1F07A

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
321
Chain Sequence
MKFGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDELSNGRATLGIGPGDKATFDALGIEWVKPVSTIRDAIAMMRTLLAGEKTESGAQLMGVKAVQEKIPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAAKIVVAFIAAGSPPPVFERHGLPADTGKKFGELLGKGDFGGAIGAVDDALMEAFSVVGTPDEFIPKIEALGEMGVTQYVAGSPIGPDKEKSIKLLGEVIASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 117
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1f07A00
3FGCB 2B81A 1TVLA 1NQKA 1YW1A 1BRLB 1RHCA 1LUCB 3B9OA 3SDOA 5LXEA 1XKJA 3FGCA 2I7GA 3B4YA 4J2PA 3B9NA 4US5D 1NFPA 1BRLA 4UWMA 1LUCA 1M41A 1EZWA 1BSLA 1FVPA 3RAOA 5DQPA 1Z69A 4US5A 3C8NA 5AECA 1F07A
chains in the Genus database with same CATH superfamily
3PBWA 3T40A 1BXBA 4U2ZA 1AD4A 3DC0A 4K6AA 3AUJA 4M1RA 1X6NA 5EKYA 5FD0A 3T08A 1VPXA 4JX6A 4DB7A 4DM1A 2VT0A 3W1MA 4XTDA 3TH6A 3KCOA 1VFFA 3UG5A 4AIBA 4OKDA 4NHVA 3NVDA 1UUOA 1EGZA 3PB2A 4KWUA 3WQDA 1EJSC 3CHCA 4GQBA 3FJ4A 3G8EA 5LA0A 1KM4A 5JU6A 2V0TA 3W2JA 2OEKA 1FUYA 3OJGA 9CGTA 2OPJA 1XPYA 1EHNA 4O57A 5D04C 1A47A 3CK5A 1UD6A 1PIFA 1FHUA 4Z2GA 1JZ7A 3F1QA 5AYXA 4U33A 3N13A 3CHDA 1TV8A 2REQA 1PS9A 3WD3A 4K7YA 4LEQA 4CNPA 1LUCA 5ENLA 2QPUA 2FB2A 2CHRA 5A2BA 1Q7MA 5DF0A 6ENLA 1CENA 3VCRA 2PDCA 2EPOA 4GYPC 4K7VA 3TTQA 1A5NC 2NUXA 1D3CA 1XIFA 4DUXA 3PZQA 4R9OA 1M7XA 3I3EA 2PSNA 3EDJA 5CPSA 4H8VA 1UOZA 2WJEA 3HV8A 3PUEA 2ISSA 1Q8AA 1GOXA 3TAOA 3H2MA 5HMDA 5L9FA 3BZGA 5DT5A 3ZLHA 2WOQA 3L4UA 1OGBA 4I9TA 1ZBWA 2ZRXA 2XYLA 2Y85A 4MFEA 2WXDM 5MHBA 4CQ9A 1VCGA 2ZRWA 3WBEA 4O13A 4O8RA 5XIMA 3NDZA 3M7SA 3WLPA 3FJ6A 1PX8A 3RPDA 4UTHA 2F84A 1FWEC 3S9ZA 2OELA 3YPIA 5AB3A 5C70A 3WDRA 1CGUA 2ZADA 3BW3A 3PF3A 1GONA 3ALFA 3TQVA 1O5QA 3H2CA 2QDEA 4TMCA 3SCTA 2TODA 1K02A 4C91A 1O1ZA 4R33A 2Z1KA 4EF9A 3FVDA 3OBAA 1XG4A 2J9ZA 1JXJA 4TVUA 2GVLA 3LXBA 5EBAA 1UMLA 1VS1A 1E71M 3TROA 2XIIA 1GG0A 1CX9A 1JYNA 2RFGA 4I5XA 3EZ4A 4AZ5A 3SN0A 3TA9A 1NP0A 4HPNA 4LEFA 1PXGA 4HTYA 1E4NA 4TVDA 3AISA 3CH9A 2YCKX 1VJSA 3QZEA 2VC7A 4LB4A 1L2QA 3LDVA 4LY8A 2NXHA 2JKPA 1O68A 1BPLB 5BU6A 3W7MA 3MI6A 1RPKA 3VNKA 3LGEA 1UW9A 2A79A 1E3ZA 1TVPA 3EX4A 3ZVIA 1W32A 4ACYA 5CCZA 1GVEA 3LNMA 4TV5A 3EWUA 1TV5A 3BLEA 4A4AA 4R9XA 2PDLA 2YKKA 3HMCA 1VCFA 4FZIA 3BSMA 4QLKA 3ABZA 2DSUA 2P53A 4W84A 1EBHA 5C55A 2R1MA 3P2VA 3S1UA 5EYWA 4KH2A 3QY7A 3LI0A 4IWWA 3TSBA 1EIXA 2V8ZA 4MTVA 1Z8AA 4YXGA 1K7FA 2PDYA 3E0FA 2WANA 2Y0FA 1AQMA 3UPMA 8TIMA 1GKRA 3PSWA 3MHUA 3PJUA 1TVNA 2VQTA 4TUFA 2OT0A 5JMUA 4PULA 3THQA 1GW1A 1ADSA 3N4AA 2J75A 1C8XA 4X22A 3CS2A 4HHHA 3W1LA 3TXZA 1F3TA 1TPEA 3G22A 3VA8A 1C3FA 2R1PA 3RK8A 1AW5A 4JXCA 4GYFA 3ZLFA 3ZT5A 4DZAA 2QF8A 1Q7ZA 3NQVA 3OTRA 3STCA 3HPXA 3CC1A 2PWUA 1HXJA 4F4RA 5F4WA 4OFCA 4EF8A 1EJRC 4WDWA 1C7TA 1NOWA 2YDRA 2X05A 3DCPA 4J2PA 1EP3A 4G1KA 1H3GA 4XZHA 5FCZA 3ARVA 4QS6A 3O0KA 1PPIA 4MVAA 1NWUA 1DHKA 5FEPA 1ZTVA 1YADA 1DWJM 1XDMA 4KEMA 3BW4A 3DI1A 1XS2A 1YDNA 2DZBA 1DJQA 3F5JA 4AZBA 3S3GA 4PFHA 5BU9A 2QUTA 4QGCA 2QHAA 2R1NA 4FNSA 4NSBA 1KLZA 1IXOA 2V3GA 1PKYA 4YJ5A 2OSYA 3TNBA 4WR3A 1JJKA 1KFCA 4BK9A 1SO5A 1MQQA 4KWVA 5D2XA 1F6YA 5A6TC 2FLIA 1TMQA 4LCSA 4CU8A 4N42A 4GI8A 3VKKA 1WB0A 4IFOA 1WNOA 3TV8A 3GLCA 2VDIA 3QVQA 5GJNA 5E1QA 4DX3A 4E2OA 4M80A 1H60A 2GGJA 3S5OA 4QHRA 4P7LA 4US6A 2DW7A 3IRDA 3MMWA 4RXGA 3VIKA 3FYPA 3D5HA 5A8NA 6TAAA 4KERA 1F05A 1DYSA 2GLKA 3P6LA 1ZGDA 5HA7A 2I16A 1LROA 4AWTA 3ITGA 3L4XA 1RA5A 1OBAA 2PS2A 4AC1X 2VEFA 4JTTA 1TJPA 3FGCA 1E6NA 1KFLA 3V3WA 4CCCA 3RRXA 1W1TA 4QFUA 2WBKA 2E0PA 3UESA 1K9FA 1LJYA 1H09A 4LC8A 3KL5A 3OGSA 4M7TA 3TC6A 3P14A 5LKYA 2PBGA 3L0NA 4XISA 2JEPA 3IJQA 2DZWA 1N55A 4YLWA 2PP0A 3NQMA 1XPGA 1FA2A 3PBGA 4GUJA 4E5TA 1LOSA 2TPSA 3CQ0A 3EWBX 2V67A 1CXFA 3CQHA 4FEZA 3UXLA 3EX6A 4DBUA 1S5MA 4ZTXA 4ZOAA 3CUJA 1Y8BA 3I3BA 3MKCA 1Q8JA 1TWDA 1YE4A 1E72M 4DQWA 3HPSA 2HWGA 4NI8A 2KZHA 4Y9MA 1KFWA 5LZLA 1RBLA 4LUJA 2CEQA 4AISA 2GDQA 3TNOA 3UYIA 2XVKA 4KIRA 1L2UA 1FWJC 1S1RA 3TN6A 1MRAA 3MWAA 2QMJA 2HBXA 4KRUA 3IARA 3TOPA 1C8VA 3L5MA 5T8GA 2ZZ3A 4DYJA 2V30A 2R9RA 2BXVA 1KKOA 2FYMA 3QV7A 1V6TA 4CGTA 1TTQA 4V28A 3VIMA 1B9BA 1N2VA 1LL4A 3VNDA 2BVTA 4LS2A 1U5HA 1Q4NX 4CD5A 1R86A 3OO2A 2V38A 5B7YA 1VBUA 5T9BG 2Y7EA 4PR4A 3F4WA 1MW2A 3L12A 1ZRQA 4NJKA 1HJQA 2ZQ0A 3IGXA 3NSMA 3CHEA 4MPQA 3LLXA 4ADUA 4PMDA 1JRCA 1W56A 3UCQA 1OWQA 1DXFA 1JGIA 5I3DA 1WDQA 2H8XA 1FKXA 1DV7A 1GHRA 1HX0A 2PDBA 4L56A 3VGGA 1LTDA 4IX0A 5M3WA 4AWSA 1S2TA 4AZCA 3THUA 5EMKA 1QPKA 2V5CA 3SRFA 4S1FA 1IWPA 3MBDA 3EWYA 1W5NA 2V5LA 3N6HA 1H1NA 1W1IE 4IUOA 1JUEA 1JPMA 1ZAIA 3TYDA 3UGVA 1JZ4A 7REQB 2H3BA 2CYGA 2DZUA 3CT7A 1ZP3A 4GCAA 3T1GA 5LGXA 3CU2A 1RY0A 1TYGA 4TX8A 2FTWA 2I1OA 4XG1A 2MANA 4OJYA 3N29A 2VZVA 3APYA 3EA1A 3KTSA 3KW3A 4XB3A 3BLDA 1T96A 5HPOA 3G1DA 4KT2A 1ISVA 3AI0A 1KM0A 2VDHA 5EA9A 5CPQA 4O1EA 4W5UA 3BSGA 1FFQA 3TP4A 3ZSSA 5CPMA 5A8OA 4WKAA 3KLKA 3QV8A 5EMUA 3VCCA 3K1DA 1QNOA 1TV3A 2J7BA 1BHGA 1XD0A 4WJEA 4ZODA 1LWHA 4I6KA 1QW9A 3FA3A 3R5EA 3ME3A 5HNUA 2A3EA 4D8LA 2NX9A 4GVHA 3OG2A 3RU8X 4LT9A 2E3ZA 3NSXA 1RCXB 2GOUA 