4X7EC 2VIRB 2IFFL 5T3ZE 1KTDA 5JA8B 2H6PA 4I3SL 4W84A 2APTA 5FYLL 5CUSH 1K9TA 2D7NA 1M01A 5E1AA 3M17B 1G7JA 1W3KA 5M17A 2LAAA 4FQHB 1SYTA 1U6AH 4L9DA 5E08H 4G9FA 3FZUD 3L9RA 5DUBB 2XGBA 3WFBL 1CFVH 3IFNL 5DUML 1XH0A 3GSOA 4P23A 5I1IH 4F9LA 1EXPA 2NY0B 3RILA 4YHOH 4WI6A 3I2CH 5DT1L 2HVKB 3F58H 2J4GA 1V08A 4PJ9D 1CXLA 1UA6H 4O5LH 4OZGE 2XVPA 1AR1D 3RVVD 4F8XA 1LE5A 1VDGA 4M48L 1TVHA 3QQNA 1UB6A 3HC4H 3U4EB 1QPKA 3IJHA 4GOSA 4L8BA 4C56B 4Q74A 1NCAL 4XC3L 3IDMB 4OZHE 2AJSH 3KLKA 4JFDB 3BJ91 3EJYC 2ZG1A 4IIQA 4M5YL 3HTLX 3RGVD 1KG0A 1SY6H 4KJPC 2PYFA 3N1PC 3JTTB 5DRWB 3L2LA 5JXEA 4JM2D 1BSIA 3RKDD 4JRYD 3BZEA 4M8VA 1A3QA 2V9TA 3T0DA 1TJIH 4MXVF 3RL2B 3U7YH 2WBJC 1HN1A 1HJSA 3TH3T 1NCDL 1FYTB 3DX7A 1XCTA 3MMEB 4AMKL 5KSBA 2ITCB 1AVAA 4KUCD 1OAZH 1KNOA 4YHZL 1E4WL 4GO8A 1GZQA 5KVFH 5C0AE 3UAJC 2C7UB 4WDIA 5JBDA 5T1DL 4OIIL 3KHQA 2XFXB 3EYOA 2XTJC 3CUPA 4KVCH 3QXAA 5FM4A 2DL2A 1AXTL 3UYOD 1A4JA 3RWCB 1DQDH 5A16B 5E0QA 1R5VB 4F8TA 1B3ZA 1VBRA 1I1WA 5FOBB 1CI5A 3LY6A 4HWNA 3UDWC 1UKQA 1BBDH 4JY4B 1NBVL 1UKSA 5IMOB 4B50A 4BA8A 5C08B 3JV4A 2COQA 4FN0A 1NC4D 2AGJL 3QDHA 2A73B 5ABGA 4CN6A 2ZG2A 2PO6D 1JTOA 1T66D 2WC4A 5JBEA 4H26B 4IJ3B 4ZPTB 3QEQD 3VMOA 3NIFE 4M43H 4LCWE 4QY8B 2YD8A 1SY6A 4U0QB 4F37K 3HUJF 3V6ZB 2HH0H 2E3VA 2EE3A 3TBSB 2Y2WA 2J8UB 5CJBA 1KB9K 1H4PA 4PP1C 2J7FA 3WNMA 3SCMB 1AKJB 1A6TB 2OQJA 2XXMB 4AH2A 3SCRA 3WEZA 3NSMA 3AVEA 1NAMH 3VD5A 1I1FA 2ZOLB 3MLPA 1QOKA 4Q9QL 5C6TL 4HLZG 5DQ9B 5IMLA 4WHYG 1P2CB 1GOMA 5ITBH 1UZ6E 4ZFOL 4QT5A 1JGUH 3O9WC 4WWID 4JFFD 1S5IH 4GMTL 4K3GA 2ATKB 3O6AA 1N26A 3WJJC 3OG4B 3PF2A 4YH6A 1WT5A 3FONB 4P7RA 1MCKA 2Y72A 3VXUD 4F33A 4RE2A 3EJZC 1FGVL 1NGXB 4TSBL 1CFNB 2MCG1 3FQUB 2IH1B 3W81A 3SCSA 4K3EL 1DEDA 5A43C 4TTUA 4ZXBD 4CL7A 2UY2A 3T4AA 3LKRA 1EBPA 4OV6F 5DJ6B 1JGVL 3T8XB 4RGOL 4DFIA 4M56A 1V6UA 1X5FA 2NW2A 1TQWA 1BVKA 4LLUA 1RU9H 5F7WC 1JPST 1W2VA 2NW0A 1QLEH 6A3HA 4JRXB 2AK4E 1MCWM 4LCWD 4TSAL 4JAMB 5I71C 4EZMA 3FRPG 3TH2T 3AREC 1UWGH 3T0BA 3V7AE 1GC1C 1KPRB 4AYFA 4NFBA 3BESR 4KK6D 1NUNB 1NAMA 4OZ4A 5J8OA 2DM4A 4XH2A 4QRTB 3UO1L 3U5UA 1ZGLP 2ZX6A 4UV4H 5TQ2H 4PJ8B 5JOEA 2DYPA 2XJ7A 2ZOKA 2H2PC 4WSKA 4AZ6A 3MRDB 12E8H 4KKAD 1ZWIA 4D0DA 3T0WA 5EUOE 3MV8E 3S98A 1FG9C 3A5VA 2ZNWA 3QULB 5GS0C 4NKOA 1GGIH 1T5WB 5KSAB 5L2JA 3ZSSA 1B30A 3TN0A 4UTBH 4OLVL 4PIRF 1IGIH 2VZVA 3IKCA 4PJFF 1RIUH 4F8QA 5EOCH 5LBSH 3BZFA 2VDQH 4HT1L 4MB1A 2ED9A 3E6HB 1H3TA 3ZO9A 1IM9D 3CX2A 4X99B 1Q38A 3F12A 4N0YH 1MF2H 5DJCA 1WC7B 3MV01 4KVNH 3W0WE 1FDLL 1JAKA 4OT1H 4HPGA 3IGAA 3MBEA 2AW2A 2WWCA 4ALAH 1L0YA 4RBPK 3HNSH 1FBIL 3D48R 4QKXB 1WICA 3JUYA 5E5UB 3CK0H 3OX8B 1KCRH 1OW0A 2H1PH 3CDYA 3A22A 2EKJA 4AM0A 4KRTA 3T1FB 1VF8A 4CN4A 4MNGB 3ULUC 4D1IA 3LRGA 1DEEA 1FFPB 3KYMB 3F62A 2NX5D 2UZXB 3VXTA 3MV9B 4X8XA 4MXWL 4KHTL 4HKBB 4XCYA 4CJ1A 4Q22A 3FB7B 4Z2KA 3W26A 4GW1B 4W6XB 1KJMB 4XCNA 2W9EH 4OJFL 3WFEH 1MOEA 3IJYB 3CZSA 1OSPH 3SBWC 1V0MA 4KRUA 4WY7L 3N1QC 1XEDA 4LSUH 5C9JA 3WD5H 3W24A 2A3EA 1ESWA 5E6IA 5FO9B 5D7LD 3NMEA 3ARDC 4NUJA 2V3EA 2X7LA 5ETUA 4NWTH 4X4YA 3MRJA 3VXMD 5E5MB 4EVNB 4R2GB 1N0XL 2BNQA 1O7VA 1FC1A 1J1PL 1DQJB 4MVBC 3L3GB 4PGDA 1UM6L 32C2B 4PREB 4HS8H 4GIAA 4U0RB 2EDDA 4PBGA 5BMFH 4DWSB 4WEUD 3NZHH 1DN0A 3VXNB 3X17A 4YHNA 3SUWA 1FC2D 4M1DH 3ZKND 5DTFA 4NHCL 2V2TB 3U30B 2DLEA 3VG9B 1S7TB 2EDLA 3S35H 2HP4A 2DH2A 1NEUA 4OV5B 3GBDA 2CK0H 5LGHH 3N1AA 5HHMB 2NY4D 3UPCA 1HOCB 1B4JL 2VNCA 4JHAH 2GT9B 3VFPB 2VDRH 4YHEA 2CBJA 5ERWA 1JMXA 5BZDA 3STZA 5I1DB 2G3MA 1CICC 5IKCB 2X1XR 2GUOB 1NKOA 3QIUB 2F5BH 1A7PH 1RZGB 4ZUUA 3WIJA 3EJUA 4I18B 2XN9A 3DX3A 4KKNA 4PJEB 5EBAA 5JORA 3MROA 1VB9A 5EOTA 4PJHF 5HVWA 3TCXA 3ZR5A 3V6OE 1V7ML 4LNRB 4U1MB 5E0FA 4ZPVB 5E99L 3WFLA 4AG4H 3P4NA 4S2SB 4ODTH 4UFHA 1QFUH 2V2WA 1G9NC 4P2RE 3CHEA 5ISZE 4PG2A 1RJLB 3T0EC 1G0DA 2ZUSA 4NSKB 1NEZB 2Z31A 3CVHL 5CD5C 5CJ5A 3LEVH 1QR1A 1PDKA 3TP4A 4NRZB 4YC2C 2VSDA 3NCFB 2IJ0C 5TH2A 5FO7B 2FHCA 4OM1L 1TJHL 1S9WA 2I07A 5FYJU 1IGYB 4JG1H 1T1YB 1V03A 5SWZD 4G8FA 1OGAE 1ND0A 3NCEB 4HBCH 