2DIJA

Complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLFDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Structure of cyclodextrin glycosyltransferase complexed with a maltononaose inhibitor at 2.6 angstrom resolution. Implications for product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dijA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dijA01
3G6DL 2B1HL 3FJTA 4ENEC 4YHZH 3MRIA 1KXQE 4QT5A 3S4SB 3BP7B 3DXAA 5ITBH 5I1JH 1WE5A 5E09A 2WMIB 2ED7A 1BGGA 4I3RH 5DVOA 5CILL 3TZVC 2X44D 1NQBA 4GXPA 4M9PA 1FAIL 3U82B 4E4PA 1I1AC 2EH7H 2CRZA 4FFZH 1MAMH 4PG9A 4GAGH 3A4AA 3HR6A 4M82A 2CGRL 5FCZA 1PGRB 5HY9B 1S5HB 2D3NA 1EFQA 3U0TB 3LPFA 1QTYT 1N59A 2ICWJ 4JFQA 3DOSA 2PF6A 3RA7L 5FO8B 5JIIA 5DJ0B 5ALCL 3IFLH 4QCEA 5A6BD 5LBSL 2VC2H 1B3YA 2GUOA 3KPPB 2GK2A 3PBGA 5FAAA 5IKCB 3MV7A 2IMNA 2NPLX 4D9QE 4HIEA 2NXYC 1NM9A 4JB9L 1SFSA 1ZEAL 2QPSA 4QEGA 4BZ1H 4RGMB 1JK8A 4AH2B 1UH3A 1BEYL 1F4YH 1KJ2L 4IJ3C 5KVEH 4XX6A 2CPCA 1M1SA 3BP4B 4BUHA 3EJYC 1LDPL 3GNML 4U1GC 1LG2A 4UIKL 2UY3A 1J11A 3DSNA 2NY5C 5I6XB 4OCLC 3JWOC 1RUML 4NHCH 3S34L 1VDGA 2K7QA 1RSFA 5HYJE 5DSCA 2IANB 1V3KA 4ONHA 4FXGA 1Q0YH 3WFLA 1BX2A 2G4FA 1E27B 2NTFA 4KKAC 3BE1H 3CO4A 1G01A 4BSVB 5D1XB 5IVOA 5J9PB 4M6AA 4U6XA 1S46A 1KENH 3CIQA 3KYOB 2C4XA 1QX1A 3ARGA 1HF6A 1JWUA 5GGQL 2Y23A 1VHPA 3BPCA 5BS0B 1XT5A 3VRLF 4W93A 1PAMA 4ERSH 1SYVB 2FX9H 4E41D 4W88A 4FQ1H 4WI6A 3B8SA 4OCXH 2W9LA 3WDRA 1S7TA 3RKDC 2FIKB 3BZDA 1E4XH 3CX2A 5C0BE 4ZAKC 3HAEB 5ITFA 4FQXC 1GC1L 3QRGH 4MA3B 2GJZA 5C6PB 1ZHNB 1LP9B 4PTVA 1EH9A 4P5TD 2HMIC 1H3TA 3ZSTA 3WMCA 3ARVA 4CDGC 3WO4B 1XH1A 4JFOA 1LK3H 2OLHA 1U2YA 5K9OB 2J7CA 3GI8H 3DX6A 4JG1L 3WO3B 4HUWB 1JUFB 4NKMB 5JOEA 3S6CA 5DHVB 5DUBB 5T5FL 4RCAA 2LE9A 4YFLI 5H94B 4HU0A 4XP9L 4M00A 2BY3A 5CJ8A 3QUKA 1GQIA 4RE4A 5FECA 1HHKA 1MCHA 2E9WA 1G6RA 3QAZB 4H1LA 5DJZB 2V6HA 5GRWA 3E1F1 2R69H 1KIQB 4P23C 2XACC 4EANA 5I1EH 4P9ML 2YSSB 1AH1A 4N8VG 1VFMA 3QIBD 3TOPA 4OUEA 3AAZA 5JLZB 3WL9B 4GO9A 3DARA 2DQDH 5TPWH 4IM4A 4AIUA 1H9VA 3GO1L 3PWNA 4DGVL 1ZWIA 5TH2B 3BSHA 2F58L 3JZ7A 4JGUA 1CEOA 4LMQI 2FZ3A 4BZ2H 4PV9A 4PGJA 2EICA 1LILA 3C2AL 5IHZB 2EH8H 3UR7A 4P99A 2EDQA 4AIXA 3IDJA 3C08L 5IR1B 2XVGA 5DHXB 3VRLE 1WSST 2F53D 1N7MH 4YBHA 2C5DC 5C09E 3VFTB 5DFVD 2H32A 3VGHA 1WB0A 4X5WB 4JY5L 1MCOH 3QQ9D 1QHZA 2JIWA 3L3IB 2R56L 3MBED 1BZ7B 1MIEH 2BOBB 1UJ3A 1DLHA 1DR9A 2AVGA 4P46D 1W1PA 2ERJB 4Y5VC 3UZQA 2AXJA 4M7KH 3KS0J 3BT2H 3LQAH 3GSRA 4PJHF 4ETQA 4N9GA 3WUWB 4BCEA 2NYYD 4U6VL 4CUCA 3GJFK 5F6HI 3D0LB 5JPMA 1PFCA 3B5GA 1AGCA 3H8NA 3PQYA 2OZ4L 3VE0B 4LSVL 1K8DA 2B2XL 3U0PB 4K3DL 2UVFA 3QEQE 4K94C 3MOBL 5K9QI 4PMUA 4DVBB 1QI0A 3MR9A 2DH3A 5IJKA 3TJHC 1W3JA 4M48L 4DGIL 5F1NB 5FO7A 1OM3L 3QUYB 5HI5C 4W81A 1QFOA 3PABA 2J7BA 3ZLQC 3C9NA 3WEZA 3DVGA 4PTUB 4GQ9H 1KUMA 1RZ7L 2AJZB 3VIMA 4XP1H 5AZEL 4MAYA 5EZJA 1IAOB 5EOCL 3UDWA 4F7TB 4XPFH 5CEZL 5CEXA 5K59E 5CQ1A 1NC4A 5BCAA 3AS0A 5H8DA 3O2WL 4NZDA 3LZFH 1RIVL 2HT2C 4OLZH 5AY7A 1CD0A 1PBYA 4LU5L 4MQXC 5SWSE 4OF3A 3O6LH 2FBJL 5EBMA 3GSXA 1OLZA 2OYLA 5KSBB 4NZRH 2R0ZL 4MDJB 1P9MA 4X7DC 1QOXA 3SJVE 4C56B 4JFFD 5BJTA 5C0EB 1MHCB 3WDIA 5L2KE 4S1SH 1SMDA 1I8MA 5J1TC 2WHKA 4NUGH 3SPVB 4X4XA 5F71A 1JZ3A 3MUGB 5D7SH 5DRNA 5I1GH 3REWA 1UB6B 5A2JH 4JFSA 5T3XH 2W0FA 1BQSA 4OFVA 5HI3C 3EYQD 1Q9KA 3RGVB 1JI1A 3KPQB 1N6QL 1HNFA 4PBVC 4V2CB 3B2UC 3UO1L 3T0VA 4PJHE 4LRNL 1CU4L 1CYGA 3MJ8A 4K71B 5E4EB 4XZUA 3ZKXC 4G6FB 2F54B 3RWGB 1OT2A 2ZG2A 1AKJA 1E4LA 5JO5A 1FL5A 2E7CA 1EQCA 4PJ9B 3CDGB 1X5HA 6A3HA 1T6WA 4QRPA 2MHAA 2VLKE 1X5JA 4XXDA 1VJSA 5IBTL 1U41A 1Z5LB 4I0CC 1ACYH 4G5ZL 4UV4H 4P4RB 4G8GD 3PWJB 1SJHA 3GSVA 3O11A 1S3KL 5CZXD 1R3JB 1HN1A 2WV3A 3CK0L 3RNKA 4LKXA 1AQ0A 4IMKC 4YC2B 3M17B 4PMRA 4LCCA 2AJXH 1WO2A 1RVFL 1AC0A 3QZWG 4YO0A 1OB1A 4JRYD 3BXWA 4N5EC 3T0EA 1I1YA 4LVHB 5IJVA 4GO6B 1U92B 3JXAA 3O9WA 1E6ZA 4KZEH 4XCEB 1KGUA 4Z8FL 4HKBB 2CHNA 3PL6A 3QH3A 4WK9A 4F9PA 4NIKB 4D6FA 1OP9A 1IV8A 2DQUL 1JRHI 4JREC 3WFZA 2WUCH 3DO3A 3SDAD 1G7PB 3L6FA 2FEDD 2EDYA 1WAAA 2NQCA 3ALGA 1HSAB 3VFWB 5BV7L 3D25B 3BH9B 3MROB 2B7DT 4L1HA 1ZLWK 2NX5A 4RGOH 4EDXA 3AMDA 1RPQA 3RJDA 4X8JB 4UNUA 2OW6A 1JF1B 1J88A 5CPTA 5HHXH 1TZHB 4H1LG 1UCBH 1HILA 4Y19B 1BPVA 4LXFA 4X7CC 6FABH 3OAYH 3QEHA 1ERNA 5HDQL 3U30C 1JZ8A 5CCKH 4WKAA 5ID0B 2VT0A 3FCTA 3LEXB 3HPJA 1AQDB 2Z0BA 2VRKA 1NGQL 3IRZA 4I18B 5E6YA 4AXNA 5C3LD 3UX9B 3C8DA 2EH7L 4PTMA 4PJAA 5I18L 3KLSA 4PREA 3A0OA 5I1DB 4GAGL 4KU1A 4JZOA 5KN5B 2D7OA 3GB7A 2YRLA 3S5YA 1MRDH 1D3CA 2WC3A 5DEGA 1YECL 2J4WL 4Z6AT 3D39E 2X4SB 3D3AA 4M4PA 1AY1H 4PMNA 2DQGL 4J4PC 1XGQB 3RBSA 4PTWA 2BFVL 3EYUL 3DJ9A 2AV1B 3L3JA 5FUCE 4DTGH 1A6ZA 5FYJH 1MNUH 4Z7WA 1AHWA 4ZUSB 1C08B 3CDYA 3SGKC 2X1QA 2WMJA 3ES6A 5TDNB 4L4VB 4YH6A 1G9MH 2R23A 5DJYA 2YWYA 1U2CA 5HHQB 1EZVX 3UEQA 4OLYH 3OF6D 3WDJA 4E0RA 4CU8A 2H3NB 1YYMH 1F4YL 1HXJA 3NFSL 2YDSA 2PKDA 3QUZA 2XZQH 3O3EB 4PJXA 3D3VE 3VWJC 2EYTA 1A2YA 4NJ9H 1JAKA 3RVTC 4GJTB 4NHCL 4F7PA 5D8JL 3X11A 4AM0B 4O9HL 1YYLH 4JQVC 3TNMB 1BQCA 3BGMB 4M7ZB 2NR6D 