3VOGA

Catalytic domain of the cellobiohydrolase, cccel6a, from coprinopsis cinerea
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
362
structure length
362
Chain Sequence
VPSTGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiohydrolase
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
total genus 137
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3vogA00
1UOZA 1HGYA 3RU8X 2BOGX 1OC7A 4B4HA 1OC6A 1UP2A 1QJWA 1OCNA 4I5UA 3RPTA 1UP3A 2BVWA 2BOFX 1HGWA 4AX7A 2BODX 1CB2A 1GZ1A 1DYSA 4I5RA 3ABXA 1OCJA 4AX6A 3VOFA 4AVOA 1OC5A 1OCBA 3A9BA 1UP0A 3VOIA 3VOJA 1TMLA 4AU0A 1QK2A 1BVWA 4AVNA 3VOHA 1QK0A 4A05A 3VOGA 2BOEX 3A64A 4B4FA
chains in the Genus database with same CATH superfamily
2VRQA 4LEFA 4AG0A 4Z1BA 5T9CE 3CL6A 3GZAA 4YJ5A 2OKTA 3V5CA 2GSHA 2PB1A 4J3WA 2XIQA 3FEQA 4PMJA 3SI9A 2WB5A 3LERA 1UD8A 2J74A 3S1WA 1UD2A 4CD4A 4WLCA 1AODA 4HOXA 1W1ZA 4IQJA 2IW0A 3U48A 3FAXA 3MYOA 1WDWA 4E3TA 5HK4A 3WLTA 3WDHA 4QR6A 2QF7A 1ICSA 3L2IA 3LG3A 5A6LA 4QP0A 3NPWA 2GGEA 4GNVA 1YDVA 3DFSA 4ECLA 2ZA3A 4AIEA 1FH7A 3P67A 2H6RA 1MNSA 3OLGA 4C65A 5A6KA 2EPKX 4QS6A 1TJPA 4GKTA 5A6MA 5DO8A 2OGJA 4IJRA 3AS1A 8A3HA 4AD1A 4OBSA 2HVOA 3GDKA 3LBCA 3OBKA 3PVFA 1M04A 1ONRA 1QHOA 2XIMA 4ZXOA 3FDKA 2YL8A 3CNYA 5A2AA 1YX1A 3ARUA 3UPWA 3FA3A 2F7FA 3BQ5A 3XISA 3ZWTA 1PZ3A 1FWIC 3VDBA 2FZNA 1RPKA 3RYSA 1Q66A 5I00A 4IMDA 1DTNA 1RUSA 5HBFA 3UWQA 5D32A 3EWYA 2FZBA 3E12A 2VCBA 2RJGA 4AAJA 1ISXA 1R3TA 1ZZMA 3ITYA 3HPZA 4J9JA 3S2LA 4K1GA 3CUXA 3PFRA 1RHCA 4GVIA 1DXEA 3QLDA 4OHQA 2HS6A 3TSMA 3P2VA 1ZNNA 3CQ0A 3W7IA 1Z69A 3R10A 4GFSA 4HSNA 5I77A 2EAWA 4GZIA 1A5NC 4UB9A 4L9ZA 3HV9A 4IL0A 1KTNA 2JIEA 1P0KA 2HTMA 2NZLA 3T0TA 1GVYA 4FALA 2FFCA 1LQ0A 4M6PA 4JN8A 1QCWA 2FZ8A 1EGMA 5I3HA 3UEQA 1NARA 1VBRA 1X98A 3N18A 1R0MA 5A6TC 3NAVA 4QE1A 5LKYA 3BL3A 4O14A 3SCNA 1FXPA 2PLCA 3WFZA 1L6YA 2Y2WA 3VOJA 3PTMA 4H8NA 5DT7A 1V6XA 3O6CA 2ONEA 1XIDA 1NDVA 3IARA 1NWRA 3PUEA 3PPHA 4XZIA 2GZXA 2PEVA 5AYZA 4E3VA 3CHFA 3D47A 4ZO6A 5AOUA 2V5DA 2Y8UA 3VGDA 1OGBA 1V08A 3GW0A 1CDGA 1F5ZA 2G3NA 2X7WA 1X1OA 3ID7A 1PDZA 4A29A 3P74A 3NQEA 4DJDD 4ZB0A 1S2CA 3VCCA 3V16A 3UQNA 2Q01A 2ON3A 4O52A 2XDFA 4LUSA 5G4WA 3SJ3A 3M16A 3PG8A 3U2CA 4GNKB 1UWQA 1KCXA 4OT7A 4ROQA 3XINA 4EVZA 4KWVA 2ZUWA 1VFFA 4CU8A 1R86A 2DIEA 2R91A 4UTTA 1MUCA 3PF3A 4EXAA 3WQVA 3W71A 3MVTA 2ALDA 3CL7A 1S5WA 1G9HA 4DWSA 4OBTA 2J6XA 4QISA 3BSHA 4BS0A 1BHGA 2CPUA 3TCEA 1HVXA 4JDYA 3ZYZA 3OQEA 4HMCA 2D2JA 1BLIA 3WUBA 1E72M 4J1OA 4NX5A 2G41A 2EG6A 2WHLA 4D6EA 1OX4A 1ZB5A 3OIHA 4NHVA 4I6KA 3CS2A 1YXYA 2Y62A 3TR2A 1O68A 2Z27A 1K9DA 4O10A 5G4HC 3WQ8A 2HK0A 3R94A 2Z1BA 1K6AA 4EOUA 1SZRA 3ZLFA 3OZYA 4U3AA 4EIVA 2E7FA 1Q8JA 3TXZA 1Q6OA 5D33A 4C6DA 3M7WA 1QUMA 1FBAA 4BY3A 2YCKX 3W75A 3E2SA 1UA3A 3R0UA 3WNKA 3QY7A 5I78A 1GHRA 3B3DA 5FA5A 2XISA 4FI4A 1L6GA 4WOZA 2WC7A 2XFRA 3B0UX 3URBA 2DIJA 4B5WA 1J0YA 1P6BA 2X7VA 4NYYA 4JTIA 1SW0A 3ARVA 3PAJA 1OQFA 4LBSA 5E5CA 3GU2A 3M0JA 2OQLA 1UR9A 1CGTA 1QK2A 5LYRA 3A3WA 5TF0A 3QQ1A 2C1IA 4HA4A 1OFPA 3KBWA 2ANUA 4XAYA 3YPIA 3IGSA 5LA1A 4DBWA 4UMBA 3W1XA 1N82A 2Q3RA 3W76A 3TEVA 2PTWA 2YL5A 2MANA 4MDOA 5MKGA 1TPFA 4JAWA 1FFRA 5ENLA 3W6LA 4C7DA 1AJ2A 1BAGA 1ZJBA 5D03A 5A6BD 5FIPA 3HPFA 3D46A 2YFOA 1UZHA 4PSRA 2G3MA 4UTWC 4FF7A 3ARTA 3MUY1 1HGYA 1ZP3A 2ABBA 3M0YA 3C0SA 5H8PA 1WDDA 1XG4A 4J28A 3BV7A 3STGA 1XYMA 3LCHA 2BY1A 3EWUA 3F2BA 4QQ3A 2XHYA 4R7WA 5IHSA 3W7CA 4H6QA 2XN2A 3K2GA 2NLYA 3TFCA 4LCQA 1SPQA 1ODUA 1BFNA 2QVNA 5I0DA 4M7SA 1FDYA 4XQ6A 5FL0A 1YE4A 4LNYA 2XYLA 4KETA 3LA4A 1UIOA 4JX6A 3WY1A 4UTHA 3QSRA 1OJXA 4NASA 3W81A 2CWNA 3TNOA 4L1GA 4QITA 4ZZ9A 4IISA 2GPTA 4LBRA 1WV2A 1IHIA 4WXZA 1KFJA 3U0HA 2FTPA 2XSAA 4UTWA 1JCYA 3UCCA 1AL8A 1NFPA 2JE8A 4EF8A 1C29A 1FA2A 4PMQA 4R3UA 2PDMA 4KGLA 2KAUC 2XGIA 2XVNA 1RXOB 1FWGC 3SN0A 3TJLA 1WQ5A 5JU6A 3VKDA 2X05A 1DL3A 3S6TA 2J47A 3WK3A 4S38A 1GOMA 4X2RA 3NDYA 4OUEA 3EEZA 3TN4A 3ZXWA 3VNLA 4H8VA 1H4PA 1LRTA 4PCNA 3R7MA 2W27A 3WNLA 2RHGA 3BW3A 1LT7A 2YLLA 4FEZA 3DXIA 2ZUSA 2WNNA 2Y1HA 3NQMA 1DORA 2A0NA 3HURA 4TV6A 5GJNA 4H2HA 2B7OA 1K8ZA 1UKQA 3A6OA 2CLMA 4IF2A 4X3ZA 2QS8A 4PCSA 1JL8A 1M3UA 2VX6A 4PR4A 1AW5A 3AC0A 4ZQRA 1F61A 3ARPA 1TJ1A 2V67A 4FMVA 1C3FA 1K70A 4IX0A 4ZXLA 3QZ6A 5A6JA 1AW1A 4Q8PA 4LT9A 5E0CA 5T8GA 3JR2A 1PHWA 2R1PA 1IT8A 1Z42A 4GX9A 3EZ4A 3Q58A 2JEQA 3ALFA 4LYQA 2VEFA 3WQEA 3GH4A 3NPVA 2XVKA 3DYPA 3LY0A 4HZ7A 2Z1SA 3SAZA 1A5CA 1OYAA 1DXIA 4H3DA 2I9EA 2WBGA 3WH9A 1X96A 4R85A 3H26A 4RE3A 1WP6A 2QPXA 4IP5A 1IIGA 3RX2A 3NOEA 3GHTA 3QM3A 1SYTA 1AJZA 1KM2A 1X38A 4LYPA 3CM4A 5H8MA 1RQEA 1FKXA 1VPYA 3W2UA 4JTDA 3EPMA 1NP0A 4IIGA 2QW5A 2XWEA 2X1TA 4IXXA 1LROA 2X0HA 1XD0A 3DFPA 2PDXA 1XRSA 1GEQA 1DJIA 1X8CA 4W5ZA 4DQWA 1XKYA 2QJMA 3TCSA 1P5BA 4M7TA 2DUXA 1SFTA 1TV4A 2AGKA 2D0FA 1V77A 1JGIA 1UCWA 1BYDA 1ZY9A 3ORWA 3SCWA 4IFKB 4MFDA 4OZOA 2IKJA 1EEXA 2WJZA 1Z6KA 3DBNA 1CYGA 1NF0A 1E56A 4LXFA 3N2OA 3H2NA 3AISA 4O4VA 3F2CA 3NQ2A 3JW7A 4RV3A 1LZOA 4ZQNA 3I3BA 1FWJC 3BW2A 1H11A 3V7PA 2PDHA 3ZJ8A 2JKPA 4XSLA 4P8UA 1JD9A 3QF0A 1S5VA 