1F07A

Structure of coenzyme f420 dependent tetrahydromethanopterin reductase from methanobacterium thermoautotrophicum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
321
structure length
321
Chain Sequence
MKFGIEFVPNEPIEKIVKLVKLAEDVGFEYAWITDHYNNKNVYETLALIAEGTETIKLGPGVTNPYVRSPAITASAIATLDELSNGRATLGIGPGDKATFDALGIEWVKPVSTIRDAIAMMRTLLAGEKTESGAQLMGVKAVQEKIPIYMGAQGPMMLKTAGEISDGALINASNPKDFEAAVPLIKEGAEAAGKSIADIDVAAYTCCSIDEDAAAAANAAKIVVAFIAAGSPPPVFERHGLPADTGKKFGELLGKGDFGGAIGAVDDALMEAFSVVGTPDEFIPKIEALGEMGVTQYVAGSPIGPDKEKSIKLLGEVIASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COENZYME F420-DEPENDENT N5,N10-METHYLENETETRAHYDROMETHANOPTE
publication title Structure of coenzyme F(420) dependent methylenetetrahydromethanopterin reductase from two methanogenic archaea.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 117
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 1.5.98.2: 5,10-methylenetetrahydromethanopterin reductase.
pdb deposition date 2000-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1f07A00
3RAOA 1Z69A 4UWMA 3B9NA 4J2PA 1BRLA 5AECA 1FVPA 1LUCA 1F07A 1XKJA 3C8NA 2I7GA 1NQKA 1NFPA 4US5A 1BRLB 2B81A 1LUCB 5DQPA 1BSLA 3FGCA 3B9OA 1M41A 1RHCA 4US5D 1YW1A 3FGCB 1TVLA 3B4YA 1EZWA 3SDOA 5LXEA
chains in the Genus database with same CATH superfamily
4NVTA 4ZCWA 3WD3A 3B9DA 1HJWA 5AY7A 1I2PA 1VS1A 4LUTA 4PTNA 1NY1A 1V7AA 3GNOA 1EF2A 3W85A 2XISA 3VOJA 1ISWA 1YPFA 4KCWA 4CKQA 3BZGA 2PRMA 3NVTA 2Z24A 2V8ZA 3A9IA 4L1GA 2YLLA 3GU2A 2AL2B 2AMGA 1JDCA 1YE4A 2JFEX 2VZVA 1Y7VA 3EOLA 1QTWA 4O8AA 4M1RA 2XDFA 5HOSA 4UTTA 3GXDA 4AF0B 3CZLA 1E5JA 1TYGA 1HJQA 1IGSA 3EX1A 3SO7A 5A94A 2V0TA 3HGJA 4XD5A 3TCSA 4MJZA 4DO7A 3VGDA 2CNCA 4O13A 1B2YA 3T42A 5LYRA 1PZ3A 1YDVA 3ZR6A 2ADAA 4PMDA 5CAHA 1BWKA 3T05A 1QPOA 1PIIA 3H2MA 4PUDA 1O7AA 3N2MA 3NYDA 2BTMA 1VH7A 2MNRA 1DJIA 3MDWA 4WDUA 5A6SA 4BF9A 3OHMB 5I09A 1LBMA 2E9MA 4QG8A 1F8MA 2XH4A 3URBA 4IWWA 1BAGA 1BG4A 3MANA 1U30A 4ZSTA 4LF2A 5I00A 1ALDA 2FDMA 4KGJA 3AXHA 1IGWA 2Q3OA 2NUYA 2DIEA 2V63A 4FOKA 2D23A 1ITQA 3EX3A 4JQ4A 4RNFA 4D6JA 3KRSA 5G1YA 2CLIA 1F6PA 2C1GA 1I0BA 2G3FA 1E55A 1ZALA 2ZRZA 3TTYA 1E73M 3OTRA 1DP0A 4XG1A 4PYSA 3TWAA 3ZS4A 2OEKA 3S8HA 1MMFA 1A80A 1Q6FA 1UD5A 4DY1A 3DHPA 4QP0A 3S83A 3FXYA 3HOJA 3EKLA 4IISA 1Q85A 3H2OA 3QZAA 5L6UA 2G8ZA 2YXGA 2PFHA 3BW4A 1J0JA 1W1TA 3UVIA 1K6WA 4JQ3A 3VE9A 1W17A 4N4PA 3SN1A 4RXFA 1NOUA 4W9TA 4QJ3B 1P5BA 1S2WA 3I4EA 2QDEA 1DQXA 1ZU8A 2GQ3A 1HQTA 2ALRA 2VMFA 4BJHA 1PX8A 2PA6A 3POHA 4FR6A 3WYZA 2YA2A 2PMQA 4OBTA 4K7VA 3ZWSA 4AD1A 4MSSA 1IIGA 2IUZA 3H7VA 4G5DA 1VBHA 2X05A 1DQWA 4AVOA 3FHQA 3ORWA 4XIAA 4JYDA 1GTEA 1ZGDA 2GWNA 4D8AA 3ZR4A 3M4HA 3CAVA 1PZ0A 1TCMA 2NT0A 2GOUA 1TJ0A 3VC6A 1P0NA 2GQ9A 1NF7A 5F7UA 3GG7A 5LIXX 4AD5A 3AFBA 3QFEA 1Y5WA 1RLDA 5FJIA 4IZGA 4GUJA 2PDCA 4DUOA 5HA7A 3RIKA 3CHFA 4UXDA 3EOUA 1B30A 4HHHA 1X97A 3N29A 4DWSD 2CLKA 1QDSA 3QPYA 4JR5A 2ACSA 4JDBA 1J0HA 2OXNA 3S6TA 3H2EA 2EO7A 1MDRA 4ADUA 2L5HA 3IRDA 4JX4A 3TYZA 3EBVA 1JL8A 1VZWA 2V6AA 5HQLA 2GUUA 2Y85A 3T0CA 7ODCA 3AHYA 5GJMA 2XVGA 4BK9A 2H3DA 4QGCA 3AISA 4B9YA 3FXGA 1JAEA 1XICA 4AXNA 5C2XA 4UQDA 1QO5A 4UQ9A 4UTUA 2D20A 4FNRA 2YFOA 3N2OA 2WAGA 4GFIA 4AHOA 4ZXLA 5AHMA 1F74A 1MFUA 2PLMA 5CPNA 4YHEA 1SMAA 3UZWA 3BQ6A 3TNOA 5FJTA 4YN5A 4N7QA 1QI3A 3QRHA 5HPOA 1OY0A 3EXSA 3W88A 3EB2A 4JFUA 5HATA 1T6MA 1S3HA 2QLYA 2D24A 1TUXA 3V1HA 3FOKA 3MP5A 1TVPA 3I3EA 4ADTA 3UR8A 4IJBA 3V5FA 3OVQA 4FLSA 3OP2A 4R3UA 4TX8A 2BBFA 3VFLA 5C5YA 4GYKA 1XIGA 1FH8A 4D71A 3GKAA 3EDKA 5ABHA 3LCHA 3UEQA 1JPMA 3CWHA 1UWSA 2ZUSA 2BG5A 5TBOA 1OINA 2OJPA 4DZHA 2NQLA 3W7DA 4WR3A 1FCQA 3QC0A 5HWNA 1R47A 3PB0A 4WD0A 2AL2A 2G96A 1EOMA 1BEUA 1E1FA 2VFIA 3W2MA 2GYIA 1VYRA 2PWUA 3E6EA 5U7SA 3OG2A 4GQRA 2ZX5A 3SY1A 3VKJA 1CX9A 3DKLA 5AZ0A 4C7GA 1I6NA 4AF0A 4AUBA 3WLKX 1O95A 3VKCA 2FTPA 1W1IE 1XD0A 3CM4A 1W1YA 1IHIA 2PGRA 2V3GA 3C56A 3QR3A 2E3ZA 4PCFA 1I60A 3N6HA 4IHCA 4L4PA 1OVDA 3O63A 4HSOA 1MQRA 3WEZA 2WCSA 5FEZA 3SGZA 1C8XA 1Z3NA 3HPFA 5DQPA 3L2IA 1EBHA 4LNCA 4ZODA 3E2SA 3ZJ7A 2R8WA 2J24A 3RO6A 1DORA 4C65A 3WJZA 2PDNA 3B0PA 3B8IA 4UTWA 1SO5A 4M29A 3UU0A 4L1XA 3VIFA 2VFGA 1F9CA 3OBEA 1WYIA 1MNSA 1V6XA 2OO0A 2WNNA 4I5XA 1F5ZA 3GDKA 4YVVA 4KQNA 3RLGA 1O12A 4ZB5A 1EDGA 2ZC1A 1TTQA 2G3NA 4ENLA 3CEUA 4S3AA 2XM1A 3M7SA 2QUMA 4X9SA 3N2XA 3AMDA 3BANA 4NI8A 3W7MA 1U22A 4HQVA 4URIA 2WM1A 3DEQA 2Y1HA 3BLIA 4DVOA 3UR7A 3UETA 1Q6EA 4WSKA 2FPVA 4Q3MA 2EF9A 3LTYA 2Z6JA 1CXHA 3I3BA 3FAXA 2GGJA 3TZNA 1DJHA 4W5UA 5J8LA 2ZZ2A 3QGAC 3BJSA 5K3VA 2QPXA 4NZ4A 1FHDA 3VOIA 2CLOA 3FDGA 3B97A 4PA8A 3BCJA 1NDVA 3G77A 4PB4A 1HN1A 3BURA 1G7VA 3FY1A 1SFJA 1H63A 1C7TA 3IJ6A 3IV8A 1Z7AA 4U31A 1BTMA 2ZUVA 1DJZA 2I5IA 2FMOA 3BGGA 1QOQA 4ZO6A 4ROPA 3WN6A 3UXAA 1PZ2A 3DN5A 3SSJA 2OOGA 3FEQA 3BH4A 3FFSA 1EB3A 1OK6A 5D4YA 3PTQA 4MNLA 4ERAA 2WHJA 1RSCA 3ABXA 2F2KA 3BLFA 2D0GA 1R2RA 3F4VA 3NQ2A 3W28A 3KDOA 3RPMA 4H19A 5E93A 5J04A 1MYRA 3IWPA 3VIGA 2QHAA 1U1JA 4ZTXA 5HR6A 4E8DA 1ITUA 4A3UA 3U5YA 5K4XA 4TQTA 3TYBA 1GPWA 2QMKA 4H7CA 1RA5A 3TYEA 4QHRA 2WXDM 3VMPA 3GS6A 3MI3A 4O50A 4EF8A 3HJEA 1FH9A 1R6WA 