1NQ6A

Crystal structure of the catalytic domain of xylanase a from streptomyces halstedii jm8
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xys1
publication title Structure of xylanase Xys1delta from Streptomyces halstedii.
pubmed doi rcsb
source organism Streptomyces halstedii
total genus 123
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nq6A00
4J27A 4AISA 4OOZA 5BRQA 5A6AA 5BWFA 5GNXA 1UR0A 1KXTA 2QMKA 4HZ8A 3GTNA 3ZQ9A 4Z2IA 3AXIA 2YKKA 1GNXA 3A6OA 1KQZA 2DIEA 1VB9A 5BXSA 1UH4A 1J18A 5E0FA 2JEPA 4ATDA 2J78A 1XSKA 3AIRA 3W81A 2WMIA 1DP0A 1QNRA 3VIOA 4HTYA 2UY5A 5E6ZA 4ZE4A 3ZJ8A 1B3XA 2W61A 1ISXA 2J77A 4PMVA 1FHDA 4GQRA 1Q6FA 3VIGA 3OZPA 3WQ6A 1CBGA 5I6SA 3OGSA 4F66A 2XGIA 2A3BA 1GJWA 4HZ7A 3W24A 4KRTA 5A6KA 1GJUA 3AS3A 1UQYA 1NWUA 2AOSA 4MDOA 1H11A 2OSWA 2J75A 1BG4A 2QLYA 1KXHA 1K6AA 2YBUA 4B16A 5BYWA 4MB1A 3JUGA 2JALA 2A3CA 1R87A 4WK9A 1EIBA 4XZWA 1Q6DA 2QPSA 4IPNB 3VTRA 3A4WA 2W62A 4GZIA 4P8UA 4CN4A 2XFYA 1HKIA 3LPGA 3KEHA 3WDJA 3N18A 9CGTA 5FKYA 4NF7A 1CECA 4PMRA 4P7OA 3MSDA 1JF6A 3CH9A 1U33A 1V6UA 3AYSA 1QW9A 4Z2GA 1C91A 3BC9A 3LPFA 4JKMA 3DHPA 2XSBA 4NZCA 3SCUA 5ABEA 5IHSA 1V6VA 2YDQA 4C7GA 2PBGA 1E5NA 3ZT7A 2GJPA 1NP0A 1US2A 3OLDA 4W87A 5E6YA 4R27A 3RJXA 4AD5A 5EFDA 5AC4A 2ZUSA 4DM2A 1GPFA 4TVDA 3CUHA 4HMCA 2J7EA 3WF4A 3FY1A 4BS0A 3W6MA 3WD0A 5I0DA 3SUUA 1GOQA 3NIYA 4H41A 2CBUA 2EXOA 4ZENA 3WQWA 2VQUA 1OINA 5HOSA 4FLQA 3DC0A 3DYMA 1C7SA 3FN9A 2PWDA 2GJRA 2VCAA 4M80A 4NSBA 2HISA 3ARVA 3TTOA 3K8MA 3W25A 1GOOA 3MMDA 1B9ZA 2J8GA 3CZ8A 4CN6A 3MV11 4V27A 4AIOA 4Z2JA 1GOKA 1EH9A 1JAKA 3M07A 5A6BD 3THCA 1W1TA 3BAXA 5A6JA 3A3HA 1EOKA 1V02E 4WSKA 1V0NA 5HXMA 1CIUA 4CVUA 4XUYA 1ECEA 3L2MA 2D24A 4D1IA 4P7LA 3BMWA 4UFJA 2XVNA 3PN8A 3VX0A 1UWRA 2F2HA 2PWEA 4P7RA 1E1FA 1CXFA 4U31A 1VENA 1KWKA 1PBGA 2JF7A 1QI4A 4JL2A 1U2YA 3K8KA 3PZOA 4AEFA 4HOXA 3MUY1 1O6IA 1C8XA 1JDAA 5A94A 3VIHA 3WKZA 1V02A 1E4IA 3CTTA 3NJ3A 3UG4A 4GIAA 1UR2A 4B3KA 3RDKA 1JZ8A 2Y5EA 4B9YA 4QFUA 1KXVA 1W2PA 1NOFA 4BQ2A 1TA3A 2D0FA 1JNDA 4MNMA 4JKKA 1UD4A 1C7TA 1GONA 2AAAA 1BSIA 3TONA 3M46A 1HJVA 3AICA 4QP0A 1K9DA 1JG9A 2VRJA 1NQ6A 1LF1A 2X05A 1KBBA 1E6RA 3E1F1 1E6QM 1G9HA 3EBVA 3WFZA 1QNPA 1J0IA 3L4ZA 2VRKA 1E56A 1ZB5A 1PX3A 2ZUUA 3AIUA 3OLGA 1M7XA 1MW0A 2XFRA 1HKJA 2ZUVA 1ZL1A 4UQDA 1Q6EA 2DQXA 1VFUA 1W1YA 1ISVA 4MB4A 3NDYA 5FL1A 1XYZA 3T08A 1FA2A 1HT6A 2BY3A 2ESCA 5CPQA 4UR9A 1CWYA 2Z1KA 2GFTA 4CKQA 2WVVA 4AC1X 2WSPA 2BV9A 2J7CA 1JFHA 4AZHA 1NARA 1W3JA 5A6BA 2JIEA 3CHCA 3AS0A 5A95A 3VU2A 3L4WA 1EDGA 2A3EA 1WAWA 1LWHA 2WMJA 3TTSA 4LYQA 4AZIA 3L2LA 2BNJA 5CQ1A 5E9AA 2ZXQA 2YJQA 3RO8A 1C8QA 3EDKA 3VD5A 3AHYA 5GQBA 1W1VA 3B9DA 1XCWA 1VEMA 1XD0A 4IUGA 2J4GA 1SYTA 1J11A 4W5UA 4BA0A 4TX6A 1VIWA 3ALFA 1OGSA 2D0HA 3CMGA 2XWDA 4M1RA 2NT1A 3K4DA 1KCLA 3VDCA 2BVYA 5FOOA 3VILA 3BCFA 2E40A 2BHUA 1FP9A 5I77A 4AIUA 1DWFM 1H5VA 1IT0A 1JZ3A 2Y24A 2WANA 1MXDA 1JIBA 3WDIA 1KGXA 5GPRA 3VINA 2WSKA 1CNVA 1S46A 2WNWA 1RD6A 3AMCA 2OLHA 1BGGA 3T2QA 2PF0A 2UY3A 2QV4A 3OZOA 3II1A 2CNCA 4Z2HA 4ACYA 3MANA 1E4LA 4AZ6A 3ARZA 4AW7A 3WEZA 1D3CA 2PB1A 2XGBA 1E43A 3L4XA 1JYWA 1ODZA 5CLTA 3EYPA 3CHEA 2YOCA 4LQ1A 5A8OA 1L8NA 2E9MA 1CEOA 1JXJA 2DT3A 2XTKA 2OWCA 1C3FA 3A4AA 1KQYA 2V5DA 3AS2A 4ACZB 1MQQA 1QNQA 3ZJ6A 4P7NA 4ZFMA 2JEQA 1GCYA 4B9ZA 3WNKA 3VX1A 2J25A 4MPKA 1EOMA 1HKKA 3T0AA 1BF2A 4OIFA 4UQ9A 2BY1A 1R7AA 2XHYA 4ZE5A 1AVAA 2IUZA 1B3ZA 2X1IA 3EDJA 2A3HA 4UZSA 5A8PA 3TTYA 1OT2A 1PJ9A 2IXVA 4CCEA 3I3DA 1PX8A 2OWXA 5BXTA 1V6WA 4W7VA 3N13A 5CGTA 3PTKA 3WD4A 2W91A 2WHLA 4B3LA 4LYPA 3WNNA 3AMLA 1BQCA 3CUJA 1E6XM 3B9EA 4CD8A 1UZ1A 5CXPA 4U33A 1RPKA 1PEZA 3VD4A 1M01A 4WJXA 1NM9A 3W28A 4PTXA 3TTQA 2X0YA 1E4NA 2J7FA 3UR7A 4BF7A 1DTUA 2E9BA 4PMOA 1WE5A 4RE2A 4AZBA 3WMCA 4P8VA 2X09A 2YLAA 1HP5A 4JFVA 2CITA 5EMYA 1UG6A 1TE1A 4M29A 5M3WA 1WO2A 4H2CA 1CXIA 1OGBA 1EDTA 2ZX9A 3SURA 3KWXA 6CGTA 1J0KA 1UKTA 3EDEA 1FFQA 3HU7A 5EFFA 4WKAA 7TAAA 1CTNA 1KB3A 1EA9C 1CGVA 4PCTA 1EQCA 1NWRA 4EKJA 2G3MA 1CZ1A 1V3LA 1V3MA 1BYCA 2WVTA 4FF5A 3W29A 1A47A 4UFIA 1F4HA 2WMGA 4CVWA 1GZJA 4MB3A 2E0PA 3AXHA 3RM9A 1P6WA 2GJXA 1IZJA 5IFTA 5HNNA 3WF2A 3S6TA 1H0IA 4B15A 1UR4A 1H41A 1FH7A 1QBBA 1UR9A 1JZ2A 2GDVA 2QPUA 2D1ZA 1BTCA 2WZIA 1LG1A 3VGGA 3M7SA 4AD2A 4S3KA 4W89A 5A6SA 1CENA 2G4FA 2ZIDA 4CCDA 4M8UA 1V08A 1E5JA 1ISWA 2FHBA 2FGZA 1W3HA 4J3WA 1VFOA 2XIBA 4GZJA 5ABFA 2WMIB 3DYOA 1ZBKA 3AYRA 3QOKA 3UR8A 1BFNA 3J7HA 4TUFA 5JUVA 3BSHA 1LLOA 1OD0A 2IXUA 5I23A 3F5LA 2G41A 1ESWA 4A3HA 1E15A 4UOJA 3FHQA 1J01A 1JYVA 1JD7A 3G6LA 3SCOA 3QR3A 4CU7A 4JHOA 3BLKA 4HU8A 1GORA 4MB5A 4OJYA 4YHEA 1MW1A 3WBEA 4HA4A 3I3BA 1HVQA 3VPLA 4E2OA 1WP6A 4M24A 4D6DA 2CEQA 1DWJM 2OYMA 1FP8A 2VX7A 5HBFA 1ZU8A 4JFTA 1HJXA 4PTWA 4UQEA 1YQ2A 2VJXA 1WPCA 4DWSA 4NRSA 3UESA 1U30A 2WXDM 3BAIA 5KEZA 2BHYA 4CU6A 3GH4A 1D2KA 3K46A 2VZOA 4MDPA 1XCXA 3N12A 2J7DA 2E8ZA 1GQKA 2FHFA 1E55A 3N11A 4W5ZA 4E4PA 1WNOA 5DEZA 1ISYA 1HJUA 2GDUA 4N0RA 3SCVA 4CGTA 3WY1A 3RMEA 4H8VA 2EJ1A 4MNKA 4W93A 4XZBA 1HF6A 1JI1A 1PPIA 2PC8A 4PMXA 4BQ3A 4BCEA 2EPKX 