1NQ6A

Crystal structure of the catalytic domain of xylanase a from streptomyces halstedii jm8
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xys1
publication title Structure of xylanase Xys1delta from Streptomyces halstedii.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Hydrolase
total genus 123
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nq6A00
3T0BA 5DFAA 4ACZB 4AZ5A 3VDHA 3AIUA 1SMAA 4IISA 1UZ1A 4Z2LA 2VC9A 3MMDA 3WUBA 1XRVA 5GNXA 2VMFA 3PZMA 1AQ0A 1GOKA 2WWCA 2O9RA 2WVSA 2GJXA 3GXFA 4MAZA 2DSUA 2WZIA 2WMGA 4LGXA 2BS9A 1E56A 1Z32X 4H2CA 2OSWA 4WF7A 1HKMA 3CLWA 3VMOA 3WD2A 1HKKA 1HXJA 1JZ4A 2GVYA 1H49A 3SURA 3IJ8A 5M17A 1W9XA 2IXUA 2X09A 1K9DA 4W8AA 3VPLA 4UQAA 2A3AA 3AQUA 2BFGA 1GHRA 2FGLA 3VX0A 4K68A 1Q6DA 3CUIA 3T2OA 3I3EA 4TTUA 5C71A 2FDMA 2V3DA 3CO4A 4UQEA 1XYFA 2WLYA 1JYVA 2JF7A 4MAVA 4WKAA 4PRWA 4CN1A 1UWSA 1H2JA 4XB3A 4ACYA 1E5JA 1HN1A 1VBUA 2XM1A 4JIEA 1VEOA 3W38A 2J78A 3BSGA 4GI6A 2YA1A 1VRXA 1TVNA 5GNZA 2WKGA 3WEMA 5D9NA 4LYPA 1R86A 4D71A 2YLAA 1J0IA 5KEZA 3AJ7A 5DF0A 4TVUA 2J7BA 4FF5A 1JF6A 3VGBA 1LQ0A 3WN6A 1J10A 1V6YA 3IJ9A 3WNNA 2X1IA 1HL9A 2XFRA 2ZICA 1C93A 1M53A 3KWXA 2GK1A 4EAMA 2E8YA 2WANA 3M07A 1E6PA 5C8BB 4UQCA 1PX3A 2G3NA 4MB1A 3WNKA 2J7EA 4XX6A 3WF4A 4UQBA 1QHZA 3ARSA 3FHAA 2CEQA 1HJUA 4ACZA 2ZWYA 4PMXA 1PX8A 4TUFA 3SUWA 4WJXA 1QNOA 4BF7A 5A6BD 4D6DA 4D6HA 3L4YA 5IFPA 5E6YA 3NIYA 1HJXA 1W3JA 1XYZA 1ISYA 2WMIB 1XHGA 3UR8A 4JFUA 1CXLA 4HU0A 2WK2A 2VQUA 3VGGA 3MKKA 3TTYA 4H7VA 4MTVA 2G8ZA 3CUFA 1QW8A 2YA0A 3MS8A 1F4HA 3VIOA 1V3HA 2WM0A 2YL6A 3CHCA 1KCLA 1X1NA 1V02A 5C70A 4ATDA 2AMGA 1V02E 1GOMA 1ODUA 4MDOA 4AZHA 1D7FA 4CVUA 1JD9A 1BG4A 1W3KA 2PWHA 3A4AA 1J0YA 3AXIA 1B31A 3UESA 4JFWA 2EBNA 5AYBA 1I1XA 1CXFA 3SEPA 1Q4NX 2EXOA 1BHGA 3A4WA 1CXIA 1Q6FA 5D9MA 2DSKA 3VTRA 3QR3A 2ZOXA 1CDGA 1FHDA 5E9AA 4JAWA 4QAWA 1VEPA 1E6ZA 2A3HA 1JIBA 1MW1A 1MVYA 4UFKA 5CZKA 4B3LA 4DUWA 2DH2A 3NCOA 1EO7A 3RM9A 6TAAA 3SCPA 2NT0A 2ZX5A 1RH9A 4H8UA 1GQIA 5CG0A 2Y5EA 2HISA 3GNRA 1C7SA 1WKYA 5A6SA 4CN6A 2E4TA 1G5AA 3DYMA 1K9EA 2WYSA 2E9MA 3WBEA 4H41A 1LF1A 1E6RA 3S2CA 4JFSA 1K9TA 3HN3A 3CH9A 4HP5A 3WQWA 4ZFMA 3PTMA 2ZUNA 1XCXA 1DWJM 5ABEA 1H5VA 3EDJA 4D1IA 4W5ZA 2VR5A 3WSUA 4UNIA 4PTMA 4Q7NA 1GVIA 1OB0A 4GQRA 1BYCA 1OIMA 4P8WA 3WNOA 3PZGA 3OIHA 1E4IA 2WMIA 5CLWA 2QPSA 4PMOA 1E55A 3NYDA 4CCEA 1ZL1A 3A6OA 3IAPA 4WSJA 3AHZA 1QBAA 2OWCA 2D3NA 1CLXA 1V6WA 3ZJ7A 7CGTA 3WEZA 1W1VA 3VOCA 3II1A 3QOMA 1RPKA 3CIVA 1KGUA 1VFFA 4PBGA 1UD3A 1GUVA 3CUJA 1JDAA 2JALA 3FW6A 3AHXA 1W32A 1V0KA 4PMNA 3ZMRA 4MADA 3A3HA 5I79A 4MNJA 4IPNB 1OGSA 1XGZA 3GBEA 5BCAA 5JIWA 4Z2JA 4TX8A 1WCGA 1H11A 4WKHA 2VR4A 4MPKA 1GW1A 1GOWA 5A3HA 3AFBA 4MB3A 1SMDA 3PTKA 1FHLA 4AZCA 3ZSTA 2JEQA 3PBGA 2EPKX 3VO0A 1VENA 1CIUA 2J7HA 3BGAA 3DHPA 4WKFA 1NQ6A 3KEHA 3ZO9A 4PTXA 1EDQA 4R27A 1W3LA 1ZBWA 4FMVA 3KL0A 2MANA 2JFEX 2CYGA 3VD5A 2BHUA 2TAAA 1TZ7A 4QLLA 3AICA 2VZUA 2V3GA 3QHNA 4OIFA 1LL6A 2XIBA 4CD7A 2O92A 1HVQA 1JF5A 5CGMA 3WDHA 3RDKA 4BZYA 3EDDA 4U5KA 5M3WA 2ZXQA 3E1F1 2Q8XA 1DEDA 1UKSA 1JZ2A 3BAYA 4GO9A 4AZGA 3WFZA 1NOFA 3VIHA 1WB0A 1CGVA 4OKDA 2VRQA 9CGTA 4QDMA 1BYDA 1BYAA 1HKJA 5CSYA 1KBBA 2YKKA 2YOCA 3CGTA 1PJ9A 4FLRA 3IK2A 4BA0A 1VJZA 4P8XA 1W91A 1PIGA 3ARXA 3BMVA 4ZXLA 1IZJA 1U2YA 2BHYA 1UR4A 1HX0A 3ARVA 1LL7A 1M7XA 1JYXA 1NOUA 4GZEA 1NWSA 2PWGA 3GNOA 2WHLA 1E6XM 5JIPA 2XTKA 1X6LA 1NOWA 1UKOA 1CPUA 5IHRA 3MANA 1UYQA 1HKIA 1I1WA 1TE1A 4Z2GA 3ARRA 3T0DA 4DUXA 2F61A 1BQCA 4JFTA 2DPEA 4W88A 4JL1A 5GNYA 3B9DA 4TTGA 5A6AA 4PN2A 3VIFA 1E73M 1CEOA 1W9PA 2O9PA 4CKQA 5I77A 1UUQA 4M82A 1V3JA 1QI0A 2ZWZA 1AQMA 2V5DA 2J25A 3AMDA 4CCDA 1DHKA 2CNCA 3O9NA 1UZ4A 3VD4A 1DWGM 3BCDA 1WP6A 1HJSA 2W92A 3WIJA 2X8RA 1XH1A 1M03A 2DEPA 1B0IA 1CYGA 3GH4A 2FHFA 5IDIA 3W4RA 4CUCA 2DQXA 4FLQA 2ZUTA 1C90A 1JZ6A 3BAXA 1NARA 5A8PA 3EMCA 4FLOA 5DT7A 4OBSA 3SUVA 4GZJA 1JDDA 5FL0A 2VURA 1CENA 4J28A 1VBRA 4UFIA 3PN8A 5D8ZA 2WWDA 1KXTA 4J3UA 3B8SA 3CZLA 3WENA 1V0MA 1EHAA 4OJYA 2QPUA 3GH7A 2EPMX 2VNCA 2WXDM 3W53A 3CZJA 3SCNA 3OZOA 2X0YA 3NSNA 4KH2A 1CLVA 4TVDA 1J11A 3WUFA 1UR0A 3WY1A 4S3JA 3AZTA 1MYRA 4D6CA 1US3A 4YHEA 1RP8A 4E2OA 3WDPP 1VFOA 4W93A 3W81A 4AEEA 1EHNA 3UETA 3WNPA 2J7FA 1E15A 3ARYA 2D20A 1UWIA 3ARQA 4CD4A 4HZ7A 1JAEA 1HNYA 3GXMA 4GQQA 1JXJA 4W7UA 2D0GA 1EA9C 3N12A 1LLOA 4D6JA 3K4DA 2UWFA 1OINA 3AIWA 2CBIA 2WB5A 2WC4A 1C92A 1CGUA 5CPSA 4Q22A 5JBDA 2X0HA 4AD5A 4CD5A 1QNSA 3WDRA 1K6AA 2WSPA 1BLIA 3WBAA 2WCSA 1RD6A 4F9DA 2DT1A 1TMQA 3BCFA 3ALFA 2WLZA 3BC9A 2V5CA 1EQCA 1QHOA 1E0WA 4NZCA 4DM1A 1ZBVA 3OBAA 1ESWA 4U2YA 3N17A 2VOTA 5FD0A 1Y7VA 3AMKA 1L8NA 2WMJA 3RILA 1BGAA 3CZKA 1GZJA 3SUSA 5DT5A 1XC6A 4RE3A 3VD3A 3MU7A 1ITXA 1HJQA 3VGDA 4PUEA 1H4PA 4L4PA 1C8YA 3WD3A 4JCLA 1FH7A 3AMGA 4XUYA 2Z1KA 1EO5A 3F5KA 1W1PA 1V03A 6A3HA 1BYBA 3VM5A 5A8NA 4NI3A 1B3YA 3O2LA 2XGIA 2YL5A 1UHVA 4GPNA 3U57A 4C7DA 3MSDA 4PTWA 3AHTA 4JKKA 4GZIA 3L2LA 4LYRA 1XSIA 4PUDA 1E6SM 2J8FA 1PX4A 1SFSA 4CCCA 1EIBA 7A3HA 3AROA 2BHZA 2ZXAA 4AIUA 3ZR5A 1KR1A 2WBGA 1E4MM 4L4OA 4AXNA 2OSYA 3ARUA 