3VGDA

Ctystal structure of glycosyltrehalose trehalohydrolase (d252e)
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
555
structure length
553
Chain Sequence
AYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLEAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 193
structure length 553
sequence length 555
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgdA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgdA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgdA02
4Y1AD 1BVNP 2Z8SA 5CJQH 2R4SL 3BP7B 2IBBA 5IFHL 2OMBA 3ZOAA 3H2WA 1OOAA 2ITCA 1PG7W 3O4OC 3KZSA 4JFFB 5ESAB 1RUAH 4I9WD 1NGQL 1TZHA 2NCMA 1NLBL 4U1GC 3CZGA 3HG2A 3L3JB 4P5TA 4D1JA 2CNCA 3NFPB 3IJ7A 1IE5A 2AEIT 4GQQA 3AZRA 3C08L 5TF1H 3MSGA 4Y8DC 1ADQL 3FO0H 5DLMH 4X6CF 1BZ7B 5B3JE 1WB0A 4MDIA 4NOFA 2CLRB 5CSGA 3RWJA 4LGRB 4DFHA 1YY8A 1AY1H 4JPKH 3LRLA 3UCQA 3L3HB 1IJ9A 4PREB 1G7PB 3NSXA 4OZGA 2IC2A 4CGTA 2VXUL 4M5ZL 4MSWB 3SDAB 4C56B 5CD5D 2Q3ZA 2DQGH 1AD0B 2EDHA 2BMKA 4F80A 3FY1A 1SMAA 3DXAA 3T0VA 1JWSB 7A3HA 4O51A 3BP5B 2BOBB 4HIJA 1R5WB 3IVKA 2WZIA 2Y5TB 1DWJM 3BSZL 1H0IA 5A6BA 2V5CA 4MXWH 1AD9A 4MNMA 3WNNA 1UXSB 5F88A 1J10A 2HRLA 2CLZB 4ODXA 4WUUD 5TE6H 5IMLA 1HOCB 2PWDA 3CH8A 4K7FB 2IG2L 2FWOA 3N12A 4OLEA 1UT9A 1P7HL 1TMQA 5F7MC 1JDAA 3B2VL 5JXEA 4GXVL 5E5MB 5HI5C 3RVVD 4GG8A 4JHWL 3UTTB 3BAEL 4GRWF 1FVDB 3W0WA 1OT2A 3RL1A 1JDDA 3TT1H 4WEUD 5ABGA 4LF3B 3AY4A 1WT5C 2AABH 5TJWK 5KVGH 1CL7H 1V7NH 3P0VH 5J1AA 2AK4A 1KNOA 2X4TA 4NM4L 1MFDH 4GBXD 4JPWL 3VWKD 3QJFB 3ZT6A 3C2AL 3HC4L 4E0RA 5F1KC 1VESA 1MWAA 5TE7L 3SGKA 1RVFH 1QVOB 2V6HA 4Y4HB 4J28A 3QDGA 2RIKA 4APQA 3OV6A 4L4VE 4NKIH 4P2QA 2XKNA 1C5DA 5I1IL 5SWZA 3Q3GB 3OX8A 3E6FB 2XFFA 2LE9A 3CUPA 5MEND 1PKQB 1HKIA 2IH3A 3BDXA 1TVHA 1BQLL 1T5WA 3OJVC 4MA3A 3KYNA 4GG6B 1ADQA 4ODWB 1YMME 2FGWL 2OTPA 1KJ2H 3FRPA 1MJJB 5F7NC 5DO8A 1JHTB 1V3MA 3VJ6A 1U41A 1ZSDB 4WEMB 1JYNA 1VKXB 2VSDA 4PJBE 4HMDA 5KZ6A 2WHJA 1OP9A 4JY5H 1A14H 4B0MM 3RZCD 1GOIA 1BBDH 4OV5A 1SHMA 3EO0A 3VX0A 1LE5B 4Y5YA 3PZNA 5CD5C 1VBRA 3RWDA 5HHQA 4PG2A 3PDDA 4QOKA 2CRZA 2O5YL 3ZKXB 4RFNC 3TIDB 4HV8A 5B4MD 3ALWA 1ED3B 1L9MA 4CKVX 4X4XB 2V9TA 1JGUH 2R0KH 4LSQH 3D69B 2A83B 4OCRL 4W7WA 1KC5H 4UILL 2N7BA 3GBML 1WAWA 1W0VB 3CC5B 2WIIB 1BF8A 1B1YA 1ZGLP 5FO9A 1OW0A 5ICZA 1Z9SA 4QRRE 1N8ZB 5FB8B 1I7UA 1U8QB 4DEPC 3EYQC 3P77A 5F6HI 1A7NH 3AOFA 1NL0H 5H37G 3RVVC 3CSYA 4A3HA 3HMXL 3STZB 3E3QC 3I6KB 3K8KA 1HVQA 4TULL 3BW9A 4NXSA 5TFSH 5DMKB 3S5ZA 1K4CA 1WCBA 1OD0A 5EBWB 3ARBA 3O8XD 4YXLH 2UVEA 3MA9H 5F96L 2DQDH 2EO7A 2YA1A 2ZNWA 1OF2A 1PEWA 5I73C 2E4TA 3SURA 3SCMB 3VWKC 1FLRL 3L4XA 1KFAL 4LSPL 1KN4L 1P2CA 1TA3B 1JGVH 3ARSA 3ARQA 1FH5L 5IVXE 3QUXD 4JO1H 1G9MH 4NDMA 5FUZL 5T3XL 3S5LB 1HINH 2DQTH 2ED9A 4JDTH 4UTBH 2A9NH 3CSPA 3FQXB 4D3CL 4PYGA 5I6XB 5BV7C 5HGHB 3U7AA 5D4QA 1MAJA 1OWRM 7TAAA 2DI8A 4UV4H 4Z7VE 5IVXF 4IMKC 3F5LA 5FO7A 2RB8A 4M62L 1EH9A 1N6QL 5E2JA 4JREC 3F58L 3TA3A 2Y9RT 2PF6A 4FQ2L 1DEEB 2HAZA 1BLNB 1ZA6B 2VL4A 1XFPA 1T04B 1T6VN 2MWCA 4GMSH 3W37A 1XGYL 1BQSA 1JWMA 1P7QA 4DGVH 1DQQA 3S36H 4HWUA 1UZ6E 4OD3L 2FATH 4HBQA 1KBGH 1ZAGA 1E4JA 4KKBD 4KXZI 4YDKH 3S35L 5KBNC 2ZUWA 4Z7VF 5HGBA 5DRXB 5AD0A 1CU4L 4HEPG 4X9GA 3HI6L 3MNVA 2EDOA 4UOQA 4OAWB 5HHPB 5C09A 3S4SB 5GS1C 5B4MC 4EZMA 3NA9H 3PGCB 5J11C 3L2LA 1S8DB 3BAIA 5A3ID 2ZOXA 5JTWA 1HH9B 2VR4A 1UZ6F 4S1QL 1BYAA 2PW2B 2QQQA 3QULB 1FL3B 5LGHH 2IUZA 1KELL 4LLVB 2VWEE 3BDBA 4PJ7B 2O5XL 5D93C 4WEBL 4PRHA 3MYJB 5KAQF 5F7WC 1M7XA 1JNHB 2MCPL 3P40A 1T20B 1FE8H 1BJMA 4WNQA 1QG3A 5JLZB 3T8XB 3N11A 1P6AB 2FSEB 4BK5A 1UH2A 2DBLL 3R4DA 3O8XC 5IROC 2WP3O 3L7FB 4AM0B 3BIBX 4LPWA 3O6LL 2BFVH 3BKCH 3VFWA 1LG1A 4LARL 1MQRA 2W63A 1A3LH 5A2FA 2HFTA 2FECL 4YNYB 1W9XA 1RJYA 1SYVA 4R97B 2WMKA 2AAVA 3QUXC 4WKFA 4NRYA 5KSVB 1EFXA 3WIHH 1PX4A 2D4DA 2VR9A 4I5BB 3RRQA 2W9EH 5T33L 1GZPB 2YSSB 3VRJA 1QFHA 1FYHB 4HIEB 1DDHB 1U8MA 4TVPE 5J6GB 1MCWW 4YHPB 4NO0A 2DH3A 1F4YH 1XGUB 1KACB 3HRPA 4O02H 4BK4A 4OZFB 2RJMA 3LKQA 4L4PA 4WTXA 1Y6KR 4LLWB 4U1MA 4WU7A 4AZGA 1AQHA 4KQ3L 5L88L 1GOOA 1BGXH 3NABL 3CFJB 5IHLB 4OUUA 3W4RA 4MNQE 2CKBL 5LG1A 5ISZD 1TUXA 2YPLD 3CSGA 4Y1AE 4ZG1A 1DN0B 4X8JA 3UJJH 3VH8G 4AW7A 5A2LH 1XH1A 3C87A 3L95A 5IFJA 4KKBC 4KY1H 2VJXA 4I9WE 1WWBX 4N0FB 4KMTH 1FVCA 1ROWA 4X6BA 5EIVA 2PXYA 5C0BA 5HHXL 4RQQB 4DM2A 4AYSA 1UOKA 3SCTA 4LIQH 1AO7D 3DX1A 3C8KB 4UQCA 5CD3A 4L3CA 3U9PH 1DSFL 4HJGA 5GISH 1F5WA 3BPLC 4ATWA 3C2AH 3MLRH 5JORB 3IKCA 4XPGH 4GI6A 5D7JD 1FZKA 5T1KD 2BFGA 5A3IC 1MCBA 4TNWK 4I4WA 2XGBA 1PZUB 3JTSB 1V0KA 4G3YH 4KUZH 1G9MC 3OLGA 5F9DC 4JQXA 1OPGL 2I24N 1YEHL 3QAZB 2EDLA 4DGIL 2H1PL 4WWKB 3TO4B 1I9JH 5B38B 4DWSB 3FKUS 1GC1H 3S34H 4GRLA 4RGMB 4PMOA 1ZKAA 4HAFA 1MF2H 3VXOA 3TTSA 2JK5A 2VQ1B 3M17A 2YUVA 2JJUA 3AIBA 2Y2WA 5MHSD 4WUUE 2JCCE 3OB0H 3DGGA 4Z7UB 5DO2D 1VFBB 3KPRB 1XF3A 3U0TB 1JZ3A 1AQDA 1RUPH 2ORBL 1L4IA 5DRNB 3VDHA 1V3LA 4ACZA 1S9YA 3TBTB 5C1MB 2A6JA 3LMJH 2PC8A 3OSKA 1BQHA 5DJYB 4DKAA 3E3QE 4NFCA 3EYSH 2OK0L 3VDBA 1OSEA 3QIBB 1IFHH 2J4WH 5D5MF 5FGBC 2JCCF 2XGIA 1QSEA 4YLQT 