3VOGA

Catalytic domain of the cellobiohydrolase, cccel6a, from coprinopsis cinerea
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
362
structure length
362
Chain Sequence
VPSTGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellobiohydrolase
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
total genus 137
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3vogA00
2BOEX 4A05A 1TMLA 1QJWA 1HGYA 1OCNA 4B4FA 4AVOA 1HGWA 3VOGA 1UP2A 4I5RA 3VOIA 2BOGX 1UOZA 1UP0A 2BOFX 1DYSA 4AVNA 3RPTA 4AX6A 4B4HA 1OC6A 1OC7A 2BVWA 3RU8X 1BVWA 4AU0A 1OCBA 4AX7A 4I5UA 3VOHA 1QK0A 1OC5A 3VOJA 3ABXA 1UP3A 2BODX 3A9BA 1QK2A 3A64A 3VOFA 1CB2A 1GZ1A 1OCJA
chains in the Genus database with same CATH superfamily
1JCXA 1C8XA 4YJ5A 4MWAE 4I9JA 2VGBA 3AIUA 1EPVA 4TO8A 3VKDA 1EGVA 3SRDA 3DI1A 4WGHA 3BAWA 1NP0A 2BY3A 1W91A 4LWWA 4V15A 2OODA 1VH7A 3CIWA 3MHUA 2H3BA 2QDDA 5I07A 1EDQA 4ACZB 4H9MA 1RPXA 4DYEA 4N2YA 1RQHA 6XIMA 5FEZA 2VXNA 2CLEA 3R58A 1S5WA 2O56A 1KTNA 4DAFA 1IWBA 3NYZA 2PDWA 1W3LA 2Z6JA 1GYLA 2UWFA 5FD0A 4AAJA 5A5WA 4V33A 1AMKA 3FVDA 1GZJA 5HMSA 1X8FA 2PDKA 3PP7A 4TX8A 4LYRA 3ZJ7A 4D6CA 2R1KA 5K3VA 3R7MA 2FH6A 4F79A 4PB4A 5LHEA 2VRQA 1FFRA 3SUVA 1GK8A 5FF2A 5I24A 5K2ZA 1G9HA 1RV8A 3QEZA 2C14A 2AKZA 2IS7A 2B7QA 4ATDA 1Y5WA 1HIZA 1QNVA 2C3ZA 1OCJA 2OQLA 4JTKA 3WY1A 3OZPA 4JFVA 3VNDA 1W3KA 3MU7A 5LHFA 4WDUA 3KOWA 3EGJA 3LERA 3AZTA 1HKVA 3I68A 4H41A 3O7UA 1JGIA 4S3DA 3B03A 2O92A 4XKYB 5FJRA 4IFKB 3MZNA 1KR0A 3WNNA 2C71A 2VEPA 4M29A 1DJYA 2HE8A 3APYA 1WKDA 3GG1A 3LTYA 1KA9F 4C6KA 4H8VA 5LNUA 3UY8A 3RO6A 3KE0A 3LPGA 4CQ9A 1TR1A 4HU4A 2IW0A 4HK7A 2HWGA 4O8RA 1C9DA 3NEVA 2PU1A 3AYTA 2O7SA 1ONXA 4NZFA 5EY5A 1RCQA 1JNEA 5TD4A 1DWJM 1RLCL 3VDBA 1FWGC 4RK8A 2PTZA 1BTCA 5KMYA 3WUBA 1PPIA 1E71M 3UG4A 1EH9A 1X39A 3ZM8A 3RX2A 3QHNA 3H54A 4AWUA 4AZHA 2REQB 2BXVA 3NDYA 2VI0A 5IFTA 2E6YA 1ZCOA 9XIAA 2J7DA 1EZWA 2D1ZA 3DFQA 3W7NA 3EWZA 1OGSA 2XIQA 3ICJA 1MRQA 1Q7MA 1Z42A 1Q4NX 2YKKA 2WVSA 1P6WA 3GNDA 2BS9A 1Y5VA 4MJ4A 2F7FA 5AZ0A 2EJAA 2CITA 3TFCA 3WNOA 1QDSA 3ARRA 2DT2A 3LS9A 3CAQA 4LTSA 5I3JA 4KCUA 4G1NA 5IDIA 5JUVA 5U7SA 3WD4A 4DB7A 3OGSA 3AIRA 2WBKA 1RP9A 2F38A 3RDKA 2PLJA 2OTDA 5FL0A 4AH7A 1QTWA 1R86A 4L6OA 5M1TA 3NQVA 1LG2A 2WO5A 1XH0A 1AW1A 1V3IA 1EX5A 1IZCA 4I8YA 4CD4A 4GUJA 4BEUA 1ADDA 4EF8A 5A6BD 5D09A 1ZHAA 3WSUA 4ZOAA 3HB9A 4GRSA 4UB9A 5CPMA 1Q13A 3NQEA 3WFAA 2Y62A 3ARPA 1PTGA 4H83A 4L7ZA 3MUY1 5CPNA 4LYKA 2OLSA 1C93A 2DZPA 4NRSA 2QKFA 5DMLA 3AU6A 2B4GA 3NOEA 1TPH1 3URQA 1SFTA 3B9EA 1R0MA 3N6JA 1SO6A 1E4LA 2A1YA 1TMQA 2TAAA 3LXBA 2A5HA 4Y8EA 4X9SA 1VCVA 4I5UA 1SFLA 3UYIA 5KINA 5L9FA 4GX9A 2CHRA 1CLKA 1V0NA 5HOSA 3GR8A 3PB2A 2Z1BA 4ZBCA 2ZC1A 3W76A 3N19B 3ARUA 3RXZA 3D47A 4HMCA 4GKLA 4GINA 2BY0A 5D05A 4JTEA 3KP0A 4MDOA 5HQEA 4FK9A 1VRXA 3PSWA 2GOKA 1PBGA 1K8XA 3WMSA 2PBOA 3OODA 2P1FA 3MT1A 1GEQA 4ZA0A 3ARTA 2O55A 1TV2A 3L66A 1MEWA 4H7CA 3NM3A 2D2JA 4O13A 1BYAA 2VGGA 3SR7A 2V9DA 1QBAA 1WKFA 4GMEA 1W2PA 2CFFA 1XP3A 3GS6A 1GVIA 3EX3A 1VKFA 1QJWA 3LPPA 3BSMA 5DO8A 1BRLB 3K1DA 4IJCA 3KTSA 3ZIZA 5IOBA 4ATLA 5FF4A 5A2AA 2WHKA 3GC5A 3WMBA 4TV6A 1NAL1 2QCDA 3G1DA 4BQ5A 2YYUA 4H6QA 4N42A 3UZZA 5LIUX 2OMAA 3KCLA 1FHLA 4IH3A 3MDWA 3NL5A 4JHOA 4MZ8A 4QHRA 1Q2RA 2G3IA 3KBJA 1B3ZA 3BLEA 2F6XA 2GVEA 3RAOA 4TX6A 4C1KA 3WQ5A 2ZZ6A 4UQAA 1POJA 2PF8A 1EPXA 3ABSA 3C8NA 1H2JA 1QI3A 3N6HA 3LTPA 3T0AA 1TTPA 3UNDA 4JQ3A 4IIDA 1W3NA 3QW3A 4NXSA 1KFKA 1XIFA 1XLCA 2OR2A 4MUZA 3BARA 4RR4A 4JEJA 4L4LA 2P53A 3WDRA 3WJSA 3GH5A 3I3BA 6A3HA 3WLNA 2HS6A 2ZRYA 5LIKX 1W56A 3NO5A 3TXZA 1THFD 1TPWA 2PDQA 4CVWA 3IGUA 5HATA 1F6PA 4FLSA 4BWLC 2QHAA 3P60A 1RR2A 1RJPA 1AQMA 3RILA 5E5CA 1UR9A 4R9XA 1TV5A 5HMEA 1KC7A 3UG5A 3OBKA 2AMXA 4XG1A 4Z2GA 1UUMA 3JW7A 1SQ7A 3L4UA 4ERAA 4O1EA 4UFHA 3N34A 1OZQA 3KBNA 1D7KA 1OQFA 2H90A 3QZEA 2WMFA 3W25A 1NELA 3C2YA 3G8RA 3JZUA 1Q7ZA 1QO2A 2VC7A 3ORWA 4NRRA 3ZXWA 3W22A 4W93A 1EJSC 2CETA 3ZSSA 3ATYA 1G1YA 1WBJA 3F4VA 5MKGA 3S83A 1ME7A 4O1CA 5JBEA 1I60A 4H9VA 2EPKX 2CZFA 3JVAA 3KRSA 2HNHA 1UA7A 2X1RA 2OEJA 2WC4A 2D3NA 4EANA 1Y5XA 4LS2A 2Z00A 3UPBA 4JIIX 5FI8A 4M3PA 2OX1A 4QLJA 5D37A 2QW5A 3M44A 3ZSTA 1KFBA 3TW9A 1B57A 3A47A 4TX9A 1CDGA 2VURA 4JTQA 3DBNA 3FYOA 3LB0A 1QHZA 1UP3A 4B9ZA 3CMGA 4Y90A 4GY0A 1FDZA 1XLDA 3GDBA 3I10A 4GNVA 3RM4A 1LOLA 5DCDA 2BY2A 4CNPA 4LALA 1OADA 3LGGA 3SECA 1WCGA 1OFEA 4QBXA 3GB6A 3MYPA 2D0FA 3B05A 4NKCA 3DC8A 1C91A 5HAOA 3HA1A 5LIYX 4JIPA 4XAPA 4PE8A 2RKXA 3LMZA 1CT5A 5G2WA 4HOXA 1TMHA 4DPQA 4GQQA 1VLWA 2RDUA 4J3VA 3TU9A 3QXBA 5E6YA 1VCFA 5EU9A 2NT1A 3MSDA 3TE9A 1XGEA 1UKPA 2QCDB 3CMJA 4K8HA 1FWEC 4F8XA 1BVWA 4S38A 5FF0A 1UR0A 4LAOA 5JQ9A 4WOQA 2X42A 4Q22A 5C71A 3M16A 2PDGA 1LLOA 1MUWA 3S9IA 2BHUA 2RJGA 3BQ6A 3F7JA 3LXAA 4RV3A 2XFYA 2Z0IA 3BZGA 1H5VA 5A8QA 2ON3A 4D71A 1V5XA 5HJXA 2V5BA 3ARXA 2VFGA 3WK2A 4E8DA 5J04A 1Y0EA 2DT0A 4Q4KA 3HGRA 4G7FA 3GWQA 1XLIA 4KEVA 4GC3A 3UGRA 2VRKA 3GO2A 3MHFA 4O50A 4YIWA 1JPMA 3PUOA 2RFGA 1AQFA 1GWJA 5I5RA 1F61A 1G6CA 1J0YA 4B5SA 3LNPA 4IIHA 3WKZA 2O0TA 2PTWA 2DDXA 3GDMA 