5CPQA 3WD4A 3ZJ6A 2WMHA 5LYRA 3WELA 2CBJA 2VCBA 4V28A 1ITCA 1MXGA 4D6FA 2VRJA 1WZKA 4MB5A 4E8DA 2J7CA 2QHAA 3WDIA 1B3ZA 1UD4A 4B9ZA 2ZX8A 4W89A 2VQTA 1W9UA 3NSMA 4J3WA 1E6QM 2PWFA 3OLEA 4EE9A 2HVMA 3VNYA 3THCA 4C7FA 4NF7A 3U5UA 5DMYA 1EOKA 1UKPA 1JL8A 1WO2A 4OOZA 1LL4A 3RPMA 3LPPA 4UFMA 1B3WA 1HIZA 4PMVA 3VIMA 2XSAA 3GBDA 5CPTA 1V0NA 3WNLA 1H09A 3PZIA 1JXKA 2PF0A 1AMYA 2VO5A 3AS1A 3VKKA 1BG9A 2WNWA 3SUTA 1R7OA 3PZOA 1E9LA 2W5FA 5IFTA 1US2A 4Y7EA 4F66A 5EFFA 3AS2A 1XD1A 4EK7A 3ECQA 5M03A 1QI4A 5FCZA 1R87A 2DSWA 5D8WA 3CZEA 2PC8A 1J0HA 5JBEA 1EXPA 1W9BM 4WIWA 3EBVA 4H04A 1OGGA 1IZKA 2YJQA 3AMCA 4R5EA 5A69A 4AD1A 3TTSA 1TA3B 5A6LA 2UY2A 4PSPA 2PI6A 3W28A 1CWYA 2DSVA 4X0NA 3TP4A 1J9YA 1R85A 4LYQA 3WF3A 5A1AA 3NJ3A 1QHPA 1M04A 1UWUA 3PZTA 2D0HA 1JGIA 1BAGA 1OSEA 1J0KA 5A94A 3N04A 1G1YA 1UQYA 2VZOA 1KXHA 4KRTA 1BVZA 4KGLA 2GDVA 2XIIA 3FXYA 1PZ2A 3VU2A 1JNEA 5ABGA 1MQQA 4PSRA 3ZM8A 4W85A 4QFUA 8CGTA 3VGFA 3SCTA 3QOKA 5HOSA 1OBAA 3WF0A 5LA1A 3QGVA 4A4AA 5HNNA 2XG9A 5ABFB 1HJWA 4J3VA 2WMFA 4DWSB 4LXFA 1N82A 3OGSA 4IUGA 3WMSA 4DWSD 1VF8A 4NRSA 4UR9A 5A6BA 3K8KA 3GNPA 2WHMA 5EFDA 1UOKA 1E43A 3BLPX 4W84A 3BXWA 4AWEA 1HJVA 2CBVA 2G4FA 4UCFA 1PEZA 5A8MA 1OD0A 2OWWA 4S3KA 2ZUUA 1W9VA 1ZU8A 2WVVB 2E9LA 1LWHA 3U7VA 3OA5A 2J74A 3WMCA 4D6IA 4DUVA 3MUIA 1ZJAA 5D9PA 2G3JA 2DIEA 2VZSA 5EB8A 4B3KA 2VX6A 5BXRA 3ZJKA 1ZB5A 2W61A 2XWEA 5TD4A 2ZX6A 4XV0A 3VIKA 2AOSA 1GNXA 1MW3A 2J8GA 3MUZ1 1B90A 1WPCA 2CHOA 4AISA 1E4LA 4M81A 1BPLB 3WH5A 2QLYA 2DT2A 3RJXA 1C8QA 5A8QA 3GYCA 2Y2WA 3PZUA 4KWUA 2EPOA 2J75A 3WH6A 4E4PA 2AAAA 1TA3A 4RE4A 3W25A 2XPKA 4LX4A 1JI2A 4AD0A 1TCMA 4JHOA 2FHBA 1BGGA 3PTQA 1UD2A 2PBOA 4UOJA 1ZBKA 1HP4A 4W8LA 1UKQA 1Q6GA 1R7AA 3CHEA 1TFVA 4OOUA 5DO8A 1FH9A 1KQZA 2DIJA 3J7HA 2ZUSA 1PBGA 3T2PA 4TOQA 2V38A 4N0RA 2YDRA 1JG9A 1W9DM 2VT0A 1H41A 1V3LA 2X2YA 1MQPA 3UG5A 4EANA 2CERA 1UH3A 4HA3A 3VGHA 3DECA 4HPGA 5HPOA 4XZBA 1BSIA 2BVDA 5ABFA 1QVBA 1H1NA 2VZVA 2FH6A 4DWSA 1KWKA 2XVGA 2VCAA 5AC4A 2C0HA 2PWEA 4FK9A 2BY2A 1J0ZA 4UQ9A 3N9KA 4IPLA 2O9TA 3EMQA 3F5LA 2WC3A 1H0IA 3AISA 3VIPA 2C7FA 5A2AA 4JCMA 3TTOA 1KR0A 5HPCA 5A95A 4P7QA 5HBFA 3SCSA 4BQ2A 3N1AA 3AHVA 2XVNA 4AMCA 1JZ3A 2YL8A 4MNLA 4OUEA 2XUCA 2V3FA 1CGXA 3EYPA 2FH8A 4J27A 4LQ1A 1B2YA 2V3EA 2WVVA 1CXEA 3WF2A 4N42A 1E72M 5A2BA 1PAMA 2E8ZA 2D22A 5BRPA 3SCRA 5IHSA 1GQLA 4W5UA 3W27A 2A3EA 1GOIA 2VI0A 2ZX9A 3LPFA 1WZAA 1JZ8A 2ZXDA 2FHCA 3WH7A 2B31A 3FY1A 1QI2A 4CD6A 3ZT5A 1TR1A 4YN5A 3LPGA 3WFLA 2JE8A 1XSKA 2GJRA 3AOFA 2WW5A 1ZJBA 1ECEA 1JD7A 5CJ5A 4UOQA 4GXPA 2WCGA 1OD8A 3GXIA 3JUGA 3VINA 2RGMA 5CXPA 3THDA 4PTVA 3WMBA 1A3HA 3BLKA 4P8VA 3I3BA 5KZ6A 3BAWA 2CKSA 4AZBA 1EDTA 1G94A 2WAGA 4PMZA 5LA0A 3AXHA 1XD0A 1NP2A 1BF2A 1ODZA 4OBRA 3WDQA 4W87A 2G41A 1W2VA 3GZAA 2ZX7A 5A6JA 4GO8A 2YA2A 3K46A 4W8BA 1B30A 4ZENA 1BVNP 2GJXB 3WDJA 1GQKA 2ZUMA 4GKLA 4GI8A 2XYLA 1K9FA 2A3CA 2PB1A 5AC5A 1QNRA 2J47A 3ZJ8A 3FHQA 5I78A 1VFUA 1JI1A 3WD1A 1UWQA 3MO4A 1V3IA 3APGA 1FFQA 1JNDA 3AS3A 1U33A 1LJYA 4HMCA 2ESCA 3UG4A 4Z2KA 4AD3A 1J01A 4PMUA 1GJWA 3PHAA 3CZGA 5I23A 3WQ6A 3BAJA 1DWFM 3W6LA 1BFNA 2CBUA 3DC0A 1GHSA 1MFUA 3D3AA 4WSKA 2BV9A 1FA2A 2YBUA 2QMKA 4P7NA 1CXHA 1B3XA 1KQYA 1VIWA 2W4XA 2XGBA 4HZ8A 3CPUA 4ML4A 5E0CA 3TTQA 2CPUA 2DH3A 2VVNA 4RE2A 1NWRA 1FOBA 3OLIA 3PZVA 2WCAA 2WVUA 5EMYA 2NSXA 2X05A 2EEXA 2VTFA 2WSKA 3ZOAA 1WE5A 3L4XA 3WF1A 1D2KA 1JAKA 4C7GA 5A2CA 4TX6A 3T08A 1WDRA 3VMNA 1UR2A 2VJXA 3K4AA 1B9ZA 4WLCA 4AYSA 1UD8A 2QMJA 3CZ8A 1OCQA 1E0XA 1JDCA 4B16A 2Y8VA 3O6AA 4KMQA 1OM0A 4NRRA 2EJ1A 2D2OA 2OYKA 2VRKA 3IJ7A 1B1YA 4XZWA 4A3YA 7TAAA 1XV8A 5CSUA 1QW9A 4X9YA 2ZE0A 3BSHA 2QF8A 1JFXA 3POHA 2JIEA 1U30A 2O9OA 4PMYA 5A8OA 3ZQ9A 2G3IA 3VD7A 3WL1A 1E4NA 3AHYA 1LG2A 3WKZA 5A6KA 1UH2A 2VL4A 1V3KA 2VX7A 2XVPA 3RMEA 3BAIA 4PCSA 2BXZA 3FAXA 4X0VA 4HZ6A 2BXYA 2W91A 4AD2A 4V27A 2GUYA 3OGRA 2UY4A 4AEFA 3NSXA 1HP5A 3EMZA 4QCFA 2NT1A 3GTNA 5E70A 4M29A 2WKLA 1Q6EA 2F8QA 1HL8A 1FP9A 2D1ZA 1C7TA 3AYSA 2EPNA 3KL5A 1MFVA 4ATWA 1QI3A 3ZT6A 2CITA 4CGTA 3MUAA 2XFYA 1NH6A 1AQHA 1R8LA 3L4UA 3LPOA 1H0GA 4W7VA 5JUVA 1QPKA 4PMRA 4CD8A 4HTYA 3K8MA 4U31A 1VAHA 3WUGA 4J3TA 2WVTA 4UOZA 4GIAA 1W3HA 4M1RA 1WNOA 3MV01 4CVWA 4Z2HA 4JKMA 3L4ZA 3WEOA 1SYTA 2W67A 3CUHA 3ARPA 1Q6CA 5F7UA 2J79A 3ARWA 4HOZA 5IXEA 3SIMA 1GPFA 4J3XA 4JHZA 4V2XA 3UEQA 2EPLX 1XCWA 1IV8A 3S6TA 3GXDA 2VVSA 4CU7A 4DM2A 3BH4A 3M6DA 4U5IA 2GFTA 4CU8A 3W24A 1MW0A 1CGWA 2WHJA 1OWQA 2XFFA 5D4YA 8A3HA 4GI9A 3TOPA 2WHKA 3WQ8A 2IUZA 3IAQA 5CQ1A 1ISVA 2GSJA 4DWSC 1VEMA 4PMDA 5FOOA 3B9AA 1S46A 1SR0A 1EDGA 1CXKA 3RCNA 1C91A 1WDPA 3HJEA 4MB4A 3UERA 1UKTA 2F2HA 2VUYA 1JZ5A 1GOQA 4PCTA 2YIHA 2BVTA 4M24A 1TVPA 4OZOA 2YBTA 4QP0A 4UTFA 4JZ5A 1ZBCA 5BRQA 1HT6A 2Y24A 5BYWA 1GOOA 2BY0A 3G6MA 2JEPA 1VB9A 1QNQA 4U3AA 4MNKA 2UY5A 1E1FA 3VDCA 1CECA 2XHYA 1XH2A 3KE0A 1GCYA 1NM9A 2IXVA 1HF6A 4D72A 3L4VA 2EQDA 4FLSA 4H8HA 2DGAA 5I6SA 1V6VA 1YQ2A 5FIPA 4B9YA 3OLDA 5ABHA 1F4AA 3RM4A 3UCQA 4UFJA 2C8NA 2G3MA 1UH4A 4BQ4A 3L4TA 4J3SA 2UY3A 3L2MA 1KCKA 3BAKA 4QLJA 3WQVA 5I3DA 4URIA 