2WM1A

The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between nad synthesis and glycolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
332
structure length
332
Chain Sequence
b'MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOXYLASE
publication title The Crystal Structure of Human Alpha-Amino-Beta-Carboxymuconate-Epsilon-Semialdehyde Decarboxylase in Complex with 1,3-Dihydroxyacetonephosphate Suggests a Regulatory Link between Nad Synthesis and Glycolysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 114
structure length 332
sequence length 332
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2wm1A00
1FWBC 4PBFA 3F2BA 1J6PA 3QY7A 3MDWA 1V7AA 1KCXA 4C65A 3S4TA 4GOAA 4F0SA 3E0FA 1P6CA 2HPIA 3GTFA 4LCQA 3MSRA 2CZVA 4KIRA 3F4DA 3WZ0E 1RJRA 4NP7A 1GKQA 2GZXA 4RDZA 4GYFA 2QVNA 1DPMA 1GKPA 2VC7A 2YZ5A 3ID7A 4C6CA 4DI9A 4H01A 4V1XA 5A6TC 3TN6A 1RA5A 3UF9A 3IRSA 4HK5A 1NDZA 3PBMA 4IQJA 2ANUA 2Z4GA 3E38A 4DO7A 4QROA 2OB3A 4C6OA 4IFRA 3MTWA 4IGNA 3LGGA 2OQLA 3IARA 2I9UA 3G77A 1A4MA 4KETA 4GX9A 3NQBA 2WJEA 4C6DA 4PCNA 1ZZMA 1FWJC 1ONWA 1ONXA 4C6MA 3IV8A 4DI8A 4XD6A 2Z2AA 3LNPA 4LANA 1J5SA 1E9YB 4DLFA 4C6KA 4WHBA 3QGKC 2AQOA 2Y1HA 3PAOA 3GTXA 3OQEA 4UBPC 4KESA 3QGAC 4DNMA 4B90A 3CAKA 4R88A 1FWAC 3TNBA 5HMFA 3CJPA 4C6JA 2G3FA 3TN5A 3DC8A 2IMRA 3UR2A 3RHGA 1A5LC 4CQCA 2R1LA 4C6IA 1A5NC 3LS9A 4E3TA 1ADDA 3URBA 3O0FA 1KRCC 4QS5A 4LCSA 3E2VA 3GU2A 1FWDC 3AU2A 2Z00A 4CQBA 4R7WA 2E25A 1A5MC 4GXWA 4DLMA 1FWGC 4DZHA 2PAJA 4PCPA 3N2CA 2Z26A 1FWCC 4C6BA 2Z27A 1EJXC 1M7JA 4TQTA 4R85A 3T1GA 1EYWA 2BGNE 1I0BA 3B0XA 4MUPA 4LAMA 1XRTA 2PLMA 1I0DA 5CH9A 2YB1A 4DZIA 1BF6A 1R9YA 4LEFA 4PE8A 1WXZA 4RDYA 2Z24A 3K4WA 2D2GA 4QRNA 4HK6A 1M68A 1FWIC 3K2GA 1EJSC 1UIOA 4I6KA 2PUZA 2HQAA 2OOFA 3GUWA 3E0LA 2HBXA 2DVUA 3FDGA 4J5NA 3JZEA 4H9YA 2GOKA 1EJWC 3B40A 3TN3A 1XWYA 3DUGA 3QY8A 4BY3A 1P6BA 4C6PA 2ADAA 2QT3A 4KQNA 4XD5A 1NDVA 3ITCA 1POKA 4H9ZA 4QSFA 2ICSA 2GWNA 4G2DA 3SFWA 4C60A 2UBPC 3OODA 4GC3A 4WGXA 1NDYA 3MDUA 1K1DA 1RJQA 4H9UA 4C6LA 3URNA 2OODA 4DIAA 4EPKA 1VFLA 1NDWA 3LSCA 3OU8A 2WM1A 3T81A 4HK7A 4AC7C 1A5OC 2YB4A 1J79A 3PANA 1RJPA 4AQLA 2W9MA 4RE0A 3RCMA 2EG6A 4YIWA 4F0LA 4UB9A 5FSEC 1FWFC 3S2MA 3A3XA 3IACA 1HZYA 4H9TA 3AUOA 1S3TC 4KEZA 1O12A 1PO9A 1UBPC 2PGFA 4NI8A 4KF1A 3A4JA 2DVTA 1FWEC 1V77A 1GKRA 2D2HA 2FTYA 3PNZA 1EJRC 2AMXA 4RDVA 4LAKA 4C6NA 3IJ6A 4LCRA 4C6EA 4M51A 3GTIA 1EJVC 3PNUA 1XRFA 3QY6A 3S2LA 1UIPA 4V1YA 4CNSA 2Z29A 4XAZA 3EWCA 4ICMA 2F6KA 4CNTA 4H00A 3T8LA 5HMEA 3MPGA 2VR2A 2XIOA 1A5KC 5E5CA 2QPXA 3FDKA 4CEUC 4KERA 3DCPA 2Z7GA 4IH3A 1YMYA 3S2JA 4KEUA 5LXXA 1KRMA 4G7EB 3HTWA 3UPMA 2P50A 3GG7A 1R9ZA 4P5UA 3BE7A 4QS6A 3LSBA 2E1WA 2RAGA 2R1KA 1EZ2A 1PTAA 1UMLA 3GIQA 1ITQA 1O5RA 4B91A 1RA0A 4CQDA 2O4MA 1V4YA 1EJUC 4BJHA 2EG7A 3WYZA 3F2DA 2AQVA 4XAFA 4D8LA 4DYKA 3WMLA 1M65A 2UZ9A 4C6FA 3IGHX 4IFKB 2Z28A 2QS8A 3NEHA 3V7PA 4GBDA 1E9ZB 4L6DA 3RN6A 3GRIA 1QW7A 4G7EA 3E74A 3OOQA 4C5YA 3EWDA 3OJGA 2EG8A 1YNYA 2HPMA 4INFA 4KEVA 1EJTC 2ZC1A 1RAKA 1FKXA 4H9XA 3HM7A 5FSDC 3A3WA 3HPAA 2DVXA 3ORWA 1QXLA 4XD3A 3FEQA 1V79A 5AKQA 4ZSTA 1PSCA 1FKWA 4Z42C 3EGJA 4XAYA 1RK6A 2GWGA 4I6VA 4IFOA 2YXOA 4WVXA 4CEXC 4BKNA 3LGDA 4L9XA 4IFKA 3LU2A 1P1MA 4JOMA 1JGMA 4EPBC 1J6OA 1W1IE 2FVKA 2HNHA 1R9XA 4C5ZA 3F4CA 3GTHA 3TN4A 1PB0A 4C6QA 3LA4A 1RK5A 4EPEC 3URAA 1POJA 4IG2B 2A3LA 1YRRA 2FFIA 3MVTA 2P53A 3CS2A 2VM8A 3F2CA 4NG3A 4J2MA 4GY0A 1IE7C 2HBVA 1YIXA 1KRBC 3B0YA 3MVIA 3C86A 4OFCA 3ICJA 4ERGA 4ERAA 4RDWA 4HJWA 2VUNA 4PBEA 3URQA 2PGRA 3ISIX 5G4HC 1ITUA 2D2JA 3OVGA 1YBQB 3R0DA 2Q09A 3GU9A 3E3HA 2FTWA 3IPWA 3LY0A 4GY1A 4CNUA 1KRAC 4IG2A 3GU1A 4GY7A 4IGMA 4LAOA 4LH8A 2KAUC 4EPDC 3AU6A 1XGEA 3MKVA 2R1MA 4H9VA 3UR5A 2Q01A 3NURA 5HMDA 4QTGA 2Z25A 1FWHC 2R1PA 4GK8A 1A4LA 4ERIA 1K70A 3S2NA 3SO7A 3D6NA 2WJDA 2GSEA 2FVMA 4ZSUA 1YBQA 1WXYA 2O4QA 3MJMA 4EP8C 2R1NA 4B3ZA 3GIPA 4LFYA 4XAGA 4XD4A 3KM8A 4HA0A 3UBPC 4GX8A 3O7UA 2WJFA 1K6WA 4RZBA 4B92A 2VC5A 4IF2A 2BB0A 2VHLA 4LALA 1V51A 4GZ7A 2I5GA 4J35A 3K5XA 1NFGA 1EF2A 2Z2BA 4F0RA 4H9MA 2OGJA 3RYSA
chains in the Genus database with same CATH superfamily
3F2BA 4HMEA 1H49A 2NX1A 2PCEA 3DHDA 3ANVA 3P82A 3U2ZA 3ABZA 1PIFA 1NWSA 2IW0A 3TV8A 1V6UA 2GQ8A 2POZA 4NRSA 3L0NA 5EMUA 5D05A 1B0IA 3TTQA 1EC9A 2WSKA 1PBGA 2XH7A 1B90A 4O14A 1B3VA 4CD5A 3D0CA 3N2OA 2V5LA 4V1XA 1KNWA 1KFKA 2ZRWA 3E38A 2VYOA 2ZOXA 3T55A 1K8YA 3FHAA 4YLWA 3S1WA 1VKFA 4W8BA 2E8ZA 2PODA 2RJGA 3UWYA 2YFNA 1HL2A 3CHVA 1O4UA 1UH4A 5CAHA 1D2KA 3DU0A 4C6DA 5AN7A 5LA0A 4TTGA 3T2PA 4NF7A 2VEMA 3WFAA 1E9IA 2TMDA 5AYXA 4HOZA 4YXGA 4EVZA 2PWEA 1SO4A 1FWAC 1KFEA 4X3ZA 2R14A 1EPXA 2PRLA 2D2OA 4JTGA 2OT0A 3KWSA 3GC2A 5AY7A 4GINA 1PZ3A 5J5DA 2CHRA 3CPUA 2WKJA 3MW7A 3TFXA 5MF5A 3TQPA 4KS0A 2HE5A 4R7JA 2QV5A 3BAJA 1JPIA 4JIQA 3H4XA 4N9BA 3W0KA 1DJXA 1MWOA 2REQB 1OZQA 4Q8UA 1US2A 4IIHA 1BSLA 3ARXA 1MMFA 5E1QA 4N6EA 3ME3A 3VIMA 2WCGA 4QRNA 4REQA 2VZVA 4DBUA 4Z2GA 4GG9A 3ZS4A 1UIOA 3OBAA 1JCLA 1R3QA 3H7RA 4JFWA 1K6AA 1W9DM 1JAKA 4LS2A 5JH2A 1GORA 1RY0A 1ME7A 1J96A 1MXGA 3C0JA 