1F07A

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
321
Chain Sequence
MKFGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDELSNGRATLGIGPGDKATFDALGIEWVKPVSTIRDAIAMMRTLLAGEKTESGAQLMGVKAVQEKIPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAAKIVVAFIAAGSPPPVFERHGLPADTGKKFGELLGKGDFGGAIGAVDDALMEAFSVVGTPDEFIPKIEALGEMGVTQYVAGSPIGPDKEKSIKLLGEVIASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
total genus 117
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1f07A00
1NFPA 2I7GA 1YW1A 3SDOA 3FGCA 1BRLA 3B9OA 4US5A 1RHCA 1LUCB 3B4YA 1F07A 1Z69A 4US5D 1BSLA 1LUCA 1XKJA 3B9NA 1FVPA 5LXEA 4UWMA 1TVLA 3C8NA 1M41A 5DQPA 1EZWA 5AECA 2B81A 1NQKA 4J2PA 3RAOA 3FGCB 1BRLB
chains in the Genus database with same CATH superfamily
1Y5VA 3GQYA 4QS6A 3GH4A 4YJ5A 2GGHA 1AW2A 3G2GA 5DLCA 2QQ6A 5HR7A 1UH3A 2GVYA 3WDHA 1V6XA 3WNMA 3UG3A 1L2UA 3PN8A 5FL1A 1W1A1 1X6UA 3WLIA 2F6XA 1VPYA 2OT1A 3PZMA 4YVPA 4AVNA 1D3GA 3VNIA 2GUBA 3TV8A 3RYSA 4LH8A 3VOFA 2OVLA 4R34A 1VKFA 1M03A 4X22A 3BLEA 1AG1O 5ABHA 4AUBA 4AX6A 3CH9A 5CBBA 4F48A 3NOEA 3SCRA 2YXGA 1A5LC 5JBFA 3WLMA 2YLAA 4CUCA 2CBJA 3WJWA 2ZX8A 1ONEA 4GISA 2ZICA 4MDPA 4S39A 2ZXQA 5A3HA 3MVTA 3ABSA 4J35A 3W7GA 1SFTA 2IQDA 3NQDA 4XBJA 5LXEA 1PHWA 1I1XA 3CEPA 4BEQA 4DELA 1FWBC 4RDVA 2VDIA 3TCSA 2VYOA 1QJWA 2QDEA 7TAAA 4DYEA 1BRLB 2AKZA 3MMTA 4ACZB 4B15A 2V82A 3VDHA 2ACQA 3OZOA 4HNNA 2BB0A 1UQYA 1Q6QA 2YDAA 2OKTA 2BS9A 3LNPA 1ZSXA 2HRWA 4GKLA 2X2YA 1XG3A 4JTJA 4WY0A 1AZ1A 2VL4A 4NZ3A 4RZ4A 1W1PA 3KFTA 1QPQA 2ISFA 3SBFA 4Y2WA 2OZ3A 3PPCA 4OOUA 1BSLA 1G0CA 2XYLA 4JYFA 3UVIA 3TDFA 3VX1A 1WAUA 4Z2GA 1UZ4A 1YNYA 1JEZA 3RU6A 3URAA 4E5TA 1I2NA 4H7ZA 1FP8A 3G8RA 1OSEA 2YB4A 1R47A 4FAMA 1UR3M 1LBFA 6ALDA 4Q8OA 4JTRA 3WK0A 1B90A 1HJUA 4YVVA 4K8EA 1VLWA 1JZ6A 1G4EA 4FOJA 1ECQA 4A3QA 3IUDA 1MZHA 4K6AA 2V2CA 4A8LA 1FDJA 3QV7A 3WMLA 1PAMA 3R13A 3TQ0A 5BU6A 3V36A 3H70A 3GDRA 3WF1A 4GJJA 1QNQA 2Y7EA 2OR2A 1E55A 3WNOA 4IOTA 4RR4A 5GNYA 1H60A 3F1QA 4MSSA 4YU1A 2BBFA 1QW7A 5K4XA 2Z1WA 3T2OA 3ARZA 4JCMA 5GPRA 4LNYA 1DJWA 2HS8A 4RV8A 1S2UA 5ABFB 3CGTA 2VCBA 3RLUA 3PBGA 2J88A 3TEVA 3NGJA 3S5ZA 1LL7A 4GBUA 4AZ5A 2VFGA 4H00A 4NASA 1K70A 4MB1A 4Y7EA 5CPTA 4IMEA 3SR7A 1UJQA 2XIIA 2CBVA 2VDHA 1OYAA 1UKOA 4KEZA 4ZBCA 4GI8A 1FXPA 4GINA 2VX7A 1ZUAX 3BAXA 4MPKA 2OYKA 2NT1A 1CGVA 4JFTA 1MW1A 2YCEA 4JFWA 1R8LA 1TWZA 5BZAA 3DGRA 2HVMA 3W1QA 1BHGA 5EMMA 3NL3A 2AMGA 4XQ6A 1ZJHA 4O14A 2XVKA 4LGXA 3NSNA 3OBKA 2ALDA 3G24A 1XXXA 1J12A 2FMOA 3L23A 1J6OA 1CDGA 4BQ4A 1HJQA 4X2PA 2HDJA 2HVNA 5HMEA 6TIMA 3PAJA 4H2HA 3Q45A 1WQ5A 1ONWA 2PDGA 4OV9A 3QW4B 3OBAA 1EP2A 3PNUA 1TCMA 3P84A 5FAJA 1QHOA 4DWSA 3E2RA 2PZ0A 5F1VA 3P67A 1UWQA 1E51A 4GKTA 2XVPA 4HGXA 1TVLA 3T44A 2VC6A 1YE4A 1YBQA 4NZJA 1YYAA 3AIWA 3CLWA 4RNHA 1VJSA 2ZWYA 4H6EA 3TW6A 3ITTA 1XICA 3BQ5A 3VNKA 1JUBA 3LHUA 4DF2A 2GGGA 1B31A 2VOMA 3C0SA 3CXOA 3RHGA 2DORA 4IT1A 4UBPC 1SQ7A 2A3BA 3RG6A 4Z2LA 4YCOA 5LYRA 5BRBA 1R3WA 3AHZA 2HCVA 3FIGA 4REQB 3QMTA 5KZDA 1W2VA 1I8JA 1JRBA 3AS3A 1FCBA 2XWDA 3KTSA 3H24A 2HXTA 2IPFA 3A5FA 2ZUSA 4IIHA 3DFTA 4FLQA 2J7FA 3S6DA 4CQBA 3RNDA 2YCJA 2BP1A 3UNTA 4UMAA 1V79A 1RPKA 4OE7A 4KFNA 3CUGA 1LOLA 2GQ8A 4PUJA 2PRLA 1R0MA 3T2QA 1FWHC 1J2BA 2WMGA 4WKAA 4URIA 2H8ZA 4IICA 1S38A 2QGHA 1EX5A 4K2SA 4U5KA 3GVVA 4HN4A 1HO1A 3VYLA 3BOXA 1KFWA 2J62A 2W63A 2FTWA 5AVNA 5KMYA 3WFZA 4YVXA 3LB0A 3B9DA 5D2XA 3T42A 3BAWA 2Y8UA 2NVCA 5AOUA 3H2OA 2F8QA 2QCGA 2J13A 2BX7A 4LUIA 3C2YA 4YTQA 4JX5A 3SFKA 4Q8WA 3UR2A 2CCRA 5EMLA 1DYSA 3XIMA 1F6PA 4JFVA 1V3JA 4NJGA 1BXNA 1KBJA 1CB2A 3VZXA 4F2TA 1NWSA 3UGVA 2EO7A 4LUSB 3UETA 3QXBA 4ICCX 4NYUA 2DT1A 3CJPA 3O3RA 4MWAD 1GVQA 1EHAA 1KXQA 4DJFA 4Q6XA 4TMCA 3ZM8A 1R9ZA 5DELA 3TVAA 4CD6A 1HP4A 4YTRA 4OOZA 1IGWA 1TPWA 4F9JA 3A13A 2CLOA 1XLLA 1DJQA 1U1UA 3URBA 3OGSA 1VBHA 3QPEA 2QXWA 5REQA 2ATMA 4PEEA 3PJUA 5BOEA 4HMDA 2A7PA 4FIQA 1XUZA 3CUZA 1W3TA 4K38A 1SO3A 4LB3A 1XCXA 3BLDA 2NVDA 1WKEA 4CNUA 3PF3A 3HG5A 1Z32X 2QCDB 3L5AA 4BWLC 3K1DA 1BTMA 3LBCA 5PTDA 2E09A 4MADA 3P3BA 3QN3A 1UA7A 1E0XA 1O66A 1M7PA 4O13A 2NX9A 4DPQA 2V3DA 1O7AA 1MRQA 1JPKA 2ACRA 4ICMA 1ZAHA 4GY0A 2WSPA 4QEHA 4YTSA 3IARA 5FL0A 3S6TA 2CZDA 4RE0A 4HIBA 3UG5A 3BANA 3UESA 2W61A 3L9CA 4Q7BA 2G50A 3P8JA 3ONCA 1WE5A 4NP7A 1MEIA 3O07A 4Q4QA 2ZRWA 2JIWA 3G0SA 4QG8A 4RK8A 2QNEA 1QXLA 2Q71A 1Q66A 3AYVA 3PWIA 3S1VA 2PLKA 4QX4A 5A6JA 4RW3A 4PMDA 1W91A 2G3NA 1IWPA 2OQYA 5FSEC 3EDKA 1ICSA 4QDMA 4C1NB 2DSZA 2A3HA 3CPRA 2HMCA 1TPDA 3EEZA 1RUSA 4ATWA 1V5XA 5GJPA 1Q2SA 3ZT5A 2EKCA 1UCWA 1Z44A 1XHGA 3PM6A 4MKSA 2BXVA 3HPXA 4DJEA 4ERIA 3S9IA 4FZIA 4GI4A 2AQOA 3HV9A 2FDMA 1FHVA 5EMKA 3W2KA 1OEPA 4GNVA 4JBRA 2WHLA 1QW9A 3TNBA 2YW3A 3EOOA 3BV7A 1SJCA 4L80A 1Y0EA 4AEOA 4WXYA 3VCNA 4RNJA 4WSJA 3E96A 4I9TA 1G69A 8CGTA 2BHYA 4GVGA 2QCLA 2WC4A 2OSXA 3GNRA 3ITLA 4WKFA 4PTMA 3L5MA 1O1HA 1B3WA 3ZJ7A 4HNUA 3V16A 1KFEA 3NG3A 1AMYA 3THQA 1FWTA 3CU2A 2Z4GA 2XVGA 1OX4B 1EGMA 4PMUA 1ZPTA 3BG5A 2ZX5A 4W86A 1J8VA 2PLCA 3BLFA 4S2CA 3PTMA 1PIFA 3JVAA 4LAMA 3FOKA 1K7XA 2ISVA 4AX7A 5IM51 1T5AA 1W0MA 5LA2A 