3SCVA 4ZE4A 4M8UA 1LWJA 4HOWA 1OGBA 1DP0A 2YDQA 3SCWA 1V6XA 3NDZA 4F9JA 4A3HA 4D6GA 4ATLA 4AIOA 2XVLA 3AZSA 5E0FA 1UR1A 1G0CA 4AZCB 5AY7A 3SCOA 5I24A 4M80A 4TVCA 3AXXA 2J62A 4B15A 1KGXA 1UR9A 3TA9A 1QOXA 4MNMA 1ISZA 3ZSSA 2JF6A 4HOXA 2ZIDA 1UWRA 2WZEA 4D6EA 3PZNA 3WNMA 1GONA 4RL3A 2J4GA 1WDQA 3ARZA 1LG1A 3WH9A 3AIBA 2GDUA 3AMLA 2YL9A 4M56A 1G01A 5HDRA 3IANA 4ZXOA 3POCA 4NSBA 1XSJA 5D9OA 4HA1A 3T0AA 3AYRA 6CGTA 1QI5A 4E8CA 1E1EA 4TXEA 1NWUA 4P7OA 2J7GA 1NP0A 4IM4A 3HMCA 3G6LA 1IT0A 2D0FA 4P7LA 1DTUA 3OB8A 1D3CA 5LA2A 4U33A 1ISXA 1E3ZA 1C3FA 2DSZA 3N11A 5BXSA 5CGTA 1MWOA 4YPJA 3QHMA 1UR8A 1WAWA 2E40A 3VDAA 5E6ZA 3N15A 2GJPA 5A6MA 3VUPA 3L4WA 2J77A 2CXGA 1UD6A 1W2PA 2CKRA 2XJ7A 2WC7A 3OZPA 3VM7A 3SCUA 3DYPA 2VX4A 2Y8KA 2E9BA 3M7SA 4UFLA 4KRUA 1CNVA 1O6IA 4ZE5A 4P8UA 4UFHA 3N13A 3OG2A 1UG6A 3ZR6A 1V08A 1TUXA 3VNZA 2D24A 3CUGA 5GPRA 2BY1A 1E71M 1E6NA 5BROA 3KZSA 2BY3A 1I75A 5JBFA 1AVAA 2ZUVA 1UA3A 1YHTA 2RGLA 2A3BA 5HXMA 1GQJA 3VILA 1X6NA 3K1DA 3RJYA 3WL0A 3W0KA 5I0DA 5GQBA 5FL1A 1JZ7A 4YHGA 3W6MA 2WZHA 5M5DA 3MMWA 3ZIZA 3LMYA 1OT1A 2OWXA 3RIKA 2WMKA 1P6WA 1G9HA 1KFWA 3AS0A 2VZTA 1FFRA 1CGYA 3UG3A 4QLKA 3W37A 4HA4A 2DDXA 4W86A 1DWIM 2J7DA 4PMQA 2E3ZA 4F8XA 4D1JA 4BS0A 4UZUA 2PWDA 1KXVA 1WDSA 4U3CA 4PYSA 3SUUA 3SCQA 4AZ6A 3VDBA 1GVYA 1KXQA 1V6UA 1V3MA 3TONA 2ZUWA 2W63A 2NW0A 1UA7A 2OYLA 3AIQA 3FNDA 1CBGA 2VX5A 1DWAM 4EKJA 3MSGA 1J12A 4W7WA 2XM2A 3U5YA 4MDPA 2WBKA 1EH9A 1VJSA 2WPGA 1MQRA 4WK9A 5I5RA 1UD5A 3MUY1 4LPCA 1E5NA 3F4VA 3VGEA 1HVXA 3GM8A 4HU8A 4JL2A 1W1YA 3FAWA 1TG7A 2XVKA 4AY1A 4H8VA 3W29A 3GDBA 5BXPA 2D23A 1A47A 4KGJA 5BWFA 2CESA 2QV4A 1J18A 3I3DA 2XWDA 2CCRA 2CETA 1RP9A 3ZT7A 1JFHA 1GJUA 3CMJA 1ZS2A 5BXTA 3KL3A 4JKLA 1EOMA 4AW7A 3F5JA 3W26A 4F79A 3OLGA 2VCCA 1XH0A 3A47A 1C8XA 1PPIA 3VIGA 3QHOA 2W62A 4Z2IA 3W82A 1CTNA 3VD9A 4ZEPA 3MV11 5E09A 3GH5A 3WUEA 4PEEA 3MMUA 1JYWA 3BMWA 2YDSA 4BCEA 4GINA 4AC1X 4P7RA 3WD0A 1W1TA 1VFMA 1WZLA 1EGZA 1L0PA 3PZ9A 2JIWA 3K8LA 3T09A 1KBKA 3AIVA 3B9EA 1DWHM 4HMEA 5EBAA 3CBWA 2W66A 1CZ1A 2BVYA 3FN9A 2XSBA 3RO8A 2DT0A 1E0VA 4MJ2A 1E70M 1FH8A 4AIEA 4BQ5A 1JYNA 1QBBA 4J7RA 3EDFA 1BTCA 1KB3A 3WQ5A 3VIJA 2CIPA 1UQZA 3OGVA 3WH8A 1B3VA 1OT2A 4AZIA 4AD4A 4JFVA 1J0JA 2DT3A 1UWTA 4HMDA 1EQPA 3WQ4A 3NDYA 2OYMA 1QNPA 3T2QA 4CU6A 3RM8A 1NWTA 3D5HA 4U2ZA 1PZ3A 4MJ4A 4CN4A 2YLLA 2OLHA 3UR7A 1MW2A 5AYIA 2CHNA 3PZQA 1MXDA 1PIFA 2D3LA 2BNJA 1ISWA 1H3GA 3AI0A 3VVGA 1O7AA 2E0PA 3DYOA 1V0LA 2PBGA 5DEZA 3AIRA 1M01A 3AIEA 4UQDA 1E40A 3CTTA 3HU7A 1KGWA 5I2UA 1OIFA 2FGZA 3EDEA 3A4XA 3U7BA 1FP8A 3CHDA 4HPHA 1E3XA 1GORA 4QCEA 3ARTA 3NUKA 3CMGA 3DHUA 3VMPA 2GK1B 3AZRA 4UZSA 2Y4SA 5ECUA 3EDKA 1KWGA 3ALGA 3M46A 3CHFA 2EO7A 4BQ3A 5FKYA 2OSXA 4AZ7A 3VIIA 3N18A 5CLTA 1WZMA 1CGTA 2ZXBA 3VX1A 2Z1SA
chains in the Genus database with same CATH superfamily
4N9CA 4DI9A 4DZHA 2VC9A 4OGZA 2AQWA 3MZNA 4I9TA 1AMKA 3PZMA 2AKZA 1GOKA 2WVSA 2GJXA 5A5WA 4MAZA 2DSUA 4BI5A 3TDFA 1PIIA 3B0YA 3S2NA 1HKMA 3CLWA 9XIMA 3OO2A 2GVYA 3RRXA 2D2GA 4GNKB 3SURA 1K9DA 3VPLA 4UQAA 3TIMA 2BFGA 1GHRA 3E74A 3CUIA 3T2OA 1DYSA 3I3EA 2G3FA 3LU2A 4TTUA 2D69A 3CO4A 5D2WA 1YYAA 1KFJA 1TPUA 4PRWA 4CN1A 4UTHA 1H2JA 4L65A 5KETA 4XB3A 1E5JA 3S5ZA 4M6UA 3TAOA 1Q3NA 3E0VA 4JX6A 5D02A 3REQA 3ZVHA 3G1VA 3JZEA 3WK3A 3HV8A 2WKGA 1GTHA 4LYPA 1J5SA 1I2RA 1KC7A 1TTQA 3QQ1A 2YLAA 3LSCA 5KEZA 4KKXA 3MTWA 3RO6A 3GDRA 4FF5A 1JF6A 3VGBA 1LQ0A 4I3GA 3WNNA 3HG3A 3B0PA 2VFDA 2ZICA 1C93A 1AW5A 3GIYA 1OF8A 4J40A 1HFBA 2Z2BA 2E8YA 1ZAJA 1YDNA 2WANA 1OVDA 3IUIA 2VENA 4MB1A 3TCSA 3WNKA 3S9YA 4UQBA 1OABA 4FXFA 4OT7A 2QKFA 3FKKA 3G1AA 1FWDC 3E2RA 4IPJA 2Y61A 4BF7A 3L7RA 4D6DA 5IFPA 3OIXA 1A5BA 1W3JA 2QUTA 2A1YA 2BODX 1ISYA 2WMIB 4JEQA 4BK9A 3VA8A 4JFUA 1Q6LA 4KFPA 4JR5A 3TTYA 4MTVA 2YA0A 4JIQA 1XPGA 3L65A 5XIMA 1V02E 1X1ZA 1GOMA 5B80A 2VGFA 1ZUAX 2HV5A 1D7FA 3IIVA 1W3KA 2ACRA 3A4AA 4HYWA 3UA3A 1B31A 1OYAA 3TROA 3UESA 4JFWA 1P0DA 8XIAA 1WXYA 3JW7A 1CXFA 3GW3A 2PDQA 4O1FA 5D9MA 2DSKA 1F3TA 3HPZA 4OV4A 3EX3A 4AWSA 2ZOXA 3V5CA 4E38A 2OODA 2Y70A 3GDLA 3D3FA 2E6AA 1XCFA 3G1SA 2QCHA 2A3HA 4RZ6A 4EXQA 3L5LA 5C2GA 6TAAA 2NV2A 2NT0A 2HISA 3GNRA 2G0WA 4H3DA 1MMFA 2WYSA 3WBEA 4H41A 5D30A 1M5WA 3S2CA 4JFSA 3SBFA 4K8GA 3M9YA 1EP3A 3HN3A 4HP5A 3WQWA 4ZFMA 1XCXA 4K6AA 5B7YA 3GE7A 3EDJA 4LV4A 4GBUA 2R8WA 1G4PA 4TMBA 3WSUA 1FCQA 1YDVA 4XKYB 3H70A 4PTMA 1EX5A 1GVIA 2QF7A 1K8YA 4MSSA 5BW6A 3TVAA 3KBNA 4Q8NA 6PTDA 3PZGA 4NG3A 4IX2A 2REQB 2I5GA 2QPSA 2P0OA 1E55A 3GKAA 4AVNA 4HQVA 4LH8A 4INFA 3UXIA 4WSJA 4QR6A 1NTHA 3A23A 3WEZA 1RPKA 3U2CA 1KGUA 1VFFA 4C5YA 3UZJA 4O19A 2A5HA 4I6VA 4XO6A 4CNPA 1TWSA 2INEA 1JEZA 1SGJA 5HWJA 5FJJA 3WLQA 5GVJA 3TWAA 3CASA 5C54A 1XGZA 2G37A 1ZY9A 4Z2JA 3IK4A 1H7NA 1WCGA 2VC5A 4JXCA 4MPKA 2NQHA 1GOWA 5A3HA 4O50A 4MB3A 3HURA 4MG4A 1MUMA 1FHLA 3ZSTA 2JEQA 3PBGA 1A5UA 1ECQA 4F48A 2J7HA 1T6MA 1X7IA 4NKCA 1A4MA 4HNLA 4R27A 2NLYA 3VNLA 3CIWA 4WY0A 3NPXA 3GU2A 4LT9A 3RFAA 1TZ7A 2QCGA 4LAOA 2QW5A 2PAJA 3W1QA 4HK6A 2V3GA 1R2TA 1S39A 3I7SA 3NQ8A 4R53A 5HMFA 1PS9A 3B8TA 5LIYX 