3VGDA

Ctystal structure of glycosyltrehalose trehalohydrolase (d252e)
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
555
structure length
553
Chain Sequence
AYKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLEAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate recognition mechanism of a glycosyltrehalose trehalohydrolase from Sulfolobus solfataricus KM1.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Malto-oligosyltrehalose trehalohydrolase
total genus 193
structure length 553
sequence length 555
ec nomenclature ec 3.2.1.141: 4-alpha-D-((1->4)-alpha-D-glucano)trehalose trehalohydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09071 Alpha-amyl_C Alpha-amylase, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vgdA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vgdA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vgdA02
2UVEA 1TJGL 4QNPE 1CF8L 1IEAA 4XBEH 3LQAH 1FFNB 3ZMRA 2DICA 2UZIL 4DN3H 1RJCA 4OCSL 2XA8H 4UDUB 5FUOL 3G5VB 2DTML 2XZAL 3N1FC 5EBMB 4V1DA 1O7SA 2FIKB 3MNVA 4NXSA 3HE7D 5A94A 4X5WB 2F54A 5F7WC 4LSSH 4UOJA 1BZQK 1BVKA 2B5IB 4XBGB 3W39A 1GZJA 4P46B 5D71H 2J77A 1HHGB 4BQ9A 4H25A 2SEBA 2JK5B 4D0BB 3NA4A 2XWJB 2XOTA 5F9DC 2G3JA 2XVNA 3LKSB 1QLFA 5C7XL 3EJYC 3KNBB 3GIVA 5GGTA 4AY1A 4JPIB 4FHBD 5DS8B 1NWSA 4OSUL 2J4GA 3W39B 4G5ZH 3HG5A 4WFGD 1MJ8H 2HJFB 4L8SA 2P8MB 3UP1A 3GIZL 3F6IA 3MNVB 4AW7A 3ZKSD 3IF1A 4OCXL 2X09A 5B8CC 2HFTA 4NO5B 5E8PA 4P7OA 5C0RL 3VXUE 4UT9L 5E6ZA 1H8OA 5T1DL 4X4YA 3WIJA 4ODBD 4OF6A 5AZEL 1MFCL 3BUYB 2R0ZH 1HKLH 5I8EA 3P0GB 2B0SH 4URIA 1EEYA 5FUCE 5JOPE 4KRTA 4U7KA 3X3FH 1HWWA 3JWDH 4PRPD 4XPHL 2AJVL 1A64A 5JDJA 4XCFH 4FQHA 3THDA 3OGSA 4MWFB 4PREA 2R23B 4KK9D 4ZNCD 4UILH 3V8OA 4D0BA 5SWZA 4ZFGL 4Q22A 1V3LA 2XG5A 3H9ZA 1MIMH 3W5NA 1QLEH 5FB8B 3TGXA 3L1OH 1CNVA 2IPKA 4KZEH 1UYQA 3BZEA 1OY3B 5DS8A 4JPWH 2BSRA 5CPTA 3QDGB 4HWBH 2DYPD 4X5XA 3GSWA 3S4SG 1JIBA 1EXUB 3ILPA 4ODUA 1DWGM 2J74A 5AWNL 1YPZB 4WO4C 3M1BB 3ZKXB 1N8ZB 1A0QL 4Q7NA 5JW3H 3QDMB 1ISWA 5IM7A 1HILB 4BZ1H 4U3AA 2NX5B 2VLJE 1CTOA 4DZBA 4Y19A 1G1CA 1BFVL 3KVQA 5B22A 3W11D 2FYVA 5J3HC 1J12A 2EH8H 3ZOAA 1KQZA 3QCUL 1KPVB 5C0BE 3O2WH 4TUJA 5DFTA 1W9BM 3CZLA 3CSYA 1S7UA 4PTWA 4KRMB 2YPKA 5ESQA 4WENB 1BF2A 4YFDB 5I8KH 2V17L 4KVNH 3VFMB 2W67A 3WQ4A 3MV9B 3O3DA 4M61A 3WNPA 4ZTPH 3RKPA 1N7ML 1AGBA 1VA9A 2DTSA 1W72H 4JDZB 2ZCKL 1UCTA 4UV7H 1CD9B 3P9MB 3ZL4H 3AM8C 3IGAB 4XX1E 3SKJH 4YXLL 3ULVH 1A8JH 1PG7X 1U58B 1FVCA 4UQ3B 4AC1X 4RGMB 4K8RC 3ARED 5GNXA 3C6LD 3W26A 1JGUL 3DVGA 1OSEA 3IETB 3AS3A 2EYTB 5BJTA 5DHYA 1UA6H 3T04D 3QZWA 4NHUB 2PWFA 1Z3GH 4YHLL 1Z5LB 4K3JL 4ELMF 1IQDB 2BHZA 2GTWB 2IPUG 2VN4A 3RM4A 3VG0L 1HYSC 2DKUA 3FFCE 3JV6A 4F7PA 5D7LE 1QHOA 5E8DH 3OLDA 1BECA 2VWEC 4OM1H 2KPNA 2XI9A 5K9OB 1RPQA 4ORGA 5TDPA 3L3GB 4IRJA 3FY1A 1WBZA 2FLBT 3IJHA 5C2BH 5CUSH 2QADD 4XNZC 4ETQA 3G6LA 4U1GB 3BAWA 3RKDC 2G3MA 1KUMA 1WBYA 2UY2A 4LHQB 4UT6H 1UQYA 4JM2F 4OF3A 1CXLA 3NDZA 1G7IA 3QFDA 3OAZH 1A9EA 1M7DB 4FS0A 4LBEA 2W5FA 6CGTA 3HZVB 1ZXQA 1PJ9A 4LLVA 4P23C 4UTAH 4M3JA 1TCRB 2G75A 1ED3A 4Q74A 3NVQA 4AMXA 5FHAH 4GFTB 3MCLL 3CZ8A 2DQJL 5I18L 4HPYH 1DBMH 1G9EA 5DJCA 3AIEA 1KB9K 4JJ5A 5LBSH 5T3ZH 3UTTA 5JOFB 4UIMA 3UTSE 2R1XA 5IMKB 2HKHH 4JQXA 1S9XB 4UDTB 2WCAA 3FKUS 1MUJA 3BZFA 1NAML 3D3VA 4KI5F 4B0MM 1ZS2A 1BYCA 4TRPH 5ETUA 1E5JA 4IM4A 1XF4A 4UI2A 4H1LG 3AU1B 1AQHA 5HPMA 3QOMA 3RGVB 4NI3A 1MWOA 2OCFD 5IMKA 2G5BA 3LMJH 2V3DA 2HKHL 4QRRD 2J6EA 5C6TL 1BQLL 1UASA 1XZ0A 1GYAA 3QJHB 3MZGB 4QEGA 1K9DA 3HG1E 4YXKH 2CIPA 4CRPA 4CMHB 2VDPL 3D3VE 2D7PA 3LDBB 3BVUA 5MEPB 4OCYL 2W0PA 2IXUA 4PB9H 2VLME 5DK0B 5HGDA 1AR2A 2IH3A 3MV8A 3M45A 3BKJL 5F3HB 2X8RA 3GBDA 3DMMC 3GB7A 4X6BB 4P46D 3O3AB 4MCZB 2Q76B 3HZMB 5C09E 3H55A 1OGAB 2J2ZA 5ID1B 1ZHLA 3AY4A 2LTQB 4WNQA 2EYTA 4M24A 3TNMA 3WH9A 4IOFC 4KMTL 4WKFA 3WHE1 3HG2A 1F4WL 3BAEL 3TBSA 3AISA 3MODH 1AR1D 5F9WC 2AAAA 4GG8B 5I75C 3R4DA 5J6GB 2O9OA 4AISA 4F7PB 5I1HL 1UZ8B 3CFKA 3IDXL 5B38G 4Z95L 2HFGH 5I2IA 3OKOA 1XD1A 5I76B 5JLZA 1YJDH 3GSNB 4M6AA 5HGBA 1F4WH 5DVNA 1P2CA 2C3VA 3B5GA 4QRRE 4YHOL 5DI8A 5MENE 1RQ5A 4JHWH 1WVZA 3MNZA 5CEZL 5GS0H 5L88L 1W8OA 5I1HH 3EYSL 4X6CF 4WI2A 4I3RH 4NRZB 5K33A 1HSBA 3OJDA 3OLEA 3UTOA 3PABB 5HGHA 3FN9A 2WLZA 1OIMA 5E2UL 4R7DB 2W9EL 4ML4A 2DQGH 4ZAKD 1JPSH 3KPNB 4R97B 5JLZB 2J7CA 4O2CA 4MLSA 5BOZG 1K8IB 2OZ4L 3OXSA 3QCTL 1FBIH 3QWRD 1PG7H 2CBVA 4X4ZA 3WSUA 5D96B 1ZLSL 3DUUB 4OUUB 4U05A 2DQGL 4YIQA 4W68A 2WWMC 5DK2A 5J13B 3QULA 3L3GA 1NGQL 1ND0A 1T5WB 2ZUQC 4Z7VB 2J8FA 5T1KA 3EYOB 1IT9L 1E4WH 3MRFA 5KSVA 1TUXA 2MMXA 1K2DB 2ICEA 5HD8D 3DVIA 1JPGA 3PWNB 5DMIH 1S5HB 4WI7A 2I9TB 1F3DH 3AC0A 3O45B 1KXQA 3JXAA 1SEBB 5E6IB 2ZE0A 1GGTA 1DVFC 4D6GA 2VDRL 3G5YB 2D7TL 1FL3B 4PJHB 1MLBB 1E4KA 2BVUA 3O9WC 2QTEA 5A3IC 5FGRA 1CI5A 1NBVH 5HI3C 1KLUA 1L6ZA 4JJHA 5TDPB 4MA1B 3GMLA 2XN9A 5TE7L 5KW9H 1YQVH 4RAVB 3LRKA 4XNXL 4X0NA 3MUIA 4HDIA 3T08A 1AHWA 2J8UA 2OBGA 3ZT6A 1HXYA 3IFLL 4PP1D 5BS0D 1RK0A 3D85A 3WNKA 4Z7WB 3HAEG 1XCXA 5DUML 3OG2A 4RGMC 1UXWA 2YK1H 2GTZA 3DIFB 3NOIA 2WVUA 2BP3A 1Z0NA 3TFKC 2MPAL 2H26A 