2DIJA

Complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLFDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of cyclodextrin glycosyltransferase complexed with a maltononaose inhibitor at 2.6 angstrom resolution. Implications for product specificity.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dijA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dijA01
5I1LA 5IVOA 1QR1A 3W11D 4JFDE 2W62A 1R3LA 3AISA 3V52L 1H0IA 3VXUD 1JWMB 3MRNB 3W0WE 2FJGB 5BS0E 4K94H 2Z8RA 2IPKB 1Q1JH 4X7TB 4ZUSB 4ETYA 4JO2H 4ZTPH 1HXMA 9CGTA 3ZTNH 3LVEA 3CCHB 4JL2A 1NL0L 3VFRA 1I7ZA 1I4FA 4JY4A 4BSWA 4P5TC 1A2YB 2L0DA 4WFGD 5EIVA 4NQCE 1J12A 4X9HA 3RI5K 4FFVC 5CP7B 4BQBA 3WF2A 1ISXA 3E2HC 1T1XB 1IC1A 3GBML 5FM5O 5BZWA 5SWSE 4MXWH 3GMOB 3LOWA 3RGVA 1V0LA 1T4KA 3P0YH 5D96C 1ZOXA 1TQBC 1CU4H 2BNRE 4PGCA 4Z77A 2O93L 4LSUH 2XKNB 4WHYH 5J1AB 4LLVB 3B6SB 3FQWB 2G75B 2VLRB 4OBSA 1TZIB 4U7MA 3BSZH 5DEZA 2F8OA 4MXQD 3RIFK 2OI9C 4JRYD 1G9MH 4FXKB 2MPAH 3BWAB 3EO1B 5F72S 5EOQH 3D2UA 3CUIA 4U0QB 3IFNH 1SQ2N 1QRNE 2D73A 1I1WA 2Z92A 3FRPA 4C54A 3DHUA 1W72A 2W0FA 1CLCA 2NY5C 1E4XI 4LCWE 3RWHB 2VABA 3WH9A 1RZFL 2XZCL 4MNQD 1IC7H 3P4MB 3MZGB 1VACB 5TFSL 5IFHH 2DQUL 3AB0C 3WJJA 1WFTA 3OKLA 2Y5TA 4N5UA 3NCYP 2ZJSL 2A6JA 1OAUH 2FX9H 4EN3C 4WW2A 1UJ3C 2V2XB 1Q9OB 2VZUA 4LNRA 2NZ9D 4X9YA 5TE6H 3DDFA 3U7YL 2VH5L 2XY2A 2X2HA 4ODVL 2VLRE 5CJXC 4XV0A 1XD1A 1C16B 3KPSB 1V6UA 2K7QA 4LSSL 1F58H 2DS4A 5C09A 4B3KA 3NVQA 1NGWB 4GAFB 1XF2B 3IS1X 1S78D 2X7LA 5AUMB 5JW5A 5J11B 2PB1A 2OK0H 4Y19D 2Z91B 3ZDZF 3BIAX 3VIPA 2UY6A 5I19H 3PL6C 3U82B 1YC8A 5GZND 2Y2WA 2A77L 2E8YA 4GRLD 3QR3A 1RUML 2F5BL 3VM5A 1B0GA 2NTSP 2VDKL 3D9AH 4J4PA 4LFHG 4P99A 4EXKA 1V3MA 3QI9C 4ZXLA 5E99L 4JZJB 3T0EE 1KGCD 2A9NH 3HZMA 4ZAKD 5GRJL 5K59F 3CHDA 1KG0A 3HJEA 25C8L 1M03A 1SFSA 3A4AA 1UZ4A 3U2SA 1Z3GL 3LKPA 4OFYA 2BY0A 1FORH 2OJZL 2XSAA 1CDUA 3MNWA 5SX4I 4U1IB 3EO0A 4CL7A 4D71A 4PV9A 5BVJA 3NIFE 4L5FH 3GNOA 3EJYD 1H15B 3BIKA 1HKLL 3KWXA 4ODXA 1KACB 4QRPE 4YDLB 2B2XH 4LLAA 4WRLA 3CH1B 4I48B 2Y36L 1CD8A 3MACH 3QULB 3S5LB 4RGOL 3NBNA 1RULL 3QDHA 3F7YA 4XPTH 1YJDH 2F19H 3PWPE 5IW6A 2P5ED 4EN3B 5DD1H 1HXYA 5BZDA 5IEKB 4WU5B 1UUQA 5KSAD 5CG0A 3AICA 1FYHB 5EWIH 1S5IL 3E8UH 4CU6A 5JXAL 2R8SL 2OM5A 4MXWL 3BPLB 3PZTA 3LEXB 4OI7A 4YDVA 4EAMA 3LDBC 4OSUH 4HJGB 4IMLA 3DVNB 2CHOA 3PABB 3P2TA 1V7NL 1W3JA 4PG2C 1L0YA 2YBRB 2L7JA 2P7TB 2JLLA 2QHRL 1FH5H 4G8EB 1E0OB 3VGEA 2IXVA 1T2QL 4X80H 2MMXA 3ZYJA 2PTTA 4ZUUA 3B9VA 2YXFA 1UACL 5DRXB 3IDUA 3TZVC 3GSUB 5IKCA 3GDBA 5LVEA 2AOSA 3U6RA 1EUTA 5IM7B 3OA5A 2C3VB 4ZQKA 2C4XA 3MRMB 2VXQH 2F54B 1HNGA 1NGPH 4HPYL 4YH6A 3QDJD 1JZ5A 4HHAA 3GXDA 1BMGA 4X7SL 5H35A 3RWGA 3HC4L 3JTSB 4O51B 3NFSH 2YPLA 3KLSA 3GMOA 3MCLL 4NJ9L 5DURB 5MENB 3OJDA 4NZRH 3MCG1 1GJIA 4YN5A 3F6LA 2NY5L 4Z7QE 5DD6A 5BV7C 4CCDA 2WC4A 5EB9A 5E5MB 3IXTB 4R7NA 1FOBA 3LKPB 2DQFA 4FQXB 1FVDB 2AJXH 4MZ2A 4WWID 1N82A 4QF1B 4HPGA 1J9CT 4H88H 5DD0L 5DMKA 1BLIA 1J1OH 1AXTL 4HLZH 2UZIH 1BEYL 4BZ2H 3TESA 2EECA 2BHYA 4JB9L 3NABL 4NHUA 4D1JA 3EJTA 5GS1C 3PQYD 3KLLA 4LPVA 2NY7H 1L0XA 3WHXB 2BSSB 4HKXA 1WWAX 2COQA 3ARDD 3CNKA 2DF3A 3STZB 3OKLB 5T1MA 4I3RH 2AJSL 1EHXA 3SCUA 2E5EA 2APXA 1NSNL 3SOBH 4NWTL 1A9EB 2EDXA 3WNPA 5F9JA 2LFGA 3ECBB 4OM1H 5B8CA 1AQDB 3BPCA 2FJGA 1QFWL 1KXQA 1MH5A 1F3JB 3M1BB 4UINH 1ZMYA 4EEEA 1ZVYA 3HFMH 3SDDC 3SO3C 3BEVA 3X11B 5A8QA 2VDQH 4TSCL 2BERA 4JIEA 2CBJA 1MJ8L 2CD0A 4BSWB 3V0VB 1TZHA 1F6AA 2Y72A 3T09A 43C9A 3M1BA 4JFDB 4PUEA 2CHNA 1RPQA 4DWSC 2DLFL 5E8NA 3VRLE 1K8DB 1RJYA 2V5MA 3A24A 3GI9L 5CSUA 1Z9SA 3WL1A 2IBGA 4XPAH 4W4NA 5J06A 4OLVL 1EV2E 5GRYA 1HEZA 3MRCB 1ZS8A 4K94C 4OGAC 3LDBB 4ODHL 4K7PH 1KULA 3N12A 4EI5A 5E00B 3TTYA 5LBSL 3WNNA 1RIVL 4YX2H 3UTSE 1I3VA 1E73M 3WSQL 5DJZB 3WF3A 1MQ8A 4ZAKA 4YHPA 1UD2A 3KLHD 5C0BB 1KJ2A 2BCKA 1HF6A 1JZ6A 1GPOH 1QNZH 4CU8A 3KS0H 1XR8A 1KJMA 3ULVD 2YWZA 4JM2C 4LLMA 4PG9A 3AOFA 3AMKA 2FJHA 3CZNA 4X98A 1KCSH 3A6BH 4X8JB 1Q9WB 4KKBC 4OUOA 1H4PA 5B39B 5F7MC 4NQEA 4RL3A 3GH4A 1HI6B 3S35L 5IF0B 2VX6A 1LHZA 2OZ4A 2J8HA 5E9DA 3EKCA 2BV9A 5F9AC 5IQ9A 4EE9A 5I1IH 3HE7A 1HKLH 2E9WA 4LIQL 3VRIA 5EBGA 3O4OB 4O9HL 3G04A 4L8CB 1RURH 1JP5A 1YECH 1I9JH 4NO0A 3IAPA 4RDQF 2XI9A 5FL1A 1EZVY 5BV7B 5FGCB 3TTQA 3VXUE 1ZT4A 1XF5A 4IRSC 3B2VH 3LQAL 2AEQL 2ZE0A 4CADB 1J86A 2A0LC 5D5MA 2CLVA 5IBLC 3LHPL 4PJHF 3MRQA 1EDQA 2BVTA 4HA3A 1U95A 4DWSB 2PXYA 1WE5A 2F53D 2APFA 3PZNA 4RE3A 2AXFB 1MHCA 4KPHH 5KVGH 1T1ZA 1Z9MA 4UQ3B 1VEMA 3MLUH 3BAYA 3EDFA 4PIRF 1AFVL 4P3WA 3H53A 3GK8H 2XWBA 1QLRA 1A4JA 3PGFH 3VX1A 3K1DA 3AVEA 3L4TA 3ME0A 3PDOB 3RWDA 4UOW1 1S5HA 2DYPA 5I1KH 2XZAL 3MA7B 1QA9B 5HTSA 3QXDA 1J0IA 5DF0A 1G9HA 5IK3A 5GJTH 1NGZB 4M4PA 4IOSD 3T4YA 3L1OH 4M5YH 2WP3O 1EEYB 1CL7L 2F54D 5E00A 1M4KA 5MI0B 2VX7A 2YFOA 4QCIA 4HUKB 4K68A 1QLFB 1QR4A 1G0YR 1GGCH 2X40A 4NCC2 3RMEA 4WIQA 5DVLA 1X4ZA 3S34H 2Y1VA 4O00A 4WI4A 1CGTA 1TQSA 1HQ4A 2J6EH 1HHKB 1KC5L 3NOIA 1B2WH 5IB5A 1DBBL 1YEKH 3HRZB 2FJHB 1EGJA 2B4CL 5GGTL 3WDPP 3AS0A 1W1YA 5IW3A 1S8DA 4KDVA 1A1OB 4JR9L 