3VOGA

Catalytic domain of the cellobiohydrolase, cccel6a, from coprinopsis cinerea
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
362
structure length
362
Chain Sequence
VPSTGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
molecule keywords Cellobiohydrolase
total genus 137
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3vogA00
1OCBA 4B4HA 1UP0A 1QJWA 1UOZA 1HGYA 4AX7A 1OC5A 1HGWA 4AVNA 1OCJA 3RU8X 3VOJA 4AVOA 4I5UA 2BVWA 1GZ1A 3VOGA 3VOFA 1OC7A 4AX6A 4AU0A 1UP3A 2BOGX 3VOHA 2BOEX 4I5RA 4A05A 1OCNA 3RPTA 1DYSA 1QK2A 1QK0A 2BODX 3A64A 1BVWA 3ABXA 3VOIA 2BOFX 1CB2A 1OC6A 1UP2A 1TMLA 3A9BA 4B4FA
chains in the Genus database with same CATH superfamily
5CLTA 3ATZA 3ZFHA 2ACQA 1SW0A 3H26A 1XWYA 4PMDA 3KRUA 4UR8A 1S38A 5K7JA 8XIAA 1ZL1A 2WVVB 2YSWA 4R7OA 2VMFA 3LLFA 4MADA 3RO6A 4TTGA 3EDDA 1Q66A 1C8QA 3P0WA 4AVNA 4NJKA 3MZNA 1WAUA 4W84A 4FK9A 1REQA 2CW6A 4IMFA 3TMQA 2WMFA 3NPVA 1OZQA 4IF2A 2ON3A 4GPNA 2X2GA 4NNBA 5T26A 5BXPA 4YTSA 2GJLA 2J7BA 3NL5A 3EX1A 2J78A 3RU6A 4LYKA 2QIIA 2Q09A 4A8LA 4UOQA 1EHNA 1IGWA 3AIRA 3EMZA 3R6IA 4QG9A 1S39A 1OYCA 3IIOA 4PTWA 4L1GA 1V7YA 1X6LA 3GG8A 1CGWA 2NQLA 4XZMX 3BSHA 2XH0A 3HA1A 4GZ7A 2VI0A 3NURA 3MUIA 2VEGA 2JALA 5HPCA 4ERGA 3I3DA 1BVNP 1UPMB 2J9YA 1XD0A 5AFDA 1JUEA 1H5YA 3WD3A 4M6UA 5EMLA 2ZYFA 3W24A 2C0AA 3TVAA 1EIBA 4UZUA 2AL1A 4WDWA 1R6WA 4BI7A 1RQBA 3GYCA 1EEPA 1XLGA 5D2XA 4PGLA 3LZ3A 4CNPA 2OWCA 2INFA 4ROQA 1NWRA 1SJCA 4LBSA 1UIOA 1FA2A 3UJ2A 3MDUA 1YXYA 1QK0A 1P0BA 3G77A 4MLJA 1CB2A 3WQCA 5M3WA 1L2UA 1GYLA 4MF4A 4LXFA 1G7UA 2GJPA 1O94A 3NQDA 2W61A 3UPBA 3UR2A 4UTKA 4MWAC 4JTKA 4P7NA 2B7QA 4TV6A 4EX4A 4ZQPA 4H7VA 1K4HA 4F3HA 1IEWA 2ZA2A 3COTA 4KFOA 4JTAA 1PCKA 3W7KA 3ABSA 1K1DA 3M5VA 4XD6A 4F2BA 3RJYA 1QWGA 2INZA 1PB0A 3A24A 3WDHA 4LY4A 2CBJA 3PPGA 3W9ZA 3GXIA 3GE7A 4CU6A 3GXDA 2KAUC 4B3LA 1BGGA 3FSUA 1PIGA 3MI6A 2V38A 1JD7A 2OELA 4V1YA 1TSIA 1TE6A 1TV3A 2Y6ZA 1XYFA 3NSMA 4B90A 2X05A 4H7CA 3FX4A 4O12A 4XD5A 3N6HA 3GD6A 4MWAE 1VGAA 2PTDA 3VILA 4N4PA 3NO1A 4LANA 3K1DA 1E6NA 2W66A 4KWUA 2Z1KA 5J5RA 1TJPA 2WSYA 1VFOA 1TMHA 3CMJA 3TSBA 4ZOEA 1YKWA 1RXOB 4GH1A 1PZ1A 3QR0A 3DESA 3N15A 4IGHA 5D02A 3T44A 1XISA 1R30A 1SU5A 3WUBA 3N12A 5A6KA 4M3PA 4Z42C 3OLDA 2BXZA 4HMNA 3BICA 1OGBA 2DVXA 3CYVA 3P82A 1QAPA 4DWSB 3ID7A 3WK3A 4P8XA 3NAVA 2OPJA 1BGAA 1GPWA 2IKHA 3LPOA 4GUHA 4G7FA 1T40A 1KW1A 3UERA 5I24A 1GPFA 1QHOA 4Q6JA 3BQ5A 4B3KA 3O05A 1KR1A 4QCEA 1RK5A 1TPFA 1ME9A 4S3EA 3T1GA 4XUYA 4OBRA 1V79A 1OY0A 3GKFA 2C16A 5G4EA 3G1HA 1GOWA 5RUBA 1LRNA 3CH9A 4FLSA 4DWSA 5I02A 4DB7A 4MJMA 1HGYA 4ZQOA 3FW6A 2ACUA 3AO0A 1SZGA 2CC0A 4K3ZA 4B5VA 4ACZB 4JNZA 3ALGA 1IXNA 4U3CA 3BZGA 3KUMA 4RCXA 1XFCA 4AF0B 2VHLA 1GOOA 1K7XA 1W8GA 3HQ1A 1KFEA 2TAAA 1LP6A 5E0FA 4P7QA 1N8WA 4GXPA 4EANA 2PWEA 2KZHA 2WSPA 3KE0A 4L7ZA 2NUWA 1NWTA 4EF9A 1QW7A 3NA8A 3R25A 2XGIA 3OTRA 4H8VA 1NDWA 3M0ZA 3UZJA 1RBLA 4QTGA 2V5DA 3M6YA 4IZGA 3UG8A 1Q13A 2GJXA 3D3AA 1KQZA 3GY1A 1ZBCA 2FFCA 1LG2A 3P2VA 4WIWA 1AA1B 5DELA 3UG3A 4PODA 3NZRA 2UY2A 2WOQA 4IICA 5BCAA 4YJ5A 3GSMA 1B57A 3MWCA 2PTYA 1V4YA 4ZE5A 1D8CA 2CFFA 3PTQA 2RDUA 3VX0A 2GL5A 4X60A 1GTEA 2PE4A 3RRAA 1QBBA 2YCLB 4PULA 3PK7A 4W86A 4C7FA 2I5QA 3SURA 2HK1A 2DSZA 2P0IA 3G1YA 3S6OA 2Y62A 3E0WA 4PMRA 5DBUA 1IEQA 4Q8PA 2WO5A 4K38A 4O15A 1MSSA 4LUSA 1QRQA 4HJWA 3ZJKA 1EBGA 3REQB 2PPGA 5LIWX 3W2LA 2VVSA 3IJIA 1OFDA 4ZO9A 3KVLA 2V5BA 2WZIA 3W1QA 3LGEA 1DP0A 1YNQA 2FTYA 4X3ZA 2CZDA 3TZFA 4H1ZA 5LHFA 3WF2A 3A3XA 1H0GA 3MPGA 3U4AA 1UYQA 2E9BA 4UTFA 1IZKA 1JZ5A 1EIXA 3VM5A 2XH7A 3WLOA 4H8UA 3CNYA 2V9DA 1A0DA 4X61A 4GUGA 3W84A 4OFCA 2ISWA 5T91A 2Q71A 4UFKA 3WMSA 1A49A 1O60A 2GGJA 1QVBA 1RCXB 3CT7A 4QG8A 4F2UA 3MV11 5HMEA 4GOAA 1ZBKA 1CXFA 3WCZA 2BY3A 2Q8LA 4Q6XA 1F8MA 1LOQA 2DZBA 3K4DA 4AWUA 1HQTA 1JGMA 4Y9AA 3FN9A 3TROA 3JR2A 2WKLA 4HU0A 3RN6A 4G8TA 1XYBA 1MQQA 1W1B1 3BG5A 3FCPA 3AIBA 2OWWA 4TTUA 3GDKA 1U1HA 3TN3A 1REQB 2IPFA 3RGTA 4PBFA 2OR2A 5HQEA 5E70A 3NVDA 3P7YA 3MUAA 3VMOA 2OSWA 3S1UA 4J3XA 3AMDA 3C0SA 2UY5A 1EO7A 4UFIA 2YGYA 9CGTA 2DT2A 1XYCA 1H3GA 1MDRA 1E9YB 3KBNA 3QMSA 3WQFA 3KHDA 1QR7A 4JPGA 4W8BA 5C9WA 3NVTA 4KIEA 2XN0A 3AHYA 1JR1A 1AQ0A 5E9AA 2EEXA 2NZLA 4FNUA 5CJ5A 5AC7A 5JBDA 1KM5A 4RZ6A 3BCJA 2X1SA 3BOLA 4MYXA 2NT0A 1NOFA 5AZ1A 1W3NA 1BKHA 1XR2A 3JU2A 4IP7A 2PBGA 4FHAA 1XYLA 2PTXA 2WCGA 2ZRWA 3F4NA 2CHNA 3VKAA 3W74A 3MJYA 4BHYA 1Z9AA 3N2CA 1P7TB 5F4WA 2VUNA 2VZOA 4I3GA 1OM0A 2ALDA 4JTTA 1JDCA 1L9WA 3F4CA 2VZVA 3WO8A 3W25A 3BLLA 3FJ6A 2XVLA 1LLWA 3HPFA 2E5BA 3CXOA 3LERA 4JOMA 2FPTA 3EMQA 4UOJA 3PFRA 1QOPA 2A3EA 3VD3A 1K8CA 1Z8AA 4J3WA 4HOWA 5M03A 1TV8A 3QFWA 3CV7A 3SM0A 4L9ZA 4DJDC 1E72M 3ZR5A 3KOYA 3P5YA 3GBEA 2ZQ0A 1DL3A 2RH9A 4GQBA 5L6UA 1IV8A 3S6DA 1CIUA 5HATA 2WMIA 4INFA 1LORA 4NP7A 2OTDA 3VIMA 1AW5A 3CC1A 1UPPA 3NQVA 2EPHA 4GXWA 1L8PA 2FZBA 2VL4A 1UR4A 4UTLA 3CPGA 4WHBA 1PE1A 4GC4A 1YBQA 2YZRA 1C8VA 4S1FA 5C55A 1DXFA 3QFEA 3ARYA 3FA3A 2OU4A 3IJ9A 3N19B 4H6EA 1TCDA 2V3FA 1XIIA 3XINA 3SN4A 3SGGA 3PF3A 4Q8WA 3N1AA 3TOYA 1KM3A 3AXKA 3CUIA 5I6SA 