4AFYA

Crystal structure of the fimx eal domain in complex with reaction product pgpg
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
249
structure length
249
Chain Sequence
MQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of an Eal Domain in Complex with Reaction Product 5'-Pgpg
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
molecule keywords FIMX
total genus 81
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4afyA00
5MKGA 2R6OA 4Q6JA 4AFYA 3PFMA 4LJ3A 4Y9MA 3PJWA 3GG1A 4HJFA 3PJUA 3HV9A 4Y9NA 4FOKA 4RNJA 3U2EA 4FOJA 4HU4A 5M1TA 4RNHA 3N3TA 3GFYA 4RNIA 2W27A 3SY8A 5MF5A 4KIEA 3GFXA 3PJTA 4Y9OA 4AG0A 3GG0A 3HV8A 4RNFA 4HU3A 4F3HA 3TLQA 2BASA 5MKGB 4LYKA 4Y8EA 3KZPA 3S83A 4ES4A 4F48A 3GFZA 3PJXA 4FOUA 4Y9PA 4J40A
chains in the Genus database with same CATH superfamily
1OFEA 2FPTA 3AUJA 4G7EB 2ESCA 3IJQA 2YZ5A 4FZIA 3O6AA 4KIEA 3MSDA 3WL0A 4NHVA 4ICMA 1PV8A 3C2FA 1J11A 5BROA 2HBVA 3CLWA 3FYYA 3N9KA 3OIHA 4H7ZA 3MB9A 4V15A 4JL1A 4UTTC 3LLDA 5AHMA 1EGZA 1H50A 2ON3A 4TIMA 1OK6A 3AWOA 1LL6A 1L8NA 1M65A 4B2DA 2EG8A 4IGSA 3VKBA 1Z7AA 3Q94A 5D8ZA 4DJFD 4Q22A 2YYTA 4RNFA 5IDZA 1KC7A 1KKOA 2WSPA 2D2OA 2HK1A 3G1YA 4ERAA 4BF9A 2HBXA 2XGBA 1C29A 4OFCA 1S2TA 1KBKA 2G0WA 3W2KA 1XV8A 4V1YA 4LQ1A 5T26A 1UBPC 1I9CB 4NASA 1C92A 5AC6A 1W37A 4FIRA 4DRSA 5LXXA 1GVOA 4CNOA 1E55A 5FESA 3VI2A 2XVNA 4IUOA 2P5NA 3K8KA 3PPFA 2Z6IA 2CYGA 3WJZA 4CLMA 3ABZA 3POHA 2NUWA 4IP5A 1ECEA 2HPMA 2RHGA 4CKQA 1WX0A 3FVMA 4AIOA 2V3GA 3QHMA 3W1MA 3F4CA 1R7OA 2G5WA 4KPLA 1A5OC 1UWUA 4TXEA 1CLVA 4QE5A 1EYWA 2ZX6A 3JW7A 5H91A 1IWBA 1ODZA 3ALFA 2FDMA 2WCAA 1MDLA 3ARPA 1BKSA 2XM1A 2XVKA 1EIXA 4PGLA 3AZTA 3NTYA 4YHEA 2YLLA 2O9TA 4Q4PA 2VENA 3PBMA 1JYWA 3EX6A 4ROQA 1E6RA 2AQOA 1XQKA 3KS6A 3LSCA 2OZ0A 1AODA 4PTVA 4L6HA 4ZE4A 3BH4A 1VBHA 2PWFA 3IJ7A 3BW3A 4OQVA 2WZTA 3G1VA 3FKRA 2XM2A 1H41A 3WD4A 1TJ0A 3ITXA 3ONBA 4B5TA 2XSXA 4MYXA 3RJXA 3UW6A 1WBHA 1Y5WA 5EU9A 3CM4A 2YCLA 1E3XA 2CHOA 4C65A 5C2CA 3VIGA 3H12A 3EKZA 2CBIA 1IYXA 1DTUA 3B8TA 2ZUSA 3GBDA 3DFOA 3H2EA 3RCYA 2EPNA 4G2DA 2NWSA 3K1DA 3OVRA 4OV9A 2WHKA 2BV9A 1W1VA 1WUEA 3MP4A 4IPLA 4Q4KA 5G1YA 3KEHA 5FIPA 1Y5XA 2GK1A 3DYMA 5LA2A 1DKWA 3GNPA 3CL6A 2BGNE 4LC8A 3VNDA 5G1TA 4PUWA 1IIHA 2R9RA 2WZEA 3CUFA 1CT5A 3G1FA 4ZQCA 1AMYA 4F0LA 1QPRA 4AEOA 3W25A 3GB6A 2ZZ4A 3UXLA 1SW0A 1W8SA 1Z6KA 4R3UA 3LGEA 2UY2A 4JZ5A 2ZBTA 4ICCX 1VCGA 4AX6A 4GH3A 3O7UA 4HA4A 3CS2A 3ERPA 1JCMP 4OTKA 3FX4A 4HSNA 4ATWA 1V0NA 4PUUA 1KFBA 3VOIA 5CAKA 1PZ3A 1HJVA 3ZR4A 3GVVA 3LCLA 4Q8MA 4UTLA 3TCSA 3W7MA 3BANA 3LA4A 2X8RA 1XW8A 2NT1A 1XLGA 1V02E 3W1RA 3O15A 3T40A 1LRNA 3QOKA 4U3AA 3KOXA 1VKFA 3A4WA 1LG1A 3IJDA 5BWAA 2E40A 1NSJA 2ABBA 2VGIA 2YA1A 4I3GA 4QEEA 2A3CA 3HMCA 2Q3OA 3NQFA 5D4YA 4LT9A 3ZVHA 1CB2A 3OG2A 3THDA 2Z26A 2J13A 2Y61A 4WDXA 1G9HA 4JTDA 4YN5A 1Q6EA 5FF3A 1GG0A 2INFA 3SDOA 4FX8A 4TR9A 5H8UA 3CPGA 1YQ2A 4Q8NA 3U0HA 1QR7A 2BY1A 3CH9A 1F3XA 3N6HA 4WGHA 3WLHA 3EZ4A 3C0QA 1XKYA 5I3HA 4M24A 2X7VA 3PR2A 1BGAA 4LF2A 4OV4A 3WLLA 4MM1A 1OC6A 1XCWA 1OB0A 2GL5A 5KZEA 3MUY1 1QJWA 3KVJA 1KQZA 5AZ0A 1UKPA 1YLVA 2ALDA 4AHOA 1TKKA 3G24A 8TIMA 2EPHA 1JAKA 2QUVA 2QUNA 2PUZA 1M6JA 3WNKA 1KFCA 2DVUA 1DE5A 5EKYA 4NZ5A 4IPIA 2E6FA 4RPPA 3MI6A 1NOWA 4OECA 1O60A 3UG4A 3M0VA 3IV3A 1D3GA 3OG3A 4ENLA 5JXQA 5I6SA 3NO3A 3SB0A 1OX4B 3EX1A 4CN1A 5K9CA 1YHTA 2AQVA 4QSHA 4WVXA 1IXPA 3LENA 1A5CA 4KWWA 1FH8A 1V02A 4DJDA 4HBKA 4ZOCA 4RXFA 1X7FA 1TV3A 2QR6A 1EHNA 2Z2AA 3BJTA 4WDWA 4GQRA 5JQ9A 4P2VA 4MAVA 1XRTA 1FTXA 3FIGA 4S2BA 4GVFA 4AD0A 2HRWA 1JF6A 1IF2A 3PB0A 1FWSA 4GK8A 2DPEA 4Y90A 2Z4GA 3NQ2A 1DJXA 2D2JA 5DN1A 3UFYA 3N3MA 1RCXB 5DBUA 4DF0A 5AB3A 1CXLA 4RE4A 1BFNA 2J74A 2L5HA 4FOUA 1SFSA 3H4WA 4MPKA 2DP3A 3OODA 4E38A 4LTSA 2XVPA 4AY7A 5FJOA 2PDLA 4TVUA 4W5ZA 3MDWA 4A2SA 4M6VA 3EPNA 3O6CA 1PWLA 4N0RA 1XIEA 1JD9A 4GY7A 4XUYA 3EOSA 4MUPA 2Q8LA 3NDYA 4KWVA 2XUCA 4M81A 1UWTA 2PTZA 5C5YA 3KS5A 2C71A 1F6PA 4CD7A 7ODCA 4DPPA 1TJ1A 4IF2A 1HXJA 3A9BA 3LLFA 4X60A 3EX4A 5A5WA 1RXOB 5D05A 4GHRA 1RJQA 1FFQA 2FIQA 3E2VA 4Z1YA 3FJ4A 3M0ZA 3QLDA 1XSIA 1YADA 5A6AA 1XCXA 2W92A 1YBQB 1E4MM 2VHLA 5C70A 3QH2A 1HKMA 3M9YA 3NPWA 3P61A 2OSXA 2C7FA 4JOMA 5TAOA 3QC3A 3ID7A 4OWGA 3TQKA 4OZOA 1CXKA 1PJ9A 4GX8A 1DWFM 5E6ZA 5A8GA 2Y2WA 2PAJA 5TD4A 4IGMA 3STFA 3S9ZA 2J75A 4X0VA 3LZ3A 5A6MA 3L9CA 2PE4A 4MWAE 4LCRA 4ROPA 1I4NA 1GW1A 5A1AA 3MU7A 3MBDA 4H9TA 3L4YA 3LK6A 4A4AA 4GKLA 2LLEA 4ZQNA 1Q8AA 3PBGA 2WMIA 5E70A 3RG6A 5T91A 3VCNA 3K8LA 1XRVA 1W56A 3WDHA 3BGAA 3RLVA 1HO1A 2X0YA 4LWWA 1EC8A 3I6TA 2GQAA 3BV7A 1KXHA 1G7UA 1EPXA 4S3EA 2WC3A 4E2VA 1C8YA 1GQLA 3CNYA 1ISYA 5E6YA 4ZVJA 2GJXA 3ITTA 3MC5A 3NZRA 5F4WA 3CAQA 4WJ8A 1KXTA 4QGCA 1A4MA 3I6RA 3R10A 4KEUA 1W32A 2ACQA 3ZLGA 1AQMA 2Z27A 3KFTA 3VDBA 1UROA 1CW2A 2OSYA 1YPIA 3ZT7A 3LGGA 5C9XA 5C9WA 4B5NA 4H8NA 3SY5A 5L6UA 1R8LA 2PDBA 1QPNA 1MO0A 4M7SA 3NO1A 5D09A 3EXTA 2J8GA 2BLEA 5FD0A 2EHHA 4E4PA 1TYGA 4W86A 3QFWA 3VMNA 3C61A 4M6QA 3HTWA 2PCQA 5EB8A 2ZE3A 2IQ0A 3WNOA 3VIFA 2PLJA 3NEHA 4NAFB 1P1XA 1K4HA 2WZMA 1BWVA 4HNCA 4AMAA 4NZJA 1T6MA 