5FOBA 4Z5RA 4X4XB 1HQ4B 1KLGB 1XC6A 3RUGE 1LEIB 3KS0J 5ENWA 3E0GA 2D2OA 3RBGA 3U4BL 5JHLH 2FO1A 5C6WH 1I1RA 3WL1A 1QX1A 2EDJA 2QEJA 1MREH 1ZJAA 5EO0A 3S35X 1HIML 4FXGA 12E8L 4I0PA 3EJQA 2Z93B 4F7MB 4X4XA 3CHDA 2ZX8A 3D39D 2QL1A 3LN5A 1MWAA 1XSJA 4D9LH 1P4LA 5F3BA 2YD4A 1GJUA 4PLKC 1FFPA 2BS9A 3B9VA 4PY7B 1UR9A 5E2VL 3AQUA 4UZUA 4W5UA 1RFDL 5GS2D 1K3IA 3D39E 3WDRA 1DTUA 1P53A 3WNOA 1NGWA 3Q6FB 1UB6B 2YLAA 2AK4A 4X9YA 3ULVL 2LFGA 4MJ6A 4LDEB 5EU7C 1ISYA 1LP9B 3QDJB 2PWGA 4Y4FD 1J8KA 3ZYJA 3LOWA 3V6OE 5FKPB 5CSBA 3O6KH 1KIPA 3BQUA 1XIWC 3UC0H 1QKZH 4NO0B 2Y6SC 1EIBA 4TVPH 3P4OA 1V6XA 3GSXA 4F9LA 5MERA 2R2BB 5IJVA 3CZSA 5ILTL 4HK3N 4YHPB 2X4UA 4OSUH 3QR2A 3O41B 2OSLA 1VDGA 2FH6A 1KB3A 3VXOB 1RURH 5J56B 4WCYH 1FFNA 2UYLB 2LABA 1LEKA 1W0WB 1QPXA 4U7SA 3SGEI 2NY6D 1GGIL 3S3SA 4F33B 4Y4KB 5EG6C 3O81A 2QQKL 3TA3C 4BZ1L 3EJRA 5IBTH 2J8GA 4JVWA 1CZ8L 2CEQA 1X4YA 5I19L 4G9FE 5T33H 2F8XC 4WCYL 2BNRA 3Q6GH 1NGYA 2XTJB 3CBWA 5FDYA 3GBNH 1DWHM 1C1EH 3JTSA 3F58L 4P2OD 3X3FL 3MI6A 2DWDB 3STLB 3VXOA 5CFHA 2NY1C 4I18C 4APQD 5K9OA 3WUBA 2WAGA 1EZVX 3QEUB 1BLNB 4R5EA 4B9ZA 5CSYA 3S88L 3DXAD 3ESUF 4OLYH 4U1GC 5IG7A 4XUYA 1GW1A 1OINA 2PB1A 1R87A 2FX8L 1KYOJ 2AOSA 2Q7YA 1G94A 2E7LC 2CLRA 4PSRA 1VKXB 4QLJA 3QDME 4TNVK 1YNKH 5BRZD 1XCTB 5IQ9B 4GW1A 5KSAD 3CPLA 4LU5H 3RWJA 4ODSH 1AXIB 2GK1B 1OAYH 3C5JB 3OKYA 4AMKH 3LIZL 3PWJB 5D9OA 1C08B 1T89C 2NXZC 3EYUH 2J7DA 5EN2A 2DH3A 1OAQL 2A3BA 3T0EA 3U36B 1EFXD 1AGDA 3G6JB 3DX4A 2X4QA 3LMJL 3GMLB 2OTWA 3SKOA 4M43H 2WWKT 2VXTL 1X44A 5DHXB 2C1OA 3LD8C 2OW7A 4X9FA 1EA9C 3G6JF 1IAMA 1JNLL 2HT2C 4PY7A 5A6BD 1C5DA 1IM3B 5INCB 3AREB 2E6JA 1F02I 4MLIA 4YPGB 5CXPA 1UM5H 3IDIA 4OD2B 5C0DB 2VVNA 2ERJC 3OAUH 4HS6B 4LQFH 5EU6A 1OB1A 3H8NA 3LEXB 3A3HA 1PVHA 1C5DB 1K6AA 1MQ8A 5E2TH 3AHZA 1BZ7B 5JZ7C 4OOUA 4C7GA 3EDJA 1YPZE 3V52L 4CNIA 2VZSA 2ZSVA 4PGEB 2EACA 1MRDH 4TSCH 4W4OC 1UWIA 2P7TA 1A47A 4G6ML 2D9QB 1UZ6F 3RVTD 4PGZA 3PJSB 2FD6H 1CDGA 4LDOB 1XR8A 4K3JH 5I1JH 5LBSL 4FNRA 3DVNB 5D6DA 2ZWLT 4HF5L 2CR6A 3BAJA 3IETA 5C0NC 2K7PA 3IJ8A 2EZ0D 4M3KB 2OR8A 1KG0B 4DGVH 3HMWL 1DN0A 3KYOB 4NWTL 4KUCD 4YDIH 1DQQB 3VM5A 1C5BL 5HBBA 4KQ3H 5GIRA 1FL6B 2QQNH 5J6HA 1D6EB 2ITCB 4DK3A 3HG1D 4MX7B 4ELMA 2VR4A 3N85H 1AXTL 4LHUG 4QTHB 3DV4A 5D70H 2YA0A 2B4CL 1AE6H 3QYCA 1ZBKA 2B31A 4HJ0D 1NCDL 2DQFB 2ARWA 3OKKA 5KVMC 4LCWA 1E6ZA 3QFJD 3E2HC 5KOMC 2WMIB 3ARTA 3BEWB 5ACLA 3D0LB 4MYWB 4KDTA 3SURA 1E4MM 3LQZA 1AQKH 3P77A 4BH7A 4QLRA 2Z4QB 3OQ3B 1IGTA 1SY6H 2UYLA 4U6VL 4N42A 1R5WA 3BZDA 1MFEH 4G43A 2D9CA 2ZCLH 4OUEA 4JDTL 1N2RA 1LNUB 4ZDHB 1NQBA 1XH3B 3CDYA 2DGAA 5D1ZC 3RIAF 2QSVA 2YEZB 1BFOA 2X7LA 1BD2E 3U7VA 2OQJB 4NP4H 5DURB 2DLTA 1R5WB 4PRNA 1RUAL 2OTPA 1KIRB 4DGYL 1NCTA 3FT4A 2J7GA 1C12B 4AD4A 5IVXB 1KFWA 1XH3A 4DO4A 3TIDB 1OARH 5T5FH 5DT5A 3CX2A 1XYFA 4JFSA 1OTUC 1CTNA 3VI4E 3CFCH 2R0LL 1XGTB 1KC5L 3QPXH 1UWEH 1U91A 1O0VA 3H6JA 4H8VA 2XA3A 5D1ZD 4GW4A 3V6ZB 5LWYL 4X6DB 2WC3A 1RUQH 1ZK9A 5D7LD 3QRFM 2X4OB 1ROWA 3OG6B 4P2YA 4WU5A 3ULUF 1CK0L 1WFOA 1TNNA 4EI5A 1WAAE 1BEYH 1BJ8A 1H5VA 3HNSL 4NRYA 1FGVH 1XV8A 4YHNA 4UT7L 4CW1A 3IGUA 1MVUA 3HI5L 2DDXA 5GRVL 2G4FA 5HYEA 3OGVA 4PMXA 3NCFB 4L3EB 2F7PA 5E1HB 3ECBB 3REVA 4GLRH 2XZAH 4NQSB 2AXJA 4JRYB 1PBGA 3GKWL 1U42A 3BFOA 3NUKA 4ODUB 4IHOA 4LIQL 3I02A 4B7IA 2ZX9A 4DWHA 5GGTH 2Y5TA 3D69B 4HA1A 5I66A 2Q1EA 3ZR6A 5E00B 1GJIA 2OTUA 1G9MC 2C1PA 2E4TA 4Y4HA 3G6JA 2DWEB 5EC2B 1ZSDA 2NXZD 1ZHBB 5C7XH 3HZKB 3IFOB 5BMFL 3U46B 3VXSE 5HXMA 4NO0D 4JRYA 2QSCH 4LSPH 3QIBB 4HJGB 5INCA 5KANG 2VLJD 4KV5F 4YHKH 2VZ1A 2ZCLL 4PRHA 3PTMA 2XZZA 4WGVB 4NSKA 5A40E 5EBGA 4NKIL 4I9WE 5I1KH 3IDJA 2CR3A 1XGPA 5ABHA 3B9KB 4QHNA 4CVWA 4ZO6A 5KG9B 3VGFA 2DQUH 4Q9RL 1S7TB 2H45A 4BQ8A 2VKXA 4Y4KD 4YC2B 5ECJE 4JZJC 5EU5A 3W6MA 4P5TB 3RX5A 4JANB 5IJKA 1WEJH 4NNXA 2WHJA 1JGLH 1YNTB 2D24A 4AIXA 1EJOH 5M3WA 2Q8AL 3PL6D 4HU8A 3UG4A 4FG6C 1A7BA 1R7AA 4OUUA 3OPZL 1BOYA 1AKJA 4MPKA 3CDFA 2DOCA 3PV6B 1IE5A 2QQKH 2WB5A 1ACZA 3D9AL 4XH2B 3VXTB 3WENA 4HLJA 1S9YA 3DX6A 4TOYH 1FA2A 1ZANH 4TVPE 4LGRB 4ZFMA 4S10A 1E4NA 1BVZA 1Q38A 3RTQD 5D7IA 5FUZL 1HWHB 4DZBB 4KDTC 4PBXA 3BGMA 4PMVA 3BPCA 5KSAB 4LLWA 2GSJA 4GBXD 4R7NA 1AJ7H 1EO8L 3W27A 3ZDYE 3W28A 2P4AB 1JAKA 4HC1A 2XN1A 4NXKA 1CXKA 1WFTA 1HKLL 2LU4A 3VFUB 4OGYL 1IEAB 5CKGA 3B2VH 5HGBB 4U6YB 2MPAH 4NOFA 1KSRA 4GAFB 4X7CC 2FHFA 2F58H 3D0LA 1G0DA 4XWGH 3D0VA 3U4BH 4WY7H 5JHLL 3IGAA 2QADC 1PKQB 3AM8A 5T3ZL 3TA3D 1I9IL 4ENEC 2V2XB 1JUFB 4N0FB 4OF0A 2ZUVA 4ZSOA 1TCMA 1MI5D 3N1MC 4LKCA 1J8HA 1FVEA 1IJ9A 4PJ7A 1WDRA 2IC2A 4GUPA 1CYGA 3AYRA 3RDTC 4DO5A 1B3WA 1TA3A 1K4CB 1JPFA 5D9SB 1FOBA 3OB0H 3CUGA 1FRGL 3N17A 4PMOA 2W63A 1R33A 4JE4B 2R9HD 4BQ5A 4KROD 2PYEE 5GJTL 3NIDE 2WBGA 4NC0B 2ED8A 1VESA 5M17A 1MIEL 3GFUA 4Z7WF 5HYSA 5DEFA 4GAGH 5EOCL 1ZTXL 3VD7A 4NDMB 1MHCB 3VIFA 1NOWA 2NY4B 3GHEH 4ZUVA 1DWJM 1J0HA 4YWGL 1OD0A 2J88L 2C1OB 5HHNA 3T0WA 3U9PH 4X9HA 4CD7A 4OM1L 4Z5RB 1MI5E 3DUSB 4XHJC 2IFFH 4Z0XA 4OCRL 5BO1L 4K3DL 3MXWL 5EOQL 1J05A 3EDKA 4U6XA 4NRRA 2VC9A 2QHRH 3FQRB 1EDQA 4NZRL 5C0JB 2E27L 3TONA 3OZ9H 4U1IA 4B16A 1T1XA 4K68A 2DT0A 1I7RA 1MHEB 