3VKCA 4GH1A 3GD6A 1RCOB 4H9UA 1ISVA 3E6EA 4UFJA 3NA8A 3KP0A 3O1NA 3ZJKA 3T05A 4NUWA 1E4MM 4B16A 4MOZA 4MPQA 4LX4A 1JNDA 4RZ5A 3SY5A 1ZQ5A 3LQGA 4ZB2A 3NQ6A 1X8CA 2VCAA 4JZ5A 4EP8C 3PZOA 3RGTA 2W0UA 4NI8A 2WBGA 3CLMA 5G1TA 5HJXA 4W7VA 5H6HA 4YXGA 3NAVA 4ORIA 2BV9A 1UP2A 2ZZ5A 1ADSA 3CWNA 4NZ5A 1GVOA 2IPJA 1H7PA 4MWAB 4O1CA 1YIXA 2O55A 3HGRA 1GT8A 4JYDA 4FA3A 3KAOA 1TUFA 1C3FA 2R1NA 2PMQA 4DEFA 1JRCA 4IFKA 5A8MA 2WJZA 1R6WA 3R1ZA 4QG9A 1IXOA 5A6LA 2D0GA 3AZRA 1IEXA 2ISSA 1CWYA 2I5IA 3EX1A 4ASTA 2C79A 4PUEA 1D8CA 4DX3A 4AY8A 2J66A 5G4WA 2HISA 4TOQA 2BGSA 3G0XA 3GH5A 3NQ7A 3C3NA 1LQAA 3S2NA 4ZOAA 3DBNA 3C0QA 5AKQA 3L4XA 3LU2A 2X09A 1OYBA 5FCZA 1ISWA 3D3FA 3GIPA 2E9MA 5HAOA 2Y8VA 1A0CA 1TWWA 3U2CA 1U1JA 2TYSA 2PWVA 3FHAA 3FEQA 1VEOA 1XI3A 2YL9A 3UR8A 1RQEA 5JXQA 2FLIA 4ORMA 3ATYA 5I24A 1IXNA 2B7QA 1XIMA 2R24A 3KVKA 3RM9A 1QNOA 3EMQA 1BKSA 4UTWA 4K39A 1W1VA 2Z00A 2NXHA 3B40A 1IT7A 3OVRA 1N8WA 1L6SA 2XM2A 1DOSA 6XIMA 1E9YB 2J8GA 1LUCA 5LKYA 4UNLA 2VX6A 1NY1A 1TELA 5EMYA 4PR4A 2IKIA 5AHNA 3LI1A 4F0SA 1XDLA 2Q02A 2VVSA 4RPQA 3KW3A 2F6UA 1W9BM 3T40A 3PAOA 3W4RA 4PMXA 4A2SA 3Q4DA 4F79A 4JPGA 2YCLB 3LHTA 1L6GA 3KTCA 2B7PA 3NQEA 3PBWA 3BAYA 5C8BB 4C6QA 3MSGA 3RPDA 4K37A 3KLKA 3ITOA 2WMIB 1F3WA 3VGDA 1GYMA 3S83A 1X6LA 1MNZA 1W8GA 5D02A 1MDLA 1GOIA 3IVTA 2WHKA 3CQKA 3E0VA 1SZGA 5E09A 1HKIA 4DWSC 1HL2A 4WVXA 1V6TA 3QM3A 2GJXB 3VGGA 4US6A 5T26A 1R86A 3QBUA 3U48A 3AICA 3SCUA 3T0CA 3W82A 3FKRA 2NQHA 1OCNA 3GKFA 2DZXA 3VIIA 3LS9A 3O6YX 2JKEA 1T6MA 3AS2A 1MUWA 1H1YA 2RHGA 1RK5A 1UWUA 3GW0A 2DJXA 3TWAA 4UQAA 4C6NA 3GUGA 5CJ5A 3UXIA 1FUYA 3GHSA 3SURA 1R3TA 1P5BA 3BQ6A 3TK7A 4QDPA 3HB9A 4MHBA 3P93A 1VB9A 1V6YA 3DG7A 4DBUA 3QC3A 2FGLA 3AISA 1L9WA 2FZBA 3I4EA 3URQA 1KCXA 3WFAA 4BKNA 3RILA 4PTXA 4Z2KA 4QP0A 3IAPA 3Q2DA 2FTPA 3DFQA 1EGVA 3AIUA 3ABXA 1YDYA 1A5MC 2PDMA 1SGJA 3KZPA 1G4SA 4O11A 1GUVA 1PWMA 1NFBA 1WOAA 3EWWA 5FF0A 3HPFA 2YDQA 2BOFX 2FPVA 4J28A 4LS0A 2OT0A 3RLGA 5RUBA 2VEMA 2W6RA 3R5EA 5HDRA 2PRHA 4LY4A 1GK8A 2ZX9A 4PCSA 4NVTA 3UGRA 2VC5A 1FWJC 5KZEA 2ZCGA 3SGGA 4FPSA 3MWAA 5FEZA 2YJQA 3MSDA 5DCEA 3ERPA 4LVFA 1XCFA 4DYJA 3WUFA 2Z1XA 1K8CA 3CUXA 3E2SA 3T08A 2WQPA 1EIXA 1E15A 4OJYA 4LOCA 1CXEA 1H7NA 4H9TA 4TVUA 4WSKA 3GSMA 1A5UA 4AHOA 5HQLA 4LANA 1ZB5A 3UCDA 2AGKA 1P0NA 4LVGA 2DVUA 3GHRA 4D9PA 1W2PA 4DJFC 5JU6A 4Q7IA 1MRAA 3EB2A 3EB3A 3QJAA 3L4ZA 1DWFM 3FY1A 4WGHA 1PV8A 1JIBA 3DU0A 3H2MA 3RPTA 1XIFA 4PE8A 1Q8JA 3VMNA 4XZ9A 3RX2A 4UFKA 1TIWA 1FFQA 1ODZA 1B4KA 3PUEA 4IPIA 1NWTA 1TJ2A 2CZEA 4GACA 2WVVB 1YEYA 1WXZA 1JPHA 1PKNA 1SYTA 1T41A 1E9ZB 3H4WA 3H7VA 5D4YA 3DG6A 5H91A 1ECEA 4JTQA 3G1DA 1WPCA 2WSKA 2BSLA 3ISIX 1VHCA 3BGGA 4M51A 3SECA 3W9ZA 3GE7A 4GIRA 1UG6A 4DHGA 3W1TA 3NNTA 1P1MA 1ELSA 3TYZA 1XYMA 2RKXA 1EUAA 2FJUB 2PDNA 5HNTA 2IW0A 4Q8TA 4KERA 4LYQA 2EPLX 2Y7GA 3NJ3A 2DT2A 4DZIA 1FQ0A 1ZGDA 1CNVA 1W3NA 1J01A 2WVTA 3EPMA 4PMRA 4A3HA 1LG2A 4IWWA 3YPIA 4OBTA 3TMQA 3WNLA 2PDWA 3ZJ8A 3F5KA 4HB7A 4XVEA 1W9XA 1X98A 2L5HA 1TWDA 1HUVA 2H3DA 4WX2A 3KE0A 5CG0A 1K9TA 1T99A 4LC8A 3ME3A 4P7NA 1LDCA 4NXKA 4AZGA 4DYKA 1QK2A 2RGMA 3M5XA 4IISA 3W27A 2OODA 4MB4A 2JE8A 2R9RA 5FJJA 4LALA 1FH7A 1L6FA 1Z41A 1I60A 1U5VA 3W7OA 3VDBA 4DPPA 3TA6A 5DY2A 3S9YA 4PC8A 4N0RA 5DANA 1CXIA 2NX1A 3JZEA 1OF6A 5HPOA 4MG4A 3M47A 4A21A 4DJEC 2XUCA 4CVUA 4ZB5A 2V5KA 3L0NA 5A5WA 1C7SA 1I0DA 3FFSA 2VVNA 4A3RA 3DENA 5D30A 3UZYA 3UCQA 3P7YA 5I3FA 1V0NA 2G96A 3N73A 5IFPA 3SUUA 1C8QA 1V02A 4IG2A 1EJRC 2XGZA 3W70A 1F2JA 4BZYA 3LN3A 5FJOA 6ENLA 1RHCA 5C71A 1G4TA 4QSFA 4YTTA 4IX2A 2E5CA 3OLEA 3B8SA 5D04C 4DUWA 3VKAA 5CSYA 4MUPA 2P10A 1IE7C 4PUKA 1K4GA 4FO4A 3CWOX 3QC0A 4F2BA 1RLCL 1XRSA 3LY0A 3THCA 3UWYA 1XLCA 3K8KA 3EWBX 2CYGA 2Z1SA 5LGXA 4V1XA 2PBOA 4LS2A 3T81A 7REQB 5I3KA 3E0FA 1XLKA 3H23A 3W73A 1KD0A 3SRFA 4OBRA 4BQ2A 4P7OA 2BMBA 3E38A 1YDVA 1PB0A 4XAGA 3GXFA 2WKLA 1A0DA 1H7OA 4IMAA 4GC4A 2Z7KA 1H50A 3IPWA 3ZR4A 3N13A 3L2MA 3MUZ1 2DVXA 3FN9A 1BEUA 2DUAA 1UKPA 4H7VA 2VEIA 4B90A 4GH3A 2VFIA 3ENLA 2Z6JA 2ZC1A 4JTHA 2QF7A 2JFEX 2DIEA 4A2RA 1T7LA 1REQA 4LUYA 3AWOA 4GI6A 1WDRA 1PS9A 1LRQA 1F61A 1LM1A 4R7JA 1F74A 3S5NA 4GXWA 1LQ2A 4KWUA 3ABQA 1JCNA 4QR6A 2ZBTA 3T8LA 1AVAA 2ZTKA 4PMYA 1SW3A 5CPSA 4DB7A 3GTNA 3L21A 1EOKA 5CC5A 4FLSA 4AY7A 3LYEA 3EWXA 4NJJA 3ECQA 1RZMA 3VZYA 4FXJA 3GTIA 5CKSA 4C65A 3SCOA 3H26A 1ML1A 3PJTA 4P8UA 5IOBA 3FYPA 4O1BA 3ZSSA 3EXTA 4FHAA 1ME9A 5I3DA 1M01A 1XD0A 3WBYA 1R9XA 1PX4A 1IR2A 1XD1A 3PZVA 3QMSA 5H8UA 4WCJA 4LAUA 1I2QA 2VNCA 2FJKA 2GOUA 3B3DA 4KF1A 4LUTB 4HTBA 3VIOA 4S3FA 2Y1HA 4D6CA 4GZJA 3KHDA 3I3EA 2Z29A 3VNZA 2GL5A 4YIWA 1KO0A 5HWNA 5KZ6A 4V33A 3EDFA 1TV2A 3W72A 4JL2A 3TYCA 2BFGA 2ZRUA 3VA8A 3PS7A 5DEZA 3SN4A 4O10A 3ID7A 2CFFA 3ABOA 4H6QA 2XIMA 4UTWC 4OBSA 3KS6A 3G6MA 4RE2A 2YKKA 3M0LA 3W83A 1ZFJA 1RJPA 2XFWA 3RF9A 3BL3A 2YIHA 3DECA 3ANVA 1ITXA 1MW3A 5ECVA 4DXXA 2GQ9A 3FX4A 1RJRA 2ZWZA 4XZBA 3E2QA 1Q7QA 4X9SA 1E6RA 1J79A 1OHLA 5A6BA 2F6KA 4H19A 4QLKA 5KEZA 4XIMA 4LPCA 5K2ZA 1DJGA 2A0NA 1NDWA 2AQVA 2E77A 2IQ0A 4HK5A 1J6PA 2REQA 1ZJBA 1A3WA 3U8GA 4I5RA 