3MUY1 1C5CL 4PLNC 4GKSA 4ZDHA 3CLFL 1LEGA 1HIZA 4WSJA 4CD5A 2AK4B 1OTTC 2VERN 5DJ6B 4I9WD 1JXKA 4XPHH 4I3SH 2G41A 4NKIL 1MI5D 3MLSL 4XBPB 5IW3A 4TVSa 1BM3H 3O8XD 3BP5B 3E3QE 4EXPX 1UACL 2DOCA 1E4KA 1OTSC 3CFKB 5C70A 3VGEA 1NL0H 3PV6B 3BP6A 2DL2A 2XSBA 4MJID 1INQB 2OTUA 4FQ1L 4PGBA 1TVBA 1JRHL 1J01A 1Q72L 3S35L 5BVJB 4X9GA 1FNSL 2BHZA 4UFLA 1T04A 1TZIB 4J1UA 3KE0A 1L4IA 3BD4A 43CAB 3DUSA 4TUOB 1FFPB 1IAKA 3SDDA 4LPVA 2BXYA 1CZ8L 1SYSA 3L5XL 1S7RB 1EFXA 1JWSB 4ODBD 3KPLB 1WCBB 3KWWB 3WE6B 3MV11 4LAQL 3RTQC 1PEWA 2DDXA 2MPAL 4AW7A 1O7AA 3HB3C 2OP4H 1HXYB 1F3JA 4ZSOA 4ZO6A 2RQ8A 1ZHLB 4NQCD 1AGEB 3ISWA 4MQTB 4XVSL 1K9TA 4J3SA 1HL9A 5E2VH 3RDTB 3O45B 4I2XB 1H3XA 2AQ1A 4XPAH 1FFNB 1HCVA 3NPSB 4HXAH 2YD5A 5EIQA 1J5OL 3PWUA 2AKRB 1WKYA 4PMZA 4P2RE 4U3XA 3C60A 3GMOB 3V95A 5I1EL 2CJUH 1B0GB 4D6DA 1LO2H 4ELMF 3MRNA 2NNAA 2PYFA 2PYEA 3PWLB 3SE8L 2HTKC 1DQMH 3ZYZA 1CECA 1QA9B 2W91A 2BVTA 5DO2D 3HI6L 3NUKA 1IQWL 2PETA 3CMOH 5I30H 5DR5H 1FGNH 2VR5A 3GSOA 3MRRB 5JW4Q 3DBXB 5HVGB 1I4FA 2YPVL 3IU4H 3DTXB 5CSZB 5IB2B 1NSNH 4FFVD 2J7LA 3TM6A 5IVNA 1VB9A 2EDTA 2VL5A 4BZ2L 5J3HD 3OKKA 3WIJA 3O2DH 3HG3A 4PJ8C 3RFZC 4ZFZB 1B30A 2XFXA 2YL5A 4LLUB 4KMLB 3QHZH 4M9OA 2QQNL 5DMGC 3OX8B 5E1AB 3S88H 3OA5A 2KUTA 5C8JA 4QOKE 4QRQB 3GZAA 3U9UB 3V6OC 5F7UA 1ZANH 2IPUG 1RUKH 1I7UB 4FTVA 3TTSA 2ICEB 2UV3A 3HS0B 5AYUL 2FBOJ 1MIEL 1SY6A 2J2ZA 1XR9B 2Z35A 1WWBX 4QP0A 1F6LL 4OZIA 3RZCC 4WO4A 5T1LB 1W9DM 3EMCA 4HEME 4WDIA 1DEEB 2VDOH 2O5XL 3VD9A 2CLVB 2P8MB 1PW3A 5LA1A 3LQAL 3FO0H 2VDRL 4AYSA 1BAFH 1FVEA 2HYMA 3SDCA 3STLA 5I73B 1QI5A 3WHE0 2QSQA 4GAJH 5GJTH 4LEXL 5C1MB 1JZ5A 1E43A 1WFNA 1FVDB 3JBG7 1JHLL 4AYGA 4EN3B 5CBAA 1K9FA 4OSUH 2GTZB 2HA1A 2R8SH 1Y6KR 3JUYA 2I26N 3UR8A 4ELME 5DJDB 3G5VB 3SCMC 2EBNA 3X3FH 1IEBB 4FQIH 5A8MA 3V79C 4OZGB 5GZND 1IKNA 2B0SH 4KXZH 3JTTA 3H0TA 2UYLA 5JW3H 3RWIB 4PY8I 3AS1A 5BRZA 1WITA 3KXFA 4CU6A 3CZLA 35C8L 1IBGH 3LIZH 2FX8H 1PX8A 4OD2B 1QQDA 4U6HB 3UXFA 1VADA 4IISA 1W0WA 2QBWA 5DI8A 5KVFL 4C7FA 4DVRL 4S1SL 2BVQB 4AJ0A 2AEQL 2R1WB 2E40A 3GK8L 5F21B 3JV4A 3W0WD 1BFOA 3SGDH 2VDQH 3UJJH 1E0XA 2E9IA 2R4SL 3UPCA 5I1GL 1G7LA 4CRPA 3KLHD 3OZPA 4UAOB 3VXRD 1KN2H 5KOMC 2PO6B 4GI6A 5ILTL 1FNHA 5T3XL 5F72S 4RMUA 4Y5YA 1S8DB 4Y4FD 1LEIA 5GGRY 1J0KA 1U6AH 3WJJA 5EBWA 4YXHH 3U7WL 4CW1A 4F2MB 5IF0A 3AVEA 5KW9L 3EFDH 4JFHE 2A0LC 1HHIA 1OGAE 4Z7NF 4U31A 1H3UA 4XMLH 3U7AA 4ZTOH 1NH6A 4U4BA 1QBLL 4ZXLA 2X4TB 2JIXA 4FQCL 1UM5H 3MMEB 4PS4H 1BG4A 3OKMA 4G6ML 1HKMA 3DLQR 1UR2A 1JI2A 2F8VA 4NC0B 4G80B 4U7SA 3V0WL 1CF8H 5IMLA 3RWHA 1XGRB 1ZA6B 1IC1A 2ADJB 2DIJA 3D48R 3PWPD 3DUHA 1CTNA 1BQHB 2E6JA 1AP2B 3QXAA 5IBUB 1X9QA 4UT9H 5ABFB 4QWWC 3GSUB 3NZ8B 4Z2LA 1UQSB 2RCSL 2ZUSA 5B38A 1QEWA 3NCBB 4X99A 2CD0A 3MCG1 1FO0L 4M1CC 2CHOA 3ECBB 1MCEA 1ZT1A 1BFVL 4LYQA 4Z95L 3K80A 3QDMD 2IFFL 5IB1B 5L9DL 1EGJA 4JO3L 4RGNB 1J0JA 4B50A 4WU5A 1ZT7B 4PJ5E 1H3WM 2W38A 4CJ1A 5DRWB 3GRWL 3T4AA 3ROLA 3HG1A 5D1ZB 1RY7B 1S5IL 4U1JA 5D72H 4RWYL 3BH4A 3SKNA 3N50A 5IHUL 1RH9A 4JDZB 3TBTB 1FNEA 1W3LA 4LSUL 5ACZB 1TR1A 1MWAH 1E6JH 2ZOKB 4WHYG 1MCPH 5BXSA 1DFBL 4PJGB 4YHYB 5BXFA 1A6WL 1AGFA 3MOAH 4ETYA 2IADB 4Z7NE 4N9OB 1KG0A 5HHXL 1AGDA 1DBMH 3S4SA 1WAAF 2BSRB 4W84A 2VXTH 4G7YL 5EO1B 3U57A 2YKLL 4OCNC 2B1AH 4XPBH 5BWFA 1C8XA 1BVLB 4G9FE 3MKKA 4NM8L 3QDGD 1RIUH 3DECA 4IIQB 1RUPL 4LQFL 4NCC1 4L3CB 3U4EA 3RY5A 3G6JF 1FH5H 3WFCH 2OX5A 3LRLA 2FL5B 3RWDB 4LPXA 2Q8AL 1KB5B 1MRDL 5AUMB 3RHWK 1NFDB 4U1LA 3HRZB 4PJIB 4WHDA 3REVB 1JGEA 4KZDL 4QRUA 3U0TA 4N0CD 1NAMA 3VXQB 3WV0A 2B4CL 3BMVA 1A7PL 1YEFL 1ZLSH 3B9VA 1BBJA 4J8RA 1DN0B 5IW6A 2PW1A 1MCKA 2BC4B 1K85A 4QAWA 4Z77B 4MS8D 2AXHA 1YMHB 1Y6MR 4NNXB 2NXZD 2VLRB 5FO8A 2E9BA 5H2BB 3LN9A 2VCAA 1E5NA 4FNPA 2DDQL 3KPPA 4Q6IC 3MLTB 5IKCA 3LKNB 4L4TE 4HFUL 4NO5B 1JPSL 5EB9A 1V7NH 4JN1H 3MCLL 4IMLB 3PP3K 1KFAL 1CE6A 3LEVH 3KG5A 4NXSA 4UQBA 5J12C 5FGSA 4I4WB 1JCKA 4JFXB 3IU3A 3T1FB 1CL7H 2XN9B 4BKLA 3QCTL 4D0CA 4WY7L 3BP4A 4KI5C 2XKNB 1CXFA 2XZQL 1U93A 3MZGB 1HJWA 3CD4A 3MFFA 4V27A 4IDLA 2XWEA 5BXTA 2VH5L 1P7QD 3V7AG 4KGJA 1WAAE 2CLZB 1GGCL 1XCQB 5I8EA 4HG4J 1QG3A 2CLRB 4WFGE 2RAMA 3P11L 4WFEE 4P9HC 1MQRA 4BH7B 4HX1A 1H1NA 4QHNA 5D1XA 3BSGA 1FAKT 2XWJB 1Y6NR 3KYOA 2HRPH 1IGTB 1KTRL 4QNPF 1CGSH 3G6JE 5BS0A 3PV7A 5CIPA 2N1KA 4WEUD 1LWHA 1C12B 1SEBA 1UC6A 3MV9B 1H11A 1S7VB 1V3LA 5ESQA 1YEGL 1MLCB 5J0BA 2WLZA 4ONOA 3CH8A 1K4DB 5D1QC 4UQDA 3ULVC 2OJZL 4FQJH 1RPKA 3UBXG 5JHDE 3W81A 1R5VB 3MUZ1 3WIFA 2FD6L 1WBXA 5K9OA 4ZXBD 4M29A 1QNZH 4C57C 1JUFA 4WEBL 2ZCLH 5DHVA 5DUBA 3MNZB 3LS5H 5A6MA 1EO8H 3TFKC 1OWQA 3CSGA 4U7KA 3HTLX 1N5AA 4NF7A 2VLLB 3NZHH 4NQDA 2JE8A 2BY1A 4P8XA 2IQ9H 1ORSB 4O58H 1NEUA 2YSSA 4H25A 1LO2L 4MCZB 1WISA 1EO5A 1A9BB 4Q9RL 2K3TA 4MD5B 5JLZA 3WL9A 3QA3B 3JWOH 3CMOL 1FHGA 3MRPB 4KQ3H 5I30L 3HFML 3L3HB 1RMFL 3FFCA 3RVVD 3ALWA 4Y2DB 3VIOA 4OQTH 4MB4A 2O5ZL 4PJCB 1MVFA 1NDMB 2BDNL 4QNPE 1C16B 2GY7B 4Y4KD 5IR1A 5B38G 3KPSD 4KKCC 5A16B 1US3A 5BQ7A 2ZZUT 2WC7A 5BZWA 2XN1A 2WBGA 3SGEI 4WV1C 4NPYB 4OCWL 2GJRA 1ZANL 3BDBA 3MO4A 