3IJIA 1XINA 4OECA 1ONRA 3OLGA 2V5JA 4JIHA 3TNBA 4H9VA 3HQ1A 1WP6A 2GGGA 3PM6A 1M1BA 4JIQA 3K46A 1GOOA 3FDKA 1FCBA 5AYZA 2O4QA 3N6QA 4G1KA 5BROA 4WY0B 1XLAA 4IMCA 3UWZA 1DIKA 1EPVA 1NFGA 3IGXA 2A3EA 3NCOA 3NEVA 1K9TA 5AC4A 2EAWA 1AL7A 3W7EA 3HGSA 3TQPA 1BVWA 1JPKA 4O52A 1RVKA 1GOKA 2UY4A 2XUCA 4PE8A 4ZL1A 1MDLA 1VCGA 3N9KA 2PDKA 3TTQA 1UH2A 4QJ1A 1THFD 2ZE0A 4PRWA 3TZFA 4TVCA 5K7JA 1FP9A 4GY0A 4X22A 3SR7A 4HPXA 2REQB 3SRHA 1QHPA 2Y5SA 3TFCA 4UCGA 1IXPA 4H04A 2QCHA 4O0QA 3QGVA 3GDLA 5HULA 4HNCA 2VWSA 2VNCA 3WD0A 1UD6A 4Y9NA 3CAWA 4NHVA 1G1YA 2ZTJA 3M5YA 4FXJA 5CPMA 3BAWA 3S5ZA 1RVGA 1RZMA 3RM9A 5EFFA 1UG6A 3Q4DA 3M07A 2PDWA 3EKZA 2A3AA 4LVAA 2VX4A 4GH1A 3AC0A 3W2JA 2AQVA 3DFQA 2A6NA 3SCRA 4DBWA 1XX1A 3WK2A 4RKAA 4JTQA 1GJPA 3CNYA 1QR7A 1GVRA 2XN1A 4XZNX 1AJ2A 4M19A 4GACA 5FAJA 3WH9A 1O5RA 5CZTA 1FCUA 5AFDA 1W3KA 2HBXA 2W4XA 4R33A 3VDAA 4HMEA 2V3EA 2XN2A 1T96A 1CNVA 3W1AA 1V77A 5ENLA 3TJIA 3WNLA 1TRIA 4XZIA 1WUEA 2ZTKA 2ZE3A 4S3GA 4W7VA 3TA9A 4IP5A 4FX7A 2VZUA 4UOJA 1KV5A 5HJXA 4WX2A 1S5TA 4CNUA 1EWDA 2FHCA 3LXAA 3S0CA 4IUGA 3ZR5A 3KW3A 4XTIA 2I5GA 3U2OA 3WQWA 1ZBVA 3LV5A 4DYKA 2D0HA 4IIGA 1QI4A 5LNRA 4RL3A 3ZJKA 1Q6DA 3QW3A 1TX2A 1RAKA 1FH7A 2JGQA 1JF5A 1ME7A 1HKIA 1V0NA 2WZEA 4ZA0A 4ATWA 2VRJA 2VQUA 2D69A 2HK0A 3RILA 4GIYA 5FL1A 3WFLA 1D8CA 1KM0A 4GOAA 3CQKA 1EGZA 3B4UA 5BZAA 4HSHA 4YS1A 3TEVA 1XPYA 1KO0A 3P67A 3EWYA 1IF2A 4L9YA 1FRBA 1CI1A 3KLLA 3O15A 1KM1A 3KHDA 4KWWA 2C71A 6PTDA 4JKKA 3WH5A 3VGBA 4OWGA 4UB9A 5A3HA 4IJRA 1YDYA 1S2VA 1JQVA 3GSMA 3CH9A 3ZVIA 4YJ5A 4XAGA 1KW1A 1W5OA 2CLFA 1C9WA 3E0WA 1HNYA 3H24A 2VGGA 1NWUA 3QMTA 3BAYA 2PTYA 1NVMA 4RE2A 2X42A 1PVNA 3W83A 3TOPA 1CDGA 4KCTA 4BKNA 3W38A 4WXYA 3H2AA 3GAKA 3GY1A 2EG6A 1I2NA 3O8AA 4QE1A 2DORA 4IF2A 1GOQA 5AHEA 2G4JA 2XIQA 2INFA 4V27A 4H7VA 1G69A 1OYCA 4R7WA 2RGMA 5CSUA 3T2QA 2OKTA 3THUA 4JN7A 1VYSX 1H11A 4QISA 3KWSA 4C1KA 4LOCA 3R12A 1EPXA 1E4NA 5CBBA 3NSMA 3WQGA 1TR1A 4HNUA 2V5BA 5B80A 2W5FA 4H6QA 1FWTA 1RCQA 4NZCA 4PUMA 1DIDA 1M5WA 3B40A 4YU1A 1I75A 2DVTA 2O7QA 3IK2A 1PBGA 3DGBA 3LRKA 2HNEA 2P88A 3N14A 1VF8A 1UMYA 4XSMA 1UPPA 3DC8A 2PBGA 1GZ1A 4QG9A 2BX7A 3B4YA 3UG3A 1TV8A 4MGGA 5G4WA 6CGTA 2WW5A 3C6CA 4Y9AA 5HANA 3VIMA 1FCVA 2HWGA 4A3QA 2OQYA 1P4CA 3MV11 3AIBA 4HU8A 2FHBA 1UD2A 4Q8TA 1JCLA 2BVTA 3RMEA 1KR0A 5C54A 1IIHA 5C9UA 3C0SA 1BHGA 2ZRWA 3NGJA 3CTTA 3UNDA 3UP8A 1FHUA 1AZ2A 2GJNA 4AD0A 3AU2A 3AIRA 2XGIA 5LIUX 3VIOA 4AC1X 1EBGA 3E1F1 4WY0A 1X8FA 2OZ3A 2GVEA 2PRLA 4G7EB 4P7QA 1XDJA 4PTVA 4PMNA 1P1XA 1ZS2A 2YDSA 1N55A 1OK4A 4F4RA 1GVYA 1A5MC 3SAZA 1GVIA 3O06A 3SUWA 2A7PA 2GK1B 3IV3A 3NQ8A 2KX9A 2Q6ZA 3QV7A 1XG3A 1H7WA 4HA4A 2QPSA 5AHIA 3HPSA 5A8MA 4XAPA 2EG7A 4Q4MA 4BF5A 1XUZA 2CZ5A 4NJIA 2REQA 1DHPA 5T9CE 1DWFM 4IPNB 1KFLA 2W63A 4ZQMA 4XQ6A 3WD1A 4X2RA 3LG3A 2FTYA 1J6PA 3GO2A 2Z26A 8CGTA 4HNLA 4RW5A 3WQPA 4L61A 5G1MA 4A22A 1UH3A 4TV6A 4M6UA 4ASTA 4ZENA 2ZUMA 3GNNA 3MHGA 1JDEA 1B4KA 4S3FA 3SFWA 4DNMA 1KCKA 3KX6A 4TVDA 2ZRYA 3LENA 3MUIA 3PN8A 5D09A 1Z44A 2EKGA 3N3MA 1B57A 4IFKB 5HINA 1FWBC 1B3WA 4PMJA 3OJGA 4F2UA 3GAYA 2V5KA 3A3HA 3H7RA 1W1VA 2YSWA 2H9AB 2ZBTA 4CVWA 1W3NA 3STFA 2PGEA 1S38A 5XIMA 1B90A 1KRAC 1JGIA 1KBJA 1W6TA 2ZX9A 3W82A 4EACA 1N7KA 2O92A 4QSFA 1F73A 1UWUA 4WJEA 2PDFA 1P7TB 3L5LA 1BF2A 3G6LA 1V6WA 4C6DA 5CC5A 1EHAA 3TDFA 3BOLA 9XIMA 5DELA 1HX0A 3WLQA 3TC3A 1H1NA 2H3BA 2V5DA 5LIYX 4U28A 1RPXA 3CZGA 2PSNA 4DF1A 2YCIX 4QQ3A 5LIWX 2PWDA 3KE0A 1UBSA 1HL9A 2VWTA 4YTTA 1AODA 2WHMA 1YNQA 2WYSA 4HU3A 2H8XA 3MCNA 3SRDA 1YW1A 2YXOA 4QE5A 1TWIA 1GNXA 4UTKA 4ACYA 4FNUA 4Z2HA 1WKYA 2C19A 1R9ZA 4MNMA 3KBSA 4E2VA 2X0YA 2QZRA 5AOUA 1KBLA 4Q4KA 5EY5A 5FL0A 4LUYA 1LL7A 4MJ2A 4ZO8A 4ONVA 3DFYA 3P0XA 4UBPC 3T0BA 3JU2A 3UESA 2WNWA 3GDMA 3DU0A 4QS5A 3IUIA 2Z1WA 1EXPA 5EMLA 4DJDC 3DGRA 1UKTA 2VC9A 4CNSA 3PF3A 1JRCA 4R9XA 3TYUA 4QLLA 1BXNA 4XBSA 3CQHA 4O14A 4ROQA 1TWZA 2B0MA 3FS2A 4S1FA 3DERA 1EQPA 3RXZA 4IX2A 4O17A 3ALGA 4GVHA 3FA3A 3UY8A 1TPFA 3HTWA 3U4AA 1FXPA 4E2BA 3JS3A 4OJYA 2VFHA 4J3WA 3VD9A 1B0IA 2O7SA 3CJPA 2YLAA 1W1B1 4FALA 3VILA 1UZ4A 2UV8G 2ZX8A 2OMAA 4AFYA 1EJXC 3USBA 1Q8AA 3W29A 3EMZA 2ESCA 3WMLA 4WY0F 3UVAA 1GVEA 4ZQRA 5LA0A 4LEFA 4GCXA 4GZIA 1WA3A 3OLEA 3NXLA 1JCXA 1JZ2A 2W61A 2WKJA 1VFTA 2OZ8A 4CN6A 4KEUA 3LBCA 1QNSA 2EJ1A 4JTRA 4ECLA 3QZEA 2PC8A 1ADSA 3O05A 4EPDC 1JF6A 2V9DA 3B9AA 2ZC8A 3AIEA 5HUPA 4XZMX 4XD6A 3VIHA 4O8RA 3LBMA 2HJPA 5EMYA 2VDGA 1YRRA 1M04A 2YZRA 1UD3A 2VURA 1X7IA 2VCAA 2BXVA 1FWAC 2SFPA 1I1WA 4Q8WA 1H7OA 1MFVA 2ISWA 5IBXC 4H4IA 1KM6A 4X60A 3L67A 1LL6A 3VU2A 4UIOA 1U83A 1XRVA 3NUKA 2QIWA 3WK3A 2QPUA 1XYFA 3BV7A 5LNUA 1BQGA 3GDRA 5LXEA 4X0VA 3S5NA 3GDBA 1WDRA 2Q8ZA 1ISYA 3PTKA 1V3MA 4G7EA 3CPUA 1X6UA 4P7LA 1PHQA 4J7RA 1H7PA 1HL2A 1Q6CA 4PFMA 1OC5A 3LCLA 3UWWA 2GK1A 5HQEA 2OZTA 4DI9A 2E77A 2WOQA 1UOKA 4ZQCA 4F48A 3S6DA 1BGGA 1I2QA 3PANA 5BOFA 1AW2A 1JIBA 3KVKA 1T8XA 2VCBA 3HMCA 3CU2A 3ZT6A 1Q6LA 4LY4A 5G2IA 1RBAA 2GZXA 3MQTA 4MIMA 5A6LA 3VKKA 5FSEC 1SZRA 3B9NA 3RM4A 3EEZA 1G9HA 3NO3A 1IWBA 3VOCA 1PKNA 4KRZA 4KIRA 5CC3A 4LAMA 5A8GA 5A6JA 2WM0A 2YCKX 1RR2A 2XFYA 5C9RA 1A47A 3SCPA 3BOXA 2FJUB 3DHDA 3LTPA 