1TV7A

Structure of the s-adenosylmethionine dependent enzyme moaa
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 108
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv7A00
1JUEA 3S1WA 1ME8A 5LHFA 2ZFAA 3W7EA 4AHOA 5FEPA 5BNKA 1R2RA 3E9AA 4FX6M 1WBJA 1FDJA 4DBEA 1VHNA 5CPMA 3SGZA 3LCHA 5IM51 4HKPA 5CSSA 4I7WA 5BRBA 1G4EA 3PB2A 1WOAA 3UXDA 2JGQA 2X1TA 4ADTA 2ZTKA 2E1DA 5EMUA 4XUGA 3N9RA 3Q94A 3W7LA 5HUPA 3STGA 2ZZ2A 1SU5A 3USBA 4CNNA 3G3MA 5DLCA 1IIHA 3S5OA 1TPWA 3NM1A 2AAMA 3WJXA 3W1QA 4BI6A 3PF3A 2XN2A 3NA8A 1XKYA 1BEUA 2BLEA 3CEUA 3TMQA 4LV4A 4GUGA 4NJGA 3CM4A 3RF9A 2VFFA 3GDKA 5LNVA 4Z0SA 2B7PA 2VOMA 1W37A 3TKFA 3UQNA 5F4WA 1QPQA 2QCHA 1JJKA 2NX1A 3L5LA 1ZY9A 3L68A 4PH6A 1ZAHA 4ZMGA 4CQ8A 2E6FA 3KFTA 5LNSA 4Y96A 1PCWA 1ICQA 3O05A 4BF9A 5IBXA 1I8JA 1SW3A 2C18A 3HIJA 1TTJA 4IJBA 1VPXA 5K9XA 1YDOA 4CNOA 1K03A 5E1QA 2WNZA 4K37A 4D2JA 5CPNA 1W5PA 4O28A 3TIMA 4XKYA 2B0MA 1TRDA 1GQNA 4GE8A 1OJXA 5ABTA 1EUAA 1LOLA 4M6QA 2H90A 4DELA 4ORMA 5CZSA 1T8XA 4IMCA 1Q45A 2ZZ1A 1X8FA 2JKPA 4IX0A 2EGZA 3CEPA 4M5PA 2OT1A 1T99A 3W7IA 1DJQA 4O50A 4N9EA 4WQ6A 1LBMA 3E96A 3LRKA 3EKZA 3S1UA 3L5MA 3IIXA 3N19B 3KRSA 3TH6A 5K4XA 3OVRA 3TNOA 3G1AA 4M19A 1IGSA 4YCPA 2J9XA 3QSRA 5H2ZA 3EXRA 3O06A 1SSDA 1ZFJA 2CZFA 3UXAA 2CWNA 5C2XA 1FBAA 1AL7A 1B57A 4QNEA 4Z1DA 1EX5A 4IPJA 1PIIA 3ATZA 1QNVA 4MFDA 3M43A 2NUXA 1DBTA 3L0KA 3GXTA 2ZCGA 1KFBA 2BXVA 3SSJA 1NVMA 3TMLA 5EYWA 3GIYA 4O52A 5BMXA 4JR5A 3LHUA 4RZ5A 2GJLA 1EB3A 4JY9A 4I7VA 1SR9A 1H51A 3DI1A 2E5CA 1TV8A 1W56A 3S1VA 3N2XA 2NLIA 2F7FA 2C3ZA 3M5VA 3TFXA 4HNTA 3L66A 4O16A 5DBTA 5I3FA 3O63A 4KWVA 4B5NA 1ZCOA 1TPFA 1FUYA 3GR8A 4JTKA 2V82A 1YXDA 1ADOA 1SSGA 2YX0A 4JTHA 4Y90A 1OFRA 2CZDA 1XUUA 4QM1A 2E68A 2VFHA 2ZRXA 2R14A 3P80A 3P5YA 3FOKA 4LUIA 2X1UA 4JTFA 1OFPA 3FYOA 4ZQOA 1RQEA 1WV2A 2YFOA 3R89A 5LNUA 1WDWA 3PUEA 4Z0JA 2R91A 3IIZA 3NEVA 1XFBA 5AHIA 3W71A 5AC8A 1EP2A 4CLMA 5U4NA 1IXNA 4FEZA 2J9ZA 3G1YA 5L9FA 5EKYA 4GRSA 4OT7A 1WBHA 2DU2A 4BI7A 5I3JA 1GT8A 3IVTA 3VNDA 3NM3A 3MP4A 5AHLA 2V5BA 1L2UA 4Q4KA 1TMHA 3LX9A 4GFSA 3OVPA 1KA9F 1DJNA 2WPBA 1VS1A 3I65A 1H7XA 4MJMA 4RLIA 2ABAA 3LTYA 5FF7A 1VLIA 2A6LA 4ZQMA 3O6CA 1VCFA 5AC6A 2V2DA 1GTEA 3MI3A 3BGJA 1DQXA 5DELA 4K8HA 4PL1A 1RZMA 4MZYA 4K6AA 3BW4A 3BPWA 3W7JA 2ISSA 3HOJA 4TIMA 3C2FA 1F74A 5G2HA 1DVJA 1EWDA 2QCDB 4JYDA 4M6PA 2WNQA 3W6YA 4UR8A 4JDBA 3UNDA 3V1PA 1H1ZA 1KM3A 1XL9A 3W1TA 2JKAA 2QJIA 5DY2A 3BV4A 1I2RA 3W7HA 2NWRA 2EPHA 3NNTA 1LLZA 4M7TA 2Z2UA 2DZXA 1R30A 2FPYA 5CKSA 2DZPA 2YDAA 4A29A 3NPVA 4O57A 4JDYA 4O19A 1TPB1 4O53A 4WZHA 3W07A 4M7SA 4HNVA 4AAJA 4OBTA 3G1DA 1M6JA 4FNPA 5D32A 3MI6A 5HUOA 2PCQA 3P67A 2IQTA 5CSRA 1I4NA 2GVJA 5G4WA 1TO3A 3S42A 2NUYA 3EWWA 3PUDA 3G1XA 4IX2A 3NQ8A 5G1YA 3GNDA 4O1CA 4A3UA 4BWLA 1ICPA 3T40A 2BTMA 3C2VA 1ZNNA 2VEKA 4R53A 4OV9A 1CW2A 3W83A 1ONRA 2ZRWA 3HJZA 3P5ZA 1RPXA 2PRLA 3FJ6A 3DKJA 3W7CA 3CIWA 1VRDA 3GX9A 3W7RA 1PS9A 5LNWA 2QR6A 3PR2A 4JTJA 3HGJA 1OYCA 4JX6A 1C29A 1B4EA 1KFCA 2I9EA 2RFGA 2Z0IA 3CHVA 3LXAA 5U7SA 1HG3A 1R46A 2Y85A 3NDOA 5C6MA 3M0ZA 2RDWA 4AVFA 1KTNA 3PSWA 1G4TA 1HL2A 3YPIA 4UMAA 1YADA 2X16A 2H8XA 4IMEA 2TYSA 4LS1A 4N02A 3WJWA 2PE4A 4H6KA 3BLFA 3QEZA 1Q6RA 3Q58A 4NQ1A 3UPWA 1YYAA 4L4MA 1TTQA 2AGKA 3S6DA 3HPZA 2DZWA 3P81A 4JIQA 2A21A 3DBPA 3O1NA 1W5NA 2GQ8A 2P10A 1THFD 4NZJA 4RZ6A 4WX2A 1O4UA 4AWUA 3EX4A 2OMAA 2ATSA 1VR6A 3GR7A 1F76A 1DKWA 1YPFA 3FIGA 3N2MA 5D38A 1XCFA 3H53A 4POCA 4DPQA 3NGJA 3QQ1A 3W22A 3E02A 4HNUA 1JUKA 3MJYA 5DN1A 1D3GA 1E51A 3S0CA 1C9DA 3LBMA 1EA0A 3BO9A 1OF6A 1Z41A 2J6XA 5DCEA 4ZQRA 3C6CA 1H50A 1H7NA 1WAUA 1O5XA 3QYQA 4O15A 2D73A 4RZ4A 3N9SA 4O18A 3K30A 4O4WA 2E09A 4TMBA 3P74A 4OGZA 4GNJA 5J5RA 2XN0A 3W73A 5TQLA 3G18A 4ZL1A 4CQ9A 2FB2A 3L9CA 3LCLA 3GDTA 4YCOA 4JX4A 3C61A 4O54A 1T0OA 4MKNA 1TPH1 1YTKA 1ICSA 5D02A 3HQ1A 4YMZA 1GVFA 1G67A 2A0NA 2E5DA 2NXIA 3MMTA 5F4XA 4XWUA 1OHLA 2Y88A 3O16A 1S5WA 4C1KA 2NZLA 3SFKA 1T96A 3M6YA 1FWSA 3WK0A 1OF8A 2NUWA 4UFIA 4FNSA 4PL2A 1LLWA 2WSRA 3TQVA 2FQIA 2TMDA 3MHFA 3LV5A 4PCFA 1WA3A 4LVDA 2OJPA 4UTJA 3S5NA 3G8EA 4AF0A 3HG4A 3W2JA 1TPEA 3MUXA 1EUNA 1TYGA 1LCOA 3VE9A 1LP6A 1UASA 4P61A 4UTHA 3AJXA 1B9BA 4O0ZA 2WJZA 2C15A 1LOQA 2Z6JA 5KZMA 4O17A 1TIMA 3F4NA 3W2MA 3GXPA 1SZFA 5DXXA 1H7OA 5DCBA 2B7NA 1EPXA 3RFAA 3LCGA 2YW3A 5AYXA 3W1PA 4LU0A 4AEOA 1YXCA 2GQAA 1LRQA 3A21A 4E2BA 1LDCA 3OG3A 2NV2A 5HWNA 3NYZA 4O1AA 3EB2A 3ABQA 1A53A 3PVFA 2V81A 3W7KA 1TTIA 1RQHA 4XZ9A 2YXGA 1BWKA 1VYRA 3NQGA 4DO5A 1NF0A 4DEFA 1I2PA 1EP1A 3ZWSA 4JTUA 3LLDA 4IPIA 4GUIA 1JCXA 2H3DA 1LM1A 3G1FA 4AB4A 1N8FA 3W2LA 1QO2A 3IGUA 1VJIA 1DOSA 5K3VA 1W5OA 3ZR4A 3LTPA 1V5XA 1W3NA 3CWNA 3E12A 1XUZA 5CZ0A 3SGUA 3W23A 4NXSA 3THQA 3NPXA 3UZ5A 3CTLA 1OFBA 1WQ5A 4HPXA 2GQ9A 4JGDA 4UFMA 3PC0A 3PG9A 1XI3A 1KV8A 4JEQA 2J24A 3FLUA 1P0NA 2QCFA 5EY5A 1XDMA 3QC3A 1KV5A 3HPXA 4HNNA 3SJ3A 1NFBA 3GLCA 1KLZA 2QCDA 1OVDA 1GYLA 2Z1BA 1K7XA 2C1HA 1Q3NA 1DHPA 3T78A 4MLRA 3SR7A 4UTTC 4K7YA 5C55A 3NQ7A 2H3BA 2QCCA 3SIZA 1QMLA 4QQ3A 1UUMA 1TSIA 2GVGA 