1TV7A

Structure of the s-adenosylmethionine dependent enzyme moaa
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
total genus 108
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv7A00
3KVLA 1SU5A 4FXSA 1A5AA 4XBKA 4O4WA 4IMDA 3LM7A 4N9DA 2C0AA 3SW6A 1JCLA 5D33A 3OA3A 1GTEA 3L67A 4UR7A 5EY5A 2A7NA 3DFOA 1LYXA 5F4WA 4NU7A 2V0TA 3QMTA 3HG4A 4JTHA 3B0UX 3R8RA 3KXQA 1NF7A 1M7OA 2V2CA 1EEPA 2QCMA 3FOKA 1TPB1 3W1PA 3KHJA 1QPNA 2EPHA 1F74A 1ZENA 4ZMGA 5LKYA 1PIIA 2XFWA 2ZZ6A 5I3IA 5G2HA 4WD0A 2WOQA 1JUBA 4PODA 2E77A 2YXGA 1ZALA 3B0VC 3NQAA 1OFDA 2ZQ0A 1SR9A 3QRHA 1O60A 1H7WA 4Z1CA 1IXNA 1XDMA 1G4PA 3HG5A 1TTQA 5CPLA 3P60A 4DF0A 1SUXA 2GJLA 5C5YA 1UBSA 1BEUA 1XC4A 4WJEA 2GJNA 4XTIA 1OF6A 3HPSA 3UY7A 1L6WA 3NQFA 3LTYA 4JS3A 5CPNA 4TMCA 4MLRA 1G7VA 4DF2A 4QSHA 2QCFA 2TPSA 2CLIA 4RXGA 1K7XA 3H54A 4YXGA 3NPVA 5AFDA 1R2SA 4K38A 1ZAIA 5D2TA 4DBDA 1THFD 2PURA 1I2OA 3W83A 3QMRA 3OG3A 1W3NA 3EX2A 3QMSA 3I7RA 4FNPA 5H2ZA 3BGJA 4GJ1A 1OX5A 3CLMA 5LGZA 2Y7DA 5EYWA 5G1TA 1DJNA 2V2HA 5HR6A 3PBYA 3NO5A 1OFPA 1OX4A 1HFBA 4MLJA 3W85A 2PRLA 4FIRA 1ME7A 5BMWA 1CX9A 1I2NA 1L9WA 4GNJA 3L0NA 3DGRA 5DCBA 3N3MA 2CLLA 2R8WA 1F5ZA 5FF0A 4FNRA 2OX1A 2CLHA 1X6UA 5I3JA 4RJEA 1HO1A 4RK8A 2A1YA 3TSBA 3TKFA 1GJPA 1LOLA 4AHPA 1JRCA 3IGSA 1S5WA 1U83A 2VFEA 5J5DA 1K3UA 3E02A 2QJGA 2NLIA 2J24A 1OFRA 3A24A 3G1DA 2ZBTA 1JQXA 3CTLA 2DZVA 4UMCA 5D2WA 4BI7A 4UTWA 5DXYA 1QPQA 1AW5A 3LHTA 3BARA 3T40A 2DZUA 6TIMA 3PB0A 4S2BA 1DQXA 1GOXA 1O5XA 3LX9A 3FKRA 3LCXA 3BG5A 4OU1A 2I9EA 3W1XA 1OK4A 1PCKA 1XBZA 4AH7A 3GX9A 3G8RA 2WJZA 4LUJA 3LLFA 1KTNA 1SZGA 3QPYA 4GUFA 4RV8A 3CIXA 3WJSA 2EGZA 1FWTA 4Y6GA 1SFLA 4ZQPA 4JN6A 2Y88A 1F76A 4HNUA 1T0OA 5FEPA 3W7LA 2CW6A 2QDGA 2WNZA 2OZ0A 1WYIA 3VCRA 2NUWA 1FCQA 4HNNA 5KMYA 3GXPA 4MJMA 3PF3A 2P1FA 1TPC1 3LTSA 5DCDA 1IF2A 3TDFA 5HWNA 3CU2A 2KZHA 3W7PA 3PY2A 2ZA2A 3HMJG 5LGXA 3OEXA 3UWZA 4MY1A 4JGDA 3BPWA 1WX0A 1PHWA 4LRTA 1HO4A 3QJAA 2WPBA 2H8ZA 1YDNA 5AN7A 1HUVA 3C3NA 3FFSA 1QR7A 4QM1A 4GUHA 5D2YA 1E51A 1SZFA 3SGZA 1XL9A 5BNKA 4MFEA 4AHOA 2V30A 3OVRA 3ABSA 3PUEA 2V2DA 1YDVA 3W7IA 1SW7A 3BW4A 4MUZA 4PTNA 1W5MA 3NYZA 5G4WA 1N8FA 3S5OA 3MP4A 3NPUA 5C2XA 2WV8A 4LS0A 1VCFA 3DU0A 3SZ8A 1JCMP 5BMXA 4YCPA 1FX6A 1N7KA 2B7QA 1P4CA 1ME9A 3W1NA 2ZTKA 3LXBA 1KFJA 2ISVA 1GWJA 5FEWA 3WJZA 4O1CA 3TROA 3IV3A 4OWGA 3QM3A 4LU0A 1KBJA 4LVAA 4I7UA 3MI3A 1EP3A 3N14A 1Z41A 4MVAA 4R33A 4DQWA 3SI9A 3TXVA 1Q6OA 5AHLA 2A2IA 3B4UA 3S8HA 5CZTA 3EXTA 1P0NA 1TB3A 3A22A 5G2WA 4E0CA 3S5NA 3O6CA 4HNTA 1F2JA 1MEWA 4QQ3A 3TW7A 1OK6A 3VE7A 2HSAA 3G1AA 5EL1A 1LRQA 3P62A 3I6RA 3CHVA 3M6YA 3UXDA 3EKZA 4HSNA 2A4AA 5AHNA 4JIPA 1ZAHA 2PRMA 1MEHA 2Y85A 2XN2A 4ICNA 4YLWA 5I3KA 4TIMA 4FX8A 1W5PA 3W76A 3TAOA 1SSGA 3W1TA 1LBMA 1N55A 4PFMA 2C18A 1IGSA 2NZLA 2QJHA 3S1WA 3LHWA 2Q3RA 4WX2A 3EX4A 3TC7A 3K30A 3L65A 4C1LA 5BRBA 1W5OA 1ICPA 4RZ6A 1AMKA 4N9EA 4Q33A 1GG1A 4MFDA 4O28A 1TPVA 3LBMA 3GKAA 4WQ6A 4R34A 3HG2A 5KITA 4NJKA 1FWWA 4TO8A 1WA3A 3MI2A 1AL8A 3THAA 4R53A 1U5JA 1FWSA 1H7RA 2PRHA 1MSSA 3IIXA 4DBEA 2O7QA 4O0ZA 5A8GA 3LXAA 4K39A 4MKNA 3L21A 2C15A 7TIMA 3UZ5A 5KZDA 1H7OA 3NNTA 1AG1O 3M5ZA 5F1UA 3TX9A 1KBIA 4YMZA 3O8AA 1DVJA 1XFBA 1RQEA 1OFOA 5AC6A 2HMCA 4E2BA 1DKWA 3P80A 1GT8A 4N02A 3ATYA 1KLZA 1QCWA 1FCBA 4P61A 3C56A 2HS6A 1W1ZA 4JTUA 1EWEA 1VYRA 4HT3A 1F73A 3HB9A 3R5EA 4Y8FA 5LHEA 3C4UA 1W3IA 2JKPA 3P5ZA 4M5PA 1Q45A 4C1KA 1BKSA 4AEOA 1EP2A 1I8JA 3UPBA 3MO7A 4OGZA 2QAFA 1JVNA 3IIPA 5C55A 4DO4A 1FDZA 1K02A 4LNYA 4JY8A 2VFGA 1MZHA 4NUWA 2GVJA 1MXSA 2TSYA 1R2TA 1W31A 4WY0B 3DFTA 1R46A 3HJZA 3MW7A 4IMGA 2ZYFA 4O8RA 3W71A 5D02A 1RVGA 4JXCA 4HHPA 3NM3A 5HNRA 5K3VA 3G18A 3WK2A 3P74A 4FO4A 1OFEA 2QCDB 4NX0A 3TFXA 3QH2A 3QF0A 2VOMA 1GVOA 4M19A 3NL3A 5FI8A 2ZRZA 3NM1A 3HGJA 1KFLA 1LBFA 1XBVA 4IMCA 1L6SA 4MZ8A 4UTWC 5LNUA 1QPRA 1SQ7A 4OV9A 3P61A 3W7HA 3W1RA 4FXRA 1G7UA 3NOEA 4GUIA 3TQ0A 4JTEA 4AHQA 3NQEA 5CPMA 4JY9A 3CEPA 4Z0SA 1HL2A 1FWNA 3EB2A 3F03K 2R94A 3OVQA 4UTLA 4LS1A 3W7JA 3AO0A 1RQBA 2A6NA 3PB2A 3NL5A 5AHMA 3SECA 2VKZG 1IIHA 2RDWA 1FCVA 2ZZ1A 4AF0B 1FY6A 4LWWA 2A21A 3L0GA 3GK0A 1PCWA 4O16A 2E6DA 3SIZA 1SZEA 5K9DA 2A85A 1JCXA 1TRIA 5EPDA 3SJ3A 2BX7A 1ME8A 1LOQA 1TRDA 3RFAA 2FPTA 3MUXA 4JD4A 3GKFA 1J4EA 3DHDA 1DHPA 3UQNA 4QNEA 1KM1A 3U8GA 4LVFA 4JYFA 2FDSA 3S9YA 2NV1A 1OVDA 4ZZ9A 2DJLA 2QKFA 2ZFAA 3TK7A 1VS1A 1OF8A 1TTJA 2CLEA 3MMTA 1ZY9A 3TQVA 4RKAA 2BSLA 1LLWA 2FJKA 3TCEA 5I3HA 4N4QA 4IX2A 3NL2A 5IM51 5DY3A 3B04A 4NZFA 4MZYA 2A0NA 1WV2A 1VC4A 5A5WA 3W1AA 1C29A 4K6AA 2C6QA 1W0MA 3V1PA 3PULA 1P1XA 3MP3A 4WOZA 1W3TA 4FNSA 4O4VA 2ZRWA 4KFNA 3HPZA 3TE9A 3NZ1A 3DKLA 3S1UA 2A7PA 4JEQA 3QPZA 4KWVA 5G2IA 4O1AA 1ZHAA 1K8XA 3OBKA 1H5YA 5D37A 2RHGA 5DN1A 3RNDA 5BW6A 3Q37A 2X30A 2E5DA 5I3FA 1CW2A 3ABRA 1SZNA 4UFLA 3EXRA 3KVKA 4IJBA 4LC6A 2JGYA 1JCJA 4X9SA 3KVJA 3LRLA 2TYSA 5F4SA 3JS3A 2E5CA 2J9ZA 5K4XA 4JTLA 4JTGA 2NX1A 4FEZA 1GVQA 4CCDA 3KRUA 1YDOA 2QF7A 1F05A 2BXVA 1FWRA 1B4KA 4JIQA 2FIQA 4KFOA 5AC7A 2CZFA 3HQ1A 4XUGA 5EMUA 1RPXA 1IIGA 4OQVA 