3CUFA 3PZUA 3AZTA 3WUEA 4AEEA 2VO5A 2XG9A 1UD3A 1B3VA 2XFFA 3NDZA 1D7FA 1JYXA 3WNPA 1LJYA 1J0JA 1GHSA 1FH8A 3U57A 3N9KA 3W37A 2VX5A 3BAWA 5ECUA 1XSJA 3HMCA 1CGTA 1CDGA 5A8QA 4A3YA 1OCQA 4AYSA 3BAYA 1MW3A 4W8BA 1UR8A 1KBKA 2WPGA 3AIEA 1C8YA 4GO8A 1QNSA 5CG0A 4UQAA 3M6DA 1RP9A 1UA7A 3WN6A 5DF0A 3NSNA 1MFVA 4D6FA 2EPMX 1ODUA 2CYGA 3WDHA 3MMUA 2W63A 4TVUA 1GQIA 1V3IA 1B2YA 1MVYA 1V3JA 1BG9A 3VGEA 6A3HA 4CN1A 4XV0A 3GBEA 2VX6A 3QHNA 3VGFA 2ZWYA 1CXEA 2RGLA 3W53A 2GK1A 4PBGA 1MYRA 2WC4A 1V0MA 2WCGA 1K9TA 4W7WA 4AD1A 4WKHA 1PX4A 3VD9A 1NWSA 1UD8A 1HJWA 1J9YA 1Y7VA 3KE0A 3VGDA 4WF7A 3FXYA 1QHOA 5JBFA 2DDXA 1CYGA 3GBDA 3WH9A 1AQHA 2WC3A 1HIZA 4W88A 1R86A 5D8WA 4GI9A 2WHMA 1E6ZA 1JDDA 2XSAA 4GZEA 4JL1A 4J3SA 3DECA 3BAJA 1HP4A 3SIMA 3KL5A 3K8LA 1SMDA 1W91A 2EO7A 4WIWA 1XV8A 2ZICA 4KGLA 4DUXA 1G94A 2F8QA 1TFVA 4AD3A 4MAVA 2EEXA 5ABGA 3VMOA 1LL4A 4OUEA 2ZOXA 3AMGA 1XD1A 1L0PA 3DYPA 5LA2A 1IV8A 3LMYA 1G0CA 3CPUA 4D6HA 3IAPA 4H04A 1MW2A 2CERA 4LGXA 4U3AA 3OGVA 2X8RA 3T09A 3UG5A 2VZTA 2VUYA 4WSJA 1MQPA 4H8UA 2FH8A 3MMWA 1C93A 3MO4A 4Q22A 4JCLA 2DSKA 3POCA 4KH2A 2J7HA 3ECQA 5C70A 2X0HA 2WZHA 3AFBA 3NYDA 1HL8A 4HA3A 4MNJA 3EMZA 2D20A 1W9VA 1UWQA 1HJSA 3SUSA 1N82A 4U3CA 1F4AA 3SEPA 5DT5A 1WZMA 1C90A 2WB5A 2NT0A 3QHMA 1J0YA 1E72M 3WNLA 4CD5A 4QLJA 2XVKA 3MUAA 1H4PA 3VMNA 1OBAA 4UQBA 5LA1A 4PTVA 3AROA 1V3HA 1CLXA 1I1XA 2JE8A 4E8CA 1MFUA 4GPNA 3WD1A 2YL9A 3NUKA 3FAWA 3L4YA 2D23A 5D8ZA 5M5DA 3N15A 3QGVA 4AZ5A 1UKSA 3ARYA 1BHGA 5LA0A 3WFLA 1B1YA 1PAMA 4L4OA 3AMDA 2WKLA 1NP2A 2EPOA 4OBRA 8CGTA 3CHDA 3FW6A 2E3ZA 3CGTA 1JF5A 3PTMA 4P7QA 2YL6A 3W6LA 3AMKA 3WEOA 3MKKA 4TXEA 3WBAA 3CZEA 2WZEA 2TAAA 5BXPA 1BYDA 5CZKA 5AY7A 2G3JA 4UFHA 4XX6A 3TP4A 4PYSA 1HJQA 4PEEA 2W4XA 2W67A 2DPEA 1JNEA 3GXMA 3VNYA 4Z2LA 2EBNA 1UWTA 2CKSA 2JFEX 4PRWA 4U5IA 4CUCA 3ARTA 2YLLA 3VD3A 4RE4A 4YN5A 2CESA 3BSGA 4QLKA 5A6LA 3W82A 1VF8A 1W2VA 1UWUA 2NSXA 2J7GA 2J74A 3POHA 4AD0A 4U2ZA 4ZXLA 5CSUA 2CHNA 3ZJKA 4KGJA 1EGZA 4Z2KA 4X0NA 1UR1A 1XH1A 3GDBA 1GVIA 3VDBA 3G6MA 1EQPA 1KR1A 1LL7A 3AIWA 2YA2A 1HXJA 5CPTA 2E8YA 4FLSA 1B30A 2EPLX 3PZIA 4GO9A 3UETA 3VOCA 2WVSA 1NWTA 1GQJA 1VBUA 4AZGA 1CGUA 4UOZA 5BCAA 1ZJAA 1W9BM 1TR1A 3WD3A 1OGGA 1XGZA 1BVNP 2GUYA 1JYNA 4PMDA 1KGWA 1EHNA 1WB0A 1VFFA 3ARXA 2OSYA 4LPCA 3VIIA 2XIIA 4AD4A 1I75A 2WLYA 1VBRA 5A8NA 2PWHA 2V5CA 1TVPA 3WF0A 1NOUA 4D72A 2VCBA 3WUBA 3GH5A 3OG2A 1MXGA 4AZCA 5D4YA 3F4VA 1AQ0A 5BROA 1SR0A 4K68A 4UNIA 7CGTA 5E0CA 3FHAA 1H0GA 3WDRA 3ZSTA 4BZYA 4HP5A 2NW0A 5GNYA 3ZR6A 3WUFA 4D6EA 3VDAA 2J47A 4GKLA 1BYAA 2VZVA 2W66A 1CGWA 3ARWA 3CMJA 4D6JA 2C8NA 2Y2WA 3IJ7A 3FAXA 1JZ6A 2ZX7A 1CGXA 2YIHA 1W9UA 2F61A 2W5FA 2ZXAA 1B3YA 2UY4A 1EHAA 4QLLA 3OGRA 1VEPA 1WKYA 2VVNA 3NSXA 1GHRA 5I24A 1Q6GA 1Q4NX 4OBSA 2CCRA 5IFPA 3CZJA 1Q6CA 3SCTA 3AHVA 4PMNA 5AYIA 5M17A 4RL3A 5A2CA 3WQ5A 1VJZA 1HN1A 1E70M 3DHUA 4Q7NA 2OWWA 2DT2A 3CIVA 3U7BA 4A4AA 4L4PA 2YDSA 1CPUA 2B31A 2CBIA 1V3KA 4DWSD 4JIEA 1R8LA 2GJXB 5JBDA 3OA5A 1WDSA 1UUQA 1B0IA 2VT0A 3D5HA 1XSIA 7A3HA 4AY1A 3W26A 3VIKA 3VUPA 4H7VA 4U5KA 4ZEPA 1PZ3A 1JXKA 4FLOA 3W27A 2Z1SA 1XRVA 1E6NA 3RCNA 1B3WA 1H2JA 5I5RA 1KFWA 1VFMA 5HDRA 3QHOA 3TA9A 5JIWA 1B90A 3PZNA 3A47A 3NCOA 3PHAA 1W3LA 3SUTA 4JHZA 5CGMA 1WDRA 3VM5A 2V38A 1CXLA 3MSGA 3RM4A 1GOWA 4JFUA 3CHFA 2FHCA 4PMQA 3SCNA 2WBKA 1DWHM 2O9PA 3CZLA 2Y8KA 3U7VA 3GZAA 3WDQA 1GOIA 3ZJ7A 4DWSC 1WDQA 1G1YA 4J3TA 1TUXA 2CPUA 5D9NA 3L4TA 2PWGA 3PZQA 1NOWA 1AQMA 1W9DM 3WMSA 3GXFA 2QF8A 4ATLA 3OIHA 2WHJA 1M53A 1BVZA 2XVLA 3EMQA 2J79A 3PZ9A 3RIKA 4C7FA 1E0XA 3SCWA 1J12A 4NRRA 3WL0A 1JZ5A 4DUVA 1OD8A 1V03A 2VI0A 2BHZA 4UFMA 5JIPA 2XUCA 4MNLA 2A3AA 5ABHA 4J3XA 5GNZA 4IM4A 2WMKA 6TAAA 1QI3A 3B9AA 2WMHA 3CUGA 1EO5A 3WNMA 3AS1A 1A3HA 2DSZA 4HMEA 2XYLA 4X9YA 4JCMA 3WD2A 2ZE0A 3PZVA 3WEMA 1QI5A 4UFKA 4HPGA 3IANA 1QW8A 3MU7A 1E3XA 4P8WA 2JF6A 3T2PA 1HX0A 3HJEA 2PWFA 4M81A 2GSJA 2WC7A 4QCEA 1JZ7A 3D3AA 3K4AA 3VKKA 1BPLB 3B8SA 3HN3A 1FHLA 3N17A 4WKFA 3ZO9A 2FDMA 1KR0A 1DWIM 3VIFA 3CO4A 1UA3A 1GW1A 1NH6A 2BXZA 2VMFA 1ZBCA 2QMJA 5A2AA 1W9PA 1V6YA 2VQTA 3UERA 2O9OA 3ARRA 3GNOA 1ITCA 3VD7A 4U2YA 3T2OA 2OSXA 3BLPX 3ZIZA 1TG7A 3OLEA 3PTQA 5EB8A 1MQRA 3ZM8A 2DIJA 3VIMA 5IDIA 3UCQA 4ML4A 1GOMA 1ISZA 3F5KA 3BCDA 2Y8VA 3ZT5A 2ZX6A 4AZ7A 2XPKA 3GM8A 3VMPA 4GI6A 4D6GA 1VJSA 4OKDA 3WSUA 4QAWA 1QVBA 3AHZA 2O9RA 2BFGA 4HU0A 1JDCA 5I79A 1J10A 3WQ4A 1OWQA 4HOZA 3RILA 2OYKA 4PUEA 4OZOA 2GK1B 3AISA 2YA0A 2G8ZA 3VNZA 3APGA 3W0KA 2PBOA 2VNCA 1LWJA 2WW5A 2VRQA 4KMQA 4TOQA 3MUZ1 4D1JA 1DWAM 4MJ4A 3OBAA 3SUVA 4GXPA 4JFSA 1H09A 2Q8XA 4IISA 1VAHA 3ZMRA 4TVCA 4YHGA 3PBGA 5CLWA 3AQUA 5D9PA 2DSWA 3AZSA 1WZLA 1LL6A 2DH2A 1GVYA 2MANA 1EXPA 1BGAA 2CKRA 3EMCA 1UQZA 4DM1A 2UY2A 3K1DA 3WH7A 2VC9A 3N1AA 2D22A 2VURA 3KL3A 1PIFA 1C92A 3T0BA 5FD0A 4TTUA 2FH6A 2BY2A 3FNDA 1TA3B 4GINA 4JFWA 4V28A 1J0ZA 4WLCA 4H8HA 4PTMA 3WQVA 2CBJA 5I78A 2J8FA 3WNOA 1DEDA 5D9MA 1UD6A 1OM0A 3SCRA 4CD6A 4UFLA 1CXKA 2DH3A 1ZBVA 2ZX5A 3IJ8A 3AIBA 5M03A 5E09A 4C7DA 3ARPA 3WF1A 3O6AA 2CXGA 4MJ2A 3RM8A 2VCCA 3EDFA 2C7FA 