1HJSA 5FL0A 3GC2A 3EPNA 4FOJA 5C9UA 2GWGA 2NT0A 2I14A 3GBEA 2OLHA 3QW3A 4AFYA 4HNNA 1Q6FA 3EB2A 1G4SA 1OG0A 2OJPA 4H3DA 5D9PA 1S5VA 1Q66A 3KRZA 4CEUC 3UCDA 1XFCA 2KX9A 2VEKA 1XC6A 3DKJA 2H9AB 3GU9A 1PL9A 2FHFA 4A3UA 3TW6A 3LMZA 5KETA 1PZ3A 1SJDA 1XGZA 4UCFA 1CT5A 3VOHA 4J27A 3M1ZA 1QWKA 3PZNA 3B0XA 1JPKA 2Z29A 3TQKA 3MKKA 1J0IA 3DDMA 1IXQA 1UC4A 4QNEA 2ZX9A 1JZ5A 1J0HA 3BOXA 2HVOA 2PDJA 5CPOA 1HF6A 4GRSA 1DXIA 4HA3A 2BGSA 2TYSA 1LLZA 1OCQA 1R7OA 1GQIA 3LV6A 3QBUA 4L1GA 3DFNA 2E6YA 4GI6A 2XIOA 1UQZA 3M9YA 4JTEA 1ZFJA 4F66A 1G94A 3F4VA 4UNKA 2WO5A 3SFWA 1EOKA 3NXLA 5I79A 1SZRA 3RPTA 3GD6A 3R25A 1EUAA 1B3VA 1E0VA 1XIGA 1T8XA 1WDWA 3QRHA 5E09A 2E6DA 1R3VA 3NPXA 4JL2A 3UT0A 4LANA 1VAHA 3MBFA 3AMLA 1SZFA 2EO7A 3WG6A 3TN3A 2V2HA 4YHGA 4Z2IA 2WVUA 4GI9A 1KWGA 4MOZA 5FJTA 4NILA 2GZXA 5D9OA 2POTA 3WY1A 4CNNA 5I23A 3GM8A 2OCZA 1TG7A 2XIBA 1GQKA 1AW1A 4PUEA 3FV9A 4HHPA 3ERPA 1V79A 4CD8A 4L4PA 3WD2A 3VCNA 4MKNA 2PGWA 1BYBA 3WLIA 4JYFA 1YTEA 5JH2A 1EF3A 1UA7A 3CT2A 1XSKA 3B8UA 2OKTA 1LM1A 1TX0A 3ABRA 3H54A 1NDVA 1PDZA 1RQEA 2CLHA 1G0CA 2MNRA 2XGIA 1NEYA 1W9DM 3M4HA 4H9UA 1PIGA 5T26A 1VLWA 4J4KA 1GVIA 3EXTA 4UNLA 1KGUA 5LHFA 2CW6A 2RJHA 2EG6A 1JCXA 4O12A 2Z7GA 4E3TA 1SQ7A 1J2BA 2W3ZA 3UA4A 2PWHA 2V6AA 1QOQA 5FF7A 1WAWA 2BG5A 4N9EA 5LA1A 1P0NA 2EJ1A 4AD5A 3U9IA 2CBJA 4UR9A 4J3ZA 2D2OA 3B40A 1F73A 1O4UA 1PYFA 4OT7A 3VM5A 3CHVA 2E5CA 4FIQA 1Z32X 1AW2A 4YVVA 2VL4A 1KTBA 1TIWA 2E68A 5CPLA 2QDGA 2BB0A 4BQ4A 1VYPX 4DM2A 1G7UA 3VOGA 3UG3A 2QVNA 3WF2A 1ELSA 3CPGA 4QXIA 1QUMA 1EJWC 1J79A 4XVDA 1OFEA 5DY2A 4M51A 4B92A 3W6YA 4X9YA 1EA9C 3OVQA 4PUJA 1ZBVA 2XH4A 2VFFA 3AS2A 1ODUA 4NZCA 4IFKB 3LLDA 5EPDA 1VIWA 1KXHA 3K2GA 3N6JA 3LM7A 2X41A 3RLHA 3KCLA 3WQCA 4BFAA 1GT8A 4MJ2A 1CWYA 4AHPA 3M0XA 4Q4RA 3IJDA 2O0TA 3DHFA 1D3GA 1HJXA 4NYYA 4A8IA 2ZWZA 4G1NA 2GVGA 2PAJA 3UJRA 1W5PA 2HTMA 2A7PA 2INZA 4HPXA 4F0SA 1GOOA 3R12A 2Y4SA 3IIPA 1A0DA 5FEZA 4QAWA 1AD1A 3IPWA 1GVOA 2QUNA 1V6WA 3RLGA 4TMBA 4ZTYA 4AC7C 4C90A 4H04A 2ZXDA 4O28A 1Q7QA 5HUPA 1J5SA 2J74A 1Y5XA 3NQCA 4S3GA 3N25A 3JZEA 5TF0A 4UZUA 5KMYA 2EPLX 1SGJA 4W86A 4MWAD 3HG2A 2CPUA 5D2YA 1DIKA 1PAMA 2CC0A 1RV8A 3UNDA 1FY6A 1GVRA 3E2QA 5BZAA 2ACSA 2BS9A 1VPYA 3EDDA 3V0SA 3H4GA 4JN7A 4PA8A 4MWAB 4RNIA 3W1UA 1HGYA 2R1KA 5A3HA 2INFA 3CMGA 4BHYA 1B3WA 2VZOA 1AQ0A 3GO2A 5M03A 3S2LA 3TFXA 1GKPA 1GPFA 1W37A 1YNYA 1UD8A 3O07A 3WNOA 3H26A 1CTNA 3QGKC 3B05A 2GJRA 1IF2A 1E1FA 2QZRA 3Q65A 4GKTA 1UPMB 4JNMA 3M0VA 4JQ2A 4O10A 4LS0A 2O9TA 3PR2A 4CD4A 1FWFC 4LVBA 3QQ1A 2NVCA 1YXCA 4JHOA 5D4YA 3UXKA 3FA5A 2WMGA 2VX7A 1RVGA 2Z00A 4GYKA 3NSNA 3WLLA 4ZO6A 3B8WA 1SW3A 4WKFA 3W7IA 4LOCA 4Z2HA 3GU1A 3ZVHB 3CAQA 3OZMA 3TJIA 5DEZA 3CZGA 4LGXA 4BF7A 4K8EA 5D33A 4UR8A 3T2PA 3OLEA 1PX4A 3H7UA 1TPC1 5A2AA 1DWGM 4CNUA 1Q6LA 1E15A 4C6FA 3G1AA 1CDGA 1Q6EA 3PWGA 1T7LA 3W3OA 2IKIA 3NQGA 5BRPA 3PG8A 4OTKA 1KM5A 5A6KA 4Y8FA 4C1NB 1MQRA 3F2BA 1MEIA 1UB3A 4Z42C 4WDUA 2YCIX 4PCFA 1GEQA 1XJBA 1GQNA 4GJ1A 1XH0A 1XLFA 2QJGA 4J3TA 3L4VA 3KXQA 2XUCA 4NQ1A 1BD0A 4PB3A 1SO6A 1GTEA 2ANUA 1LG2A 4YWSA 2JGYA 4DJDC 4K2SA 3B8VA 1KA9F 1XKYA 3B8TA 2GWNA 2DSVA 4W8LA 3NOEA 4AYGA 4RZ5A 4IQEA 5E6ZA 4WCJA 4EOUA 2PLKA 1JNEA 4V1YA 4TU1A 1RLDA 4RE0A 3NL2A 4QEHA 3W72A 4YL2A 3NZQA 1EJUC 1GOKA 2P50A 4ZVJA 2VVSA 3NCOA 4XD6A 1R7AA 3S1WA 1JPHA 3USZA 2ESCA 3O9NA 3TWAA 1SJAA 2FHCA 1IIHA 3IACA 2GQ9A 1V0KA 3APTA 3EDEA 3L21A 2X09A 3AWNA 3C2YA 2YBVA 2ZOXA 3FJLA 1QT1A 1G5AA 2Z6IA 3VDHA 3IVTA 4JTKA 1OFOA 3IUIA 4W7UA 4DF2A 4H9TA 2H8ZA 5G4WA 4X0VA 1CB2A 4XWUA 5AHIA 4E2DA 2VRJA 4KFPA 2E9MA 3GFXA 4OV9A 3HN3A 3U48A 5FJOA 1ISYA 3CB3A 3VE7A 3ZWSA 3ONBA 1XH1A 1H7OA 2WM1A 3FY1A 3W1TA 1B54A 3ZIZA 4DLMA 1IGSA 3FHQA 1LWJA 4I90A 3WQWA 4OQVA 4C6PA 3GVRA 3V0TA 5A6LA 5CGTA 1GPWA 1H11A 2PGFA 3INPA 5CQ1A 3ARSA 4B5NA 2E9BA 2Z1BA 4ZQCA 1XSJA 4IP5A 3G1VA 2NQ5A 4HVXA 3E3HA 1JZ2A 4PB4A 2GYIA 1Q6RA 1S1PA 1VGAA 3ZR6A 4S3FA 5CSUA 3M7WA 4N6FA 1OFPA 4BY3A 1JUKA 2YDSA 4E3VA 3TK7A 3W81A 3AHYA 2Y8VA 2OGJA 3W7EA 3BAYA 4WY0F 3VAVA 1AL8A 1DKWA 1PCWA 3SZ8A 3PZGA 1E6ZA 3QR3A 1UJQA 3BCDA 3CL8A 3P5YA 4C60A 3AROA 3HZ3A 3W70A 3PJTA 5HJYA 1MDRA 1UR8A 5EL1A 3CBWA 1RHCA 1FWGC 1UR2A 1ZPTA 5C7VA 5KTLA 3EEGA 4FA3A 4MJMA 3O16A 3IJ6A 1TJ0A 4FXRA 2J7CA 5BW6A 2I17A 1FTXA 3VXGA 3CUFA 4NL1A 4HQVA 3ZZ1A 3LPGA 3GXDA 2Z6JA 3ZOAA 3NQFA 1S2WA 3PK7A 1TZZA 5H91A 4BA0A 4IZGA 4NAEB 1BXNA 3URNA 1QTWA 3DYMA 4M3PA 3QGVA 1Q13A 2O92A 4KS0A 2C7FA 3NEVA 1REQA 2VVNA 2A0NA 1BVZA 4HN8A 2Q01A 3GTXA 2DSWA 3KBMA 3GWQA 3W22A 2X0YA 1TTJA 4CKQA 4PMZA 4HPJA 1G01A 3GAYA 1QOXA 3QC0A 1GORA 3A4JA 4LBSA 3HIJA 5K9CA 1CEOA 5D8ZA 4Q4SA 4RUBA 4RDZA 4IH3A 6PTDA 2BOFX 1E51A 1FVPA 5BXRA 2WC7A 3VTRA 1K8XA 1OC6A 3H7RA 2ZRUA 1TWIA 1EGVA 4JTLA 2J8GA 1B4EA 4YPJA 3BURA 5I3GA 1EYWA 1ONXA 1Z3NA 1KV5A 4POCA 3PG9A 5XINA 4PZVA 3TLLA 4S3KA 4DJFD 3S9IA 1GYLA 3NEHA 4K1WA 5A69A 4F0KA 5EFDA 2OG9A 3F7JA 3CV1A 5KZDA 2WZIA 5K4ZA 4HZMA 3QMTA 3OZPA 1J10A 4NI3A 3QQWA 3M0IA 4MZYA 4TOQA 2QCNA 3WO8A 1VEOA 2PDIA 4EIVA 1VF8A 3CV7A 2EBNA 3H22A 4JR5A 4C6BA 4JY8A 4A2SA 5H2ZA 3W7RA 4Q8NA 4W5ZA 1T40A 