4AFYA

Crystal structure of the fimx eal domain in complex with reaction product pgpg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIMX
publication title Crystal Structure of an Eal Domain in Complex with Reaction Product 5'-Pgpg
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4afyA00
4Y9MA 3HV9A 4RNFA 3PJXA 3HV8A 4HU4A 3SY8A 4AFYA 4HJFA 3GFYA 4FOUA 3PJWA 4Y8EA 4F48A 3U2EA 3GFXA 4HU3A 4RNHA 4FOJA 3S83A 3PJUA 4Y9NA 3GG1A 4Y9PA 5MKGA 4Y9OA 4Q6JA 2BASA 4F3HA 3N3TA 5MKGB 3PJTA 3GG0A 3KZPA 4LJ3A 4LYKA 4AG0A 4ES4A 4RNIA 5MF5A 4FOKA 3PFMA 2W27A 4J40A 4KIEA 3GFZA 3TLQA 2R6OA 4RNJA 5M1TA
chains in the Genus database with same CATH superfamily
4MY8A 2HPMA 2X1SA 4ML4A 3BOLA 5DT5A 4CCZA 4A29A 4JIEA 3S83A 4MSSA 3T0AA 2A3AA 5CPQA 4IFKB 2V2CA 2DSZA 4MWAA 1I0DA 4AH7A 1OFAA 1G7UA 3MP4A 2OSXA 3CNYA 5LYRA 1TUXA 1BXBA 2P0OA 2WKLA 1KLYA 3CB3A 3WNLA 5CCZA 4F66A 1CEOA 1XYZA 1Z69A 4GY1A 4BCEA 4M6VA 3ONBA 4TR9A 1W3HA 1E0VA 2GQ8A 2CLHA 3BICA 3WLTA 4ZTXA 1W1YA 4KKXA 2F6XA 1BXNA 4RL3A 4TX8A 2BY3A 4K8GA 5CZTA 2BB0A 4BEQA 1EJWC 2Z29A 3AUOA 4B2DA 4BQ3A 1OINA 1S2UA 4CN1A 4E4FA 1I60A 3NL6A 5BXTA 5FJJA 3U57A 1G67A 3IEBA 3KTSA 4O0QA 1OFEA 4YWIA 1D9EA 1C7TA 4UOJA 1JGMA 1UUOA 1ISWA 1JI1A 2HROA 4JFTA 3I4KA 1MQQA 3UPWA 5IDIA 3S9IA 2QAFA 4E8GA 1NDZA 4H9YA 3TYEA 3ZT5A 2J7EA 1TWIA 4O4WA 4TV6A 1H7XA 1XIJA 4DJDC 4CCDA 3VTRA 2ZWZA 3RLGA 2O9PA 3RJXA 1GNXA 3WMSA 4PYSA 1JZ3A 1PAMA 2VGFA 3MB9A 3T2OA 3AIEA 3PBVA 3OB8A 4HQVA 4DPPA 4QS5A 3S1UA 4DJDD 1LOQA 3LZ3A 3W7KA 1SO3A 3FGCB 4EP8C 2ZOXA 1AD1A 2JKAA 3GR4A 2ZZ3A 4I7UA 1WAWA 1G4TA 3BL3A 2W3ZA 3S46A 3DG6A 3WLPA 2O55A 4MNJA 3UWUA 2INFA 1UIPA 1GOXA 1OK4A 1XLAA 3N2CA 3MY9A 4IT1A 1F4AA 4MOZA 2NWRA 3GC2A 1XKJA 1UZDA 3W1QA 1DWIM 3ISIX 2XFFA 4Z1BA 4X63A 1FCQA 4BY3A 1E0XA 1DXFA 4OV4A 5A3HA 1D7FA 3PNUA 1VH7A 2GLKA 3C2YA 1E9ZB 4IG2A 1SFSA 1EWDA 1GOOA 1PO9A 1KW1A 4FS9A 2WC7A 2DIKA 3W1NA 2H6RA 1REQA 2C1HA 2QW5A 5A94A 2TSYA 1Q6DA 3TQVA 3B9DA 1XINA 3W84A 5HOSA 1LQ2A 2PWUA 5D03A 4FZIA 4UTWC 1IEVA 1RVKA 2ZRUA 1GKQA 3VOCA 3GXMA 1KV8A 2QCEA 3OA3A 2DIJA 4X0NA 2H9AB 4JQ3A 1VBUA 2D73A 3VGBA 1XJBA 3VOGA 4B9ZA 5CPOA 5T8GA 1UWIA 3MI6A 2CC0A 4KFNA 2DP3A 3G1AA 3GQYA 4GKLA 3EX6A 3EMZA 4B3KA 5MF5A 4JBRA 3TLQA 1R2TA 3LGEA 1CGWA 1SSDA 1TWSA 1GQKA 1V03A 3SR7A 3LXAA 1CGUA 3N2BA 3FNDA 3PC0A 4IFKA 1WO2A 3TSMA 1V02E 1UPMB 2Z2BA 4XUYA 1I1XA 1TPH1 4J3TA 1M65A 4I90A 1PS9A 3FLUA 1H63A 1MUCA 1O68A 4PCTA 5CAHA 3SCVA 3R0UA 1UWAA 1J12A 1I9CB 2DU2A 4AXNA 4R3UA 1KV5A 2HJPA 5JH2A 2WWCA 2RJGA 2X7VA 3O63A 1Q45A 4HPNA 4HBKA 4RDWA 4XWUA 1FQ0A 4LJ3A 3WJSA 1W17A 1FDYA 5J5DA 2V3GA 1Q7QA 1O1HA 2YXXA 4MYAA 4O12A 1E72M 4DB7A 4J3ZA 4QG8A 2X1IA 1IXOA 2AQWA 3G1HA 4DJDA 3ARTA 2QGYA 2DJLA 4AHQA 4Q22A 3T05A 2P76A 4P7NA 5LNWA 2Y8KA 2F6UA 2KX9A 3W85A 3M0YA 2ZA2A 4KGJA 4W87A 1IR1A 4K36A 3LB0A 3PK7A 1XICA 3CUGA 3AMDA 3RFAA 3DX5A 5I07A 4NQ1A 4O1AA 2MUCA 4F3HA 4GQBA 3M0XA 3F4DA 3TWAA 1R3QA 1Q2SA 1KD0A 3H4WA 3PZIA 1W6TA 2QV4A 5IBXC 4YTUA 2GOUA 2CEQA 4ZE5A 3LERA 4RXGA 3VOFA 1KTBA 3PG8A 2XH4A 2ZDSA 4TX9A 3TOYA 1FDJA 2E9BA 2ISDA 1SGJA 1Q6FA 2NUXA 5FJIA 3UCQA 3U4FA 1ZS2A 2D3NA 2ISVA 2QCGA 3UP8A 3FGCA 3G6LA 4W89A 3CIWA 5I79A 1K9FA 1W1B1 2UY5A 1PIFA 1YXYA 2TRSA 4QJ5B 3MTWA 4QHRA 4DY1A 5HINA 4C6BA 1ZB5A 1HJSA 4LEFA 4OTKA 1TTPA 3WQ6A 1A3XA 1I1WA 3TN6A 1ONWA 4PFMA 3S2LA 3E2RA 1NWSA 3CIXA 2CLPA 1IWBA 4DM1A 1XLCA 3JU2A 3I6RA 4B4FA 4NI3A 1ZAIA 3QYSA 2VQTA 4UTWA 1TR9A 3L9CA 2QGHA 4A3HA 5LNSA 1RV8A 3NZ1A 3BSGA 2YZRA 3BCFA 3BW3A 4WJ8A 1PIGA 4JQ4A 1TIWA 3CZJA 4GZIA 1QK0A 3LZ5A 1OGBA 1FP8A 2AL2B 3O06A 4GH3A 1ML1A 4EVZA 2CIPA 1RPKA 4Q8WA 3THCA 4I9AA 1HXJA 2X05A 3NL2A 3MP5A 1VZWA 3MBDA 1H7PA 3ZLHA 5F2MA 4PMDA 2GQ3A 4R7WA 1RALA 5HWNA 2PDMA 4GJ1A 2OO6A 2VR2A 3CIVA 1Q6EA 3CWNA 2VR5A 1BTMA 1SZEA 4A8NA 4WVXA 3E2VA 4Q8TA 4MLJA 5HJXA 2H9AA 3B8VA 1QWGA 3GXIA 3AXMA 1NOWA 4INFA 1L6YA 1PUDA 1R9XA 2PS2A 2RHGA 1OG0A 3P82A 3QGAC 1DVJA 1BYCA 1F3TA 2GSJA 4PFHA 2ZUTA 4PUUA 5HNTA 2HE8A 2DSWA 2JE8A 4XD5A 1MMFA 1TTIA 2XIMA 3M0KA 5FF2A 3G3DA 2DEPA 2PGRA 2Q8LA 3TW7A 2R1PA 4H2HA 4HHLA 4R27A 2XVNA 4UMBA 3GIPA 2PDQA 1RLCL 2VZTA 4H9VA 3B97A 3ZOAA 2IW0A 3P0XA 1Y5XA 1EXBA 2HWGA 2Y24A 4C6PA 3SQSA 3VKCA 4HYVA 3BCDA 4ASTA 4K8HA 1XPGA 3LCFA 1HF6A 2QUVA 4LNYA 1ZENA 1ENUA 5LNUA 1QCWA 3PS7A 3F4CA 5AVHA 1CENA 2J4GA 3C2FA 5EY5A 4X9YA 2RJHA 1FRBA 1RP8A 3UG5A 2PDCA 1OX4B 1H2JA 2RDWA 1XDLA 4K7VA 5IBXA 2C91A 2X40A 3VPLA 1TE6A 1XX1A 1HZYA 1H11A 3PPFA 4DUXA 2PA6A 4JTHA 3EXTA 4WLCA 1AFSA 3F1QA 3T0BA 1RJQA 2XG9A 3G0UA 3QHOA 4JY8A 1N82A 3UEQA 2OELA 3V36A 4YCOA 2ALRA 1TJPA 1XKYA 1E1EA 2FGZA 3DZ1A 1LQAA 2FLIA 4AY8A 2NQJA 1OT1A 4G6CA 1BKHA 3KUMA 1E1CB 1C91A 4GUIA 3B05A 2VFIA 2NUYA 1JD9A 2PODA 2NXIA 4NJGA 4IMAA 2NQ9A 1NFPA 3GG1A 3TJXA 4K38A 2GJLA 2XFWA 2V81A 3KVMA 2VX5A 3LMZA 2VC9A 2OYLA 3QQ0A 4CGTA 4I5RA 4BI7A 4PMQA 3BAJA 4QBXA 2PBGA 2FVMA 2V68A 4WDTA 1X96A 2ZRVA 4Y9PA 4LXFA 4DIAA 1DPMA 1TA3B 3BURA 4GQRA 1SSGA 4O1DA 2PDJA 3GYEA 3R43A 1HP4A 2GL5A 3FV9A 3FDGA 2J6VA 1XIHA 3DIPA 3LCLA 1NU5A 4ILSA 4HKPA 3CUJA 1NIUA 1QOQA 3LOTA 1JEZA 