2QGHA 5CC7A 3NTYA 1KFEA 3G1FA 1U5JA 1C9WA 4AEFA 1JDEA 3BMVA 4PFHA 5K9XA 1CW2A 2WK2A 3W02A 2OZ3A 1K7XA 1UR4A 1ODUA 4NI8A 1W3IA 2C13A 1DJGA 1G0CA 3FN9A 1OINA 2E6DA 4H00A 2G97A 3GVRA 1IIGA 4L1GA 3QV7A 3IGSA 4NU7A 2WKLA 4KF1A 4WX2A 4J2MA 3NDZA 4NX5A 4C6PA 4IZGA 3WK1A 3ZWSA 1JI2A 1JZ2A 2V82A 1KM0A 2GFTA 1WA3A 3KWXA 3MS8A 1RAKA 4XUYA 2ZUUA 1VJSA 1OBAA 5CSYA 3VIMA 2J79A 1UBPC 4XV0A 4MFDA 1XISA 3S0CA 4M56A 1A0DA 3ABZA 1V3HA 1QI5A 2KAUC 1BYBA 9XIMA 3GVGA 1EP1A 5MKGB 3W7DA 3FK4A 5AHLA 3LCIA 1XSKA 5BOFA 4JN8A 4Z0SA 1FRBA 3VKKA 4WVXA 4ZE5A 1S3HA 4LC8A 4KETA 3G1SA 3AUOA 4XZHA 2CZ5A 5FOOA 4AZBA 4I9MA 2GJPA 3W38A 4J1OA 1GOQA 4IPNB 2GJXA 1NF0A 1FBAA 3CYJA 1E1FA 1EO7A 3XIMA 1L6FA 2Y70A 1XLBA 5AKQA 3IVTA 1AH0A 1TCMA 1KO0A 1UHVA 4GIAA 5TQLA 4GH1A 3F2DA 1FH7A 4D72A 5KZMA 4XAYA 5AVHA 2ACUA 1XDLA 3BGAA 4A3QA 2FKPA 3DFTA 3A4XA 2E5BA 2BVYA 4URIA 3U57A 3UZWA 1DE6A 1FTXA 3TX9A 3FY1A 1LWJA 4S3GA 5CPSA 1VPXA 2DZXA 4GBDA 1QW8A 5LA0A 3OBEA 3L4YA 1EWDA 2R1MA 3QMSA 3QOMA 2PTXA 1TKKA 3RX3A 3MMUA 2QAFA 4GFIA 2PUZA 3POCA 2W63A 3ONBA 1OX5A 3EDKA 1B4KA 2YBVA 3NQ7A 3GNNA 3N15A 3A24A 3IIXA 1KXTA 3ES7A 1EBGA 2EAWA 2GGEA 3QKEA 3FGCA 4MIMA 2QV4A 4UBPC 1FHDA 2FIQA 4EK7A 1EB3A 1NH6A 4U3CA 1LWHA 1LYXA 1QPRA 4PYSA 3GTFA 3P62A 3SB0A 1UWSA 4JYEA 3KZSA 1JPDX 1SW0A 4PEEA 5BU9A 1Q6QA 4Q32A 1RK5A 1OFRA 3NQDA 5F1VA 4OIFA 5AY7A 1T40A 4MKNA 1CGUA 1F5ZA 1GVFA 3VD4A 1HKIA 3H2EA 1JDAA 2HK1A 2NX1A 2B7PA 2DORA 2WSRA 1K02A 3PBGA 3WDJA 1ZGDA 1K7EA 1B31A 3WBAA 1JCMP 1NQ6A 1ISZA 4GZIA 3TTYA 5DCEA 1HKMA 1M6JA 1V0MA 1W1VA 4N7QA 4U5IA 1L2UA 3MCOA 3CWOX 1NY1A 2QIWA 1A0CA 1SU5A 4BI7A 2G37A 1ODZA 1WDWA 1FWIC 5HWJA 3CQHA 1NDYA 4KEZA 5CC5A 5AYBA 2OSYA 4TVDA 4F9JA 2IUZA 2HXUA 1XIEA 1XRVA 1GW9A 1JYNA 1YW1A 2Y0FA 4G8TA 4EPEC 1XBXA 1MRAA 3W7RA 4Y8FA 3KL0A 1YDVA 4IICA 1GZ1A 2SFPA 1JZ4A 1HGYA 2UV8G 3AS0A 2X8RA 3TMQA 3UR2A 5DN1A 3WQ4A 4AXNA 1CXFA 1KBBA 3ABXA 2OLAA 1VS1A 3TC3A 3H70A 1YYAA 2ICSA 3UESA 1E9YB 3AZRA 1VFUA 1BWVA 3HJZA 1TYGA 1VGAA 3WQCA 1XRTA 2QUNA 4E8CA 1EQPA 4O14A 4M6PA 2YLLA 3THUA 1VEOA 1L6GA 4GZJA 3TOYA 3KCJA 1F2JA 3C4UA 3OO2A 3QRHA 3O16A 1HL2A 3BO9A 4I7WA 1K1DA 4FXSA 1O94A 3KP1A 3BLPX 1M65A 7A3HA 4MLJA 4IPIA 1C92A 1KKOA 3VC6A 1P7TA 3MKCA 3CQIA 4PB3A 2IPJA 1V51A 5G4HC 1T7LA 2NX9A 5AB3A 2AMGA 1SO3A 5KZDA 2DH3A 2Y7EA 4J2PA 2O9PA 3PZMA 4AVNA 5ECUA 4TVUA 3AIVA 5CC6A 4NHVA 7TIMA 1MNZA 3MSGA 1J12A 4YCOA 4Z2LA 4PRRA 4IXXA 3RPMA 1OC5A 3NQMA 4LAMA 2Y6ZA 4AB4A 4WKHA 3WLRA 1ZLPA 3FGCB 1CX9A 2XFWA 3EMCA 1DIEA 3BLFA 4ZQOA 4KWOA 5F4XA 3FKKA 4OOZA 2H8XA 1LT7A 3MV11 3DYPA 2A3CA 5C5YA 3LSCA 4OT7A 4JBRA 1VZWA 1SSDA 1ADOA 1NM9A 2CYGA 3H21A 1PX8A 1LQAA 4W87A 4KT2A 3NCOA 1GOXA 4GC4A 3INPA 1E55A 2HRWA 3TJIA 1VP5A 4QISA 3P8JA 4DBEA 4JL2A 3A21A 1UR2A 4YS1A 1R3WA 3R12A 5D9PA 4FLRA 3LCXA 1EKOA 3L5MA 1UKQA 4DPPA 2QVHA 5HXMA 4ZVJA 3UWZA 2PDUA 4IG2B 1JAEA 2G96A 4P5UA 4J35A 3H2FA 4E4UA 5C8BB 5T91A 4H8NA 1OZMA 1JD7A 2J78A 1V02A 2BV9A 1VBJA 1TCDA 3L21A 1OVDA 3AMDA 4XISA 3DOPA 5C2GA 4FF5A 1KGXA 1PEZA 2X0YA 3VIIA 1LQ0A 1UJQA 4QS6A 4RX0A 3T6CA 1RBAA 2O9TA 1TPDA 3I4KA 3Q58A 1EIXA 1WKYA 3L4VA 5HJYA 4JEQA 4BF5A 3U5UA 1P48A 2ZE3A 1ONRA 3VD3A 3LK6A 2WBGA 4YTUA 3EWDA 1XR2A 4ERGA 5LA1A 3B9DA 3WQWA 2FDMA 4POCA 3LGDA 3KTCA 3S2LA 3RCMA 1L6WA 5AC8A 2FH8A 4O54A 3W75A 4KQNA 2DSZA 2POZA 1UA3A 3BPWA 3T7VA 2ISSA 3LI1A 4W7UA 4ROQA 1TVNA 1FHUA 4I7UA 3GH7A 3M0LA 4FNPA 4F2TA 3R6IA 4W8BA 3KLLA 3NPVA 3GE7A 2BNJA 3B8WA 5FJUA 2Z1SA 3VIHA 1ZSXA 1U1HA 4OJYA 1RA5A 4GZ7A 2E5DA 1I2OA 3V36A 1V8EA 4LANA 3VD7A 4B5TA 3ME3A 2FGLA 3OA3A 4PTVA 2CXEA 4ZB0A 4KWVA 1P0EA 1XIGA 4GCAA 4L4MA 3I7SA 1VFTA 4Y9AA 1Y7VA 2WHMA 3IVUA 1P6BA 4HZ6A 2ACRA 4ZMGA 3B8SA 3GXMA 4L9ZA 3TJ4A 3H24A 3A9BA 3UXKA 4HA4A 2GQAA 4UOJA 3EBVA 3COTA 1JF6A 4KPLA 2QR6A 1R3YA 1R9XA 4IISA 5C9ZA 4XZLX 1TIMA 1ZJIA 4GYKA 3SFKA 3VI2A 3CT7A 3T08A 4WDTA 2RDWA 2WCGA 2IKJA 3A3HA 3NWRA 1SW3A 2HEJA 4QEEA 4PBGA 4YLWA 5LIWX 3SRFA 3TC7A 3UW6A 1KWKA 1ISWA 3FXYA 4NJGA 2JE8A 3K2GA 4ADUA 1ZFJA 4YTTA 3ANVA 4X3ZA 3VK5A 2VDGA 4E2VA 3NSNA 5G1TA 5G1YA 2TRSA 2A85A 1HT6A 4BQ3A 2HROA 1TMLA 4HHPA 4HSNA 1BSLA 2ATSA 2Z29A 2ZUTA 1JFXA 3E9AA 3E12A 1TJPA 4K36A 3OVGA 1ZBWA 4KFOA 4D8ZA 1W9DM 1JDDA 2XSAA 2YB4A 1BXNA 2ISFA 1EJXC 2FVLA 2PGEA 1Z9AA 5C70A 1BFNA 2PODA 3E3HA 5HPOA 1R38A 3RK8A 1XGZA 3LCFA 3RFAA 2BDQA 2YBTA 3V0TA 1YDOA 4DYKA 4WRHA 3URBA 1RK6A 3HBLA 3THQA 1CB2A 3S5ZA 3EEZA 4QDPA 2HV5A 4MYXA 4U31A 4IMFA 3C3UA 1BVNP 4M24A 4MAZA 4ZSTA 4RDZA 1IF2A 4A3HA 2CKRA 3BJTA 3TP4A 2D20A 2CXGA 4Y9MA 2P8BA 3ISIX 4NSBA 3ZJ6A 3DXIA 4MM1A 3D6NA 3KRZA 4PCPA 3SEPA 4NG3A 4H4IA 1PV8A 3T42A 3VIPA 2I7GA 4CD5A 3WO8A 1FWNA 3NGFA 4WJ8A 1EIBA 3C2RA 4CEXC 1I45A 2ZUNA 2ZZ5A 4FB7A 1XCWA 2DGAA 3W85A 3CK5A 4N4QA 2BHZA 1YTEA 3QY7A 3FJNA 1UC5A 3IIVA 2NZLA 5A8NA 4F0KA 3L7RA 3VNLA 4KWWA 2ZZ7A 3N29A 2Q3OA 1EA0A 3H2AA 4ROPA 2G50A 1JPKA 1EHNA 3R94A 4HCHA 2HJPA 3S2JA 1ITCA 4FEZA 4PTXA 3VGBA 1SM9A 1OG0A 2C16A 3GTHA 1WB0A 4UMAA 4F2UA 4FNTA 4Y2WA 1UH2A 3PVFA 2V5LA 2J7GA 4MF4A 3IV8A 4A8LA 3POHA 1WDPA 2XPKA 4UTFA 3RLVA 3W6LA 3EOUA 3SN0A 2WNZA 1M7OA 1PYMA 