3O06A 4WK9A 3MI2A 3PZNA 1G7UA 3QQWA 2BG5A 1R7AA 2CEQA 2GZXA 4A6GA 3GZAA 4ADTA 4RNFA 2BY3A 4NI3A 2ACUA 4PUWA 2FDSA 2G3MA 4XUYA 3H12A 4KQNA 4GQQA 4G7FA 4P61A 4UB9A 3RPMA 5EPDA 3A21A 3QR0A 1NFGA 4PFHA 2DQWA 5LNRA 3VDCA 3MMUA 3R4IA 3AUJA 3I68A 3DEQA 3QLDA 3NL5A 2HZGA 4H41A 5M03A 1VEPA 2HPMA 4WEVX 3VX0A 3AHVA 3BG9A 2ZZ7A 2OYLA 4HMNA 2O4QA 2G3JA 2E6DA 1KCLA 4D2JA 4UTJA 3VOJA 4UQDA 1VBUA 3BOLA 3UWQA 2YBUA 4O1EA 1OGSA 2DT0A 2VWSA 5I0DA 4JQAA 1F3TA 1TQXA 3UA3A 2RH9A 4RDZA 3CM4A 4BI5A 5AHIA 3E12A 4AC7C 3LLDA 5HNRA 5EY5A 2CLLA 4C7GA 4M82A 3AU2A 4BR1A 3LA4A 4XZIA 2POTA 1C8YA 4TO8A 4EPDC 3GB6A 1IHIA 3W37A 1WDDA 3E5BA 3IIOA 5D9OA 4OZOA 1Z48A 2JGQA 1FH9A 2Z1BA 1P43A 4O0KA 2HSAA 3GXDA 4JS3A 2C0AA 3L0GA 9XIAA 2RUSA 2XN1A 4NILA 5JIPA 3T1GA 4KPLA 6REQB 3JUGA 4LFYA 4C6BA 3AMLA 3ELFA 4GXMA 3NXLA 2X1IA 2J75A 1E6SM 4IQJA 2HWGA 1JUKA 2ASHA 3HO8A 2IMRA 3L2LA 3GZ3A 1LP6A 4W5UA 2YR1A 1OZQA 4LQ1A 4KBXA 1CT5A 1NWUA 2CZ5A 4PMZA 4AXKA 2FKPA 2VRKA 1B57A 3QV9A 3CZLA 2Z27A 4WR3A 5LNSA 4M6QA 1EHNA 2PWFA 1Z69A 4G9PA 3JZUA 5HK4A 1NSJA 5ABFA 5DT7A 1Q6OA 4B5XA 1BYDA 2PPGA 5CSUA 4TR9A 2BNJA 3OIHA 3PTQA 5FJUA 2F61A 4PRTA 5KINA 4LS1A 1FDZA 1LLOA 1RAKA 5HPCA 3W26A 4HPJA 3G1SA 1C8VA 1VFFA 4MIMA 3SGZA 3WLHA 2DZWA 1F76A 1EDTA 4R27A 1RA0A 4IMGA 4HA0A 1XISA 2I17A 3EOLA 3H8AA 1LWHA 2Z25A 2INZA 3AALA 2ZTJA 1J5TA 1OG0A 4KWVA 5D2TA 1XBXA 3NSMA 5BXPA 1KM0A 4DQWA 1UD5A 3M64A 5LHEA 1XLFA 2G4JA 1V51A 3R0DA 1KFLA 4DN1A 3ZMRA 2PLJA 3NDYA 2D0HA 3RCNA 4I7VA 4JAWA 1EOMA 1GW1A 1G7VA 5C2XA 2WXDM 4S1FA 3GUWA 1ZCCA 2QMJA 2WC7A 3DKJA 4MKVA 3TJLA 4B4FA 5H8MA 4JIHA 1DXEA 3TROA 3O2LA 4A3YA 5J5RA 1V3HA 3RM8A 2FHFA 3PTKA 1XP3A 3Q58A 3DYPA 4JIQA 3AIRA 2XM1A 5BYWA 4ADUA 3RCMA 4FF7A 4B3KA 1KR1A 2PEVA 3MI6A 3DHDA 1GOXA 3QW3A 3N9KA 1SO5A 3VUPA 5K9CA 4A05A 4MZ1A 3CV1A 1X1ZA 2CERA 1W5OA 3A4JA 2PDJA 4PUNA 2OQHA 3IIPA 4LWWA 1KFKA 1UKSA 3BZJA 5I5RA 4RDYA 1Q4WA 4RZ6A 3NXFA 1H0IA 5LIXX 1MFVA 1GOMA 5DBUA 1CI1A 2OWCA 5AHLA 3T6CA 4PMOA 4B5VA 5DRCA 2Z28A 1QK0A 4UZUA 5FEPA 2X7VA 2V38A 1X8FA 3QPYA 1OZMA 5I02A 3TCEA 5CQ1A 4L9YA 1HQTA 4U2ZA 3PANA 2VXNA 5AFDA 3QV6A 1ENUA 4XIAA 1CECA 2VZUA 1JAEA 1LLWA 3RU8X 1M5WA 3DYMA 2VGGA 4OV4A 2RJGA 1B5TA 4WDWA 2CU0A 1JNEA 4LT9A 1SR9A 2Y5SA 1F07A 2DSKA 1WV2A 4KWWA 4ZXLA 1HFBA 3BH4A 3LQLA 5CSSA 3NQ8A 1Q13A 5JQ9A 3H7RA 1OVDA 4GVIA 4IP5A 3WEZA 1EJSC 1T40A 3IVUA 3VC5A 1UOKA 3EMZA 1TMHA 2ZUWA 3P8IA 4Q8UA 1TTIA 4HK6A 1AFSA 5U4NA 2VGIA 3B4YA 2DV0A 1EXBA 4GD0A 2EBNA 3H2EA 2FB2A 3STPA 4NU7A 4GIEA 3QV8A 4OKDA 2BVDA 2DH3A 4BF9A 5C54A 4WIWA 5EA9A 4N9EA 2KZHA 4E8DA 3MUCA 1BWKA 2PDHA 1J0JA 1PBGA 3MP3A 4W9TA 2DZTA 2VKZG 5XIMA 2OLSA 3MQTA 3LBOA 2UY2A 3TA9A 3EWYA 1NDZA 4AIBA 4DVOA 5ABGA 4EKJA 1JI1A 2BWGA 1QT1A 2YYTA 1EKOA 5HWMA 2C71A 3ARTA 4J3TA 1ZRQA 3MUIA 4HNVA 4G1KA 1YHTA 4IUGA 4EWJA 3C86A 1GVFA 1YTDA 1SW7A 4D6IA 5B7ZA 3W3OA 1W56A 2RFGA 4NRSA 4X60A 3BLKA 1M7OA 4AWEA 3MSRA 5XIAA 1TTJA 2IQTA 1WKYA 2OX4A 4I5XA 4EIVA 3NR0A 3WLOA 3DIPA 4XD4A 3IIVA 4ROPA 1ICPA 2BHZA 2FPYA 3FA4A 1QPKA 3DHPA 2YCKX 4GE8A 3O0KA 2C18A 4X3ZA 3VIPA 4PUUA 3HF3A 2I57A 4EAMA 1OFBA 4YLWA 2WZMA 3WLRA 1F8IA 4GFIA 3SN1A 5CZJA 2B7NA 4DAIA 4UQBA 2J7DA 3VI2A 3PHAA 4GX8A 5HR6A 2ZUUA 4UFIA 1TA3B 4G8TA 2WNQA 3PPGA 1RK6A 2CLIA 1EYWA 1A5AA 2AQWA 4QGCA 1GQLA 3MMWA 4AC1X 3U7BA 2A6LA 4N4PA 2GJLA 4NJHA 4H9VA 4GFSA 2WCSA 1NFPA 5LSMA 4PRWA 3SUWA 3M6DA 1XYLA 3N2CA 1N8FA 2ISDA 1BVZA 2ZRVA 4ZL1A 1XG4A 1DV7A 1ZL1A 2D2HA 4K7VA 4C6CA 3GIYA 5HUPA 3UR5A 1P7TA 3OB8A 4PMNA 4UIOA 2Z26A 3B8WA 1VCFA 1NARA 4LV9A 2X0HA 3TLLA 4IJCA 2NQJA 1B2YA 5DT5A 3U4FA 3SCPA 4KCTA 5JMUA 5K3VA 1O4UA 5AHEA 3ARPA 2D3LA 4Q7NA 3WYZA 4CEUC 4JTFA 3K46A 1OADA 2EPKX 3MKVA 3VKBA 5DMMA 1HP5A 3WK2A 3U57A 3MUXA 3NZ1A 1HKMA 3K2GA 4Q8VA 2GWNA 1Q8AA 1LRNA 4PULA 1H49A 3PG8A 4IGSA 5C0QA 2OO6A 1EJWC 2J24A 3VD9A 3HZ3A 3P60A 5MKGB 3ALFA 3DFNA 2Y70A 1W9VA 4IXXA 3N2TA 4QBXA 5CAHA 5LNVA 1K8ZA 4DZ5A 1A0EA 4M0XA 3KBWA 5AC5A 2FGZA 3XINA 4E2OA 2G3FA 4NIRA 3S47A 4R9XA 1XLJA 3CZ8A 4PGLA 4DBDA 3RRXA 3WX7A 1UZ1A 3USZA 2AAMA 1FWDC 3PK7A 3B9EA 3WY1A 2F2KA 2V5DA 1PZ1A 3ZQ9A 3TU9A 1B3OA 1V7YA 3VFLA 2X1SA 3IJ7A 3ARVA 5B7YA 1O95A 1XS2A 1DHKA 3W7EA 1US3A 3NQFA 4F0MA 2WMJA 1V7AA 2FZ8A 3G3DA 2DPEA 4RL3A 1H1ZA 3F2CA 4ZSUA 2Y0FA 1H51A 4CQ9A 3TFCA 3CC1A 4Q4OA 2D20A 4U10A 2WYSA 3Q37A 5LIWX 3D0CA 3WJYA 4ZB0A 1QPOA 3QHNA 2CBIA 1FWEC 4M7TA 1H63A 3HG4A 2CZFA 1YRRA 5JBEA 1WKFA 5HULA 3QKZA 3F4DA 1LOSA 1BF6A 3AXXA 2QUNA 2PLMA 1GQIA 3BZGA 1MQPA 1M7XA 2Y5EA 3HG3A 4N6FA 3WD3A 3LCIA 5TF0A 1VH7A 1E56A 1EO5A 4CNTA 1W54A 2XWEA 3TMLA 2OGYA 4AY1A 5JH2A 1EDGA 1S5VA 3MPGA 3B8TA 3PUDA 2EG6A 5G1MA 3EX4A 3UQNA 3KRBA 3AQUA 4G1NA 3VDGA 1XJBA 3C2VA 2XISA 3QTPA 3I6EA 3KTXA 5E5CA 1SZFA 1R2RA 1UZHA 3DHUA 1MSSA 1K02A 3WH7A 3N29A 4HA1A 1H1NA 5AC8A 4CLMA 3WQ8A 2XIQA 4LEFA 4ZO6A 4IZGA 5I00A 1RY8A 3CK5A 1TPUA 4J9JA 4Z1YA 4R9OA 4M8UA 3H22A 3V5FA 5I06A 3GS6A 1TV5A 3IJ9A 1DQXA 3H55A 3M44A 1ZJAA 3D47A 3BSGA 3CV2A 3ORWA 3TE9A 2NUWA 2B7OA 5F2IA 4BI6A 4E8CA 1UW9A 3VIMA 1YE6A 3N04A 4JL1A 2WHJA 1UD3A 4M7SA 2PUZA 2X7WA 1P6BA 2RDUA 4GY7A 3HPZA 4MVAA 3S1GA 