2WM1A

The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between nad synthesis and glycolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
332
structure length
332
Chain Sequence
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOXYLASE
publication title The Crystal Structure of Human Alpha-Amino-Beta-Carboxymuconate-Epsilon-Semialdehyde Decarboxylase in Complex with 1,3-Dihydroxyacetonephosphate Suggests a Regulatory Link between Nad Synthesis and Glycolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 114
structure length 332
sequence length 332
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2wm1A00
2ANUA 4ERGA 1ADDA 3PANA 4KEUA 4C6QA 1EJXC 5FSEC 2HNHA 2OB3A 3K2GA 1EF2A 1XRFA 4HA0A 3GTFA 4DLMA 3ICJA 1E9YB 4AC7C 4H01A 4GX8A 4DNMA 1FWEC 3TN6A 4C6PA 3RHGA 2OQLA 3ISIX 2R1LA 3IPWA 4KERA 1A5OC 3B0YA 4DYKA 2GSEA 3KM8A 2P50A 2YZ5A 4GK8A 4C6KA 3K4WA 4RDVA 1YRRA 4DZHA 1ITUA 1K1DA 4J35A 1P1MA 1NDYA 3AUOA 2UBPC 4L6DA 2ICSA 4DI8A 3LSBA 1RJPA 3EWCA 2R1MA 3K5XA 1A4LA 3T8LA 3LA4A 5G4HC 2Q01A 3OU8A 2PUZA 4LANA 3E0FA 4DO7A 1R9XA 2WJFA 3F2DA 2HPMA 1FKXA 1VFLA 4ZSTA 4EP8C 3O0FA 3WYZA 3T81A 4C6CA 3E3HA 4DIAA 4F0RA 2AQOA 1ITQA 3WZ0E 2FTYA 4GY7A 1YMYA 1XRTA 2XIOA 3IJ6A 1ONWA 3GTIA 2AQVA 2ADAA 3MVIA 1V79A 4IFKA 3IV8A 1M65A 3C86A 1EJTC 3E2VA 3PAOA 4L9XA 2VC5A 3SFWA 2YB4A 3FDGA 1IE7C 4F0LA 4IGMA 1YBQA 4J5NA 2CZVA 2Z2AA 4V1XA 1POKA 1KRCC 1NDZA 1PB0A 1RK5A 4MUPA 3QY8A 1A5NC 5LXXA 4GY1A 3QGKC 1KCXA 2DVXA 1HZYA 1POJA 4GZ7A 3LS9A 4C6EA 1R9YA 3IACA 2OGJA 3LGGA 4XAYA 1WXYA 4C60A 4HK7A 1FWGC 4DI9A 4KF1A 3GTHA 2E25A 3UPMA 4GX9A 3NURA 4QRNA 4IG2B 2BB0A 3UR5A 1ONXA 4B91A 4C6LA 4H9VA 3GG7A 4PE8A 1RK6A 4J2MA 1WXZA 4IG2A 2Y1HA 3GU2A 4LEFA 4AQLA 4TQTA 2FVKA 2VHLA 1RJRA 5CH9A 2QPXA 1A5MC 4LH8A 1KRAC 1UIPA 3F4DA 3FEQA 3FDKA 1I0DA 3ORWA 4QSFA 1RA5A 2HQAA 3LY0A 2G3FA 3URBA 2Z28A 4XAZA 4ERAA 2HPIA 1FWIC 1V51A 4H9ZA 4RDZA 3AU2A 4LAOA 1P6CA 4C5YA 3NQBA 4B92A 1GKPA 3R0DA 3V7PA 3BE7A 3A3WA 1YNYA 2O4MA 4QTGA 4I6KA 3GRIA 3A4JA 2OODA 3E38A 2GZXA 2Z4GA 4M51A 1RJQA 2R1NA 1I0BA 2PLMA 4HJWA 4CNUA 4KEZA 4XD6A 3OOQA 4BY3A 3LSCA 4IGNA 3ITCA 3S4TA 4HK5A 1P6BA 3JZEA 4BKNA 4B90A 3G77A 4EPEC 1K70A 1V7AA 4H9XA 1FKWA 3CAKA 4PCNA 2Z00A 2EG8A 1EJSC 3TN3A 2WJEA 2Z29A 3CJPA 4XAFA 4H9MA 3CS2A 3TN4A 1FWAC 4GYFA 2OOFA 4DLFA 4IFKB 1PSCA 2QVNA 1S3TC 2Z26A 2FTWA 4Z42C 3UF9A 1UIOA 2VM8A 2WM1A 1A5LC 1YBQB 4DZIA 4C6BA 1W1IE 2Z27A 2D2GA 4IQJA 4C6JA 4RZBA 2BGNE 1UBPC 4RE0A 3S2LA 3PNZA 2RAGA 3MDUA 3EWDA 3S2JA 1FWJC 4LCSA 2O4QA 3MVTA 2D2JA 2R1PA 2F6KA 3IGHX 4QS5A 4P5UA 3IRSA 3DUGA 4WHBA 2WJDA 4CNSA 3URNA 4G2DA 4BJHA 1GKQA 2DVTA 1EJUC 4R7WA 1FWCC 4WGXA 4LALA 3GU1A 4CEXC 4F0SA 3MTWA 1EJRC 3E74A 3E0LA 3NEHA 4C6NA 3IARA 1BF6A 4PBFA 2QT3A 4WVXA 1J6PA 4G7EA 4GOAA 4EPBC 5HMFA 4LCRA 3DC8A 4XD4A 1RA0A 2W9MA 1KRBC 3MJMA 4IF2A 3RCMA 4KETA 1XGEA 4CQCA 1DPMA 4ZSUA 4ICMA 5E5CA 2A3LA 1NDVA 2E1WA 3QY7A 1EYWA 4LAMA 2D2HA 3EGJA 2GWGA 2Z24A 3WMLA 3MKVA 1GKRA 3LU2A 3GIQA 2Z25A 1ZZMA 5HMDA 3T1GA 2P53A 4KEVA 4C6MA 3URAA 4CQBA 4EPDC 3UBPC 3HTWA 4C6OA 1NDWA 1V77A 4KQNA 1J6OA 4H9UA 3AU6A 3LGDA 2YXOA 3O7UA 1QW7A 1KRMA 4LAKA 4KESA 3S2NA 2QS8A 3HM7A 1M7JA 2VR2A 3RYSA 2GOKA 3B0XA 5A6TC 4C6FA 5AKQA 2KAUC 4B3ZA 2PAJA 2VUNA 3LNPA 4I6VA 3OQEA 4C65A 3QY6A 3GUWA 5HMEA 2R1KA 1EJVC 4C6IA 3F2BA 4V1YA 2VC7A 4CEUC 1V4YA 2I5GA 3MSRA 2Z7GA 2YB1A 1XWYA 1FWHC 4XAGA 3URQA 2EG7A 4R85A 2PGRA 2ZC1A 4GC3A 4LFYA 4QROA 3GIPA 2FVMA 3MPGA 3QGAC 4HK6A 1A5KC 4QS6A 1YIXA 3PBMA 4R88A 3UR2A 3SO7A 3N2CA 3OVGA 4IFRA 4RDYA 4KIRA 4PCPA 4C6DA 1PO9A 4GY0A 2AMXA 3S2MA 3F2CA 1J79A 2EG6A 4YIWA 4H00A 3B40A 1R9ZA 4G7EB 3OJGA 1O5RA 2IMRA 4NP7A 1JGMA 1PTAA 3GTXA 4UB9A 4CNTA 4INFA 1EZ2A 4EPKA 3RN6A 1UMLA 4ERIA 2HBVA 2PGFA 1K6WA 1RAKA 1E9ZB 2HBXA 1QXLA 2UZ9A 4OFCA 2Z2BA 3D6NA 1EJWC 1A4MA 3F4CA 3DCPA 3GU9A 1NFGA 4CQDA 1FWBC 4E3TA 4C5ZA 4XD3A 1M68A 4NI8A 1FWDC 4PBEA 2I9UA 3TN5A 4RDWA 1FWFC 4H9YA 3HPAA 4JOMA 1J5SA 2Q09A 2DVUA 4GXWA 3TNBA 4H9TA 4D8LA 4IFOA 3MDWA 1O12A 3A3XA 4NG3A 4XD5A 4GBDA 3PNUA 3ID7A 4UBPC 2FFIA 2GWNA 3OODA 4LCQA 5FSDC 4IH3A
chains in the Genus database with same CATH superfamily
3N9SA 5I79A 4IHCA 3HPFA 1VEMA 5FF0A 1OYCA 3OB8A 2BS9A 3K2GA 1OM0A 1XRFA 3H2CA 1PZ1A 3B8IA 1W17A 4ZO6A 3W7OA 4GX8A 3AICA 2PGEA 1E6PA 1JZ3A 1R5YA 3AS1A 2YDQA 2Z1WA 3OGSA 1MZRA 2R1LA 2YDRA 5T9BG 3AIVA 3NDYA 3SCNA 3ALFA 4BI7A 2NVAA 2P50A 2FHCA 4C6KA 4AZ5A 1VR6A 1IGSA 4F2BA 3CL7A 1V6WA 3I4EA 1H2JA 4L6DA 3LSBA 1TVPA 3LMYA 5LIUX 2A1YA 3AALA 2JGYA 3U4AA 3EKZA 1KA9F 3QV9A 4V28A 4LANA 2GUBA 3P61A 3GM8A 4Q4MA 3UU0A 1WA3A 5A6AA 4QLLA 1A0CA 3LI0A 3BK0A 1MW3A 3JW7A 1DWJM 5DN1A 1NQ6A 1HG3A 4LC8A 3DIPA 1TV8A 1YMYA 4P8WA 2XZ7A 1JFHA 1OK6A 3W85A 3PAOA 3WH6A 1IE7C 1WNOA 4KCUA 1W1VA 4UFLA 3II1A 1NDZA 1RK5A 2Q8LA 4Q22A 4Q32A 4J3XA 3B05A 2FGBA 7ENLA 1KM1A 2OVLA 2OO0A 1SZGA 3C2OA 4XAYA 4JTFA 4REQA 1FWGC 3ZMRA 2PSNA 4IJCA 4TMCA 4MFDA 4GIYA 3UR5A 2JKPA 2B31A 4C6LA 3OLGA 2E5CA 2FZ9A 1UG6A 1JZ2A 2CPUA 3HG4A 3IIZA 2IKGA 3QTGA 2Y1HA 4FS9A 4ZODA 3PPFA 3AXKA 1OT2A 1RA5A 1Z8AA 1UMYA 4UFHA 3URBA 4XAZA 4YVVA 