5D7LD 4A6YA 5I0DA 1B6UA 2QKIB 3QIUC 5FYKU 2EH7H 1OTUC 1ORSB 2YMXL 1V0NA 3MSPA 5L2KA 2PC8A 1ULVA 4FN0A 2XVLA 4AIOA 5CFHA 1IJ9A 5FUOH 4S1DD 43CAB 1ZHBA 4KKCD 1A0QL 3P0VL 4E41E 1KJVA 2YEZB 1TVBB 2OL3A 3WD5H 1MQQA 1LNUA 7TAAA 4GRLC 4N8CH 4YBLC 3G6AA 1T6VN 1T1YB 2X05A 3ARDB 5D5MB 4L3AA 4AD0A 4HA4A 4NQTA 4HUWB 4F80A 2DJUA 3V0VA 5EFFA 5D7JD 2F1AA 4HH9A 4P2OA 4P2YA 2PCPA 4OTXH 4NQUA 2F5AH 5EC2B 4AWEA 4YFEA 4P2QB 3CIQA 3ILQD 1D5MA 4R0LA 3W6LA 2PO6C 2IUZA 3CK0H 2I07A 2NY3B 3MLXL 3C8KA 4Y4KC 5CGYC 1S7UB 2YXMA 1ZS8B 4NN6B 4H8HA 1DUZA 2XTJC 2AJVH 1Q0YH 1Y18B 2Y7QB 1W2PA 2A6KB 1JNLL 1MFUA 3M8OH 2X4SA 2I26N 3ZKND 2AEQH 2BVOA 1C16A 3KPSA 3OGRA 3FMGL 4V1DD 3QXWA 2FEDD 1U6AL 1EXUB 4JY5H 4YHYC 1CFSA 3K3QA 1V6WA 1FVEB 4JRXD 4Z5RA 1KN4H 1DBKH 3QDGE 1LEIA 1C8PA 5CBAB 1BYCA 1JZ4A 1FV1A 1BM3L 1KOAA 3O11B 4NQEB 1A0QH 4WY7L 5IMKA 5C0BE 1C5CH 3PDDA 2XYLA 3SDDA 3UTQB 4Z7WB 4FP8L 5DVNA 5C0BD 5JXED 4G8GA 5E6ID 3ZE0E 2DQDL 3VRIB 4Y5YB 1NGYB 1D5IL 3TBYA 4FTVB 1U93B 3JBG7 4M48L 4PJDF 2VRQA 2CDFA 3HZKA 2DMKA 3OAZH 3C5ZB 2J3SA 4MNGE 2OMBA 4JGJA 4Z7UF 5JXAH 5M95B 2R8SH 3RDKA 1TQCB 4R7DA 1GHSA 4KHXH 4HJ0C 1UR4A 3CMOL 5D2NB 4CDGC 2UVFA 2CLRA 4GMSL 2XHYA 3AS1A 4PJFF 5FO9A 3VFOB 4KK9D 1S5IH 4KHTL 1JWSB 3BP7A 2YFNA 4ODXB 1EFXA 5HVFB 1CBVH 3BT2L 1IT0A 5I19L 2CH8A 1F00I 4LGXA 5C70A 4B15A 1K8DA 1AQKL 1XC6A 1RZ7H 3NA9H 4PD4J 3AMDA 3FL7A 3D50A 4I77L 4XX1G 1T80A 4RX4D 4U49A 1U91B 5I1GL 4PJFA 2H32H 3O3AB 4P2OB 2E7MA 2QPSA 1UCTA 4YHNA 3LCYA 5CQ1A 4NQDA 2VXVH 2OSYA 4LBEB 5D7SL 2WB5A 3MREB 1TMCB 1N8ZA 2HG5B 4EI5B 5T5FL 5DMGC 1U6AH 4EDWL 4YWGL 4PRDB 3FO2A 4LEXL 1NCDL 2NW0A 4NKMA 5ESAA 5TDPA 5JPNA 5C0DB 5GGSA 5C92A 3KNBA 4UIKL 1XR9B 3EDKA 1EQCA 5EO9A 5I30L 1E6NA 3NFPA 1A9BB 1KB9K 2R56L 3MOBL 5GIRA 3BH9A 3UAJD 2VIRA 1MCWM 4P46D 3WO4C 4F7MB 4RMRA 3LX9A 2GJJA 1FVEA 4UI2A 5GZOD 3KE0A 5IMMA 1U42A 1CDHA 4NHCL 4XH2B 2C7UA 3QXAA 4KVNH 5T5NG 3BAXA 1S8DB 1EVUA 3FB7B 1KCKA 5K9OA 1BD2A 5F89B 2MQCA 5E8DL 2NY3C 4Y4KB 5H94B 4NO0D 1WAAE 1ZT4B 1S9VA 1GZPB 4JFHE 4DWHA 3PJSA 4EVNB 1QHPA 2ZUNA 1QSFE 4EKJA 2CDEB 1TVHA 1XGZA 2R1YA 3F7VA 4QHLA 1OAKH 2PXYB 3QUYB 4N1EA 4XWGH 1DHKA 5T1KD 5J6GA 3ARRA 4KZDL 5DUPH 1HJWA 2EPMX 5KSAA 3PTMA 4ALAL 1BREA 5CILL 4PBXA 3QO0B 2Y5TB 2HKHL 5EO0B 1SBSL 2BOBA 2W4XA 4G9FB 5DMIL 3WQ5A 4X4XB 4GKSB 4BKLB 4LVNC 5MEPA 4AZ5A 2JIXD 2X4RA 5KJRH 5D8WA 1NCCH 4PR5A 4DGVH 1GORA 4LCIL 1BAFL 1NOWA 4FQIL 3WF4A 1KLGA 4N8VB 1F4XL 1T7XA 3JWDC 2HFFA 1VJSA 5CZVH 1RMFL 3NIDF 3O41B 2KUTA 4LU5H 1EEYA 2EDDA 3U4BL 4XVSH 3UZQA 2J74A 3BKCL 1TJIL 3D69B 1MWAH 1WUNT 2UWEF 2X4NA 4NSKB 1OAZL 1V3LA 3WLBB 4YK4B 2HLFC 4PJ8A 3KNBB 3SE3A 3WIHH 1GVIA 4JFFA 2JB5H 2ZPKH 4XCFL 4OQTL 2EDYA 4AG4H 1OM3H 5KSUB 1HYSD 4UR9A 3MNVA 1KYOJ 1UOKA 4O4YL 1PZ3A 1CGSL 1NBQA 1K2DA 3CDFA 4RMWA 5L2KD 4JPVH 3QNXB 3BP4A 3OXSB 3QH3A 4LHJB 2EDEA 2VDML 1OTSD 3MJ7A 3VXPA 4AEEA 4YZFF 2DSKA 3ULVC 3HS0B 4ZOCA 2ADJA 1R46A 1ED3A 4ZODA 2E9IA 2AMGA 5F1KC 4HJ0D 3PIQB 4I2XA 3VDBA 4BH7A 2HWZL 4W7WA 5LA2A 3T0EB 3LEVL 4UINL 4JN2B 2JEQA 2P43B 4N1HB 3P4LA 4R0LC 2ZUTA 1RI8A 1JNDA 5F6IC 5D7JA 2DT0A 4BK4A 3R4DA 4HGKC 2PCPB 3VXRA 5E08L 4DM1A 1FO0B 3TJHC 3RWFB 1DVFD 4LPWA 3GSWA 5A95A 1I7UA 1J8HB 1HI6A 4F9JA 3U4BH 4U2YA 4DN4H 4TVDA 2D7MA 4HJGA 4Q6YA 4WV1B 1XCTB 2OK0L 4K3DH 2BMKB 1HJUA 1BX2B 4UOJA 4YHEA 4PSRA 4ZS7H 4S0SD 3C08L 4FQLL 2VISA 1O0VA 2CIKA 5IMLB 1NUDA 3I6GB 3L3OA 1A1MB 1MY7A 4M1GL 4RBPH 3EJRA 4JDZB 3L1OL 3PWPA 1PIGA 4C83B 1PKQE 1NFKA 2V3FA 2X9WA 5EZIL 5C08A 1XYFA 1NMBL 3VXMD 3Q5YA 3E0GA 1DR9A 4D9QD 1NGWA 3UXFA 5T3XD 4Z7VB 3AIWA 1SY6H 4DVBB 1FDLL 1RZFH 4E9LA 4LSDA 4LP4A 2NY3D 3OHXA 2X1QA 5BZWB 5EA0L 2DQUH 1D7FA 2CK0L 3KXFE 3I3EA 3QAZC 5FUCE 4NZDA 4AMKL 4BUHA 5DO8A 2O5YH 2C8NA 5AAMA 5A69A 4PTMA 3GSOB 3MXVL 5TGBB 2NMSA 4GAJL 4XBEL 4U6XA 4Z7UB 1PVHA 1AH1A 4OZGE 5MERB 3N85H 2E9BA 3TJEL 5FGRA 1A21A 3B5GA 5DDHA 5J6GB 3BH4A 5DQJA 1BPLB 3MUIA 2FR4B 4JZ5A 3QG7H 3L3KB 1KB9J 2HVKA 4LHUD 5E5UB 5GHWL 1XGTB 3N1GC 1CDYA 4TVPE 2GJ6E 4X4XA 4BKLA 4U3HA 5GGRY 5I1EH 1GCYA 3QBTB 4HWEH 5CWSA 3L95B 5A3HA 1I7TA 1FFPB 2A38A 1WZAA 3LQZB 1EMTL 5A2LH 1E15A 4G8GD 2BHZA 1FJ1A 3MLYH 5EU5B 4RE4A 3T77A 2YEZA 3KEHA 3VIJA 4F9LA 2Q86A 2F5AL 1HXKA 5BXSA 2VLKB 3JVGC 1LE5B 3VOCA 1KN2L 1X5LA 3BH9B 4JHOA 5DRNB 2X8RA 4DGVL 1ES0A 4P46A 1C8YA 2FDMA 2VLJE 4M6OH 2JIXB 1HHGA 3IGAA 1FJ1B 4L5FL 4MXVF 2EICA 1FZKA 4R26L 4Y16B 5EU5A 4JFFB 5HVGB 1KPUB 4OD1L 4WLCA 1JFQH 3NCMA 5ITBH 4YK4C 2GT9B 4P3CH 3C60B 2HT3D 5F89A 1X5AA 4XTRD 1B30A 4FLQA 2F19L 4Z2JA 3RY6C 4Z2IA 4PLKC 1MCOH 5D8ZA 2QBWA 1FG2A 4X6DE 3A21A 2WANA 2Y8VA 3SE9H 3QWOB 1N0LA 4PJIF 4YHPB 3BP6B 4HWZA 5GQBA 4PJBF 5I66A 1X5KA 1YNTB 2CESA 5DUMH 4FQ1L 4JHAL 3S36X 3MLTB 5DSCB 4X7EC 3LS4H 1NANH 3F8UB 4J6RH 3L7EA 3EO0B 2F7PA 4ODWA 1OW0C 5E6IC 4MAUH 1CNVA 3RJYA 5HHQB 1MEXH 2C0HA 5C0CB 1YUHB 2IFFH 3P9LB 4LL9A 1EGZA 1OBAA 3L7FA 4NM4L 2MHAB 3MRLB 4AZBA 3MYJB 3ZIZA 4NUGL 5IW6B 1F90L 1NCAH 1J9YA 3GI8H 5TDOB 1GONA 4QWWD 1OARL 5DJCA 3ZJ7A 1CD1B 1ZA3B 3UTQA 3BW9A 3B2UD 1PG7H 4Z95H 3AGVA 2ATKA 5I17A 1YMHA 4JVUA 3CU7A 1NMCC 1IKNA 