4GW4A 1SYSA 2VX4A 1I7ZA 3ALWA 3IXAA 4P2OC 2X4UA 5SX4H 4RDQG 1G6RH 4JO4H 2VITA 5FYJE 3UYPA 1JBJA 4Y2OA 4NC2B 3W53A 3GK8H 3EFFB 3NJ3A 2ADJA 2LFGA 4XVSH 2ZE0A 3AS0A 1MHEA 5KW9H 2BVEA 2A3BA 1DLFL 5C6WH 4GG8A 3EYVB 3MUHL 4IRSB 4PRPA 2R2HA 4NSBA 3RPKA 4P7OA 2ADGB 4HX1A 2E7BA 3HG1A 3VDHA 2RQ8A 4HH8A 3QDJE 5I15H 1MW1A 4MQ7B 5TF0A 1ZHBA 4HS6A 3WQ4A 3V7AG 4UQDA 4MWFB 2C4FT 1ZE3C 3GSRA 1JDAA 4XXCC 4ZDHA 1QSED 4WV1B 1G7LB 1IC5L 3OKDB 4UV7H 4YXKH 2O93L 3OWEA 1FVEB 3DETC 1O0VA 1XGZA 1GPOH 2D7OA 5GPRA 3WH9A 2VDOL 4HF5L 1I85A 3U1SL 3OKLA 3T0AA 4FQ2H 1DBKH 1BOGA 1MIMH 1ZLUH 5GISH 4KZDH 1ZLVK 5FHBH 1TQSA 1MCHA 4RFEB 1G6RA 4LMQI 4NZDA 1NGZB 5D1QD 3CJJA 5FIEA 3GSNH 1W9BM 2YBRB 4GRWE 5FYJD 3CZLA 2FGWH 4NNYB 1E6PA 5C0IB 1RZIA 4MAUL 4PRHB 5E6ZA 1N6QH 1MQPA 5JOPE 3O11B 1Q9OB 3WN5C 5L6YL 4F7EA 2BRRL 4HDIB 1DQMH 5DJ8B 3QI9D 3O3AA 3ECQA 1MFBH 1URLA 1XF1A 2YL8A 2X9YA 3TBTA 1MFCL 2CETA 2JIWA 1EOKA 1S3KL 1LO3L 4P9HL 2EO1A 3RWDA 3RM9A 4KV5E 4U1LA 1B0GA 3H9SD 3RVUC 3T4YB 2YD3A 2WVVB 4MNQB 4UAOB 1QOXA 4HSQA 3NCMA 5FYKU 3RJXA 2UZIH 3DVGA 1CDYA 2GY7B 1K4DB 1OSZA 5EU5B 2XTLA 1US2A 2CHNA 4JN1L 1EEQA 4KJYB 4U1NA 2H32H 1S7QB 5CHNB 3CFBA 1AJ7L 3GSQB 1RV6X 1U3HB 1QEWA 1YQVH 3FO9A 4MLIA 5FYKE 4OF0A 2G60L 4LEXH 2XVGA 5M95B 3GSNA 5DJYA 5GSVA 5BVJA 3LS5L 2NTFB 4D72A 3CSGA 2WAHA 4JANB 4D6CA 2XKNB 3OAZH 3POCA 3O4LD 4MX7A 4JZJA 4HGWA 5ICXA 1HNFA 5EU7E 5F6IB 2HJFB 4YDVB 5JOPD 4Q9BA 4QRPD 2DT2A 2DD8H 2O5YL 4IM4A 5A8MA 4PLKD 3ECBA 3OJMB 5CCKH 3MRFA 5E00B 1ETZA 3SE4C 4LSTL 4ZOCA 3ZLQC 1KTLB 5C0CE 4GKSB 5HHNA 3WFCL 3BI9X 5JPMA 2MWCA 2ZUQC 1G0CA 4KWUA 1T6WA 5D2LB 1I7RB 3NABL 1QLFB 3HI5L 2WZPD 2AV7A 1RFDL 3ULVC 3C8KA 4XP5L 4PJ5B 4HV8A 1GZJA 4LNVA 5DQDH 1K5NB 2R56H 3TZVD 4APQA 4D6HA 1A0QL 1MCEA 2GUYA 1OWRM 1OTSC 2FZ3A 1LEKA 3GXDA 2VDKH 3FFCE 2IAMA 5F96H 4P2CG 1UHVA 1LILA 3GMLB 1M7IB 3C2SA 3HE6D 4C59B 2DQDH 3D4YA 1A1NA 2FYYA 1DHKA 2UWFA 2KQMA 3VPLA 1T3FA 1RH9A 3OB0H 1HDMB 3EHBC 1MCWW 1W1YA 3PJSA 2CJUH 2DDQH 4PRBB 4PP2A 3N1FC 4X83A 4DK6A 4P8XA 4UFLA 1CT8A 1EGZA 1PYWB 5F7DA 5BROA 1LO0H 3TO4D 1TJGH 2WCSA 1IRAY 1H5VA 4U3XA 2EBNA 4HZLB 4OQTH 1R33A 2APWA 1TA3B 4KI5F 4QRRD 3BKCL 5CMAB 3NFSL 2Y8KA 1LG2A 2NCMA 4Y16B 3QHZL 4MAYB 1AGBA 2X89A 4FQCH 4OSUH 3SDCB 5BRZE 5JUVA 3SCOA 5I77A 1SZNA 2RIKA 2XNAB 3SUUA 1OL0A 3PZVA 1ZANH 3NA9H 3G5ZB 1JZ3A 1F58L 2F61A 1YMMB 1QA9B 1J01A 4TNVF 4TTGA 1M6OA 3FQXB 1Z2KA 3ULUL 1ADQH 3EGSA 4HLZH 5CGYC 4N8VA 4KRPB 5EDXA 2W0FA 4MAVA 4QYOA 5BOZG 3PGDA 3I6GA 1HKKA 2IADA 2Y06H 4NO0A 3SKOB 4YHLL 1ZT1B 2F53D 3ARBD 4U6XB 5J9PB 4B3LA 4FQIH 3JV0A 3O3EB 1NBZB 3LQAC 1H15A 1DE4B 3ZSTA 3T2QA 2NY3B 5CD3A 3O2WL 2LVCA 5D71L 1FZJA 2EH8H 1RZ8A 1TMCB 4LCIL 1WDSA 1D5ZA 5E09A 4CCEA 4HJJL 3ES6B 3I84A 4HWUA 3UTSD 2JKXA 5DMIH 4EBQL 1R86A 5ID0A 2VDPH 4P2QE 3O3DA 1EEUA 4IS6B 3U7BA 4LHUG 3V4VH 1GRWA 1JE6A 1YNLH 3MRRB 5E4IA 4XP1L 4YGAB 3KZSA 2OYPA 5D1ZB 2ICEA 3THML 1JFQL 2IPKA 4FNTA 4GMSH 4U3AA 2O9PA 5GJSL 3GMRA 1NDGB 4WUKL 4J27A 3KYKL 3OAYH 1VBUA 1K8IA 1PKQB 1E6XM 3FMGH 1E73M 5BRZD 5CEXA 5J3HD 3QUYD 5LA1A 1BVZA 3HRZA 2GJ6B 4YHPA 4Z7UF 3BOVA 2F7OA 3FHQA 4TUJA 4N9GA 3RIFK 4NKQB 1NC2A 5DMYA 2R1YB 4A6YH 3VM5A 5EWIH 1XGYL 1ADQA 3VG0L 4L4VA 3OAUL 1P1ZA 5TDOA 4WI9A 1E6OH 5D8JH 4L4PA 4OM0L 5DURD 2BMKB 2VLLB 5DUPL 3CFKB 2R2EA 2XRAL 3ZKQD 1EDGA 4NQXA 4DGVH 4NXSA 1BGGA 3VINA 3ELAT 4H1LB 4TTDD 5IMMB 3V5DA 2YPVL 1JPGB 4MD0A 2R0ZL 3GBLA 3BEWA 4HXBL 3D2UB 5D1XD 2V7NA 3PWJA 4QHMA 3CPLA 4LAQL 5J13C 1HYRC 1SEQL 2EYSB 1QFWI 3SHSA 2J3SA 2E9IA 4PTTB 5BW7C 1XYFA 5HBFA 4I0PC 4RQQB 2QSQA 4G80B 1B1YA 3GIVA 3LIZL 4DQOH 5FGCE 3ZL4L 3MRQB 2VLME 4U1IA 2R2BB 3BO8A 3IDXL 3HMCA 4DCQB 2NLJB 3WUWB 4EKJA 4Y89A 4KKLC 4OUUB 4NQCD 4W68A 2EIDA 4PJ9A 5I5RA 3QA3B 1CXFA 1GOGA 1A02N 4GAGH 4AEHH 3MRLA 4H88H 1T21B 4X6BA 3ZHDA 4E41D 1TTUA 4FZEL 1MNUL 4A6YA 1E6RA 3VXRB 2YSSB 4X9IA 2NY5C 2O61B 4S1RL 2VXTL 4Y5YB 2O9OA 3KDMA 1NSNL 3HLAB 5DEFA 1S7WB 4JCLA 1TQUA 2BSTA 1CIDA 2W65B 4NN6C 4U4BA 1A6AA 5MEND 4PMXA 2WSPA 4JM2A 4JRYA 3W9DB 4Q6YA 5L2KB 1IV8A 1P4LB 3AROA 3KPQB 4K23L 1K8DB 