2V5DA 3DHPA 3KDOA 1R2SA 3USZA 2L5HA 4WJ8A 1XIDA 3AZRA 4EOUA 3VNMA 2DT0A 2BXZA 4LU0A 3TSMA 3HMCA 4FIQA 3E38A 3WLTA 2GJXB 3TTEA 2R1NA 1R7AA 2PODA 1KC7A 1NOWA 2QZRA 3ITCA 4LS1A 2ATSA 2BV9A 2CKSA 2NVDA 3WLRA 3L2IA 1R86A 3CO4A 1EZWA 2ZX8A 3BURA 2JEQA 4DJEA 2A3AA 3DOPA 5D2WA 3KLKA 3W01A 4ADTA 4JTTA 1WCGA 2C0HA 3N6JA 1G5AA 1OF6A 3TJXA 3BOFA 4H9MA 1XH1A 3CS2A 4TTUA 4A3QA 3FY1A 5IDIA 3TYBA 5L6UA 4RNIA 1UIOA 4EXAA 4WY0B 3VK5A 1HTIA 1TRDA 5C9RA 3CIWA 1JCLA 3OA3A 5T26A 1HKIA 1EGMA 4MY1A 2BGQA 3NQFA 4HNCA 3MWAA 2QJJA 5CJMA 1FWJC 4HZMA 2O4QA 1E5JA 3U2OA 3QF0A 3W29A 3ZT6A 3DUGA 3L65A 5I00A 3URNA 2V5CA 2AL2A 1PKLA 1UWRA 4R7WA 4ATWA 2GJLA 1O95A 3WMBA 2GJPA 3U7BA 2QIIA 4G7EA 1X6NA 4GOAA 1JPDX 3UWWA 2BHYA 4AD3A 4QR6A 2YL6A 3U7VA 3ZWSA 4PGLA 2VT0A 1RCXB 2ABBA 4JBRA 4TMBA 1JF6A 2V8ZA 3NNTA 3VVGA 4AY1A 1P6WA 3FXYA 2O9OA 5EFDA 2XVGA 4AF0A 3AYTA 5J8LA 3MUAA 5IRPA 2WZIA 1UR3M 3DFHA 1VIZA 3MHFA 1NTHA 3SECA 5LGZA 3LGDA 4KFOA 1C8VA 2QS8A 4MUZA 3R7MA 5E6ZA 3EMQA 3FKKA 3QQWA 3TC7A 3P81A 3QMRA 3DFTA 1XBZA 2GQAA 4Q4OA 2OPJA 3GZAA 2WAGA 3T4WA 2X7WA 5D9PA 1R85A 1SR9A 2WSYA 3A47A 3GUWA 3CUHA 1E0VA 4L56A 3UESA 4Q6XA 1JDDA 1QFEA 3OVQA 3F5KA 2PRLA 3PBVA 2ZTJA 3W88A 1MUMA 1W5NA 2PWHA 2FPTA 3GIPA 1H62A 3QGAC 4N9BA 3PTMA 4PTVA 5D2VA 2QNEA 2UY2A 3I7QA 2WC4A 4YTSA 2AMXA 3ECQA 1MDRA 1WKYA 1MYRA 3JVAA 4H00A 1E4MM 1X8FA 1PTAA 5AHIA 1TV3A 2WQDA 3MSGA 1UWIA 3W53A 1GONA 1W3JA 3TP4A 3W70A 3UWUA 3LHYA 3TUUA 4WDXA 2CLIA 3CH0A 4F3HA 1H50A 6PTDA 1A4MA 1O66A 2WM0A 1P1XA 1D8WA 1QPRA 2YA2A 2IS7A 1FQ0A 1M7OA 4UTFA 5HXMA 1LQAA 1YXCA 4Y9AA 4AY8A 2GVGA 1M04A 3EWUA 3D0CA 4R34A 2QVHA 1NEYA 3HJZA 3M5ZA 1R30A 1EIBA 3E9AA 5CPSA 2GK1A 2WMKA 4J3ZA 4C6QA 2INEA 3W7PA 4US5A 1EF2A 3VUPA 1P0DA 2PTYA 1OCJA 1PCKA 4P7LA 2PLJA 1UUQA 7XIMA 3UD6A 2OX1A 2ZUNA 4QAWA 4U3CA 1BLIA 4G56A 1XLCA 4FXJA 3HIJA 1D3GA 4AHOA 1QI0A 1SZNA 1YRRA 4DZHA 6ENLA 2GOUA 5BU9A 2YLAA 5CC3A 2J7HA 3RM9A 3NM3A 3TFCA 3IUHA 4O1AA 3SGZA 1W9DM 1HVQA 1JPKA 1AW5A 3KRZA 4PBGA 3ABOA 1CZ1A 5GQBA 3SCSA 1TVNA 2C14A 4KCVA 3T81A 3WDPP 4S3JA 1ITQA 1DJNA 3VMNA 2OZ3A 1E9IA 5I23A 4Z08A 1W5PA 2DJLA 1V79A 1EP1A 5HJLA 1XS2A 2GVLA 1GUVA 4LVGA 1UP2A 2FYMA 1GJUA 4M7SA 1XIGA 1CGXA 2WW5A 4MUPA 2Z6JA 3AWNA 4NZJA 1QNPA 2CLKA 3VU2A 3EBVA 2ZRYA 5FD0A 1VP5A 5B80A 1AA1B 3C0JA 1V3MA 2PWFA 5A6KA 2QPUA 1Z7AA 2WK2A 2YW4A 4IICA 1HF6A 3RPTA 3D3AA 1Q6GA 1GHRA 2R6OA 3L0NA 1FXPA 4IPJA 3W3OA 1V0MA 3BOXA 1KTBA 1RQEA 1VCFA 5JQ9A 2XH2A 2XINA 2OSYA 1K77A 1XLBA 3BSMA 1S5WA 1JZ8A 3GU2A 2WSRA 1HP4A 3GG1A 1RJRA 3TYAA 1A3XA 2QMKA 5D9OA 1E3XA 2VDIA 3EA2A 1DP0A 4ERAA 7PTDA 3JU2A 4R3UA 1LUCB 2FJUB 1VB9A 3TYEA 4LS0A 1HVXA 1L8PA 3RF9A 4K37A 1GKPA 1TMQA 3N15A 2ISVA 2YCJA 4D6EA 5D03A 2OYKA 4NXSA 1RVKA 1XSIA 3CWNA 4BY3A 3OG2A 1Z9AA 3OG3A 1P6BA 2G4FA 3P80A 1IZKA 9CGTA 3QKEA 5FESA 1FKWA 4JNYA 2YX0A 1BF2A 1RLDA 3BAKA 3VNLA 4RLIA 4WSKA 2VVNA 3UXLA 3UF9A 4MG4A 3TE9A 1JYNA 1XLGA 3GK0A 2HNEA 4AZIA 4EE9A 1MUWA 5A8PA 2XVNA 1SZEA 3MQTA 4F2UA 4DWSC 5GPRA 5FJJA 1MFUA 3N9RA 3NZPA 3AHTA 3QXBA 3PBYA 4DNHA 3WEZA 4A4AA 4CVUA 2C7FA 4R7OA 1C8QA 4I9JA 1X7FA 2HS6A 4JQAA 3SJNA 4JL1A 2CZDA 4QDWA 4XV0A 2GLKA 3E0LA 3VMOA 3PJWA 2ZDRA 2PC4A 3DECA 1S2CA 1JCNA 3QSTA 4B9YA 4IQEA 1H7WA 2EKCA 4WKHA 2PDXA 2CKRA 4KMQA 1RSCA 5DCEA 1VLWA 4YWSA 3NQDA 1U5HA 1OIFA 1LWHA 4P7RA 1SMAA 2XFRA 4E2BA 4WY0F 2VZUA 4CQCA 4ZSUA 1J8VA 3KE0A 3M1ZA 4Q8OA 3C0LA 1CB2A 3VXGA 5AVHA 1HL2A 4ZA0A 3GDMA 2G3IA 1ZZMA 3L4VA 4S2CA 3NYZA 1MW0A 1NF0A 2C3ZA 3L23A 3TZFA 4S3CA 3BSHA 5A6BA 3VIMA 1WQ5A 3KEHA 1Q4WA 4MDOA 2GOKA 5IFTA 1NFPA 3G6MA 1PTGA 1YDNA 4AZCA 4ONVA 2NW0A 4GG9A 2V6AA 3M44A 1ZL1A 4ZB0A 1VFMA 2WMHA 3D47A 5I2UA 3D5HA 5IHRA 3NZQA 4M29A 3W71A 2HJPA 4HN4A 3HPZA 4AUBA 3GS6A 2ZA3A 2B0MA 3G18A 5DXYA 3MPGA 3W28A 5LNRA 1YIXA 4AWUA 2PTDA 2FDSA 3M0YA 4QAIA 5CGMA 3BARA 2WZEA 2OT1A 4JTUA 1UPPA 2EG6A 1IZCA 1OQFA 3QR3A 4AWEA 4HZ8A 2CBUA 4ZQRA 3KHDA 2VFFA 3WLPA 3F7JA 3NPUA 5LSMA 1V6TA 2TMDA 5CJ5A 3LPOA 4XKMA 1ZAJA 3CHDA 2CNCA 2OWWA 4UR7A 4NAFA 1V02E 1NFGA 1AK5A 2H3BA 4Y9OA 4E3TA 2VELA 1JCJA 1E6RA 3KX6A 4D6DA 1RPXA 3WD4A 2MUCA 3BZJA 4PL2A 4JHMA 3K4AA 1UWTA 2OR2A 4HMDA 3RJXA 3R13A 2HEJA 2VC6A 3DDMA 4UBPC 1I8JA 5LNWA 5FF3A 3CHEA 4HSOA 5C54A 4ERGA 4E3VA 4B15A 3MUIA 3O05A 4LJ3A 4TVUA 4RZ6A 4BHYA 4DLMA 4N42A 4OIFA 5CPLA 3N4AA 4LF2A 4C6PA 2PD9A 4LVAA 5C71A 3CEUA 2V2HA 3KM8A 3NOYA 6XIAA 4FF5A 1GW1A 4G1KA 4X60A 5CZ0A 3WDQA 4A21A 4DEFA 5DMYA 1K1DA 4M6VA 3WELA 2UY5A 3A22A 1J12A 5F2LA 1VH7A 3BLOA 3STEA 4HSHA 2VZVA 1BKSA 5G2WA 4JDBA 2WCAA 2ZUVA 1UR4A 1V8EA 3D3FA 5AZ1A 3T4CA 4ZSTA 4QQ3A 3VC5A 4JX5A 3LEPA 4BZYA 3ZR6A 1PX8A 3MSDA 1XRVA 2VEGA 1XRTA 2ZZ2A 5A8NA 3SRFA 1XISA 3RX2A 2QJNA 2ALRA 1I2QA 1X39A 4QNEA 4FNPA 1BXCA 1PS9A 3E2VA 4JTRA 3RLHA 3E96A 4ZXOA 1YKWA 3RM8A 1US0A 3BOLA 4GACA 1OT1A 3VNKA 2WXDM 3N19B 1RBLA 2G41A 1IYXA 2DT3A 5G1TA 3VDCA 4C6EA 1S5NA 1R38A 4QJ5B 5EGRA 1S2UA 4OT7A 3CBWA 5F1VA 3MW7A 3Q45A 4ATDA 3DFNA 2PDYA 3GKFA 3SURA 4ZQPA 2Z7KA 1AH4A 3OYXA 1MXSA 1Q6LA 2OQYA 1RVGA 3GG7A 5C7VA 5KEZA 3G1VA 4OOZA 1Q6FA 3UZYA 3KTSA 4RW5A 3VINA 4WRHA 3MBFA 3BC9A 4TV6A 4FLSA 1GJPA 1B5TA 