1D9EA 5DXYA 3WDHA 1JPIA 3MT1A 3OVGA 7REQA 1XF0A 3EDDA 4U5KA 3CV7A 4Y9MA 3E1F1 1DEDA 4LFYA 1BXCA 3BAYA 4GO9A 4WCJA 2GQ9A 1FWWA 1GVSA 9CGTA 1XRFA 4Q8PA 1BYDA 4PBEA 5CSYA 4RXGA 1KBBA 1Z44A 2YKKA 3CGTA 3IJ6A 5JMUA 1S2VA 4ZR8A 3LCIA 3IK2A 4P8XA 1W91A 3B3DA 2HS8A 4Y8FA 1FTXA 3EWZA 4QIUA 3BMVA 3RXZA 1IZJA 2PU1A 2Z00A 1LOLA 3P2VA 3BV7A 3PANA 3GNOA 4ZB5A 1ITUA 3H4GA 1X6LA 3GNDA 4JTFA 1RJRA 2GVGA 4TU1A 1R2RA 4DELA 1UYQA 1I1WA 2V68A 4AFYA 3VK5A 4ZBCA 5LKYA 3ZR4A 2F61A 4JFTA 2DPEA 4JL1A 5GNYA 1GVFA 3K13A 3E0LA 1ONXA 3PJTA 4PN2A 1Z89A 8TIMA 5G2HA 4M82A 3LZ5A 2HDJA 1V3JA 4G9PA 1ME8A 3BLLA 4C1NB 1IGWA 2ZWZA 3EKGA 3LD5A 2A85A 1DHKA 2C19A 1UZ4A 3LS9A 3PWIA 3QZ6A 1HJSA 4AX6A 4DF0A 4YXGA 4LY8A 2Q02A 1REQA 3S1XA 4PFHA 2DEPA 4FA3A 1TE6A 1B0IA 1WV2A 4MFEA 3GH4A 4QM1A 4UIOA 3W4RA 1XLIA 3NL2A 5K4XA 2CW6A 4R3UA 1MO0A 3NL6A 1VLWA 4RNFA 5HQEA 5A8PA 3MSRA 5DT7A 4OBSA 3SUVA 2H8ZA 1JDDA 4J28A 4LV9A 3UZWA 3C52A 2EKGA 3GXTA 4REQA 2QPUA 3GH7A 2RFGA 1TB3A 3CZJA 4LCQA 3OZOA 4B5VA 3WJZA 1KM5A 1VFSA 4D6CA 4DBSA 1XXXA 2VFGA 1M3UA 4FX7A 4RZBA 1F8IA 5K9XA 4A21A 2FJUB 2GVLA 4U4MA 1XS2A 3EX2A 1DJXA 4JTHA 4AEEA 2OZ8A 3WNPA 3ARYA 1DIEA 5D2TA 5M2FX 3P84A 1FKWA 2VGBA 3GXMA 1JXJA 2YGYA 2ZRZA 3DERA 3N12A 4IL0A 4RW5A 4ZMGA 2UWFA 4HHLA 4QSFA 2CBIA 3TW6A 4Q7BA 3OA3A 1CGUA 4AHOA 3ABQA 3QPEA 3S1WA 1K6AA 3WBAA 1XDMA 1HGWA 1R0MA 3CWHA 1O68A 2WCSA 2DT1A 1TMQA 1KLYA 2WLZA 2B7NA 1IXOA 1E0WA 4NZCA 3A24A 1EJVC 4DM1A 1ZBVA 3AMKA 4IIEA 4RPPA 4UTIA 3C56A 1YMYA 3L0NA 5DT5A 5HMDA 1XC6A 3MU7A 3WQEA 3CQHA 1GVOA 1HJQA 5G1TA 2DVTA 4PUEA 3G2GA 1FXPA 5DBUA 4L4MA 3WLJA 3AMGA 4EAYA 2PDLA 3BG9A 3GG0A 1A5LC 3A13A 2Y8UA 3LV6A 3VM5A 5A8NA 4ZB2A 4KETA 3P5ZA 2W0UA 3O2LA 2YL5A 4GPNA 3U57A 4C7DA 1OCNA 4GXMA 1LQAA 5HUPA 3O6CA 1X98A 3CWOX 1OZMA 3GB6A 1PX4A 4CCCA 3HG2A 1DXFA 5FJUA 1A5KC 3VC5A 2GYIA 2X1UA 4LUSA 1GEHA 3IV8A 1E0UA 1RA5A 2WMHA 3WELA 2QCLA 4DJEC 1SZFA 3EX4A 3U8GA 5EGRA 4D6FA 2QUMA 1WZKA 1FWCC 4DIAA 2J7CA 3UXLA 4B9ZA 1IHIA 2I9UA 1QPQA 3W7JA 4EE9A 3KP0A 1WBHA 5DMYA 1EOKA 1UKPA 2FZMA 1JL8A 2R14A 3GHRA 3L68A 4HKPA 4FX8A 5AHEA 1RXOB 2XSAA 1LORA 3CQJA 2VOMA 2Y5JA 3EB3A 2CC0A 3PZIA 1QDSA 5XINA 1XLDA 2VO5A 1Q6RA 1LUCB 1BG9A 1XBYA 1R7OA 4M6VA 3WK1A 1E9LA 5TNVA 3LHTA 3LQLA 2OO6A 4EK7A 4WGHA 3ECQA 3DENA 5M03A 1F05A 4HHHA 3ITYA 1J0HA 3SGUA 1W9BM 1EBHA 3H21A 1KKRA 3O16A 2OO0A 1OCBA 2R1LA 2V67A 4H04A 2FTWA 2E5BA 2IKHA 2CZVA 5HWMA 5A6LA 2UY2A 4PSPA 1CWYA 3QXBA 1J9YA 5A1AA 3S4TA 4H4IA 1Y5XA 3NJ3A 1Z48A 3TLLA 2ABAA 4IIFA 3OQEA 2D0HA 1OSEA 1O1ZA 1JQVA 1SZEA 4PUKA 4F0LA 2ZZ5A 4JIHA 1BVZA 1YTDA 3FXYA 1B4KA 3H2NA 1FWGC 1JNEA 5T9CE 4W85A 2G5WA 1YE6A 1S1RA 3QOKA 1OBAA 4ZL1A 3QGVA 2XG9A 3LHWA 4R7JA 2OQLA 1AUSL 4GJ1A 3H12A 1N2VA 4DWSB 2WQPA 1VQTA 4LXFA 1N82A 1VF8A 4NRSA 3S5OA 7ENLA 1GJPA 3GNPA 1F3XA 1E43A 4XTDA 3BXWA 1IZCA 1HO4A 2G4FA 1QR7A 1SW7A 4UCFA 1PEZA 4ZZ9A 4ZO6A 1DJHA 1XBXA 1K7EA 2ZUUA 4ICMA 2Q8ZA 4MY1A 3VKCA 4YVPA 3E38A 4GXWA 3U7VA 2I5IA 2J74A 1ZJAA 2Q8LA 1P1MA 5D9PA 4DAIA 2FPVA 1IQ8A 3RCYA 3ZJKA 1XIIA 3P74A 1MSSA 4XBJA 1TJ1A 3MVIA 2AAMA 3O05A 3OHMB 2ZX6A 4XV0A 3E0WA 3DC8A 4ALDA 4DRSA 1B90A 4O53A 5K2ZA 1KRAC 1EP1A 5FF2A 3BOFA 1AH3A 3WH5A 2QLYA 3JZUA 8XIMA 1C8QA 5A8QA 4KWUA 1B54A 1SJCA 2J75A 4XSMA 4LX4A 3SRHA 4GKTA 4UR7A 3PTQA 3UF9A 4Q4SA 1UUMA 4W8LA 3WJSA 5H91A 3CHEA 5AC6A 1JPDX 1FH9A 1LTDA 2DIJA 4TOQA 1EGMA 3QEZA 3BW3A 3F1QA 1JDEA 5DMNA 5MF5A 5AHLA 2OKOA 1V3LA 1MQPA 2E68A 4EANA 1UH3A 4HA3A 4O10A 4HNUA 2FVMA 4XZBA 2Z26A 2D73A 1BSIA 2BVDA 3KLKA 5ABFA 7XIMA 3LMZA 2VZVA 1MI3A 2C0HA 3QR1A 1J0ZA 1R3YA 1H0IA 3AISA 4Z1YA 5A2AA 3H7VA 2PWUA 4LEQA 4HYVA 5A95A 4P7QA 5HBFA 3N1AA 3AHVA 4AMCA 1JZ3A 3HOJA 4DJDA 1R9XA 4LNCA 4J27A 3ERPA 3IIPA 1CXEA 3FYYA 5CZSA 3WF2A 4QAIA 4N42A 1E72M 1PAMA 4HNTA 3PBUA 4W5UA 3TEVA 4GQGA 5CAKA 4IIHA 4RE0A 1TELA 2PRHA 1JZ8A 4TX9A 4LF2A 2JKPA 2FHCA 1TJPA 3ZT5A 1M1BA 1TR1A 1O12A 3PR2A 4YN5A 3MP3A 2O7QA 3QH2A 2JE8A 4A29A 3R6IA 1XSKA 2GJRA 3AOFA 1ZJBA 2WW5A 1S5NA 2DVXA 4MFDA 1W5QA 3IUHA 1W1A1 1AW1A 1R3QA 3HBLA 3F2BA 4HSOA 2ADAA 3GXIA 2VEIA 1W8GA 3ZZ1A 4C60A 2C91A 2PDPA 1PXGA 4K38A 3VINA 4C6OA 1XIMA 5CXPA 3THDA 3WMBA 3CB3A 3LCXA 4LAZA 4UTJA 3BLKA 5AKQA 4P8VA 3I3BA 3B8VA 4K8EA 1IR1A 3BAWA 4I5XA 2CKSA 3GC2A 1EDTA 1G94A 4PMZA 3SY5A 1Q4WA 3R1ZA 2PA6A 1FBAA 1XGEA 1BWKA 3PWGA 4DYKA 4UBPC 3W7KA 1GKQA 4ZENA 4I9JA 3W2NA 2GJXB 3WDJA 1GQKA 4KEVA 1Z42A 2A3CA 2PB1A 2PS2A 1QNRA 2ZRVA 2J47A 6REQB 3FHQA 1H63A 5I3IA 1P7TB 5DANA 3FJ4A 1V3IA 3APGA 2EGZA 3PF3A 3CPRA 4HMCA 3GR8A 1H50A 2ESCA 3SB0A 3I6EA 4I90A 2YZ5A 1KD0A 4UTUA 5F2LA 1S5VA 3U2EA 1DWFM 2XISA 4IGHA 2V8ZA 2Q09A 3EEZA 4WSKA 3NQMA 2FTPA 1K8XA 1YNQA 2QNEA 2GL5A 1CXHA 1VIWA 2W4XA 4KIRA 2XGBA 5AHMA 3RRAA 4HZ8A 1LDCA 2P8BA 1FHUA 1JPMA 3LK6A 5ENLA 3ABXA 4GACA 8RUCA 4RE2A 4S2BA 3OLIA 4HYRA 5T9BG 1DXEA 1PDZA 3L4XA 1D2KA 3BQ5A 1A5CA 4M6PA 1JAKA 4NYUA 2C15A 1S2TA 4GISA 4QEEA 5D37A 4C7GA 5A2CA 3VMNA 2VJXA 1B9ZA 3EWYA 3B04A 4EOUA 1VCFA 1BWVA 1KM1A 4GIYA 4KMQA 1OM0A 1R47A 4IL2A 3KRZA 3LENA 4NRRA 3NZ1A 1UZDA 2GGJA 2A7RA 4X9YA 2ZE0A 4DY1A 3I10A 2VFEA 4YTTA 2WJFA 