3CQHA 3E0VA 4H04A 3AYRA 4KBXA 1UKTA 4DJEC 1DXEA 3PWIA 1XLJA 2GJXB 5DMMA 4EPDC 1Z3NA 2XU2A 3QHNA 3E6EA 3FDKA 2GJNA 3M4HA 3H22A 2H8XA 2GSJA 3EX2A 4PCFA 3Q2DA 3QZ6A 4N02A 3KL5A 4ZBCA 4JTIA 2ZUSA 4FOUA 2VCBA 4ZO8A 4PC8A 5C0QA 3B9NA 4O54A 2YA0A 3GTIA 3T6CA 2EPMX 1TPEA 3WY1A 3R4IA 1JQVA 4QGCA 1FHDA 1KLZA 3GVRA 3WJXA 4AHPA 1F3WA 1POJA 3UP8A 1TZ7A 3NWRA 3T07A 3UGVA 3MO7A 2HCVA 3QF0A 1KWGA 4NSBA 2VGIA 1V3MA 7ODCA 2IQDA 2W79A 3PBWA 5LYRA 1UCWA 5C54A 1QOXA 1XRTA 5FA5A 1EJUC 4O1FA 4FIRA 1FOBA 3VGFA 4GO8A 1RR2A 3A4AA 1JAKA 3B4UA 4FSAA 1W9UA 3TAKA 3W1MA 1HKMA 1Z6KA 2P53A 5FL1A 4PYSA 1JCLA 5FF3A 3ZIZA 4DO7A 3VI2A 3UWEA 2FHBA 3U5YA 2DUXA 2E25A 1MW3A 1T6MA 3B8TA 2XH2A 1GYMA 4HSNA 4DO6A 2D69A 4L4OA 3NL6A 3P84A 2YCIX 3T05A 2GLKA 3NOEA 1SZRA 4WY0A 4Y9MA 4XUGA 1TV4A 1RVGA 4FA3A 2PTWA 4AY7A 4XWUA 2PDQA 5IOBA 2ZFAA 1P0DA 4O1EA 1QK2A 4WOZA 1DBTA 3HPSA 3ITYA 2B31A 1MXDA 1UKQA 4EVZA 1KM6A 1TMQA 3IACA 4V28A 4REQB 2OB3A 4H19A 4LC6A 4DUWA 4FLQA 4FNRA 1ALDA 4H4IA 4W8LA 4HOZA 3FLUA 3NQEA 2ZZ5A 4CQ8A 1JGIA 2QCDA 4Y96A 1DIOA 1OF6A 2FZDA 1W91A 3DFTA 4CNOA 4WD0A 1Q7MA 4F66A 3BG9A 1HJSA 2F9RA 2OQHA 3WLMA 3AQUA 3GFXA 2B7NA 4O4VA 4JTUA 3VIPA 4EAMA 2ZOXA 4PBGA 1KO0A 2ZE0A 4XV0A 3GDMA 4FS9A 3PSVA 2CEQA 4IOTA 3GHTA 3KCOA 3GH5A 2E5CA 3WUGA 5FF4A 1IXPA 5FF7A 1KRBC 3HTWA 4LNYA 1IEIA 2H3DA 3EOOA 4YTRA 3ES8A 4M82A 3H2MA 3URBA 4WDUA 4OE7A 3NQ8A 4AD1A 4U5KA 5G2IA 3M16A 5CZJA 1PO9A 1TJ0A 2E0PA 4LUTB 1FQ0A 1HKVA 1QW9A 2J7GA 3L0GA 4BKNA 1Z41A 4CKQA 1B3WA 1J93A 2YL8A 1GHRA 1MW0A 4K8HA 4C90A 1YXCA 3W7RA 4JTEA 3WX7A 5AC5A 4F0MA 1DIEA 3S5SA 3WG6A 3KAOA 3UW6A 1R9XA 4BI5A 3AZTA 3F2DA 4HHLA 5I3IA 2YDSA 3QY7A 2R91A 1NFBA 3W53A 5A95A 2VOTA 4H41A 1XKYA 3LXAA 5BXTA 2R1NA 1Z42A 3RR4A 3GW0A 5IXEA 3TW6A 3SY1A 2YBTA 2GOKA 1ZP4A 1JZ3A 4HHMA 2J24A 2BP1A 4CQ9A 1M68A 1POKA 2PP0A 4CN6A 1HT6A 1PSCA 2I7GA 3G22A 4O11A 4HU3A 3TIMA 4ZCWA 1QUMA 1H5VA 1HL2A 3EBVA 4XBSA 4EPEC 2MANA 3O6DA 5DCDA 1SFSA 4ICNA 2XVGA 3UZXA 2DH3A 3UJFA 2Z1WA 4DUVA 5BU6A 2R1KA 3D3FA 1GOQA 4UXDA 5SWUA 3TSMA 3WDPP 1O5RA 2GQ9A 1TWIA 3CZLA 3VNLA 2RAGA 1SZNA 2Q8XA 2XTKA 3AMLA 3E0FA 1XXXA 3CUGA 1HX0A 1XKJA 2HRWA 1HKWA 4JYDA 3ZSTA 2OSXA 1QXLA 2VRKA 2RJHA 3QR1A 4CN1A 2FVKA 2TSYA 2CPUA 4LT9A 5A3HA 1EJWC 3PWAA 1EWEA 1CLXA 4W9TA 4N2YA 5HDRA 3MP5A 4FLOA 3KZPA 5XIMA 1B3ZA 2UY3A 3LXBA 3ZO9A 4WSKA 1EA0A 1VENA 1XGDA 3GXFA 4KGLA 1VFTA 3LNPA 1B3OA 4UUIA 3GR7A 2W91A 1EFZA 3G1DA 3GXNA 1KQYA 2AAMA 5HULA 4A4AA 1ZGDA 3QBUA 1JFHA 3LNMA 4M81A 4QNWA 3T0BA 4DF1A 3BLFA 4CNSA 4Q7NA 4OIFA 2Y5SA 1ZCOA 1R8LA 3S6TA 4BWLA 1PTDA 2PD5A 4IUGA 3SQLA 3LBMA 1VRDA 3HPZA 1KXQA 2QDDA 2D0GA 3VOIA 3W72A 4PMYA 2ZXAA 5A8PA 2QJNA 4LOCA 4ZXLA 5IFTA 3T2QA 1MMFA 3MO4A 1M7PA 5G1YA 2VFIA 4I5UA 1OIMA 3LLXA 5D4YA 3SZ8A 1JVNA 4ZOAA 3LUTA 3CLMA 3PAOA 3N73A 4Q8MA 5D2TA 4EXBA 7TAAA 3DERA 1DJYA 4C6KA 4RW5A 4TVCA 2GPTA 2JQXA 1J6OA 2OXNA 2VO5A 3WLSA 3GS6A 3HZ3A 1ISXA 4GBDA 4HP5A 4MAVA 3WD1A 1SUXA 2DSVA 4KRZA 2Z24A 3QYQA 1TJRA 1G01A 5HOSA 4NQ1A 4EWJA 3LCIA 4IISA 1I2QA 2Y70A 1J12A 1NP2A 1BQGA 2A3HA 2ZDRA 3VE9A 4PTXA 5DT7A 2BHZA 1VAHA 4HMDA 1XLCA 3IUDA 3U48A 1KV8A 2I57A 1NEYA 3QQ1A 3O8AA 2OFJA 3ARXA 1UMLA 1XLHA 3IGXA 3AJXA 1LYXA 3H55A 1EC8A 2QR6A 3HPAA 1E9ZB 4NHVA 5A6TC 2VYOA 1XQKA 5F4XA 2QUTA 3RLUA 2Z29A 1Q85A 1S2AA 3VD5A 3NM3A 3WMCA 4M6PA 4DJED 4HD5A 5LZLA 1H62A 1XLMA 4KIRA 1VEOA 4LY8A 2PDFA 3DH7A 2CLHA 1Y8BA 2VP8A 4ECLA 3EOUA 3AAMA 2GWNA 2PWHA 4LF2A 1D7KA 1Q6CA 5D37A 4YS1A 3EDJA 1ZPTA 4J3VA 4WGHA 2C13A 4Y9OA 1K6WA 4D8LA 1EGZA 4QEHA 4DXVA 1I6NA 2PMQA 1GVQA 2OKOA 2ZUMA 2DVTA 4KCWA 4AXKA 2QZRA 1OCBA 4DPQA 1MUWA 1IIGA 4DZHA 2WKJA 4ADTA 3K46A 3KLLA 2MUCA 5FJOA 5I00A 4Y90A 1Y65A 4QXIA 3VIIA 3N13A 3TC7A 2Y8VA 4QBXA 1NSJA 4PMQA 5H2ZA 4JIEA 4WXZA 4PEKA 1ME8A 7REQA 5EL1A 2OVLA 2QAFA 4JBRA 5CSSA 3ZJ8A 3AZRA 5EBAA 4JL1A 4M7TA 4A8NA 1JYXA 1FX6A 5HJYA 4WXYA 4Q4SA 4GABA 4OOZA 2JKEA 4QJ1A 4AC7C 1NDZA 1D2KA 1CCWB 1S2UA 1BXNA 3QHOA 3CQ0A 2ZDSA 4AZGA 1R87A 3F2CA 4PFMA 1X96A 3M0JA 4IJCA 4O14A 4H9UA 3G3MA 3DENA 3NQFA 3OZMA 2AMXA 1TKKA 2VX6A 1UWQA 3PN8A 1XH1A 4PMOA 1OFBA 1V02A 3B8UA 5G1TA 1OK4A 2Y7EA 5JQ9A 2BMBA 4G1NA 3B8SA 2IW0A 3CPRA 3GNPA 4HKPA 1DTUA 4O0QA 1V93A 2DT1A 3VGGA 1FXPA 4LVAA 6XIMA 4TUFA 4WF7A 5HINA 4LGXA 4PMXA 3WDJA 3P14A 4RX0A 3T0TA 3HMCA 5I3HA 2VX5A 1E0WA 3UNTA 3URAA 1EX5A 5DCBA 4RXGA 5J8LA 1O5XA 4E2BA 2GVJA 2WC7A 3WLJA 3AXIA 2WC3A 1EUAA 1TV2A 1XL9A 4EACA 4UTMA 2OEJA 4H8NA 4JFWA 2XPKA 5REQB 4W87A 2ODOA 2DIKA 3CV2A 3HGSA 2NV1A 1DJWA 3EPNA 3MP4A 4UQAA 3M64A 3S2MA 2DT0A 2I1OA 3AICA 1DWHM 1Q4WA 2OZ0A 3AS2A 1EP3A 2UY4A 3HPXA 3ZT7A 4AD5A 1LUCB 1XYMA 1HO4A 4NXKA 5C9ZA 3RCYA 2YX0A 2A21A 4H9XA 1H1ZA 3NQAA 2W92A 3USBA 4X2RA 4G2DA 2J74A 3NDOA 4B9YA 1UD8A 3U5UA 3VDHA 1BFNA 4DWSD 3QGKC 4XKYA 1CW2A 1GCYA 4IL2A 2XYLA 4HPHA 1F05A 1YBQB 1K9DA 2ZX8A 4I7WA 5FACA 3WH8A 2CLOA 2Q3RA 2H3BA 4J1OA 3TJIA 3FJLA 8TIMA 2GGGA 1JPKA 2I17A 4JN8A 3BPWA 1HL9A 3T7VA 5KZEA 2HBVA 1XV8A 3MC5A 3P80A 4UTHA 1TRDA 2WMKA 4LYRA 4MGGA 3U9IA 1JCXA 3DKJA 1LWHA 1VJSA 2PGEA 1JF6A 2BGQA 4C6DA 4XZHA 4H7ZA 1I60A 1TWZA 3O3RA 