3CWOX 3LTSA 1FBAA 3A6OA 5FF3A 1GQKA 3T9PA 3I10A 1JI2A 3WENA 3PF3A 1E6RA 1EDQA 3RM4A 4H9UA 5D4YA 4IIGA 2Y61A 1MEIA 3I7RA 5A2CA 2FFCA 4HK7A 4AC7C 5C2XA 1F6PA 3TQKA 1WV2A 1RJPA 4EAYA 3U6WA 3VCNA 1OF6A 2W63A 4L1GA 1MEHA 2XN0A 3S2MA 1AQMA 4PMZA 4GGBA 4RCXA 3W1AA 3ARZA 2PMQA 3ES8A 3W2MA 2DVTA 1IYXA 4B5XA 1GYLA 5G2WA 4IGSA 2R6OA 4C6NA 3E5BA 5M1TA 1VCGA 3PUOA 3RNDA 3SQMA 2F6KA 7REQB 2NXGA 1XXXA 3KBSA 3N13A 2X40A 5A6BD 3U8GA 4HNNA 3VNMA 4Y2WA 5C9WA 1PHWA 1IEWA 1RR2A 3H26A 1V5XA 3WQDA 1UC4A 1C7TA 4KERA 2Y63A 1CWYA 1UW9A 4UTKA 1VFOA 2EXOA 5A2BA 2E77A 4G1KA 2BHZA 1E4NA 2OU4A 1BRLA 1IF2A 2ACQA 4LRTA 2Z1BA 1QPKA 1M5WA 4BQ5A 3TCEA 1K9TA 2W92A 4AY8A 4ZXOA 5CZJA 4XAFA 4JNYA 4RE2A 1JFXA 5FF2A 3WH7A 1PKNA 1W54A 4AU0A 4G6CA 4M82A 2YDSA 1SJDA 2P8CA 3N34A 3RN6A 3FIGA 2Y5EA 3F5JA 5K3VA 3EXSA 5EMYA 2P3ZA 4X60A 3WJWA 3SGUA 4MSSA 2D20A 3H6OA 3SN4A 4JHMA 5DXYA 4AMCA 1VEPA 1Z8AA 3XINA 1EJTC 2UY5A 4TXEA 4H9XA 4ATWA 1JPDX 4JFUA 1Z7AA 2Y7FA 3FEQA 1V79A 2WMJA 1JPKA 2HS6A 2YW4A 4JHZA 3CUGA 4ZQOA 3W7KA 4R9XA 3WQ4A 4MNJA 4DJFC 4LVGA 1XH1A 4NAEB 4M0XA 4LBSA 1K4HA 2NV2A 4O4WA 2A2IA 3PZOA 2DEPA 2OX1A 5E70A 3MVTA 2P53A 4NG3A 1FY6A 3L68A 4L6HA 4MZ8A 3IJQA 1VBRA 2DSUA 1D8CA 1MFVA 2CKRA 3G5EA 4Z2JA 5C8BB 2VUNA 4C7DA 3SW6A 3V16A 1RD5A 2YW3A 3KUMA 2X1IA 3NG3A 2VGGA 3NL5A 4RJEA 1W1ZA 1X1OA 3FA5A 3C4UA 2QMJA 2FH6A 4K68A 4HPHA 3R43A 1K02A 3NA8A 3GDTA 3GNPA 1I45A 3OG3A 3PJUA 3W7HA 3AJXA 2J9YA 2FB2A 2XPKA 3GD6A 4GXMA 4Q8QA 2A5HA 3CM4A 1AMYA 3W02A 5DCEA 4HA3A 3RCYA 2V68A 2C19A 1Q6LA 2ZZ2A 3DENA 1W1TA 1H60A 4D6EA 4EXQA 2O9TA 4B3ZA 3U4FA 3PUDA 4ZB2A 4ACZA 4LFYA 3SJNA 1HJWA 1PYMA 4O19A 4PUMA 3H2NA 2NXIA 4DM1A 2WJFA 4QJ3B 3SQLA 4PMNA 4HHMA 1GHRA 1V51A 3P0XA 3P0WA 3HQOA 1GEQA 2ZZ6A 4GACA 3CHEA 4E38A 1XBYA 4ES4A 2GJNA 1F76A 3OIXA 1J8VA 3VKJA 2VZSA 5GPRA 2PZNA 5C55A 2OOGA 4IL2A 4CU6A 1WKYA 1YPXA 4QLJA 5I2UA 3STGA 4G56A 1MUMA 1OFPA 3VDCA 1YHTA 3DFNA 3ZLFA 1ADOA 3ZZ1A 2PDHA 4DWSC 4GZIA 3AXMA 3G0UA 4HK5A 3OW1A 1UPPA 5CSUA 2GVGA 3TJIA 3CHCA 4US5D 4S3FA 3BVJA 4MUZA 3EWXA 3WJXA 2AQWA 3TYZA 5ABFA 1XYAA 3NQBA 2HVNA 5FJOA 3DFQA 1ONWA 2V5CA 1XQLA 2Z2AA 4M6QA 4O8AA 4KCVA 3T4WA 4MAZA 7TIMA 3MB9A 2J25A 3GTXA 1B54A 2D23A 1A0CA 1ZFJA 3UQNA 4LF1A 1E0VA 4IQEA 2RKXA 1R3SA 3GS6A 3GB6A 1M7XA 4C7FA 1DKWA 3QTGA 4MLRA 1WCGA 1UR1A 3LENA 1BXCA 3W1PA 1NQKA 1DHPA 2DUXA 4UFMA 5B80A 1ZENA 3W7GA 4BA0A 4K8HA 4NUWA 4QG6A 5FOOA 4C6BA 2J6VA 2VX4A 3CZ8A 1UKTA 4WY0B 5JBDA 1HUVA 4WLCA 1UKSA 2OZ3A 1GZ1A 1AH0A 5I79A 4JTLA 3NOEA 1ZALA 1UROA 2OFJA 3NTYA 4XZBA 4C91A 1B9ZA 1AVAA 1UR4A 1GWJA 1FWRA 4GUFA 1HIZA 4IMAA 4EIVA 5ABHA 1U2YA 3HIJA 3P14A 3WDJA 6XIMA 4GUJA 1FHDA 2AKZA 4K2SA 1AQHA 4DWSA 4H1ZA 3K46A 3TFCA 2NUXA 4OBTA 3GAKA 3B05A 3BXWA 2TSYA 4F2TA 3BLIA 1J79A 2VX6A 3H24A 3CZGA 3TW9A 2VO5A 4EWJA 6ALDA 4XZNX 2E1DA 2EG6A 5HJXA 3T6CA 4UB9A 3KHDA 3I65A 2W3ZA 3Q65A 3TOYA 4H8HA 4R9OA 3M0YA 3SUUA 1MVYA 4XZHA 3OZOA 3NPUA 4PH6A 3MUY1 2VC9A 1RZMA 3BGGA 1FDJA 3S8HA 1OT2A 3CL6A 3PNZA 5D9NA 4O57A 3AMDA 1UMYA 2V8ZA 1R2TA 2CLEA 3S5SA 4D6CA 4AX7A 1QOQA 1LM1A 1KQZA 2OLSA 3MJYA 3OLIA 4ICMA 2BP1A 3U5YA 4RZ5A 3WLKX 4QE1A 4JL2A 1RSCA 1QO5A 1F3TA 2XIQA 2QPXA 3SN0A 2VC6A 2J74A 2QCGA 4UQBA 3GNRA 5AYIA 2Y4SA 1ONEA 2VEKA 2OJPA 4QJ5B 1T99A 3NEVA 1OIFA 4G7EB 2P50A 2DZBA 4LT9A 1R9ZA 2XIJA 4F9JA 3TQ0A 3BE7A 1W8GA 4IT1A 4H04A 5H2ZA 1EZ2A 3SURA 5EGRA 2JIEA 4ICNA 2HWGA 1L2QA 4CQDA 3CPGA 4EF8A 1SJBA 4FR6A 3K1DA 3ZT7A 2G4JA 3APTA 2QS8A 2A4AA 4POCA 4PEEA 1I4NA 4GIRA 1M3UA 3O05A 3NVDA 4DO6A 4ZQMA 1GOIA 3O2LA 1OJXA 3SY8A 2NQ9A 3ELFA 3OBEA 1OCQA 3W71A 3O06A 1JDCA 1EUAA 2GJXA 1KWGA 4YTTA 4F79A 1VJIA 1SFLA 1H7RA 1EUNA 3FYPA 2E0PA 3TWAA 1EEPA 5DRIA 4FXJA 4KRTA 1UQYA 3NDYA 5MKGB 4XKYB 1Q85A 1OCBA 1W1IE 3M47A 1CGWA 3SCWA 2BXYA 3O9NA 1Q7QA 4AZ5A 1POJA 3VABA 1EO7A 5DN1A 2GGJA 1GVFA 2DORA 4N6FA 3QVQA 3NNTA 2BXZA 2YYTA 2ZRYA 4OFCA 1OVDA 4LB4A 4ERAA 4MB3A 2A21A 3T0CA 1K7EA 2DZUA 2DDXA 1EJ7L 2GGEA 3F5LA 3ARWA 2VI0A 2WQPA 3R0DA 5LA1A 3G1HA 3BJSA 1KW1A 3E0VA 4IIDA 1L6WA 5HPCA 3GYEA 1DHKA 2BVTA 3G24A 4D8AA 3KCJA 5ECVA 5CPSA 3N9RA 4H9VA 3XIMA 4PBGA 1VYPX 1I1WA 1K9FA 2E09A 2ZZ3A 4M8UA 5FF7A 3D6NA 3O6DA 3HOJA 1XLCA 3QHNA 1YBQA 5EBUA 3ZT5A 1WZAA 1SZFA 3IUHA 5LIWX 5MHBA 3O7UA 3SB0A 4AD5A 1S5NA 1WYIA 4LQ1A 2DSZA 1TPB1 3NDOA 2J88A 3GC4A 1WUFA 2Y8UA 3BLOA 2IPJA 2XN1A 3R58A 1NFGA 1NWTA 2DIJA 4WR3A 3FA4A 3SCOA 1YXDA 1HGWA 2VRKA 2WVTA 3AUJA 3NQFA 1AA1B 1FWBC 4PBFA 1K8XA 1XBXA 3PTKA 2DZAA 1BLIA 1VJSA 1VFFA 5C9RA 3UETA 4LAUA 3S4TA 4DXXA 1CXKA 2HPIA 4GA8A 5A6BA 1WQ5A 4K36A 2F61A 4XZ9A 4W7UA 3VNDA 3L0GA 4M81A 3LERA 2ATSA 3VNIA 2QCDA 3UVIA 1G4SA 4X61A 4ZEPA 4IPJA 1A80A 1Q6DA 4J9JA 3AMLA 4V28A 3WN6A 3O16A 5CZSA 4GGHA 4P8VA 3OBKA 1EB3A 3VOIA 1MDLA 4NRRA 3W1QA 2OQLA 4HCDA 3W81A 2XU2A 3ARPA 2WMIA 1GJUA 2IKGA 4AEFA 2VCAA 1A3WA 2J62A 1S5MA 4AZ7A 1W1A1 3PBYA 1KR1A 2A3BA 5J04A 3QGKC 3VD9A 4URIA 3MUZ1 4GYPC 2AQOA 2WK2A 3AHXA 3PPHA 3R8HA 4JTHA 4Z2LA 1TE1A 5J8LA 1UA7A 4JIPA 1TPC1 3ZLHA 1CDGA 4HPGA 1A5LC 3IIXA 1A5CA 2VFGA 1ZRQA 4ALDA 3LS9A 3APGA 2EGZA 2FJUB 1FWDC 4BI5A 1GG0A 3L4UA 1LQ0A 1AQ0A 2PGEA 3MU7A 4AWSA 2BHYA 