1NQ6A

Crystal structure of the catalytic domain of xylanase a from streptomyces halstedii jm8
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
b'AGALGDAAAAKGRYFGAAVAANHLGEAAYASTLDAQFGSVTPENEMKWDAVESSRNSFSFSAADRIVSHAQSKGMKVRGHTLVWHSQLPGWVSPLAATDLRSAMNNHITQVMTHYKGKIHSWDVVNEAFQDGGSGARRSSPFQDKLGNGFIEEAFRTARTVDADAKLCYNDYNTDGQNAKSNAVYEMVKDFKQRGVPIDCVGFQSHFNSNSPVPSDFQANLQRFADLGVDVQITELDIEGSGSAQAANYTKVVNACLAVTRCTGITVWGVTDKYSWRSGGTPLLFDGDYNKKPAYDAVLAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xys1
publication title Structure of xylanase Xys1delta from Streptomyces halstedii.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Hydrolase
total genus 123
structure length 302
sequence length 302
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1nq6A00
2DSKA 4F79A 4M24A 1VFUA 2J7DA 2VCCA 3PZGA 3ARQA 1MW0A 4BQ4A 3WBAA 5HBFA 1GOIA 4D6HA 1R7OA 4MNMA 1E6ZA 2UY4A 4N42A 1UWQA 3M46A 3CGTA 3HJEA 3ZMRA 4UFLA 4PMNA 4HA3A 4BQ2A 2DDXA 1UD6A 1UYQA 4QCEA 4XB3A 3SIMA 1E43A 3CZGA 4QDMA 3LPPA 4GIAA 4AIOA 5CG0A 2BVDA 1PZ3A 3F5JA 3AYSA 3CUFA 2OYLA 2EQDA 3W0KA 2ZUNA 2J8FA 3A6OA 1VB9A 3L4WA 3O2LA 3N12A 4GKLA 4ATWA 1JDAA 4HA4A 4P8XA 2Y5EA 2G3NA 5I77A 3PZMA 1ISZA 2GK1A 3SUTA 3CUGA 2XVNA 1MXDA 2GSJA 5I24A 2OYKA 4BQ3A 2BY3A 1UKSA 3SCSA 5I23A 3A4XA 1JIBA 2CEQA 4WF7A 1CXIA 3GYCA 3RM8A 4Z2LA 5FOOA 1UWUA 3PN8A 3WQ8A 3VINA 3OG2A 4CN4A 1QHZA 2J74A 4WLCA 5A95A 1TVPA 3BXWA 4AZ6A 1HNYA 5E6ZA 2VR5A 4WIWA 3QOMA 3WH8A 5JUVA 3SUWA 2ZXAA 4J28A 1SR0A 1HL9A 1BHGA 2PBGA 3CIVA 2VCBA 4J3SA 4AEEA 3DC0A 1RH9A 2VO5A 1EGZA 2GFTA 3VIKA 2E3ZA 3D5HA 3WMSA 1ISXA 2XYLA 1VBRA 5D9MA 4LX4A 2WXDM 4UQCA 4ZENA 3W82A 1IZKA 1JI2A 3IJ7A 5CSYA 4W86A 4F66A 3SCPA 1OB0A 1WCGA 2D1ZA 4J3WA 2E0PA 1ZBWA 1OT2A 4Z2GA 2J7FA 3MMUA 3VNYA 2ZE0A 2WM0A 4QFUA 4X0NA 2E9BA 4W93A 1ITXA 4PTWA 1Q6FA 1C3FA 2G41A 5C70A 5A8QA 1BVZA 1MQQA 4Q22A 3CHEA 2XJ7A 3WUGA 2YKKA 4E8DA 3CZEA 3VD3A 1GCYA 1WDSA 1QNPA 4W84A 2JE8A 2YDSA 2JIWA 4AZCA 2O9TA 4AD2A 4LQ1A 4GZIA 3VPLA 1WNOA 1HJXA 4FK9A 4B16A 1KQYA 5KEZA 4U3AA 3AYRA 4Y7EA 2DT2A 1XSJA 1B9ZA 1JZ6A 1E1EA 2WBKA 2XM2A 3UCQA 1W1VA 1BG4A 4RL3A 3AIRA 5BXRA 1RD6A 1UA3A 2VZOA 3OGRA 3LMYA 1QI2A 1GQIA 4H2CA 1OGGA 1BYBA 3AHXA 3AMKA 2CKSA 1C8QA 4ZFMA 1NWUA 4PMUA 2W66A 1HKMA 3PZQA 2EPKX 1ZB5A 1WAWA 5TD4A 2YL8A 1UD2A 2HVMA 1V6WA 2X2YA 1KWGA 3HMCA 3AZRA 1LWHA 2EXOA 1OT1A 4NSBA 1B30A 3OLDA 5LA1A 5A94A 1G5AA 3I3EA 3WMCA 4DWSC 1UA7A 3VMOA 4F9JA 3SUVA 1GPFA 2EPOA 1QNOA 4QLLA 1NP2A 4UR9A 3WKZA 5EFFA 2WMJA 3WQ6A 2DH2A 2X09A 2G8ZA 3VGBA 2WMGA 2IXUA 4NI3A 3BAWA 1W9VA 1B0IA 1JYXA 2DGAA 2E9LA 3BAYA 1BQCA 1HF6A 2IXVA 1JL8A 3ZJ8A 4DM2A 2GJRA 3W27A 1WZAA 3CZKA 1ZL1A 3N13A 5JBDA 1GVYA 4W7UA 2AAAA 1E40A 2ZICA 3NSNA 4W5ZA 4GZJA 4L4PA 3W38A 1D3CA 1SMAA 4AD0A 4HOXA 5EMYA 1E3ZA 1TG7A 5A8OA 1BFNA 4TXEA 3ZO9A 2WVUA 4CD5A 2WANA 1W9XA 3O9NA 4UZUA 1NQ6A 3BAXA 3OLEA 3N9KA 1HN1A 2XVGA 1E5NA 1JNDA 1QVBA 1TA3A 1V02A 3WQVA 1XGZA 6CGTA 4UZSA 4CD7A 1EHNA 2ZUMA 2X05A 3BMVA 3WH5A 3U7VA 3KWXA 2PB1A 1MWOA 5DF0A 1GW1A 1O6IA 3L4YA 2ZUTA 2GVYA 1UD8A 1CLVA 4FLRA 1ISWA 3TOPA 3MUAA 1QBBA 1C7TA 4TTUA 1E6NA 3AS0A 5I0DA 3CPUA 2YDQA 2BY0A 3AS1A 1C90A 2EEXA 2BXZA 4M81A 3TTQA 4QLKA 1ODZA 2XIBA 1UR0A 3PHAA 4GXPA 3ZJ6A 2AOSA 3BGAA 1XSIA 1G9HA 1PJ9A 4AZGA 4W5UA 1VF8A 1ZBKA 4PTXA 2CITA 5E9AA 3UEQA 1GOOA 2WB5A 4MAZA 1WP6A 1M04A 2J25A 1P6WA 2C7FA 3AIUA 3GXFA 3UESA 3VX1A 2WVVA 3ZIZA 3PZUA 4W85A 5ABFB 1VRXA 1UG6A 4AMCA 1QHOA 1HJWA 1E56A 1C93A 1VEOA 3BAJA 1CGVA 3TTYA 3VIPA 2OSXA 2VC9A 1DTUA 1FH8A 1B3YA 3ALFA 4P7OA 2YL9A 1UQZA 4D6JA 2J8GA 3POCA 4LYRA 3UG5A 3BAIA 5FL1A 2Z1KA 1BF2A 2Y8KA 1VBUA 1GZJA 4TVUA 2OWWA 3PZTA 4AIEA 1ODUA 1OGBA 1HJSA 3ZR5A 3SCRA 1V6XA 4XUYA 1PIFA 2CYGA 1MQRA 2D0FA 2XWEA 4OOUA 4J27A 4AZ7A 5AYBA 1W3JA 4HU8A 5I5RA 1QI0A 2PBOA 1J12A 2V38A 2BS9A 1H4PA 1UZ4A 1NWTA 3CLWA 3T2OA 1EDQA 3K8KA 2ZIDA 3D3AA 2VJXA 1JYVA 3ZQ9A 1UWIA 4HMEA 2VRQA 1IV8A 3K1DA 3N04A 4QAWA 1XH2A 1VEPA 1R85A 5A6JA 1HKIA 3G6MA 2DT0A 4WJXA 4ZEPA 4AZ5A 7TAAA 2UWFA 1M03A 3FY1A 3L4ZA 3WDHA 1FH7A 3POHA 1E71M 1CNVA 3A4WA 3IJ8A 3VDHA 5DO8A 3THCA 3WD0A 2QLYA 3AISA 1ISVA 3UG4A 2ESCA 4QP0A 3LPGA 3U5YA 4B9YA 4RE2A 4PBGA 4P7LA 4CCDA 5CSUA 3FN9A 4J3TA 3SCUA 3U57A 3IJ9A 3CTTA 2O92A 3K8LA 8A3HA 2QF8A 3GH4A 2XSAA 1OBAA 3ZT7A 2UY5A 3ARZA 4KMQA 4BF7A 3VIMA 3AZSA 3KEHA 1QOXA 2J7BA 2VX7A 1ESWA 3L2MA 2YA1A 5IXEA 2D23A 3IAPA 2EPMX 1CBGA 1LWJA 1PPIA 3OZOA 3MO4A 1EA9C 2JF6A 2TAAA 3TTOA 1EOKA 2XVPA 2VX6A 4W88A 2D20A 1AQ0A 2WLYA 3QOKA 4TX8A 2WPGA 2GJXB 3KL5A 2CPUA 3SCQA 5A2AA 3WF1A 1CXEA 5GNYA 4ACZB 1NH6A 1LG1A 4LPCA 4AWEA 5HXMA 5I6SA 1UR9A 3VKKA 1JZ2A 4P7RA 4UQEA 3RO8A 4GPNA 1EQCA 4JKMA 1J0YA 1NARA 3WNPA 2DPEA 2XSBA 4D1IA 4AZIA 3GNRA 3GXDA 4DM1A 3CZLA 4DUXA 1FHDA 4Z2HA 3B9DA 2BY1A 1R8LA 3ZSTA 1QW8A 5ABEA 4CKQA 3SEPA 3B9AA 3QR3A 2XHYA 1I1XA 3WDJA 2XG9A 5A8PA 1E55A 3AMDA 3WD3A 1MYRA 1JD9A 7A3HA 2VRJA 3VD7A 2J7EA 4MB5A 4NF7A 2B31A 1LJYA 5CPTA 2ZX5A 5AC4A 5HOSA 5KZ6A 5CZKA 1ECEA 4CN1A 4XX6A 3VDAA 3W6MA 3ZJ7A 3AS3A 2WSKA 4W7VA 4MJ4A 1Q6EA 5AYIA 1QHPA 3T2QA 4D6CA 3UR8A 5ABHA 1GHRA 2PWFA 1PX3A 2DH3A 1G0CA 4YHGA 4MJ2A 