2BP1A

Structure of the aflatoxin aldehyde reductase in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
323
structure length
323
Chain Sequence
RVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Aflatoxin Aldehyde Reductase in Complex with Nadph
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
total genus 120
structure length 323
sequence length 323
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.n11: Succinic semialdehyde reductase.
pdb deposition date 2005-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2bp1A00
4L1XA 4YS1A 3MC5A 1LWIA 4XO6A 1AH0A 2DUXA 4GA8A 1X98A 3V0UA 4H7CA 2PDKA 1HQTA 1K8CA 3R8GA 3COTA 4I5XA 2PDHA 5LIXX 1EKOA 1ZGDA 3T42A 2PDPA 4PMJA 3O3RA 1ZUAX 3LD5A 1S1RA 3UG8A 2ACQA 4JIIX 4XVEA 1T40A 1JEZA 2FZDA 1J96A 4HMNA 2IKGA 3KRBA 4JQ2A 4OTKA 4DBSA 3B3DA 1PWMA 3DN5A 3LN3A 2PEVA 4IJRA 2FZ8A 2PDFA 2F38A 1AH3A 3UYIA 3CV6A 1YNQA 3GUGA 3V35A 4YVVA 1ZQ5A 3UZYA 1FRBA 1Z3NA 5DANA 4EXAA 4QX4A 2AGTA 3DOPA 4H8NA 3R58A 2FZBA 2BP1A 2PDGA 2PDXA 4R9OA 1M9HA 4FALA 2PDQA 4PUUA 1UR3M 3Q67A 1EL3A 2IS7A 3RX4A 4QR6A 2HE8A 2R24A 1T41A 4XK2A 3VXGA 4GQGA 1PWLA 3N6QA 3BUVA 3D3FA 2IPJA 3MB9A 4WDTA 4IJCA 2HVOA 1S1PA 2PDCA 3QKZA 1VBJA 4DBWA 2PD9A 3LBOA 2I16A 4LAUA 4AUBA 3R6IA 1Q5MA 2IPGA 2PDNA 2ACUA 4WEVX 4LBSA 4ASTA 1XF0A 4LBRA 4XZNX 3UZWA 4NKCA 2ACSA 3R43A 3FX4A 2HEJA 1XJBA 3NTYA 2PDIA 4HBKA 1X96A 4QXIA 2FZ9A 3G5EA 3LQGA 5LIKX 1R38A 1QWKA 2P5NA 3M4HA 3BCJA 3WCZA 2FGBA 1IEIA 3O0KA 4GIEA 1RALA 4WDWA 3EB4A 4FAMA 4XAPA 1S2CA 4PUWA 3GHUA 2IPWA 4JTRA 3LQLA 4JIHA 1X97A 1PYFA 4EXBA 4YVXA 2A79A 2DUZA 3G1RA 2HDJA 3ONCA 4LAZA 1QRQA 3CV7A 1A80A 3WBWA 5LIUX 2PDUA 3UZXA 4ICCX 4DZ5A 4Q7BA 2WZTA 3CASA 4MHBA 3BV7A 4RPQA 2HE5A 3LZ5A 1PZ0A 2HV5A 3V0TA 2WZMA 3CAVA 3P2VA 3ERPA 4LB4A 2BGQA 2PDWA 1GVEA 2I17A 1YE6A 1AH4A 5LIWX 3UZZA 2IPFA 1Z9AA 4G5DA 4WRHA 4XZIA 2F2KA 5AZ0A 2IQ0A 1S2AA 4GABA 2IKIA 4LB3A 2IKHA 4PRRA 1C9WA 1MRQA 4PRTA 5HNUA 2PF8A 1XGDA 4YVPA 3LEPA 1Z89A 5AZ1A 3CAQA 3FJNA 5JH1A 2NVDA 1AZ2A 2HVNA 4WGHA 4JQ1A 3GHSA 3CMFA 3Q65A 4JQAA 3V0SA 2ACRA 1Z8AA 1MZRA 3UP8A 3V36A 2PDMA 5M2FX 2INZA 5JH2A 3M64A 4XZLX 1EXBA 4FZIA 2INEA 4GCAA 1AZ1A 1LQAA 1MI3A 5HNTA 4DBUA 2PD5A 3WG6A 2IQDA 1US0A 2BGSA 3LZ3A 3F7JA 2IKJA 3WBXA 4XZMX 1VP5A 2C91A 2DV0A 3R8HA 2QXWA 2J8TA 2ISFA 2PDYA 2PFHA 1Q13A 5KETA 3H7UA 1ADSA 5HA7A 1YNPA 1HW6A 1IHIA 4WDXA 4XVDA 4GQ0A 1EF3A 4JTQA 3H7RA 3UFYA 3LUTA 3BURA 4Q3MA 2PZNA 1ZSXA 3R7MA 3S3GA 4JQ4A 4JIRA 4JTDA 1RY8A 4ZFCA 4GACA 4XZHA 1SM9A 3WBYA 4JTCA 3RX3A 3N2TA 2R9RA 3UWEA 5C7HA 5LIYX 3GHRA 4PR4A 4YU1A 2NVCA 2CLPA 2FVLA 2PDJA 2ALRA 4FA3A 3ONBA 2PDBA 3H4GA 3U2CA 4JQ3A 4IGSA 1OG6A 3EAUA 3LENA 3GHTA 4XO7A 4QBXA 3LNMA 1AFSA 3EB3A 2VDGA 1PZ1A 3R94A 3UGRA 3C3UA 4L1WA 3M0IA 3RX2A 4WDUA 4JTAA 1RY0A 2PDLA 4F40A 1YE4A
chains in the Genus database with same CATH superfamily
3H2EA 2DVXA 3UG4A 2D24A 3TROA 2QDGA 3W02A 3C0JA 2DT1A 1IT0A 4H6QA 3A5FA 1AVAA 4AZIA 3PPFA 4LEFA 4GXPA 3MZNA 3LS9A 5G1TA 3DGBA 5XINA 3N2MA 2UY4A 4QRNA 1VH7A 3VKDA 1OB0A 3TW7A 1RXOB 2EBNA 4MTVA 5XIMA 1UJQA 4NSBA 4M82A 3EOLA 1Q3NA 2PSNA 4O13A 1XLMA 4GBDA 3N6HA 2X1UA 2X7WA 3F5KA 4PTMA 4LUSB 3G3MA 1BF6A 1UB3A 1AODA 3CZLA 2W9MA 2GDVA 5BU6A 5I03A 1SO5A 3GIQA 4DJFA 2Z4GA 1J10A 3VOCA 3TK7A 3C2YA 1H51A 2BXYA 3OODA 4EXAA 1JUBA 2VX7A 2QAFA 4LJ3A 4EVZA 1C92A 2YL6A 4NASA 4W7UA 4O52A 2OO0A 5TIMA 4P2VA 1TPDA 2AMGA 1A5SA 3CIWA 4A8IA 4OHQA 1SUXA 4K1GA 2PDQA 1FH8A 4HKPA 1LCOA 4GQRA 3RLUA 2R6OA 4DWDA 1MUWA 5M17A 3TMQA 4WLCA 2VUYA 1ZALA 4NJKA 2ZC8A 3LMYA 4E2VA 3PY2A 4Q8NA 3W1MA 3NO5A 3OEXA 3T8LA 1GZ1A 2DZTA 3MKKA 3O2LA 2ALDA 4CCDA 4NHVA 2WANA 1WPCA 3BQ6A 2J88A 3FAXA 4QISA 1KTCA 1UA7A 1UHVA 3TYZA 3TC7A 3QLDA 3GSMA 3PC0A 4LBSA 1VLWA 1T0OA 3GNOA 1DJIA 3M0XA 1PIFA 4XSMA 3GG8A 4AF0B 4KEVA 1K6WA 2HEJA 1XJBA 1GHSA 4IPPA 4AY8A 4LC6A 1NVMA 3VNLA 4WX2A 2RGLA 2BY2A 4UCFA 1V6TA 4QROA 2NQ5A 2DJXA 1C9DA 4D8LA 4H9XA 3F4CA 3ITVA 3RG6A 3VNYA 3CUJA 2ZZ1A 2X05A 3N19B 3QOMA 2F6UA 1GQIA 1W31A 4P8WA 1YNYA 3S5OA 1HL2A 1B1YA 4RJEA 1WZAA 4A3YA 1NFGA 2J9ZA 1NY1A 3GS6A 1LDCA 3TA6A 3II1A 3B9NA 4UQEA 3BJTA 3PF3A 4GCXA 2QUNA 3VDHA 3O0FA 5M5DA 3MI3A 4RXFA 1V0LA 4HU4A 4YCOA 2J27A 1ZTVA 1BG4A 3IGXA 3B8WA 1RJQA 3R2GA 1ISWA 2QUVA 4W8BA 3W6MA 3S6TA 3AC0A 1R2RA 1Z9AA 1V7AA 2CBJA 3S47A 1CWYA 4Q4MA 3PSVA 5CC5A 8XIMA 4ATWA 7PTDA 3CPRA 1K9EA 2E6FA 1C9WA 2VL4A 5D8ZA 1EQPA 1XSKA 1XGDA 3EWXA 3AU6A 2WB5A 2PI6A 2RFGA 4AZ7A 6PTDA 4HA3A 4HMCA 2P50A 3PK7A 3HBLA 3WMCA 3TEVA 1QWGA 4XTIA 3DAQA 3V0SA 3SDOA 3FXYA 1R7AA 2D69A 1EP1A 3E0VA 3PULA 4E38A 2V2HA 3WNMA 1EZWA 3M64A 2EAWA 4KWSA 4UMCA 4XZLX 2QCHA 2E4TA 1GKRA 4S2CA 5D2YA 5JQ9A 2XN2A 2ZE0A 2RDWA 1J2BA 3IV3A 3UG5A 1XLCA 5CPNA 1H50A 4I8YA 1HJWA 1NJJA 4HPXA 1NF7A 2OT1A 4ZQMA 2GJPA 3GD6A 1OGSA 2Y6ZA 3FHAA 3VZZA 3BXWA 3ARXA 2ZIDA 2WBGA 4BZYA 7TAAA 4ZCWA 4O1EA 4GQ0A 5DT7A 2H9AB 1SO6A 3O05A 5CEWA 1ZFJA 4FPSA 3M9YA 2HROA 3VZYA 1G5AA 3QF0A 2PA6A 3LUTA 3BURA 4M6UA 3BICA 4D71A 4EX4A 1YADA 2QR6A 4JTDA 4ACZA 4FIQA 3DGRA 4AD4A 3G3DA 3AUJA 5A6MA 3W2UA 4GZEA 2R9RA 2WCSA 2ZE3A 1OG0A 4BF7A 4I9JA 2OELA 