4AFYA

Crystal structure of the fimx eal domain in complex with reaction product pgpg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIMX
publication title Crystal Structure of an Eal Domain in Complex with Reaction Product 5'-Pgpg
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4afyA00
4F3HA 4Y8EA 5MF5A 4LJ3A 4Q6JA 3PJTA 4AFYA 4Y9MA 2W27A 3GFZA 3HV8A 4KIEA 4RNIA 4J40A 3PFMA 4AG0A 5MKGA 4F48A 4RNFA 4Y9NA 4RNHA 4FOKA 4Y9OA 2BASA 3PJWA 4ES4A 3GFYA 3N3TA 4FOUA 3GG1A 4HJFA 5M1TA 3GFXA 4HU3A 3TLQA 3HV9A 3PJUA 5MKGB 2R6OA 3GG0A 4FOJA 3S83A 3PJXA 4RNJA 4LYKA 4HU4A 3KZPA 3U2EA 3SY8A 4Y9PA
chains in the Genus database with same CATH superfamily
1Q6DA 3SBFA 5DY2A 3NURA 5GNZA 1E43A 2QQ6A 1OFBA 1QXLA 1QOXA 1BYBA 1OC6A 1SU5A 4K7VA 2HQAA 1PWMA 3NYDA 1VJSA 1KCLA 1QNPA 1CWYA 3AIBA 2X0HA 5JVLA 1UJQA 3VIMA 2VT0A 5BW6A 2JK2A 2H6RA 1Y7VA 4IFRA 3CQ0A 2DGAA 2ISDA 1XIBA 4WDXA 3UQNA 1QW7A 3HQ1A 3PY2A 3HPXA 1PWLA 5C70A 3P0XA 3BSMA 4K2SA 1IZCA 3FSTA 4PBGA 3HPAA 3VX1A 5E70A 4P7NA 3BGGA 4TX6A 4UFIA 3EOEA 2DUAA 3GFYA 3BICA 1EO5A 3QRHA 4ZVJA 4AD1A 1PTDA 3QOMA 4KRZA 1RR2A 2BXVA 4DF1A 2NLIA 2OU4A 5IDZA 3ZVHB 2J9ZA 3HG5A 5CC3A 1IEWA 1B3ZA 4W5ZA 4FF7A 1XHGA 4W86A 4RPPA 1FWSA 1KWGA 3IJ9A 5HMEA 3R12A 3E2QA 3TXZA 2VGBA 4C7DA 2Y63A 1P0EA 5D03A 1VCGA 4RPQA 2ZRUA 2PLCA 2J7BA 3GK0A 3GDMA 4NY2A 5B80A 5HANA 1F8IA 2P88A 3WBAA 4CD6A 1VC4A 2FZ9A 3WLOA 4A8LA 4MWAD 3C8NA 1A5SA 2GDVA 3WH6A 1DEDA 1ZU8A 3N6HA 4I90A 5AC5A 4QCEA 3VINA 1NWUA 8XIAA 3PZVA 1HJXA 3AIVA 1LZOA 1F3XA 4HCDA 5D04C 1GW1A 4L80A 4AIOA 2GUBA 3B8IA 2XHYA 3AXIA 3IK4A 1EXBA 3G18A 1C92A 3W37A 1XBXA 4PB5A 1Q65A 4RNIA 4NASA 4XX6A 2ZXDA 4C1LA 4MB4A 2I9EA 4QS5A 3M0VA 1PJ9A 1SQ7A 3EEZA 1J2BA 4MDPA 1RD6A 2ZRXA 3NWRA 1AMKA 3LX9A 3GY1A 4P8WA 4C5ZA 3VDGA 2NT1A 1JCYA 4JAWA 1BTCA 3W88A 1Z42A 2CHOA 4EX4A 3A13A 3QHMA 1GYLA 5PTDA 3S5NA 4XIMA 2VRQA 4S1FA 3C0QA 2WKJA 4DLMA 1BAGA 2UWFA 2WW5A 1RCQA 3STGA 4P7QA 4HYRA 3IVUA 3N2XA 2VR4A 3GLCA 4WEVX 3GFXA 5AZ1A 5FJPA 5BMXA 2Y85A 2DH2A 4NZ3A 1TV2A 5GPRA 3SM0A 1JDFA 1EIBA 3R1ZA 1NFGA 1V0LA 1BGGA 3VTRA 1XDMA 1R3WA 3NDZA 4GJ1A 3P82A 1GQLA 1HKKA 2YOCA 5BOEA 1JCLA 3LXAA 2E77A 1I75A 1GONA 3CHDA 3RPTA 4AZIA 3ARVA 2EXOA 2QJJA 1Q3NA 3QC0A 2UY2A 2E25A 1TWIA 1B3OA 2D3LA 3V18A 2G0WA 1A4LA 4XBSA 4IQJA 1R2TA 1JR1A 2IQDA 5AYIA 3WBXA 4WX2A 2YB4A 1G4EA 5FSDC 3PBMA 1V0NA 4MTVA 3OPSA 5DT5A 2ATSA 1RSCA 1Q5MA 2D0GA 1GPFA 3NSNA 1HKVA 3NOEA 3PUEA 2HPMA 4UQAA 3N9KA 4OKDA 5D37A 2Z28A 5C71A 2BY0A 4R88A 2GJXA 1EJSC 4JDBA 3NJ3A 4M8UA 1FWCC 3BL3A 3TSDA 2J7HA 3U2EA 5D05A 3UWWA 3G22A 4JIIX 2VYOA 5AB3A 2GGJA 2HK0A 4C6LA 3UCQA 1BVNP 3HGJA 2HE5A 1J5TA 3LGGA 4RE3A 2BGNE 4UTMA 1W9DM 1P7TB 4DO6A 1XRSA 3MVIA 3RCMA 2D24A 1SW7A 5K3VA 5AHLA 4H6EA 4B3LA 1IZKA 3TW6A 4I8DA 5F1UA 4E4UA 3GTFA 2OWCA 3W1RA 2NUXA 3PG8A 5HJLA 4C90A 3KE0A 1Q6LA 1CEOA 2OZ0A 4WGXA 3CUHA 4DUOA 3VXGA 3S5OA 4DX3A 3B8DA 3NIYA 1OC7A 3VKDA 5M17A 4FB7A 1RXOB 1MSSA 4GKTA 4MNJA 1IT8A 1HQTA 3T0TA 2Y4SA 1NJJA 1DXIA 3KRSA 3GHUA 5BWAA 2ESCA 2OX1A 1V8EA 3UW6A 3CPUA 3THQA 1QASA 1ITCA 3K1GA 4FI4A 3KDOA 2VWTA 2CZFA 1R3VA 5ABGA 4FNUA 1XSKA 2R6OA 2BV9A 2Z1XA 1E55A 2ICSA 2XZ9A 5EYWA 5FF7A 3V5CA 3VC5A 4F48A 1R5YA 4TX9A 2WYSA 3EX3A 3WY1A 2WMIA 3MDUA 1EJRC 1UD3A 3USZA 2A3LA 1XRVA 2VJXA 1AQ0A 5U7SA 3CZJA 1NQKA 1SMDA 3CH0A 2Y7EA 1J5SA 3OG2A 3H7RA 3ZLHA 3E5BA 4IL0A 1UHVA 3NZRA 4MYAA 3TP4A 4FA3A 4KF1A 3WF4A 1BSIA 2W62A 1YIXA 1OM0A 5DMMA 1H7RA 1QTWA 1US3A 4Q7IA 1Q45A 1FWHC 1OSEA 2PDPA 5BNKA 3QBUA 2YBUA 4CEUC 4HB7A 4KCUA 1YE6A 2D2JA 1I6NA 3FYOA 3SSJA 4UOQA 3ZM8A 4FXRA 1GVSA 2J66A 1Q13A 1DIDA 2GGEA 3W76A 4YVXA 1X6UA 1QUMA 3B0XA 3ELFA 1VKFA 4PFMA 1MNSA 3W2LA 1RLDA 4LBSA 4JOMA 5BMWA 1PZ1A 1UROA 3M0MA 1HJUA 3DECA 2WHKA 4QITA 3SAZA 4HCHA 2J77A 1LOQA 3I68A 3B9DA 3IACA 2E09A 1AJ0A 3MSGA 1OZQA 4M29A 2ZUSA 3GSMA 3WNOA 3DHPA 4JX4A 5DBUA 3A4JA 3LCIA 4DI9A 1FWRA 4F0SA 4JFVA 1K03A 3VC6A 5T9CE 1QNVA 4O15A 3H23A 2RGMA 1RJRA 4GX8A 1DJQA 5EKYA 3EB3A 1ZHAA 3RGTA 3CUIA 1Z44A 1PCKA 3F2CA 2ZADA 2OEKA 1Q4NX 2PC8A 3W0KA 1JF6A 1XIGA 4O8AA 2I14A 4TUFA 2V6AA 2QT3A 1GZ1A 1I8JA 5GJPA 3RRXA 2Z1VA 1X6NA 2ATMA 1VEPA 1P0DA 2YBVA 1V4YA 4G5DA 1W9XA 3GR7A 5EMLA 4BA0A 1WO2A 4HQVA 1UWTA 3O6DA 1VH7A 3TQ0A 3F2BA 1XCXA 2WANA 4A3QA 3P3BA 2REQA 5M2FX 2YL9A 4AF0A 2FTPA 4NZCA 2WHJA 2ZQ0A 3L0KA 3CQIA 1ZGDA 3H70A 4QR6A 1E1CB 2V3EA 2EO7A 3CTTA 3GD6A 5A5WA 3RK8A 3SUVA 2DVTA 2PD5A 4TVCA 1R9XA 4O0ZA 2ON3A 1JYNA 5C9UA 3KTSA 4L4OA 1HJWA 3R94A 2E1WA 4Z42C 5FCZA 4AIBA 3GM8A 4QBXA 4UWMA 4LF2A 1E6PA 2V69A 4QLLA 3W86A 3KX6A 5LSMA 3O7UA 3WENA 2WZHA 4OOUA 3VOCA 3TYAA 3VNZA 3CH9A 4F4RA 2XPKA 3T0DA 3T9PA 4NKCA 1KM3A 1RJPA 1GJPA 3ORWA 4Q4PA 1EH9A 4D6GA 5AVHA 1Q7MA 3GZAA 4Z1DA 3URNA 4HHPA 5I77A 4ZO8A 4GY0A 3N13A 4S3GA 2PDGA 4H6QA 2QVHA 4DJFC 4R33A 1R87A 3W53A 1RALA 2H8ZA 3PPHA 4WQ6A 1NELA 4J28A 3BG5A 3ERPA 4UFHA 3LLFA 3UZYA 1CLXA 2NUYA 1K7EA 4JN6A 4UC5A 4ZE5A 1KM4A 1U30A 1YX1A 3L4UA 3SCRA 5TF0A 3T0AA 1J0KA 3FSUA 3G1DA 3IJ6A 2YXGA 1IEXA 4QQUA 3CL7A 3FLUA 4GJIA 2QCEA 1E1EA 5H1WA 2WC3A 2I56A 1PZ3A 1GCYA 4N9DA 8A3HA 