1UR8A 2PLKA 3M46A 2D23A 3VDAA 2J8GA 3APTA 4UFJA 3MUZ1 4D6HA 2V69A 3LRKA 2QZRA 1FBAA 2QPUA 3AIQA 4QAIA 2AMGA 3VIHA 2OQHA 3C0JA 4Q6JA 2YIHA 1G4PA 2DZAA 2FVLA 4PSPA 4I6VA 1OFQA 1TPEA 3ATYA 2HK1A 1KFBA 4W5ZA 1PZ0A 1OZQA 1Q8JA 5HDRA 3RR4A 4ERAA 2D3LA 1GVYA 1RCXB 2G3NA 3PWGA 3W7EA 5BNKA 1ADOA 2BHUA 2GQAA 3WD3A 4AF0B 3O3RA 1TPDA 1E6NA 4Z2HA 5EMUA 4LB3A 4M6QA 3M9YA 2E28A 4QDPA 1KXTA 2PF0A 2DFAA 3IIOA 2YW3A 5D30A 2NVDA 3NTYA 3FY1A 3T08A 1VYSX 3ABSA 3BQ6A 1ZL1A 4TO8A 1I6NA 1YDNA 4YU1A 3EWCA 1C8XA 2C1GA 1U83A 4W7UA 4OOUA 4H2CA 3HF3A 3NG3A 3CC1A 1KWKA 4PTVA 1DIOA 3WMLA 3KBWA 1XG3A 4JEJA 5G5IA 4G5DA 2ZZ6A 3AMCA 1I2NA 4HP5A 3SGZA 3UXAA 5D4YA 5JBDA 5I24A 1KM5A 3FSUA 4ZODA 4A8LA 2Z1VA 3BV4A 4MNMA 2QJIA 4BF9A 4IFRA 2P50A 4HZ6A 1OJXA 3LS9A 2CZ5A 4PMOA 3FHAA 2OZTA 3UZWA 2WSRA 1DTNA 3N18A 3LSCA 4CN4A 4FI4A 3V4BA 3NEVA 3NO5A 4Y90A 2GGIA 1EFZA 1FWBC 3PBYA 4L7ZA 5E70A 2R9RA 1FWAC 1V0NA 4MM1A 3SZ8A 3BJTA 1Y5WA 2HV5A 1L6FA 4C1KA 5KMYA 1LWIA 1OX4A 3K4WA 3PJWA 2PDUA 1SW7A 1KC7A 3P93A 4PL1A 1HG3A 3GSMA 3M7SA 2BY1A 4M29A 4BKNA 1UP3A 3LLXA 5CZKA 3WQ4A 5T26A 9XIMA 3F2CA 3H23A 1CECA 3TIMA 4O4VA 5FIPA 3PZMA 5EL1A 4I6KA 2YYUA 5F4XA 1RPXA 3W81A 3GVQA 1OCQA 3ARSA 1DKWA 2RGLA 1NEYA 4Z1AA 5CKSA 5K9CA 4AG0A 3NIYA 5D38A 4JN6A 1E1CA 4W86A 3KW3A 3KBVA 2DUZA 2G3IA 5DX7A 2NW0A 5C2CA 1Q5MA 1DWAM 1XLJA 2IPWA 1GYLA 2EHHA 3I3EA 1TZ9A 3WBWA 1A80A 2DSUA 4O0ZA 3GXNA 4H9XA 2V5BA 3KOFA 5CBIA 1T8XA 4U31A 1MFVA 2X8RA 1XI3A 2CESA 4PMRA 1GOIA 5D9PA 1XHGA 1JDCA 2KZHA 2W67A 3W1PA 3K30A 1TG7A 1RQEA 1LL4A 1Z89A 2WHMA 3SSJA 1Q3NA 2FGLA 3FJ6A 3E5BA 1TA3A 3BAKA 1FFQA 1ME8A 2ZA1A 3M5VA 4DO7A 5D05A 1JFHA 4FHAA 5FD0A 3VDHA 3ZLFA 4U4MA 3M4HA 3B9NA 5JH1A 2QUMA 2J9YA 4AW7A 1IIHA 4LVGA 3UNTA 2A21A 2BVDA 3VKJA 3E1F1 1G6CA 4H7ZA 3VDCA 5G2HA 3L2IA 2PCEA 1DEDA 1AD4A 1S3HA 2QDDA 4BI5A 1B3YA 3C6CA 4EKJA 4M8UA 1RUSA 1J11A 2UBPC 1OF8A 1RXOB 2D22A 1QW8A 3BAIA 4F0HA 1LWJA 1SO5A 1WE5A 3VIKA 1VFMA 2BS9A 1HJQA 4XSMA 4JIPA 7REQB 4V33A 3MCOA 3BG9A 4Z17A 3FYPA 4K37A 2V38A 2PDLA 1L6WA 4B5WA 1PWMA 3STCA 3LXBA 4NJJA 5FEZA 5GVJA 5I06A 1MQPA 3KBNA 2R1MA 4QEHA 4UCFA 3T44A 5D2YA 4P5UA 4AF0A 4F9DA 5IFTA 4KIEA 4F2TA 4JD4A 4B3ZA 4UR7A 5DEZA 4NHVA 3UETA 1G0CA 4W8AA 1DJHA 3CEPA 3H8AA 4A05A 4I8YA 4AZ5A 4NZCA 2QHAA 1DIEA 2DDXA 4GWEA 1H4PA 2E09A 1D3HA 4Q32A 1B2YA 1PDYA 1DJYA 2XGBA 4LCSA 1XIMA 3VD7A 4DXKA 4TMCA 1KCXA 1X6NA 3HQ1A 1UWQA 1XRSA 4A8RA 1TO3A 1P0KA 3UZ5A 1JYXA 1RBOB 4FX6M 3HTWA 5CXPA 3MS8A 4LS0A 5CBBA 2XU2A 4ZXLA 2OWCA 1D8CA 3RU6A 1J8VA 4PH6A 4NP7A 3FVMA 2ZUNA 2Y5EA 3BLLA 2I1OA 1PX4A 5D9OA 2C16A 2INEA 3W83A 4GJJA 2HBXA 1XQKA 4CUCA 3TTOA 2YL9A 3EKGA 4NKCA 5LHFA 4I9TA 1QJWA 1VPYA 1NQKA 3ZYZA 2OU4A 4JNZA 5E93A 1E0WA 2QDEA 4LVAA 2ZZ5A 4PMYA 3WNMA 1HUVA 4GZ7A 1EA9C 3VGFA 3DG3A 1S39A 2R14A 2F38A 4TMBA 1R7OA 1PX3A 2G37A 1TX0A 1F76A 2VMFA 4HK5A 5LXXA 3KP0A 3URAA 1UMLA 1FH9A 1WYIA 1JYVA 1UR3M 5TNVA 3M5YA 4UWMA 5C7VA 4FXJA 4PUDA 4JCLA 3COTA 3OIXA 3LTSA 2CKSA 3A64A 1W3KA 1SMDA 4U28A 1I4NA 4QLJA 5DFAA 2B0MA 5U7SA 5ENLA 4JX5A 4EPEC 1CXFA 3OU8A 3LBMA 3LDVA 1J5TA 4EF8A 3GZ3A 2GGJA 2ZX9A 4JTTA 3UVAA 2VGBA 3EA3A 3NQ6A 1WDSA 3PTQA 1KR0A 3NDZA 4HHPA 4AZIA 4XTIA 4CVUA 3T55A 4KETA 1FWIC 2AAMA 1HVXA 4KIRA 5BWFA 4G8TA 1X38A 2GGEA 1OD8A 1XF0A 1EH9A 3RLUA 1KBIA 3M07A 4TVCA 2YL5A 4XD3A 1KGWA 5KITA 1FCVA 4QLLA 3KXQA 4GGHA 2H3DA 1TIMA 4H41A 1FWHC 2C8NA 3EMCA 1YHTA 4GACA 5C9XA 1PIIA 1RHCA 1U1UA 4IMFA 4XK2A 3OODA 1LOSA 3ZT6A 1SJCA 4GZJA 4JHOA 4F40A 5AC6A 2Y63A 4JTLA 2E5DA 4DZ5A 3IS4A 2PP3A 2EG6A 3SCRA 4IOTA 3VDBA 1PX8A 2PDGA 1R3RA 1VB9A 1JCXA 2PWVA 4IP4A 1W5QA 5DCBA 1KRMA 4HB7A 4W85A 3GXDA 1B54A 1EUNA 1LOLA 2ESCA 3N2OA 3E0VA 1XYMA 3EKLA 4C6FA 5HQMA 7REQA 2EPKX 1G69A 3IUHA 2QJHA 5BXSA 2OWXA 5HPCA 3POHA 4S3JA 1VIZA 3SCQA 3CAQA 3F4NA 4FO4A 4AIOA 3T0DA 1KBJA 2E68A 1RCOB 1CLXA 1W9VA 2VQUA 1TTQA 3HV8A 3WEMA 2P8BA 1V3JA 3R4IA 3TYAA 1XGZA 3NM3A 3UR7A 5KETA 1NJJA 3DFTA 3ITYA 4ZO7A 4GG9A 2GJRA 3I65A 3PF3A 4E2OA 3MUXA 1XS2A 3ITOA 3A22A 1X1ZA 2IQDA 2PGFA 4OIFA 4FMVA 1TVNA 1EDGA 3TDFA 4B5SA 1EC9A 1K6WA 3VNLA 3NZQA 7XIMA 4GQQA 1ECQA 3VGHA 5FOOA 1UJPA 4HA1A 3IVUA 3AS0A 4YHEA 5AN7A 3ITXA 3IJ7A 5D2XA 1CWYA 1GGOA 1LQ0A 2ONEA 1MFUA 1HN1A 2FHCA 1AW1A 4JTRA 5I3HA 1P6BA 3PBGA 4QQUA 2QIIA 4GISA 3UXIA 1CCWB 4DBSA 1B5TA 5CJMA 1DP0A 4JFWA 3ZFHA 2WOQA 3W6MA 3EPMA 3EA2A 4JIHA 1W5NA 3TVAA 3USBA 3DHFA 4CD8A 1UD2A 2Y5SA 3ELFA 4GYFA 2XH7A 3RCYA 4ZENA 3L5MA 2AQVA 3KTCA 1MW0A 3CH9A 3GFZA 2G3MA 1AH0A 1CPUA 1ISVA 5D33A 1WQ5A 4GVFA 3OBAA 1JPHA 5CPNA 1I2PA 1TPFA 1D2KA 1B3ZA 3UFYA 5A8NA 3DEQA 4KWVA 3UWEA 5LXEA 1TJ0A 5A8MA 3PULA 2O7QA 1VBHA 2J7GA 9RUBA 4MPKA 3R79A 2QUNA 4H6KA 5C9WA 1JUKA 1XIBA 3N9SA 3K1DA 1IEXA 3FEMA 3A4AA 2JKPA 3O6DA 1R30A 2QCMA 2UY2A 1SU5A 3P8IA 3VGEA 3W72A 2WC3A 7TAAA 4QISA 4RZ4A 1WNOA 4LTSA 4J27A 4QP0A 4L65A 5E0KA 3VAVA 4ADTA 4IPNB 4MJZA 5FL1A 4CQ9A 1MWOA 1V08A 3HJEA 4LB4A 1K4HA 1TSIA 3PWIA 3LPPA 1C7SA 1MI3A 3ATZA 1J6PA 2PP0A 4M80A 1ELSA 2YL8A 4ZL1A 1A0EA 3DBPA 1JDAA 3WLSA 3GNNA 4IIBA 1QNSA 3SCWA 1QPKA 3HQOA 2RH9A 1SVDA 4IPJA 5EMMA 3OTRA 2ZKMX 2C0HA 