4AFYA

Crystal structure of the fimx eal domain in complex with reaction product pgpg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FIMX
publication title Crystal Structure of an Eal Domain in Complex with Reaction Product 5'-Pgpg
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4afyA00
3SY8A 4ES4A 3GFZA 3HV8A 3GG1A 3TLQA 4HU3A 4AFYA 3HV9A 4RNHA 3PJWA 2R6OA 3S83A 4KIEA 4RNIA 4FOJA 2W27A 5MKGA 5M1TA 3PJXA 3GG0A 3PJTA 3N3TA 4LJ3A 4Y9NA 4LYKA 4Y9OA 4HU4A 4Q6JA 4RNFA 5MF5A 3U2EA 3KZPA 4Y8EA 3PFMA 4AG0A 4F48A 4Y9MA 2BASA 4FOKA 5MKGB 3GFYA 4FOUA 4RNJA 4HJFA 4J40A 4Y9PA 4F3HA 3PJUA 3GFXA
chains in the Genus database with same CATH superfamily
3B8WA 3NYDA 3LZ5A 4FIRA 2PDYA 3LERA 2WMGA 3SDOA 1MDRA 6ALDA 3C5QA 2PDLA 1EXBA 1E5JA 1KXTA 3H21A 3BW3A 4XSLA 3VNIA 1JI2A 4HPNA 3DOPA 1WUEA 5AC7A 5LZLA 5BMXA 2QCNA 5CZKA 2WQDA 1OB0A 1LL7A 4Y7EA 2FGBA 3TN5A 3ID7A 2I17A 4HHPA 1WBJA 4QP0A 4KEZA 1AD4A 2W0UA 2G96A 3WLIA 3BARA 2V69A 3ITYA 4O11A 3CZLA 1W1VA 3MZNA 4I7VA 2TRSA 3EZ4A 4KPLA 1TMQA 2ZOXA 2G50A 3EDEA 4C1LA 1V6XA 3NQAA 2BXVA 4YTTA 4JTRA 3W1NA 4PH6A 3I6EA 2QCEA 5FJUA 4Q8WA 4F40A 1QASA 3CO8A 1XRFA 5KZ6A 1R85A 2HNHA 1PS9A 1Q6DA 5C2CA 2E6FA 4J3VA 5A6BA 1PYFA 5JXQA 5D30A 1JPKA 5GJMA 2VQUA 2X40A 2OGYA 2DZXA 2IKJA 5AYXA 3CV2A 4NL1A 3KL5A 1QJWA 1SFTA 1TPEA 2NV1A 1H0IA 3GNXA 5I3IA 2E77A 3UPBA 3I4EA 4I6VA 3H54A 1QNPA 4J28A 3P61A 4IG2A 3VFCA 2DEPA 2F61A 2V3EA 1W2VA 4Y9AA 1TTIA 5HMSA 2HQAA 4IFKB 3W25A 1K6WA 1F3XA 4HQVA 2HSAA 5HNRA 2GGHA 1UA3A 3JUGA 5EU9A 2EKCA 4LF1A 5G1MA 2V3FA 2WSQA 4B5VA 2CCRA 3BCJA 3UVAA 4B92A 9RUBA 2DT0A 5CEWA 1E0TA 3PANA 2WW5A 1J93A 4OJYA 3CC1A 3GG7A 2C19A 2Z00A 3N25A 1RBOB 3F4VA 5HOSA 3FA4A 4O15A 4TXEA 1V6UA 3AIVA 3BC9A 2CLKA 3UEQA 4FSAA 4XZHA 2WCGA 1XIMA 2X41A 3LENA 1T8XA 4K8HA 2BFGA 1A49A 3GX9A 3AHXA 1SM9A 1N55A 5HNNA 1TWZA 1JZ5A 1FVPA 1E1CA 4C6KA 3WMCA 4OKDA 3PF3A 1TPB1 3HA1A 2CZEA 4IP7A 2PF0A 1TUFA 2WMIB 5JMUA 4PUDA 1BYDA 5JBEA 1ZY9A 2DPEA 3AI0A 4LW7A 4HD5A 1MXDA 1PE1A 3BCDA 1O66A 1CGVA 1O60A 4XZBA 3SURA 2F7FA 1JFHA 3O9NA 5HJYA 2ZX8A 5GJNA 4DZIA 1XLEA 1E0WA 1X8CA 4IMEA 4WXYA 3PAOA 4E4PA 1V6TA 4WGXA 3NXLA 3TMQA 3THDA 3ZFHA 1FCBA 4JEQA 3SUVA 1EYWA 5C71A 4DI9A 3VDAA 2PZNA 1NF0A 4PCFA 1Q6OA 2WYSA 1XBZA 4MFDA 3LSCA 4TX8A 3WLNA 5I0DA 1M3UA 3N6JA 3H2FA 4IPJA 1QHZA 2VEGA 2DUAA 2HEJA 1H41A 2OJPA 4D1IA 3U4FA 5FKYA 3MPGA 4LF2A 2FFCA 3OZYA 4AWEA 4CNTA 1V93A 5FL0A 2QR6A 3AUJA 1TB3A 4H41A 4JTAA 4FR1A 4I5RA 4XZMX 1XISA 4NILA 1XLMA 5EFFA 1WZKA 5LA1A 1AH0A 4ECLA 6REQA 9XIMA 3Q58A 1EHNA 4Z1DA 2PAJA 2AOSA 4V33A 2ALRA 1E1EA 1V3HA 3WELA 4H8VA 4QHRA 1HJSA 3PPGA 3UZWA 1AQ0A 1GVOA 1HJWA 1PZ1A 1UASA 4LEQA 3CWHA 4OV4A 2DGAA 2QIWA 1TV8A 4LAOA 3SW6A 1C91A 4RR4A 4GUHA 1V0NA 3HG5A 3R94A 3DCPA 1AH3A 3R4IA 3TW7A 2GUYA 4AFYA 2WANA 1EXPA 3AU6A 2OT1A 2J6VA 5H8MA 3TIMA 1UZ1A 4L9XA 1QPKA 4AX6A 3M9YA 4B9YA 3OBAA 1TZ9A 3TWAA 2XINA 4H8UA 1L6WA 3MHUA 3TJLA 2WC7A 3WQ8A 4B5UA 3VM5A 3RLUA 2ZUNA 3E3HA 1A0EA 3POHA 2PDMA 3OYZA 1ISYA 3VC6A 2EG7A 1OYAA 4RV8A 1KRBC 2WMKA 3D3AA 3QHMA 1JQXA 2GUBA 3QM3A 3E74A 4GXMA 1VHCA 4LSBA 4C6NA 1IZJA 4PB5A 2GQ8A 3OQEA 3QPYA 1RQHA 3ARRA 2E6AA 1TWDA 1W8GA 2CIPA 1J4EA 2OPJA 3MYPA 5FF7A 2QJMA 4FX6M 4W88A 2J77A 3W2MA 4X9YA 2JIEA 1E0UA 2CLEA 3A5VA 1YE4A 1EC8A 3C8FA 3H4GA 3U6WA 3LXAA 1ISWA 4JY9A 3B05A 4WUIA 4IMDA 3BLLA 1XDJA 4LAMA 5D4YA 3WQGA 4MPKA 1ONRA 5ABTA 3NGFA 1H7RA 3KCOA 4LCQA 5FJOA 2ZDSA 1X7IA 2VRJA 4PRWA 3JU2A 4OVXA 1LOSA 1IYXA 3L21A 3W9ZA 1FH9A 3FKRA 2VX4A 3LHYA 5MKGB 5FI8A 5C70A 2E5DA 2JKAA 4HNOA 1QO2A 1WKFA 4D6DA 4P8WA 4XZLX 2FDSA 3R8HA 4YYFA 2XFWA 1T40A 2NX9A 3EWDA 3V5CA 4QTGA 3GDBA 1JXKA 3VIKA 3NPWA 3MUZ1 3NQ8A 2VELA 3W86A 1PB0A 3IJDA 3DHPA 3P84A 1FWCC 4GQ0A 3VD4A 1A0DA 4HT3A 3ZLFA 5FEWA 3HF3A 1Y5WA 2XISA 4IOTA 1K7FA 4TV6A 4C7GA 3NQVA 2RDXA 4S3BA 3VO0A 5A6MA 1FCUA 3CH9A 3VOGA 3BJSA 3ZXWA 4HN8A 3V1HA 3KRZA 5D8WA 1WAWA 5A8QA 1W2PA 4E2DA 3CHVA 2ZBTA 3WL1A 3V7PA 3SCVA 2I56A 1UR9A 5FEPA 4OV9A 2H3DA 4AZIA 4CD4A 4GXWA 3WMBA 1EP3A 3R25A 3UCCA 2R14A 3VMOA 2VZTA 3R0DA 1D3HA 1R2TA 2X0YA 4PTXA 3LX9A 1BRLA 4W86A 3DXIA 1YXYA 2PP0A 4JIPA 4F2BA 3FEQA 2IPJA 4WSHA 3SECA 1FWAC 2V81A 3CZGA 5TD4A 3UWQA 1C92A 5CSRA 4J3ZA 1XPYA 3MI6A 2F38A 2OR2A 3GK0A 3GVVA 4G6CA 2ZX6A 3OLGA 1AVAA 1PTDA 3UWEA 3A3WA 3OZOA 3L2LA 3KUMA 3OVQA 4ZQPA 3P3BA 5EL1A 3M07A 5L9FA 1J11A 2PRLA 4MDPA 1KGUA 1S1RA 3EWXA 2C6QA 4HVXA 4H8NA 2B7QA 1UH2A 4DYJA 1ECQA 4S38A 2INFA 5IFPA 2BY1A 3KLLA 3MANA 1FFQA 1LLOA 4M3PA 4DBUA 4QLKA 3QQWA 4ICMA 3T4WA 1C8XA 4WD0A 3TYBA 4FS9A 4XVEA 4DUVA 1NWRA 3BOFA 1VP5A 3FGCA 4IGMA 3WQPA 3IJ6A 4MWAE 1UD3A 2NXGA 4B16A 2WNWA 5BRPA 3WIJA 1X1ZA 1H7OA 1NY1A 4C1NB 3NL5A 3P0XA 1M9HA 4JTQA 4NIRA 5I3GA 4KGLA 2ZIDA 2I7GA 4Y9PA 2ZRZA 4JTEA 1OADA 2Z27A 3LMZA 1LBMA 2PDIA 1LLWA 4M51A 4EWJA 3G1DA 2W4XA 3FJLA 1B4EA 2EF9A 1ADSA 3VK5A 1TZ7A 1NSJA 1EKOA 3C2FA 3NQ6A 2PGFA 1NDYA 1FA2A 3S2CA 1QFEA 1LWJA 3PFMA 4PMVA 4EPKA 3GFYA 2V5CA 1D9EA 3XINA 2PODA 2PI6A 3NA8A 1JNEA 2V5LA 1R7OA 3O15A 3WD3A 4F2TA 3Q45A 1MWOA 1F05A 1VKFA 2INZA 3JRKA 3UY7A 2LLEA 7REQA 4RXFA 