1XGDA

Apo r268a human aldose reductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPEAIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title The structure of Apo R268A human aldose reductase: Hinges and latches that control the kinetic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 98
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1xgdA00
3LQLA 4YU1A 1FRBA 2PDUA 1XF0A 4XZIA 1VBJA 3CAVA 1MI3A 4WRHA 3LENA 1C9WA 3LQGA 5HNUA 2BP1A 3GHUA 1T41A 2HEJA 4JTAA 4JTDA 3R8HA 2P5NA 2FZ9A 3V0SA 4DBWA 4LBRA 3N6QA 4H8NA 2IQDA 2IPFA 2PDIA 2INEA 1AFSA 1PYFA 3FJNA 3P2VA 4WGHA 1YE6A 2HDJA 2PDFA 3UFYA 3UWEA 4IGSA 1JEZA 2R9RA 5HNTA 2DUXA 1X98A 5JH2A 4JQAA 2PEVA 3LN3A 2BGSA 3R6IA 1Z3NA 1HW6A 3ERPA 2J8TA 2R24A 3LNMA 4PRRA 3LEPA 2PD5A 2PDNA 3R8GA 4GACA 2PDJA 4WDXA 3S3GA 3BV7A 3G1RA 4WDWA 2NVDA 1EL3A 2INZA 3DN5A 3R43A 5AZ0A 1Z9AA 4PUUA 1J96A 2PDMA 1X96A 4L1WA 2PDXA 3MC5A 1IEIA 2DV0A 3GHRA 2QXWA 3BUVA 4ICCX 3EB3A 2ACSA 4DBSA 1S2CA 2ACQA 4R9OA 2IPGA 4Q3MA 4LAUA 2C91A 3LD5A 2ACRA 3MB9A 1RY0A 3V0UA 5JH1A 4YS1A 3RX4A 1AH0A 5KETA 5LIUX 1ADSA 1XJBA 1US0A 2A79A 1ZUAX 5LIWX 1IHIA 2F38A 4PRTA 2PDHA 3F7JA 2PDBA 4GA8A 3BURA 1X97A 2HVOA 1MZRA 4JQ2A 2I16A 1GVEA 3CV7A 4QXIA 1YNQA 1EKOA 3EB4A 3N2TA 4JQ3A 2NVCA 3H4GA 4JQ1A 2HE5A 4IJRA 2PDLA 3R58A 1Z8AA 4OTKA 3RX2A 4GCAA 3CAQA 4RPQA 1A80A 3H7UA 2PD9A 2FZ8A 4YVPA 2PF8A 1OG6A 3Q65A 2PDYA 2PZNA 4ASTA 1Q13A 4JIRA 4JTRA 3WBWA 3FX4A 3B3DA 4G5DA 3LBOA 3WBXA 3CV6A 3LZ5A 4GQ0A 4QR6A 1YE4A 1PZ1A 3R94A 5C7HA 1QRQA 4F40A 3H7RA 2IKGA 2PDGA 3R7MA 3BCJA 2HV5A 1Q5MA 4WEVX 4XO6A 4JTQA 2ISFA 4XVDA 3GHTA 2PDPA 3U2CA 3O3RA 3KRBA 4XO7A 1PWLA 3M4HA 1UR3M 3VXGA 5M2FX 4H7CA 3UZWA 3ONCA 2PDCA 4IJCA 1RALA 1K8CA 2DUZA 3UZYA 4MHBA 5AZ1A 1MRQA 3V36A 4FAMA 1R38A 5LIKX 3UZZA 2PFHA 3UZXA 1SM9A 4HBKA 3LZ3A 3M0IA 2ALRA 3GHSA 3CMFA 1AH4A 4WDTA 1PWMA 2IS7A 1S1RA 1LQAA 3QKZA 4I5XA 4LB3A 3ONBA 4AUBA 4JIIX 2PDKA 4LB4A 4JQ4A 1Z89A 3UYIA 5HA7A 4YVVA 2WZTA 2FGBA 3UGRA 2CLPA 3G5EA 4QX4A 4L1XA 1YNPA 2F2KA 2AGTA 2I17A 2IQ0A 3GUGA 1T40A 4QBXA 4Q7BA 4PR4A 2FZDA 2ACUA 1ZQ5A 4YVXA 1S2AA 4XZLX 4GQGA 1HQTA 2IKHA 1AZ2A 3V35A 3C3UA 1VP5A 3RX3A 3V0TA 1PZ0A 4EXBA 1RY8A 3D3FA 2FZBA 1QWKA 3Q67A 2IPWA 4XZHA 5LIYX 4FALA 4FZIA 4GABA 3EAUA 4PMJA 4EXAA 1ZGDA 4XVEA 3CASA 2VDGA 2PDWA 4NKCA 3WCZA 4WDUA 3COTA 1ZSXA 3WG6A 1LWIA 5LIXX 4XZNX 2WZMA 2PDQA 4DBUA 4ZFCA 4PUWA 4XAPA 3UG8A 5DANA 2BGQA 4JIHA 3LUTA 4DZ5A 4GIEA 3O0KA 4XK2A 2IPJA 1M9HA 3NTYA 3T42A 1EXBA 2HVNA 1AZ1A 3WBYA 3UP8A 2IKIA 2FVLA 1S1PA 4LBSA 3DOPA 1EF3A 4FA3A 2IKJA 4HMNA 3M64A 1XGDA 2HE8A 4XZMX 4JTCA 1AH3A 4LAZA
chains in the Genus database with same CATH superfamily
1R7OA 1SVDA 2NT0A 1MI3A 1V0KA 1GK8A 4WRHA 3NSNA 1VLIA 1IR1A 1OM0A 1Y5WA 3MT1A 1KQYA 4LAKA 1N82A 1S2WA 3ARVA 1TTPA 4DQWA 4I9JA 5CAHA 3PM6A 2PTWA 2PGRA 1T5AA 2XH2A 5EB8A 4H8NA 3FKRA 1OC5A 4UIOA 2PODA 1US3A 3UNTA 4PEKA 1FBAA 2NXIA 3H2OA 1AFSA 2DY3A 3O15A 4FR6A 1QK0A 2OMAA 2CZ5A 5K2ZA 3UWEA 4JYEA 3CV2A 2VZVA 3U7BA 5D2VA 2VZTA 3ABQA 5BWAA 2JEQA 1RA0A 5CSRA 3LN3A 4V33A 4KKXA 1RHCA 2A4AA 4JFTA 1E1CA 1XGZA 4PBGA 2C1IA 1E4MM 5A6KA 1LOSA 2VNCA 3UERA 3TDFA 4WUIA 2Q01A 3IVSA 5BXSA 1VFMA 1UQZA 3HBLA 4FX6M 1GOIA 2ZRXA 1YPIA 1ICPA 4WDWA 1PKYA 3PZMA 2INZA 2WW5A 2Z29A 3BSMA 3IJDA 1SYTA 3ZIZA 4JTIA 5F2MA 4M82A 4Y7EA 2NW0A 3K8KA 3MC5A 3W1UA 3O6YX 2QXWA 3WQOA 5K9CA 2KX9A 3MUCA 1J5TA 1EPVA 1N8IA 4GJIA 3O1NA 1OFPA 1NH6A 4O52A 1EF2A 1UIOA 4QDPA 1T7LA 1WKDA 4WOZA 3WELA 5BZAA 3MSRA 3O6CA 2A3EA 1F6KA 3L7RA 1CXFA 5AY7A 2WKGA 1V8EA 3KWXA 2YYTA 3SCUA 3KBMA 3EKLA 1TJ1A 5E5CA 3B9NA 3GDTA 3WJXA 4FNSA 3S1WA 3PVFA 3CUHA 3VNKA 3BURA 3OLIA 2VQUA 1X97A 3P14A 4PYSA 4JQ2A 2I16A 3A64A 2GDQA 2QGYA 1O6IA 4BQ4A 1TA3B 3QGKC 4U5KA 3VGDA 2CESA 1BG4A 1XIDA 3GW3A 4K3ZA 3M0JA 3HB9A 4Q4RA 3GM8A 1GJWA 4W89A 3MVTA 1XPGA 4GBDA 1ADOA 5A6BD 3PZOA 1XD0A 3CT2A 2NWSA 1NFPA 3OVRA 4WY0A 4EKJA 1QFEA 3WLNA 3ARXA 7ODCA 2WWDA 2Z1KA 1R3WA 3IJIA 2DZPA 3LZ5A 5EMKA 1TPB1 2D3LA 4QR6A 3C4UA 4YCOA 3H54A 1LORA 3QZ6A 4C91A 3DG6A 1RP8A 3N2CA 2FIQA 2DT2A 2O7SA 3W7RA 2GUUA 4JNYA 2QJHA 4F3HA 4XVDA 5A6JA 3S2NA 5IXEA 2EAWA 3VI2A 3Q2DA 1GQNA 3ELFA 1YXDA 1Z6KA 4GZJA 2NT1A 5G5IA 3PPFA 2YGYA 4JY8A 3WDRA 2NZLA 4O18A 2XFYA 4TOQA 4Z1DA 4DUOA 1IV8A 1LROA 3WUBA 1IXQA 4MHBA 5A69A 2X7VA 2WYSA 3W23A 4U4MA 4QDMA 1IZKA 4FAMA 4B9YA 2O0TA 2ABBA 2WMFA 1JPHA 3MUY1 4O1BA 2WSKA 3SY8A 4WDTA 1CENA 1KFCA 4Z1CA 3R13A 3TV8A 2PURA 1KQZA 4DB7A 2VZOA 1I8JA 4AUBA 4JIIX 2A3LA 1LRQA 1Z89A 1PZ2A 3HMJG 3P5ZA 4DM2A 3EA3A 4DPPA 3BW3A 1X6NA 2GQ9A 5K9XA 3W2NA 1TPEA 4AU0A 3U9IA 1WUEA 3FYOA 5LNRA 1TTJA 3M7SA 2YOCA 2PS2A 3H12A 2R6OA 3FA5A 2C16A 2V81A 2Y62A 2ZUTA 1KWKA 1UP2A 3MS8A 2OYKA 2Q6ZA 2VR5A 2PCEA 1GG0A 1E73M 2IKHA 4DWSB 4UZUA 1V0NA 1LRTA 3DFHA 3URNA 3RX3A 4QNWA 4TVDA 2Z7KA 1UR9A 3CJPA 4XZHA 3ME3A 4XSLA 2XM2A 1RVGA 1SMDA 1V6YA 2YZRA 1UP3A 4LNCA 4J35A 1F74A 4GLEA 1WXZA 3GB6A 2VCAA 3W73A 1ZU8A 1Y0EA 4IGHA 3XISA 4JIHA 4ZTXA 1PS9A 2VR2A 1ZS2A 1HKJA 5I3FA 5K9DA 2HJPA 2X09A 5JUVA 3S1UA 2FZMA 4XK2A 2A3HA 2OZ3A 2NXHA 1CIUA 1AL7A 2CBUA 