1F07A

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
321
Chain Sequence
b'MKFGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDELSNGRATLGIGPGDKATFDALGIEWVKPVSTIRDAIAMMRTLLAGEKTESGAQLMGVKAVQEKIPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAAKIVVAFIAAGSPPPVFERHGLPADTGKKFGELLGKGDFGGAIGAVDDALMEAFSVVGTPDEFIPKIEALGEMGVTQYVAGSPIGPDKEKSIKLLGEVIASF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 117
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1f07A00
1NQKA 1YW1A 3B9OA 5AECA 1M41A 3B9NA 1NFPA 1RHCA 1XKJA 4J2PA 1BSLA 1FVPA 1Z69A 2I7GA 5LXEA 1BRLA 1BRLB 5DQPA 3RAOA 4US5D 4UWMA 3C8NA 1F07A 3SDOA 4US5A 3FGCA 3FGCB 3B4YA 2B81A 1LUCA 1TVLA 1EZWA 1LUCB
chains in the Genus database with same CATH superfamily
3PVFA 3UG3A 2ACQA 4E8CA 1A47A 3N3MA 3PZOA 4QLKA 4HK7A 3VD5A 3WJSA 5C2CA 3WZ0E 1XCWA 4FNUA 3EOUA 3Q45A 1W1B1 1I60A 2D1ZA 1XLBA 4IFOA 4UUIA 2QDEA 3BARA 2CFFA 1ZLPA 2YCJA 1XXXA 2OQLA 3PSVA 4XZ9A 5TQLA 4RZ5A 2OT0A 1T0OA 5DBUA 1KFLA 4D6CA 5KTLA 1OADA 3WF0A 1CB7B 3PP7A 5TD4A 1FCVA 5ABFA 1X1NA 4GIYA 2O4MA 4YLWA 4QEEA 1XQLA 4QG6A 4C6DA 2ZDRA 1LOLA 1PVNA 4KWUA 4NZFA 3MBDA 3ES8A 4N9EA 1HJWA 4GCAA 1GOMA 5HNUA 4HNOA 1XSKA 1A5MC 2ZRWA 2P8BA 3TZFA 1KCKA 3BW3A 1DJQA 3NR0A 3TVAA 5CPQA 1ME8A 5D30A 1U2YA 1PZ0A 4C6BA 4ZQNA 1E4LA 5E1QA 1R2RA 3GHSA 4GBUA 4GZ7A 4RW3A 1NWSA 4DBUA 1BF6A 3M43A 4QDWA 3W6MA 3OZMA 5LGXA 4XZLX 1E6QM 3M44A 4GI9A 4JTDA 3C56A 3GW3A 4Q32A 1OK4A 3V0UA 3IV8A 2PWHA 1VHNA 3G3DA 2QAPA 1M5WA 4PB3A 1BVWA 3NSMA 1P48A 1PHQA 4FO4A 2VUYA 1VP5A 1M1BA 3PHAA 2X7WA 5BXTA 1RJQA 2F6XA 4F9DA 3IK2A 3W75A 2VR2A 4GOAA 1X97A 3LI0A 5CSSA 3KRUA 4A2SA 3SQSA 1CGWA 1ZAIA 4AZ5A 1FWDC 1OIMA 2PGWA 4HYRA 3TOPA 3G1VA 1LRTA 3QW4B 3AI0A 2HPMA 3CLMA 4R3UA 4PB5A 1Q13A 4PBGA 2J62A 5CC5A 1TWZA 2VEGA 2EG7A 1RY0A 1HW6A 3QC0A 4IP4A 3RX3A 4NJIA 1W5PA 4RUBA 3PPFA 2W61A 1TE1A 1H2JA 1L8PA 1LWHA 7REQA 2MANA 4MG4A 1XV8A 3HIJA 1DJXA 4W7UA 4EVZA 3W86A 4BI5A 4FEZA 1VYPX 4ZA0A 1W56A 1D8CA 3GIPA 3SN1A 2OWCA 1UZDA 3A5FA 2E25A 3AXHA 1E4MM 3UJFA 1K8CA 1WKYA 5DT5A 5C7HA 1OGGA 2FPYA 4HPHA 5A8GA 5DMYA 3TFXA 4KPLA 4DM2A 1K1DA 1TX0A 2IKJA 2IMRA 4QBXA 5EGRA 1IWAA 3HO8A 2GDVA 2I5GA 2P76A 4IISA 2OG9A 1IT8A 4MTVA 2ZA1A 3H2AA 1CDGA 1GGOA 3AJXA 3KVLA 3RO8A 1CGTA 1HZYA 2WKLA 4KF1A 3VFLA 3A6OA 1PTAA 1H51A 4F40A 2CIPA 4Q7BA 2RDXA 4S38A 4GQBA 4IIHA 1RZMA 5A6MA 2QCDA 1ECQA 4R88A 1W1ZA 3BLLA 1UWTA 1ZQ5A 4PYSA 4MKSA 3UWVA 3EX6A 1JULA 2GYIA 5JXQA 1GHSA 3GIQA 4UC5A 2VD9A 1M7PA 4QAIA 4L9YA 1TUXA 1XLDA 1OF8A 4RZ4A 3II1A 2OGYA 2ZADA 2WVTA 4QITA 1WDDA 3QKZA 1ODUA 1EIXA 2GJPA 2YLLA 1SFTA 3UA3A 2X0SA 5CC3A 2OELA 5FSDC 3CLWA 5G2HA 4AWTA 5LIWX 1FHUA 1E55A 3FYPA 3HG2A 3BLDA 1UR8A 3HGOA 1J96A 5AC5A 4GUIA 2ZWZA 1EJXC 4JCLA 5C9WA 4Y8FA 3TYBA 1GKPA 1VJZA 5FJJA 3VIHA 4LUTA 4J7RA 4YHEA 4C1KA 1Q6RA 1UB3A 2NXHA 1TV3A 4C5YA 1SQ7A 3AUOA 3S3GA 3ANYA 4W93A 1XWYA 3T9PA 6XIAA 5A2AA 4NZJA 2A85A 5L9FA 4OOZA 3WX7A 1B3WA 1JDDA 2Y7FA 4G7FA 3VNKA 1YDOA 4LW7A 1KR0A 1YDNA 3GR7A 3KLLA 2RHGA 3O9NA 3VCCA 2WO5A 4ECLA 4U28A 3GZ3A 1W5NA 3H2MA 1MEIA 2NUXA 4XBSA 3PTQA 3UT0A 1QDSA 3BAIA 2INFA 3KWXA 3V5OA 1WXJA 5ABFB 1CTNA 3RJYA 5I3HA 1ODZA 5A6KA 2O4QA 1WV2A 1NP0A 2YW4A 2DORA 1H41A 5ECUA 3UYIA 1I1XA 1U5HA 1KRAC 2OTDA 2WNNA 2XSXA 3AIRA 3BCFA 2FTPA 1C90A 1E6RA 1A0EA 4NUWA 1R0MA 3QC3A 1EFZA 3P7YA 1BG9A 4W9TA 2GUUA 4ZE4A 4BA0A 1KGUA 3IPWA 4DPPA 2NQ5A 3MC5A 4O1AA 2H6RA 3RM9A 3ZR6A 4K39A 3RILA 3DESA 3U6WA 3W1UA 1PIFA 2R8WA 3V3WA 3B0UX 5F4XA 2BFGA 4LBUA 1TIMA 3EXRA 2F2HA 1GEQA 1ICSA 2G3IA 1H1NA 2OMAA 4PA8A 1Q85A 3VOGA 1GZ1A 1TYGA 5HINA 1ZJBA 3AU6A 5CZKA 3E96A 2OSYA 4NRRA 4LYRA 5T9BG 3NG3A 4QDMA 1XYCA 2OQYA 5DX7A 3CIWA 2W0UA 5E5CA 4QG9A 4AX7A 3V35A 3W38A 5GJNA 3W7DA 1KFBA 4PCFA 2JE8A 3ZJ6A 4I7VA 3TNBA 5HWMA 3AMLA 5C70A 3TJXA 4M1RA 1Q45A 1DJGA 2DT0A 4UR9A 4H8VA 4N4QA 1YDYA 1JCTA 1XP3A 1HL8A 1HQTA 1XIIA 3RLUA 3RRAA 3ALGA 3IJDA 4MOZA 4K8EA 1TG7A 4MAZA 2QW5A 3HQOA 1XC6A 2C1HA 4V27A 4ML9A 2ESCA 2VWTA 4BY3A 1UASA 4FMVA 1UQZA 2ODOA 6PTDA 3S6DA 4YYFA 1EYEA 3WQOA 2E6YA 3RRXA 1Q5MA 3SR7A 1XJBA 4AWSA 3N9RA 3BAWA 1E51A 3FXYA 2JGYA 4LX4A 7REQB 2OXNA 3UWWA 1F8IA 3GDRA 1VJSA 1VJIA 3PJUA 2Q01A 1W1YA 3HMJG 5D37A 2DUZA 1PTDA 3AMDA 2NQJA 3WO8A 2VNCA 1RR2A 1UUMA 2WSYA 3RPDA 1QW9A 4RX0A 2WWCA 1OX6A 2WWDA 3NQBA 1EP3A 1UJPA 1TTQA 4XD3A 4LYQA 4MYAA 4DI8A 4ZTXA 1RLDA 3LHWA 3B0PA 4X0VA 4DJEA 3B8TA 4GZEA 2WCAA 5AHIA 1YE4A 3C0LA 4IIFA 1LL6A 3QPYA 1M65A 5H2ZA 1UD5A 4L4PA 2D0FA 4CD6A 4S3AA 2XVLA 3SY8A 3MV01 1V3HA 3MP3A 1S5NA 3EWYA 3EMZA 2WJEA 3UNDA 1FWAC 1I45A 3OODA 4D6GA 4MPQA 3ZJ7A 1DIKA 4AZIA 1FHVA 4MVAA 2G96A 3B4UA 3W7MA 2WAGA 3TE9A 1AW1A 2QUUA 2QCDB 4PUMA 5EMUA 1DWHM 4Z0SA 4XAYA 4DX3A 3A21A 1EKOA 3Q94A 5JBEA 1R47A 3IVTA 4POCA 3RCNA 5LNUA 4B5TA 4ATDA 3STGA 4XAFA 1WX0A 3GDKA 1L2QA 3SO7A 5KZMA 4J27A 3TQKA 1YE6A 3PPCA 1JGIA 1A4LA 3KFTA 1HP4A 4H4IA 4WKFA 3VKDA 3MZ2A 3H2CA 4L7ZA 1PUDA 1PSCA 4GNJA 4L9XA 3E5BA 3DENA 2XH2A 3DC0A 5HPCA 1PKLA 3CHVA 2B81A 3BAXA 4LAKA 1FP8A 4HA4A 3GNOA 4JTFA 3VMOA 4B9YA 2QCMA 3WQFA 1WBJA 5KSWA 3ARQA 1EJSC 1W3TA 3NPXA 5JMUA 