3B9DA 2ISSA 4NXSA 2V3EA 3A21A 4R27A 3M5ZA 3TLLA 1U1JA 4CQAA 2NQ9A 2A6NA 3U7VA 3VZXA 4C6MA 1ZS2A 1ADDA 5D8ZA 2P1FA 4G7EB 2R1LA 2I5IA 5CZKA 1SQ7A 1CECA 4PTVA 1ZBVA 2FPYA 3KS5A 1BXBA 1QCWA 4LV4A 3OBKA 2J77A 2WBGA 4S38A 1RD6A 1TX0A 3ARWA 1WDDA 2X1RA 4FPSA 1F6PA 4B15A 3M7SA 2FGLA 2PAJA 4C1NA 2JIWA 1UH2A 4RK8A 2YJQA 3VKCA 4YTTA 2AKZA 3C2FA 3WDRA 1X1ZA 4LS2A 3PNZA 3VGDA 3W3OA 4QP0A 1B90A 1ZRQA 4JTJA 1JCTA 2C6QA 3VDBA 5E0CA 3ANUA 3B8DA 4LRSA 5D8WA 4JEJA 2A3BA 1XC4A 1PIIA 1NOWA 1XSIA 4QCFA 3WL1A 5A6LA 1VYSX 1EJTC 3LI1A 1JD9A 3AS3A 2O9OA 1FUYA 1GORA 3WLIA 4GIYA 3TCEA 4EE9A 1XBZA 1RPXA 1V0NA 4N9CA 2G3FA 4KWVA 1RLCL 3GH4A 1AH4A 1EB3A 3SJ3A 3UJSA 3AIVA 2XN2A 2X0YA 2YB4A 2X42A 1BRLA 4W89A 2TPSA 4IMEA 4QJ3B 2CWXA 3DEQA 1W5NA 2WZEA 4ZSTA 4XO7A 4R5EA 3HF3A 1SJDA 4MPKA 4WSJA 1DHPA 2WVSA 4DBEA 4AWEA 3G2GA 3AYTA 1NVMA 2HNEA 2VXNA 3MDWA 1VFSA 3PSWA 4A22A 1X7IA 4G9PA 4AZBA 4JFUA 2HMCA 3ENLA 2PLJA 3RIKA 5HUOA 3EEZA 3VOCA 3JZUA 1CI1A 4UB9A 5CCZA 1F2JA 4R88A 2YYTA 5F2IA 1XH0A 2MNRA 4JS3A 1HW6A 1J4EA 1F3EA 2REQA 3T40A 4PB5A 3NCOA 3LN3A 3NZQA 2E5DA 3UNDA 3LSBA 4RUBA 1F5ZA 1WE5A 3LTSA 3VABA 3G24A 3ZT5A 3KL0A 1NARA 1S2WA 2WANA 1FBAA 1AW1A 3I65A 3L4VA 3W1TA 3V1PA 2EPNA 3R13A 3KBVA 1GHSA 1OG0A 3QJAA 3CZGA 2VRQA 3EWWA 1XQLA 3OBEA 2CLMA 1PKMA 1AQHA 3IUHA 5KTLA 4ERIA 3GB6A 4M5PA 1W3JA 4ZFCA 4QX4A 3DI1A 3SSJA 1UR1A 1FVPA 1UA7A 3RPMA 1BWVA 1KXHA 4GHRA 3UWWA 3I3EA 1IWAA 1P1MA 3N4AA 3PB2A 1NDYA 1MZHA 1QOQA 1HL8A 1XHGA 4PA8A 1XLLA 3WNLA 5DF0A 4QROA 2DV0A 1KCZA 2PWFA 1WKDA 1KGXA 2EXOA 2HNHA 4HK5A 2Y85A 1CXLA 2XIIA 3E2QA 1H7NA 4ATWA 4L61A 3ZS4A 2PWGA 1XLDA 4PEEA 1I45A 1X98A 4HNVA 3WJSA 4KEVA 1GQIA 3C2RA 3H2FA 2QCHA 4NIRA 2QKFA 2B7PA 4QS5A 3AS1A 1RHCA 3CHFA 5DO8A 2H8ZA 1A5LC 5LNWA 2DIEA 3H24A 4JIPA 2J47A 4GWEA 1WXZA 2EO7A 4A3RA 1OINA 1GVOA 2QCMA 1UR9A 1KKRA 1MNSA 2XISA 1L6SA 4O4WA 5JH1A 5HR6A 4OU1A 3I7QA 1YMYA 1DPMA 3HQOA 5J04A 1ZAHA 4O19A 4DI8A 3H2NA 5AYZA 2EPKX 5H8UA 3M7WA 2PGFA 4KW2A 4RDYA 3WF0A 2XIQA 1FFRA 4NILA 3LX9A 3BMVA 3MSYA 4JHZA 4PFHA 1TFVA 1L6WA 3K2GA 3EWXA 2J6XA 4D8AA 1YTKA 4PMVA 4GE8A 2ZBTA 4PBEA 2E77A 2FLIA 3CUFA 5ECUA 1YNPA 3F4WA 5DANA 2BNJA 3O2LA 2E4TA 3LV5A 4XSMA 2TRSA 1LRQA 3QGAC 3N6JA 3QQ0A 4PRRA 3RX2A 4JDBA 3QN3A 4L4MA 2QIWA 4TR9A 2WMGA 1GVEA 5BOEA 2OEMA 3DUGA 1EZ2A 5M1TA 3SUSA 3RM9A 1HF6A 2VD9A 5GVJA 5C9UA 1Z32X 2HQAA 1T5AA 1MUCA 3DCPA 1DVJA 3FAXA 2J25A 2VCCA 4W7UA 3RCMA 3VA8A 4Z1DA 5G2WA 2P8CA 1ICPA 3N9RA 3V3WA 4F9JA 3P74A 3E38A 3SO7A 1JCNA 1LL4A 1YPIA 4KRTA 5CGQA 1FKXA 1AMKA 1KWKA 4ZQCA 4B5TA 2J8FA 3NQ7A 2O4QA 1G4SA 3KTSA 3KVJA 4QRNA 1WNOA 2Z7KA 3NM1A 1EHAA 1W1IE 4FI4A 1ZJAA 3NL3A 3PUEA 3TAOA 3GNRA 3GDTA 4O1CA 4N9DA 1YRRA 3WZ0E 3SCSA 4QLKA 2QCNA 1U30A 2AQWA 1MQPA 2XZ7A 4AXNA 3BJFA 1VFLA 4MNJA 3VNYA 1NTHA 2G3JA 3MUCA 5CQ1A 3C6CA 2OX4A 4JEQA 2O7QA 3P3BA 4RZBA 1EF2A 5H6HA 4YCPA 4UTWA 3K13A 3GHSA 2HROA 4YLWA 2JEQA 4N4QA 4DHGA 4YHEA 2YXGA 3A12A 3M5YA 1YEYA 3FA5A 1SFJA 4KS0A 5FAJA 2REQB 3LM3A 3W1PA 3QSTA 1EA9C 2A2IA 3T2PA 1R2RA 3PULA 2ZXDA 2ABBA 3ZZ1A 3BAIA 1DOSA 4AIBA 1GOIA 1T0OA 2QV5A 3FOKA 3IAPA 3UZZA 4D6DA 1HKJA 1UR8A 4ZVJA 4NYYA 2G3NA 2GK1A 5BWAA 2BXVA 1KTNA 3MU7A 4NNAA 3POCA 1O5KA 4D6IA 3VOHA 4GRSA 3DC8A 4JY9A 2X7WA 2W0UA 3V1HA 1S5TA 4O1BA 4XG1A 1O6IA 1JEZA 2P8BA 3E0IA 3SBFA 1QI4A 4O13A 3U7BA 3AUJA 1KR0A 2VT0A 4IH3A 3N14A 4Z17A 1ZU8A 3GIYA 3WFAA 5CBBA 4A8IA 2J79A 5A6AA 2Y4SA 3WNKA 2ALRA 3QYSA 1PHQA 1AODA 2ZE3A 4LSBA 1MZRA 3H8AA 4TO8A 1JCJA 3C2OA 5D09A 1M01A 3EDKA 2R6OA 3H2AA 2FKPA 4V2XA 1X38A 2ZX5A 4NZ3A 2VR4A 4MNKA 1KTCA 1PHWA 2DIJA 1OFRA 4TXEA 4ML9A 3NZPA 1DYSA 7A3HA 4YU1A 1W2PA 4KEMA 2PGWA 1WO2A 3QVQA 1V03A 5FEZA 3MKVA 1UB3A 1HP4A 4PUWA 1I2RA 4AD2A 3T09A 4J7RA 1OB0A 1RJQA 4GQRA 2NSXA 4FLRA 2AL2B 4MG4A 3P8IA 4RDVA 3AS0A 1K70A 1BTCA 2VKZG 3Q37A 4C5YA 1I2NA 1MFVA 1EH9A 2YW3A 1OD0A 1IEXA 3UF9A 1LM1A 3GNXA 3TR9A 3ZR4A 2CNCA 5CJMA 3SCVA 4RJEA 4E5TA 1ZSXA 1NFGA 3KBJA 3A47A 4UNLA 3L23A 5MKGB 3BLEA 4IPLA 3VINA 5E9XA 5G4WA 2O9RA 1HJQA 2JEPA 5HXMA 3IAQA 4IXXA 4R33A 3BJTA 1JNEA 5HNUA 2DY3A 2PDKA 3W87A 2Z27A 3VO0A 4MY8A 4M51A 4TV5A 3HG4A 2PD9A 4EKJA 1E3ZA 2PDNA 3W2KA 6XIAA 1EX1A 2OZ3A 1QDSA 2DJLA 1FCUA 3W70A 2RDXA 4G1KA 2A3LA 4NJHA 3WK2A 3TWAA 3BMXA 4H6QA 1A53A 2PWDA 1TVLA 3GNOA 1RJPA 2Z6IA 3W7IA 3WQWA 3VDGA 3TA9A 4HIBA 4UNKA 3TYAA 2H9AA 4X0NA 5CC5A 1RA5A 4JFVA 4FX8A 1G94A 1TVPA 1PX3A 4D8ZA 2CLEA 2J27A 4MJ2A 2QMJA 1B31A 2QCFA 3EX6A 4Z2JA 4NJJA 3RILA 1PJ9A 5CG0A 2D73A 2QUUA 1OC7A 1GJPA 1TQJA 3SDOA 3VU2A 1HVXA 2DZSA 3A64A 1E1EA 1V51A 4Q4QA 2OLAA 4Y8FA 4IP4A 5BOFA 1E6XM 3STGA 1PXGA 2ZXQA 4QJ4B 5AB3A 2PDBA 4QS6A 3ZVIA 3SN0A 3PZGA 4OT7A 5A6JA 4OHQA 4FB7A 4Q8UA 4JFSA 4DNHA 1R3VA 4HHHA 1LL6A 5AVNA 2QPXA 1WDSA 1BTMA 3P60A 1VBHA 1TYGA 3NDYA 1GVYA 1J9YA 3B06A 2G8ZA 4Q8TA 3SCTA 2X2YA 4NVTA 1A0EA 1M5WA 2X16A 3A4JA 3UYIA 3BSMA 3WQPA 2PWUA 3WENA 1XICA 1Y5XA 1ODZA 4R85A 1XIFA 2QPUA 4QAIA 4ZOCA 1UP0A 1E9IA 3UVAA 1TTIA 1GQLA 3WUFA 4GYKA 3RLHA 3I6EA 4LC8A 3T81A 1VFUA 1JIBA 3WLKX 3SIMA 1Q7ZA 1RUSA 1DWFM 1NFPA 4ASTA 4FX6M 2ESCA 1Q7QA 4MDOA 2OQYA 1SO6A 