2GGGA 1W6TA 4OVXA 1O5RA 3W6MA 4JIHA 1MRAA 1JXJA 4S3AA 4FNPA 3M5ZA 1TPWA 3LMZA 1R3TA 3PBGA 2QUVA 3WX7A 4QROA 1F9CA 3F4VA 5DELA 2XFRA 2VQTA 3QMSA 1DORA 4NHVA 4A22A 3CWOX 3WQWA 2ZWZA 3I6TA 3T09A 3LOTA 4AZCB 1XJBA 4B2DA 3L0GA 3G1RA 3VE9A 2C79A 4PTMA 4MJ2A 4R9OA 1KLZA 1J6PA 1XICA 4L6DA 1AH3A 4JCLA 1YTKA 1AUSL 3QHNA 4GISA 3TQKA 5D38A 3CLMA 1LORA 3BQ5A 2VDIA 2PI6A 3UJ2A 4N2YA 1GOQA 3R0KA 2WBGA 4NJGA 4OHQA 4LANA 4RJEA 3POCA 5ABEA 2ZUUA 4B92A 4K7YA 4RDVA 2C3ZA 4NSBA 1EXPA 3QV8A 1AVAA 3NL6A 2XH0A 3B8WA 3AMLA 4FIRA 4EOUA 8RUCA 2WOQA 4P7LA 4CKQA 4IIGA 1NF0A 5CZTA 3QGAC 4LU0A 1JF5A 5G2WA 2NXIA 5G4WA 3BWWA 1DXEA 3I3DA 1VRDA 1JCJA 3O0FA 1QPRA 4FOKA 4K8HA 1DJXA 2D2GA 3CV7A 1US2A 3I10A 2X1SA 3AHYA 2FHFA 5A8OA 1X1OA 4PTWA 2J6XA 3UZXA 3AU6A 1BG9A 4LSBA 1S2CA 3GIPA 2WAGA 4R27A 1C93A 3DYMA 2VEMA 2WCSA 1U1UA 3SW6A 4CN6A 1GPWA 4Z2GA 1WDWA 2CHNA 1UPMB 4PUMA 1KQZA 3OBKA 3OG3A 3TK7A 4IPPA 3TTSA 6TIMA 3N6QA 2QKFA 1Q8JA 1RPXA 3CUFA 3R13A 4C6BA 1Q63A 1QDSA 3VZZA 2PUZA 5L6UA 1OYBA 4ZXOA 1JZ6A 3M16A 2QW5A 3JZUA 5MHBA 1XH2A 2I7GA 5FL1A 4UTJA 3U3HA 3PWAA 1UIPA 2GSJA 4JY8A 1QO2A 2ISWA 4HP5A 4Q4RA 1GEQA 4YIWA 3QR0A 2NQZA 3GNOA 1IF2A 2QCFA 2DEPA 1SFJA 3RN6A 1YPFA 3WK2A 1WCGA 4DBUA 6A3HA 4W7UA 1EQPA 1GOIA 1UR9A 1B3YA 4FXFA 3T08A 4YHEA 1RBLA 1YNYA 4GY7A 3G5EA 4QDMA 3M0HA 1F4AA 3AFBA 4EIVA 5KZEA 2WSRA 2HMCA 3THAA 2WWCA 1XL9A 1K4GA 5CKSA 1EB3A 2TODA 1JZ2A 3HF3A 2EPKX 3WQVA 1W1VA 4DB7A 2X16A 1EDQA 3N2MA 4HKPA 4Q4KA 1IXQA 1ZJHA 1HO1A 5M3WA 2J7DA 2QPSA 1R9ZA 2OYMA 4YXGA 3B3DA 3V75A 4AY8A 2DH3A 4Q4QA 3DH7A 1UC5A 9XIMA 4JTGA 1LP6A 2VC6A 2XN0A 4KS0A 1P4CA 1FDJA 2PU1A 1S2UA 1IXNA 1CB7B 4DIAA 1Q6RA 1UIOA 3OZOA 1J8VA 5BXPA 1OJXA 4M5PA 1H62A 5FJRA 4IIFA 4CU6A 4FOUA 5C5YA 4IL2A 1MUMA 4WDTA 1V3JA 4LRTA 4LAMA 2VNCA 4FZIA 3FDKA 1IXOA 4DELA 3N6JA 2WSPA 4JKLA 1KCZA 2P0OA 3EDDA 3FGCB 3TE9A 3R10A 2ALRA 4QS6A 4C6NA 3ZIZA 1B90A 1VHCA 3PZGA 4LV9A 4BF7A 2WNQA 4XVEA 1LM1A 4DAFA 3E74A 5H8MA 4X9YA 3IK2A 3IUHA 4F2BA 2POTA 4NAEB 4BFAA 4IOTA 1XC6A 3BLEA 1H4PA 4FLRA 1YRRA 3JUGA 2NXHA 3LD5A 1FWTA 2QCCA 2W3ZA 4XBJA 4AZ6A 3HFTA 2BVDA 5JU6A 3GVWA 1W1IE 4PR4A 4DXXA 4HNTA 5HQEA 3E0FA 1MYRA 3ZR5A 3WQOA 1XYMA 5HOSA 1QI2A 1XRFA 4AVFA 1DWJM 2R94A 3GH7A 2PDKA 4K8GA 3UWZA 3GVVA 4PCNA 3V7PA 2VEGA 2VVSA 4C91A 3B8VA 3NZPA 1GTEA 2J7EA 3ARPA 4MLRA 4ZOBA 4YYCA 2PCQA 1BKSA 1YYAA 3NPVA 3L0NA 1BXBA 1IWAA 3KWXA 3DFOA 4MLJA 3AAMA 5LNVA 1QK0A 2P50A 4ILSA 4JD4A 2OXNA 3ONBA 1MXGA 1FX6A 4GZIA 4O0QA 3S6OA 3WJSA 3TIMA 3KL0A 4ZMGA 2PDXA 3TONA 2PZ0A 4FF5A 5E0KA 3WSUA 5EFFA 5D8WA 4HSNA 2WSYA 1VJIA 3M7SA 3OLGA 4QLJA 4AIEA 3WNKA 1WPCA 1TREA 2G8ZA 5AC8A 3ZQ9A 2GJPA 4IFKB 1DQXA 2Z1KA 4JTCA 4BQ4A 4HNNA 3L67A 5DLCA 3AYTA 1AMYA 3DYOA 1F74A 1TX2A 1BGAA 3ZMRA 1JDEA 4LCQA 1E4IA 4HPGA 3MO4A 1XLFA 1UKSA 3CZGA 2CU0A 3BXWA 4DO7A 1PDYA 1OGGA 3APYA 4H4IA 2WVSA 5KINA 4OBRA 2Q8LA 4OU1A 1L2UA 2F6UA 4EWND 2A3CA 3UD6A 3ZJ8A 2G4FA 3AALA 2NWSA 1VBRA 2ZICA 1X7IA 3DFQA 1XPYA 3DEQA 3M64A 3WELA 3FXYA 1Q8AA 4QDPA 4C6PA 2Y2WA 2BX7A 2WKLA 1MUCA 2GJLA 1B0IA 2VZOA 4B5UA 2OEMA 4WRHA 1P6BA 5D02A 1KM1A 4DAIA 1YADA 4HA4A 3UVAA 1EUAA 1YBQA 1ICSA 4AHQA 4AD0A 3LGEA 3L7RA 2DZVA 5HWMA 2PAJA 4AXNA 3A24A 4WJEA 1TO3A 1JCNA 1BKHA 1DYSA 1OFAA 1PSCA 4XZLX 3AZRA 1JFHA 4REQB 3MJMA 2BGQA 1RCOB 1OZMA 4UQ9A 4UXDA 3BK0A 2CHRA 4PMDA 3U57A 3CUJA 1V3IA 4H2CA 1QWKA 1JRBA 2DSUA 3FCPA 3IGUA 2G3FA 3O0KA 4MJZA 4CQ9A 4UTUA 3SY1A 3PFRA 1AW2A 4KEUA 2DZWA 4ADTA 2IPFA 3GXDA 3QGKC 3O6YX 4J5NA 2ZWYA 4H8VA 1TX0A 1ESWA 1PUDA 3U48A 2PF8A 5LXEA 3PHAA 3ZLFA 4D71A 3G8EA 1R2SA 3B05A 3WNPA 1TPC1 1G4PA 4GYPC 4XAGA 5FJIA 1K6AA 1FXPA 1TZZA 3T07A 2E0PA 1EGZA 1WAUA 2VEIA 2IKHA 1RY8A 2DVUA 4PTXA 3YPIA 1DJNA 2DW7A 1KW1A 3GG8A 3DOPA 2NV1A 5CC5A 1RBAA 3GNNA 2GJNA 2XIIA 3WLJA 1TTIA 1BYCA 4FP1A 3TLQA 4QM1A 2V0TA 3KXQA 2YFNA 3CMGA 3GRIA 1Q7ZA 4NZ1A 2BY1A 3NVTA 3WQPA 1OFEA 3QR3A 5GJMA 5CAKA 2PRMA 4RR4A 3GH4A 1BEUA 1I9CB 3ONCA 1V6UA 4OJYA 2YL8A 4YPJA 7REQA 5A95A 2XFYA 4B91A 5F1VA 1J12A 4DWSB 1C9WA 2QJMA 4AXKA 2CLPA 2E5CA 5A2BA 1YMYA 4B5SA 1R38A 3CS2A 4LAKA 1W1B1 3D3FA 2PDLA 5D4YA 5AFDA 3VGGA 3WD1A 4O1BA 4J3WA 2WXDM 1DWGM 4AIUA 3MSDA 2GSEA 3FX4A 1F05A 4W8BA 3SQMA 4G7EB 1YTEA 2DJXA 4LTSA 1KNWA 3GU1A 1KBBA 2OODA 3TTQA 1XYAA 5TD4A 4JYDA 5BRQA 3ZZ1A 3TU9A 2A0NA 1K1DA 3MHGA 4PTVA 4NU7A 4TIMA 1H61A 2EHHA 3EGJA 3IIOA 4LOCA 5M5DA 2TMDA 2C71A 5FSEC 3ARUA 1NWSA 3UEQA 1SUXA 4ES4A 2WKGA 1MWOA 3NVDA 2CXGA 1H0IA 4X61A 3HN3A 3AIRA 3WMCA 4Z17A 1XG3A 2GVEA 3WQDA 3FS2A 4HNUA 1V6YA 4ZENA 1VBHA 2IPWA 1IXPA 1TVLA 3W1PA 3VDBA 1XD1A 4BEQA 3THUA 3QZEA 1DVJA 4MB1A 3RDKA 3QEZA 3TYDA 4KGJA 4GVFA 3TH6A 1ZBKA 4DJFA 3TZNA 2XVNA 3OIXA 5EFDA 3PPFA 1P1MA 4UTTC 1KCXA 1UCWA 5DMYA 5BOFA 4UQBA 4KCWA 1XLGA 1VYSX 3UJFA 1KR1A 1VCVA 4U2ZA 2YCLB 4XBKA 2FPYA 1OCBA 3POHA 3NO1A 3PF3A 3VOFA 5K7JA 3LPOA 5U4NA 4CN4A 1ML1A 2R1KA 3W22A 2CLKA 4H7CA 2PDQA 3O6AA 2O9TA 3CAQA 5AC4A 4F0MA 1DBTA 4MZYA 3K4DA 3NPWA 5CSYA 3LBMA 3SUUA 2RAGA 4JTJA 2QLYA 4E3VA 2VC5A 4D9PA 1F76A 5D09A 3VOIA 4BQ3A 3BZJA 1W56A 2HNHA 3KLLA 3W9ZA 1JZ5A 1RK5A 5EB8A 4L64A 2IUZA 3I4EA 