2BP1A

Structure of the aflatoxin aldehyde reductase in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
publication title Structure of the Aflatoxin Aldehyde Reductase in Complex with Nadph
rcsb
source organism Homo sapiens
total genus 120
structure length 323
sequence length 323
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n11: Succinic semialdehyde reductase.
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2bp1A00
2CLPA 3UFYA 4JQ2A 5AZ0A 5HA7A 3GHRA 1T41A 1YNQA 2ACUA 3CAVA 1EKOA 4GIEA 4WRHA 2J8TA 1AH4A 4LB4A 1AZ1A 1UR3M 1X96A 3EB3A 3V36A 2PDCA 4DBSA 1RALA 3M0IA 4IJCA 2AGTA 1A80A 4H7CA 2IPWA 2I16A 5LIYX 4Q3MA 4EXAA 3LQLA 1QRQA 4JTCA 2VDGA 1S1PA 5LIWX 1MZRA 2HVOA 4JQ3A 4HBKA 1JEZA 3LN3A 2HDJA 3UGRA 4L1WA 2HE8A 3UZXA 4XZIA 2PZNA 3N2TA 4R9OA 3BURA 4LBSA 2PDKA 3UZWA 2PDMA 1YNPA 5M2FX 1J96A 1ZUAX 2PDNA 2PDHA 4ZFCA 4GQGA 3WCZA 1FRBA 3MC5A 2ACRA 4DBUA 3CASA 5LIXX 4LAUA 2WZMA 2INZA 2R9RA 3LENA 4XVDA 4QXIA 4WDTA 1XF0A 3U2CA 4QX4A 2PDYA 3CV6A 2A79A 3M4HA 3M64A 4GABA 3BV7A 2PDXA 1Z89A 3H7UA 3RX2A 4LB3A 4YS1A 4JIRA 2HEJA 1T40A 2PDWA 4FA3A 4IJRA 3G1RA 4PMJA 2PDPA 4XVEA 3UZZA 2ALRA 4FAMA 4GCAA 2IKJA 4XO7A 2FZDA 3O3RA 4XAPA 3ONBA 1OG6A 1Q5MA 1M9HA 1X98A 2NVCA 3RX3A 1ZSXA 2P5NA 1VBJA 3KRBA 2IQDA 1Z9AA 1YE6A 2C91A 3UP8A 4WEVX 4DZ5A 4LAZA 3LUTA 3EAUA 4WDWA 2ACSA 1R38A 2FGBA 1EF3A 3EB4A 4JQ4A 5HNTA 3Q65A 3DN5A 3LEPA 3N6QA 1MRQA 4XZLX 1IEIA 4Q7BA 3UYIA 2FZ9A 4JIIX 2BGQA 4GQ0A 1MI3A 4L1XA 3H4GA 2IQ0A 4WDUA 2IKHA 4EXBA 3UZYA 3Q67A 1Z8AA 4MHBA 2ACQA 1YE4A 3G5EA 4G5DA 3UG8A 3S3GA 3B3DA 3DOPA 1HQTA 4YU1A 1EXBA 1LWIA 3COTA 3T42A 1PZ1A 3WBWA 1S2AA 3R94A 5LIUX 2QXWA 2PDFA 3H7RA 2BGSA 1S2CA 3GUGA 5JH2A 2HE5A 4LBRA 3BUVA 4QR6A 3R43A 2INEA 4JTDA 2IPFA 4YVXA 4JQAA 4WDXA 3R7MA 3RX4A 4PR4A 3UWEA 1Q13A 2R24A 3R58A 3VXGA 2BP1A 4H8NA 2DV0A 1ZGDA 1GVEA 1LQAA 1US0A 3CMFA 5C7HA 1X97A 2PDUA 2FVLA 3LBOA 4RPQA 4PRRA 3WG6A 1C9WA 1PWMA 4XZHA 1SM9A 2I17A 3LZ3A 1QWKA 3GHTA 1PZ0A 3LZ5A 1AH3A 2IKGA 4F40A 4DBWA 1AH0A 4FALA 3FX4A 3BCJA 2F38A 3C3UA 4JTAA 4JTRA 1XGDA 4ASTA 2IPJA 3NTYA 4YVVA 5HNUA 4YVPA 2FZBA 3LNMA 2PFHA 2IPGA 3GHUA 4OTKA 4JQ1A 1ZQ5A 2DUZA 4PUWA 2PD5A 2PD9A 3R8GA 4XO6A 3MB9A 3LD5A 2HV5A 5AZ1A 5DANA 1AFSA 5KETA 2IS7A 2WZTA 4FZIA 1ADSA 5LIKX 1Z3NA 3V0TA 2NVDA 1VP5A 2PDQA 3ERPA 1IHIA 1RY8A 2F2KA 3CV7A 2PDGA 4WGHA 5JH1A 2PDLA 4GACA 4XZNX 1RY0A 1HW6A 3FJNA 4PUUA 3CAQA 3V35A 3WBYA 4PRTA 4GA8A 2DUXA 3QKZA 3V0UA 3WBXA 2PDJA 1K8CA 4IGSA 3ONCA 4HMNA 4XK2A 2FZ8A 2PDIA 3GHSA 3P2VA 1S1RA 3F7JA 4JIHA 1PWLA 4NKCA 3O0KA 3R8HA 2PF8A 3R6IA 2HVNA 1XJBA 2PEVA 4QBXA 2IKIA 2PDBA 4ICCX 4JTQA 1EL3A 1PYFA 4AUBA 1AZ2A 3LQGA 2ISFA 3D3FA 4XZMX 4I5XA 3V0SA
chains in the Genus database with same CATH superfamily
4LEQA 2VRQA 1TJ0A 1JGMA 5I09A 3DESA 5K3VA 3AYRA 3U57A 3A13A 3B8UA 3BLLA 1AZ1A 3VD5A 3K4DA 3H2CA 4IP5A 2ASHA 4LS0A 4O8AA 4J27A 1UWIA 4ZOEA 1CYGA 1REQB 3LTSA 4H9TA 3CH0A 4XUGA 3SY1A 4WKAA 2WWDA 3ENLA 4JTCA 4DXKA 1WBHA 2FZNA 4WXYA 3CUXA 3M7WA 3IK4A 4DI9A 1UD6A 3SUVA 1KWGA 3UGRA 2VGFA 1HKVA 4JBRA 5DXXA 2XN1A 1Y7VA 1DQUA 1W0MA 5EL1A 1CXEA 2PDMA 3AMLA 1V6XA 3BJSA 4D6JA 4C6DA 1LP6A 1M7OA 4GY1A 1UKTA 3W53A 3AZSA 1QI3A 4NNCA 1FXQA 3TWBA 1KFBA 2INZA 4AVFA 2VGGA 3IGSA 3GNRA 1OHLA 1XF0A 3U2CA 1XYBA 1NF7A 5DCEA 1GKQA 4DIAA 3V1PA 3W70A 1TA3B 2A1YA 2F84A 2EGZA 4XD3A 2JE8A 4LB3A 2PE4A 3WL1A 3T09A 4PUKA 4AD1A 2ZX7A 1DOSA 1E6PA 3PAOA 4GGBA 4OOZA 1ZZMA 3IK2A 4L4PA 4YTTA 4GI9A 4Y96A 4V27A 2JKAA 4O10A 4FI4A 1ONRA 1IEWA 3BMVA 4UFKA 3CV2A 3K8LA 1H5YA 4MDOA 1M9HA 4HN8A 3MHUA 1X98A 3INPA 2DFAA 1KCZA 3W7EA 2JGQA 4O14A 3S47A 3MSYA 2OEMA 2P5NA 2NXIA 4FS9A 4GJIA 3K4WA 5JU6A 2NLIA 3FHAA 3O2LA 1G4TA 2WNQA 9XIMA 2YW3A 1ZTVA 5CBJA 3H2AA 1EWDA 5K4ZA 3MMWA 3G8EA 4QITA 3MQTA 4ZL1A 4H00A 5F4WA 4Z2IA 4FR1A 3Q65A 4NF7A 7CGTA 4H9VA 5BRQA 3TIMA 3VOCA 3GH4A 1UR9A 3CBWA 2FZ9A 4E4FA 1GQLA 1CGTA 3LRMA 1T0OA 2FLIA 5HJYA 3H4XA 4F66A 4L56A 3DENA 1UD8A 3G5EA 1VB9A 1HKMA 4UTTC 1UZDA 3IWPA 1M03A 4MB3A 1KM1A 4RW3A 4Z1YA 3ALFA 3MV01 1GJPA 2QW5A 1XIEA 1C8QA 4K1WA 3PP7A 3WN6A 2VR5A 2HE5A 3M5XA 3A5VA 4RW5A 3WUFA 2BY2A 4RV3A 3TXVA 2G50A 4EAYA 4CN1A 3MT1A 4HK5A 4ADSA 3BPWA 3UVAA 4C6BA 1T6MA 1BXBA 3G1VA 4D6GA 1HTIA 4NJKA 3WNLA 1W6TA 3KBSA 2ZC1A 1H51A 3HPSA 1FOBA 1E40A 2GOKA 5C7HA 3KCJA 3NQ8A 4DJEA 1UP2A 2HSAA 4H9ZA 4JTSA 4HVXA 2J7DA 4W7UA 3V16A 2EO7A 3BQ6A 3LCGA 3PY2A 3MKVA 3TR9A 5BZAA 1TWZA 1OX4B 2QGHA 3UG3A 1IR1A 1P0NA 3V7PA 2PRLA 4MKVA 1QBBA 1LF1A 3VIOA 3UXAA 1XUZA 4LNCA 3R11A 4WK9A 2O4MA 1JUBA 2G0WA 1ZBCA 2O0TA 3NQDA 1MEHA 3NPUA 3MMDA 3EX4A 4US6A 4W5UA 4JN6A 1EX5A 3ARXA 3PBUA 2GPTA 2VP8A 4M0XA 3WQCA 3VM5A 3U4FA 1E51A 1EEPA 4ZXOA 1FXPA 2QV5A 1OJXA 4GZEA 3KRUA 3QOMA 5FF7A 3U7BA 1UH2A 3EBVA 1UP3A 3S5ZA 1VPYA 3G0SA 5DN1A 2P3EA 2CKRA 3P81A 1QT1A 2DH3A 1BAGA 1LJYA 6TAAA 3M47A 1OM0A 3GTXA 2IQTA 1MEIA 1MW0A 2YXOA 4JICA 4QP0A 4P8XA 3PN8A 5EMKA 1KRMA 1WZMA 1W3HA 2X2GA 3QR1A 3ES7A 4W89A 3BAIA 4KW2A 2CLIA 3VE7A 5E9XA 3PB0A 3MMTA 2Q3RA 5D2YA 3G1SA 3QC3A 1JPDX 3WL0A 3BJFA 3DFYA 4UQCA 3PG8A 4GNVA 5IHSA 3TU9A 4GA8A 4GBDA 