4AFYA

Crystal structure of the fimx eal domain in complex with reaction product pgpg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
b'MQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIMX
publication title Crystal Structure of an Eal Domain in Complex with Reaction Product 5'-Pgpg
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4afyA00
3GG0A 3GFXA 3KZPA 4RNFA 4Q6JA 2BASA 4F3HA 4FOUA 5M1TA 4Y9NA 3TLQA 4HJFA 3U2EA 3PFMA 3S83A 3SY8A 4Y8EA 5MF5A 3N3TA 4RNIA 3HV8A 2R6OA 4HU4A 3PJWA 3PJTA 4KIEA 3GG1A 4AFYA 4AG0A 3PJXA 4HU3A 4Y9PA 4Y9MA 4ES4A 4FOKA 3GFZA 3PJUA 4FOJA 5MKGA 4RNJA 3GFYA 4Y9OA 4J40A 2W27A 4LYKA 4LJ3A 4F48A 5MKGB 4RNHA 3HV9A
chains in the Genus database with same CATH superfamily
2G96A 8XIMA 1TPDA 2VGBA 4LYPA 4J7RA 2PDWA 1EJ7L 2YFOA 4LW7A 5FEWA 3WLIA 1J0JA 2VX4A 3AO0A 3IGSA 2QJNA 4RDVA 4KKXA 3L4TA 2OEKA 1WZMA 2BGSA 4J28A 3LLFA 1FWTA 3U4FA 4PTWA 3ALGA 3T42A 2X8RA 5DFAA 3PZVA 4IWWA 1HGWA 4QAWA 5KZEA 4UTTA 2E1WA 3CJPA 4AZCB 2QGHA 3N25A 4AIEA 1C9WA 4V28A 4I9JA 2IUZA 7TAAA 2YW4A 1IT7A 4MB4A 4MVAA 1HVXA 1OC5A 2D2JA 3HPXA 2CFFA 1FWRA 3CWHA 1KFLA 3AICA 2D2HA 3N13A 2EHHA 2WK2A 3THAA 1UH3A 1C29A 3U8GA 3LPGA 2J7BA 4WOZA 2HBXA 5HULA 2VZTA 2FLIA 4JCLA 4O13A 4JQ2A 2ABAA 4O53A 3MMTA 5I78A 3EWUA 2V38A 5K4XA 4JNZA 3ZLFA 5FAGA 1TIMA 5MKGB 3G1YA 2ABBA 3F2DA 4CEXC 3UXAA 3W53A 1U83A 2GVLA 5CSYA 3RX4A 4GYPC 1O95A 2BHUA 2RUSA 1RJPA 3LHTA 3DKJA 2UZ9A 3RILA 1QK2A 1LL6A 1L6WA 4ZQCA 2Z25A 3WFZA 1VFMA 2RAGA 2TODA 4AC7C 4WCJA 3UF9A 1B3ZA 4HZ6A 5A2BA 3W83A 1H49A 1Q8AA 3DHPA 2OYKA 1UD2A 3U5UA 5AHMA 1LT8A 4GZIA 1EO5A 3NDZA 5HOSA 3LCFA 1UR2A 4PH6A 1K8YA 5FI8A 1ICPA 4IPPA 1HL8A 2VENA 4L4PA 4DELA 3OPSA 4ZBCA 3ZO9A 1S38A 1UD8A 2GK1B 1H3GA 3AIQA 4GQRA 4ZQPA 3NSMA 5IBXC 1D3CA 2TPSA 1BVWA 5I79A 3W37A 1UMYA 4HNTA 1UH4A 3I65A 1R3YA 1YNQA 3R79A 2PWGA 1VPQA 1MDRA 3R1ZA 1OSEA 3ITTA 2QPXA 2Y0FA 4FXFA 3EX6A 5M03A 4HMNA 2PDUA 3KOXA 4WEVX 1POKA 2CKSA 2ZUTA 2C14A 3OZPA 4HPJA 3A9BA 4ZO7A 1OCNA 3OA5A 3ARRA 5DY2A 1XRFA 3STCA 3TYAA 2CLKA 1SZGA 3E6EA 2PDIA 2J25A 3CZJA 2ZX5A 2B7PA 3ZVHA 4AWUA 4IMAA 3EPNA 2GJNA 1W1A1 1KFWA 3EWBX 3BURA 4H7VA 5EBAA 2ZXAA 3UR8A 2I7GA 2VX5A 5FOOA 3IJ7A 4XZWA 3WJSA 4YWIA 4QXIA 1XBZA 1CZ1A 5G2WA 4W7UA 1FUYA 3UBPC 3EYPA 1PSCA 1H7WA 1LWJA 3ONCA 1RBOB 4AHOA 3T55A 4DBDA 5I3KA 1CWYA 4UTJA 2YB1A 4ONVA 4GWEA 1POJA 3GFZA 4LF1A 5H6HA 2WLYA 3VCCA 3E3HA 3W27A 3VX1A 3QRHA 2Y89A 4IG2A 3GDBA 3NIYA 3PTMA 1LL4A 1RJRA 2PURA 4Y7EA 1ADDA 4OUIA 4RNIA 2DPEA 4BWLA 3TZNA 3BV7A 3WENA 3CC1A 1UZHA 2OLAA 3WUEA 1RD6A 3GNRA 5I6SA 1OWQA 3ZR5A 2WSKA 4QG9A 3MI3A 4HU4A 1IF2A 3L23A 3BTNA 2D2OA 3W7NA 1ALDA 1HW6A 1O1ZA 4PUJA 2QUMA 4DM2A 3TK7A 4OGZA 3HM7A 3R0KA 2EJAA 1W32A 1W5PA 2YA1A 3ZWSA 3KCLA 3OBEA 2C0HA 1ECQA 3RCYA 2BLEA 3CTLA 2I9EA 1Z89A 3PK7A 2VYOA 3CB8A 3WO8A 3PZNA 1AJ2A 1XRVA 1WUEA 3TMLA 3E9AA 5A6JA 2ALRA 4Z2HA 5D2WA 4XG1A 1A3HA 3WNPA 1TWDA 3NUKA 4UR7A 3P8JA 3KRSA 1U33A 3V36A 1KV5A 3LXBA 1W3IA 4NUWA 4H8HA 2I56A 3RO8A 4O14A 4FNQA 3D47A 4ZMGA 2FHFA 3B0YA 3R5EA 1J18A 4YTSA 3KZSA 4O1CA 1G94A 1GJUA 3SY5A 1OB0A 5FA5A 2GVYA 3ABXA 4H6KA 3QY6A 5ECUA 1HKVA 3LBCA 4W89A 3EDJA 1OGSA 3W2UA 2ZRVA 2H9AB 3CUFA 4D6HA 3IJDA 3C0JA 2EG7A 1XR2A 3U48A 5I09A 2QUNA 4R27A 4ZA0A 2GGHA 3EKLA 4Q8MA 2WKLA 4MYAA 4GYJA 1LRTA 1ZSXA 2WZTA 2HPMA 1GVYA 4LNCA 2R8WA 4JEQA 5BOEA 4JTKA 1S3HA 5K9DA 2YR1A 1X6UA 3LMYA 3CV7A 2WCAA 3RHGA 1HKIA 2XFYA 4GX9A 3C2VA 1V0LA 2W63A 4FLOA 2PPGA 2XSAA 3QYQA 4MNMA 3QXBA 3HMCA 2Z27A 2CEQA 1VJIA 2DSWA 2WNZA 2XH7A 1SFSA 3HURA 3K46A 3G5EA 3N6QA 2C1IA 3NAVA 4P7NA 3VM7A 1GONA 5JBFA 1KBLA 2UWFA 2F7FA 4LQ1A 1Z41A 3CBWA 2VC7A 1CGTA 1EXPA 5FEXA 4ML4A 1X97A 3DC0A 2QULA 1MXDA 1XYAA 1XBXA 4CQCA 4JFWA 3DC8A 4H8UA 3UNDA 4OT7A 4YN5A 3NDOA 1E51A 3SCRA 2X05A 2GK1A 2ZUWA 4WUIA 4M1BA 3FOKA 3WFAA 2FZ9A 1YNYA 2QQ6A 2QJHA 4BFAA 3RYSA 5HUPA 4YTRA 1CXKA 4AIUA 2X42A 3QC0A 4ZE5A 4GJJA 1I1XA 3WLKX 4GI4A 3SECA 1PWMA 1IEQA 3TAOA 2DZBA 5U7SA 4PE8A 1A4LA 4X2PA 3ZZ1A 1M41A 4CNNA 1K7EA 3UG5A 2OU4A 4ASTA 3NSNA 3N2XA 2X1SA 5FKYA 2EQDA 2ISVA 1K9FA 3VIFA 2E09A 1HO4A 2GGIA 3BAXA 4LWWA 4LT9A 1T0OA 2FJKA 1NELA 4PB4A 1K02A 1CX9A 1IR1A 3SCOA 1X8CA 2J77A 4AMCA 1VC4A 3HTWA 2BNJA 2ZIDA 3FYOA 3NA8A 5D38A 1L8PA 3BW4A 3C2YA 3CUZA 3IIOA 1K3UA 4LUTB 1RK5A 4GRSA 2QCLA 3ANYA 2VGFA 1U2YA 3KEHA 3C5QA 4NNAA 4UUIA 4LAOA 4B90A 4F0HA 3ZM8A 2P8BA 3KWSA 2A2IA 3SBFA 4U2YA 4NI3A 5LSMA 1GEHA 1U5VA 1KTNA 3DFTA 1XV8A 1UUQA 5AVNA 3WBYA 2ZA3A 2C16A 3AYTA 3K4AA 1CXEA 4O1EA 3CZ8A 1E43A 3EX1A 1DWJM 4UFHA 2EO7A 1JZ3A 3CV2A 2QS8A 5AHIA 3AMDA 1BLIA 5KETA 1SFTA 3AMCA 4HJFA 3VI2A 1DIKA 1TWIA 5FF0A 3QN3A 2GUYA 4NAFA 3TJXA 4IL0A 3VKCA 1TQJA 4CQ9A 3H26A 2W62A 4NILA 3W6LA 2WMIA 1Q2RA 1I2QA 2H3BA 5LIYX 3EDKA 3T09A 3TX9A 1R9ZA 1OEPA 3IVTA 3NO3A 3VOCA 4GUFA 1R3SA 3GDMA 3ZXWA 5C7VA 5I03A 5I5RA 2CBIA 3ARZA 2ZADA 4C6BA 4OECA 1M7XA 1LP6A 4D6FA 4B15A 1GOKA 1W8GA 3B4YA 4DAIA 4HP5A 3OO2A 1ZCCA 3G18A 3GU1A 3P2VA 3VKDA 5AB3A 3OBKA 1JDDA 4W86A 3LRKA 4NRRA 1JDFA 3MUZ1 2YFNA 3UP8A 9RUBA 4M6VA 1FP8A 1W1VA 2IPWA 1Q6QA 4GI8A 4RR4A 2GJXB 2VL4A 2PTWA 