4MYAA 2PDJA 4ZVJA 1QHPA 4E6MA 3PBGA 4IGSA 4D1IA 1UIOA 1I0DA 2JF7A 1TSIA 3B9OA 2BLEA 5CAHA 4AD2A 1JNEA 4QM1A 4G1KA 3P0WA 1QJWA 3E0WA 1F3XA 4DUOA 4KETA 3ITTA 1W1B1 3IGHX 3WLTA 2WSRA 5A94A 3AO0A 1FWCC 7A3HA 1TV4A 4WY0A 3LX9A 4S3BA 2ZZ3A 3SUUA 1XC6A 3R1ZA 4C6IA 4HNOA 4E2OA 2HCVA 4GYPA 2OWCA 2QGYA 1ECEA 1PX8A 1AH0A 3BLKA 4DLMA 2DSKA 1TWDA 3VIOA 2WJDA 3DYOA 2DORA 3VNKA 2XH7A 4JHMA 2QMJA 1JCXA 4QG6A 4N9BA 2BFGA 3ARTA 3AHZA 5EU9A 1SU5A 3W7KA 1REQB 1ZGDA 4C6NA 4GX8A 4PMJA 2OLAA 3VX1A 3FAWA 2J13A 2E6DA 2A7PA 3AWOA 1XM3A 1PCKA 2VUNA 3EZ4A 4W7VA 3KLLA 4JOMA 5A6AA 2Z7KA 4FXFA 1C7TA 1AH3A 3QR3A 2RJGA 4V28A 4HSOA 4S3JA 3NQVA 3WY1A 2BOFX 4PMYA 1UW9A 2E5DA 1CGUA 2Z6JA 4IMCA 5LGZA 5I5RA 4LUTB 3P6LA 3W74A 2DSVA 4F4RA 2PS2A 5CC3A 5E0CA 1H7XA 2EPNA 2GWNA 4JBRA 4J5NA 5FA5A 4MUPA 1VFLA 4E8GA 3WF3A 1YLVA 3B9DA 3RPTA 3CM4A 4PUUA 4CUCA 3L21A 3H2MA 3Q67A 3GG0A 2V2DA 5A8QA 1UWTA 5HANA 1HKMA 4DF2A 1X6UA 1R5YA 2DVUA 2X7VA 4WSHA 3SEPA 3SCWA 5C0QA 2QCEA 2J78A 4IFRA 1PIIA 1XX1A 5E70A 3W1PA 3U4FA 1TCDA 2CKRA 3RITA 2FTPA 4L6OA 2WMIA 3MUXA 1IWBA 3WQCA 5C2XA 5KINA 2I16A 4UOJA 5FJUA 1IIHA 1RCXB 3WJYA 1F6YA 4ZQPA 2NLYA 2OZTA 4ZQNA 3AU2A 3BL3A 2C7FA 3GG7A 4NP7A 4LBRA 2F84A 2Z0IA 1NU5A 3T40A 1JCYA 3UR7A 4G9PA 4LCSA 4L9XA 2PDIA 4HBKA 3M0ZA 5AYZA 5CPLA 2Y88A 2XVNA 3H24A 3LYEA 3ZT5A 3FLUA 1QWKA 4FNTA 4LUSA 4CCCA 3BCJA 4IFOA 4R88A 1IEIA 2UZ9A 1EDTA 1GEHA 4FAMA 3GFYA 4IGNA 4XAPA 2DH3A 3GHUA 3VNZA 3QFWA 4H2HA 4ZE4A 1GVRA 4I7VA 1LUCA 3ZIZA 4TMBA 2DP3A 4B5VA 3G1XA 2BG5A 4JFUA 3I3DA 3FVDA 4JL2A 3BAYA 4RZ6A 3KXQA 3KRUA 3NSXA 4JTHA 2PDUA 2ANUA 4ICCX 3HV8A 2A0NA 1YPIA 1B3YA 4H7ZA 3NJ3A 3E74A 2VZUA 5MKGB 4AWEA 1AG1O 4FXSA 4I9MA 4R7WA 3DFNA 1TPUA 3AFBA 3P0XA 4LS1A 2I17A 2J25A 1P0BA 3BZGA 1HXJA 3AUOA 3R5EA 4PMXA 3NWRA 4JX6A 3RILA 4KT2A 2JBMA 3CLWA 2JKPA 4UFKA 3LMZA 3GU9A 1MRQA 3C2VA 2PF8A 5ABEA 1A0DA 4PC8A 4IIBA 4WOQA 3R12A 4R53A 1T5AA 3VUPA 4GI6A 3BANA 3CAQA 3VIIA 1LWJA 2XWEA 3T78A 1S3HA 4F3HA 1JQXA 2QQ6A 1S3TC 5I07A 1XH2A 1Q85A 1W2PA 4A3QA 2GVLA 3W7GA 2VO5A 1FVPA 5E0KA 5EGRA 1OGBA 3POHA 4NVTA 3KTXA 3RF9A 2R82A 4N2YA 1QHOA 1ZJBA 2RDUA 3RM8A 1NP2A 1RR2A 2BOEX 3CL6A 4J3SA 3DIPA 1V6YA 3KWXA 1EZ2A 3VDBA 5HNTA 4F0LA 2FVKA 1HP4A 1IZJA 5A5WA 3O63A 1DOSA 3K4WA 3VK5A 3KOXA 3GFZA 1DE5A 3QEZA 2FQIA 1BYBA 3O16A 4J3TA 1R8LA 3MYOA 4JIPA 4UTUA 2B7QA 1K1DA 5C2CA 3FOKA 3QW4B 1VFFA 4BF9A 1JZ2A 3SN4A 2PFHA 4N9EA 3GVQA 3EPNA 2C1HA 4O8AA 1XYFA 2GVYA 1QCWA 1NWSA 1TPC1 1XUUA 2V0TA 3L9CA 4FNUA 1Z41A 3OVGA 3FGCA 2JKAA 3T0TA 3AZSA 1MEWA 4M19A 2GVJA 5FJJA 1JPIA 4L6HA 1NM9A 4LY8A 3N1AA 3UWEA 3WNOA 1U22A 2AKMA 4H6KA 3RLVA 1P4CA 1XIFA 3N17A 3B8VA 5KZMA 2D1ZA 2Q8XA 4AXNA 1QK0A 4BCEA 5CZKA 4DO4A 2V3DA 4XO7A 3V4BA 2O9TA 3VPLA 2ZXBA 4H9VA 4UZSA 2VOMA 4E4PA 4W93A 3DH7A 2W62A 3GC4A 3S83A 1NTHA 1KTBA 3M0IA 1GQKA 2YCJA 2DU2A 3TONA 3TVAA 3NQBA 3V3WA 4RK8A 4I3GA 3BSGA 3QV6A 3S1XA 4XKYA 4NJHA 1E9IA 3IUIA 4HYWA 3QHMA 3BVJA 2YBUA 4AYGA 1TTQA 2CESA 1KM1A 3COTA 1HVQA 4NJIA 1E6QM 2EG6A 2JE8A 3PZGA 4ZZ9A 5IDZA 3GW0A 4L61A 2ODOA 3VUSA 5BOFA 3QBUA 1YKWA 1JXJA 1HGWA 3CQKA 1F3WA 2YR1A 4HU0A 4NZ4A 3W07A 2AKZA 3DN5A 3A9BA 2FZ8A 4PZVA 3LU2A 1JF6A 3QPYA 2JF6A 5F7UA 1P48A 4LV9A 1FH9A 3U7VA 5FEPA 3MS8A 1O12A 1RAKA 3VOIA 1W5PA 1BRLB 3URAA 3GNPA 1CDGA 2QUMA 4J3UA 3M7SA 3ABXA 3LI1A 1K8XA 3IJIA 5I3DA 2VEPA 1IXPA 4R7OA 3T44A 4WSKA 1JAEA 5BZAA 3BLFA 4S3EA 1V3HA 4S39A 4Q8WA 3KHJA 3WYZA 2ZRUA 4LPCA 3QYQA 2EPLX 3TYBA 2GJNA 2V5JA 3PHAA 3C2RA 1J0HA 4GQGA 4NG3A 2YDRA 1QNSA 3W2LA 2V5DA 3NQEA 3TX9A 2FJKA 2E7FA 4ECLA 2B7NA 1ZL1A 1S46A 4IQJA 1S1PA 3MT1A 5CZTA 3RNDA 2F6KA 4FP1A 3TCEA 3URBA 2PTWA 4CD8A 1JJKA 3EXRA 1WXZA 1K4HA 1SZGA 3LBOA 1R87A 5FAGA 1UP0A 5K3VA 5B7ZA 2CC0A 3ISIX 1IR1A 3QY8A 2OR2A 4DZAA 4KIRA 3O1NA 4QE4A 1GOIA 1UBSA 4F9DA 1J0IA 2R1KA 1PDZA 4H2CA 5HUOA 3HG2A 2WSYA 1X96A 4JPGA 1E72M 5H8MA 5H8PA 3BG9A 1PUDA 4MJMA 2W3ZA 4FXJA 4J3ZA 1JYXA 3BZJA 1XD1A 1YTDA 1LOLA 3BWWA 3HJEA 4QQ3A 3QN3A 7CGTA 4XBJA 5DQPA 1C3FA 4U31A 1PYFA 1MQQA 5ENLA 2XSBA 2CLIA 3BSMA 3TSMA 3IJQA 3LGEA 4GJIA 5FSEC 1P7TA 3BLPX 2C16A 4JYFA 2WZIA 2G3IA 1W1TA 1JPKA 2VENA 4JN8A 1JZ4A 2WZTA 3R11A 3ZZ1A 1VCFA 4MPKA 4ZOCA 4J4KA 2EJ1A 1Q6CA 4QAWA 3P2VA 1P0EA 3CQ0A 1ITCA 1UA3A 4A21A 2G96A 1W8GA 1FFRA 3NL2A 2D23A 1O7AA 2V9DA 2IQTA 1JPDX 1J93A 1K9TA 3ZJ8A 3POCA 4KGLA 4NAEB 4DELA 3ES7A 1EHAA 4WZHA 1Q2SA 4M5PA 2Y8UA 4WIWA 5A1AA 2BODX 5GVJA 3EXSA 3N04A 4UIOA 3AIWA 2QVNA 4CN6A 1VIZA 1FWRA 2YKKA 3LEPA 1Q6DA 3TDFA 1SW0A 3PR2A 4ZQRA 3NQDA 4PTNA 4AEFA 3C6CA 4S3AA 4DAIA 2PTYA 1OFAA 5JH1A 1HVXA 3PPGA 5EA9A 1R3RA 2ZFAA 4WGHA 1GPFA 2ONEA 2YW3A 1UP3A 1A5MC 1B2YA 2WQDA 4DBDA 5BXPA 5E93A 2QW5A 2D3LA 3ENLA 4H9TA 2ISWA 3Q65A 3VVGA 2AL2A 3ZT6A 4GC4A 5E0FA 3CZKA 1W9DM 2MNRA 1TO3A 4CD7A 2QCGA 5BWAA 2DZBA 1WDWA 5A8GA 1U1JA 1A53A 5EMYA 3EEZA 4D9PA 1I6NA 1E55A 5G2IA 1GORA 2A3BA 4A29A 3DESA 1XLBA 2XYLA 3Q37A 1Q6LA 1V6WA 4BKNA 5LZLA 2YL5A 3O07A 1PTGA 5C9XA 4EP8C 3H2AA 3IGUA 1Z6KA 1AMYA 2DY3A 4IH3A 1VP5A 2J66A 3VDAA 1XINA 3F5JA 2V68A 4IIGA 1C29A 1DJGA 4RNJA 2BMBA 4JTSA 1FY6A 3F2BA 3VABA 3LSCA 5JIPA 1LL6A 4G56A 1F4AA 