1F07A 4QEHA 4ZB0A 4AD4A 2G37A 1L0PA 1P48A 1TV3A 1DXIA 5FF3A 2NX1A 3DU0A 3SN1A 5E0KA 2FZ8A 1KBBA 5CKSA 2J6VA 1PCKA 5DFAA 4ZO6A 4IQJA 1VJZA 3NVTA 1BLIA 2Q8LA 4EOUA 4BEUA 4W9TA 1IGWA 1OC5A 4Z1BA 1H7RA 3G1DA 4PFMA 3WENA 5D38A 3L4VA 3OVPA 4L65A 1IT8A 4AYGA 3CLMA 2FIQA 4ACYA 4EP8C 1WUEA 2W5FA 3W02A 1PIIA 2XGZA 4NX0A 2VQTA 2I5GA 3I3BA 4W5ZA 1JI1A 1S38A 3AICA 3NQCA 5CAKA 4JAWA 2WBGA 5IOBA 3T2OA 4LVBA 3RN6A 5ABFA 1M04A 4IM4A 3MP4A 2CLMA 5AVNA 4I6KA 1J8VA 1KGUA 2XU2A 2WM1A 2RH9A 3O6DA 3SW6A 5A8MA 3UCCA 3WQDA 1XLJA 4GOAA 2RDWA 3SGGA 3FN9A 3TE9A 3VFLA 1IXQA 5HWJA 5A2CA 3CXOA 3RU8X 3BOFA 4GI6A 3IAPA 2J7GA 4W7VA 4KIRA 1LLOA 3KXQA 1K3UA 2VFDA 5CPNA 1POJA 3W2LA 5M2FX 1FWGC 2WZMA 3S46A 4PCPA 4W8BA 4AF0A 2A6LA 5CGTA 3SM0A 3MBDA 3GG7A 4MB5A 2WW5A 2HISA 2LLEA 1FY6A 3HTWA 1XR2A 3R10A 4UB9A 3REQA 2ZKMX 3TA6A 1EOMA 4RDZA 1Q45A 3ZVHB 3PF3A 2D2HA 3BW4A 3WFLA 4CNNA 1UZ4A 4J4KA 1HGWA 3R25A 1EGVA 4F0KA 3QHOA 1P0BA 3H24A 4O4VA 2W91A 1KO0A 2JBMA 4GCAA 3RMJA 3OG2A 3F5LA 3CUFA 2C1HA 2AQWA 1FA2A 1IR2A 3W4RA 2VDHA 4NX5A 4XQ6A 4HCDA 3P7YA 3E0WA 1VEOA 4M1BA 5CGQA 1R9XA 3C2EA 1VCFA 4Z0SA 4OVXA 2QUTA 1ZB5A 3PUOA 3TYDA 2DT3A 5CZ0A 6REQB 4S38A 4DELA 3AJ7A 3GVQA 3W7IA 1H7XA 3TQKA 4JEQA 2ZXBA 3GD6A 2J74A 1DKWA 4IMAA 3LLXA 4E8DA 4MF4A 1QHOA 3FV9A 1DJQA 1W3KA 2ZRWA 3D3AA 1CCWB 1RBLA 1WKEA 1BGGA 3L12A 2OOGA 2RKXA 2XTKA 4WX2A 1VRDA 5XINA 4DJEC 3ANUA 3UW6A 4Z2HA 3KBWA 2XGIA 5IDIA 4C1NB 3EDJA 1W54A 4HK6A 2OX1A 2D3NA 4XD5A 1S5VA 3PC0A 2DSZA 2NZLA 4DJED 3BANA 3CC1A 3FYPA 1QI0A 3P5YA 5A1AA 4H8VA 2BXVA 2FVMA 3QQ1A 1LLZA 3OIHA 2V5BA 1R30A 4JQAA 2XM2A 3A22A 3IACA 4A2SA 1SZRA 4NZ5A 1YLVA 2R24A 3W25A 5C9ZA 2JIWA 3TZFA 2D22A 3MJMA 1GVEA 1I2NA 4WUIA 3NM1A 3G1FA 1HNYA 4N9EA 3TVAA 4LV4A 3LB0A 2BFGA 4MKSA 3VX1A 3RM4A 2YIHA 3QLLA 3KZSA 3LM3A 4AZCA 4J2PA 1XRVA 2CZEA 4GWEA 1F3XA 3A23A 1SO5A 4H1ZA 1DWIM 3UBPC 1K8ZA 3SURA 4UTMA 3RXZA 3PNZA 3GRIA 2VQUA 1JYXA 2B81A 3DH7A 1YDVA 5A69A 1JRCA 3RU6A 2A4AA 2ZOXA 5C70A 3FXGA 2FGLA 3KRSA 1LWHA 1CZ1A 1D3HA 8TIMA 1SO6A 4N2YA 2OYKA 1MEWA 3NL5A 3P8IA 2Y5SA 1A5OC 3QW4B 2O56A 1O4UA 1IQ8A 5FKYA 3CQJA 3LV6A 1QO2A 4QCEA 2CZDA 1BG9A 1E6NA 1E1CB 3CL7A 2QPSA 1SGJA 3LNMA 4YTUA 1V6TA 1GOXA 4MWAB 3W1RA 2FYMA 3HPXA 2BY0A 3AIRA 4LUTB 3PK7A 2VFEA 2PS2A 3NOYA 4MZ1A 5I24A 1GEHA 1XYLA 3LCLA 3BG9A 3KS6A 2R94A 2HMCA 4LOCA 2CNCA 1MNSA 4O15A 2VR2A 3P6LA 3W29A 3G2GA 1U33A 4GVIA 3E0VA 2CHNA 1ZCCA 2YCIX 3S2NA 4RNJA 1KLZA 2C19A 4KBXA 4LANA 1J4EA 1IWBA 2CLFA 4E2VA 5ECUA 1JCMP 4JTGA 1S2VA 1QI5A 4OU1A 3ZYZA 4ATLA 4PL2A 1IEVA 3QC0A 4GVGA 1G1YA 1CLXA 3CWOX 3LSBA 2QDDA 2DUXA 1D9EA 2ZX8A 4GX8A 1E0WA 3HPFA 1C8XA 3CYJA 2YBTA 3P2VA 3HZ3A 3YPIA 1TV2A 3PTKA 4E2BA 3Q37A 4DB7A 1BHGA 4PRWA 1VFMA 2HVNA 2AQOA 1B3ZA 1AODA 2PDBA 1AJ0A 4DJFC 4GKTA 4JNMA 3TTQA 2XFYA 1FWJC 3U2EA 2CW6A 3BLEA 3QYSA 3CQIA 1XG3A 1LWJA 1W2VA 4CCCA 5CJMA 3W1TA 2XM1A 2FDSA 3NZQA 4GIRA 4YIWA 1A0CA 4BZYA 1Q6OA 3CAVA 1IZCA 1TQXA 2PDCA 1WPCA 2VX6A 3TNBA 1D8WA 1H11A 1YXDA 3F5KA 1XLAA 4ECLA 2ISVA 2V0TA 4AFYA 1WNOA 3JS3A 1O66A 4C65A 3G1YA 3VCNA 5CSRA 1ENUA 4MJ2A 3MWCA 1GT8A 1WDQA 4B2DA 4DQWA 4PCNA 2GQ3A 1C29A 3C52A 4NRSA 2XVLA 3TNOA 2XIQA 3AWNA 2DVUA 4XZIA 3VD7A 2QZRA 3EB2A 1KGXA 4EANA 2PDKA 1TTQA 2ATMA 4GJJA 1OWQA 3TLLA 1IXPA 5I3GA 2VC7A 4CU7A 3LTPA 4ZQCA 2D3LA 1MQRA 4TMBA 4AIBA 4X3ZA 1RVGA 3IUDA 1F76A 3W27A 5KITA 1VC4A 1HVXA 3QM3A 5E0FA 5A3HA 4HU3A 4JDYA 1BF6A 2E1DA 1AVAA 4W8AA 3B04A 2QCNA 3WBAA 1UWRA 1R3QA 3MTWA 4EPEC 2VO5A 2E40A 3SAZA 1XIBA 3AS1A 2PDWA 2HTMA 2BDQA 2J7CA 1TELA 1TR1A 4GKLA 3WH9A 3FDGA 3LBCA 5FA5A 1E0XA 1OCJA 1RA5A 2YDRA 3G1HA 2QF8A 1V3HA 4XAPA 2OWCA 2W9MA 4I8DA 1Q7ZA 3BICA 2W27A 7REQB 4BCEA 3W1QA 4WSHA 4ENLA 3MO7A 1PDZA 1IZKA 4LUSA 1ZSXA 3ABXA 2V8ZA 3KHJA 1DE5A 3TQ0A 4IJBA 3VOFA 3W23A 2Z2BA 2OZ8A 2ZA3A 1GORA 2GJXA 1R87A 3TTEA 3N6HA 5BW6A 1B4EA 4IP7A 2Y7EA 1X7IA 4HPGA 4US5A 2FTPA 5JMUA 2NQHA 3LEPA 3KP0A 1I1WA 2E6FA 4DWSA 1VLWA 4LQ1A 1QTWA 4BF7A 3EZ4A 3TK7A 3VABA 4MB1A 4YTRA 3Q67A 3W7JA 3GG8A 1RLCL 3THAA 4HMEA 3SI9A 4G5DA 2PTWA 4NJGA 4K6AA 1JZ5A 3AS2A 2C0AA 2XIOA 2E5DA 2BY3A 2Z29A 5D09A 1VR6A 2R14A 4ZSTA 3ITOA 2PP3A 3PJXA 1NVMA 3WF2A 4Q7NA 4IGHA 4TV5A 3VKCA 3H7RA 4QTGA 1VHNA 3WDPP 4C1KA 5JH2A 4Z1CA 1Y65A 2ZVRA 1PVNA 3H2FA 2VENA 4TO8A 1CTNA 2RGMA 2IPFA 3QY7A 2XFRA 2I5IA 1UBSA 2PLCA 3G0UA 2WMIA 1N7KA 2RHGA 3VNKA 4LT9A 4Z2KA 3AC0A 1JQVA 1TVPA 5CJ5A 3NNTA 3BLPX 2ZZ5A 1V6UA 1ZGDA 1XBYA 1UUOA 4WKFA 1JRBA 1US0A 4L4OA 3W28A 3R79A 2CLHA 2Z28A 1BTMA 3PPGA 3ARWA 3MZ2A 1CGUA 1PL9A 3WG6A 5E6ZA 3PULA 1PZ0A 1BD0A 5G2HA 3PWGA 2GLKA 1KRBC 4B4FA 4UCFA 2J88A 2Z27A 3R5EA 5LYRA 4DM2A 4JCMA 3DFTA 1DBTA 2PC8A 1BG4A 5HDRA 1E9YB 4FALA 4HNCA 1FWAC 2YZ5A 1E43A 2ZXDA 3ZO9A 1UJQA 2BOGX 1PS9A 3EWWA 3WQPA 4JTRA 2E6AA 2VFHA 1EUAA 2OX4A 4ML9A 3SCNA 3I6RA 5I0DA 2DH2A 4RX0A 4MMWA 4JQ1A 4AEFA 3FJLA 3LD5A 3DX5A 5HINA 1AFSA 3RRXA 3DFPA 4HNNA 5FF4A 3MKCA 1TPB1 1ELSA 1TO3A 1H7PA 2ALDA 4FPSA 3GYCA 2CEQA 4FP1A 1U30A 5DMLA 2EG6A 4LUJA 5C6MA 4NZ4A 1U1UA 1NJJA 2GUYA 3EA2A 4LCQA 4LEFA 3VNLA 3AFBA 1UW9A 1GOIA 3NSNA 1VFSA 2A3HA 5LNVA 4LCRA 3XISA 1RR2A 