1KXHA 2XGZA 2PMQA 1PWMA 2PWGA 4A4AA 3EWUA 1DIOA 2OX4A 1TVLA 1C90A 3M0KA 4TUFA 2X05A 2A7RA 1ONEA 1HGWA 3LSBA 5I2UA 2ZZ1A 1SYTA 4K2SA 4GACA 4TOQA 1A5BA 2FMNA 1BSIA 1AZ1A 2PDXA 1R85A 1RY0A 3MTWA 3AHXA 3IARA 2DT3A 2WNWA 1UR3M 3HPXA 3RUBL 3N12A 1H51A 1UUOA 4EOUA 1X1ZA 2V69A 1QWGA 3G3MA 3FEQA 3EA1A 2QCLA 4O11A 5CSUA 1R87A 4WKAA 4OE7A 2AL2A 2PRHA 3HPZA 2FJUB 3VGGA 4GOAA 2QCFA 4H3DA 5EFFA 4DWSC 1JUEA 4W4QA 1U5HA 5D2VA 1FWRA 2DQWA 4O0ZA 3V5OA 1JUBA 3CQ0A 4UQBA 4PMJA 4M1RA 2J8TA 1WV2A 4DJEC 4MJMA 3ZJKA 1HL9A 3OEXA 1XIJA 4N9CA 1A3XA 1R3QA 4HSHA 3VCNA 2QVNA 1XRSA 4UFKA 5CG0A 3W37A 3PPCA 1IWPA 1GORA 4F66A 1S2VA 4DM2A 4DWSA 1QVBA 3MI2A 4ZQPA 4C6OA 1YPXA 1PWLA 1F7BA 4TVCA 3W4RA 3RRAA 2HBXA 4EKJA 4QCEA 3F2CA 3H4XA 4XAGA 4MVAA 4H01A 3A3XA 3VPLA 1LJYA 3O0KA 2ZDSA 3WNLA 2GJRA 4P8WA 4RPQA 2A7NA 2WKJA 1MW1A 3FS2A 2JBMA 3SURA 3FX4A 3NJ3A 2ZBTA 2CBUA 2KZHA 1ECQA 4OHQA 1MQPA 2F8QA 2XISA 1VEPA 4X22A 3K4AA 4D2JA 1H63A 3QF0A 3TKFA 3NIYA 4GYPC 3HM7A 1CEOA 4WKFA 1AW2A 1FXPA 4EX4A 4WZHA 1LUCA 3H2CA 4QNEA 3CYVA 3TYBA 2WJZA 2PWFA 1OK6A 2WHJA 2BZNA 4DXKA 2WW5A 3G1VA 3APTA 3GBEA 5CLTA 4MMWA 4RKAA 3EPNA 3O07A 3T9PA 1CGVA 1WDRA 3NDOA 1TPEA 1OF6A 2OKOA 2BSLA 1SZRA 4O1FA 3OZOA 5CZ0A 4MY1A 4XZ9A 4OBRA 3B8DA 3E38A 3PAJA 3WNKA 1CECA 1O12A 4KCTA 4B5WA 5BWAA 2E1WA 2BMBA 3VM5A 1KW1A 2VWTA 1Z6KA 2DW7A 3I65A 1L8NA 4GI4A 1GTEA 4B3KA 2ZRXA 1X98A 3WH6A 1BYDA 3MMTA 2QMKA 4BZYA 5JIPA 3EMQA 4OBTA 2YPIA 1XFCA 3LQGA 1GJPA 2V5DA 3PC0A 2Y88A 3VC5A 3QQ1A 1QK2A 1ESWA 1YTKA 1U22A 4FALA 1OSEA 1XF0A 2ODOA 3GNOA 3UWVA 4MTVA 3M64A 2Z26A 3KVLA 4CNTA 4GGBA 4O12A 1CGXA 4C1NA 1S2AA 5F2GA 1XYZA 3ITOA 4IPLA 3PF3A 4QJ4B 2PE4A 4PGLA 1QOXA 1W17A 5HINA 4FPSA 3BW2A 2P3ZA 3MKVA 4IP7A 1YPIA 3TSDA 1YE4A 1I1WA 5GJPA 4UZUA 2AL2B 1C7TA 4KRUA 3W7OA 1RUSA 2J4GA 4RZ4A 5D04C 4LC6A 1X6NA 3USZA 2DZUA 2NT0A 3SN4A 1SJAA 3LV6A 3WD0A 2WZTA 1S2TA 4JTJA 2R9RA 4JPGA 1LL6A 1QPNA 2P0OA 6TIMA 4AFYA 3FKRA 3TVAA 4U4MA 2PTYA 1ZENA 1HFBA 3BLKA 1OJXA 1KM3A 1H3GA 3UZ5A 1VHCA 4LFYA 1ZAJA 1T8QA 4B91A 4F0RA 1E43A 2YDSA 4R5EA 1BVZA 3BCJA 1CLVA 3LTSA 3UG3A 2BBFA 4MSSA 2ZZ3A 4KWUA 3CUHA 1CGYA 3WJYA 2G3JA 3FJLA 2VR2A 1UCWA 3N4AA 4D6JA 1DBTA 4A21A 2ZUMA 5E6ZA 4AVFA 2INEA 3CV2A 3P6LA 1MVYA 5E0CA 1UW9A 2AQVA 1WDQA 4YHGA 1OFQA 1TJ0A 3F4NA 4Q4QA 4LVFA 3WK3A 2CZDA 1UZHA 3GYCA 3M7WA 3CB3A 2NV9A 1FVPA 3HMJG 3WLQA 3IUDA 3G1XA 4O0QA 2OELA 4FXRA 4PUMA 3AC0A 3E02A 4NYYA 5DMNA 1Q6RA 3DFPA 4W86A 1I0BA 4WIWA 3R43A 1TJ2A 3M1ZA 5BOOA 1W8SA 2DZAA 5SWUA 1GKQA 1KCKA 2DV0A 1C3FA 3THAA 4W88A 2BVDA 1BG4A 4IJRA 2W5FA 3F5JA 2PLMA 4PL1A 3W00A 4RNJA 4PMRA 1RD5A 3SY5A 4A05A 4RDYA 2CEQA 3HG4A 1E1EA 4Q8WA 4JAWA 1D7FA 1U1JA 1E9IA 3ZMRA 1W5PA 2VR4A 3PUGA 1LROA 3UEQA 3IPWA 4ALDA 3NSXA 2YZ5A 4LCSA 1RVGA 1AL7A 3SY1A 2ISVA 1V0LA 4JDBA 3ZVIA 4GPNA 4DO4A 3W86A 5GNXA 2WV8A 2YXXA 3G0SA 1I2NA 1U1UA 2E6AA 3KVKA 1DTNA 3WH9A 4DUXA 4A8NA 3KZPA 3U48A 2NWSA 1TIWA 2VEFA 3VU2A 2JEQA 3N9SA 2Y7DA 2J77A 3VTRA 2C0HA 1XS2A 1TV3A 2MUCA 3DI0A 1OFPA 2XN0A 2WXDM 3LLDA 3UJRA 4NZ5A 3LPFA 5C9XA 2CU0A 3SY8A 4UMBA 1XPYA 4J3SA 5JH2A 5BZAA 2DSVA 4M82A 2F84A 2EPLX 2Y5JA 1KCXA 2G0WA 2CLHA 1ZP4A 1R8LA 4C1NB 3EA3A 2GWNA 4UTWC 1HL8A 2Y24A 5M5DA 1T6MA 3TSBA 3U6WA 3ZR4A 3GAYA 2VM8A 3PZNA 4DWSD 2DZTA 2PWVA 3EAUA 4MAVA 1CXHA 4Z17A 4CN6A 1VJZA 3RM8A 5IDZA 4GLEA 4Y6GA 4N0RA 2Y5SA 3HGOA 4JOMA 2VO5A 3CZEA 3QSRA 1UASA 3Q67A 3FHAA 4DJFA 4B9YA 2XIJA 1MO0A 4UTWA 2RDTA 4ONVA 3SCRA 1Q5MA 2YLAA 3LRKA 1EP3A 1RP8A 3UR8A 2BOEX 1JPHA 4PUWA 2F2HA 3WDQA 3MMDA 4HMNA 4AEOA 4RZ6A 1Y65A 1O95A 4L1XA 1GQNA 3VDGA 2XH2A 1UH4A 2CLIA 1TPB1 2YZRA 3RNDA 2VDHA 1E73M 4C6NA 2GGIA 3O8AA 4G2DA 1I2PA 5AECA 4PEKA 1FY6A 4TR9A 1TREA 1KGUA 1Z69A 4ADSA 2PZ0A 3NA8A 2ZXBA 4C6IA 1NFBA 1T5AA 3K30A 1UD8A 3GG8A 4RZ5A 4CNNA 4ZB5A 4H8HA 2VNCA 5C2XA 2E0PA 2YL5A 1E6PA 2CLMA 3A13A 2I57A 3PG9A 4UTKA 3LDVA 4ZOEA 1UWAA 4AD0A 4IP4A 2Z28A 4CLMA 3HQNA 1V6VA 3CHDA 3QGAC 1TZ9A 4LRSA 2VZVA 3CZJA 1O1ZA 3AI0A 4EF9A 2G3FA 3KTXA 1RCXB 2VZTA 2FZ9A 3LNMA 2WANA 3WJZA 1TWIA 1IWAA 5EGRA 4LCRA 3DIPA 1R3VA 3AHVA 4LOCA 2Q8XA 5KITA 1EGMA 3LUTA 4DUVA 4CUCA 4O18A 3L5AA 3N14A 1JZ7A 1W5NA 3AISA 1MDLA 1F3WA 5LNRA 3BV7A 4AZIA 4DELA 1B0IA 4AC1X 3VD9A 2Y61A 4J3UA 4LY8A 3ES8A 2QDEA 4HTYA 5BXTA 1OFAA 2A3AA 2BLEA 3M5XA 2BY1A 4CCEA 3TYZA 1QRQA 3W3OA 4EP8C 2YA2A 2CIPA 2I56A 1WXJA 3CLWA 4QROA 2ALDA 2E8ZA 1K8CA 3NZPA 3RO8A 2J25A 3A9IA 2YL8A 2AAMA 1V02E 3HQOA 3DERA 2IKHA 2O9RA 4TIMA 3WYZA 2YX0A 1ICQA 4YXGA 3JS3A 5BXSA 4AIUA 3LU2A 4RLIA 3TTSA 4AIEA 1CGWA 3EDDA 2DY3A 3E96A 3GKFA 2ZRUA 1E0UA 3WUEA 1VFHA 2PLCA 1TJRA 5KZ6A 3BG9A 1HG3A 3VKBA 4FI4A 3C52A 3R8RA 1NWUA 2EJ1A 3BTNA 3UJEA 1WZMA 3ARZA 2QJNA 2PDMA 2XDFA 2EG6A 4AZGA 1FWDC 4JYDA 3B06A 4LQ1A 5HR6A 3TXVA 3ITGA 4BF7A 3CUFA 3C86A 1KRBC 1XBZA 3A3WA 1UD3A 3URNA 4HA1A 5HUOA 3UWQA 5KEZA 2GJLA 4IQDA 2PFHA 1XUZA 3NURA 4B3ZA 4IFRA 3R89A 3KDOA 4JQ4A 3IS4A 2X40A 3ID7A 2C79A 1Z48A 3W26A 1P0KA 4HGXA 5AVNA 1TG7A 2ACQA 2YB1A 5DELA 4DUWA 1SVDA 4N4PA 1JZ8A 4D6EA 1DWGM 1S2CA 2X09A 4JN7A 4XZWA 3L67A 2VYOA 1SFSA 4Q8NA 4DYJA 1BEUA 4MPQA 1A80A 