4A4AA 4DUVA 1KV5A 3FAXA 1EH9A 4L4MA 2NLYA 5A6AA 3LI0A 1UH2A 2E67A 3B0PA 1XH0A 3UPWA 2NT0A 3FSUA 3N6QA 3VE9A 1VFLA 2BXZA 3LRMA 1Q6DA 3CHDA 2GDUA 4IGNA 3L4TA 4C6OA 3OG3A 4E8GA 1EBHA 2P53A 5M17A 1R5YA 3PZGA 1QW8A 3BJFA 1RD6A 5TQLA 2GUUA 4X0VA 3VOHA 4Q6JA 1VRXA 4HZ7A 4HPNA 2C6QA 3UWEA 3N2BA 1WCGA 4KT2A 3SSZA 1QBBA 4XKYA 2A7RA 3A47A 4JIRA 3B0YA 2A21A 1HGYA 5CG7A 1FX6A 3G1FA 1ZLPA 4L5ZA 2ZUNA 2QPUA 3DH7A 2QUMA 2V81A 2YCLA 3VD3A 3KDNA 4K68A 2V3FA 1R3YA 2CLFA 3L4WA 2P8BA 2QAFA 4S3DA 1WZKA 1TVNA 2V5CA 1EF3A 3CL6A 3E5PA 1G4PA 3HIJA 4IIGA 1S5WA 4MB3A 1TPFA 3W07A 3VFCA 3N2MA 2QF8A 5EB8A 3KOWA 3K8LA 4NAEB 3WQCA 3ZO9A 4UMCA 1KV8A 1W5QA 3AMKA 3VD7A 1M65A 1RJQA 4JDBA 4ZA0A 4R3UA 1F7BA 1P0EA 1V08A 4HTYA 5AYYA 2NUYA 1VJIA 4QXIA 3W1AA 3AYRA 2PAJA 3J7HA 2OMAA 2YA2A 1LL4A 2FH6A 2FZDA 4GQRA 4FX6M 2OLHA 2W3ZA 3LEPA 2HROA 4BS0A 3IJDA 2ZX7A 4AZ6A 1TJ0A 3BMWA 4LB4A 1C8XA 2QT3A 3ITXA 2Q09A 3B8DA 4WDUA 3ABZA 4HZMA 2R1KA 1OX6A 1E1EA 1KR0A 1T8XA 2YDSA 4IM4A 3S1WA 1I2RA 3NL6A 4HZ6A 4WXZA 3ZVIA 1UIPA 1I0BA 1U5JA 4L7ZA 4AU0A 5IDZA 3L66A 3IANA 1XIGA 5CJMA 1EX1A 2EG7A 4M3PA 1HKVA 1L6YA 2FIQA 4EK7A 3QY8A 3AROA 2OCZA 3ZLGA 4QDWA 3VIJA 2PDLA 3G1AA 1SO6A 5FSDC 4IGHA 3F4NA 1U2YA 4MM1A 1K8YA 3W86A 4JTIA 2J79A 2P76A 4U31A 4XZNX 4ALDA 4GRSA 1Z8AA 1H62A 5A8PA 1VFMA 3VDAA 4NJIA 1QVBA 3S9ZA 2HNHA 3N15A 4XZWA 2OTDA 1JXJA 2OEKA 1RALA 2V63A 1YDOA 4GO9A 3KRZA 3PSWA 3CZEA 2Z2BA 3LG3A 4FB7A 1FDYA 1R3VA 2I56A 3G18A 1PZ2A 4UTUA 4PCTA 2D22A 3CWHA 3BXWA 5DO8A 3FYYA 1M53A 4K7YA 5DXYA 1X39A 3UWUA 4DWSD 2VZOA 3NO3A 2QS8A 2HNEA 4GUGA 1QOQA 1JZ3A 4LAOA 5I23A 2X8RA 3SFWA 2D0FA 5FF2A 1XYBA 4KRUA 1JPMA 1A5SA 3IS4A 3QEZA 1J0KA 3HGSA 4TTGA 2HEJA 3LGDA 1VFOA 3ZWSA 2GJNA 1TRIA 1W1IE 2JALA 5BNKA 3VOGA 4ZVJA 2YPIA 4QNEA 3INPA 4RLIA 3HV8A 3WDIA 3NQ2A 2ZXAA 2WVVA 1BG9A 1VYSX 2C8NA 1E1FA 5KITA 3T09A 2GVJA 2Y7FA 3OJGA 4BFAA 4J27A 4HNTA 4DBEA 1E6QM 2WMKA 4ZOCA 1KKRA 1E9IA 4D6FA 2IKGA 3DBPA 4W88A 4GG9A 3L65A 3QYSA 1TQJA 1O12A 2W62A 2QZRA 1UPPA 4KEVA 2JEPA 3DAQA 2DEPA 3LD5A 4LF1A 3B8IA 3NVTA 3WDRA 3GBEA 1LORA 4MNLA 1Y65A 3NQAA 5J8LA 1YADA 4W87A 2VP8A 4WY0B 3Q94A 4JTCA 3V0UA 1RQBA 5IFTA 2GVEA 2GDVA 1DIOA 2ADAA 3N3TA 1EEPA 1EPVA 5DBTA 3OBEA 3QF0A 2O9RA 5FI8A 2X1UA 4KESA 2DZSA 1MVYA 3A12A 1TO3A 1GJUA 4XAFA 4ZQCA 2GQAA 3W7PA 1J0HA 3V0TA 3AU6A 2Z1KA 1Y5WA 3WDPP 2J7BA 2VFDA 4MDOA 1FWAC 3OEXA 3WQDA 1TKKA 1NDYA 2D3NA 3W24A 4P7QA 4KETA 3KRSA 4N02A 3W87A 3N17A 4TUFA 4KFPA 5IRPA 4QCFA 2YCIX 3PB2A 4M6VA 3IUIA 3WD2A 4DJFD 2V5JA 4AIUA 4WJEA 3UG4A 2P8CA 1K7EA 1IWAA 1Q65A 5CGTA 2WCGA 4TIMA 3VIHA 1C92A 3KWXA 3N4AA 3IJLA 2NXGA 3WLNA 4UNKA 3TH6A 1TVPA 3XISA 3TN5A 3OVQA 1AH4A 1WZAA 5HA7A 3AZSA 4HHLA 2EJAA 4MF4A 4ZR8A 2FHCA 3OQEA 3DZ1A 5C2CA 1HT6A 1XYZA 3LSBA 4LF2A 1F6YA 4E2VA 3TX9A 2DIKA 4YWIA 4RE3A 1XYFA 2GQ3A 4JNYA 5G5IA 4BQ3A 3C8FA 3LMZA 1K3UA 4N9DA 1QPRA 4FR6A 1XBYA 3F2DA 4ZENA 3PBMA 4S38A 2R14A 3E0IA 1TV3A 2ZADA 2WPGA 4N42A 2BXYA 2A3CA 3TAOA 1DTUA 7REQA 4JDYA 3KBNA 1W1TA 3GTFA 1YDNA 3REQA 4OU1A 4TX9A 3C52A 1FWFC 4GX9A 1H11A 3NO5A 3TSMA 3RMEA 3W02A 2P0OA 4IQLA 3W00A 1TSIA 1EO7A 1HN1A 1AD4A 1XUUA 1GG1A 1S5TA 5F7UA 1N55A 3GDLA 1R38A 1HXJA 4ICNA 3W81A 4AVFA 2G4FA 4IXHA 4AF0A 1H41A 2VUNA 1SM9A 3FA3A 4F0KA 2QR6A 3A22A 3LTPA 2POZA 3EYPA 2PDIA 4DWSB 2XPKA 3UJFA 2V3GA 3V5OA 5HUOA 1XLDA 4X63A 2PWHA 4DJED 3LV6A 1TV8A 3HU7A 4JTLA 1L8NA 3AYSA 2V30A 1ZS2A 3U7VA 1BVWA 1GW9A 1QHZA 3TWBA 1JPIA 3EA3A 3OLDA 3WJXA 3CAQA 5KTLA 3KOZA 1I2OA 3OLGA 3ITCA 4M24A 3TLQA 4DIAA 3NQGA 3R94A 4YYCA 4Q3MA 1GGOA 4C6PA 4F66A 4R33A 2C15A 1K1DA 3MI3A 1FY6A 2VQUA 3M0YA 1U33A 5C55A 1Q3NA 1VYRA 1TZZA 1LT7A 1W3HA 1W1B1 1PHQA 3W76A 3F4CA 2PGRA 4O54A 4EPBC 3W7LA 4PTDA 4CU8A 2PP0A 2C0HA 1R85A 2PC8A 1OB0A 4QRNA 5EMJA 1WOBA 4XX6A 3KCLA 3EWZA 3RMJA 2PWUA 4LUTA 1H4PA 1QHPA 4I90A 1EFZA 1RQHA 4DNMA 1XRFA 3LRKA 1KRBC 2Q8LA 1XLIA 4LY8A 1MXGA 4DO6A 3E02A 3ARUA 3Q67A 3E0WA 1QI0A 5HATA 2EJ1A 2VJXA 5BXSA 4JN8A 3ZR5A 3EX3A 4PCNA 1D7KA 4EE9A 5L9FA 3V3WA 3M5YA 2GFTA 4AWSA 2VMFA 5AC6A 4MJZA 1K8XA 2JEQA 5KETA 1LBLA 4IIDA 4AZCA 5I77A 3WQFA 2JIEA 3BJSA 4CQAA 2OWXA 3OIXA 5CBJA 2ZZ1A 2QEZA 4O4VA 1T8QA 4FX8A 1E72M 3A4WA 3SCQA 4RXGA 1K77A 1JFXA 4JTUA 1TREA 2Y5JA 2NLIA 1FP9A 3QMRA 1XPYA 3NDOA 3IACA 4HNCA 3WBAA 4FIRA 3VOIA 2RJHA 4GOAA 1KM1A 1HKKA 3GDMA 5BW6A 3S5OA 3DI1A 1EXPA 1YX1A 4QQ3A 5D05A 1UBSA 2WJDA 3WDJA 4DBWA 3G1RA 3LM7A 1JGIA 4L64A 3GBDA 1IYXA 3GC2A 2XIOA 1E9LA 4JEQA 1XIHA 1BXBA 2PD9A 4GJ1A 1QI3A 1HNYA 3W7IA 1GQJA 1POKA 4ZTXA 3LPPA 5FEWA 1OT2A 3V1HA 1IT0A 5CJNA 3QR1A 1HIZA 4FNPA 3GR8A 2VOTA 4H8UA 2J9ZA 1TPB1 2PSNA 4IP7A 4FOUA 2VO5A 5D33A 1R87A 4FR1A 3LCLA 1OABA 1V0LA 3M46A 2OB3A 4WJXA 2PGFA 5A69A 1ZAIA 5GQBA 3BVJA 3O6AA 1MUCA 2WMFA 2PWEA 3BCDA 3M9YA 2DW6A 1UMLA 4BQ5A 1P4CA 2E3ZA 1ONRA 4YCPA 3NEHA 4WHBA 3CT7A 4LAZA 5I78A 2G97A 3H2AA 5G4HC 1EQPA 3W1PA 3ABRA 5HMSA 4NAFB 2HPIA 2WJEA 4AMAA 5FACA 1DJNA 1K6AA 1QFEA 3CH0A 1IZKA 3KDOA 5CEWA 3UYIA 3H7UA 1FHDA 3EX2A 3CNYA 3FYOA 4BCEA 3R0UA 3FLUA 5IBXA 3URNA 3W2JA 1Q6RA 4B9YA 3WQ5A 2IPGA 4M6UA 5EGRA 4FP1A 4HCHA 3OA3A 4AZIA 3NPUA 1Y8BA 