2DGAA 1OCJA 1DJHA 3PWGA 3VFLA 3TQVA 3IJ6A 5DN1A 2C1GA 1HO4A 4BQ5A 5HPOA 2VD8A 1VFTA 4R3UA 3WD0A 2V67A 5BRQA 3VMPA 3SAZA 1X7FA 1XLLA 4H9ZA 5CBJA 1Q6QA 1VHNA 1DE6A 1IT8A 1GJPA 2BY0A 1R2SA 3IS4A 4GUFA 1WDDA 3CV1A 4Q4PA 1E73M 1YEYA 2QPXA 2R1MA 1DKWA 2VDGA 1P6CA 3LBCA 3WJZA 3P61A 3LXCA 1L9WA 3D46A 1OK4A 2OYLA 1XIHA 3UG3A 5FEXA 2H8ZA 4PMUA 2Z2AA 1Y8BA 3CT2A 3QV8A 1A4LA 5F1UA 1EPXA 4F40A 2FMOA 3I7RA 3SCQA 3MC5A 4YIWA 3HN3A 3S2LA 2W5FA 1RJRA 1EO7A 3OJGA 1YQ2A 1EH9A 1XFCA 1LT7A 2J62A 1J6OA 3TOPA 3H53A 3B0VC 4XV0A 2YJQA 2PWFA 4LUYA 1OX4B 2F6XA 4PCPA 1J6PA 4OU1A 4GVHA 3TA9A 2V6AA 3LHVA 2G3MA 3UG8A 2ACQA 5LNSA 1S5MA 8RUCA 2OKTA 1KNWA 4JL1A 1MFUA 3S5ZA 5DMMA 4W87A 1GVOA 4OE7A 4AZ6A 3SB0A 2PEVA 3CS2A 2ZWZA 3ZM8A 2GGJA 1B3WA 4GINA 4QEHA 4GKTA 4GUJA 4JHZA 3S5NA 5IFTA 3WDJA 4U10A 1FWGC 3N3MA 2HRWA 1VBUA 4D8ZA 3GTIA 4AXKA 1KQYA 3F4VA 3DFOA 1ZCCA 1UUMA 3SQLA 3SRHA 4ZOAA 2MANA 4JTLA 2H3BA 2XIJA 3DC8A 4N02A 3CZ8A 3EA3A 2AL2B 3T08A 3MP3A 3ATYA 2PBGA 1P7TB 5LA0A 3AXXA 3E96A 3FEQA 1UH4A 1S2UA 3V1HA 4F2TA 1R47A 5JBDA 3UXDA 4V15A 3NNTA 3B8UA 5D4YA 2EG7A 3NR0A 3WF0A 5ABTA 2RKXA 4UTKA 2ABBA 4QR6A 1CLXA 4HOZA 1SFLA 5EPDA 2XUCA 2VDIA 3USBA 4J3WA 3BUVA 3D3FA 4NAFB 3LI0A 3GZAA 3L65A 3R8RA 1VYSX 3OVQA 3CO8A 4PFHA 4H9YA 5BMWA 1G01A 1M6JA 3MBDA 5G2WA 2WVUA 3KZPA 1W3JA 5BRBA 1DJWA 1WYIA 2W27A 2IUZA 1Q6EA 4ORIA 4AWUA 2NV9A 3ABQA 4EOUA 5FD0A 4MJ2A 3PZTA 4AX6A 1IQ8A 1WZLA 2YXOA 5J04A 3SIZA 2BASA 3SFWA 3TWBA 4Y90A 1TMQA 3HB9A 4JN6A 3IGSA 3RM9A 4DO6A 1EC7A 1DL3A 2NXHA 4GY0A 3KVJA 2OX4A 2J6VA 4RV8A 2XVPA 5DMYA 3IIPA 4HPNA 1P6BA 2TPSA 1Q4WA 1G0CA 1POJA 5FEWA 3PAJA 1BYDA 3QMTA 4D6FA 4C6MA 1YDYA 3G1RA 4IMGA 1XBVA 3IJ9A 2VC6A 1OQFA 1A80A 4BI6A 2ZDSA 2QVHA 4WY0B 2Z26A 4MYXA 3W1LA 4C6OA 4MHBA 4LVFA 3UJEA 1YPXA 2DT0A 3TE9A 4RPQA 1LL7A 4ZODA 3UGVA 4QIUA 2O4MA 5CLTA 2D2HA 1EF2A 4GGBA 5HMSA 5HPCA 4W5ZA 1LG2A 1JR1A 3WQ4A 4JYEA 1R3TA 4NI8A 3EDFA 3N2CA 1FDZA 2F2KA 3TWAA 1O95A 3TAKA 5GNZA 4GABA 3TTEA 1UZDA 3L5AA 2GK1B 4YPJA 1GPWA 4CU6A 1C93A 5DRIA 2POZA 4KRZA 5FSDC 4GNKB 2O9OA 1Q7MA 3TR2A 3HQPA 1ZPTA 2XZ7A 1PCWA 1UZ4A 4HU3A 2ZZ7A 4R33A 4RDWA 5LA1A 2GFTA 3A4WA 1RD5A 1TE1A 3I68A 4ZO9A 5IOBA 3NVDA 4XAGA 1ENUA 4S38A 4AX7A 1TIMA 3NAVA 2DW6A 1BVNP 4ZL1A 2INZA 4LALA 3GAYA 3BOXA 3U48A 1G1YA 5SWUA 4ML4A 4B5UA 1XYLA 3DENA 4GUHA 4GJ1A 3WLPA 2Y62A 4ZB0A 1EP2A 5G4EA 1PO9A 1W1PA 4OWGA 1EC8A 4AG0A 3P93A 2TRSA 3VAVA 3KP0A 3ZSTA 4H19A 3SI9A 3MZ2A 1I8JA 1M3UA 4CNPA 2ZX7A 3M43A 6TAAA 1L2QA 1W1YA 3VNDA 3PZMA 3G1DA 4MWAE 1UKTA 2BTMA 4YTTA 1RP8A 2ZUTA 3W7QA 1GOXA 4GYKA 4HOWA 2Z6IA 4MY1A 1UUQA 3H7UA 4G6CA 3PG8A 4UQBA 3WL1A 1K6AA 4LS2A 1EJWC 1ISYA 2WC3A 3NZ1A 3QV7A 3CUZA 3JS3A 3C5QA 3KX6A 1LL4A 3KCLA 3TQ0A 3WF2A 2FZMA 4KF1A 1FWEC 3CNYA 1J01A 4R34A 2OGJA 2ABAA 4GACA 4V27A 1UR9A 5LNRA 3AHVA 1M1BA 3MMWA 3IIOA 3T7VA 5JVLA 3WUBA 3EPMA 1SJBA 4HQVA 3MWCA 3VGEA 4UMBA 2ZX9A 2CERA 3CU2A 1EA0A 3GXPA 1M7XA 3T0DA 2Z27A 2P3ZA 2V69A 2F7FA 2B7PA 3ZVHB 3RK8A 3GHTA 3THAA 3WLNA 1VYPX 2X8RA 3LNMA 3CPGA 3FXGA 2OJPA 3W86A 5J8LA 2EPMX 4AFYA 1G94A 3VIFA 3R0DA 2V3FA 1TG7A 3G8RA 1MUCA 2WHJA 3AS3A 3VKJA 3EEGA 3SY8A 1BTCA 4L1WA 2VEFA 4FXRA 1VEOA 5EY5A 3RX2A 5DELA 3GDMA 1M7OA 4ZENA 1DWJM 1IV8A 1QPQA 3AYRA 1B3XA 2X40A 3QOKA 1W3TA 4AQLA 1XFBA 2Z25A 1ZBCA 1S5TA 1BHGA 2Y24A 2VZVA 3LA4A 4OBSA 3BH4A 2ZUVA 4WHBA 2A3EA 4IOTA 4W84A 4NZ3A 3L4WA 3TKFA 1KGWA 4D6DA 2DSUA 2JALA 2VFEA 4J27A 3LTSA 3TN4A 3APYA 4IPJA 3WQOA 1FH7A 1QI4A 1UBPC 1O94A 3O3RA 1RA0A 3LD5A 2CLEA 3SCSA 3WUEA 4FLOA 4DJDC 1RZMA 1L8PA 2G5WA 2FZDA 2H8XA 2J7FA 4HMNA 2GK1A 3HU7A 3UWUA 3UVIA 1OM0A 4I9TA 6REQA 2ZYFA 3LN3A 3PJXA 2X41A 1V6VA 2QUUA 5BMXA 3CV6A 2TSYA 1EEPA 4C60A 4Q7NA 3VYLA 4IG2A 1ZBKA 2DIEA 3OOQA 5A2CA 3V5OA 3YPIA 1J79A 2WPGA 5FF4A 1UIPA 3L2IA 2XIOA 2PP3A 3BLEA 3MV11 4F2BA 5DLCA 4EIVA 1F8MA 4JTFA 3WQPA 3FW6A 3O9NA 3EA2A 3PJWA 3WQGA 2YCLA 3T8QA 1AD1A 4LFYA 2GLKA 4S3KA 3IVTA 3MUAA 5G1YA 1XGEA 1T8QA 4Q33A 3OZOA 3EWUA 1PKLA 3HQNA 3TJIA 3AIQA 4IXHA 1F74A 3VXGA 1TRIA 4O1BA 4E3VA 1D3HA 1QI3A 5AC5A 1RLCL 3UXIA 1OX5A 4NRRA 4TX8A 3HOJA 5EMLA 3PZUA 5D2XA 2VX6A 4IHCA 3KE0A 3M1ZA 1XQLA 5C2GA 1WDRA 2WXDM 2CWXA 5CQ1A 4OT7A 1DXEA 4IMFA 2XH2A 1EJVC 3CPUA 1F3EA 4FLSA 2Z1KA 3M0JA 4NXKA 1KRBC 2BWGA 3C2EA 4GYFA 3ZYZA 1V0NA 4L4LA 3PZVA 3MU7A 1JZ8A 1M7JA 2JGQA 5C54A 5HULA 2ZADA 1X6NA 4XZNX 3VD7A 3EOEA 4PEEA 4DM2A 1DIKA 1EGZA 3OBEA 2A7NA 2OT0A 1TPWA 1TJ1A 3H7VA 4Y8FA 2VELA 1ADOA 1RPKA 1W5QA 2WM1A 2X1SA 3H4XA 4QP0A 3K1DA 3EXTA 1Q2RA 3WLOA 3C0SA 2OCZA 3NZRA 3SQSA 4BA0A 3BSHA 3SCUA 5A69A 1S2CA 2IPWA 3B9AA 4CQDA 1V3JA 2AMXA 4JEQA 3F4DA 1FDJA 1J0KA 3TSBA 3STCA 2C0AA 4N6EA 2BGNE 1V3MA 2HK1A 3TJXA 1KM3A 5IM51 3C3NA 4XAZA 1AW1A 3N13A 2CLMA 1W3IA 5D03A 1YTEA 2IXVA 5K4ZA 3O8AA 4M6QA 2BVTA 2V82A 3W6YA 1QNQA 4G7EB 4GE8A 3QHNA 3M0LA 4G8TA 2ZKMX 2OEJA 3LTYA 1QI2A 4C1LA 2E1DA 2EGZA 2ZXQA 2PBOA 3LV6A 4I7WA 2CZDA 3ICJA 1WAWA 3W4RA 4R5EA 2Z2UA 4U5IA 1NFBA 1FCVA 4PMDA 1QW9A 1MQPA 3F2CA 1FTXA 3M5XA 3HPSA 4CGTA 3SSJA 1UR1A 2VGBA 1WDSA 3EX6A 1UC4A 1M03A 1O68A 5IBXC 1F76A 1B54A 1OSEA 3TYAA 4Z2GA 5CGQA 1TPEA 2XFWA 3W1TA 