1CD9B 4WFHD 2BNJA 3TJHD 3P4OB 3U7YH 3IDMB 2I9LA 3OKEB 3TCXA 1JYXA 1PY9A 4EQ3A 2LAGB 3MGAA 3F8UB 1MCDA 4LMQI 1Q9LB 4MMXC 3WDQA 3DPBA 2R0ZH 2D2OA 3EOAB 1UQSA 4UIKL 4X4YA 4OTXL 3LQMA 4J23A 1C12A 1I3RB 1GQLA 2V7NA 3VIGA 4PV8B 2AJZB 1ZLVK 2BOCA 4LRIA 2BSTA 1QO3A 1V6VA 3QJHB 4K3DH 2W38A 5ESQB 2VAJA 5B22A 1CGVA 5C8BB 1I8IB 3U36A 3U1SH 1ORQA 4H26B 3MLZH 5MENE 2WV3A 1UM5H 1CFNB 1US2A 1W9DM 5JW3H 1PG7L 1HX0A 1TVDA 2YD4A 2H6PB 1Q9OA 3WEOA 4HJJH 4OI8A 1H5BB 1J86A 4XNQA 3SJVD 4ZFFB 3N9GH 4LPUA 1BVKB 3CFDA 4IS6A 4U1LB 4ENED 5E2VH 2PWFA 3IK2A 4W4OA 2HH0H 4PJGB 1EDGA 3MBED 4POUB 4HULB 3BP4A 1JNLH 4H0GA 3CD4A 1KIRA 3B9EA 5DJAB 3MV9A 3ZJ6A 3W27A 4F7EA 5I1LA 3LIZL 4X83A 1FNLA 5B39G 2ATPB 1WDRA 3O11B 3MRRA 5DD6A 4M61B 2R1YB 3SKJH 3OB8A 5ILTH 1R5VA 2UY7A 4D6GA 1ES0B 2Z4QA 1N5YL 2QSCL 5DHYB 3DDFA 1C08A 3WN6A 2X4OB 2J4GA 3MRBA 1P5VA 3MLSL 1OB0A 3WYRA 5DO2C 3GJFH 4BQ6A 4P99A 4UNVA 1H8NA 1ZS8B 1NARA 4OFKA 4OZHE 1UXWA 2RGSA 5HHNA 3MFFB 4TSBL 3STLB 3LS5H 1I1WA 3NZ8B 5I78A 2BZDA 5HHMD 3FFCB 2MCG1 1GHSA 1YEFH 1ZA3A 1IC7H 1S5HA 3BZ4B 4JM2D 1DBKL 5E00A 5L8JB 3MMDA 2BK8A 1Q0XL 2ALWA 1I1CA 5DQ9A 1CD1B 5E5RB 1V08A 3ELAT 3WFBL 4TUFA 3BCDA 2DIEA 5L2KB 4DAGH 5I8KL 4MQXD 3X3GH 5MERB 2PYED 3MBXH 1IBGH 4Z77B 1AJ7H 2YD1A 4OQTL 2VXVL 1ONQB 1AKJB 4HDIB 4QTIH 4LEOB 1D5IH 4F8QA 4HHAB 1OM3H 2NW2A 4D0BB 4MCYB 4HFWA 4PGDA 2OW6A 2FX8H 3UTQA 5SX5K 4FQ1L 4MZ2A 2YLAA 3PN8A 1U93B 4XPFL 3RNKA 1UM6L 3Q5OA 4FQHA 1T83A 1JZ6A 3PUCA 2ZUTA 1TDQA 2DRUA 3TBYB 4LEXL 2ZXAA 1W2VA 5TDOA 1SR0A 1GC1C 2E5EA 2BRQA 4AIOA 1A7OL 4ZTOH 2B1HL 3D0LA 2OI9B 4PGZA 4QHMA 2Z92B 4LCCC 1WFNA 2X5PA 4WW2A 2J7DA 4JZNB 5GS0D 3MJ9A 1RIHH 4IOIB 4I77L 3UG4A 5ALCL 1JPSL 4OLXL 5DURD 3UDWC 4HH9B 1S7SB 3O2WL 5EBLB 4K9EH 5FYKD 3VXSE 4ENEC 2DSKA 1YEIL 4J3UA 4L9DA 1IAMA 1R3HA 4WDIB 4E5XA 2XPGB 3MBEC 4NQCA 3KLHD 1CT8A 1K5NB 4UAOB 2BV9A 1JF5A 1HEZA 2CLVB 5GSRB 5I79A 3GSXB 2WXDM 1XCWA 5FOBA 4YC2B 3QPQD 2ESVD 1AGEB 2DDQL 1DBBH 4KZEH 3SGDI 1MQ8A 1LQ0A 4G8GB 3OL2A 3L9RB 3KYKH 3VWJD 2JIEA 3GSNA 4XVSH 2YWYA 3F4VA 5FKPA 5L0QC 2Y8VA 4PJAA 3JTTA 1MJ7L 4U1NB 4OBSA 3SPVA 4L4TA 4F7CB 5IQ7H 1GPFA 1NEZG 5E1QA 4OBRA 1KIUA 3FQNA 2DQEL 4KU1A 5TQ0L 1HIZA 1KFWA 5D96C 5EU3A 1T22B 3VXPA 4P23A 1SJEA 3ZE0F 2B5IC 1Q0YH 5DK3A 3DO7B 3GRWA 4PBWD 3SDDD 5FHBL 3SY0B 2F8XC 3M7SA 4RISL 2WCAA 4S1RH 4H5SB 4JM2C 5FA3A 4KPHL 5BXFB 2KDGA 4R26L 1XYZA 4FLOA 3NACL 1CZ8L 4POZD 5CJ5A 1IQDB 1KPRB 1QW8A 5D72L 4MQXC 4OQTA 3TWCL 4DN4L 4Z8FH 1KXTA 5I66B 1H0DA 2A77L 1OAKL 2FO4A 1UH4A 5A6AA 1PIFA 3TN0B 1UYQA 4WHTA 1A9EA 3AREA 1I8MA 1GGCL 2GJRA 1CQYA 4MJIA 3MUGA 5D2NE 4BSWB 1FZOA 2C4FU 3WQ8A 3A5VA 3UTSA 5CP7A 4NO5B 3VFTA 3DUSB 4YHNB 3AXLA 2J8OA 1WWAX 4JFEA 4JAMB 1C5CL 2EE2A 5CUSL 1JI2A 2W65A 1H3TA 1KLGA 2HT4D 3GGWA 3H3PH 4NQEB 3AU1B 4W8LA 5F9JA 2ILLA 3IDJB 2DQJL 2BVTA 2R0WL 3RU8H 5CQ1A 1UR2A 2D9CA 5FM5M 1DQML 3P11H 4Z7NF 3QEQD 5IB4A 4BSVA 5ISZE 1MCLA 4F9DA 2OJZH 3QFDB 4D0DB 4XV0A 2YPLE 3BXNB 4M48L 1CZ1A 2JLLA 1UB6A 4O5LL 1KXVA 4ISVB 1A1NA 2A74A 1ZEAL 4JFZH 3KLHC 4W6YB 1BGAA 3TO2A 1V5JA 4WENB 1OSZA 1AO7E 2BVEA 5D9MA 5EOQH 3T2OA 2BNQB 1EUTA 4L4JA 4LLMB 4LVNB 4X7SH 4JRWA 4F7PA 3LCYA 4P46D 1UYWL 2ED7A 3RHWK 4G7VH 1CK0L 3MMEB 1G7HB 4XMKH 4DVBB 3VWJC 3MV8B 1FPTH 2V5MA 5EO1A 3KPLB 3O3BB 4H0HB 3H8NA 1YN7A 2YUWA 3F7VB 4LPTA 1SEQL 2FLRT 3BQUB 3VMNA 5C2BL 2X7LA 1OP3H 5FXCH 2ICCA 4ZD3L 2ADGA 1A3RL 1G6RH 4HS3B 4ZS7L 5KVDL 5C0RL 1UKOA 2KZWA 5EU6B 3N06B 4F79A 4YHLL 3SDDC 1UASA 3EJZD 2R2EA 4MPKA 5I1HL 4QRTB 3HPJA 1E4XI 5C07D 3GO1H 3UTPD 4PRBA 5I15L 4UMGA 4HS6A 1RZJH 2PO6A 4WO4D 3WUFA 4POZC 3MJ7A 2CIIA 3QB7C 5MHSE 3OKDA 3GMLB 3KLSA 4AD0A 2NX5B 4HGWB 4L9LA 4P59H 4UZSA 2J7BA 4YO0B 2CD0A 4OCWH 2VDPH 5JBEA 3H9HA 4Q7DA 4K9EC 1JP5A 1T66C 4R4FH 4Y4FA 4GLRH 3LKPA 5EORH 4CCCA 1TCRB 5IIEB 1J9CT 2EYTB 4Y4KD 4QP0A 4NQXB 5GGSY 4Z76A 1J1OL 4J8RB 5D1QA 2A3AA 5F1NA 4A2MA 4WFHE 5FYLH 3DUUA 4XNUL 3WBDA 5JO5B 1LEGB 4FXKA 1EZVY 2FYYA 5D9NA 3CPLB 4HZLA 4UOW0 5BS0A 1FL5A 2BNUB 2XICA 3WN5B 4D6FA 2VXTH 5LA2A 1EAPA 1LWRA 1JGDB 1MXGA 1UZ1A 1JD9A 2WMHA 3T0AA 3DRTB 3VX1A 2Q7NA 4JKMA 3HUJE 1TNMA 4OM0L 4G8FB 1K9EA 5E1HB 2HFFA 2J79A 3T65B 3H6JA 1MFCH 3PHAA 2X4PB 1SVZA 3QH3B 5K9QI 3F62A 2VAAB 1CDUA 1MQQA 1RIUH 5IV2A 1ZXQA 4I48A 3OMZA 3BAKA 3QRGL 3WL0A 4XP9L 3O6FB 2VZTA 4Z0XB 5C7XL 3ZHKA 4EDWL 4OI9A 1ZBWA 1ZOXA 3UAJD 2X09A 5EO9B 2FX9L 5FKYA 5D70H 1Y0LB 3V8CA 3II1A 1IT9H 4F57H 3SJVE 3LHPL 4TUKH 2YRPA 4AISA 5E4IA 5IJKC 2IMNA 1BYBA 2EXWD 4NQUA 4WHYH 1U91B 4ZYKA 4HC1L 4XVUD 3WDPP 4JM4L 5IF0B 3OPZH 3RVTD 1UWXH 2D73A 1JV5A 3U2SB 1DEDA 2CIKA 1U58B 5IW1B 1AE6L 2XN9E 4GKLA 4ZMAT 4OOUA 1OWQA 2E9JA 4FLSA 5CHNB 3L3DB 2A2QT 3EJZC 4PMVA 1ZVYA 5A8MA 1AXTL 4LRNL 4XMLH 1A6ZA 5KAQG 2VDQH 1ETZA 1EBAA 1M7IA 3WFEH 3BC9A 4GAFB 1WBYA 4XPHH 4E4PA 4WO4C 1ZGLA 2QMJA 2ZSWA 1YY9D 2NW3B 3FN0L 3IDXH 4HGKC 1FIGH 5IM7B 3QOKA 3GYCA 1XH2A 4NBXB 4OD1L 1ZHNA 4KROC 4XXCA 5AC5A 1QBMH 5D7IE 3QI9D 1E6RA 2F5AL 4X98B 5DWUH 3RA7H 1JPTH 1KJVB 3D39D 4RX4D 1QSZA 3LD8B 5AAWA 2NY6D 2DYPA 1QSFA 3LOWA 1KB5B 4DZBA 4XNYH 1QI5A 3F5WA 5HHME 1LF1A 4JFFE 1U3HB 3HTLX 