1NQ6A

Crystal structure of the catalytic domain of xylanase a from streptomyces halstedii jm8
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of xylanase Xys1delta from Streptomyces halstedii.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Hydrolase
molecule keywords Xys1
total genus 123
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nq6A00
3AIBA 4HMEA 1NP2A 2VRKA 2OYKA 5HPOA 4TTGA 1WP6A 3NDZA 1MQQA 1CZ1A 3U5UA 2WMHA 1JNDA 3W0KA 1HNYA 5D4YA 2XIIA 5M3WA 3VIPA 1ISXA 3AFBA 1TVPA 2JIEA 2OSWA 2EJ1A 4JIEA 3VD5A 4PTVA 4AD5A 5I6SA 4V27A 1K9EA 1S46A 5JBDA 3ZSTA 2C0HA 5A1AA 3W38A 1K9TA 1UD8A 2WVUA 3VINA 3WMSA 3UESA 5A8MA 2ZOXA 4LYRA 4QDMA 3M07A 3K8LA 3POCA 1LG2A 3K4AA 1U2YA 1VFFA 4U5KA 1J9YA 1E6ZA 1LF1A 2JFEX 4TTUA 3ARPA 4KMQA 4BQ5A 3I3DA 2FH8A 3WENA 4JZ5A 1WDPA 4DWSA 3VNYA 2VCCA 4EE9A 5C8BB 1CXHA 3VDCA 4AYSA 4EANA 1WB0A 4CD4A 1OGSA 3FAXA 1BGGA 4S3JA 3VVGA 2J7EA 5BCAA 1XH0A 3KZSA 2DEPA 3DYPA 1DWGM 4UFLA 4GKLA 1W9PA 3THCA 4ACZA 1WKYA 1GNXA 3T2OA 5ECUA 3GBEA 4H04A 4WF7A 1H3GA 2YL9A 1W2VA 4H7VA 1B31A 1EXPA 1HKMA 2BXYA 1IZKA 4WIWA 2V3FA 2J7HA 1HX0A 4AD3A 1UZ1A 5A3HA 3SCPA 2ZUWA 1J0JA 2QMKA 4PEEA 1GHSA 3MSGA 5CJ5A 2VJXA 5D9NA 1K6AA 3OLDA 2GK1B 3ALGA 2ZUVA 3MKKA 1DP0A 2XJ7A 5HPCA 2VRJA 3WUFA 9CGTA 3AHXA 2X09A 3N1AA 4CU6A 4YPJA 2CBIA 3N04A 3FHQA 2C7FA 1E40A 1C8XA 3WH7A 2IXUA 1BG4A 4J3SA 1TR1A 2V5DA 3KE0A 3SCOA 1UWQA 4BS0A 1JAKA 2WNWA 4JAWA 2JEQA 1PPIA 3KWXA 4MPKA 3CH9A 4YN5A 1GVIA 3NIYA 1AQHA 3WNLA 2VCAA 2ZE0A 4BQ3A 5BXTA 3DYMA 4BF7A 1V0LA 2JIWA 2OSXA 1PBGA 4R27A 4OIFA 2BV9A 1CXFA 1UG6A 1TZ7A 4ML4A 4IPNB 2D1ZA 2WSKA 1GOOA 2Q8XA 4WSJA 4AZ7A 1TFVA 3PBGA 2E3ZA 1EIBA 1WNOA 4U33A 1HP5A 2Z1KA 2DPEA 3GXMA 2J8FA 4S3KA 2J62A 5DT7A 1R7OA 3HN3A 1JZ6A 4HU8A 1WDRA 4DUXA 3FAWA 3ZT5A 2YBUA 3AIWA 4HA3A 3J7HA 5DT5A 1V3JA 1PEZA 3PZMA 3AS1A 1NH6A 1RP8A 1CXEA 2GDUA 2W61A 5GNXA 1PZ2A 1WO2A 4CD5A 1E3XA 2WBKA 4AZCA 2RGMA 2YBTA 3VMNA 5E0FA 5IDIA 4WLCA 4PMOA 3AIEA 1H2JA 2A3EA 4ZFMA 2OWCA 1JZ4A 1HJXA 3ZR6A 1CXIA 2J47A 2VX5A 2VX7A 7A3HA 4F79A 3T0BA 3WEZA 4HPGA 3WQ6A 1OBAA 2DSKA 3FW6A 1RP9A 4XV0A 2ZUUA 1Z32X 5AYBA 1I75A 1QI5A 3PTKA 1GVYA 1J0HA 1ECEA 1MWOA 1JZ2A 3AIVA 1C3FA 2RGLA 3WH9A 1HVXA 3BXWA 4B3KA 2WZIA 1JXKA 1R7AA 1WZLA 2NW0A 4W7VA 5A6LA 1V08A 5FL1A 1W1VA 4HOXA 4HA4A 5EFFA 3PHAA 3ZJ6A 2FGLA 6TAAA 4GQRA 3WELA 2J7BA 1FP9A 1B2YA 2VTFA 4P8VA 1QI4A 3AISA 2G3IA 4UQBA 3TTOA 2CKRA 3RPMA 2XVGA 4AMCA 4NSBA 3CZLA 1QNQA 1GJWA 4PN2A 4B9YA 4NZCA 3RM9A 5ABFA 4D1JA 1XH1A 1Q4NX 1M03A 1UWSA 4PMVA 3VD9A 2J7DA 1B3XA 3LMYA 4E8DA 4NF7A 1KCLA 1QHZA 1OIFA 3UEQA 3ZJ8A 1G0CA 4DWSB 2CNCA 4J28A 1YQ2A 4PMNA 4JFUA 4LX4A 1HKJA 3WF4A 1ESWA 3CBWA 2WCSA 4GI6A 2VR5A 3WBAA 3GH5A 2D3NA 1UD3A 3ZIZA 3IJ7A 1YHTA 1ZJAA 2DT3A 2EPOA 1B3ZA 4Z2KA 5E9AA 3ARZA 1UKPA 2CERA 4L4PA 2NT0A 1J11A 1E4MM 2E9BA 3WQ5A 2WMIB 4LQ1A 4UQAA 4GPNA 4AZ6A 1MQPA 3F5KA 3UG4A 4EAMA 4WK9A 2GJXB 1FP8A 1HIZA 3UG5A 5A2CA 1B3WA 4UFIA 4HOZA 2VI0A 4IUGA 1FFRA 1HP4A 2VVNA 4P7QA 1JYVA 4UQDA 3OZOA 3VD3A 2PWDA 5IXEA 1MFUA 4CGTA 1EDGA 1CIUA 3CUJA 4DWSC 4ATDA 1HJQA 3GXDA 6A3HA 3BAYA 2GSJA 3TTSA 1JFHA 1GHRA 1W3LA 1OGGA 1NM9A 1J12A 2WKGA 2O92A 5LA1A 3CZ8A 4D6GA 4HP5A 4E8CA 4WSKA 1GQLA 2WZEA 3WMCA 1KWKA 3CHCA 1H11A 3AZRA 4JHOA 4KWUA 4AD4A 3VDBA 2DDXA 1NWRA 1G94A 3RO8A 2WMGA 2X8RA 5EBAA 1H4PA 1VF8A 5FOOA 3GH4A 2W62A 2CXGA 3WEMA 2YA2A 3T09A 1C7TA 2WXDM 2V3EA 1M7XA 4D6CA 4B9ZA 2W63A 1E4LA 1XCXA 4MB4A 4LYPA 2VC9A 1JDDA 2CPUA 4W8LA 3W27A 3DYOA 3GH7A 1DHKA 5JBEA 2VZUA 3AOFA 1FH7A 3MV11 1J10A 1VFMA 3AIUA 2XM1A 3AHTA 1QW8A 1QVBA 2E40A 3WKZA 1E70M 3QGVA 2YA1A 3OA5A 1E55A 1OWQA 1V6WA 2CBVA 3WNPA 3UR7A 1UH4A 5LYRA 1EQPA 3BSHA 1KXTA 4OBRA 3DHPA 1TUXA 3CTTA 1PJ9A 1QOXA 3CLWA 2QLYA 3TONA 2GVYA 4V28A 1HJUA 1I1WA 1PX3A 3VM7A 2XG9A 4WJXA 4QLKA 3ARXA 3A4WA 5I78A 3PZIA 1OD0A 2WVVA 4AD1A 1UA7A 1VFOA 3NSMA 2WVVB 3GXFA 2VURA 1R85A 5BWFA 5JBFA 1F4HA 2DT2A 4J3UA 4MAVA 4JCLA 4D1IA 1KBKA 4B15A 5I2UA 2ZUMA 2DQXA 5JUVA 2A3HA 2O9PA 4JKLA 3VGHA 5A6AA 1NARA 2BHUA 1W3HA 4QFUA 3W81A 2V3GA 3LPFA 4MADA 2GUYA 1PX4A 1WPCA 5BXPA 3QHNA 2XVLA 1PZ3A 5BROA 4HZ7A 3WF0A 4D6JA 3GZAA 1FHDA 1E0WA 1BQCA 4MNKA 3TTQA 1OD8A 3WFZA 1CGWA 1UKTA 4M81A 3QOMA 4MNLA 1EHAA 2EPKX 1UR0A 1AVAA 3VGEA 1A3HA 1VJZA 5AY7A 5FD0A 1EO7A 1ZS2A 2DIJA 2ZX9A 4AZIA 3D5HA 4P8UA 1K9DA 3EMZA 3BCFA 1JDAA 3IAQA 5I79A 2F8QA 1KQYA 1OSEA 4RE3A 2XIBA 4TUFA 5I3DA 1E0XA 2WHJA 4NRRA 4D6IA 1B3VA 4M1RA 1W32A 5ABFB 3A3HA 1BYCA 5AC5A 3GXIA 3RJYA 1UWUA 2YJQA 4MDOA 4J3VA 3SCTA 3U7BA 4Z2GA 3ARSA 4PMZA 1G01A 3CZJA 4BZYA 4AZ5A 4PCTA 2WB5A 5LA2A 1RH9A 1HF6A 2QHAA 3T0AA 1EDTA 1W9UA 1CNVA 5A2BA 3L2LA 4ATLA 1LJYA 4ATWA 1VB9A 2VZTA 1AQ0A 1JL8A 4P7RA 4TVDA 1G5AA 4GZEA 4UQEA 5IFTA 2Y5EA 2CHNA 1CWYA 1UR2A 1QI3A 1ITXA 2WZHA 1H0IA 3W24A 2PF0A 4UFJA 1ISVA 1KFWA 5CSUA 1WDSA 2E9MA 7TAAA 3ARYA 1W9BM 3N18A 3NJ3A 3U57A 1CTNA 2NSXA 1BYAA 4PMYA 2WM0A 3M7SA 4TOQA 5IHSA 1C8QA 5ABHA 3WF2A 3T2PA 1VAHA 5HXMA 4JFSA 4OZOA 1TE1A 4UFKA 2TAAA 3W6MA 4FLQA 2ZUNA 1J0YA 4DUWA 1GOMA 3M6DA 1GJUA 1G1YA 2EBNA 1OINA 3AMDA 4FLRA 5A6JA 3AXIA 