3H55A 3H22A 1XISA 4BI6A 1LRTA 3HPZA 3LI1A 3G1XA 3OLDA 4J28A 3CUFA 4UIOA 3SUVA 2HSAA 2OG9A 2Q8ZA 1KCZA 1R3SA 4AYGA 3UWZA 1O4UA 1QW9A 2A5HA 3LQGA 3CXOA 1IWPA 5H8PA 2PWDA 3OYXA 4FP1A 2ZZ4A 1I2RA 4WXZA 1TCMA 1XIGA 3CMFA 3TONA 1NDVA 3WZ0E 1JG9A 3WJXA 2XIQA 2CPUA 1E4IA 3B0YA 4V27A 1SZFA 1WPCA 3G24A 4NILA 1BKSA 4WDWA 1K8ZA 1UB3A 1TELA 4IPPA 4PMNA 3U5UA 2DUAA 3N6HA 2YA1A 1BXCA 3ALFA 3WNOA 4CQAA 2DQXA 1KBLA 4W84A 4RKAA 1V6UA 2JF7A 4JICA 3CO4A 2YXOA 3NQBA 3TXZA 3WBEA 4G2DA 4KGLA 2DQWA 4E8DA 3K8LA 3RMEA 2A85A 3QC0A 5A6LA 1A5LC 2PURA 1UC5A 4GBUA 1UR9A 4GY0A 5A2BA 5F4WA 1YEYA 2P10A 2G41A 1GOKA 5H6HA 4MUPA 5JIWA 4MYXA 1ODZA 3ZVHB 1TMLA 5M3WA 1QBAA 4HMDA 2R1LA 1HVQA 3WDQA 2G97A 1KA9F 3W7DA 1SUXA 4HVXA 1TV7A 1XQLA 1ITCA 3TNBA 1GG1A 4ZXOA 4GC3A 3WD2A 4V1YA 3WX7A 2NX9A 3WH7A 3BW4A 3UGVA 2AQOA 3MWAA 1YIXA 1ICSA 1XRFA 4DQWA 5AFDA 3ITGA 3W07A 1J01A 1XBYA 1SR0A 2W63A 2E7FA 3UZYA 2P8CA 5KSWA 3QXBA 1KM6A 2TAAA 2EO7A 2V63A 2OQLA 3AS2A 1YXCA 3WNPA 2ZDRA 2WLYA 4JHMA 3IK4A 3VKAA 4L64A 3C3UA 2DZVA 3P5ZA 3R8HA 3DG7A 4U33A 2NXGA 4US5D 4JTGA 5M1TA 3SCNA 4AD2A 4CD7A 1W3IA 3U2CA 2V3EA 2W6RA 3L23A 5CG7A 1WBHA 2BY2A 3MI3A 5K4XA 2VGGA 1J79A 2VZUA 3VNYA 1X1NA 3NSNA 2DVUA 4DPQA 3H7RA 3UJ2A 3TX9A 3EXSA 1IZJA 1M01A 2Z7GA 1X6UA 4L9ZA 2GPTA 4TIMA 1V7YA 1IXNA 3KRZA 3MJYA 4M6PA 1JIBA 3R10A 4N9DA 1XP3A 3K1GA 2PWHA 5E09A 1UKSA 5TF0A 4FOKA 3CLMA 5JU6A 3WY1A 3LG3A 4TV5A 3FKKA 3NPWA 3KCOA 1IYXA 1TPC1 4IMGA 5G1MA 3R5EA 1VLWA 4E2DA 3VFCA 4JN7A 4D6FA 2ALDA 3FX4A 4WGXA 1B0IA 4JR5A 4HA0A 4W7WA 1JAKA 4JTIA 1VCVA 1QW7A 3LUTA 1VAHA 4D9PA 1GKPA 3BAYA 4ZZ9A 1V93A 5T91A 4IUGA 1BEUA 2XM1A 3GXPA 3TR2A 1EZ2A 5KZ6A 4ZFCA 3LHWA 6CGTA 1O7AA 3EBVA 3GG8A 4HA4A 4QFUA 1T0OA 3BG5A 4XBJA 1V3IA 3WUEA 1E6ZA 2R8WA 4KMQA 3BMWA 3GVGA 4P8WA 2YCEA 1IT7A 3STPA 2JFEX 2VHLA 2ANUA 2HVNA 3V5OA 1MXGA 4LBRA 1LM1A 3E9AA 3KZPA 4UXDA 3VDGA 4A3UA 5FAJA 3H70A 1E6RA 1CIUA 2ZBTA 3QLDA 2IXUA 3V0TA 5CPMA 4DZIA 4FIRA 6REQB 1QVBA 2EBNA 3LPOA 1LT8A 1W37A 1LL7A 5EPDA 3E6EA 4YL2A 3IGXA 1DHKA 4BA0A 4AZHA 2DVTA 4LC8A 3KCLA 4KRTA 3CQ0A 1EO7A 3P0WA 1EEXA 1W8SA 2VX4A 3DECA 3OHIA 4IX2A 3EWXA 4L6DA 2GDVA 1FWJC 1IXPA 2NSXA 2QT3A 3WK0A 2CLKA 1R6WA 3T0TA 5C70A 2XN2A 3BGAA 3AIWA 3UCDA 5K4ZA 3BTNA 4URIA 1P6CA 2ZXBA 5CGMA 3BGGA 3W7PA 3PZVA 2O9OA 4WSKA 1WDPA 4JTCA 4UNKA 4DN1A 2WLZA 1LF1A 1ZBKA 3TV8A 5FF4A 1EX5A 1ISZA 3ZVHA 4US5A 4FNTA 2W92A 4WIWA 3GW0A 5EBUA 1GPFA 1XLDA 2NXHA 4L56A 1NY1A 1QO2A 3AOFA 1A3WA 3MVTA 4M5PA 1H3GA 2EG7A 1X39A 2Y7DA 3GX9A 1UMYA 5EA9A 2QQ6A 4S3GA 2J13A 4LUSB 2VEKA 4E2BA 1QHZA 3NCOA 3DHUA 4CNPA 5KZEA 1OM0A 3OW1A 1EGVA 4U3AA 2GSHA 3H4GA 3MV11 1O6IA 2C15A 4DI9A 3VNJA 5BYWA 2Z1BA 5LGXA 4M81A 4TOQA 2IKGA 1VBRA 3SI9A 1S5MA 2VCBA 4IIFA 2AL1A 2ZX6A 5B80A 1WZAA 1UH3A 1SO4A 2BXYA 2PGWA 5I5RA 3TW6A 1BHGA 3D5HA 1Q6CA 3VGDA 2IXVA 3NQMA 3B0UX 2BDQA 3WJWA 1XXXA 1UUQA 3EOLA 3TROA 1FWTA 3PHAA 4XAYA 4MMWA 1G5AA 3QOKA 4GUHA 4LUIA 4Q8OA 3SCPA 4FX8A 4D6EA 5JXQA 1UWTA 2GWNA 1BWVA 3S5ZA 2J7DA 4GI9A 1FTXA 1O5KA 1VPXA 4GX8A 3WELA 4M24A 3VIJA 3KM8A 1GYNA 2ZTKA 4UR9A 3V35A 4JXCA 1PXGA 5JVLA 5AVNA 5G1TA 5I02A 2NLYA 1X1OA 1WAUA 3DH7A 2V6AA 2XN1A 3LBOA 2GDUA 1A5MC 1P0DA 3G1YA 4RZ5A 2RDTA 2XWDA 1QRQA 4PB4A 1FX6A 1XD0A 5AYZA 3WDHA 2FB2A 3V16A 1SJDA 3W7OA 3QV8A 3UVIA 3UPBA 4MTVA 3QW4B 4C1LA 2FZBA 5A6AA 3W71A 5FI8A 2DY3A 4IX0A 2BG5A 2VCCA 3CAWA 3N2MA 1T40A 3G2GA 4S1FA 4IP5A 1DOSA 5J8LA 5H91A 4HNCA 4PTXA 3O6AA 3RPMA 1FA2A 3GR8A 4GNKB 1MZRA 4J4KA 5DCDA 3R0KA 2XZ7A 4W8LA 3S1GA 1Z8AA 2OSYA 3A12A 4S3EA 4UMAA 1NARA 3MMDA 3QY8A 2EJ1A 4MY9A 1XC4A 1Q65A 1F07A 1RK5A 3GK0A 5EMKA 2NVAA 3FDKA 6REQA 1NM9A 1V3LA 4D8ZA 1EJXC 1BPLB 1PE1A 1GHSA 4NXKA 3L4UA 4QLKA 4AZ6A 5C9RA 1Q6GA 5IM51 4HZ7A 1GVFA 4H19A 1ADDA 3UJFA 2RDUA 3P8JA 2Q09A 4OQVA 5LIYX 2V5LA 4GIAA 4MPQA 3FYYA 3OLGA 1JNDA 1YNQA 5D37A 3W23A 1BF6A 2OGYA 2J7HA 3B4YA 2WJDA 1W1TA 2WMJA 4N0RA 2DZSA 3WLRA 1MW1A 2AAAA 3GD6A 2ISSA 5T9BG 4UFKA 3S1WA 1EC7A 4E5TA 2XVPA 3UZXA 5AECA 1V7AA 3CUIA 3NYZA 3NZGA 4ZQRA 1US2A 4CNTA 5REQB 5F1UA 4MHBA 5IHRA 2J66A 3SN0A 2A3HA 3CAKA 4F2BA 2E67A 1E40A 4Y9MA 3ZJKA 3P14A 3M64A 4FF7A 1K8XA 1JUBA 3TMQA 3W00A 3KHJA 4IIHA 1AZ2A 1TV5A 1UYQA 4HD5A 4OBSA 5IOBA 3GNRA 4MJ4A 1CB7B 5FF7A 3UR2A 2A3CA 3PTDA 1GYMA 1EBGA 4WRHA 3RCMA 1TJ2A 4W7VA 4E4PA 4K3ZA 3BLFA 3FK4A 5TIMA 4LUSA 4AU0A 4BQ5A 3GNDA 4B9YA 1QI2A 1K9TA 1RH9A 1POKA 3WYZA 4IMEA 3IV3A 2I17A 3L65A 2W27A 4CKQA 1DTUA 2QVHA 1EKOA 4C65A 2A0NA 1IT8A 3TUUA 1TQJA 4NF7A 2CBIA 4PBEA 4ZCWA 2LLEA 4HU8A 2HNHA 4PL2A 1RJPA 4YTRA 2C14A 1CXKA 3BARA 1R2RA 1ECEA 4KEMA 4LAZA 3EB4A 2E5BA 4WY0A 3IJDA 3N34A 2OR2A 1HX0A 1PKYA 1UKOA 3FKRA 3EWYA 2E8YA 2VD8A 2R91A 1RD6A 4B5UA 5HATA 2QJMA 2OEJA 3L66A 1G1YA 2VRKA 4ONVA 1W0MA 4M6UA 4LYKA 1UKPA 1DQWA 4UZUA 1DJGA 3SADA 3SFWA 4E2VA 2VEIA 3W2KA 1HNYA 3PB2A 3AZSA 5E0FA 4ZB0A 5A6BD 2XFRA 2NQ5A 4RE2A 1K7XA 5C55A 4EPBC 3WUGA 3IK2A 3VILA 1PZ3A 4WOZA 4O52A 4WJXA 1ZBWA 3LCXA 3SURA 3HIJA 5F2LA 1F5ZA 4Q33A 3KOXA 3WH6A 4EX4A 1NP2A 3CGTA 5EB8A 1JZ5A 1DORA 4QQ3A 2VFEA 3QGKC 4C6LA 1R47A 1MDLA 1ZPTA 4RPPA 3W7HA 4ECLA 