1C9DA 2DU2A 4OHQA 5DCEA 4XZ9A 2NUXA 4CQAA 4L4LA 3W7MA 5K9CA 3W2MA 2VFHA 4M7TA 3OHIA 1VCVA 1GQNA 1L6YA 1BWLA 4DO5A 1JUEA 1ZCOA 1KFCA 2C3ZA 3HIJA 4K36A 4MJZA 4EF8A 5AHEA 2FPVA 4LOCA 3M5XA 5C6MA 3HGSA 3ELFA 3UD6A 4I7WA 2OT0A 2G97A 3TSDA 3LBCA 2R91A 1YPFA 2CU0A 4N6EA 3TMQA 4GFSA 4Z08A 3TH6A 2V82A 2TRSA 2E6FA 4WXYA 5KZEA 5F2MA 1PV8A 4MZ1A 2ZA3A 4RZ4A 3G3DA 2OCZA 1TPEA 4MPQA 4O57A 8TIMA 3NQCA 4DEFA 3GB6A 1X1OA 3GDRA 4UXDA 2Z6IA 2BTMA 3EWWA 3O07A 1X7FA 2Y7GA 3TIMA 3EWUA 3M7WA 1SO6A 4Z1DA 3UXAA 3RK8A 3UY8A 3EWXA 4LY8A 4R7JA 3LHVA 3GVGA 4B5NA 1RR2A 1G4EA 1GG0A 2ZTJA 1YXCA 3ABOA 1B57A 1LCOA 2VFIA 4O50A 2H8XA 4IXHA 1XUUA 1KM5A 1LOSA 3M9YA 4NJIA 1QWGA 2YDAA 5IBXA 3P8JA 4H4IA 4O15A 1O5KA 5AB3A 4O52A 1ZFJA 4DELA 2VEKA 5EKYA 3IVTA 3MHGA 4M6VA 2AAMA 2C1HA 3QC3A 1WOAA 4MYAA 4X3ZA 1V5XA 5D32A 3GDLA 2QUVA 4N2YA 3IIOA 4UTMA 3GNNA 1UJPA 2CZEA 2NUYA 1TPUA 1DV7A 2YYTA 2YW3A 2Q8ZA 4GXMA 1G4TA 4EVZA 1C8VA 4FHAA 1DOSA 1VHNA 5K4ZA 3R89A 3BV4A 4DF1A 3TJLA 4NNBA 2Q3OA 2ZCGA 1JJKA 4UTUA 2V8ZA 3LCFA 4WUIA 4HKPA 3UWVA 1XXXA 1VZWA 1H63A 3QQ0A 2YX0A 2ZRXA 4FNQA 5E93A 3R2GA 1OFAA 3W2JA 3M41A 1KTCA 1H50A 4UR8A 3QW4B 1KM0A 1OFBA 1I2PA 3O63A 2ATMA 1KV8A 5SWUA 2C19A 3L0KA 5K2ZA 4AMAA 4WY0F 4IPIA 1W8SA 3DXIA 1ML1A 1TJPA 2PC4A 3NQMA 3HF3A 2VEIA 1QOPA 3F4NA 3C2FA 4ZQOA 3W86A 1KTBA 1SFJA 1UCWA 1K7EA 1WQ5A 6ALDA 1LLZA 1GYLA 4MY8A 4GC4A 4NJHA 1SW3A 4IMEA 3SFKA 1EA0A 2FB3A 4WZHA 1JULA 3MBDA 4GRSA 5U7SA 2QEZA 3N9RA 4N9BA 2ALDA 3S6DA 1EWDA 4Y96A 1YLVA 3BLEA 1RV8A 4JR5A 3IIZA 2BZNA 3IIVA 3MI6A 3LHZA 1A50A 4JDYA 1P5BA 1Z42A 1F6PA 2J88A 1JUKA 1RD5A 2JK2A 4E38A 4O17A 3LTPA 3UYCA 2E6AA 3BLFA 3IGXA 4A22A 4N4PA 3GXNA 4JYEA 2OT1A 4MY9A 4LVGA 3QSRA 3BW3A 3F4WA 2GQAA 2B7OA 3E96A 3EWBX 3MJYA 3W7GA 1J2WA 2VFDA 4NNCA 1TV8A 1BWKA 3M5VA 4AWTA 2E5BA 3UZJA 1W5QA 1NFBA 2BLEA 4A2SA 4ZQCA 3HOJA 2WQPA 3TFCA 3ZWTA 2B7PA 4ADTA 1VLIA 3I65A 2UV8G 1TTIA 4WY0A 3CWOX 4LTSA 2A5HA 4U4MA 3W73A 3MHUA 2G96A 3LGEA 2DZWA 2WNNA 4NQ1A 5DLCA 2C16A 5TQLA 5AC8A 5HMSA 3NR0A 4BI6A 1ICSA 4IPJA 2CFFA 3H53A 1FDYA 2VXNA 3P5YA 2QCDA 2ZZ4A 2CLKA 1KLYA 4JYDA 4KWWA 5K9XA 1LTDA 2W6RA 4NX5A 3S1VA 4ZL1A 3L2IA 1DJQA 3PG8A 3TSMA 1IXPA 5HULA 2IQTA 3VE9A 3W22A 2HTMA 1OYBA 5HUPA 5G5IA 3TXZA 5T26A 3Q2DA 2YW4A 2WSRA 4O14A 4Q32A 4AB4A 2W0UA 3STFA 4Y90A 3WK0A 5DY2A 3MYOA 3S5ZA 3C2EA 1J5TA 5FF4A 3W7KA 1UUOA 1TREA 4LT9A 4NXKA 3G1XA 4UTHA 2ZZ7A 3NQ8A 1NAL1 2GUUA 1LZOA 2ZZ5A 4IGHA 3EX1A 4NJJA 4AF0A 4XQ6A 2FTPA 5U4NA 1UUMA 5KSWA 2H6RA 3DI0A 4NT0A 4O1DA 2YCEA 4PA8A 4XTDA 1K03A 3I7SA 4ADSA 1WBJA 1OX6A 4GE8A 2P10A 3W75A 1F6KA 3B03A 4K37A 3YPIA 1T96A 2QJIA 3G22A 2NX3A 3RF9A 2PE4A 3N2XA 5D2VA 4J9JA 1KFEA 2X1RA 2ZZ3A 4XKYB 4JX5A 5J5RA 3PG9A 5FEZA 3S1XA 3PVFA 1A5SA 1D9EA 3GLCA 1Q6LA 1W5NA 3DAQA 1RZMA 2QCNA 3DBPA 5D38A 3WJWA 3BLIA 1YYAA 2VELA 4O1BA 3RLUA 3T78A 3BGGA 2G5WA 2F84A 3DKJA 4TR9A 4O53A 4ORIA 2NWSA 4MYXA 2YR1A 3P81A 4POCA 4LUIA 3USBA 1EIXA 1ZAJA 5E1QA 5BOOA 1YTDA 3FA5A 4JTKA 5HR7A 1D3HA 2W79A 3N34A 3W88A 2P0OA 1AL7A 3N2MA 5CKSA 2QDHA 3M43A 3W7CA 2DZXA 1NEYA 1LROA 1VR6A 2QUTA 1OYAA 3L68A 4BFAA 3KOFA 1R47A 1VGAA 2ATSA 4IX0A 3DZ1A 4UFHA 2WKJA 4YL2A 2DJXA 2H3BA 3GR7A 3O1NA 5CGQA 3ZR4A 2E68A 3CM4A 4GUJA 4PL2A 1SO5A 1P0KA 4HN4A 2Q8LA 3G8EA 2V5LA 1TSIA 2O7SA 5LNVA 1ICQA 3E9AA 3NG3A 4YWIA 5CSRA 1VYSX 2DZPA 3G0SA 3OIXA 4U28A 1RQHA 4EOUA 2YFNA 4NJGA 3TAKA 1H51A 3WK3A 2J9YA 4DPPA 3FYPA 1GVFA 5CSSA 3FYOA 4UC5A 3M16A 1VH7A 5I3GA 3DENA 4FX7A 1PS9A 3KRZA 1HG3A 3TW6A 4PL1A 3I7QA 3DFSA 3B05A 5IBXC 3EKLA 1LP6A 3CIWA 4M7SA 4S2CA 3O6DA 4LV9A 1X1ZA 4I9AA 3LV5A 4O13A 1TQJA 4KFPA 3FJ6A 4QITA 3W7EA 5EBUA 3WJYA 3MBFA 2Y62A 4A21A 4RR4A 1SW0A 1I45A 1TPFA 3EX3A 2D73A 2EKCA 3SSJA 3INPA 3IEBA 4AAJA 1KM3A 1LDCA 5HQEA 4XBSA 3PSWA 3W7QA 2ZZ2A 2YSWA 3T44A 1F7BA 2RDUA 3W70A 2NXHA 2VC6A 4A29A 3PSVA 3GDTA 1EUAA 3P84A 3VKJA 3QFEA 1O94A 1TO3A 4NXSA 2OMAA 1YXDA 1YTKA 2GVLA 3G1SA 3W87A 4MIMA 5AHIA 3G1VA 3G1YA 3L66A 4UTIA 1WOBA 4ONVA 3NXFA 3JRKA 4Z1AA 4HPXA 5L6UA 1SSDA 3BG3A 3C0JA 3UNDA 4H6KA 2VEPA 4LS2A 1SO4A 3T55A 3WK1A 1WAUA 1MO0A 5D09A 1A53A 4LW7A 4UTTA 5F2GA 1OFQA 2Z1BA 4BF9A 3VFLA 4MOZA 3PS7A 4X22A 3BK0A 3KRSA 4WXZA 2TMDA 3SGUA 3DFNA 3PWAA 4EF9A 2YFOA 2J9XA 1FUYA 4D2JA 4IWWA 4CNNA 3QEZA 1QOQA 2Y63A 1MEIA 3NQ7A 2XN0A 3RMJA 5K7JA 1ZJIA 3FEMA 4JTTA 3STGA 1B4EA 4BWLA 4AWSA 4CNOA 4LC8A 2Y61A 4ADUA 3NQDA 3N19B 3G0UA 1PHQA 3CEUA 1IXOA 2A6LA 4UFMA 3W7DA 5G1YA 3NGJA 3GXTA 3PC0A 5AYXA 1KA9F 3WFAA 5AOUA 2F7FA 4Z1BA 3T7VA 3T4CA 3LRMA 1LRNA 2E09A 3HGRA 3DHFA 4RZ5A 4IXXA 2VEMA 3W23A 5C54A 1OHLA 1G4SA 4LV4A 1GVRA 4RXFA 4CLMA 3CWNA 4PCFA 5HWJA 3W2KA 4JTSA 1WDWA 2Y70A 1O95A 3W9ZA 1FDJA 2V5BA 2YYUA 3IVUA 3IVSA 1WBHA 2FB2A 5CZSA 3STEA 4EIVA 1SO3A 1XBXA 3HGOA 1XCFA 1H1YA 3LXCA 5EA9A 4ZQRA 1I2RA 2YZRA 4WOQA 4LVBA 4CCEA 3B8DA 4BK9A 1TV7A 1GVSA 3KX6A 3C61A 3MHFA 4TU1A 1QO5A 2WNQA 5G4EA 4UMAA 1T8XA 2NX9A 2GQ8A 3LHYA 5HWMA 3GDMA 3ANYA 2DZTA 3PAJA 1VJIA 1SPQA 3W7OA 2GVGA 2YPIA 2ZRYA 1QPOA 3FS2A 3LDVA 1K8YA 4RCXA 2JKAA 5HUOA 1A5CA 1G67A 3AJXA 3L5LA 5DXXA 