3GBDA 1BLIA 2VRKA 5I79A 4TX6A 1LL4A 3AMLA 3MU7A 1V3KA 3RM4A 1XSKA 1CGWA 5CPQA 3WH6A 3PZOA 3SCOA 1US2A 1PAMA 1G01A 3GM8A 3MUZ1 4PTMA 4JFTA 1LQ0A 3EMQA 4OKDA 4JFVA 2CXGA 2ZOXA 4AIUA 5IFTA 3VOCA 2BNJA 3NSMA 3PTQA 2ZX9A 4H41A 1RP8A 1UR4A 2G3IA 3K4DA 1Q6GA 3WY1A 2BHUA 2WMIB 1W1PA 1GOQA 1ISYA 1E6PA 2DT1A 1XC6A 1V03A 3MUY1 3T2PA 3UERA 3RPMA 4YHEA 5DT5A 3WL0A 3W81A 3DHUA 3VGDA 5CXPA 3WNOA 1CXHA 4WKHA 1EDTA 2FH6A 2OWCA 4FLSA 3L4TA 2GDVA 3RDKA 4MB4A 4HP5A 3WFZA 3AROA 4UQAA 1TVNA 2JEPA 5M5DA 2ZUVA 4HMCA 4IM4A 1A3HA 1J0KA 1EH9A 3T0AA 3SCWA 2OSYA 3WDPP 1AQHA 1QW9A 1W9DM 3EDEA 4TTGA 3A3HA 1UWSA 4JKLA 2WZHA 4CU7A 1J0HA 3APGA 3AJ7A 1BYAA 3EDJA 2FGLA 4EK7A 1V3LA 1V6YA 3VM7A 3VGGA 2WNWA 1GJWA 1FP9A 9CGTA 1UOKA 1B3VA 1XH1A 3I3DA 1WDRA 3UR7A 1HJVA 2XVLA 3TP4A 4RE3A 5D9PA 3O6AA 2DSVA 2OLHA 5DMYA 4Q7NA 1KWKA 4BS0A 1KCLA 5BRPA 3IK2A 1VFFA 1UKQA 2WC3A 1QI4A 1GNXA 2V3EA 4ML4A 1GHSA 5F7UA 1ZBVA 5BCAA 1V3HA 1JZ5A 4U5KA 1UKPA 1TUXA 3CZ8A 4Z2KA 3WD4A 4HA1A 5FL0A 3AHZA 1K9TA 3UETA 1VFMA 4JCMA 4XZWA 8CGTA 3WUEA 4CD8A 3BCDA 1HVQA 3WELA 2DIJA 4MTVA 3THDA 3BCFA 2YIHA 5A6SA 4MB3A 2VI0A 3K8MA 4H7VA 3ZR6A 4IPLA 1AQMA 3K46A 1WDPA 2EPLX 4UFKA 1CGXA 5GPRA 1JD7A 1FFRA 3TA9A 3I3BA 1MQPA 4OBSA 3VDCA 4D6FA 3AXHA 5JBFA 1CGTA 2QV4A 4FLOA 1XH0A 5LA2A 1DWJM 2BHZA 3ZOAA 4PCTA 1GONA 5D9NA 1E70M 5ABGA 1KR0A 2DEPA 1J10A 4IISA 4D6GA 2VMFA 1W3HA 1R7AA 4P8UA 3BSGA 3EDDA 2J47A 3OLIA 2CESA 1UHVA 1E4LA 3AMCA 1Q6DA 5A1AA 1H11A 1L0PA 1J0JA 1H5VA 2FDMA 2W62A 1EQPA 3OZPA 1V08A 3PTKA 3OA5A 2V3FA 3WEOA 1UH2A 2WAGA 3L4UA 2YOCA 4URIA 2X0YA 2FHBA 3WQ5A 2WZEA 2D0HA 3DYOA 4DWSB 4WSJA 2PWEA 2J62A 1DWFM 5E6YA 4LYPA 4KGJA 3TONA 2DSUA 4OUEA 3WDRA 3T08A 3AXXA 5EBAA 1V0MA 2WYSA 4AD4A 1Q4NX 1XV8A 1ZJAA 1MVYA 4H8VA 2Y4SA 1W2PA 1E0VA 3WF2A 1LL6A 1HKJA 1PIGA 3CO4A 4UNIA 2CBUA 3ZM8A 5DFAA 4J3UA 4JFSA 3MSDA 5A2BA 3FAXA 1E6XM 1AMYA 5A6BA 1RPKA 4PSPA 1KGWA 1B90A 3M7SA 1QI3A 4FMVA 1GOWA 1K9FA 2UY3A 5DT7A 1NOFA 2O9OA 2YA0A 2NW0A 2J79A 4X0VA 1PX4A 1WO2A 4JCLA 4GQRA 3N15A 1TFVA 5FCZA 1V0KA 3OGSA 4J7RA 4M1RA 5D9OA 1DP0A 2UY2A 3ECQA 7CGTA 1HX0A 1UR1A 1HP5A 3AICA 2FHCA 1C91A 2YBUA 2J78A 3KE0A 3AFBA 1F4HA 4U2YA 2ZUSA 2EO7A 1EHAA 3WDQA 2YLAA 3EYPA 4PCSA 4ZE4A 3SCNA 2XIIA 2A3CA 1CXLA 3GH7A 5A6MA 3DECA 4KWUA 3G6LA 1CWYA 1E1FA 4UTFA 1XD0A 3PZIA 2W92A 3NUKA 1D2KA 3NYDA 3RMEA 4CD6A 2CCRA 2WHLA 3FAWA 3W28A 4UQ9A 2VZTA 2YJQA 2Z1SA 2MANA 1VJSA 1ZU8A 3VUPA 3KL0A 3BLPX 4MDPA 4NZCA 4CCEA 2JIEA 2PWGA 3MMDA 3VD9A 2WMFA 3VNZA 5HPOA 1V0LA 3WNKA 1CPUA 3LPFA 1FOBA 3PZ9A 4AD3A 3VIIA 4H8UA 2XPKA 3CZJA 1G94A 3QHMA 1OIMA 1O7AA 5GNXA 4BA0A 3BSHA 5CLWA 3L4VA 3N17A 4CU6A 1CGYA 3VU2A 4DWSD 1A47A 3ARPA 2BHYA 2GDUA 2J7HA 1W3LA 4JFWA 4X9YA 3WDIA 1C8XA 2W67A 5A8NA 1IZJA 1KB3A 4PYSA 3OLGA 1GORA 1VENA 1W1TA 4M29A 4AC1X 4CCCA 1Q6CA 1KCKA 1QPKA 1K6AA 2PWDA 4EE9A 4P8VA 2ZXBA 2QPSA 4TVDA 4EKJA 4R27A 4F8XA 4FF5A 1FP8A 3F5KA 3WD1A 1EO5A 2FH8A 1KGXA 2CBJA 2CETA 1HXJA 3ZT6A 3A47A 1HVXA 3VTRA 5ECUA 3VX0A 1EOMA 4WSKA 2WK2A 3WNMA 2CHOA 2WC4A 4GINA 1NWSA 1J0IA 1H41A 1JYNA 3FHAA 1Y7VA 4OZOA 4CVUA 4ZE5A 3DYPA 4M80A 3EMZA 2YL6A 2BV9A 2GJPA 5CJ5A 2GK1B 4JL1A 4ZXOA 1VAHA 1VIWA 1J11A 1BTCA 1JF6A 1U30A 1KXVA 4CU8A 1KXQA 4AW7A 3ARXA 1JAKA 4D71A 4CD4A 2QMJA 2WMHA 2VT0A 2C0HA 1TMQA 3MMWA 4HZ8A 2WWDA 2ZUUA 3F5LA 4JIEA 1E6QM 3CHFA 5E0FA 1GJUA 3WEMA 4KH2A 2ZUWA 3GH5A 5ABFA 3W37A 4V28A 3W26A 3WD2A 1CECA 2ZX7A 5CLTA 1CIUA 2VQUA 1JI1A 2EBNA 6TAAA 3CUJA 5I3DA 3MUIA 3WENA 5AY7A 2VVSA 1K9EA 2QPUA 2YLLA 4JZ5A 2VL4A 1SMDA 4PMDA 5A6LA 1JAEA 3PZVA 4DUWA 3J7HA 1FH9A 3VO0A 3ZSSA 3BH4A 1CDGA 2W5FA 3WIJA 2J77A 3ARSA 1UWRA 2F61A 1SYTA 5CGTA 1B2YA 2W63A 2ZX6A 4MNLA 1KR1A 4AISA 4PSRA 1KXHA 1JXKA 5BXSA 2W4XA 2GUYA 1OM0A 4U5IA 5JIWA 4KRUA 2WCSA 4BCEA 4WKFA 1ITCA 1MW1A 3MKKA 4TVCA 5JBEA 4UOJA 1E3XA 1V6UA 2VTFA 4AEFA 5M03A 2G4FA 1CZ1A 3MS8A 2WCGA 1DEDA 2JALA 2X0HA 4W8LA 2DT3A 3NJ3A 1B31A 4AY1A 5CPSA 4AZCB 3FW6A 3WEZA 3AI0A 4JKKA 2D3LA 3OGVA 1BG9A 2WBGA 4C7GA 2FHFA 2J75A 2VZUA 3K4AA 4PMRA 3CMGA 1JYWA 4LGXA 3VGFA 1OD8A 5LA0A 1GOMA 4FLQA 1C8YA 3GDBA 3VIFA 2F8QA 3CBWA 1KQZA 3ARUA 3BC9A 2XWDA 1WZKA 3WBEA 3SCVA 5FKYA 4WK9A 5BYWA 1H49A 1TZ7A 1GQJA 1QNRA 1J0ZA 5IDIA 1XRVA 3CHDA 1OIFA 4KRTA 3W29A 3W6LA 3RIKA 1WZLA 4D6DA 1CLXA 1UZ1A 2WHJA 4PN2A 1JFHA 3W4RA 1CXKA 2C8NA 2RGLA 4HPGA 1XHGA 4OBRA 2PC8A 3VM5A 3W24A 1JZ7A 4UFIA 2BY2A 2E9MA 3EDKA 4BZYA 4PUDA 1DHKA 3BMWA 2G3MA 4AZHA 1EXPA 5BRQA 2VUYA 4N0RA 1HJUA 3GZAA 3ZT5A 5A8MA 5M17A 3GTNA 4ATDA 1FHLA 1UD3A 3EBVA 1EDGA 5E70A 3W53A 3U7BA 1H0IA 2GJXA 4PMQA 3TTSA 1QBAA 1DWIM 1H3GA 4S3JA 1M01A 4V27A 4GO8A 4ACZA 1H2JA 5BROA 2YDRA 5C71A 4MNJA 3WNNA 1VJZA 3M07A 3VDBA 4MDOA 5DEZA 1DWAM 5HNNA 4PRWA 2XFRA 3AS2A 4HTYA 2X8RA 4EANA 1NM9A 1WZMA 3IAQA 3ARYA 1JFXA 3IANA 1TE1A 3HU7A 2A3EA 1RP9A 3N11A 2V3DA 3QHNA 4TOQA 3WUFA 2HISA 1BYDA 2BFGA 3WL1A 2XTKA 2VR4A 3GBEA 2VNCA 3AXIA 2WWCA 4PMZA 2AMGA 2WVSA 3AIEA 1HKKA 4M8UA 3PBGA 1XCXA 1TA3B 3AIVA 5E0CA 4JL2A 1JDDA 3VGEA 4K68A 1Z32X 2OWXA 1R87A 3VVGA 3N1AA 4LYQA 1M53A 2Y8VA 3JUGA 2WSPA 3NDYA 4CVWA 3WFLA 3AIBA 1OD0A 1V3IA 1CGUA 1VFOA 4UFJA 1SFSA 1FA2A 1I1WA 3VMPA 