3VNIA 3VMNA 4XAFA 4I5UA 4XD5A 1E5NA 4AX7A 1AK5A 3M43A 3U7BA 3VUSA 4YMZA 1CGWA 4MY1A 2CZDA 3VNYA 1BF6A 1TPFA 3LI1A 5MF5A 3VMOA 3BXWA 1ICSA 3WDJA 5FJIA 1MVYA 4FX7A 2YL8A 4AZGA 4GO9A 4B5SA 1K3UA 2GJLA 3E5PA 3V75A 4AY1A 4D8AA 2BY1A 5J04A 4FOKA 1KCXA 2ZUNA 1OCBA 4LUTB 3PZUA 3A13A 1KW1A 2V68A 1O95A 3WBXA 3KTCA 4C6QA 5CPNA 4DBWA 1JYWA 4E6MA 1JPDX 1TA3A 1W9VA 4ZXLA 2VENA 3MO7A 3E0LA 2HV5A 4GY0A 4RK8A 5CSSA 3GC5A 3BV4A 3EPMA 1XINA 1XHGA 2Q8ZA 1VFTA 1XLLA 1EXBA 5CGQA 2ZTJA 5LXXA 1KWKA 3UWUA 1HGWA 1RAKA 2PD5A 4JTUA 2E28A 1DWFM 1PYMA 2JK2A 5KSWA 3KOFA 5CC7A 1FHLA 5C8BB 3BL3A 4ENLA 1GJPA 2J6XA 2RAGA 1P1MA 2ABAA 4HJWA 1BSLA 3NPUA 3EX2A 4XAPA 1J01A 2R24A 2WSYA 2HVNA 2QV4A 1W5MA 1FCBA 2Y63A 1Q45A 2QAFA 3T7VA 4GIAA 2RDXA 3IJ8A 3HPZA 3GHTA 3A9IA 3A64A 2QV5A 1OADA 1OJXA 5LNUA 1SSDA 4EPEC 1ZCCA 4F0RA 4AWEA 1P4CA 4TX9A 5A6MA 1NVMA 1FXQA 2DIEA 2POZA 3WNLA 3RPMA 4MJ4A 4LUYA 4GFIA 4D71A 4Q8VA 1KBIA 2FGBA 4IIFA 4N02A 4RKAA 1NSJA 4D6GA 1UWUA 4PL1A 1I4NA 2CIPA 3BWWA 3VGDA 3NO3A 2VGIA 1BYDA 1QXLA 1EKOA 3O63A 2HS8A 4XZ9A 2WNNA 3AXKA 3I4KA 3EX1A 1RZMA 2D1ZA 1BG9A 1HKVA 4NJHA 4H01A 2PD9A 3WN6A 2J88A 1GUVA 2OLSA 2HZGA 1OT2A 1WDDA 4JTJA 2I9EA 2E40A 2YB4A 1T6MA 3PPGA 2INEA 1ONRA 5HWNA 2VEIA 1QHZA 2VCCA 4KRTA 3T09A 4ACZB 1QPQA 3QMRA 4F9JA 4DRSA 3BK0A 3L4TA 3NIYA 2XGBA 4LAOA 5D2VA 1FXPA 3SY8A 5REQB 2O9PA 3T07A 1R0MA 2A7RA 1QI3A 5G4HC 1QHPA 3HPFA 3IUHA 3FXYA 7CGTA 3LENA 3WDQA 2NWSA 4QISA 4IQLA 3WK0A 4S3BA 2YR1A 3THDA 1GEHA 1OZMA 4H6RA 1MQPA 4ROPA 3C8FA 2XVGA 3GAKA 3KLLA 3UG8A 4DBEA 1HNYA 2XWEA 1OC5A 4C5ZA 1W5OA 3NPVA 3IIVA 5ABFB 4EK7A 1US2A 2YSWA 2F8QA 3W7KA 3VKJA 1KTNA 4L1WA 1LZOA 1VHNA 3GVVA 4CU6A 1XF0A 3S0CA 1M01A 4WKHA 3LM3A 2FTYA 3WEOA 4PEKA 3PBVA 3TTYA 4FR6A 1PCKA 1XYCA 1IZJA 3V5OA 3DXIA 3WH5A 2DT0A 3CUIA 4IGMA 4WLCA 2OQLA 3KDNA 1UR1A 3Q37A 4KIEA 1ONEA 3UZXA 2BSLA 3XISA 4ZFCA 3KX6A 2DORA 2IXVA 2VWTA 3HOJA 4FLQA 5ABHA 3OGRA 4OOUA 3GQYA 2HXTA 3PJWA 5H8PA 2OTDA 1UROA 4JL1A 3L2MA 3PS7A 1Q6DA 3SJ3A 3PTMA 1QASA 4IGHA 1I0BA 4GUHA 2RDTA 3N14A 3QF0A 1IEQA 4HSHA 4IQJA 3LCFA 2CLLA 5IFTA 1KGXA 5HBFA 2ATSA 1AA1B 3N6QA 1DBTA 2CKSA 1P43A 3JS3A 4FLRA 2YX0A 4N4QA 3GH5A 1F5ZA 1KQZA 4PTXA 2YW3A 2CLIA 3SGUA 3BJFA 3KUMA 3CM4A 1K9DA 4B5VA 4LYRA 2ASHA 3IIOA 3GTIA 4PTVA 3Q67A 3W1PA 1EHAA 2WJFA 1DE5A 1B3XA 3F4CA 5CJNA 5CZJA 4LALA 4GH1A 1VBRA 1O7AA 2C6QA 1OZQA 1CLKA 3CPUA 1G4TA 1FCUA 4H41A 3E1F1 1U5VA 2CXGA 3K30A 1T0OA 1NWTA 2E6AA 2HDJA 4IGNA 1PKLA 1TWSA 4DIAA 5DMMA 3GG8A 2NVDA 2GGIA 1XCFA 1QI4A 1VJZA 5HK4A 1V93A 3BARA 3IIZA 1XIIA 1ONWA 4ML4A 5D09A 4AMCA 3HG5A 4D6IA 1JGMA 3KE0A 2B31A 2WMHA 2UV8G 3IGHX 4Q8PA 3W7GA 4TTGA 3K4WA 1HT6A 3MUCA 5M17A 1X98A 3NAVA 5AC5A 4OIFA 5A6BD 4FXSA 1BTMA 2NQHA 3OVPA 4HNOA 2GQAA 3QLDA 1PDYA 5JBFA 4DELA 1KCZA 1JG9A 3I3DA 3TC3A 4Z2LA 4GJJA 1I2QA 4PUUA 5F2GA 1I6NA 4KF1A 2WVTA 1G4PA 3LU2A 4GI4A 4A2RA 4MWAA 1IWBA 3OG3A 1GKQA 4HCDA 4G6CA 1XLHA 4XZWA 3GHUA 1U1UA 4L6OA 3P93A 2OZTA 1W3IA 2Y6ZA 2GVJA 2VGGA 2GUYA 3FAWA 1CI1A 3NYDA 2VGBA 3TSMA 1K7EA 2G41A 3C8NA 3C0JA 3SCPA 4DXVA 3MP5A 4RDVA 5FEXA 4IJRA 1AH0A 4M1BA 3WQ6A 4B3ZA 1PTAA 3S1XA 7ODCA 1BFNA 3H2FA 3MI3A 3H12A 1FWCC 1ZBKA 3VX1A 4A22A 2YJQA 4ERIA 1R9ZA 1QU4A 2VMFA 3NYZA 1XW8A 2XFFA 5LNSA 2CLMA 4JHMA 4Q32A 1R5YA 4BI5A 3N1AA 3SRDA 1X1ZA 3TW9A 5LSMA 2YDAA 3DESA 4S2BA 1SZEA 3R0KA 3UXDA 1FOBA 3UW6A 2X1UA 1M1BA 3QTGA 2PODA 4NUWA 2WCGA 4CQ8A 1PTDA 4EVZA 4WF7A 3JVAA 4PUWA 1BVWA 4DZHA 2DFAA 2RJGA 3ZVHA 4K38A 3JZUA 1H62A 3IJ9A 3WFAA 5JBEA 2OMAA 1ICQA 3TW7A 2QS8A 4HYRA 1GQLA 3WUGA 1NDYA 4WY0B 1LL7A 5EMMA 2G97A 1IV8A 5DX7A 1RJRA 4MM1A 5G2IA 3CAVA 5HMFA 1QJWA 4DAFA 3MCMA 3MP3A 3UERA 1M04A 1BSIA 5EMYA 3WNNA 4TR9A 3VKDA 2Q09A 3GKFA 4C1NA 1MW0A 5PTDA 3DU0A 2J47A 4JN6A 2RH9A 3BG3A 1BYCA 1THFD 3W7DA 1GVSA 2DIJA 1SJCA 4LJ3A 4PL2A 2Y70A 4RW5A 4P5UA 3VOIA 4M29A 3SR7A 4BZYA 4PRWA 2PU0A 3SGGA 1GYMA 3OB8A 3W9ZA 4PH6A 4NXKA 4AF0A 2QCGA 1B31A 2FPTA 2PLMA 3LCXA 4C6CA 5CSYA 4MWAE 3BAIA 3LBOA 4R7OA 1I0DA 2GK1B 3P60A 1A3WA 2VFDA 3IUDA 3R58A 4Z08A 3CLMA 3LQGA 2D24A 2HNEA 2HS6A 3KOXA 4U3CA 3RX2A 2HK1A 2FFCA 3C2OA 4J5NA 5DBUA 1JD9A 1OYAA 1N8FA 3P8IA 1W3LA 4MAVA 1W9UA 4PCSA 1UWQA 4HMNA 4Y8EA 4GYJA 3DENA 1UBPC 3ARYA 4Q33A 1L6FA 2O7QA 4FIRA 2BHZA 1V4YA 3OBEA 4LS1A 3V4BA 1W1VA 1V5XA 2CKRA 3STGA 4EPBC 1MI3A 3SI9A 1F9CA 3JUGA 1PWLA 5F2LA 1YPIA 1WPCA 3HQPA 5JIWA 4H19A 1VBGA 1HKJA 1DJIA 2DU2A 3S9YA 1UKQA 4KPLA 1X7FA 3AO0A 3IK2A 4JFWA 3DFSA 3OP2A 1KCLA 2X1RA 1KXVA 2OZ3A 3AMGA 3C6CA 1SSGA 5FJJA 2TSYA 3IAQA 3W7NA 2YA1A 3ITOA 1GZGA 3UU0A 1K8CA 1QNQA 2VFEA 3TUUA 3A24A 4DWDA 1AJ2A 3PBMA 1RA0A 4WXYA 1WV2A 4AZHA 1Q85A 1OX6A 3MTWA 2YZRA 1VCVA 1PX3A 5F1VA 4IM4A 3N3MA 4M81A 3B9OA 4Z17A 3OPSA 1JDDA 4PRTA 3A9BA 1XDLA 1MNSA 5LIKX 2D2GA 3VDBA 2HROA 3UZWA 4REQB 2D2HA 1HUVA 4UFIA 2ODOA 5BXTA 4HHLA 1V6XA 3WYZA 3MHGA 4HZ6A 3QJAA 1BVNP 4GC3A 2A1YA 5CKSA 4AH7A 4PYSA 3TTOA 3CUZA 1OX4B 1I2NA 3FYYA 2QPXA 1NQ6A 2DT2A 3QLLA 3RO8A 3T44A 1GVQA 1FH9A 3S47A 3DBPA 1M03A 3GFZA 2YCLB 1OFBA 1QI2A 2DH2A 4AZIA 4JIHA 1OGSA 4AXKA 4NAEA 1EX1A 1GG1A 3SQLA 4OVXA 1CXIA 3VFCA 1RK6A 