3VOGA

Catalytic domain of the cellobiohydrolase, cccel6a, from coprinopsis cinerea
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
362
structure length
362
Chain Sequence
b'VPSTGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiohydrolase
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
total genus 137
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3vogA00
1OC5A 2BOFX 3ABXA 2BOGX 3VOFA 4AX6A 1OCJA 1UP0A 1UP3A 1HGYA 4AVNA 1OC7A 2BOEX 4I5UA 1QJWA 4AVOA 1OC6A 1QK0A 4B4FA 1OCNA 1BVWA 2BODX 4B4HA 1OCBA 3A9BA 1UOZA 4I5RA 3VOJA 1UP2A 3A64A 4AU0A 1GZ1A 3VOGA 4A05A 3RU8X 1QK2A 3VOHA 1CB2A 3VOIA 2BVWA 1HGWA 1TMLA 1DYSA 3RPTA 4AX7A
chains in the Genus database with same CATH superfamily
3U3HA 2PDJA 2CWXA 2J6VA 3PTQA 4US5D 3ZZ1A 4D6CA 1U1HA 1IEQA 3WUEA 4US5A 4X22A 1S2TA 3FV9A 3O6DA 2ISFA 1F74A 3CAKA 3OHIA 1E4LA 1W6TA 3LTSA 4WIWA 1E6PA 3FK4A 3EX2A 1ZP4A 3WF1A 1IXQA 2OSXA 3NSNA 4WJ8A 5FJUA 1K1DA 4YHEA 2GFTA 1PWMA 3WF3A 5IFPA 3NL6A 1I2QA 1S2WA 3VD5A 3W75A 2PP0A 2PUZA 4N42A 4K2SA 1F3WA 1BFNA 2I5GA 1LLZA 4S23A 1F6PA 2IUZA 3LD5A 3S2MA 4URIA 4M7TA 4JTKA 1YIXA 2P53A 5TIMA 1CBGA 5DCBA 4QIUA 4XD5A 4PN2A 1QU4A 3VE7A 1ZENA 2EPMX 2QCFA 5HJLA 2WBGA 2NVDA 3AO0A 4LPCA 3M47A 2AQWA 4TX6A 2DIEA 1H5YA 1P0EA 1I9CB 1EJ7L 3GXDA 6TAAA 3BAKA 4KS0A 4PUJA 3DXIA 1PDZA 1ALDA 1WV2A 1QNVA 2J8GA 4L6HA 3SQSA 3BQ6A 1EJTC 1UOZA 1IZKA 2C1HA 2WOQA 3QVQA 8XIAA 3C2YA 1V79A 1QNQA 4WKAA 4HHMA 1JF6A 1ZFJA 2WO5A 1JAEA 2HRWA 3NSMA 3K4WA 4RNIA 4E2DA 1EC9A 2KZHA 3MCMA 2ZRWA 2IKJA 2QJJA 2DZPA 4HNNA 1AW1A 2NUYA 1SW7A 1M7PA 5EFFA 3E5BA 1U5VA 5HNNA 2HTMA 4FHAA 4REQB 5HPCA 3G8EA 4PTXA 2BY0A 2XIBA 3H22A 4L9YA 3ANUA 1C8YA 3A4XA 5CPSA 5XINA 2OT0A 1SZFA 3VNJA 4IIHA 4DYEA 4UQ9A 4YWIA 1S3TC 3MYPA 1DJGA 1BF6A 3KEHA 4K8HA 3T8LA 1JCMP 3SGZA 2NT1A 1XXXA 3ZOAA 3QTGA 1KKRA 5FL0A 5KZ6A 3QZ6A 4TR9A 2PBGA 1BKHA 4HN8A 4JDYA 3GXIA 3W23A 1E0XA 2G96A 2NT0A 3W7IA 4N7QA 3EDKA 3W2NA 1GVEA 4GXPA 3ZSSA 4B5VA 2J25A 4ZA0A 1ICQA 2CLHA 2AAMA 3QZEA 1TPH1 3C8FA 3SCRA 3S2JA 3TC3A 7ODCA 3GTFA 2G3JA 2Y7DA 2H3BA 1EWDA 4YPJA 4UXDA 4IMCA 1G67A 3MC5A 3V5FA 5EL1A 1KC7A 3B4YA 3VD7A 4DHGA 1OFAA 3O07A 2A4AA 4CNPA 1D3GA 5FJIA 3S5YA 3KVLA 2YBTA 1GCYA 1DYSA 5J8LA 1I0DA 1E56A 3UYCA 3BG3A 1F61A 4FLOA 5J04A 4ZQCA 1XYCA 1CGYA 4I5UA 1DEDA 4AD2A 4DIAA 2BGSA 4QITA 3W22A 2WMHA 3IIZA 1E3ZA 3VK5A 3FYOA 1OEPA 1AZ1A 3GZ3A 3T8QA 2Y85A 3WLKX 1WBJA 1EKOA 3O7UA 5DY3A 1W37A 1UQZA 3HN3A 3N13A 5JXQA 1QPOA 2VVSA 4PFHA 1W3JA 3LCGA 2XINA 3FA3A 3CAWA 2MNRA 6XIMA 3K1DA 3KLKA 5FACA 3S83A 1GJPA 4PUKA 3DAQA 3ORWA 4HPNA 1XIHA 1XX1A 2VRJA 1EC8A 2E5DA 4JIQA 3ZT6A 4O13A 2V68A 3GBDA 4E2OA 4ONVA 4FNQA 4QJ1A 2O55A 1KXVA 3UNTA 4A3QA 2QEZA 4W88A 1JDCA 5D02A 4HZ6A 1U1JA 1PBGA 4MUZA 2PDCA 2XSAA 3COTA 1CIUA 2UZ9A 4AXKA 2WHMA 2YKKA 2YBVA 5E93A 1E9LA 1F7BA 2CZEA 1W9XA 2RAGA 3VO0A 2DVTA 3AUJA 2PDIA 2J9ZA 2E25A 5G4HC 1O5QA 2NW0A 1OX4B 2IXUA 2QR6A 2X0HA 3UJSA 4LS1A 2VGIA 3BOLA 4ZTYA 4G8TA 4CNNA 1SMDA 3W53A 3TC6A 3ZJ6A 4M82A 3UR7A 1V0KA 2CLEA 8CGTA 4TV5A 1CCWB 5LIUX 4IMGA 4S38A 2OLSA 4DZHA 1V6WA 4XBKA 3OG3A 1NDZA 4C5ZA 4L9XA 4PODA 3QJAA 3S46A 3VTRA 2CLIA 3BE7A 4CLMA 3DI1A 2CBJA 5C55A 3MO4A 3N6HA 3RX2A 1A5AA 1E1EA 3UW6A 4Q7IA 2NWSA 1ZZMA 1YKWA 5LNSA 3WF0A 1DWAM 3GHSA 5DMLA 2PZ0A 5IOBA 1SJDA 1SR9A 5H8PA 4G1NA 2DU2A 1UZDA 1UKOA 1TCDA 4K1WA 4IPIA 1PKMA 4HZMA 4BS0A 1KCKA 3EWZA 3QR1A 3SGUA 1E3XA 1P0BA 3DHFA 3B97A 4Q4SA 4PULA 4NNCA 1M1BA 2OWXA 4RUBA 3I65A 3QYSA 3ZJ7A 1GOMA 1ISXA 1VS1A 1HX0A 5EMLA 3H4WA 1VYPX 4FR1A 1QXLA 3NOEA 2OZ3A 1GUVA 3V4BA 1XH2A 4KWWA 2AKZA 1O94A 3P5YA 2XIQA 2PDMA 3T4WA 3QY8A 1C9WA 4HK6A 1JVNA 4JIHA 3B04A 3USBA 1XBXA 3CIWA 1QATA 2DH2A 1JDEA 3AIUA 3W7JA 1TTQA 3LYEA 5I03A 4ZBCA 3EOEA 4WDXA 4GI9A 5ECUA 1CWYA 3PJXA 3OYXA 4GH3A 4GUFA 1FXQA 2VYOA 1CLVA 1S2AA 4E38A 4C6FA 2P3ZA 1XV8A 3P93A 1PZ3A 3SY8A 4B15A 2P0IA 1J0IA 2YB1A 1JXJA 3C56A 4ECLA 2FHCA 2CESA 4ZOEA 1GHSA 3IGXA 3GVRA 1DBTA 3PB0A 1CEOA 2Q8ZA 3ITVA 3SW6A 1Y7VA 3WLHA 3TFCA 3W7LA 3HOJA 1XCFA 5CSSA 3PUDA 1UIPA 5I79A 1ODUA 3EA2A 3FJ6A 4MNKA 4M24A 4NUWA 1P6CA 2CZDA 4C1NA 1F6YA 3SCTA 1GQLA 1FTXA 4H9ZA 2ATSA 2CLOA 1K7EA 2VR5A 1G7UA 3W9ZA 1VPYA 4OZOA 3URQA 4ACZA 4PCFA 3NQ2A 1S39A 3RRAA 3DFOA 3V1PA 4HCHA 4G2DA 4JPGA 5HJXA 1LJYA 2WMJA 3STCA 2YLAA 1W54A 4MKSA 1ZLPA 4X2RA 3T4CA 3BLFA 1UR2A 1P4CA 2PLMA 1H7PA 5FEXA 4P61A 4PL1A 4R3UA 4MZ8A 4AIEA 1FWRA 2X09A 3MKVA 3W85A 2ZRXA 4C7FA 2J8FA 1I0BA 4AHPA 1V6XA 3SRKA 3AAMA 1LG2A 2PWVA 3AIBA 2G97A 1JIBA 1PYFA 3G1HA 1FQ0A 2YLLA 5FJOA 2ICSA 4N9EA 4ML4A 2Z2BA 2CFFA 4OV9A 4MZ1A 3SI9A 3WIJA 1Z69A 3AYRA 2HNHA 1ONRA 2ZE0A 4JFVA 3ARYA 3M0ZA 1TX2A 4PA8A 3E96A 3RMEA 5HUOA 2OEJA 1WDWA 5E0FA 1GT8A 2X2YA 1P6WA 3GX9A 1EPXA 1UCWA 2VOMA 1DJWA 3PWGA 1TIMA 1OK6A 3WDPP 3ZR6A 2QUNA 1TPB1 1FP8A 2A7RA 2WKGA 2HK0A 1MNZA 3AMDA 1NP0A 4Z08A 1XLFA 2YXGA 4Z1DA 4O1FA 1H1YA 2CHOA 3G18A 3H7RA 3PUGA 2HSAA 4JYDA 4M51A 3T08A 3IIXA 4NZJA 2CZ5A 2IW0A 4PL2A 2J75A 3T07A 1KA9F 4WDTA 3RN6A 4NHVA 3BOFA 1UHVA 2DUZA 1OJXA 3IJ6A 3LRKA 3BSMA 3AFBA 3SIZA 2QCEA 3RLUA 1SR0A 2AL2A 4GFIA 4FZIA 