2WNZA 3UF9A 3S5SA 1ADDA 3QSTA 1X7FA 3MBDA 3ZS4A 4D1JA 3CPUA 3MV11 4W93A 4HU0A 1FHUA 2QDDA 1YTEA 1WX0A 4PB4A 5BWAA 2H90A 3KEHA 4XAZA 2ZRXA 2BY0A 3GHUA 4OWGA 5F4WA 4N7QA 1YNQA 4HBKA 3UG8A 1DPMA 1CTNA 3VUSA 2JQXA 1GG0A 4F0HA 2AL2A 5HMDA 1EUNA 1OD0A 1EJVC 2EPHA 4A3UA 1GOOA 2ZA3A 1I45A 4Q33A 4KIRA 1JZ5A 1J4EA 1GTEA 4BF5A 3U2ZA 1S2TA 3UVAA 1P0DA 3RXZA 3BC9A 3PPFA 4D1IA 4ZODA 1IGSA 4LCRA 1FCUA 1TMQA 2OYMA 3I7QA 5H2ZA 4HKPA 1UB3A 5F1UA 4DUXA 4KFOA 1XCWA 4QS5A 3UJ2A 3LENA 1CGXA 5EFFA 7ODCA 5A8NA 3UYCA 4HK7A 1Z6KA 3W2NA 4XK2A 2GVGA 1XIIA 4WLCA 3A4XA 3IJQA 3MKKA 3E0LA 3N9SA 4ATDA 1W9PA 3PWGA 4FX7A 3CAKA 5DXXA 2UV8G 1FTXA 4WOZA 1KC7A 3NEVA 3H21A 4LYRA 2VUYA 4YNGA 1S2WA 1KXHA 4W8LA 3OVPA 3CQIA 1MZRA 4C1KA 4WUIA 5CC7A 4W7WA 5A1AA 1YPXA 2PI6A 1NM9A 1DXIA 5E6YA 3G3MA 4ES4A 4NT0A 1V3IA 2V69A 1P0KA 1XDJA 3BMXA 2X41A 3GYCA 1Q4NX 3W7JA 2J7EA 3FAWA 1Q2RA 1NWRA 1KW1A 3VMOA 3PZQA 1I2PA 2O56A 2FVLA 2XVLA 3B04A 3ZLHA 4UTTA 4AHPA 4TX6A 1A5KC 1V8EA 2PDCA 4RPPA 1R3RA 2PDBA 1LRTA 4J4KA 3E2VA 2ZIDA 4PBGA 2QCCA 2YXXA 1A3XA 5KZMA 1AJ2A 3UZWA 2XH0A 2INFA 3TJ4A 1XLHA 1Q7MA 1WBJA 1UP3A 2QW5A 3ARWA 4FMVA 4MY1A 1ZU8A 3CV7A 3M0KA 3KZSA 4CU7A 4UUIA 1PIIA 5JIWA 1GVSA 2TRSA 1K7FA 1XLMA 2XZ9A 3N12A 4C7FA 1BFNA 1WKDA 2ZZ3A 3RO6A 4C90A 4AD5A 3V35A 1M04A 3QKEA 2WSRA 1Y5XA 4HYWA 2AL1A 5AN7A 3F4WA 2RGLA 1UUOA 2Q01A 4NX5A 2F38A 2V0TA 3PY2A 2WZIA 3RR4A 4DNHA 5AVHA 1US2A 4HSOA 1VYPX 1NOWA 3CBWA 1TRDA 3M5ZA 1UKQA 2Y61A 1GNXA 3ARSA 2E4TA 3TOPA 3VIKA 1KWGA 1UR8A 2AOSA 1OD8A 1PE1A 3A3XA 3PULA 1TPH1 4AWTA 3QH2A 4EPKA 4GXPA 3W28A 4Y6GA 1PPIA 2WWCA 1LUCB 1PYMA 4KS0A 3VNYA 1CPUA 4AD4A 3P6LA 4NZFA 3C0JA 3WLKX 1RVKA 1G01A 2HXUA 3L68A 3LXBA 1VFHA 1W3JA 1IR1A 1AA1B 1ZHAA 1TX0A 1DP0A 2J9YA 2XH2A 3EOSA 3ZFHA 4PL2A 2C91A 2JF7A 5CBIA 5CZKA 3TTQA 1DXFA 3VKDA 3TSBA 1Q45A 4D8LA 3C56A 2LLEA 3BARA 1E5JA 4QE5A 3WCZA 1VS1A 1SW0A 4M19A 1XFCA 4IPLA 3P81A 2Z24A 3AIQA 3LHWA 4N4QA 5I6SA 4XTDA 4XZHA 5A6KA 4A8RA 3DXIA 1NEYA 3UA4A 3BUVA 5BWFA 4LJ3A 1QAPA 2A1YA 5D2VA 3PZUA 3IJ6A 4TX8A 1HJVA 5HXMA 2CHOA 1WUEA 4JFUA 3TXVA 4ATLA 3A6OA 4INFA 3V7PA 1BTCA 5IXEA 2E0PA 3PP7A 3WQ6A 4PB3A 1OFPA 4JKLA 1GVRA 2RDTA 3I6TA 2FZMA 3QLLA 4R5EA 4V28A 4GCXA 4ADSA 5IHSA 3VCRA 2XG9A 1TA3A 3I4KA 3LLFA 3FK4A 4GYKA 2YL8A 3HURA 1SSDA 4CD7A 3RCYA 4LCQA 2BLEA 2QVNA 3T0AA 1KA9F 1LF1A 1TG7A 4JHMA 2V9DA 4LUJA 1KCZA 1IEQA 3MCOA 3A3WA 2J7CA 4XSMA 4I7WA 4UFHA 1PTDA 3E3HA 4XBKA 1XF0A 2BOEX 3JU2A 4W8BA 4YYFA 2YBVA 1J2WA 3STGA 2XN2A 1PVNA 1XKJA 4UMBA 4IHCA 2PODA 8A3HA 5AYBA 5D03A 3W71A 1B1YA 1CXLA 4QROA 5DX7A 2OX1A 2H9AB 4NNAA 4D72A 2RDWA 4NZ4A 2J7GA 4DXVA 1MDRA 4RCXA 4X0NA 3M6YA 2HQAA 3SUSA 1PX8A 1YNPA 2D24A 4PBFA 3O9NA 4HHMA 4JY9A 1S5NA 4AYSA 2O9TA 4O17A 1BF2A 4Y90A 3GVRA 2DGAA 4Q8PA 1VGAA 2EEXA 2H6RA 5MKGA 4LW7A 1QRQA 3VINA 3H2CA 1KXTA 1K9FA 1SMAA 3ES7A 1F3XA 1M3UA 4M80A 1KGUA 4GI9A 4YS1A 4HSHA 5JH1A 4P8VA 3M07A 2WZTA 3CAVA 2X0YA 3PFRA 2XU2A 2DW7A 2YOCA 3H6OA 1TE6A 3GVGA 3TYBA 2VQTA 2V2HA 1IV8A 3CAWA 1AH0A 4MUZA 4US5A 4L65A 2QHAA 4PCFA 1SZNA 5L6UA 3H2NA 3S2CA 3UXKA 1E1CB 1SMDA 3P62A 4CNSA 3C2OA 2P3ZA 6CGTA 3EAUA 4GUFA 1XW8A 1M6JA 3E49A 1JXKA 2QCMA 1OCBA 5FJIA 2V8ZA 5KSWA 1S1RA 4L56A 2QV5A 5TIMA 1EL3A 2OSWA 1VFSA 3A4AA 3IIXA 2VHLA 4U3CA 8XIAA 4EF8A 5M3WA 4GQ0A 3WF2A 1R7OA 2ZDRA 4FNUA 5JBDA 3LLXA 3PPHA 1FWIC 2JKAA 4OHQA 3FGCA 4PZVA 6TAAA 2EG8A 2E6YA 1V77A 1B4EA 3UZ5A 3HMJG 3T07A 4KGLA 1PSCA 4UZSA 2NV1A 1S2VA 4QJ4B 1QASA 2VEFA 1JDEA 4CNOA 4LRSA 3DHFA 4NNBA 1BQGA 3UZXA 3GWQA 2QJGA 5AYZA 2C1GA 4J3VA 1OC6A 3NZRA 1QO2A 3F5JA 3SAZA 1WNOA 3VNDA 1E73M 4J5NA 3ONBA 3T9PA 5IBXC 1LWJA 4PSPA 3GXMA 3THDA 2WQDA 4IUOA 1XIJA 2Y6ZA 3M41A 5CC6A 5DRIA 1QO5A 5A6BD 3W6MA 1NOFA 4MWAE 4LYKA 4AZBA 2W27A 4PN2A 3I7SA 1MW0A 4UCFA 4DWDA 1W3IA 1Q7ZA 4QE4A 3UBPC 2CXGA 3GU2A 2CZVA 3P74A 4L6DA 1R30A 2WV8A 4R53A 1V6UA 2WNNA 1JUEA 4JTGA 5FESA 1XWYA 4J3ZA 3WF0A 1E4IA 4HSNA 1AQHA 5DMNA 1GVIA 4BI7A 3AUOA 2WZHA 1THFD 5CC3A 3GU9A 7ENLA 3GXPA 1E0TA 1IIHA 3E74A 4XD3A 4JQ2A 3AFBA 2C7FA 3CQHA 4IG2B 4WJ8A 5D37A 3GNDA 1DJHA 4UR8A 4NZCA 1J93A 4IIFA 1OBAA 3SQMA 3VNJA 4JTKA 3AXMA 5DCBA 2WAGA 2QJJA 2PU0A 1DBTA 1M41A 4KGJA 1UIOA 3GXIA 1H3GA 3GX9A 4JYEA 4RZBA 4GZIA 2VI0A 3NTYA 3MHUA 5BXTA 3K30A 5CGMA 3ARYA 2C13A 3TR2A 1KM6A 1ODUA 3ZLFA 4ECLA 3CZJA 1K03A 2E6AA 1XH2A 3BW3A 4I8DA 4FXSA 2ZUTA 5BROA 1GPFA 4S3AA 1C93A 2J8FA 2YB1A 2X40A 3DESA 3HA1A 1TCDA 3TZFA 3PZIA 1W37A 3U5UA 4RX0A 4U28A 4Z42C 3W7DA 3TTEA 4N2YA 5G2HA 5A8QA 4GJIA 3AJ7A 1MXSA 5I03A 1UQZA 2OU4A 1WP6A 5CCZA 3TP4A 4Z08A 3W7KA 4AIOA 3RLHA 1R2TA 4NF7A 3V5CA 3QQ1A 5LNWA 6PTDA 1GKQA 3WUBA 3SCNA 3PFMA 3FV9A 1RSCA 1AD1A 1WZMA 1EBGA 1ZALA 4N9BA 4MGGA 4NJKA 4HVXA 4CCCA 4LSBA 3CMJA 4CNPA 3SI9A 4UCGA 1GOWA 4UTTC 4NAEA 1DVJA 5FAGA 3T55A 5HMFA 5C9RA 3PR2A 3W29A 3EA2A 2OKOA 1VBRA 4GUJA 1ICQA 4K36A 4DLMA 1DKWA 3LCFA 1Z7AA 2WWDA 1XC6A 1KQZA 2E7FA 1H2JA 2PTZA 3T78A 4QCEA 3CUFA 4N9CA 5ABTA 3LZ3A 4D6DA 2NUXA 3W01A 1SVDA 1MEHA 2QJHA 3TOYA 4AZHA 1ALDA 2E68A 4HP5A 3OG2A 5I09A 1G9HA 2NX3A 3BGAA 4LC6A 2GGJA 4ENLA 2A6NA 4JN7A 4XZLX 2SFPA 1E70M 2HTMA 3VPLA 