4N7QA 3AHZA 1UWRA 1QBAA 4I8DA 1M68A 2VGFA 3QMSA 3CB8A 3W37A 5CAHA 4WGXA 2GSJA 3UF9A 5D2TA 3PZ9A 4UTTA 3IV8A 4S3CA 2UY4A 1R3SA 3CZEA 5CBIA 3KL0A 1SFSA 4LY4A 1D7KA 3FSTA 3STEA 3LX9A 5C0QA 3G3DA 4RL3A 2VKZG 4Y96A 3RCNA 1CZ1A 4GGHA 3WNKA 2QJHA 3EOLA 3QXBA 4L6HA 3AIQA 1TFVA 4JTRA 5DCBA 3S5SA 4CUCA 2CWXA 3GU2A 3Q58A 3VD7A 1AMYA 1GJWA 4D6DA 4BQ5A 1O6IA 3QGAC 2WM0A 2CFFA 3G6MA 1WZKA 2Z24A 3WDIA 4ES4A 4DY1A 4H6QA 2XH7A 2I5GA 3FDGA 3PN8A 1M65A 4JDBA 3VMPA 3V18A 4ALDA 1B3OA 4BCEA 2BY2A 2P8CA 3FYOA 1HJUA 2HNHA 2G96A 3RN6A 2H90A 1U1HA 2E1DA 3GVGA 5D30A 1EH9A 1LG1A 2JF7A 4DJFA 1ZALA 3OLIA 3R1ZA 1WKEA 1XKJA 3HTWA 3O3RA 3VX0A 1F8MA 1S5WA 5RUBA 3G18A 4ZB5A 3R0UA 3AIBA 4DBSA 1D8WA 2CNCA 1XYLA 5D9MA 1R3RA 4R3UA 1KRMA 2WB5A 2PDUA 3OYXA 5G5IA 3JR2A 4MDOA 3SEPA 1CW2A 1PKNA 3L0KA 1X1OA 3VPLA 4QSFA 2NXIA 4WUIA 1QRQA 3LEPA 1GZJA 3V16A 4HP5A 1JIBA 1A53A 4ZENA 2J79A 4F9DA 2O4MA 4A8RA 5A8MA 1ZSXA 4XKYB 3PUDA 4LUTA 1BYAA 4GY7A 1OFDA 3TQ0A 3GYEA 4WHBA 2PGRA 1ADOA 1H1ZA 4P8VA 3UP8A 1JZ8A 5BCAA 1MYRA 1OT1A 1AUSL 2YLAA 1QDSA 2C14A 4LFYA 2CLOA 3WH9A 4AD0A 3WUFA 3WH8A 3GXNA 4O14A 4NNCA 1XRFA 2OO0A 5HUOA 4LVGA 4IQDA 5CJ5A 3ZJ6A 4N9CA 1L6WA 4AEEA 3GH4A 4MY9A 3VO0A 1QFEA 3KEHA 1H2JA 1TCDA 5I24A 4D6FA 2WK2A 1KM1A 4QR6A 4UFHA 3TN5A 1V77A 2AL2B 3QHNA 3SQMA 3C5QA 3M0KA 3ARQA 4NXSA 2P3EA 3ITCA 3V35A 3EB3A 3U7VA 4RXFA 4D8ZA 4OGZA 2J27A 2W5FA 3WQGA 3PZTA 5AKQA 1EC8A 3FKKA 1HQTA 2XFWA 4LH8A 5IBXC 4KCTA 4H9ZA 3C2FA 2X0SA 1E0WA 3FS2A 4LW7A 3SCOA 3K46A 2JQXA 3QHOA 4O1AA 3GRIA 3D3FA 4H8UA 1S2CA 3WK3A 2Z4GA 1WZLA 1IR2A 1ISZA 1VB9A 3UFYA 2PRHA 3NURA 1O1HA 2ZUVA 1JCMP 4YTRA 3E5BA 1P0KA 3DYPA 4JQ3A 3BANA 1J4EA 2PWGA 4C6JA 1E6SM 3SCSA 2NWRA 1VH7A 3KCJA 4URIA 4CEXC 2VWSA 3GBDA 4X9SA 5A8GA 3NL3A 1B1YA 2Q3RA 4JAWA 4GIRA 2A3HA 4XZBA 2CLKA 4KW2A 4L64A 5FA5A 3AIRA 3EOOA 3MI2A 4XZLX 4FS9A 4ORMA 1RP9A 3BQ6A 2WHLA 3VINA 2NQ9A 1QO2A 4RE4A 5DCEA 4ERGA 5BWFA 2AAMA 4UFLA 1XLJA 4DJEC 3WJWA 9XIAA 3F5LA 3PANA 2G95A 2DIKA 2HQAA 3WLJA 5IXEA 4HOXA 4ACZA 2VC6A 4R27A 1PZ1A 1EJ7L 2OQYA 1XICA 2VCAA 4IMEA 2W6RA 4DEFA 4JY9A 5REQA 1S46A 3KVLA 3GXIA 4UTJA 2ZWYA 4QDMA 4N2YA 1J0YA 3B06A 2CBVA 4TXEA 4I8YA 4D1JA 3O15A 1IHIA 2V69A 4IGSA 1Q63A 2W27A 2C16A 2WW5A 3LNPA 2HJPA 4MNMA 2UZ9A 3N34A 1QCWA 1XUUA 1DORA 4IMGA 3C4UA 4UMBA 1Z9AA 5ABFA 4R5EA 2Y5EA 2G5WA 5A95A 1CIUA 3AJ7A 3GDRA 1VRDA 3SUWA 4S3AA 4AD1A 2OZ8A 3OZYA 1GQJA 3WDHA 1YYAA 5LIUX 1ITQA 4LSBA 3P80A 4G2DA 3T0CA 1KR0A 1ITCA 2ZXQA 3TWBA 2CXEA 3P81A 2YL6A 5KZEA 1PSCA 5FSEC 4JTFA 1PVNA 4FB7A 4U5KA 5H1WA 2Q8XA 1GW9A 1RP8A 5C9WA 2F2HA 5HULA 3W27A 2E9LA 2GJXA 3AU6A 4GISA 2HCVA 4B5XA 4P2VA 4DLFA 3N2OA 1UR4A 4IMFA 1E40A 1TV4A 1TV2A 1KV8A 3ECQA 1Q4WA 2FKPA 3FN9A 4CCZA 1CPUA 1V03A 2CZVA 1XI3A 1OM0A 1L8NA 1BGAA 1VBJA 3VDGA 2A5HA 1V7YA 4B15A 1W2VA 1NOUA 3W84A 1DQUA 5D32A 4PMJA 4L6DA 4XAGA 1C92A 1H0GA 3HMJG 3SUVA 3AIWA 3N17A 4YWIA 4AU0A 3V5FA 4ZB0A 4GQGA 1J5TA 2QIIA 1HO4A 1WOBA 4TX6A 5AC4A 3VGBA 1QWGA 1SMDA 2JIWA 4IIBA 1PTGA 3XIMA 1WX0A 4GYPA 4PB5A 2Z1SA 3L5AA 2NT1A 4JPGA 2GUUA 2OR2A 2OZ0A 1BWKA 2PTZA 3BTNA 3M46A 3VD4A 1LLOA 1XBXA 3O1NA 3KVKA 4M6QA 4PMQA 2HMCA 4W9TA 3RMJA 5MKGA 2Z2AA 3U6WA 3SADA 2A6NA 5C54A 1CLXA 4LAMA 3LD5A 2ZUSA 4YTSA 3PHAA 2XZ9A 3GW0A 4PBFA 4OU1A 1POJA 4AIEA 3H6OA 4FLOA 1LDCA 2J7EA 3EKLA 4HYVA 3KBWA 1MUWA 4B2DD 4KESA 1R6WA 2BWGA 1ZU8A 1G69A 4P61A 4HJFA 2Z28A 5FF2A 3WF3A 3E2RA 9RUBA 4UCGA 2ON3A 3ZLGA 4O54A 2PTYA 1UR9A 4Y2WA 3RX3A 1EP2A 3HG4A 2D73A 3V36A 4X63A 3W2UA 5AOUA 1E9ZB 3GDTA 5CZSA 4LQ1A 4QRNA 1CECA 4H00A 3MUZ1 1UCWA 3ZWTA 3CWHA 2QQ6A 3VDCA 4XD4A 4K3ZA 2XPKA 4UTWC 5C7HA 3BLPX 2QT3A 5A6BA 1ME8A 3VNLA 4L9XA 2OWWA 4HNUA 2ACQA 1Z6KA 2ZE3A 4GNKB 3FEMA 3HF3A 1UH2A 2TRSA 3E49A 3KBNA 2PDKA 3W74A 2DPEA 3BCJA 1OEPA 2NQJA 3NJ3A 2VC5A 3BV7A 1XGDA 4BQ2A 1MUCA 1LL6A 1DJNA 4V15A 3NQ6A 2OYLA 3DYOA 3R94A 4F3HA 5J5DA 2CBIA 2IKGA 1F2JA 5TIMA 4NU7A 3T78A 1J96A 3O6YX 1G6CA 1LBFA 4O1CA 1LBLA 3NUKA 3GS6A 4D9PA 3CWOX 1ZCOA 2VCBA 2CHNA 4JFUA 4CN4A 3M44A 3AU2A 2DGAA 2ZZ7A 4O50A 4LPCA 2X1IA 5CBBA 2G50A 4PEEA 1JPIA 2ISFA 2PDNA 3NDYA 2Q6ZA 3FCPA 2XH0A 1AVAA 5DQPA 5H8MA 4ZR8A 1WKDA 4AB4A 1B57A 1XDJA 2ZA2A 1D3HA 4GQ0A 5I06A 3LB0A 2ZA1A 5AVNA 1GYNA 2EPNA 4DJDD 1ZP4A 1JULA 3S8HA 4M6PA 1QNVA 1UD2A 3WLQA 3OW1A 4P8WA 3REQB 4ZQPA 3AS3A 1KB3A 4YVXA 4WY0A 4MF4A 1P6WA 3DGRA 3IVSA 1KR1A 5CGMA 3E12A 4Z1CA 2QPSA 1J6OA 1TVLA 3BAWA 5DO8A 3G77A 3I68A 5LYRA 1FHDA 1YDVA 4B91A 4XAZA 3RNDA 4LC6A 2ALRA 4JEQA 2V63A 1VFUA 1XR2A 2P3ZA 1YNQA 4LCRA 1EDGA 5D37A 3LCWA 3AALA 4M0XA 4JIQA 1HKWA 1E43A 3DH7A 1SO3A 4C6EA 3LCGA 4Y9AA 4RV3A 2WZHA 1Z89A 4S3JA 2AL1A 4H1ZA 1KM6A 3HPAA 3OZOA 2DT3A 3SW6A 3W2KA 1JL8A 4CD6A 1V0NA 4HIBA 3DFOA 2JBMA 3AYVA 2GK1A 3RLVA 2VO5A 1C93A 1CXKA 3POCA 4H4IA 3MVIA 4E2VA 2BGQA 4IMAA 1DIDA 5HOSA 3NQ2A 3P0WA 5AFDA 4ADSA 3DBNA 4XO6A 3W4RA 3EAUA 3PZOA 5ECVA 3B97A 2J13A 3WBWA 3M47A 1FDYA 1FWBC 1TV7A 2X1SA 4OZOA 4W89A 3RRAA 4IF2A 1R8LA 1W2PA 4B9ZA 3SCUA 2ZRYA 3RLUA 5ECUA 4BI6A 5CEWA 1E70M 3AHXA 4TQTA 4F0HA 2PPGA 3QZAA 1R2SA 3KP1A 5CZ0A 1TWWA 2D0HA 4GXWA 3UWVA 1S3HA 4LV9A 5JH1A 3WQ4A 