4Z1CA 3UBPC 3UPBA 1O4UA 1XI3A 4ZQMA 2J77A 1R30A 4YJ5A 3SECA 4V27A 3TQ0A 2NW0A 3H24A 2DQXA 3G77A 1KKRA 5DMNA 1UKTA 1G0CA 4E5TA 3PJTA 2XIOA 3VC6A 3D47A 2W9MA 4E6MA 4BQ5A 5F1VA 1EP1A 2V5JA 3R94A 2X16A 4D6FA 5FACA 4IJBA 5GVJA 1V5XA 2XH0A 5I23A 1CI1A 4RXGA 1H61A 4ZZ9A 2WMFA 2J7CA 4DB7A 2DSZA 2VOMA 3UJFA 4MDPA 3C8NA 4JHZA 3PPGA 5AHNA 3H7UA 2W27A 3GUGA 1V3IA 3ZWSA 2NWRA 1XLDA 2Y8VA 1MW1A 1NQKA 1T8QA 2PTDA 3E0LA 1I1XA 4OUIA 3W23A 4CN4A 1O6IA 2DZSA 1JVNA 3WLIA 1H5VA 1Q65A 5A8OA 3GXNA 1HVXA 5LHFA 1XLAA 4ZFMA 1VPYA 3VABA 2KX9A 2XFYA 4RV3A 1VP5A 3QTGA 3NWRA 1E56A 4B2DD 3W7EA 3CPRA 1XIDA 4DJFA 1J96A 1B3WA 1KM5A 4C6PA 1OM0A 1K03A 1RZMA 3TSBA 4NIRA 1TMLA 4O50A 1U30A 4UTTA 3CJPA 1UG6A 1E73M 5K7JA 3ZMRA 5HWMA 3VCCA 3BOXA 4HIBA 2QF8A 4YTTA 3E0VA 4Q6XA 4BI5A 5FEPA 1ZENA 3A21A 3OLIA 3HM7A 4DO4A 1ADSA 3MV01 4RDYA 4UQDA 3CUZA 3OZPA 2PDMA 3WJYA 1WBJA 1FOBA 2FZ8A 4LBRA 2UWFA 5A2AA 3IVUA 5JBDA 1RCOB 1XISA 4P7QA 1UR4A 3CTLA 5DCBA 4D6DA 4REQB 5M3WA 1Q2RA 2ZDSA 6XIAA 3V75A 1O12A 3JVAA 1PVNA 1NAL1 2FPYA 4R7OA 3HURA 4JKLA 4FB7A 3BJFA 1FCBA 3F2CA 5DO8A 6REQB 1DL3A 2HVOA 1Q4WA 3VGBA 4PUDA 3RR4A 5IHSA 4Q32A 1ITQA 5LGXA 4HKPA 3AIBA 4UWMA 1HT6A 1CX9A 3TR2A 2C16A 3PY2A 4XBJA 3HGSA 5FAGA 2A0NA 4OUEA 4GUHA 1TTPA 2E1WA 3M43A 3RCMA 3DHDA 3W81A 3SM0A 3E2RA 5HWJA 8CGTA 1YTKA 3SIMA 1BLIA 3HN3A 4CEXC 4FALA 2XISA 3VD3A 4WKFA 3VD9A 4CD6A 4UOZA 4I6VA 1XLLA 1EA0A 3TJLA 1BRLB 3TW6A 4WK9A 1M1BA 1VFSA 3THUA 4EF9A 1TWSA 3APTA 1J0ZA 2GVGA 4M6PA 1IXOA 4BQ4A 2JEPA 1K8YA 2PF0A 1GKPA 4J3SA 3M5XA 1XIGA 4NAEA 2Q8ZA 4LBSA 3ITOA 2ZZ3A 2OODA 1E6QM 3W7GA 3QOMA 2GPTA 1K9FA 2BHZA 1QK2A 4MJ4A 3VU2A 5M5DA 3AIVA 3W38A 2QYGA 4JXCA 2OKTA 3QZAA 4IPNB 3GHRA 5AY7A 3MVIA 1QW7A 2H6RA 1VC4A 1NOUA 1PTGA 1SJBA 4J3XA 3N6JA 3KCOA 5BU9A 4OIFA 3TTQA 3CHCA 4CQBA 3EWCA 1KGXA 3PBVA 1VYPX 1GGOA 2CESA 3FA3A 4TX6A 3LCWA 5D2WA 1W1IE 5G2WA 3HZ3A 5I3FA 5FJRA 1VIZA 1UUMA 5G4HC 1WKYA 4RUBA 2PCEA 2F6KA 3CQHA 4RPQA 4ZB0A 3IVSA 3M46A 3LUTA 1X96A 2B7NA 1TWZA 3FSUA 3ZT6A 2YDRA 4L4PA 3OOQA 1KRAC 1FP8A 1GORA 3S4TA 3CQJA 1EZ2A 3UJ2A 4FR6A 2IKGA 1RLDA 4B9ZA 2QJJA 3WQ8A 1OY0A 4JNYA 3SCTA 3W07A 5HJXA 2YL5A 3T2OA 5KINA 2UY4A 1E5NA 3BSMA 1R0MA 3T4WA 4CCCA 1U1UA 3L5LA 2OTDA 2WZHA 3REQB 1P1MA 4IHCA 3WUFA 4AXKA 3EMCA 2VX5A 3EKLA 3VX1A 3FYOA 3REQA 3CQIA 3GD6A 4HK7A 1SSGA 4CVWA 3M5YA 4HCLA 3N73A 1JCXA 5I78A 4GINA 4U31A 3PFMA 4BEQA 3DGBA 1KV8A 2VFHA 1E0UA 4QJ1A 4LEQA 4O1DA 1QUMA 4P8WA 3L2LA 4XVEA 1EJXC 2GSEA 3JR2A 3OLGA 2FLIA 3BAJA 1XYFA 1EYEA 3QHNA 2RFGA 1BD0A 2Z6JA 5T8GA 4BWLA 4IPPA 5REQA 4KCWA 1OD0A 2E6AA 2CBVA 3UYCA 2RH9A 4GIRA 3IACA 1UWAA 2J9XA 4O1FA 1ZLPA 2J9YA 5LIUX 2QCMA 2WLYA 3MTWA 3YPIA 2VZUA 3TCEA 5FL1A 3S2JA 2RJGA 1H51A 3M0XA 3ARWA 3M7SA 1EUAA 4UC5A 3W7DA 1P0BA 3VIMA 3T9PA 4B16A 3EOOA 4JY9A 1BXCA 4AG0A 4ERIA 3HOJA 1LROA 1ZCCA 4A8NA 1ECQA 3R13A 4GO8A 2XIBA 3UD6A 4EACA 3APYA 5H2ZA 4NYUA 5ABGA 3HG2A 4UTWC 5A6BD 4JX5A 3I68A 3CO4A 1R5YA 4X9YA 3G1HA 4K8GA 1WKFA 3SURA 1YXYA 1ME9A 2ZXAA 1Q7QA 4JGDA 3QGAC 4F0SA 4DBDA 3A12A 1PEZA 4EXAA 3DFQA 2YCJA 5CC7A 1DIEA 1JRCA 3QV6A 2Y1HA 2NV1A 1YNPA 2GSJA 1OFPA 1QASA 1F61A 4S38A 1UHVA 3G1RA 5GJNA 5TIMA 1W1A1 1RK6A 1W3JA 1A5BA 2X42A 3UY7A 2WKGA 5I77A 2YCLB 1AD4A 1LCOA 3UWYA 3CV6A 3MHUA 1M01A 5CBBA 2AGTA 4HU8A 6REQA 1W1ZA 4M0XA 3WFAA 1Y65A 3HPSA 4MWAD 1QMLA 4DO6A 2VEMA 4QQ3A 5CLWA 3HU7A 1ZTVA 1UR9A 5HR6A 1IT7A 1H2JA 4R9XA 3GH5A 3TX9A 4ADSA 4LRSA 1P7TB 4HU0A 3VDCA 3TJIA 3LV5A 1C9WA 1B3VA 1OFOA 4C1NA 2BVTA 3ABOA 4MKSA 3UG8A 3KLLA 3OBAA 1ZP4A 3LOTA 3DFHA 5A6SA 6XIMA 4A2RA 2QDEA 1GZJA 5EGRA 5C7HA 1S5NA 1J6PA 4HMDA 2AAMA 3ES7A 1E3ZA 5EMLA 2ICSA 1TV2A 2BZNA 1GQNA 1Z8AA 2JGYA 4IMDA 7TAAA 2VX6A 4OU1A 3TYBA 2PDXA 2YA0A 4DUVA 2ZWYA 4S3JA 1F3EA 3ITVA 3RLGA 3PM6A 3N2BA 4NJKA 2Q09A 1RY8A 3NGFA 5D02A 3VYLA 3F1QA 4XUGA 3W84A 3W7CA 4WY0F 3R4IA 4IMAA 4RJEA 2PWHA 1R2RA 3WN6A 4A8LA 2OQHA 1OC5A 3W1AA 1GHRA 4KFOA 3H8AA 5BRPA 5C8BB 3AXHA 2VEPA 2ZXBA 2DORA 2NX3A 3SY1A 2BB0A 5B7ZA 3BOLA 2BOEX 2E5BA 4O54A 4MZYA 5DY2A 1EL3A 2IMRA 2CWNA 4O4VA 1GVEA 3N25A 1XIIA 3VXGA 1S2CA 3N3TA 1EHAA 4V2XA 2E9BA 4IIHA 4PCPA 4DM1A 3IIXA 3GS6A 3IUIA 4PZVA 1L2UA 4Z42C 3E74A 3VNKA 3W73A 3I6EA 4IL2A 1TE6A 3M0YA 1EEXA 5TF0A 1S5WA 2BVYA 3TV8A 3VOJA 3MV11 4XO7A 1KFEA 1NQ6A 2PWGA 3N9SA 1JPKA 2E5DA 3NDOA 4PCNA 3T44A 1WCGA 1PIFA 3GHTA 4L80A 4LYKA 4QSFA 3O16A 3MPGA 5DRIA 1EB3A 1W3TA 3A24A 1V77A 4H41A 2ZDRA 1H4PA 4BHYA 5M1TA 3P93A 1X7IA 4C6LA 1ALDA 2PBGA 4IIDA 3B06A 2CLLA 3NZQA 1G6CA 1XCFA 3KXQA 3WK0A 1RD5A 2Y5SA 3OVQA 1UJPA 4XISA 2VUYA 3RMJA 3W1PA 4LC6A 3CZKA 1XYAA 2BHYA 2I5IA 3H2FA 3ITYA 3PSWA 2J47A 3AMDA 2FVLA 1LUCA 1DHKA 4ONVA 2V5CA 1J0JA 1OG6A 1I1WA 4N6EA 3ELFA 3CT7A 4HA3A 3N19B 2PD9A 2ONEA 2GGGA 3U2CA 1JQVA 1GJWA 1HJXA 3G8RA 3GG7A 1GYLA 3TIMA 4NX5A 2V3FA 4GQQA 4XSMA 1YPXA 4DJEC 1K8CA 4NUWA 1AL7A 3NZGA 3PTQA 4ZO7A 1VGAA 1ISVA 3P8IA 1ZBCA 4EKJA 3B9OA 3CMGA 4NNAA 3P2VA 3PJXA 4F8XA 1SFJA 4HD5A 4FP1A 4C6MA 4WF7A 4LUTA 3LRLA 3W01A 4M82A 2C8NA 3N12A 4CQCA 4MKVA 3F5LA 1UMYA 1PO9A 2YZRA 3WLRA 4K39A 4AHQA 3LNMA 5AHIA 3H4GA 1ZQ5A 1B3YA 1GJUA 2ZICA 3PZGA 