2WM1A

The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between nad synthesis and glycolysis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
332
structure length
332
Chain Sequence
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOXYLASE
publication title The Crystal Structure of Human Alpha-Amino-Beta-Carboxymuconate-Epsilon-Semialdehyde Decarboxylase in Complex with 1,3-Dihydroxyacetonephosphate Suggests a Regulatory Link between Nad Synthesis and Glycolysis
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 332
sequence length 332
ec nomenclature ec 4.1.1.45: Aminocarboxymuconate-semialdehyde decarboxylase.
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2wm1A00
1K6WA 4C6NA 2GOKA 3ITCA 2O4QA 3UBPC 3TN5A 3GTHA 1ADDA 3PNZA 5E5CA 3UPMA 4PBFA 2ADAA 4IG2B 4KEUA 1A5OC 3RN6A 4PBEA 4G7EA 3IJ6A 2Z26A 5HMFA 3K5XA 4NP7A 4WGXA 4H9MA 1R9XA 4GX9A 4C6BA 3F4DA 3GTXA 4D8LA 3IARA 1I0DA 2QVNA 3GUWA 4KEZA 4QTGA 3NURA 1J6PA 3HM7A 4BY3A 4ICMA 2DVUA 3ORWA 1A4LA 1EF2A 1KCXA 4C6QA 2Z4GA 1DPMA 2VC7A 4EPBC 4IFRA 4DO7A 1EJXC 3URBA 1NDVA 1XWYA 4R88A 4AC7C 3A3XA 3PBMA 1RA0A 4IFKA 4NI8A 4C6IA 4E3TA 1YRRA 4G7EB 2Z29A 3B40A 1UBPC 1KRBC 4DZHA 1FWFC 3A3WA 3RHGA 4GX8A 4UBPC 4XD3A 2QS8A 1O12A 4DI8A 1RK5A 4WHBA 3O0FA 4LCQA 1VFLA 3ICJA 4F0RA 3MSRA 4C6MA 4DLMA 2FTWA 2F6KA 4KERA 4MUPA 2BB0A 2ANUA 1NFGA 4M51A 5HMEA 2GZXA 4ERAA 1FWBC 3CAKA 3MVTA 3WYZA 4LCRA 3N2CA 2R1NA 2VUNA 1FWHC 2FVKA 4XAFA 2OGJA 4RDYA 4C6CA 3E0LA 4DYKA 1EZ2A 4GBDA 3MDUA 1FWAC 1A5KC 3OODA 3JZEA 1FWCC 3F4CA 1EJSC 3MPGA 1W1IE 4BJHA 1PTAA 1FWDC 2YZ5A 1EJTC 1V79A 4GOAA 4B90A 1ITUA 2BGNE 4UB9A 4GY7A 4C6FA 1IE7C 2HBXA 4J35A 2YB4A 4ZSTA 2WJFA 3IRSA 3OVGA 4P5UA 1UIPA 4INFA 4H9ZA 3SO7A 3QY6A 4EPKA 2GWNA 1EJWC 2A3LA 1YBQA 4LH8A 2YXOA 4HK5A 3IACA 4AQLA 4CNUA 3URNA 3AUOA 4HA0A 2AQOA 4CEUC 3F2CA 4LAKA 4WVXA 3QGAC 4RE0A 3NEHA 1FWEC 1RA5A 4QSFA 3EGJA 4HK6A 4KQNA 4C65A 2HBVA 2UBPC 2YB1A 1P6CA 4LFYA 1FWGC 2QPXA 4CNTA 3GG7A 4C5YA 1FWJC 4LALA 2E1WA 2EG8A 3UF9A 2FVMA 2EG7A 1XRTA 4DNMA 2XIOA 2PUZA 2Z27A 4L6DA 1EJRC 4CQBA 3UR5A 4HJWA 4B92A 3HTWA 4C6KA 2Q09A 4PCNA 1WXYA 2I5GA 3MDWA 2Q01A 4H9UA 1GKQA 2Z00A 3E2VA 1FKWA 1RJRA 4V1YA 1FWIC 5G4HC 4F0SA 4IGMA 4XAYA 2PGRA 2ZC1A 2DVXA 3S2MA 4R7WA 1K70A 1EYWA 4H9YA 4QS5A 1M68A 3B0XA 3EWCA 4H9XA 4L9XA 3LY0A 1J79A 1V7AA 2R1MA 4GY1A 3MTWA 2Z2BA 3C86A 2Z7GA 3OJGA 4GXWA 1EJVC 2VHLA 1PSCA 3MVIA 3CS2A 3LGGA 4DIAA 4C6DA 3T1GA 2PGFA 5AKQA 1RAKA 1ZZMA 3S2LA 2OQLA 1GKPA 4LAOA 1M65A 1YMYA 1NDWA 4C6LA 3URAA 3TN6A 4IH3A 4XAZA 3GRIA 2RAGA 3E38A 1ONWA 4KESA 3NQBA 4RDVA 4PE8A 3T8LA 4EPDC 2E25A 4IFKB 3RYSA 2W9MA 1WXZA 1E9ZB 2FFIA 2HNHA 2HQAA 3QY8A 3LA4A 2WM1A 2HPMA 4Z42C 4KETA 3D6NA 3T81A 4C60A 3GU1A 2P53A 2CZVA 3A4JA 3IV8A 1S3TC 1XGEA 2UZ9A 2Z2AA 4H9VA 1I0BA 3OOQA 4IG2A 3QY7A 3B0YA 4J2MA 3GTFA 4IFOA 3FDKA 4HK7A 3S2NA 1GKRA 3IGHX 3BE7A 1RJQA 2HPIA 1V51A 4KEVA 4B3ZA 4C6OA 4C6PA 1QW7A 2R1LA 3GIPA 3OU8A 3MJMA 4XD5A 3GIQA 1NDYA 2VC5A 3TN3A 4CNSA 4IQJA 4ERIA 2P50A 3PNUA 4GK8A 5LXXA 1FKXA 1J5SA 4KIRA 2R1KA 2D2GA 2D2HA 3LU2A 1P1MA 3S4TA 1M7JA 2G3FA 4RZBA 2OODA 4GYFA 5FSEC 4CQDA 1V77A 3PANA 1J6OA 2OB3A 4XD6A 4IF2A 3ISIX 3OQEA 1KRCC 1UIOA 1R9ZA 3DCPA 3S2JA 1ONXA 1UMLA 3LSCA 3IPWA 4G2DA 4IGNA 4ZSUA 4EPEC 3ID7A 2PLMA 4ERGA 1A5NC 4QS6A 1E9YB 4C6EA 4DZIA 2WJEA 2D2JA 3CJPA 4DI9A 3FDGA 1A5LC 2R1PA 3UR2A 2DVTA 2Y1HA 3HPAA 4CEXC 4YIWA 2AMXA 2I9UA 4H9TA 2OOFA 1A5MC 1POJA 4QROA 4TQTA 1YBQB 2PAJA 2KAUC 2IMRA 2GWGA 4H00A 4C6JA 3TNBA 4JOMA 4BKNA 1RJPA 3PAOA 3WMLA 1KRAC 4GY0A 3K4WA 2Z28A 2FTYA 1YNYA 3O7UA 1RK6A 1V4YA 3E0FA 3R0DA 4KF1A 5HMDA 1K1DA 3AU2A 2AQVA 2VM8A 4LCSA 3G77A 1PB0A 1YIXA 4R85A 3URQA 3K2GA 1ITQA 1QXLA 3KM8A 2GSEA 4V1XA 1HZYA 1P6BA 2Z25A 1R9YA 3DC8A 4I6KA 4LEFA 4PCPA 3LS9A 2VR2A 4XD4A 5A6TC 3LSBA 2WJDA 3LNPA 1O5RA 1PO9A 2Z24A 1POKA 3EWDA 3E3HA 4RDZA 3F2BA 3GU2A 1JGMA 4EP8C 3RCMA 3E74A 4CQCA 5FSDC 3GU9A 4J5NA 4NG3A 1BF6A 4GZ7A 3SFWA 2ICSA 3DUGA 4XAGA 2QT3A 3V7PA 2O4MA 1NDZA 3GTIA 2EG6A 5CH9A 4B91A 3FEQA 1EJUC 4RDWA 4C5ZA 4F0LA 3F2DA 1A4MA 3LGDA 4QRNA 3WZ0E 4LAMA 4LANA 3AU6A 4I6VA 4OFCA 3QGKC 4H01A 4GC3A 4DLFA 3MKVA 3TN4A 1XRFA 1KRMA
chains in the Genus database with same CATH superfamily
4Q4MA 1XYFA 1OFOA 2CBUA 4OU1A 4DF0A 4KGLA 5FKYA 1P0EA 5H91A 3ITCA 2DSVA 4M82A 3UBPC 3VZXA 5MKGB 5HULA 4R27A 3VOJA 4DZAA 3PUEA 3BXWA 3S8HA 4K8GA 1VBHA 5FEZA 2AAAA 4YXGA 4TVUA 5D09A 5C2CA 2QVNA 3VKKA 4YL2A 3VNYA 3EOEA 3VZZA 5AFDA 2I7GA 3VU2A 1XD0A 1W91A 5HNUA 5CBBA 4WKAA 4Z2HA 2PZNA 2Z4GA 1MZHA 2FGBA 3NZPA 5CZKA 2R91A 5IBXA 3W29A 1CENA 3WH5A 2HXTA 4Q4QA 1PKLA 5D02A 1RVKA 3W1AA 3LI0A 5EMYA 4YU1A 1G7VA 4AHQA 3CM4A 4HSNA 4R88A 4EE9A 3A3XA 5K9CA 4IFKA 4MWAD 4PRRA 2NWRA 4C6IA 2PD5A 1UBPC 1ZJIA 4DZHA 2FPVA 4J3TA 5A6BA 2X8RA 1MFUA 4RZ6A 4WHBA 3ICJA 1LQAA 4HYRA 4MUPA 4EAMA 1GOIA 3TWAA 5CPMA 1V5XA 4RXGA 4E4PA 1CLXA 3QC3A 2P88A 3GC2A 2GOUA 5BROA 5HOSA 1XIMA 1UG6A 2FLIA 4JIRA 4GUIA 1KV5A 3KBVA 2VGFA 3ENLA 5AHIA 3BPWA 4MUZA 1J01A 4TVDA 3WLTA 3CIWA 3AO0A 4O4VA 4G5DA 4H2HA 1IE7C 3C8NA 3DG7A 3MCMA 1YX1A 4D71A 1TPUA 1TTJA 3OTRA 3U6WA 