4IQLA 1X96A 4DEFA 3MS8A 4MY1A 3F4DA 4XO6A 4B2DD 3VNJA 2NQZA 3F03K 1O6IA 4IFRA 5EMMA 3MMWA 4YYCA 2HMCA 2PDKA 4H4IA 1WBHA 4M6VA 2X1RA 1BVWA 1VRXA 1N7KA 3K4DA 2V9DA 2V3DA 4HJFA 1BFNA 3AWNA 2B31A 3MO4A 3UZ5A 1G4SA 2Z1VA 2YLLA 4WXZA 2PDUA 2FZMA 4F4RA 4RL3A 4XWUA 8RUCA 2R1NA 4KEMA 3TMLA 2BHYA 3L4YA 2NX1A 3UJEA 1XGZA 1TPC1 3QZAA 2YB1A 4Z1AA 3S9ZA 5M1TA 1POKA 2FPYA 3WY1A 5DMYA 3EX6A 4XSMA 1AQMA 5I00A 4XQ6A 3C2VA 1S3TC 2D3NA 1SR9A 3AJXA 3HV9A 4K68A 1GEQA 2D73A 4L9ZA 5TAOA 1REQA 3MQTA 3MSDA 4F0HA 4YCPA 2O9PA 3IV8A 5D9MA 1GJPA 3MP3A 1EWDA 3IK4A 1GG1A 2D23A 2J74A 4NY2A 3K46A 2CLOA 3QOKA 1EBHA 1W3TA 2QXWA 2QCMA 3W01A 3W1XA 2YGYA 1HL9A 1ZPTA 4F0MA 5A6SA 1YYAA 4YL2A 4RNIA 3HFTA 1KM2A 4CQAA 3PNZA 1PX3A 2P88A 1G01A 4PCSA 1G7UA 1LQ0A 1V7AA 2WM1A 1JCMP 2D2JA 1KNWA 3QXBA 3SCPA 1PX8A 3QGKC 1TX0A 3M7SA 2V0TA 1C3FA 1EJSC 3ITOA 3P0WA 4ZXLA 1NOFA 4GI8A 2DV0A 4GLEA 5JBDA 3FYOA 3TV8A 3PULA 3WH8A 4N9CA 4ZTYA 5IDZA 3NPVA 1M7OA 2E8ZA 1HJQA 1HT6A 2ABBA 2ZA2A 4CQDA 5HNUA 2Q8ZA 1HUVA 4XK2A 3ANVA 4FXJA 3CXOA 3KOYA 2VFIA 3HV8A 1JYNA 1KD0A 4H9TA 3H4XA 4W89A 4YWIA 2F9RA 1CXLA 1FWGC 3EDJA 3RIKA 3EWWA 3THAA 4O52A 4CNNA 3KW3A 4ZOEA 2XVPA 1RAKA 2C3ZA 5HR6A 1XP3A 1QI0A 3HIJA 4RZ6A 3GHUA 1XC4A 4W7VA 1F74A 3S46A 2FMOA 3IJQA 2DU2A 1X1NA 2A6NA 2VC6A 1VFTA 4I3GA 3EXTA 3SCUA 3EA2A 3UNDA 5D33A 1KBIA 4QQ3A 1EWEA 4EIVA 3O63A 1LDCA 1QUMA 1R47A 1OYCA 1XV8A 1XSIA 3MO7A 1YQ2A 4JBRA 1EYEA 3CV6A 5HDRA 1J12A 3WNNA 4OFCA 3AO0A 1KW1A 4IMCA 2VL4A 2WVSA 3QH2A 4A3YA 1QVBA 2I9UA 1TPDA 3RG6A 1TIMA 3ATZA 4C91A 1VENA 1R38A 3N4EA 2ZDRA 5DXXA 3M7WA 5FD0A 3WSUA 3CEUA 1H11A 3HQ1A 1CXHA 2E4TA 2W67A 1H1NA 4WEVX 1RLDA 1GORA 3BMXA 4XX6A 4BKNA 1QOXA 4FOKA 4L1WA 3HJEA 4QG9A 2A0NA 2BTMA 2W79A 2BVYA 3DEQA 3GG1A 1EFZA 1Q6QA 2FVLA 1JZ7A 2EPNA 3RYSA 3EEZA 2ZUMA 4LC6A 4JS3A 3WH5A 4EPDC 1V0MA 1TA3A 1X97A 1JNDA 3NUKA 4GI4A 1ZTVA 3DFSA 5ECVA 1B9BA 3WNKA 2PLJA 3KBWA 3R8RA 4AD4A 4GIAA 4GC4A 3PY2A 4AMCA 1DWIM 3PWAA 3TYCA 3KFTA 1Z7AA 2G4FA 3BMVA 3G6MA 5D37A 3BDKA 3B9OA 1VFHA 1WP6A 2Y0FA 1JDDA 4XD3A 1SZRA 2PCEA 3VGFA 1A3HA 5I3KA 1MEHA 2PDHA 2PB1A 4D72A 4O12A 1J6PA 5LHFA 4ZFMA 4DJFC 1DIOA 1EBGA 4QX4A 1OIFA 2BS9A 3LCGA 4PUJA 4PCPA 3RK8A 4MKNA 2GVJA 1EO5A 4XKYB 3UETA 4A29A 2F6UA 1R7AA 3SM0A 1EDTA 1RD5A 5HK4A 3TN6A 4AIBA 1XRSA 2WKLA 3PTMA 1UC4A 1UR8A 2DP3A 4KMQA 3RJYA 3C0LA 3WQ5A 5I7GA 3PR2A 1GQJA 2BXYA 3IGSA 1QO5A 2Q71A 1ONWA 1FQ0A 1E0VA 3TLQA 5D9OA 5KTLA 3ZSTA 3QSTA 4GNJA 3IIVA 1P7TB 3V4BA 2CZ5A 1W32A 3E0FA 4TIMA 3FVMA 3MVTA 5AC4A 3MWCA 4LB3A 1XQKA 5G4HC 3TSDA 2Y7DA 2WQPA 2Y5JA 1TZZA 2EJAA 1V3KA 1GCYA 1VYRA 4FB7A 4JDYA 1E15A 3IIZA 3T8QA 2YSWA 1OX4B 1H7XA 1MEIA 3QSRA 1P0KA 2E8YA 2YBTA 4PFMA 4WKHA 4JKKA 3T2QA 1RVGA 2BMBA 3M6DA 4MZYA 3VIPA 2QJJA 3IVSA 1MO0A 3BANA 1P0NA 1UWTA 4OBRA 3TQ0A 4O4VA 3VOFA 1C29A 2RHGA 3ITCA 4N0RA 5C7HA 4CVUA 1CXIA 3W29A 2VFEA 1ITXA 3G0UA 4ZZ9A 1R3TA 1LP6A 2A7PA 4KIEA 1OGBA 2DORA 3GXMA 4XBSA 3AIRA 1XLGA 2GQ3A 2OOGA 1EHAA 3N3TA 3VCRA 2ZXQA 4KWWA 2V38A 3T0AA 3C3NA 1TX2A 3IJ9A 1UBSA 3W82A 5DRIA 1AK5A 1MUMA 2J6XA 3GG8A 3VCNA 3W76A 1WPCA 3BE7A 4D6FA 2TSYA 1ZENA 3FVDA 3UJSA 4IFKA 1DWHM 1UIOA 2NSXA 4HTBA 4UCFA 4AG0A 3V5OA 1TV7A 3PBVA 1J6OA 3W1QA 2WVTA 4D8AA 2EKGA 1TMLA 4FNTA 2Z2AA 1OFDA 1RJQA 1FWSA 3EOEA 5KETA 1W5OA 5KZDA 4QEHA 1HVXA 3N11A 1ZHAA 3NM3A 4ATLA 4CCEA 2PE4A 1OY0A 1POJA 4F0KA 2VFHA 1JPHA 2DSKA 3JW7A 4CD5A 2E25A 3M1ZA 1V0KA 4NNAA 4MY8A 3R0UA 2YBUA 2CITA 2AMGA 1F3EA 1SO5A 2D20A 1R86A 4MGGA 1V4YA 2YFNA 1W3JA 3NZRA 2WMIA 3WBEA 2ZZ4A 5KINA 3KCJA 1PZ2A 1H4PA 2EJ1A 5CZJA 3DYOA 5IHSA 3EWUA 2G3FA 3D6NA 3I6TA 1E4NA 3UJFA 4S3CA 2XH2A 5JQ9A 4HKPA 5AZ1A 1A47A 1DXFA 4XD5A 3MDUA 3PUOA 2GLKA 3ONCA 2X2GA 3WN6A 1G4PA 2XH4A 4ZBCA 3FHQA 3TJXA 4N6EA 2J7DA 2QS8A 1VYPX 4MJ2A 4ZQOA 3ITGA 4FMVA 3CMFA 3TR2A 2R8WA 3VOHA 4JGDA 1XLDA 2FGZA 2OO6A 1EX1A 1OEPA 3BWWA 2C1HA 2BBFA 4WY0F 3S9YA 2VX5A 2NQHA 3QHNA 3WFZA 3CLMA 3L0GA 4WCJA 1R6WA 2WNNA 5LNRA 2Q01A 4I8DA 4Z1BA 1DJGA 1KR0A 2XUCA 3W7DA 1W9DM 4U33A 4DUXA 3CUZA 3FA5A 1IEIA 4ILSA 4JTDA 1YRRA 1U83A 4YU1A 1S5MA 3MBDA 5G1YA 2DIJA 2ZUVA 2KZHA 1PYMA 3T78A 3E9AA 1MZHA 3GYEA 5EMKA 2HS6A 5CSSA 4YVPA 1TPUA 1YDNA 4BA0A 2DZWA 4RPQA 1GHSA 3L5LA 3LGDA 1YXDA 3VNKA 1UJQA 2RGMA 3AOFA 4JTIA 4Q4SA 3ARPA 1UKQA 2G3JA 4GNVA 4S3GA 4QE5A 3TROA 4JFTA 3TR9A 1T41A 1BQGA 2OX1A 3TC6A 4PUUA 4Y9OA 4WHBA 1GEHA 4UTLA 3CV7A 4LCRA 3SQLA 1M01A 3CHDA 4LT9A 3B40A 4JCMA 4P8VA 2O7QA 3EKGA 3MZ2A 3O16A 4ROQA 1BF2A 1FWFC 1TPH1 3SCNA 1M53A 3SCOA 2V5BA 4CQCA 2XIJA 3U2EA 3VKAA 1GG0A 2WMJA 3QC0A 2OFJA 2Q3OA 3OVGA 1K9EA 3QEZA 1X39A 1NFGA 3G6LA 4N02A 4K3ZA 1UKPA 4B3ZA 5JIWA 4PN2A 4ZE4A 4E3TA 1J0IA 3AZTA 1B3YA 4XBKA 3SADA 4G7EA 3IVTA 2ZTJA 3JZEA 1U1JA 3N29A 4ATDA 4NX5A 3LLFA 4AZBA 1R3RA 4Q4QA 3UVIA 3KP0A 2J24A 3LEPA 1BYBA 3GRIA 1R3SA 3N9KA 2VEIA 3IJLA 2OX4A 3B03A 4XKMA 1JCNA 5AHIA 1Q6LA 2IQTA 2BY3A 1PZ3A 1VIWA 4JICA 4RZBA 4QIUA 1E3ZA 2QDDA 2DQXA 4GNKB 4PC8A 3SY8A 3QR1A 4B4HA 5AYZA 5J5RA 1ISXA 2BODX 3HURA 2R6OA 1CX9A 2VUYA 3G5EA 3ZJKA 3V1PA 1I1XA 2VGBA 2ZX5A 3QTPA 3N04A 1F9CA 4YS1A 3NQ7A 5EKYA 3ARVA 