2C16A 2Y7GA 1EUNA 3WJSA 1CGUA 5EKYA 1P6CA 4NRSA 4Q8WA 3H2AA 3NQBA 4JIQA 2W92A 3NL2A 1LBLA 7TIMA 2PTWA 3BCFA 3LCIA 1UA3A 1R3QA 2O9TA 4I6KA 1KWGA 5D2YA 3CM4A 1TFVA 1DJYA 4GINA 2WBKA 1SYTA 3LSCA 3EB4A 2F6UA 3I6TA 3GVQA 1H7NA 5LHFA 4Q4QA 1DJWA 1MW2A 1P0EA 1XR2A 4XAPA 5CSSA 4PEEA 2J8FA 2WJEA 4LEQA 3FKRA 4PUNA 4ZTYA 4XAFA 3HOJA 3BGJA 1EX5A 4NRRA 5C2XA 5DXXA 4DLFA 1UWAA 1VPXA 1PSCA 4IFKB 5HR7A 1WKEA 4GGHA 3UERA 3EA1A 2VEMA 2EPKX 4O17A 3GO2A 4A3HA 3POHA 2HS8A 3NXLA 1EXBA 2V67A 2O55A 2EO7A 5ABFA 3T0AA 2P3EA 1R2RA 1ADOA 4OJYA 2WO5A 4LY8A 1OFEA 2PU1A 1FP9A 1VCGA 1E6QM 1W9VA 3ZIZA 4AHQA 3GNPA 2PWDA 1TWIA 2P76A 4WZHA 2AL2B 3MVTA 1EDGA 4R53A 3PTKA 1E0UA 4ZEPA 4GQ0A 1I2RA 3PFMA 4Q7BA 1LP6A 4WOZA 1GZJA 3GR7A 2DVTA 3NL5A 4LALA 1BYCA 1W3IA 4CKQA 2DW7A 1JPHA 2NVCA 3SRDA 3AZSA 3ZSTA 2VX4A 3UZJA 3TK7A 2NQLA 3RCNA 2J7CA 5HMFA 3EXTA 3H26A 4RNFA 1EA0A 1FCQA 4IIGA 4M1BA 1H5VA 2X09A 3GDBA 3ATZA 3TOPA 3WQEA 3P93A 3QH2A 3WJWA 2E9BA 3VGFA 1VFSA 5H1WA 3WMCA 1IR1A 3I68A 2B7PA 3KUMA 2CW6A 4HGXA 4X3ZA 3CV1A 2ZWYA 2EPHA 2Y5EA 4PFMA 4XZNX 1T99A 4O13A 1M9HA 2HZGA 4GA8A 3W7RA 2FGZA 1NDWA 4ZXLA 1CX9A 3R0UA 1LLOA 3ANVA 1QW8A 2PLCA 4FF7A 4MJ2A 3RYSA 3I4KA 1GOIA 1V02A 2E68A 3DGBA 3TQPA 4QDMA 4B9ZA 1EBGA 4MWAD 5LKYA 5CGQA 1T8QA 3LCLA 4GNJA 3OQEA 1JFXA 1UZDA 3QY6A 1JZ4A 1QI4A 3BWWA 2R1KA 3CUIA 4C6IA 3F2BA 4V1YA 4CEUC 2QLYA 2WMJA 2YB1A 2X1RA 4XAGA 2AOSA 2MNRA 3LPPA 4MM1A 4AW7A 1F5ZA 2W91A 3VD4A 4CD7A 3SUUA 1AJ0A 1E0XA 2P1FA 1H63A 5ABTA 2WB5A 2XJ7A 2J8GA 1ZJIA 3S1WA 3RO8A 4YJ5A 2PZ0A 1FOBA 4N7QA 1RY8A 2ESCA 3HG3A 4RK8A 4P61A 1DJGA 3WLOA 3CB3A 3SGUA 4H19A 4PR4A 1LRQA 1LOQA 1TJ2A 3H53A 4MY8A 3NPXA 5I78A 1V0LA 4RXGA 2X05A 1XCFA 3L5MA 1XXXA 1JGMA 3CHCA 2OO6A 1S1PA 3XISA 4E8GA 2WC3A 3P62A 2X40A 3U2ZA 1Y65A 2Y24A 3K1DA 4KRTA 2RGLA 2D23A 1WZAA 3G1DA 4FIRA 4QG9A 1KM3A 2HBXA 5DMLA 2HTMA 1J5TA 4RKAA 4IQDA 3UWVA 3S9IA 4IIDA 3P5ZA 2WC7A 2OWCA 2W0UA 3LV5A 1FWDC 3MMDA 2I9UA 4FNUA 2JE8A 5AC4A 1C7SA 3E12A 1F6PA 1Z69A 2FFCA 5F4XA 4YVPA 4H7CA 1EYEA 1OCQA 4NG3A 3M0JA 4CQ8A 3ARPA 2V38A 2BXYA 4OBRA 2WCSA 3PANA 4KEUA 3UEQA 4GYPC 3RFAA 4DBDA 5G2IA 5JVLA 5LIWX 1F73A 3CV7A 1R87A 3MYPA 1XIMA 2FB2A 3M0VA 1D8CA 3DERA 4J27A 1FA2A 3VUSA 3SUTA 4Z2KA 3E49A 4PMXA 5A6LA 3BLIA 2ICSA 5MKGA 3BSGA 1IXQA 4GCXA 3M0ZA 4GQBA 3S9YA 4XZBA 1M03A 1W9PA 3KTXA 3TWBA 3BICA 2WBGA 3SW6A 4EP8C 1H5YA 4KT2A 4O1EA 4MJ4A 5FCZA 4KWVA 4B5NA 4K1GA 4OHQA 2AQVA 4N6EA 2H90A 1M65A 5I7GA 1SFSA 2YW3A 3SADA 4NKCA 1W2PA 3HPSA 1QJWA 1IQ8A 2QF8A 3G8RA 3QY8A 2VOMA 3VKCA 1L6YA 4GY1A 4YS1A 3W38A 3VCNA 4KWOA 4W5UA 3TXVA 2OGJA 1QTWA 2XISA 1HKJA 2HVMA 4XZIA 3WK2A 1DWAM 3E5BA 1WKDA 2Y5JA 3EX6A 3L4YA 5E09A 3LXCA 1XRSA 1TVLA 3QFEA 1KFLA 4QFUA 5HPOA 5AYYA 3WF4A 3GHTA 3W7DA 3R11A 1B9BA 3E0VA 4O50A 3DYOA 1XF0A 4AQLA 3TYCA 3PZMA 2NQ9A 3LZ5A 3HURA 3BGAA 3LTSA 3WLMA 5I5RA 4KCWA 3MI3A 3G1HA 1OZQA 3V0SA 4J40A 1XD1A 1MXGA 5EYWA 2BVYA 3U48A 2BTMA 5AYZA 4Z1DA 1SR0A 3GG8A 3BE7A 4LUTB 1UD5A 1YNYA 1SJDA 1A0EA 3QW4B 1JF5A 2YOCA 4X63A 4JNZA 7REQB 3AWOA 2OELA 5C9UA 2CHNA 3E0IA 3GXPA 3AJ7A 4XBKA 1J0IA 3AHYA 3UG8A 4BKNA 1E0TA 3I10A 4H9XA 3AYRA 3DENA 4IP5A 3JR2A 1B3ZA 4XISA 3GTNA 1HX0A 5DCDA 1TPDA 4HZ7A 2WMGA 1A80A 1QHZA 1DWHM 2WANA 1LZOA 3T40A 2NV1A 1X6LA 2VM8A 2WM1A 1G4SA 4XZ9A 4ZL1A 4JIPA 4QLKA 3G6LA 4IQJA 1NWRA 4YCOA 2W79A 1MNSA 3S2LA 1KM6A 2D73A 5B7ZA 1EPXA 1SZRA 3QOMA 1EL3A 3NVTA 3H2FA 4Z2JA 3GFYA 1XYMA 1FP8A 4IQLA 4IGSA 2Z0IA 4O0KA 1FWCC 1EJRC 3THUA 1CXHA 3NEHA 4JHOA 3UCQA 4L6HA 3H4WA 2VFGA 1MXDA 1N8WA 2ZC8A 3MBDA 4HOXA 1VC4A 4HD5A 4QDPA 2OQHA 3GAKA 4UZSA 1X97A 2CC0A 4JTKA 4IF2A 4NL1A 3W87A 4ZB2A 3MANA 1BYBA 1UZHA 2DU2A 4E8CA 1K8YA 2NWSA 4S3BA 5AYIA 1KFBA 2XN1A 4J3VA 2OX4A 2HV5A 2Z25A 3S9ZA 5M1TA 1HO1A 2P53A 3OZOA 4BQ3A 1V77A 1IXPA 1G7UA 3DHDA 1OINA 1AQMA 2CERA 2HVNA 4AZCB 1KRMA 1QPKA 2A5HA 1EBHA 5CSYA 3ZSSA 1MNZA 4Y9PA 2Q02A 3C2YA 4FO4A 5AKQA 2KAUC 1EC8A 3S1GA 3UW6A 2PAJA 2H3DA 3GNRA 3BLDA 3EB3A 3LNPA 4XX6A 2TRSA 2FKPA 4MPKA 2DQXA 3TH6A 4O15A 4O16A 4KGLA 3CMFA 5EBUA 3IVUA 2ZKMX 3GQYA 1FWHC 3SIZA 2WVVA 1AUSL 1MEIA 1M7PA 4JYEA 2XVPA 7TAAA 6REQB 2J7BA 4QROA 1GPFA 1E6NA 5EU9A 3STGA 3WK1A 2ZX6A 3OLEA 2ZE0A 3NQVA 1SSDA 3VFLA 2VRKA 3K4DA 3IJ9A 4IFRA 3POCA 3WBXA 1IXOA 3SDOA 4HCHA 2YYTA 5HQLA 1ODUA 4NAEA 3GNXA 3R8HA 3PWAA 5IBXC 3GNDA 3SN4A 3R25A 3Q67A 3GFXA 4INFA 2VWSA 3ARXA 3STFA 5AFDA 4NAFB 3VCCA 4BWLC 4CU7A 3BQ5A 4EXBA 1JUKA 4O12A 4JHZA 5D05A 4QISA 3QR1A 1EJWC 2Z1XA 4LQ1A 3DCPA 5HANA 4IOTA 5DBUA 4HNVA 1TTPA 1AODA 3KZSA 4AEFA 6XIMA 3TA6A 3T42A 3KRSA 3VDBA 3HGRA 1TCMA 2A85A 4JTGA 4WEVX 2WNZA 2JEPA 4IFOA 2Y7DA 3KVJA 1T8XA 3K13A 3PNUA 3CZ8A 2ACSA 1KXVA 3MJYA 1H11A 2IPWA 4HN8A 5TIMA 1PBGA 1WYIA 2B4GA 2VXNA 1OFDA 4JEQA 1SJCA 1VYSX 3GTFA 3V1HA 2W61A 4LBSA 1TPH1 4H01A 3LI1A 4XIAA 5LXEA 4R27A 1N8IA 4UTUA 1ZFJA 1HO4A 2F7FA 4FXFA 1T96A 3FYPA 3WX7A 4H6QA 1L0PA 3QLDA 1AMYA 2QCGA 3M5YA 2XIMA 5BOEA 4DRSA 5SWUA 1B57A 2NQZA 4WR3A 5TQLA 1XD0A 3O16A 1VBJA 3PJXA 2ZXBA 2FHBA 5FF7A 3ZZ1A 2VO5A 1AD4A 1KNWA 3ONCA 1MW1A 2PP3A 4JYDA 1MFVA 3EWYA 2J9ZA 5FJOA 3WD3A 4LV4A 2Q01A 4P8VA 1VYPX 3PVFA 1EWDA 1FKXA 