5XIAA 3PPHA 3UJ2A 3G1DA 5BU9A 2X1IA 1C9DA 3LCLA 3LMZA 3B9EA 4GVIA 2XDFA 3BLDA 5FD0A 3APTA 1NEYA 2J7HA 3GZAA 3TQVA 2Y62A 2ZX5A 3VXGA 3AUOA 2DT2A 4HA3A 2W62A 1RLCL 3LTSA 3BH4A 3QXBA 1SSDA 2AAMA 1DIDA 4LUSB 2HEJA 1XXXA 4M7SA 4LQ1A 1FHDA 1GOWA 3M64A 2C0AA 1A5AA 4LFYA 1SFJA 1V3IA 1E70M 4GISA 4CN4A 2Y61A 4ZENA 3TP4A 3LLDA 3U0HA 5A1AA 3MSGA 2V69A 5A8OA 1Q45A 2ACRA 3SCOA 2J9XA 3VAVA 1UBSA 3L4VA 2Q09A 4OOZA 4HU8A 1XIEA 2OLAA 2VX6A 5G4HC 1NSJA 1XP3A 1EPVA 1VC4A 2WVTA 3WUGA 1S38A 1HP4A 3C56A 3NDZA 1WKYA 4HPJA 3EYPA 5BWAA 2QUVA 1V7AA 3CUXA 3LBMA 1AG1O 1J0KA 3HPFA 4XVDA 4BCEA 4C6DA 1KLYA 5A6BD 1Q65A 1ZZMA 1V02E 3CQ0A 4B9ZA 1WDPA 3VM5A 1VEMA 4GZIA 1KTNA 4ZXOA 4K1GA 3NXFA 4B3LA 4QLKA 4NZJA 2ACUA 3LA4A 1UKSA 1VIZA 1GYNA 3NJ3A 2YOCA 3P5ZA 4XISA 2P53A 4EVZA 4B5TA 1ADOA 7ENLA 1GPWA 1XX1A 1YE6A 4GVHA 1Z42A 4GQRA 4J2MA 4P2VA 3IGHX 1XW8A 5I6SA 3IJDA 1QRQA 1R85A 3AROA 1TPWA 3VYLA 1XFCA 3GIPA 3OU8A 1GT8A 2JBMA 1RCOB 1OHLA 1NP2A 3HIJA 4WQ6A 2QZRA 2P50A 3KRUA 2VO5A 4ADTA 5LXXA 3LU2A 2J88A 1JD9A 4IPNB 2QDGA 2ALRA 3CTTA 1RZMA 4FLRA 4ORMA 2DSWA 4MYAA 1J6OA 2NXIA 5CJNA 4H83A 2CBIA 3MO4A 4LVGA 3BAJA 3G1XA 4NAEA 3LSCA 3EPNA 5F2GA 1GWJA 2HISA 1TV7A 2PLJA 2ZOXA 3CB3A 4XIMA 2V2DA 1PAMA 3LQLA 1YQ2A 4O52A 4TR9A 2I16A 2BTMA 4EXQA 2OJPA 2V5JA 1H41A 4PMXA 7TAAA 4Q6JA 1S2WA 2E77A 1A5MC 3VIOA 2YJQA 3GC4A 2A7PA 3G2GA 3A12A 3ITGA 4Q8NA 3F4NA 1ONEA 4MB1A 3T44A 3BJFA 5I3FA 4DJDD 2VDGA 1U30A 3WLMA 1MDLA 1XH0A 1SMAA 4QXIA 2V8ZA 4Z2IA 1KM5A 1V4YA 1YPIA 1AW1A 2YDSA 3KWSA 4ZQPA 3KEHA 1SUXA 4HP5A 3GM8A 1S2VA 3XINA 5DRCA 3VUSA 4O1FA 2ACQA 3NL5A 2Z25A 4PODA 3VIGA 3U2OA 4GO9A 3CWOX 2X05A 3TFXA 3W84A 4NYYA 4O8AA 1FCUA 3GXFA 3P84A 4IIEA 4C1LA 1H49A 4DRSA 4XZHA 4Z1AA 2XSBA 3GQYA 3U57A 2XPKA 1S1PA 3VE7A 2OCZA 1MUWA 2XWDA 4F66A 4OBTA 1XLHA 3W7GA 1OYCA 4PMJA 1OFEA 3FV9A 4S3AA 2Z7KA 3P74A 4CQCA 3L5AA 2G3NA 4NG3A 3AXMA 3GO2A 3BOXA 4HIBA 4BQ3A 4IIDA 1WZMA 2ZE3A 3GKAA 4UMCA 3UEQA 1W32A 3UERA 3ITVA 2O4MA 3MS8A 2WSKA 4N9CA 3I4EA 4DJFA 4Z08A 4UCGA 5K3VA 5G2WA 5BOFA 1QNSA 3ZZ1A 3OG2A 8TIMA 1KGXA 3NQ2A 1SM9A 4AIOA 4MZYA 3IAQA 4DLFA 4N42A 1PKMA 3SUTA 3VFCA 5DBUA 1BGAA 2WB5A 3CLMA 2CHRA 4FOJA 4U3CA 3SQSA 2PTDA 1GGOA 2DU2A 2J6XA 3CEPA 4XK2A 1NP0A 3P6LA 4MADA 4KEUA 4I8DA 4MJMA 4KWSA 3TEVA 4V27A 1MI3A 4K37A 4O53A 2ZZ6A 4NP7A 4MNMA 3NEVA 1PXGA 3KWXA 5AB3A 1F3WA 1ZB5A 4AYSA 3AQUA 3N2BA 2HXUA 3ME3A 1H50A 4IZGA 3RUBL 2EPLX 1K4HA 2Y24A 1UPMB 3NURA 5DEZA 2XGBA 1VJIA 4DYEA 3ORWA 3F03K 1A4LA 3L0NA 2PP0A 3RGTA 2POZA 3E12A 3TSMA 1OABA 3AZTA 1BTMA 4LW7A 3GXIA 2PDQA 4DWSB 3S3GA 3CK5A 1ODZA 2DZPA 1YRRA 1F61A 2V3EA 4CLMA 1W17A 4WOZA 2ABAA 3TYEA 3T08A 3EMQA 4E3VA 3SUWA 5JQ9A 4LCQA 1H1ZA 3HV9A 2WMGA 1KM0A 1LRQA 3PJTA 2FZ8A 3MUXA 1N82A 3VTRA 3H23A 1XRVA 2VXNA 4BQ4A 2BLEA 4JIHA 3NDOA 1JQVA 3OW1A 4AXKA 4C1NA 1SO3A 4LYQA 3AALA 4B5WA 4UR9A 1V6YA 3CGTA 1V79A 5TNVA 1T8XA 2G4JA 3S1XA 4DAIA 2G3IA 1JPHA 1UD4A 1F2JA 3WF0A 5LNUA 4REQB 5FOOA 2H90A 1V0NA 3QM3A 4EPKA 2ZWZA 2GWNA 2DZWA 3FYYA 1JFHA 4N9EA 4AX7A 4DBSA 1KWGA 5FAJA 2VVNA 3RM8A 3W1NA 1EUNA 1KV8A 4E8GA 3EA1A 1SJAA 4CNUA 3EDKA 4WUIA 4GUFA 4HNNA 3ZT5A 2VR5A 1G4TA 4HHMA 4RE0A 4XBKA 1XV8A 4KW2A 1K7EA 2G4FA 2E4TA 1TV4A 3ANUA 1BEUA 4RV3A 6ALDA 1XBYA 4UNIA 6TIMA 2GJXB 4I7WA 2IUZA 4HJFA 4O19A 1K77A 3B4UA 3A4XA 5G1MA 3KS6A 3KW3A 2WHLA 2BBFA 3HTWA 4AZBA 3A23A 2Z00A 3CU2A 5F1VA 3WK2A 4MKSA 3WH7A 4UTWA 2EF9A 4R7WA 1RBAA 3WJSA 1X97A 2XSAA 4IP5A 4V2XA 3ZJ7A 4QJ4B 1XCFA 1B1YA 2CZEA 3OJGA 2VOTA 1PSCA 2DJLA 5LGZA 4NJIA 1WP6A 4JL2A 3TLLA 3C2FA 4JX4A 1YMYA 2E40A 4GLEA 2VX4A 4L5ZA 3VX1A 4NF7A 1HP5A 3CO8A 1ONWA 1X39A 1FOBA 2VWTA 3DKJA 5I79A 4PE8A 2QV4A 1BVZA 2HQAA 2PRLA 3AI0A 3BV7A 1WPCA 1XGEA 2ZXBA 3BSMA 3TYAA 3EWXA 1TV5A 4Z1DA 4DXXA 1V03A 3E02A 4GH1A 1WB0A 4DEFA 2GQ8A 2XZ9A 3AMGA 1TPEA 2WC3A 2PDWA 1LDCA 3MUZ1 3W2UA 2CLLA 4H2CA 3GC5A 1NDYA 1FP8A 4M81A 5CJMA 2PMQA 3GXPA 3IUHA 3U3HA 1XSKA 4CD8A 3LTYA 4GIEA 4GINA 2QMJA 4GHRA 3ZWTA 1G6CA 3OQEA 4AIBA 1QNQA 1R9ZA 3DCPA 4Y8FA 5AC8A 1ELSA 4ERGA 4D1JA 2DP3A 4PMNA 4UNLA 3LCFA 3R1ZA 1MQRA 1VJSA 2G3JA 2ZUTA 3WK1A 1IQ8A 4AFYA 3O63A 1UR2A 4H8HA 4WY0B 1YBQB 2NV9A 1XCXA 3CZGA 5DY2A 5IM51 4M3PA 3QFWA 1KRAC 3CV6A 4HNOA 3K4WA 3ATZA 2VDIA 3HOJA 5BCAA 6ENLA 3WX7A 4IQEA 2CESA 1K02A 3E49A 3ITYA 4O1AA 5CBJA 1CDGA 4HU3A 4J40A 4N9BA 1NFBA 1Y7VA 3VMOA 2E68A 4JFVA 3MCOA 2WJDA 3TTSA 3H12A 1JI1A 3AISA 1VENA 1MFVA 4DWDA 5F7UA 5FEWA 4JTFA 4EP8C 4IGSA 3FYPA 1E9LA 3O9NA 2O0TA 1WNOA 1ZBVA 1VJZA 3N6JA 4UTJA 3UNTA 1XQLA 3N1AA 5HUOA 1E56A 1F3TA 2QT3A 5H2ZA 3BWWA 3OBEA 1W9BM 2H3DA 1PYMA 5CH9A 3NPUA 3VD7A 4NU7A 3BLFA 3F2DA 1OIFA 1F4AA 1RLDA 4F79A 4OZOA 1MXDA 1DHKA 5D9MA 1I1WA 1CNVA 3I68A 2F38A 4B5SA 2BZNA 4Q8UA 5E1QA 3P81A 1K6WA 1TVNA 3F5KA 3KBNA 1UA7A 3W70A 2ZUVA 4PMQA 3GDLA 3UPMA 3MANA 3RK8A 5FF2A 3AYTA 1YLVA 2HZGA 3B3DA 3UZXA 1UOKA 2Z26A 5A94A 3K5XA 4XV0A 4H9MA 1EBGA 4EKJA 1E1CB 2V5BA 2Y70A 5DXXA 1GVYA 2EPOA 2HDJA 3S9YA 2WVSA 3WNPA 5I06A 1GOQA 2OQYA 1JPKA 4TTUA 4BY3A 1KB3A 3FVDA 3VD5A 3AS3A 3N2TA 5FIPA 2CXGA 1UH4A 1U1JA 5EMJA 1E72M 3UXDA 3PB2A 2XM2A 3OZYA 2QNEA 4BS0A 4GNJA 1O6IA 2NLYA 4X0VA 1DE5A 