5CMAA 4M02A 4JHZA 1AO7E 1L6ZA 2DDQL 3IJSB 4YE4L 1WQVT 3TO2A 1ZEAL 5CIPA 3IFNL 3LS5L 1YMHB 1CLZH 5J6HA 3H7BA 3ROLA 5J56B 4OCYH 5CS7A 4D6EA 3CUPA 1BVLA 1MHHA 3E6FA 1B88A 1F13A 3BEVB 3X11A 3DETC 4OFIA 5IHZA 2XFFA 4APQB 2CJUL 1E4KC 3BMWA 4UNIA 4XMPL 3AB0B 3N50A 1FFNB 3LZFL 3RNQB 4UZSA 2OWCA 3C60A 3QI9D 2D3VA 1HHHA 5A2JH 5C0AA 1I8LA 3ETBF 3EOTH 3QIBD 2CIIB 5I2UA 1N8ZB 3CFBB 4MAUL 4B5EA 4UU9B 4KVCL 2H1PH 3BQUC 1INDH 5DFVD 5FUCC 3FFCA 2EC9T 3QUKB 2YPLD 2AJZB 4NWTH 4UT9H 1X1NA 3O6KH 2Q76A 4PGDA 3SKMA 5FIEA 2WMPA 4LLWB 3PGDB 5GRVK 4KKNA 3RIAK 3RWJB 2I60L 1G7IA 1KUMA 3P0YL 1EHAA 1MRCH 2F5BH 4DW2L 3K80A 4W68A 1NFDB 5BZDB 4JM2A 5DT1L 4YQXH 1WBXA 2OX5A 1LO3L 3VFUB 4PJ5D 3RWJA 3NGBB 1XSJA 5HDQH 4ZAKC 3HG4A 4LHUA 2GK1B 4JY6A 4P0DA 1A4KA 2WVUA 5LCVH 3NYDA 4DKDC 2Z8WC 3TA3B 4OLVH 5IQ9B 3LSOA 4AENA 4PTTB 5LXGL 5I8OH 3PJSB 4FABL 4WI8A 1A9EA 2HA1A 3UR8A 4W6YB 2NY0D 4BSJA 2MCG1 4ZFGH 1QO3B 1FZJA 5D7IF 3X13B 1QRNB 4OT1L 2C3GA 4IRSA 3EYQC 4L1HA 4PY8I 4MWFA 1QSFD 2XN9D 4JRWA 1Q9KB 1RULH 5E2WH 2A74A 3CU1A 5EPMA 5B38A 3H7BB 3DMMB 1PY9A 4PRIA 1E4WL 2YK1H 5GGQL 3SCRA 3TNNB 2B0SL 1HHIB 3IT8D 1IGTB 4AG4L 3CCHA 3HAEB 3Q3GB 5DJAB 2IAMC 4FFVD 1JZ8A 5A16A 4S2SA 4MAYA 3K1KC 1H3PL 5ADPL 5DK3A 4PCTA 3MV7B 1K9EA 1IGTA 1NWUA 1YNTA 4GSDH 3TH2T 3WNMA 4WUUA 1HKJA 1IZKA 3TTSA 4JRYB 1OAKL 3ZM8A 3C60D 3QI9A 4WHTA 5JQ6L 4I3RL 1M04A 1DANU 4OFKA 1ONQB 3WKML 5F96L 4XNUH 4DCQB 3MJ9L 4JFED 2P5WA 3WQVA 2NTFB 2H8PA 3V6ZB 4M82A 2X4TA 2KZ1B 1IAIL 4LCUA 5MEOB 3U7VA 1ZB5A 1IEAA 3PP4L 1MW2A 4XMLH 1DQLH 4NN5B 4OLUH 3SGKA 2WMIB 4URTB 4GRLA 4QHKJ 2EABA 3T3MF 4UFKA 3UC0H 5H37G 1Q1JL 3GSXA 2P5WB 3GBEA 3RO8A 1XIWD 1LE9A 2DGAA 1CD1A 1ZT7A 2JB6B 2F53E 3GHBH 3PZMA 4QXUH 3QJFB 4PPTA 2D4FA 1H3XA 1I1FA 1NEUA 2AI0L 1FP5A 1MCPH 1FBIH 3DX1A 4ZFFA 4NO3B 4O2EA 1BVNP 3KPSD 1YEFH 5D71L 2V2XA 2D3LA 3KPPA 4ZS7L 1P4IH 1U36A 5ESVB 4CNIA 4XAKD 2FSEA 2Q7YB 3S5ZA 4Z95L 5HHOA 4P9HL 2NY7L 4HUXA 1WFUA 5HHNB 2OP4H 3GIVB 1A14H 4RISL 3SBWA 3CUPB 4NKDA 4J2XA 1A6UL 2FD6L 1ZK9A 3WUEA 3C09C 3VIGA 4YBQD 4P57A 3FO1B 2ESVB 1I7UB 4JPVL 2JFEX 4HGMA 5BS0A 2GJZB 3SQBA 5I1JH 3CTTA 3QJHA 5A3ID 2WUCH 4LHQB 4C58B 5KVMC 3W29A 3OKEA 1MLCB 3EYSH 5CEZH 5C0AB 3VMOA 4DO6A 1QA9A 4QHNB 3WDJA 4LCWA 4XHQA 3D6GA 2XPGB 2DWDA 3L5JA 2GUOA 4XX1E 4KAQL 1XGPB 3UYRH 3WL9A 3NFPB 5J89A 5I73C 5M7QA 1JI1A 4U2ZA 1VIWA 1Z5LA 3KL3A 5DQDL 1FNLA 3LKRB 4L4VD 1E40A 3MYZA 1TPXC 3SDXA 5BQ7A 3WS3B 3DPBA 3QT2A 5IW1A 4QXTB 4PJEE 4WEUD 1X5JA 3Q1SH 3ULSB 3DX7A 5IIEB 5IEHA 2DQHH 2G9HA 1V08A 2AQ3A 2ZUXA 4A4AA 3O3BB 4LAJH 2Q8AL 4MA7L 1KPVA 5IJKC 5CLWA 4MZ3A 4N1CA 4UT9L 4C57C 1DBML 4EOWL 3ECBA 3WIHA 5JBFA 3VWKC 3VXOB 1N4XL 3HU7A 2DQGL 3VGDA 3R0NA 1HWHB 4OZIB 4A3HA 4RMQA 1YNKL 2ICWA 3FT3B 3MJ8B 1KF9B 4L9LA 3D87B 4ZOEA 5GRXG 4MMXC 3K2UH 4QHMA 1MQRA 3HNSH 3RFZC 4JPWH 4PJXA 2OBGA 4ZTOL 3GXTA 5CPQA 3V6BR 1G7HB 2XZCH 1B9ZA 2EIDA 5I8OL 1JZ3A 3HFML 3Q5TA 1BIIB 2FECL 3LKQB 1WAAA 3LPFA 2M2DA 2J6EA 1KTDA 1QFWH 5F1SA 1FP9A 3TLRA 2XG9A 1EGJH 2YBUA 3WUGA 4WVRA 3QXUA 3U36B 2H3NA 1IM3A 2IEPA 4CJ1A 4HPHA 2OTUB 4IJ3B 2DBLL 2AW2A 4XWOD 1I7TB 4AEIL 3FOMB 2JELL 3T4YB 3MGOA 1JNEA 3SDCA 3UO1L 3JWNC 1JGDB 2DWDB 4M8UA 1LK3H 3U0PB 4FZ8L 3S2CA 1ZT1A 4Y4FC 2YD3A 4UT6L 5EIQA 3TJHD 4NKMB 2Y06H 2XVKA 3CIVA 4KDWA 5T33L 3CSGA 2BY1A 1GZQB 2G41A 4X6CE 1HHJB 3C09B 1L7IH 4FLOA 5J3HC 1CFTB 2KL6A 1RJCA 3L4WA 5KVEL 3ZJ8A 4I77H 1NGXA 1RFDL 2NR6D 4NP4H 2WHJA 3VWJB 3PIQA 5C2UB 1E3ZA 4FQPA 1CXHA 4ONHA 2HVJA 5EU3B 1BAGA 4JN2A 2YUXA 1OARH 4RWYH 1CL7I 1N5AA 3HUJE 4NUGH 4XMLL 2GJXA 4NRXB 3O2WL 5F9OH 1RK0B 2RBLA 2IGFH 3O3DB 4OFDA 4YDKH 4KJQD 2D3NA 3KYKL 4DN3H 3NSMA 4LPUA 3ZJKA 1C08B 1Q38A 3RILA 4C56A 1U2YA 3SKUD 5ISZE 1CDIA 4NRXA 3AYRA 3K4ZA 4XPBH 3BAJA 1OB0A 2J1KA 1XCTA 1T2QH 4NKDB 1S5HB 5SV3A 5J11C 1JGEA 2EKSB 3IXAB 2ZWZA 3WQWA 2ICES 2PYEB 3CVHL 4WFHE 3IDGB 4TUJB 1BFSA 3VG9B 5CD3B 2YS4A 4U1MB 5EZLB 3OZ9H 1TJIH 5I24A 3QJHB 4Z2LA 2HRPL 4UBDD 3H3KA 1KB5B 4P4KA 4UT7L 1BPVA 2Z31C 5E4EB 3EYVA 4KKAD 1ZHLB 5IBTL 3LXCA 1KJ3H 1OGAB 4HAGA 1KT2B 5DWUL 1BFNA 1WV7T 1BZQK 2NXYD 3DV6B 1F4AA 1PKQA 1W9XA 2FEDC 1CK0L 4GAYA 4UQCA 2IALA 3CC5A 5ICYB 2WMIA 1YEHL 2DICA 3T65A 5F6HJ 3BAKA 1KPRA 2VWEC 5D4YA 4PMVA 1AC0A 3QHZH 4PGEA 1Y6MR 2ZNXA 2V38A 2B1AH 2JB6A 3RAJL 1F4YH 2VR5A 4KMTH 1G84A 3KXFA 4PJ8C 2XKSA 1T66D 3U0WH 1G6RH 5C08E 4P23D 5T1LD 4FNSA 3HMCA 4P5TD 2QPUA 3H9SE 4QO1A 5F7EH 1G6RA 3ZHDA 5IVNA 5FM5M 3O4LA 3WJLC 4NDMB 5J57B 3UPRA 2J8OA 1KXQE 4PJBA 5DFAA 4QRTA 2IAND 1ZLUK 3NFNA 3APGA 1JF5A 5LQBH 4P2QA 4LIQE 4OD3H 3LRSB 5BRPA 4AD1A 2Z92B 1CFNB 1DWHM 5AY7A 4HMDA 2W60A 1P9MC 1L6XA 3KPMA 4FQHA 5DA4A 4HOZA 4B7IA 1I8KB 2P5WD 1BQLH 1XIWB 3K8MA 1WBXB 3DLQR 5F1IA 3QAZB 5DD3L 1VACA 2DQIL 5ANME 3PHQB 1ZGLA 4E8CA 1A4JB 1KFAH 2VXQL 4OUUA 1I8KA 5JDJA 1P6AB 2DQTL 2JIXA 4WV1C 1M1SA 1KBGH 3MUZ1 3CFEA 2R69H 3T4AB 2P47B 3AS3A 1FGNH 3MU7A 2QR0B 4G9DB 3O2DA 2AXGB 1NLDH 2X1IA 3AAZB 4KROC 1UCBH 2DQCL 2P5EA 5IMKB 3GM8A 3QHNA 2VNCA 2WV3A 4FS0A 4M7KH 1AGCA 1N7MH 3UTSA 3VXSD 3UZEA 4ZUTA 3WE6A 1GOIA 1VFBA 4GOSA 3OKKB 5E8PA 2ZX7A 3G9AB 