4LEOA 3M07A 4OKDA 1TQTA 2BOBA 5DVNA 1DWAM 4PJBF 3OKDA 2X70B 1D5MB 3O3AA 1FRGL 1RJLA 2VDOL 4ZFOB 3ZYJA 4AK1A 3NAAH 5E8OB 1E6PA 3DMMD 2ZG3A 1FNGA 1R3HA 4EI5A 1IGFL 1A9EA 4KQ4L 1A22B 4Y1AB 4BYHA 1VGEH 1XGTA 3WXVH 3D0LA 4R6UA 1JE6A 4CKVX 3IFNH 1MIMH 5DS8A 4ZUTB 5GRVK 1MWAB 3VA2C 1MJ7H 4WCYH 5I8OH 4QXGH 4UTBH 2EC9T 5E6IA 3LPPA 2R8SL 5F1NA 3S4SG 2WBJC 4GAFB 3QUYA 1JNJA 5D9NA 4X7TB 3JV6B 1UUQA 5ECJE 3U4BL 5DMJB 2JTDA 4AQ1B 1BWMA 4R96B 3AREB 3IANA 2AJZA 1F4HA 3TVMD 1IAOA 2JIEA 3PUCA 1RURH 5JW3L 4R7DB 5GRUL 1H0DA 1AO7B 1RZFL 2YR3A 2VISA 3BUYB 2Y2WA 3RIFK 2R1YB 1RK1A 1JGVL 5DZOA 4JFVA 4R4BA 1A3LH 3C5SB 2Z8RA 5KSBA 4WLCA 1ZOXA 4MDJA 4OB5L 1T89A 4HBQA 2VVSA 4H26A 5T3ZH 2V2TB 3CH1B 1MHCA 5I8KL 3MPCA 3GMPB 4C59B 3SPVA 3S36H 4R2GC 3ABZA 2BNRD 4V1DB 3MUGA 3QHFH 4UBDC 4GINA 1JHKH 4NNYA 2BNQD 5HVWA 4H8UA 1UYWH 4PJBE 4HIXH 2M2DA 2XIDA 1H8NA 4MHHG 3CC5B 3NA9H 5TE7H 4JR9H 1PY9A 3RGVA 3KPRE 4YUEH 1K9EA 3TN0C 1HWGB 2GSIB 3NIGF 5A6SA 2F54A 32C2A 3QCVL 3RWGA 4R27A 1JGLH 4NO3B 4ALAH 4Q9QL 2G3NA 4XCYA 4DZ8A 2CRIA 4PJ9A 1NP2A 3GNOA 1YNTB 2EJ1A 2A9MH 2UZIH 3FO9A 3RIFF 1ZSDB 1QW8A 1KGXA 4POZC 2J8UF 3ARYA 4M03A 4PJEF 2AK1L 2UVEA 5CP7B 3OGVA 2J88H 3O81A 1A1NB 4YLQT 3QHNA 5HYSA 3CVIH 1QBAA 5I9QB 1JZ4A 3UJIH 3P0VL 3MRJB 4YBLC 2X4QB 5LXGL 3CFJB 1W3HA 1JGUL 4NNPH 5HD8C 3BZFA 5DMKA 5H37G 2GQHA 3QIUA 3U2SA 5E95B 3NACH 1C92A 4OBRA 25C8H 2G60L 5EUOA 2CBVA 1I1AB 1CGVA 5BMFH 5GNXA 4Q2ZB 1P4LA 4PR5B 3PN8A 1CBVL 3PZOA 2AJUH 1AC6A 3HAEG 4GKNB 1D9KD 5C0CE 5AD0B 3KXFE 2AGJH 4JM2A 5HVHC 2F8QA 4HXBH 3MU7A 1E4JA 1UD6A 2VJXA 5MENB 3BAKA 4OZFB 3QPXL 3EZ8A 1Q1JL 4WW2F 1ZHBA 1QWNA 2IQAB 4NBYB 1HSAA 4JANA 3RPIA 3VFWA 1H5BC 3D25A 4L8DA 4HV8B 1GOQA 3RUGB 5LAXB 5D9PA 4OCYL 4Y4HC 1BGXL 4R26L 4QRSB 3CVHL 3IDMA 1T21B 3NIGE 4RIRA 5DUMH 1C7SA 4QRRD 4HSQA 1Q9LA 4WWID 2V7NA 1TZHA 2NXYB 1DBML 3ZIZA 1U3HC 3SE4C 3S5LB 2XRAL 4HWBA 3W53A 1NCBL 2B1AL 1E71M 1NCWL 4YWGL 5EORH 4F7CB 4XCFH 3INUH 1XIWD 5JPNB 3ELAT 2QLYA 4U1GB 2V3GA 5I0DA 2GK1B 4DUXA 2J8UE 4PJEE 3V4PL 2DI8A 3EYSH 3EO1A 4PV8B 3HKFA 2GDUA 5A2FA 3WFCL 5GS2H 1OAKH 2AP2A 2W66A 1JPFB 5CSUA 3PZIA 1U8KB 1GGUA 1KCVL 1S78C 5IFHL 4R5EA 1F6FB 4FQ2L 5D5MB 1B90A 1P5UA 5F1IB 4KK8D 1WWCA 3H9SB 4OV5B 4TX8A 2PR4H 3RMEA 1VFUA 4XPTH 2W92A 1HIML 5ANMB 3IXTB 4NRXB 5D2NC 1LK2B 1IARB 4TVPE 2AJSL 5DTFA 4YXKH 4ZUUB 1O7DC 4ZUSA 3JTSA 1C08A 3OG6B 5SWZA 2HT3C 1JF6A 3G9AB 3VX1A 5CBEB 3VD7A 4OF7A 1FE8H 1NGZB 2X5PA 2P5EA 1V7NL 2ZE0A 8FABB 4YBQC 3SY0A 3WMSA 5HHQA 3IFOB 2GK0A 3VD5A 1FHLA 3VIFA 4MDPA 1EMTL 4S1DC 4ZAKB 2H3NA 2JLLA 1HZHH 3TZVD 2GJXB 4M93C 3WUWG 2A6DA 4AG4L 1CK0L 1I1FB 3ZSSA 1U91A 4GH7B 1PD6A 3OJ2C 5HXMA 4AMWA 1OSPH 2YL6A 3BGFC 3BVNB 4R0LB 3TT1L 4AM0A 3KVQA 2D20A 4RMTA 4GMTH 2W59A 3BGMA 4IRSA 1M6OB 4M61A 2CR6A 2XTJE 1KCSH 4NWTL 2DSVA 2F5AL 1DBJH 3JUZA 4JPIA 1U8MB 4PLKD 4NQED 4GUPA 4M56A 3ALXA 3H3PL 1U8PB 4EUPH 1WJ3A 2EYSB 1HH6A 3BP5A 4LDLB 5C0DB 2R4RL 3B5HA 2YLLA 4G7VH 2BSSB 4WKHA 5IG7A 2A1WL 3FO1B 3RILA 2CIKB 1Q6CA 4AD3A 1TZIA 5CD3A 5D71H 4JN2A 1XH0A 2X0YA 2A6KA 4F8XA 3V4VH 4XH2B 1C91A 1S7RA 3MCKB 5D7JA 4Z2IA 3KPLA 1WCBA 3KWWA 5ALBH 1IC4H 4C55A 4DGYL 5F3HA 4Q22A 2VN4A 1IGCL 3UTQB 4D0BA 2FWOA 3CU1A 4PJ7A 2PCPB 2E9MA 3LRMA 1YPZA 1ZHLA 3QDHA 2Z4QA 1FL3A 2WVSA 3LMJL 1UZ8B 3D2UD 4XVJH 3O45A 1I3RB 1QLEL 1X5IA 2DQFB 1FFNA 4JPKH 5I1HH 4TXEA 1LP9F 4KRPB 2N56A 4YE4H 1N64H 3GMQB 1QBMH 3MRMA 2JF1A 2QADC 1B0GA 1F8TL 5JOFB 5M17A 3ROOB 3PWLA 3ARGC 1JWMB 4RFOH 1VESA 1SJXA 2OXGA 5MEOB 3FN0H 4D6IA 4FOMA 1QA9A 2NY5L 4L3AA 3WCYA 2XNAB 1FZMA 3A4WA 4KJPD 3HZMA 4ZFGL 2GAZA 3MLUL 3MRRA 1F2QA 4A3HA 3OR6B 4UOQA 1BJ1H 5E6ZA 1MEXL 1J0IA 2XTKA 3WIHA 5HYSG 4M1RA 4WI7A 2IANE 4ELKB 1LEKB 4ZFZA 3W9EA 1EK3A 1LO5B 4OGXH 1YEJH 4JFEB 3UPRB 2HMID 3BKMH 3OX8A 3CCHA 5E1AA 2J7EA 3DYOA 2ARJQ 1OAZH 2F8XC 3L95B 4M6OH 4JFYB 2QV4A 4AY0A 3F5WA 2J7FA 4OLXL 2ICEA 2VVNA 5BS0E 5CEZE 4FG6C 4XC1H 4WNQB 5T1LA 1F4AA 1FJ1A 3VFNA 3MACH 3O6KL 4P23D 3FT2B 4ODTL 2Y6SC 3O9NA 4XAWL 4YHNA 4OD1L 3UTPE 2H45A 1G0YR 5I15L 5E0FA 2CKBH 1L7IH 5EFDA 1LP9E 5T1KB 1UCTA 1MIML 3CBWA 12E8L 1TXKA 3U0WL 1LWJA 3VFUA 2ESVB 3MMUA 5C0RL 1MJ7L 1X4ZA 2FDBP 3UTSD 4G43B 2IWGA 4EN3A 2A74B 3O2LA 1EZVY 3VFPA 1GZPB 4WRLA 3LHPH 1NANI 5IVXA 1C8PA 3WSQL 4BFIA 4C7GA 1CIUA 2NZ9D 4XHJD 4MNLA 4BF7A 3ZKXB 5ADOL 2FATH 4JVWA 1KQYA 4OZHF 3BN9D 3EJZD 1UR8A 1IGYB 2A3HA 1OAXL 2HP4A 2OBGA 1HHHA 4D3CH 3RWIA 4N0YL 2HKHL 1HH9B 4I5BA 4XXCA 3SCUA 1NGXB 4G6KH 4UINL 4O51A 3BO8B 4Z2HA 2F61A 1UJ3C 1KPUA 5DJCA 5I0ZA 4GO8A 3L1OH 1AXTH 2CUIA 3GSQB 3VI4F 5TFSL 1H4PA 3FHQA 4X98A 1XD0A 1S9XB 2QQLH 2R1WA 4JLRA 4ORGA 4XPGL 2BS9A 4Z2KA 3L3GB 1F4WH 2HN7B 3DPBA 4OAWB 1MY7A 5CP3H 5CJQH 2XUCA 4N90D 4XP5L 4W8BA 2PTTA 4KROC 4GZIA 3I6LD 1HVXA 1S8DA 2FYYA 1JPTH 5DA4A 1BD2D 5IJKC 4KVCH 1CBGA 4F2MA 2JF6A 2WMFA 1FYTB 5BXRA 3FRUB 2J6EH 3WMBA 5TJWK 3KPMB 3SCVA 1NDGA 3KLKA 4XNXL 2X4TA 3U7YH 4KJQD 4JREB 4MAYC 3L3KB 3RL2B 1QD0A 3UDWC 3U7VA 3HNTH 3THDA 4WUUA 4M8VA 3NH7H 4XRCA 5JXED 4J23A 2JK5A 3S9DB 2ADJA 1HKJA 5I2IB 2RFXB 5GISH 3MRLA 4FMVA 4K94L 1E56A 5FIEA 4W87A 