4QISA 1TIMA 2OJPA 1S5TA 2C14A 1B9BA 4JTJA 2FQIA 1EP1A 3FKKA 3Q94A 3P82A 2H90A 3BVJA 4IUOA 4O12A 3M0ZA 2FPYA 3LCWA 3TJXA 3QQ1A 3D0CA 2Y7EA 1KW1A 1T99A 3A21A 4IQLA 3TU9A 5AYZA 3LCGA 5D03A 2CZDA 4FNTA 3W84A 1FQ0A 3S0CA 1AW2A 3O15A 2CLMA 1NVMA 1JCYA 2EAWA 3CC1A 3NDOA 2Z2UA 2VFFA 3TQKA 3C8FA 3GR8A 3L5MA 2ABBA 2CLFA 1TPDA 5DBUA 1OJXA 1WXJA 4QIUA 1M5WA 3G1FA 3LI0A 1IXQA 5FEXA 3LI1A 4GUGA 1K8ZA 5D05A 4PC8A 4ZVJA 1GPWA 2E1DA 4O11A 3LERA 3ZS4A 2X1UA 2C13A 1XKYA 4UFIA 3UPWA 1ONRA 3NQVA 4L4MA 5LHFA 1W56A 2AQWA 3LB0A 4NVTA 3ZFHA 1S3HA 2E6YA 1TQXA 3TUUA 3LHUA 3O05A 4K8HA 3C2VA 4A2RA 3NA8A 5F1VA 4UNKA 5HINA 4OV4A 1Y0EA 3QYQA 5F2LA 4PH6A 2CLOA 3NPXA 4TMBA 1GZGA 2ZA1A 2GPTA 2Z0IA 1H7XA 2B4GA 4CQ9A 2DORA 2GQ9A 2ISWA 4O18A 1KV5A 3MYPA 3QSTA 4TX9A 3EWYA 1DL3A 1FCUA 1VPXA 1ZNNA 1AK5A 1D3GA 2EHHA 3PR2A 4UNLA 1G6CA 2RDTA 2QCGA 2Y89A 1YPIA 3CQ0A 3EX6A 4HPJA 3CB8A 3A9IA 4JTFA 3DI1A 1QO2A 1UASA 1Z44A 4CCCA 3P67A 4XKYA 1UB3A 3GAYA 1LRTA 4JTIA 4I7VA 2QR6A 1VQTA 1XM3A 3WJXA 5FF2A 3LLDA 3W2LA 4K8EA 3VI2A 3Q58A 1OX4B 3F1QA 3DFQA 3PUOA 3A5FA 3KFTA 3OVPA 1QAPA 4E2DA 3GNDA 4X2RA 3W07A 1VCGA 1TYGA 2ZRVA 2QCCA 4AWUA 1TPWA 3S42A 1TJRA 4FX6M 1S5VA 3TNOA 3MP5A 4UIOA 4JNMA 2GOUA 3C52A 2ZDRA 1QDSA 3TV8A 3H55A 1LBLA 1YADA 3W1UA 1DORA 2QCLA 1VHCA 1KM4A 1TV5A 5TIMA 1Z48A 3W7NA 2FFCA 3IGUA 3GAKA 4YCOA 3R12A 3LCLA 4UMBA 4JX4A 5FF7A 3B0PA 3G3MA 3UWQA 3UWYA 1H61A 4QJ1A 2H3DA 3THQA 4JICA 4DXVA 2B0MA 4K7VA 2AGKA 4UFKA 3DFPA 1KM2A 2YGYA 2JGQA 4O0KA 1Q6RA 2X2GA 1BTMA 5KINA 3B06A 4KKXA 3R13A 3NZRA 4Y9AA 1XI3A 2BWGA 3CT7A 4FIQA 5HJLA 2WSYA 5D2XA 4N9CA 4JX6A 2NXIA 1W37A 3FLUA 3W74A 3FJLA 5DBTA 1OG0A 1FBAA 5DELA 5AYYA 3ZWSA 1R2RA 3E49A 2DP3A 3PM6A 3KAOA 1PVNA 4O19A 3EEGA 4RLIA 2EF9A 5FF3A 2NXGA 4H3DA 3G0XA 3BG9A 3M5YA 2PCQA 3BO9A 5LNWA 1DBTA 2B7NA 1AW1A 2NWRA 4UTJA 4QAIA 2R14A 3PBWA 1QMLA 4PEKA 1GEQA 4GBUA 3SR7A 3KVMA 4UTTC 4Z0JA 4ALDA 2FLIA 5F2IA 3LV6A 5L9FA 4NNAA 5KTLA 1TPH1 4AVFA 1R30A 2HS8A 3LCHA 1DQWA 3DH7A 2X16A 1Q6QA 2I14A 2I1OA 3I68A 1TCDA 1EPXA 3U2OA 1VLWA 3W7RA 4HNVA 3NPWA 4P2VA 4M6QA 1B3OA 3MWAA 4OBTA 3U6WA 2QAPA 3STCA 3ABQA 1KM6A 3P8IA 4BWLC 1H1ZA 3LRKA 2V81A 5FESA 5H91A 2G95A 4M6PA 3V75A 5LZLA 4LVDA 1I4NA 4LRSA 3GYEA 4UTKA 2QCEA 5E0KA 3SY5A 5LSMA 4W9TA 4OT7A 2DZSA 3RLVA 3TMLA 3PUDA 2X1TA 2JBMA 4UFJA 2X1SA 1NSJA 4A3UA 1L2UA 2WSQA 3GZ3A 4CNPA 1FXQA 1OYCA 1GYNA 4ML9A 1Q3NA 5KZMA 2Y7FA 4N6FA 2CWNA 4ZQMA 1G69A 1H7NA 2ISSA 2QUUA 2VENA 3C6CA 3TC6A 1PE1A 3EXSA 5CG7A 3G24A 3O06A 1H62A 4BR1A 5GVJA 3HPXA 5LNRA 3L5AA 3W2NA 3P7YA 3C2RA 4BI5A 1KFKA 5D30A 1K7FA 3NAVA 4NZJA 1XDLA 2LLEA 3A5VA 3HG3A 3NEVA 5CZ0A 2WO5A 1V7YA 3HBLA 3LOTA 5F4XA 3W72A 4FB7A 3IRDA 4ORMA 5CZJA 1ADOA 3O6YX 1PL9A 4UCGA 3QZEA 3C2OA 4AXKA 1CI1A 3CPRA 3EWZA 1HTIA 3S5YA 2ABAA 3M1ZA 4S1FA 1YTEA 1W54A 1YXYA 3N9SA 1ALDA 1I2QA 3TR2A 2Z6JA 3W1QA 2RH9A 2RKXA 2QCHA 4IMFA 3W6YA 3VNDA 4HIBA 1H7PA 4O54A 3RU6A 4RX0A 4ZQNA 4XWUA 4CQ8A 1QFEA 1KFBA 2NV2A 3NL6A 5MHBA 3W2UA 5AHFA 4Q4KA 3W1LA 2V9DA 4G1KA 1GTHA 2CZ5A 3A23A 1A5BA 3TA6A 2J6XA 3PBVA 1OABA 5CPOA 2Y6ZA 1EB3A 2RFGA 3E0IA 1M7PA 5TBOA 1JQVA 1FXPA 3PBUA 1X8FA 1H60A 1O4UA 4UUIA 3W3OA 4FNUA 1LORA 4EWND 1XUZA 1TTPA 5D04C 3M44A 3NQGA 1VRDA 2XN1A 3O16A 3W1MA 3NQ6A 3HO8A 4FF7A 3L9CA 1NF0A 1M6JA 4HSOA 3GIYA 5LNSA 3G1HA 1EUNA 3M47A 4IOTA 4JDBA 3NQ2A 3UWWA 4K7YA 1EX5A 2JKEA 3N73A 4OE7A 1QNVA 1XBYA 3GDKA 1JCNA 3ATZA 2J27A 3QW3A 3JR2A 4O10A 3UWUA 2ZRUA 5ABTA 3NVTA 3FIGA 1JRBA 1LM1A 3E12A 4GWEA 4DPQA 3BW2A 3LCIA 4QNWA 1TMHA 1VYPX 1JR1A 4DO6A 2A7RA
chains in the Genus database with same CATH superfamily
1SU5A 1IHIA 4XBKA 3VKKA 2C0AA 3SW6A 2F9RA 2O9OA 3OA3A 3P6LA 2HJPA 1XYZA 5JMUA 4H7ZA 3HG4A 4WF7A 1M7OA 1W9DM 4GY1A 5A6AA 3FOKA 2UBPC 1XKJA 1TPB1 3OJGA 3WLLA 3SQSA 4FXFA 2XVGA 4FALA 3AZRA 3M0YA 5I3IA 5I7GA 1JUBA 2QUNA 1ZALA 1E4LA 2ZQ0A 1UZDA 4Z1CA 1ZQ5A 1G4PA 8CGTA 4CD4A 4UTFA 3P60A 1SUXA 2R82A 1E3XA 1XC4A 4L6HA 1FA2A 4HCLA 1OF6A 3QY8A 2J6VA 2VWSA 3TZFA 4J3ZA 4JS3A 4MLRA 4DF2A 3B8TA 2QCFA 1V02E 4MKSA 2BOGX 4RDZA 3W37A 4V28A 2XM1A 1Y8BA 4K38A 2PURA 3QMRA 4FR6A 3WMSA 3MMWA 2ZC8A 3LSBA 3K1DA 3WX7A 4Q8VA 3GS6A 4GJ1A 3CLMA 3KOZA 5LGZA 4LANA 1Z9AA 1QI5A 3VD5A 5G1TA 3VDAA 1H4PA 3PBYA 3MZNA 1OX4A 1US3A 1RVKA 4FSAA 1YHTA 4N7QA 1W2VA 3ZR6A 1XIGA 1I2NA 2OZ3A 4CD5A 4GVHA 4GNJA 1GJUA 3L0NA 3N3MA 4CEXC 2R8WA 4QJ3B 1Y5XA 4C91A 4NG3A 3KBJA 3G1RA 3N2OA 2CLHA 4RJEA 2WQDA 2OO0A 4MWAD 3TP4A 4PYSA 2YOCA 1GJPA 4JPGA 4Y9MA 3AHXA 4Q3MA 4NYYA 4DAIA 2J24A 1OFRA 1IZKA 3G1DA 1JQXA 4NZ3A 4TUFA 4BI7A 4UTWA 3KDNA 1QPQA 3OGSA 4S3JA 1UIOA 3SEPA 1RAKA 3PB0A 4S2BA 1DQXA 1DJHA 4DZIA 1CB7B 4EXQA 1O66A 1UG6A 3BG5A 3CUHA 4EPDC 3W1XA 3GH4A 2ZE3A 3EKGA 3NEHA 2Q8XA 4AH7A 4B2DD 3GX9A 2BV9A 2KAUC 2WJZA 3S9ZA 1UHVA 4IP7A 1BVWA 3CIXA 3VIHA 4Y6GA 3E74A 5PTDA 1LQAA 2OZ0A 1TJ1A 1BQCA 2NUWA 4HNNA 3NURA 1YW1A 1AQMA 4PUUA 3PZOA 2VZVA 1JZ6A 1QHPA 4AZIA 1XSIA 5DCDA 3DERA 3TDFA 5HWNA 4JHZA 3PY2A 4I8DA 3MMUA 1CGYA 4MY1A 4Z2GA 2G3JA 4PUDA 1PHWA 2ZWYA 2E1WA 1HO4A 4TQTA 3QJAA 4H9YA 2H8ZA 3T05A 4CN6A 4JQ3A 