5J5DA 2PP1A 2Y63A 3VOHA 2A85A 3GR7A 1W9UA 5E1QA 4IFKA 1OGGA 3FSUA 5DLCA 2C8NA 3CMGA 4BI5A 4OZOA 4B5UA 5MKGA 4K7YA 3T0TA 3GFXA 3VIKA 4ZE4A 3NQCA 4LS2A 3U4FA 1ZRQA 2H9AA 4UC5A 3QOKA 3VOGA 1GGOA 3QY6A 1QASA 4N42A 4CEUC 4Q8OA 3P0WA 3TFXA 3UWYA 3ID7A 3UCQA 2ON3A 4JFVA 3W2LA 4Y8FA 4N9EA 1CB7B 5I3DA 2RHGA 2AKZA 1P7TA 4AYGA 3WBEA 2Y7DA 1JZ3A 1LBFA 1QI2A 2CC0A 5CEWA 4CGTA 4GPNA 4FF7A 1GYNA 4P8XA 1Y8BA 2BLEA 2VX7A 4JTJA 1CB2A 2Q8LA 3B3DA 2B7NA 3QR1A 3CUGA 5I3HA 4CCZA 1UA3A 3RG6A 1ZJBA 4LRTA 1IE7C 1DJGA 4KCUA 2NX3A 2JKEA 4U3AA 4WOZA 3S1UA 1UYQA 5HNRA 1G4SA 1KCLA 3NURA 1E3ZA 3SQLA 1DKWA 1E51A 3N18A 3WG6A 5E0KA 4V1YA 3MA8A 2BP1A 4I7WA 2GDVA 2OT1A 1DJNA 3LQGA 1XL9A 1H7XA 4JHZA 3WDHA 4S3BA 3UJEA 4MB5A 1JCMP 3QKEA 3W2UA 3A5FA 1JULA 2OLAA 3EWXA 4NY2A 3M46A 3NL6A 3S1VA 4RE3A 2VENA 4GZEA 2BHYA 4H3DA 4YWSA 3IIOA 5BXSA 4W4QA 4M56A 4DNHA 4M5PA 3S47A 3SY5A 1FWGC 2OWCA 1VKFA 5JVLA 5F1UA 1J11A 2NXGA 4GLEA 1XLHA 3LMZA 3ZXWA 4QCFA 2PPGA 2VO5A 1NFBA 2OEMA 1FWDC 1HKWA 4ML4A 3AIWA 8XIAA 1EP2A 2WO5A 5BXTA 1JYVA 4O57A 4QITA 2WB5A 5AYYA 1J0KA 1NQ6A 4NASA 2Z1BA 2WV8A 4DXKA 1E6ZA 4D6HA 5CCZA 3RCNA 7REQB 3CUJA 2DVUA 1UIOA 2G95A 1QK0A 3LSBA 3ARPA 3WDIA 1QNRA 1A5SA 2XSAA 3PY2A 3PZ9A 3LUTA 1WDQA 3AICA 4QG6A 3MUCA 4F9DA 4DZ5A 3KTCA 3GD6A 3EMCA 3LD5A 4PTXA 5HDRA 1HFBA 1LZOA 3RYSA 5U4NA 4Z42C 3PSVA 1TJRA 1EL3A 1W91A 2XSBA 5I3FA 1VFLA 3TE9A 1JCTA 1RH9A 2WQDA 3CZ8A 4CCDA 5DMYA 4PUKA 3W26A 4UTMA 5D32A 4Y90A 3AMLA 2CBJA 3VX0A 3ITOA 1YMYA 2HS6A 4M7TA 1WAWA 1EIXA 4NP7A 3IVSA 2PD5A 3OU8A 4K8EA 2C13A 1F76A 2Q09A 3O2LA 4J2MA 3B0XA 3WF3A 1ADDA 5A6AA 3TYAA 3Q45A 3WZ0E 1XWYA 1OWQA 3PAOA 1W3HA 3N3TA 1N82A 1D9EA 1VPXA 3NQVA 3H70A 3N17A 4LYRA 5BRBA 4B9ZA 3PFRA 1O5QA 4AHQA 3DBNA 4DJDA 1UZ1A 3WQ4A 2TYSA 6REQB 1DWHM 2H90A 3SCWA 1SO3A 4MNJA 3W72A 3U7BA 3TUUA 4H01A 1RBOB 4EOUA 1IXNA 5BRPA 3UXLA 1NH6A 4BI6A 2R14A 4QEHA 2PAJA 1O68A 4PBEA 1B3VA 2ABAA 2Z7KA 4AIOA 1S2CA 1XCFA 4UOZA 4EAMA 3ZWTA 3LCXA 4BEQA 4MMWA 5D2WA 4FF5A 5G2HA 1MSSA 1LG2A 2C0AA 1OT2A 1OCBA 1NQKA 4MZYA 3L2LA 4RNJA 1OX6A 1J96A 4LAKA 1KA9F 1TZ7A 1YX1A 3GR8A 2J9YA 1Z42A 2DU2A 1AMKA 4P61A 4WJXA 4LC6A 3L4VA 2DT1A 2V67A 2PDIA 1SYTA 1KBIA 3WUBA 3C8NA 1KBBA 2WJZA 4IX0A 3KM8A 1ZPTA 4JTUA 1K02A 4HA1A 2C3ZA 2DW7A 1FWEC 4OOZA 3EA1A 3W1UA 1VEPA 3VZXA 4RNIA 5FF7A 3KFTA 1UHVA 5JIWA 4UFMA 1KWKA 3KOWA 2WJFA 4AB4A 3NQ7A 2CKRA 5IFPA 3VGEA 3UPBA 1AG1O 4HPJA 1E9LA 3WQ6A 1ADOA 2P0OA 1GPFA 2OR2A 3RR4A 2G3MA 4NJHA 3SCQA 4OV9A 3L4UA 4O1BA 4S39A 4JCLA 3UY7A 1X98A 4AX6A 4LS0A 4MLJA 1SVDA 4JQAA 1IT0A 3AUJA 5IBXA 3GHRA 1U1UA 4JY8A 1U5HA 5CZJA 2BOEX 5LNWA 4US5D 1CLKA 2B31A 4M6VA 2PCEA 1VRXA 3N25A 1A5CA 2NV9A 3E2VA 4C6IA 3CT2A 3NIYA 2JGYA 1DIEA 4LYQA 1BPLB 1ZFJA 1Z41A 4ERIA 1B9BA 1IEQA 3IUDA 2WC7A 3PR2A 4QNEA 3SCNA 1OFBA 2IQDA 3V5CA 4MKNA 1R3SA 6XIAA 2XVLA 2E09A 1XIJA 3V36A 3OVRA 1GONA 1KFEA 3VE7A 4HMCA 4RE0A 4KFOA 3FHAA 4YL2A 4DM2A 5C9WA 4UMAA 2DSVA 3BAJA 3DX5A 3P93A 6ENLA 4MTVA 4YVXA 3STCA 3WX7A 4Z2GA 2DZVA 3CYVA 3OIXA 4O11A 3O7UA 1HJSA 3JW7A 1SO6A 4WRHA 5I02A 3AXKA 3IAPA 5DT7A 4WKFA 4WKHA 4GQ0A 3K30A 1X1NA 1S5WA 5FA5A 3LOTA 4WSJA 4HTYA 3KBWA 1J79A 4JTEA 3PNZA 4QQUA 1J2WA 4XIMA 3P61A 1XSIA 2XIJA 3VD4A 1V02A 4V28A 1DTNA 4J1OA 1W3LA 4TVUA 4C6LA 2VC7A 1YQ2A 2Y5EA 1T40A 3RCMA 4UMCA 1AFSA 2Z00A 2OG9A 1FTXA 4TU1A 3FW6A 3LI1A 1W56A 4C6OA 5FF2A 4L6DA 3RGTA 4LW7A 2VFEA 3C8FA 2Z1VA 3WLHA 3HN3A 1MW1A 4JTGA 1TRDA 4O1CA 4DX3A 1UBPC 1ZTVA 5CPLA 4AAJA 2V2CA 7REQA 4PCPA 3KVJA 3E12A 4UQCA 3QW4B 2W27A 2ZCGA 4F0SA 1S3TC 1OFPA 1L6GA 3WLNA 2XSXA 3LCWA 1CGXA 3WMSA 1JNDA 1SPQA 3RMJA 3NR0A 1DL3A 1XSJA 2Z2BA 3W7LA 4N02A 1U5JA 3ARXA 4O28A 3DDMA 3G3MA 8XIMA 3GC4A 2CXGA 3T8QA 1SZFA 3UQNA 5DFAA 3H8AA 4HHMA 3XISA 1UWAA 1C9DA 1XBVA 3BLLA 3QV8A 2JK2A 1REQB 3N2CA 1NM9A 1FOBA 3TW9A 2YYTA 1Q8JA 1M9HA 3WQVA 3WNOA 2QJGA 1NDZA 4U2YA 4B16A 3OEXA 4MADA 2OTDA 3WIJA 3S6OA 3NDZA 5LXXA 3PBWA 3C86A 2PDMA 3E2RA 1I2RA 2ZRVA 2D2HA 3GIQA 4AWEA 3WUGA 5HMFA 3SUSA 2WVVB 2PLCA 2ATMA 4YXGA 3P7YA 3KVLA 4PMZA 5DBTA 3PUGA 1KM3A 4E4PA 3NQDA 4NYUA 2INEA 1RK6A 4OE7A 4PGLA 6A3HA 1DJWA 6REQA 2OZ0A 4POCA 4TV5A 4M81A 1S46A 1OD8A 1RCOB 3TVAA 3C2FA 2P8CA 1KCZA 3L0GA 2INZA 1TPDA 3PJUA 3HA1A 3CUXA 5FEPA 2CXEA 4IPLA 2P10A 1ZP4A 3A5VA 2BFGA 4KFPA 3YPIA 1QU4A 1DVJA 1B3ZA 4CUCA 4JL2A 1SUXA 1W8SA 3SUTA 3VDHA 4XD4A 4AZHA 1TZZA 1C29A 4OBSA 4JTAA 1DWJM 1A0EA 3QOMA 4XV0A 1O66A 3PBVA 4GIRA 4D2JA 1CT5A 2OT0A 3G1FA 4PR4A 3SN0A 4LVBA 5BOOA 2YPIA 5C9XA 5A2AA 1UC5A 3UG8A 4RXGA 1ESWA 2VEPA 2BXZA 5AHFA 3PJTA 2QVHA 3HG2A 2PU0A 3IVTA 5FKYA 5GJNA 1UKQA 3FKKA 3THAA 1ML1A 3GH5A 2C1HA 3OBKA 1QWGA 1QXLA 3V5OA 1RALA 3TW7A 3OO2A 3AS1A 4PC8A 2BASA 5D38A 1EO5A 3MUXA 2TODA 4S38A 3T55A 3IK4A 3TAOA 2A79A 5BXPA 1AW1A 1KLYA 3UZXA 1WXJA 4I7VA 3E02A 5BCAA 1XYZA 2BHZA 1US3A 3TYCA 5E9XA 1GJWA 3M0VA 2CFFA 2F61A 2VC5A 4XISA 1PX3A 1J18A 4ZFCA 3QR0A 2X30A 3VNKA 2QR6A 3GB6A 5D9MA 3LTSA 1PSCA 1TO3A 1K03A 1Y65A 4XTDA 2R24A 3ONCA 3UFYA 2V3FA 3GK0A 4XUYA 3GDTA 3JUGA 1Q2SA 4DF0A 3BV4A 3B04A 3FVMA 5AKQA 5BW6A 1VHNA 4N6EA 3DBPA 4LPCA 2CHRA 3SUVA 1LQAA 1S2AA 4ZB0A 4QX4A 1I9CB 3AROA 3CYJA 3DKJA 1AQHA 4ICCX 4PL2A 2C79A 1WDDA 1N8IA 3MS8A 