1KTCA 3GUGA 4REQA 4JCMA 3Q94A 1GVEA 4R88A 2JKAA 3AXHA 1RY8A 4XD5A 1FCUA 4Z1YA 1S46A 3C0JA 4P7LA 3WD1A 3PZUA 3CM4A 4I3GA 3C0LA 1E6RA 4M6UA 2J7CA 2O4QA 3NEHA 1UBSA 5EBUA 3SAZA 4XTIA 4B90A 1JYVA 1ZZMA 1PO9A 4C6MA 2G3NA 1B9BA 5CZJA 3PANA 3VIOA 3UCDA 1GGOA 1H09A 2JIEA 1GCYA 2EEXA 2Q3RA 3AYRA 1V6WA 4LH8A 5H8MA 4DI9A 3WMCA 1KRAC 3U5YA 1NU5A 3HGSA 4EE9A 3K5XA 1XXXA 3BDKA 3VKCA 3VNZA 4RE2A 4B5NA 3I3DA 1TZZA 1JJKA 2XIMA 3CUGA 4WQ6A 7XIMA 4LUSA 4XTDA 3N2CA 3CPGA 3MYOA 3VM7A 4FO4A 3LGEA 3WZ0E 3EOOA 4HIBA 3SCQA 4A29A 3RLHA 3FJ6A 3BAKA 1F3EA 1H62A 4PR4A 1V77A 4H9ZA 2GSHA 4GJJA 3II1A 1GOOA 3ECQA 3PFMA 3CT2A 2EGZA 2R24A 1H1NA 3UXLA 1GVRA 3KBSA 2VC9A 3WUGA 1XYCA 5TF0A 1BQCA 3D5HA 3TC6A 3A64A 1LRNA 2WNQA 3OQ8A 3OGRA 4NILA 3B0YA 2ZRWA 4CCZA 1D8WA 1W3JA 2C15A 2O7QA 4US5A 1UUQA 3CC1A 1PSCA 2F2KA 3QM3A 3A23A 4M51A 3TH6A 3RMEA 3W29A 5DRCA 3M41A 4Q6XA 1IXPA 1PIGA 3BLOA 4C6FA 3OZYA 4DJFD 2WMGA 3IRDA 4H9YA 4UCFA 1PVNA 2PC4A 4FXFA 4RDWA 1I75A 3P84A 2WKGA 1WZKA 3WLPA 1KQYA 3NL6A 1S39A 4TQTA 3TA6A 4E5TA 1G69A 3MI6A 3WLHA 3VFLA 3VNYA 3AHZA 2ANUA 3VOFA 4DJDA 3IGHX 4WY0F 1ENUA 3ALFA 2WVVA 3W2MA 1IT7A 3EOEA 4MG4A 1N8WA 3CTLA 4HJWA 4E8GA 1R2SA 3DG3A 1Z8AA 4WCJA 2ZA2A 4BY3A 1X6UA 1C7SA 3N18A 2FZNA 3PAOA 3T09A 1Q66A 1K3UA 3H12A 2J27A 1OIMA 5C54A 4ERIA 3SW6A 2PWHA 3VD5A 1BKHA 4AX6A 5H6HA 4Q4MA 1TPUA 1TZ7A 3RR4A 2FTWA 4YL2A 2FTYA 3FVMA 1B54A 1QW9A 2QNEA 4JX6A 5FIPA 5MHBA 2QJHA 4X0NA 3E5BA 5BROA 1XD1A 3TROA 4NNBA 1KCLA 2BOFX 2C8NA 5DCBA 4DX3A 2YFOA 4ILSA 4WLCA 4UTUA 1J2WA 2JKPA 3WJXA 2NUWA 3SCOA 3B4UA 1F05A 1W5MA 1MWOA 5I3DA 1QATA 1AH3A 1PDZA 2XH4A 5HBFA 3Q4DA 4J27A 1LLWA 4YVVA 4KRTA 4LAKA 1JGMA 1EFZA 3TQ0A 3W28A 3LZ3A 2Z24A 3L4XA 3CAKA 4L5ZA 4JICA 1DJIA 1A49A 2PLKA 5LNVA 2QF8A 4W5UA 5A6AA 1E6SM 3LRLA 4E2DA 3W53A 1XIMA 1CI1A 2VZSA 2XN2A 2WVTA 1YNQA 7REQB 1G01A 4S3FA 3AOFA 5HMFA 1N2VA 1YHTA 3DDMA 4EXQA 1QT1A 5AC7A 1VIZA 3IJLA 2PA6A 2JF7A 4NNCA 2QS8A 3OG2A 3S9YA 4K7VA 3LHVA 3H2OA 1V3LA 3BMWA 1TRIA 2CLPA 2WC3A 1FWBC 1D3GA 2NSOA 3TJLA 3LOTA 1E9LA 1HN1A 1KCZA 2NQZA 1S1RA 3KRUA 4DZHA 1HXJA 1TPFA 4ORIA 3LV5A 2FZMA 3EDJA 2I5QA 1WQ5A 3OLEA 1EDGA 4DI8A 2XM2A 1CBGA 1UR1A 1O5QA 4RNFA 4FS9A 1UC4A 2VZUA 4ACZA 4JTRA 1E6NA 1Q4WA 4J40A 4BK9A 3VGFA 5BCAA 3O63A 1G4PA 3ENLA 3PPFA 3CEPA 1E72M 2ZKMX 2J9XA 3OIHA 2OEKA 4WSKA 4X9YA 3BAJA 3MWCA 2DSWA 3Q37A 3UCCA 2EO7A 4UR7A 1EWEA 2A3LA 4V1YA 4R9OA 3G18A 2G3MA 2DIKA 1K8YA 2WJEA 3I6TA 2IPGA 1PB0A 3B3DA 4GXPA 1J79A 2RAGA 2WVVB 5DXYA 4ATWA 2VTFA 2DEPA 5I77A 4LF1A 1R2RA 4QE1A 3ZO9A 1MFUA 1ZP3A 1UG6A 3QGVA 2AQWA 2VQTA 3TNOA 4QAWA 2J9ZA 4QCFA 2HNEA 1H41A 2XGIA 2OT1A 3TTQA 5I0DA 3H8AA 3TQVA 2CLKA 3OG3A 1A4MA 4GQBA 3PN8A 3M9YA 4HCLA 3BJFA 2BWGA 4ORMA 3S6OA 3G6MA 1B3YA 1WZLA 4GUIA 4RNIA 5I7GA 4KWSA 4IMDA 4IMEA 4NY2A 1WKEA 2VHLA 2H3DA 5D8ZA 2EG7A 1QPKA 4KBXA 1EGZA 5CJ5A 4GD0A 3NL3A 2J7BA 3C8FA 5GJMA 3B8UA 4WHBA 1GOWA 3GUWA 4YWIA 4G9PA 2WWDA 4KH2A 3RU8X 3CTTA 1QCWA 1H4PA 3C56A 5U4NA 4WJXA 3HPAA 2I1OA 2J6VA 2W92A 2D3LA 3WH5A 2Z6IA 3LBOA 5JVLA 2Q8ZA 1P4CA 1A4LA 4HA0A 2XH0A 1HJQA 3FCPA 4AF0A 2H9AB 1VRDA 1CXKA 3CL8A 2WSKA 4MB4A 3FAWA 5FJPA 2OT0A 3VDAA 5CBIA 4AISA 3WD3A 3U2CA 4UFLA 4J5NA 2H8ZA 4MJZA 1WYIA 3L2LA 3RCNA 3AYSA 1NFPA 5CG7A 3S8HA 2QDGA 4ZXLA 4EXAA 5XIMA 2Z4GA 4HU3A 4PA8A 1FDJA 4H19A 2DUAA 3W81A 5CPLA 3OQEA 3SRKA 4GJIA 3W7PA 3QPEA 4YTQA 2X1SA 5AHEA 2OYMA 2BG5A 2PWUA 1H7WA 4DNMA 3T55A 3TV8A 1PKMA 3DZ1A 3BOXA 4B5VA 1FWJC 1JYXA 4JTIA 3W27A 1XW8A 1IXQA 1EEXA 1Q63A 2QPXA 3A5VA 4ACYA 3U9IA 1XSJA 4PMDA 2X7VA 2W91A 3EMZA 4FNUA 1O5RA 3D3AA 4HYRA 2Z25A 5GQBA 1DQUA 4YVPA 1DJZA 3RMJA 1GVYA 2VZOA 3CAVA 3OVQA 4XAZA 3DHDA 2ZXAA 5IXEA 3AXXA 4H1ZA 3PUDA 2V2HA 3O2LA 1JXJA 3GDKA 1BAGA 4LV4A 4GE8A 3PJXA 4LVDA 1XRFA 1HJUA 3N4FA 4JNZA 2A3BA 3F2BA 3S3GA 1HVQA 4NAFB 5JMUA 3P5YA 4Y9PA 3CNYA 3S1GA 4L9YA 1FWFC 1D9EA 1JZ6A 7ENLA 4GUGA 1EEPA 4NF7A 2NQLA 4RW3A 4L4PA 3NM1A 3E5PA 1E0XA 1Q85A 3VFCA 3DG6A 3SCPA 5LGZA 4AMAA 4HMEA 3CZ8A 3CGTA 3HOJA 5FEPA 5ABGA 1YXYA 1QPOA 4FZIA 4HU0A 1GG1A 3DU0A 3OB8A 6ALDA 5KETA 2JK2A 4Q8UA 3OOQA 3OLGA 1OIFA 3BG5A 4Q6JA 4H2CA 3GU2A 5HDRA 3AS3A 3OBAA 1AD1A 2XIOA 1CNVA 3A4WA 3IRSA 1RQEA 4HNNA 4KIEA 1WBHA 1VIWA 1BRLA 3DYMA 3FHQA 1V93A 1U5VA 1B3WA 2FB3A 4MWAA 3BVJA 2OOGA 2A2IA 2Z2AA 2OLHA 1M3UA 4QSFA 2QAPA 2GZXA 1XLJA 4GCXA 2W6RA 1XQKA 4J4KA 5CGQA 2ZVIA 1CIUA 1DP0A 1EC7A 2PDJA 3GIQA 3T4CA 1W9PA 1JIBA 3LYEA 3WK0A 4NJJA 1OFDA 4ZXOA 4DY1A 4A8IA 4A6GA 2JFEX 5CSSA 2XYLA 1Q6OA 1VAHA 5M2FX 4IMAA 1GHRA 1ONWA 4PRTA 2OYLA 1QI4A 3RJYA 3N9RA 1RCOB 3FDKA 2ABBA 1PCKA 5DT7A 4JFSA 1JD9A 2G95A 5H91A 2CHOA 3BAIA 4AF0B 2GVYA 2Z27A 1H7XA 1OG6A 3ZYZA 3QW4B 3FJ4A 5MF5A 2DW6A 5IBXC 3GVWA 4YNGA 4WXZA 3KW3A 3E1F1 4INFA 1GPWA 2D2GA 3BANA 4H8UA 2G5WA 2R94A 2VCCA 2BVWA 4HN4A 3GXIA 3QC3A 3EOSA 1UMLA 2FZDA 5C9UA 4HHHA 1H7PA 4PTWA 3WQOA 5D2XA 1EJUC 5IBXA 1XKYA 3CMFA 4UTHA 1TSIA 4M6QA 2C1HA 3C3NA 3CV7A 3SO7A 1R9YA 3CPUA 3R25A 3EB2A 2PCEA 3W2LA 4UQ9A 1XYMA 3PNUA 2FVKA 3PTDA 1GQLA 4QLLA 1TV4A 3TZNA 3C2VA 3N3MA 3TCSA 3AZSA 2J6XA 4PMYA 2PDNA 3PY2A 4LX4A 4RE4A 1OFBA 3ELFA 