4CEXC 4K8GA 2ZZ3A 4WDWA 1YDYA 3TQPA 2J7BA 2A3CA 1MQRA 3CHDA 3UR8A 2DZAA 4DPQA 3O16A 3LI0A 2Q8LA 4JQ2A 4JTQA 3UZ5A 3AS3A 4UTMA 3TSMA 3VIOA 4NY2A 1OGGA 2QUTA 4A3RA 4X0VA 5BZAA 3MP3A 3A4AA 2FFCA 2HVMA 4XZHA 2AOSA 2OB3A 3ITGA 2P5NA 1LQ0A 4IJCA 1US0A 1WDDA 1JZ3A 2QW5A 3BAJA 4S1FA 3SIMA 1A5CA 3P0WA 2VL4A 1BXBA 5KTLA 4OWGA 1AQMA 1TB3A 1WXZA 3BSGA 1QRQA 3QFEA 5C0QA 1AQFA 1PSCA 4G9PA 2WXDM 2GJPA 1FWIC 2YDQA 2WJFA 1GQIA 4Q8PA 4HU4A 1KQYA 1DTNA 4JHZA 4B5NA 4O53A 4FK9A 4AD5A 3FN9A 2RUSA 1R9ZA 2CBUA 2Z00A 2QJMA 3VNZA 4LBSA 1OBAA 1J5SA 4UMCA 1Z44A 4UR8A 4GC3A 3MTWA 3V5CA 2J7FA 1QBAA 3FFSA 3D47A 3HA1A 2F2HA 3H23A 4RCXA 1J10A 2TAAA 5G2IA 3GB6A 2QPSA 1GZGA 4A35A 2GLKA 4AMAA 1Q85A 3RIKA 4UQCA 1Q45A 3EOOA 1MQQA 3ZLFA 4XWUA 1UKSA 1VF8A 1TWIA 3EPMA 3B0YA 4F2UA 4Y96A 1EOMA 1G5AA 1SM9A 2CLPA 4WK9A 5HMFA 4R34A 3IJIA 3IWPA 4PMUA 3VIJA 4NZ4A 3S4TA 4UCGA 2ZWYA 4LYPA 1Q6CA 2PE4A 1A49A 3LY0A 3RAOA 2UWFA 4JY8A 3GWQA 4DWSD 2X42A 1DXFA 2CXEA 4DWSA 1QDSA 4XQ6A 2I1OA 4GNKB 3R7MA 3GDLA 4MFDA 1P6BA 4HYVA 3BZJA 4M3PA 3FA4A 2DVXA 1GJWA 2FIQA 1FCQA 1H60A 3GTIA 4JTGA 6TIMA 1DE5A 4IP7A 4Q6XA 3E2QA 1UASA 4OT7A 5HA7A 4L1XA 4OV4A 3UXIA 1SZNA 3U2EA 1XIFA 2XVKA 1M03A 2CEQA 4IP5A 2YL6A 5A6MA 2P8BA 1BKSA 1ONXA 3CQHA 2PWGA 2YZRA 2XIMA 1VGAA 2YCLA 3KP1A 1PS9A 1Y5XA 1K3UA 1E1CA 4QRNA 1FBAA 3GLCA 3M7SA 2V6AA 4MYXA 3O63A 4W8BA 1EBHA 2OPJA 1EQPA 2MANA 3QGAC 4OECA 3FIGA 3SM0A 3CQJA 4HNCA 3UQNA 3MMDA 1J18A 1X7IA 4OBTA 1OX6A 3DOPA 1UUOA 1C8QA 4JYEA 4GJJA 3OA3A 2Q6ZA 3APTA 1LWJA 4JKKA 3CMJA 1J93A 4H8HA 5EFDA 3LGDA 2X1IA 4Z2JA 3UR2A 3QC3A 4M6UA 4HMNA 3LUTA 3ZR4A 5PTDA 4LVBA 2GWNA 4H01A 2NLIA 4C7DA 5BXSA 2ZUVA 1IEIA 4BI6A 1HUVA 4O1EA 1MWOA 2V5BA 3H8AA 2PB1A 2ZRZA 1MMFA 2J13A 5EBAA 1RH9A 3TYCA 1M9HA 3KCOA 4LAUA 1E4IA 3WLMA 3UJ2A 4GRSA 3K8LA 3W24A 5KZDA 4AAJA 3EWBX 1BWKA 1TTJA 3IV8A 3RM9A 3MQTA 3SQMA 4A2RA 3PZGA 2XGBA 4IGMA 3S2NA 2G50A 4X61A 3GS6A 4A8NA 3Q94A 5EPDA 5B7ZA 1DOSA 4Q4PA 3UZWA 1FOBA 1B3ZA 3AS1A 3BQ5A 1WBHA 1KB3A 2HV5A 4Y90A 3VNIA 3WD0A 3E49A 1TV3A 4FXFA 2DZBA 2E1DA 3M5XA 2Y7FA 1PKLA 5BOFA 2WMGA 3CH9A 2VWTA 3S1VA 3GK0A 4AZCB 3E0IA 1QOPA 1J0ZA 3O1NA 3MUIA 4ZFCA 3IACA 4PB5A 3ABZA 2FYMA 2X1RA 3NA8A 1HO1A 3H2FA 4NIRA 2R1NA 5D2VA 5CC7A 2DW7A 1XYMA 2B7QA 2YB4A 3KUMA 1WAUA 3E2VA 2RKXA 4MYAA 1MEHA 5U7SA 4QE1A 1QWGA 1Q6DA 2WMIA 4AG0A 1G69A 1OC5A 4ZZ9A 3HG4A 4G5DA 4DUXA 4ICCX 4INFA 4HQVA 4H7VA 3CO4A 3DGBA 3K13A 3IEBA 2XU2A 5LHEA 1W3IA 1H7NA 2BXYA 4FALA 1UWRA 5LHFA 4Z1BA 2G3IA 1UWSA 1XIBA 1Z42A 3E38A 1W1A1 2OQLA 3MMUA 4YN5A 4RZ5A 1DP0A 4O17A 1KGWA 3W3OA 4L6OA 1I45A 4DJED 2QJHA 1XLDA 1JUBA 4JEJA 3VX0A 4AD3A 3RR4A 3C52A 4FR6A 5EY5A 3FSTA 3LPGA 1CGTA 2SFPA 2C14A 3W1AA 3A6OA 2W3ZA 1PEZA 2O7SA 4JTHA 1G1YA 1S3HA 1OYCA 4IWWA 3G1VA 1M53A 1TPWA 1R38A 1IEXA 3TZNA 1W31A 2DZSA 3U7BA 3BMXA 1Q7QA 3WQDA 3AIQA 4HZ8A 3EXSA 5RUBA 3S8HA 4IT1A 3A22A 4UTTA 2BB0A 5JIPA 1KBBA 3WH5A 4K7YA 1YX1A 4Q8TA 3DFSA 3TA9A 4EPDC 3UVIA 4AY8A 3WLJA 4W7VA 3L0GA 1OF6A 4MSSA 4JTRA 1T7LA 3AWNA 2OZ0A 3BH4A 1IEVA 3UG5A 1P1XA 3UEQA 3AXMA 1K7XA 3LX9A 3W7HA 1JZ5A 5G2HA 3DESA 4CU7A 2NSXA 1UWQA 2EHHA 1SZRA 2PDYA 4H6RA 1KR0A 4GVHA 4LC6A 1AQ0A 5DLCA 2GSJA 1A0DA 4RLIA 1C92A 4I5RA 2YJQA 3XISA 1AZ2A 3LCIA 4LYKA 1BGAA 1XICA 5I5RA 1VJIA 3ATYA 2DEPA 5FIPA 2VJXA 3C2EA 3VPLA 4KCTA 1PB0A 2C18A 4H8NA 5CLTA 5BU9A 2DZUA 1R2SA 3CHVA 3BAWA 5JVLA 4CQAA 3UZYA 3M16A 1HKMA 3FCPA 1F05A 1WDRA 4DBDA 2JGQA 1DWJM 4J3SA 4DNMA 2KAUC 3TX9A 3VX1A 4QQUA 3ARTA 1TWSA 1FVPA 4IHCA 4UB9A 1ZRQA 4WSKA 4XD4A 4NYYA 3KZPA 5DF0A 4OFCA 2CXGA 3NR0A 4HPJA 5IBXA 2WHKA 3SCWA 4HU3A 3PTDA 3IJLA 1R3QA 3BV4A 3GQYA 1SQ7A 1IWPA 3WD3A 2R9RA 4QAIA 1MXSA 4J3UA 3S1WA 1KFKA 3G3MA 3V0UA 3PR2A 1Q66A 3LPPA 5KSWA 2VEIA 3UYIA 4QJ3B 4IG2A 2VEPA 1C90A 3RU8X 4P7NA 4LB3A 2VUYA 5AVHA 3B0VC 2Y0FA 3TFXA 4F4RA 4OU1A 3GDKA 4DF1A 5TD4A 2OZ8A 5K9XA 2ANUA 3D0CA 5C7HA 3PNUA 2ATMA 1AW2A 6REQA 3WBAA 1EX5A 1VENA 1B3WA 3M64A 3W7GA 2GDUA 2PAJA 1CLKA 1B90A 1H61A 1X6UA 1RR2A 4YNGA 3BCJA 2GGGA 3T0AA 4A3YA 4HP5A 1ICSA 3EX1A 3MCOA 4JFSA 1RBAA 2I56A 3MI3A 4CNUA 3VZYA 3BICA 2GJXB 1KGUA 2PF0A 2WK2A 3BANA 2VFDA 1BTMA 1PKYA 3UWEA 4M81A 3UPBA 2WSKA 1EGZA 1XRTA 3PBWA 4A29A 3LSBA 1H2JA 3A24A 2VEFA 3RPDA 1C7SA 4LUIA 1YXCA 1CXIA 5K2ZA 4CN1A 2XVPA 1KR1A 5HWMA 3B9DA 3P3BA 1YBQB 1GYMA 3HPSA 4FLSA 4J7RA 2OJPA 4WHBA 2QV5A 3WD1A 5I77A 3W25A 3M0KA 3THDA 1G4TA 5LNVA 4Z0SA 1BSLA 3IUIA 2BXVA 2YA0A 2I57A 1FDYA 1LUCB 4AMCA 4DWDA 3KL0A 4GD0A 1TIWA 1ISYA 4IJRA 1SJBA 4GHRA 1E1FA 4FX6M 3SCUA 2HE8A 4BR1A 1UYQA 4W8AA 3GDTA 3VM5A 3S1GA 3LLFA 2FFIA 3PZUA 1A3XA 3CV1A 2Y88A 3U8GA 3CYJA 4HOWA 3BDKA 5FEWA 3WUGA 2PC8A 2GSHA 5D9PA 2Z0IA 3B8VA 3BMWA 1UR9A 2EPOA 5HUPA 1U83A 1ADOA 1TJRA 2DSWA 1PPIA 5ECVA 2POZA 1X97A 3GSMA 5BOOA 1T8QA 2JALA 3GY1A 1B5TA 1UQYA 3WMCA 1RK6A 2FPTA 4D6HA 1ZTVA 3NJ3A 3VOGA 2VX6A 1A80A 3O3RA 4YVXA 1F9CA 4QSHA 1QFEA 2G5WA 2F9RA 4DY1A 1KFJA 4LALA 2VXNA 5AYBA 5I00A 2YL8A 4I9JA 4BKNA 2ADAA 4W7UA 3CV2A 1L6GA 1RBLA 3NO3A 3GFZA 2W79A 1EPVA 1JZ7A 3IJDA 3N29A 3E12A 4M5PA 2VNCA 4EACA 1I4NA 2WAGA 4JZ5A 4OOZA 4JIRA 4UTUA 