4DZ5A 4CU8A 2FVMA 1G4PA 1TPB1 2ZWZA 3CBWA 4OBSA 4ROPA 2ZZ2A 2CCRA 1LCOA 2F6UA 2JE8A 3BO9A 1KKOA 4JFTA 4AEFA 1B30A 3VX1A 2EGZA 4HK7A 1CBGA 3GC4A 1E43A 4NI3A 3RLGA 1B3YA 3LRLA 1ZY9A 2J7CA 4JDYA 2X1TA 3O63A 1OX4A 3ARPA 4PUKA 1JRBA 4PUEA 1O95A 1L6FA 1LLZA 4IWWA 4DJFA 2OMAA 5EBUA 1E71M 4WQ6A 5DMLA 1TWWA 1XG4A 1LZOA 5EPDA 1R3YA 1BHGA 2FMNA 3MQTA 2C7FA 2J6VA 1XH2A 1E6RA 4MYAA 3VKDA 5AYXA 2G3MA 4OUIA 2QCCA 3UQNA 3GUWA 1J0IA 1DJNA 4RE0A 1H7PA 1X7FA 4GVFA 1C29A 2OSYA 1FHVA 1TUXA 2VUYA 3CL6A 2PU1A 4PMJA 4HZ6A 1EDTA 1RAKA 4RPPA 3BTNA 1KBLA 1WX0A 1SGJA 2HE8A 5FIPA 4NNCA 3LPPA 4IGNA 4UNIA 1KFKA 4ONVA 3EXTA 1FHLA 3IUIA 4O18A 2PDYA 4LPCA 4M8UA 2VGGA 4XVDA 3BGAA 3AOFA 1W3KA 4H9YA 3HFYA 4DI9A 1EDGA 4HU4A 3W86A 2QF8A 4US5A 3NDZA 4ERAA 3QR3A 3KXQA 1OF8A 2DDXA 2HISA 3QC3A 1NQKA 1OX5A 3BLIA 4QITA 3ZLFA 1WZMA 2C91A 4FOJA 2VC6A 3STCA 3TX9A 3WL0A 1C92A 3K1GA 3TYCA 4TX9A 1JDDA 4N42A 1V77A 1W1A1 3ZVHB 2ATSA 1TG7A 5A6BD 4B2DD 5A6SA 4P8VA 3PZ9A 3E5BA 3CEPA 3R5EA 3OA5A 1PTGA 4RV8A 3IRSA 4AZ7A 1W3HA 4D72A 4Q8OA 3P0XA 3ZWSA 3R12A 1QO5A 4AEOA 5TIMA 4E4FA 3NJ3A 4P8WA 1M65A 3WIJA 3KCLA 3ABZA 3FAWA 3HG3A 1VQTA 1QNVA 4FXRA 1S46A 3PPHA 1XIJA 4LQ1A 3WQOA 2NLYA 1SJAA 2FJKA 3I7SA 1HVQA 2JBMA 2ZX7A 2QDGA 1CNVA 1TO3A 4WK9A 4D6EA 4B5SA 5BOOA 1RV8A 4GX8A 1VJZA 9RUBA 4E8CA 2WLZA 2V6AA 3A9BA 1LWIA 4D2JA 4HVXA 4ZB5A 3LY0A 1QASA 1HIZA 2DZTA 3RUBL 3SFWA 4ZR8A 1VB9A 1AUSL 4XIMA 3F1QA 1TZ9A 5JU6A 3OP2A 4Y7EA 1S1RA 4W8AA 1E5JA 3TMLA 1E1FA 4F4RA 3LXCA 3L5MA 3BV7A 2DH2A 4NAEB 3C3UA 5I3KA 4RPQA 4GISA 3VIHA 1TPWA 3DAQA 1LT8A 3FV9A 1TUFA 2G4JA 4RE2A 3D47A 5D9MA 3GWQA 3OGSA 3PZMA 5LA1A 3GVQA 3ME3A 1WDQA 3WNOA 4JTGA 2DZVA 3QPYA 3VK5A 2WZMA 3ARRA 1YTEA 3DFNA 2Y1HA 3RX4A 2ZRYA 3HG5A 2VWTA 3NXFA 3FHQA 4CLMA 3OJGA 5LHEA 3W27A 3TW7A 1OFQA 5FF0A 4HNCA 1IF2A 1A5KC 2AL2A 4QM1A 5KSWA 4BK9A 4J3ZA 2GUUA 3C0JA 1ZCCA 4A29A 3SY5A 3W83A 1DXIA 1CEOA 4P8UA 3SY8A 4HPXA 1EF3A 2C18A 3LRKA 2BY0A 1DJGA 3CYJA 2BHYA 3QV6A 1ZAJA 4AIUA 3L2LA 5T8GA 1FWIC 4J2MA 4QIUA 4IQJA 1GG0A 2Z1VA 1C90A 4C6LA 4G6CA 2NQJA 4EK7A 1XRVA 3OVGA 2QUMA 1H7RA 4JL2A 3UY8A 2ZICA 1FFQA 2G37A 3ES7A 3NNTA 4UQCA 2XUCA 3KOXA 4HT3A 3LGGA 2VVNA 3LM7A 4IP5A 3ITVA 4Z08A 3IK2A 3LHVA 1PYMA 5CH9A 4B92A 1OWQA 4C7GA 1ZJBA 1TIMA 3GDLA 1PZ0A 2AOSA 4CGTA 1W56A 1A3WA 1GNXA 2YDQA 3VMPA 2A85A 3AU2A 1H0IA 1E6SM 3DX5A 2EKCA 1Q4NX 3LMZA 4IFKB 1P0EA 4D6GA 4KF1A 3H4WA 5XIAA 5TAOA 4JQ4A 3MBDA 5CXPA 1ZLPA 2XGBA 4JR5A 2GK1B 4BY3A 3DKLA 4GNJA 3KVMA 2L5HA 1ZBWA 3NQCA 4DAFA 4K1GA 1W5PA 2CHRA 4HZ8A 3LCWA 2BVDA 3GTFA 5D33A 3R0DA 3TJLA 3AHTA 5F1VA 2OT1A 3G6LA 1VBUA 4DJFC 5CC7A 1Q6EA 1D9EA 4IIBA 3GYEA 6TAAA 5BXSA 1QI3A 3PJXA 2ZUUA 2FHFA 3RU8X 4HCLA 2D2GA 2XVPA 3CUXA 3ECQA 3DN5A 2BFGA 1JUKA 6REQB 3SUUA 3I10A 2AQVA 5GPRA 3K8LA 1WAWA 2EG7A 3SCPA 4FNPA 1IWBA 3L12A 4JNMA 1UUQA 3NEVA 2A79A 1GQJA 1P48A 1V3JA 4WRHA 2EF9A 1I9CB 4HNOA 5JUVA 4GJIA 2OYLA 3LMYA 1V6XA 4X63A 5AYBA 3L4XA 4CCEA 2QJIA 1UW9A 1GEHA 1GK8A 3LU2A 2ISFA 4A3YA 5F1UA 4Q4RA 1PKYA 3PP7A 1R2SA 4D6FA 3DYPA 5AHIA 5FEWA 3E74A 4NAFB 2BODX 3W81A 3WYZA 4C6EA 3L2MA 3DFYA 3H7RA 1Y7VA 4PUUA 4DF0A 4G5DA 4EXQA 4MPQA 3WQ6A 1LQ2A 1EL3A 4GFIA 1DQUA 3NL2A 1QT1A 1J18A 3TTQA 1H1NA 1BQCA 4GG9A 4O17A 2X0SA 3FFSA 3BAWA 4NU7A 3MYPA 1SYTA 3UEQA 1JQXA 4Q32A 2BOFX 1EYEA 4QE4A 4IQEA 1Z89A 1FXQA 1VCGA 3VKBA 2VEKA 3G0XA 4DJFD 2Z1SA 4LCQA 2Z2UA 4XAGA 2DP3A 2H6RA 2BSLA 1I0DA 2YL6A 2PDPA 1S2CA 3WBWA 3QPZA 1KM0A 5EGRA 2PS2A 1TA3A 1HN1A 4AZCA 3E96A 3GU2A 4DY1A 3QZEA 1OGGA 5LNRA 3W71A 4A2SA 2JGQA 2YCJA 2CXGA 1UBPC 3HOJA 4IPPA 5I3JA 1KA9F 1T96A 1QBAA 5D03A 4EIVA 3BW4A 3NYDA 4TMBA 1KRCC 4DQWA 4BQ2A 3FVMA 3I6TA 4GZEA 4O8AA 3K30A 2VC7A 3KS6A 1T99A 1W6TA 4E38A 1R9ZA 3LSCA 2Z25A 1OJXA 2DSKA 4DIAA 4ZMGA 5I3GA 2DJXA 2BG5A 3N3TA 4CD4A 3NPUA 2VFGA 2NXGA 3P61A 1X39A 1ADSA 1DV7A 5C7VA 4B4FA 2H90A 1DJXA 3QY8A 1WOAA 3TH6A 2J8TA 3WQDA 4IMDA 1OHLA 1PBGA 2WZHA 3PNUA 4E8DA 2FH6A 4GMEA 4GO9A 1OC6A 3LGDA 3AFBA 2FZ9A 4M1RA 4W7VA 3WQ5A 5EFDA 5HUPA 2P88A 2OT0A 1KRAC 1UD2A 3WNMA 4AD3A 3MY9A 1SJBA 5GJPA 3VIGA 4CCZA 1WKFA 3ITTA 4NZ5A 2QHAA 1XLIA 2I9EA 4UIOA 4JCLA 3S5YA 1U1UA 4FNTA 4DM2A 3T8LA 2F8QA 1NJJA 3TTEA 1S5NA 1UBSA 1GTHA 2W63A 4MTVA 3TP4A 1UR2A 2NV9A 3AIWA 1WKEA 1UKSA 3IK4A 3C52A 3EWZA 2GWGA 5T9CE 2O55A 2XVNA 3QW3A 5A6MA 2CZVA 1JCYA 6PTDA 4DBUA 2FB2A 3WELA 3NIYA 1BXCA 2OLSA 1KC7A 3SGZA 3ZLGA 1VBGA 6REQA 1BG9A 4H9VA 5FSDC 3BLPX 3W7NA 3T42A 1EPVA 3S9IA 4HPJA 4O52A 3S46A 3LK6A 3HURA 4DJEA 4XTDA 1VF8A 2GQAA 3DHUA 3DI0A 2NV2A 5CPSA 4C6IA 4NI8A 4HYWA 3UBPC 1N2VA 1ZUAX 3TJXA 3HQPA 4ZEPA 3ARQA 3WLQA 1BVWA 3QHMA 5G1MA 1HG3A 5JBEA 2C1IA 4CCDA 3G1FA 4NZ1A 5LNUA 3FYOA 3CT2A 1FTXA 2C3ZA 1M3UA 4K7VA 1CWYA 2JK2A 2P5NA 1E6QM 1J01A 1B4EA 3DZ1A 3SCQA 1OCNA 1XSJA 1WZKA 3ZXWA 3A22A 1AW2A 4LEFA 2RGMA 1DIDA 3IJQA 3N4FA 4FNSA 4HU8A 2OLHA 4IQDA 2V67A 1VIWA 3BAYA 1MRQA 1C7SA 1UJQA 2WV8A 3O15A 1UZ1A 3L4UA 1KCKA 3GNNA 5EMUA 3G0SA 3GK0A 2ICSA 3W82A 1WDPA 4R7WA 3N17A 3H4GA 3RHGA 1OADA 1XC6A 4PCTA 1GKRA 1R38A 4MDPA 1RSCA 3GHRA 5CBIA 3S9ZA 4L9XA 4I9TA 5H91A 4UQDA 2DU2A 3G3DA 