1E55A 1EEPA 4XBKA 3FKRA 4NZ3A 4QEEA 2QUVA 3CYJA 4H83A 1RQBA 2V3FA 4NZ4A 2GUBA 2P0IA 3A12A 1UD3A 4DPPA 2REQB 1KKRA 2W61A 1XLEA 2DZVA 2NZLA 5FJUA 3EWXA 1TPH1 3WF1A 4DI9A 2O56A 1FCQA 2V9DA 1TJ2A 1H0IA 3KBVA 4PMRA 4ZZ9A 3MHFA 1E4LA 3WELA 2HE5A 2W92A 5A2CA 4L9ZA 1TB3A 2J62A 3O6CA 1YQ2A 2L5HA 1NELA 3KZSA 1RJQA 4HGXA 3CQKA 4JX4A 1BWVA 1ZUAX 3RJYA 4L1XA 1FWHC 3NPWA 3U3HA 3UWYA 1UD5A 4PBEA 1PZ2A 1MO0A 3E96A 3THAA 2JIEA 1WQ5A 4MAZA 1A5OC 1V0LA 2X2GA 3NOYA 3BMWA 4P7QA 3CWNA 1HZYA 4REQA 2WHMA 4OWGA 3CQJA 1JQXA 3NXFA 3ABOA 2GJPA 4GBUA 2NV9A 4HU8A 3NQ8A 1X8CA 1YRRA 4LVFA 3ZYZA 3SIMA 4MNLA 1PO9A 1YMYA 2EAWA 3WMCA 1DQXA 3GNRA 1Y5VA 1IEWA 3GR4A 4C6IA 4GZJA 5JIPA 4ZFMA 3KDOA 2Y88A 3BMXA 1XM3A 2WJZA 1GK8A 2RGLA 4R53A 2ZRVA 3J7HA 3N4FA 3THCA 1T99A 2D0GA 3KVJA 5HQMA 3NWRA 2X30A 5E70A 1R85A 1V7AA 1IGWA 2QJJA 3GG0A 4EWJA 2Y5JA 4G56A 5AYBA 4MZ8A 2E5BA 4HZ8A 4LWWA 5FESA 4AWUA 4FXFA 1W8SA 3I7SA 5HJXA 1HP5A 3BG9A 3IANA 4NRRA 4K8HA 3PPHA 1EYEA 4B5TA 3LOTA 4RNHA 2QGYA 2NQZA 3MUIA 3WF4A 1W17A 2IQDA 3SUUA 4GXMA 5AVHA 3M0JA 2VP8A 1D7FA 3H2NA 1A5LC 4PMNA 4RPQA 2P76A 4V33A 3OA3A 2VYOA 3LYEA 2AQVA 2AMXA 1ZHAA 4HU0A 4KCVA 3DGBA 2RUSA 4YIWA 1VYSX 3APGA 3I7RA 3AXXA 1YDOA 3DX5A 1E0TA 3U0HA 5GQBA 5HMSA 3MCNA 2ZRZA 4AD2A 2ZVRA 3N11A 1R2TA 3UPWA 1XBZA 3KOYA 3TX9A 1UG6A 1R3YA 2E4TA 2PWEA 4BKNA 1T41A 3NZ1A 2NSXA 1W9BM 2QUMA 4MLRA 4KEZA 2ZX5A 3I6EA 2PRMA 3AYRA 4NRSA 3LHYA 1DEDA 3E0IA 4Q4KA 3QOKA 6REQA 2WJDA 3KRUA 1FWTA 4HA1A 1JDEA 1C9DA 1J0KA 7XIMA 1ZJBA 4CQAA 2BTMA 3VI2A 1F74A 4GMEA 1VLIA 1TZ9A 1HFBA 4LF2A 3RHGA 4GJIA 3KWSA 3COTA 4JIIX 1SFLA 2VD8A 3MO4A 2E8YA 2GDVA 5KINA 3I4EA 1KXTA 2OWXA 3VC5A 5FJRA 1E1CA 3GC4A 1I8JA 1D8CA 2ZCGA 4A6GA 3L9CA 6XIMA 3QPEA 3USBA 1Q6GA 1DJZA 3PSVA 4JCMA 4AEFA 3S4TA 3CNYA 4O11A 1YBQB 2D3LA 3FDKA 1JI2A 3CUXA 4CVUA 3LXCA 4WX2A 3IAPA 3H4WA 3SN1A 4DO6A 1O5RA 4HN4A 1DTUA 3AHVA 2WVSA 1EXPA 1ESWA 1YW1A 1NH6A 4ZQRA 4O0ZA 1UZHA 1MW1A 1ZJAA 2OXNA 3G8RA 1Q6CA 1LBMA 4I7WA 1UUQA 3NGFA 5GJPA 2YPIA 4YTQA 4LUSB 1V02A 4Y90A 2WSKA 4K36A 1KFBA 2XIQA 3ARTA 5HMEA 2PRLA 4JTQA 2VD9A 1MW3A 3WLNA 4F2BA 1TWZA 3RJXA 3SECA 4YTUA 5E93A 4DXXA 2AL2A 3DFPA 3S1VA 3TA6A 1A3XA 1I1WA 2BVDA 3WQ5A 1FWDC 2HE8A 4CCDA 3TAKA 3CZLA 3RX4A 5GVJA 2J25A 3GE7A 4ADTA 3WK2A 5DMNA 3WKZA 1VFHA 1UWIA 4GA8A 3PTQA 1WBJA 4Q8WA 4GX9A 1DHPA 1TQJA 3RM9A 1I75A 4FI4A 5E9XA 1K9EA 4OUIA 1E9IA 3BOFA 1F4AA 3HGOA 5GNZA 3H2EA 4JKKA 1EL3A 5GJMA 1J93A 4HD5A 5HR6A 4GZEA 1QK0A 4QG8A 2OLAA 1KM3A 1OFQA 4ZOCA 2NV2A 4JTGA 3MZ2A 2YXXA 5D02A 4A05A 1XYAA 4X61A 3STPA 3L4YA 1OVDA 3TFCA 2ZA3A 1TJRA 2EKCA 4O53A 4K37A 3UR8A 3LZ5A 3CIXA 4C6MA 2G3FA 4G9PA 3JU2A 4QE5A 3RYSA 4UTKA 4FSAA 3ABQA 4I5RA 4GE8A 3WMBA 4KFOA 5EB8A 2QDDA 3SCQA 1AL7A 1CGTA 2GVYA 3HGSA 3QR0A 3M0LA 2C1IA 2ZZ2A 4O1FA 3FVMA 1WCGA 2YA2A 4FNQA 2IS7A 3KM8A 3ITYA 1GZ1A 4MYAA 2VXNA 3KFTA 3IJLA 5GPRA 5BOFA 2BMBA 4EE9A 3CL6A 1H51A 1CB7B 1US3A 1UWTA 3QH2A 1E5JA 2Q3OA 2Y7GA 3OIHA 1EX5A 3TCSA 4DZ5A 2X42A 3EWZA 3PFMA 1V02E 4QCFA 5EY5A 4ICCX 2I9UA 5CAKA 1E6XM 2ZYFA 5HR7A 1VRXA 1KBBA 3DG3A 3RCMA 3HQNA 3NGJA 3FSUA 1VFOA 1LQ0A 2HSAA 2KAUC 1X39A 4XBJA 3R7MA 3WMSA 1WA3A 1LF1A 2F6UA 4ZOBA 3SJNA 3O2LA 4I9JA 3NQEA 3UWQA 4DAIA 2PCEA 3A4AA 1PE1A 4I6VA 4RDWA 3HURA 5HANA 1A5SA 3D3AA 1NQKA 3E2SA 3G0UA 3QHMA 4J3VA 2WMJA 4PSRA 2WHKA 4RE3A 2PP3A 1YNPA 4R34A 2XM2A 1FWNA 4ZE5A 4W88A 5C2GA 2C91A 4GQRA 4NIRA 4JKMA 4R7WA 1E3XA 3SIZA 1UKOA 4S23A 3PZMA 2W67A 4ECLA 4D72A 4LBUA 1F3WA 1ITXA 4QBXA 2JKEA 1TPVA 2EPMX 3VDAA 2GOKA 2OB3A 3ONCA 4XZNX 1W8GA 4NAFB 3GNOA 1OY0A 3W7OA 4FF7A 3SSJA 3WJZA 3G2GA 3F03K 3M5VA 3IK4A 2X1TA 3L66A 1V6UA 4P7OA 4EWND 1TPDA 2PDMA 5I3HA 1W1B1 5G1YA 2VFIA 2Y8KA 1IT0A 5AZ0A 1G9HA 4ZO7A 3VE9A 2A3LA 3UZJA 2VM8A 2XDFA 3K5XA 3OQEA 5E0KA 3TJXA 4TV6A 1XCXA 2B4GA 2B7OA 1EDTA 2ABBA 2DUAA 2WMIA 4P8XA 1BRLB 1RR2A 1V51A 3V5CA 2GGGA 4HK6A 1RJPA 1XL9A 5I3KA 3HA1A 1P0BA 3AXMA 3N73A 3A3XA 4WK9A 2VUNA 3ZFHA 3HGJA 3FHAA 1JZ3A 1FRBA 2VRKA 1NU5A 3MUXA 4XSMA 5CLTA 3W7HA 1WDSA 1UWSA 4I7UA 4HMDA 4JTDA 3CXOA 5K3VA 3R8HA 1EQCA 3VIOA 2FZDA 3WSUA 4J3WA 5G4EA 4D6EA 5AHEA 5LHEA 3MANA 3PPFA 4BWLC 4PTNA 4HHMA 2V5DA 2DH3A 4ICMA 2E6FA 2BP1A 4U31A 3EDKA 1P6CA 5AN7A 4DXKA 3VGEA 1HO1A 3GDBA 3GTFA 3MYOA 5FOOA 2DUZA 2J7GA 2ZKMX 4H9MA 4RR4A 1H7WA 1WE5A 4A3QA 3B0VC 1FBAA 2WPBA 4O8AA 3CL7A 4QIUA 4MB5A 3W28A 4DUVA 5DXXA 2YCJA 5CC5A 1OHLA 3PAJA 3WUBA 4B2DA 2R14A 4FPSA 3H53A 5KITA 3QM3A 3W7LA 3WLRA 4E4UA 3CPRA 3N2TA 5A6JA 2J77A 5BROA 1NOFA 3ATYA 1MFVA 5CXPA 4AD3A 1JXKA 3AFBA 4PTMA 3K13A 2BFGA 3W1AA 2Y61A 3HM7A 1QW8A 4J40A 2BXZA 4RZ6A 3VIHA 4ZGYA 2YDQA 1EJTC 1SYTA 3LERA 2NUYA 3URQA 5L6UA 2IQ0A 3AICA 3GG1A 3FW6A 4MYXA 3UWZA 1UZ1A 1CXHA 5HQLA 3C0QA 4US5D 1H1YA 4G5DA 2VEMA 4ATLA 4A29A 1I2RA 1XXXA 1OQFA 2FZMA 4RNJA 1V3IA 1WDRA 2C1HA 4DO4A 1AZ2A 2ZBTA 2WC3A 3OEXA 3UGRA 4IUGA 2GQ8A 1L9WA 2WZMA 2WVVB 1NTHA 3OQ8A 3C3NA 3MYPA 5E9AA 3ZS4A 4Q3MA 3A3HA 4HK7A 3U5UA 1XLCA 5GNYA 2HEJA 4RCXA 4MADA 1MMFA 1AZ1A 4TIMA 3V1PA 4C65A 5CBJA 1KM2A 3MB9A 5AHNA 2XIJA 2NQLA 3H2OA 2PURA 2LLEA 4W93A 4EX4A 2VUYA 5CC6A 4F40A 1XD1A 2ISVA 