1XGDA

Apo r268a human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title The structure of Apo R268A human aldose reductase: Hinges and latches that control the kinetic mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1xgdA00
3UGRA 2PDPA 4YS1A 3V0UA 1T41A 2IKIA 2WZMA 4DBUA 4ZFCA 1YE6A 4ASTA 3R8HA 5KETA 3F7JA 2INEA 4XZIA 4GA8A 3WBWA 3M4HA 3N2TA 3P2VA 2FZBA 2R24A 4GQ0A 2FZ9A 4R9OA 4YU1A 1LQAA 3LUTA 4JIIX 4G5DA 4Q3MA 2PEVA 3B3DA 2PDWA 5LIYX 4JTRA 3UZZA 1HW6A 4H8NA 5AZ1A 2IS7A 4XVDA 2WZTA 2ACRA 1X97A 1ADSA 3C3UA 4XO7A 1ZGDA 5LIKX 5LIWX 2PDFA 1Q13A 1T40A 2PF8A 4FA3A 4DBWA 2PDUA 4WDUA 2A79A 2HV5A 2DUZA 3RX3A 4XAPA 4DBSA 4XZHA 2PDCA 2ACQA 4XO6A 4JQ4A 3ONBA 2FZDA 3UFYA 3NTYA 2PDIA 1QRQA 2FGBA 4JTCA 3EB4A 3GHSA 3WBYA 4IJCA 3RX2A 4PUWA 1ZQ5A 2PDXA 1AZ1A 1PZ1A 5JH1A 3LD5A 1X98A 2DV0A 1US0A 3LZ3A 2IKGA 3GHTA 3R43A 1RY0A 2ACUA 1UR3M 2PDYA 2PD9A 3D3FA 1AFSA 1XF0A 3DOPA 2F2KA 4WDTA 5C7HA 4DZ5A 4YVXA 3T42A 2BGQA 3Q65A 3LBOA 4QR6A 3M0IA 5JH2A 1EXBA 1PWMA 4PMJA 4GCAA 3GHRA 2PDQA 4JQ3A 5DANA 3GHUA 4JQ1A 2CLPA 3LZ5A 4I5XA 3N6QA 2FZ8A 3R7MA 1AH0A 1JEZA 1YE4A 2PDGA 3RX4A 4ICCX 3UZXA 2VDGA 4GACA 3CV7A 3H4GA 4MHBA 3H7UA 1QWKA 3COTA 1SM9A 2PDHA 2PDNA 1AH3A 1IEIA 2IPGA 2INZA 3LENA 2IKHA 4HBKA 1FRBA 4NKCA 1Z9AA 1HQTA 2DUXA 4YVPA 4GABA 3MC5A 4IJRA 2NVDA 3CAVA 2BP1A 2NVCA 5HA7A 1RY8A 2ALRA 4XZMX 4GIEA 2IKJA 4F40A 1GVEA 4LB4A 1ZSXA 3VXGA 3WBXA 1Z89A 3LQLA 4WDXA 3H7RA 1X96A 5HNTA 2PZNA 3LN3A 3UYIA 1S2AA 1PWLA 3DN5A 4PRRA 1XJBA 4WEVX 1PYFA 4GQGA 3BURA 3EB3A 1Q5MA 2R9RA 3EAUA 3UG8A 4L1XA 2F38A 3ERPA 4LAUA 1AH4A 4WRHA 3CV6A 3V0SA 3G5EA 4EXBA 3MB9A 4Q7BA 2IPJA 3R58A 4QBXA 4RPQA 1S2CA 3LNMA 5LIXX 2HE8A 4HMNA 4L1WA 1EKOA 2FVLA 5HNUA 1AZ2A 2PDBA 2PDJA 2IPFA 4JIRA 4IGSA 3GUGA 3UWEA 4LBRA 4AUBA 2HEJA 3BUVA 4EXAA 2HVOA 2I16A 1Z3NA 2ACSA 1A80A 3V0TA 1VBJA 4WDWA 2I17A 3G1RA 2IQ0A 2PDKA 4FZIA 4LB3A 3UP8A 3FJNA 4LBSA 2HDJA 4QXIA 2PDMA 4PRTA 4FAMA 3CASA 2PD5A 1XGDA 2HVNA 1M9HA 3V35A 1OG6A 4WGHA 1MRQA 1RALA 1C9WA 1EF3A 2J8TA 3LEPA 4H7CA 2QXWA 2AGTA 1IHIA 4JQAA 4PR4A 4JTDA 3BCJA 1YNQA 1LWIA 3QKZA 2PDLA 3M64A 3KRBA 4XK2A 2IPWA 3O3RA 4OTKA 3R94A 1PZ0A 3CMFA 4XZNX 5M2FX 1R38A 2HE5A 3UZYA 3BV7A 3WG6A 4PUUA 2C91A 5AZ0A 1ZUAX 1K8CA 4JQ2A 3V36A 4JIHA 4FALA 3Q67A 4XZLX 3WCZA 1Z8AA 4JTQA 1MI3A 1YNPA 3LQGA 3FX4A 4XVEA 4YVVA 1VP5A 4LAZA 1EL3A 3R8GA 3R6IA 3O0KA 1J96A 2BGSA 3S3GA 3CAQA 2ISFA 2IQDA 2PFHA 1MZRA 2P5NA 1S1PA 3UZWA 3ONCA 4JTAA 5LIUX 3U2CA 4QX4A 1S1RA
chains in the Genus database with same CATH superfamily
4PBEA 2G8ZA 3IGSA 2TPSA 1C8VA 1NY1A 3G2GA 3V0UA 4LYQA 2QLYA 3LX9A 1AODA 1E15A 2XISA 3R8HA 1TO3A 1GVRA 2C7FA 3MI6A 2XN1A 2WC7A 1QDSA 3IAQA 2FZ9A 1LQAA 4DJDD 3ID7A 2VX7A 3G1SA 1Z69A 4CUCA 1E1EA 2Y6ZA 2D3NA 1X6LA 4XAYA 3N73A 3C2YA 3FYYA 5CSYA 4LWWA 3UG4A 3H2EA 2AQOA 1GPWA 2GSEA 1ME7A 1RCQA 3WYZA 3JS3A 4TV5A 1PDZA 4NZ1A 3WD2A 4O17A 5LA2A 3WQ8A 3FDGA 3PZMA 1Q13A 3FA3A 2ZXQA 3CUGA 3W01A 1EC9A 4PSRA 3RX3A 2QDGA 2POZA 1TCDA 2PDCA 4XO6A 3JUGA 3RGTA 3RM8A 2DSUA 3DI0A 3ONBA 3GG0A 1Q66A 1UWSA 4E4UA 4EPEC 1EEXA 4NF7A 2YCJA 3SAZA 3B03A 4Y9NA 4FF7A 1NQKA 4K8EA 2VOTA 5HINA 4BI6A 4EWJA 4PMUA 3ALFA 1JI2A 2X30A 4R34A 3GX9A 1WBJA 4BFAA 3HIJA 1VLWA 3VKCA 2PLMA 1E0XA 2X40A 1G4EA 4MMWA 3EOLA 3TTSA 4ADTA 4FXFA 1HJXA 1XIBA 3GQYA 1FWFC 2VGFA 2VQUA 3C2EA 2E3ZA 2VWSA 2PSNA 4XBKA 3GR4A 4HKPA 4GG9A 5CJ5A 2J47A 3H2OA 2W9MA 2FZ8A 1AH0A 4AXKA 3MVIA 5T9BG 1O1HA 2C15A 5HPOA 1IWAA 2W92A 1FKWA 1RLDA 3C0LA 3CLMA 3PAOA 1DJHA 1IZKA 1W3JA 4ICCX 2Y62A 1TMQA 1C8XA 1E6RA 1DJYA 2NSXA 4AWSA 3KTXA 1AW5A 4KESA 3M7SA 3M0VA 1VFLA 2VO5A 5LXEA 2GVLA 1AH3A 1RD5A 3C2FA 1A5KC 1VF8A 4O1CA 1E51A 4F2BA 3AJ7A 4NNCA 1R86A 1NP0A 5A8NA 3P0XA 1A5BA 1LM1A 3M5VA 4WF7A 3C3NA 3CL8A 3L0KA 2PC8A 1FWSA 4WOZA 2IKJA 5EMJA 1UZ1A 3VDBA 3LY0A 4BEQA 1RH9A 1EX1A 1RK5A 4DBDA 1DIKA 3A3HA 2C13A 1YBQB 4PL2A 2A5HA 3N34A 4O19A 3S1XA 4ZXOA 3AIUA 4RNFA 1GUVA 4PMQA 4QQUA 3E02A 4JHZA 3BICA 5DT7A 2QF7A 3ARYA 2QT3A 2IPJA 4TTGA 1JUKA 2Z7KA 4QNWA 3NYDA 1O12A 1QPRA 5LIXX 1JZ7A 1ITCA 4O13A 1I6NA 3WF3A 2Z25A 1GHSA 4B3KA 4AF0B 4F8XA 1HKJA 3PULA 3CQIA 4H9XA 2J13A 3WMBA 2OGYA 1DWJM 5E93A 3DYOA 5LHFA 5AHNA 1Q85A 2NT0A 1OT1A 3W7CA 2EPLX 1TX0A 3F4WA 1LWJA 3WK3A 5C2GA 3ARPA 3C2OA 3AI0A 3M43A 5GNYA 3NAVA 4PE8A 4ZO6A 3K2GA 4OZOA 1BYAA 3KUMA 3QV7A 3WQOA 1W37A 3VNYA 3GFXA 1LRQA 1H4PA 3BAIA 1E1CA 3EOSA 4ATLA 4L5ZA 1PXGA 3KTCA 5D9OA 1UASA 1XR2A 2C1HA 2PLCA 5EA9A 3NEVA 2YBTA 4JBRA 3SRKA 3WSUA 2ZADA 4MZ8A 1I0DA 2UV8G 3E49A 3I7SA 2GSHA 1GW1A 1ZBKA 4K7YA 4JEQA 2Z2UA 4EXQA 4NZ4A 2JEQA 3BCDA 3SR7A 5KSWA 4LBUA 4ZCWA 4D6EA 4MWAE 2HWGA 3D3AA 3OYXA 2VEMA 3P82A 4Q4OA 1G0CA 1BXNA 4I9AA 4Z1BA 2DPEA 4MY1A 1PSCA 4PMRA 3M0MA 1X8FA 2TRSA 3PANA 2BTMA 4XK2A 1DE5A 3S83A 3VKDA 4KRTA 5EMLA 5KZDA 3VK5A 3ZT5A 2QEZA 1LDCA 4E3VA 1I45A 4FPSA 4HA3A 1R47A 3BOLA 4CNSA 4MNMA 1C3FA 3WFLA 1XPGA 2NXIA 4R7OA 1HUVA 5AVHA 2G97A 2CPUA 4KIRA 3NL2A 2C91A 3U7BA 3AS2A 4QG8A 5CPMA 1RJRA 2AMXA 2HS6A 4LC8A 3SRDA 1R2TA 3W7IA 1O1ZA 3QEZA 3JZEA 2E6FA 3K4WA 3UVAA 4DF0A 2LLEA 3EKGA 