2VXUL 1OWQA 2XN9E 3SDAD 3UP1A 2VZ1A 1SEBB 3V6OC 3WS6C 4KJWC 2QL1A 2CDFB 4WI7A 4ETQA 4QAWA 5F96H 5IB2B 1G7JB 4H8VA 2AABL 5DVOA 3S4SB 1JNJA 4BCEA 4TUOA 1T89A 5DJ6B 4F8XA 4L4VB 4MA3A 4QT5A 4X4MA 1LL7A 4JLRA 3QUMA 32C2B 1DTUA 3WEMA 1VHPA 2YD9A 3MNWB 4JM2D 3O4LE 3S4SA 2YKLH 1YN6A 1T21A 4RGMB 5CEZE 2XJ7A 3WNOA 5A3IC 1LK2A 4OI9A 4ZUWB 1MWAA 2DSVA 2Z35A 4XVJH 2D9CA 3MBXL 4QT5B 1GOKA 5KG9A 5CEZD 1CXEA 1LJYA 1BBJB 4U6YB 3PHAA 4ODVH 3BEWA 3GXNA 4R90L 2EKJA 3SKJL 4QGTA 2A83B 4OGYL 4OGAD 5FA3A 4V2BA 4OF3A 4ZUWA 4UBDC 3MFGB 5KG9B 1XIWA 3VFSA 5BXFA 2FEEI 2HRLA 2YRLA 3JV6B 5HYSG 2A77H 4HOWA 2PO6D 4WCYL 5FUZH 4V28A 1D5MB 1RIHH 3RQ3A 2Z1KA 1XF1A 3CFKB 4ZFFB 3EJZD 4XNYL 4XNQB 4H20L 5D7LE 2GW5A 4PBGA 1T0NA 2KZWA 2QV2A 4ZFOA 1LO4L 4IHOB 5FYLE 3EO9L 1NP2A 2O61A 3CZKA 3WUWA 2ZX5A 4ODHH 3T4AA 4ACZA 2WVSA 4GBXB 5DEFA 1IC5H 1NUGA 1UVQA 5AYUH 4LEOA 5EU6B 4D0CB 1PS3A 5F93C 3BN9D 4U1HA 1OGAE 2EIEA 3GGWB 1U8QA 3PWLA 4HIJB 2QQKL 3A6CL 1S9KC 4MB1A 1Q0XL 5D1ZD 3K8KA 3CDYA 3RGVB 1LO5A 1OAUL 3SIMA 1OGAD 1SM3L 3WMBA 4GBXA 2HVJB 1VERA 3HZMB 3FXYA 4LF3B 3VXMA 1UM5H 3FFCB 3TZVD 3W2DL 2JJSC 4RGOH 3ARGD 4H0IA 3IJHB 1G7JA 1AQ0A 5ID1B 1C7TA 4HFWB 1A5FH 3LB6C 3NTCH 1G6RB 4ELMA 4XP1H 2VDQL 3H2WA 4PRHA 4TSCH 5AAWA 2JB5L 2ZPKL 3O81A 3FFDA 2WBJD 4X4ME 3VXTB 1US3A 4JLRB 4O9HH 4Y19B 3G6JB 4OZIE 2ZUSA 5EBWA 1XH1A 3ZR6A 4NC0B 3U4AA 3CBWA 3FN9A 1MFEL 1NWRA 4PRHB 3OR7A 1H0DA 4WU5A 2UWEE 4KUCF 3PGCB 3VG0L 1MCHA 3FN3A 5KZCD 2EDQA 4Q9RH 3UTZB 4Y1AE 3B9AA 3DRQB 4PJAF 4XC3L 4ZO9A 5I18H 1F11B 1W91A 5EFIA 4N90E 1U8JB 2ZXBA 3CZ8A 3GMPA 3BUYA 1S7TB 2BY2A 1MY5A 4LVOC 5J3HD 4ORGB 1ZAGA 1IFHH 4OGXL 5C6TL 5DJ2B 5FGCE 3LS4L 3FT4A 4TNWK 4DK3A 4P46B 4X8XA 4P9ML 1LO0H 4LSQH 1E6QM 3QB7C 4ERSH 1R3HA 5I79A 4PRBB 4LCWD 1UZ8A 1TCRA 1P5VA 3QEQD 1E4XL 5CSBA 1D5BA 1LEGB 2QKIA 2BXZA 2VL4A 4W85A 4ZNEE 3PWLB 2A3BA 3OL2A 3VIFA 3B8SA 4H26B 5A8PA 1FZOA 3EIFA 2YRZA 3MRIA 2DSUA 1AXTH 1ZVHA 4FG6D 2WP3T 4JQXA 1IEBB 1ZHBB 3B9KA 1AR1C 5TQ0L 3BP6A 5B3NA 5HGDB 4EIZC 2QHRH 4HXBH 4P4KD 3ZMRA 2BS9A 5FO7A 1BHGA 1CIDA 5HGBB 2XY1A 4JFQA 3T0EC 5BROA 2VLME 1NBZB 2RCSH 1HZHL 4Z7OE 1HSAA 4UNTA 3EO9H 3ARYA 4JHBA 3HCVB 4L9DA 4HC1L 1R75A 3IK2A 3ARSA 5IQ7L 2YD8A 4O58L 5C0CA 1H11A 4W8LA 1CLOH 1OSZA 3TFKC 4WV1A 4PMOA 3V79C 1GGUA 5F7UA 1WSST 5HGHB 4ZD3L 1AR2A 3KPOB 3OKMA 3PV6B 2XG5A 2XIIA 1CF8H 4FQJL 1U58B 1D9KB 4FFWD 1I1FB 5J0BA 2DQDH 1F8TH 5T1LB 3DVNA 1I1RA 2YL8A 2O5XH 3BE1H 5JIWA 2NY2C 4UQ9A 5JZ7D 1UWGL 1N6VA 3JWOL 2HTKC 3HRPA 4XVTH 3QR2A 2DWEB 5SWSA 3GSVA 3DVIA 3BUYB 3QFJE 5MEQA 3OPZH 4MD4B 5DS8B 3GJFA 5CSZB 2QHAA 5SWSB 3FB8A 5HY9B 3CLFL 4EXPX 4NRZB 3MRPB 2AXFA 5D1QC 2VB5A 2Y23A 1P7KB 4PRNB 1Q9KA 1B2YA 3BPNB 2YA0A 1A2YA 4XPHL 2EEXA 3IDJB 1EAPB 1FG2B 4LKCA 3MRBA 2WMFA 4ZFOL 3AHZA 4Z2HA 4AYSA 4IPLA 3W5MA 5BCAA 4C7GA 2R39A 3HNVL 4MDIB 1FZOB 4HC1H 5K9QG 1BM3H 3VVGA 2VR4A 2A1WL 5DFWH 4PY7B 4LRNL 4QHKI 3HE7C 1ZHLA 3QEQA 4TRPL 4X6CA 1FHLA 1WDPA 3ROOB 4NBYB 4L8BB 5KS9A 4KJPC 1XIWC 5MEND 4NHUB 4ZPTA 4A6YH 3AI0A 2ITCA 4ONGL 4X4YA 5F71A 3X14B 3A4XA 3KLKA 3GZKA 3FFCD 2FHCA 1QQDB 2HT3C 5BRZE 1J8HD 2EH8L 4NNYB 5TE7L 4GINA 1L7TL 1U8MB 4YFLF 3QA3A 3MO4A 2CXKA 2IF7A 4QWWC 1NPUA 3FQTB 2A6IB 4D9LH 3FW6A 4NOFA 2WCAA 2CGRL 1FFOA 1QKZH 2VLKA 4LPYA 1FPTL 4M7ZC 3U4EA 4NUJA 3MRRB 1DJSA 3TV3L 3RGHA 4WJ5B 2PR4H 2F9BT 3CDCA 1DDHA 5ITFA 1JZ7A 4TULH 3MRMA 4RFOH 5DJ8A 4JO4L 1S3KL 3OKDA 4HIXL 1XH2A 2IH3B 2K3TA 5ESVA 1E72M 1X5XA 4AZCA 3U48A 1F90H 1NCAL 2RJMA 2I25N 1UXSB 4BZ1H 4JDZA 3LRSA 3GUTA 4GZIA 1CGYA 1FNGA 1E5JA 1QLRB 1C12A 3CHEA 5IGXH 1G01A 4FFZH 4YXKH 2VDRL 4B53A 1I9JL 4KRPC 3IJHA 1OAQH 4YHLH 2R0KH 3GEWB 4OOUA 1LG2A 4RGMC 2NYYC 4HS8H 2GAZA 2BDNL 1OB1B 4JZOA 3QIUA 3D52A 2BSRB 2LVEA 2X2YA 2VRJA 2GTWB 4LQ1A 1HK6A 1PSKL 4LCWB 1H5BB 1J1PL 1GW1A 5IB1A 4LLMB 1E56A 2WWKO 4HQQH 2VJXA 3BT2H 4NKOA 3RDTA 4AM0A 3O6MH 4K07A 3QCTL 1HSAB 1E70M 2WBWB 4JG1L 3TFKD 3ZYOA 3ZTJH 2ADIB 4CD5A 1BQHB 1G1YA 2ATPB 2QSQA 4RQQA 3RPKA 1MVYA 1OAYH 3LPWA 4G9FA 4PJAB 3VILA 2R4SL 3S5LA 2VDLL 3QYCA 2V2WB 3HLAA 2OW6A 4G5ZH 1P4BL 3R06B 3T8XB 4PJ9B 4JFYA 1QFWM 3C6LB 4PMRA 5DZOA 3GMQB 4M9PA 1KCRH 5FHBH 25C8H 3A67H 2D0HA 3DYPA 2WNWA 3PZVA 3A0OA 5HDOA 2EYSA 3U7WH 1IQWH 5IOPB 2FGWH 1VESA 3RU8L 1N6QH 3O8XC 3QZWG 3GB7A 2MWCA 3BH8B 4DOHE 5AZ2H 4MQXC 2LE9A 1MCKA 2YC1B 1LLOA 4JFFD 4BH8A 1JK8A 4PRHD 3VFRB 5AD0A 1JGEB 2OR7A 3ULUH 2ZOXA 5DZNA 3H9HA 3ARZA 3SY0B 1CIUA 2DI8A 4PJXB 5B4MD 1BFVH 5HJ3B 1NAKH 5HVHB 4PRNA 2V5YA 1IAKA 1CT8B 2FX8H 2VDNH 4MB3A 4WEBH 4YDIH 4GG6E 3CVHA 4JQVA 2FATL 2RGSA 2PF0A 1TFHA 3CUHA 4L9LC 4PJ5E 4U3XA 1HN1A 4YHNB 3BXNA 3H9YA 3VD5A 2R9HC 3VJ6A 5C0IA 2WMHA 2OS7A 1AGDA 3VFVA 4KRMB 1JGUH 4F8TA 2X9YA 4JRYA 7CGTA 4CD6A 2H6PA 3BN3B 5ESAB 3WXVH 1LO2H 2VKWA 4CVXB 1ADQL 1JE6A 3AXLA 1XMWA 5D6CB 4DUWA 2F7RA 4UZUA 2DQFB 3WUWB 1BZ9A 3TVMB 1MCNA 2EQDA 2XXMB 5D7JB 2X89A 3MLZL 3QO1B 3VFMB 4BQ2A 2ZCLH 1IARB 1DWAM 3OGOE 2HVMA 2GJ6B 3JVGA 1GQKA 4L8CA 3BP5A 1H3GA 4MVBC 2ZKHH 4N0FA 2W0LA 3RJXA 4YXLH 2NY1C 1YEJH 2B8OT 3RNKA 3UBXG 1ZKAA 3B43A 5CJ8A 2V9TA 4DOHB 4JM4L 3BDBA 3BGAA 