3ECQA 4E2DA 1ONXA 4LX4A 3M6DA 4PMQA 2CLEA 4A6GA 3WUGA 3CMJA 4HA1A 3KBNA 5IHRA 1GOOA 3PFMA 8CGTA 1VBGA 2V5KA 2XWDA 2C7FA 2PU1A 2YL6A 1E56A 3TJLA 1GYNA 3S4TA 7XIMA 3ONCA 2D2OA 2QF7A 4D8AA 1S1RA 4UQ9A 2P50A 3O63A 2JKEA 5HUOA 4HA3A 3PS7A 3S2LA 3R8HA 3GVWA 2CU0A 1ZL1A 3HOJA 3AIVA 4DNHA 3LBMA 4YTSA 5A6LA 2X7WA 4P7RA 3W7OA 3H4WA 2A7RA 4LAMA 4GUHA 1AL7A 3KLKA 1JUEA 3VVGA 4B2DD 4Q4RA 5JBEA 2DDXA 2ISFA 4CQBA 3G6MA 3BLIA 4JQ2A 1CB2A 1TVNA 3O1NA 2WANA 3UWVA 1YNQA 1XDMA 1FH9A 3GTNA 3EX6A 1VCVA 2G97A 1UKPA 8XIAA 4RE0A 2DZUA 2RJHA 3AHXA 2QUNA 4L6HA 3PZMA 3T40A 3M0HA 4B3LA 3W24A 3E49A 2BX7A 2VI0A 2VL4A 2A3CA 2EJAA 4DZAA 5AYZA 1H61A 4O52A 3T0TA 5ECVA 2P0IA 2C1GA 2HVMA 2F7FA 4GK8A 3PZ9A 3N4EA 5HOSA 1Z41A 2FTWA 1S5WA 1G69A 4WY0F 3GTIA 1ITCA 4A3YA 5DF0A 3UGVA 2OSXA 1AW5A 1ZJIA 2WCGA 2WSRA 4ZOBA 1ONWA 5FJRA 5D9PA 4NVTA 3GC5A 1KM4A 1J96A 2J6XA 1CXIA 2EF9A 2PDNA 1L6WA 1BTCA 3WJWA 1W1TA 3UWZA 5F4XA 4GH1A 4OECA 1W9XA 3CIWA 3N19B 3BH4A 4PMNA 2DIKA 3KUMA 4XKMA 1G4SA 1JZ3A 1EPXA 4H6RA 6A3HA 4AB4A 3BZGA 4QCFA 1UZHA 2VC9A 2WC4A 3I65A 1UWQA 1Z89A 4FNPA 1LTDA 4JIRA 3QZEA 3HGJA 1V0LA 2XSAA 1TUXA 3TN6A 2BBFA 4NU7A 2WJFA 3VDCA 1H7OA 2AAAA 3IRSA 4DWSC 2PDPA 1ICQA 4AC7C 4J35A 2ZX5A 3KS5A 1GVRA 2A3BA 3NPXA 3PBVA 2I1OA 1G94A 1NSJA 4US5D 4PUEA 3AUOA 1SR0A 4DF1A 1AD4A 1DPMA 2HJPA 3LHYA 3L2IA 2I9EA 4DWSD 2ZXAA 4TX9A 1UHVA 2WZHA 3PZUA 5AYIA 3ARRA 3W85A 1KM0A 1TYGA 4HP5A 3PHAA 1SZNA 2W4XA 4H6QA 4OZOA 4L9ZA 3ZMRA 3CUZA 3PTQA 3CM4A 4WEVX 3FGCA 5LA1A 2QUUA 1WXYA 7TAAA 5HPCA 1CIUA 2J8FA 1E6SM 1A0EA 4HSOA 3FEQA 4REQA 2QV4A 1M65A 1P43A 1E73M 4XZLX 1PZ2A 4DXXA 1JI2A 2UY5A 2CETA 1FH7A 2ZWZA 1YXYA 1MI3A 3WLPA 2HRWA 3H4GA 4GLEA 3AHYA 1W8SA 4FHAA 1ISWA 4EXBA 4V33A 3WBEA 1BVWA 3BK0A 5A8NA 2RAGA 1LOSA 1QW7A 1G4EA 3W7DA 1YE4A 1NFPA 3GBEA 3GH7A 3LI1A 2DJLA 2YL8A 4K1GA 1IYXA 3ES8A 4MFEA 5MHBA 4GI8A 4BI5A 4M80A 5I07A 4ICNA 1N82A 5I7GA 4H6EA 3BSGA 5G2WA 2Q71A 5LKYA 1IZJA 4U5IA 2YYUA 2DZBA 1JFHA 3R1ZA 3FAWA 3HPZA 4JD4A 5FJIA 3USZA 1TREA 1M41A 3TR2A 2C0HA 4ALDA 1Q6LA 3RIKA 1I8JA 1TKKA 4BI7A 3ANVA 2CHRA 2L5HA 4MZYA 4ICMA 1E4MM 4EVZA 4ZFMA 2FVLA 4JHZA 4WZHA 2PB1A 3FKKA 1K02A 3MYOA 3NL2A 5A6AA 1X1OA 3KAOA 3ITGA 5G2IA 3C4UA 1MSSA 1ZP3A 3UPMA 2VURA 3IJIA 3VDBA 1ZFJA 6XIMA 2GDUA 1NOWA 1WX0A 4F2UA 5A8PA 4BJHA 1FHDA 4L5ZA 3DUGA 1M6JA 3HM7A 1FWRA 2CITA 3VTRA 3STCA 4Y7EA 3KL3A 3PBWA 1UB3A 4B91A 4M82A 1TMLA 3SY5A 4AD5A 4LS1A 2FH6A 2ZRUA 3RR4A 3LERA 3LGDA 2D73A 4IQDA 4AXKA 1HGYA 4XKYA 4ZENA 3AS3A 2A3AA 1SUXA 2E5BA 4JPGA 2QHAA 5BU6A 1TTJA 3FCPA 3ZT7A 4CN4A 1QUMA 2PBOA 1RUSA 1O68A 3UA4A 3UXDA 1JDEA 2IMRA 4LVGA 1WDDA 3R12A 1UD3A 5LNUA 1OB0A 3LI0A 4JFUA 4CNSA 4UMAA 1R9ZA 4HN4A 1PAMA 1BSIA 4ROPA 1XW8A 3URQA 3C3NA 4JN8A 8A3HA 3S5YA 1W9PA 2QKFA 4INFA 2ZUTA 1RCOB 3EMZA 1J11A 3OBAA 3SB0A 3MW7A 3ZLFA 3EWCA 4U5KA 4HU0A 1ZU8A 2OODA 1DIOA 3MV11 4ZA0A 3OQEA 2ZX9A 4TXEA 4D9PA 2H90A 1OSEA 3NJ3A 3QPYA 2ZZ6A 3UXLA 2DT1A 3PBMA 4HYRA 3SQLA 1ODZA 3WBYA 4R5EA 4NIRA 4IMFA 2Q8XA 1OYBA 4O53A 5AVHA 3ZR5A 5FJTA 4KEUA 1LRQA 1M1BA 1UQYA 4J2MA 4HQVA 1FDYA 3M16A 3LXBA 1VH7A 4CUCA 2R82A 3F7JA 4F4RA 5CH9A 3T2PA 2VRKA 1YXCA 1UKOA 4RL3A 4GXWA 1QPKA 1XIIA 3BW3A 2V82A 1HKJA 3GDKA 4JTQA 3V5FA 4P8WA 3GE7A 2V63A 4QFUA 2Y1HA 3QQWA 4OE7A 1E6RA 2X41A 2GWGA 3OZMA 3LZ5A 1MZHA 4KWUA 3QGAC 3VCRA 5C9XA 4GI4A 4AY7A 3BXWA 2Z1XA 1WDWA 4GO9A 3W0KA 3M0IA 4M3PA 3E3HA 2WHMA 3L21A 1C91A 1A80A 3S9ZA 5TQLA 3UXIA 4GCXA 3GXMA 2YKKA 3NSXA 1H1YA 2VDGA 1OT2A 4K37A 2J27A 4HHPA 1OFQA 3W1UA 4JQ3A 3HG3A 5I03A 4X9SA 4ZQMA 2PZNA 2Z00A 5CBBA 3N2BA 4FOUA 2F2HA 1YNPA 4IUOA 2QPUA 1B3WA 4MNJA 4ZODA 2X40A 1EJRC 2DSUA 4UUIA 1A3XA 1PHQA 2YSWA 4HYWA 4O57A 3MKKA 1RJRA 5GVJA 1Q8AA 1XDLA 3M0KA 1GPWA 3S0CA 1TPC1 2FVKA 1DXEA 1A5UA 3KW3A 4N7QA 4W87A 2J78A 3GIYA 5KZDA 2E68A 3W00A 1OFDA 3T78A 1NDYA 3N4FA 1V08A 3FAXA 4JNZA 2I7GA 3BGAA 1JGIA 2CLLA 5IFPA 2PGEA 3F4CA 5FESA 3EEGA 4U33A 1NDWA 2NQLA 1RD5A 1TTPA 3GXTA 3ARYA 3OVQA 3KE0A 4U31A 3M0JA 4ZE5A 1V77A 4NZJA 3LRLA 4UNLA 3VOGA 1KFJA 2ISWA 3CIXA 1CXKA 3OVGA 1DTNA 4DX3A 3NZGA 1SW7A 1MVYA 1MQPA 1T8XA 3BL3A 1LM1A 4DZ5A 5TNVA 1EHAA 4V28A 2ACSA 3NR0A 4MLRA 3AYTA 4HMCA 3VOJA 2UBPC 1Z42A 3R13A 3IIXA 3G8RA 4J3UA 3UY7A 2D69A 3GZ3A 3JR2A 4C6NA 1Y5XA 4DBDA 2J47A 1QPRA 1WE5A 2P1FA 2NSOA 1X1ZA 5I77A 1B31A 4IMDA 5DY3A 3LM7A 3L4ZA 4N0RA 2TODA 4AMAA 3UG8A 2PP0A 2YLAA 2I56A 3UR7A 1TB3A 2DEPA 3IS4A 4UR7A 4GYJA 3WBWA 1PZ1A 2QEZA 1S2AA 3SY8A 3V5OA 5C9UA 3C5QA 1B9BA 2X0HA 3WZ0E 5FSDC 5LIUX 1W1ZA 1G7UA 1R2TA 4AWEA 3TOPA 4ZB5A 5MKGA 3BUVA 4S3CA 3W7HA 1M68A 1UR4A 4B5VA 2YW4A 4AWTA 5BOEA 1B3VA 4YVXA 3MWAA 5FEPA 1ZRQA 3AXKA 4Z42C 1O5RA 3R0UA 2G3IA 2WHJA 1EH9A 3CLWA 4KETA 1KTCA 5KZEA 3SZ8A 4AY1A 1XYCA 1ICPA 3TX9A 4HNLA 4JIQA 1W2PA 3F4NA 4NZ1A 2GVLA 4PRRA 3KFTA 2VEMA 1W3JA 1M53A 1A47A 2H8ZA 3TQPA 1OEPA 3NPVA 2VVSA 4D1IA 4DF2A 1A3WA 5K9CA 1D3GA 1LG1A 1OFRA 3AMDA 1AH0A 4LRTA 4JHOA 3E38A 1GQKA 4IXHA 3W1LA 1E4IA 2Z1WA 4MPKA 4HNVA 4Q6XA 1QXLA 3GKAA 3F03K 3KP1A 2PWHA 3DYOA 3EWUA 4UQDA 2JEPA 2WJDA 3LHZA 2E8YA 5C5YA 1XGZA 4RCXA 4PGLA 3NTYA 3AZRA 4CQAA 3FS2A 4QSHA 