4BK9A 3UZJA 2B7QA 4ZVJA 3IIPA 3S9YA 3DFQA 4UC5A 5D03A 2QCNA 1OG0A 3QW4B 5F1VA 2VFDA 1FCBA 2YGYA 3UWYA 1A50A 3NL3A 2CLLA 1P1XA 1BWLA 2BZNA 5LGXA 3S5ZA 4JYEA 4S2BA 3TX9A 5G1TA 2H8ZA 3E0IA 2G95A 1PCKA 3RNDA 4U4MA 5FEXA 1D9EA 1G7VA 3G0UA 3W88A 3QPZA 1AL8A 4JN6A 3TJLA 3ZS4A 1FCVA 2PRMA 1GOXA 3GDRA 1IIGA 2QCLA 1FDYA 2FLIA 3OBKA 4Z1AA 2CLIA 1K8ZA 3R8RA 1Q6LA 3KRZA 5J5DA 2X30A 1FWTA 2Q3OA 3T4CA 3RU6A 6TIMA 1A5CA 5F4SA 3L21A 3LBCA 2Q8ZA 1EEPA 3DGRA 3E49A 3CWOX 4BFAA 5G5IA 5AYZA 4R34A 3LCXA 2RDTA 1ZAJA 1L6YA 2CLKA 2V2CA 3HPSA 3N3MA 1SFJA 1QPNA 5LZLA 3PUOA 2EF9A 5H91A 1FY6A 1H63A 5HMSA 3ZFHA 2HTMA 5AHEA 4NX5A 3LRMA 2Y7GA 2G97A 4IOTA 4EIVA 1JUBA 4DF2A 5SWUA 5GVJA 1FWRA 3BG3A 3UY8A 3F03K 2YFNA 5I3HA 4UTIA 3TDFA 1W5MA 2HSAA 4FNQA 4IXXA 5F1UA 4S1FA 3U6WA 2P1FA 3MP3A 4AF0B 4FIQA 3C2EA 3PSVA 5D09A 3MBDA 3VCRA 2ABBA 3DKLA 4M6VA 4ZQCA 1TQJA 2GPTA 3N14A 3ABRA 3QZEA 3IIVA 3HO8A 4EF8A 3TXZA 3MP5A 5C5YA 4N9DA 4LUJA 1JQVA 2Y6ZA 3OVQA 2PC4A 4QJ1A 2V8ZA 5EL1A 1CI1A 3BLEA 4Q32A 3M16A 2X1SA 4N9CA 3UWUA 3W70A 1G7UA 4R33A 2H6RA 3G0SA 3NZRA 4GXMA 1QO5A 1W8SA 4NNAA 3U2OA 3GXNA 2HS8A 3HG2A 3SZ8A 4ZQNA 4FIRA 1TREA 4IXHA 3PBWA 2CFFA 2YZRA 1GG1A 1AMKA 3TXVA 5G4EA 2FIQA 3LM7A 5AYYA 2BX7A 3GNNA 1YDNA 3GAYA 3LB0A 4RV8A 2A4AA 2R94A 4UTWC 2FPVA 3IVUA 3G1SA 3KVKA 4CNPA 5D33A 2DZSA 3LXBA 1VCVA 3M1ZA 3V75A 2WOQA 2ZZ3A 2ZRYA 2RHGA 2OT0A 3DFTA 4UTMA 1SW0A 2A85A 3W87A 3DFPA 3A5FA 5BOOA 3R13A 2YYTA 4N9BA 3FYPA 1PHWA 3M7WA 5BW6A 1GJPA 4NXKA 1J2WA 3M5ZA 1DL3A 1KFLA 4Z1CA 1KW1A 5D05A 2BSLA 5I3GA 2C6QA 3IGXA 4RCXA 3NQEA 4JTLA 1LORA 4O10A 2DP3A 1H7WA 5DY3A 4AWSA 3C4UA 4LRTA 3A23A 4FB7A 3B8DA 3KVJA 1HFBA 2WSQA 3KOFA 2ISVA 3M5YA 3NAVA 1ME7A 4TX9A 3TK7A 5AFDA 3A24A 4Y9AA 1TV5A 1FCUA 3EX2A 4Q33A 3NQVA 4TO8A 3UWVA 1WXJA 2NX3A 2DJLA 2RDUA 3S8HA 5CG7A 3G24A 1YDVA 3MO7A 4FHAA 3DXIA 4O14A 1YLVA 1UCWA 3O6DA 1UJPA 5K4ZA 1GZGA 4LVFA 2ZZ5A 2FFCA 5KZDA 2QUUA 4MIMA 1RR2A 4NNCA 4NJJA 1G69A 3GB6A 2NWSA 3P8JA 3A5VA 1H62A 3G8RA 1ZHAA 4OV4A 3ELFA 3G22A 2G96A 4OHQA 3LOTA 4MZ8A 4H4IA 1SZGA 4KFNA 2DZVA 1MEWA 2CU0A 3W2KA 1XDLA 2Y7EA 3KX6A 1W5QA 4LTSA 3L5AA 3ZWTA 3C56A 3C52A 3B0PA 5HJLA 1PHQA 4LVGA 2A7RA 1TJPA 3CB8A 4UNLA 4HPJA 3DENA 3TV8A 1SO5A 3LHTA 2ZA1A 3LHZA 5KINA 3NQMA 2ZRVA 1HO1A 2DJXA 4EVZA 5E0KA 1KFKA 3W7OA 4DQWA 1KM2A 3PS7A 4LT9A 1FDZA 1KFJA 2QJHA 3GDLA 5D37A 3TUUA 5AOUA 5AC7A 1PVNA 3IRDA 4MFEA 1SW7A 4PEKA 1VCGA 4QAIA 2WNNA 4AWTA 3M5XA 3NG3A 3L0GA 3N34A 4FF7A 1XBXA 3NZ1A 4UTTA 4DO4A 3QSTA 1DORA 2FTPA 3TU9A 4AHPA 4GWEA 2NX9A 2XFWA 4U28A 1W3TA 3W1NA 3HGOA 3GAKA 3TSDA 4MY8A 3MHUA 3W86A 3INPA 3LHVA 1OFEA 5FESA 3LHWA 3GDMA 2ZZ6A 1N55A 2QF7A 4BI5A 1XBYA 2FJKA 3M9YA 1ML1A 5BMWA 3QH2A 3PY2A 1LTDA 1LROA 1OFQA 4QNWA 2DORA 1ZAIA 2ZZ7A 1UB3A 3B04A 3W1AA 3IIOA 3SECA 2WQPA 2WO5A 4YXGA 3LI0A 1ZALA 4LWWA 1XBVA 1Y0EA 3PBVA 5CGQA 4UMCA 2Y7FA 2YCEA 3EX1A 3OHIA 3EWBX 1AK5A 2CW6A 2WKJA 3LXCA 5DBUA 3TR2A 4DXVA 5KITA 2UV8G 4MVAA 4RXFA 2DZTA 3FKRA 1TB3A 3GKFA 2VEPA 4ALDA 4JXCA 4YLWA 1EP3A 3P62A 5F2LA 1GVOA 1ALDA 4KWWA 4NJHA 3UWWA 2QDGA 3LCIA 3Q37A 3HGSA 4LVAA 4N6FA 2Y61A 4FNTA 4JIPA 5E93A 1KM1A 1F73A 3TCEA 4YL2A 1LOSA 1HTIA 1W54A 2Q3RA 5KMYA 3GK0A 1F05A 3BVJA 4NJIA 4ICNA 4WOZA 2XN1A 3IVSA 2VFEA 1TCDA 1TV7A 4ADUA 4WXYA 3CT7A 1KTCA 4DO6A 3P82A 3G3DA 4ZZ9A 2V2HA 2HS6A 4MPQA 4LRSA 4JX5A 1Z42A 1G6CA 1U83A 2C19A 4ONVA 3LRLA 1L9WA 2JKEA 1H60A 1QDSA 3HB9A 3TW7A 1F7BA 3HG3A 3M44A 3GKAA 3L2IA 4RKAA 4MZ1A 4UUIA 3G0XA 5EBUA 3D0CA 3MBFA 3GYEA 4I9AA 4PODA 4W9TA 2PRHA 4XTIA 4G1KA 3B05A 3P61A 1LRTA 3WJSA 3U8GA 4FXSA 1EWEA 1OFOA 2VFIA 3BG9A 4IGHA 2X2GA 3CU2A 4JY8A 4HSOA 1SPQA 3NL5A 1Z48A 4O8RA 3W84A 4J9JA 2EAWA 3CQ0A 3KAOA 4JD4A 5LNRA 5G2WA 2RH9A 1MZHA 4O1BA 3TE9A 3S5YA 4Y6GA 2V5LA 2W6RA 2QCMA 4FNRA 2B7OA 4MLJA 3W1UA 3HF3A 4S2CA 5D2YA 3EX6A 2Y63A 3PG8A 4UTWA 1F2JA 1GWJA 2BWGA 4LV9A 3MWAA 1NAL1 2ATMA 3DZ1A 1J4EA 1TPC1 2NXHA 1GPWA 3Q2DA 1VHCA 2ZRZA 5D30A 3W1LA 3OEXA 3T44A 4UR7A 4GJ1A 1VC4A 1EIXA 5HWJA 3FJLA 4RR4A 3W72A 3QFEA 4UNKA 1I2QA 4JTSA 3RLVA 4HSNA 1H1YA 2TPSA 1JCJA 4GC4A 3O6YX 3DI0A 1P0KA 2JBMA 4AMAA 4TR9A 3A22A 4N4QA 2C16A 2I1OA 4ORIA 4A21A 4IMDA 4LY8A 3W7MA 1FXPA 3JS3A 1RV8A 2FB3A 4E2DA 5HULA 3QJAA 3SI9A 4JICA 2RKXA 3TW6A 4YWIA 3KVLA 4FXRA 5EPDA 3T7VA 5D2VA 5FF4A 3PBYA 5LHEA 3FS2A 1TPDA 1FXQA 4EF9A 3W3OA 3LV6A 2CLMA 1LRNA 5A5WA 1WX0A 4PC8A 4UTLA 3A9IA 3VI2A 4MUZA 4DBDA 1R2TA 1YTDA 2B4GA 3W74A 1MSSA 3BW2A 5EA9A 3O15A 2P0OA 1ZENA 2VXNA 4N2YA 1BKSA 4JS3A 2W79A 2QUVA 5FEWA 3TA6A 4K39A 4OQVA 5K9CA 4RXGA 4I7UA 3O07A 3WK1A 2VELA 1KTBA 3AO0A 3EWYA 4HN4A 3RK8A 2G5WA 3LI1A 1TPVA 1AW1A 4QITA 1IXOA 4LS0A 3VKJA 4UXDA 3HBLA 1QWGA 1PE1A 2ZZ4A 1GTHA 2QKFA 3MW7A 1KBIA 5F2GA 1OX4B 4N4PA 2E5BA 1KM0A 1X6UA 3BW3A 1K8XA 3THAA 2OX1A 5L6UA 5FEZA 4K38A 4E38A 4JTTA 1AW5A 1V7YA 3FEMA 4LVBA 2AQWA 3P7YA 4NU7A 5CPLA 3W1MA 1K7EA 3RLUA 3QQ0A 1RVGA 1DV7A 3NL2A 1HUVA 2E6YA 2GJNA 4MJZA 3WFAA 1GYNA 1W3IA 2E77A 4UTUA 5D04C 1H7PA 2ZRUA 3TQ0A 1JCNA 2EHHA 4UFJA 3S1XA 4ADSA 4Y8FA 4DPPA 1I45A 4GUJA 4RK8A 2ZBTA 3STCA 