3WLPA 3WD3A 1E6PA 4ERGA 4N9EA 4RZ5A 2X1RA 3HV8A 4IX2A 2D0HA 5GQBA 2WMGA 3GNDA 4ZXLA 4HCDA 2H9AA 4UZSA 4TX8A 3E5PA 5LNVA 2PWHA 3WNMA 1SZNA 4UFJA 4X61A 4CEUC 3S42A 4KF1A 1UROA 4ADUA 5FL1A 3IUDA 3TQ0A 4UTMA 4BJHA 2GDQA 4L5ZA 3M6YA 4ZFMA 3UY8A 3VZYA 3KVJA 3WX7A 2Z1KA 3F4DA 1TPUA 2G37A 3S6DA 4QE4A 2WSPA 3WDPP 1ODZA 2HPIA 2V9DA 3DGBA 5MF5A 3HQNA 1XDLA 3PPGA 2V63A 3HPSA 1DXEA 2XVGA 1W9XA 3T78A 5HPOA 1FRBA 4I8DA 3I68A 4ZENA 2HE5A 2VCAA 1TWZA 5JMUA 2J24A 3SCUA 3VNIA 3OZOA 4QITA 2IQ0A 3SB0A 1A49A 1B4KA 4L61A 1SO6A 4YIWA 1K6AA 2EG8A 5C71A 3MUIA 3R0UA 1S5TA 4ZL1A 1XFCA 3EOUA 3MMWA 3CNYA 4FOJA 4WKFA 4ADTA 1UR3M 2Z6JA 1YDOA 4GJ1A 4HGXA 1MWOA 5E9XA 1QO5A 2C7FA 3GHTA 1RALA 3OIXA 4EP8C 4PZVA 1S2CA 5DMYA 1VFUA 1EGMA 2HXTA 1JCLA 4B91A 3SUTA 1O68A 2XYLA 5A6KA 1EJXC 4Q8TA 4CCCA 1QDSA 1S2AA 2V3FA 1V3KA 3W6MA 3W7QA 4DVOA 4KEMA 4GG9A 3KAOA 4O1BA 2AQWA 2AL2A 1CECA 3B9AA 3COTA 3PFRA 4S2BA 3BLOA 1AW2A 3UZWA 1DKWA 3HGOA 2BV9A 5A94A 3DG3A 3W85A 4JTAA 1IGWA 5ABHA 3EEGA 4C6PA 4PTVA 4CQDA 1VYRA 3ITGA 1YX1A 3VGGA 2QCHA 3NSXA 1SSDA 3QR1A 4DJFA 5IFTA 3F4NA 1UQYA 4LYQA 2XTKA 1HN1A 1UJQA 1E1EA 5E5CA 2Y62A 4OE7A 1WDSA 2QMKA 2FGBA 3G1XA 4WKAA 3C61A 4EOUA 4LUSB 3TONA 3CASA 4PCPA 4LRSA 4L9YA 4H9TA 1IWBA 4CNTA 4YVVA 3OGVA 4QR6A 2OGYA 3L2IA 4QJ1A 2JGYA 1Q45A 1I4NA 1U1HA 4Y2WA 2VFIA 4U33A 5AYIA 3NO5A 1BKSA 3LRLA 4DO6A 1JR1A 4NXKA 1BXCA 3LBOA 4B3ZA 5AY7A 3W02A 3TYCA 3AXIA 2F61A 3NXLA 2YA2A 2AGKA 1QBAA 3SW6A 3GC5A 3FXGA 3ATZA 4ICCX 2W4XA 4GQ0A 3AS2A 2YB4A 2VEGA 1H7RA 1VBJA 3BLKA 3KVMA 2G5WA 1BRLB 2ZXQA 3L4VA 1Q66A 3A6OA 2R91A 3O16A 4C7GA 2DZVA 3QFEA 3MO7A 1FP9A 4H7ZA 1XUUA 4ZO8A 4LUJA 5TBOA 4AZHA 2ODOA 4GUGA 4LV4A 1PHWA 1TUXA 1JUBA 3QTGA 4LEFA 1W1IE 4E2OA 3BE7A 1TX2A 4F4RA 4Y8FA 1IXQA 2DU2A 3AU2A 2RDUA 3CO4A 5B7ZA 4JGDA 3FVDA 4JPGA 1Z7AA 4KW2A 1TIWA 4WX2A 1OCBA 3NR0A 1WZAA 1IHIA 1FHLA 1VB9A 3NQAA 3AQUA 1B3YA 2GQ8A 1HL2A 1ODUA 3WQ6A 2QYGA 1DBTA 4GVIA 1NFPA 1IYXA 1R3TA 4AWEA 1AZ2A 4FOKA 3VC5A 2B4GA 3FDKA 1KGXA 4K39A 3WLOA 2ZX8A 4IOTA 4K36A 1XIEA 3W7CA 2QV5A 3O15A 1CB7B 2YCLB 3DBPA 4WSHA 2Z29A 4OBRA 1G1YA 3GNXA 1J96A 1QW8A 2D24A 4W87A 3WDJA 1LG2A 1TMQA 4BQ3A 2OVLA 1V3IA 3CQ0A 3R6IA 2FTWA 3VNKA 5T9CE 4UQEA 3BLLA 4D8LA 1F4HA 4REQA 3V35A 2J47A 4M6PA 3WJWA 3I3BA 3RLHA 1WDQA 3E1F1 1R87A 3QGKC 1LZOA 1NIUA 3ELFA 1FWFC 5D9NA 1LRNA 1ZU8A 4UQCA 3SCNA 4S1FA 4Z17A 1J79A 1V3JA 1J01A 2P76A 3WMCA 3VM5A 1R2RA 1EXBA 3ARTA 4G7EB 3AXXA 5E93A 4AY7A 3UJRA 1TV8A 1UWSA 5A8PA 3R94A 3WBEA 3WELA 4OBTA 4TV5A 4XBSA 3UWUA 2FPYA 2P0IA 3NYZA 3TCEA 3BAJA 2PZNA 2V5LA 4Y6GA 5HBFA 3A9IA 3TYBA 5HATA 4DUOA 5FJRA 1HL9A 2YJQA 4ADSA 1BWLA 1R46A 3BLDA 1M68A 5HJXA 3WJZA 3M43A 2Y8VA 3REQA 5CSSA 4F0MA 3FNDA 4EPDC 2A85A 2GWGA 3JRKA 4Z0JA 2VMFA 3SAZA 3PWGA 4JR5A 4MFDA 4A3RA 3AOFA 3C8NA 4GQGA 3QHNA 4W7VA 4QJ5B 3SCPA 1F6KA 3DECA 3U2OA 3WLNA 4FLQA 2ATMA 1SGJA 1BYAA 1GYLA 4KEUA 2NLYA 2D23A 2AOSA 2QUUA 5G2IA 4IH3A 1JPIA 5D2VA 2D3LA 3QOKA 1PEZA 3WLQA 3RXZA 4E4FA 4GNJA 5GNZA 5IDIA 3AIRA 5CPLA 1KBJA 2L5HA 2V68A 3OLIA 1XKJA 1OG0A 1XIIA 3KL5A 3WLRA 2E3ZA 3CAVA 2PDCA 1QI0A 1KC7A 1J5TA 4JEJA 3TR9A 1XLFA 4GY7A 3GAKA 4HA0A 3ARWA 4XKMA 4PMVA 3ZQ9A 1YYAA 2V0TA 2OEMA 4GA8A 4DNHA 1BHGA 1JPDX 1TUFA 5JH2A 1KFBA 4WDXA 1X1NA 1V93A 4CD4A 1S2TA 3W7JA 5AHEA 3QPYA 3AXMA 1DJHA 1XFBA 2Y8UA 4YTTA 2BMBA 1TFVA 2WC3A 1DPMA 3KL0A 4DQWA 3TYUA 2E8YA 4FOUA 3BXWA 2QDEA 2NX3A 3NCOA 2E68A 1N82A 1C7SA 4ZVJA 4QIUA 5D37A 5T26A 4Q8NA 3NL6A 1K9DA 4FNPA 5A8NA 1WO2A 2J79A 1BYDA 1P0EA 3BWWA 2OJPA 5AZ1A 4HNCA 4PCFA 4DAFA 4ML9A 3HB9A 1HXJA 3WK0A 4D8AA 1ZTVA 2O0TA 5FF7A 2WW5A 3SUVA 1HJWA 2MANA 2WZEA 3K2GA 2VJXA 4GQQA 3WCZA 1WYIA 2HCVA 1GKQA 4GISA 3BAIA 1W3KA 4LOCA 2XIOA 1AJ0A 1B1YA 3BG3A 1SFLA 4ZE4A 2O9PA 3TOYA 1DE5A 2FH8A 1C90A 4JIEA 1UKPA 4PGLA 3JW7A 2GUBA 2BGQA 1TMHA 1EF2A 2XN1A 4IPNB 1RLDA 5F7UA 1UKQA 1VH7A 4V15A 4ICNA 4PUKA 2CLEA 1EC7A 1VPXA 4JTJA 3GXDA 1K77A 3A22A 3D46A 1XBYA 4WOQA 4HCLA 5AYZA 4D6JA 1E0UA 4WF7A 4HYRA 4WJ8A 3UD6A 1ZGDA 2WKJA 4HTBA 4PR4A 4H8VA 3GG0A 1VBHA 2PS2A 2B0MA 2INEA 1DV7A 1XSIA 4JL1A 1T6MA 3U2EA 4NZ1A 3TN6A 1VRXA 3HGJA 3RK8A 2NUWA 3VMPA 4S3KA 4DUVA 1E4NA 4J3XA 3VIKA 3LQLA 3THUA 3DUGA 3ZS4A 2JK2A 3VIPA 3NWRA 4W85A 4GKLA 2WJZA 4DF1A 2A3EA 2XFRA 4G7EA 2WNNA 4YCPA 3ISIX 3BK0A 3AHTA 1T8XA 3DHDA 3Q65A 1H5YA 4M81A 6TIMA 4C7FA 1VJZA 3P7YA 1V7YA 1QFEA 1HIZA 3GVWA 4JTIA 4FLRA 1K4GA 3T08A 3PUGA 5CC5A 1FXPA 4M6QA 1MUMA 3URAA 3OVGA 1O12A 3EDFA 9XIAA 5K2ZA 2ISDA 1JG9A 3GKFA 3B04A 4WIWA 1DYSA 1NWSA 4YHGA 3C2EA 5A95A 4GGBA 1F2JA 3VIGA 4W84A 4XTDA 1KCXA 4J3WA 2V69A 1KXTA 1C92A 3G0XA 5CH9A 4HZ7A 5D9OA 3SRHA 3UNTA 3JS3A 3FW6A 1VZWA 2PI6A 3V75A 4QE5A 2ZRXA 1XRSA 4UCFA 3SCQA 3WD4A 4DJDA 1N7KA 1B9ZA 3CMJA 5KZ6A 4GX8A 3V16A 4C1NA 4CQ8A 1DIOA 3O6AA 3ZR4A 3MJYA 2HNEA 3A21A 4YCOA 1FQ0A 2OODA 3KRZA 4NY2A 2QMJA 1UIOA 1W0MA 5A6AA 1R86A 2FZBA 5EB8A 1HJQA 2FMOA 4UTHA 4N6EA 3IJ6A 4HYWA 4Y9MA 3SQMA 1O4UA 4NXSA 5BRPA 4L65A 2F6KA 1UBPC 3S47A 4A2RA 3S2CA 4KMQA 4WSJA 3UVIA 1JAKA 4IFKA 1VLIA 1OJXA 3GD6A 3A13A 3N2CA 5H1WA 1PIFA 2DUXA 1T41A 1A4MA 3LRMA 1Q8JA 4QG6A 