2WZEA 2Q20A 5HGAB 3BYYA 4NC2B 1Q8MA 4WK9A 2UY6A 1A6PA 2GW5A 3VGHA 3VD3A 3C6SB 1TZIA 5CD3A 4RISH 2O61B 4R2GC 2CUMA 4ZFOA 4XAWL 2ZSVB 3MLYH 2VDNL 4PP2A 4OM0L 1QSFE 1FN4A 3FRUB 3BIAX 1F3JB 1KCUH 1A3RH 2G9HA 5C0EB 4FFYH 4QXGL 3F7VA 3KPMA 1V6WA 5FYKL 5ICXB 4Y5YA 2RIKA 4GRWH 3ROLA 2WUBL 4OV5A 4GS7B 3WEZA 1CFQA 1QQDA 2BMKB 3I50L 1XSIA 2QSTA 3ABZA 2EBNA 1MCDA 3T2OA 4ZUUB 1R5IA 4JFHE 2WYSA 2P44B 3D5HA 5IHUH 3VGBA 1Q72H 4LLDA 4PJXA 4JO3H 4NKOB 4U1LA 3TP4A 5DJZB 5JPMA 4R4BB 4GRLC 3AXXA 3OA5A 3ETBF 2H41A 2KDGA 3F7YA 2X1XR 2CKBH 1BLNA 1ZHKA 1BJMA 1J0JA 3ARDC 3W37A 2DLFL 1P2CB 5I9QB 4K7PY 3UR8A 1S7XA 4JQIL 2QQLH 4GUPB 4I9WD 5CBAA 4H0GA 3MMWA 3P9LA 3I6GB 2YD7A 3PWNA 3V4PH 1HHJB 4D3CL 3SDAD 5ITBL 5M03A 1KGCE 4MB1A 3GMMA 5HYJD 3KLHC 3V4UL 3MRFB 2UY7A 2Z1SA 4UTBL 4ZPVB 1KTLB 1I8LC 4I3SH 2Y8KA 3MACL 1U92A 4XNUH 5GGVH 5KSBB 3MLRL 1H3PH 1UWXK 5E9DD 3LKRA 5HHME 5GNZA 1NFDE 3JV5A 4KK8C 1T04A 5CPQA 3CLEL 5CEXB 4OF8A 2OS7A 3VILA 1KTLA 1S5IH 4DW2H 3NGBB 4WFFE 5B21A 1T6WA 4P3CL 3BE1H 1EEUA 1L9NA 4H8WH 3PWPE 3KLAB 1QSED 1LEKB 1CLZL 1WBZB 2CERA 1ODUA 1CIDA 2C4FU 3BKYL 2ZUYA 3Q5TA 4I3RL 1VFBA 4MJ5A 4F7EA 4IDLA 1DL7H 1T20A 3G6MA 4A6YH 5IFAH 1IM9D 4TPRL 4XMLL 1IQWL 5FYJU 3JVGC 3WIFB 4FFYL 3WY4A 2NZ9C 1UB5B 2NXZB 4X7TB 3H9SD 4PRIA 4LCYA 3KXFA 3QHMA 4M82A 3NH7H 4LK4A 1I9JL 4MXVF 4P59H 5F9JB 4WI6A 1PW3A 3CMGA 1QR1B 2FECL 3SDDC 3GJFA 5EO9B 4AK1A 4O4YH 1AXSA 1A4KA 1LO4L 2JTDA 3VIGA 1QD0A 4M6NH 1V7MH 5IROC 3DECA 1I1AB 5TGBB 4M7LT 4R8WL 4M8QB 5EA0H 1NP2A 3BP7B 4NKIH 2VL4A 5D71L 2EDYA 4R2GD 4Q2ZA 5EORH 5ICYA 4B3KA 1BD2D 4E0RB 5DK0A 5E4IA 3VG9C 4KRUA 1G0XA 4ORZC 3C5ZD 2DWEA 2RAMA 3U2SB 1T1ZA 3MOBH 5TE6H 4DN3L 4S3KA 3PZGA 1U95B 2B1AL 1WPCA 3RM9A 3N04A 1M7IA 2EPNA 4KKCD 1JDDA 5IFJA 1YN7B 2BOBA 3ARBA 2XFXB 1CDUA 1K8IA 1ZVHA 1B3YA 4HIIA 3J7HA 2AXFA 1MY5A 5C0CB 1XR9A 1BZ7A 5MEND 4PD4J 1T1WB 2BVQA 3SE9L 4GXVL 2CLVA 5BXRA 1G9HA 4FQXB 1W0VA 4JRWA 1T2QL 5ALCH 5JORB 2I26N 1OHQA 3IK2A 3ZM8A 4Z7UE 5JR1L 3SCOA 3UPAA 5FO9B 3P30L 4MQSB 2BRRH 4Q2ZB 3NZ8B 1FAIH 3FB7B 1ODZA 4N8VA 4XNMB 2J5LC 1I75A 1DCLA 5HI5C 3ZJ8A 3ET9F 2WMFA 1WITA 3DYPA 2OL3L 4ZEPA 1DWFM 1RZJH 1N5AB 4P49A 1GONA 4U49A 3UG5A 1CDBA 2JB5H 2Y1VA 2BVEA 4PGJA 4JLRA 5E0CA 4E41A 2VCAA 2VQTA 2CIKB 3UPRB 4KFZC 4LSPL 3ZE0E 2OSLB 3BRFA 3TNNA 1J01A 2OJEB 3ZE2F 6FABL 2ZNWA 3QNZA 5J12B 3W29A 5A2JH 5CIPA 5ITFB 5FD0A 2VLLB 2CKBA 1MEXL 5IVXF 3KJ6H 2GSGA 2HVKA 3ARFA 1BZ9B 4X8JB 2ZOXA 2EC9T 5J11B 3JWDL 2WIMA 5C9JB 1E73M 2XKNB 1T0NB 3WBAA 4PS4L 1BFSA 2V5MA 1JDAA 4FMFA 3MRPB 4FTVE 3AHXA 4WV1C 4NYLA 2Y5EA 4TULL 3BPLB 1W3KA 2ORBH 1TITA 1D9KB 2GDUA 1K6QH 4RA0C 3QA3A 4DTGL 4L29B 2ZCKH 1VB9A 2J7EA 2Z4QA 4MB4A 5DK2B 4CGTA 1UH4A 2VLLA 1TVHA 1N64L 3AXHA 3QHZL 1LE9B 1KULA 4D0DA 3WKML 3WQ6A 2VXVL 5C9JA 1DSFH 4X6CA 1BYDA 5AYUH 4K3DH 3U9UA 1ZT4B 1T04B 5D7JB 5LGHH 5BOPA 3CXHJ 1PSKL 2R0KH 5H8DA 3GXIA 4MJIE 4NJAL 2CHOA 4PG9A 5BV7H 1HJUA 4U1NB 4PJIE 4UFHA 5AAMA 1CICA 3NPSC 4S1DD 1KTCA 2BNQB 4NQEA 3HFML 4KKCC 2HKFL 4IRSB 5BRZE 4FQHB 4KV5E 1ORSA 2W9LA 3CZEA 1PY4A 2HT2D 3QSKB 3TBYB 2BCKA 5HI4D 1MFDH 1MFNA 3OZOA 4Z7UA 4JAMB 2FGLA 2XQBH 3S8WA 3QEGL 4JZNB 3KPOB 4HS8H 1FDLH 2UWEA 3RKDD 3QR3A 3ARUA 1U8MB 3H42L 4JFTA 4GKOA 3QDGA 2UUDK 4LPUA 2QMKA 5CBEA 3IJSA 2W4XA 4WHYG 4MNGB 5DQJB 1DWIM 2VUYA 4JKKA 3M1BA 2JJSC 2YUZA 4KK6C 2XRAL 3EJUA 3GJEA 5J8OA 4FQIH 3FO2A 5J12C 3H7BB 1OGTA 1FHDA 2ICWA 2KL6A 4E9LA 4AMKL 4GZEA 1C5BH 3BCDA 5I16B 1KGUA 1BYAA 2WIIB 4MA7L 4OLXL 1MHHA 5E95B 3CTTA 3T77A 4FFZH 2HAZA 4P23A 2Q76A 3HZMA 2AABL 3P2TA 1MVYA 5I1DB 5F6HI 1OAZH 4IPLA 5HNNA 2UWFA 1JBJA 2IGTA 4X0VA 2ZJSH 3O2VH 1RJLB 3DGGB 4Y2DA 43CAA 5C0EA 1JNLH 1R3LB 2PXYA 4ONGL 4OZHA 5E6IC 3GUTA 3HA0A 3P0YL 3V8CA 2VUOA 1VPOL 1L0YA 2V3FA 3B6SB 1FQ9C 4H0HB 2V6HA 4PJFE 4C7DA 3VDCA 4FQXC 4RRPG 5EOQH 1OP3K 5C70A 5AYIA 2EEBA 3WJLA 4PJBA 1A14L 1HKMA 4GQ9H 3I6KA 1KIQA 4XMKL 2ADJA 1KEGH 2CESA 3EFDH 1DDHB 3EYVB 5I8OL 3EO1B 4HT1H 3UTZA 2EXYD 2E9MA 1R6VA 4UQDA 3WHXA 2VLKA 1M05B 4LGSB 4UQBA 4HIXL 4NP4L 3W11C 3DBXA 5J89A 2JK5A 1CD0A 1V3JA 2XN9D 4KKBC 1L8NA 1DANU 4MSWB 1V7NH 5I30L 1C90A 2CPCA 1GCFA 1MQQA 4KJQC 4W6WB 3THCA 3Q5YA 5F1SA 4KJWD 4X6DA 3EOBB 1NP0A 2FYYA 1HHJA 4R2GB 4AEHH 2XYLA 2J88H 4XWOC 4OI8A 2VH5L 5HPOA 4N1EA 4O51B 3QHFH 4BSVA 2EPLX 4NM8L 4Q9BA 1CVSC 2X4PB 1PD6A 3TV3L 4JHAL 3A4AA 4FK9A 1CFTB 3O8XA 3GJFK 4JGMA 5I30H 3IKCB 4JKLA 2YEZA 2WMKA 2F15A 3QFDB 1G7IB 3AREA 3GNMH 2PO6A 3GXMA 3K7UA 2X4SB 5T1KB 3QUXA 5LA2A 3V52H 2JIEA 4ODVL 4M1GL 4F33A 3KPOA 2OSYA 3KEHA 2F5BL 3VIPA 3P77B 1FG9C 5DJ6A 2OJEA 4FABL 1V5JA 4FQIL 5BS0E 3WFCL 1DVFD 4HZ6A 4U0QB 1A6AB 4A2MA 2CHNA 3BC9A 4PV9A 4G43B 2DQHL 5E4EC 3I3DA 4UINL 1W9UA 5D7IF 1U8LB 4AMCA 3BKCL 3HG3A 2Z92A 4PN2A 4CVZB 1IL1B 1Z9MA 3U9UB 1BD2B 4HWEL 5EFIA 4W88A 5DYOB 4F9PC 2AJYH 5DVLA 2FATH 4MAYA 5F21B 2X9WA 1AFVH 2OWWA 1F6LL 3BPOB 2GCYB 3SKUD 5A8NA 4MQTB 1GAFH 4GXPA 3CVHH 2AQ1A 1J11A 3GBML 5L2JB 1Q72L 2NY3B 1YEEH 2A74A 1QSFA 1I7RB 1MHEA 5FM5O 1BBJB 2HISA 1S7RA 3SY0B 5J1AA 1WLHA 3MBEC 5CCKL 3GJFH 2GFTA 3W38A 5TDOB 4Y4FB 4OB5H 5GS1A 1MPAL 4RX4A 4IHOB 2H8PB 1UWEL 4OAWB 2JCCF 5TH2B 2VWEE 3HJEA 4J1UA 4OZFG 