3VOGA

Catalytic domain of the cellobiohydrolase, cccel6a, from coprinopsis cinerea
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
362
structure length
362
Chain Sequence
VPSTGNPFEGYDIYLSPYYAEEVEAAAAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYDLPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNMNVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDAGRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQGRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYDTHCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the structural changes in two cellobiohydrolases, CcCel6A and CcCel6C, from Coprinopsis cinerea - a tweezer-like motion in the structure of CcCel6C
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase
molecule keywords Cellobiohydrolase
total genus 137
structure length 362
sequence length 362
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 3vogA00
1UP3A 1OCJA 3A9BA 4I5UA 3VOIA 2BVWA 3RPTA 1UP2A 4AVNA 3VOJA 3A64A 1GZ1A 1OCNA 1OC6A 2BOEX 1DYSA 1TMLA 1QK0A 4AX6A 2BOGX 1UOZA 1HGWA 1UP0A 1CB2A 4A05A 4I5RA 2BOFX 3VOHA 3VOGA 3VOFA 4B4HA 1OC5A 3ABXA 1BVWA 1OC7A 1QK2A 1QJWA 4AX7A 4AVOA 1HGYA 4B4FA 2BODX 1OCBA 3RU8X 4AU0A
chains in the Genus database with same CATH superfamily
1O5RA 2J7CA 2J7HA 4MWAE 4CLMA 5HJLA 3QLLA 3VKKA 4C6JA 4Q8TA 2QPUA 2CITA 2NVCA 3WLLA 3BG5A 4P7RA 4NSBA 3W7JA 1H2JA 2CBVA 3UR5A 3CUZA 1J9YA 3N4AA 4L7ZA 4D6CA 4B5NA 4L5ZA 4O1AA 4CU6A 4LUYA 1TZZA 4GO8A 2X7VA 4M6VA 1QI3A 1XIEA 3DIPA 4H9ZA 1F3EA 3H53A 4L1WA 4P7LA 2E5DA 1E6NA 2Y5EA 4LALA 2VEFA 4KWWA 3ECQA 4UOZA 3QFWA 1FDJA 1XBYA 4XAGA 2YCJA 1A0DA 4MJ2A 4B4HA 4GH1A 2JFEX 5LIWX 3LTYA 3R6IA 4KWOA 1PWLA 3K1GA 3VZXA 1EC8A 5CPOA 2V9DA 4ACZB 3PVFA 4N9BA 2O0TA 3NOEA 1OBAA 5BXRA 4CCCA 1EEXA 2YA1A 4Q33A 2IS7A 3P6LA 5A95A 3PN8A 5K9XA 2FGBA 4Q7NA 3WLHA 1BEUA 3KHDA 3OIHA 4A3HA 1V51A 2MNRA 4TQTA 4LUSB 3NSXA 3HQOA 4L6DA 3WF3A 1K9EA 1GCYA 5LGZA 1OFQA 4WKHA 3MMWA 3M64A 2WB5A 4FO4A 3KBMA 1LUCA 2V63A 2XWEA 4A8RA 5D32A 4RUBA 3VGDA 1X8FA 5FF4A 2X42A 3N73A 1KCKA 5CSRA 3U6WA 4HQVA 4DJFD 4PTDA 3NQ7A 3K1DA 3OP2A 4A3QA 2YBTA 4ERIA 1RJQA 3OOQA 3JU2A 2A21A 2E68A 4LSBA 3LHUA 2VJXA 5I3KA 3MSYA 1BAGA 2V69A 4B90A 4W93A 3K2GA 4AVNA 2HWGA 1TIMA 1EX1A 1QNRA 1S5VA 2XSBA 2XIOA 4DPPA 3OYXA 1E1EA 1JUBA 3T81A 1TA3A 4AZBA 1GOQA 1HKWA 1ISYA 4HZ7A 1E1CA 1OD8A 4DB7A 3WKZA 2OO6A 1LG1A 3MCMA 2Y5JA 1ELSA 2GQ9A 2A3CA 2IPFA 3L9CA 2YA0A 4AEEA 4NZ3A 5E0FA 4Y8EA 4OECA 2GDQA 5A8MA 3GXTA 3PBVA 4J40A 1O66A 3K8MA 3LCHA 1MQQA 5HOSA 2VDHA 5A6MA 3CZEA 5FJJA 3M0VA 1UR9A 2ZADA 1ZJBA 4YL2A 4KPLA 3ZO9A 1Q45A 1K9FA 4Z2HA 2YFOA 2F2KA 3VDGA 1BYDA 3COTA 4FOJA 2Z6IA 3P8IA 2ISFA 1US3A 4ZSUA 1DWGM 3C56A 4Y8FA 2C3ZA 3ZSTA 3AU6A 1LT7A 3W1AA 3W71A 3QV8A 4DJED 5KZMA 1KXHA 1R87A 2NWRA 4DJDC 3K8LA 2HS8A 2QR6A 4FHAA 2RFGA 3KHJA 5HMDA 3PPCA 4EPBC 2VURA 2OELA 3DHUA 1BTCA 2YSWA 1VC4A 3WNKA 3GU1A 1XIGA 1BG4A 4FOUA 1LL6A 3WQ5A 1KRBC 1RCOB 1RPKA 3WEOA 3ZVIA 1IXNA 2D23A 5GJMA 4M1BA 3WD4A 2YBVA 4D8AA 1W2PA 3LHTA 1IZKA 1M01A 1NWUA 3W6LA 2Z1BA 3TR9A 4PBGA 3E0IA 2CPUA 4WGHA 3DFQA 5REQA 1G5AA 2WJEA 3N34A 2Y6ZA 7REQA 2AMGA 4HNCA 2VELA 1AA1B 2BGSA 1NARA 2DSUA 5CC5A 4KGLA 3QRHA 1KM5A 5I06A 3R25A 3GB6A 4PUKA 5C5YA 1Y5XA 4UNIA 3TQ0A 5HINA 2WSKA 4UFJA 1H1ZA 4B4FA 2OCZA 3HG4A 1ENUA 4GFIA 1WAUA 5DCDA 1OSEA 1SSGA 3VKJA 4Q8NA 4W5ZA 5D2VA 1V02A 1UBPC 1CLXA 3PG8A 1IIGA 3MT1A 2WMIB 4J5NA 3M0YA 2NUXA 2HXTA 3A9IA 2WVSA 2P76A 3NM1A 3SUUA 4YHEA 3BW3A 2A1YA 1ISZA 1GOOA 1OIFA 3R0KA 4I3GA 3IIPA 1ADSA 3ITLA 4AF0B 3AALA 1NOFA 2INEA 1BHGA 3Q37A 3PK7A 3N2TA 3W84A 3MUXA 1WKEA 1GQLA 3ABSA 1B3WA 1UWTA 4IFKA 3USZA 2Z29A 4O16A 3VZZA 1KLYA 3WFLA 3ZT5A 4LGXA 1RA5A 4A22A 1KBKA 1V6TA 2Y24A 1WBJA 1MNZA 1JI2A 3L2LA 2VVSA 4ECLA 3WQDA 1Z42A 4DYEA 3GH4A 3ABRA 4NKCA 1UJPA 4KRTA 3RO6A 4F48A 1RBAA 3M5XA 2I7GA 3C61A 3K46A 1D8CA 1E15A 3IJDA 3BJTA 4CCEA 3KRUA 3FJ4A 4K8GA 3D6NA 4Z1AA 2YYUA 3QR1A 3RHGA 4M56A 3KLKA 5BXSA 4GX9A 2XVKA 3LZ5A 2FMNA 1P7TA 1QU4A 1LWJA 1JR1A 1VHNA 5EMYA 3AOFA 6TIMA 1XDLA 4D1JA 3MHFA 4PGLA 4UFKA 3I3BA 4AU0A 1W8GA 4P5UA 3UF9A 4DQWA 3UQNA 3W7MA 4QHRA 2PWFA 4AC7C 5H8PA 4AIUA 2KAUC 4LS0A 1SFTA 4YS1A 3GXPA 3H2NA 2D73A 3WL1A 1RVGA 2NLYA 1GVOA 3IVUA 1ICPA 1I2RA 3TJIA 3GWQA 3AYVA 3PTMA 5F2GA 5AHIA 4GE8A 1JCJA 4FR1A 4PMXA 5A5WA 4CQBA 3EWXA 3UXLA 3N3MA 3CC1A 4M7SA 3H8AA 3EPOA 4UFMA 3V0TA 4AAJA 1SJBA 5CJ5A 1BGGA 1CXLA 3ZR5A 3TNOA 5I3JA 1OQFA 1KXTA 3MV11 1OF6A 3G1FA 4TX6A 4IPJA 1GYNA 1K7EA 1EC9A 3W1PA 2QAPA 2PDFA 4NHVA 2EHHA 4XZNX 4PMDA 5AHNA 3MYOA 1TWDA 3PJTA 1XCXA 1IQ8A 2BY0A 2J77A 4DO6A 3EWZA 1BXNA 3UG8A 1KA9F 3VMNA 1J18A 4B91A 4R7JA 3TP4A 2AQWA 4J3XA 2DQXA 3UG4A 2CIPA 4YWSA 3OQEA 1GVQA 5HPOA 3DHFA 3QY8A 1ZAIA 3IK2A 1JCYA 2A0NA 1RXOB 4JQ1A 1J0YA 2O4MA 3LLDA 1GPWA 3VI2A 1L2QA 5CCZA 1WDSA 1N8WA 2VL4A 4LC8A 4EACA 5C9RA 1UG6A 3LPGA 1KBIA 3LBOA 3FA5A 1Y5WA 1WDWA 3PTQA 3WF0A 1XPGA 3RUBL 3O6YX 3KTCA 2PBGA 2HBVA 1VFMA 5HJXA 3EMQA 3QEZA 3NQMA 5HNUA 4FXJA 1A5MC 3EYPA 4JBRA 4HYRA 4PTNA 3KDOA 4YTRA 3DG3A 1JYVA 3ABZA 4GMEA 1NDWA 5B7YA 5TQLA 4N2YA 3DOPA 2OQLA 4AD5A 4Z1BA 5IFPA 3WBYA 3LA4A 3N1AA 2VRJA 