3GR8A 1L6YA 4DBUA 1DIKA 1JD7A 2E77A 2E25A 3LS9A 3MA8A 4WEVX 5FJPA 1GOKA 1X6LA 2EPKX 2NT0A 1E6NA 1FDJA 1Q63A 2E0PA 1XUUA 4DBWA 1K70A 3F5KA 3VTRA 4D71A 4NRRA 1OFDA 3N4EA 3WJSA 4XD5A 3GR4A 3UETA 3H2OA 1EQCA 3SRFA 1UJQA 1MRQA 1VBGA 1YBQA 5DBTA 3UR5A 2PDCA 1H62A 5GJPA 1QOQA 3ARQA 1BWKA 1X6NA 1E4LA 3EWWA 2PDJA 4OJYA 4US5A 1O5KA 3ZWTA 1G01A 1MUWA 3CZGA 3D5HA 2KAUC 5TQLA 1MNSA 4ZXOA 3TXVA 4K8HA 1Q6FA 3TMLA 3IGXA 3KZSA 1NVMA 3QMRA 2QCFA 3S2LA 3S6TA 1SO3A 1P0KA 5K4XA 4WY0A 1JDDA 1VFUA 1FWHC 4Z2LA 2WO5A 4QS6A 2Z2UA 1XLKA 1EXBA 2GQ9A 4H19A 4UMBA 1KXQA 4F0MA 1Q3NA 1KD0A 3ARYA 4M1RA 2GGHA 2C13A 2R1NA 2R82A 5CPNA 3U48A 2WJEA 4F2TA 5L9FA 1BF2A 3BTNA 4LOCA 4IFKB 1RH9A 4FS9A 2ISDA 3MI3A 4FOKA 5I03A 2WM1A 2W6RA 4UFHA 4S3BA 3LI0A 1HG3A 4DUWA 4Q8WA 3D0CA 3R5EA 3LHVA 1ZPTA 2X7WA 4LJ3A 1MDRA 1JI1A 1TWWA 4YS1A 4XKYB 4BZYA 2OFJA 2EEXA 4Y8FA 3QV8A 2GWNA 4JTLA 2YA2A 4D9PA 2WXDM 3S6OA 1JCTA 2GFTA 4M29A 2RDUA 4DUOA 2CLKA 3F4VA 3T0TA 3I3EA 3S8HA 4ADTA 4PTNA 4J3ZA 5K2ZA 3VZXA 5FJUA 3TXZA 4GCXA 5JIWA 2CZEA 1TMHA 3TJ4A 4PC8A 2FTYA 1W3IA 1DV7A 1W1TA 3WD1A 2J25A 4GNVA 4R9OA 1HZYA 3JUGA 3LBOA 3PWAA 3PP7A 4HZ6A 4E0CA 3M0LA 2R91A 4GD0A 1MXDA 1VJZA 2O92A 1H0GA 2DFAA 2WMGA 1A50A 4Y6GA 3CWNA 4YCOA 3IGUA 1QCWA 3W1UA 1SJDA 3CYJA 3VO0A 4YLWA 4ACYA 4LCQA 1C91A 3G0UA 4UBPC 3WY1A 1UP2A 3PULA 4MNJA 4IP7A 2PSNA 5I7GA 3NSXA 4XD3A 2WHMA 3CTTA 2PZNA 1NP2A 3K2GA 3MHGA 4O1AA 4LCSA 2CW6A 3GVRA 4PMVA 1R3YA 4WUIA 1HJWA 3CUJA 8RUCA 4DPQA 1VCFA 1CIUA 1UZ1A 4L56A 1D8CA 3VE9A 4MGGA 3AXXA 3AFBA 3DESA 2PLKA 3TN3A 4AZ5A 3G1XA 3WUGA 2TRSA 3R11A 4PSRA 2DZXA 2QJGA 5CH9A 7REQB 4N4QA 1W5QA 5J5DA 3G22A 1OG0A 2VURA 2DUXA 1GWJA 3NVTA 2H3BA 2DIJA 1GVSA 2CLOA 2YLAA 3O06A 5HPOA 2ZRYA 1EH9A 1TUFA 5C6MA 1HJQA 1R7AA 4XV0A 1SW7A 3VNIA 4X63A 4HPHA 4F40A 4D8LA 4JFUA 5LIXX 4A05A 1J79A 1CGWA 4RK8A 4B4FA 2BY0A 4RX0A 3W86A 2D3NA 5IHRA 4PUEA 4CU6A 1JCNA 3ZR5A 3WBYA 4AMCA 3F03K 2VT0A 1XYMA 4WSJA 3MHFA 2VNCA 2V30A 1K4GA 1QTWA 1V3LA 3BGJA 4MF4A 1ICPA 2W0UA 5I3IA 2J62A 3LHTA 4B5SA 4NY2A 2E5CA 3AAMA 3D46A 1KGWA 3GNRA 3RPDA 1V7AA 2J4GA 4PBFA 1AH4A 1VJIA 2E9LA 4JQ4A 2H8ZA 1R9ZA 4JIQA 5M2FX 3KVMA 2MANA 4PUKA 4RR4A 3SGZA 3O6DA 4RNJA 5H8PA 3NG3A 4BF7A 1TPFA 1AUSL 1LZOA 1QPOA 3V16A 9RUBA 2CU0A 2VYOA 3FJ6A 4PTXA 1V0KA 2R6OA 5D8WA 4FHAA 1F73A 3I3DA 3VILA 4PMOA 4O52A 4XAPA 1I45A 1WV2A 3AC0A 4HHHA 4L1GA 3A4XA 1J0HA 1QXLA 4IIGA 2GSHA 1RJRA 1IT8A 3QN3A 4AF0B 3TC6A 2DSKA 2PU1A 3NR0A 3GDLA 4KGLA 1E1FA 1XYZA 3S1GA 3A4JA 2A7RA 5C9UA 3F2DA 5C9RA 3RLHA 5D33A 1EWEA 1NWUA 1GZGA 3WH9A 3R2GA 3LY0A 2DQWA 2WNQA 3UEQA 2DH3A 2VDHA 1CXFA 4EK7A 4M7TA 3VIIA 1SMAA 4XAZA 2YSWA 4R34A 1V6WA 1UB3A 3P84A 4AWUA 5BRBA 1EO5A 1EEPA 2DZAA 2OO6A 4KF1A 4LNCA 2P1FA 2FB3A 3DHUA 2YJQA 3PZIA 1VEOA 2DW7A 1OGGA 5AKQA 4O10A 5CC6A 4CCEA 2ALRA 2O9OA 5D9MA 3KTSA 4I6KA 4AEEA 3SUSA 2Y4SA 3IJ8A 3N13A 4BFAA 3M07A 1PTAA 4AWTA 3FDGA 3NOYA 3QJAA 4O0KA 5JBFA 5DCDA 4TMCA 1E0VA 3L7RA 4QNEA 2PMQA 3NM1A 3CIWA 2ZTKA 1VYRA 2X2YA 3WQOA 4F66A 3UYIA 5I06A 2YBUA 1I2QA 2WW5A 2EF9A 3JRKA 1OQFA 1MMFA 2VMFA 3KTCA 3WQDA 2BX7A 4MFDA 3HQOA 2A79A 4DWDA 1W9DM 1TFVA 4P7OA 5AVHA 4FA3A 3M5ZA 1Q8JA 1HL2A 3SI9A 2BXYA 1IR2A 3KCLA 1A0EA 4E8GA 1L0PA 5HUOA 1T5AA 3AMLA 3IJ6A 4KBXA 4KW2A 5IM51 3OQEA 3M5VA 4R88A 1OYAA 1RPKA 1XLJA 4JIIX 4GC3A 4Q4QA 4LXFA 2FHBA 2XG9A 2XPKA 4L4OA 1QO2A 1TREA 1DORA 1Z32X 3SN4A 4D6CA 2QCEA 3U57A 3EWXA 1H09A 3W28A 3ME3A 3KM8A 1EC9A 3IVTA 3WLPA 4B15A 2NQZA 4C6FA 4MUZA 1KNWA 4F48A 3PZOA 1GVFA 1E1CA 3TTEA 3S1UA 3WFZA 1H60A 4O1BA 3VGFA 2QMJA 3NQ8A 3R43A 1QNRA 1MYRA 2EJ1A 4JYEA 3LHWA 4KEZA 2ZZ1A 3L4XA 1E71M 1EF2A 2GLKA 3Q67A 1QOXA 3CZLA 3B0VC 4H7VA 3NNTA 4J7RA 4AIEA 2NX9A 4DAFA 1UZ4A 4NZ4A 1XXXA 1VRXA 4DZ5A 5KSWA 2DIEA 3NA8A 2QCNA 5GNZA 1EJ7L 4N9EA 4PTDA 5LSMA 1W17A 3PZMA 4DZIA 3VKDA 2HNEA 2AL1A 3UY8A 4ZBCA 5D9PA 1JDCA 1WDPA 3WQGA 1B3XA 5D2VA 2MNRA 3RJYA 2CZFA 3SZ8A 2WAGA 3GNDA 3ARRA 2BWGA 1XLFA 4HN8A 2Y5JA 1HP5A 2BP1A 1W9BM 3XISA 2P8CA 4FLSA 3QY8A 2DZWA 4N2YA 3GYCA 1A5AA 7CGTA 4PCFA 3RM9A 1V93A 3V0SA 4FXJA 4HOWA 4GA8A 5DXYA 4LANA 1KR0A 2E1DA 1E9LA 2PF8A 4WSKA 3QLLA 3FY1A 3JZEA 4R7JA 4AC7C 1U83A 1OCBA 3GDKA 4DHGA 2GK1B 5DF0A 3R58A 4L9ZA 1TPB1 3URBA 2OEMA 2FTPA 4LVDA 1J12A 3J7HA 4IMFA 4ZE5A 3URQA 4GUJA 4LALA 3UP8A 2ZUNA 1MEIA 5IBXA 3KHDA 4EP8C 1XKJA 4UTIA 1T8XA 3MBFA 1GQJA 1GW9A 1I8JA 3TWAA 1KGUA 3VKKA 1K8XA 4Y9AA 3UWVA 2PWUA 1R3SA 4IFOA 1TCDA 4XZLX 1I2RA 3AXKA 2P76A 1TG7A 1UR1A 1A0DA 2J7BA 4C6DA 1HKJA 2GJXB 3SCRA 3WH7A 4Y9PA 3IAQA 3N2MA 3UPMA 2Z7GA 4LS0A 4US5D 1JZ4A 4L1WA 5DCEA 2WVVA 3FVDA 1GG1A 2B7PA 2VEIA 4NJGA 3S47A 2V5LA 3S5ZA 2PPGA 3FOKA 1KV5A 4Q8UA 2GQ3A 2WSKA 1OCJA 4DLFA 3DIPA 4U10A 1UR8A 3BQ5A 3RYSA 1QWKA 2YDQA 1OX5A 2QCLA 3S5SA 2X41A 4JKMA 4XZHA 2EQDA 1XH2A 2HZGA 1H7XA 1JEZA 4GZ7A 3NPXA 4AU0A 2QGHA 2EJAA 1ITUA 2PGWA 1T99A 4D1IA 5HDRA 1TPWA 3MSRA 4DIAA 2E28A 4WJXA 4DJDC 4PMRA 4RDWA 3MKKA 4DYKA 4LVAA 3V5FA 4MADA 1P7TA 4V33A 4GYPA 1OBAA 1FH7A 2BVDA 3DHPA 3TW7A 2I5GA 1JXJA 3L5AA 3MUCA 2I1OA 1UIOA 1TCMA 1Q2SA 1G4EA 1GVIA 2A3EA 2VKZG 1RBOB 4I9JA 2OYMA 4S3FA 3WF1A 4PMUA 1AG1O 1HKKA 