2I56A 4BR1A 1VHCA 2ANUA 3AIUA 1BRLA 2CLEA 1FHLA 3MVIA 1QI5A 5H8UA 3V7PA 3L2MA 2J4GA 3FEMA 5EYWA 1J0ZA 3DG7A 4G9PA 3VNZA 3WDJA 5C7HA 4XKMA 5EGRA 4BCEA 1SW7A 2QXWA 2W3ZA 4ATLA 4FO4A 1DIOA 1N8FA 4Z2JA 4KS0A 2J9ZA 2QV4A 4LT9A 4WQ6A 2QV5A 2F7FA 2FYMA 1TA3B 4UZSA 5CJMA 1RPKA 2IXVA 3BGJA 3MTWA 1LORA 2CWNA 1AVAA 4L80A 2BB0A 1K9FA 3G8RA 3NEHA 3B06A 4MAZA 3C3NA 4V33A 2VUYA 4EK7A 1ZY9A 3F7JA 3R13A 3HURA 1EIBA 2PDHA 3TN6A 5CG0A 5H6HA 2HVNA 2IPFA 4JZ5A 3TSBA 3SCOA 5SWUA 3RLVA 3M0LA 1US0A 3AQUA 2WANA 3JVAA 5KSWA 4RDZA 3OQ8A 2IPWA 2XFWA 4PBGA 2BY0A 1CXKA 3LDVA 3FYPA 1WB0A 5F1VA 2QJHA 4AG0A 3WQCA 2PDUA 1IWPA 3EDDA 4C6PA 6TIMA 5HBFA 1Z89A 4MWAD 2J7BA 1ICSA 1T7LA 3PZTA 2DZUA 2VCCA 4NAFB 4A3HA 3E49A 3WKZA 1ZUAX 4UR8A 2HE5A 1AL8A 1XLBA 1YTDA 3W7PA 4B92A 2QIIA 3TN3A 4DBUA 4NL1A 1MZRA 1PIFA 4ILSA 2LLEA 1PEZA 1P1MA 4ICMA 4AWUA 5DEZA 1M01A 5J5RA 3RITA 3UCCA 1EX1A 4LAZA 1OG6A 2QJIA 3WJWA 3S2LA 1AD1A 4CLMA 3BW2A 5AZ1A 1J0YA 1I0DA 1WKEA 1M65A 4GK8A 1F05A 3URQA 2WMFA 1REQA 1UMLA 1G4EA 3W81A 5B7ZA 5CJ5A 3SM0A 3V16A 5EBUA 4XKYB 3NQBA 3TKFA 1W5QA 1QPRA 1JXJA 4C6BA 2P53A 3NG3A 1V0LA 1XJBA 4HD5A 5FACA 2JIEA 4PH6A 1KXHA 1VD6A 3QSTA 1BYCA 4MUZA 2WVVA 3NM3A 5FESA 4JEJA 4AZGA 3PUOA 5F2GA 1ZL1A 3UYIA 3QN3A 4HJFA 2ZVRA 1LF1A 1FKXA 1F3WA 2RUSA 3QLDA 3E38A 1WPCA 2ZWYA 4GNVA 4AD4A 4QR6A 2P50A 3TJLA 3LNPA 2NVCA 4FP1A 1A5KC 1FWHC 2ZVIA 1B3OA 3JRKA 3R94A 1OQFA 1HJXA 2OOFA 1QMLA 4W85A 1HJVA 3OHIA 1UQZA 4BY3A 5FEWA 2NT1A 3PZQA 1SJAA 1F6KA 2BGQA 1EQCA 4FX6M 1NDWA 4NX0A 2IQTA 1H61A 3W6MA 1XGDA 3GVWA 4IGMA 3NPWA 3T07A 4FNTA 5EKYA 5C2CA 5D2VA 3DOPA 3LCIA 5KZMA 4AEEA 1PWLA 2Z2UA 3VZZA 3CIVA 3ZT5A 4AVNA 1IEIA 4XZ9A 5GJPA 4NU7A 1ZZMA 3FA4A 4YTUA 1KFWA 3ARWA 1XLFA 2WC3A 1O94A 1ELSA 5A8PA 4IMEA 3UZJA 2VUNA 1ZB5A 2CLHA 1L2QA 2G37A 2ZIDA 2PWHA 1P0EA 2I9UA 3CTLA 1XH0A 1OF6A 3UXKA 5A8QA 4MWAE 4JHOA 3BOFA 1JDDA 5FJRA 1J6OA 4KBXA 4E2OA 3LCGA 3WNPA 4MG4A 3KCJA 3QGKC 3WBWA 4E5TA 3SCVA 5A5WA 2WSPA 1DXEA 4US6A 3WDQA 3WNKA 1RP9A 1WXZA 4K8HA 4MKSA 1Z48A 5FF0A 3SRFA 3ITCA 1XISA 2G50A 1R30A 3ABQA 1OX5A 1OC6A 4UR9A 4RLIA 2D73A 1BTCA 1SR0A 1NJJA 3BGAA 1LRQA 3GU1A 1XPGA 4S3JA 1H5YA 3K13A 3DXIA 2BSLA 5CPQA 3S5YA 3AS3A 1RQEA 1K8XA 5IRPA 4JFTA 3GIYA 1NAL1 2ZXBA 3GTIA 5A2CA 4L7ZA 2R1NA 5I79A 1KFKA 1GYMA 2WWCA 3TR9A 4JXCA 3CH0A 2R9RA 1V93A 4PB5A 1UD4A 3I7SA 2PDPA 2XIMA 3H22A 3T0DA 1UPMB 5I0DA 3ZSTA 2CHNA 1WZLA 1K9DA 4WDWA 3LPPA 1H0GA 1J93A 4Q4SA 3IS4A 3R1ZA 4OOUA 2HQAA 1R3YA 2PE4A 4GXPA 3S42A 1GOXA 4AIEA 2NQZA 3MU7A 2NXIA 3SB0A 3ECQA 2WZTA 4PMOA 2I17A 4GISA 5EA9A 3QSRA 1QBAA 4I5RA 1LWIA 4C7FA 3R7MA 1V6UA 3KUMA 1V7YA 4O16A 1VIZA 5EL1A 2HVOA 2ZZ4A 1QW8A 5ABFB 4C7DA 4CCEA 1TA3A 4GWEA 4GKTA 1Z6KA 4MOZA 3ARUA 1ODUA 4JTSA 3U6WA 2VR2A 4F0LA 3DESA 5CZKA 1E6RA 1TREA 4O1AA 4H9UA 1LCOA 1HGYA 1E56A 1GEHA 3K8LA 3UD6A 1WUFA 2AQWA 3WLMA 1VIWA 1YTKA 3ARTA 3THCA 1L0PA 4E6MA 2W92A 5I06A 4CQAA 4HNNA 3WLIA 5CKSA 2WPGA 1EDQA 2QCMA 1QHOA 3L5AA 4GZ7A 4ZQPA 4EF9A 4NNCA 4Z2LA 2YB4A 3WH6A 5CBIA 4DJED 4NAFA 2YXXA 3IJDA 3TSDA 3RRAA 3ELFA 1S2UA 4DRSA 4G8TA 2C0HA 1K7EA 3STEA 5IDIA 4NYYA 2CERA 2JALA 2NQJA 3R4IA 1NFPA 2JIWA 4GY1A 5CC6A 3O07A 2B7QA 5G4HC 1LLWA 2Z0IA 4YYCA 5XIAA 1ZJHA 2Q71A 1O6IA 1E0XA 2J27A 3IEBA 3F4CA 5I5RA 4DIAA 5DN1A 1VLIA 1PTAA 5TNVA 4QSHA 2J79A 3G0XA 2O9RA 1QW9A 3NZ1A 3VIIA 4XKYA 2H8ZA 3BCDA 3VIPA 4YYFA 4Z0SA 3ZO9A 4BF7A 1BYAA 4GGBA 3TP4A 2GVGA 3MDUA 4Z1CA 2HBVA 1IT7A 3LHWA 3L5MA 2AMXA 2PP3A 3KBVA 3VUSA 2IKGA 1GG0A 2GUBA 3CZKA 3FYOA 1LM1A 5DRCA 4Q8VA 1V3LA 1OC7A 1BF6A 1AQMA 4O4WA 3PWAA 1AQ0A 3GNXA 2PC4A 3B03A 3V75A 2B7PA 2NWSA 3CC1A 4GUIA 2A6LA 3LY0A 3ZM8A 1W9BM 2NUWA 3G0SA 3AYRA 5CSYA 2UY5A 1AH4A 2KZHA 4IP7A 4PSPA 4AW7A 5AVNA 1LG1A 2QT3A 5IHRA 4DWDA 1KGWA 2BVDA 4GUHA 3A4JA 2ZDSA 3PVFA 1P0KA 3L66A 5H2ZA 4TOQA 5CZSA 2E6DA 2X0SA 2VC6A 3SECA 3KBNA 2PTZA 3ERPA 1Q6OA 3SI9A 1BKSA 1XLGA 2QF7A 1ZAHA 4L56A 5E6YA 3JZUA 2AAMA 4I8YA 3RO8A 3WJYA 3GW3A 4F0RA 3HQPA 3CXOA 4PTWA 2F8QA 3O0FA 3ZJ6A 1JUKA 1YKWA 3BLKA 3JR2A 3B9EA 1TV3A 1X1ZA 1OB0A 4LS1A 1QNPA 2C16A 3LRMA 2HXTA 3W25A 3LV6A 2W79A 2J8GA 3H2CA 1XHGA 2ZZ5A 4W7UA 4O19A 2WZHA 1NIUA 2VEIA 4EX4A 3E3HA 2XZ9A 5D2TA 4H2HA 4I90A 3P6LA 3RX2A 2BVYA 2X1SA 3GNPA 2POZA 4TTGA 1G0CA 3NSNA 3THQA 3ZLGA 4LU0A 1X38A 2NSXA 4DLFA 1Q66A 3MKKA 4L64A 2OLSA 3WUFA 1P48A 4ZXOA 1GKRA 2JEQA 2FB2A 1V6VA 1DJYA 4TX9A 1GW1A 2XVKA 1XCXA 1KRMA 2VOMA 3W37A 1GQLA 1E71M 3FKRA 1LRTA 5TAOA 1CYGA 3BG3A 4S3CA 3BSMA 4MAVA 4XWUA 1F8IA 1POJA 1OHLA 2IPJA 3P74A 1TWSA 3NGFA 4NRSA 1H7RA 2DFAA 4M51A 4JDYA 1H1YA 1MEHA 2CLPA 4XZBA 4PMRA 5AECA 4NZJA 5BMWA 1O1HA 4ZFMA 3GC2A 1XYMA 4LYKA 3VMOA 1OF8A 3K4WA 1OCQA 4PTMA 4GVFA 1E1EA 5LIKX 9XIAA 2HE8A 4JIEA 2ZWZA 3AXXA 3T1GA 1EEXA 4C6MA 4O10A 3HGOA 1Z69A 5ABFA 1WZAA 3MHFA 1QHZA 1K70A 1BQCA 1IV8A 4FPSA 2Y7FA 3IIVA 4GXWA 4PMQA 2DW6A 1CGVA 2CLLA 4MB3A 2FGZA 4Y96A 3R8RA 3IAQA 2PF0A 5I24A 1OJXA 3VNMA 5AYXA 1X1OA 4GJJA 1EA9C 3IVUA 1JI1A 4HN4A 4OGZA 2WZIA 3BVJA 4DO6A 1UR9A 3F2CA 5FI8A 1GOIA 1HP4A 2EG8A 3TU9A 2X16A 2RKXA 3L12A 2OSXA 3GG1A 4B5NA 1E70M 3W22A 2DSKA 1TIMA 1RD5A 4MM1A 4JY9A 5AVHA 4HNTA 1QPNA 4NRRA 5KZDA 2X41A 1BLIA 5E0FA 3S1GA 2D2JA 4QTGA 