4XK2A 3UERA 2HSAA 2P0IA 5BU6A 4TMBA 2P0OA 4JTHA 3AJ7A 3B0XA 3B8DA 1B1YA 2PDBA 2Z6IA 3P0WA 3FKRA 1Q45A 1REQB 5RUBA 1HJQA 4J5NA 4H7VA 1KFLA 4XX6A 3W7GA 4I7WA 3DIPA 4OECA 5F2LA 1GVFA 4P8XA 3TYEA 3FA4A 1PKYA 3N13A 3T2OA 3S2NA 1LLWA 3D5HA 3KFTA 1QMLA 3KLKA 1UWRA 3BGJA 2QCEA 3S6DA 3EDKA 2IPJA 3GC5A 1I75A 2VOTA 4O12A 2WJEA 1LTDA 3KTCA 4O1EA 4AC7C 1TV3A 1G7UA 3ITOA 5A3HA 5AVNA 3RIKA 1O1ZA 4MG4A 5CPSA 2WLYA 4JXCA 1IWBA 1A49A 3A4AA 2ABAA 3MCOA 1ZGDA 3CAKA 5BXRA 3UZ5A 4LYKA 2XN1A 4FOJA 2CZ5A 5GJMA 4C6EA 4AMCA 1MW3A 3KOFA 1T8QA 3TSBA 3C61A 3GR4A 3KS5A 2INFA 4IMCA 1CWYA 5D05A 1Q85A 2NV9A 2IS7A 1KFCA 2OJPA 3CZGA 2B4GA 1K9EA 2ZICA 4JTCA 4N2YA 5LIWX 4IMGA 2ZZ3A 3M46A 4WJXA 1JCTA 3DHFA 3A5FA 3RITA 2D2GA 4B2DA 1KKRA 1WKDA 5CPTA 2ZZ7A 3JRKA 1IIHA 1HF6A 1VD6A 2VQTA 4AISA 5G1MA 1H09A 2PE4A 3CUHA 2ZVRA 2GVGA 4QEHA 3N29A 4GYPC 1NDYA 4CCDA 3MC5A 4AIOA 9RUBA 2XZ9A 4U3CA 2C1HA 3BGGA 2WKJA 3ANYA 2ZA2A 4LY4A 5A8NA 1V6YA 3V0TA 2DW7A 4WIWA 2DVUA 5C9WA 4GXMA 2G4FA 1GVRA 2X16A 3AO0A 3LENA 5J8LA 2DSZA 2GJXA 2E9LA 2C1GA 4OKDA 1PX4A 4S3JA 1WNOA 4UFLA 1OFBA 4IIEA 3MA8A 3MUZ1 2WANA 2WZHA 3QZEA 3GVGA 5I6SA 2VWSA 5KINA 1MRQA 2WSPA 3NDOA 1WPCA 4Q4PA 1XRFA 5AHFA 5C6MA 2ZRYA 4A3HA 2OVLA 3OBAA 1S2VA 3G1VA 1S38A 4RUBA 2WZMA 3MV01 2POTA 2ZZ6A 1QHPA 2D3LA 3VKAA 2GLKA 4KKXA 3D3AA 4CUCA 4YTQA 3AIRA 3B97A 4ZR8A 2V5JA 3GAKA 4FR6A 4ZFCA 2FB3A 1O94A 1ZCCA 1GKQA 2NWRA 4PCTA 1LLZA 3RO6A 3W7NA 3CLMA 3V5FA 3F4DA 4IGNA 1W9XA 2P88A 3PK7A 3KX6A 3C2VA 4AVOA 4NQ1A 2RAGA 4UTMA 4M81A 1E43A 2DZWA 4DJED 1PCWA 5FJUA 1CX9A 3B9NA 4B16A 3IRSA 5C7HA 2Y8KA 3ENLA 2NXGA 1US2A 2Y7EA 4EANA 4LAMA 1S5TA 3KDNA 3ZT7A 1UH3A 5XIMA 1IWPA 5IOBA 1EA0A 3HTWA 3N2BA 2OEKA 4MJMA 4QFUA 4F79A 1W2PA 2JK2A 4RPQA 5HNNA 1ONXA 3QV6A 3E2RA 1MNZA 2CYGA 1PEZA 4UUIA 4KFPA 2EEXA 4K37A 3SR7A 2GJRA 3ISIX 4IJBA 3BLPX 2HV5A 2WZEA 2DZPA 2ZDRA 2C8NA 4PUJA 4ZFMA 4PUUA 1JCLA 3QOKA 1W9DM 3WJZA 1MFUA 4HU8A 4PCPA 3VD5A 3BJFA 1C8QA 5ABFB 2ACUA 4H6EA 3SUWA 1CGUA 3QYQA 4MGGA 2YDQA 5D8WA 1BF6A 1TA3B 5LSMA 3R79A 1AH3A 3GDMA 4CCZA 1HO4A 4JL1A 3ATYA 5DMYA 3QPEA 3ITXA 2DZBA 4FLQA 3PR2A 3UF9A 2QJJA 5C9RA 1D8WA 4XZWA 1J8VA 4DRSA 4DO6A 3UR5A 2YXOA 3DYOA 1UP3A 2IMRA 5ECUA 2VGBA 3TOPA 1IEIA 4ZQMA 3RM8A 4DELA 1C9WA 1HX0A 3LMZA 3AS3A 2Y61A 1V03A 3RU6A 1MDRA 3NR0A 4ZCWA 3VIGA 4MVAA 1JJKA 3AWNA 1XBZA 5LGXA 3R1ZA 1E40A 3GKFA 3B8WA 4HNNA 5EKYA 4R9XA 1WDSA 2ZZ5A 2JGYA 3G0UA 1LL6A 1SU5A 1XR2A 2A7NA 2OXNA 5FF3A 1KM6A 2WKGA 3VAVA 2FDSA 4Y9OA 2WXDM 3LUTA 3ZWSA 2BTMA 3G6LA 2Y24A 2OCZA 2ZTJA 4B5UA 1DE5A 2VVNA 1IXQA 2ZWYA 2J7HA 3GFYA 5AN7A 3AMCA 1LWIA 1MZRA 1M5WA 4GA8A 1DQUA 3WLRA 1E5NA 3N1AA 3CTLA 4YYCA 1QO5A 2X2GA 3W25A 1XLIA 3OHIA 4ADSA 4D2JA 2AKZA 1PSCA 1W1B1 6XIAA 1QNVA 3UESA 2IKHA 4C6KA 5B7ZA 1A47A 2J7GA 4FOKA 1FFQA 3IUIA 3CWHA 2VX7A 1R38A 1N8WA 4WCJA 3BJSA 4O15A 3DBPA 1CGXA 2YZ5A 3KWSA 1NDWA 3I7QA 3O0KA 3P7YA 2DZXA 1XIIA 3GNXA 5CKSA 4XWUA 2P8BA 3T44A 1M7JA 4QSFA 3S8HA 3VZXA 3VGFA 4JTUA 4FPSA 3TV8A 2V5KA 3CPGA 3I7SA 5I09A 1NP2A 3URAA 3KZSA 3QR3A 3AUJA 3LB0A 4E4FA 4YTUA 3EWZA 4MLJA 1DJGA 2NUWA 3ABOA 1ZFJA 1MW2A 2R1KA 4CQBA 3UG8A 3T78A 1Q7QA 2F8QA 1F6PA 1TVPA 1R85A 3T1GA 2CZFA 2B7QA 4W9TA 2G0WA 1OX6A 2HVNA 3N2CA 1VEPA 1K03A 4LAUA 4YTSA 4J35A 4FIRA 1JFXA 2HQAA 1XYCA 3HB9A 3QRHA 1GYLA 1XYFA 3U5UA 3SGGA 5TAOA 5U7SA 3QV9A 3M0HA 2E4TA 2PODA 1KFBA 3HGJA 1QWGA 4ML9A 3HG2A 5K9DA 1ISZA 2E5BA 1T41A 1E1CB 3GNRA 4HPHA 4OJYA 3GXFA 5DCEA 2R24A 4QJ4B 4HIBA 1XJBA 5HR7A 4IG2B 4LOCA 2FB2A 3DN5A 4C1NA 3T4CA 4S3DA 3AYTA 1YTKA 3ITVA 2GFTA 3IVSA 3H21A 2IPWA 3B0YA 1I8JA 1A4MA 4WSHA 4W8LA 3AIUA 1UMLA 4O8AA 1C8XA 3QLLA 2L5HA 1DWGM 1JXKA 4Y7EA 3B03A 5EMMA 3S83A 4ERIA 4RKAA 3OZPA 4D6FA 3VDGA 3DHPA 1PKLA 3FCPA 2NQLA 3UD6A 1AUSL 2GDUA 4HU0A 1UZDA 3GE7A 1DQWA 4J3ZA 3VE9A 2QMKA 1G6CA 1UZ1A 1FXQA 2GQAA 2W9MA 3WL0A 1OG6A 2E40A 2J27A 3NNTA 2PDGA 2BXYA 2GJNA 4E2DA 4N4QA 3WZ0E 1QOQA 4TVCA 2VX4A 4PB5A 3PBVA 3K8MA 1RD5A 4DF0A 1E4LA 5M3WA 2Z26A 3EPNA 1F76A 5CAHA 3JZUA 4PUWA 4FNRA 4MNMA 4YYFA 1WZLA 3QW4B 2CBVA 2RDWA 2NQHA 3LZ5A 3B8UA 1L8NA 4J3TA 2ACRA 3DECA 1MEWA 1CTNA 1THFD 1OINA 3BLKA 3Q45A 3V18A 4F40A 1TWIA 1KXHA 3BLEA 2VKZG 3PSVA 4O1BA 2VI0A 5JBDA 2BLEA 2WMIA 3ARXA 3APYA 1J0KA 4P7RA 1NJJA 1A5MC 4IJCA 2JBMA 3B8SA 5A2BA 2VQUA 4YVVA 3JUGA 3T2QA 3GBDA 2OOFA 3CEPA 3KTSA 4CNNA 1EUAA 2R14A 4REQB 2E6AA 4Z2KA 3MBDA 3STCA 3N12A 3L2LA 2DY3A 4LUTA 2ZVIA 3GDRA 1HXJA 3JZEA 2VNCA 4D1JA 8XIMA 3QZAA 1W5NA 3PJXA 3B0PA 3NFUA 1WKYA 4O0KA 3F1QA 4H6RA 1UA7A 1F7BA 4YS1A 3U3HA 2G3IA 5AZ1A 4WKHA 2ZUTA 3SRKA 1VHNA 3M4HA 2VP8A 4PB3A 3MCNA 2PWGA 4BA0A 4BWLC 3GS6A 4NJIA 2CKRA 3P60A 2D24A 4NRRA 3UG5A 3ZT6A 2IPGA 4IIHA 3TC3A 1J0IA 1RALA 2PF8A 1HG3A 1M53A 2QCFA 1CLXA 5EYWA 3BICA 5CZ0A 3GY1A 4PFMA 3CUJA 3GDTA 3R5EA 2Y5EA 1OHLA 2X8RA 1ZAJA 4J3VA 5LNWA 4XD5A 1KCLA 3C2FA 3A13A 1R2SA 3U2ZA 4I9TA 2OU4A 4WEVX 3S2JA 4FK9A 4TOQA 3NQFA 3OOQA 4K1WA 3CEUA 3WNMA 5F7UA 1A5UA 4HA1A 1S2TA 1H7WA 4GVGA 1GKRA 1OYBA 2ZE0A 3APTA 4K2SA 5D04C 1QK0A 4EE9A 3UNTA 1E6QM 1TPUA 4NY2A 4JYEA 2QCDA 3WQPA 1JYWA 3AOFA 1CI1A 1CGVA 4D9PA 