1K7FA 1TQXA 2CLLA 4GVGA 3GWQA 3H4XA 1XHGA 4TQTA 2Z24A 5JBDA 4O8AA 3KXQA 4PUMA 5KZDA 3NVTA 3T40A 2HEJA 1S46A 3M5ZA 3G2GA 4AAJA 2WPBA 4B4FA 5FIPA 1V0KA 3G0SA 1O7AA 4BQ2A 2F2HA 1LLOA 3F7JA 4W4QA 5F2LA 1KM4A 1XLIA 4FZIA 1BKHA 3E2VA 1VF8A 3GR8A 3VMOA 5HQEA 3LK6A 2QR6A 3MW7A 4AZ6A 2Z1SA 1BXNA 1YMYA 1UZ1A 2FTPA 3N2TA 4A8NA 4EWND 5I3JA 3E2QA 1K4HA 3UG3A 2GJPA 1U1JA 3S9IA 3VNZA 3O05A 1QHPA 2A6NA 1NOUA 3FA3A 4P8UA 1ZP3A 1E6QM 3MCOA 1AH3A 1BTMA 4BI7A 4S3DA 4WJEA 1J0ZA 1UJPA 3DEQA 4JQ3A 4D6EA 3B0UX 3A64A 3WF1A 3B05A 3B9OA 3EX2A 5D30A 5HMFA 4JDBA 4EK7A 3QGVA 3SJNA 3WUGA 1E71M 2Q02A 1UP0A 3T1GA 1IE7C 4H6EA 1X39A 4JY8A 1CDGA 4DJEA 2EPMX 3S1UA 3B3DA 4CNSA 3GTNA 2BXYA 3WBAA 4AX6A 4IM4A 2WVVB 3ZYZA 3WQDA 4XAFA 2NQZA 2PF8A 2DY3A 3UJSA 4IUOA 2WWDA 3MY9A 3NM3A 4UTTC 3IGUA 4GUHA 4MZYA 1S2UA 3W1XA 3CIXA 1J12A 2BP1A 1QTWA 3A4WA 3UT0A 3CQKA 2VR4A 3R8HA 4JXCA 4XKYA 1A3XA 1R3VA 2OZ3A 3CIWA 1Y8BA 4B5SA 4P2VA 3UETA 2DZAA 2PUZA 5EBUA 3C6CA 4KETA 2C0AA 1JYXA 1H11A 4PMOA 5DRIA 2VKZG 3MVIA 2CETA 2PRHA 2ZX9A 3VCNA 4UB9A 3OGRA 3MZ2A 3VFCA 1YADA 4MNKA 1QAPA 3N2OA 4GYFA 1G4SA 2DUAA 2QJMA 1F74A 1QR7A 1JDCA 1ISYA 4A8RA 1LWHA 6PTDA 3WLHA 3GH7A 2VCCA 2XM1A 4TX6A 2P3EA 1KGUA 4IMGA 3GXTA 1VAHA 1MO0A 2VZSA 3EB4A 2A7NA 2NVCA 3WNOA 3EMZA 1X6LA 3QHMA 4JD4A 1EQCA 5A6LA 5CBJA 3L65A 2FZDA 4IMFA 2I1OA 1QASA 1OX4B 2AQOA 3N3TA 4DBWA 2FIQA 3W86A 3AFBA 3K30A 1ZPTA 3TNOA 3L7RA 3LTPA 1GVQA 4DYEA 5CPMA 1G4TA 5EMYA 2Z7KA 3XISA 5I07A 1BAGA 1AFSA 1A0DA 4Z1AA 2JEPA 5HDRA 3G1RA 4ZOEA 3ZSSA 1UB3A 4IGHA 3DN5A 4PRRA 3MDWA 3VIJA 4Z2LA 2YDRA 4KBXA 3C4UA 4C6JA 2CHNA 5BMWA 4EVZA 1XLLA 5CGQA 5M5DA 4I5RA 3W4RA 4TVCA 1V7AA 3UYIA 2QHAA 2X09A 3INPA 5FD0A 2PDBA 2X41A 4XZLX 5DT5A 3RR4A 3ZJ7A 4J9JA 4XTIA 5E0CA 4WGHA 4F0KA 1HJVA 3MO4A 5C9UA 3KTXA 4NJKA 1FWWA 5LXXA 1J6OA 1KO0A 2GDVA 2PLCA 1OFRA 5BZAA 1RR2A 5A8QA 4GH1A 1SJDA 3E38A 2EPKX 2DH2A 1O5QA 2PE4A 2X30A 1RP8A 5FF4A 1KM1A 3KS5A 1BYBA 1EJRC 2IQTA 4ORIA 3RM4A 1H62A 5AC4A 2QT3A 4RXGA 3Q67A 1R30A 1V6YA 1D9EA 4N0RA 3SFWA 1H1YA 1I2PA 1YXCA 3PVFA 2Y8KA 5JU6A 1E4MM 3FYPA 4GNVA 3BLIA 3C56A 4MWAD 1XGZA 4N7QA 3RNDA 3BGJA 3IK2A 3LI1A 1F3XA 2TYSA 1E1CA 5BW6A 5K9CA 1I2NA 4S38A 2V6AA 4MJ2A 3W1PA 1UIPA 4AH7A 2NQJA 4ZB2A 2PF0A 1ML1A 4LV9A 3DG6A 4BQ5A 5I3DA 5C5YA 1UH2A 3YPIA 1RBAA 1LTDA 4K38A 2E6AA 1V6VA 3VGEA 4POCA 1GG1A 2CCRA 2VEPA 1FH9A 3UR7A 3BG5A 4AIOA 3CM4A 4A4AA 4HSOA 2DORA 2IXUA 1EP3A 1FTXA 1E4LA 3KHDA 5HR7A 5EGRA 3VAVA 1UASA 2ZVRA 2OWWA 3E2SA 4HOWA 3N6HA 1QNPA 3IRSA 3KLKA 3OLEA 2Q8ZA 1J0KA 1FWGC 4JX6A 1KCLA 3TSMA 4XO6A 3ARUA 3FGCA 3B0VC 3PSWA 1TX0A 2XIJA 4KFNA 1I60A 4PYSA 4KEZA 1TB3A 2VFEA 2E6YA 1MW1A 1FHDA 4J3TA 6A3HA 4RUBA 3P8IA 2CHOA 3UYCA 4IMEA 1OIMA 3TWBA 4G2DA 2GVJA 3C2OA 3L4ZA 2OWXA 4PTXA 3SRFA 4B4HA 2PGWA 4BI6A 1OK4A 2UY5A 2I57A 1MMFA 2WAGA 1AUSL 5E70A 4AYSA 1EZ2A 1UD4A 2W92A 1XCFA 2XM2A 3WDQA 2GDUA 2P88A 3C0SA 3E0VA 1VKFA 3EXRA 2D0GA 4FK9A 2EKGA 5AYBA 4LAKA 3W82A 2QAPA 3T2PA 1F76A 3CWNA 3DU0A 2OT0A 5TAOA 3URBA 4CLMA 4DXKA 3OU8A 4CUCA 1Q6FA 3C86A 3TC6A 1OINA 1YPIA 1V51A 3EKGA 3H70A 3GYCA 4P8WA 4Z0SA 1R9YA 1EYEA 1XIGA 3EXTA 2J78A 2DIKA 2VD9A 3CL6A 5IFPA 2HNHA 4ZO6A 1MFUA 3WH7A 4RKAA 1F05A 4GZJA 4HNOA 3WQ8A 4FI4A 2PWUA 3MS8A 1MXSA 3NOEA 3S2NA 1NF0A 2RGMA 5G2HA 1PZ0A 3ORWA 3GR4A 3LXAA 3WEOA 1XC4A 3MKCA 2XIIA 3O1NA 4OOZA 2DQXA 3GZAA 2OG9A 3TOPA 3VGDA 1TCDA 4NX0A 1EO7A 3MDUA 4DO4A 2Z26A 1OX4A 1XLJA 1E55A 1H2JA 1Q13A 2VVSA 4EACA 4E8DA 4FAMA 2F38A 1W3JA 1N2VA 1DOSA 5LYRA 3DERA 4UXDA 4JN6A 2PAJA 4O16A 1S2VA 4HBKA 1PUDA 4Q7BA 4EWJA 4DJED 3AJXA 3P80A 1WAUA 3ITVA 4S39A 4X22A 3W7DA 4GOAA 1J10A 1PZ2A 4ES4A 2E40A 3ID7A 5DRCA 1EUAA 2WQPA 3EDEA 1WXYA 2QCFA 3NQMA 3M0ZA 3R10A 1BQCA 2J7GA 2X0SA 3ZJKA 4I6VA 1S5NA 5DCDA 5HPCA 3CUGA 2FGZA 3LM3A 3PG9A 4NNCA 4C7DA 1SPQA 3BV4A 2E6FA 3BDKA 2ALDA 5A6TC 3RMEA 4US5A 3M5XA 3U9IA 1CT5A 2OR2A 3LEPA 2CIPA 4YYCA 4AISA 2XZ9A 3F4VA 5DANA 1JIBA 1KBKA 4RK8A 1SZEA 4BS0A 1OFEA 3NYDA 2BXVA 3AXKA 5EFFA 1JCMP 1WDDA 4CNUA 2F6XA 3C52A 3EEZA 4MJMA 4O52A 3EWCA 1XCWA 3GAYA 4HNLA 1US3A 2NV9A 1L9WA 3TAKA 5JQ9A 4C65A 1SVDA 3ZLHA 1MQQA 1PKLA 2FZ8A 3CHEA 4UFKA 1XD0A 4UNIA 3B4UA 3OOQA 3OB8A 4HPHA 3LDVA 4XZMX 5G4WA 2I5IA 1XS2A 1TWSA 2HK1A 3ITLA 1Q6LA 8RUCA 2ZUVA 1O5XA 3I3EA 4L4MA 4HOXA 2OQYA 3R11A 3V7PA 2XZ7A 2G4FA 3UPBA 4MLRA 1T99A 5AKQA 3KWXA 4AXKA 3TJ4A 2O7SA 1ISZA 1ADOA 3E0LA 3FCPA 1MI3A 5KZMA 1V02E 1EHAA 3I10A 6ALDA 4GINA 2Z2AA 1ZY9A 3K13A 1LM1A 2R1KA 3EZ4A 3UJEA 5HNTA 2BWGA 1WE5A 5C70A 1NF7A 1XICA 1YDYA 2IS7A 4QJ4B 5FJOA 2J9XA 4WDWA 3P81A 2DJLA 3VUSA 2VEMA 1BGGA 1OD8A 2XWEA 4E5TA 1TRIA 3ZSTA 4JTTA 1MW0A 1DQUA 4WVXA 2Y7FA 4DX3A 3R13A 4UC5A 1SW0A 1W3LA 3W7EA 2POTA 4PEEA 2DIJA 3A12A 1ZAHA 2YLAA 4LS1A 2ZA2A 4U31A 3T6CA 2E0PA 1NM9A 1ZJIA 2BXZA 2HS6A 4AYGA 2PGFA 3WD1A 3BH4A 4IICA 1KKRA 4B5TA 5BYWA 3UXIA 1REQA 3BUVA 4FXSA 5A6SA 2BSLA 1H5VA 4JTQA 3N34A 2PODA 1B9BA 3LLXA 1QCWA 3HGRA 3W2KA 1FKXA 1G69A 1XPYA 3TNBA 4L1WA 3UFYA 3P74A 5D2XA 1NARA 2G41A 3IS4A 1QVBA 1EA9C 1GTHA 2YDAA 3B8VA 1GOWA 1W9DM 2CITA 4JTCA 2YXGA 1SW7A 2DSZA 2OLHA 3QBUA 2VR5A 2IKIA 