4URIA 1A47A 4AD2A 1C93A 1CGUA 3WDIA 3L4UA 4CD8A 3GNRA 1PX8A 5ABGA 1MVYA 5CQ1A 3AHYA 4D72A 1R87A 4GXPA 3WSUA 1ODUA 4CN4A 3AZSA 2XFRA 3AHZA 1JNEA 1KQZA 3WUGA 1GPFA 3I3BA 2AMGA 3OLGA 4W7UA 2PWFA 4GIAA 1CGYA 2XVPA 4W88A 2O9OA 4BQ4A 2EO7A 4NI3A 3G6MA 4UNIA 3L4ZA 1UUQA 3U7VA 4U2YA 1JF6A 1QI2A 3GNOA 3VIJA 1E43A 1MW1A 3BAJA 3A4XA 5DO8A 1WDQA 3S6TA 1XHGA 1GCYA 3EDEA 3BAWA 3O9NA 5E6ZA 1V3LA 4OOZA 1VJSA 1ITCA 4JKMA 1H0GA 1WZAA 3II1A 4Z2HA 1E6XM 3VMOA 5CPQA 3ZT7A 4JKKA 1KCKA 2OWXA 3WDJA 2WBGA 1LWHA 1LLOA 4TX6A 3RM4A 2PWHA 6CGTA 1W9DM 3CMJA 1UD5A 3VGGA 3VIMA 3PZTA 4X9YA 3SCRA 3PZNA 1XSJA 2X2YA 2DT0A 3ARRA 3ZSSA 5HOSA 2MANA 1MW3A 1EHNA 3N17A 2XYLA 1H1NA 2AAAA 2CESA 3W29A 2IUZA 5TD4A 1VFUA 3ZOAA 3VKKA 1E6QM 3WMBA 2J4GA 1FH9A 4AIOA 1M53A 3BSGA 4K68A 1FA2A 3WD2A 3IJ9A 2FGZA 4W5ZA 2GDVA 3CZEA 3RDKA 2WWDA 1LWJA 4C7FA 4AEFA 2X0YA 1CENA 3SIMA 4Q22A 3AJ7A 4ZEPA 2XWDA 2UY5A 2F2HA 3CZGA 5A95A 3CUHA 2ZIDA 1JF5A 1E4IA 2V38A 4UTFA 3THDA 1JZ8A 2YDRA 1US2A 3KL0A 2FH6A 4M82A 5CG0A 2CIPA 1E15A 3MUY1 3SUVA 1MFVA 3SUWA 1XD0A 1TMQA 2D0GA 2V3DA 1O7AA 3BH4A 2E8ZA 2WHMA 1TA3B 5FL0A 4B3LA 4AIEA 3UR8A 3G6LA 1UA3A 3O2LA 3CIVA 2WC4A 2DSWA 3WD1A 3BAXA 1KBBA 5I5RA 2EEXA 1V3MA 3AXHA 1CYGA 5A6BD 2BHZA 4PMRA 2WCAA 2XGBA 1IZJA 3WIJA 4GO8A 1OT1A 4PUDA 1JI2A 1MYRA 2JF6A 1E4NA 1V6UA 3QHOA 4CU8A 3B9AA 1KXVA 3ALFA 3W26A 5D8WA 4QCFA 1E72M 3KL3A 1WCGA 3UG3A 1FH8A 3B8SA 1KGUA 1JZ3A 1J0ZA 1FHLA 3MANA 1MXGA 4C7GA 1D2KA 3TTYA 3MS8A 5A8NA 4MTVA 2YIHA 1PIGA 1GZJA 2EPMX 5LA0A 4W8BA 2J74A 3NSNA 2WK2A 4TVCA 3AZTA 2G3NA 2D2OA 4M8UA 1ZL1A 1XSIA 2A3CA 3WUBA 3EYPA 3N13A 1XCWA 4AC1X 1JZ7A 4BCEA 5E09A 3CHFA 1GONA 4E2OA 1XYFA 1GQJA 4CUCA 2YDSA 1ODZA 1XRVA 1DTUA 4H2CA 4F9DA 1IT0A 1H09A 2DH2A 3VIIA 4EK7A 2FHCA 4LYQA 1QNOA 4HMDA 5CLWA 4DWSD 5A8PA 3WF1A 1B9ZA 3HJEA 1CECA 2XGIA 3MUAA 4Z2JA 2ZX7A 2X1IA 4PRWA 3I3EA 2BXZA 4J27A 4A3HA 2XHYA 2G4FA 2O9TA 4DM1A 3PZQA 1DWAM 5AC4A 2F61A 1E3ZA 1VIWA 2BNJA 1ISZA 4OKDA 3W4RA 2VZVA 2A3AA 5ABEA 1KWGA 3CUGA 2WC3A 1E5NA 2VRQA 2VX4A 3VTRA 2XVNA 4P8XA 2X0HA 3LPPA 1VEPA 3WFLA 1EOMA 4MNMA 4FK9A 2WPGA 4UFHA 1M04A 3EBVA 4EKJA 5I24A 4N0RA 3VGBA 3VU2A 1TG7A 3SURA 4PMDA 2W66A 3K8KA 4C7DA 2QPSA 5HDRA 5CGTA 2VNCA 3W82A 3KL5A 1F4AA 1QNPA 3EDDA 2XPKA 2VUYA 3VIGA 1ISYA 2UY4A 2BY0A 3GBDA 1EA9C 3BLPX 1XC6A 2J77A 3BMVA 2CKSA 1QBBA 4QLLA 3MMWA 3WQVA 5GQBA 4MB3A 2J79A 2VOTA 1UR1A 1H5VA 1C91A 4DM2A 2VT0A 1JZ5A 4U2ZA 1V0MA 2XVKA 3POHA 1UQYA 3D3AA 1U33A 3ARTA 2FHFA 2Y4SA 1V02E 2ZXDA 4OUEA 3IJ8A 2J75A 2FDMA 1W1PA 4U3AA 3T2QA 1XV8A 3N9KA 3OB8A 1C8YA 1QHOA 1UKOA 4M24A 2J7FA 2WLZA 2G3MA 5IHRA 5I0DA 2WKLA 3VPLA 2BVDA 4U5IA 4KGLA 1Q6FA 3ECQA 1V0KA 3MO4A 5I77A 1RD6A 1BFNA 1LL6A 3L2MA 3UERA 2G3JA 3ARVA 2EPNA 1EH9A 3BCDA 2ZICA 3RCNA 4CVUA 4Z2IA 1OCQA 3L4XA 2D20A 1MQRA 3VX1A 1V6YA 2V5CA 4ZXLA 2JALA 3MU7A 1UWIA 4H8HA 1B30A 4UR9A 4XX6A 4TXEA 2CETA 2PWEA 2YA0A 3DC0A 3K1DA 2YL8A 4OBSA 5CPSA 1ZBKA 1GOWA 1V03A 2ESCA 1KGXA 3VIFA 2WSPA 4AEEA 4GQQA 3PZVA 4Q7NA 3OLEA 4CVWA 7CGTA 1HJVA 2WCGA 1EGZA 3MSDA 1BG9A 3E1F1 1QW9A 2YOCA 1UD2A 1QI0A 1W9XA 4PTWA 5A8QA 3WUEA 4WKAA 4HTYA 4M29A 4W86A 4MDPA 1BAGA 2D3LA 2PWGA 2VZSA 2W91A 4U31A 1H49A 2J7GA 4M56A 1SFSA 3WBEA 1N82A 3O6AA 3AIQA 5A94A 2D22A 2CHOA 1CBGA 1GQKA 4AY1A 3W28A 3FHAA 1K9FA 2WAGA 1JFXA 4D6HA 4PCSA 1CXKA 2AOSA 3T08A 1C92A 3ZMRA 1U30A 1H41A 5AYIA 5CXPA 3WD0A 3SUUA 2O9RA 3VO0A 4J3TA 1J0IA 2WMIA 4IM4A 2ZXBA 1XH2A 1E1EA 3MUZ1 4Z2LA 3OGVA 3UETA 4Y7EA 3TOPA 2WMJA 2BS9A 1WE5A 1HKIA 2VX6A 3TP4A 2DSVA 1B0IA 2VVSA 4E4PA 1V6XA 3ZJKA 2OLHA 1E6PA 1LL7A 1BSIA 3WF3A 4RE4A 1DWIM 1TA3A 2EPLX 5GNZA 4F8XA 2Z1SA 5JIPA 4PTMA 4OJYA 2WC7A 5JIWA 1CLVA 2Y2WA 3VIOA 2BHYA 3L4VA 4PMUA 2VQUA 4AWEA 4F66A 5CGMA 4RE2A 3MMUA 4W84A 5IFPA 3VGDA 1KR0A 3WDQA 4JL2A 4H8VA 2WWCA 1E6SM 1KXHA 3CGTA 3AQUA 1CGVA 3EDJA 4MJ4A 3AICA 2ZXAA 2J25A 1X6NA 3FXYA 1UWRA 3OGRA 2GFTA 1SR0A 3VILA 2YLAA 3VIHA 4V2XA 3WNKA 5M03A 4UOJA 2QPUA 5BXSA 3VM5A 2DH3A 1NWSA 3WEOA 5EB8A 4CKQA 5BRPA 2GJXA 1BYBA 2VL4A 4MB1A 3HMCA 4CN6A 5C70A 3FN9A 3RMEA 4UQ9A 2XFFA 1QHPA 1JGIA 2E9LA 3B9EA 2EQDA 3NCOA 4AZGA 2B31A 3CUFA 2BVYA 4H41A 1NOWA 3PN8A 3WDHA 5C71A 2Y8VA 3ZJ7A 4N42A 1JD7A 2CITA 1LL4A 1V0NA 5A6MA 2W5FA 5E70A 2WVTA 1KR1A 2CBUA 4JFVA 1UD4A 3WL0A 2VMFA 1OB0A 3IANA 5A6SA 2GJRA 3U5YA 4AD0A 5BXRA 1BVNP 2EXOA 4LGXA 2JE8A 1QNSA 1BTCA 2G41A 3N11A 1VBRA 1UH3A 3EDKA 3SCSA 5FCZA 2VR4A 1R86A 5F7UA 4JCMA 1HN1A 3W37A 2WANA 2W92A 4R5EA 3RJXA 5M17A 1UHVA 3BC9A 1B3YA 5A2AA 3AMCA 3GDBA 2CYGA 3AHVA 3OZPA 4MB5A 1OIMA 2Y24A 2WMKA 2G8ZA 1HL8A 1WZMA 1HVQA 1JDCA 4CD7A 3ZO9A 2QMJA 1WZKA 4GZIA 3LPGA 1OGBA 3CHDA 3WD4A 1CXLA 4X0NA 3SCNA 3WY1A 1ZU8A 3EDFA 2PI6A 1J0KA 1VEMA 5D9OA 5GPRA 1W1YA 2BY3A 3VMPA 3W6LA 1NOFA 2WYSA 5A8OA 1KB3A 3ARUA 1P6WA 3OLIA 3FNDA 3JUGA 3AS2A 4PMQA 3NYDA 3SCUA 3WQ4A 1E56A 1E5JA 3SUSA 4CCCA 1GOQA 3CPUA 2DSUA 2DGAA 3WDPP 3WQWA 5BRQA 2OWWA 4X0VA 1G9HA 3L4YA 4TVUA 5E6YA 1E6RA 4DUVA 3AROA 4HA1A 1E71M 2XWEA 1HXJA 1DEDA 2D0HA 3VOCA 2E0PA 2J8GA 2ZX5A 1ISWA 3S2CA 2PC8A 2D0FA 1BGAA 2DSZA 3FY1A 4KRUA 4YHEA 1UYQA 4HZ6A 3BLKA 