3CHCA 5A8OA 3QR0A 1YBQB 4UOQA 1TV8A 1KTCA 3EGJA 2OGJA 4HSHA 3S9ZA 1K1DA 2J27A 1F7BA 3VM7A 5BXRA 3CS2A 2PC8A 1HJXA 1R3WA 3KE0A 4Q7BA 3LEPA 4H01A 4L6OA 3T1GA 2BODX 3LY0A 4Z42C 1NTHA 1SFJA 1AW5A 5JBEA 2GK1B 2PTWA 4M51A 4O28A 3AYTA 5DY2A 2EPLX 2BASA 1UD3A 5J04A 1DWJM 1XDJA 3MUIA 4MJ2A 3SEPA 3UXDA 4GFSA 1LZOA 4X61A 1QR7A 3MVIA 2DGAA 3D3FA 2Z6IA 1S38A 4I8DA 3RG6A 3DU0A 4G1KA 1HKMA 1LL6A 3H24A 3W02A 3GU1A 1EGZA 3MC5A 5AYYA 4MZ1A 4LEQA 3P74A 4KT2A 1GTHA 1PTGA 3WQPA 3REQB 1YDYA 1MVYA 3MQTA 4RJEA 3TAKA 4LYPA 1AMKA 3AZRA 1B30A 1ICQA 3U2OA 1KXQA 1J10A 3AJXA 3OLEA 3F2BA 3VX1A 5REQA 1AH3A 3T4WA 2CLIA 4KWWA 1KWGA 3RR1A 1LG2A 1JCNA 2FB3A 3TTYA 4RNJA 4XZ9A 4PUKA 1RSCA 1ZAHA 3SRKA 5E6YA 2JEPA 4UTFA 1LRQA 4M0XA 3R94A 1NELA 2YCLB 1Q4WA 5IDZA 1TWDA 3SFKA 4AD4A 3EPOA 1Q6LA 1RR2A 4TU1A 2QEZA 3WLQA 3B9OA 1WDDA 4J3VA 1XDMA 1LRNA 1W3TA 1V6WA 5A6BA 4YJ5A 1YPXA 2FTWA 3WEOA 5FF0A 2B7OA 2TYSA 1BTCA 1X8CA 3MKKA 3HMCA 1M41A 4N9EA 1O66A 3BJSA 1JPDX 2QS8A 1XBZA 3AHYA 1ZJBA 3TC7A 3F5JA 3GC5A 3OLIA 2D20A 2HBVA 4AMCA 1CB2A 4HU4A 3O05A 3ZMRA 2XISA 4DM2A 1JPMA 2PRLA 1SW3A 3Q67A 3S3GA 2IMRA 3V7PA 3W25A 5I03A 1YNYA 1IV8A 1W1ZA 5G4EA 4A3QA 1H09A 2QKFA 3WF3A 4RV8A 4NAEB 1F3EA 2ON3A 3IARA 1Z32X 3N12A 3NSXA 3XISA 2VC6A 1ITXA 3W74A 3KWSA 1IT0A 7PTDA 3SJNA 3SIMA 3QBUA 3WJZA 3F03K 4EACA 2VX6A 5C7HA 5D2WA 3BWWA 2J47A 5AZ1A 4D1JA 1XYLA 3QTPA 1V3HA 4KWUA 4XAFA 5LSMA 5D02A 2Q3RA 5DY3A 1V6VA 5I7GA 3WK1A 1D8WA 1ESWA 4MKVA 2PC4A 2YR1A 2PRMA 1QUMA 3AFBA 5M2FX 4Y2WA 3VIIA 1D3CA 4X0VA 2Z26A 4ML9A 2VRJA 5CSRA 4UNLA 1IWAA 4NSBA 4BEUA 1XUZA 2BGNE 4WKAA 2NUWA 2BVYA 4Z1DA 1VJIA 1YBQA 3KHDA 4KWSA 8A3HA 3IIXA 4H7VA 1C8VA 3NQEA 3TJLA 2E1WA 1QHOA 4LUYA 2CERA 3WD0A 1B9BA 1R38A 3MZ2A 1VFOA 4O54A 1LCOA 2E3ZA 2ZUVA 4YTTA 3ABZA 1PTDA 3S4TA 1WV2A 1KM3A 1JQXA 1IR2A 3ECQA 3IGUA 2I7GA 4ALDA 1NDWA 1AH4A 3HB9A 4UTKA 4PUNA 3IV8A 3NJ3A 5CSYA 5EMYA 3BMXA 3B03A 1XLIA 1AG1O 2FHBA 3N29A 3OG3A 3FJNA 1ZHAA 1UR4A 2VR4A 3D6NA 1VBJA 3KDOA 1UWRA 2IPGA 4OWGA 1LLZA 4AEEA 1SR9A 4HHMA 1C93A 2YDRA 3RYSA 4K7YA 1MUMA 3FAXA 4LW7A 5M17A 3VNZA 4IIGA 5F1VA 3PPHA 3O0FA 4YCPA 3N15A 1FWNA 5HR7A 3A23A 4JYFA 1S5TA 3REQA 3DOPA 4H9ZA 2YX0A 3GVVA 3O6YX 1J5SA 3W88A 2WVSA 4HZMA 2C7FA 3S5OA 3M0LA 2OOGA 1XPYA 1EOMA 1U5HA 1GOQA 3HG3A 1W56A 3MWCA 3RNDA 3DDMA 3NDOA 1HKWA 4LX4A 1Z7AA 3ZWSA 1B90A 2GUUA 3HV9A 3H2AA 1R3TA 2QDHA 4JX6A 3V5FA 3ABOA 4AD0A 3K5XA 2Z28A 3DKJA 1TJRA 2WMIB 4O1FA 1OK6A 5FJPA 4JIRA 1EDQA 1W3JA 2W61A 3V5CA 9CGTA 3RMJA 5H1WA 4L4OA 3WK2A 5LZLA 4Z0SA 4RV3A 2PUZA 3TFXA 3WD1A 5A6KA 4AZBA 1XBXA 2YCLA 4X2RA 3WLNA 1DXIA 5BROA 1WDWA 3T40A 2PWEA 1VJZA 1PHWA 2HMCA 1K4GA 1XLFA 2PWGA 3UZZA 4LCQA 2YL6A 1VEOA 5G2IA 3BLEA 4I5XA 3H53A 3C0SA 1JCTA 1WB0A 1FWCC 3WQGA 4AQLA 1EQCA 1QAPA 1YMYA 4TVUA 1FH8A 4ZQNA 3PJTA 4DO6A 2VVNA 1K9DA 2BGQA 2A7PA 4O1EA 3VYLA 4CEUC 4RE4A 4ZOAA 3C2EA 5TAOA 1K8YA 4DBWA 3GAYA 2CYGA 4C6CA 3G5EA 1FCUA 3TE9A 4QIUA 3B8SA 5EBAA 3G1RA 1A47A 3APYA 3L4VA 3ZR4A 1LG1A 3LTYA 3GIQA 4KH2A 3CL8A 3B0XA 4NAEA 4M82A 3AMKA 3A3XA 1XRVA 3C2OA 1M7XA 3KX6A 2JKEA 1EJUC 4H8NA 2WSKA 4F0MA 3E96A 3VNDA 3NQFA 3H21A 3UJSA 2PDKA 1JXKA 1XCWA 3DHPA 2QPXA 3WQ5A 3IJLA 1KGUA 2XYLA 4ZQOA 5I77A 3URQA 2Y8UA 3GZAA 4IGHA 2O9TA 5CSSA 4PN2A 3JS3A 3KS6A 1UC4A 3MSDA 3TR9A 4G7FA 3IPWA 5I3IA 1I2OA 1PYFA 3GIYA 1LDCA 4Q8QA 5FSEC 2CW6A 4F0KA 4EE9A 3I10A 1EIBA 1MDRA 3CZGA 1ICPA 3CB8A 1LWHA 3LPGA 1KTNA 2NVCA 3KBMA 5K9DA 1O95A 5J5RA 3ZJ7A 1F2JA 4MKNA 4Y9OA 4LC6A 4YVXA 3RGTA 1FWRA 2YFNA 1CNVA 4C90A 3UCCA 1QTWA 2VC7A 1JDEA 3OQ8A 5KINA 1XRTA 2X2YA 1H60A 3VMNA 1Q2RA 3MUY1 1W3LA 1B9ZA 2NQHA 4TVDA 5HA7A 3NA8A 4JN8A 2REQB 1QOPA 1SZRA 3ZSSA 2C13A 4GYPC 4U2YA 3MZNA 1E6QM 3BV7A 2WHJA 4UFHA 3LHVA 4XZMX 1ZY9A 1WCGA 4MNKA 2ZA3A 3OGVA 1TJ1A 3QR3A 2YW4A 1IIGA 4KCWA 5CJ5A 4QCEA 4Y9NA 4DF2A 3T0CA 1LLWA 1YDOA 3BLPX 4ZQPA 4E4UA 1M6JA 4LY4A 4H9UA 4N02A 1QT1A 2HVMA 2ZICA 4JDYA 1QOXA 3S8HA 2GWGA 4UR8A 4JIQA 3AS3A 3AZTA 3GHUA 4M1BA 4PTDA 2DZXA 5EKYA 3DI1A 1S3TC 1ZCCA 4O18A 2YBUA 4O8RA 3STEA 4ZO9A 6XIAA 4DF1A 3SCTA 2NV9A 4K68A 4JTQA 1DJWA 4J3WA 2B31A 7ENLA 3DFHA 3SN1A 2CZFA 4UTUA 3V0SA 2QIWA 2V2DA 3GUGA 1TMQA 2PCQA 3IJ8A 4ICCX 5GQBA 1QNQA 1GQLA 5I3JA 3QMRA 4QE5A 5A1AA 2VXNA 4GVIA 3VKKA 1MO0A 2A7NA 1C29A 4PRTA 4DZHA 4P61A 1VLIA 4W9TA 1CW2A 3KTXA 1Z6KA 1M3UA 3I6TA 4JIIX 1FWSA 1R5YA 2O4QA 4Q4KA 3ITVA 4GIRA 2DV0A 4R85A 1MW2A 3UG3A 3BMVA 4CU8A 1WXJA 3E74A 2QF7A 4AUBA 4EAMA 4DUOA 1PZ2A 3NFUA 4L61A 5ABFB 1V0LA 2O92A 1FKXA 2F84A 4YNGA 6A3HA 2QUUA 1U1HA 4XD4A 1XCFA 1JYNA 3QEZA 3LPFA 5BU6A 3VFLA 1NSJA 4KEZA 3TK7A 4EF9A 1C9WA 3MU7A 3MW7A 3UWQA 4IJCA 1HO4A 1A3HA 1S2VA 1OGSA 3B8IA 1KM0A 3GTXA 4D6GA 3F4WA 3LHYA 4AHPA 3JZUA 5BOFA 1HGWA 2Y89A 3U9IA 4NL1A 4KCUA 4MIMA 3LX9A 4H8VA 1V0MA 2OEMA 3E2QA 4XZLX 3HGOA 4FR6A 2IUZA 4RCXA 4ICMA 5HWMA 3CYVA 1E0TA 3M0ZA 3W70A 2VEPA 5EFDA 3RUBL 4IL2A 2CLEA 3SECA 4OOZA 1M1BA 4AVNA 1SQ7A 3CMGA 1EGMA 3DC0A 1VP5A 5AHEA 2DJXA 3RLHA 4A6GA 3W9ZA 5CEWA 3SUTA 4LWWA 1IZKA 3MCNA 4GYPA 2RGMA 1QI4A 5DMMA 1E1FA 4KEVA 3VKBA 1F6YA 3GTFA 3AWNA 4GY7A 1MYRA 3LNPA 3K8MA 