2QAFA 1OYBA 4TV6A 3VDBA 3P93A 3L4WA 2YCKX 4HK7A 5CC6A 1TREA 1K03A 4Y90A 3GH4A 2OX1A 3M0LA 1DJGA 3RCMA 3M0HA 3DFYA 1F3TA 4LX4A 1OX6A 2AKZA 1KXVA 2WJDA 3LB0A 2B7QA 3RPMA 2FHBA 3SN0A 2GVEA 2OSWA 4M0XA 4BEQA 2ZWYA 4K68A 5CG7A 2FVMA 1WP6A 2WMFA 2HBVA 1K7XA 2AGTA 3GFXA 2UY4A 5T9BG 4QROA 1ONEA 4ZZ9A 4JYFA 1IZKA 3C3UA 1E40A 4FX8A 3G1DA 2HVNA 1OZQA 3PULA 2NQHA 4XWUA 3G1HA 3GIYA 3WD2A 4QDPA 1C93A 5IHRA 3CU2A 2PGEA 3P14A 5FJIA 2Y5SA 4P7OA 1XLCA 3BAWA 2PP0A 1XH2A 5F2GA 1E72M 2PA6A 2XINA 3BL3A 1OHLA 2GQAA 1DHKA 4HMCA 3HPZA 1D7KA 4C6DA 4XVEA 4I7WA 3N15A 1PAMA 4HU8A 4DEFA 4L80A 5FSDC 1UR4A 4MUPA 2YDQA 4JIQA 2C8NA 3CS2A 2ZE0A 4UTWC 1SFJA 2F84A 4JBRA 3L4XA 1GKRA 4PCSA 1L6FA 4ATLA 3JU2A 3WMSA 2DSVA 3VYLA 4UTUA 4QDMA 4KESA 3TXVA 4H1ZA 1YQ2A 3M1ZA 1VIZA 2VC5A 4RV8A 3U6WA 1M1BA 4F0LA 2HS8A 4UR9A 4RE4A 4HNUA 1TR9A 3L0KA 3LHUA 1XINA 3LCIA 3WF0A 1FFQA 1BD0A 3USBA 4H8NA 2A7PA 8TIMA 1NVMA 3AUJA 4JKMA 2B7NA 1CTNA 4GYPA 1RVGA 3RLGA 3MVTA 5F2MA 1GTEA 5H8PA 4F2UA 5C9RA 3PUEA 5XIAA 4XZNX 4DN1A 4O11A 1YXDA 3HMJG 3FVMA 5D33A 4DLMA 1WXZA 3SI9A 4PMRA 4L56A 4O4WA 4YL2A 3LSCA 3IGXA 2ONEA 3I6RA 2Z7GA 2Z1XA 4MGGA 3AHVA 1JZ2A 1MEHA 3MKKA 4MG4A 4JZ5A 4I90A 3THQA 1EB3A 3R43A 4AIBA 3HIJA 3R2GA 5DELA 1XW8A 1SW3A 4DBUA 1W9PA 5DCBA 2J8GA 2ZE3A 3VA8A 4FHAA 3HN3A 1PKMA 2A21A 1OVDA 2GJLA 3M44A 5IBXA 1PCKA 2CESA 3PZMA 1KKOA 1M03A 1UYQA 1RQEA 1UZ4A 1G0CA 1X38A 1HF6A 3IUHA 4UFLA 5IXEA 1KQYA 3PANA 1VFHA 1R3WA 2VOTA 2ZC8A 4J3SA 3PPHA 1F07A 1XQLA 2BOFX 3VXGA 1DIDA 5BRBA 1MUCA 1LL7A 1K9EA 3ARXA 1DL3A 4AF0B 4US5D 3TTOA 4JTLA 2C1HA 3EXSA 2HK0A 1SMDA 1VBGA 4DBEA 4V33A 1NFGA 3CT7A 3WLLA 3T8LA 1UA7A 3N3MA 2O4QA 4HCHA 1DTNA 3IIVA 3WMLA 2YL8A 3S1GA 3S5OA 2NUYA 1TPB1 3CQIA 1EBHA 2GL5A 4MB5A 1O5RA 4R88A 2DDXA 3VGFA 3PJUA 1ICQA 2NX9A 5TF0A 3H7RA 1DORA 2FTYA 2GGEA 3NPUA 5HA7A 4W93A 2EGZA 2GOKA 2RHGA 3M0XA 4S3AA 1HO1A 3B9NA 4IXHA 3XIMA 1GW1A 2WMKA 3AC0A 4R3UA 1U30A 1QATA 5T8GA 1DE6A 1X7FA 6XIAA 4RV3A 1UD5A 1U5HA 4UTFA 3BVJA 1GQKA 5H8UA 1TPH1 2VRJA 1PO9A 3IIXA 4GO8A 3PS7A 2D20A 1IT0A 1H7OA 3MP5A 4WD0A 1RA5A 3STPA 3GNOA 2RDTA 4PA8A 1ENUA 4B2DD 4L9XA 4MY8A 4BHYA 1ELSA 3B06A 5CXPA 2CLIA 2QCMA 3RN6A 4CCZA 1OC6A 1XIDA 3GM8A 3P62A 4UTIA 2G3NA 1K8ZA 4A3HA 4R85A 3N29A 4WSKA 5D9PA 4Y9AA 4XUYA 2E1DA 5EY5A 3PPCA 1GQIA 3F5JA 5I24A 7ODCA 1ONRA 3SCVA 1RA0A 2EPLX 3FXYA 4JIHA 3NL2A 1M7JA 2OXNA 2CZ5A 1UUOA 4DWSD 1W3HA 2X2GA 4U4MA 3IACA 1HKWA 5AFDA 1V6UA 2CERA 1XQKA 1YTEA 3B40A 2XFFA 2NXGA 2VD8A 3CV1A 4NYYA 2WMHA 3AIWA 1ZBWA 4B3KA 1G7UA 3T7VA 1A47A 4YTUA 3WYZA 1GYMA 2OO0A 1IXNA 1LUCA 1GQJA 3TQPA 1DEDA 1KW1A 3GC4A 4M82A 1XYMA 4QQUA 3GHUA 4GIEA 2W79A 2I5QA 1WPCA 1CEOA 3N04A 3MUY1 2ACRA 3SQLA 4QX4A 4X3ZA 4F0SA 4G7FA 1GORA 3LHWA 5HNUA 3G1AA 1V4YA 2QV4A 3VABA 2P8CA 1FCQA 4PRWA 1GHRA 3ARPA 3KE0A 4C60A 4NKCA 4UQDA 1ZJHA 4KERA 2A79A 2XVKA 3PJXA 4M5PA 4H9UA 5L6UA 4B5NA 1CXLA 3VNMA 1RCOB 2VUYA 4H6RA 2PEVA 4ZB5A 4Z2GA 4NI8A 2BVYA 1Z6KA 4IJRA 3S5SA 3AZRA 5A2AA 3F4WA 3VOHA 4AD2A 4CU7A 1FCUA 5CZ0A 3C8FA 1E15A 3DI1A 3GXNA 4FPSA 1V0NA 4ZTXA 4Y8EA 4PCNA 4XAYA 7REQA 2UBPC 3FY1A 4QHRA 4IIGA 1E0WA 4AG0A 1GGOA 1BGAA 4AY8A 1Z44A 1EX1A 3NPVA 1P0BA 4HMDA 3PZIA 4BZYA 4QS5A 3FJ4A 4LVGA 2WB5A 3SO7A 8CGTA 5A8MA 3GTIA 4E2BA 4ZGYA 2J88A 3MUXA 3VIHA 2FB2A 5HJLA 3TN3A 3V0SA 4I7UA 1Z48A 1JD7A 3GU9A 4OFCA 4GK8A 1Q63A 4CN6A 2JQXA 1DJQA 1C8VA 1TZZA 3KRUA 2J66A 3H2NA 5DCEA 2Y5JA 1Q6EA 4A29A 1QUMA 1D8WA 1M5WA 4Q8UA 1WKYA 1Z32X 3A5FA 1KR0A 3MWAA 4IHCA 1ZAJA 3FSUA 3UESA 4AF0A 4K37A 1TTJA 5E6ZA 3NQ2A 1U1UA 2QCDB 1I75A 1KXQA 2CPUA 1Q7MA 4HK6A 2WCSA 3H24A 1TE1A 3ZVIA 1JXJA 1YBQA 1ZBCA 2FPTA 3CH0A 4MKSA 3MSDA 4C91A 3GW0A 3GVVA 4O0QA 4P7RA 4ZR8A 4MSSA 4C5ZA 5I3IA 2XWDA 4IIDA 5JIWA 5EMMA 4ACZA 3RGTA 2ZX6A 1OY0A 3VINA 2ZRUA 1YXYA 4FR1A 1JRBA 1GOIA 1W6TA 2PDHA 3AROA 3CGTA 3PZUA 2P3ZA 4AD5A 2J74A 5C2XA 3C0QA 1UP2A 1H7PA 4HPGA 1JXKA 4R7OA 5EFDA 3OLDA 3NL5A 1RBLA 4HVXA 3H2OA 4BR1A 2Q3RA 4J5NA 1PXGA 1XYLA 2HZGA 1LBMA 2VOMA 3ICJA 4PFMA 2V30A 4MPKA 1OT1A 3UWZA 5A2CA 3SM0A 3W1TA 2VURA 1FKWA 3W1RA 3T81A 1AG1O 2IKHA 1CBGA 1XRTA 4TTUA 2XH2A 4EPBC 1KFKA 5CZJA 1LT7A 2W67A 1J4EA 3KVLA 1ZZMA 5LA2A 1G67A 3ANVA 1XH0A 3PTQA 1KLYA 4J4KA 4MWAC 1W2VA 3W9ZA 2XIBA 4OVXA 3V4BA 1ZCOA 3CQHA 1J9YA 4A3YA 4KRUA 4MOZA 4I9AA 4JKLA 2BVTA 1LYXA 1E0VA 2QXWA 2ICSA 3A4XA 3IJQA 3GB6A 4GZ7A 1J0IA 3N14A 1E1FA 3V5OA 3APYA 3ES7A 3W71A 2B81A 2DH3A 1PZ3A 3OEXA 1NDZA 2Z1BA 4MYXA 4IIHA 2XHYA 1P0KA 2W6RA 2WYSA 2FVLA 4H41A 4GCXA 1W9BM 4PB3A 1MVYA 2R1LA 2Y88A 3OW1A 1XWYA 4Q8VA 5CC7A 2VEKA 2F8QA 4PMNA 5A3HA 1FHVA 5HK4A 1JNDA 3KBNA 1NP0A 3TA9A 3VD9A 4WDTA 2E5BA 2QDDA 1ZFJA 2VNCA 5A8OA 1KB3A 2R24A 3N9RA 4N9CA 1HKJA 3E12A 1IIGA 4DZHA 5L9FA 3S9ZA 2HROA 1XG4A 1H50A 3B03A 4MAVA 4A05A 2X1TA 4HTYA 2YA0A 3AS3A 2AAAA 4BY3A 3LS9A 4Q8QA 1PZ1A 3EWZA 3OVRA 2SFPA 3QFWA 4E8CA 5LA1A 1E56A 3IK4A 4LGXA 4XZ9A 2JF7A 3QW3A 1H0IA 4A3UA 2EKCA 1WDWA 3LV6A 1GKPA 2DUZA 5A6BD 4ZO9A 1GK8A 3ATYA 1E9YB 2C19A 1E70M 3DIPA 1JL8A 1JPKA 2TSYA 4KCVA 1TPC1 2WVUA 3OGSA 3T0AA 1C8QA 3ZFHA 2OELA 4N02A 5DBUA 3L9CA 4P8XA 3GY1A 4GC4A 