1VGKB 1B0RB 4MNQD 4OZHE 4UNVA 1P9MC 2WM0A 5FYKU 1RU9L 3ZE1F 3NZ8A 3H3KA 1XRVA 4NWUL 1GONA 4D6GA 1QNRA 2HLAB 2O93L 4EUPB 3LV3A 3K74B 1IEAA 3U30B 4ZOAA 5FCUL 5MHSD 4DWSA 4KY1L 4OGAD 4XBEL 4FA8A 1Y0LA 1U33A 1T2XA 4YHOL 5IB1A 4ODVL 4FABL 3P4OA 3MRDA 5HHOD 2HVKA 1BG9A 4UCFA 3LQZB 4L9LA 3VI4E 3BLPX 2ZUTA 4UB0H 5DRWA 4URIA 3B2UD 3BEVA 1RJZA 1CDYA 4YN5A 4OV6F 1Z0MA 3CH9A 5D1ZA 3AMLA 5TE4L 4LDEB 2VXQH 4YDLC 3SDXF 1ES0B 3HJEA 1ZLVH 4C56E 2ZCKH 3IGAA 5DXWA 2ZOKA 2XVPA 43C9B 2EC8A 4P2OD 5HPOA 1TTFA 4ZS7H 2GHWB 1C3FA 1GGBH 1RQ5A 2IADA 5DUML 3C5JA 4EQ3A 3S96B 5HYQB 2X4PB 4JPVL 3WS3A 2BSRA 1YNLH 4NZJA 1BVLA 3TC9A 4LCCC 4IIQA 1NMAH 4BQ2A 1BYCA 4ZOCA 1UXSB 3VWJB 1T4KA 3EFFB 4L3CA 5E24E 1QNQA 3T0EC 4LNRA 4DO6A 4P48A 4E5XA 4OKVB 5A2LH 4LLDA 1OLLA 1NFIA 3RWDA 1G0XA 3ZE1E 1KB5A 3O9WC 1H41A 5AUMA 3GUTB 1HNGA 2MKLC 3HRZA 4PJIA 3IDIB 2DLEA 3MRHB 3VIGA 3IT8D 4UQ2A 1TTUA 1ZGLP 3PDOA 1XF2B 3C6SA 2A6IA 3O4OB 3OMZA 4F9PC 1DN0A 4AD5A 3QO0B 2C3VB 2OL3A 1OL0A 4PUBH 1C8QA 4NNXA 2FNBA 2Z1KA 3O0RH 3SO3C 1U30A 3MTRA 4N0FA 1MRCL 4XAKD 5H2BA 3L4TA 4LKCB 4HA3A 1A1OB 1QSVA 1WTLA 2FHCA 3O4LB 5HHMD 5BO1H 3P77A 5FA3A 4ODUA 1ZJBA 1L9MA 3LKNA 4NO5A 5DMIL 4LX4A 3VXSD 4AEIH 1HK6A 4MJIB 1U8IB 1IGIL 3CV5A 1F45A 4IMLA 4TUKH 1FN4A 4JY6B 3SDXE 1KLUB 2DMKA 4ZTPH 1PG7H 4JFXA 2XN9A 5JA9A 1HZHL 1IVLA 5E9DD 4MLSA 2P5WB 5A3IC 4PCSA 5JQ6L 4UDUA 1UD4A 1GOIA 3T65A 4TUFA 4QFUA 2YPLD 4TULH 3K8MA 3HPLB 4FXKA 2CKBB 4NQVA 2BFGA 4I9WE 1MYRA 1GPOH 1O5DT 3ULUH 3HG4A 2CLZA 4KKLC 3C87A 5JTWA 4G8FA 1L0YA 2CLRA 1JZ7A 4BH7A 3GHBH 4NN7C 5EU6B 3HNSL 4J4PD 1UWUA 2HLFD 4PMDA 2O5YH 5EDXA 2XYLA 5EU7C 2W63A 1FV1A 4Y19E 3TBYB 3WNPA 4HWEL 1AHWC 1NBYB 1EXUA 1IRAY 1UM4L 2IAMA 4JCLA 3X3GH 1XV8A 4LHUB 1A7NH 3GI9H 3MV8E 1C12A 1ADQH 5IIEB 3DV6A 3BRFA 4PP1C 1MLCA 5D71L 1YQVL 2ALWA 1K4DA 1MJUH 4ZENA 2NY6C 2VXVL 2A3BA 4U1HB 3D18B 3VDBA 4PJ8B 1NWUA 4FZEH 2D9CA 3QUZC 4JM4L 2IUZA 3BUQA 3VMPA 4Q58C 1GOKA 3GM0A 3MNZA 2EO1A 2KZ1B 1JVKA 1R3LA 4JRXD 2VLLA 1QSEB 4L4VE 4UV7H 5F97E 5EG6C 4E2OA 3DURB 4YE4L 2XGBA 1F5WA 1I8IB 3QGVA 3RZCB 3N9GH 4NC1E 1H5VA 5HGBA 3AOFA 2MQ3A 4RMVA 4MCZA 2O92A 4RFOL 1OD0A 1UD2A 4QF1B 4MD5A 4XC3H 5EU3A 2XA8H 3B3IB 1E4KC 5EOTB 5F7NC 3VW3H 1LL6A 1NC2B 3KHQA 1HKLH 4F3FA 2X1WL 4TRPL 5FM4A 4KJYB 5FIPA 5EZOL 2X6MA 1BQHG 2HKFL 5IBUG 3H53A 3G5ZB 4I13B 3SDDC 1C16A 3VNZA 4HA4A 2B5IC 2GKIA 1WWWX 2EE2A 4K9EL 3RTQD 4OGXL 3SCMB 5DD1H 3IJHB 1A7OH 1OAZL 1Q8MA 2AK4E 4K8RC 4AIZA 1WK0A 4Z76B 5DD0H 4F37K 2HH0L 4EE9A 5F93C 1X4YA 5E94B 2VOTA 3ILPB 4UU9B 4X6BB 1OY3B 4WFHD 4HC1H 2EXYD 3OAYK 4U1NA 2X70A 3G9VA 3DDGA 4JKWA 4ZFOA 1UEMA 1ZE3C 3ULVH 4KTDH 3C60C 2VX6A 4GXUM 4CGTA 3GBNL 1LD9A 4P2QA 2X2YA 4DJMA 3LDBC 4Y1AA 2HTKD 4GI8A 3KAAA 3GJEB 3W0WB 2NY3C 1AQHA 4UDTA 1J1PL 1L7IL 1YMMA 4BUGA 3E6HB 5C0AA 1WIPA 4NSBA 4HT1L 4Y89A 2YHGA 1JTOA 2ZUXA 1ZL1A 2EIEA 2AJ3A 5HSFA 5JR1H 3ARDD 2EEBA 4DOHB 4I2XE 5T3XE 4X7TA 3NPZB 4Z7UA 1EHLL 2WAGA 3UTTD 4R96A 4AT6B 4OFPA 5DMGD 1TZGL 5EO0A 1MFDL 3AREA 3F6LA 5C08A 5JMOC 3A6CL 5LCVH 3SUWA 4O2CB 2L0DA 3OAUH 3QFJA 3B9KD 3AM8A 4LLVB 4M4RA 5DD5H 2NMSA 4R7DA 3I9GH 4MAUH 1WWAX 5KSAD 3STZA 3IVKA 1ZVSB 2CK0H 1GJUA 1V7MH 3MMDA 3CTTA 2R1YA 3TESA 1RJCA 1MW0A 3NOIA 5DMYA 1HHJB 4OZGF 3C5SA 3S2CA 4WO4C 4MA8H 3TA3D 3L1OL 1ZBVA 2P49B 1F58H 3NSNA 5KEZA 3PZTA 1I8KA 2V2TA 1S9YA 3CH1A 3RJQB 5JXAL 3PWVB 5AAMA 1JDCA 3FKUS 1N0XL 2EKJA 1G7QA 3GMPA 1NGWA 2GT9B 3SDCC 1LG1A 1IAII 1CLCA 5CMAB 2D2OA 2VURA 4JFDA 3BX7C 2HISA 4AIOA 1G7IA 4UFMA 3U1SH 1ZBWA 1KCUH 2OK0H 2DLFL 5INDB 3GHEH 3T2NL 1GOOA 1HKKA 3ARTA 4AMCA 1DVFB 2D9QB 3LKRB 3BDYL 3BOVA 3MRGA 4HUUA 2I5YH 1FFOB 1K3IA 4NO3A 4YZFF 1IKNC 3U7YL 2JELH 4R8WH 5I1CH 5IEHB 4WWKB 4HW6A 2DYPD 1YNTA 3HNTL 4MA1C 2E7LA 2WP3T 2X89A 2OSWA 3LH2L 3VDCA 1ZSDA 3NH7L 4L5FL 1RULH 4HK3N 4NN5C 5HGHB 4LLMB 2GJJA 1NCDL 5CP7A 1UQYA 1A1NA 2ZXDA 1L7TH 3BH8B 3MXVH 4XHQA 2GJ6D 2X4QA 1E6OH 5KVGL 3MODH 2VQUA 4R9HA 3DVNB 4F58L 5SX5H 3MJ9A 2CUHA 3QDGB 5A2AA 4HUKB 2X4UA 2Z92B 3QG7H 4OZGE 1ISWA 1QACA 3L3DA 4Q2ZA 4Y5YC 4UB0L 4X80L 4GRLD 3MLRL 3WJJC 1Z3GL 4KK9D 1AXSA 1A1MA 1R5IB 2ICES 4M7LT 3GM8A 5KS9B 4NDMA 2VXQL 1KJ2A 4OZFA 5GGVL 4V28A 4P2YA 4D9RE 2IQAA 2APBA 2NXZB 3WHXB 1K5NA 3EO9H 3T04D 4WU7B 5A6BA 3UMTA 4HV8A 7FABH 5LAXA 2NT0A 1U8QA 4QRSA 1T21A 3TO4D 3ARBD 5FYJE 5FUZH 1NLDL 1NUNB 4DN3L 1JFXA 4X5LA 2YD1A 1HDMA 4ZFMA 1IQDB 4YZFE 3VG9B 3QIWD 3BWUC 5J12B 2CXKA 4I77H 3MLZH 3BEWA 3WLWD 4RAUB 1PSKH 5FYLD 4PJGF 4RA0C 4X6CB 1LJYA 3VXUB 5JPNA 3QJHB 5EO9B 1A3QA 3L4WA 5JORB 3RAJH 4PV8A 2GTWB 2WBWB 4UQEA 4GRWH 1QLFB 5IT2H 3F7RA 1R34A 3IDYC 1JPFA 2IJ0C 2F1BA 3AHZA 2XY1A 1IAIL 1EJOH 2IFGA 5BVPL 5F1IA 2BVOA 4OV5A 1CDCA 4OGYH 4OLWL 1CE1L 5ANMA 3O0RL 1I9IL 3BVWA 3DX3A 4LL9A 5FYLL 1HINL 4ZUUA 2DQIL 1NFDF 4PJIF 4ISVA 1ROWA 4HCRL 2EPOA 5BO1L 3B2VH 2IALA 3P4MB 4OCMC 1BLNA 2BRRL 1JHTB 4E41A 2Q3AA 5I8CA 4TUKL 2Y8VA 1T1YB 3D5HA 2A83A 5BW7A 2R1XB 4P5KA 3VDHA 3D85B 3BXNB 5T5NG 3WSUA 1MFBH 4ZUWB 3SQOH 2ZPKH 5DQ9A 2C4FU 1M03A 5D1QB 1LF1A 4KGLA 2GJXA 5I23A 2DQHL 4XNMB 4X6DA 2R2HB 1H8SA 3BKYH 1AQKL 4D9QD 4P5TA 