2YDQA 5KINA 3NCOA 1V6VA 4TMBA 4MUPA 3LRKA 5AHMA 5D2TA 1VBUA 5BRPA 3VNYA 4PE8A 2IPWA 1JGIA 3I3EA 4LNCA 1UP3A 1VF8A 2PUZA 3D3FA 3NOYA 1UB3A 3FDGA 4NILA 1TTJA 2R24A 3H4WA 5EYWA 3B40A 4S38A 3SCPA 1V8EA 4P2VA 3KBWA 1GOMA 2YGYA 3B8IA 3K1GA 2PWUA 2EJAA 4QSFA 2W66A 4QDPA 4C60A 1JF5A 7CGTA 3AWNA 4GC3A 2WVUA 1GONA 4HZ8A 3M4HA 2Y24A 1SSGA 1NDWA 3LSCA 3OU8A 4CVWA 1KQYA 1GYNA 4HD5A 4GLEA 2V5JA 4OHQA 3T81A 1G94A 3Q37A 2VFFA 4GI9A 4OTKA 1ICQA 3HG3A 2HZGA 4JXCA 4J3SA 2QJJA 1JZ7A 2PWVA 1UKOA 3CK5A 5AYYA 3XISA 3W6LA 2BSLA 4H3DA 1B3XA 3P8JA 2QIWA 3CU2A 1LL4A 4WDUA 5K7JA 3V0TA 2FTPA 2PC4A 3UZJA 4O0QA 1IIHA 1IXPA 5K9XA 1W9UA 3W86A 1BRLB 4R33A 3VOJA 4MZYA 3HG5A 4B5WA 3PNUA 2F6XA 3NWRA 4W84A 3UXKA 1V93A 4HTYA 1GYMA 1GPWA 3MV11 4O52A 2V0TA 4FEZA 3UCDA 4D1JA 2NX9A 4B3KA 1NQ6A 5E5CA 3P8IA 3VVGA 1RLCL 4GJIA 3DCPA 3HBLA 3M46A 4IIFA 4F48A 3OLGA 3IJLA 3S5YA 1UUQA 3ZIZA 3HTWA 1NOFA 3NR0A 1XIFA 4ZA0A 3QQ0A 4QS6A 1UMLA 3DFPA 1MZHA 3QQ1A 3R6IA 3PPCA 3KRBA 4GCXA 2OZ8A 1TPUA 1IZCA 3QLLA 4A05A 4F2UA 1UASA 1V4YA 3AS3A 5A95A 2JK2A 4L9YA 5D30A 3UZXA 1E40A 2ZBTA 1OD0A 5G2HA 5BMWA 2BWGA 3FEMA 3WMLA 3M5XA 5DX7A 1K9EA 4HIBA 1SFJA 1DJIA 3R4IA 3AOFA 5FJIA 2P10A 2E6DA 2FMOA 3GRIA 4US5A 1FVPA 5BXRA 3HN3A 3WL0A 2QDHA 5IBXC 2NQ5A 5AC7A 4FNQA 5FEZA 1MXSA 1HNYA 1LORA 4INFA 4U3AA 3EEGA 5FACA 5F2LA 2ZC1A 1RAKA 3VNZA 1QT1A 2R91A 4F4RA 3CTTA 1EWEA 4J27A 1JZ2A 3WUGA 4UZSA 4I5XA 3EYPA 2PU0A 1GQIA 3R2GA 3IGUA 1RK6A 1JPHA 5EMKA 3PBGA 1P4CA 1JYNA 5CPMA 1X39A 1HFBA 3M41A 1TG7A 3EX1A 1DWJM 1H11A 5AZ1A 2AKMA 4QISA 5M5DA 1OGGA 3G1DA 3TN4A 2OG9A 3CQKA 3SCRA 4EPEC 3SSJA 2X05A 3WQ6A 3ZJKA 4MWAA 3CS2A 3T05A 3B03A 4OWGA 1GW9A 1Q6OA 5I6SA 5A6MA 3WMSA 2BDQA 4LRSA 2PGRA 3ZLGA 4KWWA 5E93A 2QVHA 3KDNA 3BZJA 1B30A 3CHDA 3VX1A 4ACZB 4FOKA 4W4QA 3S9IA 3UD6A 4IXXA 5LNUA 1C9DA 2ZXBA 2VGFA 1OC5A 3GVRA 2Z25A 2H3DA 2YPIA 1YPFA 4HHLA 3WJSA 3C0QA 5T8GA 3SO7A 2WJDA 3D3AA 1JFHA 3B9EA 1QOPA 4YWIA 3BAIA 4OECA 1WOBA 1KM4A 3MSDA 4GKTA 2FZ9A 3CNYA 5IBXA 4AIUA 5IRPA 3L5LA 1DORA 3NM3A 2V2CA 2OZTA 3MWAA 4LBUA 1QI0A 2VTFA 2F2KA 2G3JA 4ZO8A 4BF9A 5CC6A 3LG3A 1MRAA 1ZSXA 1TQJA 2A7PA 4ROPA 3OP2A 4DUVA 4HYVA 3MCOA 1KCXA 1U5VA 3QR1A 1S2AA 1AZ2A 5FJJA 4FXSA 2PS2A 1JUEA 2UY4A 4CKQA 3F4NA 4C1KA 1WP6A 1B3WA 2ZUVA 3RO6A 1EQPA 3MUIA 4ATDA 3L4ZA 4MAVA 2C7FA 3TONA 9XIAA 3R94A 3LHWA 4B15A 3QW4B 2Z7KA 2CESA 3G77A 3COTA 1Z89A 3FYOA 4AVNA 8CGTA 2IUZA 2ALRA 4AXKA 4TX9A 3L67A 3UXIA 8XIAA 1I1XA 2PTZA 3QGAC 1IV8A 1N55A 4GXPA 2ZUMA 1W6TA 4UNIA 5BXSA 3SGGA 1DWIM 1EIBA 1KR0A 2OSYA 1RUSA 1U5JA 2CEQA 1S1RA 1OEPA 3PZUA 1GVRA 3VNKA 1TB3A 2PBOA 1WE5A 3PZGA 3TYBA 3TOPA 3TYAA 3BW4A 1V08A 4L80A 1P7TA 3AROA 4PTVA 1WZMA 3NO3A 4QM1A 1GOOA 4KCWA 4YCOA 1OCNA 3I6EA 3O1NA 4K1WA 3TROA 4W8AA 2EO7A 1B5TA 2V38A 1QUMA 1JDFA 1QDSA 4Q6XA 1L6FA 4JCLA 1TRIA 1I0DA 1LJYA 2YB1A 3TC6A 2OWWA 1TSIA 1OYCA 2CLHA 6REQB 1M68A 3M0HA 2C16A 3WH6A 2NLIA 1ELSA 1KM0A 3HQNA 5I78A 4H7CA 5HQLA 4ZQNA 1YXCA 1EJWC 3IVUA 4PCSA 4XX6A 1VPYA 4CD7A 3DYMA 3ITCA 1TRDA 1XYZA 3QHMA 5FKYA 2ICSA 2E28A 3GDKA 1W9PA 2JF7A 4FLRA 2PD9A 3KX6A 2KX9A 3LHZA 3WSUA 2PWDA 4PMJA 3UPBA 1FHVA 2YB4A 1MQRA 3OYXA 3N11A 4FNSA 4DF0A 2CLKA 3FSUA 1BXBA 2XVLA 2XVKA 3S0CA 4HNCA 3ITOA 5HR7A 4JHOA 4HU8A 3A3XA 2CLLA 2VD8A 2XYLA 4ZOBA 3QMTA 2RGMA 1HJVA 3A4JA 3TXVA 1WOAA 3GXPA 2NUWA 2H9AB 3EBVA 3GXFA 2VP8A 4L1XA 4ADTA 1R3WA 1V3MA 4RZ6A 1N8WA 1OG6A 1XBZA 3BARA 5HMEA 1XLAA 4O13A 3WLQA 4O0KA 2XH4A 2BGQA 4Z1DA 1KM2A 3II1A 3N3TA 3A9BA 2D3LA 1JZ5A 4NX5A 2I7GA 4ASTA 3GG7A 1WDQA 1W5PA 3R5EA 4PN2A 5DBTA 3FKKA 4Y9AA 2AL1A 2ISVA 3BC9A 2P88A 3W7PA 1JDEA 3C3NA 3K4DA 4H6RA 4ILSA 1YX1A 2NWSA 5CJMA 2FMNA 4P8XA 3LRMA 2PDFA 3MKKA 4LYPA 2GUUA 3SR7A 4ZB5A 3NQ7A 5FAJA 1K4GA 4J28A 3V7PA 4GBDA 1E9ZB 1TZ7A 1H1ZA 2HISA 3AYSA 2CZFA 4PR4A 3LPPA 4Y9MA 4A3RA 1GUVA 2PDNA 2EG8A 2FHFA 8A3HA 4OQVA 3GK0A 5FSDC 2F84A 1CXHA 3BAWA 5I00A 1XICA 4AUBA 2Y88A 3B8TA 1KV5A 2FKPA 4FP1A 4IFOA 4S2CA 4WKHA 5A6AA 4QR6A 1JIBA 2OQHA 1RQEA 2OZ0A 3NUKA 4C5ZA 1L0PA 4NZ1A 1RK5A 3ZOAA 5CXPA 1V3HA 3F2CA 2E4TA 3V75A 3PAJA 1LRTA 5KZEA 4GQGA 1XLKA 3N9SA 1FDZA 3BW3A 3ICJA 3H7UA 5CG7A 2V9DA 4KMQA 1TVPA 4WEVX 1EBGA 2YBUA 4H7VA 2WHJA 2EF9A 1YBQB 2BASA 5HANA 2VWSA 3PTQA 3BLEA 4CVUA 4PMUA 4L4MA 2DUAA 5EA9A 1ZNNA 3PB2A 1LL7A 3TC3A 2VQUA 4RNFA 4W87A 1EBHA 1UUMA 4B2DA 1FH9A 2YCLA 1XLHA 2HE8A 1OK6A 3VILA 1L2UA 4PMXA 3UA3A 3UERA 2G97A 3ATYA 2BNJA 4J3TA 3UZWA 1UD6A 3ZJ7A 3H2FA 1A53A 1Q6GA 4EK7A 1B3YA 2QCNA 1PXGA 4JTCA 1E4LA 3BOFA 4ZENA 4ZQPA 2QCMA 1Q6FA 4HA0A 4KWOA 3L4VA 3UT0A 5DEZA 3PR2A 2J66A 1MZRA 4ZXLA 5EY5A 4IF2A 2E6AA 1P5BA 2QCDB 4M1RA 1YYAA 1CZ1A 2PTXA 3P60A 3OGVA 1LUCA 1SPQA 1S2VA 2X16A 1GW1A 1F4AA 1KLZA 1H51A 2JQXA 1ZAHA 3UG3A 3KL5A 2W27A 3FK4A 3JZUA 1KB3A 1ESWA 4H6QA 3S6OA 4JTKA 1DWAM 4KIRA 3UGVA 3F4DA 4GPNA 2NVDA 4RUBA 5I3IA 3T4CA 1SJCA 1GKQA 2VZOA 3GZ3A 5CLWA 3OGSA 3CQ0A 1JJKA 3TW7A 4I5RA 3AFBA 4WOZA 3PFRA 3W2LA 5CBBA 1XLMA 3H2OA 1DQXA 3NPWA 4FZIA 5LXEA 4X63A 1CIUA 4GD0A 4IQJA 1DV7A 2ANUA 1SQ7A 4Q4KA 3CPRA 1EEXA 1JYWA 3P62A 3QF0A 3L21A 2YBVA 3RU8X 1GGOA 5DMMA 5D2XA 5CSRA 3ARYA 4TO8A 3VZYA 1BTMA 