2DIJA

Complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLFDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Structure of cyclodextrin glycosyltransferase complexed with a maltononaose inhibitor at 2.6 angstrom resolution. Implications for product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dijA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dijA01
3FKUS 1EJOH 1IJ9A 5ICZA 3EUUA 3CFJB 4TVCA 5E9DB 1KPRB 4AH2A 2JK5B 5CJQL 3QWQB 4PJIB 1SM3L 2G41A 5DFVC 3CPUA 1YYLL 3M8OL 1MQPA 4TPRH 4OTXH 2L4OA 4Y19E 3M7SA 3B2UD 1J0ZA 5FIEA 1N6QH 4I13B 1LD9A 3HE6A 3UYRL 4W8LA 3UBXI 4JE4B 4XP6H 3TPUB 2DD8H 2NXYD 1HXYA 3CSGA 4HGWA 3WEMA 1OGAA 3QUYC 4L9LC 1P7QA 2D31B 4OCRL 5ICXB 1OP5K 2JFEX 4KVCH 4PJ5E 1N8ZA 3DO7A 1EHLH 1XCQA 4M6AA 3QO0B 3ZHLA 3SHSA 4X6DB 5F44A 2AEWA 3QBTB 1C16A 2DJSA 2JCCF 1S7SA 4UIMB 1CFSB 3B8SA 3HZ3A 2AERT 4XX1E 4FMKA 6A3HA 1FVCA 5TDNB 3V4UH 2IBZY 1MFCL 2JJTC 1L6ZA 5AZEL 1DQJB 4OUEA 4NHUB 4ZO8A 4OZIF 2IANA 4RGNC 3RWCA 2X89D 1VFFA 1HQRA 3EYSL 2XQBH 5M95B 5E5UB 2DAVA 2CKNA 4YHIA 4U6VL 2AXJA 4PR5B 3ET9F 1GPOL 2DQFB 3HAEG 1VPOH 4EJ1C 2OP4H 4JO4H 4GO6B 2ORBL 4Y4HC 4PMXA 3RCNA 3H9HA 1MNUH 1TDQA 1UADC 4LCCB 3TT3L 3LRHA 4P7OA 5HYSA 4GKSB 4JLRB 1CFTB 1RZJH 5CZVH 1WTLA 4R96A 5E2WH 5F3HB 1CL7I 1DBJH 3OX8A 1A6UL 1J0KA 3P0GB 1HQ4A 4UNUA 4J3WA 4X98A 3FQXA 2QPUA 1A3RL 1RPKA 5C07D 3BAKA 4JDTL 3UTZA 4OUUB 1PDKA 1ZHNA 2FL5A 1T7YA 2ADIA 5EBWA 2DBLH 5JUVA 4HK0A 2FGWL 5DRWB 3LMYA 1DEEB 4FTVE 4NQEB 5DC9B 1VFOA 3FZUD 3UTSB 2NY2C 4I0CC 1H4PA 4LF3B 4YPJA 4MA3B 1HN1A 2IBZX 4PRPB 5HHXL 4BH8B 5BZWB 4DM2A 3CLEH 1AGCB 1WNOA 5DVOA 3KPTA 2WVTA 1W2VA 1I1AB 2XWTB 1BFOB 4NRXA 5D1ZB 5KSUA 5FL0A 1RZ7L 2PI6A 5EFIA 2JCCA 2XT1B 3DRQA 1HXJA 2ZSVA 3OR6A 3QNXB 1XD1A 1FGNL 2OJEA 3FB8A 5BXFB 1JPFB 4NO3A 4C57C 4HUVB 2B31A 1HXMB 4M80A 4ISVB 2XJ7A 5T1LB 3VG0L 1KLFA 1WWBX 3MBEC 3WIIH 4FQXD 4F37K 3HUJE 4OZIA 2OZ4H 4Y4FD 3RY6A 5KN5B 2LABA 1AXSA 2Q3ZA 1OD8A 5AYUH 1TJGH 1ORSA 4GAGL 4P2QB 5C0ND 5TE7H 3B9DA 4RGOL 2GHWB 5FYJE 2EJ1A 4HBCL 4MA7H 3I2CL 3EJZC 1MLBB 1S9WB 3GJFH 1RFDL 4EVNB 1MXDA 3GJFA 3WD5H 4WSJA 1CU4H 4GRMA 3CFBB 3TVMC 5LGJB 3BJLA 3IDJA 2WHMA 2DTMH 1FN4A 4JN2A 5E6ZA 3PABB 5IQ9B 2BFVH 1P69B 4HWZA 4TTDC 2Q8BH 5ITBL 4M4RA 1T5XA 2X4RA 1NGPL 3GHEH 3IFLH 4HQQL 1E0VA 2HT4D 3RDTC 1A6PA 1MW2A 3CVHH 5C0IB 4HWEL 4X80L 2OL3B 4RQQB 2NYYD 4FQCH 2YC1A 1U30A 5EN2B 2NY6D 3HG4A 5FA4B 1JMZA 2YD8A 1NGWB 2E3ZA 1I9RL 4GG6B 1IEBA 1J12A 5FYLE 4XXCC 4HJGB 4GLRI 3U5YA 4KK6C 3C6LD 2D24A 1NUGA 4ETQA 1XC6A 2XQYG 5CPQA 5IHSA 3DV4B 1TTFA 1UKSA 4LSUL 5CIPA 3V6FA 3GIZH 3LKOB 4WNQB 2AJUH 2NT0A 1NCTA 4Z76B 4AYSA 1Q6DA 4LFHG 4LLUB 1NANI 3RWFB 2MCPH 1BLIA 4R90H 4L1DA 1X7QA 4ZXBD 3KLAB 5A6SA 3OAZH 1P1ZB 4ATWA 5DUBB 1YC8A 4JFFA 3ZKND 4PUEA 5FYKU 3FFCD 4JFZH 1OGBA 2NY3D 2JJTA 3X14B 3ZOAA 2E27L 1I9JH 2AXHA 2EDDA 4EI5A 1KWKA 1C5DB 2PW1B 1YEKH 3QZWA 5HHPB 1OT2A 4YHKL 3CPLB 2FBOJ 2FJHA 1U8OB 2VLJA 1JHKH 4MTVA 3KWWA 3OB0K 1DANT 4Z7WE 5CKGA 1Y6MR 4U1LA 5JTWA 1JXJA 3FQRA 1WEJL 2ZWZA 1S7WA 2IH3A 2YWZA 3D39A 5F7EL 1LE9B 1CR9H 4TVUA 4XZBA 5BZDA 4X6BB 1G9MC 1W3JA 1AGFA 1DDHA 1UJ3B 2VXUL 1CWVA 2BJMH 4FFZH 2Y36L 3VH8B 2W0FB 3ECQA 1M4KA 4L4VD 3VD9A 3LEVL 4RGMB 4OCYH 1EDTA 1LLOA 1CZ1A 2FGLA 4JPIA 1FL3A 4XCYA 2ZUYA 3FCTA 5FKPA 1RZKH 1NOFA 1U33A 4GQRA 1GH7A 3IXAB 2XNAB 5DUPH 3WUWG 1P7KA 4JO2L 3DI3B 4IPNB 3S37L 5ADOH 1RHFA 3BPCB 4S1RL 5IHLB 3AREA 4CCEA 1CT8B 3BKCH 2YUXA 4JFEA 1HWGB 1OM3H 3TCXA 3QIWC 1SJEB 4PRNB 3ROOB 2A1WL 3GJEB 3QJFA 4QRSA 2E5EA 1IGTA 3PHQA 4PJCF 4UAOB 2ZX5A 2BNRA 3MBEA 3V0AC 2XWJB 1P2CB 2GJ6D 3N1FC 4K3DL 2AABL 3VFNB 3WUEA 4QYOA 2F7QA 5C07E 4G8EA 3IGUA 3ZL4H 4LKCB 1TIUA 3NGBB 4PGDA 1CG9B 3GXTA 5FOBA 3NBNA 5LA0A 3TVMA 3WS6C 5EO0B 4AG4H 1VFUA 4XMLL 5IV2A 4BELD 1DQDL 2LV4A 2X09A 4HLZG 4FFVC 4MZ2A 4Q9CA 1F90H 3QDJA 4L3ED 3KLKA 4MQXC 3DRTA 3EYQC 3DV6B 4H2CA 3DIFA 1BAFH 1L4IA 2AEIT 5SX5H 4FHBD 4ZUUA 3GBMH 5E8OB 5ICYA 1O5DT 4N5ED 4HWBH 1UYQA 2AK4D 3G5ZB 3DYMA 4HWBA 5D2LF 4HPYH 4LSPH 1PZ2A 1Q0YH 5ENWB 4PREA 1CK0H 2WZIA 4L5FL 4YH6A 5E08H 1MIML 4YXHH 4DUWA 5H94B 1TVNA 3TN0D 1M6OB 3LKPA 1CE1H 2GK0A 3EYFB 3GSXB 3MRNB 1WF5A 4POYA 1X1NA 4MAYB 3KYKL 3MFFA 5GZNC 4ZYKA 3TTSA 1P9MA 1A9BA 3GHBL 1KJ3L 3NACL 3SCPA 2B4CH 3NIGF 1Z0NA 5CSGA 2PTTA 4M4PA 4J6RH 4JJ5A 3W38A 3T4AA 4U4BA 4Z0XA 2WW5A 4DWHA 1TR1A 5CEZH 5DJXB 4PJCA 3NMEA 4BFGA 5F7MC 1H3TA 1C08B 1KGUA 1A6VH 4KWUA 3NPZB 4ZOCA 4OFYA 4KMQA 4NZFA 4OFKA 2YHGA 3HZYA 4LU5H 3SCMC 2XN0A 4M43H 1NJ9B 1I8MB 2VN4A 5DO2D 3W25A 4TRPL 1FJ1B 3RZCC 4FFYH 4YDKH 4M61B 4P46D 3G6JB 4LCWB 4NC1C 1R3LB 1IFHH 5MP6H 1MWAB 5JIKA 2PCPA 4MJ5B 2WVSA 3J8F7 3FB6A 4NKIH 4OV5A 4UNIA 2ZUSA 4PV9B 3OKLA 4QCFA 4NO5B 3RVWD 4JO1L 1BPLB 4GW1A 1QD0A 4OT1L 5D2LA 4IRJC 3U46B 4K3HA 1QPKA 4CD7A 5BXRA 2BMKB 3B9KB 1DVFC 5EC1A 1T6VN 4ZTOL 5HDBF 4TULH 4QTIH 3GMQB 3VXRA 4X4ZA 4HUXA 3SKMB 3H3KA 4UIKH 4JHWL 1IEAB 2I60L 3MLZH 2BDNL 3FFCE 4NQDA 1OVZA 1MCWW 3CFJA 5CUSL 4UILH 5HDOA 2XTJD 4HJ0D 5E9DA 2HJLA 2JK5A 4MCYB 1CGXA 4OF0A 1UWTA 1AC0A 2E4TA 4NN6C 3T3PF 3V0WL 4Q74A 1MVYA 1MCDA 