1E9LA 1OIMA 2BY0A 4ZXOA 1JL8A 4RE3A 1G5AA 3BMVA 2XWEA 2VTFA 3NSMA 2WYSA 5BRPA 4QDMA 1PIGA 2WKGA 1TZ7A 2VR4A 1W1PA 4PN2A 3WDPP 5FCZA 3WL1A 2W92A 2WVVB 5LYRA 3UEQA 4PSRA 1H1NA 1XYFA 1BYBA 1LQ0A 4ATWA 1FOBA 2ZXBA 3GNRA 3WIJA 1TVNA 2ZUMA 1HKMA 1QI0A 4EE9A 1W9XA 3WF3A 1B31A 4CCCA 3U5YA 5IXEA 3PZTA 4LX4A 3WMBA 5TD4A 3IJ9A 2G3IA 3ZSSA 3VVGA 2C0HA 4BQ5A 1JZ4A 1QBAA 1J0HA 2BVTA 4CU8A 4P8XA 1CXHA 4AXNA 1FFRA 2XM2A 2VVSA 3O2LA 1UH2A 5BXRA 2DSVA 1WDPA 4NI3A 1W3KA 1LG2A 4X0VA 2DT1A 1OSEA 4AWEA 4GI8A 4W84A 2X2YA 3S2CA 4BQ4A 1QOXA 1UOKA 3CLWA 1E1EA 1BAGA 4YPJA 2WAGA 3WENA 1KWGA 4PSPA 2J7BA 1XHGA 3GYCA 4F9JA 1QNOA 4OOUA 2OYLA 4D6CA 3WH8A 3AHTA 3WH5A 4D6IA 4XB3A 4W8LA 3U5UA 3IK2A 4HPHA 5A3HA 5A6MA 3VO0A 1UZ4A 2V3DA 4HA1A 1V0LA 3RJYA 5IHRA 4W85A 4N42A 1UD5A 1US3A 2O92A 4FK9A 1UWSA 2D2OA 1JFXA 5D9OA 1GUVA 3ARQA 3ZT6A 4J7RA 2YA1A 5C71A 5I2UA 2EPNA 4W86A 1ZS2A 2WVUA 3VGHA 4MAZA 1X1NA 1UYQA 1X6NA 1OT1A 1M04A 1RH9A 2VL4A 4LYRA 3L4VA 2WM0A 1AMYA 1R85A 1QPKA 3SCSA 2VR5A 3CBWA 4R5EA 4MADA 1G01A 1UWIA 3ZR5A 3KZSA 4PUDA 1VEOA 1QHZA 4KRUA 4GQQA 2BXYA 2D0GA 4EAMA 2DT0A 4TTGA 1O7AA 1XH2A 3VIJA 3BAKA 1SFSA 3AOFA 3EDDA 1M03A 1H3GA 4AZCB 2WK2A 1PZ2A 2DEPA 3SUWA 2BS9A 1QI2A 2XM1A 2G3NA 1DWGM 3VDHA 3GH7A 1W32A 5A1AA 4FMVA 1E6PA 1EDQA 1DHKA 1CGYA 3AZRA 3WUGA 3CZGA 2WCAA 3SCPA 2EQDA 1SMAA 3CUIA 5HPCA 3PZMA 3QOMA 1XC6A 3GXDA 1MWOA 2DSUA 4URIA 3AI0A 4JAWA 1R7OA 3AXXA 1UD2A 2D3NA 2YDRA 1VRXA 5HPOA 1ZBWA 1TMQA 2VX4A 4EANA 4QCFA 4F9DA 3UG3A 3WQ8A 4S3JA 2ZWZA 4PCSA 1E4MM 3VGBA 3AHXA 1WCGA 4MTVA 5DMYA 2RGMA 3AJ7A 2FGLA 4W7UA 1K9EA 1HVXA 2ZUWA 4UTFA 1IZKA 3AIQA 2E9LA 1JI2A 1RP8A 4EK7A 2V3EA 2YL5A 1TCMA 2WBGA 1JD9A 4JZ5A 5AC5A 1ZJBA 3GNPA 4UQCA 5EBAA 4PMYA 4M56A 2BVDA 1I1WA 3RPMA 3WELA 3BGAA 5A2BA 3KL0A 2VZUA 4KWUA 2XVPA 4HOWA 4ACZA 2YL8A 3I3EA 4Y7EA 2ZUTA 1UKPA 2XVGA 5KZ6A 5A8MA 4M82A 1JAEA 1UH3A 4AMCA 4HMDA 5DFAA 1EO7A 5C8BB 2ZX8A 3F5JA 5FIPA 3N04A 2CETA 1YHTA 4F8XA 3MS8A 2WLZA 2WWCA 1HL9A 1E3ZA 2AMGA 3W38A 4TX8A 4J3UA 1E40A 3L4UA 8A3HA 2GVYA 1WZKA 2HVMA 5E70A 4V2XA 4J28A 5DT7A 3MUIA 1E71M 1XH0A 5FL0A 3W4RA 3BXWA 2WWDA 3LPOA 4PMUA 4F79A 1H49A 3ALGA 1KXQA 1V6XA 3T0DA 2WHKA 3ARUA 5ABFB 5CSYA 4DUWA 4CD7A 1GQLA 3BH4A 1HNYA 1UKQA 3THDA 2E4TA 3PZGA 1WZAA 2PI6A 4UOQA 1QHPA 1E0VA 3SCQA 2VZSA 2DGAA 4FLRA 4W8AA 5CPSA 1Z32X 5AYBA 2ZXDA 3O9NA 1KCKA 3WH6A 5F7UA 2CBVA 2ZUNA 1E0WA 5A69A 2WCSA 1CLVA 1K9FA 2XJ7A 4UCFA 1ITXA 2JIWA 4D71A 1KGUA 1OIFA 3VIPA 3OB8A 2D3LA 4J3VA 3TOPA 4LXFA 2V3FA 4CD4A 3OLIA 1E73M 3GXIA 2J62A 3A4XA 3CZKA 1BLIA 1UHVA 2Y4SA 4IPLA 1X6LA 4PMZA 3ZOAA 3AIVA 2UWFA 3IAQA 5CJ5A 5JBEA 2QHAA 5DO8A 1V0KA 1UKOA 2O9TA 4DWSB 3LPPA 2WMFA 3ARSA 3MV01 1FH9A 4JKLA 4E8DA 3VM7A 1E6SM 4UZUA 1JGIA 4AIEA 2V3GA 1OB0A 4HZ6A 2VOTA 5I3DA 2CHOA 2CIPA 2YBTA
chains in the Genus database with same CATH superfamily
4AISA 3IJQA 1X1ZA 1A53A 1T7LA 4EP8C 4RZ6A 3UYCA 2Y5SA 3W73A 2YKKA 1IEVA 3UZ5A 4F0RA 1DIKA 3CQKA 2QDDA 2DIEA 4DYEA 3A22A 2PLMA 3O0KA 3P81A 5E0FA 1L6GA 4ATDA 3AIRA 3NQFA 1NIUA 3THQA 2PRHA 1DP0A 2POZA 4ZE4A 2Q3OA 1CX9A 5AHLA 4YVXA 1NF0A 2J77A 4PMVA 4YS1A 5AFDA 1PTAA 4WDXA 3E9AA 3USZA 3WQ6A 1BXNA 1UPMB 4F66A 2A3BA 4TR9A 1NWUA 2AOSA 2JGQA 3LEPA 1LRTA 2YBUA 4FNTA 4B16A 4MB1A 3PM6A 2JALA 4JYDA 1EIBA 1RQBA 4XZWA 3VTRA 4UR8A 2W62A 3APYA 3CJPA 4KWWA 4O53A 4LSBA 1CECA 2JKAA 4PMRA 3HF3A 4NXSA 2REQB 4AWUA 2QIIA 4ZQCA 3B8UA 3MP3A 3C2FA 1JUEA 2XSBA 4DNHA 5IHSA 3TXVA 2PBGA 2GJPA 3B4YA 2JK2A 4AD5A 2P3EA 3SAZA 1GPFA 1FRBA 3OBKA 4HMCA 3W6MA 5IM51 3L68A 1GOQA 3WQWA 2VQUA 1OINA 3NQCA 4FLQA 1DPMA 3ZZ1A 4MJMA 1C7SA 4IG2B 2VCAA 3HBLA 4M80A 3K8MA 1GOOA 2X2GA 3LV6A 2P0IA 3MMDA 1DIDA 4ZQNA 1QFEA 4MKVA 4Z2JA 1GOKA 1EH9A 1JAKA 5A6BD 4KCWA 2Q3RA 5HJYA 3A3HA 3NTYA 1EOKA 1V02E 1V0NA 1CIUA 4XUYA 5T8GA 1F6KA 1POJA 3CASA 3DESA 6REQB 2CZDA 4P7LA 4BI7A 4L64A 1FWBC 1FWGC 3VX0A 5LNRA 2WNNA 3S2LA 3UJEA 2D2HA 2OOFA 3ONBA 4ZZ9A 1KWKA 4GYFA 5BOEA 3E5BA 3GVVA 4HJWA 4WSHA 4EPKA 4JL2A 4WVXA 1XG3A 4F2UA 1IE7C 3K8KA 3PZOA 4AEFA 4HOXA 1EJTC 1V02A 4Q8WA 3NJ3A 2IPWA 3W7QA 3SADA 3UG4A 4DBDA 3TWAA 2A79A 1IGSA 3W7CA 1NOFA 4AC7C 1TA3A 2D0FA 2H3BA 2Z6JA 4QSFA 1Z3NA 3DG6A 5AN7A 3TFXA 4DELA 4MOZA 5FJUA 5JH2A 2FTYA 1G4EA 3S9ZA 2AAAA 5K9DA 2PCQA 1UMLA 3SN4A 1B9BA 4RLIA 3N2BA 3AICA 3C61A 1IHIA 2VRJA 1YBQB 1OZQA 3KBVA 4RDZA 2QKFA 1E6RA 3W01A 2YXOA 4IIEA 3E1F1 1E6QM 4C6DA 4M6PA 3WFZA 1UZHA 1FTXA 1PX3A 4ZFCA 2ZUUA 3AIUA 4A29A 3B06A 1MW0A 3L5AA 1K7EA 1HKJA 5CBJA 4PZVA 1ZL1A 1AFSA 1OYCA 3DFHA 3IIZA 4LF2A 3PPHA 1W1YA 2HQAA 1ISVA 3THUA 4MB4A 2J27A 3NDYA 3S4TA 2H9AB 1XYZA 3LSBA 3T08A 3FYYA 2BY3A 2BGQA 2RKXA 3Q2DA 4B92A 4AC1X 2WSPA 4NL1A 4RKAA 3T44A 3EB2A 2C15A 1NARA 5A6BA 2PEVA 2DUZA 4RPPA 2OLAA 4E0CA 2C16A 2WM1A 5XINA 3LTSA 3TTSA 4NAEA 4LJ3A 5E9AA 5B7YA 5J5DA 2YZRA 2IS7A 2D69A 2ZC1A 3TR2A 1GJPA 1XCWA 1V5XA 4KIRA 2DZPA 5GJNA 4MWAD 3PWGA 4NZ5A 4W5UA 3M5YA 1TJPA 2D0HA 3CMGA 3PNUA 2NX3A 4M1RA 3GVWA 3MBDA 1KA9F 2BVYA 2E40A 2O56A 3TQ0A 1DWFM 1VFLA 3H4WA 2ON3A 1LQ2A 1TZ9A 1H5VA 4FS9A 4LVDA 3UWZA 1UP0A 5DMNA 3ATZA 3WDIA 2HNHA 1H1ZA 1RHCA 