1Q2SA 4KRTA 4EF8A 3WSUA 1S1PA 3TIMA 4A3QA 3MU7A 4RDZA 5F7UA 4R53A 2J66A 1MDLA 3MCOA 4O1FA 4XZBA 2IUZA 5CC6A 1M1BA 3VD5A 3SGGA 1QW8A 2BTMA 2EGZA 1R3SA 5KEZA 1LOLA 2E5DA 1AH3A 3PJUA 1TIMA 3KS6A 4OBSA 3KVJA 2WMKA 1CXHA 3M7WA 1VPYA 4UFHA 1U5JA 2UBPC 2XH7A 5D2TA 3DFYA 1LWJA 2WOQA 3AUOA 3EOLA 1PJ9A 2VHLA 5CBBA 2GVYA 5B7YA 2J77A 1DYSA 4BR1A 1OFOA 2C14A 1VS1A 4LWWA 3SEPA 2XSXA 3L0GA 1XLCA 2BVDA 3ZLGA 4AIBA 4XUYA 4IFRA 3ID7A 3ANUA 1PYFA 3OHMB 3AIRA 1H11A 4EPDC 3QC0A 5FA5A 5CPTA 1K03A 1PX8A 3U7VA 2W62A 1NQ6A 4JDBA 5JBFA 4I7UA 2P53A 2HPIA 1XDJA 4IF2A 2Q8ZA 3DYPA 1B3WA 2VC6A 4A21A 2ZTKA 1V02E 2VVSA 2XU2A 3PBVA 4C1NB 1Z3NA 4M19A 3SCVA 4CNTA 4GKTA 2D20A 4GH3A 5EU9A 4E4PA 3FDGA 1IWAA 3BG3A 2Z6IA 5CPQA 4FMVA 3L21A 4WXZA 4J9JA 2B4GA 3VDBA 3RPMA 2HNEA 4E8DA 4F2UA 3GE7A 2NVDA 1UD5A 3MHFA 4XZWA 4AWTA 1W1TA 1WKYA 3BOXA 2DZSA 2RKXA 3EWBX 3S4TA 3TYDA 4PH6A 1KFEA 2WM0A 2AQWA 2W91A 3QSRA 3AWOA 1YHTA 4PA8A 4QE5A 1PTDA 5JH1A 2BXYA 3CUIA 2XSAA 3VKCA 1C91A 2R1PA 2X0YA 2Y8VA 1W91A 2GOKA 1JJKA 3CPUA 1US0A 1JCJA 5D30A 4N9DA 3ARRA 4NI3A 2ZX8A 3GDKA 1SR9A 3CIXA 4GA8A 3UXAA 3RJYA 3VDCA 3A5FA 5L6UA 3BDKA 5CC7A 1QNPA 3NQVA 1MZRA 3IUIA 3QOMA 4ACZB 3GK0A 3LMZA 4FNRA 1GJUA 3PG8A 4HMEA 3G8EA 2FH8A 1V08A 2B7OA 4L6DA 4OUIA 1GVFA 2HTMA 3VE9A 3BGAA 3MUZ1 4RPPA 3RR1A 3GKFA 3Q65A 3ABRA 2G4JA 4GYPA 4GI9A 3EXRA 2AKMA 5F1VA 3GU9A 3G22A 4L4OA 3UJRA 4GQRA 3P6LA 1W54A 4H4IA 4J40A 2QLYA 3NL2A 2J47A 3C2EA 3LMYA 3NVDA 2QPUA 3PBYA 5A6LA 3B40A 1YMYA 3BGGA 1EP3A 2ADAA 3E74A 3LI0A 1PEZA 4UB9A 5C7HA 1VRDA 3VOGA 3DFNA 4JL1A 1UOZA 3LSCA 3PULA 3VTRA 1CXLA 2XFRA 1B57A 3W0KA 4JTQA 2ISFA 4LCSA 2YCJA 1JXJA 3W2KA 3EX4A 2J7DA 4XD6A 3ATZA 3WF3A 4LY8A 1TV4A 3THDA 1Q7ZA 3V1HA 1XIFA 3B8DA 3WLSA 3V7PA 4GVFA 5FKYA 4B5TA 1YX1A 1A0DA 3SCPA 2DFAA 3S9ZA 1WDSA 1HZYA 2G0WA 5A3HA 1KC7A 4QNEA 1RJPA 2QDEA 3FJ6A 3M47A 1QDSA 1HJSA 4JKMA 1FP9A 5HQLA 5CLTA 2B7PA 5A2AA 3UXLA 2AL2B 4Z2KA 3SUVA 4HBKA 3GNPA 3CWNA 4UFMA 1XRFA 5CJ5A 3C56A 3XIMA 2PDKA 4LB4A 4HPHA 3UYIA 1BGAA 2GGGA 4YVVA 5FESA 4S3JA 2NV1A 3MO4A 1UWTA 7CGTA 4X22A 4DO6A 3MQTA 3FCPA 3B0XA 1SFSA 3MV01 4JTUA 4Q8NA 4YYFA 1OCBA 3GG1A 4MWAE 5AVNA 3SSZA 5IFPA 3PBMA 4QBXA 4XZ9A 1ZQ5A 4KCVA 3NZRA 2OU4A 5FF0A 3W84A 4QLKA 2NUYA 5HQEA 4ZQNA 4CNUA 3F5JA 2Z25A 3SIMA 7XIMA 1AZ2A 4B16A 4BZYA 3TC7A 4ZQCA 1BYCA 1C7TA 4M29A 2OQLA 4W85A 3W24A 1BF6A 2DU2A 3H23A 1W3KA 1O5KA 1PCWA 4W5UA 2EHHA 2EQDA 4L1GA 4YPJA 4HSNA 4JX4A 1GVRA 3K1DA 2Q8XA 1X1NA 1J93A 1FXPA 3ISIX 5H1WA 4QP0A 3M0KA 1I0BA 1NJJA 1PHWA 1QO5A 4JEQA 4I5UA 2W9MA 2O9OA 2G5WA 2QYGA 3VM5A 1GZ1A 2Y7DA 5D9OA 4LUSA 4PUWA 2NLYA 3WK1A 2E28A 2CIPA 4LYPA 3V4BA 3JRKA 3LHTA 4XQ6A 5DCEA 4UWMA 3E3HA 3GXMA 3SUUA 3SFKA 1TJRA 4MDPA 4XAGA 4CUCA 2E77A 4GBUA 2QCLA 1JZ4A 3WMBA 1SMAA 3CAWA 1ZALA 3WBYA 4LVAA 1UZHA 1H7PA 4HU8A 2W4XA 5E9AA 2WBGA 4XTDA 5ENLA 3QV6A 3A3HA 1PDZA 1SPQA 3Q45A 4FA3A 2W67A 4HMNA 1GGOA 4MY1A 2FPTA 2I5GA 2PC4A 4E8CA 3B03A 5A6BA 1FHUA 1VFHA 3BAWA 3LQLA 3AYSA 1L8PA 5I03A 4FOUA 1Q6LA 4JIQA 2QCGA 3CK5A 5M5DA 4Z0JA 2C1GA 5M17A 3MMTA 2R91A 1L2UA 2PWUA 3QR3A 1THFD 2OSWA 1E0WA 2OKTA 3HFYA 5BXPA 1FCQA 5I77A 1FWDC 4KFOA 3NQMA 4QHRA 3VOJA 4DBWA 3L4VA 2QUUA 2ZZ5A 4OE7A 2IPFA 1W1PA 3E0FA 1Q63A 4JN6A 1OQFA 3UFYA 4YWIA 3NSXA 3B8UA 5DT5A 5HUOA 3PWIA 3G1SA 3ZLFA 5FEPA 3L4ZA 1S39A 4GISA 1YIXA 3TW6A 4AW7A 3L4YA 2RGLA 2E68A 2XVPA 2W5FA 4NRRA 4MLJA 3TJIA 1ZP4A 1M3UA 2X42A 3DBPA 4RNHA 3S5YA 4HIBA 3LEPA 2WK2A 4W9TA 4GACA 2EG8A 4O17A 1MXGA 4C60A 3OJGA 5LA1A 4R33A 3VFLA 4H9YA 2INFA 1J96A 1P43A 1XUZA 3BLDA 2V8ZA 1D2KA 3KRSA 2OX1A 2ZCGA 3BC9A 4NRSA 1G01A 2WO5A 1XYBA 1R9YA 5AHEA 4C90A 3NDYA 3WLHA 3GAYA 2ACQA 4HHPA 3TMLA 1Z44A 2GJPA 2JF6A 7PTDA 4OGZA 3AYRA 3WQFA 4F48A 4GKLA 4N0RA 2DQXA 5BOFA 4U33A 2EKCA 3DKLA 2YDAA 2BB0A 1JCMP 1CGUA 4PRTA 3CZKA 4DO4A 3SGUA 2Z7GA 4GQQA 5H6HA 1F05A 2GPTA 1UD8A 3EWZA 4ZR8A 1I1XA 1HL9A 1OB0A 1IYXA 5AC7A 2JGQA 3EX2A 3QHNA 1JFHA 3PTQA 2F6UA 4I6KA 2D73A 4CCEA 1OEPA 1W3JA 1VGAA 1BTCA 2YCIX 1CGVA 3SRDA 2QIIA 2V63A 2WZIA 4HNTA 3CAQA 1GHRA 1ZLPA 4RPQA 1S2UA 3M0MA 3UJFA 3N4EA 2PWHA 3MWCA 4UOJA 5A94A 1VIZA 1BEUA 3MJMA 3BGJA 2OEKA 4DYEA 3R4IA 3CQJA 3ARWA 1Z32X 4JTRA 1ZBWA 1ISVA 3IV3A 3UA3A 4NYYA 1FFRA 3QBUA 5LNSA 2OWCA 3B8SA 1PX3A 1H5VA 2PC8A 4RV3A 3A3WA 4HPNA 4KERA 2XPKA 3TAOA 3ALFA 1BRLB 1EGVA 1V7AA 4Z42C 4S3BA 2YJQA 3O9NA 4C5YA 4LF2A 3QSTA 3M4HA 3NPVA 5ABFA 4WZHA 4Y9MA 4UFLA 5AECA 4J3SA 1B3XA 4JBRA 4UQDA 4FS9A 4WF7A 4P8WA 2Z00A 3BQ6A 1HTIA 2JE8A 1PE1A 4FHAA 2VFIA 3GFZA 1E72M 1RJRA 3W75A 1NM9A 3KS5A 4IUGA 3MWAA 1IT0A 1BLIA 1MRQA 2BXZA 3UJSA 2UZ9A 2I5QA 4OUEA 4RZ6A 3ALGA 3WQDA 4GUJA 2W79A 1V0LA 4Q4MA 1T96A 3A24A 1CXKA 2P0OA 7REQB 1WXJA 3WL0A 1XIBA 1OFEA 4IQLA 1GOQA 3W2MA 4LPCA 5FI8A 3WLJA 5I3DA 3KLKA 4GOAA 4DAIA 3RDKA 2BODX 4K8EA 3V5FA 2YL5A 4KGLA 3ARSA 2D22A 2W92A 5C9UA 1AVAA 4FLRA 1XX1A 3WZ0E 2YA0A 4P8XA 3MV11 1EJTC 5BU9A 5CPLA 1OADA 2Y5SA 4LBUA 4IIGA 2FZDA 4ZO7A 2XH4A 1OT1A 3DH7A 3OQEA 3LHYA 5FACA 4JN7A 4MPQA 1TRIA 3VMNA 2AAAA 2CC0A 3OU8A 3S6TA 1TR1A 3EDJA 3VNMA 4NSBA 1MNZA 1MW3A 4DXVA 2WJDA 1ZBCA 3CO4A 4ATWA 