1R3IH 3BAJA 3EJTA 2UY4A 3AY4A 5JIWA 4ZO8A 4R0LA 3QRFM 3WENA 4RMSA 2EKSB 3G6AB 3L3OB 4HF5H 1IE5A 4MDIA 3PZQA 5HHNA 4ZS6C 1CFNB 4DM2A 1U8MA 3GXFA 3GHBL 4PJGE 1GCFA 4A3YA 5BZDB 1C1EL 3EYVB 4GRMA 5ICYB 1K9DA 3OKOA 5HYJD 3GXPA 4XTRC 3RZWA 3OR7B 3T3PF 2CIIA 5C0DA 1NKOA 3QIBA 2IGFH 1P4BH 4BA8A 1A7NL 3EJUA 4U1IA 3QDAA 5C6TH 3L4VA 1JPGB 1MW1A 5FKAB 5BOPA 3VX0A 1K6QL 4LPWA 4GG6A 2P24B 3FN3A 5E8NA 3FTGA 3MCKA 1J05B 5A6LA 1NFDE 5ISZB 1T0MA 4JFZH 3I6GB 4PJIE 1U8JB 4M62L 4X6FB 1ECEA 5I6XC 2WSPA 2F53A 1TFHA 1ZK9A 3SCQA 3BW9A 4A6YH 4S0TD 5C0BD 2OR9H 4Z7VB 4X6EB 1INDH 1QRNB 1I3RA 2ID5A 2VLRE 2OZ4A 2DQFA 2OTWA 1A02N 5KANG 2ZX7A 1MCFA 1ZHKA 1R46A 2ZX9A 3GMQA 4OM1H 5D1XC 4P46A 5C07B 5E2WL 2YDRA 3ROOA 1RHHA 3S37X 1TJGL 2FCBA 3NCJL 1T0OA 1CLYL 5MEOA 5GGTL 4J6RL 5TQ2L 1TETL 3CIVA 1JNNL 1OSZB 2HFTA 1HT6A 4HZ8A 4XGZB 3B9AA 3CLEH 1JNHA 3S3JA 5EPMB 1TNMA 2WNWA 4ELKA 4P9HL 3T3PE 2DF3A 1LO5A 1XZ0B 5FUOL 1D2KA 5GGSB 1KT2B 3DI2B 4JFEA 1WCGA 3MX0A 4JPWL 2WKLA 2WCSA 4WJXA 2BK8A 2J47A 3EOTH 2R0LL 3O6MH 2FO4A 4PJCF 5KJRL 4F57H 3TFKD 5FM5M 4HC1L 1GZQA 3LAFA 1GW1A 3MYJA 3QXDB 4H20H 1VFBB 5CD5C 5C09D 1Q9WA 3MV9E 3PHOB 1EEUA 2DQJL 5IFAH 4PTTA 3VXMD 2BNUB 4JFFA 3TV3H 5IFPA 1QR1B 3V52H 3NSMA 4OZFG 4GKOA 4OF8A 1UJTA 2ZUQC 1PLGH 4R2GB 1R0AH 5T1KA 4LIQH 5C0JA 2VMFA 4PLJC 2NY7L 4G43A 1DBBH 4O2FB 2A74A 2V9RA 3TEUA 5IB3B 3EOYG 2DKUA 4HUXB 2MTPA 1DE4A 1NGPH 3S5LG 3OZ9H 1GPFA 1TE1A 5TDOB 3UERA 2EXOA 1SJVA 3GKZA 5DGQA 2C8NA 1RZ8B 1BQLH 2QEJA 1FORL 2HFFB 5M3WA 2FHFA 4OJFL 1FBIH 2CO6B 1HHGB 3GIZH 3IDXH 4QY8A 4BSJA 3DO7A 4RL3A 2FLBT 5ESVB 4K23L 4KI1A 3BKCL 3QUXD 5IOPB 2CK0L 5SWQB 4GRWB 3BO8A 4NGHH 4KRTA 1UWQA 2DQTH 4YHML 3X13B 1OCWL 2Z8WC 3DNKA 4Q74A 2DWEB 1F58L 2QQQA 4X8XA 4CDHA 1KN4H 4G8GA 3S97C 4EI5C 4YBLB 5EU4A 3I2CL 5A3HA 2HN7A 4PJCE 4OAWA 2UY7A 5SWSD 1T5XA 4X4MA 1LQSR 1DQDL 2ESCA 3B9DA 2C1OB 1MFCH 5E08L 1KBGL 1FLRL 3SJVD 3MNWB 5C0ND 3OPZL 1NCTA 5L2KD 3UTZB 3TYFB 5E6IC 2WZHA 4PJDB 4S1RH 2WBJD 1FG9C 1UM6H 3QUYC 1HOCB 1KWGA 2DH2A 1G6RH 3MRFA 4H1LH 3FRUA 1QNPA 1G5AA 4JAMA 3MJ7B 2EYRB 3ZDZF 2E7MA 3CFDB 3VILA 4TOQA 2ORBH 1EDTA 3SDAA 4WF7A 3VU2A 1DHKA 3SE9H 3GH7A 4L29B 3WEXB 1KJMA 2OMBA 4Y1AE 1N3NB 5A8OA 1QFWH 4Y4HB 5DQJB 2E4TA 1VGKA 2I9LA 3D51A 1E1EA 4BQ9A 1P2CB 1M7DB 2XY2A 4PJFB 4Z5RB 1T89C 4YPGB 2DB8A 4MJ4A 5F1OB 5E7FA 3C5ZD 4WSKA 4NZUH 3W5MA 2VLKD 1UH4A 5C0GA 4NX0A 5D2LA 3QXTA 2D73A 2X05A 1WZLA 3ZR5A 4DQOL 2H32H 1RFDH 3RVUD 2JKXA 5DWUH 3MLVH 2WUBL 3RGVC 3OLIA 5MP6L 3F58H 3G04B 1AO7E 3MRBB 3RVXC 4Q7DA 3TN0D 3MJGX 3BIKB 3P9MB 4ZNCD 4YJZL 1I1WA 3VNYA 5GHWH 1SMOA 3MGOA 3BESR 2PNDA 1ZA3B 3CZFB 4JIEA 2BJMH 4XBGB 2D03H 4XWGH 4IHOA 4PRNB 3RY6A 3K2UH 3DX7B 2F5BH 4PJ9C 1FP9A 1ZTXL 4A6YB 43C9A 4V1DE 2DWDA 1VRXA 3I3DA 1V6VA 4BH8A 3S96A 3ZDZE 4FRWA 5HYQA 1A6TA 2PWHA 1V05A 3MRIB 3OF6A 1A0QH 3DXAB 4K7FA 5HD8D 4YC2C 3CZNA 1OAUH 1CLZL 3SEPA 2P4AB 1VKXA 3RUGF 2QR0A 2Y07H 3BUBA 1DUZA 4M93B 3QIUC 1BVZA 3A3HA 1UXSA 3MNVA 3VWKD 3P4NA 1KACB 2AQ2A 4OI8A 2F19L 2FEEI 4OKVA 4PLOB 5EA0H 2NZIA 1IC7H 5GNYA 5HHVH 4PG9B 3P40A 3MRHA 5D6CB 3ZKNC 3HI1B 2AW2A 4GAYB 4OQ1A 1IM3B 3K2MC 4U2ZA 1KCRL 3Q3GA 4JM2C 2VDML 1HYSD 3VA6A 4JFQB 4OOUA 5CJXA 2JFEX 2DM4A 3WFEH 4LKCA 1MI5A 1NANH 1B9ZA 2V2XA 4FZ8L 4XB3A 1V02E 1A1OA 2XIBA 2XQBL 5B4MD 4CVXA 3FL7A 5D5MF 3H2WA 4LCWB 3D39D 4OIFA 1TG7A 3WH8A 5E2UH 4MJIA 5F96H 1NWSA 2QHRL 2GUOB 3EHBC 2NY1D 4HIEB 4FNLH 1U58B 1U3HD 3QNXB 4HWNA 2ZPKL 3W24A 1JK8B 4KMTH 3CPUA 4W5ZA 2UWEB 1GJWA 2DLTA 4HUVA 2ITCA 1EHXA 5C6WH 2PTVA 4ZPVB 1T7ZA 3LS4H 2ADIA 2CR3A 3IDUA 1AJ7H 5MENE 1MFAL 4EDWL 3PIQA 1D6VH 4HF5L 5DSCB 1PVHA 1S78D 1JAEA 1AFVL 3D3VD 4FXGB 3RUGE 3UCQA 1BX2B 2IBBA 3UPAA 1N6UA 2NTFB 4RAHA 3PJSA 5I16A 5I76A 1TVDA 3BVVA 5F7DB 4U6XB 3TBYA 2Y8KA 2QADB 5T1DH 1CZ1A 3KZSA 4WHTA 4M3KB 4LHUA 4CADA 4O00A 3P73A 3M8OH 4YBQD 1LGVA 2A3AA 4NC1C 1BOGA 4P4KD 3GMMB 1H2JA 1QFHA 1OM0A 4PGCA 1S7TB 2F7PA 1R75A 3IKCA 4QTIL 4U1HA 1XSIA 3NDZA 5JUVA 4L8SA 3D18A 5FV2A 5C2BH 4N0UB 1RZKC 5K9QG 1WNOA 4ATDA 5D5ME 1VEPA 4OF5A 3HN3A 3H9SE 3GSNB 1AGBA 4JFOB 1I3GL 1CICD 4PYSA 1A6VL 3DX6B 5I71B 1NUFA 4IRSC 3A21A 1BMGA 1PYWA 1FZKA 2VDNH 3DURA 5EU5A 3ZKMC 4DWHA 3QUKB 2FEEL 5D7IA 1MFUA 1HHKB 3PGFH 5EOQH 3MXWL 3SCOA 2Z93A 1P5VA 3WBDA 1VEOA 5TQ0H 5EOTA 4MA7H 4IPLA 3B5TA 1VPOH 1ZMYA 5TE6H 3IRPX 1UWRA 1QFUL 1OPGH 3QQNA 2DSKA 3L5HA 4HJ0D 4JQXA 1ODZA 4P2RD 3DUUB 5DVLA 4X4ZA 3WF2A 3LXCA 1SJEB 3G5ZA 4S10A 3FB6A 1GIGH 3F8UB 2PBGA 5D7JC 5B8CA 4LCYB 4PV9B 4M43L 4EUPG 2DAVA 4FNUA 4Y16D 4KHXH 3IDJB 4M5YH 4KK5D 3X17A 4Z76A 3B4NA 4NRSA 4PMYA 3HZKA 3HE6D 2H32B 5E94A 4MB1A 1U9KA 3EZJB 1KJVA 4URTB 3N1AA 5A6JA 1UJ3B 1DLHB 2A73A 3GMRB 4HGKC 4JQIL 1E55A 4UT6H 4ZD3L 1RZGA 1J0HA 4OIIL 4WTWA 3V52L 3MRQA 3RRQA 2LVCA 1LL4A 3HNVH 3GJEA 3W0WA 1YJDH 4HULB 5K33A 2UY6A 5T3ZE 4XP6H 4KROB 5JPMB 2VZSA 3VXRA 3PQYB 4MNGB 1IEHA 4Y4FA 4L4OA 2AJYH 3OZ9L 3MR9B 5D9SA 3QPQD 1SQ2N 5FO7B 2CH8A 4CD4A 3FZUD 3TF7C 4YEFA 5IB5B 4NHUB 3TJEH 3WD5H 5CJOL 3C9NB 2YZ8A 3MRKB 4OT1L 3V6ZB 1FO0A 4AMKH 3IDXL 1PZ5B 4MAYB 1NCAH 1KFWA 3S3SA 4YHEA 3SHSA 