1VRDA 1E40A 3W71A 3QMSA 3VZZA 4C1KA 2VTFA 4E3TA 1CLXA 4R7WA 4LS2A 4G8TA 3P0XA 3FHQA 4WR3A 3I10A 1QHZA 3TLLA 2ASHA 4WLCA 1PZ1A 4PTMA 1JNDA 2EKCA 3VKCA 2BMBA 4OBTA 3M7WA 4YWSA 1F8IA 3TU9A 2C1HA 2Z00A 3DFPA 1W9XA 4U3CA 2IXVA 1LUCB 3PSVA 3EX3A 1FBAA 4W7UA 3WUBA 2QVNA 4CN6A 1J10A 4UTWA 4X22A 1LBMA 1SW3A 1S39A 3BMXA 1TV7A 4L7ZA 3M47A 3DXIA 3T7VA 5BXRA 3UJEA 2FFIA 2OYLA 4LV4A 4UFJA 2Z1WA 2BODX 4WDTA 4PEEA 1TQJA 4IJCA 3WK3A 2WMHA 1KTBA 5IDIA 1TZZA 3NL5A 2GVYA 3QHOA 1W1B1 1WOAA 5FAJA 1KM4A 5CPSA 3E0WA 1W31A 2YB4A 5T9BG 1NDYA 5TNVA 1NWTA 1AMKA 3PBUA 1NFPA 2PD5A 1QHOA 1A3XA 1KCKA 2IKIA 2I7GA 1H7RA 3S3GA 1V3HA 3WLNA 1P48A 4GGHA 4MZ1A 3DENA 2VD8A 4XTDA 3A3XA 4D2JA 4CNSA 4JFVA 1GKRA 4QP0A 1X1ZA 5DANA 4D6HA 1RA5A 3TA6A 1PHWA 1IEQA 2Z0IA 1YXCA 1AL8A 5K3VA 3EDJA 3L12A 3V5OA 1I60A 3EBVA 2F7FA 2NXHA 5GNYA 1C90A 3GTXA 1RK5A 2HE8A 3GU9A 3MP3A 5HWNA 5KETA 4LSBA 3T4CA 3SIZA 3NDZA 3SAZA 3KWXA 4AX7A 2QIIA 2ACRA 2FPVA 3QZ6A 3A64A 4KMQA 2WK2A 3AOFA 3GVQA 2VZVA 4MB1A 1Z44A 3G6LA 1VD6A 2RDTA 5E0CA 1KBBA 1IWPA 1DJYA 1QWGA 2JALA 3OLDA 2D2HA 2HJPA 1VJSA 1VHCA 4FR1A 1YW1A 2GYIA 1QAPA 3QPYA 4L9YA 1FWWA 1XFBA 2VZTA 4KGJA 2G41A 3GTFA 3IIZA 3SBFA 2PTWA 1RUSA 1F3TA 5CZJA 4C6QA 4U5KA 1OK4A 2VUNA 3VD5A 3W83A 3H54A 2ZUVA 4F3HA 2PWVA 3BDKA 1WZLA 1E1CB 4IWWA 3ARXA 3AZSA 2YDSA 4H6RA 2VC9A 1RJPA 1H1NA 5IFPA 1Z41A 3CBWA 2P0IA 2ZZ7A 4QLKA 1LDCA 2BSLA 1EJWC 1S1PA 3K1GA 1FWNA 2NX1A 4LAMA 1TRIA 4GFIA 1HVQA 3QQ1A 2GJPA 3CB8A 3N17A 4S3CA 1BYAA 2Z29A 4PFMA 4PUJA 2Q02A 3CHEA 3QPZA 1UR3M 3P8JA 1MEWA 3B3DA 3PAJA 1VBRA 1K02A 4J28A 4DBSA 4CQDA 1OT2A 5BRQA 4Y2WA 3T42A 3DYOA 3L23A 3I7QA 1AZ1A 1W3HA 1WAWA 3OA3A 1TX2A 2HMCA 4WIWA 3UWUA 6CGTA 5KMYA 2DZUA 5FJIA 5HANA 4UOJA 2CKSA 4GIEA 2I5QA 4QIUA 3O9NA 1EC7A 1PCWA 3TP4A 4EPDC 4GZEA 4IISA 3TYZA 1DQUA 1PKYA 3R12A 4IFRA 1OIMA 3CUIA 3WFLA 3U3HA 1D8WA 1TPC1 4E2OA 4ZA0A 2Z24A 4XZNX 3TQVA 1E5JA 4YTRA 1G4SA 1TIWA 3KRUA 3ZQ9A 1TUXA 4TVDA 2TODA 2Z25A 2PDYA 3TN5A 5EMUA 3PUDA 4GYPC 4DXXA 4KCVA 3MSYA 1LORA 4MAZA 1TA3A 1LT8A 1JDEA 1HTIA 1XDMA 3NQ6A 3SUVA 4W8BA 3VX0A 4U4MA 2XIIA 3WH6A 2YXXA 1KFJA 3U9IA 2WBKA 3M41A 2X0SA 3QBUA 1UC5A 3L65A 5DQPA 3TN4A 2FZMA 1VPQA 3W53A 4AZCB 2ZRZA 1E1EA 3NVDA 1A4LA 1M03A 1U5JA 3I7SA 3CV2A 4LAOA 4E3VA 4G7EA 4YCPA 3NGJA 3R6IA 4PUNA 4OVXA 2QULA 1SJAA 4XD6A 2YW3A 4WKAA 1A5KC 1C7SA 1S3HA 4K36A 1BHGA 4DO7A 1WA3A 2GUYA 3B40A 4A8RA 4KRZA 3B0YA 4AHPA 2W66A 4GCAA 1G4PA 4QRNA 3BZGA 4YTUA 3CWOX 3DG6A 4IQEA 4I90A 2FJUB 1QK0A 1KLZA 4MG4A 2HEJA 5AC5A 2YGYA 1XM3A 3S0CA 1MEHA 4N7QA 2EBNA 2AMXA 4GE8A 3VGDA 1RQBA 1WDSA 4ALDA 3GZ3A 3LN3A 5KITA 2VGFA 5DELA 5LNUA 4Q6JA 1UC4A 3BG5A 2NXIA 5T9CE 1UR0A 1W0MA 3B04A 1RVKA 5CGQA 3U2OA 3TC3A 4AWEA 3MCNA 1FWRA 4UNLA 1XIFA 3OB8A 3USZA 1UH2A 2J6VA 2NQLA 3OBKA 5CJ5A 1CXIA 1JZ5A 4Z17A 4H6EA 4HSOA 3GRIA 1PKNA 3NXLA 1HJSA 2W79A 3OLEA 3HQPA 5D38A 3MO7A 3UZXA 1UKOA 1TR1A 3ZOAA 4FOJA 1TVPA 2F6UA 4H00A 1RPXA 1XRFA 3WBAA 1S2VA 1A5UA 4W89A 3WG6A 5CG0A 4WGXA 4J35A 2YX0A 4UXDA 3C4UA 2UV8G 1ELSA 3A22A 3ITGA 1DEDA 3ZYZA 4ILSA 3UXKA 3OGVA 4B90A 5F2LA 1EJSC 1BAGA 1CPUA 3WMCA 2Y5EA 1W3LA 1FDYA 4MJZA 1QNVA 4LVFA 2GDUA 4XIMA 1VLIA 3T05A 2P10A 3LI1A 3GFZA 1VENA 2YBVA 1EO7A 4LB4A 3KDOA 3BVJA 1A49A 5EMJA 4WXYA 2QJMA 4Y96A 1S38A 1GPFA 4HYWA 3QKEA 4H9MA 2CLFA 1PHQA 5I79A 7TIMA 2VELA 2NVAA 4LPCA 1V6XA 3AHVA 3BAXA 3VA8A 3W7KA 3II1A 2QDHA 1RQHA 3USBA 1I2PA 3NJ3A 1TR9A 2BY2A 1U2YA 3GKFA 4C7GA 4PL1A 1VIWA 2WANA 5AYYA 5PTDA 4XIAA 3EKGA 3W24A 4M80A 4M19A 3SCVA 1SYTA 4ZFCA 4FF5A 1BG9A 4DNHA 1C7TA 4IICA 5K9DA 4JIRA 3BPWA 5H1WA 3MI2A 3B8VA 4GVHA 1Z9AA 1EXPA 1YTDA 3GHSA 3EPOA 5LNVA 4XB3A 3UVIA 2XU2A 1NFGA 1SGJA 3U7VA 3W4RA 3L5MA 3TYUA 2OQYA 2ZRWA 5FEZA 3UWEA 1GOIA 4GG9A 1IZJA 2HQAA 3C0JA 2ZVIA 1Q7ZA 3NL3A 1YX1A 1SSDA 2WVUA 4O12A 3AJ7A 3LTYA 1F7BA 1GOXA 3VNLA 3QEZA 1DOSA 1WZMA 3AUOA 1M53A 5HMDA 1HF6A 4X2RA 2AMGA 6TIMA 1CEOA 1KR1A 3K8MA 4ERGA 1O68A 1OZQA 1XRSA 4NQ1A 3E1F1 1WDQA 1QFEA 4GY0A 1RHCA 1WDWA 3AYRA 4NNCA 4C6NA 3ATZA 1S5VA 4DELA 1XIJA 3TTYA 2A7NA 5KZDA 1DJGA 2C91A 3RM8A 1KLYA 4IIBA 3QZEA 3STPA 3P62A 3S2MA 3TH6A 3NOEA 2GVJA 3WDRA 2FFCA 3PZVA 1B54A 2VVSA 3DCPA 2NLYA 4GISA 1IHIA 4TV5A 3K4AA 3BWWA 1OHLA 3GU2A 4PB4A 2QQ6A 1UD4A 5ABHA 2PGEA 3O8AA 3M44A 2X30A 1JI2A 4JTQA 2CLEA 1BGGA 3H2MA 2P50A 3EMZA 2PTXA 1DXIA 2XIMA 9XIAA 5HQMA 1U1HA 5HOSA 3PPHA 2H3DA 1E6SM 5I2UA 2PLMA 1N2VA 2O0TA 3VNJA 1XSKA 4GLEA 4ES4A 2VFIA 3GW3A 1Q6RA 3U4AA 4DY1A 2DGAA 3CL8A 4W93A 1AW1A 1LOLA 4PBEA 4PB3A 1H1ZA 3KP1A 4S39A 3VIKA 3KWSA 1MWOA 2VVNA 3SGGA 5IBXC 4GNJA 3GHUA 1VEPA 2CPUA 4HCHA 1PX4A 5BOFA 2DJLA 4TQTA 3E38A 3BARA 3WDJA 1SZRA 2D0FA 4PMYA 3LGDA 3WD0A 2CLHA 3TYCA 3FV9A 3TC7A 3BURA 4LRTA 5DX7A 5EY5A 1ZAJA 5LZLA 4ZB2A 1OFBA 3NYZA 1F6KA 2OU4A 3DG7A 2EKGA 3S6DA 5H6HA 2VR4A 3HG5A 1Q5MA 3WLQA 4RE3A 3LDVA 3S1WA 2NVCA 1QU4A 2QUTA 3MS8A 1BG4A 2PP3A 3PUOA 1ENUA 2WVVB 4GUFA 1QVBA 1TA3B 2WJDA 3KL5A 4FPSA 4BEUA 4UFMA 1GVRA 1X38A 5CEWA 1V79A 4MLRA 2QDDA 3UZYA 1J8VA 2WC7A 4J40A 3AQUA 1ZUAX 2CHNA 3B8DA 1CGYA 2QT3A 3PBYA 4QJ3B 4BQ3A 4B5VA 4Q3MA 3PTMA 4KWSA 1XDJA 3L4UA 3VUPA 