4LSRL 5FF6B 4FZEL 2X2HA 1U8IB 5E6ZA 4DUWA 3T4YB 3KL5A 5LAXB 4Y4KC 5CKAA 3GSRA 4OFYA 4H25B 3MLYH 5HPMB 4NXKA 1A64A 1VFOA 4OZIA 2HVKA 2D3VA 3ULVL 2VI0A 4NKMA 4JKPH 4JZOA 4PJ8B 2GSJA 2OL3H 3TVMB 3GZKA 5CILL 1IZJA 1UACH 2HA1A 1UA7A 2PYEE 3RAJL 2EYSA 4OD2A 2P5ED 2CMRH 4U6HA 5JNYB 1IEAB 3GMRA 1FO0L 3A0OA 3QWRD 5I8EA 4C83B 3ECBA 4ZXLA 1JF6A 2YD5A 2H32B 3LDBC 3V6FB 5HYJA 3PWJB 4LDEB 5A3HA 2WYSA 4C56E 3MLWL 2R0LH 5BRZA 4G80B 3QIWB 4BFBD 4FNLH 1EAJA 2VMFA 1S7XA 1QFOA 5IW3A 3NSMA 4PTTB 2CGRH 5ID0B 5FCSH 3LKOB 1TNNA 5LWYL 4QDMA 2VLMD 3C8HA 5CBEA 3VW3L 3T1FB 3DHUA 4ORGB 2F19L 1QPPA 2FJHA 1J1PL 1NFIB 1RZJC 1UG9A 4R90H 3U4BL 1R8LA 4W8AA 3Q5TA 4L5FH 3WHXB 1FG2B 3RQ3A 3MANA 1QEWA 1NC4B 3MRMA 3D4ZA 2LU3A 1ITCA 1CR9L 1EPFA 1ACZA 1NJ9B 3EJPA 1EHLL 3C6SA 2EXWC 5FYKE 3C5ZA 4P4KB 3Q1SH 3BKMH 4NN6B 4XVUC 1P7KA 4YHMH 5EU7E 3JWDH 3IB4A 3QDHA 1D9KC 3UTTE 3E2HC 1VFAA 1BJ1J 5K9OA 1CWYA 2NY3B 5BROA 6FABL 5MEOA 2ESVE 2WBWB 3OR6B 2VABA 4KZDH 3ARFB 1CXEA 1NDMB 3PNWA 3VRLF 1DUZA 3NGBC 4RRPG 2R23B 5EBMB 2R2CA 5CSUA 1IAIL 4MD0B 4ZO7A 3K81A 4LNRB 2WBGA 2RFXB 2Z91B 2VDRL 1YY9C 5AWNL 2CXKA 4NQDA 2HJFA 3PP4L 4NUJA 5DJXA 1MAKA 1M01A 5JBFA 1SJHA 3QI9C 1ZJBA 3KL3A 4XVJH 3BXWA 3QDMD 2WCGA 4AZCA 1VHPA 5JA9A 2NY6C 1FDLH 3IDIA 1OY3B 4HLZG 2DSZA 3X11B 5B39A 3KLKA 2YEZA 4WKHA 5AZ2L 3WBEA 4JGJA 1PKQE 4ONFL 3R8QA 1MW3A 5IHUL 2QQNL 4XCEB 1MJ8L 3MZGB 3MREB 5IW6A 5D8ZA 5C0CB 5KVFH 5E8PA 4P3DB 3ROOB 1JIBA 3CV5A 1RZGB 4HT1H 1U8LA 5F1OB 2FRGP 2XVPA 4AZIA 3L3IA 4PIRF 3DECA 3U9UB 4OIBA 1AGDB 4XHJD 1CFVL 2P43B 1MPAH 2DLGA 3ET9F 3SCWA 3TJEH 3G5XB 2O61B 5E2WL 1DBAH 5CPSA 2NY1D 4GG6F 4V2CB 1CFSB 4UIMB 1GOKA 3RWFB 5J06A 3LS4H 3M6DA 1J05A 4LVHB 4FP8L 2VCAA 2WC7A 3SE4A 5DVOA 1OM0A 4Z7WA 2L7JA 1ZT4A 3HZYA 5GRUL 1RUQH 1WFUA 1Z0MA 2D03L 5EC1A 2XPKA 1TQWA 3QEQE 1BQCA 1VAHA 1MCPH 2EDJA 2KKQA 2XZZA 4HKBB 4K07A 2XZCH 5FM4A 5C2UB 1K4DA 4QRPD 5JHDD 3C60B 4U6XA 1FNGA 4ZUVB 1NUNB 3GTNA 4G6KL 4ZNEE 1OP5K 1YYLH 2GJ6D 2YKKA 3VIMA 3TYFB 3W39B 4UINH 5HI4D 4L8DA 2EC8A 3UTZA 5BXTA 4PJFB 5GGRA 2VLRB 4O00A 2YD6A 2Q8AL 4WJ5A 3ZDYF 1NC2D 4WI9A 3T3ME 3CO4A 1A0QH 3UEZA 3OGCB 4JN1H 2C8NA 2QLYA 4BQ4A 1RZFL 4GW1B 4PRNB 3D18B 1EGJH 4OM0H 2DOCA 2X4QB 3KPMA 1M71A 2XFXB 4PRPA 4AD1A 2OCFD 5F44A 1KPUA 3SBWA 5KG9A 2Z1SA 4X6CA 1G7QB 4NZCA 2BS9A 3CDGB 3GI8H 5CMAA 1CLXA 4GKNB 1V7MH 5D71L 3VA2C 5ABEA 3GMPB 1RURH 4MD5A 1BVLB 1P9MA 5C07E 3UTPE 3MR9B 1NANI 3SKMA 4EKJA 1GIGL 1T5XB 5CZKA 2FL5A 3N18A 2VLKA 3F5JA 3A6OA 4L4OA 5DVLA 2O92A 2QSVA 5FDWA 1BFVL 1X9QA 4I2XA 3B9VA 3BAXA 4GW5B 3FTGA 1HKLH 4M5YH 5I8OL 5AUMB 3MCKA 5DJ2A 1R0AL 1B0GA 1N7MH 2W67A 4XHJC 1JRHI 4GRMA 1F00I 1IKNC 5DJZB 3AMCA 1UZ8B 1FGVH 2XV6B 4TVUA 3CUJA 1DBMH 4XAWL 4L8SB 3DTXB 1KYOJ 4GAYB 3I02A 1A7BA 1ORSB 4JG0H 2NY1C 1CFBA 1ZHBA 2HFGH 1NDGB 1MI5D 3PWPA 4HJ0D 1ZTXH 4UQBA 2H9GB 3OKNB 4EN3B 3ZR6A 4XP1L 1G9NL 1G0YR 5EBGA 2W0FB 5C0ND 1VRXA 5FL1A 3HPLA 4P57B 5K9KB 4NBYB 2ZUNA 1MFAL 4AEFA 1FSKC 2BC4B 4CW1A 4H8HA 4G7YL 5KVMC 4MNKA 2VZUA 1NGYB 5A6LA 1ZBCA 1FAIH 5F9WC 1PKOA 4P9ML 1YNTA 3FQUA 4H1LH 3I50L 2HT3D 3H9ZA 4L3ED 4PJ7E 4AT6A 4GO9A 3V6ZB 1OB1B 5BYWA 1NSNL 3I6LD 4UV7L 1BIIA 2YL9A 4PY8I 4IM4A 4OSUH 5DEFB 3WS6C 4RA3A 3KPPA 2MJWA 4KKNA 3TA9A 3EIFA 5DUMH 1UB5B 3QT2A 3SOBH 4AMKL 1E4XL 35C8L 4AEHH 4NOBA 1DQDH 3WO3B 3BPNC 5I74B 2YA0A 4QHLB 3ZDXE 4PJ7F 4Y5VA 4B16A 2ZCLL 2A6IA 1QSVA 4EEEA 5DZLA 2C5DC 4H8UA 3PE9A 1J8HB 3BGMA 1T0MA 4PJ5A 1H3WM 1R7AA 5T5FL 2FHBA 3WH7A 3DMMB 2G75A 3WO4B 4Q7NA 1AQKL 1G6VK 5ANMB 1CLVA 4YX2L 1UWIA 4UT7L 4YXHH 4KC3B 2W5FA 2N56A 3V7AE 4ZUSB 3ZDXF 2O26U 5H35B 1INEH 3BSHA 1A5FL 2JEPA 5I75B 3NDYA 4AMWA 2IF7A 5ITFB 2FB4H 2P7TB 4NN7C 1JBJA 3ROLA 1XSKA 3VRIA 5GHWH 2ZOLB 3DVNA 4JRXB 1HL8A 3WY4A 1C5BL 4M7JH 4NSKB 2OJEA 3RP1A 3UZEA 3DX9B 2JJWA 4CD4A 4YHIB 1YEKH 5KTEL 1KCRH 4GPNA 3CH1B 4UQ3B 1CDIA 5D1XB 5ENWA 1MNUH 4QO1A 4WW1A 1TJIL 2G8ZA 3B9KD 5HHOD 3H0TB 5GZND 3WQWA 3BUQA 4NNXA 1NAMA 3BZFA 3TCLA 3DARA 4KKLC 3AIUA 1TJGH 4OLWH 2VDNL 4ZFMA 5HD8C 3WIIH 5B8CB 2W62A 2CKBB 3UBXB 1XR8B 3LSOA 1U42A 4PTWA 3DBXB 4W4NA 4XNZC 5E6YA 4LCWA 3LEYL 5JR1H 2X70A 1JFHA 4RFEB 2OP4H 3REVB 5C9JB 3H42L 4P5KB 2XQYK 1S5IH 1Q94B 3VXRA 1JTPA 4Z2LA 4YR6A 2FX7H 2HT3C 2AGJL 2C4FT 5CS7A 4XH2B 1K3IA 4UDUA 1VIWA 3TNMA 2C26A 1NLDH 1IEBB 5JA8B 1UWSA 5ICXA 1NCBH 2RBLA 1A9BA 1VJSA 3HC3H 2BVQB 1MQKH 2ZCHL 1T21B 3QHFL 2VLME 5CINH 3LV3A 3LPFA 4LLYB 3QEHA 3S98A 3WD2A 5FYJH 3MLVL 1IM9A 1YJDH 4M6NL 2QKIB 5SX4I 3QUYB 1Q9KB 2Q7YB 5ABDE 1JHKH 1KQYA 4PJIB 4ZNCD 1KIPA 3NYDA 2IAMD 4EI5A 1KENH 3REWB 1NGZA 4Z7UE 3DURB 4YDJB 4HWZB 3KPRE 5IVXA 1MFEH 2EABA 1CBVH 3WE6B 1D3CA 1TZ7A 1MAMH 2VURA 1NGXB 3WFLA 1KIQB 4PRAA 2CKRA 2XVGA 4FFWD 5KSUA 5AEAA 2L0DA 2WC3A 3ZYZA 4HIHB 3BRFA 4WHDA 2O9OA 1KYOK 4NQTA 1WTGT 4GSDH 4Z7UF 4KTDL 3FQTB 4Z7VA 3GSUB 5KSBE 1BFNA 1SJVA 5HYSG 1QFUL 5HVHB 5LGJB 5J9PB 4P48A 1WDQA 2D23A 3THML 4NO2B 2C3XA 4XBPA 4KROB 5JQ6H 3CLWA 4PLNC 1X5JA 3NH7H 3D85B 2V2TA 3K0WA 2ENSA 1UKTA 3CBWA 5GGUB 2UUDK 3OHXA 4N8CL 2PBOA 1A7RL 3X13A 4WU5B 3UO1H 1GW1A 4O4YL 1K9FA 4IIQA 4M7KL 4P5TD 2DKSA 4ZODA 1NBYB 2J8FA 2XHYA 