3OVQA 4DLMA 4DXKA 4O11A 3WSUA 3OU8A 4AD4A 4NAEB 1GGOA 1EH9A 1KCKA 5JBFA 2WVTA 3ARRA 4MYAA 2W6RA 2EPOA 2EHHA 5HMSA 4B91A 5FJOA 3SSJA 2SFPA 4I5UA 4MYXA 1B3VA 2ISFA 5FESA 4NZ5A 2H8ZA 5BXTA 2DQXA 3K4AA 1KQYA 4ZODA 5E9XA 1QASA 4EX4A 3N34A 4DM1A 4XKMA 4A3UA 4Y2WA 1SJCA 3KBJA 2YLAA 1C9DA 2HCVA 2O9RA 4HPGA 4UQBA 4LS2A 5A94A 1M65A 3FOKA 1E0UA 3EBVA 2R1LA 1NY1A 1HKMA 4UQCA 2O56A 3M0KA 3VC6A 3SIZA 1G69A 2PC4A 2J4GA 1LDCA 1XRVA 4GPNA 3W6MA 1F74A 1WYIA 4DJFC 1OSEA 1GW1A 4HKPA 4CNUA 1H63A 4N42A 4PYSA 3SN4A 2KZHA 3GTHA 3E5PA 3WF0A 1CB7B 3TK7A 4XD3A 1BPLB 4JTKA 4UTKA 4Z2HA 4DBDA 3MTWA 3PPCA 4YVPA 4OVXA 1XC6A 1H0GA 3V4BA 4Q4RA 1Q7ZA 2DSKA 1QOPA 3KW3A 5GJPA 1QNSA 5IDZA 1TUXA 3H4WA 2E6FA 2PWVA 3BGAA 3H2FA 5C70A 3LRMA 5D8ZA 1UUMA 3DI0A 5G2HA 2OZ3A 4PTNA 4FZIA 2OQYA 5A1AA 3IJIA 1UG6A 3LGGA 1SZGA 1I45A 1R6WA 1DPMA 3ZVHB 3O1NA 2BWGA 1OFAA 3B8IA 4QAIA 4B3LA 3KS6A 4E4UA 3AZRA 1O5KA 3MHGA 2BASA 2VFFA 1F6YA 1NWUA 4RNHA 3IJ9A 1K1DA 1LWJA 1EPVA 1UD5A 2VEKA 3F4WA 1GOQA 2GQ8A 1MW0A 4EP8C 2RJHA 4JFSA 4RDVA 3LSBA 5FF4A 4H83A 3UNDA 4GZ7A 3AU6A 4JFVA 3NQDA 2Z00A 1HNYA 2B81A 5JMUA 3W1TA 1I4NA 3E6EA 3MKCA 4QROA 4WF7A 5D30A 4CQDA 4W86A 4IFRA 4XBSA 1NIUA 2QCLA 1Q2SA 2CETA 3B4UA 2UY5A 3MUIA 1TPB1 2QCGA 6CGTA 4CGTA 3UA4A 4UCGA 5I23A 3C0LA 2VGIA 1EP1A 1S1RA 3WN6A 3ITLA 3VMNA 5FEZA 1WBJA 2J79A 2JF6A 1RPXA 2OYLA 1BWLA 3CO8A 1UP0A 3VKJA 4JTLA 4HN8A 3EOSA 1JYNA 1Z9AA 3KRBA 1M7OA 3C6CA 2HDJA 1EJTC 4PMNA 5J04A 4KBXA 1YMYA 4YL2A 1SR0A 1L8PA 4PUEA 4QJ3B 4POCA 2B7PA 1JDFA 4UR8A 2RDUA 3CQIA 1U1HA 4W88A 3RJYA 3ATZA 2AQVA 3SCPA 1YPFA 1VENA 3H4GA 4NIRA 3MUCA 1UR4A 2IQDA 3LRLA 2WMGA 5FKYA 3VNIA 1J9YA 4LNCA 2LLEA 4JTGA 1CZ1A 1DWHM 3IACA 1L2UA 3MZ2A 1GZJA 1RA0A 3P93A 2FPTA 2A2IA 1J0ZA 2QUUA 2YR1A 4HU3A 1V7YA 3VIFA 3PB0A 1XM3A 5T26A 4WR3A 4G8TA 4F8XA 1DJHA 4KMQA 3ZQ9A 2ZFAA 4RZ6A 1YDYA 4FLRA 3NM3A 3LTYA 1N7KA 1TR9A 3KXQA 2E9MA 1U22A 2DJXA 3P8JA 4MB3A 1QT1A 4W85A 3G1RA 3P0XA 3L23A 3QC0A 5LA2A 4C6QA 4Y90A 3W2JA 3IK2A 2CBIA 5CPMA 3GTXA 3MUXA 3CO4A 1RP8A 8CGTA 4Q3MA 4QNEA 2GOKA 1G67A 4NG3A 3V0SA 3W24A 1AMYA 1EKOA 2Q71A 3U7BA 4AQLA 4BEQA 1OF6A 1F4AA 4AVFA 3UR2A 1OFEA 2OO0A 3GC2A 2E28A 2DORA 3TZFA 4HK6A 1O6IA 4UXDA 3ABXA 3IS4A 1G5AA 4HD5A 1XX1A 2WVVB 4JQ2A 3E38A 2PDCA 1YBQA 1KRAC 4NF7A 1BYAA 1OBAA 7CGTA 1UB3A 1MUWA 2ACQA 2A21A 1SO6A 3HPSA 3LI0A 4N9CA 4QM1A 1ISYA 1BSLA 3VUPA 5F2MA 4HA0A 2B0MA 4JIPA 3E0VA 4GBUA 4F0HA 1YE6A 5JQ9A 3F4NA 3PN8A 5F4WA 3REQB 2PDLA 2YBTA 3GVQA 1GPFA 3LXCA 2OWWA 1I2RA 3AXHA 1BVZA 4DNHA 5MHBA 3PNUA 2Q8LA 3FJ6A 5JIWA 3C4UA 3GHSA 3RMJA 3RX3A 1HL2A 2W61A 3W00A 1VAHA 4DHGA 3K5XA 4UTFA 1UUQA 2AGTA 2XVLA 3AIQA 4KWSA 1V02E 3MHFA 3QV8A 4I7VA 1HJWA 4MWAE 2J9YA 4N0RA 4CD8A 2YW3A 1W56A 4UFKA 1GKPA 4L6OA 2FVMA 5CGQA 3WMBA 2CLFA 2GGGA 3KM8A 3W84A 1V3MA 3AALA 2QUVA 1ADOA 4B3ZA 2BVDA 1TSIA 3PUGA 2DGAA 5E70A 3S1VA 2O9OA 3AU2A 5JIPA 3WBWA 5CLWA 1C8YA 3BAXA 3B9AA 4MJZA 3SRDA 3M5XA 3URNA 4BHYA 3VGHA 3NJ3A 1UUOA 2BZNA 4M24A 4K7YA 3C8NA 2ZRWA 4KCWA 1QATA 3NDZA 3ARQA 5TD4A 4JEQA 4AF0B 3WD2A 1UD6A 2BY0A 4JOMA 4CU7A 3NPUA 2ZUMA 3Q65A 2CEQA 2XFWA 4IQEA 1LORA 3LBMA 4MMWA 2JKAA 2VHLA 3U2OA 1A3XA 4B4FA 1JCNA 1VHCA 2DSUA 3CB8A 1GTHA 3DGBA 4Q7NA 4X0VA 4W8AA 4BQ5A 2PZ0A 5EMLA 4ZE5A 3AS2A 2TAAA 1PVNA 3ZLHA 2GK1A 3R2GA 2QGHA 1BQCA 5HMEA 5BRPA 3AUOA 4XZLX 1EA9C 3CC1A 3E1F1 4HZMA 4KFOA 3U4FA 1W1IE 4GYJA 1ZUAX 1K3UA 1SFJA 4X22A 3PBYA 4GJ1A 1EC8A 4O50A 4TVDA 2FZ9A 4JX5A 2G95A 1FUYA 1XC4A 5E6ZA 2YBVA 4KGJA 2QZRA 4AX6A 4G1NA 4US5A 3W07A 9XIMA 4AVNA 1TB3A 4DUVA 3NGFA 1H1ZA 2VFGA 3QV7A 3IANA 1VFUA 4N9BA 1TZZA 3UJEA 2ZOXA 1S46A 3N4AA 3MO4A 1E6RA 1W0MA 2NQJA 1I9CB 1VKFA 3PZQA 3ARSA 3T81A 3P6LA 2GWGA 4AU0A 5CH9A 3LPGA 3M0XA 1EB3A 4PB4A 4GH1A 2I17A 4BI6A 2Z25A 3BG5A 3LPFA 3TQKA 1K77A 1JZ3A 2QKFA 1DJQA 2QDGA 1KBLA 1TUFA 1XBXA 1Y5WA 3I6EA 1LBFA 2FZDA 2BDQA 2BY3A 4H9UA 1J12A 2R1MA 2V68A 4JCLA 1S5MA 2WMFA 1YIXA 2GVYA 1XYBA 3KDOA 1GOIA 1Q63A 4JTRA 4GFIA 5J5DA 3AI0A 4V1XA 4MZ8A 3UP8A 4PA8A 5CBIA 1W5OA 3NEVA 2I57A 4P7NA 3VD9A 3WELA 3PS7A 5C54A 5FCZA 2A85A 1JR1A 1UH2A 3MMUA 3W72A 1ZSXA 4C6NA 4B5NA 1E6PA 4PTVA 2P76A 1A4LA 3KCJA 4CVUA 1EJUC 3F4CA 4AWUA 1KXVA 3WQDA 1E70M 4G7FA 3FJ4A 1YW1A 1H1YA 3UT0A 3KL0A 4PE8A 2VUYA 3MKVA 5KSWA 4LYRA 2ZUUA 3AXKA 1F8IA 4JNYA 1MUMA 3GR7A 4KEVA 3AXIA 2BGSA 3B4YA 4JIQA 3OO2A 3QMSA 3TE9A 1GVSA 1DWJM 4H19A 4AHQA 3TYUA 2BBFA 4IICA 1WE5A 1XPGA 3WX7A 2EO7A 5I3IA 1QOXA 5BMXA 1BQGA 2HZGA 2OO6A 1PIFA 4IPJA 1S2AA 1F3XA 1OEPA 5BU9A 5A2CA 3V1HA 3T2PA 4AWEA 2FH8A 1XLDA 3Q67A 1VCVA 4GD0A 3FN9A 4IIDA 1MO0A 2C7FA 2XSXA 1N2VA 3O05A 2PU1A 4DPQA 4LC8A 1GG0A 3WDJA 2Y5JA 3AIWA 3PZUA 4ZGYA 1K8CA 3D0CA 4ILSA 4QHRA 1A5SA 2CKSA 1P0BA 4MTVA 1YDOA 3QMRA 1IZJA 5A6AA 3NQCA 3TMLA 3GFXA 4FP1A 1GNXA 3BAWA 1A5LC 3DUGA 4E5TA 4P7QA 1R2RA 3EWCA 1C7SA 3AFBA 2PA6A 2WQPA 2YDAA 3W1LA 3RLUA 3OZMA 1XGDA 1H41A 2I56A 3EEGA 1KFKA 3DKLA 1RP9A 5EFFA 5A8OA 4NZJA 2BY2A 1OM0A 4D6CA 1E1EA 1PWMA 1AQHA 1UZ4A 4RNFA 1DWIM 5KZMA 4LWWA 3GB6A 3B9EA 3MZNA 4PEKA 2J8TA 3I6TA 1WXYA 5AC5A 4YWSA 1CW2A 4R7JA 3T8QA 4O53A 3U4AA 5ABEA 3IJQA 