4JRYE 4G7VL 3AIQA 1U92B 3AIRA 3TO4D 4U1GB 1T1YA 4H8WC 2WW8A 4WJ5A 3AZRA 1MRFL 2YN5A 5LWYH 2EO1A 4HUVA 4KU1A 2GFBA 1DANT 1YEIL 2D03L 3CUJA 4K3DL 1CFNA 3CVIH 1BJ8A 1MNUL 1OGSA 3PWJA 3IVKA 1BLNA 3S4SG 1KGWA 1FYTE 3O3DA 2MTPA 1FAIH 3KPNB 3OGCA 5HVHC 1HX0A 1TR1A 5KZ6A 2DYPB 4AZ8A 1C1EH 2BX5A 3QUMH 3RL1B 4G42B 3GUTB 1BF2A 3QXDB 4DJMA 2FIKB 5JW4R 1V7NH 4ZENA 4XB3A 1ADQA 2VDPH 2DPEA 4BA8A 5D7KD 4MNLA 1RZKC 4C7DA 2WUBH 4Y0GA 1D5XA 4F7CA 4EI6A 3CUGA 2I9LB 1MUJA 5BV7L 3CVHB 3L9RA 1JHLH 3DJ9A 3DC0A 5E0QA 2V5DA 1UKTA 3H0TB 1LP9E 4M8VA 1I7RA 1SYVB 1RHHB 3MS8A 2VRAA 2XXCB 5I76A 3BVTA 2IPUK 1ZHNB 3LEYL 4LFHD 2MCPH 3NACL 4PJ8D 4HW6A 3WUWG 3KYMB 3U0WL 5IHUH 2AJYL 5FYJE 3U5UA 4R3SB 1TJGH 1WBYB 2C3XA 3WENA 4I9WD 3ARGA 5IB2A 1IBGH 3ARWA 3U57A 3EOAA 4MNJA 3K8LA 4GLRH 5E9DB 4UFIA 1PPIA 2XTKA 4XP9L 3EW3B 3V7MA 3TA3D 4PJGA 1K9DA 4GG6F 5TF1H 4OZIA 3ARDA 4NCC1 1HYSC 1CGWA 4PMXA 5BOZG 1EH9A 3IFLL 4HT1H 1LK2B 2JCCA 5GGUA 4I18B 4MQXD 4WUUD 2F7QA 1HH9A 3VD9A 2HFEA 3MACL 5DVKA 3I2CH 1KJ3L 4DKFL 5CUSH 4HWBL 4R4BA 2H45A 4LCIH 1ZANL 4HUVB 4K8RC 1MHPL 2E0PA 5IXEA 3UJIH 3QDAA 5BS0B 2CBIA 3DMMD 3L5XL 1I9IH 2X1OA 5D71H 1F58L 4D8PA 2HJFA 1NGQL 3JTTB 3WD0A 4D3CL 4JG0L 1PZ2A 5TH2A 3WHE0 4AZIA 1SVCP 3VXQB 1UB6A 3O2VH 4G3YL 1FSKC 1YEJL 1DBAL 3WH5A 1BYAA 1HVQA 3MRFA 4QOKE 4PJCE 4NWUH 2W9DL 1EPFA 2EDHA 4AIZB 3IXTA 1LDPL 1DL7L 1NMAL 1EA9C 3C8DA 2DLFH 3L7EB 5I74C 3EDDA 1FIGL 4OLXH 5GRVL 4ZAKB 5DGQA 5HVWA 1WAWA 4EI5D 4FQQA 3FO9B 4WKAA 3UX9B 5C0RL 1KEML 4P59H 1UZ6F 5SWQA 2R0LH 2P49B 1GZQA 5KEZA 4QYOB 3X3GH 5I2IA 2BNRA 4TSAL 2EDRA 1KYOK 3I6LD 4W7VA 3BKML 4MX7A 2R0ZL 2CPUA 4NJAL 1MXDA 5JA8B 3PGFL 2GUYA 5HOSA 5JOFA 3SO3B 1CPUA 2OYKA 1NC2D 3DX3A 4BM7A 3DO7A 5L2KE 4XWOC 4KTEL 1MFVA 1ACYL 2J75A 3I9GH 4GG8B 1KLUB 3QQ3A 2R2EA 4HZAA 4J4PC 3ARVA 2QV4A 4LOUD 2E3VA 2XTJD 3I02A 4XC1H 4MNQA 1TQVA 4XP4H 4Y4KD 4EBQH 3EBVA 2MQ0A 1R3JA 5DC4B 2LTQC 3CXDH 2KDGA 4W87A 1FO0A 5F97E 1JNHA 1JDAA 2GY7B 4V2XA 4ZPVB 4TUFA 4WI6A 3CFJB 4OM0H 4IMKC 3UG4A 5E4IA 4LYPA 4HG4J 3QUYD 4Y89A 3ZTJG 2FWOB 1IM3B 2CR3A 3JZ7A 4KRUA 2UYLA 3NH7L 4RRPA 4X4ZA 1YDPB 4KQ3H 1L9NA 3VRLF 4Z18A 2YPKB 4DGIL 2CIIA 4KV5E 1SVZA 1VKXB 2R4RH 3WEXA 4X7SH 3IJYA 3SGKC 4PREA 1CE6A 3OLDA 1Q6CA 1BJ1H 3OWEA 5BXFB 3VD4A 2J77A 4HPYH 12E8L 2LQRA 5C0GA 5BMFH 3QOKA 3KR3H 3TBSA 3HPJB 2YPKA 1P7QA 1JTOA 1Q4NX 4U6VL 3MUJA 2AK4B 4R97B 1F3DJ 2DM7A 1JHLL 1Q6FA 4QXTA 5IM7A 3VNZA 3N1QC 3SDYL 4CD8A 1WBYA 2FYYB 3HZYB 4JG0H 2IAMB 3GJFH 3DGGB 4D9QE 1UG9A 2FZ3B 1Q6DA 1ZWIA 4YGVB 3TBWB 2LU3A 3AU1A 4LLDA 3UTSD 2I5YH 2QEJA 3EOAB 3B5TA 1GGYA 1ZA6B 5D2LE 5I6XC 1E3XA 3X3FL 1OWRM 1KJ2L 2KKQA 3MC0A 5JOPD 5TQ2L 5KS9E 5E2TL 1QPKA 2H32A 4KUCD 2GFBB 3VDHA 2H2SD 1AHWA 5C1MB 4XMKL 1E27A 3ALGA 4OCXH 2F53A 4MNGB 3KYOB 1AD9A 1UYWH 5FDWB 4D6CA 2SEBB 4G6FD 1IVLA 1XGRB 4YHMH 4GIAA 1WZLA 1ZE3C 4WTZA 1VBRA 3IF1B 4UV7L 4C59B 2PNDA 1ZVSA 2BRRL 2DTML 1QBLL 1B0WA 2CK0H 2IMNA 3STLA 5DQ9B 2R1XA 2X4OA 5CUSL 1BIIA 2WHKA 3T1FA 3CDGB 3VW3L 1BIHA 3FAXA 2VDNL 2EPKX 1X6LA 5FECA 4TVPD 5CJOH 5BS0D 1VB9A 3S9DB 4PJIE 4UFJA 4ODSL 5L8KB 4P7RA 1U8JA 3VWKA 1E55A 5C0ND 3O2VL 5C0DA 3FOMA 7FABL 1W8OA 1I3RB 1FZKB 5FOJA 3AMCA 4Y4FD 1HIML 2OQJB 5C9JA 2GYSA 5CHNB 1MCIA 3CLEH 1E6JH 5ACMA 4MPKA 5IFJB 4P5MA 2A3AA 4CD7A 1WPCA 3F5WB 1JWUA 5GJSL 3HNTH 3VWKB 4F7MA 1FZMA 1MFDH 4HS3B 1RVFL 4TN9A 1A6TA 2IJ0C 3MLRH 5EC1A 4K8RL 3T0EA 4HK0A 4WO4B 3RX8A 5DR5L 5D9SB 5C0FB 1NQ6A 4X6CB 4Z7WA 2OSXA 4YXLL 3WY1A 1CL7H 4GQQA 4XC3H 2CQVA 5D72L 3MUGB 4PJ7A 1U8LA 3KS0J 4FNLL 4I0PC 4M56A 1TMQA 4D0BA 1KIQA 4E41B 4GKNB 3FQWA 4JFEE 3O9WA 4QRPA 3VNYA 3SKOA 3P73A 1NQBA 2YJQA 4J1UA 5FCZA 1G9MC 3WN5B 2X89D 1GHFL 3RUGB 1AD9B 1PJ9A 4X0KB 3QRFM 1G7IB 1NAKL 3PL6B 5CLTA 5CINL 3ZT5A 5T3ZH 3CZLA 2GCYB 5E9DD 5HYSA 2QQLL 1RUQL 1I8LC 5ILTL 5T1KA 5GNYA 1JMXA 1KN4L 3MRRA 3O3AA 2DM2A 2XZQL 3L3OB 4AIZA 1NEZG 5LJYH 4XZUA 5JTWA 2Z0BA 2DI7A 3BAEL 4LHUB 2GK1A 3T0WA 1CE6B 3QISA 2CMRL 4EK7A 1Q9OA 2X70A 1OQOA 4Y19E 4N0CC 5BQ7B 3TPKA 3KZSA 1JIBA 2C3VA 4ZQKB 4XX6A 3W53A 1BFOB 1FZJB 1Z3GH 1UYWL 1KT2A 2NXZD 4HIIA 3V0WL 4ZSOE 3L3JB 4JANB 1DQQB 1XAUA 1E6SM 3V9FA 2VYRE 3OAYK 3BAWA 3WFCL 3V0AC 2EZ0C 3V5DB 2BVQA 2LU4A 3DMMA 1UR2A 4NQSA 3OJDB 4KKLC 2RGMA 1WB0A 3FCTB 4KJPD 4KWUA 2HJLB 4RIRA 2CKBB 3QWOA 2VLMD 1U0QA 4PYGA 1Z0MA 1DN2A 2E7BA 4NN6C 2WWDA 4C56E 2ZWYA 4WCYH 5FUZL 4U6XB 3BZDA 2DAVA 4BSVB 2Z1SA 4M8QB 4R9HA 3RVUC 1H5BA 3O8XD 32C2A 4P5TB 1I3GH 2ICEB 1FLRH 2HFGL 5DD5H 4AZ7A 1QBAA 4BJLA 4M7LH 3V4UH 3A22A 4U31A 4JFSA 3UJJH 3VIOA 1T6WA 4AY0A 3SUUA 1QP1A 3U2SB 4R2GB 5A6SA 3M46A 2NW2A 1FPTH 4LSRL 3MRLA 4JKPH 3HE7D 4Y7EA 4Q7DA 2XVGA 4U1JB 5TQ2H 4NDMA 4KY1L 1QTYT 4PJ9A 3IU3A 5I8KL 1X4XA 2Z31B 3LQZA 5E4EC 3MROA 4NFBA 2VI0A 1P4LB 3N0PB 5F3HB 5J13B 4WF7A 3AQUA 1OD9A 4I9WE 3KHQA 4M3JA 3RTQC 3MCKA 3OX8A 1KTLA 3EYFB 1GUVA 4LNRB 2QADB 4TNVF 2XTJB 3BH8A 3WLWC 1I1YB 5KW9H 2J2ZA 2XRAL 4MLIA 1JFHA 2J4GA 4UQAA 3VH8G 1FLTX 4MAYC 3Q6GL 5DJ2A 1YA5A 3D0VA 3G6AB 3GBNH 4M1RA 5ABEA 4Z7NF 3BSGA 4Z78A 3QFDA 5IT2L 3RPIA 5FF6A 1QBML 2VE6B 5C71A 4MS8D 2R23A 3G5XA 4XH2A 