3B9AA 3HFTA 4JL2A 2DUAA 5MKGA 2BG5A 1QATA 3ABQA 4NVTA 3UF9A 1RBAA 3MCOA 4IMCA 3DAQA 5AHEA 1CXEA 1XLHA 1PZ0A 1EUNA 3NYDA 1DXEA 3P7YA 1ML1A 1M7XA 3G3DA 4PB5A 3C86A 1X97A 3RN6A 4D6GA 1FFRA 1UA7A 2X1IA 2WQPA 4IXHA 1HW6A 4P7RA 1LL4A 1ISWA 2YB1A 3THQA 3IARA 2H90A 1WE5A 2FZDA 3H7VA 4QLLA 5JU6A 1IXQA 1V6YA 3FN9A 2Y70A 1L6SA 3TSDA 1J9YA 4O11A 4R33A 3S9IA 2OJPA 4Q8OA 1TELA 1Q7MA 3A23A 1W54A 4NZ3A 4GXWA 4W87A 4Q7NA 3WJWA 1W1PA 2WMJA 3A5FA 4AIUA 4EXQA 3C5QA 4CU8A 3POCA 3LHUA 1K8ZA 5HNRA 5HPCA 3MO4A 3AIWA 1JFXA 4IP4A 3WENA 5DT5A 3B05A 5LXEA 1KBIA 3NEVA 1X98A 2P8BA 3GG1A 3BCFA 4N9DA 2Y62A 3GDMA 2SFPA 5KTLA 4HP5A 4QEHA 3M4HA 1JXKA 1ZFJA 3LZ5A 1O66A 1WQ5A 2WKJA 4FX7A 5ABTA 1UPPA 3DKJA 2RGMA 3T0AA 3WEZA 3Q45A 2OZ3A 1IT0A 3V3WA 2DVTA 3CAWA 2OQLA 3GFXA 3WH5A 5I3JA 3N29A 3GXDA 2CZDA 1UP0A 2WB5A 1TX0A 2INEA 1PWMA 1GJPA 1XSJA 1UD2A 2RDWA 2C79A 5ENLA 1M04A 4RZ4A 3ICJA 3WBXA 4LW7A 3L66A 2ZZ6A 4PN2A 3T2QA 2J7HA 1BSLA 4UR9A 4GX9A 1XQLA 2VX7A 1V6TA 4XWUA 1TJRA 4HT3A 4MY1A 2V9DA 5D30A 4M6UA 2PDPA 1GTEA 4BK9A 4NT0A 1K9DA 3MANA 3KBWA 3NQAA 1CZ1A 4FNSA 1DJNA 4HSHA 3M64A 3ZJ8A 1L6FA 1JULA 4JYDA 5FL0A 2XN0A 3OGSA 3H22A 5LGZA 2PB1A 2Y85A 2GJNA 4Q8QA 3O3RA 5FOOA 1XPYA 4PTWA 2A4AA 1B1YA 4NJJA 1X39A 1US3A 1KCZA 4GI6A 5JH2A 3ANUA 1DWAM 3KL0A 4XZIA 5BNKA 5FEXA 3SO7A 1E6PA 1EQPA 4O13A 2AKZA 1KCLA 4C6BA 3XINA 4JEJA 1MRAA 3LG3A 4LEFA 1GVYA 4FO4A 3CV1A 2E6YA 3WMBA 1KWGA 2XZ9A 3ORWA 3ZS4A 2PWEA 1BPLB 1HIZA 3R0DA 1L6GA 1ZZMA 1GHSA 2VOTA 1S1RA 1ZALA 5LNRA 4LB3A 3H21A 2XVGA 3UZWA 4EF8A 4F4RA 2G4FA 2XZ7A 1EWDA 1DIOA 2VQTA 3UJRA 1GTHA 1PYFA 4CUCA 5HK4A 5FF0A 3OW1A 3OO2A 4ML9A 2PLCA 3GC5A 1CGXA 1SFLA 4AVOA 3E0FA 3M0HA 4FLOA 9XIMA 3LRKA 4L61A 1ADDA 1DTNA 3CPUA 1Q66A 2QCDA 3R25A 3LX9A 2JF7A 1WDDA 5G4WA 1BYBA 2PC4A 4JR5A 4UR8A 3QF0A 1SZGA 2YFOA 4HTBA 4C91A 1G5AA 3PTDA 2XWDA 1EIBA 4H9VA 5MHBA 4CVUA 2R1MA 4DJEA 1EJUC 4C5ZA 3CIXA 5FF7A 3SY8A 1PX3A 1UKSA 3WNPA 3PFRA 4H4IA 2EXOA 2GJLA 3ZSSA 4MNKA 4I5UA 1EF3A 1IEVA 1POKA 2VDIA 1E0WA 1Z3NA 3OJGA 5HMEA 5JBEA 1XYBA 1AVAA 3WQ5A 4Z0SA 3U5YA 2FJKA 3WF4A 1XG4A 1TTQA 4HK6A 4AZGA 2PI6A 2J7FA 1SR0A 4NXKA 4Y7EA 1JPMA 3NL6A 2X1SA 2B0MA 4JBRA 3B8IA 3WLKX 4LUSA 5IRPA 3TEVA 4IGNA 4FNQA 3OQ8A 4UQEA 3RX3A 4YL2A 4MOZA 3IV8A 1KM3A 1VF8A 3LQLA 4L9XA 4FLRA 2BXVA 2B4GA 4O8RA 1PDYA 1N82A 1BXBA 4J2MA 2ZUUA 4H04A 1I2OA 3GSMA 4GZJA 4L4MA 3PZNA 4PRWA 2CBJA 1ZNNA 4GUIA 2I56A 3SJNA 3RMEA 3VIOA 3NL2A 2QNEA 3IPWA 4ECLA 3NIYA 4Q4RA 2ZX5A 2J27A 3C2OA 3SSJA 1LM1A 2R1PA 3QV7A 3FSTA 2G3NA 2IKHA 3CMFA 4GFSA 3UG3A 3TW9A 1JPHA 4W8AA 3EOEA 1ESWA 2I17A 2HVNA 1IV8A 3TVAA 4JTTA 4JN8A 2JK2A 2ZRVA 4JTEA 4O8AA 3WDPP 2BOFX 3L0GA 2OLAA 1GYNA 3T6CA 1OC7A 3N2CA 5BZAA 4YYCA 3CGTA 4A6GA 1V3JA 2X1RA 3EEZA 1LYXA 5SWUA 4GC4A 4JAWA 1AJ0A 3VUSA 2XTKA 3M16A 2RUSA 2QJIA 1UH4A 3EDKA 2HS6A 2RJHA 5HMFA 4V28A 1HKWA 3U7BA 3W22A 2GOKA 3H53A 4QE4A 1REQB 4UCGA 2JEQA 1OSEA 1XD0A 5JIPA 3MMTA 2Y7EA 2GGJA 2Y88A 4JS3A 3CH0A 4X9SA 1JIBA 2GVEA 4HK5A 1WUFA 4JIHA 4JQ1A 4JCMA 1K77A 3QSTA 4MNMA 4S3KA 1F8MA 4H9ZA 3OEXA 2R8WA 3EB3A 5HMSA 3IIVA 4GI8A 3EDDA 3HB9A 3AMCA 3BK0A 4X3ZA 3VKJA 3ALGA 2P53A 2O4MA 4IQLA 2Y8UA 1JAEA 3GKAA 2HCVA 3ZLHA 5F2GA 2AGKA 3T09A 3TDFA 1TSIA 4C60A 1K3UA 2A5HA 2OO0A 3TA9A 4I8YA 3W02A 1HFBA 2DDXA 1LBLA 1M9HA 1EBGA 4B5WA 3PZTA 4PMJA 3LM3A 1PE1A 3S2CA 1E43A 4CQ8A 3L4ZA 3WQ4A 3P82A 2DUZA 4P5UA 3FK4A 3GDTA 3SFWA 3NPUA 2A85A 3O05A 2AOSA 1M3UA 1NF7A 5M17A 3AICA 4ZEPA 3TN6A 3JU2A 3LPGA 3UA3A 4F79A 2XSAA 1BEUA 1QT1A 1J2BA 1NDVA 1X8CA 3AHXA 1ITXA 3E6EA 2G50A 1HN1A 2P3EA 3W2UA 4YMZA 2PZ0A 2V63A 3UJSA 1TMQA 1YPFA 1VCVA 2Z1XA 3SN0A 3OBEA 1F5ZA 4H1ZA 4LX4A 3MUAA 3E5BA 1NIUA 4O1EA 4UIOA 2XYLA 3GAYA 2CKRA 5CSSA 4H8VA 4JDBA 1FA2A 2XIJA 3LCFA 2QIWA 4UTKA 3A5VA 3IWPA 3BMVA 3BGGA 3NM3A 2PGFA 1P0EA 3AXMA 3KRBA 4PRRA 3RK8A 3P60A 2J7GA 2ZTJA 4WY0B 1FXPA 2WCGA 5A8MA 2PDIA 4C6CA 1JG9A 5CSRA 1GNXA 4ZENA 3R0UA 3GG8A 1DP0A 4UQ9A 1TPDA 1P0DA 3BLFA 3EX2A 1JDAA 3CEUA 2XHYA 3MY9A 1C93A 4AY8A 3DOPA 4ZQRA 3NSMA 3UNTA 2Z7KA 1VZWA 3KBSA 3HV9A 2IKJA 4DJDD 3L4TA 2G3MA 2ZQ0A 1IEWA 3EB2A 3EGJA 5EMMA 4FEZA 3FCPA 2A3AA 3QGKC 4NZ1A 3IEBA 3S5NA 4A21A 3NSNA 3RHGA 4BR1A 4IG2B 1R85A 3AIUA 4MB4A 3WQFA 4QLJA 4C7FA 3W2LA 4KCTA 1VFMA 4LUSB 4J3WA 3MYOA 3VFCA 5G4EA 1OJXA 3W74A 4K1WA 3KOYA 4IX2A 1P0NA 3S83A 2P3ZA 2VXNA 3BAYA 3CEPA 4EX4A 2O55A 1H7PA 2YBTA 2QMKA 1XLEA 1T0OA 3PZQA 3C2VA 4AD3A 1KO0A 3AJXA 4MDOA 4HNTA 3QM3A 3JZUA 3WCZA 3PWGA 3MCMA 3RIKA 4GYFA 1V7YA 4W7WA 1SO6A 3AHYA 3S1XA 1A3WA 1WPCA 1JUBA 3PWIA 4KCUA 1UOKA 4ZMGA 4A3UA 3EA2A 1Y8BA 2PS2A 3RXZA 4Y9MA 2OXNA 3VM7A 2CC0A 4QCEA 3WIJA 4C7DA 1BQGA 3MDUA 3URAA 3HGOA 1AQHA 1VFTA 2HPIA 1ONXA 3KBMA 1M7OA 3SCPA 5A6JA 4IOTA 3GR7A 4B4HA 3F7JA 2PFHA 3MZNA 3AU2A 2QS8A 2CHRA 2GDVA 1M7PA 2QEZA 3VM5A 1O7AA 3IUDA 1VS1A 4EAMA 1OYBA 3SCSA 1CECA 2DSWA 4GZIA 4CEUC 4A35A 5I09A 1YDYA 2FHCA 3VC5A 4PCTA 4N9CA 4NZFA 4RW3A 3GDBA 2WMKA 1RP8A 1TTIA 1NOFA 1MW0A 5A94A 3LYEA 3W2JA 1W9PA 2ZA3A 1R3VA 1W91A 1AH3A 3NQDA 4C1NB 3K4WA 1SMDA 3SFKA 1ICQA 2ZA2A 2VEFA 5BU6A 1O94A 3L67A 1TV5A 1EPVA 1XIBA 1CENA 1HJUA 3LHYA 5C55A 