3VE9A 2XWEA 3KOWA 3A13A 4RPQA 1J4EA 3EWWA 3WUBA 1QBBA 3FVDA 3QQ1A 3RIKA 5JBFA 1WDDA 4XBJA 4QE4A 2F61A 1SJAA 3PS7A 3OQ8A 4L9XA 4A3RA 4ZTXA 4N6FA 4KRZA 5EY5A 5HNTA 2E40A 2DT1A 1RQHA 2VD9A 1A5NC 4HNOA 1TWSA 2DVXA 2WNWA 3WQCA 3KL5A 2B7QA 2BGSA 2WHMA 1ALDA 1VJSA 3WF2A 3GTHA 4FNRA 4Y96A 4UOZA 4UTWA 3WKZA 3SRKA 5C0QA 2OLAA 4MDPA 1EEXA 3G5EA 4H6RA 1FWNA 4IG2A 3HQ1A 3NZGA 2VHLA 2QUUA 3EOOA 3BLFA 1FWSA 5BXSA 2HQAA 2IQDA 2ZZ5A 9XIMA 5CG0A 4KCTA 1TV4A 2XUCA 3CH9A 2ZCGA 4BQ4A 4AWSA 3K8MA 4DJDC 4D72A 1TWDA 4MY9A 4QTGA 3GRIA 3B9AA 3A4JA 5HJXA 2OODA 3PM6A 3WBWA 4IIHA 4PUMA 1I0BA 4HSNA 2G3NA 4GJIA 2AL1A 1Z6KA 4B90A 1AFSA 4FOJA 3PB0A 3BJSA 4KWWA 3T6CA 2HMCA 4BQ2A 1I1XA 1IXNA 3DGRA 4S3EA 5HDRA 4Z2GA 3W82A 3E6EA 3ERPA 4RPPA 3VOJA 4I5RA 1EDTA 4LB4A 3MMWA 4WJXA 2BG5A 4HT3A 3TFXA 4U2ZA 1IT8A 2VL4A 1V03A 2BGNE 4UCFA 3PFRA 3KBNA 1YNQA 3KBJA 3O06A 4XBSA 1YTDA 2YSWA 3TSDA 3TIMA 3KP0A 5XIAA 3OZPA 3LPGA 1MQPA 1NSJA 1PIGA 2VOTA 1GZ1A 2E8YA 2GDVA 3B97A 1TX2A 3WFLA 1K3UA 3GU1A 3R43A 1O68A 1G01A 1XX1A 1J6PA 2ZRUA 4AYSA 5C8BB 2QUNA 4FK9A 4QEEA 2FDMA 2WKJA 3A9BA 2POTA 5AHLA 1BWVA 2VVSA 2DDXA 3W1NA 4JEJA 3ENLA 4LYPA 4AC1X 1IWBA 3WDRA 1L9WA 4UOQA 4ZQNA 2J47A 1M3UA 4GFSA 4X61A 2JGQA 1C8YA 1PEZA 3MKVA 4GO9A 2X0YA 3JUGA 1MVYA 4AU0A 5BXPA 4KQNA 4ORMA 2R91A 3NQMA 2D2OA 4E2VA 1XYLA 4DUWA 3B0XA 4GXPA 1JL8A 2V30A 1YEYA 2XM2A 4PH6A 3TW9A 1LQ0A 2XH0A 5GJPA 3NL3A 1KGWA 3V75A 1L2QA 3GXMA 4DZAA 3O6AA 3VX0A 3GSMA 2ALDA 2YFOA 4LTSA 2BY3A 1OJXA 2V3GA 2C1HA 1ZCCA 1JQXA 1BRLB 5EBAA 3PUGA 4AHPA 3CWOX 2Y62A 1KXQA 2XWDA 4GC3A 3CV2A 2PTZA 3IRDA 1OIMA 2WYSA 5DBTA 2XU2A 4K39A 3WEMA 3ITOA 1KM0A 2YL5A 3W74A 3WO8A 4IUOA 3GDRA 4XUGA 3OJGA 1O5RA 2J7FA 3PZQA 1XLAA 3EMZA 3CUXA 1Q7QA 3BL3A 1YADA 3W7QA 4GC4A 3VZZA 2PGFA 1K6WA 1LBFA 1QXLA 3RXZA 3C3UA 2VDHA 3F4CA 4UIOA 2HK1A 3L4ZA 4UNKA 2C0AA 1FCVA 3VC6A 4URIA 3TOYA 1QDSA 4AH7A 2QF7A 3QGVA 3IJ8A 4NZ5A 4DJFA 3CASA 4JOMA 2G3MA 4Q4RA 4GE8A 4TIMA 3TZNA 3OGVA 2YKKA 3W37A 4GBDA 2C8NA 1Q6RA 1RP9A 1JR1A 2DSUA 3PZVA 1JYXA 4HOWA 3NFUA 5DMMA 3RX3A 1EF3A 1K9FA 1SO5A 1R3TA 4Y2WA 2ZVRA 4JAWA 3WIJA 4TXEA 2BOFX 1PPIA 3TX9A 1BSLA 3ES7A 2ACUA 1DXIA 2PDHA 4FHAA 3VD3A 2PI6A 3K30A 3MI2A 5A2CA 3AIQA 4IT1A 1E4NA 4ZMGA 1QK0A 2X8RA 3S6TA 2OQLA 4JQ2A 3BLPX 3QC3A 1ELSA 5HNRA 4OE7A 2X2YA 4WKAA 2WMIB 3STPA 1Q7MA 4QXIA 2E3ZA 1ZNNA 3KOXA 3VZXA 5DO8A 4MVAA 3VGHA 3UWYA 3MV11 1YXYA 2QCDB 1W1YA 2WKGA 5C5YA 2R1MA 4O1BA 2POZA 3ZXWA 2CITA 5REQB 1PXGA 3A21A 2BY2A 4NZFA 1I60A 3AROA 2G8ZA 1ZJAA 4QJ4B 3WYZA 1TZ9A 4FXSA 2OFJA 3DXIA 2WJZA 2FZNA 4AX7A 3LOTA 1REQB 2A2IA 1YE6A 2Q3OA 5FEZA 3ARQA 3RNDA 4WY0A 3DHUA 4BR1A 4I9TA 2RFGA 4NZ4A 3WDJA 1POKA 1Q66A 4HPNA 3NTYA 1PB0A 3UNTA 1KCLA 2W3ZA 3KWSA 3GHRA 1RV8A 4B2DA 4F48A 3TONA 3BUVA 4GZ7A 3CQHA 2X0SA 3M0LA 1KFCA 3LX9A 5HMSA 3P2VA 5GNYA 1XHGA 4ML9A 1EP3A 3R94A 3WH5A 1QHOA 1V08A 3UPMA 4WF7A 5D8ZA 4KBXA 3THAA 1FHUA 2J24A 1FXQA 1E1FA 4QRNA 4GI4A 2X2GA 2ZADA 3MMUA 5I3GA 3PWIA 3KOZA 3HB9A 4W8AA 3N2MA 3LHTA 3TJLA 1G1YA 1HJSA 2VURA 1BGAA 4JTDA 3VIPA 1I45A 4ZB5A 3SCQA 2O7SA 2Y6ZA 3LTYA 2GFTA 2E4TA 1T41A 1UQZA 1AQHA 4CQAA 1OADA 4EVZA 2A7NA 1TPUA 2VX6A 4CNNA 4NX0A 5AHMA 2PWEA 2CLFA 3DFSA 2ZUSA 4LNCA 5DEZA 1F6KA 1N8FA 3LRLA 2ZXAA 3GVWA 4H7ZA 2Z4GA 1RJQA 4GRSA 3HN3A 1GVEA 1VYRA 1KBIA 4GI9A 5K9CA 3A5VA 5HWJA 3SIMA 4Q8QA 2DJXA 1YYAA 3N9KA 5A94A 4NNCA 2CYGA 3C0SA 2J27A 2Z00A 2ZBTA 2BOEX 4DWDA 5FKYA 2Z29A 2KZHA 4MHBA 2PGWA 1SM9A 2PDJA 1FWAC 2Z26A 3G1XA 4MFEA 4D6CA 1MEHA 4DZIA 1XC6A 4DM2A 2E67A 5JIWA 3UZWA 4MIMA 3G8EA 2V0TA 3BV7A 2EJ1A 1KQZA 1GVIA 1QOPA 4JFTA 5TD4A 2IQTA 1GTHA 4P5UA 3IRSA 4O0ZA 3O07A 4ADSA 4H8HA 1OBAA 4F0SA 3A9IA 2EAWA 4GQRA 3VIOA 3D46A 2E9LA 3TQVA 1TTQA 1LL4A 2CZ5A 3LDVA 2WZHA 1F3WA 2XM1A 3TDFA 4EF9A 2FJKA 1U2YA 3O6DA 3U6WA 3ZS4A 3P8JA 3R10A 4OBSA 1EDQA 4KGJA 1KRBC 2FZ8A 5F7UA 3WLQA 3UYIA 2NXHA 1DPMA 3I3EA 3G1AA 2JF6A 2A3LA 4GJ1A 3IK2A 1D7KA 3LHZA 2VGGA 2QUVA 3Q2DA 1UB3A 4HQVA 4UNLA 1U22A 1OYBA 2ZZ3A 3AIRA 1GKRA 1CXFA 3DYMA 4DWSD 3N17A 2WNQA 1K6AA 3DU0A 1C7TA 4NILA 3HTWA 1GQKA 3LLXA 3K8KA 2J66A 4L4OA 1XV8A 2BOGX 2YXOA 4DBUA 2V9DA 3KDNA 5JXQA 2D69A 1QU4A 3TLLA 3SUVA 1N55A 1QVBA 1WPCA 2Y5SA 5A6TC 4B3ZA 3VFCA 4QG6A 5IHSA 3A4XA 4PCTA 2A21A 3VE7A 2BHUA 4ZFCA 4ES4A 4O10A 1V4YA 3TU9A 2W5FA 3RU6A 5BW6A 5HINA 4M5PA 4DXKA 1NWSA 1XWYA 2OKTA 2TODA 3EDEA 5IFPA 3W7KA 4J1OA 3WK3A 4V27A 2BWGA 5CQ1A 4KIEA 2HE8A 3EB2A 2CHRA 3SAZA 4RL3A 1W3TA 3L68A 4AIUA 4IWWA 2YA0A 4NAEB 1W9XA 5E9AA 4AWTA 3L4UA 4RDYA 2DPEA 2RUSA 3T2OA 5A2BA 4LBRA 3S2MA 4HJFA 2PDNA 4PODA 3S5ZA 3W00A 3L5LA 3ITVA 1JCYA 1JCMP 4EK7A 2R9RA 1Q2SA 1DIDA 4NJIA 3VZYA 1UMLA 1PYFA 4H8VA 4FEZA 3W6LA 4FR6A 2YL9A 4JY9A 1RHCA 3ARWA 3TLQA 3G1RA 5BWAA 4UTMA 3TA9A 4RDWA 2VYOA 2WPGA 2NQHA 2C1IA 1SUXA 1GQJA 1JIBA 1B9ZA 5BOFA 1K8ZA 1KFEA 4KFPA 3NSMA 7A3HA 1ADDA 4F0KA 1FWTA 2YDSA 2ZZ6A 2OB3A 2AKMA 3AXXA 1GORA 3ICJA 4AC7C 4HU8A 2HSAA 3VX1A 3C56A 1OB0A 4EKJA 5H2ZA 2QCFA 4KRUA 3KVLA 2PS2A 3FN9A 3LXBA 3PSVA 3UY8A 3S1XA 4QJ1A 2FPYA 2C13A 5HWNA 1LUCA 3CAQA 3FV9A 3U9IA 5J04A 1TQJA 4MAZA 1ISZA 2A3HA 5A8OA 1U1UA 1P43A 1E51A 3SSJA 1A4LA 1ZHAA 