1T0OA 5GZNC 2HG5B 5H2BA 3HNTL 5HGDA 4HS8L 5FYJD 5L7XL 4M7ZB 5I5RA 2J88L 2EH8L 1MWAH 1R3LA 4ZPTB 3DROB 3T08A 4R8WL 1E6XM 1F4WL 3HFMH 2W9DL 5FO8A 2AJSH 3P9LB 1LVEA 2R4RH 1E56A 3TPUB 2EH7L 4NNPH 5GJTL 3ILPA 4PJGE 1A6TB 2QEJA 2WWMD 1DWIM 3DXAD 3EW3B 3DHPA 4WHCA 1XZ0A 1F90H 3T0EA 4D6HA 1QBAA 2B2XH 2Z8RA 3QPXL 3AISA 3VFOB 4DO5A 2D24A 5ERWB 5M95B 4Q9QH 4W68A 1F3JA 5ICYA 4PJGF 2ZWLT 3QHZL 2ZJSL 5DD5L 5MP6L 4MWFB 1ISWA 1ECEA 2DM4A 3IAPA 2NPLX 5EUOB 4QRPE 1F4XH 2IAMC 5JHDE 5T1DH 1UJ3A 1FLTX 2YN3A 5MEPB 1CBGA 5JXED 4JFXA 1WE5A 1BP3B 3D0VB 2WWCA 3D6GA 2GJ6E 4MNGB 2R29L 3W0WD 2ICEB 2JB6B 3FB5A 4ONHB 1LHZA 4X5XA 3ULUH 2EYRB 3ETBF 4FFWC 2DGAA 5GQBA 3TTOA 2F58H 1A1OA 4HEME 2NY5L 2XWEA 1AQ0A 2AK4D 4I3GA 3SKNA 5C08B 2DH2A 2E9BA 1J5OL 2C1OB 4M1CC 3CJJA 4H88H 4LP4A 4Z9KB 4MB3A 2VZ3A 3U30C 3LEVL 3O2VH 3ZDZF 3SUSA 5I19H 4MNQA 5I18H 5SX5H 5J0BA 1IGML 4XPAH 1QNZL 1XH0A 1B3ZA 1FVEB 3QDGD 4OLUH 4APQD 3NCJH 1HSAB 4P2QD 5E99H 5GS2D 4DGYH 4NKOA 1JNEA 1VFFA 5SWZD 3GIZL 4M1DL 4JDVA 3SKUD 3O3EA 3TV8A 3ALGA 3O81A 3MOAL 1E4IA 4P5TC 1BAFL 3NFSH 3QG7H 4U2ZA 1UA6H 1X5AA 3RMEA 4TQEH 4RRPA 4ZUWA 2GSGA 3SO3C 3WD1A 3S37H 4ZOEA 1I7ZB 1NH6A 1RZ7L 1UC6A 2ERJB 4KJQD 1YJDC 1UEYA 5FM8A 4PRIB 3OAUH 3WEMA 4CADB 3O41A 5EO0B 3V52H 5K9JH 4YXKH 3PHQA 4U4BA 2A6KA 4RAUA 2HJLA 3P4MB 4QXGH 5HDOA 2F8QA 2CJUL 1MLCA 3FQWB 4N42A 5JOFA 3SDXE 2B4CL 4K3JL 1II4E 3DX4A 1CGSL 2FBOJ 3VG0L 2WWMC 4QOKD 1NQ6A 4ZFZB 1MI5E 3A6CL 5HY9B 4LLUB 3S97C 2XA3A 3VFRB 4JANB 4FFZL 5C0JB 1DL7L 1X5HA 1A2YB 3DNKA 3IFOB 3IRPX 1VDGA 3IF1A 4D0CB 1BYCA 3NCEB 3WHE0 3C9NB 4XX6A 5D5MA 3BUYA 2ADIA 2JCCA 12E8H 5TD4A 4LFHG 4DCQA 4V1DB 1ZWIA 3U7VA 4L3EE 5IBLD 5I16B 3JWOH 5GGQH 5JXEC 3I6LE 4NZUH 4Q9RH 3HRZB 4YDVB 4AIEA 3KR3L 1U8OA 1JUFA 1AVAA 5KS9B 3WD5L 2F54B 1KLUB 1I9EA 3WUWB 3AY4C 3CU7A 4CD5A 4I18B 3WV0A 2NY4D 5CP3H 3ARBD 1PY4A 3GMMA 5EU4A 1HHGB 4NYLB 1BJ8A 3U5UA 2NSXA 3GUTA 5IMMB 4WK9A 4GBXA 5CIPA 2V9QA 3VFUB 1BPVA 3EAKA 1FORH 3D9AL 2PR4L 3N1PC 2ITDA 2D7TH 1FN4B 5I9QB 5BZDA 1CXFA 4XXDB 1HJUA 2CDGB 1I1AA 2NLJB 4CAGA 4KDWA 2IH1A 3SGKC 4DVRL 4FQPA 2X4RB 1CLYL 1ND0A 3I9GL 1MEXH 4KAQH 3V6OA 2CYGA 3FCTB 4UNTA 2PBGA 1TQUA 4APQC 3AICA 3FONA 3PXJA 4MB4A 4IRSD 1XD1A 1MREH 4PCSA 2GITA 4HLJA 3QO1B 1I7TB 3NA4A 2IADA 5L2JB 4RMWA 4HUVB 5KSAB 4XP4H 5MENA 4OLZH 4DZ8B 4UB0L 3ZKSD 1E3ZA 3TA3D 4RIRA 4AH2A 4KJQC 4W7VA 3VI4F 5IG7A 4HD9A 4RBPK 4AG4H 1MHEA 1WEJH 4EQ2A 1P7QD 1IMHC 4JCMA 2IALA 1JI1A 3UZVB 1QFPA 3RZCA 1IEHA 3G6JE 3GXNA 4JZJB 1S7UB 4Y5YC 4ML4A 1J12A 2OTUB 5D6CB 5DUPL 5HHOE 5KVEH 3N1QC 1NBZA 3AYSA 5I1KH 3L5WB 2G3JA 4PG2C 5K59E 4X6FA 4G8IA 3WF1A 2VLLA 4UOZA 1Y7VA 2R8SH 1P4LB 1MFBH 4OB5L 5C09D 5E8EB 1RK1A 3CLFL 5C8JA 3RCNA 4R4ND 4P2RB 4P8UA 1QRKA 1UCBH 1ERNA 1Y6MR 2V7HB 3V0VA 3MTRA 1JFQL 4WY7H 2OLDA 3HI5L 1UWGL 1RY7B 3MV8E 3E6HA 1E6OH 4O2CB 4R2GD 5JHLL 1CDJA 4FMFA 4J3WA 4M43H 2OXGA 4MX7A 4N8CH 1CICB 1YECH 4EIGB 4PSRA 3EO9H 1UVQA 1OW0C 3DLQR 1YQVL 2NMSA 4XNXL 5H8DA 4PRHD 3QQ3A 3GB7A 4D9RD 1R75A 4M8QB 1NBVH 1ZLSL 1SEBB 2X10A 5EU6E 2VRKA 4J3OC 3TZVB 2FLBT 5T1LB 1O7DC 3G6LA 4M24A 4MNHA 4O2EA 3EDEA 3HZMA 1E6JH 1NMCB 1LEIA 2YD8A 5E0FA 1FHGA 2NY4C 2VDMH 5T5NG 3ARBC 3IFPA 2ZUSA 2XG4A 3BDYL 4XX1G 5DTFB 3OJMB 4G6JL 1W72L 2DSWA 4ONOA 2I60L 3QEUA 1AGFB 3BPNB 3ESUF 1DLFL 3UJIH 3I75A 3RGVA 1PEZA 3W82A 5L6YL 3ZIZA 1EO8L 4LLAA 5CXPA 2EH7H 5I2IB 3W9EA 3MRIB 2NX5E 1A4JA 3X12A 5T3XD 3CTTA 4NUGH 3T0DA 3ALFA 3IJSA 1EFXD 1PGRB 4K3HA 4HPOH 3VSTA 1RJLB 1X5LA 4LAJH 3HG1B 4GMTL 2XWTB 3QFJB 3U0WL 2DDXA 4JR9L 4U0RC 1RPQA 4Y2DA 2E8ZA 4NO0D 1EXUB 2X89D 4MA8L 1IGIL 1W91A 2P8PB 2XWJA 1RD6A 4O58H 1BD2B 4XRCA 1LWJA 4HTYA 2XKSA 4N0CD 4UT9L 5SWQA 1QBLL 3VGGA 4N5ED 5I1AB 1WBXA 1C16B 3EDJA 1MRFL 4IRJA 1A6UH 1QRNB 3TA3C 3L5XL 4NP4L 2RR3A 3KYOA 4HWBA 5DC4B 4GZJA 2HMID 5I24A 1M4KA 2F1BA 1YN6B 4XNMB 3ZKND 3BEWA 4NGHL 1M04A 4AENB 1UWTA 5BXRA 4DQOL 1CFTB 1MVUA 5ACLA 3VXSA 1XYFA 2NY0B 3DX8A 3I2CL 5C0BD 3RTQA 5KZCB 1G0CA 2PXYD 4HFUH 3GNPA 3W53A 1I3GL 3B4NA 1MLBB 1JPST 2HLAA 5J1SC 1XHGA 4PJXB 5D9SA 3MRFA 2YKLL 4JKWA 1L7IL 1NCCL 4AEIL 4YAQA 1RJZB 3IXTA 4FZ8L 5FYJE 3EYOA 4R4NC 1IKFL 2IQ9L 3GSWB 3TBWA 4XNZB 4R2GC 4ZAKA 3KPSA 1GUVA 4P3CH 3AGVA 4CDGC 3B6SA 3L4TA 2YC1A 2VXSL 3JZ7A 2P45B 4OZGE 1K8DA 4GAGL 4YGVA 3BMWA 3MRHA 3AAZA 2P44B 1U95A 4WFFD 4U1IA 1XRVA 1H8SA 5E94A 5TGBB 2GTWA 4YWGL 3SKOB 3DXAE 3CZFA 4MDOA 4WCYL 1JF1B 2BRRL 4TSAL 5BO1H 3FN9A 4GRLD 2R2BA 5JXAH 1M05A 5E09A 1K9DA 3NIGE 4JFHE 3FRUB 3MNZA 1B3JA 4YE4H 5EZLB 3ARWA 4CVXA 2K9UA 2DIJA 3S4SG 2ZG2A 2MHAB 1E6NA 1I85A 4W93A 2Y07H 4OIIH 1FBIH 5JIKA 1TVPA 2BVPA 3DVGA 4ZFOA 2BX5A 2HFEB 1XGPB 1EO7A 4HXBL 3OJDA 3VG0H 5CCKL 2WQ8A 1GAFL 4PSPA 4E41B 5FUCE 1Q1JL 2QQKL 3W0WE 2D4FA 1JXKA 3NIGF 4BH7A 3NZHH 3BRDA 2VB5A 4DK6A 4OCYH 3QHNA 1ISYA 1F6AA 5D2NA 2FIKB 2WBJA 3NVQA 1EX0A 1QSED 1ODZA 1W3KA 2J77A 1K8IA 1JWUB 4K7PH 1U2HA 1NOWA 4N0CC 4HUWB 2AEWA 1D5BA 4N5EC 3SDCA 3RJDA 2GFBB 5HVFB 4UQ2B 1YUHB 1MSPA 1NUGA 2F9BT 3BE1H 2DQFB 4P2YA 1S7WA 1XR9B 3RBGA 1RULH 4XC3L 2HMIC 1F8TL 5DK2A 3FAWA 3ZKNC 5CZXC 3RL2A 1L7TH 2APFA 2VRQA 4P2QE 2I07A 