2DIJA

Complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
Total Genus 239
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
239
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLFDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Structure of cyclodextrin glycosyltransferase complexed with a maltononaose inhibitor at 2.6 angstrom resolution. Implications for product specificity.
pubmed doi rcsb
source organism Bacillus circulans
total genus 239
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1998-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dijA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2dijA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2dijA01
4ML4A 1MCRA 4ZUTA 3VWJC 1J5OL 3SCMB 2D7TL 1TQCC 3BX7C 3ZE0F 1NAKH 4LP4A 2YEZA 1WPCA 5A2CA 4NQUA 3BZDA 1QQDA 2V5TA 4M93C 4U3CA 5I19L 3FFDA 1FFPB 4XBEH 3C87A 5IR1B 3VWJA 3SCRA 4JCMA 1L7TL 5E4EC 1W8OA 2B5IB 4D9LL 4R5EA 1T0NB 3EZJB 3W0WE 3W82A 3AQUA 1IEHA 2XIBA 4CU6A 2YLAA 3FQWB 2OR9L 1HXKA 3P4MB 4X9HA 3CUGA 3MA7B 5JZ7C 3MCKB 5HPOA 3B9KA 3WIFA 2R1WB 4O4YH 2J8UE 2P8LA 3BEWB 3CHFA 5J3HC 1TNMA 4JLRA 4M9OA 1EUUA 4QY8B 2EKSA 1U58A 4MA7L 3LXBA 3CFIC 1S7TA 1Q9LB 2VUYA 3G5VB 3QEQA 3T09A 3UERA 5FHAH 4Z7VF 3WXWL 3JUZA 3GK8L 3X17A 3ARZA 4HUXB 4LAJH 1BFOA 3Q5TA 5C0CD 4APQC 4M48L 3AY4A 1TE1A 4NN6C 2YL9A 3LS5H 3C9NB 5DD0L 2G8ZA 1C1EL 4LBEB 5I1IH 2XZCH 2EPKX 4OCXL 1DQJB 3L5WA 3CSYA 5LYRA 1IE5A 4OF6A 2J8UF 2WK2A 2M8XA 3LD8B 3FB8A 1J1OH 3E6FB 4AJ0A 5C9JA 1G01A 4XC1L 4KJYA 4GSDH 2OMNA 4EE9A 5HPCA 4Y5XA 4GS7C 1CFSB 2Y7QB 5E08H 5FGBC 4HUMB 2R2HB 3FQUA 1CDUA 1XV8A 2IAMB 3F12B 4MGXA 3VXSB 2ZUMA 1G9EA 5EOCJ 3N85L 4N8CL 4PRIA 4QEGA 4UQCA 5A6KA 1ZS8A 3GUTB 1CGTA 1K4DA 3MRQB 4W8LA 3ARGD 3WNKA 3M1BB 1B3WA 4ODSL 3ULUL 3POCA 3IAQA 5ECUA 4DKFH 4KJQD 3NCCB 1ITCA 4U1KB 2HT2D 1TLKA 4KK5D 3EYPA 2XWJA 5K9OA 3N9GL 2IAND 4Y4HD 2VLJB 4HC1H 3G6AB 2Z92A 4AEFA 4C83B 2OYMA 3QXTA 1GL4B 8A3HA 3BUIA 1YEJH 3JWNC 4L8BA 1I7RA 3UJTL 3G04B 2FJHB 1NMAL 3WF3A 2VXUH 1AQDA 2VL4A 4JN2B 3IJYB 2QV4A 3VFWA 3QNYB 3ZTJH 2NY0C 1OAUL 3BESR 2VQUA 8CGTA 1XIWB 2Y9RT 4FP8H 1U2HA 3G9VA 2OL3B 4HFUH 1UC6A 4YN5A 4XVJL 1PG7X 3T0DA 3MRJB 1BVLB 1L0PA 5KS9E 2OJZL 2DI7A 4NKDB 1NCCH 2LFGA 4O2CA 2VC9A 3ZLQC 2N56A 5JHLH 4Q6IC 2YUXA 4FG6D 1B9ZA 1MJJA 5C3TA 3V4UH 5IGXL 1EA9C 1LK2B 3GBMH 1YMHA 4KRPC 3QI9A 2ID5A 1QNSA 3W24A 3RGVA 4OZ4A 4FXGB 2X0HA 1NOWA 5D7SH 2VXQH 1UR1A 1FG2B 3QUZB 1XCXA 1QRNA 4HKJA 4FABL 3SGJC 5GHWH 1N26A 1I1AC 1R3IL 4K7FB 3ZSTA 3FZUC 3ESVF 5A3ID 4PRHE 5GGVL 4NQVA 5EA0L 4Y4FC 2F53E 5D93B 5J7CC 4WSKA 3SUTA 4U6YB 4GG6E 4R8WL 5KS9F 4PJEB 1DLFL 4PJ9A 4OIFA 3GEWB 1L7IH 3FB6B 1F13A 2Z4QA 2OZ4L 3QWQB 5F3HB 3WKMH 5T33H 5FV1L 2X70A 4BFBD 4WIQA 2B7DT 4BJLA 2HRLA 4JKMA 4XAWL 2P24A 4WLCA 4RA0C 4GMTH 5CFHA 1AIFB 3H3PL 3P11L 3Q3GA 1H3TA 3TJHD 1S78C 5I30H 1P1ZB 3ZDYF 4OF5A 2B1AH 3TA3B 1Q4NX 5L2JB 4KROD 4MAYD 1YEKL 7A3HA 3OPZH 4TN9A 4TVUA 1AR1C 4GG6F 4ZE4A 1FSKC 4MVBD 1NFDF 1MREH 4MDIB 4GINA 4NC1E 1T21A 3MGTB 5F9OL 3V8CA 5FL1A 4Z18A 1ZLVK 3SJVE 3O9WC 4G7VH 1R7AA 1MHCA 4GO8A 5FM8A 3VW3H 1L6XA 5I24A 1UZ8A 3BMVA 1BVKB 5CWSB 2FLBT 2J88L 3PUCA 4RMTA 3TF7C 2XFFA 3U4BL 4S2SA 1QBLL 1BM3H 4U1LB 5FYJD 5F96H 1RV6X 4Q9QL 4EN3B 3BAKA 4H25A 4FFWD 1E72M 2Q7YA 3RM8A 3VFGL 3QG6B 2IWGA 3FHAA 1AH1A 5GSRB 3W2DL 2VQ1B 3MRNB 5A95A 5I1GL 5FKAB 5JW4M 1B4RA 3BP6A 1NDGB 3LEXA 4CN6A 1G0DA 3JV5A 3B5GA 3NCBB 3QCTH 1URLA 2AJZA 3S35H 5E24E 4AENA 1MCFA 4NM4H 4XI5C 4AZIA 4D0BB 5GRVL 3VH8A 4EI5A 3FRUB 4CJ0A 4X4YB 2XQYG 3HMXH 4MD4A 3IKCB 4O9HL 4ENED 5EO1A 3CDCA 1D5MA 4JFZH 1E4KA 3V0VB 3MFGB 5C6TL 1BAGA 3FOMA 1BFTA 3WIIL 3KNBB 4PJXF 3E2HB 5A94A 2CK0H 4JDVA 4LCYA 3V4VH 5CQ1A 4MAZA 2QJDA 4KMTH 4PJFF 5JPMB 2FHFA 1I8KA 1YZZA 5EZLB 3L5XL 2YMXH 1V0LA 1A7NL 1U8KA 3IFPB 5TF1H 1YNLL 5DRXB 3CZGA 2AKRA 4KTYA 1YMMB 3HC3H 4Z5RB 3S6TA 4DK3A 4XPAH 2DQIH 3O4LB 4O51A 1MUJA 4RGOH 1K4CB 1FO0A 4G6AC 3AAZB 4XT1C 1IQWH 4U7SA 3V7MA 3VFPB 3RJYA 1A02N 1NL0L 3VX1A 4N5ED 4ACZA 4AD5A 1FHGA 5JO5A 1LGVA 1Q9OA 2QL1A 2P7TA 3LV3A 1P4LA 2ADFL 2CBIA 2ZNXA 2VZ3A 1MFCH 2GT9A 1REIA 1RJYA 3N0PB 4XCNB 3RA7L 4QYOA 4R4ND 2PBOA 3ULSA 1YYMH 2VLME 5TQ0H 3RIAK 3V5DB 1SJHB 4WKAA 4G6MH 2IG2H 3G6JB 5SX5H 3CLEL 3U0WH 4M6MH 2CUHA 4J3TA 4TSAH 2JJSA 4OD2B 4XP4L 1UWSA 1MVFA 3V8OA 5EZJA 4TSBH 4HV8A 4HIJB 3ARQA 5E9AA 2ZUNA 4GXVL 1G6RB 4N9GB 3T77A 4ORGB 4R96A 5HYJB 1W9XA 1EDQA 1KIRA 3GSNH 3B2VH 3L9RA 3NABH 1PX3A 4M7JL 4OIAA 3ARDA 4HEME 3F62A 2VLKE 4ZD3L 4RISL 1FGVL 1SM3L 3LKNB 1MCQA 4OBSA 3S37X 1XT5A 2CIIB 3QSKB 1T04B 3I3BA 4DM2A 2VZ1A 1RVFH 1R3JB 1JDCA 4KI5C 3GB7A 4OQ1A 4ZFZB 4XMPH 1OPGL 1GOFA 2HJFB 2WPGA 2X1XR 4NQXA 3LCYA 2C5DC 4JPWL 4UTBH 1G7QA 5JXAH 4P2CG 1H4PA 3E3QC 2Y5EA 5GSVB 1IKNC 3SO3B 5DMYA 3EBAA 2YPVL 3QA3A 1I85A 4NZTH 2VLMD 3AS3A 4PLJC 3T4YA 1G1CA 5T1LD 5IEKB 2XFYA 3CHDA 3GSRA 3D85B 2O5YH 4ZXBD 5B3JE 1D5IH 4JJ5A 5F70A 2XZQL 4WKFA 5D1QD 3RWEA 2FYYB 3U9PL 2DQUH 5DA4A 4PREB 1R7OA 1IM9D 1U8HB 2Q7NA 5B38G 3BKCL 3EYSL 3SPVB 3RWFA 4JKWA 5IMKB 1GJWA 2BOCB 4HIIB 3EDJA 3CVHB 4JZJB 2XWTA 4BS0A 5SWSB 2IALB 1YN6B 2VLKD 4XNUL 