3VD4A 1WB0A 1BYCA 5BWFA 3VIJA 3ARWA 2V3GA 1UD4A 4MADA 4GQQA 3WUBA 2J4GA 3MSGA 2CIPA 5A3HA 1UUQA 3B9EA 3VIGA 1US3A 1BGGA 4YPJA 1WDQA 1JGIA 2E4TA 2WMKA 3S2CA 3HN3A 2XVKA 4UQDA 4UOQA 5HDRA 4C7DA 3NSXA 3B8SA 5CQ1A 3S6TA 4IUGA 3GXIA 3T0BA 1GQLA 1KGUA 1ZS2A 2JEQA 2FGZA 3GNPA 1OWQA 3NCOA 4MPKA 4PMYA 1LL7A 1MFVA 1NOUA 1I75A 1X6NA 1F4AA 3II1A 2Y24A 3ARVA 5D4YA 1E6SM 1W2VA 2D24A 2DSWA 2WVVB 3F4VA 1JF5A 4W8AA 3SURA 2XFFA 2F2HA 1M7XA 4D6EA 2D2OA 4UCFA 1H09A 2A3AA 1E0XA 3GXMA 4H04A 1UH4A 1NP0A 2XGBA 3ARTA 4P8WA 4C7FA 4HPHA 2WMIA 3VILA 4E8CA 2VX4A 2A3BA 2DSZA 1BAGA 2A3HA 2EPNA 2JFEX 2W91A 1QNSA 1W32A 4M82A 1UWTA 3AHYA 1BSIA 3OBAA 1HL8A 1WE5A 1V3MA 1EIBA 3WNLA 4ATLA 4YN5A 2O9PA 4Z2IA 2J7CA 1E6RA 3GNOA 1FFQA 4ZXLA 3L2LA 2E8YA 3OB8A 5IFPA 1JNEA 1LLOA 2VQTA 4E2OA 3T09A 1C92A 1J9YA 3AIQA 1U2YA 2WKLA 3FXYA 5A6AA 2ZX8A 3RJXA 1PEZA 3SCTA 3LPOA 2D0GA 2RGMA 3EMCA 3KL3A 5GQBA 3VGHA 2CHNA 2WC7A 4CN6A 2VOTA 3RILA 1W91A 1J18A 4MNKA 2ZXDA 3UG3A 1CXFA 1GQKA 4W87A 2IUZA 1UKTA 1MXGA 4W7WA 3AQUA 3AIWA 3MV11 2BVYA 2OSWA 4B3KA 1W1YA 1S46A 3PTMA 3EDFA 2XFYA 4BQ5A 1XD1A 2VCAA 1UD5A 2WCAA 1E15A 1UQYA 3CMJA 4J3XA 2DIEA 1KBKA 3ARRA 5IHSA 1KBBA 4AYSA 3L4XA 5EB8A 4QCFA 2BVTA 3WF0A 5D8ZA 6A3HA 3VIHA 3WQ4A 3CH9A 1V6VA 4AXNA 4UOZA 3MANA 1J01A 1JG9A 4DUVA 2V5DA 3CUIA 4S3KA 5A6BD 2ZWYA 3M6DA 4UFMA 5IHRA 3SUUA 3DHPA 2CBVA 3CUHA 4HMDA 4P7QA 2ZXQA 2EJ1A 2G3JA 2J7GA 4IPNB 4A3HA 1OCQA 5A6KA 5BXTA 3FHQA 1G1YA 3N18A 3T0DA 3WSUA 5GNZA 4OOZA 1E0WA 4XV0A 2XM1A 1PZ2A 3RJYA 4U31A 2QMKA 1HP4A 1NOWA 1EO7A 1R86A 3A4AA 4HZ6A 2CNCA 3ZJKA 1ZJBA 1H0GA 1WKYA 1W9UA 5I78A 4MB1A 3RCNA 3W25A 1OSEA 4A4AA 1DWHM 1H1NA 2VVNA 1X1NA 1HJQA 4CUCA 5FIPA 4PMXA 3VIOA 3WH9A 3OIHA 3BLKA 4UQBA 3NIYA 1PX8A 1CEOA 4E4PA 1JDCA 4B3LA 1VEMA 3DYMA 2Q8XA 1LG2A 1L8NA 1YHTA 3AHVA 2CKRA 2NSXA 2VURA 1MW3A 4PUEA 3NDZA 1B3ZA 3VD5A 4NRRA 1QNQA 2WLZA 1XYZA 1OGSA 1UH3A 2WVTA 2NT0A 3AHTA 4QLJA 2PF0A 4HZ7A 1CTNA 5EFDA 1GVIA 1JXJA 2VX5A 4KGLA 2XGIA 4D72A 2OYMA 4DWSA 1V3JA 4EAMA 4H8HA 4HU0A 3WQWA 2WHMA 1JZ8A 2E8ZA 4OJYA 3E1F1 5I2UA 1E72M 1E4MM 1GUVA 1X6LA 2O9RA 1YQ2A 4Z2JA 4U3CA 1E4IA 4M56A 4PEEA 1BVNP 3MV01 4UFHA 4U33A 5M3WA 3AZTA 4GZEA 4HOZA 4AD1A 2V5CA 5AC5A 1OINA 4V2XA 4GO9A 2Y2WA 4PMVA 1XYFA 1KFWA 1KXTA 1W3KA 4AZBA 3VMNA 1B3WA 4L4OA 2NT1A 1CENA 5CGMA 1ZBCA 2WZIA 1HT6A 4ACYA 1TCMA 2VZSA 4B15A 4P7NA 3WMBA 4R5EA 4D1JA 2D3NA 1QI5A 2QHAA 1TR1A 4AD5A 1AVAA 5LYRA 5HPCA 4WKAA 1W9BM 1K9DA 1E73M 4GI6A 4LXFA 5A2CA 2ZWZA 1E9LA 2WKGA 4W8BA 3ALGA 4GI9A 4JHZA 4W89A 2XUCA 4A3YA 1WPCA 1MFUA 1NWRA 3SUSA 1E5JA 4NRSA 4B9ZA 1U33A 1V02E 4PTVA 4GI8A 1HIZA 3WF4A 4JAWA 1GOKA 4J3VA 2BXYA 3AMGA 3FNDA 5BXPA 2X1IA 3QHOA 1BGAA 4XZBA 1LF1A 5D8WA 1PBGA 2WW5A 3BAKA 3KZSA 1CYGA 1C7SA 1D7FA 5E09A 5JIPA 3QGVA 1JZ4A 1IT0A 1UKOA 3PZNA 1DWGM 4PMOA 3WN6A 4HOWA 2W61A 4JFUA 4JHOA 3U5UA 4CGTA 1MW2A 1UR2A 2CERA 4TUFA 2PI6A 5C8BB 2PWHA 4F9DA 2E40A 4OIFA 1BPLB 1E4NA 1N82A 1XCWA 1V0NA 2YBTA 2YA2A 4U2ZA 3WH7A 2VZVA 4D6IA 2JF7A 4MAVA 2WHKA 1B3XA 1UR8A 2D22A 2YL5A 5FD0A 2CBIA 3RM9A 1W9PA 1JZ3A 4RE4A 2DQXA 3AOFA 3WF3A 1B1YA 3CHCA 5A69A
chains in the Genus database with same CATH superfamily
1PCWA 2DSKA 4F79A 5IBXA 8XIMA 3BCJA 3G1VA 4BQ4A 5DANA 4DLFA 2F2KA 4IQJA 2UY4A 1Q85A 4LSBA 3M46A 3LHUA 4US5A 4UFLA 4O17A 4A2SA 3R89A 4BQ2A 4XB3A 4HHHA 3MP3A 1RJPA 4XD4A 4N9EA 5CG0A 3C2YA 2BVDA 2PODA 3F5JA 5LGXA 3CUFA 2OYLA 3IRSA 3S6OA 4DJFD 2ZUNA 3LBOA 2J8FA 1V8EA 1XLIA 2BVWA 3N12A 3W1QA 1JDAA 2G3NA 3T9PA 3TSBA 2POZA 1ISZA 4XVDA 4ADSA 1KTCA 2ZZ5A 4B5NA 5K7JA 1VFHA 3SUTA 1IEXA 1MXDA 3IUIA 2OYKA 1K6WA 1XPGA 5GJNA 2BY3A 1EX5A 1UKSA 3SCSA 5I23A 2QDEA 2CEQA 5AHMA 1CXIA 1XIJA 1WAUA 2ACSA 1X8CA 3GG7A 3SRFA 4S3AA 3B06A 1FHUA 1TTQA 3ABQA 2Q3OA 3VC5A 4J28A 2Z6JA 1HL9A 1U5HA 3MVTA 3CIVA 1FDZA 4ERGA 3ENLA 5GJPA 1RH9A 3EKLA 3CASA 5DXXA 3LYEA 4UC5A 5IOBA 2E3ZA 3WMSA 2XIQA 4HHPA 4MUPA 4YVVA 5D9MA 3H7RA 1IZKA 1JI2A 1SO5A 4GY7A 4W86A 1SZGA 3BPWA 4AC7C 1YBQA 2JKPA 4BI6A 5I03A 1OB0A 4G5DA 1WCGA 2D1ZA 4J3WA 2E0PA 3VZYA 4ZB2A 2E67A 4N9CA 4R7WA 5KSWA 3GTIA 2ZE0A 3O7UA 4X0NA 5DMNA 3CAQA 5C70A 2C19A 4PFMA 1ZPTA 1MQQA 4KESA 1KFEA 4IJRA 4Q4QA 3UNDA 2XJ7A 3LENA 3WUGA 1A4MA 5LIYX 4E8DA 3CZEA 1GCYA 4JIRA 1WDSA 1QNPA 2PZ0A 1MEHA 3B0UX 4ICNA 2YDSA 4FI4A 2JIWA 3U2ZA 4AZCA 3ISIX 3VA8A 1HJXA 1Z44A 1PS9A 2VFHA 3QYSA 3CT2A 5H8UA 1W5MA 1VJIA 1M7PA 1B9ZA 3IRDA 1E1EA 2XM2A 3UCQA 3KXQA 1NFGA 2YXGA 3F03K 1T5AA 1FCQA 1FWAC 4ZFMA 4DBDA 4K8EA 4FR6A 1WAWA 4IIFA 3TSDA 4PCFA 3TYCA 3R79A 3HMCA 1ITUA 1LWHA 4NSBA 4UTTC 1B30A 2Z7GA 1L2UA 5LA1A 4C6JA 4K37A 1PYMA 4C65A 3I3EA 1HW6A 3P81A 2BLEA 2L5HA 4Q8WA 3SUVA 1EUNA 1NELA 1X1ZA 2EPOA 1QNOA 1TELA 2PDHA 4IPPA 2CHRA 3WQEA 3K5XA 1X98A 3JR2A 1HTIA 2IXUA 3R94A 4U10A 1MMFA 2G3FA 3HG3A 1HF6A 2IXVA 4HVXA 3ZJ8A 4GNJA 3WZ0E 1GVFA 1K4HA 3OW1A 1PZ1A 3QR1A 5JBDA 1K3UA 1S2WA 2AAAA 3MY9A 2ZICA 3R58A 3PWAA 1D3CA 1R2RA 4AD0A 1O60A 1XRFA 3M43A 4B5UA 4AWSA 2Y6ZA 4CD5A 3G24A 3GG1A 3S1UA 2WNZA 2PPGA 3QY6A 4OT7A 3SIZA 2RUSA 5CEWA 3W70A 1H51A 1XRSA 3HPSA 4MYXA 2IQTA 3BMVA 4C6QA 3HM7A 2E1WA 4UB9A 1GW1A 2DIKA 1AG1O 1O6IA 4AY7A 4L9YA 3UY8A 3RR4A 