3HFTA 2CWXA 4JX4A 1U30A 1FWBC 2ZRXA 3VDGA 3M0XA 3HV8A 3M7WA 3QZEA 2DZXA 3H23A 3O2LA 4AIOA 4M5PA 2G37A 3E1F1 3WDQA 3QMSA 4O54A 5F2IA 4Z1YA 5LIUX 1ICPA 1JRCA 3BZGA 4AAJA 1OCBA 1QNSA 2NT1A 2NXHA 4WJ8A 3EOUA 3PTDA 3N4AA 2OB3A 4XAZA 2WZMA 1C7TA 4UR8A 4QE4A 5E09A 4OUIA 1EQCA 4IQDA 4ZFCA 4BF5A 2PTWA 2GFTA 3O15A 1XL9A 3WY1A 1CGTA 1KR0A 4GH1A 4AEFA 1SZFA 1ODZA 2VT0A 3W7PA 1T8QA 4Q3MA 4N4PA 3MMTA 4Q6JA 5FJPA 4MTVA 4ZSUA 1FHDA 3AYVA 4R85A 1B31A 1FWNA 2OEKA 1W1A1 1F3EA 4B9ZA 2O7SA 1GW9A 3IIPA 4K1GA 2NQZA 1QI4A 4DN1A 1NDYA 1QI3A 2XZ7A 1FWDC 4FOUA 5LXXA 3N6JA 2VJXA 3R25A 3CB8A 1SSDA 4UBPC 3NQEA 5AC7A 1XDLA 4LCQA 4DYJA 4I6KA 3KAOA 5EMYA 4BHYA 3R1ZA 1JCLA 2DZTA 5IHSA 4A35A 4XAPA 2VUYA 3QHMA 1W3NA 2GWGA 4IOTA 2ZWYA 2OYLA 1VJSA 4CQCA 1K6WA 4AZ6A 3TSBA 4RR4A 1ZJIA 3U7VA 2PDXA 4GGBA 4H8HA 1PVNA 4D1IA 3QPZA 4NX5A 4Z1DA 3RRAA 2W79A 1J2WA 2Y5JA 5G5IA 4MADA 5A8PA 1F3XA 4I6VA 4ZOBA 2QVNA 4UFKA 3T0BA 1XLIA 5D9NA 3CZLA 3P80A 4KH2A 2O0TA 4C6IA 1XF0A 4I9JA 3BJTA 1IIHA 2R91A 4DJEC 4UZUA 3AIWA 3KCJA 5EBUA 2GGJA 3GH4A 4QR6A 4P7RA 3OVRA 5JH2A 1CXLA 2JEPA 4K2SA 3I10A 3H53A 1XLGA 2Z1VA 3DESA 3C2RA 4RPPA 4C6CA 1IWPA 3CIWA 3MWCA 4GLEA 5CBBA 1EC7A 3GU2A 4H4IA 3JZUA 4WJXA 2V38A 4TU1A 1UC4A 2X05A 4DJEA 1A5MC 3HMCA 1ZL1A 2E8ZA 3N17A 3ZXWA 1OGBA 3HF3A 1SVDA 1SM9A 5D8WA 5A6AA 4AY7A 1KFKA 2INZA 3ARSA 1H1YA 4PUMA 1SMAA 3RMJA 4U2YA 1W9XA 4PUJA 4L4LA 4YVPA 1J18A 1BWVA 3TYZA 5TQLA 4KWUA 1W17A 3UA4A 1FWTA 4LRSA 1W9BM 2ADAA 3MO7A 4IMDA 3T44A 1ELSA 1TV4A 3WBXA 4CVWA 4ADSA 3OP2A 4PODA 1UBPC 5AHIA 3B8VA 2JKAA 4IFKA 1E1CB 3LSBA 1Q63A 3HTWA 3DN5A 3H21A 3O07A 1RPKA 5CZTA 1YPFA 5IBXC 3W7GA 1JYWA 2GVYA 5DLCA 4M24A 3AIEA 4UXDA 4W4QA 3RXZA 4B2DD 1TPUA 1GT8A 3AIRA 2C0AA 1WYIA 2HJPA 4CKQA 4AX6A 2E9MA 2QCDA 1UIPA 3CZEA 2EJAA 3NM3A 3UNTA 4GE8A 4IMCA 4FI4A 3LNMA 1W9VA 1NFGA 1P1MA 3MKVA 3AMGA 4GQQA 2XHYA 2G95A 1GKPA 4DZIA 4IT1A 1VRXA 3EWUA 4KFNA 3IUIA 4U3AA 2QW5A 3BUVA 2BHZA 3TYAA 4LJ3A 4AZHA 3BG9A 3VIJA 2E77A 4E8CA 2BX7A 4GZEA 1YPIA 3I65A 3SIZA 5HR7A 4QCFA 4BKNA 3U9IA 5C9WA 4HOWA 3STGA 3TYCA 4CLMA 3YPIA 5D2YA 2E0PA 1V02A 4WUIA 1OG6A 2FZMA 1M53A 3HPXA 4GJIA 4RW5A 3DFHA 4HPHA 2PB1A 4AWEA 1MEWA 4Z2KA 3QW3A 3M44A 2ZICA 4HIBA 4XSLA 1F3TA 2QXWA 2V81A 3OA5A 2R94A 3GVWA 3LM3A 3HGOA 3OA3A 3SN0A 4TVDA 5BOEA 2IW0A 4E2OA 2DSWA 1XPYA 2H8XA 1PZ0A 3SN4A 2J9ZA 2QDEA 2WVSA 2VCCA 3E0LA 2QMKA 1VPXA 3SADA 2QCGA 1OC6A 4D8ZA 5HJLA 4FEZA 4RDWA 3C8FA 4ERAA 4BI5A 2QIIA 4YTSA 1QXLA 1CCWB 2W63A 3VYLA 3MA8A 5G4EA 1XIFA 3I4KA 4QROA 4LVDA 3BW3A 1TTJA 4W7UA 5DCDA 1XC6A 3N19B 5FF2A 4ZTXA 1KA9F 2WKLA 4UNKA 1DWGM 1H3GA 3B9DA 3S3GA 3QLLA 2H90A 3SUWA 2BOFX 2Z29A 3R89A 1Q6EA 2DT0A 1ECEA 4IGMA 1GOQA 3VFCA 2Z00A 1CW2A 3CXOA 1LP6A 1YHTA 1OGGA 3BSGA 1FX6A 1JNEA 4S39A 1T41A 3ATYA 5F7UA 1JFXA 4DBUA 1JF6A 4OOUA 2VGBA 1PCKA 3AIBA 3QM3A 3MCNA 4RNJA 1W9PA 5BMWA 1HVXA 2OFJA 3IJ9A 1X8CA 1PTGA 1OFDA 4R9OA 3CUXA 1KFWA 2WCGA 2PEVA 4DPPA 2PGWA 3THCA 2X1RA 3MSRA 1KM5A 3B8DA 3TXVA 4AC7C 2A3CA 4HYVA 1V3KA 2ACRA 1W8GA 3TQ0A 2EG6A 3S8HA 1PBGA 2NX3A 1R85A 4N6EA 3T81A 1QOXA 4H9UA 2NSOA 2VZUA 4C7FA 5ECVA 4YN5A 1KFJA 1RXOB 3D0CA 2WBGA 3VIHA 3WF2A 3BLIA 4EF8A 1DWFM 3VDAA 1E9LA 2EJ1A 1W1B1 4C6MA 4EAYA 3KL3A 2WVVA 4S3DA 2WM0A 1YKWA 3NXLA 4V2XA 4NYUA 4JIQA 4DUOA 1H60A 3WJWA 1QRQA 3NWRA 4B5SA 1X7FA 4ECLA 2D2HA 3A13A 4PUNA 5E9XA 4JZ5A 3W7JA 3W38A 3LYEA 3M46A 1Z42A 5CJMA 4H9TA 1M7XA 3TDFA 3L4WA 2HTMA 4O0ZA 3QSRA 5JH1A 3M5XA 1SFSA 1Q2RA 3QH2A 2WMIA 1MWOA 3NNTA 3TN3A 4I3GA 2J24A 2GQ9A 3GXIA 4D9PA 2E8YA 4J3ZA 1HFBA 3TAOA 3BLLA 5DF0A 2WZHA 1RHCA 3L7RA 1MNZA 2R8WA 1VEMA 2NV9A 2A3EA 1EGVA 4IFKB 3W28A 1PL9A 3WEOA 2J9XA 3S9IA 4HN4A 3SRFA 2CBJA 4HA4A 4E2VA 2BDQA 3PUOA 1EYEA 1AL8A 3VD7A 1B3OA 1US3A 1VYPX 3QR3A 3LHTA 1JEZA 3I6RA 2P8BA 4OGZA 3GIPA 3AO0A 2XVKA 2FLIA 5CH9A 1YDOA 4UOQA 2QCDB 3OIHA 1FWAC 4G1NA 2VKZG 1B0IA 4IXHA 4TUFA 4EK7A 4H01A 2WVUA 5TAOA 1VBGA 2EPOA 1V7YA 4JHMA 3DX5A 3UNDA 1D2KA 4PL1A 1SZGA 3G1YA 4UNLA 4H2HA 3B0UX 3QFWA 3N12A 1IEIA 3AWOA 2Y70A 3T4WA 2DZUA 1JR1A 3QY6A 4DAIA 1REQA 4IMGA 1A3HA 2ZZ3A 1R3TA 1NWTA 1UKTA 4C6DA 3EX6A 1TRDA 4OIFA 1NVMA 3HJEA 1E9YB 1VBHA 3MCOA 1D3GA 3HN3A 4MJ4A 1FUYA 4V28A 3MI3A 1KM1A 1PKNA 2NQ9A 1Q6DA 1K70A 1KRBC 4XTDA 1VRDA 4BQ3A 3PJXA 4NY2A 3ZR6A 1RP9A 3Q94A 4H04A 1YDNA 1J5TA 4UOZA 3PTKA 1JXJA 4WY0F 3WF0A 1GVIA 4Z2LA 2F38A 3K46A 2XIOA 4H9VA 3SFKA 1LQ0A 4GO8A 2GGGA 5FF0A 2W27A 4KERA 3EPMA 3TQPA 4DXKA 4FNUA 3H70A 4AZGA 2C3ZA 1MDLA 3STFA 2I5GA 4M19A 1DWIM 1V79A 3RCNA 1LLZA 3NQ7A 5F2GA 1NAL1 2A7NA 3GM8A 4CU8A 1YADA 4ICNA 2V2CA 2Z4GA 1GYNA 3WH7A 3A4XA 5AC4A 3GUGA 4HTYA 2HEJA 2E5BA 3CYVA 2XFFA 4GZIA 2XU2A 3NL6A 4E3TA 2ACSA 3PPCA 1DQUA 4YTQA 1T96A 3TN5A 5CSRA 1M7PA 2OQYA 1YDVA 3UG5A 1VCGA 2ZX5A 2FHCA 5DT5A 2VEKA 3H7VA 1AQMA 4CNUA 1MQPA 3GAYA 2HPMA 1C9WA 5IFTA 1PEZA 1RJQA 2QJNA 2J8TA 4W8LA 3TQVA 5BRPA 1FFRA 1D8WA 1IHIA 1TPDA 2J6VA 2X09A 4CD6A 4IMAA 1WKEA 1I1WA 1VS1A 3SCUA 1HJQA 1X1ZA 3LS9A 5I07A 2VL4A 2VR5A 1M03A 4KCUA 4N9EA 1T5AA 2HK1A 1WAUA 3R10A 2OT1A 3CAWA 3DG3A 4RNHA 4M7SA 2NZLA 5C9XA 3MUXA 