3QRFM 1WCGA 1TTFA 1MVUA 3OHXB 4W93A 3E2HB 1I3GL 3BT2L 1Q72L 3RU8L 5HYJE 2FX8H 1BWWA 5JDSB 3P0VH 1CBVL 3SKJL 2QSTA 1UR0A 5T1LA 1B4RA 2HTLC 1QWUA 1K9EA 5CPTA 3HPJA 3CLFL 2H26A 1TMQA 1B31A 1ISZA 4XVUD 1GZPA 2A6JA 1EO5A 3BGFC 5CBEB 1KV3A 1XGQB 5J6HA 5IF0A 5IBLC 1OAQH 2DJUA 3KNBA 3MREB 1NMBL 2H9GB 3B2UC 2GK1B 5A2KH 1MRDL 1D5XA 4QOKD 5CAYB 4LIQL 1DZBA 4KRMB 1U30A 4ZE5A 1NC4A 1PQZB 2PO6A 3RUGA 4HWBH 4M1GL 4Z7QE 5JIWA 4NCC1 3QEQA 1L4IA 3SDXE 3KPRE 1G7QA 3JUZA 1UACH 3QDMD 5C7XH 3SKNA 4PJCA 1R3LA 1VJSA 3A4AA 3WS6A 1E0WA 1YNTB 1NH6A 1C5CH 3WFDH 4JFZL 2F18A 4ELKB 2K7PA 1L0QA 2J7HA 2JEQA 3MBXL 4KDTA 3ARWA 4NNXA 1F4XH 1Q9KA 1VEMA 3GMMA 1AQ0A 1K4CA 1FL3B 5SWSD 3GJFH 5JA9A 5CSGA 1RZJL 4JFFA 3LPPA 1MVFA 2E6JA 2DTSA 5EC2A 3CFCH 3RBSA 3WUEA 4AW7A 3HKFA 1LP9B 1TZ7A 2DOCA 3LXAA 1FIEA 1SFSA 1MPAH 3HMWH 1PZ2A 3VDBA 1HHHA 3W39A 4ZXBA 1CLYL 4PLJC 3M46A 1WAAF 4XI5C 1R3IL 5EPMB 4YXHL 3LH2L 3HZVB 2MTPA 3FQTB 4KK8C 1PBGA 4HWBA 3OZOA 1XGPA 2Z35B 1MCLA 4XAWH 4K71C 4JFSA 2FO4B 1IEAB 4UI2A 1XMWA 2VLKB 2ZXQA 4LCWA 1GOHA 1J87A 5B4MC 1D5IL 1R7AA 3U7WH 4K8RD 1TZHB 1X5XA 3PQYE 2A3HA 5I1HH 2JK5A 2K1MA 4HUWB 5CWSB 4G43A 5SV4A 3EMQA 4S1SH 2VE6B 4G3YH 1DDHB 4L8CA 3E3QC 4OTXH 5MEOA 2EIBA 3GKZA 1XD1A 2FX9L 1MQRA 3GJFA 5E9DD 1E0OB 4PRNA 1HHKB 1V02E 2QADC 2QQQA 4JVPA 4AIZB 1XH3B 4OFVA 4XC1L 4QCIA 3C5ZD 1P84K 1A1OA 2E9MA 1AMYA 2GW5A 4ZO7A 4HC1L 1TCMA 2PETA 3AICA 5DJDA 3WHXB 4AD1A 2APXA 1TFHA 3OKOB 1I1XA 2HFEB 5E0CA 1CFBA 4WI2A 4UTAH 2AQ1A 5GGRB 3AIEA 4X7FC 1BAFL 5TE4L 1JNHA 4AT6B 3O6FB 3FO1A 4P3CL 3RIAK 2DLIA 4JQIL 4S1DD 1CU4L 4WU5A 2HG5B 1KN2L 3S5LG 3HPLA 3WV0A 3OMZA 1R24A 5CIPB 5IHUL 1IM9A 5EIIA 3E0GA 2FJFB 3FOLA 3P9LA 2GK0B 4PJDB 1NFDB 3NCBB 1OTUC 4GAFB 1K9FA 3QIWB 3ZT7A 2HJLA 2VCCA 2SEBA 4PGZA 1N2RB 4N0CD 2CKRA 2CHOA 3PQYD 4LPTA 1BQCA 3B83A 4Y4HC 4F9LC 5A40E 2R0WL 2OP4L 3H9ZA 3DDGA 4LSQH 5FYLE 2W0LA 1MW2A 1RUMH 35C8H 2B2XH 2XZAL 3C08L 3AXLB 5J12C 4JFPA 2HN7A 5FECA 2XFRA 1T89A 3G5YB 1G7PA 2NX5A 4H0HB 4H20H 3D3VB 1U9KA 4YO0A 2OYKA 4QO1A 3MLWH 5EIVA 4XCCL 4BUGA 3PZGA 4UIKL 2VKXA 2R39A 5E8DH 2LTQC 3DROB 1R3HA 4EJ1C 3CIVA 2VLJE 1HHJA 5D7LA 2G4FA 5HHXH 2FECL 3S37H 4YNYA 2L7JA 2ESVB 4KJWC 5DJ0B 3LQAL 3V6FA 3L4ZA 3VXMA 5C07B 2R69L 1AHWB 5CJXA 4D6FA 2H41A 3FT3B 3C87A 3DHMA 2NSXA 4WWKD 3GM0A 5DDHB 5L7XL 2AAAA 1RUQH 1OWQA 4AYGA 4DTGH 1MFDL 2CLVA 2R2CA 1GW1A 1IL1B 3MRMB 1CENA 4QXTA 5D7JB 2F74B 2XWBA 3DSFL 3HC3L 5T1KB 4YFLI 1MLCB 4FFVC 1CGUA 3DMMD 4W5ZA 1TG7A 1MFAH 2N7BA 2BXYA 2WHLA 3RWEA 5BXTA 2CKNA 3X14A 1CE6A 3TT1L 1T7ZA 3VFVB 1JNLH 3PDOB 1KIRA 1E6NA 3WFHB 3WSQH 4ZS6D 5JIPA 4OZFG 4UT9L 4L8DB 4A2MA 4P7NA 4BK4A 5HOSA 1MCSA 3L5JA 3ZMRA 5DMJB 4YBLC 2WHJA 4NQED 4N1EA 1DQQA 3LEXB 4ZTOH 1FL5A 2FJGB 1PZ5A 4X6CA 4G6JL 1S7SB 5ADOL 2EDXA 3E8UL 4XTRC 4YAQB 2W0PA 4HWZB 1WITA 4LARL 1UVQB 2GSIB 5LVEA 4L3EB 4U05A 4JFQB 3FCTB 3MRGA 4QHKJ 2W66A 5BS0D 4PJAE 4XZWA 2DI9A 5C8BB 1AXSA 5GGRY 4D6DA 2VT0A 1IGML 2R1XB 3PWLB 1A3RH 1FA2A 5SWZA 1G01A 1YEGH 2DQJL 3PL6D 1FVCB 1LF1A 3QXTA 3WBAA 5TQ0L 1BD2E 1FN4A 4K3HA 1YECL 3LKSB 3D5OF 4URIA 1WZ1L 1TZIB 4PY8I 5FYJH 3DI2B 5IHLB 5I2IA 43C9B 1W0VA 4GRLD 1QHPA 3RM8A 1BJMA 4HXAH 4H41A 5IEKB 4F9PA 2NW3B 4K7PH 1YEEL 4R7DA 1CLZH 1U41A 1XGUB 2NY6B 1B3JA 1J0KA 2QSCH 4LKCB 5C0DA 3V6OA 4D9RE 3PWPD 4YDIH 1I8IA 3HMXH 4OGYL 1XSIA 2W5FA 2BERA 1T03H 3LSOB 3HZ3A 1QSEA 1BZQK 1V8HA 3L95B 4MCZA 3UC0L 3N50A 1NAKL 2KQNA 3ZE2E 3RA7H 4PJGE 3ME0A 5ESVA 4HU0A 4FQQA 3LKPA 1TE1A 4DZBB 4MA8H 4FTVD 4RMTA 5B22A 4H8HA 5I1JL 1B6UA 3QEGL 3Q6GH 5FDWB 3RDTB 1S78C 2BNRE 3GXTA 4KDVA 5DO2D 1IC1A 3WXWL 5F1SA 4ONGH 3RNKA 4UDUB 3VA6A 1KJ2L 5D1QA 2G75A 3TN0C 2X0HA 1QVBA 3DX6A 1HH9A 2Q6WB 2WMJA 3TCLA 2QBWA 2B1AL 3UBXI 5GGVY 1D9KD 4NQDE 5FA3B 5AD0B 1IT9H 1VERA 4M6NH 4Z76B 1Q6DA 5EBWB 3MUGA 3CMOH 5D8WA 1JPFB 4WO4C 3ARFD 3QI9A 2LU3A 3BXNB 3I50L 4Y2DC 4TPRH 2ID5A 1BIIB 4M6MH 2VQUA 3L3JA 5T33H 3TVMD 4FFZL 1QFWM 1PKOA 3IDIB 5E2TH 5D7IE 1W91A 2W60B 1TNNA 3H9SA 2D31A 3CNKA 2PR4L 4ODUA 2CNCA 4G5ZH 4HK3N 1G9EA 3ULUF 4LHUA 4P5MB 2UWEF 5DEGA 5L9DL 