4PC8A 4ASTA 3LQLA 4GC4A 2CBUA 1TPDA 1UWAA 2A3HA 4IM4A 4H9TA 4AC1X 2HVMA 3BURA 2BDQA 3NA8A 2B7OA 3BH4A 4MKNA 3L21A 1X1ZA 1LDCA 1IHIA 3C5QA 1JYVA 3MCNA 3CBWA 3BC9A 5C2XA 5KZMA 2WJEA 1UC4A 3NZQA 3IGXA 2PODA 1FVPA 2TRSA 1J10A 1LQAA 2ZRWA 4PMVA 5B7ZA 5BCAA 1H1NA 3GAYA 1W8SA 3SO7A 5ABTA 5A6BA 2VFEA 1LYXA 1NDVA 2Z6IA 2FVMA 3GO2A 3L68A 2GQ3A 3NO5A 4G6CA 4QFUA 3O3RA 1MQQA 1XYLA 4RNJA 2PFHA 2DW6A 1O1ZA 2E9BA 4MG4A 4AY1A 1XW8A 1VIWA 4QQ3A 4NNBA 4AZCA 5F2LA 3LI1A 2HBXA 1XUUA 4Z08A 2ZZ3A 1GVYA 3CJPA 3T4WA 4RZ5A 4MKSA 2R8WA 2FZNA 4PB4A 3U2ZA 3A22A 3CUZA 3MUCA 3DN5A 3GIYA 1POJA 4KEMA 3M5XA 1H51A 2CYGA 4LUJA 3QYQA 1JEZA 1XC4A 1FUYA 1JDCA 4IMDA 5LNRA 3ITLA 3FFSA 1EF2A 4JZ5A 4PCTA 3VYLA 4AZ7A 2ACQA 2ACSA 1CX9A 4N9BA 4U3AA 3C2OA 4NL1A 4JHZA 5CCZA 1EJWC 4HOWA 4GA8A 1ZAIA 2YJQA 3U7BA 1PHQA 1UZHA 3KTCA 1W8GA 1DJYA 2DT3A 3VILA 2XH2A 3UG5A 5C9XA 3SGUA 2AMGA 3RFAA 3AI0A 1PX8A 3ZS4A 2HISA 3TNOA 2NX1A 3UY7A 1E9ZB 1T99A 2FTYA 4C65A 3S42A 1VAHA 3NTYA 3BANA 3LU2A 1ZBVA 3LTPA 1I4NA 4NAFB 1XKJA 4G7FA 3WCZA 1Q4WA 2C18A 4Y9MA 4LC8A 5A6MA 1EJTC 3MMTA 3NGJA 2XFFA 3WLLA 3QZ6A 3RLVA 4UTLA 5AHFA 4ADSA 1LBFA 4DPPA 4ICMA 2B7PA 4IIBA 4UNLA 5E93A 4JNZA 3A9IA 1ITUA 1EUNA 2XFWA 4MZ8A 4U3CA 3FA5A 2ZIDA 1QNOA 2Z24A 3M41A 5LXXA 3LV5A 4CNSA 3HGOA 2FKPA 1QCWA 4MPQA 2QEZA 1NDYA 3OQ8A 2VHLA 1IEQA 1EGVA 5DEZA 2BLEA 1OFOA 3SJ3A 4MOZA 3JR2A 1CXFA 3WIJA 3B0YA 4IPNB 3E9AA 3GKFA 4NIRA 1QPNA 3M0LA 1YNQA 1QR7A 1L0PA 1VCFA 3BAIA 3C86A 2OCZA 1KBJA 2CC0A 1W5MA 1G5AA 1Y5WA 2VP8A 2ZC8A 2FFCA 2DP3A 5HUOA 1S3TC 4NP7A 4KWOA 3QF0A 3WJYA 1E70M 1W2PA 3W1AA 1KXTA 4NJKA 1NWTA 5EPDA 2EPNA 2Z25A 3RF9A 2O55A 4ERIA 4O17A 1XGDA 4KWVA 3UXDA 1J96A 2E6AA 3LV6A 4C7FA 1UKPA 1YDNA 3BZGA 3IV3A 3AIUA 1BSLA 3R79A 3BAWA 4LRSA 4N6FA 2CLLA 1H7WA 3RMEA 1UOKA 4O0KA 3JW7A 3PP7A 1EYEA 2I5IA 4NX0A 3H2FA 3BGJA 4IUGA 1XIFA 3V3WA 3W28A 2YXXA 5AN7A 3NPUA 3LENA 1E0TA 1N8FA 3GXNA 4GLEA 3VCRA 3H2MA 3R8RA 3LBOA 1IEVA 1O94A 1BQGA 2JF6A 1LBLA 3SRDA 2X1IA 1AJ2A 3LCGA 3II1A 3ZXWA 1ADSA 5E6ZA 1KRBC 2QCGA 3P5YA 5HR6A 4Q8MA 3T0BA 4GPNA 5I3KA 1RHCA 3MI2A 3S5SA 1OFDA 1VFTA 4ZGYA 4QXIA 1JCXA 1RCXB 2QULA 5D2YA 3LQGA 3WK3A 2V2HA 4JNYA 3PBWA 2ZX6A 1FWIC 5FIPA 1W0MA 5D2TA 3KBWA 1FWDC 4UZSA 1GKRA 4NILA 5AOUA 1I2OA 1GVOA 5CBIA 2ZFAA 4UTHA 4ZQMA 7TIMA 3LK6A 4LJ3A 3B04A 3LB0A 4HNOA 1AH4A 5AZ0A 1VR6A 4L9ZA 1EIXA 3W7LA 3PANA 4ZB0A 4AZHA 3VKJA 1WUFA 2OR2A 2XZ7A 4E8CA 5LHFA 3V4BA 3PBYA 3LRLA 3NGFA 3VIFA 2H3DA 2ZXBA 3KDNA 1WZKA 4B5TA 5GQBA 2YLAA 1OF8A 3WQ5A 1HN1A 1V6VA 5BYWA 5D9NA 1FKXA 3MO7A 4NAEA 4IP7A 1W3NA 3APGA 2G3IA 2CFFA 2PDCA 3FNDA 2FPVA 3PS7A 3FAWA 3N29A 1OQFA 3FJ6A 2AL1A 2RFGA 3WQCA 2ZE0A 1J0YA 3GXFA 4ZFCA 2OGYA 2VC7A 3LHYA 3ZO9A 1WKEA 1HNYA 3SURA 1CLVA 2HXTA 1ECEA 4GIRA 1FBAA 3WDRA 4YVVA 2A21A 2NSOA 4UFMA 1UUMA 2FDMA 2FDSA 3TLLA 1QAPA 2QJHA 1A5BA 3LZ3A 5AC7A 3M0XA 4NQ1A 3DESA 2ZKMX 2FPTA 3UR7A 3C8FA 3HV9A 1EO7A 2J27A 2FZ8A 2DUXA 4PMQA 2UY3A 3WLHA 2VGFA 4I3GA 1VFMA 1TRDA 1EL3A 2PPGA 4R7WA 1TELA 1SGJA 2XM1A 4DYKA 1MEIA 3N1AA 4ZA0A 1VF8A 4D8ZA 2PS2A 1O12A 4LB4A 2EPMX 1OD0A 4ZXLA 1LWHA 3PULA 1ELSA 4PRWA 5DX7A 4AQLA 4AISA 2WNZA 2P3EA 4AYSA 2OVLA 4LYQA 2QDHA 3HMCA 4IZGA 4LVFA 1KA9F 3S9ZA 2YSWA 4WKAA 4ROPA 1OT2A 5HK4A 3WLRA 1RA0A 2EEXA 3U4AA 4GNJA 1QFEA 3WL1A 4Q4MA 3P62A 2PGWA 1AH0A 1D7FA 4XTIA 3VABA 2E5DA 1EP2A 3FAXA 4EE9A 1UA3A 4F66A 2OZ8A 3MHUA 4EXQA 4YLWA 2A7RA 3NDYA 4CVUA 4TOQA 1PTAA 1TJ2A 3GX9A 1KKRA 2QCDB 4JYFA 5A6TC 2PU0A 4EPDC 4L9XA 2UV8G 4PMNA 2W6RA 5FI8A 3TJLA 4LNYA 5HMDA 3KCLA 2PDNA 4AC7C 1CPUA 4FLSA 3BV7A 1UWIA 2A7PA 2I16A 5I7GA 1BTMA 2HV5A 3GTIA 4N9EA 1ZAHA 1LTDA 2CEQA 2PDWA 2FYMA 4LW7A 3WD4A 4HN4A 3AWNA 4H9XA 3NQ2A 2GUUA 5C9WA 4Y6GA 5T8GA 1OC5A 4GYPA 2Z1SA 1CXLA 3HPZA 1KM2A 6TAAA 4REQA 1GUVA 2X2YA 4CLMA 1XXXA 1XINA 5AHIA 1OX4B 3UXAA 3WH5A 3B4UA 4AYGA 3EZ4A 3FYYA 3DI0A 3GXMA 2OLSA 3PNUA 1JQXA 4PCPA 4PZVA 4DYJA 4E4FA 3QOKA 7PTDA 3I6EA 4P2VA 1DV7A 2YR1A 3RU8X 1Q6EA 3WEMA 1UH4A 4CD5A 2V5BA 2DZXA 1RP9A 1EBHA 4WGHA 3A3HA 1JUKA 4XD5A 4B4HA 2ISVA 3PN8A 4PUKA 5DY3A 3WL0A 2X8RA 2DSKA 1KV5A 1QBBA 1AFSA 4JEJA 1DQUA 1RJQA 2CZDA 4MWAE 2CCRA 5A6KA 4PFHA 3VNYA 1ITQA 1CGVA 1IGSA 1A4MA 3VKAA 4D6DA 1XWYA 1AQFA 3PJWA 4M19A 1OINA 1G67A 2HZGA 3QY7A 1OX5A 2QJGA 4QNWA 5EGRA 5FL0A 4JIEA 2J7CA 3PNZA 2HSAA 1NVMA 2O4MA 3A3XA 4W85A 3ABOA 2V8ZA 1V0KA 2X30A 3WLTA 1TB3A 4MB5A 1UD6A 4LCSA 3QGVA 1KB3A 1V5XA 2YCKX 1XLAA 2V68A 3T55A 1R7AA 3LNPA 1KBKA 3CAVA 1B57A 1FFQA 2H9AB 3D3AA 4JHOA 4BF5A 1XYBA 2ZVRA 2BGSA 4JN7A 4ONVA 3K13A 3S2NA 1LT8A 4JNMA 4YTSA 1XDJA 3B8SA 3WQ6A 5FJTA 3F4WA 1RV8A 1SO4A 5D33A 1WDDA 3O06A 2NQ5A 3UESA 1MVYA 3D47A 3C3NA 3EX6A 3UCCA 3GHTA 2Q8ZA 3AYSA 3T7VA 3QTGA 3BSHA 4L5ZA 3CB8A 4DLFA 1B5TA 4G7EA 4ML4A 1TPUA 2BY3A 3LUTA 3D5HA 3AXHA 3DI1A 3E96A 4E2VA 4XZ9A 4UTTA 4XG1A 1S5MA 1Q66A 1JZ7A 3FHAA 3IJ7A 3K8KA 2B81A 3E0IA 4GY1A 4HK7A 3ARXA 2A3EA 2AL2A 4W7WA 1PKYA 2RUSA 1C8VA 4BJHA 1WNOA 3WMSA 3TUUA 4ADUA 2PCEA 5C7VA 1S2WA 2XSAA 4U5IA 1DJHA 1ZS2A 3ARWA 3RR4A 1A80A 1BRLB 4PTDA 5CEWA 3GTNA 1ISVA 1GVIA 3BLFA 2XWDA 2W5FA 4R9XA 4GI6A 2X7VA 