3LI0A 4PL1A 5CLWA 2DW6A 2PTXA 2EBNA 1JPMA 2FPVA 1JYWA 1XG3A 2ESCA 6ENLA 1EP1A 4ZCWA 1D3GA 3V5FA 2VO5A 2YPIA 2PTZA 3DHUA 1MQPA 3P0XA 4LVAA 2Y2WA 4KRTA 4PCTA 3NQ7A 3B8UA 2Y70A 4BA0A 3Q4DA 1DWIM 4FIRA 1K6WA 1YTDA 3HBLA 3OVPA 4QCFA 1Q6CA 5M1TA 1PYMA 3BSGA 1JVNA 1F5ZA 3G1VA 4X0VA 4Q4RA 3AIBA 1AZ1A 2G3FA 5C55A 1Y5XA 4AB4A 1VQTA 4U2ZA 2ANUA 2ZTKA 2VT0A 3M16A 2H90A 4GVHA 4DUWA 2HSAA 4V1XA 1XF0A 3TH6A 4GQBA 3QV8A 4YWSA 2WCGA 3BSMA 1UP3A 1NU5A 1OFOA 3CLWA 3CV6A 3M0KA 1GT8A 4OJYA 3V1PA 1HKKA 2C1GA 1PIGA 4OOUA 3O6DA 5BMXA 4DJEC 3BLEA 2OFJA 4AZCA 1Z8AA 3ARQA 2QNEA 3BG9A 1PKYA 4S3EA 3OQEA 1EYWA 1EIXA 4JL2A 5CPTA 5LNSA 2HDJA 4DZAA 2CLFA 3VKBA 1UBSA 1QPNA 5CBBA 5IDZA 4W8AA 4AZBA 2G50A 4ZQOA 3VTRA 4O18A 3TMQA 4AHQA 2OYMA 1UPMB 4HB7A 5MKGA 3A47A 1JUKA 4FSAA 3GVQA 1M7PA 4A21A 2O56A 1VFFA 1WNOA 5XIMA 4INFA 2OCZA 3PB2A 1EDGA 3ARVA 4HU0A 2BY0A 3BJSA 5U4NA 3LPPA 1IV8A 1H0GA 2W66A 4E3VA 3L5LA 1EGVA 1CXFA 4PN2A 3A23A 2J9ZA 4HA3A 1SJCA 2WQDA 3KDOA 4UOJA 2ZC1A 3AYRA 2NVAA 3N18A 3LA4A 4JFVA 1CLXA 2BODX 2G95A 1QMLA 2EPOA 5I3HA 4Q4MA 1MUWA 3RRXA 4JFTA 4AD3A 1K70A 1DWGM 5HUOA 1XYFA 2PFHA 4RZ6A 3CAKA 3TJLA 3PB0A 3E96A 3EX4A 1HNYA 5XINA 3QV7A 3LBMA 3W22A 4HIBA 2J6XA 3BJFA 4HNVA 3V0UA 1QW7A 3P67A 3R12A 2XPKA 4TU1A 3SFKA 2W61A 1VGAA 5JUVA 2CBJA 2E6DA 2YBUA 2G8ZA 2VFDA 1R85A 6CGTA 3THDA 5KINA 3KOFA 4KGJA 3TA6A 4UTKA 3S5ZA 2YSWA 2O9RA 1UR8A 4FXRA 4R9OA 2NZLA 2PDXA 4GFIA 4MDOA 2NV1A 5F4SA 1AK5A 1FXQA 5F4WA 3QMRA 3L67A 5TD4A 3MUCA 2QDHA 2WZMA 1QNVA 3MSYA 2CWXA 4AEFA 4NX5A 1LWIA 1VS1A 5J8LA 1A5LC 4UFIA 1B3VA 3CHCA 3MTWA 3IVSA 5H91A 4UOZA 4TUFA 1ISWA 5HWMA 1HX0A 1Q85A 3WDIA 2ZDRA 4GO9A 5HXMA 1HJSA 3H6OA 3BMWA 5G1YA 3EA3A 3B97A 4NAEB 4QBXA 1D3HA 4FEZA 3LY0A 4TX9A 3GS6A 4NRSA 3GG1A 7TIMA 4OV9A 2X2YA 5JH1A 4M56A 4HHPA 3WF4A 3HG2A 1B2YA 1YPXA 2OSXA 4H83A 2VFFA 3UZYA 3RDKA 4B92A 1OFBA 4V2XA 5E6YA 1ZENA 3IV8A 1LLWA 4JX5A 3D3FA 3U4AA 4TR9A 1EDTA 3V3WA 1GVFA 2P50A 1XIBA 3GXMA 1A5KC 4NL1A 1HGYA 2P1FA 4AVFA 4IJCA 2WBGA 3NVDA 2Q01A 4JYEA 4IL2A 4AZ5A 3TN4A 3SDOA 4EXAA 3M7WA 4PMUA 3W7PA 4NHVA 3WQFA 3L0GA 4UQBA 5CG0A 4ALDA 3WQCA 2O55A 1YHTA 4LANA 3VDAA 3LM7A 1F3EA 3VGBA 4GNKB 4E8GA 4FO4A 1LORA 1GOQA 4IXXA 4M8UA 2PMQA 2VI0A 2QJIA 3DKLA 3SGZA 3L68A 4KWVA 4QE1A 1QJWA 3NQGA 1EDQA 4IF2A 3FYYA 3IJ9A 1PHQA 2WHJA 1GW9A 1T96A 1DTUA 2DEPA 2ZCGA 3HQOA 4G1NA 2C15A 3PBUA 5SWUA 4H04A 1WCGA 3QZ6A 1KTBA 3APTA 2OSYA 2ZICA 2DIEA 2BY1A 3ME3A 4IMDA 1XLEA 4MNLA 1LBFA 3BW3A 1TV2A 5G4EA 3MU7A 3PNZA 1S39A 3PTDA 4NZCA 3RX2A 1PIIA 2I16A 4UNLA 1I9CB 4Q8OA 3NDYA 1QW9A 4KWSA 4KGLA 3FSTA 4CD8A 3GFYA 1MRQA 3H22A 4M19A 1UOZA 4PEKA 3IAPA 4W7WA 1V77A 2WJFA 2WHLA 2CYGA 2V5CA 2OYLA 1CIUA 3OVQA 3U0HA 3ECQA 1HT6A 3KBVA 4XV0A 1HP4A 4KWUA 3E0FA 2NXHA 1XISA 1FWDC 3VOFA 1KWGA 2PC4A 1PBGA 1ZRQA 3VIMA 5T91A 2VELA 2NWRA 1V02A 1H1NA 3IJLA 5GVJA 3PF3A 3FFSA 1UC4A 4C6KA 1XIMA 1GVIA 1CGWA 1KRCC 3IV3A 1TRDA 4J3ZA 3FHAA 1N8FA 2PP1A 2GQ9A 9CGTA 1WXJA 2Y4SA 1A5AA 4JYDA 4M80A 1V03A 1LF1A 3GIPA 3LCGA 4A35A 2DVTA 3W38A 4EF8A 4DBSA 5KMYA 4Q32A 4JTSA 3CAQA 1FWIC 1M01A 5I23A 1R2SA 1XC6A 1H41A 1WQ5A 1F6PA 1KTCA 1ICSA 2QVHA 4QSHA 3SIMA 4XX6A 2A3CA 3UXDA 3AIEA 3CL7A 3VO0A 1VD6A 2IXVA 4EF9A 1RJQA 3SRKA 2YDSA 1GOMA 5CCZA 4EPKA 3UCQA 3JR2A 3ITOA 2PZ0A 1NDVA 1J8VA 1Z69A 3W28A 3W0KA 4JX4A 3CH9A 5BXTA 2WJEA 2NLIA 1W91A 1V5XA 4P5UA 2VC9A 3S46A 1DJNA 2V5DA 3KZPA 3TTEA 3CUJA 4MKNA 1V3MA 5FESA 4JQAA 3H2AA 5K4ZA 3MI6A 3T4CA 3W1UA 1A0EA 1XDJA 4G56A 1N55A 2P10A 3EAUA 2YL6A 1KM3A 4HPNA 2BGNE 4LUTA 3GQYA 1R47A 2VHLA 4XD5A 4QEHA 1J6PA 1DHPA 1KFJA 3TW6A 3HQPA 4KFPA 3HPFA 2PDJA 5BU9A 2YIHA 5FSEC 1WZLA 3H2CA 1EEXA 4O1DA 1WV2A 4LBRA 3RLVA 4YNGA 5ECVA 4KWOA 3TE9A 2Z4GA 2XVLA 2XIMA 4H7CA 3M4HA 1XGEA 2B31A 3CUHA 3KBMA 4Q8PA 4KFOA 3N12A 4YS1A 5C8BB 5LNWA 2PWDA 1WA3A 4J3VA 5EKYA 3A4JA 4NNBA 2WSQA 3FAWA 4JIIX 1RHCA 3L4UA 4U5IA 3NJ3A 4KCWA 1XXXA 1RCXB 1KD0A 4MF4A 4E4UA 4NQ1A 3AUOA 4LYRA 2YGYA 2OGJA 2G3JA 5B7YA 3ZWTA 3UXKA 3L2LA 1DWFM 3CTTA 1BSLA 1NY1A 4MZ1A 1KWKA 3Q94A 3LCLA 2DT1A 4B5VA 2INZA 1E6RA 4GY1A 1OF8A 3GC2A 1KRAC 2MNRA 1AODA 4E3TA 1A53A 4LCRA 1DJXA 3LCHA 4U5KA 1UWTA 3KHJA 1VHCA 4CN1A 2FB3A 3NZ1A 4AFYA 4JTHA 3W26A 4F40A 2PDFA 1IEXA 2E8ZA 3U57A 3GR7A 4MPQA 3NFUA 2Z2BA 1PV8A 3P5YA 2VDGA 4PTDA 3PZOA 5CZTA 1SO5A 1MW2A 1VEOA 3E0IA 3CPUA 4NJGA 4DIAA 3H2FA 4U3CA 3W7KA 3LU2A 2YW3A 4EIVA 2GJXA 1JPHA 2OMAA 2G4JA 2VZOA 3NEVA 4GIYA 4JQ1A 1XKYA 1E73M 1KM2A 3NTYA 4GUJA 4GH3A 3AMLA 4MHBA 1PX3A 1UKOA 5HJYA 4DWSC 2PBOA 1V8EA 3PY2A 4OTKA 2ZX7A 3I7QA 1WUFA 1H7XA 1NTHA 3C3NA 3UZJA 4DF0A 1GZGA 4GHRA 5CJ5A 3KTCA 3W07A 2E67A 3EA1A 4E2VA 5BWFA 3WDHA 2WOQA 3NQCA 4PL2A 3T0BA 4DZ5A 4QQ3A 3WIJA 2WMJA 2YCEA 4C6OA 5E1QA 3M0JA 3M5YA 2J7DA 1SU5A 4IG2B 2WC4A 4IJBA 3LUTA 4EKJA 3VIIA 3G6LA 2XSBA 3SUWA 1GEQA 2ZYFA 4X9SA 1G4PA 4O57A 3NM1A 3MP3A 3WH8A 2FFIA 2GUUA 1E5JA 2V3GA 4L6HA 3S6OA 1P6CA 3S83A 1XLDA 3BICA 1RP9A 3GW3A 2CBUA 3QPEA 5GJNA 2YX0A 2HVOA 1I2RA 1TJRA 3IVUA 3MB9A 4LJ3A 2PLMA 2O9OA 4JN7A 4NZ4A 4XISA 5FAJA 3W25A 3CT2A 3JVAA 2WC7A 3TC7A 3AZTA 3VFLA 1VFSA 1BFNA 2GJRA 4FF7A 3CLMA 