1TV7A

Structure of the s-adenosylmethionine dependent enzyme moaa
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
327
Chain Sequence
EQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein A
publication title Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligand binding protein
total genus 108
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.1.99.22: GTP 3',8-cyclase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04055 Radical_SAM Radical SAM superfamily
A PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1tv7A00
2QDGA 1A5AA 5HMSA 4ALDA 4NJKA 1J2WA 4DBEA 3G3MA 4XKYB 2ZZ1A 1KTCA 4TX9A 1F7BA 3KX6A 5G1YA 1OYCA 3LHZA 1WYIA 1QPRA 4O15A 2QCDB 1A53A 4D2JA 5I3FA 4L4LA 4P2VA 1LP6A 3LI0A 1ZHAA 2C14A 3FLUA 2FPVA 3CEUA 3NDOA 5G2IA 1SZGA 1THFD 3WFAA 4NNCA 5U4NA 1VQTA 3MHGA 4N2YA 3CIWA 3O15A 3I65A 4WJEA 2BX7A 3AO0A 4ZQOA 1SSGA 2I1OA 2ZA3A 4IMDA 1B4EA 1H7OA 3FYPA 4Q32A 1I4NA 3HMJG 4M5PA 1QAPA 1LTDA 3QPZA 2ZCGA 3TFXA 5BRBA 4HN4A 1L6WA 3MHFA 3LTPA 5J5RA 3M43A 3M5VA 3MP5A 3P7YA 3B06A 4N02A 3CC1A 3W75A 1YDOA 3BLIA 3S42A 1F2JA 2VKZG 3EWWA 1D3GA 3NZ1A 5G1TA 3IIXA 1FCBA 3TW7A 3G0SA 1PCWA 5CKSA 1KW1A 1OYAA 1PL9A 4O53A 2VENA 3R8RA 3C4UA 5EL1A 1HG3A 2DZUA 1W31A 3TUUA 3H54A 4H3DA 2H6RA 1O5KA 2ZRZA 3C52A 3QZEA 4XWUA 5K3VA 4CNPA 1PE1A 8TIMA 4UFKA 1SW3A 2E5CA 4KWWA 3PBWA 2W6RA 2Y61A 3IEBA 1GTHA 1SZFA 3RFAA 3JRKA 2OT0A 5K4ZA 3KRSA 4NT0A 1QFEA 5LGZA 1C8VA 1Q6LA 4BR1A 3W1XA 4HSNA 1K03A 2YSWA 5D2WA 4UTHA 1WQ5A 4MFEA 1ICQA 3HIJA 4N9DA 4FO4A 3L65A 1N7KA 2Y7DA 1KM6A 4RCXA 2ZRVA 4MYAA 5DXYA 1TV5A 3PG8A 3CWOX 3UXDA 3TXVA 1G67A 5BOOA 4AWTA 2ZRUA 1UBSA 4GJ1A 1R2TA 1YDVA 4LVGA 2A85A 3HF3A 4MJZA 4O4WA 3EX3A 2GQ9A 3GYEA 4TR9A 3I68A 3Q58A 3DI0A 2WOQA 1O95A 4IMFA 5KZDA 3DXIA 4QNWA 5D32A 2JKAA 4RX0A 1VHCA 3C2FA 3HG5A 1ZAIA 2NXIA 1AL7A 2EGZA 5EPDA 1R47A 3C6CA 3M9YA 5D30A 1OG0A 5L6UA 3SFKA 3FEMA 2Y6ZA 3B0VC 1TPVA 2NUWA 2H8ZA 4UNLA 2WKJA 1E51A 2CLHA 2VFDA 2DP3A 1JJKA 1AW2A 4MLRA 2Y70A 2QCEA 2WNQA 4C1LA 5FF0A 4JDBA 3N9RA 1LBMA 4ICNA 3TAKA 3FJ6A 3INPA 3W2MA 1LYXA 4LUJA 2Y7EA 3ABSA 4HKPA 3LRLA 1KM2A 3GKAA 4O1CA 4N9EA 1YPIA 1H60A 3NYZA 3P80A 1SUXA 1WV2A 3LCXA 1EB3A 1YDNA 4WD0A 1ZJIA 1OK4A 4TMCA 2WV8A 4N9CA 3LERA 5G2HA 3W1TA 3M7WA 5EY5A 2ZQ0A 1XBYA 4ZMGA 3BG3A 1WOAA 5DCDA 1QPNA 5HUPA 1XM3A 2E5DA 4FNUA 5CSSA 2WPBA 3L21A 1KV8A 1TPWA 3VE9A 2YPIA 3ATZA 4ORMA 5GVJA 5BMWA 4BWLA 3MBFA 3O8AA 4J9JA 2EKCA 3C61A 4ZL1A 2CFFA 3G1HA 4PCFA 1TPH1 4JX6A 4NJIA 4HHPA 3TJXA 1AMKA 3SECA 1F6PA 5K9CA 5LSMA 4ORIA 1C29A 4PA8A 3SZ8A 