1KGXA 1S46A 3EWWA 3P93A 1I2QA 3H12A 1BSLA 3II1A 1L2UA 4Z2HA 3DDMA 4ACYA 1F3EA 3DIPA 4AU0A 1LQAA 4JY9A 5FSEC 3L4XA 3HQOA 4NZ3A 1JYWA 4L1XA 1ODZA 3G8EA 1XJBA 2BOEX 4IJRA 1T40A 1Q6QA 3BICA 5A8OA 3HFTA 1JXJA 2XTKA 2OWCA 1C3FA 2ZDSA 4QQUA 3AS2A 3BLEA 4M3PA 5TIMA 3EXSA 2YYTA 2G96A 1VP5A 2JEQA 3KVLA 4MHBA 4MWAE 2NV9A 1DJHA 3C5QA 4M6QA 4LBRA 4B9ZA 3AXMA 3DG7A 2J25A 4PRTA 1HKKA 1BRLB 2H6RA 3IGXA 2QCFA 4UQ9A 1HQTA 2XHYA 1WOAA 1AD1A 2X1IA 1R2TA 1OFPA 1EYWA 3DKJA 3TDFA 2NVDA 1KRAC 4QDWA 2R1LA 1XQKA 2FMOA 1PJ9A 3N3TA 4IGNA 3SY1A 1V6WA 3M1ZA 1SGJA 4JIQA 5KTLA 2WHLA 3WNNA 3AMLA 1BQCA 3CUJA 4MWAA 4ENLA 5FEXA 4CD8A 4U33A 3VD4A 3ITLA 4ORMA 1UBPC 2X0YA 1K8ZA 1AG1O 4LCRA 1W1B1 2E9BA 2XIQA 4PMOA 1I2NA 5HNUA 2TYSA 4LVBA 1WE5A 1IQ8A 3GUGA 1GYLA 1YEYA 5AHMA 4XO7A 4Y96A 3ZXWA 4POCA 4JFVA 3LCXA 3IK4A 5EMYA 3GG8A 1UG6A 2A6NA 5C9ZA 1TE1A 4RV3A 5AVHA 5M3WA 4H2CA 3QXBA 3UPWA 3SURA 3GU9A 3KWXA 1XIIA 1J0KA 2XDFA 1O1HA 3EDEA 2ALDA 4B5SA 1FFQA 3R8HA 3QY7A 5EFFA 4WKAA 5BWAA 1DQWA 2CLOA 2QGHA 1KB3A 1W0MA 4PCTA 4JGDA 2G3MA 1CZ1A 2RJGA 2OLSA 1R3TA 3M0MA 2WVTA 3W29A 1A47A 4PCPA 1GEHA 4UTLA 2BGNE 4IQJA 3Q65A 2E0PA 1VYSX 4LB4A 1P6WA 2BXVA 3JR2A 5HNNA 3S6TA 1FH7A 3T9PA 1YRRA 2Y7DA 2ISFA 2D1ZA 2WZIA 3VGGA 1JPKA 3M7SA 5GJMA 4W89A 4Q6XA 5A6SA 4JD4A 1V08A 3FDKA 3DH7A 2FGZA 1VFOA 5ABFA 2WMIB 4QJ4B 3AYRA 4LRSA 4G1NA 3RX3A 2FIQA 4FIRA 3W88A 2RDTA 1Y5VA 3H22A 2PDXA 1TO3A 4CNPA 2VFEA 2PGWA 3QR0A 4LBUA 3F5LA 4H9UA 2FZ8A 2YCJA 6ENLA 2B0MA 4UOJA 1O12A 2PODA 1UWAA 3SCOA 4L5ZA 3KLKA 2V30A 3GWQA 4HU8A 1GORA 4OJYA 4YHEA 4ZA0A 3RNDA 4RXGA 1XYCA 3G18A 1XIHA 2Y7FA 3VPLA 4M24A 3H2FA 2Z6IA 1FP8A 1ZU8A 1BWKA 2QVNA 1HJXA 1XLCA 1K70A 2G5WA 3A3WA 4ZO7A 1EGMA 3UG8A 2BHYA 4HNNA 4CU6A 1TZZA 3NZ1A 1D2KA 3K46A 1TIMA 5AYYA 2ATMA 4EACA 1E55A 1WNOA 3E38A 4C90A 1UP2A 2Y8UA 4Z1DA 2GDUA 4NG3A 4ZCWA 2QAPA 3RMEA 2EJ1A 2PTDA 4B91A 1PPIA 4PMXA 3V36A 1OFBA 3GS6A 3CUFA 1UD3A 1B3VA 3NDZA 1D7FA 3WNPA 1FH8A 3U57A 3FKRA 3UXAA 3QKEA 3N4FA 1XSJA 3N29A 1CGTA 3WJXA 4AXKA 4D8LA 1EBHA 4A3YA 4AYSA 4F2TA 1MW3A 4W8BA 3S47A 1ZJHA 4TO8A 4DLFA 2ZQ0A 2A7RA 3WCZA 3IV8A 1K7XA 4O1DA 1QPRA 1C8YA 4GO8A 4JNZA 1Q63A 1QNSA 5CG0A 1JCMP 1PTDA 3LGGA 1ODUA 2XFWA 4A3QA 3MMUA 1ADDA 1SZNA 1GQIA 3VGEA 4CN1A 1PZ1A 5F4WA 5REQB 4E2BA 4LUJA 3W7PA 2RGLA 3URAA 2GK1A 4PBGA 1H62A 4AD1A 3H4XA 3VD9A 3GU2A 1M3UA 1HJWA 1J9YA 1TE6A 1CB2A 3HM7A 4JQ2A 3VGDA 1OG0A 2OXNA 5JBFA 2DDXA 1CYGA 5I07A 1QMLA 5HR7A 3OZMA 1R86A 4QX4A 4IFKA 5D8WA 4QE4A 3WZ0E 4J3SA 3DECA 1XIBA 3BAJA 1HP4A 3K8LA 3W1QA 1IR1A 3A5VA 5D02A 2ZICA 4KGLA 1G94A 5AYZA 2BDQA 4AD3A 2Z7KA 3UPMA 1W8SA 3VMOA 5B7ZA 2ZOXA 1RQEA 1I8JA 4BEQA 4BF5A 3EOEA 1G0CA 4D6HA 3IAPA 3GTHA 4H04A 4LGXA 3A13A 1Q66A 1W5QA 4A8NA 1EP1A 2X8RA 2VZTA 1XRTA 3BANA 1MQPA 3MMWA 4EXQA 4JCLA 3POCA 1NQKA 1ZP3A 3ECQA 5C70A 5JU6A 3BLOA 4DXVA 2ACQA 3F2DA 3OQEA 1XKJA 3AFBA 4MNJA 1W5NA 3C2VA 1HJSA 3V1HA 4ZO6A 5DT5A 1C90A 1AK5A 4DJFA 3L0GA 1E72M 4QLJA 2Z1WA 3MUAA 1H4PA 1RCQA 2H3DA 4PTVA 1V3HA 3B0PA 2KX9A 3S0CA 1ZLPA 3LHTA 3E6EA 2FYMA 1GWJA 3L4YA 3T42A 4NX0A 4PCNA 4YWSA 1TCDA 3ARYA 1UCWA 1Q4WA 2WKLA 2EPOA 4GMEA 1GYNA 3GRIA 3G24A 8CGTA 4F40A 3P8IA 3FGCA 3NL2A 3CGTA 3W6LA 4F0SA 3CZEA 4LRTA 3AAMA 2TAAA 5BXPA 2IPFA 2IQ0A 1KM3A 3SW6A 3TP4A 1HJQA 1UJQA 2EG8A 4IMAA 2I56A 4Y8EA 2VDGA 3K13A 1FWDC 3DN5A 4RJEA 1QJWA 2YLLA 4YN5A 2PCEA 3PR2A 5FA5A 3BSGA 1M7OA 1OVDA 4QLKA 3HV9A 4IP5A 1W2VA 2QCMA 2NWSA 2NSXA 5T26A 4NI8A 3Q45A 2WSYA 4LEFA 3G1DA 4Z2KA 1L6SA 3TC3A 3QM3A 3T4WA 1F74A 4MSSA 3CU2A 4FX7A 1GVIA 3TKFA 3MBFA 2DV0A 1LL7A 1BF6A 3UY8A 2PSNA 4FLSA 2EPLX 3KOFA 2WVSA 4LUTB 3DBPA 1VBUA 3CUZA 3HPFA 4DWDA 2FJKA 1N2VA 3P8JA 3WD3A 4HK6A 3ZLHA 1F73A 4DNMA 1XGZA 1EX1A 3LZ5A 3AU6A 1I0BA 1EHNA 1REQB 5AC8A 1VFFA 3ARXA 1HO1A 4LPCA 2WLYA 4O4WA 1VBRA 5A8NA 2JKPA 3WF0A 3HGSA 3PUGA 1EJUC 3GH5A 4F48A 4AZCA 1MRAA 3TYUA 4ES4A 4Z42C 5D4YA 3F4VA 1AQ0A 2NQHA 5BROA 4K68A 4UNIA 5E0CA 3FS2A 3VFCA 3SY8A 1GG0A 4K7VA 3MP5A 4UXDA 2NW0A 2Z28A 3QV8A 3W7HA 3H54A 1RA5A 3NL5A 3G1FA 3ZR6A 2OFJA 3M9YA 4GKLA 1LWIA 2QJHA 3MMTA 1CGWA 1ZCOA 3ARWA 4ZTXA 4P5UA 4D6JA 1SJBA 2Y2WA 2BOGX 2VGFA 3FEMA 1WOBA 2F61A 3W1XA 2W5FA 5G2WA 4ZB2A 3URBA 2ZXAA 3EWCA 3UZWA 2PTYA 2V5BA 4PULA 4P61A 1GHRA 1Q6OA 3KCJA 4GXWA 1Q4NX 3SQSA 4C6PA 5F1VA 3N2CA 5ABTA 3CZJA 7ENLA 3S1UA 3AHVA 2QJMA 5AB3A 5AYIA 5M17A 2HROA 1S2VA 1E70M 3DHUA 3EX1A 2GSEA 2DT2A 4ALDA 3W87A 3LHYA 4L4PA 2X42A 5EMUA 3MB9A 3MWAA 4GFIA 1XG4A 1HL2A 1XLMA 3D5HA 3G8RA 3R79A 3VIKA 1EL3A 1XLGA 4H7VA 4ZEPA 4C6KA 3UD6A 1A0EA 3W27A 2Z1SA 3V7PA 4TU1A 2R9RA 4MY8A 3W3OA 3W7KA 3RCNA 2OCZA 4K1GA 1KFWA 5HDRA 5E93A 2NQLA 1Z9AA 3PZNA 2E6DA 4OTKA 5F2LA 2HSAA 3LCFA 5AHFA 1QXLA 3MA8A 2CW6A 3RM4A 4JFUA 1OFAA 3GB6A 2HTMA 1VBHA 5D32A 2FHCA 3RRAA 3T81A 3SCNA 1DWHM 1RVKA 1EC8A 5D05A 4JX6A 1GOIA 3TNOA 3ZJ7A 3GIYA 3WK0A 1TUXA 3PZQA 5C9RA 1W9DM 3GXFA 4O1CA 1M53A 2VD8A 3R8GA 3WG6A 4XIAA 3PFRA 4C7FA 3I10A 4NNBA 1DJXA 5KETA 1E0XA 3LCLA 1J12A 4NRRA 3WL0A 4DUVA 3R2GA 2VI0A 4UFMA 2XUCA 3ZLGA 2A3AA 3FA4A 2YB4A 2Q09A 3CUGA 1I4NA 4LNYA 3WNMA 3NPUA 2QV5A 3OZYA 2DSZA 