2PE4A 5A5WA 3TOPA 7REQA 1AD1A 1PSCA 4Q4OA 1AW2A 2YDQA 1POJA 5DMLA 2QCCA 1POKA 3ITTA 5HNTA 4QNWA 1KRMA 1L6GA 1UR0A 4J9JA 2AOSA 1XSIA 1IEWA 1G9HA 1VF8A 1EJ7L 2CITA 4LRTA 4L65A 3CNYA 1QXLA 1WP6A 4HTBA 1IR1A 3THQA 2C7FA 3AIUA 3VX1A 1HGYA 2FJKA 2QCDB 4LF1A 4JTUA 1UG6A 4QIUA 4AMCA 4A22A 1XG4A 4KCTA 4XAPA 1VEOA 3WK0A 3L5MA 1JR1A 3R4IA 3B3DA 1RVGA 3L7RA 3S2JA 1OCJA 2J8GA 4F0HA 1QTWA 3POCA 4LYRA 3TROA 5FL1A 2Y8KA 4TVUA 4I7WA 1R9YA 2PTZA 1JUBA 2V8ZA 3SCRA 3CL7A 1PIFA 1GQNA 3N2XA 2REQB 3DHDA 3WJSA 4KRZA 2D0FA 4DLMA 2XWEA 4QJ5B 2OZ8A 3KS6A 2ADAA 4UR8A 3T07A 5ABTA 3S1VA 2V38A 2DZTA 3WLMA 1NWTA 3M0LA 4Q7BA 3EX6A 3BANA 2VJXA 1UJPA 1PO9A 5BNKA 4UTHA 3WCZA 1S5TA 4QAWA 1XH2A 1DJZA 3G6MA 3DDMA 1MDLA 2DT0A 4AZ5A 5J8LA 1W1ZA 1LORA 3FY1A 3A24A 3H7UA 3W7EA 3O1NA 1BVWA 4H8NA 3THCA 2QLYA 2HVNA 1UOZA 3LSCA 4WVXA 3PJTA 4DELA 2ESCA 2DUAA 3PFMA 4BEUA 3UZ5A 4RDYA 4RE2A 4PBGA 5F2MA 3BICA 4MJMA 2VD9A 3T0TA 1AJZA 8A3HA 1HO1A 3CV7A 3NQ7A 1OBAA 2RAGA 1ALDA 2UY5A 3LERA 3PB0A 4GZ7A 4ZB5A 3KRSA 3ITOA 5BMXA 3C2RA 4EACA 1QOXA 2J7BA 4WJ8A 2VX7A 3L2MA 2YA1A 1GK8A 3LTSA 2VWTA 5K9CA 2PFHA 3VNIA 1CBGA 1FWEC 1JRBA 1LWJA 4PA8A 4JTTA 3RLGA 1J93A 4XQ6A 4CNOA 3MO4A 4YL2A 4IIEA 1TPVA 1P43A 2XVPA 2VX6A 2D20A 3BOLA 1BXNA 2NUWA 5BW6A 2WPGA 2PGFA 1TJ2A 4RW3A 2FZ9A 3Q37A 3R5EA 2PF8A 5D37A 3S9IA 3CL6A 5I6SA 1RQEA 2BOGX 1UR9A 3CTLA 3RO8A 4GPNA 1F6YA 4JKMA 1J0YA 3D46A 4MKNA 2FVLA 2A3LA 5CBBA 2HBVA 3W7RA 1JCTA 2VXNA 4M7TA 3A5VA 4C5ZA 4LBSA 5I09A 3B9DA 2RFGA 3MUXA 1M6JA 4NX0A 2XU2A 3SEPA 3B9AA 3S83A 2GLKA 2XG9A 1UMLA 3AMDA 2AQVA 1MYRA 3FYOA 4XZHA 2X1UA 3UNTA 4YWSA 1DIDA 5C2GA 3VD7A 2OKTA 3GAKA 3KVKA 3TW6A 4GUHA 4IFKB 3VDAA 4UTWC 1XL9A 3ZJ7A 3ABOA 1R9ZA 4IX2A 4MG4A 2RDWA 2FYMA 4L56A 1O95A 2Q71A 1V7AA 3EX2A 2OKOA 1RR2A 2BODX 2FJUB 3MI2A 4YHGA 1LCOA 3GBDA 1YTDA 3SW6A 1AMKA 1G6CA 1V3KA 3RM4A 4AMAA 1B57A 3NPVA 2DVXA 1PUDA 3EX3A 3LCLA 1K77A 3MUZ1 4PTMA 3FCPA 1ZCCA 2PWVA 4JFVA 2CXGA 1V7YA 2ZRYA 4UMCA 4QG9A 4LNCA 2ZX9A 4LUIA 1DQXA 3T40A 2R1PA 2G3IA 5B80A 2BHUA 4LS2A 3NPXA 1V4YA 1LBFA 4MSSA 2DUXA 3LD5A 4D2JA 2SFPA 1W1PA 1P48A 2Z1VA 1E6PA 3NXLA 1XC6A 1V03A 2YZRA 5CZ0A 3CWNA 3MI6A 1NVMA 3TK7A 3B0YA 5HQEA 3W81A 5CXPA 4C6EA 4Q8OA 4ZVJA 1S3HA 3PBUA 3BLFA 4FLSA 3GR4A 3AROA 1W3NA 1HFBA 1U1JA 2I57A 4R85A 4G7EB 2JEPA 2VEKA 2ZUVA 4GBDA 4Q4MA 4HMCA 4JYDA 1XXXA 1A3HA 2X16A 3T0AA 1CW2A 4S23A 2OSYA 5HWJA 1QW9A 3EDEA 3RX3A 2GUBA 3CHVA 1H7PA 4ZOEA 5G1MA 3APGA 4N4PA 3RCYA 5EY5A 1BYAA 4RXFA 2NQHA 3GXTA 4WXZA 2VHLA 3S4TA 4CQCA 4I8YA 4O12A 3VFCA 2ZRVA 3P8JA 1UOKA 4ZA0A 5JXQA 5FEZA 3I3DA 1WDRA 3RU8X 3UR7A 1HKWA 3O8AA 3E02A 3DFNA 2IKGA 2XVLA 3LBMA 4C6OA 2DSVA 1J2WA 4PC8A 4F2UA 4BS0A 5BRPA 4N6FA 1JCLA 3S46A 1N55A 4X60A 5EMMA 5EPDA 4KIEA 3W75A 4JTJA 3A4JA 2D73A 4QDWA 3KTXA 5H8MA 5G1TA 3V75A 3HOJA 1TUXA 1X38A 1VFMA 8CGTA 1PKLA 2FVMA 4CD8A 4O19A 3BCDA 3WELA 2DIJA 4P61A 3F4WA 1KFCA 3BCFA 2YIHA 5A6SA 3EA3A 4MB3A 2VI0A 3ZR6A 5F2LA 1KTNA 1TWIA 4O0QA 1AQMA 3K46A 5J5RA 1QK2A 3I3BA 2PLCA 4FLOA 2BHZA 4K6AA 3RG6A 1E70M 1BKHA 2IKJA 1S3TC 3HPAA 1TSIA 3STCA 2ZZ4A 4D6GA 5FJUA 1Q6LA 2VEPA 1S1RA 1R7AA 4P8UA 3BSGA 2J47A 4N4QA 1GKPA 1L0PA 2FDMA 3G8EA 4DO5A 2D2HA 3OZPA 2O0TA 4QEEA 3OA5A 2V3FA 3FA5A 3WEOA 4WXYA 2WAGA 5HK4A 2X0YA 2EG8A 3WQ5A 3SY1A 3S6DA 4AHQA 5MHBA 1BSLA 3FVMA 2KZHA 3ZWTA 3GUWA 4WSJA 2PWEA 4D8LA 1DWFM 5E6YA 4KGJA 1F6PA 3PBWA 3BK0A 3LNMA 3O6DA 4ZTXA 5C0QA 1DJQA 1ZZMA 2Y4SA 1HKJA 1VCFA 2WZTA 3HGOA 2NUYA 3NA8A 1D7KA 4J3UA 1RJQA 2V5BA 5DN1A 5A2BA 3FAXA 1RZMA 5A6BA 1NSJA 1RPKA 2PC4A 2ZVIA 1XLAA 3CMFA 1H7XA 4Z1BA 1EWEA 1W3IA 1IR2A 8XIAA 1TWZA 2YA0A 2J79A 4JX5A 5EGRA 1JPIA 3BO9A 3G1FA 1TFVA 4J7RA 4XZNX 1Q8AA 1X8FA 4FNUA 3CPGA 3GVRA 4IH3A 3IV3A 4H2HA 3RPDA 5CH9A 4PRTA 3P8IA 1P0DA 5C6MA 1EHAA 2YLAA 4PCSA 3XIMA 4MPQA 3QBUA 3SCNA 4B2DA 3HIJA 5A6MA 3DECA 2VELA 1CWYA 1MUCA 1LM1A 4UTFA 2Z1WA 4ZQOA 1XD0A 3IUDA 3D0CA 4BEQA 3RMEA 1AFSA 1XLGA 4ADUA 4MKSA 1DTNA 4LT9A 2Q01A 2EKCA 2YGYA 4JDYA 5TIMA 1XLKA 4KIRA 2VZTA 3LCGA 5U7SA 3UA3A 2MANA 2PDFA 4IGHA 1TKKA 2R24A 2IMRA 4WDTA 3W1LA 3KL0A 2ALDA 2R14A 4GA8A 4MDPA 2V81A 2IQDA 3LZ5A 4X2PA 3MMDA 3GTXA 4B5VA 3BJSA 4EXBA 3MZNA 2ZZ1A 1SSGA 1FOBA 2Q6ZA 2H8ZA 3VIIA 3UZWA 1ME7A 5CLWA 5JH2A 3N17A 2WQPA 4IOTA 4QSFA 4DZIA 1LUCB 3ARPA 4L61A 1W3LA 1MEWA 5A8NA 1KM3A 1UZDA 1M9HA 3N9SA 1KCKA 2PWDA 3OOQA 1RA5A 4DNHA 4O0ZA 1H60A 3HGRA 1HXJA 3A47A 3PG8A 2VP8A 1XW8A 4HYRA 4WSKA 2WK2A 2XZ7A 3AYTA 2CHOA 4GINA 1NWSA 3FHAA 4NIRA 3P7YA 1C9WA 4Y9NA 4CVUA 3F2BA 3G0UA 3EMZA 3QMTA 2GJPA 1VAHA 3UWQA 1O4UA 2PDWA 1DIOA 1S1PA 4CU8A 3ARXA 1JAKA 1DJYA 4D71A 2QMJA 3F5LA 1EPXA 4JIEA 3NNTA 4JN6A 3A12A 3ICJA 2QCDA 2PLKA 1KFLA 1PTAA 2YZ5A 3WEMA 3UPWA 2P0IA 2QGHA 4V15A 4IHCA 2QDHA 3MB9A 1CECA 1MRQA 1WV2A 1CIUA 2VQUA 3ANYA 4WR3A 3RX2A 3MUIA 3O3RA 2FTPA 4XO7A 2EKGA 5ECVA 4MYAA 1X39A 2D2JA 5CKSA 2VL4A 3IIXA 3O15A 1W6TA 5A6LA 1EJUC 1Q7QA 3PZVA 3SO7A 3BH4A 4XVEA 2RH9A 4H7ZA 2J77A 2REQA 3M5YA 1SYTA 5CGTA 4C60A 5BU6A 4BHYA 1JXKA 2W4XA 4AQLA 4H9MA 3ATZA 1I2OA 3NL2A 1ITCA 4UOJA 1V6UA 4FNSA 3NAVA 1YNPA 4JY8A 3EPNA 1FXPA 1QASA 1A5KC 1EZWA 3MS8A 3FSTA 1DEDA 2JALA 4IIHA 1QWGA 4M19A 