4GZEA 1VC4A 1KBIA 2V2DA 2TMDA 3P61A 3T8QA 4JXCA 4QJ1A 2X30A 3SB0A 1RXOB 3IGXA 4ZSTA 3UP8A 1XLEA 2QCEA 3OGVA 1NQKA 1VF8A 3UJSA 4O28A 3IRSA 1I1WA 2MUCA 3CYJA 3M0JA 1BQCA 3WENA 1MEWA 2NQLA 2P88A 4R85A 1XFBA 2VZSA 5JUVA 2Z7GA 2YZ5A 4A35A 2PRMA 1X97A 2CWNA 1UP0A 3P0WA 1MUMA 3AZTA 2CLMA 1H61A 3PB0A 1VP5A 3POCA 4PB5A 2QVHA 3T0DA 3B9OA 3E1F1 4LCSA 1ISYA 3HJEA 3IGSA 3DFYA 3VGFA 3DX5A 1FFRA 3B9AA 3HOJA 2NSOA 3U4AA 3OTRA 1BAGA 3VM5A 2VC9A 3CO4A 3NPWA 4NSBA 1DE5A 4M29A 2QAPA 1OX5A 4O1FA 3LPOA 1BD0A 1A3HA 2ZZ6A 1WDWA 2BDQA 2A3LA 2FYMA 3TXZA 1NTHA 2EQDA 4HU3A 3K5XA 4H83A 1DL3A 4O53A 1MXDA 1PTAA 1RCQA 4AYGA 4LU0A 3HQPA 3UY7A 5HANA 5CZ0A 3OHIA 4MKNA 1RA5A 2REQB 2C14A 2VRQA 3NL2A 5AY7A 1XDMA 2QMKA 3KL3A 1C29A 2J47A 4E0CA 3NOYA 4D6JA 4JHOA 1A5NC 1L6WA 2P5NA 1GQNA 1EIBA 2CW6A 2ZDSA 2W5FA 1S46A 1HF6A 2BVYA 4GWEA 3UU0A 5ECUA 4QAWA 4K1GA 2BODX 3G77A 1VCGA 2VEGA 3IK2A 1JR1A 3NCOA 1SU5A 4Y8EA 1PXGA 5A95A 1ZENA 1WBHA 1JD9A 2ZE3A 4H6KA 4CKQA 5C7HA 1VRDA 1VCVA 4RKAA 1SFSA 1WA3A 4QIUA 4P5UA 1J0YA 2IKJA 4KCVA 3WZ0E 3I3BA 3FJ6A 3EGJA 3W7NA 3FA5A 1Q5MA 2UY4A 4UTIA 4IL2A 3ZT7A 3UFYA 4WKHA 1GHSA 4E6MA 4Z2IA 3GFXA 5BRPA 3BAJA 3QOMA 3W6YA 2J6VA 1AZ2A 1OIFA 1KGWA 2W9MA 1FWWA 1UMYA 4HJFA 5H1WA 3IIZA 1C91A 2D2GA 4F4RA 5HQMA 4PTNA 2VEKA 4HOZA 2OO0A 4LVAA 1E3XA 3N4EA 3ANUA 2WKGA 3OZPA 1LYXA 1YPFA 1ISXA 4EXBA 5EBAA 2IXVA 1YTKA 2QV4A 2GK1B 3WNPA 1JG9A 2CC0A 1EB3A 3GKAA 2VR4A 3W1UA 1DJXA 3EKZA 4GBDA 4YL2A 1US0A 4WY0F 5HQEA 3ITGA 1VD6A 1XKYA 3SY8A 3TZNA 3VKKA 3B03A 3N2OA 3RJXA 3V0SA 3DC0A 1UH4A 3BTNA 3O7UA 4NYYA 4IPPA 3W7MA 3L0KA 1KCKA 4J7RA 1VZWA 1XPGA 1XIBA 3CIWA 2R1MA 5T9CE 3TW7A 1ITCA 4ZO9A 2R1PA 2CPUA 4F3HA 1NP2A 1TR1A 1JCTA 3VIGA 3C2EA 4NRRA 4KH2A 2ZUMA 4KIEA 1XSKA 4GY1A 1R9YA 2Y89A 3RUBL 2E5DA 4QLJA 4GYPA 3NURA 1P1XA 2QDHA 3WBXA 3IJIA 2OEJA 1P0BA 3M1ZA 5E0CA 4AMCA 7CGTA 1EWEA 2E40A 4OQVA 3DFPA 3NZQA 3IEBA 1UOZA 2P3EA 4DRSA 5E1QA 2Y88A 3EA1A 1KBKA 4L6OA 3ZT6A 3WJSA 3SUTA 3S2LA 1BYBA 3KX6A 2I5QA 1HZYA 1K9EA 3VNLA 4GC3A 4Y9OA 1TZ7A 1XLGA 4NKCA 1ZZMA 4HJWA 4IGMA 4MTVA 3P82A 4CNNA 1F4AA 1VIZA 1VFUA 2B81A 1XIEA 4UTLA 5A6TC 4RNIA 4GA8A 3WLLA 3AYTA 3QQ0A 3PC0A 2DZPA 4IFRA 3W2MA 1DIEA 3VD4A 3GVWA 5C9ZA 3TN6A 1S2AA 4G7EB 3HGJA 5TAOA 5C5YA 4M1BA 1GCYA 1JDFA 3GO2A 4UTFA 1KM4A 3CQ0A 1FOBA 1OK6A 4BK9A 3O05A 1FBAA 5AZ1A 4HCLA 4ZOEA 3I65A 1PKYA 2QIIA 4XZMX 4Q22A 1J11A 4Q4MA 1W5MA 2A85A 5CPLA 2PDFA 4IP4A 3UJRA 3VILA 2A7NA 3CL7A 2J27A 4F0RA 5K9DA 4Q32A 4S2BA 5DQPA 2VGFA 2J7HA 2WBKA 3EKGA 3JS3A 3N4FA 1UD2A 3ZVHB 4C5ZA 4HZ8A 1UWSA 3HN3A 1AW5A 2AKMA 2F9RA 4R88A 4C6DA 1E5NA 3BPWA 3KBVA 4DM2A 4K8HA 5D9MA 4EF9A 4I6KA 4KW2A 3STCA 1S3TC 5CPMA 1TX2A 4B3ZA 2ABAA 2VFEA 3LM3A 4OIFA 1FA2A 1A4LA 1POJA 3EOUA 4B4HA 4HNLA 3BCJA 4DZHA 1SFLA 2YFNA 1PZ3A 4OTKA 3STFA 5CPQA 3GY1A 3S6OA 1HL8A 1W9DM 2DJLA 1EYEA 4HT3A 4LVDA 1JQXA 3S5YA 1MYRA 1YXYA 3LHZA 1P48A 4FSAA 2ZUVA 2PBGA 2FB3A 4O8AA 2QCHA 1PEZA 3GDKA 1XRVA 4XWUA 1G5AA 4CCZA 5FF4A 3VIFA 1CGUA 1W31A 6XIAA 2PA6A 1ZBWA 2EAWA 2DH2A 2FMNA 4GUHA 2ZA1A 4RV3A 3SGUA 3TYEA 3GG0A 4QG6A 3OGRA 5TNVA 1RVGA 3RX3A 3IK4A 1EJTC 4YN5A 3VO0A 4Q4SA 1SSGA 1NF0A 4JCLA 3BCFA 5LA0A 3B8UA 3EXSA 2QDGA 5A8GA 3LOTA 3S3GA 3LCXA 5LA1A 5FA5A 1BRLA 3OZYA 3F2BA 4ACZA 3LTYA 4XV0A 3VKJA 1V3LA 2UBPC 4MFEA 3PJXA 3FXYA 2PTWA 1HKJA 1KXVA 1UR9A 4EAYA 1OFEA 1PKLA 3CEUA 4O19A 1OGGA 1PJ9A 1XV8A 1IEIA 4CD8A 3NM3A 4UQ9A 1EA9C 3K1GA 1W3KA 2G5WA 5CSRA 3EPOA 4DF0A 1VQTA 3TN4A 3WKZA 1UWIA 1A80A 1B3VA 3WUGA 2DSUA 5M1TA 2OEMA 3MCMA 1OFRA 2VURA 2R6OA 2O0TA 3LCHA 3BWWA 1QNPA 3T4CA 1B30A 3VCCA 4CVWA 1NAL1 4XD5A 1KKOA 1UWAA 4Q8MA 2TAAA 3S42A 1N2VA 3W0KA 3SY1A 1JCMP 2VD8A 3U3HA 4L1XA 4U3AA 3QGVA 3ZXWA 4UOZA 2MNRA 1TTPA 4DJDA 2AGTA 1RP9A 3AAMA 1ZJIA 3SCTA 2E6FA 2W92A 4ZTYA 4H8HA 1E0UA 4KEUA 5K7JA 3LSCA 4QAIA 3HPSA 1T0OA 4Z1DA 1B3YA 1MFUA 4AXNA 2TSYA 4G56A 1E6ZA 5FOOA 4Y9PA 3EDEA 2PURA 3SCVA 4MJ4A 1B54A 4HPXA 3CUHA 2NZLA 3KVLA 4K1WA 5E93A 2X05A 3W2UA 4Q4PA 4NAFA 3DGBA 3ZWTA 3LXCA 1XM3A 5A94A 3PTDA 5E9AA 4V27A 1P7TB 3BLOA 4U33A 4E4FA 3VK5A 1SO4A 2V67A 4D71A 4J3XA 3EWCA 3AC0A 3QHMA 1UD8A 4NY2A 3L2IA 3CIVA 4CGTA 3R89A 2EKGA 2XH7A 3N2XA 2ZX6A 2OPJA 3QHOA 3THUA 3OO2A 1F4HA 3G1HA 4V15A 3TKFA 3G22A 3CZKA 4C7DA 3BJTA 3NWRA 1KFBA 3DFHA 1TV7A 3BSHA 3MVIA 3II1A 3TC3A 1XINA 5I3IA 3WD4A 4UXDA 1TTQA 4AB4A 5K4ZA 2EF9A 5HNUA 2O4MA 4J2PA 2QLYA 3W75A 3W22A 5IHRA 3QGKC 2YW4A 3USBA 4O18A 1VEMA 3A24A 4PUMA 3GLCA 1EC7A 1JI2A 4IJRA 3S1XA 1EWDA 5T9BG 2FH8A 3UR7A 2O92A 3GU1A 2MANA 4W85A 1OFQA 1D7FA 1XX1A 1TPEA 1AJZA 3KCOA 1VLIA 3QY6A 4UTKA 4MLRA 5AHFA 4ZCWA 1BGAA 4R7OA 4V2XA 5AZ0A 3CL8A 1OJXA 4ZEPA 5AECA 1FHLA 4H6RA 3Q65A 1TYGA 2NSXA 4ZMGA 3NQMA 3U9IA 3WELA 4ERAA 1NP0A 1F9CA 4GABA 2B4GA 2WCAA 3MUY1 4Y96A 1IZJA 5CLWA 1V6WA 4M81A 2VX5A 4C6IA 1H5VA 4D8AA 3M5VA 1QU4A 3WG6A 3QVQA 3WH5A 4F9DA 4PH6A 3QR3A 4REQA 4I8YA 3CPGA 1RPXA 4ZGYA 3EOEA 2ALRA 1W1YA 4ZFCA 3NGFA 4I9JA 4D8ZA 5AC7A 4MYAA 3OLIA 1WXJA 4GLEA 2NV2A 4M5PA 4TMBA 3RAOA 3N6JA 4QE1A 3KOXA 1R3QA 3SIMA 3IUHA 5D8ZA 1DWIM 2GDQA 5CPOA 3MY9A 4RDWA 1Z9AA 4B5NA 1IT8A 3TUUA 2VT0A 