1HUVA 1X38A 3MDUA 1QRQA 1E51A 1IE7C 3MANA 3FX4A 2XFRA 2QGHA 5FL0A 4AHOA 2A3EA 1K9DA 3CL7A 3W7IA 2AMXA 4E3TA 2PDXA 1SW7A 3BW4A 4MUZA 4PTNA 4OBSA 4OUIA 1UROA 5BMXA 2PWDA 3N4EA 2BOEX 3DEQA 1CYGA 4O1CA 4QROA 3QM3A 4LU0A 2GGHA 1UWUA 3N14A 4AZ6A 4B3ZA 4MVAA 5E09A 1Q5MA 4R33A 4H6EA 5AHLA 3UJRA 1CTNA 4OKDA 4X61A 3RR1A 3WIJA 1KBLA 1EQCA 1EZ2A 4CVUA 4PUMA 3TW7A 2HSAA 1POJA 4CUCA 4W86A 4GQGA 4YHGA 1VB9A 4HOWA 2A3AA 4N0RA 1F3XA 4A3HA 3UXDA 5AHNA 1ZAHA 2PRMA 4ICNA 3EB3A 1SSGA 1R87A 4R88A 3QR1A 4FOJA 2Q3RA 5A6BD 2ZX5A 2UY2A 3GU1A 3S5SA 1S1PA 1XLCA 3KTXA 1MQQA 1W5OA 1BF6A 4EK7A 4MFDA 3AZTA 3GKAA 5AVHA 5I03A 4WQ6A 4R34A 1YBQA 3N9KA 3UETA 1AL8A 3HM7A 2I5IA 4Y7EA 1SGJA 4UNIA 1H7RA 2PRHA 4WR3A 1OGGA 2O7QA 3WZ0E 1UD8A 3LXAA 3GXDA 2CHNA 1TVNA 3SRFA 2C15A 1WNOA 1AFSA 3TX9A 1XYMA 4PB4A 2PBOA 4CNTA 3N2BA 3VZYA 3S47A 5A2BA 4C60A 2HMCA 4E2BA 4JCMA 2J8TA 5DFAA 1GT8A 3TYUA 3A4AA 5LA1A 4Q8WA 4LYQA 1FCBA 3VINA 1K8CA 3GHTA 4EWJA 3EPNA 2JIWA 2QGYA 2HS6A 3C56A 4S39A 2HISA 3DFYA 1XIMA 4JTUA 3WF3A 1XGZA 3WQ6A 4NZCA 3THCA 4ZSTA 2YDQA 2JKPA 2WLZA 3P5ZA 3VUPA 4C1KA 4IFKB 1EGZA 1XLBA 3BV7A 1ZBWA 2DH3A 3GY1A 1I8JA 1U30A 3ZOAA 3MO7A 5FSEC 1XIBA 1JVNA 5C55A 4DO4A 1K02A 3CQJA 1RBAA 2TSYA 3ONCA 3D3AA 3HJZA 3MW7A 4IMGA 2HPMA 3WCZA 3JVAA 4C6BA 2BVTA 1JEZA 1EDQA 4H8NA 5K3VA 1OCQA 3BLLA 3KE0A 2PWUA 3B4YA 4FO4A 1OFEA 3T0DA 2ZUTA 3VOCA 1GVOA 4M19A 1R3YA 5FI8A 2ZRZA 4KF1A 4LCQA 1KFLA 1LBFA 2VNCA 1L6SA 4MZ8A 1R86A 2GDQA 3W1RA 3DC8A 2QNEA 1W1VA 4FS9A 3NOEA 1V6UA 4JTEA 5CPMA 4JBRA 2WMIB 1BVZA 4NRRA 2QW5A 2PC8A 3RMEA 4Z0SA 1VIWA 3F03K 2RJGA 2R94A 4LS1A 4MWAB 3W7JA 5MF5A 3PB2A 3NL5A 3WDHA 1LQ0A 1FCVA 2PZNA 4M8UA 2D22A 2RDXA 3L0GA 4RE2A 2G0WA 1C90A 1FP9A 1RXOB 1J79A 1TRIA 3CUIA 2XGBA 1LOQA 3BANA 2FPTA 1V6YA 2X0YA 3MUXA 1ONWA 3DHDA 3TYZA 5A6TC 3PFRA 1DHPA 5CQ1A 1HZYA 4G2DA 4LVFA 1FWEC 4JYFA 4IGMA 4YWSA 4AX7A 4XZHA 1T5AA 4AIOA 1P0DA 5I23A 2ZFAA 3GXIA 4S3KA 2BB0A 1WZKA 3EA2A 3VKBA 3WDQA 4J1OA 1Q2SA 1U5HA 2BSLA 4XZNX 4QHRA 2TODA 4QEHA 5I3HA 1HVQA 1G1YA 2EXOA 4MZYA 3GM8A 5A5WA 1ESWA 3NYDA 4NL1A 3WNMA 4WOZA 1XJBA 1W3TA 1AD4A 1F9CA 4DXXA 1OBAA 1J5SA 1XRTA 3TE9A 3WLSA 4FI4A 5EGRA 4JEQA 1HL9A 4UQEA 1FWCC 1K8XA 1W3LA 3ALFA 1H5YA 1P6WA 3M6DA 5D37A 5AY7A 2RHGA 3M0VA 3RNDA 4L5ZA 2BGQA 1ISXA 1J0HA 2HNEA 4Y9PA 2FGZA 3ABRA 4DX3A 4HK5A 1KNWA 6ENLA 2FVKA 2OOFA 2NX1A 1Q66A 3BZJA 1YDOA 3IUIA 3AIEA 1B4KA 2FIQA 4KFOA 2BXZA 5BXRA 1V6TA 4XUGA 1DXFA 1RPXA 1L2QA 3VFCA 2DU2A 4OHQA 3RDKA 3T81A 4C6MA 3EDJA 5DCEA 4XZ9A 2NUXA 3W7MA 3W2MA 2OYMA 4JL2A 3VDGA 3F5LA 4D8ZA 1EO7A 3ITLA 5H1WA 7ENLA 4MJZA 4QRNA 3N13A 3UD6A 2GQ3A 3V35A 2ZX7A 1IZJA 2D2OA 3RJXA 1YPFA 2CU0A 4K2SA 4GFSA 4H9XA 3TH6A 4Q4OA 3PBMA 3G3DA 1KBBA 2YB4A 4O57A 8TIMA 2JE8A 3NQCA 3OO2A 1X1OA 5CCZA 4GHRA 1DJWA 4KWUA 4CQCA 1YE6A 2BGNE 3EWUA 3WH5A 3LQGA 4LEFA 4GI8A 3OVGA 1R5YA 4IF2A 5LA2A 1QNQA 1ZJBA 2WZIA 3NSMA 3UR2A 4PRRA 4C5ZA 1XUUA 2R1NA 5A69A 1J9YA 1JFXA 5IBXA 3WD2A 1O5KA 1KR1A 1U5VA 5EKYA 3L4YA 5REQB 1MWOA 1ITQA 4M6VA 2AAMA 3Q67A 5B80A 4S3EA 1WOAA 3VOHA 4JQ1A 1CXLA 3TEVA 1NWRA 3GNNA 1ONXA 1UC5A 2GVEA 2EPMX 3RGTA 2Q8ZA 4NY2A 3RLGA 1XLJA 4H7CA 1C8VA 2QVNA 4FHAA 1VHNA 4ZO6A 3PP7A 4NNBA 2PP0A 5C9WA 1S3TC 2ZCGA 3SRKA 1JJKA 5C0QA 2W66A 3I6TA 4AYGA 3AZSA 4UTUA 1E1FA 1W1A1 3WL1A 4NRSA 4ZO8A 5JBEA 4HKPA 3LD5A 3RITA 1N82A 3VZZA 2JFEX 3H26A 3ZVIA 2ZRXA 5E93A 3W2JA 2D3LA 1KGWA 4C7DA 3FJ4A 2OEMA 1QNOA 3W28A 5H8PA 2QHAA 1I2PA 4D1JA 3O63A 3B9DA 1QNRA 4A35A 2Y5JA 3L0KA 1CENA 5K2ZA 3N15A 4B3LA 2WW5A 2ZVRA 5FJPA 1ML1A 4G6CA 3C2FA 3MS8A 1A5OC 1SFJA 1UW9A 3WQDA 3IK4A 1GKRA 2GSEA 3M0MA 1X96A 4DLMA 4DY1A 1MW1A 1LJYA 4AIBA 2FB3A 3B8UA 4N9BA 4GX8A 2VM8A 1E4IA 1SJBA 4PEEA 3IIZA 2Y5SA 4DUXA 2ODOA 3VGHA 1Z42A 1ENUA 4UOZA 4H2CA 1Y5VA 4F79A 4E6MA 2RJHA 3GXNA 3V5FA 1R9ZA 1UWAA 4HPNA 4LVGA 2GDVA 3BOLA 4D6HA 2J77A 2XGIA 1J2WA 2VFDA 1TV8A 2XVPA 1NFBA 3N6HA 1WKEA 5TNVA 4QG8A 3FSTA 2Z2AA 4M29A 2O4QA 4RPQA 3P14A 3OLIA 1RD6A 3MKCA 1FP8A 3ES7A 5DLCA 1TJ0A 5TQLA 1JYXA 3NR0A 4BI6A 1AH3A 2D2HA 3TQPA 2F6XA 1OC5A 3SCUA 3H53A 1FDYA 3CNYA 2QF8A 3P5YA 4M81A 3XISA 3BXWA 5CPQA 1K1DA 3BLDA 3S1VA 5T8GA 1DJQA 3TSMA 2J75A 3RXZA 3W22A 1OYBA 3GXMA 3L12A 5DMYA 2WMIA 5T26A 2YW4A 2VYOA 3NCOA 4DJFC 4MWAA 3C2EA 3W7KA 1CGTA 4NXKA 5HNUA 4EX4A 1VFMA 2ESCA 4XQ6A 2E7FA 1UUMA 1PZ0A 4JIRA 3PZTA 2YCEA 4FLSA 2X7WA 1M01A 4JTRA 3TW9A 2NSXA 3G22A 1W1PA 1HX0A 2PE4A 1KFEA 4PUWA 1DIEA 2CBIA 2PDMA 3R10A 3OLDA 3IJ7A 4JHOA 4B92A 4HPHA 5FEZA 4DIAA 5JH2A 1A5SA 1TWIA 4R9OA 3APYA 3AMDA 2EG6A 2E0PA 1RZMA 2QCNA 5D38A 3WJWA 4L65A 1YYAA 4BHYA 2HZGA 1FKXA 4ZB0A 3BCJA 2WM0A 2F84A 5CAHA 4O53A 1R9XA 4ORIA 3GE7A 4MJ4A 3KS5A 4MYXA 4HCDA 3P81A 2QPXA 3UYIA 1B3XA 1G5AA 5E1QA 3GUWA 1YTDA 3BQ5A 4US5D 5HR7A 3VK5A 3N34A 5CKSA 2QDHA 4W93A 4G9PA 4H19A 2QUTA 1OYAA 2YBTA 2C8NA 1R47A 3FV9A 4XSMA 3DZ1A 4QSFA 4Y9OA 3O1NA 3GBEA 3ZR4A 5MKGB 1L8PA 4PL2A 2VX7A 2UY4A 3GHSA 3SUUA 2P0IA 2V5LA 1PSCA 3GFXA 2O7SA 4F0LA 2DGAA 1FHLA 3RLHA 1IR2A 4ECLA 3GUGA 3EWDA 1U33A 4U5IA 4YWIA 1M41A 3W27A 4U28A 4NJGA 1E0TA 1H51A 3W02A 