1S7TA 3RJQB 5SWZE 1S3KH 3TTYA 1W0WB 3HG4A 3U7WH 4D94A 2G5BA 2PXYC 4BKLA 4XZUA 1TQBB 3HS0B 5DJ0B 8CGTA 1OSPH 5E9DB 3ZL4H 1MHPH 3V7AG 4HF5L 4YDIH 2VTFA 5JIHA 5DJDA 1V0MA 2QSQA 4LL9A 1IC4H 3KWWA 1IGTB 2IEPA 3MODL 2WZEA 3SE8H 5HYSA 3K1DA 2EKSB 4Y7EA 5EZIL 2VDLH 1IC5L 5HBBA 4OZFG 5D7JA 1ODAA 3C2SA 2ZUQB 1FO0B 5CEXA 4QY8A 4O9HH 5D8JH 4HP5A 1WIUA 4QXUH 1N64H 1ZE3C 1E73M 1U92B 6CGTA 1DUYA 1HWGB 1XCTB 2VZ1A 4JQXC 2F61A 1JNDA 5HDBF 4LDLB 2XIBA 2Z93A 3GSVA 1TQSA 1ZK9A 5IHZB 3UXFA 2VVNA 4ATDA 3TIEA 2D7MA 3DJ9A 4MS8D 3MV9D 5C0AB 5FL0A 3QXAA 1N4XL 2AJXH 1MOEA 2X4SB 5GS3A 4ZTPL 3LXCA 5DFTA 1OAUH 5IJVA 4GRLC 1D6VH 1L0PA 3ZYIA 1HYRC 2BVDA 3CUHA 3CX5J 1LLOA 3O9WB 2Y7QA 2EICA 4HWNA 3BOVA 4OLVH 1K6QL 3MJ9H 4XBEL 1W3LA 1R3JA 5F9OL 4B9YA 2P5WB 3BAYA 1C1EH 2VIRA 2B8OT 3EFDH 1VB9A 2A6DB 1ZLUK 3S96B 2XG9A 4G9DB 3VMPA 1AXIB 1PVHA 2DWEA 2X9XA 4BH8B 1AIFA 4K68A 4LVOC 5GGVY 1GOMA 4E8DA 2UZYB 1I8LA 4LPCA 1F4AA 4CRPA 3MKKA 1SYSA 1HHKB 3MJ8B 43C9A 3UYPA 5C0FA 3W25A 4PB9H 2C3VA 5B38G 1LMKA 3GSNH 3O2DA 2HVJA 3WH8A 1B6UA 5DJ8B 1IGYA 2EDBA 4U7KA 1HKFA 3GNMH 4PV9A 1B31A 2W0KA 3RWGB 1TFVA 4NZTH 2DWDA 2VDOL 1MHCB 1ZLSH 1HJVA 3QSKB 1RP9A 3M8OH 5FFLA 3V95A 2E27H 3UERA 2WHKA 1RJCA 2ADJA 3GRWH 4LRIC 3QYCA 5BVJA 1FZMA 4FXLA 1WZLA 4XMPL 1KUMA 1PPIA 5A16B 1WTLA 1RP8A 3LKNA 4JB9H 2EDWA 1K2DB 4NRZB 4HWEH 1QLRB 2PTUA 1MH5A 3CDCA 3WFHB 5GNZA 1F3RB 2CCRA 4Y19A 2Y24A 2XZQL 4FG6D 1ZT7B 3HHRB 3BZEB 3QO0A 2R2HB 1BLIA 5FGCB 4FQLL 3H3BC 5I71B 1T1YB 3UTOA 3KE0A 3MGTA 5C92A 2Y06L 4QXTB 3RIAK 2XFYA 1XGTA 2OYPA 1UADC 2ARJA 2YOCA 3ARZA 1OP5H 2Z8WC 3ME0A 1QOKA 1CD8A 1P4IH 4M4PA 1U8NA 4PBXA 4I13B 5H37H 5DD3H 3GI9L 4W4OC 2UZIL 1GPOL 4DKFH 4JFOA 4QYOA 1EXPA 1HZHL 4X7EC 2XN9A 4XCYA 1R3IL 4Q6IA 4NWUL 4Y16A 4HZ7A 2BJMH 4CMMA 5FA4B 4G6MH 4M6ML 3RWCB 1YPZB 4TNVK 5GNYA 3BEVB 1OGAA 3LRKA 4Z7OE 4LKXA 4L4TD 4B9ZA 1YEJH 3T2NL 4HPYL 4P2OA 1CNVA 4ZUUB 4N90E 4CNIA 4PRHE 4D9RE 1A4KA 2HYMA 3PHOA 4P23D 4PJFF 3R0NA 1YHTA 2GIYA 3BP7A 3BFOA 5ITBH 2WANA 1MIEH 4JFFA 3E0GA 5ESAA 4Z7OF 1GGBH 3L3JA 1F13A 1QFWH 2A9MH 5M03A 4M3JA 4WI4A 5JUEL 3NFPA 4XGZB 2A73B 3QUMH 1X5GA 3L7EB 1M53A 1HVXA 3QIUB 2J2ZA 5SV3A 4G8EB 4PB0H 5GGVH 1ZANL 2V9RA 2A3EA 3K8MA 1BZ7A 4F2MB 3KJ6H 5T3XE 5A2JH 2CLRA 2GI7A 4KUCD 5C0IB 3OG4B 4HCRA 3RM8A 2Y5EA 4JVUA 3MROB 3L3HA 4PREA 1FL6A 1G7PA 1QYGL 5E8DL 1FFRA 3W26A 1VACB 3ARED 1IQWL 4MJID 4X6EB 3VD4A 4MSWA 3SDAA 4C56A 3B3IB 4ODBD 3UTSD 3T4AB 1AD0A 1V3IA 1T83C 2AEQL 1RZIB 4NPYB 4JFED 3LRGA 4BZ2H 1JWSA 4ONGL 1HQRB 2MMXA 4MA3B 3ILQC 3LH2L 4FG6C 2DS4A 4D9LL 5DQJB 2OYMA 3BP5A 2VC2H 2BOBA 3CVHL 4GO8A 1J1XH 1R5WA 5DD0L 3CX5K 1HIMH 2Y5TA 4PJDB 5GGTL 4LU5L 4ZXBB 3F7PC 1UXSA 2CLZA 2XWBB 1HOCA 2QADD 4K7FA 3QCUH 4KXZH 4XZWA 1FCGA 4Z2KA 5EB9A 5C0BE 3A6BL 1GJIA 5E5MA 3UTTA 4NC2B 3RKDD 1FVDA 1ZS2A 1GQJA 1PX3A 1QQDB 4XB3A 3S7GA 4JO4L 5IOPB 2ZX5A 3FMGL 4LF3A 2B1AL 4MXQD 3VXQB 1E4WH 1WCQA 4I3SL 5D2LB 2DQIH 3DRQA 1UR4A 4BZ1L 2AK1H 3QJFA 3V5HB 5M17A 1HXMB 5EN2B 1IT0A 4JFWA 4X4ME 2IGFL 4BFGA 3AZSA 1J8HE 3D25B 1AC6A 1XH3B 4TRPL 2XIDA 1QVOA 4OCNC 4Y4HA 1F02I 4P23C 5F21B 2CERA 5FUOH 3GSOB 4AWEA 3NMEA 1I1FB 2AQ2A 1JE6A 5IK3A 4YQXL 5IBTL 3OF6A 3D48R 1RZKL 3OIHA 3Q3GA 4NO3B 4X5LA 5EZIH 1I75A 4JY6B 1IM3B 3QR3A 3QHMA 2DL9A 3D1MC 5GJSL 1MCOL 1PKQA 1HCVA 2PO6D 4LHQB 5J13B 4GG6A 4MAYB 4ODWA 2VNCA 4UQAA 1IGJA 5DFAA 1NFDB 2FJFB 4NCDA 1MJJA 4MD4B 1JHTA 3WMBA 1VKXA 1ZSDA 5BJTB 5KN5B 3WLBB 2XQBL 1N2RB 1XGRB 4Y4FD 3W6MA 1OCWL 5A6JA 3AREC 3GJEB 1LE5A 1O0VA 4YBQD 3IS0X 4Z2IA 5LQBL 2VISB 5D1QD 5F7UA 2DAVA 4IJ3C 5C3TA 1E0XA 3S3JA 1AXSB 3TIDA 5IFTA 3MX0A 3DDGA 1NP0A 2GK1B 1V3HA 1ED3A 1KR1A 5BS0D 4EIZC 4X4XA 4LASH 4UT6H 1DVFB 2DM3A 4GJTB 3BWAB 3VNYA 1HN1A 3D69A 2A83A 4ZFGL 4U6VL 1W0VA 5L8LB 4HBCL 2V3FA 3CC5A 2WIIA 2QADC 3GMNB 4MDJB 2AJUH 1KXVC 2GK2A 2Y36H 1N8ZA 5FB8A 1Q6CA 4ZNEA 4WUKH 3QXDB 3S88L 4Z2GA 1Z3GL 1HKJA 3PZQA 3RKDC 2NNAB 3QWOB 1ZHKB 3CMOL 3UC0L 2H8PB 3HNVH 2WLYA 3STZA 3I6KA 2B0SH 2EIDA 5DMKA 3O6KH 2ZP0T 4P46A 4HOXA 1FGNL 5EBWA 2JB5H 1EVUA 3U4AA 1AC0A 4DTGH 3JV6B 2W0PA 2Y25A 3HG5A 2H3NB 1CEOA 3SCMA 3L2MA 1M03A 4HPHA 4Z2JA 3A22A 4NHUB 1O7AA 5LXGH 2FEEL 2C3GA 1TA3A 1WUNT 3QUZB 3U82B 3I85A 4U1HB 5HGAB 1E15A 4QF1B 3S5LA 1TETH 4DUVA 3MV9E 1NM9A 4TVCA 2BERA 4NN5C 1T0NB 2WLZA 2F5BH 4PJIF 5HGHA 4NJ9H 2APBA 4U33A 1VJZA 3OXSA 3W5NA 1VGEH 2PO6C 5E8NB 5E5UB 5DVMA 3WKNA 3WCYA 3HU7A 5IMKB 4OFVA 4C4KT 2HLFD 5EA0L 4H7VA 5GGRY 2UUDH 4L9LC 4MA1C 4QNPF 1DEEA 1I1YB 1BLNA 1ZA6A 4KJPD 1ZGLM 1JZ7A 5FCZA 4PJ9B 4XAKD 1T04A 1URLA 2D20A 3V5DB 1HP5A 4XWGL 2DTMH 2DYPD 1QSFD 4PMNA 3O0RH 4MHHI 4PGJA 4Y4FC 3BUDA 1A7PL 5F7EH 4K2UH 4X7CC 2RQ8A 3JVGA 5DC9B 1MRDH 4OFYD 1AFVL 4YBQC 3VKKA 1GRWA 5DRXA 5D1QC 4OAWA 4TN9A 5HHPA 3AFLA 1GGIL 5BZWB 3U7BA 3S4SA 1RMFH 4LSUL 3PGCA 2EACA 3B5GA 1S8DA 1HH9A 1OGSA 2AEPH 1AHWB 3IXAB 1MCWM 4ETQB 3QULA 1FL3A 5HYJD 4MA7H 2OSLB 4LLVA 1OAQH 1N59B 2E3VA 3MRGB 3BVUA 4PJ7A 4MHHG 1FNEB 4Z7QE 3IJYB 5BRZD 2VDKL 3MYJA 5IB2A 2EADA 3FOMA 4WJXA 1JNHA 4K23L 5E1AB 1T20A 1E43A 2ZPKL 4KRPC 1EEQA 3PQYB 1NCWL 3MUJA 3T8XA 3W9DB 4KWUA 3K2UL 5JLZA 