3PAJA 4YWIA 4N9CA 2PUZA 2QXWA 4YTTA 2J4GA 1IGWA 2CESA 5GNZA 3F2DA 1SQ7A 3N4FA 2PDUA 2VX7A 3AMLA 4ZZ9A 2HXTA 4JXCA 1RBOB 3H4XA 4JKMA 3LCHA 5TF0A 5D9MA 4CU8A 5HNNA 3H2NA 3IJ6A 1YX1A 2Q3RA 5DT5A 2YPIA 2E8ZA 2GGHA 3VNZA 1KRCC 5ECVA 2INFA 2YYUA 4E2OA 3ZOAA 3WD0A 3HPXA 1R3YA 1THFD 2A3EA 2VKZG 3RU8X 4XTDA 4JFUA 2ABAA 3F5LA 1MQRA 1WXYA 4C60A 4UQEA 4W5ZA 2WKLA 1A5CA 3HA1A 5D32A 4IG2B 5CJNA 3NQGA 2WLZA 1ECEA 4JQ4A 2Q6ZA 3BAIA 1KM4A 4A8NA 4NU7A 1RP8A 3W1LA 3P5YA 3R8GA 1Q6CA 2Y7EA 3BJFA 1RY0A 4QBXA 4RUBA 1JCXA 2Y4SA 4C90A 1KKRA 1E43A 1GOWA 2VI0A 4TOQA 3OGRA 3P74A 3WH7A 1BPLB 1DQXA 2DORA 3THDA 4UTIA 4PUWA 3SBFA 3CHVA 3IIPA 3WLNA 4GVGA 1O6IA 3CPUA 3ZQ9A 2A79A 2ZTKA 1KM5A 3THQA 4UTHA 3CZKA 3IV3A 3H70A 2RDUA 3W1XA 2O4MA 4UQBA 3FA3A 3O1NA 3O15A 4M51A 3PJTA 4HMEA 3FIGA 2YCLB 1WZLA 3A23A 5HR6A 3A4WA 1AZ2A 3CL8A 3QVQA 1W37A 4JTLA 1TG7A 1V6YA 2J7GA 3V0UA 5LYRA 2D3NA 4W7UA 3BZGA 2V69A 3MA8A 3T44A 5AN7A 3GVVA 4GYFA 2RDWA 2OOFA 2BY0A 2FTWA 3AHXA 3S6OA 4CCZA 1UR1A 1W54A 1CCWB 1A5LC 1YBQB 3T09A 1HXJA 3PZOA 1DJIA 4FOUA 3SN0A 4NZ3A 1GVRA 3FSTA 2NZLA 1K03A 2XZ9A 3QPZA 4U4MA 4ZQCA 4C6JA 2QJIA 1XBVA 2J62A 4LUYA 1MO0A 1SMDA 1R0MA 3E0WA 2Y61A 3EYPA 3PSWA 1ZLPA 2R1PA 2YFNA 1L6GA 1FDJA 3TSBA 1XL9A 5PTDA 3FLUA 4DM1A 2X1SA 2NQJA 3GYEA 2ZVIA 2DP3A 4NI3A 5BXRA 3T2PA 4C6NA 4GNVA 3NSXA 1PKYA 4AD2A 3TTOA 2A6LA 2I14A 5K9XA 3KRBA 4BF9A 3DEQA 4M6QA 1TWWA 4WCJA 3M0MA 3G0SA 1US3A 4JTCA 5LA0A 3QPEA 3IIXA 1Q4NX 5U7SA 4E5TA 3VTRA 2CBVA 1E72M 1G9HA 3ES8A 1Q45A 1V0NA 4FALA 2CZEA 2R8WA 5AHNA 3BH4A 4PCFA 1EYWA 4GWEA 2GWGA 2QMJA 4IPIA 3VMPA 1TRIA 4P2VA 3L4XA 1Z42A 4CQBA 4EPDC 3UBPC 4P7OA 1B3XA 3H21A 4F40A 1NOFA 4H9UA 3AU6A 1DIEA 1EIXA 1M7JA 1X7IA 3N18A 4BF5A 1OSEA 4YVXA 3L2LA 3WNNA 4NNAA 2E9MA 4AIOA 1FWWA 3UETA 4V2XA 4HHHA 1YPXA 2NWRA 4FX7A 3UR7A 1Q2RA 3N13A 2P10A 1XLLA 2PF8A 4CN4A 1GQIA 2DZVA 2NLYA 4IMEA 2F2HA 3EEZA 3Q37A 1OX4B 1SSGA 1UWSA 2Z7GA 3PP7A 3PK7A 1BVNP 5I24A 2YIHA 2TAAA 1AH3A 2Q71A 2VENA 3GLCA 3EXSA 1RXOB 1ME9A 1PCWA 1RALA 1SPQA 2CBJA 4D6JA 4DO6A 4HA4A 3OVGA 1FDYA 4KIRA 1WZKA 4PUKA 1BQGA 1EO7A 1V7YA 1J79A 1XPGA 4J3WA 4MJZA 4Z17A 1UD8A 3BMWA 3LRKA 4WDTA 1JCTA 1DEDA 3QHOA 4UMAA 3C6CA 5EL1A 1WDRA 2GGJA 1W5QA 2VGFA 2DUXA 3IAPA 2ACRA 4ZE4A 2G50A 1TMLA 3ZO9A 4DWSB 2Q8XA 5HUPA 4ROPA 5E9XA 1NP0A 4WGHA 1S38A 2DVUA 4GXWA 4Y8EA 1H7OA 2ZQ0A 3I65A 1R2TA 4FZIA 1W3KA 4B5UA 3A3XA 3ID7A 4ORIA 2GWNA 3MV01 2WLYA 5M2FX 2HE5A 2DW6A 2HWGA 3WUGA 2GQ9A 4QP0A 4PFHA 2BY1A 2E09A 1MQQA 3BXWA 3KOYA 3GXIA 2O9RA 4WOQA 1FWEC 3MP3A 3QFWA 3AFBA 5DRIA 1MZHA 5D9NA 1QATA 1A5OC 2DUAA 3M7SA 1M6JA 1C91A 4GCAA 4Z0JA 3SFKA 4CUCA 1W2VA 1ITUA 2WHLA 4J35A 4MTVA 2GQ3A 3AUOA 1T6MA 3EX4A 1VAHA 4POCA 3EWCA 3OBAA 3T8LA 2E5BA 5LA1A 3IVTA 5JBDA 1W0MA 1DQWA 4DO7A 1PVNA 4HVXA 1CEOA 5I77A 2HPMA 1GVYA 4NNBA 1XIIA 1E56A 3VOFA 3ZT5A 2FH8A 4GY7A 3SCRA 3AXIA 2OEMA 5CC6A 4PMDA 4IFKA 3IV8A 3QKZA 3CT7A 3WQWA 4Q4KA 3FDGA 1YHTA 2IKJA 4J5NA 3EPNA 1NQKA 3DI1A 3CZGA 3HV8A 5MF5A 2OEKA 1FCUA 5C9XA 1AZ1A 2GGGA 1FH9A 1POJA 2YCIX 2DGAA 3CQ0A 2QDHA 4HKPA 3VIGA 3RRXA 3RK8A 4KS0A 3K1GA 2ZDSA 3VCRA 4M6PA 4DQWA 4GX9A 2YXGA 3FEMA 3WLIA 4YYCA 3Q65A 1CPUA 4J3SA 4LYKA 9RUBA 4PE8A 3W81A 1ZBVA 5I3JA 3N3TA 3BANA 1XLMA 2YLLA 2WWCA 3AIEA 4L9ZA 5DF0A 4G1NA 4Y8FA 2QPXA 1UIPA 2UY4A 5D38A 1F07A 1HUVA 1KXHA 4MB5A 2Z28A 4AX6A 5DRCA 1FWIC 2ISFA 4JTQA 3S5YA 3M41A 3AU2A 4WD0A 3PUDA 2VC9A 4HBKA 2JKAA 1E6ZA 3ARTA 3WQ5A 3A3WA 1VGAA 1AJZA 1C9WA 5E0FA 2GZXA 4ZBCA 1VFTA 3ZLFA 4PMOA 1JNEA 4HNTA 3VABA 3MI6A 3S4TA 3BGGA 1H41A 3JZEA 1WX0A 3N12A 1GGOA 4LGXA 4OOUA 4GNKB 3CAKA 4UCGA 4MOZA 4E4PA 1UC4A 1L6SA 3TN3A 4CVWA 3F5JA 3CUFA 3E5PA 3TW6A 5HULA 2BVWA 4DF2A 2QUTA 4DPPA 4DBWA 2PDIA 2W67A 5HAOA 1CECA 3S83A 3M16A 3SQLA 3C52A 5AC8A 1CIUA 4CQ9A 3HGJA 4JNMA 1A49A 4Q33A 2WNNA 8RUCA 1JXJA 1OD8A 1HT6A 4RZBA 4EF8A 3S1VA 4LT9A 4GQQA 1LTDA 1K7EA 4Q4PA 3LB0A 4CD5A 3UP8A 1ZGDA 3RITA 4WX2A 4HHPA 4QITA 5I3IA 1SW3A 3RX4A 5D02A 2WJDA 2V82A 1KLZA 5EB8A 3RM4A 4J3TA 1U5JA 3NXFA 4WVXA 4GABA 4W84A 1XLKA 5C9ZA 4OV4A 3W25A 5FJRA 3VIKA 4M81A 4WJEA 1YDVA 1T0OA 1IIGA 3HJEA 4MLJA 3OBEA 3GDLA 4JD4A 1UKTA 4Z2LA 3DC8A 2V5BA 2QAPA 4R7JA 3VOCA 3MJMA 4M19A 5DELA 4M7TA 1TIWA 5C6MA 1JDEA 1A0DA 4LUJA 5E5CA 4JCMA 1WDSA 3CAWA 4PTWA 3U4FA 4DUOA 3W1AA 5BNKA 1NVMA 2Y8VA 1BXBA 3N6QA 4DZ5A 4D6HA 3W1RA 2B7OA 1VF8A 4F9DA 3ARYA 1KCZA 4H8UA 1OD0A 1QNOA 3A24A 1IIHA 2OEJA 1MI3A 2QR6A 3SUWA 4H3DA 4O8AA 2JALA 1WAWA 1A3HA 1KBLA 3W72A 3P0XA 3WY1A 4B5XA 1OY0A 3SSZA 3FJ4A 2FZBA 2BVDA 3QW3A 5GJMA 1B0IA 1DJQA 1M01A 1TJPA 3B4UA 1VFFA 5F4SA 3PG9A 3VNDA 1OZMA 4GUIA 4ZQMA 4QS6A 2F9RA 1G69A 3L4TA 4N02A 1SFJA 4IMAA 2F8QA 3VKJA 1OCNA 1RR2A 2J7EA 3THCA 4WUIA 1LL6A 3WDHA 3WL0A 1BWLA 3NWRA 1SW0A 4UTJA 1PDYA 4I8YA 4YIWA 1N2VA 3PZTA 1O1ZA 4NP7A 3W2MA 2OZ8A 3NQ2A 1XLIA 3RN6A 4MMWA 2RDXA 1GVSA 4ERIA 1RD5A 4AEEA 2Y8UA 2CWXA 1OFOA 3FA4A 3M6YA 1NH6A 3W75A 3WNOA 3GU9A 1S2AA 3M0XA 1KXTA 1XCWA 2C71A 3MCOA 1GYNA 1BG4A 1VS1A 4PZVA 1GOQA 1OGBA 1FWFC 3GDTA 1J5SA 4DXVA 4JTHA 4A8RA 1LG2A 1O12A 2DSWA 4BS0A 3FW6A 1Q8JA 2QKFA 3LN3A 1UOZA 3CTLA 1DOSA 3QM3A 2XSBA 5KZDA 