1MJ8L 1ONQB 1TTUA 4Z77B 4JM2B 5B3JF 3CJJA 3WUWB 4TTGA 4RRPG 4X7SH 2R2EA 1JPST 5J6HA 1R5WA 3BYYA 4YR6B 2CYGA 2VX6A 4H8WL 3PQYB 1HHIA 5F93C 3EYFA 3OKYA 4BQ6A 2Q86B 5ERWB 5C0AD 2HKFL 4M7KH 4NWTL 1NGYB 1E70M 1OTTD 2UZIH 2YPLA 5C08E 4X6DB 2GFBA 5CP3H 1AKJD 3CH1A 4ZO6A 1EXPA 5A6JA 3LPOA 3SQBA 1X7QB 4JPIA 3RWDA 1DBJH 3QXAA 4WUKL 4PV9B 4ZSOB 4JIEA 3S36L 4BUGA 5IVZB 3POHA 3QO0B 3I9GH 3L7FA 5I73C 3OF6A 3NSNA 5FGCE 1B4JH 5HHVH 3NAAL 5I6XB 3P77B 3KJ4B 1G7LA 3ZDZE 1CGSL 3CNKA 4LKXB 1O7AA 4KQ4H 3LRLA 2PYEB 3CDGA 3JV0A 1KCSH 2ITDA 4G7YH 4XHJC 1K2DB 3NUKA 4G3YH 5ITFB 3B9AA 4GBXB 5HNNA 1F4YL 3PL6D 2GDVA 4GI6A 2CBUA 1TMCB 1VADA 4DWHA 2V9QA 4LSPH 5I76A 5IFAH 3VIKA 5BQ7A 4ZFFA 3SCVA 2YPKA 4X4XA 4PLOB 3CPLA 4NI3A 2IADA 1P6FA 4KTEL 1JGUH 1PGRB 2F58L 3LKOA 4RGND 2IPTH 4FMKA 3IDXH 4HIXL 5I17A 2HT4C 2XN9E 3K2MC 2VLRB 3TP4A 5A6BD 5D5MB 4U1MB 1F3DJ 3PP3K 1KBKA 3JV4B 4JGJA 4NIKB 4RFEA 4RCAA 4CUCA 4WY7L 3T2NL 1BFSA 1J05B 4PPTA 5IHSA 2Q8AH 4TRPL 5EIIB 4KUCF 4HAGA 4OZHA 3I84A 2JF6A 5DMIL 4PJ7B 3VXUE 1TQBC 3WY3A 1G7JB 5C0EB 3M17A 4MNJA 2NY6B 4D2NA 4YHML 3MUHL 5E4IA 1MVUA 1NEZB 1VPOH 3WHXA 5IMLA 2XFXB 1WLHA 1JZ2A 4FNSA 4C56E 2ICEB 2VZOA 4K8RH 2BVOB 4MMXC 3QULA 3QEUA 2QADB 4W4OA 4MXWL 4M1CC 1CTOA 3GSVA 3ARBA 3IAPA 3S4SG 4P7QA 4FNPA 1UENA 3MRHA 5I1EL 1KIQA 1KB5H 2BNRE 4V2CB 3R1GL 4MNQB 1BOGB 2ZUQC 4YJZL 1U8JB 3V79C 1FL3A 5KG9A 3LQMA 1MIMH 3DETD 1IEAB 4KUCD 4WHDA 1WIUA 1ZLUH 4FQLL 3P0VL 1RZ7L 4AH2B 3WD3A 3MRFB 3OKMA 2UUDH 1JGEB 5EN2A 4HJJH 5FYKH 5D9MA 2W9EH 4PJCA 4KI1A 1OAYL 4XNXH 3HS0A 1KCRH 3V6OA 2K7PA 2Z35B 1IFHL 43C9B 1JMXA 1YEEH 3VCLA 2NTSP 5F1NA 3HMWH 1BLNB 5EC1B 4LVOC 3AB0B 3STZA 3AIBA 4JFXB 1I4FA 1D9KB 2ICWJ 4BQ3A 5HHXH 1JF1B 1N0LA 3GJEA 2RCSL 4ZG1A 4PB0L 3GXFA 3VXUD 2PR4H 3F7QA 4TTDD 4NJ9H 15C8H 5CS7A 1MAJA 4J6RL 1F4WH 3GMQB 3BSZL 1HH9B 4I1NB 3LPGA 5L7XL 1NUNB 2EDQA 5DJZA 2O5XL 4ATDA 5GGTL 3GH7A 1BFNA 4C56D 1F58L 5BV7L 4JM4H 4DQOH 4V2XA 3EJQA 5DD1H 5C6WH 2G5BB 5F89A 4BQCA 1MRCL 3MRRB 3GM8A 5KVGH 2GDUA 1IGIH 4HK3N 3PZOA 3RWJB 3L3IA 3VFMA 4GI8A 3CZEA 4UILH 2BNRD 3MRCA 5H94A 1FP9A 2E40A 2D7QA 4KWUA 3QZWA 5CD3A 4UQAA 1NCWH 3MREB 4ODUA 4KJPD 1UWRA 2J5LB 4YFLI 2BCKA 2MJWA 5EUOA 4OFYD 5L2KE 1CLZH 4ALAH 4XAKD 3PZIA 4CCDA 1MWAA 4Z2KA 2UYLA 1W9VA 5ADOH 3RWIA 1M7DB 2J7GA 1BJ1H 2ZUVA 3VD5A 2DYPD 2V3DA 5BXFB 3B2UD 4UTFA 1A9BA 5C0CB 3O3AB 4S1SL 3TH2T 4J4PD 4JHWL 5AYIA 4TVPD 5E56A 3MRMA 2DQJL 3C60D 3PHOA 5DUMH 5EH1A 5GS1C 1U8IA 5DEGB 1T89A 1YYLH 2PXYA 1C7SA 4NXSA 3AJ7A 2XACC 3BN9C 4XMKH 1PLGL 2D7TH 4FQHA 3SE3C 3TYFB 4WU5B 1HKKA 4JFDE 1CXFA 1FVCA 3WJJA 5J4MA 3D0VB 4Z7WA 3D2UA 1NGWB 4CU7A 1IAIH 4Z7VB 1L7TH 2QR0B 3EJPA 3L3HB 3IJ7A 4IRSB 2D22A 4HPYH 3GSOB 4PRNB 4X9IA 1B6UA 4DVBB 3JWOH 4CCCA 3TBSB 2DI8A 4YXHH 5TE7L 1H1NA 5IHUH 3PWJB 4GZJA 5FUZL 3JWDL 3V6ZB 2EIEA 2IANB 5FCZA 4QRSA 5KEZA 4LSUL 3IS1X 4PJIE 3WH8A 4MA7H 4YHIB 3DO7A 5L2KD 2UZYB 2AK1L 3ZE1E 5TE4H 4ZPTA 5LBSL 2G3NA 3VG9B 4MNLA 4PP2A 5F71A 3UTQA 2NXYD 4OIIH 4M48H 5CEYA 1MQKL 1ITBB 1I8IA 4ZOEA 4JAMB 3VXOB 1DBML 5DD0H 3VRLE 4QXTA 1WEJL 4I4WB 3TO4D 4OGYH 4OCXH 4EI6A 1TNNA 3SO5A 4W89A 5LQBH 5BVJB 4KUZL 2F7QA 3QDGE 1AGCA 4G8GA 4L9LC 1NGZB 1CVRA 3T08A 3T8XB 3OAZK 3KWWB 3CFKB 4O5LH 4FHBD 1E27B 2X4SA 1MH5B 1YA5A 4OUEA 1EGJA 3AM8A 4KC3B 1E6XM 3M6DA 4RFOH 4JHOA 1CGVA 5LAXA 1MEXL 1XF4A 3MMWA 4L4VB 5FCSH 3V95A 5KSUA 5IB4A 3CZFB 3SDYL 3S6CA 1NLBL 2CXKA 1S8DB 2CLRB 4JFDD 4DWSC 5CHNA 4YH6A 3DHUA 1HK6A 2J8FA 4YBLC 1JPGB 3MGOB 4OSUH 2Q6WA 5E8EB 5D8JH 5B8CB 1SBBA 2HLAA 3AHTA 5T1KD 5EBLB 3MRGB 5HTSA 1A6ZB 1QFWM 3QISA 1FNEA 4ODSH 2UWEB 3BVTA 3JUGA 3C6LB 4OCRL 2WWCA 3BP7B 3PZUA 5D1XA 1I3UA 4P5TD 4S1DC 4OF7A 2APTA 4LNVA 3SOBH 1HE7A 1IBGL 1GRWA 2EDEA 1AGBB 1U93A 5IG7B 5ICYA 4DZ8B 3MV8B 1PZ5B 2WWMD 5TDPB 2GTZA 1K8DB 1AP2A 4HKZA 4MJ5B 1MI5A 3CGTA 4PS4L 2C8NA 1T4KB 2OTPA 2X9XA 3UJTH 5CPSA 4OGZA 3THCA 1HHJA 3BZEB 4D8PB 1GUVA 4XCCH 4PRDA 5MERB 2Q20A 5CD5D 2AOSA 5TJWK 5IK3B 3C6SB 3VWKD 3SE9L 1F90L 1Q6EA 4DGYH 5DJYB 5DK2A 3C5ZA 1QNPA 2AABL 2J79A 4PJHA 1SYSB 4IJ3B 4CW1B 3EAKA 3QDGD 1WAAE 3ZYIA 3G6DH 4PUBL 5KS9B 2OM5A 4Z7NF 5CGYD 4L3EA 4YHZL 3T0EE 1EO7A 1ZA6B 5IGXH 4CD6A 2WBJD 4HG4J 1UR2A 3VFSA 2FH8A 3VD4A 5DT7A 3D3VE 3F5WB 4UU9A 2R1XA 1A4JB 1NBYB 3CDYA 2OW6A 1A1NB 1NAMB 2VI0A 2QSQA 2YL6A 3O6LL 4FABH 3M07A 3PXJA 3WSQL 3DUUA 4B50A 5IBLD 1CBVL 5D2LA 1EUTA 1B1YA 4QOKA 1JGLL 3BQUA 3K2UL 2XFRA 1CK0L 5D7IA 4W7UA 4D1JA 1RFDL 3WDJA 4GG6B 4OCWH 1HXMB 1DBKH 1NFDB 1A6AA 2EDFA 2R56L 1EZVX 1VSCA 3VI4F 3WLWC 3PWUA 3ZZ1A 3GNML 4ZOAA 2V3EA 1H15B 3QEGL 5DMJB 4JREC 1WWAX 1U3HA 2OL3H 2YD8A 4IS6A 5C07B 4AMCA 5KANI 2F2HA 2WBGA 1PKQB 3U36B 1IGTB 3HNTL 1Q0XL 1C5DB 5FEBA 4KHTH 1UZ4A 2XICA 4KRUA 2ICWI 4DKEH 4F9LA 5DHYA 2MNUA 2NY1D 4X8JB 3QUYC 4JJHA 2UY6A 3UYRL 3EO0A 5JMRA 3EJYC 2XI9A 3SGDI 4G6KL 1KNOB 1VCAA 4MHHI 2WANA 5F9OH 5FGSA 3FB7B 2YRLA 1PBYA 4WKHA 5EU3A 3K4AA 4WCYL 1O7DC 2BSRA 2BY0A 2O26U 3LKQA 1TQVA 3I75B 4UINL 3LKPA 1KLUA 4MAUL 4G5ZL 3RUGA 4W85A 3QUYA 3VRJA 1X3DA 2I07A 5C0JA 4C4KT 3MV9B 2ZCHH 4BKLB 2C4FU 2Z31B 3VMPA 2QHAA 2J88H 4K3HA 2I9TA 3W0KA 5I9QC 2JB5L 3VFUB 2YXMA 