4ML9A 1YXYA 4PUEA 1A3WA 4Z2KA 2DFAA 1AQFA 4XIMA 1MXDA 3WMLA 2Y62A 4ZOAA 1ZZMA 4HU4A 2DY3A 2Q71A 4AZHA 4NYUA 3GBEA 5I5RA 3NQ2A 2WKLA 4I6KA 1GOKA 1C3FA 1TG7A 2ZE3A 4FALA 3CYVA 3DI0A 2EPLX 2R6OA 4HPHA 4WJ8A 1W1ZA 1YE6A 3MWAA 3NPXA 4EANA 4HK7A 1GZJA 1UKOA 1VEPA 2IPJA 2QUVA 2BASA 3WLIA 2YXXA 3MA8A 2YLAA 1Q8JA 4C1LA 1YHTA 2C91A 3AXIA 2BV9A 3U57A 1DTNA 4GVFA 4LANA 4GNKB 3THUA 1QPNA 1HGYA 1RD6A 2ZYFA 2DGAA 1H5VA 2Q8XA 8CGTA 2OSXA 4L65A 4DXVA 1K7FA 2KZHA 4C6NA 2E09A 4XBSA 1V3MA 2VNCA 7TIMA 1E5NA 4IGNA 4MDPA 5CGQA 3VNLA 3ZSSA 4PULA 3OLGA 4UNLA 2EPKX 4RZ4A 2REQB 2J8GA 4QQ3A 2GDVA 4AWSA 3TAOA 3E6EA 4WGXA 4ZVJA 1DIOA 4UB9A 1R85A 3BAYA 3RCNA 4AZ5A 4CNUA 1DPMA 1TKKA 4GVGA 1ODUA 3VC5A 3BMXA 4ZQOA 1U1UA 3SFWA 5BW6A 1QHZA 1GGOA 2H6RA 3BARA 1GTHA 4U5KA 5JXQA 4KIRA 3W1XA 1AW2A 5K7JA 2XH0A 1X98A 2P88A 3P0WA 3H21A 1F3XA 4HPGA 1IWPA 4JTKA 2Y8KA 1NVMA 3TVAA 2ISWA 2PFHA 2VEGA 4Y9MA 5L6UA 3GR7A 2VOMA 5JBFA 1B90A 2YL8A 3MMDA 1OFPA 4MPQA 4Z1YA 1ZBKA 3QMSA 1XYZA 4WX2A 3FCPA 4DWSB 3WUFA 1S5NA 1FWWA 4W4QA 2XH4A 4KW2A 4H9VA 4EX4A 2QT3A 2V2HA 3P5YA 4E0CA 1AZ1A 4GJ1A 2WNNA 4O0QA 1ISXA 1TJRA 3DFSA 5E6ZA 4HOZA 2BXVA 4R7OA 2Z1WA 4EWJA 3HQPA 4L4PA 5E09A 3RX2A 3B05A 2O9TA 3QV7A 2IQDA 3TAKA 5CJNA 3CZ8A 3W7DA 2X0SA 1LP6A 4KERA 1MI3A 4K7YA 1R5YA 2CLOA 2CESA 1J6OA 1F4AA 1GQJA 5CC7A 4JNYA 4BS0A 1XRTA 2GOUA 3SCNA 3UWEA 1FWBC 1KR0A 4RX0A 2NQZA 5EMUA 3O7UA 1A5NC 2PGEA 4PMZA 1XC6A 4HMNA 2VKZG 3RM9A 4D8LA 4HOXA 1JEZA 4JIPA 3SUTA 1FHDA 3T6CA 3IJIA 4IUGA 4G56A 1KFCA 3LCWA 2VZTA 2VDIA 2P1FA 2ZIDA 1XC4A 1R7OA 3M0KA 4HP5A 5G4EA 3IAPA 5BU6A 1DWIM 2PF8A 3HGRA 4H1ZA 4REQB 4CNTA 3PTDA 4IMCA 2QUMA 5I7GA 3S1VA 4MUZA 3LNMA 1TWSA 3WENA 1MRAA 3CAWA 3I4KA 1D8WA 3K5XA 4JHOA 3TEVA 1K03A 1KTNA 3LB0A 1XLFA 2ZRUA 1LBFA 2X1IA 1UWQA 4FX8A 3BPWA 3RPTA 4WSHA 4YTQA 2EBNA 2PAJA 1DORA 4QAWA 5CSYA 1G4EA 1GUVA 1WZKA 3N4FA 5EYWA 2E9LA 3KOZA 3T8LA 3STFA 4ZCWA 2PTDA 2V82A 5HNTA 3KBNA 3W1NA 3W27A 3W53A 3F4CA 2QV5A 1HL8A 4L80A 3SM0A 1J0JA 3EBVA 3KL5A 1E6PA 3MDUA 3AHTA 3H70A 3D47A 5AY7A 4IMAA 4XZIA 4X61A 3IUDA 4M6QA 5HPCA 1R47A 2F61A 4JL1A 4ZEPA 5G2HA 3UT0A 4WY0B 4BEQA 3VCNA 1I60A 5IM51 4FP1A 3GYEA 1QK0A 4MVAA 3WLJA 4IGMA 5XIMA 1FXQA 4TMBA 3GVVA 3KVKA 4GLEA 1XIIA 5EPDA 3TU9A 5DF0A 4PFMA 3GIPA 3RG6A 4DWDA 4B5SA 3LTPA 4CCZA 5I07A 2GGGA 3LBCA 1JD9A 1JDAA 2OTDA 2J6VA 5HMEA 2VZSA 3MO4A 4NNAA 4JTCA 4KIEA 4X3ZA 3GC5A 1UUOA 1L9WA 3SB0A 2GJNA 2ZA3A 3VCRA 1Q85A 4UZUA 1ZBWA 1GVFA 1XD1A 4C5ZA 4DPQA 5AYYA 2EG8A 5CPLA 2D69A 3VIFA 4QEHA 3E5BA 5M2FX 4FPSA 2XIJA 1T40A 5ABFB 4O10A 4P7NA 1RP8A 2A7NA 2VR2A 2G4FA 3NZQA 4NILA 2V3FA 1PX3A 3PJXA 3RMEA 1BF2A 3FA3A 1AK5A 3ID7A 5LA2A 3BOFA 5D2XA 9RUBA 4S3JA 4B15A 2W5FA 1V8EA 3EKLA 1R3QA 1PHWA 4Q8VA 1SJAA 1HUVA 2O56A 3GUGA 1WAWA 3LXBA 1WOAA 1XFBA 3PNZA 1R3VA 3W29A 1AW1A 1PE1A 5EMKA 4X9YA 2J66A 1V3IA 3N12A 3U7BA 2QUNA 5A8QA 2DEPA 2JQXA 1C91A 4PA8A 1GVEA 4KCTA 4GA8A 1CXIA 4W89A 1Y7VA 3ITTA 1ME9A 4KESA 2A3LA 2Y7EA 1EO7A 1L8NA 2YFNA 2OT0A 3RX3A 3VFCA 3TN3A 3WLPA 3EOLA 3FX4A 1A49A 2DZPA 1SMDA 4K3ZA 3F2DA 3SCSA 1AH3A 1NDZA 1JYXA 3FAWA 1TMHA 2HS6A 1TPVA 1QHPA 3SCOA 3IUIA 5HMSA 4U28A 1OGSA 4B5VA 1BQCA 2QCCA 2QJGA 2PC4A 1T41A 3QHMA 4WCJA 3DG6A 1WYIA 5EMJA 1U5VA 2GUBA 3VGFA 4JTEA 2ZC8A 1WA3A 3WD2A 1VBRA 3O2LA 3N6QA 1MUCA 3HPAA 4MPKA 3G22A 1NF7A 3URQA 5HBFA 1C7TA 3PJWA 3TX9A 4I8DA 4GY1A 4I7VA 1FY6A 4O17A 3WJWA 4JYEA 1BSIA 3VNZA 2J78A 3ITOA 3N29A 4DJEC 5E9XA 1XSIA 3RO8A 1DP0A 3S3GA 1J0HA 3B97A 3S1UA 3WQVA 1SMAA 3WSUA 3EA1A 2PWUA 1PIIA 5ENLA 3W3OA 5A6JA 1A5SA 4DBEA 4I8YA 1YIXA 4FZIA 1E0WA 3F5KA 3LGDA 1QVBA 5LXEA 2OGYA 3OVPA 1RSCA 3W7PA 1EHAA 5LIXX 4GJJA 3QZ6A 1ICQA 2D2GA 2AL2A 2ZUMA 4FLSA 2MANA 2BLEA 1EJTC 3B4YA 3ITYA 2FPVA 4LVAA 1XLIA 4KRZA 3E2RA 3CT2A 1QRQA 3S83A 1TSIA 1XS2A 1G0CA 2E28A 3CHDA 3EDJA 2YYTA 3U0HA 3UG5A 1LL4A 3GC4A 5AB3A 5A94A 2CLFA 1L6SA 1VF8A 3RXZA 3CWOX 2HROA 3V5OA 1NQKA 3C86A 3KVJA 3GNOA 5GNYA 2EF9A 4W85A 4LYQA 3UU0A 1F6YA 3TR2A 4B16A 3AXXA 1MW2A 4JHZA 1AD1A 3CUGA 4GCAA 1JG9A 3TZNA 3W02A 5FD0A 1LG2A 4Q6JA 4UOQA 3W2LA 3RJYA 4JTAA 2IXUA 1L6FA 2YDAA 2ZZ4A 1TPC1 4J2PA 1IF2A 3M9YA 3NZGA 2PF0A 2NQ5A 3QKZA 4Z0JA 4HNTA 4IMDA 4OVXA 4WHBA 2Z1KA 1JZ3A 3RRAA 1TX2A 4H2CA 4C6FA 1S5TA 2GWNA 2Z2BA 5DANA 4AY1A 4JTTA 2Y70A 1TYGA 1WUEA 3NO5A 2Y5SA 4ZL1A 2NV9A 1VCGA 4YWIA 1I9CB 3DDMA 1VBHA 2BGNE 3AMLA 3MW7A 1TREA 3FHQA 2PTXA 5BMWA 1JGMA 2P3EA 1YLVA 4GABA 1FQ0A 1ESWA 3ZYZA 5IXEA 3T4WA 3TWAA 2JEPA 4NJIA 4NJGA 1UWUA 4GZJA 2QEZA 4A8LA 4L56A 1GQKA 3R1ZA 3AXHA 4HHPA 4LEQA 1S3TC 3PAJA 1O1HA 1PYMA 4FS9A 3WJYA 4S2CA 1XYAA 2OGJA 2H8ZA 2ACSA 4WDWA 3WZ0E 1TRDA 2QMJA 2YB1A 4XTDA 3ABXA 2XM2A 3R8GA 2DW6A 1US0A 1TFVA 1L6YA 4ZA0A 1DHKA 1HG3A 4DAFA 2YGYA 3QR0A 2GGIA 2FDSA 1CXFA 4PUJA 3UYCA 4YPJA 4LBUA 1XI3A 1LORA 2P0IA 3BAIA 3F5LA 4UTUA 3BICA 3LCXA 1KCXA 4J2MA 3W6YA 4BHYA 2C0AA 2O9RA 3GE7A 5A69A 3BMVA 3RF9A 3FY1A 1GJWA 3POCA 5FEXA 3BUVA 3STPA 4WY0A 2OKOA 5AHFA 4NXSA 2QMKA 2EPOA 5DN1A 3N3TA 3THQA 2QIWA 3P74A 3T0CA 3C2EA 4U31A 2J13A 1P0BA 3WJZA 3VDCA 2OKTA 1TELA 3QYSA 2Y2WA 4KFOA 1QTWA 1E40A 4B5WA 3G1RA 5CGTA 2DUAA 3LPOA 4ENLA 4QR6A 1UZHA 1UROA 1HKMA 2IPWA 5FJOA 3N9KA 