4QFUA 3FNDA 1KLYA 4F8XA 1A47A 1RH9A 1R46A 5I2UA 4AD1A 3C4UA 2ZRZA 2PGWA 2OELA 3G1YA 4Y8FA 1ITUA 3PZTA 3KOFA 5T8GA 4NXSA 4CQDA 5FJRA 5T91A 2PGEA 2GSHA 2PU1A 3SQSA 4QTGA 1AMKA 3BOFA 5LIUX 3GNOA 2ZVIA 3VD5A 1KLZA 2Z2UA 1KGXA 3VM7A 4P7LA 4A22A 8TIMA 1EF2A 4GO8A 3SW6A 1XSJA 3FSTA 1A5CA 4Q8NA 5F2MA 1KFCA 3M0IA 4LUSA 3MDWA 1UA3A 1HGWA 5EBUA 3AS1A 3UXDA 4B2DD 1WDPA 3K4DA 4JOMA 1JYXA 3PBUA 3IV3A 1KBBA 1GEQA 1GKPA 3DDMA 4IJBA 1OT1A 3ZOAA 1VFTA 3R43A 3GR4A 3RR1A 4IH3A 1OK4A 2OG9A 5C70A 4C91A 2E1DA 4JY8A 2QCNA 1TJ1A 4GYPC 4NNCA 3DKLA 2CWXA 1I9CB 1BLIA 1EZWA 1Y7VA 4KWSA 4S3GA 3GG1A 4AIEA 2Q8XA 4UNIA 2QCDA 1AW1A 3IGHX 5FD0A 2DZVA 3UNDA 1UYQA 3WH8A 1LCOA 4XKYB 3UW6A 4POCA 2PB1A 5M2FX 4DY1A 3WEOA 3IAQA 2QUVA 2V3EA 4C1LA 4ZQOA 3WDQA 3UEQA 1U1HA 3VGBA 4L6HA 1E4LA 2VZVA 4QQUA 3W53A 4B9ZA 1OQFA 4WGXA 1PO9A 3VOCA 1A53A 5C9WA 3WQOA 3LCWA 4HOXA 3MANA 3N18A 1B9BA 1DQWA 4ZQPA 4TU1A 5HWJA 4NZ1A 5CGQA 4PSRA 1JF6A 4Z1CA 1SJDA 1JF5A 2QPXA 1Z89A 3TIMA 3B06A 2VENA 3H54A 3T4WA 2CLPA 2F7FA 3SJ3A 5E9XA 4TQTA 3WLJA 4GGBA 4IQDA 2VD9A 2FZNA 1JULA 2I5GA 5LGZA 3AOFA 4CQ8A 3FJLA 1X1NA 3MUAA 3NYZA 1UWTA 1CB7B 3EDDA 4TV5A 4MJ2A 4K3ZA 4NHVA 5G2IA 3M0MA 4H8NA 4C1NA 2WSQA 3P0XA 1ITQA 3CS2A 3MKCA 2DT3A 4HOWA 4N6EA 4DXKA 1JVNA 1UR4A 2XZ7A 4MY8A 4JR5A 4FXRA 2YL5A 5FIPA 2WKJA 1UPMB 4FNRA 2VWTA 3R25A 3LNMA 3S0CA 3TJIA 4WQ6A 1A49A 1D2KA 3LERA 4O0QA 4UTMA 1NELA 1HJWA 5FF3A 2GLKA 2KAUC 4M1RA 4TV6A 4WSHA 1JDDA 3TTYA 4HNOA 4IMCA 2UZ9A 3SDOA 3MHFA 3UPBA 2WPBA 1HVXA 1S1PA 2CHNA 3UCCA 2XFFA 2VDGA 3KL0A 4XTIA 2WB5A 4UTHA 4Z2JA 2GYIA 2VEPA 3WO8A 2GOKA 1UR0A 1M1BA 2NXIA 1L8PA 1PDZA 1ZAJA 1BVNP 1NH6A 2BVWA 3CHVA 1QWGA 4ACYA 4JFSA 1OX4A 1JAKA 1OYCA 1XQLA 4FNTA 2I1OA 3VE7A 4G5DA 3I7RA 3VXGA 2H9AA 2ZE0A 1G67A 1V4YA 2CESA 2G37A 5ABEA 4IIBA 4S3JA 1AQ0A 3N19B 2OWWA 3CIXA 1LG1A 1ZBKA 2WLYA 2OZ0A 4CCDA 5C9UA 3KHJA 3HG2A 3GFZA 3O6CA 2KX9A 3VABA 5F2GA 1PX3A 1V0KA 3MU7A 2J9XA 1FWNA 1Q6CA 4QITA 3A5VA 1Q85A 1WYIA 5F4XA 3BG3A 3BAKA 1YMYA 2A3AA 2HK1A 1KNWA 1YPIA 2X16A 2WMHA 5I07A 4AG0A 4G2DA 4PMVA 4H9ZA 3WLQA 2NVAA 2TODA 3EZ4A 3MC5A 1MMFA 3HBLA 2E8ZA 1QNSA 4KWOA 1UZDA 1C9WA 4MWAA 1OY0A 3F4VA 2A4AA 3G1XA 2CETA 4ZQMA 3HM7A 1RP8A 4L1GA 1E1CA 3I3DA 2V5BA 3N1AA 1YXCA 4A8NA 2QYGA 3NFUA 2ZFAA 1TPVA 1W5PA 3W7RA 3VTRA 2YDRA 3MS8A 2YL6A 2V5LA 1R2SA 1VENA 4H8VA 1XL9A 2AAAA 4CN1A 4DJDC 1MO0A 4JKKA 5D9NA 4O16A 2YA1A 2DUZA 1PIGA 4FXFA 2O9OA 3DOPA 1OGBA 3WMSA 2ZRYA 3GAKA 1DE6A 4AEEA 9XIMA 1O1ZA 2CIPA 4DF1A 3DYOA 4E2BA 1XBZA 4PTVA 2QJIA 2W67A 4E3VA 1KTCA 3EPNA 3KOYA 1H0GA 4B5WA 4DO5A 1N82A 3TW9A 4WDXA 4AD3A 4UQCA 4H01A 2OSYA 3U6WA 3MTWA 4PEKA 2NW0A 1DTNA 2PCQA 1V3MA 5GVJA 1MQQA 3H4XA 2DU2A 5EU9A 3MP4A 1X6NA 1HO4A 3C0LA 1FWSA 2V6AA 5G2WA 4UC5A 1BWVA 5HBFA 3AHYA 3NQCA 2WC3A 3L67A 4DUOA 1LT8A 2PF0A 1GTHA 1A5OC 3PBYA 2XFRA 3OP2A 1AH3A 3D6NA 4UWMA 3V75A 5DFAA 1QUMA 2QIWA 3APTA 4BJHA 3VGEA 4MAVA 3C2FA 2WNWA 2QGYA 2ON3A 3GDTA 2WSYA 2E25A 2Q3RA 3CYVA 2WO5A 4GIAA 4FOKA 2GSEA 1GJPA 4CU6A 3R0KA 4J2MA 4AFYA 4J3SA 5C6MA 3KRUA 4PA8A 3H53A 5D32A 3B0UX 4MMWA 3N3MA 2PDXA 1AJ0A 4PTWA 3GAYA 2DSWA 1LROA 1A4MA 1H5YA 1KM2A 2PWDA 4TXEA 4Z1BA 2P0IA 3ARQA 3M16A 2WMIA 2HE8A 1W9UA 3S2JA 1SZEA 2XSXA 5CAKA 3MV01 3R2GA 1CLKA 4AW7A 4HMCA 4WF7A 2XH4A 3FEMA 4G6CA 1GKRA 2WM1A 4WD0A 2VZTA 5MF5A 1AODA 2XHYA 3AXHA 2D73A 2D2OA 4AAJA 2GJXA 2HBXA 3HQNA 4JX6A 4WZHA 3HQOA 5BCAA 2J74A 4EACA 5C2GA 1IIGA 1TWIA 5CZSA 5GNXA 4GVHA 4XSLA 2G95A 1Q6LA 4W4QA 1ZCOA 4GYFA 5E0KA 1EC9A 3W84A 4BF7A 2XJ7A 3TN3A 4HHHA 2YGYA 2YXOA 4X2RA 4WDTA 1JCLA 3REQB 4HA3A 4QJ3B 5F2LA 3L12A 2VCCA 4HYVA 5CPNA 1GZJA 4I9AA 5D8WA 4E3TA 4HU4A 4O4WA 1TPC1 1DORA 3W74A 2IPWA 3TNOA 2GJRA 3ARXA 3W7CA 4ZQNA 4QNWA 1J5SA 2WVSA 2Y62A 3UZJA 4AF0B 3U5YA 3EB4A 2X42A 1E40A 1C90A 2PDKA 3TYAA 2YFOA 3MO7A 2DFAA 2XSBA 1K4HA 2EPOA 4MB5A 4ZQRA 5CXPA 2EXOA 3PBVA 4XAPA 2O7SA 4Q8QA 3NVDA 1W1ZA 3SJNA 4JTEA 1XLBA 3KS5A 1SJBA 4GMEA 4PFMA 2A2IA 1ZY9A 3ZJ6A 4Z0JA 3OA5A 3OYXA 1IEVA 5IDIA 2DVTA 1O68A 3VAVA 4O15A 1J10A 3N6HA 3NDZA 3P2VA 3MSYA 1SR0A 1WAWA 3IJ8A 1UC5A 1F8MA 4H4IA 1EP1A 4LEQA 2HK0A 3GG8A 1VBGA 4MY9A 4U4MA 5G4EA 2CHRA 3STEA 4DI9A 4CD5A 2ACSA 4J40A 4IFOA 1ZP4A 3ZZ1A 2I7GA 2PZNA 3L4UA 3A23A 3PSVA 3P5ZA 3R58A 4P8XA 3A9BA 4UQEA 4JIEA 4EANA 3LX9A 5LXXA 4I5UA 4A29A 3RN6A 1MQRA 4KRTA 4XB3A 3OVGA 2GUYA 4BA0A 3LUTA 1RBAA 1IEWA 1CX9A 4NX0A 1K9DA 1GJWA 5BOOA 4H2CA 1RBOB 1JL8A 3B8VA 3BE7A 1FH8A 3U0HA 2CKRA 3QSRA 4ILSA 5BOFA 1JDAA 1M68A 2X2GA 3M0ZA 4AZCB 2WJFA 2OLAA 4HN8A 3D5HA 2UWFA 1D8WA 1YLVA 4I6VA 1ESWA 4PCPA 3WH9A 5I3GA 2PF8A 4D6HA 4FLOA 1WXYA 2FFCA 3T0BA 2OFJA 1RCXB 1O6IA 3MCNA 4XO7A 4Y9MA 5C7VA 3WH6A 2D1ZA 2PFHA 3MB9A 4WOQA 2FTYA 1NVMA 3O63A 2D23A 1PCWA 3HQ1A 1Q63A 2C16A 1J18A 4M6PA 2DDXA 1O5KA 1KRCC 4C6JA 4ZOBA 4ML4A 2Q6ZA 3SCWA 3AI0A 3OU8A 1LTDA 1NQ6A 3NQBA 1CBGA 4H9YA 1E3ZA 3B9NA 4Z1AA 3CMFA 3MJYA 5EFDA 4B5UA 3MP5A 1V0MA 3A64A 4LYPA 1ZBVA 4KRZA 3OOQA 1KM5A 3PWAA 3VMPA 1VAHA 3R79A 4L4LA 1W8SA 3BO9A 4CEXC 4AEFA 1W17A 8RUCA 3THAA 4HHPA 3TC6A 3OHMB 2XTKA 2EPMX 4S3CA 4C6MA 3M43A 1UWRA 3GNXA 3CUIA 5MHBA 4B92A 5AB3A 