4L4JA 3WEXB 1X5JA 2GHWB 2UY3A 3ARFA 4WI4A 1OGSA 3U6RA 3VFGH 4PJXB 4MXVE 4WTWA 3WH6A 4PJFB 5H35B 4CGTA 4OZFA 5M94B 5DJCB 4KKBD 1V0KA 3D39E 3O3DA 1VFBA 2WWKT 2J7DA 1W91A 2EH8H 3RU8L 2R4RL 3LSOA 4P9HH 4ZFOL 3KG5A 1EHLH 3BP5B 4RIRA 2XXMB 3CMGA 4Y8AA 3GMNA 2WUBH 1T5WA 3KS0J 4BA8A 4HBQA 3AFLA 3TFKD 2XKNA 3QIWC 2APFA 4S0TD 3RZCA 5F7EL 2L0DA 2OTWB 3DI3B 3HHRB 3O45B 5ITBH 4HJ0C 5CZKA 2MPAL 2EXYC 4ZYKA 3G6LA 4MXVF 4XCYB 3LY6A 3VGHA 5BS0E 3BD4A 2NX5E 4YDLB 3CZJA 2APWA 1A1MB 4G43A 3NN8A 2FL5A 3HUJE 4PMQA 4OFIA 2NZIA 3QB7C 5FIPA 2GJXB 2IH1B 5EPMA 2HT3C 5DI8B 4DVRH 3EYQC 4XVTH 5HJ3B 4QXGH 4NO5B 5F97E 4OD1H 1CICA 2ZJSL 4EIZC 2IPKB 4P2QA 3CIQA 3DROA 3GBNH 3P4NA 1TJGH 4I77L 4TUJA 4F2MA 5C09A 4NXKA 3AGVA 4YZFE 1W9DM 2WLYA 5T5NG 2RGLA 1YY9D 3HAEG 3EOAA 5J1AA 4QRQA 4PRBB 1D6VL 2J4WH 1GQLA 5IHBA 1HOCA 1ORQA 3RA7H 2E8YA 4P3DB 3D39D 1EEYA 3G6MA 4I3RL 4LLDA 3QAZB 1OAKL 1MLCB 3BDYH 1OD0A 5D1ZC 2R23B 5T1LB 1JWUA 3GJFH 3MRKA 5HHMD 1KENH 3V0WL 4XP4H 2PKDA 4YHLL 5GRVK 2O9TA 3QNXB 3TN0D 2EDOA 2XWEA 1GVYA 2BFVL 5HI4C 2NQCA 1V0NA 4YHKH 1C3FA 1QBAA 1PEZA 2A0LD 3REVB 5KSBA 5E8NA 2WKGA 4JVWA 1A14H 4OZOA 5BS0D 2Y24A 2NX5D 2PTVA 5HVWA 3IDNA 2ZG2A 4PBWD 4YWGH 3DMMD 3RVXC 3NZ8A 3L95A 1OQXA 43CAB 4W87A 4XP6L 3QO1A 3PZGA 3PE9A 4P23B 1RK0B 1TMQA 2OK0L 1N4XL 2QQNL 2WQ8A 1MJUL 1Z9OA 3TGXA 3OKDB 1SEQL 3V6FA 1K9FA 5IDIA 1NBZB 1OPGH 4IRJB 5JW5B 1W0VA 5C7XH 2NNAB 1H9VA 5C0AB 1A3HA 5JQ6L 1HX0A 1CGWA 3ZKQD 4JPWH 4U6HB 4AD1A 2W0KA 3QJHB 4HS6B 4Y16A 2OR8A 3VA2C 3ALGA 1T2QL 4G9FD 4LPXA 2GK2A 5M3WA 3IVKB 1IL1A 1EMTL 5INDA 4XBGB 1G6RH 4PJ5A 3MRDA 4U1SA 2FJGA 3MJ9A 1IC7L 1JI1A 4R0LA 2GVYA 3CZ8A 4AYSA 4XZBA 3VG0H 4ZUUB 2PW1A 3LDBB 1UKTA 2KPNA 2F54E 3MXWH 4KKAC 4AIEA 3A6CH 5FO7B 4KZDH 3GJFK 1HQ4A 2HLFC 1GNXA 1S9XA 2AV7A 2WHKA 3AHYA 3B6SA 1JYVA 1CLXA 4N0CC 4KKNA 1TA3B 1V7ML 4JFPA 4W6WB 5MEPA 3W9EA 1F8TH 1BIIA 3SY0B 1JWSA 1LO4L 1GYAA 1IEBB 4D72A 5D7JB 5DFAA 4JQIL 1F4HA 1HKIA 4OGXL 5DC9B 3OMZA 5CZXC 5GS0L 5F7DB 1J11A 4RGNB 4GLRH 1VF8A 4QHLB 1FIGL 4G8IB 4E41E 5IROA 4PMVA 3OA5A 4H8WH 1YDPA 3ARTA 3D69B 3L3OA 1M71B 4LEXH 2M2DA 5E9DB 1I7TB 1LWRA 3PHSA 2HKFH 3TTOA 3QHFL 2MCG1 4NWTH 3NFSH 4XPFL 2P8PB 4Z7UF 5CZVL 1H11A 2A73A 5EWIL 4OZIE 5E2UL 1I1FB 1FRGL 2G60L 1E4WL 5ID0A 1GAFL 3BWAA 3BPNC 2AXGB 1NQ6A 1ISVA 2YDRA 4WUKH 3EIFA 4QNPE 3QDJA 1BZ7A 1SYVA 4JFEB 3MO1A 1PG7W 4MCZB 5CCKH 3LRSB 5DFWH 1YPZB 1OW0C 4CMHC 3LXAA 3JWOC 3CVHH 4K3JL 3JTTB 3T1FB 4F66A 1WSST 3SKUD 2F54D 1MFEL 2MCPH 4NYLA 1V3IA 3OXRA 1IQDA 2ADGB 1SBSL 4N8VB 5E00B 4GZEA 2Q76A 3SCSA 4KXZH 1C08A 3TVMD 4E8CA 2EQDA 3AMGA 1IKFL 3LN5B 3QXVA 1OWQA 4M62H 3T3PE 5JXEC 4JO3H 5L6YL 5LWYH 4XMLL 4NNXB 4BSVB 4P4KC 2PO6A 2Y6SC 3OGSA 4HA4A 4QNPF 3S36X 3RBSA 4H04A 4NZRL 3S5ZA 1ZHKB 1QSFA 4GAYA 3PABB 5DLML 2F58H 4GRLC 2O61B 4MNGB 3VDCA 4A2MA 3SCMC 2NW3B 3QQ9D 4TPRL 1QA9B 1TDQA 2ZUXA 3Q6GL 1C5CH 1MFDL 3BW9B 4UTAH 2EDBA 4Y1AB 2ZOLB 5IW1B 1LNUB 1ND0B 2GUYA 4L9DA 1CDCA 2DI9A 4K2UL 2MTPA 4HMCA 2HH0L 2B5IC 5DURD 2CGRL 3CHCA 3X3GH 2W9DL 4JG1L 1CGUA 3WL0A 2DLIA 3TYGL 3WNMA 1H0IA 1HJQA 3SDAA 4JFHE 2GJ6A 4LYQA 2E5EA 4KVNL 4YO0B 4WWKA 4XNMA 1FFPA 2YA2A 3NTCH 2NY5L 5FOJA 1S9YB 4YHPB 5IR1A 1X1NA 4P7RA 4QCEA 4JPVH 3HC4L 1MCLA 1QD0A 3GIZL 1T0NA 3W9DB 3PDOB 4AQ1B 1YQ2A 3P4MA 3MA7A 4MXWH 1OGTB 4UIKH 3ARPA 1RULH 4B9YA 5FB8B 3MCKA 3VFVB 3D87B 2R1WA 4NHCH 4PRIE 2JCCB 3VWJD 3BEWA 5IMMB 1NMCB 1A7PH 2YRZA 3DVFA 2X41A 2OWXA 5F7LB 2X09A 2J78A 3RVUC 1QI2A 1E4NA 1KBBA 1MIEL 1UVQB 3U1SL 1DDHB 4ACYA 1OP9A 1P4IH 3WFZA 5DJ0B 3S88L 3B9KD 4M43L 1GQKA 3BUDA 1FP8A 4HUXA 3LD8C 5EOCL 3MR9A 2ESVA 3B5HA 4GO6B 4LAQL 3C9NA 2Z1SA 4XWGH 1F6FB 3U7WL 4DKDC 1SR0A 1V3JA 5TDOB 4LBEA 3H9SE 1E43A 1DQJA 2NY4D 2VR9A 4HCRH 3QEQD 3L7EA 2DYPB 2YSSB 2IAMC 1R0AL 5B39B 4NOFA 2DTML 5L0QB 1KF9B 3V2AR 5J3HD 5GZND 1U3YA 1T1ZB 4NBZB 4NFCA 4IISA 3L2LA 2V17H 3WDRA 5A2FA 1CFSA 1KEMH 2R2HA 2BV9A 1XSIA 4JFHD 3VXSA 2K7QA 2LU3A 1JAKA 4P46B 1A3QA 3GUTA 3GXNA 5L7XH 3MRQA 1FHDA 3BGFB 2F8XC 3UBXI 5HDQL 3MROB 2V6HA 4N1CA 2N7BA 4U1KA 2AI0H 2FWOB 4PJ8A 3EFDL 5DYOA 3U30C 3E6HB 3ZL4L 1QRNE 2YBUA 3BUYB 4PRID 3ULVH 2VLJA 3DX8B 3MCG1 4BK4A 3G6AA 3VGBA 3FMGH 2EO1A 5AYQA 3OKLB 4W6YB 2BSSB 3PTQA 4L3AA 5TPWH 1XIWC 4X6CA 4L3CB 1ZVYA 5HYSG 1QFWI 1IC5H 1I8MB 3QUKB 4RZCB 2NTFB 4F9PC 1QX1A 5T1MB 3RKDC 1JNLL 2WINB 3LIZL 4GRWF 4MZ3A 2YXFA 4F58L 3IT8D 1SYTA 3NA9L 1T20B 2ZOKB 4LLYA 2QF8A 2KQNA 4N68A 2VZUA 1XIWA 1QFHA 5IB5A 2OL3A 2DSZA 2AEPL 4LPCA 3MRJA 4WEUD 1BVLA 1R24B 3BE1L 3PV6B 3QUZC 4S1SH 1GQJA 4ONHA 2GTWA 4HOWA 4WF7A 3BT2H 2R4SH 1RH9A 2YBTA 2DWEA 1H3PL 4JHWH 3LZFL 3TO4B 1GGBH 2WC7A 1CXIA 4G42A 1QBMH 3HRPA 1A7RH 5D93C 2DQJH 3V0AC 3LRHA 1RK1B 3AREA 2EXWC 3QUZA 5LVEA 2AJYL 1NGQL 1S3KH 2X7LB 4K7FA 4KHXH 1C7TA 2WHMA 2NY0D 5IFPA 4WJXA 5D2NB 2XQBL 5EORL 3FONB 3QI9D 4M6AA 4LPUA 3RGVD 1DN0B 4YGAB 4NQCA 2HFGH 1BGXL 4U6YA 1NC4A 4PJEA 2WVUA 1HJXA 3RCNA 2H41A 4P9HC 4UDTB 1QRND 3EYUH 4U3XA 3U7VA 2EC9T 5F3HA 1YUHB 4X0VA 5AAWA 2FIRT 1ZJBA 3NACH 5TE7H 1MLBB 2HG5B 6FABH 2CLZA 1DUYB 3REWB 1BECA 1N8ZB 2V2XB 3CUPB 1AIFA 3WJLA 4OQTL 3P0YL 4PJ9D 4A4AA 5MHSE 2UY2A 2OWWA 4L29B 