3W2MA 2I5GA 3S1WA 2GL5A 4RCXA 1B4EA 5EA9A 2ANUA 3A6OA 1Y8BA 4W89A 4EKJA 5JUVA 2V67A 4QJ3B 3WF3A 3W2NA 3GB6A 4W8AA 2JQXA 3WLMA 3AMCA 3WKZA 1KFBA 3LGDA 3M5YA 1NEYA 1TA3A 4LS1A 2YCLA 1UR1A 3FEMA 1HGWA 3U5UA 5CGMA 1FCQA 2GJXB 3FY1A 2P8CA 4U4MA 1PX3A 3GU2A 3OTRA 4L6HA 2NW0A 5KMYA 5E0CA 3QLLA 1KTBA 4HVXA 1LLZA 2WVTA 4WDWA 4MNMA 1TPH1 4MY9A 3KW3A 3DUGA 3UWUA 1B9ZA 4DN1A 5E9XA 1VFFA 3ZT7A 3LHUA 3VDAA 2YPIA 1FHVA 2QPXA 3EWWA 3O8AA 1DKWA 3PWIA 4YL2A 2PB1A 3W70A 1M68A 4GCAA 3G3DA 1SJAA 4EPEC 1YPIA 1P6CA 1R30A 2E7FA 3E0WA 1G69A 4K8EA 1UBPC 1TPVA 4DM1A 3G1AA 4Q4SA 3TJIA 3I6RA 3DC0A 3QLDA 2PTYA 3WNMA 3QQ1A 1OYAA 3OVPA 2C15A 2A4AA 4OGZA 3BVJA 1PL9A 4AHOA 2PSNA 2R1LA 1NP0A 5HATA 1R3SA 2BHZA 2IQTA 3W6YA 3AJXA 3FJ4A 3ANVA 3MWAA 2XIQA 3NFUA 3W73A 3EAUA 1PEZA 3GYCA 3HV8A 2PDMA 1OGSA 4B15A 3DC8A 2R1NA 3STFA 4GUJA 1JI2A 1TJ0A 3EWDA 3OW1A 3A12A 3P7YA 3H6OA 1SJBA 3W7DA 4E2BA 3MB9A 4NJIA 2WHMA 3MI3A 3BLDA 2TSYA 3WLKX 3TSBA 2JFEX 1CW2A 3LTYA 4HJWA 4PMXA 4PCFA 5EBUA 5IRPA 2XGIA 4G1NA 5ABFB 4FSAA 3DHDA 4WD0A 3SIZA 4H04A 3THCA 3CK5A 4CQCA 4UMCA 2BSLA 3M7WA 1T8QA 1MMFA 4AY7A 5FF4A 3GC2A 3BOFA 5HPCA 3LM7A 3SRFA 3NQ6A 4K3ZA 3OYZA 4LNCA 4GGBA 4G8TA 4GABA 3GTHA 2PP0A 4EAYA 4GH3A 3NAVA 4G56A 2FQIA 1R47A 4UTWC 3VIIA 1X97A 5CG0A 1MNZA 4FK9A 1O60A 5CSRA 4W4QA 2AQWA 1GOOA 4BI6A 1AZ1A 4P8UA 1J0ZA 3KBNA 1W3HA 3WDJA 2WZIA 2YBTA 2F7FA 4WHBA 3WNNA 3ES8A 1F4HA 2OWXA 3QH2A 4HK6A 3AUOA 1TG7A 3N34A 1O7AA 1PVNA 1ZB5A 2F2KA 4NAFA 4CEXC 3BOXA 2QIWA 1KM6A 1NY1A 5K9CA 4RDYA 2QCLA 1SFSA 3T2QA 2VX5A 1CXEA 4H01A 7XIMA 1EZ2A 3QVQA 1VGAA 3OJGA 3FA3A 1U1HA 2DQXA 3LERA 2YCIX 4GZEA 4DUXA 3P8JA 3MMUA 5CJMA 4YCPA 4GUGA 2FB3A 3UWYA 1AK5A 5HJXA 1JJKA 1JGMA 5I3GA 3M43A 1XR2A 3RX4A 2ZZ7A 1C90A 1L9WA 4IPJA 4HTYA 4AWTA 1WXZA 4UR7A 4CVWA 2Q09A 4AUBA 1LWJA 1E51A 3WF2A 3W1MA 3L2IA 2PRLA 1FFRA 4QDWA 1EEXA 4GI8A 5JQ9A 1PKNA 4YHGA 4NT0A 1JNEA 3S46A 2WSQA 4JDYA 5CPOA 3U9IA 4JBRA 4E8GA 3MP3A 3VIJA 1W5PA 1Z9AA 2DZPA 2Z0IA 3RO6A 3MY9A 3DAQA 1DWHM 4QJ1A 1XSIA 5DCDA 4RDWA 3W01A 3VIKA 4LVGA 3KVKA 4A3UA 3URBA 1LCOA 2I17A 1W9BM 3N73A 1HKMA 4E2OA 1O5KA 4M6VA 3TR2A 1O1HA 4UMAA 3WH8A 3W7HA 5AHMA 1CECA 1CGWA 2HJPA 1UUQA 1GG0A 3AIWA 1GKQA 3HB9A 1SO6A 3Q94A 2WV8A 3QXBA 2MNRA 1QBAA 2ACUA 3OA5A 1TSIA 2JF7A 2X09A 1SR0A 1CTNA 1UQYA 2INZA 3ZWSA 3W2KA 4KETA 4QJ4B 1XIIA 2CIPA 3G0XA 3WUBA 2XM2A 2WC4A 4MNLA 4B5NA 4J1OA 3RILA 4NUWA 1V93A 1SW3A 2C16A 3USBA 4KMQA 2O9PA 4R53A 1XLIA 3PZQA 1JIBA 1TMHA 1TPFA 3UJEA 1XLEA 2WWDA 2QV5A 1TCMA 4PUWA 1HF6A 2OG9A 2C0HA 2PWUA 3P81A 3S2LA 1XM3A 4L1WA 4O1DA 2WPBA 4QE5A 4LGXA 1S1PA 1Z69A 4Q6JA 3UZWA 1GYMA 2NQLA 4LB3A 3AYVA 3GBDA 1AQMA 3UWEA 3MDWA 4GKLA 3CUGA 2XIBA 2JIWA 2EGZA 5CC6A 1K9DA 4JIPA 4XISA 3TWAA 1M41A 2D73A 1HKJA 1I60A 1E6ZA 4LBRA 3VIOA 3MANA 4IMAA 3IIZA 3ITOA 3S9IA 3ABSA 3D6NA 3ITYA 2OSYA 2VR2A 2WO5A 1GQJA 1HG3A 1T8XA 1LQ2A 1OK6A 3CQKA 3ZR6A 2FHBA 3RM4A 5ECUA 3EOUA 1HKWA 3HA1A 2YDQA 2X0YA 2ABBA 1VPQA 4O1CA 5BXTA 2V38A 3TTEA 1Q6FA 1EZWA 3NCOA 1CGUA 3VDHA 4XVDA 5KETA 5AC6A 4PSRA 4JQ1A 4ZOAA 5G2IA 5EMMA 4POCA 3UYCA 3WLPA 1YQ2A 4ZOCA 4IX2A 1H41A 2VR5A 2C8NA 4Y8FA 4CUCA 3SIMA 2GWNA 3RIKA 1YW1A 1I45A 4AMAA 4ZO9A 2G3JA 3NQAA 4RW3A 5BU9A 1V02A 4AWSA 1Q6GA 3APTA 1TMQA 2JKAA 3R6IA 5FACA 4CCCA 4F0LA 3W7EA 4AH7A 5MF5A 4NYUA 4BQ2A 1V3KA 4S23A 4O10A 1AQHA 1IQ8A 3CAWA 4AZGA 3WQGA 4F79A 4TXEA 1OHLA 1XH1A 3L66A 3LA4A 2VEKA 1OD8A 2VFFA 4JTQA 4IGHA 2EPHA 3EDJA 3W84A 5HR7A 1HFBA 2BBFA 1TCDA 2ZTJA 5DRCA 2UBPC 2OX4A 5T26A 3VKBA 4IUOA 1TE6A 1M7OA 6CGTA 7ODCA 3V5FA 3EA3A 3KOWA 3PAOA 2GVGA 1IE7C 4H41A 2QVNA 8TIMA 4WKHA 3IJLA 4I7WA 1XRTA 4XV0A 1UZ1A 2ZX9A 3ATZA 3MP5A 3KRUA 5A2CA 1FWWA 3O16A 1KXHA 5DMNA 2B31A 1GTHA 1MW2A 2QCDA 1I0DA 2VOTA 3UG4A 3ALGA 4MAZA 4M82A 4R7JA 3LSBA 4V1YA 1JPHA 4W87A 3G1YA 3W81A 1AA1B 1GKPA 1QW9A 4Q8WA 3KVMA 1IT0A 4KH2A 1PO9A 4WK9A 3CXOA 2ZDSA 1IR1A 1FDYA 2VZTA 1WDPA 3SDOA 5BZAA 1LOSA 3L5MA 1XIMA 3SCPA 2ZZ2A 3KCOA 4LWWA 3V0SA 1XGZA 1OCNA 4TTUA 4A2RA 1R8LA 1OX4A 4JL1A 2CBJA 3A5VA 1XYCA 4KEVA 1RA5A 3VMOA 4JCMA 3C0LA 1I0BA 5I02A 1V79A 3VI2A 3CUXA 2E9LA 2HS8A 1H7PA 2G4JA 3SGZA 2J6VA 2VFIA 3FOKA 1DJZA 1TV4A 3GDLA 3E49A 3MSYA 1WX0A 2VRJA 3ABXA 2BXZA 3CLWA 5DO8A 3F7JA 2SFPA 2YDSA 2ZOXA 3LLDA 4FLQA 1REQA 1XFBA 3UJRA 1PBGA 2A2IA 3IWPA 4GYJA 3QSTA 4DBEA 4MHBA 3C2EA 1C29A 5CPLA 5BRPA 1XLCA 3W2JA 1J18A 2JBMA 2NWRA 1EWDA 3DENA 5FAJA 1CBGA 1NU5A 3AS1A 1OB0A 1QNQA 2ASHA 3HGRA 3UR5A 1CT5A 4JTAA 4FAMA 1ZP3A 1IIGA 1JDAA 1UG6A 4BF9A 5I03A 1JAKA 3T40A 3R8HA 5AYZA 1HJQA 3UR8A 1WKDA 1GWJA 4GACA 1OYCA 1KFCA 3VGFA 2J8TA 3FYPA 1NDWA 3OGRA 4IIHA 1MFUA 4A29A 1VFUA 2CBIA 2OTDA 4K36A 3B9AA 4LAZA 4AHPA 1CLKA 1KV8A 1W3TA 3M6DA 1C8YA 3TTYA 4WKFA 2H9AA 5HNNA 1H3GA 3KL5A 5D2XA 3W27A 2ZRYA 3NQEA 3W7RA 4IIEA 2QDEA 3H4GA 3ZJ6A 4D8LA 1J4EA 4V15A 3H2OA 4I5XA 4DBDA 1SZGA 1GQIA 3ZSSA 2XH7A 4ICNA 3QW4B 1OFQA 3M6YA 4BK9A 4KWSA 3H8AA 4FOJA 3TW9A 4JTDA 3N14A 4IWWA 4S2BA 3UR2A 3G2GA 5CGTA 3NQFA 2PTDA 3EDKA 3FHQA 4KBXA 5CZSA 2ZXAA 2VRKA 2PWGA 3HO8A 3W1QA 5K4XA 2PTZA 2GVJA 4PTNA 4O13A 3CMFA 2CLIA 4CQBA 2VDGA 