2X05A 2UY2A 3AMKA 4NRSA 1B1YA 1VENA 1HJSA 1Q6EA 2IXVA 3ZT6A 4H8UA 1UH2A 2HISA 2WW5A 1XGZA 3RIKA 3AIRA 2XSAA 5CSYA 4A3YA 1E6NA 1X6LA 4HU0A 2DT1A 2XSBA 1D7FA 4W8AA 2YL6A 4BQ2A 3SUTA 2D23A 4BA0A 1Y7VA 1FFQA 4HOWA 4UCFA 5DFAA 4D6EA 4D71A 3W25A 1Q6DA 1JG9A 3EMCA 4AZBA 1JYXA 1MW0A 2WHKA 3N12A 1EQCA 1ZB5A 5HNNA 1GUVA 3WD3A 3AYSA 1IV8A 1Q6CA 3SCWA 1HT6A 1JXJA 2GJPA 2OYLA 4AISA 2YKKA 1ZBWA 4AIUA 1ZBCA 1XYZA 3OIHA 2ZX8A 4P7NA 2BVTA 3A4AA 2CBJA 3L4TA 3CUIA 3RILA 3TA9A 2XM2A 4RL3A 1KXQA 4JHZA 3WL1A 3GM8A 4AW7A 4MJ2A 3OBAA 1W3KA 1BPLB 1UOKA 1GOKA 1JYWA 2DIEA 3AXXA 3PTMA 1VBUA 3VUPA 1UD6A 4PBGA 1QNRA 3VIKA 3W53A 5E0CA 2VO5A 4UQCA 2UWFA 8CGTA 1DWHM 2XFYA 1AQMA 2E8YA 1FOBA 1CPUA 2A3BA 5CZKA 3WH5A 4UOZA 4UFMA 1E1FA 1MXDA 2ZUSA 4PMXA 4QCEA 4CCEA 3QOKA 4FLOA 3F5LA 1EOKA 4ZE5A 1UQZA 3A6OA 5M5DA 3A47A 3NUKA 1UKQA 4KH2A 4PUEA 3APGA 3BGAA 1SMAA 2HVMA 4CD6A 3PZ9A 2E4TA 2XTKA 1GQIA 2PBGA 3VGFA 1NWTA 1L8NA 2OSYA 1SYTA 3QR3A 3AI0A 3WN6A 4QAWA 2J78A 3K46A 3F4VA 3VDAA 5BYWA 4UZUA 3L4WA 4JFTA 1B90A 4XUYA 1CDGA 1V6VA 4A4AA 3OG2A 1LQ0A 1D3CA 2GK1A 4L4OA 4P8WA 3WNNA 1GORA 2BFGA 4WKHA 4QP0A 4PSPA 3QHMA 2XUCA 1NQ6A 1OT2A 1W91A 3MMDA 3DECA 1CLXA 2QV4A 4XB3A 5A6KA 1C90A 1OM0A 3VD4A 1NP0A 3ARWA 1UWTA 1DWJM 4J3XA 1J01A 3ARQA 1W2PA 2FHBA 4CCDA 4ZXOA 3NSXA 4WKFA 1EDQA 3CMGA 5GNYA 4UZSA 2Y8KA 1L0PA 3AMLA 1TCMA 3EMQA 4KGJA 2ZX6A 1VEOA 4B16A 4PYSA 4UOQA 1BF2A 3BAKA 2C8NA 3AS3A 3KEHA 2D24A 1UR4A 2PBOA 5DF0A 4OOUA 4XZBA 4JFWA 4LPCA 1ZJBA 4AXNA 2ZWZA 1ZBVA 1BHGA 4GI9A 3MUIA 1E9LA 3ZR5A 1BYDA 3GNPA 5KEZA 1E0VA 1O6IA 1W1TA 3SCQA 4FF5A 3F5JA 3IK2A 5EFDA 4W85A 3VDHA 1C7SA 4HZ8A 3LPOA 3N15A 1UR8A 3HU7A 1TVNA 1UR9A 5CPTA 1UKSA 3GTNA 2JF7A 4GINA 4U3CA 2UY3A 1NWUA 1NOUA 4TX8A 3WQ8A 2VQTA 3T0DA 1E73M 2BY2A 3BMWA 3AYRA 1PAMA 1HJWA 3GYCA 4CN1A 4JL1A 3WNMA 3CZKA 4FLSA 2VZOA 4HPHA 2JEPA 2WMFA 4ACYA 4F9JA 1LG1A 1VRXA 4W5UA 5EMYA 4QLJA 4YHGA 3PZGA 2CEQA 3MV01 3WDRA 3VX0A 1JIBA 2W67A 1V02A 4ZENA 4FMVA 4D6FA 2ZUTA 5I23A 1HL9A 2WLYA 2WHLA 2J7CA 1KGWA 4CU7A 1V3IA 2YDQA 1JAEA 3K8MA 3VD7A 4XZWA 5D9MA 5A69A 4MAZA 1US3A 5KZ6A 3NDYA 1PIFA 3PZUA 1CEOA 3CHEA 3K4DA 4KRTA 3PZOA 4HMCA 5A6BA 4PSRA 5D9PA 1EO5A 4D6DA 4J7RA 3ZM8A 2NT1A 5D8ZA 5DEZA 4PTXA 4W89A 5FIPA 3WNOA 2ZXQA 3DHUA 3UCQA 1Q6GA 4IISA 1CGTA 1GW1A 4P7OA 2PB1A 2YL5A 2YLLA 1BLIA 4P7LA 1V3KA 3ZQ9A 3WH6A 4GI8A 3OGSA 2QF8A 3PTQA 1J18A 1MW2A 1DWFM 4IPLA 4M80A 2OYMA 2W4XA 1GOIA 1XD1A 4MNJA 3B9DA 4ZE4A 4LXFA 4W93A 1R8LA 3SCVA 1HKKA 4W7WA 4ACZB 4AZHA 1JYNA 3CO4A 2WVSA 1AMYA 1V3HA 2CCRA 3AMGA 1QBAA 3BAIA 4GZJA 1SMDA 3M46A 1JI1A 2VCBA 4J3WA 1XSKA 3WH8A 1QPKA 1JD9A 1I1XA 5DMYA 8A3HA 5FKYA 3RM8A 1W3JA 5CLTA 1CGXA 3SEPA 1BVZA 2BY1A 1UZ4A 2ZWYA 4GO9A 1X1NA 3AS0A 4W87A 1RPKA 3VNZA 1W9VA 4AZCB 1WAWA 5HBFA 3IAPA 1M01A
chains in the Genus database with same CATH superfamily
3AIBA 4YTRA 4MWAC 2VRKA 3RNDA 2OYKA 4XWUA 4CEUC 1WP6A 5D33A 1DJXA 4ZQRA 3LGEA 1JNDA 2I5QA 5D4YA 2XIIA 3VIPA 1Z69A 1Z7AA 3OIXA 4QM1A 1LRTA 3R0KA 1K9EA 4TQTA 5HAOA 4L64A 4J5NA 2PZNA 5A1AA 3CV7A 1R5YA 2WVUA 5AB3A 4YWIA 4HKPA 3VINA 1LT7A 4LYRA 2BGNE 5F2GA 4OBTA 2PDFA 1J9YA 1LBLA 3HA1A 4XAYA 3T8LA 1LF1A 2EJAA 1ZLPA 2JFEX 4TTUA 2PWUA 2I9EA 5HNUA 3C86A 3FJ6A 3C8FA 4EE9A 1LOLA 1CXHA 1A49A 1Z42A 4AYSA 4EANA 2CZVA 4CD4A 4HD5A 5HQMA 1UUOA 3HV9A 3QC0A 1TV2A 1FCQA 4DO5A 1UIPA 5G4HC 1QK2A 2J27A 3KBWA 1D3HA 3ORWA 3QKEA 4ACZA 4HVXA 5ECUA 5AZ0A 1YNYA 2QCLA 4WF7A 5T8GA 4QEEA 4S2CA 1H3GA 1B31A 1EXPA 1HKMA 3NQ7A 3FJLA 3C4UA 2FZMA 4JTHA 4DBUA 1KM5A 1RQBA 1HX0A 2AGTA 5CZSA 1XYCA 4WOQA 1G4TA 1A5MC 3STEA 5C5YA 1GHSA 4LCSA 1PYMA 2QJJA 5JMUA 2VJXA 5LKYA 4ADSA 3TXZA 4F0SA 3MKKA 3H7RA 3OBKA 1GVRA 2YB4A 5G4WA 2QIWA 3NEVA 3AHXA 3WJYA 3VOFA 1DXFA 3N1AA 4UTJA 4YPJA 3OJGA 3EPMA 1W1ZA 5MKGB 3PBUA 4Q8WA 3PG9A 1CX9A 3QQ1A 1MDRA 4TO8A 5LGZA 1S5TA 4KCWA 2BTMA 2V5DA 3U2EA 3WK1A 2PRLA 2IQTA 3Q4DA 4JAWA 4CNNA 1LP6A 2WZTA 4FSAA 3G1FA 4YN5A 1AODA 3NIYA 4ZO8A 3WNLA 4XD5A 4U10A 3CUXA 1IGWA 4BF7A 3LD5A 1V0LA 2OSXA 3SW6A 2BV9A 1LOSA 2C3ZA 4FXJA 2Y88A 5LGXA 4IPNB 1L8PA 4UXDA 5LNRA 4JQAA 4XUGA 2B0MA 3JW7A 2A4AA 5KZDA 5I7GA 3GXMA 2J8FA 5DT7A 1OFOA 4DRSA 4HU8A 1EJWC 1WDRA 1XINA 1TRIA 5FAGA 4FNQA 3G1RA 4LBSA 3J7HA 3K4WA 3SSJA 3CS2A 1RP8A 4GLEA 5FF2A 4DQWA 2GDUA 3CV1A 2PDYA 1WO2A 4PUJA 4FALA 1E3XA 3TV8A 2PDXA 2QKFA 5CH9A 3FEQA 1H2JA 2AQVA 1LOQA 4O52A 3C2EA 3EOUA 2CZEA 1CXIA 1PHQA 1NDYA 2VX7A 4O57A 4Q4QA 2D2JA 3DN5A 3GDMA 4H9XA 4TR9A 4F79A 4XTIA 3WEZA 1YEYA 4AWTA 5H2ZA 3O0FA 2HTMA 1VFSA 3KVMA 3NZ1A 1C3FA 3MDWA 4QE1A 4UTTA 1HVXA 2NX3A 3BXWA 1JXKA 4Z1DA 1H50A 3STFA 4DJED 2P8CA 5A6LA 3KRBA 1EPVA 4DZAA 4HA4A 4PFHA 1TX2A 3O63A 4G8TA 2OMAA 1W1IE 6TAAA 3EEZA 3NVTA 3EEGA 2J7BA 3RR1A 1NF0A 2J6VA 4I9AA 4HSHA 4P8VA 1QI4A 4UQBA 2OEKA 3ONCA 4AMCA 3MJYA 4FOKA 4J1OA 3QQ0A 4B9YA 4GNKB 1ZAHA 5CAHA 2ZTKA 3HIJA 4IIHA 4H9MA 4IJBA 3O16A 2FJKA 2J7DA 4A05A 5E1QA 2BVWA 1KA9F 3UEQA 3PPFA 3V3WA 2CNCA 1YQ2A 1GG0A 4RW3A 1GGOA 1XWYA 2Y0FA 1HKJA 3WF4A 3VNJA 2RDTA 4ORMA 1S2CA 4GI6A 2NVDA 1KV5A 2P53A 3C0SA 3WBAA 3E5PA 3GH5A 3N3TA 1UD3A 3ZIZA 2CWNA 