1NAKL 4JN1H 4WJ5B 5SWZB 4PMOA 5GRYA 3QCVH 3WH6A 3TPUA 4FQJL 5LWYH 2R1YA 3ZYJA 5A6BD 2YR3A 1AMYA 5ICXA 2XVPA 3F7YB 1UKQA 5T1KD 3SO3B 2EXYC 4NXSA 4FQLL 1UR4A 3VKKA 1UR2A 5B22A 4UIMA 3F7RA 5F1IB 1ETZB 4KXZI 2QMKA 2Z8SA 4K3EL 2I9TB 3G5XB 3U0WL 5TDNA 1BEYH 3WS6A 3HG1B 4DK3A 1W8OA 4NHUA 4HU0A 1DWFM 1OQOA 5CSUA 1BZQK 3BKJH 3GRWH 2VDQH 4URTB 2CJUH 4X4XB 3GRWA 3CMOH 3RGVC 3MCLL 5FEBA 1GZPB 3G5YA 2VISA 3RY4A 1A02N 1ZLSL 1CGVA 4JG0H 4MXQD 2FIRT 3DSFH 3RWHB 1Z9MA 4MA8L 5BJTB 1H0DB 2V3GA 3RAJL 2P44B 4Q9QH 4LCCA 4LHUA 1XGQA 4KUZL 2Q8AL 1RUML 5KBNC 2MOVA 3RM8A 1T22B 5HVGB 5DSCB 1QNOA 1R46A 3W9DB 5FF6A 4W84A 2V3FA 4PSPA 3TTQA 2YPLB 3WSQL 1ZMYA 1G7QB 4OFIA 4OUUA 2AAAA 1DTUA 1DWAM 4X83A 5AYBA 3ARDC 4LASL 5A16B 2XN9D 2GJ6E 3BEWB 3NFNB 1DEEA 2NY0B 4NPYA 15C8H 3TH4T 3UTSA 1H0GA 4UOQA 4RBPH 2ESVD 2DYPD 4GG6F 4LF3A 2E8ZA 5F6HJ 3TYGL 5C7XH 1KR0A 4RFEB 4PRPA 4P8VA 4YPGB 4FZ8L 5BZWA 1AGCA 4RMWA 2LQRA 3VRLE 4OFPA 4KJWD 4EAMA 3IFNH 2O93L 3QUKA 2JELH 3G08B 3MJ9L 5IFHH 4KRUA 2R0WL 1B4JH 4HFUL 2R2BA 3WQVA 2ITDB 3OV6A 5BXFA 2E7BA 1JPFA 4HUVA 2XXMB 1HXMA 4XZUB 2D9QB 5F7FA 4BSWB 3OPZH 4ISVA 4OCLC 4LVNB 3MV01 5T1LA 3JWOL 5GRWA 1F3JA 3K1DA 3SDDC 3ZJKA 5KN5A 1HZHL 3DX6B 3CZ8A 4G6FD 4PTMA 5EWIL 1INDH 3MRMB 3QI9C 4P2QA 4WCYH 5DJDA 5TQ0H 1K3ZA 1KCUL 2XWDA 3SGEH 2MPAH 3WO3B 3WKML 1OINA 1CEOA 1KLUB 4JFDD 1CENA 1L7TH 1BQHA 4PJEB 5LGJA 3UTTA 5T5NG 1J8HD 2FWOB 3FFDB 4CGTA 5JBEA 5ADPH 2W0KA 1DVFA 5IQ9A 2MCG1 1P4BH 1U6AH 4P7RA 2C3VB 2BY0A 4QWWC 3G9VA 2IFFL 3TH2T 2WCSA 4P2RD 2KDGA 4LMQI 5IUSA 4JRXB 3T0DA 3K80A 1XGPA 4PTUA 2ZSWB 2OL3H 2OL3A 1CDJA 5HI4D 4LCYB 1FFPB 3ZHKA 2WBJC 3REVA 5EN2A 2DS4A 1NGWA 3CSYA 4RIRA 3IFPB 4GG6A 1JWUB 1FA2A 1UZ6F 3VW3H 5HI3C 4H04A 4MXVF 5C0CA 3N0PB 3QR2A 3LS5H 1SJXA 4U0RC 1YUHA 3GI8L 4WI3A 4XP6L 1OSPL 2YEZB 5F7WC 2C9AA 1WQVT 2HTKD 1ZA3B 3LKOA 2YDQA 4QDMA 1R5WB 3WV0A 2ZG3A 2Y23A 1IM9D 2APTA 4LLUA 4K9EL 5D5ME 5DFWH 1WDSA 5HGDB 4CNIB 5F96L 1JL8A 2A9NL 5HY9A 1IC5H 3KLAA 4WI2A 3NZHH 5E4IA 2QBWA 4L8DA 5DUBA 1MJJB 1T1WB 3I50L 2WCAA 3X14A 1UA6L 1K8IB 4JDVA 4CN4A 3THCA 2EH8H 1W0YT 5AZ2H 4EOWH 2IGFL 3CPLA 1F13A 4LPTA 4R3SB 5MEQB 1OB1B 3RGVA 5TQ2H 4WK9A 2XTJE 4N8CL 1GOIA 2NTSP 1LE9A 1OTUD 1YZZA 3JV4B 1CDYA 1MNUL 3GO1H 3GBEA 1E6NA 1KJ2B 2G5BB 2PUQT 4X6BA 1ZT1B 4KJYB 3ULVD 3T0ED 3MLWH 1UJ3A 5ESVB 2G5RA 4NBYB 5FL1A 5AAWA 4WHCA 4Y2DD 2EPKX 4HX1B 2W0FA 2HVJA 4YXLL 1NEZB 4ELKA 3VFRB 2O61B 2VVSA 3ARDA 4HT1H 3WMCA 2PKDA 1DCLA 3K4DA 4M5YH 5KJRH 4FS0A 5JBFA 4PJDF 1WZLA 4PRID 4N68A 1BFNA 3IXAA 2G75B 2XNAA 3HG2A 2WANA 1BFSA 5CWSB 1CLOH 2EDFA 5T1MB 3BPCA 4LPYA 3V5KA 3R8QA 2C3XA 4Z5RB 2BSRA 5EA0L 2E9WA 4DQOH 1OTTD 4CW1B 2HFGH 4NZTH 4UQ3A 4QY8A 2BSSA 2Y06H 3LS4L 1SJEA 3VRIA 3KPMB 4X6EB 4Y4KD 4PRDA 4NT6A 1JGVL 2EIDA 4ZD3L 2F18A 4PJFF 4Q2ZB 3ARTA 3DYOA 5EG6C 2EKSB 1HHHB 2VLME 2D7NA 4WFGD 2XWJA 1FG2A 3VXTA 2YDSA 4W8AA 1I85C 5EFFA 3VFNA 3D5OF 3QI9A 1AR1C 3ZKXB 5AYUL 1YPZE 4LKCA 2F8OA 4P8WA 3OLEA 4MD5A 2XN9E 1YY9C 4N0CC 4QHKJ 5EO0A 2K9UA 2XFXB 3TO4D 4YC2C 4DVBB 2ZX9A 2DTML 2B7DT 4LEXH 3QO1A 4W86A 4RE4A 3ZDYF 4H8HA 2FGZA 5DRNB 3RUGB 1FNGB 2BFVL 2P5EB 2DMCA 2GJZB 2V9TA 3DV6A 3EDFA 4I3GA 4OLVH 3ZJ8A 5GS1B 1IKNA 5D7LA 2Y72A 3SCVA 2F7PA 3MOQA 3LQAL 5E8OA 4O2CA 4GAFB 2VKWA 2I5YL 3L7FB 4F2MB 3G5ZA 1I7UB 1KACB 5LG1A 1U8NB 4PJDA 3TBVB 8FABB 1HSAB 1Q72L 5ENWA 3W0WD 3FB7B 1X5KA 4NGHH 5I23A 1TQCB 5FXCH 1HWHB 4K71B 5J8OA 1V02E 5FUOH 1AXTH 3ZE2E 2DQDH 4MHHG 3CZGA 3GSXA 2EDYA 3MRNA 4MAUH 4NWTL 4P9HH 4RISL 1QRND 3LRSA 2WSPA 5E6IC 3HPJA 1Q0XH 2W59A 2PBGA 4MS8D 4X0VA 1AP2B 1P4IH 1AI1H 4M48H 5LGKA 1EO7A 2HN7B 3MXWL 4OUOA 2ARJA 4PJFA 4WO4B 1A2YB 4RA3A 5DJXA 4R90L 1E0OB 4JFDE 3HZVA 5T33H 2V5MA 4OCMC 1I8LC 1E4LA 1J8HE 4WV1B 3WY4A 2NLJA 1FYHB 5HVFB 2E6QA 5FO7B 1JZ5A 2F15A 3BISA 1FP8A 4DM1A 4R4NC 1OW0C 1C3FA 2ZCLH 3BCDA 4XCNA 2V7HB 4WEBL 1NJ9A 3PV6B 1I8MA 3EOAB 1AFVH 1G7IA 2YLAA 3NIYA 4M61A 4DGVH 1XGZA 2BNQD 3P30L 3QG7L 1LNUB 1MWAH 4IHOA 3ZDZE 3IFOA 3Q3GB 1RU9L 4MJ5A 2O9RA 3L4UA 3EO1B 4EN3D 2ZOXA 4BZ2H 4QT5B 1PYWB 1Q38A 3EHBC 3HR6A 5B38B 5D7IB 2ZIDA 2CGRH 3U46A 2CXGA 4JJHA 2BMKA 3F62A 4C4KO 4J8RA 3AOFA 1CIDA 4CU6A 1KV3A 1A22B 3GMQA 1N6UA 3SY0B 4HTYA 4PLOB 1XIWB 3F7QA 3SKMA 1R3HB 4KDVA 1IEAA 4RMTA 1X5XA 4X9HA 4FQ2L 2YK1L 5JNYB 3WHE1 4Z7WB 4MCYA 4ZG1A 1T0PB 4QXUH 1VSCA 3HI5H 5IHBA 5DK2B 2HVKB 3BWUC 4WJ5A 2D1ZA 2CRIA 3MRBA 3R8BB 5HHMB 2BVDA 1WISA 4HEME 3NTCL 1U92B 4M5ZL 4AZ7A 4F3FB 3F7YA 4ZOBA 4ZPVB 3ULVE 1LO4L 3MXVL 3T0EE 3VFTB 3DVNB 4JKPH 5C0GB 3N85H 4NKDA 1DN0B 1G7LB 3GZKA 2D7TH 1QLEL 1IGYB 4OGAD 5MERB 5IB5A 4ONFH 4L4TD 5F1IA 1ETZA 3FT2A 2I9TA 4POZC 3W0KA 1GQKA 4R4FL 4PG2C 1E40A 3CMGA 1S78D 3HC4L 2YSSA 4PRIE 3WXVL 3BH9B 2EYSB 4YFDB 5JUEH 1F90L 2C1PB 3LKRB 5EU5A 4HIIB 1MCQA 5BXTA 2KH2B 4PBGA 3GDBA 4U33A 1IKFH 3U9UB 4H0HB 4LX4A 5FM4A 3CZFB 4WHYG 1MUJB 2P24B 1H0DA 3K7UA 3V6OE 4HWBL 4PJEF 4AY1A 4QF1B 5IHZB 3QQ9D 3BAIA 1KN4L 1T22A 5HPOA 5DSCA 5M94B 1FZOB 1FO0A 5C6TL 5IGXL 2E6JA 1HHGA 4AC1X 1AGDA 2YPLA 1KB5A 5IF0B 2XY1A 5JDJA 1IRAY 1MY7A 2HLFD 4WFGE 2NX5A 3EMCA 1FSKB 2DDQL 5FHBH 