5ENLA 3RUBL 4HOXA 1UKQA 3HMJG 3BARA 4N6EA 2OSXA 3CAKA 3C52A 2IKIA 1KGWA 2XYLA 3N04A 1ZENA 5HNTA 2QAFA 3WBEA 3LCHA 2QNEA 3BMVA 3TOPA 3LPGA 4GNVA 4KQNA 3KL3A 4XD3A 3S2JA 3AIQA 3BAKA 2NQJA 2XWEA 1Q85A 2V5JA 2FZDA 3LS9A 2GFTA 4A4AA 2VZUA 4GMEA 2GVLA 3BO9A 1TWSA 1BRLA 2PWFA 4LF1A 4HPHA 4S3DA 4DJFD 3S5YA 1W32A 4DWDA 2VM8A 1JGIA 3ID7A 1JPMA 1ZJBA 1MUWA 2CBVA 3D46A 1QHPA 3EMCA 3VGBA 3F5KA 3GW3A 1ISWA 1EFZA 3U8GA 2PLKA 1H5VA 3NSXA 4HT3A 1QK2A 3O05A 3PB0A 4AU0A 2E9MA 1YPXA 1F3TA 3PZUA 3ABQA 2ZA2A 1XBZA 1KTCA 1JUBA 3RYSA 3B0UX 2V5KA 4J9JA 1UD5A 1XYFA 1UH2A 2E6YA 1J6OA 4CCEA 3QHOA 3EKGA 1E4MM 1M01A 1W37A 3SN0A 3PJXA 4DXKA 1K7FA 1TWDA 3W38A 4JFWA 1W5NA 1QI0A 3BJFA 3G8RA 4XAYA 1LLWA 3B06A 3K4WA 1A5NC 1MXSA 2Z6JA 2NQ9A 2QGHA 3WBWA 1YLVA 1L6WA 3MTWA 2VURA 1XP3A 3TA9A 3HZ3A 3WLQA 3IEBA 3O07A 4W88A 2P5NA 4IMEA 3NXFA 4ZQPA 3VAVA 2PDUA 1NH6A 5I09A 2VI0A 2BOGX 2CZEA 1ZY9A 2CNCA 4HYVA 3A64A 5AECA 1E6SM 4LVAA 5IFTA 5FEXA 3WLNA 1Z48A 1JAEA 2MANA 4GUHA 4QSFA 3ISIX 2J9YA 3PTMA 1VD6A 1YBQB 3KHJA 4HBKA 1BFNA 2VL4A 2TPSA 1FCBA 3QZAA 5FA5A 4KT2A 2E6DA 3QMTA 4GJJA 3HIJA 1RY0A 4JX5A 2P8BA 1ODUA 1G7UA 2PWDA 3OQEA 1ICQA 1FHUA 2NV2A 2WZTA 5K2ZA 3H22A 3CQJA 1WDSA 3KM8A 5A6LA 3MUXA 3RXZA 4AD2A 1QT1A 4V27A 3LHZA 4UTWA 3Q65A 5E9AA 4C6JA 4IQEA 3SZ8A 4WXYA 3FN9A 4E2DA 2DFAA 4LEQA 6REQA 4MMWA 3WN6A 1CXKA 1KM0A 5ABFA 4C5YA 5RUBA 3MKVA 3W74A 2FFIA 2FGLA 2R1MA 1G4TA 4M81A 1ZLPA 3HU7A 1C8XA 1PIIA 1W3JA 3C0JA 4LVBA 4D6JA 4RUBA 4DI8A 3B40A 2WZEA 2YFOA 1B31A 3GYEA 4ZZ9A 4TQTA 2UY5A 3CO8A 2E8YA 4H8NA 1MI3A 5L9FA 1A53A 3CT2A 3BGAA 3IANA 3TDFA 3P0WA 2XSXA 1EJVC 3IJQA 3N18A 2R24A 1SZNA 4Q8UA 2WHLA 4ERGA 2GQ8A 1TE1A 1ISYA 4JQ4A 3GNRA 3LEPA 1PKLA 1F8MA 3NL5A 2Y5JA 3WFAA 2YA0A 3WMLA 3RHGA 4YJ5A 1N2VA 4ZCWA 7REQB 1FP9A 2VX4A 1G94A 4MJ4A 3LLXA 4ZQRA 3IJDA 1XFCA 3S9YA 3SCOA 4DEFA 2Y8UA 4YCOA 3A5FA 1DIEA 3RJXA 1FWNA 1SJCA 1N7KA 4GOAA 3CHCA 3OGSA 4H83A 2OPJA 6XIAA 3AICA 1CGYA 1X8CA 4WOQA 1E9IA 3AOFA 3WQFA 4R34A 2EKCA 4XZBA 4C6OA 5M03A 3S2MA 1OX6A 4MAVA 4LX4A 1TIMA 2RDTA 1PIGA 1JZ4A 2WBKA 4Q7BA 1TTPA 1A49A 4Q32A 1LJYA 3RM9A 2XSBA 3T05A 3V35A 2CERA 1V6TA 4LUSA 3T2OA 2V5CA 1TV8A 3N3TA 1OT1A 3WJXA 2ZX7A 4QISA 3N2OA 3IIXA 3HOJA 2X1RA 3BDKA 1QRQA 3H55A 3W83A 3MMDA 1IEIA 5KZDA 4TTGA 1MZHA 1OG0A 4PEEA 3EWUA 4CU8A 3EX1A 1XBYA 3EMQA 3UCDA 1RUSA 3EWYA 1EBGA 2VCAA 3VKCA 4ZQNA 5JBEA 4GD0A 4LT9A 3VPLA 5GJNA 2Z00A 1DIKA 2OLAA 4M80A 2Z26A 3BQ6A 4UFLA 3JVAA 3ABRA 4TMBA 2IKGA 3MCMA 5MKGA 4FX7A 1ZUAX 3K8LA 5I23A 2PMQA 4OE7A 4FX8A 3CB3A 2A79A 3WO8A 4RK8A 4WCJA 2FGZA 4I6VA 4KCVA 3H53A 5IDIA 3GQYA 2ZC1A 4N02A 1CENA 2BWGA 4D2JA 1Y65A 2BMBA 2WMHA 3EXTA 5EL1A 2LLEA 3TQPA 3DYPA 5EY5A 2A7NA 3F5LA 5D9MA 4PSPA 2Y0FA 3PUGA 2CLFA 3E2VA 5REQB 3RNDA 5EMYA 2BVWA 3ALFA 2DIJA 2I57A 3LHWA 1LQ0A 1GK8A 1ZAJA 3GWQA 4KRTA 3CEUA 1W1TA 2F6XA 3IIPA 4MVAA 5CG7A 1K3UA 3NG3A 2O7SA 1FHDA 2PDBA 4H1ZA 3VZYA 4UUIA 1QJWA 4J3ZA 1BD0A 3IJIA 2CPUA 1EHAA 4JTEA 3AZTA 3BLIA 4D6IA 1E4LA 4LAOA 4ZSUA 3MBFA 3R89A 5CPQA 4HPXA 2G41A 1Q6CA 3M1ZA 5LZLA 5G5IA 1EPVA 2F38A 1X39A 4RE4A 4D72A 3GW0A 4ZR8A 1QPOA 3AJ7A 1KM5A 3TMQA 1U2YA 5IBXC 3DBNA 4RL3A 1XGEA 2WLYA 3KHDA 2VXNA 1XSJA 1NOUA 1E6NA 1SSGA 2OZTA 3P61A 1W1A1 4HU3A 4DQWA 8CGTA 5I6SA 2W0UA 4GQRA 2Z1WA 3TYZA 3WDIA 2V5LA 1QPKA 3ARQA 3FEQA 3C2RA 3CQHA 1RQBA 1S1RA 1ALDA 1RD5A 4FNSA 3M07A 4UOZA 1ZL1A 3QW3A 1IIHA 4PL2A 3VFLA 4W93A 3E1F1 2C6QA 4OTKA 1NQ6A 5HULA 3N4FA 1C3FA 2J78A 4XKYB 5H6HA 1TQXA 5I3HA 1M53A 3VCNA 3G1HA 3PPCA 5KSWA 3CNYA 4XD6A 5M1TA 4DJEC 1PHWA 1W5QA 4KWUA 5DBTA 4B9ZA 1FH7A 1VBJA 3LN3A 3M0ZA 2H8XA 3BJTA 1GOKA 1JD9A 2X7WA 1W1YA 3R25A 4XO6A 1EWEA 1UR8A 1LG2A 4IJCA 3TCSA 1E4NA 3SCSA 4L9YA 3QY6A 1PDZA 3BCJA 1MEWA 5FOOA 7CGTA 1ZP4A 1K6WA 1V6WA 1X8FA 2DY3A 1XQLA 3ANYA 4W9TA 1ZTVA 3UZZA 1A50A 2HPIA 4F2TA 2X1TA 5AHEA 1KRMA 4WVXA 1AL8A 2CLEA 3TC6A 3OP2A 4XSMA 4IGNA 1XIDA 3DKJA 9XIAA 5CQ1A 3IARA 3MUY1 4DPQA 5DXYA 7A3HA 2DVXA 1YTDA 4ZB5A 3QY8A 3BTNA 2E40A 5G2HA 1LL4A 1JVNA 5GNYA 3KVLA 2F61A 4JKKA 4M0XA 1X96A 3V36A 4AEFA 1LROA 4I9JA 4WDUA 3VNJA 3RR1A 2J88A 4BI7A 1H49A 3ZOAA 3LHVA 2C13A 1ZPTA 3QQWA 2OFJA 3ARYA 1WYIA 1XG4A 4ATWA 4AEOA 3H7VA 4UIOA 2OMAA 5BROA 2KX9A 3S1UA 2QPUA 4RZBA 3RPDA 3MPGA 3GDBA 1HVQA 2D0FA 1GGOA 2HWGA 3EDFA 4LVDA 4Q22A 4GQBA 4FX6M 3T6CA 2EPOA 3W23A 1MDLA 3S1XA 5J5RA 1JPKA 1PPIA 2W4XA 3AMDA 3FDGA 3T8QA 2INEA 3UZJA 3ZWTA 2Y6ZA 2VVNA 2JEQA 4V2XA 5KZ6A 6PTDA 1DQWA 4GVIA 3Q37A 4EWJA 1DJWA 4PYSA 4NVTA 4S3JA 5BWFA 4Z1CA 2O7QA 3NQ7A 5G1TA 1HP4A 1SJDA 1EP3A 2E4TA 1Z7AA 4B3KA 3PG9A 4BS0A 4INFA 1YNPA 1S5TA 3S4TA 1FDZA 4FNTA 4ML9A 4O53A 2NX9A 1IGWA 5HUPA 1HP5A 4I9TA 1LF1A 4LV4A 3PJTA 4DY1A 3OLEA 4EF8A 3M0YA 5HDRA 3MV01 2DZUA 4KIEA 5LA1A 4CCZA 2Y24A 3W07A 1VPYA 1VRXA 2WCGA 1PAMA 1UMYA 5LIYX 1DE6A 3VNLA 3I7RA 3N9RA 1UP2A 3UYIA 1D2KA 1GG1A 1FTXA 2NXGA 4WIWA 3EWXA 4HZ6A 4DXVA 2ZRVA 1JPDX 1E40A 4NXKA 1F6YA 2Q71A 3LCLA 3N12A 2E6FA 1O5XA 1K9EA 4DZ5A 5XIAA 1J11A 4C6FA 2Y61A 3TTOA 3BLLA 2Y1HA 3W7KA 3VOGA 3PB2A 3TWBA 1FOBA 1W9VA 4DWSD 4ACZA 2A6LA 3NPXA 2WM1A 3N17A 3FW6A 1X6LA 1NF7A 