2ZE3A 4EP8C 4F9JA 2VHLA 4Z2IA 4XTIA 5FEXA 4JX6A 3ZM8A 1KFBA 2Q09A 3DHUA 5EU9A 3F1QA 4NU7A 3W6MA 1LBLA 1XGZA 3HPSA 3FA5A 3GU1A 1T99A 3PN8A 3HQ1A 3FX4A 1Q4WA 4RZ6A 5BXSA 2OYMA 2C8NA 2QR6A 4LCRA 3G0XA 3GYCA 1AW1A 2A2IA 3VIFA 3RILA 2WWDA 4UFHA 2XSXA 2WVVB 3U2EA 5FSEC 4X0VA 3CUIA 1KO0A 1DTNA 2DT2A 1MW0A 4UQCA 1OZMA 1OGSA 4LX4A 1VHNA 3CUFA 3LPOA 3BJFA 5CZ0A 3UXKA 4AVOA 2DT3A 2FQIA 3GC2A 1DYSA 3BG3A 1VAHA 4FOJA 3QW4B 3I6EA 1YE6A 3PWIA 2WMIB 4XZIA 3L4ZA 1J0JA 4JCMA 4RNIA 1OINA 1G4SA 1E6SM 5A1AA 1XBZA 2D0HA 5HNNA 3LLFA 1XBVA 3MHFA 4ATWA 3I4EA 4Q8PA 2ZZ7A 3EPNA 3UPMA 4XV0A 5AYIA 3KFTA 3HFYA 4U33A 3O6CA 4IQJA 3BANA 4DJDA 2RJGA 3C3UA 4O57A 2KAUC 4KWOA 1MVYA 5CGTA 1Q8JA 3HO8A 4B92A 9CGTA 1RQHA 3BAWA 1MSSA 4CU7A 3K30A 3SSZA 4QTGA 2QCLA 1XCWA 4JY8A 2P76A 1AVAA 1SPQA 1T40A 1N55A 4L6DA 1PX3A 3URNA 4MB4A 2DUZA 3LGGA 4U28A 3V1PA 4MAZA 2ACQA 1H7OA 3SCQA 4UUIA 3W76A 1J6OA 2VC5A 5D2VA 4FOKA 2YYTA 4JNYA 3IWPA 1SO4A 3KVJA 3KOWA 4JDBA 1ZQ5A 3PJTA 1AZ1A 2ATMA 4CNOA 3IARA 1SW0A 1REQB 5C2CA 4EE9A 3L66A 2YCLA 1DXEA 3DFTA 1GK8A 1HNYA 1LG1A 5I3IA 3G8EA 4AMCA 4QG6A 4DZHA 2CFFA 3P8JA 4M1BA 1XYBA 2DZBA 1AFSA 4D8LA 5AC5A 5C54A 4R7WA 2G3IA 4INFA 4GKLA 3P67A 3M1ZA 3MMDA 4KGJA 1OF6A 4RX0A 2EPMX 4O53A 2PMQA 2ISVA 4E8DA 2UY2A 5AB3A 2PDQA 4QS5A 4XZWA 3VGEA 5G2WA 1R9YA 1PHQA 1KBBA 1W1PA 4XSMA 3G24A 4IQEA 2VI0A 6TIMA 4O18A 1JYXA 4LUYA 4TVCA 1TJPA 2VR2A 3CZ8A 3RK8A 3RPMA 3GWQA 1QPOA 3FN9A 3PZTA 1N8WA 1IXOA 2WBKA 2VENA 4B91A 2EHHA 2Y2WA 3P8IA 3GK0A 1UD2A 4TX6A 1P0EA 2V3EA 1V3MA 2IKHA 2WK2A 1SQ7A 9XIAA 3WMLA 1FVPA 4HBKA 3QYSA 4I8YA 1DIEA 1FRBA 3RN6A 1MZHA 4MIMA 1HQTA 4F0SA 1KCXA 1E0VA 1GTHA 2P3EA 4YJ5A 1V02E 1E6ZA 4F40A 4J27A 3QMTA 3WQFA 1HKMA 1J5SA 3N11A 3LN3A 3BH4A 3VCRA 3HPFA 1KM3A 4PUEA 1JCJA 4LRTA 2VC9A 4QIUA 1ZALA 1CEOA 4RK8A 4XZBA 3DYMA 1PDYA 3U5UA 3VOFA 4Q8OA 3EDEA 4URIA 3KBNA 1H51A 2I7GA 4CNPA 3NXFA 4ES4A 3GVQA 3WQWA 4S2BA 1YX1A 2BBFA 4NAEA 4S3FA 4MPQA 1AQFA 3N2MA 1KTBA 4O1FA 4D6GA 4F0RA 3QV8A 4WSJA 3L0GA 3PSVA 3LHUA 1TV3A 4Q4QA 3LLXA 6A3HA 3ABZA 5DX7A 4L80A 1ZJBA 3SJNA 1KV5A 2AOSA 2X1TA 4EVZA 4EWND 4OVXA 3EXRA 3UXIA 1OYCA 4KPLA 5BROA 1KRAC 3N4EA 2CZDA 3WLSA 1XLLA 5LGZA 5LA1A 1FWRA 1PX8A 3VU2A 3CPGA 3B8SA 3IAPA 3U2ZA 3ARRA 1Y5WA 1K4HA 1R3RA 3A12A 3GBEA 2CKSA 3KX6A 5ABHA 4DF2A 3AFBA 3K8KA 5CBJA 1WX0A 2HDJA 2YYUA 2PBOA 2REQA 2BMBA 1W9UA 3HGSA 3W37A 3F2BA 1Z6KA 1YRRA 2W6RA 1I9CB 3CPRA 5HBFA 3OLIA 4H41A 3QSTA 4HN8A 5LYRA 1ZAJA 2X8RA 1UWIA 1NOUA 2HNHA 5DRIA 4F0KA 3CH0A 1MMFA 4H3DA 1JRBA 1MFUA 3T6CA 4H9MA 4RUBA 5CPOA 3T7VA 4DWSD 2J7HA 3K4DA 1BEUA 2MUCA 4A3RA 2PDLA 3KRBA 4UMBA 1WZMA 1LF1A 1KV8A 3TTQA 3VDHA 2O4MA 4HHMA 3LTYA 3RDKA 5BYWA 2CZ5A 1OX6A 4XZNX 5M2FX 1A53A 2HCVA 1V6XA 2PTXA 2XDFA 2HE5A 2A3AA 3W2JA 1S5TA 1TJ2A 1TZZA 1XFBA 1JPHA 4YHGA 5AZ0A 3GDKA 4K68A 2QV5A 2VC6A 5FEWA 4K3ZA 4JN7A 4QDMA 2KX9A 3UW6A 1MI3A 5A8MA 1L6GA 3ZWTA 3GC4A 1B3YA 3SZ8A 1OEPA 2YB4A 1QNPA 4GINA 5I00A 1J96A 2V5JA 1UJPA 1I2QA 2OZ0A 4NJGA 1QPQA 4PTNA 2F6UA 5FEPA 4PGLA 1GEQA 5HATA 3DBNA 2O9PA 1TX2A 4EPDC 4GXMA 3WH8A 1Q6RA 1XIHA 3W7HA 5C2XA 1JZ4A 3TLLA 3AHVA 1DE6A 1MXDA 5A6BD 3IVSA 3BWWA 1AA1B 2BB0A 2OZTA 2YA1A 1YNYA 3GH5A 4US5D 3CT2A 1BTMA 2YCLB 4PRWA 1U2YA 3C8NA 3NURA 4GVIA 3P2VA 4GJ1A 2JKEA 1EDQA 5D2WA 4XIAA 1IR2A 3ARTA 4YU1A 3WUBA 2G4JA 4G5DA 3GXTA 4A8RA 3STCA 1GKQA 4FIRA 3M6YA 2ZUUA 5BOFA 3W81A 4R7JA 1KFLA 4GVHA 3L67A 3THQA 1XD1A 2VVSA 4L61A 1UD3A 4D2JA 1B90A 3UVIA 1E4LA 1TUXA 4IZGA 2BLEA 4GIAA 5EFFA 5G1MA 1ZP4A 3W02A 4BJHA 2R6OA 1P0DA 4ZFMA 3WLQA 3QJAA 4H1ZA 4A2SA 1E6NA 1R3QA 3MANA 2QCCA 4MPKA 4UC5A 3M41A 1W1VA 1FXPA 3IGHX 2CLHA 4YTTA 4U31A 3VD4A 3TR2A 2OPJA 1D3HA 6REQA 2FTWA 3GR7A 3PUDA 3RFAA 1ZPTA 4KW2A 1TREA 4GJJA 2G0WA 3NZ1A 2Z1WA 1XIEA 3GKAA 4AIEA 1V7AA 1XLMA 3WDHA 4J3VA 4LAOA 1UHVA 4JFTA 3W1QA 3GLCA 1LORA 1VB9A 2YDAA 4S38A 2QAPA 3S6DA 3S9ZA 1MEHA 1BYBA 4EAMA 3S2LA 1BTCA 1JPMA 3QPYA 5H1WA 3DHDA 1XI3A 3WNOA 1C9DA 5REQA 4RDZA 2CXGA 2XH0A 2E67A 4PH6A 4ERIA 4Q4PA 5BXTA 1PO9A 3WL1A 3T42A 1O5KA 1L2UA 3DYPA 1OZQA 1PCWA 1O5QA 3UJSA 4HCDA 3F4VA 1DORA 3TWBA 3PZUA 1XKJA 1W6TA 1DWHM 2ZQ0A 1OFPA 2X1SA 3SECA 1EUAA 2OELA 1J79A 5AC8A 4NAEB 1CGVA 3A22A 2DT1A 2WKJA 3HQPA 4CVUA 2QJIA 3QTGA 2ZTKA 2FPTA 1Q3NA 1EP1A 1XDJA 3G6MA 1Z41A 2CLLA 3CWOX 3AISA 4FX6M 1KQYA 3WUGA 2GLKA 3SCOA 3AUJA 2FVMA 4RE0A 1Z9AA 4K38A 4GQBA 1FP8A 4DUWA 3AICA 4KEZA 1UH4A 3NR0A 4W93A 2OOGA 2CETA 5GJMA 5C5YA 5HQMA 1CXIA 2E28A 3ARQA 4J3XA 3N3MA 3WH5A 4QSHA 3OG2A 3AYTA 4OUEA 1R87A 5E0CA 3WLTA 1QNQA 1S5VA 4ZOCA 1A5NC 1LZOA 2FKPA 3AXMA 1P0BA 4HU8A 1W9DM 2C19A 2REQB 2BOGX 4ZO7A 3B4UA 4H83A 5I23A 5D09A 3H54A 2WMFA 3EA2A 4HTBA 3QC0A 4UTTA 4P7QA 3GZAA 4NJHA 1L6WA 1B1YA 3GSMA 5C7VA 1EO7A 4MLJA 2GGHA 1TUFA 1AK5A 3QPEA 2CWNA 1A3WA 3R58A 3NOYA 4X22A 8XIAA 4B2DA 1UCWA 3QV9A 1B3XA 1OFOA 2G50A 4Q8UA 5C6MA 3F2CA 3DI1A 4HJFA 3UGVA 2FVLA 1FWHC 3IVTA 2XIBA 3B0PA 3GDLA 7A3HA 3UXAA 1BXBA 4IGSA 5F4SA 4N9BA 6XIAA 3BQ6A 4FR1A 4JKMA 3RMEA 2WSRA 1CWYA 1L6FA 1XSJA 2WLYA 1ITUA 1O95A 3L23A 3ES8A 3D6NA 4ZB2A 3WQ4A 3ITOA 1YPXA 1TPFA 