5A16A 1F4YH 3BEWA 4AWEA 3VFOB 4O02L 3AIBA 1JGEB 1JRHH 5DK0B 2NXZB 1EA9C 3MV8B 4J6RL 3GNMH 4FXLA 1LDSA 3P0VL 4LDEB 3G9AB 2Y5TA 3H7LA 3QIUB 1VBUA 3EOBB 3K2UH 4OI7A 3H54A 1N4XH 4D6GA 4LAQL 2GDUA 1LMKA 1WIUA 2OMBA 3G08A 4I2XE 1OW0A 3EBVA 4JAMA 5DJCB 1HKMA 3SPVA 4TUFA 1Q9LB 1I1CA 4LU5L 3FN0H 3MNVA 2GIYA 4M43L 3VWJD 3JUZA 3MUY1 2E3VA 5FIPA 1GOWA 25C8H 1MELA 4XZUA 4BSWA 3OF6A 4YUEH 1GZQB 3LY6A 4G8IA 4DAGH 3KR3H 1OSEA 3BT2L 4FQXB 5I8CA 1FC2D 5EBLB 3KPRD 4LGPB 4ODHL 3IVKB 4LPWA 3MRMA 1HL8A 1G9ML 5HJ3B 4WI4A 4UT6L 5EU6D 5CXPA 2V9QA 2NNAB 4CL7A 1KLUA 2DB8A 4ZFFB 4PJEA 4ZUSA 4KVNL 1WWAX 2FWOA 1V03A 3AC0A 2C1OB 4LFHD 3P4MB 3L95A 3T1WA 3PL6D 2V3EA 3SDYH 1AR2A 2K7QA 3SCUA 1JNDA 1CZ8L 2E9BA 3KYOA 4Z9KB 3IJ7A 1I1FB 2FD6H 2IQAB 2VH5L 1T0MB 1RK0B 5GGTL 1CBVL 3FO2B 2V17H 3MLZL 5JA9A 1YJDC 1NC2B 4LCYA 1EXUB 1O6IA 3CFKA 4ERSH 3EDJA 5CCKH 2H26B 3IFPA 1S46A 1JWUA 4HG4J 3NN8A 2ZUWA 3E8UL 4JVWA 2UY7A 1QNPA 5J13C 3POHA 4ENED 2HKFL 4XWGH 1QBMH 3DVGB 1YEJL 4MHHI 5GS0H 4WFHE 2CKBB 4W7UA 3JWDC 5F6IC 4R7NB 4XI5C 4M00A 3KLHC 3VFMA 3SCNA 2CK2A 1EHAA 4PMUA 2BY1A 1GW1A 4O2EB 1MYRA 5HGDA 3CO4A 5HGAB 1ACZA 1T80A 1B2WH 5ACZB 1J1PL 3O6LL 3VMNA 1K8IA 3CLFH 5KOMC 2R23B 1TNMA 1C5CH 2P1YA 3O6AA 5DJ8B 3FMGL 2VDQL 5F70A 2VQ1B 4U2YA 3P40A 4YE4L 1NLDH 4P48A 4Y19A 4ALAL 4P5TC 5FA3A 1RJCA 3DDGA 3GMOB 4PJ9D 4PRHD 3X11B 3ZR6A 2R9HC 4YDVB 5I1EH 1TXKA 3PWLA 1KJ2H 2QADB 1PJ9A 3RWEB 5JXAH 1L0PA 1KJ2A 2G5BA 4KJYA 4FK9A 2UZYB 4PJ5A 4XCCH 4YLQT 5DF0A 2XA3A 1UENA 1WJ3A 4QKXB 1CPUA 3AHZA 1KXVC 4K23L 2FECL 2IH1B 4S1DD 2KQNA 2XA8L 3QHZL 1FL6B 1NEZA 2DKMA 4NO0D 3VFRA 2O61A 3BUDA 1WLHA 3S2CA 1NMAL 4UBDC 2QHLA 2G75A 3HUJF 4YDLC 5I15L 5HHVL 4L4TE 1DFBH 4WUUD 1T1ZB 3VGAC 3N1AA 4R4BB 4OIIL 4TOYH 3AY4A 3SDXE 5I76A 3M6DA 4B5EA 3OKYA 3P11H 1UXWA 4BS0A 3HE7D 3VE0B 3ALFA 3QFJB 4W6WB 3UZEA 2YIHA 1PPIA 3KPMA 3A67L 1KN2L 3Q1SH 3QCTH 4X6EA 1DSFL 5DC4B 5EU7E 1MHPL 2UYLB 4Q2ZA 4MXWL 3F4VA 2NXYC 2EKSA 1C8QA 1HHHA 4S0SD 2VERN 1OCWL 5E6YA 3RU8H 5KW9H 4D6EA 5K9OB 2AJ3B 3T0XA 1QG3A 2PWFA 3WSUA 4AZHA 3U7YH 3STLB 4FTVA 1NARA 4UFLA 1NCCL 4MB3A 1W2PA 3TH3T 1VKXB 4LLVA 3TOPA 2XFXA 1ZL1A 3WQ5A 2VDPH 2J47A 4KRLB 4U6HB 4KPHL 5CJ8A 3WKZA 2OR8A 5IHRA 1EAPA 5DRNA 1U6AL 5IEKB 2GJZA 1RSFA 4U1JB 3Q0HA 1CF8L 3IJHA 2D20A 4E8DA 3PWPB 4LIQE 2I25N 4G8GB 2VITB 3L7FA 2YFOA 1E43A 4FNQA 1MOEA 1I7UA 3F7VB 1W72L 1U8NA 1MPAH 8FABA 1HSAA 2ALWA 4AK1A 3HUJA 4XVTL 3DHJA 3MNZB 2PO6D 4JREC 5FYJH 5D1QD 3WCYA 4YX2H 1RJLA 4HXBH 5I74C 5ID1B 5EC2B 3CC5B 3A6BL 5FUZL 5T3XD 5ESQB 1KBGH 1NFDE 1JTTA 3KPRE 4N0YH 1CS6A 3INUL 4Z7WF 1AP2A 2ERJC 4Q9RH 2HN7A 3BFOA 3CH1B 4IMKC 3FZUC 4F15B 2EDEA 3MMDA 3SE9H 2J3SA 1IMHC 2XY2A 4RAVB 2F1AA 1UJTA 5A6KA 4WO4A 1A2YA 4XP5H 2ICCA 1A1MA 4G6JH 3OAZK 1N5AA 4P7LA 4M3KB 4KUCD 2BVPB 1DE4B 5D7JD 4PBVC 3H3PL 1ISXA 2VDNH 4XC3H 3QSKB 2WWDA 5EULV 2JJUA 4ZUWA 2EH8L 5AZ2L 2V7HA 3PV6A 1RV6X 3DMMB 4U31A 3EOAA 4OJFL 4P5TA 5E5MB 4G9DB 5A6JA 4W88A 4M93B 3CUPA 3UR8A 5A8OA 2ZOLB 4HLZH 4PP1D 4UQAA 1Q94B 2IEPA 5HDQH 3KL3A 4ZMAT 1A6ZB 2DM4A 5A2LH 3WQWA 4Y4FC 2ZWYA 3Q3GA 4XV0A 3L7EB 4QHNB 1MCRA 2GJJA 1RZKC 2NQCA 4LCUA 3EO1A 4ZNEE 3QDGD 4TSAL 1XR9B 3BUTA 5C0NC 3VXPB 1LWJA 3MLWL 4QT5A 4B41A 4ZUTB 4HIXL 5D5MB 5EO1A 2E8YA 4M9PA 2X9XA 4KHXL 5IG7B 3PZUA 2MQCA 3VI3E 3SY0A 5BVPH 4W4OC 3QUMA 4M1DL 1R3HA 4LSQH 1E4WL 4JFWA 1MAMH 2OLHA 2HT4C 4HW6A 4M7ZB 4XCFL 4BZ1H 1CLOL 3FAXA 5LAXB 1BHGA 2DLIA 5JNYA 2VRKA 4Z7WA 2XTJB 1MJ8L 4ETYA 3L5XH 2NY6C 1SYVA 4XNQA 2WW8A 5BO1L 3BDYL 4P5MA 1T0OA 1JTPA 1EAJA 4K8RH 4LPXA 4Y16D 1INQB 4PRHE 3NSNA 3C6LC 5DJ0B 3U83A 5DD0H 1E6OL 5L8KB 1U2YA 4XVJL 4ORGB 3FRPA 3B9VA 3RIAF 5I1LB 4F3FA 2H2SD 5I79A 3HRZB 4BYHA 4ZPVA 3KLLA 1H3PH 1E6ZA 2X2HA 5C0GA 1DN0A 2XN1A 1G7LA 4RMUA 2XKNB 1AIFB 1IGYA 2DWEB 2BY3A 4R8WH 5DURD 4HC1L 4ZXBC 1E5JA 3NA9H 1MFAL 3ZKNC 3QHMA 3QQ4B 3BVNB 4DN4H 2NY3C 5D2NC 1FH5H 1RK1A 3BH9A 2EYSA 1BBDL 4BM7A 2X89A 3ZHDA 4EIZC 4WUUE 2JB6B 4TUJB 3LKRA 4HIIA 4ODBD 3WN6A 1JDCA 2EACA 5BXSA 5KVDL 3HNSL 2FX7H 4WGVB 3U9UA 2BVEA 3EYUL 2P24A 2QQLH 3WNLA 3VWKD 2XWEA 4JR9H 1TCRB 4NQVB 4QF1A 5IHZA 1MCOH 1I8IA 5JMOC 1NDGB 2ICWI 3U57A 2B4CC 2O92A 1HHJB 3L5IA 4PJ8D 3A24A 4J4PA 3O11B 5I1JH 5FHAL 1C1EH 1FDLH 2YN3A 4F8TA 5C07A 1WWWX 4U1KB 1YPZB 4QGYA 4GI6A 2G3IA 4NIKB 5H37G 2G3MA 4Q0XL 1CICD 4TSBL 3WHXA 2XN9B 3WDQA 4PS4H 5DI8A 2H8PB 4LNRB 5J0BA 3STBA 5DK0A 4NZCA 3PZ9A 1PSKL 1NCAH 2RR3A 3U7WH 2YD6A 3A6OA 4HXAH 1BG4A 2VO5A 4LRNH 4IEFB 3MUJA 4R97C 3QIUA 3H53A 1V6UA 3EOBA 4AISA 4KH2A 4S1SL 3VI4E 3RKDC 1U2HA 3HR5B 1LK2B 3ZMRA 4D0CB 4AZ6A 4UOZA 1XF3B 4B0MM 1IAIL 5E2UL 4XMKH 4NRRA 4UDUB 1FFNB 1Q9LA 5IBLD 1CD9B 1GPFA 4Q6IB 4ZAKC 2JALA 1GZQA 3CUHA 1DBMH 3F5JA 1EBPA 1QBBA 2YPKB 4FQXA 1Q9OB 3LXCA 2F53E 5EBLA 5FYKD 1FE8L 1U3YA 3IVKA 3CJJA 2KBGA 4MA1C 3TNNB 1DWIM 5D8JH 3ZYZA 4I0PB 4UV7L 4GXPA 5L9DL 3IETB 3SUTA 4BQBA 2NNAA 4P9MH 3UC0L 4KJQD 3WH5A 4YQXL 4W70A 5D71H 4CU7A 4ZFFA 4JFDB 4L8CA 5KVGL 2C1OA 1VB9A 1J8HB 4FABL 1QACA 3MLVH 4IIQC 3N04A 4JG1H 3DGCR 4LLWB 4I3RH 4KK5D 5I1AA 2YPVH 4KQ4H 2IQAA 4RDQG 1B6UA 1RK0A 5D1XD 4AEIL 