2P3EA 2V2CA 3W88A 4TVUA 5BWFA 1K02A 2PDHA 1WA3A 2OG9A 4RDZA 2VRJA 1D7FA 3CHEA 4Q7IA 1US3A 2YCEA 4I6VA 3A3WA 4U5IA 1W17A 5B80A 1ZJHA 4RV3A 5I0DA 1X8FA 3W1UA 3AUOA 3DG3A 1EQPA 1D8WA 1DQXA 2BY1A 3BW3A 1G69A 3MTWA 4MAZA 2QT3A 2V30A 3MI2A 4QE5A 3SCRA 3EGJA 1YXDA 3DGBA 4BQ4A 4CNUA 4PMUA 5ECVA 4I9MA 1XIHA 2LLEA 2J13A 1OG6A 1VRXA 3LQLA 4HGXA 1G4TA 3UWYA 4Y9PA 3WN6A 1IZJA 3QM3A 4HA0A 2TMDA 1QNPA 4C65A 1KFLA 3NZGA 3FGCA 4PZVA 2CZ5A 4K6AA 4S2BA 3RMEA 4N6FA 4HA1A 3IJLA 3WJWA 3UFYA 4ZODA 5CZSA 3AHXA 5A2BA 4IG2B 1FCVA 1QNQA 3HB9A 5LNVA 3NPWA 4MKSA 1IT7A 1P4CA 3TFCA 3ISIX 3G6MA 2OOFA 4ZQMA 1TE1A 2X30A 4LFYA 4PE8A 2BV9A 3OG2A 3M0VA 2NQ5A 3BAJA 3FA4A 7TIMA 1PDZA 2WJZA 4MMWA 3GIQA 4Z0SA 4E2DA 2DFAA 4MJ4A 3TFXA 2D2JA 4I5RA 2QCLA 3CJPA 2C0HA 3NQ2A 3SRKA 5U7SA 3QTGA 1OIFA 1S2VA 4FMVA 4LNCA 1A5AA 1K9FA 3FSTA 5HR7A 2E6DA 3OPSA 3PZIA 4XO6A 3UJRA 1XM3A 3BDKA 2PDGA 4W7WA 2QJJA 3RYSA 1KLYA 2NSOA 3WEMA 4MB4A 2ZVRA 4QR6A 3N18A 2NX1A 5K4ZA 1HJXA 2R9RA 1G0CA 3BV4A 5DN1A 2DQXA 3VKJA 2VGFA 2DZXA 5I07A 2E1WA 4C7DA 1ZTVA 2FYMA 3E2SA 3OLEA 3HGOA 4JIHA 3W7CA 4YTQA 1UD6A 5KZ6A 2UWFA 3E9AA 4JXCA 4NAEA 1HJUA 4K8EA 1ELSA 3ZVHA 4OBTA 1ADOA 1E0VA 1GG1A 4F0SA 1DWIM 4O50A 1DE6A 4CNNA 4CVWA 4Z2GA 2YFNA 1UP3A 3EEGA 1ITCA 2XHYA 3W7GA 4DYJA 3RM8A 1A3HA 1FP8A 1XBYA 1CGXA 3BANA 1TRIA 2EJAA 2X41A 4GQ0A 3N6QA 3L5LA 1LG1A 4AIEA 2V2DA 4DAIA 1TREA 4WOQA 3FJNA 2EJ1A 3CQIA 4GYJA 1F61A 4TQTA 3CAVA 3PVFA 3UT0A 1B5TA 3GX9A 3GKAA 2AGTA 3KCJA 5F4SA 3TQPA 3OZOA 1H4PA 2CKSA 2GZXA 1RPKA 3VGBA 3C2EA 1FWRA 3CK5A 5JMUA 2E1DA 1V6VA 4UTTC 2DPEA 1J10A 4I9AA 3TCSA 3TZNA 3HO8A 1US2A 4OV9A 2FPVA 4MSSA 1FWHC 3AZSA 2Z00A 2E28A 3AIUA 4GNKB 2PF8A 4OWGA 3QKZA 4D1IA 3URQA 5CPOA 2VURA 4ZO6A 1CXIA 1M9HA 2YFOA 2QS8A 2ZZ6A 4S3BA 2E40A 3B40A 4KFPA 2YLLA 3HBLA 3VIFA 2HE5A 3WFLA 5FD0A 3VGEA 4JY8A 4WJXA 1RJRA 1IZCA 1R7AA 2PDLA 4J3SA 3TLQA 3W01A 3UD6A 1ITXA 1TZZA 4GI6A 4KWSA 4QEEA 3MUZ1 3N29A 3V5FA 3NO5A 1O1ZA 1X97A 1W8SA 1AJZA 2JIEA 1YX1A 4ZZ9A 1G7VA 3PZUA 4AAJA 3B97A 5JH2A 4CN4A 4J27A 1JPMA 3VKKA 1AQFA 5HJLA 2C14A 3ITOA 4GYFA 1KFJA 2Y7FA 4DLMA 3STEA 4UBPC 1V3KA 3IARA 4F48A 3PM6A 1CXHA 2XDFA 1X1NA 1KBJA 4PCPA 5A5WA 3A23A 3AXHA 1VEMA 1WYIA 3PZVA 1UD4A 5I78A 4JIQA 4MFDA 1M1BA 4MB1A 3AXMA 4YVVA 3GVVA 4K2SA 3RXZA 3O0FA 3B9EA 3VOJA 4UQBA 4PR4A 3WQGA 4YTUA 2D2HA 3VCCA 3MJMA 3TSDA 3PJWA 5I79A 1UZDA 3LEPA 3THCA 1FHUA 1IXOA 2JF7A 1LBFA 1WCGA 1JPHA 3U2ZA 5F2MA 3EX3A 5LIKX 1TELA 1EC7A 3B0XA 3Q4DA 1CB7B 4JGDA 3FKKA 1TIWA 3KL3A 5I23A 1Q6GA 3N9KA 4WGXA 3LCGA 1UP2A 3QV9A 4YNGA 4AYSA 5EMJA 4AFYA 2UV8G 4ADSA 2YA1A 4B9ZA 3S2LA 3EKZA 3S2JA 4PSPA 2W5FA 5C7HA 4PCSA 2BGNE 1V3HA 3WK0A 4ZTXA 5IDZA 3BG3A 4PTMA 5BRBA 2AQOA 4MIMA 3UWQA 3GW3A 1W2VA 3ITGA 1E15A 1E0TA 1ZP3A 1FWDC 1KM2A 2VQUA 5E6ZA 1THFD 5M2FX 3L4WA 4LJ3A 4OV4A 4MLRA 3MBFA 4F79A 2PSNA 4IQLA 2FB3A 2XG9A 4HSHA 5ABFB 1CGUA 4J9JA 1J0YA 1W32A 4AZCB 1P1XA 2PWVA 3AWOA 5DRIA 1ESWA 1UR0A 4CEUC 3NG3A 5BMXA 2CIPA 3CUZA 1UJPA 3GRIA 2WHKA 2YDRA 3R8HA 1G67A 3S3GA 2WYSA 5AHMA 1QHPA 1EXBA 3WNNA 3PBUA 2G5WA 2XWDA 3A3HA 4U31A 4A3QA 1CPUA 3P62A 4IFKA 1OCQA 3EA1A 1MQRA 4POCA 1FWEC 4BI6A 1A47A 2CBIA 4FAMA 4GH3A 1E73M 3F7JA 4IJBA 1VFHA 2V69A 3R43A 1E40A 3VZZA 2E6YA 4P7LA 4HNTA 1SSGA 2QQ6A 3ANVA 4GGHA 1W9PA 2D23A 2WK2A 3T0CA 2WNWA 3MMUA 4HTBA 2VX7A 3QQWA 4J3TA 2Y7DA 3I3BA 2Z28A 3W0KA 4CEXC 5CGMA 4DLFA 1CZ1A 1ITUA 2V5JA 5DT5A 2GUYA 2CBVA 3GO2A 1SFTA 3KVKA 4S3FA 2DZWA 1AZ1A 2RFGA 5LXXA 3DDMA 3WLNA 1I1WA 3VNMA 4L1WA 5FKYA 4JKMA 1EXPA 3EWYA 5B7YA 3WLRA 3WUEA 3HV8A 4F9DA 2HPMA 2HDJA 6A3HA 4H00A 3V0UA 1SO3A 2BOEX 2FGBA 1V7AA 2E9MA 1H50A 3VDAA 1PZ2A 3E02A 4MB3A 1JYVA 4ZQRA 3GC5A 3FXGA 1YADA 4X22A 1TPC1 3QH2A 4XAFA 3VFCA 3BAXA 3KX6A 2RGLA 2ZKMX 4J28A 1S2TA 2V2HA 2ZC8A 4PMZA 2TYSA 2WNQA 3N25A 4OZOA 3L21A 3PG8A 5JIPA 2ZIDA 2YA2A 3EDEA 5E6YA 1X6NA 1RP9A 1XLAA 4E2OA 3SCUA 5CSYA 1GVFA 3U0HA 3WF4A 3BGGA 4IG2A 3M0XA 4BFAA 4HZ7A 3W2MA 4AZIA 4W5UA 1TPUA 2HK0A 2WLYA 1AJ2A 1GW9A 2HS8A 3CV6A 1F3TA 4L65A 1X1OA 4I8YA 3WDQA 1UROA 1F4AA 3PUOA 8XIMA 1BWLA 2XSBA 1U83A 2POZA 3LPGA 1E56A 1AD4A 4HA3A 1JYWA 1C8YA 4XSLA 3W7HA 4UTWC 1OZMA 3FEQA 4OKDA 4XK2A 4JTDA 3CS2A 4UFLA 2XFWA 4XKYB 3VNJA 3GR4A 2YDAA 4KT2A 1EWDA 4V1XA 1UH4A 3PG9A 3SGUA 3GG0A 3CO4A 4E8GA 1GVSA 1K9TA 1TV7A 3AIQA 4Q4KA 4DXKA 1P0NA 3TR2A 4PRWA 3FK4A 2Y0FA 4LAUA 3S42A 4LB3A 5D2YA 4GIAA 1RCOB 2Q3OA 3WQ8A 4M6QA 2VR5A 1HP5A 5FJRA 3R1ZA 5REQA 4UOZA 1C93A 1EBHA 3QGVA 1KFWA 1SZFA 2BBFA 3IJDA 3W76A 1LRTA 1VIZA 4GY1A 2WHJA 3DYOA 1RBAA 4GLEA 4Q8NA 1H2JA 5CZTA 1ICSA 1UWSA 2V5LA 3LI0A 1PVNA 3PBMA 1CLKA 5HNRA 4QAWA 2XIMA 4LF1A 3Q45A 4GVHA 3VPLA 6CGTA 1VLIA 4UR7A 1RY0A 5GQBA 1BD0A 3GVWA 4UC5A 3VOGA 3EXRA 1J2WA 1QI2A 3EMCA 3OVQA 3G8EA 4N0RA 3S1WA 1N82A 2Y5JA 4JTSA 4F0RA 2YYUA 3KBSA 4AHOA 2BTMA 4MOZA 1VFMA 4A35A 5CSUA 1QFEA 3SJNA 2O9TA 1CTNA 2YPIA 4C6BA 3DG7A 4RE3A 3FS2A 1UD3A 1W1TA 3TNOA 1KV5A 3INPA 5I7GA 5AHLA 1EQCA 1ZHAA 4GY7A 4DYEA 2Y8UA 3A9IA 1R3QA 1AZ2A 3QW4B 3V5CA 4Y9NA 1JRCA 4IIGA 5C6MA 2GGIA 2F6XA 3MMWA 4M80A 4MZ1A 4DRSA 1XGZA 4KFNA 3TE9A 1TJ1A 2BX7A 