2P3EA 2PPGA 1BD0A 3ZQ9A 5D09A 4BEUA 4HJWA 3WKZA 3LGGA 5A6KA 2Y7EA 4O4WA 3VNKA 1NDZA 3C3NA 2HQAA 4FNRA 3FK4A 2W91A 3TNBA 1CLKA 4IGSA 2GUYA 4L1XA 2Z1XA 4GRSA 3W1PA 4XO7A 5HJYA 1HP5A 4O0KA 2NT1A 3GU9A 3UCDA 2ZZ4A 4N02A 4M29A 5C2XA 3H7UA 3IGSA 2RJHA 1FP9A 3AYSA 1QI3A 4RK8A 5E5CA 4HCLA 3NQBA 1H7WA 4GYJA 3USZA 4CQ8A 2PDCA 1H0GA 2E7FA 4W7VA 3T7VA 5CBIA 4U31A 2QUNA 4LCSA 4B5TA 1VAHA 3UQNA 4K7VA 2NVAA 3M5YA 4CVWA 5D2XA 4Z2HA 4JKMA 3CUZA 2NX3A 3KOWA 2J79A 5K3VA 4JHZA 1IV8A 4NZFA 4Y2WA 4JTQA 2IMRA 2VVSA 3U0HA 2ZRXA 3GVGA 5D2VA 2GFTA 3QLLA 4GZ7A 4CU8A 1MW0A 2WHJA 1MNSA 5D4YA 4MWAD 2B7PA 4GI9A 3URNA 1ISVA 3PUOA 3ITOA 4DWSC 5FOOA 3B9AA 3TSBA 1QRQA 3W7OA 4M5PA 2BBFA 3H23A 1CXKA 3RCNA 6ALDA 1UKTA 2F2HA 2VUYA 4JHMA 2VFIA 3CT2A 2X0SA 4NIRA 4KESA 3IPWA 3PAJA 4WDWA 2YBTA 3IS4A 2GSHA 3D47A 1ZBCA 1HT6A 2Y24A 4WRHA 1XRTA 3OODA 1GTEA 1VB9A 3QW3A 4U3AA 1XIDA 4MNKA 2F2KA 2A2IA 3WMLA 3N6HA 2RDTA 2BOFX 3RG6A 3JRKA 4AUBA 4DJFA 1FCVA 3LM3A 4H8HA 5I6SA 1V8EA 1XYMA 3RM4A 2TYSA 1EC7A 4CEUC 4ADSA 2O4MA 2G95A 2WO5A 1UH4A 1XIHA 3L4TA 3N2OA 2OELA 2UY3A 1KCKA 3BAKA 3TUUA 5I3DA 4S3CA 1VJIA 4G7EB 4HOWA 3KM8A 4LRTA 5D38A 4A3HA 4ATLA 3AZSA 5AY7A 4XIMA 4M80A 3GG7A 3HGSA 1RHCA 2VEMA 4YLWA 3PM6A 1QOXA 4MNMA 1DOSA 1XLFA 4HPJA 4HOXA 2ZIDA 1UWRA 2WZEA 4D6EA 3E49A 2CLPA 1MRAA 2I17A 4MWAE 1WDQA 3KVMA 1QPOA 4PMJA 4BWLC 4DB7A 2YL9A 1Q66A 1RJQA 2FFIA 3KTXA 1FXQA 4ZXOA 3POCA 1XG3A 1XSJA 5D9OA 3LDVA 4YNGA 1J8VA 1QI5A 2FDSA 5SWUA 4ZA0A 5HUOA 1EB3A 1DTUA 2RH9A 2X7WA 1ZAHA 3THAA 3UT0A 2G96A 1TR9A 1D3CA 1R6WA 3W1XA 1E9ZB 4U33A 1C3FA 1SM9A 3UZXA 1GYMA 2PSNA 5CGTA 1MWOA 3GQYA 3P0XA 3NR0A 1WAWA 3VXGA 3N15A 3VUPA 2EG7A 3L4WA 4C6MA 2C1HA 1MUWA 1W2PA 4R88A 3VZYA 4UFLA 2AKMA 4XUGA 1OFBA 4UFHA 3Q37A 3MY9A 3VNZA 1A5SA 3HA1A 2D24A 1QK0A 5IDZA 5GPRA 1GVEA 3E2SA 2BY1A 2VC7A 1YLVA 3LNMA 1OEPA 3VCNA 3KZSA 2BY3A 4C6PA 2OX1A 3QKZA 1VLIA 1XYAA 2PURA 3BCJA 2A3BA 3VILA 3AWNA 3W0KA 1U22A 4YHGA 2P0IA 5EA9A 3ZIZA 4PFMA 1OT1A 1Z41A 3GZ3A 3Q65A 3MHUA 2VZTA 2B7OA 4F0RA 3W37A 3SFKA 2V9DA 2A0NA 4PMQA 4PRRA 2E3ZA 3LXAA 2ON3A 4UZUA 4ZQOA 3SUUA 3SCQA 2DV0A 3NZGA 1YKWA 1V6UA 1V3MA 5LNWA 1K8CA 2ZUWA 4LYKA 2CZFA 4RNHA 3VNDA 5DY3A 1PTGA 2VEGA 4GNJA 3QYQA 5LHEA 1NJJA 1O5XA 2XM2A 1ZHAA 4MDPA 5FESA 1VJSA 2WPGA 4IZGA 3WQOA 3GD6A 3T55A 1G4TA 3O0FA 3GDMA 5BOEA 5DMLA 1VBJA 1UC4A 4AY1A 4PUMA 5DQPA 1QWGA 1A53A 2CESA 3ITCA 1J18A 3CH0A 2UV8G 4DQWA 3NURA 2CETA 3ZT7A 3TAKA 5J04A 1VYSX 2ZA1A 4JKLA 5CPLA 3F5JA 1AK5A 2C6QA 3OLGA 5EKYA 3A47A 4FHAA 3N4FA 2GQ3A 1R2SA 4S3FA 1TO3A 3PG8A 4ZGYA 4ZSUA 3WUEA 3T78A 4EXAA 5DCBA 2INZA 3VUSA 2YDSA 2X30A 3ICJA 3QV9A 3D46A 3PNZA 4P7RA 5E93A 1VFMA 2C71A 1DJQA 3H2EA 3CC1A 2JIWA 1RBOB 3GRIA 3T09A 3LBCA 1KBKA 1IIHA 1M7OA 4X22A 4IHCA 4I8DA 4FOKA 4LAMA 1CI1A 1CZ1A 1Q7MA 3BANA 2BVYA 3FN9A 2IQDA 1IIGA 4MJ2A 2QGHA 2Q71A 4B5WA 6XIMA 4QG9A 3EDFA 3S2JA 4QE4A 3OGVA 3WH8A 1OT2A 3N2MA 2ISWA 4MZ8A 3RUBL 2OYMA 3JVAA 3G1XA 1QNPA 4CU6A 3VNIA 3SY1A 2Z25A 1GZ1A 4US5D 4EPBC 3LRLA 1GK8A 3PZQA 1X8CA 1PIFA 1PHWA 2BNJA 1ISWA 4KFOA 1T0OA 1SO3A 1O7AA 5DN1A 1PTDA 2OXNA 4UUIA 1KRBC 1O66A 1M01A 4UQDA 3CTTA 2FGZA 4QSHA 4O17A 3S83A 3FOKA 3FGCA 4Z42C 3EWBX 4HPHA 1E3XA 2TODA 3SM0A 3P6LA 3NUKA 1TPEA 3CMGA 3BLDA 3LCLA 3VMPA 3AZRA 2Y4SA 1TV3A 2I5QA 2CLOA 1HTIA 3VDGA 4G2DA 5F4WA 1I4NA 3M46A 2DUZA 4H2HA 2OSXA 3W1NA 4AZ7A 3QJAA 4LB4A 1WZMA 2ZVIA 3UPWA 3SRKA 2PFHA 2Z1SA 5DFAA 3VDHA 2FFCA 2Y63A 3AIUA 1WUEA 4IISA 3IGUA 3TJIA 2NZLA 3KRBA 3B4YA 3B8DA 4J5NA 4O16A 4R85A 3NGJA 4KIEA 2PDGA 5B7ZA 1AQ0A 1U5JA 3QGAC 5CBBA 2WMGA 2V63A 4LGXA 4NZ1A 3BK0A 4DXKA 1MDLA 3WD2A 3V5FA 2HCVA 1JZ4A 1TRDA 4LUYA 1YPIA 4K1WA 1W9XA 3WJWA 4W8AA 3PB2A 4ICCX 2A3AA 1W5MA 4AXKA 4O54A 2FGLA 5H8MA 1KRMA 2BGNE 1FY6A 3SN1A 2PCEA 1BKHA 5C71A 1XI3A 3M5ZA 1XYFA 1V7AA 3L5MA 2J6VA 3K2GA 1XLHA 4MAVA 4JY9A 4UTMA 3KCLA 1SFJA 4ACYA 3ID7A 3UJRA 2R82A 5MKGA 4KEUA 1ENUA 1EXBA 1VEOA 3W38A 2J78A 3BSGA 5BU9A 4GI6A 4ADUA 2YA1A 1TVNA 4M7SA 1R86A 1ONEA 4RLIA 1JCMP 1J0IA 1TWDA 1XQKA 4TVUA 3WQFA 3A5FA 1BEUA 1J10A 3HG4A 4XG1A 1HKWA 2XFRA 1M53A 3KWXA 5HWNA 2BG5A 2GK1A 1YTEA 3CO8A 2CLEA 3LV5A 2XIOA 3FEMA 1E6PA 1DIDA 4UQCA 1PX3A 2G3NA 3ARSA 2ZWYA 4PMXA 4WJXA 1QNOA 2J27A 3EB4A 3LLFA 4FI4A 4J4KA 1NEYA 4KCTA 2L5HA 3L4YA 4NJJA 5E6YA 3A21A 4N4PA 1LROA 5DCEA 1TVLA 1XHGA 3H8AA 3UR8A 2I16A 3ZWSA 2VELA 1YNPA 3CEPA 1XLAA 2DJXA 3ZS4A 1C9DA 3C0LA 4C6EA 3VIOA 3E2VA 4JPGA 1ZRQA 2WM0A 4H1ZA 4YU1A 1KCLA 1X1NA 4ATDA 1XX1A 2PDFA 1Y5VA 4OFCA 2HNEA 1ODUA 4IFKB 4MDOA 4AG0A 4AZHA 4CVUA 2XN2A 1JD9A 4YTSA 2FB2A 2ZVRA 1J0YA 1BVWA 2YDAA 1XL9A 1VFLA 4J1OA 2EBNA 3KXQA 3THQA 1HGYA 4DWDA 2V5JA 2OQYA 3MO7A 3PBWA 4IIBA 3QW4B 4PUWA 1ZQ5A 3C2OA 3NO5A 1UC5A 4A35A 4IICA 1CDGA 3IJDA 1SFTA 3NO3A 5E9AA 1QO5A 4QAWA 1MW1A 5CZKA 1OQFA 4B3LA 2DH2A 4DUWA 1EO7A 4RXFA 2OOFA 2LLEA 4ZOCA 1TSIA 1RH9A 3TA6A 1WKYA 4CN6A 2E4TA 3H4WA 1YXYA 2E6FA 3W87A 2HBVA 2DIKA 1Q63A 1K9TA 3ANUA 3GY1A 3ITGA 1POJA 2PMQA 1DWJM 1WBJA 4D1IA 5J8LA 4Q7NA 5PTDA 1OB0A 4GQRA 1SW3A 1OIMA 2E09A 3I7RA 2WMIA 3EPMA 3MJMA 5D33A 2XH0A 1SSDA 3NPWA 3NYDA 1EJXC 