3CWNA 4O15A 1I2OA 3A23A 4NZ3A 2X0HA 3ARUA 1PZ1A 4ML4A 4O10A 1JF6A 2HK0A 4TU1A 4MJZA 4AC1X 4JL1A 4Q8VA 2P3EA 1HKMA 2OCZA 2O92A 4C6IA 4LY8A 4JIIX 1VHNA 3UCQA 3MBDA 4Q4PA 4HMCA 2EKCA 4DLMA 3CT2A 2C14A 4PCFA 1UH3A 4WSJA 1KXTA 1ML1A 3BLDA 1S2TA 3P84A 1M7JA 5FAGA 1UP0A 2X7VA 4E0CA 3R0KA 3K13A 4OVXA 3DKLA 3WUEA 5B7ZA 2PB1A 1WXZA 4RDYA 2Z24A 2OO0A 2WMFA 1S5TA 4LWWA 4J4KA 5A1AA 2QF7A 3T2OA 1F7BA 4JZ5A 3UZZA 3GUWA 4J5NA 4E8CA 4FOUA 4MIMA 3W24A 1JUBA 3IIZA 1YNPA 3KFTA 1MI3A 3DI1A 2QT3A 4O1DA 3LHUA 4KQNA 1X97A 3LXCA 2VCBA 3HFTA 4GWEA 4PTNA 1NDYA 3EMCA 3MDUA 3DYOA 3TQVA 1F8MA 3URNA 1UWRA 1U1JA 2QAFA 3NSMA 3UYCA 1XPYA 2FLIA 1M9HA 2J6XA 3WF2A 1GT8A 1FFRA 1EQCA 1AW5A 1PL9A 2VL4A 4NZCA 1UWTA 5D38A 3USBA 1DIEA 1KA9F 2WCSA 1REQA 3MMUA 3OGRA 4JTAA 1HZYA 4GHRA 4AWTA 1HJXA 1XIBA 1G7VA 4AAJA 2E8YA 1Z9AA 4KPLA 2X1RA 4WIWA 2E9BA 4X2RA 4JTTA 4FALA 2X1SA 3H4GA 2G41A 1FWWA 4R3UA 4RV8A 3G22A 3TSMA 1DL3A 1OK4A 2J7CA 3VC5A 5BNKA 3PPFA 5HOSA 1BWKA 4Y96A 2Z29A 3ITYA 3P67A 3UFYA 3KP1A 3QR3A 4FF5A 4GQRA 2XIOA 2VZUA 3NSNA 4S3CA 3VFLA 3RO8A 2HNEA 2ZADA 1YMYA 3S2JA 3S5ZA 1TIWA 4M6PA 4QE5A 1KRMA 3UWZA 5LZLA 4E3VA 4IJCA 2VDHA 4KRUA 3VIGA 3UJSA 5RUBA 3U3HA 3GHUA 2UY3A 1H50A 2B7OA 2R1KA 1RXOB 1UD8A 2WJZA 2OGYA 4HKPA 1I75A 1IWPA 2EG7A 4PL1A 2WWDA 3L4XA 4DYKA 2WW5A 3S2CA 2PLKA 3GG0A 8XIMA 2W4XA 4L6DA 3NQGA 4BEQA 1KXHA 3WJZA 2XN2A 4UQCA 2TODA 3EB4A 4JFVA 4WDWA 2GQ9A 4MWAB 3ZVIA 3W76A 4L7ZA 4PMDA 4S3AA 1XYBA 5IFTA 1HP4A 3HPAA 3PZIA 3ORWA 2QYGA 3M0JA 2QGYA 4LTSA 1FCBA 5CPNA 3E9AA 2WSPA 2MNRA 1FKWA 2G0WA 3WBWA 1F74A 2J13A 1QVBA 1XW8A 1DWGM 4XAPA 1C8VA 2VEGA 1JGMA 4LX4A 4GVIA 5E6YA 4XIAA 1XR2A 1XLFA 5CLTA 3E2SA 3T0AA 4A3QA 4KGLA 2PBGA 4C1NA 5AYZA 5LIYX 1TWWA 4JFTA 1LOLA 2VQTA 2GUYA 2OSWA 2LLEA 2QR6A 4LUSA 3ANYA 3GUGA 1KRBC 3IK2A 4WY0F 1U83A 1X96A 3PJTA 3S6DA 4LS0A 4OU1A 3A21A 4FAMA 1ICPA 3GNXA 4CNNA 1SO5A 2BX7A 4MDPA 2AGTA 4ZODA 4NZ5A 4LC8A 3RUBL 1Q6RA 1IEQA 3DBPA 4RE4A 1EX1A 5C2GA 2F9RA 4L1WA 2B0MA 5DELA 4DJEC 2NVAA 2BY0A 1MXDA 3UR5A 3UCCA 1LROA 1C91A 3TDFA 4IX0A 3ENLA 3UWVA 5H8PA 2Q8XA 5HJYA 4HNUA 3LCXA 1C7SA 4E4UA 4A21A 3H21A 1OY0A 2PRMA 3AICA 4NZ4A 1J0ZA 3ZXWA 4PULA 1XCFA 3W29A 4WZHA 2CHOA 1WKDA 4GX8A 5ABTA 4RZBA 3S47A 4D6FA 3CUFA 1MRQA 4FX8A 3GHSA 5M17A 3M16A 3TIMA 2VUYA 1YE6A 1ISVA 4AMAA 5AFDA 1E72M 5D8ZA 2GDUA 2E6YA 3NO5A 2XFWA 4NZJA 4U3CA 1MW1A 2RDXA 5HR6A 3TCSA 4S3GA 4CLMA 4Q8OA 4ORMA 2XWEA 4KW2A 3UR7A 1TWSA 2XZ9A 2ZZ1A 3OPSA 4FLSA 3MUXA 4EOUA 3F5KA 3UPWA 3G3DA 3UZYA 4JTUA 3CEPA 1XIMA 3W75A 2PP3A 4I3GA 4NP7A 2CPUA 3E12A 4XUGA 1F3EA 2QJMA 4JNZA 3B9AA 2VC7A 2XSBA 2GSHA 1KC7A 5AC4A 2ZUSA 2R9RA 1GZGA 5FEWA 5G1MA 3H70A 4GVGA 1QTWA 2TRSA 3L4WA 1YEYA 3EA3A 3AYRA 3EXRA 3O07A 1SMAA 1P48A 4KETA 2Y89A 2QCCA 1GK8A 1P7TB 1UZHA 1FWJC 2XH2A 4C6MA 2WVVA 5D9PA 3C61A 5D09A 3DAQA 3LV5A 4P7LA 4DJEA 4QLKA 1TELA 1OFBA 2XZ7A 3VIHA 2VEPA 4Q22A 5IDIA 3KZPA 2YOCA 1JI1A 3CQIA 1QOXA 3GYCA 3DC8A 1XGDA 3FXYA 5CBJA 3GH5A 1ADDA 3N6QA 3PG8A 1ZL1A 2RDUA 1N7KA 5D03A 4WGHA 3VXGA 2C0AA 4GUGA 3CLMA 2XVNA 1D7KA 2VDGA 5EBAA 4O18A 2WHKA 3IS4A 1OGSA 4LAMA 4G8TA 5CH9A 3OVRA 1BF6A 2J75A 3IANA 1HKVA 1XDLA 3EMQA 3WD0A 5HINA 3N14A 1EJSC 2VR5A 1R2SA 3BGAA 1BYCA 3N4AA 4HSNA 4AYGA 2PDCA 2VRJA 3JZEA 4ZE4A 2FGZA 2HVOA 1BWVA 1R2RA 4MNMA 1BF2A 2JEPA 4GNVA 2BOGX 2Z1VA 4WGXA 4O4VA 1XD1A 4ZO6A 4YL2A 3RU6A 3VGEA 2OODA 2DW7A 4JTJA 1QWKA 3PHAA 1OABA 2L5HA 3RDKA 3EDKA 5BXTA 1IR2A 1AJ0A 2VX7A 4AQLA 3GIYA 4RE0A 3V0UA 3TLQA 3VGDA 1NFPA 4YIWA 2JALA 2EPKX 2J8GA 5HNTA 3AXXA 2IKIA 2WKGA 1XV8A 4H9TA 2ACUA 2CU0A 4PRTA 1HVQA 4FNRA 1P0DA 2QF8A 1Q7ZA 3PG9A 4AH7A 4QIUA 5EL1A 3S1UA 3VD5A 5H1WA 2FTYA 1LQAA 4KT2A 1XI3A 3WQGA 4OBSA 1VBGA 3DFSA 1K8ZA 1P0KA 4IISA 9XIMA 4XAZA 5CSYA 4DRSA 1DIDA 4LB3A 5JIPA 1TUXA 3WBAA 1KFJA 4NI3A 1O6IA 3IIVA 4XZWA 5CBIA 4H6KA 4MG4A 1J9YA 4ZE5A 1ZPTA 3KAOA 1RP8A 3I68A 2IQ0A 2PFHA 3UY7A 1E9LA 4PUUA 2Y6ZA 4PMQA 2JKPA 3V36A 1G4TA 3LSBA 1XX1A 2GGHA 2JBMA 3VOGA 1AL8A 3NJ3A 3UNTA 1QK2A 4MMWA 1IZKA 1VCVA 3MP4A 1GVYA 4A3YA 4FPSA 3WYZA 2J77A 2E3ZA 3WLHA 3NYZA 3QV8A 1H4PA 4RXFA 4PSRA 3CEUA 4P7NA 3N6JA 3QSTA 5A94A 1P0EA 1ZJIA 3CV6A 1X6UA 1J0IA 1CECA 4QQ3A 1CXIA 4J3VA 4E8GA 3GVVA 3QC0A 2PTYA 2XWDA 1TKKA 4O1FA 4JICA 4AZ6A 3KBMA 1FKXA 1XM3A 3ZQ9A 4XK2A 2XGIA 1BHGA 4EX4A 1QXLA 4XD3A 4PSPA 1XLBA 4DB7A 1O5XA 4IFKA 5TAOA 4BR1A 4JR5A 2VNCA 4A8LA 3TA6A 1S5WA 4J40A 3DYPA 2H3BA 1SZEA 3I4EA 3GTHA 2ZE3A 5DF0A 4GIAA 1RH9A 4O11A 3URAA 2JGYA 2FFIA 3RRAA 3T7VA 4JTSA 3U2EA 5F1VA 1W3JA 1BGGA 2OVLA 2ZA2A 1J11A 3WLLA 4YPJA 3AXHA 1R47A 2VX5A 3TWBA 1TMHA 1PKLA 4JQ1A 1ITUA 4E5TA 4DBWA 3GDMA 3GG8A 1C3FA 5GVJA 1CLVA 1TJPA 4GQBA 4Q4SA 4H2CA 4IJRA 2WZIA 3R0UA 3SCTA 1FXPA 2J7EA 3IPWA 4GY1A 1E1CB 1XG3A 5CAKA 3OZMA 5F4WA 1EXBA 3FX4A 5CC7A 4AFYA 1ITXA 4AZCB 2V69A 1E6QM 1YQ2A 3M0LA 1GVQA 3I3BA 2YJQA 5ECUA 3LCGA 3FW6A 2R1PA 2WBKA 4HA1A 2ZX9A 1LBLA 1FP8A 1IEIA 4N7QA 1VIWA 4ZSUA 3B0VC 2PLCA 4MB5A 3CWHA 3KRUA 3M1ZA 3WH5A 3KLLA 3N17A 4DYEA 3FN9A 3WO8A 3RLVA 3RPDA 5C54A 2PRHA 3DFHA 3QMSA 2PI6A 1XP3A 5DANA 1OSEA 2G4FA 1TV4A 4ML9A 1XRSA 4DZAA 1GVEA 2E5DA 4C7GA 5EB8A 3B8DA 3WNPA 