2Y63A 3TWAA 4US5D 1PKYA 1K8CA 3WQOA 4O8RA 1J8VA 4MVAA 4ZZ9A 1YADA 5G5IA 1JYWA 3E6EA 3VGFA 1OD8A 1ZGDA 1GOMA 4RXGA 1C8YA 3GDBA 2A4AA 2QR6A 1KQZA 3WLSA 1OFOA 3NGFA 1EKOA 1YLVA 5CG7A 1XC4A 1N8IA 1OIFA 1AZ2A 5I06A 1F61A 2WJEA 4K36A 1VH7A 4S38A 4HNNA 4WDXA 2PCQA 2H9AB 2NLYA 2BY2A 2ATSA 3G18A 3W7MA 4L7ZA 1DHKA 5AFDA 5I3IA 2VUYA 4O1BA 1H61A 5A8MA 5M17A 2OQHA 3GTNA 1NDWA 4MZ1A 4QEHA 1UD3A 3EEZA 1EDGA 1TWDA 2GVLA 5DLCA 1GVOA 1XIGA 3TTSA 2X1SA 1H3GA 1M01A 2IPWA 5AZ0A 1H2JA 3FKRA 1M7OA 5C71A 5AVNA 5T9CE 3WNNA 3EA1A 1JEZA 5HNNA 2FTYA 2XFRA 2WV8A 4EANA 2J8TA 2FZNA 4A8NA 1WZMA 4JTLA 2ICSA 3I4KA 4HPNA 4AX6A 3W23A 2V3DA 1V79A 3DG3A 3FX4A 3WUFA 3WL1A 4Q7IA 1SO4A 1KV8A 4HNLA 1A80A 3C2OA 3RLHA 3GVQA 1UC5A 4PMZA 5CZTA 4NYYA 4EF9A 3FYYA 3MCNA 4EWND 3S9ZA 1XCXA 2QJGA 2VFFA 3ITCA 3VGEA 2NWRA 1OFPA 3VVGA 3N1AA 4C6NA 3NDYA 4UCGA 4UMBA 1REQB 3VNDA 3QGAC 4UFJA 1SFSA 4IFKA 1FA2A 4GYPA 5B7ZA 3VIJA 4KWVA 1VZWA 3C2VA 4MADA 4C90A 2GGEA 3LCFA 2XH0A 2VDHA 1EEPA 1F73A 4RE0A 3B9EA 4IT1A 3OVQA 1M65A 3BZJA 3VOFA 4KWOA 4O0KA 1GYMA 2FPTA 4JNYA 2FKPA 3HN3A 4UQDA 5HDRA 4C7DA 4Y8FA 3KFTA 1XKYA 5HR7A 3TJ4A 1JCXA 4FB7A 3EZ4A 1A0EA 1IEIA 1MZHA 5HQMA 2FGZA 3NCOA 3OJGA 2PDQA 4E4FA 2PUZA 1E6SM 1W2VA 2D24A 2DSWA 2E6FA 3LRKA 2WVVB 3F4VA 3MP4A 3E0VA 3JW7A 4RX0A 1EBHA 4I7VA 1H09A 4KCVA 3G1YA 1H5YA 3H2CA 6TIMA 3DG7A 4GIRA 2DSZA 1BAGA 1FKWA 3OYXA 2W91A 4DJEC 3P0WA 3JZEA 3RFAA 1W32A 4M82A 1UWTA 4KEZA 5KMYA 1BSIA 1WE5A 4FNRA 5C5YA 3U0HA 1E6RA 1AJ0A 3STEA 4I9AA 1S2TA 2V6AA 1DE5A 1I2QA 1SJAA 3CQJA 3UJSA 4RZ6A 3AIQA 5A6AA 3H2FA 3RJXA 4WD0A 4G7EA 4KPLA 2D0GA 1R6WA 2E28A 3KL3A 3GLCA 1MNSA 1J18A 2ZXDA 3UG3A 1GQKA 1UKTA 4NZJA 2CZVA 4AHOA 2VC7A 4EAYA 5XIMA 4NI8A 1TTJA 2XINA 5FACA 3RNDA 1XUZA 4IG2B 2XFYA 4BQ5A 3TLQA 4AY8A 3A3WA 1DV7A 3CMJA 2DIEA 3TNOA 4PUUA 2ZRZA 3Q94A 3KTCA 5EA9A 5EB8A 3VCRA 2F6XA 1VCVA 1EJRC 1KFJA 1F5ZA 2G37A 2P5NA 1IEQA 2G96A 1KC7A 2X7VA 4HGXA 4TV6A 2OLSA 3WK2A 5IHRA 3DHPA 3QW3A 4V1YA 4DO7A 1RJRA 2J7GA 3MJYA 4IPNB 5MKGB 1G1YA 3BW2A 3PR2A 3FJ6A 2H8XA 5FJOA 1F3TA 1E0WA 5BOOA 3RJYA 1AD4A 4JX6A 2CLEA 1R86A 2QUMA 1ZJBA 3W71A 1AODA 1W9UA 3C5QA 3K30A 5EU9A 2Y7FA 3WJZA 1HO4A 3U4AA 3A21A 1PB0A 2QGYA 2R1MA 3ZLFA 1X1NA 1F6KA 2QUUA 4LANA 3HG4A 4O1AA 4ZGYA 3WH9A 2PP3A 4BY3A 2Q8XA 4KFPA 3TQPA 4B90A 3U48A 1LG2A 3DKJA 1L8NA 4RW5A 3E49A 2NSXA 2VURA 4PUEA 1B3ZA 3EWXA 4NRRA 4LCRA 1QNQA 3A23A 1H1ZA 2WLZA 4IXHA 1XYZA 3MPGA 4IP7A 3B9OA 4BR1A 3AHTA 4QLJA 1CTNA 1JXJA 4KGLA 4UXDA 3WK1A 2NVAA 4DJEA 2W6RA 4H8HA 4IQLA 3T4WA 5B7YA 1LDCA 5I2UA 1E72M 3URNA 1E4MM 2WSQA 3OZYA 3C56A 4DZ5A 5JVLA 1TIMA 4XWUA 3BVJA 1JPDX 3H4WA 4RR4A 4M56A 3NTYA 4PEEA 3WLPA 1PL9A 3T44A 2OZTA 2V5CA 3L68A 3RU6A 3EWDA 4V2XA 4GO9A 3NZRA 2Y2WA 4PMVA 1XYFA 3AALA 3Q4DA 4V33A 3VMNA 2TYSA 4L4OA 4WCJA 1XGDA 2PRMA 2WZIA 1HT6A 4ACYA 1WUEA 2VZSA 4B15A 3WMBA 2D3NA 2QCFA 3ABSA 3CB8A 3W9ZA 3F4CA 1TR1A 4Z1AA 1R2SA 5HPCA 1V51A 4WKAA 1W9BM 1FWCC 3NQ2A 4GI6A 3W3OA 3HMJG 3L23A 4NP7A 3PULA 2GJLA 3W2JA 2B0MA 4JHZA 4FZIA 1R2TA 3KZPA 2NX3A 3KLLA 4RV8A 3CUXA 1V02E 4PTVA 2WSRA 1RK6A 1HIZA 1ZLPA 3WF4A 3S5SA 3MHFA 4JICA 1GOKA 3PTDA 3FNDA 1Z42A 1XYMA 1QOPA 3QHOA 4NJGA 1ZY9A 1XWYA 1PBGA 3W7GA 3CV6A 3BW3A 3O07A 3E2SA 3MVIA 2DQWA 1JZ4A 3PZNA 1DWGM 3WN6A 1TJPA 4JFUA 4C1NB 3U5UA 1TR9A 1MW2A 2C0AA 2CERA 2QNEA 4YTRA 3VAVA 4F9DA 4OIFA 4C6IA 4U2ZA 2VZVA 1TJ1A 1DQWA 3GRIA 5D2WA 2A1YA 2Z4GA 8TIMA 3LM7A 3IWPA 3KLKA 1KFKA 3MWCA 1BQGA 1TQXA 1KRAC 3RM9A 4F4RA 1A5LC 3E0IA 5HMEA 3WF3A 1LWIA 3GTFA 3UF9A 1DJWA 2VC6A 1LUCA 5CPOA 4ROPA 1VFUA 4ERIA 1YPIA 2J7DA 5D38A 3N3TA 1ME8A 4KETA 4MUZA 1MW0A 3RITA 2B7NA 2PDKA 3O6CA 5HBFA 1GOIA 4D6HA 1E6ZA 4N42A 1UWQA 4HN4A 3ZMRA 5LNUA 4CLMA 2DDXA 1UYQA 4IMFA 3W7QA 1WX0A 2C18A 5JMUA 4QDMA 4GIAA 2I9EA 5LXEA 3ONBA 4K7YA 2EQDA 1T41A 3L4WA 2NX9A 3UU0A 1Z41A 4L4LA 4LV9A 3PF3A 3PZMA 1EXBA 3MHGA 3OODA 3OIXA 2QS8A 3RLVA 2GSJA 1OJXA 2QDGA 2OTDA 2FIQA 1VHCA 2INFA 3APYA 1XR2A 4Z2LA 3VINA 1OYCA 2J74A 4WLCA 4JEQA 3GNDA 1N7KA 5A8GA 3IPWA 3BXWA 4A6GA 3U8GA 3PPCA 3QFEA 3WH8A 5JUVA 1SZFA 4ZSTA 3CJPA 4ZQNA 4GFSA 4GVHA 3GDRA 1SR0A 4XKYB 1PHWA 3N4FA 4PL2A 3CV1A 3MDWA 2NXIA 4MY1A 2VO5A 5DRCA 1ISXA 1J6OA 1JULA 4UNKA 4ZENA 3GG0A 3TH6A 1LT8A 3W74A 3IJ7A 4F66A 4GE8A 3SCPA 3VFLA 4EXQA 1SPQA 3QZAA 2DZWA 1B4KA 2QUVA 1ZBWA 2YYUA 2NUXA 1YXYA 4Z2GA 2J7FA 5DRIA 2FLIA 3VNYA 5D04C 4YIWA 3W01A 1XIBA 3EWBX 4JNMA 1C3FA 4GQGA 5A8QA 1BVZA 3SRHA 1PKNA 4Q22A 1LQAA 3CHEA 4ZFCA 2XISA 5TBOA 4GC4A 3S5NA 3VD3A 1GWJA 5J04A 1N8WA 1TWWA 3TMQA 4W84A 1HGWA 3SN0A 1OZQA 4GZIA 3SDOA 1KQYA 5AHEA 3AYRA 4Y7EA 5FJJA 4Z42C 4GISA 3ZLGA 1W1VA 5TAOA 4RL3A 3TR2A 5BXRA 1RD6A 2EPHA 3LMYA 2JGYA 1YNYA 4AF0B 4C5YA 4H2CA 1Z48A 1SZRA 1SW7A 4XISA 4H6QA 1NWUA 1ICSA 1HKMA 3PZQA 2A85A 2H3DA 1ZB5A 1IYXA 3FJ4A 4M6PA 2NQ5A 1E9ZB 1UD2A 1V6WA 2QAFA 2H9AA 3H8AA 3AZRA 3R13A 3P93A 3UCCA 4CQ8A 4PFHA 4JIHA 5F4WA 3XISA 5AB3A 1A5OC 1MO0A 4DWSC 1L6SA 3Q2DA 1P0NA 1AW5A 1TX0A 3NM1A 3WKZA 2DH2A 2G8ZA 3OU8A 3TYDA 2WMGA 1XYAA 3BAWA 1W9VA 1GKRA 1JCYA 5C9ZA 1JYXA 2D2GA 1RLDA 4DBSA 1DJNA 3JVAA 1I8JA 3BAYA 2QYGA 3KBNA 1JL8A 4DM2A 3W27A 2QQ6A 4IWWA 1JUEA 3OQEA 3N13A 