1BXCA 1MNSA 2Y8VA 4UQDA 2VFEA 4UWMA 3WNLA 1RLDA 3RLVA 4UTKA 4JNMA 5DMLA 1S2AA 1KFLA 1H50A 4QRNA 1OG0A 5CH9A 5CC3A 3O05A 4HYWA 2J7FA 1BQGA 2VFGA 4O13A 1F8MA 1O12A 3NWRA 3SAZA 2PRLA 2WLZA 2CHRA 5AOUA 1JCXA 4ERGA 1LRNA 3LUTA 1KTCA 3PZMA 1DJNA 2J75A 3V75A 3SN0A 4PB3A 4AVOA 3BSHA 1MXSA 3ZT7A 3K4DA 3Q2DA 2GDUA 3H7UA 5K9DA 2FJKA 1U83A 3TTYA 2QCFA 1S2CA 3L2MA 2QKFA 1LLZA 3R10A 2F6UA 1O94A 2Z4GA 3ALFA 4IMEA 3ITVA 1E4LA 1CPUA 4PMRA 1AJ0A 4XD6A 1C9DA 3K4WA 3WK0A 2X2GA 1K3UA 4F66A 3AIRA 1E0XA 1PAMA 3RU6A 1SW0A 3WNMA 1SW3A 1AZ2A 4ALDA 5DX7A 2FH8A 3DX5A 4DYJA 3OG3A 5M5DA 3OGVA 2GFTA 1EDTA 2VZUA 1DHPA 3EXSA 1B3OA 4W8BA 1EA0A 1IGSA 1VD6A 2BP1A 1EJWC 3P67A 4XBJA 3BCDA 1JZ4A 3QOKA 4BQ2A 4N9CA 3EX4A 4C5YA 3MANA 4Q8PA 2J7GA 4UFLA 4TUFA 1WCGA 1TPFA 3CEPA 4LTSA 7PTDA 1OC7A 3B0XA 4DWSA 2F6KA 3BGAA 2PDHA 2HVNA 1FCUA 3SEPA 2JF6A 3DH7A 2JGQA 4YYCA 4KQNA 3BGJA 2P10A 4H01A 6ENLA 3KRBA 1YBQA 3PFMA 1UBSA 3WLRA 3W72A 3CHVA 3CUJA 2CLPA 1JGIA 3N25A 1XLDA 4PUMA 5CAKA 1PZ3A 4IIEA 1EPXA 5TBOA 4TX8A 1XQLA 2J9YA 4D6FA 1PZ1A 1OFOA 2EKCA 3H7VA 5HR6A 2WHMA 2BHUA 2YZRA 3L4ZA 4L6OA 3XISA 4Z2GA 2CU0A 3GKFA 2V3GA 3G0XA 2HQAA 2VQUA 1DWAM 3FEMA 5LNSA 4QFUA 2ICSA 3IJ7A 1A47A 3RN6A 3VM5A 2DH2A 3QFEA 1K8ZA 3HU7A 3WIJA 3ZMRA 3WDPP 4WK9A 4YYFA 4ICMA 4MWAD 3TMQA 4XZ9A 1VP5A 2G96A 1UASA 2FJUB 2WBGA 5HWJA 1K1DA 4CUCA 1W5NA 2FVMA 1F3WA 1QNOA 4HN4A 4IFRA 3AHVA 4DXXA 3LMZA 2AL1A 2I16A 1QJWA 2XIIA 3ITCA 4R5EA 3OG2A 4O4VA 4AIOA 1I2QA 5MHBA 2QF8A 3TYZA 4CD4A 3GAKA 2WKJA 1CEOA 3R79A 2NW0A 4ZMGA 1RD5A 3SADA 5HATA 4RZBA 3I7SA 1V5XA 2A6LA 3PBYA 5CC6A 3AIUA 4FF5A 4Q7IA 4QITA 1JI1A 1M5WA 1VGAA 1W3HA 4C6PA 3GDRA 4XKYA 4Q6XA 2PDGA 1TR9A 1JD7A 3UZ5A 3W4RA 3AXMA 1Q13A 4PUUA 1S1PA 2HSAA 1YNQA 2Z6JA 3L67A 2A7RA 1TO3A 2WJFA 4OOUA 3TN5A 1LT8A 4HZ6A 1OIMA 3FIGA 3FXYA 3WF2A 3E2SA 4IOTA 2PU1A 3K30A 4E2VA 3UR8A 1VEOA 2FQIA 1RH9A 1C8QA 1EDQA 3PB0A 2E5CA 1NTHA 1EJRC 4LY4A 1WDQA 2A7PA 1IEVA 4XD5A 4LAUA 3V5CA 3ZJ7A 3C0QA 2CEQA 3VKBA 4F0MA 2W91A 1DYSA 3FVMA 4XWUA 4AC1X 2DIKA 4IT1A 2J9XA 2ZDSA 3GO2A 1TV8A 1T7LA 4LAMA 1YXDA 2O7SA 1B4EA 2Y8UA 3G5EA 4UR7A 4GX8A 1YDOA 2CZFA 1AG1O 4FOKA 3FFSA 3W1QA 5C2CA 4QS6A 3PY2A 2W9MA 3IV3A 1OX4B 3UXDA 4NZ5A 3FYPA 1F73A 2BXYA 2QCDB 1LL7A 3AUJA 3C3NA 2ISVA 3ZQ9A 4RV3A 2WMIA 3C6CA 4KEMA 4ZSTA 4RZ6A 3HQNA 1B3VA 1GVSA 1JZ2A 4H9MA 1HJSA 3OO2A 3WQEA 2VZVA 3GHSA 3TDFA 2OX1A 4LCRA 1XINA 4XZWA 1SO6A 3HFTA 3NCOA 1YDVA 5DY3A 1H7RA 1YPXA 1DVJA 2ZXQA 3V0SA 3W7QA 1ZP3A 1VYPX 1P0NA 4UTWC 3CZKA 2OXNA 2G37A 5FSEC 4I5RA 3W2KA 1KM0A 3KBSA 1KBJA 3EB4A 2EJAA 4DBWA 1HQTA 3N6JA 4WKAA 1RQBA 2PRMA 4D2JA 3CQ0A 4EAMA 4HBKA 1JXJA 3IJQA 2WCGA 4ZBCA 3H12A 3O9NA 4CNOA 3CQJA 1OFRA 1PB0A 3HPSA 3STCA 2EO7A 3UZXA 1OM0A 1XX1A 5A2BA 3V18A 1RVKA 5BRQA 1QOQA 3HGJA 2W0UA 3NQDA 3SI9A 1IT7A 4Y96A 1ODZA 4IIDA 1ZCOA 1MUWA 2PCEA 4ZO8A 3KBVA 3P82A 4ML4A 2BG5A 3ZT6A 2AGTA 2ALDA 1EJUC 4UQEA 2BB0A 5AC4A 3E1F1 1ZLPA 4QG9A 4W7VA 3DUGA 1FCBA 1U33A 1XYMA 2OX4A 3A5VA 3N11A 3KZSA 2OLHA 2PDXA 4D6EA 1VEMA 3IGUA 3GFYA 3T0TA 4EPKA 3BSGA 1JRCA 4HHHA 1DQXA 4V15A 7ENLA 1QOXA 4LH8A 5HMFA 1X7FA 2ZQ0A 1D9EA 1EJ7L 3WD1A 2XVNA 2XH7A 5FOOA 1DQWA 1IR2A 1H5YA 5I02A 1FWCC 2YDQA 4O18A 1V02E 2F7FA 4S2BA 3L4VA 1LBLA 4FLOA 4BQ5A 1WKYA 3MI6A 2E8ZA 3GSMA 1S3HA 1YYAA 4W86A 2QCHA 5E6YA 4C6LA 3VOCA 2D2HA 2R1LA 5I2UA 3FDGA 1HF6A 4PL2A 4FX6M 2CBUA 2QJJA 3BJSA 4S38A 2QCNA 5K2ZA 3FSUA 1D7FA 1VBGA 2X30A 4WJXA 4XKMA 1XUZA 4JTQA 1OFEA 3GM8A 4TVDA 2PDMA 4L4MA 4OQVA 3CWHA 1VENA 4S3EA 3TYDA 2B81A 1LWHA 4O1BA 4F4RA 4MYXA 4HZ8A 4GRSA 1CXEA 3CZJA 3W01A 3NVTA 1FFRA 1MEWA 4QE5A 1Q7MA 1KV8A 3AFBA 5EMMA 3R5EA 4MWAA 1VFOA 2D24A 3PZIA 1H4PA 3IK4A 3OZYA 3GG8A 4RE4A 1KXVA 4PUWA 4EXAA 2QJMA 4HK6A 2OJPA 3ARXA 4NF7A 3VOJA 4CNPA 2EEXA 3LHWA 2A3EA 3LD5A 4UTMA 2CZEA 3BV4A 1YX1A 1MFUA 5G4HC 3CYJA 3O6AA 1VH7A 2ON3A 2QCEA 4KCVA 3F7JA 3BAJA 1EZ2A 2C1IA 3KRZA 1RCXB 2ANUA 4G6CA 1V3HA 4G5DA 3RPMA 2DDXA 4S3DA 2I14A 4RXFA 4XV0A 4RW5A 4IH3A 4WJEA 3UZZA 3L2IA 3WQGA 2VGFA 2ZZ6A 1OT1A 1PL9A 5E1QA 1M04A 4D6JA 1UPPA 3EDDA 3SSZA 3BLDA 3EPNA 4HCHA 3NO1A 3B0YA 4NASA 4U5IA 1UKPA 2QCLA 4M8UA 3U3HA 5M03A 3EA2A 4H2HA 4A8NA 1NFGA 2DJXA 2ZRVA 3RU8X 5FL1A 5CAHA 5FL0A 1W9UA 1G9HA 4C7GA 3L0GA 2J7DA 1LJYA 5FACA 3LG3A 1O95A 4JTHA 2VEKA 1R3YA 3TW6A 5M3WA 2AOSA 4JN7A 4WXZA 5A6BD 3NQ8A 1QPQA 3DU0A 4F2UA 4ACYA 1X39A 2PDIA 3CQIA 4MM1A 4G7EA 3AIWA 3N2XA 1GVIA 3C5QA 3OLDA 4L6HA 4PH6A 4CN4A 1NWSA 3KCOA 3W76A 4LEFA 2HNHA 1E70M 1AQ0A 1TTJA 5CZ0A 4JIIX 1I4NA 1EL3A 1YNYA 2AQOA 4XAFA 4ADUA 1EXPA 1TTIA 1XWYA 1GOMA 3RR1A 1TV2A 2XG9A 3DGBA 3IEBA 1YPFA 4CNSA 3P80A 1PPIA 3OA5A 4INFA 2PE4A 4XKYB 2FZBA 4IFOA 4EE9A 4UXDA 4YHGA 4CU7A 2BOFX 4WLCA 1OFDA 3DFYA 4O28A 3SO7A 3VD9A 5BWFA 3H22A 3MI2A 5HUPA 4I6VA 1C8VA 2RH9A 1FWGC 1IGWA 2UY5A 1ZAJA 2E9MA 3MCOA 1QNQA 3CPRA 5BROA 2GJLA 4L4LA 3WH5A 4DJFA 5A6SA 4XQ6A 2ZX5A 4LUJA 3AIBA 4KCUA 4PRRA 1GTEA 1TPWA 3SCPA 3FDKA 5IRPA 1NP2A 1PZ0A 2ZUSA 1H1YA 4QG8A 1KM1A 1UW9A 4HZMA 1F6KA 1ONRA 1QO5A 2H90A 4QGCA 1MVYA 3H23A 3NSMA 4MAVA 1V3LA 1JF5A 3M1ZA 4P7OA 1BYCA 1W32A 3AZRA 1G4TA 1W1A1 2PA6A 4DM2A 3HPZA 3AHYA 3GG0A 4H9TA 1HN1A 2FZMA 4P2VA 1UD4A 