1MCRA 1I3RB 1BZ9B 1ZHKA 3GBEA 3FY1A 1FO0H 4LYQA 5EU4B 1JL8A 3SGJA 3H42L 4O51A 3HRPA 4XGZA 3S7GA 3P0YL 1U92A 1FGNH 1QNSA 2QHRH 1XZ0B 1S9VB 1SMOA 2F58H 2OJZH 5E6IC 2AXGB 2C9AA 5FYKH 3R8BB 4WI4A 4PJXE 3WO4B 4JM4L 4EI5B 1WVZA 3D85B 2ZPKL 3O4LA 3OR6A 3ARGD 1TVDA 4JKMA 4Q2ZB 4ERSH 1XF2B 2AJXL 1R47A 1BJ8A 4QRPA 2H3NA 4PG9A 1XAUA 3H3PL 4PR5B 5E1HB 4PSRA 5IVNA 2NYYC 4B0MM 1YYML 1EAPA 3WMCA 3CO4A 1CXEA 4JPWL 3RWFB 4B15A 3KYNB 3ZKMD 4HG4K 2MHAB 4TOYH 5C0FA 1UG6A 4ZFFA 1NQBA 4C54A 4GS7C 2J7BA 4G8GD 5IXEA 3RNQB 2ILLA 3QQ3B 5T3XE 1S7XA 2PXYC 4BZYA 2AK1H 3QZWB 1UM4L 2PC8A 3W28A 3TZVA 1AQDA 1FO0A 3QPXL 4YDLB 5EOQH 2J47A 4GUPA 5KSVB 3U0WH 3AQUA 1HH6B 1U8MA 4KKBC 4ZAKD 3CU1A 2V2XB 4Z7VE 3OGCB 4P4KD 3HE6A 4JKWA 3ZJ6A 4NO2B 2CH8A 2A77H 4IHOA 3WQ6A 4Z2LA 2XG9A 3C5JB 1R5IA 5DSCB 1FZMA 1RQ5A 3HHRB 1PX3A 4E42A 1E1FA 4BQ3A 2HVJA 2EYRA 1B0WA 5H37G 4OZIB 3EMZA 5SWQB 1OGTB 4JGJA 3U0TB 3LRMA 1A7RH 3KPTA 3TO4A 2Z31C 2FATL 3H7LA 3IF1A 3OKKA 5D70L 4QXUL 3PHAA 1EERB 1FORH 1BZ7A 1T04B 4H25A 4L29B 3RL1A 2YMXH 4RAVB 4QRRA 5D2NB 4E0RB 5ICZA 4K9EL 1CGXA 1Q0XL 4PTUB 1GIGL 2OW7A 1IAOA 1CGSH 5C09E 3KLAB 1CK0H 2V5CA 2P5EE 3JV6B 1HHGA 5CPSA 1TIUA 3QGVA 2IQAA 3B3IB 1O7DC 4AEIL 5DRXB 2P46B 1VACB 1UM5L 2E27H 1U3YA 3RMEA 2XQYK 4KKCC 3NCJL 1A6VH 4UDTA 4XNQB 3DLQR 1A6WH 4FQLL 5IBUG 1E5NA 1X4ZA 4D9LL 1KENL 2Y5EA 4HS3B 1UWUA 3ARBA 1S46A 4XMPH 2NY7L 2VABB 1LWHA 2QLVB 2XWJB 1GVYA 4AMWA 1BBJB 2FE0A 2OTPA 3WH6A 4MA7H 1YN7B 1TPXC 3WH5A 4Y4FB 2OR7A 4ZFZB 1NWSA 4Y0GA 4CCCA 4OD1L 2GFBB 4YR6A 2CLRB 1P9MA 3QCUL 2Q86B 2BVOA 3UTSA 3BX7C 1Q9WB 3F7VA 4GXVL 3BVNB 3FTGB 4QF1A 3GHEH 2DQFA 4BELD 3B8SA 4RZCB 1J1OL 4UT7L 4ZSOB 2R0KH 4DO4A 1I85C 1MRCL 4AL8H 4O2CA 4UNUA 5HYQA 1ZHLA 4GKZB 5D5MB 2ZJSH 1MCFA 3NFPB 5BRZA 1KXTB 1F3JA 2DLHA 3QUYA 5C09D 4CMHB 5GGTL 4GBXB 2AABH 4D8PA 4W70A 1WTLA 5KANG 2P5ED 5ECUA 5IW1A 4CMMB 5I16A 2ZUUA 4NYLA 3G6DH 4N8CL 1ACYL 3HZYA 4Y5XB 2B1HL 4JHOA 1OQOA 5J1AB 4FFYL 4LPCA 2I25N 3ZZ1A 1YPZB 4PD4K 4YWGH 4XZUB 3NN8A 1OLLA 5D1XA 4UQCA 3ROLA 2PYED 2VQ1B 1XGRA 4GW5B 1QSFE 3C6LC 1HQRB 3RWGA 3AY4C 4I9WD 4LPVA 5F9OH 1OM3H 3WFZA 4PRIB 5I8OL 5JNYA 5I8EB 3EYUH 4H5SA 4MXQC 3D0LA 3JSSA 4L1DA 3CGTA 2JIEA 4JEGB 2JFEX 3EJYD 2NY1C 3BUIA 5DFWH 1C08B 3UPRB 2XPGA 3F7RA 4NQCA 1KULA 1J8HD 1BF2A 4J23A 3A0OA 4D9QE 1OAXH 3S96B 3F7YB 2ZX9A 3MCKB 1LDPL 1QRNE 4E41A 4JY6B 1C7TA 3PABB 2F54D 3TO2A 2WBJD 1IGJA 3W2DH 1DWHM 1NWTA 4ODVH 2C0HA 1BAGA 4KHXL 5IMKB 1CIUA 2BVPA 3BKJL 2UY5A 2OWCA 3V0WL 4Z2GA 1VFUA 4RAHA 2J4WH 4BCEA 5IB5B 1G7IB 3VXOB 3CZFB 5GGQL 3UAJD 5MENA 2MJWA 4I4WB 1GAFH 2A74B 3VFWA 2XTJD 1A7OH 1WPCA 5DRZA 2AJUH 3VIOA 3BUBA 4KJQD 1ZSDA 4LLYB 5C1MB 25C8L 1H11A 5HYEA 1ISVA 5BV7C 4OZGB 1SJVA 3A6CL 3V4PL 3T1WA 1TZGL 4I5BA 4P9ML 4MYWB 4Q97A 4MD5A 4MAZA 4K94H 4QLRA 3SJVB 5HGAA 4Z0XA 4ZD3L 3ULVF 5IFJB 1T20B 3WF3A 1VGEH 1GVIA 2YKLH 4PJBF 5MERB 5FUOH 3NDZA 1QSVA 4LKXB 4OKVB 5IVOA 4APQC 4LVOC 4NI3A 1XT5A 5F9DC 4PJHA 1H5BA 4LOUD 2VZTA 5JXAH 4M29A 2ADFH 3GMPB 3MV7D 5TGBB 4V1DB 3BC9A 3K4DA 4HOWA 3KPPA 1HKIA 4F7TA 4QLLA 3CH1A 5FUCE 3PUCA 4QOKA 5TPWH 3QFJB 4Z2HA 2V9RA 4PJ7F 4R97B 3MYZA 2BSSB 1AD9A 3ZIZA 1RURL 3GH4A 4BH7A 1MHPL 4TUOB 1PS3A 3ROOB 5HGBB 1EUUA 3LD8B 3WD0A 2K7QA 3GSWA 1X5GA 2M2DA 3UJTL 3O9WD 2CO6B 1QFWH 3QDMA 5A2CA 2DLFH 3QDAA 1HTYA 4MJ4A 3A6BH 4NGHL 2CUHA 1C5DA 3QXWA 4K8RH 5EBLA 5AWNH 4FG6C 3QXDA 2NXYC 2PWEA 4DN4L 4Z7NF 3EJZD 3OQ3B 2ZWLT 2B0SH 4EXPX 1OLZA 3BPNB 1U8NB 2VL5A 2BJMH 3QEUA 4QRSA 1ZK9A 1X1NA 2R4SH 2YPLD 3BD3A 1SBBA 3AHVA 3ZJKA 4HFWA 5SWSA 2EXYD 5E2WL 1V0NA 3BGAA 4XHJC 5HVFB 2C3WA 5CLWA 4HGMA 1QO3A 2EPLX 5AY7A 3ARVA 2EH7H 1EIBA 4ISVA 2CUMA 4KROB 1AD0B 4CNIA 1YEJL 2VDLL 3ARED 3OL2A 1CF8L 3I6KA 5GJTH 4JFHE 3BDBA 1ZVHA 4PJIB 2LVEA 2HFFB 2Z93B 2CKBB 2PN5A 5FCUL 3TBVB 1CDBA 3W4RA 5IM7B 2EXWC 1CDGA 4B3KA 4GQPH 1JF6A 3AAZB 3KYAA 4MSWB 3MLXL 4GXUM 1UASA 5DMGC 4HIJA 1N64H 5F1NB 2MOVA 1NP2A 3SE8H 4Y4KB 5GRJL 1CQKA 2X9XA 3WJLC 2H2PD 4XMLL 1E9LA 5DT7A 1ORQB 4UNIA 2H2SC 4JKPL 5D93B 3T2OA 1NUFA 4XB3A 4HH9B 4BQ9A 4WUUB 5BO1H 1ONQA 3QG7L 