1AH0A 3HBLA 4N02A 3WFAA 1E40A 3LEPA 1EWDA 4Q8PA 4L4PA 1SMAA 4HOXA 1TG7A 7TIMA 3EGJA 4TV5A 3TQKA 4TXEA 1TV5A 1HKVA 2RDUA 1W9XA 4JY9A 4UZUA 1D8CA 4AUBA 3GFZA 1QVBA 1TTPA 4JTCA 3TAOA 1XGZA 3KVJA 4MIMA 4UZSA 2G97A 2VFEA 4GCAA 4IP4A 1REQA 2PMQA 1FWTA 2V5JA 4B5TA 1UW9A 1ZAJA 4DB7A 2VFGA 3ZXWA 3L12A 3L4YA 2ZUTA 2J9YA 2GVYA 2PLJA 2ZRUA 1CLVA 3ES8A 2E5CA 4QISA 2QW5A 3RLUA 1E6NA 4IFOA 3CPUA 3UWZA 2BY0A 1GT8A 3MC5A 2QDDA 4KFNA 3PHAA 4FAMA 3V3WA 1M68A 4M6VA 4QG6A 3LQGA 1PJ9A 4AZGA 4PTXA 1DJXA 1AQFA 3ANVA 2OQLA 4ICCX 3UEQA 3WQGA 2WB5A 3H55A 3ERPA 2BGSA 2NX1A 4ZSUA 2JGQA 3CS2A 4ADTA 2J25A 1P6WA 2ACUA 3GXFA 2WVVA 2PRLA 1KLYA 4HHLA 3ZIZA 4DJDC 2C1GA 2PZNA 4PGLA 3H2AA 3MSYA 1E56A 1C93A 4B2DD 3QY7A 4R34A 3TTYA 3CT7A 1F8MA 2VC9A 1B3YA 3ALFA 4P7OA 3Q45A 2FZBA 3AU6A 2YL9A 3S1WA 3MW7A 3M0KA 4HNUA 2Z1KA 1BF2A 1VBUA 1GZJA 2OQYA 3PZTA 3V7PA 3P6LA 1MNZA 3NVDA 1W54A 1DE6A 2Y88A 3S2MA 2CYGA 2QJMA 1O68A 3QPEA 2HWGA 4S2BA 4TR9A 4QBXA 3Q58A 1X6UA 4OOUA 3KOWA 1T40A 3DC8A 3VCNA 4HU8A 1WKEA 2BS9A 1H4PA 1SJBA 1KA9F 4YU1A 4JPGA 3P62A 3T2OA 2DZBA 1H50A 3UWUA 3BE7A 3K8KA 2H6RA 2XGZA 3BDKA 1UWIA 4YYCA 2VC5A 3N04A 1VEPA 4IZGA 4XZIA 4NAEB 1DHPA 4FF7A 2Z27A 4YTTA 1FCVA 4IG2A 2UWFA 3ZVIA 1T6MA 3EWZA 3POHA 4ZTYA 3IJ8A 1RXOB 4Z0JA 5AECA 2ABBA 4H6RA 4H9TA 3EX1A 6ALDA 2GGHA 5K4XA 2Z1BA 4QP0A 3U5YA 3U9IA 4B9YA 3O16A 3MI3A 2J66A 4IMCA 3UXIA 2GDQA 3GU1A 1D9EA 3GU9A 3FN9A 4J3TA 3SCUA 3F4DA 2C6QA 3K8LA 2QF8A 4DAIA 4ECLA 1OCBA 2YW3A 3ARZA 5MKGA 2CU0A 1R3YA 4PCPA 4BF7A 2DJLA 4N2YA 3VIMA 4AVOA 3K4WA 4LALA 4FS9A 3SN4A 3G77A 1ESWA 3TCEA 5C7HA 2V9DA 3N25A 3IAPA 1A5BA 2A6LA 5EMKA 2R91A 3TTOA 1EOKA 4YS1A 4ORIA 1AQ0A 1NEYA 2LLEA 3N73A 4IGMA 2GJXB 4ROQA 4DZHA 3FXGA 4HU3A 4GABA 3NQBA 1CXEA 5GNYA 4ACZB 1NH6A 2WNNA 1RUSA 2QV5A 4HJWA 1IXNA 3JU2A 5G4EA 4I90A 1AH3A 1EQCA 5K9XA 2I7GA 1OX4B 4NJJA 2DPEA 4RNJA 4GVFA 2CXEA 4LJ3A 4R7JA 4B92A 3QN3A 4DUXA 1KBJA 4HZMA 3GDMA 4Z2HA 3ZSTA 1QW8A 4JIIX 3SECA 2P3ZA 5ABEA 4CKQA 5FEXA 3QR3A 2XHYA 1W1B1 5A8PA 1BF6A 3WD3A 1JD9A 4XBSA 4Q8MA 2CZDA 4NF7A 2B31A 3UXLA 1LJYA 4RK8A 2B81A 4RJEA 5E0KA 2BXVA 1GYNA 5AC4A 2R94A 3V4BA 5HOSA 4OFCA 2BTMA 2XIOA 2BWGA 3TN3A 2GQ9A 4O50A 3H22A 4G1NA 2Z29A 2FZ8A 3C2EA 1QHPA 3MYOA 3T2QA 4D6CA 1GHRA 1XLCA 4O8AA 1ENUA 1QO2A 4GHRA 4TX6A 3MU7A 3TYBA 1XRTA 4TO8A 4O1DA 2ZZ3A 4QE4A 3DXIA 3GTHA 1XSKA 5CPQA 3G0XA 3WH6A 2E5BA 3I68A 5LXXA 4X3ZA 3BV7A 1Z7AA 4CQBA 3WLLA 3IIZA 4MJZA 2ZTJA 1F05A 3O63A 2ZOXA 4TMCA 4AWTA 3GNXA 1OK6A 2OPJA 3VOCA 2BNJA 5RUBA 3PTQA 4H41A 4HBKA 2ZKMX 4NX5A 1RP8A 3K4DA 2GQAA 2P76A 1Q6GA 4LF2A 3PNZA 4LBRA 3S5YA 1ISYA 1VR6A 3NOYA 3T2PA 4NJHA 2PP0A 3NO5A 1TZZA 1O5QA 3R8GA 3DHUA 4XK2A 2X40A 1WUFA 3ES7A 2V5KA 4I7UA 3WNOA 1CXHA 4C1NA 4H9ZA 1EDTA 3VABA 1Q13A 4EPEC 4WJEA 5H1WA 4EPDC 1E1CB 4UTUA 3GD6A 4Z1YA 4MB4A 1SUXA 2GL5A 4IM4A 1P0KA 1MDRA 2XZ9A 4MWAC 3LZ3A 1UPMB 1W9DM 3UWVA 4GVIA 3RPTA 2P0OA 5F1VA 1UWSA 4LVGA 2WZHA 4RNFA 4U28A 4CU7A 4S3GA 4DI8A 3WLJA 4NJKA 4K38A 4KW2A 2I5GA 3VGGA 1VQTA 3A13A 3S2LA 4KBXA 2I16A 4HNCA 2PCEA 1TPB1 3INPA 1VGAA 4C1LA 1UUOA 1Y5VA 4JTEA 3VNLA 2Z2BA 4RE3A 3O6AA 4E2DA 4GH3A 5DMYA 4HNVA 1KCLA 1DXFA 3TAKA 3IK2A 3UR5A 1VFFA 4JX4A 2ODOA 3NL6A 1QI4A 1H1YA 1MUMA 4CQDA 4EF8A 3H2OA 1GHSA 4L80A 1G4TA 1ZBVA 5BCAA 1VCGA 2HXUA 2X2GA 1K03A 2ZYFA 4H9XA 4HNTA 1TTIA 3WBXA 3VNKA 4HA1A 3AHZA 5FJIA 2PGRA 4JTIA 4NG3A 4JCMA 9RUBA 3TKFA 3L0KA 3P0XA 1JCNA 4DYKA 3THDA 2KAUC 4IPLA 3IEBA 4HJFA 1H7NA 3C8NA 4UFKA 1M3UA 3FEMA 3DFOA 5GPRA 1JD7A 3TA9A 1ZALA 1MQPA 3VE9A 4LNYA 5JBFA 2QV4A 3ZOAA 4ZOBA 1K7XA 2VGFA 3G1HA 4XKYA 5ABGA 1KR0A 2DEPA 2C71A 4N9DA 3F2DA 3OLIA 1UHVA 3FA4A 4S3CA 4OWGA 1UIPA 2W62A 1H5VA 2HSAA 3CV2A 4EXAA 2C16A 3PTKA 1XDMA 1O94A 1UP3A 4XKMA 3QW4B 4DYEA 4URIA 1S2UA 2OFJA 1FQ0A 2D0HA 2V2HA 3NURA 5G2HA 4ILSA 3W7KA 1XIIA 1BRLB 4ALDA 4UR7A 1L6YA 4LYPA 4AYGA 1G69A 4BJHA 1I0DA 3WDRA 3T08A 3AXXA 3LHWA 5EBAA 1XCFA 3C4UA 1XV8A 1P7TB 3B8WA 3QC3A 2DUZA 3CH0A 4PL1A 3WF2A 3BGGA 2C91A 3C2FA 1PIGA 2CBUA 5DFAA 4Q3MA 2ZZ6A 1E6XM 3BW4A 3H53A 1AMYA 3GVVA 3IUHA 4XSMA 1KGWA 3TR9A 3M7SA 4YVPA 1GOWA 4HSHA 1EP1A 1PDZA 2UY3A 1QDSA 3TSMA 5DCEA 1NOFA 3BUVA 2O9OA 2PLMA 2NW0A 1PX4A 1WO2A 3LCIA 3SB0A 4AF0A 3C0SA 4M6QA 1OEPA 1KO0A 3URQA 3N15A 5FCZA 1V0KA 3OGSA 4LAKA 2ISWA 3ECQA 2Z28A 4H83A 4C1KA 5H2ZA 3BL3A 3N19B 2AGKA 3L0GA 1SZNA 2FHCA 1TPWA 5HMFA 3GX9A 4HNOA 3AFBA 4GNVA 1CLKA 2OB3A 3WDQA 4ZE4A 3CL8A 5KZDA 3W00A 4Z1CA 1CXLA 3GH7A 3HGSA 3GHSA 2ONEA 4WOQA 4OE7A 1WBHA 1S39A 1T8XA 5AYYA 1D2KA 2CCRA 3W2NA 4UUIA 2TPSA 1IXQA 1S2VA 1VBJA 2DJXA 2YJQA 2Z1SA 3IARA 4J3ZA 2J6VA 3LS9A 2X42A 4NZCA 3TC7A 3VD9A 4ZO8A 3QQWA 1OG0A 2Z7KA 4Q8QA 4NILA 3LPFA 3PZ9A 5CC6A 5D09A 3H24A 4H8UA 3PNUA 4DJFC 3QHMA 3TW7A 5CC7A 1UP0A 4GH1A 4I9JA 4M1BA 5GNXA 4CU6A 3E3HA 1CGYA 2GDUA 4DJED 2OCZA 4DI9A 4JFWA 4X9YA 4EWJA 2W67A 4NZ3A 3I7RA 1KB3A 4IPJA 3HTWA 1GORA 3HV8A 4AC1X 1Q6CA 1K6AA 3F1QA 2ZXBA 2BDQA 4R27A 3WBWA 3GHTA 3FFSA 3F5KA 3WD1A 3WYZA 2CBJA 3EOUA 1H7RA 4Y2WA 2I1OA 5I3JA 1FWSA 1GGOA 4CCZA 1VP5A 1IWAA 2PDYA 3BLEA 5SWUA 2WC4A 4FXRA 1J0IA 1P0EA 2ZDSA 4WGXA 3DOPA 2WO5A 4ZE5A 4M80A 4GWEA 4ZXOA 1AW1A 1YRRA 