2XFYA 1G9NH 1WE5A 2VIRB 1MFEL 2M1KA 5CSZB 4PJGB 4XMPH 1MVUB 3ZTJH 2ESVA 2A3CA 4MCYA 3MSDA 4MNQE 1UWQA 1GPOH 1CGXA 4NN7C 4ISVA 2VZOA 1JGVL 2WLYA 4NZUH 4UT9H 1W2VA 3TT3L 2H32A 4LSQL 1AQ0A 5D6DC 3O6LL 2HJLB 4B15A 4H8WC 2NY6B 3MMEA 4PTUB 2OR9H 4JRXE 3VWKB 3DYOA 3TM6A 1EDTA 3QIUC 1QYGH 4FQJL 5DSCA 3WIIH 1LE5A 3HPJB 5EOTA 5FB8A 4MJ6B 2JELH 2H32B 4FQ1L 2M2DA 1NLBH 4PJXF 3RX8A 2XIBA 3V9FA 3HZ3A 3H7BA 1E70M 2XTJD 1RVFL 3KPRD 4AQOA 3KHOA 5EC2A 5DT1H 3QPXL 2Z91A 2CD0A 4FQXA 4UCFA 2P24A 1YN6A 1VGKA 2A83B 3DNKA 2CSPA 3MUAA 4J4PD 1UENA 2E6PA 5IBUG 4DKDC 3BESR 4KJPD 1CBGA 4Q97A 1KJ3L 5DUBB 4Z9KB 3MGTB 1AD9B 2FGWH 2BJMH 5FDWB 3MV01 5DWUL 5BRZB 1CU4H 2J8UF 4X7DC 5ACZA 4HG4J 2BXZA 5K9QG 5F88B 2OI9C 1FLTX 5GGQL 2GFBA 1NFDB 4LAQH 5E8OA 5CD5C 2E8ZA 1T2XA 5EU5B 3MGAA 4V1DB 4PG2C 3BT2L 4S1SH 1G0CA 2XGIA 2ZX7A 3MRDB 4F3FB 2HTKC 4JKPH 9CGTA 5IW6A 2OP4H 5BYWA 3B9DA 1KTRL 5AZ2L 5AG9A 4OZ4A 3H3PH 2NLJB 3RTQC 4E41E 1E55A 3IB4A 2MKWA 3GZKA 4U0RB 1QW8A 4LAQL 3PV6A 5KZ6A 1JE6A 3EYUL 1HHGA 2VDMH 2F7QA 2CKRA 1FO0A 4O00A 1EEZA 1DEEB 4BH8B 4XPFL 2CIIA 2BY0A 1UJ3B 5AYUL 5I15H 2DL9A 1QSFB 4HA3A 2VXTH 1AY1H 1U91B 1G9MH 4L5FL 2VE6A 3PP4L 4ORGB 3QWRA 1J9YA 3GMMB 2WZIA 1R3IH 3D52A 1QBMH 4DEPC 3DO7A 4PJDB 1LMKA 2XQYG 1EO5A 1BVNP 2G41A 5FUZH 3MRIB 3C5ZC 3VFWB 2AJXL 1Y0LA 3WFBL 4G9FB 4O2EB 3BLBA 4JR9H 4IMKA 5D72H 2BHUA 4OIIH 4OQTA 3D6GA 2A3AA 3BP4A 2OI9B 3FTGB 4M80A 1HHHA 3B83A 4MZ3A 4EIZC 5ABGA 5I1AA 2R4RL 5L8LB 4FQ1H 2FEEL 4J12A 1I3RB 1QACA 4KROC 2IBZY 1FLRH 3V5KB 3DO7B 3IRPX 1B2YA 2NNAA 3U30C 3V0AC 5J9PB 4EI5B 2HT4D 4ZE5A 4OD1H 5D6CB 1HVXA 3DDGA 1CFQB 1QQDB 2XXMB 2WC7A 1BQSA 5EU6E 3SGJC 3WH7A 3WN5B 4TOYL 3EAKA 1GQJA 5LGKA 2V9RA 1XIWA 1MCLA 3VFRB 3TBTB 4LRNH 4GRLB 1OD7A 5CKAA 3DPBA 2J8OA 1PLGL 4AZBA 4FXKA 4L3EA 3VRJA 4XVSH 4HPYL 5DWUH 4FQCH 3SDXA 1A7QH 1PQZA 3NN8A 4KJPC 4EANA 3ZHKA 5DJ2A 4HQQH 3NFPA 4QHKJ 3HZKA 4V27A 1XGPB 2B4CH 2HFEA 2O5YH 2E9JA 3MPCA 5F96L 3GHEL 3BW9A 2OTUB 3BJ91 1GQKA 3PHSA 1NFDA 5FF6B 2VLRB 3F7YB 1X3DA 4I0PD 4KC3B 4QY8B 2W59A 1TFHA 1G6RL 3QNZB 1KN4L 1P7KB 3CMOH 4Y5XB 3C09C 3I9GL 4IRJD 4GG8A 3U4EB 3FRPG 4ZTOH 1WGOA 1NUFA 4WI8A 5F96H 4D3CH 3MGOB 1ZLWH 1E6PA 2KQMA 2VURA 1R5IB 1N5AA 2JEPA 1NEZB 3O6MH 5C08D 3BIBX 1CL7I 5DO8A 3GXTA 2BNJA 1RMFL 2WMIA 5F7EH 3SKMA 1X5IA 2ADGA 2R0WL 4WU7A 3ILQD 1RZKH 3SN6N 4G42B 5L2KD 5ICXA 3LEYH 1V0MA 4XGZA 3FT2A 3TO4A 4YXHH 3B4NA 1XR9B 4PJXE 1PYWA 5F7HA 4U5KA 5GGRB 3HAEB 3GDBA 2KBGA 1X5GA 5LQBL 1I85C 3BKYH 4POZC 1T4KA 3AHYA 4PLKD 1G7MB 1IILE 2V2WA 1H5BA 2PR4L 1UQSB 3L2LA 4E4PA 2EIBA 4QHUA 2F54B 2HN7B 5CMAB 3GK8H 3SJVE 1T5XA 5B39B 2NMSA 5AUMB 3CPLB 1YPZF 4IOIB 5J3HD 1GORA 1YZZA 2GDVA 3OZPA 1E4JA 4Y4HD 4ALAH 4NUGH 4HIEA 3UJTL 1QG3A 2PYFB 1I9JH 1UJ3C 3VGDA 2NY3D 2WCSA 3GSVA 5MEOA 3PWLA 3S5ZA 3NIFF 3CJJA 5ADOL 1AQDB 2DQCL 1U3HB 1CGSL 1KT2B 3HG1B 3K1DA 5I1LB 1AGEA 4AY0A 1B0GB 3VRJB 4PJDF 4PLJC 3ELAT 4OD3H 3UJTH 4JRXA 2Q3ZA 4M5YH 3EJTA 5CMAA 3WLBB 4ELKA 4P48A 4OBSA 4Z0BL 3SUTA 1QSZA 1J0IA 1E27B 2PWEA 5KSVB 4I48A 5A8MA 1H3PL 2NTFA 4QRPE 3MS8A 1Q94B 3FQTB 4MNQA 1UCBL 3RZCB 2J7FA 3D18B 3CVIL 5SX5K 3ZLQC 1A5FL 5EZIH 2YMXH 3MUZ1 2J25A 4LYPA 1Z32X 1E27A 3S37H 2PKDA 3BOVA 2J62A 3SCTA 3QI9B 4JY6B 3MREA 4P5TD 1HQ4A 4WW1A 3GSVB 5JPMB 4ACZA 4LFHD 5IF0A 2R0LH 4X6DF 3U7WL 1QFWM 5GGSB 3M7SA 1AGEB 3HR5B 1U9KA 3VRIB 1MJ7L 5ITBH 1WBXB 1BSIA 4APQB 1GPFA 1SMOA 3F5KA 5ESAB 3FQUA 5IV2A 2EYRA 3R1GL 1M03A 4HZ8A 5D1QA 4Z95H 2JJVA 4GBXA 3ZIZA 2IH3B 3MV8B 4LCCC 5ALCL 1ONQB 2JJWA 2YN3A 4XX1G 4JFUA 2W60B 3OLGA 1A7RL 4EI5C 2ZUNA 1E6NA 4N90E 1RULL 3W2DL 4JM2B 1W1VA 2R1YB 4WW2C 1NDGB 2MQ3A 1IMHC 1S46A 3MO4A 4Y8DC 3BN9C 2X2HA 1BIHA 1X4XA 5FM5M 1YEFH 2NY1B 1KIQB 4HUMB 2P7TB 1AGCB 5TPWH 2HT3D 4XBEL 4E42A 2Z93A 1J5OH 4W81A 1RZFH 2G60H 3QGVA 5HI3D 4G3YL 1F3JA 4AIEA 1WISA 1IV8A 3N9GL 4X98B 3HRZA 3D50A 5JW4Q 4X6DE 1EERB 1HIMH 5I1EH 3OHXA 1LGVA 3ARQA 1A3HA 2YFNA 1NAMA 5BMFH 2NY2C 5FKAA 4LVNC 4MDPA 3FQNB 3GSXB 1CS6A 2FJHA 4LLQA 5IHZA 1D5MA 3Q3GA 2NY3C 2X4TB 1F8TH 5SWQB 1NDGA 3MGTA 4LSTH 3RAJL 1R5VB 1A0QH 2WBJC 1S7VB 3VD9A 1SMDA 3ZJ6A 3TO2A 4DM2A 2RGLA 1T03H 1A7NH 1SJXA 2ATPA 3DI2B 1AHWC 3DX3A 1CD1A 1P6AB 1HKFA 1T7YA 3WD4A 3AMKA 5CD5D 4IRJC 3OKDA 2BFVL 2GITB 2BNUB 1CE1L 4Z7QE 2Y36L 5I0DA 2VT0A 2NY2D 4IBLT 3GYCA 3EO9L 1LWHA 4TSBL 4TQEH 4R8WH 1VSCA 2E0PA 5IB5B 1MQPA 1R5VA 4TSAL 4M1CC 1FIEA 1IKFL 3RVXC 2AJXH 4PUEA 2ICWJ 1HCVA 3ARGC 4G80B 2H2SC 3C2AL 2FB4L 5EZLB 3CO4A 3LAFA 3HG4A 2BVOB 4U1HB 1CXIA 3ZL4L 4I0PB 4U3CA 4JM4L 1RU9H 2HKFH 2LE9A 1HTYA 2XKNA 4HPHA 1DQLL 1F58L 3AOFA 3BD5A 3QULB 4D0CB 3V6OA 2YDQA 3ZO0A 2QPUA 2VITA 1ND0B 1T5WA 3N1GC 5DMGC 4MD4B 1GPOL 5GHWL 3RNKB 2V5DA 3ZJ7A 3RIFF 2CBIA 1QI0A 2FZ3A 4DK6A 3KPRB 1TVBA 4J1UB 2OSWA 4PRBA 4O58L 5DD0L 4ELKB 3B5TA 3RDTD 4UB0L 2RCSH 2A2QT 4W7WA 4D6CA 4G8GA 2DS4A 5I19H 3MA9H 2IAMA 3UJIL 5IESL 5CHNA 3HUJA 3W24A 1S7RB 3KLDA 2FSEA 4AZ5A 3DI3B 1V05A 3TCLB 3KXFE 3V0WH 4X6CB 2F58L 1ZGLP 35C8L 3BD4A 3SE4A 3GSUB 5C2BL 3WFDL 4BFIA 2IQ9H 1M53A 3V5DA 1DQQA 4HUNB 3GM8A 1TVHB 2VNCA 4XAKD 3UPCA 1K4DB 1DQJB 2YDRA 2O9RA 3BQUD 1JHKH 5FOBB 3EDFA 4NPYA 4G7VL 1ZS8A 3BSZL 3INUL 4PJGF 1MCFA 