4LW7A 5LSMA 1F5ZA 2YW4A 1SO3A 2VC6A 5I3IA 1Z44A 1TTPA 5TBOA 4EOUA 2QCGA 3NPWA 1I2NA 1QPOA 3I7RA 4L4LA 4HT3A 4LOCA 5D2WA 3CPRA 3KXQA 1SZEA 4NZFA 4KFOA 4UFLA 3UY7A 2WV8A 5LKYA 1A5BA 1K7FA 3WK2A 1O95A 3EXSA 1NSJA 1SO6A 2QEZA 1JVNA 1MEIA 1MO0A 5KZEA 4WY0B 4IUOA 5K9DA 3NQDA 5C54A 1B4KA 1QR7A 1K02A 1M7OA 2FPTA 2A2IA 5FI8A 1R2SA 3B0VC 2TSYA 2YYUA 4QSHA 8TIMA 2YSWA 4RJEA 4MYAA 2ZDRA 2QAFA 4QIUA 4PA8A 2OCZA 3DHFA 4UTKA 1SFLA 2QAPA 1F6PA 3HGRA 2DZUA 4X2RA 4UFHA 2ZA2A 5TIMA 4NUWA 2CLEA 3R12A 4WD0A 3W7QA 4Z1BA 2VKZG 5FF2A 2QJGA 3EEGA 1OX5A 4CQAA 1G4PA 4KKXA 3KRUA 3IGSA 3NQFA 7TIMA 2CLOA 3VE7A 1CX9A 1GEQA 3UWQA 4OWGA 3NVTA 2O7SA 3UYCA 3H55A 1IF2A 3QMSA 1OX6A 1XC4A 1LBLA 4LNYA 2I14A 4FO4A 2GUUA 3NL6A 1OYAA 4NJKA 5F2MA 1VZWA 2V30A 1VLWA 3QF0A 1S3HA 2E6DA 1KM4A 5CZTA 4CCEA 4WOQA 3GZ3A 3QW3A 3F4WA 3NQCA 4NVTA 3LGEA 4PTNA 4O11A 1NEYA 1J5TA 3TAKA 4O0KA 3STFA 4IMGA 3NPUA 2FDSA 1VQTA 1FWNA 2VEMA 1M7PA 3ABOA 2ISWA 2O7QA 2A1YA 4JTIA 1KBJA 4UIOA 1B3OA 5AB3A 3EXTA 5AHMA 4UCGA 1GG0A 1SZNA 3L0NA 1U5JA 1GVRA 1FQ0A 3LERA 4XTDA 4H3DA 4RX0A 1P5BA 3W7DA 2Y62A 3SY5A 1KM5A 2YPIA 3FA5A 3MI2A 1XXXA 3NQ2A 4XQ6A 4C1LA 1FWWA 5HINA 3P60A 4E0CA 2YR1A 1TQXA 5MHBA 1O94A 4NT0A 2Y7DA 3PBUA 1QOPA 3TFCA 3L67A 3C0JA 1RD5A 4JTEA 3DFNA 3PULA 5T26A 1O5KA 1QOQA 4K8EA 3QMTA 3TC7A 4WXZA 2KZHA 2J9YA 3F1QA 6ALDA 1P4CA 4P2VA 4DF1A 5KTLA 4IQLA 2W0UA 4ML9A 5HQEA 3R5EA 1F6KA 4ZQPA 1KFEA 2A5HA 2ALDA 3PB0A 3OIXA 4JYFA 1KLYA 3W2NA 5IBXC 3M47A 2QUTA 1BTMA 1OK6A 5CZJA 2JGYA 3M41A 3EWUA 1FX6A 1S5VA 1SQ7A 3B06A 3QRHA 3NQ6A 3DFOA 3LLFA 3NQAA 4LC8A 2NXGA 3BG5A 1JQXA 3KVMA 2J27A 3I7SA 2V0TA 2C14A 4MY9A 3QPYA 2E6AA 5AHFA 3TAOA 1UUOA 1UBSA 1WYIA 5AN7A 2VEIA 2NV1A 3LHYA 4HIBA 4OE7A 5A8GA 3WK3A 2HMCA 3SW6A 4LC6A 3P8IA 4XKYB 3MHGA 4JNMA 3W75A 1VH7A 1K3UA 3EX3A 1D3HA 3I7QA 5I3KA 3TSMA 1Q6OA 2C13A 1QAPA 1TRIA 1L6WA 1JCMP 1L6SA 4LS2A 1X1OA 4XBSA 3P84A 1IXPA 2WSYA 3BGGA 4PFMA 2Y89A 2JK2A 4AH7A 1RQBA 2Z6IA 4GUHA 3TQKA 4TMCA 3NR0A 4FX7A 4NNBA 5F2IA 4IWWA 3W2UA 1OK4A 2A7PA 5DXYA 5HR6A 3C3NA 1SO4A 1JULA 3ABSA 4GUFA 3W7NA 4HHPA 1LZOA 3BLIA 3DHDA 2C0AA 2J88A 4AXKA 3I68A 3EWZA 4CCDA 3LDVA 1IXQA 1QFEA 2PURA 3R2GA 3GVGA 3VFLA 3W7GA 2CZEA 2X1RA 1H5YA 1GVQA 3EKLA 3B0UX 1OX4A 2OZ0A 1DQWA 3LCWA 4FNUA 3BK0A 4Z08A 3MYOA 4K36A 1O60A 2R8WA 3PWAA 4O12A 3NOEA 1AG1O 3ANYA 4JTGA 4UFKA 1G4SA 3H54A 1X1ZA 5K7JA 3HMJG 5HNRA 4MY1A 4KFPA 3PM6A 1R47A 1YPIA 2CLHA 1X7FA 1MXSA 1ME9A 2QDHA 1OFAA 1W1ZA 1LBFA 1KM6A 3B03A 5FF3A 2F84A 1FCQA 5CPOA 3W1XA 3JR2A 3L65A 3QMRA 4WY0F 3RMJA 3WJZA 1VYSX 1H61A 4X3ZA 4A2SA 1S5TA 4NX0A 5AHNA 4MOZA 1Q6QA 3LCFA 3DH7A 3TSBA 4GBUA 1VGAA 2ZTJA 3C2OA 4O4VA 3BARA 5D2TA 1LYXA 2LLEA 4A2RA 2Q8LA 1JCYA 3TC6A 4R7JA 3TROA 3CC1A 2GOUA 5LGZA 3C2RA 5HR7A 2CLFA 4WY0A 1JRBA 3DU0A 4O13A 3UPBA 1NF7A 3B4UA 3NO5A 1QPRA 4A22A 2A6NA 2Y70A 2VFGA 3C8FA 3TJXA 2ZA3A 3G1VA 4XBKA 3W1RA 4X22A 1YTEA 1GVSA 2ZQ0A 1I2OA 1OFDA 3JRKA 3O8AA 4X9SA 3UWZA 4AHQA 3CLMA 5K2ZA 1YXYA 3ATYA 4WUIA 1K8YA 1OABA 2VENA 2ZYFA 1VYPX 3STEA 3UD6A 3LTSA 4O1DA 3CIXA 4TU1A 1JCLA 1WOBA 1TPUA 4MYXA 3EWXA 3NXFA 4BR1A 1JRCA 2CZ5A 3DFSA 2QCEA 1W0MA 1C8VA 5D2XA 3I6RA 5HWMA 3OA3A 4N6EA 3QM3A 1PV8A 3W7PA 1M5WA 4OU1A 3FKKA 2GVLA 1W31A 1TJRA 3W9ZA 2TRSA 3N73A 4WJEA 3G1HA 4FX8A 3FFSA 4UMBA 1QCWA 1XM3A 1XBZA 3KHJA 3T55A 1OYBA 3HG5A 3W76A 4QISA 5FF0A 4EWND 1ZJIA 2EKCA 4BWLC 1PL9A 4K7VA 1AW2A 3IEBA 5DCDA 4CCCA 1A5AA 3MYPA 1HO4A 4DF0A 3PAJA 3DAQA 1MEHA 2A7NA 3WJYA 1H7RA 1A5SA 2V9DA 1JR1A 5G2IA 5KSWA 3IV3A 3W85A 1N7KA 1SUXA 4IMFA
chains in the Genus database with same CATH superfamily
4JFWA 1JUEA 5BNKA 1XPGA 3MJMA 1UYQA 4FX6M 3C8NA 4L7ZA 2PGRA 3LCHA 2WNWA 5BWFA 5A2AA 5IM51 3U2EA 3UXDA 1JEZA 4MWAA 2X1TA 4ADTA 1JPKA 4HK7A 4XUGA 1PZ2A 3USBA 4CNNA 3QY8A 3WLSA 3WJXA 1XSIA 5A6SA 4AX6A 3PF3A 2CESA 3NA8A 2GVYA 4JTAA 4C6FA 1IR1A 4H7VA 2C71A 1J8VA 4Z0SA 3RM9A 2VOMA 3GO2A 3Q65A 4XZHA 5F4WA 2QCHA 4A35A 3LSCA 4HYWA 2PTDA 1TELA 3JW7A 1MXDA 3L5LA 3L68A 3QVQA 5C9WA 4QEHA 4DAFA 1FFRA 1ICQA 1NFPA 2VD9A 4IJBA 4FSAA 1YDOA 1K03A 5E1QA 4GX9A 3EOUA 2BGQA 1LUCB 3AMGA 5AECA 1V93A 4M5PA 3N4AA 4YJ5A 1T99A 3W7IA 3A64A 4O50A 1RD6A 3SCQA 3EKZA 3N19B 4HGXA 3R8GA 4Y7EA 4IPNB 3QSRA 2XVKA 3EXRA 3O06A 1W3JA 3QR1A 3UXAA 3HZ3A 5C2XA 1I9CB 4J1OA 4Z1DA 4CNUA 1EF2A 1ECQA 3WH7A 2WWCA 1BSIA 1EX5A 1PIIA 1QNVA 2YB1A 3SRHA 3L0KA 1PTGA 3GXTA 1FA2A 3QZ6A 4LEFA 2ZCGA 2WZMA 3CMGA 1VPYA 2Q01A 4KBXA 1NVMA 4MMWA 3EWDA 3NSXA 2OZ3A 4RZ5A 2GJLA 1EB3A 1I75A 5CBBA 3DI1A 2X2YA 2E5CA 3CWHA 1UZDA 1NP2A 2NLIA 4PZVA 2F7FA 2PWFA 3A12A 3M5VA 3LMYA 3O63A 4X61A 3SRKA 3QGVA 1MQPA 1ZCOA 4FZIA 4J4KA 5AVNA 3GR8A 4JTKA 1BG4A 1BYBA 3R4IA 1YXDA 3GNOA 1ADOA 4EPBC 1GKQA 5LIWX 2G37A 1XUUA 3NWRA 3SBFA 3QYSA 2E68A 2IW0A 1POJA 2ZRXA 4J3TA 3E0FA 4JTFA 1VBHA 1ITQA 3FYOA 4ZQOA 1RQEA 2YFOA 3R89A 1TZ9A 2CKSA 1ESWA 5LNUA 1E72M 4HHMA 3WLTA 3ME3A 3MA8A 4M56A 1B2YA 3AICA 4FEZA 3TWAA 4HD5A 2P53A 1SMAA 2P88A 1FRBA 1S2AA 2OLSA 3M64A 4LBRA 4NI3A 2V5BA 5JU6A 5TNVA 1L2UA 1M68A 4W8LA 4FOUA 1KA9F 4HA4A 4AC7C 1E1FA 1R3TA 4JHMA 