1EBGA 1JG9A 2REQA 4DLFA 5CJNA 5CGTA 3CMJA 2OQLA 2DT2A 4ORMA 1QNRA 4G7FA 5DO8A 1E6NA 2RHGA 3WFAA 4GCAA 2Y89A 1KBKA 4U3CA 2QJIA 3KP1A 3P8IA 1B9BA 4YHGA 4UTTA 3FS2A 3BGAA 4NNBA 4MNJA 5EMUA 3F4NA 4WSJA 1UH3A 1XLIA 4K68A 3RMEA 1SZEA 3PANA 3AISA 3WN6A 2IKJA 2FVMA 1Q7ZA 1JDCA 2P53A 3LHUA 3DC0A 2QXWA 2WZHA 5REQA 1W37A 3LPFA 4ADUA 1A5LC 4GX9A 4H8UA 4JFTA 3GNNA 1DPMA 3N4FA 1PEZA 2X0YA 1Y7VA 2WO5A 3MA8A 1H61A 1ADSA 3UWYA 2A6LA 4NILA 1CXIA 1J12A 1W9VA 1XYMA 3NXFA 2DFAA 4WXYA 2QS8A 1Q45A 3H7RA 4CD5A 4BF5A 2E68A 3H2NA 1R3SA 2TMDA 5KZDA 1E43A 1W0MA 4Q3MA 4GZJA 5I06A 1G4SA 2VC9A 2ICSA 1XDJA 3O6AA 1J5SA 2GOUA 5FF3A 4HMDA 1RY8A 1JZ6A 3CL7A 1RBOB 3UZ5A 3AXKA 3V7PA 4IT1A 2YXGA 1H7WA 4Q4OA 4QQUA 1XRSA 2WHKA 3GHRA 4B9ZA 3NXLA 1NOWA 1TV2A 3AALA 4UOZA 4MJZA 2RGMA 1YXDA 1IR2A 2VP8A 4RPPA 3WD3A 3W0KA 4KERA 2EG8A 1EC9A 2W91A 3FDGA 1JIBA 4CNSA 4FNRA 4R27A 3C3UA 3V5FA 2XIIA 3R0UA 1GYMA 3D47A 1ZZMA 1WXYA 3D5HA 2QCCA 5A8OA 2ZUWA 4L1XA 4YS1A 1LWIA 2J8FA 4UFHA 4Q4RA 1E6RA 1FKWA 3CQIA 4H7CA 4NZCA 3VIGA 1TV8A 3ZT7A 4DF0A 1UD6A 3ARVA 1VPQA 2Y7GA 3HG5A 5AHIA 1SJDA 2FZNA 3STPA 3VA8A 4EK7A 1XXXA 4JIIX 3A23A 5HMEA 1JDEA 2YBTA 3QFEA 1TX2A 2DZUA 4XD4A 2QLYA 3V5CA 2PWGA 3TIMA 1GG1A 2YDSA 5HWMA 2PRLA 3C0QA 1AL7A 5CSUA 5FL0A 3NIYA 2GJRA 3WMLA 2PDFA 3DCPA 2X0SA 2EEXA 4L9YA 5DBTA 3AZRA 2XGZA 1FWHC 4N6FA 3V35A 3OG2A 2GZXA 1CB7B 2WWDA 1B3OA 2DSWA 4U33A 2D2OA 3TV8A 3ELFA 1QASA 2ZCGA 2BZNA 3L66A 4R7JA 1A5AA 3NPXA 3DKJA 4INFA 1FCUA 3L12A 3VIPA 4MLRA 2BP1A 2RH9A 2R8WA 2PDGA 3WD4A 3AIUA 4LX4A 4XAYA 3TTOA 3W1UA 4KWOA 4Y6GA 1GJUA 2WSPA 1EDQA 2E40A 1W3LA 3RJXA 5BYWA 1XLEA 2VFDA 4Q4KA 1T41A 4FHAA 4HMEA 1J8VA 2BY1A 4XQ6A 3N29A 4J28A 3NZPA 4A3HA 2IPJA 4X61A 3WH7A 4U3AA 1XBZA 5ECUA 5A8PA 1UG6A 3VGBA 1MO0A 4OBTA 2QIWA 4YTUA 4LAMA 1OHLA 2CIPA 4JHOA 1PYMA 1KW1A 5FJTA 2EKGA 4JN7A 1KV8A 4QDMA 1Q5MA 4LAOA 4DI8A 4XIMA 1TELA 3EDDA 3W38A 1WBHA 2D22A 2VEGA 3AS1A 4PMNA 4PUKA 1H1YA 2CNCA 3FX4A 4KRUA 3UWQA 4I8DA 4H41A 1BQCA 5TD4A 3TQPA 3OYXA 2E28A 1XLDA 1MW1A 3AMGA 3VGGA 3W2MA 3GO2A 4TVUA 5C6MA 3E0FA 1YTKA 3DUGA 4MKNA 3N34A 3GB6A 3ABZA 4I5RA 3N12A 2DZPA 4C6FA 3KAOA 6XIMA 4CNTA 2JK2A 3W7JA 4EWJA 1VFHA 3WH9A 2GGGA 4MIMA 2OODA 5GJNA 1LZOA 1KRMA 1G4EA 5REQB 3OGSA 4REQA 4LYRA 1Q6GA 3NQ7A 3W2JA 3W7CA 3IK2A 3C86A 1MDLA 3IK4A 3DFPA 1TJ2A 4KEUA 1DWGM 1TJ0A 2PGFA 2R1LA 2A85A 2YLLA 1VEPA 5HJYA 1BG9A 3DX5A 4RE0A 4IMDA 3LZ5A 1MZHA 2VWTA 3O6CA 1PZ0A 3WMSA 3CAVA 3W1XA 3ERPA 3FNDA 4XBKA 1S5VA 2QULA 2VVNA 1AH4A 1VIWA 2ZZ2A 4F0KA 4L4OA 1TX0A 1UPPA 3P80A 5D05A 2ZRXA 4O1CA 1VPYA 2FPVA 2ZX5A 2PTDA 4XD6A 2OX1A 2Z1WA 4XG1A 1FHVA 4B3LA 3UQNA 4PL2A 4AD3A 3QW3A 4MNKA 3KS6A 1FOBA 2FKPA 3A3WA 2OOGA 3ZLFA 2VQTA 1E9LA 1TTPA 4QEEA 4ILSA 3GQYA 3KCJA 5AZ1A 4H3DA 3LPPA 1QHZA 3M41A 1OFDA 3H55A 1RQBA 3MCMA 2XFYA 2A3CA 2CEQA 2NXIA 3CLMA 3GHSA 4HIBA 2POTA 2ZA3A 3WLRA 4RV3A 1CTNA 1Z8AA 1FP8A 4FS9A 2PDMA 1LRNA 2E5BA 1DWHM 3W72A 4S3GA 3CO4A 5AYBA 4RW5A 2O4QA 4UTJA 3KHDA 1FHDA 2WW5A 1GTHA 3AYSA 4DUVA 4JDYA 3NPWA 1XG4A 2CETA 3LZ3A 5BW6A 1P43A 4AMCA 1ZCOA 4HNNA 1Q6FA 3SJNA 3G1FA 3T55A 5CGMA 4L6DA 3OW1A 2D0GA 2Y8VA 5CPQA 2X0HA 5DCDA 5EMJA 8A3HA 3STEA 2XH4A 1G7VA 2HSAA 4HCDA 5HQEA 2R1PA 5T9CE 4C6QA 5CAKA 5D30A 1HKIA 5EYWA 3W87A 2RJHA 3OP2A 4WDXA 1EF3A 3DZ1A 3A12A 2Q02A 4L65A 5EB8A 3UFYA 4PTDA 3B4UA 4C6PA 3WJSA 4H1ZA 2X1IA 3IPWA 3NQ8A 4ZOEA 3R7MA 3DFYA 2VC5A 1W1IE 4F9JA 2QGHA 1MQRA 3NQFA 4AW7A 2GUUA 4BEUA 4DIAA 3I3BA 4KKXA 2VFFA 5LHFA 1LQ0A 5DMLA 4YTSA 1FX6A 4HHLA 2Y8KA 1GW9A 1V03A 1ZBVA 1KC7A 1PIGA 2WMKA 1F73A 5IBXA 3QRHA 1TV3A 4CNNA 4Z17A 4WK9A 1RD6A 4AZ5A 4MZ1A 2YOCA 4QJ4B 3TN5A 1U5VA 1JDFA 1KQZA 4H8HA 3HMJG 5K9DA 3GXTA 4CEXC 4S1FA 4AD5A 3FSUA 1YE4A 5EMKA 2DZAA 3M7WA 4PSRA 4FI4A 1PB0A 3BMXA 4GZ7A 1QT1A 1XLFA 4GIRA 3AHYA 1HQTA 2UBPC 4L1GA 5AHLA 3HA1A 5H6HA 2WNNA 1PKYA 3HG3A 3UJ2A 1CT5A 3BV4A 4JYDA 2QPUA 1H7PA 3BE7A 3UD6A 1WCGA 3DG3A 4WJEA 1GOOA 1YHTA 5U7SA 3R13A 1E4NA 3TW9A 3ZJ6A 5GNYA 5LNUA 3IUHA 4WKAA 1GJWA 3B8DA 3KCOA 4G2DA 4DM1A 5F2GA 4A2RA 3NVTA 2Z24A 4Z1BA 1KM0A 1E4IA 2VFGA 4DF1A 1O5XA 3NQCA 3W29A 4WKHA 1FRBA 3OA5A 1P1MA 2DSZA 4DWSC 3VNJA 5FKYA 4HNLA 4DXVA 3VKBA 1DTUA 1F07A 3AYTA 2RUSA 4F0MA 3EX4A 3WMBA 3XINA 1A3HA 2DVTA 3QQ0A 1QMLA 1XSJA 2FB2A 4MF4A 4K8GA 4RE3A 2ZC1A 3G1VA 1OYBA 1FWFC 3BGGA 2ZUSA 4DJED 1XV8A 5E1QA 1WXJA 1EJUC 4K36A 3K2GA 1OZQA 4H4IA 3TTSA 1EHNA 4XK2A 3M6DA 4KCUA 4QS6A 1LRTA 3BJFA 1PWLA 6XIAA 1UR8A 1QR7A 9CGTA 3BG3A 2VFIA 2PWUA 3C52A 5LXEA 4ZMGA 5FCZA 4NUWA 3LRMA 5DRCA 3HGOA 1EQCA 1R2TA 4ADSA 1KXHA 3VZXA 3GXMA 1EOKA 4YHEA 1VENA 2PF0A 2IPGA 5M1TA 3W82A 3AXMA 3NYDA 4MOZA 1XF0A 3LV5A 3NGJA 1LBLA 2Y5EA 4QDWA 1E1EA 1KM6A 4HN4A 1S5NA 2VX4A 2I5GA 5HJXA 4BI5A 3W2KA 1UWRA 4MY8A 1AJZA 1G7UA 3Q45A 4FK9A 1CPUA 1SGJA 1OCQA 2WHLA 5LIKX 4YXGA 1WOBA 4GUIA 4JFWA 1D7KA 3EWBX 1W3HA 1CB2A 4IISA 3GM8A 3MYPA 1JFHA 2HJPA 3OGRA 4DYKA 3N14A 4PUWA 3QPEA 3QQWA 3LY0A 2X30A 4MUZA 3VINA 1OZMA 1TA3A 5C70A 5M03A 2WKGA 3ABOA 3PSWA 3FJ4A 4A8LA 4RDVA 4QLKA 4FF7A 1XW8A 3O6YX 1BF2A 4O10A 4IUGA 4YLWA 4U2ZA 1TQJA 4Q8VA 1UCWA 1X7IA 3EKZA 4LGXA 1VGAA 4OUEA 4IMEA 