1N7KA 4GO8A 1GK8A 1X7IA 1P6WA 1FWFC 4Q4QA 4UQ9A 2XSBA 4QCFA 3UR5A 1F9CA 1HL2A 1V79A 3SW6A 3BUVA 1XCXA 2ZQ0A 3O0KA 1EO5A 3EDFA 2YOCA 3O6CA 3QH2A 2J7BA 2REQA 3TTSA 1FUYA 2WJFA 4N9CA 2A7RA 4YS1A 5CZ0A 1S2CA 2O9RA 3CL7A 5AYBA 4A4AA 3WF1A 3L5LA 4GXWA 2GJNA 2WMHA 1TPB1 4B92A 3HGSA 2XWEA 1GZ1A 1DXEA 2BOFX 1ZALA 2GYIA 1FHDA 1U22A 2V30A 4H4IA 3WDPP 4AX7A 3PBMA 2ZUUA 2H3BA 4HTYA 1T5AA 4J1OA 3KOYA 4QGCA 1EJTC 2ZZ1A 4J3XA 1B3OA 1MQRA 4J2MA 3TU9A 2ZZ7A 1MEIA 3H7VA 1GJUA 4GINA 3MCMA 3DERA 4DLFA 3OG2A 2HS8A 3JUGA 3LGGA 3LU2A 3M0MA 1ZCOA 3E02A 4J5NA 3BZGA 3W2NA 3VC5A 4JGDA 2WVVB 5CBJA 5E1QA 1CDGA 4HCDA 2XGIA 3W7JA 3W2MA 4S3CA 5B7YA 2XSAA 3L12A 3WNNA 4Q8VA 3CPRA 2F6KA 4DNHA 2PFHA 1XD1A 4P8XA 3RK8A 2VP8A 3KS5A 4A3YA 1E73M 4X2PA 4AIBA 1O5RA 4AZCB 4ZTYA 1ZU8A 3PM6A 4MZYA 4WKFA 3CLWA 4R53A 3PJUA 3M1ZA 1V6YA 4C6IA 3L0GA 2P5NA 5D8ZA 2V8ZA 5I0DA 3ZT7A 2FH6A 4Z2GA 1JZ7A 2OB3A 4WSHA 3GBDA 1UJQA 3UBPC 1U2YA 4UTHA 1UKTA 5ABFA 3CWHA 2WO5A 4GA8A 1R7AA 3ZJ8A 3ITCA 4IGSA 1HFBA 3CQKA 1PKMA 5DELA 1AZ1A 1TWWA 1WUFA 3BH4A 4UTLA 1EL3A 2WSQA 2PZ0A 3W22A 1Q7MA 4M19A 1AQFA 5AYIA 3QF0A 3B8UA 3GRIA 1LUCB 1Z42A 1H61A 4TTUA 4WDXA 3EMQA 3TEVA 4OJYA 2WZMA 6TIMA 2ZRYA 3TJIA 5DMLA 4C7FA 1ME7A 3UJEA 1UOZA 1H1ZA 3NEHA 1Q8AA 4GQ0A 1KKRA 1QPQA 2VUYA 4YXGA 2V5CA 3UERA 1GQIA 1OIMA 3OZMA 3M5ZA 2G50A 3NDYA 3RPDA 3FA4A 4K39A 3CUZA 1ZFJA 4ERGA 1CLVA 2AOSA 1H1NA 5A95A 2VDIA 2VTFA 1M53A 4H1ZA 2WJZA 1MW3A 3ID7A 3G77A 4C6OA 3BANA 3R12A 4XD6A 3EWWA 1UWUA 4AISA 3QGVA 3TTQA 5C71A 1XLEA 1FKWA 1GJWA 2X16A 1OVDA 2PEVA 3WQDA 5DMYA 4BFAA 3H54A 3SUWA 4WEVX 5GNZA 4FOUA 2Y7EA 1AA1B 1GOMA 3U2EA 7CGTA 1MXDA 4CQBA 1U33A 4V2XA 4QNEA 1Z9AA 3VZYA 3I68A 1W1VA 3PN8A 3WF4A 4M7SA 2GUBA 3WLKX 3U7BA 3OIHA 5HJLA 1XLBA 5KZDA 3A5VA 2VNCA 4PCNA 4NNBA 3NGJA 5GJMA 4GPNA 3TYBA 4AD5A 1PTAA 2DZBA 1UP0A 5LA2A 2WKJA 4KCTA 3MHUA 3HPXA 4AZ7A 1AL7A 3M16A 4BR1A 4BF5A 2PZNA 4L4MA 4PB5A 3AAMA 3VX0A 2DW7A 3GDKA 3L4WA 4RNHA 5AB3A 2QCHA 2ZRXA 5HWJA 4QJ3B 4CD6A 5FA5A 3IUDA 4XSLA 4QM1A 5AZ0A 3HN3A 1E9IA 1OYBA 2DT2A 3R8RA 3RITA 3CHVA 1A5AA 3N1AA 4CQDA 2HCVA 1I0BA 3U0HA 3HG5A 3P62A 2DW6A 4UFLA 4D6IA 2QCNA 2IKHA 4OUEA 5AHMA 4EANA 1S2AA 1CGXA 3GNXA 3MHFA 3KL0A 1GT8A 4QJ4B 4FSAA 2Y70A 3KOWA 2DZWA 3CZLA 4ERIA 2WVVA 3GTNA 4LF1A 3T6CA 3IIPA 1QMLA 4D6JA 3UYCA 4GGBA 3U48A 2Q8XA 3GBEA 3K4DA 2QVNA 4YYFA 4AXKA 2J8TA 2V3DA 2IS7A 3M0HA 4FXFA 3RRAA 3ZJ6A 4UOZA 2ISWA 5TQLA 1A5KC 4GHRA 2W4XA 2VC5A 5H2ZA 2CZDA 2ZTJA 5D09A 1EF3A 2VYOA 4PMZA 4AZCA 4E6MA 1WOAA 3PZOA 1M7OA 3SGGA 1VENA 2G3FA 5K3VA 4PTMA 2O7SA 4FEZA 4Q4OA 3RX2A 3WK3A 4AY7A 3GVWA 1EEPA 1HL9A 1QFEA 2NQZA 3U8GA 4D71A 1UBPC 3PP7A 3EOUA 2AKMA 5GJPA 2X2GA 1PB0A 3L0KA 4XV0A 2OLHA 1KM1A 2FFCA 2CLOA 2E9LA 2GFTA 3I4EA 4UZSA 3IUIA 1E43A 3AIRA 1OC6A 3QV7A 3TC3A 1W5MA 2CBUA 1TV2A 3NQGA 1UPPA 1DHPA 4H8HA 3JRKA 2C19A 1WZKA 2J75A 4YHGA 3QVQA 3WQ8A 3G3MA 1LUCA 3P81A 3L4YA 1JDFA 1XSJA 3WENA 4E3TA 1K77A 4HSNA 3ZSTA 5HPOA 3BLIA 4C5ZA 3TN3A 3MMUA 3MPGA 1RY0A 3MYPA 2EGZA 1L2UA 4EXBA 1V3MA 5G4WA 2BVTA 1NF7A 3IVTA 2WMGA 1VHCA 5JMUA 4NYYA 1I45A 1GVIA 2CBJA 3W86A 4N4QA 2AL2A 3E12A 1H41A 4KQNA 1HJVA 1YTKA 3AICA 3HGJA 2JGQA 2Z6JA 3R25A 3WL1A 4C6KA 3ZS4A 1F3WA 4WJEA 5CSUA 4JAWA 3K8KA 4GVHA 4I7WA 4V1XA 1QPRA 3EEZA 3EOSA 1IF2A 2D2OA 1QPOA 3C4UA 2VJXA 1RQHA 2C6QA 5DBTA 4X9SA 5FSDC 2ZXQA 1DV7A 2E40A 1RA0A 3L7RA 2MANA 3DYMA 2I5GA 1MNZA 3DGBA 4QTGA 1B3XA 3DUGA 4HK6A 1S1RA 2ACUA 1WUEA 4LANA 2ZZ2A 2ZVIA 1YLVA 4JTSA 4PCFA 5AHLA 3NVDA 2OPJA 3GS6A 1C9DA 2PB1A 2X0HA 2FMNA 3W24A 3HQNA 2G95A 1F4HA 3BK0A 3GDBA 3L21A 4AWSA 1TYGA 3T2QA 1G7VA 4UBPC 2WYSA 4MGGA 2VGIA 1VQTA 5I2UA 1OEPA 1WDRA 5EYWA 4M1RA 4CN6A 1JQVA 3BPWA 3A5FA 2FQIA 3A3HA 1LORA 3QJAA 2R1KA 6XIMA 3EX1A 3YPIA 3D47A 2BVWA 1GW9A 3EX3A 4Y6GA 4QS6A 4PULA 3VKDA 2OOFA 3V3WA 2DPEA 5HMDA 2NT1A 2OMAA 3POCA 1E6SM 4L80A 3VNIA 1SYTA 4FALA 3USZA 1B31A 3DYOA 5JUVA 1DIKA 1F3XA 1VPQA 1GVEA 3G8EA 3W1LA 5HQLA 3ZM8A 4GFIA 4GI8A 1Q85A 1MEHA 4LH8A 3S5YA 5DXYA 3QHNA 2VFDA 1X7FA 5CLTA 5ECVA 2E1DA 4NX0A 1EYEA 2TODA 2NV2A 3GW3A 3UYIA 1E9LA 1YXDA 2SFPA 1GPWA 2WCSA 1W31A 3TN5A 3W2LA 2XSXA 3N2XA 5GJNA 2PE4A 4MUZA 4XO7A 5HUPA 1KBKA 3N9RA 1FDZA 5A69A 2BP1A 3VZZA 2G4FA 3MDWA 4TXEA 2EF9A 3RLVA 3KVLA 4BWLC 4ZE4A 4PTWA 2P3ZA 1UBSA 3S5SA 4RDVA 2A3EA 3PJXA 2JIEA 1RA5A 4Q8PA 5HNRA 3OZYA 1KO0A 3BGJA 2V5KA 2A1YA 3AQUA 1SJBA 3N3TA 4PTNA 3VIPA 1BG9A 2ZX5A 3W7GA 5HMFA 2R24A 4YTQA 2OZ0A 3L5AA 1RLDA 2WM0A 5LNVA 5LIUX 2Q3OA 4MB5A 1DJNA 3VCRA 3FAWA 4NNAA 3WH8A 2Y8VA 3VOHA 4C6QA 3EWUA 3RDKA 4EPDC 2I14A 1J96A 2F61A 1JFXA 1PCWA 3LD5A 3TAOA 3DBNA 4KFOA 3ZQ9A 2CHNA 2GVYA 2Z27A 3GFXA 3EDKA 4UMCA 4W8BA 3VMPA 3WFLA 1TE1A 3NYDA 3WQOA 1TZZA 2E6YA 4GYKA 1EF2A 2BHZA 3VINA 3WQVA 3NQ7A 2AGTA 2J25A 1RAKA 4K1WA 2FPTA 2A2IA 2YCKX 4Y8EA 1EB3A 1T41A 1AVAA 5LA1A 3IJQA 3F7JA 3IVSA 3IIZA 1KFLA 3C56A 2WCGA 5K9XA 2H90A 2DIEA 1MRAA 3C8FA 2V9DA 2AGKA 3AS1A 4Z08A 3BOFA 2ACRA 3GFYA 5EU9A 4ZOBA 4JKLA 2RAGA 4GIYA 3R0DA 1F74A 8TIMA 4JQ2A 1KR1A 3VGGA 1MZHA 5CC3A 3GVRA 3W29A 1SJAA 2ZE0A 3KBSA 1PPIA 3BSHA 4PODA 3PPCA 1HGYA 3ZIZA 