1W9UA 3WDPP 1IT9H 3HMXH 3X14B 1S7WB 3PWPA 2HAZA 4OI9A 1M01A 2YUZA 3KLAA 4PRIB 4W7WA 3A22A 3I6LE 5BJTB 4AL8H 2PWDA 2GT9A 1I8MB 1D5XA 1GHFH 5CMAA 3I6KA 3AB0B 4K8RH 4X4XB 3HHRB 4FQLL 4RX4D 5DRNB 3WFHB 2F18A 3QDMA 4NQUA 1UZ1A 3REWB 5LA0A 4EAMA 2X09A 2V5RA 4EN3C 2W0FB 3EUUA 1MFNA 4S1RL 4WI5A 3HI5H 1PKQB 4XP4L 4GW1A 4Z0BL 3PTMA 1DDHA 1DVFA 1FPTL 3LKRA 3NABH 1G6RL 1MCCA 1B3XA 2R9HD 2H9GA 3MJ8B 3P4LA 1FFOA 4XZUB 3VFRB 2DBJA 1J8HE 4YDLB 4KPHL 5F9WC 3TCLA 1I9JH 4R90H 5IFJB 5IEHA 5DVMA 4WWKA 1AKJB 4XXCC 5JO5B 1YEHH 3KJ4C 1FL5B 3GXMA 2G2RA 4CD6A 5TGBA 1OTUD 3MLXH 4JFHD 1OGAD 4QRPB 5CINL 1QWUA 3TYGH 1MFVA 2ESVE 3BH8A 4QCIB 4NXKA 5INCB 2PXYD 4JJHA 4GMSH 1SJHB 3M6DA 4W7VA 5F9OH 1SVCP 3AMCA 1YEIL 3DVNA 3RNKB 1BSIA 1Z9OA 3LMYA 3BVXA 3QDGA 2J8OA 4LHUG 5ADPL 3DYPA 4YO0B 1OB1B 4K55A 3WXWH 2QV2A 1QYGL 4GKZA 3T0EB 1C5BL 2R0KH 4LOUD 4G3YH 1IZJA 1SY6H 5IJVB 3O9WB 1HE7A 1FNLA 3FB8A 5DURD 2CBJA 4KUCF 5GHWL 4TOYL 2ENYA 3QH3B 2VRJA 2QL1A 3H9YA 4KUZH 2D03L 4PJ5D 3K2UL 3SO3B 2F5BL 3WHXA 3L6FB 2EE6A 4QRTB 4QLLA 1NC4D 2MCG1 4H04A 4NQSA 5E8PA 5IV2B 1B2WH 2V7HA 5M95B 1N6VA 2QQKL 1N2RB 1I9EA 3ZT5A 2NX5B 1E6QM 3W39A 5EBAA 3F7QA 1CI5A 1IQDA 1NKRA 1IAMA 1WGOA 4RDQG 1AI1H 4L4JA 1HILB 1GGTA 2IPTL 2A9NL 1S7UA 5FDWB 5E1HB 4K3JL 2Y07L 4DWSC 4GBXB 1FYTE 5E9DB 5EO9A 3HUJB 5E03A 5KZCB 5JORA 1ODUA 3UYRH 3WS6A 1DBKL 3HPJB 2GTWA 1CFQB 3OLDA 1QLFA 5LWYL 4RGNC 1CR9H 3VXPA 1E6SM 5E8DL 5EC1A 4GG8B 4L9LC 4PREB 1P7QA 4JZOB 2BY0A 3GB7B 4G9FD 2FH8A 3N1PC 5DFAA 1E1FA 5I1KL 5DEGB 5D1ZC 4G6AD 1G7HB 4MDOA 5A6KA 3HC4L 4P7OA 1A6ZB 2ED8A 5SV3A 2VCBA 1X5KA 3PHAA 4HGWA 4Z7WB 2WVUA 1AHWB 3N85H 3P4MA 5I1AB 4YHYC 2V2WA 1E0VA 2YK1H 5E2UL 2WHJA 2C26A 4NBXB 4QYOB 3OKLA 3LKOB 1T1YA 1UR4A 2R23B 5ACLA 5DJYB 3D85A 3BXNA 3GKWL 4ZUWA 4M5ZL 2D23A 1I85A 2JB5H 1LO4H 3Q1SL 2NY6B 1QSFB 2YBTA 2V5SA 4E0RB 3WFBH 2J7HA 1JZ6A 2R2HA 1H3PH 4IIQC 4UQ9A 4L4TD 3WUZA 1MQPA 2MMXA 3U46A 3QUZB 1E6RA 4PJXB 2K9UA 4Y0GA 3LS4L 2EYTB 5DRXA 1T83A 1S7SA 4ZXBA 3PGDA 1OP5K 1CDBA 4ZQKA 2Y06L 3RVWC 1YNKH 3W6MA 1MXGA 3F12A 2QSCH 2Z31B 1JTPA 3PL6D 4GKSB 3U36B 9CGTA 3EYVA 4J3TA 3T2PA 5ICYA 2J8HA 3MSPA 5L8KB 4NO0D 2ZKHH 3ZE2F 2BX5A 4I0PB 4GW4B 3CXDL 4P3CL 1HTYA 5CSYA 4UOW1 4DKEH 2XZCL 2YFOA 1UA6H 4W85A 4H8WH 4WFGD 4DAGH 2YD3A 4WFED 4ACPA 2B39A 1F90H 1EGJH 2OYMA 3EYOA 2OTUB 4PGBB 1TVBB 3Q6GH 3UETA 1EEYA 2P24A 2JCCF 1PY4A 1T04B 4J1UB 4OLUL 4L9DA 1IAKB 3SDDB 5ISZA 5C2BL 3OTTA 5E1QA 3I6GA 1U8JA 4Y4KA 1IKFH 2B5IB 5A3ID 3WD3A 2Q7YA 4X6FA 1C5DA 5GS0C 4XCCH 2IPKA 4P59H 3VFGL 1HJXA 1UG6A 4OFKA 2D7TL 4JFPB 3VD4A 4OCRL 3VG0L 2VLME 4ZSOB 4X6EA 4X7FC 1CGYA 2PBOA 1XGYH 4HAGA 4JZJB 4KKLD 3SDYL 3MLWH 5JHDD 3AZRA 3P0YL 3O4LE 4PPTA 1MFEL 5DD3L 3ZL4L 2J5LB 5A40E 4LGXA 3VFMB 5DQDL 4MTVA 3PWUB 4YHLH 5EOQL 3AIVA 2E7BA 2HT4D 4DZBB 2AAVA 3WELA 3DMMA 3G08B 2GY5A 5TQ0L 4KTEL 2PYFB 2PYEB 3UAJD 2IAMC 3LCYA 4AISA 2P5WE 2NY3B 1OSZA 3IK2A 1FQ9C 1TJHH 3OHXA 1U3YA 3VGFA 5D8WA 3CDCA 4XGZA 4RDQF 4PP1D 3NTCH 4XNUH 2HTLC 3W11C 3KYKL 2J74A 2X4RA 5I1IL 1NAKH 3ZE2E 1OAQL 4K2UL 1NAMH 1HJVA 4RRPA 1XZ0A 3Q2CA 3OKKB 3A6BL 3FONA 2XFXB 1GVYA 2AOSA 5EU6E 5GJSL 3ESVF 2N7AA 3TVMA 3ZKSD 2YZ1A 4WJ5B 2MANA 4ZYKB 3MANA 2JCCE 2LAAA 1NCNA 3FMGH 4QXUL 1D5BA 4EBQH 1LO0L 4FTVB 1M4KA 1DWIM 1ULVA 3QXDA 1VFBA 3OKYA 3S37H 5JHLH 4IRZH 5E0QA 2Z35B 5KTEL 3PHOA 3EOAA 2LU4A 4WO4B 5F3BB 4D9LH 4M1DH 4WDIB 4DKFL 4HWZB 5J8OA 3VGGA 2X2IA 5EZIL 3OG2A 3NYDA 1WT5A 2BNRA 3STLB 3VINA 3QCUH 1XH2A 4EKJA 3I50H 2BNQA 2DQCH 1LO3L 5DZLA 3K4DA 1HNYA 5F89A 4O2FA 4LSSL 3U7BA 1XCWA 3R1GH 4GPNA 8CGTA 3AUVA 3IAPA 4HG4K 4Q0XH 5CZVH 3G5YB 4XMKL 4MZ3A 1BYBA 5E7BA 2Q6WB 5JIHA 1QSEE 1P4IH 3Q5TA 1YY9D 4AEFA 1HHGA 1O7VA 1YEKL 1LNUB 3P2TA 4BJLA 2IH3B 1ZBCA 4JHOA 3JTTB 5CIPH 5IOPA 4F8TA 2UYLB 4MA1B 1UWXH 3CPLA 3BUPA 1UWEL 5BRZB 3TTYA 2VXSH 4HIHA 2W5FA 3E2HB 3BQUB 4NN5B 3WDQA 3X13A 5GIRB 3AYSA 4HFWB 4F15C 1LE9B 1WQVT 2NSXA 3EOBA 1QQDB 5IQ7H 1VADB 1BIIB 5D70H 1YEEH 5DI8B 4LVNB 2DSZA 4WKFA 5GRYA 5SX4I 3P30H 2R0WH 2YBRA 3JV4B 5D6DC 1CVSC 1MJ8H 1QI3A 3AICA 2YMXL 1BBDH 1UXWA 1HJUA 3U4AA 5DHVH 1HI6A 2Y7QA 4ODSL 1I8LA 5EFIA 3UTZA 3TYFA 3A67H 1VEMA 4PJDA 2ZG1A 4Y5YB 1L6ZA 1OAYL 1LEIB 1HOCA 5J7CC 5EBWB 4CW1B 2CO7B 5HPMA 7A3HA 1AR2A 3MJ7A 4DN4H 4JKPL 1HHIB 3AMKA 2VLJB 3CFDA 3AREC 1UB5B 3BIAX 4FFYH 1ISZA 1W91A 1EQPA 3KPRD 2CUMA 4WUKH 2JIXB 2APWA 1T80A 3OKMB 2HJKA 4NJAH 1RI8A 2W9EH 3WEXA 4B41A 5IMLB 3KJ6L 3RWHB 2XT1B 4CCEA 1MHPH 2VIRB 5BXPA 3HE7D 3PZVA 4QRRA 1R7OA 3ZM8A 4C54A 2E5EA 3KYNB 1XMWA 4U49A 1PX3A 3QXAB 1P7KB 3U83A 4S1QH 4GMSL 3QIWB 4BFEA 4OGZA 1JMZA 3THML 2AJVL 2Q8BL 4ODHL 3R8BB 1QEWB 3SDCD 4DOHE 2DTML 3ULUF 4X99B 1XIWA 1ZT1B 3PG2A 4M8UA 1CLOH 1UR9A 2X1PA 4WGWB 1OP3H 3FQRB 2P7TA 4G3YL 4Q9CA 1Z32X 4DK3A 4WU5B 3WQ5A 4XVTL 3N18A 4O02L 3T4AB 3CZFA 3ROLB 3HG1B 4XBGA 3BKJL 4PRNA 5D7LB 2EPKX 5M5DA 2EXWD 3SKNB 3K1DA 3MLYH 1NMCB 5MEQB 4QXWA 1XF5A 3LKSA 2E7LC 1A3RL 2XZAL 5C0CD 4PG2A 3MO1A 4MXQD 3KXFD 3GGWB 1T1XA 4UTAH 3NGBC 5KS9F 4OCSL 3V5HA 3CHCA 1KV3A 2LAGB 1AGFB 2EO7A 2H1PH 4O5LL 3ZO0A 5JIPA 5I9QC 4KJWC 1KG0B 5JW4M 