1KFKA 2QIIA 4W5UA 3RHGA 4WJEA 4GFIA 2ZVRA 3GG0A 1O12A 1C8QA 1QOQA 3WF2A 2HVOA 1YKWA 2X7WA 1NFGA 3A22A 3GHSA 2J74A 4DBWA 1FRBA 2GVYA 5HWJA 2XJ7A 3WYZA 1EIXA 4DWSC 4V33A 4BI6A 3SJNA 4GYJA 4MFDA 5EMKA 1ZAHA 3RRXA 1JIBA 1ZUAX 3STPA 1FWAC 4M5PA 4YTRA 2WHJA 1VRDA 4ZQNA 3S9IA 4PUDA 3TSDA 4HZMA 5JBFA 1QTWA 4UB9A 3L0KA 1BVNP 2XVKA 3W23A 3BL3A 4UTTC 3CPRA 3MCNA 3N9KA 1XIFA 3MZ2A 1W9XA 4P7QA 4MPKA 1OGGA 3DECA 5HAOA 3ARPA 5D03A 1BTCA 4I9MA 4LGXA 4L9YA 2QJGA 3NQ7A 1J10A 4YTSA 3CV7A 4PUEA 3DFNA 4TMBA 4FXFA 3FY1A 4GUHA 2HCVA 4HHPA 3TVAA 5HPOA 3TIMA 5EFFA 3TK7A 3PP7A 2BHYA 3RNDA 4C7FA 3S1VA 2XVPA 2Y4SA 3WQPA 4JKKA 1XLLA 5KZ6A 3W7DA 3N12A 3WD1A 1UYQA 5T9BG 2O7QA 3LXCA 4PGLA 6XIAA 1NWRA 4IWWA 4PCNA 5LA2A 2X1RA 1T7LA 4A6GA 1AW5A 2W5FA 1Q6CA 4CNNA 1KFWA 2Z1VA 1Z44A 4GVGA 3SRHA 2VL4A 4CQAA 3K8LA 1PZ3A 5GVJA 1AMYA 2PGRA 5J04A 3AZRA 1M01A 5ABHA 3LMYA 1EYWA 3Q67A 4Q8WA 5C9WA 1ME7A 4LUTA 4O15A 4JQ1A 3T8QA 2WMKA 1QPRA 5AY7A 2QCDA 3WLNA 3B8SA 4JZ5A 3PUDA 1XYZA 3THAA 4AHOA 3ANVA 1DJHA 1ADSA 5FF4A 1E6RA 1E6SM 2VOMA 2J9ZA 5CSRA 1EF3A 4O16A 3TZNA 4B16A 3N6QA 1SZEA 1N8WA 3WLKX 4O4WA 1ISWA 1T40A 5TBOA 2ATSA 1RD5A 3A4AA 1QCWA 1A3HA 1XLIA 2RHGA 3W83A 1SU5A 1SZFA 5A6KA 4KETA 2CZVA 4OIFA 1GVFA 3IV8A 5AHNA 4OECA 3SAZA 2RJHA 5I7GA 1X1NA 3CV2A 4PUUA 2F9RA 2BV9A 3HQ1A 4XO7A 2PLCA 3QTPA 1OX4A 3TV8A 3W00A 1HO1A 4AVFA 1Q4NX 3IIPA 4FLOA 2BG5A 1TWWA 1PX4A 1HJVA 1KCLA 1RH9A 4MGGA 4QSHA 3H2OA 1JVNA 4JTCA 4MPQA 5C7VA 2AL2A 3TA9A 4O54A 1UWUA 3VGEA 2WJEA 2QV5A 4YYCA 3SDOA 3O8AA 1E6NA 1GEQA 4I5UA 3CQHA 4AG0A 5C9ZA 1FCQA 4CKQA 3GDMA 2YL5A 2WBGA 5HUPA 1ODUA 3B8WA 4AMCA 1ICQA 4M1RA 3NZ1A 1B3VA 2R9RA 4I8YA 2QXWA 2XIJA 3QLDA 3FA3A 2GL5A 1F3XA 1XLFA 4AZ6A 1P0BA 4HVXA 1GVRA 4PMYA 2QUNA 2XFYA 1PWLA 4D6EA 5AVNA 3VX0A 1P6BA 3U2CA 4J3ZA 4O10A 3SN4A 4Q4RA 1SFLA 3VCNA 1LWHA 1QW9A 3RCYA 4FR6A 1JZ4A 4HKPA 3FA4A 3V75A 3BSHA 4UTFA 4G1KA 1XPGA 1JPDX 1S1RA 2F7FA 5J5RA 3ALGA 3H53A 3ECQA 4JGDA 2GVJA 3NPVA 2P10A 3UY8A 4YJ5A 4G56A 5I23A 3TCSA 4HHHA 2ZZ3A 3EPOA 4UCFA 4IUGA 3UCDA 1QPNA 5D2XA 2V30A 1UWRA 4XZMX 3AZSA 1UR8A 1BWLA 5CAKA 3G8EA 2IQ0A 4GG9A 4AHPA 4MWAC 1CGXA 4B5NA 3IJLA 1TE6A 4YYFA 5AC6A 2EQDA 3PULA 1H51A 3P80A 4G9PA 2IKGA 4UUIA 1HKMA 4LY8A 5G1TA 3M44A 3O07A 2OU4A 5HMFA 4OUIA 4K3ZA 4GO8A 2CLIA 2INFA 3EA2A 5A8GA 4QJ5B 2MANA 3STGA 4JKLA 4Q8TA 2YCJA 5FJPA 1ECEA 1PYFA 2FQIA 1HX0A 2ZUNA 2NT1A 3MHGA 2CWXA 2EPNA 4BF9A 5IHSA 4DJEA 3DHDA 3GB6A 1IT7A 4U10A 2EXOA 3TTEA 4AWSA 4IFRA 1RALA 3SY1A 2DY3A 1LUCA 1A5CA 3OGVA 6REQA 3GXTA 2Q02A 3T55A 4CD5A 1LYXA 2QJMA 1PX3A 3PFRA 4AC7C 1RA0A 5HR6A 2PD9A 5BYWA 4E6MA 3WQFA 3R7MA 4GX8A 1QATA 1RK5A 1DE6A 2X16A 3MSRA 1H62A 4PMOA 2F6KA 2BB0A 1PZ2A 2D2OA 2XFFA 3S5ZA 4QM1A 5HMEA 2OOGA 2E8ZA 1B31A 5DT5A 1KA9F 2CZ5A 2OWCA 2QAFA 2TYSA 5LGXA 4QEHA 3UA3A 2QUMA 4JN8A 4W89A 4AAJA 1J2BA 2BX7A 3E0LA 4IISA 4UQBA 5E9XA 1A50A 1A5KC 1QI2A 1MMFA 1PIFA 1EP1A 3SIZA 1FWCC 1VLWA 3GNOA 3HG2A 5FA5A 1W1IE 4F9JA 2C15A 3DH7A 3ES7A 1PTAA 1FH8A 4KH2A 2BXVA 5D33A 2BGNE 1F6KA 1XLJA 4NAFA 2H9AA 4IGHA 4IXXA 1G94A 3AXXA 3NOYA 4QNEA 3UZJA 1HJQA 2BNJA 4PFHA 1GONA 3WF1A 3INPA 3SO7A 2POTA 5IBXC 1HN1A 2GJLA 5BXRA 1LTDA 2A3LA 5A8NA 4CVWA 3VGGA 1GQNA 3RXZA 3TQKA 2J27A 1EXPA 3RJYA 4C1NB 3QGAC 1P5BA 2IKHA 4OWGA 3G22A 3A24A 5TF0A 4AEEA 1IWBA 8CGTA 2FVLA 4GWEA 3BQ6A 1IEWA 3HG3A 2EG8A 2EG7A 1XRTA 1IEXA 3O16A 2XIOA 5KITA 2ASHA 4RW5A 1R3QA 2Q01A 2E5CA 3BW4A 3TSBA 1PJ9A 3EWWA 4GYPC 2V67A 2RFGA 4DJED 1Q6LA 4YTTA 1CCWB 1YHTA 2JIWA 3ZLHA 2PBGA 1KM3A 4DAFA 4U2ZA 1FHUA 4WDWA 9CGTA 1JNDA 4GY1A 4ES4A 4UQDA 3ARWA 4K2SA 4GA8A 1HTIA 3MVIA 2YGYA 3LGGA 5KMYA 1KBKA 2ZZ2A 1W5PA 4OKDA 4ORIA 2DW7A 4XIAA 1B5TA 3GFXA 3Q58A 3PTDA 4O11A 4RZ4A 3T8LA 4EPDC 5LA1A 3EX4A 3MZNA 2WM1A 3D6NA 1E73M 1U33A 1YDOA 5CC3A 4A4AA 2ZA3A 3VGDA 3VOHA 5TQLA 1DTNA 3GTFA 3HPXA 4DJDC 2PURA 2DUAA 2EHHA 1JEZA 4A8RA 4AZCB 3EOOA 1V0LA 1KW1A 4NI3A 2Q8XA 3MJMA 4W8AA 3RO8A 3C2OA 5G2IA 3UVAA 1XG4A 4F8XA 1FKXA 1KO0A 3W85A 1C7TA 2RGLA 4I90A 3W76A 2OODA 3FN9A 4NZFA 2ZDSA 5D30A 3KRSA 4GGHA 4O1DA 4Q3MA 5H8UA 3EAUA 3NR0A 1E40A 1JCJA 3CUHA 2IXVA 5H8MA 3PZIA 4F2TA 1R3TA 5I77A 2NSOA 1U1UA 1ZTVA 3DKLA 1QNPA 4NX0A 4HNLA 3ZLFA 1OK6A 1NF0A 2PLKA 4D1IA 2VFEA 2OOFA 5F2IA 1OC7A 4TQTA 3WNLA 2BGSA 3L9CA 2HJPA 4TVCA 3PZQA 5I00A 5LSMA 1OVDA 1O60A 5DLCA 5EMLA 4IL0A 3OYZA 2Z1BA 1XKJA 1A0EA 3W1LA 3MT1A 4NJHA 4WOQA 4QG6A 2QPSA 3NXLA 3W02A 2Z6JA 3AU2A 1MZRA 4YCOA 1U22A 4LCSA 4UWMA 4Y90A 3H2MA 1Y8BA 3H4GA 1VB9A 1EC7A 2LLEA 3DC8A 1L8NA 1HL8A 5BRBA 3W7KA 4FK9A 4ZQMA 2PS2A 2VURA 3Q37A 5BW6A 2JGQA 2VC9A 3EWZA 3RLVA 3OYXA 4JNMA 3F2BA 5E09A 3IS4A 1CXIA 3PFMA 1FVPA 3ZQ9A 5BMWA 2ZRZA 4U33A 1KM1A 1DP0A 2D1ZA 4HZ6A 1A4MA 1U2YA 4QRNA 3WZ0E 2B0MA 1E0TA 3AU6A 3FEMA 4MJ4A 1UD5A 3GIYA 4JL1A 1AL7A 5J8LA 1IEIA 1Q6EA 4US6A 2GFTA 4XZIA 1KD0A 4I3GA 1DOSA 2OFJA 1BXNA 3E1F1 1H60A 3N2OA 3MMTA 1P0KA 4BEUA 4HOZA 3OHMB 4XBSA 1XR2A 3UPBA 1FWNA 2CNCA 3BLOA 3E6EA 1D3CA 4LC8A 1QPKA 4WGXA 3T4WA 2NQ5A 5TD4A 1G4SA 1JJKA 3F4DA 3RLUA 4OGZA 3LUTA 1VFFA 3GNPA 3UWWA 4CN6A 3AOFA 3AS0A 3UXIA 2VX7A 4S2BA 3W22A 3RDKA 2ZX8A 3GNRA 3BK0A 4CGTA 4EIVA 4XKMA 