3O07A 4HHMA 3VD5A 5CLTA 2XU2A 3PAJA 4R34A 3ZLGA 3CPRA 3S5NA 2KZHA 4HN8A 2PDLA 1TVNA 1G01A 3L2MA 3AJ7A 1OFPA 3OODA 4MWAE 3G77A 5D03A 3DI0A 3AWNA 2ZZ4A 1LG1A 5C0QA 5CGMA 3IARA 9XIMA 1OYAA 1EOMA 3H4WA 4AZGA 3B8SA 1XH1A 2CC0A 1ME7A 4GACA 5HMEA 5I2UA 3BCDA 5AYYA 4YXGA 5D02A 1OGBA 4D6DA 5DX7A 3GH5A 1CENA 4W9TA 1LROA 4H3DA 2EF9A 1IEWA 4J27A 3W72A 3U5YA 5HAOA 2V67A 4XO7A 4AU0A 1BTCA 1NEYA 1ZS2A 4ZXOA 4QSFA 1ZJBA 4UQ9A 4Q7NA 4WKHA 4RNJA 4LUSA 7PTDA 5K7JA 2W27A 4FR6A 2ZA1A 1W54A 2DT3A 3TVAA 4CCEA 3PBWA 1DJWA 1N8WA 3S3GA 3UWYA 2VQUA 3V5CA 1TV4A 1L6YA 4QLLA 5LZLA 3O6YX 4Q4SA 4DWDA 3MA8A 3LXCA 1LOLA 4WQ6A 1V79A 4E0CA 4JNMA 1LDCA 1I0BA 3QY8A 1NWTA 1NOWA 1PE1A 4US6A 4V27A 3PP7A 2W91A 1EPVA 2PD5A 4Q7IA 2VFGA 4PUUA 1D2KA 3UJ2A 1RK6A 3UPWA 1FOBA 4L1XA 1BRLA 4ZOCA 1OCQA 4UMBA 4Z08A 3XINA 1DXFA 3EBVA 2FFCA 3F2BA 2XISA 4LAZA 1GNXA 3THCA 3AZSA 3E74A 4RW5A 3U2CA 1JZ4A 4ICMA 3V18A 1XDMA 1W1TA 4XAPA 3TP4A 4Z2JA 4IQLA 3P0WA 4P7LA 3LPFA 1Q6RA 2ACUA 2LLEA 2QUTA 3UG8A 4E4PA 1SMAA 5I0DA 4G1KA 1B3XA 3AIVA 2CZDA 3P6LA 1AQMA 4WRHA 1UR0A 2AMXA 4DJFD 1JNEA 5EL1A 2NV2A 1RY0A 2XH0A 1L6SA 3WQPA 4C6MA 3WQ4A 3WK1A 3JUGA 3DFSA 3P84A 2QDGA 4QISA 3BLPX 2J62A 4Q4PA 2Y63A 5I02A 2GFTA 5LNRA 3B0XA 3CZLA 2YCLA 3ARSA 1VCFA 4LTSA 2PDQA 1GVOA 3VKJA 3W23A 3FEMA 1NH6A 4FNUA 4PUWA 4NJJA 8XIAA 3APGA 3KS6A 3DAQA 1QHOA 4H00A 5CBIA 2O9TA 4FIQA 3F5LA 2JKEA 2QJGA 1W31A 1NQ6A 1CGUA 1X1OA 3TIMA 2ZKMX 3GNNA 2OO6A 3NNTA 4PULA 3TQKA 3GVRA 3URQA 1WZKA 4CVWA 2RH9A 3W7HA 1E4IA 3N2MA 1EJUC 3QKEA 1QNRA 3DFHA 2TAAA 1R7AA 2R6OA 3E2RA 3D0CA 3NURA 4LCSA 1FDYA 1YLVA 1JCXA 2WSYA 3K1DA 2H8ZA 5LIWX 3ZIZA 3O8AA 1P48A 4HPXA 4V1YA 3G1FA 3GTHA 1UWRA 3BJTA 4AVOA 3W87A 4ZQNA 3IJIA 3LZ3A 5AC8A 3GNPA 4D6IA 2ZZ2A 3VVGA 3W3OA 4UBPC 3QHOA 3MHFA 2GSJA 5LGXA 1ITUA 3II1A 2CLPA 4JTEA 1W1B1 2QLYA 1H09A 4NAFB 2Y6ZA 1W5QA 2WMIB 3O2LA 3WNLA 4F3HA 1ZUAX 1B4EA 4YYFA 3I4KA 2X0HA 4XSLA 1EWDA 5H8MA 3T2OA 3OTRA 2PTDA 3H12A 2E9MA 4K1GA 1C3FA 4CNOA 3QTPA 1R9XA 2A3LA 4M24A 1KNWA 3W88A 3O63A 3F5KA 3TFCA 3H7UA 4JAWA 1L2QA 5AOUA 4YPJA 3SURA 2X7VA 4IP5A 5M17A 4PBEA 1E6SM 1Q65A 4C6CA 3V1HA 4GCAA 1J5SA 4D6GA 5JIPA 3MPGA 4N6FA 4A6GA 3POHA 3L5AA 1QOQA 3FAXA 5D4YA 4L6OA 4DZIA 1I8JA 1OFAA 1A5NC 4IFRA 1P43A 1PB0A 3LHYA 2PCEA 4TVDA 3VUPA 1ZAIA 5AVHA 1RPKA 1NDWA 2CNCA 3O06A 1CGXA 2QGYA 1Y0EA 4RNHA 3PZTA 5HANA 3W2MA 3NZRA 1UKSA 1ONXA 2C91A 3NQ8A 4AEOA 1S1RA 2WNQA 4QS6A 3C2RA 2Y7EA 3TJIA 4TO8A 4ORMA 2RGLA 3S2LA 5D04C 3W2NA 2HVMA 3W81A 1BF2A 2G3MA 4LB4A 2ACSA 1BQGA 3DFQA 3EOEA 2DQWA 3A3XA 2VUNA 2QIIA 3PR2A 5E9AA 3WSUA 3W75A 1UOKA 2PBGA 1E9ZB 2CZFA 1I2OA 1LOSA 3VDCA 3PZGA 1KCZA 2G3IA 3ZJ6A 3UWWA 5G4HC 2DT2A 2O4MA 1FWAC 4OU1A 1GVEA 4PBFA 3MYPA 3SY8A 4F8XA 6REQB 2WZIA 1LQAA 2AL1A 2XN0A 3DYPA 1MSSA 2FDSA 5DXYA 3USZA 4LSBA 2FZNA 4HK5A 2W5FA 3S1VA 2V82A 3FLUA 3MT1A 3MV01 3IPWA 1KXHA 4P8VA 1S2WA 1EGZA 1JGIA 2D22A 3S6TA 3O0FA 5BXPA 3S5YA 1OM0A 1W3TA 2V3DA 4AHPA 5A5WA 1O66A 1S3TC 3W2LA 3UZXA 2VVNA 2C6QA 2Q8LA 1WDRA 4M6UA 1DWHM 4B5WA 2GQ3A 2IPJA 4RE2A 3I4EA 3T0DA 2A3BA 3HFYA 1O1HA 1K8XA 1UG6A 4GFSA 1LOQA 3FA5A 1Y5WA 3W7LA 1FWJC 2AL2B 1VEPA 2P53A 3NO1A 4DUXA 1EJTC 2ON3A 1YIXA 1UD6A 1XSKA 5CEWA 1Q4WA 2Q71A 3BO9A 1FDJA 4W5ZA 2XGZA 4C1KA 4GBDA 3GKAA 4HYVA 3T0CA 3PG8A 3VCRA 4Q8WA 1CXIA 4XD4A 3PWAA 4PODA 5K3VA 4EXBA 4JHZA 4BF5A 2ZFAA 3WG6A 3EKZA 1C8YA 4HSHA 4KWWA 5G1TA 3WQVA 3UQNA 4W8BA 4PTNA 3DZ1A 2R1PA 1BYCA 1I45A 2X1UA 4MUZA 4RE0A 5LHFA 3O7UA 1Z3NA 4N4QA 3MHUA 1W5NA 4CKQA 1UQZA 3S1WA 3HG4A 3GUWA 4L4LA 5LIKX 2TRSA 3LYEA 1DJYA 4CVUA 3LNPA 3U3HA 4ATDA 1VCVA 3CZKA 3H54A 3BARA 1XCXA 1A50A 4EPEC 3RLUA 1E6NA 5ABGA 1B5TA 2ACQA 3M0VA 3RITA 3NQDA 3BZGA 2A3HA 4JCMA 3OP2A 2YOCA 4XK2A 2NUXA 3W1QA 3PBVA 1GVRA 4IX0A 1SZRA 4FA3A 3QQ0A 2A5HA 3LV5A 4RL3A 2ADAA 4G6CA 4UIOA 3SQSA 3EMQA 5A1AA 4CU8A 1IXOA 1JYNA 2A6LA 3AYVA 1VBUA 4D72A 4G8TA 2ZQ0A 3NZPA 4MLJA 1IZJA 1F7BA 2ZZ6A 5FEZA 1R38A 4H01A 3R8GA 2DZXA 4X9YA 3TUUA 3QVQA 3TTSA 3CIVA 1LRQA 1PL9A 5I77A 1DP0A 3W1NA 1LQ0A 1I6NA 3W84A 3GO2A 3QF0A 2W0UA 4QG8A 1QWGA 4E2DA 4YVXA 5CJMA 4JOMA 3ZT5A 3UA4A 2NQ5A 2BG5A 2VDIA 3WKZA 3PJWA 4NIRA 3HG3A 4LS2A 2PDNA 1W37A 3CUXA 4D2JA 1H7NA 4RW3A 4F2BA 3QH2A 3TCSA 5KITA 3BCFA 3EOOA 1W1ZA 4RXFA 4GI9A 3TV8A 1OF6A 1BPLB 5HINA 1KCKA 1OZMA 1OX5A 4AZ7A 3L12A 1E0TA 3HF3A 3CXOA 1EPXA 4DYKA 2VP8A 2RDWA 1L2UA 1FWSA 2QUVA 1MRAA 3T9PA 4E38A 4PUEA 2F2KA 3W00A 3GK0A 1TE6A 3LQGA 3VDHA 2C79A 2QF8A 4A8IA 3M47A 3TFXA 1ZALA 4REQB 1XLBA 3SADA 2E5DA 2AAMA 2ISSA 2WHMA 1HTIA 3FV9A 1JDAA 1S5WA 3N9KA 4S2CA 3KOYA 1LLZA 2CW6A 1RQHA 2E28A 3BW2A 2D2GA 2XUCA 1J11A 1F3WA 1UA3A 1RY8A 4Q33A 3T8QA 4B5UA 1WAWA 4O4VA 1HG3A 1TTQA 4MTVA 4BWLC 4ZEPA 2FH6A 3OIHA 1GJWA 3M7SA 4PMYA 2X40A 4ZOAA 1ISVA 1A5MC 3E02A 4UR8A 1T40A 2BY3A 4WXZA 1P5BA 3VILA 3HG5A 5C2GA 2I5GA 2R1MA 1QI3A 3LOTA 2BVWA 4GJIA 3A4AA 2OTDA 4LC6A 6REQA 3LN3A 3PNUA 2DZWA 3W24A 4DJDD 5LA0A 3GBDA 4IPIA 2JIEA 4I9MA 3DH7A 7CGTA 1YRRA 4I8YA 3NQVA 5F1VA 4O0ZA 5C7HA 5HQMA 2OZ0A 2ZOXA 3PC0A 2PC8A 1EQPA 1XYCA 4NSBA 1W5OA 1P0DA 1F4AA 3WLSA 1E9LA 3BQ6A 3REQB 2P0OA 4M29A 