2HTKC 1CGTA 3BGMA 2C1OA 4NDMB 4HBQA 1OARL 1GOFA 2FDBP 4I3GA 4J4PD 5E9DA 2WZHA 3G08A 4CVXB 1EZVY 2C8NA 3VM7A 4DUWA 4FQXC 4F80A 2JF6A 1RUPH 1MJ7H 3C5ZA 2DWEA 4C56E 3SN6N 4NZTL 3N18A 5HI4C 4JFDE 1U42A 3OLDA 4DAGL 5ANMB 1B2WL 5C0EB 3IFLL 1YNKL 1DWFM 1INDL 4IOIB 4JFHD 1XGTB 4X4MA 1I1YB 4OD3L 3ZTNH 3IDJA 3P9MA 3WNKA 4PTWA 2XN1A 3N9GL 4OD2B 1SJXA 2R23A 5HGHA 3ULUD 3MOQA 5LA2A 1FYTE 1SBSL 4ZUSB 1A6ZB 4LVNC 4QXGL 2DLTA 4YUEL 3DUUB 3G5VA 4U6VH 5DK0A 2DM3A 3GKWL 3JWOL 3UTTD 3FZUC 3AOFA 3OZ9L 4Q6IB 4O2EA 4RGMB 3PQYA 5E8PB 4QTHA 1NGWB 2IFFH 4X7TB 3NAAL 2YD6A 2CDGA 4PS4L 4PJ9C 4F3FA 4I3SH 4NKMB 1IAIL 3H6JA 3IXTA 1AR1C 3RVVC 2XA3A 3M1BA 1BYDA 5CZXC 3EOBA 1N3NA 3SPVA 5HVGB 5GS1B 2YUWA 5C08E 3REWB 4MVBD 1RIVL 5EU6B 3EAKA 2Z91B 4MNMA 1W72L 1UWRA 2JE8A 3HUJE 4K7FA 3SDAB 1BIHA 4JLRA 3WFBH 3IFNH 5DUMH 5F9JA 3VSTA 3U36A 2CK2A 3JXAA 5DT1H 5DRNA 4JM2C 3WBDA 4XNUL 1NLBL 4ZS7L 2J8UE 1JZ7A 2DN7A 5HJ3B 5JHLL 1Z3GL 2VRKA 4MS8C 3MJ9L 4WU7B 1WV7T 4M48H 3B5TA 3F65A 1EXUA 1LD9B 4WWKA 5D9PA 5DF0A 1B3VA 2JB5L 3LV3A 4B16A 1SEBA 1WLHA 1W0WB 3ULSA 3FQRA 4YZFE 1CICD 1YN6A 3P2TA 1NCAH 4XC3H 1C8QA 2P7TB 1PX8A 2D0FA 2Z8SA 4U31A 4G42A 4M5YH 3VIKA 3TYGL 3DMMA 4FLOA 1ISYA 1T22B 3MZTA 2G41A 4ODWA 4U6TA 3DTXA 3BKML 4CDGC 3GMNB 2ZSVB 5I1AA 1I3UA 3CC5A 1AGCA 3F8UB 1JF1A 3QG6B 1NCDH 3GJEB 3W9EB 3BIKB 4AMKH 3CAFA 3IDYB 2PW1B 3T0ED 1TVNA 4YHZH 1E4WH 3QNZB 5A94A 3L4VA 2PO6C 3F6IA 1T66C 4R4BB 3I3DA 3AXXA 3GXIA 1I4FA 2JCCB 5T1DH 5E2JA 3P4OB 4NQEA 4OIIH 1OP5K 3V0VB 3AU1A 4CVUA 5HHQA 3IAPA 2DPEA 2VRAA 4OFPA 2YOCA 1F3DJ 1AXTH 4JRXE 3FO0L 2VLJA 3M8OL 1V3LA 5KSUA 1FV1B 4JB9L 2MPAL 3T3PF 5I1EL 3EO0B 3WS6C 4LIQE 5AZEL 3L2MA 1HQ4A 5BZWA 3GBML 1NBVH 2IAND 2FLBT 3MO1B 3EJQA 4CU8A 2EAEA 1NGPL 1HSAB 2AGJH 4KDTC 5H37H 5ECJE 2OSYA 4FLQA 3POHA 3SCMD 3VIHA 5BS0A 2CIKA 1U3ZA 5CGTA 4YIQA 1F45A 2X10A 2ZUVA 2OR9L 2GJXB 1MWAB 1J0IA 4U7SA 3H9HB 1GQLA 3JUGA 4WFED 4WEMB 5C0JA 5DO8A 3QYCA 5FKPA 3GMOA 5F7EH 3VXSD 1F4HA 3PL6A 4FQJL 1PFCA 1JPTL 1XR8A 3QDGD 4UTFA 2NTSP 5C0ND 4G6ML 5H2BB 2R1WA 3P11L 3CH9A 3CSYB 5C3LD 2EYTB 4KC3B 4OBRA 5BXFA 3BWAA 4PFEA 4ZXBC 4MDOA 3J7HA 4XVJL 4GRLA 2C3XA 3IFPA 4Q9QH 2WNWA 5C6TH 5HPMA 3VD3A 1UZ1A 2PCPA 4NXKA 3O41B 3AM8C 2C3GA 5EUKA 4GMTH 4MMZC 2GTZA 4X9BA 4GG6B 1OGAB 4YHYC 4DJMA 1XF5B 4ODXA 1J05A 3PWPA 4GG6F 1M03A 1FGVH 4TSBH 1R3KA 1PLGL 4Z7UA 3MMDA 4CADA 1GCFA 4K3EH 5CKAA 2YRLA 1A1MB 2PKDA 5C9KA 4KK6C 1C1EL 3OXSA 1JGVH 2A0LC 3CFEA 4RGOH 2FECI 3WL9A 2DIAA 4UU9A 2EJ1A 3DV6A 4MNGE 1LEIA 4FTVA 1Q9LA 2Z8WC 3MV9E 1JXJA 4N0UA 5LXGL 4ZOBA 4TSAH 1AIFB 4PJ8D 3KL3A 5D9OA 3EMCA 4FHBD 4Z6AT 4KKAC 2VOTA 2Z4QA 1REIA 2KZWA 4XNZB 2EICA 4UIMB 1BFOB 1H0IA 2CIPA 3TOPA 2Y9RT 3ZKXC 3SQBA 1MLBA 4X98B 3KLHC 1MCDA 4PPTA 4G6KL 5E1AB 2E8YA 3APGA 3HN3A 4ONFL 1D9KA 2XQYG 2Q76A 3UO1H 1KXQA 4I2XE 5F7NC 1U8LA 2C7FA 2YL9A 1DWGM 4QDMA 3CZEA 4PMYA 3L9RB 3ARFA 3RJDA 2UYLA 5K9KA 2XZQL 4QHLA 3QHFL 3GSOB 4P23B 1OOAA 4R4ND 3TVMA 2PBOA 1WO2A 3HG2A 4OLVH 5IGXL 3KXFD 3OG6B 3UERA 3K3QA 3MLRL 2QHAA 4L8SA 4HT1H 1AGFA 4YE4L 4G8EA 1HKMA 1ZVSB 1T89C 4L8BB 2G3NA 5F7MC 4JJ5A 5ABFB 2VZOA 3BYYA 3LX9A 1MWOA 1FDLH 4IIQB 4L9LC 4MD4B 2J5LC 2PYFB 4OUOA 1RK0A 5JHDD 5JW3L 1FE8L 3CFDA 4PJEE 2F8VA 3KGRA 4OGZA 4UFMA 2HLFD 1BJ1J 4HUVA 5GRUL 3DX7B 3GIZL 5CJXC 1XCTB 3ARGA 5F9WC 5KSBB 1N7ML 4R2GD 1KNOB 4X6DB 3W38A 2DQXA 4MXWH 4KHTH 2D7QA 1GZQB 4Y88A 4KQ3L 4Z7WF 4XNYL 4BFIA 4GFTB 2O5XL 4OJFH 5LGKA 1T7WA 1OTSD 3EYOB 5IEHA 3CUPB 4WY7H 4EDXB 3QXAB 2NZ9D 3ZKNC 4DWSD 5H8DA 3CFJB 4XBPB 2ADIB 3QNYA 1IE5A 2XY1A 2FLRT 4G8GA 2OJEA 5MI0B 1CVSC 3RI5K 3VO0A 4P5TC 2NY4C 2JJWA 1N0XH 1UWXK 1VGKA 5E2UL 5HHMD 1GYAA 3VSUA 4Q58C 1J1PH 1UM6H 1T1XA 4L4TB 1IKFL 5JBFA 3DURA 4ZAKA 5GGUA 2YD1A 2X40A 4P4KA 3QIUD 2AXFA 2BHUA 5C0CB 5CP7A 3LRLA 1JV5A 4Y5VB 2WIIA 5IP4A 1NCCL 4JO2L 3QJFA 3VDCA 3V5KA 2X4NA 5GRYA 3REVB 3WH8A 4JDVA 3CV5A 4AH2B 2HMIC 3BAEL 5JOFB 4MDJA 1Q6CA 5IMLB 1B3YA 2ATPB 4Q0XL 1KBBA 2BS9A 4GJTB 4OFIA 3FFCB 4HPOL 4NC1E 1N6VA 2P42B 2ENYA 2OL3L 1N59A 3IK2A 4RL3A 4DWHA 2YS4A 4DEPB 1V7MH 1EOMA 