3W2NA 3ZJ8A 5U4NA 1W1TA 4HTYA 4KW2A 3NCOA 4PTNA 4PRRA 4XUYA 4FA3A 2PMQA 1B30A 2QCHA 1NFBA 2D0GA 1U1JA 1XIHA 2HXUA 1Y7VA 2VRJA 2X16A 4YTUA 3TN6A 5AECA 2GSHA 1RCQA 1QNVA 1HJWA 3G0XA 3ISIX 1TCDA 4I7VA 4KERA 1CLKA 3N29A 3NJ3A 4AVOA 1TE1A 3FHAA 3MSYA 4ECLA 1F7BA 5E0KA 3DBPA 1FCBA 1R6WA 1DE6A 4LUTA 2H6RA 3G0UA 3SEPA 5AC6A 3R58A 2BVTA 3KAOA 1N82A 3MY9A 2QAFA 1JZ6A 4IL2A 3S1UA 1BSIA 1KGXA 7REQA 2QV4A 3AC0A 3OU8A 1Z48A 3CWHA 3O8AA 2Y0FA 1R9XA 2NV2A 3OZMA 4AYGA 4IMDA 4DHGA 1VFLA 3WLJA 3H4GA 1R3RA 4R33A 3E3HA 4C6CA 2D0HA 3PUEA 1I75A 3M7WA 2FTYA 1Z32X 4NJGA 1FHLA 3GVGA 3MO4A 3VD9A 1JVNA 1W31A 3F4NA 3FGCB 1KKOA 3UWQA 1UP0A 3KL3A 8XIAA 4K2SA 1X1OA 4XVDA 2X1UA 1NAL1 3LS9A 4GO8A 3DI0A 3BAJA 4U28A 4WXYA 1FFQA 1J0HA 4IJBA 6A3HA 2OSXA 1PX3A 1VFOA 3MMTA 1MSSA 2BB0A 1BAGA 1U33A 1JG9A 1CT5A 2MANA 4O4WA 5H8UA 4MLRA 1QW9A 1PHWA 3VOIA 5CSRA 4HHLA 3F4DA 2PLKA 4EAMA 3CC1A 4H1ZA 2G5WA 1LDCA 4AG0A 3H7UA 2WZTA 1XKJA 1X96A 1EHAA 1YTEA 3RPDA 4IJRA 4PEKA 2NUWA 2EPOA 4OU1A 2XFYA 3WMSA 4B5TA 5TNVA 7ODCA 5EMJA 4A3YA 3OOQA 4PUUA 4HK5A 3DX5A 3TC6A 3N11A 4XKYB 2XGZA 1V7AA 3M6DA 2VGIA 4ZE5A 3V36A 4AMAA 3EOLA 5ABHA 4FLRA 1HL9A 3PR2A 3M0IA 1TX0A 3GC2A 2QVNA 2EPNA 5J5RA 4BEUA 1CXKA 3EDDA 4CCCA 3N14A 4YLWA 3VA8A 1Q6DA 3WBEA 3PG8A 2ZA1A 2Z27A 3T0CA 3OIHA 4PSPA 1XM3A 2HK0A 6REQA 2ISSA 4S39A 1MMFA 3H2EA 3EMCA 4DJDD 2JFEX 3FJ6A 3OO2A 2PDFA 1TQXA 5AC5A 4MZYA 4UFMA 4C7DA 1GVOA 3A4AA 2OJPA 4EWJA 3ZFHA 4U3AA 1XI3A 4UTKA 1AH0A 4TVCA 1EOKA 5AVNA 4GMEA 1ZENA 3ZLGA 3QHMA 1XC4A 4KH2A 1OGSA 4F0HA 1F4AA 3CZJA 3WCZA 2IW0A 2D20A 1UD6A 1XG4A 3AI0A 1YE4A 4AEOA 1L6FA 3OYZA 2DIKA 3W83A 1BTMA 4LAMA 5JH2A 4LUIA 5BRQA 3UXDA 2VEPA 1NELA 3GIQA 1UUMA 2HRWA 1DORA 3IAQA 4LYRA 3FAXA 3CQIA 3WFZA 5BWFA 4DF0A 4YPJA 4MWAA 3B9NA 2EXOA 4A2RA 2RKXA 3AS3A 1EGZA 1QO2A 3AMKA 4RXFA 5BYWA 5I3HA 5DLCA 3EEGA 2VUNA 3LZ3A 2FGLA 3CTTA 3C5QA 5DANA 1TUFA 4R5EA 5HMEA 4S3KA 1GG0A 4RZ5A 1R3SA 3TV8A 1DWFM 3VNIA 1PV8A 4C1KA 4QE5A 3AMDA 1IEXA 3S5NA 3TROA 5B7YA 5CLWA 1VQTA 4MYAA 5BROA 1E6SM 3PZIA 2XIBA 3CT2A 4IM4A 1QCWA 4PC8A 3QHNA 2PZNA 5J5DA 3ZM8A 4KWUA 2PURA 4G7FA 1K8XA 4FNSA 1WP6A 4H41A 3LXAA 4UTTA 3OTRA 3WUFA 3WNMA 2J6VA 3ZLHA 3N2OA 3RMEA 1DIKA 5DX7A 4Q8NA 2DH3A 2P3ZA 2EEXA 2A3BA 2H8ZA 4DX3A 3D6NA 4L4PA 4GZIA 3UA4A 6TIMA 3I7SA 1KBJA 2Z6IA 1J2BA 2VQTA 4FMVA 3GH5A 4M8UA 1G94A 2OMAA 2NSOA 3AZTA 4US6A 1ZTVA 2YXXA 3MHUA 3SQMA 3P67A 2VQUA 4JIEA 4Z1BA 3LQLA 3QZAA 4UMBA 1A5AA 2EPMX 3IUIA 4ZOEA 1FHDA 3FYYA 4JX4A 2W63A 4X0VA 1CXIA 2VFDA 3LM3A 5A6MA 3V1PA 3B0UX 3BQ6A 4P8UA 2GVEA 4MKVA 4I7WA 1UD3A 3CAVA 4UFIA 4PRWA 3Q58A 2DV0A 2E77A 4W8BA 3KS6A 1QI2A 3AOFA 4DYKA 2BP1A 2G96A 3KW3A 3P7YA 1JYWA 2XPKA 1WOBA 4RDVA 4JN6A 3GKAA 2ZUMA 2UBPC 1YPFA 4QJ3B 2RHGA 1B31A 4OECA 3CYVA 1S2WA 5BMWA 3P82A 2E0PA 3IJQA 3C61A 2V2CA 4J28A 2GVJA 5JUVA 2HROA 1V6VA 5FAGA 3F03K 3S5SA 3W86A 4DIAA 2OCZA 3KTCA 4PMNA 1GPWA 1OGGA 2OZTA 3VD5A 2OYMA 1DTUA 5CAKA 1ONWA 1V3IA 2ADAA 3RLGA 4QQUA 2VDGA 2O7QA 5CSUA 3C86A 3B9OA 1Q65A 3HO8A 1K7XA 3B8DA 2CZVA 1XBYA 3O9NA 4ZOBA 4JN7A 3V3WA 4HNNA 1NP2A 2CLEA 1LM1A 1UUOA 1KO0A 1EP2A 4UQ9A 2J8TA 4L1GA 3SY1A 1TV7A 5I3KA 3G2GA 5GNXA 4PMYA 3SUSA 3VOHA 4XO6A 5DFAA 2QJMA 3ABZA 1J18A 4LVFA 1JZ5A 1E55A 3RMJA 3I6RA 5CZKA 5M3WA 4A05A 1CNVA 2JKEA 4F2TA 2I7GA 4B91A 4M0XA 2ZRWA 2Q8ZA 1VBGA 2AMGA 2PF0A 4JFWA 3B8WA 3HV9A 1DKWA 2WQPA 4JR5A 1KRAC 2ZX9A 3FDKA 3MP4A 4Q8PA 5EA9A 2X41A 1VRXA 1TSIA 4GH3A 3UVIA 3LY0A 4HB7A 4FSAA 5BCAA 2F6XA 3ARUA 4JKKA 3T05A 3LBOA 1PIIA 1O60A 3M64A 1PZ3A 4NQ1A 2DH2A 4PMRA 4DPQA 3M5XA 3QYSA 1DBTA 3S3GA 5G4EA 3LERA 5K4XA 5LIKX 1EX1A 4OBTA 3ITLA 2OYLA 3P6LA 1M53A 3BPWA 3UJSA 4B5SA 1JDFA 5A8GA 1SO4A 3TMLA 3S8HA 1FRBA 4HYVA 3CJPA 3QZ6A 3TN4A 4Z2HA 3KZPA 1WDPA 2UV8G 1XYBA 1ONRA 5HA7A 2BX7A 4AZ6A 3LD5A 1BRLA 1S5VA 1LYXA 1HGWA 2GDQA 1Y0EA 2ASHA 3M9YA 3LHUA 4MB3A 1TUXA 2PWUA 4K8EA 1PYMA 2D2JA 2VTFA 1XLJA 2PDQA 2XH7A 5LA2A 3AYSA 1YQ2A 1TPVA 2A3CA 4GXMA 2XSAA 4AXKA 1SW7A 3CIXA 1C29A 4PSRA 3WQFA 2AKZA 1UH3A 3RLVA 2DQWA 3E74A 2OG9A 3NO3A 3AISA 1UROA 1ZJHA 1BF6A 1J11A 1UWUA 1ZAIA 1IT7A 3T0TA 3FFSA 4DB7A 4DVOA 3RDKA 3GBEA 1BYDA 4ALDA 2NX9A 1QR7A 5A6SA 3M0HA 3B9DA 3L9CA 3DC0A 1CGWA 3W1TA 3KBVA 1ZRQA 1ZBKA 3EXRA 4NJJA 5ECUA 2PA6A 4OVXA 4FX6M 1QRQA 3VIJA 1X8CA 2NLIA 5D04C 1JZ7A 2NUYA 3G3MA 1PL9A 4AZ7A 1CGTA 1GW9A 3O7UA 3ZYZA 3QTPA 5FI8A 1XG3A 1EHNA 3HM7A 4YMZA 1WZMA 2C6QA 2PWGA 4H4IA 1LL7A 4JY8A 3TW7A 2QCNA 5CKSA 4RW3A 2P5NA 1GQLA 5D8WA 4L1XA 1XUZA 4TO8A 1HFBA 5IOBA 1H1NA 5H8MA 3ITXA 1ESWA 1QPNA 3B0VC 4H04A 2W4XA 5G5IA 2Y85A 4AD1A 3QN3A 2B81A 2WMIA 1UKOA 3OLIA 1CI1A 2WVSA 4L1WA 2QCCA 2QDDA 2IPFA 3B8VA 3NVDA 3QMTA 4R85A 1ZS2A 2PGRA 5LNSA 2A6NA 1B90A 3VDHA 3EAUA 2QCDA 3BAWA 3T2QA 1OK4A 3VYLA 1UASA 1UR8A 3PBMA 5REQA 4QIUA 3N2CA 4JIHA 4J3UA 2JBMA 1JNDA 3C2FA 1DJXA 3H2OA 1JYVA 4E4UA 2H9AA 3KCOA 5LZLA 4N2YA 3DAQA 3WLSA 3I6EA 2NXGA 3KBMA 1DIOA 3TNOA 4O19A 4C1LA 3V4BA 1OG0A 2NX1A 4J4KA 1REQA 3CZLA 2NQ5A 1CLVA 2Z2BA 4S23A 4H8NA 8XIMA 1YXDA 5CG7A 2J6XA 4OGZA 1NY1A 3MU7A 4XZLX 2CLOA 2F84A 4NI8A 5C55A 8A3HA 3NO5A 2EBNA 1GOXA 3BCJA 4I90A 5DY3A 1TTIA 2OGYA 2GYIA 