1EF3A 3EA1A 3WQPA 5GNYA 3ES8A 1GYMA 3IPWA 1VH7A 1S2TA 4FX7A 3PTKA 3TW6A 1HG3A 1GHRA 3CMJA 3B05A 1CECA 3BH4A 3BLPX 3EKLA 1RHCA 1V6WA 4I9AA 3LV5A 4MMWA 1MW2A 4KFPA 3LNPA 3CHEA 5EBUA 3MBFA 3EX3A 4TVDA 1LT7A 4KMQA 5D9NA 5HQEA 3CJPA 4XBSA 3PSWA 2ZZ2A 1X8CA 4GACA 2VRKA 4A29A 3OLEA 3VKJA 3QFEA 2INEA 4R27A 1TO3A 2JF6A 3WFLA 4J27A 1YTKA 2W62A 4CU6A 2OEJA 2E9LA 4HHLA 4HZ7A 2WJDA 3B0YA 5AHIA 1PYFA 4NI3A 1WOBA 3UJFA 3H8AA 3FGCA 4Z1AA 4HPXA 3H2OA 1J11A 3UNDA 4A8IA 5A6BA 3MZ2A 3UZWA 1V7AA 1UH2A 1V3MA 4EKJA 1WAUA 3ALGA 1MO0A 5REQA 4LW7A 5AVNA 1T6MA 3GVQA 3VFLA 4MOZA 4RUBA 1HIZA 4E2VA 4HK6A 1WKYA 2DUAA 1I0DA 3CQKA 3SGUA 1H3GA 2ZUNA 4EF9A 3N2CA 2YFOA 1HKWA 1IQ8A 2J9XA 4AZ5A 1MVYA 3CYJA 3WLKX 1RH9A 1ZJIA 3FEMA 4JTTA 4B5WA 4MB3A 1B4EA 1IR1A 3N19B 3CEUA 3T0BA 3W7DA 5G1YA 3GXTA 4ZXOA 1XLHA 3BSGA 1LRNA 2E09A 3NO1A 3DHFA 1T41A 1PTGA 4ZBCA 3UFYA 1G4SA 1JPDX 1JAKA 2R1MA 1GVYA 4CLMA 1EGVA 4AEEA 1N2VA 2QJJA 3ZLHA 3WBAA 4IZGA 4H8HA 1JI1A 5T91A 1WDWA 9XIAA 1XG4A 4KRZA 1FDJA 3FJNA 3W9ZA 3IVUA 3D46A 1PIGA 3STEA 1XQLA 2AOSA 1I2RA 2FZMA 3PHAA 2PU0A 4H9MA 4YTSA 4CCEA 3KX6A 4W8AA 1QO5A 2WNQA 3KP1A 2NX9A 1V0MA 3LHYA 5LIYX 3ANYA 1ZBVA 4AD1A 3PAJA 2VUNA 2VVSA 5EBAA 2V68A 2GVGA 1O5RA 1HP5A 3BE7A 4FA3A 3H2CA 5H8MA 2XG9A 2JKAA 5HUOA 1G67A 1SMDA 4JQ4A 1S5TA 1B9BA 3WLMA 1RLCL 2H90A 3WQ4A 4IUOA 2IPGA 3AMCA 3TJXA 4GBDA 1GORA 3A21A 5HBFA 4B5UA 2YCJA 4KETA 3C2YA 3K8LA 3LCGA 3W84A 3LPFA 1V3LA 3PPCA 1AW2A 2CLMA 2BBFA 3WQ5A 1HW6A 2OO6A 2ONEA 4U10A 1KCZA 1BAGA 1DJYA 3NDOA 4GO9A 3TQKA 5I02A 2YCKX 2ABBA 1Z32X 2PU1A 5B7YA 1DJIA 4GQBA 1OJXA 1WXJA 3LI0A 3G1FA 1XQKA 4HQVA 1K4GA 1WZLA 6TAAA 1IXQA 3A9BA 4GUGA 3CYVA 3V16A 4O11A 3UPMA 3LERA 2PSNA 2X1UA 4UFIA 4PBEA 3SURA 3OZOA 4OOUA 4MM1A 1W56A 4NVTA 3ZFHA 1AH0A 2E6YA 3MY9A 1KCKA 3TUUA 3IWPA 1W8GA 2BASA 5EMJA 1S1RA 4QTGA 4OV4A 4F0RA 5F2LA 4PH6A 3AS0A 1QI2A 4TMBA 3S6OA 2ZA1A 2Z0IA 5FJIA 2B4GA 1I75A 2J47A 3LPGA 3SCOA 3B9OA 4TX9A 4HK7A 3CT2A 2OQLA 1ZNNA 2Z1VA 4X0VA 2J25A 1VF8A 4DHGA 3PR2A 4JQ2A 3W6MA 4UNLA 1G6CA 4RDYA 1U22A 2RDTA 3KP0A 2Y89A 5CAKA 4FAMA 2OLSA 3GFZA 4HPJA 1EL3A 3L7RA 4AY1A 1QO2A 4CCCA 4C6PA 3W0KA 1AQHA 3GAYA 3JUGA 1LRTA 4W89A 3PPGA 1KR0A 4JTIA 4I7VA 1GOQA 3LLDA 4GD0A 2VEGA 3DFQA 4IP5A 3CQIA 1C91A 2VDIA 4E2DA 4V2XA 5FAJA 2Q01A 4DJEC 3WFZA 2HCVA 3OZMA 1S5VA 4H8UA 3MP5A 4JNMA 2G3NA 3TV8A 3H55A 4S3AA 5HOSA 1DORA 3E5BA 1VHCA 1CGVA 3GAKA 4YCOA 2B31A 1WZAA 2HWGA 3DGBA 3UWQA 3G3MA 3ZO9A 1BYCA 3LYEA 3SQLA 4QCFA 5MKGA 4DJDC 3LMZA 4M82A 3EA3A 1O6IA 3QV6A 4IPNB 2AGKA 4TVCA 3GDBA 3H4WA 2YGYA 2JGQA 2BHZA 3OU8A 1Q6RA 3AMKA 4XBJA 3LLXA 5KETA 1XI3A 4IT1A 4DLFA 3CT7A 3ANVA 4KIEA 4C1NB 5D2XA 4JX6A 5IHSA 2PGRA 3VDHA 5DBTA 3VIFA 3AAMA 3WLIA 3RG6A 3E49A 3PM6A 3UERA 1BWVA 2OGJA 4RLIA 3QV9A 3AHYA 2PCQA 1VFTA 1DBTA 4Z17A 2NWRA 4UTJA 1E55A 5A8OA 2CZVA 4DJFD 3KVMA 1B5TA 2Y8VA 2G3MA 5BROA 2FDMA 3LV6A 3QVQA 3MVTA 4NNAA 5L9FA 1MDLA 1RCOB 5GJMA 2HXTA 2EKGA 3B97A 4HZ8A 1EPXA 3WQGA 2PPGA 1EYEA 3U2OA 2WCAA 4A8NA 4J40A 3SCNA 3NPWA 4M6QA 1TX2A 1XDJA 5I78A 3MWAA 5DQPA 3U6WA 1BGAA 4IH3A 3RX3A 3ABQA 1EYWA 3U2CA 4BWLC 5FESA 4S23A 1FRBA 5XIMA 4LVDA 3DECA 3GYEA 2PDQA 5E0KA 2DZSA 1YDYA 2X1TA 2X1SA 1NSJA 3QC0A 4YJ5A 2WSQA 2G4FA 3GZ3A 2PWEA 1FXQA 1W9UA 1XH1A 1CWYA 1CBGA 1DPMA 2NLYA 4W8BA 1MI3A 4DUOA 2R24A 4ZQMA 2QUUA 3C6CA 3MPGA 3QYSA 2PF0A 3VOJA 3UVAA 1ZB5A 4BR1A 4LYRA 2Z2BA 3M0KA 5GVJA 3HPXA 3L5AA 1XCXA 1K7FA 3R8HA 2LLEA 2QQ6A 3CH9A 7PTDA 5BU6A 3LOTA 3AWNA 1PX4A 1F3EA 3IRDA 3PPHA 5TF0A 1FWAC 2XZ9A 2C79A 1PL9A 1TR9A 1T7LA 1XLLA 5EMLA 2FZNA 3WY1A 2JEQA 3M1ZA 4S1FA 1YTEA 3B8SA 1I2QA 3WDPP 4F9JA 1SVDA 3TR2A 1XICA 1AH4A 1CGUA 4MJ2A 3PZ9A 3VNDA 1R3QA 2RGLA 4RX0A 1W6TA 2OWWA 4CQ8A 2X7VA 2ZKMX 2PTXA 2IPFA 4KWSA 2V9DA 2D69A 4I8YA 3FK4A 1NQ6A 2CZ5A 3WL0A 2VX4A 3PK7A 5CG0A 1J0KA 4XAYA 3H2MA 1ZUAX 3WLJA 4N42A 1OABA 2IMRA 2E40A 1EJUC 3BAJA 4L64A 1M7PA 1XG3A 3PBUA 3RU8X 3UF9A 4DB7A 4E4UA 1X8FA 2PD9A 1O4UA 1BGGA 3GW3A 1LORA 4A6GA 4D8LA 1TTPA 3LG3A 1NWUA 1XLMA 4I5UA 5CBBA 2XN1A 2J8FA 3HO8A 3AIVA 1XFCA 2OSXA 4G1NA 3UW6A 2GFTA 5D4YA 1QXLA 1XBYA 2J27A 5FIPA 3UWUA 2C7FA 1AQ0A 4DAFA 3ARUA 1JR1A 4DO6A 2A7RA 3CZGA 1XYLA 3T9PA 4MPKA 4O4WA 3UXKA 4GI4A 1WAWA 1K9EA 3L67A 4UR7A 2A7NA 1FWGC 1Q6EA 5F4WA 3O9NA 2F61A 3WQVA 3B0UX 2HE5A 1QI0A 4BS0A 3G2GA 1EEPA 1FWFC 2QCMA 3V0TA 1ADSA 4HU8A 4ERAA 3W1PA 1TZ7A 3UGRA 1QPNA 2EPHA 2MANA 3LPPA 3BJFA 1F74A 4JTDA 1XD0A 5LKYA 2IW0A 2XFWA 3V3WA 2OGYA 2WPGA 2YXGA 1ZSXA 2QPSA 1S39A 4KT2A 1DQUA 3VGEA 3LGDA 1O60A 1NOUA 3QKEA 1XDMA 2GGIA 4D6CA 3HG5A 1TTQA 3VIGA 3MV01 4WKFA 5CPLA 4DF0A 3WBEA 4PCSA 4LGXA 1A5NC 2GUYA 5IFTA 2AMGA 2GJNA 4JTQA 1EC9A 1BPLB 4RE4A 3AS3A 2ACRA 1BSIA 2ICSA 1WDRA 5CPNA 3TCSA 3ARQA 3KBMA 1L6GA 4R9XA 2CLIA 2ZXAA 3T2OA 4ATWA 3EB4A 3BMVA 4H6QA 4JAWA 1ELSA 2IKIA 2O9PA 2P53A 2R1LA 1XINA 4AVNA 1C7SA 3I3EA 1EZWA 2DPEA 3ZSSA 3OG3A 1W3NA 3EX2A 3I7RA 4HN8A 4FOUA 2BY3A 1OX5A 3FSUA 3U48A 4CD7A 4US5A 4PTWA 5HR6A 1FKWA 2CWXA 3AIWA 3GTXA 5A8MA 3BWWA 5DF0A 5A95A 3A13A 1ME7A 5BMWA 4LEQA 4WJ8A 4F2TA 3AHTA 3UEQA 