2E67A 3KRZA 4P8VA 5G5IA 1HP5A 4LEQA 5FJOA 3PBYA 1MUWA 2P3EA 1OSEA 3R6IA 4O0ZA 2G3IA 3C3UA 3PUDA 4UNLA 4AIUA 4C6FA 3K2GA 3PZGA 1LLZA 3Q94A 4INFA 1LWJA 2HDJA 3HIJA 4K1GA 1XBZA 1A5LC 5CPTA 4TMBA 4CD5A 3M0KA 2CHOA 5KETA 3VIJA 2DZWA 5JBFA 1VFFA 3WLPA 5BWFA 4CN4A 4YTSA 3ONBA 2MUCA 3CK5A 3KOFA 5HNTA 5BXRA 2VGFA 3R58A 3WY1A 5C0QA 1PL9A 3GXIA 2HEJA 3BMVA 1KRCC 2O9TA 3RAOA 1B3XA 4LQ1A 2D1ZA 5M2FX 1FVPA 3CHVA 3EX6A 3KL5A 4KT2A 2FMNA 5HMSA 2OGJA 3USZA 2DZSA 2V3DA 1W54A 3MYOA 1GKPA 2FH8A 4C60A 5A8NA 5JIPA 4PMXA 3U3HA 2A3LA 1WDPA 1FQ0A 3LYEA 1ZHAA 1JCNA 1UH4A 3MKVA 3MCMA 3REQB 1R38A 2VT0A 1G01A 4H8NA 4MHBA 2WWDA 3DFHA 4Z1BA 1SZNA 1QATA 2FFCA 4DJFC 4QJ4B 3I10A 4PSRA 1MQPA 3WEOA 2XU2A 3CUHA 4AX7A 2CZVA 3FGCB 2QJMA 4X3ZA 2DIKA 3O16A 1A5OC 2OO6A 4G2DA 1WO2A 1CWYA 2NZLA 5AC5A 4PFHA 4LBUA 2WBGA 3L4TA 3COTA 3TR2A 3IUHA 4CNOA 4GVIA 1RK5A 1V8EA 2D2GA 4ZO7A 2ZXAA 1MO0A 4DO5A 3DECA 5IXEA 2Q8XA 4HMNA 4Q8QA 5DRIA 2WJDA 3MPGA 4RUBA 2GGIA 4H6EA 3C5QA 1XLMA 2QUNA 3G6MA 3V18A 3PTDA 1BSIA 1QI0A 1RJRA 3G3DA 8TIMA 5K9CA 3HFYA 3OPSA 4EVZA 5BU9A 5L9FA 4ML9A 3WLOA 3R43A 1RJPA 4GUGA 3SW6A 4QCEA 4QDWA 2HS8A 2YBTA 2OELA 3GG0A 5CSSA 2Y70A 2Y7EA 4YMZA 1BWVA 1SR9A 3PK7A 6ALDA 2CBUA 5IHSA 1E9IA 1ONXA 3MP4A 4EE9A 2J7CA 2CCRA 4MKVA 4HSNA 3QMRA 1GK8A 1AUSL 1XC4A 2VX6A 5K9XA 3T4WA 1A3HA 4HPNA 1UP0A 4Z1YA 1Q7QA 5B7YA 3MZNA 4Z0JA 3L9CA 5TIMA 4C6EA 4EWJA 8A3HA 2Z1KA 3W86A 3GG8A 3W74A 5CGQA 3EYPA 1V0MA 3MCOA 1IEXA 4REQB 3SN4A 3L4WA 5XINA 4BQ3A 4NJGA 4FR1A 2G3JA 5I3IA 2QCLA 4JBRA 3W07A 3CPRA 1FWIC 1XDMA 3GKFA 4DUWA 4H83A 4O1DA 1UWQA 2ZX6A 3R0DA 4JYFA 1HIZA 4IGHA 1XGEA 5A69A 4P2VA 4AISA 2ZZ6A 3IJ8A 2A4AA 4XZLX 4LH8A 4YIWA 1MZHA 5C55A 2VGIA 4QNWA 1OG0A 1KKRA 1XRFA 5ECVA 1FDZA 2ZYFA 4A6GA 2J8TA 2VFFA 2W67A 3TTSA 4B2DA 3NQ6A 1VBRA 2X2YA 3TSMA 2VZOA 3NTYA 1BXBA 2F84A 4I8DA 1G7UA 4HU4A 1V79A 4J35A 5KINA 3B8DA 2E1DA 3UT0A 2AKMA 4RPQA 3ZVHB 1KM5A 3H2NA 5EBAA 2W62A 1YHTA 4PUJA 1D3HA 1Z8AA 1I2OA 1DQUA 5I2UA 3VM5A 1X6LA 1JYNA 1A49A 4UQAA 3LX9A 3MSYA 4PUUA 3WH7A 4C6JA 2R82A 1JFXA 3W7KA 2A2IA 2PD9A 5C8BB 4YCPA 1E1CB 1S5VA 4V1XA 1EC9A 1LUCB 1E6QM 4UFIA 2VD8A 1FA2A 3GZAA 3H4WA 1PDYA 4DELA 3M0JA 4MYAA 3WDPP 3E9AA 2AAAA 1KFBA 4MPKA 2QW5A 1T41A 1Y0EA 5C9ZA 1DJQA 4CU7A 4PULA 3W7HA 2QDDA 3GVQA 3A64A 4D6DA 1R7AA 4KWSA 1UWIA 1JG9A 4O0KA 2PS2A 3VVGA 4XO7A 4HCLA 3PHAA 3BWWA 1XLCA 4ZOBA 2BXYA 1TV7A 4AC7C 3ATZA 3GVGA 5H1WA 2VELA 1UP2A 4P7RA 3JZEA 2NQHA 4H1ZA 4RE4A 2FHFA 1TTPA 5AN7A 2DVXA 1R46A 4DQWA 2RDTA 1V3KA 3VD5A 4PMUA 4GMEA 3C2OA 4WVXA 3MC5A 1M3UA 3P5ZA 5DO8A 4JEQA 4QLJA 3GFYA 3NPUA 1GG1A 3AUOA 4QAIA 1E5NA 4V2XA 3PC0A 3NVDA 5LNSA 1KGXA 3VKDA 1XIEA 4DWSC 1XLKA 2Z6IA 1Y5XA 1FDYA 1OBAA 2JKPA 3VI2A 3O6YX 1H7NA 4WDTA 2IKJA 2PUZA 5CSRA 1FKWA 3REQA 5A6BA 1UKSA 3BAKA 1WOAA 2UY3A 1GOWA 1GZJA 3S2JA 3TJ4A 3W0KA 3GBDA 4JTCA 4WSHA 2V2DA 1GVQA 3AO0A 5FOOA 3K4DA 1H51A 2Z4GA 1HL8A 3FGCA 2PBOA 5CAKA 2O4MA 3HU7A 4IXXA 3OGSA 3GZ3A 1TPH1 1GZGA 3W70A 4ORMA 3IJLA 2O0TA 1YADA 1W2VA 2BV9A 2ZKMX 2FB3A 2FTWA 4AEFA 3P3BA 4KFNA 1NP0A 1GQIA 2YKKA 3QEZA 4JTTA 2X7WA 1LOLA 1M68A 1G94A 1DPMA 2E8YA 3G2GA 2IKHA 4WK9A 3V0TA 4M6PA 1H62A 5I03A 3QHMA 4MPQA 4EPBC 2ZZ3A 3C2EA 3EB4A 3PPHA 3OZOA 4H2CA 5KZEA 2WCAA 1XW8A 1KTCA 2E1WA 3LLXA 1H49A 5CXPA 3VDGA 3H4XA 1AJZA 4NXSA 3SIZA 3MBFA 3VCCA 1ENUA 1WBJA 2RFGA 1UR8A 5HNUA 1YNPA 1KM2A 3GIPA 4IPPA 5AC7A 1HKJA 5F4SA 1FDJA 3KL3A 5MHBA 2WKLA 4C1LA 8RUCA 2A0NA 1K6AA 4X63A 3OYXA 2ISVA 1Q13A 4FA3A 3CL6A 4A21A 2Y0FA 2F2HA 3LPGA 2DT2A 4HPHA 1J5TA 3NXFA 3OG3A 2Z1SA 1CXIA 3UXDA 2NQ5A 4A8NA 4ZQOA 4E8CA 1ME9A 4M8UA 1ICPA 4HA3A 4DWSB 2YOCA 5AYIA 1YLVA 2PGWA 4Q4OA 2ABBA 1E15A 4HKPA 3GHUA 3PS7A 4S23A 7XIMA 4CD7A 3N6JA 3DHFA 2Y7GA 3QVQA 1C8YA 3A24A 2FIQA 2ISFA 3DYPA 1T8QA 4M7SA 1XR2A 1OZQA 3QV6A 3B8WA 3W2KA 2ZOXA 5LSMA 1QBBA 5TQLA 1YXYA 4W84A 4ZVJA 3W01A 4HB7A 3WL0A 4REQA 3W1MA 4A3YA 3OW1A 2XWEA 2TMDA 3MW7A 1XQLA 4DJFA 2YL9A 1GYLA 2X2GA 3S2CA 1TFVA 4XZHA 2ZA2A 3AZRA 1QPKA 4AD2A 1NOFA 1TKKA 3ZYZA 2Q02A 3FV9A 1C8QA 5DANA 1EA0A 1W32A 4Y7EA 1LLOA 1W1PA 3KS5A 4TX6A 4QRNA 3N2BA 4R88A 3A4AA 5D8WA 3W2NA 1VR6A 2ZUNA 4ZE5A 5HPCA 2UWFA 3POCA 1IZCA 1VEMA 3LBOA 1AH3A 1PYMA 1TB3A 5G1TA 4A05A 2YR1A 4MVAA 4W89A 2DSWA 1TJ2A 4EPEC 4ZMGA 3ZVHA 3AWOA 3UJ2A 1FWWA 1EH9A 3CV7A 3VUPA 3M16A 1CTNA 3KL0A 2FLIA 1K8ZA 2WSRA 3GUGA 2IS7A 4J4KA 2PTDA 1E1CA 3RNDA 5K4ZA 2E68A 4NX5A 1LUCA 1BWLA 1QOPA 3FJLA 3VK5A 4GYJA 5KEZA 3RU6A 3ARSA 3S5OA 3E74A 4M82A 3UZ5A 4JTIA 1UUOA 1XXXA 1UW9A 3NZQA 3WO8A 1S1RA 1L6FA 1TX0A 4F0MA 3RX3A 2FZNA 3DC0A 3PZMA 4ZZ9A 1JI2A 4IXHA 3V1PA 5EMUA 4DXVA 3T9PA 3HV9A 2GVJA 3QPEA 3G1HA 5BU6A 3F1QA 3U2ZA 4D8ZA 3EWUA 2FPTA 2E6AA 1TVLA 2EHHA 1GVFA 3NL5A 1LT8A 1U2YA 4YPJA 4E3VA 3H53A 3WF0A 2QAPA 1EP3A 1R9XA 2Z1XA 1H5VA 3AS2A 1MEIA 1K8CA 4D9PA 3ME3A 3PULA 3U7VA 3DYMA 2V82A 2J74A 3S46A 4UWMA 2AL1A 4P8WA 3S2NA 2DV0A 3EDFA 4AMAA 2EPLX 2PGFA 1D3CA 1FFRA 3AIVA 4E4FA 3L0KA 3LZ3A 1MXGA 3LQLA 3N19B 2Z25A 4O18A 4FEZA 3E0IA 1WQ5A 1GCYA 2YCEA 1M41A 1XSKA 3K5XA 5I78A 3MO4A 3RLUA 3TX9A 4MYXA 2X7VA 4IM4A 2HCVA 4IPIA 1J8VA 4DPQA 4YCOA 1YDOA 5GNXA 4HCHA 5FCZA 3I6RA 1BG9A 5GQBA 2V81A 3WH8A 1SW3A 3W6LA 2NSOA 