4P61A 2X1UA 2ASHA 2V5DA 2HROA 2A6LA 1T41A 3KHJA 4JTRA 3UP8A 3FGCA 3VIFA 4YHGA 2CITA 1IIGA 4F0SA 4PUNA 1SR0A 3BSMA 1V3JA 1GZJA 2OXNA 1Q3NA 1XINA 3HGJA 4H41A 1DIKA 1RJRA 1XC4A 3NZQA 3E5PA 3UGRA 4I7WA 3CHFA 2VGIA 3AIEA 3VU2A 1UHVA 3TLLA 3WH8A 1RBOB 4HU0A 1WKFA 4DO7A 3WNNA 2CXEA 4IGNA 5L9FA 1QK0A 2DY3A 2GGIA 4DWDA 4Z2KA 3PTMA 1ONXA 3WLIA 1J5SA 3HG4A 5CC5A 1I8JA 1OFQA 1EL3A 1QNRA 3C2YA 2VOTA 4YYFA 4ORIA 4UBPC 4KESA 4MKSA 3T2QA 3C2RA 2E9LA 1G6CA 3E2RA 3L9CA 4DXKA 5G4EA 2QUVA 3D5HA 1LQ2A 1VFUA 3BV7A 1OFRA 5HXMA 5HK4A 1A5NC 2J7DA 3GBEA 3GDRA 4E3TA 5LNVA 3C2FA 3URBA 1Z32X 3E2VA 4AWEA 3AU2A 3RILA 2B4GA 3G8EA 1GVSA 4ZVJA 5CZTA 1FWGC 5D37A 3HQ1A 4PCPA 2CLPA 1ZUAX 1BG4A 3E96A 1NF7A 3UU0A 3MMDA 4TQTA 1F6KA 3SY1A 4DZIA 2I17A 1R9YA 3UJEA 4FA3A 2O7QA 3W1LA 4AIEA 1UR3M 3DESA 1JEZA 3RIKA 1OZMA 1YNQA 1E51A 4UCGA 3QTPA 3ABQA 1XISA 4RV3A 3ECQA 4US6A 1QI3A 1REQB 5JMUA 1NH6A 1W32A 5GJPA 1YLVA 3B9DA 4XD5A 1WDSA 2V2HA 3PZMA 3WNMA 2A0NA 2UBPC 2GK1A 3L65A 2FZ8A 1PCKA 5BMXA 3W1NA 3CUJA 1QNOA 1RJQA 5DT5A 4DVOA 1J0HA 4Z0JA 1UKQA 4G9PA 3MKCA 4HNTA 1W31A 4QG9A 1A5OC 1Z48A 1BYDA 1UD4A 1W9BM 1AW1A 4WJEA 3U0HA 5CJNA 1X7IA 3LOTA 3FA3A 1FCUA 1XFBA 1A49A 4HYWA 4B5NA 3F4WA 3G8RA 2V5KA 1WDWA 3MSGA 3GR4A 3TJXA 1V6WA 2QUMA 3T07A 1FWEC 3C8FA 3BW2A 3WQFA 3TJLA 1GOQA 3RCNA 3IJ6A 1ECEA 2BV9A 3QM3A 4M51A 4RE3A 1XH2A 2E68A 5K4XA 3WJYA 3UW6A 4MB1A 3RGTA 5CPQA 4GO9A 1I2QA 1E0WA 3JS3A 1WB0A 3VMPA 2QZRA 1Z6KA 1PX3A 3H22A 1SFSA 1Q2SA 1PWMA 4PCTA 2BY1A 4A3HA 4CQ8A 3WQVA 4XVDA 1WBHA 3CMJA 4CCDA 4K1GA 5M03A 3NQ8A 3PSVA 3PK7A 4DUOA 3MMWA 2GVLA 3MYPA 5C6MA 1ZGDA 5B7YA 2CYGA 4DJDA 1PTAA 5HULA 3B8UA 1CGVA 4OV9A 4X9SA 3T09A 5JIWA 3FHQA 4K8EA 1C9WA 3W37A 2OPJA 4HMNA 4BJHA 1H0GA 4NSBA 2AQVA 1KBKA 4PMVA 1CYGA 1SZNA 2ZXDA 1BVNP 1QI2A 3FJ6A 3F1QA 4JS3A 1YDYA 4OIFA 2DT2A 4JTEA 2C1GA 4AD1A 1WZKA 4NJKA 1IGSA 4N9CA 3M43A 2UV8G 3SUSA 4C5YA 2W6RA 3QXBA 5AHNA 4C1NB 5HUOA 1YNYA 4B5VA 3PZQA 4AZGA 4GFSA 4B9ZA 5K4ZA 1NOUA 3WD1A 3ZO9A 4LUSB 5A6SA 2DZVA 3MV01 1CLXA 5DT7A 1TV8A 2ZUWA 3EGJA 3LUTA 2EHHA 4QP0A 4XTIA 3GLCA 3DOPA 3EDEA 5H8UA 4XZLX 4BKNA 4L9XA 3FVMA 1ZBCA 3HPXA 1X6LA 2XJ7A 5FA5A 3R1ZA 2D73A 2IQDA 3BV4A 4JDYA 1YRRA 3RLUA 2XM1A 2YA0A 1BGAA 1G0CA 4JBRA 5XIMA 2QDDA 4AD2A 5LNSA 5E9XA 3FJ4A 3A5FA 3UA4A 2V30A 3Q67A 3HZ3A 1MO0A 1XIHA 2E5BA 2WZTA 3NVTA 1Q6CA 3NQMA 1SO6A 3JUGA 1E0XA 1UZDA 3AIBA 3ATZA 1SR9A 4IG2A 5AVNA 5C9ZA 3MI2A 1QAPA 3WDPP 3WCZA 2R94A 1TA3A 1DJHA 1ZBVA 1TIMA 4PTMA 1I2RA 4NIRA 4MY9A 1HF6A 2VGBA 1A5BA 2WPBA 3WDHA 4BQ4A 3WF3A 4KEMA 3O15A 3W88A 3USZA 3LBOA 3MZNA 2ZYFA 1NEYA 2Z1KA 4J3XA 4B5SA 2Q6ZA 4QGCA 2DH2A 4OV4A 4UR8A 4MNKA 2E6FA 1VJZA 4XV0A 3OLDA 4EXBA 4KFOA 4YJ5A 2PZ0A 5K9DA 2ABBA 4UQEA 1XRVA 4Z1YA 5KZMA 1EOKA 3OQ8A 2DQXA 4UTTC 1G4PA 1BQGA 4UR7A 4U2ZA 3PS7A 2WCAA 3M0VA 1AK5A 3HJEA 4R34A 1BQCA 3HV8A 2H6RA 3VGHA 1PYFA 3E0FA 2I56A 1WKEA 3SUVA 3GBDA 1XFCA 4YTSA 4I9MA 2WVVB 1DJYA 1XL9A 4UMAA 4N2YA 2IS7A 3LX9A 1JCYA 3VFCA 2J7BA 3HU7A 4S39A 1OFDA 2QVNA 5KMYA 3H54A 4WK9A 1SVDA 1E70M 5FCZA 3P61A 3APYA 1E1EA 4DO4A 4D72A 3ALGA 4PB5A 4QAIA 3DFYA 5DLCA 3GKFA 2NUYA 3UWQA 2WJEA 3MUAA 3NIYA 4C6KA 4BCEA 3N29A 2I1OA 3WDQA 5A5WA 5D8WA 5A6KA 1I9CB 1PIGA 1L8NA 3TU9A 2VWTA 2ZX7A 3MCNA 1W17A 4GMEA 5H6HA 3IJ7A 1S1PA 4ZO7A 1SU5A 2PPGA 3WNOA 4CQBA 2C1HA 5BRBA 3IIPA 2DSVA 3T44A 3HO8A 5CKSA 4EE9A 4E8DA 2QULA 5D2YA 4UCFA 2ZZ7A 4WX2A 4A8RA 4UFHA 4E2VA 3UG5A 4LV9A 4F2BA 1FWIC 2Q71A 3K2GA 4MPKA 3AYVA 3EKLA 2BZNA 2OOFA 4M6UA 2NQLA 3JR2A 3PBWA 3Q58A 3N2MA 5E0KA 2YA2A 1TV3A 4PMRA 1BTCA 4GJ1A 2GWNA 3GXMA 1JVNA 3QV7A 5TD4A 1F3XA 4LF2A 1LLWA 4L4OA 3TYEA 2ZA1A 1JZ3A 1QWGA 4Z2HA 4ZB0A 1W1VA 4KIEA 2PTWA 5E09A 4TMCA 4CGTA 1AH3A 1DEDA 1E55A 1F9CA 1FP9A 3TE9A 1O12A 3PWAA 1UWQA 4HN4A 2Y8KA 5HBFA 4UIOA 1UBPC 4BQ3A 4UXDA 4QJ1A 1RBAA 4GBUA 3ZWSA 5AZ0A 3KBNA 3T0TA 1E0UA 3WKZA 2D2HA 4M1BA 1SFTA 3LDVA 5H91A 5C9UA 3A24A 1H09A 1HL8A 3GQYA 3LZ3A 1CGXA 4YWSA 1D3CA 1K03A 3KTXA 3NL6A 3KCLA 3DZ1A 5I3KA 1EC7A 2O9OA 1IGWA 2WM0A 3TA9A 3QV9A 3KOFA 1QHPA 1XIGA 2PDKA 4AZBA 1KCLA 2Z7GA 5E0CA 1Q45A 3FNDA 4KEUA 2B31A 1W56A 5CPTA 3M7WA 3VKKA 6XIAA 3PTDA 1AUSL 4DBDA 3TMQA 1V3KA 1CW2A 2RAGA 3AZTA 3ONBA 2FB3A 2VEIA 2ATMA 2P76A 3SECA 5I3DA 1TJ2A 4RW5A 3QV6A 3LD5A 4NAFB 2Q3RA 3BH4A 3DN5A 1VR6A 4JX6A 4M19A 3ITGA 3SCVA 5LNRA 3IGHX 4IFKB 1TMLA 3C2OA 3TC7A 3NEHA 4O16A 1EFZA 4B5TA 2ZE0A 4IGHA 4AWUA 2PURA 4JD4A 1H3GA 3N2BA 1LCOA 5DQPA 4JQ4A 4HSHA 3KRSA 1I60A 1J2BA 1DJGA 4HYRA 4O50A 1LRNA 4ZQRA 5AHIA 3A3WA 3KXQA 2DT1A 3VIPA 5CGMA 4DJFA 1GVIA 2RGLA 4D2JA 1V0LA 2WVSA 1W1YA 4TIMA 3MI6A 2ZZ4A 4JOMA 3SRHA 4IMCA 2PDGA 3WNKA 3SRDA 2SFPA 3L5MA 1FQ0A 4HHPA 1U1HA 2GJPA 1OADA 1TZZA 3KOZA 1WO2A 3W87A 3HURA 4LBRA 5IHRA 4AB4A 2WAGA 2VOMA 2ZTKA 4FOJA 3V1HA 4JX4A 1GPFA 1TVNA 1YTEA 3AO0A 2XFRA 5U7SA 4EKJA 3GFZA 3MY9A 4DQWA 3AMKA 4IUOA 4W93A 5AOUA 1IWBA 3PPGA 5KEZA 1TPEA 2HTMA 2NSOA 1E6NA 4GY7A 4LH8A 2DSWA 3UG8A 1L8PA 2PP1A 2R1MA 2X30A 1VLWA 4PA8A 4NVTA 4W88A 1XIJA 2GSJA 2NWRA 2VR4A 2YSWA 4GI4A 1O68A 3NXFA 4ZL1A 5XINA 3BMWA 3FGCB 2WNWA 4A8NA 6PTDA 4Y9OA 1DQUA 1BWLA 5F4XA 3M7SA 2YR1A 2FHCA 5ENLA 