3DG3A 3IJ7A 1B3ZA 1RK5A 4EPBC 3ARZA 2CERA 4FO4A 5AZ1A 1B4KA 4Q8PA 4RDVA 5T9CE 2NT0A 1E4MM 1GYLA 2E9BA 3WQ5A 3C2VA 3RYSA 3UG4A 4WK9A 1J4EA 1WBJA 1VBJA 2RH9A 1NDWA 2VI0A 1BWVA 4MYAA 4QJ1A 2WM1A 4UTIA 2OZ0A 1RLDA 1A53A 5IXEA 1MFUA 4PTNA 4M3PA 4AX6A 3UCDA 1XUZA 2KAUC 2FVMA 3URQA 4QSHA 4UBPC 1P43A 4BEUA 3EKLA 1WXZA 1AJZA 6A3HA 5B80A 1DVJA 3UXIA 3C5QA 3L23A 4GIYA 1J6OA 1J12A 4LAMA 3M9YA 3HPSA 4QG6A 4E8CA 1KWKA 1KTNA 3EWYA 5EKYA 4ZFCA 1W3TA 2WPBA 2EG8A 1NWRA 3LS9A 3PUDA 3RO8A 3IIPA 2WMGA 2X8RA 3EOLA 1EIXA 5FOOA 3GH4A 5F2IA 1FQ0A 4WR3A 4JTSA 3EXSA 4RXGA 3EWUA 5HQLA 1F7BA 1M7XA 1UBPC 2E67A 4KT2A 3KTXA 3A12A 4S3GA 2W63A 3W7QA 2Y7EA 2VC9A 1Z9AA 3BJTA 4GI4A 1IEQA 1T96A 3W27A 1DHKA 5D09A 5JBEA 4HHPA 5HK4A 1O5KA 3Q2DA 2R1PA 1L6SA 1VFMA 3GX9A 2XM1A 1QW8A 1QVBA 4GCXA 1GTEA 2ISFA 4EPEC 2YA1A 1LRNA 2FVLA 1TUXA 3OQEA 1PJ9A 3R58A 4JPGA 4LUSB 1YNQA 2QLYA 2VGBA 3B8VA 3TONA 3CQKA 3DERA 1PX3A 3N3MA 3W75A 3VM7A 4DF0A 3T4WA 1X1ZA 3ARXA 1W8GA 3A4WA 4YCPA 3PZIA 1VCFA 1RXOB 2WVVA 3M1ZA 4AD1A 4Z1AA 2IS7A 5EBUA 5F1UA 1DQXA 2WVVB 4WDUA 4I7VA 1R85A 1SO6A 4J3UA 4JCLA 1XC4A 3L5AA 3USZA 2QJHA 3HBLA 5JUVA 3EGJA 4IWWA 4GOAA 1NARA 2BHUA 1P5BA 2TRSA 2V67A 1W3HA 3W81A 4AF0A 5K9CA 3LPFA 2JK2A 4DXKA 3FA4A 2XVLA 1K8XA 1OFEA 3GZAA 3OVGA 3H2FA 1E9IA 1E0WA 3TTQA 4NG3A 1OD8A 1FVPA 2HXTA 1UKTA 1EZ2A 4Q7BA 4MNLA 1PTGA 1QW7A 1AVAA 1IEXA 1M41A 4V1YA 5H6HA 3A64A 1XM3A 2DIJA 2ZX9A 3R10A 2SFPA 2RJHA 3BCFA 1WUEA 4MSSA 3R8GA 2I9UA 1OSEA 5GJNA 4TUFA 2X41A 1A50A 2F2KA 4D6IA 3FSUA 4MKVA 3KDNA 1P7TB 3TVAA 1P0DA 5ABFB 1AJ0A 2PDQA 1F76A 4Q32A 4C60A 2VEKA 3G22A 3NPUA 4S1FA 3SCTA 4RXFA 3ARSA 2HWGA 4PMZA 2OQYA 3TA6A 3P6LA 5HA7A 3CZJA 4BZYA 4ALDA 2V5BA 4AZ5A 3CNYA 3E5BA 4BR1A 3LN3A 5D32A 1RH9A 3T0AA 1SJCA 1CNVA 4IMCA 5A5WA 5AHFA 3OU8A 2Z25A 3L2LA 1THFD 1VB9A 4L65A 4P7RA 4P5UA 4UQEA 1OFDA 3F4NA 5J8LA 5B7YA 4M6QA 3PJUA 2WZHA 1ISVA 2AQOA 4EPDC 1FKWA 5FESA 1GKQA 3ARYA 3JVAA 3AAMA 3DFOA 4HQVA 3EOSA 5PTDA 2PTWA 2I17A 3KRUA 4TOQA 2FZ8A 2FTPA 5K4XA 3WF2A 4OQVA 1SZEA 1M9HA 1GOXA 3P67A 1E9ZB 4J9JA 1NTHA 3WJZA 4Y9PA 2ZUNA 1J0YA 4DUWA 3OVPA 4OUIA 4AF0B 1GJUA 1G1YA 1XF0A 1XDMA 2VFEA 4R7JA 1C93A 5CAKA 2A7NA 3GNRA 3DIPA 3NZQA 5CQ1A 5FACA 1XLDA 3ANVA 5GJPA 3WSUA 4IJCA 5LZLA 1N7KA 3UR2A 3AZSA 1QXLA 4MFEA 3APTA 2G96A 4JHMA 5MKGA 1GPFA 4MJZA 3AUOA 2ON3A 4FNSA 3P61A 4I90A 1DJYA 4GIAA 1F74A 4W88A 4BQ4A 3G6MA 4HN4A 3VKJA 1UUQA 1KFKA 1JF6A 1QI2A 3GNOA 3VIJA 4AHQA 1E43A 3BAJA 2YCLB 3A4XA 2A79A 4GY0A 3S6TA 4JR5A 3PUGA 3V0SA 1VRDA 4XKMA 3UA4A 4OOZA 1VJSA 3S47A 1T0OA 1PS9A 2B7NA 1E6XM 3W1XA 3VMOA 3TCEA 2REQB 4JKKA 1AW2A 1KCKA 3GXNA 3WDJA 5HWMA 4K8EA 1GW9A 3RM4A 5C54A 1BSLA 1J6PA 3CMJA 4A22A 2ODOA 1RCQA 2ZTJA 3PZTA 5HOSA 2W27A 4EXQA 4IMDA 1HQTA 3HB9A 4Q7IA 3SRKA 4IZGA 4KWWA 1TJRA 1AL8A 2CESA 2IUZA 1VFUA 4YVPA 3ZOAA 4QS6A 3T42A 4Q4PA 2QUNA 3IJ9A 1TCDA 4K8HA 1UIOA 1EA0A 3CZEA 1ZPTA 5FF3A 1J93A 5LNSA 3TH6A 1VIZA 2XWDA 1DJNA 2OG9A 2F2HA 3TKFA 1P6BA 4K3ZA 2Z6JA 2V38A 4KERA 4QTGA 1E15A 3MUY1 3SUVA 3SUWA 2V69A 3QW4B 2D0GA 4UWMA 1XIMA 1NVMA 4GKTA 2DV0A 1VD6A 4LNYA 4O1AA 3L0KA 3BMXA 3UF9A 3WFAA 4NZFA 1PWLA 3G1DA 4B3LA 3G5EA 1V5XA 1UA3A 3CIVA 3BAXA 5I5RA 1ZGDA 2IPFA 2QNEA 3VNDA 2NXIA 1TUFA 4MUPA 1GKPA 2FKPA 4DHGA 2PDNA 3HJZA 1OT1A 2FTYA 3MJMA 4ZZ9A 1JI2A 3I4KA 3TR9A 5C2XA 4EWND 2PD9A 3KOWA 3KOYA 3URAA 4E6MA 5D8WA 4KWSA 3GO2A 3TCSA 2OKTA 2NX1A 1VFHA 2WJDA 3EX2A 3VOGA 2QDGA 3UG3A 1FH8A 2YFOA 2F6KA 3MKCA 2CZFA 2E6YA 1J0ZA 1FHLA 3MANA 3URBA 1MXGA 4C7GA 1TV5A 4L6HA 4ZO9A 4Y90A 3HQOA 3MUXA 4MTVA 4NJGA 1GZJA 2AKMA 3AJXA 3MUCA 1QOQA 1EP1A 2J74A 3ABQA 3NSNA 1Z48A 5D2VA 3GG0A 4TVCA 2A1YA 2D2OA 3SGGA 3P14A 4FNTA 4UCGA 1JZ7A 5D03A 1GONA 4JTJA 4RK8A 4E2OA 1AFSA 2YDSA 3VKCA 3DENA 3Q45A 3S2LA 3HPAA 1MUCA 4EK7A 4CEXC 1JULA 4JYDA 1SM9A 1QNOA 1WQ5A 4IMGA 4HMDA 5CLWA 1XQKA 4HYVA 4LW7A 3MP3A 1J2WA 1FWDC 2BMBA 4PRWA 2PCEA 2NQZA 1TTIA 2ZRUA 5FJOA 4WOZA 4D2JA 3PZQA 4GHRA 2F61A 4OFCA 3P82A 2NVCA 1VIWA 4US5D 2ALRA 2BNJA 4HK6A 4OKDA 3W4RA 5FSEC 2VZVA 1KWGA 3CUGA 2W6RA 1AG1O 3C61A 3LENA 1P48A 4GCAA 2FDSA 4P8XA 3LHTA 3LQLA 4FK9A 4I8DA 2WPGA 2D69A 3IJLA 3V1PA 1KV8A 4EKJA 4C6JA 5I24A 3SURA 3VKAA 4PMDA 2WJEA 3M0YA 4F40A 1Y8BA 1Q6OA 4RR4A 4NYUA 2ONEA 2VNCA 3W82A 2V8ZA 3KL5A 3EDDA 2VUYA 3GVQA 1ISYA 1A3WA 3U4FA 3LLDA 1XC6A 2J77A 1U22A 3FEMA 2EG6A 1OX6A 1QBBA 2VOTA 4FR6A 4ZO6A 1UR1A 2G97A 2VT0A 3OEXA 1TTJA 5CPOA 4AFYA 5HQEA 3S2MA 1RQEA 1UQYA 4MKNA 3ARTA 1V02E 1S2UA 3T0CA 1TZZA 3HMJG 1QHOA 4R33A 2YZ5A 4CNUA 4NVTA 2X0SA 3TSBA 4UNKA 2J7FA 2WKLA 3NO5A 2BVDA 2NV2A 3M41A 4UTWC 1V0KA 3MO4A 1RD6A 4H8NA 1LL6A 2E09A 4IG2A 4K2SA 5EMKA 5DX7A 6TIMA 2XN1A 4JQ4A 3DFSA 2ZICA 4PZVA 3N4FA 3WLTA 3L4XA 2D20A 1MQRA 5HMFA 5EMUA 5REQA 3AWNA 5DY2A 4ZXLA 4ZBCA 1DJHA 3T9PA 2HROA 3QSTA 6ENLA 4EVZA 1B30A 4UR9A 2CETA 3SY5A 5KSWA 3N4EA 2QDDA 3OPSA 3DHFA 4MWAD 3EX6A 3OP2A 1SUXA 4JDBA 1KGXA 5AC6A 3KOZA 4N02A 3PZVA 2OJPA 7CGTA 3P3BA 4FIRA 1AH0A 4WCJA 4RCXA 1QI0A 1QO2A 3C3NA 3QPYA 1D8CA 4R9OA 4Y8FA 4GYFA 3WUEA 4HTYA 2KZHA 4O8RA 3VA8A 1BAGA 4MDPA 3SDOA 2PWGA 4GD0A 2VZSA 4RDWA 1MSSA 