4UNIA 1US2A 1H50A 3DH7A 4KF1A 3VCCA 4Q7BA 1FDJA 1H1YA 3ZQ9A 1PWMA 3LCFA 1SW3A 2C8NA 1Z69A 1F6PA 3KL0A 3ZWSA 3ZT5A 1HX0A 1TV5A 2H9AA 5BOFA 1LZOA 1Y65A 3G1SA 1DEDA 4RE2A 4D6IA 1EOKA 3T81A 1CT5A 1KXVA 3AJ7A 3O05A 1GOKA 1OC5A 4XAZA 1W17A 1W3IA 3O3RA 3A22A 1UP2A 3NO5A 1Z42A 5DQPA 3VIJA 4A3UA 1TVNA 4WDWA 1MSSA 1PKNA 4JN7A 3AZSA 4PE8A 3L65A 4RZ5A 3P82A 4IQEA 3KS6A 3UNTA 3T0BA 1L8NA 3UU0A 3BZJA 3SFKA 5F1UA 2ZC1A 3GKFA 4YTSA 1UWIA 2FZ8A 3NG3A 2HXUA 1JCTA 3S8HA 1IT0A 4ZOAA 1VCGA 4J3SA 1KGWA 3EYPA 2Y4SA 3UA4A 4ZMGA 2CBIA 1J2WA 2OWXA 4AIEA 4MHBA 1SO4A 1JYWA 4DIAA 1K77A 1Q2RA 1NWSA 3BLIA 4Z2JA 2XHYA 2GDQA 1VZWA 4NYUA 4LC8A 1DHKA 3A13A 3ABZA 4NI3A 1FP8A 1AJZA 3N15A 3G2GA 1WOAA 4JTCA 4YVXA 3I4KA 4WJXA 3BGGA 4DWSD 4I8YA 4FLQA 2PEVA 4Q33A 4PEEA 2GOUA 3T05A 2B4GA 2J13A 3L7RA 2VGFA 4XVDA 5B7YA 1P1MA 5ECUA 3S83A 3EWYA 2PC4A 4MJZA 3W00A 3ES8A 2WJDA 3WQCA 2V2DA 2WZTA 1Z48A 4BHYA 3QLDA 3Q4DA 4V28A 3ABSA 3C56A 3W6LA 1P0BA 1T7LA 3LOTA 3SN1A 3NL3A 3UG8A 3WBYA 7PTDA 4K7VA 5CZ0A 2ZICA 1XCXA 5E0CA 3WUEA 4IIDA 4Z1CA 1JF5A 1A5NC 4LCSA 1XYMA 3ISIX 1P6WA 1IXQA 1TE6A 4KERA 4QJ4B 4QXIA 5LHEA 4Q32A 3W23A 1GZ1A 2XM1A 4F0RA 3QF0A 2IQ0A 2VCCA 2I16A 3GU9A 4W7UA 4NJKA 4EXAA 1UD2A 1UBPC 2W27A 4PMYA 8CGTA 5FJPA 5E09A 1IR1A 1YTKA 3WX7A 3D0CA 1UB3A 4QLLA 3UWZA 2G5WA 5AHMA 1HL2A 4GUFA 2GSHA 1B3WA 3DG6A 2OODA 1DV7A 2PU0A 4PMNA 1LUCB 4PBGA 2XVGA 1FHLA 1XPGA 1LT7A 4YLWA 3BAKA 6XIMA 3LHUA 3V35A 1S2TA 4UOZA 1IT7A 1ZFJA 4JOMA 4K1WA 4G2DA 1W56A 2XZ9A 3CGTA 1EUNA 4M80A 1GW9A 5BWAA 5DCDA 4MSSA 4DJFA 3KEHA 1P4CA 2E5CA 3LXBA 1K4GA 5I3DA 2BDQA 2A3LA 5EYWA 1B30A 3W6YA 2OG9A 3MB9A 4Q8NA 1YTDA 5F2MA 4PYSA 3ABXA 1VRDA 2RDTA 1LL4A 1MXSA 3MP5A 5E5CA 3UWUA 2C13A 3VAVA 2G97A 4QJ5B 1WX0A 1V79A 5F4XA 9XIAA 1OK6A 1RD6A 4AVFA 4J2MA 3HG2A 4ZENA 4ZOBA 5E6ZA 4GPNA 3W7MA 1DP0A 1EDQA 5TQLA 1VQTA 2DSWA 3TP4A 4S3KA 2MUCA 3ZM8A 3R11A 5DY3A 3BLKA 1S2CA 4JQ2A 5BXRA 1M7JA 1UOKA 3QQ1A 4UQAA 3URNA 3VPLA 1TE1A 3NQDA 2EBNA 1OFOA 2Y7EA 1KLZA 4I5XA 3LXCA 3IAPA 1TPFA 3LM3A 4ZCWA 1OBAA 4KEUA 4UTWC 2V6AA 4PUNA 4PRTA 3ME3A 1UC5A 5FJIA 5DX7A 5KZMA 3KWXA 1MI3A 4JTJA 3SN4A 4JX5A 2FYMA 3DC8A 1FHDA 3QY7A 4X61A 2Y85A 2PDGA 4O10A 2PRHA 2JKEA 3DIPA 1XYLA 1Y5XA 1DIDA 1CYGA 1SMAA 3BW4A 1Z3NA 2FH8A 5C2GA 1E6PA 3GKAA 1DTNA 4JTFA 4KS0A 3ARQA 3F2BA 1YLVA 4B5WA 3H23A 5LSMA 5CPOA 2QCCA 2A1YA 3C2EA 5HXMA 1CXEA 3UG4A 3PPHA 4L6DA 2XWEA 4GE8A 1KTCA 2CEQA 4ICNA 3VUPA 1VEOA 3R7MA 5LIYX 1FRBA 4WDUA 2W66A 5K4ZA 1EJXC 3WENA 3QLLA 1RP8A 2QMKA 1UMLA 3G18A 4XAGA 4J27A 2EPHA 4G7FA 5CXPA 1HXJA 1J0YA 1JFXA 4PB3A 1JDCA 2Z4GA 3GTXA 3VD3A 1WDRA 3RX2A 1A3WA 1OC6A 2YL5A 2PDPA 4OTKA 1GKRA 1W1B1 2OWCA 2BV9A 1Y5VA 4L6HA 6XIAA 3SAZA 2HK0A 3B06A 4HZ7A 3CEPA 2OKTA 3H6OA 4MFEA 4KESA 3BVJA 4C6OA 3A9BA 4XO7A 4PMJA 1PCWA 4TMCA 1O95A 2YR1A 2W9MA 3GR7A 2VFDA 3F5LA 2XSAA 1IXNA 2ASHA 1G94A 2Y5SA 3U0HA 3TSBA 2JEQA 5D9PA 2BVTA 2ZRUA 4PMUA 1JYXA 5EMJA 3ZR5A 3RO6A 2ZRWA 1JUEA 3VKKA 2GGIA 4LU0A 1I6NA 1WZMA 2DIKA 3SUUA 1VHNA 5CPNA 2I1OA 2PP3A 3M5ZA 1LQ2A 1TR1A 3AYRA 1HL8A 4JQ3A 3SY1A 3UYIA 2Y1HA 3NJ3A 4TUFA 2TMDA 3KVLA 1FOBA 1XLHA 4XIAA 3PZIA 4Y8EA 1F6KA 3O7UA 4NT0A 3V18A 4PTMA 2O9OA 3W81A 1AL8A 1W5NA 5A8MA 1DQXA 3M4HA 3DG3A 4M7TA 5FF3A 1I9CB 3ARUA 3SRFA 1OG6A 4K38A 3WF3A 1LBLA 1NIUA 3WDIA 1GONA 3DZ1A 3EOUA 3WJXA 5C2XA 3WF4A 1WOBA 2BY0A 1AH4A 5LGZA 1E40A 3W2KA 4U10A 1R3QA 3OGVA 4OWGA 3USZA 3VFLA 2P0OA 2V63A 1I1WA 2ZZ6A 1V08A 2YL6A 3NYZA 1K4HA 3PSWA 1BWLA 4F66A 5HATA 3E2VA 4EX4A 5BXPA 5I2UA 3UQNA 1SJBA 2VOMA 1QXLA 2P10A 4FF7A 3J7HA 3L2MA 5C9XA 3N12A 1SVDA 3QZEA 5CC7A 1FKWA 1PIFA 5BCAA 5E6YA 4Q4KA 4FOUA 2YCLA 4IF2A 4FEZA 4YHEA 2R1MA 3WLMA 1F07A 1OFQA 1RPXA 4JTUA 1OCJA 3ABRA 4J1OA 3GDMA 1RLCL 3EBVA 4PULA 3M46A 3LUTA 3EB4A 5D04C 2R9RA 1EDGA 3AS1A 4UB9A 4KFOA 3CTLA 2WKGA 4EKJA 4MJ4A 3FSTA 5J5DA 1YPFA 3OGSA 4U2YA 3TAOA 3H12A 1VR6A 3KDOA 4XKYA 3PBUA 2Q6ZA 2QJNA 3WK2A 1UZ4A 1WDWA 3N19B 1ONEA 4AIUA 4R3UA 4PGLA 1P6CA 5CGQA 2ZFAA 1JD9A 4UZUA 2GQAA 5T91A 1DWFM 2XIMA 1RHCA 3G1VA 4U28A 2NQLA 2V68A 1RBLA 2JE8A 2Y8VA 4LALA 1QW7A 1P7TA 2QGHA 4GHRA 3L9CA 3HMCA 2UZ9A 5CH9A 1C90A 3LYEA 4Q8VA 1FWTA 4MB4A 3W71A 4RJEA 1A5SA 1OYBA 4GFIA 2P8CA 1UUOA 4W93A 1NEYA 5BXSA 4QCEA 3WF2A 3NFUA 4KQNA 2IQDA 3KVJA 3URQA 1HP4A 4S39A 1YW1A 4E3VA 4K1GA 1LOLA 3S1WA 1JAEA 2ZWYA 5HANA 1OX4A 2D2OA 2VGIA 2WMHA 3OHIA 3QJAA 4HPXA 4WKFA 1CENA 4GQQA 3GDRA 2VKZG 4Q4RA 2PDNA 3ZJ6A 3FA3A 1U1HA 1U5HA 1LRNA 5FSDC 3S0CA 3FY1A 4JHZA 2PBOA 3AS3A 2J7BA 3RPTA 3K1DA 4A4AA 3O1NA 5F7UA 3NEVA 4LS2A 4EXQA 3GE7A 1MW0A 2I5QA 1O4UA 3NSMA 3CO4A 3KP1A 1RCQA 3PZTA 1W91A 4Q4PA 5J8LA 5GNZA 3VZXA 5B80A 4JQ4A 3N9SA 1OG0A 3S42A 5CG7A 3WNLA 3UXLA 2VO5A 4JNYA 5FOOA 4Q8QA 4DJEC 4QM1A 5M2FX 2J7FA 2QV4A 2FZ9A 1JPMA 3GZAA 1EUAA 4O1AA 1KC7A 4MYAA 4WX2A 2CZDA 4GKTA 1E0XA 4E38A 4D6JA 5G2WA 1XDLA 2QVNA 1RY0A 3BAYA 4O13A 5HULA 1EIXA 3MY9A 5LIWX 1UR1A 5A6JA 3SRHA 1GYMA 1RCOB 3GR4A 3TTYA 1F8MA 3W7OA 4US6A 5EBUA 2G41A 4NRRA 5FACA 4GXPA 3FJNA 3ZYZA 2VWTA 4DXKA 4IGNA 1Z41A 2BXZA 1W9BM 2V5DA 3HM7A 4O53A 1ZBWA 3WBWA 3LI0A 4KIRA 5BZAA 3GC2A 1NDWA 