4WGXA 3DGRA 2VGFA 5DCBA 2CLLA 5I77A 2CHRA 2GLKA 3CHCA 4QP0A 5EB8A 4RK8A 2R9RA 3T8LA 1LOLA 3N1AA 2XIQA 2Y1HA 3ZJKA 1W2PA 4PSPA 4W4QA 4BQ2A 1H49A 4CKQA 3BAKA 2ZX6A 4P8UA 3NDZA 4MDOA 2QJGA 2D0FA 2E28A 2ZBTA 3SY8A 2Q6ZA 3PWGA 5LIWX 5DXYA 4PCNA 3LHTA 3BARA 5I07A 3T40A 6TIMA 1O5XA 3LX9A 4ATDA 4AD0A 2X40A 4C1NA 2VC7A 3K5XA 2ZICA 4OU1A 2XM2A 4CVWA 4LBUA 4K3ZA 1OD8A 5FD0A 1ZP4A 4PTXA 1JD7A 2EJ1A 4GA8A 1PCKA 5I79A 3Q4DA 1J6OA 5E9XA 2JIEA 3G8RA 3CUGA 1KTNA 4H9UA 4RV8A 4BF5A 1FWTA 4JFUA 4ZTYA 1DIOA 4GVIA 1T0OA 4X0NA 3E2QA 5FEPA 1JNDA 2QDGA 1XLDA 2WANA 4MNLA 1WYIA 3VCRA 3TZNA 1B0IA 1FCQA 1M68A 5KMYA 3PF3A 4ZA0A 1TPC1 1IEVA 1IF2A 3RILA 2KZHA 2ZA2A 4M6UA 5LGXA 3OEXA 2OWCA 2YZ5A 1WX0A 2PDGA 3EWCA 3UG4A 3WLOA 1FHUA 4GFIA 2WPBA 3GNOA 2PAJA 5AN7A 2HXUA 1YE4A 3IV8A 1QR7A 4QM1A 3BSHA 1AD1A 4W7WA 1IWBA 3AALA 1XW8A 1JPMA 3OVRA 3ABSA 1YDVA 3AXIA 3H7RA 4ZE4A 4O0QA 1W5MA 3NYZA 5G4WA 1EQPA 2FMNA 3URBA 3TTOA 1N8FA 2PMQA 4L1GA 2WV8A 4DJED 2VQUA 1VCFA 3SZ8A 4YCPA 1N7KA 2B7QA 2ZTKA 2ISVA 4HTBA 4E8GA 5I00A 3TROA 4LF1A 4GIYA 1UJQA 4I7UA 2ZVIA 1NELA 1EA9C 4G7EB 3LS9A 4S3GA 4OUEA 1B1YA 1Q6OA 3B4UA 2G3FA 3EXTA 1HF6A 1P0NA 4DJDD 5HQLA 1ISYA 2XH0A 3K4WA 1D8WA 2WZEA 4PMQA 1WP6A 4QQ3A 3V5CA 4B15A 3AHZA 2A3BA 3CHVA 3GHUA 4OECA 1QOXA 3M6YA 1SJCA 4GY7A 4HSNA 2R1PA 4JIPA 1PAMA 2XN2A 2Y85A 4YLWA 2FJUB 5I3KA 1OSEA 4TIMA 4FX8A 1YEYA 3TAOA 1UC4A 5HMFA 3W01A 4AVOA 2P88A 4IUGA 2YCIX 5FKYA 4AZBA 5M03A 3E3HA 4WX2A 1ZS2A 1EJXC 2OR2A 1GQJA 3TC7A 2TAAA 3K30A 4C1LA 5BRBA 1W91A 4RZ6A 1AMKA 1GG1A 4O28A 5D9MA 1TPVA 1A5LC 3PUGA 4H9TA 2PFHA 5F7UA 4J28A 4MGGA 1KC7A 5TD4A 1U5JA 1MSSA 4JFTA 3U7VA 5A8NA 4K39A 3S2LA 1XYAA 1QTWA 1XCWA 3EDKA 4MNKA 1WZMA 4PMJA 2J78A 3NNTA 3M5ZA 5F1UA 2QJMA 2BGSA 2WZTA 1NFPA 1RQEA 1W1B1 4GQQA 4C6QA 5AC6A 3ZLGA 4HA3A 3EGJA 1PTDA 4N02A 3M7SA 3ATYA 5I09A 2IQ0A 3DIPA 1W1ZA 1IZCA 1VYRA 1F73A 2O9RA 3FEQA 2WCGA 3R5EA 5LHEA 1TZ9A 6A3HA 1W3IA 4AQLA 2VR5A 1UQYA 1CGXA 2PLJA 3MUIA 3SBFA 3QLLA 1BKSA 5D8WA 2JQXA 4AEOA 1XRSA 3KBSA 1CDGA 5BYWA 3UPBA 1KB3A 2QAFA 1RCQA 4OGZA 3IIPA 2V69A 4JL1A 4HTYA 4NILA 4GO8A 3T0AA 4E5TA 1DHKA 3A4XA 1R7OA 3DFTA 1R46A 4UBPC 1RVGA 3I3BA 4JXCA 4C6OA 1GOOA 5CZKA 3DG3A 3WK2A 3WQ8A 2VR4A 3R94A 2QCDB 4NX0A 3W53A 3NL3A 1PJ9A 3NM1A 3HGJA 4A3RA 3TYBA 4OV9A 3P61A 1ZZMA 2YDSA 1OEPA 4GKTA 1V3IA 3N11A 2QIWA 5A6SA 4AEFA 1E9IA 4YTQA 3CEPA 1HL2A 1FWNA 3OGRA 3OVQA 2A79A 3S9IA 2IXUA 1RQBA 2A6NA 3MT1A 5AHMA 3UT0A 3BTNA 3Q65A 2RDWA 4AF0B 4QS5A 1PCWA 1E43A 1JGMA 2E6DA 1HQTA 3SIZA 1SZEA 1OWQA 2OG9A 1JCXA 1TRDA 3VOFA 4JD4A 3H7UA 4JOMA 1GEHA 3NDYA 3UQNA 4QNEA 3U8GA 3AUOA 2QLYA 5FJUA 2OKOA 3I4KA 5FACA 1TTJA 1Q85A 1WKDA 4PMOA 3TQVA 4RKAA 3KBNA 1LLWA 4Z2IA 5IM51 5DY3A 4NZFA 4LUSA 2A0NA 1VC4A 1Z3NA 3W1AA 4K6AA 2C6QA 1KXTA 3PULA 1JXKA 1P1XA 2PWVA 4FNSA 3AU6A 4DJFA 2VD8A 1VBUA 2P76A 1E6QM 2FVLA 4ACZB 4Q8TA 4GZIA 4EPBC 2A7PA 3AS1A 3QPZA 4KWVA 1PYMA 5G2IA 3UVIA 4YTRA 3V7PA 3MUCA 4Z2HA 2PA6A 3W38A 2PGFA 2W3ZA 4PMVA 2C1GA 2GGEA 2X30A 3KWSA 1Q65A 4UFLA 3EXRA 4GINA 4IJBA 4LC6A 1C3FA 1E4MM 2TYSA 5F4SA 1MQPA 2XIIA 4JTLA 4JTGA 1GVQA 1MNZA 3WO8A 3OODA 2NVAA 3KRUA 4GI9A 4PBGA 3VYLA 1F05A 2HK0A 4JIQA 4Q4MA 5AYBA 5AC7A 4BQ5A 5EMUA 1IIGA 3F7JA 1JL8A 4OIFA 4CQAA 1UP0A 5K9CA 1MFVA 2PWGA 4M7TA 4KCVA 2ZX8A 4MF4A 3OHIA 1VCVA 1L6YA 1PDYA 3ITTA 3APGA 1KFCA 3HIJA 1B3WA 5AHEA 2FPVA 2X0HA 1QATA 3II1A 1NWSA 4LOCA 5C6MA 3HGSA 3EOOA 4DO7A 3ELFA 4I7WA 3C0QA 2OT0A 2G97A 1U2YA 3UA4A 4MB1A 4N6EA 2WHLA 4WXYA 5KZEA 3L2MA 3I4EA 1PV8A 2WC7A 4V27A 4IP4A 4QDWA 4LYKA 1Q6GA 2W4XA 3GB6A 2P3EA 2G3IA 3DUGA 4GYFA 3O07A 1X7FA 3G6MA 4G7EA 3TIMA 4KH2A 2PDWA 3HZ3A 3M7WA 1ZTVA 1SO6A 1M04A 4DBWA 1F3WA 4IIDA 1DIKA 1UR4A 3UY8A 3V36A 1J0YA 3EWXA 4LY8A 2FZBA 2W67A 3CMFA 4XO6A 4U31A 3ABOA 4IG2B 1JNEA 2J7BA 5HK4A 1KM5A 4ZOCA 3P8JA 4O15A 4DELA 3MHGA 5D9PA 2OQYA 2C1HA 4U2ZA 3GTIA 4FXJA 2GSHA 4MYAA 1J18A 4X3ZA 1V5XA 1ADDA 4N2YA 1A3XA 4UTMA 1GK8A 2QMKA 2NUYA 2CC0A 1DV7A 2YYTA 1TR1A 4S3FA 3VIOA 1KD0A 1DOSA 1VFUA 2JALA 3H2AA 5K4ZA 3TJLA 4GISA 2Q3OA 2V8ZA 1FFQA 1XSJA 4IQJA 1H63A 5C70A 1VPYA 4ERIA 1DWAM 3KLLA 4K8GA 2NT1A 4W7VA 1H50A 3N3TA 4UR8A 3QW4B 2XIOA 4JEJA 2ACUA 3AUJA 3R0DA 3RCNA 3DHUA 5C2CA 1GZJA 3N6QA 1UPPA 7CGTA 1GHSA 3E0WA 4QFUA 4R7OA 4W7UA 2VWTA 3PZVA 4H41A 1W8SA 3DXIA 1TJPA 4Q8OA 1GOWA 4GKLA 1QOPA 3W86A 1KTBA 3KL5A 1UCWA 6ALDA 2XINA 1GW9A 1SW3A 4TOQA 2CEQA 3ZT7A 3BMXA 4GCAA 3SFKA 3M64A 4WKAA 1EA0A 2PTYA 1BVNP 4WZHA 5U7SA 3CXOA 5FJTA 4Y96A 1TV3A 3OA5A 4HMEA 3TYCA 3IIVA 4C6NA 3ZJ6A 3LHZA 1UKPA 1F6PA 4E38A 4Q4RA 2O92A 3LTPA 2ZDSA 3BLFA 3IGXA 4WKHA 2CBJA 2VRJA 3P0WA 1K6AA 1EH9A 4JYEA 2OT1A 4FPSA 3F4WA 1FWDC 4GPNA 3ARRA 3E96A 3EWBX 3AS2A 3W7GA 4NNCA 4ES4A 1BWKA 2WHKA 4AWTA 4A8LA 5ABFB 1JDEA 3HOJA 2WQPA 3TFCA 3O0KA 2B7PA 3I65A 2UV8G 1CIUA 4EACA 3GTFA 1H11A 3MHUA 2WNNA 4NQ1A 3HURA 5AC8A 3N25A 3BOXA 5HMSA 4YVPA 2HBXA 3WD3A 4F48A 4F8XA 4F0HA 3E2VA 4Q8UA 4AY8A 3TWAA 2CFFA 3HFTA 2QCDA 2ZZ4A 3CUJA 4JFWA 1XRVA 3B8IA 4KWWA 5K9XA 1LTDA 1XLKA 2W6RA 3PG8A 1IXPA 4AG0A 4C6DA 4FZIA 3R8GA 2IQTA 1LQ2A 