1EWEA 1TCMA 2OCZA 3BOXA 4D8AA 3P60A 4LW7A 4C6PA 4GYPC 1DTUA 2BASA 2ZA2A 4IUGA 4PMRA 3IK4A 1NDVA 2XTKA 4YTRA 4FNTA 3HFTA 4DUVA 3N15A 2PRHA 3DFQA 1S38A 4I8YA 4UTKA 1EQCA 2C7FA 3ITOA 4J40A 2Q09A 3VKDA 3LBCA 3GM8A 3NL2A 2A85A 4Y7EA 4OGZA 1JFHA 3WQPA 1YDVA 3FAWA 1KO0A 2OSYA 4HJWA 1HJXA 3U0HA 4ORIA 1X8CA 2I9UA 1VFFA 3NWRA 1NARA 3SSJA 2HS6A 4GINA 1W5MA 4DBSA 4O52A 1LRQA 1UZHA 3IVTA 1KLYA 4ROQA 3F4DA 2NV2A 5DCDA 4R7OA 1JCXA 3FW6A 4WXZA 3F2BA 1CXHA 5BXPA 1TVNA 2FJUB 4IF2A 2VFGA 5G1YA 2PU0A 4K7VA 3AYTA 4B9ZA 1HT6A 1XH0A 1KXQA 1IV8A 4QG9A 2GJLA 1K6WA 1V0LA 4PRWA 4KRTA 5E1QA 1VRDA 4U5IA 3O0KA 2PP3A 2Y5EA 1PO9A 3EDJA 3TCSA 3A23A 3WLRA 4TOQA 1XLIA 1T8XA 3HURA 3LCWA 4DJFD 1S5MA 3VILA 3N9RA 4DJFA 3P61A 2ZDSA 4KMQA 1GTHA 2XSBA 3R8RA 3RR1A 2FB2A 4Z0JA 3GUWA 3SJNA 1TUFA 4UQBA 1XIMA 5KEZA 1ZJIA 3DHUA 1MXDA 3GE7A 4H00A 4DZIA 4ROPA 2J74A 3O2LA 4HA0A 4LYRA 1Y5VA 3NQEA 3TWAA 1XG4A 1V7YA 1CXKA 1GKQA 1JGIA 2ZXAA 1PZ1A 5CZKA 1QI3A 1YDOA 2XH2A 2ZRYA 1XR2A 3RF9A 1UD2A 2G4FA 4IGSA 3RMJA 5K9DA 1RJQA 3MZNA 2TYSA 2W63A 1PZ2A 2IKHA 3TN5A 3EX3A 2OFJA 5I02A 3B05A 1TFVA 4YCPA 1W5QA 3L5LA 3UJFA 3M6YA 3EYPA 5LNRA 4M80A 1I1WA 4DO6A 1Q5MA 1XKYA 4OUEA 4HU8A 1BD0A 4N4QA 4GI4A 2DORA 1BF2A 1JUEA 2PLJA 2RDWA 2Z1XA 1RXOB 3MSRA 1VLWA 5I07A 3EAUA 2DGAA 4C6DA 4NNBA 4PCTA 1W1IE 5E6YA 4ZL1A 1GVIA 3C61A 2IMRA 3T1GA 1XG3A 3VINA 4PMOA 2CIPA 4K38A 1IE7C 1ZBWA 4LWWA 3W1TA 2XG9A 4FS9A 2YZ5A 3GNPA 1X39A 1LQ2A 1QT1A 2X7VA 3R2GA 3AZTA 3LU2A 3T42A 3QH2A 1RLDA 1FX6A 3U2ZA 1H1ZA 1XCWA 4UNLA 1B3YA 3KVJA 3MCNA 3MI2A 3H26A 3QQ1A 3FXYA 4XD3A 2XWDA 4LB4A 3WX7A 3AROA 5C70A 2E77A 2E09A 4TIMA 4KEZA 5H91A 3G1RA 1XGEA 1DWGM 3GAYA 3HPAA 4B90A 1WA3A 4ACYA 3UFYA 3ZLGA 5DT7A 1JI2A 3PHAA 2G3MA 1BQGA 1UR8A 3SBFA 2NQZA 3GH5A 3PBVA 2J9XA 3IUHA 3TWBA 1V3LA 1V4YA 1XRFA 3G8RA 2V67A 2HWGA 2WM0A 1H7OA 3QV8A 3KBJA 4PMZA 5BWFA 1LLOA 2Z1SA 2Y63A 3BLLA 1Z8AA 4PMDA 4RE2A 5LSMA 2XPKA 4HTYA 4F48A 4CEUC 2C79A 1CDGA 2I7GA 3CMFA 4UC5A 4RR4A 1LRNA 2HXTA 3FVDA 1YW1A 4DB7A 5JH1A 3H55A 4FSAA 3W83A 5FAGA 4KW2A 2PDQA 3H2EA 5LYRA 1NVMA 1GQKA 1T40A 3NQMA 5CSUA 4YIWA 3H54A 4OBSA 4ZODA 5F4WA 2CNCA 2VGBA 1M5WA 2DZVA 4RPPA 2A7NA 4I7UA 5FJPA 3TEVA 3LBOA 1HJVA 3H2MA 2PCEA 5JBEA 3G0XA 3TYEA 4FIRA 4EK7A 4QCEA 3CLWA 4GA8A 1W9UA 2V3EA 4F8XA 3SN0A 2YW4A 4UIOA 2WPGA 2WNZA 1DWHM 3VNDA 3Q45A 3S9ZA 3VOCA 5HR7A 1GEHA 5CC6A 1TELA 1YE4A 2XFWA 2ZADA 1K4GA 4D71A 3SY5A 1E15A 1M7XA 4C6CA 1FHLA 3PUOA 1NEYA 3KTCA 3RG6A 1A5KC 5C9RA 3ECQA 1RALA 4LVFA 2ODOA 3L4WA 1ISZA 3ZLHA 3CASA 5DBTA 3TAKA 3LN3A 3SFKA 2C8NA 5EB8A 1EFZA 4DZAA 4QAWA 1PKNA 4WOZA 3OIHA 4V2XA 5CSRA 1E0TA 3TJIA 4KKXA 1GPFA 3TV8A 2YDRA 1YHTA 1KBKA 4U2YA 3E0WA 2JGYA 4DM2A 1JDFA 2B7NA 2FMNA 4O50A 4LH8A 2ZDRA 2EJAA 1PTAA 4GABA 3E02A 3VIFA 1TE1A 2FZBA 4WDUA 4P7OA 4MNMA 1HQTA 5A95A 1KTCA 5C9UA 4A05A 1R30A 2O56A 2HCVA 2WMKA 1RV8A 4Y9NA 1P0DA 3H2NA 3GDRA 4GXMA 3UR5A 1B1YA 1YYAA 4Z2GA 1BG9A 2PDUA 2I14A 1VCGA 4R33A 4UTFA 1DJHA 4UFKA 5D2YA 2ASHA 1UOKA 3SCQA 1BSIA 2YW3A 2HBVA 1QK2A 4PTWA 1O1ZA 1P43A 3SUSA 4LCQA 2FTWA 3IGSA 3CGTA 3EKLA 1DV7A 2JEPA 2YCIX 4HKPA 4Y9AA 2J7EA 3LZ3A 3HB9A 3LMZA 3PZIA 1QWKA 5I3GA 4W9TA 3GBEA 4FXRA 4A8LA 5M3WA 1U30A 3DC0A 5F2IA 4IQEA 2J7DA 4J2MA 1FCVA 2V63A 4M19A 3VMOA 1XUUA 4YL2A 3WQFA 1V3MA 2Z1BA 4NJHA 4ZO6A 3GZAA 3WJXA 1W1TA 1J0YA 2X30A 4MDPA 3LHTA 4GY1A 5ABFA 4HMCA 5CC3A 4MJ4A 3WBXA 1JYVA 1V77A 1BXNA 3HIJA 3O06A 2GJNA 3WLNA 1E5JA 3UF9A 4ATWA 4JIIX 4UOJA 5AFDA 3VNKA 4DLFA 2X8RA 2AQVA 3WH8A 4LU0A 3HG2A 3QOKA 4ACZB 1NF7A 3OGSA 1R47A 1DXEA 1WOAA 2J7HA 1P1MA 1KNWA 1B30A 2HVOA 3W7OA 1K9FA 1AG1O 4A8RA 1BHGA 5F4XA 4DBUA 1GTEA 2W0UA 4UNKA 3NEVA 4RXGA 2I17A 4LFYA 1TJ0A 7A3HA 3M44A 3ERPA 2H8ZA 1FFRA 1LT8A 1UB3A 3M7WA 4RZ6A 4KERA 4O8AA 2IKGA 4PE8A 3L5MA 4Q6JA 3TONA 3NVDA 1IIHA 3VDBA 3N3TA 3S47A 3NSXA 3OPSA 3HM7A 1YNYA 4DF2A 2PTYA 2DFAA 4XG1A 4OVXA 4C6EA 4P7QA 2O4QA 4MY8A 3ZSTA 3DYMA 1TV5A 1GW9A 1XRVA 4W84A 1E6SM 4PUMA 4O0KA 4UFJA 5GNYA 1IZJA 2WZTA 4FIQA 2Z7GA 3AIRA 4JN6A 4JAWA 1N55A 3GYCA 2ZUMA 3DYOA 1QW8A 4JL2A 3MP4A 5CEWA 1K4HA 4I5XA 5I3IA 4EANA 3KS5A 3L66A 2Q3RA 1OFBA 3KOXA 4LUJA 4MY9A 3EB2A 3PWIA 3ZYZA 3W00A 2IPFA 3MZ2A 4V27A 1FKXA 3DGRA 4PCNA 3OODA 3SUTA 3UXKA 5T9BG 4C6KA 3JVAA 4GQRA 3UETA 1UUQA 2NZLA 4AIOA 4LSBA 3AZRA 5CPQA 1JFXA 1RBOB 5HAOA 4IIGA 3WNKA 3STGA 4C6OA 4D2JA 4J3VA 2EO7A 2OLAA 1OFEA 4WJXA 3GNNA 2DT3A 3AIVA 4FEZA 2YL9A 2H9AA 1R3TA 2GVJA 2PF8A 4ADTA 3L21A 2ONEA 1XF0A 2HK1A 5CBBA 2E67A 3ONBA 4O0ZA 1H1NA 3B8UA 2CZFA 4MAVA 4GI6A 2XN0A 4ZENA 5JU6A 1OC6A 4Q8WA 2V30A 4GWEA 4UZSA 4QDWA 3QYQA 2FPYA 4M6PA 4MM1A 2WNQA 4MB1A 2GVYA 1KTNA 1XRSA 3QHOA 4RDZA 4E4FA 3CUFA 1K70A 2C0HA 2ZRUA 3URNA 3HMJG 1THFD 1UR3M 3WG6A 1KXHA 4O4WA 1SU5A 1JQVA 5ABGA 1ISVA 5HMDA 4KETA 5D2XA 5F2MA 4YXGA 1C9DA 3ZVHA 2QPXA 3AMGA 2QCLA 3C86A 1PAMA 4WR3A 4H6KA 3U48A 5CC5A 3G3DA 1EXBA 3VCCA 1QI2A 1L8NA 2B31A 2FZMA 4LCSA 5CBJA 3QGVA 4F9JA 4B3LA 1P5BA 1LLWA 3R89A 4S3CA 4MWAC 2GUUA 2I16A 6CGTA 4WSHA 2WNNA 1ZP3A 3R58A 5DCEA 1ITUA 1F8MA 3L9CA 1KM0A 3GXPA 2E6DA 1O60A 1E6NA 3Q37A 1FWAC 3NO5A 1RQHA 5DXXA 