2YA0A 2UZ9A 2W5FA 3O15A 4Q8UA 4C6OA 1I0DA 2A3LA 4LQ1A 2OZ0A 2IQ0A 1PL9A 2Q6ZA 3KEHA 1AH0A 4B9YA 1XYAA 3CZEA 1ZCOA 4GACA 1E15A 1BXCA 3VNDA 3BSGA 4HVXA 1XSKA 1NH6A 1HZYA 2R8WA 3ZMRA 4EACA 3NO1A 1E4NA 1B9BA 3EA3A 4HN4A 4NXKA 4DYEA 1P6CA 4L4OA 1D3GA 3E0WA 4P7LA 5IBXA 1B54A 1AVAA 3VOGA 1WOBA 4IL2A 5DXYA 5IDIA 4LPCA 4LRTA 1NFBA 2O4QA 3K8LA 1V93A 2ZX9A 1P48A 4QNWA 4M19A 3NSNA 3SRHA 3OGVA 1JGMA 4KW2A 5K9CA 3ALGA 3ZSTA 4MWAB 5HQMA 4RLIA 3PUDA 2Q8ZA 3RN6A 1FP9A 1FCBA 3TN3A 4FXSA 4HNUA 4DAIA 4H9MA 1EFZA 4TQTA 1OF8A 2GDQA 1FY6A 3NO5A 2ZRUA 1WZAA 2TODA 4XUYA 3EMQA 1TV7A 2ZE3A 1J96A 1V4YA 3WFLA 3ZZ1A 2BB0A 3CQKA 4I3GA 3DESA 3EB4A 4LV4A 1FWRA 4JTSA 1QU4A 4F66A 3IEBA 2DVTA 4KRZA 3PJUA 4HTYA 1DJWA 3HQNA 2BS9A 2X0SA 3SQMA 3PC0A 4B92A 4XKYA 5EMUA 2WZIA 4J3SA 3WF3A 1VBUA 4M8UA 3T0AA 3NQAA 1NTHA 3T42A 2I7GA 3MO7A 1XLGA 3UXAA 5ECVA 3CZJA 1JZ5A 4QE5A 3FEMA 1XFCA 4F9DA 4JTAA 4E8DA 2NX3A 1QNPA 3VC5A 4MPKA 1PUDA 4GVFA 4Z0SA 3VIHA 4X9SA 3CV6A 3FDGA 1CXKA 4DZHA 1F3TA 2ACSA 3K30A 1GWJA 2A6NA 1R9YA 3V36A 3I4KA 1KWGA 3S6OA 4EPBC 5CJMA 2E6DA 4NP7A 4GIAA 2J62A 4GQGA 4CEXC 3IGXA 5HR6A 3BSMA 4H9YA 1V6WA 2C13A 1YKWA 1PIGA 2PUZA 3S5ZA 1XQLA 3SRFA 3T55A 5CG7A 4LS1A 5IFPA 3RXZA 3NZQA 3SDOA 1QW8A 2G50A 1TV5A 4LX4A 4J40A 1X39A 1GYMA 4YCPA 3B04A 1U5HA 3LHYA 3NQ6A 3O6AA 1WDPA 1CCWB 2J75A 5HPOA 3UCQA 4BQ4A 1HJUA 3W1PA 4E2BA 2QIWA 3HF3A 3W28A 4NNBA 3WLPA 2NX9A 2PTYA 4JTJA 3AIEA 1XIHA 3RG6A 3CZKA 3DCPA 2DIKA 2REQA 2DT3A 5DXXA 3QYSA 2Z29A 3HU7A 4O17A 1GQIA 1WO2A 1WUEA 3RRXA 2A3AA 4TR9A 4EXBA 4K39A 2RUSA 4PMDA 5A69A 1UWSA 4QLKA 2FHBA 1RAKA 4JZ5A 4G1KA 1QRQA 3NCOA 4H8UA 5CBBA 3TLQA 3RF9A 5DX7A 1Q7MA 2Y7FA 3LGEA 1TA3A 2C0HA 4GGBA 4N4PA 5LIUX 3K8KA 1L2QA 2PI6A 4WJEA 2WNZA 1M6JA 3ITTA 4PUMA 2XTKA 3PZVA 3E49A 3W7QA 3RAOA 3AQUA 3PBGA 1SQ7A 3W74A 4IFOA 5TBOA 3B0VC 3V75A 3W70A 2VZSA 4N6FA 1QI3A 3DU0A 1Q6EA 1U1UA 1NWSA 1V0LA 2WHMA 3MCMA 1PZ2A 5FSDC 1BGGA 2HPMA 3UA3A 1NDZA 1TPVA 2VVSA 3WLHA 5HXMA 2PTDA 3PZIA 3NQ8A 3FGCA 2Y89A 5D9PA 3ZSSA 3C0QA 5AY7A 1Z89A 2VCCA 2QCHA 1EL3A 1HJSA 1UASA 2AKMA 2ISVA 1ELSA 1VYSX 1XHGA 3BH4A 4MNLA 3TC6A 2Z1XA 2CU0A 1W5MA 1VYPX 3ARYA 1OC6A 4JIIX 4DBSA 1P6WA 4Q4OA 1TX0A 2O0TA 1A5BA 1TZ7A 2J6VA 4DUWA 4PH6A 3KBMA 1DJNA 3UW6A 3M07A 5EL1A 3STFA 3VK5A 3OODA 4CN1A 4RK8A 2R1NA 3K4WA 4M0XA 5KMYA 3FFSA 1XI3A 3II1A 1ZLPA 4L9XA 5E09A 2OEMA 4IHCA 4DJDA 4I9AA 3ZFHA 3WDQA 2EJAA 4CD6A 3V35A 1B3XA 1OFOA 2E09A 4ZOEA 2PWUA 2P5NA 2PDNA 4NILA 3GG7A 1V0NA 3QEZA 3VABA 1EUNA 1DE6A 5AC7A 4C1KA 1BRLA 1HVQA 2CXGA 3UY8A 3CTTA 3P5ZA 4DYJA 2CHOA 3LV6A 1V3LA 3L4YA 2QUMA 4Q32A 4TVUA 1YYAA 3E96A 1X97A 5HINA 3BLLA 1JCJA 3C2OA 1EJXC 5LGZA 5H1WA 1DIDA 3QBUA 1UBPC 3E0IA 2PLKA 5D38A 3GC4A 3CXOA 5D02A 4QE4A 2OYKA 1HP4A 4UFJA 2HWGA 3MBFA 3U5YA 3LS9A 4XZNX 4GIYA 2XZ7A 1RJQA 2IQTA 2O7QA 1MEHA 3PM6A 3F5JA 4B5TA 3CH9A 1V51A 4L64A 1TPEA 3A5VA 2YYTA 4HK5A 1H7PA 2C14A 3H23A 3TJXA 1DVJA 5G1TA 3EKLA 5HWJA 4C60A 4HJWA 4A2RA 1Z8AA 1LWHA 1UC5A 3RLVA 2W66A 2HEJA 1UIPA 1NVMA 2CZDA 1GQJA 2WLZA 2X41A 7TIMA 1EYEA 3NL3A 5K4XA 1YPIA 2PDKA 1TELA 2V38A 2CLIA 2DPEA 3N2TA 1XICA 2PPGA 3I65A 2JQXA 2ZZ4A 3OHMB 4NAFA 5FL1A 3USZA 3RO8A 1FWAC 1ITXA 3R0DA 4D71A 2ISSA 4ZEPA 1Z41A 1FDJA 4GBDA 4JKKA 3DC0A 2VJXA 3SO7A 2WC3A 2D2OA 1J2WA 3N11A 4ZE4A 2YBUA 3N14A 1NSJA 4N7QA 3BOLA 1E3XA 1CECA 2W62A 3KOWA 1RK5A 4AIUA 1AZ2A 1HKWA 4UNIA 3LEPA 3BXWA 2FQIA 2V6AA 1JZ8A 2FPVA 5MKGB 4I5RA 1N8IA 2WWDA 5A6BA 3ELFA 5I24A 1K9TA 4QDMA 2DT2A 4W84A 3QH2A 4RDWA 2A3EA 2UY4A 5E6YA 1PCKA 4Y9AA 1XLEA 2VL4A 4P2VA 1F05A 4MUPA 2E9BA 1Y0EA 2YCLA 4F9JA 1UWIA 1WOAA 4HMNA 4H4IA 4DZIA 2VX5A 1P0DA 5I3FA 3C86A 4Q6JA 1C91A 5DY3A 1JCMP 2QJHA 3V0UA 3HN3A 3FYPA 2JIWA 2HK1A 4F2TA 1RK6A 1OYCA 1ZAHA 3SSZA 1W6TA 1E1FA 1CLKA 4NKCA 1EXBA 4B15A 1XYZA 5C2XA 1B57A 2HVMA 4PTWA 3PJTA 5BW6A 4K3ZA 5K3VA 2DZTA 3W7DA 2NWSA 4QLJA 4AZ7A 1KTBA 1V6VA 5GNZA 3TU9A 2QEZA 3TW9A 1UP2A 1XLBA 3PZ9A 2YCEA 1P7TA 3MI3A 2E8ZA 1JI1A 1JNDA 2J7FA 3H2MA 3GG1A 5CLTA 4BJHA 1Z32X 1IXPA 3H4XA 2D23A 3RCYA 4KCTA 4IOTA 3SY8A 1VIZA 4L5ZA 5CJ5A 4Z2JA 1MWOA 2ZX7A 6ALDA 1LOLA 4A8LA 2DW6A 4CQCA 4LV9A 4Z17A 3OVRA 4X63A 1RY0A 2VC6A 1TV8A 4UMAA 3GD6A 3H2AA 1GOWA 2XVGA 3D3FA 2HBVA 4R88A 3RU8X 4MADA 4HPXA 1FX6A 1KXTA 2C71A 4ORIA 4XD6A 5CC6A 1PZ0A 3MU7A 4GUGA 2F6KA 1T5AA 5F1VA 4E8GA 2OX1A 4D1IA 5I3JA 4HHHA 1NELA 1XYLA 4PMZA 3S4TA 3RGTA 4GXPA 5CCZA 4GKLA 3WLLA 1I1WA 3OGRA 4LANA 3SY5A 1FHDA 4UFHA 1TTPA 4DO5A 1QBAA 4S3GA 1LG2A 3H54A 4ZL1A 3OQ8A 3L67A 2WZTA 4P61A 3R89A 4WQ6A 1UMYA 1WBHA 2QIIA 7REQB 2GQ3A 2NV1A 3DFOA 1IZKA 2DT0A 1VF8A 4Z08A 4Q8MA 2PDJA 3DFNA 1LUCA 1XL9A 3M9YA 2VELA 3WH7A 1H5VA 3EX3A 4IPIA 2FFIA 2EJ1A 2JGQA 1BXNA 3LGDA 5DBTA 3TZNA 5EPDA 4AD2A 4XIMA 5LIXX 3WQWA 2ZTKA 1J0HA 4C6LA 4YTTA 3W6YA 3GKAA 1KWKA 3U57A 2ZA1A 1UKTA 1KQZA 2OMAA 2NQ9A 1MXDA 3JU2A 2PCEA 4MPQA 2GSEA 2Y0FA 3UJ2A 4P8WA 5DMNA 5JH1A 2ZADA 3SM0A 1KTCA 2BOGX 1Q13A 3W01A 1T7LA 3UYCA 1VFHA 4RW5A 4KIRA 3QY6A 5T91A 3PZNA 4IPNB 4UTTC 2PD9A 3RM9A 4TX6A 4J7RA 4S3BA 2ZIDA 3S5SA 5C8BB 3GHRA 2WHJA 4DWSC 2D22A 1R46A 1EHAA 4ATDA 1FHUA 