4MZ8A 2DZUA 4J1OA 3TONA 3CO8A 3HMCA 2O7QA 1EEXA 4E4UA 2J4GA 2ANUA 2RAGA 4TVCA 3EDJA 4OGZA 1OWQA 5A2CA 2D69A 1AQFA 1I75A 1DJIA 4XO6A 3QOKA 1LOQA 1LJYA 1DIDA 3BMVA 4Y9NA 5DCDA 2I9UA 3B0XA 2G3IA 2PDYA 4O57A 3EKLA 4YPJA 2YBTA 4QJ5B 1EJUC 4LBUA 1BKHA 3ZIZA 5H8PA 3EXRA 4AISA 3UT0A 2YX0A 5BMXA 3W1MA 5AYIA 5FEXA 1NF7A 3ZYZA 1Q6EA 4S23A 4U2YA 4W89A 4OUIA 2NV9A 1E43A 1CXFA 1PWLA 1XLAA 2YYUA 2A3EA 4O12A 4NG3A 4J3UA 1J0ZA 3WLPA 1LQ0A 1TR9A 2PWGA 1ZTVA 1CGTA 1EPXA 1UUQA 5CH9A 3P80A 1OM0A 2OJPA 2BZNA 1CIUA 1CGYA 4Z0SA 2GK1A 3HJZA 1V3KA 1PCKA 5TBOA 1LL6A 1XR2A 4OVXA 4XD6A 4YMZA 3LRLA 1TZ9A 1NOUA 3MZNA 1D3HA 3G5EA 1NIUA 1I6NA 4MNMA 5XINA 2WHMA 4JNZA 1KRMA 5DMYA 2ZYFA 2DZBA 1QOXA 1TB3A 4GQBA 3WL0A 4GGHA 5G1YA 2ZVRA 4KCWA 2AL2B 2WANA 3MJMA 4L9XA 4F40A 1QI4A 3SSJA 4EXAA 2JKPA 3AXKA 5EMUA 2GPTA 3R8HA 1Z3NA 3WF3A 1S2CA 3HFTA 3NQVA 4QHRA 3M7WA 4RW5A 2ATSA 2Z1VA 3RK8A 3WMBA 2PE4A 1XGZA 2I16A 4NL1A 1JYWA 2J77A 3DC8A 1C9DA 1CCWB 1MNSA 2QKFA 3W6LA 2VR2A 4YHEA 4DLFA 5E70A 4AD2A 3SUVA 4MWAC 1E6XM 4C6EA 3OQ8A 3PNZA 3FHQA 1GPWA 1M7JA 1E0WA 1YBQB 2WLZA 4LXFA 2ICSA 2J78A 6A3HA 5J5DA 3AIEA 3A9IA 1IZCA 5AHMA 1EZ2A 3WN6A 3AJXA 1GEHA 3LHVA 2XIJA 4KCUA 1O5QA 3F7JA 3SZ8A 1F5ZA 1UR1A 1H7RA 1G1YA 1M9HA 2PP1A 4JGDA 3KLLA 4EXQA 3OYZA 1JZ4A 3WBEA 4S3EA 4OECA 4RJEA 4EWND 2R91A 2Z2AA 2IXUA 3QFWA 3UWZA 2PS2A 3PJWA 4PYSA 3VVGA 3KM8A 1AL7A 3UWVA 1ISZA 4PL1A 4G7EA 4L4OA 4GNJA 2HVOA 1QR7A 4RUBA 4LNCA 3IWPA 3GYEA 4ZE4A 4XBSA 4AH7A 2ZZ4A 3BLIA 3GVQA 1PL9A 4GVFA 5J04A 3WNNA 3R11A 4FEZA 4QLLA 1IXPA 3AMDA 3KCJA 2W4XA 2O9PA 4P7RA 1YQ2A 3B4UA 2C1HA 3F5LA 4OUEA 3TQVA 3WEMA 4H9MA 3C3UA 2Y2WA 4QM1A 1DJZA 1Q6GA 1FKXA 3B97A 4LBSA 4XISA 3ZVHA 3N11A 1KBLA 4K8GA 4BEUA 3B05A 1YKWA 2VFFA 3NUKA 1Z42A 3ATZA 3RDKA 1KB3A 3BK0A 3CUJA 4TTUA 1RV8A 4P8WA 1JGMA 1UKTA 3PG9A 1OFDA 2G41A 3OODA 4ZE5A 4L4PA 3NM1A 1OINA 4JNMA 3VZZA 1X38A 4C5YA 4US5D 2XIBA 4CQCA 3P5YA 2EHHA 4M56A 1XYCA 3WD0A 1RD5A 2PDUA 3GHTA 3TJXA 4DM1A 3MDUA 1UASA 1TJRA 3KVMA 3DERA 4J3WA 5D2WA 1B9ZA 1XYAA 4F2UA 2OXNA 3RJYA 2XVNA 3IVSA 4GHRA 2WVUA 5BMWA 2VTFA 3SRKA 5REQB 2VFHA 2A79A 3W1XA 3GDBA 2VGBA 3CQJA 4FI4A 1XGDA 4LAKA 1HJSA 2QUTA 3CT2A 3V1PA 3G8EA 3SM0A 4UOQA 5E0FA 4R7WA 2P1FA 3M0XA 4GNKB 3CASA 1QI2A 1JJKA 3KBMA 3BW4A 5LHFA 3VNMA 4I3GA 4CN4A 3O16A 1QATA 3QZ6A 2J25A 2ZOXA 3AXIA 3FDGA 2X1TA 5TD4A 2JGYA 3BW2A 3FJNA 3FXGA 1WUFA 2HS6A 3TQPA 3TTSA 3WK1A 1A50A 2ZXBA 4GPNA 2WW5A 3K4AA 2ESCA 1GONA 1GWJA 2OQLA 4W8AA 3LPFA 3B0VC 4JQ3A 3UXLA 1BG4A 2GSJA 2UY3A 4GUIA 1RR2A 2VR5A 1UR2A 2OOFA 4JTTA 3BDKA 3IV8A 5M5DA 3WD1A 4D6GA 1E0VA 3WQGA 3AMCA 1DQUA 4JIPA 3C6CA 5HNNA 1ZBCA 2E5BA 3ARRA 4LBRA 4CCEA 1F3EA 3WBWA 2QJMA 4JX4A 1T96A 4JQ1A 1XSIA 3KBJA 1JFHA 1G6CA 4GIYA 3MO4A 2A5HA 1W5NA 2G0WA 1BPLB 3C5QA 4PRRA 1B3ZA 1YW1A 3TR9A 1W6TA 2J8TA 1DEDA 5DN1A 5I3JA 3SADA 4B3LA 3W2LA 2FFIA 2NWRA 3PZ9A 2ONEA 3O6DA 1QOPA 2HJPA 3I6RA 1ONXA 4HMEA 5I3HA 3S8HA 6REQA 3W1NA 1HG3A 3R8GA 3K13A 1OG6A 4XKMA 2TPSA 1X1OA 2FGBA 4Q4KA 3O15A 4DBSA 5F4SA 2H3BA 1FCQA 3FS2A 3KUMA 3UD6A 1QNVA 4AHQA 1IF2A 3PVFA 2X0SA 4DAFA 3BLLA 2J6XA 3SIZA 3WLTA 2JK2A 2GGEA 2CLHA 2D2JA 4MAZA 4OFCA 5DMLA 5C9XA 3P14A 2RDXA 3UJEA 5I7GA 1EJ7L 2FHBA 3DFSA 4GCAA 2GVLA 4B5SA 3BURA 1QTWA 2FQIA 2E28A 5ENLA 3SRDA 2BHUA 2XSAA 3T2PA 1GOKA 1GOQA 1TMLA 3SCSA 1S3HA 2BGQA 1J96A 4UFMA 4F0LA 3WQWA 3POHA 3BV4A 4HPHA 2W66A 3A3HA 1CGWA 3PUGA 2R1LA 5DY3A 3WL1A 1XBVA 2FVMA 3T7VA 5CZTA 2B31A 2CLKA 5JVLA 3LTSA 4LV4A 4GQGA 4ZZ9A 3R7MA 1KTNA 2BTMA 3FDKA 3N9RA 2ODOA 3SRHA 2UY5A 1C7TA 4H1ZA 2EPNA 3WQPA 1J9YA 3VGHA 3GIQA 2PTDA 3S2MA 1CXHA 1P6WA 1UROA 4QSHA 3EWUA 2PP3A 1XGEA 2OOGA 1TWSA 1DWAM 7PTDA 4JQ4A 3QPZA 1EJXC 3GRIA 4ML9A 4DO7A 4YTUA 3LXAA 4JTAA 5DF0A 2AMXA 3H2FA 3WQEA 1B3XA 1PYFA 2Y4SA 3MBFA 4JIIX 3HTWA 1TFVA 2E1WA 1P6CA 4KEMA 2ZA2A 4S3KA 1HX0A 1OFAA 3U2EA 4IFKB 2PTYA 1H09A 3RM4A 1QPNA 3K8MA 2ABBA 2C3ZA 1ZNNA 1IXQA 4LRTA 2GJPA 3N25A 3GC5A 3PUOA 3COTA 4W84A 1UBPC 1NU5A 2I9EA 2QUUA 1E6NA 2Y85A 4E38A 1VPQA 3JRKA 4IIEA 4DI8A 4IQEA 1DWHM 2DP3A 4PMQA 1I4NA 3GH7A 1TJPA 3KBSA 2NQ5A 1VJZA 3FGCB 2W91A 3N34A 3WQVA 3KL5A 4C6FA 1YXDA 1GORA 1GVEA 3E9AA 5U7SA 4E4PA 1L2QA 1R3SA 2INEA 3CTLA 9CGTA 1UJPA 1EQCA 4A8IA 3BLPX 3V4BA 4GK8A 3IRDA 1IWBA 2ZXDA 2JBMA 5GNZA 2YLLA 2XFYA 4AWUA 4O1DA 4JEJA 2IUZA 4YWSA 4YHGA 1PTGA 4HU8A 4E2DA 1F05A 3CZGA 1GQKA 1IQ8A 2XGBA 5BXRA 2ISWA 3AHTA 1OF8A 2YZRA 4H04A 3G0UA 3TTOA 3APYA 1GZ1A 2DUXA 3TAKA 3HFYA 3FVMA 4MLJA 2FVKA 1BWLA 1FWGC 5LIKX 2W79A 1V93A 2PDQA 2OZ8A 3TSDA 1E4NA 1KWKA 1OCJA 3ZSTA 3GM8A 1LLZA 3VC6A 2Y8KA 4QISA 3R8RA 1XRTA 4O1AA 4AQLA 3WUEA 2VELA 4Z2HA 2Q3OA 3RRAA 3WIJA 5A6SA 3LGGA 3ZR6A 2WOQA 3L7RA 3MWCA 1CW2A 1UC4A 1QNRA 4ERGA 1JQVA 1H7XA 2XN0A 2FZ9A 3UERA 1WB0A 3NSXA 3NZGA 1UHVA 3BSMA 1JZ2A 1LZOA 2I14A 3W1RA 2QULA 3D3AA 1DIKA 1O60A 1CEOA 3AIBA 1JYNA 3ITYA 3FCPA 1FRBA 1U83A 4IL0A 1HJXA 2HV5A 3F03K 3ICJA 5LZLA 2IKHA 4JD4A 2QCFA 3HPAA 3KVJA 3MT1A 1OFOA 4JN6A 1GYLA 4IX0A 3NPVA 1D3CA 1D9EA 2NQZA 3MYOA 1JCYA 3C2RA 4AD0A 1EP3A 4ROQA 5I79A 2PD5A 2Y7DA 3BICA 3DG3A 3MYPA 5E6ZA 1SUXA 2BGNE 3I10A 3VU2A 1TUXA