2O93L 5AYIA 2FSEA 2CDEB 5IT2H 3D3VB 5IB3B 2I26N 3L7FA 4AM0A 5JW4M 4I4WB 3WXVL 1E71M 4FMVA 5EUOE 3PWUB 4YNYA 3C5ZD 1H15B 3CFEB 3NFNB 3PWNB 3DSNA 4RSVA 5KSVA 2OZ4L 4FS0A 5F7DB 1HP4A 4X80L 4W6WB 4I5BA 3QNXB 1GZPA 2YSSA 4WIQA 3FB6B 1DDHA 5J6GA 4YHPA 2DJ4A 5F7LB 3WFZA 3QZWB 5E08H 2E7LC 1BG9A 4LU5H 1XGUA 1RH9A 1CIDA 4TPRL 3J8F7 5EUOF 4OZFA 1YEDB 5IESH 4PJAE 4LLWA 5F71A 4L4TE 4KH2A 4NQDD 3UMTA 3P2TA 4E8CA 2HLFC 3MI6A 3CFJA 2AI0H 4XXCC 3ZMRA 2DD8L 4PUBH 4KDTA 4PGBB 1YEEH 3VGAB 5E95B 3FT4B 3L6FB 3ES6B 4ACZB 2FH8A 3MNWB 4MJ5B 3OB0K 4K3GA 3K3QA 4N5UA 3H9SB 2MNUA 4RNRB 5I1JH 1KEML 3STBA 1J0YA 4R96B 2XTJC 4N0FA 4OCXL 5DD1L 5J12B 4HIXH 4RQQA 4NJAL 3MV11 3C8KA 4ODSH 3AIEA 3CLEL 3EO1B 3S35X 4NHCL 2CPCA 3WXWH 2EAEA 1GGTA 3SUUA 1EOKA 2P8LB 1LD9B 5JORA 4UOW1 1U33A 4PRIE 4Q74A 1HI6B 2AJYH 3MXVL 1DQJB 5IWLA 1G9HA 1PJ9A 1R5IB 2CRIA 3P30L 2YDSA 1PLGL 1KJ3L 1UD3A 4ELMB 4OF7A 3JTSA 3IFLH 4I1NB 5DEZA 3MMWA 2BOCB 1MRCL 3HNSL 1L6XA 4KI5D 4RAVB 2AJ3B 3FT2B 4MJIE 4KKAC 1K6AA 3MV7B 1DQTA 2XYCA 2JJTA 4U1JB 2DQHH 3QCVL 4XPTL 3UTSE 5L8KB 5BRPA 5DJ6B 2XSAA 3EJTA 2FD6H 1QHOA 4JFEE 4ZUTB 4WWKA 3QCTL 3TO4A 3F7RA 5B38A 4QHUB 3LRMA 4DWSA 2HJKB 4KV5E 1GOGA 5AZEH 3OXRB 1I9RH 4P0DA 4E42B 2VQ1A 2YPKB 1QD0A 4JFPB 2H26B 4WTWA 5TPWH 4CMHB 5FK9B 4V1DE 4Z7UA 3VI3F 1LO2L 1VFBA 4Z0BL 3KPRA 3C5ZC 1DFBL 3U0TA 1WK0A 5FCUL 1NCDL 5DRNA 2WSPA 2CH8A 3CGTA 5DMYA 1CECA 1NAKH 3TBTA 4RZCB 1U3YA 1ZVSB 5DJYA 2BY0A 4YBLB 4OT1L 3RDKA 2DLHA 3LPOA 4GRWH 4PMUA 3RDTB 3QIBA 4TVPL 5MI0B 3UP1A 3RUGB 4IDJL 4XP5H 3P4OA 3IDMA 4KK6D 3IFNH 3OKEA 4IRZH 1C08B 3FRPG 2PYFB 3DGCR 1HK6A 4MTVA 5BW7A 3V4UH 1Q9LA 4OGAD 5KS9F 4UFJA 3WELA 3EOAA 1FRGH 4NM8L 1LEKB 2DJUA 4YHZL 3P4LA 3G04B 5DQDL 1I3RA 1RUMH 3IS1X 2G60H 4X99B 4TSCH 4PV8A 2AJZA 3WFCH 2GFTA 3GJFK 1HE7A 1P6FA 3QJHA 2K1MA 5ESQA 5I1GL 4QFUA 2NW0A 4X7DC 1C93A 2N1KA 1I8IA 3BGFC 3FOLB 4MJ6B 4H26A 4UDTB 3CUIA 2VLKD 5SV4A 4M3KB 2R56L 1CFNA 2CR3A 3MLUL 1E9LA 2LV4A 5E7BA 3MYZA 2VH5H 4Z95L 1HCFX 2H6PA 3Q2CA 1LG2A 3QDJB 1H5BA 4ZFFA 1NWSA 1CFQB 3F7YB 1BVKA 3GHBH 1ACYL 4M1GH 1N0XH 4U1LA 3BLPX 4PJGA 4KI5C 3UTQB 4S2SB 3Q6FB 3PWPD 3QDAA 4PGCB 4N0YH 4KHTH 5DJAA 5HDRA 1E55A 1HXJA 1B4JH 2ATPA 3SE4C 3F6LA 3O11A 1FH7A 4P2RE 4M61A 2R1YA 3C5JB 5CWSB 4KKCC 1IGCL 2GQHA 2NXYB 5BS0E 4PRDB 1ES0A 4XCFH 3NCYS 5E6IB 4R7DB 4LYQA 2UY5A 5DHYA 4ALAH 5AYBA 1VEPA 5F6IB 3NN8B 1G84A 2X4OA 4KVCL 2GVYA 1F58L 2FGLA 1X4YA 4Q9CA 4PMYA 2Z31B 4Z5RB 2V3DA 3HZKB 1ZS8A 1A6VH 2GJ6A 2I25N 3STLA 5CJQL 1UKQA 1RV6X 3NZ8A 1OAZH 2VQTA 4KJYB 1NAMH 3FFCA 4OF6A 3QHTC 4MB1A 1RUAL 2CK0H 3MO4A 3BZ4A 4LHJB 2YIHA 4LHUD 1WISA 3BKJH 4JHBA 5I30H 1CD1A 1S9VB 5ECJE 2WWKT 2XFRA 4KK6C 5L2KA 3C09C 5MERA 5BOPA 5TF1L 1IZKA 4PJ5D 4Z77A 3FO0L 5DLML 4URIA 3WDRA 4OGAC 5DZOA 1C8XA 3IAQA 2RGMA 1OGGA 1ONQA 1AKJA 1X5YA 4HDIA 2WVVB 4LEOA 1AY1L 4JPKL 3SBWC 4S3JA 4HHAA 2XZAH 3K7UA 1IARB 4S1SH 4MCYA 4D0BA 1QI2A 5ESVB 1B2WH 1W72B 2DQGL 1U93A 1RSFA 4BYHA 1FNAA 4HUUB 1P9MC 3OR7B 4FFYH 4ODHH 3TBYA 4M9OA 1OT1A 3N85H 4AIZB 3BIAX 2EEDA 5GXBB 2ZG3A 4X7FC 3O3UN 2VZVA 2GYSA 2Z92A 1L8NA 3ZE1F 3BD5A 1T89A 4FNUA 4XAKE 3PGFH 3BPCB 4JZNA 4MXWL 3WL1A 1B0WA 3C6LB 1NGWB 3ZM8A 1PG7X 4IOIA 2BNRB 5TE6L 5D1ZB 4HH9A 4EOWH 1S7SA 2R9HD 3PDGA 1CXKA 5EBLA 1GNXA 3NTCH 4ZE5A 2FH6A 4OF0A 4WFGD 3A23A 4PTUB 2VUYA 4WDIA 1EHXA 2XPGA 1W9BM 5HPCA 1MCCA 2IBGA 1K5NA 3E8UH 4OZIE 2OLHA 2CLVA 2NYYD 5GSRA 3GSXA 4PJXE 1DP0A 4K94C 5DVKA 3TT1L 2EEAA 3OAYH 3VFNB 3GH5A 3K4AA 1JNJA 1AGEA 2AABL 3DI3B 5KVGL 1CL7L 1V7NL 3WIFB 3P0VL 4G8GA 2K7PA 4LCWD 3L9RA 1E28B 1MFDL 2WHLA 1XSJA 1AGBB 3ARPA 2VLJB 3BPOC 4HU8A 2FZ3B 4U1NA 4F7CA 3VXRD 3MCG1 1WGOA 5HYJE 1F3DH 2O9RA 3ZO0A 2OMNA 3EYPA 4PJXF 3W11D 3JV4B 1RVFL 5BRZE 1T22A 4UTAH 1DHKA 2FHFA 2ZNXA 1W2PA 3DYPA 1UR1A 4H8WH 3DO7A 1OTTD 4NKIL 3SY0A 4U1KB 3CUGA 5JZ7D 4MZ3A 4PP1D 4AZBA 2RCSH 1IM9D 4H5SA 4F15C 2PTTA 5BXFA 2NXZB 3IDYC 3QUMB 1L9NA 4QRUB 4O2FB 1IQDA 4Y5VC 1KPRA 4WI6A 4EI5D 5EC2B 2EDEA 1KJ2L 4Q6YA 4H41A 4ZPVB 5I66A 1YNKH 1Z5LB 3OKLB 3MUIA 4JFDB 4NZRL 4JQIH 5HSFA 4H8VA 3TN0A 2FIRT 2E9WA 3CC1A 4JY5L 4M82A 1A14L 1NGPH 2P8MB 1OP3K 3KXFB 2W61A 1BBDL 2ZICA 2BDNH 2Y8KA 4OIAA 5CZVH 2ICWI 4ZS6D 5IEHB 1I1XA 4BSWA 2CUHA 3EUUA 3IGAB 4NO5A 3RKPA 3DUSA 1AI1H 4Z6AT 1HSBB 4JAMA 4H20H 4YBHA 4QHKJ 1KPVB 4LMQE 1W3JA 4NRRA 4NQEA 4P7RA 3AU1A 5IB1B 4NQDE 1DWHM 4FK9A 3IDJA 3A21A 2FECI 2YWZA 3WQ4A 1JGUL 2R0KL 4LOUD 1QP1A 4LSQL 2EDFA 3DHJA 3QFDA 1KC5L 4WI3A 4D0DA 1WP6A 3BXNA 5D7LB 1Q8MA 4KGLA 1Q6DA 2R9HC 4ISVA 2DT2A 2LVCA 1WDPA 3BSGA 5A8QA 4W84A 1A7NL 3WH5A 3ULVE 1NL0L 2A1WH 1U36A 4JVPA 4BQ5A 2DF3A 3O6MH 2NYYC 2HT2D 2BNQA 4XCCH 4GUPB 3RWIB 1I9IH 2OQJB 5TFSL 4DO4A 1VPOH 2FYYB 3MMEA 1G7HA 4YXLL 3MA9L 2DQDL 4DVBA 3MV8A 3UBXI 1QKZH 3AS0A 2HRPH 3KPLA 3O3BA 3FB8B 1RU9H 1J0ZA 3CMJA 3PABB 3F7VA 5CJOH 1FFQA 3BQUA 3ULVF 1JGVL 1G7MB 3AS1A 3VG9C 4WI7A 1V6UA 4JO1L 1G9ML 3W11C 4CU8A 4HS3A 4R0LC 4BM7A 1TR1A 4MVBD 3VIHA 4PS4H 1JFXA 3KNBB 3T0ED 5EU6A 1V02E 1HINL 3ARDB 4HK0B 2DQTL 2GSIB 4KRPB 3EZJB 3T0BA 1OTTC 4JDTL 4UTBL 5A1AA 2A9NL 2AXFB 1VADB 3PL6B 4QTHB 2GW5A 3NCMA 5JZ7C 