3GNRA 3TV8A 5HK4A 3TC6A 2DGAA 2YCLB 1EJRC 3GTFA 2FVLA 2J9XA 3CASA 1EUNA 1VFSA 3PJWA 3UF9A 1YXCA 3G1SA 4CNPA 2TAAA 3CO4A 4H6RA 4ZR8A 2OCZA 1LT7A 1ECEA 5JH2A 1EOKA 3INPA 5BNKA 3BSGA 3QMSA 2JBMA 4YNGA 1E4IA 5JU6A 2R94A 2QJJA 4LAUA 2GSEA 3AU6A 2O9OA 3CQJA 4A3RA 3W1TA 5HUOA 1EWEA 4AD3A 9RUBA 3SSZA 2OSYA 1E9ZB 3CMFA 5K2ZA 1KV8A 4PCTA 3T09A 5LHFA 5T91A 2HISA 3VFCA 1E0WA 2VVNA 3NO5A 1PWMA 2GDQA 4PMVA 3KDNA 1W1ZA 1PCWA 1K7XA 1J2BA 2XZ7A 4B3ZA 5D8ZA 4Q6JA 3ITLA 4DI8A 3GXPA 3AHZA 2I16A 3H23A 2IW0A 2Y6ZA 1A3WA 2G5WA 1KFJA 1VQTA 4ES4A 5LKYA 1D7KA 2J66A 1TSIA 3P5YA 2DZAA 3HG4A 4UQEA 4RDWA 4CQBA 4GI6A 1SU5A 5I3GA 3GVVA 4NZ3A 1R9YA 5IM51 2HSAA 3N4FA 3C4UA 4C6KA 2EJAA 4C1NB 3OZYA 1XIHA 3M9YA 2RDWA 2V5CA 3O6DA 3H55A 3RJXA 4CU6A 3S4TA 4JTHA 2PTXA 1RCXB 3CLWA 3W1PA 3FSTA 4DWSA 1FXQA 3SGUA 1QO2A 3WQDA 4LV9A 1A3XA 3CHDA 5ECUA 4L9ZA 1J10A 4WZHA 3C0QA 1JD9A 4XZWA 4HOWA 4U33A 3RCYA 3UG5A 1EO7A 3W7GA 3G1DA 3M0ZA 2H6RA 3N1AA 1SSGA 3NNTA 3HZ3A 2VGBA 1W31A 1KC7A 1KWGA 3UR2A 3GH4A 4IFOA 4IL2A 1C7SA 1A53A 1VCFA 1UP3A 1JCYA 1DXFA 2ZICA 3ITGA 2VDHA 2XFFA 1KTBA 4GE8A 2OGYA 3EDEA 4K36A 5A6MA 1PKMA 2J7HA 1RY0A 5I7GA 1KB3A 3V0UA 4S3EA 2C15A 3W7IA 1LP6A 2WMIB 3NL3A 4H00A 4A8LA 5K9DA 1SZEA 4NXKA 1TWWA 3PUEA 3SBFA 2GSHA 2BVWA 5AHNA 4H9XA 2GVYA 2CESA 3I7QA 4Q8MA 1E6NA 4N9BA 5AHLA 1HZYA 1PAMA 3AYVA 2VTFA 1AA1B 3ITXA 2O55A 2W9MA 3NFUA 4IFRA 1TV2A 7ENLA 2FJKA 3ITVA 3RPDA 3AWNA 2QULA 4MZ1A 4A4AA 1PO9A 1H50A 2AGTA 4R7JA 4AYSA 5KTLA 4HNOA 4UFJA 3KP1A 4ZQNA 2ACRA 3QQ1A 1V0KA 1VB9A 3Q65A 1RD6A 3UCDA 4ZOCA 1EZWA 2VXNA 4PL1A 3HO8A 4HGXA 1G5AA 1XFBA 4F66A 1EJSC 1EC8A 2PWEA 3E5BA 5G2WA 7CGTA 3MUY1 1SFTA 3L4YA 5E6ZA 1HUVA 1HO4A 3PZIA 1S5NA 2CZDA 1ZAIA 3OZPA 3LA4A 4UR7A 1KQYA 2E5BA 3V0SA 2PLKA 4O1EA 4BQ4A 3F2DA 1H4PA 1MRQA 4GHRA 2DT3A 4HP5A 2JEPA 3LN3A 4NSBA 4N9DA 4RZBA 4DZAA 4NF7A 4DEFA 3AS0A 4Q7IA 4R7OA 3TH6A 4M80A 4BZYA 1F3EA 2GVLA 3I6EA 1TMHA 4B3LA 4QFUA 4L6HA 3P81A 4HZ7A 4Q4PA 3VD3A 2RJGA 3TQVA 2A7RA 1OIMA 3EAUA 3IIZA 4HTBA 5GPRA 5HAOA 3M0HA 5REQB 2J7GA 1GQKA 4Q8UA 1P6BA 3AZSA 3EPMA 2ZRXA 5FJPA 4J3ZA 1CXLA 4DAFA 2C91A 2QNEA 2PI6A 1XBYA 2E0PA 3D5HA 4JQ1A 4HNVA 1R2SA 5PTDA 1AZ1A 1QT1A 2OYKA 3VNJA 1W1A1 1KKOA 1WX0A 3VNIA 3G1YA 4A8RA 3P14A 3GFZA 1HKKA 3VYLA 3NA8A 2Z7GA 3ZT7A 3CUFA 3T44A 1P0BA 3CHCA 4I6VA 2Y8VA 3W7QA 5JUVA 4K38A 4Y9MA 2PDBA 1Y5VA 1IEWA 1UZDA 4GCAA 1VEOA 5BWAA 1NDYA 4I9JA 3ARZA 3RF9A 3DIPA 1G67A 3QJAA 4GI8A 5BOEA 3VKAA 4R34A 3V3WA 2YDRA 2GFTA 3MY9A 3I68A 4M24A 1QCWA 4O4VA 4D6GA 1VPYA 4FNQA 1TTIA 1E0UA 4MDPA 1WCGA 3F4DA 1FWFC 4GFSA 1P6CA 2YW3A 4LBSA 2YCLA 4IQEA 4JYEA 2I1OA 4GRSA 2HZGA 4AZIA 2R6OA 2CZEA 3KOXA 4W8AA 3BLEA 1TPB1 4NILA 2VD9A 4Q22A 4CEXC 1BKHA 3MZ2A 5E5CA 5JQ9A 2NVAA 2HTMA 3FJNA 1XKYA 5D04C 3WUEA 3MSDA 2CITA 1OCNA 4AXKA 1CCWB 2FZMA 3D6NA 4FZIA 2AQOA 2J7FA 3B8SA 1FUYA 2ACUA 1W5MA 3A13A 1NEYA 4AZ6A 4FB7A 1RQHA 2QAFA 4CN1A 3BLOA 4OT7A 2PF8A 4UFLA 5TF0A 3VD7A 3WK0A 2HROA 3M47A 3KTSA 3APGA 1AW5A 1FWSA 3KRUA 3GHSA 1G6CA 2VVSA 4ZGYA 3PP7A 3T2OA 3ZFHA 3PPCA 3S1XA 3HQNA 1XYLA 2E28A 4GNKB 4B5VA 5F2IA 2HK1A 5DXXA 1RLCL 4J3UA 1IWAA 1M7JA 3GXMA 3BC9A 4GVGA 4MY1A 4EAYA 5AB3A 4N2YA 1N2VA 3G8EA 3W53A 2FZ9A 4NG3A 4XX6A 1MRAA 1W8GA 3WLLA 4H7ZA 3N15A 5CZ0A 2NX1A 4BS0A 5H8PA 4J27A 1OFAA 4I9MA 1XG4A 3C0JA 3TTOA 1OFDA 3L4XA 4C1NA 3SJNA 4RNHA 1R7OA 3WFZA 2DZPA 1EC7A 1EF3A 3WQOA 2BZNA 2QCGA 4BWLC 3ANVA 3ABRA 1V3HA 2QCEA 4JD4A 4O54A 1VAHA 4PUWA 4GBDA 1A5UA 3Q58A 4GH3A 2Q01A 3UPWA 3I65A 4D8LA 1R0MA 3AIQA 2Y8KA 4Y6GA 2VQTA 3ZZ1A 4XBJA 3B9OA 3CPGA 4Z2KA 1O5KA 2QJNA 5JBDA 5DMLA 1VYPX 4CD6A 4JN6A 2B4GA 1F4AA 2RDXA 4HK6A 1VFOA 3MYPA 5D9PA 4U3CA 1QVBA 4UCFA 4IOTA 2IPGA 2QUTA 1ODZA 1A5AA 3NDYA 4UFHA 4JTDA 1CXFA 2TSYA 3Q67A 3WNMA 2WMIA 3NQEA 2ZA1A 4I9TA 1H09A 4GBUA 2QF8A 5C7VA 4N9CA 4UZUA 3LGDA 4IICA 3A4XA 1EP1A 1Z32X 1PKYA 2OSWA 2VKZG 1K4GA 4GJIA 4G56A 4IL0A 3M64A 2DZTA 5D03A 3BQ5A 4NNBA 2UBPC 4GJ1A 3C61A 3WSUA 2WVUA 4E3TA 3GE7A 1CLXA 1RY8A 4Q7NA 1CW2A 4LCRA 1A50A 2EPMX 1XLIA 5LNVA 1EX5A 3GNDA 4PRTA 3MSRA 3HPZA 4QDPA 3VCRA 1I8JA 1TPEA 1LRNA 1XCWA 3SDOA 2FVMA 4S3KA 4O15A 1SJDA 3K8MA 1DHKA 2GQAA 4JN8A 4AY8A 3R8HA 1WNOA 1FY6A 3P82A 3W4RA 3CV1A 2FPYA 1DE6A 4WGHA 3NAVA 1Q7MA 1CEOA 1C92A 1CPUA 3MUAA 2FH6A 1IYXA 3QHNA 4IIBA 4W8BA 1HKMA 3NO1A 4JTLA 3QM3A 4RZ6A 4R27A 1CLVA 2R1LA 1JZ5A 3TONA 4DUXA 3AALA 1Q6QA 1S1PA 1KGUA 5BYWA 3QFWA 1JXKA 1OGBA 4MY9A 1U33A 3BCFA 4DLMA 4RK8A 4RV8A 1GORA 1E0TA 1JPDX 3E0LA 4OFCA 4C6CA 2JF6A 4OQVA 3ABZA 5REQA 5C2GA 1FHVA 4C90A 1QRQA 4W88A 2WQPA 3D46A 2NUXA 1W5PA 1TV5A 4ACZB 3FA5A 4JGDA 2J7EA 5JH1A 1HJUA 5F2LA 4HOXA 3A9BA 3O9NA 3DAQA 4IG2B 1F4HA 1US2A 1IR2A 1TR9A 4UTIA 5A6TC 1UR1A 3SCTA 3QY8A 4XUGA 1ZCCA 5JXQA 3LCFA 3ABSA 4JL1A 2BGSA 1JUEA 5BRQA 3S9IA 1OADA 2XIIA 3AYSA 3NDOA 1EUAA 4U10A 1B54A 1MW0A 4EXBA 3GTHA 2QVNA 4NQ1A 4HPGA 3ARVA 4FK9A 1XIIA 3UERA 2E9LA 5M5DA 4ATDA 4K2SA 5CPSA 4IPJA 4HZ6A 3L65A 3W7RA 4C91A 4KH2A 2V2HA 1JUBA 5A2BA 2XH7A 1YIXA 2DJXA 3NWRA 5GNYA 2ZXQA 1NOWA 4GKLA 1KNWA 1ME8A 1VP5A 3VGGA 4IIEA 4OIFA 5DCBA 3WBXA 1Q2RA 2E9BA 4RDVA 3G5EA 2DUZA 3A3XA 3L23A 1XIFA 1EYWA 5LGXA 2TRSA 2C7FA 2ZZ1A 1NSJA 1UOZA 2XN0A 4HCDA 