1A3LL 3FO2A 3CBWA 2I26N 3PHAA 1NC2A 2VN7A 3FQWA 4N5EC 1G0DA 5ERWA 3QDHA 3PUCA 4IOIB 4NRYB 2DQTH 5GHWL 3GMPB 3L5HA 1F58L 4O58L 4K2UH 3GXMA 3CU1A 3LB6D 4AT6B 1GGIL 3TN0C 2DKSA 2R4SL 3OG2A 2A6DB 3SCRA 1H9VA 3DVGA 2R8SH 2Z92A 4EDWH 3W24A 2D9CA 2CKBA 1YNLL 1T83A 2YUWA 4R7NA 4UINL 5IOPB 1MCSA 3LRGA 5C08E 5IB2B 3AU1B 5I66B 4O2EA 1IM9B 4YHPB 5HGAA 1CD1B 3OKOA 2OR9L 3O6ML 4ONFL 2FBJL 1V3HA 4Z2JA 5A2BA 3BW9B 3FFCA 4J28A 2GJRA 5D2NA 1GQJA 1DQTA 4H0IA 3CSPA 5DD3H 1J9YA 2R23A 4F57L 4HS6B 2BRRL 5DJ8A 3GSRB 1R0AH 5D9NA 2EQDA 1G1CA 4XPTH 1G9EA 2AGJH 4HF5L 4NFDA 5DO2C 5LGHL 1PEZA 3GMOA 2IPKA 3DSNA 5JO5B 4FG6D 4K7FA 4MJIE 3OKKB 3RILA 4YDVA 2CPCA 1J0JA 3GBNH 4GXUN 3RWEA 2Z91B 4P46C 2DOCA 5J6GA 5GIRB 2X05A 2WIMA 2D7QA 3VRLF 1FO0L 4TX6A 4KK9D 5J9PB 2IH1A 3E2HB 3MJ7B 2AOSA 2A9ML 2PTVA 1KB5L 4UV4L 1EDQA 4ACYA 3ZSTA 4XPBL 4UT7H 1GHSA 2QQNH 3JVGC 3QAZB 1CLXA 2CEQA 4Z7VB 2F8XC 4LLYA 5C0EB 1YN6A 3VIPA 3CFCL 1T1ZA 4E41B 5ALCL 2IJ0C 4R4BA 3MZTA 4NM8H 4P2OD 1C12B 4OAWA 1DUYB 1T2JA 3QG6B 4PYHA 2WB5A 2HH0H 5T1DL 4HJ0C 3VE0A 1NBQA 3ARGD 1N4XL 3LD8B 1EEZB 3WE6B 1WSST 3CUIA 1MCNA 3B2VH 2ED9A 1GHFH 1UWGH 1UH3A 5DD6B 1U2CA 2EXWD 3V52H 4MJ4A 3WNKA 3WFCH 1XH0A 2FATH 3KR3L 2AJ3A 1HE7A 2GJ6A 1RIVL 1GC1C 1IC4L 3SQOH 3WN5B 4JZOA 1MXGA 3O3DB 4KAQL 1I7ZB 4FQHB 5T3ZD 2DSVA 2BX5A 2BOBB 3NVQA 3V8CA 4HK3J 5IBUB 4OGXH 1IGJA 1KENL 4U6HA 5TPWH 4IM4A 3REWB 3H9SD 5IEKA 4L3EA 1WKYA 4CMHC 4I2XB 3TA3D 4P23D 2X6MA 2DEPA 1QFUL 1II4E 2KKQA 4C83A 3MA7B 2B1AH 1EFXD 4EBQH 1TTUA 5GPRA 5D5MF 2DDXA 4MNGA 3FONB 2ZG1A 2V17L 3KLSA 3F7VA 3AMLA 1KCVL 3MLUH 3S96A 2IAMD 1UHVA 1G7JB 2UWFA 5CINL 4W8BA 5B8CB 4J3TA 3THDA 3MNZA 2R0KL 3TN0A 1E4JA 4OZGE 3VG9C 1ZS2A 1HI6A 1C7SA 4AXNA 4M7JL 1CFVH 5E2VH 5FYKE 3HMWH 4H5SB 3VXSD 5DJZA 1YECH 3CH1A 5DGQA 4YHYC 5IKCA 3TC9A 4BUGA 3MOAL 4HA3A 3K0WA 2GITB 1H5VA 1FLTX 5C3TA 1HF6A 5JPNA 3UYPA 4I18C 3HCVB 1DE4A 3V5DA 1BAGA 3OTTA 2XGIA 3CH9A 1AKJB 4MNKA 1FNEB 3S3PA 1V7MH 4KJWC 4HMCA 4IRSD 3CDFA 1J87A 3MRGB 3LHPH 2LAGB 2NR6D 3EFFB 3C60D 3U7BA 4PB0L 2MKWA 1HNGA 1UZ8B 1UGNA 1WV7T 3VSUA 1DUZB 5IQ7L 2AEPH 4G9DA 5E2TH 3WNNA 1Q94A 3CVIH 1A6ZA 4H88L 4C54A 5TFSL 4P46A 5I1EL 2DQIH 4DKAA 3IAPA 4H25B 5CPTA 1NCDH 1N5YH 4XCCL 3V4PH 4D6HA 3OR7B 1A7PL 1XF4B 1S7RB 5D5MA 1UM6H 2IWGA 4E5XB 3MMEB 3MS8A 1BGXH 1S7VB 1BIHA 5IG7A 1UASA 1F11B 1WZMA 1XT5A 2WVVB 3VXQB 1ZTXH 2EPOA 1KIUA 1NLBH 3MJ8A 4ZDHB 1IC7H 5D9MA 3L3JB 5JR1L 5A2KH 3ILQD 1W8NA 4J1UB 5I9QC 5LAXA 5ABDE 3KGRA 1YPZF 4QHLB 5HI4C 1MCFA 3H42L 5B39B 1WAAE 3BRDA 3VGDA 3U9PL 1VA9A 5E9AA 2YBUA 4Z6AT 1D5IL 2VNCA 5IR1B 4M7LT 1B6DA 3EYPA 5FUCC 1VERA 3UP1A 2P8MB 2AAVA 1MJUL 2NZIA 1PW3A 3I9GL 4GINA 3OJVC 4ORGA 4OZHE 4U2ZA 2XG4A 5GS2H 5I1LA 3UZQA 2ENYA 5A6BA 2HTKC 3VSTA 4NUJB 4ODSH 5F9JB 2YKLL 5T1KA 3VIFA 4NN5C 2HJFB 1VGKB 2Z0BA 1LP9B 1MRDL 1AIFA 2XKNA 4PTTB 3BMVA 3ZO0A 2DWEA 4RSVA 4XGZB 5IMLB 2YJQA 3A3HA 3AYRA 1J1XL 2VLRD 2V5DA 1ZOXA 4J7RA 3WO4C 1AQDB 2JIXB 5HPCA 1ADQA 3BVNA 5L2JB 1R3KB 3ZE2F 1WDPA 3VNZA 1AXIB 1KPVB 4F7EB 4XAWH 3BAEH 5A69A 2X4UA 1RY7B 1KF9B 3SGJA 3N17A 3VFVB 3IS0X 1GOFA 4MAVA 3N18A 1NMCC 4XTRD 4EUPG 3W6MA 3RY5A 1U8LB 4J3VA 3OZPA 2HFTA 3D5HA 4B3LA 1PX4A 1OTUC 2XZCL 5HHNB 1NBVH 3UTQB 3O6FD 1GNXA 1NDGA 1HHJA 3BP5A 3W39B 4U3HA 4WY7L 4Y2DC 2EEDA 5EIQA 2X44D 4YX2L 4U1KA 1BYDA 4HXBL 1FHGA 1YPZA 5BMFH 2JEPA 2Z93B 2ZUQC 4IOFD 2XN9A 4QLRA 3VVGA 1JMXA 3OGRA 4KRPD 1CGTA 3JWDL 4G5ZH 5F7DA 4U1MB 1F97A 3AFBA 1CLYH 1JIBA 1E3ZA 2ESVA 5T3ZE 5EIIA 3IYLW 2UVFA 3S5LG 1CLZH 1JI1A 3DROB 4AIEA 3HR5A 4YIQB 3OKNB 4PLKC 3ZTJG 1XF3A 3BGMB 4S10A 3CK0H 1OTTC 2X4PA 4XC3L 1LDPH 1URLA 4UDUA 5A3ID 2IMNA 4KY1L 3ULUC 3BPNC 5IFAH 4ZOAA 4Y4KC 3VWJB 4ZFOA 5FYLL 4M82A 1V02A 5DJ6B 4Q6IA 1JAEA 2YL8A 3L3KB 4HAFA 5CGYD 3O2DL 4RAHA 2V5SA 2YPKA 3RVTD 3GIVB 4X7TB 5HHOD 5I71B 5L0QC 2WQ8A 3UBXA 3WL9B 4QRQA 4U6XB 1NFDB 3TNNA 3OJMB 1B2YA 2YLLA 3U4BH 5I6XB 3BSHA 5ALBH 3IETA 5ABHA 2DQUH 1EVUA 4NZJA 5JHLH 3MANA 3TCLB 4W4NA 3VMOA 1X6NA 5I8EB 4JFDA 4FNRA 1SEQH 4EZMA 1T1YB 3TO4C 1KB9J 1J8HA 3MO1B 4YZFE 4OQTH 5C09B 4P57A 3VA6A 5JLZB 4I5BB 3QHFH 5BVPL 3QUML 3N50A 2APBA 1I3UA 3ULVF 5B21A 4LSQL 2E9LA 2WUBL 4N8VG 4KTYA 4UU9A 4QRRD 5JZ7D 1IM3B 4RGND 2W67A 3EDDA 5ISZD 3MNWA 4IOIA 4XPAL 3L5XL 3FTGB 1TLKA 4JPVH 4LVOB 1Y7VA 5IROC 1UA7A 3BQUB 1EFQA 4AT6A 1GOKA 1A14H 2OXGA 3LAFA 2EEXA 4N90D 2A6DA 2WMIB 2VTFA 3BZFB 1RZFH 2AV7B 2VXQH 3G04B 4GS7C 2F19L 2VDKH 4AYFA 5IOPA 2GDVA 4MS8C 4S1QL 5IB2A 4MB4A 4LRIA 1RZ8A 1DBBH 5I6SA 1IM9A 1MVUA 4LBEB 3F12B 2F5AL 2ESCA 1RURH 4XC1L 4HPOL 2FB4H 2FRGP 3PDOA 3BW9A 4HH9A 4RFOL 4U7MA 2DH3A 5FGRA 3PZOA 3EDKA 4U1SB 5DRXB 3GSRA 3ES6B 2UZIH 5GGRY 1UWUA 2CD0A 1MFDL 3D69B 5ELIA 4YN5A 5GGVY 5DLML 5JO5A 3JTTA 4PJ9B 4PRHB 1BFVH 2DBJA 3OKKA 1PEWA 4XVSH 3U36B 1KYOK 2NY4D 2P5WB 1P84K 2QQLL 4FZEH 3LN5B 1N64H 4G80B 2J74A 2ZCHH 5GIRA 1J1OL 3ULVH 1IGIH 5BRZB 1C93A 3T0EA 4EN3C 3SE3A 1PZ3A 4D3CH 4QRUA 1JAKA 3MTRA 3MJ7A 3N1MC 4NQCE 3CAFA 3QH3B 3BE1L 4HD9A 1JCKA 1XZ0B 1I8KA 3LEYH 3MV7B 5ACMA 3T2NL 4Z78B 1OAZL 3O2LA 1CGUA 3O9WB 3KLDA 1IZJA 4PMZA 1GCFA 5HGBB 