1AGDB 5FKPA 1SBSH 2MJWA 2IGTA 1CG9B 2NY0D 1TJIH 3ULSA 3L4YA 4MJ5A 3DX8A 5JW4R 3CAFA 4DKAA 2I60H 5IMMB 4FNSA 4Y88A 4IRJD 4IDJH 5CKGA 2DQEL 3U4EB 4JO2H 2YL8A 1XF3B 5D6CA 4X6CF 3HI1A 1EEZB 4GAYA 4KI5F 2JJSA 1IM3A 4U1LB 4RRPG 5GRVL 4CBPA 4N42A 1JGEB 2WWMD 4NQEA 4QRUB 1NAMB 3ULUE 3U6RB 4HLZH 1BBJB 3V8OA 3VXNB 4J8RB 4NKOA 5I1LB 3QULB 5IW6B 4S2SA 2PW1B 2KL6A 1TIUA 1W2VA 1U3JA 4W5UA 2MCPL 5F7EL 4LCWA 4NZTH 1AD0A 3CUGA 1E5JA 3AXXA 3EO0B 1U58A 4YQXL 3NDYA 4P49A 3QNXA 4FP8L 4TVPD 1DQTA 5DUPH 1CE6B 1F42A 4I48A 1TQSA 2JB5L 5C7XL 1Q94A 3RWFA 1KEGH 2UWEA 3IU3B 3WFBL 4YHKL 4BKLB 4D0CB 4ZPVA 1KTLB 5KS9E 1U93B 1QSZA 4XMPH 3WKMH 3F65A 3MFFB 2J7GA 4IOIA 4QHUA 1TQBB 2CDFB 1CFVH 3D2UA 3ULVF 5AZ2H 2O26U 1MHEA 3JWDH 2VL4A 2QSCL 5I8EB 3UYPA 4LSTH 3OAZH 3MA9H 4TVPL 1JZ2A 1W1TA 4HX1B 4QHNB 4AEHH 5F7DA 1PKOA 5IHBA 1LMKA 2XKSA 5B3NA 1X1NA 4LLYA 1NEZB 2XTJD 4RISL 1MRFH 2D4FA 1HKFA 4KMQA 4YXLL 2X2JA 1R86A 1IAIM 3SO5A 4X6CE 4XI5D 4N8CH 1F90L 5CIPB 3VXUE 4KI5E 3V6BR 4JHBA 4AIEA 3LPOA 1KXVA 1SEBB 3Q6GL 3GMMA 3HZ3A 1I1XA 3AXLA 5ESQB 4GI9A 5BW7C 1I9RL 5I66A 2D0HA 2HFGH 2I9TA 1T03L 1SEQL 3T1WA 1UWGL 4N0UA 4KK6D 1E4WH 1J18A 3LD8C 3KLLA 2VDKL 3QUML 4XCCL 4TQEL 4TSCL 4P5TC 2W4XA 4LDOB 3GSNA 3WIFB 1X5YA 2APVA 1WBXB 2FGWH 2XGIA 3AY4C 2FH6A 2I24N 1LVEA 4R0LC 2ADFH 2XFFA 3V9FA 1FLTX 4HUNB 3HMWL 1R33A 3C8KB 3AHTA 2WINB 1V3MA 1N5AB 2CESA 1W1YA 2DPEA 4NQDB 1IGML 5SX5K 4HWBH 4KKNA 1JV5B 4YHLL 2G8ZA 3ZTNH 3OKNB 3AIEA 4Z7VF 1WZ1H 4KVNH 2EIZA 3I02B 4F33B 4ONGH 4H25B 3ULVE 3QIBC 2ZUQB 1B3ZA 1TMCB 1FL6A 2AV7A 2MFNA 3DUUA 4XNUL 3NTCL 4G8IB 3UTSA 4HS8H 1SJEA 5K59F 3OXRA 3FFCB 3D4ZA 3J7HA 5TF1L 4LCYA 4YNYA 3IGUA 1R3KB 2P8PA 1OARH 3UZEA 2Z91B 4WI3A 5BQ7B 4MQ7B 5DK2B 1EVUA 5BZWB 4LBEB 3DRQA 1B31A 3PZ9A 1J1OL 1JGDA 2V17L 3QEQB 1D5ZA 1UT9A 2IAND 3VXME 4HKJA 4D72A 2ADGB 3QQ9C 4LEOB 5JBEA 1QKZL 3QQ4A 3IKKA 2Q3ZA 1N5YH 3NFNB 3S37L 4KRPC 1VF8A 3SUTA 4IRZL 4QHMA 5AAWA 3GMRA 2PC8A 1JIBA 3OKDB 4HJJL 1F97A 3AFBA 4R4FH 4JDTL 4YHPB 5D7KE 4MYWB 4P46C 2EADA 3O3AB 4M8QA 3TBWA 1Z9MA 1RJLB 3O6AA 3KLDA 3BLBA 4HIIB 1RZKH 4EI5B 1FNGB 1R3HB 4I8DA 2NTSP 2P8LA 1F4XL 3TH4T 1UWIA 1A9EB 4GLRH 5BS0D 4LF3A 5CEZD 1ITBB 5ISZE 2NYYC 1XGTB 3QCUL 1GGIH 4YX2L 5EUKB 4PBWD 4MZ2A 5DS8B 4MNGA 3S36X 1TQVA 1WEJL 3UTPD 4Z7VE 1QRNE 5E6IB 1BD2A 1CXIA 4UIMA 4KHTL 4ML4A 5J1AB 5DHYA 2DJ4A 5IB5A 4NHUA 3AMGA 3MRKA 3OB8A 3V6ZA 1MJJA 1A21A 3IETA 5C07E 3OKEA 1PZ5A 2EDHA 1FP5A 2NW2B 5J6HA 4LCIL 1YHTA 3HZVA 1H0DB 4ZNEA 3X14A 1QPKA 2VISB 5JXEA 2J75A 2VXSL 1EXPA 2ZJSH 1S7WA 3L7EA 2FYVA 1RK1B 4R4BB 5DK3A 2VDPL 4GXVH 3RX8A 1WUNT 1MUJA 4PRIA 3GYCA 4HBCH 5C9JA 5IQ7L 4ODXA 5D70L 4H26B 2AI0H 2AEPH 5IMOB 2LABA 3IXAB 3MBXH 4GRWF 4P3DB 1HKIA 3L5IA 3P30L 2R0WL 3O2VH 3WN5B 2YUWA 1D7FA 1G9EA 2ARWA 3M1BB 4OUUB 1QUNA 4NNYB 3WFHA 2XA3A 4OTXH 5HHOA 3QR3A 4JHAH 4AD4A 3EYQC 5AWNL 1N4XL 1PKQA 3VI3F 4X7SL 1EDQA 3MA7B 4YDKH 1KYOK 1QR4A 2Z8SA 1S7XA 4MQSB 1JXJA 3VFRA 3LEYH 2FGZA 2R2EA 32C2B 5IFJA 2NY4B 3DSFH 2VX5A 3TBVB 3TONA 4PJDF 5FXCH 2VAAB 3C6LD 4XCYB 4DZ8B 5HGDB 4NJAL 1KB9J 1X3DA 3V6FA 3VGAC 4L8CA 2W9DH 4P2OA 3AU1B 3FO9B 4EOWL 4NT6A 4DO5A 2P1YA 1UWSA 3WIHH 4QCIA 1J1XL 3IDGA 1CQYA 1XEDA 5IROA 2OCFD 5INCA 3K0WA 2Q87A 1MCDA 5HYSB 4HKZB 5CZXC 5DLMH 4O4YL 3T2QA 2GCYB 5EIVA 3A47A 5E2JA 1W9BM 3BZFB 5DMKB 4ODWA 1RUAH 3IF1B 3ZZ1A 3FT4A 1MQ8A 1G7MA 2H2PD 3QIUB 3AIWA 4MX7B 1K3ZA 5BV7C 3U2SB 4PJFF 2NY2D 5EUOB 4QHKI 1KJ3L 5CLTA 3LVEA 1A14H 1FH8A 1P4LB 4XNZC 5I17B 3QUYD 15C8H 1NMBH 3D9AH 4GRWE 3WY3A 3O3UN 3EGSA 3WFDL 1W8NA 5EOCJ 4JM2B 5IW1A 1T1ZB 3SDAC 4QRTA 5ENWA 2FEDC 2YA0A 1E4XI 2QHLA 1ZHBB 5IV2A 4MVBD 2MSPA 5FOBA 2CRYA 3VI3E 4JANB 3RPIB 4LP4A 4L8DB 4U1KA 3MSDA 1MCWM 1N2RA 1PZ3A 3TTQA 4JAWA 4FHBD 5L7XH 3VXSA 3IDMB 5HOSA 4RIRB 1WAWA 1Q9LB 2NY1B 4C56D 1E4MM 4N1HB 2V7NB 4YHZL 1FCGA 4LCUB 5ITBL 3OB0K 5I1JL 5FDWA 1SBSL 4PJDE 4Y8DC 5F7LB 3RGHA 3ZT6A 3BZEA 4GBXA 4I3RL 1YUHB 5E9DA 3AZTA 4ACZA 4JO1H 3HUJA 4B16A 5ICXA 1BHGA 4BZYA 3QFDA 1CFQA 2XWDA 5E2TH 4UQ3B 5JW5A 1ZVHA 1RIHH 4IDJL 4FFZL 4GG8A 1MAML 3EO1B 1YEDA 3RGVD 3WH7A 3MRCA 2APTA 1YZZA 3QWOA 2X4OA 3ARFD 3FHAA 5GQBA 3D3VB 4EKXA 1CDGA 4G6FD 4ZFFA 2F54D 4DW2H 1LWRA 4UFJA 4ZMAT 1G7HA 2Y5TB 3DX4A 4PJFE 3RY6C 4HOWA 1ISYA 2V5MA 4PJ9D 5DTFB 3IFLL 3JTSB 2FB4H 2FJFB 4OLVH 5I1AA 2VC2L 3IJ7A 5SWZB 1CD1A 2HWZH 3FQUB 1NCCH 1GAFH 4QYOA 3LKOA 1E0OB 2BVPB 2EDFA 2P5EB 3VRJB 4KDTA 3SY0B 4ZUVB 2GK0B 5DUPL 2OLDA 1G7JA 1NLBH 4BZ1L 4GKLA 4C83A 1NOFA 1QSFA 3BD5A 2DI9A 3NIDF 3VH8A 4GOSA 4YDIH 3VFSB 2A3EA 5KVEL 1M04A 3MC0A 4TUJB 4C4KT 5B3JF 2A6DB 4Z18A 2R2BA 3L5WA 3WKML 4J2XA 3RKPA 4MNJA 3AHXA 4PGDB 1AR1D 5HNNA 1GNXA 1U91B 5EN2A 3MREA 1CICB 1T5WA 3QEGH 5F6HJ 5D2NE 2UWEF 1VERA 3LY6A 5BOZG 4IRSB 1FP8A 2Z31A 2NR6C 2XM2A 4M61B 4OOZA 5EB8A 1Q0YL 3ZHLA 4CCDA 4JPIB 3U36A 1T7VA 3O4OC 3BE1L 4GUPB 2RIKA 2EECA 2ED9A 4I0PA 4GW4A 5CJXC 1KENL 2I07A 4RNRA 3NFPA 1A7QH 1TQUA 1HH6B 1MREH 3DXAE 1HP5A 4FQQA 5J57B 1MRFL 5FA4B 5I5RA 4BQ5A 4N8CL 1OGSA 1X6LA 4ERSL 2FX9L 5IG7B 2WXDM 3HMXA 3EHBD 4GS7C 3BAWA 4RE2A 3QYCA 4OCXL 4PP2B 4Y19D 4LHQB 