5HWNA 5CCZA 1ZBCA 5KTLA 1B2YA 1XYBA 3S9ZA 4JFSA 1H0IA 4EXAA 3EXRA 3UJFA 5D9NA 3VM7A 1EBHA 3W7LA 1UROA 3A3WA 1W56A 2OR2A 2CWNA 3VNJA 3VD4A 2FTWA 4EOUA 2DZXA 2FHFA 3N6HA 4JX5A 1XSJA 1DQUA 4U31A 3S1GA 2JIEA 2P8CA 4FIQA 3LRKA 5M2FX 3DDMA 1C90A 1YTKA 3PJUA 1EP3A 4HN8A 2FVKA 5C2GA 4FOUA 1HKKA 4L4LA 1QPQA 5GJNA 1E6ZA 5D05A 4RDYA 2XVNA 1J0JA 3PBGA 4D6IA 1EQCA 3FSUA 1RCQA 3W81A 2PWVA 1EDGA 2OX4A 1A49A 5DMYA 1UUOA 1FWDC 3M0IA 2Y6ZA 3WDRA 1XLBA 4LVFA 5B80A 2VWSA 1W3IA 4AY7A 2D69A 4ZSTA 1UIPA 3RILA 4D6CA 3PTQA 3R13A 3QY6A 4AWTA 1OZMA 4KPLA 2C0HA 4JTLA 3NQCA 2PDKA 3WJXA 1U5HA 5EYWA 2GDQA 1LOSA 1RA5A 4FP1A 1X1ZA 4LT9A 2OZ3A 4KIEA 1HT6A 3WLQA 3AMDA 1TJ0A 1FWJC 1UC4A 2OSYA 4QQ3A 3S6TA 4LWWA 4W87A 1V0KA 3A6OA 3GHRA 2D3NA 2AGKA 2XFWA 2R24A 2OEMA 3FJ4A 3TC7A 4JDYA 1ZGDA 2G41A 1J2WA 3QN3A 4NIRA 1ZQ5A 2E09A 5DCEA 4GI8A 3CHDA 1EC8A 3MP4A 1K70A 2B7OA 4OJYA 3UZ5A 4A3YA 1UMYA 3HGRA 1LORA 2ZX7A 1PE1A 4UNKA 1DIOA 2ZZ1A 3I4KA 3CZEA 4QEEA 1H1NA 4PA8A 3T1GA 4NZ3A 2PGFA 1VF8A 3CC1A 4LAOA 1T0OA 1W1PA 1O66A 3URAA 1V6WA 1VYSX 4ZB2A 2OEKA 3GRIA 1HO4A 3OP2A 2F84A 4KESA 1C8VA 4F3HA 3BMXA 4QP0A 2IKJA 4H6EA 4PSPA 3DFHA 5CLTA 2YA0A 4Y7EA 2VD8A 5AC5A 3N2MA 2O9OA 1DWJM 3TNOA 3KL5A 3UQNA 1RBOB 3SB0A 3WENA 1TMQA 3USBA 1GW1A 5MKGA 4RCXA 3AMKA 3QPYA 3SCPA 2YYUA 3FHQA 2QCDB 2YZRA 1MW2A 3RR4A 3OGSA 1UQYA 3OZOA 2VEMA 7XIMA 1IZJA 2I17A 1MQPA 1W3HA 3AMLA 4RPPA 2ISFA 3PWAA 2NQZA 3PUGA 3HQOA 4QDMA 4ATDA 4GK8A 1CGVA 2YA2A 1U1HA 1JR1A 4H8NA 5AYBA 3VGFA 2DIJA 2D2GA 1AK5A 3GNDA 3ZT7A 1M7JA 1US2A 3SN1A 4UTWC 1K6AA 4GYFA 1P0NA 3DYOA 2PDIA 1DHPA 2FGLA 4WXZA 2CPUA 1XINA 1TTPA 3TAKA 2VFFA 2EO7A 3SCRA 4JIQA 3B97A 5BU6A 4G2DA 3W1PA 4R34A 1B4EA 2FZDA 3W2JA 5HJLA 5HR7A 1TPC1 1YTDA 4L7ZA 3FDGA 3W1UA 1R3WA 5IXEA 1E4MM 1K9TA 2HNEA 1AVAA 2PTYA 5HINA 5T9CE 3UG4A 1PZ0A 2KAUC 3NQMA 5J5DA 2J77A 3BW3A 3F5JA 2NQLA 3N4AA 4FHAA 6XIMA 1NFPA 3R89A 1MDRA 3QKEA 1ZSXA 4MNLA 4XX6A 2PDJA 3TONA 3GR8A 2VKZG 2DUXA 4IX2A 4WIWA 3M0KA 2AL2B 1R46A 4OOUA 3T07A 5CSYA 3MJYA 3N14A 1NOUA 4ZO8A 4LEFA 3GR7A 2ZFAA 4WK9A 4KKXA 4MNKA 3ZJ8A 1OFBA 1XLEA 3DHUA 4DY1A 3XISA 1O5RA 2GPTA 3M5ZA 1MO0A 4RDZA 4QIUA 4K39A 2UY2A 1O4UA 2RDWA 4LRSA 2NQJA 2PI6A 5HANA 1XBVA 2FFCA 1D8CA 3ARZA 4ZO7A 1PVNA 2J62A 4NXSA 3FXYA 1NDZA 3V0UA 3WDPP 4YCPA 2WBKA 1Q6FA 4A05A 4FA3A 3CZJA 4PTMA 2WLYA 2ATMA 3M0LA 3OEXA 1QDSA 4BZYA 1VBJA 2OSWA 4TOQA 5A8MA 1UR0A 4AY1A 4H8UA 3V36A 4AISA 1M5WA 2EPKX 1H7WA 3IGXA 1GQIA 1H09A 1YYAA 4LVDA 2GSHA 3MKVA 3NQFA 4GCAA 3E2QA 4JTEA 1FWRA 4L4MA 7ODCA 3TN5A 4LBSA 1X38A 4UFHA 5E5CA 1KBBA 2H8ZA 1VGAA 2PDNA 4ZOAA 1X8FA 3DGBA 3IJ6A 4M0XA 2OSXA 1S2UA 4E2VA 4GPNA 1DEDA 1TWZA 2CXEA 3MB9A 5M17A 1TJRA 3B06A 1AMKA 4ACYA 3OB8A 4LF2A 2Z1SA 3HM7A 3QMTA 2Z1XA 4BEQA 3LHTA 1KM6A 1T41A 3BG9A 2YSWA 1L9WA 1QBBA 4XSMA 3URBA 3LYEA 3LZ3A 3O0KA 2Q3RA 1F6PA 1OC6A 2O55A 4MZ1A 2WXDM 4JAWA 1W3NA 2PP3A 3CL6A 2VI0A 3LOTA 4IMAA 1JXKA 2BHUA 2WCGA 3TXVA 2WJZA 1FQ0A 3H4WA 2QS8A 2DV0A 4YTQA 1IEVA 1JZ2A 2DZUA 4O0QA 1SFSA 4F0RA 4H8VA 1DIKA 1JDDA 4AWEA 3TC6A 4Y9NA 3LCHA 2Z1WA 3D3AA 3CAKA 4DYJA 3QW3A 2R1NA 3MU7A 3C0LA 1TVLA 1LUCB 1UOZA 1IT0A 4H19A 4C6CA 3K8MA 4DYKA 3BICA 4GBDA 2XFRA 4GD0A 4WKFA 4OV9A 3BQ5A 3UJRA 5CC6A 1TE1A 1IF2A 1TPH1 3PZTA 1FXPA 4CU6A 3GDTA 3UG5A 3SR7A 1M04A 2ZX6A 5LIXX 9XIAA 4H41A 3VNLA 3C0SA 4XAPA 1AZ2A 3W2MA 4HGXA 3S6OA 3OZPA 3KTSA 1XCWA 1Q13A 4GC4A 3IIZA 2AQOA 3OLGA 2B7NA 2X1TA 1NWSA 4ROPA 5K4XA 2P76A 3WUEA 3TJXA 1LT7A 2PTWA 1FUYA 4DVOA 3FIGA 2A3CA 2PTXA 2PWEA 2RDTA 3WJWA 2QPXA 2J7FA 2H9AB 1OINA 2J6VA 1A0CA 1XISA 4AMAA 5E0KA 4GI4A 3UF9A 1EOMA 3LHVA 3PBVA 1XDJA 4P8XA 4PH6A 1H7RA 3SQLA 2DSZA 3MO7A 1SO5A 2GQ9A 3B8TA 3BANA 4GFSA 3IV3A 3IGUA 2XN0A 4ML9A 4JY8A 4WLCA 2ZC1A 4IJRA 4AZ7A 3VDAA 2YCIX 2FB2A 3C4UA 4LBUA 3H54A 1QHOA 3LN3A 1MEHA 4Q4OA 1VLIA 4GXWA 1RPXA 3MI2A 1EJVC 3W01A 1BSIA 4GNVA 4EWJA 3H7UA 3CHVA 1GKPA 2EKGA 3KRZA 2PWUA 3NOEA 3DERA 2AMGA 4X22A 3T0BA 1VAHA 3WO8A 4RDVA 1QO2A 5E0CA 5D9OA 3W1XA 4WR3A 4XO6A 1CZ1A 4I5XA 1VQTA 4W86A 2DZBA 1I0BA 3EDJA 1OD8A 3VD9A 4FX6M 5FL1A 2WZIA 2NXGA 1E51A 1JZ5A 1MUMA 2VCBA 2C18A 1ESWA 4MHBA 1A5SA 1QW7A 1UR3M 1L6GA 3GIQA 3WH6A 4IQJA 1W5QA 1I1XA 4S3EA 2R1KA 3PC0A 3QV7A 1SMDA 3ZS4A 5FSEC 4PULA 2OZ0A 2PSNA 1V77A 2EKCA 4B9YA 4KBXA 2DZSA 5M03A 2BY2A 3IVUA 3PSVA 3W53A 3S2JA 4ZE5A 3ID7A 3B0UX 1PTGA 4JQ4A 4QS6A 1OADA 2CEQA 2W91A 4C6EA 4UZUA 2ZE0A 1S5TA 3GAYA 3NFUA 1GNXA 2Y0FA 4MY9A 4IMDA 1QVBA 2QQ6A 3IGSA 4GMEA 3HPAA 4TV5A 4H4IA 4GI9A 4CEXC 1ITXA 1KXTA 4A3QA 2XH2A 3WJYA 1Q4WA 2FJUB 4LRTA 4JTQA 1B3YA 4LVAA 2WCSA 3DI0A 2OLSA 4LYKA 3NVTA 3RG6A 2C71A 5D2VA 3WDHA 3FNDA 1Y5XA 3BZGA 1VFOA 1RK6A 3O6YX 5G5IA 4MAVA 3W1RA 1K1DA 1D3HA 4HPXA 3PPCA 4POCA 1W8SA 1VFTA 1AW2A 2ZRUA 2GGGA 4O1BA 1J93A 2A5HA 2GSEA 3RPMA 1BQCA 4PCPA 2VR2A 2YW4A 4B2DD 1F73A 5CGTA 3ZO9A 5T91A 1Z9AA 4RPQA 4K8HA 4REQA 5GNXA 1HJUA 1PO9A 1FCBA 1UZHA 3VUPA 3WQ4A 3GU2A 2FMOA 2YPIA 4ZXLA 1W0MA 3G8RA 2FDMA 3WNMA 3K4AA 4HMEA 4E0CA 2WPBA 5BOEA 3MUIA 8RUCA 2F8QA 3W2NA 3MKKA 4XTDA 3P60A 1HL9A 5DBTA 3NPWA 1Q6DA 3EX1A 4GC3A 4HA1A 1UR9A 1UKTA 3QMRA 4JN7A 2DZTA 3V18A 1DXFA 1W9VA 1W1ZA 5RUBA 