2ABAA 4C5YA 2A6LA 1CLXA 3CV2A 3ORWA 3L23A 2AL2B 9CGTA 4PB5A 3MI3A 2PGWA 1A4LA 5GJNA 1DQXA 5ABEA 3KCLA 4PL1A 4QLKA 2B81A 3BW4A 3W7JA 3HOJA 4NSBA 4KGLA 1IZKA 4AQLA 3W6YA 3EDDA 3PWGA 4UR8A 3WF2A 2Y8UA 1H1ZA 3UCQA 1KM3A 1XL9A 1VF8A 2J7GA 4C60A 1CWYA 4DXXA 3T09A 1BRLB 4ECLA 2NWRA 3NNTA 5T9CE 3KEHA 3NEHA 6ENLA 3FGCA 5C9RA 1TR1A 1WO2A 2PDUA 5CKSA 3IS4A 2PTXA 4JDYA 1Q5MA 1TPB1 4O53A 4WZHA 3KLKA 1Q6EA 4M7SA 2GSJA 2XIQA 3G1DA 3N29A 1KRBC 4CVUA 4IICA 3P67A 1D8CA 2IQTA 5CSRA 3S42A 3VO0A 3AIRA 2YA2A 2DPEA 3PUDA 4IX2A 3QHNA 4O1CA 4F0RA 2QPXA 4BWLA 1JFXA 1SJBA 2BTMA 2XGZA 4B4FA 4HOZA 4R53A 4W88A 5I07A 1EQPA 4JKLA 1QNSA 2WK2A 2QGYA 2A3LA 3LD5A 2OG9A 3RM8A 3W7CA 3CIWA 3SB0A 4GCXA 4IGNA 4JTRA 3PR2A 4JX6A 1TJ2A 1R46A 1E0XA 5C6MA 3UR7A 3P14A 1WZAA 4XG1A 1WUFA 2XM2A 3VMNA 1S3TC 2TYSA 3GNXA 1XYAA 5A8QA 4M8UA 1UD2A 1XGZA 5C0QA 2X09A 4S3EA 1UKQA 3BOFA 3SFWA 5LIXX 4L4MA 3S6DA 3XIMA 3P81A 2FFIA 2J6VA 2P10A 2XGIA 3MSYA 4RZ6A 1OCJA 5BXPA 1VB9A 1VR6A 1AJ2A 3FIGA 1XCFA 3H53A 3NGJA 1J0KA 4DB7A 1KNWA 3MJYA 1FWFC 4LANA 3S0CA 1BLIA 1C9DA 3R58A 4Q4OA 4AYGA 1EC9A 1EA9C 2J6XA 5DCEA 3THCA 1QNPA 3V5FA 3VDBA 1K6AA 1O5XA 4O15A 3S1GA 2J4GA 3SO7A 1E1EA 5E6ZA 1LQ2A 3V0UA 4Q3MA 2NSOA 2XN0A 3W73A 3G18A 4PE8A 1VFSA 1NFGA 1KRMA 5D4YA 5I2UA 1PKYA 2WPGA 4LH8A 4YCOA 1T0OA 4ENLA 4MKNA 1ICSA 5ABFA 2PA6A 3S6TA 3BL3A 3E0LA 3AUOA 4C1KA 3C3UA 3M6YA 4KIRA 5DRIA 4MWAE 4RE0A 4ATWA 5BWAA 4UFIA 4PL2A 3FN9A 3TQVA 2FHBA 2P76A 4FLOA 3LV5A 4F0KA 4LVDA 1WZLA 1PIGA 4HTBA 3TYEA 4DNMA 3SY1A 4ZSTA 1TPEA 1DP0A 1QJWA 2HEJA 4DJDC 3VE9A 1VENA 4P61A 1TWIA 4RNHA 3AJXA 1B9BA 1NDZA 2C15A 4DN1A 3UXKA 5KZMA 1TIMA 3GW0A 3AIEA 3PTDA 1A5UA 3LCGA 2YW3A 3SADA 4KCUA 4IUGA 4U5KA 3VGFA 3D5HA 1CGXA 4GI4A 4D6HA 2NV2A 2OZ8A 3W7KA 1HVXA 1CGVA 1R85A 2XVGA 1VYRA 1XKJA 3A4WA 3CZEA 4NAFA 3ZWSA 4FLQA 4XVDA 4JIEA 4KESA 1DJYA 1LL6A 1QASA 4IFKA 2H3DA 1W9PA 3M07A 4AB4A 2DSUA 1QO2A 3IGUA 3V0SA 4DIAA 4JHOA 4CN4A 1VJIA 1JAKA 1W5OA 3H22A 4WHBA 5DMYA 3ZR4A 3GTXA 1V5XA 3THQA 2FH8A 3CTLA 4HPXA 3TYZA 1P0BA 2GQ9A 4JGDA 4RE3A 3PC0A 3PG9A 1KV8A 3CYVA 1B54A 3S5SA 1JFHA 1UWIA 1XDMA 3JUGA 5AZ1A 4RDVA 3QC3A 1IWPA 1E6RA 1BXCA 1KV5A 3HPXA 4HNNA 1NFBA 4FF5A 5CPSA 1OVDA 2C1HA 4BY3A 2R1NA 1DHPA 5CAHA 1C9WA 3SR7A 5C55A 3NQ7A 1UUMA 4XZBA 2WBKA 3UYIA 2B7QA 1CGTA 1M7XA 3IIPA 1B1YA 4GISA 1OG0A 4H00A 5A6KA 3NL3A 3ARWA 2CLLA 3AALA 1RK5A 4IL2A 1BWLA 5BU9A 2C0HA 5G1TA 4ZO9A 2HK1A 4EAYA 2PDCA 4G56A 2QQ6A 2E4TA 1YW1A 3RNDA 1EH9A 1R9YA 4PMRA 3LPGA 4AXNA 1KBLA 5FEXA 3FX4A 4GPNA 2OFJA 4JL1A 1NQKA 1J12A 4JN6A 2PEVA 3TJLA 3T05A 3KBJA 2Y8VA 4WEVX 2ZVIA 3GDRA 1IIGA 4HYRA 3HPFA 3Q45A 2FLIA 3OBKA 1ITCA 4FR1A 1K8ZA 3C0SA 5J5DA 3CH0A 1XFCA 2Q3OA 2OPJA 2ZX6A 3B9AA 5F4SA 1QBBA 1Q6FA 3LBCA 3TLLA 1RUSA 2OZTA 2WKGA 2O0TA 2X41A 2Q8ZA 1GOWA 4JCMA 2VHLA 3TOYA 4UQAA 3HQOA 4NP7A 2CLKA 2PDPA 4DYEA 4OIFA 1QI0A 3NSNA 3VGGA 3PK7A 1Z7AA 4M82A 5HJYA 5LZLA 4A8RA 3F7JA 3QOKA 3BICA 3VIMA 2EQDA 1XPYA 4NX5A 3LRMA 3HN3A 4FALA 4Q8PA 2X7VA 1RJQA 4DJDD 3OLDA 4HU3A 5C2CA 5SWUA 4DM1A 1POKA 4AEFA 3CBWA 1F4AA 2WMIA 1SZRA 2HSAA 5CPQA 4IXXA 2BNJA 1GHRA 3CJPA 3MUY1 4AF0B 3C2EA 4CVWA 3VTRA 4WGHA 5D09A 1W9BM 4MGGA 4LY4A 3DKLA 4LYKA 1JDFA 5CJMA 4UOZA 2W67A 3W37A 3OPSA 1LWHA 4EF8A 5LA1A 5C5YA 3OVQA 2DT1A 3OIHA 4QJ1A 4FR6A 5EL1A 1C8XA 2X1SA 1G7UA 3J7HA 4GXMA 1W8SA 4NNAA 3K8MA 3SQSA 2OU4A 5FJRA 1ZQ5A 4MNMA 2EG6A 4FIRA 3PBWA 4NRRA 4GVFA 5RUBA 1AMYA 3TXVA 4HZ6A 5FJTA 1NELA 2PWGA 2R94A 3VKBA 3AFBA 3G1SA 5D33A 1GOQA 3IJIA 3LXBA 4JN7A 2Z00A 3LZ5A 2WOQA 3SN4A 4CUCA 2BODX 1XIMA 1XYFA 3DFTA 4IPPA 1UWQA 1SW0A 3W87A 2HZGA 1YE6A 3A5FA 1PHWA 5BW6A 2X7WA 1OINA 3KWXA 1PKNA 5JVLA 2GJPA 2JIWA 4CEXC 3CYJA 2BSLA 3KBNA 2IKIA 4UOQA 1A0CA 1H7WA 5DY3A 3IV8A 4E6MA 2Z1KA 3OOQA 4MDOA 3KVJA 2OKTA 4DJDA 1EO7A 2ISVA 3M5YA 2OYKA 1DJWA 3A24A 1Z89A 4CQDA 2EJ1A 3EX2A 4G7FA 3IPWA 4B9YA 4YIWA 1E73M 1FWEC 1BKHA 4BQ4A 1T8QA 1Z6KA 3G24A 5JH2A 2V63A 3DXIA 3GXMA 4O14A 1UW9A 1UCWA 1ODUA 5K4ZA 3BAXA 5GPRA 2QUUA 4ZGYA 4NNCA 1RR2A 4W8AA 5MKGB 1UJQA 3PFRA 3URNA 2NWSA 4D6GA 1U5VA 1UA3A 1IGWA 4LQ1A 5EU9A 4W85A 4ZSUA 1QI4A 3LOTA 1ADSA 4DHGA 1SZGA 3R10A 2PLKA 3MO4A 4I3GA 3L5AA 3A3WA 1ZBCA 3VCCA 1Z3NA 1A80A 3IUHA 5EMJA 3GHTA 2HK0A 1YNQA 2A7RA 3M0VA 3OZYA 2PF0A 5M3WA 1W9DM 1PPIA 3CB8A 3RIKA 3DENA 3SUWA 3TV8A 1SO5A 2BVTA 1IZJA 3VDHA 1XRVA 1KM2A 4IIBA 4ZOBA 2QJHA 3GDLA 1AH4A 1F3WA 3IRDA 3FXYA 3KDOA 3W6LA 4KIEA 3DYPA 3T1GA 2ZDSA 3GVQA 4AWTA 3L0GA 3N34A 1QNQA 3EA1A 3VNKA 3CHCA 4DO4A 1QVBA 3TU9A 1JCTA 1OBAA 4RDYA 3M6DA 1W3TA 3HGOA 3GAKA 4MY8A 3MHUA 4YN5A 4LGXA 2PDQA 1KCZA 3LHVA 1OFEA 1N55A 4HA1A 4KF1A 1JD7A 1OC5A 2PPGA 2FJKA 3M9YA 8XIAA 1ML1A 5BMWA 3QH2A 3VZZA 1LROA 4N7QA 3CK5A 3IJLA 1BF2A 1ZAIA 2G3MA 3TN3A 1E6NA 4OFCA 7TAAA 3SECA 2GSHA 2DUXA 2WO5A 2ZUNA 3N2OA 4YXGA 1F3EA 3NGFA 3DHPA 4FLSA 5HDRA 4LWWA 3ALGA 4PTDA 2YLAA 3PZGA 4UMCA 3ERPA 2Y7FA 3VNMA 2DEPA 2XISA 3ITCA 3UCDA 4NASA 4E8CA 1RLCL 2VMFA 3H7VA 5B7ZA 3LXCA 5DBUA 4DXVA 1Z8AA 5KITA 2UV8G 1JPMA 2DZTA 1Q7QA 4XB3A 1MI3A 4Q7NA 2X0YA 2VEPA 1EP3A 3P62A 5F2LA 