3W88A 1J11A 1BTCA 3AXMA 3HQOA 1W8GA 2BB0A 3B8DA 1TPFA 3B8UA 4AW7A 1YXCA 4JEJA 4CD4A 1XLMA 2VT0A 1TMQA 3MMWA 4C6BA 2ZUUA 4AH7A 1OC5A 3GSMA 4LU0A 2HNHA 4KH2A 4I3GA 3PWGA 3GH5A 4RPQA 3W37A 3OP2A 1J2BA 4YCOA 2HPMA 2GJNA 3TJIA 4IQDA 1JI1A 5I3DA 6TAAA 3CUJA 1QNVA 2IW0A 3R11A 3WK3A 1FXQA 2QPUA 1SMDA 2WM1A 4LAUA 3GYEA 5T26A 3VO0A 5HNRA 3KCJA 3WIJA 3EOOA 2P1FA 1B2YA 4MKVA 3TX9A 4FNTA 1T96A 1GVEA 1F3XA 5BXSA 1TE6A 5HA7A 4N7QA 2GUYA 4GXMA 1TX2A 4ES4A 4BCEA 1OYAA 3IVSA 1MW1A 3MKKA 1E3XA 4RDZA 4AEFA 1XBVA 5CGQA 3SJ3A 4NAEA 4V1XA 5CZSA 5G2WA 1SFJA 2PDBA 3KM8A 2X0HA 3N2MA 4FXSA 2O4MA 4NNCA 4W8LA 3Q65A 3PM6A 2Y5JA 3PJUA 1B31A 1A5NC 3FW6A 3WEZA 4GK8A 3AI0A 2QAPA 2D3LA 2FDSA 2GQ3A 3TYUA 4FA3A 2WBGA 4XIAA 3KX6A 3EOSA 2VZUA 3NM3A 3QV7A 3K4AA 2F7FA 4GMEA 4PMRA 3W1NA 1EJWC 5CZJA 4AHPA 5LA0A 4LB4A 5IM51 4FLQA 3O0FA 3VIFA 1RK5A 2NV2A 1GVQA 2PP1A 3BC9A 4ZQCA 3VZXA 3HG2A 3SCVA 3MBDA 1LP6A 4KEMA 3K1GA 2B4GA 4HN8A 2FMOA 3TIMA 3FYPA 1J0ZA 1Q5MA 1EJVC 3HPXA 3CHDA 3CC1A 4KRTA 2IPFA 1CB7B 1KV5A 2A0NA 4R88A 1VC4A 3W29A 4BK9A 3IIPA 4Q8TA 1CLXA 4M0XA 3UP8A 3QXBA 1CXKA 2RGLA 1XHGA 3W24A 1JZ7A 2DW7A 4UFIA 2E9MA 4PUDA 3BMWA 3UGRA 1LTDA 1BXCA 4AZHA 4Y90A 4N0RA 3GZAA 4MFEA 1KM4A 2BX7A 1QPRA 3QY8A 1FHLA 2YXXA 3R6IA 2VOMA 5E70A 5C9XA 2GJXA 1BWKA 4S3JA 4ACZA 1XI3A 1UZHA 1FCUA 3R43A 3VDBA 1VJZA 3M07A 1UROA 4MDOA 1NF0A 3AS2A 3DFYA 2X8RA 1NU5A 1NM9A 1OX4A 3ITYA 3OZMA 1L6WA 3ARYA 3TCSA 1JFXA 3WX7A 1TE1A 3HU7A 3N11A 3QHNA 4TOQA 2A79A 4AIBA 1GG1A 2XTKA 2VNCA 2A6NA 3CWHA 2WWCA 3G1XA 3AXKA 3EX4A 4UTIA 2AMGA 5F4SA 2Z24A 2GGIA 4M8UA 2C79A 1TA3B 2GGGA 3NVTA 3UXAA 3QQ0A 5L6UA 5E0CA 4E0CA 4K68A 2OWXA 5D2XA 2Y8VA 3JUGA 2HVOA 3AIBA 4AVFA 3CLMA 4YVXA 4LFYA 1CGUA 3L5AA 3RCMA 1ONEA 3WQDA 1P5BA 3ARWA 2V3GA 3RO6A 1UD4A 4GQQA 1A5AA 3WUBA 4GC3A 3MSGA 4YPJA 5HMSA 4NHVA 1W0MA 3LOTA 4AX7A 4GQBA 1GKQA 1YDYA 2Q09A 2ZADA 2WMKA 3LM3A 4UOQA 1LRNA 4DXVA 2J13A 3S6TA 3LXCA 3PUOA 3LTPA 3NPWA 3SSZA 3MKVA 4PMYA 3GNPA 1LL7A 2OU4A 1I75A 1X6NA 2Y24A 3LI0A 5D4YA 3CWOX 1JF5A 1JCMP 1XUUA 3HJZA 3SURA 2XFFA 1EJTC 1OVDA 1CB2A 4JTAA 3P80A 1E0XA 3MA8A 2WJFA 4H04A 1RQHA 1UH4A 1EBGA 1NP0A 3VCCA 4HSOA 2XGBA 4C7FA 1JQVA 3A9IA 1YPXA 1XFCA 3VKDA 1XX1A 2EPNA 3W83A 6XIAA 4JHMA 1PVNA 2RKXA 2JFEX 4AWUA 3UWYA 4CEXC 3IGSA 4Z0SA 3AO0A 4KKXA 3CYJA 4O53A 1HL8A 1V3MA 3WNLA 4ATLA 2HCVA 2E7FA 4YN5A 2J7CA 2W3ZA 3A9BA 3IJIA 3KP0A 3OHIA 2X7WA 4ZXLA 3L2LA 3IV8A 4NZ5A 2E8YA 3OB8A 5IFPA 1JNEA 3KW3A 1LLOA 2YCJA 1E1CA 4E2OA 1C92A 2Y7GA 1U2YA 3FSUA 2NQZA 1XJBA 2ZX8A 4A3QA 1W5QA 5CSRA 3WLIA 3CPRA 1FTXA 3P61A 1QAPA 4LAMA 2QT3A 5GQBA 3RILA 5CC3A 1PIIA 1CXFA 3TDFA 3NR0A 1W17A 2IUZA 5KZMA 1FWRA 1LZOA 1TPH1 3R1ZA 7ODCA 3U2OA 1XYLA 2OSWA 1UD5A 2WCAA 2P8BA 1E15A 2PDCA 1ZJHA 4GYKA 4J3XA 3ELFA 3USBA 2PGEA 4DYJA 3ARRA 3W1TA 1KBBA 4BWLC 3L4XA 3O6YX 2BVTA 3WF0A 5D8ZA 4C6DA 3UZZA 3VIHA 1P1XA 2C1IA 1V6VA 4AXNA 1J01A 2VENA 2OODA 2V5DA 1UMYA 3M6DA 3IVUA 2OXNA 4NZ1A 3SUUA 1TPUA 4K8HA 3LLFA 4P7QA 3OTRA 1LLZA 1U1HA 4A3HA 1OCQA 4HKPA 5BXTA 4XAGA 6XIMA 4DPPA 1OQFA 2AGTA 3N18A 1EJXC 3T0DA 3WSUA 4PUWA 5GNZA 1QPOA 4OOZA 2QZRA 1FRBA 1Q8JA 4FIRA 2ANUA 2QMKA 2PWUA 1HP4A 1EO7A 1NFBA 3A4AA 1SJCA 4J4KA 4ZQMA 1H0GA 4BF9A 1WKYA 3BWWA 2YPIA 4IMAA 4QE1A 3RCNA 1K4GA 1OSEA 1FKXA 3WLHA 1DWHM 1H1NA 4HHMA 4YNGA 1R0MA 1HJQA 4CUCA 5FIPA 4PMXA 1QPNA 3TVAA 1AL8A 4LBUA 3V16A 1F07A 3LGDA 3WQCA 3NIYA 4CNTA 4E4PA 1VEMA 1B3OA 2F9RA 3DYMA 5DY2A 2CWNA 2HTMA 1ML1A 1YKWA 3PBYA 1XLDA 2CKRA 3GKFA 3VD5A 2FFIA 2Z6IA 4QG8A 4O4VA 1UH3A 4LVDA 1IIGA 4B4FA 3H4GA 3W86A 5EFDA 4UTTA 2R1LA 1GVIA 2VX5A 4C6LA 4O11A 4D72A 4QE5A 3VI2A 2OYMA 3NO3A 1OFRA 3I6TA 1GVSA 2YDAA 1BRLA 4IGSA 1RSCA 4RDVA 3TN4A 1GUVA 1X6LA 2O9RA 1EFZA 3TA6A 4Z1DA 4EPBC 1GG0A 1ONWA 4U3CA 1P7TA 4ASTA 4LC8A 1D8WA 5HULA 1BVNP 2DZUA 4ERAA 4GZEA 4HOZA 4AD1A 1XLJA 3N29A 4LW7A 1KXTA 3LN3A 4AZBA 2AQWA 2NT1A 3MUCA 4XD3A 1TCMA 2PDXA 4P7NA 3LMZA 1QI5A 3E2RA 4AD5A 4H6KA 1AVAA 2E6AA 3H2EA 4Q32A 3G22A 2ZWZA 1E9LA 2Y8UA 3PVFA 4XAFA 3V0UA 3ALGA 1OY0A 4MLRA 4DEFA 5DXYA 1H63A 4UTJA 5KZEA 4DAFA 1MFUA 1NWRA 1R46A 3SUSA 4FIQA 3RHGA 2QCHA 4O14A 1Q7MA 3C0LA 3ID7A 3RN6A 4J3VA 4Y9AA 1A5MC 5MF5A 2OEMA 2X1IA 5PTDA 1RAKA 1BGAA 4S2CA 2JKAA 1JGMA 3BAKA 1F3EA 3KZSA 1C7SA 1D7FA 2P10A 4FR1A 5D2TA 5JIPA 1AA1B 3W7PA 3QGVA 9XIAA 2P8CA 1UKOA 5FEWA 1FVPA 1WBJA 4CGTA 3CQHA 4TUFA 2F38A 2PI6A 2E6DA 2PWHA 3W73A 1U1UA 4MWAE 1RD5A 1XCWA 1QO5A 2YA2A 5I3HA 2JF7A 1WQ5A 2OVLA 3N2TA 3BLLA 3SAZA 2VM8A 4F2TA 2V67A 4FOKA 3CIWA 3QV9A 2ZC1A 2Q3RA 5T91A 1W9PA 3QSTA 5JH1A 2TRSA 1B1YA 3CHCA 5A69A 4M24A 4ENLA 4ZBCA 3CQKA 3TZNA 3PZGA 4XTDA 3ARQA 2Q8ZA 3UXKA 3ABXA 2BGNE 3CEUA 4F0LA 4MNMA 1ECQA 3NQEA 2CLFA 3QR0A 3QRHA 4H9UA 2VYOA 4PMNA 4HA3A 3FDGA 3AAMA 5FF4A 4A8LA 3VNMA 5H91A 4J1OA 4AB4A 1PZ3A 3W0KA 3A6OA 3O2LA 4GKLA 4ATWA 1Q2RA 3LTYA 1HL2A 5EKYA 3FA3A 3KP1A 3OVGA 5KTLA 2Y5EA 5I77A 4FX6M 4JYEA 3GR7A 4Y6GA 5REQA 4PULA 5I24A 3V0TA 1XIEA 1FWGC 3A4XA 5E93A 4WF7A 4JS3A 4Q33A 3KDNA 5FOOA 2VEGA 3PN8A 1XQKA 3WQ8A 4CN4A 3OG2A 1O12A 4DF0A 1TVPA 1VBGA 4M51A 4ZO6A 3QMRA 4AZ6A 4O15A 1HNYA 2VR5A 3QOMA 2Y0FA 3LLDA 5AHLA 3TYZA 1BHGA 1VYRA 1YX1A 