2ZX7A 4AIUA 3EJZD 4PRIA 2VLRE 3GSNA 4JGUA 4KI5D 4GRLB 5DD1H 1U95B 2RBLA 3WEXB 2LTQC 3U7WL 4HXAL 1A5FH 2J4WH 1NC4B 1DUYA 3QG6A 2AK1L 4OF3A 4OLZH 1E71M 3H8NA 3HC0B 2WZPD 3D3VD 3T4YB 2ICWJ 3R1GL 2FEEL 1EEZA 4CVUA 4Y7EA 1I3GL 3V6OA 5KVEH 4DJMA 1UWXH 4KZDL 2APFA 3OGCB 5CGMA 4V2CB 1G9HA 1GAFH 3RDTD 4Y4KA 1JHTA 3VD7A 3DARA 5DD6A 2E7HA 3X13A 2ZXBA 4P8UA 1MF2H 2JCCE 1MIEL 2GUOB 4QTHB 2NT1A 3RKPA 4Y88A 1DBKH 3CXDL 1RVFH 1G0XA 2BC4A 35C8H 4GSDH 3AXHA 4K94H 3OG4B 4NQSB 1IILE 4KK6D 5GGRB 3L9RB 3WN5A 3S35H 2IQ9H 5JMRA 1NBYB 4OGAC 2NW3B 3EYVB 2W60B 4FQHA 2WMPA 4LVEA 4GI9A 4K68A 2BOBA 3LQMA 1AD9A 5KVFL 2ADGA 3TT1H 4TVPH 1HKLH 3TO4A 5TDOB 2P8LB 4FMVA 2WXDM 5EORH 3REWA 2VXVL 4I2XA 4I3RL 5IVOA 1JUFB 3MI6A 3D1MC 3MA7A 4Q7NA 3K4ZA 2DWDB 4WIWA 1RUQH 3ZM8A 5EU7C 4D9QE 1HIMH 3BMWA 2Z4QB 3IGAA 1FNAA 3N1PC 3SKJH 2RB8A 2VABB 1JWSA 2D0GA 3QQ9C 5E0CA 1G7JA 2AXFA 3SKOA 2F53B 2J8UB 5B8CA 2R0LH 4AZBA 4JFXA 4ZFMA 3RJQB 4DGYH 2DQEH 2PO6B 2OI9B 2HLFC 2PXYD 5HHOE 2V3DA 3QPXH 2Q8XA 3S8WA 2CKBL 1MHEB 1Q9KA 1N82A 1UYWL 1QLFB 1TQTA 1V3KA 3BRFA 3II1A 5ITFB 1E4XI 3X3GH 3ZTNL 4MQTB 4FFWD 3TV3H 4MLIA 3SGDH 1LQ0A 2GITA 5DHYB 4LVHC 2J12B 4Z2IA 4WI9A 4ESKA 7FABH 1GORA 4UFKA 2HAZA 2JB5L 4OD3H 1AKJA 4H20L 2QMJA 1FNEA 3T0AA 3X3FH 5TF1L 1UG6A 3EFFA 1BZ9B 3KG5A 1GGTA 4RFNB 1MCLA 1UZ8A 3VGBA 3SJVB 2WHLA 1MW0A 3FQNB 2FLBT 5CP7A 4XPTL 2O9PA 1B88A 5C0AB 3QWRA 4EQ2A 4QRRE 2YXMA 1R24B 4RGNE 5D93C 3WBAA 1ZVYA 3O2VL 5ISZE 5DEZA 4ACZB 4P99A 3SDXF 3QIWD 3AHYA 1D9KB 1FC1A 2PYFA 4H25A 6FABH 3GH4A 4X7CC 5IK3A 4KC3B 3OR7A 5C08B 4N9OB 4N90E 2EDJA 1CFNA 3ARBB 1XSIA 4E5XA 1HOCB 3ZE1E 3MMEA 5FAAA 1V5JA 4X7DC 2YMXH 2X4NA 3AZSA 1QYGL 4YEEA 2QQNL 4U6TA 3IDYB 1F11A 5IJKC 3SURA 4AQOA 3PL6C 2XQYK 1XCTA 4G6KL 1E1FA 1MCHA 3PWJB 2C4FT 3MA9L 3TWCH 2K1MA 5HYJB 3BSZH 3I6LD 3VXMD 4J1UA 4D6CA 4DZ8B 2QF8A 4MCZB 3S4SB 4QHLA 2X2JA 3BUQA 2PR4L 5B39A 3S88H 4MJIB 1ECEA 2F5BL 1GGBH 5I5RA 4XB3A 4F80A 3AUVA 4HKJB 1WBZA 5IR1A 2WAHA 2N7AA 4YK4C 2NSXA 2P8MA 1JWMB 2OR7A 3PZGA 5LBSH 4M6MH 5CGTA 4ENEC 3EJRA 1S5IH 5CBEB 3IKCB 4CD5A 1X5LA 5F9JA 1HJUA 2Y25A 2Z31C 1QO3B 1NFIA 1ZS8B 4LSVH 2HJFA 4JB9L 3L4XA 1VGKA 4TXEA 1ACYL 1RUKH 3EFDH 3OAUL 1OAXH 2Y24A 1UR0A 1DL7H 4XGZA 3TJHD 1P6WA 1UWEH 5C2BL 1U41A 1AQDA 2JIXA 3QEHA 4L4TA 4DO6A 3GNPA 5GISL 1FNSL 3O3BB 1X5ZA 5L2JA 1R3KA 2VDRL 4PBXA 3SDXA 4MDOA 5IIEB 1KPVA 4OGXL 1RP8A 2EC9U 3DX7A 4AMKL 4D71A 2I27N 1ZV5A 4HIJB 4KI5E 1RIUH 4JZJC 3VFVA 4QXGL 4KZEL 4K71C 1AO7E 5E1HB 3K46A 1FQ9C 4YNYB 3WEOA 1FGVH 5FCUH 3PN8A 2FYYA 4PY8J 1UD6A 3FOMB 3D3VE 3BXNB 1F6LL 1YQ2A 7TAAA 3F58L 1TVBB 4TUKL 5IB4B 2HLAA 4R7DA 5I1DB 3UTQA 3QOMA 5EBMA 3SCMD 1RZGB 2WP3T 3OAYH 4HZ7A 4PGEA 1BGAA 1ZHKB 3ZQ9A 4PCTA 1EHNA 3RZCD 3WUZA 1DQMH 4JM2B 1QFWI 4S1DC 1LF1A 4UI2A 2FE0A 2Z93A 1H3WM 1MQ8A 1UB6B 4N42A 3I3EA 2FX8H 3KPSD 4U1MA 5JPMA 1FYTE 1MJ7L 1YMHA 3QUXD 1BSIA 1Z5LB 1RPQA 4LLQB 4CCCA 1E73M 5JIWA 2OX5A 1DLFH 4QLKA 3CLWA 1B3XA 3PQYE 4YIQA 3OKNA 2J6EH 3HE7C 3KPQA 2J6EA 3BGMA 4NX0A 4UT9L 2CUMA 3GSQB 4ZO9A 5IWLA 2JF7A 3GKWH 5I3DA 4BQ8A 4OJYA 3VWJA 5CEYA 3VI3F 4YHOH 2OQJB 5C0JA 3L3KA 1YN7B 4OZGB 4YHNB 1D5XB 3WS3A 3U7VA 3SE4A 3WL9A 4NM4H 1NFDA 3KPRA 4U1GC 4WEMB 4Z8FL 1R7OA 1W0WB 3C8DA 1T6WA 3GSUB 1NCDL 1B0GB 4YO0A 5I2UA 1U93B 4GAJH 3WBDA 2WHKA 1YYMH 3O6KL 1T1YA 1V0NA 1OAYH 4L8SB 1R5VB 3MO1A 5JLZA 5GSRB 2PF0A 1TPXB 3P77B 5ILTH 5IJKA 1C90A 2PWHA 5JOFA 1EUTA 5DXWA 2P7TB 4KHTH 1M1SA 4X9FA 1EEQA 1Z32X 2HRLA 4M7LH 2WMJA 2CO6B 2VRAA 1NLBL 4EDXA 2BHUA 3NH7H 1L7IL 4TSCH 5E95B 2CKRA 1Y18B 1SFSA 1CNVA 1T2QL 1N7ML 3TA9A 1RMFL 4J3OC 3RI5K 4YHZH 1REIA 3MLRH 3VDHA 3FTGA 4WEUD 3WIFA 3UG3A 1HJXA 5IB3B 3C2AH 3TZVD 4F9PA 5DA0B 3QHNA 1JN6B 2XG9A 1A64A 5J11C 1F8TL 4ZNEA 4EI6A 3AMDA 3T08A 5D1QC 2WMIA 3BZFA 4IDJL 4YGVB 1AH1A 2AJXL 1NUDA 1NSNL 4ZOEA 4DVRH 5FECB 3UJIH 3CIQA 1FZMA 1TJHL 1U3HD 3ILPB 3VXOB 4PMVA 4OGZA 4OF8A 3RPKA 3WXWL 1GC1L 4LBEA 4G3YH 4X7FC 1ZA6B 5I1GH 3F12A 4HCRH 5GRVK 5IT2H 4HCRA 3QUZB 4FMFA 1H11A 3MMWA 4UB0L 5L2KD 1ADQL 2X4SB 4PV8B 1KXQA 1DP0A 1NCWH 3UO1H 4NI3A 3ARVA 1PKOA 4OBSA 5EZOL 4U1IB 1T20B 5DFTA 5F1NB 3A4AA 3MBXH 4HOZA 3U4EA 3ES6A 3I6LE 2JJWA 2XM2A 5C92A 2F54D 3QIBD 4PJ9A 4PRHA 1U42A 1SM3H 3U36A 5M7QA 2DSUA 3FT3A 1YYLH 3LN5A 5F72S 1OAQL 4OZHB 4RMQA 3VI4F 4ZO7A 2FO1A 5JXED 4HA1A 2IXVA 1BG9A 3KNBB 1MEXL 3QH3A 4OCRH 2ZUVA 4PG9B 1XZ0A 4GBXB 4NO0A 4Z78A 2EDBA 3JV0A 5IEHB 2Q6WA 3TFKC 2SEBB 3O45B 5DRZA 5HYQA 1KLGA 5HPMB 4G5ZL 5HGBA 1EJ6A 1NGYB 3TIDA 5DYOA 2PYEB 3GI9L 3OZOA 1CLYL 1U95A 4WUUA 1NGQL 4HKXA 1IT0A 4LDOB 1NC4A 4HP5A 5AZEH 4UNTA 1JVKA 1A4JB 2F74B 4NQUA 3RVVD 4AZ8A 4B53A 4AD4A 1U8MB 3EYSH 1BQLL 3OGSA 3GMLB 3HE7A 3VDAA 1JGLL 3ARGB 4NZDA 4XAKD 1E6PA 1G7HB 3HN3A 4U6VH 2X2YA 1GPOH 1DANU 1VFMA 1KUMA 4Y16C 4FNPA 2ORBH 5SX4I 4ZFOL 4YDJB 3TT3H 3DWTA 3P9LB 4XHQA 2H2SC 4DWSC 3UDWA 5ABGA 3CDYA 5K9JL 5HI3D 1A6UH 3IAQA 4NQSA 1JYVA 1B30A 5GGRA 3L9RA 3K8MA 1A3RH 3RJYA 3U4BL 3HRPA 4JDTH 5ALBL 4AEHL 3EYVA 2W60A 2JJSC 1KPUB 3O3EB 4NC1E 1UT9A 1QNZL 2FGWH 4HFWA 4OQ1A 1JNHB 2YD5A 4Z7QE 4KROD 1T4KB 5TDOA 2P8LA 5DQ9A 