3IJYB 1T7ZA 1Q0XH 1R47A 1ZLVH 2JJTA 4X6CE 4MD4A 1XIWB 1VEOA 1GGCH 2YL5A 4K3HA 3V5HB 3K8MA 8A3HA 4YHYC 5KAQF 4GW5A 1E4LA 1IGCH 2DD8H 5JQ6H 2IH1A 3QJFA 5F8QC 3KYMA 1NKRA 1PZ2A 4OT1H 3T1FA 5IHZB 4MNMA 2HT4C 3C6LA 4G8IA 4NQEE 3BHBA 4IS6A 4QRPA 5EO0B 1G7PA 4LGPB 2HMIC 1P4BL 2EDTA 1OB1B 3LEXA 5E8NA 1GH7A 3QWQB 3VXPA 3AS0A 3X12A 4S0SD 3MRKA 4M1DL 3AMDA 3BXNB 4NQXB 2XVLA 3QQ9C 4NO0A 4XV0A 4YK4C 3REWB 1UFUA 2CNCA 3MFFB 1MF2L 2X5PA 1MAML 3SDDA 3PHOB 4AYFA 2AEPH 4QF1A 5CINL 4JFFB 4NN7B 5DD5H 3O3UN 3DHMA 4QNPF 1UVQB 3QIWA 4JG1H 2VZ3A 5EWIH 5BRZA 3EDDA 1I8MB 1U93A 5HHOB 5JXEA 4RAHA 1W3HA 4ONHB 4XBPB 3BKJH 4NSBA 3Q2CA 1NMBH 2ZOKB 2ENYA 1RZGB 5CAYB 5IEKA 2QHAA 3WHXB 4PRID 2COQA 4EI5D 3EFFA 3V79C 2CO6B 4P2CG 5D72L 2X0YA 4F37K 1JAEA 2CCRA 1EFXA 2ITDB 1NDMA 2ICWI 3EO1A 1UH3A 4ONHA 5IW6B 5DO2C 4ZO7A 1LQ0A 4LVEA 2BC4A 4HKJB 3QEGH 4IRSA 3MLSL 2Q87A 5EB8A 1KELL 2EDLA 5HYFA 2NT0A 4PPTA 1NGXA 2P5WE 1G6RH 1EOKA 3QIBD 4LPXA 2CK0L 1TQSA 1BPLB 1E0WA 3DSFL 1ZLUK 1IGJB 1NJ9A 5DJ8A 4C83A 5D70L 2HH0H 2WWKO 1U8JB 1XF5B 4HLZH 4ZPTB 4MB5A 4FLOA 4NQCE 2DM7A 5GXBB 1KEGL 4ZXBB 2GJZA 4G7VH 5E5UB 3N1QC 3MRQB 1NCDH 1YEHH 1Q6DA 1LE9A 3IS0X 2E3ZA 3SO3C 4YX2L 2VDQL 1TMQA 1YMHB 4I18B 1CGWA 2XWBA 4NN6C 2IEPA 4HOZA 1A1NB 1N4XL 4H5SA 1A6WH 4KHTH 4OAWA 1LP9F 1YEKL 3QWOB 4L4TA 4U6VH 5MERB 1RK1A 1C08A 1JMXA 5D7IE 4P46A 3W0WE 3BEVA 1NBYB 2XA8L 5ISZB 1EHXA 3S97C 4QWWD 5CZVH 5D2LA 3SGKC 3BI9X 1US2A 2HFEB 1RY7B 3T0AA 1DLHB 1OARL 4JZNA 5T5FL 4AT6A 2P8LA 2FCBA 4M5ZH 4K2UH 1Q94A 1UD6A 5A6JA 4OIFA 1HI6B 1T21B 5EBWA 5BV7C 1R86A 1ZA3B 3SDCA 3ULSA 3RPMA 5IVNA 3QWOA 4NZUL 1SBBA 2BVYA 1N0XH 4C56B 2NR6D 4JPVL 2IBZX 3OJ2C 5DRNB 3MRMB 4U1NA 2W92A 2APXA 3LSOB 1J10A 2LAAA 2YHGA 3HC0B 2D4FA 3HMWH 1H3GA 2RGSA 3MRCB 1E6RA 3J8F7 3K8KA 2J1KA 1KV3A 4FQJH 3K8LA 3LEYL 4PJAA 1U8QA 5BS0A 4UTBH 4QRTB 2JF7A 5ERWB 5E8EB 1DUYA 2YD6A 3QUZD 3O9WB 4G8EA 2D3NA 3SKMB 2F61A 1P7QA 3CZJA 3DRTB 5I1AB 1B3XA 5CEZD 3TBVB 5CEZH 5MEQB 3VA6A 4KZDL 1A1OA 1NOFA 3ZHDA 5I79A 3IKKA 3DARA 3KNBA 2X1IA 5ACZB 4JFXA 1UHVA 1J0YA 2PF0A 4X7SH 3ZYOA 2I60L 1CF8H 4F9PA 5CD3B 4UFJA 5HYIA 1FC1A 2GJ6E 4CDGC 1JK8B 2YRPA 3DMMB 5IWLA 1S9VA 4MNJA 4CADA 3PNWA 1F4YH 2X0HA 5C71A 2V7HA 5FV1L 1HDMA 4X80H 4EAMA 3EJYD 3SE3C 3MJ8A 3MLTA 4JFEE 2W0FA 1ZLUH 2GJRA 1D9KD 5CSGA 1CQYA 3IXAA 2ARJA 4FFWC 1NFIB 5EOTB 5HVWA 4QHNB 3AIRA 4HWEH 5JUEH 4MX7A 4JFZL 2BNRE 5H94A 3DX1A 4HUVA 1WKYA 2AK4D 4NHUA 4Y2OA 2X2YA 5A8QA 2CRZA 3QO0B 5I15L 3ARVA 2AXGB 2ZUTA 2A6JB 2E6QA 5HGGS 3CVHL 4K9EH 5IB4B 3GH7A 5IB3B 1XGZA 1UKQA 4ZQKA 1ISZA 4O2FB 2W0FB 3H7LA 4TVCA 4P9HL 5CZXD 2J7BA 1EHAA 1KJMA 3GNOA 1QBML 3MCG1 3PWPA 3WLWC 4TVDA 5E5MA 2HVJB 1II4E 5E7FA 1AMYA 4XNXH 5GZOD 4MSWA 3QUXC 2F53D 4ZXLA 4LRIC 5IQ7H 3QAZC 4OKVB 2N7BA 3BJLA 2G5BB 1E4KC 3FTGA 4FNUA 3RU8L 1OGSA 2FLRT 5GS1B 3GNPA 5HSFA 2EEDA 3UJJL 1MCKA 2AJSH 1YA5A 4NFDA 5AZEH 4WLCA 1EXPA 1TQBB 4JM2D 1V03A 4S11A 2I9LB 1FZKA 1HNGA 1W2KT 4X5WA 5EBLA 1NGPH 2NY0C 4UUJA 1CENA 2NXYD 2EDNA 4NRYB 3KZSA 3TLRA 3WMSA 1U8HB 3TBTA 4JJ5B 2WAHA 4E5XA 4TTDD 1DE4A 4KXZI 4QRTA 2Z9TA 1DR9A 2YC1A 4MQ7A 2OR9L 3FNDA 2V5TA 3WUGA 4MAYB 2I5YH 4H20H 1BM3H 2FDMA 2F1AA 4S1QL 2DQIH 1TVNA 1IZKA 1WO2A 4WV1B 1IL1A 3MMEB 1EVTC 4HWUA 5DQ9B 1MEXH 2YUWA 3UERA 3VKKA 4G9DB 2XNAB 4HG4K 3CXHK 3WF2A 2V9QA 5CUSL 4JY6A 5IFHL 1OW0C 1LNUA 1TTFA 4ZDHA 1QNSA 3GMPA 1AO7A 2X1OA 4OGAD 5D9MA 4H8HA 4CCCA 1HI6A 4K94C 4ZOAA 4I18A 1MY7A 4KRPB 2IUZA 1I3RA 3BISA 2F74B 2HP4A 3JTTA 5A6SA 4PJ8C 4WHCA 2DF3A 3T1WA 4LCYB 5IOPA 4AL8L 1XH0A 3EO0A 1D5XA 4RIRA 2OLHA 2VXVH 1NBYA 5ISZA 3RHWF 5CJ8A 1AI1L 3WUWB 3BH9B 2ZKHL 1QFWI 3OGOE 4X6BA 2N56A 4M1DH 4R0LC 1TZ7A 5D93C 3S6CA 3NABL 3LPGA 4OLVL 3V0VB 4PJ5B 5LGJB 4ONOA 4P23B 1NCCH 4AL8H 2BSRB 5LCVH 4BQCA 1TMCB 5DDHB 3FMGH 1KBBA 1FNFA 3O8XD 3U7AA 1OF2A 1LHZA 3CSPA 3F7QA 3L5XH 4HUKB 5CWSA 1QNQA 3N12A 1N8ZA 1UT9A 3SKJL 1TQCC 1SBSH 5E9DA 2PYEA 5FGCE 1MWAB 1TDQA 4JDZA 3KL0A 4KRPC 1HZHH 1H3UA 5GJSL 3F7VB 1XGRA 3PDOB 1MJUL 2Z31D 4J4PC 3SGEH 5JO5B 3VIIA 4MQXD 3PWPB 4YAQA 32C2B 1IVLA 2R1XB 4ZSOE 1FCCA 1S9XA 4UDTA 3QHOA 4RAUA 3ARBD 3S4SA 4AD0A 4MMXC 3B2UD 2WSPA 4LCWE 4HZLB 2AJUL 3T4AA 3TN0A 2O5XL 1EJ6A 4XAWH 1TG7A 4NJAH 2DIBA 4OF7A 1ISXA 2AJ3B 32C2A 1IGCL 1S7XB 3FRPA 4DOHE 4V1DE 4WY7L 1BX2A 1OAZL 3EKCA 2EDKA 3H9SA 1JZ8A 3ALFA 3ZDXF 2O5YL 1AGCA 3U46A 4NKOA 1EFXB 4BQ4A 2X4PA 1LVEA 4Z7VF 2FX9H 4PFEA 4PGDB 1WIPA 2JF1A 4JFEB 1U3YA 4WFHE 1LO2L 1KJMB 2ICES 43C9B 3RI5F 4E8CA 3IXAB 2A9NL 4UQ2B 5JIIA 4BZYA 5JIKA 2J7LA 1XD0A 1CFBA 2PCPB 4P4KA 2XFFA 2Y24A 2DSVA 4XP6L 5GS0L 5D7JC 3UTQA 1W3JA 3TH3T 3AYSA 3EFDL 3RVWC 4NHCH 4OLXH 1UZ4A 3ARFD 3JV4A 4U1SA 2Q8BH 4IIQB 1J8HB 1FVEB 4PJ7B 1QPKA 2N1KA 4ZQKB 1IAIH 2A6IB 3QCVL 5A2LH 1M6OA 2FDBP 1B0WA 4X4MA 4GI6A 4AEHL 2GJJA 1HKIA 1DBAL 3GMQA 1C92A 3U7YH 2MQ0A 3GMRB 1CICC 2E9WA 4TNWF 2FSEB 1UKOA 3BDBA 1BP3B 2GT9B 4BQBA 2R2EB 4FZ8L 4LASL 1G7LA 4NM4H 2DSUA 2RR3A 2V5RA 4OCYH 4AD2A 4XI5C 3AIQA 3VSTA 4FNSA 3FOLA 5HHNB 3VU2A 3MCKB 3ZE1F 3TA9A 2W38A 1E4IA 2Y07H 4PRIE 4AZGA 4P3CH 1KB5A 1OAXH 4KVCL 4ZUVB 5GNYA 5ABDE 4EN3B 4AH2A 3QQ4A 3HG1A 5BVPH 3IU3B 4MD0B 1J88A 3MODL 5BZWB 1UZ1A 