4LUTB 1OK6A 3LPGA 3MSRA 3QQ1A 1W5QA 3W84A 3W6LA 3EMQA 3ID7A 1UH3A 3TMLA 2AKMA 1E43A 2YOCA 2IKIA 2J7BA 4KW2A 1K70A 2J7DA 3I3EA 3ZJ8A 4UTUA 3UEQA 3V0SA 5CSRA 5D38A 3M46A 5LA0A 1SFJA 1SZFA 3BGAA 1VENA 3TNOA 1VCVA 4IIGA 2VVSA 1P1XA 3VNJA 4V28A 4NT0A 1KXQA 5F2MA 1W0MA 1BGGA 3AS0A 2PA6A 1XC4A 3GZAA 2YB4A 4Z2JA 3WQGA 4B5NA 1XM3A 3TROA 4C65A 3QW3A 3E2SA 4FF5A 1UKPA 3QFEA 1TO3A 4IH3A 4QSHA 1ELSA 5BOOA 1UKOA 3E2QA 2CC0A 2WHKA 3F03K 4C6EA 3GVWA 3BW2A 1V6YA 3ITTA 1VBRA 3KOWA 2HTMA 5DF0A 1KFCA 1EXBA 2FYMA 3FHAA 2ZRYA 1EC7A 8XIMA 3CAVA 3T2QA 1MQRA 2GK1A 1MXGA 3VD9A 4LVFA 3MWAA 4I7UA 1TVPA 2VGGA 4EAYA 1F76A 3QY8A 3N19B 1B30A 1F61A 3UWEA 4TO8A 2MUCA 2VKZG 3K2GA 3CZKA 2Z24A 3MB9A 3IGUA 1XYBA 1M7JA 4F0SA 5DRCA 3HOJA 4QIUA 1OFOA 3AAMA 3ARTA 3QFWA 2VEKA 1J0ZA 2W27A 3GXPA 1RV8A 2BVDA 2OQHA 2YL5A 3PZNA 4ZE5A 1RVKA 4M80A 1FH9A 4DN1A 4IFRA 3U2ZA 1HKKA 4HNVA 3W22A 3VNIA 1UIOA 2V5DA 1O1HA 2PBGA 4REQA 3RPMA 1JJKA 3AXXA 4MNKA 4B2DD 4WDTA 4QJ4B 3I65A 1R86A 1KBKA 1AODA 4O8RA 5KMYA 1S2UA 2PMQA 4UNLA 3S46A 3T4CA 3TP4A 3VOCA 2QDHA 1US3A 5CBJA 1Y5XA 2ON3A 3FKKA 3MUY1 4JNZA 2R82A 4IPIA 3LB0A 2PLJA 4K38A 1S2TA 4C6FA 1BTCA 3H2NA 3I68A 3NXLA 5FD0A 4NJKA 2NW0A 4D1JA 4D6DA 4FZIA 3U48A 1A80A 5E9AA 2WVUA 6CGTA 3VGFA 3M0VA 3I10A 3SCTA 3RHGA 1H61A 4OV4A 1KRBC 4ZB5A 3NCOA 3M4HA 3NJ3A 1CPUA 2PGEA 2ZUVA 3P74A 1ISYA 4I90A 4E3VA 1W2PA 2JEQA 3ITGA 4MNJA 4NNBA 5HPOA 3GFXA 3RLHA 2YGYA 5LGZA 1QNPA 3IJQA 5F7UA 2A7NA 3B3DA 3F5JA 4Z0JA 1XIMA 3QPZA 4HT3A 2XGBA 4AZ6A 4Y9AA 1XPYA 1CW2A 1FY6A 3LG3A 2Y62A 4PBFA 5BOEA 1D3HA 3S2LA 4K1GA 4HMNA 1XSIA 4WGXA 4A3UA 3PBYA 1W1VA 4L56A 1CB2A 1LM1A 2HRWA 4BF5A 3N6JA 2PC8A 4E4FA 3WY1A 1FOBA 4V1XA 4DO4A 3R89A 4FOKA 2PGFA 3FDKA 2JFEX 1QJWA 1GVQA 4ZOCA 5BOFA 1H11A 1QT1A 3DGBA 2EAWA 1SZGA 4D2JA 1BQGA 1VLIA 4TXEA 4G7EA 3F5LA 4O4VA 5IBXA 1DHPA 1V5XA 3BLOA 1Q7MA 3OB8A 2JALA 3APGA 4DLFA 4XIMA 1CX9A 4Z08A 5BMXA 3RGTA 4HCHA 4WJ8A 2WPBA 1RD5A 1QOPA 3SN0A 2QS8A 3VM7A 1QI5A 1R7AA 1O12A 3E6EA 1THFD 2PE4A 3TDFA 1Z9AA 1TJ2A 1G5AA 2HK0A 3MDWA 3R13A 3LZ3A 4KRTA 5AHNA 3GKAA 3V1PA 3EEZA 1OZMA 1VZWA 3WF3A 2O9TA 4P7LA 4B3LA 4C7FA 2E8ZA 3HG4A 1A5AA 4XKMA 2UBPC 3BJFA 1E4IA 3PUEA 1XLCA 4CU8A 3HGSA 1QPNA 4LNCA 4UTIA 3OLGA 4JGDA 3DU0A 5HOSA 1UWSA 5EMMA 1EX5A 2FH8A 2A3HA 1F6KA 1Z6KA 3ITCA 5T26A 2P50A 5XIMA 3TLQA 4BF7A 1ZTVA 1D7KA 2DZXA 3C3UA 2VX5A 4LUSA 2WMJA 1J0IA 3CQ0A 4KGLA 5GJMA 1CECA 4V15A 1NWTA 4QEHA 4F48A 1M68A 3P67A 3E9AA 3S1VA 4G1KA 3NYDA 1WP6A 2AQOA 2Z2AA 3RU8X 3W2LA 4ZMGA 3IGHX 1V3KA 2J8TA 1KC7A 3W7QA 1AZ2A 3WD1A 3QTPA 4LXFA 3PB2A 2B31A 4LANA 3EB4A 1VBHA 3MP4A 2Y89A 4M7SA 1DHKA 5A69A 2PODA 5I3FA 4WRHA 4JKMA 2PF0A 4QISA 4FNRA 1Z8AA 3OZOA 3L67A 4PFMA 3G22A 2PTYA 3ABXA 3VAVA 2WM1A 1PJ9A 2P88A 1OHLA 4DYKA 3KHJA 1E72M 3IUIA 5U4NA 3SBFA 4OUIA 4L65A 4NF7A 2YDAA 1EYWA 1EHAA 5MKGA 2BDQA 3MS8A 3CMJA 2O0TA 2GK1B 1QTWA 1W3LA 2X0YA 1H0IA 5HATA 4Q8PA 4HN4A 4IXXA 1GVFA 2C71A 2WCGA 5HMEA 3BO9A 4Z2KA 1TPFA 4E38A 2BOEX 4H2CA 1PXGA 3N2BA 2KZHA 4IPJA 4GVGA 4ZODA 1O1ZA 4F2BA 1B57A 1V3MA 1H7WA 3PWAA 9XIMA 1NDWA 4AG0A 4PMZA 1MNSA 3CIVA 3OOQA 3ZVIA 2Y1HA 1V7YA 3WUEA 4JTJA 5IHSA 3N15A 2FZDA 1H7XA 1VFTA 3HGRA 3RXZA 1YHTA 3GM8A 2VZOA 2DSWA 1JD7A 4REQB 5D2WA 2ZRUA 3NA8A 3I7RA 2DUAA 3AHXA 4L80A 3GHTA 3C2YA 1FWSA 2Q02A 5BCAA 4W7VA 1M41A 4INFA 4B3KA 4V33A 1RHCA 1HGWA 1QNRA 3UBPC 3H26A 3OHIA 2RH9A 1QI3A 4H9YA 1EX1A 3KL3A 1WOBA 1ZNNA 1U5JA 4DJFA 1V0MA 3ZT7A 6TIMA 3VKCA 1JAEA 2L5HA 4U5IA 4NXSA 4XUGA 2W62A 3PTDA 3BSMA 3H4WA 4O0QA 3UY7A 1D2KA 4PMUA 1V0NA 3RCYA 1H3GA 3CUHA 2EG8A 4BWLA 4HYVA 3SCNA 1JZ2A 2GJLA 4WKAA 2WHLA 2ZUWA 1ADDA 2B7QA 2ZE0A 1NY1A 1E5JA 2J47A 5I24A 1DIOA 3OLDA 1M9HA 3SCRA 2VOTA 4UFJA 4NZCA 4A22A 1ISXA 4RXFA 4AY1A 1UR1A 3UF9A 4DBSA 3A3XA 7PTDA 3OYXA 1A5KC 3B9DA 3UG8A 1Q6DA 4F0LA 3WL0A 2V5LA 3WBWA 1D3GA 4P5UA 5G1TA 5J5DA 3GKFA 4K6AA 3QYQA 4G7EB 6A3HA 2QUMA 4HGXA 1UZHA 1BG4A 3W74A 1TV7A 4BF9A 4RDWA 2DT3A 4LVGA 4FOJA 3WNPA 3PAJA 3UPBA 3BURA 3A24A 3KBVA 3MW7A 4X3ZA 3RLGA 3BQ5A 3O6DA 1VFSA 1LWIA 4C5ZA 4P8UA 1NTHA 3GNRA 4B90A 2E1DA 3LLXA 2QPXA 5BRBA 2G3FA 1BKSA 3QZEA 1JZ7A 4ATLA 3F4DA 5XIAA 4PTWA 3ZXWA 4DF1A 1GTEA 2OSWA 3SCOA 3B9NA 7XIMA 2NX9A 2YCKX 3TR2A 1DJNA 4JTEA 3GSMA 3DI0A 5FJIA 4JTCA 4EXBA 1B90A 4M8UA 2D20A 2V3DA 2GVYA 3T8QA 4E8DA 4HHLA 2C0HA 4W8AA 2XJ7A 3B8IA 3M64A 3SRFA 1K7FA 1MW0A 3WEMA 2OZ0A 4ICMA 4LUSB 3CH0A 4WIWA 1WBHA 3LTYA 1FTXA 5D2VA 2ISFA 4D6JA 5FKYA 4YL2A 4IMAA 3EA2A 4DNMA 2W6RA 3A22A 3BWWA 5T91A 1EDTA 1N8IA 4J3SA 4FX8A 3K8MA 4BR1A 1KBLA 3I6RA 3QV9A 1XGDA 1JIBA 4GABA 2GSHA 4JL2A 2PDNA 2X8RA 2WM0A 2XN0A 1MDRA 1EJUC 5I09A 3CZJA 3BOLA 4JFWA 4ADTA 2EO7A 3GLCA 4DRSA 2P0OA 5K7JA 3WD3A 3VU2A 1JAKA 3HURA 3O3RA 2Y5EA 5AZ0A 3SDOA 2W92A 3K8LA 1DXEA 3N2XA 2GQ9A 2XSBA 3F4CA 2QUTA 4CQ9A 5MKGB 1HF6A 1TMLA 4RDVA 3GS6A 2VX4A 4DEFA 4HU3A 4QCEA 3UXDA 1AW5A 2G97A 4WJXA 3PWGA 4GQRA 5FEPA 3L9CA 1DJWA 1Y5WA 1K9TA 1RK5A 3MI2A 4RNIA 2O56A 3VDGA 3MUXA 3C86A 4JTTA 4U2YA 5DBTA 3EOOA 3SGZA 2DT2A 3FEQA 3DFYA 4B5WA 1GUVA 3WLQA 3PUOA 1AH3A 4JQ2A 2QHAA 1WZAA 3UWQA 2J9ZA 1SO6A 3MYOA 2EPLX 8XIAA 3LTPA 