3FDKA 2OWCA 1XUUA 1TV2A 7CGTA 2Z4GA 4CNNA 1W1VA 3VOCA 1QCWA 3ITVA 3GS6A 4PBGA 3NQ2A 5G5IA 4FNSA 4NNBA 3DG7A 3AHXA 3VFCA 1W32A 1V0KA 3NZPA 2IS7A 3ZMRA 5LIXX 4OE7A 1Q85A 3A3HA 5I79A 4MNJA 2CU0A 4IPNB 1BKSA 2Y5SA 4JQ2A 4O11A 4WJEA 4A22A 4IMEA 5FF7A 1GW1A 4O15A 3AFBA 4HPXA 1W5NA 3MQTA 4NHVA 3GG8A 1HG3A 3VO0A 3DHPA 5FF0A 4S3EA 1EDQA 2QJJA 1W3LA 3KL0A 2MANA 3VD5A 3GW0A 4DJEA 2VZUA 3VKDA 3WX7A 4DBEA 1JF5A 3IVUA 1AFSA 4LNYA 3RDKA 1MEIA 1A5NC 2ZXQA 4QG6A 4W4QA 1UKSA 4AZGA 2VWSA 2ATSA 3ZLHA 3VIHA 3ATYA 4XKYA 3C8NA 1AZ2A 4S23A 1BYAA 2XIMA 4KFNA 5HJXA 2YOCA 4H6RA 3RPTA 3T8LA 4Y9NA 1FWBC 4FLRA 4DX3A 3O6DA 4JTAA 4Q3MA 1PIGA 1XLKA 3QMTA 3ARXA 2PGWA 2E6YA 2WZTA 3BARA 1UR4A 1HX0A 3ARVA 4N2YA 3WJXA 3MCOA 1E6XM 3R43A 2CLHA 3IARA 2Z6JA 4WUIA 1NOWA 4WX2A 3KRSA 3UR2A 3W07A 1HKIA 4L9XA 3ARRA 3NM3A 3T0DA 2V5LA 3UWYA 1AD4A 2ZBTA 2YFNA 3WBXA 4QDWA 5A6AA 1FWEC 4O1DA 3LA4A 1W9PA 3WLLA 4OWGA 3LRKA 4N6EA 3O06A 1K3UA 3VOGA 1VFHA 2FZDA 3ONBA 4RX0A 4CCDA 5KITA 5FI8A 4YTUA 2CNCA 1KTCA 1DWGM 4LUJA 4ZQPA 5AYZA 2W92A 3WIJA 2ISVA 3ABRA 3RR1A 1XH1A 2EJAA 3UWWA 1M03A 2DZAA 1GG0A 1CYGA 4OHQA 1XIBA 3L0KA 2Z6IA 5IDIA 4WJ8A 4PC8A 3W7QA 4FLQA 4X61A 1C90A 1JZ6A 3EMCA 4Q4QA 4BKNA 4XVEA 3P93A 3UJ2A 4UFIA 3PN8A 5BOFA 3AXKA 3B8SA 3N25A 4Y6GA 3TK7A 3NOYA 1H51A 1ZJIA 3QV7A 2NXIA 4OJYA 1EX1A 3W53A 4GH3A 2X0YA 3O6YX 4KH2A 1J11A 4PCFA 5H8UA 2XSXA 3WY1A 4G1NA 3C2FA 3QY8A 2QJGA 4RV3A 3W85A 5FAGA 1K1DA 3MKVA 1RP8A 4E2OA 2JKEA 4CCZA 4AB4A 4W93A 3W81A 1XYBA 1QUMA 3ANYA 4DYEA 3UETA 3H26A 1E15A 4HZ7A 1JAEA 3NQ7A 1HNYA 4IXXA 4X60A 4LVDA 1LLOA 4D6JA 4B2DA 3AIWA 5U7SA 1D8WA 3RYSA 1UIPA 2JBMA 2WC4A 1TPDA 3YPIA 3C8FA 4Q22A 2WM1A 5C2CA 2NWSA 4XD3A 4AD5A 1QNSA 1K7FA 3WDRA 2WSPA 4HN8A 2P88A 3NNTA 3STEA 3IVTA 4C1NA 1RD6A 4F9DA 1R30A 2ZKMX 4GNVA 3OBAA 4WDXA 3QGKC 1OK6A 5FD0A 4JNZA 3RILA 3G1YA 5J5DA 3EPNA 1D8CA 3VD3A 3DDMA 4HCDA 4EPDC 5CAHA 1OFRA 1H4PA 4JCLA 4NJIA 2Y62A 2F6KA 3L23A 4MUZA 3GG1A 4E2VA 2Z1KA 3DCPA 1EO5A 3I6RA 3F5KA 3WLHA 4H83A 1UIOA 3K5XA 1U5HA 2HS6A 1VR6A 5KZDA 2FVLA 3WQPA 2XGIA 3S0CA 3OVPA 1ZP4A 5HNRA 5CZJA 4LJ3A 3B05A 1S3TC 3L2LA 4LYRA 2X41A 2RAGA 2QVNA 1EFZA 4DBWA 1SFSA 3P80A 1EIBA 5EL1A 1XLJA 3AROA 4YS1A 1OC6A 4LC8A 4AIUA 3LGEA 1A3XA 2ZZ7A 1KR1A 1YPXA 1KM4A 4Y96A 4JTLA 4YL2A 5LYRA 2J88A 4M0XA 2CXEA 2NV9A 4IGNA 1WOAA 4A2RA 3TSMA 1B3ZA 4GVGA 2ZX8A 1XISA 1W9UA 4H6KA 4J3WA 1E6QM 4IG2B 3OLEA 4IQDA 4GY0A 1FWRA 4RR4A 5HNUA 3N2CA 3DIPA 3LPPA 3WQDA 1AZ1A 4PMVA 3PSVA 5LIUX 4ZQRA 3GBDA 1ICSA 2TRSA 3P3BA 1V0NA 3WNLA 5DY2A 3HMJG 1H09A 3TC6A 4FP1A 4DNHA 3AYTA 1AMYA 3AS1A 4KWWA 3CQKA 2PDMA 2E5DA 2WNWA 3SUTA 2OLAA 3W73A 2A7PA 3S3GA 1VH7A 1Z3NA 4O52A 3DG6A 5AECA 1QI4A 4H9VA 3DBPA 1DORA 2PC8A 5CSRA 4BI7A 2VP8A 1KW1A 1EXPA 2V81A 4WIWA 4FXRA 3AXMA 1FWHC 1DQXA 5CBJA 1X8FA 4ZCWA 2YJQA 3AMCA 5A69A 4H9MA 3TTSA 3DHDA 4J2MA 3W28A 2QDDA 2DSVA 1D3HA 3TP4A 1XYLA 3SZ8A 1GW9A 5BMWA 1M04A 2R1KA 3M16A 4KCVA 1JGIA 4MF4A 3V18A 1BAGA 5A94A 1DJGA 1KXHA 3PJXA 2XIIA 4U28A 1BXNA 4PSRA 3ZM8A 1WKEA 3WBWA 3N4EA 1M41A 4KRZA 3WF0A 4XK2A 2QCEA 5HNNA 3PK7A 5I7GA 3WMSA 4UR9A 2A3LA 3CL8A 2CBVA 2PDKA 1OG0A 2P8CA 4A05A 5CC6A 1OD0A 2I57A 3RX3A 1RQHA 2XINA 1N55A 3WJYA 1DE5A 4H6QA 3S5NA 1TJ0A 1NFGA 2DIEA 4B3KA 3LI0A 4MKSA 1LUCA 3BL3A 4PCNA 1ZB5A 1D3GA 4JTSA 4MYXA 1UBSA 2R24A 2WNQA 3CPGA 4ZTYA 4AF0A 2X42A 1I2OA 4DPQA 1DKWA 1MW3A 3HFTA 5DELA 3SJ3A 2CHOA 1KFBA 5G4HC 1UB3A 4AY7A 3OW1A 2WPBA 1E4LA 4M81A 5F1VA 1S2AA 2NXHA 3HFYA 2WOQA 2Y2WA 2EPOA 1SVDA 3A3XA 2C0AA 2AAAA 3ATZA 2HK0A 4RE4A 2XPKA 4Z17A 4AD0A 3CU2A 3INPA 3L5AA 3V3WA 3W7LA 1BGGA 5AC7A 1UD2A 3WQCA 3E02A 1ZBKA 1HP4A 3GAKA 1TX2A 2WSRA 3QV8A 1P1XA 3NQCA 4JNYA 4QE5A 5BOOA 1UR3M 2V38A 3UJFA 1G7VA 2VT0A 1H41A 1HZYA 1RQEA 3M64A 5REQB 1M65A 3UG5A 5BZAA 1K6WA 2QVHA 1A5AA 4G6CA 1WQ5A 4HPGA 2YSWA 1G7UA 1AA1B 1K03A 2GOUA 2VGGA 1I6NA 4DWSA 1KWKA 2PWEA 3SQLA 1QJWA 2BY2A 1G67A 3H2MA 4MGGA 3VNJA 3EMQA 5H1WA 4KWVA 5BNKA 2CWXA 3U9IA 1KR0A 1JJKA 4BQ2A 2XVNA 3WLRA 4OUEA 3CTLA 2XUCA 3MKCA 1CGXA 1ALDA 4LQ1A 3LERA 4O1AA 4IIDA 3SR7A 3UPMA 2GVEA 5BRPA 3PTDA 1EWDA 1GOIA 1K4GA 1KBIA 1WZAA 3LLXA 5A6TC 1Q13A 4J2PA 5GJNA 2VGIA 3WFLA 2J6XA 4Z1DA 2WCGA 2JKAA 2WJEA 4PCPA 4IP5A 3U6WA 1RBAA 1LT8A 4F2BA 4PTVA 1LQ2A 4Q6XA 1YNYA 3WLMA 1Y65A 2XZ7A 2OPJA 5LA0A 3AXHA 3S2LA 3A64A 2F6XA 2R91A 4NXKA 1W2VA 1PCWA 3ES8A 4GFIA 5A6JA 1XWYA 4GO8A 2YA2A 3BO9A 1XLBA 4YVXA 1BVNP 2PE4A 1OF6A 3I7QA 4KBXA 1YXDA 1KV5A 4DBDA 3UWQA 4US6A 4L1GA 2XIQA 3WD1A 3EGJA 3MO4A 1KTBA 3EOSA 4BWLA 1FFQA 3AS3A 1U33A 2J24A 3S9IA 1V6TA 1J01A 4NXSA 3S1VA 3TU9A 5CGQA 2QCCA 3PHAA 4AEOA 1PVNA 1NSJA 3WQ6A 3TYBA 5AZ0A 1F6YA 5IBXC 1BFNA 1SO6A 2CBUA 4JYEA 2PDXA 3GVVA 2F6UA 1Q65A 3G1FA 3N9RA 4IMCA 1ME7A 3EWXA 1V93A 3TTQA 3BE7A 3P81A 2AQVA 2C1IA 3ZFHA 3V0SA 3PZVA 2WCAA 4ORMA 5EMYA 1KTNA 2NSXA 2EEXA 2OVLA 1EUAA 2VTFA 1Z7AA 4OQVA 1UWAA 1U5VA 1AG1O 4TX6A 4B5UA 1GYLA 4WLCA 1UD8A 1OHLA 2C18A 1JDCA 3O6AA 5FJIA 1Y0EA 3GXNA 1MEHA 3QSTA 1B1YA 4XZWA 4XZLX 2PC4A 2QF8A 3BZJA 4JGDA 4ONVA 4PMYA 5A8OA 2G3IA 3VD7A 4QS5A 3WL1A 1PUDA 1E4NA 4JX5A 3AHYA 3UW6A 4QITA 