5A5WA 4JGDA 3ZFHA 1NELA 2GJLA 2JIEA 3LGGA 3OQ8A 3ENLA 1WA3A 4H8UA 4XVEA 5CG7A 2A7PA 1EEPA 3PAOA 5LIXX 5FJOA 2OB3A 3WH6A 2PDQA 1LBFA 1SZGA 1JF5A 2H9AB 4MLRA 4WXYA 5C9ZA 4GFSA 3T40A 1XLJA 3GG0A 1EOKA 2TAAA 3GDLA 3TKFA 1M7XA 1C92A 3IPWA 4WSKA 4WGXA 5C55A 5CAKA 1L8NA 2IPJA 3PNZA 2DH2A 4I9MA 3W82A 4P7QA 1W9PA 1XBVA 1G9HA 3UWQA 1C3FA 2HVNA 3DYOA 2QJIA 3R10A 4GVGA 1ITUA 1EX5A 1AQ0A 1G7VA 1EP2A 4IPPA 2ATSA 4QJ4B 1VBUA 1MQRA 6REQB 2P3ZA 3DOPA 2NQZA 4GCXA 3ANVA 1H60A 2Y5EA 1HJVA 4DJFC 2PWFA 2WSQA 3JW7A 2V5DA 4LS2A 3TW9A 2IKJA 1PUDA 3AICA 2NSXA 1SO6A 2VR4A 3KDOA 3OGSA 4H9MA 3CMGA 3BAKA 1Q85A 3PWGA 1QPQA 1JQXA 3VIHA 1UBPC 2GQ8A 4MSSA 1E55A 4Q4OA 4RX0A 2CKSA 1J79A 3LENA 1BKSA 4GI4A 2V5CA 3F4VA 2YDSA 5FJUA 1NVMA 3FA4A 1F3WA 1WBJA 3OYZA 2OTDA 4H3DA 3S83A 2ZVIA 2Y2WA 2XYLA 1WUFA 4DVOA 1VHCA 3M6DA 3QPEA 3TA9A 4D8ZA 2IQDA 1H7XA 4QS5A 4JICA 5MHBA 4K39A 1HJXA 4JTKA 4LRSA 4XUGA 1LUCB 1DXIA 3TJLA 5CGTA 1X98A 1V4YA 4TUFA 3BLPX 2WC4A 3S6OA 4UTTA 2Y61A 1VYPX 4RNJA 3Q58A 4FNQA 2ANUA 2DH3A 4HMCA 3KFTA 2FTYA 4H2CA 4XBJA 2GUBA 2XIIA 3WENA 4NASA 4A22A 3NNTA 1LL7A 2PU0A 2HWGA 3KP0A 1TZ7A 1SJBA 2UWFA 5JVLA 3R8GA 5D4YA 3MW7A 3G1DA 1NWRA 3ZR4A 3BV7A 2GL5A 1AJZA 5D9NA 2CXEA 4ZE5A 1W3IA 1VEOA 1XG4A 5AHMA 4YMZA 5TAOA 5DEZA 4BI7A 1KLYA 5KZMA 1E9LA 3AXHA 2V3FA 2JQXA 3WO8A 1IGWA 4JFSA 4GG9A 2AOSA 1A5BA 4QG9A 4IQDA 3F4NA 4HNNA 4KMQA 4PMOA 2FPYA 2OZ0A 5BCAA 1PIGA 4E5TA 1XIEA 1NF7A 4W7VA 3M5XA 1JGMA 3W7HA 4AZCB 6PTDA 3SO7A 1TCDA 2QW5A 2PAJA 1ZUAX 2VOTA 4AY7A 4AZ5A 1IHIA 4TVCA 1GORA 2IW0A 1V51A 3AMDA 3FJ4A 5AYYA 4X9SA 2X2YA 2HS6A 1B4EA 3NDOA 3I4EA 3OLGA 3GAKA 4IMGA 2QGHA 4DIAA 3S1XA 1DJGA 1H63A 1UB3A 2QV4A 3B97A 3UU0A 4Q4SA 1FCVA 4X9YA 4JN8A 1A53A 1JFXA 3N2TA 5G1MA 1BTMA 3H4GA 2DZUA 3QN3A 5G2WA 1Z8AA 3SY1A 1MZHA 3TR9A 4GMEA 3TQ0A 3FXYA 3MHGA 4ZO6A 1TV7A 4YL2A 5B7ZA 3LPGA 3H2EA 3STEA 3RIKA 4OWGA 3OHIA 4O1EA 2DSUA 3FY1A 2GSHA 1S5MA 3U5UA 3W6MA 4U2ZA 1BFNA 9XIAA 3PUOA 3NAVA 1UC5A 3BICA 3WF1A 4O1CA 1CWYA 2J6XA 4HHMA 2OGYA 3LTSA 3PUEA 2FTPA 2VURA 4Z1AA 4WKAA 4L9YA 4L6HA 2HV5A 4NL1A 4WCJA 1KBJA 3G3DA 3S42A 5AC5A 2X16A 3GC5A 1E4IA 5CKSA 5FAJA 2ZZ4A 3IJLA 1U5VA 1GQIA 4BCEA 2V68A 2WAGA 4LQ1A 4E38A 1XQLA 1CXEA 4LGXA 1GPFA 4NILA 3TN4A 4TMCA 3T2QA 4Q33A 5FEXA 2P1FA 1VQTA 3GVVA 4J5NA 2OELA 2FTWA 4NP7A 3VDHA 4PMXA 4YJ5A 3NO3A 4GXPA 5IDZA 2QAFA 3PBUA 4DJED 2JF7A 1TWWA 1VFSA 5CPMA 2QJMA 4WX2A 5EGRA 3RO6A 3QQ0A 3NFUA 1K9TA 2ZX6A 3ZJ7A 3E49A 1XSKA 1YNPA 2F2KA 1OX6A 2AGTA 3PAJA 3QRHA 1KKOA 2E0PA 3QF0A 2XIOA 4EPEC 4OFCA 3C0SA 4Q8OA 1FKXA 3UQNA 2C71A 2QVHA 4GD0A 3RG6A 4E4UA 4PL2A 1QBAA 4KPLA 3LCLA 3C0JA 4PUMA 4AHPA 1MW0A 1RBOB 4ADSA 1ONRA 3I7SA 3MTWA 1E1FA 4C6EA 5AYXA 4Y2WA 2PBOA 3V18A 1ODZA 2FZBA 4GUHA 2BHZA 1FCBA 1B30A 2CZDA 4DWSA 4QSFA 4RE2A 1MMFA 3OVPA 3SRKA 5A8MA 2MUCA 4RNIA 3OVGA 1J0ZA 1Z42A 5CZ0A 4D6HA 1DOSA 4MF4A 4O19A 4R3UA 2PDWA 3W81A 2VOMA 5G4WA 2Q02A 4Q8MA 4QJ3B 4D6GA 4N6EA 4DAFA 1TR9A 3M0LA 2BGQA 4PTWA 3SADA 2ZZ2A 3CMJA 3QGAC 3AIBA 4US5D 1PBGA 4CD6A 2CPUA 2WVSA 3W6LA 3T42A 4XIMA 4Y90A 3CHDA 1E6PA 1HIZA 3VU2A 2FPVA 2VVNA 2J7GA 5A6TC 1BVZA 4GY7A 1DIKA 2FKPA 4G7FA 1LT7A 3ANYA 3AXXA 4JTJA 4ACYA 3UJEA 1I2RA 3FAWA 4D72A 1MWOA 4QJ1A 3E12A 1UD4A 1EDQA 2P3EA 4JIEA 2RJGA 2Y63A 2CLFA 3ZVHB 2YL6A 2F9RA 5A1AA 4DJDA 4YU1A 1KTCA 2O56A 5HNNA 2VGIA 4ZFMA 3VKKA 4O11A 5IDIA 1X7FA 3LQGA 4L6OA 4B5SA 3ITXA 4HGXA 1L6SA 3N18A 3KXQA 3F2BA 4BK9A 3NDZA 5I6SA 1XQKA 3N2BA 5CSSA 1JPIA 4GE8A 4JTDA 1HN1A 2ISWA 3DEQA 1CDGA 3LU2A 1UP0A 3FOKA 2AAMA 3W76A 2PDIA 4PSPA 1IEXA 1A47A 1J18A 2J24A 4U10A 3P2VA 3WLTA 5FCZA 1JYXA 4WY0B 4JD4A 4X0VA 3BQ5A 5LGZA 3WF4A 2W3ZA 5AHFA 2JBMA 2E9MA 2VZUA 1BXBA 4AVFA 4TO8A 1H61A 5ABTA 4PB5A 3GIYA 1XL9A 3ERPA 4L7ZA 3NYZA 4S39A 3H2MA 4BY3A 5HK4A 1EJWC 2CU0A 4YNGA 2ALDA 3SECA 3OLEA 1HKKA 1JG9A 2OLSA 4LRTA 3H21A 4KETA 3SRHA 1UUQA 1K1DA 4X60A 1BPLB 3M5ZA 4HTBA 4D1JA 3TN5A 3RLGA 1WXYA 2GJRA 2YBVA 3L4TA 3BUVA 3EB3A 5B80A 2DZAA 3GBEA 2O9TA 2ZA2A 4J3TA 1XIHA 3DAQA 4WK9A 2J4GA 2C1HA 4B5VA 3LBCA 1L6YA 1H49A 1R46A 2OG9A 2QCMA 1XJBA 4LUTB 1C29A 1LDCA 5LHEA 2Y6ZA 4JNMA 1ZP3A 2YL8A 3C8NA 4ZBCA 4JZ5A 3S5OA 5BMWA 4PCFA 4KRUA 2AMGA 2FVKA 2PWDA 4UR8A 1SGJA 4ZB5A 1GUVA 2QCCA 3WEMA 1DJHA 1H7OA 4IOTA 4ZENA 3DG3A 2VM8A 2UV8G 2WBKA 2V38A 1XBZA 4BJHA 3R58A 3RX2A 4PMZA 4ACZA 1A80A 3TSMA 4WHBA 3MMUA 3JU2A 1ZJAA 3VGGA 3B05A 2WM1A 3T81A 3LOTA 1XRTA 5GJPA 1W0MA 4JIRA 4M1RA 2YYUA 4FX8A 3N04A 1CNVA 1DHPA 1YQ2A 3PSWA 1HL2A 4GYPC 4JAWA 1JDAA 3CV6A 5REQB 1JQVA 2HISA 4PMQA 3GG7A 2XM1A 5EY5A 1MUMA 2P76A 4LX4A 2ZZ3A 4W87A 3W1MA 4AZGA 3LB0A 3EOEA 2XGIA 3CQHA 2C79A 3MUAA 3U6WA 3CH9A 5C9XA 4NIRA 1PDYA 4KWOA 4US6A 3GVRA 2CKRA 3IJ7A 2DSWA 3QC3A 4MJ2A 3FS2A 1QOQA 1BGGA 3SGZA 3UZWA 2F84A 4U3AA 3FV9A 3WNOA 3R0UA 2VL4A 2WMHA 3GC2A 5FL1A 3TP4A 1E4LA 3F2CA 1R30A 2E09A 2DORA 4G8TA 3TWBA 4NXKA 3T44A 1RQEA 3UPWA 4FIQA 1IEVA 2Z1BA 1R87A 4PODA 5ABHA 2AL2A 1QI2A 3ICJA 1Z7AA 1ISWA 1X8CA 5CCZA 2R94A 1VBHA 1JZ2A 1JDEA 1V3LA 1E43A 3AIEA 3AJ7A 1V5XA 2IXUA 3GXPA 1KFBA 2IQ0A 1CXIA 7ENLA 3CTLA 4QRNA 2OQYA 1DWJM 1GQKA 1K4HA 