3WQ8A 1AUSL 2GOKA 2YLLA 5JMUA 1OY0A 1O95A 5HDRA 3S2CA 2NV2A 2YKKA 5LNVA 3V5CA 2WSPA 4AIEA 1PCWA 1MUCA 4B15A 2ON3A 2BY1A 2JF7A 4WKHA 1CGWA 1F76A 2IW0A 2GUYA 4FPSA 4N4PA 2CKRA 3P82A 4WXYA 4CCDA 1NJJA 1J6PA 2OPJA 3L7RA 4HN4A 3RRAA 1X7FA 1TPFA 2J8TA 2PP1A 1B54A 3CUJA 4RR4A 3E9AA 4Q6XA 2DH2A 3AIEA 4GQ0A 3REQB 2OZTA 4ONVA 3KBWA 3BAIA 1R3RA 4E2OA 4NXKA 3CWHA 2DFAA 1B9BA 1Y5VA 3N3MA 3ZJKA 4A35A 4JNZA 3LGEA 4HCDA 1L2QA 2HV5A 3A9IA 4XZLX 4D72A 4GKLA 4L61A 4ZTYA 1FWBC 2PDYA 1FDJA 1ISXA 1HFBA 2YLAA 5IHRA 2DIEA 1FWHC 1ZJBA 3DEQA 1UA3A 4XAFA 3U4AA 2HTMA 4MM1A 3QPEA 2YDQA 5AHFA 3MDUA 4S3KA 1GOMA 5K4ZA 3HG5A 3ZT6A 3FX4A 3CZ8A 1QFEA 4PCTA 4J28A 5CZJA 4C6FA 4DJEC 2J9YA 1GORA 3LBOA 1F6YA 1ZJAA 1JZ8A 4J35A 1IGSA 3TWBA 3A47A 3ONCA 4H9ZA 4FSAA 1KC7A 3NQ6A 4WD0A 2FH6A 3DGRA 3QV9A 4WY0A 1YBQA 4XSLA 3ZFHA 2VT0A 1X8CA 2CIPA 2QVHA 4AQLA 4OUEA 1KXHA 4HCLA 1H11A 1DWGM 1VPXA 3NEHA 3V1HA 3LQGA 1OYAA 3IK4A 1OZQA 4DB7A 2NX1A 3TYBA 1JCYA 1KCKA 3W7PA 4NILA 2P0IA 3G24A 5JVLA 4C90A 4CNTA 1IHIA 4LALA 4IM4A 5A8QA 1T8QA 4H1ZA 4JIIX 2WW5A 3IJ7A 3D5HA 3R94A 3N04A 4AZ5A 2A3HA 5FJUA 3PZUA 1WXYA 2I5GA 4H9UA 3PWGA 3R8HA 1FWWA 4V1YA 3STEA 1O94A 2FYMA 3E5PA 3P3BA 2BVYA 3MP5A 2E6FA 3LPPA 4HB7A 5HJYA 1W1A1 3C52A 4ZEPA 3N2XA 1Z41A 2R1MA 1EHNA 3K8KA 4J9JA 3L12A 1TIMA 4TO8A 1CXEA 2G3MA 3VIJA 1XBZA 1J9YA 5L6UA 4E4FA 1MSSA 4FNTA 2IQDA 1FXQA 4BI7A 3WBYA 1DJGA 1CGTA 4DPQA 2W92A 3BLIA 2PDFA 1UD6A 3E38A 3HQNA 3K4DA 1TUXA 1WKDA 4FLSA 3JS3A 3R4IA 1KGWA 1VEPA 2DT3A 1L6FA 3PPGA 1G4PA 2IPFA 3C6CA 3M43A 4HK7A 3ZM8A 4KEVA 1MQQA 2V3FA 1BLIA 4R7JA 1S2AA 1DQWA 1YXCA 5HWMA 4CNSA 4L56A 4DO5A 4GQBA 4S3CA 3TJIA 3CHEA 2D2HA 3W88A 1GUVA 3QJAA 3NL3A 4AH7A 3MMDA 2UY4A 3W9ZA 4RNHA 1NOFA 3LCXA 1KRCC 3MKCA 3W1MA 2W79A 3WEMA 1ONXA 2EEXA 3S46A 2OYKA 3RPTA 4NKCA 4H6RA 3VKCA 2R82A 3U48A 3CJPA 2QJIA 4W8BA 3UXKA 3DENA 3UR2A 4FEZA 2OO0A 2I9UA 4AIUA 3E2SA 1BD0A 2INZA 3TW7A 1F9CA 1W5MA 3E2RA 4EANA 3I7RA 3AHTA 3S0CA 1HGWA 1JZ6A 4GGBA 5IFTA 4F48A 2RDXA 3G1FA 2NX9A 3STFA 3G1RA 4W4QA 3AHZA 4Y9PA 3WD3A 3AXHA 3W1TA 3HQPA 3FK4A 4F2BA 6A3HA 4LX4A 5HQEA 3O2LA 1ZU8A 3GNNA 3WQEA 4KFNA 2HK0A 1JNEA 1HJWA 1OD0A 3EMZA 2QCMA 3RFAA 2QEZA 2OYLA 5AHEA 1TPDA 4IIGA 2XINA 4ACZA 1R9YA 4I6KA 1FTXA 1TIWA 2B81A 4FIRA 4HPGA 1JAEA 3WLLA 4MJZA 2YCKX 2E67A 3L4TA 3LSBA 4WSJA 4XWUA 1KQZA 1LRTA 3PBYA 3FSTA 4Y96A 2C19A 5CLWA 4MDPA 4Q7IA 3RCMA 1JD7A 3PBUA 3HG4A 5AVHA 2ICSA 1EB3A 4DUXA 3IIOA 1QOXA 3SY5A 3QZ6A 1A3XA 1CECA 1LWIA 5D38A 2EG6A 2ZIDA 1XIGA 1N7KA 1PHQA 1QI4A 3PWIA 3KHDA 1OSEA 4I6VA 4NNCA 4OFCA 3TH6A 4MF4A 2Y8UA 3ARSA 4RNIA 2BMBA 5C6MA 4RE4A 4ZMGA 4ZL1A 2PU1A 3ALFA 4JQ3A 3NA8A 2PCEA 4AZGA 5A69A 3TROA 1R86A 3DBPA 3AICA 3SCWA 1K9FA 4C6NA 4ICNA 1WUFA 3ZSTA 1TZ7A 1QNOA 3PNZA 1KXVA 3B9DA 2YBUA 3E0WA 4JR5A 3LPGA 3AIBA 1WXJA 3NAVA 4H6KA 3EX2A 3WMCA 2VQTA 3BJTA 1R9XA 4A22A 1EDQA 1RXOB 4AY8A 3EDFA 3NZQA 3VIKA 4TMCA 1LBFA 4B3KA 1S5WA 1JDCA 1W5NA 3CTLA 1EXBA 1XIBA 3ELFA 4AEOA 4ICMA 1XICA 2HS8A 3GTNA 1V6XA 3LLFA 2FDSA 3WQDA 1TJ1A 4PL1A 3E96A 1LP6A 1C29A 2P3ZA 4OTKA 2GGHA 2J4GA 5CPSA 3VOIA 3CV1A 1JCTA 1RQBA 1VKFA 2VYOA 4O1CA 5I09A 1H7OA 3EEZA 1HKVA 4CCEA 2X30A 1DTUA 1OCBA 4XVEA 3NL2A 3KOYA 2HE5A 3GW0A 5EKYA 4QX4A 1K8CA 4KCWA 3H2FA 3M07A 1SR0A 4DF1A 4FI4A 4O50A 3MVTA 3TYUA 3F5LA 4MJ2A 2BWGA 9RUBA 1O1HA 1K7FA 4PUNA 3HFYA 2WVVA 1Y65A 1TA3B 4NNBA 3OVRA 4YVVA 4S39A 1SW3A 3SRDA 4IJCA 3DN5A 4UQAA 4DBEA 4IMEA 2V5CA 5DMNA 2CLEA 2E6DA 4JTKA 5DO8A 4RL3A 4GOAA 1ZFJA 3R58A 4XBJA 3DYMA 3DBNA 1KQYA 3LX9A 3F4VA 1J8VA 3UP8A 2WHKA 1WDRA 1LQ2A 4M1BA 1WAUA 5H6HA 2A0NA 2DW6A 4HOWA 1Q7MA 4DUOA 3UZWA 1ZP3A 4Q4KA 5A5WA 5CGMA 3T40A 1S3HA 3QTGA 4GIRA 1B9ZA 5IFPA 3H55A 1W5OA 3SURA 3TYCA 7A3HA 3ZVHA 1V0MA 2A7RA 4NY2A 3OLIA 1QHPA 2G0WA 1EP2A 1ZCCA 4QQUA 1QBAA 2V82A 2A3AA 2GQ3A 4CQBA 4B5VA 3E0IA 4B92A 2NZLA 3QYQA 4N4QA 2OGYA 3W38A 2QGYA 3BUVA 2X0SA 5A2CA 2XM1A 4ILSA 4DO6A 5A8PA 1E4LA 4P7OA 4B5UA 3R10A 2VQUA 2A3EA 4L1XA 4AF0A 4IPIA 3VE9A 4K68A 4L9XA 3KVMA 2VZTA 2Z2BA 4ZODA 2PF0A 3VNKA 2CBJA 2WMIB 3NPXA 3I3EA 1JYXA 4PMDA 4JN6A 4WZHA 3WFZA 2ZQ0A 2QF7A 1N2VA 1AD1A 1EDTA 4AB4A 5HNRA 3TTOA 1UP0A 2W9MA 1E9ZB 2Y5EA 1I75A 4JFUA 5FJRA 3GU1A 3PR2A 3UG8A 1NELA 1D3GA 4LBRA 4JIEA 3HBLA 1GKRA 4DM1A 1UKQA 2V6AA 5HQMA 3A5FA 1V51A 4B5XA 3GYCA 4UOQA 3AJXA 2PDPA 3IRDA 5CZTA 3SM0A 2OKOA 1OYBA 4RE2A 2V68A 4QDPA 3S4TA 3P8IA 4W88A 3A13A 5LNWA 1H3GA 3SIMA 4CQDA 3H6OA 4K7YA 4IF2A 2Y7EA 1UZDA 1SQ7A 2RKXA 3IPWA 2WSRA 3AHXA 3FAWA 3L2MA 2VRQA 2D0HA 3BJSA 4TX9A 2DZAA 3ARQA 4F0HA 1K8XA 1Y5WA 1GVIA 4J3VA 3FXGA 2DVTA 1XLGA 3CH9A 3L0GA 2UY3A 3ZMRA 4UOJA 3ZSSA 1ONRA 4FO4A 1POJA 4XZBA 3CMGA 1ICPA 1QR7A 3BGAA 1OG6A 3M0ZA 3G5EA 1QU4A 3UCQA 1CPUA 1G01A 2Y5SA 1UKOA 4JDBA 3SBFA 3NNTA 4LB4A 2JF6A 2FTYA 1U83A 4Z0JA 3DOPA 1SR9A 4R3UA 1C92A 2Y7GA 5JBEA 3WH8A 1RV8A 1UPPA 3KCLA 2W63A 4GABA 3TKFA 2PCQA 3CNYA 2WZEA 1Q7ZA 2XGZA 3KM8A 4LVBA 3CUIA 4P7RA 2PE4A 4JTTA 4X63A 8A3HA 3HA1A 1XM3A 4M29A 4UFIA 3GNXA 1GJPA 2REQA 3FKKA 2WO5A 4K8EA 5D8WA 2PEVA 5FAGA 5JUVA 2QULA 1OK4A 1JGMA 4JYEA 1F8IA 4H7CA 4V28A 2AOSA 2O56A 1GEHA 3IJ8A 3B9NA 3SFWA 1YXYA 1DWHM 1B3WA 