2OR2A 1XBVA 4NAEA 4JFUA 1M7PA 1ZP4A 3PBWA 1EOKA 3ME3A 1UKPA 2Z7KA 1OWQA 3N4EA 1WDRA 2YCIX 2J7EA 4GUJA 4L4LA 3BARA 2BNJA 1F3WA 2WO5A 4C6BA 1O60A 3POHA 3EWWA 4KWUA 4K68A 1QFEA 3B8VA 1V6TA 3GNPA 3N17A 3WLJA 5EB8A 2WKLA 1UHVA 1TPDA 5HDRA 5AVHA 2UY2A 3QC3A 3M6DA 1ECEA 1QWKA 1XCWA 1TPC1 1SO5A 2OLAA 3HPAA 1UOKA 3LM3A 2BVTA 1JUBA 1U1JA 4ZSTA 4R53A 3FHAA 3NPXA 1PHQA 2EKGA 4E2VA 4HNCA 1R47A 4A3YA 4NI3A 3GR8A 1GPWA 4XZ9A 1UR8A 4HA3A 3WEMA 5FF7A 1W5PA 3NG3A 4N9DA 2MNRA 1UD4A 3CAVA 4HSHA 4K7VA 3GVWA 4NX0A 3A4JA 3L68A 1TMLA 1ZHAA 3A24A 1E71M 2ISDA 2D0HA 3L0KA 3UWZA 3SBFA 2DUZA 3VDCA 2E8YA 4GYKA 4HYVA 1UOZA 4MJ4A 3V3WA 3L5MA 2ZRZA 1UW9A 5TIMA 1OCNA 2DT1A 3MMWA 3S9IA 4ICCX 3QJAA 4ACZA 1FWDC 3AICA 4RDZA 2X1RA 4CN6A 4W89A 3RHGA 2GSJA 3CIVA 3ZVHA 4DJFD 1DJXA 1KM3A 3WH5A 1KBBA 1J0JA 3P8IA 2A7RA 5CAKA 3DH7A 3EXRA 3E2VA 3O63A 2NLIA 3HGRA 3EOLA 3L5AA 3QGAC 1ONWA 2IKGA 2GUUA 1JAKA 4D6GA 3CAWA 3EGJA 4JYFA 4RDYA 2YOCA 4BF5A 4GY7A 1RH9A 1GVQA 4FSAA 3OP2A 4PMXA 4S1FA 4V28A 3GZ3A 1SZFA 1TTQA 3VYLA 3WDRA 2XINA 4ADTA 2H8XA 1OC7A 1O5QA 3GHUA 1K7EA 3LXAA 4ROPA 1MDLA 5GPRA 3E2QA 1EX5A 5CXPA 1ITCA 1IXOA 4ASTA 5BZAA 4D8AA 3W4RA 4GHRA 3GDBA 3G1DA 3G24A 1WA3A 4GGHA 1XDMA 2Y7GA 5EBAA 3KBSA 5HJLA 3QGVA 1JULA 5FJPA 3UZJA 1OIMA 2ZXQA 1BG4A 4V15A 2NT0A 4I9MA 1KBKA 4RZBA 3DERA 1TCMA 4LALA 3W2MA 1PZ1A 5AKQA 3CU2A 1ZBCA 4C5YA 3UXDA 1ICQA 4PMYA 1J01A 2XPKA 3CL8A 3TTYA 1XLMA 5I06A 3VUSA 4CU6A 1GZ1A 3GU9A 1AA1B 1C93A 3OVGA 5I07A 4RE0A 5HNUA 3W1NA 2UBPC 4GI8A 2XGBA 1OY0A 3M0MA 4A3QA 3CB3A 1VFOA 3KTXA 4CCEA 2PDFA 3NZ1A 3UPMA 4DXXA 4EWJA 3CUFA 4WDUA 4D6DA 3TYDA 3WYZA 4J2PA 4PTMA 2INZA 5FACA 1F3EA 5JH2A 1GOKA 3OW1A 1H50A 3BCDA 4WK9A 5CZSA 1W91A 2A3BA 3N2XA 2CXEA 2RDXA 5FSEC 4IIBA 4QG6A 4WGHA 5F2GA 4ZVJA 3WK1A 3PBMA 3TJIA 1YDNA 4DJEA 3EWXA 4CNTA 1US3A 3A3XA 1HL9A 3UFYA 1MQPA 3CJPA 3DEQA 5M03A 3GG0A 3QR0A 1OADA 2GYIA 4L9YA 2E5CA 1NU5A 2PS2A 4E2OA 5JUVA 1R3WA 5M5DA 2QHAA 3LRKA 4NXSA 4UTIA 3LPOA 1RLDA 3FS2A 1Q6CA 2P3ZA 4HTBA 1AJ0A 4FF5A 3TIMA 2VUNA 1W8SA 1OB0A 4G6CA 3TTEA 3VNZA 1KFEA 3DYMA 2J88A 4BKNA 1KM5A 3T7VA 2YGYA 1H61A 3F03K 1PO9A 2WVVA 4V2XA 5K9XA 5HMFA 2X40A 1MRAA 3ZO9A 3R8GA 1XLHA 4BZYA 3KBVA 4Y9MA 4HPJA 4IUOA 4CN4A 3S1XA 1DQXA 1IGSA 1EEPA 3VU2A 3LNPA 2HNEA 2O92A 5F2IA 1DWAM 2QULA 4RJEA 2EF9A 4F0SA 1XDJA 4YNGA 4LC6A 1HQTA 1MQRA 3CQJA 2VC9A 4KPLA 1OT1A 4YHEA 4RXFA 3NQVA 5HATA 3I6RA 2PDPA 3ZOAA 3BZGA 4GNJA 5C9XA 4LB3A 4M6VA 4D6HA 2XWDA 2QUNA 4X0NA 4DN1A 4DB7A 4WDWA 3WD3A 3BANA 1HKVA 1F4HA 1Q4WA 5HUPA 4UQEA 3QPZA 1EIXA 1C7TA 1SW3A 3WMLA 3PPGA 4DZ5A 4ICNA 2C6QA 3CT7A 4Y9PA 4B3KA 4JHMA 2FZMA 4KRTA 3SZ8A 3EPOA 4O1CA 4MKVA 3KLLA 3WUGA 2WK2A 3CT2A 1I2NA 1W2VA 3B9OA 4XTIA 1JUEA 3SN1A 4ZTXA 4D6JA 4UZUA 4TO8A 1XCFA 4GWEA 3KRZA 4NJJA 3PJWA 5F4XA 1QBBA 2G97A 5HQEA 1Q5MA 1MXGA 3HOJA 1LLOA 3SEPA 3WLMA 4ATWA 1KGXA 4FHAA 2WPBA 4GJJA 1S5NA 3DFQA 2CWXA 1V3HA 1TPWA 3VIMA 2WMHA 2AMXA 4PUDA 4MB4A 4BFAA 3GIYA 4G9PA 3T0BA 4Y8EA 4AF0A 1US0A 3M47A 4EWND 1S2UA 5E0KA 3TLLA 4M80A 1HKKA 2V5LA 3KVLA 2YYUA 3VIJA 1P0NA 1QI0A 5DCBA 3OG3A 3W88A 3THUA 2R9RA 4XZHA 3R12A 4U4MA 5GNXA 5F4SA 4B5VA 1QPRA 2D3NA 3W7EA 4LVDA 2CZVA 4YHGA 4GUFA 1EF2A 1A5KC 1C92A 5TNVA 1VPXA 1DIEA 2GVEA 4K8GA 4YN5A 5HA7A 3ITGA 1FTXA 3AYVA 1AQMA 4AY8A 5D09A 1B0IA 1MVYA 1YHTA 1MI3A 3EWDA 1LM1A 5DMLA 1NOUA 3NQBA 2DZSA 1W3IA 4RW3A 3N3MA 4PUNA 2GWNA 3WBYA 2PWDA 1VZWA 2CZEA 5AC8A 2ZX8A 3OJGA 2H9AB 2KX9A 4WGXA 1SSGA 3SCTA 1E0VA 2OB3A 3WK0A 1R9XA 5LNRA 4O0QA 4FLSA 1QNOA 1YNYA 3NEHA 4MF4A 4ZO7A 3QHOA 3VMPA 3THAA 3VPLA 2GOUA 4FAMA 4Q8QA 3GQYA 1B31A 1BTCA 1ZAIA 5HUOA 2PSNA 3STEA 4GISA 3EKZA 1FWSA 3W1AA 2WCGA 2VDIA 5M17A 3WQ5A 3TN5A 1W1PA 5LA0A 4C1NB 4K6AA 3UCDA 1TPH1 4RV8A 1XGZA 1QXLA 5DRIA 4M1RA 3BCJA 1XLCA 2XH2A 4EXQA 2PDIA 4F2BA 3THCA 2ALRA 3AHTA 1TRIA 3ZVIA 1G4TA 5C5YA 3SUSA 3P81A 3U7VA 4JHOA 3WLNA 4FNPA 3CMJA 2WVUA 2FJUB 3T9PA 2Y5SA 3RLGA 1X6NA 3WJYA 2XN0A 3FXGA 4RCXA 2I9UA 4WX2A 5DY2A 4W7VA 4QQUA 1ADSA 2BHZA 1YNQA 1W1TA 3UR7A 2PBGA 4OV4A 3R4IA 1WX0A 1RSCA 3CWNA 3BMWA 3S47A 1XUZA 2IKIA 2FGBA 4UMCA 1R9ZA 3KVKA 3O0FA 4GZJA 3C8FA 1R7OA 5REQA 2QNEA 3DC8A 2HBXA 2C19A 4JX4A 3GG8A 1RLCL 4JBRA 3W22A 3W7KA 1MFVA 4O1AA 4J27A 1VCFA 3ZS4A 5I3GA 2ZCGA 5C2GA 2H90A 3CHDA 1SFSA 4D6IA 5J5RA 3H6OA 4E8CA 4LB4A 2E68A 2GGHA 2ZC8A 3UWVA 3BLIA 4GCXA 5HMDA 4IWWA 4AC1X 3BCFA 5AC4A 3SGUA 3CMFA 4UNLA 5HAOA 1QVBA 2EBNA 4TMCA 4KEUA 5CBJA 4CVWA 5FI8A 4CNPA 3MI2A 4JDBA 5T9BG 2P1FA 4R34A 3SB0A 1FQ0A 5E1QA 2PWEA 5AHIA 1W5QA 1E9IA 1FCVA 5C71A 2PP0A 1YXDA 2CBUA 1HP5A 4QEEA 2V0TA 4LUTB 1OCJA 1OGSA 3BLOA 1W9BM 4H01A 4C6MA 4C90A 2QJGA 2EG8A 3OLEA 5DELA 3ICJA 4KQNA 3HPXA 3M0ZA 1GQNA 3DG3A 3HIJA 1Y5VA 5U4NA 1TMQA 3G2GA 1A0CA 4GOAA 3EYPA 2NQZA 3G22A 5I79A 4BI7A 3PWAA 3PTDA 2OSXA 3W27A 2DZAA 1PKMA 3L0NA 4MNKA 2MUCA 3S2CA 1CGYA 3WKZA 9XIAA 1PX8A 4Q22A 3MP4A 1EJRC 5KZ6A 1QJWA 4URIA 1VJSA 3OA5A 1XLJA 4M5PA 2NW0A 3M6YA 3C0JA 1MSSA 4Q8OA 1LP6A 1R8LA 2WCSA 4W5UA 3SFKA 3VVGA 1LL4A 3KRSA 1KRMA 5HWMA 5CZTA 1XP3A 2FJKA 4GO8A 1QI2A 3IJ7A 2DH2A 5HQLA 1G4SA 3LHZA 1JUKA 2VGFA 2R94A 