2G37A 4A8LA 2BVYA 2J7DA 1ME7A 3BW2A 4ZO8A 4NYUA 3DFTA 1U22A 2ALDA 3REQA 2XN0A 4UTIA 2P10A 2PDQA 2J4GA 1EC7A 3E74A 3WQ8A 1TRIA 3A4WA 4JEJA 3W85A 4DJDA 3B0PA 2VZUA 1A5KC 1UP2A 5AECA 1TJ1A 4XIMA 4BR1A 2DQWA 4CN1A 4PMUA 3DHUA 3VM7A 1XH2A 4KWWA 1H7PA 3P82A 5TBOA 3LTPA 3UA3A 4EPKA 1YE6A 4G7EB 1ZENA 2FZ9A 3C2RA 3GG7A 5K4XA 4B5UA 3BMVA 2I5QA 1XRVA 2B7PA 3M41A 3NQ7A 1LYXA 1J9YA 2DZXA 4LYPA 3NL5A 2E25A 1UKPA 5TQLA 4QITA 3EXRA 3C3UA 2GL5A 3H21A 1KTCA 1I2OA 3IEBA 1WXJA 5TD4A 2ZX8A 4GXPA 3W83A 1VZWA 4ZQNA 3EWWA 1UZDA 5I6SA 3OA5A 4PGLA 1GNXA 1XUZA 4AX6A 1E56A 2ACRA 2R1LA 1O12A 2ZFAA 4LNYA 5B7ZA 2YBUA 1H63A 1KC7A 1W3NA 2XSBA 2G0WA 4NVTA 1YHTA 2NXGA 1EFZA 3VUPA 4DWSC 1DPMA 5SWUA 2WMKA 2Z2UA 4Q8QA 1LP6A 3W25A 1DE6A 1B90A 4GABA 4IPIA 2CZ5A 3W07A 2C0AA 3SGZA 3WNPA 3W1QA 3R13A 3WX7A 4NT0A 1W1A1 3IV3A 2EEXA 1A50A 1KD0A 3VD3A 4JIPA 3W00A 4D6JA 3EXSA 3BOLA 3ARRA 3DAQA 1F07A 4FMVA 1YTKA 1OABA 3ARWA 4GGBA 3WFLA 3GB6A 1RBOB 4FNPA 4PODA 3ZQ9A 3SCNA 5DMYA 1RCQA 2O9RA 4NZ5A 3W75A 4DHGA 2I7GA 2WSRA 2X7VA 3MQTA 4AXNA 5A1AA 3B3DA 1W31A 4GFSA 1Z42A 4CN6A 3G5EA 3LPFA 1OB0A 5E5CA 1DL3A 1RPXA 1YIXA 4CNOA 2DSZA 1QNRA 1V8EA 4LYQA 4LTSA 3N9KA 2WMFA 3Q45A 4EPDC 1S5NA 2CHOA 3VKBA 1OX5A 1POKA 5F4SA 1GTHA 1XBYA 3D6NA 4HOWA 4XSLA 1V0MA 3U2OA 3HJEA 4JTIA 3S5NA 4QJ4B 2GQ3A 1OINA 3QYQA 3VVGA 1SPQA 3MW7A 4PUMA 2VI0A 4BI7A 2IUZA 2X8RA 1JDCA 4HA0A 3L5LA 4MLJA 3NTYA 3CZKA 2GSHA 2EXOA 3B9DA 5F7UA 2RGMA 2J24A 4DYKA 1OK6A 3AMKA 1WKYA 1VPQA 5HNRA 1O60A 3WIJA 3ITXA 4Z2JA 3LG3A 4JDYA 3CZJA 4IIDA 2VFHA 3RIKA 2Z26A 3LBMA 1JNDA 1XYBA 4PCTA 5FSDC 2YYTA 3A3WA 5JQ9A 3BLOA 3WLMA 1HP4A 3WLKX 2WNQA 2ZX7A 4LAZA 2WCAA 1AG1O 2FZNA 2IPGA 5G2HA 2IPJA 4Z0JA 1FWWA 5AHFA 5HJLA 3OYZA 5I00A 4J2MA 3A5FA 1F7BA 3I65A 1NF0A 3M07A 3SM0A 4MUZA 4W8AA 4EAMA 1NWSA 1R3TA 3GR8A 2ZVIA 2PWDA 6XIAA 1W1PA 3N19B 3WDPP 1XGEA 4L80A 1ISXA 2NUWA 5G2WA 2EF9A 3AS0A 1K8ZA 1M7OA 4O18A 1PKMA 1G7VA 2VHLA 2QCHA 3GX9A 2DY3A 2QXWA 2X40A 1V3HA 3B04A 3OLDA 4KWSA 4DF1A 8CGTA 2G8ZA 4EACA 2OYKA 4NX0A 1E4MM 1TR1A 2A3AA 3R2GA 4DBDA 3KOWA 2WKLA 3QY6A 1Q6QA 1GGOA 3NZRA 3SN4A 4Q6XA 2QCFA 4UMAA 3WD0A 2PDFA 3ATZA 4UBPC 1F6KA 1UYQA 2VEGA 4N0RA 4NF7A 4UWMA 1XLAA 1A5MC 2EPHA 3FA4A 3ITTA 5GNXA 1C7SA 4IICA 5J8LA 3G1HA 3UY7A 2C13A 3WNMA 4FNRA 1A5BA 2FDSA 1KGWA 1TMHA 3VABA 4W85A 1CGVA 3RM4A 1ZBCA 3B8DA 3MA8A 3BLLA 5BWAA 4ZSTA 4B5WA 2DT1A 3L0GA 1NF7A 4FO4A 4AAJA 4FK9A 5I5RA 1P48A 4Z1BA 4HSNA 1HL9A 1IEVA 2B7QA 4JNZA 4PUDA 1I45A 4IXHA 1A80A 4XBSA 1W3KA 1K7XA 1JCNA 8XIMA 4NJJA 2E7FA 1NFBA 4XX6A 3GVQA 4WDTA 4KFNA 4DF0A 1UD4A 1FWAC 2D2JA 3DN5A 2YBTA 2I56A 2BHUA 1YBQA 4Q4PA 2WLYA 4NASA 1ECEA 4JFVA 3MJYA 3EB4A 2QCLA 1E1EA 2ZC1A 3TYEA 2E09A 4UZSA 3UQNA 1MXSA 1YDYA 4O1BA 3PTDA 3ZM8A 1B30A 2WHJA 3MMDA 1P7TB 3UJEA 4E8GA 3OLGA 3UR2A 1FDJA 2ZZ4A 2ONEA 1ZAJA 1TTIA 4JTAA 3S2NA 4U10A 4YVPA 3FFSA 3QC3A 4MNKA 4B16A 5BXPA 2DW6A 4IP4A 4MB4A 5CZKA 2CLPA 3RGTA 3GSMA 3BGGA 2EHHA 2EGZA 1AMKA 3EWDA 4DI8A 4LUSA 3GDLA 2NX1A 2PWVA 1TIMA 1V3MA 4RDYA 4UQAA 2FVMA 4QNWA 2DJXA 5G1TA 2QLYA 3B0YA 4AHOA 2YXOA 1HVXA 4Y6GA 4WSKA 4U5IA 3SB0A 4ML9A 3SY1A 4GLEA 2F2KA 1Y65A 1K8YA 4ZQMA 3O6AA 3WCZA 4C6DA 1A0CA 1HJVA 3SDOA 4LV4A 4DNMA 3MWCA 1F8IA 4QJ5B 1R47A 2CZEA 4GZIA 4C6NA 2OU4A 1EUNA 4Z1DA 5I02A 1SR0A 3M0ZA 2B81A 4PFMA 3T4CA 3CHFA 1P1XA 1SVDA 3VC6A 3ZJ8A 4UTMA 2UWFA 4GO8A 4I9MA 4ZMGA 4MG4A 1JFXA 7REQA 3GUWA 5DMLA 1QO5A 2VFGA 2Z1XA 3H7VA 3P5ZA 4YU1A 4ZBCA 1R87A 4H9XA 3UJ2A 2WCSA 3CTTA 4DJED 4MB1A 4GC4A 4C7DA 3PZVA 2ISWA 4JX5A 5IOBA 5DELA 3F4NA 4EP8C 2EJAA 1QNSA 5DY3A 1SW0A 1VFMA 2XM1A 3VU2A 3R0DA 1UC5A 1G4EA 1XG3A 4H8HA 3U2EA 1JYVA 4O0QA 3A23A 2RDWA 1QPNA 4DPQA 4XUYA 3W76A 5FL1A 3BICA 1RALA 1E9YB 4O17A 2QF7A 1ALDA 3RITA 3W86A 4NZJA 4PBGA 4C1KA 5A6AA 4I3GA 4XQ6A 5BXSA 1JCLA 1B2YA 4XKMA 3T2QA 4XAYA 4AY7A 3ZMRA 1REQB 3HV9A 1Q2RA 3T9PA 3G1RA 3HU7A 1NFGA 2J7FA 4DUWA 2ZICA 1X38A 1IZKA 2D22A 4IIGA 1E6RA 4H2CA 1JF6A 3QSTA 1WZAA 3PFRA 1VEMA 5DFAA 3GIPA 5HATA 4P8UA 1QATA 1JAKA 3GK0A 3L4WA 3WJXA 4AD4A 1WP6A 2Y2WA 1US0A 2AGKA 5EBUA 2ACUA 3R4IA 2H9AA 2H6RA 2OEJA 3MS8A 2C8NA 4IPNB 3F2CA 2G3NA 3LXAA 4ZOEA 3CASA 5C9XA 1JAEA 2HBVA 3OVGA 3LUTA 4JN8A 1L8PA 2CITA 1BF2A 1C91A 2PUZA 4UQ9A 2PMQA 2V5BA 2VR4A 3CTLA 1G1YA 2QJMA 3C0LA 1S2AA 2DV0A 5A6SA 4GVIA 4IPJA 2BZNA 5I2UA 5I03A 1S2VA 5IHSA 2F38A 1OIMA 2NX3A 3TU9A 4JTHA 2SFPA 3T81A 3BSHA 3C0SA 1K6AA 5IDZA 2ZZ1A 1JVNA 2DVTA 2W91A 1CYGA 4J35A 1FH7A 1JCYA 3DFQA 2DZPA 4M6VA 3GIYA 2WQDA 3AJXA 3UZZA 4AYSA 3KL3A 3S5ZA 3W38A 5HNNA 3SSZA 3LK6A 1U1JA 1VKFA 1XIJA 4S2CA 4IIEA 2QW5A 3BQ5A 4MIMA 3E0VA 2PTWA 1RY8A 3EGJA 3W2MA 4BS0A 4NAFA 5F4XA 1PHQA 4D1IA 3W26A 4M24A 2BHYA 3G3MA 3U2ZA 3MSYA 1HL2A 3AYSA 4GG9A 4WEVX 3E02A 3LMYA 3AXHA 6A3HA 4GNVA 1BTCA 1QHOA 4KQNA 1P5BA 4JIEA 4Q4QA 2YA0A 2ZZ5A 3VGFA 1VFLA 1CGXA 5IHRA 2XFYA 3O8AA 1V3LA 1V6YA 3PULA 1BRLA 4EXAA 3B03A 1QPOA 2UBPC 1O5KA 3HB9A 5D8WA 4HU4A 1ME9A 2WC4A 1NP2A 4PCPA 4AY8A 4FF5A 5BOEA 3VFLA 2PGEA 3TQPA 1NJJA 4MFDA 3OGVA 1JUBA 2GFTA 5I7GA 3KRSA 1TA3B 2XN2A 5CZTA 3POHA 2PTXA 2WAGA 3GYCA 2J8TA 1XBVA 1ML1A 3DERA 1QNPA 3QR1A 