2EPHA 2YL8A 2HVNA 4LYRA 5JH1A 4A8NA 3W27A 3AWOA 3I7QA 4AD0A 1F4HA 3QHMA 5DMLA 3S5NA 3EKZA 3GVVA 6PTDA 3KFTA 4M80A 5AYXA 3MW7A 3VK5A 4I9TA 1OT2A 4LU0A 3R79A 1HG3A 1NWUA 1S2CA 1A80A 1XLCA 3LEPA 4DJFD 1K8ZA 3GUGA 1ZY9A 5CC5A 2JALA 5D2TA 4BK9A 2XN1A 3M5XA 2GYIA 1CWYA 3SJ3A 1FDZA 1T99A 1PIGA 2C14A 2CLOA 3MV11 1HKWA 1KGUA 1TV8A 1TV3A 2TSYA 5G1YA 5I2UA 1JQXA 1E5NA 2C91A 1CLVA 4KEZA 2PRHA 2QF8A 2FZNA 3PTKA 3RX4A 3GLCA 3GH7A 1W9DM 4FXRA 2QCGA 4ZB0A 2CETA 1V6VA 3PBMA 3UETA 3VMNA 3L4WA 2VEGA 3ABOA 5DMMA 2ONEA 3B04A 1YEYA 4F0MA 3H21A 1LOLA 4HOXA 2Y63A 5D32A 4KERA 1GTEA 5JBDA 1FHLA 4AZCA 4O0KA 5EMMA 2XUCA 3NZRA 1FA2A 2JKAA 3A64A 1ZHAA 2GZXA 4JTJA 4ERAA 1NOWA 4O17A 1GVSA 4HSOA 4QR6A 2NUXA 4NX5A 3EWBX 1V7YA 3N15A 2PA6A 1R6WA 3TA6A 1W2VA 2X2YA 2R14A 3D46A 4BJHA 3R12A 4D8AA 2YZ5A 2HWGA 3UT0A 2BY0A 1UHVA 1H1YA 2NX3A 1B30A 2Y89A 4DM2A 2A79A 3SSJA 4CVUA 1JUEA 1F8MA 3W1QA 3WDJA 1E0VA 5XINA 1EA9C 3DG6A 3GDRA 1QK0A 1KNWA 4UTLA 1CB2A 5GJMA 3IACA 1ZP4A 1WOAA 3AIWA 1Q8JA 4UIOA 4HA0A 5F4WA 1JCMP 4M6PA 1BXCA 1YE4A 4IIHA 1Z89A 1ZPTA 1DXIA 4C91A 1GHRA 2BOFX 4HMCA 4GH3A 3UU0A 8XIMA 5LNRA 2KX9A 1EGVA 1G69A 3VFLA 2P0OA 1UH3A 5GQBA 1CTNA 1UJQA 2PUZA 1BQGA 1FHVA 3DFTA 4HJWA 1Q5MA 5LZLA 4C6KA 4LB3A 1TZZA 3OQ8A 1DJIA 3E2VA 5G2HA 4IXHA 1S46A 3R8RA 1X98A 3OHIA 1VFMA 2WAGA 2C7FA 3CASA 3O6CA 4LV9A 1IZKA 3N11A 3GHUA 2WMJA 2D0GA 4IQLA 3DFSA 3EWCA 3L2IA 3CAWA 1Q6RA 5BRQA 2XWEA 1GJUA 5C0QA 4CQ9A 3P14A 3EDEA 2CLHA 2GUBA 2QKFA 2EJ1A 3WNNA 1UWAA 1XKYA 1YW1A 1M1BA 2YFOA 3EXTA 1A53A 4GIYA 1M7OA 4XAZA 4MSSA 5JIWA 2QPUA 2WHMA 1TCDA 3WD0A 3B8UA 3T6CA 5AC4A 4DUVA 4PR4A 5F4XA 4FNQA 3A4WA 2DZVA 1MEWA 1LJYA 4LNCA 3T81A 1GVOA 3OA3A 2W27A 3FYOA 3UR8A 1IR1A 1D8WA 3PM6A 3B8DA 3BO9A 1V3JA 4GZJA 1TSIA 3B0YA 3FDKA 3W74A 2YCLB 3C0JA 4AUBA 2JEQA 3TTYA 1U5JA 5T26A 1DYSA 3GG8A 4C6OA 5ABTA 4U5IA 3W7NA 3WQ6A 1EUAA 4LF1A 5JH2A 4XD5A 3CMFA 5EGRA 4CU8A 3A3HA 4DF2A 4P7LA 5HXMA 4UFKA 3AYVA 1PCKA 4DX3A 3QR0A 3ZLGA 3O06A 3QQ0A 2XU2A 5SWUA 1KFCA 4RZBA 1VFHA 3KOWA 1GG0A 3LM3A 1UQZA 3VMPA 2V38A 3ISIX 4GNKB 1TX0A 2XN2A 4RKAA 5FJTA 4I7VA 2VFHA 1A5NC 4UC5A 4DZ5A 1JZ7A 3FW6A 4P8WA 2HS6A 2E9MA 1TG7A 3L68A 4PUMA 1WDDA 3I10A 2A2IA 4KGJA 3QQWA 3II1A 3IUDA 1M6JA 3CIVA 1DL3A 1WKEA 5F2MA 4H00A 1VYPX 3RLGA 2NUWA 4JOMA 3WMLA 4NASA 2Z28A 3DFYA 1VFSA 2YBVA 2W67A 3LK6A 3IJQA 2J7GA 1I2RA 5HMDA 1FH7A 3CYVA 4ASTA 4M7TA 3W7IA 2Q8LA 1EZWA 2X42A 4GYKA 1QXLA 5C2XA 2QDDA 1HZYA 1ZRQA 3GVQA 1QJWA 2RGMA 4Y9AA 2FB3A 4J3XA 5MHBA 4I7UA 1VPYA 4U2YA 3T0AA 1A5UA 2X40A 1L0PA 3OVQA 2FHCA 3AHYA 1POKA 3C3NA 2BS9A 4WJ8A 3MYPA 3VC6A 2V3GA 4PB3A 4XAGA 2OKTA 1IIHA 1X6UA 3WL0A 4PN2A 4ZBCA 2SFPA 1QI0A 4FZIA 2OO6A 3T4CA 4IOTA 4ACZB 2FJKA 3S1UA 3UR7A 2E5DA 1TWIA 2O9TA 4NVTA 3ABXA 4NZ4A 2Y88A 2P5NA 1WDWA 3R0UA 3R8GA 2P1FA 4GI6A 5G4WA 4ECLA 4DUWA 2YXXA 2NVCA 4ZQRA 2A21A 4UTKA 1W31A 1XYAA 1A5OC 4B4FA 2AL1A 4PTWA 1TYGA 1JYNA 2H8XA 2O7SA 4PBGA 3TQPA 3SFKA 2OTDA 4C6BA 4D8LA 3MMWA 1I2OA 3IARA 1E6QM 4JTIA 5A2BA 3V5FA 2J75A 1G9HA 1NH6A 2QMKA 2VJXA 4NRRA 3LCGA 4MWAA 3WSUA 2X7VA 3T78A 1Z32X 4C6QA 4MKVA 2TPSA 3NSMA 1VBGA 3T0DA 1K9DA 1EQPA 2QJJA 3PK7A 3HPZA 1XWYA 1K8YA 1QPOA 5M5DA 4P61A 3QOKA 3B40A 4JD4A 3HMJG 2WC7A 1BRLB 2D73A 4XD3A 4ATLA 2Y7FA 1ISYA 1VEOA 1IXOA 2BP1A 1WUEA 2D23A 1FWSA 4C6MA 1W2PA 3QH2A 4QGCA 5TAOA 3L4XA 1XH1A 5CJ5A 1KM2A 1XGZA 1OX6A 2ZRWA 4LCRA 3YPIA 4AU0A 4N6FA 3RR1A 2E28A 4PRWA 2OG9A 3RJXA 1L6WA 4N7QA 3BAWA 4PL2A 1W9PA 4QG8A 2PGWA 3M7SA 4J2PA 1QW8A 1ITCA 1HF6A 4Q8VA 4EAYA 1UWTA 1W1VA 1LQ0A 3JZUA 1I4NA 2GDVA 5FEPA 1NY1A 2CZDA 1A0DA 3CUFA 1H7PA 3R2GA 3PF3A 3GZ3A 3AIRA 2DQXA 5FI8A 3D0CA 1QO5A 4QG9A 3JW7A 1LROA 2VGBA 2IPWA 1EH9A 3L4YA 1EJWC 3SY8A 1UJPA 1FFRA 3BOLA 1P7TA 2CFFA 2Z1KA 3Q2DA 3BG5A 2YXOA 3NWRA 1RP8A 1G7UA 2WVVB 3C5QA 4CEUC 5PTDA 2PDMA 1HJSA 3OBAA 3WQWA 1Z48A 4MTVA 4IPPA 1FWEC 4O57A 1AQ0A 1W3JA 2HBVA 4JTGA 2JKPA 1V3KA 1BYAA 4PCFA 2XIMA 4ZO6A 1BKHA 1FWGC 3M0JA 3VKJA 2E1WA 3RAOA 1HW6A 4XKYB 1HXJA 4EF9A 3KLLA 2WKLA 4FMVA 4DNMA 4R53A 4MIMA 2PDUA 2WNWA 3VINA 3WEOA 1UD3A 1R87A 3UWVA 1H63A 1UWQA 1JPIA 3ARTA 4UQEA 1GKQA 3RF9A 3GW3A 2VCCA 4S3BA 1CLKA 3NDYA 2FHBA 2WC4A 3HN3A 2DVXA 4JCLA 1GG1A 4OBSA 4YN5A 1C93A 3GSMA 1WAWA 5E9AA 1HKIA 1KFBA 2I14A 4YWIA 3CB8A 1YDYA 5EA9A 3ZWSA 4LOCA 3L5LA 1LM1A 3WD4A 5A6AA 3ZVHB 1TREA 1L6YA 5FACA 5A6JA 4M6QA 5AKQA 1TRIA 3KVJA 3S2LA 4UTIA 4W7VA 2BXZA 1M65A 3A5VA 4R7OA 4C6LA 2ISDA 2GJRA 3C2VA 3EKGA 1PIIA 4GYPA 4O28A 4X9YA 1JCLA 4PSRA 2FFIA 1PDYA 1ISVA 1V6TA 2HPMA 1FFQA 3VIIA 3A4JA 3POCA 3LHWA 1NTHA 3G3DA 4YWSA 4AF0B 5GNZA 2H6RA 1M3UA 4IFOA 1J11A 2OWXA 1H2JA 2PU0A 4LSBA 4D6DA 1PL9A 4R9OA 4WEVX 3B0VC 3HB9A 4K7VA 3LV6A 2JGYA 5E93A 2CLPA 1XYMA 3KS5A 2G37A 3T09A 1N8FA 3PPFA 4ERIA 1BFNA 3CAVA 3TZFA 1REQA 3W4RA 2CC0A 5I3IA 5CKSA 3EX6A 3O6DA 1G0CA 1ZLPA 1QHZA 3L21A 2PLMA 1RCXB 3CLWA 1I60A 1SW0A 4LAUA 4LYPA 3M9YA 1QT1A 4NL1A 4ZA0A 3W24A 4DJDA 1A5LC 1PUDA 1TFVA 2A4AA 3PN8A 4GJ1A 5LHFA 3NSNA 1M03A 3DHFA 2CLKA 3W2KA 4LV4A 5GPRA 3B0PA 2VRJA 4WSKA 3GK0A 2J7EA 4IP7A 5K7JA 1R47A 3PTMA 1TX2A 5DRIA 2WNQA 5CZ0A 3O7UA 2QDHA 1EGMA 3QV8A 1Z6KA 3N9SA 2ZUUA 