8CGTA 1DIEA 5AYIA 3RIKA 3V0TA 4BQ2A 3EX3A 4C6BA 5MHBA 4PEKA 1HX0A 4DHGA 1DWAM 4G1NA 5CZ0A 4RW3A 4JKKA 4LEQA 1D2KA 3GLCA 5D9MA 2P76A 5I79A 1VFSA 4LB3A 4H6RA 2FTYA 5CC6A 1GVQA 2CCRA 3MY9A 4PUMA 3GH4A 4LVGA 3JZEA 5CPSA 1V0KA 2ATSA 3PUDA 2J79A 4E8CA 2PU1A 3HJZA 3LTPA 3ZS4A 5A95A 4QJ1A 5TF0A 2C6QA 3NDOA 3I6TA 3TW6A 3FJNA 4UR7A 3UWZA 3QM3A 5D02A 4MM1A 4GH1A 2PTZA 3ITLA 3UYCA 3QY7A 4S3FA 3WNPA 3UXAA 4Z08A 3K8LA 1E9YB 2E09A 5FAJA 1DBTA 3VIHA 5TNVA 4IX2A 4DZHA 2OQHA 5I6SA 1Q65A 1BKHA 2ZX8A 5E9XA 5A2BA 4FZIA 4LY4A 1MI3A 3S2MA 3A5VA 1H1ZA 2YIHA 3WLIA 4WJXA 4NU7A 5I7GA 1FCQA 1U30A 1VJIA 4MG4A 1BLIA 2YFNA 1MNSA 2YCLB 1VBRA 3THUA 3DECA 3VNIA 3N2BA 4AIEA 4LT9A 2A1YA 1D7FA 4I9AA 2KAUC 4NRSA 1N8IA 1GGOA 3NQGA 3A3HA 5G4HC 4Y9MA 2PCEA 4L4PA 2H3DA 4V33A 4AVFA 4HNUA 1HW6A 3W75A 3C8FA 4QE5A 4H6EA 1XIDA 3NGFA 1LLWA 3H6OA 4EKJA 3J7HA 1E15A 3VM7A 2A6NA 1ZSXA 2A3LA 3AROA 5DT5A 2Y2WA 2VEIA 4GY7A 2V63A 1QBAA 4JIRA 1XPYA 2P10A 4BHYA 2FPYA 2WOQA 3NFUA 2CXEA 3QC0A 1J5TA 3PBVA 3ZSSA 4DN1A 3VKAA 1ZBWA 1ISXA 4Y96A 2FTWA 3DERA 5FACA 4PMOA 4BWLA 4IP4A 4FA3A 4RDZA 5I77A 3W7PA 1IGSA 1NDZA 1EJTC 3M44A 2GYIA 3MHGA 4GWEA 1V7YA 1JD7A 1TZZA 4GK8A 4O19A 1SMAA 5I3KA 4HJFA 4FSAA 3OZYA 4H9MA 1JFXA 1RHCA 2DZXA 3W37A 1YXCA 4P8VA 2QUTA 3N73A 1TQXA 4QCEA 4US5D 5CJ5A 2FMNA 5CKSA 2EPHA 1N8WA 5MKGA 2I9EA 4GA8A 4PUDA 3W01A 1KTNA 1C7SA 4UNIA 2UWFA 1H3GA 3QYSA 2CFFA 2CPUA 4JX4A 3SURA 4EPDC 1HL8A 1PTDA 5A6TC 5LIXX 3RAOA 3REQB 1V5XA 5KMYA 1ZUAX 1JGMA 5AC4A 3N9KA 1NFPA 3G0SA 1WKFA 4DBSA 3KTCA 1D8CA 4ZO6A 4ROPA 5F4WA 2OGYA 4RZ5A 4HYVA 1JYNA 1L6SA 3BQ5A 1FHUA 3RFAA 3VE9A 1YNQA 3MJYA 1LQ2A 4QG9A 1FWNA 1D9EA 3FYOA 4RR4A 3GXIA 3ATZA 1GONA 4O28A 1O6IA 2GVEA 2G3NA 2BDQA 2ZRVA 3GDTA 4JNYA 4DNHA 4W88A 5RUBA 3SCPA 5DY2A 3IIVA 3HGSA 1ODUA 2HQAA 3HGJA 1H7NA 1EFZA 5DXXA 4K1WA 4O0KA 4HK6A 2VURA 3RX4A 1ZJHA 2IW0A 3L68A 1K9FA 4WD0A 2W4XA 4GGHA 5HBFA 2WJZA 4ONVA 3SCRA 2QMKA 1ONRA 4UQDA 3K8MA 3NEHA 2NVAA 1H1NA 3CUGA 5BRPA 3S1WA 1F9CA 1TRDA 3E2SA 4X2PA 2J47A 3LG3A 1EDGA 3SCOA 1CGTA 1FQ0A 4PB4A 5IXEA 1E40A 1XRVA 1MRAA 5AB3A 3UU0A 2PU0A 3UCQA 2ZZ6A 3MHUA 2EHHA 1B0IA 2I7GA 3U8GA 3THCA 1WUFA 4K3ZA 2ZOXA 1GK8A 1V4YA 2W61A 2V5CA 2FZ9A 4Q22A 3TFXA 4X9SA 3GBEA 2WVTA 4PCTA 3T2QA 1IEVA 5D9PA 4JAWA 3UA3A 4HHHA 3U7BA 1SYTA 2Q8ZA 4LCRA 4NZ1A 4DWSB 1GVIA 2VEKA 3A22A 4WDWA 3N15A 4IIFA 5FF0A 1H5YA 4MNMA 1YPFA 2VJXA 5DBUA 5KTLA 3A4JA 3ZR5A 3UF9A 2O9PA 4JTIA 4OIFA 3TOYA 2XTKA 1VCVA 3KWSA 3RN6A 4EXBA 2A79A 1ZS2A 4O1DA 2HXUA 3LLDA 4ZTYA 1FWAC 4LVBA 4OV4A 2Y4SA 4DZ5A 1FBAA 4Q7BA 3MCNA 3CASA 3NPUA 1S39A 1RSCA 5E6YA 4AWSA 5J5RA 1W9XA 1G67A 4CCZA 1UC5A 5PTDA 4CU8A 1IXOA 2BGQA 3LCFA 1QPNA 5FJRA 2V81A 1A5KC 4Z2JA 3UJFA 4AY7A 2ZRZA 3ECQA 2ZZ5A 3WDHA 1GQNA 4U4MA 3T81A 1Q4NX 1JGIA 2VEMA 2IQ0A 3UVAA 3G8EA 2IKIA 4HP5A 4M80A 1PV8A 4P8UA 2ZQ0A 1XD0A 1GNXA 1F61A 4GZIA 2G4FA 4DB7A 2ISDA 2DIJA 5HATA 1HG3A 3M46A 2A3HA 3SGGA 4GI9A 1Y0EA 3DG6A 1IWPA 3GVGA 4HPJA 3ZXWA 4OZOA 1E3XA 4AC1X 7ODCA 1Z89A 1K4GA 2AAMA 2WC7A 1JCLA 1VZWA 1BXCA 1DQXA 4KQNA 2ATMA 3CMFA 1PZ2A 1DJQA 4B2DA 2O56A 3NPVA 2WZEA 3B40A 3DFHA 1XYBA 3U5UA 5DEZA 3IACA 1EXBA 1OC7A 4J1OA 2WVVB 1J18A 1U1HA 5AY7A 2F9RA 3RXZA 4UNLA 4DJDA 2GDUA 3BPWA 1KBBA 1PE1A 3SZ8A 5K9XA 3KOYA 3NO1A 3RCMA 5HMFA 3THDA 3SADA 1C90A 2CZ5A 2DV0A 3M0KA 2J8TA 1B4EA 1SO3A 3IANA 1QXLA 4Z1CA 2QDEA 4LANA 1FA2A 1NAL1 3NURA 1SW3A 4IIHA 1O5RA 1XYZA 2AGKA 1JF5A 2WNQA 4UFIA 3DFTA 3ITCA 4JR5A 4ATDA 3SO7A 2JQXA 1HJVA 2WAGA 5U4NA 3ANUA 4ZEPA 1RP9A 2OEMA 1E5JA 2XGIA 3EWWA 1CLVA 5D32A 1XISA 1U2YA 3MSGA 1I2OA 5AC7A 4JFSA 4PBEA 2VC7A 2X16A 3RUBL 3ARRA 3RX3A 1I2QA 1JCTA 1UUOA 4PR4A 3IJLA 2WLYA 4TUFA 2ALRA 4JQ3A 5CSRA 1E0UA 3HPFA 4IJBA 3WUGA 3AQUA 1J0ZA 3SN1A 3FSTA 4M0XA 3KDNA 1CENA 4CKQA 1E0XA 4QNEA 2VTFA 3GH7A 2CZEA 2G3JA 1I2NA 1GW1A 3LERA 1A0CA 3E02A 1TWZA 4ERIA 3B0YA 4Y9PA 4OOUA 1B57A 1O1HA 1IGWA 5HWNA 3O06A 4DRSA 4QAIA 1I75A 2PDLA 4E8DA 2OWXA 1DEDA 2YGYA 4F48A 3PBWA 3ZOAA 3VKCA 2OVLA 3KFTA 3LPGA 1P0NA 2Q3RA 3THQA 1L6WA 5EMMA 3QH2A 1GKPA 1TZ7A 2Y63A 3VIMA 4EWND 1NOFA 7REQA 3A4AA 4ZQCA 1E6ZA 3OVPA 3MANA 1A50A 3E2QA 1UQYA 2PDPA 4KH2A 4X2RA 1CCWB 3UBPC 1A5NC 2BV9A 4NZFA 4KWUA 5C71A 3OHMB 3A4XA 2C71A 4FO4A 3BC9A 1J96A 3QPZA 3KRBA 4UTLA 3QSTA 1LOQA 4TR9A 4JTJA 5BWFA 4IJRA 2WJFA 4WGXA 3B4YA 3RO6A 2EPKX 3UYIA 4EANA 5CJMA 1W54A 3W85A 3RCNA 3RCYA 3OQ8A 3S1VA 4ZSUA 2PP0A 3ZWSA 3TMLA 4PTWA 2CZFA 1YBQB 2NWSA 2DZSA 3NM3A 4D72A 3SCVA 3AAMA 1QPKA 3GZ3A 3KBWA 4DWSD 2ZUNA 4B3ZA 4HPGA 1CNVA 4PTXA 1IXNA 1CLKA 1AQFA 4H7VA 2ZICA 3N4AA 1DQUA 1MNZA 1EL3A 5JIWA 2QCFA 4P7QA 3EDEA 3RDKA 3MBFA 1XSIA 4P7NA 5KSWA 3U3HA 4NL1A 1WQ5A 3M0YA 3Q94A 1J0JA 2J75A 2EO7A 3LSBA 3OZMA 4GVGA 2E9LA 4LC8A 3RM4A 2X2GA 2ZXDA 3PBUA 4N4PA 1XWYA 2PD9A 3RU8X 4D8AA 1SMDA 2FGZA 2BB0A 3I7QA 3G6MA 4AUBA 5DX7A 3B9EA 4Y7EA 4AEOA 4WEVX 2ON3A 3WBAA 4XZBA 2PZ0A 1VB9A 5C9RA 5D09A 1BWVA 4B9YA 1E5NA 3WQFA 3BO9A 2C14A 4NYYA 5A6BD 1AD4A 1RH9A 1T99A 4GQQA 4WKFA 2JKEA 1EIXA 5FL1A 5J5DA 4KCWA 3FHQA 4DZIA 1DV7A 3RJYA 4W9TA 1JCMP 1W1ZA 4QGCA 4PMZA 1HO1A 3NO3A 2J7DA 4O4WA 2OKOA 2FGBA 4J40A 3ZR6A 