4O11A 4C91A 3TNBA 2AGTA 4H9TA 3WF1A 4MAVA 1BKHA 1BEUA 6ALDA 5DQPA 1BD0A 1OHLA 3OODA 4NUWA 4Q7NA 3W02A 4IH3A 1KBKA 4G8TA 2NSXA 1EKOA 1EJXC 1VPQA 4WSHA 4RE4A 3MC5A 4Q4SA 3C2RA 2OWXA 4W85A 4ZO9A 4ADUA 2VCBA 4HTBA 4MNMA 5FJUA 1V6XA 2ODOA 3T07A 4YTRA 1ML1A 5C70A 1KFKA 3UXIA 1TA3B 1E71M 3WNKA 1W9BM 3MZNA 4IMFA 3B3DA 4UWMA 2WV8A 4WQ6A 3P84A 4IPNB 4L4LA 1VENA 4G5DA 4B3KA 5CPOA 3SY8A 5GVJA 1RBAA 4L5ZA 3SGGA 3O2LA 3K5XA 1QI3A 4GPNA 3R1ZA 3LA4A 4U5KA 1JAKA 4IIFA 3BW2A 3GNNA 3W1QA 3NQEA 4IXXA 3WQOA 1XJBA 5KMYA 5BMXA 4L61A 3VPLA 3GUGA 4LB3A 4NVTA 3N4EA 4A8LA 1WBJA 1LF1A 4UTWC 4FX8A 3NPVA 3WZ0E 1ZAHA 4XZMX 4L7ZA 2XIOA 5AYBA 1WBHA 1E1CB 2QV5A 3LCXA 1B1YA 2VC5A 1F8MA 3R89A 2JF7A 2VEFA 3WN6A 3MS8A 3NGFA 5CLTA 5A6JA 3DH7A 5LXXA 2IKIA 4R9OA 1BTCA 3VIFA 3W26A 5BRBA 1K9DA 3FOKA 1AL8A 4RV3A 4NSBA 3FNDA 1VCVA 1W1A1 1C92A 1Q85A 1B4KA 1BYAA 1N7KA 3RR1A 5FJIA 3QV6A 4XZWA 3TYUA 3T0DA 1R8LA 3TR9A 1GOOA 2V68A 4A3UA 3TKFA 1DL3A 2XYLA 3DZ1A 3W7NA 3PULA 2C18A 1JRBA 1UHVA 4XZHA 4H9VA 3RGTA 1EGVA 3EX1A 1SVDA 2FVKA 1LWIA 3AJXA 3L0KA 5HK4A 3JS3A 1HL8A 2ZOXA 2XSXA 1HJVA 1OX5A 3K8LA 4GZJA 3ZJ7A 3CQKA 1B3YA 1X1NA 4JTEA 1J10A 4C5YA 3CQJA 1KQYA 1GJWA 1W32A 1XFBA 5C9WA 3UR8A 4QX4A 3QJAA 1GG1A 3REQA 3RPMA 1I6NA 2VZTA 3UCCA 1V93A 1QASA 2QHAA 1ZPTA 4UMCA 3G77A 3SQSA 3T55A 2QCMA 4Y9MA 2EG8A 1CXEA 2RJGA 4A8IA 4M80A 3HBLA 3AS2A 1UH4A 3N2TA 3TC3A 5LGXA 1LT7A 1H61A 4B5VA 4KPLA 5AY7A 4U2YA 2Y63A 4DJED 2D24A 4L6OA 2C19A 5HOSA 5E0CA 1P0NA 3CO8A 1G6CA 2CHOA 1XICA 2IXVA 3QRHA 4LUSA 3WH9A 4GIEA 1CBGA 2NXIA 4NXKA 3LGEA 3GW3A 1HN1A 2ONEA 2QJGA 3EWDA 4BI6A 3FJLA 3QMSA 2DIJA 2WPBA 4A29A 1K4HA 2I17A 2QJHA 3EPOA 5FEPA 3W7HA 1ENUA 4IGHA 3EWXA 3MT1A 3NDZA 4AIBA 5K4ZA 4A22A 4CEXC 5KZMA 2DSKA 1XLFA 3MTWA 1Q6EA 4HYRA 1P7TB 3NIYA 4ZO7A 1W5MA 4Q8TA 2XIQA 2YZRA 3PTQA 4IZGA 2XFFA 4BF7A 3W2LA 2ZXDA 4GIAA 4MNLA 5HWMA 1IHIA 4H6KA 3VO0A 4LNYA 4RNJA 2VJXA 1BFNA 1K4GA 2ZRXA 3TAKA 3RCMA 4AVFA 3VGEA 1W3LA 2WZMA 1KV5A 2JIEA 3CLWA 3O0KA 3P8IA 3GDKA 3K46A 4D1IA 4PMZA 5HATA 2BZNA 5HUOA 2EQDA 5HMDA 3OHIA 3GY1A 4IISA 4MWAB 3PPCA 4K36A 3SCOA 1YDOA 3TXZA 3R4IA 4W87A 3WBAA 3EWZA 2AQWA 3W4RA 3F4VA 1KW1A 2DZSA 1H0GA 1QHPA 4FR1A 5T91A 4OV9A 1IT0A 1UW9A 2DZWA 3UWZA 3NG3A 3WG6A 1S2VA 1O94A 4EACA 1AG1O 1SU5A 3UG4A 4IX0A 4N9EA 4DXXA 3PZ9A 1ZP4A 4RCXA 4UQCA 4UFKA 4DO5A 4LFYA 3TJ4A 3EPMA 2RGMA 3PTDA 3W73A 1QUMA 2BMBA 1W8SA 1A5KC 4DJFC 1W1B1 2GJRA 1QNQA 3KCJA 3HFTA 3HGSA 3GXFA 4K6AA 1LOSA 3S47A 3FS2A 1A5SA 2BXVA 3B04A 3HG5A 4H6EA 4MB1A 3DG7A 3UZXA 3C3NA 3A12A 4RZ4A 2LLEA 1EZ2A 4ACZB 5K7JA 3H55A 3O6YX 2ZA2A 3S6DA 4LF1A 4C1NB 3P60A 3BTNA 5C2CA 4PB4A 1OC7A 1TPFA 3L12A 5TAOA 1CXLA 4GI6A 1TZZA 4O1DA 2Z1SA 3S2CA 1W3HA 1Z41A 2IXUA 1M68A 3KL0A 3VGGA 4FPSA 3OBKA 1B3WA 3BG9A 2C91A 2FTPA 2V5KA 1L8NA 3TN5A 5FF2A 3W7GA 1UPMB 4D8LA 3MDWA 3GWQA 3IIVA 3EKLA 1JI2A 1YLVA 4FP1A 5I0DA 4CD4A 4D2JA 2ANUA 4RNHA 4E38A 2VEIA 2ZFAA 5FSEC 1ME7A 3CXOA 3LCGA 3QEZA 3RUBL 4BK9A 1OF8A 3M07A 1NARA 2C1GA 3APGA 3N34A 1HGYA 4ICCX 4US5D 4Z1AA 1CGVA 1TJRA 3TCEA 3RHGA 3LK6A 3MWCA 4GUJA 3VNJA 2Y88A 1Z89A 4TX6A 1TR9A 3FAWA 2P88A 1UD2A 1SGJA 3BG5A 4K68A 5JU6A 1OEPA 1DYSA 1P1MA 3LV6A 4C7GA 1RD6A 1ODZA 4JQ3A 1KB3A 1TIMA 3UJEA 2YCLA 4GVHA 3WQ6A 4U33A 4MNKA 4O18A 3UFYA 3VKDA 2EPLX 3NL6A 2VRQA 1UC5A 2QGHA 4MB4A 5ENLA 3LHVA 2I5IA 1TZ7A 2XGIA 3A6OA 2I57A 3MUXA 2FHFA 3BLEA 1LOLA 3WJYA 2I9EA 5M5DA 5BZAA 3KVKA 3WK0A 3ZVHB 1A50A 3NGJA 1GTEA 4PUJA 3VDGA 4S38A 4AISA 4PMQA 1LQ2A 2HCVA 3HF3A 3CL6A 3MVIA 1X38A 3T78A 4HNLA 1BGGA 5D33A 4B5WA 3SCWA 3UZ5A 4F0LA 2X1TA 1YBQA 3QBUA 4UQDA 4X9SA 4AD4A 1DXEA 4XSLA 3CGTA 4JQ1A 1R9YA 3FSUA 1A47A 1UKQA 4W93A 5A5WA 2TSYA 3TQ0A 1W3NA 4DI9A 2E25A 3WQPA 1ME8A 3T9PA 4Q3MA 4HNUA 3CYJA 4TV5A 1HJUA 4HA3A 4K38A 3BAYA 4HCDA 1RK6A 1TYGA 2RJHA 3GFZA 3UPWA 3VAVA 4TQTA 4OWGA 1A5MC 3FEQA 1LT8A 2WWDA 2YBUA 4XB3A 4NZCA 2HISA 2YDAA 3R0KA 1JGIA 3T08A 3C2EA 2W27A 4I5UA 4A2SA 3E2SA 2OTDA 3FHQA 1JDCA 3KVMA 4JZ5A 1H51A 2P0OA 1SJBA 4CLMA 5K2ZA 1ISXA 1J01A 2ZUUA 3FK4A 3W24A 2OLHA 1K70A 4DN1A 1UQYA 4JIIX 2V5LA 4S3GA 3HU7A 3H6OA 3GXNA 4NYYA 1NF7A 1AW1A 2J9XA 4O52A 2OKOA 1UJPA 1Q63A 4N4PA 5KZEA 1OX4A 3PHAA 4C6BA 5CCZA 3UJRA 3WBYA 3WJZA 5FOOA 4HPJA 2PCEA 3S0CA 2AAMA 5FL0A 1TELA 1LRTA 3BO9A 3W76A 4QCFA 3PNZA 2XN2A 3W0KA 3B4YA 3GZ3A 4JICA 4CN1A 4WDWA 3PB2A 4REQB 2KX9A 4QS5A 5AB3A 1TO3A 3PPGA 2HVOA 4HU4A 1UWQA 1PX4A 1F76A 3GE7A 1XQLA 3C0QA 1TV2A 1P5BA 1VPYA 1C8XA 1T7LA 4IIEA 4PBFA 4EANA 3L21A 2A0NA 1ZP3A 2PPGA 1US2A 1YW1A 2EGZA 1J93A 3L66A 4BCEA 2CWNA 3ITTA 3VOGA 5D2XA 4LW7A 1E9LA 3CEPA 5LNVA 3R12A 4MNJA 2PDLA 4F4RA 3C4UA 1UCWA 1ZY9A 4JTIA 3GH4A 3TEVA 4DWSA 3QLLA 3UCDA 3F4WA 3QY7A 4AB4A 3EZ4A 3EGJA 2RDTA 3TTSA 4H2HA 3S5OA 3WMLA 4LVBA 2QGYA 1EUAA 1JQVA 2ZZ4A 1G4TA 3URAA 1XPYA 3ARSA 3U8GA 2R82A 1WO2A 1QWGA 2TYSA 5H6HA 3MUCA 1W9UA 4LAKA 2X42A 3C8NA 2VR2A 1H1YA 5D4YA 1EWEA 1DHKA 1ICPA 1PTDA 4C6FA 3EKGA 2JQXA 2UWFA 3IJLA 5A6BD 4I6VA 3QSRA 2PDGA 1BG9A 4IXHA 1AVAA 2ZX5A 5AHEA 4LS2A 3DYPA 3MSRA 5JIPA 2GVYA 1PUDA 5F2IA 2Y89A 3GAYA 1O5KA 3WD2A 3AUJA 4J2PA 2GSJA 2G4JA 2Z1VA 2WSKA 3TJIA 3WSUA 