2DT1A 3P0WA 4Z1YA 2D22A 3QZEA 3UPWA 3NG3A 1B3OA 3TDFA 3PAJA 5CG0A 2NT0A 3CWNA 3FJNA 1CX9A 3AAMA 3P62A 3WELA 3SCNA 2WMFA 2E9LA 1JCXA 3TX9A 1V08A 3M41A 2YR1A 3OVPA 1VHCA 5FJJA 3TR9A 3WN6A 4Q4SA 3W26A 3U2ZA 3CL7A 2W66A 1FX6A 2Z24A 3LHUA 1UR1A 3EWDA 1R3SA 4AW7A 1EGZA 5DX7A 1KM4A 3P7YA 4WDUA 1EEPA 4IIFA 3I3DA 1B4KA 1UUQA 5KINA 1B3XA 3RX2A 3PS7A 4IICA 1PWMA 2F6XA 3QBUA 2FH8A 3V0SA 3M7WA 3TJLA 1HNYA 4Q4PA 3E0VA 3L23A 3G6LA 1CGYA 1ML1A 1M41A 3CPGA 3HV8A 1WKFA 1K7XA 5JU6A 1UWIA 2NLIA 1F7BA 4MFEA 4A2RA 3L67A 2YW3A 2R8WA 5C54A 1IZCA 1XLKA 4PEKA 1XIDA 2REQB 3AWNA 2B4GA 2OQHA 1Z69A 2DT0A 3ZJ6A 4E8DA 3T42A 3M0VA 3ABZA 2VZSA 2FZMA 3KZPA 1IXQA 1TCMA 2ADAA 3PJXA 1C8YA 2VRKA 4LAZA 4GUJA 1D9EA 3GTXA 3R0KA 3IK2A 3B05A 1Q2SA 1E0UA 3IJ9A 3ARUA 3H7RA 1GOXA 4ZVJA 3V5OA 2VMFA 3QZAA 1A5BA 1DIEA 5CQ1A 2DVUA 1SZNA 4Q32A 3GDKA 3GE7A 4EPBC 4A8IA 3LBCA 1OT1A 3G1VA 1LOQA 3HU7A 1MW0A 1RQHA 1ZJHA 2A6LA 4KCTA 2XTKA 3UGVA 1H5YA 2OZ8A 3G1SA 2ZRYA 3KOXA 4HU0A 1DVJA 3EPMA 5A6SA 2FPYA 3QC0A 1EA0A 1Q6OA 4JTUA 4IQDA 1S5NA 1R30A 1SZRA 1CXLA 2VX5A 2QYGA 4RK8A 4KEMA 1AH3A 2WSYA 4ZOBA 3B9OA 1W37A 3H2AA 1J96A 2ANUA 1UB3A 4K6AA 4LUYA 1UZ4A 3VILA 1BGGA 5I78A 1GCYA 1D7KA 3H2EA 4W9TA 4F4RA 2VUNA 5A95A 4J1OA 3LG3A 1TR1A 1PBGA 4AD3A 1XC4A 2C13A 3KTXA 5IRPA 1BVWA 3SGUA 3OODA 3F4CA 1LL4A 3MPGA 4M19A 4JQ2A 4FNSA 5F4SA 4UQ9A 1VRXA 2YCEA 4QITA 1JG9A 3GH5A 1WCGA 2ZX9A 2GK1B 4MG4A 3UXAA 1AQFA 3OVGA 1WDQA 3CEUA 3PBWA 5GNYA 3IEBA 1IWAA 1KXQA 3N25A 4G1NA 4F2UA 2OLHA 4ATWA 3EZ4A 3OPSA 4PMZA 3RLHA 1QK2A 4DBDA 3O3RA 5AOUA 1S5MA 3VIFA 4TX6A 2WQDA 3F2CA 4K1WA 3UESA 3BLLA 3PZNA 1O1ZA 1QWGA 3EGJA 3SUSA 4HK6A 4D6FA 4C65A 2G97A 4J3WA 2B7PA 3OLEA 1LG2A 4AEFA 1RY8A 1KR1A 3KP0A 3GG7A 4R9XA 5K9DA 2PFHA 1OCJA 2DDXA 5E6ZA 5CSSA 1HVQA 1R2RA 1A3WA 2XH0A 1KWKA 2Z27A 2XH4A 1R2SA 2J8FA 2QCNA 1E1EA 2BGQA 1E6PA 3BCFA 4CCZA 3BG3A 1HKJA 1AJZA 3MC5A 4F0SA 2WPGA 3NUKA 1UD8A 3WD2A 4JY9A 3SCQA 1T6MA 2VFDA 1P48A 5C9RA 1DBTA 5I3GA 3CHFA 1MXSA 4IP4A 1SSGA 3LY0A 1W9UA 4BI5A 3MTWA 4HCHA 3OGRA 3WF4A 2Z7GA 2V81A 2VHLA 1IV8A 4W5ZA 1NDWA 3QV6A 4NZ1A 3TN6A 3LRMA 5U7SA 1K03A 4IH3A 3W25A 2R94A 3GFYA 3BAYA 3TR2A 2BVDA 1TO3A 1QNRA 1TZ9A 3NQBA 2OELA 1JPMA 1OQFA 1MRQA 1EIBA 3CL8A 3EX3A 3P61A 4RXFA 2UZ9A 1O7AA 1RUSA 2ZC8A 4JYFA 2PDXA 3S2NA 1SW7A 3RMEA 2J47A 1RJQA 2XIBA 4E2DA 3DU0A 1TRDA 3KXQA 1VP5A 2ABBA 3JVAA 1G1YA 1VBUA 3KL3A 2Y8VA 3NZGA 4MY1A 3DX5A 1EPXA 2ZZ5A 3PANA 4XD6A 2GSJA 4NZCA 4HNVA 5I3DA 4IGNA 1M7XA 1IXNA 7TIMA 1I2PA 4XUGA 5DCDA 4HT3A 3LDVA 1MVYA 3MV01 4M6UA 1YXDA 3TU9A 1OCQA 3REQA 3M0YA 4O8RA 4IMGA 2QCHA 2AMXA 1R38A 4JICA 3XIMA 3BVJA 3N4FA 4NQ1A 2PDCA 4JXCA 4FOKA 4L1GA 4HTBA 1ME8A 3WF3A 3W7MA 4C6JA 3H70A 4Q8OA 1YNYA 4P7NA 3CIXA 2I56A 3E0FA 3IANA 2QHAA 3TYZA 1EL3A 4JHOA 3QVQA 2AQVA 1CXKA 3LENA 1YIXA 4R85A 1ZNNA 2NW0A 5C7HA 4DJFC 4PEEA 3CT2A 3KUMA 2XSXA 3I6EA 4QISA 3AJ7A 3VO0A 3LS9A 4XD4A 1JDFA 4FAMA 4LUJA 2ZVIA 3VNMA 5E70A 3WMSA 1YDVA 1SZGA 1NQKA 4GZEA 3VC5A 4PYSA 4AC1X 4RW3A 1UZ1A 2E1DA 4MY8A 3DYPA 3E74A 3CXOA 3GU9A 3T0TA 3TAOA 5HNTA 1KR0A 1W3LA 3DUGA 1KFEA 1J12A 4NZ5A 1VYRA 3GG1A 2FTPA 3V7PA 3KCJA 4WJXA 3G6MA 3DC0A 1LBMA 1OFAA 4W7WA 2J7CA 4DELA 4WGHA 1XIIA 1M7PA 3NGJA 5I03A 3MUY1 3LGDA 4LAMA 3THCA 3ARRA 1QI5A 3QGKC 3FHAA 3MQTA 2ZTKA 4X61A 1XJBA 1E6XM 3KDOA 1KRMA 1OM0A 3FOKA 4C7GA 3U4FA 3DI1A 5LXEA 1H0GA 2VFIA 1US0A 2JEPA 1ADDA 3N29A 1EWEA 2VDHA 3JU2A 2BODX 4PBFA 3F4WA 2Z2UA 4IG2B 3DAQA 3S5YA 4RNFA 4G7EA 1H4PA 3L4UA 1W1TA 3SW6A 1FWTA 1ZS2A 3CMJA 1WA3A 2E5BA 1N55A 4D6JA 4XZ9A 4QTGA 4JHZA 4BF5A 5DN1A 3G0SA 3KL0A 2OWWA 4J27A 3LZ5A 3CT7A 1E9IA 2VC7A 4G6CA 3KCOA 2VVSA 5HJXA 4FX8A 4DQWA 4W85A 5BWFA 5CG7A 2W61A 3V3WA 3ARYA 1SJCA 3WQGA 3RX3A 5HQLA 1GZJA 4YPJA 1JULA 4AXNA 1SO4A 3C0QA 4IMFA 1AZ1A 3NL6A 4GIAA 1EX5A 3S5SA 4MWAB 4AD1A 5XIMA 1LBLA 3H8AA 4OV4A 2G96A 3LB0A 3U2EA 3K1GA 1GVQA 1XQKA 2HK1A 1XLAA 3I65A 4IJBA 1X7IA 3IAPA 3TQ0A 4IHCA 3AXIA 4H3DA 4RLIA 1DWAM 1V8EA 5F2LA 1XDMA 5H1WA 3MY9A 1WQ5A 2WKJA 3CQKA 1DJWA 4QFUA 4HNUA 3W3OA 1RQEA 4EX4A 5CGQA 4JPGA 2VGIA 4FNUA 3VIHA 5ABFA 1PTDA 3ERPA 3G18A 4A3HA 4JTHA 4NNAA 1JDEA 3TMLA 4S23A 3TFCA 1LL7A 1A47A 3WJZA 2PWGA 2WLZA 4W93A 3H2CA 5L9FA 5EB8A 4DPPA 1BG4A 3KLKA 3MBDA 1EC9A 3SUVA 2YX0A 4O1EA 1JGIA 4NUWA 4GBUA 5C70A 1EFZA 1E71M 4AX6A 3UWYA 4L6DA 3UR5A 1JF6A 2RUSA 3MDWA 3WMBA 1J5TA 1P7TB 1YNQA 2CLMA 5REQA 5EL1A 1RSCA 1CBGA 4N02A 1CB7B 3AC0A 4XAYA 1L8PA 1YDNA 2CLFA 3QHNA 5FJIA 1Q85A 2R6OA 4L6OA 5JXQA 1ZBWA 2PZ0A 3AUJA 3EXSA 3G1YA 2D0FA 4CU7A 4LXFA 3GXNA 1L6SA 3NQEA 3VPLA 4BWLA 1E0WA 2VTFA 3AIUA 3P67A 5ECVA 5CPLA 2WCAA 1BXBA 1E0XA 3JR2A 4MNJA 3WLHA 2JKEA 1WYIA 1RY0A 2CHNA 3UZYA 3TW9A 1RD6A 4JQAA 1KTBA 2AQWA 4IFKB 2ISVA 3QY8A 3WLJA 3N34A 1SYTA 4S1FA 4C60A 4D6GA 2F2KA 4PB5A 1V93A 1H7NA 2Y7DA 2Z2AA 4BFAA 3IVSA 2GJPA 3OOQA 4J7RA 3QY7A 7PTDA 5I24A 1ZAIA 3TUUA 1CXHA 1E43A 5I3KA 5FESA 1JZ3A 1DJXA 1Q6QA 3ZR5A 4N6EA 1FP9A 3IUIA 2R1LA 2F61A 3G1HA 3BV4A 3WK3A 2A3BA 3KDNA 2EPMX 3R6IA 1RR2A 5LNSA 1W54A 4PUKA 5I02A 3VI2A 1P1MA 4A3RA 4DXVA 1UIOA 4CUCA 4PTXA 3QW4B 1TMLA 2WOQA 4Z0SA 2HROA 4EK7A 2WQPA 2X1SA 1MYRA 1ALDA 2V5LA 