3SY5A 2FB3A 2C15A 4CVUA 4IL2A 2CKSA 2D2GA 4IL0A 3EDJA 3UZJA 3ZMRA 1Y5VA 3GVRA 2FDSA 1R30A 4J3VA 4LUTA 3GW3A 4JIHA 1PBGA 1EJSC 3E38A 2JEPA 1A5OC 5D2WA 3LBMA 3NCOA 3WLQA 1WV2A 2WSQA 4V1XA 2X09A 4TOQA 2HNEA 1UWAA 2HNHA 2KX9A 3GTFA 3BTNA 4WOZA 3MWAA 1FWTA 1VRDA 1RK6A 3GR4A 2C19A 3D6NA 3FIGA 1YDOA 4LH8A 4Q8PA 3WJWA 4L4MA 4K8EA 3LRKA 3TQKA 1R3VA 4OECA 2PDWA 3W88A 2Q71A 3K4DA 4WF7A 1YE6A 4GVFA 4PUEA 5GJPA 2VXNA 3T2PA 4NX0A 1WAUA 2HXTA 2VGGA 3CH0A 3WFLA 3QLLA 2I9UA 3UXLA 1LROA 4UBPC 4O0QA 2OSXA 1K03A 3BLLA 1X8CA 1U83A 5HNUA 1UH2A 4HK7A 5DF0A 4X22A 1OABA 1DHKA 4YVPA 3WD2A 2PODA 1TREA 5CPTA 3UEQA 3V1PA 1BEUA 4AYSA 2WBKA 2X2YA 2BBFA 3ZQ9A 1H63A 4UUIA 4NNCA 3LRLA 1M53A 3RLGA 2QJNA 3RO8A 1EYEA 4DPQA 5HUPA 3BAWA 1KGXA 1VJSA 4HT3A 1V3IA 2WMHA 3CAWA 4RL3A 3GR7A 3CXOA 3F4WA 5BXTA 4AAJA 1CW2A 3CWNA 4FIRA 4NIRA 3Q4DA 3OIHA 4UTFA 3W3OA 5A8MA 1T6MA 2NX1A 1ZJIA 3QC3A 2J7EA 3E5BA 3WH8A 4UMAA 1XIBA 1LUCB 3W7NA 4EPEC 1QOPA 1Q7QA 1VJZA 5DFAA 3OHIA 5CBBA 5BCAA 2ISFA 2PDYA 5TBOA 1JUEA 1XIMA 3S1UA 1XDLA 2DEPA 4AD1A 3WO8A 1K8YA 3F2DA 1XRFA 4K7YA 1EIBA 2NQLA 1ZHAA 1OT1A 1ME9A 2A2IA 5JU6A 4L5ZA 4ZB2A 1K8ZA 1QW7A 3W2NA 4MWAA 4MMWA 1XYAA 2ZUMA 1JYVA 4YWIA 1DJNA 4TQTA 3WQEA 1CXHA 3INPA 3I6EA 5LYRA 5A6LA 1DJYA 4IGMA 1TPB1 1B9ZA 4JQ4A 4ZFCA 4XZHA 2AQOA 2NWRA 1VC4A 2QPSA 3WBYA 2WKJA 4B4HA 1TUXA 2QCLA 3QV9A 1RVKA 1V08A 1X1OA 2DQWA 2NUYA 3PTQA 1K7EA 2NVCA 3S5YA 3KOZA 1MW0A 1UKPA 1IEQA 2O7SA 1CZ1A 5H91A 1XS2A 2WLZA 3A6OA 3LENA 1KA9F 4IPIA 1S2VA 5AECA 1KB3A 3NL3A 4GQBA 4WY0F 1YRRA 4D6EA 4P7RA 1BVWA 1H0IA 1R9XA 3K4AA 4RNFA 1PZ1A 4TO8A 1PVNA 2NSOA 4IF2A 3W81A 5K9CA 3ZLGA 2E6AA 3GYEA 4MKSA 1CBGA 5H2ZA 1ZU8A 2AAAA 3VE7A 1KWGA 3SUWA 1IEWA 2A5HA 3AXHA 3EKGA 2P88A 2VM8A 4ACYA 1B4KA 2B31A 5ABHA 3W27A 3UNDA 1E56A 3ZO9A 1E1CA 2GGEA 4GIYA 2UY5A 3V0UA 2YZ5A 2PDKA 1CIUA 4IIEA 1OWQA 1AA1B 1GQJA 1W5OA 3ZJ7A 4EAYA 4NXSA 1GQLA 2P0OA 4ZSTA 5JMUA 4JNMA 2B7OA 4DJFD 2Y5SA 4AHOA 4DVOA 2GUBA 3AIBA 4K38A 1NDVA 3CZGA 4MB4A 2NSXA 1XKYA 1XKJA 4F0HA 4OTKA 1PWMA 3PUOA 4KEMA 3GRIA 4HHMA 1VAHA 3WF4A 2YDAA 3MSRA 1G6CA 4L64A 1Q6OA 3GUGA 3TJLA 4YCPA 2GGIA 3TFCA 2QV5A 3VKKA 3N3TA 4NZJA 4EXQA 3P5YA 4TX6A 1W5MA 2Y85A 3OBAA 3CB8A 4S3DA 4IUOA 2Y70A 3OTRA 2OTDA 4M51A 3DBNA 1M9HA 1FXPA 3MTWA 1UWQA 3CIVA 3MMUA 1VYRA 3HIJA 2V5LA 4RDYA 2IS7A 3RR1A 3PBMA 2DH2A 2OO6A 2R24A 1HN1A 1OFOA 3LXBA 3Q2DA 2I5QA 2Q09A 3CHEA 1OJXA 4QSHA 4RZ4A 3WK1A 5I3GA 5T8GA 4RUBA 4GXMA 4IM4A 4E4UA 3E0IA 4AVOA 5KITA 2Z28A 1AQHA 1A0EA 3K1GA 2I14A 4GO9A 4N4QA 1XG3A 1FWIC 1GUVA 4IFKB 4C6KA 1IWAA 4LAUA 5A8NA 3NA8A 2W63A 4OV9A 4OVXA 3GC2A 3WEOA 1VCGA 3UERA 4W7WA 2BX7A 3ZVIA 1ZNNA 4IQDA 1E0WA 1HIZA 2GVGA 2GL5A 5CPOA 1UD2A 5FIPA 3KEHA 1PHQA 3MDUA 4LNCA 4BWLC 4K2SA 1SSGA 1F5ZA 3WQ5A 4J2MA 4PRWA 1C8YA 3BK0A 2F61A 1OIMA 3VMOA 2VRKA 2PGRA 3H2OA 1V93A 1O60A 2GQAA 5BXSA 3AWNA 4WVXA 1QATA 3CB3A 3WK2A 5F2LA 4F66A 3GIPA 4RE4A 3B8IA 3OA3A 1XLHA 2DUZA 3SW6A 1EUNA 3DDMA 1H4PA 3H12A 1O4UA 4DUXA 2WWCA 4I6VA 3ZJKA 3GVVA 1QOXA 2WMJA 1ITXA 4GO8A 3CV2A 3KVKA 1OVDA 1JNDA 1TWIA 5BXRA 3TN6A 2ADAA 4LRSA 1AJ2A 3TNOA 4P7OA 4ACZB 2CLKA 3E12A 4W4QA 4XSLA 2G50A 1F05A 5HNNA 1REQA 3M5YA 2IKHA 3CHFA 3CK5A 4PRRA 2FHFA 1K77A 1XUZA 3N2OA 3SUVA 3GTNA 4IZGA 3EBVA 4MGGA 4B5TA 2OZ0A 3W1RA 3HO8A 2CZVA 4FR1A 3V18A 1DYSA 4C7GA 5HXMA 5AC6A 1E4MM 4ZB5A 3P82A 2QJJA 3W00A 4GG9A 1HKJA 2ZTJA 3VC6A 2BXVA 2D2JA 1MZRA 1CEOA 4LU0A 5M2FX 3UT0A 4HA0A 3CYJA 1W9BM 4IX0A 4IWWA 1W1VA 2D0HA 1AZ1A 1H7OA 1QK2A 1QI0A 3MO7A 2GJLA 3WG6A 5G1MA 2ISVA 3QTGA 1JPMA 5HMDA 4AIOA 2GJXB 2VX5A 4UQCA 3IRSA 2PRMA 3F7JA 2XN0A 1M41A 4EPKA 2UY2A 3WBXA 4PODA 3LHYA 3WENA 2R1NA 2V5BA 1X1ZA 3ARZA 4AZBA 1P0KA 2GSJA 1R85A 4NNAA 1XI3A 1EGMA 1Q13A 3QJAA 4ZGYA 4LYKA 4BQ3A 1NH6A 2A4AA 3EDKA 4MPQA 2E8ZA 2J77A 3EWZA 1W2VA 2QCDA 2EJAA 1ONWA 2FHCA 2QDDA 2P8CA 1UD8A 5H1WA 2GSHA 1KFCA 3S46A 3KDOA 4DYJA 2PZNA 4K37A 3UJSA 1KFWA 4Z0SA 4KS0A 3H54A 3TLLA 2DQXA 4J35A 5D2VA 3FFSA 2E9MA 3A13A 3VDCA 4DYEA 2DZWA 3U2EA 1HKKA 1HL9A 1YX1A 3PUGA 4JICA 3IVSA 2PDBA 3MP5A 4DNMA 3EAUA 3LGGA 4P5UA 2OB3A 2OPJA 4TV6A 1UD3A 3CC1A 4P8XA 3HMCA 1NQKA 3JRKA 3W25A 4JKLA 1V6UA 3U4AA 3W84A 1IXQA 1C91A 1QO2A 1FWSA 1OF6A 2DIKA 4L7ZA 4YYFA 1TV5A 1BYCA 3G1AA 1FP9A 5C5YA 4JTAA 4HHPA 4O8RA 4UZUA 3S6DA 1MFVA 1P0DA 3D3AA 3AI0A 2J7GA 3OLEA 4IFKA 4AZGA 1VBHA 2WSKA 3CZEA 1X98A 1XBXA 3WZ0E 4UWMA 3N2XA 1I9CB 3TAOA 1K8CA 1UKQA 4HZMA 1QI5A 1LOSA 4I5XA 5HOSA 3E1F1 2WV8A 1F6PA 3SY1A 4BQ4A 4UCGA 1IIGA 3CMGA 4IICA 3T42A 2QKFA 3A64A 2MUCA 2QAPA 1RV8A 1P6WA 4NF7A 2WKLA 4FX7A 1EO5A 5CSSA 1L6GA 4P7LA 3GDRA 5CXPA 4O14A 5FJIA 2OXNA 9RUBA 3TNBA 1IT7A 5HDRA 1JDAA 1A3WA 5E9AA 2REQB 2DPEA 3HTWA 1HNYA 1MUMA 2JEQA 4HPHA 5I09A 3R25A 3G18A 4FX8A 1VFOA 4GHRA 1GTEA 1PAMA 4O1AA 4YYCA 3W7IA 4QX4A 3ORWA 1O1ZA 2NT0A 4JTUA 4IQLA 4GY1A 2E0PA 4DBEA 3WD1A 1SFSA 4R9OA 3QMSA 3I10A 4BK9A 3DYMA 4K8HA 5DY3A 2ZDRA 5DCBA 4B15A 4JDBA 4AMAA 3WLKX 3TYUA 1I1XA 5G4WA 1SPQA 1UROA 1E1FA 4LCQA 4KBXA 1SZFA 3DG7A 4ZXOA 1WZMA 3N6QA 3M5ZA 1R86A 4C7DA 3VCCA 3PTMA 1C8XA 3IIZA 3QKZA 5IRPA 5HWJA 1VPXA 2TAAA 4DBWA 1GOMA 1H7RA 1JRBA 