4QISA 4B5SA 4Y2WA 2X0HA 6PTDA 4ZODA 3RRAA 1CB2A 3IJIA 3B0YA 4GGBA 4UQCA 3N6QA 4CD7A 3CASA 2J47A 5EGRA 3U5UA 1PDYA 2PWVA 3FX4A 1SYTA 4FA3A 3VIMA 2Y62A 1UR0A 1FH8A 4JFSA 1Q13A 2PF8A 4HOZA 1YPIA 1MXGA 4IZGA 3UWVA 2HDJA 3EDFA 1VAHA 2ALDA 4ATWA 1EA0A 3QV8A 5TBOA 2XDFA 4EANA 3N17A 4IQDA 2ZA1A 1E6RA 1UUQA 2NV2A 2CKSA 3PZVA 3W37A 1JL8A 1Y7VA 3DX5A 2Z1SA 4R7WA 3B8IA 4EVZA 2HTMA 3SJNA 3AS2A 4Z0SA 1TFVA 4QCFA 1SO3A 1XLFA 4YIWA 4DJFD 4BK9A 4AWUA 1UWRA 1E51A 4L80A 1EEPA 4A8IA 1TG7A 3GB6A 4QFUA 2W63A 2PA6A 4F9DA 3AROA 2G3MA 3RILA 2NZLA 3DFHA 4Q8UA 2A3BA 2XU2A 5A1AA 4PUWA 4IGHA 3GDKA 1WQ5A 4E8CA 4MWAB 3SO7A 3W88A 2W5FA 2A85A 4NKCA 3W1AA 1RVKA 5I5RA 4QG8A 4NJJA 2XM2A 5CBBA 3HPZA 4UCGA 1JQVA 1NH6A 4S3AA 5DMNA 2WXDM 2WSKA 7XIMA 1EJ7L 2JK2A 1VIZA 4H9VA 4D2JA 3C2YA 4W8LA 3H8AA 3G8EA 3VE9A 1TPWA 4NZFA 4MPQA 4FXRA 4LXFA 1PIGA 1NOUA 3HG4A 3N34A 5HBFA 3VU2A 1GTEA 4N6FA 1H1ZA 2ZVRA 4PBFA 1N8IA 3EX2A 4X3ZA 1PDZA 1FWJC 2DW6A 2OSXA 2DZTA 3VGHA 2W3ZA 1BSIA 4BS0A 1KKOA 4V1YA 1V7YA 1JUKA 4PRRA 3QFEA 3O6DA 3TYDA 2CHOA 5K9CA 4QNWA 1W1TA 4S3EA 3QYQA 2UV8G 2O56A 3K2GA 4ES4A 2QCDB 3LZ3A 2FB2A 5C5YA 5CGMA 2O7SA 2ZADA 1FP9A 3TK7A 1K02A 2WJFA 1MNSA 5T9BG 3TCEA 4Q8PA 2VFGA 4ZEPA 3EKZA 1ZSXA 1NJJA 1XBYA 5DF0A 1YNYA 2W6RA 4HA0A 3FXYA 1S3HA 3TA6A 3PUGA 5HQLA 3P93A 4UTWA 5GQBA 3UG3A 3FKKA 4HB7A 4UOJA 2O4QA 3BG9A 3PC0A 1CEOA 1KWKA 5E0KA 5DBUA 1TJ2A 3FV9A 2DZBA 1OZQA 2XSBA 3WEOA 5M03A 1R3WA 4N9EA 1S2VA 2E67A 3LRKA 2YA0A 1NU5A 4ASTA 2ZVIA 3VKCA 3PP7A 3GNNA 3QY8A 4H6EA 5H1WA 4M82A 2ISDA 4H2CA 3HPXA 4W85A 4BR1A 3LA4A 4HHMA 2HRWA 2FIQA 2RDWA 2GDVA 1ZJHA 1I0DA 3N2TA 1M68A 2ZZ2A 3GR8A 4LX4A 2D2HA 3A47A 4FNRA 5G2HA 4HCDA 3L4ZA 1PVNA 3OEXA 1PTAA 2BGQA 2CLFA 2IKIA 3PAJA 4PCNA 3WDJA 2NWSA 4PBEA 2VZSA 2JBMA 1ZBKA 4DVOA 1XYCA 4KWVA 1C7SA 3CJPA 1HO1A 4LS0A 3WEZA 3EMCA 2HZGA 4FLOA 4DN1A 3FDKA 1YDVA 2W92A 3EGJA 4M1RA 1XIEA 5DO8A 3KDNA 2BG5A 2F6XA 1HKKA 2P3EA 2JF7A 1E9LA 3P74A 3BLOA 1M7PA 5HWNA 3T1GA 2AMXA 2NQJA 4FOJA 3HO8A 4FXFA 5A95A 1FWIC 4FF5A 1X98A 3GHTA 3TA9A 5XIMA 3WQWA 4EOUA 4DAFA 4O16A 3LNMA 4S2CA 4DAIA 5A94A 1DJIA 3RRXA 2ISSA 2AL2B 3NPXA 1BAGA 3THCA 5CCZA 2J7EA 4MNMA 4RXGA 1SFLA 2WJEA 2BX7A 3A4AA 5T9CE 3LRLA 1XICA 4RW5A 1EP2A 2XYLA 3VOIA 4ADUA 3O6CA 1CI1A 3N18A 4MKVA 5BMWA 1I60A 3PJUA 1OHLA 3B3DA 5IFTA 3F4WA 5H2ZA 2EPLX 1CCWB 4DY1A 2QCHA 4XZWA 4FNSA 3WUGA 2FJKA 3IAQA 3HU7A 1OF8A 2O4MA 2YOCA 2YB4A 3WLSA 4E2VA 3UJ2A 4KETA 1WZAA 3G24A 3QVQA 4Q22A 4A35A 3V5FA 2ZX9A 4QAWA 4XD4A 1SFJA 1DIKA 1KR1A 3WD0A 2C7FA 3W2UA 5C9WA 1UWQA 1C9DA 3D47A 4G9PA 3QRHA 1KCKA 3DFTA 4ZA0A 3W1MA 3GTNA 3WH6A 1NQKA 2QAPA 2X7VA 1Q5MA 4IJCA 3GU2A 3Q37A 4JTTA 1LROA 1B57A 2HE8A 4HMEA 1Q6RA 1UUMA 3A64A 5I79A 1W3NA 1KRMA 3KHJA 4C7FA 3QGAC 2FFIA 5FF2A 3DGBA 3L4TA 1K3UA 1NF7A 3TJ4A 2QCFA 1R2RA 5AECA 4R5EA 4IM4A 4P7LA 4MWAC 3W7RA 3L5MA 3IUDA 1UP0A 5EY5A 3SRDA 1BPLB 2WKJA 3AXKA 4UMCA 1G69A 5BXTA 2QDGA 1JULA 4H2HA 4RLIA 4LUSB 4Z2KA 1Z9AA 3REQB 4PSPA 1JUBA 2WJZA 9CGTA 2Z2BA 3OLEA 1AL7A 4MY9A 2VFFA 3LV5A 1J5TA 1K8XA 2E6YA 1EPVA 4UQDA 3PZNA 4UOQA 3GYCA 1S46A 1HTIA 1WNOA 3S3GA 5K7JA 2OYMA 3DN5A 2HBXA 1MQPA 4OHQA 4WY0B 1JZ2A 1QT1A 3L5AA 1OQFA 5FL1A 4Q4MA 3WLHA 2HJPA 5I24A 5DELA 3RLHA 5IXEA 3RM4A 1Y0EA 3HN3A 5ABFB 4WLCA 1KKRA 1QR7A 2QZRA 1K7XA 3G3DA 3P7YA 3PSVA 1XFCA 4HN4A 3W7GA 3BG5A 5REQB 5U7SA 3F5JA 4POCA 1TPVA 5HQEA 4ADSA 3NZQA 4LUYA 3OQ8A 3VDBA 3M47A 1F76A 1GZGA 1J79A 5KITA 2HROA 4RV3A 2CLLA 3W85A 3AXHA 1LLZA 2YXOA 1M7XA 1PPIA 4IJRA 4B2DA 3IK2A 1GJUA 1QPRA 4XIMA 2ZYFA 5HQMA 2Z1WA 4OIFA 3VDCA 2FVMA 4R9XA 3KOZA 4CKQA 3W53A 2JGYA 3PS7A 5EFDA 3D46A 4MADA 3AHZA 1NP2A 5AHLA 3KBSA 3WD2A 4A6GA 3W07A 3H7VA 4N7QA 2YDRA 3KAOA 3VD9A 2YCEA 4JYDA 1CPUA 1QHPA 3B8TA 3KRUA 1KRCC 1S5NA 5DFAA 2J7GA 3L67A 2CHRA 3CTTA 2DJLA 1Q7QA 3G22A 1T5AA 4GG9A 2E40A 3PZMA 5E70A 3DU0A 2UBPC 1BGAA 3P6LA 1E6XM 3W6MA 2ZUUA 3OIXA 1VLIA 1XINA 4DZAA 1KTNA 4U4MA 4AQLA 3R10A 3FXGA 1D3GA 2OWWA 4REQA 2DVUA 5C9RA 2GJXB 4K8EA 3VOCA 3WFAA 4WR3A 3U57A 2ZRVA 3S6DA 4DJEA 3ANYA 3VGDA 2I14A 1FBAA 4BI7A 3LMYA 3UJRA 2GK1A 4R27A 1UD4A 2REQB 4Q8TA 2FZNA 3ZMRA 3URAA 2GDUA 4QGCA 1GOQA 4AH7A 1M04A 3KBJA 1CXFA 2PTXA 3SGUA 4IG2B 4XG1A 1SZGA 2VOTA 4QSFA 1UD6A 5EBAA 4OZOA 1KFBA 2IW0A 3O6AA 2VDGA 5GNXA 3POCA 1SSGA 1JZ6A 2WPBA 5ABGA 1QNSA 2HVNA 4ZTXA 5GNYA 5HR7A 1THFD 3ARTA 4OOUA 1HQTA 3EKLA 1OX6A 3M5VA 3V75A 1FFRA 4KWOA 4A05A 2BOFX 2V67A 2WBGA 4GJJA 3CAKA 4LUTA 4N42A 1ALDA 2QLYA 4W5UA 3PTKA 3G3MA 3B9DA 2YL8A 3K13A 1QRQA 2XSXA 1IWBA 2Y89A 2Y88A 5LIKX 1XYZA 2E5BA 1HIZA 4NI8A 3RU6A 4UMAA 3EWBX 3E1F1 1AODA 2VR5A 3V0SA 4C6LA 5AKQA 1FCVA 1DOSA 2V5JA 3CZJA 1E1CB 2F6KA 3GW3A 1NDZA 3WMSA 2DT2A 1PKLA 3JR2A 4D8ZA 3HJZA 4EF9A 3NURA 1HKMA 4GJIA 1F2JA 3BURA 2CXGA 3TZFA 2ADAA 4ZOCA 2J8TA 2PTDA 5G4EA 2XFYA 3ALFA 3SUSA 4MZ1A 1T99A 5EPDA 4OECA 4DWSC 4S3DA 3RDKA 5MHBA 1TQJA 1UZDA 3QHOA 3RM9A 3VIIA 2ZCGA 3HTWA 4FI4A 3TNBA 2JIWA 4E6MA 1XIBA 3W28A 1L2QA 4MTVA 2YIHA 4M0XA 4XUGA 1TJ0A 4LVBA 4KCTA 5K3VA 1XS2A 1ZJBA 1KBKA 4HZ6A 3BUVA 4HPHA 3NCOA 3TXVA 3F4NA 3MWAA 4RDWA 4QR6A 4UTKA 3ES7A 