3SKNB 2EE6A 1HQRB 1ZWIA 1GUVA 1I8IA 1DQDL 3A4WA 3QDMA 1TETL 1NARA 4WTXA 1CFNA 4MMZC 1E3XA 5F9OL 3LXCA 2YBRA 1INEL 1N59A 3WUWA 2WMJA 2VZVA 3AZRA 1QBLL 2JF6A 3I2CL 2VH5H 1OD9A 2AKRA 3L5JA 1X5JA 1I1YA 3HUJB 4OFKA 4OIBA 4UQCA 4HU0A 3W53A 4J3WA 4YZFE 2DBLH 4PRWA 3TZVA 3CVHA 4ZXBD 3GRWA 1QRKA 3ZSSA 3HI6H 1XAUA 2JCCE 3MLXH 2MANA 1YEIH 3WNNA 4YDLB 1Z6JT 4PRAB 3ROLB 1U2YA 3GRWH 1SYVA 7FABH 4U1JB 1G5AA 5F7FA 3UEQA 3AZTA 3IRZA 3RWCA 3X13A 2RBLA 5DVKA 2OK0H 3IJYA 4BA8A 3PZVA 1MCSA 1FZMA 4GKSA 5DFVC 1A7PH 3NFSL 3NCCB 1FFPB 5F7YC 1U8KA 3ULUL 1E9LA 4AEEA 4KU1A 1LP9A 4KI5C 3WUZA 5HVHB 3L7EB 1MFBH 1ZVYA 4Y2DD 1MPAH 2PCPA 4P4KB 1E0VA 1J1OH 1U8JA 1XF5A 5CSUA 2A1WH 3QXDA 4DGYH 4D6DA 4XP4H 3KWXA 5D7IB 3GSNA 5EULV 5GIRB 1RZJC 3WN5C 3DHPA 4XAKE 4ODWB 4F7TA 5I5RA 3BO8B 3P4LA 1UB5A 1RJZB 4HFUL 5I74C 4BK5A 1VAHA 2BC4B 4RFOH 4TSAH 1VFAB 4IMLA 4LKXB 4AZ8A 3WO4C 4IISA 4GI8A 3DV6B 2P5EA 3KXFD 1QFUH 1XRVA 3H0TA 5TF1L 3PL6A 1MSPA 1LO5A 2HYMA 5FKAB 1RUQL 2DDQL 1KCVL 1E6OH 2W07A 2CKBB 4F7TB 2XWDA 3UTZB 5CJ5A 3C2SA 1F45A 3FRUA 3WEMA 3WFLA 1Q6CA 1H5BB 3MMUA 1U3ZA 4URTB 1OPGL 5JR1H 4TVUA 3KLAA 3ZJKA 2RB8A 4JZJA 4X0KB 2DJUA 5C8BB 3P0VL 1GQIA 2V2TB 3MNWA 4HS6A 3D5OF 2C7FA 4CD5A 4QDMA 3OGCA 4UMGA 4MJ4A 5I1EL 1DQMH 5KSAC 5DD0H 3PXJA 4GSDL 4F15B 5KEZA 1OT1A 1KEML 2BSSB 3B9AA 4P3DB 3LKRB 2D7NA 1BD2A 5EFIB 1LILA 1VEMA 2BVTA 4YBLB 2LV4A 4FFVD 1ZT7B 4O4YL 3CGTA 4EDXA 3VXMD 2BFGA 2ESCA 3RDKA 1HXYB 3OBAA 2ZPKH 3WIHH 5TQ0L 2BJML 4GRLD 3HU7A 3W6LA 2VDLH 2PN5A 1VEPA 2AJVH 5E03A 1NFDF 3QUXD 1OGAD 3HNTL 5JW5A 5D7SL 2EJ1A 1EO8H 5ETUB 2VRJA 1E6JH 5FYLL 3C5JA 3S34H 4ODHH 3BDYL 3RTQB 4NZJA 2NTFB 4DVBB 4Y4KC 4RFNC 4PS4H 3CUFA 1MRCH 2HA1A 3T1FB 4XVSL 1HXKA 3UBXI 1WWWX 3K4ZA 3EO9H 4WUKH 3VWKC 5MENA 3SDXF 2XPGB 2DD8L 1YEGH 2NY6C 5KZCB 2GK1A 3VXQB 3QHTC 1OB0A 1A1OB 4NNYA 1KXVC 2YXFA 2UWEB 5T1LB 2OZ4A 3EYQD 5CILH 1BG4A 1MOEA 3UDWC 3QUMB 1M4KA 1KB5B 3SBWC 4DUVA 5IVZA 3FFDA 3WDIA 4JM2C 1IC5H 4I48B 1EAPB 2VLKD 4V2BA 1KTDB 1KB5H 1QSVA 3OR7A 5DMKB 2DQEL 3QG7H 4YJZL 3G08A 4ZTPL 3KYAA 2P45B 3VMOA 5TJWK 1QA9A 3L3IA 4OCXH 5IR1B 5C09A 3JZ7A 4Z78B 1YNLL 2QSQA 5D1ZB 4PJIB 3STZB 2K3TA 4RNRA 2A73B 4I5BA 1D6VL 3C09B 4N9OB 4UV7L 5IIEB 5ABFA 1T21A 4KROB 4KRNA 5FAAA 3NYDA 4Z7NE 3KYOA 2N7AA 5ILTH 1OSPH 2AV7B 2DI9A 1UEMA 3AAZB 1GC1C 1YPZA 3VM7A 3PWVB 2W9DL 4PTTA 4W6YB 4X7TA 35C8H 3WELA 2C3VB 5IFTA 1G9ML 4XCFL 2WQRA 3OWEA 1N59B 4WWKA 2VSCA 3VG0H 4QAWA 4BSWA 2R1WB 3MRLB 5DC9B 2J4WL 2KZ1B 4G80A 3OR6A 2N4IA 3RFZC 1S7WA 5C8JB 4OGYH 3CC5A 1Q0XL 2WBJD 5MHSD 2CIKA 3UPRA 2NW3A 4R4NC 1KJVA 3ILQC 5JNYA 3C6LC 1GL4B 3KYKH 4M6OL 2YD8A 4L9LA 4OLYL 4YDVA 1VBUA 1A6ZB 1G7QA 3BVNA 3NSMA 4LEXH 4OCMC 2L7JA 1KTBA 2FJGA 1U6AH 1ZEAH 1DBJH 5SX5H 4QTHA 4WWKC 2NZ9D 1YY8B 2XY2A 4EUPG 4K7FA 3EMQA 2NX5D 4RWYH 2VDPH 1IC4H 1RHFA 1KCSL 1VACA 2A77H 1T0PB 3L3KB 5F1NB 1DBJL 1T22A 2BY1A 1S5HA 1FH9A 3GMNB 4HKZB 1TQUA 4BQ2A 3B9KD 4PJ5D 1RHHA 1IEBA 4KK9C 1NWTA 3O6ML 1QR4A 2RJMA 2VLKE 4YWGH 3CZKA 1N6QH 5C0CA 3SDAA 2GFBB 1BVKB 4Q0XL 5A3ID 5FA3B 5HYJA 2DSZA 2VDKL 1KB5L 2CDEB 4NQTA 5IQ9A 1G7HB 5AYQA 3RWIB 4NZFA 1RMFH 1PKOA 1IEBB 4U5IA 2XQBL 2YPVH 3QISA 4D9RD 3S3JA 2ESVD 3A6BH 1QNPA 4W4OA 3SJVD 2ZOLB 3FN0L 3WD5H 5JW5B 3PZ9A 1PY9A 4L9DA 1U8PA 4RISL 4A2LA 3ZDYF 4LSUL 5CHNB 3U7WH 3V0VA 1BREA 4I1NB 5C1MB 1AXSB 1ZB5A 2F19L 1HINH 4RQQA 1TZGL 4RZCA 3U48A 3WV0A 2EEAA 4JFYB 3V6FB 3LX9A 2G5RA 1X7QA 3MRGB 3KPRA 3B9KC 4PJFB 1U8LA 4JG0L 4TUOB 4UV4H 5DJXA 4Z2HA 3O2VL 2Z92B 2ZJSL 1WAAA 5K9KB 3DHJA 1PZ5B 1HWGB 2EKJA 2NY5H 5FK9B 4NNPH 4PJEE 4KPHL 3RUGA 1K5NA 3QDJE 4YXHL 4GW5B 1CT8B 1EEQA 3ALWA 5E00A 4ZODA 1TXKA 5DK3A 1U41A 1XCTA 5ANME 2OK0L 5D9PA 1U8OB 1NC2B 3DWTA 4FQQB 4WI4A 3WQ5A 3MLWL 1JNNL 1OVZA 4CAGA 4D0DB 3G6DL 4YFLF 3MLSH 2ZZUT 2R9HC 4OZGA 3RWGA 1MCOH 3F5JA 1LDPL 4R7NB 1FYTB 4PG2A 1S3KL 3UESA 1AQKL 5F3HA 1S78D 3SDYH 3L4TA 25C8H 3C9NB 1T0OA 1J1OL 3O0RH 5CGYD 1P9MA 3CH8A 5CJOH 4F58H 3IU4H 5A69A 5AAWA 2R4SH 1JNNH 5KS9A 4I8DA 3FB5B 1K9TA 5IM7B 5JDSA 3ZO9A 1JPSL 1UD5A 1GZQB 4WHTA 3BH9A 3BP6B 1HJVA 4HFUH 1P4LB 5F3BB 4FTVB 5AEAA 1D5IH 4P9ML 4P9HC 1IGTB 2ZCHH 2DTMH 1YJDC 3REVB 3CK0L 3TCXA 2YS4A 3QRGH 4UFLA 1ADQA 4U4BA 2Z91B 3M8OL 3RWFB 4DGIL 3CU7A 5JBEA 4DCQA 4OLEA 4J3TA 1SR0A 2DQFA 3OKKB 4LSRL 1H0DA 5E2WL 1HXJA 1I7ZA 1SEQH 4XPHH 1E3ZA 1K8DA 3LXBA 4TNVF 2Q86A 4Y0GA 1IM9A 1B4JL 1IFHH 4RGOL 3T0VA 4Z6AT 4UFMA 5HD8C 3CH1A 4HHAA 4AG4H 2ATKB 3OL2A 3QRGL 3BUPA 1KIPB 5AUMA 2AJSL 2PTUA 2F8OA 4JFWA 1PFCA 5C92A 3GH4A 1VGKB 3ARPA 4M03A 4MA8L 1GCYA 3UBXG 4P0DA 2EIZA 5I1DA 2ADGB 3GSOA 3NA9L 4G3YH 4PGCA 3S7GA 3IFLH 3RVUD 1CK0H 1ISVA 3HI1B 5GRXG 1MCPL 2AP2A 1UACH 2HJFA 3N0PB 1ACYL 5AYBA 4QKXB 1KB9J 3D9AH 3B5HA 5IKCB 3IDYB 2Q7NA 1KIRA 3NCOA 4GAJL 4HPOH 5DJDA 4PJBF 2HJKA 4KK5C 1QUNA 4KDVA 1ZT1A 2C5DC 1TNMA 1QEWB 2WMHA 5KVGH 2VC2H 4TNWK 4L4PA 5JOFA 1ACYH 3WDHA 1IGJA 2QJDA 4M7KH 1JPFB 1K4CA 2IF7A 3R06B 1PQZB 3NN8B 4EBQL 5KS9E 3W25A 1YMME 3RX7A 1JF6A 1RIVL 4DN4L 3ARZA 1DHKA 5EBMA 4PSPA 3BDXA 3CX5K 4ZSOB 4OUOA 2VISA 3HE6B 2G2RA 4AZCB 3W0WD 5E56A 1OSZA 4R9HA 5T3ZE 2VDML 1IKNC 4U31A 2NY0D 5DA0B 3TVMA 1JNJA 2DQEH 3W4RA 5C0JA 3ULUH 