4F33B 1ZA3A 4NPYB 5E99H 5B8CA 8FABB 2RCSL 1NWRA 2GK2A 4S11A 1TQBC 4ONHA 3Q5YA 3G6JB 4X5LA 1OT2A 2YD4A 1H8OA 1RULH 3UETA 4U33A 4Z18A 2QJDA 4HKXB 3O0RL 1DUZA 3CVHH 4F15B 5ADPL 2NW2B 1I1RA 3OJDA 2VAJA 2G8ZA 2P4AB 1BVKB 4LLUB 2E7LC 3EO9L 4OM1H 4POUB 4OQ1A 1C5BL 1OGBA 1TJHH 5DQJA 1EHNA 4PV9A 4AENB 5BOPA 3AXIA 3GSUA 2IH3A 4UQ2A 4Z7VA 3UBXA 1QFOA 4EDWH 3KPOA 3OPZL 5FCSH 4ZNEA 3PHOA 4MJ2A 1ZLSL 3MACL 3WS3B 1UH3A 3V6OC 4JHBA 4YEFA 1JD9A 1YDPA 2C5DC 4QRUA 4PGCB 3S5ZA 5D96C 5E95B 5T3ZL 4OZ4B 2OZ4L 1EMTL 4JZOA 1A9BA 2J2ZA 4MNQE 3RVWD 3ET9F 1GQJA 4LGSB 3QXUA 2BY0A 5C0BE 1DLFH 2AERT 2DYPB 5IJKA 1EEZA 2ZOKB 1HT6A 2A9NL 1JXKA 4U1HA 2LE9A 3BKYL 4P5KA 3L3KA 4M7ZB 3TJHC 3PGCA 1DBBL 1VFOA 4J3UA 1KLUB 5L8JB 3S6TA 5C09A 4LRIA 2EKSA 1LE9B 5K93A 6CGTA 4PMOA 1T80A 4FXKB 1AGEA 2P5EA 3IKCB 1J5OL 1IC5H 3D51A 3BZFB 1FP5A 1GGTA 2NY2C 3CVHA 4OLXL 3ALFA 1TQCC 4EN3C 1FVDA 5H94B 3T77B 4NT6A 1RVFL 2VDOH 4HF5H 3U1SH 4PRHD 1BG4A 4PRDB 4ZXLA 4F2MB 3IGAB 3MBEB 2XSBA 5DFVD 2WM0A 3VFTB 1U8OB 4FNLL 5IVZA 4KKLD 2PYEA 3U9PL 1G6VK 3P77A 4MJIE 4CD5A 5FGBA 1HVXA 2D3LA 2Q3AA 3RFZC 1UKTA 3DSNA 4XZBA 1KT2A 1FCCA 5D2LE 5CKGA 3VE0A 1CN4A 2F5AL 4MAUH 3WH7A 1LO2L 1GONA 3VXTB 4MNQD 4PJ5E 4XCYB 5L6YH 4WIQA 4ZODA 5T1MA 4YQXL 3QXVA 3A24A 4XCNB 3N85L 2DT1A 2I9TA 1CD1A 5D7SL 2EO9A 4LVHC 4F66A 4RWYL 5T5NG 1WBXA 1J8HA 1MFCH 1FNGA 4CU7A 3CDFA 3DX8A 5FA4B 1S3KH 2Y23A 1LO3H 4P9HH 4LGXA 4X4YB 3MRPB 4DVBA 2F54A 2WBJA 3QIBC 3KJ4C 5IROA 4KFZC 4E8DA 4PGDB 1BYBA 1CGWA 1MXGA 2A6KA 3MJGX 1JVKA 4M7JL 5BQ7A 3BP7A 5FGCB 2PWHA 4JN1H 2FR4B 2D0GA 1NEZG 1QBML 4KI5E 3BVWA 3OLEA 1ZEAL 2L4OA 4KMTL 1AJ7H 5DTFB 1DWIM 1KCKA 3ZDXF 1KFAL 3CZGA 5IBLD 2YC1B 2G60H 1QI0A 2RFXA 4YEEA 2V5SA 1MJJB 4G9DA 5K9OA 1SYVA 1DLHA 3LS5H 1J8KA 1V3JA 1ZGLA 4AZGA 2A6DA 4UQAA 4X7SL 2CKBL 5BZDB 4NO5A 4GSDL 4JPVL 2VISA 4U1KB 3TBWA 3FFDB 1YMME 3BPOC 3FB5A 1KTCA 4PJ5D 2O5YH 3NBNA 3TZVC 5IOPA 4DZ8A 1IGFL 2FHFA 1U91A 5ACZA 3QR2A 2J6EL 4JG0L 4LSTH 5EN2A 3MV7A 3MROB 1U58A 5EOTB 3TV3L 2AAVA 3WFCH 2Y5TA 3MRNB 3WHE0 4WIWA 2D4DA 3OTTA 5MP6L 2X0YA 4ESKA 5CXPA 3MI6A 3A47A 3NABH 1P53A 3HI5H 4NBYB 2KUTA 1RFDH 5J11C 5JMOC 4XP5H 1JK8A 2OK0L 2VERN 1QR1B 2VAAB 4N8PA 1A0QH 3WNPA 2FJHA 2AKRA 3TO4C 3O9WA 2BFVL 3JWDL 3KLLA 2EDKA 2DJSA 1XIWB 1NWUA 1IKNA 2I07B 3VNZA 4B9YA 4ORGA 4TOQA 4OF8A 2CDEA 4BJLA 3ALGA 1W8NA 5MHSD 4OFYA 3RY4A 3TA3B 5HYIA 1DSFL 4ZTPL 5IVXF 5TDNB 4Y16D 3WIIL 1I7ZB 1PKQE 5JPNB 3B9KC 4PLJD 1SHMA 4MAYD 3SDCD 2VITB 3IFOA 1J88A 2YPLA 2GJ6E 5ESAA 2G5BA 4B7LA 5CFHA 4JL2A 3MGOA 3BVUA 2ADJB 4XMKL 3WENA 1U8QA 2Q1EA 2W4XA 3VXQA 1ZBVA 3KPRB 4D0CA 3DX0A 1WWAX 4LCUA 3WIFA 1JUFA 5HHOB 5B4MD 2ARWA 3BKCH 4NUGL 2ITDA 3NFSH 2JJTA 1JI2A 3UTQB 2Y4SA 3ARBC 3AREA 3HG1B 3BPLC 3QHZH 2D03L 1BTCA 1IEBA 1VJZA 4K3JL 1T4KB 4FFWC 1BGXL 1MH5B 4DKFH 3WCYA 1UEYA 4LAJH 1ZHBB 4HS6B 5JQ6L 2YEZB 4XHQA 3UR8A 4YDJA 3GSRB 5IW6B 1G1YA 2NY3D 3H53A 4RMVA 1P9MC 1T0MA 1F58H 3UTOA 3ULUH 1MHCA 2QADD 2D23A 4YPGA 2XWTA 3K8MA 5INCA 2WVSA 3FAWA 3OKLB 3OBAA 5HGDA 3B9VA 1ZT7A 2P24A 4D6EA 4YHLH 4W89A 1QG3A 3OKEB 3AISA 1WFTA 5D1ZD 5JO5A 4ZXOA 1UJ3A 1X5AA 3U4AA 5D71H 4MDPA 4Z0BL 1I7TB 2E40A 1U2YA 1G6RB 2O5ZL 5J3HC 5FOOA 1KN4L 1INQB 4LCIH 5FD0A 2CQVA 3QJHB 3O6KL 2QTEA 4I0KA 4J4PA 4HJJH 1KIPA 3UZVB 4ORZC 4EBQH 3WLBA 3LN9A 3VXRE 4KMQA 3RWIA 1CLOL 3O81A 4R0LA 4WK9A 3HS0B 3UJJL 1OTUD 3EJJX 3IDGA 2AEPL 4XP1H 5GZOD 4M9PA 2GJPA 3ARUA 1R0AL 3THMH 1JFQH 3L3DA 3BDYH 3O3AB 4WUKH 1AE6L 3DI3B 3KYKH 2GSJA 3TBTB 2DI8A 4Y4HD 1RZKL 1R87A 1QFPA 5D1XC 4ELMF 2VIRA 3D0VB 3RWDB 5KN5A 4Y19D 5L2KE 1ITBB 2X1PA 2JB6B 2BSRB 1XGYH 3QUKB 3VG0H 1GXEA 3OAUH 1O6IA 1JHTB 2A3CA 5I1LA 4HJGA 3IAGC 4FQHA 3MOAL 4RFNB 1F6FB 1KLFA 4OM0H 1MCNA 1KEML 5DUPH 2APFA 2XRAH 4U1NB 3VFOA 1KC5L 3SBWA 2WINB 3CFBB 5DUBA 1XCQA 4URTB 2YPVH 1OD9A 4I0CC 4OI9A 1QEWB 2R0ZH 3FO9B 4HXBH 2XFYA 1U33A 1UJTA 4KJWD 1RMFL 4WTZA 1SEQH 5D7KE 1GJUA 4DW2L 5GSVB 5DK3A 3X13B 2Q8BL 4BFGA 2PTTB 4JZJB 1ZT4A 2JJVA 3LIZH 3VXRD 1MFVA 3BW9A 2BOBB 2J7GA 1JHKL 3K7UA 3ZL4H 3ZDZE 1A7BA 4U2YA 1A3LL 1BM3L 2W59A 3ECBB 