4XVDA 1H49A 2E6AA 2J7GA 4WUIA 1JUEA 4GJ1A 3WBEA 1EC7A 1YDYA 4A2RA 4B5NA 4WDXA 4HYWA 1JFXA 1CXKA 3LHYA 1PV8A 3ZMRA 5L6UA 1U30A 4TV5A 1H41A 2LLEA 3KFTA 3SJNA 2QCCA 1I0DA 4J3TA 4DNMA 2X42A 3OGVA 3UETA 2HPIA 3JRKA 4XAPA 4Y7EA 4C91A 3I10A 6PTDA 3TP4A 5IOBA 2Q3OA 3GAYA 3KOFA 4DZHA 3ZJKA 1E6PA 5AFDA 4PCFA 1BSIA 1Z8AA 3WF3A 1DWIM 5EPDA 5GNZA 4F8XA 2FZ9A 2Z1SA 5JIPA 1I45A 2ZADA 3C3UA 4ASTA 5D30A 4B5SA 2Z4GA 3C8NA 1PTDA 2GVEA 3VIOA 4YLWA 4MGGA 3F1QA 4PMUA 2V6AA 4F66A 4RE2A 3R13A 3JZUA 4W84A 4PC8A 1TV7A 1KR0A 1UZHA 4KFNA 4JL2A 4WY0A 1A5NC 1E6SM 1KXHA 2YCKX 4X2RA 4ZB5A 3WK0A 2ZXAA 3GWQA 2J25A 1X6NA 1M7JA 3NL5A 4GISA 4H4IA 2GFTA 3VILA 5M03A 2PFHA 3VM5A 2DH3A 3WEOA 4CKQA 2VL4A 1BYBA 4MB1A 1I8JA 3IVUA 3UPMA 4UQ9A 2XFFA 2YPIA 1JGIA 2E9LA 1JR1A 3B9EA 3QLDA 3UXDA 4O1CA 3XIMA 2B31A 4D8ZA 3W02A 2PRHA 5C71A 2Y8VA 3ZJ7A 1V0NA 3HM7A 5F1VA 5E70A 3VFCA 1TWDA 1KR1A 3QZAA 1UD4A 3IANA 3TXVA 2JBMA 3T44A 2C6QA 2EXOA 2ZVIA 2OELA 1BTCA 3E0LA 2XIQA 5LIUX 3EDKA 3SCSA 5FCZA 4JTRA 1JPIA 5F4WA 5F7UA 1IEIA 1IHIA 4R5EA 3IGHX 3S8HA 5M17A 3BC9A 5HJYA 5FEPA 4Q8OA 2PU1A 4JBRA 1OIMA 2VEFA 1HVQA 4CD7A 4JX6A 1QO5A 4WDWA 3UJRA 1BQGA 5FF4A 2ADAA 4FXSA 4IIBA 3NAVA 3HGJA 4GY7A 3SCNA 1ZU8A 1OFQA 1VEMA 2GUBA 2QF7A 3TYEA 2FPVA 1KM0A 3RITA 1KFEA 1KB3A 3BE7A 4QE5A 2HBVA 1RY8A 4DJDC 2E5BA 3NYDA 4PMQA 1E5JA 3QW3A 3SUSA 4CCCA 3PFMA 4RZ6A 2QDEA 4DYKA 4YVXA 3V0UA 3M0VA 2W79A 3FIGA 3G3MA 2OCZA 3S2CA 2PC8A 1EX1A 4HNLA 4HNNA 2DSZA 4YHEA 1MZRA 2ZDRA 4JQ2A 1UYQA 2P8BA 3BLKA 2X05A 2Y89A 3AMKA 1KTCA 3TQKA 2QW5A 4NJJA 1V93A 2IPGA 1XLFA 2IXVA 3ZT6A 3E49A 2YCJA 3BICA 2HISA 3RIKA 5CSYA 4IHCA 5DLCA 1EF3A 5KZEA 2A5HA 1E51A 3UWVA 3WLNA 1K8YA 3D6NA 1M3UA 1YLVA 3TQVA 3TW6A 1Y7VA 1V7AA 2RDXA 1Q6DA 3EWZA 4JTDA 3WLPA 3N12A 5CC5A 4GXWA 3W7IA 1XYAA 1TX0A 2BZNA 2FVKA 4PL2A 1Q6CA 1XRTA 5AVNA 2NUXA 3VNMA 4JX4A 4QJ3B 1ZBWA 3LCLA 2ZX8A 2BVTA 3FKRA 1DE5A 2XM2A 4RL3A 1KXQA 4GUFA 5D02A 3WL1A 4QX4A 1ZY9A 3OBAA 4PBGA 4UQCA 3COTA 1DWHM 1AQMA 3KHDA 3TAOA 3UA3A 2E8YA 1OFAA 3WH5A 2ISSA 2ZUSA 4QCEA 4CCEA 3M5ZA 2PEVA 4ZE5A 1BF6A 3R11A 3LA4A 2PLCA 1ZTVA 1YXYA 2B7OA 3A47A 2HVMA 4CD6A 5DXYA 3W7NA 2O7SA 3SRDA 1KFBA 3USBA 2OOFA 1RR2A 3TZFA 1R3RA 1DJWA 1SYTA 1WKEA 4H9YA 2NXGA 4QAWA 5SWUA 3EA1A 3K46A 1NAL1 3VDAA 5BYWA 3N9SA 3G1AA 1YADA 3BV4A 1V6VA 2GK1A 4L4OA 1OCJA 2QYGA 2BFGA 4JY8A 3LZ3A 3HF3A 3JZEA 4F2UA 1ME8A 3IIZA 4QP0A 1VFTA 2DZAA 3W83A 2NUYA 3BG5A 3O07A 3MDUA 1OX4A 1NP0A 5K2ZA 3D3FA 4NX5A 2FHBA 4G7EA 4UZSA 4ZOBA 4IF2A 3AMLA 1MUMA 3WQOA 2ZX6A 3WZ0E 3P7YA 2XH7A 4DYJA 1P1XA 3BLFA 2C8NA 1H7XA 3MCNA 3UFYA 5D38A 2R6OA 4GH3A 2DZBA 2Z00A 4LPCA 1ZJBA 1B9BA 1O66A 2ZWZA 4ONVA 4XQ6A 1E9LA 3NFUA 2IPJA 3SCQA 1OC5A 4FF5A 2PUZA 1G6CA 2PZ0A 3AUJA 5EFDA 3NQGA 4HNUA 1UR8A 1OCBA 3W1PA 5CPTA 2GJNA 1XUUA 3DI1A 1JPMA 4LY4A 1TO3A 3UJEA 2IQDA 2MUCA 3DOPA 4TX8A 3V7PA 4HGXA 2ZC1A 1AJ2A 4L4MA 4I9MA 3RX2A 1FX6A 3KRSA 4PGLA 2QXWA 4F9JA 1EYWA 2Y62A 4G56A 5EMYA 1XYLA 3QTGA 4QLJA 1DL3A 3WDRA 3TX9A 4NXSA 1V02A 4ZENA 4JN7A 3UZZA 3LTYA 5JH2A 1GVEA 4U28A 3HQ1A 4KIRA 5XINA 3G0XA 1IWBA 4S38A 5C9UA 1KLZA 3LGDA 2Z1BA 1GTHA 3ABRA 1KGWA 4UTLA 5D9MA 3PZUA 3W87A 1CEOA 2ISDA 3CHEA 3PZOA 4JTCA 4PSRA 1EGMA 2NT1A 5D8ZA 3LU2A 3S1VA 4Y9OA 5DEZA 5DMNA 4JX5A 3P80A 2X2GA 2ACQA 2QAFA 2YR1A 3U48A 2OODA 4GQBA 1N8IA 2A0NA 3ZVHA 4MWAE 1W37A 2YLLA 3ZQ9A 4BKNA 1J18A 3PTQA 3WLSA 1MW2A 1Q8AA 1JPHA 4K36A 1NF7A 3E38A 3LX9A 4IPLA 4M80A 4GBDA 2OYMA 2W4XA 1BKSA 1UBSA 1XD1A 1TMHA 5DY3A 1Z41A 3WLLA 2IKIA 4LXFA 2GJLA 3U8GA 2CLEA 2A7PA 2E68A 1W1B1 3PNUA 3GHSA 2WVSA 2CCRA 4HJFA 4PH6A 3AMGA 3L66A 2PP3A 1KW1A 2YYTA 3M46A 4BWLA 3KBJA 3I6EA 4J3WA 2PTYA 1XSKA 1Y5VA 1I1XA 1ZCOA 3CC1A 1IE7C 3NQVA 4IGHA 1W3JA 5CLTA 3SEPA 1BVZA 4GO9A 2P5NA 1JUKA 3WQEA 1Q66A 3P2VA 3AS0A 1RPKA 2B4GA 1S39A 5HBFA 3IAPA 1M01A 1O94A 2E7FA 1Z89A 4O1BA 2E77A 3UYIA 4TTGA 1MQQA 1TPUA 3DFTA 1BXNA 3FJ4A 3NQDA 4CNOA 1F8MA 1ISXA 3AFBA 1VGAA 4AD5A 4U4MA 2ISWA 3RO6A 3WLRA 5JBDA 3ZSTA 2C0HA 1B4EA 2A6LA 4S2BA 1PSCA 4C5YA 1ZHAA 3W38A 4GUGA 1DYSA 4WRHA 3QBUA 3M07A 3K8LA 1LG2A 3K4AA 2POTA 4U5KA 1OVDA 2PC4A 4KMQA 5DBTA 3OYZA 3TMQA 3I3DA 1PYFA 2FH8A 1TV3A 4KQNA 4JZ5A 1A5BA 4C6BA 1TPFA 4GA8A 2EHHA 2QJMA 1H7OA 1P6CA 2E5CA 1WB0A 2XZ9A 1XIHA 4DJFC 3KLKA 2OO0A 3GAKA 1DWGM 4GKLA 3PAJA 2WOQA 1Q13A 1QWKA 3CPRA 3RFAA 4ZTXA 5CG7A 1GEQA 1IZKA 4ORIA 3GLCA 2ZQ0A 1YPFA 3KTSA 1UZ1A 5A3HA 3SCPA 2HK1A 4QXIA 4ZODA 4PEEA 5CJ5A 2ZA1A 3GUWA 1O1HA 2DZTA 3G2GA 5HPCA 1XS2A 3M4HA 3WUFA 4DF1A 4IP5A 1A5SA 2CBIA 5C6MA 1I2RA 1ZAIA 3N04A 4O0KA 3WG6A 1E40A 3LRMA 4IP7A 1M68A 4M0XA 1OFPA 1Z6KA 3NQEA 4I7WA 3SCOA 1Y65A 1HFBA 1VCVA 3HFTA 2ALDA 1IXPA 4NAEA 4PBFA 1JAKA 3XINA 4JTUA 2EKCA 2HJPA 1SGJA 4IGNA 3HV8A 1GVIA 1SW7A 1H1ZA 4BQ3A 2WV8A 3ANUA 2JIWA 1IWPA 1OX5A 4JIQA 1NSJA 1PBGA 4IMAA 4WDTA 3EKZA 1YBQA 3PC0A 2WSKA 1GOOA 1O68A 2Q8XA 3M0XA 1TFVA 2NXHA 4BI5A 1HP5A 3VKBA 2Z1KA 4US6A 4GVFA 1WAUA 2J62A 2DVTA 2FZBA 1JZ6A 3PS7A 4EXAA 4UTUA 1YE4A 4N4QA 4DUXA 3FAWA 3V1HA 3F2BA 4NNBA 4HA3A 5DRCA 3W76A 3GC2A 3PZMA 3AS1A 1U1JA 1NH6A 4W4QA 4IIGA 1HTIA 2W61A 5GNXA 1SSGA 