3ABOA 3EWDA 4J3ZA 4HJFA 4GJIA 1UH2A 2VL4A 3QMSA 5LXXA 2QIWA 3H2OA 4XAFA 1EYWA 4MJMA 2CZDA 2DW6A 2VX7A 2XVPA 2W6RA 2V2DA 3BAIA 3UJEA 4E2DA 2BXZA 4NX0A 6REQA 2OOGA 4NILA 4AY8A 4AD2A 1FWAC 1T7LA 2J9YA 1P7TA 4XQ6A 4O14A 4AEFA 2VYOA 5E70A 1HL8A 3URQA 2D1ZA 3UZZA 1C7TA 3OTRA 2H8XA 4ATWA 3ZT6A 2CITA 1F5ZA 1C29A 1GYNA 4IJCA 2BB0A 1RLDA 3IJLA 2GGEA 4H8NA 4JEJA 1YRRA 3L4UA 3LPOA 3W6YA 5JUVA 4QTGA 3UPBA 2PDWA 3H55A 2X1SA 3UY8A 4ZFCA 4HU4A 2FGBA 4UOZA 4RDWA 1WNOA 4O0ZA 1TMHA 5I07A 3S9ZA 4Y9PA 4HZMA 4LF1A 3WEOA 3W1RA 2W67A 4CNTA 2OR2A 1VIZA 3ARWA 2X16A 1GPFA 3B8UA 4V2XA 1DL3A 4K1GA 4GHRA 3S6TA 3GXDA 1ZAIA 4AYGA 3BH4A 3M6DA 4I6KA 3F2CA 4MWAB 3W24A 1OWQA 4HK7A 1GVQA 4ML9A 3STCA 3WQ8A 4DO5A 2P1FA 3IAQA 5CQ1A 4AIBA 1ZSXA 3CWNA 1VEMA 5H8PA 4PMDA 2XH7A 5HJLA 3LTYA 5I3FA 3UERA 4JTKA 2OZTA 5KZMA 1VPXA 4C65A 2E1DA 2YIHA 4MY8A 3P8IA 1FWIC 4M24A 2OX4A 4OZOA 4UTFA 1JCNA 1XFCA 3W7CA 4P2VA 3KS6A 3WYZA 5BRQA 5BYWA 3G6MA 1P0BA 5L6UA 1IEXA 2DVUA 1QNQA 3LX9A 2WNZA 1TZ9A 3O7UA 4G7FA 1L2UA 1TZZA 4GFSA 2XHYA 1S3HA 3OEXA 3A9BA 4NI8A 4HNOA 1A3WA 1THFD 3KE0A 3O8AA 4D2JA 1GCYA 1UBPC 5CC5A 4F4RA 4IQJA 2OGYA 4O12A 3L4VA 2YCEA 5F2IA 4FLSA 2NQ5A 1EWEA 2QAPA 3OLDA 3AU2A 2I1OA 4XSLA 1U1JA 1X6UA 4GYPC 1I0BA 1SJDA 3DAQA 4PB3A 4IQEA 4I7UA 4JQ3A 2C8NA 3G3DA 4DO4A 3LOTA 3CQIA 1A49A 1PKYA 1S5MA 1YBQA 2NVDA 1OFQA 4QLJA 2A21A 3WQVA 2WNNA 3SCVA 3VKBA 4M8UA 1LWJA 4Q8TA 3AALA 1DP0A 1TREA 1V6XA 4O8AA 2XVLA 4WGXA 5E0FA 1G0CA 3SCOA 4XIAA 4GC4A 1PE1A 1NDVA 4DN1A 2J62A 1QWKA 1UR9A 3EOOA 4KWOA 3TA9A 1EJ7L 2FZ9A 3VE9A 2FIQA 1XLEA 3NFUA 3BLEA 2Y88A 2BMBA 2R94A 1RALA 3PZNA 3GSMA 3QTGA 4EPEC 1JPKA 1LG1A 4N6FA 3AIBA 4MPQA 1G01A 5HDRA 4Y90A 1YTKA 1DE6A 5AVHA 3TJ4A 4HA1A 3T0AA 2PGFA 4A3RA 1E1EA 4TXEA 4Z08A 2G4JA 4DO6A 4IM4A 3HMCA 4P7LA 3P5YA 2IKGA 3O15A 3OB8A 1H61A 2C14A 1ISXA 3M0VA 2FPTA 5FAJA 1V4YA 4LW7A 3TXZA 4V33A 5E6ZA 2GJPA 3HQPA 2WSYA 3QLDA 3OZPA 5JXQA 1GEQA 1KM0A 1HUVA 4E6MA 1LLZA 4KRUA 5E1QA 2PTWA 4ZE5A 4JNMA 3LZ3A 3N13A 3TW9A 1ONWA 3TJLA 1ZFJA 3CUGA 2YXXA 3RX4A 2OZ0A 1E71M 2QJMA 3GNXA 5BROA 1I75A 5JBFA 4QGCA 2ZUVA 1GOXA 2YW3A 1GT8A 4LS2A 2RGLA 3B9NA 3UXDA 1X6NA 1KFEA 4G7EA 5C7HA 3E5PA 4F2UA 5I0DA 4GA8A 3SFWA 3LM7A 3MMWA 2Y89A 2WMKA 1P6WA 2RUSA 1G9HA 4ROQA 3AS0A 2DZUA 2ZQ0A 4HA4A 1EGVA 1SPQA 3TYZA 3H22A 2BLEA 2WJZA 2PDJA 5H6HA 4D1JA 3AUOA 4LUIA 3R13A 1WDSA 5KSWA 3QQWA 3B8WA 1F3WA 1E51A 4NZJA 3IIOA 1KXQA 1FWJC 1V51A 4M6QA 1UA7A 2OYLA 3AIQA 1CBGA 3LEPA 1DWAM 3MSGA 1J12A 4W7WA 1DV7A 2ACSA 2GDQA 3E0IA 1TYGA 5IOBA 4WK9A 3MUY1 4RV8A 4B92A 4S38A 3PJUA 3VGEA 1HVXA 1EF2A 4HU8A 1KBLA 2ZRWA 4IJRA 2XVKA 4H8VA 5FJPA 3W29A 5BXPA 2D23A 3APTA 5BWFA 2QV4A 6TIMA 3MCMA 1AJ2A 3O1NA 1ADOA 3TZNA 1JFHA 1GJUA 3BOXA 4AVOA 3W2LA 5BXTA 2XDFA 5T91A 3TQPA 2PLMA 3W26A 4F79A 2PU0A 3KCOA 1PPIA 3QHOA 2PZNA 2W62A 4CNOA 1POKA 4Q4OA 1CTNA 4DBUA 3LQGA 1ZENA 2EF9A 4C6JA 3IVSA 2BTMA 3GH5A 1WKDA 2QZRA 4LB3A 2E28A 4K36A 1XDJA 3E2QA 1JYWA 3FVMA 1QASA 3BMWA 3HGJA 4BCEA 4JTDA 2DJLA 1DQUA 1Z9AA 1EGZA 1L0PA 3PZ9A 4O57A 3WQGA 2D2JA 3VZXA 1TCDA 2HXTA 1NDYA 1QATA 1DIKA 5EBAA 4HBKA 2CZ5A 3A4JA 3RO8A 3U4AA 3SRDA 4XWUA 4PUJA 3SY8A 4IWWA 4AIEA 4BQ5A 7PTDA 1KB3A 4L6HA 3VIJA 3NTYA 1QMLA 1UQZA 2PLJA 4AZIA 4JFVA 1K4HA 2IPGA 2ACUA 5FJOA 3KBVA 3T2QA 4U2ZA 3OVRA 4MJ4A 2GVJA 2YLLA 2OLHA 3EEGA 2AGTA 3LN3A 4QE1A 1G4EA 2D3LA 4HNNA 3AI0A 4UTWC 3CHVA 4YWIA 2E0PA 3EOEA 3M0ZA 3AIRA 1KA9F 4FF7A 2QQ6A 3KAOA 1KGWA 4O8RA 5I2UA 3UVIA 1OIFA 1X39A 1ZALA 3GU1A 3QYSA 3N2XA 1FP8A 4LVGA 1S2CA 3CHDA 1GORA 3KOYA 3OU8A 3ONCA 3RGTA 4E5TA 4UZSA 4MWAC 2QAFA 3EDKA 3KOFA 3QPZA 5HANA 3CHFA 4MOZA 7TIMA 1TIMA 4BQ3A 3N18A 3GDTA 5CLTA 4ACZB 3PUGA 1X38A 5KZEA 1SMAA 4YIWA 3LTPA 1LBFA 1XRVA 5GNXA 3PPHA 2VMFA 1BSLA 2O9RA 4DHGA 4UTTC 4AC7C 3GNNA 2BS9A 1E56A 1HO1A 3OZMA 3H53A 1SZNA 2OSWA 3VMOA 2WSQA 2PDBA 3LG3A 1PV8A 1H49A 4YTQA 3TYCA 2QR6A 4NYYA 3O07A 3N6QA 2C1GA 3T9PA 4H9YA 3ENLA 2OT1A 1LBMA 4ZSTA 1Q6DA 2FZNA 3IWPA 3F4WA 3G24A 4FB7A 2FDMA 2V3DA 4EWJA 3DX5A 2WLYA 1JYVA 2JF7A 2FZBA 2D2HA 4WKAA 1CB2A 1EPVA 1UWSA 4TQTA 1YXCA 1VBUA 2J9ZA 1L6GA 3TMQA 4JIEA 2Q3OA 2HMCA 3B40A 4X2PA 1VRXA 2BX7A 1OC5A 5GNZA 1W6TA 3N9SA 1PWLA 4F40A 5CSSA 4D71A 5C55A 5DX7A 4PTNA 5CZTA 3V75A 4MYAA 3TFXA 3AJ7A 5DF0A 1R3SA 3NOEA 3ZWTA 1G69A 1V6YA 3IJ9A 1OK4A 2X1IA 5JH2A 1H7RA 4FSAA 4PA8A 2QXWA 3M07A 1GPWA 2Q6ZA 5C8BB 3PULA 2J7EA 2W79A 3WF4A 1IT8A 3FHAA 1TV7A 3M44A 2CEQA 3H7RA 1HJUA 3THUA 1QPRA 1KNWA 1PX8A 4CQAA 3SUWA 3GTFA 4IH3A 2ICSA 3GX9A 3FEQA 3NIYA 3B97A 3UYIA 2Z27A 1XYZA 1TPH1 2DORA 2WK2A 1L6WA 2NV1A 3UBPC 4H7VA 3CUFA 2YCIX 1F4HA 1V3HA 2YL6A 1F73A 5C70A 1V02A 2WJDA 3SO7A 3B06A 5GJPA 2IPFA 2HE5A 2FJKA 3TC3A 4P5UA 4BF5A 1PHQA 2PWHA 1G4SA 4XAYA 4E8GA 4AF0B 5AYBA 1I1XA 4O0QA 4RNJA 3LI1A 4M7TA 3SEPA 1BHGA 3A4WA 2GJNA 3ITXA 1CXIA 1Q6FA 4WQ6A 2YXGA 4ZO7A 3WZ0E 1SSGA 2GUUA 3VTRA 3QR3A 3U2OA 3L0GA 3URAA 4S3BA 1VEPA 1E6ZA 1QNVA 3L21A 4A2SA 2F84A 4AWTA 4UFKA 3T8QA 3RM9A 1W8SA 3SCPA 4S2CA 4RUBA 2ZX5A 3LUTA 4H8UA 1GQIA 5CG0A 2Y5EA 3TTEA 2QCDB 1C7SA 5A6SA 3PFRA 1K9EA 3WBYA 3QY7A 1E6RA 1CW2A 3LY0A 