1BPLB 2R14A 4FMVA 4PSPA 1CYGA 3PTDA 4YN5A 5GQBA 3BLOA 3FYPA 5LXXA 3XISA 5HK4A 3T4CA 4NYUA 3F03K 1XPGA 3R6IA 5LSMA 5AVNA 1GOQA 4AEEA 3RYSA 3EOSA 2PUZA 3AJXA 5B7YA 1EGVA 1UR0A 1FDYA 4DJEC 1U5JA 3NDYA 1CGVA 3CIXA 4JX5A 1DJZA 1BXNA 1E9ZB 3KL5A 7ENLA 3WQDA 2VR4A 5I78A 4K7VA 1J11A 2P5NA 1AUSL 2W0UA 3U2ZA 2CITA 1PJ9A 4HSNA 4MZ8A 4US6A 4M6VA 4GIEA 3M47A 3QGAC 4UTWA 1PKMA 3ZR4A 1VKFA 4PFMA 3CJPA 3L2LA 4ES4A 3IAPA 3PPCA 3ID7A 1MVYA 3DHDA 1H0GA 3GU1A 1F3TA 5CZJA 5HAOA 1OINA 4ZA0A 5FJPA 3W1AA 5I23A 1ZP4A 3WLHA 3UWWA 1ZAHA 4JNZA 3W7HA 1KV5A 1W56A 2QCDB 3BG5A 5CPMA 3FJ6A 3TU9A 2Z00A 4Q4QA 3EYPA 1TWWA 3BDKA 5DMNA 2VD9A 2J7CA 2X1TA 3OU8A 1OX4A 2PWVA 3JVAA 2YCKX 5I02A 2PLKA 1XP3A 2VCAA 4XZIA 4A22A 2XIBA 4B5XA 1KKOA 1S2TA 5I00A 1SR9A 4PCSA 3WBEA 3WLLA 3I4EA 3T0BA 4AISA 4M1BA 2PC4A 3EGJA 5I2UA 1JL8A 3VGFA 4D6JA 2GWGA 3EMZA 3MSYA 1N8FA 4MLJA 3NG3A 1Q63A 5A6SA 3L4ZA 1ISVA 1SJAA 4S2BA 1TVNA 4YL2A 1Z32X 2RAGA 2E25A 3VDGA 3VOGA 2Z7GA 1E4LA 1VF8A 3W6LA 3C0LA 1EEXA 4FOUA 2J4GA 4HZ6A 4DPPA 1HKVA 2IXUA 3VC5A 2R91A 1R7OA 1DVJA 3LHWA 3MCOA 2NX3A 5JH2A 4J2PA 4YNGA 2QCMA 1KCXA 5CBIA 1HJQA 2ZUUA 3CQJA 1NARA 5KEZA 4RCXA 1LQAA 3WKZA 3NZGA 3PZ9A 1QTWA 2XZ9A 3AZTA 3GG1A 3TR9A 4LYPA 2HBVA 3WDRA 4LF2A 4FX6M 2BGSA 5EKYA 1NOUA 1IZKA 3LB0A 3FJLA 4O11A 3K46A 2G0WA 2Q6ZA 3PZNA 3SJ3A 1CI1A 2XGBA 2UY3A 2FH6A 1QBBA 2YYTA 4MAVA 3SBFA 6TIMA 1Z44A 3WDPP 4X0NA 3DKLA 3VM5A 3UJRA 1US2A 1HFBA 1M65A 1TR9A 1CXFA 3B04A 1YNPA 2P1FA 4C1NB 2PMQA 1IE7C 4S23A 3FKKA 3VFCA 2E67A 6ALDA 4Q8OA 3M07A 3TP4A 1A3XA 5FJOA 3PUEA 1KM5A 3KRZA 5AN7A 3TH6A 4C6EA 3UCCA 1YMYA 1EXPA 4HD5A 3URNA 4JEJA 1ODZA 1QUMA 1UKSA 5D9OA 1EPVA 2G3FA 5IDIA 2OMAA 1BRLA 4AF0A 1HZYA 1KFKA 1EOMA 5BNKA 2BHUA 2Z1BA 4H9UA 2FVLA 1S2WA 4C7FA 3QQ1A 1QPOA 3H4GA 3LHTA 5JXQA 1ME7A 5AKQA 8XIAA 1OG6A 1ICPA 1XIJA 3CHVA 2O55A 4BI7A 4A05A 4UTMA 4IPLA 3ES8A 4FNPA 1Z42A 4JTGA 3G6LA 4Z1DA 3W53A 3NSMA 3VCRA 3W7RA 1NDYA 5E5CA 1OFRA 3N11A 1UWSA 4XUGA 3GKFA 1G9HA 5HR7A 2F2HA 4D1JA 3VD4A 2OYKA 2OSWA 6ENLA 4DJEA 2VWSA 4LTSA 3WLMA 3TYCA 1W5NA 3T05A 4Y9NA 3T07A 2PLCA 2TODA 4DUWA 3H2FA 3NDZA 3VNMA 1TFVA 3RU6A 2G97A 1AW5A 1M68A 3AMDA 3TYEA 1JCJA 3M16A 3WLJA 2FPTA 4FB7A 4MB3A 1IZCA 2UV8G 3SUTA 1C8QA 2W79A 1QU4A 3GDLA 4JZ5A 1N2VA 3S0CA 3AHXA 1PHWA 4TU1A 3ITXA 3HZ3A 1BWKA 4C6JA 3DU0A 3L2MA 4BJHA 4Z2HA 2VGFA 4JQ2A 1KFEA 5A2AA 3B3DA 1I2RA 5DCEA 1ELSA 1HKWA 4HZ7A 1SJCA 1ZAIA 3WDIA 3R4IA 3OLIA 2Q8LA 3ARUA 4HA4A 3FGCB 1LP6A 5TAOA 3VGHA 3P7YA 1L0PA 5CH9A 4PUNA 3L4VA 2I5IA 1LRQA 1FWJC 2YW4A 5K4XA 4PCFA 1Z3NA 4W89A 3CHCA 2CYGA 3A47A 3WQVA 4WQ6A 4O54A 4HJWA 4DXKA 2XU2A 4CNOA 3PTKA 4H8NA 3R79A 2XINA 4KGJA 4EACA 4J3XA 4G7EA 4Z42C 3M5VA 4HB7A 1D3CA 3W70A 4HSHA 3HQOA 3MHFA 1F6KA 1T7LA 4GC3A 1LYXA 5FOOA 1OBAA 4XZ9A 2C13A 5I3HA 2XFRA 4LXFA 4B4FA 5L6UA 1SZNA 1WKEA 1WKDA 2YB4A 1TKKA 3PFRA 3O15A 3WELA 3WSUA 4WUIA 5AFDA 3M0HA 4B5WA 1F2JA 3H26A 5AYXA 2NXGA 3ALGA 3RLHA 4HNTA 2CHRA 4GI8A 4MDOA 5C9UA 4C1NA 2HPIA 3K30A 2H9AA 2XH0A 4W8AA 3I4KA 3L0NA 1B3ZA 4N0RA 4UTTC 1HP5A 4POCA 4MWAB 5H8UA 1HF6A 1XLJA 3E6EA 3R43A 1BSIA 4O16A 2ZZ4A 1EUAA 2BVYA 1PS9A 1NSJA 2B4GA 3P8JA 4KFNA 3GBDA 3PP7A 4O53A 4UNKA 1PPIA 3SR7A 2NQ9A 3LQGA 3W7DA 2YFOA 5AOUA 4EF8A 1Q66A 3GUWA 1IF2A 3W1NA 4GUGA 1YDNA 3EB4A 1TIWA 1JD9A 4Q6XA 4IG2B 4JGDA 2NQZA 2HS8A 1OX6A 2X42A 3H70A 2QF7A 2W92A 2YPIA 4PE8A 3PBYA 4XKMA 2PURA 3DI0A 1R6WA 1X8FA 4Z2KA 4DO7A 2FGLA 5GJMA 1EP3A 4E3TA 3KVMA 3EA1A 1DXIA 4AZHA 1UZHA 3NSNA 2P0IA 2GDQA 4MNLA 1M7PA 4LRTA 4EE9A 4GISA 3UZXA 3GNRA 1UQZA 3LPOA 3TN3A 1LLZA 1GWJA 2HWGA 1E1CB 2PLMA 4MFDA 2XVKA 2GOKA 5GPRA 1I45A 4WRHA 3CYVA 1JZ7A 1WA3A 3WEZA 3AXIA 3LNPA 3RR4A 1JI2A 2J8GA 4CLMA 1UZ1A 2XN1A 2QYGA 2CBIA 1LTDA 3FEMA 4AD0A 4OOZA 2WQPA 3DEQA 3LCXA 1B31A 3ZWTA 4B92A 2QCNA 1WBJA 3A3XA 2NQHA 1QOQA 1KM2A 4ZBCA 1NF0A 2GSEA 3OB8A 4O17A 3BW2A 4J7RA 1NEYA 3CQHA 5BOEA 1WKYA 4JQAA 3TC6A 1RA5A 2Q01A 4QLLA 2ZVRA 4RE2A 3STFA 4DQWA 1XYCA 3QSRA 3ARSA 3LHZA 3HFTA 3B03A 4ATLA 2QF8A 1V79A 1PDYA 1FWDC 5IFPA 4DEFA 1DIOA 3BW4A 1TTIA 4C5ZA 5BROA 9XIMA 1XCFA 1J2WA 3C2FA 3VILA 4LUIA 2VZOA 2C91A 3H4WA 2Z1SA 3UPMA 4AHQA 1ME8A 1KBIA 5JUVA 2BS9A 5EFFA 4D6CA 1XGZA 1RPXA 1SQ7A 1LWHA 1W9PA 1FCBA 1EX1A 2PCQA 3M6YA 2PC8A 4B16A 2ISSA 4FEZA 2WMIB 3ZLHA 4GVIA 1TPFA 4GLEA 3I6RA 2W67A 3MSDA 1E71M 1L2UA 4DXXA 3KM8A 2C0HA 4MFEA 3VI2A 4QLJA 1OFQA 4NAEA 5D38A 4XISA 4O18A 1SM9A 4KW2A 3N2TA 1M04A 3EB2A 4AZCA 3PWAA 4AIBA 3FCPA 4CD6A 3GTXA 5HJLA 2E1WA 1L6YA 4A35A 5JBEA 1WB0A 3BW3A 4UC5A 1QNVA 2XHYA 1Q8JA 2XG9A 4MWAD 2PGWA 4C65A 3QR0A 3GE7A 3VOJA 3TXZA 3CUFA 1KO0A 4NJGA 3O6DA 4UFJA 2V3EA 4A2SA 3E0LA 3L67A 3LCGA 1OYCA 5CZSA 1HUVA 1ALDA 2WK2A 3UGRA 2FHBA 3E3HA 3BLDA 1TYGA 3S2JA 3VOHA 4KRTA 3NYZA 2V3GA 2O7QA 1UR4A 3WEMA 4RNHA 3PNUA 3PM6A 4N9CA 4H00A 4MB5A 5CG0A 1CX9A 4FNSA 1J0YA 3IJ8A 1R3QA 4NJJA 1XCXA 2CLLA 3TUUA 2H90A 3BAKA 4D2JA 4OGZA 3NOEA 3UCDA 1ZP3A 3NL5A 3IJDA 3R8GA 1MXDA 2DUAA 1ZRQA 5AHFA 3S42A 2F8QA 1HT6A 3MUY1 1VHCA 1DWFM 5LNWA 1ZAJA 2YYUA 1FWBC 1J4EA 3S9IA 3OLDA 5AVHA 3GNXA 4HNCA 4M7TA 4CQBA 2QDHA 2NT1A 2F38A 2YXXA 3KOFA 4NI3A 5F4SA 