4ATDA 1GJWA 1Q2SA 1K77A 4CD6A 3W38A 1LQ0A 4WX2A 3CB8A 4GGBA 1P0KA 3VGHA 2G95A 3CIXA 3L0NA 1IR2A 4NY2A 4H8HA 2PLCA 4A8RA 4IIEA 3WKZA 4ZENA 4D6HA 2NWRA 3DXIA 5K9XA 2NQZA 1IWPA 2QDEA 5CPTA 4HB7A 4FEZA 5KZMA 5FSEC 5KINA 3DIPA 3MW7A 3WEOA 3B8VA 3ABQA 4DM1A 5TNVA 3ARUA 1E4IA 1VHNA 4H83A 3TKFA 3S1GA 3GG1A 1F9CA 2XFFA 2CITA 2Z2BA 4XZBA 1ISVA 3T55A 1VHCA 1FWTA 4AMAA 1H7WA 3PBGA 1FWBC 2GYIA 3H21A 3AYSA 1PAMA 4U33A 4ACZA 3WLTA 5FL0A 1IEVA 3USZA 2PFHA 3GXTA 4URIA 3ZYZA 3W4RA 4HNUA 5I09A 3N4EA 4ZB2A 3V7PA 4Q4PA 3VUPA 4UFHA 4JX6A 1TVNA 4NASA 3OLIA 4OQVA 1QATA 4Q4OA 1OBAA 3CUHA 3ELFA 1HUVA 3GFZA 1FCBA 4DX3A 3E0LA 3GVGA 1MRAA 4V33A 4E4PA 4PMNA 3E49A 3RMJA 5MHBA 3BH4A 4A3UA 4X9SA 5C2CA 2WKGA 2GJRA 4OUEA 4HMEA 4Q33A 1I2OA 5DRCA 4PSRA 4Q8VA 1VH7A 4O0KA 4C6PA 3TONA 3VIOA 4JKLA 4YMZA 4C1KA 3OGVA 3ABOA 1E4NA 3SI9A 1ISZA 3C5QA 1D3CA 3WBAA 1DKWA 3RG6A 3HIJA 4LYQA 3T78A 4BS0A 4XZWA 1BF2A 3K4AA 3LRMA 3UPMA 3S1VA 3KWXA 2E6AA 1DJQA 5C9XA 3RJXA 3VD7A 3AROA 3GG7A 4KETA 1JI2A 3CASA 2F38A 5HWNA 4CU7A 5CG7A 4ZXOA 5GNXA 3TW9A 4RW3A 3W7DA 1XP3A 4UTTA 1Y0EA 5DQPA 2H9AB 1SO4A 4AY1A 3N2XA 4PH6A 2XFRA 3VNZA 4N6EA 2ZTJA 3R2GA 3TTOA 3WJZA 2EHHA 1B54A 1H1YA 1MYRA 4TX6A 1W9DM 1W1VA 1AMYA 1NOUA 2IKGA 4NAFA 2R1PA 2QPSA 1LF1A 1Z44A 5HMFA 1M7JA 1WUFA 1OD8A 5F2GA 2VD8A 3CU2A 1FY6A 2P76A 3EWBX 1DWJM 1KGUA 1H7OA 4C6FA 2G3IA 2CKRA 3DBPA 4IMAA 3UXDA 2J8GA 2WWDA 1CDGA 1SPQA 1NF7A 2WHLA 8RUCA 1W5MA 1XD1A 1B9ZA 3WH9A 4BQ3A 4O53A 2PDXA 5MKGA 4B91A 2BB0A 3FDGA 4B16A 4F40A 2D22A 5D38A 1B1YA 1VP5A 4P7RA 4GY0A 4WVXA 5FJJA 1O5QA 1QMLA 3PZNA 3BLOA 4LUIA 3P93A 4H6RA 1VKFA 2ZZ1A 4LH8A 4OOUA 1CXEA 1T8XA 1P6CA 2FZMA 3UPWA 4MHBA 5K9CA 1ONRA 3ITLA 5C70A 3DFQA 4GACA 4C6QA 4RR4A 4WJ8A 3YPIA 4BJHA 3U6WA 5E1QA 3IEBA 3P5ZA 4KMQA 4MUPA 3DFPA 1W1ZA 4MKVA 3BE7A 3TJ4A 3WQVA 1YHTA 4A05A 2CLKA 3MSDA 3B0YA 3VAVA 2A7NA 3SUVA 2G0WA 3DFSA 2ASHA 2F2KA 4GINA 3CGTA 1U2YA 2NVCA 4AX6A 2I5GA 4GD0A 4NKCA 2E3ZA 4M56A 2CLLA 4LAKA 4KWWA 3LPFA 2O56A 3UWUA 3WMBA 3NEHA 1XLFA 2YLAA 1C91A 1WUEA 2Z1XA 1J8VA 1XGEA 1BAGA 4XBJA 4BQ5A 1HKIA 4B2DA 4XAZA 1QI5A 2WVVA 2QCEA 1NAL1 3N2OA 3ZR6A 4MWAD 3LHZA 1MFUA 1HTIA 3LCHA 2O0TA 2PDMA 1K8ZA 3D6NA 2RKXA 3FGCB 3B0PA 2GVYA 4XBKA 1S5MA 1AG1O 2P50A 4H2CA 4XAYA 1OYBA 2XJ7A 1ECQA 1PYFA 2ZZ4A 2JKPA 4YWIA 1R3WA 4H9MA 3LBOA 5LXEA 2PZNA 1HFBA 1MXGA 3L7RA 1V6TA 2NQHA 1UQYA 1FWFC 5HANA 1AK5A 3PBVA 2PCEA 5JIWA 3M5XA 2E8YA 3MYOA 4XD4A 1ITQA 3OHMB 1HKKA 4AD4A 2IKIA 3UCCA 4RL3A 2V68A 2VEMA 2OO0A 4HTYA 2BASA 2G96A 1VYRA 2BXYA 4LVFA 3W73A 3R8RA 3OO2A 3TN6A 4A21A 3KDOA 1FWWA 5AC8A 1V08A 4CCCA 3B03A 1XCWA 4KQNA 1CT5A 3NOYA 1T7LA 4EWND 2DZPA 3SRDA 5I06A 4C5ZA 2Q6ZA 3E12A 1YDVA 4JICA 1Y5WA 1AH0A 1JCMP 3AHZA 4I5XA 3OODA 3RO8A 4N7QA 4QHRA 3QTPA 3TYZA 5DEZA 3L66A 5KMYA 3THQA 1W1PA 4C6CA 2DT3A 2ISVA 2C19A 2O9PA 2A5HA 3OIXA 1AFSA 1UIPA 1UHVA 1XBXA 2PRHA 2DORA 3FYPA 3ZOAA 2PCQA 3MUXA 1OYAA 1MI3A 1IT8A 3LD5A 2FDMA 3HM7A 2VCAA 3JS3A 4PB4A 2QUVA 3OHIA 1RY8A 1R3TA 1KGWA 4IT1A 3U4FA 2WVUA 4K1WA 2D3NA 4PTNA 3M47A 1R3RA 2Z1BA 5D05A 2PDWA 2NLIA 4HYVA 1UC5A 3IIVA 1E4LA 3TTYA 4W93A 3MCNA 4J40A 3KWSA 4H01A 3LDVA 1EJ7L 3CWNA 4K68A 3LOTA 1CLVA 2IXVA 3PHAA 5IFPA 3QRHA 5AYIA 5EB8A 3KHJA 1QTWA 3U2OA 3WDIA 3PANA 4UCGA 3B9OA 3CEUA 3ZSSA 1R46A 3EWCA 4LBUA 1SO5A 2PURA 3IRDA 2NX9A 3TYUA 2I9UA 4ORMA 1YIXA 3Q65A 1PUDA 5D9PA 1GQKA 2EKGA 3GTXA 5IDIA 5T9BG 1H7XA 5HMSA 2A4AA 3GDBA 3RX3A 4JTHA 2HZGA 3CWHA 1QNRA 1K03A 1GQNA 1XYZA 1US0A 3EWDA 1O12A 1WDWA 3DBNA 4M7SA 4AHQA 4NZ4A 1VCVA 1VS1A 2E09A 3MT1A 1KBBA 4CD7A 3BURA 4GZIA 5TD4A 3KTCA 1WBJA 1U33A 3ZMRA 3AMKA 1GJUA 5EYWA 5HQMA 3M6DA 4HN4A 3UGRA 4Z2LA 4NT0A 4BA0A 5H8MA 4MVAA 4MB5A 3F5JA 2ANUA 3M1ZA 3SSZA 3W37A 2HJPA 3EOLA 1F74A 4UR9A 1IR1A 4RNJA 5FOOA 2XWEA 4AZ6A 4CUCA 3W23A 3IS4A 1E0XA 3ABXA 3F5LA 4HJFA 1NP0A 3BXWA 3GUGA 1TTPA 2JGYA 4XB3A 1JZ6A 3SCOA 4GK8A 3MWAA 4UQEA 4ZL1A 1BSLA 3W2UA 4FR1A 4QDPA 4QNEA 1J5SA 5FEXA 3GNDA 2ZUNA 3O7UA 3TYEA 1OX4B 1HJVA 4JX5A 2HPIA 5AHEA 2ZZ7A 2FJUB 3N9SA 2GQ3A 5A2AA 2VNCA 4X2PA 5A8GA 2E6FA 1MUMA 3U8GA 3OEXA 3K4WA 2JKAA 3CTLA 2XSXA 2PTZA 3IPWA 2VFHA 3UWVA 4P5UA 3V0TA 4GVIA 1SR0A 1OFAA 5FCZA 2NX3A 3R7MA 2INEA 1JDEA 5AC6A 4GUIA 2ZCGA 1ZQ5A 3F03K 1WKYA 1Q6LA 3QXBA 4LALA 2Z7GA 1DTNA 1DJHA 3G0UA 1XFBA 1A4MA 2CHOA 3URNA 4HSOA 3H6OA 3BW2A 3H7VA 3WBXA 3LCXA 3W75A 5BROA 2ZTKA 4MNMA 3KZSA 4M6VA 2Y24A 4XQ6A 1Q8JA 1IHIA 2NXHA 1AJ0A 4S3DA 2G97A 3V5OA 4B5UA 3UXAA 5HNNA 4E0CA 3N34A 2G4FA 1BVZA 4JTRA 1LT7A 1XUZA 1SFLA 2OEKA 4FZIA 4S2CA 2J7FA 4ZA0A 4DZIA 2X1UA 4JQAA 1XIGA 2Z6JA 4AWSA 1EOMA 5AECA 3N2MA 4LUJA 3ZM8A 5TQLA 4JKKA 3A4XA 3LTPA 1RVKA 3W02A 4N9EA 1M04A 1W37A 3SUTA 1MXSA 4S3JA 4PTDA 5F2LA 1KCLA 4NL1A 1XCFA 2P10A 2D0HA 3L65A 2E67A 3MCOA 2YXOA 2J4GA 3VDCA 5FESA 4UTJA 2HVMA 1Q8AA 2I14A 4S3AA 1V6WA 1RALA 1TWSA 2DSWA 1M7XA 1L6YA 2YW4A 1LJYA 2A1YA 3VD4A 5AHFA 4Y8EA 3W7PA 2J9ZA 2J7DA 1GOKA 1AQMA 3SQMA 2CZFA 1V8EA 2UBPC 2YXXA 3R0KA 1WXJA 2EG8A 4L5ZA 2DSUA 1EKOA 1LBMA 3ITXA 3GQYA 2RUSA 2GUBA 4U28A 1CX9A 1A80A 3B0VC 3WD4A 3LS9A 2D24A 3E1F1 1P43A 4LU0A 3TQ0A 