4HMEA 5DRCA 4X9YA 2ZE0A 4PBFA 1V7AA 3F4NA 4R34A 3MU7A 4P8WA 2JF6A 4GQ0A 1W3IA 3T2PA 4CNNA 4GNKB 2KZHA 2NQ9A 3IJLA 1P1MA 2I9EA 2A5HA 2HS8A 3LXCA 4FP1A 2WC7A 1ZCCA 3LCWA 1OJXA 3TSMA 3U2EA 1EZWA 1SO6A 3VKKA 1BPLB 1Y5XA 2XN1A 3S6DA 1SSDA 1DWIM 4PCFA 1UA3A 3TQKA 5AZ0A 4NJIA 1GW1A 2PC4A 7REQB 3NQVA 2VMFA 3HV8A 1ZBCA 3KHDA 1D7KA 4J9JA 5LNWA 2VQTA 4JIIX 1ZSXA 3UERA 1BQGA 2O9OA 3UJRA 1A5SA 4ASTA 1ITCA 4B2DA 5E1QA 4WJ8A 3VKCA 1QTWA 4ERAA 1TSIA 4LAKA 4AX6A 3GDRA 3B9NA 3PTQA 4ZR8A 1R9XA 5EB8A 1MQRA 3KX6A 3MCNA 1K4HA 4NNCA 1GOMA 4ML4A 3LRMA 2C1IA 5G2IA 2Y8VA 3ZT5A 2ZX6A 2XPKA 3L5LA 3IIPA 3GM8A 1PWLA 2OOGA 3NAVA 4OKDA 1QVBA 4AVNA 2GVLA 2BFGA 2WSRA 1JDCA 2XU2A 4ICMA 2ZRZA 3E0IA 3CV6A 3UP8A 4C6CA 4XBJA 2Q8LA 4OZOA 2CLLA 3VNZA 2FMNA 1K02A 2VNCA 3EOOA 1T0OA 4MGGA 2VRQA 4KMQA 3PC0A 1V77A 4B5VA 4D1JA 1PKLA 1R6WA 2A6LA 4O54A 4HSOA 4GXPA 4CQDA 2Q8XA 1JUBA 4BR1A 1I60A 3MKCA 5BMXA 4IOTA 2ZCGA 3ZMRA 4YHGA 2DSWA 1E9IA 1WZLA 1S2UA 5C9WA 3W2LA 4UTWA 1SW7A 1FHUA 4DM1A 2DUXA 4F0LA 2VC9A 1OG6A 4YTSA 4GBDA 1C92A 4XG1A 4PL1A 3W00A 5FD0A 3WO8A 2FH6A 1IWBA 2BY2A 2WNZA 1TA3B 4A21A 1F5ZA 3I7SA 4V28A 4WLCA 4HPJA 3DI1A 1MSSA 2J8FA 1DEDA 1WYIA 3QKZA 3SRKA 3IJ8A 1GZGA 5E09A 4GI4A 2G4JA 3BE7A 3WQDA 2CXGA 4FX6M 5HJXA 1MO0A 4Z1CA 1BKHA 4Q8VA 3RM8A 1OC7A 1NY1A 1E9LA 2BY0A 3PS7A 2P0OA 4QITA 2XWEA 4WZHA 3KOXA 4LS2A 3NSMA 2EGZA 2WYSA 1RVGA 5BRPA 2ZRWA 1PIGA 3OPSA 1TZ7A 4RZBA 3EZ4A 3WDPP 1DV7A 4RNFA 3MKVA 3UZYA 1NSJA 4JIRA 4OHQA 3L0KA 3UEQA 1GVOA 2PD9A 1OABA 5HMDA 2E6YA 4LFYA 3EX3A 2Y5JA 3S5OA 3DOPA 3N4AA 1YXYA 4GIYA 4EE9A 4FAMA 5U4NA 5EYWA 1OF6A 4BQ5A 1KKOA 4Q4QA 1TMLA 5A8GA 4CU8A 3LHVA 5HJLA 2XM2A 3SY5A 3W84A 3O2LA 5ENLA 4R88A 2G95A 3BJFA 4X0VA 2DT1A 4LWWA 4GUHA 4JIHA 3MO7A 4W84A 3GLCA 1R3YA 4BQ4A 3AU2A 1E1EA 1RJPA 4Q8QA 4IX2A 2WAGA 1KWGA 2RFGA 1XLJA 3GYCA 4FNRA 1QNOA 2Z29A 3GU1A 8TIMA 3WH5A 4D6IA 3P82A 4MYAA 3IK2A 3U5UA 5A3HA 4I9MA 1O68A 2I5IA 1CT5A 2GYIA 1LOQA 4FK9A 2XINA 4F3HA 3EWYA 3QPYA 5D9OA 4G9PA 3ARQA 3ZT6A 2DZWA 2YA1A 2F6KA 1A80A 2YW4A 1E9YB 3VI2A 4JX5A 4DEFA 2HBVA 3HFYA 3S1XA 3PB0A 4JTIA 4RDYA 2FJUB 1W31A 1PDZA 4GCXA 1RV8A 1A5OC 3L4VA 1S1PA 2WM0A 1R85A 4FOKA 4DJEA 4ZOCA 4R5EA 1VLIA 4MADA 1SZEA 3CV1A 3ZR5A 4GVFA 4PUDA 1VEOA 1QHZA 4KRUA 3V5FA 2BXYA 5AZ1A 3TA6A 3NEHA 1HUVA 1A0CA 3P60A 4TTGA 3VIJA 1SFSA 1TV4A 1XLAA 2I9UA 1PZ2A 4HQVA 3SUWA 2BS9A 1H7RA 1MEIA 2O7QA 5XIMA 2ADAA 1G67A 3VDHA 3OTRA 3LYEA 4HCDA 1CGYA 3W1NA 4LW7A 3AZRA 1R3WA 1TWZA 2PD5A 4IPIA 1N55A 1IR2A 1K8CA 1SMAA 1EB3A 1Q2SA 1ICQA 3CL8A 1BTMA 4JN7A 3GXDA 2DZUA 2CZVA 1QK0A 4RX0A 1R7OA 1QR7A 4H6KA 5DELA 2Y6ZA 4PUKA 1P0NA 1VRXA 2J6VA 1ZBWA 1TMQA 1Q8AA 1ONEA 3UG3A 4K8HA 4E2DA 4Z0JA 4MTVA 1PXGA 3AJ7A 2FGLA 1G4PA 3EPNA 2ZUWA 3QSTA 3VKDA 2UZ9A 3AIQA 1JI2A 4DXXA 3W22A 2V3EA 1TCMA 4C6QA 4PMYA 3RGTA 1S2CA 3P5ZA 1I1WA 5I3KA 4IXHA 3A64A 3B8WA 1XIEA 3OHIA 1VPXA 3S5SA 2TRSA 1JPIA 1X1OA 3SO7A 1SFTA 3H21A 2XVPA 1JCNA 4IIFA 1T6MA 3CMFA 4Y7EA 2ZUTA 1UKPA 5EPDA 3GXTA 5A8MA 1JAEA 1UH3A 4MZ1A 1A49A 1EO7A 5C8BB 2ZX8A 3N04A 3P6LA 3VCNA 4F8XA 1MUMA 4HYVA 3MS8A 4O1AA 2WWCA 3GIQA 2NX9A 3E96A 1DXFA 5LSMA 3PJTA 4HN8A 1E3ZA 3W38A 2RDUA 3I7RA 1R3QA 2IMRA 3O6CA 2GVYA 3FYOA 4INFA 4XAPA 2HVMA 3BG9A 5E70A 3KXQA 4J28A 5FL0A 3W83A 3W4RA 5C54A 2WWDA 1O5XA 1H49A 3V1PA 4B4FA 2PDKA 5C7VA 4UIOA 5ABFB 4DBEA 4DUWA 3BH4A 1UKQA 5G5IA 3GXPA 1WZAA 2IKJA 3FIGA 4UOQA 1E0VA 3Q4DA 1UBSA 1FXPA 3H23A 4DO4A 3QF0A 3WBXA 5K3VA 2ZXDA 1B54A 2CBVA 1A5NC 2E5BA 3GG7A 1OIFA 3VIPA 1PHQA 1IT8A 3MT1A 4CD4A 3UJSA 2PE4A 3CZKA 4L9YA 3GNXA 4IPLA 4PMZA 3ZOAA 3WJSA 1YE4A 3C52A 3IACA 3IAQA 5CJ5A 2QHAA 2Q8ZA 1UKOA 2O9TA 3LPPA 4JKLA 3XINA 1DQXA 4UZUA 4AIEA 4HZ6A 3ELFA 2DZAA 4H1ZA 4DVOA 1E0TA 1Y0EA 5BRQA 5A6AA 3BW3A 4M5PA 4AVOA 4DUOA 4GCAA 4ZOAA 2CWNA 1EF2A 4HZ8A 3GTNA 1S2WA 2J8TA 3CEPA 3LNMA 2R1KA 3KUMA 3WQGA 1MEHA 1VB9A 2PTZA 3LBMA 3CHVA 3HPSA 2AL2B 1J18A 1XBZA 4RK8A 5C9UA 3S5YA 1ZZMA 4K1WA 3EPOA 1GVFA 3T40A 3ZJ8A 2W61A 2ZZ3A 4NJJA 1FHDA 2Y89A 1O95A 4Q7BA 2Z1VA 1UROA 2BWGA 5I6SA 4OWGA 2XGIA 4PH6A 1SZRA 4HZ7A 4KRTA 1U83A 3AS3A 3B0UX 3M0IA 1K4GA 1H11A 2V0TA 1BG4A 2AKMA 4JTQA 2Y1HA 4QISA 4CQCA 4GUIA 2C3ZA 4MVAA 4XKYB 5HQMA 2QUMA 2C14A 2PDJA 2W3ZA 4PR4A 4GZIA 3VOHA 5D38A 3IIOA 2XFYA 1ZQ5A 5FKYA 1WKEA 4NF7A 5D09A 5IDZA 1S5TA 1XLBA 1RSCA 3CH9A 3PWIA 1TTQA 2A7NA 3M5XA 4IHCA 1LROA 1VYRA 4IGMA 1ITUA 2PTXA 1N8WA 4NQ1A 3BC9A 1P6CA 3V4BA 3LPFA 3DHPA 3LB0A 3E0LA 3UA3A 3ZT7A 1NP0A 1GPWA 1T96A 1QU4A 1XP3A 1X7IA 3NOEA 3RJXA 1P0KA 3CK5A 5AC4A 3R0UA 2ZUSA 4DM2A 1LORA 3FY1A 4BS0A 3WD0A 4EX4A 1F05A 2CBUA 2EXOA 3EXRA 1F61A 3DYMA 3BGJA 3CXOA 1NDWA 3W25A 2HISA 4C6LA 4PFHA 3CZ8A 2FKPA 5BOOA 3NQDA 3M07A 5HUPA 4FB7A 1W1TA 1Q3NA 3BAXA 4FZIA 5A6JA 2FZNA 1LT7A 3A9IA 2FZDA 4LF1A 3IEBA 4WSKA 1DQUA 3I65A 2VFHA 4HSHA 3MW7A 4D1IA 1ZY9A 2VWTA 4BFAA 2R94A 4K38A 2I5QA 4HK7A 3GR8A 3CWNA 4UFJA 3LG3A 4RPQA 2ZVRA 1SZGA 3C0QA 3LXAA 1UWRA 2F2HA 2PWEA 3RRXA 3EGJA 1PBGA 2HV5A 1RAKA 4KS0A 1QI4A 4PTDA 2QIWA 4K3ZA 3STCA 3OYZA 3MUY1 1O6IA 1C8XA 1ICSA 1KTBA 4C5YA 1EIXA 3SN0A 3VIHA 2A85A 3WKZA 1E4IA 3O6YX 4TIMA 