5CD3B 4JN2B 4X0VA 2A6KB 1E4XL 4TTUA 2DBLH 1DLFH 4PUDA 1TQCC 3QRGL 5D7JB 1E4WL 4M6MH 3F7PC 3MV8D 2CMRH 3QNZA 5F3HB 4NN6C 4D0BB 2FWOB 3FQWA 5IDIA 2NW3A 4JFPA 4PJ7B 1LK3L 2WWDA 1MCIA 2GW5A 2W1NA 4HQQH 4AD0A 3GI8L 4AY1A 1YPZB 2CQVA 4CD8A 2Z4QB 1FL3B 4JZJA 2DMBA 1SR0A 4YDVB 1T7YA 3NIDE 4GZJA 4LCWE 1B4JH 4A4AA 1CFSA 4JFUA 3VFMA 3QNYA 5A6AA 3PDDA 4PRPB 5GSVA 5B3JE 1FGVH 3FRPA 3WH6A 3ZTNL 4DZBA 3MV7E 2EQDA 4QOKB 3MRMB 1L0PA 1WZ1L 2R69L 5EBLA 4U0QB 5KSUB 3G08A 4BFBD 1UWTA 5DFWH 4IOFD 4G6JH 4JZNA 4CD7A 3KPOA 3GFUA 3HC3H 2BY2A 4FMFA 4L4VD 2UWEE 1FZMB 1MPAH 2DQDL 4HMEA 5DO2C 5TPWL 1UFUA 3S8WA 3HZMB 2GAZB 2RGSA 4U6TA 5T33H 1KB5H 1G9NC 2EDWA 2HJLB 2APXA 5JOPE 4LIQE 2XVNA 3OLEA 4FFVC 3ARDA 4L8SC 2E6QA 5J3HC 4V2XA 2QLVB 2EH8L 2OSLA 1NCUA 2OL3H 3CSYB 4HPOH 3W9EB 3WIIH 1KR0A 4TSBH 1INEH 3UTTA 4APQD 1J9YA 4TVCA 3CCHB 1N7ML 3HZYB 4UOW0 5HGGS 4WJ5A 3B9KA 3WJLA 5CWSA 4ZYKA 5CUSH 1UKQA 3F5WB 1MCOL 4MXWH 1RUQH 5KSAA 5C71A 2XICA 5IB4A 3CFBB 4POUB 2XYCA 3U5UA 2AK4D 2PW2A 2XPGB 4PB9H 2EPNA 5F3BA 1FJ1B 3QJFA 1NBVH 3VFNB 1M7IA 3EDJA 4GQPH 2IC2A 5L88H 4HWZA 4M7KL 4RFEB 3HG2A 1HL8A 3BT2L 5FOOA 5CKAA 1S9VB 3CX5K 5GS0H 4YHNB 4N0UE 3M45A 2FHBA 2K7PA 1BJ1J 5HI4C 4JQXC 4K3EH 1MLBB 3VFUB 2EAEA 2DEPA 3TH2T 4HWUA 1IT0A 4FQHA 5DC0A 3VFPB 4QLKA 5CGTA 2AXGB 3G5YA 3ARRA 4Z2JA 1UR0A 4CJ0A 2ARJB 5B8CC 2EDLA 1KELH 3F7YA 5IVXB 2B20A 5GRJH 2Q6WA 4BFIB 5I75C 3RIAK 2ZNWA 3PGCA 5HHPA 5F8QC 1HYRC 4GQ9L 1JGIA 1LNUA 5GZNC 2IH3A 3FB7B 5F9WB 1MW3A 4XP1L 1YY8A 2JEPA 3FNDA 3RCNA 3DX2A 4XPFL 1B6UA 4HJGA 3RDTD 4Y7EA 1HHHB 2DYPA 5I74C 2D3VA 4I5BB 4LLWB 2FX7H 5T3XD 5IWLA 3KJ4B 2DM7A 3LZFL 5I78A 4OLZL 3BQUA 4O51B 5GIRA 3V2AR 3O6LL 4LSQH 4ACYA 1KPUB 4HFWA 4MGXA 5DJCB 1LE9A 3HR5A 4NZRL 3SGJA 5K9JH 1BIIA 4HGMA 1QHOA 2GJ6A 4L3EB 1MF2H 4X98B 5F6IC 4JLRB 2XFYA 4ORGB 4NUGL 4HZLA 1EUUA 5D7SL 1A6UH 2WWKO 3TT3H 2PTTB 4OTXL 1IFHH 1TFVA 3BSZH 3RWEB 4Y4FC 2FYYB 1DANU 1MOEA 3FQTB 1CGWA 2MNUA 2O9OA 4GRLA 3O6FB 1TDQA 3VH8G 3RIAF 3PP3H 3LEYL 2VLJA 2WW8A 1UB5A 5E56A 1ZT4A 3TBSA 4MD0A 1NDGB 3O3DB 2IPUK 5JUEH 1DSFH 2XN2A 5F7HA 3TWCH 1TVPA 3BWAB 3LB6D 3PP4H 2DN7A 5B39A 4WUUB 4XRCB 3J8F7 2VIRA 2JK5B 2OTPA 3TO4A 2O9RA 3ARBA 5T1LD 4F66A 3MRLB 3KYNA 3OGCB 1ACYL 1P7KA 4UV4L 4MXVF 3PQYE 1BVNP 4LSPH 2UZXB 2CSPA 3QIWA 5ETUA 3VGDA 4PY7A 3LV3B 2AJXL 1IEAB 4PFEA 2ZUNA 3BMWA 1V6WA 4DWSB 5LQBH 3KL5A 1Y0LB 4HCRA 3VXTB 3EYPA 2BZDA 3FQRA 1KC5H 3MRDB 3P4OB 1KXQA 2HVKB 1ZVYA 1UEYA 1EAPA 1BP3B 4L9LB 4HHAB 2EDOA 4KZEL 2LU7A 1BJMA 1A8JH 3W2DH 15C8L 1DVFC 5DC4B 3LRGA 3BEVB 1RJZB 3TPKA 2WQ8A 4EIGB 2OYKA 4H2CA 5D7LA 5FYKH 1UVQB 2WUCL 1OHQA 4LYPA 4PRIE 4CN6A 4UOZA 2PN5A 4WWKC 1BZQK 1CXEA 5MEQA 5GZOD 2CPUA 3IGAB 2YXMA 4YPJA 3GGWA 1RZJC 3ULUC 3WH9A 1DL7H 4QXTA 2B8OT 4RGOL 4HOZA 3C5JB 4PSRA 4M7LH 3RU8H 2R29H 4S0SD 2B4CC 4D9RD 5J13C 2OR7A 1A64A 5CGYD 1UCBL 1BLIA 3WLBB 2WMKA 4GQRA 3WS3B 3LRKA 6FABL 1CG9A 1T2QH 1PKQE 3CFCH 5DD6A 3OJDB 5CCKL 2XV6B 5FYJD 5IMMA 2EDJA 4C58B 1PG7X 2YD7A 2YA2A 1R8LA 2H41A 2PO6D 4GW5A 1K4CA 1T4KB 4PRWA 4LNRB 5I3DA 4E5XB 2VAJA 3E8UH 3EJPA 4MXVE 4LLDB 3ZO9A 1NFIB 2L4OA 2XXCB 1XF3A 1I7ZA 1Y18A 1EEZA 3OXSA 5LGHH 3TGXA 2FECI 1Z9SA 5E99H 2WQRA 4QRPE 4N0CC 3U6RA 5D9MA 4UQ2B 2ZIDA 2YPKB 3PDOB 2XXMB 3C6SB 1AY1L 2A6IB 3VXNA 2DI7A 5I1LA 3QULA 2OL3B 1I7RA 4KAQH 4PJAF 5I79A 4DEPC 4MS8C 2HRLA 2OQJA 3SKOB 2NXZC 5IBLC 4DTGL 4N0FB 3WUBA 1BYDA 5FYJL 1MNUL 3CZEA 2Q8XA 2FB4L 3T4YB 3BAIA 3F7VB 1GAFL 2HJFB 3P77B 5FA3B 4ODUB 2FO1A 1AE6H 1GOWA 3GBEA 1G9ML 3N1QC 3EO0A 4XVUD 3G6DH 2B1HH 3B6SA 1XH3A 3QDJB 3T0EE 1FN4B 4Y5XA 3VG9C 2WMPA 1GZJA 4OLYL 3BPOB 2DICA 3G6JB 3ZHDA 4Z7WF 3IJ8A 4FLSA 2FR4A 1GRWA 1YYML 3UG4A 5KSVB 5CILH 1KTLA 1W72B 3SCNA 1RJYA 1U3ZA 1FAIH 5GGTA 3WS6C 1VAHA 4UDUB 2QPUA 3T65B 2J12B 4NJ9L 1K8IA 2A6JA 2V3DA 1E28B 4FXKB 5C0BA 2CDFA 4NQVB 1JFQH 1CXHA 4UNIA 2XQYG 5SX4H 2CGRH 1YYLL 3WF3A 4NP4H 2H6PA 5DEZA 2ZCHH 4S3JA 4G8FB 3NJ3A 1V3HA 4PJXF 4U7MA 4R7NA 3UESA 3VIIA 2NX5E 2VQ1A 1IGJB 4XPHL 3AXIA 4I3SL 3RA7H 4F8QA 4NKQB 1BM3L 1FV1B 4HPGA 2ZICA 1NEZA 4XB7A 3FO2B 4OM0H 3MJ9H 5ALCH 5FK9A 1EXUB 1NL0L 2IAMB 5JDSB 2YD2A 1W0VA 4UILH 1OD8A 2FRGP 2Q1EA 3HUJE 4FMKA 5E5MB 2W61A 5TDPA 3DV6B 4PY8J 1MXDA 1UA3A 2OWXA 2C7UA 4JB9H 3ZJKA 3NA4A 3QG6A 1ZEAH 1MELA 4KXZI 3IS0X 4PJAE 1I85C 4KH2A 1DLFL 2CKRA 3WF0A 1CT8A 2P47B 4JL2A 1KJ2H 2ATKA 1LDPH 3GNMH 4OZFH 5E00B 1WC7B 4H0GA 4UIKH 5IQ9B 1DWFM 2OP4L 1T83C 2VABA 4ZXBC 3S34H 5FGBA 5IK3B 2PWEA 4YGAB 5EU7E 4P8UA 5A8PA 5E2VL 1A6AA 4XPAL 5DJXA 1R3LB 3C8KA 2RGMA 3NSXA 2WINA 3AROA 4Z7WE 3LN4B 3SGDI 5JZ7D 1YN7B 4HXAL 1JV5A 3OKNA 4AZBA 3V4UH 3NIYA 2VLRD 3I02A 2UUDH 4F33A 2CJUL 5M03A 5HGBB 1BQUA 4JGJA 2YS4A 1QSFE 2FECL 5GGQH 1CWYA 5EU3B 4C7DA 1DQML 1GQJA 2A38A 4F3FB 4QTHA 1XCTA 3IB4A 3NCEB 5DR5L 1FGNL 4PJXE 1KB5L 4G8IA 4POYA 3IU4L 1AMYA 3RVVC 1NSNL 2XN9D 1GC1H 1R3KA 3O2DL 4OZ4A 2WMGA 4Y4KC 3WIIL 2Z91A 1OSEA 1N8ZB 2DQXA 4AD1A 4MQ7A 3QHZL 5DK2A 3W5NA 2X40A 3S88L 1OWWA 1MAKA 4LBEA 2ZWYA 4EIZC 3WHE1 4UOJA 2XQYK 3QEQA 4AIZB 5BRPA 1DP0A 1TLKA 4JG1H 4R3SA 2ADGA 2PB1A 1RUKL 5T5FH 1ED3A 3QUXA