3NQDA 1YTEA 1BYBA 2J7DA 4URIA 2YBTA 4JS3A 4MB3A 1K4GA 3QGVA 4WCJA 2PDGA 4IL2A 5D37A 2BVTA 2HE8A 4XTIA 5ENLA 3V0TA 1TJPA 1BPLB 2ZCGA 4AVNA 2J8GA 3U9IA 5LYRA 2IMRA 2I5QA 1V3HA 2J24A 3WLSA 3G0UA 3TNBA 2EAWA 1REQB 4KWWA 3W0KA 5I0DA 1DWIM 4PB4A 4L4PA 3AYRA 2PWHA 2O9RA 4GY0A 3RCNA 2QJNA 1DV7A 4IPJA 3W7EA 2E7FA 4KF1A 1TVPA 2CYGA 5KZEA 1TA3A 1XPYA 4EWND 4FX7A 3RO6A 4F0KA 3THQA 4QLLA 2BOGX 3K2GA 2YIHA 4V1XA 3VIMA 5M1TA 2PF8A 1YNPA 3NYZA 1W1B1 3PSWA 5JIPA 4OT7A 2QR6A 3GYEA 4MWAE 5G4EA 2CKSA 1SJDA 4OHQA 4AZIA 2V3DA 2ZUWA 4QE1A 5FSDC 1BF6A 2WZMA 1I2NA 1H5VA 1E4IA 2DUZA 2FZ9A 1Y0EA 4DO4A 4UTUA 4MZ8A 2DH3A 4N2YA 4PRTA 2PPGA 1EJUC 4O13A 3R11A 4C5ZA 3Q94A 3DESA 3AXKA 3PUOA 1WZAA 3BCJA 2J25A 2IXUA 3KP1A 4XG1A 3PB0A 5AYYA 1JRCA 3BMVA 4QDWA 2PODA 1GOOA 4X60A 1H7XA 4Q7BA 3NM3A 1UW9A 1AH4A 2ISSA 2ZYFA 3FJLA 4Z17A 2VEIA 1XHGA 3UY7A 1VZWA 2DSUA 3D3FA 4FXJA 4UZSA 1I9CB 1WBJA 1ZL1A 1GQJA 2YXGA 1J0HA 3N9RA 1AA1B 4GX9A 4K36A 3BC9A 1OFDA 3AS1A 4MLRA 1P43A 3GUWA 4LS2A 1HIZA 3AMCA 2XVGA 1XG3A 3M47A 5D8ZA 3EDDA 3B8VA 3ABSA 1TMHA 2PWDA 2WMIA 3CYJA 1HGYA 1YPXA 3U8GA 2VFGA 2OVLA 2Z6IA 4CNPA 5C5YA 3QKZA 1IGWA 3RPDA 3UD6A 4E8CA 4NAEB 1EWDA 1VCVA 1B0IA 3LHYA 3VIPA 2WNZA 3CZKA 4GKTA 1AH0A 3R25A 2Y5JA 3NQAA 2Z29A 2VCAA 1DORA 3VKAA 4IT1A 1BAGA 1FWFC 3SEPA 4QHRA 3ANYA 1E4NA 1Q2RA 1UC5A 1R7OA 1RVGA 4YNGA 2VZVA 3PZ9A 3B9AA 7CGTA 4G8TA 4PC8A 4PMRA 3C2EA 1IXPA 5U4NA 3N2CA 4UFLA 2A6NA 4N9DA 4ZQOA 4JNYA 1C8XA 1NF7A 4W84A 2JFEX 3N13A 3QSRA 3C2YA 3OZMA 5AYZA 5GJPA 1EJSC 3ATYA 1BWKA 3CBWA 5AZ0A 3UZZA 3B03A 5IDIA 2PB1A 4B90A 3MUAA 2PTZA 4JYDA 4ZZ9A 5DF0A 1BG9A 3SECA 3L66A 4I9JA 3VOCA 3TOPA 4AZHA 1KTCA 1IR2A 1OEPA 1FY6A 4INFA 4HU4A 3WLPA 4US5A 2OT1A 3HURA 5CZSA 1RP9A 4IUOA 1W1YA 4H6QA 3NYDA 3TW6A 3OG3A 2X2GA 3NM1A 4YVXA 4DNHA 3W71A 1M53A 2PC8A 3GHTA 1KKRA 1BYDA 4AD5A 4WSHA 5AZ1A 2UBPC 3QLLA 3GBEA 2PBOA 2QW5A 4H7VA 4JTDA 1EO5A 1TUFA 3CO4A 3WBXA 2Q71A 1EJ7L 3T2QA 1B57A 1CT5A 2XYLA 1UD2A 3GD6A 1EJRC 3AYSA 4LS1A 1GJWA 4L64A 5T8GA 4PTDA 2DGAA 3BZJA 5E6YA 3WBWA 2YL6A 1DXEA 3VNIA 3N19B 4D8ZA 3W7JA 1LT8A 4IGMA 3RM4A 1MXGA 3FAXA 3PVFA 1GTHA 1P0DA 1PS9A 4L9ZA 1M68A 3HF3A 3B0XA 4L1WA 1AJ0A 4KRZA 4WDXA 4J4KA 2JE8A 2BASA 1DJYA 3WDIA 1R2TA 5B7YA 3N17A 3DFOA 3WKZA 3PZVA 4DIAA 3HO8A 2J78A 1G5AA 1GZ1A 1XD1A 5HNNA 2ZA2A 2OQLA 5E0FA 3SGGA 1FDYA 5EU9A 3KE0A 1LRNA 4V15A 5BXTA 3STCA 3EKLA 2OYMA 4NJKA 3RYSA 2V5DA 3LPFA 1C91A 4Z42C 5CPOA 3NQGA 3UA4A 3UGRA 5HPCA 4AD4A 3WK0A 1XBXA 4QE4A 4C1KA 2TAAA 5HK4A 4UQCA 1OF6A 4OVXA 5EPDA 5BNKA 3LHZA 3MYOA 2C8NA 2G95A 3B8IA 4KCVA 1CI1A 2QCFA 3UWUA 3P2VA 4ZGYA 1OB0A 5HMSA 1GQKA 2QLYA 2E0PA 3TN3A 1XF0A 4JBRA 4F9DA 4IIBA 5ABGA 1MWOA 1N8IA 1YPFA 1FH9A 4GXPA 4US5D 2E6AA 1US3A 2E6YA 3EMCA 2WV8A 2RJGA 1Z8AA 5BRPA 6CGTA 1F3EA 3PJWA 2D2JA 3G3MA 3I6TA 3VVGA 4I9AA 4YIWA 3W87A 3W75A 3EBVA 4MB5A 2WM0A 3BGJA 4O0ZA 3M0XA 4JTAA 1CGUA 3OLDA 2GWGA 1W8GA 2ZZ4A 5D4YA 1EHAA 2PRMA 5C55A 3LXBA 3PZOA 5H8PA 3QR1A 3ARVA 2OMAA 3RMJA 1NWTA 3ONBA 3PAOA 2ZDRA 1LLWA 1QNVA 1WO2A 4AYGA 3EWYA 4PZVA 1VPQA 3BSGA 1Q3NA 1XH2A 3MMUA 1TPVA 4X3ZA 4E38A 3Q4DA 1JF5A 2VM8A 3DFQA 3G77A 3GH4A 1E1FA 2WWCA 2CZFA 3URQA 4WX2A 5LIYX 3C2RA 3V35A 4CCCA 2NVAA 1BYCA 2WZTA 2Y8KA 2J66A 5CPNA 3GY1A 3SADA 2BFGA 1LWJA 1WDSA 4HYWA 2X1UA 3LD5A 3GS6A 5CPTA 1JFXA 5K2ZA 1SO6A 2E3ZA 2YDAA 7REQA 1FBAA 4ZFMA 1WZLA 3HGSA 1OCNA 1OG0A 1UCWA 1YADA 3WIJA 1Q7QA 1GYMA 1W6TA 2GGJA 1E15A 2ZXDA 4NSBA 3K1DA 3B4YA 2V9DA 3MP3A 4RV8A 4FB7A 3FEQA 3SUUA 1LG1A 3U5YA 3QQ1A 2UWFA 3MI3A 4A2SA 2ACSA 4NRSA 4PMVA 3U5UA 3N18A 3BTNA 1PEZA 3GXMA 3THUA 4TV6A 4ZO9A 1IYXA 3U7BA 2NQ9A 4AD2A 3WBEA 3W82A 4CD7A 4JEQA 4KFPA 1VD6A 4YMZA 3I6RA 3NTYA 4TIMA 2BXYA 3ITTA 3O15A 5EBUA 1KCZA 2BSLA 5ECUA 3OA5A 4PBEA 1THFD 1T5AA 4D9PA 4L80A 3QF0A 5KZDA 5DANA 1T96A 1W3TA 3WL1A 1QOPA 2B31A 3QHOA 1I0DA 3HJZA 2C1HA 4UOZA 3MSDA 2I5IA 5D2WA 3V16A 1R8LA 3FS2A 1KCXA 1DPMA 2X09A 1TWDA 4DO7A 3O05A 3KBJA 1LF1A 4M6VA 4PTNA 1UR4A 3H22A 3BDKA 5EFDA 3JRKA 4UR7A 2O9PA 1P6WA 2FKPA 3P93A 3MWAA 4E3TA 1WZKA 4Z2GA 2CITA 4CD6A 4G7EB 3WLIA 3NCOA 2XG9A 1UUMA 1QUMA 2DSKA 5LHEA 4UBPC 4JKMA 4DI8A 5CEWA 1AL8A 1V3MA 5HBFA 2C16A 3W7OA 1Q6GA 2YCLA 4HZ8A 4DLMA 5M3WA 3C3UA 2ZXAA 1OGSA 1HUVA 2QDEA 3M1ZA 1P4CA 4LS0A 3IIVA 2X41A 2B7QA 3TOYA 4KWVA 1SJBA 3FLUA 1J0IA 3NIYA 2J13A 1QAPA 3FGCA 3LLXA 3Q65A 4ZR8A 1JUBA 2ZUSA 5D9PA 1EOKA 4ML4A 1PZ1A 3JZEA 4O18A 3W7CA 2DQWA 4FNPA 4JTSA 3NVDA 3D47A 1EJTC 3UNDA 2VELA 4QAIA 4TUFA 2Q6ZA 3KAOA 1GZGA 2YB4A 3IRSA 3UWQA 4P5UA 2F6UA 1XLMA 1XYCA 4ZCWA 3POHA 3W86A 3WEZA 4YTUA 3RM9A 3UWEA 2YA1A 1GOKA 3TLQA 4L65A 4Q8PA 1F07A 4DHGA 4LH8A 5I3HA 3CZLA 2BDQA 3SRFA 3M4HA 2EBNA 1OGBA 1C7SA 3URNA 3VCRA 2VC6A 4KMQA 4GE8A 4WVXA 3NO3A 3J7HA 1HQTA 4FXSA 5A2AA 1NIUA 2ISWA 4KQNA 4EF8A 3EOLA 1W3KA 4KRUA 2YB1A 4ADSA 4W7UA 5FF0A 4C5YA 1NM9A 4NT0A 1VCFA 3LM7A 3EOUA 3ITLA 1GPFA 1XIHA 5ABFB 2CW6A 2PWFA 3QEZA 4B4HA 3M6YA 3S42A 2QGHA 4QJ1A 4I5RA 3EB2A 1QWKA 3M46A 2Z0IA 1RJRA 5DFAA 1AJ2A 3SQMA 3VDGA 5AHLA 4HMNA 3S2MA 4HD5A 4QS5A 1F05A 1TTIA 3QPZA 1J79A 3W7RA 1XI3A 2A85A 1RBLA 2IS7A 2AKZA 1CIUA 3FA5A 3C86A 1EYEA 1UASA 1FCVA