2V30A 3GDBA 3UGRA 2HEJA 4PCPA 3HF3A 1B2YA 1UH3A 5BNKA 2XHYA 4EF8A 4GQ0A 2PU0A 3BCJA 2GVEA 3EKZA 2PDPA 3IJ6A 1M3UA 5GQBA 4M29A 4H83A 3WH6A 1XRFA 1DXIA 2HK1A 1FDYA 4UTJA 3U7VA 4IQEA 4HHMA 3MP3A 4UUIA 3Q45A 3CGTA 2CETA 3WDQA 3MZ2A 5FA5A 3BCFA 1J8VA 3LSBA 2G97A 5LHFA 1JFHA 3S2LA 4K1WA 2YW4A 2OOGA 3KCJA 4C60A 1I6NA 3LCIA 3G0SA 4C1KA 2WSPA 3GFZA 3REQA 2DZWA 1OCQA 3GXFA 1B30A 4OJYA 4L64A 3S4TA 1I1WA 3VIIA 1KC7A 1UWIA 3T2PA 3LK6A 3CT7A 3AWOA 4LYKA 4MB5A 1ECEA 2A6NA 1HVQA 1PTGA 1HW6A 3RLUA 1PBGA 4JAWA 2YLLA 2IKIA 3SSJA 2WMFA 4HPJA 1XCWA 1XG4A 1QHOA 1QBBA 4AWTA 5XIAA 5EMLA 4LFYA 3F4WA 4DF2A 2VXNA 4AB4A 4R3UA 2NV2A 3K13A 2ZA2A 2D22A 4O15A 4D9PA 1B9ZA 1VPQA 1W9PA 4F9JA 1TJ2A 4HU8A 4MKSA 2ISDA 2WPBA 1KNWA 1ITXA 2R8WA 1U2YA 5LA1A 4GY7A 4XX6A 4MOZA 4CQDA 3W7NA 5FESA 1PDYA 5DMNA 1E6QM 4BCEA 2ABBA 1RUSA 4GBUA 4GVHA 1XBVA 3GNPA 1LCOA 1FKWA 4HNUA 2UV8G 4LVDA 1YADA 4AW7A 1D3CA 4JXCA 4NJKA 2GQ8A 3F4VA 2V2DA 3SY5A 4Y7EA 3NEVA 3GYCA 1Q6FA 2HVMA 4NZCA 2NVDA 1RP9A 3AYRA 3O8AA 3OYZA 3CB8A 4LY8A 1XDMA 2OOFA 1XLBA 4C1NA 1DKWA 1E1CB 3OB8A 3IGHX 5T26A 3R8HA 4NAEB 1SO4A 5RUBA 5G2IA 3B8VA 3MJYA 4YCPA 1TTPA 3M7WA 3PSVA 1FKXA 3WLOA 5D2YA 3VIHA 1YTEA 2ZUTA 4ADSA 4OU1A 1LZOA 3FAXA 2RDXA 3FW6A 3LPFA 2QUUA 1FUYA 3S2NA 2F84A 4C6OA 3IARA 1FWIC 1UHVA 4MFDA 4BQ4A 2DQWA 1KKRA 4LRSA 2E0PA 3UNDA 3UCQA 3G1VA 4AMAA 2I9EA 1RHCA 4Z42C 3OBKA 1ZL1A 1FX6A 5H1WA 4NAEA 1B3YA 1CENA 1KGXA 2Q8ZA 4IZGA 3A3WA 1XJBA 1R8LA 3BGGA 1JZ7A 4KRUA 5HAOA 2CBIA 3AIQA 4UMAA 4BI6A 1UQZA 3AMGA 4N0RA 1J2WA 3QHNA 4GI6A 3HPFA 1FWHC 2A4AA 1UP0A 4GHRA 4A35A 3LLXA 4U3CA 4M0XA 2IQ0A 3NXLA 4RCXA 1TCMA 6XIMA 3MDWA 1ZAHA 5DELA 2DZSA 3O6DA 5IOBA 4WSKA 3B0UX 4O57A 4HOWA 3CAVA 3MY9A 1B57A 4H7VA 3KEHA 5I0DA 2HJPA 3W73A 2WKGA 3H54A 4ATLA 3SQLA 3IJLA 3OW1A 4CCDA 5AHMA 1DJWA 1FFQA 3EDFA 3QTGA 3NQGA 5IDZA 2CC0A 2YCEA 4DX3A 4GIAA 1B3XA 1ISWA 1PV8A 1CWYA 4CQCA 4Y90A 2ZWZA 5EL1A 4HT3A 2ONEA 5IBXC 3FEQA 2GYIA 1OC5A 1UZ1A 4L1GA 1XP3A 1GWJA 1PZ2A 3LQGA 4IISA 1ZALA 3Q58A 2E77A 1C90A 3CXOA 3QPYA 5CZSA 4G8TA 3VD5A 3ABOA 2HNEA 3PM6A 3ALGA 4DEFA 5GJNA 3CIVA 1ICSA 1V6VA 1XLEA 2ISSA 3H55A 5CLTA 2OLSA 1XGDA 4RDZA 3E0LA 2ZX7A 4K2SA 4WKFA 2VEIA 3BLLA 4HHLA 4H6RA 2V38A 1FWDC 4GPNA 4GYFA 1SW7A 4AMCA 2Z1VA 1QPKA 5A2AA 2NQHA 2VZOA 3M0LA 4OOZA 5C9UA 2H3DA 3BW2A 2PI6A 4MHBA 3FHAA 4L9ZA 3KAOA 4PUDA 3QC0A 2QUTA 4XB3A 2D0FA 3C3UA 2PDCA 1R86A 5K3VA 2IUZA 3KW3A 3LRMA 4HB7A 3ARZA 6A3HA 3W7OA 3CPGA 2ZX9A 1EH9A 1PKYA 1HKJA 2R1MA 5A6KA 4V27A 1GZ1A 3UXIA 3CO4A 5BWAA 4AYSA 4E38A 3TKFA 3P84A 1V0LA 1NU5A 4BY3A 5A6BA 1CI1A 1CXKA 3NZPA 5CPTA 3GUWA 2QVHA 2X1TA 4HJFA 2V5JA 3QW4B 1RBOB 2L5HA 4I9JA 2FTWA 1UKTA 5LYRA 4C65A 2XWDA 4RNIA 1Q6DA 1IT8A 4EOUA 4JX5A 1GHSA 3QBUA 3BQ5A 3TXZA 1QNVA 1CGVA 1M7XA 1BWLA 1OF8A 1K8XA 3M07A 1W31A 3LXAA 1Q2RA 3F4DA 4UQCA 4UTHA 2BVDA 5AZ0A 3QY7A 2HV5A 3DXIA 3GRIA 1G6CA 3TW9A 1Y5VA 2DZBA 1QMLA 4WY0F 2G95A 4GUHA 1S5MA 5DLCA 2QW5A 2V68A 2JKEA 2J7BA 2GL5A 3T0AA 1MWOA 4MJZA 2BWGA 3GVGA 3GFXA 3GNRA 3GR4A 3M16A 2I9UA 1JL8A 3LS9A 4GUIA 3WEMA 1YEYA 3QF0A 3TONA 2FTPA 3SCWA 2QGHA 3JVAA 3PUOA 1UD8A 5G1TA 4MKNA 1QI4A 3NXFA 2DVUA 3U9IA 4S1FA 3A4WA 4A3YA 2O9OA 2J8FA 1BD0A 1N7KA 3MQTA 1SO3A 3H2AA 3LBMA 5FI8A 3CLWA 3QLDA 1XYCA 4RNHA 3LCFA 1GKQA 4Q8OA 1X6LA 1WV2A 1VFTA 4F0LA 5ECUA 3WELA 4IX0A 5KMYA 5FF3A 1NAL1 4Q4MA 1DBTA 4KKXA 3UBPC 2Y0FA 3GK0A 2VHLA 3JR2A 3L65A 1Z3NA 1V77A 3NTYA 4PMNA 3LV6A 4REQA 5CKSA 2DSZA 1SO5A 4JN6A 4KFPA 1O7AA 4MKVA 3NO3A 4NIRA 1EWEA 1XLLA 4HCDA 4H6EA 3T1GA 5F4WA 2VDGA 3W2JA 2V6AA 3AS0A 3AS1A 3LZ3A 3B3DA 3UWWA 2E9BA 2DPEA 3BLFA 3DENA 4GFSA 1W5QA 3GIQA 2PGWA 3KDNA 3B9AA 1VFHA 2G3JA 2WV8A 2YX0A 3R0UA 4C7DA 4CD5A 2WSQA 5E9AA 1SVDA 4X60A 3FKRA 3T78A 4M6UA 1TA3B 3PBMA 1YDNA 4LUTA 2Z25A 4QTGA 3E2QA 1MDRA 3PSWA 3OGSA 1Y65A 3KUMA 1OVDA 1E6SM 3P2VA 1WQ5A 2EXOA 3WQWA 4RPPA 2C8NA 2ZXDA 8A3HA 3HV9A 2GVYA 3U4AA 4EK7A 2OG9A 3QW3A 4DXKA 3M0MA 4GYPA 1WZMA 3LU2A 4AEOA 3SN1A 1C8XA 4HTYA 5JBDA 1J0KA 3DCPA 4PEEA 2DZXA 3M43A 3H4WA 1EJXC 2V0TA 2J4GA 1UA3A 1XH2A 3BE7A 5D9OA 1OT2A 1Z69A 4ADTA 3UPMA 4LW7A 4RR4A 5AC6A 3LGGA 3H26A 6TAAA 5I00A 4IL0A 3PPFA 5FCZA 1UD2A 1H63A 4MJ4A 4DUOA 3A3HA 1W37A 3RNDA 2D0HA 3WN6A 4V33A 2AMXA 4P7QA 2JIEA 1YRRA 9XIMA 3T2OA 3H2OA 1H62A 1KQYA 3KM8A 3T42A 5HWMA 1A80A 1XLHA 2PRHA 1WDPA 1AL7A 4GGHA 3OIXA 2V5CA 4RE2A 3E12A 4GOAA 5D2TA 1ME7A 3NQAA 1K02A 1OX4A 4LUTB 2VX7A 3TA6A 3SCVA 4IGSA 2VEMA 3DN5A 5CJMA 3W74A 4P61A 3HQ1A 1P5BA 3MZNA 1MW3A 1WZLA 2A2IA 4X2RA 3HIJA 4JTFA 2CXEA 1JNEA 1VYSX 4R34A 3NPVA 3APTA 2NT0A 3VIGA 3VAVA 3AMDA 4LAOA 3GS6A 2A3AA 4KGJA 1UWSA 2VQTA 2CWNA 5LIUX 2CFFA 3TTEA 4L9YA 3MKCA 3H4XA 3VABA 1DV7A 3S5ZA 2VEPA 1OGGA 4PN2A 5CSUA 3HBLA 4GZIA 3EWUA 4YVPA 2NXIA 4LBSA 4URIA 4W5UA 1QDSA 5JVLA 5FIPA 2EJ1A 2E1WA 3IS4A 4S23A 3CUHA 2ZC1A 4S39A 3MYPA 1HP5A 4LV9A 5I23A 4JKLA 3O63A 3S1GA 4YCOA 3WK3A 3EOOA 3GG7A 5J04A 1JCLA 2WNQA 4UTLA 1KW1A 3KTXA 5AHLA 4DN1A 1IWBA 3ATZA 5A8GA 2OO0A 4L61A 2B7PA 4JR5A 4IIHA 3VTRA 4TOQA 3QR3A 4TTUA 2OQYA 5BCAA 1D3GA 4KEZA 3ATYA 3L4TA 1GVYA 5BU9A 3AYSA 3W00A 4GKLA 2AGKA 4PCFA 1UIPA 5HWNA 2EG7A 1VHCA 1RY8A 2J62A 3HOJA 1PX8A 1W5PA 3LN3A 