4O54A 1X8CA 1OC6A 1UOZA 4UFLA 1K6WA 3EWBX 4E2DA 2DT0A 2VC5A 2QW5A 4IOTA 4L56A 4BFAA 5A8QA 2WBGA 3L4YA 2BG5A 4EWND 1ADSA 1DJNA 2C6QA 5I7GA 2FZDA 2X2GA 2ZA3A 7ODCA 3VMOA 5DRCA 4F0RA 3FJLA 2OGJA 3VE9A 3M64A 1VPXA 2MUCA 1ZJAA 3VDBA 4JY8A 4XKMA 1SO3A 3O8AA 2DPEA 2NW0A 3IK4A 3LCLA 3T0BA 2JFEX 4MOZA 5BW6A 4HPXA 3THCA 2GZXA 4HA4A 2HS8A 4RDZA 1KGXA 3VKDA 5A6LA 3P81A 1KM1A 4O12A 1PZ2A 3NL3A 1W3HA 2X09A 4TVDA 1RA5A 5SWUA 1B31A 2PDQA 3KVMA 2IXUA 2J4GA 4X2PA 2XIBA 3I7SA 2OB3A 4KCTA 4XUYA 2E67A 2Y8VA 1ISXA 5HUPA 3GXTA 2I9UA 3OIHA 1ISYA 3A22A 1ZP4A 2VJXA 1AODA 2W91A 3M0KA 1LBFA 1M01A 3MBFA 3BANA 3C52A 4M80A 4WOQA 1EOMA 1GNXA 3L2LA 3POCA 3OQEA 3VE7A 4L5ZA 4B90A 3KWXA 3N25A 3MI3A 3TZNA 1Q2RA 1S2CA 1ZLPA 2VDIA 4KFNA 2J8TA 1GQNA 3AHYA 2ZX5A 1QJWA 1DWFM 1KBLA 4IIBA 4ZMGA 3VIOA 3I7QA 1QPNA 1H1YA 2E5CA 1SUXA 5C2CA 2ZRVA 3H2CA 1ENUA 4I90A 1VPQA 2Z26A 3FVDA 3LV6A 4OE7A 4BK9A 1KKOA 1SMDA 3TAKA 4FK9A 4NNAA 1V0KA 2GK1B 2OO6A 1Q6QA 2PLMA 1UWIA 4Z1AA 4X0VA 3SI9A 3KDOA 3UG4A 5A8NA 4LEFA 2O55A 4FI4A 1IXNA 2R82A 3QJAA 3A5VA 1H5YA 4CU8A 1NWRA 3SCNA 2QPUA 1IZJA 3QC3A 2E9MA 1CB2A 3GAYA 4N4PA 2AMGA 2FYMA 1M1BA 6CGTA 3QY8A 2NV1A 3L4TA 1AFSA 1Z3NA 5DXXA 3IUDA 1DOSA 4H9ZA 4V2XA 2CBUA 2V3EA 3CTLA 1K1DA 2CERA 2FDSA 1TR9A 2ZXAA 4HBKA 3VOFA 1NIUA 1SW7A 3EKZA 4LOCA 1SSDA 2FIQA 1MNZA 3VK5A 2OEMA 3PUEA 3PANA 2QNEA 2CLMA 3TXZA 3JVAA 3GHTA 4J3WA 4D9PA 3VOHA 4I9JA 4V15A 1S3TC 4KEZA 2WC3A 2PF8A 1X7FA 1NAL1 2B7QA 2X2YA 4BEUA 1GKRA 5FIPA 2J7GA 3KS6A 1EJRC 4O8RA 1W3NA 5DMNA 3B0PA 4C6EA 4JDBA 4PTXA 4QITA 1TJ0A 4CNSA 2XHYA 5M2FX 1R8LA 2PDPA 2ZZ5A 1HL9A 3LPOA 3W23A 3EA1A 3N6HA 3GC5A 5BROA 2YXGA 1IT0A 2CC0A 3UXAA 4O53A 1ZCOA 3O63A 4ADUA 1XIEA 4NASA 2XFFA 2FPYA 4YTRA 4N02A 3W73A 5IXEA 3AIQA 1UWSA 4JKLA 4JX5A 1ITQA 1CTNA 4B91A 3MO7A 3LCHA 3PWIA 2I5IA 5FJTA 5EMJA 5LYRA 3N4EA 4C90A 1E6PA 3S1GA 6TIMA 3O6AA 3KVKA 2IXVA 4D8LA 1FOBA 1TX2A 4X9YA 4C6FA 1F6YA 4F40A 1O1ZA 4GVHA 1BD0A 4Q8PA 3PC0A 3W2KA 3R8RA 4I9AA 1M03A 3MP3A 1QW8A 2OEJA 3EWDA 2QJNA 3GNOA 1UKPA 2HPMA 4YCPA 1TV5A 1OFEA 3D46A 2DUZA 1UJQA 2D0HA 3EX2A 5TF0A 2WHLA 1VENA 4H8VA 2DFAA 1FX6A 3MWCA 2V2DA 3EB3A 5FL1A 3RX2A 1ME9A 1JZ6A 2JF6A 1DVJA 4CEXC 4B9YA 3HA1A 1P1MA 3BO9A 1OT1A 5HPOA 4GIYA 1MW0A 3HMCA 2VKZG 3IGSA 3QSRA 4XTDA 1BYAA 4AD3A 1D7FA 2VFHA 4IG2B 3KS5A 1KFBA 5LIKX 1BXNA 4ZOEA 5TNVA 4MY1A 1W0MA 1WDPA 2QPSA 1JRBA 4RNIA 3BPWA 5DY2A 3W85A 2VMFA 1QNPA 1K9DA 3GH7A 3STFA 2A7RA 5BYWA 1LBMA 1M41A 3URQA 8RUCA 3WQOA 3MHUA 2Z6JA 2WC7A 1OCJA 3WDIA 4LAOA 4JQAA 2KAUC 5D9MA 5JUVA 1JR1A 1E71M 1XGEA 3KE0A 1VP5A 1VYRA 3E2QA 1XLIA 5GNXA 5GJNA 5AECA 1FWHC 3BMVA 1Q5MA 4NZFA 4REQB 1HTIA 3WQPA 4NYUA 1SW0A 3R8GA 5LSMA 4ZZ9A 4YMZA 1JCMP 1Y65A 4IXHA 6TAAA 1HVXA 5D32A 1QR7A 4FXRA 5D2VA 2ZRZA 3ZMRA 3YPIA 1O5QA 3DGRA 4L4LA 5KZ6A 2OSXA 3E1F1 3QPZA 1FWNA 5C71A 2OX4A 3ZR5A 3GTNA 4P8WA 1U30A 3K5XA 3KBVA 3LHYA 3FSTA 5T26A 2Z2BA 4H9MA 4TX8A 1PDYA 1H7WA 2YDRA 3INPA 1B3ZA 3EA2A 2G96A 1CBGA 2DQWA 4QEEA 4HVXA 4GJJA 3H12A 2XSXA 5I0DA 2A3CA 3MSRA 1E4MM 3VD4A 4MY8A 1XIIA 4AZHA 3ABOA 4UFJA 3R10A 1JG9A 4GYFA 2PWGA 2JEQA 1R86A 3PJWA 2WZEA 2ZC8A 2D22A 4DI9A 5HATA 2FPVA 3W84A 4GZJA 1VFMA 2C18A 1ZTVA 1F61A 1RY8A 1H0IA 4WXZA 5C70A 2AGKA 2OQYA 3IARA 4Q8WA 1T8QA 3BCDA 3L2IA 4J3UA 4GYPA 4UOZA 3VKCA 1XSJA 3CH9A 5MKGA 4J1OA 3W7JA 1AH4A 1R30A 4JKMA 1EIXA 1XF0A 2PDYA 4YYCA 1H7XA 5T91A 2AAAA 2E40A 1XC6A 5IOBA 1Q4NX 4MADA 2IKHA 2P8BA 4IMEA 3DXIA 4KBXA 4LVBA 5KETA 2F6UA 2A7NA 4QS5A 4OT7A 1J4EA 5KZDA 2Z00A 1E5JA 2OR2A 2YCEA 1ZJHA 4PYSA 3C2VA 3SIMA 3A4XA 3K30A 3KEHA 5CEWA 3N2CA 1A3XA 2Z27A 4CN4A 1E6XM 2BMBA 3GSMA 3RM8A 3T1GA 1EYWA 3QH2A 3HGOA 4KWUA 3TYCA 3CV2A 1Y0EA 1FFQA 4HGXA 1SYTA 4K8GA 5HWNA 3H55A 4DY1A 2XDFA 4LS1A 1GTHA 3WMCA 4IMFA 4UTIA 1R3TA 5F7UA 5TQLA 1CENA 4ATLA 4MFEA 2PEVA 2E7FA 4LUTA 4DPPA 5I07A 3H7VA 4MFDA 1KBIA 4JGDA 1NOWA 3OODA 7TAAA 1OBAA 4HNLA 3K4AA 3CMFA 3NGFA 4MKNA 2ABAA 3BURA 2DSKA 2A6NA 4U5KA 4C6LA 2GVYA 2Y5SA 3W7DA 1NARA 5FI8A 2WM1A 4PL2A 1CXEA 2PE4A 3RCMA 3EWYA 3BGJA 1WPCA 4AIOA 3UXDA 1TVLA 4X22A 2DZPA 3VZXA 3RRXA 4E4PA 2O7SA 3IACA 4PEKA 4U2YA 5FJRA 2J78A 3U9IA 2BLEA 4JKKA 3NM1A 5C9XA 2RH9A 4OGZA 2ZRXA 1PO9A 2Y5JA 3ZR6A 3AMCA 4D6IA 4U4MA 2PGFA 4KF1A 4I7VA 3KL3A 2BS9A 1VQTA 3U2CA 2ALDA 2ZWYA 2EPOA 4LCRA 3DBNA 3GTIA 2QJIA 1XRFA 3S2LA 2NX3A 5BOEA 2YL6A 3EWCA 4I9TA 2PSNA 4L6OA 2NT0A 3EDFA 4IP7A 1OYBA 2PDWA 3NZ1A 4NXKA 3AZRA 3WD4A 3NQ2A 5IFPA 1QRQA 3AIRA 3UPMA 1AD1A 3P3BA 1ZAJA 5KSWA 4LSBA 4QHRA 2XVGA 4ZO9A 4FSAA 4L64A 4Q8MA 3KRZA 3DG7A 4ADSA 1XYFA 4WQ6A 3REQA 1RA0A 1XIDA 1OX5A 2AAMA 3TX9A 4NU7A 3F2DA 3SUWA 3RR1A 2W79A 4G7FA 2OYMA 2POTA 2CETA 4ZOAA 4S23A 1V0MA 3MS8A 4JN7A 4AYSA 1M65A 5DY3A 4O0ZA 2ZDRA 2VELA 2ZVIA 1A0DA 2O0TA 4LNYA 5F2GA 3TTEA 3KZSA 5AHFA 2FGLA 2ONEA 3AMGA 4HTBA 1A5AA 4WJXA 2CBJA 4XZMX 1VAHA 3NQEA 4FLQA 1WZLA 4LYRA 3LK6A 4TV6A 2ISWA 3VIIA 2OWXA 3PUGA 4FIRA 1RALA 1CGUA 2GYIA 4DBSA 3NAVA 2DVXA 2FZNA 1F8IA 3CV1A 1JUKA 4U31A 1V02A 1J0JA 4GYKA 3DKJA 4I6VA 2YXOA 4WVXA 2V5BA 2P1FA 5ABFB 2FQIA 1EA9C 1TQXA 2D0GA 3W2JA 5JXQA 2OTDA 1K77A 2HNHA 1KFLA 3K8KA 9RUBA 1AMKA 4P7QA 