1M5WA 3AYVA 3QV6A 5M17A 1MQRA 1YPXA 3F7JA 1WKYA 2NVDA 4A3RA 2QPUA 1GHRA 3PPCA 4AYGA 5A8NA 3VYLA 5CLWA 2ANUA 3CQIA 3KOWA 4WRHA 3VMNA 3WQEA 2HWGA 4EAMA 1ZP4A 4IH3A 3V36A 7TIMA 4RDVA 1KQZA 3QMSA 3MDWA 1YNPA 3DECA 4KRTA 1FXPA 4AD2A 3UESA 4BQ3A 4Q6XA 1MUCA 1C7TA 3AMGA 5SWUA 5M5DA 2EPMX 3P60A 2DUZA 3L0NA 2QUUA 2XFRA 1OD8A 2X7WA 1E70M 1QOPA 3LSBA 3MU7A 4LTSA 1O5XA 3QYSA 2O92A 2PMQA 5EA9A 3IV3A 3EMQA 1EEXA 2YA1A 3EXSA 1BQCA 4RX0A 3RXZA 1NM9A 4ERIA 2B7PA 4J3TA 4LNCA 4W87A 3WK3A 3KVMA 4NAEB 5FIPA 2VJXA 3A5FA 3LCLA 4KEVA 2JFEX 2FZDA 1KGXA 4QJ1A 2CKRA 3SSJA 4I9TA 4EWND 3L68A 3ZO9A 4NJHA 3GM8A 2WCAA 5CG0A 1GWJA 2C0AA 4KT2A 2BB0A 4I5UA 1W9XA 3L2IA 1GVSA 3HGRA 4J2PA 1GTHA 5G4WA 1XHGA 4M1BA 1UKSA 3MMUA 2ZZ7A 4HA3A 3BSGA 4H83A 4BQ4A 4UWMA 4WZHA 1JVNA 3S6TA 4UUIA 3N2CA 4QDMA 2MANA 1V5XA 1IZCA 4AZCB 4IUOA 5DT5A 3I3DA 3W2LA 4HP5A 2B0MA 2WCSA 3ABQA 3KX6A 4KWUA 4KFPA 3M43A 3S4TA 3STFA 1S1PA 3T2PA 4BWLC 2V2CA 2VC5A 2RFGA 3CK5A 3TTSA 1U5VA 1Z6KA 1LG1A 3HQOA 2RJHA 4AHOA 3FW6A 4DYEA 1ZJAA 1XLJA 5A2CA 2PU1A 2DZUA 1BXNA 2V3GA 1NWUA 3V0TA 4PCTA 1Z44A 3B04A 2ZXBA 1Z32X 3CUFA 2ZRYA 3LCIA 1YMYA 4KBXA 3S2MA 2QT3A 4YXGA 3WQFA 1VC4A 4YHGA 1TTJA 1OM0A 3GNOA 2WB5A 4YNGA 1L6FA 3AS0A 3ZIZA 4CEXC 3GY1A 2PRMA 4O1DA 1E55A 4DPQA 2VD8A 1JZ8A 1GVIA 1LRQA 2FHCA 2FTWA 3VABA 1AG1O 1Q8AA 2OGJA 2DZAA 1PWLA 2A4AA 2J27A 1RP9A 3R12A 2DSVA 3VNDA 4FLRA 1LQAA 2NXHA 3M64A 3SCTA 2BZNA 4GUIA 2YA2A 3QBUA 4O1BA 4UR9A 2Z1XA 1NELA 4HU0A 3ZJ7A 1FDZA 1Q85A 1L8PA 2WZIA 2R94A 4UQBA 5A8GA 2Y6ZA 3KLKA 4DJDC 3LTSA 4EF8A 3ZSSA 3GNDA 3OGRA 1VYSX 4LEFA 4M6UA 4HBKA 3FEMA 1EX5A 2PWDA 1BRLB 1JAKA 1E3XA 4HOXA 1Q4WA 4AC1X 1GOIA 1V6VA 3ITVA 1ZALA 1F73A 1R30A 1S2UA 3WQVA 3TYZA 3W4RA 1F6YA 1I2QA 3STCA 3TQVA 3EOLA 2QEZA 3B9EA 4ORMA 2NUWA 3W70A 1DVJA 5F1VA 4XD6A 4ZSTA 3NAVA 4JHMA 4DO4A 3GVWA 4A22A 4DM1A 4NAFB 2IXUA 1B2YA 3EPOA 3SFWA 5LIUX 3QW4B 1DL3A 4XV0A 4H01A 3SCQA 3WUFA 5FAGA 3WL0A 4D71A 1H3GA 2INEA 1OINA 3BLEA 1PCKA 4DF1A 2OSYA 5CPTA 3FCPA 1GYLA 3MSYA 1YX1A 1DHPA 2I9EA 1K8YA 1KA9F 1LT8A 3W7QA 4Y9MA 3AICA 3LM7A 1BVNP 3FGCB 4DXVA 1US3A 2BP1A 4HZ8A 4MWAA 1ZLPA 3VILA 4N9BA 4B9ZA 3W0KA 1V6YA 4XB3A 2WWDA 1A5KC 3BQ5A 3U2CA 1LTDA 3TE9A 1W6TA 4QS6A 4ADTA 1BKSA 7ENLA 2XN1A 2IXVA 4Y6GA 3O06A 2ABAA 3LQLA 3EX3A 1ML1A 4LYQA 1F4AA 3BGAA 2RUSA 1XRTA 2PGWA 3MV01 2D0HA 4J3UA 3QOMA 1EZ2A 2VUNA 2XG9A 2OZ0A 4IPPA 1A5UA 1AMYA 4F2UA 3MUY1 5DY2A 2E09A 3CQ0A 1YBQB 1VFLA 3N3MA 4QE1A 1UIPA 3TFXA 3TTOA 4LBUA 3TEVA 2R24A 4O57A 2PD5A 2CERA 4C65A 1VLWA 1XGDA 3QTGA 3B8SA 3OG3A 2HV5A 3BTNA 4DO5A 1XYBA 3CAQA 3I7RA 1GW1A 4X2RA 4AZHA 1Q8JA 4DHGA 4MZ8A 3O0FA 2A3AA 3II1A 1KCLA 3GNPA 1HFBA 2X30A 3P80A 1DPMA 3LQGA 3LV6A 1H51A 4HK5A 5CJMA 4W4QA 4HZMA 3CT2A 1TV3A 2QCDA 7ODCA 1G5AA 1GVYA 4Q4OA 3K8KA 3CWNA 3XISA 1B3OA 2VRKA 1TWSA 2P3ZA 2WHJA 4HYRA 2D3LA 1XD0A 4IIFA 4C6JA 4LVFA 1W1PA 2XVNA 4KH2A 5CPQA 5FEZA 3OB8A 1WUFA 2EQDA 4GYFA 1F4HA 4AHPA 2VD9A 1EQPA 4QSHA 4DJED 2Q02A 2XGIA 3UD6A 3LBMA 2OELA 4L6OA 4RUBA 4RCXA 5G1TA 4AY1A 2X1SA 4PEKA 1G1YA 4CU8A 4G8TA 4DO7A 2WZEA 6TAAA 4AEFA 3MBFA 2FTYA 3DFYA 2OEMA 2WLZA 1AZ1A 1CXKA 3LI1A 4QAIA 1UHVA 4ZB2A 3AWOA 4R9OA 3ARYA 3W38A 3H2NA 3WLQA 2VRQA 1YEYA 1TTQA 4F9JA 3T07A 3MVIA 4ZSUA 4YN5A 1XL9A 3EOSA 1B3XA 4CCZA 4H6QA 1P48A 3NL2A 5I3HA 5AYYA 1B1YA 1I2NA 5EMLA 4N4QA 3T8LA 1REQB 3WUBA 2QDEA 3U2OA 4GO8A 1TMHA 4XAPA 2BSLA 3IGHX 4US5D 1O5KA 2GUUA 5CC5A 3LPOA 2V30A 1DQUA 3M6YA 3ZS4A 2IKGA 4FX7A 1ZGDA 3E0LA 3W24A 5EMUA 2VM8A 2WNQA 3S1GA 1G9HA 3KTCA 1BTMA 1E9YB 5CJ5A 3KE0A 2ACUA 2RKXA 2OO0A 5FF4A 3QFWA 5AYBA 3GVQA 4JXCA 2Q8LA 3H2OA 4HSNA 2PPGA 3SI9A 3DBNA 4EAYA 1M41A 4YVVA 1EA9C 3DI1A 5I3JA 1Q45A 2IPFA 5G2IA 1G67A 1LORA 3SSZA 3TZNA 5CJNA 3CB8A 1AW1A 3EDDA 4JTSA 4M24A 3WD1A 1V3IA 4CNUA 1XX1A 2NXIA 5FCZA 1BG4A 1TCMA 3CQKA 5EB8A 1Q6FA 2AL2A 1XH2A 3UPMA 3MSRA 5CPLA 3T55A 4CEUC 4CN6A 3W7CA 1J96A 3U48A 3WQDA 1H0GA 2OQLA 1V6WA 3UR8A 3NZGA 4DO6A 4RKAA 5FSEC 3DDMA 5C54A 3ORWA 4E8DA 1LG2A 3UZYA 4C6EA 1AJ0A 2Q3RA 1J9YA 3MJYA 3UGRA 7CGTA 3UCQA 1P1XA 3RCNA 3W7HA 4LAZA 3W74A 1G6CA 4DBSA 4GMEA 1GPWA 2NVAA 2FZBA 4FZIA 1HF6A 3W1LA 8TIMA 4UFMA 2JGQA 4ZO8A 4GWEA 1AQHA 1OX5A 3FIGA 1E43A 3KHDA 2H6RA 2SFPA 4H7CA 5BOOA 4JTKA 2G4JA 1PX4A 3VIGA 4DWSA 1R3VA 3EPNA 2A6LA 1J0JA 2XH7A 2NT1A 4Y96A 3ZLGA 1K1DA 2GGJA 1QOQA 1XLIA 1ZCCA 2GVYA 3RX3A 1VEPA 3I3EA 1DJXA 4ACZB 4Q8MA 4IIEA 1SZFA 3W72A 3WK1A 3ZLHA 2GYIA 1JPIA 3PB0A 3VD7A 2QW5A 3G1RA 4PMXA 1KM6A 1FXQA 1BWKA 4NXKA 1EH9A 4Z2GA 3CHEA 4TMBA 3FYYA 4LNYA 1WDDA 5F2GA 1A5OC 4OU1A 3KM8A 1UMYA 4O50A 4L64A 1EZWA 3SCSA 1W3KA 3CB3A 1T96A 1QDSA 3EWCA 1EF2A 1WXYA 5ENLA 4LUSA 3REQA 4H1ZA 1B9ZA 3GTFA 1XIGA 4CNOA 4M5PA 2ACQA 1J0KA 3W7PA 3AMLA 2FKPA 5TF0A 3BCFA 3AXIA 1FWDC 1WKDA 3LPFA 1QCWA 5HPOA 2JF6A 2J7HA 2WWCA 1X6UA 3TX9A 2ISWA 4WY0A 1MYRA 3WLOA 4H7ZA 3GXIA 3MKKA 3UY8A 2XGZA 2E1WA 3M0YA 4NQ1A 3W7IA 1PIIA 4ZQMA 4B90A 1GT8A 3WMLA 3Q2DA 5DCBA 2WZHA 2NV9A 1GYNA 1IR2A 3AMKA 4HA4A 4GYPC 1YKWA 2OQHA 4M7SA 3HGJA 1SQ7A 2MNRA 1XXXA 3KWSA 4D6GA 4JIRA 4AD0A 4ONVA 3AQUA 4FXSA 3HBLA 3W26A 1WCGA 4QDPA 