1KFWA 3NOEA 3PFMA 4DF0A 3FXGA 1M9HA 1QBBA 2GOKA 5M03A 3GDRA 1OC7A 5HAOA 2FZMA 2B7NA 3TP4A 4XBKA 1K6AA 3UR8A 2WXDM 1FOBA 4B16A 4O0KA 3Q58A 3G22A 4TUFA 4NX5A 3GUWA 4Z0JA 8CGTA 1G01A 4DYKA 1KRAC 4A21A 1OIFA 3H2FA 4HJFA 4ATLA 5E9XA 4K8EA 1J0IA 3CWOX 1AQ0A 3HFYA 3M43A 4F9JA 4TQTA 2QJNA 2I5IA 4ES4A 3W7QA 4BWLA 1FHLA 3M44A 4IIDA 3ERPA 4UC5A 1CYGA 5A6TC 4RXFA 1GWJA 1ZNNA 2F2KA 1EJSC 2A79A 3RO8A 1SPQA 1LJYA 2TMDA 5BMWA 3ZO9A 5DT7A 1IEQA 3LGDA 4KRZA 2QJGA 4KESA 3GDMA 1V0KA 1VFUA 3R7MA 1HIZA 4NZ5A 1BD0A 3D0CA 3DGRA 2D69A 2QV5A 1OYAA 2D2HA 2VZSA 1R46A 2J88A 4XG1A 5FEXA 2V67A 1JGIA 2FDMA 4JOMA 4LS1A 4IIEA 3WD4A 2PU1A 3QV9A 4BK9A 2ABBA 4BQ2A 3KAOA 2O4MA 4IH3A 1H7WA 4JX4A 4J3UA 2YB4A 4DYEA 3W26A 2CNCA 4PEKA 3RX4A 4KPLA 1QATA 2IPJA 5FEWA 2BV9A 2IQ0A 1K8CA 1ONEA 2HEJA 3WBYA 1O5XA 1E51A 4NZ3A 2X1TA 4B15A 4I9MA 4N42A 2FVKA 4MFEA 5I09A 3VIFA 2C3ZA 1SM9A 2OKTA 4HPJA 4R34A 2MNRA 5SWUA 2ABAA 1JPKA 3HOJA 1CX9A 3ENLA 3GU9A 4E8CA 3QRHA 2X1UA 1W2PA 1Q6OA 4DWSB 1YE6A 2VDGA 3E38A 5CC6A 2Z1WA 4Y9AA 5F4SA 1XL9A 3EOEA 2D0HA 1KLZA 4P7LA 3IGHX 4FF5A 2RUSA 1X98A 5AYXA 1YW1A 5CPLA 1TX2A 1NOFA 4QROA 2PI6A 1SW0A 3WH9A 5AC8A 3GG0A 4E3VA 4R9OA 1ZBVA 2BOGX 1T6MA 1C8YA 3HG2A 4D6DA 5CG0A 1GHRA 5A2CA 2J78A 1J6OA 4JL1A 1QI5A 4DJFC 3N19B 4XZBA 3FA5A 3WLJA 4XTDA 2PLCA 2JEQA 4ZSTA 1CGTA 4CD5A 3L2MA 3N25A 3OEXA 3EWDA 4DWSC 2YFOA 4MDPA 2YDQA 3BXWA 5I78A 2Y7FA 4XAPA 4G9PA 4DJFD 3WL0A 3VIMA 3EWBX 2ACQA 1EPVA 2FMOA 4XB3A 4JZ5A 3VUSA 3SY8A 4DWSD 2ZX7A 3UJRA 4GMEA 1ZLPA 3RJYA 4EIVA 1YPFA 3N11A 1ZSXA 6ENLA 1XV8A 4N2YA 4QE4A 1EWEA 1RD5A 4K2SA 4JTEA 3TOPA 3UNDA 2GVEA 1S1PA 2PD5A 4KF1A 4L6HA 4RNFA 1LBMA 1CGVA 2Z1XA 1JD7A 2IKIA 3SN4A 1JZ4A 3EWZA 3DFPA 2PPGA 3HG4A 4IGMA 3GNOA 5L6UA 3H6OA 3UXLA 2PTZA 2QAPA 2EJAA 3WH5A 1ONXA 1OD0A 1BRLB 2BGSA 3NO3A 2OXNA 4L9XA 3T2PA 2OTDA 3PG9A 5DANA 1EA0A 5TBOA 4DAFA 1C90A 4ZOEA 1XSIA 2EKGA 3GWQA 2W62A 1VS1A 3EB2A 2V3FA 1X8FA 2HS6A 1JZ8A 2WNQA 4UTTC 1CGYA 1Y0EA 2EQDA 2P53A 2FFIA 2CLFA 5C2GA 3EB3A 3BOXA 3WQWA 1OCJA 4FIQA 1BVZA 2Y5JA 3B40A 3F5KA 4MFDA 1R3VA 4XQ6A 3PWAA 2C1IA 4YMZA 3TYUA 1D3GA 4QSHA 4V15A 1J2WA 4Z1CA 3GC4A 5JQ9A 3AMLA 1AMYA 1UKQA 3PZ9A 3EDEA 5CGTA 3N6JA 1BF2A 5EMJA 1J0YA 3CYJA 1A5NC 5KEZA 2PTYA 2CWNA 2XINA 1XIEA 3MJMA 1DQXA 2XHYA 2Y88A 1WKDA 4MWAE 1G94A 5BRQA 5MHBA 1VFSA 4WD0A 1H62A 1JCYA 1Y65A 2I16A 5DBUA 4PMJA 3G6MA 2PDIA 1DWFM 2Y85A 3FVDA 1Q6RA 4OT7A 4U5IA 5D32A 3AXHA 3RHGA 3AXKA 3W6YA 1JCMP 2PDHA 4AWTA 3OGRA 3C86A 4CLMA 4RZ6A 3O15A 3QN3A 2E6DA 1A0DA 2W66A 3NPVA 4D72A 4OV9A 4PEEA 2G5WA 3WCZA 4UQEA 1H1YA 3ARRA 3TZFA 4O19A 4S3BA 3FJ4A 3KP1A 4IQEA 1EP1A 3LM7A 4CQ8A 4GI6A 5A8PA 3EA1A 4RW5A 4NT0A 3P84A 1RBAA 3GLCA 3W7MA 4CCCA 4I7VA 5I00A 4HK7A 3IRSA 1XLLA 2ADAA 3LA4A 3CV2A 2FJUB 3W7NA 1F05A 2WQDA 1A0CA 3TCEA 4UTJA 3F2DA 3KVJA 3NL5A 1FXQA 4CEXC 3WBXA 4OE7A 2C0AA 3ABQA 4DJFA 4C6EA 2VURA 3TQ0A 2I9UA 1HW6A 4LVBA 2OYMA 8XIAA 4UFIA 5E0CA 4DWSA 3I3BA 4J9JA 1H7RA 4QAWA 4UCGA 4NRSA 2VL4A 4JTUA 1PL9A 1Z3NA 1JZ2A 3LTPA 1QNRA 1VD6A 1PV8A 1UWSA 4J3SA 4U5KA 2Y2WA 4WY0F 3AU6A 4O11A 3VCCA 3ITTA 2OLAA 4PBGA 4LU0A 2VX7A 4F4RA 4NU7A 1DWHM 4O16A 4HPGA 1XGEA 2YDSA 1EOKA 2W0UA 2ZX8A 4DNMA 3M6YA 5F7UA 5FF3A 1IGSA 1OYCA 3SB0A 3W6LA 4OFCA 3Q4DA 1G9HA 1PWLA 4OKDA 3II1A 1YX1A 3ANYA 4LV9A 3VXGA 2CLLA 2X09A 1G4EA 4N6FA 4UNIA 3MSRA 1VC4A 1L8PA 4NZ1A 3ARZA 1JYWA 4HNUA 4ZVJA 2WJEA 2WAGA 4AHOA 1BWLA 2ZRWA 3AWOA 3CO8A 5C54A 3R13A 4AIUA 4KS0A 1RVGA 3B8DA 1FHVA 2FKPA 4P8VA 1Z44A 1JUEA 1Q13A 2QCLA 4F8XA 4ZQMA 4AFYA 3CZEA 4GUFA 1NWUA 4QRNA 1IQ8A 4MVAA 4UTTA 4JTAA 3VE9A 4O50A 1OX6A 4MDOA 4FLSA 1ODUA 3TFCA 4HNVA 1P1MA 3LK6A 1QWKA 1XIDA 1JXJA 4I3GA 2TPSA 1ZRQA 4KBXA 3EXRA 5HXMA 1BRLA 3B06A 2QLYA 4BJHA 1NF0A 3WSUA 2OKOA 1KFCA 3R11A 2XH0A 3SQLA 2Y61A 1Y5VA 1BQCA 3U4AA 3WG6A 5BRBA 1F6KA 4ORMA 1QNPA 1ZUAX 3S2CA 3VABA 3IRDA 2ZUSA 3TLLA 3HPSA 1LTDA 1R86A 3T09A 4N7QA 4HNOA 2ICSA 3CAVA 1CBGA 4OUIA 4GO9A 2Z00A 1JVNA 2J7CA 3NSMA 3LCHA 3ORWA 2WMFA 1KFEA 2DZTA 5K7JA 4EAYA 4E0CA 1W5OA 4LYQA 1SFTA 3QOMA 3WFZA 1QI3A 1GOWA 3SY1A 5C8BB 1BYDA 4DAIA 3I7RA 3SRDA 4Y96A 1EPXA 3BAWA 1AUSL 1I75A 1L2QA 1D7KA 1L8NA 3AJ7A 2Y1HA 2ZC8A 3H2MA 3HPAA 2WNWA 4UQBA 4C6NA 3FN9A 1GEHA 2H8ZA 1UP2A 1EZWA 3E0IA 5D2TA 4O14A 2G96A 3EYPA 3HA1A 4WUIA 5H8MA 5CGQA 1WXZA 1EYWA 4OHQA 4J35A 1GTEA 1HKJA 2PTDA 3OYZA 1VCGA 2D0FA 3PFRA 2DVXA 4CNNA 4BQ4A 5C5YA 1W9BM 4NIRA 1M7JA 4MKSA 4JY9A 4A2RA 3M0VA 1GVSA 3E0FA 4IICA 3UQNA 1TTJA 1P5BA 1KXHA 4U3CA 3VC6A 3FOKA 3K4AA 4NZ4A 3OVGA 4PE8A 2WNNA 2E4TA 5FJUA 2R1NA 3EAUA 2P3EA 4UFMA 2E5CA 4HCHA 1RY8A 3GTIA 4WXYA 2VUNA 4GOAA 1WZMA 2CHOA 2YBTA 1NOUA 1V6XA 2OX1A 3C8NA 3KRUA 4P7OA 1F8IA 2R6OA 2OVLA 2D0GA 3CZKA 3MUCA 4DYJA 2I57A 1P4CA 1ZGDA 3QZ6A 4DRSA 3NPXA 4HIBA 4AWUA 2Q6ZA 1W32A 3B0VC 4DXXA 3GO2A 1XYFA 4S38A 5M5DA 3AXIA 1TPUA 3W87A 1GW1A 4GQGA 1OADA 2R82A 3LHTA 5A2AA 5ABGA 4JKKA 3THDA 2WVUA 3CUHA 2DORA 4EK7A 4LNCA 1W9DM 5KZMA 1XH0A 4S3AA 1VEMA 3BLOA 1K7FA 5I3FA 3GDTA 4IFOA 4CU7A 4YPJA 4LY8A 4MZ8A 3SCOA 2PAJA 5DQPA 1LT7A 4N6EA 3S2JA 3W7RA 3TMLA 3P7YA 2CCRA 4REQB 3OOQA 3GH7A 