3RWJB 3UCQA 3V5KA 1JGVH 5TH2A 2A74B 4FQXD 3MRMA 5FYKU 1KR0A 2UUDH 1VFFA 5E9DB 5HYSB 4BFBD 4W5ZA 5EN2B 5J0BA 2YBRB 1RU9L 1XGQA 3BXWA 1K85A 1GOIA 4NZCA 4YUEL 4EDWL 1M01A 1CFVH 2YUXA 5J13C 3CFBB 5IVZB 3BKML 1CICD 5H2BA 1B3VA 1A7NL 1NH6A 2P43B 3D69A 1B0RB 4A6YA 1QKZL 3UXFA 3WFBH 3PGCB 5HPCA 1HH9A 2HTLC 3E3QE 3WIHL 5KS9F 2VZTA 3CCHB 1YQ2A 1HOCB 1M71A 5BZDB 4QYOB 2OM5A 3HE6C 4QLLA 3WL0A 1JXKA 1ORQA 2YD3A 2FEDC 3KPPB 3SCSA 4CVXA 1ZU8A 4PRAA 1ITXA 3MA9L 3QI9A 3UZQA 3TH2T 3MBEA 1WCBA 4OJFH 4HZAA 5H35A 1FP8A 4MS8D 2EDBA 4Z8FL 5FECB 4YHNB 4V2CB 1MXGA 3QXWA 4HZLA 3EYFA 3QUMH 2F74A 5BV7B 1P5VA 4H1LA 1GQLA 4N8CH 4JANA 4UQ3A 2A3HA 4J28A 5BWFA 1FFOB 1XCWA 1LO0H 1DBML 2BMKA 1PGRB 1H9VA 1ERNA 4Y7EA 2ADIB 3TNMB 3AXLA 4ZUWB 4HBQA 5I78A 4RDQF 4KY1L 3EHBD 1I1YB 3BT2H 1FZOA 4HMEA 2NW2A 3MLYL 3RRQA 5AWNH 1IC5L 4YBHA 4Y5VC 1I1AD 2ZKHH 1UM4L 2OJZL 5EO1A 5CEYA 2FBJH 5SWSA 3RJYA 4F57H 4LHUA 1B6UA 3PWLB 4PJ8A 4P8XA 1EO7A 1IBGL 5IT2L 4DKEH 1NCCL 4G9FA 5LKNA 5T1LD 3OAUL 3SHSA 5IHLB 4N0CD 1RIVH 5E2JA 5DUPH 5CP3H 1ADQH 1E28A 1VADA 5E4EB 5I71B 4IMKC 4M62H 1XYZA 4HEPG 1UGNA 4AEIL 3B2UC 3AXLB 4CCEA 1MHPL 3PDOA 2QQQA 5HDLA 4WTZG 1OLLA 1HJWA 4NKDA 4LSDA 3G9AB 4PMDA 1QW9A 1UWGH 2XWJA 4NQCB 4LLQB 2X44D 4Q7DA 4OKVA 5GGUA 2XPKA 3AI0A 4NX0A 4LVOC 3K3QA 1UUQA 1C91A 4J2XA 4OCWL 2I27N 5HHVL 1KXVA 4NFCA 2EDDA 5DD5L 4UOQA 2NSXA 4D9QE 1CE6B 4OT1L 4DOHB 2PUQT 4DO6A 1N6UA 1F2QA 3QUZA 1TVDA 4H1LH 4Q9QL 1XH1A 1FH7A 3E3QC 4LEOA 3ESVF 1TFVA 3QT2A 3AMLA 4RGNE 5F7UA 2X4RA 4WHYH 5I1CH 4PJ9B 4FA8A 4L8DB 4NWUL 4J3XA 1MAJA 3CLFH 4JCMA 1ES0A 1JTOA 2ZUXA 4JO4H 3WE6B 1NCBH 1RK0B 3QEQD 4N5EC 3K80A 4HUXA 4I3SL 1OCWL 3QUZB 4GLRI 2Y2WA 4HUWB 1LL4A 3HNVH 1HXMA 3A6CL 2B1HH 3AY4C 3ARDD 3PWJA 3KLLA 5HPMB 4C56E 3N1AA 1VGEH 4Z7WA 2XWTB 1MFAL 2EDHA 3D3VB 1Y0LB 1EK3A 1ZT4A 2WXDM 2AABH 2I24N 2PO6C 4X6EA 3HCVB 2AKRB 4OZGE 3WIFA 3PWVA 4Z77B 1OBAA 2WVVB 3GBLA 3DUSA 3NFNA 5E94A 1I1CA 1P9MC 1HHKA 1TENA 3VGAB 3QP3A 1EFQA 5C08A 4F8XA 4XBGA 4JO1H 4O02L 4TUKH 1JYWA 2IAMD 3SCQA 2VRQA 4XI5D 2FBJL 3EYOA 5T5NF 4MD0A 2FJFB 3K4DA 1A6WL 2NW2B 4N0RA 1KCLA 2AEWA 4RBPK 4YH6A 4R0LA 3FQTA 4MNQB 4MXVE 1OP3H 5F1IA 3VFPA 4PJGE 3S98A 3OKMA 3MRKB 4ZMAT 4LHUB 1ADQL 2YPKB 3CFEA 2FATL 5JPNB 1NC2A 4FQQA 4L9LB 4YDVB 1BYBA 1OF2B 2B8OT 3DTXA 3TBSB 1OTSC 4XCNA 5FGBA 4F7MA 2AQ3A 3GSRB 4J3SA 5FCZA 4NZTL 1OGTB 3KR3L 4EQ2A 5F9WB 1MCQA 2H2PC 3BUQA 2CDGA 5DRWB 4B3LA 4XXDA 2BNRD 3LV3B 1JN6B 5T3XH 3PTKA 3PABA 1YEHL 2E7BA 2HG5A 5HI4C 4CN1A 3LKPB 4NHCL 2Y8VA 1MI5B 4XVJL 4MXQC 4NZTH 1AD9A 3CXDL 4GRWF 3BAKA 4NSKB 3SUUA 5JBDA 4Y2DC 3UYPA 3HMXH 1T6VN 4KWUA 1UWXH 5EFDA 2BOCA 5KSAA 3CZFB 3LKPA 5D7LB 1DVFB 2PI6A 3KE0A 1F4HA 5GZND 1UXSA 3S36L 1W0VB 3NA9H 4HJJL 1ZT7A 1KYOK 5SV3A 3ZYZA 2GUOB 3Q1SH 1NGYB 3UJJH 1EGZA 3UBXA 2R15A 3CSGA 4LVNB 4G8GD 2F19H 5CEZE 3RGVC 2CYGA 2NLJA 1QNRA 3QPQC 5BQ7B 4M6ML 2JJTC 1NGZB 1VGEL 1F11A 1IQWH 3VH8B 4P7LA 4XZWA 1Z9SA 1V3KA 1FNAA 4YGVA 1W3LA 1KNOB 1IAKB 4PJHF 3FQNA 1KPVA 1V0NA 1MQRA 1QWUA 3QNYB 1S8DB 5M5DA 2IALB 3QA3B 2FX7L 1OM3L 2RHEA 5E1AB 1EQCA 5IGXH 4P5MA 4ODHL 2XPGA 1RAMA 2DSKA 2YSSB 1LDSA 1KNOA 2X89D 4Z77A 5TDNA 1VBRA 3MA7B 3RO8A 2CLVB 3FZUC 2ZSWB 3DOSA 4N8PA 3BLPX 4YK4B 1JTTA 1T5XB 5B39A 2F5AL 4H26A 1DQTA 1ZHKB 1J1XL 3VRLE 4MNKA 1LO5B 1FE8L 1XSKA 4DVRH 2HFFA 4M48H 1UH2A 1HJSA 3BH4A 2D20A 4JPWL 2MJWA 3UROR 2CLRB 4QRPD 5CIPH 3BUDA 1BLIA 1HH6B 3QQ3A 3OF6D 4S1SL 3SDCB 2XN9B 4XZUA 3GMOB 3P9WB 3SE4C 2X4NB 4YHIB 1DUZB 1IT9H 1E4WL 5I75B 4C58B 4LPVA 4PRIB 5I2UA 4JO2H 1WDQA 2IALA 1U8MA 3BSGA 2NPLX 5IF0B 2DQUL 1CL7L 3O45A 1YNLH 3TBWA 4MXWL 1OAUH 1Q9OA 3CUIA 4NCC1 4AIZA 1RK1B 1U36A 2XQYK 1K2DA 4YZFF 5DVOA 1L4IA 3CUHA 4PRBB 3THMH 3VDHA 1D5XB 2OSXA 3VNYA 1EJOL 2HLFD 4NQCD 3Q6GL 1D2KA 1NLBL 3RY4A 5JHDB 3AAZA 1WEJL 4HWBA 5TE7H 3SUSA 2BOBB 3ARBB 5DRZB 3HC4L 5ACMA 3NIGE 3HNTH 1F2XK 1W72L 1FGVL 4W85A 5KVEL 1KN2L 1BQHB 1MNUL 5EBWB 1MYRA 4Q6IC 5HHPA 1NBQA 4S1QH 2BRRL 4ZOEA 3WJJC 1A9BA 2RCSL 4PBWD 1S9VB 4QRSB 3EZJB 1CECA 1QP1A 5A6MA 1B0GA 4KY1H 2AI0L 5EIIA 4W89A 1QNZH 5DFVD 3CU1A 1XF2A 1KR1A 1D6EA 2WVSA 2R4RH 4P7RA 4PY8I 2OL3A 3BP6A 4BFEA 3L5IA 4Z7OE 1UJTA 3UDWA 4L3ED 4NRZA 1UR1A 3FFDB 3NAAH 4F2MA 5AD0B 1QI2A 2GK0B 3WIHA 3OMZA 2YBUA 1DBKH 1ZHNA 3OSKA 3ALXA 3OX8B 3DYMA 5DR5L 4GKZA 5KSUA 4UZGA 4ZXBC 3ARBC 4YNYB 4CU8A 1C1EL 1A9BB 1NEZG 4L4VE 3WUEA 4Z7QF 1JPST 5KVGL 2DEPA 4Y5VB 3IDGB 2IFFL 3ARFB 2CH8A 4X8JA 2EXOA 1IGMH 2GUYA 2BY3A 1U3HC 4JFQB 1F4XL 4JB9H 3D4ZA 3UTPE 1US3A 1Q1JL 3WD1A 1S7WB 5C8JA 4MCZA 4HEME 4XNZB 4GRMB 1B6DA 3OAYK 1D9KA 5F89B 1SYSB 4NFBA 4R6UA 2YFOA 4HW6A 5FYJD 1H3VA 1PSKH 1GOKA 4M1RA 4N1CA 4PR5A 3H9SE 2ITDA 3BWAB 2X2IA 4KAQL 4M43L 5ABEA 5GGRY 1T1WA 4JGUA 1S7QB 5IEKB 4WEMB 5BW7A 4YGAB 4IRJB 1IC7L 4HF5H 2B4CC 3L5WA 5KTEL 1U8HA 4P5TC 4JZJB 1UR4A 4NUJA 1YYMH 2WVTA 3CPUA 1W2PA 5C86A 4U33A 4LLUB 1Z3GL 1UM4H 2R56H 3PWPD 4WDIA 1X1NA 2VCCA 5HHXH 2IBGA 2WUCH 3MRQA 1K5NB 1XHGA 2IANA 3MV8D 1P7QD 1DDHA 3EYVA 3QHFL 5ALBH 2IGFH 1R85A 4ZO9A 1D5MB 3Q3GB 4WSJA 2FEDD 1KLGA 4OLZH 3ZQ9A 5HHMD 4NKQB 5E9DE 5I17A 4HUXB 4YC2C 3VXPB 3WH8A 2VITB 3RNKA 1N82A 2ZXAA 2EPMX 2B7DT 4M8QA 2A9NH 