4PP1C 3VFVB 4P7OA 3HAEB 4UV4L 1ZLUH 4DUXA 1MCNA 4D72A 5JW5B 3MRLB 4EDXB 4N0UB 3UBXG 5C6TH 4EI5C 3GMLA 2APWA 3X3FH 2NX5A 4HGWA 1HHJB 1MFNA 4YO0A 3VH8B 1E4NA 1KB9K 2YL6A 3WIJA 4D9QD 5AC4A 4GMSL 4HLZH 4I0PB 4XC1H 2CDFB 4X9IA 3V5KA 4DGVL 3EOBB 3S36L 1LL7A 4K8RH 3IU4H 5HHVL 2FATL 5E2TH 1KBGL 1TCRA 3F12B 5IIEA 4YPJA 4YDKL 7CGTA 3AB0C 2EYTA 1Y6NR 4M7LH 2UWEB 2PUQT 4NQXA 2IMMA 2OR9H 4J8RA 4PJEB 2F8VA 3GM0A 1SBSH 5JO5A 1LEGA 4DKDC 3NA9L 3OG2A 3CPLA 2BNUA 4UFMA 3WN5A 2MPAH 3OAZK 2R15A 1JGDA 4PG9B 4GW4B 3WJLA 1CE1H 3DRTA 4LOUC 3PIQB 4X6CE 2NT1A 3GBLA 5BMFH 5J4MA 2GJPA 5LBSH 5LGHL 4G8FA 4MDPA 3WS3B 3DX7B 1TZGH 2VN4A 4TNWF 4R5EA 3T65A 2ADFH 4Y5XB 2X4PA 4IIQC 3QH3A 2XTJB 1AR2A 4E2OA 2VAAA 5DC0A 2J6EA 4H8WC 3OZ9H 3UETA 2FEDD 5CG0A 1UM4H 3O6FA 4Z0XA 1FE8L 2HT2C 2VLKE 1UFUA 2UYLB 5FGCE 3D3VD 5EO9A 2VC9A 2J7CA 3UYRH 5HYIA 1T1XB 1Y0LA 4I2XE 2BFVL 1KCUH 1XIWB 3BKCL 3AIWA 2V5RA 3FW6A 4JAWA 1MQPA 1A3LL 2VWEC 1JAKA 5EFFA 2OXHA 1I8KB 1U91A 4GKZB 1G9EA 1G94A 4LPVA 3AVEA 2XKUA 5IF0A 1DBJH 5BV7H 3ULSB 3U2SA 5BRQA 3WY2A 4K8RD 3ZZ1A 5J3HD 3WIHL 1WQVT 3PWPE 1U58A 5IW1A 4PP2B 1EIBA 1M7DB 2W9EL 1MYRA 4NZJA 5CHNA 4QT5B 4JFVA 3L3DA 4GRWE 3WKMH 5DSCB 1J8KA 3LN5B 4RGNB 2K3TA 3VD7A 3HA0A 1LL4A 1F4YL 1JGLH 1MCKA 4WI5A 4O02L 3DO3A 4LNVA 1S7VB 4PJCB 1SY6A 3U4EB 5I8CB 1JMXA 3MRMB 2NW3A 5IM7A 5I1CH 4PUEA 1UJ3C 4W86A 1BGXL 2V17H 3B9DA 5M7QA 4X98A 3WL9B 1MVYA 3WH6A 2JIXB 1CLOH 1E5JA 1KB5A 4XUYA 5I3DA 4MGXA 3UJJL 1YPZF 1S9XB 2MTPA 1FNFA 1U3HA 4DK3A 4GLRI 2WUCH 5FF6A 1TJHH 1U8IA 4KY1L 4N8VB 3T4YA 4F9PA 4FLQA 5LAXA 4KMTL 2WAGA 4H25A 2X9YA 3MRCB 5HPMA 4LIQL 4XI5D 2R39A 2Z35B 4K71C 2DM2A 4PJ8A 1KTBA 4C7GA 3G5VB 2WHMA 3U9PL 4GXUM 5GISL 3TVMA 5HDQH 1HHIA 1TPXB 3MLRL 1I1AD 5IKCB 5CFHA 2JEQA 4XPGL 5IR1B 2CRMA 1LK3H 4PJ5E 3TONA 4Y0GA 5E7FA 5JNYA 1IEAA 2O9TA 3MRDB 4C83A 4LYRA 2H32A 3BRGC 5ACMA 3V6FA 1TQVA 4RWHA 5A8PA 4G3YL 1EA9C 4KUZL 1BFTA 2LFGA 3OGVA 1QWUA 4JZ5A 3DX2A 4QEGA 2XACC 4TOQA 4G80A 3QIWA 1FC2D 3OKYA 3VXNB 3CZJA 5EOCJ 2EDYA 3BGFB 3DSFH 4PTTA 1DZBA 2FEDC 5ID0A 3GHEH 3A67H 2BHYA 3LKOA 1I9JL 1FYTB 1GC1L 3RX7A 3T1FA 3S34L 2FGZA 2MQ0A 4ORGA 4HQQH 1R34A 1IAKB 4OGYH 1MF2L 1NFIA 1F6FB 2DIAA 3CFKB 4NZRH 3WHXA 4F3FB 4FQXB 2NY7H 1NC4A 1QWNA 1NJ9A 3O4LB 2PB1A 1JRHH 3GXTA 2JIWA 3DX0A 4ZSOB 4P4KA 4HUNB 4WFGE 1I3VA 1RUPL 2X1PA 1CF8H 4K8RC 1C7SA 3LMJL 4PJDF 3DI2B 1UA3A 3EYSL 3CVHB 1CDHA 3SCNA 3OR6A 5D2LE 1IFHL 2J4WL 1WZ1H 1NDMA 3ARFA 2V38A 4ZQKB 4LCWE 1DQLH 1LO3H 2R23A 4HWBH 5EBMA 5JW4R 3U7YL 4MD0A 3ZTNH 2I5YH 2NR6D 4LNRA 2RFXA 2Z91A 1QR4A 1BGGA 3VXRE 3ZKQD 1GONA 2DQCH 2C7FA 3ULUF 3K1KC 4JRYB 1P4BH 2R0ZL 3WSQH 4NC1E 3D87B 5D2LF 4JPIB 4QGTA 3HC0B 5GGRB 4NRXB 1PW3A 4K3DL 3X11A 1E3XA 2W59A 3HE6B 3GBNH 1YNLH 3GMOA 2IAND 5DR5H 3WFDH 3U1SL 2Q1EA 4GBXC 4XI5C 4YFLF 3RGVD 3MLZL 4UFLA 3BVNA 4XCEA 4P4RB 1UM5L 3MREA 5F3BB 2MSPA 4OJFH 5C0CA 5JW3L 3NAAH 4P3DA 3ROOA 1I1AC 1RZGA 3BUBA 1BYDA 2VX4A 3CUFA 4HH8A 4HJJL 1CLCA 1NUFA 3N9GL 1BEYL 4DJMA 1AGDA 5E2VL 4IRSA 1WKYA 1H3PH 4Y2DD 4KI1A 2HH0L 2ZX7A 3G5XA 2APVA 3MO1B 2O61A 1BZQK 4BQ2A 1JNLL 5DK0B 1CFSA 4UIMA 3RWFA 1NFDF 1NKOA 3WUWG 5ADOH 3SKMB 2YUXA 5ADPH 2WNWA 1EMTH 1B30A 4IRJD 3AZTA 2ZX8A 3SKJL 3BYTA 4HU0A 5ILTL 3BIKB 1NEZB 3RNQB 3GM8A 1WZKA 4HKBA 5HHVH 3VXSD 3RZCC 1F42A 3C60A 2QR0B 5HGGS 4ZUVA 1SM3H 3RTQD 2Q3AA 4U49A 1LO4H 4ODUB 4BQ8A 4YHYC 5DZNA 3TYFA 3W39A 1JZ8A 1T2QH 1KULA 2CBUA 3LS5L 1V6XA 2RGLA 3FFDA 4LP5A 2HTLD 1YEFL 4PJFA 3GNOA 2VLRA 3AROA 4UTFA 1IC7L 3ZJKA 1E1FA 3QNZB 1OIFA 3OGCA 4ERSH 4ZAKD 3KPSD 2IPUK 4GW1A 3WHE1 1H1NA 4PRNA 1YNTB 4DAGL 4KRMB 3X3GL 2X4QA 2HISA 5DEGB 2XFXA 3RJYA 3MBXL 3SCQA 1IBGL 1AJ7L 3LXBA 1XT5A 2XN1A 3D5OF 5FDYA 4KDVA 5A69A 4K3EH 4QTIL 1K85A 3K46A 1D5IL 2V5DA 2OS7A 3MCLH 1G7QA 3T0EE 2C1PB 5BWFA 3HMXA 2J25A 1OM3L 3CDGA 3LXAA 2WWDA 3IDGB 2YMXH 2FX8L 3EYUH 4FQJH 3KLLA 4GKNA 4CU7A 2NY2D 3GMPA 4WV1B 5B21A 1HILB 3PTMA 4AZ5A 1BVLA 3DWTA 3MR9A 3QA3B 1S7RB 4YEEA 1T5XA 3RGVC 3EOTH 4M00A 4PY7B 4NWTH 5CGMA 3IDUA 3KL0A 3B8YA 5GZOD 1KCVH 4TVDA 2GT9B 2IQAB 4ZTOL 4OGZA 3LX9A 1BREA 1GGYA 4KTEH 2ZUXA 4FHBD 4EUPG 7FABH 3C6LD 4D9QE 2OWCA 3VO0A 1GCYA 2YJQA 4GW5A 2G75B 1RIHL 2EC9U 5AUMA 5LYRA 4X6DB 1X5KA 1NMBH 4L4VB 2Q76B 4GS7C 4K9EL 1NCAH 3QXWA 5DJZA 1I1RA 1UZ8A 4Y2DC 2EDRA 2WBJD 4L8SA 4G6FB 4X4ZA 3DTXA 5CSBA 4GAYA 4CD7A 1ORSA 3M1BB 2APTA 4CVZB 2X89A 5CEZH 2EE3A 1NDGA 2JELH 2H9GA 3OKNA 2ZCKH 4EN3A 1FJ1B 4OGXH 3SDCD 2W0FA 4IRJC 4P57A 5K9KA 1YMMB 3KS0J 3Q0HA 1DBBL 3WY3A 4KZEL 3LQZB 3KYKL 2BC4A 1MWOA 1E6QM 4XVSL 4L29B 4PJBB 1NGYA 3RPKA 1LDPH 3RHWF 1JK8B 4YUEH 3MRQB 2I9TB 5IQ7L 1KTKE 3V6ZA 3RTQC 1L0YA 1OB1A 4QCFA 2OWXA 3OGOE 4JKLA 1T1WB 3VXMB 2HKHH 4OCMC 4WI2A 8A3HA 2EECA 1Q0YL 5DEFA 3M46A 5BVPH 3IJ9A 3O2DH 5SWSB 1UB5A 2HTLC 2AW2A 3I3EA 4LSTH 3BISA 5EULV 2OSWA 4S1RL 3D3VE 1G7LB 1N5AB 4EVNB 3FO1B 4ZAKC 2X70B 4NFDA 4QHLA 3FHQA 1WIOA 2HN7B 5TQ2H 2XY1A 2FYVA 2YFOA 2XJ7A 3DC0A 4X4MA 2CRYA 1J8HA 3ARGB 4QRRB 2QHAA 1XF2B 2XYLA 4N1EA 3VG9B 4Z8FL 5E2UH 2X0YA 4YK4B 2EBNA 4Z18A 3DMMA 4R0LB 1NBQA 5ANMA 4LPXA 3AXHA 3HE7B 3KG5A 2DTSA 4ZUSA 6TAAA 5CEZD 3Q5YA 