1A3HA 3MT1A 4Y7EA 2V6AA 1FTXA 3RMEA 4U10A 4J2MA 4E6MA 3W7IA 3RLGA 1OX6A 3QZAA 4JNMA 4RPPA 1EKOA 1ZJBA 1Q65A 4WRHA 3O6YX 3PWGA 1US3A 1D9EA 3SRKA 3SBFA 3UESA 2BOEX 4Q7BA 4PB4A 4OJYA 4AHQA 2FTWA 3WG6A 1KRAC 1GQJA 3N2XA 3N04A 1QPQA 2QUTA 3MANA 3AU6A 1TPH1 2Q01A 3QW3A 1NM9A 1VFSA 2IPGA 1V6XA 3BG3A 1EZWA 3WK2A 1LP6A 2WSQA 1KFCA 1H7OA 4RKAA 4B16A 3C56A 2GJRA 1QBBA 4AEOA 2V82A 1NSJA 4HCLA 3S3GA 3B8SA 2YKKA 1O94A 5HNRA 4XAGA 4XD4A 4D8ZA 4UFIA 1D8WA 1OFAA 4TR9A 3RR4A 4FB7A 2QJHA 4DWSB 1LG2A 3VIKA 4V33A 2BTMA 2PDMA 4OOUA 3W1RA 1GOKA 1MW2A 3KVJA 4J35A 1V02E 1ZHAA 4GQ0A 4EAMA 2PDBA 4Q4OA 3OVPA 1A5SA 1OYAA 2WHMA 3EOLA 2Z1WA 3EWUA 3NZPA 2WMGA 1ZB5A 3CB8A 3WLSA 1V7AA 4GZEA 5HWJA 2BHUA 2INZA 4LCQA 1C90A 3OVQA 4IM4A 1HT6A 2Q3OA 4M7TA 3P6LA 1HKWA 3CZEA 4MYXA 2C8NA 3OA3A 2C15A 1DPMA 4LY4A 5J5RA 4W7VA 4MB4A 4H01A 2RDTA 4FNUA 1RPKA 3TN6A 4H19A 4UTWC 1IR1A 3LBMA 5K9CA 4IFRA 5AHEA 5I02A 1CB7B 2YL8A 3WK1A 1C8XA 4GX9A 3NZRA 4A29A 3IUIA 4ECLA 1PCWA 1LWJA 3LNPA 3AS1A 3UJ2A 1X6NA 1IXOA 1E9YB 5BWAA 1NF0A 7XIMA 1H5VA 2OYLA 1H62A 3VDAA 1XLDA 3B3DA 3G0SA 4LC6A 4R88A 4KKXA 4H8NA 3ANUA 2VEFA 2JIWA 2XFYA 3IAQA 2G3FA 4F0MA 4FO4A 3CT7A 2AOSA 2GGGA 4PB3A 3V1PA 3G1AA 4Z2IA 1UR0A 1V03A 1EPVA 1RQHA 1F5ZA 4N4QA 3POHA 2WYSA 4IZGA 4QDWA 3UEQA 1FWCC 3HQPA 1TE6A 1EJXC 2OKTA 1YTDA 2GJXB 3NDZA 3B4YA 1HKJA 4MVAA 5CZKA 1EHNA 3UR8A 1G1YA 3WMBA 3FCPA 2TPSA 5C7VA 3SUTA 4M6VA 3VGBA 4FS9A 1D3GA 4I6KA 1Q4WA 4IP5A 3R7MA 3HJZA 2ISSA 2YCKX 4WSHA 4UMBA 4RR4A 1O5KA 4N9DA 3ZSSA 3VTRA 1P6BA 4C6PA 3MYOA 1KM6A 5JH1A 4IL0A 1K8CA 1KWKA 1J10A 3OHMB 4O1AA 3OTRA 4QE4A 3BLPX 4QAWA 1LF1A 4MKVA 1W5QA 3PZTA 4YVPA 1G5AA 3WQWA 3EDJA 3UWEA 3IIOA 4UTWA 4EPKA 1HG3A 1RCXB 1A47A 1VC4A 3BLFA 4OUEA 3ITTA 3JRKA 3PZVA 2W9MA 4P8UA 4BF7A 1JZ8A 1UR8A 4HOXA 3FAXA 3W1UA 3HG2A 1SJAA 1FWFC 2XIIA 2ACSA 1FWSA 1D3HA 3U4AA 1FHUA 4FMVA 4QSHA 2FGBA 4PUEA 5DMYA 2HXUA 5AB3A 4LVAA 1WA3A 4GI6A 2AMXA 4RDVA 3GKAA 2V3DA 1BKHA 3P5ZA 4DM2A 1W37A 1KBJA 3GWQA 1Y8BA 5REQA 3EKGA 2VR2A 2OEKA 1A5KC 1TPFA 1CT5A 1R5YA 2EPHA 1XYLA 3SJ3A 3AHZA 3CUHA 2PWFA 3OZPA 1W3KA 4F8XA 1WAWA 4MWAD 5EU9A 1YADA 4J2PA 1VBJA 2QHAA 3QFWA 4XBKA 2E1WA 2GFTA 3ZM8A 1W5NA 4ZR8A 1N8IA 1HJQA 2A79A 1FCQA 4PUJA 3V0SA 4W9TA 1Q8AA 3W7CA 3PP7A 1QNQA 1IXQA 2X41A 3MA8A 5LIXX 1LT7A 3M0IA 4H4IA 4I8YA 1XLLA 3BICA 3NQCA 2CHNA 3PBVA 2CZDA 3E74A 1PTDA 2J8FA 1E73M 4IWWA 3QYQA 3QHOA 1MDRA 2JKEA 1OG0A 3KOWA 4QQUA 5AKQA 3CAVA 3UWWA 3BAXA 3W2NA 6REQA 3OHIA 4Q6JA 2GWGA 3LTPA 2XIMA 2WMIB 5BU9A 4U5IA 4S3DA 3LU2A 4LYKA 1H63A 3W4RA 3THDA 3W1XA 2HV5A 1XPGA 3MMTA 4HP5A 5BXPA 1A50A 3HGRA 1WAUA 3W7EA 1VH7A 1R7AA 3EEZA 4H83A 4FXFA 3MSYA 4F0HA 3AHTA 3A13A 1IEVA 4GUIA 2V3GA 2CLIA 4YTQA 3BAKA 4HJWA 4HNVA 5LA2A 2PU1A 2DU2A 3MO4A 1UP2A 3N2TA 4GO8A 1ZS2A 5I3GA 2XISA 3W27A 4IMGA 2X8RA 1BFNA 1FHLA 3MKVA 2ZXQA 4ZBCA 4UTMA 2H9AA 4QTGA 4JAWA 1XLGA 3THQA 4KRZA 3VKAA 1MSSA 2I57A 4H6EA 3J7HA 4PUWA 4QX4A 4GK8A 1FH7A 3OYZA 3RFAA 1H1NA 1VD6A 1O95A 2OT1A 3W26A 3ONCA 3W38A 3B9NA 2XM2A 4D6GA 1CI1A 3MJMA 3GDLA 3EZ4A 2ON3A 1SZGA 1Z41A 3WF1A 4N0RA 2I16A 3UBPC 2GDVA 3P93A 4UFKA 1UH2A 3E0WA 3M0ZA 4B92A 3G3MA 1F73A 3AAMA 3MC5A 3LNMA 2XVPA 2PDLA 3TEVA 1J18A 3W7QA 2EPMX 3PB0A 4C1LA 3AIUA 1GHSA 4U33A 3QKEA 3W7MA 1O66A 1TPVA 1LL6A 3EWZA 3AWOA 4O28A 1ODUA 3UYIA 1FH8A 3EB2A 3GR8A 3AZSA 3CASA 1N2VA 3CL7A 3LI0A 3WQ8A 2XTKA 1DYSA 2BODX 4A35A 4ONVA 2YLLA 1XKJA 1WBJA 2VD9A 2ODOA 1DP0A 2VVSA 1QATA 4TV5A 1R6WA 4XZIA 1UYQA 3KCOA 1GJWA 3TTYA 2G5WA 2GLKA 2W0UA 5TIMA 2YZ5A 1UD5A 3EDDA 4ZFCA 5A6TC 1BVZA 1OGBA 3IAPA 3IRSA 1DQWA 4LU0A 2BVYA 4C6OA 1P0BA 1TMQA 3WNLA 1EYEA 4JTIA 4FHAA 2FDMA 5FL0A 1EGVA 5BU6A 1G4EA 4PCNA 4DI8A 3IV8A 3NZGA 5T9BG 1P1XA 3W7OA 1ZBWA 1UA3A 1B4KA 2WMHA 3THAA 1CGTA 1Y5XA 3ZR4A 3UNDA 3ARRA 1QHZA 1KFWA 1VS1A 4HZMA 1S38A 3WK3A 1GG1A 4XO6A 2Y70A 3UR2A 3RHGA 2EPLX 3UZ5A 3H2AA 1FCVA 3GW0A 4CQAA 4MJ4A 1HQTA 4PODA 2WNZA 4Q33A 2XINA 2QCHA 1A5MC 1S5VA 3RMJA 3S46A 2PTDA 4LUTB 4DZHA 1V6YA 4RW3A 2ZDSA 4LVFA 1UWAA 1VEMA 5LIUX 1R46A 3W72A 4Q4RA 4FIQA 2CKSA 1X1NA 4E4FA 1DJQA 4RXGA 3E0IA 1P0NA 2O56A 1TO3A 4CNPA 1PTGA 4DF2A 3L0KA 4XBSA 3ERPA 5E9AA 4Y9PA 4BY3A 3A4WA 1XYMA 1A5UA 3ZT6A 4J7RA 1CXLA 4NJHA 3MCMA 1I6NA 3I6RA 4UZUA 1VBHA 3SFWA 2VVNA 3NGJA 1PKMA 1W1B1 2XH0A 3QQWA 3A4AA 1SW3A 2F8QA 5U4NA 1TREA 3EPMA 3RITA 2FHBA 2AL2A 2QDEA 2BXVA 3BQ6A 1PJ9A 1YDNA 3CYVA 1V3IA 2Z1SA 4RPQA 5IM51 4DAIA 3PBUA 4BS0A 5AC8A 1IT8A 7ENLA 1NTHA 3R13A 1FWTA 3LB0A 4NI8A 1XSIA 2EKGA 1V77A 2R8WA 5BWFA 2BFGA 2OLHA 4JIHA 4JN8A 3ZFHA 3NL2A 3WUFA 5JBFA 3NPVA 3SEPA 3CAWA 3REQB 4KFPA 1IT7A 4G5DA 2YDAA 4H00A 1MQQA 2OMAA 1LOSA 1OX4A 3AIVA 4N9EA 5EFDA 4MDOA 4K39A 4CEUC 5CCZA 4CCEA 3PVFA 2CXGA 2ISFA 4NYYA 3NFUA 5LXXA 2WNQA 1UZ1A 4OKDA 4P5UA 1ITCA 3IWPA 3RPTA 1KTBA 3VOCA 1O5RA 2C91A 3V5FA 1JDAA 3KOYA 4BI7A 1EJUC 3OG2A 3GM8A 4YN5A 2DIEA 3W7LA 4QNEA 2UZ9A 2WC4A 3WIJA 1TWDA 2G3MA 3GXNA 5FD0A 4B2DD 1QW7A 4JFSA 1M7PA 5I3HA 2A3AA 1J0YA 3KOXA 2RDWA 3WBYA 5LKYA 3BG5A 3FKRA 4WJ8A 5I09A 4HSOA 3HPSA 3RXZA 4YNGA 4WXYA 3N18A 4CN1A 1XD0A 4CQ9A 1S2UA 1TWZA 2DW6A 1GOWA 4WDTA 3LLXA 3VUPA 2V67A 4Z42C 