4N0RA 1V6WA 3H55A 1XLFA 2I56A 3SSJA 3TONA 3ZVHA 2CETA 4MGGA 4QP0A 1WQ5A 3TZNA 1OX5A 4IIDA 4P8VA 4CU7A 5JU6A 2HISA 4JIHA 4PE8A 4XAZA 3NGFA 1MZHA 3TXVA 3WLHA 3ZLFA 1O6IA 2E6AA 1QBBA 5T8GA 3L66A 3PJTA 3WUBA 1J0YA 2F7FA 3G6MA 4B91A 5B7YA 2WMFA 3CUFA 4CN4A 3WNOA 3EOSA 2CLHA 1XUZA 1BVNP 4UTKA 3TJLA 3NQEA 4F0HA 4HU8A 3E0VA 3CV6A 3LXBA 5CPNA 2PDJA 2VGFA 3AS3A 3KHDA 1C7SA 1IZKA 4DUOA 2OZ3A 3UR7A 1JF5A 3MJMA 2XVGA 4DAIA 3W25A 3TW7A 3E0IA 1E1EA 1OCBA 3SECA 5I07A 2DGAA 3OO2A 4N02A 3UZWA 2QMJA 4ZBCA 1DWFM 2G3JA 4A29A 2ASHA 3SAZA 4UBPC 2VENA 1Q7ZA 3N2CA 4Y9NA 2BV9A 2HWGA 4MF4A 4WR3A 1TWIA 4AD4A 5A6TC 2OX1A 4MDPA 4OKDA 4PTNA 2YL9A 5FF0A 3M41A 3WF4A 2QF7A 2J79A 1TV2A 4KGJA 1FWIC 3W71A 4D8LA 2FGZA 3LDVA 1LQ2A 3FX4A 4FLOA 1GEHA 4ZFMA 3RM4A 1KWKA 3L4YA 4AD0A 1G4PA 1P6CA 1FXQA 4YWSA 3KM8A 1OYCA 1OVDA 4QNEA 1HO1A 1KR1A 3GNPA 1QPRA 4TV6A 1NOFA 4CNNA 5LIXX 5G2WA 5CAHA 4M19A 3UJEA 3TWAA 4JCMA 2CHNA 3URBA 2EPNA 1PZ3A 1UOZA 4WDXA 1WZKA 1K7XA 1UWAA 2UY5A 2QDDA 4UZUA 1R3TA 4EPKA 1SW0A 1B54A 3TV8A 1TTJA 1Q6OA 1EBHA 3SGUA 4J3WA 1BKHA 2ISWA 4IG2A 4GUJA 3ABRA 3BGJA 1OFPA 2A3BA 1KGXA 5LIYX 4XQ6A 1KM2A 3P81A 4UTWA 3TQ0A 4ZQRA 3MYPA 4WXYA 4GQ0A 1VFUA 1WXZA 1ZAJA 2CNCA 1WYIA 4UNIA 1UD4A 3DBNA 3GYCA 3HQNA 2DQWA 4ZZ9A 4BJHA 3C61A 4I5UA 2CBIA 2GZXA 3AQUA 1POJA 4OTKA 4ROPA 3F1QA 1ZALA 4KEUA 1W9BM 3WH5A 1Q6GA 1LOSA 4O19A 2VQTA 4NNAA 4PUJA 1GZJA 2ZTJA 5FCZA 1UR0A 1JPDX 2DIKA 3AISA 5D02A 2REQA 1ZGDA 1MRAA 4C6PA 4A21A 3CYVA 3FV9A 5I06A 1TV4A 1HJQA 4FS9A 2NUWA 4Q3MA 1IWBA 4MIMA 4FLSA 3A3HA 2Y85A 4GI8A 1FWNA 1C8QA 4AZHA 4TTUA 2OWWA 3RX4A 3VKJA 5AFDA 3IIVA 4ZOBA 1GYNA 1SSGA 5DEZA 4UZSA 1J0HA 5FJTA 4IP7A 4EACA 3T55A 4PTMA 3S5YA 3URNA 4HMCA 3VGBA 1O5XA 3LQLA 3VDBA 3G1FA 3W28A 4Q4KA 1JDAA 5LA1A 5CH9A 2HVOA 2RFGA 3HPSA 1FDYA 4DXXA 4G2DA 5HJLA 3T08A 1JFHA 4E2OA 3IIZA 3G1RA 5MF5A 1V79A 1UYQA 1GQNA 1E71M 3SQMA 1ITUA 2R14A 4UCGA 4QJ5B 4G5DA 4IWWA 3B8SA 5DCDA 1CGUA 2YFOA 3GXIA 2ZOXA 1DIDA 1LORA 1GG0A 1KQYA 2DQXA 1I2OA 4JOMA 4MB1A 4ORIA 4AZGA 4O18A 3WQWA 3PUGA 1KWGA 1G1YA 3GU2A 5CLTA 5D05A 3L4XA 3STCA 3WCZA 3FVMA 2E68A 1S2CA 5PTDA 2UY3A 2GGHA 3BLPX 2YPIA 4WDUA 3QOKA 4U3CA 2WZHA 1JPKA 3GDBA 3AYSA 3QV7A 1UIPA 1UA7A 3GBDA 3IUDA 4NXKA 2ZRXA 1O95A 3VK5A 3ZVHB 4KBXA 6TAAA 1PE1A 4PMNA 4BQ4A 3MANA 3MZNA 1JCYA 3QEZA 2QF8A 5DXXA 2YL8A 4QCFA 1CXLA 2J7GA 1JCMP 5MHBA 4HTBA 3STPA 4I9JA 2O9PA 2IPWA 3CUIA 4UTTA 4N6EA 7CGTA 4NIRA 1TPVA 2DU2A 4H8HA 3VGDA 3L0KA 1AJZA 4H8UA 2DV0A 1J6OA 4WX2A 2E7FA 1OJXA 4HJWA 1FH8A 3IJ6A 3OU8A 2HK1A 5CGMA 3W07A 1SW3A 3OBEA 3U7VA 3MHFA 3VA8A 1EDGA 4QQUA 2OO0A 3LXAA 4XVDA 5FJUA 1E9YB 1XCXA 1Q6LA 5EA9A 4O1CA 1OBAA 5E6ZA 2FDSA 2GSEA 1PV8A 3UXKA 3WQ6A 4GNVA 2CLIA 3W26A 1PYMA 4KESA 3EWCA 4AHOA 3WLJA 1JF6A 1DTNA 4D9PA 1LJYA 1E0VA 1PX8A 1GYMA 2ISSA 3I4KA 1YPIA 1DE5A 2V3GA 2OODA 1JUBA 3WF1A 2OYKA 3NUKA 1AUSL 1SR9A 3S42A 4ICCX 1IIGA 3DOPA 1SW7A 1V8EA 4ML4A 2V81A 1QI0A 3FGCA 4MUZA 2ZZ2A 3AIWA 1KFWA 1MSSA 4JTKA 1UR4A 2D24A 1P0EA 6XIMA 3ZR5A 4DWSC 5FF3A 3HA1A 5I3JA 3FJ6A 1VH7A 1PIGA 3QZAA 1SZEA 4M0XA 3HG5A 4BS0A 4M3PA 4GZIA 4WHBA 3QGAC 4XZBA 1U1HA 1NVMA 2BBFA 2ZX7A 3O63A 2Y7EA 1QOXA 2OEMA 5LKYA 2J13A 5A8QA 2YDRA 1R3SA 3A9IA 2ALRA 3A47A 1BWVA 1S1RA 2FTWA 3VIMA 1GVYA 4OT7A 1TPB1 2OLAA 4XX6A 3ABQA 3QLLA 4ZENA 5EMKA 1JL8A 1TQXA 1XYZA 5CKSA 3TSMA 1VCGA 4RLIA 2A5HA 5KITA 3TSDA 3VNMA 4HTYA 2F2KA 5C8BB 1OFRA 2XFWA 3QZ6A 2E8YA 1SU5A 3J7HA 1E40A 1GPWA 1ZCOA 5CPMA 2OYLA 1OYAA 3MI3A 1WB0A 1BGAA 1P43A 4LY4A 4JNMA 3WDHA 3N17A 1VFOA 2GGJA 4O12A 3VCNA 4J3TA 1J8VA 1DPMA 3NDOA 1F4AA 3TKFA 1YKWA 3ARYA 3N25A 1KXVA 2PP3A 3AIUA 1W8SA 4TU1A 2Y4SA 4LH8A 1D9EA 1PO9A 1X96A 1RPXA 4B92A 1BF2A 1XG4A 4QJ3B 5TNVA 5D4YA 3WLMA 1H7PA 2YLAA 4B3ZA 2D0HA 4DAFA 1I2PA 5CZJA 5AHLA 3VIIA 4S3BA 1S3TC 2VURA 1IXQA 3JVAA 2REQB 4LAOA 3WBAA 1B9ZA 3BG5A 4J2PA 1SMDA 2NLIA 3VTRA 2DZPA 4I8DA 4JDBA 2NUYA 2JIWA 2VJXA 1C8VA 4DXKA 1TR1A 2OGJA 4Q4MA 1TMQA 2ZX5A 5AYZA 1UC5A 3Q67A 4QFUA 1FHLA 4GISA 4DM1A 1K9DA 4AXNA 4F3HA 5ABHA 4NX0A 4FP1A 2VD8A 3HFYA 1DVJA 5C0QA 4ZSTA 1WE5A 3VMNA 3WENA 5H91A 5C5YA 1ZPTA 3W2JA 3AICA 1V02E 1DEDA 2AOSA 5RUBA 5E09A 1B5TA 1KLYA 1A0DA 1A5CA 1UHVA 3RMEA 4GXWA 4HU0A 1E9ZB 1XINA 3IJIA 2IQTA 4CNTA 3N2OA 4J3UA 5TAOA 1IIHA 5FEZA 4CQCA 5CC6A 4ZO9A 4H01A 3MHGA 1NOWA 1S5VA 3I6TA 4ZQPA 1G4SA 5E0KA 9XIAA 1G67A 2EXOA 4QX4A 1I2QA 5A94A 4XIAA 4H04A 2XFFA 1SM9A 4HNCA 3KBMA 5J5RA 4BI6A 3QSRA 1SO3A 1W32A 3E0LA 4HCLA 4KWVA 3MKKA 4G8TA 1KD0A 5BWAA 1F74A 1KCXA 1JXKA 4IZGA 3MI6A 4NYUA 3VE9A 2J27A 4IL2A 1V0LA 4O57A 1GK8A 1ZBKA 3FEMA 3CXOA 1S5MA 1W17A 3WNNA 2A7PA 2E9MA 2DH3A 4R7WA 1I0BA 4H6QA 4MJ4A 5LXEA 4HZMA 1DBTA 3USZA 1XDLA 1MW2A 2OU4A 2DPEA 1FDJA 5HJYA 3S1GA 3VMPA 7TAAA 3F2BA 2UV8G 5AY7A 2I5QA 1WA3A 4H7CA 3PULA 3PBVA 4J3XA 1EP1A 5EFDA 5H8PA 3CB8A 3PBGA 5FIPA 4XKYA 2ZUMA 2VZVA 4D8ZA 3VZYA 1V93A 1XQKA 2KX9A 4QM1A 1ICQA 4K68A 1GVSA 1V03A 4JEQA 4LAMA 4MNMA 5D2XA 3A9BA 3IVUA 1RQEA 4MKVA 3M9YA 1ZJIA 1HXJA 5ABTA 5A6BD 1XIHA 1N8WA 2ISDA 1ICPA 3DBPA 4UMCA 1N55A 5BNKA 4H3DA 2J77A 4ZGYA 2OZTA 2Y8UA 3WLKX 2FVLA 3UESA 2QVNA 4LYPA 