3KUMA 4GPNA 1WNOA 4HVXA 3VNYA 3HFYA 5CPTA 4FNRA 4HHMA 1G94A 3EWDA 4RNIA 1JRBA 3BMWA 2OT0A 1HL8A 1S3TC 1QNQA 4AW7A 3GXMA 4UB9A 1SQ7A 1P6WA 4HGXA 1DXFA 1KB3A 2J9ZA 4QG9A 3G18A 4N42A 2PDQA 4GGBA 4MY9A 4D6IA 5I07A 1TIMA 3H2NA 3TFCA 1XS2A 3VD7A 2JBMA 1LP6A 3HPAA 4FX6M 2CCRA 2YCKX 3CYVA 1OT1A 1PUDA 1TWDA 5I02A 3MUZ1 3SUTA 1EJRC 5AHLA 3VOGA 1QI5A 3PZUA 4F9DA 1F3WA 2ISWA 4WDUA 4BY3A 4EPBC 3WF0A 2EAWA 3IUHA 3NAVA 5KZ6A 2BS9A 3VOFA 1E0XA 4GY1A 5MF5A 4EXBA 3ZJ6A 1DQWA 2YDAA 3I3BA 3EOLA 2Y7GA 3RILA 4GI9A 3GW0A 3W6MA 5DFAA 5U4NA 2CLMA 4H83A 3HG4A 4G5DA 3L0KA 2YW4A 5FCZA 2V8ZA 6ENLA 3AYTA 4H01A 4DI8A 1VYSX 3VVGA 2GZXA 4L6DA 4M51A 5EFFA 1CNVA 2ZZ2A 1H49A 2HNHA 1O95A 2HXUA 3TQPA 3B8WA 1XBVA 3LXAA 1K7XA 4MJ2A 3TTSA 1TJPA 4U28A 2JIEA 1OX4A 3LSBA 2BOGX 1MXSA 4B5XA 4MTVA 3C0LA 3GTHA 3R7MA 2YKKA 1Z42A 5AC8A 3LRMA 3AROA 4QG8A 2VZSA 4JTIA 1VR6A 1EX1A 3WF2A 1CLKA 4Q33A 4S3DA 5ECVA 1CXHA 3IRSA 4MSSA 3MUXA 2E7FA 2VC6A 5AFDA 2TPSA 3KBJA 4KKXA 4YWIA 4D8ZA 1DWIM 3WK1A 4OT7A 4O57A 1FWTA 4J9JA 1MNZA 1EDQA 4MHBA 2CERA 1A53A 2X0HA 1R9YA 4QX4A 2EGZA 1Q85A 1WKDA 4ZR8A 3SUUA 1LTDA 2ATMA 1WP6A 3MSGA 3CAKA 4I9MA 4HHPA 3I4EA 5XIAA 3EOUA 1W1YA 1I2NA 3H6OA 4H6KA 3OHMB 4EOUA 2J6XA 3MKVA 5LYRA 3W7QA 3BW2A 4HB7A 2V68A 4K1GA 4AB4A 3UG5A 1JPIA 1UIPA 3FYPA 3W1LA 4QTGA 1Q13A 3TWBA 4NYYA 4J5NA 2WJFA 3PF3A 1LL7A 3AMGA 3LBCA 1KWKA 3UCDA 4ADUA 2D23A 3AS0A 2BGSA 4FK9A 5F4XA 1ZHAA 1IEXA 4JTHA 1D3CA 5G1MA 4PMQA 1IZCA 2PGRA 2J7EA 4PULA 1KCXA 2BFGA 3THCA 1DWJM 1UWRA 3ZVIA 3DERA 4KETA 4CNPA 3VFLA 4WHBA 3FLUA 2VRKA 4U2YA 4FF7A 1JYNA 5FJTA 2VQUA 4HA1A 3SN1A 2FVMA 4OOUA 2OMAA 3ARTA 1XC6A 4NAEB 3EWYA 5E0FA 4GQGA 4I8DA 4IFKA 4HNOA 2DZPA 2E67A 2VO5A 4G9PA 1W3NA 4PRTA 1VHNA 1XJBA 1AA1B 4FXSA 4MVAA 1P5BA 1UR2A 3H4XA 4H8UA 3T0DA 1DPMA 1KFKA 4KFPA 1F2JA 2FB2A 3ZT5A 3C6CA 3OGRA 4Q4SA 4U5IA 1D3HA 3ARUA 5DEZA 3TK7A 3CAVA 1ZSXA 1DJQA 2IXUA 3QW4B 1I0DA 3SQSA 5HXMA 4QR6A 2POZA 1XBXA 3UWZA 1Z48A 1J93A 1GT8A 1OCNA 2ZWZA 3EA1A 3FXYA 2F84A 2PRLA 3PN8A 3QYSA 4AQLA 5EMYA 1HP4A 1QBBA 2Y7FA 3NQMA 1XGZA 1HUVA 4FAMA 4JX6A 1IR1A 4NL1A 1YKWA 2J78A 3TR9A 3ZO9A 2QCGA 1UA3A 1KFLA 2G8ZA 4FNUA 1R2TA 1HQTA 2D0GA 5I0DA 1LLZA 1DJIA 3QY6A 1VQTA 5BOOA 1C8XA 5HUPA 1KM0A 4GIYA 1NWSA 2O7SA 3FNDA 2OPJA 3V5CA 3VOHA 3PPCA 2WVTA 4LUIA 3Q37A 4M1BA 2FZ9A 3EYPA 2Y7DA 5C7VA 3M6YA 4MJMA 3WQEA 3UCQA 4W8LA 4H8HA 3HIJA 4QAIA 3TNOA 5CBJA 3E0IA 2A21A 1OABA 1WO2A 3M0JA 3S46A 3UGRA 4M56A 4O53A 3FAWA 3BUVA 3C2EA 3BLIA 4RE2A 1OIFA 1KXVA 3LHZA 4WKHA 1BSIA 3HGRA 4ZO9A 2WSYA 3FAXA 1ZRQA 1B4KA 3IJLA 1TQXA 4UNIA 2P0OA 1N8FA 2HV5A 3IK4A 4CCDA 5AZ1A 3WF3A 2Z1VA 5LNSA 4GNKB 2D73A 4DBEA 3PS7A 3OZOA 3NQ7A 1PS9A 3S1VA 3EMQA 3KLKA 2P88A 2OWCA 3KHJA 5CPLA 1GOOA 5HAOA 1FWJC 1E51A 1LRTA 3DFSA 3EWUA 2HXTA 5AN7A 3M0KA 3EXSA 4N9BA 3G3MA 3KBVA 1UD8A 4LGXA 4NSBA 2VZOA 4EPEC 1J01A 4HA0A 3MW7A 4C6JA 1R87A 4AWSA 2O4QA 2C0HA 3DX5A 3GFYA 2VM8A 3C8FA 3K13A 4KEMA 1ZJIA 1UWSA 1DBTA 1TVNA 2OEKA 3FEMA 4K37A 5LIYX 3LU2A 2VFEA 1ZB5A 2WLZA 2NXGA 3DDMA 1YXDA 5C2XA 4L65A 1UWQA 2A3LA 1YNQA 3CT2A 4Q7IA 2OZTA 4GWEA 2PP1A 2ZE0A 1KM2A 1VFLA 2CWXA 5C2GA 4HZ8A 3W3OA 2IPFA 2VEGA 4J3TA 3VDAA 4TUFA 1UCWA 4QM1A 4FIQA 1I0BA 5LKYA 1WOBA 4TMBA 3W72A 1OFAA 4ZOEA 1E4IA 3HO8A 4XAFA 3GIYA 2ACSA 3PZ9A 4M5PA 5AYXA 1US0A 4XZWA 3PG9A 2XGIA 4QXIA 1BYDA 1OF8A 2DJXA 1GYMA 1K9EA 4JQ2A 3GZAA 3W7RA 3P81A 3KCJA 1UP3A 1UUQA 3MZ2A 2ABAA 4DYEA 2VR5A 4POCA 2F2HA 3O6YX 3JS3A 4BI6A 4AD2A 3PJUA 5HULA 3RNDA 1S2UA 1ZAHA 4MMWA 5D32A 2PA6A 4QCFA 2IQDA 5CCZA 1WZAA 2PURA 2ZADA 4ZTYA 5J8LA 1B57A 5CC5A 5LIKX 1RVGA 3MJYA 1LWHA 2C3ZA 2QGYA 2JGQA 2Z1SA 4W4QA 2V0TA 3A47A 4DWSC 3Q65A 4UR7A 3O0FA 1YEYA 4MWAA 1PXGA 3BAIA 4WSHA 1ICSA 2JE8A 4W84A 4MLJA 3T2PA 3B9NA 4ZXLA 1FVPA 3SW6A 4BWLC 3BSGA 4Z1DA 1RQEA 4Q8TA 4H9YA 3RX4A 1WDRA 4MIMA 3GNOA 2D3LA 4C6OA 4PEKA 3Q4DA 1L9WA 3HV8A 3O63A 1CGVA 3Q58A 1XX1A 2DSVA 5MKGB 2A7PA 2EPMX 2CETA 2I14A 2QPXA 1EJVC 1TV8A 2FKPA 3G6MA 3THAA 1F07A 3WNLA 1XUZA 4ACZB 4C90A 1NDWA 1XBYA 2HTMA 4YVXA 3EPMA 4O28A 3DC8A 4NG3A 5LHEA 3IGSA 3CK5A 1NFBA 4CD8A 4DLMA 3FJNA 4EPKA 2ZUMA 1PKMA 5A8PA 3DI1A 4AFYA 4BCEA 4GKTA 4INFA 4FMVA 1QBAA 2G37A 2AL2A 4I7UA 3ZR6A 3C2RA 2QXWA 1GQIA 3MMUA 2GUBA 3E5PA 1FH9A 3W7LA 3GTIA 3N6QA 2JFEX 4GJJA 4FNTA 4KRUA 2QV5A 2WWDA 1BYCA 4ATLA 3UZJA 3HPXA 3BCDA 3UR2A 1AD1A 1P6CA 1SUXA 2JIWA 5BW6A 3W6YA 5F1UA 2FGBA 3I4KA 5A6TC 2XN2A 3VNMA 1FWEC 1US2A 3GC4A 4LAZA 4ZQPA 3QY7A 3WMSA 1IIGA 1SR9A 2V3DA 4ACZA 1CGTA 2Y6ZA 1WB0A 3KW3A 3GDRA 4JDYA 2HDJA 2GGIA 3KOZA 2W4XA 2PDNA 2Z1BA 3HQ1A 3TJXA 4EIVA 4P61A 4QBXA 3WDQA 3P6LA 1YE6A 2A6NA 1V0MA 4LVGA 3TUUA 2YIHA 3B8SA 3GYEA 1SM9A 5LA1A 3FKKA 4DQWA 3R1ZA 3E49A 4IGHA 4A22A 3G2GA 4I9TA 1GOQA 1X6UA 4DN1A 4K6AA 1BF6A 4LBUA 1W2PA 2VX4A 2DW6A 1X1NA 1XPGA 4JTSA 2EPOA 4OE7A 3C0SA 2CITA 1E6XM 1D9EA 2HWGA 4KERA 1XP3A 1XLBA 4JQAA 2UZ9A 3BO9A 3GX9A 3B0XA 5CZSA 1R3TA 1ZCOA 3I65A 3AO0A 1TZ7A 1A0CA 4GI4A 3FGCB 3IGHX 5HINA 1VAHA 3S2NA 2IQTA 1R6WA 3FA5A 1TJ2A 3CHVA 4YIWA 3LPOA 5HJYA 3OA5A 1H7WA 2TMDA 4GRSA 3C3UA 4LYRA 4J3UA 5CLTA 2QVHA 3ATYA 1XL9A 3RDKA 3G0XA 4NILA 