1A3XA 1SJCA 3LPGA 3NVDA 3UXIA 3TDFA 1LCOA 4BF7A 3O07A 1R87A 1ZP3A 2X09A 3TW6A 1MRAA 1VH7A 2Y63A 3NZPA 3DAQA 2QUTA 5F2LA 1UD8A 7TAAA 4BFAA 4AZ5A 3DYPA 3LS9A 1JCYA 1SPQA 2GQ9A 4PA8A 4N4PA 4H9ZA 5CZTA 4MAZA 1EC7A 3WLRA 2J7CA 3FAWA 2QPXA 3M5YA 4TQTA 5BRQA 3UZJA 3E2SA 3QV9A 1OGSA 4DELA 3U3HA 2JQXA 1SGJA 2YCJA 1ZBVA 3E96A 3HFYA 3BJFA 1LF1A 3U5YA 3AXMA 2VNCA 3BSHA 1CB7B 4BWLA 4EPBC 3VE7A 5HMFA 2TPSA 2YYTA 1CGUA 3NQ2A 3AHYA 3GXFA 2QGYA 3KRSA 3F2DA 5C7VA 3VGEA 4TVCA 4IGSA 1XYFA 3CZ8A 3SQSA 3MV11 3GXDA 2V8ZA 4BF5A 2GJXA 4NZJA 4NF7A 3TFCA 1HKIA 3CHFA 4AF0B 2OMAA 1S39A 1BD0A 1B5TA 3GLCA 4B3LA 4GABA 2C14A 4Q8OA 4DUOA 1JZ4A 3RX4A 3NQBA 2E9BA 3VIOA 3R43A 2VYOA 2YXGA 1JXJA 3R6IA 4GFSA 3NQCA 2REQA 3PTDA 2XVKA 4HMNA 3W84A 1HKJA 4W84A 3DESA 1RZMA 3VC5A 1VGAA 3VA8A 1WZLA 1ZNNA 2Z6JA 2XH0A 5IHRA 1ICQA 3CPRA 4HPJA 3TYAA 2C15A 4ENLA 1W3LA 1KFLA 3TOYA 3UW6A 1S2WA 4O0ZA 3PNUA 3LTYA 1S5WA 5DANA 3S5ZA 3GVRA 3R13A 1A5MC 2EPKX 1GOMA 4QRNA 1XC6A 2GZXA 1JDEA 4EXBA 3C61A 4O54A 5KSWA 1OC7A 3QZ6A 3TONA 1XLKA 1SW0A 4RK8A 5HPCA 1CZ1A 4DJDA 3IGUA 3M0IA 4RDZA 3STPA 1FY6A 4Q3MA 2P8BA 3WZ0E 3P2VA 4IIBA 5AZ0A 2GJLA 1ZCOA 4QITA 3WBXA 2ISFA 2WV8A 3NPUA 4JQ1A 1EP1A 1M03A 4XISA 3AAMA 4D6EA 2RGLA 4PMZA 1YTEA 4JTLA 2IPWA 4LRTA 1RXOB 3N2XA 1W1IE 3E2QA 2VDIA 4MWAD 3L4XA 1ITCA 3V0UA 3B9NA 4NYYA 3VOJA 4AEEA 3BH4A 4RNHA 2FLIA 3GU1A 1HJXA 3PN8A 4KCUA 3CAVA 3M0HA 4TO8A 3UYCA 4O0KA 2IPGA 2DH2A 4X0NA 1X1OA 2PLMA 1CGTA 5LXXA 3RMJA 3CU2A 4AWSA 3CAWA 1XCFA 4NU7A 2BASA 4S3FA 3QGVA 4Z2LA 1DJNA 4KGJA 2YKKA 3VXGA 4H04A 1WKEA 4X60A 2Z26A 1QI2A 4GQRA 3S5SA 4FIQA 1L2UA 4U3AA 3W7KA 4DWDA 4H8HA 3UP8A 3WDPP 3U9IA 3T40A 1R9YA 1K9DA 2JALA 4MB3A 3SBFA 4RE4A 2PWGA 3VNMA 2DT1A 1AFSA 1W1YA 3ARWA 1AD1A 2AL1A 1V3LA 4HMDA 4F0SA 4ZQCA 4H6KA 2XN0A 4XBJA 4MLRA 3C3UA 1VF8A 2HE5A 3B4UA 3ITLA 3TUUA 1UH4A 3MKCA 3N2MA 1CGWA 3C4UA 1WV2A 5AHNA 3R8GA 2E1DA 4GH3A 1HO4A 3H2MA 3M41A 4GUJA 4AXKA 2VR2A 4OOZA 5CBIA 1MW1A 2F8QA 1EJUC 2QNEA 2I57A 1KM3A 3DYMA 2C1GA 4LVDA 3MUAA 5E9XA 1PSCA 4A3QA 4ERGA 5PTDA 3ARZA 2YFOA 4GCAA 3GNRA 1VCFA 1OF6A 3I10A 3R2GA 4GY1A 3NSXA 4GH1A 1MUWA 1EJVC 1UA7A 3W7NA 4O4WA 4WDXA 4J5NA 5BU6A 2YDQA 4AWTA 2QUVA 3RLVA 4P7OA 4AIOA 3STEA 4HNVA 2QULA 3CZKA 4AVOA 1XIIA 3F2CA 4NAEA 4O14A 1C8QA 3SCWA 5A69A 5T26A 2G3NA 1C8VA 5HNTA 1FTXA 2CXEA 4B5TA 2VZOA 5BYWA 3DKLA 3ZOAA 3AUOA 3P14A 1E71M 1XGEA 2FH6A 2A3CA 2UY4A 4J3XA 4G7EB 4NX0A 5A3HA 4FLSA 1JI1A 1BYAA 3GDLA 2BVWA 3U8GA 3MUCA 1KFKA 1K8ZA 2E7FA 2O0TA 1PL9A 2G0WA 2FPTA 2OVLA 4K36A 2E0PA 2P1FA 1QTWA 4DUWA 1B4KA 4JYFA 3N13A 2Y8KA 2WM0A 1PUDA 5MKGA 1DKWA 3ITXA 1XF0A 4AZCA 5BU9A 4OBSA 4UFLA 1H09A 2QV5A 2FPVA 3T4CA 1MNZA 2OZTA 2E68A 4A3HA 1Y8BA 3PG9A 4ZVJA 5CGTA 4AISA 3BAIA 1E9ZB 4H6RA 2ZE3A 1LJYA 3W83A 4JL1A 3WEMA 1A4LA 2ZQ0A 3O2LA 2HS8A 2ZXAA 4IL2A 3PZ9A 1TELA 1ESWA 4ZXOA 4BQ5A 3PM6A 3T08A 3MTWA 3DC0A 4JPGA 5AOUA 3KCLA 3PUEA 3H2CA 3P5YA 1EJTC 1UROA 2Z1KA 3F5KA 3QPZA 4QNEA 3VKJA 5A6KA 3F4CA 2Z2UA 3IPWA 1BHGA 4C60A 1BXCA 3ANUA 5JVLA 1TTPA 4CD6A 2VC7A 3CL7A 4IXXA 1Q6EA 2H9AB 3IEBA 1L6GA 3TYEA 1E56A 4L4OA 1FUYA 1F5ZA 2AQVA 3VDHA 1ZL1A 3GTHA 2IMRA 3RPDA 5I06A 4P61A 4HSHA 1LWHA 5A6AA 3S1UA 5JU6A 5DCEA 2A21A 5HJXA 2GJRA 2C91A 1XRVA 2QCGA 1JD7A 2C16A 2PD9A 3KOFA 1MVYA 5JUVA 3KVKA 4IIHA 4FNQA 2VENA 2XIOA 4GVIA 2PC8A 1X7FA 4CU6A 1GVFA 2HBVA 4ROPA 3RPMA 2ZC8A 4PMOA 3TOPA 1Q7ZA 2QJHA 4OQVA 3RNDA 2VWSA 4GIEA 3QKEA 1JCLA 1CTNA 5GJPA 1YNQA 3LLDA 5AVNA 1H5VA 4MNKA 2EXOA 1G4TA 3I7QA 5AHEA 3W22A 2C79A 2WVVB 4HTYA 1U5JA 4A8RA 3GXPA 1QPNA 4PUKA 1UH3A 4MB1A 3OJGA 4GYKA 3VKDA 2QF8A 2G8ZA 3IARA 3NVTA 3LHWA 1OK4A 3GXNA 1TO3A 4HNLA 3ZJ8A 1PHQA 1TR9A 2D0GA 1ZQ5A 4X2PA 1ADOA 2D0FA 1D8CA 2E6DA 2PLCA 2BHZA 4FO4A 5BW6A 5BNKA 1TVLA 2EG6A 2VC9A 1JDFA 4NAFA 4CNPA 5IOBA 1UWUA 4JIHA 4AU0A 3C86A 3AYTA 3PJWA 3S2LA 5HAOA 1UR3M 2BVDA 1O12A 4R7OA 3PBGA 1M65A 4KRZA 3E0VA 3DI0A 5D2XA 1US0A 3SB0A 1A5CA 4DB7A 4C1NA 1SJAA 4GIRA 1QBBA 3STGA 1XFBA 4S3JA 4GIYA 3N4FA 4D8LA 3E5PA 2C71A 1JRCA 3GDTA 5DXYA 1XCWA 3Q65A 4G56A 2KX9A 4JAWA 3VVGA 2VVNA 4RPPA 2DT3A 3WNPA 4LVAA 3B9AA 2VVSA 1VPYA 3I3BA 5HUPA 4A8NA 1N8WA 4CUCA 2ATSA 5CSYA 5JH1A 2YCKX 5DT7A 4FHAA 2J8FA 4HJWA 1SZNA 1ICSA 2Z29A 3ZVHB 2BLEA 3SEPA 3LGGA 3WDRA 3LHZA 4I9MA 4E4UA 1GNXA 4LUIA 3CL8A 5FESA 1HKWA 2HVOA 1VFFA 3GBEA 4NJIA 2D1ZA 5HUOA 1LL6A 3OBEA 4WJ8A 4QJ3B 3AMCA 3FNDA 3CIXA 1AUSL 2PFHA 4IQJA 2J4GA 3VGGA 4LH8A 1NAL1 4AEOA 3KTXA 2VEPA 3EXRA 2X1UA 4NZ1A 1XSKA 3CUXA 1NWTA 1BLIA 2XIQA 3IWPA 1YBQA 2H8XA 5K9DA 2PWUA 1VBUA 3NXFA 3PWGA 3EWZA 4YTUA 6ENLA 3MT1A 4GYPA 4CLMA 4YWSA 3TJIA 3DG7A 4WSJA 3ERPA 1X6LA 3R0KA 2PWFA 1XBVA 3CMGA 3BAXA 3LBOA 4GQGA 3URBA 2ICSA 3H53A 4O18A 4U5IA 4K37A 4NNCA 3GH4A 1PKYA 1EF3A 4YTRA 3A4JA 4UTMA 1RY8A 2VTFA 4NSBA 2Y8UA 2XIBA 4Z2HA 2VHLA 1ADDA 1AW5A 1KQYA 5BRBA 4Z42C 3QN3A 2P5NA 1SFSA 4TX9A 3NO3A 3WLLA 2CC0A 2RJGA 3MI2A 4L1XA 4BQ2A 4DM2A 3A9IA 3XIMA 3CYJA 3PBWA 2C18A 3EDKA 5A6BD 1L9WA 3N2OA 1H49A 3ZR4A 1ZJIA 2X0SA 4NNBA 1VFMA 1LRTA 1H2JA 1HG3A 1Q63A 1V8EA 3T44A 4OUIA 1NVMA 4QE4A 4D1JA 4DQWA 4LY8A 4MYXA 3RR4A 