1PKMA 5BNKA 2V68A 3FLUA 1H63A 3PPFA 4RR4A 3DI1A 1QVBA 3PG9A 3WQEA 5DXYA 4PTMA 5H8UA 4TU1A 1R5YA 3EA1A 2VDIA 1OF8A 3MB9A 1U5JA 1H7NA 1EDTA 3FVMA 3THQA 4RKAA 1UROA 2ISSA 1I4NA 2X1IA 1T96A 4PMDA 4AIUA 2HBXA 3U4AA 2W66A 5CSSA 5SWUA 5I3IA 2VZTA 3QQ0A 3LV5A 1Z3NA 3WMLA 5FL0A 4QNWA 2FHBA 4KKXA 4P2VA 1W3TA 2POTA 2YDSA 3IJ7A 3VD4A 4U10A 3SFKA 1UH3A 5FJUA 8RUCA 4FXRA 2X1RA 2XISA 1XQLA 3D47A 3TYEA 3ZXWA 5AHLA 1TQJA 3SN4A 1TCDA 4QG8A 4XIMA 2CPUA 4PH6A 5FACA 4WSKA 2ZWYA 2XWEA 3ZWTA 4I7VA 1B5TA 3AAMA 1FWBC 5C2XA 2EPNA 4PULA 3TP4A 5A2BA 1W5MA 4ONVA 2QCLA 1JCYA 2CERA 1NEYA 5CZSA 2X7VA 4I6VA 5IBXC 1EJ7L 3LHVA 3O0KA 2OCZA 4EPDC 3QBUA 5F2LA 3MHFA 2OT0A 3APYA 4HKPA 2VOTA 3N13A 5CG0A 3DECA 1XFCA 5T91A 1GZ1A 3EA3A 1GQNA 1ZPTA 3CHFA 2WXDM 4HJFA 3N2OA 4JKLA 1E9LA 1UKQA 4X63A 3U5UA 3PZIA 1IIGA 1CXFA 1J0IA 2WKGA 4IF2A 5C2CA 4HMDA 5FEXA 2V5LA 3POCA 4I5XA 4RDYA 4YHEA 5D33A 4PTDA 3CWHA 4E8CA 4F9JA 3VI2A 3H53A 2REQB 1PBGA 1HL2A 4PB4A 2RGLA 3I68A 2J8TA 1BF2A 1E1FA 1TPVA 1F2JA 1R3TA 3D0CA 4UTFA 4N6FA 3M5YA 3NGJA 3WKZA 4FNUA 5D2TA 3MUY1 3ZJKA 1GWJA 1HKIA 4EIVA 1J0JA 1Q8JA 4XAYA 1TV4A 4KEZA 3B0PA 3K30A 4H7CA 1KV5A 2IPWA 4FXSA 3VM7A 3AZTA 1S1PA 1MZRA 1HF6A 1W8GA 3LGGA 3GR7A 4FR6A 1VZWA 2G3FA 4R7OA 4X22A 3A5FA 3N2TA 4B5SA 4R9OA 3SUSA 3VO0A 3QH2A 4HOZA 1BEUA 1FWNA 4DWSB 4PMOA 2H6RA 3PPCA 2FDMA 3W7KA 1RPXA 3WCZA 3MC5A 2CLKA 2ZUSA 1WP6A 2YA0A 1VBRA 3RFAA 4BQ2A 1HP5A 3ZT6A 2V9DA 2R9RA 5IM51 2XVPA 4QXIA 4GUIA 4IUGA 1I75A 1LROA 2ZBTA 4UTIA 2RDXA 3SRDA 3B0YA 2G96A 3MI6A 4XZWA 3MY9A 4IQEA 1T99A 3I7RA 3JRKA 4FOJA 4ZZ9A 4GGHA 3VNZA 4NZ3A 1B1YA 2QCDA 3G77A 1XBVA 3LSCA 1I45A 3O06A 4ZO8A 4PSRA 1ECQA 4KEVA 1FP8A 4MWAE 1KD0A 4FAMA 4IIFA 2IKJA 2EKGA 4XO7A 4Q8QA 2XHYA 5H91A 3T9PA 3SADA 1D2KA 4GJ1A 4HPXA 3H2EA 1QJWA 2ON3A 2BVTA 2GVJA 2AMXA 3KTXA 2H3BA 1XG4A 2ZUMA 2PMQA 4A3UA 2XN2A 5C55A 4IX2A 1QASA 1B54A 1H49A 1T7LA 2GWNA 1M7PA 2H9AB 3WD0A 1WQ5A 3U2OA 3GH5A 3UR8A 1XRTA 5B80A 3HFYA 2FZMA 1EJVC 1DVJA 2BHZA 4XX6A 4LAZA 1V3IA 4MUZA 2E1WA 4H7ZA 3UNTA 3TMQA 5EMLA 1E0TA 1SPQA 3CNYA 1SFLA 3EOLA 1W17A 1XLIA 1C90A 3WLQA 5FIPA 4IISA 4GZ7A 4EE9A 4KRZA 4A3RA 1KGWA 3O6AA 4MG4A 1ZNNA 2DZVA 3WQGA 1OVDA 3IVUA 4LS2A 4UMCA 4PCSA 4M6VA 3A3HA 1KBLA 1KFEA 1S46A 2QULA 5CZJA 3OZPA 2OG9A 3CAWA 3VOIA 3OODA 4GBUA 1AQHA 2ZZ1A 4JL1A 2AL2A 1WOAA 1Q6RA 4H04A 1XICA 4K38A 1QNQA 4CD7A 1JZ8A 3IUHA 5ENLA 4WJXA 1A5CA 4ORIA 3MUZ1 1E1EA 3V3WA 1KXTA 4N9BA 4Q22A 2G95A 3W74A 3W01A 1QNRA 4QG9A 4ZOCA 2QDHA 3QLDA 4K8GA 4N02A 5CLWA 1XCFA 3GAKA 4ES4A 2DUAA 2GQ9A 4M6UA 3VZZA 4RPQA 3LG3A 1B30A 5HAOA 1JQXA 3LZ3A 3DFQA 1NELA 4HNUA 3WJXA 1O6IA 4PN2A 4ERGA 2YDQA 4GVFA 3WLOA 1XXXA 2PTDA 3U2ZA 2PLJA 4B15A 4K2SA 4G1KA 1R3VA 2QQ6A 2V2DA 3T2QA 3VNYA 3STGA 1W3IA 3R4IA 4HHHA 1K9FA 1WAWA 4CEXC 1EFZA 1XCXA 2ONEA 3EXTA 1Q3NA 3VKAA 4BHYA 1BWVA 1YBQA 5CXPA 1XLMA 1YYAA 3UG5A 1J9YA 1CGYA 1UYQA 3FNDA 3H7VA 3P5ZA 1VFFA 1H0GA 4YWIA 3BMXA 1NIUA 2PLMA 4KESA 1V0MA 2NW0A 4AXNA 2EPHA 3FK4A 3W82A 2EAWA 3VDGA 3CWNA 3G1AA 1R85A 3D5HA 1UWUA 5DANA 4Z0JA 3FEMA 3NXLA 1YRRA 1WZKA 4YJ5A 1SZEA 5CPTA 4O19A 4JYEA 3BMWA 2HNHA 3B9NA 5C9RA 1H2JA 2DT2A 4BA0A 2OQYA 1DIKA 4PMRA 4AG0A 4C60A 5BMXA 5AC5A 3C2OA 1K9EA 5CLTA 5AYBA 1K9TA 2Y24A 2J75A 2PDGA 1GZJA 2YR1A 1ODUA 3O0FA 3N29A 3OVRA 1EGZA 2J4GA 3ABRA 2EBNA 5GNXA 1WKYA 4BWLA 5D30A 2J7HA 1ZJAA 4LH8A 1TMQA 4KEMA 3WDIA 1VKFA 4ADUA 1DQWA 5EKYA 2C3ZA 1TRDA 3QW3A 3SR7A 3GQYA 1E9ZB 3RPTA 3L2MA 5FAGA 1I2OA 2ZCGA 3BLFA 4P61A 2PTYA 2Z4GA 2VGBA 1MMFA 3HQNA 2PDJA 3SCPA 3T0BA 4AC1X 4JZ5A 2A7NA 4LVAA 4XIAA 4C1LA 3WEZA 3CQHA 2V3DA 2PCQA 4G9PA 4JIHA 1E0UA 2WJEA 7PTDA 5BU9A 1EHNA 1XIJA 5B7ZA 3L4WA 2X1SA 3R6IA 3VPLA 3UU0A 1IWPA 1ZBWA 3FY1A 4Q8PA 3LMYA 4R27A 4N9DA 1QOPA 1J93A 1JULA 4F2TA 4AX7A 4EF8A 4D6HA 3WDJA 1N8WA 1U83A 2QJHA 1XIHA 3EX2A 1Y5VA 2J9XA 4KWOA 3SRKA 4JKKA 2ABAA 3UFYA 4DO7A 4FF7A 4CNOA 3LX9A 3VMNA 4W7WA 1LORA 4IX0A 3HMJG 4BY3A 3V36A 1RXOB 2TAAA 5LNWA 5BOOA 4K8HA 3S8HA 3TKFA 4C6QA 1EO5A 3NUKA 4K8EA 2PAJA 2NQ9A 2GSHA 3N9SA 4WR3A 4Q3MA 2Q8ZA 3FGCB 5GNZA 2QCCA 1FFQA 1OD0A 2P88A 4L4MA 3EKZA 4WF7A 4L1WA 2ESCA 1NDZA 1DWHM 4CD5A 5M17A 4NUWA 4REQB 3N9KA 3OU8A 4JTIA 1DHKA 4JN7A 1TJ1A 4V1YA 2PDHA 3BLKA 4KCWA 3HA1A 1JPMA 6ENLA 3WF1A 1DWAM 3APGA 3GBDA 1SQ7A 3C2RA 3P84A 1CEOA 1KQZA 2Y8KA 2QDGA 4R9XA 4UCGA 4XVDA 5C71A 9CGTA 1K7XA 1UQZA 4QX4A 1MW2A 3TC3A 3M5VA 4H9YA 4IMEA 3CV6A 4C6PA 3H6OA 1VBUA 4GABA 3RR1A 2J9YA 3QTGA 4E38A 4W93A 4K3ZA 2QIWA 2EEXA 1SFJA 2E28A 4N4QA 3M9YA 4QJ5B 2E4TA 3N34A 1TMHA 2I9UA 1T40A 2I14A 1XIFA 3S9YA 2VZOA 3MUAA 4DO4A 2Z7GA 3OOQA 2P0OA 3MSRA 5AB3A 1K4HA 3WLRA 4F8XA 3P67A 3C0QA 4HZMA 3TYZA 5M5DA 1WZLA 1QW8A 1RV8A 3TONA 3RHGA 4Z08A 4PC8A 1LG2A 1VIWA 1WCGA 2OJPA 4UC5A 5AY7A 3KRBA 7TIMA 2YLLA 4KWWA 4M6QA 5HUPA 1PPIA 5AOUA 3WO8A 1WO2A 1XRFA 1XH2A 2WMHA 1FWIC 3W7PA 3M6YA 1Q6GA 1EDGA 1K77A 4JFWA 1KBKA 3B0XA 1W3NA 1R47A 5FJPA 2VT0A 2X2YA 4ZMGA 2V3FA 2O9RA 3N6QA 4Y8FA 1XYAA 3GVRA 4Q7BA 1ISXA 5BYWA 4S3GA 1JDFA 1YDNA 2INFA 2VTFA 4XUYA 4XKYB 1F7BA 3CL6A 2OSWA 2BXZA 2ZRXA 1J79A 5I3FA 4QHRA 3PUGA 4EKJA 3XINA 4RE4A 1J0KA 