3TOYA 3PZOA 1Z8AA 3KBJA 4IQDA 4Q8PA 2CXEA 1V08A 3Q4DA 3UNDA 4E38A 3KZPA 5BRBA 5CBBA 3AYRA 4M1BA 4Q7NA 3TEVA 3QKZA 5D9OA 4DJDD 3GXTA 3VVGA 4P61A 2YL5A 5A8QA 2CW6A 3VUPA 3R7MA 1FWAC 4Y2WA 4GG9A 3O63A 2W67A 2WJDA 1NFBA 4UFJA 1HTIA 5D8ZA 3IV8A 4PMRA 3WNLA 2ZE3A 4ATLA 2Z29A 1ZCCA 3OIHA 3S5ZA 3PVFA 3ANUA 1EJ7L 3OHMB 4JTFA 5HQLA 2HVNA 1FRBA 4LUYA 1YXCA 4QEHA 2HEJA 9RUBA 5C54A 3H54A 1TWWA 3UA3A 5DQPA 3DERA 4CD4A 4UBPC 1W91A 3EEGA 3L5AA 4AG0A 4HU8A 1ITXA 4L56A 1GVRA 3F4CA 4QE1A 1EKOA 3S1GA 5A69A 4HA3A 1DWFM 2CLOA 2PGRA 3FJNA 2OOFA 4ZOEA 7TAAA 2GYIA 4IHCA 2P10A 2X41A 4H19A 3L23A 1JYWA 2DORA 2VKZG 2HCVA 2XIJA 1VJZA 4HZMA 2PDFA 4IFOA 5BU6A 2VFHA 3SSZA 3TX9A 2DIEA 5F4SA 3KOYA 1KFJA 4N9CA 2D0HA 5I3IA 2ZTKA 3WQ4A 4EACA 2GDUA 6ENLA 4AX7A 1LT7A 1J79A 1XD0A 2BHUA 1F3EA 2WPGA 2E5BA 4CQDA 4LFYA 1AD1A 2P76A 2YYTA 4C6EA 1U83A 3CYVA 4DBWA 2GJRA 1O4UA 1QWGA 5K4ZA 4GH1A 3W2UA 4KPLA 3E6EA 4H2HA 2QUMA 3U0HA 3C61A 1F3WA 4ZBCA 4UTFA 3JZEA 3VCCA 1FWFC 3L5LA 3PJUA 1P48A 4US5D 4M56A 3NQVA 4QG6A 2WK2A 4J3UA 1X1NA 4Z2LA 3AHTA 1Y0EA 1K7XA 3SCNA 2O4QA 2VFGA 3ITCA 2ZUMA 2GK1B 1W3IA 4O1AA 5K9DA 1OIMA 1OG6A 1UD4A 3VNDA 4GCXA 4BWLC 4AD4A 2FB2A 4QTGA 5HQMA 2BODX 3S6TA 4PUUA 3P74A 3UBPC 3K1DA 4FLOA 2BTMA 2O9RA 4ZE4A 4GQ0A 1U22A 3RITA 1T96A 4X22A 4S3BA 4OWGA 2PWVA 2RGLA 1ZNNA 2WCAA 2XUCA 2G96A 4Z1AA 1EQCA 1P5BA 4R85A 1ME7A 5K9XA 1WDRA 3W7OA 3NXLA 4V33A 4XZHA 1UZDA 1JRCA 4Q3MA 3WEOA 1C8QA 5T91A 1DTNA 2X40A 4UTKA 2G50A 3LBCA 1MXDA 3ZVIA 2GUYA 4AX6A 1WDQA 4BKNA 4H8HA 4MGGA 2VCCA 4KW2A 4D6HA 2G37A 2GQ9A 3MSRA 1TMLA 3H2NA 3S8HA 1DTUA 2X1UA 1K02A 3NL3A 4O8RA 4MYXA 5LA0A 3T81A 2DIKA 2WVVB 3J7HA 2FJKA 4I9AA 4O4VA 1AD4A 4Q4OA 4GK8A 4IP5A 5I00A 1ZZMA 4JX6A 4U33A 3MHFA 1L8PA 3Q58A 2ACRA 3LRMA 2OKTA 4AZBA 3O2LA 2QCMA 2D2OA 4Z2IA 2YYUA 4UZUA 1W9PA 2RDUA 3E38A 1E6RA 3WUGA 5CSSA 5LNSA 4U5KA 1BYDA 2C1GA 3ZFHA 1H50A 4NJJA 5AVNA 3M5VA 1WXJA 3I65A 2VUYA 1OK4A 2V9DA 3P2VA 2CESA 4F0KA 3DFYA 4IX0A 3KEHA 3AXXA 3NQMA 2DSWA 4XO7A 4WF7A 3SFWA 1DXFA 3LCFA 4Z0SA 1CGTA 1WZMA 3URAA 1D8WA 4D8AA 3E5PA 4N4PA 3A3WA 2P53A 3TA6A 3L4VA 2JKPA 1HL9A 3KAOA 4RLIA 4ATDA 3LNMA 4IMCA 4E6MA 1Y5VA 3ARRA 3TC3A 1AODA 4KEZA 4O11A 1VB9A 3WF0A 3QKEA 4BEUA 4NYYA 2V2CA 3G6MA 3DFTA 3UNTA 1E9YB 3QSRA 4JY9A 2C0AA 1BWLA 2OQHA 1F6KA 1ODZA 3Q45A 5JIPA 3PSWA 1UD2A 2POZA 1D7KA 3T8LA 5TBOA 3RPMA 4O52A 4XAFA 1MQRA 3L12A 3DG6A 1S3HA 2VENA 2GLKA 3OLDA 3NL2A 3GIQA 1X7FA 3OVQA 3MBDA 1H60A 2E1DA 1BPLB 2AL2B 2V3FA 1SSDA 1DP0A 2XU2A 1GOXA 4C6MA 3N19B 3DHUA 3WMBA 1FCVA 2G5WA 3KBMA 4EAMA 1J9YA 3G1XA 1EEPA 2Y7FA 2B7QA 1K70A 3LHTA 1DL3A 3ITVA 1TJ1A 1HW6A 2QV4A 1TV7A 2X42A 2I5QA 3P80A 4L61A 3TCEA 1U5JA 1KWKA 1XDLA 5F4XA 3MYOA 1S2VA 1VLIA 4IH3A 4WXZA 3OLIA 3E0LA 3LRKA 3GUWA 3GVGA 1XLLA 3I7SA 3MP4A 3KOFA 2Q01A 4GQGA 1T0OA 5JBFA 2WQPA 3MMWA 4CN1A 1H09A 3A4XA 5KITA 1TA3B 1TYGA 3IS4A 4MM1A 1W31A 3W87A 4IXXA 3ICJA 1IZJA 1OWQA 2J7GA 3ES7A 4MADA 4C6KA 3SCUA 3DZ1A 3C4UA 2QAPA 4HPNA 4TMCA 5EMJA 3NYZA 1E3XA 3WDQA 4J3TA 3VD3A 3W71A 3OVGA 3SECA 4HIBA 1LRNA 1UUOA 3GDRA 3KOXA 2GOUA 3DXIA 2W27A 4CQAA 5AYYA 5TIMA 1I2NA 2O56A 2V5DA 4O12A 3LMYA 3Q67A 1HJVA 2Z4GA 3MUZ1 4OFCA 5REQA 3WLSA 5CPSA 5IBXA 3JRKA 3GU9A 5EBAA 4FALA 4K68A 4HSHA 3MU7A 2X0SA 1GEHA 2XIMA 4U31A 2PBOA 1UWRA 2IS7A 2P0IA 3UP8A 4JTUA 3KCJA 4ZFMA 4S3FA 3CWHA 4GO9A 1JCTA 4UR8A 1GT8A 4X2RA 3TNBA 3OYXA 3ZJ7A 1XUZA 2OSWA 4I5RA 4Y9AA 3QM3A 2O92A 3VD5A 4YU1A 4IISA 3TSMA 5I24A 5A8GA 5I3FA 4XTDA 1LG1A 5HWJA 2IPJA 4YNGA 4UQEA 2FLIA 1F73A 4DJEA 3U7VA 2XDFA 4MWAB 5D32A 1H1YA 5D2WA 3FJLA 1YKWA 3BSGA 2X2GA 4NNCA 4H6RA 3VUSA 3GBEA 2FVKA 1SYTA 3DU0A 3UPMA 2CITA 4GXMA 2ZRZA 1VENA 4M6QA 1LBMA 3OVRA 3EKLA 3W7QA 5H8UA 3VFCA 2XG9A 4DF0A 3AQUA 1MZRA 4XKYA 3S83A 3H4XA 4ACYA 1FHLA 1ONRA 1WXYA 4P5UA 1FH8A 1S46A 1ME8A 4AMCA 2FZMA 3WQEA 2WB5A 2Y62A 3W1UA 2FH8A 3UVIA 3KVJA 4URIA 2C1IA 1UOZA 5F2IA 3D0CA 4MWAC 2FZBA 3W1LA 4WZHA 3CU2A 4AB4A 2ISSA 3W1TA 3O15A 4K38A 4RE2A 3AHZA 3VIGA 5A6AA 3B0VC 2JGQA 3IRDA 4EPBC 5I78A 1XF0A 3K30A 1WOAA 2EKGA 1IWBA 2XIOA 2QCHA 1R2RA 3B03A 1TZ9A 5J04A 3GVQA 1Z32X 2F2HA 1EC7A 1EYWA 4BQ5A 3N2CA 1VFSA 1BYAA 4I7VA 1BWKA 4AZ5A 3KP0A 2O0TA 4X2PA 4Q8OA 1OVDA 4M6UA 3PPGA 5IM51 4DUVA 1G01A 1SO3A 2G3NA 4W8LA 4IQLA 4WSKA 2JKEA 4CGTA 3L4WA 4AWEA 1SMAA 1FP8A 1E0VA 1XCFA 4ZQOA 4FIQA 2OLHA 2F84A 3IVSA 4PUDA 3NEHA 1M6JA 2P1FA 3LXCA 2Y8KA 3BOLA 1CCWB 2ZZ1A 1K8XA 4B5WA 1GOWA 1BG4A 4JTTA 1B30A 1EX5A 2R82A 4F8XA 3EOSA 4MUPA 4GI4A 1R3YA 3EA1A 1K8YA 2PDIA 3F5JA 1WA3A 4PRTA 4TV5A 2ZYFA 3HBLA 2HS6A 1J2WA 3U5YA 4EK7A 1P0KA 5E5CA 2EPLX 1TQJA 4FEZA 5FJUA 4JKMA 5C2GA 3AC0A 1JDDA 4MKVA 1JULA 2B4GA 2QZRA 1JXKA 1XLHA 4RXFA 4DZAA 5C9RA 4R5EA 1UP0A 2V82A 4FO4A 4S3CA 2YGYA 4EXAA 1KFWA 5LIWX 2AOSA 3ECQA 3HG3A 3TFXA 1RLCL 1UBSA 5I3DA 3U2OA 4RKAA 3MKKA 1G0CA 3N11A 1SZFA 3L4YA 1VQTA 1LRQA 4H9YA 4XZMX 4X60A 2DZSA 3EX2A 1VIZA 4OUIA 4UCGA 4AD3A 3SUTA 4PA8A 3I3BA 1VYPX 2OQYA 3WK1A 1PV8A 3LCWA 1QATA 3UPWA 4NI8A 4C6CA 3HG2A 3BCDA 3RO8A 4KGLA 5TQLA 2EAWA 2OB3A 2ZZ4A 1A5OC 1XI3A 2ALDA 3DGBA 2YZ5A 2VD9A 1V3MA 4J3SA 3ZR4A 