4AZHA 3MCLH 2A2QT 3IDMA 3IDXH 3MRFB 2YLLA 4FFVD 3D50A 5DD3L 1MWAL 1R5WA 2IBZX 2EEDA 4JREB 5DRWA 3LXCA 2ESCA 4M93B 3L4XA 1ITXA 5C2BL 2DQTL 4FZEH 2J75A 5L2KD 4R8WL 2AV7B 3C8KB 5FEBA 4S1RH 5C2UB 3BVTA 2VXTH 2IBBA 4HV8B 1KOAA 2I9LA 1CICA 2JLLA 4RMQA 2FBJL 4M7LL 1NSNH 1EDQA 4HEME 4QRQB 4XVUC 2IAMB 4MDIA 2C7UA 3TIEA 2XFXA 1H5BC 1T6VN 4PBXA 5C8JA 4JFED 1A1NB 2FYYB 3B5GA 1NBQA 3CXDL 4XBEL 1LP9E 4XTRD 2VWEE 4OCLC 3RWCA 5A16A 3QSKB 4K23H 5F3HA 2IGFL 4P0DA 1MW0A 2LU7A 3IRPX 3UJIL 2ZG3A 4HEPG 3EDFA 4JY4A 4PP2B 3T0EA 5IMOA 1I3GH 3BT2H 3K1KC 3NGBC 3UG5A 3RU8H 3L4WA 1V6VA 1CBVH 5F7DB 3MMUA 2CRIA 2YDQA 4U1GB 4FNPA 3CLFH 5I73B 4H26A 5K9QI 5A8OA 1H8NA 4ZPTA 1H0GA 5EZJA 1JMZA 1I8KB 4FZ8H 4JPIA 3V6ZA 1V3MA 5EMYA 5DVOA 1NMBH 1AGBB 2X42A 1LMKA 2ALWA 2VDML 1AO7D 1MRDH 3ZE0F 4LIQH 2IANA 4WTWA 1GOWA 2HRPL 1P4IL 3SCMA 3V95A 3O45A 1W0YT 4M1GH 4N8VB 2ZOLA 4JE4B 1WE5A 1P2CA 3PGDB 3I6GB 3VXSA 2IADB 3VX1A 1U95B 2AJ3B 4RFOL 3QDGA 2ATKA 2D7TL 4DGYL 2X5PA 5KVGL 1TCRA 3BP5A 1H15B 3FONA 4JFZH 3L4UA 5CD3B 5DYOB 5EC1B 4H1LG 3TTSA 1RZ8B 1NGXA 3MBXH 3GI9L 3FQUA 4XXCA 1E56A 1D5ZB 3IU4L 1WFOA 4JFTA 5A2IH 1JZ8A 4NN7B 5AUMA 4PJAB 5ID0B 4PMRA 3UYRL 3KR3L 3O3DB 1IAII 2F7RA 1RZJH 2EDOA 3MNZB 3G6LA 4PJDE 1NFDE 5HGGS 1FZOB 2ICEB 4YBQD 4PRWA 1KEGL 1X5HA 2VLKD 4LFHG 1S78D 4K8RC 5TE7L 2WKLA 4M80A 2FBOJ 4JAMA 1MCCA 3WUWG 3SY0B 3QUZB 5CEXB 1CLYH 3DPBA 3HRZB 4IRJB 4YHPB 1Z9SA 1QWNA 1R3IH 3GDBA 4YXHH 1W8OA 4TUJB 3N17A 3LH2H 1BFSA 3AIVA 1NC2B 5IG7B 1P1ZB 4HA1A 1ZB5A 5BRPA 1UYWH 3WN5A 1DFBL 3LRSB 3D3VE 4JN2A 4HW6A 3P73B 3AFLA 4QRTA 3RDKA 3C5ZC 1D5IH 4N68A 1EEYA 4PJ8A 4WO4D 5KS9A 3NFNA 4NWUL 2Q87A 5IWLC 4TULL 4Y2DD 2ERJC 5A6AA 4MD0B 4W4OA 3BEWB 2V7NB 4X80L 4QHMB 3SOBL 2E9JA 1H3GA 4J1UB 2ESVE 3MSDA 2D4FA 2X4TA 4UB0L 1NMAL 3DX4A 3GNOA 5HDRA 2FX9H 3NUKA 4YHIB 4PJGB 3GIVB 3VXPB 4XC1H 4PGEB 1E6SM 3KS0H 3MU7A 4UT6L 4HC1H 3N0PB 3VGAC 3VD7A 5GIRA 3QIWD 2BNRB 3UXFA 3ZE1F 1E15A 3AMKA 5HTSA 3PWUA 1BAFH 5DA4A 3G5XB 1LDSA 1CGYA 3HG3A 1I3VA 4P3CH 2FO1A 4JQIH 3BMWA 4AZBA 1NCNA 1JD7A 1KN2H 5HPOA 1NCWL 2X70A 3DNKA 5IHUH 1WDPA 2NXZB 3LKQB 4NQDB 2BNQD 4XBGA 4JGMA 2YD5A 3EFDL 4ZQKA 4BSWB 5DEFB 1GHFH 3MV9A 3RGVB 2NYYD 4W7VA 2HKHL 5DD1L 3L7FB 1KJMA 5JHDA 4O9HL 5DVLA 3QUML 2R0WH 4GO9A 5FO9A 5D7IB 4JM2F 1UXWA 2XZAH 3C08H 3UTPD 5INDA 2FH8A 5IHZB 4HKJB 1MVUB 5E5MA 5C07D 1F4WL 2PXYD 2J25A 4IRZL 4L3EE 1HJQA 4PREA 1Q1JL 2A83A 3L3GA 1LEGA 3HPJB 4JVUA 3DDFA 4UIKH 1QKZL 2A6JB 4KKBD 3L4TA 5FL1A 4U2ZA 3HB3C 3VSVA 4DWSA 4PGBB 5J6HB 2VLRD 1MRFL 1K6AA 2BHZA 3DMMC 5F1IB 4QEGA 2V2TA 2XIDA 1S7TA 3LQAH 4PJXB 5E6YA 1FNHA 2P47B 1Q6GA 4IDLA 4HOZA 4ZENA 1LL7A 1W9VA 4LSDA 5L7XH 5I1KL 4ZE4A 1MFDH 3RUGB 3ETBF 1S7RB 2GT9A 3VFPA 4TVDA 4ZS6C 3EYSL 4IPNB 5CGMA 3QEQB 5I1DA 3QQ9C 1H2JA 1G7QB 5IKCA 4LDOB 5DWUL 1FL6A 4RRPA 5F1KC 3ZJ7A 1IQWL 3DSFH 3QIUA 4G8IA 1RZGA 5F6HJ 1OAKL 3MRBA 2W62A 5DC4B 4DM1A 4OZHF 4PJCB 4I18A 4Q7DA 3GTNA 4P49A 4PJEA 1GH7A 1IZJA 1DUYB 4AQOA 4WFFD 3CUHA 4LNRA 4PJCF 3DGGA 3TT1H 2N56A 4ZFMA 4S2SA 3QHOA 3GMMB 4LEOB 1MELA 3MUY1 2F2HA 1K4CB 1RJLA 5F89A 4UT9H 1KPUB 2WLZA 4L3ED 4KKCD 1LWRA 4JFFB 5IV2A 5EU3B 3MZGB 3QWQB 4NRZA 4DN3L 1MQKL 1IFHL 1CL7L 2M8XA 5CINL 5EC2B 1A7NL 4X6FB 2GSGB 3VXUB 5M3WA 1IGYA 1T1YA 5E03A 1M04A 4G6JH 1IAMA 1B0IA 3E8UH 2VDNL 4TXEA 3W39B 4LYRA 4LARH 5GRVL 4TNWF 2YN5A 3X12A 2P8PB 5D9SB 1XGPB 4GRLC 1Y6MR 3GRWL 3Q1SL 3EFFA 1E28A 1IGMH 3DUHA 2PF6A 2QQNL 1OCWL 4A2LA 1DVFB 3IDUA 4NKIL 2DQJH 1K6QL 3PV7A 3NIFF 3UTZB 1YY8A 3KYOB 1R3JB 5TQ0H 4EK7A 4ODBD 5M03A 2ADGA 2NY6D 5ICYB 1EVTC 2IQ9L 1YECH 4MQ7A 5MEOB 3WE6B 1WZ1H 1JPSL 5ID1A 3KEHA 5HYSB 4NZUL 2WHKA 4WV1A 3GJFB 1G7LA 3OKDA 4AZ7A 1U8HA 1DP0A 3L7EA 2ZUMA 4QCIB 1OP5H 1A1OB 5D4QA 5J6GA 5D6CA 1YEEH 1UZ6F 3EUUA 5DJDB 1BQLL 3O3BB 3RZCC 1KB5B 1TETL 4MZ3A 2CIIA 2F7PA 2EC9U 1F90L 2YA2A 4OGYH 5DO2C 3RDTD 3ZKSD 1MAML 4A4AA 2ZXBA 2R0LL 2J7LA 3D18A 3KAAA 5JW5A 2CXKA 4L1HA 1NOFA 2CESA 4WU5B 5GHWL 5K9QG 2CXGA 3C6LD 4BK5A 3FOMB 3HPLB 3UC0H 4RDQF 1ODAA 5CZVL 1NAKH 2YBRA 1R24B 5EIIB 1KTBA 2C3HA 1BOYA 2DBLL 