2VL5A 3TA3A 5L2JA 4ZPVB 4JFFB 4OCMC 4QXUL 3MNWA 1E28B 1RIUL 1T2JA 2VLLB 3FRPA 4OT1L 4H8HA 1E6JH 4YFEA 2PCPB 2VXVL 5HVHC 4PGDB 1AXTL 1MHHB 2OP4L 4S3KA 4HWEH 3H53A 1CR9L 3KPPB 4EN3C 3RPKA 4EKJA 1CLVA 3MNVB 5LGJA 2HFFB 1F45A 4RNRB 5H37H 3GDBA 1OB0A 2P1YA 5CWSA 1JZ3A 1BPLB 4BELD 2E7HA 1X5YA 1A8JH 1A3LL 2V5MA 4U1LA 1FFQA 2YZ8A 2KDGA 4ZUVB 5GSRA 2WBJB 3LHPL 3SDYH 2VQ1A 3MBEA 5FKAA 1AR1D 4JPKH 3DX2A 4JO4H 2H6PB 3AIRA 5I8EB 1C93A 4KPHH 5ETUB 4D0BA 4B7IA 4UDUB 1UKOA 4OKVB 3X11B 4X4YA 2LABA 2JELL 3IKCA 4CRPA 3N1GC 5ESVA 3HU7A 3K8MA 2A6KB 2LAGB 1IGFH 3MV7E 4TQEH 5DT1H 1UD5A 4PMXA 5IFHH 5F72S 3QRFM 3L6FA 3UEZA 2HVJB 1WZMA 3FXYA 2E6QA 4L8SC 1NCBL 1UXWA 3EYVA 4PLNC 1WDSA 4EI5D 3BPCB 1AXSB 3PGFH 1S5HB 1HNYA 4WFFE 5F7YC 2J6EA 3VGAB 3WFEL 3I6GB 1M05B 3SE8H 1QNZH 4GW5B 3BI9X 3AOFA 1YMMA 1OSEA 2NT1A 3O3UN 3WBEA 3KLAA 2NY1B 2H1PL 2VMFA 5JBEA 1K4CA 1VEPA 1IGCL 1N5AB 4X8XA 2PF6A 3VFPA 4GAJL 4PUBH 2IGTA 5HDRA 4X6BA 4YGVB 2Z9TA 5JDSB 2H2SC 3VFOA 1GC1H 1TQWA 2B4CL 2B2XH 3A24A 4Z2GA 1T6WA 3OKOB 1LQSR 1HSBB 4FNQA 1Q94A 3SHSA 1G7MB 3HZMB 2N1KA 3WDHA 1RJLB 3MRPA 4BZ1L 4YPGB 1SJHA 3BH9A 2EO7A 4YIQB 2HJKB 1JGVL 4CNIA 1BG9A 3TNMB 3MYJB 1JGLH 4KK6D 3A4AA 1FE8H 2KZWA 4OD2A 4NRYB 4KI5E 1R34A 4K7PY 1CD8A 1RFDH 2YN3A 3LQAL 4BSJA 3FT3A 1W1YA 2W9LA 4PEEA 1OP5H 3EJTA 3HG1B 2FX9L 1JRHH 5J56B 1GJIA 3GBLA 1FH8A 12E8H 1IT0A 5HGBB 1F4XL 2IBZX 2UWFA 3OJMB 3B5TA 1KPVA 1Y6MR 4GI9A 3ABZA 3E3QE 4WV1A 5E99L 1H8OA 3QNZB 3HNTH 4WFFD 5ANMA 3TPUA 2EEBA 3CUJA 4QRTB 2BXYA 3AUVA 4V2BA 2OSLB 4X0KB 3EO9L 4FQCL 1TZGL 3UYRH 1GGUA 1T04A 4PGCB 4DN4L 4UCFA 3I02A 2BFGA 4KK9C 3WIHH 4P5MB 2BDNH 5FYLE 4YHGA 1AD0A 4PJBE 2CH8A 3SO3C 2SEBA 3ARDD 4H8WC 5F1KC 5FYJH 3I50H 4NKOB 7TAAA 4NUGL 4NWUL 4OLVL 1KGXA 3H9YA 5EG6C 1H3VA 4WUUB 3IJHA 4G5ZH 3UCRA 2A6JA 3PWNB 5IBUG 1CLYH 2APVA 5K59E 3CVIL 3HZYB 4Q0XH 1IAKB 1MXDA 1FNLA 3GSWA 3ZKND 5E2WH 3TBWA 2P45B 3GMMA 3RIFF 2EDHA 3D85A 4QCFA 1KACB 3U2SB 4AZ8A 2UY5A 1UD6A 3X12B 4XWOC 1JE6A 1ZTXH 1X9QA 5DEFA 4KI5D 4JZJC 1ZBVA 1M6OB 4G8EB 4WFHE 3FKUS 1IAIM 5TFSL 1TJIL 1U8HA 2QQLL 5HHMB 3VRIB 1I1YA 5SWZB 5K59F 3TNNB 1TQSA 1H8NA 5D72H 3VGFA 4Q7NA 4HIIA 3HZ3A 4JZJA 4PIRF 2CUMA 1J12A 5SWSA 1FOBA 2IALA 4N90D 5HD8D 4S1QH 1KN2L 2AJSL 4U0RB 5IM7B 2BNUB 4PMOA 1HP5A 4JM2A 3KPRA 4RGMB 1C8QA 2ZXBA 2E8ZA 3BXNB 4U7KA 2Q3AA 2ZX6A 2IH3B 5KVDL 4JZ5A 4Q9CA 3TA9A 1KJ2L 1WQVT 2WQRA 1XF5B 1HHHB 5FYLD 3O2VH 1EX0A 5DQDL 3H7BA 1HKJA 1BAFL 4F8TA 2Q86A 1CD1A 3BKMH 1MPAH 2VXTH 2X4RB 2WKLA 3DX4A 1YQVL 3IK2A 4J3XA 2NSXA 5ALCL 5I6XC 3KJ4C 4X6DA 3HJEA 1FYTA 1O7VA 2CKBB 5HHQA 4ATWA 1ERNA 5J6GB 3EO1A 4NFDA 1KIPB 3GRWA 3UETA 1BLIA 5IVZA 2A9ML 1T3FA 4M5ZL 2YPLD 1RQ5A 3P77A 1U95B 3W5MA 2XOTA 4LKXA 4U49A 4G9FB 4WGWB 3SIMA 2NXZD 1A64A 1SY6A 4X6EA 2CBJA 3QRGH 4NNYB 1F2QA 4GBXA 2VDQH 4WFHD 1UA6H 2E9BA 3V0WH 3NH7L 3OF6D 3IYLW 1E55A 3NZHL 4YHLH 2WBWB 1I75A 2VDOH 5HHOB 3GFUA 2VDRH 1NWUA 1E6OL 2A3HA 4ODXA 2AJ3B 1A6VH 5HGAB 1A6WL 1HN1A 3IFLH 3QR2A 1J9CT 3OIHA 4OZHF 2NLJB 2F5BL 4FTVE 1MCPL 1IARB 3ET9F 3PDDA 2VLRA 4PBXA 4I8DA 5D6DC 4M6NL 3QWRD 2NY6C 3R06B 4P2RB 4UB0H 1FORL 1DCLA 3JV4A 4XP6H 4MJIE 3SCUA 1F3JA 5EBWA 1S7SB 1N4XH 2QQNH 5BRZA 5DC4B 4H1LA 5BZWB 4PJ7A 3HG4A 1SJVA 4F80A 1OWRM 5C0EA 1H5VA 3N13A 1KJ3L 5EU6A 5EU7C 1IAMA 3V9FA 5I75B 1QR4A 4GUPA 3HE7B 4JFQA 1QLFB 3ALXA 4QHNA 2GCYB 3D48R 4OLEA 4M5YL 3WN5B 4CKVX 5JA9A 3QFJE 2HT4D 1CD0A 4Y5VB 3PJSB 4NQSB 5C8BB 1LO0L 4L4TA 2DH3A 4GW4A 1J8KA 4ZFGL 1GORA 3QOKA 5I66B 4PJCF 3ULVC 1IC7H 1BEYH 5E7FA 3P30H 1TPXB 4K9EL 3DUSB 4MQSB 1W9BM 1IV8A 2JIXA 2F54B 3GSXA 2DLFL 4P2OA 3ARBD 2BVDA 2EECA 1JGEA 2CUIA 2XA3A 3AB0C 3WHE1 4R2GD 5ENWB 3WFBH 2E9JA 1D9KC 1V7MH 4Z7UB 2W60A 4JZNA 2E3ZA 1TVBB 4W81A 43C9A 4BFGA 1H5BB 3DYMA 4FXLA 4M1CD 4EDXB 5FGRA 4R3SB 1BLNA 5EUOE 3T3MF 2X40A 3F4VA 1D9KA 2XGBA 4M81A 2ZUUA 2DM2A 3RTQB 5CJOL 1B31A 1JF1A 2X44D 2JF7A 3CCHB 2XM2A 1QSEA 4K94L 1HJWA 5TGBB 1TQTA 2J7HA 1FC1A 4TUKH 3AS0A 1HH9A 4HPHA 2G41A 2JB6B 4LSQL 5HI3C 5EWIH 2OI9B 2VITA 1LEGB 1WIPA 3NIGE 1E4WH 2VDML 1DQQB 4WJ5B 3HZVA 3SBWC 3QFJD 3MQIA 3PGCB 2FHBA 5EUOF 2G5BA 1KB9K 2EE3A 3K74B 4ZUTB 2J5LC 1UB5A 3RWJA 3F5KA 1V7NL 4FQ2H 1AVAA 5F6IB 2YEZB 4Z7WE 1BJ1J 3E0GA 4LLAA 1MFEH 3H7LA 1G1YA 3HRZB 3MREA 2YIHA 3FFDB 1MQRA 1I3GL 3MKKA 2HRPL 4OCSL 4XVSH 2W65B 1IKFH 1E0OB 2AGJH 2V2WB 2DQGL 1F97A 1PY4A 3VXME 3C2AH 2FECI 1WTGT 3WD4A 1GONA 2XY1A 4XNZB 2YRPA 3LB6C 3MRBB 4WEMB 4RX4A 4Y19E 5EFIB 3WIFB 1HZHH 5BXFA 4OCNC 5AY7A 3O3AA 5ALBL 5DLMH 2AMGA 4JLRB 4WI6A 3KWXA 3TJEL 3EJSA 1U58B 3A6BH 4H0GA 4TPRH 1E3XA 4LSSH 2VERN 2NY4B 3K3QA 4Z7WF 1S7TB 5KTEL 3QEQB 2WC4A 3HLAB 4J28A 1BQLH 5GGSY 4EUPG 1BFOB 5DEGA 3KXFB 4IMKC 1NGPH 1T2XA 2HJLA 2J7FA 5AC4A 2W9DH 5HBBA 3ARGC 1ZGLP 3TYFA 4WU5A 3PGDA 1U91B 2F74A 2WB5A 1H3XA 4KJQC 3OGCB 3FW6A 3CSYB 2WMKA 2HT2C 1VRXA 4KK5C 1NGWA 3BOVA 2NT0A 4Y4HC 4IMKA 5IW6B 5K9JL 3FB8B 3L3HA 1U6AH 2W92A 2PXYD 4IRSA 3RGHA 3GSOA 4KJYB 2D7PA 4PRNA 4DVBA 2IEPA 3N1AA 3R0MA 3TBSA 4Y5XB 2D4DA 4LLUB 2X9YA 4K23L 5AG8A 3VG9C 3HR6A 3F7PC 4EOWL 4ONGL 1A6TB 3IJ8A 1DJSA 2WZPD 1JZ7A 1K4DB 2VDKH 4YHIA 1MIEH 1J0HA 4X7DC 