5KETA 4NL1A 1GVOA 3VC6A 3WLKX 4KWWA 2ZKMX 3UWWA 4ZFMA 2QDGA 1NARA 5GNZA 4LVAA 4FNTA 2XVNA 2O9PA 1QHOA 4ACZB 3M0IA 4YL2A 1LOSA 2Q3RA 3R7MA 1B5TA 4AD0A 5M03A 3GK0A 3H8AA 3G6LA 2R6OA 4QDPA 1F05A 1NH6A 4E4FA 4NJIA 2BGNE 4ICNA 1GQKA 3R0UA 4B16A 2XN1A 3IVSA 3N6HA 4J3ZA 1TV7A 4HQVA 4DO6A 3G3DA 4ZZ9A 2HS6A 4MPQA 4LRSA 3ZLFA 3EDJA 5FJUA 1B31A 4ONVA 1JPDX 1GQIA 4PMQA 3GKAA 1ITUA 4RKAA 4MZ1A 4AZCB 3V5CA 3G0XA 3NTYA 1EEXA 3PZOA 4PUMA 2IQ0A 3P61A 3U8GA 2ACQA 4IGHA 4F4RA 4JY8A 1NWTA 4O8RA 3W84A 3KAOA 5G2WA 3RX2A 3FAXA 3IWPA 4BS0A 3CAWA 3ITTA 2B7OA 2PDMA 3TN6A 1H41A 3HF3A 5LA0A 5F7UA 3PG8A 2ZUVA 1SGJA 3S2LA 2CETA 3II1A 4ZB0A 1GWJA 2BWGA 2PMQA 3IARA 2ATMA 2GUYA 2A3CA 1TPC1 1JG9A 4GVHA 1GPWA 3Q2DA 1VHCA 3AXHA 5D30A 3OEXA 4GJ1A 1BTCA 3QFEA 1OY0A 2PDGA 1CLKA 1QK0A 3B8VA 4ZA0A 1UHVA 1BG9A 3RLVA 4S3CA 3D46A 3E2RA 4WLCA 2QUMA 3U3HA 4PBGA 1P0KA 3GD6A 4RNFA 4IMDA 4LY8A 3W7MA 2FB3A 4YWSA 4B91A 2OX4A 2VCAA 4WDTA 3GM8A 5CJ5A 4FXRA 1MQQA 3F5KA 5D2VA 5FF4A 1TPDA 4UCFA 5AVHA 4EF9A 5A5WA 3VKAA 1VRXA 4V2XA 1A5LC 2HVOA 1DIKA 4BZYA 1EFZA 1MSSA 3PZ9A 5I77A 2VXNA 1UKSA 1UZ1A 4JS3A 3U0HA 2QUVA 3KBSA 2GDQA 5K9CA 4RXGA 3O07A 2VELA 3EWYA 4Q8MA 3SCNA 1AW1A 1NQ6A 1M53A 1FOBA 1IXOA 1MDLA 3VKJA 3WEZA 2VR2A 1PE1A 2IKJA 1AJZA 1R3WA 2GDVA 1X6UA 3THAA 1ADDA 2VX5A 3WLNA 1EJRC 1J79A 4E38A 4JTTA 3EMZA 3FEMA 2AQWA 3N4EA 4NU7A 3W1MA 3QQ0A 1DV7A 4MJZA 1GYNA 1CECA 3UESA 3CUIA 1W3IA 3RG6A 4X60A 4UTUA 4XK2A 2E9BA 4HA3A 1W1YA 2EHHA 4GYFA 1DJGA 2VVSA 4Z2KA 4ADSA 1QW8A 1I45A 3I3EA 3QBUA 3REQB 4LW7A 1OGSA 2YW4A 4H9MA 2VC6A 3MY9A 1X98A 1S2CA 2F9RA 4MB3A 2QNEA 5TBOA 4MG4A 1ISVA 2QCGA 3PJTA 2BGSA 1FWGC 2X40A 4UOJA 1YKWA 4LOCA 1ZP4A 2R1PA 1GJUA 1SZEA 3IAQA 4UFLA 3ZJ8A 3F4CA 1EJSC 1A5BA 2REQA 1K7FA 4I5XA 3RU8X 2VYOA 3GW3A 1SFSA 4HNCA 1MEIA 1MO0A 3NQDA 2VT0A 2XIOA 1QNRA 1G0CA 2JF7A 3WQ4A 2FZMA 1B4KA 1K02A 2WCAA 1M7OA 1IE7C 1R2SA 2ZC1A 2YSWA 4RJEA 2VUNA 3T0TA 1SJAA 1FKXA 4J2PA 4QIUA 1KRAC 1R7OA 3EMQA 3KWSA 4ZCWA 4UTKA 1OCQA 2PDHA 3L4VA 3HGRA 3IANA 1XISA 2DZUA 2YL6A 4A3QA 3ZT5A 3F4VA 3TTSA 4J5NA 5JH1A 3MCOA 1H4PA 3WBAA 3R12A 5D8ZA 3T9PA 3WUEA 5FF2A 1LLOA 2FTYA 3EEGA 3R11A 1OX5A 3PNZA 4CQAA 1Y7VA 4ICCX 1LL7A 1GEQA 4LFYA 1O5RA 3UA3A 4PUEA 2O7SA 4BEUA 3H55A 3BMXA 5I6SA 1TV3A 4UR9A 1D8WA 2XVLA 3NL6A 4NJKA 4NYUA 5F2MA 2E6DA 1KM4A 3I6TA 2O9RA 4WOQA 2CITA 2E7FA 2YCKX 3FYYA 2Z2BA 5E0CA 5BU6A 1VQTA 2FTWA 4ZOCA 3NUKA 2VEMA 1R38A 1KBJA 2VEFA 4XUYA 5AB3A 2A3EA 1NY1A 4AZ6A 1SZNA 3LERA 4FLRA 9RUBA 1H5VA 4XTDA 2I16A 2XH4A 4H3DA 4RX0A 2HE5A 3WQVA 3GR4A 4TV5A 3VZXA 3E6EA 4NZ3A 3B8IA 1WDDA 2ESCA 3MCNA 5JIPA 2QLYA 1XJBA 1SFTA 2YCJA 2YA0A 3CZJA 3CPUA 3L67A 4JEJA 3PULA 5T26A 3SUTA 1MXGA 1YHTA 2J9YA 6ALDA 1P4CA 2OLAA 3GHSA 2EPKX 2WMHA 4DUVA 3M0HA 1F6KA 1OEPA 1U1UA 1OM0A 4ZQPA 3WKZA 5I00A 2B31A 3AIVA 4D71A 2PU0A 4JYFA 1KLYA 3W2NA 4KCWA 4ML4A 2KX9A 3WMCA 3EWUA 3SDOA 3B06A 3QRHA 4LC8A 3NQ6A 4I9TA 3OLEA 4W84A 1YIXA 2OWXA 3I7SA 5FOOA 4E2OA 4MY9A 3BH4A 2E6AA 3WQ5A 4HZ7A 1FHDA 5AHFA 2PDWA 2YBUA 3AZTA 1UBSA 3I10A 3GC2A 3MHGA 4JNMA 3W75A 1VH7A 1DIDA 1A5OC 3TSMA 1XLHA 1Q6OA 1GKPA 1L6WA 1PUDA 3RXZA 3P84A 1IXPA 2WSYA 3GU2A 2ZWYA 1DJIA 3UA4A 3UR2A 1R9XA 3BLOA 5HXMA 5CJNA 3CHFA 3USZA 4AMCA 4TMCA 3NR0A 4K3ZA 4IWWA 4R88A 3W2UA 1OK4A 2JFEX 1UR8A 5ABHA 1SO4A 3S46A 1LZOA 1TVLA 3DHDA 1CENA 4RV3A 4AXKA 2BY2A 3K1GA 4CCDA 4HMNA 1IXQA 1QFEA 1V03A 1EO5A 2DQWA 3HMCA 3B0UX 1FFQA 1OX4A 3GU1A 1D3CA 1DQWA 2EG7A 4FNUA 4ZFCA 3BK0A 3VIHA 4QS6A 1CXKA 1JYWA 3A9BA 5A8OA 3AMCA 2YKKA 3H54A 1NTHA 5K7JA 2ICSA 2POZA 2BB0A 2X42A 4NAEB 2CLHA 5HK4A 3WLMA 1ZBKA 4ACYA 1MXSA 1JNEA 1XIFA 2EXOA 2OWWA 3KS6A 4I6VA 4MDPA 5CPOA 2PDKA 4AISA 1X38A 3D47A 3JR2A 3L65A 1YBQB 1E4MM 3VOCA 4AZIA 4J40A 3FXGA 1QRQA 4FK9A 4Q8NA 4MOZA 2OGYA 3DH7A 4GBUA 3C2OA 9XIMA 4O8AA 4O4VA 3BARA 5D2TA 1M04A 2VM8A 1EC8A 1JCYA 1TV4A 2VC5A 1ISXA 3POHA 4L65A 3OQEA 4DWSB 2JEPA 5DRCA 1GEHA 4BHYA 3CC1A 3TVAA 5HR7A 3GU9A 1ISZA 2CLFA 1E55A 2CBJA 5HAOA 3UPBA 3B4UA 3NO5A 1QPRA 3KOYA 2DDXA 1L6GA 1WXZA 4XBKA 1EZWA 3W1RA 2YLLA 5A6MA 4GGBA 1LG1A 5HNTA 1GVSA 2ZQ0A 3UWZA 4X9SA 3WQGA 4AHQA 4QG9A 3C5QA 2Z1VA 4WUIA 1DXIA 1OABA 1VYPX 3STEA 5E6YA 3BURA 3PPHA 1OCBA 4MM1A 1JCLA 1TPUA 1W1IE 4DLMA 2J79A 1YRRA 4BR1A 1UOZA 2CZ5A 2QCEA 2PI6A 1GUVA 1W0MA 5D2XA 6A3HA 3I6RA 3CUGA 3LSBA 3B9DA 2XIBA 1M1BA 3AXIA 2TRSA 4NZCA 1MQRA 2ZX5A 3G1HA 4AFYA 1RLDA 8RUCA 5FL1A 3FFSA 4UMBA 1XM3A 3TYCA 1XBZA 2HVNA 1IT8A 5AKQA 4O1EA 3F5JA 4NHVA 4QEEA 5FF0A 2VGGA 2EKCA 4UNIA 3W0KA 3PPFA 1AW2A 5DCDA 1A5AA 4KMQA 3SY8A 4QJ5B 1MEHA 3QQWA 3PBGA 4IF2A 1A5SA 2V9DA 4L1XA 3B9EA 1N7KA 4OJYA 2AL2A 4H41A 3QPEA 1ME8A 4IP4A 3KLLA 4IIGA 2ZFAA 1NOUA 1DYSA 1LQ0A 1A4MA 3CO8A 4JIRA 3VDAA 2DIJA 3E9AA 5XIMA 1V51A 2A79A 3NO3A 1YDYA 5IFPA 4HKPA 3CL7A 2INZA 1G4EA 4CD6A 2JGQA 2D0GA 2ZTKA 5EMUA 4JQ4A 3UG3A 4QJ4B 3AS3A 3W7LA 5HUPA 3EA3A 2ZZ2A 2X0HA 4IP5A 1KKOA 1BRLA 3G3MA 3S5OA 2PU1A 3I3BA 2VC7A 1F07A 4PR4A 4BI6A 1GVYA 1L8PA 5EMYA 1IHIA 5HATA 1VFTA 4LV4A 4Z42C 3GXIA 4EPDC 2I9UA 3RF9A 5FL0A 5EGRA 1T5AA 1MNZA 1R3VA 2QDDA 2B7PA 