2JKPA 2QPSA 4H8VA 1O12A 4FLQA 2VGBA 3VZYA 5D2XA 1EBHA 4YTRA 4P61A 4O16A 5DXXA 1O5XA 3EA1A 2E5CA 3AHYA 4RNFA 4GJ1A 3A5VA 2VI0A 4C6IA 1EHAA 3F4WA 3VE7A 1XCFA 3L0KA 2VDGA 1VAHA 3LY0A 2G3MA 3COTA 1EC7A 4DPQA 3T78A 1XM3A 4HZ7A 3RU8X 2OODA 5GNYA 3O2LA 2EG6A 4XAPA 3V1PA 3CL7A 2CZVA 4NZ1A 3RF9A 3G0SA 4HYWA 2UY4A 4Y9AA 4QCEA 3HV8A 3UCQA 3MMDA 3NTYA 4ZE4A 1F8MA 3CLWA 3E38A 1UASA 4MNKA 5I2UA 1EXBA 3VKBA 3GXIA 4B5XA 4AIOA 3CBWA 5HXMA 1Q4NX 2ZA3A 3MP5A 4QG8A 4PUNA 4CD5A 1E4NA 1FTXA 3M43A 4B4HA 1IEQA 3AROA 1JVNA 2PTDA 4DLFA 3NURA 1S2VA 1JPKA 4TVUA 4QE1A 2GVLA 1U83A 4AG0A 3OB8A 1H0IA 3W2JA 1WZAA 4KF1A 1W8GA 3W2LA 5AB3A 4IL2A 3HGOA 3QMSA 3KBJA 4GFIA 5HULA 4HYRA 3T9PA 1Q6RA 1OGBA 5AHNA 3POHA 3ARYA 1EDTA 4KT2A 1S5WA 4KQNA 2PTZA 3CUFA 3VGFA 2P5NA 5CBIA 3OG3A 3GO2A 2PP3A 4QG6A 3GD6A 3UR5A 3AIQA 3PZNA 4U31A 1ZAJA 1Q6QA 1SW7A 5CPNA 3SCRA 4IPJA 3M0VA 3P8IA 1O5RA 3TLQA 1VLWA 3VNLA 2NX1A 1EA0A 1V3JA 4F0SA 1FWTA 3TSBA 2VX6A 9CGTA 3RM4A 3W85A 4QGCA 3GNRA 1KTNA 5CSYA 1YLVA 4DXXA 2R1MA 2YX0A 3C2FA 2BGSA 3SCTA 3N9KA 3OBEA 3TUUA 2V6AA 1XCWA 4JOMA 2NVAA 1HF6A 2C6QA 2BG5A 1DP0A 2PDNA 1W2VA 3EX6A 2NXGA 3CIVA 1HXJA 4AWUA 1GYNA 1KB3A 4DJEA 1O94A 3L4XA 3VOHA 2XSBA 4LYRA 4R9XA 1HJUA 3PFRA 3WD3A 2EEXA 4FEZA 1W1VA 1QXLA 3R43A 1Z9AA 5AZ0A 3W1TA 3WH8A 4B90A 3QHOA 4UR7A 4LVGA 1FH9A 4PN2A 2XN0A 5D33A 1VEMA 3H2AA 2PDXA 1IEIA 3OPSA 3PJWA 4M6QA 1UC4A 3RLUA 2Y1HA 4ICCX 4GC3A 2ZQ0A 4UCFA 3RR4A 5A2BA 5AC6A 4UTKA 2ZDRA 4NX5A 3TFXA 3U0HA 1R3TA 3LXBA 4AF0B 4AMCA 4PRWA 3GRIA 2C91A 4BF7A 3EKZA 3W3OA 3PY2A 4IX2A 1ODUA 2B81A 3SM0A 3FJLA 3WQWA 1MDRA 1LL6A 2C15A 3EWCA 5IM51 2FYMA 3VIOA 4IPLA 4KIRA 3KOXA 2ZE3A 2PRHA 2R82A 4C6KA 3ZR6A 3FLUA 1QW7A 2PP0A 3AOFA 3QW3A 3S2CA 5AC4A 2J7EA 3KBWA 4MY9A 1SFJA 3P62A 3PJTA 1F5ZA 2VD8A 3W7NA 5BU6A 3B8VA 3GC4A 1DWAM 3USBA 1EKOA 1XICA 1ICQA 4AD2A 3CS2A 3ZR5A 4E2OA 1P6WA 3T4CA 3H7UA 3WMSA 3QMTA 3FGCB 1ZL1A 3RM9A 4EP8C 2PF8A 4O1AA 2ZX7A 1J0KA 1W9VA 4FNUA 4KFNA 4A6GA 3FX4A 3TK7A 3VGBA 3LBOA 3VCCA 2R1KA 4P5UA 2OGJA 1HO1A 6XIAA 1JRBA 3IJQA 4IGNA 1WE5A 1P7TB 3CL6A 1X1ZA 2UY5A 4LUSB 4M0XA 3UWYA 3IIPA 3P61A 4B2DD 3ZWSA 1Q6OA 1J0YA 1W37A 1Q5MA 2WSPA 1S3HA 4YTQA 3QXBA 1E6XM 1MQQA 1ZJBA 4EX4A 1A0EA 1GONA 1BRLA 1V0MA 3WJZA 4LC8A 4FO4A 3K8MA 1UA7A 1JZ7A 1FUYA 1CX9A 2HQAA 3W53A 4LTSA 1UKSA 4AX7A 3WX7A 3BV4A 1V3HA 2OVLA 2B7QA 4KESA 3WFAA 3MSDA 5C2XA 1H2JA 4FSAA 4MIMA 3V5CA 1CT5A 3A9IA 4RK8A 4ZMGA 1JPDX 1QNOA 3TC3A 3L12A 5HINA 5H8UA 2WNNA 4DF2A 3GHSA 5DY2A 1EC9A 1PWMA 1VZWA 2J78A 3AIVA 3HQ1A 3EWXA 4Q7NA 3W74A 3QVQA 1WZMA 4AISA 3KW3A 1EOMA 3TNOA 7REQA 1K70A 5D2YA 3G1AA 3UGRA 5DQPA 2G3FA 4RV8A 4MFEA 4YYCA 3P67A 1ME8A 3RPTA 1XLAA 1C7SA 4ZB0A 4HTYA 1X6LA 3K8LA 2FDMA 1W6TA 3NQGA 2BVWA 4KH2A 4TX9A 4W88A 3OZYA 2QR6A 3FEQA 1SJAA 3STGA 3UVAA 3NEVA 3E2QA 2QAPA 3GDMA 1NARA 3NL6A 3C3UA 1HT6A 2ZRUA 4A29A 5TNVA 1TJ2A 2B7NA 4K6AA 4MNLA 1DQXA 1OD0A 1EJRC 2IPWA 3VD4A 2VFEA 3SUTA 3WEOA 1JCXA 1G4EA 1F76A 3G0UA 4W7WA 2D69A 4KCWA 2P50A 3HGSA 5I23A 4GABA 4L56A 4ML9A 1ZGDA 4CQDA 3WQCA 3UJ2A 4RDWA 3CB8A 3A47A 1UD3A 4ADUA 5A8QA 1XD1A 3TROA 1V3KA 2NV9A 4O8RA 4AZBA 1YDVA 1AJ0A 3C61A 3R11A 3T8LA 3LM7A 4FLOA 1K8XA 4C7FA 3MY9A 1Z69A 3AHXA 3MYOA 3S5NA 1J6OA 3EOUA 4KCUA 1LYXA 3QLDA 2OPJA 1A3HA 5AOUA 1H1NA 4WOQA 4BF9A 3GH4A 2IKIA 4YLWA 1V6WA 1BYAA 2YR1A 1XINA 3EWDA 3B8WA 1EF3A 2W6RA 4LVDA 5BXTA 2TYSA 3LM3A 4HVXA 1MO0A 4GVIA 1GWJA 3CC1A 1UCWA 4W7UA 2XVKA 6REQA 2WZHA 4H04A 4NJIA 4LAZA 3DYMA 4DXKA 1QWGA 2Y5JA 1JI2A 4KEMA 1VENA 3NL5A 1WNOA 1AUSL 1OFDA 3TVAA 1T99A 4XAZA 1WCGA 2OT1A 4ZZ9A 1POJA 2X8RA 1J11A 2ZXBA 3VC5A 2X05A 4IMCA 1UKTA 3UR2A 3HQOA 3V0SA 4LBRA 4D6FA 1GQJA 5CG0A 2KZHA 3CZEA 1VFLA 1DHKA 2OX4A 2C18A 1IQ8A 1BQGA 3HJEA 4G7EA 1JEZA 4AD4A 2R9RA 2XZ9A 1NWUA 1UD2A 1JL8A 3FDKA 3IUDA 4ZCWA 3UGVA 5DMMA 1WDDA 4JQAA 3DZ1A 4BF5A 4UOZA 5A6SA 4UNKA 1LUCA 3BLEA 3J7HA 4UTTC 1JD9A 3S2JA 1VJSA 1GT8A 4FOJA 3WLIA 3E2SA 4DNMA 1KGWA 3B9DA 3DFOA 2G41A 3TQVA 2OXNA 3CZJA 5LSMA 3CGTA 5G4EA 1EXPA 4D2JA 1PKNA 1DIEA 4K38A 1C8VA 3VABA 1G4PA 3QZEA 3GYCA 4HMDA 3WLLA 3GHRA 1A4LA 1B0IA 1W5OA 1BWVA 4EWND 4J2MA 4HPJA 1IF2A 1EC8A 4MYXA 2DQWA 3RYSA 2XFFA 2A6NA 1TJPA 5FJPA 2V3DA 5A95A 1MEHA 3LD5A 3G1VA 2R1LA 2WZEA 4HNOA 4ROPA 4O13A 3OEXA 3FKKA 4O14A 3KOZA 4AZCA 1F73A 1WDRA 1I6NA 4AD1A 2J62A 3RITA 3THCA 2CERA 4C6FA 3WUFA 4MVAA 2CYGA 4CQAA 1J10A 1KM0A 3HG3A 4QTGA 3UWVA 1FWSA 3N14A 1NP2A 2YXXA 1H1YA 3GKAA 2FMOA 3B9OA 1S5VA 3A12A 4GZIA 1MQPA 1XFBA 4Q6XA 1HKVA 5J04A 3W7LA 5LXEA 2F6XA 3EB4A 3HQNA 3JZEA 4JQ3A 4IP5A 2PSNA 2E4TA 4ENLA 1RK5A 4HPGA 4AC1X 1UMYA 1N7KA 4TTUA 4GH1A 4A3RA 1GVYA 3ABOA 4ZOCA 3U2EA 3QYQA 1PZ3A 4ATDA 2A85A 2GJXB 3KM8A 5KITA 2CXGA 2PZNA 3H70A 4ASTA 3W1XA 5H8PA 4E2BA 1AD4A 5GNZA 4G5DA 5E70A 2ZUVA 4IIHA 1R85A 1CLVA 3C52A 3EXSA 2HROA 3VGEA 3LGDA 1ISZA 1V93A 2PMQA 1VIWA 3QH2A 3N15A 2B0MA 4FPSA 1OSEA 3WLOA 1A0CA 1EX1A 4FXSA 1XLHA 3WN6A 5DMNA 3R7MA 2A2IA 3UZ5A 3GFXA 4FB7A 4Z0SA 2PDPA 3APYA 2AL1A 3MVIA 5HJYA 3GDRA 4OIFA 1YXCA 1XLFA 3EDKA 4V15A 3E5PA 4GJJA 3UXDA 1XH0A 3APTA 3R5EA 3UA4A 2ZDSA 3GSMA 3N9SA 