4ZQKA 4W5ZA 3OX8A 2DRUA 2XWBA 1DSFL 5HGHB 2XWJB 1T7ZA 4EANA 4CVUA 3MCLH 1MI5E 2MQ0A 4JAMA 2Z92B 5FM5O 1H0DB 4HFWB 3VXPA 1MWOA 1I7RB 1MFBL 1JPSH 1U2YA 1KCVH 3T8XA 3DX6A 1HVXA 5A40E 4N42A 1MAML 7CGTA 1AQDB 1MH5A 5B8CC 2BY2A 5IQ7H 1EAPB 1GC1C 3LRGA 3BLBA 3I2CH 3C6LC 4L4VA 4PJHE 3CZFA 5L8LB 3EDDA 2CLRA 5I16A 4G8GD 2NW0A 2J8HA 5CJXC 3ZT7A 5CINH 4DAGH 1JPGA 1T7VA 4KQ3L 3MGOA 4L3EE 1GZQB 4O2CB 3QYCA 4OUOA 1A0QL 1A6ZA 1MJJB 1TTFA 2UWEA 4GRWB 3C6LA 3VUPA 3UTTA 3BP7A 2F8OA 2O9OA 3P4OA 1YNKL 3EFDH 1FPTH 4OZ4B 3ESUF 1UM4H 1ACZA 2EPOA 2K3TA 4UT6H 2NZ9D 4DZ8A 3MV8A 4LLWA 4AD3A 5TDPA 3MFFA 3TJHC 3PDGA 1FH5H 1QWUA 3HZKA 4UQDA 4PJHF 4QOKE 4RWHA 4OCLC 1NCAH 4NQVB 1QR1B 1D2KA 4PMYA 3RO8A 5D1XD 4IJ3C 4R7NB 5D7IE 1YHTA 3CK0H 4MVBC 5D8ZA 5MERA 5ABDE 2BVTA 5I78A 4PJ9B 4ODTL 3V6BR 4OJFH 2EO9A 1R75A 3ARXA 4B5EA 1QPKA 1MI5D 4FLQA 2X70B 4TVPH 1XGQB 2GI7A 4L5FL 2P24B 4LVHB 5JW4N 5HDLA 3MLTA 1T0MA 1MHPL 3H54A 2IBBA 1DFBL 1XGRA 3Q3GB 1V3MA 4HPOL 4JZOB 3UPCA 4C54A 1RMFH 4DZBA 1BHGA 5L8JB 5D2LF 2XNAA 4IDJL 1H3PH 3BDBA 3UJIL 4FFWC 3LH2H 1V6WA 3C5ZD 2PWGA 3PZQA 5D7IF 1F3RB 1NBYA 4YPJA 4FQJL 1K3IA 1U36A 1T21B 1NAMA 1HIMH 1JYWA 1OY3B 4WI8A 4HWUA 4BFIB 4L3ED 2OJEB 1N64L 5FCUH 1MHCB 2CPUA 2YOCA 4ENEC 1UZ8B 1OD9A 2R0KL 5DT5A 1HXMA 4WW2B 4UT7L 1GOWA 4H25B 4H88L 2Q7YB 3N06B 4IOFD 3ZKXB 3SCWA 3B83A 4XNQA 2D3LA 4QOKD 2G9HB 4D6CA 3BQUD 4HXAL 1W0WA 5C07A 5FUCE 4M7ZC 4AG4H 3U36A 4N0FB 1LO3L 1IGTA 3QHZL 3AMKA 1P5VA 2EE9A 4P59L 1QUNA 5HYIA 2AJZB 1BFVL 1HHKA 3VXQA 4AENB 4ZEPA 2Z8SA 3RUGF 5B3NA 3UBXG 3VH8B 3RKPA 4QXUH 4MD4B 1ZANL 1U3HD 1NSNL 2Y5TA 4ODHL 4GOSA 3AIQA 1WT5C 5EO1B 1D5MB 5KSAA 1KNOA 4PB9H 1QVOA 4QRPB 3FB7A 3FOMB 4AL8H 4JDVB 4LCYB 1U9KA 4HWBA 1VACA 3I75A 4N5EC 1MFVA 1ZVHA 1RURL 3RX7A 4NOBA 1Q72H 1JD9A 3MV9A 5HPMB 1OGAE 2Z31A 1Z6JT 4NBYB 4RBPK 4A6YL 3S5LG 4F7MB 2CERA 2JJVA 4HBCL 3CMJA 3OR6A 2DJUA 3KLDA 5M95B 2O5ZH 4MNKA 4P2QE 1A47A 2QMJA 1JF5A 1YEFH 3QUYD 4O51B 1E4MM 4ZTPL 2CJUH 5DJCA 2V7HB 3EJUA 1XYZA 2XT1B 5AWNL 4WHYH 3ARFD 1ISYA 2Z8WC 5E0FA 3AU1B 3MLUL 4UNUA 4ACZB 2BS9A 2MHAB 2D0FA 5JO5B 1Q9OB 1NUGA 4YDLC 1KCUL 2P7TB 3LV3B 1X5AA 2DDQL 1H8SA 1MFNA 1P4LB 4LVEA 3EFFA 3OAYH 4PRWA 2GT9B 5MENA 3OKKB 1UH4A 1J10A 4QYOB 1YY8B 5KJRL 3MJGX 1NKRA 3P9LB 3ULSB 2AAAA 1XAUA 4DEPB 4UOZA 3W4RA 3FFCE 4NRZA 4XCYA 1QACA 5CSYA 1OLZA 4NC2B 5I15L 3DSFL 3H2WA 2W1NA 4YDJB 2Q87A 3VNZA 1IAII 4LYRA 3HNSH 2GJXA 3GMOB 5C0DA 5DI8A 3UTOA 5EZJB 3VFRB 5GRJH 5KSBE 3MU7A 2R0WL 4HV8B 4NO5A 5E6YA 4E5XB 1KJVA 3HTLX 2X1WL 3SDDB 3RI5F 2XN2A 1R33A 3T77B 5CP7A 4R96B 5I3DA 5BMFH 1KIRB 3LEYL 3VM7A 1KPUA 1FO0L 4YX2L 1ESWA 4NO0A 1JFQH 1QG3A 4GAJH 3ARDB 3GBEA 2EXYD 3D52A 1R87A 4LFHD 3PIQB 5C0FB 2XVNA 4DCQA 1CICD 4O2FA 4NM8H 1QRKA 2C1PB 4P2QD 5DSCA 4ZXBC 4P2YA 4JDZB 1CQKA 3CZKA 5C09D 4P3DA 4BZ1H 5D1QC 3GB7B 2CR3A 5KSBF 1U8OA 1MQ8A 3HG3A 1MLCA 2NY3D 3MV11 4FQIL 1DR9A 4UOW1 4PMRA 2D20A 2PYFA 1G7QB 3AIVA 4XX6A 4E8DA 3QNXA 1U8PA 2FNBA 5IV2A 3QA3B 1MW0A 1VFMA 4LARH 4WENB 3CFCH 1DVFA 5GGVY 5L9DH 1CZ8H 3GSRB 5FM4A 5KAQF 4Z95H 1IRAY 4R4FL 3BGMB 1JZ6A 4C7GA 5GGRY 3T0WA 4DO6A 5ISZA 4IRJC 2I24N 4HGMA 3EO9H 4GFTB 2X89A 3V7AE 4GG8B 3S34H 4P23A 1QFUL 4C58B 5KVMC 1GIGL 1OTTC 4OOUA 3RWFB 3QPQC 2PWFA 1G7HA 3QIUA 3OKDA 2XWTB 4ODVL 1NBZA 4IRJA 1A7QL 4NUGH 5HI4D 5JW5A 2OSYA 2VRKA 1UOKA 1CFNA 1AE6H 1DQDH 1GGTA 3EMCA 1YEIL 4HIEA 4L1HA 4U6HA 3CU1A 2R2EB 3LDBC 3QJHA 4K3DH 1R5WB 2QV2A 4P7NA 1NMBL 2R29L 3KJ6H 4DO4A 1HHIB 4PG2C 2CMRL 2W61A 3EYFB 32C2B 3QT2A 4XBGA 5H8DA 3PL6C 4MWFB 4RMUA 1FZKA 3KYKH 5E2TL 4JHZA 3UTSA 5E0CA 4TNWF 5LGKA 2DGAA 2YPLB 3RVTC 2GFTA 4OB5L 1AC0A 4M1GH 2AEWA 4Y16D 1MCBA 3RWDB 5D7JC 2Q8XA 3EHBD 2NXZB 3BAEL 2ZWZA 4MNHA 2BSTA 1ZGLM 3WXVL 3CH9A 1LLOA 4PJ5D 4AD4A 3L7FB 4RGNC 4BQBA 1G7LB 1B0WA 2DT3A 1XGYL 1XR8A 2EIDA 1PQZA 3HNVH 4HZLA 1TFVA 5FYLL 5D7JA 4HF5L 4G80A 1AO7B 2X5PA 1GZPA 3HG5A 4S1RL 1LP9E 4HUUA 5D7LB 1NP2A 3NPZB 1VADB 5I76B 5BQ7B 1ORSA 1JGDA 2E9MA 4X4XB 2YFNA 5DQ9B 3D69A 4MB4A 3CPLB 1BAFH 5E9DA 1BD2E 1I7TA 1QSFE 1UYWL 4BZYA 3WNPA 5GXBB 2EIZB 1ZL1A 3MMDA 3E1F1 1CFQA 5ALCH 4NQEE 5F7HA 1I1FA 3WBAA 5I17B 1JCKA 3IKKA 1Q8MA 5F3BA 2HTKD 3L4YA 1QZ1A 1BYCA 2I25N 3OG4B 2BRQA 3QUMB 4MA3B 2EC9U 2G5RA 4RFEB 1XYFA 5ACMA 1EQPA 4JFEA 2VUOA 4MCZA 1AQKH 2JK5A 1B0GA 1YPZA 4OZHB 1TJHH 3P40A 2GJ6E 1NAKL 3DHMA 4W93A 3DETC 3T1FA 3O2LA 3OWEA 3CC5A 2ADGA 3M17B 3ZSSA 1S7WA 3QEHB 3CMOH 2QKIA 5E00A 5FDYA 4JQXC 1VEMA 4JANB 3EDEA 3WHXB 3QDJD 3DV6A 1CFVH 5DQJA 3ARSA 4KV5F 2DIJA 3QEUB 5DVKA 3DBXA 2AK4A 4MMZC 1YC7A 3ARBB 3ZTJG 4O4YL 3UDWC 3MRHB 4YDVA 4FLRA 2O61A 2YD5A 4MNGA 2F5BH 1IGJA 1FL3B 5KG9B 3JVGA 4Y1AA 3WS3A 5FHAL 2CKBH 5IW1A 4NPYA 1LNUA 2PO6D 3K7UA 1FORH 4TTDC 4A2LA 2PI6A 1KXVC 1QSFD 1ZXQA 2VSDA 5EN2B 1MELA 3WBDA 4PJCB 5DRWB 1M53A 2GY7B 5KZCB 1WZLA 3VFNA 3O6FA 3HS0B 5I1IL 2OYKA 2XZCL 5JOFA 4DO5A 2G3IA 4HT1H 1PZUB 2Y6SD 3OB8A 1EJOH 2R2CA 4GKSA 5I18H 3OLEA 4IRZH 2YWYA 1NMCC 1J1OL 3W9DA 2H32A 5DUBA 3STZB 3QZWG 3SCMD 3GI8L 3VIMA 4GSDL 1JHKH 2VVSA 2GSIA 1JDDA 3SDAD 3GJEB 1OGTA 2GJ6D 3VXSE 5BXSA 2DKMA 5T1DH 4WWKD 4XTRD 5E08L 4H8VA 3N04A 3CH8A 4XC3H 4KJPC 