4XQ6A 2ZX8A 4JD4A 1CECA 1PHWA 1KXQA 3A5VA 4OHQA 3W2KA 4GUGA 1A0DA 1SU5A 1V3JA 2OEMA 1MW2A 1JF5A 3E2SA 1MRQA 1TJ0A 3QKEA 1F76A 4O10A 1CI1A 5DN1A 4TVUA 1QI2A 2QCHA 4F3HA 1LQ2A 3IV8A 2CZFA 3N1AA 2QYGA 4LAMA 3KOFA 2IXUA 5EMMA 3TLQA 2PA6A 3ZYZA 3W74A 3WEZA 4KBXA 5HAOA 4O12A 3M64A 4Y7EA 4UTFA 1IYXA 2O7QA 4WY0A 3R2GA 1OY0A 4DRSA 4OTKA 4PA8A 1H5YA 2XVPA 1VBUA 5HR6A 3PBWA 4KFOA 1YEYA 2XIIA 1IEQA 8A3HA 4AD0A 1CPUA 5DELA 4MYXA 1VQTA 2I5IA 4FALA 3H55A 3WCZA 3NL3A 4N4QA 1IGSA 4JTQA 4ZMGA 5KZMA 2VGIA 3R6IA 3A4WA 4AMAA 6ALDA 1PKMA 2I1OA 2ZUSA 1FCUA 3F4CA 1ADOA 1G1YA 4ACYA 2OO0A 1UROA 3LXAA 3MKKA 3L68A 3H2MA 2F6KA 2ZA3A 1LG2A 3BLEA 4JTAA 6REQB 3W75A 5E6YA 1J9YA 4QX4A 2ZA1A 4H9ZA 3NFUA 1UUMA 1K03A 3NO3A 4TTUA 1VYRA 4B3LA 4HK7A 1DPMA 3HJZA 3OLGA 4WR3A 1GORA 3S6TA 3M0HA 3IIXA 2Y61A 4O0KA 4HD5A 1PIIA 4MZYA 4F2TA 1UPMB 4LY4A 3UWQA 1R9ZA 2CLEA 4S3CA 4W89A 4PCSA 1UG6A 4OV4A 5DMNA 5REQB 1UUQA 3OJGA 5FJUA 2FMNA 1TV7A 3E2VA 4G56A 4BEUA 3W1XA 2WZTA 3VINA 1ADSA 1MRAA 3BGGA 4E2BA 2ZX6A 4LU0A 1VGAA 3R12A 3RO8A 1HKIA 4MYAA 2JIEA 1RK6A 5I6SA 3ARWA 2PDFA 3HQOA 3SCVA 4GYKA 4H7VA 1KGWA 2VR4A 5M17A 1P6BA 4I7UA 3K4AA 1MXGA 1UWAA 1QK0A 2DIKA 1QHOA 4XZHA 1XM3A 3P74A 4PB4A 1ZB5A 5HQEA 4BR1A 2VMFA 1E4MM 4JFWA 4W87A 3WQCA 4DYKA 4DNMA 2RGMA 3DH7A 4MFEA 2BWGA 3EOOA 3AMLA 3CWNA 2PBGA 4UMCA 4N9CA 2XVNA 1PIFA 5DEZA 2OYKA 3KWXA 3TC3A 3RF9A 2ACUA 5FACA 3OOQA 3T2PA 3W2MA 3GNXA 3D3FA 3BAYA 1JAKA 3G1HA 1RUSA 4E0CA 2R1PA 5C7HA 3AZTA 1AL7A 1LRNA 4M3PA 5KITA 1WB0A 2E25A 3S9YA 1J0IA 3KDOA 3Q65A 4OQVA 4LANA 3QC3A 3DU0A 3RM9A 3ITXA 4ADUA 1JIBA 1HZYA 3S6OA 4KF1A 4B5UA 4UQBA 1XC4A 3LV5A 5A6TC 2DJLA 4MG4A 4Q4SA 4I5RA 3RX4A 1DL3A 1WO2A 1RBAA 1FOBA 4LNCA 1Y5VA 1JDEA 5EL1A 3EZ4A 1AJ0A 3S4TA 4ZENA 4LS1A 4CQDA 2QPXA 2QQ6A 4UNIA 3TU9A 4KT2A 1ITQA 4TIMA 5LGXA 1XS2A 1QHPA 2ZKMX 1G01A 5HQLA 3MJYA 1F3WA 2HISA 3G3MA 7TIMA 4HGXA 2A6NA 4GNKB 4O52A 3L5LA 2QJGA 2G3JA 3MC5A 4MFDA 4AZIA 1U1HA 3SQSA 3KL0A 3LOTA 4CEUC 3R79A 1LUCA 5U7SA 3FXYA 3P6LA 4ZVJA 3GBDA 3C4UA 4UTWC 1GOOA 1F7BA 4AYGA 5DFAA 3TCSA 2PAJA 1EJXC 1KC7A 4S1FA 2RDTA 2YDSA 4A22A 4NQ1A 1H11A 3HA1A 3OG3A 4PRRA 1M5WA 1XQKA 1DQXA 4FMVA 1ZFJA 3WF4A 5EBAA 2TODA 2R9RA 3C0SA 2PU0A 3EAUA 4FX7A 4P8WA 3AHYA 1XRTA 5JIPA 4B90A 1JPIA 5D02A 2CBIA 4X9YA 3VNKA 4C5YA 2Q3OA 4RJEA 4PEEA 1SW7A 2R1KA 4P8VA 2DDXA 2DH2A 4QBXA 4UWMA 1CTNA 1ESWA 2J25A 1HJUA 1JUEA 4WY0B 1ZBWA 3ZVIA 3B0XA 4IX2A 3O6YX 4GXWA 1KR1A 2HE8A 1WUFA 3LGEA 4W86A 3W1AA 3DGBA 3AMDA 2PDJA 4FLOA 1HIZA 2X2GA 2ZZ2A 4P8UA 2VX6A 3GY1A 2QCFA 3VCCA 3M0KA 4AWUA 4J40A 5IFPA 2QF8A 4S2CA 4YPJA 1BXCA 1J4EA 5F1VA 1VBJA 3TMQA 1X1OA 2HROA 3E38A 2WLZA 2YJQA 3VPLA 4JPGA 2DP3A 4LBSA 2GSJA 3ZWSA 3BVJA 4PEKA 1BKHA 4N7QA 2ZXBA 2PTDA 4KWWA 4GNVA 5BXPA 3HG3A 2DIEA 3A3XA 3KOXA 3KS6A 1UOKA 1TTIA 2J78A 4Z0SA 1Q6GA 3GRIA 4YWIA 1L2QA 4LFYA 2VD8A 1UOZA 1RVGA 4GI9A 5L9FA 3ZZ1A 1K8XA 8TIMA 1W5NA 4W8AA 3ANUA 3BCJA 3UBPC 1IEVA 1XICA 3LERA 3PB2A 2D23A 3P84A 4IPJA 5A5WA 1CGXA 5BXRA 2YZ5A 3UJ2A 3WO8A 3O3RA 1UD5A 1B3WA 4O15A 1HP5A 2XVLA 1TQXA 3AHZA 3HU7A 2PC4A 3N25A 1FWJC 2EG8A 2E6YA 2ZUTA 2ZUNA 2YOCA 4N0RA 1K8CA 3GXFA 3GR8A 4WX2A 2P3ZA 1I4NA 3W9ZA 4QCEA 2QGYA 4NG3A 3AYRA 1EWEA 4ZQOA 1SR0A 3KTSA 1J0YA 4JL2A 1OB0A 2BVTA 1RLCL 3OZMA 4WSHA 1Q6OA 3U8GA 2WWCA 1R3VA 3RNDA 3V7PA 3APGA 1CT5A 3WMSA 3S5ZA 4TR9A 3UZWA 3WK0A 4Z1AA 1VFMA 3AHXA 5CLTA 2WYSA 2DVXA 4R53A 1QO2A 1W2PA 1L9WA 1R3SA 3H24A 5E5CA 3C0QA 1ZCOA 4CQBA 1H5VA 2QULA 1FCVA 2CC0A 3IANA 4CNTA 3PJUA 1M7JA 1EO5A 5BZAA 4PMXA 4PTVA 5HK4A 4XBJA 5IOBA 2XG9A 3PNZA 2WNQA 3ZVHA 3LUTA 1FKXA 1G94A 2XYLA 3VNIA 2WVTA 3N29A 2YGYA 3GTXA 4D6FA 3RLHA 8CGTA 4DLMA 1FCBA 4PB5A 5C71A 1VFUA 2H9AA 3USBA 4CQ8A 4EACA 4IL0A 1A50A 4M6PA 3FEMA 1S5MA 3IUHA 3EYPA 3F5KA 4ATDA 3VNZA 4M0XA 1F2JA 4JEJA 2HRWA 3WDJA 4AQLA 2YLAA 1FDZA 3P5ZA 3W71A 2XVGA 4OE7A 1UH3A 3VIIA 3C2VA 4M51A 4TO8A 4UQDA 3ZO9A 4ALDA 4F66A 2VTFA 4BZYA 3QQ0A 3DZ1A 4WGXA 2HS8A 3VZZA 3LCHA 3S5SA 3M0YA 1CGUA 1D7KA 1KGUA 3L2MA 2Z2AA 4KRUA 3C86A 2ZUMA 4L4MA 2R1NA 1W3TA 3T0CA 2WMKA 1DJNA 1T6MA 3GW0A 4A6GA 4MUPA 1US0A 1WZKA 4A4AA 1EIXA 1EDTA 2QUTA 2YW4A 4IQLA 1LUCB 2OEJA 1TB3A 3NEHA 4M6QA 2Y24A 2PI6A 1BHGA 3OLEA 2F61A 3UG3A 3OBAA 2WHKA 2PRLA 3CV1A 4WDTA 3EKZA 3L65A 1WDPA 3NQ2A 4DO5A 3ECQA 1E71M 3H2CA 4BF7A 1QW9A 1PWMA 4ZBCA 1IQ8A 4MNJA 3GHUA 4JQ1A 4YXGA 3LG3A 3R7MA 5T91A 3DENA 1XSIA 1YE4A 3I7RA 5FIPA 4KMQA 1ONRA 3AOFA 1QO5A 2J27A 4X63A 3WK2A 1JUBA 4PCFA 4IHCA 5HNRA 1A5AA 2QKFA 1Q7ZA 8XIMA 3O6AA 3FNDA 3T2OA 4C1NA 5CKSA 2HZGA 1K9DA 5A2CA 3WNLA 2ONEA 2BV9A 1QWKA 3IJDA 3B0VC 1EFZA 3R11A 5DRCA 3VE9A 1GYLA 3TA9A 4QE5A 2X41A 3UPBA 3S1UA 1MXSA 4MJZA 3WQVA 3I3DA 2QJMA 1OVDA 3KP0A 1XLKA 1UKOA 3PY2A 2F7FA 2ANUA 3V16A 1X6NA 5A8GA 1KM2A 4AD1A 3VNMA 3CMGA 3G1VA 1HKKA 4UTMA 1ZSXA 4HYRA 1ZENA 3SUSA 3QR1A 2J7FA 1XYLA 4UQEA 3K1DA 2GDQA 2X2YA 4WEVX 1XV8A 4NZJA 1JQVA 4GI8A 2PLKA 3ABSA 5HWNA 1S46A 3B8UA 1FHUA 1UR8A 5KZEA 5AHFA 3V1HA 1S5WA 5I06A 4TXEA 5FJRA 1TYGA 2DZSA 4JNZA 4FK9A 4QAWA 3QQWA 2V3DA 1QBAA 4Q8NA 2I14A 4BA0A 2NQ5A 4W9TA 4R5EA 