4HJFA 3W00A 1JCYA 3R8HA 1FXQA 5A6KA 4K2SA 2QAPA 2Q3RA 3B4YA 5ABFB 4KIRA 4IG2A 2QKFA 1GONA 3A6OA 3WD2A 3SCUA 2ZX8A 3W1TA 2BDQA 3NZPA 3W1NA 4AISA 4L4LA 4E4FA 3WEOA 1B0IA 3WYZA 2XSBA 4B5UA 2BNJA 1UASA 2Q71A 5A2CA 5DT7A 2E8YA 2G4JA 2XJ7A 1M41A 2VC7A 4QAWA 2J79A 3FEQA 1AJZA 5DLCA 2ZIDA 4H9UA 1AH0A 3TZNA 3LTPA 3UCCA 4IXXA 3LTSA 1SZEA 3SRDA 3CQKA 3EEGA 3SGUA 3V7PA 1TE1A 4G7FA 1E9IA 1AQ0A 3TYAA 3IJIA 3SCQA 1UYQA 1NTHA 3NFUA 4NI8A 3TONA 1DJHA 3WBEA 4NX0A 1W3KA 1VLWA 6A3HA 3U6WA 1EGMA 4GOAA 4QJ4B 2PODA 5REQB 4MNLA 4H2HA 1BRLA 1CDGA 2J24A 2WSQA 4I5RA 3QC0A 5A8NA 2Q6ZA 3EWZA 2IS7A 2QUMA 2NVDA 2PDGA 3UXIA 2QAFA 1U1JA 1TPEA 1LWJA 1THFD 4F0HA 3P5YA 5FA5A 2PDUA 3AS1A 2DSUA 4DXKA 1UMLA 2CXGA 3ISIX 4LAUA 2QJNA 1Q6OA 5HR7A 4BKNA 4ZO8A 3PB2A 5GQBA 1R2SA 2CZVA 2FH8A 3HGJA 2ZX7A 3S5OA 4MY8A 1W5OA 2D22A 4DJFC 1H0IA 1E9YB 4N4PA 1M68A 1MVYA 4BJHA 4CQAA 4NF7A 1W5MA 3RCNA 4DUXA 3AS3A 2F38A 2WBGA 4TTUA 3UGVA 4LYPA 3ANYA 2BY3A 2DY3A 2YXOA 1CCWB 5FKYA 4HYRA 1VB9A 2NQ5A 3KX6A 1ZS2A 4UFKA 2WVSA 3S5YA 5GNXA 3ENLA 4CNNA 3QMTA 1A80A 1FP9A 3DYPA 1IE7C 1D7KA 2H9AA 5HBFA 1E9ZB 2CLPA 2OVLA 1HKVA 5GJMA 3M0MA 3VKAA 3TYDA 2QUUA 3V4BA 2KZHA 3I7RA 3DC0A 2PDWA 2FMNA 4FXFA 2ODOA 4IQDA 1B5TA 2I57A 2OEJA 3QW3A 1G7VA 5D03A 1POJA 4IJRA 3A3WA 3TNBA 1O1HA 1JFHA 2I9UA 1AW5A 1AW2A 2V69A 2Y89A 9CGTA 2YPIA 4FSAA 5E1QA 3DN5A 2D69A 1JUKA 2AKMA 3BXWA 2FQIA 3DECA 1ITCA 4IX0A 1LOSA 4I7VA 4J4KA 1DHPA 1SO5A 2VR2A 3N4AA 4XZBA 2WZIA 3W85A 1REQA 1ONWA 5CJNA 4LY4A 2O7QA 3DFTA 1FWFC 1D7FA 1JQXA 2XDFA 1KBLA 3MYPA 1N8IA 4L5ZA 2B7QA 2X1TA 3PUGA 1XF0A 2A6LA 2C14A 2IPJA 2PDKA 2J7DA 3BAKA 1OYCA 5EBUA 3R0KA 3N4FA 4XX6A 5F2IA 2BHUA 1ZJAA 5EBAA 2OELA 3GO2A 2DZTA 4QROA 3URNA 2GVLA 2W61A 3MUIA 3HJEA 1K1DA 1U22A 3NQEA 4XKMA 2HE5A 4WD0A 2XH7A 4NJHA 1V08A 1J5TA 4MB3A 3SCOA 4PYSA 5DMLA 1L6WA 5EL1A 2ISVA 1WXJA 5LA0A 4YHGA 1RA0A 1GEHA 2B81A 4OBRA 1ZGDA 1H7NA 4H7CA 1F9CA 4PMZA 2NQ9A 8XIMA 2CEQA 1DWGM 4GQ0A 4K8EA 3TTOA 2BXZA 1K7FA 3VGGA 1CWYA 3HBLA 2W91A 1J2WA 5B7YA 5AOUA 4LFYA 1EOMA 4NNBA 4R5EA 4PBGA 3LNPA 1IGWA 3MWCA 1DIDA 1NY1A 4HJWA 2V5DA 2UY5A 2YR1A 1MZHA 2WQDA 1EJTC 3KRSA 2WSRA 4REQA 1XGEA 4EWJA 1OWQA 4DZHA 2E6DA 3FW6A 4OOZA 3W0KA 1OZMA 1UWIA 5DRCA 5C0QA 1O5XA 5F4SA 3PC0A 3T81A 5CPQA 5E0KA 1FUYA 2XFRA 1XR2A 3GVWA 2NV9A 4RZ6A 3W7NA 5CSYA 3W7IA 3MMDA 3OPSA 4F2UA 3N14A 1W5NA 3SRHA 1K6AA 1MI3A 1UZHA 4YNGA 1MUMA 3GIQA 4ORIA 2E68A 3WLMA 1UKQA 2G3IA 1AFSA 2OKOA 3U2ZA 2UY3A 5RUBA 3QV9A 1NELA 1O5QA 5AECA 1FCQA 4E2BA 3PHAA 2ZZ5A 5IFTA 1YYAA 2ZC8A 2VCAA 2FGZA 1QI4A 1NWRA 5CZKA 1H63A 3G1DA 1JGIA 5A95A 2WMIB 2PRHA 3ABSA 4C5YA 4DF1A 2WV8A 3OZMA 2HS8A 3ITCA 2NUYA 3RAOA 5J5RA 3STEA 5HQEA 2TSYA 4WJEA 4MZ8A 5EYWA 3W1XA 2MUCA 3W27A 4CCZA 1QPQA 2CXEA 4HNUA 3S9YA 4ZB5A 1BTCA 1FWAC 3H55A 1NH6A 1WKEA 3TOYA 1RBLA 4R53A 4JTFA 5E09A 7REQA 4K68A 1TPH1 3SUWA 1FCVA 1ME7A 2OGYA 3AZRA 4NP7A 3QTPA 3G0SA 4JTUA 3WX7A 3LCIA 3V0UA 3LBMA 1V51A 4LS1A 4I7WA 1KTNA 2F61A 1SU5A 4TO8A 2FH6A 4S1FA 5AHFA 4J3VA 1XIHA 7ENLA 3PTKA 1VH7A 1IQ8A 1AZ2A 2ZRUA 2ZOXA 3WJXA 5FF2A 2BTMA 5CAHA 3KP0A 3OYZA 1C8VA 3AIRA 2C15A 1QOPA 2A2IA 2YXGA 3BQ6A 5TBOA 1A3HA 3UXDA 2F2KA 1UD3A 4DI9A 4NXSA 1RP9A 2ANUA 1GQKA 3G5EA 1F4HA 3CUGA 1XDLA 1SZFA 3LCGA 2XN1A 2ZXQA 4FLQA 2H8XA 4RE0A 1EDTA 1RY0A 1V4YA 3F4DA 5C54A 3CL7A 4EAYA 5CGMA 2QF7A 1PDZA 2X05A 4BQ2A 3LV6A 4BI7A 4GACA 4HPNA 4JPGA 4GIAA 3V18A 3ZVHB 4LNYA 3CZJA 4NU7A 3DU0A 4KS0A 1EX5A 4JKKA 1MQQA 2QPSA 4OGZA 2D2GA 3B4UA 2V5KA 3MQTA 1J5SA 3H2AA 3QSRA 2CFFA 2VCCA 3CXOA 1EKOA 4CD4A 1NEYA 1GUVA 3VDHA 4KFNA 2XFWA 1V3MA 3BL3A 3PBWA 4O14A 1EP3A 3VD4A 5LIWX 4WCJA 1C8QA 3WMLA 1JL8A 4AZHA 4JN6A 4K7YA 4K7VA 4Y9NA 4HNNA 2X40A 4AUBA 1U5VA 4PR4A 5I3DA 3AWNA 1K7EA 2ZUWA 1E4NA 2PWDA 4JQ3A 3IIOA 1KW1A 3H70A 1GVQA 2XFFA 2W5FA 1F6YA 4WRHA 1KQYA 1BTMA 1XYLA 2F8QA 2HISA 1G4TA 4HOXA 2XWEA 3N2TA 1LRQA 1PKLA 3WZ0E 1ZL1A 3VK5A 3PNUA 5BMWA 5GPRA 4HQVA 4AAJA 1QHPA 4GJIA 3DFYA 4DJED 4D6EA 3RO6A 1JR1A 4UQCA 4Z1BA 4FXRA 2QHAA 2D20A 3GM8A 4Y9OA 1EZWA 4HU3A 4PL2A 1XGDA 3W2NA 4ZSUA 3BICA 2EG6A 2HVMA 1DVJA 3GC2A 2REQA 3IIPA 1P6BA 4A3YA 1U33A 3QXBA 1QNSA 2W3ZA 1RCQA 1ZY9A 6ALDA 3ZIZA 3AIEA 4UQAA 2V38A 3UESA 3B0PA 3RO8A 4ZSTA 1XLIA 2OR2A 1HL9A 1A5SA 3F5JA 3DI0A 1ODUA 3DGRA 4O18A 5FF4A 4GMEA 2OGJA 4XZ9A 3KDNA 1F76A 3VNZA 1UW9A 3QKZA 1J4EA 4HNLA 3SEPA 4MB5A 2G97A 1W8GA 1JZ2A 2W62A 3RRXA 3NCOA 1S46A 1JCLA 4ATDA 2GWGA 5D2XA 3O2LA 2TYSA 3ZJKA 1EOKA 4UTHA 1B3ZA 2ZUTA 2ATSA 3DEQA 4JFWA 4AY1A 4I9AA 3NQGA 2REQB 4US6A 4AYSA 4MFEA 3UA4A 2J66A 5FEWA 2E4TA 2DV0A 3SJ3A 5HJLA 3V35A 7A3HA 1BKHA 2FZBA 4ZOBA 1M5WA 4EE9A 3W7JA 2WOQA 3GXTA 2V5BA 1BVZA 3FGCA 2F6XA 3T78A 4H3DA 3DH7A 4AYGA 3GK0A 1DJWA 2JKEA 8A3HA 3FA4A 5ABEA 4J2PA 1KFWA 2VWTA 2WYSA 2OSWA 4TVCA 2CIPA 1W9VA 4IT1A 4G6CA 3W37A 3AMKA 1EDGA 1J18A 1LQAA 2I16A 3CC1A 4LV9A 3WQVA 3E3HA 2EG7A 4O0ZA 3WNMA 3UZ5A 6PTDA 3T08A 2GGEA 4UZSA 4H2CA 3A4AA 1FDZA 1LLWA 3M0IA 3ONCA 1E70M 1TRDA 2DT1A 2CZ5A 2OT1A 1OADA 2IPGA 3P0WA 3BOFA 4AVFA 3ZFHA 2QCHA 1Q4NX 3EXRA 4KWUA 2WCSA 4IM4A 4W88A 1PAMA 2H9AB 1PL9A 8XIAA 3MT1A 1XICA 3BG3A 2C6QA 