4EAYA 1O12A 2NXIA 1LCOA 8RUCA 1CGWA 3ZJ7A 1TJ2A 4EPDC 1TQXA 1QPKA 1CXFA 3EMCA 4QG8A 1AZ1A 4WDXA 4MZYA 5EBUA 3G1FA 1B30A 3ERPA 3KP1A 3LCFA 4ATLA 3CHCA 2NQ5A 1B3ZA 5D37A 4XAPA 3OPSA 2QCDB 2ASHA 1UKOA 3OGSA 5E93A 3W53A 3NM1A 4QAWA 1J6OA 3IJ8A 3VDHA 1K02A 2VR4A 1W3JA 4AIBA 4KRUA 3TYZA 2W91A 1XH2A 3TP4A 2ISWA 2Z7GA 4NNCA 2ZXDA 5CPQA 5K7JA 4QCEA 2GGIA 3WIJA 1Q6RA 1VLIA 4UQAA 5DEZA 3QXBA 1JZ6A 4RR4A 2CITA 1CB2A 1W37A 3RUBL 2V9DA 3GNDA 2CLEA 3AHYA 3P5YA 2F84A 2XH4A 3CUIA 3H53A 5AECA 2ADAA 4Y8FA 3GBEA 2JFEX 1GT8A 2IPFA 3EX1A 2ZX5A 2ZUNA 4B90A 4X2PA 2YA1A 3KRUA 1ZJIA 3R6IA 1IR2A 3Q37A 1JAEA 3LV5A 1FWHC 2OELA 4UOQA 4DO7A 5IM51 3TDFA 2VEGA 3NOYA 3FLUA 1E6SM 2NVDA 2P50A 4AXNA 1UROA 4CNOA 1Z7AA 3OTRA 1GOXA 4GQ0A 2PTXA 1R7AA 1G4EA 5EY5A 5DCDA 1J5TA 4OOUA 1SZNA 5H6HA 2FIQA 2GJPA 4ZENA 1JPKA 5EFDA 1L9WA 3TC7A 2XIIA 1AK5A 4WVXA 4ZQCA 2BP1A 1S3TC 1W54A 3VOFA 4ENLA 3VCNA 4G7EA 3EXSA 4HHLA 4DNMA 5D2YA 3EOOA 1ZTVA 3L9CA 2WSKA 1R3RA 1IZCA 1H7OA 2VENA 2V3FA 2X1UA 3UJSA 4DX3A 1XF0A 4OV9A 2EKCA 5H2ZA 2YFNA 4ZOBA 1SJAA 4MKSA 4XZMX 3BAJA 3ZM8A 4YXGA 5FF0A 2YIHA 4AZBA 4L4PA 4EF9A 4KF1A 3L4VA 2A1YA 4NT0A 1O66A 3WF2A 2H3DA 5BYWA 1K4GA 1W3HA 2VCAA 3K4DA 4JQ1A 1GZGA 1W3NA 1WB0A 3NGJA 5AYIA 1JXJA 3T40A 1CT5A 5FJTA 4A05A 3INPA 3QKEA 5PTDA 3LCWA 3MI6A 4GQQA 2X1IA 2PLMA 2V82A 5DMMA 1PBGA 3LSCA 2PRMA 2V3DA 4Q8VA 4QJ5B 3T09A 1H7RA 2YW4A 4EKJA 1V0MA 3QFEA 4GABA 2FGLA 1YTEA 1SM9A 1V6UA 4OTKA 1J93A 2FDMA 1JZ7A 3CGTA 4JKMA 3WNOA 3WQ4A 3WJXA 3C2YA 4GCAA 4KS0A 4AYGA 4HNVA 1JPHA 4BF7A 1KNWA 4ZO8A 3K46A 1EGZA 4NUWA 3CHVA 4MAVA 3CWOX 1HJXA 3LTPA 2Z6JA 4AD3A 3JS3A 3OZOA 3WLIA 3DHDA 3IV3A 3E5BA 3S9ZA 1L0PA 4JQAA 2CLKA 1C90A 1DYSA 4MKNA 1KKOA 4ES4A 4Q7IA 4MUZA 3W1MA 3MP5A 3QSTA 3CUGA 2PAJA 3EB3A 5LXEA 1JDAA 3TAKA 3M5YA 5EMKA 4JHZA 3E9AA 6REQA 4M56A 2ODOA 1B4KA 1AD1A 2FYMA 4Z42C 3VTRA 3THDA 4MOZA 2ICSA 4UZSA 5IFTA 2HISA 3WUEA 5EGRA 4UIOA 5BOFA 2PWHA 4NJHA 3VGEA 2E6YA 3EX4A 1OFRA 3AMDA 4US6A 3CBWA 4NVTA 4UOJA 1I2OA 2CHRA 3L66A 4JQ4A 4R27A 5C7VA 4ALDA 3OYZA 2V63A 1R87A 1RCXB 1I0BA 1P1XA 2J9ZA 1QDSA 3TNBA 2QQ6A 4V27A 1Z44A 1HGWA 4N9EA 4MM1A 4MY9A 3VILA 1VQTA 2QR6A 4WKFA 1TG7A 3VA8A 1QW7A 3B9DA 3FKKA 4HMEA 3HZ3A 4ACYA 1O5RA 3RR1A 3LDVA 2WCAA 1PYFA 2WYSA 3BOFA 3A47A 2PTZA 5I3DA 3H2OA 4TUFA 1J2BA 4UTJA 4HJFA 4TXEA 3QQWA 1CIUA 1LL7A 1YBQB 2YDRA 1ZRQA 1AQ0A 2ZKMX 3IJLA 4C6FA 3IUDA 1DJYA 2QJNA 1Z48A 3AXXA 4UR9A 2OSWA 1EDGA 2HMCA 3D6NA 3NIYA 1VFTA 3MUAA 4OBRA 1VEMA 2WSRA 4BQ2A 1RVGA 3W86A 2ZZ1A 3NXFA 5DLCA 1GQKA 3TQ0A 4BF9A 4DI9A 2VZVA 4WDTA 2AAMA 3IK4A 4IH3A 1PTDA 1AMKA 4R33A 3OIXA 1FWTA 4JIRA 3VIPA 5A8PA 2ZDSA 3KWXA 4MLRA 1W1VA 1NQKA 4A4AA 1UKSA 1KM0A 3WNNA 4JN7A 1IEXA 1R3QA 3W85A 3P14A 4F4RA 2OWXA 3GYCA 3ABRA 4MWAD 3KE0A 1SGJA 5LNSA 1XQKA 1I2QA 1LJYA 1HKJA 1ITUA 2I5GA 4O16A 1W32A 4E6MA 3TX9A 5BOOA 1B5TA 1ZBWA 1PTAA 4O0ZA 4UQDA 4HYWA 3DDMA 4DUOA 3I4EA 1J5SA 4LVFA 4YPJA 3N4FA 1WCGA 2NVAA 4GI6A 3F5KA 2XU2A 3VDAA 1RBOB 2BHUA 4LRSA 4AUBA 4H7CA 2YCJA 4RNIA 3CQHA 2V3GA 4LCSA 3BC9A 2HJPA 4GZEA 1Q4NX 4XAFA 1ICPA 5C2CA 3MSGA 1UR2A 3SCVA 1VRDA 4U31A 3VX0A 4L7ZA 2A4AA 3HQ1A 3UBPC 2VXNA 3U8GA 7PTDA 4Y6GA 1NAL1 3NWRA 2ZWZA 3N9SA 3W73A 2O9PA 3RPMA 1FP8A 2NUXA 3GVVA 4C5ZA 1QR7A 2WAGA 3BZJA 4NZ4A 4IMFA 1W1YA 1H2JA 5IHRA 3V1PA 3HQOA 4QG9A 1EJ7L 4RNJA 2BOFX 2FVKA 2GK1B 3UVIA 1E0XA 1WAWA 3FV9A 4INFA 3H12A 4S23A 4EPEC 1KO0A 3CZLA 4FXRA 1OT2A 1BKHA 1OVDA 3TMQA 3H2CA 4ZQPA 1T40A 1FWCC 5CPOA 2V3EA 4WJ8A 2C0AA 2HS8A 2NUYA 1ESWA 4KWWA 3MY9A 3G1HA 1SVDA 1TVNA 1QI5A 3C3NA 3UU0A 4LY8A 1DHKA 2J7DA 1QTWA 4PBEA 4AZCB 3VOCA 4GG9A 5FJRA 4IGMA 1JRBA 2AL2B 3S5OA 4QLLA 3TA9A 3MV11 1ALDA 2A6LA 5FD0A 4HCLA 1LT8A 3CMGA 4PL1A 1OG0A 2ESCA 2VWTA 4HNLA 2Y85A 4Q8WA 1PWLA 3W7HA 1RV8A 4FX7A 3NO3A 3S1GA 4XB3A 3KOYA 3NURA 2WW5A 1RJPA 3H24A 5CQ1A 6TIMA 3CV2A 3BURA 5GVJA 3WDPP 3AROA 1DKWA 1FOBA 5A6SA 3WD0A 2JF7A 4WXYA 3O2LA 1PKNA 3PZTA 7REQA 1UQZA 3KL3A 3L4TA 2CFFA 3UYIA 1O5XA 1TWWA 2WJDA 3LD5A 3WBAA 3M0IA 1P1MA 1QAPA 1V5XA 3QQ0A 3VZZA 2FVLA 4AMAA 3KHJA 2QPSA 3THQA 3W37A 1DV7A 2G3FA 3L21A 1T8XA 5HULA 2E25A 1BGAA 5C55A 3VXGA 5LIYX 3SUUA 1BSIA 2ZX6A 3R43A 1UJPA 2I1OA 1SJDA 2TRSA 1VC4A 2IUZA 3BVJA 3CPUA 4IT1A 3KZPA 5AYYA 3CLWA 1E4IA 3ES8A 3S2MA 2Y4SA 1GG1A 2ZXBA 1H5YA 4HMDA 4AB4A 5DANA 1T96A 1FKWA 1WUFA 3RLHA 3EDJA 4IQLA 2DEPA 1UR0A 4C6CA 4GINA 2ZC1A 1K9FA 5BWAA 1JPDX 4DVOA 3NYDA 5AHEA 5LHFA 2RFGA 4C6JA 5DF0A 3W7RA 1EP3A 2Z2BA 1JDEA 2PDQA 3AHXA 3VOIA 4QJ1A 1U33A 2VTFA 1E55A 3DGRA 1EC9A 1KFWA 1GJPA 3ABQA 2VO5A 4JD4A 1XIMA 5FAJA 4Z2LA 1VP5A 4KCUA 1EIBA 3O07A 4F2UA 3TQVA 3N3TA 3KVMA 3HG3A 1BG9A 3WG6A 3B40A 2CW6A 2IXUA 1R3SA 2E67A 1X1NA 3HG5A 4HK7A 5GNYA 4GIRA 2BGNE 1O4UA 4MDPA 1LQ2A 3PTKA 3TOYA 1QNRA 4HZ6A 5BXPA 1VCGA 3L4WA 1UQYA 2D69A 4NI8A 3FSUA 3NTYA 4L6DA 3R8RA 1QNQA 3LK6A 4DPPA 3VINA 1ZU8A 3IIXA 2DSVA 3PTQA 2VD9A 5CJNA 3VD3A 3W0KA 4DWSD 3FVMA 4JFTA 4AZHA 6PTDA 3G18A 2WWCA 3GVRA 3R13A 3M5VA 1M68A 1TFVA 4WY0B 2WSYA 3W87A 4QRNA 4Z2IA 5CGMA 1U5JA 4OOZA 3BOXA 3EDDA 1R2TA 4NJGA 4Z1CA 1V3KA 4GI9A 1JFHA 2WVSA 1W17A 4K36A 