5DO8A 3MSGA 2NUWA 2A7PA 3K1GA 3G1FA 5XIMA 4HSOA 2PGRA 1K9EA 1EKOA 4IP7A 3CC1A 4H6QA 3FXGA 3GXPA 1ONXA 1AQHA 1OC5A 2FB3A 4RXFA 3UWEA 4KEUA 2PWHA 1GQLA 1CBGA 3EWCA 2HPIA 1EXPA 4LVAA 4LVGA 4HNLA 1NWSA 3S5OA 4ZO9A 3V0TA 4HNNA 4WDWA 3G1RA 1IF2A 2X7WA 5FI8A 2QDHA 2NQLA 1ZAHA 3USZA 4TQTA 5FF4A 1HL9A 2WB5A 4JHOA 4U5IA 5D9PA 3E0FA 3SO7A 4JTSA 5HMEA 3N13A 4AZCA 4WGHA 5I2UA 1IXNA 2C71A 3EWDA 3K8LA 5TBOA 2PU1A 3IJ6A 5HDRA 4Y2WA 4YTRA 3SFWA 1VKFA 2A0NA 2J9YA 1V5XA 4NHVA 3IRSA 3T2QA 2NX1A 3NYZA 4JQAA 4GFIA 1FFQA 4I8DA 3HMJG 3U57A 4L7ZA 1JZ5A 2QUVA 3PP7A 3GNRA 2PWFA 2PWDA 2XSAA 3H8AA 3ZVHB 1UW9A 4ZR8A 2EPNA 3GDTA 1XCFA 2FH6A 1LL6A 4UQAA 1QATA 1VLIA 5CEWA 5AECA 1NOWA 5F1UA 4DWSA 1O94A 2H9AB 2WNZA 3LI1A 1ZBVA 1PS9A 4Q4RA 1EWDA 2AL1A 3HV9A 1EIBA 3T0AA 3F5JA 1FCQA 2OT0A 4JIHA 4AW7A 3BMXA 4MF4A 1B3ZA 1TVNA 4CN4A 1Z8AA 2OCZA 4HU3A 3LQGA 2O92A 3KVLA 4LY8A 2E68A 4E38A 4HZMA 2BGSA 2Z1BA 1TKKA 1EJUC 3FHQA 4I7WA 1XYFA 1U5HA 2I9EA 3BSMA 2WHJA 4UFJA 3EWBX 1OFAA 3C0JA 3R4IA 4O1AA 4NJKA 2A85A 2YSWA 4LUTA 3P3BA 2WSKA 3GW3A 4PCPA 3WX7A 4UTHA 3NQDA 6PTDA 2J7EA 1NTHA 3QFEA 2PTYA 3OTRA 5ABEA 1KCLA 3WBWA 1R6WA 2P50A 3GTIA 3NG3A 2XIJA 2YL8A 2ESCA 3NUKA 3EXTA 5A6BA 9XIMA 1W3IA 5G1TA 1JYNA 2W4XA 4DPQA 3L2IA 5E1QA 3TV8A 3CEPA 1TMLA 4US5A 4QS6A 2NV2A 3EX2A 4AZBA 4QDWA 5AZ1A 3STPA 1BYCA 4UIOA 4EPKA 3BQ5A 3SM0A 1X97A 1BQGA 4FNQA 2P88A 3EX3A 2TSYA 3PBYA 4DO7A 1WUEA 3R5EA 1ICSA 2XIMA 5TF0A 1OADA 2GVGA 5C0QA 3HURA 3DG6A 3MZ2A 4KGLA 5LIWX 1NDVA 3FLUA 4DBWA 2PDUA 2OSXA 4X0NA 3EEGA 1NFPA 3W73A 4C1NB 2E7FA 3BPWA 4JX5A 4MUZA 3O6DA 4MB3A 1O5XA 1L6SA 2PDIA 4D6DA 4BWLA 3MU7A 3WBYA 4PBGA 1XYZA 3BJSA 3LCGA 2NXGA 4LT9A 3WDIA 2GDVA 2X1IA 3EB2A 3PBGA 4ZE4A 1CXHA 3EMQA 3G77A 1SZNA 2BXYA 4C7DA 3RYSA 5TNVA 3LD5A 7CGTA 5I0DA 4HMDA 4HNTA 1HP4A 4RV3A 2J8FA 3LZ3A 5H8UA 1XLCA 1XFCA 1PV8A 1G7VA 2EQDA 1RY0A 4J1OA 3PG8A 2VFEA 1JZ8A 2O4QA 3FSTA 1QPKA 3ISIX 3S0CA 4K6AA 4O28A 4J9JA 2Z28A 4GISA 5I77A 1TA3A 5AHMA 2XJ7A 3V3WA 4AD5A 4O11A 4D8AA 4Q33A 2J4GA 4S23A 3V18A 4NL1A 1XIDA 2Y8UA 2G41A 3LRLA 3CK5A 3WUFA 2ZE0A 2AKZA 3N6QA 3AWNA 2WMGA 3LHVA 4V15A 4ONVA 4QAIA 1DWAM 4ML4A 3MUZ1 1TWSA 2HXTA 1EF2A 2D24A 3TYUA 2CW6A 2Y7DA 3BAJA 4WK9A 5H2ZA 2R1MA 1BWKA 2QNEA 1NIUA 4UFIA 1E0UA 1CDGA 4N9DA 1V93A 4D6HA 1NP2A 3KLLA 5EPDA 3S5NA 3UJRA 4GO9A 4I7VA 3F4NA 2V67A 1S39A 1GVOA 4FXRA 1JQXA 3I68A 1TJ1A 2DW7A 4JFSA 3GVGA 1V08A 5B80A 3TJLA 4KCTA 4IJRA 3KZSA 1VZWA 2INFA 2BZNA 1E3ZA 2Z1SA 1J2BA 2BVYA 4WHBA 1I2OA 1FH8A 1Z89A 2HBXA 3E12A 1DXIA 3H2NA 1E0TA 2PF0A 3UYIA 4D72A 5HWJA 1XJBA 2YFNA 4NJIA 3UERA 4AZCB 2V69A 4Q7NA 3W07A 3BURA 4M1RA 4UCGA 5HMFA 2ZC1A 3FYPA 2PP0A 5CJNA 3U4FA 3NSMA 1NARA 3KWSA 1IZJA 4MY8A 3B4YA 1BVWA 2EXOA 3M47A 4EXBA 4O4WA 3WQPA 3GZ3A 4Q7BA 3SCTA 5MKGA 1FBAA 2JQXA 2CLKA 3BC9A 2OWXA 1F8MA 1JCNA 3KRZA 3HG4A 2ASHA 2Y7GA 2EKCA 2QUUA 4C65A 1SJCA 4POCA 5D8ZA 3LPPA 4HHPA 4DWSB 3OVGA 1G67A 3PPFA 2RGLA 2XH2A 4JIRA 2WMJA 3KP1A 3VM5A 5CPQA 1EX5A 4GQRA 3PZGA 3GXDA 3NIYA 3W22A 2VWTA 5EKYA 4ZTYA 5D38A 4NXKA 2I16A 3M5ZA 1FXQA 4E2DA 1MDRA 4JIEA 5FL0A 1UMYA 1JD7A 3SCSA 3PF3A 1OCNA 2IQ0A 3W2UA 3LU2A 2A4AA 3I3BA 1W31A 2BASA 2XH7A 4JTIA 4CD4A 3VE7A 2PD5A 3UWVA 1UWTA 2CLFA 4GGHA 2BHUA 4ZOEA 4P7OA 2Q71A 2PE4A 1HJSA 4H6KA 1OFBA 1SGJA 3VO0A 1FWEC 4LUTB 2ZUWA 1P7TA 2ZVIA 1VYSX 1YXDA 4X60A 1NEYA 5CC6A 4ZOAA 4C6KA 3S42A 2JIWA 2V82A 3W82A 4JTDA 4KQNA 2X0YA 1F07A 3SSJA 1QI5A 4GIYA 2I5QA 4Q8TA 4K36A 1SJDA 2CCRA 1WDDA 2Z27A 2B4GA 1DP0A 1SUXA 5A2BA 1BAGA 2GUUA 1DJQA 4PTMA 1QPNA 4U4MA 5KINA 4Z2GA 1KTCA 5F2LA 1VJIA 2OSWA 4GZ7A 1MNSA 3DKLA 2DSKA 1J93A 5EFDA 1UQZA 4PB3A 3C52A 4LAZA 3MY9A 5HUPA 3S5YA 4PTXA 1KB3A 4L4PA 2ISFA 2YA2A 2IQDA 2E6DA 4LYPA 2CHNA 4M7TA 1IT7A 1OCJA 3SUUA 1OQFA 4LC6A 1A0EA 4Q4KA 1E5JA 1TWDA 3MHUA 2YKKA 1TMHA 4K7VA 2MANA 2JBMA 1QMLA 5G1YA 2XM2A 3T05A 1N2VA 4R3UA 4TOQA 3N2TA 4GYPC 2R24A 1L6YA 4Y8EA 2OKTA 4F4RA 2W62A 1BPLB 1XXXA 1LL7A 4V27A 4AHQA 1TA3B 3RPTA 2VC7A 4JTRA 2WCAA 3UWWA 1S3TC 1IE7C 2GPTA 3TZNA 5M3WA 5A3HA 4GIRA 2XINA 2WJFA 1TE1A 2QIWA 4GYPA 1HKWA 3OU8A 4HVXA 5AHLA 2Z24A 4HZ7A 2J7DA 1UKSA 4RE2A 2E5CA 3B0YA 2Z6IA 1P0NA 3ATZA 1ZNNA 2ZFAA 3QZAA 3IIVA 2Q3RA 1XBYA 2Y88A 3LA4A 1UZHA 4JQ4A 3WBAA 3CHCA 2CBUA 4JTEA 1BKSA 4PMNA 2CITA 3GVVA 2PZ0A 3MZNA 5IXEA 1CXEA 2YCIX 2SFPA 3OZYA 1HO4A 3WQGA 2WC3A 2IQTA 1Q8AA 4QG9A 1QW8A 2XN2A 3BMVA 4REQA 3UF9A 4AC1X 5H8MA 1ICQA 1FDYA 4LUJA 3CM4A 3G18A 4JICA 3GHTA 3OVQA 5DCBA 1C90A 4UTKA 4LALA 4CQAA 5KMYA 5I5RA 1NM9A 5EYWA 5F2MA 2CERA 2J7BA 4UTLA 4JTGA 3NVDA 4J4KA 3BK0A 3UCCA 3WK1A 1UR1A 3NQMA 1LRTA 3ITGA 5IDZA 2BS9A 3P0WA 1PKYA 1ZZMA 1Z44A 4HNUA 3MSDA 2Z7GA 5I3DA 3W3OA 4K39A 1UBSA 2V5BA 2BODX 2J62A 3SIMA 4FIQA 4UFLA 1TR1A 2D2JA 3W6LA 3KOYA 4MHBA 2G3MA 2EPHA 5MKGB 4Z08A 2ISSA 4J3WA 4MWAA 4JNMA 1W5PA 2VM8A 4L9ZA 1DXFA 1DJGA 4M8UA 4JL1A 5E0KA 1MUCA 1MO0A 1M01A 2HXUA 4KIEA 3G1AA 1OABA 3A24A 1DIOA 2XFRA 1H0GA 1DIDA 3L2LA 2EF9A 1XIJA 1RQEA 1ONEA 1V6TA 1KD0A 1GVSA 2WXDM 2YL6A 2ALRA 3UR7A 3NQCA 2GVJA 3C61A 4HA1A 3NPUA 5JBEA 1X96A 4MM1A 4NUWA 1WZAA 3VNDA 1S2AA 