4H8VA 2WSKA 3OOQA 3N4AA 1JRBA 2VX5A 2VR4A 4X0NA 3M5VA 2I5QA 4LNYA 1TJ1A 4I7UA 4LF1A 3QXBA 5A95A 4KMQA 1RJQA 2PCQA 3DI0A 4DYJA 4EIVA 1UZHA 4CQCA 3OZMA 3WJSA 4NAEB 4D6EA 5A6KA 2BHUA 3W7OA 3B0UX 3B8VA 4H6KA 4JCMA 5EFDA 2AGKA 1B31A 3MMWA 2J6VA 1DWGM 4ADSA 3FK4A 3IRSA 3LZ5A 4DJDD 4KW2A 1V4YA 1TJPA 4LAOA 4RV3A 3GH7A 5IOBA 1BFNA 3HF3A 1ITCA 1FWRA 3IGUA 3MWCA 3VPLA 2CKSA 1EJTC 3LHTA 3F5JA 2OU4A 3P62A 3MSGA 3OYZA 3N4EA 3R25A 5LZLA 1IZJA 4FIQA 4HA0A 4Q4RA 2V30A 1ICQA 2HPIA 2IMRA 2OQLA 2A7NA 3N12A 3ZLHA 4YTQA 5EB8A 2PDYA 1UR2A 3A22A 3BTNA 3TQ0A 1DWAM 1VBJA 2XYLA 3CIWA 2ZADA 3U0HA 2VEMA 1GQJA 1NU5A 4HVXA 1J01A 3LLFA 4CNTA 2NXHA 3ES8A 1JDFA 2VJXA 1UR4A 1PTGA 3GTXA 3FJ4A 1B5TA 2E8ZA 2FKPA 2P1FA 4IGSA 2DUXA 1OIFA 3F4NA 4EP8C 2PDJA 5FD0A 1EJVC 2J88A 1KM4A 3FJ6A 3MWAA 2GL5A 4A2RA 4PCNA 2Y89A 1OFRA 1TCDA 1HW6A 1D3GA 1YBQB 1XS2A 1MW3A 4YVPA 2PLJA 4JICA 1HVQA 3NL2A 1WV2A 1NP2A 4CQDA 3TLQA 4NZFA 3URAA 2V68A 3W1XA 4L65A 4DHGA 1R5YA 2VEKA 3B8UA 2V38A 4S3DA 2D2OA 4M3PA 4MFEA 2QMJA 1YDNA 3LXCA 2GSJA 5JMUA 1K1DA 5T8GA 1TQJA 1C3FA 1GVSA 2G97A 4ZBCA 2BNJA 4CVUA 4J3XA 2XWDA 2UZ9A 1WKFA 1KXTA 1JPIA 3IACA 1HO1A 1UC4A 3C2RA 1YTEA 1OM0A 3KWXA 4OVXA 4HYRA 3VKBA 1POKA 4JPGA 4IH3A 1OFQA 2J13A 1WOBA 3RX4A 3SZ8A 1M7XA 3MMDA 1X6NA 3GC5A 2OB3A 3N11A 2P76A 2R1PA 3PZVA 1YEYA 1W0MA 4N6FA 5GVJA 4YTRA 4QS6A 3CQIA 4UTHA 1BVZA 5CBJA 2WZMA 4W5ZA 1M7OA 4BWLA 4IIHA 2POTA 4L4LA 1NELA 3ABOA 1PZ1A 4KKXA 5FF4A 5CPOA 3MJMA 4ZTYA 4IP4A 3EOOA 3LXBA 4FHAA 3W75A 1JPHA 5T9BG 3TN5A 1RHCA 3A3WA 1RUSA 1UJQA 2PP0A 1M03A 2PDGA 1TZ9A 2F6KA 3PZNA 1XM3A 2PTWA 2OEJA 2EEXA 2FGLA 1J0IA 4GUFA 1L8PA 4ACZA 1C90A 3CV6A 1ISZA 2QYGA 4DXXA 2A5HA 3EWDA 1K9EA 4IG2A 3EB3A 1D7FA 3GWQA 3SQMA 2ASHA 4HYWA 9CGTA 3O6AA 1ZQ5A 2PDQA 1EDTA 2YX0A 2GUYA 3WENA 4IQJA 2IKIA 2J7DA 3LS9A 4FMVA 3W73A 1TWDA 4AZCB 3WBYA 2YFNA 1AQFA 2CEQA 1XIMA 4WIWA 3L7RA 4DM1A 2WMKA 1V08A 5CLTA 1XLJA 4KEVA 3LPFA 2DDXA 3FN9A 5I3KA 2CLMA 2YYUA 3H7UA 3HMJG 1SGJA 1TPVA 4WDXA 3T81A 1RQBA 3PAJA 3OLIA 3AHXA 2WLZA 4UMBA 3WJXA 1QUMA 1LDCA 1VFMA 1FP8A 4WEVX 4FX8A 3QPZA 1P0DA 2VM8A 1UKOA 1MQQA 3NQFA 4GO8A 2GLKA 3SEPA 1D2KA 2VZTA 3M6DA 2ZUUA 1E4MM 2YL5A 1UB3A 4H41A 4TR9A 4LWWA 1F61A 4XO6A 5DF0A 1R3RA 2BY2A 5C6MA 3PPGA 3FX4A 3CB8A 1ECQA 1JZ4A 3MV01 1VCVA 1DWIM 4A35A 2G0WA 3W1NA 2GWGA 4ALDA 4E8GA 1B1YA 3H4GA 5MKGB 3LPOA 3OGVA 4TMCA 1UJPA 2VRKA 3P84A 3TAKA 3BLPX 3T4CA 2B81A 4L5ZA 2C14A 4PMYA 2WMJA 5TD4A 4NAEA 1B9ZA 2Y5JA 1QPQA 4IMGA 2JKAA 3L68A 3TOYA 5I3JA 4TO8A 4PEEA 1A4LA 4WJ8A 4PBFA 3N9RA 2YW4A 2WBKA 2ISSA 4J3TA 3EXRA 2PWVA 5CGTA 3PFMA 3R89A 2BOFX 5DCEA 3KBMA 3P8JA 4FNPA 1LROA 2ISDA 3BMXA 4BQ2A 2GJLA 2HXUA 3CBWA 1ZBCA 3WLJA 3NQGA 1XLLA 2CETA 2VL4A 2ZZ7A 1A0CA 4QDMA 1I45A 4DBDA 2DSUA 2RJHA 2C18A 1LQ0A 3RFAA 3M44A 4F0KA 3R0KA 4LUJA 1EKOA 4PUNA 5LGZA 3U2EA 3IIXA 1P43A 3IARA 2DQXA 4C6QA 3LB0A 5E0CA 2NW0A 2CWXA 1V02E 4AIBA 2CU0A 4NIRA 1E9YB 3A23A 4I5UA 3E2QA 1E0VA 1QJWA 5F2MA 4PTDA 3T40A 3HPXA 3QZ6A 2OVLA 4BHYA 4J3VA 3NJ3A 4J9JA 4Q4QA 1UR0A 3T6CA 4XBKA 1VC4A 3UR5A 3ITTA 4KETA 2YL8A 3U9IA 1F3TA 4RJEA 3PG9A 3LERA 3VMNA 3L0NA 4KCVA 3GYEA 4IQLA 3UWEA 4HN8A 2PODA 3KVMA 2VI0A 3R79A 4D6FA 3SQSA 1CZ1A 3WBAA 4DN1A 1XYCA 4GZJA 3KXQA 4K1WA 2F38A 2ONEA 3TLLA 4AY1A 1YBQA 3IGHX 4D1JA 1YNYA 1LOSA 4FAMA 3GVRA 2AOSA 4GY7A 1L9WA 1GT8A 2WC4A 2D22A 3WLTA 3AAMA 1L6YA 3OGRA 2A21A 2X8RA 3PBGA 3UG4A 3QV9A 1UD8A 3AZTA 1JEZA 4KEMA 1OFEA 3QTPA 4CD8A 3NM1A 3S1WA 3D3AA 1VENA 3A47A 5M1TA 1CGUA 3H2FA 1OABA 4NJJA 4UOQA 3RK8A 4JNZA 3BZJA 3W24A 1MWOA 4NI3A 4NZ1A 1B4EA 4LYPA 3CB3A 3OQEA 4FLQA 5C70A 3STPA 2QCCA 3VA8A 4G7FA 1PKLA 5KMYA 4QROA 3RRXA 4EXAA 1TPC1 2O56A 2CW6A 4LGXA 1E43A 3RDKA 1V6YA 2QUUA 2PRHA 2HV5A 3BDKA 4Q8NA 4XSLA 3VZYA 3W7JA 1G4PA 4V15A 2P3ZA 3RHGA 1K7FA 3F5LA 1VJSA 2DSZA 2HNHA 2J25A 1NF0A 4GIAA 3QC3A 1SQ7A 2O9PA 1HTIA 1W9VA 5F4XA 3EWWA 2FZDA 4HK7A 3VC5A 2X1IA 5AC8A 2QCDB 2OWXA 4ZO9A 4P8UA 3DYOA 2NLIA 4F9JA 4WXZA 5D33A 3CMJA 4H9MA 1W9PA 3MUZ1 3CAQA 2GJPA 4NKCA 1CECA 1KRBC 1U1HA 5DY3A 1V51A 3A4WA 1VJZA 4Y9PA 4OV4A 4Y8EA 3GXFA 4B5TA 3VAVA 3G22A 3WK1A 3CZEA 1WDWA 3IIPA 3WFAA 2W0UA 4AVFA 2VR5A 4GGHA 4JIPA 5I77A 1LWHA 4QJ5B 2YL6A 2JF7A 3NOEA 3BK0A 2VZSA 4TTUA 2DQWA 2EKCA 1TIWA 1XC6A 1HF6A 5FEXA 1RV8A 4Y9OA 3N9SA 1OGSA 4GI4A 1I4NA 3SY8A 4F3HA 3T08A 4JIIX 4WOQA 2NWRA 4JFSA 3CGTA 5CQ1A 1R8LA 4AZCA 5LHEA 2CYGA 3STGA 4AZ7A 1E6SM 1X39A 3W87A 1WBHA 3IJQA 3OBAA 1PXGA 3QF0A 3QTGA 5HWJA 3S9ZA 3ATYA 4XAFA 2W66A 4R53A 4DO4A 1SFSA 1F7BA 4HMDA 1SO4A 2J78A 4K8GA 2ZA3A 1AMYA 4K37A 3PNUA 3BAIA 1IR1A 2WK2A 4QXIA 4EXQA 2WHLA 3HPAA 4E0CA 4J40A 1A5NC 3LGGA 2FGBA 4OBRA 4WGXA 2DP3A 2PB1A 1V6TA 3T78A 1K8YA 2Y62A 3LLDA 1UIPA 4HHPA 1Q4WA 3KHJA 2G4FA 3DFOA 4AU0A 3THDA 2G41A 2PDXA 1HKVA 1XDLA 3G1RA 4MNKA 3FVDA 3GBEA 4FSAA 2WVSA 3PWIA 5AYBA 1XP3A 1B3YA 4DAIA 3XIMA 3WQEA 4GIEA 3RPTA 4JX5A 5HQMA 2QCFA 4KF1A 3M1ZA 4F2BA 1VLWA 3AOFA 1CGWA 5JBEA 1QNVA 4ZOAA 3H54A 1KCXA 4RW3A 3NZGA 3WEMA 1I1XA 1SZGA 1QK2A 1PDZA 3SJ3A 2E5CA 1EJ7L 1JAKA 1XUUA 2IXUA 3F03K 1RA0A 1FX6A 3WMBA 5E70A 1OEPA 1Q4NX 2BOGX 3BO9A 1UA7A 2ZXDA 2QEZA 1J9YA 2X1TA 2EPKX 1GEQA 4FXFA 4N4QA 3V35A 4OUIA 2HVMA 4IMAA 