1ZPTA 5KTLA 1XH1A 2P53A 4UBPC 3NYZA 4GQRA 2B7NA 3GX9A 1EYWA 1OD0A 1M01A 1UWTA 1Q65A 3TYCA 3GW3A 2Y6ZA 2OOGA 2C3ZA 2EPHA 3ES7A 3K1DA 2PWFA 4OFCA 2W4XA 3RPDA 3VD7A 2OX4A 4PC8A 1IEWA 4XSMA 1M9HA 2VC7A 2EXOA 1UYQA 4A22A 4S2BA 4FO4A 4H9XA 1LG1A 1EDTA 2D20A 2VR2A 3BTNA 2GUBA 4PFHA 3S42A 4FNSA 3FYOA 1BKSA 2OT1A 3VNKA 2BOEX 4GLEA 3OLDA 4S3KA 5A95A 3LTSA 2QXWA 4HQVA 2Y63A 4IIFA 2HXTA 4L4MA 4MNJA 3VFLA 1M41A 2PP1A 3GM8A 4A21A 1ZJAA 1EGVA 4Q4KA 1HTIA 2YX0A 3AMLA 3VMOA 2QGYA 2XM1A 1XW8A 4CCCA 2O4MA 4JPGA 3IV8A 1S39A 3ZR6A 2OSYA 5HANA 4HOWA 2QMJA 3WD1A 4CQAA 5FJIA 2QYGA 3VGBA 2DFAA 3A3HA 4W7WA 4Y9NA 4W4QA 1IT0A 2V8ZA 4NZ3A 4HHPA 5D2XA 2G8ZA 2W79A 3BAKA 4KWOA 3H7VA 5BCAA 4R7OA 1X6LA 1VJIA 1JF5A 5HJYA 5ABGA 1W3LA 7ENLA 2CESA 3SADA 2PGEA 5I7GA 3KAOA 2VURA 1W1A1 3FNDA 4JCMA 3NSXA 4LAZA 4QTGA 4ZMGA 3ZIZA 2AQOA 1X7IA 1KXQA 4Q4QA 3T4WA 1AFSA 4AY1A 1PIIA 2Z1KA 1B3WA 3T05A 3W9ZA 1FWBC 3EX6A 2PFHA 1PTGA 1VGAA 2PD5A 4D8LA 3WLKX 3PY2A 1S1PA 5G4EA 4XKYB 3RJXA 4KEMA 2OG9A 4O4WA 4LF2A 3FK4A 2Q09A 1KM4A 4HPNA 2GGJA 3PZMA 3W29A 2RDTA 2X30A 3VGGA 1GVIA 4W93A 3IVUA 4GYPA 3AWOA 2F61A 4RXGA 1Q6GA 2VEPA 4JIEA 3MANA 1VBGA 1IEVA 1TWZA 1XRTA 4DLFA 1VRXA 3CPRA 3UXKA 1EO5A 2HPIA 1MW1A 2EGZA 4PMUA 2PU0A 1KGUA 3PWIA 1K8XA 1IGWA 1YRRA 1VB9A 1NQ6A 4MFEA 3OLIA 1D8CA 2ZXAA 3U6WA 3IUHA 1QI4A 2VC5A 2JALA 3LN3A 2P3EA 4UCFA 2QAPA 3EWBX 4B9ZA 4DO4A 4DBUA 3W3OA 3G1XA 1OGGA 4LSBA 2WPGA 5HNRA 3C5QA 1XLLA 3MJMA 5FEWA 4JTQA 5E9AA 3S3GA 1PAMA 3W38A 3K1GA 2VRKA 2REQB 4NJKA 4IP7A 1ZALA 3GUWA 3M64A 5IXEA 3WEZA 3U9IA 5D2VA 2D1ZA 3AHZA 3TJ4A 1TMHA 1F6KA 2X2YA 3GTNA 2EPLX 5TQLA 1SSDA 1VBHA 3LLFA 4GY1A 4GY0A 5CSYA 2OTDA 2PCQA 1JPMA 4JS3A 4YIWA 4UWMA 2HXUA 4ML4A 4CLMA 5B80A 1D3CA 2GUYA 4XUGA 2WHKA 5HNTA 1XIJA 1XFBA 3APGA 4TU1A 3FIGA 1Y8BA 4HZ8A 1ZS2A 3N19B 1XLFA 3TAOA 4AXKA 5CSRA 3T0DA 1T0OA 2OEJA 4CD7A 3G3DA 1KV8A 1Q6QA 3IWPA 3KOXA 3FGCB 1VYRA 4LJ3A 3TYBA 2NSOA 1WZMA 1OZMA 3IPWA 1UR3M 4RZ4A 2OODA 3RCNA 3DX5A 5CSUA 1AD4A 5EMJA 5AFDA 3GYEA 2J25A 3PSWA 4JNMA 1D7KA 1U83A 3IIZA 1ZJHA 2PBOA 3AYRA 2G37A 4UNKA 1KLZA 1IV8A 4LCRA 5A8QA 1IWAA 4IFKA 1Q6DA 2CLOA 1UC4A 3TXVA 3DG7A 1PPIA 4QSHA 4KESA 1VH7A 3EAUA 3GFZA 1KBJA 2O7SA 4S3CA 4H9ZA 4AZ6A 4GUHA 6XIMA 1XV8A 2XIOA 3RK8A 2VDGA 4ZSUA 1GVEA 3CV1A 3QHMA 3A4XA 2WNQA 8TIMA 3ZJ6A 1Q2RA 4JTTA 1HIZA 1R3VA 2VRJA 1A3HA 3WEOA 4S2CA 3TH6A 2V5BA 1GW9A 1OFQA 2VM8A 4L56A 4DF1A 3RNDA 2XGZA 4W87A 4GXWA 4ERGA 2F9RA 3VD4A 4GC4A 2J13A 4H8HA 1BRLB 4Z1YA 3F7JA 1EC7A 1REQA 4PRTA 4AD0A 5CEWA 3QR1A 1GJUA 2FTYA 1TJRA 2DV0A 2QV4A 4M51A 4TX8A 2C91A 2ZRXA 1TJ0A 1H7XA 3B05A 5FF2A 3SW6A 4AEOA 4CQ8A 5IBXC 1CBGA 4FX6M 5DT5A 3TWBA 1ECQA 2F38A 4IM4A 3RM4A 4CNSA 3S5YA 1JPIA 3N6HA 3R11A 4MB1A 4AYSA 3T6CA 5EMYA 3IIPA 1DIKA 5M2FX 4UFIA 4O13A 1O95A 2D2HA 1ZENA 3W2KA 1BEUA 4UR7A 1GYNA 1E6ZA 1XIEA 2H9AA 1B9ZA 3QY8A 3QKZA 3H22A 2G5WA 3F5LA 1H62A 2DH3A 3SCSA 3C56A 5A8GA 4BI5A 3GK0A 1G4PA 1DOSA 3ARZA 4WKAA 1ADDA 2V2HA 3KP0A 2J78A 4XZBA 4J3UA 3C2EA 4NAFB 4F3HA 7XIMA 3HO8A 3TFXA 1BWVA 5CSSA 1RQBA 3MWAA 3PUOA 3PANA 4B2DD 1GJWA 4JL2A 2GVJA 1EBGA 3GNNA 4FOUA 1V79A 1RA5A 1SO3A 3A9BA 1F2JA 3LNMA 3ECQA 2Z1WA 3EB2A 1YTDA 3MMDA 3PFMA 2QCMA 4UC5A 4I5XA 3VO0A 4E38A 1DWFM 1RD6A 4U10A 3ARWA 4FA3A 2W0UA 4O28A 3I3DA 3L0GA 4G2DA 3SFWA 1KV5A 4IMEA 2PDYA 1TV2A 1T99A 3N6QA 3NZGA 1RBLA 3O8AA 4EK7A 3LCGA 4V33A 4LU0A 3SQLA 1VFSA 4YU1A 2YCLB 3IJDA 3RDKA 3H2EA 3AMKA 3WLOA 2YJQA 2WNWA 5DQPA 3M5ZA 1G7VA 2V81A 3HA1A 1POKA 1E9LA 4IQDA 2P10A 4NYUA 3MB9A 3G1SA 1BWKA 3R58A 1ME7A 3RPTA 3N73A 1FHVA 1I2PA 2VFEA 1TTJA 5HJXA 3PZOA 3VCRA 3QHNA 4FR1A 1NF7A 3POCA 3LPPA 3GSMA 3EMZA 4S3FA 3FXYA 5E0FA 3L65A 3MHUA 4AD5A 1JI2A 1GHSA 2PRLA 5L9FA 4LVAA 2VOMA 2J7BA 4LAKA 2BXZA 1N55A 4F0LA 1P7TB 1XS2A 5DBUA 4PTDA 4E4PA 2XIJA 3NQ7A 2QAFA 1VFLA 1FHLA 4ICMA 1SMAA 2WOQA 4UOZA 1UR1A 3UVAA 3AS0A 2Q02A 2VMFA 3BAIA 1H49A 2OPJA 3TVAA 2H3BA 3CIXA 4QIUA 3W7LA 4BQ3A 3E0LA 3P3BA 4PTXA 3UWWA 3VKCA 1E0TA 2FTWA 1OABA 4A2SA 3EKGA 3O16A 1D2KA 4GI4A 2OQHA 5ABHA 3BDKA 4F0RA 1G0CA 1AQFA 3W1RA 3MSYA 1VFMA 1LRNA 2VZTA 1PE1A 4TV5A 2YXGA 3L7RA 1ZQ5A 4N6EA 4JTEA 3S5NA 1E6XM 3CUZA 2PZNA 3HG4A 2BVYA 4JIHA 4L1WA 5ABFA 3VM5A 2F6UA 4B4HA 1TE6A 1W9VA 1FCQA 5CC3A 1XXXA 3UG3A 2XVPA 4NZCA 3IIVA 3SJNA 5XINA 4UQ9A 4AFYA 1IQ8A 2NT1A 4IX2A 1OFDA 1X8FA 2Y7DA 1LUCB 1FH9A 3AIBA 2E5DA 1ISWA 1EX1A 4QX4A 1KBIA 3WL1A 5G1YA 4H6KA 1XISA 3H7UA 1X7FA 3O06A 4I90A 3LBOA 1J79A 4DJDC 5HOSA 2X42A 4M1BA 3TN6A 2QDDA 4KH2A 5C9ZA 4ZOAA 4FNTA 3PBUA 1DP0A 1TO3A 4PCFA 1KRCC 4QBXA 3HQPA 4HP5A 1Y7VA 4LF1A 5FJJA 4BWLA 1J18A 3FHQA 2OLSA 4C7GA 1W31A 1E0WA 1JVNA 3IGUA 2ATMA 3DFTA 1V8EA 5KITA 2QCCA 1H1NA 3B06A 2FHCA 3G8RA 5KZDA 4TX9A 5HPCA 1UJQA 5CZJA 1MYRA 1YPXA 1TREA 1SUXA 4AZGA 3LMYA 1XINA 3WMSA 1KCZA 4DI8A 3ABSA 3A64A 3FJNA 4PL2A 1H7NA 3UR8A 1CEOA 3SIMA 4YCOA 1UWUA 3AMGA 4HNTA 3OA3A 3EDEA 3IIOA 4M6QA 5F1UA 3WLQA 4QS5A 1W3KA 3SGZA 3A4WA 4LUSB 3WQOA 3SCUA 4KCVA 2XFFA 4V1YA 4PZVA 2ZYFA 2VZUA 4MJ2A 2EPNA 1ITQA 4DY1A 2OLHA 4XVDA 2CLHA 1K4HA 3VIOA 2EQDA 1OX5A 4D8ZA 5FEPA 3TTSA 4ZB2A 3IGHX 