4I4WA 3REWA 1KXTB 2WBKA 4LNRB 1KGCD 3PL6C 3PZUA 3QXAA 2XZCL 1VFUA 1UWSA 3ARFC 3C5SA 1MHHB 3WFCH 4UFIA 2WWMD 1PBYA 1Q9LA 3T77B 3SY0A 5KS9B 4M6OH 1HDMB 4GMSL 3VFOA 1HVQA 2ZOKA 3BKCH 3QJHA 4G8IB 3C6LB 3F12A 2RQ8A 4I13B 1AGDB 4ZO8A 4PREB 2JIXB 2Z8WC 3TN0C 3AZSA 5DXWA 3GJFB 5EO9A 3VD5A 1K4DA 5CP7B 5GISL 2J79A 2CKBL 5K9JH 2JCCA 1BWMA 1V6VA 4QRQA 3MKKA 3ARGA 5EZJB 4P8WA 1N5YH 3FCTA 4ZS6C 3IJ9A 3RVVD 1DFBH 3TO4D 1HJQA 3ILPB 4PTUA 3MUGB 4XTRD 2DT2A 1VENA 4BYHA 2ZCHL 4F9DA 3UTSA 1GOHA 1S78C 1I7ZB 3WXWH 5HHQA 4JFXB 5F89A 1Q6FA 1DL7L 4UOZA 2VXQL 3BMVA 5F9AC 1AD0B 1ORSB 2CDFA 4YDLC 4DCQB 5A2AA 4LSRH 3CC1A 1ZKAA 2UY4A 1RUKL 4NM8H 4QRPB 2XT1B 3EHBC 3K74B 5CGTA 3T4YB 4BKLA 5BVPL 3KLHD 3VIKA 1RZ7H 5D1QC 3CHCA 5LQBH 3O3BA 1RUMH 4U6HA 4P7QA 1S9WA 5D2NB 5D7KE 3RA7L 1RUPL 3K0WA 5A2CA 4LCIL 3WQ8A 1A6ZA 3DSFH 3CFDA 5AG8A 3PN8A 3WF1A 3P0VH 2YDSA 1FNLA 1BQCA 4FLRA 4OTXH 4YHMH 5HGHB 3F65A 1NEZA 1MLCA 4FG6D 4JDVA 4ATWA 1DLFL 4JRXD 4J8RA 1EUUA 2MQCA 3U79A 5CLWA 1TZGH 1ECEA 2MCG1 1W9VA 3P9LB 4ZS7H 1C12A 1QLRB 2K7QA 2FWOA 1YY9C 3KPSE 2A0LD 3GSNH 4UNIA 1JJUA 4OD3L 1P6WA 2R4SL 4MNQD 1IC1A 3I85A 3E8UL 3P3YA 1F5WA 1RZ8A 3RWDB 1MVFA 4AENA 4P4KC 3WFEH 3SDCD 2VQ1B 4WFED 1E6JL 3MANA 4EBQH 4HS3A 5IMOB 4JO1L 1BGXL 4O02H 2DQXA 2EH8L 4IEFB 3TNNB 3V4VL 3LEVH 4HGMA 2WANA 3WD2A 5CEXA 2XWBB 5K9QI 2GJZB 2HVJA 2A6JA 4FFVC 5JXAL 4LFHG 4GG6A 3PG2A 2NXYC 3ZT5A 1ES0B 5IHSA 4M8UA 1NKOA 3IS1X 4WGWB 4KHXH 2I07B 2PXYC 5AY7A 1L0QA 4FZEH 4HWNA 2GYSA 1I9EA 4P4KD 4OD2A 3TEUA 4C59B 5A43C 3AFBA 4PMYA 3GRWL 1C8PA 3IF1B 4KKAD 3VUPA 4JFOA 4MAUL 3VWJC 2WKLA 4DZ8A 1ZT1B 3AHVA 2B1AH 3SCVA 4LSSL 2CITA 1G9NL 1MCWM 4CW1B 4HIHA 4U1IB 1SZNA 2JB5L 5FGBC 3LKSA 2XFRA 1D5IL 4P9MH 3GJEB 1FH5H 2O9PA 4FNLH 3HKFA 2DIJA 1H15A 3DX7A 1D6VH 3A6OA 1UXWB 2DKMA 3BVWA 3GSWB 4H25B 4Y4FA 3UYOD 2DSWA 2GAZB 2AV1A 4TVPD 1I1WA 1D5BA 2WHMA 3GMRA 5ANMB 1OSPL 5GSVB 4DGIH 2VL5A 2XGBA 3TN0D 2YPLE 3O4LD 3FZUD 3S2CA 1VKXA 5HHOD 1FO0L 1NGPL 3VDBA 4R90H 2F1BA 1RZFL 2G60L 1HXMB 4JZ5A 1CDIA 2BCKB 3EBVA 4L3CA 2E7CA 3QO0A 4HJJH 3IDJB 5T1DH 3DURB 4PJDE 4OIIL 5DT1L 2Y7QB 3BUYA 1T7VA 3QB7C 2JJSA 5D9SA 3LKOA 4DUXA 1FZMB 4HHAB 1OTTC 3VXUA 3AREC 3L7FB 4BQ6A 3RP1A 4OZIB 5D2LE 3HS0A 4Y4FC 4EZMA 5DO2D 3MJGX 3KWWB 3NCBB 1GC1H 1EQPA 1IGFL 1Q9KB 4XC1L 4PCSA 1UACL 5EUOF 4M1CD 5C07E 3RVXD 4RIRB 3W81A 2V3EA 3S37X 3L1OL 2VMFA 3NCEB 3BPLC 3VTRA 5A2FA 2YKLL 4LARL 3WUWG 5IMMB 3KJ6L 4JAWA 5HJ3B 4GBXC 3EYFB 5T33L 4AXNA 4QRUA 2FJFA 1JK8A 4BKLB 2C4FT 1OLZA 5D1XA 5FUOH 3VXSD 1WCBB 1AI1H 3VWJA 3F58H 3JV6B 1GHFH 5F88A 5IMOA 4WHTB 2OYMA 1AO7E 5HYQB 5J4MA 2XV6B 3RPIA 1J1XH 4XPTL 4OFPA 5FYLH 3RWEB 2F7RA 4TULH 3UTSB 3SGJA 3FB8A 4XXCC 3L3DA 2DJ4A 2YRZA 2Q86B 3PGFL 4D72A 5IMMA 4WSKA 3MRNA 3VH8G 2ZUQB 5D2LF 1PKQA 3QUKB 4YBQC 5BS0B 1FP9A 3HLAB 5SWSE 4MVBD 3SDDD 2A0LC 3SDXB 2C3XA 2JIXD 5GRZA 5A6AA 4GH7B 3LS4L 4KKLD 3TO2B 1HT6A 4CKVX 4XPGL 5IB1B 4P4RA 3TO4B 5HDQH 1G7MA 4YPJA 5J6GA 4A3HA 4KMTH 1Y18B 2DQTH 3MA7A 3HFMH 5MEOB 3L4VA 3HAEA 2R0ZL 5JA8B 5GSRB 3M6DA 1RP8A 2OQJA 2WHLA 3MYJA 5HDOA 1L0PA 2VQUA 4NT6A 3NTCL 4NF7A 5ANMA 5C3LD 2C8NA 3WY1A 4C7FA 2UV3A 3BP4B 1FYHB 2VSDA 1FORH 3ZR5A 1HHKB 4BA0A 1CFNB 2XRAH 2A6IA 3KHQA 2H32H 4RMSA 3WQWA 4Q6YA 3RL1A 3TZVD 4D71A 1NSNL 3HCVA 4MWFA 1KFAL 4LRIA 1I7TB 3PP3H 5HVFB 4I0CC 3IDNB 4KPHH 2HJKB 2K1MA 2UVFA 5D96C 3RUGF 3WE6A 1WZLA 4UOW0 4PJCF 4MDJB 2OYPA 3SDCC 4NDMA 2AGJH 1X5KA 4L8BB 1E6QM 3MJ7A 4RWYL 1XZ0B 5L0QC 4HDIB 4EUPB 3RI5K 3FT2B 2J8UB 4OLVH 4AIZB 3KWWA 1FNEB 4G9DA 1LL6A 2AERT 4R3SB 3MLWH 4DEPB 4IOFD 4NJ9H 3GXDA 4AZ7A 4MDJA 2W66A 4J3VA 1EVUA 4L4TD 4Z2IA 4H26B 1ZAGA 1IAOB 2Q8BL 4PRHB 1BTCA 3MBXH 5GGSA 1OSZB 4P2RD 4PJAE 1AP2A 3BVVA 2BNQE 3GIVB 1NOUA 2FJHB 3U7BA 1AXTH 3WN5A 1HH6A 3QQ3B 1BX2B 1B88A 5DJ2B 2RFXB 4EUPA 1QNOA 2P8MA 2OMNA 4J7RA 5GS2H 4ZYKA 5KANI 1A3LL 4Y5XA 1CBVH 1ETZB 4PLOB 1JV5A 1F6AB 4HIIB 3CVHB 1Q9WA 2R0WH 4ZNEE 4BZ2H 4OLWH 3BW9B 1H15B 15C8H 1J05B 1FFQA 3DX7B 1UWGL 3H3BC 4LF3A 3TIEA 3W9EA 3FW6A 2NTSP 3UTTE 5GGVY 3BAEH 5CJXC 3MOAL 3SPVB 4JREC 3JWOC 2XZQL 4JHOA 4YBQD 3LRSB 1FH8A 4IRSD 4JPKL 1F6AA 1WK0A 2P5WB 2D4DA 4LDLB 1N6VA 3FQUB 4XT1C 1K3ZA 4JRXB 2WWCA 4TTUA 5C09D 4OQTL 1UWRA 2RFXA 4MNHA 4JPVH 4Y19B 5FYKE 5JHDE 4R96B 1OP5K 1XF3A 2Y9RT 3BZ4B 5A95A 4YGVB 2VJXA 2VLMD 5CEYB 4W86A 1I7UB 4WKHA 5F9OH 5C0AD 4Z2JA 3WSQH 3BQUB 2DBLL 2PR4H 1YY8A 3VWKA 4NRSA 3WFZA 1LD9B 1JFHA 4FQPA 4HA4A 5E7BA 2MHAA 3U0PB 1SYVB 1JV5B 1CLZH 1X4ZA 2QKIA 3MR9B 3QH3B 5CCKH 1S3KH 4S1DC 3I50H 1MCCA 4HPOL 3T3MF 3QDAA 3EMCA 2DLEA 3G6DH 2YXMA 5L6YH 4EKJA 3NSNA 3MLXL 5AC4A 3SOBL 3V4VH 2WK2A 4L4TE 5DA4A 3RL2A 2MHAB 3RIKA 4XVUD 3CDGB 3IDNA 25C8L 2NW3B 5EPMA 1ZHLB 1NUNB 4YHOH 1ITCA 1YECH 1MW3A 2UY5A 2ED9A 3QHNA 1QLRA 2VXUL 1F4YL 4HMDA 2DJSA 1X5YA 1KT2A 3CZGA 5I8OH 1FE8H 3P73B 5CWSB 3QDGD 4RGNC 2C3HA 3BPCB 1HSAB 3VXNA 5D8WA 2X10A 1CPUA 1FNEA 4MS8C 3QIUD 1JHTB 5IVXA 2CGRL 1CE6A 2PYFA 2MNUA 3QG6A 3MTRA 3LPPA 4AYSA 3QDMD 1JZ2A 2Z8SA 5GSRA 4K7PX 3MUJA 3CK0H 4IOIA 4W84A 4XH2A 3NIYA 3VINA 4K71C 1HSAA 3VXNB 2E7MA 3Q0HA 3PGDB 2IPTL 2DH2A 1QFUL 4PBGA 3T8XB 2WBWB 4RGOH 3JWNC 1HJXA 5DGRA 4HXAH 3VA2C 4ZXBA </