4AHQA 1MNZA 2VOTA 4MB3A 5CJMA 4H6KA 5A94A 2XG9A 2J9XA 1Z41A 4UMCA 3NR0A 2A85A 1KBKA 4HSOA 3VYLA 4ZL1A 1WO2A 1HG3A 1LT8A 3CUGA 1RK5A 2MUCA 6CGTA 4RPPA 3TTSA 2JGQA 2XSAA 4MUPA 3TR9A 1IE7C 3NQBA 2JEQA 3LA4A 3WK1A 3GW3A 4GIYA 4QJ1A 4M7SA 4LU0A 1UJPA 3D47A 3LPOA 2CLFA 3NQAA 1VQTA 3UZYA 3V7PA 4PMYA 5LIXX 4OV4A 4FXJA 3RXZA 4GKLA 4IP7A 3I10A 3Q2DA 3LHZA 4K8GA 2WV8A 2ICSA 4ZEPA 1FDZA 1NAL1 3QPZA 3UXIA 3DFYA 5HWJA 4V27A 2ZXBA 5CSRA 2Z1VA 3QPYA 1DWHM 2E8ZA 4IFKA 3K8MA 2W0UA 2E1WA 2YFOA 1LLWA 3UVIA 1J0JA 1CLVA 2OGYA 3LGDA 3UYCA 3P0XA 4WD0A 5FF0A 4QJ3B 1FP8A 1EJXC 3CIWA 1MEHA 4O19A 2C1GA 3DFHA 3EMCA 1HKIA 3BG5A 7PTDA 4LCQA 4QQUA 2YZ5A 3KWXA 3LRMA 3GNPA 1XLIA 1SM9A 1XWYA 3VZZA 1ITUA 1EWDA 1GCYA 3UBPC 2FH8A 3RCYA 2DVXA 3D46A 2R6OA 2BNJA 2WVVA 1UQYA 3T55A 4N6EA 4US5A 3KVMA 2AQOA 1RSCA 2PWFA 3GY1A 2XH2A 2I5IA 1FHVA 3GXMA 4R7JA 1F6PA 9XIMA 1K70A 4UOQA 4PN2A 5I09A 4Y9OA 4B4HA 3CIVA 1LT7A 3VIPA 2ZTKA 4UQCA 2PZNA 2OQHA 4HPGA 4DYEA 1TR9A 2IW0A 3TYCA 3ELFA 1VFSA 2VOMA 3KBSA 4XIAA 3G1FA 1PJ9A 1IEXA 2OKOA 1IXPA 2Z2BA 4DUOA 3PM6A 2CERA 4ORIA 1R30A 1UH3A 4F2TA 2Z0IA 3W88A 1NDWA 3C2VA 1AH3A 4MY8A 1L6SA 1TX2A 4J1OA 1GOMA 4HB7A 4LYKA 4IL2A 4H6EA 3ITLA 4LBRA 4QAIA 3GVWA 2C3ZA 4BEUA 4UQDA 4O15A 4G7EA 1K03A 1QR7A 3LQLA 1MZRA 3AIEA 2WSQA 1EBGA 2A4AA 2JE8A 2C0HA 3T0DA 2J6VA 1BKSA 2QVHA 3TC7A 3IJIA 2ZE0A 4RV8A 3DG6A 3BE7A 4MPKA 2ZIDA 1ECQA 4Z2KA 4JICA 1VYRA 1Z69A 2WWCA 1B3ZA 3UWWA 4V1XA 3SCWA 2Y8UA 4PC8A 3BZJA 3F5KA 4F0MA 4U2YA 2J66A 4HMCA 1B9ZA 1W0MA 3UNTA 2QULA 2ADAA 1KBLA 5C71A 1WBHA 3GZ3A 2FFIA 2PA6A 3VGHA 3ZXWA 2JF6A 2ZZ6A 1TCMA 2QJNA 1R3QA 2GVEA 2XHYA 3M6YA 1QK2A 4KRZA 2F9RA 3S2MA 3H24A 1KXQA 3SBFA 3IIXA 3RR4A 4YCPA 2X2YA 1R38A 4P7NA 4WDXA 2NLYA 4L5ZA 4C1LA 1B4KA 3GNXA 5BOOA 3CMFA 1U5JA 3ITVA 3QOMA 5TNVA 1IEIA 5I78A 5BRQA 3URAA 2VEPA 1Z7AA 3C61A 2WNWA 3ZT6A 1TQXA 2AMGA 1U83A 2VRQA 5LNRA 3T8QA 3T0TA 2TAAA 4B3LA 3H2AA 1OFRA 3ANVA 4H7CA 2PDHA 2PDGA 1WYIA 4GK8A 1N8IA 3WF0A 1I60A 3MCOA 2PTDA 1RLCL 1ZQ5A 5CG0A 1XQKA 3EOUA 5HNTA 1DTNA 2CWNA 4N9BA 2QR6A 3PWIA 3S6OA 5IDIA 1A3HA 3WEZA 4ICNA 1H41A 1DQWA 5K2ZA 4JHZA 4CQDA 2G3MA 3MC5A 3UVAA 1NY1A 3TSDA 4H7ZA 3EKGA 3SUSA 5BMWA 1DWIM 3EMQA 1M3UA 3AHTA 2BDQA 5DRCA 4HOZA 5EU9A 1X97A 5FJPA 2B7NA 2GSEA 3MVTA 1CBGA 4GIEA 1EDQA 3ARPA 1V08A 4CQBA 3VIFA 4QQ3A 4Q4OA 2P88A 2J7HA 2XGZA 1FWSA 3XINA 1HW6A 3UCCA 1XC4A 3I7QA 1IIGA 4HNLA 3OOQA 3S46A 4FX8A 1B0IA 3M0YA 5BRBA 4CNSA 3HQOA 3GKAA 1VP5A 1EIBA 1XYMA 3VIJA 5H8UA 2P8BA 1EWEA 3R8RA 5LNVA 1MXDA 1D9EA 3CZ8A 4PUNA 1HKMA 4DN1A 1W54A 4ZCWA 1O66A 1F61A 8RUCA 2RDUA 1UWAA 5C2CA 3TONA 2F7FA 2Q02A 5IRPA 4BEQA 4PE8A 3B4UA 1R9XA 1N8WA 4GY1A 4E38A 5DRIA 3ALGA 3V0UA 2DP3A 3WD4A 3ANUA 4RLIA 5EMLA 2Z25A 3L4ZA 3DI0A 4PRRA 1MUMA 1CXLA 1TREA 1RD6A 3UG4A 3FEQA 4RZBA 4UTUA 4YYFA 4FHAA 4O16A 3VNJA 3ZJ7A 4U4MA 3OVRA 4MMWA 4OBSA 1YEYA 3TYZA 4AVFA 3TYUA 3DIPA 4A3RA 1EZ2A 4TTUA 3LBCA 2EQDA 4E8CA 1UA3A 5EMJA 4O52A 3TR2A 1TTPA 5FIPA 3VNZA 4QX4A 2Z1WA 1WDPA 3R6IA 2RHGA 3DZ1A 4FNTA 5F2IA 2XVLA 1DJWA 2Y7FA 3PAOA 4UTFA 2ZC8A 1JF5A 2W63A 1EEXA 4X3ZA 4GBDA 3B9EA 2XZ7A 3W1RA 5D05A 3M0HA 4H7VA 1PWMA 2V3EA 1HKKA 2QCEA 3I6TA 4JBRA 4A35A 3W29A 5T91A 3ISIX 3U4FA 4F2UA 2EG7A 1U2YA 4AF0B 1Q65A 1P6BA 3ABSA 3TDFA 2DJLA 1TUXA 4IFRA 4O1DA 1EP1A 3RO6A 1IXNA 3BJSA 3W7CA 1TKKA 1MEWA 5FI8A 3GNDA 4O0KA 4LRTA 4GUIA 3GHSA 2X7WA 3OODA 3PNZA 3LHTA 1WXYA 4HK5A 1OFAA 5I3JA 4K39A 3CMJA 1SMAA 1W6TA 2QUUA 2OWCA 3JRKA 3AZSA 3BH4A 1XIBA 4JQ1A 4JTSA 2QCCA 1W9PA 4S3EA 3U57A 5IFPA 1BKHA 4HMEA 3MUY1 1P7TA 4PTDA 3ORWA 4CD7A 1TE6A 3H4XA 1DVJA 1MFUA 5M2FX 1Q2SA 3OBKA 2WKGA 4S3DA 4IJCA 2BOGX 1MSSA 3R89A 5F1UA 5BYWA 1OC7A 3FX4A 3W53A 4ZO9A 5A5WA 3ID7A 1UPPA 2BXYA 2YGYA 1W1YA 1ZY9A 4WZHA 2VELA 4M56A 4J9JA 1FH8A 5AC6A 3MP4A 5HINA 1TO3A 3U8GA 3KHDA 5IBXA 1H5VA 1A5CA 2FGZA 3AXIA 4LF1A 1LRNA 1XLGA 2OODA 3KBJA 4Q8TA 3IS4A 1E9LA 1EPVA 2D3NA 2VX4A 1WUFA 3R43A 1JRBA 3GIQA 1VR6A 4LNCA 4NX5A 1WXZA 1VHCA 4BJHA 1UIOA 3E2VA 3BAJA 4QLLA 3HFTA 4HYWA 4IHCA 1XISA 1MWOA 3NDOA 1A5UA 2QKFA 5D2WA 3VD5A 1BGGA 3BGJA 4JD4A 2B0MA 3HO8A 1R2RA 3VZXA 4YN5A 3BVJA 3FK4A 4A3YA 3ARZA 2IXUA 4AQLA 3N2XA 5HQEA 1AJ0A 4MKSA 2R94A 1XLKA 1EZWA 4ASTA 1E6QM 1JDFA 3CEUA 4UQEA 3G1YA 1E0UA 4V2XA 1F3XA 2QCDB 3LSCA 4KEVA 1AFSA 2AGTA 2O9OA 1XV8A 4DJEA 2WQPA 2ZXAA 1V6VA 2YXGA 2YL9A 4IMDA 3HGRA 3CAWA 3BLIA 4ATDA 3K4AA 4LAUA 1W9XA 1UMYA 3WQEA 3QZ6A 1J6PA 3P61A 3CV6A 1QW7A 4Z1AA 2W62A 2BY3A 3NQDA 1JCJA 3GDMA 3R10A 3TN4A 2OVLA 3W6LA 4K68A 2A6LA 2VX5A 4QDPA 3CV2A 3NVTA 4JQAA 4QP0A 3ICJA 2NVAA 1GJUA 2BVWA 2WZEA 4AVOA 3NA8A 4IOTA 1VIZA 4MNJA 3TIMA 2G3JA 4H2HA 4IISA 3LLFA 1VEPA 1C8YA 4JOMA 2OT1A 1OF6A 3L65A 3NG3A 1E6PA 4GZ7A 1NFPA 2FHBA 3UPBA 1KLYA 4HZ7A 4B4FA 3PPCA 4KWOA 4LVDA 2GGEA 4Q7BA 1PHWA 1YPXA 3U2CA 2BODX 4QDWA 1BAGA 3KOZA 3EBVA 5JVLA 2W79A 3CJPA 1QI5A 3P7YA 1RCOB 3B8IA 3CUHA 1VC4A 2PEVA 2A21A 4NZFA 1OD8A 2HXUA 3PWAA 1EPXA 1ZAHA 3MMTA 1XRTA 3FXGA 1VBHA 4I7VA 4NY2A 2VR2A 4G7FA 5AHMA 3OHIA 7A3HA 1EOMA 3CGTA 2YCEA 4GVFA 4RJEA 3LTSA 2PE4A 4ZE4A 4PMOA 4QM1A 4L61A 3QFWA 1J18A 4JGDA 3UR5A 4GWEA 