4N6EA 5CZSA 2BX7A 1HKJA 5RUBA 1XV8A 3UPMA 1K9EA 3I7QA 1TR9A 3HFYA 3TN3A 4W8AA 4IJBA 2VOMA 3V3WA 4IF2A 2P8CA 3M0ZA 3RU6A 3EYPA 2OO0A 3MHGA 4JIEA 1OEPA 1VFLA 1KM5A 3CUIA 1BGGA 4YMZA 5AC5A 2VR5A 4FX6M 4XIMA 4H6KA 2ZOXA 2PGFA 4FOUA 1PTAA 4OV4A 1F76A 2DT1A 4UR9A 4UNIA 1N82A 4O1DA 1WAUA 3PUEA 3EDFA 3GVVA 1XYAA 2R91A 2ZX5A 4AZ6A 3ZT6A 4HKPA 3WQ6A 2V3FA 4LU0A 2QUUA 3E0LA 3P7YA 1XBYA 1XI3A 4FF7A 5G2HA 1KD0A 4NVTA 3ARWA 3IIOA 3B0XA 2GVLA 2PC8A 3O15A 5EMUA 3QTGA 1Z44A 4NJIA 3VMOA 4M6VA 4MWAB 2DZVA 1UYQA 3EDEA 1GKRA 2V63A 1B3VA 2OVLA 1KBKA 3ZJ8A 1M9HA 1I6NA 1T0OA 4DO6A 1QU4A 2PGRA 2EF9A 3AMKA 3NNTA 4MNJA 3TJXA 4FP1A 1XL9A 3ZLFA 3WBYA 4GA8A 4HOZA 3O3RA 3ANUA 2D23A 5A6SA 3G0UA 5A6TC 1PZ2A 1S38A 4Q8TA 4GVHA 1KLZA 1NVMA 2A21A 3OVPA 4JIQA 4BI6A 1ISXA 1A5NC 1UD2A 4AWEA 4QAIA 2J62A 4E2BA 1SJCA 3BSHA 4AIBA 4WOZA 5A8OA 3IJDA 2V5JA 5I02A 4JCLA 2EKCA 3DFSA 4XQ6A 4K8EA 2GWGA 4A3YA 4MZYA 2OU4A 4I90A 4JTHA 1F9CA 2VL4A 1HJXA 1OYBA 3WCZA 2ADAA 1LLZA 7CGTA 1RQBA 4JTFA 1OC6A 4R27A 3WFZA 1DTUA 2Y4SA 5EB8A 3AUJA 3LXCA 1J10A 4P8UA 2GQ8A 5FJTA 5BU6A 2IKIA 2E77A 3M0HA 1JL8A 4IQLA 5K9CA 3DBPA 1FOBA 4LPCA 3OW1A 2TODA 3KCOA 4BQ4A 4CVUA 3C0SA 5I03A 3N3TA 3GDLA 3R11A 3IK2A 1V79A 3AIQA 4HBKA 3VXGA 3UGVA 3BSGA 3GFYA 5F2LA 6PTDA 4AD3A 5FEXA 3W83A 2XZ7A 4W5ZA 1UR8A 2PTDA 3BV4A 3ERPA 3MA8A 3WDHA 1P0BA 3UCQA 1AMYA 3BJSA 3ARVA 2C19A 4JTAA 1SZEA 3UWWA 3R79A 1NP2A 2P50A 1WX0A 4LUIA 3F5KA 4WSHA 3U2ZA 1RLDA 2BODX 3IWPA 1A47A 3BMXA 3PWIA 1TX2A 3IANA 1TTQA 1OCNA 1GOKA 3RM9A 1EUAA 4TMCA 3CASA 4Q4OA 2ZUSA 1BHGA 4L1WA 2FHCA 1QNQA 1EA9C 1HJWA 2YCKX 2HVOA 1QWKA 3V75A 3W7JA 1CWYA 1JQVA 3P93A 1J6PA 1NJJA 4L80A 4MWAD 3WLSA 4ZQMA 1ITUA 4A35A 5CPTA 2XFFA 3PZGA 4NZ4A 1KXQA 2QJIA 3GLCA 1YX1A 5D03A 3K46A 4E4FA 4GI6A 4ZQCA 1GW1A 1VFOA 4BFAA 4WGXA 3BICA 1JUKA 3BUVA 1VQTA 4ZL1A 3WQVA 4LBUA 2ZE0A 3CLMA 1BTMA 2YCLA 1DV7A 5DMMA 4US6A 1AL8A 4HPXA 4PCSA 3WLKX 2B0MA 5H1WA 2WVUA 4CQBA 4AQLA 3S5OA 4HJFA 3N17A 3Q65A 5T26A 1B30A 3O6CA 1FCBA 4LEQA 4S1FA 4PC8A 3ZQ9A 3EB4A 3UY7A 3OP2A 3KAOA 1KQZA 3UF9A 3E74A 4AMCA 4A3RA 3EXRA 4Z42C 4NIRA 4IWWA 1GEHA 1F3TA 4ZR8A 3AQUA 1LG1A 4HK6A 5EL1A 4DBDA 3URAA 1ZY9A 2RH9A 1QHPA 4M5PA 1A5SA 3FSUA 2Y8KA 3T78A 3ZS4A 2FFIA 1KM2A 3BWWA 1E6XM 2OYKA 3GNXA 2OFJA 1WZAA 3WIJA 4E2OA 3FNDA 2ZA3A 2PDLA 1NQKA 2WOQA 4MPKA 2QUMA 1P43A 1KNWA 5EPDA 4MKVA 1K7FA 4C6EA 3G1RA 3HV8A 1L9WA 1V3JA 3M6DA 4HNOA 4XD3A 2DSKA 4G56A 7TAAA 4KERA 5LKYA 5LXXA 1R3TA 3M0VA 2OZ0A 5IHSA 4Z08A 3QJAA 1OF8A 1JXKA 3O05A 5C6MA 2ZZ2A 3SCUA 3WJWA 1F6YA 3QQWA 4WR3A 1REQA 3LI0A 1V4YA 1WOBA 1WAWA 5TNVA 4Q8VA 1CB7B 3NZ1A 1MI3A 4C90A 3CL7A 3UETA 3OYXA 3ITTA 1FCQA 1MW3A 1Z3NA 1UH3A 3SUSA 4O19A 2PWEA 3TZFA 1OB0A 2NSXA 4FOKA 4O16A 4DF0A 4WDXA 3TYAA 4XBKA 4Z2KA 1MXDA 1HZYA 4UFMA 3L68A 4W7WA 1CPUA 4ML4A 4LUTB 1QFEA 4CCCA 2QIIA 2BGQA 3SADA 2OCZA 1NEYA 4QG6A 1JCNA 2WSQA 2RUSA 1EOKA 2PD5A 3QC0A 4N9BA 2G4JA 2UZ9A 5AHMA 3SIMA 6ENLA 3HTWA 3AWNA 1UB3A 4B15A 1MUCA 1OX4B 2DPEA 1WXYA 1MNSA 4EAYA 2YW4A 1AQHA 2Q09A 1P1MA 1YNYA 3UZYA 2BGSA 3PJUA 2O9OA 3AYVA 1TWZA 5E1QA 2GDVA 1JCYA 4FXJA 3BURA 5DRIA 1L6YA 2YXGA 2E25A 1V0KA 1EXBA 3T2PA 4HU8A 3TWAA 1VENA 3GFZA 4MB3A 5TAOA 2WPBA 4D8LA 1LBLA 4O15A 5A6MA 4HYWA 4AG0A 2I9EA 2OWWA 3KBWA 1G4EA 3UBPC 1K9TA 1IYXA 4QG8A 2DU2A 4LGXA 4GWEA 3UXAA 3IAPA 2EPOA 2YCLB 4MLRA 2A79A 3LM3A 3VIGA 2HS8A 4PFMA 1QK0A 4DAIA 3W84A 3TW7A 3G8EA 1K70A 4U2ZA 2VOTA 3CIVA 4X0VA 4I9TA 3DFOA 4HHMA 3BGGA 5LNSA 2IQ0A 3ITLA 3FXGA 2QZRA 3GIPA 2YYTA 4HPHA 1MMFA 1KB3A 4NZJA 4HN8A 1J0IA 3SI9A 1GUVA 3WQ8A 2XVNA 4GABA 3UR5A 1IR2A 4EPBC 1K6WA 3W07A 3B9OA 4RJEA 4UFIA 1ZQ5A 1OK4A 1XFBA 4PMNA 4TU1A 1Q6FA 4S3BA 2QV5A 5DLCA 2PB1A 5FJIA 4JTUA 3THCA 3SCSA 2DVUA 5EMKA 2IPFA 3UXIA 2GVJA 4C6DA 1GQJA 3TFXA 3OA5A 2C7FA 4N02A 5GPRA 3UVIA 3YPIA 1J9YA 4NUWA 2DUXA 4R34A 5DT5A 3F1QA 3IV3A 4D6IA 4D1JA 4QS5A 1OFOA 2PRLA 5A6LA 4CCDA 3W24A 2Z2BA 1XKJA 1J0JA 4YVXA 4E0CA 2YIHA 1RJQA 1E4MM 3GHTA 1E3XA 4H9UA 4K1GA 4ZE4A 1KXVA 1UZ4A 1ZUAX 3W7HA 3LCHA 2OWCA 2ISWA 4ZSUA 3JUGA 1W1ZA 1REQB 3AIBA 5M3WA 1BWLA 4UOZA 2LLEA 4XK2A 5HUPA 1OT1A 3T0BA 2F6KA 4UCGA 5CEWA 1P1XA 4IG2A 5E93A 1I1XA 2NXIA 2GLKA 5HPCA 3WQPA 1HW6A 2PF0A 4H9XA 4HZMA 3E0IA 1Q45A 3VGEA 3ITXA 2GUYA 1FDYA 3SCVA 4R53A 3H7VA 5TIMA 1CGTA 3CO4A 3G6LA 1YEYA 1LRQA 3N04A 2TSYA 3G77A 1OX6A 3NZQA 3E2VA 1M04A 1PDYA 3J7HA 3W7QA 4RXFA 1KV8A 4GBUA 4UNLA 4HNLA 4CNOA 1TJ1A 4TTGA 3AS1A 4PH6A 2X2GA 4XKMA 1YXCA 2VRJA 2WQPA 4GQRA 2V6AA 1FKXA 4Q7NA 3SCNA 5ABTA 3MV01 1M53A 3B9AA 2C0AA 5C7VA 2CLFA 4WSJA 3W1UA 5HJLA 3FA5A 4W84A 3VX1A 3IGXA 4OUIA 3H23A 1J4EA 2ZX7A 4GUHA 2UBPC 1A5UA 1VJIA 1F07A 4ZB2A 1XDMA 2WMIA 3MVTA 3PBYA 3KHDA 4QTGA 3IVSA 4GIYA 3TCEA 3QR1A 2ZTJA 4K39A 4Q8QA 3AXMA 2Q01A 4NAEA 3EXTA 5HR7A 4YTRA 5HMDA 2OZ8A 3O0FA 2W9MA 3R0UA 4C7DA 1AK5A 1ZJHA 3BQ5A 3C6CA 2QT3A 4G1KA 2BOGX 1UOZA 3WEMA 1GQIA 3BAYA 2ZYFA 2B81A 1VBUA 5FJOA 2GGHA 2GGJA 4E3TA 4DBWA 3QPZA 4UZSA 3FFSA 2PP1A 4L4OA 2OJPA 2WMKA 4ICMA 3FEMA 4HTBA 3KOZA 2P0IA 4HD5A 4UIOA 1Z32X 3VKAA 1GG0A 1TE1A 4DO7A 3AIWA 1CXLA 1X97A 4QIUA 2W0UA 3PS7A 