2FH6A 2XHYA 3K1DA 3M7WA 2WC4A 3FGCB 4J4KA 2JIEA 3M0MA 1GT8A 4AYGA 3JU2A 2PUZA 4XO7A 4AX6A 3B8UA 1K6WA 4Z42C 2GQ3A 3PBMA 2I5IA 3BUVA 4FHAA 2V38A 1F2JA 3HMCA 3I4EA 4Z1CA 2G4JA 4RXGA 1FWGC 4BKNA 3LCWA 1DJYA 1MFVA 3OGSA 5HNRA 2ALDA 4DZIA 1T96A 2Q71A 4R9OA 3WLOA 2B4GA 5HBFA 7A3HA 1HUVA 3U3HA 2NQHA 1JDCA 3GWQA 3OVGA 2JEPA 4ORMA 4PMXA 3AUJA 1ME9A 2XZ7A 3NOEA 1MQQA 1CLKA 1RPKA 1E56A 1QASA 1JD9A 4J3VA 1C91A 3VIGA 4LQ1A 5I23A 3HB9A 3P5ZA 3CAWA 5CSYA 1VRDA 1CBGA 3DYOA 2A7RA 3OHMB 2OOFA 2CHOA 3OLIA 3QXBA 5JIPA 1G7VA 2IPJA 2WZIA 4QQ3A 3RCMA 2V2CA 1QI4A 4FXRA 4C6QA 1YQ2A 3WK2A 2BMBA 5JVLA 3A4WA 4Y96A 4XB3A 2YW3A 5A3HA 1BQCA 1KKOA 2RAGA 2XIOA 1EUNA 4PMJA 3CWHA 5LZLA 2R6OA 3BPWA 3KVKA 1P1MA 5K2ZA 5AZ1A 3OP2A 4GYKA 3HG3A 1GONA 3NDZA 4N7QA 3VNYA 1GVEA 1SMAA 2VC5A 3NFUA 4PCNA 4LV4A 5I3KA 3NTYA 1FDZA 3E49A 1XFBA 4YTUA 3AHZA 1BWLA 4I9MA 2FVMA 3T07A 4WZHA 4H00A 3K13A 4DHGA 3BJTA 3U2EA 3OIHA 2QUVA 3WDQA 3EXTA 4MB4A 3HTWA 5J8LA 4L9ZA 1CLVA 2VRQA 1GCYA 3POCA 3TLLA 3KL5A 3B0VC 4MWAB 4JPGA 4H9TA 3GK0A 2VCCA 3V0TA 3FLUA 3PZVA 2HNEA 3VNZA 3HFTA 3CT7A 1WKFA 4K2SA 4C6OA 4ZB0A 5BYWA 5EBUA 4XUYA 3HPXA 4O17A 4B2DA 3CB3A 3PF3A 2EF9A 5FAGA 4Q8TA 3DC8A 3B4YA 1MFUA 2W67A 3H7VA 1FP9A 1G4EA 1EQPA 2DVXA 2EKCA 5F4SA 4L6OA 4MAVA 4XAGA 1EWEA 1L2UA 2OEJA 1OT1A 3LPOA 3VDAA 5C9ZA 2A1YA 1IYXA 5EMJA 4H1ZA 1JDFA 2XG9A 2CITA 3G0SA 4H8NA 3PK7A 4LAZA 1ZZMA 3SY5A 3WBYA 1AZ1A 2O9RA 5B7ZA 1NFPA 2DW7A 1DQWA 3JR2A 3D5HA 5DMLA 3ABZA 3L2MA 2J4GA 2XVNA 4MWAE 5K4XA 5D09A 4I5RA 2OJPA 1NEYA 1FH7A 4W8LA 1KBIA 4D6FA 2E67A 1JRBA 3CQJA 1HN1A 4L1WA 2ZXDA 3CUJA 3P2VA 3AWNA 1VRXA 4GMEA 1J6PA 1B3OA 1TWSA 2ZZ4A 1LTDA 2Q09A 1RAKA 3RM8A 4UFLA 5HMDA 4AQLA 5EMYA 2GGEA 5DANA 3QSTA 4WSHA 4O11A 3U57A 1JCXA 1K3UA 1X6UA 3QMTA 4R7OA 4GXMA 3QYSA 2PU1A 1TB3A 1RALA 1RUSA 1HT6A 1E73M 1ZBWA 1FCBA 1YADA 2KAUC 2VC6A 3T0DA 3SRDA 4QAWA 3LRMA 3NPWA 4RE3A 5KINA 1E6ZA 3VM5A 3LV6A 2GGIA 3GDMA 3P5YA 4MHBA 3H4XA 1LUCB 4V2XA 2ABAA 3B9OA 4H6RA 2XFRA 1BD0A 4JD4A 3G0XA 4NZ1A 3WK0A 4MJ2A 3C8FA 1HJXA 3AS2A 1RCOB 1PDYA 4JN6A 4DWSD 1QPQA 2HE5A 2PDUA 1OGSA 3ALFA 2P53A 2PDWA 2HEJA 4GH1A 2OT1A 1M7XA 1UKTA 2GPTA 4P7RA 4O8AA 1A5UA 2AAAA 1KA9F 2ZX6A 3PJXA 4KEZA 1TWDA 3BXWA 4X60A 1L0PA 2CLMA 3UXLA 4BCEA 1EF3A 3NURA 4XSMA 2QGHA 4JY8A 4PMRA 4DO7A 4HYWA 1VGAA 4YTQA 4GUHA 2WKJA 3H7RA 4AC7C 3M6DA 1NQKA 1T8XA 3A13A 3MVIA 3KW3A 3B03A 1QHOA 2VZSA 3LCXA 2ZX8A 2Z00A 3LBCA 2EQDA 1ZS2A 2A0NA 1TPWA 1V3JA 2H8ZA 2C8NA 2PP0A 4F0MA 1W3HA 5EKYA 1JZ6A 2XSAA 3LGEA 3FJ4A 3S5ZA 3UY8A 2DZWA 2X1IA 4L5ZA 3O06A 4GY7A 4GX9A 3IIOA 1VFLA 3W83A 1RA0A 4B15A 2PBOA 3BC9A 1JGMA 3R10A 3S4TA 9RUBA 1RJPA 1CZ1A 4YCPA 2P1FA 3LCGA 2TPSA 1XPGA 5REQA 1GW1A 1AJ2A 2VRJA 2YCEA 1GYLA 3B9AA 1J01A 2PZNA 4CN1A 4MM1A 1QXLA 4GC3A 1Y5VA 1A5OC 3EYPA 3H6OA 3GNDA 5I6SA 2PURA 2X7VA 2G3NA 3C2VA 2C15A 4LV9A 4MZYA 2WHJA 4GKLA 1JYNA 4MDOA 1K4GA 3AJ7A 3CK5A 2WBKA 4OECA 4YWIA 5HXMA 1TIWA 4AD1A 2GVEA 3M7SA 1M6JA 3OZPA 2XN2A 4DI9A 3BOFA 3OQ8A 5ABGA 5CPOA 5FL1A 4DIAA 5DN1A 3UJRA 4D1IA 4GYPC 4GI4A 3AFBA 4HNNA 3FHQA 3L2LA 2OR2A 4WDWA 5EYWA 2BB0A 3E38A 3VD7A 1B3VA 3XISA 2AGKA 4NJGA 3U5YA 3E74A 1OGBA 2V3EA 5M1TA 5DQPA 4ZXLA 4GGBA 2WSQA 1K77A 1T41A 3DFHA 5K9XA 3LSCA 4CVWA 2QJMA 1V7AA 5CG0A 3PZTA 4EOUA 2ZZ1A 1K7EA 2FGBA 5JH2A 2CWXA 5D32A 1EJVC 5CLWA 1TPH1 3QLDA 4YVPA 3SUVA 2BX7A 3EB3A 4EPBC 2QGYA 2PDGA 2DIEA 3LCIA 1CWYA 3F5KA 3LM7A 1E15A 3PC0A 2W3ZA 4PC8A 2TYSA 3G3MA 2VFGA 4E4PA 1P0BA 1FWRA 3LENA 1KV5A 1KLZA 4AVFA 3LHTA 4JKLA 4PODA 1HG3A 1QNVA 3IACA 3QQWA 2RUSA 1HVXA 1TSIA 5IM51 1BHGA 5GNYA 3ECQA 2G41A 2J7HA 3C2OA 5A8OA 2XISA 1QUMA 4JXCA 2OO6A 4FK9A 2CLLA 3R25A 3L65A 1NFBA 4HMDA 1TMHA 2DVUA 2Y63A 2IPFA 3BAKA 4UQAA 1DV7A 5C2GA 1UPMB 3OVPA 3DFQA 3C8NA 2WZMA 1JCNA 4WOQA 4S3EA 1KM0A 2ATMA 4O1EA 1I8JA 2C7FA 4LUJA 4Q8UA 3G8RA 2QCGA 5L6UA 4GHRA 3SRHA 3N9KA 3OEXA 5H1WA 3GG8A 2C18A 1Q6QA 3EDKA 4CQAA 3WLSA 3AYTA 5F2GA 3Q4DA 1AVAA 1IZJA 1W9DM 2C91A 4X61A 3M0HA 2FLIA 2GDUA 4DBWA 4P8WA 3EMCA 2AMXA 3O05A 1TKKA 3AHTA 4UOZA 3QV8A 4W86A 2XTKA 3MMTA 2CBJA 3P60A 1XYAA 2FPTA 5IDIA 3OGRA 4KQNA 4QSFA 3RX2A 1NELA 3GVGA 3QY7A 2J75A 1S2AA 4JIRA 3N4AA 1G01A 4AC1X 1IXNA 1R5YA 1R2SA 4PRWA 3W9ZA 1F9CA 3UG5A 3NL3A 4U5KA 4GY1A 3B05A 3WQPA 1YIXA 3VO0A 3I6EA 3W4RA 4EANA 1WDPA 3BK0A 5AC4A 3AYVA 1CGVA 4JZ5A 1IHIA 4N9CA 4R9XA 3R12A 2BTMA 5CBBA 3CGTA 1A3WA 4WK9A 4NU7A 3CHDA 4JIQA 4Y9MA 1KCLA 1VD6A 2VMFA 5A2CA 1TR9A 1CENA 3PAOA 4RE4A 3SFWA 2BS9A 1MUCA 1TZ9A 2J78A 1P4CA 3TJ4A 3B97A 1J11A 1Q4NX 1KM3A 2V3FA 5E9XA 4CNOA 3KCJA 3C0SA 1PL9A 3OVRA 2GVLA 4JTIA 3DXIA 4M7TA 1BFNA 3AU2A 1WO2A 2Z1KA 1H1YA 2ZTKA 4S3FA 3DHDA 3S83A 4JFVA 1W3KA 3W01A 1QW7A 2P8CA 2WLZA 1J5TA 2VEMA 5LNSA 4PMOA 1VKFA 1JYVA 3VD4A 3RK8A 4FAMA 3CWNA 3N34A 5D2TA 1EZ2A 1LBLA 1A53A 3N12A 3ORWA 4WQ6A 4UXDA 3DKJA 4C6JA 2Y0FA 1O68A 1LBFA 2WLYA 3GG7A 4UTJA 4UB9A 5REQB 1KM1A 2B0MA 4Q8OA 2YA0A 1P0NA 3NQ2A 1UWIA 2V68A 1J2BA 3T42A 1K8XA 2YKKA 1GPFA 1JNDA 3HJEA 3M47A 1XG3A 4IXHA 2VELA 3BQ6A 4JL1A 2YB1A 3AIQA 4U33A 3T4WA 3W81A 1KXTA 3NZQA 3W7RA 3FYYA 4OBTA 4JYFA 4GRSA 4NHVA 5BWFA 3W27A 3U2CA 