3DTXA 3DVFA 3TN0B 1L9MA 5L88L 1OSPH 4UT6H 3AAZA 4DVRL 4ZYKA 2D2OA 3BPOC 4R96B 5IHRA 3O0RL 4L4OA 4PJ9C 4S1SH 3WKNA 5M5DA 5TE7H 3WFLA 4P57B 3PWPD 3VX0A 4M61B 3TO4C 2W9LA 2AK1H 1BECA 1J1XH 2ZOKA 3PWNA 4Z76A 2XVPA 1FNAA 4WW1A 4TVUA 2Q6WB 2WIIB 5J1AA 1AR1D 1QEWA 1XF4B 4LSRH 1W1TA 2A6KA 2D7TH 1H8SA 2C3WA 2WWCA 3P9LA 1TQCC 1TZIA 4K94L 3GXPA 2ICEA 1BGXH 1KCLA 4LVNB 2BSRA 3DYMA 1KIQB 3UJIL 4ZPTB 4M24A 3RIKA 5DJCB 1A5FL 3H42L 3FTGA 5DGRA 2V2TB 5LAXB 1KIPB 3DX8A 1KR0A 4U0RC 1H3TA 4X7CC 1YN6B 5H2BB 1YEDA 3JV4B 3PWUA 3PP3K 3SCMD 3CZSA 2J79A 5D7IB 3IDGA 2I60H 1RIUL 3WN5C 5L6YL 5MI0C 2VOTA 4P9HH 1MI5B 3U7WL 3IDIA 1ORQB 3MV7D 4NO5A 5HD8D 4CN6A 4IRSD 4DUVA 4JE4B 2FLRT 5EU4B 5JNYA 2NW3B 4U7SA 3BYYA 4HS8L 3VFSB 1FLRL 3SUTA 1YMME 1C7SA 3QEHB 5IHZB 4ZMAT 4MWFB 5JUEH 3W9DA 1KXVC 1PD6A 1IZJA 3VFPB 5BVPL 1KSRA 5CSZA 4RMSA 3RL2A 5CBEB 5EUOB 4X6FB 3AYSA 3MNVB 3L5WB 1TZ7A 1INQB 2G60H 3GFUA 2VE6A 3VCLA 4WFHD 4FQJH 3SCTA 1A6VL 4XXDB 1UD3A 2FBOJ 3G5XB 2YUZA 4RX4A 3SGEI 5CZXC 2LAAA 5D70H 1F8TL 3IDJA 3BDXA 3MV9A 4LEOB 4QKXB 1CFVH 4QTIH 4NQDD 1SJEB 1QSED 4NC1E 4Y4HA 3BISA 3CZFB 1W1VA 4NC1C 1IM9A 4WFFD 4E5XA 4JFWA 1Z32X 1E6OH 5CGMA 4JO1L 3GMMA 1XR9A 5FXCH 4BQ3A 3O8XA 1UM4H 2ADGB 4IRJD 3WXWL 3QRGH 3RUGA 1UXWA 1A02N 5DJZA 1IAIM 5ESQB 1P1ZA 2R1WB 4G8GE 4PYSA 4AT6B 4DAGH 4PLJC 5FM4A 5ACLA 1CDGA 5E6YA 4NQCD 2ZCHL 3D48R 5T1KB 3BPOB 3Q5OA 1D3CA 3FY1A 1JPSH 1QNQA 5I5RA 4KKCC 2X0YA 2D03H 2H26B 3BGMB 4N0RA 3MYJA 3MRDB 3IANA 2B5IB 1CG9B 3OMZA 1H8NA 2ILLA 3FN0H 3QP3A 4QTHB 5GRZA 1PW3A 2QF8A 3MR9A 3DX2A 3TBWA 5IFAH 2DTMH 1SJXA 3AREB 2VZSA 3MXWH 4NZFA 1PDKA 1AE6L 4JFZL 1NC4D 1RSFA 2WQRA 5T1DL 2NY1B 1NM9A 4FQ1H 3PHOB 5FA4A 2ZIDA 4XNZC 1EO8L 1IGJA 2PW2B 1XV8A 4Y8AA 5EFIB 2AERT 2VN7A 1AHWB 4U6VH 4OKDA 1BZ7B 2AXHA 3TBVB 2BNQD 4ESKA 3LN5B 4NQDE 4Q9QL 2EH8H 1A8JH 4L4TD 1F5WA 3SDAC 4K23H 2X4QB 5DUBB 3OKKA 3HMWH 1MHEB 5TE4H 2DBJA 5K9JH 4ONFH 3VSUA 1E4IA 3QQ9D 4QDMA 1S7WA 4G7YH 4M8QA 3O6ML 1HVXA 1UM6H 4G42A 5DA0B 3T0VA 1NKOA 1FNEB 2BC4B 3QDMA 3W81A 1UA6L 4UAOC 5DUBA 3T1FB 4PTWA 4QOKA 4Z76B 1J7VR 4UB0L 5I66B 4QCFA 3AC0A 4Y5VB 3L2MA 4DAGL 2I9LA 2I9TB 5E5RB 3KPSE 1BQUA 2K1MA 1XGUA 4JREB 1HSBB 3HG1B 5C0AD 4LRIC 3L4YA 2QHLA 2NY4B 3QEUA 2G9HB 3VU2A 4IEFB 4O02L 1NDMB 1U8HB 4OIAA 4Z6AT 4S3KA 1PEWA 4KQ4H 5F9OL 1I1XA 1XGUB 3SCOA 1JF6A 4NRSA 2BSSA 3HCVA 4MHHG 4G8FB 4HKBB 1V02E 4ONOA 4GI8A 2Y6SC 4TVPH 5L2JA 1WGOA 1MFCH 2OSLA 2XACC 4PGEB 4IIQA 2WZIA 4QTIL 3VFUA 4R7DB 3EYFA 1T7YA 5CINH 2DD8L 1RUAH 4PMDA 3K81A 2VUYA 3KPOA 4OFPA 3NZHH 5FKAB 3QZWA 3PZGA 4JN1L 3UTTE 3QHTC 3WO4B 5EZJB 5B8CB 5F9JB 1US2A 1PGRB 1DBMH 5FK9B 2WVTA 4R2GD 1HTYA 4LX4A 4V1DA 5EBMB 1W2KT 4EJ1C 3QFDB 4LGRB 5DEGB 3U6RB 1HHGB 3BKJH 1KELH 4XP5L 2D0FA 1C08A 3SCMB 4GZEA 5FFLA 2GJZA 4ACZB 4QRPB 3PWJB 5FDYA 1KR1A 2G4FA 2MOVA 1MW0A 1OAYL 5E99H 2CBUA 4XGZB 4PJBB 5CP3H 5LBSH 5E2JA 1T03L 3IGUA 4WTZG 4KK5C 4QRSB 1MLBA 3UTPD 1IAKB 1YPZA 3WL9B 1H09A 3FQXA 4TUJA 4N0UE 2CIPA 2BNQA 4J3VA 3VH8B 1IC5L 4WDIB 1T0OA 4RZCA 3D0LA 5JPNB 1DP0A 1JRHI 2L4OA 4OZIF 3RGVC 5IFTA 4R7NB 2ARJQ 4HKJB 5C0IB 5A16B 2KQMA 4UQ2A 1C5BL 2IFGA 4QF1A 5EN2A 1XF3A 1V0KA 2EYRB 1GQIA 4ELMB 3VIHA 4RCAA 3PV7A 3OG6B 3RM8A 4ISVB 2R2CA 5HDLA 4KTEH 2DRUA 5I8EB 1BZ9B 3WFBH 3SCQA 4PBVC 1ZXQA 2ARJB 3JWOC 1P9MA 2N56A 2CR6A 5SX5H 2IBZY 4HWNA 4POYA 4LLDB 1MIMH 3V8CA 5LGJB 1QPPA 1AGCB 4JO1H 5CD5C 3V6ZA 4LEXH 1HCFX 2XUCA 3WXWH 4N9GB 1JHKL 5LKNA 4JO3H 2PO6A 3S88H 3ZQ9A 1UR8A 2WIMA 1LEKA 4ATDA 5HYEA 5DJDA 3DV4A 1ZJBA 2YL5A 4OZFG 2BP3A 2E40A 3QNZA 2IXUA 3MOBH 3DX0A 5JIPA 3ARPA 1G9NC 4OV6F 4ORGA 1G9NL 2O5XL 1EMTH 4HUUB 5HHME 5D93B 3T2NL 1JPFB 1OD7A 2NLJB 2WMKA 1BD2E 4P4RB 3PF2A 2YOCA 3E6HA 4BFGA 3MJ9H 1BOGB 4NRRA 3T0BA 2XFXA 3NAAH 4PRPE 5I75B 2B20A 3DRTB 4HZLA 1TCRB 1IE5A 4HSQA 1GZJA 1FL3A 1KNOB 4POZC 5KN5B 4XCNA 2EJ1A 3O41A 2APWA 2GSJA 1NBVL 3X17A 1VBUA 2J8UE 4W81A 1NLDL 3BE1L 3ULVE 3U0TA 2DKMA 5CWSB 3ULUL 5F6IB 4XVTL 4XPHH 4CD4A 3O6FC 1EEUA 3OZPA 1NDGA 5ERWB 2UZYB 2RGLA 4M00A 1W72L 1OP3K 1AP2B 4FNQA 3H3BC 1VCAA 1UR1A 1JWUB 4RBPK 1R86A 1OIFA 1AGFB 3BDYL 4DTGL 4JKLA 1HDMA 1MFBH 4YPGB 3WXVL 2ZNWA 1JF1B 2XWTB 3ZDYF 1RUPL 4P49A 1OTSC 2VDPL 1FYTD 4H8WH 5FYLH 2XTLA 1F4HA 5FGBC 4HIJA 1E6ZA 3AHTA 4UNUA 1QUNA 4CJ0A 1XF5B 3S6CA 5JORB 1QZ1A 2OYLA 1RIUH 5DRZB 5L6YH 2XQYK 1FFQA 1CVRA 2ZOLA 5J1SC 4MDOA 5DJDB 1A7PH 1FFRA 3RBSA 3V5HA 3AJ7A 4K3EL 1JJUA 4YDJA 4KK6D 4Y2DA 1T1ZB 4U1GC 4J3WA 4KRTA 4UUJB 1ACZA 2CUMA 4Y4FA 3QIWB 4DW2H 1H2JA 2Q7YA 1JNLH 3KAAA 1U8PA 3TYGL 4UDTB 4F8QA 2AJVL 1YUHA 4H0GA 4XCCH 2R2HA 1NP0A 4HUXB 3WDIA 3LMYA 2AI0H 5D2NC 2OYMA 2YC1A 4JO4H 2W91A 2W67A 5CZKA 3NGBC 5GS0L 2DSWA 3VXQA 3GIZH 3S96A 7FABH 3OGSA 3UMTA 4X9BA 2PWGA 3EYOB 1IC4L 1U9KA 2ZUYA 1OCQA 3IDMB 4M6AA 4F9PC 3FRUA 3QPQD 3VMNA 2ZX9A 3D39D 1XFPA 1ZHNA 4Q97A 4XNQA 3X3FH 1J0KA 5DK0B 1QI2A 1B90A 1WIUA 4LVHB 3ZSTA 1MJJB 2C5DC 4RFOL 3NA4A 5F70A 5FECB 3A4WA 3ZKXB 5CJ5A 4P7NA 2ZCKL 3HRZA 4EN3D 4AY1A 5H37H 4LSTL 3MFFB 2WUBL 5E1QA 1A3RH 4IDJL 4NQSB 5EU6A 4D0CA 1YMMD 4B0MM 2WCSA 4RWYL 2WWMD 1ZLVH 3MBED 4ACYA 3SN6N 