1XF2A 2JCCA 1CQYA 5IMMA 4D9QE 5C2BL 2IBGA 2YUWA 4Y88A 4ZENA 2RGSA 5M7QA 3LRKA 5D96B 4LU5L 5E0QA 4DKFL 3CHEA 2IUZA 5DJ0A 4M8UA 1HCVA 3TT3L 3CZLA 3B2UC 2VLJE 4ZDHA 5L0QC 1WZ1H 4NQDA 5TE6L 5CSZB 4J4PC 5CIPH 2WMGA 3SCQA 1U8MB 1FNGA 1QOXA 3MRCB 5H94B 5JW4R 1JNNL 3I6LE 2O93L 1YEJL 1FGNH 5E03A 2FSEB 4FLSA 4ODUB 2VXUL 4KFZC 3VD3A 5C0RH 1D5XA 5GGUA 5EUOB 1UACH 2ESVD 4JFWA 1BG4A 2Y06H 3O2DA 1MWAB 1DP0A 1ZVSA 4OI8A 5CMAA 3RWIB 1F2XK 3OZ9L 4PMNA 5DRNA 5ESAB 4FP8L 5A8OA 1Z32X 2FGWH 1A9BB 5FUOH 4P46A 5MI0B 1LJYA 1NCCL 1I9IH 4JG0H 5JHLL 4X6CF 3V4UL 4CBPA 5I8OH 3MROA 3VPLA 1ZT1A 1OAZH 2FWOA 3RDTA 1QHZA 4E42B 3VXSD 3PHOB 2VXQL 1PD6A 1LWHA 3FB5B 5IKCB 2PXYB 5DHVA 4DFHA 5GHWL 4FQHB 1V7NH 4D9QD 5I71C 3OKLA 4NUJA 1ETZB 1FVCB 2BHUA 4M8QB 4R26H 2VISA 3AZSA 3SURA 2OZ4A 4PJ8D 3D2UB 4PJEE 1RAMA 2HRPH 4UIMA 2OXHA 3PWLA 4B41A 2X2HA 1OP3K 1I8MA 4RZCA 2DQEL 2NTFA 2NXYC 2VLJD 5JLZA 3BJLA 4J23A 5T1MA 1L7IL 1JK8B 4YFDB 3GHEH 3WKML 2ZOKA 2DMKA 1PBGA 1TCMA 3TO4C 5T33L 4FF5A 1AI1H 3I6LD 3L1OH 5GNYA 1J1XL 3II1A 2ENYA 4EVNB 4GMTL 4DOHB 2Y23A 4MA8H 2CPCA 3DYPA 4ZUWA 2FRGP 5I30L 3DO7B 5D2NC 2B1AL 2I26N 1QLEL 1XIWD 1ZHBB 2DBLH 4ZAKA 4ZPTB 3OPZL 4PJEF 2XZAH 4QFUA 4C57C 3U0TB 2A6IA 1EFXB 5LA0A 1MREL 3UTQB 5CEYB 1WCBA 2X7LA 4TYUA 3OZPA 3VIIA 4YNYB 4QXTB 4FQXB 3UTZB 3T0AA 3FONA 2EZ0D 4G7VL 1WDPA 3IXTB 1NCDH 3RHWF 2VNCA 1RZIA 4TSCH 4P5TC 3MJ7A 3VW3L 3DOSA 4G8GB 3H9ZA 2E4TA 2WSKA 5K9JH 3ARED 2WWMC 3QUZD 4IUGA 4UDTA 1BM3L 1FJ1A 1YUHA 4GLRI 5F96L 2GJZB 4GXUM 5LAXB 4I3SH 1XF4B 4HX1A 4ISVA 3R8BB 1XGZA 4AY1A 4ONOA 5KSUB 5IB4B 4QWWD 1XH0A 1WC7A 5CHNB 4NQCD 3CUPA 4ONGH 3Q5YA 1NC4D 2G4FA 3KPQA 2WZHA 1KB3A 4QT5A 1AC6A 2FEDD 3QCTL 4MJ4A 3S35L 4AMWA 1FFRA 4NM4L 2JEPA 4N8PA 4FFVC 4C7DA 1JBJA 4JFFA 4PTUB 3NMEA 1E28A 4P3CH 1DSFH 1K8IA 2PCPA 2BERA 1NGXB 2EDXA 3EYOB 1MHHA 4R4BA 2GTZB 5CGYC 4YXKH 1EOMA 1AP2B 3V4VL 3BYTA 3THMH 4D6HA 4KMTL 2OYLA 2HFFA 3NIFE 3TA3D 3VXRB 3PWPB 2WBJC 3T4AB 4NC0B 2Q8BH 5LJYH 1V6VA 3O0RL 2X4TB 4Y4KA 3DLQR 1Q38A 3PWVA 3L4TA 1OT1A 3DURB 3MLYH 4NJAH 2ADJA 5TF1L 4KRMB 1YMME 2D31B 3U5YA 1PY9A 4BQ2A 5DMKA 3B43A 3C5ZB 4LDEB 5FO8B 4XPAL 5GRYA 2DQIL 4PJDA 3QXWA 4RGOL 1J0JA 2H6PA 1A5FH 2AEQL 2X9WA 1HDMA 5CBAA 1KGUA 3KLHD 1WF5A 5ETUA 4UDUA 5L8KB 3DARA 5C8JA 1V3LA 1WVZA 4IMLB 5FHBH 5JR1H 3VFSB 4D71A 2CIKB 5EIQA 4QF1A 4F7CB 4UU9B 1UJ3A 2R1XB 5CPQA 1MFCL 1GGCH 4PY7B 3ROOB 4I0KA 1YYML 2CXGA 3G6JE 4LK4A 3DV4A 5D2LB 2IG2L 3FHQA 3BPCA 1AXSA 2NY1C 2BRRH 4HZAA 4QOKB 4M6ML 3U0WL 3BQUB 3V5KB 4TSAL 5JTWA 4Z2JA 1CIUA 3L5JA 1WE5A 1W2PA 2HMID 1A6AB 1HH6B 4TSBL 2EXOA 3N11A 5A2IH 3PWUB 3DJ9A 5FK9B 2VKXA 3O2WH 4PMUA 5HYJE 1V02E 4IS6B 1UQYA 4P48A 3FQXB 4LNRA 3WEZA 3VM5A 5MEQA 2BHZA 3GSNL 1N5AA 3O4OB 3VIOA 2KH2B 3NABL 4HPOH 2PTTA 4YGVA 4ZXOA 4LDLB 3UJIH 1YMMD 35C8L 4D6EA 4GRWH 3OKOA 4OZFG 4XNYH 5DHYB 1P7HL 5JHDB 3EJRA 1P69B 3HZMA 3EO0B 4P49A 4KKBC 1NH6A 1R3KB 1RJLA 4UFHA 4XP9L 1CDBA 4AM0B 1MCNA 4DTGH 5KZ6A 1QI0A 4XMPL 3LKQB 3ARUA 4YIQA 3TNMA 3ZTNH 3RUGB 5GZOD 2XG9A 3VRJB 5C0JB 4O02H 4NRYA 2DKUA 2NW2B 4PCTA 3TFKC 4BQ8A 5FKYA 4M1DH 5HGGS 4XXCC 5JXAL 1A3RL 4RAUA 4CD4A 3ARFB 5EB9A 2WUCH 4H88H 2H2SD 5E8OA 4NZTL 2FO4A 3C09B 2O5YL 2V5SA 1MFUA 2DQFB 3QHZH 4D6JA 4LFHG 3O3DB 1VFBB 4GKLA 4LRIA 5DK0B 4HGWB 3UPRA 1J9YA 1FH7A 4F9JA 4HG4K 4QRTA 2DQUL 3IGAA 2Q3ZA 3WFLA 4UQ9A 1OAQH 5JUEH 3RJQB 3GMNB 2NY7H 2XKNB 5SWSE 3RZCB 4U3AA 5EZOH 4KK8D 4OM1L 4ZYKB 3ISWA 5D6CB 4YHOL 4F57H 3KPRE 4ACPA 1E56A 4MJ6A 3G5YA 1UQZA 4NQTA 3H55A 3NN8B 5JW3H 3IAGC 3PQYE 1RD6A 5EPMB 3OJ2C 3QQNA 1HI6A 9CGTA 1BQSA 2P46B 5HGDB 1MCHA 4Y89A 4CDHA 2F15A 4M7KL 1AQ0A 4P2QB 1YEGH 2XVGA 4L8DB 4ELKA 4D6FA 3SDCA 4NN7B 1KLGA 4X6DE 4TUJB 3MA9H 2YA0A 5C09B 3W81A 4F2MB 1INEH 2AW2A 3HE6A 3OV6A 1XMWA 3LS4H 1QFOA 4ZSOE 4EEEA 2VN4A 4G8EA 4NRXA 2A0LC 4JM2F 2NY2B 4X80H 5IJKC 5TQ2H 2B31A 1T66D 4U0RC 4QRQB 3D85D 3I9GL 5SWZA 4ONFH 1B4JL 4Z76B 5T3ZE 3F7VB 2PYEE 3WNLA 1XSKA 4KQ4L 3DMMC 4XB8A 4LLDB 5JPNA 3L4ZA 4G7YL 4F7EB 2BVQB 3EOTL 5IM7A 2E7LA 1JWUB 3EBVA 4U6XB 4HP5A 3A4XA 2YS4A 4UQ3A 7FABH 1V6UA 1NBQA 4LLQA 5IFAL 4LSPL 4XWOD 1F42A 1MCDA 4X6FB 5SWSD 2ATPA 5CEZD 4JN1H 4V1DA 1OSZB 2X4RA 1JGUL 2WNGA 4JM2D 3KPRD 1DWGM 2WVSA 1FO0H 5AZEH 1IAOA 2IPTL 2VLRE 4YX2H 3BCFA 5D5ME 3BUPA 4W68A 2CETA 3WIJA 5DGRA 3IDNB 1RUMH 3QR3A 2CKBA 5J6GA 4G6FB 3NZ8B 2J8GA 3L95B 2XG5A 3K8LA 3DRQB 4TNVK 5BRZE 2Q8AL 3GHBH 4RRPA 3BP4A 4PJ7E 1MJ7H 5DRZB 5MP6H 1G9MH 1U95A 4NF7A 3V6FB 3P4LA 2N4IA 3GZKA 3KYOB 4J27A 1W0VB 3SGEH 3V7AG 4NNYA 4AZ5A 2JIEA 2IBZY 4XCEB 2YLLA 4OV5B 1FVDA 4MB5A 2BNQB 4EDWH 1MNUL 5HHOA 4QTHA 4Y16B 2WAHA 5T3ZD 3WY4A 1B2WH 2AJ3A 2PYED 4Z9KB 5E70A 5INDB 3FTGA 1ZLWK 3KPNA 3F6IA 4GBXD 4PJ5B 4MNQE 4U1SB 2FJGB 4JE4B 1KB5L 4PJ7F 5DS8B 4Y5YB 4R0LB 1UT9A 5CLWA 2WLZA 2PC8A 2PW1B 1XCWA 3KHOA 4PN2A 1V6YA 5JIPA 1S9XB 4P2RA 1S9VA 2AV7B 3ULVE 1VFUA 5EO9B 5DJDA 2DKSA 3B6SB 2I27N 2PN5A 1HCFX 3VINA 1QFUH 2W9EL 3GO1H 1PVHA 3X14B 3IDUA 1SJEB 4JFPB 1TITA 3WN5C 3WNNA 5MEPB 4GQ9L 3K46A 1KCRL 1F11A 4Y5VC 2VLRD 1BIIB 3UPAA 2X42A 1JWSB 3BLPX 4OD3H 4NSKB 1AGFB 1X4YA 5EULV 3HE7A 1QLFA 1N59B 1YEIH 3D6GA 1SVCP 1TIUA 