1O6IA 5CPSA 4EKJA 4GNJA 1JCYA 2C14A 3CHDA 2DH3A 3MV01 1Q6LA 1W2VA 3TONA 3TJIA 1ZU8A 3ERPA 3AS3A 1P7TB 4ZA0A 1C7SA 4OBRA 2A7RA 1NWRA 5JMUA 1R2SA 4L6HA 3CTTA 2V30A 4PMOA 4L9YA 3FAXA 3ABXA 1WNOA 3JRKA 3GNNA 4MKVA 1XYMA 3BOXA 1G5AA 3LRMA 4C90A 1DHKA 3LCLA 3O9NA 4O14A 3W27A 3EA3A 4QITA 3DHFA 2IMRA 4A8IA 3QY7A 4HMNA 1JZ3A 2OGJA 5G4WA 4L9XA 1EJSC 4HOXA 4IMEA 2D2GA 2FTYA 3W7EA 4C6NA 3WQ6A 1B3VA 4A21A 4IX0A 3TC7A 4NVTA 4ZO8A 1KNWA 1F74A 1GZGA 4LBRA 4AUBA 4W5UA 4U10A 4FXSA 1A5SA 2DSZA 1Y8BA 3T1GA 4AY8A 2I17A 5LZLA 2PWEA 4LYKA 1GEHA 1DJIA 1PZ2A 3LDVA 2ABBA 3AHTA 4C60A 2UY4A 1CX9A 3AS0A 2J6XA 1HF6A 2PDMA 4JYEA 1D9EA 3GG7A 1FA2A 1TPH1 1O4UA 1S2WA 1YTKA 1WE5A 1EF3A 2YL9A 3QQ1A 1FHLA 3KXQA 4AEOA 3WELA 5A95A 3DIPA 1E70M 3KLKA 4RKAA 1TWIA 3A47A 2ZRZA 3RLUA 2XSBA 1TWWA 1GQNA 3IK2A 4A05A 2ICSA 3U48A 4G8TA 1B54A 2X42A 1TV8A 2VFGA 2A6LA 2J77A 3W86A 4NI8A 1XUUA 5K9CA 3TA6A 4XBSA 4AXNA 2RDXA 2DEPA 1CGYA 4LS0A 3F4DA 3OW1A 1XUZA 2G4FA 1ZUAX 4A3UA 1UA3A 3E96A 1EP2A 2ZX7A 3G0UA 3HG5A 3LBMA 3VNJA 5CGMA 3WLOA 3C56A 3LI0A 1V6VA 1PUDA 1GQIA 3NQVA 1YNPA 3BXWA 2WPGA 4LUIA 1ALDA 4EX4A 3EDJA 1Q7MA 3TJXA 1EGZA 1DV7A 4ZQNA 3MTWA 3CUHA 4WD0A 3S46A 1LBMA 3H4XA 4LVBA 4ZODA 1KCZA 1OX4A 1A4LA 1U1UA 4AB4A 4YMZA 4YS1A 4RZBA 3AALA 1VCFA 2EBNA 3BL3A 4REQB 4G2DA 3FYOA 2NVAA 4ASTA 1QNOA 1EUNA 2A21A 3S1VA 5HUOA 3V75A 3GTNA 3THDA 1OK6A 2PRMA 1EGMA 3P14A 3ARZA 3CAKA 3OEXA 4G9PA 1W1TA 1WCGA 1B9BA 1RPXA 3KBWA 1XRFA 1G4PA 4O4VA 3T08A 1EYWA 4HNOA 2QVHA 1HT6A 3TFCA 2GK1A 3TIMA 3URAA 3IACA 3LNPA 1QTWA 1W8SA 4LUSA 1OD8A 4XO7A 2NX9A 2WQDA 3P61A 1QFEA 5CSUA 1CLVA 2CU0A 3GTHA 4XUYA 3UR5A 1BLIA 2CLMA 2ZC8A 2HV5A 2VRQA 2OVLA 1JI1A 3DUGA 1LROA 4H9YA 5FJOA 4MWAB 2GQAA 8RUCA 1IIGA 3EB4A 4YLWA 2V6AA 2WSYA 5CCZA 6XIMA 4IMFA 1B9ZA 2NWRA 3EWWA 2X1UA 3ZQ9A 3WD1A 1PZ1A 1SW3A 5LNWA 1VHCA 3WN6A 2I56A 2QHAA 4CCCA 4EF9A 4F2UA 1S38A 1GJWA 1EC8A 3PVFA 2PD9A 1WAWA 4QLJA 2D0GA 5E0FA 3B04A 5FA5A 2RFGA 1TVPA 3TROA 4B4HA 4LEFA 3UEQA 4X3ZA 4GVGA 1QUMA 1FP9A 3GHRA 1PTAA 2D1ZA 2BY0A 2V5KA 1ZBCA 1XH0A 4FF5A 1U22A 2PUZA 5JUVA 1AW2A 3W24A 1L0PA 4ZQPA 3GS6A 3AMCA 2XGIA 2QS8A 3UJFA 2OWCA 3CV7A 3H4GA 1RV8A 4XD3A 3CQKA 3SBFA 2YLLA 3RCYA 1I2PA 5B7YA 3MDUA 4WXZA 1AQ0A 3ZT7A 4P7NA 4XAGA 1LCOA 2PDHA 5D9MA 4IXXA 2PDNA 2EPKX 2VFFA 3WD3A 1MUMA 2Y85A 3PWGA 3B9EA 2DUXA 3PHAA 2C79A 4MJMA 2FGZA 1TZ7A 3EMZA 3DFYA 2NQJA 2OQLA 4FNPA 3RIKA 4HMCA 3VXGA 1FWWA 1KWGA 1ZCCA 3OVPA 7REQA 5FL1A 1EBGA 2H8ZA 3UXLA 3W1UA 2WOQA 5HNTA 4IUOA 3S47A 4UB9A 1PWLA 4H8VA 2YR1A 1VFSA 4IUGA 1TTPA 1PKLA 2NQHA 4WSKA 1A47A 2YXGA 4MY9A 4WJEA 5JBDA 3AYSA 3DCPA 1I2RA 1XW8A 2VYOA 2V5DA 4OECA 1P1XA 1CZ1A 1W1ZA 4C7GA 4YWSA 1SFTA 2PGFA 2NLYA 1XX1A 4HOZA 1CNVA 1XH1A 3TOYA 4V1XA 2WJEA 5GVJA 3CT7A 2PCQA 1NQ6A 1ZLPA 3L21A 5FF3A 3NSNA 1ZJHA 3KRSA 4N2YA 4B5TA 4CN6A 2EGZA 4PZVA 1BRLA 1VIZA 2PDBA 3RU6A 3E0VA 4B5VA 2GJNA 1C29A 1WQ5A 4U3CA 1KFEA 1UH2A 4QP0A 1JVNA 1NFBA 3MPGA 4CGTA 3HZ3A 3BW4A 2GQ8A 4GX8A 3MP3A 3RAOA 3SY5A 2CYGA 4DJDC 1KLZA 4JXCA 1JDDA 1VENA 4IIDA 3U3HA 1DOSA 3D47A 2J88A 1FHVA 3MT1A 4FAMA 4PRTA 1CXFA 3UR2A 4JN8A 2HVNA 4PUDA 1RALA 1OD0A 1Y5XA 2A1YA 2GOKA 4ZQCA 2D69A 1GVFA 1OX4B 3FSUA 1X1NA 2NLIA 1ME8A 4LF1A 4U2ZA 1B2YA 4JTJA 3UQNA 1HX0A 1QW7A 4G1KA 3T40A 1F6PA 1VPYA 4PR4A 5J5DA 2PGEA 1YNQA 3P60A 1LWIA 2I9UA 5CQ1A 1KGXA 2PCEA 3AXHA 4WLCA 1UP0A 1FDJA 3GYEA 4C1KA 5D05A 4JTLA 4EPBC 3H6OA 1W1IE 1QCWA 1XRSA 2ZRUA 3BDKA 3QMRA 4N6FA 4AWTA 5H8PA 1VEOA 4LS2A 5K9DA 3IIOA 3DDMA 4ZB0A 2VDIA 3L5MA 3QVQA 3CQHA 1GJUA 3K5XA 2DZVA 1BYDA 1WKFA 1EH9A 2GK1B 1U33A 4DEFA 3KDNA 4R88A 1G69A 3REQA 1XSKA 1GG0A 4LUSB 3WQ5A 4D6JA 2OX1A 5XIAA 3Q67A 4XIMA 3Q2DA 3RITA 3WLKX 1GTEA 1ISWA 2W3ZA 3N9SA 1VP5A 4FP1A 3FA4A 3L4XA 3NA8A 3BLKA 3L5AA 1XLAA 4GHRA 4GZJA 1UD8A 3EWXA 1OM0A 1MZRA 5AY7A 3GG1A 3SI9A 3NCOA 1S1RA 2WZIA 2ISDA 4LEQA 3UGRA 2IKIA 3WQDA 2VZVA 2DIJA 2WO5A 2V8ZA 3L4TA 2VP8A 1XYAA 1SFJA 4JOMA 3FJ4A 5J8LA 3QF0A 3UR8A 3VX1A 5ABTA 4GQ0A 1WXYA 1XIGA 3BLFA 3S2JA 2GUBA 4KFPA 1N7KA 1TR9A 4LVFA 3AZSA 4G7FA 3VIPA 1QR7A 4WKHA 3PM6A 1TQJA 3ZJ7A 3L9CA 3VDCA 2XUCA 4LPCA 5FEZA 2IS7A 1AG1O 2YL5A 1EJWC 1X6UA 2ZOXA 1FH7A 4JFVA 3KRUA 3SRHA 1XYCA 2ZTJA 1S3HA 5DMLA 4KCVA 5IRPA 1HO1A 1IXPA 1KW1A 2WNWA 3FCPA 5I09A 1BF2A 1CB2A 3FJ6A 4V1YA 3WH9A 5CZSA 4X2RA 3RO6A 3LCFA 4JKKA 4FA3A 1UWUA 2A79A 3VKKA 2PP1A 1BG9A 3R0DA 4QNEA 1SFLA 3MYPA 3W29A 5J5RA 3T9PA 1OFQA 4JTCA 3PZNA 3IV3A 1RZMA 2RDUA 1QVBA 4B5XA 3MYOA 1RJPA 1WZLA 2XPKA 2ZXDA 4EIVA 4PMVA 2Q6ZA 3CB3A 3QBUA 2IXVA 1IT0A 4I5UA 3WLNA 3R43A 4DUVA 3A23A 2X0HA 1IEXA 3PS7A 1E43A 4C1LA 3P5YA 4NJJA 4RE4A 4QSFA 3VOGA 3A9BA 1J11A 7REQB 1IR1A 1QAPA 3WNNA 4JR5A 2BY1A 3LHWA 2OLSA 4ENLA 3VIKA 1KBLA 3B8WA 3LBOA 1K8ZA 1NF0A 1KM6A 2BOEX 4DLFA 3HB9A 4GCAA 5DANA 4TX8A 2CLPA 3G0SA 4HHLA 4NNBA 3U5YA 3LMZA 3N4FA 4C6FA 2DU2A 3TEVA 3LHYA 5GNXA 2PDGA 4HK5A 1TPC1 1JNDA 4HNCA 2OMAA 2G96A 2WJDA 3N04A 1JYVA 2E4TA 2H3BA 3DG7A 1N8IA 4DI9A 2OU4A 1RP8A 4NX0A 2WHMA 3NPVA 5BCAA 1CLKA 5D04C 2IPGA 1BRLB 1GOWA 1KKRA 4J5NA 4JTUA 1DEDA 3TYBA 3M6DA 3GNOA 1H1NA 2NVDA 