4QDPA 3SGGA 4JEJA 1GNXA 4FOUA 4LS1A 1TUFA 4JBRA 4HCDA 2J8GA 1DORA 1K8YA 4ZQOA 2PWFA 2DUXA 5HNNA 3THQA 1U1JA 1V51A 1VIWA 2QIIA 2NVCA 1R85A 3WH7A 3F7JA 1AK5A 1HJVA 3W2NA 1K4HA 1A3XA 3NIYA 3YPIA 5HA7A 1DWGM 1KB3A 2ISVA 2V9DA 3F2CA 2O9OA 3TAOA 2HS8A 3NYZA 3CPGA 2GVJA 2X2GA 1QPOA 2R1LA 4CNPA 5CJ5A 4PMDA 2PSNA 4GJ1A 4B5SA 3ZS4A 2FIQA 2IKGA 4MKNA 4AEFA 3JS3A 3N6QA 3RIKA 4KRUA 1UWQA 1LQ0A 3GO2A 3WLTA 3HM7A 5HR6A 3B8DA 3WJYA 4UMBA 3WELA 4HPJA 1CXEA 2Z29A 1GOOA 1RH9A 4WSKA 4C1NA 3SJ3A 3H21A 1ZENA 3CUGA 1X6NA 3QV6A 5DFAA 1LLZA 1NSJA 2PDPA 4LFYA 3TQVA 2PTZA 3D46A 5DY2A 5F1UA 3BLFA 3DAQA 3QMRA 4Q8NA 1KQZA 3OG2A 1BYDA 8RUCA 3WMCA 3VABA 1CGYA 5A6JA 2J6VA 2ZXQA 4GBDA 4UFMA 1M04A 2VQUA 2TODA 5C54A 3CL7A 1ONRA 3E5PA 2A6LA 1WKEA 1SFLA 4DUVA 3KRZA 1JUKA 3A12A 1OC6A 1H63A 4ZOAA 4WF7A 1WPCA 3CU2A 3WQDA 4NQ1A 2OLHA 4A8RA 3DFSA 3LBOA 4NP7A 1JYWA 4IIEA 4IHCA 3W76A 4KFNA 2V2HA 3GH5A 4HOXA 4ERGA 5EPDA 3H53A 4FXJA 4B4HA 2HBXA 4LRTA 2PDCA 3FN9A 4AWEA 5G2IA 3VUSA 4U4MA 3TYUA 3WDRA 4OJYA 3TC3A 4A8IA 3SQLA 1QU4A 4RPQA 2ZC8A 2X05A 3TW9A 5LNVA 1J5SA 5I03A 4FF7A 4O0ZA 4UQBA 3B04A 4JR5A 3VE7A 3PSWA 2YYTA 1R2TA 3FSUA 4GXPA 4EWJA 2Q3RA 1PKYA 3EZ4A 1L6GA 5D04C 3HPZA 3FW6A 2EG6A 1IWPA 5HAOA 1G4TA 4O1BA 2DY3A 2ZUUA 4OWGA 4R34A 4KMQA 4AISA 1UPPA 4LEQA 3UR5A 1VYSX 3IWPA 4IMGA 1FUYA 3BDKA 4NX5A 4UQDA 1QI2A 1S39A 4GCXA 3LX9A 4Q4RA 3VOJA 3ICJA 3VIJA 5TF0A 3COTA 1SJAA 3G0UA 2ZZ7A 3DCPA 4E8GA 4AF0A 5HQLA 3SCUA 5AECA 3FKRA 3VDCA 2W5FA 1DE6A 1PYFA 1X8CA 1ZJHA 1VCFA 2XIMA 2DZAA 2PEVA 3EDFA 3RJXA 4M5PA 2CZDA 3E2RA 3KE0A 2QAFA 4UR7A 3WJZA 4XD6A 3TYCA 4OV9A 2QJHA 1XH0A 3MBFA 1TRIA 1OYBA 3CYJA 1S2VA 2YFNA 3OG3A 3G2GA 4I6VA 4MWAD 1VS1A 2GUYA 2PWEA 1LDCA 1XSJA 3CMFA 2LLEA 4WEVX 1H49A 3GVVA 1XYMA 3CHCA 1RQBA 1RSCA 4GVHA 4TMBA 1XIBA 2G3MA 3FNDA 4Z2IA 4H9ZA 1Q7QA 3SURA 2G4FA 4RPPA 2Q3OA 3SM0A 2VHLA 1VHCA 3R0DA 4RL3A 1D7FA 1U5VA 3DHFA 1MYRA 3ME3A 3O07A 3CWOX 4Q8WA 4I5XA 2GLKA 3A4XA 4X2PA 1ISZA 1K03A 1V77A 1UP0A 3SZ8A 2WMKA 1M01A 4AB4A 5AOUA 4KEVA 3GR8A 3MSDA 4KS0A 3NQFA 3RNDA 1AL7A 3P84A 4HA1A 1EHNA 3HGJA 5JIWA 2FHCA 1KGWA 2CPUA 2PB1A 4GVFA 1XIEA 1HKJA 1EXPA 4DBEA 3UFYA 1C3FA 3VNLA 2C79A 1SUXA 4JQ4A 5I0DA 3KXQA 3UNTA 2PDBA 1QFEA 1KBBA 2IS7A 2J7FA 1VC4A 2OCZA 4XZHA 1UW9A 4AFYA 1VYRA 3RMJA 2Z26A 5CC7A 2NQZA 1MEHA 4TVDA 4FX6M 2OEKA 1A5NC 3D6NA 1JPHA 2TSYA 5DY3A 5BW6A 4KETA 1BLIA 3HBLA 4M6UA 5DRIA 4S23A 1EWDA 5HNTA 1FKWA 1EGZA 1CCWB 3ARXA 1XCFA 3WSUA 4A05A 1NU5A 2H8XA 3W73A 3GTNA 1W37A 5HQEA 4PUUA 2QIWA 2PDKA 1MVYA 3FA5A 4CD5A 4G56A 4O16A 4ASTA 1MW1A 3V4BA 4L61A 4J5NA 3W2MA 3TEVA 5KETA 2FZBA 3D0CA 1NF0A 3E0WA 3DG6A 4O1DA 3IJ9A 2YCIX 1GOIA 4OGZA 4PCPA 3A3WA 1NH6A 2YZRA 3TTQA 1EC8A 1AQHA 3R79A 4CD8A 1CXIA 3MTWA 1EJTC 3W70A 2XH7A 1EIBA 4JQ1A 1VPYA 4FLRA 4GA8A 1VBUA 1XLJA 2CCRA 2ZZ6A 4HU4A 1TVLA 4GJJA 4C1NB 4WVXA 4UTFA 1MUMA 1KXHA 2QV5A 4HA0A 4NASA 1XKJA 4GQGA 1KBJA 3PFRA 4PULA 2A3EA 1EB3A 2WVVA 4OHQA 1EPVA 2EPHA 4W87A 2ZYFA 1X7FA 3KTCA 2WZTA 1GQJA 2BASA 4NJHA 1PWLA 4PMVA 3PTMA 1EEPA 1F6PA 2ZWYA 1IQ8A 1OY0A 3W37A 2IUZA 1F6YA 3ZJKA 2X1SA 4H83A 1Y8BA 4LS2A 1DP0A 4HQVA 1C8YA 1N8FA 4O10A 3NZPA 3BMWA 1QVBA 2AL1A 3C0JA 2F84A 1TCDA 2I7GA 4X2RA 1VFFA 1UQYA 1J0KA 3ANVA 5I78A 3P62A 4HK5A 2XZ9A 3QY6A 1YNQA 3W1NA 1FFRA 4F4RA 2F61A 5TBOA 3TN4A 2FTYA 3T0TA 3W00A 4PUEA 2CKRA 1GG1A 4MZ8A 5AN7A 4GNKB 3S1XA 3GTXA 3C4UA 2YL6A 5EMLA 3NXFA 3XIMA 3NVDA 1GVRA 4ALDA 2CBVA 3DG3A 2ZZ5A 2F6UA 3I7QA 3PM6A 5HULA 3B8WA 3NGJA 3LHVA 3N18A 1TZ7A 5DMNA 3L23A 1OFAA 2Y2WA 1LT7A 4H9XA 4ZOEA 1ZUAX 1EQCA 1B1YA 4OOUA 4XWUA 3VIFA 2Z1WA 4EWND 4JICA 3FXGA 4U31A 3O6CA 2FFIA 1F4HA 4AD2A 4LB3A 4AF0B 1K9FA 3KUMA 4DZAA 5DELA 2RKXA 5GPRA 5HK4A 2V82A 3N9SA 1J10A 1YNYA 1A5SA 1JRCA 2WMGA 4JYDA 4A35A 1K02A 3DYMA 3SB0A 1TCMA 2VDIA 5U7SA 3W02A 2X40A 3NO5A 4HD5A 2DZUA 4Z2LA 3B40A 4JAWA 3OBAA 3EEGA 3APTA 4MY1A 4EIVA 4JS3A 3K1GA 2IXVA 1DWAM 2QV4A 1L8NA 4IGHA 4DVOA 1NAL1 4JN8A 3O7UA 1A50A 5C9XA 2NWSA 1MNZA 4FB7A 4JTQA 1IE7C 4CCDA 3M0JA 1PIIA 4KCTA 3WEZA 3LERA 5M3WA 2JBMA 2QMKA 2YSWA 4ZR8A 3LGDA 3P14A 1NQ6A 4ZVJA 1BWKA 3UD6A 5M5DA 5AHFA 1OCQA 5CEWA 5DMMA 3W29A 2ACUA 3KEHA 4BHYA 3N13A 4NRSA 1NFGA 1XBZA 4S3CA 3TYZA 4L6DA 4PMQA 3N14A 3GU1A 3RN6A 4XTDA 3T40A 3CV2A 3NQ6A 2WMHA 1PPIA 4GO9A 2VUNA 2A3LA 1X1OA 4OVXA 4HK6A 3W1MA 2PRMA 4J9JA 4Q7NA 1Y7VA 2ZKMX 3TN3A 1I1WA 3V5FA 2TRSA 2E09A 4A3YA 2BXVA 1OEPA 3INPA 1OABA 2PDMA 2C19A 1KTNA 4TX6A 4WOZA 5E0CA 1XLGA 1QK0A 4BFAA 4DZHA 5E0FA 1E4NA 1QNSA 5ABEA 2I17A 3GNNA 4C6LA 4FLQA 2E28A 4QROA 3U2OA 4N4PA 3VOHA 2H9AA 3M0KA 2VVNA 3N4EA 4S3KA 2CYGA 4P2VA 1Z41A 4Z1AA 3T44A 3CZ8A 1R9ZA 1A49A 4LF2A 2V0TA 4TMCA 2W63A 2E5BA 2CESA 4DUWA 3OZYA 4US6A 3GVRA 4DUXA 4Q6JA 4NILA 4L1XA 5CCZA 4XZIA 3EAUA 3VGGA 1ME7A 1S38A 1PX4A 5IHRA 3U0HA 3NEHA 3WD0A 3GFYA 1CXHA 2VFFA 4XBKA 3M0YA 1XYFA 3BH4A 4D6IA 2VXNA 3THAA 1FCQA 3G1AA 4US5D 3W82A 3PTKA 1IXPA 3S5OA 3AXMA 1O60A 1IEWA 3W53A 1DL3A 4KFOA 2Y7GA 3BMXA 5M17A 3T0CA 3HU7A 3EWBX 3H23A 2ZDSA 2B7PA 2QJJA 2P10A 1AA1B 2WVVB 2QR6A 3S9YA 3ITOA 2E0PA 1FWBC 2ZQ0A 2Y6ZA 4AZBA 3EWWA 2Z7KA 1XDJA 