4KCUA 2DY3A 4YL2A 1VGAA 5DMYA 3KBVA 2Y88A 3DC0A 2GGEA 1EXBA 3W1AA 3LNPA 1QAPA 3OBEA 4Y9MA 1BRLA 1EP2A 1NH6A 1C92A 4AHPA 1A4LA 3LPOA 4HU8A 1DP0A 1W5NA 2DZAA 1YKWA 1GYLA 4KWSA 4RPPA 5C9WA 1PIGA 3VKKA 3EMQA 1YTEA 1LZOA 3NYZA 2B4GA 4A8NA 1EEXA 2HK1A 1U5VA 1MWOA 4AZHA 2BP1A 3SUWA 3C2YA 2DV0A 5DCBA 5I02A 3PSWA 1F3EA 1KRAC 5K9XA 1IIHA 1P7TA 1BPLB 3UJSA 2E8ZA 1OZMA 3OHMB 1TX0A 4QE5A 4ZOAA 1L2UA 2YA1A 2X0SA 3TW9A 2ZUVA 1TPH1 3VCCA 4K7YA 5FI8A 4UOZA 1AH3A 1RCXB 4V15A 4G1NA 5B7YA 4F40A 2FJUB 4DBWA 3T4CA 4KT2A 4GXPA 4NJHA 3BSHA 3TN4A 1L6GA 4D6EA 1JYNA 2XINA 4JTKA 3B9OA 1YNYA 4NILA 3N6JA 1XS2A 4AHQA 4ZO7A 4GH3A 5IDZA 4EPBC 3VMPA 1OGBA 5CSUA 3TCSA 5I5RA 2R1PA 1GNXA 2VFFA 3WLMA 4C6LA 1J01A 3QV8A 1UUQA 5DT5A 1XV8A 1KBJA 2QUMA 4RZ6A 4YVPA 3BQ5A 3QMTA 3SGUA 2OQLA 1B4KA 3G18A 1JPIA 4NNBA 2Y5JA 5C0QA 3FIGA 3W37A 3QV7A 2FPYA 4DAIA 3MDUA 3OPSA 2D24A 3W1MA 3AXMA 1X8FA 4XSLA 3B8SA 1XBXA 3OO2A 1TA3A 2GQ8A 3V75A 3QZ6A 5G4WA 3WLKX 4CD4A 2W92A 1W1VA 2DT0A 1S5TA 1YMYA 4CGTA 9RUBA 4GNJA 3N11A 3E0FA 2E6YA 2PWUA 4LVDA 2V38A 3P0XA 1QK0A 3EEZA 3TV8A 5C54A 1D7FA 3CAQA 2YB4A 3DBNA 5D4YA 1O1ZA 4H3DA 2J7EA 1IEQA 2C79A 3BVJA 3QHMA 1DEDA 4MTVA 5BXSA 4NG3A 2QVHA 1UPMB 4UIOA 2PDIA 2WWCA 4FNQA 3WNMA 1G7VA 4LFYA 1RPKA 5DY2A 3EWXA 1AUSL 1XKJA 3EPMA 5D37A 3TC6A 4S39A 3QY8A 2YA2A 1GZGA 2RDUA 3S1XA 4QBXA 1US2A 4IZGA 4W84A 1QNVA 3E5PA 1WKFA 1WAUA 3RGTA 4FK9A 4RV8A 3QOKA 5MF5A 4L7ZA 3ARQA 4PCFA 5EMJA 3CB3A 5A6BA 4Q7IA 4X9YA 3DHPA 4JIPA 4QIUA 3NXFA 2C1IA 4GIEA 3CT2A 4LB4A 1B3OA 4MYXA 1X96A 3GM8A 4Q8TA 3HV8A 1DV7A 3LCHA 2PWEA 4A29A 4S3KA 1R0MA 4N4PA 3W1PA 3WF0A 1V7AA 5A8OA 3UZJA 4GVHA 3HQOA 3MS8A 2B31A 1XQKA 3QTPA 2G5WA 1HJUA 4AEOA 3LTYA 4WHBA 3SFWA 3S1WA 3LN3A 3UZ5A 2E77A 1CGVA 1XIDA 4IIEA 4IHCA 5A6KA 5HQEA 2Y2WA 4MUPA 4OIFA 3SQMA 5I78A 4ZB2A 4LYKA 3E2RA 4UFHA 1ZUAX 1XL9A 2WLYA 4OQVA 4TUFA 1GHRA 4Q32A 2ACRA 1TV5A 1SU5A 1LUCB 1S3TC 3BV4A 3QV9A 1EQCA 4I5UA 3VZYA 2VHLA 3BZJA 3RAOA 3IIOA 1Z7AA 4LBUA 2D0FA 3KTSA 5GJMA 1XSJA 1P0EA 1JCTA 1H50A 4ZO9A 1BXNA 2P8CA 4Z17A 1M01A 1BSLA 1PE1A 2E25A 1M3UA 1MW3A 4I90A 3L23A 2VVNA 3N2MA 3WQ5A 3IJDA 3RX2A 4LTSA 2CBJA 3SGZA 1FHUA 6CGTA 3CZGA 4ZVJA 4IPNB 1MDLA 2BSLA 4E5TA 1U22A 3LOTA 5J8LA 4ZQOA 3BG3A 1GVFA 1Q6FA 4PMJA 1CI1A 2XH4A 5CZTA 3GDLA 3KOZA 1XP3A 5K4XA 3GU1A 5AECA 1EZWA 1H5VA 2QGYA 4WY0A 3P3BA 1H4PA 3LCXA 3PWIA 1DXFA 2NVCA 2WV8A 3TSDA 3VUSA 2YFOA 2EPOA 1W5QA 5FEWA 3ZLGA 3ITTA 5FSEC 4YYFA 4IG2B 5G4HC 3B0VC 1KM3A 4D72A 1S5MA 4IGNA 1WDSA 4U2ZA 1ZBVA 4GE8A 4QSFA 4H9MA 1FBAA 3LUTA 3LDVA 4WDWA 3B8TA 1PUDA 2J66A 4BI6A 4YNGA 1VYRA 4EF9A 2V69A 5HNTA 1WUFA 1GQIA 2TSYA 4N9CA 4JIEA 1GQJA 5LGXA 2QJNA 2WBKA 4A05A 3KOXA 4JYFA 4BQ5A 3L5LA 1XISA 5I2UA 4O0QA 4IMCA 1DORA 2DVXA 3FOKA 3W26A 1J6PA 4YTQA 1UZ1A 1DIEA 4N42A 2PC4A 4C7DA 1TV8A 1SJCA 2ZRYA 5HANA 1KXQA 3S42A 4RZBA 4H2CA 3GTHA 3B97A 1GGOA 2PDFA 3BLDA 5TIMA 2OLSA 1OC6A 3U5YA 4LBRA 2INEA 2PWGA 1QO5A 1FKWA 1ZY9A 3PVFA 5LA2A 3CPRA 1TSIA 1Z48A 4FNTA 3SCQA 1ZAIA 3WMBA 3RG6A 4HYVA 4O50A 3TN3A 1WYIA 2GJNA 4LV9A 4X2PA 4BKNA 3L4UA 4H19A 3W83A 1TWSA 3R2GA 3EWDA 1HX0A 1TWIA 4S3DA 2XIMA 1X97A 5F2GA 3N12A 3PM6A 4NAEB 2ZZ2A 2D0GA 1BKSA 1PWMA 3B03A 2AMGA 1MUCA 3QYQA 4R34A 1ZS2A 2PWFA 2VJXA 1VHCA 3W75A 3TJXA 3M0XA 1NOUA 3QN3A 1YHTA 4R7JA 3WD1A 2YDAA 4TX6A 4GYPA 3AQUA 1A0DA 2QUVA 3C0SA 5DBTA 3MCMA 3FA4A 4J3WA 3ITXA 2F38A 3VIHA 1XM3A 1ME7A 4QNEA 4DYJA 1GPFA 1NAL1 1F61A 3CHEA 1JCLA 3ME3A 2GGJA 3TTYA 2BY1A 2J25A 4YVVA 5HNUA 2VEFA 1J0ZA 3CJPA 2W63A 3KX6A 2Y89A 1NP0A 3CS2A 4JDBA 4HHLA 1R2RA 1C9DA 1DJXA 1HJSA 1GTEA 2CCRA 5D05A 2PSNA 2PWDA 2Z7KA 4O28A 4E3TA 1JF5A 4YMZA 3ORWA 1JPKA 4L9YA 1V6YA 3MSDA 4DZIA 1QW9A 5H6HA 3PJWA 3UERA 4LSBA 3A64A 1UR2A 4GUJA 3WH6A 3B4UA 2F2KA 4KQNA 3CV7A 4MY9A 2D2GA 4D8ZA 1C93A 4S1FA 1UPPA 3ZVHA 5ABTA 2GK1A 1YPXA 1GKRA 3QKEA 3UA3A 4LPCA 1FWWA 3QSTA 4LUIA 1QPOA 3T81A 2POZA 4O1FA 3NDYA 1TVLA 3AXHA 2XSXA 4KGJA 1HJWA 4XBSA 3ITVA 3MU7A 3W88A 3R8RA 3TN5A 4HU4A 1CECA 2VCAA 2YCLA 1F4AA 5CC7A 5IRPA 1AMKA 5GQBA 4JXCA 1R2SA 1M7JA 3KCOA 5F1UA 1DE6A 2G4FA 3W2MA 2XYLA 3CO8A 4HZ7A 2PF8A 3BJTA 2OR2A 3W7QA 2QCDB 4NHVA 4O54A 4HPJA 1TRIA 6REQA 9XIAA 4UXDA 4ZGYA 5EMUA 3AIEA 1X6UA 4HPHA 1K7FA 5DRCA 4TV6A 3MUIA 2ZVIA 3E2VA 4H83A 2DORA 4MGGA 3E5BA 3NQBA 3ELFA 1L6YA 2VZVA 1E4NA 2GGGA 1SVDA 2CLPA 3N04A 1MO0A 3AMKA 3EKLA 1K8XA 2VOMA 3KWXA 3OZOA 2HS8A 5HMFA 1K03A 4MJZA 2AQVA 4IJCA 4TVUA 1UWAA 4C1NA 1NM9A 3GDTA 2WVVB 3N25A 3O9NA 3T05A 1U2YA 3WQOA 4F9DA 3NQ2A 4XD4A 3BDKA 1GYMA 3AALA 1UUMA 4I7WA 2JALA 5CEWA 1G9HA 4DUXA 3UZXA 1KXVA 4PBEA 2OLAA 1XX1A 1S5NA 5CCZA 1PXGA 3UZWA 1W1A1 1I0DA 3VIKA 3DKJA 3H21A 3UWWA 2DZTA 2MUCA 2DPEA 4KWVA 3GIQA 4NYUA 2R1NA 1Q63A 3W7LA 5CC5A 4CU8A 5A8GA 4J1OA 1GJUA 4IQLA 3EPNA 3M4HA 3M64A 3RLUA 2XUCA 4LJ3A 5HPOA 2PTXA 4HSHA 1O1HA 2YL5A 1RH9A 5E09A 2IXUA 1HG3A 3L66A 2G41A 4CU6A 1RK5A 1W1YA 4GMEA 5HATA 5D9MA 5A6MA 3GNNA 3N73A 4JTUA 3WD2A 1V3LA 4GQRA 4F3HA 2OGYA 4QLLA 4IJRA 3OTRA 2C18A 1OG0A 3UZZA 2W61A 4K7VA 1XLHA 3O3RA 7ENLA 2OZ0A 3GNXA 4NI8A 5AYYA 4TQTA 1E1CA 4NNAA 2EXOA 4KGLA 3M1ZA 2ADAA 4ZQRA 