2GCYA 4HIHB 1UD4A 5BRZD 1H0GA 2EPLX 1LE5A 2R9HD 1YDPB 1CPUA 2G75B 1UWEL 2NY6D 2PR4L 5CSUA 4NJ9L 15C8L 5GGTA 5E2JA 3AHZA 3OGVA 1EXUB 3JZ7A 5GRUL 1F4WL 3TVMC 2A73B 2UV3A 3DUSA 3BWAB 2QADD 4JM4L 4DQOL 1H5BC 2XPGB 3BAEH 4L4TD 1JPTH 3QDJB 3EW3B 5KVGL 5ENWA 4E9LA 2D73A 1IGIL 3BHBA 3MO1B 2HN7B 4X4MA 1EEZA 1KEGH 3QCVH 4UILL 5IB2B 1QNQA 1TVBA 2GJRA 4W88A 3S4SA 2C3VB 4LGSB 1V3KA 5DWUL 4D3CH 4P2OD 3MUZ1 4QHUA 4S1RH 1C08B 4GAGH 1KN4L 4KRTA 5C0IA 1EGZA 2OI9C 1CLZL 4ALAL 3BFOA 3UZVB 5H2BA 4WWID 4U5KA 3RTQA 3WSUA 3TLRA 5ADOL 3L3JB 1WAWA 3MRLA 2PO6B 2YC1B 4YDIH 1JRHI 5TGBA 5C0CE 4CD8A 5SV3A 1HJSA 4GAYB 2JB6A 3KR3L 1ODUA 1D9KD 2WCGA 5F6IC 3PNWB 4HS3A 1YNTB 2AXFA 2IJ0C 2YD7A 2HA1A 3PGCA 1QSED 3INUL 1I8LA 1S46A 5DUML 1EQCA 1YYLL 1DWIM 4WDIB 3LPFA 4XMKL 1CWYA 4LSTH 2QPSA 1DZBA 1ZGLA 3SDAB 1O7SA 2GJ6B 4WWKB 1F6AA 3HRZA 4XNMB 4Z7VE 1GOIA 3B9KC 3P9WB 2XWDA 3T2OA 1IAIL 2W65A 4HJGA 1L8NA 1C5BH 5HI3D 4HPYL 2V2WA 4X9BA 1EHNA 3JWOL 4I0PA 2NY4C 4YXHL 1FLRH 2F9BT 3HI5H 5IHUL 3BD5A 2OTUB 3CD4A 2IANE 3MRBA 5EFIA 3RIFK 1KJMA 1ZLSL 5GZNC 5FYKU 4U1HA 4U1GB 3AY4C 4ZUSA 3L4UA 5HYQA 2A74B 2CDFA 2P8MA 1NFIB 3X3FH 2H26B 3LEVH 3BLKA 5TE4L 1UH2A 3HLAA 2GY5A 4JRXA 4RX4D 4WI9A 1QEWB 3KXFA 3CFEB 4QCIA 3MR9B 4OIIL 2PB1A 1T5XB 2ESVB 1CD9B 4P57A 1J8HB 1P7QA 1U91A 4OGYL 2PBGA 4Y5XC 3OGCA 5ELIA 5LQBL 3L7EB 4XPTL 1A6UH 3WF2A 2FGZA 5FXCH 4IDLA 3EOBA 3LB6D 3FN9A 3KDMB 3W0WA 4O5LL 1UD8A 5IW6A 5D7KE 2DQCH 3RL1B 2P4AB 4JFSA 4ATLA 1IT9H 3GI8H 4F7TA 4RFOL 4L4VE 2ARJB 4Y2DA 1UZ6F 4Y7MA 4ZODA 4LLUA 4WO4A 1YECH 1DBBH 2EDYA 4HH9B 1MQPA 1MCWM 1U42A 4P99A 4LRNL 3SKNA 5EUKA 1A6TA 5FAAA 1U41A 5C2BH 3SKOB 3G5XA 4OSUL 1ITXA 5D8JL 4IRSD 2UWEE 2D7NA 4NFBA 1MRFH 5ESQA 2C1OA 4HXBH 5E5RB 3GYCA 4LU5H 2DMBA 1L0YA 1DWHM 4PJ8B 3TT3H 3F58H 5DYOB 3SUSA 3MV8E 5KSVB 5HGHA 3SOBL 4XHQA 4JQVA 4HS8H 3ORJA 3MV01 5TE6H 5DJAA 1H0DA 4JO2H 4HFWA 3WDPP 1XH2A 5F21B 1JNNH 4BQ5A 3C8DA 1JWMA 4X6CB 1WKYA 3DX9A 1CN4A 3RAJH 2QLYA 2D3NA 4XCCL 5A2JH 3MJ8A 2UWEF 4P7LA 4DGYL 1EAPA 4LLYB 4Z78B 3FN3A 3OZ9H 3QI9C 1ZS2A 5HI5C 3RGVC 5IB5B 3QQ3B 2X1PA 3K8KA 4Q2ZB 1GH7A 1HXJA 1GZQA 1KBGH 3G6DL 4ONHB 2GTWB 1ACYH 2EPMX 5D7KD 2DWEB 3HR5A 4G42B 4L4VD 4QAWA 4XPBH 3WEMA 2FBJH 3JXAA 3SCTA 3TBYA 1JHLL 5FYJE 3AREB 3MGAA 4PJ9C 2O92A 3TZVA 5GQBA 3H3KA 2YFOA 1KC5H 3ZDYE 3FRPG 3C6LD 2FX8L 3UTTD 4LVHC 1QR1A 3SUVA 4PJAA 4R7NA 4ZNEE 4NQCB 3C08L 3MLRL 4JY5H 1NFDE 1NC4B 1CXEA 2DQEH 4HPGA 4MAYA 3MV8D 4OCWL 3M8OL 1DBKL 4TUOA 2DQHH 4Y4FB 2F7OA 1OB1B 1VGKB 1FLTX 1GHFH 1MWAH 4WEBH 5HY9A 1XGQA 5C07E 2CR6A 3VXTB 3PZVA 2CLZB 1LVEA 2OL3L 1PKQE 1J1XH 4PGEA 2BJML 4X5WA 4EIGB 4K7PX 4Z8FH 4H5SA 4JZOA 4KHTL 3H8NA 1Q6CA 1HTYA 2VL5B 4DKEL 4GQRA 1QLEH 5FL0A 2AJXH 3OZOA 2H2PD 3MNWB 3AVEA 3WMCA 2G2RB 2JALA 1KTKE 4WW2C 3IDMA 4PRHA 4BFIA 1RY7B 2OJEA 2E9IA 2F53A 3DX7B 3Q1SH 5DZNA 5LGJB 2DJ4A 2EYRA 1RZJH 3MV9E 2YD1A 2EEXA 2ZCHL 4ZTOL 3TTSA 5C0GB 1FBIH 4WW2A 4PJXE 1KFAH 2VSCA 4PJFE 4EI5C 2G9HA 4ZFOA 3GIVA 2RQ8A 3MBEB 2YL8A 3BIKA 1C12A 4N0FA 5DZLA 1E4KC 1GGIH 2X4NB 3F8UB 5EMYA 4OCYH 2ARWA 2EH8L 5FKPA 4P9HL 3NDYA 2F8QA 4DUVA 3WD1A 1EHLL 3MUJA 5ACZA 1PSKH 2DQDL 2VVNA 3U4EB 1LEIB 1MHEB 1FH9A 2WUBL 1XR9B 4Z7QE 5DUPH 3DGCR 5C07D 5ESVB 4POUB 3BKJH 1JN6B 4QRPA 3SJVA 3L6FB 5ITBL 5C0BA 4LOUD 1UXWB 3EYVB 1Q6FA 3GXTA 3WY2A 3O0RH 3MUGA 4WTZA 5HPMA 1RUQH 5E6IA 4F7MA 5KSAD 1JDAA 3S35X 5IJVB 4CU8A 1DQMH 1EGJH 3W6LA 1NANH 4DVRL 3HCVB 2DLHA 4XVTL 4QXGL 1E0WA 4DN3H 4OD1L 3FQRB 1FNSH 4P8WA 3KLAB 1OM3H 4KK6C 4Z7QF 2J4GA 3GBNL 3MV9D 3TWCL 1TJGL 2V7HA 2Z31D 3O8XA 1G9MC 2AEQH 4KRNA 3MNZA 3SCOA 4X6BB 4UFLA 4DEPC 3AU1A 3VFOB 3WF4A 3N15A 2MWCA 2PWEA 3MYZA 2MHAA 2W0PA 5DFVC 5EOQL 3R8QA 5EIVA 1E40A 2PF0A 2W0LA 1QYGL 4ZO9A 1TZHB 1Q94B 2JJSC 1P5UA 2J4WL 2DQXA 2V3GA 4RMRA 3L5HA 3OKKA 3WKZA 4UQ2B 1YY8A 3MRPB 1X6NA 2DF3A 3P9LA 4I9WE 1M04A 5E5UB 2DIBA 3KGRA 4PBVC 2CITA 3BDYL 3BH9B 1FN4B 4CNIB 1KENL 3SDDC 5DR5H 3PTKA 4YDJA 4N0UB 1I9JH 2V7NA 4PCSA 3AIWA 4K3EH 3GMOA 1MCOH 3SGKC 2FHCA 2YK1H 3ARDC 3FT3B 3OB0H 3VFRA 2XRAL 4YHKL 4H20H 1BQUA 4E5XA 4UMGA 3UAJC 4DUWA 3KPOA 3SDDA 1A14L 4PYGA 1P9MA 4NZDA 4ELMB 1KPVB 1JNHB 4GQQA 4WV1B 3O6KH 5ANMB 4NCC1 4U0QB 3SGKA 3TPUB 3M45A 4YWGL 3ZKNC 4POZC 1HT6A 35C8H 4EAMA 2GK1A 1OTUD 3PIQA 5C0FA 4NHUB 2C1PA 5KVFH 3EJZD 2ZICA 5KW9L 5D71H 3S5YA 4JDZA 1K5NA 3I02B 4R7DA 4JFTA 4XP9H 3ZYZA 4NO0D 2CKNA 1AD0B 3W5NA 2SEBB 4UUJB 1LL4A 5C0AE 1UR0A 2DSKA 1I85C 5C7XL 3IJHB 2DSUA 3HG2A 1ADQA 2A6JB 3WUEA 5LKNA 3AISA 3U7YH 2DIAA 1HKMA 1A3RH 1W72B 1S7VA 5CGMA 4PBGA 5FA4A 3TBTA 5HD8C 3WS6A 2B39A 3GSWB 1EV2E 4JL1A 3J8F7 3HAEA 4QTIL 5FV2A 3TBWB 4I9WD 3GMMB 3WUWG 2ED8A 1PYWA 1G6RL 4LPTA 3PV7A 4P5KA 3RWHB 2J25A 2VLKA 2J2ZA 3BGMA 3VG0L 3MXWL 5DEFB 3A6CL 4LGPB 3RWGB 4KZDL 5SX5K 1HNGA 2LQRA 4CN1A 1JFHA 1DVFD 3K1DA 3P9MB 3SDXB 4AK1A 1CENA 3WUBA 4GG8A 4WI2A 3ECBB 1I1YB 3W39A 4Y0GA 5CGTA 3B3IA 2BSED 1F8TL 2KBGA 5AD0B 2VX7A 2EDLA 4OM1H 3DSNA 5ISZD 4YHOH 4LIQE 1BP3B 3CX5J 4LQFH 1FZMA 4RGNE 2X89D 3KPRB 5GRZA 4P23D 3K0WA 4EBQH 4XP1L 3A67H 5I1DA 2GEEA 5GJTH 5E9DE 4IRJD 1ZMYA 1I9EA 3BPOB 3H7BB 2NXZC 3PHQB 4LEXL 4RAVB 2VURA 