4IL2A 4FIQA 1JZ8A 1EZ2A 4BQ2A 3W2UA 4HHLA 2RHGA 3FGCB 1JGMA 1H61A 2CXEA 3CAQA 2V5JA 3PNZA 1GONA 4JTHA 3TONA 5FACA 4DJEC 3F2CA 3B8TA 1R5YA 1NQ6A 3FKKA 1KBBA 4LUSA 3P7YA 1G9HA 1QNPA 5DLCA 3L4ZA 2WQDA 3IVTA 4QEHA 3OLGA 4FR1A 1XC4A 2CLHA 2O0TA 3NO3A 1ADSA 1Q6EA 1VFUA 3GKFA 3NPXA 3BSMA 2QCDA 4HNOA 1FA2A 1HT6A 4XZMX 5JVLA 4GC3A 1CWYA 3OO2A 1TWSA 4C60A 4UTUA 1X8CA 2AGKA 3NXLA 1ML1A 2GQ9A 4O50A 2J7CA 1NELA 4HK5A 3OODA 3F03K 1VFTA 2WJDA 1K8YA 3L4WA 1EDGA 3NOYA 1RLCL 4MUPA 5LNUA 1LWHA 3F4CA 3S5NA 3KTXA 5AHIA 3W85A 4QR6A 1XYMA 3C2OA 4AZIA 3L2LA 4EXAA 4DYKA 4BJHA 3RO8A 4ZQRA 4DY1A 3VD5A 3AHYA 1W1VA 1IWAA 1T41A 3WJWA 3B40A 1O60A 2J4GA 3NXFA 4BA0A 4U10A 1WBHA 3ALFA 1SSGA 2XWDA 2QCHA 3RMJA 2INZA 1SPQA 1KCLA 3TZNA 3VDCA 4V33A 1DE5A 3VILA 3EOLA 3BCFA 3E0VA 4UC5A 2D2JA 2YBVA 3CAKA 1XBVA 3VFLA 1IT0A 3SR7A 1JZ3A 1MZRA 1DJIA 2E5CA 3BK0A 1JIBA 1PV8A 3PBMA 4Y9AA 4ML9A 2KAUC 1BWLA 2WSKA 4A3UA 2G97A 1CNVA 4JOMA 2XH7A 3AMCA 3MYPA 3LQLA 3T2QA 4I6KA 2PF0A 3BLDA 4JS3A 1FCBA 2QV4A 3OYXA 2OMAA 2CNCA 2DJXA 3STEA 1V51A 4GKTA 1TWWA 1NJJA 3O0FA 2PZ0A 3ARZA 2VEIA 2R1NA 3O6DA 1X7FA 4DN1A 1FQ0A 2HVNA 3I6EA 4JTFA 2OJPA 3W7EA 2HDJA 2YCIX 3HO8A 2DT3A 3U2OA 5F2MA 3A4AA 4ACZB 3R58A 1X96A 4G6CA 1IEWA 1RLDA 4P7NA 3PP7A 3C0SA 4S2CA 5HATA 3HQPA 1SM9A 3ITTA 3R0DA 5LIKX 3AWOA 3T0AA 3GDKA 3HG2A 4DAIA 1R7AA 4TQTA 3P62A 4ZE5A 1B3ZA 3QMRA 1TV3A 4UZSA 5G1YA 5TBOA 1B5TA 5I03A 2IXVA 4CCEA 4K8EA 3I3DA 3VE9A 5BXTA 4QG6A 3U48A 4QM1A 4WX2A 3ABXA 5C5YA 3N13A 3PTKA 2OZ8A 1BXBA 4K7YA 4IMEA 3DG3A 5J04A 1RXOB 3GFZA 2AQOA 2H90A 1Z8AA 1UZ1A 1RPKA 1PEZA 4WJXA 3W28A 2J7FA 3LHZA 3UR7A 4BF7A 1DTUA 4BI6A 1MMFA 3G0SA 3B0YA 4AZBA 2OX4A 3B0VC 3DZ1A 3VUSA 1PHWA 4EVZA 3TLQA 1FDJA 1GT8A 1ZGDA 3V18A 3NGFA 3QQWA 1TELA 4ROPA 4S38A 3HU7A 2YCEA 1TV8A 3UWVA 3FSTA 5IOBA 3SZ8A 3Q37A 4HPXA 5C7HA 4WGXA 4NZ1A 1P7TA 2DQWA 3KDNA 2ZVIA 5BU6A 3PJXA 4UFIA 5FSDC 1VLWA 4JTJA 3DI0A 3AXHA 3RM9A 2GJXA 3HGOA 1IZJA 5IFTA 1PYFA 3LBOA 3DFNA 3RR4A 1H0IA 1X38A 1RD5A 2ACUA 1H41A 1UR9A 2O4QA 4AQLA 1S2TA 3LBCA 2PDBA 4X2PA 4AD2A 2PDGA 4LS0A 1CENA 4B5TA 1D3HA 3KM8A 4KEVA 2WJEA 1K6WA 1SZFA 3CQIA 2FHBA 3V0TA 4J3WA 2XIBA 4GZJA 5H8PA 1YW1A 3DYOA 1ZBKA 2E1WA 4S23A 1BFNA 2ZYFA 3J7HA 4TUFA 5JUVA 3BSHA 4E38A 4WRHA 1ZJIA 2ZZ1A 3MQTA 2HPIA 4NZ4A 4XD4A 1EBGA 3FHQA 3UXKA 4I5XA 4R85A 3WQOA 4FNUA 5T9BG 3OVRA 3W7NA 3M0LA 4MB5A 1XLLA 2A4AA 3TXZA 2W79A 5FEZA 2GUUA 3JS3A 1SJAA 2P8CA 2Z24A 2BB0A 3ISIX 4Y8FA 3BCJA 3WLQA 2Y61A 3IVSA 2I7GA 1H5YA 4IQDA 2CEQA 3KCLA 5EKYA 2J66A 2VX7A 3MHGA 4PTWA 3K30A 2VJXA 4DWSA 1OFEA 4NRSA 2YSWA 5CZJA 3TW9A 3BAIA 4DF0A 3A12A 4QJ5B 1XCXA 4MKNA 2J7DA 1GQKA 5IBXC 4FALA 1GQNA 5DEZA 1I0DA 4N4QA 4WDTA 1HJUA 3SCVA 4CGTA 1M6JA 2DZXA 2ISWA 4I3GA 4W93A 4XZBA 1WDWA 1VKFA 1RBAA 1KBLA 2QQ6A 1XIGA 3AZTA 3LLDA 4C6JA 1JYXA 5K7JA 1A3XA 4KF1A 1LBFA 1TJ1A 1F7BA 4NIRA 4H6RA 5T91A 4A8RA 1FCVA 1N8IA 3W37A 2HZGA 3BAWA 3TUUA 1R2SA 3HMCA 4HNUA 5A8QA 3SM0A 1HFBA 3H2OA 3NQ6A 5AHEA 3WYZA 2GZXA 4B4HA 2ZE3A 3W1UA 1EJXC 1KBKA 1M68A 2Q6ZA 3AIEA 3PTDA 1VBGA 2HXTA 1GVQA 3OVQA 1D3GA 1RP9A 5DF0A 1XDMA 4NYUA 3THAA 5HNTA 3FK4A 3DERA 5DBTA 3ME3A 3WDHA 1CW2A 1BG9A 4LAZA 2OEMA 4LB3A 4XV0A 3KAOA 1SJCA 4UWMA 3QHNA 4OGZA 3LCHA 4S2BA 1G7UA 3MCOA 1CXEA 3R25A 1A4LA 1V0MA 2XZ7A 2WCGA 4KFOA 3A21A 4WKHA 4DYJA 3KE0A 3JZEA 4EOUA 2WC3A 5D04C 2NUYA 3OIXA 3S42A 2ZA2A 5K2ZA 3B9OA 5CJNA 4C6NA 4JHMA 1VS1A 3KL5A 2X16A 1SMDA 4MY1A 1DVJA 3G1XA 2EAWA 4JQ1A 4WIWA 1A50A 3PY2A 3TYBA 3KBMA 3P2VA 9RUBA 1LL4A 3BLIA 1L0PA 5LA2A 4ORIA 3LMYA 4UMAA 3CPUA 4EF9A 3PPGA 3ABSA 3UG5A 4H8UA 3QTPA 3U2ZA 3QQ0A 4IJBA 5D2TA 3F4WA 1EKOA 4YCPA 4D8AA 2X0HA 4L9ZA 1TQXA 1R2RA 2WZHA 1HL8A 3EMZA 2ZZ6A 2D20A 1W9VA 1UWQA 3ICJA 4ADTA 1V7YA 4GVIA 4N6EA 2WO5A 2VHLA 9XIAA 2VEKA 4CD5A 2XVKA 1JVNA 4UQBA 3KWSA 5LA1A 2DY3A 3AROA 2V5KA 2ZBTA 4XAZA 1JEZA 1IGWA 3LLXA 4PGLA 3NR0A 4JTSA 2YL9A 4F0KA 4F0HA 3RPDA 5FF4A 3RITA 4NUWA 1UKSA 1BHGA 3IGUA 4S3CA 2C1HA 1H60A 2NWRA 4NHVA 2H8XA 1PAMA 4L4OA 5DCDA 1GZ1A 4I7VA 1JF5A 4GVHA 4M1BA 1ZAJA 3WEOA 3AMKA 1BWVA 3GNNA 4TXEA 1N8FA 5BW6A 3W2JA 2C79A 1BYDA 3LRLA 4XK2A 5AY7A 4JTGA 2G3JA 4PYSA 3VKAA 2OZTA 3RAOA 4Z2LA 2YCLA 1UWTA 2JFEX 4PRWA 1W6TA 3IJIA 4CUCA 3ARTA 2CESA 1VBJA 4LOCA 1UOZA 1ELSA 1EJVC 1UWUA 2Y0FA 4G7EB 4KCVA 3EWZA 3POHA 3VK5A 4AD0A 4U2ZA 1RUSA 4ZXLA 1A0DA 3H6OA 4O15A 1PL9A 3TLLA 3G6MA 3TE9A 1IXOA 3PAOA 1KRBC 1S5NA 1WX0A 1EQPA 1Q65A 1HXJA 3Q67A 5E0KA 3VNKA 4AF0A 3VOCA 2G50A 2TMDA 1NEYA 4GK8A 3QV7A 3VKBA 2ZZ4A 3ITYA 3CIWA 1AQFA 4C6OA 1W9BM 3OVGA 1OK4A 4G7FA 4QRNA 2GUYA 4WY0F 4UTTA 3PSVA 6PTDA 1WB0A 2OSYA 5RUBA 4AD4A 4QNEA 3UBPC 4JTKA 4O12A 2F9RA 4UTKA 4YVVA 1DYSA 1NOUA 3TCSA 4UMCA 4DO7A 2GQ8A 3N14A 3WK1A 1W3TA 4O4VA 3L67A 3E2RA 3LXBA 4U28A 3NQ2A 3M6YA 1XRSA 5GNYA 3FJ4A 1H51A 3G22A 2PURA 5BNKA 2ANUA 2AKZA 3FAXA 1A5AA 4LY4A 4XVEA 4QLLA 2Y63A 3W1AA 2PMQA 1RR2A 2FQIA 4EWND 3NVDA 1XUUA 2MUCA 4OBSA 2CCRA 5EMJA 2PPGA 3RK8A 1G6CA 3CV2A 2FB2A 4PMNA 4UTMA 4J2MA 1TPC1 4GZ7A 1HN1A 3KP0A 4GE8A 4Q7NA 2OWWA 1RZMA 3RHGA 3CIVA 1KV5A 1E1CA 4YIWA 4IMDA 2YDSA 1CPUA 3GW3A 5JBDA 