1VJSA 2O92A 3RLHA 5C9ZA 4QS6A 2Z2UA 1RCQA 3CQKA 1MEWA 2CWNA 4JX6A 3KM8A 3YPIA 3CIVA 4HNTA 1ZL1A 4MKVA 3N4EA 4E2BA 2P10A 2EPLX 1F73A 3H53A 1GYNA 4N9BA 4QR6A 1OYAA 2TSYA 2WCSA 3MW7A 2VEKA 1HJWA 4BQ3A 4JS3A 3U7VA 2WJEA 1RQBA 3R5EA 3GR8A 1PHWA 3NZPA 1TPC1 1FWEC 3PBMA 3VDCA 4NZ1A 3QEZA 4JHMA 1CXLA 2GJRA 2PDFA 4XSMA 3ZT7A 4M0XA 5G4WA 1JZ2A 4AISA 4HHLA 5CJ5A 3RLGA 4DQWA 2VELA 3W1NA 3RILA 3INPA 1BAGA 4I90A 4X60A 4GZIA 3GU2A 5F1VA 4CD4A 2YCLB 3T6CA 3LB0A 4D6IA 2H6RA 1E40A 1E1CB 2ZUNA 3CZGA 1N82A 2DQWA 3WD4A 3URAA 5C8BB 5FKYA 5J5DA 1DJZA 3OGVA 3LMYA 3LTYA 4CCCA 2TODA 3UJRA 4PTVA 2RJGA 1N8IA 4ZTXA 2JIEA 1Q6LA 3FGCA 2QIIA 3W07A 3NQCA 2GVLA 5F1UA 1V8EA 4XTDA 2V5DA 3MWCA 3GXMA 4C6MA 1HVXA 1QO2A 3WEMA 4MJ2A 2I5IA 2VX4A 1XCXA 5GQBA 2VT0A 3NZQA 2XVNA 5C7VA 5KETA 2GQAA 1Q7MA 2PDXA 4S3GA 3WL1A 4KIRA 4I6KA 3OGRA 3CTTA 1XDJA 3MU7A 1NH6A 2W27A 1W9BM 2W6RA 3F03K 3ALFA 2PTDA 1ITXA 4GZ7A 4GVGA 5DN1A 1OD8A 1EP2A 4Y9PA 4AZ5A 2CERA 4Z1YA 3TQ0A 2BOEX 1XSKA 2D69A 4ES4A 4XTIA 4Q32A 2J7GA 3U4FA 3PZNA 3ZWSA 2QPUA 4GY7A 2BXZA 1XHGA 2E28A 4TVDA 3W6YA 2G4JA 1V51A 4GGHA 3LHVA 3TYZA 2ZX9A 3U2OA 1DORA 3CB3A 6PTDA 1HZYA 4B5XA 1ESWA 3GW3A 3M0HA 4NNAA 1IHIA 1XI3A 1ZAHA 4BEUA 4DJDC 1ME9A 5JH2A 3WN6A 3OHMB 2INFA 3APGA 1YTDA 2BWGA 1H62A 2GQ8A 3C2OA 1I2PA 4TTGA 4B4HA 1XBZA 3BK0A 3LA4A 2FGLA 4NAEA 3AYVA 4U3CA 3VKCA 2NWRA 4LANA 1DE6A 4E5TA 2XIIA 3AMKA 3ABRA 5TBOA 2GZXA 4Q8NA 2ZUSA 3EXRA 3QW4B 4LAZA 2WSPA 4HA1A 3M1ZA 2PSNA 2WQDA 3NOYA 4LY4A 5AZ0A 1MW1A 1W9VA 2CHRA 1Q6FA 4CU6A 1UKTA 1W5OA 3C6CA 1JNDA 1CXFA 3DUGA 2Y6ZA 2ABAA 3DG6A 4JFUA 1JCTA 3W88A 3AI0A 1TA3A 3KFTA 3ITYA 4O1BA 2QYGA 3TCEA 2DT0A 4W7WA 4JN7A 1WZLA 5GVJA 1CNVA 1RSCA 2QVNA 3VIIA 2NXIA 3RX3A 2FTPA 5T8GA 1M7OA 2WSQA 3PG9A 4ATDA 3VCNA 2EPKX 4ERAA 1JEZA 2A2IA 5FAJA 3OTRA 3VD3A 5FSDC 1ELSA 1UP2A 4H9UA 4QJ4B 2HBXA 1V6UA 4L61A 4AD1A 1QOQA 3PSWA 3LSCA 1FDJA 3GHTA 5HBFA 1VHCA 3WJSA 2R14A 2X7WA 4J3ZA 3W81A 1ZY9A 4N2YA 4WUIA 4U2ZA 3TA6A 3G0SA 2BGNE 4QLJA 4PEKA 2FVLA 1XLJA 2JKPA 5LA0A 1GVYA 3CUIA 3WQ4A 3HPFA 4GIAA 1CGXA 1GOWA 1JPHA 3QZAA 3UZXA 3LPOA 4WF7A 4QDMA 3N6JA 2W4XA 4ZQMA 1EO5A 3CL7A 1YPIA 5BMXA 1XPGA 1EJSC 3E9AA 4NVTA 1H63A 4TUFA 4ENLA 3K4DA 3FJLA 3W1RA 1UPPA 3PZOA 4QP0A 4AYSA 3L65A 4WY0B 1IEWA 3TTQA 3CQIA 4ERGA 3AOFA 3VFLA 3QC0A 3NAVA 4UMAA 1V3JA 4MKNA 1W5PA 3ARPA 4HMEA 2J8TA 4IPLA 5LA2A 4BFAA 4RL3A 1EF3A 5JUVA 5A5WA 1QNSA 1A5LC 4RDYA 5CG7A 4O1DA 1E9YB 3GR7A 4GBUA 3ONCA 1XM3A 4DN1A 1E71M 3QFWA 2VZSA 1Q8JA 4H9VA 1TV7A 1VFUA 3VIHA 5ABTA 3PBUA 1FWTA 3ANYA 4CQDA 4EP8C 1JQXA 4MIMA 3QHNA 1UR4A 4XZIA 3M0YA 4XZWA 1NM9A 3PUEA 3VZZA 3U6WA 3S3GA 3CAQA 3FDKA 5L6UA 1FH7A 2QUMA 3A9IA 2V5KA 3KDNA 1MW3A 2F6UA 5A8OA 3HV8A 5HPOA 1EBGA 3HQNA 3NQ6A 4AIUA 1H11A 3ME3A 3WK3A 3TNOA 2H90A 2FDSA 3UNDA 4N9DA 2TPSA 1ZB5A 3H6OA 2VRQA 3AJXA 3I7QA 2AL1A 4RNHA 5E0CA 3WMSA 1KKOA 1KD0A 4IFKA 2XH0A 1E73M 4TO8A 1YBQA 1UWAA 2V38A 5HDRA 1FCUA 1JPKA 4L4OA 2XZ9A 1QCWA 3WH6A 7TAAA 1JD7A 4AZIA 4I7WA 4D6EA 4IG2B 1XYAA 1V0NA 3PFRA 3CHCA 5D37A 1UC5A 4GQBA 2ZXDA 3ZIZA 5DBUA 1TV2A 1JCLA 3N4FA 1BYCA 3IJ7A 1UIOA 3VGFA 2CBVA 5DQPA 4Q4OA 1R5YA 6REQB 1TVLA 5EU9A 1MW0A 4HNUA 1N7KA 3RFAA 5AC6A 1SGJA 1JULA 1ECEA 3G1YA 5I24A 2PC4A 1RPXA 3CHEA 2AGTA 5DT5A 4KBXA 3W2JA 1AL7A 1S5WA 2DVUA 3OYZA 4AY1A 5CBIA 4DXXA 3DN5A 3N1AA 3N18A 3LI1A 1FUYA 1ZJBA 1BPLB 5I0DA 3NPXA 4DVOA 3KAOA 4UTLA 3GW0A 4KQNA 2GUYA 2YBUA 2ACSA 3N34A 4PYSA 4LRTA 3EB4A 3TQKA 1YRRA 4HNVA 3GU9A 1I2NA 2PI6A 3TYBA 1E6QM 3M0XA 4GG9A 1Q2SA 9XIAA 4ZQPA 1HGWA 3OP2A 3NTYA 3IS4A 3EDFA 3NPWA 4A8IA 3VMPA 4WKFA 2EG6A 2W92A 1GONA 2W5FA 3QBUA 1H49A 4GIRA 1JCJA 3K30A 2E6AA 5CZJA 3S6OA 3HQOA 4L5ZA 3PPGA 1OCBA 4IPNB 4DYJA 2DSZA 2J79A 3N19B 5LNUA 1E4MM 1BYAA 5IDZA 1VRXA 4MY1A 1VCVA 3ABSA 2Y7EA 4JCLA 1S2CA 5AHNA 4Q7BA 2VD8A 1ENUA 3MS8A 3HU7A 2NQLA 2Z1WA 2V3GA 5D9MA 3AHZA 1B4KA 3RO6A 3FX4A 5GJPA 4FMVA 5A8GA 3BWWA 3UU0A 4L6DA 4UTJA 3DECA 3LNMA 1OVDA 4JHOA 9RUBA 3MSYA 3ZWTA 2J24A 4ZO7A 3HJZA 3KLLA 3M46A 2JQXA 4AUBA 3LHYA 3LLDA 3PSVA 2AMXA 4PMNA 3GTHA 1E70M 1F3EA 1UP3A 4JL1A 1K77A 4KFPA 3WDQA 4Z1AA 3J7HA 1DQWA 3HGJA 3DHPA 5AYYA 4XX6A 4UQDA 3PAJA 4JTSA 3VABA 2BHYA 1CZ1A 3GD6A 1LL7A 3ZXWA 5A6LA 1UH2A 3ICJA 5KZMA 3F4WA 2FQIA 2G0WA 3MY9A 1TUXA 4AVOA 3E74A 2O9PA 1T5AA 1AFSA 3N2CA 4AWUA 3LM3A 4IIFA 3CUGA 4ZCWA 1OX5A 2BX7A 4K8EA 3AUOA 3B03A 4P8XA 5KZEA 4NJKA 3VDGA 1VEMA 1W3NA 4S3EA 2NX3A 3WELA 1E5NA 1CT5A 1V93A 3AIEA 4MPQA 1TPDA 3KVMA 1X7FA 4IX2A 1A53A 3Q4DA 2UY5A 4LYQA 4J9JA 3M0LA 2X05A 1OZMA 3REQA 1LWIA 2D2GA 4A2SA 5JIWA 1KXTA 3W7KA 1A3HA 3ELFA 1U2YA 4R5EA 5A6KA 3CPUA 2NQHA 4DI9A 4WRHA 2HQAA 3HJEA 2QQ6A 4YTSA 1SVDA 2XVGA 1QW9A 3FHQA 5I2UA 3KS6A 4FNRA 3QXBA 3Q58A 1QI4A 4H9YA 4UMBA 3VDHA 3I6TA 1G9HA 1AD4A 2VGFA 3TROA 1F5ZA 1JXKA 1OGBA 2PDLA 3E0LA 4FOJA 3ARRA 1KM5A 3KW3A 4Y8EA 4AZGA 2Z1VA 1YMYA 3E2SA 3SUVA 3MSGA 5TF0A 4HTBA 3ENLA 1KFCA 2BFGA 4MJMA 5IFTA 2X1SA 1XIEA 4M29A 4RV8A 2ZIDA 1LYXA 1QUMA 3QMRA 2O0TA 3UCCA 4I3GA 3N6QA 4IL0A 1XS2A 4EAMA 4BY3A 4C6BA 4MMWA 5CZTA 4E8CA 5A6AA 4IM4A 3W74A 1XYLA 4KFOA 4JY9A 1BEUA 3VD9A 