1W37A 1EGZA 1UKTA 1S5NA 4Q4PA 3WCZA 4MNKA 4IH3A 2F6XA 4QE1A 3VNJA 2IPGA 3WLIA 1Y8BA 1EYEA 4MB1A 3WD3A 1PWMA 1AH3A 5BXTA 1UWAA 1WAWA 3QV8A 4ZMGA 4E5TA 1WDQA 1K6WA 3I3DA 4IMAA 2HNHA 2VO5A 5FA5A 2QV5A 2QW5A 1SW3A 3HIJA 5K9XA 1XICA 3BAYA 4K37A 2Q09A 3N15A 2OQYA 4YHEA 3TIMA 4XKYA 3N04A 1GQNA 1NOFA 1MUWA 1D7KA 1EUAA 3EDFA 4ORMA 5CZSA 1T8XA 2FZDA 3ABZA 4CN1A 1X8FA 1KXTA 2JKPA 1EL3A 1W8GA 3AROA 1JZ3A 3QR0A 1XG3A 2PBGA 3JU2A 4TQTA 4N9EA 2FMOA 4GZJA 3LRKA 1LL4A 4XAZA 3L5MA 3E5BA 3EOLA 4C7GA 3WD4A 3TH6A 3R0KA 5K4XA 3TNOA 3G1AA 1PYFA 2Z24A 1WPCA 1OZQA 5A1AA 5A6TC 4YCPA 2J9XA 4Y9MA 1SSDA 1ZFJA 2VX7A 4E2VA 2CWNA 2WC7A 4QNEA 3WO8A 4PMDA 2I5IA 2Z27A 2J13A 4MFDA 3KP0A 3M43A 4M3PA 5DT5A 2WKLA 4W5ZA 1T40A 3TNBA 4L1WA 2YL5A 2BXVA 3TYDA 5EYWA 4J35A 4GY1A 1Z69A 4JR5A 4LXFA 3T2PA 4Q6JA 1SR9A 1H51A 4KRTA 3NZGA 1TV8A 3GQYA 3S1VA 3N2XA 3B40A 2RDXA 3TFXA 2PLJA 4B3ZA 1MWOA 4O16A 4TVDA 4MAZA 1H09A 3ARSA 1RPKA 4B5NA 1TPFA 3H2OA 2WAGA 3GHUA 3S2NA 4IFOA 1A49A 1GOIA 4D1JA 3P80A 1OSEA 3P5YA 3VU2A 3R8HA 3FOKA 3C0LA 3OGRA 3AU6A 1JPHA 4XV0A 3W71A 1UG6A 1XFBA 4CLMA 4L56A 3AU2A 3VX0A 4PTWA 5EKYA 4GRSA 1XYCA 2IKHA 3ZT6A 1JZ4A 1GGOA 1GOKA 3IVTA 3H24A 3VNDA 3SCVA 1GCYA 4P7QA 1S39A 3LX9A 4GFSA 3VNIA 1DJNA 2WPBA 2BDQA 3H2CA 5G4HC 3D3FA 4MJMA 4RW3A 2CNCA 4RLIA 1BWVA 1KBKA 2YIHA 5HPOA 2PDNA 4ZQMA 4ZBCA 2I56A 1QOXA 1UC4A 2W62A 1GTEA 3BGJA 1FHUA 4PTXA 1B90A 5DELA 1P0EA 2OOFA 3TN4A 3BPWA 4F3HA 3VMPA 3WBXA 3C2FA 1F74A 2DT2A 1HQTA 3RM4A 4JYDA 4M6PA 1V4YA 3V1PA 5DY2A 4CD8A 1XR2A 4GQ0A 2Z2UA 3EAUA 2NQ9A 4PN2A 1EGVA 4INFA 1R30A 1MMFA 1B3WA 1GNXA 2DZPA 2P3EA 3ZVIA 4O19A 4PSPA 4FMVA 2FGLA 1GOOA 3E2VA 3H2MA 4LYQA 3WEOA 3A47A 1PJ9A 1K4GA 3PJUA 1RBLA 4FNPA 3MI6A 4GI9A 5HUOA 2PCQA 2XG9A 5CGTA 3AQUA 1I4NA 3LPPA 5G4WA 4PMXA 1EBHA 1EGMA 2NUYA 4KETA 3EWWA 3BLKA 2P5NA 5A94A 1JPIA 3M0MA 4B3KA 1CW2A 2ZRWA 2I5GA 2DY3A 4FXFA 3F2CA 3HJZA 3P5ZA 1BSLA 1Y5XA 1RPXA 2GK1B 1VRDA 3GX9A 1J11A 3EOOA 1PS9A 1JZ2A 2QR6A 3H2AA 1UPMB 4EXAA 4WKAA 3GWQA 3KL0A 5U7SA 2Y85A 4C6CA 3WL1A 2RDWA 2J8GA 3IJ9A 3RLGA 4AVFA 1DIOA 1KTNA 1W3KA 2O55A 4LJ3A 3CAVA 1RY0A 3BOLA 3VIPA 4UMAA 1YADA 2H8XA 4IMEA 3ARXA 4LS1A 2FJUB 1J0HA 2BVYA 4H6KA 3BLFA 3QEZA 1Q6RA 3V5OA 3W00A 4NQ1A 2PLCA 1YYAA 1JL8A 5IDZA 3LGDA 3HPZA 2DZWA 3DBPA 3BXWA 1V6XA 2GQ8A 1YX1A 1THFD 4C6IA 4NZJA 4X63A 1ODZA 3N2MA 5D38A 5AYIA 1QTWA 1UMYA 1V0KA 4URIA 4UZSA 3QQ1A 4A4AA 2V3GA 1E51A 3W53A 2V5KA 4GLEA 2VDGA 2X0SA 1B3XA 4DI9A 2PF8A 4L6DA 2EPMX 2XZ9A 2QULA 3A4XA 1H50A 1H7NA 4C6NA 2X1IA 2PWVA 1DWIM 1E5NA 3QYQA 4RZ4A 1PX4A 2G4FA 1PDZA 2E09A 3FVMA 3TTQA 5J5RA 3RPDA 4ZL1A 4CQ9A 3FNDA 3L9CA 2PFHA 3LCLA 3GDTA 3BCDA 2YBVA 4JZ5A 1LJYA 2DQXA 3MMTA 4D6FA 5F4XA 4K1GA 1UD8A 3WLPA 3SFKA 1T96A 1V7AA 3WK0A 3T8LA 3G77A 3EBVA 4LUTB 4P8VA 3W38A 3CXOA 4Q8TA 2ASHA 2TMDA 1WA3A 1ZBWA 3EYPA 3S5NA 4AF0A 3HG4A 4FOJA 3W2JA 1RCQA 6XIMA 3GH4A 2QJJA 2DT3A 3L4TA 3I4KA 1LP6A 1UASA 1JDEA 3THUA 4XISA 1GPFA 4DAIA 1MUMA 1H7OA 4XD4A 3RFAA 3R6IA 3VKDA 2Q8XA 5AYXA 4XZWA 1Q2SA 2J8FA 3K13A 4MAVA 4H9UA 3LPFA 3AHTA 4KERA 3RRXA 3PVFA 4KGJA 1VIZA 3HJEA 3QC0A 1RQHA 1UR3M 2YXGA 4BF5A 4RDWA 4CD7A 4G8TA 4JTUA 3LLDA 4D8ZA 4GZ7A 4IPIA 4GUIA 4A3RA 3FEQA 4QFUA 5I23A 4C6KA 1LM1A 3ID7A 3G1FA 5E9AA 3K8KA 1RXOB 1I0BA 1DOSA 3GS6A 1XCWA 1W3NA 2R1MA 3CWNA 3DBNA 4HB7A 1XUZA 5CZ0A 4B90A 2IXVA 3UZ5A 3LK6A 4AIOA 4IIDA 1G1YA 4KCVA 3TW9A 1XYBA 3VMOA 2R1LA 3FLUA 1UR9A 4JAWA 3HV9A 2PDFA 1UC5A 2DUZA 2XH0A 3SJ3A 4Q8WA 4PUJA 1KLZA 1B3ZA 2QCDA 2WB5A 3MMUA 4UWMA 1TUFA 4LEQA 4HYVA 3T78A 4JIHA 3MUIA 3OU8A 2GJXA 4UTTC 3WDRA 3HFTA 5MKGA 3GIQA 1HIZA 4GYPC 3S9YA 4O0QA 3UP8A 1UZHA 3QW4B 1Y5WA 1A50A 5A2BA 4AD3A 3M4HA 4DY1A 3WFZA 3W81A 5LGXA 3S5ZA 4JYEA 4C6DA 4YTRA 2A3BA 4DUOA 3EA2A 3OJGA 1UP0A 4S3AA 1DE6A 1E0TA 4OBRA 3RX4A 1VD6A 4MADA 3R25A 1FCVA 2PRMA 3ZS4A 1E9YB 1GOXA 3ITLA 4TTUA 1VFUA 2QCLA 4Z1AA 2CLIA 1W1VA 1ENUA 1XCXA 3KRZA 2HWGA 3H2NA 3OP2A 2IUZA 4BKNA 1EEPA 1UMLA 3N1AA 4BFAA 5AYZA 4IL0A 4R34A 4XIMA 3LCXA 4F8XA 3N3MA 4YNGA 3PTQA 3C0QA 4GJIA 5H91A 4NIRA 3KTCA 3L4YA 2W3ZA 5HMSA 4XKMA 3RR4A 3T81A 3UZXA 2HTMA 2ZADA 5AHEA 2YCIX 1A3XA 3APYA 2G8ZA 2G97A 1JUBA 2DSZA 2PDIA 1FWRA 3CASA 2YL9A 3UY8A 2OQLA 2F6KA 2V5DA 2GGEA 1S38A 3BC9A 4S3FA 3TDFA 4S1FA 3U6WA 2P1FA 4FIQA 1JZ7A 3LQGA 4M81A 3PSVA 3MDUA 3FDKA 4PB4A 4EXBA 3U5YA 3VCRA 3IJ7A 1H0IA 3UG5A 4ZQCA 3NSMA 1NM9A 3V3WA 4IM4A 4S39A 3KOWA 3MV11 2Y6ZA 1UOKA 2PC4A 3BLEA 2ZX7A 3UWUA 3W70A 1KGXA 2OO6A 3GXNA 4MJ4A 3CQKA 3KTXA 4GA8A 3SZ8A 4ZQNA 1BPLB 1LQAA 2POTA 1ZPTA 4IXHA 1AMKA 5G4EA 3IK2A 3GNNA 2FPVA 3KVKA 4KEMA 5FIPA 1T6MA 3M1ZA 4Q22A 3GG7A 4JTCA 3V75A 5HA7A 2QIIA 3GUGA 1XIIA 2C91A 1E43A 1KR1A 2RHGA 4UTMA 3H12A 4J28A 4M51A 4K68A 4ZR8A 4N9BA 3VFCA 3FYPA 3BTNA 3OZMA 4NY2A 1KFLA 3S2CA 4Z1CA 1KW1A 4OOUA 5D05A 5I3GA 3PP7A 2VZOA 4IPLA 1E0WA 4AWSA 3C4UA 4LRTA 4AZCA 4C5ZA 3B8DA 3V16A 1ME7A 4TX9A 3TK7A 5AFDA 4Y9AA 3GG8A 1WXJA 2BHYA 2DJLA 2RDUA 2GZXA 3ZM8A 5CG7A 2CIPA 1EPVA 3OZPA 4B5XA 1REQA 1FH9A 4CD5A 5CEWA 1HJWA 2ZZ5A 2FFCA 2HDJA 2OWCA 1U5HA 3CQHA 4BQ3A 1C90A 