4QS5A 2P3ZA 2NV1A 4AZCA 3VMNA 5IDIA 3AIEA 1W54A 1MEHA 3QFEA 1QFEA 3GNNA 4EIVA 1OADA 3GR4A 1YDOA 3M5XA 3T0BA 3HGOA 3KLLA 4IT1A 1OBAA 2DSKA 1WKDA 2E6FA 3EX4A 4FEZA 4XV0A 2PSNA 4AUBA 4HT3A 2ZUUA 5LXEA 2I56A 3PJWA 1QI5A 1ZP4A 3PTKA 2RHGA 1WDDA 4C6FA 3R8RA 3WH9A 3OYXA 1Q5MA 2WZIA 1FDZA 1R7AA 1WZLA 4W7VA 4LV9A 4Y9MA 3CYJA 5FL1A 4HOXA 5BZAA 3RXZA 1CT5A 3V35A 4Z1BA 5FA5A 3VI2A 2FGLA 3DZ1A 4GQRA 3QMTA 1FP9A 1B2YA 1EFZA 4DO7A 4UMBA 4LAOA 7ODCA 1LWIA 2G3IA 2A3LA 2XVGA 3TJIA 4H2HA 2Q02A 1QNQA 1KO0A 1BWLA 2PS2A 3VC6A 4K6AA 1KFLA 3LXAA 1UWSA 3VD9A 1B3XA 1X1OA 5LHEA 2O0TA 1ZAJA 2EGZA 4J28A 1REQA 4LX4A 2E1WA 2WCSA 3UR5A 3LDVA 1A5KC 1YHTA 2QEZA 2EPOA 4Z2KA 5E9AA 3MYOA 4L4PA 3U0HA 1PB0A 4E3TA 3KVLA 3ISIX 4A8IA 4LUSA 3O3RA 4UQAA 3PB2A 3SM0A 1GPWA 2HBXA 3IIXA 1HIZA 4H6KA 3LXCA 1B3WA 4UFIA 4HOZA 5KZMA 3OBEA 1AL7A 1R6WA 3B3DA 1YMYA 1M6JA 3ZWTA 1EDGA 3N2TA 3C0QA 4DWSC 4JS3A 4IMFA 2UBPC 2PGFA 1GHRA 2BB0A 1XLJA 3QLLA 1RVKA 6XIMA 1J8VA 3MI2A 1NM9A 2WKGA 1EX5A 1YE6A 2BWGA 4DWDA 3DUGA 1UR3M 1KM1A 1MRAA 4KEVA 4JTGA 2RDUA 3CHCA 4JHOA 4KWUA 5J5RA 5FF7A 2X7VA 2DDXA 1MUWA 1XIDA 4QG9A 3QY7A 3N2CA 1SFJA 1H4PA 1VF8A 3WEMA 2YA2A 3T09A 3P8IA 3GC4A 3ZLFA 4ZCWA 1WUFA 4DJEA 4D6CA 4HSOA 4B9ZA 1TV8A 1XCXA 4MB4A 4LYPA 1JDDA 1T7LA 3UWEA 2VOMA 2VZUA 3AOFA 3TEVA 2XIJA 4QRNA 1L6WA 3W2UA 3B40A 3AHTA 2E40A 4RNHA 4KF1A 1V6WA 2VFHA 2CBVA 4ML9A 4X61A 3WNPA 3W2MA 1UH4A 4YS1A 3BSHA 4DXVA 5AOUA 1R9YA 1I60A 3NZGA 3CLWA 3LSBA 5G1MA 1R30A 1I1WA 4A3UA 4WJXA 2VXNA 3ME3A 4QLKA 4ZO7A 2ZA2A 5I03A 4MMWA 4ENLA 1SJBA 4S23A 5I3JA 1UP0A 1VFOA 2VURA 3RU8X 5TQLA 4AY7A 4IQEA 1GT8A 2R8WA 3CQHA 4B15A 1F8IA 1HGYA 2GGGA 5I2UA 2X40A 2TPSA 2V81A 2O9PA 1LROA 1M1BA 3VOIA 2V3GA 1YKWA 2GUYA 3S4TA 2DP3A 5BXPA 4YTUA 3QHNA 1N8FA 4CLMA 3O6CA 3WLKX 1F3XA 1FHDA 3G1SA 1VLIA 4IQJA 4MNKA 4RNIA 1GYNA 1CGWA 3S6OA 4FB7A 4M81A 4MFDA 1K7XA 1UR0A 5GVJA 3VGEA 1A3HA 5AY7A 3QXBA 1EO7A 1XBZA 7ENLA 4ZL1A 4AZIA 2QGHA 4RKAA 3O8AA 4P8UA 3T40A 5D05A 2F8QA 1KQYA 1EUAA 4C5ZA 2H9AB 3I65A 4RE3A 5AHIA 4GK8A 1SR9A 2WHJA 4GY1A 1PWMA 3B8TA 4M1RA 5AC5A 3GXIA 1UJPA 3RJYA 4MDOA 1VQTA 3Q65A 3V4BA 2C79A 2X30A 1W5PA 5H91A 3BANA 2VGGA 3FS2A 3RAOA 2NZLA 1HF6A 3LBOA 5CZJA 5CPLA 3LCHA 1FWWA 3O15A 3QZ6A 1IWAA 1LJYA 1KRCC 1DJIA 4ATWA 1I9CB 1UOZA 1G5AA 1H0IA 9XIMA 2PF0A 4UFJA 3CAKA 1A5OC 1Q85A 1WDSA 3EB2A 2E9MA 1EWEA 3N18A 1W9BM 3NJ3A 3U57A 3GFZA 1IXOA 4O19A 4PUWA 2ZCGA 1BYAA 2WKJA 3GU1A 1AZ2A 5ABHA 2PGEA 3WLMA 2FMNA 1VAHA 6XIAA 5HXMA 4DVOA 4JFSA 4QQ3A 2V30A 2TAAA 5T91A 3W85A 1OQFA 3C2YA 3IGXA 5C0QA 1GOMA 4XZNX 4NZJA 3M6DA 1B5TA 3GFXA 4X63A 1A47A 3R12A 3WJWA 4KETA 5ABGA 4KRZA 1HGWA 4DNHA 3VNIA 1R87A 2VELA 1PKNA 1OG0A 3M0MA 3W1NA 2ZZ3A 1TWIA 1JNEA 3W7LA 3ICJA 3JU2A 5K3VA 2VD9A 3E02A 4REQB 4W7UA 5JU6A 3W7KA 3FJNA 2EO7A 2MNRA 1U5VA 3NR0A 3KOXA 2GQ9A 3SO7A 4XG1A 2OEJA 3B9OA 4E2VA 4DJDD 4EWJA 3Q58A 2PDLA 3EDEA 3BAWA 3EPOA 3TNOA 1FWGC 1V3LA 3WBYA 3FGCA 2PDKA 4Z2HA 4LEQA 2INEA 4ICNA 4S39A 2OWXA 2Q71A 2CZDA 4ECLA 3NO1A 3B8UA 3PSVA 1SO4A 3UWUA 3NEHA 1TKKA 4X60A 3DFPA 3B04A 1W9DM 2I16A 1B57A 2V2CA 5BRBA 4MLRA 4X9YA 1DTNA 1H51A 1XSJA 1XLEA 4L9YA 5D2WA 1SO3A 3ZSSA 5CZ0A 4Y6GA 1EHNA 3W6YA 5FJPA 3N17A 4AX7A 4IMEA 5AVHA 2NQLA 3OQ8A 3LI1A 1REQB 5TD4A 3M0JA 2G0WA 3NM3A 3WMBA 1FH9A 3TDFA 1M53A 3BSGA 3B4YA 4B5UA 4B90A 3WD2A 2QVNA 4LAKA 1HW6A 2FFIA 5RUBA 5I3KA 2WWDA 1C8VA 4IOTA 4QSFA 2B7QA 3H2EA 2REQA 3B9NA 3TC7A 1CENA 3QV9A 2Q8ZA 3WK3A 4UUIA 5BOFA 5IM51 4G7EB 3S5YA 3VDGA 3CUHA 3IGSA 3SJ3A 2ZIDA 1TPWA 1E4IA 1O12A 3THDA 1JZ8A 1Q7QA 4YTTA 1KM4A 3KL0A 2DY3A 1EJSC 2GVGA 3BH4A 2E8ZA 1KBJA 3PG8A 3UR8A 4NIRA 4YTSA 5AC8A 1V3MA 2BHZA 2ZRXA 3GIYA 4PMRA 4I5UA 3GVGA 5CPMA 4XISA 5CJMA 4Q6XA 3WIJA 2CWXA 4HNTA 4JIPA 2BODX 3LHZA 1MYRA 3CQ0A 2JF6A 1GZ1A 4CU8A 4WQ6A 3ZYZA 3W9ZA 4C65A 1E72M 3KL3A 3KS5A 3NURA 4RDZA 1WCGA 3NOEA 4ZQOA 4BHYA 1EGVA 4I5XA 4HCDA 1UB3A 2NQ9A 3EB3A 3NYZA 2FYMA 1ADOA 3P74A 4OVXA 2C91A 2WK2A 2VDIA 3CT7A 3K1GA 4I7UA 3AZTA 1RALA 4M8UA 1R46A 4BWLC 1XSIA 1J5SA 4I6VA 5CC6A 1N2VA 2IKHA 2GQAA 3CHFA 5TAOA 1OK4A 1GQJA 4CUCA 4DELA 3G24A 4QNEA 3B0UX 1ODZA 1RY0A 3PULA 1DTUA 1BD0A 1PO9A 1H09A 4AWSA 2HNHA 3MI3A 1OZMA 3WJSA 3W01A 4Z2JA 4NZ3A 2QCMA 2O55A 3VAVA 2PPGA 2X1IA 3BLLA 4ZB2A 2V0TA 2XHYA 3PAOA 3TN4A 4ERGA 5CPNA 4QBXA 4ZSTA 3RCMA 3UZXA 4J35A 1AK5A 3UG8A 3FLUA 3WQPA 4ZMGA 3FSTA 3V75A 4EPKA 3GY1A 3A24A 3PANA 4GYPC 3GTHA 4PBEA 4QJ4B 4ZQMA 1H1YA 3WYZA 4CNTA 2QCDB 3L67A 3S2NA 1DXIA 1JGMA 4N0RA 4RX0A 3B8WA 3VYLA 2PDGA 2QPSA 1P0NA 5CGTA 1V79A 2V5JA 1F4AA 2XPKA 1RV8A 2BY0A 1EA9C 3BLPX 1YDNA 1JCXA 1A3XA 3BMVA 4QLLA 2I14A 5I02A 2PRMA 2Z2UA 3KS6A 4MB3A 1JCNA 2J79A 1H5VA 4WJ8A 4L1GA 1JZ5A 4PULA 1V0MA 2XVKA 4KESA 3PVFA 3POHA 5ECVA 3D3AA 1A5AA 4O16A 4GABA 2VWTA 3RPDA 4U3AA 3MKVA 3T2QA 4DYEA 2AL2B 3CJPA 1C8YA 1EP2A 3ITVA 4A3RA 2YGYA 1FUYA 2VENA 5AECA 2WLZA 4KGLA 1Q6FA 1OFBA 1TV4A 3ECQA 1AD4A 2VUNA 3VK5A 2BGQA 3RLVA 3UERA 3ARVA 1JJKA 2VC6A 2GYIA 2QUVA 8RUCA 3BCDA 2DUXA 4PB5A 4S3BA 3GU2A 2ZZ6A 4RNJA 1QNVA 3VX1A 3W74A 3H12A 3MU7A 4IGSA 4H8HA 3LLXA 4FNUA 3QC3A 3C2RA 5C2CA 