4LYPA 4TOQA 4MWAA 3T0AA 2C8NA 2AL1A 4DWDA 1J2BA 4JTLA 4L61A 4LUTA 2W79A 3QSRA 2EG7A 1UC5A 1ZAJA 3F2CA 1OCBA 4CCEA 4NRRA 3SN0A 1RJQA 3DEQA 3OYZA 3GB6A 2GFTA 1KCXA 4KIEA 1RP8A 3R0DA 1UR0A 1MFVA 1YW1A 2DVTA 5AHNA 4FOKA 4J9JA 1DJWA 4Y9OA 2ZZ7A 4FX7A 1IEIA 3S1GA 4LU0A 1OGSA 2BS9A 1YBQB 1I6NA 1HL8A 1VFTA 4WDUA 4YPJA 3AXIA 3POHA 1UKSA 1DJIA 5I3JA 3TFCA 2PTZA 3BAYA 3DHFA 2J77A 3A9BA 3LYEA 1IT0A 2W3ZA 4BFAA 1F74A 4YU1A 3WDQA 1LWIA 1X6LA 1FWCC 2B0MA 4GYPC 2WCSA 2QJGA 1LQ0A 3OJGA 3GSMA 3SSZA 5CPLA 3VNMA 1UD2A 3VILA 4B5XA 5AHMA 2XDFA 3VGBA 4AU0A 1XLFA 4O1AA 1EGMA 2W6RA 3BARA 1S2UA 3SCWA 3MYPA 2CHOA 1AD1A 1RBOB 3ZM8A 1XPGA 3MA8A 3Q45A 4RE3A 1LQAA 4QJ4B 3EOOA 3B0UX 5D8WA 3K8MA 1R3WA 2V5JA 2XZ9A 5CPMA 3N14A 5D9NA 5J5DA 3JUGA 2W62A 2QJJA 4M29A 3T07A 5H1WA 5FEZA 3ZR6A 3NAVA 5HMSA 4DUWA 3KTCA 3ZWSA 4NL1A 4F0MA 4ACZB 3MP3A 2PF0A 4G7EA 4AH7A 4UTUA 3T08A 2XSBA 1DWGM 1KFCA 2NT1A 4P7NA 2Y0FA 1BQGA 1EIXA 2QCHA 4Q4OA 1WKDA 1B2YA 4M19A 4QS6A 1Q2RA 1OBAA 5TD4A 3W07A 1ZALA 1Q85A 3FJ4A 1VD6A 2ZRZA 1B9ZA 1E9IA 4ADTA 5CG7A 4KERA 2IPJA 2NV2A 1OYAA 1TV7A 2DJXA 3MANA 1NARA 3LXAA 1CLVA 1W5OA 2FZBA 2PRHA 2ZQ0A 4Z1DA 4S3AA 3IJ9A 3HQ1A 4YHGA 2UV8G 1ZQ5A 5IFTA 4XO6A 2XVNA 1ZJHA 3DERA 4KS0A 1YDOA 1BVNP 1V3JA 4AWUA 4DPPA 4HHMA 3GXNA 3TW7A 4Q4SA 4AZGA 3VINA 6PTDA 3SJ3A 3NQGA 4FLOA 2WMJA 3FSUA 3CL8A 5AHEA 3GDRA 3DCPA 5JH1A 2OOFA 2YYTA 2F6XA 3VU2A 2ZFAA 3N3MA 4FXFA 4HNOA 3CHCA 4Z1AA 5D8ZA 1X39A 3SUTA 3M7SA 5CC3A 2GGHA 2XG9A 3LCWA 3FJNA 4GXMA 4IIBA 4C7GA 3VNIA 5KTLA 3PZNA 7REQA 2HZGA 3KDOA 3KOFA 4XBJA 2WNNA 1DL3A 5EB8A 3M44A 1PKLA 4Q4KA 3B05A 4CCZA 3TROA 3HG2A 1VYPX 3BSMA 5H2ZA 4J3SA 4KFOA 4HT3A 2PI6A 4UTTA 2VFGA 1FDJA 4AVNA 4M81A 1XH0A 4MOZA 4XBKA 4TMCA 3EXRA 2NUWA 3OA3A 4JX6A 3I3EA 4MNLA 4JTHA 1I0BA 3ARPA 1OADA 1AW2A 1BFNA 3O8AA 3OZYA 5C8BB 2YL9A 4A22A 3PBGA 1HJXA 1R3YA 1ADDA 3UWYA 4LY4A 5BWFA 2ACUA 2ZUWA 2V67A 3IJQA 3VMOA 2CWNA 3E1F1 1J2WA 3MBFA 4I5RA 2JF6A 3MO4A 1UWSA 4LRSA 1L2QA 3SRFA 1V79A 4MPQA 1QI4A 1QOQA 1M5WA 3KBMA 3OG3A 1HKWA 3CUIA 2X1UA 3K4AA 1OFBA 3WFAA 3VD3A 1QOXA 4GISA 3E02A 3LQLA 5E5CA 2Z6IA 3C6CA 1JZ7A 1CDGA 5BXTA 2HVOA 1KKOA 1QNOA 2WHKA 4HBKA 3ARTA 4EK7A 2NV9A 4C6KA 5BXPA 2QMJA 3WNOA 3AIQA 5A6SA 3IGUA 4V2XA 5GJPA 2NQZA 3BGJA 3WH5A 4HTBA 3UPWA 2VX7A 5F4SA 1O5XA 1Q4WA 4O1CA 4GQGA 1EJUC 5E1QA 2ZTKA 4DBUA 1GTHA 2D0HA 4MWAC 2WOQA 1EBGA 2P76A 1JIBA 6TIMA 1XDJA 6ALDA 3QGKC 4B16A 1JXJA 3L2LA 4RNFA 1VEPA 2EPLX 4W85A 4Y2WA 1GVOA 4NT0A 3NWRA 2PDYA 5EU9A 3FXYA 3VNJA 1BRLB 2UY2A 3UR2A 1TE6A 4MWAD 5U4NA 1G5AA 1R8LA 3WQWA 1ML1A 1SFTA 3K5XA 2IUZA 3RCYA 3TAOA 3VGDA 4AW7A 2UZ9A 4OKDA 3DZ1A 5TF0A 1N55A 4GHRA 3T44A 1KFLA 2A2IA 1ME8A 1FCVA 3W1NA 3UJ2A 1JF6A 3W6YA 4IFOA 2BODX 2X8RA 1P7TB 4NXKA 2CZ5A 1X38A 1UASA 4D8LA 1VBJA 4PMUA 3FHQA 4S3JA 5I00A 1YE6A 1QNPA 3ABSA 2C91A 3VDAA 1V6WA 4O0KA 3UP8A 2DZPA 4IIGA 2YX0A 2G3NA 2V3EA 2WZEA 1PSCA 3EB4A 3NEHA 2SFPA 4JQ4A 3V4BA 2P3ZA 3NGFA 2J13A 4A2RA 4ZTYA 3I3DA 1OCQA 3IPWA 5KSWA 3N2XA 2Z25A 5I23A 1A5NC 2JKPA 3QXBA 1VS1A 1BQCA 1JCNA 4KRTA 2Y6ZA 4E0CA 3W73A 1ITXA 3W3OA 1TWWA 4PUMA 2A6NA 1B3XA 2GYIA 4QLJA 2QLYA 3FVDA 3ALGA 4XAZA 1TPEA 2V30A 2Y8UA 1PB0A 2WC7A 5F2IA 4BQ3A 1UIPA 1P4CA 4G8TA 5DELA 1H1ZA 1UD4A 5CZKA 5A2AA 2ZXQA 1JR1A 4DBEA 4C6FA 4L80A 2ISDA 4CEUC 4QEEA 4GRSA 4K36A 3STPA 4W86A 2FJKA 4XTIA 1RQBA 4FO4A 2E9LA 3U48A 3TOYA 3C0JA 1CXHA 1EUNA 1JL8A 2ZTJA 3CIVA 1KFKA 3CZLA 4DEFA 2G3JA 3L9CA 1LLWA 4O1EA 5AYXA 3U3HA 4GG9A 2ZUNA 5T26A 4XISA 3THUA 4GYKA 1ZP4A 2Y7DA 4B90A 1LBFA 2VZSA 3MP5A 1EC9A 2PP1A 2FB2A 3EOSA 1EA0A 1C3FA 1C7SA 2VUYA 4HK7A 2OWWA 4CQDA 4EWND 2NT0A 3SJNA 4C91A 3KVJA 3OA5A 3WNKA 4A21A 4MJ4A 5AC8A 3CTLA 3UF9A 1JD7A 3RILA 1XSIA 3NQAA 3GFXA 3I4KA 1KM2A 4H2HA 1IWAA 1XI3A 3TEVA 1F4HA 4GIYA 1NTHA 1K7EA 1N8FA 1A4MA 3TXZA 3TLQA 2OMAA 2OKOA 1DTUA 1QATA 3H55A 3G22A 2PBGA 4XTDA 3H12A 3SCRA 2Y8VA 3GHUA 5CC6A 1IT7A 2PCEA 1TTIA 4FB7A 1RHCA 2YZRA 3FFSA 1TJRA 4PEEA 1GCYA 1VJSA 4U3CA 4JL2A 4BS0A 4B5UA 3QY6A 1IGSA 1KNWA 4JY8A 4HCLA 5LIKX 2NVDA 2QCGA 1VP5A 4PSPA 3W2UA 3ERPA 3PUDA 2W67A 1F73A 4O18A 5FF0A 1FQ0A 4IL0A 1VEMA 4L6DA 7ODCA 4RZ4A 2G3MA 3C8NA 3WLNA 1RSCA 3ZZ1A 4PFHA 1A5KC 1XC6A 3ARVA 1X8CA 2DZWA 3FDKA 5LGZA 1QFEA 4M6PA 3RLVA 3RRAA 3IJ8A 4IFRA 2ATSA 3NSMA 3W7CA 3UJEA 2VD9A 4S3BA 2WSKA 3GHSA 4GD0A 4AVOA 2V5DA 4NKCA 5EMYA 5FOOA 2O55A 4NJJA 1XJBA 3Q2DA 2PEVA 5I6SA 3Q94A 4NASA 1PHWA 3QMSA 4AZ5A 2EHHA 5HQLA 3APTA 1I1XA 4GC4A 4Q33A 1GHSA 4CNTA 5JBFA 3O15A 3UQNA 3RLGA 2DQXA 4WY0B 3V0SA 2GVEA 1RBAA 1VFUA 3TCEA 4H9UA 4LF2A 2YGYA 4JX5A 1EKOA 4YWSA 1C8YA 1IXNA 2H8XA 2OXNA 1AH4A 1JCJA 3W7RA 4B9ZA 2NQ5A 5G4EA 1SR9A 2EJ1A 4DYKA 3F4WA 1Q4NX 1SSGA 2VX4A 3QEZA 4IGMA 3WEMA 1YTKA 3LGEA 5LIYX 1J12A 4EXAA 4JTEA 3GNDA 1YIXA 4CN6A 4HOWA 1A53A 1ADOA 3N4AA 2MNRA 2QDEA 2HE8A 3VGFA 5JUVA 2GJRA 3TA9A 4P8UA 3DFOA 5K2ZA 1UMLA 3RK8A 1XD1A 2FGZA 3DDMA 4ZE4A 3MVTA 1T5AA 3AIBA 4B3KA 4E3VA 1GOMA 1JDAA 3NDZA 2BLEA 5D32A 3L7RA 2PWVA 3ARUA 5EPDA 1OFPA 3T6CA 3W2NA 3G24A 3H22A 4WQ6A 4ZQPA 1GJWA 5T8GA 4Z2LA 3FKRA 1U5HA 4G7FA 2UY3A 4AEEA 1TX2A 1LL7A 4UZUA 3QV6A 