1TE1A 1ZHAA 3QHMA 4OV4A 3G22A 3UJ2A 1EJ7L 5FCZA 1UR0A 4H4IA 3T0DA 2RGMA 4AY1A 1MEWA 1W6TA 2CU0A 3ES8A 3KX6A 1W5QA 4LTSA 3PJXA 2PTZA 3ZWTA 2GLKA 4OOZA 1E0UA 3C52A 1R3YA 3GIPA 3OLIA 3B0XA 1MFVA 3B0PA 4G6CA 3RO6A 5HJLA 3HPAA 5FAGA 3NO1A 1TJPA 4EX4A 2IPJA 2NVCA 1P6WA 2GSEA 3GFZA 3CHEA 5KINA 1BHGA 2ZRVA 2DJXA 2UY3A 5E0KA 3WMSA 1RJRA 2VGFA 3EPNA 3PS7A 4LNCA 5D37A 5AYBA 2WVVA 3APTA 1MYRA 4GXPA 4IIEA 1U33A 3BE7A 4XO6A 1LWJA 3RJXA 4V33A 5I0DA 3M5XA 3NG3A 3H6OA 4UTTA 3QSTA 2BV9A 2FTPA 1J0JA 4GWEA 3WH5A 2NX9A 4AVNA 4NF7A 4GYPA 4LCQA 4DUWA 3P0XA 1I60A 1F3TA 3VDCA 1A47A 1RVKA 3VYLA 4QDWA 4CU7A 2BFGA 2BY1A 3PY2A 3BCJA 5G1MA 3LNPA 1DWAM 3B04A 3UWEA 3IIOA 3L7RA 2VX6A 2WQPA 2REQB 3VKKA 3SGGA 3WDJA 1XBVA 8CGTA 3PBVA 3LBOA 1B0IA 1E15A 4GBDA 3EWBX 4GX8A 1K77A 3TR2A 1XYLA 4QE5A 3BZJA 3KCOA 1W32A 2BHUA 1TB3A 3FJNA 4YPJA 4JXCA 1ALDA 1IZCA 4R3UA 4TX6A 3WQPA 3BCFA 3Q37A 4JQ1A 4Y9OA 3REQA 3TCEA 1DWGM 4DWSC 4W7UA 3O2LA 4LALA 1Q6GA 4EE9A 4WIWA 2VWSA 4E3VA 2NLYA 3K4DA 4WOZA 1BQGA 3W27A 4ADUA 1XLCA 1FVPA 2FVKA 4YTQA 4XZNX 2V2HA 1FKWA 1O7AA 1JNDA 3OGVA 3GTHA 3VD4A 1Z42A 4JKKA 2XHYA 1U83A 2C19A 3HB9A 1V3KA 3HG3A 3M44A 3KBWA 3KS5A 1ELSA 4UUIA 1FTXA 2VGBA 3WQDA 4W9TA 2PRHA 4P8WA 4XD6A 4XTIA 4G1KA 3LY0A 3B05A 5BZAA 3NVDA 1Q7MA 3N17A 1EJUC 4FXSA 1KO0A 5CC6A 4DX3A 3EKGA 4GNKB 1Z48A 3CL8A 1BYAA 3MSRA 2EAWA 3CQ0A 4J9JA 5LNRA 4RZBA 4JOMA 3DDMA 3S5YA 4U33A 4I5RA 1E56A 4W7VA 1UUQA 4TV6A 4NZ1A 5D2YA 3T0CA 3EPOA 3EX6A 1ZUAX 3V36A 3LM3A 3BUVA 5HMDA 4FAMA 3VXGA 4LV9A 3MWAA 4X9YA 3ZLHA 2GGGA 4MPKA 3UJSA 2Z2AA 2V3FA 4AW7A 2J74A 2WXDM 3UEQA 2W91A 2J77A 2ZRZA 3VGDA 3T44A 4I90A 2C1GA 5D9MA 1EIXA 2V5JA 3W72A 3SCTA 4UNKA 4JTSA 4HSNA 5HQLA 4J27A 4L4OA 2GGJA 3KBVA 1XD1A 2ISFA 2TPSA 4L61A 4R7WA 3GFXA 4K1WA 3DI0A 3CIVA 4AMAA 2I1OA 4ORIA 3QTPA 1FXPA 2DSVA 1WZKA 1V77A 5HULA 3UFYA 3GXDA 3L2MA 3URAA 3EDKA 3UPMA 2ISDA 3T7VA 3PBYA 5LHEA 3FS2A 1CTNA 2G0WA 5EB8A 2UWFA 5FSEC 3RAOA 3LV6A 1V79A 1R5YA 3VNYA 3N6QA 4W5UA 4DBDA 4M1BA 2AAAA 4OUEA 2F8QA 5EA9A 2DGAA 4IJCA 4N2YA 2W79A 2YDRA 5FEWA 1V02A 3CUXA 3VM5A 3QTGA 1XRSA 3E1F1 4HN4A 2O56A 3OB8A 1TUXA 3AIWA 1TPVA 4R9OA 5BCAA 1I1WA 4B5VA 5I78A 4LS0A 1RAKA 2QKFA 3FSUA 2WMKA 1HP5A 1OX4B 3UETA 2BOGX 4G1NA 1M65A 1WUEA 1SJDA 4K38A 5FEZA 1HX0A 1C8YA 4LVBA 4QSFA 2DVUA 3P7YA 4DWSD 5HNNA 3UVIA 1K7EA 3RLUA 1RVGA 1SMDA 4ATDA 1KGWA 3WNOA 2E28A 3T4WA 1GVIA 5D04C 3BLPX 2WANA 4M24A 3TQ0A 4DJFC 4GG9A 1TWZA 3GG0A 3U4AA 1M01A 3OBAA 3S1XA 3DG3A 2GUBA 4DPPA 1CGYA 3L12A 3UXLA 3N4FA 4C90A 5LSMA 1F5ZA 3ZOAA 1Z44A 4R7OA 1W3LA 4WJXA 3N11A 1I2NA 3I7RA 5D2WA 3CPRA 3KXQA 4NZFA 3GZAA 4KFOA 2WV8A 2MNRA 1O95A 3DC8A 4GFIA 5JQ9A 1UD3A 1GVEA 5KZEA 2PODA 5K9DA 5C54A 3MUAA 1DJZA 2PZNA 3G6MA 2W9MA 2FPTA 5FI8A 4NAEA 5CLWA 4QSHA 4ZODA 5KEZA 3PZUA 4PA8A 4P5UA 2OCZA 3DHFA 4W89A 2QAPA 1XIBA 4XO7A 1YBQA 4UFHA 2ZA2A 4IIFA 2YDSA 2VZVA 3W7QA 2XIMA 4MKVA 1G4PA 4KKXA 3IGSA 3PZQA 1RA5A 7TIMA 2CLOA 5REQB 4C65A 3NVTA 3UYCA 4WCJA 1XC4A 4DWSA 4Q4SA 3H4XA 2I14A 4FO4A 2GFTA 5C71A 1E5JA 1ZBVA 1VZWA 3QF0A 3AWNA 1UH4A 2WZHA 3GZ3A 3H23A 1J0YA 3NQCA 3AIQA 3LGEA 4PTNA 4O11A 1NEYA 1J5TA 3EOSA 3VA8A 3V1HA 2DZBA 2TAAA 3NPUA 4HZ8A 1R6WA 1FWNA 3ABOA 4UIOA 1NIUA 3EXTA 4CNSA 2XGBA 3IAPA 4KEZA 4WR3A 3L0NA 4L9ZA 1GVRA 1FQ0A 5LXEA 3N25A 1KM5A 4GOAA 1E4LA 2INFA 3GH5A 4PTVA 1FWWA 3LMZA 4E0CA 1TQXA 3NDYA 4NT0A 1XYZA 3PBUA 1P48A 5FJOA 4CN6A 2E3ZA 1IEQA 4J2MA 1CIUA 1KGUA 3C0JA 3CB3A 4Q7IA 3C2YA 4C6QA 4WXZA 7CGTA 1XLIA 4ERIA 3BAIA 4J3XA 4PBEA 1V6VA 4DF1A 3O3RA 5KTLA 2W0UA 4ML9A 4QS5A 3R5EA 2DV0A 2A5HA 4AIEA 3M46A 1W1B1 4A3HA 4QQUA 4WK9A 5IBXC 1JXKA 2QUTA 3WEMA 5C7HA 3NDZA 4HU8A 3M41A 4HPGA 1S5VA 1A0EA 2VP8A 4E4PA 1UZ4A 3LLFA 2Q02A 2VQTA 3BG5A 1JQXA 4WKFA 1QWKA 3VGHA 4F2UA 4H6EA 1VEPA 2V0TA 2C14A 3CAKA 4DJFD 3BLDA 1OC7A 1RP9A 4WGXA 4P7OA 1ZJBA 3LHYA 3PNUA 4HIBA 4OE7A 4CQBA 4LC6A 4PRRA 4IZGA 3P8IA 4XKYB 1SJCA 3EX3A 1V0MA 3T42A 4QLJA 6PTDA 2C13A 1TRIA 1JCMP 2V68A 4ZEPA 2XH7A 1XD0A 3MDWA 2E1WA 4WSKA 2JALA 4WVXA 4J3UA 4PFMA 4IJRA 4MJ2A 4GUHA 3TQKA 4NNBA 3MSDA 5DXYA 4D6DA 3C3NA 4XZIA 4GUFA 3QKZA 4NZ4A 2FH6A 3BLIA 5DT7A 2VD8A 1P6BA 3EWZA 1BVWA 4B5WA 3LDVA 3WQEA 3G1RA 1HJVA 1PWLA 2YJQA 3R2GA 2AKMA 2PB1A 3GVGA 7REQB 3UGVA 1H3GA 2V6AA 2G3NA 2PP3A 1G5AA 3QV9A 2OZ0A 4Z08A 1JZ6A 3ZVHA 3PWAA 4AZHA 1M3UA 1AG1O 4UFKA 3DCPA 1K9DA 2YOCA 1K9FA 3JZEA 3BZGA 2HE8A 5HNRA 2WMFA 4KFPA 1QI3A 1ZRQA 1Q4WA 1YPIA 3OW1A 4YVXA 4YTTA 1ZSXA 1VKFA 5CCZA 1OFAA 1W1ZA 1KM6A 3FK4A 3RYSA 1E6ZA 3MPGA 2QF8A 4WY0F 3RMJA 3WJZA 4B5SA 3L4XA 1S5TA 4NX0A 2JQXA 4DJFA 1JYXA 1UIPA 3VGEA 4LAZA 1VGAA 2ZTJA 5CSUA 4J7RA 1TCMA 4A2RA 2Q8LA 2CBVA 2INEA 2BXZA 4IIHA 2CWXA 1QXLA 4QDMA 1O1HA 5FKYA 2A3HA 5LGZA 4Z17A 5LXXA 1JRBA 3DU0A 2Y70A 1A3HA 3PANA 1OB0A 1VBGA 3G1VA 4WKHA 4X22A 1H49A 3DYOA 3MZ2A 4F0SA 1PO9A 1NDWA 1CB2A 5K2ZA 1V02E 3T2OA 3LA4A 2ZYFA 3UD6A 3WQ6A 3PBMA 4O1DA 3AYVA 3CIXA 3RILA 3EWXA 2ZVRA 1BXBA 3DFSA 2WVUA 3E0VA 1EJWC 1XLLA 1C8VA 3HQNA 1PEZA 3QM3A 1PV8A 3W7PA 3GHRA 4OU1A 3FKKA 4QROA 4BQ5A 1W31A 1TJRA 3W9ZA 3JVAA 4FX8A 3WUGA 