1V6UA 2ZXDA 4XKYA 4YVPA 2I9EA 3QR1A 1SJCA 5XIMA 4WZHA 3WLTA 3MWAA 1R38A 1TWIA 3GTNA 2PU0A 5BXSA 3ZJ7A 1KM1A 2A3HA 4KQNA 3AXIA 2WHLA 3W82A 3B8UA 3VDGA 3QYQA 4GQBA 5CG7A 4WOZA 1UQZA 3VE7A 2QCCA 3OHIA 3CMJA 1XC4A 4H6QA 5D9NA 1CB7B 2XGZA 4DWSD 4W5UA 4EVZA 1T41A 3WQ6A 3HG3A 4UTFA 4BF5A 3BLEA 4G1KA 3LM7A 4IPJA 1DJZA 5I00A 1A5NC 3QQ0A 3NQVA 4E8DA 4XBKA 3IAPA 3KOFA 4HZMA 3T1GA 3LXBA 4C6EA 1GEQA 2PEVA 3LB0A 3CV7A 4ZQOA 2QV4A 2VRJA 3CHDA 4E2DA 4K3ZA 3HPFA 4C6IA 2PTYA 3L2MA 3NZ1A 1Q6QA 3D3AA 1I6NA 1A5MC 4AXNA 2VJXA 4AH7A 4HNVA 3W2MA 3VIJA 3U2EA 3G1SA 2BBFA 4ZOAA 3SCNA 1XLMA 1Q6GA 3O07A 2Y8KA 2ZKMX 2NSOA 4AEFA 1VFHA 1FHUA 3PUEA 3GY1A 3F4NA 4QJ5B 4O15A 2DZVA 4XQ6A 1NM9A 1QW9A 1T7LA 1WAUA 1R46A 3FFSA 2NUXA 3GNNA 1TV4A 2W67A 3CZ8A 2R1KA 2HK0A 1LG2A 2A1YA 4JD4A 4GH1A 3WQWA 5J04A 3DHFA 2VDGA 4B3ZA 5CKSA 4EWND 4UCFA 4RZBA 2DH2A 4WX2A 4RL3A 4QQUA 4AZ6A 3N1AA 4YVVA 1YIXA 3KVLA 1RALA 3GH4A 3EB4A 5A6BA 4RDVA 1OGBA 4O19A 3LPFA 1QI0A 1OX6A 3ECQA 5FSDC 2OWXA 3BJSA 3W88A 1F4AA 1R3QA 3RGTA 1B9BA 4HMNA 5CZ0A 3CLMA 4S3AA 3W29A 5EMKA 3LQGA 5BWFA 3W7OA 5BMXA 2ISSA 2QZRA 5ABFA 5CC3A 1N8WA 3H2CA 5H8MA 3NXFA 3Q2DA 1Y0EA 1PBGA 4JYFA 1QPKA 5G2HA 3VOCA 2FGLA 3CWHA 2NQJA 3KOWA 3OP2A 4E8CA 4LUYA 2FTWA 1LOQA 3WL1A 5A6LA 2WJZA 3OU8A 2G96A 3IS4A 3XIMA 4GYKA 5AVNA 2GUUA 4GBDA 1SPQA 3L2IA 2WWCA 2QW5A 1WYIA 1M7JA 1KBJA 3TKFA 2IW0A 4JTKA 4QG6A 4PCSA 3IJ9A 4L6OA 1OD8A 4LU0A 3VZYA 4F0RA 3RF9A 1SO4A 4YYFA 4IH3A 1R9XA 1F05A 1H5YA 4P8UA 2VFDA 5BCAA 1VFFA 2VGGA 4A3HA 3DFNA 2R94A 3GXFA 1FHLA 3OVGA 4N6FA 4AVNA 3L4WA 3P67A 4IL0A 4Q4MA 2EPLX 4YU1A 5KZMA 3N2XA 3TLQA 4CNTA 1JUEA 4GXPA 3HQNA 5M03A 2WNNA 4JNZA 4ZCWA 4A3RA 4HYVA 4Q8PA 3HF3A 2Y24A 1ONEA 1YMYA 4UTUA 3SRKA 3ABRA 4FI4A 2VFGA 4M8UA 5HNTA 1B4EA 3WEMA 2V81A 1OGSA 5BXPA 2WNWA 1W2VA 4KWOA 4PH6A 1RAKA 3AS2A 4PE8A 3VINA 1EP2A 1EFZA 3U4FA 3C2YA 3BCJA 1Y5VA 1N7KA 1NJJA 1A47A 2POTA 1GOMA 2NLIA 1FX6A 3VCRA 4ZL1A 1AQFA 3BLDA 3BLKA 1XLCA 3QVQA 2AQWA 3BW4A 3M1ZA 5HQLA 1EA9C 4NI3A 3CHFA 1JDFA 4IIEA 3CU2A 2GDQA 2QDGA 1BVWA 4JTGA 3VPLA 3W76A 1LBFA 1MXGA 2PDFA 3ZLFA 3GVGA 4NKCA 1OEPA 1ONRA 1GKQA 3C56A 3F2BA 1J6OA 1VBJA 4F0KA 1GOWA 3WH8A 3W7PA 1TPUA 3R79A 3O0KA 2VGBA 3G8EA 2NQHA 4EANA 3RPMA 3V1PA 2X09A 5K4ZA 3W26A 3QFEA 3N34A 4W9TA 1U5HA 3APGA 3BSHA 4RDZA 2AAAA 3MP5A 3FS2A 4DX3A 3MMWA 2G95A 4UZUA 1XD1A 4DYJA 4RV8A 2V6AA 4HPGA 2Y63A 4ZTXA 3GXPA 3H26A 4XG1A 1B2YA 2V67A 2YL9A 2FVKA 4B91A 2ZVRA 1FWGC 1OFRA 3T55A 3R8RA 3DBPA 5CQ1A 3WKZA 5E5CA 3KZPA 4PSPA 3UZZA 4YXGA 2VWSA 2Z28A 4JFTA 1B90A 3N2OA 3OYXA 4PA8A 4XO6A 4CGTA 2C1IA 3RR1A 2VI0A 3LCHA 1UQYA 5CBIA 5XINA 1MSSA 1DE6A 3TYEA 4GVIA 3W70A 1PB0A 4XBSA 3LCXA 2FDSA 3WQCA 4JNMA 4UFLA 4XTIA 5JMUA 5JUVA 2PP0A 4HU4A 1JYVA 1R47A 2D1ZA 3FHAA 3RFAA 1HO4A 2RKXA 3E2SA 3L68A 1LWIA 2QJHA 4D6JA 2WM0A 3R89A 1QDSA 1B9ZA 2J88A 4JIPA 2WKLA 3P74A 4B3KA 3RITA 2OB3A 4DAIA 2DIKA 3DUGA 4ML4A 3QGVA 3D6NA 1UOZA 4YPJA 3WBWA 1ZU8A 1V8EA 4UTMA 4G56A 5DMMA 2OYKA 5U7SA 1XYCA 3BLOA 2GQ8A 1K9TA 3ARZA 1X8FA 4WQ6A 1VPXA 3RUBL 4TX8A 1PX8A 4PMDA 3KVKA 2O9PA 4GXMA 1FKXA 2X2GA 3VIHA 3IK2A 2G3JA 5I3KA 3GXIA 4Z2HA 4JTRA 1J0KA 4AIBA 3VMOA 1BXNA 3UERA 1W6TA 1YTEA 1P43A 3E02A 2FYMA 4IZGA 4PODA 3LERA 3V0TA 4JEQA 3DZ1A 3AYSA 3KE0A 3MKCA 1XINA 4Z0JA 5HA7A 2XH4A 2E9MA 4MPQA 4R27A 4IUGA 2DU2A 4O16A 1TZ9A 1RV8A 2ZFAA 2JKAA 3ITLA 3SSZA 4CNUA 3LXCA 4DVOA 1SZNA 3CIVA 5I24A 4P8XA 5E9AA 1JZ6A 1VBUA 7PTDA 5EA9A 3OVPA 1MFUA 3CO8A 4TOQA 3GAKA 4LH8A 1XIMA 2ZA1A 3FDKA 3KRZA 4E4UA 1UH3A 5C71A 5ECUA 4DM2A 3WLSA 5G5IA 3P80A 4XSLA 4K38A 3B0UX 2B31A 4GJ1A 2ZC1A 4OHQA 4Q8VA 3IRDA 1W5PA 1KTCA 2TAAA 1QRQA 2Q01A 4QS5A 2FMOA 2E3ZA 3UNDA 3COTA 3PJWA 4IMGA 3W87A 3NQBA 4Z08A 4AD4A 4CQ9A 3TAKA 4H9XA 3AIQA 4HN4A 1RLCL 4DO5A 4FNPA 2WC4A 5CJMA 2XH2A 3D3FA 3ABXA 4B9YA 4DWSB 4F9JA 5AYBA 2OCZA 3TOPA 3ES8A 3N11A 1XWYA 3EA3A 1CTNA 4BS0A 2PRMA 1JF5A 2BGQA 4IIFA 3SCWA 1MQPA 3B97A 4LUTB 3VAVA 2BVWA 4HZ7A 3QQWA 1KRMA 3W1QA 5AYZA 4N02A 3INPA 1V03A 2ZYFA 4QE1A 4XZMX 4AD5A 1GCYA 2YCEA 2V3EA 4L64A 3NQCA 3A3HA 4NJIA 2RGLA 1GZ1A 4A8IA 2Y0FA 4JHOA 4HMEA 4J27A 4NZCA 5JH1A 1FHDA 1T40A 4UFIA 2PBOA 5DMYA 3OIXA 2OX4A 4Z2GA 4X2PA 5AC7A 3TFXA 4DNMA 1J0IA 4GVGA 3VGHA 2F9RA 4W85A 5EPDA 7XIMA 2AL2B 3S42A 5CPOA 4ZGYA 1QNPA 3HPZA 2J8TA 4Q7BA 3QPEA 3BAWA 1SFTA 5AC4A 4QNWA 3L0NA 1MQRA 1TTJA 4NAFA 3T0CA 2ACUA 2D24A 5DY3A 1BWLA 4X61A 2WPGA 2Q8XA 4D1JA 3CZEA 5D2YA 1XH1A 3ARVA 2WPBA 1PZ2A 1QO5A 3GNXA 1XHGA 3GBEA 6TAAA 1Q6LA 2JQXA 3PAOA 3CASA 2VC5A 1T96A 1ZBVA 2V82A 4QISA 2YL6A 1FCUA 1Z69A 3RLUA 1XFCA 3DG3A 4OBSA 2YYUA 1IWAA 1NP0A 2J8FA 1Q6DA 1QW8A 3TZFA 1JPDX 2OG9A 3NPVA 2E09A 1JJKA 3LMYA 1B30A 3STGA 1I75A 5DXXA 1TPVA 1NF0A 1F74A 2OLSA 2WHJA 3ZXWA 2DT3A 4OKDA 5CZTA 3BC9A 5D2TA 1V6VA 3B9EA 2Z2BA 5CSUA 5BYWA 3P14A 4MWAB 4YTQA 4AZBA 2RDXA 3F4WA 5I5RA 1S5MA 4AC1X 1Q6CA 4UMCA 1E6ZA 4JICA 4UTJA 3OTRA 4UUIA 4UMAA 4MKNA 4S23A 2EO7A 5IXEA 1MW2A 1D2KA 3O1NA 3MVTA 5EFDA 2XVLA 1TO3A 4Z1AA 3GH7A 4WXZA 4HCDA 1G1YA 2YFNA 4DWSA 1NARA 2OZ8A 3GG0A 5JVLA 3GQYA 2BASA 4LUJA 1ZJBA 3PANA 3HA1A 1RD6A 2RAGA 1JGMA 3W9ZA 5E93A 4LY8A