4ZMGA 2FZMA 4KWOA 1HO4A 2VT0A 2OQLA 2PTWA 1O66A 3VAVA 3NQEA 3BQ5A 3VUPA 1JXKA 4FLOA 4HYWA 2HXUA 3W7MA 3OBEA 3ZVHA 1XRVA 2OVLA 1H2JA 4IH3A 2AMXA 3GKAA 2YW3A 3QHOA 3TA9A 1B90A 3V3WA 4XO6A 5CGMA 4KFNA 1Q6LA 2V38A 3TW7A 1GOWA 1JRBA 1QOQA 5E9XA 3NEVA 1UUMA 4PMQA 3CZLA 1DHPA 3B97A 3U7VA 3GZAA 1XL9A 4XTDA 4DWSC 3M64A 1G1YA 1GKPA 1GTEA 4J3TA 2ZA3A 5D9NA 4HNTA 1XFCA 3L4TA 2E09A 3HG3A 1TPUA 3E2SA 3EB4A 4AVFA 1BVZA 2XVLA 1ECQA 4GXMA 3EMQA 1KFKA 2J79A 3G0UA 4NP7A 3C2EA 5FEWA 4GA8A 2VDIA 3SCWA 3GVRA 2A0NA 3UVIA 5K4XA 3TU9A 1V03A 3I68A 3MP4A 3CT2A 5CC3A 4MNLA 4ONVA 3PULA 4IM4A 2WMKA 3ITOA 3NQBA 2UV8G 3UWWA 1EO5A 1OYBA 3V0UA 3DKLA 1Q6RA 1A3HA 1SJDA 4G5DA 4AWSA 3SRFA 2XYLA 4JCMA 4M6VA 1QDSA 4A35A 3PZVA 1NVMA 4DZ5A 2EKGA 1BKSA 1FVPA 1A5LC 2Y7GA 3QY6A 2PWFA 1JCLA 1KNWA 2RUSA 4UMBA 2R8WA 1JZ7A 4NAFB 3ZO9A 2F7FA 3R6IA 2C13A 4HA0A 4JN8A 3CO4A 1KBJA 4WDWA 4CQ8A 2V67A 2BXZA 3WLLA 3EKZA 4YTQA 4ZBCA 1W9PA 1V6YA 2YR1A 3UGVA 1J2WA 1K03A 5LKYA 2C19A 5C2CA 3BLPX 4XBSA 1R47A 1UUOA 4JYEA 1MXSA 3KS6A 1C9DA 2DIJA 3R94A 3ZM8A 2Z2BA 3OU8A 5IDIA 1K3UA 1TV5A 3WMLA 3G2GA 2YZ5A 3RN6A 2DZVA 2QJGA 1DXEA 4WHBA 3UXLA 2YCKX 1RBOB 1YDOA 4NVTA 1A5BA 5K9CA 1LUCB 3AUJA 3S8HA 4D6GA 1AZ1A 3WSUA 1OY0A 4H6QA 5I79A 1D8WA 4HOZA 1KCXA 3RILA 2OYKA 3ORWA 3GTXA 4KW2A 1KM5A 3IVUA 3QTGA 5FI8A 2PBOA 2L5HA 2WW5A 1LWJA 5AOUA 5FJIA 4X9SA 4H19A 4QE1A 4W9TA 1DWAM 3OBAA 3W7RA 3HOJA 4N02A 1PKNA 1YNQA 4IUOA 3SUVA 4QQ3A 2ACRA 4JFSA 1H09A 1OX4A 3U4AA 3KVKA 1VAHA 4TVCA 4YTTA 5D9PA 2YB1A 2E1DA 1A3WA 4Q4PA 4ZOBA 1GVYA 2MANA 2REQA 3SECA 5H8MA 3QZEA 2MNRA 2XSXA 1UQZA 2R82A 2UY2A 3A3XA 2D22A 1XXXA 4B3ZA 3K5XA 4WY0B 3T0BA 3MDWA 1TV7A 4N6FA 3MI6A 4PTMA 4ZO9A 4O52A 4AHPA 2W9MA 1DBTA 2CBJA 3DX5A 5C55A 3W7IA 3L66A 5FESA 3ABQA 3SCRA 2F6XA 4CD6A 2OX1A 1FWRA 1TB3A 2Q71A 3AIBA 3HB9A 5M03A 4UTJA 4GYPA 4IG2A 3C56A 4O1EA 3PG8A 1RK6A 2VCCA 2ACSA 3UNDA 4ZXOA 4RE3A 3NZGA 4QS6A 3TCEA 2VTFA 4Z1BA 4C1NB 4LVAA 4QDMA 1FWSA 5FCZA 1YPXA 4BI5A 3S6OA 2I1OA 6REQA 4QJ1A 3W9ZA 2X40A 2Z1BA 5EBUA 1AZ2A 3LM3A 3G1SA 3QGKC 3GSMA 4ATWA 1DL3A 3KHJA 4ADSA 1F9CA 3ITXA 1AW2A 3TOYA 3UT0A 1NFPA 3WIJA 2ZUMA 4J1OA 3R7MA 1AH4A 1W9XA 3T7VA 2B7NA 3REQB 1B31A 4CCCA 3U5YA 1ENUA 4YTRA 1B4EA 2J24A 3IJ9A 3NQ8A 1OX5A 2G3IA 1JPHA 1XX1A 1XPGA 2BVTA 1KTCA 1XPYA 2OTDA 1CXHA 3G3DA 4XKMA 2Y7EA 3FVMA 3B3DA 4L1WA 4Y2WA 4XZLX 3SSJA 1T8QA 5BXRA 3NQGA 4X2RA 3CH0A 1W3KA 4A2SA 1XGDA 4AWTA 4GI8A 2IPGA 2GVGA 4CQAA 1UJPA 3S2CA 3S3GA 3CLWA 1BAGA 4GJIA 3W74A 4R9XA 4F9JA 2PWVA 3T1GA 1JDFA 5EU9A 3WH8A 3AHTA 2V82A 4GC4A 4JQ4A 4AB4A 1YBQA 2V3DA 2BLEA 2NV2A 5AKQA 4DO6A 4N42A 1UD5A 1XDJA 1US3A 4XTIA 2Q01A 1XF0A 8XIAA 3LS9A 1OFRA 4Q4OA 5C71A 5I2UA 1ZS2A 2HRWA 1UB3A 3VGHA 1UYQA 4O16A 4FOUA 1M04A 2EKCA 3GNDA 2VL4A 4LYRA 2YFOA 5HWJA 4D9PA 1AMYA 3PBYA 2VR5A 3CBWA 1UIPA 1G01A 1UWIA 3TH6A 3XISA 3WQCA 2I5GA 3QZ6A 1C8VA 4AX7A 4JICA 5M1TA 1Z48A 4J3ZA 1XH2A 3AOFA 3A9BA 3V75A 2O55A 1H3GA 1Z42A 1QI2A 2XM1A 1DWGM 4C6BA 1W32A 1OCJA 4EAYA 3FJLA 3LX9A 1Q45A 4MYXA 3FVDA 3KOYA 2GJNA 3WUGA 5LIYX 3IPWA 3TMLA 3LI0A 1O5QA 1XR2A 1F8MA 3PVFA 1ZPTA 3QOMA 4NASA 5H8UA 1XC6A 2DSUA 4I9JA 1UC4A 1LM1A 1XIJA 3AI0A 4JAWA 3SDOA 2NVAA 1UD2A 3LTPA 3DENA 1KLZA 4CCZA 1PCWA 2VX4A 4QCFA 4GNJA 4N7QA 4O0QA 4BWLC 2ZWZA 4PCSA 3LHWA 2V2CA 4DJDD 3IIVA 1UMYA 1ALDA 2GQ3A 5DMYA 3GE7A 3BOFA 4W7UA 3UWYA 4OQVA 4YVPA 3ERPA 4E8GA 4R7OA 4FXFA 2WBGA 2DZTA 2J13A 4JZ5A 5AC5A 1ZJBA 3HQ1A 5EBAA 5CPOA 1SO5A 4JTEA 3GR4A 4M56A 2PDUA 1AODA 3N9RA 4OVXA 4AAJA 2HWGA 2BZNA 3E12A 1HZYA 3PBVA 4IIHA 4RCXA 1MDRA 5A2BA 4IL0A 3H2MA 2VZUA 4LC8A 4IX0A 3M16A 2YL8A 2PGEA 3UJFA 2BOFX 1ME7A 1R38A 3VNJA 4JBRA 3W7GA 2ISVA 5DFAA 1ME8A 3N34A 1R9YA 1S5WA 1FBAA 5H2ZA 2V6AA 4XSMA 1ZNNA 3N2OA 3RU8X 1QNVA 4PB5A 3TN4A 3KBJA 1HGYA 4WOZA 3PF3A 1W5OA 2R24A 1F3TA 3ITVA 1XH0A 4GYJA 3N6HA 1Z6KA 4LU0A 3CB8A 3LPOA 4F79A 5G4WA 5F4XA 3BURA 1KXQA 1V6XA 2FFCA 3R89A 1MRQA 4CNOA 5CSYA 2V2DA 1KRCC 4H7CA 3TV8A 1GVEA 5FAGA 3Q94A 3PUDA 3HIJA 3THDA 2E4TA 4IMFA 4AY7A 3R11A 4FLRA 2X1UA 2VR2A 4QXIA 2OGYA 3WH6A 3UGRA 3M5ZA 2DW6A 2JIWA 1W54A 3DAQA 4DJDA 3TOPA 4DI8A 1J6PA 4LXFA 1TJRA 4S39A 1E73M 1FWNA 4U4MA 4E6MA 2Y4SA 1S5VA 1X6LA 3TIMA 1ADOA 4OE7A 1RY0A 5DO8A 2CZEA 1AH0A 3IRDA 4DWSB 5CBBA 4G8TA 2YXGA 3FFSA 3VM7A 1E6SM 4L80A 1JGIA 2V3GA 1KFLA 2VOTA 5I3DA 4O0ZA 2CHOA 1EFZA 5U7SA 2CIPA 2YBTA 2PZNA 1RCXB 1UH2A 4J27A 4OOZA 1XIMA 4IT1A 5BWFA 1UR0A 1TTPA 2NLIA 1V93A 3W6YA 3ZQ9A 4Z2IA 2OR2A 3AXIA 3B8DA 2QT3A 2W27A 1GNXA 2PDQA 4IQLA 5JH1A 4GBUA 4IQEA 3LD5A 1KQZA 4FEZA 1EJWC 5BXSA 1UH4A 2JEPA 4Q8NA 5I3HA 2WMIA 1QWKA 2UY5A 5E6ZA 3QFWA 3M4HA 4E4FA 1B3XA 1DKWA 1XCFA 2HMCA 1OQFA 4QEEA 1XIDA 3S2MA 4GLEA 3VIGA 1CBGA 2LLEA 2HK1A 5LGXA 1GJWA 3EKLA 3W24A 2I17A 1UQYA 4PUJA 4MDOA 4PMJA 2XIOA 3ANVA 4GJJA 3VDGA 3T4CA 2J75A 1K6AA 2PU1A 3SI9A 3PUOA 1KO0A 5BYWA 3H26A 4WK9A 3KRBA 3N4EA 1QOPA 4CN4A 1HKIA 4M6UA 3KEHA 3WDJA 2PP0A 2PDCA 4P7OA 4N9CA 1GG1A 3T0TA 1TPFA 3BLLA 4J40A 4JXCA 1XLIA 3AYSA 1QW9A 1XINA 1O4UA 2V69A 1J93A 1O1ZA 3VZYA 1TPWA 3PANA 3CC1A 1LCOA 1YNYA 1US2A 2V5LA 2JKEA 2J9ZA 2NUWA 