3IK2A 4D6CA 4HD5A 4L4MA 3K30A 4RR4A 4OECA 3GZAA 2DIEA 2X2GA 3R0KA 5SWUA 4PE8A 2DVTA 1WP6A 3MANA 1XIGA 2E25A 4TV5A 3CTTA 1V7YA 3GTFA 3BTNA 5M1TA 4EF9A 2XJ7A 4MADA 2V3GA 1OHLA 3UZZA 3MUIA 2J27A 9XIMA 3NZGA 3W72A 2PFHA 3TR2A 1SM9A 3SI9A 4LV4A 4ZO8A 4AEOA 2IS7A 3QY7A 3CUJA 3IAPA 1I2NA 3PPCA 1O66A 3GTIA 3MSGA 4JQ4A 5CLWA 3SZ8A 5HA7A 3QM3A 1EYWA 4ICNA 2OOGA 4J1OA 3LS9A 5A8NA 2CLPA 1DVJA 1EHNA 3FNDA 3TYZA 3KVLA 3IIXA 3ZQ9A 4E2DA 4YHGA 5I7GA 3W1NA 3CXOA 4HOXA 3NQ8A 1XWYA 5D38A 1DJNA 3SB0A 4Z1YA 3KL5A 2OCZA 1DJWA 2YIHA 4CVWA 4K68A 2FFIA 1R9ZA 3VNZA 3DI0A 4H7ZA 1LF1A 4H7VA 4CGTA 1H3GA 1EGMA 1NTHA 3W71A 3V0TA 3QR1A 5A8OA 3WQGA 1U30A 1XFCA 1ZNNA 3P0WA 3EMZA 3MSYA 3I68A 1E5JA 4NNAA 7TIMA 1U1HA 3BXWA 3K4WA 1IXNA 1AD1A 2G3IA 1UA3A 1SZEA 3IAQA 3KRUA 2ZE0A 4PBEA 4FNTA 4DWSC 1OFRA 1R0MA 4PB3A 4PMUA 7TAAA 3VNDA 4PCPA 5D37A 2RDXA 3BSGA 3LG3A 3STCA 2VELA 4WDUA 4HCHA 4HJFA 3DIPA 3SN0A 2QJNA 1SSDA 2Y7GA 4NZ4A 2DZVA 3PZ9A 1GEHA 2Y7FA 3UYCA 3LLDA 2VJXA 2Q71A 5EMYA 2XN1A 4WSHA 2BGNE 4LANA 1TB3A 3PK7A 3PS7A 1EBGA 2D0FA 4KS0A 4GZ7A 3WNLA 5E0KA 1BWLA 1H62A 1I2PA 1TE1A 3DFQA 2CLLA 1XI3A 1F8IA 1QW9A 1XLDA 3LCHA 3CNYA 4MUZA 4JTTA 2VKZG 4JXCA 1R5YA 3IK4A 4XKYB 4HKPA 1OFAA 2WHLA 4H19A 4NNCA 5F4WA 2FHCA 3MHUA 1FH8A 4K37A 4AMAA 1GEQA 3Q4DA 3F5KA 3B0YA 2PLJA 5CZJA 3W7IA 1K9DA 2I9EA 5CPOA 1EDGA 1EWEA 1OCJA 4DZHA 1C9WA 1K02A 4DJDC 3ZVHA 2Y8KA 3WYZA 3NUKA 2YKKA 3ZJ6A 3DHFA 2Y89A 1YDYA 4BQ3A 1CI1A 1T41A 3WNPA 3AISA 3SN4A 1FOBA 4S23A 3VX1A 2ESCA 2F7FA 4O28A 3NCOA 2YA1A 2FB2A 2INEA 4GIRA 5GNXA 1B5TA 4S3FA 3NIYA 2QUMA 2PGWA 2HDJA 4N9BA 5I24A 5DX7A 3BPWA 5FSEC 1UPMB 3DUGA 4AZ6A 1XBXA 1NAL1 3ECQA 3DCPA 3VIFA 4L80A 1A4MA 1CECA 6ENLA 3WLRA 1NDVA 3B9AA 1O1HA 4J4KA 1E0XA 2H8XA 2QZRA 4NU7A 3AYTA 2G3JA 5MKGB 1QHZA 3WLPA 1YDOA 2IXVA 1S46A 4J3UA 4CN4A 5HBFA 3TEVA 3ZSSA 1QTWA 4OKDA 3T0TA 1I1WA 4MWAA 3GY1A 4JHMA 4IMDA 3SUSA 3WDIA 3RGTA 1AK5A 2POZA 3LHZA 3AS3A 1W3TA 4OV9A 2OYLA 1NDZA 3O6DA 4AD3A 2ZBTA 2BLEA 1P5BA 4P7RA 5FL0A 2HRWA 3EYPA 2L5HA 3VKAA 3ZXWA 3VC6A 4DUXA 1RK6A 1O60A 3KRZA 3WLMA 4JCMA 3BW4A 4JNZA 2DDXA 4L9ZA 2PDHA 3NSMA 3D6NA 1XR2A 2P0IA 3M5YA 1D8WA 3C8FA 4LAOA 2GWNA 4LUTA 2X1TA 1I75A 1AL8A 2XTKA 1E6QM 3QQ1A 4W4QA 8XIMA 3LBMA 1W5QA 1TV2A 3ZO9A 4R7OA 3NZPA 3VIIA 2YA2A 1G67A 1K9FA 1NP0A 1XCXA 1GHSA 1FWCC 1QVBA 2NVCA 2ZRVA 4JQ1A 4IJRA 3HZ3A 1F3TA 1AJ2A 1UH3A 3OBKA 4XKMA 3W27A 1FWBC 3PC0A 3CT7A 4M24A 3VMOA 1QR7A 1OG6A 3M16A 1KBBA 4O4WA 5HPOA 4WD0A 4WJEA 4XD3A 4EOUA 1EYEA 1IWPA 1W1A1 3TYCA 1WDWA 1OFBA 4J3ZA 2LLEA 4ZGYA 1CGYA 2VQTA 5G2IA 4X61A 3OOQA 4YTSA 3WF2A 1BAGA 4GQ0A 1JCTA 4ADTA 2D3NA 4D1IA 1R2RA 3RLVA 3C5QA 3WJYA 5REQA 2P8CA 3QFWA 5J8LA 3GHTA 3U2CA 2WCAA 5EMJA 2WNWA 1ISXA 5DBTA 1OC7A 5H91A 1K3UA 5TQLA 4ZQOA 3K5XA 5T91A 1E6SM 3N2XA 4ZQRA 1ONXA 1UPPA 4BKNA 1NFBA 2WVUA 3AHVA 5FSDC 3E2VA 4N2YA 4DN1A 3WH9A 1FX6A 3IIZA 4AQLA 5D8ZA 1OD8A 2WHJA 3BWWA 3WQ8A 4TV6A 3KZPA 4IWWA 1XYFA 3GH7A 3G24A 1LG1A 4CD4A 5HR7A 2VO5A 3N2OA 3EWWA 1GTEA 2ON3A 1Y8BA 5CH9A 5IFTA 1O1ZA 3H2CA 3E0VA 1N8WA 2G96A 2EBNA 3OW1A 4CLMA 4Q4PA 3TMQA 4GUIA 2X1IA 1GTHA 5K4ZA 4DJFD 2WHMA 3WD2A 3EX1A 3ITYA 1K8YA 3WBAA 4PR4A 1ICSA 1KO0A 3AMLA 1RCXB 3PZGA 3RLHA 3E02A 3NWRA 4ORIA 3E1F1 4FP1A 4F66A 2CWNA 1YBQB 1GNXA 4UQAA 2EF9A 4IG2A 3TWAA 2WSYA 3HOJA 3RCYA 3RFAA 1EA9C 4F8XA 4ZQPA 1OYBA 2A7RA 4JYFA 4V27A 3LSBA 1DJYA 3QLLA 1XDMA 1EB3A 5E09A 2MANA 3H2NA 3GLCA 1YDNA 3WJSA 3UF9A 3KBVA 4BHYA 5LIYX 5CJMA 1KXHA 3MJYA 2ZC8A 4C6PA 4BEUA 5E0FA 2VZSA 3M6YA 5BRPA 1A49A 1TELA 2ZFAA 2HSAA 4B5NA 4XIAA 1G0CA 1C8QA 3QY6A 3TC6A 3DGBA 1E9YB 1FDZA 3KCJA 1TSIA 3UR7A 4HU3A 4FNPA 4K7YA 3KVKA 3QTPA 3L9CA 3W7PA 2QMKA 5F4SA 4JTLA 4MNJA 3UY8A 4GO9A 1B4KA 1FWFC 2PLCA 5AHLA 1PTAA 4UOQA 1LM1A 3PN8A 1LWHA 2JFEX 1DWFM 3CPGA 3L67A 3M0HA 4UQ9A 2CLOA 1EWDA 4GUGA 1WQ5A 3PZUA 3PZTA 3M64A 3BJFA 4JPGA 4CU8A 4EPKA 3TXVA 4YIWA 3ZJ8A 1FRBA 1XF0A 4WIWA 3AZRA 1FCUA 5L9FA 4JKKA 3WQ6A 1V77A 2DZWA 3W7MA 4PMYA 3G6MA 4PUJA 1W5NA 3IUHA 3RN6A 4YTTA 4QDWA 1DJZA 3PPGA 2HEJA 3NO1A 2WCGA 2RDTA 2D2OA 4R7JA 3SCNA 2EPLX 3KP1A 2ZUMA 4AD0A 1WV2A 2TODA 3AZTA 1OGGA 1JAEA 1WZLA 1DWGM 1OYAA 3VD3A 5JU6A 4Y8FA 1UD6A 2O9PA 3TTYA 1H5YA 2W63A 3VUPA 4A8LA 2A3AA 3CLMA 4DI8A 3NVTA 3LERA 1UWIA 4HZ8A 1FKWA 3RRXA 3C2VA 5F4XA 2YB4A 2A5HA 4P2VA 3SURA 2PEVA 1AQHA 2X41A 2XN2A 1XIJA 1DWHM 1UZ4A 2C0HA 5CZTA 3UWZA 1M65A 2J8TA 4KIEA 2REQA 2R24A 1VFOA 2GGEA 1RPXA 3PUDA 3KLLA 2PD5A 4GYFA 3OBAA 2XFWA 4MB5A 3WLQA 3V16A 4FX7A 3DXIA 4LNYA 1M7JA 4EAYA 4CNSA 4AB4A 4M81A 1NY1A 4MZ1A 3QW4B 2PDMA 1ZJIA 2V2HA 3KTXA 3F2DA 2G50A 1I2QA 4C5ZA 4U28A 3YPIA 3LPPA 3BAJA 1J5SA 4MGGA 1S2CA 4ZL1A 3NPXA 1ENUA 2DJLA 3H4WA 2IPGA 4PFMA 5M03A 4UFJA 5FF3A 1FWGC 2A7NA 1X6UA 2Z1SA 4LU0A 1LT8A 3HV9A 4HCLA 2BSLA 2VEIA 3SR7A 1XKYA 3GVGA 1AH0A 4B5WA 2PCQA 4AF0A 1LP6A 2A79A 3G3MA 2AKZA 5T9BG 3CYJA 5KMYA 3GQYA 2QCFA 5JQ9A 2WLYA 4MAVA 3WIJA 3HG5A 1XH2A 1IWBA 4W86A 5EMMA 2OR2A 3P3BA 2PZ0A 2TRSA 1OZMA 3W25A 3OLDA 4IXHA 4M51A 3CV7A 3H24A 3PWAA 4GPNA 1RR2A 4U3CA 2A21A 2QJJA 2OJPA 1YNYA 3F4CA 4W8AA 2ZWZA 4FXJA 1KCZA 1JIBA 2PD9A 