5CAKA 2QLYA 1IF2A 1NDYA 2DZTA 2DJLA 4TOQA 2PI6A 2IKHA 1U83A 2VFHA 4Y2WA 1W3JA 1OCNA 1S5WA 4M56A 4Q7IA 2VGBA 1XD0A 1RQHA 3S1WA 4GKTA 3L12A 1ONEA 5BMWA 2VFDA 3LRKA 2CLEA 3L4UA 3THDA 4E3TA 3L4TA 3GFZA 4JX6A 2ZXBA 1GTHA 5AKQA 1YXYA 3NM1A 4ZTYA 4AUBA 4IPNB 2J7EA 1AFSA 3MCOA 4KIRA 1LG2A 5CPLA 3VD3A 2SFPA 4O52A 4J35A 4Z1DA 4EX4A 1I9CB 5A6BA 2QUNA 4PR4A 1XDMA 3B9EA 2FHFA 3LCLA 4ZSUA 2WNZA 5FI8A 2YBUA 2PWDA 1B2YA 2X1RA 4YTTA 1CIUA 1WNOA 2XIIA 2ZCGA 1ZHAA 2WPGA 1C29A 2Y61A 3TN6A 4GIAA 1SSDA 4DLMA 1TVNA 3IAQA 3H70A 1GOQA 5E70A 5D9PA 7ODCA 1WUFA 4P7OA 4KFPA 1XFCA 4O4WA 4GWEA 4W5UA 1GVOA 1FVPA 3W1LA 4KRZA 3DUGA 4CCCA 4UFKA 3LYEA 3IANA 2E5CA 2QYGA 3E2VA 2FMNA 3UXIA 3PZMA 1MQPA 4XG1A 3REQB 2BXYA 3CMGA 4P61A 1UMLA 4PUWA 4PB4A 3HN3A 3OA5A 3DG7A 4K37A 3CV7A 2QEZA 3ITXA 5FF2A 1WUEA 2XVKA 3VZZA 2R1NA 3WD4A 4D72A 3MMWA 4FNQA 1YRRA 3FY1A 4C7DA 4XD5A 7TIMA 1IR1A 1S5TA 2JKPA 3STEA 4Z2GA 2VYOA 4DB7A 2ZBTA 3R0UA 3LU2A 1UCWA 3Q37A 5I5RA 4HHPA 1P5BA 4PUDA 4I3GA 4HVXA 5HWJA 3GH4A 1TJ0A 3P0WA 1H7RA 3NZ1A 3KAOA 3TYAA 3VVGA 3CQKA 3GXNA 1MW3A 3MUCA 1O4UA 4ONVA 1H60A 1RK6A 2A4AA 1AD4A 3AIVA 3VIPA 3C52A 1YX1A 1KM5A 1Y0EA 2WHMA 3S1UA 1O66A 1UOKA 4J1OA 4IM4A 2Y8VA 2Q6ZA 4HNTA 5FSEC 3TUUA 2DIJA 3CUZA 4NZ4A 3S9IA 4KWOA 1DJHA 3GC5A 1NM9A 3R4IA 3T78A 3S8HA 3OA3A 5EB8A 1B3ZA 4GFIA 2QCNA 1ISVA 4Y90A 1U1UA 1LT8A 1PB0A 5AYIA 3ZWSA 3N4FA 1O7AA 1JVNA 2BP1A 1JNEA 3JRKA 1V6XA 2BGQA 3UCDA 3VGEA 1UROA 2YXOA 1XW8A 1BPLB 4DJDC 4WLCA 5D9NA 1T40A 4PTDA 5AB3A 3VFCA 3DI1A 3DYPA 1Q3NA 3HQ1A 3MKCA 2H9AB 3EPNA 4LVDA 1IV8A 4JFUA 3CL8A 3WQ4A 2PLCA 1BSLA 3QGVA 3WN6A 3KVMA 3RO6A 3KBNA 5C6MA 2DZSA 4L6HA 3G77A 3A23A 2I57A 3M1ZA 3MQTA 3R94A 1EOMA 5K9CA 3UU0A 1YXDA 1SJCA 4DY1A 1YEYA 4KKXA 1JI1A 4ZQMA 3P93A 3W6YA 1E6NA 1DXFA 4Q6XA 2Z27A 3M16A 4CQ8A 4PEEA 3ARWA 2J8FA 3PNUA 3GTFA 4WY0A 4M1BA 3RAOA 3GDLA 5SWUA 1YMYA 2A3AA 2OPJA 2CZFA 1OINA 2Q8XA 4D6EA 1ZP3A 2HNHA 4NL1A 3UG4A 3KZPA 1G94A 3MHUA 1XH1A 2PLKA 2ZUNA 3KX6A 5K3VA 1R8LA 2INEA 1G0CA 2WYSA 4XISA 4HSNA 1K8ZA 2INZA 5K4ZA 3BGGA 4ZXOA 1M53A 2QPSA 1GQLA 3KZSA 2VWSA 3SADA 1YXCA 4I9AA 2W9MA 2P3ZA 4KCUA 3WQEA 4FXSA 3SIZA 3L4VA 5A95A 2VC7A 3GX9A 4N2YA 2XFYA 3R8GA 5IFTA 1LG1A 2PDQA 3QMSA 2JQXA 2WJDA 1OX4A 1Y65A 4P7QA 3GC4A 4JQAA 4DWSA 1YTEA 4CD4A 4QNWA 5LIKX 2OYMA 3M0LA 2OZ8A 3DECA 3WJXA 3UJ2A 4MLJA 3QF0A 1I2NA 4YJ5A 4IF2A 2RDWA 1EUAA 1UZ1A 1UD2A 3ARRA 1RBOB 1VFMA 3MMDA 4TIMA 2PLMA 5AYXA 3UGRA 3JZUA 4Z1BA 5C71A 3TXZA 4L1GA 1OFQA 2GWGA 3ZR4A 1RBAA 1ADOA 4F9JA 4IJRA 1UZ4A 3EKZA 4MB3A 4W84A 3HQPA 3WQ8A 2AKZA 3DFNA 3FAXA 2D69A 3SUTA 4KCVA 1POKA 4PTXA 3CQIA 5IRPA 3SRKA 4WXZA 4Q33A 1NF7A 1R9YA 1FA2A 4M6VA 4QJ1A 3PG9A 3VX0A 3R1ZA 4JN7A 2ZRVA 2WNQA 1RXOB 3PWIA 2EKGA 4Q4QA 4MY9A 3QTGA 3ENLA 4GQQA 3IV3A 1IEVA 2OVLA 3RDKA 3CHEA 2ZXAA 4DYEA 2BOFX 1VF8A 2G37A 3PZQA 2QPUA 3N2MA 1J9YA 4LGXA 1HKIA 4HOWA 2Z1SA 3TA9A 2ACSA 1XX1A 3ZIZA 1KW1A 2ZUSA 4JHOA 4EPEC 4Y7EA 5GQBA 1IR2A 2DVTA 4A8LA 3P6LA 4UQ9A 5EBAA 1Q63A 1UJQA 2H90A 5FAJA 2RJHA 4IPLA 2BHUA 1LRNA 3P82A 3TIMA 4DELA 4I9TA 2CU0A 1RLCL 5AHEA 4O28A 3IEBA 1RCQA 3AMKA 1AJ0A 3FFSA 3QR0A 1OT2A 1CEOA 4JTAA 5FL0A 1J93A 1TQJA 3W1QA 3WK3A 3IIPA 4UMAA 4CUCA 1XIJA 1UWUA 1AG1O 2Y7DA 1UMYA 3OBKA 2WZEA 3DHUA 3P80A 4HSHA 2C3ZA 2Y8KA 4NAEA 1R87A 3TA6A 1Q4WA 1VR6A 1PKMA 1VEMA 1OB0A 2VR4A 4RE0A 2JK2A 1LP6A 3M0IA 4JQ3A 5A8PA 2WJFA 2PAJA 3GUGA 3R11A 1R3WA 9CGTA 2VOMA 1CT5A 1C93A 4TR9A 5E93A 4PTVA 5D2YA 4W88A 5H6HA 1AL8A 1BXCA 2FDMA 1OQFA 5AC6A 3OQEA 2D3NA 4B5VA 4AMAA 1HL9A 4KWWA 1JZ4A 3N29A 3EOLA 2J66A 2R1PA 1V08A 1IEXA 1S46A 5FESA 4XVEA 1OC5A 2Z2UA 1ISWA 1TX2A 3W3OA 3L0NA 3WLRA 4ZB2A 2PDYA 3UVIA 2EPOA 2W4XA 3PB0A 1W54A 1E1CA 2G50A 3LHUA 1U33A 1Q66A 1P6BA 2Y88A 5DLCA 4Y9PA 2GJXA 1XLAA 3SJNA 1XLKA 3VI2A 3D3AA 4RZ6A 1R46A 4YHGA 2PRHA 3MSYA 3UPWA 4I7WA 2XWEA 3CAQA 3WDPP 3LHYA 1EGMA 2Y5SA 1F73A 2Z1BA 1WXYA 1FWHC 3AO0A 2J6XA 5C9RA 4PUNA 1QO5A 4Z2HA 2WW5A 1CNVA 2YDSA 2P3EA 2OX4A 4FXFA 2HZGA 3WL1A 1RA5A 2XWDA 2H3DA 2DSUA 4PH6A 4WY0B 3QHMA 3O0KA 3VIOA 5BU6A 4OE7A 4FR6A 3ZOAA 1M3UA 5LHFA 4HN8A 4EPDC 4WCJA 3H2FA 1LL4A 3FAWA 3T2PA 1E0WA 1WDQA 4JDYA 3WEOA 1Z89A 1Z48A 1JZ8A 2VRKA 3LPFA 4W85A 3O8AA 2GUBA 3KDNA 2JF7A 1OCJA 3KOXA 2J24A 1IEQA 3EWDA 4RV8A 3FA4A 4IGSA 1BSIA 3KS5A 3VOIA 3LQGA 4O13A 4C6MA 4IJCA 3U9IA 1AQMA 1EJ7L 1V6UA 3OTRA 1VEPA 1CI1A 4NG3A 2Z1XA 2VX7A 4NZ5A 3CZEA 3KDOA 4FALA 3B0XA 4IOTA 2ZUTA 3W23A 1UH2A 3R43A 2NXIA 3G18A 4JYEA 3S47A 1OX4B 1UP3A 3GXDA 1MMFA 3BG9A 3UA4A 2X30A 4DWSB 4JTSA 3PNZA 4JIEA 4UOJA 1VEOA 3H8AA 3PPGA 3FJNA 1B31A 3CT2A 3NQVA 3DFPA 4IGNA 1V02A 1DWJM 3G1YA 4QLJA 3K4DA 1JZ5A 4GK8A 3NQGA 4IJBA 3T0AA 1PEZA 3QGKC 5G1MA 2MNRA 4K7VA 2GJNA 1XD1A 3NVTA 4L64A 1HVQA 3T81A 2X41A 2FFCA 1Q6FA 3W0KA 4LB4A 2NV9A 2WC7A 1Q2RA 2HQAA 1W5MA 3AC0A 3MO7A 5AYYA 1OSEA 4AHPA 1VFHA 1XIFA 3TX9A 2DZVA 3IUHA 4LF1A 4MPKA 1WKDA 4F2UA 2EHHA 3LUTA 2WXDM 5IOBA 1TA3A 2JGQA 3F4WA 4QE4A 5AYBA 5I7GA 1T99A 2XINA 1W9VA 4YVXA 4TQTA 5A6AA 1EBGA 1F05A 3FCPA 4LC6A 4R7JA 4YXGA 3N73A 1LBMA 4C6NA 3WQVA 4AHQA 3O6YX 1XR2A 4O50A 5IXEA 5A5WA 4TVCA 3TFCA 3LI1A 2QVHA 