1XGDA 2OKTA 1EBHA 2C1IA 3R2GA 2NW0A 4HZ7A 4R3UA 4NZCA 4GVFA 2Y8UA 4QEHA 2CCRA 2FHBA 3AS2A 1SZNA 4B92A 5D2TA 3EZ4A 4Q7IA 3VZYA 4RDVA 1PL9A 3AO0A 3NQ6A 3GAKA 4MADA 5T9BG 2PDHA 2FPTA 3NQCA 4I6VA 2E68A 1WOAA 3ZFHA 2EBNA 4U10A 1TPC1 2ACSA 3GU9A 1KM1A 1IZKA 3LA4A 3VO0A 1JCJA 1KFJA 3HIJA 4LS0A 2HZGA 5REQB 2I5GA 3QYQA 3QKZA 1RBOB 1TX0A 1A53A 4ICCX 2BASA 4S3CA 2PRMA 1U83A 3UP8A 1J5SA 4I7VA 1M01A 3AMCA 4XZIA 2QCCA 1KRCC 2I14A 3SJ3A 5A6KA 1B90A 3U3HA 5D8WA 1M1BA 2E3ZA 1OD0A 4GG9A 3B0VC 2AQOA 2FVMA 3B04A 1B3OA 4YU1A 1W6TA 2XG9A 2UY4A 1LCOA 4O4VA 2VX7A 3SIZA 3TOPA 4NL1A 2KX9A 4KGJA 4OBSA 4IX2A 1O4UA 3PZQA 1PIFA 1DHPA 1RXOB 1H61A 2E28A 2VGIA 2E9LA 3N2TA 2AOSA 3PBWA 1FHVA 4AY8A 1W3HA 2HXTA 3MDUA 4ZODA 1PKNA 2VWSA 3P67A 1LT8A 3RYSA 3RGTA 1KLYA 1PS9A 3TAOA 3N2XA 1EL3A 1G4TA 1G94A 4W7VA 1BLIA 4IGHA 2WMIB 2E67A 1JZ5A 4L65A 2W3ZA 2YFNA 4S39A 3OGVA 2J66A 4I8DA 3A5FA 3WBWA 3UPWA 3CZKA 4XZNX 5F7UA 1O66A 4IFOA 4P7QA 4TMBA 8A3HA 4HYVA 2JIWA 3USBA 3SCWA 3S2CA 2YA1A 3LLFA 3STPA 4NQ1A 1F4HA 4D1IA 5I78A 2WCSA 2FPVA 2GGGA 3V4BA 2EPMX 1MEIA 3MSYA 3QBUA 1PIIA 3GM8A 1N8IA 4KW2A 4P61A 4NAEB 4Z1CA 2DP3A 2PDCA 2V2CA 3VE9A 1CXIA 1ME9A 3S9ZA 3RN6A 3PZ9A 5L6UA 2FDSA 3LCGA 3W7EA 4FLOA 3H55A 3HURA 4LVBA 4GGHA 2CBIA 2FGZA 3VDCA 4U5KA 3Q45A 2XVLA 3FYPA 2QCNA 4UTIA 5A1AA 1JNDA 1E40A 3QR0A 3L12A 1ZAHA 4J3TA 1LDCA 1XYBA 2XSBA 1WPCA 3WL1A 2W61A 1KM4A 4DZAA 4FX8A 5C9RA 4BR1A 4IX0A 4H7ZA 5DX7A 4C5YA 2VQUA 2XM1A 4OGZA 2ZXDA 1DE5A 1J2BA 4MOZA 1E56A 3GR4A 2X2YA 2NVCA 1KBLA 1XH2A 1OYCA 1HQTA 4PN2A 1A5CA 3EKZA 3HJEA 1WDDA 4UOQA 1CENA 4XBSA 3LLXA 1ZAIA 4OUEA 3NFUA 3K8MA 3S46A 3TK7A 3B97A 4ZQRA 1F8MA 4O10A 3OU8A 5ABHA 4AHQA 3UG8A 4WY0B 1JG9A 1TFVA 3BG3A 4JTGA 1J0KA 1W54A 4U28A 1OY0A 1EOMA 2GUUA 3KEHA 3PTKA 1OGGA 3ZOAA 2YCJA 2I16A 5I09A 1HX0A 1UKSA 1HO1A 1EHAA 3GK0A 1ICSA 3H4GA 3B4YA 3CS2A 3R5EA 5JXQA 1J01A 4KGLA 4NJKA 1NWTA 3C0QA 1UJPA 2OQHA 2QYGA 4JFTA 1AODA 3GBDA 4M7SA 3TN5A 3A22A 5I23A 1VPQA 2OZTA 3W1RA 1TO3A 5D02A 1P5BA 1W9VA 3CQJA 3DYOA 3WBEA 2WNNA 1BD0A 4QP0A 1SMDA 3M47A 1TTIA 3B8TA 2GJNA 3W87A 2J8FA 4MHBA 5EMJA 3I7RA 3VMPA 1E9ZB 5ENLA 1BKSA 1J8VA 5E0FA 1W5OA 1WUEA 1X96A 1YE6A 4O1AA 2ZFAA 2V5CA 4FR6A 4JXCA 2EKGA 2Z1XA 3L4ZA 4YCPA 2DIEA 4GYJA 3P0XA 3QVQA 4UUIA 1US0A 1OT2A 2R6OA 4S3AA 2QPUA 1ITXA 3ZR5A 1XWYA 2HPIA 4S3JA 1H5YA 3L5LA 3OIXA 1SW7A 3AROA 3AAMA 1JVNA 4W89A 3PPHA 2X1TA 5HNTA 4S3EA 3E2QA 2VUYA 2ZADA 3GG0A 5ABFA 3VE7A 4HCDA 3TUUA 2C91A 3UZJA 3CIXA 3KXQA 1M7PA 2YGYA 4JTDA 4ZO9A 3M0YA 4WUIA 3GC4A 4DVOA 5FESA 5CXPA 5LSMA 2CKSA 3WG6A 3NXFA 3CWHA 4OFCA 3QTPA 1H60A 2CERA 2ZWYA 2DIJA 3SN1A 3BOLA 2XHYA 1FUYA 2XIIA 2XWDA 3GZ3A 3I3EA 3RRXA 5PTDA 3UWYA 4MZ1A 4AZCA 1IIHA 3MC5A 4LJ3A 1TWDA 1Q7QA 1MXGA 1QR7A 3CQKA 4PRWA 5K9DA 4QG9A 5EYWA 3CB8A 3R8HA 1IR1A 1LRTA 4UQEA 1V03A 1TELA 3AXIA 1R7AA 5F4WA 4WF7A 4XZMX 1WE5A 1H7OA 4CU8A 1K03A 4S23A 1O6IA 2B7NA 2FFCA 3EX2A 2QUTA 2XN1A 3KOYA 1X1NA 1YDYA 3SDOA 5AFDA 1ML1A 1UIPA 3KVMA 3SUWA 4NZ3A 5CH9A 3OHIA 1LP6A 1ZBCA 1YPFA 3DHFA 4GH3A 5DANA 1M7JA 4JDYA 3BE7A 2BFGA 1Q8AA 4AIOA 3CPRA 3P5ZA 3BW3A 4NT0A 2Y7GA 2ZVRA 4MY9A 3MCNA 4FA3A 2CWNA 1BYCA 4DO5A 2OGYA 4LUYA 1QOQA 1E4NA 2WC7A 4X2PA 1K9DA 1FA2A 3H7RA 3WN6A 3EWYA 3T1GA 4GO9A 4JQ2A 1IE7C 3SQSA 1SR0A 1J0HA 4BWLA 5DMYA 1V6XA 2D0GA 3BLDA 1BXCA 3N2BA 1QOPA 3S1XA 1Q6LA 2ZTKA 3TTEA 3WLLA 3NYDA 4P8VA 1RPKA 4XD4A 4XZBA 1GNXA 4KMQA 2Z7GA 4IHCA 1RD6A 1GJUA 3KOFA 1F6KA 1MEHA 3C2EA 4NI3A 2Q02A 1RVKA 2ABAA 3C61A 2PP3A 4C7GA 4D6HA 2V2DA 1ME8A 2WZMA 5LYRA 3RLGA 1K77A 1DPMA 3PHAA 5M17A 2QCGA 2A7PA 2P5NA 4FNSA 4MGGA 4R7OA 5EMLA 3ALGA 3WBXA 4LUJA 3OYZA 4UTLA 2HMCA 4IMCA 4YTSA 3PG8A 3WF4A 1F3XA 3QV6A 1C8QA 3ZT7A 2J7EA 5IRPA 2QUVA 3GNPA 3Q2DA 1R2TA 4CD8A 1SO4A 4HPNA 2VELA 1Q6GA 4ZTYA 3SRHA 1H7NA 1V3MA 1R46A 2QJJA 4CQ8A 3P8IA 3QR3A 1E5NA 3PTQA 5ABFB 3BC9A 2DJXA 1EJ7L 3ZLGA 2CW6A 3PFRA 1CLXA 1YKWA 3OJGA 3LZ5A 3QMRA 4XX6A 2Q6ZA 4ICNA 1DJQA 3VMNA 2WMJA 4DIAA 2X0SA 3MCMA 1XLLA 1X6LA 4OZOA 4EPDC 3AXKA 2J24A 1XJBA 2XTKA 3DFHA 3LBMA 4E4PA 4AZCB 3M43A 3WELA 7ODCA 2FYMA 3LEPA 1DIDA 3W74A 4PTNA 3KDNA 4F9DA 1ZS2A 2HBVA 3MKKA 4L6DA 1JZ3A 4KKXA 1DEDA 1AVAA 4AZ5A 1G7UA 4MKSA 2EPHA 1SJDA 1TPVA 2I5IA 5EBAA 4I9AA 4GK8A 1UKTA 2XVGA 1VYPX 4TV5A 3ARYA 1ISVA 1E0VA 4B2DA 4E3VA 1UZDA 2CPUA 2OSWA 3QFWA 2PDBA 1F73A 3UR7A 2GDUA 4GI8A 3V5CA 3PBUA 4EXBA 1E15A 2J8GA 2YL6A 4DF2A 5I3KA 3SUTA 3WNMA 3MANA 4NYUA 4Q4PA 1UP0A 2NWRA 2VC6A 3NQFA 5LNWA 1UPMB 1VD6A 4FSAA 2MNRA 2QXWA 4HMDA 2NX3A 1DKWA 3GRIA 5CJNA 1VLIA 4U33A 1X7FA 1IXOA 2V0TA 3AALA 3W23A 2PI6A 2VCBA 5IM51 4M80A 1VYRA 5HNRA 1CYGA 1WDSA 4JL1A 3IUIA 3CO8A 5E0KA 1NDWA 2G4FA 3KOXA 2OGJA 3AFBA 3JU2A 1JFHA 1W1B1 4LV9A 2QCHA 3TNBA 1TTJA 3MB9A 4LY4A 2FPYA 1O7AA 4XVDA 3H7UA 1NFGA 3DFNA 3DCPA 1PUDA 1JCLA 4IL0A 1E70M 1CCWB 4BKNA 1D3CA 4LVAA 4KEUA 4MFEA 2FHFA 3CHCA 4P2VA 3WD2A 4NZ1A 1X8CA 4QM1A 2D69A 2CESA 1DQXA 1FWHC 3CHVA 3PBMA 2A0NA 3QZ6A 3GDRA 5I00A 4K38A 5FAGA 2VCAA 3MZ2A 1PCWA 1XG4A 2WSYA 3A6OA 4W9TA 5G2IA 5JIWA 1UQYA 2NVAA 3ANYA 4XD6A 1H1ZA 4LYPA 2ZQ0A 2VENA 1ADSA 1M03A 2QJMA 2XINA 