3W2JA 4ZTXA 3ZJ7A 1RQEA 2HK0A 4X60A 4ERIA 2OO6A 4S2CA 2Z24A 1ITQA 1H1NA 1PZ3A 3GFZA 1ME9A 2E67A 2C15A 1VJIA 4PA8A 4IPPA 3GC2A 2NXHA 3S5OA 2FZDA 4Y9NA 2FMOA 3UETA 2Y70A 3SUUA 2CBVA 3NIYA 1AK5A 3LMZA 3WQVA 2VYOA 4X61A 4RLIA 2JF7A 3ATYA 1O5QA 1ICSA 1TPFA 1UR8A 1KCLA 3GY1A 1I9CB 2V81A 2DW6A 4GIAA 1F3TA 1KLYA 2ABBA 4U2YA 3ZIZA 2VM8A 2OFJA 3G3MA 5EFDA 1VFHA 3W2KA 4AD2A 1EZ2A 1PV8A 2QPXA 4LF1A 1SO4A 3PZOA 3TAKA 1NWSA 3GXDA 3SCSA 2WKLA 3EAUA 4Y6GA 4X0VA 1HL9A 1JNEA 1FWEC 2HROA 3BAWA 4CD8A 2F9RA 4WIWA 2OKTA 4JIIX 2FPVA 1Z44A 3S2CA 3TYCA 2ZE3A 2Y61A 1UIOA 1A5SA 4DJFA 2Z6JA 4H9XA 5ABFB 3QR0A 3E0IA 2WO5A 3M0MA 3DOPA 3ISIX 1CPUA 1OYCA 3U6WA 1UC4A 4OV4A 4FLRA 1EQPA 4TX8A 5BMWA 5I3HA 2HXUA 2Q02A 2ODOA 1KQYA 4DPQA 2UWFA 2X42A 1CLKA 1V8EA 3M46A 1R9YA 3E9AA 4LW7A 1VLIA 1AJZA 4GQQA 5JBDA 3LK6A 2GK1B 4PODA 5DMMA 1P1MA 3PWAA 4R85A 3C56A 5F1VA 1I60A 2VEGA 3H2MA 1A5BA 4JFSA 2DSVA 3NDOA 3USBA 4OOUA 3F2DA 2CC0A 2YCKX 5KEZA 2KZHA 1P0KA 4AF0B 3UT0A 5DO8A 1UJPA 4AISA 4M7SA 1KM6A 2YCLB 1HJVA 3GHTA 2PZ0A 4IH3A 3REQB 3RMEA 5XIAA 1E6ZA 4B92A 4RUBA 3WUEA 1A49A 3CU2A 2GSEA 3HB9A 3HO8A 2HXTA 2CBIA 5DRIA 1V02E 1X6NA 1MXGA 1M7XA 3U8GA 1YDYA 2WMKA 3ARSA 4PBFA 1NWUA 5CGMA 3WDRA 4JTAA 3MSGA 2NWSA 3HGRA 1A5LC 3KRZA 7A3HA 1E70M 2PPGA 1TIWA 3WYZA 1MDRA 2BG5A 2A5HA 4UTWA 1KBIA 1AL8A 2D2JA 3C2FA 3P62A 1ZENA 3VA8A 2A3EA 4NY2A 1SFSA 1JYVA 3STFA 4LCSA 2EQDA 1B57A 3T0DA 5HJLA 1QHPA 4FZIA 3TMLA 1ADSA 3B40A 4O13A 2PUZA 1HO4A 2XFWA 3AHZA 4W4QA 3GVGA 2Q6ZA 1NY1A 3W71A 1IHIA 2A3LA 4WGHA 2YBUA 2ZYFA 2GGIA 4BF9A 4UTKA 3I6TA 4MZ8A 1NFGA 3HN3A 3K13A 1WXJA 1NP2A 1QR7A 1H0IA 2QCEA 3IEBA 4UNKA 1QMLA 3SBFA 3HMCA 2ZICA 1OFEA 3LA4A 1YTDA 4UR8A 5AHFA 2WB5A 1VCGA 3I6EA 4IIHA 1K8CA 3W84A 4GNKB 3CYVA 4WJ8A 4JFVA 1LQ2A 1XFBA 3SCOA 3E2QA 4DLFA 2WM0A 1RCQA 3WQ4A 3AUJA 3RM9A 2VNCA 2IKIA 4HB7A 2X09A 3VIGA 4S3FA 4CCDA 4C6MA 2D1ZA 3WNPA 5FJJA 2WVTA 3VIPA 4IL2A 3M07A 2NX9A 4FNSA 3SO7A 3T0CA 4XZMX 4AZCB 2NWRA 2Q09A 2VUNA 3DG7A 5HA7A 3F1QA 3VKBA 2CLOA 5KINA 4KCVA 4FLQA 4Q4MA 4Q8VA 5EFFA 2C14A 3OQ8A 4PUNA 1LL4A 4FSAA 1UR3M 2BNJA 4G2DA 3EX3A 2YCEA 3LHUA 3B9DA 4IFKA 2AGTA 2WK2A 4JHMA 3W22A 4AY8A 3VIIA 1CB7B 3OLEA 3CZJA 5HJXA 2PU0A 4IMGA 4Y9AA 3TZNA 1QRQA 3GKFA 1PX8A 3AISA 1BYDA 5DLCA 5LIWX 4L4LA 3M0VA 3V5CA 1Y8BA 2A0NA 3CUGA 4KFNA 2HDJA 1JZ6A 2VEKA 3AROA 4AMCA 1OIFA 3IARA 3EMCA 4ATWA 1FTXA 3VZXA 1DJYA 5ABGA 2XVGA 1R7OA 5CQ1A 1EBHA 1R3SA 4XSMA 4OJYA 4CQCA 4MADA 5LA0A 5T9CE 3NYDA 5LIXX 3S83A 3I10A 2VMFA 1C7TA 3BCDA 3CPGA 5DX7A 4OV9A 4WDTA 5FD0A 3GNPA 1CT5A 3IUIA 4WGXA 3VKJA 1XLEA 1ESWA 3H7UA 2I57A 1YPIA 4YS1A 2VZUA 2ZE0A 4I9TA 1B0IA 3TTOA 5LXEA 5RUBA 1RVKA 3LHTA 4B5WA 4FA3A 4OBSA 1H41A 3IV8A 4HOXA 1EYWA 4K39A 3DFHA 4WOZA 1DJNA 3KL5A 1PX4A 3WK0A 3ANYA 2NVAA 3K1GA 4Z2JA 3LY0A 4AIEA 4QLKA 1EYEA 3G0XA 3A47A 3AYSA 4L64A 4DJFD 1Q65A 2VWSA 4G7EB 3UCDA 1E6QM 1EWEA 4DHGA 1X7FA 1JD9A 2QCFA 1VAHA 4Q4QA 4UFLA 1H62A 1R38A 2J79A 4DNMA 1J0YA 4DI8A 4JS3A 3L5AA 4HSNA 2YXXA 4S23A 3AHVA 1AMYA 5CPSA 2GQAA 4L1XA 5E6YA 5K9DA 2GVYA 4KCTA 4LC8A 2HPMA 3D46A 3W86A 2O9OA 5T9BG 3S3GA 5HQMA 1PIFA 4FIQA 3WJYA 2O7SA 2BB0A 4GFSA 1XH1A 3QF0A 4O8RA 4ZXLA 5CBIA 3GUGA 2IXVA 3AU2A 3NZRA 3CZKA 1HUVA 4JTDA 2E7FA 2Z1VA 4R7WA 2YPIA 3WH7A 4DN1A 1FCBA 3ITCA 5PTDA 3ATZA 1JVNA 1KV8A 4PR4A 3RX4A 3KOWA 3S5SA 3UWEA 2BOEX 5EMMA 1TWDA 4UTWC 2ZUUA 3RCMA 1MNZA 2OO0A 3L4YA 1NDVA 1BYCA 3R0KA 1XLKA 4IICA 2TMDA 1F05A 3N1AA 4HCHA 3F4DA 2F6KA 1EJSC 3WF4A 2I17A 3QJAA 2REQA 5BROA 3TYAA 4YCOA 1LYXA 4QG6A 2VFIA 2R1KA 5FCZA 1C8VA 3B4YA 1F6PA 2GZXA 3R89A 5F2MA 3WK1A 3W72A 3G6LA 5G1MA 3F2BA 3S2JA 4HZ6A 1NF0A 3IIZA 1NQ6A 1VQTA 3FX4A 3BCJA 4WOQA 1GUVA 4PBGA 1SSDA 2OT1A 2BZNA 2YCJA 4GFIA 4GQBA 2OPJA 4Y90A 3QFWA 4F0SA 2ZDRA 1AA1B 4A35A 4ASTA 5JVLA 3AMCA 4NYYA 4XD6A 3O16A 3WMCA 1T8QA 5J5RA 1WZAA 4D6CA 1WDPA 1JPHA 4NAFA 4LUSB 1V4YA 4KFPA 2JK2A 3EKGA 1UBPC 1PCWA 3DIPA 3CZEA 4QM1A 4PUWA 5HWMA 3R8GA 3FA5A 3W7GA 1EIBA 3UESA 2FHCA 4CVWA 2GJXB 1VRXA 1NOFA 3WNNA 2XZ7A 3TTSA 5LZLA 2WPGA 1S3HA 1SJDA 2GL5A 3P74A 3NPWA 3S9IA 2XIIA 3V0TA 5E93A 5FJOA 3P60A 1BGAA 3H8AA 3W7NA 3B8VA 3QPZA 3GTFA 3W6LA 2WQPA 3MPGA 3H2NA 3O05A 4HIBA 3WX7A 4I9AA 4AX6A 3AU6A 3HGOA 3P82A 1TPUA 4AZ6A 1E5NA 3WK2A 1PO9A 4GACA 1E5JA 1HIZA 3QGVA 1Q7MA 4A8IA 2Z2UA 4JTJA 2NXGA 2VC5A 1V3KA 3EWYA 4GY7A 5HNNA 1KFWA 4PRTA 3GYEA 3GS6A 3ITYA 4OUIA 2FMNA 3CUHA 4Y9PA 4XWUA 3T8QA 4H41A 3GU2A 4DRSA 4AZ7A 2OQHA 1HVQA 3A4AA 2VKZG 3P8JA 3SIMA 2H9AA 4DJDA 1RP9A 1J10A 3WF3A 3TQVA 3C2VA 1Y5WA 3OGRA 4LY8A 4IWWA 2E3ZA 3L4TA 3UPBA 1N2VA 2WMIB 3AMGA 3W6MA 5XIMA 4QJ3B 4CQ8A 5HK4A 3ZQ9A 2CFFA 3IIVA 3FA3A 1AQMA 1HP4A 3MVIA 4U4MA 2PRMA 3N18A 2X1TA 2WHLA 4MNMA 5AZ0A 3HIJA 1WOBA 2PGWA 2PLKA 1T41A 4ZSUA 4EAMA 1HFBA 4B5NA 4JR5A 2NUYA 3CT7A 2QJMA 1GW1A 3DG3A 3E0LA 4GX9A 4UOJA 3KHDA 1CW2A 4FF5A 3LHWA 3BLOA 4C6OA 3A9IA 3RPDA 2I16A 3WLTA 1P6WA 3S1UA 1QWGA 3DYPA 1SMDA 1BYAA 3BGGA 1JFXA 2G8ZA 2AAMA 4E8GA 4OBTA 2KAUC 4MY8A 3GIPA 3PZGA 1XYFA 1BYBA 1OX6A 3KL0A 2VWTA 1XPYA 3A3XA 4ZFCA 3EOEA 3K1DA 1L8NA 2Z26A 5E70A 1E3ZA 3QZAA 4PUDA 1P0DA 3RM8A 2JQXA 