1I1XA 4P7LA 2WW5A 2C1IA 5A6LA 1JYVA 1H0GA 1RA0A 4QISA 4EWND 4HSHA 1EJVC 1PL9A 3CL6A 1N82A 4CCCA 1HO4A 1I0DA 1PZ1A 1CBGA 2FHCA 1H7RA 2IKGA 4Q4RA 1JR1A 5G2IA 5HMFA 3IV3A 3W85A 3P6LA 3CTTA 1SUXA 4IMFA 1WE5A 3S1WA 1XHGA 2ZUUA 4AHOA 5FEPA 4MNJA 4ZOAA 4V15A 1ZU8A 3MQTA 1FDJA 4XZLX 1C3FA 1VHNA 5CPMA 3SGZA 2I7GA 5J04A 2WHKA 1UH3A 4GQRA 5J8LA 3U2ZA 1IT7A 2V3EA 1JDDA 5BRBA 1TIWA 4DM2A 3SCRA 2ACRA 1UD5A 1KKRA 4ERGA 5C9XA 4QBXA 1NWUA 2WLYA 4IT1A 5E09A 3DYMA 1SU5A 7XIMA 1IIHA 1DXEA 2AAMA 3GBDA 1A0DA 1XKYA 4GUGA 3AMKA 2IPFA 2O9OA 4NJGA 3A3HA 3BGAA 5AY7A 2VFFA 1UP3A 4XBJA 4D1IA 5LNVA 3WNPA 4E4UA 3TKFA 1JJKA 5CSYA 2PCEA 2VX4A 1HW6A 2DW7A 1J93A 1AQMA 4OECA 1ZY9A 4PH6A 3CZ8A 4GIAA 1ZAHA 1C93A 5CLTA 2E6FA 1HJXA 5LNSA 3TTEA 4Y96A 2OSYA 3O05A 4BF9A 5IBXA 1I8JA 2C18A 1TTJA 3U7VA 2GK1A 1XGDA 2RAGA 4H9XA 1TG7A 4D2JA 3P0WA 4TUFA 4GE8A 1OWQA 4AY7A 5DMLA 1LOLA 3MUZ1 4M6QA 2H90A 4XVEA 4DELA 3VILA 4IMCA 2PDXA 1AD4A 3PZMA 2ZZ1A 6XIAA 2EGZA 3CEPA 3EB3A 3SCPA 2OT1A 3GXFA 4B5TA 4AIBA 1DJQA 1QNOA 3S3GA 5JMUA 4WQ6A 1LBMA 3E96A 3S1UA 5FAJA 3L4WA 3KRSA 3W28A 1FHVA 1UBPC 3OVRA 4HHHA 4M19A 1IGSA 4H01A 5H2ZA 3SQLA 2KAUC 3MT1A 1FBAA 3UU0A 1B57A 5DMNA 3ARZA 3KM8A 3MUCA 3WDQA 2QMJA 3K2GA 1DBTA 3WF3A 4K2SA 4PRWA 3W01A 1SYTA 1KFBA 4JFSA 3B9NA 2J75A 2W4XA 1EBGA 3TMLA 4AD2A 3WQFA 1PTDA 5BMXA 2VNCA 2OEJA 4GH3A 1R9ZA 1VAHA 1W56A 4W87A 3KP1A 1RH9A 3TN5A 2C3ZA 1AFSA 4HNTA 3AHXA 3L66A 5DBTA 5I3FA 3DN5A 4KWVA 3FHAA 3SAZA 3KZPA 1FUYA 1F6YA 2WMGA 3BSMA 2YX0A 4JTHA 4Y90A 1OFRA 2CZDA 2R1KA 2VFHA 4CEUC 2X1UA 1F3XA 4HMEA 2FZ8A 2PWEA 4DBUA 1YNPA 3E3HA 4ZOEA 4DZAA 4L6HA 3AS1A 4Z0JA 3NEVA 4LAKA 5AC8A 2Y24A 5AHIA 1EP2A 2XSAA 2WHJA 5U4NA 1IXNA 2IQDA 1WZMA 4LUTA 1GK8A 5H8UA 2J9ZA 5L9FA 3ENLA 1Q13A 4OT7A 2DU2A 5I3JA 1GT8A 1X96A 2W66A 3DESA 2G3FA 3A13A 2D3NA 3NM3A 3SN0A 2GJRA 1TMHA 4DYJA 2C7FA 1XC6A 1Y65A 2WSPA 3ARVA 3OVPA 2AOSA 4GIEA 2WM1A 3I65A 3RDKA 1AH0A 4RPQA 5FF7A 1AVAA 3O6CA 1VCFA 5AC6A 2V2DA 1RHCA 1XSKA 2JEQA 4K8HA 1P7TA 1RSCA 4MZYA 4K6AA 3QKEA 4BA0A 1CYGA 1E9LA 1DVJA 1EWDA 2MUCA 2QCDB 2W61A 4RE4A 4JDBA 3UNDA 3SEPA 4QRNA 3VKCA 3A6OA 5EMMA 2GJXB 1P0DA 4TVUA 4ATLA 3ARTA 2EPHA 2PP0A 1U22A 3RUBL 3FA3A 3UW6A 4UQBA 1RBAA 4W8BA 1XLBA 2YDAA 1ZJAA 3NPVA 1WKDA 3W07A 1DE5A 4HNVA 4Z2JA 2CPUA 3THDA 3GFYA 1R0MA 2GVJA 6REQB 3T08A 3NQ8A 5G1YA 1EHNA 3PFMA 1ICPA 3T40A 3C2VA 4ZENA 2OR2A 1ZNNA 2VEKA 3UF9A 4OV9A 1JF6A 1CT5A 3QHOA 3RITA 3WSUA 1AODA 4JBRA 4Z2GA 1US0A 2PRLA 3FJ6A 3AHZA 1EX1A 3W7RA 4IISA 3OHMB 1P43A 4EAMA 3WBYA 2CHNA 5HJXA 1OYCA 3HGJA 1OC6A 4E8DA 2RFGA 2Z0IA 1IWBA 3NFUA 3CHVA 5HNUA 1BXNA 1HG3A 3NDOA 1IQ8A 3M0ZA 2VUYA 2VZUA 3PSWA 1UR4A 4PULA 4GH1A 3ARRA 3CH9A 2X16A 1E70M 1BQCA 3ONBA 3WJWA 2PE4A 3VINA 2F2HA 3UPWA 4JIQA 3STPA 4GK8A 4YS1A 1VIWA 4QR6A 3B8TA 3IJ8A 4WX2A 2NVAA 1NWRA 2ATSA 3GR7A 5BOFA 1DKWA 1YPFA 2QZRA 4GQQA 4KEUA 5CBIA 4EWJA 3E02A 4HNUA 5JUVA 1JUKA 1K8CA 5DN1A 2FGZA 3LNMA 3LBMA 1EA0A 2BASA 3R79A 1TVNA 4DJEC 4ASTA 3VZYA 4ZQRA 3CUJA 2OLHA 1NDVA 3C6CA 2G3IA 4U31A 4ROPA 2P8CA 1WAUA 3EOEA 3VIIA 3N9SA 1EDQA 1US3A 2EKGA 4WDUA 4F0MA 4O18A 2GWNA 4O4WA 4TMBA 4AU0A 1E71M 4OGZA 1LT7A 3QXBA 5TQLA 1EDTA 2Y5EA 1A5KC 1V6UA 4C7FA 4JX4A 5EMLA 3TR9A 1O1ZA 2ONEA 3C61A 4O54A 2Y0FA 4D6CA 3WL0A 4YMZA 1GVFA 1G67A 2PGFA 2E5DA 2NXIA 2Y88A 4PMZA 3EGJA 3O16A 2WZIA 4W7WA 2NZLA 1FWSA 4H2CA 3OA5A 2HJPA 1OF8A 2RUSA 1F61A 4HA0A 2J25A 3MHFA 2CXGA 3DHUA 4PCFA 2OJPA 3G5EA 5I3DA 3VC5A 5IFTA 3CZLA 3WBEA 3MUXA 2XZ7A 3UJEA 1BVZA 3B8UA 1HT6A 2YCLB 1J0ZA 2WVTA 3GE7A 3N3TA 2WJZA 1QI5A 2D22A 3URQA 3TQPA 3LLXA 4PGLA 1HKKA 3AHVA 3F4NA 4JFVA 3GXPA 1SZFA 2IS7A 2PGEA 5DCBA 1EPXA 1HKMA 3S47A 1FWHC 3W1PA 2OB3A 1LT8A 4LU0A 1YXCA 2GQAA 1LRQA 3A21A 4E2BA 5M5DA 3NYZA 4O1AA 3EB2A 1JD9A 1A53A 4U3CA 2VOTA 1REQB 2BVDA 4XZ9A 4XX6A 4U2ZA 4DO5A 2YDQA 3QN3A 1NF0A 4DEFA 1EP1A 2X8RA 2OXNA 1JCXA 2EJAA 2HV5A 5E70A 5K3VA 2DZAA 1L6FA 5HBFA 3LTPA 3CZGA 3SGUA 4NXSA 3NPXA 4P7NA 1OFBA 3KOXA 2ZE3A 3ICJA 3VOHA 2PDLA 1XI3A 2GVEA 4X2PA 2MANA 1E6XM 3O0KA 4NRSA 2DFAA 3DFHA 2ALRA 3GLCA 4G7EB 3AXMA 3ANVA 3MKVA 1GYLA 2Z1BA 2BOEX 1F8MA 3F2BA 1KD0A 1B3YA 4K7YA 1VBUA 1VBRA 3SIZA 1DTUA 1QMLA 1W2VA 4QQ3A 4ZTYA 1TSIA 2WVVB 3WNNA 4ZVJA 3VD9A 3DFQA 4UC5A 1X39A 5D03A 3ZJ6A 2QCNA 5F1VA 2VFDA 2DIKA 2BBFA 1CXFA 4LSBA 1HGWA 4Y9NA 1J9YA 1BD0A 5EFFA 4S2BA 3TX9A 3GVRA 1TJ0A 4QAWA 1E9IA 4OBSA 2PS2A 3RJYA 4KRZA 5C8BB 3BJSA 4DJED 1PCKA 4IHCA 2ZXQA 2AQVA 4U4MA 5EBAA 1D9EA 2VZSA 1WDRA 1G7VA 5D9PA 3NZPA 3QPZA 3T0AA 1AL8A 1TMQA 4IG2B 1XLFA 1US2A 3WZ0E 1VFHA 3UCCA 3RO8A 3FY1A 2XWEA 4MSSA 3TYBA 3LN3A 3B3DA 4L6OA 3R8RA 1Q6LA 3KL3A 2X30A 1HJQA 3T4CA 3RU6A 6TIMA 3L21A 2R9RA 3E49A 5G5IA 2HRWA 5A8MA 1L6YA 1PYMA 2V2CA 2XINA 3ZMRA 4DWDA 1OQFA 1SFJA 1QPNA 3IGHX 5JXQA 3PUOA 2QMKA 4F0HA 1FWBC 1FY6A 3ITYA 1FWCC 4GQBA 4WSHA 3ALFA 1X7IA 4GGHA 3TCSA 3EMCA 3N13A 4MB4A 3AMLA 5ABGA 4EIVA 2J7EA 5LA2A 5GVJA 4Q6XA 1ZJHA 2OEMA 2HXTA 2WSKA 5I3HA 3RRAA 5FSDC 2E67A 4UTIA 3CNYA 1W5MA 4FNQA 4ZE4A 1E40A 2IPWA 5EMKA 4ZB2A 1M03A 1QI2A 5XINA 1XYMA 3GDBA 3VGBA 3MBDA </