2CKSA 1XIDA 3VE9A 3UJEA 2AKMA 3E0FA 4IHCA 3T09A 3OB8A 2EG7A 4TVUA 2OU4A 1E70M 4Y90A 3WK0A 1XLEA 3POHA 4Q8PA 1NDWA 3S5ZA 3VGDA 1LL4A 2YBUA 5FF4A 4LT9A 2YL6A 1EJVC 4L80A 3NQ8A 4AF0A 4NJJA 4HMCA 3W24A 3M0XA 4ZCWA 1W3JA 5U4NA 5KSWA 2Z7KA 1Z7AA 3UCDA 1YNYA 4W5ZA 3W75A 4H7VA 4K37A 4DYKA 5GQBA 3CMGA 3LM3A 3N2XA 1UWRA 1OC6A 2ZZ3A 3EEZA 5I5RA 1PZ2A 1XPGA 4DUWA 3GLCA 1W5NA 1JPIA 3DAQA 5DMMA 3MKKA 3OLGA 2DH2A 1KQZA 4QXIA 3RLUA 1RBOB 1TUFA 2G5WA 6REQB 1TVLA 4V1XA 1V3JA 2J7EA 1RK5A 3POCA 1EIXA 1ZAJA 4ACZA 4JTKA 2YXOA 2XVLA 1IWPA 1AL7A 1WUEA 2PCEA 3W7CA 3M43A 1SFSA 1LROA 1VR6A 2X42A 1G94A 3VO0A 1EOMA 1UMYA 3L68A 1LL6A 2DW6A 4L4PA 3FXYA 4IX0A 4YL2A 3ISIX 4RL3A 4QG9A 1SO5A 1UOKA 3G8EA 2AL2B 1TSIA 3E9AA 4DZAA 2DZPA 3AU2A 3GU2A 3GTHA 5M3WA 3VU2A 4DBSA 2J9YA 3VILA 2Y4SA 3ARWA 3U57A 3GZAA 3DENA 4DJEA 4DWDA 3DFSA 4ICMA 3BJSA 4L9YA 3OG2A 5HNTA 3W81A 3CIWA 4LV9A 2E3ZA 3GO2A 2WLYA 3Q45A 1TQJA 3ZYZA 4PE8A 3FJ6A 4QITA 2VEFA 5T9CE 1L0PA 2Y62A 3UZYA 1SW0A 3N4FA 1CPUA 4OBRA 2FMOA 5C9XA 3SSJA 3IEBA 1LDCA 4AD4A 2J62A 3DN5A 3QOMA 4DZ5A 3CUFA 4DJDA 1P1MA 1E6PA 4XZMX 4KRTA 2YSWA 3WQCA 2XGZA 3QKZA 1NIUA 4L61A 3ZSTA 2NXHA 1BXBA 4A3YA 1JYVA 1EUAA 1O94A 3VOIA 4NXSA 1R8LA 2NQ5A 3S6TA 2GVLA 2PDIA 3VD9A 3G1SA 3M46A 4MIMA 3FA4A 3PNUA 3G1VA 3ORWA 3ONBA 4WDXA 4ONVA 3PZIA 5JQ9A 2PTZA 5L6UA 1SSDA 4IG2A 5CLWA 4Q7IA 5HMEA 4LS2A 1MRQA 4QJ4B 1SO4A 1MYRA 3T55A 1UH4A 4JKLA 4MG4A 4C6IA 1LWHA 5D09A 5EU9A 1OG6A 3AJ7A 5F2GA 1GQKA 4BF9A 3RCYA 1E72M 4ZO9A 2XH4A 1SJDA 1E5NA 4WEVX 4X22A 2O55A 4CNSA 4KERA 1MDRA 1GOKA 3KCJA 2I5GA 3WQEA 4GC3A 4IWWA 4CNNA 3GG1A 1B31A 3QEZA 4GH3A 1QOQA 3VD7A 2XN0A 3RMJA 5K7JA 4IIHA 1UWSA 4O1FA 1HJQA 3VMPA 4BWLA 3P0XA 4ADUA 2IKHA 2FHFA 2MNRA 3TYDA 3NQDA 7A3HA 1PHQA 1UA7A 1IXOA 3WNNA 3WUBA 2A6LA 4UFMA 4KGLA 3NO3A 2A3CA 4IPLA 5AKQA 2PDNA 2WKLA 3BURA 1A0CA 3P2VA 3L4ZA 1QHZA 4V33A 4RE0A 4AX6A 1IT0A 3HQOA 2VEMA 5C54A 4LV4A 3CB3A 1IEIA 3H21A 3IAQA 1ZPTA 1GVRA 4K1WA 4RXFA 2ON3A 4PCFA 2OVLA 4JTSA 2V5BA 5CZSA 1XBXA 3HGOA 1XCFA 3QOKA 4G8TA 4ZQRA 1UD6A 2YZRA 3K8KA 4H9ZA 4R85A 2XVKA 3MHFA 4XZBA 4UMAA 1F4AA 1AQFA 4S3DA 3HA1A 1M9HA 2GQ8A 1ITCA 5HWMA 5D9OA 3FA3A 5HJXA 3WKZA 2J7CA 2ZRYA 1R3SA 2BS9A 4PFHA 4GYKA 4RCXA 5BOFA 3L5LA 1TIMA 1JCTA 2XIJA 4JTJA 3BMWA 1EP1A 2FQIA 3QV7A 3V0UA 3Q94A 5HA7A 2C1IA 3M0ZA 1XWYA 2FPYA 3QBUA 4GMEA 3LCWA 1A5MC 3AC0A 1GW1A 3QQ1A 2MUCA 3S4TA 1T99A 5ABFA 3OTRA 1R9YA 1EXPA 1OIFA 1Q8AA 4WVXA 1UD3A 2CZDA 2FHCA 5DANA 2PDCA 1NVMA 3KW3A 1KWKA 1HKJA 2Z2UA 3GR8A 4H04A 2CLFA 1PX3A 2QULA 3SCPA 4W84A 4QIUA 1VKFA 2D23A 5FEXA 1K8ZA 2ZUWA 1GPWA 4LAZA 4NSBA 2C13A 3MV11 3UPWA 4W85A 1ONRA 1O1ZA 4L4MA 5DRCA 3KM8A 3EOUA 1S3HA 2REQB 1TQXA 5GNZA 1Q2RA 3HN3A 5EFDA 5DMNA 3O05A 4IMAA 1S2VA 5HINA 1OGSA 4LF2A 1UZ1A 5CH9A 3RR4A 3NPXA 3RO6A 1GZGA 4GOAA 2GQ9A 4KEUA 1FWIC 3WD0A 1AK5A 1TV4A 2EHHA 3BJTA 3K1GA 3GVWA 2QCGA 4DUVA 5JXQA 1YPIA 4JKKA 3CB8A 3DI1A 3P67A 1EBHA 3WDIA 1TELA 2GWNA 1CT5A 2QR6A 1RSCA 1VQTA 3WJXA 5FF2A 1UP3A 3PPFA 3UR5A 3W2LA 4K8EA 4NAFB 3IJQA 3Q58A 1UH3A 2ZC1A 3F1QA 3PUOA 4KIRA 3A5FA 3KFTA 3OVPA 1QAPA 4KW2A 6REQA 3GNDA 4GVGA 2DQWA 1TYGA 4XB3A 1DTUA 1OIMA 2QCCA 4LFYA 4PB5A 3S42A 1SM9A 1UD4A 3C52A 4PMNA 4ZXLA 1XRFA 1D2KA 1BHGA 3WELA 1R3RA 1LBLA 3RPDA 4KEMA 3W1UA 3OP2A 2QCLA 3SRDA 5XINA 1Z48A 2Q09A 2FFCA 3IGUA 1TG7A 1ZJAA 3R12A 3WLTA 2V6AA 3LCLA 4LBRA 4YN5A 4F66A 1RK6A 3APTA 3GG0A 4JICA 4OZOA 3WMLA 1Z89A 4K7VA 4M0XA 4UFKA 3WEMA 4CQDA 3DFPA 5IOBA 2AL2A 4KEVA 5HMDA 4KGJA 4O0KA 3QPEA 2FZ9A 3ICJA 5BRPA 2WMKA 2QV5A 3HPFA 4AIEA 4Y9AA 4ACYA 1B54A 3FHQA 4PB3A 4F9DA 4D8AA 1MUWA 4N9CA 3EDEA 1ECEA 2NXIA 3FLUA 3W74A 4XVDA 2NQLA 1R2RA 8A3HA 1PUDA 3KAOA 2DIKA 2DVUA 1MMFA 5FF3A 3HMCA 4BJHA 4LXFA 5LIUX 3G0XA 5GPRA 5LNWA 4BF7A 2B7NA 2PP1A 4B16A 1QMLA 4PEKA 3ARZA 3M0IA 1B3ZA 1RA5A 4UTTC 4LNCA 3K4DA 4ZB2A 5KTLA 4S3CA 3SCVA 4AVFA 1F8IA 2QIIA 1DQWA 2QPUA 3DH7A 2X16A 1C9WA 1TCDA 6CGTA 1E1EA 2X41A 1VLWA 4MWAE 2PP3A 3U9IA 4P2VA 4R5EA 5BZAA 5CSUA 1JDCA 2R6OA 2DT2A 2QAPA 3STCA 3LRKA 1VEPA 3ITOA 4M6PA 4LRSA 4JZ5A 1V79A 4L4OA 2PUZA 2QCEA 1XX1A 1PX8A 2VI0A 4W9TA 1PKYA 4X60A 3PUDA 2JBMA 4A3UA 1PZ1A 2E8YA 2WHJA 4XUYA 3GD6A 1K4HA 1E6NA 4ML9A 4B3KA 8XIAA 1GUVA 3GHRA 3IUHA 1UR2A 2YA2A 2YBVA 3BAXA 1V93A 1ISVA 1G69A 2ISSA 4J5NA 1PE1A 3G24A 3DDMA 2HVNA 3O06A 1H62A 5M1TA 3M0JA 1AUSL 1ODUA 4BCEA 3UBPC 4ZODA 1XDLA 1VBHA 4PMZA 5EMKA 2WO5A 1V7YA 3W72A 4Z2LA 3QXBA 3CK5A 1GPFA 3O6YX 5JIPA 3GFYA 3AWOA 1CI1A 3OHMB 1HTIA 2ABAA 1ZLPA 1YXYA 4K1GA 1HN1A 1ALDA 1XPYA 4I9MA 2Z6JA 3W00A 3W1QA 3A6OA 2EO7A 2RH9A 1HL8A 4IMFA 4HIBA 2HROA 3RU6A 2BY0A 4ZQNA 2UY3A 2DY3A 3TN5A 1QFEA 1KFBA 1QJWA 1TVPA 3NL6A 3DG7A 2WSPA 1BSLA 2VC5A 4PR4A 4EP8C 3GNPA 3W1LA 4QE4A 4KCTA 4GIAA 4KPLA 3VDCA 1RBLA 3VAVA 1QT1A 5DEZA 5CPOA 2Y6ZA 1IEXA 1EB3A 1NDYA 3HU7A 2ISDA 2BP1A 1H0GA 3IJLA 1H60A 3H7VA 1IGWA 5C71A 3W3OA 4FNUA 1H09A 1KXVA 3QQWA 4EWND 2YA0A 2GGGA 2NQJA 1TZZA 3NQGA 1OINA 1UYQA 2WK2A 3O16A 3OGVA 1VJZA 4IL0A 3W1MA 4PULA 3L9CA 1NF0A 3UA3A 4WDWA 3GIYA 3AI0A 1V03A 3D5HA 3G1HA 3M47A 3NQ2A 2OFJA 