5J6HB 3KPPA 4IS6A 4CN1A 4MNQB 1FLRL 5FK9B 3DJ9A 1E0WA 3QHFL 2FEDD 2MMXA 3WH9A 3QXVA 3N9GL 4R26L 4R27A 1S3KL 5F9WB 1IVLA 1RHHB 2B8OT 4K7PY 3S36X 1RZ7H 1GGUA 2A38A 1BWWA 3K3QA 3VWKC 4MVBD 1OSZA 1E15A 4ACPA 2VABA 2XPGB 1L6XA 4RL3A 3CFIC 2ZUTA 4M6OL 1FGNH 2F53A 4PJ8C 1C7TA 3EOYG 4UTAL 3BOVA 1ITXA 4RX4D 2PO6A 3VG0H 1HDMB 4YBLB 3GUTB 2CR6A 5CEXB 1KCKA 1CL7L 3A6CL 1MHEA 3ARFB 1CICC 1TFVA 4GAGH 1W9XA 1QLFA 1YDPB 2Q3AA 1U58B 4P4KD 4RGOH 5ITFA 4N8PA 4HBCH 4KDTA 1BM3L 1KQYA 1DBBL 3BWAB 1RFDH 1SVCP 3EYOB 5EIVA 5I0DA 2BOCA 1RURL 2ZICA 5D7JA 5SWSD 3MLSL 1OHQA 3MUIA 3MRPA 5J06A 3MREA 4NSKB 5CHNA 4DTGL 5ITBH 3HPLB 3QEQB 4NRSA 1NGPH 1BZ9A 4HQQH 1EQCA 3L4WA 2HTLD 5DO8A 5EH1A 5IBLC 4K7PX 3C5ZD 3QNYA 2YL9A 2F9BT 1NCNA 2H32B 4H7VA 4XBGB 2WC4A 5ICZB 1R24A 3K74B 5I30L 4MDJA 4XP4H 3AM8C 3BH8A 2ZNWA 4AH2B 2WYSA 1I9RH 3MODL 1S9VA 4IBLT 2OTUA 1RUPH 3ULVL 1LD9B 5CJXC 1WZ1L 2AMGA 1TVDA 4C56D 3BCFA 3RIKA 4D3CL 1HXYB 1E27B 3ARBA 4BKLB 1XF5B 1OGAB 1OL0A 2DKUA 4KJQC 2VCBA 2UWEE 1PY4A 3HI6L 1VFAA 1CGYA 1J01A 1N8ZB 3A4WA 1XCQB 1BWMA 1JPGB 1C16B 3UROR 1JZ6A 3X12A 1S7SB 4JQXC 1W1VA 2XKUA 4KK5C 3GSNL 5K59F 3FXYA 5DD1L 4AZCB 1YY9D 5D1XC 5J89A 3DX2A 2WUCH 4ZQKA 4W5UA 1C5BL 3S4SA 3UR7A 4MXVE 4DN3H 4E0RB 3MCKA 4MJIA 1HQRB 2V5CA 2N56A 4YHKH 2AJYL 4HKJA 2F54E 3O4LE 4ODTL 3A5VA 4Y16A 3LB6C 1WEJH 4TQEL 3MRIB 1JWMA 5F7EH 1ERNA 3O0RL 4WFFD 4TOQA 2OSYA 3UG4A 3H9HB 1IAIM 2DMKA 3CDGA 3BUPA 5CBEA 3IKCA 2E9IA 4NQCB 5T5NF 43CAB 1OD7A 5HYSB 3A47A 2VXUH 1QO3A 3SIMA 3NZ8A 4R96B 2Y36H 2J4GA 5D72H 4MJ6A 4X98B 1D5ZB 2LU7A 4H41A 2JJSA 3UTZB 4P4RA 1E6RA 1HXKA 1ZHNB 4NYLB 3C08L 2ADIB 4K55A 3O3BA 5EBWB 1HT6A 4S3KA 4APQB 4HK0B 2AI0H 5IIEA 4OZGF 4ORZC 4F79A 4KMTL 4KKLD 4HIJA 4JO2H 4JKKA 5GJSL 3S37H 4YNYA 4HZ6A 5LVEA 1EGJA 5DS8A 3RVUD 1FH7A 1HJQA 1QI0A 4S1RH 3FOMA 5GRXG 1BTCA 1VHPA 2IGTA 4FG6C 4MGXA 1TVBA 4NRXB 5KSUB 3VWKA 5I1DA 2JCCB 2PTUA 4LQFL 2MTPA 4P8XA 4E4PA 3DRQB 4R2GD 2V2TA 1SBSL 1Z2KA 3MLYL 3W9EA 3P4OA 2BCKB 4IJ3C 1ZSDB 4JGJA 4JM2A 3RBGA 4PJGF 3T8XB 2EPLX 1QRKA 3NCOA 4ODUB 2DLEA 3MRDB 3P9MB 4H26A 3TIEB 5GRUL 4HBQA 5IHUH 8CGTA 2QV4A 4OZIB 2J8HA 4K3DH 4EK7A 2MSPA 1CICA 3MKKA 1AXSB 4KRPB 3EZJB 3EJJX 2KL6A 1PZUB 5E8NB 1AE6L 4L4PA 3TO2B 4TTGA 4LLQA 5F9OL 3TV3L 3T0WA 4LHJB 4P2OC 4CKQA 2DSWA 4XMLH 3IDJB 2DM3A 1Z9OA 3MGAA 4XNUL 1IE5A 2X4TB 3GSQA 2GCYB 1K9FA 5D6CB 5KSAD 2X4RB 2A3HA 2XHYA 2OQJA 3VH8G 2D3VA 2EADA 3NIDE 3JBG7 4JVUA 2EXWC 4OZGA 1DQLL 3QDAA 1EGZA 5IFTA 4L5FH 1D5XA 1MIMH 3ELAT 1IEBB 4X5LA 2VX5A 1W0WA 3VJ6A 3GSUA 2VC2H 2MKLC 1WAAF 1B0GA 3KYKH 4A6YA 1RAMA 3QB7C 3W81A 4L9LB 3QUYB 5CIPB 1KJ3H 3BLBA 3NACH 4LSRL 4X5XB 4JHBA 2A6JA 4L8SA 1R5VA 4G9FD 5GSRA 3P77A 4N1HB 1VDGA 4NNXA 5TJWK 4XRCB 3N15A 1R47A 2CIPA 4BQ6A 3TA3C 4P23C 4I1NB 3PHOA 5AC4A 1J10A 1CYGA 5SWSE 5D1XA 3GK8H 3MACL 3B5HA 4POZD 1CFBA 5FM5M 4UQ2B 4QRRB 4RGNB 2LFGA 2DQGL 5ISZB 2IAMC 4BK5A 4TRPH 2FJHB 2Y1VA 3KWWB 5CSBA 2VDMH 4U1LB 2NY7H 1FPTL 3FQRB 1S7WB 4YGVA 3D39B 2ICWB 2BXYA 4Y4HB 4ZTPL 3BC9A 4PGJA 4Y5VC 2OYKA 3H0TA 2VZVA 5I16A 5FECA 1B3YA 1D3CA 3U48A 3VXOA 1NKOA 1AGFB 1DDHB 4LSVL 4Y7MA 5D9SA 4C56E 3BKYL 2XV6B 3EFDL 2RFXB 4JO1H 4OT1H 4GW5B 3QUZA 1YQVL 5J7CC 4B7LA 5MEND 2VZUA 2X4SA 2C7UB 4ZTOH 3MLXL 4WWKD 3APGA 3R4DA 4U1IA 1MW3A 1T20A 5F1NA 4WW2C 4JHWH 5DQDH 2NR6C 2NY2B 5JBDA 1WAAA 3C60C 1VIWA 2I60H 1M05B 4C59B 2XXCB 4OLYH 2BDNH 5I1IL 2D73A 4TNVK 2ZXAA 4HPGA 5AD0B 5CUSH 4HIEB 3H3BC 1UQYA 3V0WH 4OZHA 3AI0A 1NAKH 4NKOA 1Q1JH 4N0UE 1F45A 3QJHA 5A2IH 4FQIL 4ODWB 2BNJA 4Y1AE 3KNBA 4FQJH 1MRCH 2H2PD 3QJFB 4WFFE 4GQ9L 1IGTB 3JV6A 2GEEA 3D48R 2BNRB 3MBEB 5CS7A 2GAZB 5IEHA 3C5JB 1I3RA 1OGTA 2DJUA 4FQLH 2R56L 2SEBA 3O45A 4QYOB 43C9B 2FX8L 5FYJU 2I24N 3ARZA 2NY1D 3NABL 1CD0A 1KCRH 4BCEA 4K3EH 3U0WH 1X5JA 1AO7B 3IF1A 4P2OA 4PGDB 1ZGLP 1ISWA 3ILQC 5FOBB 3VIGA 1Q9WA 3CD4A 3TVMB 3HB3D 1X44A 5IV2B 2F74A 4LIQL 1A6AB 1U8MA 1GSMA 3GMLA 3D3VB 2J6EL 3ARGA 5FGCE 3QDJB 3PG2A 4RZCA 1G7HA 1KSRA 3SDAD 3DRTB 3HE6D 4YZFF 1W9VA 5HHQB 3RHWK 4LSDA 5EZJA 1ZLSH 2E6PA 4ZUUB 3RDTB 3GH5A 4IDLA 1C92A 4MA8H 3IANA 2H1PL 4YDJA 3RAJH 2VCAA 2GFBB 3EJYD 4KUZH 4L3AA 1RUMH 4PUBL 3SGEI 3EO9L 1TVHB 4NCC2 2BZDA 4PREB 3I6GB 1LO2L 1HHIA 3I02B 4NM4L 1TJIH 2MWCA 4WW2F 1FYTB 3WSQH 2HT2D 2WINA 3VRJA 1KPUA 3NDZA 2BNUB 2GK0B 2AVGA 3ZO9A 4JRYD 4ZFZB 1A9BB 2J8FA 1MCKA 1YYML 3W28A 1R3JB 1PX3A 1T4KA 3PQYB 4NBXB 2VKXA 1H1NA 5EMYA 3ECBB 2PTTB 4JJ5B 3TYGH 5ILTL 3DXAD 1I1RA 2APXA 1W3KA 3AIRA 2HFEB 5CJ5A 4FZ8H 4XTRC 3N11A 3TA3A 4Z0BL 4LHQB 5D96C 3WIHA 2W62A 1ZBWA 2ZKHL 1RHHA 3RNKA 3QEUB 4AQ1B 2XPGA 4HFUH 5DD5H 3O6FC 2AJVL 4DEPC 1NGZA 4M3JA 4MWFA 4FLSA 1QNQA 3JWOH 1GOQA 2D2OA 1I7RB 3GUTA 2G9HA 1A0QH 4IOFC 1UD2A 3ARFA 4Y5VA 5EWIH 5C6PB 4H8WH 1ED3B 2PCPB 1KCUH 5HD8C 4NO2B 3UJIL 4LYPA 3O4OC 3WKMH 3FB6B 3F5KA 2W38A 3BWAA 4I8DA 5JOPD 3EYOA 4G3YL 3MPCA 4JFHD 4HCRL 4LSSL 1Y0LB 5IT2L 1W2KT 2YD2A 1IQDB 2WQRA 4G9FE 3VD5A 5EC1B 4NSKA 3HPLA 3NAAH 2IFFH 4KKCD 3GM8A 4IRSA 3L3DA 3C60A 5A3IC 1W9UA 2H32H 1HCVA 4OF7A 4NQDB 2VL4A 1ZB5A 1LG2A 1N59B 2F61A 2HJLB 5AWNL 1QSFD 2AKRB 