3H7VA 2Z27A 3W00A 5GVJA 4KEZA 3G2GA 3GYEA 4F4RA 1W3LA 1L6GA 5BYWA 3WQEA 1UJPA 1KCKA 5FJIA 1QI4A 4A05A 4PZVA 3PBWA 4OBTA 4UC5A 3KDNA 1DEDA 3FGCA 3N6JA 3NXLA 1ZZMA 4Q8WA 1W1B1 4LCQA 3H4XA 1P4CA 3DENA 3M0XA 1XISA 1FHLA 4GIAA 2PGEA 1TV5A 5CC5A 3SJNA 1QI5A 3AXIA 3QR0A 3EOOA 1P7TA 2ZADA 3D3AA 2VYOA 2XVNA 1WX0A 4W84A 2ATMA 1D7KA 4C1KA 1J8VA 1LZOA 4H7CA 3AIWA 4OQVA 1PB0A 4OOZA 3W22A 1T8XA 3UVIA 4ERGA 3MI2A 2GJNA 5K4XA 3SAZA 3ONCA 2HXTA 1KFJA 1JPMA 2ABAA 4H8HA 1DKWA 5U4NA 1G5AA 1IEWA 2GK1A 4LS0A 5AZ1A 3W1QA 1IXOA 2QUVA 2R1NA 5A8GA 2E40A 1GPWA 2HK1A 3C2YA 4IXXA 5D9PA 3LZ3A 2PU1A 2QJGA 1LBMA 4IGMA 1PIFA 1SU5A 4NJGA 1TE6A 2OT0A 1PHQA 3N13A 3MPGA 5E9XA 3HTWA 4JHZA 1MNSA 4WSJA 2H90A 4HOWA 2YLLA 1JZ3A 5IBXA 4EANA 2YL9A 2WZTA 2FVMA 1RBLA 1FWIC 2WMJA 3NEHA 2CCRA 3AI0A 5E0CA 4QITA 1T0OA 2VGGA 3G6LA 4L1XA 2RJHA 1K8ZA 3G1HA 3L68A 3VA8A 3GUGA 4QEHA 2BHYA 1S5NA 4PTXA 1UG6A 4DZIA 1MXSA 1XIIA 1M6JA 2X1UA 1EO5A 4GQGA 4PUEA 4ZSTA 1HQTA 4JDYA 2CHOA 1CPUA 1XXXA 3L65A 2E3ZA 3RNDA 3KTSA 3CPRA 4R88A 4F2BA 3O07A 1MW1A 1TREA 1BKHA 1EUNA 4XG1A 4J3XA 4NAEA 3FXGA 4YCPA 1C9DA 2Y7EA 1U33A 4QFUA 3EAUA 1U22A 2ZWYA 1DJXA 4R27A 5FD0A 3W83A 4CU7A 3TNBA 4XZNX 3N25A 3BAYA 3ORWA 1VJZA 1GZJA 4Y96A 1LQ0A 3LRKA 3MKKA 1TRDA 4NUWA 3S5SA 3WFLA 1J0HA 2O4QA 4P7OA 2Q8LA 4NZ3A 1QO2A 4KWSA 1PVNA 3UP8A 1H41A 3WL1A 2GZXA 3BO9A 1LG2A 1L9WA 3B4YA 4OV4A 4TX8A 1FQ0A 1TYGA 2VC7A 4LAMA 3QGVA 2OEJA 4PMNA 2WSRA 2C19A 3EPMA 1PIIA 4H83A 1RA5A 4PMDA 3GH5A 3CAKA 1H7WA 1MUWA 1OX4B 3PZQA 2YBUA 3F4DA 4LS1A 4JFUA 1GOOA 3AMCA 3AFBA 1J2BA 1UJQA 1J9YA 1XYAA 1HKMA 4MB3A 1CLXA 3LGEA 1KCLA 3T0BA 2PBGA 3NM3A 2OO6A 4O57A 4MTVA 1VR6A 1DJQA 1ZPTA 4GXMA 4QROA 1RCQA 2JALA 4IMAA 1I45A 3E5BA 3A4JA 4UZSA 3NPUA 3QFEA 3CEPA 4CCDA 4IUOA 2Z2UA 4Y8EA 2FZ9A 4PUDA 4GWEA 3KEHA 3K13A 2W61A 1I4NA 4L4LA 1W2PA 5LYRA 1K7XA 1NDYA 5F2GA 4YTUA 4XISA 3SQSA 4HCDA 1QAPA 2YBTA 1JRCA 1OGSA 1UZDA 1VPXA 3S47A 3VPLA 4QM1A 1OINA 4GNJA 3TTSA 1BD0A 1TX0A 5HUPA 4CNOA 3BOLA 3UXIA 2XIQA 4PL1A 4AZHA 2ZC1A 5KSWA 1Q6GA 2J7HA 1KTBA 3SW6A 3WNNA 4JX5A 3WDJA 4XD5A 4EPBC 3O0FA 1R6WA 1QJWA 3W02A 3GS6A 4ERAA 5XIAA 1KM6A 2FB3A 4JTFA 1ALDA 4I3GA 1SZFA 4H6QA 2NLIA 4A8IA 2PRMA 2EPHA 1IIGA 1MVYA 4ZOAA 4HSOA 2DZTA 4DJFA 4IH3A 4MYAA 3BOFA 4DBSA 4S38A 3DI1A 1OWQA 5KTLA 4UTIA 2H3DA 4R9OA 2VRJA 3SFWA 5A6MA 1HVQA 1KM5A 4JTEA 1JUEA 3K4DA 2GOUA 4EACA 3WDQA 3QV8A 4YS1A 1TV8A 2Z1WA 5I3JA 4YWSA 4BS0A 4FLSA 1RAKA 3RX4A 2AQVA 3P8JA 2PLKA 1CTNA 5A2CA 1TPWA 3R25A 1A50A 1FA2A 2D2JA 1EJXC 1UWRA 2CBIA 5HMFA 1A3WA 3TCSA 3RK8A 2NX9A 1L0PA 4F0RA 1TQXA 4UTFA 3MA8A 5C8BB 1NU5A 2PF0A 3W1RA 3W7DA 4QXIA 1VCFA 3W7KA 1SR0A 5CGQA 5D05A 4GCAA 1M7OA 1K77A 2J25A 3EA2A 5I06A 3R1ZA 4R7WA 3DDMA 4JKLA 4NHVA 4H1ZA 2FGLA 2VC5A 3M41A 5EFDA 3CQ0A 2GSEA 3IGHX 1TPFA 3VD7A 1M53A 4AD5A 2GJXA 4GI8A 3EEGA 4HNUA 1A5KC 5EMLA 2DT0A 4S2BA 1CEOA 4ILSA 3A6OA 2QCEA 1XUUA 3TX9A 4WEVX 3BLFA 3P82A 4O53A 1XIMA 1HKWA 3W88A 3AJXA 4UQEA 1XBYA 1OF6A 1ISYA 2UY2A 3N6HA 2WVVA 1V3MA 1Y5VA 3B06A 3WF0A 2ZZ6A 5CC3A 4EE9A 1AG1O 1K4GA 1RVKA 3TYBA 1JI1A 3BVJA 4O1DA 2I7GA 2TMDA 3RAOA 1QPNA 3NM1A 1CLKA 4LYKA 5BRQA 4A3HA 4AEEA 3MCMA 1XLLA 3CM4A 1XSIA 4PULA 1B31A 3BK0A 1KBKA 3CMFA 2YZ5A 4NYUA 3HJZA 1E6RA 1UHVA 4EVZA 3EWYA 3AS1A 3PTDA 3ZT6A 1FWHC 3HO8A 4FOKA 1BQCA 1NOUA 5BROA 1K7EA 3GR4A 4QX4A 1XYCA 4BQ2A 3N17A 1GCYA 5XINA 5C7VA 1VBRA 3W07A 4TU1A 4G2DA 3A9BA 3BCDA 4ICMA 7A3HA 1G94A 1QNQA 2EG7A 4TTGA 3B0PA 4G7EB 4X2PA 1JCLA 1RLDA 3E6EA 3CZ8A 5C2CA 1CGTA 3GW0A 2ZZ1A 1VD6A 1VP5A 3PANA 3BARA 3LV6A 4HZMA 3BLLA 1F4AA 1P0KA 5CZKA 2YW4A 4X3ZA 3JS3A 2BDQA 1KM1A 3DX5A 4O0ZA 5ABEA 4FZIA 1VYSX 1P6CA 1Q65A 4CCCA 4HA3A 2Z1XA 3OIHA 1ZFJA 2DGAA 3DERA 3U5YA 1YW1A 1IE7C 2E1DA 1DV7A 2Y24A 4G56A 2Z0IA 1TPUA 3CHVA 4AHQA 4J3VA 4DZAA 4DZ5A 4IIBA 1MXDA 3H53A 4ML4A 4I8YA 4A2SA 4E4FA 1M9HA 3K2GA 1E5NA 5F1UA 2NX3A 3N11A 1M01A 4B92A 3L23A 4XAFA 1DJIA 5EPDA 1VJIA 4XD4A 2WKJA 2I9UA 3CUGA 4GHRA 3IIVA 3TXZA 1WOAA 3PP7A 5HANA 5DXYA 1XYZA 1TIWA 2WV8A 1JZ6A 2YLAA 4IIDA 1GVOA 3EPOA 1PO9A 2D2HA 5AFDA 3W7EA 1ZBVA 3I6RA 5FOOA 4DX3A 4TQTA 1QBBA 2WJZA 4XKYA 1QPOA 1US2A 4PSRA 2DUAA 2P8BA 3FVDA 4O4VA 3WUGA 3GNOA 3P0XA 1NIUA 2BWGA 2NWRA 4MG4A 3R8HA 1HX0A 1X8FA 3LCIA 1UROA 4ERIA 5I79A 4WJ8A 4UNIA 2EJAA 1FDYA 3WBEA 2D23A 4A3UA 3ARQA 3TA6A 1SO4A 3CO8A 1AA1B 2EPOA 3LA4A 4LALA 4Q32A 2W66A 4JEJA 5AHIA 4RE4A 4H2HA 3GR7A 4JS3A 1X7IA 3VDAA 1YPFA 1S38A 3LHWA 1WPCA 4DO7A 4REQB 1B54A 3EZ4A 4N9EA 3NOEA 4GZEA 1QPRA 3DFSA 5HJLA 4HOZA 1HJWA 4ZODA 1D7FA 4I9TA 3LNPA 4L9XA 4ALDA 2PDJA 1KW1A 2GDUA 3TZNA 4XV0A 2WQDA 2Z24A 2J74A 3BLKA 1EL3A 3KOYA 4PUUA 4OOUA 3VNIA 4PC8A 4QISA 4CQ8A 2OEMA 2QULA 2OO0A 1DXEA 1W9BM 5MKGA 3ZWTA 1S3TC 2ISDA 1UKOA 2OOFA 2R14A 2O4MA 2ZTJA 3ARPA 3K46A 1KM4A 1W56A 4MWAC 1OG0A 4PMRA 3ATYA 3EEZA 4EK7A 3N19B 1RUSA 4DRSA 4QE4A 3PTMA 1VRXA 2V67A 1C93A 4FXRA 2BNJA 3JUGA 4C6OA 5KETA 3K4AA 3TQPA 1E9ZB 1ADSA 3NQDA 2E6FA 1D8CA 4PTDA 4RL3A 2BY0A 2CLMA 2DEPA 4I9AA 4I90A 2PDBA 3UPMA 4GGHA 2CLIA 4GIYA 3CU2A 3MZ2A 1R7AA 3BZJA 4PTNA 2HVOA 4LH8A 2ZYFA 2VFFA 3LRLA 4UTMA 