3PK7A 3JR2A 1XISA 5E0KA 2WB5A 1QI0A 4ILSA 3NXFA 3QY6A 4F79A 3KOYA 1K9TA 1AMKA 3B8WA 5H8MA 3VC5A 1LBLA 1PIGA 1MZHA 2YGYA 1AJZA 3WLOA 1L0PA 2A3LA 5LIYX 3L12A 4CGTA 4XKMA 2ZZ2A 3P84A 3WBYA 4LCRA 2QCCA 2Z6JA 1HKVA 4LVAA 1O5KA 4NX0A 1XD1A 3WZ0E 4W85A 3W1UA 3WNOA 4B5TA 3PG8A 4WLCA 1O12A 2ZOXA 3PULA 3ZM8A 3TP4A 4GMEA 3LCXA 3VUPA 1FKWA 2QJIA 3U57A 2XN1A 3GNOA 4J35A 4NT0A 3M0IA 3UG8A 3CZLA 4WGHA 3UWYA 2NV1A 3PVFA 3UWWA 3PY2A 3EBVA 3GG0A 1HP4A 2D20A 4CNSA 2VM8A 2D0FA 1NTHA 1TJ1A 2Z1KA 5BW6A 4GH1A 2RHGA 1IXOA 4TQTA 1GOIA 4L4PA 3KOZA 3BURA 4QXIA 4S3BA 3H4XA 1RJRA 3F2DA 4JNMA 1IXPA 4MADA 2Y5JA 3O15A 5D8ZA 2W66A 3BLIA 1EEXA 3H2CA 2CW6A 1ZALA 3WH9A 2BDQA 4NZFA 3OQEA 1BQCA 4F0RA 3QOMA 1HJQA 2J7CA 3WJYA 1ZUAX 2PWDA 4TXEA 3LQGA 3IV3A 3NGJA 3WD2A 1Q13A 4MFEA 3WUBA 4WCJA 1W3KA 2GQ9A 4S3DA 3P14A 2D0GA 2PLKA 5H6HA 3RJXA 3KTXA 1DWIM 2DJXA 2XGIA 3HO8A 1J12A 4QTGA 1A5BA 2VC9A 4O28A 1EJUC 4DEFA 5H8UA 1WXJA 3LM7A 2E8YA 4EKJA 4GJ1A 2VFIA 4NJIA 4RPQA 5I3HA 4JX5A 1LORA 5T9CE 2BOFX 2IS7A 4PR4A 1QO5A 1RY0A 1AA1B 4GYKA 4NAFB 5DRCA 1E0WA 2UBPC 5CPLA 2QV4A 4V1YA 1RP9A 1W1YA 1YNPA 3BAYA 2F61A 2AGKA 2BV9A 5EBUA 4EAYA 2AKMA 4BHYA 3TYAA 2HVNA 2E8ZA 1ITCA 4LGXA 4LRSA 3IJ9A 4IP4A 3QR0A 3C5QA 1VFTA 1YQ2A 4PMVA 4KCUA 3EOSA 5G5IA 1NOFA 2BNJA 1GNXA 5DELA 3N3MA 5D30A 3AHVA 2VOTA 3AIWA 1OQFA 4FF7A 4JQAA 4MUPA 2F2KA 2BP1A 1FH9A 1KCLA 1Q8AA 3A9BA 3KOFA 3N14A 3WBWA 3DBPA 4ZOBA 1OCQA 4CCEA 3DFHA 4ZE4A 2R82A 5HATA 1QI5A 1ZJAA 2YDAA 5BRBA 3UXDA 3D3FA 3VU2A 2IQTA 4PFMA 3RPMA 2VD9A 4GFSA 4IMAA 3NPVA 1M65A 3WL0A 4HSOA 1EC7A 2NQJA 3M5ZA 2VDGA 3ZO9A 3OZOA 1AJ0A 1G0CA 4LAKA 3ITTA 3PF3A 1E43A 1TPFA 1DWFM 1JF5A 5I3KA 2Q8XA 4YS1A 4OE7A 1R3VA 2OO6A 1HG3A 3SFWA 1VFSA 1B57A 1O6IA 5EA9A 1GZ1A 2OXNA 2QXWA 4NI8A 1RZMA 2Y8KA 4D9PA 5LA1A 3FKKA 1P48A 2C1GA 3NIYA 4XO6A 1U5HA 3DYPA 4W93A 3TH6A 3W01A 4DXVA 1GWJA 3W7EA 1I6NA 1R46A 3OIXA 3AXHA 1XP3A 2CLLA 1M04A 4ZEPA 4X9SA 2A21A 2XM1A 3WQEA 4LUTB 1CGVA 4O14A 5I3FA 1QHOA 1NSJA 2OWCA 4NP7A 5HWJA 1D7FA 3PTKA 2PGEA 4ZXOA 1C7TA 4HK5A 4QE4A 3NEHA 1KCZA 1TTPA 2J6XA 3CJPA 2ZX8A 3DBNA 1NU5A 3SY1A 4Y8FA 3VA8A 5D2WA 4MNJA 3OZYA 2HJPA 3PPHA 4FOKA 4O11A 1G01A 1ZU8A 2VX7A 4V33A 4L56A 2ZUUA 4ADSA 3G0UA 2RGMA 3W28A 1EB3A 2ZA3A 1BVNP 1KRBC 1S2UA 3B8TA 1GHRA 3BL3A 5ABFB 3W71A 1QR7A 4EPKA 2F6XA 3BG9A 1I8JA 1I2OA 1VBHA 5SWUA 2G41A 3KRBA 3F4CA 2HE5A 3CQ0A 2CLKA 2V0TA 5A94A 4KH2A 2E0PA 2WBKA 3CIXA 4IPPA 2IXVA 5JQ9A 1L6SA 4H9XA 2GWGA 5I06A 4KWSA 5MKGA 4LOCA 4POCA 3OB8A 3BW2A 1W2VA 4Y9OA 4J3TA 3W26A 1JYWA 3R79A 4LEFA 4NJJA 3MPGA 1DIDA 4LVDA 4X9YA 4YWSA 3QV7A 4DWSC 4QLKA 1QOXA 4OJYA 3GDMA 1C8VA 4XZ9A 1LROA 5A8QA 4IIEA 4R7WA 1FDZA 3RLVA 2WVVB 1GYLA 3ARVA 3T2QA 3WQWA 4MWAD 4PTMA 3FLUA 1UZ4A 4MWAA 4NRSA 3MUY1 3AISA 3AMCA 2D2OA 1JD9A 4PUWA 3PZTA 4E6MA 1R9XA 3CNYA 3R11A 3BTNA 1YADA 5CJNA 3RX4A 1N8WA 4AH7A 1OM0A 2VWSA 1MNSA 3VYLA 3QW3A 2ACRA 3POCA 1BWVA 4Q8MA 4CCZA 3KWSA 4KWUA 4Q3MA 2OGJA 3WJWA 4KT2A 1W91A 5BU6A 1XUZA 4GO9A 4G1KA 1E0VA 1BG4A 3M0JA 5DX7A 4H9TA 2D0HA 1LCOA 3R1ZA 1OG0A 1R87A 5G1TA 1OC7A 2A6NA 3IJ8A 4XAYA 1CW2A 2J88A 4MJZA 3SQLA 3P74A 4V15A 3LV5A 1Q3NA 4ORMA 4ZE5A 5HR6A 3D5HA 1AUSL 1ME8A 4WJEA 1DIEA 2D3LA 1R9YA 1K9DA 3G24A 3ITXA 3BW4A 1SO5A 3BMVA 1XFCA 3EWYA 1V0MA 3BV7A 2XH7A 1Q6QA 5IM51 3BLDA 5FI8A 4EF9A 4PB4A 4GX9A 2H9AB 4UNIA 3H7VA 2DQXA 2OX1A 4ZGYA 1G94A 1V3KA 4XVDA 5CPMA 1K02A 3WNLA 5FD0A 3V0SA 5G2WA 2ZRVA 4CD5A 3AS2A 3WEZA 3I7RA 2AMGA 3G77A 4HB7A 4JTCA 3TR2A 1W8SA 1TJ2A 1B9BA 4ZQOA 2FH8A 3VAVA 1TO3A 5K4XA 3KOWA 1FWWA 3NM1A 1KQZA 1ICPA 1NQKA 3A4WA 3O6YX 7XIMA 3RCMA 4MPKA 5CQ1A 5CPTA 3G1DA 3ZVHB 3P81A 5JBDA 2FZNA 1CXEA 3SR7A 1L2QA 4YVVA 3DCPA 3V18A 4H7CA 1UD6A 3GIQA 4NF7A 4P8WA 2FZDA 3NVTA 2GOUA 4LAOA 5AN7A 1WOBA 3LXBA 3KXQA 3VOFA 3QM3A 4TMBA 4HD5A 3OLDA 4PBFA 3EMZA 5CXPA 3ARUA 2VP8A 4Y9MA 4J1OA 3QV9A 4MB4A 1TV4A 2VFEA 3QKZA 1I1XA 2OT1A 4QQ3A 1H41A 1X98A 4LS0A 3EEZA 3RCNA 2FKPA 1FWJC 3QMTA 2A3EA 4IX0A 4DUOA 1GVSA 1WYIA 3BAXA 1IWAA 4YHGA 2ABBA 4R85A 4X3ZA 2OQYA 4RK8A 4DJDD 4TX9A 4CD6A 2Q02A 2GL5A 3OLIA 4KGLA 1US2A 3SDOA 2IKIA 3TTOA 4IFRA 1EO7A 2P0OA 5C2CA 3UWUA 4DZ5A 2OQHA 1HKKA 2J27A 3B8DA 2PWUA 4M1RA 2XSXA 4D6GA 1YE6A 4Q4QA 1EP1A 1R85A 2REQA 1R3RA 2C0AA 3PZ9A 2CCRA 3N2OA 3VVGA 2G3FA 1HFBA 3B0PA 2NQ9A 2R1PA 1POKA 5LXEA 2CETA 4C6QA 1ZGDA 1GOQA 4GBDA 4ZQNA 5DMMA 2V9DA 1LL4A 1TR1A 3I7SA 3AXIA 1Q63A 2PDKA 2HROA 1SFJA 2NXHA 2FHBA 5LKYA 2ZKMX 3L4UA 1IGWA 2Y7GA 5C54A 3ABXA 1KRMA 1WUFA 1WDSA 3LHZA 4FI4A 3JRKA 1Z89A 1MXGA 1V02A 1A0EA 1O5XA 1VYSX 4HT3A 1KBLA 3OG2A 5FSEC 4ZOAA 3SAZA 2PLCA 4BCEA 2C91A 3CS2A 1OFRA 3FGCB 3CWHA 1YPFA 4OHQA 1IQ8A 2B7PA 4TVUA 3CUXA 5CZ0A 1P0NA 3G1SA 3WK2A 1O66A 1DQUA 3GKAA 1UMYA 1XPYA 3P82A 4IJBA 1J4EA 3USZA 4H7ZA 3M6DA 1G4PA 2ZXQA 2BVWA 2E1WA 5CG0A 5BWAA 5FOOA 1R86A 4FO4A 4PZVA 4PMYA 2WSYA 3AXKA 3VI2A 3CEUA 1Q4WA 1VB9A 3OVPA 4YU1A 1PXGA 3B40A 5D09A 3MMWA 1NFGA 1J9YA 2JIWA 1OIFA 2JEQA 1OD0A 2VRKA 3WDIA 3CLMA 3BLOA 3UGRA 4H6EA 3W2MA 1DJQA 5HXMA 3N9SA 3L68A 2VCAA 1TTIA 4RE0A 2V2DA 2BTMA 2HPMA 1SO3A 2F7FA 2RGLA 3BCDA 3CAVA 1UD3A 