2PBGA 4AEEA 2FB3A 3KS5A 1D3HA 1K8ZA 1F76A 3C61A 4CNPA 1EGZA 4ICMA 1K1DA 4K2SA 2GFTA 4LVFA 2J24A 3D5HA 4C6CA 4XD5A 1VBRA 4UQCA 1IQ8A 4G56A 2RJGA 1SR9A 3NFUA 3U2CA 2VUNA 2OJPA 5DBUA 3AUJA 1I2PA 2VEMA 3MMUA 4PB5A 1LOQA 3M5VA 5BU9A 2WM0A 1I0BA 2E9BA 4W93A 1ITXA 1Q6FA 3S3GA 4XTIA 3NEHA 2NVCA 4BF5A 3T05A 3D47A 3GE7A 1RY0A 2QIWA 3COTA 4JNZA 3DIPA 4LQ1A 3B4UA 1T0OA 5LHEA 5A6TC 3VPLA 3A22A 1C29A 1TV7A 2Y1HA 4U3AA 5TQLA 1IIHA 4QRNA 4IIDA 4KT2A 4PCNA 2IKHA 2V69A 2A7PA 1JZ6A 5DQPA 4KCWA 4J35A 1QI2A 1EP3A 2IPJA 3PJWA 4U4MA 3B9NA 2CLIA 1ZRQA 1JCJA 1OGGA 3AHXA 1OF8A 3AMKA 3RUBL 3VKJA 3DI0A 2O56A 3G3MA 1K8YA 2YL8A 1XF0A 3LRLA 2HVMA 1DIKA 2X2YA 4UTWA 3C6CA 4DO6A 3MZ2A 2OELA 2EXOA 3OLDA 4A3RA 5A94A 1G5AA 4Y9MA 3S5ZA 4FXFA 1YYAA 4Q4PA 3BSMA 1NP2A 4LAZA 4R9XA 3WQ6A 3VGBA 4I9TA 1RVKA 1PXGA 1W3TA 4G2DA 1B0IA 2DGAA 3WLKX 3GS6A 3SRDA 4L6DA 1WZAA 3CZKA 5BWAA 3KBMA 4E2BA 3W2KA 4W7UA 4N9BA 2G50A 2JBMA 1JVNA 3QH2A 4W5ZA 2OEJA 1IEVA 4XZMX 4RUBA 4YYFA 5EMYA 2MNRA 1LT7A 2YBVA 1SJDA 1K7EA 3E0FA 2WVUA 3FS2A 1TV8A 3N3MA 4RDWA 3O9NA 3SM0A 1NQ6A 4GIYA 1HN1A 5LSMA 1TA3A 1V02A 3WQVA 1DKWA 3CYVA 1LQ2A 1A49A 2EAWA 3G1RA 4CD7A 1E9IA 2PDNA 3BTNA 2X05A 2WJZA 4G6CA 2XH2A 1DXEA 3U7VA 3WQPA 3KWXA 4LUYA 2PB1A 1MWOA 3C0QA 4GVGA 4H4IA 2Z26A 3JS3A 1TIWA 4FLRA 4O10A 1ISWA 3MBFA 4OV9A 4TTUA 2I9UA 2NLIA 3AS1A 2EEXA 2BXZA 3SRKA 5HINA 4QLKA 2Q8LA 3NL3A 3VKBA 3BGAA 4GGHA 4W5UA 3DCPA 1SO6A 1W5OA 2NQJA 2CFFA 3M0IA 5G2IA 3OQ8A 1M04A 1EB3A 5C9RA 1ONRA 3TMLA 3E5PA 3ORWA 1EIXA 5ABFB 1KNWA 1HJWA 5FSEC 3VIPA 4KFOA 4J2MA 1ZNNA 1FH8A 4ZO9A 5IBXC 1UQZA 1SFLA 3OPSA 4D6JA 1THFD 3BAIA 2OWWA 3WJWA 1Q3NA 1ODUA 1ITQA 1HJSA 4XUYA 4JN8A 4IP5A 1TV2A 4PMJA 4K39A 3SJNA 1P6BA 3P5ZA 4GBUA 4Z17A 4AZ7A 3XINA 5AYBA 1W3JA 3SGZA 1QI0A 2PBOA 4LC6A 4DUOA 3LCHA 3TN5A 3CLWA 3E12A 4F2BA 1MZRA 1YPFA 2DVUA 1JYVA 3U2EA 1IV8A 3K1DA 4P2VA 2CZEA 3TQ0A 1R85A 2QUTA 1SGJA 1EC7A 3L21A 1HKIA 4ML9A 1PWMA 3L4ZA 1FH7A 3QZ6A 2G5WA 2OEKA 5CCZA 1E71M 3LBCA 3VDHA 4DHGA 3CXOA 3BJTA 1ISVA 2VFDA 1YTKA 1SW3A 4OU1A 2PD9A 5DELA 1HUVA 4GUJA 4P7LA 4CCDA 1F7BA 1YDVA 4WUIA 3U57A 3IJ9A 3CTTA 2O92A 1WOBA 3W7JA 2QUNA 3FOKA 3MT1A 3OVRA 4LEQA 4LUJA 1RCOB 2PSNA 3NZQA 3K13A 1E0TA 3H26A 3IIOA 3C3UA 2DZAA 2XH7A 1XIDA 1DORA 2EPMX 4NKCA 1SQ7A 2I14A 3OZOA 2DZXA 1S5NA 3I65A 2JF6A 4Q8NA 2TAAA 3GFYA 4W88A 4GCXA 2WLYA 3QOKA 4TIMA 4TX8A 1C9DA 5TF0A 2CPUA 1GEQA 2YXOA 5A2AA 2ISDA 4A35A 3R0KA 1LG1A 1PE1A 4EPKA 5HXMA 2C3ZA 4EIVA 3VKKA 5CBJA 2HS8A 4P7RA 4UQEA 2BP1A 3S8HA 4ORMA 1NARA 4RLIA 4EOUA 3WNPA 4D1IA 4OECA 5T9BG 3LCWA 3GXDA 3UJEA 4XBJA 3VK5A 4D8ZA 1WA3A 3CZLA 2V2DA 1YDNA 3ZVHB 3R12A 3VOIA 1OYBA 4N6EA 4LCQA 3M0YA 4GYFA 4IIGA 1I1XA 3WDJA 1XLLA 4CNUA 3GVWA 2GPTA 2VRJA 2ZA1A 2J7EA 5FJRA 3UA4A 2HQAA 5LHFA 3FIGA 3PAOA 5CPTA 2ZX5A 3TQVA 2QVHA 3AC0A 1ECEA 4CN1A 4XX6A 1KM6A 1VIZA 4H9YA 2WSKA 4MJ4A 1Q6EA 2VEIA 3E38A 5ABHA 2PWFA 1PX3A 2EJAA 3WQFA 4MJ2A 3P67A 4LAOA 2VRKA 3AMLA 4WGHA 4A21A 4H01A 2Y61A 1TJ0A 3H12A 2NXHA 3BQ6A 5D03A 1CGWA 3UZXA 4S3FA 2GGJA 3SCOA 3RX4A 1US2A 1EC9A 1G01A 4B5SA 3GM8A 1JDFA 4B5XA 1XQLA 1LQ0A 4BI5A 1XYCA 3TEVA 3MYPA 3STGA 4AIUA 2TMDA 3E0LA 3CQIA 4O57A 3R0DA 2OX1A 3ZR4A 4Z08A 3UW6A 4HMNA 1W5PA 4E6MA 4UBPC 3MUY1 3UERA 2AKMA 5LIUX 5DT5A 5LNSA 3WG6A 4HA0A 3VGDA 2FPYA 1EC8A 4WKHA 4LUSB 3SI9A 2FH6A 2YB4A 3L0NA 1F8IA 4F48A 4K1WA 3L4TA 2GDVA 4UQAA 3DU0A 3DESA 4KWSA 2PDPA 2ZBTA 5M5DA 1VKFA 3W1XA 1J0KA 1V6TA 4O1EA 1EH9A 3VZZA 3EWYA 4K7VA 3SCWA 1AQHA 1D3GA 7PTDA 2BGQA 3A3HA 4O54A 3DGBA 2B7OA 3L2IA 1J0HA 3AJ7A 3EDJA 2QPXA 1WKFA 4QS5A 3P82A 1Y0EA 1DXIA 3OG3A 3E9AA 3M0HA 1V3LA 3UVAA 1V6YA 3DFPA 3L67A 1S5VA 3VM7A 2WNWA 2PDJA 1FP9A 4O52A 9CGTA 1XH1A 3P3BA 1T8QA 1VS1A 4AFYA 5FAGA 3LA4A 1W1IE 5D9PA 4NU7A 2OLHA 4Q7NA 4NQ1A 1KWKA 1OABA 4I9MA 5HNUA 2YW4A 4J40A 4NNBA 2UV8G 1FBAA 4E3VA 2CLPA 2V3EA 3QMSA 4QQUA 4RKAA 5F7UA 4WSHA 1V3HA 1G4SA 8RUCA 4AU0A 3GXPA 4S3EA 1UKPA 3CZ8A 3EB2A 4Z2KA 3LDVA 3IGHX 3KVMA 3PUDA 4QS6A 4XZWA 3WUEA 1HVQA 4DWDA 4JBRA 4GIEA 3K8MA 4H7VA 1LRQA 1VYPX 3SFWA 2EPLX 1X97A 1CGXA 1FFRA 4X61A 1G7UA 2UZ9A 4RPPA 3IACA 3VDCA 3IJLA 4XAZA 3G3DA 1CGTA 3WJYA 1IT8A 3LLXA 5C55A 4PCTA 1GONA 3PJXA 5D2YA 4QHRA 1A5UA 1N8FA 4LY4A 3N9RA 4IISA 4RZBA 2VMFA 3QKZA 1W3HA 2D69A 1FWFC 3EDDA 1K70A 1E4LA 3AMCA 2YR1A 5G4WA 2WQDA 2YSWA 1Q6DA 5HJYA 4JQ1A 3NZPA 1VBHA 3W84A 1EQPA 1V08A 1Z9AA 4NT0A 1IT7A 4GX9A 3L4UA 3KBVA 2YOCA 3GKAA 2FHBA 2WZEA 1S2CA 2UBPC 4PUJA 3I6RA 1OFQA 4DWSB 2J62A 4REQB 5AOUA 1UJQA 2B7QA 3CB3A 4JR5A 4BKNA 3RGTA 3EKZA 2HRWA 4AD4A 1Q4NX 1Q66A 1W2PA 1E0VA 4WRHA 4NXSA 1U5JA 4HK7A 3C0JA 3ZM8A 4JFSA 3MSDA 1TB3A 2ON3A 1G7VA 1E9YB 5J5DA 3GR8A 5D2VA 2ZRXA 2OOGA 5D30A 1QI3A 3BLDA 3H2NA 1ZTVA 2QIIA 1PZ0A 2PD5A 3JRKA 3UZJA 1QK0A 2PURA 4X0VA 4JQ2A 3QTPA 2NV9A 4JCLA 3ZFHA 4GQRA 1UPPA 1PKMA 4JN7A 5HJLA 4ZL1A 3ABZA 1OZMA 7CGTA 4GYJA 1HX0A 4LTSA 1YEYA 2HS6A 4UTKA 3AICA 3N34A 1C91A 2YBUA 2J78A 3KE0A 1DPMA 1F4HA 4U2YA 2ZUSA 2EO7A 1NJJA 2XIIA 2A3CA 4KWUA 3KWSA 4XD6A 3HPZA 5C9UA 3PZIA 3NUKA 3NYDA 3EEGA 2WHLA 3M0JA 1KFBA 3UWEA 3W28A 4UQ9A 1PCKA 3MCOA 1VJSA 5C2CA 4CCEA 2FQIA 2JIEA 2PWGA 3EXTA 3AWNA 1XBXA 2WMFA