3O63A 4GC4A 2WB5A 2WJEA 4MJZA 4CEUC 4JYDA 4I8DA 3NQFA 4HNLA 1UR2A 5DY3A 2ISVA 3QMRA 4KW2A 3CYVA 1KFWA 1G4TA 1QK2A 4UMAA 3HQPA 1XV8A 2P88A 5C71A 1EO7A 3GNDA 3AS0A 1Q7QA 4OVXA 1VEPA 4RE0A 2DIJA 3I4KA 4H00A 1Q13A 5LKYA 3UETA 3QTGA 4QEEA 2HPMA 1XKJA 3M0ZA 1XHGA 3KVMA 3TN6A 1Z48A 4CN1A 3T0CA 3R94A 3CZGA 5GPRA 4HK6A 3VNJA 3R12A 4PCSA 1XYLA 2QQ6A 4XSMA 5EA9A 4MFDA 3AHZA 4H01A 3KTCA 2DPEA 4M7SA 4L65A 1TVLA 1OIMA 4C6LA 5I3KA 5I09A 1V6XA 5M2FX 5D9MA 1G69A 2ZUUA 3LCGA 1NSJA 2XIJA 5EYWA 1ZHAA 4AFYA 3NGFA 4PCNA 3FW6A 6TAAA 4AWEA 2ZX5A 5I78A 4Z17A 2DUZA 4S3AA 4NVTA 1JDCA 4NY2A 1GOKA 4JFWA 1WO2A 3C2OA 4NX0A 1Q6DA 1F6PA 1QI0A 4EXQA 3POCA 1R3VA 3UZXA 4E8GA 3OYXA 2FJKA 3PNUA 1AH4A 3LPFA 3WK0A 3RXZA 1EJ7L 2GVJA 3MZNA 1PYMA 1S1RA 3LLFA 4BFAA 3TE9A 1PAMA 4S3DA 2HBXA 1JYVA 6A3HA 3G18A 4CNPA 1F3EA 3AMKA 4LEQA 2Q09A 4DBEA 4DI9A 3O6AA 2H8ZA 3MUXA 4AIEA 4Z1BA 5I3IA 3ITLA 3QKEA 4KCTA 3IS4A 2CLHA 2O92A 3BJSA 4Q8UA 3CQIA 1JDFA 5C9RA 3QQWA 4V1YA 2W0UA 3P60A 4O0KA 4YVXA 4YN5A 4LVFA 3EDEA 1S2AA 3RHGA 3WLKX 1VCVA 3PB0A 1W1YA 5G1TA 3SBFA 1PZ0A 1RY8A 1GKPA 1TVPA 4IHCA 2HS8A 3REQB 1EEXA 1YBQA 1E0UA 3BLIA 4AY8A 5AC8A 4DNHA 4AYSA 2ZUWA 4V2XA 2E1WA 4IFKB 1U1JA 1E56A 2BV9A 1PXGA 4GVHA 2X40A 2H6RA 4F0KA 5IRPA 3UNDA 2IMRA 5FEZA 1WOBA 5EBAA 5TIMA 1SSGA 1RQBA 2YB1A 4ZXOA 1OYCA 3PZVA 4GUFA 2HBVA 4F0MA 2BX7A 1HJQA 1F3XA 3UG8A 1WAUA 4EAMA 2AMXA 1QATA 3UCDA 6TIMA 4MWAB 1RQHA 5D32A 5HJXA 3C86A 1KD0A 4LY4A 3D5HA 4RUBA 4IIFA 4HK7A 1Q6CA 2VDIA 4RW3A 4FK9A 4C6NA 4M6PA 1D9EA 4Y9OA 4QCFA 1L2QA 4S3CA 1C90A 3TOPA 4LXFA 1N8FA 3SCSA 3I7QA 3R8RA 3T8QA 1H4PA 4Z2GA 1L6FA 2X0HA 1UKQA 2VMFA 3GZ3A 3UBPC 2QEZA 1M68A 3F5LA 1X1OA 3O05A 3P81A 5I3HA 5FJTA 1QNRA 2HE8A 1H09A 2XGBA 4H9ZA 1IXPA 3V3WA 2J7CA 3CIWA 2ZICA 3WD1A 2X30A 4Q22A 5DELA 2E5BA 1FFQA 1FWEC 2A6LA 3A3XA 3IARA 3O8AA 4O54A 3TCEA 1W9XA 4TXEA 1P1MA 3IGXA 3W70A 5CEWA 4O10A 4U5IA 1KXTA 3NQAA 3U48A 3W29A 3LLXA 5DMLA 4MY8A 3L0NA 3VIMA 4F2TA 1OFQA 2PDFA 2G4FA 3SCQA 4NF7A 4NJHA 5JH2A 4BWLA 5LA2A 4HK5A 1KA9F 2V2DA 4AXNA 1E3ZA 5A8PA 3P93A 3R6IA 3SUWA 3D0CA 4GGBA 2QCDA 4P7NA 4FF7A 4A2RA 2D1ZA 3IIOA 4HNVA 2OFJA 2E9BA 4NNBA 2WQPA 3N12A 1DWIM 3LHVA 1X38A 3FAXA 4JY9A 2RH9A 2BS9A 3GU1A 3NPWA 2ZA1A 2I56A 1R2SA 1VKFA 3ZOAA 3UG5A 3SY5A 1RV8A 5F2LA 3RO8A 5C54A 3PHAA 2ACSA 1YXYA 1E71M 1AW1A 3ES7A 2DW7A 1G1YA 3ITCA 3THQA 1RPKA 2QUTA 4TX6A 1TPH1 2VFDA 5ABGA 3MB9A 1RY0A 2CZEA 1P0EA 4UTWA 3I3EA 1FXQA 1TUFA 3UEQA 3SQLA 5HMDA 2FHBA 3DC0A 1CGXA 5LIUX 1W5PA 1G6CA 4MUPA 1R86A 1HG3A 3WMLA 2V5BA 2F38A 2JIWA 3SCWA 2PP1A 3S6DA 3F7JA 4DHGA 2Y4SA 1P0NA 4S3GA 3VD9A 3OG2A 3HPXA 4ZEPA 5DF0A 4ES4A 5HNRA 4QLJA 1PX4A 4ZOEA 3WDHA 3EDDA 3UCCA 4IG2B 1D3CA 2GQ3A 2DSVA 2FFCA 3VZZA 3A4AA 3OIXA 1LLZA 4J28A 4K8GA 4YVPA 2CLEA 2YXGA 3UW6A 3P5YA 1H7NA 1F2JA 1E0VA 5PTDA 3BMXA 1E15A 4JX6A 4A3YA 1XG3A 4O50A 2CW6A 5JBEA 3IACA 4X63A 1OY0A 1GOXA 2PE4A 3TONA 1TKKA 3H2FA 8RUCA 1DE6A 3DESA 1M7PA 1PZ1A 2MNRA 3BLOA 1B3OA 3HFTA 1VCGA 4QQUA 3MO7A 5T8GA 1CB2A 4XBSA 1UYQA 1SUXA 2D0GA 5CGMA 2F2HA 3VGHA 4UFKA 3U3HA 4C6BA 3H8AA 2X0SA 4AH7A 1R3QA 1V6VA 3KRBA 2C3ZA 1MFUA 1B9ZA 3UG3A 4INFA 4MKSA 3S2LA 2PWEA 4FI4A 3AHTA 1FWWA 3ARTA 1ZB5A 4ZOBA 3CHEA 1CW2A 2E6AA 4DWSD 1JYNA 4GRSA 1XDLA 3CL8A 3HN3A 3PFMA 1JD7A 4H9TA 4IJCA 1OVDA 3GX9A 3VNYA 1E9IA 3NZQA 2DJXA 5EBUA 2WPGA 2C13A 3G1XA 3V36A 1PV8A 5ECVA 3VINA 3II1A 1O5QA 3WH7A 4J7RA 4KWVA 3OGVA 4MKNA 2ALRA 1PKMA 1J4EA 3B8TA 1QASA 2QIWA 2BY1A 2XIMA 2J9XA 3KAOA 1KRAC 3W9ZA 4PGLA 4MB4A 1B3ZA 5DMYA 4S2CA 3DKJA 2VWTA 3ZZ1A 3W7JA 3IGUA 4K8HA 3LV5A 5IHSA 2VRKA 5IBXC 5D04C 3G5EA 1B90A 4IM4A 2QNEA 1JUKA 3L4WA 3OZMA 3NL3A 3B9EA 2SFPA 1GQLA 3VKJA 1W17A 4J2PA 4XZLX 1B3VA 3PTKA 1WAWA 4OJYA 1EZWA 3LX9A 3A4WA 1X39A 3IJ6A 2ZRWA 2DSKA 1V6UA 4DJDD 1AW2A 1HGYA 6CGTA 1UH4A 3U2OA 3AXKA 1TPDA 1TTQA 3HGJA 4FALA 2RFGA 1NWTA 2PI6A 4F79A 1R3YA 5DCBA 4AEFA 2REQB 5BRBA 3VM7A 3CASA 4CQ9A 1LL4A 3U57A 4IL0A 1ZSXA 4X2RA 2WZMA 4POCA 1VC4A 2Z4GA 1TUXA 3NQ2A 5KINA 1E3XA 3HU7A 1NDWA 1ESWA 3GTHA 1TTIA 2PTYA 3W87A 3STFA 1GVSA 2QDDA 1ECQA 4W93A 3AO0A 1IT8A 2Y70A 4D71A 3NR0A 2DT3A 5IHRA 2FVLA 4NAFA 3S1GA 1XSJA 3JVAA 1HL8A 4DELA 1RXOB 3LRMA 4N42A 3F03K 5J5DA 1ZCOA 2FLIA 2OQHA 1GW9A 2WVTA 3WQPA 5HOSA 1TWDA 3IRDA 1UWSA 3EGJA 4C6QA 4Z2LA 1FHVA 3VIPA 2RGMA 2AGKA 3VKDA 3WK2A 5CSUA 4TR9A 2BVTA 3INPA 1OT2A 2FDSA 2ZZ7A 5FAGA 4XZIA 1XP3A 5I02A 2G37A 1SW3A 1F6YA 1OX4A 3EXTA 1ME7A 3BG5A 5JMUA 3VIGA 2ZUSA 3AU2A 1D3HA 3VOIA 4A8NA 1OC6A 4IJBA 1O4UA 3HPZA 2BP1A 4HP5A 4OT7A 2BVYA 1R9XA 4F9DA 3JR2A 1VYRA 3NQ6A 3NQ7A 2B31A 1ME9A 3C6CA 3N3MA 4BA0A 5J5RA 1QNVA 1P48A 3N6QA 4AHOA 1V3IA 1H7RA 5LHFA 4GINA 4OBRA 4PFHA 4M6UA 4WLCA 3IRSA 2EXOA 1BXNA 1E70M 1KFLA 3D47A 1ZRQA 3CWHA 1IGSA 4US5A 3FIGA 4B3KA 4KWWA 3ABZA 4CKQA 2J75A 1ZY9A 2BXVA 1ONEA 3MI6A 1K6WA 3P80A 1O7AA 4RLIA 1QI3A 4N7QA 5EMUA 1W32A 1LLOA 2RDWA 1J0JA 4C6MA 3VMPA 3WQ5A 4IP7A 1F9CA 2ZRZA 4WJXA 3LNMA 3VK5A 4DEFA 1U5HA 3IEBA 2CEQA 4Z08A 4LFYA 4WDXA 1JYWA 3S3GA 3N1AA 1EP1A 3WUEA 1H0GA 3B04A 3DN5A 4I7VA 3O16A 3OA5A 3TYUA 3LDVA 3BCFA 3MMWA 3C3NA 2V3EA 