1K6WA 4IP4A 4MLJA 3HF3A 1DWJM 1TUFA 3BV7A 2FQIA 1V03A 4JKMA 2PDXA 1EA9C 4GO8A 1U1HA 1QCWA 2NQJA 3LLFA 3RYSA 3DC8A 2G4JA 3OLGA 1W1PA 4XZ9A 1OFAA 4UMBA 3WJZA 4DAFA 2J8GA 4MB4A 3C0LA 1YEYA 5KZ6A 3WQFA 3TWAA 1TFVA 1KCKA 3OEXA 5D04C 1OG6A 4P7OA 3EPOA 4WD0A 4IT1A 1E71M 4QAIA 3MUCA 2ZA1A 3PFRA 3H23A 1EJTC 1QHZA 2HCVA 1RK6A 2IQDA 4YCPA 3S5NA 4OHQA 5FL1A 1TIMA 1HT6A 3LLDA 2TRSA 1TG7A 1JJKA 4HNTA 4ILSA 3PZTA 3QVQA 1QDSA 3WQ8A 1MYRA 1WV2A 3DKLA 3PZQA 5DCDA 1ISVA 4X0NA 1TJ2A 1W9UA 1MRQA 2XN0A 5A6TC 3AIWA 1O12A 1K8YA 3UYIA 4GQ0A 1W3LA 1MUMA 1W31A 3GR4A 4KRUA 2IQ0A 3WY1A 4GINA 1VFOA 3OYXA 3H2OA 4H8UA 1ZAHA 4TIMA 1RQHA 2O7QA 2IW0A 4MHBA 1CENA 4ZBCA 4LNYA 3PTMA 1J5SA 1PTGA 3BE7A 4DZHA 4CVUA 4UTHA 1KW1A 4NZCA 3JW7A 5REQA 1IEXA 3GW0A 2QXWA 1QK2A 1GVIA 5TBOA 5CAHA 1MXSA 3RO8A 3Q4DA 2P10A 2QAFA 2WNWA 2H3DA 1I2QA 3SQSA 1CGXA 2WQDA 1XIMA 5C2GA 4O0ZA 3T7VA 3V18A 4L6OA 3TDFA 3PR2A 2QR6A 3BOXA 3ZR4A 2DQWA 3VIJA 3WLJA 1QI2A 3N15A 5I3DA 2QMKA 3IV3A 3N2CA 4U3AA 1CGWA 1E3XA 3MCNA 3E12A 2FH8A 1XUUA 4A3QA 4QDWA 1KM5A 2HBVA 3CMFA 3FSTA 3HPAA 3N3TA 2E9BA 3PPHA 2XIBA 4QDMA 3BWWA 1BVZA 3T1GA 1ZHAA 2FPTA 1YQ2A 3IGXA 1FWSA 5D03A 1AW1A 6XIAA 2WJZA 3D6NA 3GNOA 4M24A 3WEOA 1OGGA 4DUVA 2AOSA 1D7KA 4QISA 1Q6CA 3NA8A 1PEZA 3NM3A 1H60A 2QS8A 3GW3A 5HR6A 1S2TA 3AO0A 3P0WA 1I2RA 1FHLA 2WPBA 1E72M 2VCCA 4D6DA 3NCOA 1NU5A 3O07A 3UJRA 1MW1A 4ZQNA 3BW2A 3DGBA 4ZEPA 1GKPA 4G56A 1H7WA 2AKZA 1BXCA 2J62A 3GXPA 3RDKA 1OX5A 3GFYA 4ORMA 1AQ0A 3QFEA 4PTNA 2Z0IA 1CNVA 4OUEA 3K2GA 3T4WA 3CPUA 2ICSA 2O4QA 3SSJA 3ID7A 2F8QA 4CD6A 4LC6A 3C61A 1HKKA 4R3UA 2CZFA 3UG4A 4RNHA 1GG0A 3S6OA 2YB1A 3CZ8A 3WD3A 4DJDC 1U1JA 5GNYA 2TPSA 2WNZA 3HJZA 5H8PA 2PGRA 4NQ1A 2YOCA 1LRNA 1EO7A 4HGXA 5CJNA 4JGDA 1J5TA 2PDQA 3HV9A 4LVFA 4P7LA 3IRDA 2OZTA 1FH8A 5DT7A 1LT7A 1Q7QA 1F8IA 2CKSA 4DJDD 4LWWA 3AI0A 1A50A 2BV9A 4PMVA 2B7PA 4PB3A 3IVTA 5AFDA 3BC9A 3E96A 1WXZA 3MMUA 3ARZA 3CMGA 3P61A 1HW6A 3RO6A 4QAWA 4DXVA 3IVSA 1VF8A 4QRNA 2FB3A 3CQKA 3QKZA 1V93A 3B8WA 2NV1A 3WBXA 3WLIA 4AWSA 1I2PA 3AOFA 5A6JA 3T8LA 2FFCA 1S39A 1RZMA 4D6FA 2NUXA 4UNIA 4B4HA 1PWLA 5LHFA 4NI3A 2EKCA 4UOQA 3K8KA 4WVXA 5C7VA 5HR7A 1O7AA 4PTXA 3H70A 1HO1A 5DBUA 4H6KA 1DQXA 1OZQA 1OFOA 2Z1KA 3G1XA 3BCFA 3L0KA 5E9AA 1UWTA 1ITUA 2Z2AA 3OLIA 5HMEA 1EPVA 3AIUA 4UR9A 3M43A 3D3FA 5EY5A 3WD4A 3W9ZA 2XH2A 3VD9A 1DIDA 3I4EA 3PB2A 4Y8EA 4KF1A 5BRBA 4JEJA 3UJFA 3E2SA 1FX6A 5HXMA 4WRHA 1EC7A 1V5XA 3L67A 1UMYA 3ZOAA 3LPPA 3CB8A 2BTMA 3IANA 1RALA 2VXNA 1Z6KA 4OFCA 1MXDA 3DBPA 1R86A 3NL6A 1G6CA 3IJ6A 1W9DM 1RLDA 1JAEA 2CXEA 3LXCA 1P6CA 4QROA 5AC4A 4WLCA 4YXGA 1K4GA 1FCQA 2BVDA 1VPXA 1LBMA 5LSMA 3UYCA 1LDCA 1NWRA 2HNEA 3VOHA 4G6CA 3KM8A 5AHIA 3E6EA 3GDBA 4J40A 2X0YA 3VDHA 3ZSSA 2XGBA 3N9RA 2ZA2A 1OK4A 4NZFA 3RITA 1W1B1 1E4LA 1XHGA 3GVVA 3BG5A 3CHDA 3W76A 3LENA 3WMSA 5HWNA 3AXXA 3GG0A 4H8HA 2QYGA 5BXRA 5J04A 3W38A 1Q6EA 3ABQA 1OD8A 2GJLA 2A79A 3VKDA 4DY1A 4MNKA 4A8RA 3CO4A 1L9WA 2Y63A 3TSMA 1FKXA 5AN7A 1OABA 1HZYA 2OEKA 3THCA 1KTNA 4LAKA 3NZ1A 3MUXA 3RCNA 5JXQA 4QGCA 1WB0A 5I06A 5IXEA 2ALRA 4DLMA 3C86A 2A85A 3VC5A 4W8LA 1GONA 4XAGA 1XLGA 3O6YX 2CIPA 3ONBA 1Q5MA 2J7FA 5KZMA 5M1TA 2DIJA 1P1XA 1EDQA 1XLLA 3GU9A 3NFUA 2DU2A 1REQA 2UY4A 5G5IA 1NQKA 4IOTA 3ZT5A 1Z9AA 2YXGA 1XLDA 4GUGA 3UD6A 3VGHA 2XPKA 2V2HA 2VEIA 3A24A 3RF9A 3B9AA 4BWLC 3LU2A 2QIIA 3WLSA 1ISYA 1TJPA 2ZADA 1JYWA 1ZLPA 3DN5A 3A12A 3C8FA 5IBXA 4M7TA 1XLBA 3PTDA 1W32A 2BGQA 1BKHA 4RXGA 1E0VA 3UEQA 4D2JA 3UZYA 1PJ9A 4C6CA 2R8WA 1P5BA 3SECA 4F2BA 1QNSA 4GC3A 1DJZA 3G3DA 1G0CA 1NWTA 4TTGA 1FWTA 3T42A 2QCMA 4LGXA 1PTDA 2J24A 4XZBA 1S2CA 1YADA 1AJ2A 1VBHA 2WMGA 5EGRA 2ZRVA 4QR6A 1TPWA 3DFNA 4UTJA 4EX4A 4I7UA 3CEPA 5G1TA 4GYFA 1XD0A 3KVLA 2O92A 3ABOA 3URBA 4AYSA 3SIZA 3R7MA 2ZC8A 2GJPA 1X1NA 3M0YA 3VXGA 1KKRA 3M0LA 3PUEA 4UQBA 5ABHA 1KR0A 1W56A 4C6IA 3PAJA 4C5YA 1QU4A 4TVCA 1NFBA 4XZHA 2E9MA 2XH0A 2FKPA 4QJ1A 1QWKA 1UG6A 3OB8A 3ZJ6A 1Z32X 3URAA 2RDTA 4BQ4A 4HZ8A 2OYLA 2O9PA 1Q2SA 1VIZA 4IXXA 4WJEA 5LHEA 2QT3A 3KOYA 2DZSA 3DI0A 5GPRA 2P53A 4HD5A 1UOZA 1ISZA 3ABZA 1UD5A 1H09A 1SO3A 5JQ9A 3FYOA 4C5ZA 1XRSA 4LXFA 2WAGA 4HA4A 1F9CA 3CGTA 4MJMA 5HBFA 1EX1A 3NQ6A 1UCWA 1JCXA 1CBGA 3KWSA 4UWMA 4OGZA 4J7RA 4JYDA 3H54A 3NL3A 4UZSA 4C7FA 1V02A 4PCTA 3EDKA 2BHUA 2WMFA 2OVLA 4O1DA 4OWGA 3DAQA 4OTKA 1G4PA 4OT7A 2PD9A 4X2RA 1LUCA 3IJLA 2BASA 4P8VA 1XSKA 5KETA 1JZ4A 4IFKB 4AIOA 5DQPA 1EXPA 5DMNA 3WUBA 3KVKA 2XJ7A 1YX1A 1EP3A 4XB3A 3RPMA 1RY8A 1K9DA 4XG1A 1ZCOA 2V3GA 3WH8A 2YFNA 1EP1A 3NEVA 1QPQA 3CUJA 1UA3A 3VGEA 3P80A 4BF5A 3L4XA 3GDMA 4MY1A 4WXZA 4E2OA 3VFCA 3W87A 2BWGA 1W9VA 1IV8A 2BMBA 4PYSA 3KBJA 1CWYA 1OX4A 1EJXC 3EOUA 1FCUA 4IGSA 4XK2A 1GOWA 5MKGB 2FTYA 1JDDA 4XV0A 4IG2A 1TZ9A 5CPQA 3VE9A 1OIMA 4D6IA 3MHGA 5AC7A 4PTVA 4WSJA 4PL1A 4UFMA 4Q8MA 4UTLA 3OHIA 4W88A 3HFTA 3WK3A 3NQEA 1POKA 1XBZA 4Z2GA 1UR1A 5E0CA 5I3KA 1A5MC 4AZIA 3OGSA 4S2BA 4A4AA 3PSVA 3GHRA 4F79A 2GUBA 4EWJA 2Y4SA 1J6OA 4AD0A 1V51A 5L9FA 2OGJA 4GZJA 4CKQA 4DBSA 1OINA 5HULA 8XIMA 5A94A 3VIFA 4K68A 4F48A 1OK6A 1RJPA 2WSYA 3B8IA 4AZBA 3HG4A 1V0KA