3FOLB 2APBA 5C0IA 3P9LB 1RIHL 4OF5A 4PRHA 1ISWA 2ZKHL 1S7UB 3N13A 4W5UA 4YGVB 3Q6FA 1YYLL 4B53A 5I1JH 1KCLA 2X4OB 3QEGH 2NY1D 3TJEL 2HJLB 5FHAL 1L9MA 1JP5A 3V5HA 3TYFB 3WXWH 1C3FA 4W6YB 2ZX5A 2RHEA 3FN3A 3AHTA 1I8LC 1KJ2H 2M26A 3BUPA 3VILA 1EUTA 2QR0A 1KGXA 4Q9RL 4IMKC 2A9ML 3D9AL 1ZKAA 1JZ2A 3SCQA 4NJAL 2V7HA 2B1AH 4G6FD 5FECB 3MLTB 4UUJB 3DWTA 2DM2A 4L8SC 3T4YA 1IEHA 2WVVA 5CP3H 2V38A 4MNQA 5HHVL 3U2SA 4X0NA 5IJVB 4JO3L 3X11A 5L8LB 1E4IA 5F88B 5EU5A 5M5DA 4HIXL 3I50H 3H8NA 4KJYA 1F13A 3FT4A 5D7LB 1V6WA 4WW2C 4YNYB 3VFSA 1JTPA 1CDHA 3GSQA 1S9XB 4FFZH 4WTXA 3GSXA 3ZHKA 3V6FB 3VXMB 4N0FA 3INUL 3DYPA 2NTFA 1J86A 3MRHA 4OZIE 5A2BA 4JANA 2XKNA 5L9DH 5DJXA 1AGDA 1E3ZA 4QXTB 1KPVB 1J18A 1N82A 5DS8B 4I13B 2HJFA 2XWBB 3H42H 3SCPA 1ED3B 3SGDI 1FAKT 3FQNB 2AI0L 1A7PL 4RA0C 4H04A 3P0YH 5I9QC 4Z7OE 3OZPA 4J28A 5E00A 5D2NE 1KJ2A 3MA9L 1KTLA 3VWKC 3VGHA 2GITB 2G9HB 3X14B 4N1HB 4JM4H 1KIRB 1JFHA 2ZPKH 5CP3A 2VXUL 3WBEA 3SGEI 2AEIT 2AJXH 4PJ5A 3BCDA 1RP8A 2YWZA 1YYMH 1UXSB 1K5NA 5IR1B 4BZ1L 5L88L 4JPWH 6FABL 3WEMA 1DQQB 2G3JA 5E94B 1FL5B 1BLNB 1BQSA 4JG1L 1CXHA 1KUMA 1PZ5B 4X6CB 1N5AA 3BQUC 1ECEA 4LLWA 4X6CF 5D9NA 1MAJA 2D7MA 1BQHG 3HNVL 1UM4H 2BVQB 4D3CL 4QLJA 3ARZA 1G6RL 4CGTA 3C5SA 4M00A 4PRBA 3VH8A 2L7UA 3QPXH 2I5YL 3E6FA 3QO1A 1QW9A 1OD7A 5GRXG 5E7BA 1CG9A 5I75C 3BLPX 2RJMA 4ZSOE 5E4EC 3VUPA 4J3VA 5SWZB 4HZLA 1ZLWK 5D8ZA 3LQMA 5LKNA 2MQ0A 4NO0D 2RBLA 5F3BB 4LF3B 5CMAA 4Y16A 1H3UA 4MGXA 3RWJA 5D5ME 1OPGL 1FN4B 5B8CC 4A3YA 4MAYA 3SDCA 5I8KL 1OP3H 4D0BA 4JQVC 2N1KA 1CLCA 4Z8FL 1AFVL 5FK9A 3O4OC 5I2IB 1FFOB 1WIOA 5A2LH 2BY1A 3W6MA 1U8IA 2FATH 4G7VL 5D70H 4QXUH 4U49A 1OGGA 1E55A 4ETYA 3S36L 1ZVYA 3GNRA 4K9EH 1L6ZA 1Q0XH 2H2SD 5C0DB 1GIGH 4UBDD 4U6XA 4D94A 5J9PA 5L0QB 3O3EA 1NBZA 3KE0A 4OZOA 4GKLA 4E4PA 1JWUB 1DE4A 2HTKD 5DI8A 3IB4A 4RNRA 4AEIH 4Y4FD 2G3IA 3BUDA 4XPTL 2GJZB 3W0KA 1UM5H 2WVTA 1JG9A 5ESVB 2W9DL 2EO7A 4PRIE 1IAIM 3NCJH 3ES6A 2IXVA 4RGNB 3LB6D 4FQXD 3U82B 2WW5A 1N6QL 4UQ3A 4D9LH 1KENH 4IS6A 4WVRA 3QUXC 1X4XA 5IJKC 3QHNA 2XFFA 2NY7H 4LSSL 5LWYL 5D1ZA 1XRVA 2DQEL 1MVYA 4CD7A 2HFGL 1RJCA 3RNKB 3WDRA 5D1QB 1PKQA 3R8QA 4LRIC 4O2FB 2G75B 2VX7A 4OD1H 3DX9B 4UFIA 1ZAGA 3QCUH 1JGLL 4WKHA 4GBXD 1HH9B 2IALB 4MA1C 4GXVH 4LLQB 1KQYA 1M4KA 1BGAA 2R1YA 3KVQA 3MTRA 4LXFA 1J1OH 1T1WA 3MUGB 4UT7H 1FAIL 1MRCH 4Y1AD 1BPLB 3QI9B 5SX5H 2BXZA 3CFKA 1SMAA 4Y4HA 3Q48A 4KTDL 5GGTH 4XAKE 2P45B 1J10A 3GXMA 3KPSD 4Y19A 3H9SB 2W38A 5FGBC 3L3OA 3VFNA 2XN0A 3HC0B 4PTTA 4ODUB 4N8CH 3OG2A 1ACYH 5CZXD 2B1HH 4PRAB 3AI0A 3SJVE 4PJBE 4G80A 3ZYJA 1N4XL 4FFYH 3S8WA 3QZWG 1ZHKB 4KXZI 4P7LA 3CLEL 4MCYA 4WW1A 3AIUA 4O51B 1WIPA 3MRQA 5F7HA 4WFGE 2W63A 2R2BA 1U92B 5LQBL 2NLJA 1OTTD 3V52L 3WUWA 2Y7QA 4V1DE 4OUUA 4MS8D 4PJ7E 3QH3B 5T3ZD 4HJ0C 1CD9B 3QA3A 1FZKB 3O8XB 5HI3D 4BQ5A 5I8OH 3QFJE 1T21A 1WBYA 3VGGA 1PX4A 5IROC 4GRWF 3VXRA 4Z7WA 4ZMAT 5MEQB 5KVEL 5D4YA 4QRPB 2H3NB 4XWGL 3CX5J 4Z9KB 4FQ1H 3HLAA 5T1LD 5GRWA 4EI6B 5C0FB 4P57B 4GQQA 3AFBA 5F96L 4KJQC 5GGTA 4Z7NE 4ZFFB 5BVPL 1LDPH 4LCCC 3W9DA 1BEYL 5L2KA 5CJQL 1HKFA 1S7XB 4KHXH 3BKJH 3V0WH 5I0DA 1K8DA 3DX2A 2X4QB 3WY2A 1AQDB 1IT0A 1GGUA 5C3TA 3SO3C 3HUJB 2YXMA 3MFFB 4D6JA 1BVLB 5I74C 5JDSA 1QQDA 1RSFA 3AMGA 5I6XB 4LOUC 3HE6B 4JFEA 4P59L 2AJVL 3P0GB 1XGQA 25C8H 2FSEA 1KFWA 1VPOL 3WHE1 3A6CH 3V4PH 4P9HC 2P5WE 4LCYA 1TZGH 1R5IB 2IPTL 4P9MH 5ILTL 1FZMB 4PJIE 4GLRI 4OAWB 4ZD3H 1MJUL 1U8PB 5EO1B 3QFJD 3HI1A 3EOTL 4LQ1A 1PQZA 5DD0L 3P4MA 4DVRL 1BHGA 2E9BA 4JVWA 5HVHC 2B8OT 4LASL 4P46B 4QXWA 3OKKB 5B3JF 1V6YA 3RGHA 5C0AD 3L5XL 1BZ7B 4QRRB 1EO7A 1IKNC 1QYGL 5DZOA 2DQCL 5GS3A 3NH7H 4XNMA 1QNZL 1AO7A 3VX0A 1YNTA 4WUUE 2IQAB 4K7PY 4RAUA 5JW4R 4ELKA 3BP6B 1EFXB 1RURH 1HXMB 3I6LE 1MHPH 1ZMYA 3ARQA 2EXYC 5EFFA 4NN5C 1FL3A 1G1CA 3RTQC 4WEBL 3UJTH 2XI9A 1NUGA 4GINA 5GS2D 3VWJD 3THCA 4NGHH 5JW4N 2J8OA 2F53B 4WI5A 2JJTC 3MA7B 4DN4H 1HK6A 4KROD 2WB5A 5ANME 5BJTB 4EE9A 1WF5A 1I9EA 3B5HA 1TR1A 5BXRA 4YR6B 5EO0B 2WWDA 2JIXB 2A0LD 5EPMA 3F7VB 5E2WH 3HZVA 3ARXA 2YN3A 5CJ8A 3FQTA 2DQFB