2EPHA 3RLHA 4JTFA 2XPKA 3VX1A 1LOQA 3U48A 4LC8A 3L4ZA 1CIUA 5DBUA 3KP0A 2WSQA 1F6YA 1XF0A 3WMCA 4W86A 4IIFA 4EKJA 4UUIA 1PTDA 3U57A 3BG9A 3ANUA 3GRIA 3P60A 4GABA 4O53A 2QGYA 3FCPA 4KGLA 2ZFAA 7TAAA 4H9TA 3W1RA 1W9XA 1PJ9A 4Q6XA 3R2GA 3TYDA 4B5WA 1IEVA 4O12A 1QNQA 3H12A 1FWJC 4S2BA 3QBUA 5M03A 2EBNA 2OKOA 4B15A 1XLDA 4ORIA 5MF5A 3VINA 1XD1A 2X0HA 1VRDA 2NV2A 3LNMA 3UA3A 5EMJA 4P5UA 4WCJA 3HV8A 3SCSA 3KOZA 2QS8A 2YA1A 3B0VC 3KRBA 5D2YA 4L1WA 2J6XA 5D30A 1H3GA 3E96A 2WNQA 3KZSA 1OCJA 2WJEA 5DCDA 3OODA 1QNOA 3UJFA 1X96A 2F6XA 4JAWA 3N2TA 2BODX 4F79A 3S9YA 3N73A 1E3XA 3WQ5A 4MJ4A 4KWVA 3SCUA 3R11A 3R8GA 4ZEPA 3CV2A 4LY8A 4JHMA 2NQ9A 4FS9A 1NWRA 4GNJA 4D1IA 3Q2DA 1MI3A 5BMXA 5FJUA 5D2XA 3AMKA 2YGYA 3ARYA 2PWFA 4Z17A 1O1ZA 4JKLA 3II1A 3KBJA 3OA3A 3NPXA 3UXIA 3EX4A 1ZBWA 3CAKA 4GD0A 3G18A 1OFOA 1SM9A 3SURA 5D37A 4CD4A 1PX4A 3TMQA 2YZ5A 3DFNA 5C71A 4LX4A 4LTSA 1UROA 1XV8A 2DIJA 1BYDA 4UNIA 4U5KA 2XJ7A 4NNAA 4MWAC 1ITXA 5CLWA 3QQ0A 1JJKA 4GQGA 5H8MA 4KERA 2RGLA 3ENLA 4H9YA 1XRTA 2QCDA 2VHLA 4US5A 1Q45A 5F4WA 4WUIA 3RN6A 4CQ9A 3KCLA 2BGNE 4JS3A 2X1RA 4KESA 4LANA 3BJFA 4UTJA 1E72M 2E6FA 5DMMA 3LHZA 4GXMA 4JOMA 3W3OA 2YDQA 1VFUA 4GQBA 2FZBA 3ICJA 2HRWA 4XK2A 1EGMA 2RDUA 1EJUC 1HG3A 3NQAA 1K77A 2XGBA 4K39A 1ZJIA 1H2JA 4RZ5A 3EWZA 3EGJA 1LTDA 3EOEA 2RAGA 4MZ8A 2Y8UA 3EWBX 3F5KA 1R85A 2P8BA 5IDZA 2UY2A 4MFDA 4JKMA 1BSLA 1YYAA 4GC3A 1F3XA 3WD4A 1CXEA 2KAUC 2JE8A 3W7CA 3XINA 1DV7A 4Q8PA 1BVNP 4ZSUA 1AJ0A 2VEFA 4R85A 5FJJA 3O0KA 1PB0A 4GC4A 4XD3A 3W00A 3EOSA 2Y88A 4MY8A 3VGHA 1UR3M 4R9OA 1IZKA 3URNA 1KR1A 1M6JA 2WMHA 2OYLA 1UASA 4IQDA 1E6PA 3BMWA 5DMNA 4B4FA 1JGMA 3UZZA 4GI9A 2EGZA 2YB1A 2OPJA 3S3GA 4TIMA 3OIHA 3OVPA 4M1BA 2Z29A 3G1XA 3TA6A 3O6CA 4B4HA 3PJXA 5DT5A 1T0OA 1L2UA 3CLMA 3HJZA 1E4LA 3VO0A 4IGNA 3AMCA 1EYEA 1PPIA 1XRSA 1VGAA 2R1KA 3DFTA 1XYAA 4OTKA 1JD7A 4FNSA 4H9ZA 3UWQA 1CGTA 2Y2WA 3GHTA 5CG7A 2XTKA 3IGSA 4MB4A 2R1MA 2X40A 1MUCA 1K3UA 1UWRA 3AI0A 3EEGA 3MMTA 4MWAB 1FFQA 1WZKA 1T99A 2XIBA 2J47A 1KBKA 1J12A 1XIDA 4AMCA 2GJXB 1N8WA 3UGVA 4HYVA 1PV8A 3M0XA 4E2DA 2HPMA 3W84A 2FQIA 4AY7A 3OA5A 3VDCA 1PHWA 5EPDA 2C6QA 1BYBA 2XGZA 4G6CA 1R2TA 3MJYA 1OX4B 4ZB2A 4S2CA 4QM1A 3EDJA 3LHYA 1HXJA 3EKGA 2BS9A 1TV4A 3PBUA 1DYSA 4HZMA 3APTA 3CO8A 4X61A 4OU1A 4D72A 3L21A 5GNZA 4CCCA 3KEHA 2FFIA 1W5NA 3LK6A 4RCXA 1GOMA 1H0IA 2J77A 2OFJA 3QY7A 4ERGA 1OT1A 3SFKA 4LBRA 4AHPA 3KS6A 2D0FA 4DPPA 1TUFA 3TQKA 2CZFA 1PCKA 2X1UA 3UZYA 4AEOA 1A5BA 1XLEA 3MT1A 3ZLFA 1F07A 1AH0A 4W93A 3ZJ8A 4BA0A 1WKDA 1BRLB 1VPQA 4QLKA 1R87A 6TAAA 1TE1A 2YIHA 1DBTA 2ZDRA 2XFRA 4UNKA 3GQYA 1TVNA 1DE5A 1V3JA 3FAWA 1Q63A 5FSDC 2EPOA 3LSCA 4X2PA 2I7GA 3H26A 3ES7A 3AXIA 4DBEA 2OYMA 2VP8A 1UCWA 1FWCC 5HNNA 1WDSA 2Z27A 3EPOA 1SSDA 3K1GA 4BFAA 3VDBA 4N0RA 3AHTA 1TG7A 2WHKA 3NYZA 3M6YA 3T7VA 4F0HA 2CIPA 2OX4A 2OODA 3LI0A 2FZ8A 2A1YA 2BWGA 2OWWA 3QH2A 1TE6A 4BQ5A 3I3DA 1BGAA 2PURA 3SUUA 2XIOA 1H60A 2WMGA 4Z2IA 1O4UA 6XIMA 1TMLA 2E25A 2QDHA 3R10A 3TN4A 2PZNA 2IQ0A 7A3HA 3BARA 3HG5A 1TTJA 3MHUA 3WQ8A 4K3ZA 3PB2A 3W76A 4LSBA 3O1NA 2PZ0A 2EXOA 2YBUA 1A0DA 4Z1AA 1WE5A 3ALFA 2WSYA 5A8OA 4FXSA 4IIDA 1JVNA 1DXIA 2GGHA 3TCEA 1JQXA 4LVGA 3APYA 3C2YA 3QYQA 3WL1A 3K8KA 1GUVA 3LM3A 1NWTA 4PZVA 3AHVA 3EZ4A 3MO7A 4DZIA 1XFCA 3UBPC 5D02A 4F8XA 1C91A 4TUFA 1JR1A 1GTHA 1G4TA 5FIPA 4AH7A 3M43A 1JDAA 4NT0A 4E4UA 4YLWA 1F2JA 1XI3A 4HT3A 4PB3A 3MP3A 2QGHA 1SMDA 3E0FA 2DY3A 5LA2A 3CUZA 3FLUA 3GUWA 4MF4A 3SIMA 4W87A 2DEPA 5LA1A 1IXOA 5D9OA 4DJEC 1X8CA 4LUSB 1L6SA 2QKFA 2CBIA 3N04A 4FXRA 4W7WA 3TWBA 3GX9A 1ISVA 3VM7A 4CU8A 5G4EA 3C2VA 2X09A 3D0CA 2ZQ0A 3BJTA 3TW6A 3OVGA 3WCZA 1WZMA 1JCJA 2XHYA 4KWUA 2QCNA 3GU9A 2DT0A 4B91A 4LB3A 1QW7A 2CPUA 2E5DA 3CEPA 3G1VA 3UWUA 3W1LA 1RP8A 4J5NA 3BLDA 1PE1A 1TPWA 2BDQA 3M0IA 3MKCA 1Q3NA 4DYEA 5I23A 4MLRA 4XB3A 2V5LA 4HZ8A 2DH3A 1LL4A 4OUEA 1WAUA 4AZBA 3F2BA 4GO9A 3AJ7A 4M0XA 1M7PA 2Y4SA 4LUIA 3FNDA 1W3TA 1MW2A 4B3KA 2NV1A 5FAGA 4BI7A 2WNZA 4WLCA 4A8IA 4FOUA 4Q32A 3N13A 3NQMA 3AXMA 4HIBA 2OLHA 5IFTA 4UTLA 4UFKA 2B7OA 1Q5MA 3M41A 1JYWA 1W3IA 3UW6A 5EU9A 4GYPC 4LXFA 3ANYA 1KFCA 3BE7A 2V69A 3ARQA 3EA3A 3HM7A 1DTUA 2WCGA 1Z9AA 3UJSA 2E40A 4PN2A 3A12A 3EMQA 3LGEA 5EMKA 2OX1A 3F4WA 1KTNA 4GX9A 2D3NA 3TXVA 1ZSXA 3MVTA 3WELA 4TXEA 4L4OA 1VBUA 1Q6RA 3CIXA 3B0YA 1HVXA 3E5PA 4O1FA 3DFSA 4F2TA 2BMBA 4XAZA 5EMMA 3CL8A 1VFHA 3RUBL 4OHQA 2I57A 4FIRA 1XH1A 1GJUA 4PUEA 2EQDA 4FOJA 1J5SA 3V4BA 4MWAA 3TC7A 4J28A 3QKZA 2F6UA 1EEPA 4GYFA 3B8TA 3GR4A 5E09A 3UWVA 2GJXA 1FBAA 3I4KA 5I07A 3W1QA 4MJMA 1V5XA 3LM7A 2XH0A 3ZQ9A 3DG6A 2MANA 3A21A 3SRKA 3KCOA 3UJRA 1OX4A 4DF2A 2TPSA 4KWOA 4NZ5A 5CC7A 3DUGA 3PBMA 2P0IA 1QWKA 2XM2A 3GLCA 2XINA 4K6AA 1CBGA 4I6KA 3AYTA 3HG3A 2GDUA 3CL7A 4HJWA 3W27A 4GINA 3G1AA 3GTNA 1L8NA 4H8HA 1UKPA 1NWSA 4JTKA 1MVYA 3PZOA 1XGZA 3OLDA 3RU8X 3ZSSA 2Z28A 4R5EA 1ZLPA 4WHBA 4EANA 4PODA 1EZ2A 1KXQA 1UUQA 1SJBA 3FIGA 2ODOA 2XVPA 3EA2A 1ISXA 4FLOA 1U5VA 4UQBA 3S5SA 3LMYA 1LJYA 1GVOA 3KOYA 1LYXA 5DX7A 2P5NA 1XH2A 4HHLA 3W7NA 4HK5A 4Y2WA 2DPEA 1GHSA 5T26A 3FYYA 2DUAA 3AJXA 3KLKA 4YWIA 2GJRA 3H21A 1PYFA 3U5UA 2GPTA 1K4HA 1EGVA 4E38A 4EPKA 3WF1A 2VFDA