5LA0A 1M53A 2HXUA 4FI4A 3WLMA 4HVXA 3TLLA 1G69A 1CGXA 4QJ3B 3VE7A 1B1YA 2TYSA 5DBUA 4JCMA 1RJRA 4K8EA 1T99A 2PP3A 3QGKC 4UIOA 4X9SA 1NJJA 3QQWA 4QJ5B 2QJIA 5FEPA 1T8XA 1YDYA 1U5HA 1JPHA 4H04A 1GNXA 4GNVA 4MB3A 3UWYA 3RIKA 3EEGA 1V0NA 3WH8A 1CT5A 1VLIA 1CGUA 1KBLA 2PTZA 1UIOA 4NAFB 3I6RA 1LDCA 1S39A 3B8SA 3HMCA 1W9DM 2RJHA 1FWJC 3VPLA 1QNPA 2WMHA 1F07A 1OFBA 3KOXA 1R9ZA 4XG1A 4GGBA 4W7WA 2FPTA 3VIOA 3ZIZA 2EPHA 4E4FA 3ANYA 3LI0A 4E3TA 1AQMA 2C1GA 1THFD 2XGZA 4G1NA 3GH5A 4DZHA 4NQ1A 1IE7C 3S8HA 3T7VA 5I3DA 3WBWA 3JRKA 4HNVA 4JGDA 4D1IA 1ALDA 4J7RA 2DZAA 4WR3A 1TV4A 2BY3A 4M1RA 1SZNA 1XYFA 2G41A 4R85A 4K68A 4Q4KA 2WZHA 2DSWA 5HULA 1WO2A 1YKWA 1JF6A 4NZJA 5KINA 1JPKA 2ZX8A 3OVGA 1V08A 4QDMA 3FJ6A 3BW4A 4D6GA 2H9AB 3E2VA 3KCLA 5HNNA 2INZA 5DO8A 4IQJA 3PR2A 3G1HA 1GK8A 1LOSA 1G67A 5AVNA 2WWCA 4W88A 3M0HA 3TTSA 4E2DA 2YR1A 1NQ6A 3A9BA 2V67A 3I4EA 3L4UA 3P5ZA 4FB7A 4K1GA 1ONWA 3G3MA 5CZJA 5D02A 2Z28A 1L2UA 5CPMA 1A0CA 4AQLA 4XVDA 1ADOA 3D0CA 5FAGA 4G7FA 1CW2A 5IHSA 1MO0A 2J74A 3LENA 4O50A 3I7RA 1W1PA 5DBTA 1E73M 2PD5A 3EA3A 1CNVA 1WNOA 2IMRA 2G3FA 1PSCA 2C15A 4LNCA 5DFAA 4BA0A 1SU5A 1E6RA 1FCVA 1TPH1 2VFHA 4ZO6A 1YTKA 2WM0A 4FMVA 5I77A 1X96A 1UP2A 4NX5A 3ITGA 4JX6A 3O07A 3U8GA 2WOQA 4O0KA 3VNDA 1CB7B 2XU2A 1VKFA 3KL3A 3P61A 1ZHAA 2FB2A 2TSYA 3D46A 3HV8A 3RPDA 3NZRA 2FZ9A 5CLWA 4GC3A 2GGJA 4A3RA 1A50A 1IR1A 2PTYA 3G8RA 1J4EA 2VX4A 4Q4OA 1B54A 1EUNA 5EA9A 2Z00A 4UQAA 1EKOA 1JDEA 3BANA 4XAPA 2ATMA 4E2OA 4OIFA 4BR1A 1FRBA 2CHOA 4OT7A 6REQA 1IEQA 2WC3A 3E02A 2YDRA 4H19A 3BK0A 2XYLA 1UD6A 1GEHA 3N6HA 1DXFA 4O8RA 4AXNA 5BYWA 1K70A 2WHLA 3EB3A 3VOHA 5CXPA 2CW6A 5TAOA 2NX1A 4ZB2A 3BWWA 1GVRA 2DSVA 2VENA 3T09A 4AZCB 4RE3A 4ZE4A 1KXQA 1MUMA 1WPCA 4U2YA 3ORWA 2QPSA 3OZOA 3DYPA 3S2MA 1LBMA 1AH4A 4M51A 4LS1A 3UVIA 1HIZA 1J79A 4TVCA 3EX3A 2ZZ3A 4AZ6A 3QJAA 4RJEA 1H7NA 2VX6A 1BRLA 3CL7A 1I1XA 4QX4A 3FGCB 2QDHA 3C8NA 5AKQA 1DE5A 2WVUA 4LPCA 5TF0A 3CU2A 2A3BA 3AC0A 2RAGA 4MY1A 2OLAA 3B9EA 3EOUA 3B9DA 4AHOA 3GLCA 4FLRA 6XIAA 4MGGA 3BLKA 1JQVA 2UWFA 2P0OA 3T0DA 4ZOCA 1M65A 4WOQA 5BXPA 4NG3A 1AJZA 1V03A 4DLFA 5SWUA 3DI1A 3MUIA 2HZGA 3CB3A 4RV8A 3SQSA 3IIZA 3A5FA 5E93A 2WC4A 1QWKA 2XGIA 1XQKA 3TJLA 1PIGA 4DIAA 2VP8A 3VGHA 4Z2LA 1E3XA 2FZDA 1V79A 3I68A 4GD0A 5AZ1A 1WDRA 3W81A 3W7GA 4MNKA 2G3MA 3U5UA 1UUMA 4WD0A 2O92A 2WZIA 3HTWA 3R2GA 1VAHA 3Q94A 4IQDA 3FJNA 1PUDA 3PULA 2WZEA 1SGJA 3UESA 2AKZA 2WK2A 1UWAA 1Y0EA 5CG0A 5LIKX 1V6WA 4PBEA 3CV2A 4MIMA 2XVGA 3EDEA 3BZGA 1EYWA 5J5DA 3Q65A 4JFTA 4OFCA 3NQ6A 5BOOA 2A3HA 4XUYA 1KFEA 4LYPA 2WXDM 4F2BA 5F7UA 2BY2A 5L9FA 3WO8A 3BLIA 1LYXA 3SCQA 1K8YA 1JVNA 3G1YA 4N7QA 3R8RA 3UJFA 1EX5A 4KBXA 4PEKA 2SFPA 3L5LA 3QPZA 3I3DA 4AZCA 5CBJA 1KM2A 2HE5A 3AIEA 4MSSA 1XLCA 4QE1A 3TJ4A 3ARRA 3EXRA 2ZDRA 1K4HA 3BG3A 4NL1A 1TB3A 3U2ZA 1Q5MA 1NEYA 1NOWA 3RLGA 2DH3A 3DFNA 1J11A 2FH6A 4GNJA 3TK7A 3S0CA 1Z6KA 4MWAB 3N2MA 3NG3A 3CAKA 3WQPA 1VBUA 1WBHA 3DFTA 2OYKA 3T08A 4E4UA 4I9TA 5T91A 1PDZA 1SZFA 2WMGA 8XIMA 1I2OA 5EKYA 1QAPA 4CD6A 3ES8A 4KFNA 2FDMA 3R13A 4ZTYA 5B80A 5FJTA 3VYLA 1P7TB 5LNUA 4L1XA 3LI1A 3AYTA 4FK9A 2EGZA 1WE5A 4UMCA 2YCKX 1BKSA 2RGLA 3WD3A 3CIWA 3TTQA 3QC3A 3G2GA 3W86A 4NVTA 1M6JA 4OBTA 3W7IA 2BOEX 3FNDA 1UUQA 5A6AA 3CZLA 1CTNA 2XINA 1DIEA 2PLMA 4UR9A 4Y9AA 4E4PA 1GONA 3TN6A 3GDKA 4N4PA 4GYJA 2MUCA 3V0UA 1JYWA 3R94A 4OUIA 4HK5A 1CXHA 1H7OA 3CM4A 3SCTA 4XVEA 3NQEA 1B5TA 1Q8AA 3LLFA 4X2PA 4DJFC 1AJ2A 3THAA 1LM1A 2VD8A 4O53A 4JQ4A 1UD3A 1W3IA 4GACA 4IP7A 2ZTJA 4O19A 1L6GA 1FWNA 2WPGA 4GVIA 3PPGA 2E67A 3MB9A 3UERA 3AAMA 3M4HA 3HGOA 3CZGA 2Y7GA 3EEZA 1V7YA 5EBUA 4XAZA 3T05A 4B3ZA 1TZ9A 1POKA 4AD0A 1XM3A 3UVAA 2NV1A 1XF0A 4MF4A 3S6OA 3A22A 4JPGA 1U5JA 3FXGA 1QW7A 4JFVA 1JPDX 1W1TA 3M44A 3VD3A 4WZHA 1DJQA 3S5OA 3PBWA 1OZQA 1BRLB 4H8NA 3PFRA 3KL0A 2YCLA 2WQDA 4PRTA 1FHUA 3HM7A 1NDVA 3E38A 3N19B 3VMPA 2X2YA 4Q4RA 2OWXA 4QNEA 2FFCA 2Q01A 3TC3A 4IF2A 4Y6GA 3CBWA 2WCAA 4IUOA 2BVTA 1ME8A 4IJCA 3UCDA 2BS9A 5BOFA 4AZIA 1B4KA 1R9YA 4OKDA 3IVSA 4GQBA 1CGWA 1UKSA 1REQB 2W67A 5AYXA 1XICA 2QQ6A 2GWGA 3EX2A 1YPIA 2XVLA 2FZ8A 1OINA 3IANA 4JTGA 3GHRA 3O6CA 4NT0A 3W28A 1ZGDA 3F2CA 2Y61A 4NAFA 1P0KA 3IUHA 4B2DA 2PDNA 3I7QA 2J88A 5MKGA 4W7UA 2VC7A 3CQHA 1PXGA 1PIFA 4GG9A 4YMZA 1Z44A 4ZFMA 1N8FA 2JBMA 5KTLA 4AD1A 1XLJA 4Q7BA 3MHGA 1OK4A 3CUFA 1S2UA 4YTUA 3FLUA 3PZUA 1H60A 2AKMA 1EB3A 3SY8A 1S2TA 4M3PA 2DT3A 3H2CA 3S6DA 4LUIA 1NSJA 1GEQA 1ZQ5A 3GZ3A 2YL5A 4UQBA 5CEWA 2I5IA 3A3XA 3NVDA 1JCMP 4MNJA 5AC5A 3UY7A 4A21A 1E71M 4L9XA 2HBXA 2X8RA 4IG2A 1OHLA 5E0CA 5HANA 4NUWA 3KS6A 3C2RA 3L4WA 4MFEA 2DW7A 3N14A 4N6FA 2VVNA 3LY0A 3BLPX 3O1NA 4NJHA 3VU2A 1W3KA 1TQJA 1IWAA 2ZXAA 1FH9A 3GNNA 3R7MA 1R3RA 1FH8A 5LHEA 3WJXA 1XISA 3VIPA 4HCLA 2WNZA 2VCBA 3S6TA 4A6GA 3GXDA 1E51A 3NL6A 3ITXA 4QS5A 3SCUA 4UQ9A 3TQVA 3TMLA 6ALDA 3CTLA 3WEZA 4H8HA 4DBDA 2QXWA 3GY1A 3LX9A 1M7PA 1ZSXA 4DO4A 1P0EA 3NDYA 3B9NA 4AZ7A 1P43A 3TW7A 5MF5A 4DF0A 1F61A 2QCGA 3BXWA 1EEPA 4QE4A 2ABAA 3QMTA 3I3EA 5I09A 1Q6EA 3IIVA 1Q6LA 3FGCA 4RLIA 1GJPA 3UEQA 1R9XA 2VCCA 2X09A 2XN0A 4AD4A 1GKPA 1DEDA 1BWVA 3C2YA 4UOJA 1H1NA 2R91A 1NWTA 2QDDA 