4PTMA 3I6EA 1VFSA 1UIOA 4KFNA 3VOHA 1TA3A 3BLLA 3TLLA 3EWWA 4C5ZA 3GFXA 5JBDA 4QGCA 1J96A 5J5RA 1XIBA 1XLEA 2HK0A 1KBIA 2J74A 3V18A 1ZBKA 3WLTA 5F2MA 3G2GA 3T0TA 4HNCA 5GNYA 3M0XA 2ZUVA 4Q33A 3T4WA 5ABEA 4F0HA 4JFWA 2VFIA 3T8QA 4XIAA 3EOLA 3ATZA 3N11A 3TONA 1VYSX 2DZSA 2WM0A 3P74A 4FNQA 3U7BA 3QPYA 3U2OA 4LBSA 1FWCC 3ABRA 4LSBA 5DY2A 4AD4A 4ZOCA 3ZLHA 2XIBA 4Z0JA 1SZGA 3VNJA 2PDFA 1YIXA 3SUUA 1OWQA 3R1ZA 3EWXA 2E5CA 4DJFC 3HPSA 3PBVA 3VCCA 3BCDA 1QAPA 4ENLA 4DZ5A 4AY7A 3RITA 3OVRA 1VEMA 5HQMA 1ELSA 2E9MA 1NWSA 4WD0A 4AYSA 3WDPP 3E0FA 3FYYA 3G3DA 5AYZA 2F9RA 1XC6A 3SQLA 3DFYA 1EO5A 1M41A 8TIMA 3G5EA 3LRMA 2GYIA 4H6RA 3PJTA 1LOQA 4M7TA 1PAMA 3S2NA 2PDYA 3P80A 1ZCCA 3HQPA 2AGKA 3EWBX 4Y9OA 1Z41A 5F1UA 1DWAM 3STFA 5F2IA 3M46A 2RHGA 1POKA 1XBVA 4CD6A 2QJGA 4H9TA 2JGYA 1DWHM 4QJ5B 1H7RA 1K4HA 3LCWA 1DXFA 3O6AA 2Y5EA 2WJFA 2JQXA 4MNLA 1KFCA 1I8JA 1B5TA 4PMVA 4PMZA 1GOIA 1IGSA 5C9WA 1EP2A 3L4TA 3ABOA 4GIEA 2NXGA 3QOKA 2PD9A 2ZA1A 4HOWA 3O9NA 5AZ1A 3ZWTA 2YR1A 4F48A 3T2OA 4BCEA 3M5ZA 4C6JA 1L6SA 3SSJA 1LWIA 1R30A 1ZL1A 1FX6A 1PE1A 4UFJA 1PJ9A 2OXNA 3N4EA 4V27A 5A8MA 2BVTA 2HE5A 3EKGA 4XO7A 4UC5A 3VILA 4JFUA 5H8PA 5A95A 3LHZA 2A4AA 3TAKA 3QV8A 2GJXB 1JEZA 4OQVA 1H11A 3A12A 4HHLA 3BL3A 4JY8A 2X1IA 4X63A 3HF3A 1OCQA 2VGFA 3WENA 2V30A 1S5MA 5IHRA 1KFWA 3P81A 1S2UA 1GQKA 2YL9A 4K8GA 1R6WA 3FV9A 3MUCA 4O4WA 8XIAA 4V2XA 2IQTA 2PWDA 1FWSA 1HUVA 4EIVA 1QBBA 4QQUA 4AY1A 1A5AA 3B0PA 4PODA 3RPTA 1TA3B 4A8RA 4EWJA 1XPGA 4G6CA 3QSTA 1OGBA 1W0MA 5LZLA 1XCFA 3HG5A 1EJVC 1U30A 1Z7AA 2WHLA 2MANA 1UOKA 3S1UA 2ZX8A 3WLOA 3OPSA 1LBFA 4PB5A 4PBFA 3NGJA 4G5DA 1GT8A 4CNSA 2ZXQA 4HNTA 4WXYA 2R1PA 1OHLA 3W1TA 5FCZA 3K1GA 3ITCA 3VKJA 4DBSA 3LM7A 3TMLA 4NXKA 2NQJA 2XU2A 1HVXA 4B2DD 5JBFA 3CL6A 3QHOA 4PUEA 2HISA 3TEVA 2WM1A 3HGJA 5DQPA 4H6EA 3HZ3A 2EQDA 4GVGA 2OOFA 3FAXA 1A3HA 4JKLA 4C60A 1H49A 1PX4A 1W1TA 2BGNE 8RUCA 1GJWA 1GZGA 2Y63A 4H2HA 1H50A 4JGDA 3SQMA 5EMMA 1DYSA 4ZGYA 3VNIA 1EF2A 3GQYA 4E38A 1H0GA 3RCYA 5IFPA 4DRSA 5C0QA 1XYFA 1US3A 2D73A 1W9UA 2C1GA 4ZFMA 2V8ZA 1WXZA 3O1NA 1R3SA 1HKWA 3R10A 3W7GA 2V5KA 1DHKA 5BYWA 3GYEA 5JH1A 1S5VA 3NO3A 5TBOA 4Z2JA 4AW7A 2BP1A 1UWRA 5BXPA 2X41A 4J28A 1P0DA 4PZVA 1NOWA 4F0LA 4GNJA 2Y1HA 1G4SA 3WEZA 2Y2WA 3PZTA 2HCVA 1NSJA 1BQGA 3CXOA 1IZJA 4N9EA 3LPOA 2JGQA 4WDWA 1F4AA 1IV8A 4DUOA 1AJZA 1LF1A 3BOFA 3EEGA 5CCZA 2ESCA 3RR1A 1L0PA 3IJ8A 2VD8A 4CNUA 1E51A 4N6FA 2OB3A 1P6CA 2A6LA 1GONA 3U4AA 4JX5A 4PULA 2R1LA 4K3ZA 3O6DA 4B4FA 5FSEC 5I79A 4AD5A 4GJ1A 5HK4A 1ISYA 2ZX9A 4BS0A 2BXZA 2RGLA 5HNNA 3LBCA 3WLJA 4C6LA 3W1AA 4IOTA 2A3EA 1CZ1A 1ZJBA 3V1PA 6REQA 3SGGA 1IT8A 4Q4SA 3ABQA 2DUZA 3F5LA 3AHYA 4XBJA 1FWTA 4RUBA 1XM3A 4GIRA 3W1MA 4HB7A 2JKEA 3L23A 3PNZA 2ZIDA 4QLKA 4QITA 4LB4A 1AG1O 3UU0A 4RW5A 2JF6A 1LTDA 3H2MA 7REQA 1VFFA 1MZRA 4AHOA 3KS6A 1BF2A 3C5QA 3B0UX 1UP2A 1MYRA 3MSRA 4GNKB 4IQEA 5GJNA 3KX6A 5CZKA 5CJMA 4JX4A 3TWBA 3KRBA 3VNKA 4AXKA 3MJMA 1UWUA 1S2WA 3GXFA 2GL5A 1K8ZA 3S47A 2YDQA 4O1BA 5KTLA 1XH1A 3N1AA 4D8AA 4M19A 1ZTVA 2XH7A 1HTIA 4KIRA 3HFTA 1KTBA 4FOJA 3L4WA 1P7TB 6XIAA 3TN4A 2GDQA 3QN3A 4YN5A 3VVGA 4BEQA 3W7MA 1JF5A 4IXHA 3GR7A 5FSDC 3NQ8A 3EX1A 3NO1A 5FAJA 2CBJA 4I5RA 1H1YA 4DJDC 3PZOA 1C8YA 5DEZA 3HMCA 2D22A 5B7ZA 1B1YA 2E8YA 4FAMA 2P88A 3HPFA 3W6MA 4XSMA 3L65A 1QNPA 3N2MA 2RGMA 3LD5A 1XINA 5J8LA 4QJ3B 2OEMA 2Z1KA 1GVQA 3H22A 2GK1A 2QMJA 3QH2A 2W4XA 3GIYA 3KBVA 4CQDA 3HG3A 3NZRA 4QDWA 4PL2A 2ZRZA 1YMYA 2V38A 3ARQA 4JKKA 5DF0A 4PUNA 1P0NA 4LT9A 4O28A 3O06A 1E5JA 1EUNA 3GHUA 2YBUA 3ONCA 4DM1A 2X0HA 3KL3A 1VBGA 4TXEA 4K68A 3M0MA 4RXGA 3IIZA 3W1LA 1XG3A 4JY9A 4LEFA 2EXOA 3QZAA 1JQXA 1Q3NA 1YLVA 5A6JA 1MQQA 2PAJA 4O57A 4FHAA 1T96A 4IT1A 5LGXA 3N25A 1KM6A 2Z1VA 4PMQA 4IGMA 3LCLA 1WP6A 1K4GA 5CPOA 2XFRA 4HQVA 4JS3A 3LG3A 4LBRA 2UY3A 4Z2IA 4DLMA 3BW4A 3H53A 4RCXA 3VAVA 2V3DA 5JU6A 4DNHA 1EXPA 2GPTA 1IXNA 3CWNA 4NASA 2VFDA 3T0CA 5HWMA 3BH4A 3NZGA 1HP4A 4QXIA 3CH9A 4V28A 1T8XA 4MB1A 4D6GA 2VDIA 2HDJA 2WWCA 3MP3A 2Y7FA 4Z1AA 1KFLA 6TAAA 6REQB 2FMOA 3U8GA 2H9AA 1KV5A 1IEIA 3MO4A 3MY9A 3UZXA 1VC4A 1EC9A 3W82A 3UXDA 1W1PA 4QX4A 4O52A 4PUJA 2VEKA 4H04A 3GHRA 5CGTA 2RJHA 3ARSA 3S2MA 4GFSA 3AU2A 4K37A 1CTNA 5E9XA 1RALA 1LORA 1DXIA 3VZXA 3T40A 1DJNA 1QNSA 4IGSA 3STCA 2EHHA 2ATMA 3EKLA 4LCQA 5AHIA 3UJFA 1DQWA 1UWQA 4KCVA 4ZTXA 3WH8A 6CGTA 4AVOA 2L5HA 1ALDA 4LVGA 3RIKA 3FOKA 4F4RA 3M5YA 3OHMB 2ZZ4A 3H4WA 4U3AA 4UTJA 4J3ZA 4MY8A 5LIXX 3TR9A 1I9CB 4Y9NA 1EJWC 5CC3A 1A50A 4L56A 4X2RA 4LNYA 4JTLA 3AICA 1J93A 2VUNA 2ZWZA 3ITYA 3BGJA 4JD4A 4CQCA 1XLAA 2CNCA 3F4WA 2VD9A 1SPQA 3TTOA 3W0KA 5CQ1A 3F03K 2AKMA 1XC4A 2E6FA 3SCTA 3NXLA 1E6QM 4C6CA 5XINA 4FIQA 4IMGA 4CEUC 3OLIA 4JN6A 1UD5A 3NOYA 1VBRA 2XVPA 2TMDA 4QE5A 1NDZA 1TQXA 4RE0A 4NAFA 4HZ8A 3QHMA 3IJIA 3GW3A 3QQ0A 2E9BA 2VMFA 3VNMA 4ZQNA 2WYSA 2GK1B 9CGTA 2BXYA 2PURA 1RJRA 2CC0A 1OD8A 1S3TC 5D9OA 2ALRA 4JIHA 3PPGA 2ZC8A 4ADTA 1O5KA 4V1XA 1GYNA 1SFJA 4ASTA 4GY1A 4FIRA 3O6YX 3WEOA 2DJLA 4Q4RA 2X7WA 3S5NA 4R7WA 2OPJA 3W7CA 9RUBA 1DOSA 3JZEA 3PZIA 4N9DA 5DXXA 3RLUA 3VA8A 