2EAEA 4JFOB 3U46A 4J8RB 1CXLA 1EIBA 3D5OF 2DLEA 4ZNCD 4F2MB 1TJHH 2IPUG 3FQTA 5BWFA 3MA9L 3WFHB 2R0KL 1DFBL 1X4YA 2WKGA 1XH0A 2FB4L 2R4SH 2E9LA 1S7RB 4NKQB 4YHZL 4KROD 4UTAH 1IAOA 4LPCA 5ALCL 3HG1D 2UVEA 1N2RB 4G6AC 1REIA 1TVHB 2ZOLB 5A40E 2EDOA 3REWA 3WL0A 1U92A 3N06B 1ZU8A 1U8LB 4WHCA 3N04A 1IC4H 1XH3B 3CSPA 5F1IB 3VO0A 2K7PA 2DQGH 1R8LA 3UEZA 4KJQC 5DQDH 1BBDH 5D1ZB 3DSNA 5LXGH 2W63A 4OGZA 4CMHB 3G08A 4KRPD 3GSNB 1PYWA 1WBZB 1SEQL 2VQTA 5HDRA 2ARWA 1ZBWA 1X5IA 3RKPA 1UG6A 1Y6KR 3S96B 2XZZA 4JPWL 5JO5A 1V3JA 1LE5A 2EYRA 4HULB 4M7JL 3REVA 1YEEL 4JAWA 3P9MA 4E8DA 4EI6B 3WS3A 3L9RB 1QI5A 1N64H 1XZ0A 3OJMB 3FONB 3Q6FA 5JR1L 4LLYA 4NFDA 5JA9A 3WH8A 5DMKB 1RZ8A 1Q94B 1JV5A 4MDJB 2D20A 3GHEH 2BXYA 1X44A 1DSFL 4OM0L 3VSTA 5IVZB 4PRID 5DD5L 1MF2L 1LL4A 4LDLB 2WUCL 4PJAA 2FLBT 1CZ1A 3NIYA 2R0LL 2OYPA 3WUZA 5IMOA 1WAAF 1E1FA 4ALAH 3F6IA 4YO0A 4WW2C 1RAMA 2JIEA 3ZKSD 2JTDA 4HD9A 4X6DF 3NZ8B 3QEGL 4L3ED 2QADC 1FNEA 1AI1H 5EU6D 5GSRB 1CLOL 1SJHB 3MODL 3WUBA 3ZKMC 1C1EL 1H3WM 4NJAH 4KGJA 1BBDL 1WISA 1QD0A 3KL0A 4QHUB 3PZ9A 2DIBA 1HKMA 6A3HA 1BAFH 3I6KB 5D1ZC 2XNAB 4G7VH 4UUJA 3CFJA 4PJ5A 1QSVA 3O9WB 1A6ZB 5EO1A 1R34A 4K2UH 5K93A 4PUBH 4JAMA 3DRTA 4HZLB 3NTCL 4KVNL 4CCEA 4Z7UA 2YPVL 3FQNB 4PJDA 1ODZA 3HMWL 1VGKA 1KTDB 1OCWH 3IDIB 4PTUA 2BFVL 3CUFA 2VDRH 3DMMC 3GMNA 1JPGB 3EOBB 5AYBA 3KPQA 4N8PA 1TNNA 1A6UH 1I1AC 4OIFA 1F11A 2YD4A 2YN3A 3MRHB 4XAKE 4CVUA 1MVUB 1FQ9C 3RVWC 4AD2A 1W0YT 4ZXBA 4G6JH 3QEHA 1A7RL 4NQXB 4P4KB 5FKAA 1C5DA 5KBNC 3RZCC 4LMQI 1P84K 4YE4H 2GVYA 1K9TA 4P7LA 3ROLB 1S7QA 2V5TA 3AMGA 1IEHA 1KTLB 2NPLX 3DETD 5HPCA 3MRFB 1SBBA 1KGCE 3CFDB 3RTQB 3KYNB 5CJQH 4PRAA 1SY6A 3THML 3ARXA 4G6KL 4HBCH 4PG9B 1HOCB 4C83A 3D85D 4OZGF 3HZYA 3LEVH 1AVAA 1VRXA 3PTKA 1CQKA 2Y07L 2PWDA 3N11A 4HEPG 1VGEL 3BVUA 3MLUL 5E1AA 1K5NB 3GSUA 4OD3L 3L5IA 1A7OH 1NGXB 1GRWA 2EE9A 3QXTA 3V5DA 1MW3A 2EC8A 4M93C 2X6MA 4LKCB 2F74B 1YMMA 4HWEL 2BJMH 4KTDH 1C92A 3VW3H 4M1DH 3F5JA 1E4MM 15C8H 3JXAA 1X6NA 3VDCA 2WBGA 4S1RL 1KEGL 1IGMH 5EOTA 1CENA 4MQTB 3U9PL 1TVPA 1RD6A 1V6VA 1DUYB 1P6FA 4PG2A 4DWSD 2YA2A 2F53B 2WQ8A 3OAUL 3AXHA 5BW7A 3BWUC 3EFFA 2WIIA 3MBEB 4R8WH 3WIJA 4P2RE 4E41A 2G2RA 1AMYA 4KZEL 4LLUA 3BLBA 3W39A 2BSTA 2V17H 4F9PA 1FGVH 4WTXA 4PRPD 2VABB 4HDIA 4RWHA 4UQ3A 3G6DH 1X5FA 1C8XA 4FF5A 1UR0A 1OTTD 2R1XB 2X4OB 3MMEA 1UKPA 1W9DM 3TTOA 1MELA 2ADIA 2CKRA 2X1WL 1N3NB 5KTEL 5CD3A 3CVIL 1CE1L 3L7FB 4BQ4A 3MROB 1T22B 4J27A 1T83A 4DM2A 3PDOA 4CU7A 3CMJA 3PHOA 4XPGL 4U0RB 5C09D 5I77A 1HT6A 4OZGB 3T8XA 3OJ2C 3D3VB 1JTPA 5KAQF 2BRRH 2DM3A 4NSKA 4NRYA 4Q0XH 2AJUH 4YX2L 5B38G 4FRWA 4BYHA 1TQTA 3UETA 1RHHA 2DEPA 3D4ZA 3SQOL 1NAMB 1R3HB 4XNMA 1C5CL 5IHSA 3MLXH 5GISL 2PTTB 4ZUUB 3KHOA 5I71C 5D7LB 3CC5B 1MCBA 2QLVB 5ICYA 4M3KB 1T0NB 3L2LA 2YWYA 4ZFMA 5D70L 1K2DB 4FZEL 4R3SA 3RUGF 1EOMA 1P7QB 1S7WB 1AY1L 2YHGA 4XCYA 1EAPA 2GT9A 5EWIL 1AGBB 1CCZA 1IILE 4AEFA 4IRJC 2HJLA 4ELMF 1MXGA 3F5KA 4XCNB 3ARFD 5HI4D 1FNFA 1RJYB 4CN4A 4EKXA 2O92A 1NCBL 1CXFA 4Z0XB 5GJSH 3PN8A 3VD3A 3QCTH 1R3KB 3WMCA 3LN4A 2NQCA 3C2AH 2WZHA 2NX5D 2JJWA 4TOYH 1YNLH 2ZXAA 4TULL 3AHYA 3B3IA 1JD7A 5CEXA 3MGTB 5ENWA 2VXUH 4XAWL 5BRZD 3RWCA 1J0HA 3NCFB 4U1NB 1SBSH 3SDDD 4ODWB 5D5MF 4OLWH 3GSWB 4JQXC 1PZ5A 1K6QL 3OB0K 4PGZA 2BNUB 4TNVK 3THMH 4NOBA 1KJ2B 2BCKB 4P2QD 1QQDA 3W0WA 4TVCA 4OB5L 2ATPA 3X3GL 3KYKH 1DQJB 4YPGA 1TQWA 1HHJA 4HDIB 3V4VL 1EBPA 2F8XC 3LIZL 1VAHA 4ODTH 4KMTL 3SJVD 1BX2A 2WLYA 2BVYA 2VDKH 2FIRT 4ZFZB 2D22A 2CIKB 2QQNL 5EOCL 1MCPL 4RGNC 4V1DB 4JHWH 3LHPH 3QG6B 1R5IA 4UOQA 3T2OA 1DDHB 1OCWL 3F7QA 2Z91A 3UZVB 1OVZA 3F58L 1ERNA 3UBXI 5FUOL 4B7LA 2AXGA 1GOFA 4MXVE 4KHTH 4FQXC 1P7KA 5I6XB 1RK1B 1BGAA 1B2WL 3RVTD 2BVDA 2GDUA 4HU8A 3EFDH 5K9QI 1JBJA 2B4CH 5GGTH 1DWGM 2NZIA 2ORBH 4HUMB 5HXMA 5DHYA 6TAAA 2JF6A 1HXMB 1AHWC 3HC3H 4WDIA 3UROR 1K5NA 5C6WH 3K2MC 4XXDA 3DURB 4WNQA 2D7NA 4HIXH 3RNQA 5EU7E 1UD5A 4R4FH 3HC0B 1LO5B 4FMKA 1FZMB 4U6TA 4JZOB 5D8JL 4IOIA 4EDWH 3A67L 3WEZA 3WFEL 1CN4A 2XRAH 3D25B 1T4KB 4Z9KB 3OG4B 4RMUA 3MV01 3QUZA 2GJPA 4FXGA 4PP2A 5FYKD 4FFWC 2J8FA 4M03A 4OSUL 4HFWA 5L9DL 1F2QA 4DZ8B 4QOKB 5FYJL 3RHWK 2ICWI 2ADGA 5HHPA 3BUIA 2G2RB 4NZTH 1KQYA 3NCOA 4GAYB 4L29A 4U1NA 5KOMC 3ABZA 5IG7A 1VGKB 3I6LE 4XNYH 4TTDD 2J5LC 2Q20A 4H1LB 3RZCA 5C08D 4MJ6A 6FABH 5C0CE 3H9SD 3L3IA 2V5SA 4F7TA 3AIEA 1EBAA 4M1CC 1UHVA 5I3DA 3MMDA 2LTQB 2YLAA 2BVPA 1GGIH 3RNKB 3LRLA 4QTHA 5E8DH 2P8LB 4HCRA 4HTYA 2ICWJ 2I5YL 2WM0A 2HG5A 5DJ0B 1SMOA 2D7PA 1UB5B 2UWEB 3L3IB 3D3VA 5L2JB 1A1NB 2FCBA 4FP8H 1JPFA 4WWKD 1LE9B 3CX5J 4PP1C 4ZSOB 3OJVC 3RY5A 2R23B 3S35H 2X1XR 3VFPA 5DUPL 1YY8A 5CKGA 5LYRA 1FL5B 4BFEA 3LV3A 2AEPL 2EEDA 2ZUQC 3BKCH 1FVCA 3KPRB 3GI8L 5C09B 5E8EB 3NFNB 1RK1A 1ODUA 4I0PA 5E7FA 5GSVA 1UD6A 3SCMC 5HYIA 1CD0A 5KS9F 2YA1A 5ETUB 4X9GA 4UIMA 3SGDH 3ZHLA 1NCCL 1SJEA 4JM4H 1DFBH 3QHOA 5EOCJ 5ERWA 4I13B 1GVYA 3IDXH 3HNTL 1UCBL 4OCSH 1G7PB 5H8DA 4YHKH 3TO4B 1S9VB 3TJEH 1E28B 3I84A 2D7OA 4MA7H 5ETUA 1GIGL 4P7OA 4ODSH 3P9MB 4JKMA 5D9NA 1QLFA 2A73A 3D85B 3MLPA 4CGTA 3WD4A 4OCRH 