3LCHA 3R8HA 3WUFA 5CJMA 4GPNA 3SCVA 4FIQA 4X9YA 1R30A 3OIXA 1SJDA 3AXKA 2ZZ3A 4MSSA 3MKVA 3PY2A 4W89A 4WGHA 4W7WA 4PL1A 4LC8A 4UTLA 3CASA 3P8JA 1CXFA 2IW0A 2GFTA 3OPSA 3RPTA 4J28A 3SI9A 4HA3A 4GY0A 2PGRA 4ACZA 4LTSA 3FJLA 3AIBA 2HBVA 1JEZA 1GOKA 1ZU8A 5A6LA 3WH8A 4HHHA 1QK2A 5BRPA 1OG0A 5C9UA 2QCEA 3LM3A 3TC6A 3MUIA 1C7TA 3EWXA 4AY7A 3A64A 3RITA 3EWZA 1XRFA 3KVJA 5FEXA 2C0AA 3U7BA 3LPPA 4MB5A 4B5UA 2R1MA 4DJDD 2NX3A 4QXIA 3PN8A 3CBWA 1VAHA 1PTGA 4QTGA 4GYFA 4Q8QA 4QLLA 1I6NA 1R7OA 4NAEB 2C1IA 3GRIA 3V7PA 1A0CA 4IQJA 1XF0A 1KRCC 1FRBA 2NVDA 2CW6A 2GOKA 3VPLA 3CNYA 3ZQ9A 4AW7A 4NSBA 3GAYA 3IJ7A 3OJGA 4JHMA 1TELA 3LA4A 2PD5A 3H2EA 1WCGA 3LOTA 1J12A 1OF6A 3UWZA 4PGLA 4LPCA 3CPUA 3ZZ1A 3BAJA 1KV8A 1E9IA 4JY9A 4HBKA 3U4FA 4Q4SA 2YX0A 3TJIA 2B7NA 2POZA 2TAAA 1X38A 3WUGA 5LXXA 3UPMA 4W5ZA 1RY8A 2XDFA 4JTUA 3ZO9A 1W91A 4TUFA 4ZEPA 2ZIDA 1IGWA 1YPFA 3R5EA 2A2IA 4URIA 1E3ZA 1JUEA 4GFSA 3GNXA 3P3BA 4S2BA 1T5AA 2CHRA 3KCLA 1TPC1 2FKPA 3IGXA 2PTWA 1E1CB 1TPDA 4CEXC 1AMYA 3DGRA 4RNJA 3UZ5A 1ZB5A 2IPGA 1GKRA 2CLKA 2POTA 2GJXB 1OC7A 3E1F1 3V5CA 1GW9A 3MT1A 1H7NA 2VX6A 1KNWA 4E2BA 3AZRA 2ABBA 3ZM8A 1WDRA 1PWMA 1E6XM 1PDZA 4R53A 1TV5A 1W8GA 4HPGA 1SFSA 4ZL1A 2VM8A 4PBEA 3WLIA 2EPMX 3OGVA 4LJ3A 1VPXA 3OVQA 3E02A 4R27A 2BHZA 4IX0A 5H8MA 4O54A 3HJZA 3VKBA 2PTDA 1WAUA 1JPIA 1T6MA 4H6EA 2HCVA 3W2KA 2AQVA 1E0UA 3LNMA 8TIMA 2VFIA 3L21A 3QQ0A 2Q8ZA 2NT1A 2HPIA 3ZLGA 3AS1A 3NO3A 3K46A 3SCSA 3BLKA 2AMGA 4HMEA 2VEFA 3E3HA 1IGSA 1SZRA 2QZRA 3MUZ1 1X6LA 3NZRA 3WIJA 4HZ8A 2JKEA 1XKYA 2HROA 4FSAA 2WV8A 4IUGA 4RDZA 3TWBA 4BQ5A 4LVAA 4AIOA 3SCQA 2NT0A 1VBJA 1KM6A 3VKKA 1E0XA 4S2CA 3TW6A 5DO8A 1ZBVA 3B8VA 1MXSA 1FBAA 4GC4A 3URQA 4AY8A 1DYSA 2D2JA 4KCWA 5BZAA 5A2BA 1Z42A 1LCOA 2F38A 2WSKA 4XAPA 4HP5A 4LBRA 4UCFA 2XGZA 4LALA 3KOYA 4MWAA 2PWVA 4B9ZA 4GUFA 5GNZA 4LYKA 3WYZA 1QR7A 2VZUA 1W3NA 2WVSA 3BICA 3WQ5A 2Y5JA 3O16A 2EPKX 1EH9A 1J0JA 3NL2A 3LHZA 3PZ9A 4AEOA 2DP3A 2X1TA 5I77A 5DXYA 2Z0IA 2BY3A 4UWMA 3FS2A 3TTYA 1WZLA 4DYJA 4H19A 1T8QA 1W9UA 1X1ZA 4H6KA 2QJIA 2HMCA 3GHUA 5A1AA 1TA3B 4GYPA 4S3GA 3BV4A 2CZ5A 1OFEA 4GG9A 1J4EA 1MRQA 2WMIA 3V18A 5LNWA 4JTRA 4N9BA 4Q8VA 4QGCA 2XUCA 3U5UA 1XRVA 1W3IA 3ZT5A 1FCUA 3LXCA 2D2HA 3L5LA 5CZTA 4QRNA 1UBSA 3GR4A 4RE2A 1W1A1 4D71A 2GDQA 4AMCA 3N1AA 1BXBA 2ONEA 3LK6A 1OG6A 5AC8A 3MV11 4FNPA 1RBLA 5CSUA 3K4WA 1W6TA 5C55A 4R85A 5FACA 4ACZB 3CTLA 2VTFA 3KWSA 4BK9A 1ZJAA 1ITQA 5BRQA 3H2OA 3W1PA 3E12A 2PWUA 3EKGA 1X8FA 1GKQA 3W24A 2XVPA 2HXUA 1HTIA 1I0DA 3H54A 3NQMA 1P7TA 4GD0A 4H2HA 3M5YA 2RGLA 3CPRA 4H9MA 1LZOA 1UD8A 3AZSA 1L6FA 4F2TA 1H62A 3LY0A 3TU9A 2PP1A 3ARSA 2PFHA 4DNHA 3EX2A 2BVWA 5JH1A 3R6IA 2BNJA 1O5RA 1LUCA 1QNOA 3W7PA 3EB2A 3EDJA 1B0IA 2Z2BA 2WNWA 2XYLA 2E4TA 1ITCA 1TJ1A 1NOUA 2FB2A 2C1GA 2V30A 3MO4A 4NJJA 1VQTA 3AZTA 1N2VA 3EPMA 2G95A 4J40A 3M0ZA 2HE8A 1ENUA 2VGIA 3WF2A 4E4UA 2NQLA 3MVTA 1LROA 4MFEA 3DH7A 4ERIA 7ENLA 2D2GA 1E6PA 4DPQA 2DJXA 4EAMA 1FFQA 3P61A 3VZXA 1FX6A 1QRQA 1US0A 1JZ3A 5D03A 4YU1A 4PN2A 4AD5A 4YTRA 4R33A 3MUAA 1UD6A 3IARA 3A4JA 3C2EA 3TCEA 2WCSA 3L5AA 4FNSA 1GOWA 3F4NA 4DJEC 5AVNA 1JXJA 1BYCA 3AHVA 4ADUA 3EX3A 3Q65A 4OIFA 4KWSA 4A3QA 1SPQA 3CZGA 1FWWA 2BSLA 2NXGA 1DJZA 4RK8A 4KIEA 1ZSXA 2QT3A 4RR4A 4DWDA 5CPTA 3KRSA 2QCLA 2HSAA 5DCEA 3EKLA 5A8MA 2PU0A 3H4GA 4ZFCA 5BU9A 1Q65A 4JTGA 4XZMX 4LOCA 4UIOA 3TMQA 1LYXA 4XTIA 2J9XA 3WLNA 3CO8A 4FIRA 3VOFA 3ZSSA 1W31A 2R1KA 4DF2A 2R9RA 3KP0A 4X22A 2XN1A 4QE1A 5GJPA 1TE6A 2RDTA 5ECVA 2A79A 1OFBA 1GQKA 3G6LA 3UQNA 2A21A 5JQ9A 5F2LA 3LZ5A 1DTUA 4F8XA 5HWNA 1UUOA 4Y9OA 3NQAA 5LA2A 4FX7A 2IQ0A 3KL0A 3NSXA 2V8ZA 4CD7A 1JFXA 2D0GA 3WH6A 3CJPA 1SR0A 1H5YA 3AXIA 4ROQA 3GXMA 4O15A 1BAGA 1PHWA 4YYCA 5HDRA 3FA3A 3K30A 1Q8JA 4GIEA 3THCA 1YBQA 1E1FA 1QPKA 2WKGA 2J88A 1H0GA 3AMGA 1QWKA 3CEPA 5LIUX 4CEUC 3Q58A 3I3BA 3VCRA 4U3AA 4CCEA 2R94A 2PWGA 3RF9A 3KP1A 1OD8A 4YNGA 1VB9A 4P8XA 4Z17A 2QXWA 3LV5A 4XO6A 4X0NA 1DQUA 3QPEA 3ABOA 2Z28A 4E6MA 1MI3A 1Q6CA 3TTEA 3G1HA 5XINA 1S2WA 5EU9A 1XBXA 5F2IA 3C2FA 3GQYA 4MZ1A 3TC7A 3A5VA 2BG5A 4LAUA 2J74A 2OSXA 3RLVA 5M2FX 1JYXA 2PF8A 2QCHA 3AALA 4YIWA 1XS2A 1IT0A 3WD2A 4PRTA 1H09A 3ITLA 3U8GA 4GYJA 3QOMA 3SW6A 3URAA 2QKFA 4DXVA 1KKRA 2WMIB 1QW8A 2NSXA 4O14A 3VDHA 1I75A 4WSJA 3VC6A 3O1NA 4HIBA 3W1AA 3MWCA 5I2UA 4H41A 2EBNA 1TV8A 3S2MA 3KBSA 5GVJA 1G9HA 3WLPA 1W2VA 3O0FA 4NAFA 1EP2A 1M03A 3NSNA 3GG1A 1V3IA 3L5MA 3IK4A 1PAMA 2OKOA 1XRSA 2CERA 1A5LC 3FVDA 1UD3A 2PC4A 3W72A 4DQWA 1S1PA 1XLMA 4Q4PA 3EBVA 1FQ0A 1REQA 2F8QA 3EPOA 4LT9A 3VC5A 2Z7GA 4XV0A 5I3IA 2B7OA 3S2CA 2PS2A 3M07A 3FYOA 4L4MA 2Y24A 3LD5A 4K3ZA 1DWIM 1OZQA 3IIXA 4M51A 1P7TB 3LTSA 1L6YA 4HZ7A 1JG9A 2QNEA 2GQ8A 4RW5A 4LCSA 1IZCA 5FEWA 4D6HA 4XSLA 3CZLA 1R3VA 1TPUA 3MDUA 1PCWA 4E5TA 3RG6A 3STFA 3ISIX 1W1TA 2WJZA 5F4WA 2Z25A 1MO0A 4IQEA 1TJPA 4HKPA 3M5VA 4M29A 3NQ7A 2F6KA 3GVQA 3N2TA 2O7QA 2XGIA 5AVHA 3CEUA 4C7GA 4LWWA 4QS5A 3CV1A 4AXKA 4US5A 4EKJA 3E0FA 3WNMA 4IICA 2HVMA 3IVSA 1UA3A 2XH0A 1AQFA 2CXEA 3POHA 1Z7AA 2PPGA 5D8ZA 4MLRA 5KEZA 4B16A 5J04A 2BHYA 5CPSA 4TVUA 5AC7A 1XLHA 