4EXBA 3SADA 1XIDA 1FHVA 2HS8A 1XWYA 2E6FA 1LBMA 2QJNA 1NOWA 5HINA 5IBXC 3OBKA 5HNUA 1VHNA 3MVTA 3HV9A 5AHMA 5CJMA 3WQOA 1SW0A 2V3DA 3VIKA 4XUYA 3C3UA 1IR2A 1XC4A 1BVZA 3TMQA 1XDMA 1E9ZB 3EWCA 1SMAA 3IVSA 7REQB 2JF6A 2EBNA 3QHMA 4PEEA 4OOUA 1AW5A 1IT8A 3C4UA 3C0SA 4DJEA 1VBUA 4GACA 3LCFA 5I3JA 1HVQA 4KWVA 1X8FA 4NAEB 4NSBA 4XISA 4DBWA 4NKCA 3KBVA 2J47A 5D33A 3AHXA 4QBXA 3NM3A 4G7EA 4GIEA 4A6GA 5LGZA 4YTTA 2ZC8A 2VCBA 1F4AA 1UJQA 3MBFA 1TWWA 1MO0A 3W1QA 4QLLA 3EX4A 3S42A 1MSSA 5C2XA 1MZRA 3BVJA 4HCDA 1K6AA 4H04A 2DJLA 5KITA 1V03A 4LC8A 5EGRA 4UCFA 3MP5A 1TA3B 4LS2A 4GZJA 3N2MA 4WY0A 3UWZA 2OKOA 2F8QA 3NURA 2YYUA 1XYZA 4GC4A 1J0HA 1ZCCA 2W62A 2OOGA 3UA4A 1Y5WA 4IXHA 5CAHA 2FHFA 3AU6A 4G7FA 2DPEA 1FWBC 7CGTA 1AVAA 3QPZA 4Z17A 2EG7A 5K4ZA 4HNOA 5EKYA 3B9OA 1ZBVA 1TWZA 2BOGX 2Z28A 4O10A 3AHYA 4MOZA 5D04C 3TSBA 2CLMA 2FMOA 3E2RA 5BRQA 1A5SA 3C0LA 3SRDA 1IGSA 3F4NA 4GUHA 3W7QA 3H4GA 4PUNA 5IDIA 3IJQA 3R43A 4GYFA 4KPLA 4NI3A 1FHUA 2XIJA 3LCLA 4UTIA 3AZSA 4XAFA 1MUCA 2P1FA 2QCMA 3IRSA 4QX4A 3WDJA 5K9CA 4CQCA 2OU4A 2FH6A 4HOZA 4EWND 1GEQA 4E8GA 5E70A 1TYGA 3B0XA 2ZZ6A 4HA4A 1CGWA 1YTEA 2YPIA 1IZCA 4PBEA 4QNEA 1UG6A 3QKEA 4G6CA 3F5JA 4CQ8A 1VZWA 3FYPA 3OBEA 3EOUA 2NQ5A 3T78A 1NELA 3ARWA 3SRFA 5U4NA 2B7OA 1GZJA 3VNMA 4ZFMA 4Q4KA 3VZXA 5D2TA 4EWJA 3SURA 1H7XA 4GIYA 3O05A 1PIIA 3GNRA 3E0VA 1DL3A 4BJHA 1EXPA 1PVNA 1GORA 3LXCA 2QCDA 2YFOA 3OJGA 1Q6GA 3TR9A 1XBYA 3IAPA 3H7UA 1VAHA 3ZQ9A 1K8YA 2ZQ0A 3I3DA 2D24A 3CUJA 3DEQA 3EMCA 4ZSUA 3S1UA 5BYWA 2DIJA 1OK4A 1PL9A 3NNTA 1KFWA 4PSPA 3UWVA 4JKMA 3TVAA 1SFLA 4M6QA 2XHYA 3W2LA 1XDLA 3CB8A 3LOTA 1F8IA 1CX9A 1VPQA 3L23A 2EXOA 2QLYA 3A3XA 4H1ZA 4O4VA 3LGGA 3C3NA 1L9WA 3L4ZA 1ZCOA 4NQ1A 4W8LA 1D7KA 2ZFAA 3KHDA 4IGNA 3NQDA 4Z2IA 3KBNA 3P5ZA 4O57A 3ALGA 1ZJHA 5AOUA 5FEPA 1W32A 2A0NA 3CC1A 4XK2A 2EF9A 1EUNA 4O8RA 2C1IA 3RXZA 1HXJA 2PRLA 4D72A 4Q8QA 4IFKB 1G6CA 3AYSA 3EMQA 1KLZA 3TN6A 2CYGA 4QG6A 4A3UA 4FF5A 2R91A 1QNRA 5F7UA 3MWAA 1TG7A 2I5QA 1KFEA 3UBPC 3GIPA 2YR1A 3WQVA 1FWNA 3TOPA 4CVUA 1M01A 4FAMA 1G4SA 1W56A 2Y8UA 2WZIA 3LERA 4AD4A 4CU8A 1X1OA 4BWLC 3N2XA 4UFHA 5D9NA 1DKWA 4BF7A 2GK1A 1JAKA 1E4NA 3LGEA 3L2MA 4XAGA 4MG4A 1K03A 3A3WA 3R10A 3RNDA 4ICMA 1RK5A 4GOAA 1ZHAA 3MA8A 3P67A 2XUCA 2VDHA 4HPGA 3N04A 3VKAA 3W76A 1UH3A 4HCLA 3JU2A 1O5RA 1E6ZA 1UUMA 3MV01 4FLRA 2DIKA 4R88A 3F5LA 3BC9A 3CWOX 3B0UX 3HMCA 4DJFC 4C7GA 2CPUA 4N02A 2QIWA 2FLIA 3GXTA 3BXWA 2ZVIA 4IICA 1RQEA 3WF2A 4C1LA 3APYA 2PBOA 1M41A 2Y89A 2DUAA 2ISWA 4PUEA 3POHA 4BI7A 1OCNA 2BSLA 7PTDA 4HPXA 2YA1A 4KFNA 5A8NA 1QPKA 2PPGA 3H70A 3P80A 5C71A 1MYRA 1Q4NX 5EMUA 1H0IA 1H0GA 2EPNA 2QT3A 4UTWC 1VBGA 3QGKC 3IK2A 3QLDA 4QSFA 3CO8A 2Q71A 3BJSA 4NXSA 4WX2A 2X0SA 4Z2LA 1MRAA 4LNYA 1XLEA 3WO8A 3I10A 5D4YA 2ZX5A 3VDAA 1I75A 3UVAA 2YA2A 4EF8A 2QUUA 3FAXA 3N4AA 4N4PA 3NDYA 4JD4A 1BYDA 2QCGA 3WY1A 4LEQA 4UQEA 3WFAA 3WUFA 3A5VA 3WQ8A 1AODA 1JCYA 5HOSA 1OY0A 1REQA 2JE8A 2Y61A 3W37A 3DX5A 3THQA 2OMAA 4KWOA 2H3DA 1YTKA 1VFHA 1PIFA 4BF5A 1HL2A 2XDFA 1XLLA 3KWXA 3UY7A 1OINA 3TUUA 4Z1CA 1V6YA 1GPWA 5CSYA 4WKHA 1EJVC 2XH4A 1TZ7A 4XVEA 2XJ7A 1LRTA 3F1QA 4F0KA 4DAIA 3MUCA 3ATZA 2UV8G 3M07A 4FNSA 4JTEA 4CUCA 1JUKA 3CZ8A 3UGVA 4UR7A 3LBMA 3NXLA 3WH7A 3FYYA 2E9MA 5FF4A 4QS5A 2BHZA 2DP3A 4AIBA 3E6EA 3GNXA 1OHLA 1PV8A 1ADDA 1W9DM 1UP0A 2ZZ1A 5TQLA 1H4PA 1V6VA 3QR3A 4X0NA 1OFQA 3QPYA 2R94A 3MV11 1DQXA 1SUXA 1IXNA 5AHEA 1XYFA 4YLWA 3WK0A 4R9XA 4AEOA 2HXUA 1X6LA 2PA6A 3UP8A 4I9MA 1LG1A 4P5UA 2YX0A 1PX4A 1WNOA 1QASA 3REQB 4A21A 4AQLA 3JW7A 4DO4A 1RLCL 1OT1A 3LG3A 2VQTA 4WZHA 1GKPA 3B9AA 1QPNA 3GC4A 1WDPA 2P8CA 3FJ4A 1N8FA 4MDOA 4MB5A 1KTBA 5DXYA 3L2IA 3FS2A 1I2RA 4ZB5A 1J8VA 4AHOA 4D6DA 1W17A 1BRLA 5TNVA 2BY3A 3DU0A 4KIEA 2EG8A 1TPEA 1VYRA 3L4TA 3HFYA 5REQA 1AK5A 1LL6A 3BSHA 4R9OA 2QAFA 1ZAJA 3VIGA 3V0TA 1SJCA 3SRHA 1WXYA 2PDWA 1BVWA 5FJTA 2ISDA 4IIBA 3OQ8A 3UG3A 3V7PA 2WSRA 5H2ZA 3SCSA 3L0KA 1TQXA 1XLMA 4PC8A 1MEIA 2R6OA 2OR2A 2X1UA 3I68A 4B16A 1FA2A 1CLXA 3NG3A 4GO8A 4H8VA 4TVCA 2Y24A 2ZTKA 2O9OA 3U4AA 5F4SA 1JG9A 1Z9AA 4IQJA 2J77A 2B4GA 1ME7A 2YCJA 4PUUA 3WYZA 4D1JA 2X1TA 1CTNA 1HKWA 1PDYA 3R12A 1F4HA 3LLXA 3PPFA 3RHGA 1ZSXA 1X1NA 3RJYA 3WLLA 4GNVA 1A47A 1XL9A 2EKCA 3MKCA 4F40A 5L9FA 1WUEA 4XBSA 2QNEA 2V5JA 3QV6A 2X0YA 4Q33A 3A47A 4L1GA 4K37A 3ARXA 4HGXA 5KINA 1ML1A 3NYDA 4GKTA 3T55A 1OYBA 1QHZA 1W8GA 4L65A 1W9PA 2ZCGA 5FESA 1FHDA 4ZB2A 4W87A 1PTDA 4MVAA 5CPOA 2DY3A 3GXFA 2DZXA 3RO8A 2FVKA 1HP5A 2Z24A 4WXYA 4ZB0A 2XGZA 2WJDA 3AMLA 3SZ8A 1HTIA 2EPHA 2ZX7A 1DIKA 4ZVJA 1UPMB 4MGGA 3FHAA 3PJTA 2BY2A 5EMYA 5HWNA 1AL8A 4L80A 4OTKA 1UR0A 3UD6A 4A4AA 4HHHA 3EWWA 5AHFA 4AWEA 1F76A 5CZSA 1CGUA 1WE5A 5A6TC 1JGMA 2FTYA 4L4LA 3V16A 1EH9A 3VUSA 3HG5A 2G95A 4XZBA 1R3YA 2A3AA 2WHJA 4NAFA 1O68A 2YIHA 4LF1A 3SJ3A 1EP3A 4O19A 1WB0A 3U9IA 4D6FA 2PDPA 2HISA 2FB3A 3PTMA 4HA3A 3LDVA 1PCWA 2OEKA 2XYLA 1POJA 3IPWA 2QDEA 1L6YA 3IIOA 3EWXA 1T96A 3JUGA 3DI0A 1TREA 3RYSA 2Z26A 3OZMA 4JOMA 3S5ZA 1RVKA 1X1ZA 3TW7A 3V35A 4O18A 1XD0A 4C6IA 1UR1A 1TRDA 1ADSA 1H09A 3TNBA 4GUGA 2HPIA 3VMNA 