32C2A 1CD1B 3NOIA 1LEKB 4MWFA 4JY6A 1BTCA 1KQZA 3NFSL 1TVHA 3OAUH 4OZFH 3IB4A 1IVLA 3QPQD 3W29A 1DUZB 1FYTB 1WTLA 1SFSA 4AIOA 5I1KH 2M1KA 5HHQB 3WH9A 1BMGA 3EO1B 2EABA 3DNKA 4JFEE 1CU4H 4NZFA 4GRMA 1YPZE 1VAHA 3S9DB 4G6JL 3UTSD 1T3FB 1CVSC 3QIBB 3WE6A 5CCKL 1N6QH 3FQTB 4FFYH 4UFKA 1Z0MA 2XTLA 3CVHL 5ID1B 2MCPL 1BPVA 1N7ML 1AO7A 1ZKAA 4X6EB 5I8KH 3EOTH 1ZU8A 4L4OA 1RPQA 5D7LA 2EE6A 4XP5H 2W5FA 5F44A 2WM0A 5IMOA 1LO2H 2WYSA 3SKJH 1J88A 4M62L 3RVTD 3D25B 4JO3L 4M6OH 1NEZG 5LWYL 4GW1A 2EDKA 5DQ9A 4ODXB 4OLUH 1LG1A 5D7JD 3KPSB 4MNGE 3WENA 2EIZA 1YPZF 2NYYD 5BZDB 5C08A 5HYFA 4NX0A 1T1XA 4Y1AE 1T83A 3BUBA 3U0PB 1C5CL 1UCBH 4UTAL 4H41A 5AUMB 2V2TB 1LD9A 1ES0B 5E9DD 5JQHC 4M1RA 3GRWL 3QUMA 3LMJH 4MA3A 4B7LA 4UV4H 1F3JB 1JTOA 5EBWB 4XGZA 1OBAA 3X3GL 5BRZB 4UV7H 4H1LB 4HGKC 4RWYH 1FIEA 3DVNA 3O6ML 4W4OC 1F00I 5T3ZL 1A7OH 2C3HA 1I7UA 2OQJA 3QEHA 3ARBC 3FO2B 3NTCL 5EU6B 4LXFA 2XTKA 4UT9H 4GAFB 4GUPB 4JANA 4R2GC 4JPVL 4JFQB 3GMPA 1FNAA 4QHNB 4JFED 4ODWA 5EBMB 2WMFA 1MNUH 4UBDC 4HKXB 2Y4SA 4UIKL 3VJ6B 3ULUE 1RULL 2JCCE 3MTRA 1PZ3A 4L4TB 1R5VB 3ZE2E 4NHCL 1AHWA 4GW4B 2O9PA 2CKSA 2XTJB 4QRUA 1I9RH 1A7PL 1B30A 1QI3A 2XN9A 4XPHH 2ALWA 4HZ7A 2VIRB 4OF8A 3Q5OA 3V6OC 4IM4A 1VFFA 3ZHKA 2JIXB 3QBTB 4U1NA 1P4IL 3GSXB 2QHLA 2ZUQB 4P2OB 2PNDA 3LMYA 1B6DA 3ZDXE 2F5AH 3OTTA 1CFTA 4XAKE 3UC0L 5DRWA 4H26B 4XWGL 3IDIA 3QDMA 2W60B 4GQ9H 4JZNB 2W67A 3HMCA 3BZ4B 1CLOH 4HCRL 3ULUF 4Y1AD 2JCCF 1S7XA 3ZE2F 3KE0A 1UZ1A 2XVLA 1TZIA 1E9LA 2EPNA 3O11A 4LASH 4CVZA 4TVPE 2YKLL 4FFZH 3DECA 3O6FD 3ETBF 2V17L 3MLXL 4PSPA 1KEML 4HLJA 4GO9A 2YA1A 1UWEH 1QSEB 1JTPA 2OLHA 3ZDXF 3WNOA 2BNRA 4NCC2 2IFFL 5GRUH 5I74B 1ZSDB 2FATL 3MJ9H 2J8OA 2VITB 3SE4A 4OF0A 2X2IA 1PG7L 2P5WB 3HZVB 2AI0L 2VT0A 3N18A 3ULUD 1UWXH 4LLVB 3DX0A 1UB5B 2VCCA 1J0ZA 3ULVL 1HQRB 2A9NH 3FMGL 5CSZA 1U8MA 3QGVA 4DK6A 1HYSD 1X44A 5TPWL 2FSEA 3V4PH 5DWUH 2LTQB 3LQZB 1IC5L 4UQEA 1KN4H 5IHZA 5MI0C 4KMLB 4NQDD 4X0NA 4HQQH 5H37G 1ZLUK 2WMIA 2DL2A 2EDWA 1FAIH 5ESAA 2DSVA 2UUDK 4UFIA 3AXXA 2VRQA 4UFJA 3DWTA 1B3JA 1T89C 2PXYC 3KR3H 2F61A 1S7UB 2BP3A 2ZSVA 2R4SL 3BT2L 1Q6DA 3I85A 1FG9C 1GGBL 1RZJC 2H3NA 3WJJC 1K6QH 1G9NH 1QBML 3MLVH 1A21A 1A7RL 3INUH 4YE4H 4E42A 2CKRA 4OUUA 3FB5A 5IKCA 4P46D 3T04D 2BC4A 1JYNA 2HJLB 5D2NE 1S3KL 2DICA 4KHXL 1ETZA 3PGDB 2F74B 1KLFA 4M8QA 1QKZH 4F79A 4LHUB 2HFGL 4Q22A 5L2KA 5JBFA 3U57A 2DWDA 2CHNA 4XXDA 1XZ0B 3K80A 1JK8A 1GW1A 3EYUL 2XPKA 3UG3A 1KG0B 4OQTA 3NACL 2VAJA 4K71B 6FABL 3OJDA 5FF6A 2WC3A 4EVNA 1ZLSH 4I48A 3ZIZA 4JRWA 3ZR6A 2GQHA 5T3XE 2VAAB 5LGHH 4KDTA 1I3RA 4JFFE 4ZQKB 1UHVA 3D1MC 3T1WA 3OX8B 1ZHBA 4LSDA 3U0TA 4UOQA 3EMQA 2XWBB 1EFXA 2XKUA 1E6JL 5BRPA 3QUXA 1D3CA 1E6NA 2FIKB 3AM8C 5BJTB 4YNYA 4HWEL 4PMDA 4FQXA 3UTZA 1W2KT 3IXTA 2DOCA 3VXPB 3STBA 3UEQA 4XPTH 5T1KA 4HW6A 4ZAKD 3A3HA 2R2BB 3LRMA 3DX6B 4AEEA 2COQA 2NZ9C 5E8DL 1KGCE 4AQOA 1VDGA 5DD6A 1QOKA 4I18A 1H2JA 2GIYA 1FYHB 2VABB 5JW4Q 4L9LB 2GJZA 4OAWA 4OGAC 4UNVA 4RAHA 2DH2A 1OT2A 2YD4A 3KLSA 5D1XC 5I16B 5BW7A 4J3OC 1WISA 4LRNH 1P53A 4JPKL 2D03H 1P4BH 4PJIA 4JO4L 4MTVA 5IQ9B 1J87A 4X5LA 1UM6L 1SMAA 1JGIA 3BWUC 4KPHL 3T65B 1S7QB 5BXTA 1PEWA 2WMPA 5K9KA 3UTTB 4PTUA 3PZTA 3P4OB 4FNLL 5M5DA 2OS7A 4AMKL 3OR7A 5LXGH 1NGXA 4TQEL 1IGFL 2A2QT 5DT1L 5ICZA 3EYOA 1LDSA 5IFHL 4LLWB 3KLKA 3MFFB 1AJ7H 4Z7NE 3W26A 5T3XD 3QDGA 3C5ZC 3HZKB 4PJDF 3VXRA 3PWPA 3T4AA 4JFFD 2X4TA 1GPOL 3PGFL 3VDAA 5IFJA 3C2SA 3KYAA 4NZJA 3O3EA 3PZNA 3DURA 1W2VA 1RI8A 2X1QA 4X9YA 3BRDA 2D31A 1DWFM 3ZO0A 3SE8L 1QNZL 5CKGA 1GVIA 1EDGA 3GSNB 3QHTC 4FFVD 5FO8A 1RHHA 4Y4KD 3MLTB 1T0MB 3IDYC 2DIEA 1UB6A 1Z5LB 4L8CA 1XGRB 5BCAA 4DZBB 1KGCD 2XNAB 2RHEA 3VI4E 4IOFC 1GC1L 3BVUA 2B2XL 2X4UB 5A6LA 4IMLA 1Y0LA 2R0ZH 3BQUC 2CIKA 4KTDH 3CC1A 4F7CA 1JHLH 1QTYT 1GOQA 3QCUH 4PY7A 3IRPX 3ROOA 5I1LA 1U30A 3MPCA 1TETH 3TV3H 4YBQD 1BQHB 2ZCKH 2FX8H 4LF3A 2VDPL 1U3HC 1J0YA 3FO9B 3V5KA 3D9AL 3C08H 1FE8L 3MLRH 1E4XH 1FZOA 4JB9H 3O4OC 3A6OA 1UYQA 3HG1E 3M8OH 1HH6A 3HFMH 1JRHL 5FK9A 4F9LC 4XNQB 12E8L 4F37K 1WAAA 3FQXA 2BJMH 1VESA 1W0WB 2EICA 1LK3H 3MACH 4AYGA 4MADA 3T0EA 2W63A 5A2LH 6TAAA 3D0LB 5F6HJ 1HHKB 1Y18B 4P4RA 5HDBF 3VXQB 3KYNB 4AYFA 3DC0A 3VNYA 4PYSA 5D9PA 3D3VA 3IF1B 1AFVH 5JHDA 2Y5TB 2Z0BA 4HMEA 3UMTA 1R3KA 1H49A 5KSAB 4OF3A 3QXUA 5C6PB 3CFJB 3WIHL 1ZE3C 2HKHH 2BDNL 4OIBA 1QVOB 2H9GA 3WLBB 4AEIL 4AM0A 1NAML 3ARFC 5FYJL 2IQ9L 4WUUE 3I50L 1VACB 2BVUA 2BX5A 4MS8D 1JMZA 2VH5H 1CLYL 2NW2A 4GKZA 4ZTOH 5FUCC 3OR6B 4F33A 1Y7VA 4Q0XL 4KY1H 3SN6N 2IQAB 4HOXA 1V3HA 3VX0A 4Z0XA 5E2WL 4PY8J 3FO1A 5DHXB 4HA1A 2VZVA 3AIUA 2DQFA 5I0ZA 4U5IA 4C7FA 1ZTXL 3RZCC 5DK0A 4HGWA 5INCA 5F1OB 3UZEA 1UWIA 3HG1D 4BH7B 5HHME 1TFHA 1XF1A 4MA1C 2DQDH 5SWZE 1INDL 2AJUH 4TX8A 3EFFB 5D72L 5MENB 3TIDA 1YEDB 3OBAA 5ILTH 5AYUL 3KS0H 4QRRA 1MQQA 1RSFA 5D6CA 3W27A 3QIWB 4NRZB 1CICC 1KJ2A 4S1QL 1SHMA 4WHTA 3AZTA 1KYOJ 4NN7C 3BVXA 1XH1A 2WIMA 4V28A 3I6KA 5GGSB 5ABHA 3UO1H 5C0DB 3LKSA 3QPXH 2B8OT 3O2VL 5HGDA 2NY3C 4W6XB 3BKML 4MX7B 4WUUD 4UZSA 1MPAL 2VXTL 3TO2A 1KJVB 3D39A 4L8DA 2P5EA 4NKIH 4GPNA 4TVCA 5CP7B 3TWCH 4YBHA 4GIAA 1KPUB 3W37A