3DENA 4GC3A 2HE5A 1FWWA 4DWSB 4KERA 1H3GA 1KR0A 3MT1A 5AZ0A 4HCDA 4A6GA 4DWDA 1I1XA 3N04A 4PMOA 2D73A 2Y8VA 1OK6A 4MB5A 5I03A 2C15A 4DZAA 2WMKA 4NZFA 3M44A 3GIQA 3UXIA 4G5DA 3CK5A 3O6YX 5KEZA 1U2YA 1OX4B 2VEMA 2Z28A 3W23A 2F6XA 3NSMA 3WO8A 3WQGA 1XGEA 1OCQA 1NFGA 3E0FA 3GU1A 1HW6A 1CNVA 1XSIA 1VEOA 1EQCA 1QPNA 1L6SA 1KGWA 5LIKX 2WJFA 4JYDA 3LM7A 4CEUC 1EJSC 4KFNA 1FDZA 1FWFC 1NM9A 3ZR5A 4TTGA 1CXIA 4L61A 2ZUVA 3ZLGA 3NL5A 2J7CA 4KEZA 1E1CA 4ACZB 4Z0JA 3RX4A 5I3KA 4DJFA 1TVLA 2YKKA 3WQFA 2YSWA 4S3EA 2CLLA 2YL9A 4IG2A 2Q3OA 2G96A 4RL3A 4CQ9A 3AIVA 3O7UA 1NOFA 3G5EA 4KIEA 1LBLA 2OKOA 3TW7A 4U2YA 3LQGA 1RCQA 2YL6A 3SCRA 2E1WA 1HUVA 4W7UA 3H7RA 3ONBA 4LGXA 4NL1A 4DF2A 1H0IA 3OG2A 2VYOA 3BPWA 5D2WA 2CC0A 1EHNA 1WZKA 2Z0IA 4J4KA 4Q33A 3SUTA 3OVPA 1IE7C 2V2CA 4AHOA 4A3RA 1DTUA 3EA2A 2GVLA 2Z1VA 3S0CA 4ZOCA 1SR9A 5CG0A 3WH8A 1K6WA 3VX1A 4YTRA 3O6DA 2Z24A 2NXHA 1L6WA 2VZOA 3N9RA 8XIAA 2FMNA 1I60A 1BF2A 4OE7A 3P82A 4M82A 1JZ4A 3QOMA 1C8VA 1ZBVA 1BTMA 3BG9A 2F2KA 4FX8A 4OUIA 3S9YA 1QPOA 4GVHA 3P84A 3T08A 2PF0A 1S2WA 3L12A 1K7FA 2VFDA 6A3HA 2A3CA 1EQPA 4QDWA 2RKXA 4YWIA 3W02A 3BK0A 4WSJA 1E9ZB 2V5CA 3LHVA 4ORMA 5GQBA 2R6OA 3MYPA 2E1DA 2PC8A 3UGVA 4FS9A 3NUKA 2PDWA 2RGLA 5K2ZA 4S39A 2QDHA 5D2TA 2EG7A 3T07A 1TE1A 4IGHA 3LHWA 1EJVC 4Q8NA 1V3IA 1W8GA 3LHUA 3M0LA 1FVPA 3WLSA 3SCQA 2BXVA 2CNCA 4OQVA 4REQA 4M3PA 1TWDA 4ERAA 4G56A 2Y88A 4PBGA 1U5VA 3BO9A 4WUIA 1FRBA 1XIBA 3ONCA 4LUYA 2I5QA 4JKLA 3BMXA 1DHPA 5I2UA 3RFAA 2DUAA 3Q4DA 4LUIA 2BGQA 1VLWA 3VOHA 3B8TA 3PNZA 4L6HA 2DU2A 3NVTA 4MIMA 1GOOA 3GXDA 1XDLA 3QPYA 3SECA 1POJA 4NSBA 4TIMA 2ZQ0A 7A3HA 4BK9A 2CERA 3DI1A 3WFAA 1FH8A 4U5KA 1JYXA 4ZB5A 1M7XA 5FEXA 2DSWA 1BVNP 1EWEA 1TRDA 4ZTYA 4ONVA 2I16A 1OIFA 2QCNA 1Q6LA 4FXJA 4KT2A 5BOEA 1EPXA 1PS9A 1Z3NA 3L4ZA 4Q4MA 3IAQA 2DJLA 1ME8A 4F0MA 3MSDA 4Q8TA 4JFWA 3C2RA 4Q7BA 4GYFA 1EJWC 4HGXA 4AEFA 1S3HA 2V2DA 4QCFA 1XSJA 2V30A 4PBFA 1PX3A 4HHMA 1ISVA 3XIMA 1EF3A 5KZEA 4PN2A 3WENA 2VDHA 3UZYA 3VNJA 1ZL1A 1TYGA 2BODX 3M1ZA 1G94A 4HU4A 3CASA 3ITCA 4WY0F 4QGCA 1FCUA 1SW7A 3QMTA 4FNQA 4DAFA 3QTPA 1FWNA 2WM0A 1E51A 4O54A 2X0YA 3WBXA 5DRCA 3WF1A 3RILA 4L80A 3NA8A 2BHYA 2C18A 4O57A 4XAZA 1W9PA 4CKQA 1JRCA 1KW1A 3HBLA 1A0EA 4PSPA 1Q3NA 2CBJA 5D9MA 3EX2A 2G4JA 2FH6A 3TTOA 3WK2A 3WMCA 3FX4A 2OZTA 3BMVA 3HJZA 1IXNA 4R5EA 3MP3A 3BE7A 1PJ9A 4HNOA 1E6NA 4XIAA 3VNMA 1JDDA 1EZ2A 3GIPA 4AH7A 1EWDA 6TAAA 1M1BA 2YXXA 1W9UA 1JQVA 2ZZ2A 1V7AA 2E3ZA 4AY7A 2X09A 1XCXA 1M03A 2TSYA 3LLXA 4GIEA 1IYXA 3LCIA 3M7SA 4J2MA 7TAAA 3DFHA 5XIAA 1TCDA 3K13A 4JY9A 2XIBA 2QLYA 1F73A 4A35A 2IXVA 1ME9A 7ODCA 5A8MA 3R8HA 3W2LA 3RCMA 3PB2A 4GX8A 3FY1A 1JDCA 1XD1A 3QW3A 4J3XA 4PEEA 3PP7A 1SZEA 2DVXA 1RCOB 1YLVA 4LS0A 1OD8A 4JN6A 3NL2A 3ZJKA 1BXBA 1D3HA 4LBUA 1I6NA 3GLCA 2PGFA 4U28A 4PMVA 3RMEA 3R0KA 1ENUA 3P62A 3N15A 4H7ZA 4AWTA 5D9OA 4WHBA 1OZQA 3OB8A 1AW2A 3W7PA 1CLVA 1MMFA 3WBEA 4U2ZA 5BWFA 3GUGA 3IVTA 3SY1A 2WC4A 1WKEA 3S46A 4ADUA 3T0CA 4H04A 3UG4A 4MAZA 1WKFA 4W8BA 3I10A 4O1DA 1BYCA 1BYBA 1Y5XA 1MXSA 2XJ7A 3KL5A 3QN3A 4LTSA 4Y96A 4I7UA 3SURA 3VIKA 3ZT5A 1PDYA 2C79A 3NL6A 4AZCA 3WCZA 2TMDA 2TYSA 3JVAA 2AL2A 5AB3A 4BR1A 3TSDA 4AWSA 1EOMA 2FPYA 6ENLA 1LYXA 2A79A 4OU1A 4AHPA 1A5OC 2PLJA 4IPPA 4LUJA 1DIOA 4S3AA 1B3YA 4AZ5A 3C3UA 4LVGA 4XBJA 3PZGA 4N02A 1ZBKA 3TUUA 3I3EA 1A53A 5M1TA 1RQHA 3WH6A 1UWAA 5FOOA 1A50A 5HWNA 3N6JA 3EOEA 1X6UA 2RGMA 1HFBA 2XSBA 2GJLA 3QGKC 4NNAA 1TKKA 3DOPA 4YMZA 1ML1A 4JICA 3FVDA 5H8UA 4H1ZA 1WDQA 4ZA0A 3CH0A 4FXFA 2G3JA 1UH4A 3LI1A 3W26A 2I14A 2J8FA 1VIWA 1HL8A 3LU2A 4K8HA 3WDIA 5BNKA 3VE7A 3CZ8A 5AHMA 3W7OA 2CHNA 4WOQA 4FLOA 4P8VA 3DKJA 4YLWA 4C91A 3UY7A 1ONEA 3GXIA 1TZ9A 4XVEA 4OIFA 1Q8AA 1LOSA 3GXTA 3UZXA 1MEIA 3GAYA 5BRQA 3HM7A 2GJXB 1HN1A 1JCXA 3GO2A 3PHAA 2DZVA 4H9TA 1AG1O 3H55A 4DJEC 1F07A 2OWCA 3WQ6A 4JEJA 5CC5A 2VD8A 3VKBA 4UTUA 3DHUA 2BVWA 2DZUA 4L1XA 3LQLA 1OK4A 2VFIA 3G1AA 3CAQA 1O1HA 1J6PA 1V3JA 1LF1A 3FSTA 1U30A 3GXMA 5REQB 3MWCA 3MVIA 1D7FA 1KD0A 3BV4A 4MY8A 4X9YA 1UPMB 2PGWA 3S1UA 2OZ8A 3WQCA 3KOZA 1H51A 1WXZA 2BFGA 4WRHA 1R30A 1VR6A 3LOTA 4PMRA 3NQGA 4LVBA 5AHLA 4E0CA 3COTA 4O18A 3L4UA 3LZ3A 3U2EA 1RBAA 3BUVA 1QHZA 2J9XA 3W2NA 4YVXA 1TX2A 3PPFA 4P7OA 5SWUA 4GE8A 3MDUA 3DAQA 4QDPA 1GTEA 2PMQA 2VFHA 1XIGA 1DEDA 4JY8A 1XBYA 2FMOA 3GWQA 4HOZA 4RZ5A 1A80A 3Q94A 1RJRA 4ZO9A 1GUVA 2YPIA 1QPQA 1GEHA 3WJSA 4FB7A 1VPQA 1EZWA 2UY3A 4B5XA 3ANVA 4WY0A 3AJXA 5LNVA 4XBKA 5EA9A 3MS8A 5LNUA 2GL5A 5G2IA 3KVJA 1GONA 4GQBA 3UZWA 2HRWA 2J66A 1PXGA 5CZKA 4Z1DA 4PODA 4LAOA 3CIWA 3MW7A 3HJEA 2AAAA 1L6FA 3UWEA 1CXHA 3ANUA 1VBJA 1BVWA 5BROA 2NX1A 3P80A 1IT7A 3HGOA 4GRSA 1JF6A 3WUFA 3H8AA 1XG3A 1XWYA 1KB3A 1SJBA 1JIBA 4JR5A 4LH8A 5ABTA 3C52A 1TWSA 2PGRA 4DBEA 1FWEC 3WF4A 4PGLA 3HGSA 4RE2A 2W67A 3GTFA 4BCEA 5C9UA 1YQ2A 2D0GA 3GH5A 3RRAA 4GJIA 4F0KA 2W92A 5I02A 4XD4A 3TROA 3A23A 4WSKA 1RVKA 1XUUA 3REQA 2YA2A 4HCHA 1YADA 4C1LA 1G01A 1HO1A 3IAPA 1PV8A 2VT0A 2W3ZA 1TQJA 3PAOA 1JD7A 1R5YA 1XLKA 3IRDA 4RX0A 1A5AA 1QW9A 4FIQA 3E02A 2JEPA 4GO9A 4NZ1A 2C16A 5MF5A 1Y65A 3QVQA