2V69A 3BJTA 1YPXA 1EIBA 3ARSA 4B91A 1WPCA 1B3OA 1WCGA 5BCAA 9CGTA 4AVNA 3UPWA 1DPMA 3T7VA 4JX4A 3B8SA 4Q8OA 3TJLA 3K2GA 3W87A 3CL8A 2INZA 3D6NA 5LIKX 3T40A 1MFVA 3KTSA 4ZO8A 3CYVA 4KESA 1MUMA 4ZR8A 3KRUA 3SB0A 4LQ1A 3CPRA 5AC7A 3AQUA 1WQ5A 3NQBA 3F5KA 1J6PA 4M1BA 4AF0B 5DANA 2GOKA 4FP1A 1EZ2A 4I6VA 1JR1A 5E9XA 2Y1HA 3W29A 3IGUA 4IPJA 1AH3A 5DFAA 4D8ZA 3MUAA 3GRIA 3L4YA 4GI8A 4RE4A 3DKJA 3WQ6A 4CVWA 4LF2A 3H2OA 1JZ6A 4DI8A 1Z6KA 5DEZA 3W2KA 1PX3A 1UWTA 3DDMA 4IZGA 2O9TA 4JKLA 2VC5A 4DUWA 3FKRA 1NY1A 1GVRA 4YVPA 3R8GA 5ABHA 3PAOA 4JR5A 2QMKA 3GKFA 3EKZA 4NRRA 3NPUA 4RKAA 4PCSA 2VKZG 1H5VA 1BWLA 5IHRA 3MVIA 4OKDA 3E0FA 2VX5A 4Q4MA 5AYIA 5KMYA 2D1ZA 3QY7A 4K68A 1ZAIA 2GDVA 3TYDA 2WANA 1S1PA 3W70A 4LUTA 3CEPA 1RHCA 1TSIA 2PEVA 5LZLA 2VFFA 2P50A 4D6JA 1VLIA 1SZGA 4NX5A 3H21A 2EGZA 3EEGA 1IIGA 3TTEA 3G2GA 3FEQA 1AJ2A 4YTQA 2Y70A 4OQVA 4UFIA 3R13A 1TV8A 3WKZA 4GQQA 3RPTA 1VC4A 1O95A 3A13A 4QJ5B 4P8VA 4CD7A 3SCPA 4HYRA 4K36A 4S3AA 1LBFA 1DJYA 3L7RA 3VGBA 1IYXA 3N12A 3W1PA 1VQTA 4CNTA 4JQ4A 3T0DA 1OG6A 3KBSA 3G1AA 5C2GA 4DM1A 3TN3A 1JRCA 2ON3A 1S5NA 3KCJA 1TKKA 1RJPA 3C0QA 4LXFA 3MUZ1 1W3TA 1HGYA 3SUWA 4S2BA 2DT2A 1TVPA 3FEMA 5G1MA 3CZEA 3ITLA 5AYXA 3H2AA 1FWFC 1FY6A 3ES8A 2YFNA 3DFTA 4JIEA 5A2CA 2VGGA 3EXTA 4C6LA 3GVVA 3H24A 5K7JA 1XW8A 3HGRA 3TLQA 1VR6A 3DH7A 3E1F1 3XINA 3AS0A 2WVVA 1R2TA 1R7OA 4L64A 4JFWA 1LOQA 1UWUA 3TAOA 3BLPX 5FF3A 1WP6A 1E55A 3L5AA 4GVFA 3STPA 3NFUA 3PBYA 7TIMA 3CM4A 2CKSA 2NX1A 3DG7A 2VVNA 4C65A 1A5MC 4OIFA 4AZHA 2YYTA 4JTLA 8RUCA 4AW7A 2GDQA 3BUVA 3NYZA 4GQ0A 4HK7A 2QULA 5HQMA 4NL1A 2XFYA 3GNDA 3MO7A 1RCOB 1GG0A 5E5CA 3SUUA 4F9DA 4GE8A 3O0FA 3NDOA 3G1FA 4I9AA 5M2FX 3PNZA 3IIPA 1EIXA 2PDGA 1CPUA 1Q65A 3S9IA 3LHWA 1GOOA 1NWSA 1B31A 3NQ7A 5MKGB 2J66A 3VCRA 1Z7AA 1A5OC 3WLIA 1YEYA 4RV3A 3TK7A 3GG1A 3VGHA 3QSRA 3CWNA 4KGJA 1N2VA 3QLLA 3EA3A 1D8WA 2E3ZA 2IQ0A 3W82A 4NXKA 4LUSB 4A22A 3T81A 2XVLA 1TJPA 1JPDX 3KE0A 3GHUA 5E09A 4HSNA 1WX0A 2E9BA 1DJXA 4HN4A 1OSEA 3L4VA 3TJ4A 5AHLA 3ZS4A 2XM2A 3TTYA 4EOUA 1Z48A 3OU8A 3NZGA 3RDKA 5CLWA 4MWAB 4JIPA 2NSOA 1PE1A 3ZJKA 4TX8A 3WFZA 2HZGA 4LV9A 3KBWA 1G4EA 3U5UA 3K46A 1XGZA 4XAZA 1AQHA 1ZS2A 1BYBA 3E3HA 4J3XA 2OKTA 2CHNA 2FJKA 1B3XA 1TX0A 1W3LA 2GVGA 5D05A 4N6EA 3W02A 2VQUA 3BGAA 1H7RA 3BGGA 1R2RA 2NV9A 4XKYB 1VJZA 4GUIA 3GH4A 2VENA 3VE9A 4M56A 1S5TA 4GXWA 3PPCA 3ANVA 2OYKA 4JXCA 2WC7A 2OYLA 3NQGA 4C5YA 2R1MA 2VZOA 2GYIA 2OOFA 1WKYA 2RDXA 1WAWA 3BO9A 3EOLA 1S1RA 3IUDA 4JN8A 3MSDA 1UBSA 1EZWA 3QSTA 1GG1A 1W2PA 3MUXA 1J6OA 9XIMA 3TMLA 1XLHA 2BVDA 2WC3A 8TIMA 3OBAA 2GPTA 5AC4A 2PWFA 3RK8A 3NL5A 1Z41A 3LQLA 4ASTA 3W73A 1ONEA 3KHJA 2AAAA 1EUAA 4KEUA 4B2DD 2QF8A 4Z2HA 4B2DA 4F3HA 1Q6RA 2CC0A 5GPRA 3KCLA 2G37A 2QDGA 3I3BA 1OZQA 5CAKA 4MAZA 4ERIA 4F0MA 1HO4A 4ZSTA 3LRMA 3W1LA 3ARQA 1PUDA 5FCZA 2RJHA 3QPEA 1VKFA 3IARA 2DSVA 4CN4A 3QRHA 2VUNA 3RM8A 4PRTA 3A4JA 1GJUA 3QQ0A 3EPOA 4GKLA 3PZVA 3HTWA 2QHAA 1UWIA 1TMHA 4D1IA 4B3ZA 1K9EA 3DC8A 4BQ2A 3HBLA 4AEEA 2Q3OA 1TRIA 2ISSA 4JFTA 1EJXC 4MB3A 1JZ4A 4J3WA 1NFBA 1E72M 2PS2A 2FVMA 3MYOA 3OZPA 2ZYFA 3M5YA 1AH0A 5IXEA 2WYSA 3W0KA 3SN4A 3M41A 2PGWA 5A6SA 3KL3A 3FDGA 2OGYA 4NYUA 4AX6A 2VZUA 3DFNA 2BVTA 2C16A 4QM1A 4EVZA 3F2CA 3N11A 2W61A 4P2VA 1KBIA 2VDIA 5TAOA 4UR9A 5AC5A 2ESCA 2XFFA 3W84A 2UY2A 3SCNA 2E5CA 4GY0A 4B9YA 1P7TA 2J4GA 4XUGA 3CTLA 2VZTA 2VR2A 3KBMA 1VD6A 1L6FA 3S5NA 3IVUA 3MB9A 2VEMA 3VOIA 5D32A 3K1GA 1R0MA 2RFGA 4QISA 2Q01A 2J9YA 5A2AA 3WDHA 5GJMA 2OWWA 3GR4A 3W27A 4AVFA 1TE6A 1XQKA 4ZXLA 1K8CA 4LAMA 5GNXA 3LK6A 2YCEA 3WSUA 3FXGA 4O12A 4MTVA 4RNJA 1OIMA 1X38A 5FA5A 2REQB 3UWQA 4PCPA 5B80A 3OO2A 4NZ5A 1H51A 2JBMA 3VFCA 3KDOA 3OEXA 2CKRA 5DMNA 1NWRA 2ZZ4A 2VURA 2CLFA 1LQAA 4UZUA 2QCNA 3EDEA 4GCAA 4LX4A 2FDMA 1K8ZA 3URBA 1M6JA 3UJEA 1ZQ5A 2VTFA 2WPBA 2WCAA 4E0CA 2OELA 3AALA 5FJRA 1RD6A 4XSLA 3DERA 4C6NA 4AB4A 3VKBA 4M7SA 3DKLA 4Y6GA 2C71A 4QE5A 5FF2A 1LTDA 3CZJA 3OVRA 1J5TA 3WDRA 3UXAA 5AVNA 4AZ6A 1OF8A 7REQA 4KRZA 1CB7B 3OLGA 2NX9A 3W7NA 1H3GA 5AC8A 1NWUA 1I60A 3MHGA 3U5YA 3GDBA 4J2PA 4XB3A 3MT1A 1ONWA 5HQEA 3C8NA 4V28A 2ALRA 5G4EA 4UUIA 4AX7A 4H2HA 2RDTA 4MNLA 2PWHA 1F3TA 1MW2A 2OZTA 1E51A 3UPMA 2BLEA 1JJKA 2VHLA 1DJNA 2IQDA 1JYXA 3MBDA 2UY3A 3NZRA 3PB2A 1B4EA 4IXXA 4XO7A 2E68A 2ZC1A 2F84A 5BMWA 2ZUTA 4PTDA 1KM3A 4HVXA 4BZYA 1NFPA 8XIMA 4CQBA 3T2OA 1LWHA 1E9IA 3EGJA 5AHIA 2QKFA 1QNPA 4U31A 3GVGA 3E5PA 5BRPA 1FWDC 3W1MA 4S39A 5F2LA 5C6MA 1J0KA 1G7VA 1ITQA 3RUBL 1VBRA 1WZAA 1E6XM 1A0CA 3GXNA 2ZXBA 1BTCA 1S46A 1FH8A 4F0LA 2OVLA 3SCOA 1KWGA 5CCZA 4GPNA 2WW5A 4HU0A 1A4MA 5DO8A 4XD6A 3CT2A 4IL2A 4C60A 3OVGA 1D9EA 4AC7C 2ZICA 1VFOA 3OOQA 1MFUA 1VH7A 4N9CA 4YJ5A 3OVQA 3W7CA 3TXZA 2EAWA 1W0MA 3NQAA 2XN2A 4RJEA 3T0CA 1R7AA 3B3DA 3VM7A 4PTNA 1SFTA 4LUYA 2GGHA 1SO4A 4LV4A 3S1XA 4G7EB 2GQ3A 2X2GA 1NF0A 2ALDA 1IWBA 5DMYA 3PZMA 4IMDA 2BHUA 3TE9A 4REQA 2QMJA 4RDVA 1EDQA 3TSDA 4ICNA 2Y4SA 3QF0A 4WVXA 2E4TA 4UBPC 4Q7NA 1LP6A 4F2TA 1EJWC 4WY0F 4Y2WA 2VFHA 4C1KA 4Z42C 4YMZA 4TTUA 4JGDA 3SCVA 3P6LA 2V82A 4JQ1A 1JDDA 1L8PA 3GVWA 3VOHA 