4D8AA 3LEPA 1PX3A 1WDSA 3W7KA 4MYXA 2V69A 1M7OA 4X63A 1UR2A 5C2XA 3EXSA 1L9WA 4HSOA 1TWWA 5CZSA 2UY2A 2C16A 3R7MA 3THUA 2D73A 3BZGA 3NOYA 3T7VA 1AH0A 2CKSA 1D8WA 3PS7A 1IEIA 4TTGA 1JCLA 1VPQA 3NPUA 1DKWA 3VINA 6ENLA 1R9XA 2PRLA 2D3LA 4J3ZA 2DT1A 4XD4A 2WQPA 3O6AA 1W9PA 4C6CA 1NDVA 3VUPA 1C92A 2BVTA 2JF6A 2PDHA 2R24A 1K6AA 4IMDA 2FJUB 4AWUA 4P7NA 4LBSA 1EPXA 2BY1A 1J2WA 4LS0A 4IP5A 3G1DA 3VX1A 5IBXC 2PDFA 4BQ2A 2A6NA 1LL7A 3O2LA 4O1FA 1W5OA 4OBSA 3T8LA 1GOXA 5FJRA 3W7OA 2QJGA 1A4MA 3SUSA 3IJLA 4F0KA 2AQWA 2CXGA 2I1OA 1CXKA 1LLOA 1XIGA 5HANA 3LN3A 2V5KA 3BE7A 1TPEA 5D33A 3W7LA 4DF0A 1NP2A 4QHRA 2ICSA 1GZGA 1WAWA 3ONBA 2VCBA 1BEUA 2VP8A 3K5XA 3G5EA 4NVTA 5LYRA 2GOUA 1V3LA 1Z44A 1C9DA 1I2RA 2BZNA 2V67A 3NEVA 4PZVA 4ZCWA 1YBQB 5K9DA 3EWUA 1GWJA 1XICA 1AW2A 2XH4A 4O53A 4ZO7A 4FNTA 2NWRA 4EXAA 3VXGA 1EGVA 1JDEA 1YLVA 3G24A 3PUDA 2OFJA 3D3FA 1IT7A 1GJUA 1RP8A 3S9ZA 3GXTA 3V1HA 3USBA 3L4WA 6ALDA 4AIBA 1H50A 4PEKA 2D22A 4CN6A 5CGQA 5I00A 3W7IA 4PSPA 3CM4A 2GL5A 1H7OA 1YYAA 1GJPA 4JX5A 1UR9A 1CLXA 4UFHA 4A6GA 4CQBA 3UZYA 3TYEA 4HZ6A 1HL2A 3BJSA 3CH9A 5G4HC 3TYDA 2FJKA 1OD0A 4CVUA 1MZRA 4JKKA 3AHYA 3LBMA 5HMSA 3WJWA 3LMZA 4NY2A 1EF2A 4IMCA 1GQIA 4C6IA 3GTHA 4KH2A 1UUQA 2VCAA 2NX1A 3SN4A 8CGTA 3W7CA 1TFVA 3S5NA 5G4WA 3ITVA 5BROA 3T09A 2EEXA 3EGJA 3KTXA 1E5NA 1XLIA 3QR3A 2ZVIA 2DSVA 2E9BA 1HIZA 1ZBCA 3IRDA 1EJWC 4NAFB 3W7EA 1J79A 5I3GA 4C6KA 2HV5A 2E77A 2HXTA 3ES7A 3T05A 2FZ9A 3BSGA 1HX0A 5LNRA 3L2IA 1Q8AA 4NI3A 1ITXA 3FSTA 4ZO6A 3EX4A 1EO5A 3CAKA 4CU6A 4O0KA 3TR9A 4ENLA 1ONWA 3MP5A 2ATSA 3KCOA 3MCNA 1REQB 4PUKA 1KFEA 4PRRA 2WSRA 1F07A 4WY0F 4MNLA 4GUGA 2BGSA 4K7YA 2NV2A 2E6FA 1ZP4A 1ZY9A 2PD9A 1V6TA 1ADSA 1K9EA 3DN5A 1YNPA 1EDQA 4WD0A 1UWRA 2RGMA 3GW0A 1CYGA 1KO0A 4DJED 2NLYA 1QWGA 1ALDA 2PDLA 3EA3A 2DH2A 1SVDA 1QO2A 2FB3A 3AWOA 1A5BA 5DCBA 3V36A 3NQ8A 4U2ZA 1JCJA 1N82A 1BYAA 2HVNA 4EE9A 2GQAA 2EGZA 4DJFC 3FK4A 1ECEA 3DKLA 3KLKA 3KTSA 5FJOA 4S3DA 3KBJA 2X2YA 4JIIX 1LWJA 1H1ZA 1TTIA 3ARZA 4YMZA 1BVZA 2J9YA 1EA0A 3BW4A 4M24A 3IJ8A 4LUIA 5EFFA 1XUUA 1E6SM 2GWNA 4YN5A 4S1FA 1YPXA 2ANUA 4BWLC 3H22A 3F4VA 4WUIA 3W1RA 3TK7A 3BTNA 4C1LA 3NWRA 3L4ZA 4JNYA 3WKZA 3ELFA 4YVVA 1PBGA 4K8HA 3UVAA 4BQ3A 6REQA 2D2OA 3K4AA 1ZCCA 4NYYA 3KBWA 5BXRA 3GUWA 5I02A 2NQ9A 1KFKA 3BOXA 3HZ3A 3NAVA 1NWRA 1UKQA 5HUPA 4TX9A 1EO7A 4OQVA 3TTSA 3BG3A 4I6KA 1KRMA 1KCZA 4UTMA 4FPSA 1ZFJA 3ZYZA 4H7ZA 4YPJA 2I9UA 3BLIA 1US2A 2GVGA 1U30A 2ZICA 3QVQA 1RCXB 1MUWA 3HV9A 1JQXA 4B5XA 1QCWA 3FOKA 4J2MA 2OOGA 1QAPA 4EF8A 4CNSA 2NSOA 2YXGA 4N42A 1SYTA 4PCTA 4QG8A 1FWTA 4QR6A 1GHRA 4ILSA 4GJIA 5LSMA 3SCPA 2FZMA 2YZ5A 3BSHA 4M6QA 2O55A 2CLFA 3QHNA 3EX1A 1Q6EA 3VKAA 2C6QA 2I16A 1B4KA 4RDYA 2OWXA 3CIXA 1FKXA 3GC2A 2E6DA 1N7KA 2E3ZA 2AL2A 3CS2A 3NPVA 2ZC1A 3ONCA 4JFSA 3L7RA 1B9BA 3IAPA 2VFEA 3NL5A 3NZGA 4L4OA 3R0KA 4HOZA 3S2JA 1XLEA 4IPPA 3GIYA 1TTPA 2Z6JA 2ZA3A 3R2GA 4IFKA 3Q2DA 5KZDA 2BVYA 2UZ9A 3QH2A 4RV3A 2AAMA 4OZOA 2W66A 4HNUA 3LCFA 1FWFC 3PZIA 1TJRA 4LVBA 4RNFA 4GINA 4AU0A 1DQXA 4CCZA 2ZA2A 3VILA 5CXPA 3ZT6A 5KZEA 4UOQA 2XIJA 4GVIA 1UKSA 2I9EA 1VLWA 4GIRA 4E2DA 1U22A 2X1UA 3H7UA 1RP9A 1UR3M 1SZNA 4GX8A 1BTMA 3WBEA 2DSZA 1EOKA 4IT1A 3WFLA 3ZWTA 3K8KA 2VL4A 1S3HA 3LMYA 3RR4A 3W1XA 3GB6A 3ZLHA 1SGJA 4AYSA 1EC9A 1W9XA 1KFJA 4HNLA 3AYRA 4BEUA 3MJYA 4IG2B 4LNYA 2E1WA 5FF7A 4JFTA 1C8XA 1NIUA 2ZFAA 3HPAA 3A4AA 1RD6A 3P8IA 3VNDA 3LLDA 3HV8A 1X98A 5HJXA 4ICNA 3AROA 2V5JA 3TSBA 5ENLA 2NV1A 3MU7A 4WJEA 3WMLA 2YYUA 3UWUA 2BGNE 2J25A 2CWNA 3R8RA 5FOOA 3N3TA 1UC4A 1ZRQA 3DERA 3W85A 1HKVA 3GU9A 2V2DA 4GLEA 4MADA 2UWFA 2QULA 3WH9A 3PFMA 1WOAA 1YDVA 1C9WA 4AAJA 4GZJA 1FXPA 3FIGA 5CQ1A 4IGMA 2EJ1A 2FHBA 5HQMA 2DSKA 2GJRA 4AD3A 3NNTA 1EJRC 1QHZA 2CZEA 1QOQA 3P0XA 1EEXA 4PFHA 3CO4A 1OFDA 3C5QA 3APYA 4EF9A 4JHZA 2ZRZA 3ARUA 3OW1A 4MJZA 3UZJA 5CZ0A 4RZBA 3NQDA 2R91A 3C0QA 1KTBA 3DZ1A 3SCWA 3BMVA 4ES4A 1A3HA 2FZNA 3WMSA 1ZL1A 2C14A 4CNUA 2QCFA 5CG7A 5H8UA 3DDMA 4AZCA 4AH7A 1XLLA 2WB5A 1E0TA 2BXZA 4GGHA 1X39A 4XBJA 3GE7A 3TQPA 5D9OA 4OBRA 1ONXA 4XZWA 1R3RA 3QM3A 3N6HA 4QS6A 2WK2A 3PPHA 1HJUA 5JBDA 3GXFA 4MY8A 3M5ZA 4Q22A 2QDGA 1HO4A 4GI6A 1V4YA 3BCJA 1XGZA 2Z6IA 2DDXA 4PL2A 1LF1A 3DFOA 1GJWA 5JBFA 1H5VA 2BLEA 3UP8A 3RU6A 1FHDA 2PDIA 2YCLA 4ZO8A 4I8YA 3QHOA 3TN5A 2ADAA 3ZFHA 1GVIA 3T0BA 1F3EA 2VT0A 3LGGA 6REQB 3L68A 4JTHA 4N6FA 5CBIA 2FMOA 3AIEA 3WMBA 5BXSA 2GSJA 1P0KA 3MA8A 3PZUA 3T6CA 4JIPA 3UETA 1NJJA 1PKNA 3TAKA 1O94A 4AVOA 4NI8A 1RJRA 3W1TA 1D3CA 1QMLA 3XINA 3KRBA 3W7HA 2WC3A 1FWJC 1JQVA 3MPGA 1TZZA 2NVAA 1PZ2A 1LLWA 3W87A 1YTDA 3MCMA 1F5ZA 1OIFA 2VO5A 4LEFA 3S6TA 3UW6A 5HR7A 2YJQA 3C2RA 2RJGA 1DXIA 3CTTA 4N9DA 1R3YA 3QKEA 3BAYA 2ZX9A 2PCQA 5DT7A 1I4NA 2VEIA 5D9MA 4F66A 3W88A 3CHFA 4PCSA 1BRLA 3CUXA 5I79A 4ZQCA 1SO4A 3M0XA 1FWEC 4A2RA 3EDDA 5A8NA 3DIPA 3MMUA 2V6AA 2WOQA 1OWQA 3EOEA 3PG8A 1Z3NA 2V63A 2VDHA 1CGXA 4LCQA 4K8GA 3UYCA 3O15A 4OUEA 4Q8MA 2H3BA 3ARVA 1MDLA 2AL2B 2OLSA 4RJEA 3UZXA 5M03A 2TMDA 4DO5A 5CGTA 2OB3A 2NZLA 1JI2A 4LUYA 4Z1YA 4UTWC 4PSRA 3BV7A 4IFKB 4Y6GA 4BEQA 1XI3A 4GO8A 3MSGA 4W8BA