1YPXA 4YYCA 2PLKA 4XIAA 3MHFA 1WP6A 3QMTA 1Q63A 2PRLA 4F8XA 3MV01 3U2EA 1F76A 1I8JA 1T41A 1EPXA 1H60A 1X6UA 4J4KA 4AB4A 1BKSA 2QYGA 3CMFA 4LUSB 3S2NA 1PX8A 3S4TA 3KFTA 1UG6A 4WJEA 4WR3A 1UASA 3AALA 1FH7A 3BOFA 4U10A 4IFRA 1R3SA 5E09A 1FDJA 5D2VA 4I7VA 4R7JA 4F0LA 4Z1CA 1M41A 3I6RA 3GH7A 4FXSA 4KH2A 3GM8A 3WBYA 1XRFA 2AKMA 3THDA 3IVSA 3EYPA 4EP8C 1PV8A 1Q3NA 2C71A 4WZHA 2ZC1A 1OCJA 1RQHA 1XIMA 3SADA 5DFAA 1TJ2A 4GYPA 1E55A 1ONEA 3UWZA 3BL3A 3MMDA 2VM8A 1VBRA 1V0MA 3CLWA 1JXJA 4BF7A 4JQ2A 2KX9A 2HTMA 1PKLA 3L2IA 3NXLA 3W28A 3CAQA 3A5FA 3CIVA 3C2VA 4AVFA 1I75A 4ENLA 1XLEA 3LB0A 3MSRA 1FH8A 5E0KA 3D0CA 3BLKA 4M24A 3MMTA 3IGSA 3LCFA 1QPNA 1K8XA 2WB5A 3CZKA 2AMGA 4JHOA 1IXQA 3M0HA 1EZWA 2G41A 9XIMA 1XX1A 4C6OA 2GVEA 4XZLX 3NPXA 4YVPA 4GFSA 4GC3A 3BOXA 1XDLA 3XIMA 3CO8A 2AAAA 2ACRA 1C9WA 5FEPA 3RFAA 3W7QA 1F07A 1Q45A 3OBAA 3M44A 3TYBA 3CAKA 1IGSA 4UTIA 4BR1A 1NQ6A 2VFEA 3CQKA 1H09A 1LWJA 3LV6A 4X0VA 2WWCA 1NH6A 1QPKA 4JTLA 3CTTA 2YCKX 1U5HA 4Z1BA 3MSGA 4JQ1A 4RE4A 5HWMA 1VFFA 5J5DA 1ZENA 1HZYA 5C71A 3NYZA 4ES4A 3RF9A 2IMRA 3L0KA 3C0QA 3ZJ7A 1H51A 2RDTA 2Q8ZA 3G1RA 3UYCA 4Z2KA 4AUBA 5AYYA 2HWGA 4FNQA 1VD6A 1VEPA 3B3DA 3G1VA 7REQB 1ISYA 1I0BA 1N8FA 4LVDA 1J0ZA 1KBIA 3L4ZA 2Y88A 1VPQA 1TV5A 4L56A 1NF0A 1WDRA 4JTFA 3C0LA 4GYPC 4Z1AA 3M0MA 3EKGA 4IPIA 3IVUA 4XZIA 4EF8A 4M29A 3VYLA 3PJUA 3NUKA 1QU4A 3VD9A 3WLHA 1PS9A 5K3VA 3GR8A 3W29A 1O1HA 3A5VA 3I4KA 4RLIA 2JFEX 4L64A 4HYRA 4DF2A 3WMLA 4AF0A 1UA3A 4Y2WA 1VPYA 2RDWA 1GWJA 1SW7A 3VVGA 1BLIA 3OGRA 5DY3A 1HGWA 3B8IA 2BS9A 5CPLA 2QVHA 4RXFA 1W5OA 1Z7AA 4F2TA 3WSUA 3Q94A 4XX6A 2B0MA 3O1NA 3HU7A 2VZUA 1XPGA 3C8NA 3QLDA 1PWLA 5HMDA 2QJMA 4H3DA 5HPOA 1QJWA 1FDZA 4OGZA 4O0ZA 1XG3A 1U5JA 3TU9A 5K2ZA 4DUXA 3UCDA 2PEVA 1NIUA 5HA7A 3KOZA 1FWGC 5H8PA 1CGVA 2YZ5A 3B05A 5DBTA 3WH6A 3K8KA 2R82A 4IFOA 1V6YA 2XM1A 4GUJA 4GBUA 1D3HA 2WJFA 5IHSA 4P2VA 2C1HA 4JQ3A 4UTUA 1KXVA 2CETA 5HBFA 1OQFA 2PU0A 1V5XA 3UESA 2NWSA 3AU6A 1LDCA 3GAKA 5I2UA 1Q2RA 5DX7A 5DCEA 2GGEA 2W3ZA 2BVYA 1B3XA 2GDQA 2NXIA 3AXXA 3T0AA 1IYXA 1J2BA 4H2HA 3QMRA 4E4UA 1JDFA 3WD2A 1Q6OA 4O1AA 4S39A 2Z2AA 3E3HA 2W62A 3II1A 2YKKA 3QY6A 5C8BB 3PC0A 1R5YA 1KFCA 1IIHA 3HJZA 4AG0A 2QGYA 4MWAB 4LV9A 4Z0JA 3ORWA 2BGSA 4BEUA 3WF1A 3L4YA 2VDIA 7ENLA 4GX9A 2WW5A 3ARTA 2PGRA 1FP9A 1J0KA 5EA9A 5BW6A 3UR5A 2E9LA 4AZHA 4B5WA 4PN2A 5A69A 3PFMA 4K37A 3CL7A 5HJXA 3SAZA 1ODUA 4O57A 2DQWA 2W9MA 2FH8A 2R24A 1AVAA 1M53A 3GFYA 2WSRA 4AZ5A 1C9DA 2VC5A 3KEHA 3UXKA 1A4LA 3SECA 2Q02A 5EMYA 2XVKA 3PZOA 4LW7A 4BCEA 2QJHA 1S3HA 1HXJA 3E5PA 2IS7A 1P5BA 4KERA 2GGHA 1UUMA 3T8QA 3KBMA 4JD4A 3VIJA 2DZUA 1N55A 1UR3M 4HNNA 1LROA 2R94A 3WBEA 5BXRA 4HOXA 1U5VA 3CUJA 1WZAA 2O7SA 5CBJA 4KCTA 4UWMA 2VDHA 4DELA 2HV5A 3SQSA 5AZ0A 4UMAA 4S3KA 4NX0A 3PBYA 1EUNA 1MDLA 3UVIA 3ONCA 1XYAA 1YNYA 3F4DA 2QXWA 3AISA 4O8RA 2VEIA 2PI6A 3U3HA 1Q5MA 4TOQA 1KBKA 1PKNA 4C1LA 3CB3A 2J62A 4R9XA 1PX4A 3S83A 3V0SA 2FZ8A 4YVXA 3VFLA 1JZ8A 3RLVA 2ABAA 4CQCA 3CM4A 3DOPA 4MZYA 1F4HA 3ZJ6A 2C1GA 3SN1A 3WQ4A 2GFTA 4IL0A 4IGSA 1FWJC 4K7YA 3WNPA 2EG6A 1VLWA 4ATLA 3DHFA 2DEPA 2V63A 1GOMA 3CL8A 1JZ7A 4QDWA 2QUNA 4PB3A 4I8DA 5AC4A 2PB1A 1H61A 4ICMA 4V27A 2Y5EA 4KWOA 4C6NA 1P6WA 3FKRA 3BVJA 5LIXX 1J0HA 4FXJA 1BYDA 3IIZA 2PZ0A 3KLKA 5CC6A 2IUZA 1SSDA 3BQ6A 3GIPA 3GZAA 3OOQA 2V5CA 3V75A 2DW6A 1PCWA 3KRBA 1OK6A 1YDOA 2P0OA 4D9PA 3E2VA 3NQMA 4XD3A 4CQBA 1RH9A 1JPDX 2A3CA 2VQTA 3SCWA 2FMOA 1JULA 4S23A 5M17A 1IT0A 5LIYX 5ABHA 2QAPA 1W0MA 4KEZA 4DUOA 4Q8QA 4YIWA 3OLGA 2VZTA 4KESA 3UR7A 1Z48A 2EQDA 3MKKA 4AYGA 2IPGA 1EYWA 1CYGA 1VBJA 3DFHA 4IUOA 2QLYA 2X7VA 5DMNA 3RPTA 1NY1A 2Z26A 3SIZA 3M0IA 5GNZA 3U57A 4MZ8A 2BLEA 3LCLA 3PZQA 2O92A 2QF7A 1W3LA 1PIFA 3CZJA 3DECA 1RZMA 1A5UA 3MVTA 4WSHA 3M9YA 3ZQ9A 2VELA 1YDNA 3V18A 3ZT6A 2X09A 5LGXA 2PDJA 1EGVA 4JTCA 5D9OA 1YE6A 2YCLA 3QOKA 1BPLB 2ZVIA 3O6CA 5BRQA 2C8NA 3C61A 5G2HA 3L67A 3KM8A 5GNYA 1MO0A 5HQLA 4DO4A 3GU9A 3WLPA 2Y89A 1F8IA 1GZ1A 4DN1A 5DXYA 4M19A 2WCSA 3NGFA 5KITA 1S5WA 3D46A 4GXMA 4D1JA 1YTDA 4A6GA 2Y61A 3KP1A 4DJDD 1TR9A 5BNKA 1EJSC 3AIEA 5TBOA 1VZWA 2F6KA 1V0KA 3VOFA 4ML4A 4OTKA 4NRSA 5XINA 2WQPA 4L4PA 4LS0A 1TTJA 2IQ0A 1Q6FA 4ZE4A 4MJZA 4NZJA 2NW0A 3VUSA 4O1DA 5CEWA 4PL2A 1MW2A 3BCDA 2W4XA 1JAEA 4HBKA 3PB0A 2RHGA 4PUDA 1KCXA 4YHGA 5IM51 1WB0A 3KOWA 4GQGA 3UCQA 4WKHA 1G5AA 4JZ5A 2ZA1A 1EC9A 3ABRA 5LGZA 1A5OC 4PUNA 1RD5A 1JXKA 2ZADA 3GZ3A 2OKTA 2XZ9A 3PR2A 4QSFA 2A7PA 3H2CA 4IIDA 2VOMA 1O68A 4GUFA 3PWGA 1UD5A 5CPMA 1XINA 4GIRA 5A8OA 1JG9A 5ABFA 1JL8A 5CJNA 1JZ2A 1LUCA 2YOCA 4NX5A 4K39A 2V0TA 2GQ8A 4NG3A 4F0HA 3UG4A 4BWLC 2EBNA 4IX2A 4U2YA 2SFPA 3JUGA 2WMHA 4L6HA 1I2PA 3ERPA 1PWMA 3EOEA 2YL5A 1TPDA 4AVOA 2W67A 5K4XA 4IIFA 4HK6A 2VTFA 4AU0A 2QNEA 4ACYA 1V6UA 4LWWA 3UZ5A 1R47A 2Y63A 4MKNA 5LA0A 2P3ZA 1JDAA 3H23A 1GVIA 3QOMA 4UCFA 2J7HA 1YE4A 4ZQNA 2I56A 2WHMA 3TOPA 2CLIA 1O4UA 4GA8A 1CGTA 3VE7A 3W1XA 1J11A 4NJGA 3MUY1 1E3XA 4DEFA 3O6AA 2R14A 3IJ8A 2GSHA 1GZGA 1XI3A 1E6ZA 2YIHA 1UWIA 5HK4A 1O66A 1OFEA 3GTNA 1ZAIA 2DGAA 2OGYA 4AISA 4AD0A 1A0CA 3J7HA 3S9YA 