2Y7DA 3PFRA 4Q8NA 3BGGA 3TUUA 3IJDA 4OBSA 3S1GA 4PR4A 3K5XA 3VIFA 2FB3A 1XG3A 6REQB 5K9DA 1EGZA 2ABAA 3WQCA 1NFBA 4PTWA 1V77A 4IPIA 4WKAA 2D3LA 4JN6A 2OGJA 4O0ZA 2W91A 2F38A 1TJ2A 3BLOA 3BV7A 3UWQA 3O6AA 2ZC8A 3RG6A 5A94A 3HPFA 1F2JA 1GQKA 4Y9NA 4AVNA 3DI0A 1KBIA 4PCSA 3T08A 4QJ5B 1C92A 3L7RA 3SUUA 3T1GA 3GHUA 5TBOA 3MUZ1 1EC9A 3QTPA 3TOPA 2WMJA 1DJGA 3MB9A 1WE5A 3AU6A 3A4JA 5FF0A 3FOKA 1F73A 2VVSA 3FV9A 1L2UA 2OLHA 2CLPA 5BOEA 2Z0IA 1MRQA 4O4WA 5FAJA 1X98A 2VKZG 4Z42C 3IV8A 2OGYA 3KVKA 1ME7A 2OEMA 3QZEA 4AWEA 4CQBA 5HWJA 4EX4A 2WNZA 3HQNA 3ZVHB 2GGHA 3AQUA 2RAGA 1CGVA 4RDYA 4MJ4A 3RGTA 4QGCA 2H9AA 4AB4A 4G5DA 3OGRA 3QYQA 4V2XA 4UOJA 1ZZMA 2QPUA 1NWSA 3R94A 3W7DA 2YXOA 5BRPA 2RJGA 3WX7A 1HO1A 2GGEA 3FN9A 3CWNA 5DCEA 4KBXA 3A3WA 2PDBA 3UWZA 4AZGA 5C7HA 3CUFA 3VFLA 2BVYA 3WQFA 4H41A 1WA3A 1JD7A 3GIPA 4LUJA 1LL4A 3A5FA 2PDPA 3ABXA 3UY7A 3WL0A 3HGRA 2VMFA 1OB0A 1SFLA 3SGZA 3W84A 5A6SA 2Y8UA 1DKWA 2GDQA 1W8SA 2G41A 4H3DA 3U2OA 3T05A 2HE8A 4JCMA 4LYKA 3AWOA 4DI8A 5BU6A 1LLZA 1VCGA 3R79A 5AHMA 2CYGA 1SVDA 4N4PA 3OZPA 3BG9A 4L7ZA 1ZNNA 3UXLA 2G8ZA 2OR2A 2PF8A 1ZQ5A 3INPA 5DMLA 2VEIA 4C6CA 1LQ2A 4LVBA 2P10A 2PODA 1OGBA 3LHVA 2DVUA 2BG5A 4X0NA 1WDWA 5HUOA 3VCNA 4R34A 1J0KA 4ZA0A 4UIOA 4BF9A 4J2MA 1OK6A 1U1HA 5D9OA 5GPRA 3NVDA 2BY3A 4X22A 2W9MA 1XIGA 2WYSA 4FNPA 5A8OA 2FJUB 3OG3A 1OJXA 4UTMA 1ELSA 1K6WA 3NQAA 4M19A 1W3IA 2J66A 2XIOA 3FNDA 2CLFA 4DBSA 1FCBA 3AALA 3S0CA 2VGIA 2DFAA 3CPUA 4NNAA 4X0VA 1YTKA 5E6YA 4DUVA 3AROA 4HA1A 1PTAA 4TV6A 4HN8A 1VBGA 1DEDA 3VOCA 3UJFA 2ZX5A 2G95A 1EWDA 1BGAA 2D2HA 4AVFA 3TWAA 4GBUA 4HZ6A 2O7QA 1ITQA 2UY2A 4NRSA 1XLAA 2I7GA 4NL1A 4NZ5A 4AWUA 1E1CB 2OKOA 2XSAA 3WQDA 3S1XA 1E6NA 2HV5A 3VE9A 4WEVX 1XICA 3GXPA 4F4RA 4N6FA 4BQ2A 1QAPA 4D6EA 3TYUA 2XN2A 1XDLA 4D71A 1EJTC 4AZBA 1EL3A 4PCNA 3OHMB 3QSRA 2WHKA 3SBFA 1ZB5A 5I07A 1GUVA 3WD3A 2QPXA 2C1HA 3B0YA 3ENLA 4L6OA 5FI8A 4PCPA 3E0VA 3SCWA 2YKKA 2FMOA 4L1WA 3GC5A 2CBJA 4HNOA 3CUIA 3RILA 3LRKA 4YXGA 1RK6A 1K8CA 1YPIA 2ACUA 2NQHA 4IIEA 1K03A 4ZOCA 1VPXA 1BPLB 3AXXA 2R1KA 1VBUA 1UD6A 2FPYA 1FTXA 2OLSA 2EAWA 3W53A 5E0CA 2VO5A 3PBWA 2UWFA 5FJUA 2TYSA 3IVTA 1G4SA 1MXDA 4GQ0A 2X1TA 4IJRA 2ATMA 4H9VA 3GVVA 4FLOA 3R43A 1EOKA 2BX7A 1XLHA 3A6OA 1JUBA 3NUKA 4HK5A 2EF9A 1HZYA 3QGAC 1A4MA 1FHUA 1L8NA 4O1EA 4WXYA 3WN6A 1V51A 3B0PA 3EXTA 3OOQA 3TSDA 3R2GA 1D9EA 1XR2A 3L4WA 4JFTA 2BDQA 4JTIA 2Z29A 4XUYA 3IJ6A 3OG2A 1D3CA 4BY3A 3PK7A 4LB3A 2VC5A 3PWGA 3QHMA 2XUCA 4N2YA 4DLFA 1OF8A 1W91A 4RV3A 1R3TA 5CC3A 1CLXA 2OB3A 4XB3A 2ZZ1A 4B92A 1POJA 3ABOA 5I00A 1DWJM 1J01A 3ARQA 4WY0B 1W2PA 3G8RA 2J9XA 4CCDA 4ZXOA 4DZ5A 2XIMA 3CMGA 3FK4A 5KTLA 1TCMA 3FVMA 1IIHA 2BASA 3E0WA 2QULA 2CLOA 1VEOA 2B7PA 3UZYA 3BAKA 3AS3A 3W7EA 1UR4A 2PBOA 5DF0A 3P60A 4OOUA 2HNEA 1XP3A 3S5SA 1BHGA 1G4PA 4KW2A 2YFNA 3SECA 5JXQA 3GNPA 2DZUA 4J4KA 3QM3A 3F5JA 5AYXA 3VDHA 4HZ8A 3N15A 3H2NA 3HU7A 3PBMA 1UR9A 3GTNA 4ZR8A 4X2PA 2JF7A 4U3CA 3L65A 3L5MA 4RNFA 3LEPA 1NWUA 4FA3A 3T0DA 2VQTA 1E73M 2BY2A 3BQ6A 3AYRA 2BOFX 4Q8UA 3GYCA 4CN1A 4JL1A 3KAOA 4Z0SA 4WSHA 3FYYA 1P1MA 2VZOA 4N7QA 3PUOA 2ZFAA 4ACYA 1YYAA 3PF3A 4GXMA 4XZHA 5FEZA 1A80A 2XDFA 1T40A 3PZGA 5HMDA 1LRQA 1JRBA 6REQA 3DG6A 1GZGA 1JIBA 1A5CA 2W67A 4FMVA 3O7UA 1TRDA 1RD5A 1HL9A 2FQIA 2WLYA 3PJTA 3RLUA 4YYFA 3V5OA 1UC5A 3SQMA 2Y70A 1V3IA 1JAEA 3VD7A 2Z2AA 3CH0A 4MAZA 1US3A 3IUIA 3ZVIA 2G50A 3NG3A 1PIFA 4WZHA 4O1DA 2C14A 1PHWA 1YTDA 4IX0A 1Q8JA 3K4DA 5A6BA 3B8IA 1TPEA 5D9PA 5H8MA 1EO5A 3BGJA 4PTXA 2VFFA 4AQLA 4LUTA 3WNOA 2ZXQA 4I6KA 3WLOA 2PLKA 2GQ3A 1CGTA 1ICPA 2O4MA 4LAZA 3G0SA 2PB1A 3URNA 4LUIA 4KPLA 4P7LA 1NDZA 4OGZA 3WH6A 3OGSA 2AL2A 1W5NA 1DIDA 1DWFM 3PY2A 2QJNA 4LVDA 1GOIA 2R1NA 3NQBA 4MNJA 3SGUA 1DQWA 1GVOA 1HKKA 4W7WA 3NZRA 2NSOA 3TYBA 3CO4A 1KC7A 1RVGA 4JNYA 3APYA 3BAIA 3R0DA 1JD9A 4O50A 3NPVA 3M0LA 1A5UA 4XBSA 4RZBA 1AMKA 1X97A 1DJQA 5AHEA 1ME9A 1X1NA 5CGQA 3P84A 4C6NA 1SW0A 3VNZA 4AZCB 2PDIA 3FYOA 4XD4A 3HZ3A 4B5VA 1NP2A 2G5WA 3AO0A 1JCMP 4WVXA 1CZ1A 1P0EA 2WMHA 5CZTA 1HNYA 1JCJA 4R3UA 1UP2A 2XGZA 4IFKA 5M3WA 1TVPA 3ITGA 2OSWA 2GPTA 2J88A 3VD5A 4V27A 3PBYA 1XRSA 2J8TA 1S46A 3KP1A 3MP5A 4NILA 3QYSA 1OYBA 3GE7A 3UGVA 5A8MA 2ZOXA 5H8PA 4QDMA 3POCA 3ITTA 5LXXA 2ZRZA 2CLHA 3AYVA 1D3GA 3ARPA 4BQ5A 1AA1B 2Q09A 1TELA 1BXBA 4KFOA 4DWSA 1OEPA 5AYZA 2POZA 4LVAA 4XO6A 4Z0JA 4IP4A 4C1NA 3ITYA 5BCAA 4H6RA 3GUGA 1YDVA 3KZSA 3MP4A 3DYPA 4LSBA 3THCA 2XSXA 3T2OA 3N6QA 4H04A 4FS9A 2YL9A 1W2VA 2AGKA 4H7VA 2J7HA 3NNTA 4NY2A 2DZXA 1JQXA 1H7RA 2ZUWA 4F0HA 1CLKA 3KW3A 3B06A 2C13A 3MSGA 3LV6A 5D9NA 1K6AA 1W5MA 2ZUVA 1KRMA 4AY8A 1EBGA 1XIIA 2QJGA 2VRJA 9CGTA 3IUDA 4H7ZA 2X09A 4O53A 1VP5A 1ITUA 1KRBC 3FHQA 1TWZA 1C8XA 3WH7A 2IXUA 3C0LA 2V5KA 1BG4A 4US5A 1TR1A 3TQPA 5B7ZA 4UR7A 1O60A 1S2VA 4PRTA 4OV9A 1SW3A 4BS0A 1G69A 1R3YA 3N25A 4ES4A 3T0TA 3I6TA 4MPKA 4HTBA 3KP0A 3FDKA 4CQ9A 1AQHA 2VCAA 3ITOA 3TYZA 4NYYA 2QUTA 4A35A 4OIFA 1HUVA 2BGSA 1AW1A 5G4EA 1UG6A 1TZ7A 3T8QA 3OW1A 2D1ZA 4AZ7A 3R8HA 4HSNA 3REQA 2E3ZA 4U33A 4AEOA 2ZZ4A 4S3KA 2QJIA 1R7OA 4PEKA 2DORA 4O14A 3HN3A 