4YPGB 5H35A 1NWUA 1FFNB 2NY2C 4F58H 5DS8B 2IFGA 3PZIA 1G7IB 3HCVB 4J6RH 3DV6B 2E7MA 1I85C 3NPSC 4B7LA 2X4UB 2P7TA 3KPQA 5D5ME 3WJJC 5ITFA 3H3PL 3G6AB 4PMRA 2ZOLA 5GZOC 4JRXA 1H41A 3ZJ7A 5FIEA 4NSKA 4G9FB 3RU8L 3DX9A 1WIPA 3P11L 1E4KC 4HGMA 3OLDA 4YHIA 3THCA 1LO5B 5C0DB 1JL8A 2OJZL 4PRAB 3CH1A 4UQ3A 5D1XA 4FABH 1MCFA 2IXVA 3H9SE 3S3SA 3INUH 1WICA 4CVWA 2WAHA 1OAYH 4KJWD 5D2NC 4JFZL 2WBJC 3H0TA 4LSVH 3LRSB 3LY6A 2F53B 4NRSA 2QHRH 3RPMA 3NBNA 5EOQL 1ZVHA 5HJ3B 5EWIH 1WC7B 4X7SL 1HNYA 5AYUH 1KTDB 3KLAB 5B8CA 2CKBA 3UBXA 1JZ2A 4G7VL 1W1TA 1XR8A 4R4BB 2D9QB 1U30A 5FD0A 3DBXA 5F3HB 1UH3A 4WIWA 4XMKL 1FPTL 3UPRB 3H53A 3V6OE 4RFEA 3REVA 5C9JA 3EDDA 2DKUA 4NKDA 4P5KA 1Q94A 1RUKH 3VE0B 1INQB 1JHLH 3O4OB 3ORJA 4KVNH 3AJ7A 3MV7E 4XH2A 4U1GB 3TT3H 1G6RL 3F5KA 4G6AD 5TDPB 1IEBA 3TLRA 3EZ8A 1G5AA 2J7FA 4JO3H 1UUQA 1U8KB 4Y19D 4U7SA 4AC1X 3VIOA 3TYGH 2BVQA 8FABB 1T21A 3P4NB 2EZ0D 3VUPA 1J01A 3VXUB 3HLAB 4HX1B 4LLYA 4LLQB 4ELMF 2AMGA 3KPNB 5D7JC 2Q7YA 2QKIA 4FXGB 3GO1L 1Q9KA 3QUYA 1JPFB 5M5DA 4PJIA 1RZJL 3L3GB 1BEYH 2D22A 4HCRH 4JHZA 43CAB 2X1QA 5I23A 3REWA 3DURA 4YDJA 2AXGB 4HWZA 4P59L 5F7HA 1MW2A 4OCWL 4RE2A 2VDPL 3WE6A 2C0HA 1NGXA 3SCRA 5JDJA 3RY6A 2XN9D 1KIQA 1T2XA 1D6EB 5CJXA 4R4FL 1KN2H 4Y16D 4F9LA 3BP6B 5E4EC 5EORL 2LTQC 3CFBB 2GAZB 5LCVH 2DLEA 3A4WA 1JN6B 3CVIH 3KJ4C 4IOSD 4KQ4H 2VXQH 1VEOA 3C8DA 2WUBH 3H3KA 4HIHA 3RUGE 4P9HH 4C7FA 2ENYA 1OGAD 1OGBA 3FQTA 3GSUA 5FYLL 1T03H 3GK8H 5GS0H 4ODVL 3PV7A 5LGJA 25C8H 4P2OD 5J9PA 4DN3H 4G5ZH 3IYLW 5IQ9B 2A3BA 5FYKH 4AMCA 2VXTL 3D85A 2P47B 2ZWYA 1MJUH 5FOJA 1W1PA 5J6HB 5GGUA 2J1KA 1YC7A 4JFFD 3RUGF 4WU5A 1I8LC 4AIUA 4Z2HA 1MFCL 4KJWC 3ESVF 2KUTA 1NBYA 1RIUL 1YYMH 2IANE 4B3LA 2HG5A 2AP2A 4OZ4B 3TJHC 2WINB 1IAII 4DO6A 3RJXA 4HAGA 4F7MB 4LFHD 3FB7B 1WZMA 1TQCC 5DMIH 5IBUB 1B2YA 2L7UA 1QPKA 3DROA 4DWHA 5D70L 3PDOB 5MEQB 1IT9L 4Y1AB 4F57L 4TUKL 4WFED 1N0LA 4F33B 3P9LA 2F18A 3TPUA 3BYYA 1RHHB 3SDAD 4C56D 1JZ4A 1D5XB 1A6TA 1X5FA 3OPZL 4LKCB 5J1TC 3EYFB 3NCOA 4FFVD 4G6AC 5C9KA 1SMOA 1J87A 3U48A 4JY4B 1FHLA 2EZ0C 2XTLA 1YEGH 5D7KD 3VFOA 3MOBH 5ERWA 4XMLL 2DQXA 1TVBB 4D8PB 2VDQL 3WFEL 3PHQB 1JCKA 3CK0H 3T3PE 1H4PA 4XPHL 3D2UB 4MWFA 3GMQB 3A47A 4UUJB 3IDXL 1FIGL 5EUOA 1N26A 3JUGA 1LQSR 4M6OH 5ID1B 1QBML 5MEPA 3VA6A 1MELA 3D0VA 3UTTD 1BOGB 4MNGA 5DWUL 1JPTL 3RA7L 4YZFF 1RK0B 2ICEA 4MCZB 1CVSC 2JB6A 4JHOA 4ONHA 2AJVH 4Q6IC 4RFNB 4XNYL 4XP6H 4Y16C 3ZE0E 3DVIA 3MACH 3EJRA 3T3PF 5C08A 1M6OB 3MLYL 4M93C 1E6ZA 3IETB 4J3XA 5IFAH 4YDLC 2C1OA 1HWWA 3KPSE 4BA8A 3QNYB 1CI5A 1UWUA 2JE8A 4JKPL 1T1ZB 2OL3L 5CKGA 3K4DA 4WUUB 4QLKA 4P2OC 1UACL 3L1OH 2GJZB 2J8UB 3SE9H 4BQ3A 1EQCA 3L3OA 2CMRL 4Y4HD 3TFKD 2XVKA 4DEPB 5I0ZA 3CZSA 1FVEA 3BKYH 3GH7A 1F6LL 5BXSA 1HSAA 2D31B 2P42B 1OHQA 1J0KA 2WK2A 3OF6D 4HUKB 2EDQA 3HI1B 4YEFA 1CLZH 1OBAA 4U31A 2R0LL 3MPCA 4L1HA 4QRQB 5GRJH 4FNLL 5FECB 1A1MB 4PN2A 3N9KA 5I73B 3UG3A 2CGRL 5IGXH 1JNNH 5HYQB 3VWKB 3LVEA 3UJTH 2BVYA 1I7ZA 3RWHB 3MGOB 4PEEA 3IDNB 1BWWA 4PRIA 5D6DA 4P7NA 4R90L 2VITB 4OM1H 4CADA 2FR4B 5EO0A 1Q9WB 4L5FL 5FKAB 4KFZC 1GOFA 3P4MA 3VNZA 2VO5A 1U8PB 3RPIB 4Z7NE 3FQWA 2ED8A 2MANA 3SDAC 3Q1SL 3BKML 5BV7B 2JF7A 4YHML 3CXDH 3JWDL 2E7BA 4J3SA 2IGTA 4FFVC 4ZFZA 4OF5A 5HY9A 4LLUA 5MENB 1JGIA 2ZKHH 3VFRA 4JANA 4LHUG 4AY0A 4JREB 4YHKH 5C0JA 4P9HC 4KZDL 4HUXB 1A2YA 3IFOA 4LCUB 4D0CA 2GTZB 5IHBA 4HUMB 5GS0C 1SQ2N 5A6SA 1WBZB 3C9NA 1QLFA 4RFOH 4JO2H 3GIVB 3L4YA 1WWWX 4V1DA 4MQTB 3RO8A 2WP3T 4ELKB 1EUUA 5I16A 4CBPA 3VTRA 5EU7C 3OQ3B 4EBQH 1PBGA 3HRZA 4YHYB 4YDVA 4NCC1 4XVJL 5KS9A 5I1EH 2F54A 1FDLL 1KLUA 3CIQA 5DJCB 2FO1A 3WUWA 4NKQB 4OIFA 3QPQC 4XWOD 5GS1B 4I18A 5J11B 4RL3A 4L8BB 1HHGA 4HA4A 5LVEA 4NYLA 1FCCA 5IMMA 1O7VA 4X0KB 3TV3H 3SCMD 4OKDA 3AYRA 3VFUA 4RMQA 5DT5A 4BJLA 3OGSA 4WWID 4KHXH 1FN4A 5KVFL 2Z0BA 4XXDA 4UCFA 3BH8B 2WW8A 5LKNA 2CDGA 4X9HA 2NLJA 5AY7A 2H45A 5D93B 2X4RA 4HT1L 3G6DH 4Y4HC 4YFLI 3TFKC 4YGAB 1GHFH 4OZHB 1GYAA 4JE4B 4TUJB 4EANA 3FCTA 2Q86B 1AGCB 1T2JA 3KXFE 2ZE0A 1I4FB 1KWGA 3QO1A 1MPAL 1I7TA 3LQAH 3PJSB 4JJ5B 1HXYB 3V0WH 3TJEL 4N9GB 5L2JA 5CEZE 1DBAL 4HUVA 3ARYA 4GI9A 4OF3A 3O8XB 5KSAA 1NWRA 1OAXH 2VZOA 2ICES 3LS4L 5F72S 4DZ8A 3FNDA 4Q22A 4IPNB 2BSED 1F45A 2Q20A 1KJ2B 2GCYB 4BUGA 5FYKU 3NCBB 5C6WH 5DHVH 1RUQL 1YMHB 3ZT7A 1KEGH 1U2YA 4U3AA 3P9MB 3QUXB 5DDHB 3QUKB 1CE6B 2MQ3A 4OFIA 3LEXB 2IFFH 4UOJA 1MCPL 4JPVH 2AQ3A 2XZCL 1XCQB 1UD8A 3FL7A 4JZJA 5DRZB 1S7UA 3LZFH 3GFUA 3T04D 2OTUA 5D6CA 3MRNB 2G2RB 3L5WA 1YYLL 1DE4B 3V4PH 3OWEA 4UINL 3ZKXC 5CPTA 1P4LA 4ORZC 5E8EA 2VQUA 4ODVH 4UFIA 2HT4C 4P2RA 4PYSA 2I27N 2IPTH 2V7HA 4FA8A 5L9DH 1A0QL 3KYOB 4JN1L 5EPMB 4O2CA 4FF5A 6A3HA 4EUPA 1E0OB 2YK1H 1EGJL 1CICA 2YL5A 1PZ2A 2VN7A 3T0WA 2VX7A 5TF0A 4K7PX 4M8QA 3BWUC 2E9LA 1SEBA 1VSCA 4TOYH 3TZVA 5T1LA 2EO1A 4Y19E 3GI8L 4YAQB 3IJHB 2CEQA 3BPLB 4P46C 4XWOC 3BVVA 1WAAF 1OTUD 1V7ML 3SCVA 5DTFA 5JW4N 2C7UB 5A2KH 1RURL 3D3AA 5HXMA 1AGFA 3SCMC 4JL2A 3CZKA 1W8OA 3MRIA 2BSSB 1SYTA 3N1GC 3QXTA 1GZQB 1VGKB 2CSPA 3ZSTA 3VFGH 1HKLL 1BMGA 2AKRB 4M5YL 5K9QG 1RJLA 3HG1A 1R24B 1DANU 2XWTA