4MPKA 3BPWA 2VGIA 4DO5A 4E0CA 2KZHA 3MT1A 4ORMA 1YXYA 1JUEA 3K2GA 2DPEA 4Z2JA 3GXPA 5EMUA 1KGUA 2C14A 4ZODA 1DOSA 3AXKA 1ADDA 3N9SA 3GC5A 3M44A 3GFZA 2HK1A 4Y9NA 4GYFA 4E3TA 3V16A 3NQCA 2PGEA 3BAJA 1CYGA 2AKMA 1XLMA 3S6DA 4WY0B 1AG1O 3R0UA 2W61A 4P8XA 1YDOA 4LUTA 3KWSA 4X63A 4U2YA 3LYEA 1Q6QA 2WNWA 3E2RA 5I06A 2FHCA 3IAQA 3ZSTA 1KO0A 4FHAA 4HK5A 3OBAA 3S1VA 4J27A 3GKAA 3H21A 2OZ3A 4XSLA 3ZJKA 2YLLA 2J8FA 4A8NA 1TTQA 4DO4A 1MRQA 3EDEA 2PF0A 3CO4A 3BMXA 1T7LA 5C55A 1XS2A 2PBGA 2D23A 1JYXA 3GR8A 2BXYA 4YTQA 4X3ZA 3IIVA 4HOZA 1WKYA 3WJWA 1SFTA 1AZ2A 1HL8A 4S3EA 1GHSA 3TN4A 1D3GA 1VP5A 2PURA 4CNUA 4EANA 3PK7A 3U4FA 5G1YA 5KTLA 2WNNA 2CWXA 1EHNA 4O18A 3GNXA 4XZIA 3PZTA 2OT0A 1ZCOA 4J3VA 4NF7A 4EXBA 4I7UA 5A6JA 3TFCA 3OGVA 1XIHA 3PAJA 1HIZA 1IV8A 5FEZA 3H2AA 4F9DA 3GG1A 1N82A 2QMJA 3N25A 5B7YA 4EPKA 3E2SA 5I07A 1FKWA 4Z0JA 1S38A 4PRRA 4HPJA 3W00A 4LQ1A 4U28A 4NJHA 2WJZA 1LL7A 1UW9A 4BWLA 1M9HA 1NWRA 1WP6A 2GOKA 2OT1A 4KESA 4UMBA 3F4DA 3V1PA 3AIEA 3EYPA 4L4LA 4E4PA 4JQ2A 4M6PA 3GDKA 2HVOA 3HM7A 5I0DA 1TIWA 4KIRA 2BOFX 3HJEA 1V6XA 4RDZA 4WOZA 1W17A 2J47A 3TAKA 3IUDA 1ZJAA 1K77A 4IGSA 4DNMA 3JS3A 4ZB2A 1D3CA 1VHNA 2WMJA 4HYWA 4KFNA 4D6FA 1OY0A 1QOQA 1VFOA 4TV6A 4HGXA 2GK1A 3ZVHA 4PUNA 5T9BG 2OKOA 4PE8A 2NX3A 2VOMA 1M7PA 3OB8A 2OO0A 3L2MA 4RZ6A 4FPSA 4P8VA 4P7RA 2ZXQA 3PC0A 1OCJA 2A6NA 1GJUA 4HN8A 1VZWA 1M7JA 1FCUA 2CZ5A 1QU4A 2YKKA 5DRIA 1I2RA 3UWVA 2ISFA 1K4HA 1DWAM 5A8NA 2YXOA 3UJSA 2Z1BA 2B0MA 1RBOB 1JL8A 2R91A 1R3RA 3E02A 3IUIA 1P0NA 1RZMA 4GUIA 3EPOA 2ZX5A 4GVHA 4PUEA 4F3HA 4HA0A 4CD8A 1ONWA 1OFRA 1OEPA 2WVVA 2HRWA 2WJFA 2GGIA 2AKZA 1REQB 3OO2A 1TRIA 3N4EA 3B8UA 1LRTA 5H91A 5A2AA 3IGSA 4N4QA 4PCSA 1V7AA 3CL8A 2A85A 4A8RA 2BVTA 3FVDA 1HT6A 1NIUA 3T78A 3SY5A 1ZALA 3RLUA 2Y88A 8XIMA 4JICA 2GSHA 1T5AA 2VX7A 4YTUA 4X0VA 3V5OA 2TYSA 3NOYA 3DX5A 1G1YA 1FWJC 3NQ8A 1KLYA 1LWIA 2G3MA 2G95A 4PMUA 3VMNA 1GVQA 4GRSA 3PZNA 5TAOA 4YMZA 5FEPA 1C9DA 1RAKA 3FA4A 1KXQA 3NQGA 4LY8A 3B9EA 3SI9A 3M4HA 1OADA 3G0UA 1KRAC 3TYEA 3QV7A 3P60A 4OIFA 1HZYA 3AISA 4KKXA 3LPPA 3KP1A 3TKFA 4PBFA 4ORIA 3QPEA 4O16A 1X98A 2YA1A 2YCEA 3AS3A 5F7UA 5FJOA 3RLHA 1EJXC 5DMLA 4IPIA 3PFMA 2ABAA 4B5XA 1S2AA 3SRHA 4E8DA 4H8UA 2J74A 2C1HA 1CB2A 3QYSA 1QO5A 1M1BA 4FS9A 4ZO7A 3SCVA 1GW9A 3EA2A 2VDHA 3F1QA 5FF0A 4QEEA 2VTFA 2BY2A 2JALA 4YN5A 2QJIA 3DDMA 3VGHA 1XISA 2UY4A 1DIOA 1JPIA 1H1ZA 1U5HA 2VELA 3N4AA 1K9FA 2ZCGA 3CV2A 2OO6A 5FJJA 4JTHA 3W7CA 3SR7A 2GVYA 5CZ0A 3CMJA 4HZ8A 2YCJA 3I3EA 5LIXX 2IXVA 2OOGA 1J01A 1E0XA 4MB3A 4PULA 1AL7A 2J79A 3K46A 2DV0A 2PTWA 3VD9A 3MJYA 4AFYA 3DFHA 1XLBA 3W7MA 3U2CA 3N2BA 3W7JA 3TMLA 1Q7QA 1TTJA 3AMKA 2Q3OA 7ENLA 3CHEA 4H6KA 5DFAA 3BG9A 3LPFA 1LOLA 2RKXA 1VFHA 2QXWA 3M47A 4O14A 3MI6A 2DT1A 1P7TA 1M03A 4G9PA 4Q33A 3LM3A 2IMRA 3ENLA 3G1SA 2C19A 4MFEA 2AGKA 4IIDA 5HA7A 4P7OA 3S0CA 4CCDA 1XV8A 1UA7A 3GNDA 5CLWA 3M0JA 3H2CA 3RLGA 2EG7A 4CNPA 4WSJA 1E71M 1TVNA 3C3UA 4IT1A 1E56A 4HMNA 2E3ZA 1BVZA 3HQNA 3E12A 1E6QM 1PS9A 3ITTA 3WBYA 2W9MA 3WUFA 2EJ1A 4UFKA 1LUCB 4PMJA 4LYRA 5FKYA 1YDVA 1ZBCA 3MCOA 5LKYA 4N0RA 2AGTA 2XN1A 1ICPA 5IOBA 2J9XA 1F2JA 1DPMA 3B8TA 1FWGC 2XN2A 3G3MA 2Q6ZA 4LCRA 1A5MC 2W79A 3VX0A 3O6CA 2GDQA 4YTTA 5JH2A 1D8CA 3C2FA 1K8CA 3DCPA 4AVOA 2V63A 2ZX8A 4K1WA 4MUZA 5AKQA 2XH4A 4JFUA 1B2YA 1GQKA 1WZAA 4JR5A 4V28A 1PIFA 1TVPA 3T44A 4IMGA 4K39A 2E8ZA 4A8IA 2BP1A 2NVCA 2ZZ6A 1A3WA 4IGMA 1GNXA 3A4AA 4YVPA 4YTRA 4JTSA 4B2DD 4J4KA 3VO0A 3GS6A 2AQVA 3F03K 5IHSA 3WUEA 4RV3A 2PGFA 4MWAA 1US0A 3TYUA 1WBHA 3B0PA 4IF2A 2GGHA 4ICCX 6REQB 2RDWA 1LLOA 2DSVA 3VM5A 1NARA 1BQCA 4M7TA 2DSZA 1WKFA 4IXHA 3W6LA 3PZ9A 4Z2KA 5GVJA 2WVUA 4L65A 3L4TA 3JU2A 4WR3A 4XIAA 3HQPA 2PD9A 3TYBA 3CEPA 3L4XA 3WLIA 3AXMA 3C2VA 2DZTA 1JD7A 1U5VA 5AHNA 1P1XA 4NXSA 4BZYA 2J4GA 3NEVA 2YZRA 4PBEA 3W7NA 2VD8A 1C91A 2YA2A 4FR1A 1CI1A 2ZUWA 3VGDA 3F2DA 3R4IA 3EWZA 1KFLA 4ZL1A 3WDPP 1NAL1 4H9MA 5I3JA 4C1NB 3G6LA 4C60A 1R7OA 3XIMA 4XB3A 5AYBA 1R6WA 4XAZA 4RZ4A 4YWIA 1ONEA 1YHTA 3A9BA 3R2GA 4JTRA 4F0HA 3M0KA 5DN1A 3WD3A 2PP1A 1ISZA 1AW5A 1EOKA 5F4WA 4IG2B 2CZVA 4XKMA 2EG8A 3AHXA 3P6LA 3WK0A 1DHKA 2BG5A 1QNSA 1W2VA 3TAOA 4DWSC 1GHRA 1MDRA 1V3HA 1XH0A 4HHHA 2A1YA 3CV6A 1SPQA 4NZ5A 1FA2A 2UZ9A 1TV5A 5CPTA 1P43A 4UQDA 5CC7A 4JPGA 3KBVA 1GVEA 4HJFA 1C7TA 2D2HA 3GC4A 2AMXA 3BAYA 1UD8A 5C6MA 3CZ8A 4UNIA 1A3HA 5C9ZA 4CQ8A 2QYGA 3ARTA 2QMKA 4Y9PA 1ENUA 3TR9A 1OABA 4DJDC 5CSUA 5JXQA 1H7NA 4KFPA 4OZOA 3STCA 3QJAA 1E1CA 3SCTA 2J8GA 3MQTA 4AVNA 3W4RA 1T41A 3W3OA 1RPKA 1YXDA 4LUSB 1HUVA 3RMJA 3CT7A 4LC6A 1F07A 2Y89A 4PMZA 4XD4A 4C7GA 3CL6A 3V1HA 5I2UA 4EP8C 3PUOA 1E1FA 3BJSA 1MO0A 3GHSA 5EMKA 1W3KA 4WY0F 2IKJA 2J13A 3TC7A 3LY0A 3V0TA 4I6KA 4DF2A 1UR3M 1P0BA 4JYEA 3KZSA 2G97A 5AY7A 1OFPA 4O4WA 3ZYZA 1WUEA 1S5WA 1L6GA 3RCYA 1KD0A 2PLJA 2VGGA 3VKKA 1W9UA 4QP0A 3CPRA 4NNAA 1PYFA 5MKGB 1EF3A 3K8MA 3WF1A 3INPA 1GZJA 3NDOA 4MDOA 4Z1BA 3TV8A 3ZLGA 5J5DA 4QGCA 1E3ZA 2AAAA 4RNFA 3TJ4A 4L4PA 3S47A 2Z2BA 5A8MA 4GIAA 2C91A 4MZ1A 2IW0A 4IJRA 3HQOA 4MFDA 5BXRA 2XGZA 2AQOA 3OEXA 4Q8NA 3DIPA 3W25A 4S2CA 