5CGYC 1JPTL 3RVTC 4P3DB 4JFUA 1JNEA 3QIWB 1W3HA 1B31A 4KDWA 5TH2A 3GI8H 1V3IA 4TNWK 1HKFA 3FO0L 1OSPH 4F9LC 3P3YA 1E27A 1MCPH 4BKLA 3V79C 1XF5A 2R1YB 3CXHK 3QCUL 1N3NB 3BD5A 2ZCKL 5IVXE 4G7YL 4X4YB 2PWEA 4WHTA 5E70A 1M01A 1JPGA 1WGOA 4K9EH 2A6IA 3LH2L 2ATPB 5F96H 1SY6L 2A9NH 4JGMA 2WZEA 2OSWA 5A6AA 4AZCA 3AIQA 3GXNA 4U1NB 3OJDB 1JE6A 3I50H 1UA6H 2NY5C 3PXHA 1BZ7A 4E0RA 5JZ7C 4X0NA 2O5XH 1QNRA 4UR9A 2IGFH 2GJXA 1A1NB 3O41B 2KZ1B 1YEFL 3M17A 1AQKL 1XFPA 1V3LA 4M7KL 4O2FB 4JVPA 4BA8A 3G5YB 2VISB 5A8MA 4ONHA 4N8CH 5E00B 5IMOB 3D3AA 3MRIA 2FJFA 2Z1KA 1E0XA 5DHVB 3LKNA 1MI5E 2ADJB 2I07A 4NQCA 4LHUB 1NDMB 43CAA 1XGQB 1MQRA 3VIIA 1C91A 2KUTA 2J5LC 3ZT7A 5FF6B 3QHTC 4YXLH 1D5ZA 5GGVL 2AJSL 1UB5B 2VLRA 4JFFD 1XGTA 4NYLA 1XF1A 4APQA 2P43B 3RTQD 1MQKH 3RQ3A 2QKIB 3C5SA 1EMTL 1FV1A 4NPYB 1Y6KR 4EI5D 3CFEB 3U30C 4O5LL 1AHWC 2BVTA 4JZNB 2VLJD 4N9GA 2WWKO 2H3NA 2LAAA 3WDJA 3D2UB 3EOTL 3PGCB 5EA0H 3HNVL 3RWIA 2NY4C 3LS4H 3QUKB 5I17B 4B50A 4TYUA 4GZEA 5D4YA 3SCMB 1JGVH 4ZD3H 2R2BB 4HU8A 2BCKA 1ZSDA 4D1IA 3DURA 1OP3H 3T8XA 1HP5A 1NCUA 4ODUA 4F8XA 1OWWA 2D4FA 5ACLA 3LXBA 3MRDA 3P9MA 3TIEA 1KIRB 2ARJQ 4UUJA 1L0QA 1F3JB 5T3XL 5BW7C 2VR4A 3GEWB 3W2DL 5DJDB 1U8JA 5E8NA 2E7LC 4MADA 3SDCD 4Q9BA 4BQ3A 5AAMA 2YDRA 3IXTB 3EO0A 3TO2A 5JIHA 4KI5C 1HINL 5EPMB 4JRYE 4B15A 5CD5D 4QO1A 4XWOD 1BQHB 3ARED 1BD2D 4IRJB 3UTTB 4R0LC 3BO8B 3IDXL 1ESWA 1T7ZA 1DVFB 4KRMB 2X4TA 3DXAE 2GCYA 3ZE1F 2EYTB 5D6CA 4GI8A 3ESUF 3T2QA 4D9LL 4Z95L 3AFLA 3LQAH 1MRFL 1WT5C 2XACC 4QRPD 3OZ9L 1XGPB 4PTUB 3BP7B 2I5YH 3ZKSD 5JW4M 1BREA 4X5WB 1HWWA 3QXTA 3FOLB 2HMID 3D0VB 4AD5A 3B43A 1NEZG 1W72B 1Q72H 2DLHA 3REVB 4M1RA 4XP4L 3E0GA 3ORJA 3IDIB 4XX1G 3UJTL 2ZPKL 4NN6B 5HHOA 3CSYB 4RIRB 2WWMD 2O26U 3FHAA 4QHMA 1A7NL 5C0CB 1T03L 1XHGA 2XUCA 5INDB 3NPSC 1RUPL 4NWTH 1KT2B 4LSTL 4RISH 1QLRA 1BYAA 5FDWA 1YUHB 3HNTL 4N1CA 5ABEA 5CIPH 4L9LA 3QUYA 4G42B 1O0VA 3IJSB 4X5XA 3OKDB 1MVFA 2E9JA 2VLKE 3MXWH 2VSDA 1DEDA 3PDGA 1CDHA 4XRCA 4F37F 4LYQA 1ULVA 3DUSB 3DDFA 3TTYA 4NCC1 1T7WA 5HY9B 5F9DC 4HS3B 1SJVA 4P2CG 4L8DB 2XTKA 5GNXA 1CQKA 1R34A 5J3HD 4DKFL 3B5TA 2WUCL 4UQ2A 3EIFA 4JDVB 4QRRA 3BZ4A 4DN3L 1A47A 3AZTA 4WEBH 4OM0L 4LP4A 5ISZA 3CZEA 2UY4A 1GJWA 3QA3A 4R6UA 3S97C 3RGVB 2YUZA 1PQZB 5T5FL 3RL2B 4QLJA 4KI5F 3WDHA 1PFCA 5D6DC 3P30H 1QSFE 3QG7H 4Y4HA 2ICWA 1X4XA 4WTZA 4W6YB 2PXYC 1RU9H 5ESAB 2UWEB 1L0XA 1J0IA 3MU7A 1GYAA 5ANME 4FFWC 5D72L 2HVJB 2RFXA 5CEZD 4GPNA 1P7HL 4GW5A 4PJAE 3WJJC 4NCDA 1NUFA 2APVA 4Y5XC 4Q58C 4DKEL 5C0BD 3SCSA 1NWSA 4ELKB 3ARDB 3WD4A 2C7UA 1BIIB 5C86A 4BUHA 5GXBB 4L29B 2AI0L 1E5NA 3GFUA 4OFYD 5ETUB 4H1LB 2DT2A 1AHWA 2W92A 1M05A 2ENSA 1EGJL 4FQ2H 3RKDD 5AD0A 2YK1H 1QHOA 4HIEA 5TF0A 2F54B 3QRGL 3O4LB 1FFOB 3V5KB 2VIRA 3L4ZA 5E4EC 2BSRB 5E94A 4UQ3B 1FP9A 4QY8B 2BSSB 1TVPA 2EIZB 3VRIB 3CNKA 3LN4A 4XNZC 1UM5L 4ODWA 4K07A 4NT6B 4PRDB 3U79A 4G43A 1BP3B 5DMJB 4ZAKD 2Q87A 3AYSA 2G60L 1EEUA 3NTCH 1JRHI 5GS3A 4M5ZH 5JORA 4OI8A 1J11A 1D2KA 1LO4H 3MXVH 2GAZA 1FG2B 3C5JA 1JF6A 3VXTB 4HG4K 5IHUL 3SDDB 2EDOA 5BW7A 2PN5A 1YNKL 1IGFL 4WI8A 3HI1B 43C9A 1T1XB 3QI9B 1QLEH 1VF8A 4NDMB 1AO7A 4HIHB 4MD5B 4HUKB 4R4FH 4Z7UE 5E9DD 1KELL 3HC4H 3WXVH 1EO8L 1A6AA 1TUXA 3D3VA 5LQBL 1FG9C 2GQHA 3QO1B 1INEH 3VXUD 4NF7A 2YRPA 3QXWA 2V6HA 1GIGL 4KFZC 4W6XB 5D7LB 5HHQA 2X4QB 4XUYA 1MHCB 3RDTA 1WCQA 4O2CB 5B38G 3NCCB 2GFBA 1L0YA 3C09C 5E03A 5FKAA 2WBJB 5KTEL 1KN4H 1TVHA 2GT9B 4PJDB 1KXTB 1L9NA 5C6TH 3I6GA 1JNLL 5FYKL 5IGXH 3V4VL 1A7RL 3I02A 2HWZL 5D70H 5DT7A 4XXCA 5CJOL 3ROLA 3AHXA 1FYTA 3E1F1 4U0RB 4XNMB 3TJHC 2VC2L 3NFSL 2BNUA 4A6YL 2DDQH 4GZJA 4XB7A 4HZ8A 4ZFZA 1DBAH 3HG5A 3LRSB 3MCG1 3HS0B 4O02H 1R3JA 3HPJB 1F3DJ 3PQYA 3ECBA 4PRBA 3BPLC 3MX0A 2D7OA 3P0VH 2EYRB 2FR4A 2HFEA 4DOHE 1IGCL 2ARJB 4PJFB 3LN9A 1SMDA 5I24A 4ZE5A 5C0RL 1ODZA 3VIMA 3HZVB 1Z0MA 2X1OA 1BD2E 5FGBC 3OB0H 3KXFD 1EO5A 3IDMB 4LAQH 4LEOB 3QEUA 2NLJB 1RQ5A 3TBYA 3GK8L 4CD6A 2OWWA 2ZNXA 3FRPG 3D85B 3MROA 2OWCA 1ND0B 1ZEAL 4XCNB 4GG8B 4QRPE 1CTOA 1XRVA 2JTDA 4HLJA 3RX5A 4D6JA 1G7IB 4PJHE 1I7RA 1YA5A 3CHEA 2VDML 4KGJA 5EOTB 1JFHA 2NY7L 3BT2H 1NOUA 1JP5A 2B39A 3SOBL 2PXYA 4ODHH 3OXSB 2R2CA 2YA1A 4IHOB 3WFHA 4NQED 4ZE4A 3IFOB 1G9MH 2XPKA 1XYFA 1D7FA 1ED3A 2WAGA 4TN9A 4NO2A 4UT6H 1OARH 3QUXC 5HVWA 3UCQA 4EXPX 4F58L 5ECUA 3VM5A 5L7XH 3P0YL 4Y5XA 1Y0LA 5A1AA 4KVNH 1I1AD 4N5UA 1NGXA 1IQDA 4A3YA 5D1ZD 3GM0A 3O2WL 4J8RB 2ZG2A 2YL6A 2JE8A 4NNPL 4PJBE 1V3MA 1CZ8H 2Q76B 2VH5H 4OLXL 5GGTH 5DQDL 5GGTA 1BFTA 1CBVH 2K7PA 4X6CE 4OLYL 1UQZA 2QV2A 5J1SC 1N59A 5D2NE 4GZIA 5T1LD 1K8DA 2R69L 2AKRA 1FIGL 2CIIB 1LK3L 4OCSL 2P8PA 1WBYA 4P3DA 3QIWA 2X10A 4P2QD 3E8UH 5DJ2B 4WW1A 1KULA 1Q1JL 4UTFA 1MCCA 4OZFB 3MRBB 1RULL 2HKFH 2P45B 1MRCL 5L6YL 2GSJA 1YEJH 1KFAL 2DT1A 1N3NA 4X4YA 1UKTA 2GW5A 1IAKA 2YRZA 4B7IA 3F5WB 2YBRB 4NKDB 2ATPA 4HJJL 2BVQA 5B3JF 5A3HA 1TQBC 4L4VE 5IB5B 5KS9E 2A2QT 5C0BE 1J1PH 1KCRL 3FT2B 4U1NA 3OJDA 3O6LH 1JYWA 3UEQA 4PJ7E 1KTDA 2MFNA 4BQ2A 2J7DA 4YC2B 3O8XC 2YSSB 3DETD 3FMGH 3JUYA 3KZSA 3BRGC 1A1NA 3O41A 5EU5B 4YE4H 3C87A 4Z7QF 