2RJGA 5BMXA 1EEPA 2XZ9A 3CAVA 3PTMA 2ZUNA 2VEFA 4EX4A 5ABEA 3GHSA 3NYZA 3GXPA 4C1LA 2Z28A 1QT1A 3K4WA 2VR5A 3A9IA 4UNIA 1OZQA 1A4LA 1V7YA 2Z2UA 1OJXA 3QR0A 1OFPA 2W27A 5CEWA 2IKJA 4IMFA 4PMOA 3M6YA 4GH1A 4JDYA 4HN4A 2I56A 1QBAA 1V6WA 2NVCA 3W72A 4IX0A 1DVJA 3NAVA 1NF7A 4IFKA 3MJYA 4C6CA 3MCNA 2FB3A 2DU2A 3TMLA 1JDAA 2JALA 3FW6A 1DJWA 2Z1VA 4MADA 3GUWA 1OGSA 1IF2A 2ZZ2A 3GBEA 5BCAA 4KS0A 5JIWA 2QEZA 4D8LA 1F07A 1H11A 4ZTXA 3UY7A 1P4CA 3S6DA 3EXRA 2HWGA 4FR6A 3EWUA 3LYEA 2EPKX 3W3OA 1CIUA 4WKFA 3KEHA 1DJIA 3ZO9A 4PTXA 3LBOA 3GFZA 3VNMA 3VABA 1ZBWA 3DZ1A 4FMVA 2HVNA 2CYGA 2TAAA 4UWMA 3OYXA 4LOCA 3AICA 4OIFA 1LL6A 2XIBA 3VCRA 3W2MA 3EPOA 5CGMA 1PKMA 4BZYA 5M3WA 2MNRA 4PUUA 4PODA 3WFZA 1GVRA 2QCNA 1NOFA 1WB0A 4HA0A 1CGVA 3HF3A 4JQAA 4GGBA 2VRQA 2CWNA 3VC6A 1VPQA 1Q8AA 1OC7A 1J93A 4QISA 4PEKA 4LWWA 2A6NA 3QSRA 2ZA2A 2W9MA 2ZADA 3P82A 1U2YA 3PS7A 4GCAA 3QRHA 1LL7A 1JYXA 2CLFA 4EWND 1NWSA 2PWGA 4L56A 2B4GA 1RK6A 3NEVA 4XD4A 4S3AA 2XTKA 4H00A 1BRLB 4JN6A 1XPYA 4NZ4A 5H2ZA 4LSBA 1OX4B 1TE1A 4Z2GA 1N8WA 3Q2DA 4DPPA 3G8EA 1FCUA 4W88A 4D8ZA 4NAEB 4EIVA 4LAKA 1E1CB 4JTCA 4Q8MA 3B9DA 4Q4MA 4TTGA 3HPSA 2Y7FA 3IJIA 3VIFA 5TQLA 5LGXA 1CEOA 4EP8C 4CKQA 1L9WA 2EG8A 1XBZA 4AHPA 2F38A 3DG3A 2R1NA 1QI0A 4YVVA 2PWVA 4WOQA 1AQMA 2A4AA 2J25A 3CXOA 3AMDA 3FA4A 5BU6A 2BASA 3RPDA 3VD4A 4Z0SA 1VHCA 3NZQA 5T26A 2IKIA 3BDKA 2X8RA 2PP1A 4ROPA 2PDYA 2ZDRA 1CCWB 2P10A 2OB3A 3W2UA 4NUWA 3IV3A 2FHFA 4L61A 4CUCA 1PWMA 1F76A 2ZUTA 1NARA 4ZOAA 1Q7QA 1UASA 2GGGA 3R0UA 1W5OA 3W2KA 2G97A 3UFYA 3IACA 3NQDA 4HCHA 3TQKA 1UP0A 1XJBA 5FL0A 2ZFAA 3KHJA 2VURA 1CENA 3ISIX 1VBRA 3DFOA 3MBDA 2WWDA 5D8ZA 1KXTA 2XU2A 1XC4A 4KERA 3WENA 1V0MA 2DP3A 4GUGA 4ADTA 2VNCA 1M68A 3MHGA 4LRSA 3SCNA 1CLVA 1DJNA 3WUFA 1BWLA 1MYRA 3DFQA 1S5TA 2VHLA 3UXKA 4IXHA 3WDPP 5HQLA 4EF8A 1VFOA 5C7VA 1EHNA 3RITA 2J7FA 4LS1A 1UWIA 3ARQA 4NAFB 1J79A 3EA2A 3P7YA 3W1TA 1SR9A 1C92A 1VS1A 3BICA 1EYEA 1TWWA 4GE8A 5JBDA 4Y8EA 2X0HA 1E9IA 5TF0A 1VKFA 3V1PA 3PB0A 1JRBA 3BC9A 1EQCA 1QHOA 5DRCA 1N8FA 4FR1A 3GC5A 2H3DA 1FVPA 1ESWA 4U2YA 2VOTA 1Y7VA 6ENLA 2WMJA 3LCWA 1Q6QA 3GC4A 1UMLA 1RV8A 1GZJA 3SUSA 4JIPA 3TZFA 4X3ZA 1A50A 5EU9A 4EF9A 3E9AA 3PG9A 1ITXA 4HTBA 3KZPA 2PTZA 1C8YA 3WD3A 3CLMA 4X63A 1ZGDA 4JOMA 2H3BA 4MKVA 4XUYA 1I45A 4PZVA 1I2PA 4R9OA 1V03A 2VUNA 4JTIA 6A3HA 1BYBA 2IQTA 5I3JA 1LRNA 3HZ3A 1FUYA 2PRLA 2G50A 1DXIA 3MSDA 3MUCA 4WXZA 3FSTA 4GZIA 1UUOA 4PUDA 3B03A 3LCGA 1YBQB 4LS0A 2J8FA 1W1B1 7A3HA 1LLWA 3C0QA 4PUNA 3ZR5A 4LCRA 4AXNA 2O7SA 4L4OA 5AHNA 4KW2A 4PL1A 2OSYA 3VKJA 3ARUA 4HU3A 3WD4A 4Y9AA 3LXBA 4L9YA 4YJ5A 3T44A 3KVKA 5D2YA 4GYFA 3HGRA 3CYVA 3RMJA 1ADSA 1XLCA 3BG3A 3PP7A 3BTNA 2VRJA 4MB5A 2QHAA 1UD4A 3I6TA 3HV9A 2VQTA 3NSMA 3D0CA 3TYDA 3VNYA 3KFTA 3RX2A 4C7FA 1FWNA 4L9ZA 3U5UA 3EOLA 4OOZA 1LL4A 3B0XA 3CIXA 3RPMA 1B3WA 1QW7A 1FWFC 1HIZA 2KZHA 3VIMA 3HO8A 3TN3A 1TWZA 1RCOB 2AQOA 1JXKA 3EOUA 3DUGA 1Z6KA 4UMBA 3KCJA 1O94A 1KCZA 4D8AA 2ABBA 1US2A 3KBWA 4Y7EA 4F66A 3AS2A 1FHVA 1M7PA 3F4NA 3S8HA 4TV5A 3K1GA 5FCZA 5G4WA 1R87A 3CUXA 5D8WA 4UTKA 3CZEA 5AHIA 3TKFA 3LTSA 4OBTA 5IBXA 1RVKA 1OGGA 2AL2B 1IZKA 3DN5A 4AD1A 1TA3B 3G0XA 2PI6A 1JCLA 2Z1BA 4LYQA 3MZ2A 2UZ9A 2QUVA 4GYKA 1QHPA 4JX4A 1UWUA 1UP2A 3HQNA 3PZTA 1TX0A 5HQMA 3VOHA 3N14A 2XH2A 1W3IA 1UQYA 2VZOA 2OQHA 4KGLA 2GDVA 5LXEA 1PZ2A 4JIIX 3HIJA 3G18A 5ABGA 4FIRA 4QJ1A 1XIJA 3W83A 4RKAA 3NL5A 3VGFA 2ZA3A 3SCTA 3KVJA 5D04C 4B4HA 4F0MA 5LA1A 4I9AA 3UXAA 1CB7B 1HJWA 2POZA 4J3VA 5G1YA 2EPHA 1IT7A 2WMFA 2PGRA 2YCJA 1N7KA 3OGSA 2ONEA 2H9AB 4IG2A 4F0HA 1EC9A 5EFDA 4CNSA 4W84A 3G1HA 3C2YA 4LTSA 4AWEA 1HJVA 3UU0A 1NFBA 1R5YA 3DXIA 5A8MA 1P43A 1XLGA 4S3KA 5FA5A 3MB9A 1JCTA 1ZU8A 4DJDD 2WVVB 2E9LA 3FCPA 3OA5A 5K9DA 4DUVA 4XZIA 3MUIA 3BQ6A 1D7KA 3V0UA 4DF2A 4E2BA 5BXRA 3UGVA 3DFPA 2XWEA 3I4EA 5TD4A 3R10A 3LRMA 2ODOA 3LHZA 1YIXA 5I3HA 3VIKA 2J8GA 1WPCA 2PTYA 4AISA 3KS5A 1TUFA 3ZYZA 1H1YA 3UZYA 4LBRA 1VYRA 3M0YA 2GSEA 2NQJA 2ZCGA 3RJXA 3GYCA 1R9ZA 4GI4A 4O4VA 1MZRA 3WH6A 4E4PA 4GIRA 4C6LA 1JI2A 1TCMA 5EMLA 1EP2A 2X7VA 2PBOA 1UCWA 4AHQA 3MP4A 3GAYA 1IR2A 1IXNA 1R7AA 3A3WA 1KQZA 3H54A 3J7HA 2ZUSA 1PBGA 1T96A 3KBMA 4IGMA 2QIIA 4N0RA 4NP7A 1JG9A 3NXFA 2Z24A 3ELFA 2X2YA 3MWAA 4IOTA 4LUTB 3VGHA 1RVGA 2P50A 3M0JA 4HSHA 5HPOA 4NJHA 3DFYA 4C1KA 1QVBA 2ATMA 2FH6A 3SN4A 3VOIA 4S3GA 3N9KA 4IPLA 4MLJA 3F5LA 1SW0A 3CV1A 3VIPA 1WAUA 2PP0A 4JCMA 4MM1A 1GWJA 3BWWA 2DZPA 2QCMA 4C6QA 2GUBA 3SCSA 1W3TA 2HRWA 2YL8A 2BGSA 1W0MA 4C5ZA 2V3FA 3S42A 3EYPA 2FH8A 1P48A 3IIXA 5A2BA 1ZTVA 4IIGA 3W27A 2VI0A 4H7ZA 4E3VA 2HVOA 2ZX9A 4WVXA 5AB3A 4XAZA 4FNPA 1K70A 4GABA 3WH7A 5LNRA 1B3OA 2B31A 3VYLA 3FY1A 5CPNA 1U83A 4WR3A 2NX1A 1LCOA 4A8RA 3LPGA 3C4UA 1SZRA 4G56A 1ECEA 1JD7A 4NL1A 4UOQA 3S2MA 4GXPA 4GYPA 4H19A 2WKJA 3P60A 3W86A 3UR5A 1LM1A 1A0CA 1OCJA 1ZCCA 5KZ6A 4AZBA 3HG5A 5EY5A 5EBUA 3W7DA 1KM3A 1KKOA 3EKZA 3PPGA 1XD0A 1BF2A 2P3ZA 4OBRA 5AZ1A 3WDQA 1RCXB 2G41A 1L6FA 2ZC8A 3GZAA 2ZX7A 4AX7A 1Q5MA 2PODA 3K46A 1QTWA 4W8BA 1B30A 2E25A 2OKTA 4GKLA 1BXBA 1K9FA 1V77A 5D05A 5REQA 5AC5A 1ICPA