2E77A 4AUBA 5I7GA 2PLKA 2GLKA 1UWIA 5FJPA 2BX7A 1FWEC 3RM8A 3G6MA 3GDTA 2RFGA 4LVDA 3ZT6A 1NAL1 1MZHA 1UW9A 3W6YA 2WVVA 4ZOBA 2GVGA 3M9YA 2BHYA 3IANA 3M64A 1C7TA 3NQFA 1XYBA 2OQHA 3BMXA 1A3WA 4KIEA 1VEMA 4UTWA 3UWEA 2IPFA 4P7QA 4QLJA 1OD0A 1TPFA 4LXFA 4X63A 1LCOA 1E6XM 4ZODA 3H7VA 1VENA 1TV3A 1AW1A 3LTYA 4XSMA 4OKDA 1W3NA 3VE9A 2JALA 3M0MA 3HO8A 2VWTA 1HJUA 2Y7DA 1U22A 3QZAA 2BY2A 1KGWA 4J40A 3DYMA 4IGSA 4AWTA 1FY6A 1F9CA 2GOUA 3VZZA 3LPOA 3MANA 4FS9A 5DY3A 3UXLA 1QNQA 3STGA 1JAEA 3MP4A 1WKFA 1JEZA 3UR2A 1EZWA 3KBJA 3H4GA 3R7MA 4LBSA 4XIAA 2FVKA 3ANUA 4YLWA 3WEZA 4JNYA 4GKTA 2NSOA 2GGGA 1K1DA 2PCQA 4DXXA 2H3DA 4O28A 3LG3A 4TXEA 1X98A 3CHDA 3EA2A 5PTDA 3DOPA 3RPDA 4LU0A 3VMNA 1VR6A 4NT0A 4QTGA 2DJXA 1M9HA 1K9TA 4JTDA 3WBXA 1YE4A 4GLEA 4H19A 5D8WA 4UZUA 4S3BA 3W7IA 6TAAA 4TMBA 1E5NA 1SZFA 1MEWA 1ZB5A 4LUIA 1J0HA 4MB3A 3FIGA 3KFTA 1XLAA 2QIWA 3LGGA 1T8QA 1PS9A 1JZ7A 4K7YA 1B0IA 3NG3A 5BRQA 3W2JA 3HFTA 1I0DA 3UEQA 1Q4NX 2XG9A 4FNTA 1GZJA 1CCWB 1DWAM 4QM1A 2QVNA 5CSUA 3MZNA 1GG0A 4UMCA 3SRDA 3EB2A 5LHEA 1A5OC 3LGEA 3QV9A 5EMJA 4HZMA 2CZVA 1TJPA 2ZDSA 3TEVA 4ZQRA 3S1XA 4Q22A 5REQB 3S8HA 3SCTA 5GNYA 1DJIA 4FXJA 5FF3A 4MM1A 1YDNA 4AEEA 3WMBA 3N1AA 4N2YA 2ASHA 4JN8A 4RZ4A 3A24A 1XSJA 3VNDA 3W29A 1XL9A 1YPFA 5JXQA 4C90A 4IMCA 3UG4A 4MB1A 4Y9NA 5HNRA 2VFHA 1DQXA 4JICA 2PD9A 5J5RA 1W1YA 1AA1B 1UHVA 3ZR6A 3BGGA 4GXPA 1C9DA 2R9RA 1FWBC 4O19A 4IIFA 2VDHA 4RX0A 3PBYA 3VZXA 4JDYA 2AMGA 3CHFA 3OG3A 3PAOA 4HNNA 3HOJA 4BF9A 4W88A 3UVAA 3H2MA 1WOBA 4MWAB 2DZPA 3G8EA 4C6IA 2BFGA 1KRBC 1AW5A 1O60A 1V08A 3LD5A 4I5UA 3W01A 5C6MA 4XBKA 3SN4A 3UR5A 3CB3A 4Z1DA 1BWVA 2VGGA 4IPJA 4WGXA 5BOOA 4QEEA 1PTGA 4UTLA 4CD5A 5F2IA 4DF2A 3BOFA 2QPSA 3RPTA 4BK9A 3STEA 3W74A 4QP0A 4IUGA 4IP7A 4I6KA 4BQ4A 2DSUA 1Q6OA 3P61A 2VEFA 4YTQA 1P6BA 3SCWA 3AI0A 5BWAA 1CXHA 1UCWA 1JZ6A 1AMKA 4XAGA 5EU9A 3SR7A 3W76A 2OQLA 2REQB 3B9EA 3DGRA 3TTQA 3CAWA 4C1NB 1HP5A 3BQ5A 3T44A 1H51A 3W7MA 1PTAA 4HU3A 1P1XA 1VCGA 1TJ0A 3CPGA 3IUIA 4A8LA 1JF5A 4XIMA 1B3OA 4IT1A 3KTSA 4IFKB 4IQEA 3UW6A 3TWAA 4I9TA 3NQEA 4TVUA 4K8EA 3WLTA 2FJUB 3EDDA 2XN2A 3QKZA 3TW7A 3WF2A 4DB7A 3DYOA 5LXEA 3KX6A 4C6LA 1RLCL 1QNSA 1QRQA 2DVUA 3R25A 2JE8A 3FKRA 3L66A 3HGSA 1EF3A 4H9VA 4JY9A 1R0MA 1NJJA 2OKOA 3TKFA 2DZTA 1SUXA 4YMZA 2CXEA 4ZSTA 2C3ZA 1SR9A 2BVDA 1AH4A 1H63A 2ZZ3A 1WKEA 3CZEA 4N9BA 4GVFA 3WH5A 3G1SA 5GPRA 4RLIA 3H2EA 4BEUA 3UPMA 4YU1A 4HHHA 1AQ0A 3H53A 4JQ4A 1TWWA 1YKWA 1FHUA 5EMUA 2J27A 2RJGA 1CNVA 1XM3A 2DW7A 3B8IA 4K8GA 1V6XA 3E0WA 3WJYA 2J8FA 1Z9AA 4D6CA 4LBUA 5LIUX 3AXHA 2VX6A 2EJ1A 5G1MA 2OOFA 3OQ8A 3SSZA 3TYEA 2GWNA 3VD7A 3K8LA 1TPEA 4LFYA 3QQWA 1ISXA 3PHAA 4B9ZA 4UFMA 1ZBVA 3U2ZA 2XFWA 2QCEA 2XSXA 3I6EA 1IWAA 4GE8A 1B31A 4AD0A 2CLMA 3GX9A 4ZTYA 2NT0A 4FP1A 2VGIA 2CLHA 4UWMA 1BWKA 2NX1A 1JFXA 5IHSA 1OFQA 4FF5A 3VGHA 1R5YA 1B54A 4CGTA 1GVSA 1JJKA 3RAOA 1TTIA 4LAUA 1J2BA 4Y96A 1RSCA 2BS9A 1Q6DA 4RJEA 5DEZA 2PDYA 2VZVA 2NQLA 3SZ8A 2X7WA 3QC3A 4WJXA 5GNXA 3AMGA 3MWCA 3DCPA 4X0NA 2G0WA 2JFEX 3GDRA 3D6NA 3VDGA 5G5IA 3NZQA 1ZLPA 1SR0A 4KCTA 5REQA 4O8RA 2PTYA 3NZGA 4H2HA 3V0TA 3WY1A 1ME8A 3ABOA 3SUUA 5D2TA 1CPUA 4DJFC 4U10A 4PB5A 5DO8A 1NSJA 2XJ7A 3GXIA 3GIQA 1VJSA 4U28A 4XKYB 4C5YA 1KFEA 3BPWA 4FX7A 1TJ1A 2B7OA 2A4AA 2OOGA 2ZUMA 1PKNA 1UWQA 5I3GA 2RKXA 1EUNA 2J6VA 2V2CA 3W7GA 1IXPA 3UZ5A 4BI5A 2ZXDA 2CKRA 2YYUA 4OQVA 1GCYA 3NOYA 1PVNA 3I7SA 1HQTA 3L21A 5CAKA 1TYGA 3SEPA 4UOQA 1L0PA 1EHNA 1W8SA 3Q45A 1S5MA 3N19B 4JHMA 3DBNA 1SO3A 1US2A 1KA9F 4DXVA 2XGBA 3QLLA 1PCWA 3T05A 4TTGA 3BAKA 5F1UA 4MWAA 5DMMA 2HMCA 4FB7A 2QJJA 3T4WA 5RUBA 4JFUA 2J4GA 1EH9A 4MAZA 4NP7A 2PGRA 4G5DA 4ROPA 3FN9A 2YXXA 5BXRA 4H9YA 2YLLA 1SJAA 1X1ZA 1TZ9A 3FK4A 3W73A 3WLMA 3W70A 4F66A 1H61A 1FH7A 3ABSA 3M41A 3OJGA 3R8RA 1GJPA 4ENLA 2VRKA 3JZEA 3F1QA 5DN1A 2ZRYA 3S4TA 1QU4A 5LGZA 3B0PA 4G9PA 3ABZA 1IQ8A 1UR1A 3ZJ8A 2OEJA 2PRMA 3PBMA 2GGJA 3MHGA 3GVGA 4CQBA 4D71A 3GU2A 2JF6A 2XVNA 2REQA 3N2BA 1IR2A 2HWGA 3EB3A 3A3WA 3SN1A 1JZ8A 2BDQA 5TQLA 4MADA 3KLLA 2PRLA 3AS1A 4NZ3A 1TJ2A 2H6RA 2NQ9A 3TU9A 3PZ9A 2R1NA 4O10A 4HD5A 4KPLA 4HMEA 1OFDA 3WUFA 3DXIA 3KDNA 2DT0A 1ECEA 3TLLA 1ONWA 5E0FA 2WBKA 4HT3A 4GABA 3QW4B 3DDMA 2R82A 4NJIA 5D8ZA 4EAYA 5FL0A 1G5AA 1AQHA 1TPWA 1ITXA 2YXOA 5CPSA 4DRSA 4K8HA 4Q6JA 3K8KA 3BSHA 8A3HA 1JQVA 4C6FA 3VNJA 4J2PA 3SIZA 6XIMA 2RJHA 4XZBA 3BC9A 3PJTA 4JTUA 4PMZA 4DM1A 3EPOA 1EJWC 3E49A 1OG6A 4F48A 2AKMA 3WEMA 2EG6A 2DGAA 1B90A 3EOLA 4RZBA 4JS3A 5DQPA 4CD7A 3RM9A 3CHVA 3WK3A 1YW1A 1E1CB 2J13A 1XP3A 1QOPA 3T2QA 1SO4A 1A5CA 3QMTA 2YL9A 2IW0A 4GBUA 3KW3A 3KBSA 3AIUA 1VYPX 1PPIA 2BBFA 1HVQA 1PDZA 2ZUNA 3O9NA 1LBLA 1AD1A 1OT2A 3G8RA 4N9DA 7A3HA 1I1WA 4WZHA 3GG7A 1TELA 5B80A 1JRCA 3P5ZA 4HOZA 5DMLA 1XX1A 3NGFA 3ONBA 4AY1A 1UZDA 1M7OA 1VHNA 3QGAC 1EJSC 1QT1A 1JFHA 2BASA 4GXWA 3TLQA 3GXPA 3M0YA 3TW9A 3CEUA 4DPPA 4MY9A 5AC5A 5LKYA 1EIBA 2UY2A 1U5JA 3B9DA 3FGCB 4ZB0A 4AD1A 4OUEA 1G4EA 3NQBA 4GC3A 3SGGA 1O6IA 2Y5EA 2H8XA 1XD1A 4EANA 2ZZ1A 1RVKA 3W1MA 4Z2IA 2QKFA 2FKPA 1DJZA 3FJ6A 2Y7GA 3GUGA 3NXFA 3RR1A 2VEIA 3LNMA 