4OUEA 1TV2A 1U30A 3W7LA 1OT1A 2ZZ5A 3UR7A 4NZ3A 4BF9A 4ZO7A 4CQ9A 1MDLA 2UY5A 3WNOA 3E6EA 3DHDA 4L61A 1XLBA 3W7EA 4LY4A 1QI3A 4K8GA 1R2SA 3OZMA 1GOOA 2NT0A 4Y90A 2WLYA 3OODA 3VNYA 1KV5A 2NQ9A 2HISA 3HPAA 3PG8A 5KMYA 1OT2A 2GGGA 1GVRA 4O1FA 4K2SA 1RV8A 4DJDD 2GOKA 4GINA 3TKFA 5K2ZA 2OYKA 2YPIA 1YXCA 2PTWA 5C55A 3TWBA 1QK0A 2XPKA 1GVEA 3FFSA 4JZ5A 3PBMA 1DYSA 5B7ZA 3WK0A 4PMDA 2QF7A 3WH7A 1BG9A 1CBGA 3B8UA 1BWVA 3E38A 3INPA 3OU8A 5M3WA 2OLAA 1GZJA 3C6CA 3CMJA 2QQ6A 1UKTA 4MVAA 4KW2A 3SN0A 1TRDA 3NDZA 2NLIA 5AYIA 3LU2A 3ZT6A 1HZYA 4GY7A 3R79A 1CLVA 5CC6A 1VB9A 3OPSA 1PZ0A 4PUMA 4A21A 1D3CA 3KXQA 1D2KA 3PZUA 3WQ4A 1KFWA 1TIWA 1OIMA 3WQOA 3UBPC 2HPMA 1DWJM 4EK7A 3KS5A 3W1TA 3SGGA 3FN9A 3B97A 2GJNA 3GFZA 1CGYA 4N9DA 1V3JA 3PFRA 3DBPA 4JIQA 3USBA 4ICCX 1RA5A 2PWHA 4GYJA 4V2XA 1C93A 3A24A 3C52A 1EQCA 4H7VA 1A0CA 3NQEA 5CKSA 4NG3A 1UPPA 4IT1A 1GOXA 4TTGA 4IXHA 3CT7A 2J8GA 3AXXA 4E8GA 4MM1A 3H2AA 4IPIA 1KBBA 2YW3A 3W87A 2TYSA 1QATA 4R34A 2YYUA 3EX4A 1DWAM 4IP4A 3PZOA 3PTQA 8A3HA 3CNYA 1KCZA 2CNCA 2W61A 1JEZA 1O68A 3WFLA 1K03A 2GWNA 3UWYA 1DBTA 4UTIA 4Q7NA 3M0MA 4XZNX 1WAUA 2UWFA 3K5XA 1FH7A 1U1UA 3MHFA 4ACZA 2CBJA 1UG6A 3OA3A 1RQEA 3EOOA 2PCQA 3L0KA 1ZB5A 1TREA 1XR2A 3CLWA 2Y7GA 1F8IA 3HG3A 3DHUA 4E5TA 3K1GA 2BOGX 4BI6A 4ZR8A 1WA3A 4XAYA 1TCDA 2A7NA 1PXGA 2OEKA 3RGTA 1VBGA 5IDIA 1GQLA 2OKOA 5DMLA 1P5BA 3NO1A 2Z28A 2PBGA 1NP0A 3MA8A 1RK5A 2YCLB 4JR5A 3S1XA 2VXNA 3IRSA 3B0UX 2DVXA 4UMBA 1KXHA 1ISVA 1ME9A 3MMDA 5F4SA 3HMJG 1JCXA 2QUNA 4S1FA 4WQ6A 5FJTA 3KBVA 4H9YA 2GVGA 3ZT7A 5HWJA 3DFPA 3OG2A 3L4UA 3LNPA 3RO8A 2WK2A 3BOLA 3GO2A 3IIXA 4I9AA 1SU5A 3B0PA 3T0CA 3IUIA 2OXNA 5D2YA 1TYGA 3G1XA 5D9NA 2R1PA 4JKLA 3FAXA 1DJZA 4PZVA 3AHTA 4MAVA 2PDJA 2R91A 4MOZA 3LBCA 2EPOA 2QHAA 4QDWA 3OVPA 1IIHA 1EO7A 3H24A 3VZYA 1ZU8A 2CBVA 2AGTA 5IRPA 1U33A 2PDFA 4PTDA 4A2SA 4UFHA 3BG3A 4ZO9A 2VMFA 3DGRA 1HGWA 1W9UA 1H61A 2ESCA 3A4XA 3NOYA 2O55A 4JQAA 4L4LA 1UYQA 3GC4A 1OZMA 3WKZA 2QAFA 3WCZA 3NDYA 3LDVA 1DE5A 3P8JA 2PZ0A 3AALA 4HK6A 4HU8A 5G5IA 1JIBA 1V51A 2PS2A 5A8PA 2CLIA 1V77A 2QIIA 1JZ3A 3HQNA 4TTUA 2NSOA 3T2OA 5FJJA 2PTYA 3YPIA 2Z24A 3LN3A 4TU1A 1QNOA 2YZRA 4RZ4A 4LV9A 1W31A 4DBDA 4C5ZA 4AD3A 3BICA 2CWXA 4L9YA 1PJ9A 4DRSA 3A12A 1FWWA 4QG6A 4Z08A 5A2AA 4W5ZA 1YHTA 3MI3A 1ZRQA 2DFAA 5D02A 4YTQA 3KBNA 3UFYA 1VFSA 3SIMA 4DYKA 2VQTA 3M5XA 4AF0A 2PGRA 3G1HA 3WF1A 1GQNA 1VBJA 1KM1A 4NVTA 4D6HA 4BI5A 1OCBA 2JEPA 3VNZA 4GOAA 3PJTA 4ZE5A 2OZ3A 3A4WA 4WIWA 1L6YA 1H7PA 1W9VA 3VIFA 3FSUA 3BL3A 3H70A 3DFQA 1AW2A 2H8ZA 3KTSA 1UCWA 4DLFA 1KTBA 4GI6A 4GBUA 2AAAA 3QC3A 1V02E 1XG4A 4MMWA 4ZB5A 4IUGA 2J9XA 3FS2A 5LNVA 4MLJA 3B4YA 5LXEA 5HA7A 3UR2A 1CLKA 1XUUA 4GGHA 2D24A 2ZZ1A 4WF7A 3TTEA 5E93A 1UR4A 2O9RA 4HMCA 5E0FA 3K8LA 1UD5A 3UZZA 4PFHA 1A53A 3R1ZA 2ZZ3A 3CV1A 1H5YA 1IEVA 1WDSA 4DNMA 2NX3A 1TWWA 4M56A 2VURA 3B0XA 2A3EA 4WGHA 3BJTA 4RE0A 1J0HA 1RR2A 4L4MA 4FX8A 4UXDA 1QPQA 1YDOA 1V02A 1O1ZA 4IPLA 3MP4A 1UQYA 1E6QM 3WD4A 3GH7A 1OGGA 1MW2A 3E0IA 4M19A 3S9IA 3FOKA 4J3WA 4TR9A 4MF4A 5CC3A 2Q09A 1UQZA 4UNLA 2OEJA 2FDMA 4LAKA 3I7SA 3NEHA 2E28A 3E5BA 4V27A 3ENLA 3SRKA 1L6SA 3S2NA 1VJSA 1FX6A 3QQ0A 4CGTA 3DUGA 3DERA 4KFNA 1PAMA 1IZKA 5D2TA 4R85A 3BPWA 4R53A 2Y5EA 3L23A 3RU8X 4PSRA 4GC3A 2G3IA 3QR3A 1F7BA 1KV8A 4AHQA 1O7AA 2WAGA 4F48A 1WXJA 2EGZA 4JL2A 4AD5A 2VEMA 2X1TA 4OE7A 2XZ7A 1LYXA 2RH9A 1IEXA 4J9JA 4Y9NA 5CPMA 4QBXA 2J9ZA 1KM5A 3OVRA 3T0DA 3GFXA 4UR7A 3T9PA 3OYXA 3AIEA 2CWNA 1VD6A 2UY2A 1Q4NX 1FWBC 4LVGA 1B3ZA 1I2OA 3OZPA 3M0KA 4JN8A 1K7EA 4QS5A 5LNUA 3NDOA 4I7UA 4LAUA 5C8BB 2WHKA 1HJUA 1I8JA 1Q3NA 1ICPA 3TN3A 4HNUA 1DE6A 1XYAA 1KCXA 2X05A 4PB4A 4CNSA 4E4FA 1Q6CA 1HJVA 3T6CA 4LGXA 2WC3A 4M29A 2ZTKA 4AZ6A 1Q65A 4H9XA 4JX4A 2IUZA 4JFWA 1QNRA 4RNFA 5C0QA 1FKXA 4PMRA 4GRSA 3KRBA 2I5IA 1A50A 1QI5A 3GH5A 3R58A 5ABEA 4PUEA 3D5HA 3BGJA 1UP3A 4P7RA 4X0VA 3K4AA 3M44A 1JPDX 2VDHA 2BOEX 1VPQA 1HP5A 4C6PA 4HPGA 2PDXA 3T0TA 3BLFA 4JIIX 1I2RA 5CLTA 3MCNA 1GVQA 1HVQA 3P67A 4Y8FA 4MB5A 1V3MA 2H3BA 4UBPC 3HGOA 3IRDA 2POZA 5AC8A 1KBJA 4ERAA 4OT7A 1IGWA 4GO9A 3RF9A 3F1QA 4U3CA 2CLHA 4C7DA 3RUBL 1OCNA 5I6SA 2CU0A 5H8PA 3EEGA 1CECA 5C6MA 2Z1BA 4GI9A 4LANA 1QW8A 2Z0IA 5I03A 3B0VC 1MW3A 4EE9A 1KB3A 3AIQA 3KZPA 2YX0A 4WVXA 1GQKA 3ALGA 2F84A 4AXNA 1BEUA 3LB0A 2OSWA 4CD8A 4TX6A 4W9TA 3VKBA 3VX0A 4MNJA 4AD1A 3TH6A 1KM0A 3AC0A 5JBFA 5CZSA 3SUTA 1O1HA 4D6CA 1OFRA 2E9LA 3IIPA 2ZE0A 1ITQA 4NP7A 2P76A 4HHHA 1R5YA 4ALDA 6A3HA 1GK8A 1W5QA 2A2IA 1T8QA 2YDSA 4HHLA 2D2GA 4CCDA 4Z17A 3EB2A 4UTTC 5GPRA 4GJ1A 3S47A 3MUIA 4H9MA 5F4WA 5D03A 3UR5A 3AU2A 1MFVA 1H62A 1SZEA 5FJRA 4YPJA 4ZQRA 4LBSA 4F79A 5K9XA 3OBKA 2FVKA 1GQIA 4GBDA 4FPSA 3TU9A 6TIMA 1N2VA 2B7NA 1QBAA 4B91A 4AY7A 3W1RA 3U7VA 3NZ1A 3DKJA 1MZRA 1I4NA 4LBRA 7A3HA 3MKVA 2C1IA 3W02A 5D32A 3I6RA 3D3FA 1W8SA 4EPEC 1VBRA 3R5EA 3H2EA 3QV7A 1W9PA 1KBLA 4AVNA 3NNTA 5AC5A 1TJRA 1FWRA 3N2BA 1I45A 2OOFA 3UGVA 3K30A 2CHNA 3THQA 2WMFA 4HU4A 1K6AA 3UZXA 4ZL1A 4X22A 3Q67A 5FF0A 3C2RA 3TCSA 1EOMA 3AZRA 4XTIA 1J2BA 2YBVA 1H7NA 3PZQA 4DZHA 1R3YA 1XBXA 2G37A 