4IUOA 3RHGA 4C6BA 3W9ZA 3FLUA 1E4IA 1ECEA 1AJ2A 2GUBA 3ZVHA 3W1QA 1S5NA 3LHTA 1DWIM 2CWXA 3PM6A 5D2YA 1XIIA 2Y8VA 1ZU8A 5HQLA 2XGBA 2ZCGA 1Y8BA 4JTSA 1N8FA 3IIPA 1D8CA 1EZ2A 1IEVA 1NDVA 2ONEA 3FA3A 1BF6A 2F61A 1UD6A 2D24A 4LXFA 4DJEA 4DN1A 3A4AA 4ML9A 2WB5A 1AH4A 1RHCA 3DKJA 2GSEA 3QLDA 3HV9A 1RSCA 3NPUA 5HA7A 5A2CA 2WZHA 2NXHA 3CV6A 1BGAA 3CH0A 3T44A 1WUFA 3EX6A 4Z1DA 2YCEA 5T8GA 3GNRA 2J75A 2B7OA 2FTPA 4J7RA 1Q6EA 3VIFA 5EKYA 4JHZA 3PULA 4PCTA 1KBJA 1PZ0A 3NPWA 3WFLA 2IKGA 3E2RA 2VC5A 3GU1A 4EWND 4UMCA 2R8WA 4RE3A 1M68A 3B8VA 4IUGA 5AHFA 3MO7A 3WQGA 1L8PA 3WLIA 2IXUA 2WPGA 2NLYA 1AJ0A 3WQEA 2YJQA 1MSSA 3N6QA 2DQXA 1EC8A 4M0XA 1XYLA 3GXDA 3L2MA 5AC6A 4L64A 1IT0A 4AU0A 1YADA 3KS5A 1DJWA 3GXNA 2V3GA 2HPMA 2E40A 3CUZA 3ITVA 5M03A 3C2OA 1PHWA 4GISA 3V1HA 2B31A 2OO6A 3PWGA 4FLQA 2PPGA 4GYPA 1I4NA 1W2VA 8CGTA 4US5D 2XUCA 2W62A 3TYCA 1PZ1A 4BJHA 4A2RA 3BZJA 2NLIA 3PK7A 3T07A 5CSRA 1GVSA 1UWIA 4JTTA 1ICPA 2PU0A 1AW5A 4KS0A 4PTDA 3QGKC 5GNZA 3W71A 4FMVA 1FH9A 3D3FA 3G1AA 1UQZA 4R33A 4PSPA 3QYSA 4S2CA 4ZCWA 1HP5A 5AC4A 5I3FA 5I3IA 4DJDD 3M07A 3IACA 4ZEPA 3UT0A 1UZ1A 3NSMA 4S3KA 2O4MA 3LHYA 2AL1A 1W9XA 5AYIA 5BXRA 4HNVA 1WO2A 1UD4A 1E0TA 4ZO7A 5BNKA 4QDMA 5G1MA 3W7KA 1XX1A 4GHRA 3JR2A 3DG7A 3XINA 4XO6A 1FP8A 5EMYA 3IK4A 4P7NA 1WNOA 5A69A 3G24A 3MWAA 2NVDA 1QI2A 3WL0A 2E4TA 2NQ5A 3VCRA 2TPSA 3DGRA 4QQ3A 1TE6A 3DESA 4KCWA 3WH7A 3EWCA 1QXLA 5D9NA 2OQYA 4OKDA 3M5VA 1R9ZA 4IPPA 4PCNA 3RJXA 4JQ1A 3R4IA 5K7JA 2Y89A 2EPNA 1VF8A 3T2QA 3AJ7A 3VOIA 2FZ8A 1U2YA 3L0KA 2NQ9A 5E09A 4MWAC 4C6QA 2QLYA 4D6FA 2J47A 2VX4A 3CV1A 3W2NA 3LHWA 4QJ1A 1I2RA 4RV8A 5A2BA 1KKRA 3WF2A 5CAHA 3P2VA 5H8UA 5E70A 1X38A 4F0MA 1C8VA 3ZVHB 1JRCA 2WCAA 4DWSB 2WAGA 4WJEA 3VOGA 4NX0A 3GXPA 3BK0A 1JAKA 1OC7A 3MBFA 3WX7A 3F4CA 1YDNA 2P76A 1JCTA 1KR1A 4DXVA 2V3EA 1E6ZA 4F40A 1YNPA 4GXMA 1F8IA 1W5QA 4RZBA 2E7FA 5G4WA 1QMLA 2NQHA 3NUKA 3TSMA 5I6SA 1RZMA 1QNOA 1J6OA 3L0NA 4BQ2A 2DFAA 3V0SA 4YHEA 1DIKA 3TA9A 3NQ2A 1EQCA 1JPIA 1HKKA 1X1OA 1ZJAA 1O68A 3NR0A 2AGTA 5T9CE 4M1BA 3LMYA 1L2QA 4KESA 3UERA 1F74A 4IP5A 3IUHA 3WNPA 4D6DA 1OABA 1JR1A 2VP8A 3BCFA 3N9KA 4GZEA 1TRDA 1LUCB 3MQTA 2OSXA 4PUKA 5FF3A 4A3UA 2Z1WA 1XLFA 2IPWA 1J0ZA 3KHJA 1V7YA 3NPXA 1FFQA 3NQBA 4HT3A 1B9ZA 2WLYA 2YW3A 2VT0A 3EPOA 2WZEA 1PHQA 4DWDA 1H0IA 2G8ZA 4G7EA 2PDIA 2ISDA 3CU2A 3TYUA 3KWSA 3DECA 3P61A 3RPDA 1HJVA 4PMOA 4U2YA 3UD6A 1MXSA 1NOFA 1PXGA 3G1YA 1FCVA 5G5IA 2J88A 5I3GA 2R82A 4I6KA 2Q8LA 2I17A 4GYFA 2INFA 3VGDA 3EB3A 5CGMA 4PUDA 3UNTA 3B9NA 4JIRA 1ITQA 1C29A 1LM1A 2UY5A 1AA1B 5D33A 4B4HA 4OWGA 2YOCA 3MUAA 2RDXA 1A5MC 1R47A 2YDAA 2ZX6A 4XUGA 4IL2A 1QHOA 3P0WA 3HN3A 1TB3A 2F6UA 1EF3A 4Q8PA 1TQJA 2YCIX 4HP5A 1IEWA 4ZO6A 3QMTA 1RBLA 4ZZ9A 3CHEA 1JDCA 1SR9A 3GHSA 4L9XA 4CN1A 3MUIA 3M0IA 4F0SA 4LRTA 3DH7A 1TWWA 2PSNA 2J9YA 3AHTA 3B40A 1VHNA 3KLKA 3WF0A 5BRBA 4DJED 3S6TA 1DORA 1SSGA 4CN4A 2INZA 1XSIA 3RG6A 4CQAA 1FH8A 3ZZ1A 1W31A 3CAWA 3TLQA 5D9MA 3NQGA 4AC7C 1NARA 3W6YA 4J3XA 4PSRA 4B16A 4H7VA 1D3HA 1T41A 3G22A 5F4SA 3FDGA 1X7IA 4AD1A 4XAFA 3DX5A 1N55A 5BOEA 2BB0A 1DWFM 1XIHA 3GX9A 3FIGA 3VUPA 1S1PA 3GVQA 1E3ZA 1YXDA 1ZB5A 2VX6A 2XSXA 5FACA 4MJ2A 4QR6A 3GY1A 2DVTA 1AFSA 1VR6A 4UNKA 4OU1A 3W7IA 3M0JA 3VUSA 4GXWA 5D30A 4QFUA 4QRNA 3TN6A 3QLLA 3NVTA 4MUPA 3V16A 2OG9A 3W2KA 1BXBA 2QGYA 4PBEA 2W27A 3UYCA 3HU7A 3SBFA 1TV8A 3EX4A 1GOMA 4M8UA 3GZAA 1S5TA 1UROA 1PYFA 2HTMA 1FQ0A 4K1WA 2J7FA 2EG8A 3T81A 2X30A 3HO8A 3S6DA 1B4EA 3R0DA 1BG9A 1OM0A 2VVSA 3TDFA 5DFAA 3S42A 1IGWA 1LZOA 1R5YA 3C2FA 3IJ9A 4P7RA 1JULA 3U0HA 4LW7A 1J11A 3LHUA 4MYAA 3WQFA 4J9JA 1K6AA 5H2ZA 2PS2A 3K8KA 3NL2A 5A8GA 2D2OA 4PCFA 1QI0A 4MDPA 1EDTA 1N7KA 1DXEA 1SGJA 3P82A 3M7SA 1YRRA 1LL4A 2PBGA 3PTMA 4QNWA 3W73A 2X16A 4P8XA 3S1WA 1GHSA 2YSWA 3DKLA 4C65A 4PMXA 1VFMA 1ZRQA 2PDPA 3UQNA 1SJBA 3XISA 1MZHA 4G7EB 2G41A 2ZICA 3MUXA 2VVNA 4CU7A 3W72A 1ZNNA 4JZ5A 2V67A 1JRBA 4IPJA 5KZEA 4M81A 2CLLA 3GG7A 4A22A 3MP5A 3QFEA 4O8AA 4LUTA 3TQPA 1TVPA 2FQIA 4R7JA 3IEBA 4ES4A 4MB5A 5LA2A 1QPQA 3WMLA 2QQ6A 5FA5A 1SMAA 2HVMA 5K4ZA 2DVXA 5BMWA 4I5XA 5B80A 1VPYA 5GVJA 2PZNA 1XD0A 4NJHA 5FEWA 1OX4A 3GW0A 1NTHA 1A5LC 5D32A 1M5WA 3NVDA 2VEMA 3SM0A 2FB2A 1EJTC 4LF2A 3L9CA 2JEPA 4UXDA 5E9AA 3K8LA 1JDFA 4IIFA 5HWNA 4XWUA 3R8GA 3CJPA 3I4EA 3DEQA 4CKQA 5A94A 1QO5A 1XLMA 2HVNA 3AMLA 3S5SA 4C7FA 4L61A 4YYCA 2Z2UA 4AUBA 3N73A 4W85A 1MW2A 5BWFA 4JHMA 3P14A 3UA4A 2WLZA 3M6YA 2R1NA 4GY7A 1B3XA 3NAVA 4FR1A 5D4YA 3MBDA 4OTKA 4E6MA 2NV2A 5FKYA 2QPSA 1I2QA 2XVKA 5KSWA 4J3WA 3SFWA 3R13A 1RH9A 1TV7A 3GTNA 4Z2HA 1G5AA 3UVAA 4ZFCA 3EXSA 3DENA 3GC2A 3REQA 3B8IA 3AJXA 4AEEA 1Q2SA 2POTA 2CLOA 4MNKA 4DLFA 4ZOBA 4JNMA 3P3BA 2J7HA 3BLIA 3ZT5A 4AHPA 3F4DA 2CBVA 2QULA 3W70A 4GUFA 1DVJA 3KUMA 2YDRA 5FF7A 4L6HA 3N2OA 1JI1A 4X60A 1XHGA 1KGWA 2X1UA 2DSUA 1EJRC 1TUFA 4IGNA 1HJSA 1YQ2A 2NV1A 5AN7A 3MJYA 2R14A 2VJXA 4WK9A 4B5UA 3MVIA 4NNAA 3CUJA 1W9BM 4GQ0A 3W1XA 3GKAA 3VIKA 5XIAA 3E0WA 4K7YA 2GQ3A 3K4WA 3RF9A 1T99A 3CEUA 4UTMA 2ZUWA 3TQKA 2ZDRA 3BXWA 1GTHA 3U7VA 2OWXA 2HQAA 3W2UA 1NF7A 1XICA 4A2SA