4JEQA 3NM1A 3TTEA 4LUTB 3LRLA 1QK2A 2VELA 3AIBA 3TYDA 3MKCA 2NV1A 2XN0A 1FP9A 1EP2A 1ITQA 3L2LA 2FGBA 4Q4RA 1R2SA 2WBKA 1PEZA 3ARPA 1V8EA 3DCPA 4B4HA 3L67A 3GG7A 3WUFA 1ME9A 3OP2A 3GXFA 1QNVA 3GU2A 1IEIA 1QNOA 3UXKA 3W1AA 3NZRA 1ONRA 3E5PA 1QO5A 3EDDA 4HTBA 2PDNA 3NO1A 3S6DA 2BY0A 1JCLA 4IP7A 3EKZA 2VOTA 4A3RA 3A21A 2CETA 3VOIA 3R8GA 1SMAA 3QY7A 2BX7A 3LNMA 3MHGA 1DQUA 3WLHA 3NL3A 1T96A 5BOEA 3N4AA 1N2VA 4AMAA 4CNSA 1XYAA 1XIIA 2HPIA 3B8TA 2OWWA 1O1ZA 3ITLA 5FESA 3IJIA 4W93A 2G4JA 7A3HA 3V75A 1C92A 1E9YB 1H49A 3SRHA 5BMXA 3ARUA 3B8WA 4FX7A 1VIWA 1TMHA 1VR6A 3RAOA 5DO8A 1R9YA 4H00A 3SSZA 1KXVA 3AHZA 1W3NA 2PWFA 3TH6A 4ROPA 1DJQA 4WSJA 1AL8A 3ZWTA 1NH6A 4ACZB 4LUJA 2ZIDA 4XKYB 3VD5A 3WNKA 2NX1A 2VOMA 1H5VA 3AHTA 4JTFA 1M68A 3OZPA 1RQBA 2XJ7A 4GNJA 3GB6A 1WOBA 3V1PA 3C3NA 4IF2A 1E3ZA 5TD4A 4GUGA 4NJIA 1XLKA 4NRRA 2XTKA 4ADSA 3DYPA 2GSEA 1JI2A 3QHMA 5AHFA 4ZQCA 4G7EB 2B7QA 3XINA 2QF8A 3Q2DA 2CWXA 3STFA 1W91A 1J18A 5FAGA 2WPBA 2QNEA 3QV6A 4FNPA 3G1VA 3A4WA 3KDNA 1S2TA 2W91A 2A3LA 5FKYA 2VRQA 3OVPA 4ORIA 4HYRA 5CAKA 3OHMB 1E15A 1UZ1A 4Q7IA 1JF5A 2CXEA 3BLKA 3TXVA 4HT3A 4L1WA 2CITA 1FWEC 2X42A 3B0PA 1XFCA 1W2VA 1IHIA 2XIJA 4B5TA 3KBJA 2QCCA 4GXMA 3TC6A 1JL8A 2WWDA 3AMGA 1E5NA 3TWBA 1RZMA 4B5XA 4Z2IA 5XIMA 2VEFA 3OBKA 2WCAA 1GVOA 2J8FA 4LFYA 3C61A 1A5UA 4XZIA 2QR6A 2WNZA 4XAGA 1SO6A 4LF2A 1EJRC 3UG8A 3S9YA 4GNVA 4HA3A 2BHYA 3NPUA 1FWGC 5EGRA 3VVGA 3GY1A 3JR2A 4UQCA 2WM1A 4H3DA 2O0TA 1NDYA 1E4LA 4F0SA 4FNUA 3RRXA 1E71M 4H8UA 2EAWA 2PDWA 5A6JA 4FOJA 4AYSA 2WB5A 3GXTA 3M47A 4RDZA 5D8WA 4O53A 2EPOA 4REQA 4R5EA 3THUA 4WGHA 4S39A 3THQA 4D2JA 4LUTA 4PB3A 2JGYA 4EXAA 2OLSA 3WDIA 4OVXA 5XIAA 3LBCA 3ARQA 2NSOA 4P8UA 1TV3A 1V51A 4XIMA 2H8XA 1XBVA 2XDFA 1U5JA 1OQFA 5DF0A 3TQPA 3DFNA 2OEKA 3PZTA 3R89A 2F8QA 2F2HA 3NQDA 3HZ3A 3UA4A 3W73A 4FB7A 4EXQA 2PP1A 1P48A 4NVTA 2EPMX 3HGRA 3C52A 4LPCA 4LRSA 2HISA 3AROA 3UPMA 1R0MA 4AVFA 4LYRA 2FHFA 5C0QA 1UD4A 2PMQA 5DRIA 3PTMA 2PU0A 4XZHA 1R87A 3P80A 2HXUA 3TW9A 1F61A 1TPVA 3P60A 1O94A 3T4CA 2FZNA 3GH5A 4KFPA 1US3A 4Q3MA 3AISA 3CH0A 2GUYA 1W9XA 5CZJA 2VM8A 1W5PA 1U5VA 3SQMA 1HKIA 1VCFA 1UD6A 4HMEA 1A5BA 1QDSA 3N9KA 1H7NA 1H50A 3K2GA 1P1XA 1NFBA 4O17A 4DBDA 3TKFA 1FY6A 1UZ4A 3VZXA 1N8IA 3CMJA 1O12A 2VEMA 3CZ8A 1TV4A 1TRDA 1UASA 4JTKA 4H9MA 3PZGA 3WEZA 1TCDA 2FPVA 3T42A 4XAZA 3CHEA 2EEXA 3D46A 5ABHA 5CC7A 3N04A 3M41A 4UTMA 3PTKA 4ACZA 4XKYA 4GH1A 3VM5A 4GD0A 4OZOA 3PZQA 3VUPA 4LBUA 2Z2AA 3PAOA 4IUOA 3VOJA 3HO8A 4WKHA 1E55A 3WLMA 3SUSA 1AQMA 3BO9A 4IMDA 3A9IA 1L6SA 3BW2A 2L5HA 4JPGA 4E38A 4Z1YA 1P0BA 3NXFA 4FPSA 1N55A 1CT5A 3BDKA 2VVSA 1YNPA 2Z4GA 3QM3A 4G7EA 3OZOA 3S5NA 1VKFA 5EFFA 3HM7A 4BZYA 4ZSUA 1SZGA 3WIJA 4MY1A 5E6ZA 1FHUA 5DN1A 2XUCA 4XKMA 4M7TA 2DT1A 3NQ2A 1VFFA 3FIGA 3RM9A 5HNNA 1DWGM 4YWSA 4L4LA 2Z2UA 2D2JA 2V5JA 2ZFAA 2I5QA 1UD5A 3LV6A 1TKKA 4DO5A 4ZB2A 4HHHA 3ONCA 2F9RA 4NUWA 2J6XA 1UROA 3PBWA 4S3DA 3DN5A 4HMNA 5A6SA 3VNKA 3G0XA 2ZXAA 1MXSA 3DXIA 4AZGA 1NVMA 4RPQA 3AYRA 4DUWA 1W1A1 3RIKA 2F7FA 1NWRA 1OBAA 1OT2A 2HXTA 2YJQA 5DXXA 1LLOA 2VENA 1TUFA 1F6PA 4R33A 5G1YA 3CJPA 4WOQA 3S2NA 4S2BA 4HMCA 1OFOA 3QY6A 2QMKA 3W28A 4DJEC 2X0YA 2YZ5A 2PLMA 1K70A 1P43A 3FJLA 3M5XA 3BCJA 3J7HA 1EC8A 5G4HC 3N2TA 3OJGA 4DJED 1CXIA 4PUEA 3U5YA 3W2JA 3PAJA 1E0UA 2BWGA 4LSBA 3CPUA 3QKEA 1W1PA 1RCQA 5FCZA 4ENLA 5LHEA 3GTHA 1OWQA 1PSCA 1UA3A 1ZQ5A 2VEGA 3CK5A 4GC4A 1WBJA 3A3WA 3LV5A 3GKFA 4G56A 3G8RA 3THAA 5HMSA 1FWWA 1T8QA 1E4MM 3SM0A 5FJOA 4EOUA 5HNUA 3IANA 1JRCA 3DKLA 4MB1A 2PDYA 1IEWA 4TX6A 3T78A 2X41A 4JNMA 4MB4A 4CQCA 1R9ZA 2YLLA 4NYUA 4H04A 3W37A 3PR2A 3ES8A 3WQCA 3G1DA 2WBGA 1POJA 2PDPA 3WKZA 2CZEA 1S2WA 1KCLA 1CXEA 3P5YA 2AMXA 5AHIA 4MB3A 3N13A 1QXLA 2VT0A 1A4MA 4L4PA 3EEGA 4HZ8A 3NQVA 2YB1A 2GVLA 1JNEA 3W2UA 3UU0A 1U1JA 2FYMA 1BVNP 1KFJA 3KL5A 4AY1A 3M0JA 3O07A 4ZGYA 4IZGA 2VFHA 3W27A 1LP6A 4UQAA 4DBEA 5HMEA 1MNSA 5FEPA 2XIIA 4RX0A 5CZSA 4QNWA 4AEOA 3URBA 4JNYA 2VFFA 3S0CA 3HJZA 1YTDA 5BRPA 3MANA 1GONA 1YYAA 2V82A 5L9FA 3LRMA 2PGEA 4DLMA 3C2RA 4QX4A 4O8AA 2V0TA 3M6DA 3G1SA 2PBOA 4B5NA 3RPTA 2RDXA 2OYKA 2QCDB 4LAOA 3RCNA 3ANVA 1BYAA 1XLGA 3SO7A 1S46A 2POTA 4IGNA 1UZHA 2CBVA 5HJYA 2ZVRA 4PMVA 2A4AA 2DUXA 1SZNA 1GVQA 3EZ4A 3QZEA 3OVQA 3KVKA 2WV8A 1CXHA 4YLWA 3C0LA 1XWYA 3KRBA 3SBFA 4LVFA 4C6MA 5DRCA 4P7QA 3R58A 1BAGA 3CQHA 4M56A 5XINA 1XG4A 2CLMA 3LENA 4OECA 1HTIA 2VWSA 4DJEA 2ATSA 1VFHA 3S47A 1A5SA 1KB3A 1UHVA 1XH1A 2VI0A 4PZVA 3GKAA 1KRCC 2R94A 3LCIA 5FL0A 3NVTA 1KBBA 2EPHA 1YKWA 5AC4A 4QSFA 2PD9A 3OQEA 4Q4MA 4RE3A 2QXWA 1B57A 4XX6A 3IGSA 2A3BA 3RF9A 3W1UA 4RNIA 1XW8A 3DHDA 3AI0A 1UR0A 2UY3A 3B9AA 1OCBA 2FPYA 2X30A 1VF8A 2XM2A 2GK1A 4M3PA 1CI1A 4ADUA 2CZVA 3ANUA 4GBDA 5BXPA 3CTLA 4FK9A 2G8ZA 2ZXDA 4F0LA 2XVLA 4FNRA 3OA5A 2FZDA 4GYJA 5GPRA 1HJWA 3GH4A 4CVWA 1V6TA 4QJ1A 4GX9A 1JJKA 4WHBA 1P0NA 2WQPA 2VO5A 1BG4A 2QMJA 4RLIA 3C0QA 5U4NA 3VO0A 2XFYA 1I8JA 4LAUA 3W01A 4AC1X 1CZ1A 2E0PA 2Z7KA 3PNZA 1THFD 5AY7A 3DFYA 2HE5A 1PKLA 2ZRZA 3ZR5A 1Q66A 4H6QA 4IPLA 1VFLA 4HJWA 5D9NA 3UWWA 5LIKX 1AW2A 3S2MA 1VRXA 