2H8ZA 3FGCB 3AXMA 3TJXA 4LVGA 3IGUA 1ADDA 3P0WA 3S3GA 3ZT5A 2RUSA 2Z1WA 4KEUA 5DT5A 1V3JA 1G7VA 4Q8TA 3H2MA 2XN0A 4GVGA 3GFYA 5LIYX 4FHAA 3O6YX 4NHVA 2WBKA 3TJ4A 5C9XA 2YBTA 4L4LA 4WLCA 4PMOA 2Y1HA 1S1RA 1VPYA 2XU2A 4ZFMA 2OWCA 3WQGA 2Z27A 3WO8A 1NY1A 5H1WA 2P50A 1PZ1A 4K1WA 2J47A 2VX5A 3L0GA 3E2RA 4HPGA 4KCTA 3FW6A 1RP9A 2VFIA 3NQCA 4GYKA 4GNJA 3ERPA 1Z32X 3TWBA 4ZQPA 4IICA 1I75A 1GVYA 1J0HA 1ECEA 1MWOA 3GW3A 4JTLA 3AIVA 1EUNA 2RGLA 4AHPA 3WJXA 1IF2A 1S5WA 1AQFA 4IPJA 2C0AA 3RRAA 4JNZA 3SN4A 1MO0A 3NZPA 2VTFA 1NELA 3W2NA 3UJSA 4HCLA 1XI3A 3AISA 3T81A 3TTOA 3GDRA 1RAKA 4NSBA 3CZLA 1GJWA 4QIUA 1K4HA 2PE4A 1RQHA 4ZQNA 3BDKA 3CAQA 3RM9A 3RHGA 5ABFA 4FPSA 3SRHA 4PMVA 3TC6A 3LMYA 1KCLA 1QHZA 1OIFA 5FEXA 1M7PA 3ZJ8A 1G0CA 1I2PA 1F3TA 4ZQCA 4PMNA 3PPHA 1ESWA 3CBWA 5AN7A 1C9WA 2NUWA 2VR5A 4WY0F 1IT8A 2D3NA 2QUUA 3A9IA 2FFCA 4LAUA 3MVTA 3S83A 4GH1A 1ZJAA 2DT3A 1XLBA 4DF2A 2HQAA 1UKPA 1T5AA 3OVQA 2QCGA 3BL3A 3XISA 3SR7A 3IS4A 2WMIB 3A5VA 4HYRA 4AZ6A 3LBCA 1MQPA 3CPGA 2GJXB 1FP8A 1UWAA 3LV5A 1HL2A 4P61A 3STGA 3KBMA 3H26A 3P8JA 3W3OA 3UBPC 1FFRA 4IIDA 4JNMA 1HP4A 2VVNA 4GFSA 3MTWA 4P7QA 1JYVA 4MOZA 4LU0A 3QY8A 3OZOA 3VD3A 2DZPA 4O4VA 2PMQA 4ROQA 1CW2A 2OVLA 1RCXB 1UROA 5AYYA 3SQLA 4BJHA 1HJQA 4LALA 3GS6A 3GXDA 3BAYA 2QT3A 1DHPA 1W3LA 3C2OA 1FWAC 2OX1A 3V5FA 3VUSA 5LA1A 2PURA 3HPZA 3CZ8A 4D6GA 5J5DA 4FAMA 3AXKA 1GQLA 2WSQA 1T8QA 1TPVA 4IQDA 3AZRA 1R3WA 4TU1A 1XGEA 1H7NA 3LCWA 2GUUA 3W22A 3PWAA 3SY8A 4YMZA 5EBAA 3TMLA 2W62A 3UXKA 2JKPA 4AIBA 2WXDM 2V3EA 4CCZA 5CBJA 3PP7A 3RU6A 5G5IA 1EC8A 4O10A 1E4LA 3U2ZA 1PZ0A 2ABBA 3CYVA 3DBPA 1EXBA 2R14A 3U9IA 4PFMA 4W8LA 3DYOA 4PRRA 1XPYA 1LLWA 1J10A 2CZ5A 3E0IA 3WKZA 1UCWA 3EB4A 1Y0EA 3GDLA 3R89A 3OA5A 1T6MA 4Q4RA 3UR7A 1EPXA 5LYRA 1KXTA 4OBRA 1NU5A 4S3AA 5A8GA 4LV4A 3CTTA 3WLIA 1F3EA 3CB3A 1QPQA 2NQ5A 4V28A 3GNXA 1HJUA 3CEUA 2XG9A 1XYBA 3SSZA 3H4XA 4ERIA 3DFYA 2Z2BA 4BK9A 1EBHA 2PP0A 4XIMA 2UV8G 5I78A 1OD0A 4XD3A 4DXXA 3V36A 1UA7A 3BJSA 5JBFA 1F4HA 5DCDA 2ZZ7A 4D1IA 1KBKA 3W7OA 5AC7A 4CNPA 4B4HA 1VKFA 3QH2A 3VOHA 3FYPA 4PB4A 1FWHC 4G7FA 4E2BA 1GKRA 2A3HA 4GX8A 2XFWA 4C90A 4LJ3A 1FXQA 4JKLA 3VGHA 2VD8A 4QFUA 3D46A 1F07A 4D8LA 4MADA 1WPCA 2J9ZA 4B5XA 1SU5A 5BROA 4HZ7A 2WQPA 4D6JA 4X3ZA 5LIXX 1XG4A 2C19A 3LTSA 4GJIA 1EHAA 1VJZA 5FD0A 1ZS2A 3B0VC 3C6CA 5BW6A 4GGHA 3TIMA 4RJEA 1K9DA 3EMZA 1US0A 3IAQA 5I79A 4C6KA 4G1NA 2Z24A 2NX9A 3M0ZA 3W7CA 4F2TA 3ONBA 3IRSA 1E0XA 2G3FA 4NAFA 3OZMA 1D7KA 1B3VA 1IIGA 3QPEA 1V7YA 3SI9A 3WLHA 1BYCA 1ZJIA 4FZIA 1UWUA 2YJQA 1R0MA 1OG6A 3U7BA 4Z2GA 1EJ7L 3GKAA 2R1LA 4YU1A 3UZWA 5AHLA 2VP8A 4PCTA 4Y2WA 2WB5A 4UMCA 3A9BA 1LTDA 3RLGA 5A2BA 3GG8A 3NL3A 5EMMA 2VZTA 3NPXA 1AQ0A 1Z3NA 1SJAA 1TZ9A 4LTSA 5IFTA 2Y5EA 2CHNA 5F2MA 1QI3A 2DUAA 3W24A 1KFWA 4FXRA 4W9TA 3SY1A 7TAAA 1UMYA 3OZYA 3ES8A 2ZDSA 3FFSA 2PAJA 1CTNA 4PMYA 4S3CA 3M7SA 1H5YA 1S2WA 1XBYA 1NFPA 4WXZA 3U2CA 4E38A 4J3ZA 4OZOA 1EYEA 4UFKA 2A2IA 3G8EA 4FLQA 1EJUC 4LC8A 4OE7A 4MG4A 3IPWA 2EBNA 2PDJA 1OINA 2E6DA 3QKZA 4AU0A 3DGBA 2PDMA 4S3DA 3AXIA 5I3IA 1SQ7A 1XQLA 3LTPA 3WDIA 3L4UA 1PX8A 1VYPX 4D72A 4GXPA 1PXGA 1ODUA 3M6YA 2R9RA 3BLEA 3FVDA 3AHZA 4GZ7A 4QDPA 3NDOA 4I8YA 3WUGA 4EACA 3HGSA 3H2OA 3WCZA 4B4FA 2ZKMX 2PWFA 3G1HA 2O9OA 4L6DA 4D8AA 1MMFA 1OY0A 3L4ZA 4TMBA 3U7VA 4IX2A 3S5ZA 2VEPA 1MW1A 4OWGA 4L9XA 1WDQA 1P7TA 2A7RA 4K8GA 1GCYA 3OHIA 3TYDA 1T99A 2QZRA 3CL7A 3W7RA 4JKMA 1WZAA 3NTYA 1FY6A 1WKFA 4B5WA 4ZOEA 1EP3A 2WBGA 1PIIA 1VPQA 4KEZA 1S1PA 5FSDC 4L1XA 1F6KA 4MVAA 1LLOA 2PCQA 1J5TA 3MI6A 3LI0A 4TX6A 6CGTA 2HSAA 3W2KA 1UD5A 3VGGA 4Y8EA 3T78A 4O17A 1IEVA 2IPWA 2IQ0A 3PZNA 2DT0A 4ZTYA 3ARRA 3IJIA 1Q6RA 1MW3A 5KINA 3DESA 1TQJA 2BP1A 2PLJA 4INFA 2OPJA 3T6CA 3P5ZA 4XVEA 4YYCA 3F4DA 2XYLA 1H1NA 1TJ1A 3K2GA 3W29A 3MSYA 5XIMA 3VKKA 1E6QM 2J4GA 3MZ2A 3W72A 4AIOA 1FA2A 2FGZA 5JQ9A 4W5ZA 5HMSA 3DDMA 2NLIA 2Y6ZA 3TFXA 4PODA 4YNGA 3T07A 3AJ7A 2XH0A 4ZEPA 1DE6A 3D0CA 1LUCA 2UY5A 3CZGA 4PUNA 1HKWA 1JF5A 1FRBA 4O1FA 4YCOA 2FH6A 5CG0A 3H22A 3S6DA 2QCEA 1CI1A 2VR2A 1MFVA 1XD0A 4M5PA 1TMQA 2IKJA 2V3DA 5CC7A 1O7AA 2PP1A 4M6PA 4O54A 2WHMA 3W1QA 1PE1A 3DAQA 3WBWA 1YTEA 3A23A 4MZYA 4F0MA 3O2LA 3BWWA 1QR7A 1UUMA 2DSWA 2EEXA 1ZFJA 4HK7A 5A6BD 1AH3A 1RJRA 4L9ZA 4Z1CA 1FWCC 2XGBA 3DBNA 4C6PA 4GO8A 1ICSA 4PUDA 1WOAA 5JH1A 1V6UA 3QHOA 2G4JA 1EB3A 3ALFA 3W26A 3ZR4A 3BARA 4A8LA 1U83A 3L21A 1OX4B 3B97A 4IFOA 1DV7A 4MHBA 3F2DA 1JZ3A 3WLQA 4MWAA 3LNMA 3MQTA 3DXIA 2FLIA 3IK4A 4PA8A 5A8NA 4NJHA 7REQB 2YIHA 3LUTA 2FTWA 4KFPA 2EPMX 3H7VA 5LA0A 1L9WA 1XLCA 1KD0A 1W1A1 4W8BA 4X9SA 4A8RA 2V9DA 1XIFA 1XLKA 4PMJA 1KRAC 1BXCA 4I9TA 3RUBL 4QROA 1ZL1A 1GYMA 3EYPA 1XCWA 2AMXA 4YWSA 2I1OA 1QPRA 2Y7FA 1WXYA 3W86A 4YIWA 1ZP3A 3NGJA 5FJIA 1TWWA 5K9XA 2IKGA 4J40A 3BZJA 3VIIA 1VHNA 2FHCA 4LYQA 1XDJA 4R88A 3MBDA 4DWSD 3L68A 3WF1A 5A8PA 1B9ZA 1CECA 3MUAA 3KBVA 2HE5A 2ZX7A 3K13A 2HEJA 4A3HA 2WJZA 2GGJA 3SFWA 4HHHA 4QE4A 3VC5A 4DM1A 4NKCA 1OYCA 5AC4A 4DY1A 1GVSA 2V63A 4LS1A 4MY8A 2A3AA 3GD6A 4HPJA 3O0KA 1E0TA 1FWJC 3DHDA 2WC3A 1E5NA 4FOJA 3QR0A 3VTRA 2HXUA