3LZ5A 1F5ZA 1NOWA 5J8LA 1MEHA 2E67A 2YX0A 4GXWA 4MF4A 3STEA 2YW4A 1M7XA 3REQB 5LGXA 2W92A 1BHGA 5GNXA 4DYEA 1PTGA 4WJXA 3B4YA 3LI0A 4XZNX 1L6FA 3I7QA 4UR9A 3NZGA 4GXPA 4F9JA 4WY0A 3QQ0A 3FK4A 3AS2A 4HNVA 4FR6A 3CWNA 4HU0A 1XCWA 2FH6A 2R14A 1EDTA 3AHVA 5C0QA 3DKLA 3ITXA 3KBSA 4Q6XA 4HU4A 2ZDRA 4RX0A 1HVXA 4JFTA 2BHYA 2F8QA 4H9UA 3W85A 1IWPA 1BXCA 2HE8A 1FQ0A 3PBVA 1RVKA 2L5HA 1NTHA 2QIIA 3GDTA 4UQCA 3MWCA 4LS2A 2WQDA 2WSKA 3GH5A 2CWNA 4GO8A 3AMGA 3DGRA 1WBJA 2C7FA 1XPGA 4LYPA 4O1FA 2DQWA 3OHIA 3EPMA 4QAWA 3GAKA 2XVPA 4DHGA 4PB3A 1JFXA 1O5QA 1THFD 2QGYA 3RJYA 1SW0A 1HX0A 1KTNA 4C1KA 1KC7A 1OBAA 1J0JA 1M3UA 4B4FA 2JEPA 4I9MA 3SFKA 2I1OA 3VE7A 2EQDA 3PTKA 4R3UA 4HMEA 4XZWA 4TX8A 3PSVA 4GBDA 3T2PA 3C6CA 2NLYA 1O68A 1FH9A 4FXJA 4LALA 1EOMA 3W1XA 4K1GA 5H8PA 1U33A 3DBPA 1BF2A 1X38A 4TVDA 4PMYA 1A3XA 1ME9A 4J7RA 4QAIA 2VEFA 3B97A 3RG6A 2X05A 3CZEA 2NVDA 3EOOA 4H9VA 4NI3A 4GGHA 4OOZA 4L7ZA 2BOEX 4L1XA 4M3PA 1JI1A 1TV3A 4ZSTA 2J7FA 3A23A 1CZ1A 1UR4A 3AO0A 1WOBA 2Y5SA 4ECLA 1DJIA 2OEJA 4OV9A 3QN3A 4CNTA 3UPBA 4O28A 1PZ0A 1O95A 1T40A 4O19A 2FMOA 5CH9A 1PKMA 3TXVA 1UWQA 5DCEA 4GI9A 4XAPA 1F61A 3SJNA 4GX9A 2HBVA 4HNLA 1GJWA 3UU0A 3UG3A 1FY6A 3R0DA 1CIUA 1GVFA 3ATYA 3VZXA 3SN4A 4DZHA 3ZT6A 3S3GA 5CZKA 5E1QA 5FAGA 4JXCA 3G77A 3HTWA 2NSXA 1A5KC 1FWBC 3N2TA 3VIHA 3W29A 1FWEC 1R3QA 3M46A 1R9YA 1V0MA 4W7VA 2XINA 1V03A 1E9LA 4DNHA 4AWUA 1RP8A 3KUMA 4C6IA 1KBLA 1KFEA 1CNVA 5HAOA 2HDJA 2O9OA 3BCFA 1UPPA 4XUGA 3TN5A 2BB0A 1G9HA 4RE0A 5D30A 1MQPA 1UWSA 1WQ5A 4Q8QA 1SM9A 1E72M 5A3HA 5HJYA 1B3XA 2VZVA 1H5YA 2VEPA 1UYQA 2V3DA 1RQEA 4HTBA 4L1GA 2FIQA 3NZ1A 3BW2A 1K8ZA 4QLKA 1CXIA 3RAOA 3BAXA 1CXHA 3BW3A 3UFYA 3UERA 1A5CA 4D6CA 3NSMA 1VPXA 2H3BA 4KCTA 1VYRA 1MFVA 2WMGA 4IICA 1CDGA 1KXVA 3G0SA 5CLTA 3O1NA 2CLHA 1W1PA 2RHGA 2ZZ5A 1ADOA 2QDDA 3P93A 4S39A 2Q3RA 4TO8A 1U1JA 4U10A 2HROA 4L4MA 3MW7A 4HD5A 3GR4A 2GQAA 2QDGA 4M1RA 4IPLA 5C2CA 1PZ2A 3R43A 3W02A 3CPGA 1ZBWA 2XVLA 1W3LA 4B16A 4RV8A 5FF2A 4Q8VA 2OELA 3FGCA 2CKSA 3AUJA 1Z41A 5C8BB 3QPZA 2D20A 3MZ2A 4JFSA 5KEZA 2W63A 4JQ3A 1NP2A 2VMFA 3VGEA 3PBUA 1I1WA 4PN2A 1VS1A 3PZIA 2ODOA 3RM8A 4US6A 1QMLA 4DZIA 3BUVA 3SB0A 1QNRA 3SY8A 4IP4A 1C7SA 2E28A 1S2TA 4XUYA 3H7UA 1V51A 2QUUA 4ACZB 1KRCC 3DFPA 1WB0A 2XVGA 3DG7A 1A5AA 3CHVA 3W7GA 3GG0A 2P3ZA 4WLCA 3UWQA 3WZ0E 4K6AA 2WM0A 3SUWA 3Q2DA 3TW7A 1S5NA 3T1GA 2B7NA 4CD7A 4KERA 3TROA 4GINA 5A1AA 5FD0A 3RX2A 1QI5A 1TJPA 2RJGA 3EB4A 4DUWA 4D6EA 1SR9A 1UP3A 4B5VA 5CAHA 4RXGA 3L65A 2INFA 2Y7GA 1JQVA 2GPTA 2V30A 1KKOA 4F2UA 1KFKA 2PWEA 3CZLA 1P6WA 3MUIA 2IPGA 2EJAA 4OT7A 3PZMA 3EPNA 3GTXA 3WDHA 2DJLA 2QCNA 3ITGA 4LUIA 2CLMA 1LL6A 1A0CA 4Y7EA 4Y8EA 3QV9A 1A0EA 4QHRA 4BY3A 4EF9A 1KGXA 6ALDA 4IFKA 2A5HA 4PL1A 4ERAA 3HG4A 3GNPA 1EDGA 3B9OA 4NZJA 4A3HA 3DHFA 3FKKA 4YWSA 1A47A 4AAJA 3QPYA 1D9EA 5DT7A 3WFLA 1NM9A 1M5WA 2PA6A 5E0FA 5HBFA 1L6SA 3VMPA 3GXIA 3QMRA 2NV9A 2YW3A 2Z2UA 5LA2A 2KAUC 2VWSA 2VZSA 3VU2A 2FTWA 4H7VA 3UGVA 5C7HA 1QI4A 3KOZA 3STPA 1UKOA 4A3YA 3LCXA 4AEEA 4JTKA 3KS6A 4GIYA 3W7IA 3S2CA 2WC7A 4MNKA 3VNIA 4NRSA 4B9YA 2JE8A 1EGMA 3QFWA 3OZYA 2BVYA 5HWNA 3F4NA 2F6KA 3LSCA 3I4KA 4NZ4A 5I79A 4HNCA 4V1XA 3B9NA 2J75A 4M24A 2NQHA 2VCBA 3AS0A 2YB1A 5IFPA 3H2EA 1LUCA 5CXPA 4G2DA 5LIUX 1SVDA 1WV2A 2WMFA 1BXNA 5ECVA 3EKZA 3LTSA 4J2MA 5F2GA 2VQUA 1JG9A 1QI3A 1IYXA 4JIQA 4W84A 4ZO6A 1F6PA 3BE7A 3UXKA 1TJRA 2DT2A 4ROQA 1QW8A 2JIEA 3FIGA 4CNOA 1NFPA 2WLZA 4WSHA 3IPWA 4HHMA 3T42A 5DF0A 3A21A 4O54A 4BHYA 5A6BD 3KRBA 1TUXA 2DZBA 1SO5A 3VOJA 2V2DA 5IHRA 2BS9A 4JS3A 1E15A 2Z7KA 2BASA 3W1NA 3L4ZA 3T0CA 2F9RA 2Z2AA 3SQLA 4DJED 2HNEA 2PTXA 2PEVA 2V81A 2E68A 2Q02A 3SUSA 1E6XM 3MKCA 2BZNA 2YDAA 4A21A 3CTLA 1R0MA 1W1ZA 3P67A 4ENLA 3M0IA 4TVUA 3TJXA 3AU2A 4O1EA 4KRUA 3NM3A 3VM7A 4FXSA 5XIMA 4E5TA 3PM6A 2DT0A 3MS8A 1JZ3A 2FJUB 3R5EA 4MSSA 5JBDA 2CKRA 5HMFA 1G4SA 3CV1A 3XISA 1EX1A 4M51A 1TZ7A 4JN8A 3VOHA 4JGDA 3TN6A 1GORA 3CIXA 4GNKB 5CZJA 3H12A 2OYKA 3W72A 2HXUA 3GG7A 3MYPA 4GUFA 3R11A 1Y5XA 4EVZA 1MW1A 4Z1YA 5CGQA 1TPB1 4NG3A 3OU8A 4DWSA 3KS5A 1ZRQA 2V3GA 4ZTYA 1N8IA 1ECQA 4J3XA 3WD0A 2HTMA 3RCNA 3GE7A 1B1YA 4DRSA 1J0IA 3C56A 1B9BA 3PTQA 3UY8A 5A6SA 3VD4A 2PC4A 3CM4A 4C1NA 2DZAA 3WQ8A 2A3BA 4W5UA 3ABZA 1XQKA 3AZSA 3EX4A 4OQVA 4LY4A 1PE1A 4B90A 1B4KA 4A05A 4DJDA 1L6YA 4Q8TA 1PB0A 4TR9A 5HPOA 1ONXA 2DDXA 2XJ7A 4GFIA 4L6OA 2GZXA 1I1XA 1YEYA 3BLPX 3LDVA 4IG2A 5AYXA 3MA8A 4CNNA 5E6YA 1R85A 4S38A 1Z89A 1I2PA 4GZJA 3K5XA 2DU2A 1B54A 2VC9A 3HJZA 3QV6A 5LNUA 3G1VA 3DFNA 5EU9A 3BLOA 3ARSA 1E5NA 4ZEPA 4C6QA 3P5ZA 2PWHA 1E73M 3OA3A 3C0SA 1TUFA 4A2SA 1XLKA 3FVMA 2ADAA 3SN1A 4D1JA 3UXLA 4BR1A 4LBUA 4QSHA 4MY8A 3AWOA 2TAAA 4HA1A 3P8IA 1Q2RA 4JIRA 3L9CA 4MY1A 1K9TA 1I2QA 1XIEA 1O6IA 1BF6A 4WJ8A 4N7QA 3KLKA 3R58A 2ZUVA 4HZ7A 5E09A 4QG9A 4UOJA 3AROA 4GHRA 4QJ5B 3OODA 2Q8XA 2GWGA 3CC1A 3VNKA 2BFGA 2NT0A 3M9YA 3TYCA 1JCMP 5D9PA 5HINA 1B3WA 3L2LA 1QVBA 3W24A 2A3AA 3HURA 4RW5A 4AW7A 3SRKA 1UZ4A 4CU7A 4QNEA 4MJMA 2ZA1A 3WFZA 3OOQA 2OWWA 1H7OA 3FXGA 1HGYA 4LYKA 4TU1A 4S3KA 1ZSXA 2W66A 3MUAA 4GIEA