1XLGA 4D8LA 1XLKA 4EXQA 3THAA 4BF9A 4FX7A 4QFUA 1D8CA 2PWEA 2PD5A 1AH4A 1W1PA 5DRIA 4AWTA 2H8XA 4QDPA 1OT2A 3M9YA 4BK9A 3SO7A 4YCOA 1B2YA 2NUXA 2WWDA 3PS7A 3WMLA 4GUJA 4BWLA 1VBJA 1Q7ZA 4LBRA 3GHRA 4QGCA 1ZBKA 4C91A 3O6CA 2R8WA 4B5UA 4JDBA 3HGOA 5LGXA 4GVIA 2DZTA 3HGSA 2BY1A 4U5KA 2ZA1A 3RRXA 4NZ3A 5T26A 1QBBA 2D73A 3V75A 3GTNA 1PZ0A 1LM1A 3T0BA 3TLLA 3TOYA 4CNOA 1H50A 1C93A 4QG8A 4FA3A 2PODA 4A3HA 3CT7A 4US6A 2A3HA 2E5BA 2ZE3A 5M1TA 2BMBA 3NL3A 3NQ8A 3EDDA 3VOJA 4L4MA 2PURA 3VIPA 4KEMA 3W38A 1A4LA 1J79A 1FRBA 3GVQA 1BLIA 5J5RA 4IMEA 4W5UA 1EA0A 2D2HA 5MF5A 2P88A 3EWDA 1QK0A 4J28A 1D3CA 3R4IA 2WNWA 1WKEA 2R1LA 1C3FA 3N2BA 1F3XA 3LENA 3G5EA 1UMLA 2QCDB 3F4VA 3W7PA 1W1B1 2WVUA 3PJUA 1EDTA 3K8MA 2Z25A 1RP8A 2X41A 2NUWA 2WZEA 3S2CA 4NU7A 1B9ZA 3AXXA 4H4IA 1ECQA 2WKLA 4HSHA 5C9WA 4CD8A 3T09A 3MI6A 4NJGA 1XIIA 3WNPA 5M03A 3TU9A 4UTWA 4GYPA 1HKIA 2ZUWA 1O4UA 3TQVA 5A1AA 1DJIA 4B5SA 4MLRA 2FGBA 2W9MA 3A21A 3S5SA 1VIWA 2DSUA 1DIOA 1KFBA 2OLHA 2PP1A 1V7AA 1V08A 3ITCA 2OEMA 4AC1X 5GJNA 1VEPA 2WMFA 2WLZA 4K1GA 1OX4A 2OX4A 5CPNA 4AWSA 1RVGA 3FOKA 4ML9A 3LS9A 2NVAA 2Y5SA 3T9PA 2DH3A 2PZNA 2V2HA 2X40A 4TMCA 2WWCA 3I4EA 1A50A 6ENLA 4OUIA 4AFYA 2E9LA 1GOKA 3VNYA 8A3HA 1TPUA 3BG5A 1LDCA 5XIAA 1US3A 3VNLA 3ABOA 3A5FA 1J01A 1JYNA 2BVYA 2V81A 5I09A 2JKEA 4GJIA 3GUGA 1DHKA 3GFYA 1FFQA 2A6LA 4DBEA 1TMQA 1WDQA 2QGYA 3P62A 1PTGA 4NILA 1HL9A 2GK1B 4UTHA 1IR1A 2A7PA 3GIYA 1LF1A 2LLEA 4B4FA 2PCQA 2QVHA 4U4MA 1OFOA 1Y65A 3LCHA 3L4XA 5HJYA 3IRDA 1SW3A 4UWMA 4AY7A 2IPJA 2BZNA 1LOLA 2IPGA 1W3HA 3ZFHA 1SYTA 4TV6A 2GGEA 1R3WA 1WKDA 4PBGA 1UKQA 4I8DA 1NP2A 4H83A 4AU0A 3THCA 5E6ZA 4JTTA 2V8ZA 3O9NA 4GQGA 1T0OA 1AMYA 1SO6A 3R25A 4CKQA 1KM2A 5AZ1A 2VR4A 1VCFA 1YXDA 1QVBA 3W86A 1MDLA 5AYZA 4O16A 2CITA 3N17A 1Q2RA 1J2WA 3TN4A 2Z6IA 3C2VA 3VXGA 4BQ5A 5M17A 1EYEA 3R8HA 3GTXA 3IANA 3CV6A 1XINA 2TMDA 3HZ3A 2TRSA 1V3IA 2PTXA 4XIAA 7ENLA 1UBPC 1WKFA 3UERA 4FOUA 4U3AA 4KCWA 2QZRA 4RNFA 4O0QA 4H3DA 3S6DA 4LNCA 2FPVA 3W6MA 3L2LA 4IOTA 1JRBA 1RA0A 4LT9A 1YXYA 3TIMA 3JZUA 1ZPTA 4I7VA 2P3EA 4R27A 1JPMA 1KV8A 4C6JA 1HN1A 2OODA 4C90A 5AB3A 4N0RA 4DLMA 3WQCA 4L7ZA 5A8PA 3CV7A 1X6NA 3HQPA 2QS8A 2WJZA 2WQPA 3WK1A 1UD8A 2FZ8A 1BXCA 3G1XA 5F2GA 1A5UA 2ZX6A 3M4HA 2OTDA 4B5WA 1JCNA 1REQB 5I78A 1QJWA 1UC4A 4B92A 3L67A 2O9RA 5I23A 3AU2A 3I4KA 1T6MA 1J96A 4AXNA 1K8XA 4G56A 2AQOA 3WLSA 3TKFA 3TZFA 1J0JA 4MZYA 1TPVA 4GX8A 5C9XA 1ZNNA 5BOEA 2Z7KA 4FXSA 4M8UA 4HBKA 2CBIA 1KFLA 3B06A 1W1ZA 1XSJA 4QCFA 1T41A 4WGXA 2Z27A 3D3AA 2WC4A 5HK4A 3AJ7A 3V36A 3KVKA 4PMJA 2NXGA 4GK8A 4W89A 1ODZA 2EQDA 1W1VA 3BAIA 4Q8UA 1U33A 1OCJA 1W5NA 3CPGA 2B0MA 1EX1A 5MHBA 3LHUA 3UZZA 3UESA 2VC6A 5BNKA 4JTUA 2QJGA 3JZEA 3PN8A 3S5OA 3N73A 1J2BA 1HJSA 1XIJA 1TZZA 1EHNA 3GG8A 2DSKA 1GK8A 3CUZA 3NUKA 3FA5A 1UROA 3N25A 2VEGA 5BROA 3IGHX 2PMQA 3PANA 2QUVA 2C3ZA 4RX0A 5EYWA 1C29A 2YL5A 3SN1A 2C19A 4IIDA 5C5YA 1U1UA 4E8DA 3AC0A 4HHPA 3V3WA 4WD0A 3STEA 3BARA 1YDNA 1UD5A 4P7LA 1QNOA 1NOUA 3WFLA 2PD9A 1L6WA 4LTSA 2VC7A 3WBEA 5I6SA 2ZWZA 1XQLA 4ZO9A 3B9NA 4C1NB 2Z2AA 1JI1A 3ZR5A 1BRLB 2PDNA 4PB3A 5H1WA 1XYBA 3DENA 4MLJA 1GKRA 2GSEA 1GVFA 5REQB 4WQ6A 2XIOA 4FPSA 3MMTA 4ZQRA 2RH9A 5D8WA 3P2VA 3TW9A 4BQ4A 1HL8A 5FEZA 1S5VA 1LOSA 1D2KA 5EMKA 4O1AA 4FB7A 1CYGA 5FJJA 5HMEA 1SSDA 2R24A 1B0IA 1ISWA 3IAQA 4FNUA 1UD4A 4H19A 1PCKA 1XGDA 2XISA 4HYWA 1V5XA 1UKPA 5I3DA 3BGJA 3S0CA 4BA0A 2D23A 4F0SA 3SGGA 2W91A 1MDRA 3EWUA 3HG3A 1HF6A 3W7DA 1B54A 4IQLA 3LXAA 4HZ7A 3BW3A 1M68A 3UZJA 4E3TA 3UG4A 4U33A 2BBFA 1E6RA 3LTPA 4JEQA 3ID7A 5DY2A 2Y2WA 3A64A 1HKJA 4AD0A 4KCVA 3THUA 4JTFA 1U5JA 4NG3A 1D3HA 3UXLA 2CU0A 4KRUA 3WF4A 2WZHA 4PUDA 3QN3A 1A3WA 4Z2KA 2NLYA 5AKQA 4LJ3A 4X2PA 3TTSA 3VKJA 2NVCA 2QDDA 3A3HA 3MJYA 3T44A 4AHQA 3WCZA 3LRLA 3PC0A 1EGMA 5BXRA 1CENA 1KRCC 4RXFA 3B8IA 4AF0A 3NO1A 2J62A 1VEOA 2XWEA 3W1XA 4H8UA 3K8KA 3R0KA 2VMFA 4QNWA 5FL1A 3CL6A 1C91A 2DV0A 2PFHA 2YCKX 6A3HA 3KRZA 2YOCA 2AL2B 2JFEX 2GUBA 4ZOCA 4S3JA 2C15A 3NQFA 4RE3A 1O1HA 4WOQA 1XKJA 4FXJA 3GYEA 1E0UA 3VGGA 3EZ4A 2X16A 3S6TA 4JICA 5I7GA 2V5CA 4JTAA 2QGHA 2D22A 1XC6A 2FGZA 2Y8VA 1UH4A 1Q6EA 4JYFA 1T99A 3CK5A 3P8JA 4LBUA 4IQDA 4F2BA 4OBRA 3H12A 1SJAA 1FWSA 1EGVA 2XZ7A 3QMSA 4BI5A 1OFPA 2HMCA 4X63A 4XZNX 3T2PA 1RD5A 1XSIA 3Q67A 5JMUA 3GU1A 4JTIA 1KBJA 1B3VA 2WZMA 3WQ5A 4RW5A 4S3FA 1YNQA 3PFMA 2ISVA 2JKAA 2YXOA 3A12A 4P8UA 1JL8A 4IUOA 3LPFA 1XLBA 4WSJA 2ZVRA 5CGMA 5EMJA 3LV6A 2C6QA 4H41A 2ACQA 3R94A 1A5NC 3VIMA 2C13A 2OYMA 1Z32X 4PSRA 6ALDA 5IHSA 1M7JA 1NJJA 4Q22A 3WEOA 1WZKA 2BGQA 1EA9C 3Q2DA 3TW6A 3IIVA 3V5OA 5CGTA 2R1KA 1J11A 2B81A 2WVTA 3VGDA 4PMQA 1VFMA 4EIVA 4O15A 4DNHA 4UOZA 3I3EA 2OG9A 4YYCA 2WLYA 3MJMA 3R0DA 5BXTA 2EEXA 3ES7A 1QAPA 3M5VA 5D9OA 3P8IA 2ZTJA 1F07A 2P76A 3LZ5A 3L0NA 4Q4RA 3C2RA 1QHPA 3SECA 4GYJA 4RZBA 4XZLX 4XV0A 4NASA 1Q6OA 3T05A 5HULA 2OSWA 3EB3A 2PTZA 1XJBA 4L1WA 4UQAA 1QPRA 3P0XA 1NDWA 1DXIA 1PX8A 1EYWA 1R3SA 5CKSA 2Z29A 4DWSB 3DHDA 3GC2A 3MANA 3C0JA 4MWAE 3WENA 1JDAA 2QF7A 2PGFA 1UZ1A 3G22A 4J27A 2RDUA 3BLKA 2INEA 4RW3A 5XIMA 5FF7A 4DXKA