3CAVA 5CC5A 3CTLA 4DX3A 5A8OA 1RY8A 5KTLA 4GIEA 5M03A 3UPWA 1AMKA 1KBKA 3NQ6A 2P8CA 1F05A 2DGAA 1JG9A 2DORA 1UYQA 1EOMA 2AGKA 4JCLA 3UESA 2DVUA 3BGAA 3QYQA 3LXCA 3VGDA 2HQAA 4B3ZA 3UWUA 3WLJA 1US2A 1LLWA 3SB0A 1UPPA 4NRRA 4CN1A 4J7RA 4XISA 3QLDA 1V3IA 2O55A 3VD3A 2GZXA 3GDBA 2HVMA 2V2HA 3ES7A 5IHRA 3T4CA 1YTDA 1V03A 1BG4A 4OBSA 1AH4A 3TTOA 3GVRA 1RSCA 2BG5A 1J6PA 2ZZ6A 4K8HA 5E70A 3MS8A 3PFMA 2DZAA 3C6CA 4CCZA 4RPQA 2ZCGA 3ZMRA 4UZSA 3L4VA 3W1RA 1TPB1 5A6JA 3E74A 1ZHAA 3ZLGA 5U4NA 3SEPA 2Y5SA 5KZ6A 4R9XA 1PZ3A 3WLPA 4IPIA 2Y0FA 3PPHA 6ENLA 1XINA 3WEMA 5BNKA 2ODOA 3BV4A 1IEWA 4YIWA 1KRCC 1R30A 2XFWA 4FNSA 3REQB 3OO2A 1BGGA 3OODA 1QT1A 4MZ1A 1SZRA 3W1LA 5C9UA 2OLAA 2X7VA 4B5NA 1K8YA 4J3UA 1O66A 4PULA 3WZ0E 1R5YA 1PJ9A 4B4FA 1W5MA 1OFRA 4Y96A 4ERGA 1E56A 1B4EA 2QCEA 4J2PA 3S1WA 3WNKA 3WNPA 1EB3A 4FSAA 3OZPA 4ZGYA 4F0LA 3W7KA 5T26A 2YZRA 3TW7A 4E4FA 7XIMA 1Y65A 2GYIA 2RDWA 1YLVA 3MUAA 2AGTA 4F79A 1H7WA 1RAKA 1OJXA 4IP4A 3HQNA 1K6AA 3C5QA 4LAKA 4AY1A 2DVTA 4DYEA 2O9OA 3VC6A 3H2FA 3CGTA 2PURA 3KHJA 2AQVA 1UB3A 3CMFA 3WDPP 3GDRA 4EANA 4HZ6A 5D4YA 1IGWA 2TMDA 3HOJA 4QLLA 4CD8A 1V8EA 2Y63A 1DJZA 1CLXA 3WFAA 4FXJA 1XWYA 4RXGA 2CKRA 1NDWA 4V33A 2Y5EA 1SZEA 2A3LA 3WBEA 5IBXA 3HGJA 3E5PA 4O1DA 1EL3A 1YDYA 4MGGA 3FHAA 3M5YA 4S3AA 3VKJA 3CBWA 4OKDA 2OO6A 2NV1A 1EZWA 3TYEA 3ZIZA 3KBSA 3TK7A 3BLOA 3LTPA 1ITXA 1GWJA 4HSNA 3VI2A 4RV8A 2VNCA 3TYDA 4NXSA 1UWQA 3UD6A 3MHGA 3TWAA 4IICA 3PR2A 5KETA 2JFEX 3F7JA 3N9RA 3M4HA 3SCPA 1WPCA 3VVGA 3Q58A 4IISA 3MP4A 2V3GA 3NSXA 4F9DA 4PSPA 4IH3A 3PNUA 3B3DA 1SO3A 1RR2A 1WBHA 2R1LA 1W32A 1WKYA 2GJXA 3EOEA 3UZZA 2QUMA 3BE7A 2QJJA 4NZ3A 1SJAA 3APTA 4PC8A 1WDQA 2QZRA 3AXKA 1XCXA 3W87A 1Z48A 3IS4A 2VOMA 2G3FA 1J0KA 1UJQA 3THAA 2FH8A 3APYA 3EDDA 3QHOA 1HTIA 1GOMA 2A3BA 1ZGDA 5FESA 3DECA 3PZ9A 3THUA 5D37A 4DWDA 1E40A 3G1XA 2PF8A 4MAVA 2UY5A 3ITLA 3HBLA 4JTKA 2Z26A 5EMKA 3S1GA 3JU2A 1EHAA 4GPNA 4PUKA 1OC7A 2CHRA 4DBSA 4UTTC 1J10A 4HPXA 5LKYA 3R13A 3SGUA 1H41A 5HWMA 2FGBA 3FIGA 2E1DA 3RUBL 4GWEA 1H63A 1VFFA 1GZ1A 2UY3A 3KW3A 4Q32A 4Q8VA 4AG0A 2C0HA 2YBVA 4KRZA 3TJ4A 5GNZA 2P53A 3WDRA 4GK8A 4U5KA 4Z2HA 1P4CA 1G9HA 4C6BA 4UR7A 3CQ0A 1P6CA 1F4AA 3WJZA 1YTEA 1R7AA 5JU6A 1SR9A 4DNHA 1XG3A 3UWZA 2TYSA 1T8XA 5AHEA 3SGGA 5BW6A 1POJA 1V0LA 4LXFA 4XX6A 1B57A 4BI7A 3M0IA 3AS1A 1QJWA 1VFTA 4GY7A 3NQAA 3W00A 1CYGA 4GVFA 2WMHA 4LF2A 4WQ6A 3LZ5A 3KBVA 3MCMA 1V6UA 3N14A 3S2MA 3U6WA 3BLPX 3TP4A 3KBJA 4X2PA 4M82A 1E9IA 1WDWA 4AD2A 4HHHA 1C8YA 3ZLHA 4GXPA 1NJJA 2Q8ZA 1TPWA 5FJIA 2VDGA 2DW6A 3XINA 1H7XA 4RL3A 3URQA 1RCXB 1PAMA 1P5BA 3CWHA 3PC0A 3RJYA 4Q8QA 4W8BA 5CPTA 4AX7A 2FDSA 4HU4A 2OJPA 3DBPA 4H00A 1XQLA 3FY1A 1U5JA 1O60A 5BOOA 3LENA 1NELA 1KRMA 4ORIA 2UZ9A 3SQMA 1PB0A 4OV9A 1ZTVA 1XLHA 3NQGA 2JGQA 3WH6A 4JYFA 2V9DA 2Y89A 3KZPA 1XD0A 5DY2A 4J3SA 3DAQA 4Y9OA 5LNUA 1UQYA 1NH6A 1Y0EA 2B31A 1WDSA 3OLDA 3LQLA 2AQWA 2WV8A 4WDXA 1V0NA 3W25A 2BFGA 3KCLA 1GQJA 3LTSA 4HNVA 2NW0A 4C6QA 1V0KA 4NI3A 1NWUA 4PN2A 3BO9A 5JQ9A 3T8LA 1AJZA 4GMEA 1PYMA 3RM4A 4AIBA 1PYFA 4GQGA 3J7HA 2QCMA 4AD3A 3W26A 4AHPA 1R3WA 3VIMA 4L1XA 3TFXA 3PK7A 4KS0A 3EA1A 1TSIA 4GY0A 4PMZA 4ZQMA 3MI2A 4N42A 4DVOA 4QHRA 1K77A 2EG7A 4W5ZA 4O8RA 3RLVA 4BK9A 2JF7A 2V68A 2Z1KA 3TXZA 5JIWA 4HA0A 2ZXAA 1E6QM 2XGBA 1EEPA 4NNAA 3W7MA 3NVTA 3AC0A 4J35A 3MDWA 5HNUA 3O63A 4DJFD 2E40A 3M07A 4M56A 4S3BA 1ISYA 3GAKA 3NOEA 1VBRA 2Z1XA 3B40A 3IVUA 3LCXA 1A0CA 3MQTA 1Q4NX 2QDDA 3AU6A 5TIMA 2YX0A 3DGRA 3KHDA 3RU8X 1XGEA 4ML9A 1QBBA 3IEBA 3QOMA 3TC6A 1BGAA 1RBOB 4D1JA 4IJBA 4WZHA 3NQBA 5DXXA 2WCSA 2EAWA 4NSBA 4XKMA 3W1TA 4L6OA 1E73M 1XDMA 4KWVA 1G7UA 3CASA 3VGHA 2HBVA 2Y8VA 1OT2A 2YCEA 2VFIA 3QXBA 3PJWA 2BY3A 4GI4A 3ABRA 1BFNA 3AIVA 1H2JA 1MQRA 5CLWA 3CS2A 2PWGA 5AFDA 1SYTA 4AZ7A 5FCZA 2BSLA 2QCNA 2Z2BA 3FGCA 3W1PA 3N3TA 1A5CA 4YYFA 2V2DA 4IFRA 4GI6A 4DHGA 1AUSL 1Q65A 5I03A 4W84A 1PTDA 2IPWA 1KXVA 4Q4MA 3R94A 2O9TA 4H6RA 2EKGA 2HMCA 2GJXB 1R38A 3SURA 5CPLA 4HPNA 2FDMA 1EA9C 3FEQA 3WG6A 4PUUA 2WNNA 3GKFA 4O0QA 1QI0A 3RHGA 5D33A 4MOZA 3W4RA 3WLHA 1DHPA 3ITYA 3V36A 3VM7A 4RE3A 2GJRA 4XZLX 3SDOA 4FB7A 4P2VA 3II1A 4GY1A 1JFHA 2V0TA 4HT3A 1LOSA 1UR4A 1UZDA 1K9TA 2YIHA 1F8IA 1M41A 1CENA 3POCA 3ORWA 5A6SA 1WV2A 3VGBA 2W66A 3OZOA 4BF9A 1S1PA 2VZSA 3I3EA 3ANYA 3OQ8A 1E9ZB 2J66A 3CO8A 1ISZA 2C18A 3AIQA 4CU6A 3VA8A 5JBFA 4Z2JA 3UYCA 2E1WA 1HL2A 2Y8KA 2OODA 1M7OA 3WNMA 1P0KA 3BAKA 4M29A 4MWAD 2Q02A 1RD6A 5CZKA 3CIXA 2FZBA 5D32A 4DXXA 1HGYA 4Q8WA 3H2AA 1KBJA 1JL8A 5A6KA 2CXEA 3G22A 1FWCC 4LV4A 2VEIA 3VMOA 3JR2A 1H7PA 4IP5A 3NZQA 1HW6A 4A3YA 3VCNA 1YIXA 1IZCA 3V5OA 3IJ7A 2B0MA 5CBIA 5DBTA 3UJEA 3SUTA 2DQXA 3BGJA 4JS3A 4Z42C 3QGVA 1L8NA 2VFDA 3WF1A 5BU9A 1KFCA 4UR9A 1VCVA 1K7XA 3E2QA 3TN4A 4WDUA 5CAHA 3L4YA 1U5VA 4TMBA 1GVYA 1WP6A 4M6VA 2G5WA 4P8XA 3LGDA 2E5DA 1PX4A 5SWUA 3B97A 4W85A 3PZOA 3NTYA 1NDZA 1K9FA 3ZJ6A 3NZPA 1OX5A 1BVNP 3GHSA 1W54A 4Y9PA 4QFUA 4IJCA 3LK6A 3RX2A 3TNBA 1V3LA 4JFUA 4PUWA 4QJ3B 1K7EA 3LMYA 2P1FA 2VFHA 2VEFA 3MO4A 4DELA 2QJHA 1I8JA 3MSYA 4Y8FA 1N82A 