4R9XA 3L23A 1F7BA 2BHYA 4J3WA 1O60A 2W6RA 2WANA 1R46A 3TUUA 5I3FA 4JZ5A 2E6YA 2B7OA 3FKKA 4KH2A 1TV3A 4J27A 2YBUA 1X38A 5DT5A 1GG0A 4XSMA 1OEPA 2ZE0A 2ZXBA 1J0ZA 1E5JA 3GC2A 1TZ7A 4TXEA 4ZOBA 3MSDA 2ZZ1A 1PEZA 2CKSA 1P6BA 1DQUA 2XGBA 3G77A 5AVHA 4MB4A 3IVTA 1UH2A 3SUVA 1WZAA 2BFGA 3SRFA 2PODA 1OFAA 1RALA 1HKIA 3CV7A 3O16A 2XFFA 4BKNA 4YXGA 1E9YB 3WX7A 2XFYA 2V5KA 2YW3A 3M5ZA 1A5KC 1WUFA 1AQHA 2DT1A 3OTRA 5F1UA 1VR6A 4ZZ9A 1VYRA 4IPIA 3VX0A 7TAAA 2EPMX 3T07A 3N9SA 4NRRA 4Q4SA 2O4QA 3MUAA 2PDYA 4LS2A 2CLMA 2C7FA 4C6EA 3R89A 3WMCA 3WF4A 3W23A 4F9DA 3M5VA 2PGFA 4X0NA 1QOPA 1EPVA 2R14A 3ONCA 3B03A 2E8YA 5CQ1A 4QXIA 3V1HA 3AZSA 2CLEA 4Q32A 3SUWA 3V5FA 3S5YA 1JCTA 1UWRA 4QBXA 1FVPA 1VFSA 4GCXA 3M6DA 3H6OA 4HD5A 4XD3A 3UD6A 3W88A 4F0SA 4Z2IA 2XZ9A 3QY6A 2NXHA 3A21A 1PJ9A 4J3TA 1GZGA 4XTIA 5JU6A 5KEZA 4JFUA 3W7HA 3CIXA 5ABGA 3MP4A 5FF7A 4C90A 3DYOA 1QI5A 3C0JA 4G2DA 1XIFA 2FGLA 3TCSA 4MJMA 3L5AA 1O5QA 3EX6A 4IJRA 1Y8BA 2H3BA 3ZVHA 4BWLA 1CX9A 3A64A 4JKKA 5I79A 4AFYA 4YIWA 1QW9A 2FTYA 3AS2A 4XZLX 3ONBA 3ARYA 1MEHA 2VO5A 3AHZA 1JPIA 3C2VA 1OWQA 4J3UA 4S3CA 1VRDA 1K6AA 2PTWA 4A29A 2X1RA 3NURA 5D9MA 4DBSA 1PTAA 2QV4A 4P8UA 4BZYA 1R3SA 4R27A 3EZ4A 4JFSA 1FWRA 1VIZA 4JFWA 3ZJ8A 2OEKA 3SIMA 3PWIA 1XIDA 4IPPA 4DM1A 3RMJA 3BTNA 2PWEA 3VILA 4PB5A 1V3KA 3YPIA 1A5BA 1G4SA 3BURA 3QQ1A 4AVFA 3H7RA 3GNXA 2CYGA 2E5BA 3DGRA 4MWAC 2VD9A 3UCCA 3WFZA 4HA1A 5KZEA 1QI2A 5C71A 4O1FA 4E6MA 2QIIA 2NX3A 1KFJA 4NU7A 1UR2A 3MBFA 5EB8A 1MW0A 3GG1A 3WQ6A 5K9CA 3QN3A 4I5UA 3AI0A 4EF9A 3ARSA 1TUXA 4W8LA 3BVJA 2ZRZA 1TPB1 2XM1A 3B0VC 3WYZA 2WJZA 4DZ5A 1E9LA 4LNYA 1RY0A 2YJQA 3KOWA 2VCAA 4PMYA 4BI7A 1DIDA 3WUBA 1A3HA 4AXKA 1KQZA 4J4KA 4Q8QA 5I24A 4JHMA 1TX0A 5A8OA 5HR7A 1DJIA 2O55A 4XUGA 4JX4A 5REQB 1ONEA 3HURA 2ZZ5A 3NM3A 3TC6A 4QDPA 3LNPA 2R1PA 2WWDA 2PC8A 2B31A 4DWSD 3V7PA 1JIBA 1ZJAA 4CVUA 2IKHA 3PC0A 1FTXA 2D3NA 1R38A 3TYAA 3F5JA 1EA9C 5HJYA 4BF9A 1TWIA 2G4JA 3DECA 2RJGA 4RK8A 4OWGA 5A2CA 1MXGA 3B8IA 4GISA 1FWFC 4H7CA 2FHBA 2YPIA 1EYEA 2NQJA 3WLQA 1H09A 3UGVA 1QT1A 1FBAA 5DMYA 1E9IA 4LB4A 4WIWA 3OJGA 8TIMA 5CSSA 1TIWA 3W7EA 4UCFA 1W9BM 1H49A 2OSWA 4WF7A 1KV5A 1GOXA 1LF1A 3WJSA 3FSTA 1Z41A 2BBFA 3TSDA 4EIVA 1IEWA 3V35A 1EBGA 4GIYA 3EDKA 4F8XA 2GGEA 4MZYA 1NELA 1HTIA 3LRKA 2C6QA 1DWJM 1X1ZA 3S1XA 1PCKA 3T4CA 3KP1A 2WQPA 3UNTA 1XV8A 1KRCC 3PZVA 1FWTA 1OD0A 2RUSA 1SUXA 2P8CA 2D2JA 1QWGA 4O14A 3Q67A 2JF7A 2ZWYA 4LOCA 2VYOA 1NFBA 1F6PA 4KWVA 1CLKA 4TMCA 3E5PA 5BRBA 1SSDA 2QHAA 2PDJA 4H8VA 4XISA 3H24A 1Z32X 1JPMA 2ZVRA 5FF2A 1TMLA 3B4UA 4RPQA 1JZ8A 3HGSA 2PCQA 3A47A 2DZTA 5DT7A 5D09A 2J7EA 1S2VA 1MMFA 4DAIA 3A24A 3OODA 4M5PA 1ZBVA 4N9EA 1BGAA 1PYFA 3G3DA 1V3JA 1UR4A 4LJ3A 4UBPC 1KRAC 1QI0A 5KITA 1RPXA 3PZOA 2NSXA 4US6A 2IKJA 3II1A 1E72M 3WFAA 1C9WA 4Q8UA 4J3ZA 3R11A 1S2WA 5FF0A 5K4ZA 2E1DA 3BG9A 4HMEA 1TRIA 4RKAA 2AL2B 3KX6A 4IIGA 4ZXOA 1TV5A 4GQRA 2XFWA 3SJNA 1A5OC 2FHCA 3UWVA 3B04A 3IV8A 1REQA 4I7WA 3TSMA 4LB3A 3VDAA 4QISA 1OY0A 2ZRXA 2OZTA 3EMCA 1P4CA 1K8CA 5HDRA 1HNYA 5H2ZA 5T9CE 4YVXA 4R88A 3ELFA 3ARWA 1DTUA 3APGA 1ZY9A 3CASA 1QPRA 4DELA 1LOQA 1M7JA 2D3LA 2ATSA 1DJYA 1TMQA 3BV7A 3AISA 3VVGA 3VGGA 1O68A 4C91A 1W6TA 3S2JA 1Q7QA 2Z2UA 1OGBA 1UA7A 5DXXA 4ONVA 3BJFA 2DT0A 1TR1A 4BQ3A 4IIBA 1GT8A 2J79A 1OK6A 3VZYA 3L7RA 2WMJA 3CLMA 4PMVA 4OUEA 3ES7A 1HO1A 4S3GA 4H00A 1F3TA 4JIQA 3MVIA 2PDWA 2G50A 1FDZA 5LNVA 3XIMA 3M47A 1W17A 1RR2A 3STEA 3SW6A 3U2EA 1Q6CA 2V5LA 3EOSA 3R0DA 4IQLA 1MEIA 1NF0A 1QXLA 3LPPA 1KRMA 4JICA 3BC9A 1WXZA 1JAKA 3TZFA 1RK6A 1W5MA 2HTMA 5GPRA 5I78A 4B3KA 4ZO7A 2C13A 4TVUA 3GNDA 4EKJA 2VOTA 1R7AA 4R53A 4JDBA 1KKOA 4ZQCA 1E4MM 3TH6A 3NZ1A 4QCFA 4ILSA 4ZR8A 1S5WA 1TPDA 3G6MA 8XIAA 4JKMA 5HNRA 3KP0A 4D6DA 2VI0A 3C0LA 3WQFA 2ZTKA 3GIYA 3M7SA 4EAYA 4JTLA 1E55A 3CHCA 1XPYA 4I9AA 3ZJKA 4FEZA 4AF0A 4LX4A 6PTDA 3C2FA 1V93A 4F3HA 4BWLC 4OV4A 2NT1A 1FA2A 3I10A 1X6NA 2V5BA 1V6UA 5U4NA 1SZRA 4DNHA 1KB3A 3THDA 4ZENA 1DXEA 4DJEA 3LGEA 2NX9A 3C8FA 4DLMA 4W87A 3NQBA 5G5IA 4D6IA 1HJXA 4HU0A 5C6MA 4AIEA 3MKKA 2ODOA 4GK8A 4K7VA 1IXQA 4TTGA 3E3HA 4O11A 1NOUA 3SBFA 3PUDA 3DKJA 3VNYA 3EOEA 3OLEA 1J5SA 1G1YA 3C2OA 3TLQA 3WNNA 3EGJA 4H4IA 3WMBA 2W4XA 3VFLA 4W9TA 5EBAA 3SRHA 3FA4A 3PBUA 3MBDA 3WH7A 3B40A 4U10A 2PDKA 1FH7A 2ALRA 2GK1B 2ACRA 4LCQA 3TJXA 1HVXA 1OYCA 3K4AA 4M82A 3KZPA 4XO6A 3W2NA 2X05A 1L6WA 4RW3A 1VJIA 4F79A 1XLAA 5G2WA 4ATWA 2X16A 3S9IA 1YXCA 4Q4QA 2VX5A 4OV9A 4CVWA 3GXIA 2TRSA 3GVWA 4NY2A 1UC5A 2C14A 1OX5A 2Y85A 1H3GA 2WLYA 4YU1A 4H6QA 1GHRA 3PS7A 3V3WA 4X63A 1UQYA 2QAFA 4LWWA 1FOBA 4TX9A 4LVFA 4OBSA 4Y2WA 1K6WA 1QCWA 2W62A 2TMDA 3S47A 1K4GA 3NFUA 4V2XA 3ZZ1A 4U2ZA 2NSOA 3MUZ1 4QJ4B 4MLRA 1VFLA 3NPWA 1XBXA 4FXRA 4JYDA 2PP0A 3GHUA 3UPWA 4XZBA 4CN1A 3ZLFA 5D4YA 3VMOA 3DEQA 3S9YA 1GORA 5D9PA 4QEEA 3W0KA 1VFUA 4E3VA 2QDEA 3S42A 3VD7A 3IPWA 4HU3A 1N55A 4H9YA 4HJWA 2UZ9A 2XIBA 4S3KA 4F0HA 1UZ4A 1XIJA 1C92A 2PSNA 3ABQA 1IEXA 4EPDC 3GQYA 4Y9OA 1K7XA 3DZ1A 4QIUA 3DHPA 2ZCGA 2VGBA 1NY1A 3A4JA 2ZUWA 4FXFA 2R1KA 3VE9A 1EP2A 2DP3A 3SZ8A 2P3ZA 4I90A 4GWEA 3MC5A 4WVXA 4PCSA 4RNFA 1WXYA 4FLQA 1QBAA 5I03A 3LEPA 4ORMA 1KGUA 3IGSA 