4Y9NA 3UWWA 4K7YA 1QUMA 3WNPA 4HU3A 4MB5A 3N73A 1QNVA 4U3AA 3VA8A 5DX7A 3SN0A 4HNOA 3QW3A 4MNMA 5ABTA 1SJAA 1LM1A 4XAGA 3LCIA 1YPXA 4QNWA 2Z1XA 1TMHA 1VYPX 3KVLA 4FXSA 3C86A 4JN7A 2QZRA 1A5AA 3B8VA 3CZEA 1H5VA 3LM7A 4IMDA 3WNKA 1MRAA 4DYEA 1JCLA 1JIBA 4GJJA 5D33A 1BG4A 1GTEA 3RO8A 2X0SA 5EY5A 4PUNA 3QZ6A 4NU7A 2V0TA 3QMTA 4PMYA 3TTEA 1EC7A 1WXYA 3KXQA 5CXPA 3QTPA 1PEZA 4LX4A 1MXGA 3IACA 4LCSA 4Q22A 1ZENA 1PIIA 2ZZ6A 3U2ZA 5G2HA 5CC7A 2WOQA 1HJUA 1E9ZB 2E77A 4ICCX 4ZB5A 1XV8A 5C2GA 4JN8A 3NQAA 1M7XA 1SR9A 3QRHA 2REQA 4PZVA 2OEKA 3SUSA 2CYGA 1H7WA 1IXNA 2FGBA 3WQWA 1UR3M 3F2DA 5C5YA 3HV8A 3O6AA 2OODA 3GC4A 4WJEA 5FL1A 4XTIA 1E6ZA 1EJRC 3HPSA 4U5KA 3R0UA 7REQB 2VX6A 4GK8A 1FWJC 3NQFA 3LTYA 3RX2A 4TMCA 4CU7A 1RY0A 1M65A 4XK2A 4UWMA 3UU0A 3H54A 1GKQA 4YXGA 3CHFA 3NPVA 5AFDA 1R2SA 1ZAIA 5D2TA 3L4VA 2PS2A 5H2ZA 1Y7VA 3ARYA 4QR6A 4EPKA 2WSKA 3BGJA 1UZ4A 2Y7DA 4JNYA 5EYWA 1DJNA 4FLOA 4NAFA 4G56A 3NO5A 1OFPA 3QR0A 1AJZA 4MLJA 2WMGA 3SCRA 1RJPA 1CX9A 2VVNA 4UCFA 2POTA 4IPPA 1L9WA 4AD2A 4BZYA 1RP8A 4FNRA 2OX1A 1GQIA 1X6UA 2Y24A 3QZAA 3VNZA 4PN2A 1PIFA 1RALA 3W6LA 3TKFA 1QW8A 4DBUA 1JRCA 4E2OA 1KKRA 1R0MA 4ZO7A 1U83A 3N04A 2VFEA 5J5DA 4B5SA 2NLIA 3GC5A 2XUCA 3KTSA 1A47A 4UMCA 3URAA 5A1AA 3SCWA 2GZXA 2DZUA 2EG8A 1DE5A 5A6JA 1KO0A 1WDQA 1BYAA 3PTDA 4ML4A 1IWAA 2A3LA 4P5UA 2BVYA 3RPMA 4HP5A 4QLJA 2I9EA 3DX5A 1ZP3A 3ARTA 3WLRA 3OBAA 3A64A 2BOFX 1LF1A 5CPTA 3VKDA 2FVMA 3LLFA 2V67A 3E2SA 3WJSA 4GYJA 1CXFA 3BOFA 1F4HA 1SFLA 1YNQA 3T4WA 2F8QA 4ZQPA 2Y88A 1F76A 4HNUA 3S83A 1NU5A 3W7LA 2CW6A 4AZCB 3T2QA 4MJMA 2PGWA 3BAIA 3LTSA 4D6GA 5EMYA 5ABHA 1PKNA 3EDDA 3W7PA 3HMJG 3OQ8A 2O4MA 1GZ1A 3UWZA 3USZA 1TWDA 3BPWA 5I2UA 3URNA 4LRTA 5I0DA 4GG9A 5RUBA 1D7KA 4LSBA 5BRQA 3C3NA 4DWSC 4GUHA 3MWCA 1SZFA 3SGZA 5BNKA 4IGNA 4V15A 3UJ2A 2V2DA 1P7TB 4HGXA 2E9MA 4LBSA 4G5DA 1OCJA 3S46A 2CETA 1K9FA 4KEZA 3LSCA 3NPUA 4U3CA 1HT6A 1EF2A 2IS7A 3ITVA 1NJJA 1PDZA 2Q71A 1FX6A 1GNXA 1OC7A 1TWSA 1ME9A 3W1NA 2PDFA 2OWXA 3ITYA 1KFJA 1DIDA 2XWDA 4OWGA 1I0BA 1J6PA 1KBJA 1TWWA 3MI3A 4IFKA 5BXTA 1EP3A 1Z41A 4X63A 2FKPA 3R58A 4DQWA 3SI9A 3KOXA 4M56A 3R11A 3S2JA 5CZTA 3A22A 2WB5A 3VPLA 4E0CA 1MEWA 3DYPA 2VMFA 1MFUA 3G1AA 3VMOA 1HJWA 3HV9A 2ZIDA 3EKZA 1A5UA 2A4AA 1MEHA 2A3HA 2Z00A 3SFWA 2WJFA 4P7NA 3PTMA 1W5PA 3DCPA 3W76A 4PFMA 1TE1A 4LH8A 4WDUA 4JIEA 2QJHA 3S1WA 3LHWA 3VIIA 1HJXA 1Q4NX 3L65A 3AXMA 2WJEA 4Q33A 1Q6FA 4XO7A 3NTYA 4LYPA 4LB3A 3HG2A 3MTWA 1FWWA 4TO8A 1WA3A 2PI6A 1MUCA 1ZL1A 3T0CA 4E3VA 1FWSA 5KZ6A 4J3SA 8XIMA 3QGKC 3L21A 3IS4A 1S5MA 7TIMA 5JH1A 3TWBA 4I9TA 3QHNA 1H7OA 2VCCA 4PRWA 4TX6A 9RUBA 5A6LA 4YMZA 5A6KA 1UKTA 1DVJA 3EOSA 3I3DA 1NM9A 1OFOA 3SCSA 1H1NA 1DKWA 3PTQA 3ITXA 4AUBA 1X98A 3MVIA 1KLZA 1V0KA 5CLTA 3V18A 3K8MA 4P61A 3H22A 3ABXA 4HNCA 1EWEA 3WD1A 3HB9A 4Y8FA 4LAUA 1X6NA 1V77A 4PCTA 5DT7A 3O3RA 2W92A 1Q45A 3MB9A 3S1GA 5A2AA 2OLAA 2DSKA 3T2PA 2Z27A 1HP4A 2EQDA 4RW3A 1X6LA 1TV2A 1A0DA 1E1CB 1FDZA 4LNYA 3VCNA 2VFGA 1MZHA 4QCEA 4XZIA 4NUWA 1MXSA 3C0SA 5D02A 3PJTA 2CPUA 3VX1A 7REQA 4JCLA 1QI4A 3COTA 1IEWA 1K77A 3G18A 1UA3A 3P74A 2WWDA 4QS6A 2NVCA 3SB0A 3DBNA 3CPUA 1J10A 5LNUA 1XBVA 4IMCA 1QPRA 2SFPA 2VL4A 4BQ4A 4RW5A 1OM0A 4GUIA 3NQEA 4JY9A 5XIAA 3SO7A 2DT0A 3WMCA 3VNYA 3MSGA 3CV7A 1P6BA 4U2YA 3EB2A 4UTLA 4D9PA 3GC2A 3DESA 3AO0A 3ABZA 1NH6A 4CD8A 2VKZG 1IIHA 2ZZ1A 1MNSA 1FY6A 1J01A 1H2JA 4XVEA 2A21A 3WYZA 3GK0A 2DSVA 3CPGA 3LU2A 3PJUA 5EPDA 3SJ3A 3ZM8A 1ME8A 5CC6A 3RFAA 2FH8A 4AZGA 5G1MA 1J4EA 4NAEB 2NV9A 1HNYA 4J35A 1KM1A 4OJYA 4I6KA 2FDSA 3S9YA 2NV1A 1OVDA 2DJLA 4YTUA 4HD5A 1XIHA 3JZUA 3KZPA 3TJ4A 1ZY9A 1QPKA 2FJKA 4IX2A 3MSYA 3IRSA 1RPKA 2ZUMA 3QV8A 4L7ZA 4NI8A 4O4VA 2ZRWA 2V3FA 4LQ1A 3MJMA 3TVAA 1PKLA 2DSUA 2Y8UA 3TTSA 3CAWA 4O1AA 2VURA 1ZHAA 5C7HA 1W9VA 3OBKA 1DJGA 3RCMA 3TN3A 2EBNA 3Q37A 3UGVA 4AZCA 3U4AA 4RPPA 3LENA 3QTGA 4CGTA 1GOIA 3B3DA 3KVKA 2JGYA 1JCJA 4ROQA 2D24A 1UZHA 2J66A 3LRLA 2J9ZA 3V5OA 3FN9A 5K4XA 2BG5A 1FH9A 3RJYA 3SRHA 3CZLA 4GZEA 4P7LA 2QF7A 2VHLA 2BXVA 1B90A 5CGMA 2CZFA 2WNWA 1C9DA 3A3WA 4L4LA 4L1WA 4C7FA 4DO5A 3C0LA 1A5KC 2ADAA 2OYLA 4FMVA 2AGTA 2C3ZA 4WSKA 4K36A 9CGTA 1P7TA 4NP7A 3TSDA 3LBCA 2R91A 3PZUA 3THUA 3L4WA 3TMQA 1DJXA 4Z08A 2V82A 4ASTA 5HDRA 1UD5A 2E6FA 5F2MA 2ZA3A 4RZ4A 2GVYA 1JYNA 1JYWA 1UD2A 1TCMA 2D2GA 1CXHA 2WVVB 2CXGA 4DEFA 3GDRA 4UXDA 3TA9A 2BTMA 3EWWA 1ZJHA 1U1JA 1H0IA 1OADA 2PDHA 1KGXA 3GIQA 2V3GA 3EZ4A 4UQDA 1X1NA 3LHVA 2XPKA 1JF6A 3NZPA 4HNLA 3GVGA 5FCZA 1RR2A 1G4EA 4HU4A 2ZTJA 2XJ7A 4Z2JA 1B57A 2VTFA 2VFIA 4AY7A 1JZ4A 2P5NA 4O50A 4IXHA 3M9YA 1LOSA 4NJIA 5AB3A 4RDWA 1V4YA 2VP8A 2VEKA 4P7OA 4MSSA 4XAFA 4WGHA 3QC3A 3N17A 4URIA 3VC5A 4A05A 5D32A 1T8QA 2QUVA 3IIOA 3CL6A 1UJPA 1TPUA 2YW3A 4EVZA 1M3UA 3R89A 4DF1A 1QASA 3E6EA 4MAVA 3LMYA 1D3CA 4Q4SA 1GVIA 2AQVA 1DWGM 3FYYA 3OPSA 1W1TA 3KOYA 4ENLA 1H41A 1VBRA 4UZUA 1VZWA 3GWQA 3LNMA 4FNQA 3WSUA 3KS6A 4XD4A 2DDXA 1OFAA 4EAYA 4EXAA 1RY8A 5IXEA 4BQ3A 1KTCA 1ISZA 1KM0A 1OFBA 1Z8AA 2QUMA 2VDGA 3FHAA 2B81A 2ATMA 1BYBA 1BKHA 1KV8A 3IANA 5FJOA</