4L1WA 2GK1B 4K1GA 3LTPA 3GWQA 4L4PA 2FGZA 1DXFA 2WMIB 4HYVA 4Q3MA 4IFOA 1Y65A 4LSBA 3W37A 4N6FA 3A13A 4CN6A 5HMEA 4R5EA 2R8WA 1EZ2A 1OCQA 3L66A 2WLZA 3LCFA 3ZM8A 3DBNA 8CGTA 3BZGA 3W1LA 3T2PA 5LIWX 4MZ8A 5DFAA 1VFUA 2Y0FA 5BMXA 4RCXA 1HP5A 4MMWA 1W1IE 1VF8A 2V30A 5AYBA 1GG1A 4QJ5B 1REQB 4JR5A 5LNUA 3TTOA 1ML1A 5C6MA 3AUJA 2GQAA 2CITA 2NUWA 1YNQA 4M6VA 1VBGA 3TW7A 5HDRA 3I65A 3KCOA 2XGZA 1B1YA 1HO4A 1MEWA 3M07A 5KZDA 2Z28A 1POKA 4HHLA 4HPXA 2RHGA 4NAEB 4N4PA 3KBNA 4C1LA 2PB1A 3ABSA 2EJ1A 5AVHA 3B4UA 3GXFA 2VEKA 5E93A 3I7RA 1ECEA 2Z26A 2YCLB 1PL9A 1UOKA 2Z6JA 5AYIA 3UT0A 3PZIA 2YW3A 3RM8A 2XG9A 2XVGA 2WNZA 1YE4A 3DECA 5I07A 1QRQA 4X0NA 4D6EA 1JUBA 4IP4A 4JTGA 3KUMA 4Q8TA 1CGWA 1KXQA 1JDDA 3VIKA 2NQ9A 1CB7B 2BBFA 4MOZA 5E6ZA 3TOYA 4U2YA 3UWUA 1J2WA 1KV8A 2E67A 2WMGA 1SJDA 1N55A 1FHDA 1HGWA 2YXOA 4G1NA 4BQ5A 4W5ZA 3RRAA 5CXPA 1RALA 4O0QA 3UZYA 5BOOA 4YXGA 1JAKA 1R38A 1E51A 2ZX9A 3QV9A 2Z1VA 2KAUC 3O06A 3URQA 4W8LA 3M0IA 4KGJA 1SO3A 3FSTA 2ICSA 1E0TA 1AODA 1C8YA 2OLAA 1LJYA 2XVLA 2VEGA 2GUYA 4TIMA 4Q7IA 1KRCC 3AALA 2YCKX 1WDPA 1ZENA 2E7FA 3GVQA 2V82A 3PG9A 4PB4A 3E0IA 2NQJA 1M5WA 1U2YA 1XYMA 1XRVA 1LCOA 3UESA 2JKEA 1RH9A 3H55A 3CB3A 5DT7A 4OHQA 4B3ZA 2FH6A 1HKIA 1GKRA 4H41A 3CZLA 1MFVA 1QUMA 1TA3A 5I5RA 2F8QA 5RUBA 2QPXA 3THAA 1UWAA 2PWGA 3G0XA 5ECUA 3TZFA 3JZUA 2QVNA 3QOKA 1IZJA 2PPGA 1XLKA 1V03A 2QS8A 4GXWA 2ZXQA 1BF2A 3Q94A 3BH4A 1R8LA 1E40A 3TAKA 3W2UA 2PA6A 4NZFA 2NQLA 4V1XA 2GVGA 4UTLA 4LCRA 1NF0A 1GW1A 3FN9A 4E3TA 3APGA 1UR1A 2GDVA 3T08A 1TO3A 1LWIA 3GIPA 3DC8A 4HQVA 3ABXA 1XLMA 2VX7A 3HMCA 3W26A 4DBUA 3MDWA 2PGFA 1O68A 3DU0A 5DANA 3RCMA 2O55A 4KBXA 1FH7A 2QCNA 2CWXA 1TFVA 1VPQA 2H3BA 3U4FA 1YTEA 1GOWA 4JCLA 2JK2A 1N2VA 2V69A 4WQ6A 4O15A 3TN3A 1LRNA 2BASA 1UR4A 3RCNA 4QAIA 3BSHA 4ROQA 4Q8VA 1H50A 3T6CA 1KXVA 4ATLA 1HP4A 3I10A 1DTNA 3P74A 3V75A 5D09A 3OP2A 4M7TA 2XISA 3TSDA 4O12A 3WJWA 3VFCA 4XWUA 2QDGA 3T4WA 1TMQA 2J9YA 3VAVA 4JTCA 4ZXLA 2PTXA 4LC6A 2GWGA 5MF5A 1VBJA 2QF7A 3GTNA 1BSIA 1EJUC 1A5LC 2A1YA 2OWWA 3VO0A 3CWOX 5HQMA 1T6MA 2J79A 2DSZA 3B0VC 1OK4A 3EBVA 4HB7A 3W38A 1IZCA 5LGXA 2GYIA 3SJ3A 3WMCA 1YYAA 2UY3A 4QQ3A 1VFFA 2A0NA 3WFZA 3FJNA 3FEMA 1YE6A 3AIUA 3QY8A 1A3XA 1W8SA 1XH1A 4IGSA 1W9DM 2DUXA 4IZGA 3GR8A 2D2GA 5JIPA 3L5LA 3HGRA 1F07A 4GK8A 1M03A 2OZTA 1E1CB 2FHFA 3IWPA 4P7LA 2QT3A 2J88A 3MBFA 1DTUA 4Y9PA 2ZVRA 3QYSA 1KR1A 5G4HC 1FWNA 3AMGA 1HW6A 3W86A 4GNKB 3N73A 4NXSA 2VRQA 2ZIDA 1FDJA 4LEFA 4M8UA 3WEZA 3GBDA 3S0CA 1S5TA 4IMEA 4PRRA 3SCOA 4CQBA 2EO7A 3UR8A 1NWSA 1TG7A 2GLKA 4P8VA 2WVVB 3VYLA 2OSXA 3SIZA 3QEZA 3A22A 5DBUA 2VC9A 1UKPA 3CEUA 3E2RA 4IQEA 4REQA 4IMFA 4JL2A 3T1GA 4MZYA 2EPMX 2I5IA 2JGYA 1AQMA 1DQWA 4XB3A 4HN4A 2V0TA 2WWCA 3N4AA 4J3WA 4M5PA 1B2YA 3DFTA 3SDOA 4A4AA 2ZUNA 4D8LA 5M3WA 1EJVC 2WPBA 1GJPA 1NQKA 2YCEA 3MDUA 5HAOA 2ACRA 4L5ZA 3M0YA 2WANA 1KRMA 4QLLA 4UMCA 1RJQA 3HG4A 5CBJA 4XBKA 1A5CA 1F61A 3FFSA 3IANA 3M44A 1UZ1A 1KFKA 2VUYA 1A5MC 3QPZA 2C0AA 1YPXA 3LCXA 1FWJC 4DUVA 1JR1A 4O8AA 3URAA 3WNKA 3BE7A 1G4SA 2PLMA 1JZ8A 3BAXA 5H8MA 1TPVA 1TJ0A 4GY0A 5GJNA 4C7GA 3L5MA 3GXTA 4IT1A 4H6EA 4N4QA 4DWDA 5BW6A 1V02A 3VOCA 1GVEA 1JF6A 1QNSA 2FJUB 1MUCA 3GU2A 1SFTA 1Q66A 4S3KA 4UTJA 4YHEA 2BY3A 1LBLA 1RBAA 2CFFA 2PDLA 2ISSA 4OTKA 2PRLA 2OKOA 5U7SA 3IVUA 3USZA 3IJ8A 3TJ4A 4MAZA 4LOCA 3QV7A 1IR2A 3VIJA 1DQUA 1QPKA 3FSUA 3WBWA 4B91A 1F7BA 3EWUA 3WBXA 4IQJA 4RW5A 1G7UA 1OBAA 2XIBA 1EJSC 1UR0A 1XLGA 3P7YA 3ITVA 4C1NA 3VX0A 3H7RA 2C7FA 1AW5A 5LZLA 5FJJA 5I3GA 3O3RA 3PF3A 2RUSA 4PTVA 2YFNA 5HPCA 5CPSA 4DYJA 1JNDA 3CQKA 2Q3RA 5CJNA 1XW8A 1YKWA 1GYLA 2DZBA 4M56A 4DYKA 5K3VA 5BNKA 2PDCA 2BY2A 5DN1A 2EKGA 4D6IA 1R47A 1W3NA 3M5VA 5LIKX 4LJ3A 1RCOB 1KGUA 4AZ7A 1KWGA 3AC0A 1OK6A 4IPIA 4HA4A 2BFGA 3FHQA 4RKAA 2D24A 1PPIA 3HA1A 2VDHA 4I5XA 4LB3A 2W27A 1YTDA 2OYMA 3N2MA 3QZAA 2NV2A 2CHRA 3RMJA 2FGBA 2Z2AA 4CVUA 4CEXC 4GY1A 4CNNA 2ODOA 3B8IA 3S2MA 4Q8PA 3HPFA 2YDQA 4MM1A 1UWUA 4Q7BA 3TYAA 1QU4A 3TJXA 4B2DA 5TBOA 3ZT5A 2VFGA 2TSYA 4UQBA 1XC4A 2WHKA 4I7WA 2WC7A 3I6EA 5G1YA 5EKYA 1YTKA 1XLIA 2HMCA 4CD7A 1FWAC 2WNQA 1WZKA 5GQBA 3SSJA 2Y8UA 3PJXA 1DORA 1NEYA 2NSOA 3WNMA 3C0LA 4HU0A 3SRFA 3KOFA 3NOYA 4F0LA 3ZYZA 2BOEX 3REQA 4N02A 3CUZA 4LUYA 3KL3A 1RSCA 1Q6EA 5FIPA 1AMKA 4UQCA 2I14A 1CZ1A 1V79A 4GX9A 4IFKA 4L64A 3DHPA 1W9UA 2I57A 3H22A 1F4HA 1K6AA 4C6DA 4ORMA 1J0IA 1W3HA 1IIHA 2FZNA 2VEFA 4GIEA 3O0KA 3ZVIA 1GKQA 4FIRA 3H26A 2ZRYA 4ZB2A 4MJMA 2XWDA 3TQKA 2XZ7A 3KWSA 1KM2A 1AZ1A 1ELSA 3AU6A 1MW2A 4NZCA 3G8RA 1DIOA 3KCLA 5BOEA 4LBSA 2V5LA 1UIPA 3ZJKA 2DVXA 3THUA 1Q6FA 4LVBA 3T0AA 4E3VA 5LNWA 3RILA 2G97A 2O7QA 3A23A 4Z2HA 3XINA 1TQJA 1KV5A 1KKRA 5TF0A 1XGDA 3T07A 1XS2A 1GZGA 2XINA 4XZMX 5HATA 1RD5A 2F61A 3WD0A 4XAYA 4AXKA 1NOWA 3LHUA 2PDUA 4WKHA 4LF1A 1P1XA 3CAVA 1I60A 3W7QA 3I3DA 1A5OC 1UR8A 2G95A 1EPXA 4ONVA 5KZEA 3ITGA 5HNUA 3OODA 5FF7A 1PCKA 3ARUA 3QPYA 4B4FA 4HA1A 1XRSA 2E6DA 3HPAA 5BXRA 2J7FA 4IPNB 3B0UX 5JXQA 4D8AA 1JCNA 2XHYA 3D46A 4D9PA 2WXDM 3BG9A 1AQFA 1P6BA 2QDHA 3IJ9A 3GDBA 3AZSA 3S8HA 3C2RA 5HNTA 3N29A 2V9D