3TZVC 3WFBL 4ALAH 1NAMB 4O2FA 4AMCA 4NNYB 5E00A 5IMOA 1XGYL 5EO9A 1HCFX 5DHVH 3K81A 4Y1AB 2AEQL 5DHVA 3PGFL 2ADJA 4ZS7L 1QR1A 4U49A 1NDMA 1X5HA 4AJ0A 3CZNA 2D7MA 1UVQB 5E8PB 1U3HC 4CVWA 2EPMX 2VCCA 1FO0B 1ZWIA 5BS0D 4K23H 4OLUL 1TJIL 5E1AB 2XA8H 2CH8A 1HHGB 3QHZH 1AGDB 1UB5A 1KB5B 4JCLA 5BOPA 1OTSD 2NX5B 2VZTA 5T3ZL 1VESA 1NMAH 4MNMA 5DWUL 5FOOA 5DJYB 2QKIA 3G6DL 5E6IB 3V95A 1G01A 2J7HA 1JHLL 4P5KB 3PGDB 3CFEA 4UQEA 5HVHC 5I15H 4MPKA 5HHVH 1N0LA 4BFIA 4JZNA 5FGCB 1TA3B 4OIIH 4HDIA 2Y5TB 4JPWL 3WIHL 5M5DA 1JTOA 4XP9L 1I9IL 1MHHA 3UX9B 4PJIE 1XR8B 1LJYA 3D2UA 3PGCA 5I1HL 1WFUA 3QIBC 4UFHA 3VXUE 4D0DB 4HS8H 4L3EE 5I17A 3A67H 3RL1A 4M56A 1KN2H 3LDBC 1QBLL 5J56B 1DSFH 4JAMB 3SCMA 4PMQA 3SPVB 1MHPH 5DD5L 5JXEC 1KNOA 3BIBX 3MNVB 5BV7C 4MXWH 4MNGE 1NP0A 3RZCA 3TV8A 1UD5A 2HRPL 1OCWH 2AK4E 1QP1A 4MQ7B 4WIQA 2VT0A 4D6FA 1KIRA 1G9NC 4G8IB 3AB0C 4JANB 2R29L 5I8CB 4J3UA 1A0QL 1ITCA 3THML 3S36L 1H3XA 1KFWA 3AIEA 5E99L 1NCCH 3QUXA 4H8WL 5F7UA 1GHRA 3IXTA 12E8L 5EPMA 3DC0A 2VZSA 4I4WA 5I75C 1FZKA 4IRJA 4CU8A 4J2XA 4ZUSB 5KZCB 4KPHH 3BO8A 1UM4H 1EZVY 3BHBA 3RVVC 3B83A 2X1QA 3L95B 3NCJL 3CHCA 1PG7X 2UWEF 2EYTA 3NAAL 1CF8H 3KYOB 4CJ1A 3F8UB 3KXFE 3BP7A 4UQBA 2VXSL 4X5WA 4P49A 3FOLA 3D0VA 1W72H 3S3SA 1TQWA 5J1AA 1W72A 1CDGA 3HA0A 3IDIA 3CFKB 3RIFK 3PWNB 4YHLL 2D03L 4OOUA 1OLZA 4XVTH 3QXDB 5IW3A 2X4OB 4RWHA 5EOCH 3NN8B 3KDMA 5INDA 1I7TA 2Y7QB 4RAUB 1KT2A 2OYPA 3A6BH 4XXDA 5FUZH 4K7PL 3WDIA 1MCPL 4G42A 4CBPA 3INUH 4OM1H 3IJSA 4NQEE 2EZ0D 3OKDA 2J8OA 1QI5A 4LGRB 2WMGA 1MCEA 4KROC 4BH7B 3VFMB 4WUKH 1D6VL 3DUSA 4PB9L 2FX9L 1ZT4B 4HS3A 2FEDC 1NWUA 4XT1C 4WRLA 3H3PH 4XBEL 2GY5A 5CZKA 4LDLB 3MRHA 2EEBA 3ZKMD 2X9YA 4MVBC 7CGTA 2O5XL 1SBBA 3BUYB 1K6QH 3T04D 1E4NA 3TZVA 4OJFH 4M6NH 4M62L 4Y19B 2EH7H 1PQZA 5FA3B 3WJLC 3RL2A 3AHTA 1HNYA 4MAYD 3EDEA 4NSBA 4HWUA 4ZUVA 3W82A 3PWLB 3EJSA 5ESAA 2UWEA 4F7MA 4TSAH 5F7NC 2HJKA 4PJ5B 5EUKB 2VX4A 4P4KC 1U3HA 4Y89A 3BVWA 1DLHB 4YAQB 2H45A 4HIXH 1OAKL 1LWRA 3VMPA 1H49A 2Q86B 1HSBB 1HNFA 4HAGA 4UQ9A 5L2KA 1BIIA 4NP4L 4OLEA 4KHXH 4L29A 1MQKL 4H1LH 3VGGA 5ETUA 4H1LA 4M1DH 5FCZA 1E4WH 4GXVH 5J12C 2HTLC 1ZANL 4XCFH 5HDLA 3C5ZC 3DI2B 3B9AA 4HWNA 5I76B 3ARSA 2J88L 2V5TA 2F54A 3O4LA 1FFOA 1MJ8H 1UXWB 1OB0A 4PLKD 4HPHA 4LCWD 5BO1H 2WIIB 3BDYH 2EO9A 1MI5B 3JTSA 5J4MA 2EIZA 3GNOA 2AJZB 5IP4A 3ULUD 2WKGA 1SVZA 5D9PA 3BYTA 1E6OH 3RZWA 4MD4A 4XVJH 1QWUA 3DX4A 3T65B 3BKML 1S8DB 4GMSL 4WJXA 1RJZB 3GSOB 3B9KD 3C8KB 3SDDA 1ES0A 1QI2A 3NIDF 1BVLA 3HI1A 5BS0E 1T1XA 2W1NA 4FTVB 4S11A 4HC1H 1MFAH 4HC1A 4YR6B 4P7QA 3TP4A 4NDMA 5KAQG 2X1WL 4HIHA 3L3HB 2EXOA 3MRCB 4LLVB 1H5BC 1KTRL 1UXSA 3BN3B 1BBDH 5IM7B 2ESVE 1J7VR 1EAPB 3L6FA 2E9MA 5BQ7B 5KVDH 2IC2A 3HNSH 5SWZD 3STZA 1IGML 2X4QA 1MHCA 3IJHB 3EYUH 3Q5TA 1ZLUK 4HUWB 3TGXA 2W4XA 1P5VA 3W27A 3GZAA 4D2NA 2WBJA 3RGHA 2EECA 2GT9A 2DIEA 3HUJB 1KXTA 1DZBA 1H8SA 1T7XA 1V05A 4M81A 3T1FB 2B5IC 4FA8A 5FHAH 5CILL 5DT1L 1T5WB 4XNMA 1RJLB 4B9ZA 4P7NA 3VFGL 5J13B 2WPGA 1KEGH 1LO3L 2CIKA 4Q0XH 4TSBH 4JRYB 3HG1D 2O5YL 3HS0A 4KRNA 1E1EA 4F9JA 3D9AL 4RCAA 5F6IB 1X5FA 1PSKH 4KKLC 2OLDA 4PLJD 5JW4R 2EYRA 1IARB 4HZAA 3JXAA 3PF2A 1A1MB 4CVZA 4S1SH 1N5AB 3FO1B 3V9FA 3RVUC 4RE2A 1GGCH 2J25A 3IDMA 1AQ0A 4LEOA 5LA1A 2QQQA 2NY5L 3QDMD 2IUZA 3U82B 5GSVB 1IAIH 5E2UH 4AM0B 1F2QA 1KTLA 3D85A 3L1OL 3NCYP 2WMHA 3S34L 4R9HA 1ND0A 3NFPA 4P2RE 4R2GC 4ZUWB 4GG8A 4MD0B 1CVSC 3WJLA 2GYSA 2MQ3A 4P5TB 4JEGB 3CUPB 4RX4A 3CU7A 2DI8A 2XFYA 3MRRB 5EOTA 5FM8A 1BQSA 3GBLA 1FE8H 2EIEA 3OXSA 1S5HB 1J88A 2NY0D 1R85A 1LHZA 4LCUB 4UV7H 1W1YA 5L9DH 4P4KA 1NWRA 5FUCE 3RM4A 2VLKB 3UC0H 1F42A 1UEMA 4YQXH 4E8CA 5EO1B 3DO3A 5I1CH 1UWQA 5KVGH 5JW5A 3NJ3A 3MUGB 4FABH 5SWSA 2IMMA 1G7MA 5KANG 5DZLA 1KC5L 1K3IA 3GXPA 3QUMB 4YDLB 5KSAC 2Q76A 3MOBL 4AEIH 3VGAB 1GVIA 1A3LH 1CVRA 5CG0A 3C5ZA 3PWVA 4WGWB 1HHKB 4YXKL 5I1KL 2CIIA 4Q22A 2R4RL 2VDOH 1OQXA 5GHWH 1SYVB 4XNQB 4AEFA 2PB1A 2X1IA 1F58H 3HC3H 4O58H 4P5MB 5DJ2A 5LXGL 1U0QA 3S3JA 4OZFH 3ZT5A 1GGIH 4OZFA 1NMBL 2R4SH 3D0LA 1X4ZA 4C56A 2NXYB 4KKBD 3RP1A 1YNLH 4PJAB 3GSWB 4UINH 3H7BB 1LL7A 1I85A 3F5WA 1D6EA 2YBRA 1MFVA 1R5IA 3P2TA 2OR9H 4JRXD 1KGCD 3O6MH 3GXFA 2XFRA 1X6LA 2FBJH 2EE9A 2X8RA 2KZWA 2CDFB 2EKJA 2EABA 3VILA 3V0VA 1JG9A 1WK0A 5AG8A 1H5BA 3LKQB 4ELME 4CMMB 2ADFL 4ZXOA 1W9PA 4F57H 2QLVB 1RK1B 2BRRH 4D1JA 4YWGL 3H9YA 1INEL 4PY7B 1NAMH 4EUPA 1NAMA 4HF5H 3L4TA 5LGHH 4N0UA 4NNYA 3I75B 4KMLB 2IFGA 4Y1AA 3G6JE 2VWEE 4LCWE 5TE4L 4AYGA 1V6VA 4JAWA 5D7SL 5GS0D 1LGVA 3RWDB 3CCHB 2XVGA 2R0ZL 2HA1A 1I8IB 1EV2E 1UVQA 5E8PA 3ULUE 5F71A 1FO0H 1F4AA 4BJLA 1FHDA 3KPNA 5GRJL 4WLCA 1FNFA 4P3WA 2A9MH 5D70L 4JREB 1WC7B 5E1AA 1KB5H 2F8VA 2EDXA 4UV4H 3SE8L 3VDBA 2W0PA 2VLLB 5I74B 5C07B 2OK0L 4XPBH 3E6HB 1JV5A 2Y9RT 1K4DA 1XSJA 1J0YA 4L4OA 1DBAL 5DJYA 5E6IA 4D6DA 4PTXA 3WHXB 2ERJB 3PGDA 4GUPA 4P5KA 4WWKC 5DI8B 1J5OH 5BYWA 3CFCH 4O9HL 1EQPA 5ALCH 1TA3A 5TDPB 2VAJA 5T1DH 1I8LA 3JZ7A 4JO3H 4PPTA 1JZ4A 1XR8A 1F4WL 4XVUD 4D0DA 1BYCA 3ZSSA 1RJYA 2YD3A 4NOBA 4E42B 4F7CB 5SWZE 1EUUA 1BVZA 3IJYB 4WI7A 4LCIH <