2P48B 2HTLD 1T3FB 2I24N 3WD1A 1JV5B 4MDJA 2PW1A 5BVJB 4KRLB 4BA0A 3BHBA 3AIVA 4NBXB 3FZUC 4TVSa 1W9VA 1WVZA 3VXSA 2OI9B 5IVZA 2AKRA 2BRQA 4JM2B 5F7LB 3T08A 1FCCA 2NX5B 3RZCB 3F7RA 4HWUA 4IM4A 3WNKA 2XZAH 1JD9A 2PR4L 1AXSA 1PG7X 1TITA 3DXAA 4RAHA 4YFDB 4U1LA 4ERSL 3BESR 4ZEPA 5ADOH 3HUJA 4G80A 3CDGA 4NHCH 2HFFB 1KN2H 3QQNA 4KDTA 2EXOA 5DYOA 5TPWH 3SHSA 3SJVA 3L5XH 5C07D 1T5XB 4B9YA 1QHZA 3AZSA 1RU9H 2ITDB 2F54E 1PG7L 4K55A 1CXIA 1S7SB 3V6OA 3WJLA 1NEZB 3WLWD 4PJ8B 2HKFL 1CGUA 1DQMH 2WWMC 4Z7WE 1UKQA 3JUYA 2V9RA 1DBBH 2XWJA 4L8SB 5GGTA 2DLGA 2J5LB 1P5UA 4PRBA 4PB9L 5I1AB 3LRGA 1UZ6E 2FRGP 4FQCL 2VXVL 1EHLH 2CLZB 1QFWI 3TC9A 4Y4HB 2VVSA 1G9EA 3MRPA 4OZOA 1HXJA 4GQRA 4F66A 2F18A 2A83A 5E9AA 2B4CC 1OTUD 3EGSB 3QDJB 1TUXA 1LILA 3BOVA 3N85L 3MRHA 4J6RL 3QHZL 4Y1AD 5GGVY 4R96A 1V05A 2O5ZH 3JV6A 4OZHE 2FGLA 5KVEH 7A3HA 4ATWA 3GZAA 1OB1A 3EGSA 3FB5A 1NANI 1CK0H 1G6RL 5DD6B 4QXWA 3RTQA 5CILH 1IQDA 1WICA 4NPYB 5ECJE 4DGYH 4XNXL 2R0WL 3KG5A 3C5SB 3D85A 5EG6C 4JFOA 1CR9H 1WC7B 5CBAA 3O2WH 2AEPH 2VC2H 1R24A 3BVXA 3RDTB 4JEGB 4AM0B 4F15B 1TG7A 4H1LA 3PL6A 1IQDB 4NPYA 5KJRL 2XIBA 5LQBL 1D6VL 2QLYA 3T2PA 3FRPG 3MSGA 3I50L 4AENB 1GQJA 1H3PH 5DO2C 1UD4A 4N5ED 4YXHL 4Q9BA 4JY5L 4OJFL 3ULVL 1WCQA 3TN0C 5JIIA 1KWKA 5DRWA 4N0CD 2DTSA 1CWYA 1BZ7A 1YQ2A 4YHOL 2IG2L 4NUJB 5D2NA 3CMGA 1OAZH 3VRJB 5C2BL 5KZCB 5JORA 1EHLL 3CFCL 5I18L 2V3EA 2W38A 3FT3A 5DRZA 2J7FA 2A74B 1UKSA 3QUXD 3OB0H 4RFNC 1II4E 5AWNL 1MH5B 1WEJL 2OR8A 1JN6A 1OGTA 1UA3A 1YY8B 1NAMH 3IDNA 2EEBA 1L0PA 2WC7A 3L3JA 4JANA 3UYRL 1WDQA 3NJ3A 5I23A 5C6TH 5TH2B 1TTFA 3RZWA 2YLLA 2QQKH 3A6CH 3SCSA 4P9MH 5CZVL 3G5VB 3FO0H 2UYLB 5EUOA 4FNPA 2XSBA 4HG4K 4UV4H 4WFFE 1MAKA 2NY0C 2ZUQB 3RVUD 4NQDB 5KN5A 4D0DB 1SYVA 4PD4K 1K4DA 1C90A 1H49A 3BIBX 4KUZL 4FQ2L 4KK8C 4Y5VA 3RKDC 5HYJD 3W6MA 3T1WA 4PR5B 1OD0A 3QUZB 5JHDA 3QEQB 1CQYA 2IGFL 1MFNA 2BVOB 3R1GH 2HT2D 4KI5C 2R69L 3T0AA 3O2DH 2ZZUT 3ELAT 5EO9B 1R3LB 2NY6B 3WD5L 4Y5VC 3VXUA 4NZJA 3MJGX 4L29B 3N15A 3D69A 4IJ3C 1DL7H 4QRUA 3GMLB 2XN9A 3PP3H 5T5FH 4KK5D 1H8OA 3TZVA 3WKMH 4YJZL 4QNPF 5ANMA 3DROA 4DQOL 2QSVA 2KBGA 5HI3C 4GXPA 1AIFA 3HE6B 4G8GB 1ZEAH 3HNVH 3ZL4L 2V2WA 4LIQH 4NNXB 2VLKD 3W24A 3MRIB 3GK8L 3IJ7A 3KPLA 4WWKA 3L3HB 1FFPA 4GMTH 3WSUA 8A3HA 3QIBC 3HI5L 2FX9L 2Y5EA 3DWTA 5J13C 4QOKD 1JUFA 4QRRB 4Y16D 3PZIA 1T5XA 1UASA 3CFIC 4M5ZH 4UOZA 3QUYA 2R56H 4W6WB 5IB4A 1C3FA 5DRNA 3K0WA 4FQIH 4HUNB 1DLHB 4FXKA 3A6OA 3EMCA 1OAXL 1KCVH 2GHWB 2PUQT 1YJDC 3ILPB 3U83A 3UO1H 2CLVB 2HMIC 1MREL 4L4TB 4KUZH 2DDQH 3AFBA 4V2CB 1ZLWK 3EOYG 1S7UA 1L4IA 3S8WA 4QHNA 3BZ4A 2EKSA 2HN7A 3QFJD 2J47A 4XXCA 4WY7H 5HD8C 2XIDA 4L3EA 4MCZB 1QNOA 3ARQA 1QNSA 3LEYH 1N64L 4TUKH 3WY2A 2QMJA 1AKJA 1FH8A 1V6YA 3GH5A 2F2HA 3L6FA 2BMKA 5A6BD 1WZMA 2VL5B 4GW1B 5K9KB 3CFCH 3RJDA 3UDWC 4Y4HD 4U4BA 2R2BA 3QWRA 4TPRH 4PMYA 4XRCB 3QUYC 4AQ1B 3AREC 5DS8A 1PKQB 2EDBA 5HYQA 5HSFA 4ACPA 1FDLH 1ZGLM 4NI3A 2VZTA 5AUMA 4DEPC 5JW5B 4IRZL 2NNAB 4GW4B 2QR0A 4G9DA 4LRNH 3IU4L 3UERA 4GO6B 1KPRB 3QH3B 3C87A 1KLUA 1LEKB 3QQ3B 3OXSA 4XVSL 3HZKB 5TDOA 2UY3A 3UTTD 3QNZB 2GJRA 2C26A 1RMFH 5E94B 4HK3N 3WF1A 5IVXF 1T04B 4GQPH 2M8XA 3BCFA 1MJUH 4R5EA 5BXTA 3VDAA 4LPTA 4FTVE 3TF7C 4JKKA 3SE4C 2CSPA 1TTUA 3CO4A 2IAMD 1J8HE 3EMQA 4NNPH 2B0SH 4XTRC 1ZTXL 3GM0A 3EYPA 4PLKD 1BP3B 3TIDB 5FDWA 2WKLA 5KS9B 3MO1A 4UAOB 4AXNA 4JZNB 3N1FC 4XZWA 1WDSA 2V7NA 4MCYA 3ZDZE 43C9B 3SCPA 2DSZA 3RM9A 3H8NA 4O5LH 3ULUF 5DEGA 4LBEA 3RZCD 1XCQB 3Q0HA 1V3IA 4MSWA 1PQZA 5CEZL 1T21B 1NMBH 3SKNB 1GJWA 4OTXL 3D39A 3U0TB 2YD2A 3IU3B 5SWZB 4QNPE 3GMPB 4K3HA 3VFWA 4YUEH 1QSEA 5IFAL 1IV8A 1JGDA 2HTLC 3HC4H 5DJ0A 2ENYA 1V8HA 1ZT1B 4ZDHA 2WCGA 2E6QA 4FFZL 5C7XH 2G3MA 5DK2A 1N59B 2EDWA 4R27A 4MMZC 2G5BA 1AGFA 3LKSB 3M8OL 4E41D 2XGBA 5MP6L 3C5SA 1H5BC 1DE4A 1A47A 3RAJH 5B22A 4RGNE 1I7ZB 3VFMA 4XCYB 1TFVA 5E08H 1S78C 1Q94A 2PBOA 1IL1B 4GW5A 5HYJB 5IKCB 5SWQB 2VCAA 5GS0H 1YYLL 3PL6D 5HI3D 1J8KA 1M7XA 5MHSD 5E2VL 4L4VE 5DEFB 4A2MA 1ITXA 4OQTH 4NZCA 3VA2C 2V5RA 2CDEA 4WFEE 3GNRA 4P8XA 3B3IB 3GXIA 2GJXB 2GK0A 4K7FB 4FQLH 4PJ7B 5IBTH 1A6AA 5CCKH 3DO7B 2RQ8A 5I8KH 4XT1C 2C1PB 4M48H 1MEXL 3ARBB 5DD3H 4OLZH 3ZR5A 4UDTA 4J3OC 3TEUA 5INCB 5EOTB 5JQ6H 3C6LD 1W72B 2W0FB 3P73B 3X13A 4M62H 1NOFA 35C8L 5EZIH 1A6AB 4OCYL 4X99A 4X5WB 3CX5K 3RPMA 4MNQB 5LCVL 3VA6A 1ZSDA 5D2LF 2AJ3A 3TIEA 3GO1H 2VLJB 4QY8B 1PBGA 3BQUD 4U1JA 5ICXA 4DO5A 3MBEC 3FQNA 2V7NB 1L0QA 2BSTB 1HHIA 1OM3L 3NCBB 4X99B 3BAIA 4JKWA 1EVTC 5HHOE 3OR7B 3MOAH 1Z9LA 4P2OD 5DT1H 5SWZA 4CMMB 2WMGA 3MREA 4HJJL 2XICA 4WHDA 3A47A 2HRPH 4F15C 2ZX6A 5EUKA 4JFEB 4XBPB 5F1NB 3IDYC 5IOPA 4LXFA 2IQ9L 2OSWA 3WSQH 4NRZA 4KAQH 2O26U 2ZWLT 1NAMA 4M1CD 5CIPB 1SHMA 4D6HA 2TAAA 3DI2B 4JFEA 5I1AA 1NBYA 3MRNA 3LPPA 1UWQA 3L3GA 3WE6B 4FNTA 1FYTB 1A7BA 3OSKA 2VIRB 5L8JB 3L5WA 2D7TL 4LARH 3WFHA 5T3ZD 5I71B 5EB8A 3DUSB 5I1EL 4H2CA 1T0MA 3VPLA 1UWGH 4OF6A 3UR7A 3MMWA 5BJTB 5INDA 5I15H 1SYTA 3R8QA 4GKZA 2Q6WA 2B1AL 2YZ8A 4HWZB 4PJIA 3MLSH 5A8NA 3SDXE 3O6KL 3ZE2F 4L8BA 1I3UA 1ETZA 1MJ8H 3RWIB 3HB3C 4NFC<