2PTXA 3AYVA 1KQZA 3NQ8A 3N17A 2XPKA 3ZR6A 4RDYA 1BWKA 3RXZA 1J9YA 1BGGA 3PUDA 4QDWA 1PVNA 2XIBA 1WX0A 1ZBCA 1HP5A 1VBGA 3BVJA 2VKZG 4ZA0A 1K02A 3ZZ1A 3TYCA 2CXGA 1PCKA 2V2HA 3DESA 1AJ0A 3HMJG 2D24A 1ZP3A 2KAUC 2UZ9A 3P61A 4WF7A 2BFGA 1W9UA 1Z48A 4S3KA 3VK5A 3SUUA 4MNLA 3A47A 1IZCA 1RBLA 3WMCA 3LI0A 4UTIA 4GI4A 1H51A 2D1ZA 3PBUA 4HOZA 3H26A 3ABXA 2Z1SA 1UW9A 5CPTA 5AOUA 5HUOA 5C6MA 2G3JA 3UG4A 4ICNA 1LBFA 3L0NA 1WXYA 5BCAA 1R3YA 1XYBA 2Q01A 1S5NA 3CHFA 4OU1A 3WQEA 4WK9A 1MEWA 5CH9A 2C71A 4YYCA 5LNRA 2JF6A 3W53A 6TAAA 3NQAA 3B3DA 4DELA 1R85A 3U7VA 5A6MA 3A4XA 5F2GA 1BSLA 3E0LA 3O7UA 1W9PA 1ZJAA 3BSMA 3IWPA 5D9MA 2OO0A 2GZXA 2Y4SA 3LLFA 3W0KA 4RW3A 3DFOA 4JL2A 4QDMA 2HDJA 4A22A 3GE7A 4HGXA 3FSTA 1OFRA 3URNA 3WFAA 4OBRA 1MUWA 4S2CA 1GORA 5C9UA 2QCDA 1J93A 4B3LA 3BAXA 3T8LA 5IXEA 1M03A 2ZWYA 2C79A 3QPZA 1F73A 3QPEA 3C2VA 3QLLA 3C5QA 4AB4A 2HRWA 4JYDA 6ALDA 1UOKA 1DJXA 1IXQA 3H2OA 2UWFA 3M0IA 4K6AA 4RK8A 2Y0FA 2HQAA 1YQ2A 1KM2A 3QQ1A 4N4PA 4HNNA 3O1NA 3RM4A 1I2QA 4XZNX 3WLIA 3FYOA 3JVAA 2DZUA 3I7QA 4IJBA 3SCSA 5C9ZA 2WKGA 4EWJA 4RR4A 4BHYA 1OC5A 1MRQA 2YPIA 2XH2A 4GLEA 1A5CA 3VE7A 4LBSA 3DENA 3LSBA 2J77A 3L4TA 3BZJA 3KLLA 5E5CA 2Y62A 2W79A 3A24A 1PBGA 3AIUA 4LALA 4X3ZA 2OT0A 4F2UA 3EPNA 5AKQA 4Z2KA 4C7GA 4A8IA 1OFDA 3B04A 2OODA 3UT0A 4AX6A 2WSPA 4C6JA 3ABRA 4PCSA 2E6AA 3ALGA 4PUWA 1L0PA 2HZGA 3E0WA 4O15A 3M7WA 1GG0A 1JZ6A 3N4FA 1TR1A 2VZVA 1TB3A 1GQJA 2GGGA 4D1IA 1XIFA 3AYSA 2A6LA 3GR7A 3B4UA 1K7EA 2EKCA 4PUJA 3L68A 4WCJA 5AC7A 1G4SA 3UZJA 5B7ZA 3SIZA 4ATDA 2QUTA 2ZADA 3UY8A 9XIAA 4FNQA 4ZB5A 1YTEA 4O10A 2WHLA 3O9NA 4IL0A 3AO0A 2WSYA 1QHPA 5AC5A 3MO7A 2CFFA 3HU7A 3IAPA 3H7UA 5HBFA 2DSVA 4PR4A 1UH4A 2WMIA 2OX4A 4L5ZA 2WVTA 4LOCA 2E25A 4LQ1A 1P7TB 2QCFA 4DEFA 4JKMA 3UESA 3LLDA 4ZR8A 4KWOA 1OY0A 2GVGA 2EXOA 3DC8A 3H12A 4QG6A 2ZUWA 3OO2A 5K2ZA 4ZO8A 1VYRA 5LKYA 4DUVA 2OZ3A 4FLRA 4XVEA 4ZFMA 1KKOA 4L9YA 1NFGA 3I7SA 4QITA 1UR2A 4J7RA 2W9MA 4XISA 4CNOA 3PPGA 1V3KA 2IPFA 4NZFA 4IXHA 1VYPX 3TA9A 5BOOA 1XR2A 2ZE3A 2HNEA 2BTMA 5BZAA 5IRPA 3N4EA 1OB0A 1ITUA 3CQIA 4Q8NA 4ZO6A 2G0WA 2BXZA 4IHCA 1DJZA 4ZOCA 3E2SA 1TWZA 3QZAA 1TQXA 2WZTA 3PSWA 1Q63A 1U30A 4O13A 2YDAA 3MI2A 3VA8A 5A8GA 4AVOA 3TJ4A 1B3VA 4NI8A 1JULA 4CU6A 5LGZA 3AC0A 2ATMA 3OVRA 2YKKA 8RUCA 3UA3A 1US0A 3LXCA 1Y7VA 4AIEA 4IPIA 1B1YA 4FXRA 1XUUA 3MSYA 4GABA 4GKTA 4L1GA 5LA0A 5T9CE 2YLAA 1H7OA 3QR1A 3GNPA 1H5YA 1OGGA 1WP6A 7ODCA 4WY0B 4L1XA 4QXIA 5FACA 3ARXA 1FFRA 1KNWA 4PBFA 1R8LA 4GCAA 4D8LA 1DE5A 3V0UA 1XGDA 1NQ6A 3FA3A 3VMOA 3Q37A 1UIOA 1JCJA 1HQTA 3RO6A 1UG6A 3O8AA 3PUEA 4C91A 2IKJA 3ME3A 2FZ8A 3MKVA 4A35A 4AD1A 3KFTA 3LHZA 2HK0A 3Q65A 4HSOA 3T8QA 3W38A 1P0EA 1W1IE 4G1NA 4K1GA 1HJUA 1YPIA 5AHNA 3NZPA 4HPXA 4LAKA 5D04C 1JF6A 1FCBA 4H9TA 3EX2A 1PZ1A 3BJFA 4C1NB 1PJ9A 4Q8UA 4HYWA 1OFPA 3OPSA 2DT3A 2P1FA 1E3XA 1HL8A 1O60A 1B3WA 3O2LA 3W1RA 3CM4A 3D3AA 4WX2A 4JHZA 1FH7A 2RKXA 2ZC1A 1X97A 1BVWA 4H6EA 1DYSA 1UA7A 3SDOA 3TSDA 1IE7C 3LCWA 1N8FA 4YIWA 1PYMA 4UB9A 4ROQA 4C6DA 3MP3A 5JBFA 1OHLA 4U2ZA 4UUIA 4Q7NA 2YCIX 3I3DA 3CBWA 5ECUA 1OG6A 2ODOA 2YSWA 4O1CA 1XLHA 4BF7A 3W7CA 1W54A 5DMNA 1JDDA 3VIOA 4F79A 4U10A 1OSEA 4MG4A 4JS3A 2Z0IA 3SCUA 1DBTA 3F4VA 2WW5A 4W4QA 4XIAA 4R7JA 2ASHA 3TSBA 3TA6A 1TVLA 4LT9A 1UR1A 2VZOA 4GE8A 3DFQA 3LCGA 3SGUA 4WZHA 3VI2A 3ICJA 1P7TA 5HQEA 1VFTA 4V28A 2JQXA 3CUXA 1GZJA 1E6XM 1PHQA 2BXVA 3APGA 1LYXA 1NAL1 1K3UA 2GQ9A 4KCVA 3STGA 3FFSA 4DBUA 3I6EA 4F48A 1A49A 2J74A 5HK4A 4US6A 3KOZA 2FDSA 1E4NA 1UQYA 3E3HA 5FJRA 2WC4A 2DT0A 3RU8X 3P3BA 5H8UA 3L4XA 2OT1A 1WKYA 3QYQA 2GVJA 2WMKA 3LMYA 1QI0A 2FH8A 1M7PA 1ZJIA 3N14A 3H4XA 2POZA 5PTDA 3MBFA 4W5UA 2W5FA 3A4JA 4AWEA 3FS2A 3SJ3A 2JIWA 4O57A 3WMBA 1KGXA 4EPKA 3A6OA 2VD9A 3TQKA 3WLOA 1C3FA 4C7DA 4HN4A 4C60A 4DXVA 4NXSA 1GZGA 3G18A 3HPFA 4JYEA 4RZBA 1WA3A 5I3KA 3GM8A 3PANA 3MT1A 3SY5A 1E5JA 3W1XA 2OQYA 1VEPA 3IJ6A 4JCMA 1X6LA 1TFVA 2WZIA 1Q6QA 4Q6XA 1E56A 2UV8G 4MAZA 3UWVA 2HVOA 4MF4A 3R2GA 3WDRA 3NUKA 1OF6A 3PVFA 1EP3A 2P0IA 2Q71A 4B90A 3JZEA 1F8MA 2J7FA 1C8QA 1UD8A 4PMUA 2VWTA 3WO8A 5MKGB 3H2NA 1TZ7A 1HKVA 1EQPA 5CQ1A 2DSKA 5KTLA 1ZTVA 1DJIA 2OZ8A 2QPSA 3S1XA 3OBEA 2VFGA 4ZEPA 3G0SA 1B4KA 2FIQA 1WKFA 2Y7GA 1J0HA 4GK8A 3QMSA 4W88A 2E77A 1TREA 4HU3A 4H83A 5C2XA 1JRBA 1AODA 3QPYA 3F5LA 3T7VA 4AC7C 1BLIA 1OABA 4NAFB 1GCYA 1ZAJA 2Z24A 5DCEA 2XZ9A 4TTGA 2PRHA 2NQLA 2PDXA 3FHQA 2Q02A 4NJHA 3QSTA 4GZEA 4XZWA 1K03A 1EHAA 2BOEX 1Q4NX 1RP9A 3VNMA 5I23A 3U6WA 3ARYA 2FZ9A 3V18A 1BSIA 2XIOA 1ZZMA 5LIWX 2Z25A 4P7RA 4GUJA 4ATWA 2A6NA 3Q45A 1AJZA 3S6TA 2I9EA 5EMLA 4JQAA 1QPNA 4EWND 3KZSA 1T7LA 1WZLA 2YYTA 1XYCA 3SAZA 4ZBCA 4Y8FA 3LM3A 4C1NA 4POCA 1KQYA 4H7CA 3U2ZA 2GGHA 4YVPA 2Y6ZA 3MYOA 3QC3A 3NR0A 3ARWA 2J62A 3T81A 3CPGA 5ABEA 4QE1A 3LQLA 2DH3A 2B81A 4FR1A 3W7IA 2YA0A 3VU2A 1TRIA 5A5WA 1VHNA 3S42A 1J4EA 4P2VA 3VD9A 2NX3A 3MA8A 2INZA 4QEEA 4F0RA 3W4RA 5A8QA 2OCZA 1BYBA 2ACSA 1GQNA 4AAJA 1Q7ZA 4FA3A 3TNOA 3PY2A 4B5VA 4FLQA 2YBVA 3IJ9A 4DX3A 2CU0A 5CC5A 3BE7A 4X22A 4NASA 1EUAA 3T9PA 3CASA 3A13A 4KEUA 4HN8A 4YN5A 2WANA