3BLPX 3CUHA 2FMNA 4I9JA 2PDBA 1H7WA 3AISA 2WOQA 1GUVA 4LWWA 2EHHA 2CYGA 5HJLA 4I90A 1NDVA 5LIXX 2Z7GA 3TLLA 2Z6IA 2YCIX 3LTPA 1LBFA 1W37A 2X42A 5LNWA 3O8AA 4ZB0A 2P0IA 5LKYA 3U7BA 4WSKA 4C6BA 4NJGA 3NIYA 2WVVA 3WLTA 3A3HA 1HN1A 4LFYA 1ZAHA 4HCHA 1J5SA 2WPGA 3OA5A 1G7VA 2J66A 1ISZA 3EB3A 4GCXA 1X6NA 1OJXA 1ZZMA 5AVHA 3GIYA 4WK9A 1R0MA 4HNNA 4MG4A 1UWAA 4GZIA 1E6ZA 3L4VA 1QI4A 4HNTA 1LM1A 2QPSA 2OLSA 1XM3A 1NFPA 1NQ6A 2BNJA 4M6QA 3PHAA 1MMFA 4E2BA 2A79A 3PUDA 4NRSA 1JRBA 1WE5A 1A5AA 5T8GA 4IMGA 4O8RA 3ZZ1A 4O0QA 1EL3A 1VPXA 1WYIA 3GHSA 1SW7A 4C6QA 2ODOA 2PDQA 2X1IA 1XD1A 3QR0A 2CPUA 3CUGA 3PZGA 1M6JA 2I5GA 1O94A 4HK7A 1JF6A 1E5NA 4LOCA 2AAMA 3H26A 3CUJA 4IPNB 2ZWZA 4LYKA 3KL3A 1CGXA 1LUCA 3MC5A 4R88A 5D38A 1UOZA 2QJGA 5KEZA 1RSCA 5A5WA 3UPWA 4GK8A 1I2PA 2FHFA 2VCAA 2POTA 1BTCA 3K4WA 2CETA 4RE3A 4PTNA 2WC4A 1RA0A 3PB2A 4A8LA 4LUJA 3ZVHA 3RMEA 5HMEA 3GHRA 1XLLA 4MIMA 4F3HA 3WO8A 1RQBA 3QMRA 4JDBA 4JKMA 1ME7A 2XTKA 3PPFA 1D8WA 3WJYA 1KO0A 3GC5A 4JFVA 2Q8XA 2J88A 3NSNA 2B81A 4RW3A 1QWKA 3NGJA 1VJZA 3DENA 5D2WA 4UQEA 2WSRA 1TUXA 3MMTA 2O9TA 2PUZA 3W2JA 1E73M 5LA0A 1G4EA 1XIHA 3GW0A 4FK9A 3A6OA 1H63A 4HIBA 3PJXA 2VZVA 4HGXA 3RR1A 1JGMA 1QW9A 5J04A 4R7JA 4AZ7A 2V5KA 5D2VA 1ITUA 3SQMA 1BSLA 3H4WA 4AMAA 2XN2A 1JCJA 3ECQA 3M0XA 3BXWA 1UR2A 5LGXA 2RDUA 4H19A 5HINA 4C6FA 4CN4A 1NARA 4HCLA 1ODUA 3FJ6A 2ON3A 3H7RA 4I6KA 5LYRA 1ME8A 2Y7FA 2NWRA 3LHVA 1AMKA 3G1YA 3THUA 3UXDA 5BOEA 2EAWA 5I23A 4GVFA 1DJQA 1GOWA 2F2HA 5I07A 1AA1B 1GKPA 3W1PA 3OLIA 3TSMA 2UY3A 4NZ4A 1QMLA 2P53A 1EGVA 4UFJA 1TRIA 1O5RA 1GJWA 3H55A 3WDQA 1SMDA 4IISA 4AY8A 3COTA 1DIEA 1KM4A 1V0LA 4ZFCA 3MSGA 2XFFA 1JYVA 5AHFA 1NTHA 4J7RA 1MRQA 2QDHA 3WJWA 1ZBCA 1XSJA 1W5PA 3NQFA 3NWRA 1W0MA 1DJHA 1KRAC 4G1KA 1PHWA 4P8UA 2V82A 1IE7C 5DBTA 4KWSA 3H22A 2Y70A 4HNCA 4IWWA 4IL0A 3DFNA 2ZUWA 2ZRXA 3ICJA 4DBEA 2D22A 3O0KA 3LD5A 3SR7A 3CH0A 4GVGA 1WO2A 3RHGA 4G5DA 4LPCA 4LB4A 5IBXC 2OB3A 1DJWA 4O1EA 2NW0A 2WO5A 3OOQA 4GA8A 3G0XA 3GAYA 1SSDA 4AC7C 2WZMA 1E4IA 4K7YA 1Q66A 3WDHA 2BWGA 3IGXA 4BCEA 4BJHA 2Y61A 3GQYA 4UTUA 1XLAA 2OU4A 4REQB 1F61A 1NOWA 1CDGA 3GTIA 3NQGA 3AHVA 3E49A 5TNVA 2D69A 3CYVA 4Q7IA 4ACYA 4GD0A 4FALA 1QNVA 2XWDA 3CS2A 2GK1B 1AQFA 3U2ZA 1OFPA 1XKJA 4IX0A 3BW2A 4US5A 1HGYA 2A3HA 1J0ZA 3HB9A 5GVJA 1Z89A 4JD4A 4B3KA 3C2OA 4W7WA 1IEQA 4B5NA 2VEFA 1EGMA 4I7WA 4IMFA 1OD0A 4M81A 3LCWA 2QKFA 1EC9A 3IVUA 1T6MA 1ENUA 5AB3A 3CM4A 3HPSA 4ZO6A 1R9XA 5K4XA 1XIDA 2FHBA 2WVUA 4DBWA 3OIHA 5CQ1A 2VZUA 3VTRA 3GVGA 3S6OA 1S38A 1TV4A 3EA3A 1VJIA 1IT8A 2YL9A 4LUTB 4WJEA 3PK7A 1XI3A 2GWGA 3BO9A 5JIPA 4S23A 3HGSA 4ML9A 1RK6A 1PEZA 1VBHA 4IJBA 3NQMA 4IICA 3ARXA 4DLMA 4PL2A 3R89A 3P8IA 2AKZA 2W91A 3K8MA 5A8OA 3PWIA 8XIMA 1TVPA 2X8RA 1RUSA 1QPOA 1FWHC 1HNYA 1QNQA 4L4PA 1DORA 1CIUA 3ARSA 3BK0A 1BF6A 4JY8A 3JS3A 4WDTA 4JTHA 3MCMA 1XWYA 4ZQNA 4CU7A 1J01A 2DZPA 3VX1A 3ZR6A 2GVEA 2DSUA 4CN1A 4DNHA 4JN6A 2IKHA 4INFA 1U2YA 2HNEA 1B3VA 5A6TC 4JX6A 4B15A 1VFOA 1JDAA 3M0JA 3UF9A 2DH3A 5C9ZA 3RM8A 3QY6A 1TQXA 3HQPA 4BEQA 3UT0A 1W1ZA 4L1GA 3RLGA 6REQB 3DFOA 3EA1A 1S5VA 2IS7A 3TNOA 1ECEA 3N14A 5H91A 5HMDA 3MHGA 1DQWA 1RH9A 1IF2A 2EG8A 2ZKMX 2BHUA 2VEKA 4D9PA 3Q94A 2PGEA 4MDOA 3WJSA 5I78A 1EJRC 3VD5A 2VGGA 4PTWA 4S2BA 5E9AA 1XIJA 2BGNE 4KCWA 1QK2A 4JNMA 2F2KA 3CWOX 4PTVA 4UFKA 2QVHA 5BWFA 1P6BA 4C6MA 5KZEA 3MW7A 4ML4A 2DSZA 2PSNA 1F3WA 3KOXA 1D7FA 3APTA 4G1NA 4UZSA 5JH2A 4XUYA 4IHCA 2GFTA 1J8VA 4Z0JA 3NL6A 1KFJA 1UPMB 1E6NA 3B8DA 3V3WA 3ITTA 4DPPA 3IIOA 1EPXA 4LYRA 1DJYA 5FA5A 3FLUA 1B90A 3BV7A 3M0VA 4K39A 4U2ZA 4O19A 4LV4A 3EMZA 3TVAA 4DF0A 3O6YX 3T7VA 3W1UA 5CSUA 4UTHA 1IXPA 1PO9A 4AUBA 1B0IA 3BAWA 2DY3A 4ZGYA 4JHOA 3UCDA 4UTJA 4GX8A 5I77A 1ODZA 2DVTA 3W3OA 4JCLA 1LWIA 3EPMA 3LK6A 4E2OA 4DI8A 1O5QA 1OFBA 1HKVA 4IP5A 4F0LA 3MCOA 4XTDA 3SJ3A 4WOZA 5BROA 1JJKA 1GKQA 1VEMA 3GIPA 2QMJA 1M1BA 3LY0A 1YE6A 3LCHA 3T09A 3FHAA 4HSOA 4XAFA 1Q6GA 3W75A 2YW4A 1PTGA 1CW2A 4J4KA 3RJXA 1GPFA 1NFBA 1ZAIA 5DMMA 2ZUTA 1CWYA 1MEWA 5E1QA 1QHOA 2XIIA 2H90A 4FNUA 3NR0A 4KKXA 3IJ8A 6CGTA 4HYWA 4UTTA 3C0JA 5AY7A 3W27A 2J78A 1XH0A 2AGKA 1LOQA 3SUWA 4AW7A 1K8CA 3AIWA 1KFCA 1J10A 4LRSA 1R8LA 1Z8AA 1HW6A 4MKSA 2OCZA 4Q6JA 3WNMA 3BLDA 2G95A 4AZGA 4H3DA 5L6UA 3WF0A 5H6HA 4UIOA 1PV8A 3WQ6A 1UJPA 4LQ1A 2WHMA 1EIBA 2CBUA 1IHIA 1QWGA 4Z1YA 1ONXA 3L12A 2OLHA 3GAKA 2FGLA 1CLXA 2YZ5A 3IACA 1OABA 1WDPA 3M0LA 1G0CA 2JKPA 3SCRA 2HVMA 2ISVA 3GZ3A 2Y2WA 3CL6A 1WDQA 1IWPA 4DX3A 4AX7A 3A21A 2XJ7A 4NHVA 4FNPA 3ATYA 3TQPA 4YJ5A 4ORIA 3IANA 3AIBA 1I75A 1RPKA 1BKHA 1F3TA 2NQ5A 1X8FA 1BVZA 3H7UA 2GL5A 3A3XA 1OVDA 4GZ7A 3N1AA 2R1KA 3E12A 1OFAA 4GZJA 2XGBA 3BOXA 2EO7A 5AN7A 1PBGA 1YDYA 5I3FA 2P50A 1E9IA 2GSEA 4NXSA 1K9FA 3GXTA 2J9YA 4GQBA 4PODA 1XDMA 3HZ3A 3BZGA 3VM7A 2J79A 4FAMA 2YDAA 3CQJA 1IXOA 1P0EA 2GPTA 2WSYA 3G1FA 1SJDA 3EAUA 5D8ZA 2VR4A 4YMZA 1DXIA 2FJUB 4JNZA 1Q2SA 4L56A 2PTZA 4MUPA 3TQKA 1ZUAX 2YLAA 4O1CA 4JTGA 1KXQA 4KRUA 3UXKA 1L0PA 3P5ZA 1K9TA 1RCXB 4MJMA 2DIEA 1KFEA 5D09A 2J62A 4HA1A 4L5ZA 1R9ZA 3VINA 4C1KA 1WXZA 3TYUA 3OW1A 2OTDA