2PDYA 5BMXA 4GUJA 2ALDA 2VELA 2L5HA 4B15A 3PTMA 2VCAA 2UWFA 4LOCA 1FWIC 5IM51 5GPRA 1M68A 4LYRA 2B7NA 4HP5A 3PUGA 4QJ4B 1TTQA 3ITVA 5HXMA 3VNLA 2FHBA 2ZUVA 2EO7A 3GD6A 4IIFA 5FJJA 4YL2A 1VH7A 1EXBA 4PMJA 4FNRA 4MLRA 4XZ9A 4KKXA 3N2BA 3WJXA 9RUBA 3PBVA 2Q01A 3FKKA 3LHZA 2CEQA 1JDCA 2YDRA 2QMJA 2FHFA 1QASA 1VIWA 1XKYA 4MVAA 3DKJA 3OIXA 4CQ9A 3TSMA 3CUZA 2GGEA 2XZ9A 3FAWA 1RA5A 6CGTA 2FYMA 2AL2A 3UT0A 1KLYA 3L12A 2WHLA 3GU9A 4OT7A 1IV8A 3EDKA 3L4UA 2RJHA 3O1NA 5MF5A 3SCRA 3GUWA 4BY3A 2J74A 3SCNA 5K4ZA 1GVQA 3QY8A 4W7WA 3JW7A 4TV6A 4RZ4A 4K37A 2OLHA 4LW7A 3LB0A 3W2NA 1R0MA 3RG6A 1K3UA 1I75A 1F6KA 3NJ3A 5KEZA 2BP1A 2PWUA 2ZRVA 3FJLA 3A9IA 3MV11 3DFOA 1THFD 5G2HA 1TZ9A 7ENLA 1I1XA 3TVAA 2RKXA 1W0MA 3W1NA 4MJ2A 4YTUA 2YDQA 4RCXA 2E09A 4GC4A 3VUPA 3V5FA 1J01A 4RZ5A 1RCOB 5EY5A 5AC6A 3EGJA 4RLIA 4TMCA 1Q5MA 4L65A 3W23A 5AKQA 2DFAA 1BSIA 3POHA 2XN0A 3GDMA 4HPGA 1XH2A 3OBEA 3V0SA 1GJPA 4NIRA 5BU6A 5AYXA 3FGCB 2F6XA 1TV2A 4L64A 1AJ2A 1S2CA 4NAFA 3CQJA 3QOKA 2FFCA 3O05A 4GUFA 4GYFA 2D3LA 3BLDA 4M81A 2WSPA 3ENLA 1GCYA 1K7FA 4XD6A 5HMDA 4PBFA 3TW6A 2ZVRA 1JZ2A 1TV5A 1K1DA 4Q6XA 4AEEA 7ODCA 1M65A 1PPIA 2C1GA 1KCKA 3BG5A 1EPXA 3RLGA 3WENA 2G3NA 5HOSA 2ZRWA 3GB6A 1R46A 4EXAA 2RUSA 4O1EA 4NZFA 3OB8A 4QM1A 1VC4A 1A80A 2BXVA 3TTEA 1UMLA 4JAWA 1DTUA 3DFQA 3MUY1 5AYBA 3T0TA 4NZCA 4XG1A 4FHAA 1V4YA 4H8UA 1XGDA 1M9HA 2PRHA 4IM4A 3ABOA 4FO4A 3DC0A 3VMNA 3G3DA 3B8IA 3CZGA 3NZRA 4MKSA 3AUOA 4QDPA 3CHEA 1OYAA 3GIYA 3GXNA 4CD7A 4HQVA 2ZA2A 3QN3A 1V6WA 3VABA 3OHMB 4K8GA 1R7OA 4MDOA 3BCFA 3F03K 3LXBA 1ISVA 3GNPA 3QKZA 2VEGA 2QUNA 3Q45A 2CLOA 3N18A 3CZJA 2CNCA 4ZXLA 2BGNE 1EQPA 2WZEA 3A6OA 2GDUA 2Y4SA 4OBTA 3E0WA 3TKFA 5H91A 2VURA 4DIAA 4ZZ9A 3CMJA 4IIEA 4ICMA 4R27A 4HPJA 3DEQA 5FAGA 3WIJA 1X7IA 3NGFA 5G2IA 4IG2A 2DZPA 1TJRA 1R3YA 4ACZA 2WPBA 6TAAA 2XM1A 1V51A 1KXHA 1A5OC 1UR0A 3P62A 1Q7QA 3CAQA 4I9TA 2TAAA 5ABFA 3B9NA 4R33A 4X9SA 3W1MA 3O16A 5BRBA 1U83A 2VEPA 4JTHA 4M6UA 2VGGA 4QLKA 4AD4A 4B16A 2BVDA 4XKYA 5BRQA 1TPVA 1JJKA 4GH3A 1F4HA 2VQTA 1W3LA 1AD4A 3ZT6A 1UP3A 3O0FA 3PPGA 3IIZA 3CIVA 1HVQA 1M04A 3L0NA 1SJBA 1OFEA 3H26A 1Q45A 4QE1A 1W5OA 3KL5A 2VRKA 2YA0A 5LIYX 4HZ8A 4H8NA 1D8CA 4P7LA 2X0SA 1LT8A 4IIHA 1EZ2A 5G4HC 2Y7FA 3ZS4A 2GUYA 4IGHA 2V3FA 3QR0A 3CLWA 2FJUB 1ZJAA 3VOJA 5GJPA 2FVKA 3PZIA 3WLIA 3PAJA 2AL2B 1BWLA 3PG9A 2XFYA 4J2MA 3XIMA 1HXJA 3WUEA 2C16A 2FZDA 3QRHA 2VVNA 3SQLA 1ISXA 4MSSA 4HCHA 4ZEPA 1EJ7L 1YXYA 5BWFA 3EEZA 2AAAA 2FPYA 2UBPC 4KCWA 5JVLA 4AHOA 5JXQA 1BVZA 1E6XM 1HN1A 1X98A 4LTSA 3CEUA 3D5HA 2DV0A 5T8GA 3FVDA 4FLRA 1N8FA 4BQ2A 4MKNA 4TX9A 4A8NA 4PFHA 1S2VA 3DOPA 4OOZA 3EX1A 3RPDA 2XTKA 2BGQA 1XRVA 4LQ1A 3AQUA 4MDPA 3QGKC 5MHBA 3R8RA 2WQPA 4Q8MA 3F5LA 3W70A 2P10A 1E4IA 1DJWA 4WCJA 3ME3A 1HKVA 5E6ZA 3RR4A 5J04A 3MBDA 3UWYA 3VZXA 4FR6A 1HL8A 1UD6A 3IJLA 3UZXA 1AMYA 2RHGA 3LCWA 4S3GA 4NAFB 4AVNA 1O5RA 3NDZA 3GXMA 5CSSA 3UA3A 1XIMA 2ABAA 4GBDA 5K9XA 3KVMA 3W7RA 3B9OA 4LH8A 1NU5A 3G1DA 4RDVA 3W7OA 1L8PA 1UKQA 4WXYA 3TN6A 3A64A 4DZAA 2NVCA 5K7JA 2ZDRA 3WFZA 4GFSA 1GHRA 4DWSC 4LB4A 3SW6A 3R0KA 3TSDA 4YCPA 3E3HA 3QGAC 3M0LA 1LLOA 3WKZA 4DXVA 4RW3A 1A4MA 3PBUA 1VFOA 3SY1A 1OWQA 3FFSA 5FF7A 3TTYA 3KM8A 4X61A 1CGWA 1LOQA 2D22A 1YQ2A 3NQFA 1KBIA 1I2NA 2E9LA 3W6YA 2XH4A 2JGYA 3CL7A 4D6IA 3TH6A 5I79A 3VTRA 3A21A 2FPVA 3H12A 3MB9A 3M16A 3ARUA 3S2NA 1ZP3A 3AXXA 2HNEA 4QJ1A 2OX4A 2ZZ1A 4GYJA 2B7QA 3M0ZA 4J28A 4GX9A 3EWYA 3Q37A 1B30A 3TOPA 4L1WA 4XD4A 2FJKA 4IPNB 4A8LA 2IPFA 3KVKA 1T7LA 2H3DA 3UCQA 3I6TA 1EDGA 3B8TA 3S2CA 2WJZA 3W53A 4IG2B 4J3TA 1VEPA 2FZNA 3E5BA 1LT7A 2B81A 5HMSA 2ZYFA 3VOIA 4YHEA 1OG0A 2CIPA 4ACZB 1M3UA 4LSBA 1JCTA 4UMAA 4AH7A 2PDKA 3CJPA 4FZIA 4LB3A 3CYJA 4ROPA 1BD0A 4ZB5A 2XWEA 4YCOA 3FJNA 5ABFB 1NOFA 4QXIA 1F5ZA 1HJVA 1T0OA 1R2RA 4Z17A 5I24A 4BQ4A 1C93A 5I3GA 3NGJA 3MUCA 3DFSA 2OZ8A 2W67A 4XAFA 3UCDA 4XKYB 1F6YA 3OBKA 1GPFA 4QEHA 2QV4A 2ATSA 1M1BA 4I9MA 3INPA 1Z7AA 1UIOA 4BWLC 2D73A 1UR2A 3FDKA 2DY3A 3CZKA 3MUIA 3ZJKA 1WOAA 3F2DA 1GQKA 3TZFA 1JCMP 3T78A 5DBUA 3GFZA 1KWKA 3SGZA 5LNSA 5DY3A 1EBHA 2VXNA 3MVTA 1E1FA 2PLJA 4DQWA 2F9RA 3UZYA 5AYZA 1GNXA 4GBUA 4QQ3A 1ZAIA 4E8GA 1DKWA 1Y7VA 4JQ2A 4KEMA 3ZR4A 3ARVA 4DM1A 3IGUA 3UY8A 3BMWA 3MWAA 2V5LA 3WLRA 1BQCA 1ENUA 3IJIA 5EGRA 3VUSA 3W72A 3O0KA 5C8BB 3HGRA 5DMMA 3DERA 1XLJA 3VFLA 3U0HA 2VRJA 2Z0IA 3FVMA 3VAVA 4DY1A 1UR9A 3KOZA 2VZOA 3ONCA 3B9AA 3U2CA 4K1WA 4AVFA 1D7FA 1W91A 4IFOA 3SUVA 2JALA 4RDYA 2NWSA 1UD4A 2PDPA 1MW3A 3HPAA 4HCLA 5CG0A 4IPPA 1UUOA 1JD9A 1DJXA 3SY8A 4JN6A 4D71A 3T55A 1WDRA 5EB8A 4IIGA 1HGWA 2I57A 2W61A 2BNJA 3WMCA 1LJYA 2OTDA 3TAKA 4E4PA 5DMYA 4C6EA 2PDWA 1WOBA 2CZVA 4GRSA 3LRKA 2PP3A 2ZDSA 3NDYA 4WVXA 2YBUA 5D30A 4Y9MA 1MUWA 1XBXA 4HB7A 4QGCA 4NRSA 3M0JA 1F9CA 4IPLA 1OCQA 5C9ZA 1AD1A 3LPFA 3WJSA 1J0ZA 3WL0A 2YCKX 4DBEA 1C91A 2F2HA 1A3XA 4UTJA 1NSJA 5DCEA 4QRNA 3V4BA 2AKMA 2FB2A 5TD4A 1EPVA 5C70A 1F61A 3OYZA 4IGNA 3GFYA 4DB7A 4A29A 2WM1A 3PWAA 1FY6A 4CD5A 1JGMA 2OOFA 4C6OA 1H09A 5GQBA 5IDIA 1A49A 4G7EA 2H6RA 4WKAA 3WLMA 1UA7A 3ANVA 4AYSA