2O92A 4HK6A 4JYFA 3ZWTA 4CNPA 1C9DA 3QYQA 4MZ1A 4I8DA 2H9AB 3ZJ6A 3E1F1 1E5NA 1VBHA 3MB9A 1Z44A 3MUY1 1I2NA 1PAMA 4LSBA 4GY0A 2ON3A 3KRUA 3F2CA 2YGYA 3OLDA 4NF7A 1QWKA 5HBFA 3GHUA 4GZEA 4G7EB 1XW8A 5MHBA 3MUZ1 4GHRA 3MCNA 1AQ0A 1TV5A 1HKMA 3CU2A 1XFCA 4QGCA 1EQCA 1PKNA 2YA1A 1XYZA 3FVMA 4OFCA 3E02A 1RUSA 2PP0A 2FLIA 1FWBC 2E5DA 3GC5A 2TPSA 4JL2A 4C5ZA 4XD3A 4DY1A 3QZEA 4I9AA 3KXQA 4LYQA 4QE1A 4AF0B 3CUGA 1EPVA 3H23A 1OG6A 2A7PA 2V81A 1J0ZA 4GIRA 3SI9A 1LRNA 1TJ0A 1ZQ5A 5CBJA 1QNRA 1H7PA 1VRDA 2QYGA 4UR9A 4HYWA 3LMZA 1GYLA 1S46A 2VR4A 5ABGA 1GEQA 2AAAA 4AXNA 4B16A 4NHVA 1IZJA 1HJXA 1V3KA 3RG6A 1UJQA 4W7WA 4HA0A 1DWGM 2J77A 4GH1A 1E9YB 4DNMA 4WXZA 1D2KA 4M6UA 1J96A 1GWJA 4O1CA 3PBGA 3U0HA 5T8GA 5E6YA 1P4CA 4HIBA 4X22A 4ZQOA 4HCLA 4AIEA 4FB7A 3TVAA 1KWKA 1D9EA 2XH4A 4CCDA 3GNOA 4D6IA 1K8CA 4WSJA 2VFHA 4D6GA 4LVDA 3MKKA 1XYCA 4AVNA 2Z1KA 1G67A 4M82A 3CB8A 4JGDA 1DVJA 4F66A 2FPVA 3AIBA 4O14A 4N4QA 4Q8MA 3ELFA 1Y5VA 4PN2A 4F0RA 2PDKA 2VP8A 5EMMA 1BXNA 4JX6A 3EDFA 5RUBA 2WSQA 4D1JA 3OHMB 2YB4A 3WLHA 4IGMA 5I3FA 1F9CA 1XDLA 4V1XA 3VM5A 2R94A 4S3FA 3DFOA 1KCXA 4F79A 5FACA 3KP1A 3QV8A 4H7VA 2E28A 3WUEA 1ZBWA 2JIWA 2QW5A 5IDZA 1UA7A 1EC7A 3I3DA 1UYQA 4GFIA 2P0IA 1ICSA 4Q6JA 3J7HA 1O5QA 1ADSA 4JIRA 1QOQA 1SFTA 3B8TA 3G24A 2GK1B 3PPHA 5EMKA 1WDQA 4I5XA 3BLKA 2Y8KA 4J2MA 1WXZA 4EXQA 3GR8A 4LEFA 1XGDA 3CNYA 5CH9A 3GW0A 1TJ1A 3WDIA 2GUYA 1DJZA 1WXJA 3ORWA 4HPHA 3TR2A 3GHSA 2J88A 5FA5A 4DELA 3JRKA 1F3TA 5LHEA 2HPIA 1V51A 1VEPA 2BFGA 2CFFA 3FCPA 3REQB 4N9DA 1J9YA 1VZWA 4DYEA 3AO0A 4Y90A 3KBSA 2W66A 3ATYA 3WEOA 5DT7A 3BJTA 3VKAA 4CNUA 4IPPA 4XD6A 4YHGA 3IGSA 4PRTA 5CZSA 4IGNA 1E6XM 1KR0A 1WDWA 5DCBA 4NYUA 1FHVA 1IEVA 2IUZA 1BVZA 3N3MA 4LAZA 5I06A 3LBMA 1KCKA 2G0WA 3V5OA 4LRSA 4WIWA 4HMNA 3NUKA 4Z42C 3GC4A 3MKCA 3C2VA 4LUSB 1H4PA 1K7FA 3P14A 1IR2A 3NEVA 3UXAA 4JCLA 2OXNA 4PMJA 4MSSA 2D2GA 2ISDA 2P8BA 4AZHA 1GEHA 1XYFA 1UBPC 1FVPA 3N6HA 4RE0A 1UR2A 3EDJA 3S2JA 2CLLA 1O5XA 4YTQA 3AQUA 4PTXA 3T7VA 5FF4A 4LX4A 5D30A 3WL1A 1VIWA 3UT0A 2G95A 4G2DA 3R8RA 4BJHA 2PBOA 1EJUC 4RR4A 3MP5A 1XSKA 3CV6A 4JTSA 4GGBA 3N1AA 3HQOA 1E3ZA 1DJHA 3H24A 3LTPA 4NJKA 2W9MA 1FH7A 4O0QA 3FXGA 3N73A 4UZUA 4W89A 1PWMA 1MRQA 3PZNA 5G2HA 1DXFA 1D3CA 1EXPA 2QCLA 3W2KA 3AXMA 4AAJA 2FIQA 1MWOA 2IKHA 3BCDA 4RE2A 3NQ6A 5A8MA 4M3PA 4XQ6A 4LRTA 3T1GA 4WK9A 1XH0A 2WVTA 3RLUA 3T0BA 3WFAA 3ALGA 3L67A 1XCXA 2GUUA 1ZBCA 1BHGA 1QW7A 4PUEA 1G0CA 1J2WA 3LRMA 1QBAA 4S2BA 3VDAA 1ZU8A 4RJEA 1UH2A 1HIZA 1Q8AA 2I1OA 2DZUA 2FZMA 1ZCOA 4LY4A 2INZA 4YHEA 3L2MA 4UR8A 2FMOA 1KD0A 3W6MA 3BMXA 1VBRA 2W62A 2DSZA 1H60A 2PDCA 1BVWA 2XHYA 1UKSA 1TE6A 4ROQA 2W6RA 3NAVA 2ZC1A 3ABXA 2EKGA 1V6UA 2FVMA 2E6FA 4I7UA 4R88A 1LCOA 2ATMA 4XTIA 3LPFA 3OP2A 4FAMA 3CMJA 1PO9A 3JZUA 3LYEA 5BXTA 3W7IA 4FXRA 2OSWA 4PYSA 1R9ZA 1X6UA 2IMRA 3CHFA 3IUDA 4XVEA 2PDBA 3WF0A 2DZAA 2O0TA 3GBDA 5CEWA 2P8CA 1AMKA 4RX0A 2HDJA 3ABRA 1OVDA 5KITA 2HBVA 2GPTA 2YR1A 3PWGA 1ZSXA 3FGCA 5FJPA 4AY7A 1AJ2A 5F2MA 3U57A 4J9JA 2I56A 4JN8A 2PD5A 3LCWA 4O28A 4GKLA 4DF1A 1ISYA 1KGUA 2DZXA 2R24A 3RO6A 4NT0A 2VNCA 3MYOA 2E6YA 5JH1A 2A4AA 4D9PA 3ABQA 2XN0A 3GB6A 1GVFA 2ZYFA 4BFAA 4EWND 1AW2A 3SM0A 2ZUWA 5F4WA 4GLEA 3W7CA 4TTGA 3LM7A 2QDEA 1XIJA 2V63A 5FSDC 5LIXX 4MYXA 4DO4A 1IF2A 4X0NA 1X1ZA 2HNHA 4K8HA 4K7VA 2G97A 2FB3A 4GYKA 2DT2A 1QK2A 2BDQA 1K9TA 2UY3A 3VIHA 3TQKA 2PRMA 1TPWA 2XVLA 4DAIA 3AAMA 3B0YA 1JEZA 1PHQA 3OPSA 4X2PA 5CZJA 3WQ4A 5T9CE 3K4WA 1A53A 3W27A 3B9EA 2ZIDA 1S2TA 2EJAA 4JS3A 3QOKA 4HU3A 5G1MA 2XG9A 2DZBA 3DN5A 1RJPA 1F3XA 2CBIA 3SR7A 2IPGA 4LAUA 2QIWA 1OC5A 1WAUA 4MKSA 3U3HA 3IJDA 3NR0A 3RCYA 4PTMA 3FYOA 4AZBA 4XKYA 1XBXA 2WOQA 4GYPA 2VX5A 5HQMA 1TB3A 1JRCA 1CDGA 1MEWA 2QEZA 2YCEA 1E15A 3VI2A 2D0FA 4WLCA 4M56A 1QT1A 1TPC1 4JTJA 3UJ2A 2GDUA 2WHJA 4IUGA 1LG1A 2REQA 1H49A 2PDWA 3W1PA 1E4IA 1OABA 2J75A 4XSMA 1QNSA 4FLQA 3HZ3A 2Y2WA 1GOMA 4CU6A 4AD5A 4P7NA 1OC6A 4HMCA 4JFVA 3IIOA 1ZB5A 2CZFA 1T5AA 2ZWZA 3KWXA 3S42A 1RPKA 1OFRA 2X30A 2XDFA 1KBBA 1JUEA 1Y5WA 1FH8A 1FWRA 3QPYA 5JBEA 1HKKA 1VFUA 3GIYA 3NURA 1WUEA 2R14A 4B4FA 1OCBA 3UXKA 3QV7A 4B4HA 1ONXA 3H12A 2PCQA 4HU0A 1CW2A 5LIYX 3LQGA 2QQ6A 3HQPA 2NV9A 1DTNA 4BEQA 4V33A 3VIIA 1VKFA 4OUEA 3M46A 2VMFA 4K7YA 3IGUA 5CC5A 2E7FA 1GZGA 5I02A 2X0HA 3STCA 2E6AA 2E6DA 5FL1A 4RDZA 4WDUA 2DIEA 5TBOA 3NQAA 3WLLA 3R0DA 3V7PA 2XGBA 3M5VA 2J79A 4U10A 4GQGA 2FMNA 4ML4A 4PTDA 2PLMA 2E1DA 1RCOB 4LV9A 4NZ1A 1GNXA 2ZZ7A 2YBTA 4PUDA 5BRPA 3BW4A 1XUUA 4EPEC 1LLZA 4FLOA 1QMLA 1UP3A 3HQNA 4FNQA 5CGTA 5F1UA 3WNLA 3G3DA 4NASA 5E93A 4K8GA 1T40A 2JK2A 1Q6OA 3WH8A 3TWAA 1TPEA 1LORA 1PIFA 4K1WA 1QO5A 1SO3A 1EO5A 2DEPA 1E4LA 3B03A 3U2EA 1WUFA 1YNPA 3PBWA 1F2JA 1W1IE 6CGTA 2O9PA 2NUXA 6TAAA 1K02A 1GCYA 2RAGA 1F8IA 3MDUA 1KLYA 3TAOA 1B4EA 5HPCA 3IGHX 5AZ0A 4IIBA 1PZ2A 4TX9A 3LLDA 3PZUA 1H7XA 3EA3A 3P3BA 1GKQA 3QR0A 3SB0A 3R5EA 1EQPA 2VCAA 3IARA 2VZSA 1OFQA 2OZ0A 1OFPA 2ZRVA 4DBEA 1O1HA 5KINA 3EX2A 3WENA 3I7RA 4QHRA 4JKLA 4LCRA 4LXFA 3L5AA 4XD4A 4QSHA 5I3DA 1W1ZA 1I2PA 3W1UA 4EAYA 4FI4A 1JPMA 3ABSA 1WB0A 5D2TA 3WLKX 4X9YA 2E1WA 2QULA 2Z24A