3VNLA 1YKWA 4LV4A 3LQLA 3LHVA 3LMZA 4IX2A 4W5ZA 2HXTA 4EPBC 3BK0A 5BOFA 3F4CA 1R85A 4NJGA 1E1FA 2FH8A 3RX4A 3CUIA 1JCXA 1YDVA 4Y8FA 3A64A 1XYCA 4B4HA 2VM8A 4AEEA 1V3LA 1XQKA 2NQJA 4GCAA 1TFVA 2EEXA 3SQSA 1GVOA 2G3NA 4MWAC 3H23A 3MVIA 3VI2A 3WY1A 3M0XA 2PWHA 4PBEA 5M3WA 3P7YA 2ZRUA 5C7HA 3I3DA 2C1IA 5I3FA 2W5FA 1L9WA 2C0HA 3LLFA 1JD7A 1QPOA 4IMDA 3IJDA 2JE8A 4EPDC 3SFKA 4G1NA 4JCMA 2CZEA 4UOQA 4UTHA 1A4LA 1K70A 3FAWA 2Q8LA 4HJFA 1JULA 1Q6EA 1HW6A 2WOQA 2PDXA 2A3HA 4D1IA 4YVXA 3KM8A 5BZAA 3CZJA 1L6GA 1A0EA 3NYDA 3VDGA 3CO4A 4LPCA 1TCDA 5GNZA 1Z69A 2OLAA 5FJUA 3CUZA 2WZHA 1XDJA 4UTFA 4HN8A 2Z1XA 1GTEA 3G1VA 4ZGYA 3HGSA 4LYQA 4QDMA 4WD0A 3JU2A 4P7OA 4DO5A 3MQTA 3Q94A 1XCWA 4MZ1A 3W00A 4AY1A 4S3EA 1P6CA 2QJGA 1BEUA 2CZVA 3B4UA 3TTSA 3UXLA 2HVMA 1K3UA 3PFMA 3TVAA 1E4IA 5HNNA 2ISDA 4DYJA 4HT3A 4C6CA 3WX7A 4ENLA 2B7PA 1JYVA 1W2VA 3ARTA 7PTDA 3WQCA 3UF9A 1WDDA 2QDGA 2D69A 3O6CA 2Z4GA 3G1XA 1G67A 4QROA 1RV8A 4FF7A 3U2OA 3EX6A 4Z08A 4D6JA 4FR1A 3VMNA 2DH3A 1BG9A 4XD6A 2UY2A 3KLKA 1JYXA 3VGGA 3MHFA 3E02A 2NXHA 1NU5A 4UR9A 5D02A 1YW1A 1CNVA 4QG8A 3GFYA 2WNNA 4PZVA 1H7NA 5F2IA 3ARSA 5G4WA 3WEMA 2J7FA 1Q13A 3SSZA 5HMFA 3DIPA 4CQCA 3AXIA 3EX4A 4QEHA 2R1LA 4IICA 2C3ZA 4BWLC 1HKKA 4DN1A 3DHPA 4A4AA 2V81A 2YXXA 2I5QA 3QPYA 4UC5A 1XGZA 5HAOA 3AALA 2E25A 7A3HA 4Z1CA 3WLPA 3GVGA 4GXWA 3IV3A 3BTNA 3WQ5A 1HGYA 2PAJA 4YU1A 3STCA 6A3HA 1EHAA 3ABSA 5EKYA 1VFHA 3SIZA 1XRTA 3THUA 2PP0A 1ODZA 3ES7A 3LMYA 2INFA 1G9HA 2YYUA 3G1SA 4JTFA 4JYFA 2YFOA 1WNOA 3OB8A 1C92A 4BZYA 1MEWA 2A1YA 4WUIA 3NSXA 3QFEA 3E0LA 1M7OA 2X7WA 1XJBA 1C93A 3MUCA 2CZ5A 1O60A 1OIMA 1PAMA 2DZWA 3WFZA 3U5UA 1E3ZA 2XUCA 2HDJA 1KM3A 1NDVA 1POKA 2B7NA 3WUBA 4MWAE 1UZ4A 4HZ7A 2W62A 1DXFA 1VEOA 3U7VA 3WD3A 3TP4A 2WKLA 4JYDA 4NNBA 3GO2A 4KWVA 4NX0A 4A8IA 4UNLA 3RAOA 5REQB 4NY2A 5EFFA 5ABGA 4OBRA 2UWFA 4IPIA 3M44A 4UMCA 3TK7A 1EC8A 4DX3A 4AVFA 2YCLB 4RLIA 1DBTA 4IP4A 1KKRA 3WLTA 2F38A 4LUIA 4BWLA 2JGQA 2NQHA 4ACYA 1T6MA 3C0SA 5A3HA 2WSRA 5E0FA 3T8LA 5AYBA 4PFHA 2ZTJA 3F03K 5AVHA 1MYRA 5G1TA 1PIIA 1QHOA 5A69A 1RPXA 1US0A 3V5CA 3M5ZA 3TR2A 1LUCB 1JL8A 5AC5A 2O4MA 3EPOA 3W7NA 4QJ4B 4DUXA 4MJ2A 1CPUA 4HQVA 3L66A 1UG6A 2NV9A 4NKCA 2Z28A 2A85A 4FNTA 3LCWA 5A8PA 1PVNA 1H7PA 3R12A 1HXJA 3MZ2A 1GEHA 1Y5VA 3AYTA 2ZX6A 3W1MA 3GG1A 3P74A 1PX4A 1W8SA 5IHSA 1VB9A 1JXKA 4GYJA 3OJGA 3E49A 3UY8A 3G2GA 1U1UA 3W6YA 4NJJA 1DWHM 4A2SA 4GUHA 2YL5A 3PJXA 3FFSA 4MPQA 4S3KA 2OKOA 3DEQA 3M07A 3S1XA 4ZSTA 1F3WA 4MNLA 4O17A 2DZSA 4F3HA 3IJ8A 2KZHA 3BG9A 3AIWA 2O9RA 2EAWA 4GI8A 5G5IA 4QFUA 4Z1BA 1E6ZA 3L12A 1ZU8A 4RX0A 3IEBA 3MHGA 2J27A 3P5YA 5DO8A 1UC5A 1HX0A 3IGXA 5IDZA 2WANA 3W53A 3T08A 3SAZA 5BOOA 5FF4A 1IE7C 4L9ZA 3A47A 1DJZA 2Y2WA 1XKYA 1V7YA 3ARVA 3ISIX 4H8UA 4EXAA 2D2JA 2Y7DA 4UTLA 2W67A 3VIJA 5EMMA 5GJMA 2GDQA 3N3MA 3HPFA 4ZFMA 3KVLA 2DZXA 1LOQA 3B06A 4QXIA 3GU1A 5CPLA 1EP1A 2JKAA 4Z0SA 3N9KA 4RZ4A 1JCNA 4XSLA 2BOFX 3AHVA 3VCRA 1LT8A 1AW2A 3SADA 4BF5A 3ITXA 1OHLA 3GR7A 4Y6GA 4HPNA 4K38A 2HCVA 3KTCA 2VENA 1HO4A 1NWUA 3M5YA 5I06A 4JIEA 2FVMA 3LM3A 2O4QA 4QCEA 4EP8C 3HB9A 2F7FA 1UCWA 3U57A 4DJED 4GABA 2BY2A 3WBEA 1RVKA 3WH9A 3HV9A 4O1BA 1KXVA 4GFIA 5F4SA 2VHLA 1DE5A 3EOOA 3O0KA 4XSMA 1B57A 4JQ3A 4GZ7A 2I5GA 1ZY9A 1EWDA 4AF0A 2BVDA 1NFBA 4D71A 3N12A 2J24A 2MANA 1Y5WA 3OA5A 1IQ8A 2CCRA 2YZRA 3ZJ8A 3FXGA 3QY7A 1W91A 3MDWA 3IJIA 4L61A 4UNKA 2J47A 1RLDA 4GOAA 2HRWA 3TNOA 1KM5A 1B3OA 1TJRA 4AVOA 2C79A 3QLDA 1QU4A 5LNWA 1Y7VA 1KGWA 1ZBKA 5GNYA 5HMSA 2FPTA 4GIEA 2CBVA 2Y0FA 2ZKMX 1JQVA 2Z0IA 3ID7A 1M04A 3QOMA 4Q7NA 2NQZA 4D6HA 2P0OA 2PDJA 3WDRA 4W86A 2V63A 1E5NA 4TTUA 4S3BA 5JQ9A 3BMXA 2OWCA 3VM7A 3QZ6A 3BLKA 2Q02A 1L6SA 5E6ZA 2WLZA 3C0LA 1A4MA 2PLJA 3AQUA 1DE6A 1R0MA 3GZAA 1Q66A 2WV8A 3VAVA 4LANA 4AD0A 4DLFA 1J01A 3TKFA 1OF8A 3PULA 2FZBA 2GQAA 1PHQA 1R3RA 2QKFA 2Y1HA 3PAOA 3G6LA 1JAEA 1GQLA 3PY2A 5C5YA 5CG0A 3CAKA 4F66A 3Q45A 4AIBA 1MNSA 1X38A 1QO2A 4PUDA 2FJKA 2G50A 5FJPA 1ECQA 3W74A 1V6TA 8TIMA 4JTDA 3CAQA 3W01A 1IHIA 1PEZA 5CGQA 1UD3A 1E6SM 3VINA 4TVUA 4QLLA 4UQDA 1SM9A 5CJ5A 1DTUA 1E1CA 1QFEA 5HA7A 1RHCA 3WQEA 1UPMB 3A9IA 4AZCA 5DMLA 1DIOA 2ZUTA 1KLYA 5HDRA 2D24A 1J0KA 1RQBA 3K4WA 2D2GA 1KO0A 4PMOA 2QXWA 3GVQA 4CD6A 2CBIA 2AL2B 3W6MA 2HQAA 4NT0A 1KTNA 5LGZA 2WB5A 1TV7A 4JYEA 1NELA 1N82A 3VD7A 3DUGA 2XG9A 1R7OA 4HU4A 4ICCX 4W5UA 1KV8A 2IKJA 3LHTA 4HU3A 1AJZA 1JZ4A 4PTWA 4V27A 4UTUA 2A3EA 4Y8EA 4KH2A 4O1EA 2DIKA 1VFLA 4Q7IA 4MM1A 1W3IA 3V5OA 3BDKA 1CGYA 3CQJA 3T40A 4Q4QA 2RFGA 3SGZA 1KGUA 2EQDA 1XSKA 1FDYA 4JIRA 4GVFA 4F0LA 2Z6IA 5FSEC 4RNJA 1OX4B 2EPNA 3VKBA 3S6TA 4L4PA 9CGTA 1WX0A 1O7AA 4H2HA 1RCOB 2CWNA 4RL3A 2PF0A 3Q2DA 1C29A 4LAKA 3V3WA 1HO1A 4IQLA 3TSDA 4ZQCA 3CC1A 3W3OA 4Q4MA 4IQDA 5CGTA 1M6JA 2CNCA 4CNTA 3TSBA 3G1RA 3L5AA 2TAAA 4XO7A 4PGLA 4CD8A 4OZOA 1VLIA 1QBAA 2CIPA 3DFOA 2H90A 4HZ6A 3A12A 3GNNA 2VT0A 4UQAA 1EA0A 3S9ZA 3LZ5A 2Y7EA 1HKIA 3TJ4A 4BI6A 2FZMA 3H53A 3VZZA 1Z44A 1MUWA 3LEPA 3S83A 5LHEA 3C5QA 1KXQA 3WLNA 3WLJA 3B97A 1PV8A 2BBFA 2DV0A 1OB0A 5ABEA 2ACRA 5EMLA 1RVGA 3P2VA 3ZWTA 3LXAA 2RHGA 1PX8A 3KBJA 4QNWA 5DBUA 1LZOA