2W27A 4U3AA 1BYBA 4B5XA 3H4XA 2OYKA 1SZEA 3KW3A 3ARSA 1VR6A 2QDHA 1W31A 1XCXA 5IBXA 3DFOA 3ANYA 1LBLA 3OB8A 2FDSA 4IPNB 3RDKA 4D71A 4L80A 3WLLA 5F7UA 1ME7A 1K7FA 3HGRA 2HEJA 3T2OA 3FEMA 3R79A 1TCMA 5FJTA 5C2XA 3V36A 5ABGA 3QV8A 4QJ5B 4XZ9A 1L2QA 4RZ5A 1KTBA 4WDTA 1ML1A 3PZTA 4KCVA 1UH3A 1FWCC 1EP2A 5CAKA 3M0KA 4RNFA 3MANA 1OEPA 5M5DA 3Q58A 4XAPA 3TK7A 3NZ1A 5A6BA 4RNHA 3OA3A 3CHDA 2OGJA 2V3DA 1VPXA 4MY1A 2E8ZA 4YXGA 2Z0IA 2HXUA 5CKSA 1Q65A 2ZWYA 1JYNA 1WPCA 5I77A 3E2RA 3EA3A 3MI3A 8A3HA 4BF9A 4Z1YA 3DHDA 4J35A 1BF6A 3FXYA 1K8YA 4K8GA 5DXXA 4AWTA 1AL8A 4J5NA 4QLLA 3B04A 3EOSA 4US6A 1SVDA 3OQEA 1Q6RA 5CSRA 2WJEA 1G1YA 3ITCA 3VC6A 2D1ZA 3P67A 3S0CA 4ZSUA 3IGUA 3CZEA 1L6GA 3APYA 3O9NA 4NZFA 1H11A 3STPA 1QPOA 3RAOA 3OYZA 5IRPA 1MEIA 1XIBA 3MZ2A 2ZXBA 3UXLA 3V16A 3L4TA 1YPFA 1EP1A 1W9VA 2VX4A 3HQNA 3S1XA 3KP0A 2ZRUA 3WH5A 1XUUA 4X9YA 1UC4A 3MS8A 2E7FA 4LYPA 1L8NA 2V5KA 3VZYA 2VJXA 4PCNA 2PDCA 4PUJA 2OWXA 3T08A 4AMCA 1XIEA 2X1IA 4YPJA 1PEZA 2IKJA 2V82A 1PPIA 1VCFA 2WPBA 2ADAA 3UG5A 4KRUA 3KOFA 3IJ6A 4H9ZA 3R58A 3PUDA 4XKMA 3TYDA 3AMCA 1A5SA 3NO3A 3RRXA 1F6YA 3W6LA 5BMWA 2CU0A 3NQBA 1MEHA 1KD0A 4JIIX 3JW7A 4L6DA 2YR1A 2DVUA 2WJDA 3EPOA 4C1NB 5EY5A 4OJYA 3EDFA 1MEWA 1ONXA 3FVDA 1OABA 1GKQA 1GZJA 3NR0A 3TXVA 3I68A 4Q3MA 4EOUA 7XIMA 4B3ZA 2PODA 2V8ZA 3OVPA 3OZYA 1JUBA 1H41A 1OX6A 4RNIA 3I7RA 1NM9A 1M7OA 1GVRA 4GKTA 4LUYA 1P7TA 3ZWTA 3S5NA 3LBCA 1AL7A 3FHAA 3FIGA 2FZNA 3TN5A 1TQXA 5FI8A 5FAGA 2WSQA 3M0YA 4NF7A 1FWAC 3G8RA 3IV8A 5H1WA 4FF7A 4GJ1A 3S5ZA 4RDWA 1XDMA 1Q6QA 3VXGA 3OZPA 1PDYA 4GZJA 5U4NA 2ZX6A 2WC4A 3F5KA 3ICJA 1FRBA 1WQ5A 2EPLX 3IANA 3SW6A 2X8RA 1VC4A 3MB9A 1FWNA 5I03A 1OT1A 3A13A 1BG4A 2RJGA 2XN1A 3KRZA 3IJ7A 3UR8A 2PC4A 4TMCA 5E93A 4GI8A 1BSIA 3XISA 3K8MA 4HPNA 4HNLA 4FALA 9XIAA 1K4GA 4U2ZA 2IPWA 3VTRA 2V3GA 1TPH1 3LENA 4MUZA 1F7BA 1EDQA 5HNTA 2PUZA 4DBDA 4NUWA 2OOGA 1E6PA 4FXFA 3KRSA 1WOBA 4FR6A 3W26A 1YLVA 4Q22A 1JI1A 1ICQA 4KKXA 3EWUA 1U22A 2WZTA 3W1NA 4F0KA 1S1PA 1PL9A 2FFIA 5D30A 3BZJA 4GQQA 5A8NA 1L0PA 3DHPA 5AVHA 3R11A 2FQIA 4L6OA 4QQUA 3NTYA 4ZFMA 2QULA 3AI0A 3G1XA 2WBKA 2PC8A 1ZFJA 3RITA 5FJUA 4WDXA 1A5BA 4AH7A 5CZ0A 1UOZA 4AW7A 2OYMA 5EMMA 1DEDA 4ZO7A 1QHZA 1PTAA 3F2BA 2BY2A 5ENLA 1UKPA 4FX7A 1DORA 1DJZA 4I9JA 4UFJA 5JBFA 3NSXA 4E2VA 1F3XA 4MY9A 5EFFA 1J79A 1ZZMA 2VEFA 2C15A 4L9YA 1E70M 1GW1A 5C5YA 4HPGA 5MF5A 1XDJA 4HMCA 1HO1A 2QCGA 4TVDA 3BAKA 1UWUA 3LA4A 4LUTA 2PBOA 2XIOA 2PLMA 3OG3A 1V3IA 2D2OA 3OYXA 3PAJA 3B0UX 3NQGA 3QLLA 1KNWA 1B3VA 2CZEA 1QPRA 4BEQA 1UOKA 4TX8A 2I16A 5E5CA 2F2HA 1RA0A 3EB2A 2VFDA 5D04C 2HXTA 5GJMA 1DHKA 5CPQA 1C7TA 3W6MA 3GLCA 3WD0A 3AC0A 3PTDA 1RQEA 4KGJA 2HBXA 1OGSA 3JZEA 3UJEA 3C4UA 4QE1A 4LVGA 3MHGA 4ILSA 1TPVA 4O28A 1C3FA 3C86A 4TIMA 3VMNA 3SUWA 2Z4GA 1SMDA 4IPJA 2A3AA 1LQAA 3ARVA 2DZAA 2XIJA 4QLJA 3NQ6A 1K3UA 4MWAA 4XZNX 4JN6A 3W07A 2EPOA 3GAYA 4LCSA 4JAWA 2ZUTA 4DWDA 4REQA 2VZSA 2EAWA 1NELA 3CQJA 4PRTA 3L68A 4YWSA 3BUVA 4I90A 3O07A 4IJRA 3AJ7A 3TQKA 3VIKA 5A2CA 3MA8A 1GONA 1O7AA 2CXEA 3UXIA 1UUOA 2OX1A 4WY0F 1UWTA 1RK6A 1AD1A 3APTA 5JXQA 5DLCA 3W1LA 3WJYA 3OU8A 3SFKA 3EXSA 3CH0A 3GU1A 4AC1X 4FP1A 3DYMA 3C3NA 4GVGA 4L1XA 4AY8A 2J66A 1BYCA 2UZ9A 3L5AA 4ZTYA 2O4MA 4JIRA 4XTIA 4M0XA 5AY7A 4LEQA 1BEUA 4PUMA 3PJTA 1OSEA 4DBSA 2VWSA 1XLKA 4IMGA 3O6YX 4RKAA 5CGTA 3MVIA 2YBVA 1GYNA 6TIMA 4C6JA 4M1BA 1A5MC 3ZLHA 4BF5A 4NJIA 3CV1A 2A7RA 3M07A 1YQ2A 2QW5A 3LHTA 2J7EA 4LAMA 3UZYA 3W1RA 3QZAA 2NVDA 5TF0A 4ADUA 3JVAA 3TTSA 1XW8A 1Q6DA 4US5D 2D0FA 4O16A 1MW1A 1SW3A 3TNBA 1CENA 3CAWA 2F61A 1B2YA 4O10A 3TQVA 2PP1A 1A50A 1TA3B 2OODA 1DE5A 2WNNA 4IMCA 5DMYA 1WV2A 1I4NA 3NFUA 3N2TA 2ISDA 3O06A 4W5ZA 3T0DA 4W88A 1FWSA 1NU5A 3W7JA 3ATYA 1E1CB 3LG3A 1C8XA 3MHUA 3G18A 3APGA 1X8CA 2NVAA 2B4GA 1TR1A 2Y2WA 5B7ZA 3QPEA 3B9AA 1RP8A 3C8FA 4P7OA 5CPNA 3QV7A 2AGKA 3VM7A 4KPLA 1XPYA 4IGMA 4CNTA 3LTYA 3U2CA 2QJGA 1GKPA 1YYAA 3H12A 1DQWA 1NWUA 2HVOA 4GJJA 5BU9A 2A0NA 4ICCX 2X40A 4LB4A 3A4WA 3AMGA 3PPFA 5G5IA 3BJSA 2JF6A 1B9BA 3M41A 2WAGA 3P81A 4CD5A 2HSAA 3K5XA 2Y8KA 2G50A 2OZTA 3IWPA 4IHCA 3M46A 3EB4A 1SR9A 4YCOA 3PTKA 1KRMA 4U4MA 3B8WA 1YW1A 4GI9A 2YL9A 3H53A 3H2EA 4R34A 5LIUX 1YDYA 3TDFA 4S3GA 2F7FA 3M43A 4KEUA 4YN5A 2NT1A 1UZHA 2Q01A 2IQTA 4FOKA 2PDUA 6ENLA 5K9DA 5KZDA 2PRMA 3N04A 3Q67A 1RBOB 4LS1A 4QQ3A 5I3FA 4PL1A 1OVDA 1GEQA 2BDQA 1J0JA 3BLDA 4E3VA 3ONBA 4LAOA 1DWAM 4QISA 2PA6A 5BRPA 4GI4A 4DYKA 2IPJA 4J2PA 4WLCA 3TEVA 3VCNA 4R9OA 2OCZA 4JHMA 2DUAA 3W6YA 3G1AA 1XIDA 3EZ4A 5A8QA 1EJVC 4GCXA 3OW1A 1K9EA 3LHYA 1GT8A 3DC0A 3LHWA 5LSMA 1FDYA 1E9LA 3RPDA 2VC9A 2ZRZA 4JYEA 3CWOX 4HCDA 2D20A 1UMYA 1XSKA 4QDMA 4LTSA 2QMKA 3IVTA 2OQLA 1UWRA 1GOXA 3LQGA 1JNDA 4EAYA 3TN4A 1BRLB 1QPQA 4J3UA 4Q4MA 3MP3A 3W1AA 3G1SA 4HN8A 2VR2A 3GDRA 5A8MA 3IIPA 5I5RA 2WPGA 3W7EA 5ABTA 1ZALA 3GTHA 3KTXA 4HQVA 5AHNA 2VFFA 4GCAA 2VENA 1F6KA 3PY2A 1W9BM 3T9PA 1W3IA 3W2NA 1G9HA 4FO4A 2NUYA 4DZAA 3ALFA 4GNVA 4FIQA 3QKEA 3GXPA 2FHCA 3REQA 1LOSA 3LYEA 5G4HC 3SCNA 3A6OA 3BWWA 4L4LA 4RZ4A 4IXHA 4YYFA 4HHPA 5KEZA 4LRTA 1ISWA 4DNMA