2Z26A 2AQVA 3OBEA 1D3HA 3IGXA 4ZB5A 3KVMA 3QPEA 4PYSA 4Z17A 2P50A 2JGYA 3W7KA 3QXBA 1JDDA 4QAIA 4CNNA 5C7VA 2F2HA 3B9OA 3W07A 3OZPA 4IGHA 3UWQA 1FP8A 3F4NA 3REQB 4MB1A 4FXSA 4TU1A 3EWDA 4FNQA 3ZOAA 5ABTA 3LHYA 1RBLA 2I17A 4IFKB 4DRSA 1VIWA 3G1SA 4AX7A 1DJHA 4UTTA 3N17A 4FR6A 3AU2A 1Q6OA 3LM3A 1HJVA 2FVKA 1YE4A 3DAQA 4O12A 4AYGA 1AODA 5A8NA 3E96A 3ENLA 4N9DA 1XH0A 3TQPA 2VT0A 3M0XA 3QMRA 1TCDA 2OQHA 5LIYX 1JULA 5C54A 1CYGA 1I75A 1TJ1A 3W2UA 1UR3M 3EWBX 5CZKA 2FFIA 3O0KA 3UZYA 3CO8A 4IP4A 4WDUA 4H6KA 3N04A 3TXVA 1WX0A 3OGRA 2VC6A 1YQ2A 3CMGA 3Q4DA 3LDVA 2OZ3A 3K8KA 3XINA 2I5QA 2DVXA 3PAOA 2QCDA 3JZEA 1BKHA 3RX4A 3WLSA 4DI9A 3P7YA 1OB0A 4QG6A 3M0IA 1R0MA 2REQA 4PUNA 4JQAA 2A79A 2GK1A 1KLZA 2Y89A 1JDFA 1G4PA 1EDGA 3M0ZA 2WYSA 5FKYA 3TYEA 1EP3A 3VCCA 1PHQA 4B5UA 4LQ1A 2PURA 1SM9A 3HO8A 4R33A 1H11A 4N42A 1LQ0A 2XSXA 3N2BA 3ZR4A 4K36A 2PPGA 2VUNA 4M24A 4IX2A 2DUZA 2F9RA 2C71A 2D2OA 4F0RA 3WDIA 3UJEA 3WUEA 4JTUA 5LGXA 3TOYA 5LKYA 4CEUC 3OHIA 1EIXA 3HPXA 1V6XA 5CBIA 1VQTA 4GY0A 1WB0A 3OQ8A 4JIEA 1A5LC 3I6TA 3M46A 4ASTA 4UTTC 1BYBA 2IXVA 1X8CA 3GTIA 3CTTA 2V8ZA 1MZHA 3LHZA 1UH4A 1Z9AA 3SDOA 1RJPA 3U2CA 3AJXA 1IXPA 1WP6A 4DI8A 1BPLB 4H8UA 3VINA 2Y7FA 2B7QA 1PO9A 4Q22A 4NXKA 3U2OA 3GTHA 3P8JA 3SR7A 1IIHA 4BEUA 2X40A 1E56A 2FVLA 5AYZA 2AAMA 3MWCA 3FVDA 2X7WA 2GZXA 3KBJA 2UBPC 5TD4A 2INFA 3KVLA 1CIUA 2QYGA 5HQMA 1XH1A 4Q8MA 3H2MA 3W83A 3UWZA 2XUCA 3BL3A 4EWND 2C1HA 4NX0A 1PKMA 4WDXA 4WRHA 4WSJA 2QGYA 4PTVA 2YL6A 4DO5A 2PWGA 3MVTA 1UR8A 3W26A 1JFXA 2XDFA 3WLNA 3KOYA 1XGZA 4CQAA 2W92A 1AD4A 2J27A 2WCSA 2ZA1A 3R58A 2QZRA 1QPOA 4EXQA 4KEUA 4J1OA 3FYYA 5BMXA 1LWIA 4XD4A 2PD9A 2OWWA 1GJUA 2YA2A 2Q3RA 3FOKA 1J10A 4ZTXA 5BOEA 2IKGA 4JYFA 3DESA 1DE6A 3WQCA 4W8AA 3GR8A 3TYCA 3UA4A 3ZLHA 3VDBA 1WKDA 1XYBA 4JTJA 4B5XA 3QQ0A 1XCFA 4EXBA 4PR4A 2XVPA 3ZR6A 2JKAA 4XK2A 3IIOA 4GZ7A 1PX4A 5XINA 1E4IA 3B8UA 4HIBA 3LCLA 4BK9A 2OSYA 3ZFHA 4CN6A 4PTMA 2PMQA 1ZRQA 5M17A 4LT9A 4HMDA 3VNJA 1W9XA 4QNWA 3RM4A 5GVJA 3IACA 3VK5A 1J01A 4H9XA 5EFDA 3MSRA 4V28A 4Z2JA 4GYPC 1JUEA 1H51A 2FGZA 3TN4A 5AC7A 4GQQA 1SZGA 3VDHA 2W63A 3INPA 2DUXA 3WQ4A 4MZ8A 4Y9PA 3H2EA 5AYIA 1XLGA 1LLWA 3WUGA 3UFYA 2V2CA 1Z89A 1TWWA 1BVNP 3UWUA 2FB3A 3RR4A 2OYMA 1G7VA 3ZVHB 5I3HA 4KF1A 3HJZA 3UR2A 3WY1A 2QNEA 2C79A 4CU8A 2ADAA 3UJSA 3CNYA 1TE6A 4J9JA 1OJXA 1NIUA 3ZM8A 5E0KA 1W3TA 1R2TA 1BTMA 4YN5A 5JBEA 2GVJA 1JZ5A 3G8EA 3PUEA 2W79A 3BSMA 1QK2A 3QH2A 5A6LA 1U30A 2CZDA 3IRDA 3UYIA 1TPEA 4UFIA 3KXQA 1US2A 1M03A 1RZMA 4KMQA 1EJSC 4OGZA 2J6XA 3UR7A 4RZ5A 4UMBA 3OLIA 1ITQA 3RM8A 5I3IA 2JIWA 3NNTA 1KWGA 4CQ9A 2YKKA 3DERA 4E8CA 1PKLA 5J5RA 2OZ0A 3MCNA 3GTXA 1HKVA 3I6EA 4I5XA 2BHZA 1B3ZA 4DUXA 3W1MA 1MQPA 5A6TC 3MUY1 3A4XA 2BSLA 5DCBA 5ABEA 2PBOA 3LSCA 2PLCA 3RRXA 3B0PA 4WXYA 3SFKA 3TC7A 2ZZ2A 4Q8WA 2VR4A 4LVBA 3W38A 2VWSA 3MS8A 2ZRWA 2OFJA 3B8TA 1XL9A 3T9PA 2H8XA 5LNWA 1D7KA 2GUYA 4KWSA 3GBDA 1SJDA 5BRPA 2C18A 3SGZA 3HMJG 4ICCX 1H7XA 2DIJA 2GVGA 3TTOA 3GXMA 3TYUA 1EQCA 4PRWA 1UB3A 4W84A 1RAKA 3DFHA 5D2WA 5H8MA 5C2GA 1K9DA 2G3IA 4HNLA 4JCLA 3IRSA 4FNUA 1NFPA 1ZP4A 4MY9A 1IT0A 1B9BA 2ESCA 3STGA 2PDLA 1SJCA 1C7SA 1EC7A 2JK2A 3LM7A 3CH0A 1OADA 5IFTA 4M6PA 2Q3OA 3SQMA 1XHGA 2BODX 1XKYA 1R3WA 4JY8A 1G94A 3GW3A 4JEQA 3S1WA 2AAAA 2UY2A 4N02A 4OHQA 1DJXA 1M9HA 1O1ZA 2PB1A 3AUOA 2OB3A 1O4UA 3P3BA 2GSJA 2PWDA 1QW8A 4Q3MA 5A1AA 1E4NA 1W1VA 3E0WA 5T9BG 2BVYA 2IQTA 3VX1A 6REQB 3RCMA 1OG6A 5FEWA 4ACZA 4WOZA 1VFFA 4MG4A 1UOKA 3L68A 3R12A 4N4QA 3ZLGA 1H41A 1M1BA 4ZFCA 4TV5A 1E1FA 3AROA 1O6IA 2NVAA 3C52A 4JD4A 2VFDA 2DVTA 2WSRA 1MW1A 1LRQA 2CLLA 3DC8A 4Z0SA 4NNCA 2PWVA 1DJZA 1OX6A 4LRTA 1AL8A 3I65A 2D1ZA 1VZWA 4HSNA 5C0QA 3JZUA 2VM8A 3AMKA 2ACQA 1FXPA 4MZ1A 4AEFA 3VNMA 2R24A 2V3EA 3RLHA 1VBJA 3PB2A 3CQKA 3ME3A 4ZGYA 1IV8A 3GDTA 3VKDA 1WOBA 5A8PA 2E7FA 4XZMX 5C2XA 2Q6ZA 3ZWTA 1JRBA 4Z1CA 3WK1A 4OTKA 5D30A 3AZTA 2OYLA 1AH0A 5F2MA 3S5NA 2TAAA 3WG6A 4IG2B 1H7WA 4PODA 2HRWA 1UD5A 3ARQA 3SJ3A 4MUPA 2HE8A 2VFFA 3J7HA 2Y63A 2BXZA 2BZNA 3PPHA 4NZ1A 1QASA 1T96A 2R1NA 2P53A 2WJDA 3L0NA 1XKJA 1QUMA 2GJPA 2CLKA 4QLLA 4K6AA 3EPMA 3HA1A 2XJ7A 1SR9A 7A3HA 4E2BA 1A4LA 2F6XA 2NQLA 4O52A 4C6MA 4UNKA 2ZZ7A 4QJ1A 4PE8A 1GQIA 5MKGB 4PCNA 4EPEC 2H9AA 3V36A 1XRVA 1XLMA 1QATA 3T8QA 2W66A 1KM3A 2IPGA 2RKXA 1YNPA 3TCEA 2Z2AA 2WVTA 1RCQA 4IM4A 3P62A 4HNNA 2QS8A 4AHPA 1W54A 1G7UA 3BO9A 3BZJA 4TV6A 1J5TA 3WDJA 3HFYA 1A0EA 1CECA 3VOGA 2HVOA 3VOFA 4FNSA 3G1XA 3RITA 3FK4A 3MMUA 5D8WA 4HSOA 5ECVA 1EOKA 1LUCB 1XW8A 3RCYA 1HO4A 1EIBA 1B0IA 2YB4A 2EPNA 1HL9A 2X0HA 5EGRA 2Y1HA 4LUSA 5D9NA 2YZ5A 1X97A 1G01A 5C9XA 4I9MA 1P48A 4U3AA 3W1RA 3BMWA 3LHVA 4XZHA 5F4XA 1EZWA 2D0GA 1EFZA 2HDJA 3MUCA 2GUUA 3FJLA 3IIXA 1EF3A 4QLJA 5HXMA 3NYZA 1NWRA 1HP4A 7ODCA 5KZ6A 4FAMA 3MJMA 1EXBA 2XH2A 3L0KA 1K9TA 3ZS4A 1ZPTA 4LVGA 4RXGA 2XN2A 3KE0A 3LQLA 4HA0A 1CCWB 2VGGA 4ROQA 1V0KA 1BF6A 2GGHA 2XZ7A 3V4BA 2GSEA 3UG3A 1C29A 4FIRA 2CCRA 1CGYA 2BTMA 2P5NA 1AUSL 2X41A 1UKQA 3JS3A 3VXGA 1ZJHA 3PANA 4UCGA 2B0MA 1EGZA 1AVAA 4QLKA 4YTTA 9CGTA 3UETA 1MZRA 1VLWA 3W87A 2PGRA 1F74A 2NZLA 3U48A 1RV8A 2RDTA 4B9YA 2R94A 1F76A 2HMCA 2QF7A 