1LLOA 4M7SA 2OLSA 1XH0A 3E9AA 1FKXA 4Y9OA 1GT8A 2TYSA 2PP1A 2PB1A 4LS0A 4HCLA 4ADTA 4LAKA 4GJJA 3GKAA 3FA5A 1BVZA 4QDPA 2Y7EA 4M1RA 4UB9A 4REQB 2AGTA 3DOPA 1W9UA 1PX3A 2DW7A 4HZ8A 4UTHA 4H83A 4US5A 1VRXA 4U2YA 3AS0A 2NZLA 5C7VA 4Q8QA 4KESA 2C3ZA 2C18A 1V8EA 3RMJA 1JDDA 3VIKA 3MUIA 1BD0A 3WQ8A 2GJXA 4L56A 3EKLA 3TZNA 1OFBA 3MVTA 3W73A 3U6WA 2JFEX 1J9YA 2YCIX 3FVMA 2PWDA 1FWWA 2V5KA 3CTTA 1VBJA 1XLGA 3ARPA 3SGZA 4AB4A 3KTSA 4TX9A 3S4TA 4ZO8A 3I3EA 2GQ8A 4RLIA 1V02E 1GKQA 5M3WA 1PZ3A 3L5LA 4DI9A 4Q8UA 3XIMA 4NQ1A 3KS5A 5LGXA 4Z1YA 1TPH1 4NKCA 2ACSA 3K13A 4E2BA 2CHNA 2YL9A 3GH5A 4BEQA 2OSYA 4QE1A 4ROQA 2RDTA 1JUKA 1FHLA 4MZYA 3L7RA 3G22A 4AZCB 5D2TA 1F7BA 1T8XA 3FK4A 3M0MA 1CGYA 2YLAA 6CGTA 4V2XA 3LGDA 1RALA 4JY9A 4PMRA 3WFZA 1K7FA 2FIQA 1BWLA 2ZTKA 1TB3A 3LCLA 2BHYA 4F0RA 3EX1A 4MWAC 1PX4A 1N82A 1RBAA 4PB5A 3PPHA 1IEXA 1VLIA 2X1RA 2FJUB 4YJ5A 3DFQA 3A9IA 1V6XA 3BAJA 3CUIA 2CLHA 5KZEA 1H11A 5LIUX 1L6FA 3DHUA 2CWNA 5AHEA 2HE5A 3TTYA 1G69A 4XKYB 3OIXA 4S3CA 2WZMA 1A5UA 3BMWA 3KOWA 5I3JA 2OFJA 1RQEA 1EBHA 1GVEA 3E49A 3IV8A 2HS6A 1D8WA 1XCWA 3CUHA 5LIWX 2IPFA 2QZRA 1A4MA 4GNJA 4ICMA 3UY8A 5AZ0A 1B5TA 1S2AA 2HK0A 1VR6A 3S1GA 3P84A 2PRHA 4PA8A 4JD4A 1FFQA 3WLSA 2FH8A 2J9YA 3P81A 4LW7A 4ZQOA 3GVWA 3PVFA 4CEUC 4LSBA 1KWKA 4QNWA 3VX0A 4HTYA 6REQB 1PSCA 4ZXLA 3TTQA 2WYSA 1TWSA 4PB3A 1LBFA 3C8NA 4LVAA 1KCZA 2HVNA 2PLJA 3FN9A 5AC8A 2YA0A 3G1SA 3IJ7A 2VYOA 1GOKA 4EPBC 4PMVA 1EWEA 1OCBA 3UP8A 3V36A 1KBJA 1KXQA 3V75A 4R9XA 3MI2A 1UASA 1W32A 5B80A 3E5PA 2W66A 2INEA 4CQAA 3AHTA 3N9SA 2KZHA 3W24A 4DY1A 3S2NA 2QNEA 3RPMA 2I57A 2IQDA 4A6GA 4AVNA 4MB1A 4I7UA 2G8ZA 2YCEA 4QJ3B 3GR8A 4ZOBA 5HR6A 2J74A 5FF7A 4BS0A 3B06A 1ML1A 2J9XA 3ZFHA 3DI1A 3WL0A 2Z1VA 3R8HA 1Z69A 1OF8A 2A3AA 3OBKA 4FLQA 4GFIA 3HM7A 2WNWA 4JXCA 5KETA 4C1KA 2G41A 3KZSA 1E0VA 3LK6A 3PWIA 4TIMA 2E9BA 4E0CA 3GXFA 3DHFA 3S5SA 4Q8TA 4BR1A 2QEZA 3GXDA 1TVLA 1WUEA 2XIQA 4E4FA 5G5IA 2GUYA 1A5BA 5I3IA 2C8NA 4GMEA 1ITQA 6A3HA 5T26A 1RQHA 4KEZA 2WMFA 1Z7AA 1TV7A 1SSDA 3QHOA 2L5HA 1AQMA 2WJEA 3L0GA 4U28A 5C7HA 1K7XA 1H62A 3WQWA 3VO0A 1O5KA 2PTXA 4HNVA 4KMQA 9XIAA 4F2UA 5L9FA 3HGRA 5HINA 4CN1A 5AHNA 2YA1A 3NEVA 2BNJA 2AL1A 1ICSA 3U5YA 2DDXA 1VFMA 2DT3A 4LWWA 4OUIA 4C6LA 1KM4A 5CG7A 2QT3A 1CGXA 5LKYA 1H2JA 1GVYA 1UYQA 1S38A 3HFYA 4WDUA 3BCFA 5LA2A 4PCNA 1KGUA 2YBVA 1R38A 4MJ4A 4K39A 5A6KA 4XTDA 1E6SM 4O15A 4XO6A 1KD0A 3UNTA 2DUXA 2XISA 4IMAA 1EWDA 3ITGA 1JXKA 3MO4A 2VCBA 3PAOA 3UPBA 3BARA 5HNRA 3AS2A 1YYAA 2WC4A 2PWEA 2ZWYA 3MKVA 2BHZA 4ZTXA 1KKRA 4NX5A 3T4WA 3WNNA 3QZEA 5EFDA 3NQMA 1VEMA 1US3A 4F79A 1KXVA 4JY8A 1RVGA 1E3ZA 2PE4A 1JEZA 3P3BA 4DO5A 3WDQA 1THFD 2NV1A 3QZ6A 1UWIA 1WP6A 4C6CA 1HTIA 2NLIA 3F1QA 1CXEA 5G2HA 1V51A 4IQEA 4W5UA 3W28A 1AK5A 4Q4SA 4M6PA 3PB2A 3EOUA 4QS5A 1AW2A 2VDHA 3UR8A 3UZYA 4QITA 2OOFA 1V02A 1R0MA 1XIGA 2FLIA 1YIXA 3AIRA 4B90A 3QKEA 1AQ0A 3IEBA 5DANA 3CUXA 3LCWA 1QPRA 2WVVA 2HMCA 3VGDA 3KBSA 1BGGA 4HA1A 3LCHA 2ZRYA 3R58A 5E09A 1SFTA 2CBUA 4FF5A 2IMRA 4U5KA 2PDXA 4HGXA 4FALA 4AHPA 1FXQA 4DJFC 1KR0A 2VVSA 4AH7A 3PB0A 4JFVA 2HE8A 4MDPA 1LJYA 2P3EA 1JVNA 4MSSA 1OCNA 1KRAC 1R9ZA 2WNZA 3C4UA 1RCOB 5TQLA 1XLAA 2ZXAA 1LM1A 2HVOA 3CTLA 1P1XA 4KCTA 4UR8A 1QVBA 2W6RA 1YXYA 1XBYA 4Z2LA 2VRQA 4HK5A 2FFCA 2VFHA 2O0TA 4RKAA 2VKZG 2RDXA 2B81A 4LUJA 4K6AA 3FYYA 3S9YA 3CZJA 5JBFA 3EMQA 2ACUA 2GPTA 1OIFA 4OKDA 2NV2A 2DJLA 3WJXA 1GOWA 4X0VA 1X39A 1ZENA 3NQ2A 4P61A 4N9DA 5ABFB 2OZ8A 3NTYA 4W86A 1UD4A 3L5MA 4GH3A 3SECA 2CLOA 1UD5A 3G5EA 4B5SA 1SZRA 2WCAA 3M4HA 3SRKA 3UWVA 1HGYA 5F2MA 3O0KA 1MXGA 4CVWA 3VTRA 4Y8EA 3B0XA 3RGTA 2ZRWA 4E5TA 4D6GA 1W17A 3C56A 2GQ3A 2VCCA 3WQ6A 4YVXA 2PGEA 4GI4A 2OLHA 2VZTA 1U5HA 3ONCA 2CXGA 2V2CA 5IHRA 4E2DA 4DAFA 3TCSA 1ZLPA 4TXEA 5D37A 1C8VA 4MAZA 4W8LA 1H5VA 4ERGA 1V77A 3EPOA 3TXVA 4BFAA 3JW7A 5LNVA 3IWPA 3S2CA 3JR2A 1MEHA 1X1NA 4Q6JA 4G5DA 3HURA 3W26A 4AU0A 5CC7A 3L4TA 4XWUA 1XDMA 1TCMA 2VGIA 3H22A 3CEUA 3GTHA 4GXWA 3BLIA 3UXKA 1Y5XA 4O1FA 3PFMA 3KLKA 1CGWA 2NUWA 1BYAA 2XDFA 3UA4A 1KLYA 4L80A 2VOTA 1A49A 4JTKA 1YBQA 4JQ1A 1WO2A 3JUGA 3MI6A 1I2PA 4GD0A 1SFJA 4C91A 3EWYA 2ACRA 5EL1A 1F8IA 3HPZA 5EBAA 3S9ZA 4DX3A 4RNIA 3Q58A 2ASHA 3DXIA 3AIEA 4PYSA 1DWIM 5AYYA 1TJPA 3OO2A 3LOTA 1NQ6A 5A3HA 2J7BA 4X9YA 4Z1AA 4IIDA 1AL8A 3APTA 3WNLA 5C9ZA 2PD5A 1US0A 4A3UA 3SN0A 2YA2A 1XR2A 3R10A 2Y0FA 3N4EA 2YB1A 4ENLA 4XZMX 3I65A 3BOLA 3P5ZA 5C9WA 3L0KA 4PL1A 4EAMA 2EF9A 1MMFA 3REQA 2C1IA 1R3WA 4CNUA 1UOZA 4NAFA 4FOKA 1F4HA 1GVFA 4ZE5A 2QJHA 1RK5A 1LF1A 2LLEA 4XVDA 2E6YA 2JIEA 4TV5A 4PN2A 1DQWA 3MMTA 3K8KA 4LVDA 1OGGA 3PJTA 4M56A 1A5CA 3OLGA 1KRCC 1EJ7L 1Q6RA 3CL8A 1XHGA 3EWDA 1LBMA 1R9YA 1V3LA 3NQAA 3P74A 1DXFA 3RRXA 5LIYX 3B0PA 1CXKA 4IXXA 4JIEA 1TPVA 4JIQA 3AMCA 3MQTA 3S8HA 1T96A 3NOYA 1UWUA 3BMVA 1QDSA 1ADDA 2Y61A 3MW7A 5T9BG 1VQTA 2OEKA 2PWHA 3EX2A 3K5XA 5XIAA 4M29A 1OD8A 1AFSA 3GXNA 3R94A 3OG3A 4GOAA 4XD3A 2XM2A 4UXDA 3W7LA 3AMLA 3WIJA 4HN8A 1MYRA 2BXZA 4JTTA 1PTAA 3ALFA 1POKA 1I4NA 4XD5A 3FA4A 4QTGA 1ISZA 1JULA 2J7HA 4M81A 1E51A 4XZWA 3L4XA 5F2IA 4I5UA 2CHOA 4JCMA 5I24A 2HBXA