5D38A 1DXEA 3AZTA 3TYAA 3TCEA 4B9YA 4D6CA 1XSIA 2PFHA 3SFKA 1J11A 3LHVA 2Q8LA 2FPVA 2V3DA 5E6YA 4XTIA 4HNTA 1SW7A 3FJNA 2PLJA 2DDXA 4DVOA 3HJZA 1V3JA 4IL0A 2ZUTA 3SCVA 2AOSA 3W0KA 1SU5A 1QVBA 2XVNA 4QSHA 3EA3A 4WJ8A 2F6KA 3PUOA 1SZNA 2FJKA 3O7UA 4QTGA 3TMQA 5K9XA 3C86A 1X6UA 1KNWA 3DECA 3VKAA 1EB3A 3M5YA 2YLLA 4C7GA 2A3CA 3RMEA 1B5TA 3T05A 1ZZMA 2FH6A 3M16A 1OIFA 3W23A 2A7NA 1SO4A 1X96A 4ONVA 3S42A 4YYCA 2CZFA 2IQTA 3LRKA 1PZ0A 3B9NA 2FTPA 4GCXA 2BASA 4GHRA 2PDWA 1XIEA 2HK0A 4M8UA 4IXXA 3IVUA 4XZIA 1RUSA 1TZ7A 1J2WA 2Y62A 4L9YA 4KBXA 3LRLA 3D0CA 2YL5A 4M19A 1JD7A 3UEQA 1ZJHA 3T2OA 3VIGA 4QCEA 3CO8A 4B3KA 1TRDA 1V3KA 3UZ5A 3QSRA 1UZ4A 3VOCA 1F76A 1FWIC 1NWRA 2O7SA 3MSRA 4OBTA 5FF4A 2CETA 1SFTA 1LCOA 3NNTA 3ANYA 3F2DA 4UTWA 4O4WA 1O5XA 3WD1A 3G24A 1GOQA 3VK5A 2FQIA 2HISA 1RBAA 2V2DA 2YOCA 3AC0A 4TO8A 7TAAA 1UKSA 3IGUA 3MDUA 4KGLA 4MDPA 2NV1A 2HPMA 2VQUA 3TJLA 1LQAA 4IG2B 4FNUA 5D9NA 3CEPA 2WKJA 5C5YA 5A8QA 1HL8A 1KCKA 4KGJA 4LAKA 4NKCA 3AWOA 3FLUA 3N3TA 4MZ1A 4NNAA 1VENA 1X7IA 3VZYA 5FAGA 3W7JA 2PDPA 3TZNA 3F4DA 1YXDA 1X1NA 4INFA 4UFJA 5LXEA 3VILA 5XIAA 3IJ7A 4EKJA 3RDKA 4WXZA 3UJFA 4LXFA 3RU6A 3KS6A 8A3HA 2DZAA 2BOEX 2E5DA 3AYTA 1U33A 5ABGA 4CNTA 2A2IA 5EFFA 4UB9A 3URBA 1PBGA 2WPGA 1TSIA 4CCEA 1Y5WA 3M0MA 3O05A 2OFJA 1GOWA 5ABEA 1OSEA 3RFAA 3ARUA 3KS5A 1J12A 5JXQA 5HWMA 1D2KA 3GTHA 3KP0A 3L67A 3MY9A 3O0FA 4FR1A 4F79A 5FEWA 3SUTA 3Q94A 2FVKA 3EOSA 5BMXA 1K1DA 5CC3A 3CO4A 3DOPA 1AJZA 3E0WA 4U28A 4W87A 3TEVA 3K4DA 5DN1A 3CYVA 3TMLA 1N7KA 1WUEA 4UXDA 3BUVA 1A5AA 3II1A 2ZUWA 2OSWA 3PB0A 2OX1A 2HPIA 2VDGA 5TAOA 5KZ6A 1OF8A 3GTNA 4JTCA 2D20A 3AMCA 2V5KA 1T5AA 3N9SA 3GZAA 1JR1A 2FGLA 5C9RA 4LRSA 2DVUA 4ATWA 3UWEA 3UR7A 4CLMA 4FOUA 3EDFA 1UKTA 1M9HA 3SRKA 1CCWB 3ABXA 1XIDA 4E4PA 1JI1A 1BWLA 3QKEA 4JFSA 2DEPA 1KQYA 3HG3A 4Q4MA 4DWSD 3W87A 3SCRA 3SRHA 1C90A 1A4LA 4OHQA 4IT1A 4MKVA 1TE1A 2E67A 4JKLA 4K1GA 3WQOA 4WVXA 5DCDA 4L4MA 3DHDA 1DJXA 3LZ3A 1YX1A 3UD6A 4DWSB 1XQLA 2AQWA 2GJXB 1GVFA 3M5XA 4LUIA 1E4IA 5E0CA 1W91A 1UP3A 1S39A 4LB3A 4D2JA 4GUGA 3AMDA 5HDRA 1M5WA 3QEZA 4I9AA 3KAOA 3GFYA 1XP3A 1XRSA 4RW3A 4WIWA 1RH9A 1FWRA 2V82A 5HXMA 1YXYA 3TTEA 4Z1YA 2ZUMA 3S2CA 2C18A 1S38A 3C52A 4ZA0A 3DKLA 5B80A 3OU8A 3GXFA 3W02A 3PY2A 1PIIA 3RR1A 2FMOA 4GNJA 2FPYA 4AIOA 5LIWX 1H49A 4RNFA 5K7JA 4Q8OA 4MGGA 2FMNA 2XVPA 1K77A 4UR7A 2PC8A 4IX2A 1DIOA 2AKMA 3N04A 4KMQA 1R46A 3M6DA 4OECA 2NSOA 2XIMA 3S2JA 3STFA 4B90A 2Z7KA 1W3JA 5I07A 3K8LA 4LVAA 4M5PA 4BF5A 5MKGB 3W73A 2F61A 3AAMA 4JS3A 4UFKA 1P0DA 3QYSA 4NJIA 3IGSA 2X0HA 3MKVA 4HCHA 3RUBL 3C56A 4KKXA 3TLQA 2JFEX 3NFUA 5DXYA 1O94A 3U4AA 4Q7NA 4HNVA 1YLVA 4IPLA 2XINA 2NLIA 2Z27A 3HFYA 4N9DA 2FZ8A 1XLDA 4J28A 1CNVA 2QGHA 2QNEA 1LOLA 3BLFA 3CAKA 4R85A 4HU3A 2O4QA 2Y5SA 4QG6A 3U5YA 3A21A 4GQQA 2VX6A 1HJWA 4HPHA 1S5TA 3LPPA 3BCFA 3VKCA 1LQ2A 2QCMA 1DWAM 4UFMA 1OCNA 4OE7A 1UR0A 3W01A 2C79A 2FVLA 4X0NA 3NO1A 4CQCA 3A47A 1RQHA 4ILSA 4C6LA 1M7PA 2FB3A 4GX8A 3MV11 4DZIA 3WENA 3EX3A 3VOJA 1OYBA 4UTLA 3NM1A 4J3UA 1BQGA 3QQ0A 3PBYA 2AAAA 2OOGA 3ES8A 1QBBA 4O4VA 1W3TA 3WFZA 3SQSA 2D23A 1F3EA 1H7XA 1S2UA 2CCRA 3AOFA 4A21A 5DT7A 3MSGA 2DSKA 1XYZA 1H61A 3QW4B 1K9TA 4UOJA 4YCOA 1UUMA 3BAKA 3T6CA 2WNZA 1EGMA 1LUCB 5DANA 1KFKA 3G0SA 3WBAA 1ZB5A 1ZS2A 3WQVA 3WJSA 4MJZA 4NNBA 3DUGA 2OEMA 2XFRA 4FLSA 2V5JA 4QLJA 3FIGA 1YPFA 3JW7A 4J7RA 1WOAA 1KRBC 2J9YA 1VJIA 4M6UA 1I2PA 2EKGA 2DQXA 5M5DA 3BPWA 3BDKA 1XX1A 3K1GA 1ADDA 4NJGA 1AQHA 3R11A 3PBUA 5LNWA 1TPB1 4Q8MA 1M41A 2WZTA 3MT1A 3LCIA 4Z0SA 2OO6A 4HBKA 3TVAA 5ABTA 3H8AA 4XUGA 1OD0A 2GJNA 3L2IA 3VIIA 2VZTA 3S1GA 2PU1A 3DHPA 3CLWA 3QV9A 2XISA 5I3FA 1L6YA 1EJVC 3M5ZA 3WL1A 4L7ZA 1AQFA 2G4FA 2UY3A 4AEOA 3PVFA 4FP1A 2QMKA 1PV8A 1JEZA 5HAOA 1L0PA 1J0ZA 3L7RA 1OX4A 1EF2A 4EAYA 1C9WA 3O6DA 1TPWA 4F48A 2BY0A 4Q7IA 2YCLA 1ZLPA 1FFRA 4AZ7A 4WGHA 1OYCA 3PP7A 3EMZA 3LSBA 4PMXA 3EYPA 1YTDA 1IQ8A 3EKZA 2VC9A 4UNIA 3AQUA 1ENUA 2QAPA 1VD6A 1YKWA 5BNKA 4MWAC 4S39A 4HKPA 5I3IA 1NM9A 3GNNA 5D03A 3G0XA 2ZDRA 4A8NA 3ARXA 4HNCA 3BO9A 5KEZA 1DIEA 4Q8UA 2X16A 1K4HA 4E0CA 4Y9NA 4FALA 3QTPA 4AUBA 4W7VA 1OG6A 4ROQA 1B3YA 1QPRA 2UY5A 3Q4DA 4W8BA 2ZUUA 1QOPA 1X8FA 2IPWA 5AC7A 3LS9A 3ZJKA 1TUFA 2Y89A 2DZTA 3GDKA 1C8QA 3BJTA 5FKYA 4Y9PA 1ICPA 3FNDA 3QV6A 1G67A 1KBJA 3PTKA 2D69A 3H70A 1JQVA 1UR3M 1KFJA 1XYFA 4YHEA 2PB1A 4XV0A 4YNGA 4P7RA 3V1HA 4PMVA 1JFHA 4KETA 2V81A 3WMLA 1KFEA 1JDAA 3WJYA 4X2PA 3WEMA 3W2NA 3TKFA 4UUIA 3GXTA 5LIYX 3N2MA 1BLIA 1ISWA 4UIOA 1H5YA 3CQIA 2HRWA 2FJUB 3VOFA 3SAZA 3UETA 1W1ZA 2PF8A 3DC8A 1EO5A 1SUXA 1QAPA 2CU0A 3EOEA 4C7FA 3TJ4A 2WYSA 2G4JA 2P1FA 1FP9A 4AW7A 4N4PA 2ZX6A 4CU7A 4JYEA 1R9YA 2XSXA 3G1SA 1XIHA 3TXVA 2R82A 4IMCA 4GUFA 5AYYA 1J8VA 1FX6A 1LRQA 1IT7A 1R3WA 1RXOB 5K9DA 3TZFA 3QFEA 4PUKA 5JUVA 4TVCA 3ENLA 2XWDA 3QKZA 3W1NA 3L2LA 2R91A 4EXBA 2E77A 1Z44A 4XKYA 4G8TA 2TMDA 3AIUA 3GUGA 5I0DA 2O55A 5AZ1A 3RF9A 3EPOA 3MV01 1GOIA 2QCDA 1S3TC 5I77A 3TYBA 5LA2A 4ERAA 3T0BA 4MSSA 3DEQA 2H3DA 4W4QA 4U3AA 1QMLA 1W5QA 3ZR5A 1Z48A 3UY8A 3P3BA 4XO7A 1EQPA 2YW4A 4Q6JA 2J8FA 3LHUA 5H6HA 3WZ0E