4LU0A 3TSBA 1KM4A 2J8TA 1HKKA 2KX9A 4KEVA 1XR2A 1Q7ZA 1SQ7A 2I5GA 3WDHA 4NJJA 2D20A 4B9ZA 3CEUA 5BZAA 3MHUA 4KT2A 3WF1A 2E6DA 4HN8A 1T8QA 1W1B1 2E3ZA 4K37A 1J0IA 4GINA 3QZEA 1P6WA 1LLOA 1SFLA 1HJQA 1X6UA 2TPSA 3BLEA 4GIRA 3R4IA 3JW7A 1F4HA 4GI4A 2IW0A 3W25A 3WNOA 5D8ZA 1P6CA 1H7PA 3W7RA 2OEMA 4J3VA 1VCVA 4GKTA 4X22A 1TVNA 3TQKA 1RQEA 3NPUA 3GXNA 2XTKA 2CERA 3SY1A 3HB9A 3UZJA 4GYKA 1ML1A 3NOYA 3HJEA 1OC6A 3UJ2A 1N8IA 4CQ8A 1XG3A 4C6KA 2XIMA 4ZE5A 3ARUA 3OVRA 1E9ZB 1PCWA 3O3RA 2E25A 4IIFA 1HXJA 3VIKA 3NSNA 3TROA 4C7FA 3F03K 2JKPA 4JTSA 2RDWA 4BF7A 4HSHA 2QVNA 3CAQA 1VPYA 4LAKA 3UY8A 2X1SA 3CH9A 4FIQA 1CZ1A 2BY1A 3SECA 5H8UA 3D3FA 3NGJA 3RDKA 3N13A 2B7NA 1DL3A 3NDZA 1UZDA 2VC9A 4LF1A 2Z0IA 2W27A 4FX7A 4ORIA 3URNA 3BAKA 1TE1A 3HG3A 5AC8A 3T2QA 1WKFA 4NZFA 5H91A 2PEVA 3L4XA 5I6SA 3C4UA 2DT2A 4PB4A 3VKAA 2B4GA 1IYXA 2VC5A 1PTDA 4AY8A 2BGQA 3BDKA 3EX1A 2P8BA 3QZAA 5EU9A 1E6ZA 2WNWA 4RDYA 3EMZA 4IJBA 5F2IA 1EOMA 4F0KA 1LQAA 1I45A 1W0MA 4MNMA 4XBKA 5KZDA 3IJ8A 1XSJA 3N15A 3E0VA 1TTQA 1Z8AA 5E5CA 4KS0A 3WNPA 2GQ3A 3VD4A 2FLIA 3P93A 1OABA 3L12A 5TNVA 4F2TA 7REQB 1U1JA 5C9WA 2F8QA 1A5CA 1DIKA 2CZVA 4IXXA 4BF5A 2NQ9A 2GVLA 1XYLA 4DO7A 4LYRA 3S2CA 3W1TA 3EB2A 1DOSA 1SYTA 5FJIA 3ANVA 4MNLA 1ZCCA 5AFDA 3LTSA 2OT1A 3A13A 4HTBA 2V3DA 5M1TA 3F2BA 1EF2A 4BI5A 2V81A 5LZLA 3VUPA 1J6PA 2UY4A 2EAWA 4PMOA 4S3AA 5GJPA 2CHNA 4UFHA 3HG2A 2E6AA 1AMKA 3UJRA 3MU7A 5JQ9A 1PKNA 4MADA 3CV1A 3M0JA 3URBA 4M19A 1N2VA 4MAZA 2XN1A 5KSWA 4BFAA 4JIRA 4O1CA 4PSPA 4ZQNA 2OVLA 2ZOXA 1AMYA 3THCA 2WW5A 3DC0A 4MYAA 1Q6RA 4HPNA 2DSKA 1OZMA 5G1YA 3WLTA 1XFCA 1O5XA 4HYVA 4S3BA 1JXKA 2ZRYA 1FP9A 1OYAA 3NQFA 1M68A 2Q02A 1P0DA 2EKGA 3CHEA 4JNZA 2Z7GA 4FNPA 1W5OA 4PTXA 1XSKA 4N6EA 1XGEA 2E40A 2PZ0A 4MLJA 3FV9A 2WBKA 1HFBA 1ZNNA 1KR1A 4WUIA 2POTA 4QROA 3E49A 3CJPA 2PDQA 1LROA 2QLYA 4HNOA 2WZMA 1X1OA 1YTDA 3UXAA 3W22A 3KOFA 4IPLA 3MI3A 4JL2A 1EBHA 3OVQA 2PUZA 1C93A 2GJRA 1UMLA 3EWWA 3KBWA 4O4WA 1JJKA 3N9RA 3VKCA 1PWMA 2C19A 1IZCA 1ZBCA 2POZA 3MMTA 3MTWA 1EJVC 1F8IA 3SIZA 5JH2A 1OYBA 2XSAA 2Z24A 2XPKA 1E3ZA 1PS9A 1BXBA 5DXYA 3W70A 3PZGA 3QSRA 2ASHA 4PTWA 3LCGA 5FJRA 4A05A 4O8AA 5FJUA 3GHTA 2Z1SA 3CK5A 2CLHA 2VRQA 3UPBA 4GXWA 1ZFJA 3W7CA 3WQ8A 1ZB5A 2JEQA 4E8DA 4HPXA 5U7SA 1V4YA 4C6QA 2I57A 1ZS2A 2ACUA 1YBQB 3CUIA 2NUYA 2OU4A 4H3DA 3W24A 4PMQA 3TNBA 1E43A 3QHOA 5AN7A 3GVQA 4X0VA 1JNDA 2BMBA 4H9UA 5D05A 2RDUA 3W2MA 4UR8A 4POCA 3BLOA 3W75A 3W37A 4DNMA 1HL2A 1HX0A 1H0IA 1A3XA 3TE9A 3VNKA 1Q2SA 3E9AA 5KETA 4PZVA 3QGAC 3ARTA 3V16A 3RAOA 2XIQA 4G9PA 1GPFA 3O15A 4AH7A 3TIMA 3VIMA 4NZ4A 4JDYA 2VRKA 2HPMA 1Q4WA 5DQPA 3AJ7A 3ANUA 4DUVA 1JZ6A 3LYEA 4C6BA 3PZNA 5DEZA 4GUJA 4DBUA 1JYNA 4DYKA 4QSHA 2A85A 3KRSA 1GG1A 1Q6GA 2YL9A 2Z1XA 2J9ZA 4QM1A 1CBGA 4JQ3A 3BH4A 4GZEA 4OBRA 3G0UA 4K8HA 3EWCA 1UYQA 2CNCA 1V0MA 4PBFA 3PWGA 5CGMA 4IMGA 1RLCL 3CMJA 4OZOA 4O1EA 4WQ6A 1U22A 1X1NA 3ERPA 1S1RA 3W1UA 4GXPA 5JMUA 1W8SA 1ZTVA 4K39A 2FIQA 4C6IA 2WVVA 3C0SA 4XIAA 3DFOA 3L66A 1DJGA 3BAXA 1LTDA 5LSMA 4P8WA 3SUSA 3VO0A 4DVOA 3ARVA 3AIVA 3ISIX 4ATDA 4MY8A 1W2VA 2PDBA 5LNRA 3NL5A 3RGTA 3M5YA 3PBGA 5ABFA 3F1QA 1ZJIA 1FHVA 2I56A 3UZWA 3PG9A 4LF2A 3CWNA 3NYDA 3BQ6A 3QSTA 2J47A 3VNIA 4AD3A 3KLLA 3SGGA 5B7ZA 4HMCA 1RQHA 2OMAA 2DV0A 3MPGA 1NH6A 2GOKA 3SCRA 3A6OA 4E5TA 2Y88A 2GJXA 4RDWA 2ZUNA 5CG7A 2Q8LA 3MP5A 2WZTA 1FCQA 4ROPA 5GNXA 1BSLA 3QV9A 1EGMA 1BG9A 5HUOA 2FYMA 4GQGA 3SURA 4US5D 3LMYA 1UC4A 3MO7A 5G1MA 4ES4A 4P8VA 4CD8A 1OCBA 3EKGA 2XFRA 1KD0A 4PMJA 4M80A 3GW0A 3URAA 4Q4PA 5JH1A 2O9PA 1KFWA 2WM1A 3E0FA 1LRTA 2BOGX 3WCZA 4NP7A 3UW6A 4DHGA 1FWEC 2XISA 1I8JA 1EGVA 5HQEA 4IL2A 4M7TA 3SN4A 4O54A 3UP8A 3QOMA 4D72A 3ZJ6A 1H61A 5AYBA 3H2FA 4K38A 3DFPA 1A4MA 1E0TA 4TR9A 3G1DA 5CBBA 4F40A 3O0FA 1GOIA 4GO9A 2HISA 3NIYA 3CS2A 2W3ZA 5BXTA 3G24A 4GI8A 1LQ2A 2CLIA 2HK0A 4KCWA 3VUSA 1VB9A 3POHA 1ZENA 2OEJA 4RL3A 2JALA 3AS3A 4XSLA 4GJIA 3PZ9A 4QQUA 3CV6A 1TJ0A 4QP0A 9XIAA 2PLJA 4U4MA 2G3NA 2RGMA 3SRDA 1MRQA 2X0YA 3M6YA 4QDWA 4A4AA 3R43A 4H7ZA 4AWUA 2DIEA 1WXJA 1ZUAX 1FHLA 4JIHA 1P1XA 1C8YA 1TPUA 3HN3A 2VUYA 1M7OA 3ZXWA 3S5SA 3RILA 2CWXA 2YXGA 4ZQPA 1J12A 1XIMA 3AO0A 3BAWA 1UMYA 4A2SA 1UOZA 1I0BA 1Q6QA 2DU2A 1KFBA 3PF3A 3RK8A 2ZVIA 3KS5A 3FN9A 1MFVA 4A3UA 2G5WA 3FS2A 2ZBTA 1MYRA 1CDGA 4HA3A 4DJDA 1BYAA 1DWHM 3WH9A 4RNJA 2YXOA 3MV01 1P1MA 3NDOA 4NRSA 3NA8A 3IAQA 5A3HA 1QFEA 5D03A 4ICNA 6CGTA 4AISA 1KWKA 1TJPA 2BNJA 4I7UA 5JUVA 2E6FA 1T6MA 4XAYA 2YIHA 1LOLA 4AX6A 1HGWA 4P8XA 1BLIA 2ZUUA 4AZGA 4DZIA 1E0UA 4JQ2A 2VWTA 1POJA 1O5KA 3LERA 1Q3NA 1TV7A 4LCSA 4R7WA 4WDTA 4LBRA 1NDYA 5FJPA 3PJUA 1MSSA 4BJHA 4LC6A 1H0GA 4NYYA 4B3LA 3DYMA 3N2OA 3NQCA 1FWAC 3QVQA 1XD0A 2I1OA 3QV6A 2GQAA 1I2NA 4YNGA 3VGEA 3U4FA 3VOIA 4TIMA 3O06A 3LOTA 4EVZA 1XUUA 1EP1A 3GX9A 2WSYA 3OZMA 1Q65A 4JY9A 5ABHA 2W61A 4YLWA 3WD0A 3OPSA 3OU8A 1KBBA 3KTSA 3QTPA 5DRIA 4D71A 1TVLA 3E74A 5EY5A 1OCJA 3LRLA 4D6HA 2BVWA 1KCLA 1XIBA 4ZO9A 2Q09A 1QR7A 2O7QA 1IEIA 1Q4NX 1ITUA 4G1KA 1T5AA 1EWDA 2WO5A 2J24A 4DUWA 4FNRA 4UC5A 3T0BA 1FWSA 4UZSA 5FAJA 4FSAA 2HCVA 3AXKA 3RYSA 3CPUA 2R9RA 1W9VA 4DY1A 2QCMA 1W3JA 3D5HA 3U5YA 3DG7A 4C1NB