4R7WA 4OWGA 3LTSA 5KTLA 5HWNA 1UMLA 1VP5A 2XDFA 4BKNA 3HPAA 4K7VA 1EJVC 4EX4A 1AH0A 1TA3B 2HISA 3UERA 3GBEA 1EL3A 1KBIA 4LC8A 4NVTA 2V2HA 5D32A 1JUEA 3IEBA 1KFCA 2PWEA 1GZ1A 1RXOB 3LX9A 3LSBA 5FJTA 3LLDA 3K1GA 4AMAA 3MQTA 3KP1A 5D9MA 1KM5A 1AJZA 4HKPA 2ZRZA 4F9JA 5ENLA 2VZUA 3RU6A 4HJWA 1M04A 4AZIA 4BF7A 2J75A 2GPTA 1FBAA 3CQJA 2JKAA 4N42A 4GIRA 1NP2A 1XBVA 3SSJA 2YZ5A 1XUZA 3OG2A 5M3WA 3ERPA 3DFNA 2Z6IA 1OIFA 4K6AA 1YDVA 3ITYA 4MFEA 4NU7A 1A5BA 4R33A 5C2CA 1PX4A 3H55A 1JQXA 3N4AA 2GZXA 2OZTA 3AHZA 1F73A 1B30A 1BG9A 3CEPA 5GJMA 4JTGA 5CPOA 4B3LA 1QHZA 4ILSA 2J7FA 2QEZA 2WVTA 1IEVA 2PLJA 1SM9A 4PSRA 1EOKA 1UR9A 3RX3A 3KP0A 3PFMA 1BEUA 4OBSA 4H6QA 3EWDA 1V6TA 4LPCA 4Q4OA 3M46A 1G7VA 3RF9A 4L6DA 5C9XA 4BCEA 3P82A 3SUSA 5BCAA 4I5XA 1QI4A 3KL3A 3VC6A 2MUCA 5K9XA 3VIOA 3POCA 2PDPA 3UGRA 4X60A 2OX4A 3DG7A 2VC6A 4CN4A 3QV6A 1THFD 1E3XA 2JEQA 3OHMB 3HJEA 2Y1HA 1VRDA 3AALA 2PU1A 2FDMA 2VR2A 5HMDA 1R6WA 5CPNA 3R58A 4MIMA 3UJFA 4LUYA 3RU8X 3TDFA 5JVLA 4LEQA 3CL8A 3ES8A 5LNUA 5DLCA 5FEPA 3BOXA 2AQVA 2CWNA 4NZ5A 1FA2A 3IIZA 1W17A 3ITCA 1BF6A 3J7HA 3VX0A 3B8TA 3VNLA 1AL8A 1GOXA 1DXIA 1OC7A 5BNKA 2ZWZA 2WV8A 4S3CA 4TOQA 4LCQA 1VFTA 4KRZA 2PDGA 1KM0A 1B3WA 2XIQA 4DO7A 1AD4A 3WLJA 3KRBA 2J7EA 1GQNA 2HJPA 4PFHA 3QYSA 4GXMA 3TC3A 1GYNA 3ITXA 1JD9A 3NGJA 2NVDA 3DFOA 3RIKA 4D9PA 1E0XA 3RUBL 4JHOA 1SSGA 1D7FA 3U7BA 4RDZA 2FYMA 3KM8A 4M3PA 4R7JA 1DVJA 3ZT7A 1TVLA 4HHLA 1A0CA 1RAKA 3DESA 2WM1A 1SJBA 3LMZA 4WY0B 4MY1A 3GTXA 2WXDM 2XGIA 2A1YA 2ZUUA 4FX6M 3OLGA 3WN6A 4O54A 1YNPA 3PBGA 4N4PA 2X16A 1JCNA 4C6NA 4QLKA 3WL1A 2EEXA 3OA3A 5CC3A 1HFBA 1IGSA 4PUNA 4AD4A 4LYKA 1ZP4A 1DQWA 5E0KA 3MKVA 4W8LA 2W9MA 3AHYA 5ABEA 3ZMRA 3UGVA 1IEIA 3WF3A 3KOWA 2NW0A 4DNMA 3WD0A 3FS2A 2D69A 1UKTA 2PDKA 1MNZA 2I17A 1V3HA 2GSHA 3WZ0E 3QR3A 4Z1YA 5HNNA 4TMCA 3IGHX 2BOEX 3B8WA 1MDLA 5DXXA 3HJZA 1OGGA 3RMJA 2ZBTA 3D3AA 2E9BA 2NWSA 4L9ZA 1Q2SA 4EXQA 3VKKA 4DJDC 3PUOA 2XVPA 2OPJA 2PSNA 5C9ZA 3AU6A 1F8IA 3GDKA 5D2YA 1GHSA 4RDWA 4IZGA 2IQDA 1NWRA 4LRTA 4OIFA 1H1ZA 1F61A 4KH2A 1XI3A 3OZYA 1HZYA 3DHFA 1F8MA 3GTFA 4IQJA 1XIJA 3WQEA 5I00A 1V3LA 3G22A 2OLSA 1Y5VA 3F2CA 4GY0A 4OHQA 3S2MA 1TA3A 1RCQA 1FWCC 1P6WA 3L4YA 3EWWA 4DWSB 3G3MA 4HSNA 2QPUA 3PUDA 1Q7QA 2VCBA 5M2FX 3QM3A 4IFOA 3MC5A 1QI2A 4LF2A 2HRWA 1REQB 3PM6A 4FLSA 1GUVA 1G6CA 3EWXA 5HMSA 3Q37A 3WNNA 7XIMA 3FKKA 2ISWA 2I9UA 2WZHA 1BVZA 3EPMA 4AWSA 5EPDA 2ATSA 2IKGA 4O50A 4QJ3B 2HTMA 1T5AA 3BOLA 1EEPA 2WLZA 4CU6A 4XZHA 3FDGA 4PMQA 4A2SA 3WQWA 3OYZA 3GSMA 4CQAA 4B16A 3GG8A 4GD0A 4QDWA 1MXGA 4OZOA 3DFPA 2E7FA 3E5BA 4ZFCA 4F79A 4Y9OA 4K2SA 3VPLA 2I14A 1YE6A 4S23A 5AC7A 3QSRA 1L6GA 1IWPA 2J7CA 3ALFA 4MMWA 2J9YA 4ZSUA 1TPVA 3O6CA 1FH8A 5A69A 3TYDA 3MUAA 1XPGA 2HV5A 1OCJA 3FJLA 1FFRA 4FMVA 1QO2A 3D5HA 3RG6A 2VWSA 3GLCA 2Y61A 4MJ4A 3VE7A 2Q3OA 4X2RA 1EA0A 5AZ0A 5IM51 3F4CA 1UPPA 4C6QA 3SGUA 2FHCA 2E4TA 4IISA 1R2TA 3ABQA 1PYFA 4FNSA 2WPGA 3AWOA 4LNYA 5AECA 4O0KA 2VM8A 5DBTA 4I7VA 3WDRA 4XD3A 4QCEA 1P7TB 5MHBA 1SYTA 2HE8A 4D1JA 2BB0A 1W2PA 1PTDA 3LCXA 3FEQA 4JIRA 2OKTA 1UWAA 4LVBA 1E6ZA 2Z1VA 3N6JA 4D1IA 4O17A 1M65A 4GMEA 5C54A 2YCIX 4DI8A 1FX6A 5EMLA 4TIMA 3P3BA 3G0UA 3NEHA 1EC9A 4YJ5A 2PP3A 1MNSA 3T07A 1EKOA 3N4FA 3EX3A 3VOJA 2JIWA 3A5VA 3I7RA 3SY1A 3MBDA 1VFLA 2F9RA 3CMGA 1PDYA 4GI6A 3N4EA 4MKVA 2QCDA 3WJXA 2Z28A 5I3FA 4F9DA 2Q09A 3BGAA 1KLZA 4GGHA 4Z2KA 2EPNA 1WDPA 3CYVA 4PTMA 3URNA 1Q5MA 4KT2A 2EPHA 2GSEA 1X6NA 1MYRA 2NT1A 1Y65A 1CLKA 1QPOA 4LVFA 2ZUSA 5A6MA 3IAQA 4ERAA 4H9XA 4LB3A 1MW3A 1Y7VA 3CZGA 2EXOA 2WM0A 1E9IA 4PC8A 1OBAA 1UUMA 3TROA 1VBRA 1X7IA 5D05A 4UCGA 1G9HA 4Q4QA 1MZRA 3WBWA 5F4XA 3QOMA 3STFA 1Q3NA 2WNWA 2R94A 1KM6A 3M5VA 1M53A 1TO3A 1JF6A 4WDUA 4L1GA 2J7HA 3K8MA 1BSIA 5AHFA 2OWCA 1GPFA 4WY0A 2R14A 3HV9A 4RPQA 1R7OA 2Z00A 1UD3A 3N9SA 1W56A 2NSXA 1EBGA 3IIPA 3B8DA 1B57A 2ISFA 3I3DA 4R9XA 3AAMA 3GHRA 3HA1A 3MYOA 3UU0A 5CZKA 4LY8A 3VKAA 1JCJA 3O0KA 4F0RA 4R53A 2PWFA 4W5UA 1W9VA 3R4IA 4A22A 3NL3A 2V8ZA 4WR3A 2UV8G 4XB3A 2Q6ZA 2YBVA 2X1IA 3W7OA 4IIBA 5CJNA 1ZNNA 3TQVA 1EFZA 3ABRA 3EWYA 1Q6GA 4NYUA 2C18A 3W1LA 3O3RA 2BHZA 4XQ6A 4B2DA 4O12A 3P60A 3A3HA 4L4OA 4ATWA 1FDZA 4NG3A 3MCNA 3M07A 2QCCA 5IOBA 2QCNA 3BANA 1QNOA 1WBJA 2DSKA 3N73A 2YCJA 4M7TA 2O92A 3MMDA 4GYKA 5D09A 4M51A 5FCZA 5H2ZA 3CYJA 3WH9A 3MCMA 1LJYA 5FJUA 1WX0A 3QEZA 5ABTA 1H4PA 3AYSA 3BMVA 5E09A 1M6JA 3ENLA 3VD4A 4QRNA 4DWSA 4P61A 4M7SA 4DI9A 4ECLA 3DX5A 4AVNA 1VIWA 5A8GA 1QPQA 4PUDA 1QPRA 4Z1BA 4RPPA 3I6TA 3QZEA 2DZUA 5AHLA 1X96A 4AX7A 4J2MA 2KAUC 1FVPA 1W1PA 3LHVA 3MSGA 4WLCA 5EMKA 1ADSA 3LHZA 3WQGA 3QQ1A 1AVAA 2WANA 3PWIA 3LZ5A 4H9ZA 5TNVA 1US0A 2PDMA 3T0TA 1LQ2A 3GXFA 3LERA 3H8AA 1GOOA 3CO8A 2JBMA 2ZZ7A 1V6WA 1C8XA 4JFSA 4PMXA 3JZUA 4IQDA 3QR0A 3CWOX 4YHEA 3UY7A 1A80A 4DPQA 4YVPA 2VX7A 4XD6A 5FACA 1TR1A 3L5MA 3UWVA 5J5DA 4FALA 5DT7A 2YBTA 1MEIA 4OV4A 5FF2A 3PZQA 4WK9A 4IPLA 1Z42A 2IKJA 2FMNA 1K8CA 1KBBA 2CZEA 4JTFA 1AQFA 2YL5A 3QSTA 3RFAA 1J0YA 3PPFA 1TTPA 5JBEA 1P7TA 1JI1A 4Z42C 4HA1A 3HZ3A 3WH6A 3FHQA 1XLHA 3KCOA 4LH8A 4PMDA 4H4IA 1QI5A 1KR1A 2V3EA