3OLDA 3TYCA 1EGVA 3O16A 4E3VA 5EFDA 3STFA 4Z1YA 4TVDA 5XIAA 2J7EA 3HPZA 3CUXA 4EF8A 4GIEA 5BMWA 3QYQA 4OECA 4ZENA 5HOSA 2OT1A 3FN9A 2PWDA 2GJRA 2ABAA 4NSBA 3UPBA 3ARVA 3V5CA 1B9ZA 3WLKX 5D2YA 3MV11 3OG3A 4AIOA 3MY9A 3THCA 1B3OA 3CTLA 3KBWA 3NFUA 1P4CA 3EEGA 8XIMA 4DRSA 3RX2A 5HXMA 4PC8A 4CVUA 1I6NA 4H7ZA 4H00A 2YX0A 3L2MA 2D73A 4XZ9A 3BMWA 2AAMA 2GVJA 2XVNA 1HTIA 3MYOA 4IICA 5I09A 1E1FA 1CXFA 2XH2A 1VENA 1J4EA 2FVKA 3VCCA 3CNYA 2JBMA 5REQA 4RDWA 1PKMA 1AJ2A 1U2YA 2PDNA 3GYEA 1LTDA 1JDAA 5A94A 4MG4A 4AH7A 3KFTA 3CTTA 4GIAA 4B5XA 1UR2A 3JU2A 3H8AA 3RDKA 2Y5EA 4B9YA 4QFUA 1KXVA 5FJOA 3RXZA 2EJAA 5CG7A 4MNMA 3UZJA 4KEUA 5CZ0A 1X97A 3UWUA 1UD4A 3NYZA 1C7TA 1BSIA 4ZB5A 3UZZA 4ROQA 1HJVA 3BLFA 4YU1A 4QP0A 4XAGA 1LF1A 3RO6A 2X05A 3BL3A 1P0BA 2ZADA 3EBVA 1V4YA 1E56A 4GQGA 1QK2A 2QUTA 5G2HA 2XFRA 3GHSA 2ZUVA 3WK3A 3C4UA 3B04A 4UQDA 2QPXA 1ONWA 5FL1A 3FLUA 2OELA 2ESCA 3OP2A 3WJYA 1M65A 2Z1KA 1FWIC 1QT1A 2GFTA 5DANA 3S2NA 2WVVA 1KBIA 4HGXA 2X41A 1KRMA 2BV9A 3TSDA 4BEUA 1L6FA 1JFHA 4AZHA 1W3JA 4DHGA 3M47A 1ZAIA 4G1KA 3VZXA 2A3EA 3DFPA 1ONXA 1HKVA 4LYQA 3E49A 2ZZ2A 5CQ1A 4QE5A 2NSOA 5MHBA 2YJQA 3G1AA 3OW1A 2DVXA 4CNUA 2BASA 4UNLA 3B9DA 1XD0A 4IUGA 4JTCA 2FVMA 1J11A 3JVAA 4TX6A 3WLJA 1OGSA 2C91A 2NT1A 3QV9A 2C0AA 2WJZA 4Q6JA 2X1SA 3FJNA 2BHUA 1FP9A 3MUCA 1IZCA 4AIUA 1KW1A 4MFEA 4O10A 2PA6A 4O11A 2VFIA 2Y24A 3TEVA 1W8GA 1J8VA 5GPRA 4N9EA 3VINA 1AJ0A 4O8AA 4V1XA 1RD6A 4M7SA 1RJQA 2UY3A 2ODOA 3OZOA 1WXZA 3BO9A 4H9TA 1KM4A 4AZ6A 4MWAC 1D3CA 2PB1A 2XGBA 1E43A 4V15A 4I8DA 4D8ZA 3D3FA 3C86A 5CLTA 3EYPA 3CHEA 4LQ1A 1UASA 1PO9A 1L8NA 1CEOA 2VXNA 4LUTA 2V5DA 4LANA 1KCZA 3CB3A 5BRBA 1QNQA 4ICCX 2OT0A 3DFQA 1EPVA 1GCYA 1EJSC 3H2NA 1XRFA 3MJYA 1Q13A 3UVAA 3BV4A 3VX1A 4MPKA 3W72A 1REQA 1UPPA 1BF2A 4NX5A 5B80A 4OIFA 1DJZA 1IYXA 1VC4A 3AWNA 2BY1A 1JCJA 3WLNA 1AVAA 2IUZA 5HQEA 1I2PA 4HT3A 2VELA 3QC0A 5HMFA 1OFOA 3TYDA 1OT2A 4C65A 3YPIA 4IIGA 4PUMA 4Y9MA 4AY8A 1PX8A 2OWXA 3LA4A 2CLKA 6TIMA 3WD4A 2RJHA 4B3LA 1QO2A 1E6XM 3P0WA 5CXPA 1M01A 5MKGA 3C0JA 1E4NA 3AC0A 1CI1A 5C2XA 4MLJA 4DQWA 4GUGA 3V5OA 4QIUA 4RE2A 2IPJA 5K4ZA 2X09A 3A23A 3M0JA 1V6TA 2V81A 2YLAA 1EWEA 1OHLA 2NXHA 3P3BA 3QC3A 1HP5A 3IGHX 4GHRA 3PSWA 2ALRA 4M29A 1WO2A 3IIXA 1CXIA 4PEKA 1EDTA 6CGTA 3PAJA 7TAAA 2CZ5A 3FA5A 1PZ0A 1EQCA 4EKJA 4PUWA 3LU2A 4KERA 1V3MA 4R9OA 4FF5A 3GVQA 3LGEA 2WMGA 1XYLA 1GZJA 3WLSA 3NO5A 4CEUC 4BK9A 3QR1A 1VHCA 3STPA 2PUZA 5FEPA 4X22A 2CHRA 1RY8A 2GPTA 2GDVA 4R7WA 1EP2A 3GC5A 1BTCA 5AYXA 3UCCA 2G4FA 4CCDA 1L2QA 4M8UA 1E5JA 4IP4A 3SQMA 1VZWA 1F07A 3O05A 3QOKA 3L9CA 5D03A 2QDHA 3VZZA 3GTFA 3E02A 3VNMA 1LLOA 3SRDA 1OD0A 4ZVJA 2IXUA 5I23A 1QUMA 2G41A 5DXYA 4A3HA 1E15A 2FPVA 1JYVA 1U5VA 3G6LA 3PPFA 4HCLA 4JHOA 2BBFA 2WNQA 1GKQA 1XQLA 3KW3A 1IXPA 5LHEA 3M44A 4HA4A 1HGWA 3NG3A 1AD4A 3NNTA 5HMSA 3SQLA 5DX7A 1BEUA 4KWSA 1HVQA 3MC5A 1H7NA 4E2OA 2E77A 2RDWA 3EX6A 4HNVA 3P74A 4MZ8A 2Y88A 3R10A 4UQEA 1YQ2A 4HPNA 4M7TA 2PLJA 1U30A 3GH4A 4MDPA 2VZOA 3WJZA 3PG9A 1OYAA 3N11A 4W5ZA 2X7WA 1ISYA 4HB7A 3PFMA 3MVIA 4NU7A 4N0RA 3BVJA 3WY1A 1U1JA 4S3BA 3KP1A 1AL8A 4AHOA 1EEPA 4MNKA 1KFBA 4CNTA 4XAYA 1R0MA 1OX4B 1JI1A 2PC8A 2ABBA 2EPKX 3W1LA 2DVUA 4OFCA 1F8IA 1W1A1 6ALDA 2E6AA 1JPDX 7REQA 2I14A 3N9KA 1HW6A 2VX5A 3DHFA 4FR6A 5CJMA 4KETA 4XVDA 1YYAA 1CDGA 3CL7A 4N4PA 1DJGA 4LBSA 1OCQA 2ISSA 3BAYA 4UCGA 4HKPA 4DF2A 3TN3A 3TJ4A 3MZNA 1S1RA 3GUWA 5HULA 3TJLA 2WPGA 3KDOA 1AUSL 3M6DA 4OV4A 1IXNA 2VUNA 1VQTA 1UA7A 3WN6A 4D6FA 2EPMX 1EC7A 2CYGA 2AQWA 5CCZA 4TVUA 1V3IA 1B2YA 1MVYA 4L9XA 5D33A 1TPDA 6A3HA 3LSCA 3WQPA 3W1RA 1XICA 1XM3A 2GUBA 2TODA 2FLIA 3QYSA 5KZMA 2VX6A 1A5MC 3W53A 3ITCA 3SIZA 1MYRA 2WC4A 1HG3A 1K9TA 4W7WA 1PX4A 2PDWA 4DJFC 4Q4SA 2H8ZA 1B4KA 1UD8A 3BZGA 2FB3A 1Y7VA 1QHOA 3WH9A 5LIXX 1AQHA 1HIZA 3STGA 1DIEA 2QULA 2VFGA 2WHMA 4DB7A 1JDDA 2XSAA 5F4SA 2X7VA 2I16A 3CIXA 2EO7A 4L61A 1XV8A 4O19A 1OFDA 3FDGA 2HJPA 3CEUA 3R4IA 2NQZA 3AMGA 1XD1A 4LY8A 5F2IA 3DYPA 1IV8A 4HN4A 1PDYA 3LN3A 1MW2A 2CERA 1EP3A 2X1TA 3RX4A 2VUYA 4WSJA 3ID7A 3LNPA 4Q22A 4B5WA 4KH2A 2J7HA 2NX1A 2ZTKA 2CFFA 2NVCA 3RUBL 4HA3A 2C6QA 3PUEA 3GK0A 4H9YA 1XISA 3RCMA 4U3CA 1P43A 3MDUA 3LDVA 3SJNA 1TMHA 1WZMA 4I5RA 2WB5A 3UR2A 3QHMA 3WNLA 3FX4A 2POTA 3C3NA 3RLHA 1OBAA 3ATYA 1YE6A 3L65A 1CLXA 1I1XA 1M7PA 4NAEB 5EGRA 4E8CA 2GGJA 3WD1A 1OF8A 3URQA 5IRPA 3NUKA 2PS2A 2GGEA 3NURA 5CSRA 4I9TA 2J9XA 3I6TA 3HPXA 5D8ZA 3N15A 3NDOA 3HGRA 3QGVA 1VCFA 1GGOA 1Z69A 4NJGA 1V79A 4N9BA 2Z26A 3S5ZA 3GHUA 5HQLA 7TIMA 3CHDA 3VC5A 1XI3A 2OPJA 3FW6A 4JR5A 3EA3A 3PTMA 4P7QA 2ZZ7A 2YL6A 3MKKA 3P67A 3WBAA 4QGCA 1K77A 4FF7A 2WZEA 3CAVA 9XIMA 3EOUA 3P14A 1MZHA 2PDLA 1A5KC 4JQ3A 5C6MA 4PEEA 2CWXA 2XH4A 1JNEA 3IJDA 2CKSA 3C3UA 4U5IA 3VD3A 4RE4A 4Q8TA 3I7QA 4I5UA 3CWOX 3BJTA 3W82A 4WXZA 4NT0A 2J7GA 5J5RA 3OJGA 3K2GA 3VCRA 1HKWA 4KGJA 1EGZA 4S3EA 3TVAA 3GDBA 3DUGA 5CZSA 4IJCA 3U0HA 1EC9A 3DXIA 3D46A 2VEPA 4IWWA 5CPTA 1MNZA 2RAGA 1B30A 4TV5A 4ZTYA 4JEJA 1SO4A 3PZIA 4GO9A 1Q7MA 2NQJA 2Y62A 1NWTA 1GQJA 4OV9A 2UBPC 1PB0A 5MF5A 2RDXA 2ONEA 4UOZA 5BCAA 1G69A