4MOZA 3Q37A 3W1RA 4QNEA 3W1UA 3IV3A 3LCLA 2IQTA 4FNPA 4MY8A 5IM51 2W79A 4WZHA 3TIMA 2V30A 4ONVA 3HPXA 5AYYA 2JGQA 3E12A 3HGOA 3M5YA 3EWBX 2XN1A 1KBIA 2ZZ4A 5D2XA 3DZ1A 3QFEA 4ZZ9A 3YPIA 1XBXA 2RH9A 4GUIA 2EHHA 3WJZA 5DCBA 4EWND 2FB3A 4R7JA 3TH6A 6TIMA 1FUYA 2NV1A 1GWJA 1DV7A 1KM4A 1M6JA 4CLMA 4CQAA 5D2VA 4FF7A 5HR6A 2C15A 5DLCA 2DZPA 2G95A 2P10A 4E0CA 1JRBA 2H3BA 4O1DA 2CLFA 3WJYA 1TJPA 2NX1A 3FS2A 4Q4KA 1O4UA 4ZQRA 1W3IA 2JGYA 1GTEA 4O11A 3LBCA 3GLCA 2ZRYA 1WOBA 5FEXA 3GDKA 1KTNA 1IIHA 4R53A 3U6WA 1QNVA 1GVFA 4M7TA 4RZ4A 1DQWA 2A2IA 5CZSA 2B4GA 1G7VA 3LHUA 3JR2A 3N2XA 4UTJA 3S6DA 4UTMA 4UFLA 4TMBA 3DAQA 2QJGA 3HG4A 3T44A 3UYCA 3THQA 2R8WA 4RK8A 3TFCA 4GWEA 1RQBA 3QM3A 3S5NA 2CZFA 3WJSA 4BWLC 2RKXA 3QMRA 3PS7A 4EIVA 1H5YA 2R14A 2A6NA 4Y90A 1H51A 1RQHA 3THAA 3HGSA 1BWLA 1H62A 1TO3A 3E49A 1MZHA 1NEYA 3UWYA 2E77A 3IVSA 2YR1A 4WOQA 5C5YA 1G69A 4E2BA 2J9YA 4JX5A 3PWAA 3NGJA 4CQ8A 1I2OA 3QSTA 4DF1A 2NLIA 2DORA 4GUJA 5HULA 4NU7A 1VC4A 3S5ZA 4JXCA 3BLEA 1KFBA 3NQFA 3O6YX 2QJHA 3W2KA 5K4XA 3CQ0A 4ZQNA 4ADUA 1L6SA 2AQWA 4UTLA 5CPLA 1R46A 3W1MA 5AC8A 1Z44A 3DKLA 2YXGA 4K38A 3W7HA 2JK2A 3BW2A 3R12A 1KA9F 1O94A 4YWIA 2A7RA 3NOEA 5KTLA 2QF7A 4FIQA 4K39A 3W1QA 3LB0A 3FIGA 1LOQA 5FEZA 2QUUA 1UUMA 2QCNA 5LGXA 1T96A 3NQEA 1SW0A 3ELFA 4CCDA 1WXJA 4ADSA 3EXTA 4RXFA 1FXQA 1C9DA 4H6KA 2B7QA 1K7FA 3NR0A 2FB2A 3W83A 3KVMA 2VFEA 4Z08A 1VRDA 4MZ1A 2ATMA 2OMAA 1XBZA 1YXDA 3PY2A 1M5WA 2CLLA 2P1FA 1UB3A 1F74A 3Q2DA 5IBXA 2GVJA 3C56A 1OX6A 4JIPA 5G2WA 1Q45A 3M6YA 3MW7A 4FNTA 4IWWA 1OX4B 4S2BA 4MY9A 1DKWA 2CWNA 1X7FA 4H4IA 4UTTA 1L2UA 2ZTKA 2E6DA 1VGAA 4M6QA 5K9DA 1QO5A 1W37A 2NXHA 1XDLA 4FEZA 5EKYA 4U28A 4UCGA 3EX4A 1SO5A 3BGGA 4NX0A 5KSWA 3LHWA 4K7VA 5KITA 1MO0A 1RQEA 2PRLA 4GRSA 3STCA 5F2GA 3F03K 1AK5A 3KHJA 3M0ZA 3PG9A 3CM4A 3MYPA 3GXNA 4WX2A 4LC6A 2TRSA 3FJLA 4HNNA 2PRMA 2GJLA 3AJXA 1VHNA 3DKJA 1B57A 4I7UA 2ZA1A 1FX6A 4RR4A 2QUVA 4DXVA 3B0PA 1LCOA 2NZLA 3W2JA 5D05A 5TBOA 2ZRWA 1GVSA 1ZALA 4FX8A 5HQEA 4JTTA 4XZ9A 2QR6A 2ZRXA 2YW4A 3I6RA 1JUEA 3CPRA 3PF3A 3EWZA 5F2LA 3W7PA 3GIYA 1I8JA 3EX2A 5D03A 3TDFA 3NQ7A 4IPJA 3NPUA 4DF0A 3N19B 2VEMA 3S1XA 3PB0A 1BTMA 5FEWA 3STGA 1OFRA 3LLFA 3QMTA 3WK1A 5FF7A 3O1NA 4AWSA 3DFTA 4N4PA 1LRNA 2OZ0A 5MHBA 4OE7A 3G0UA 4XTDA 2ZA2A 4IX0A 1K02A 1LOSA 5F2IA 3W7DA 4IJBA 4NVTA 3O07A 3EX6A 5FF3A 1F73A 1G4TA 3LCGA 3O06A 4O54A 1JCXA 2AGKA 3DFPA 3B0UX 1FCQA 1KTBA 2B7NA 4UNKA 3EWXA 2GPTA 5F1UA 4LOCA 3QYQA 1KFEA 2Y7FA 4DO5A 2XN2A 4DPPA 2GQAA 4GUGA 3LCWA 4RZ5A 1P5BA 3L0GA 2DU2A 2XN0A 3TX9A 1I2PA 1CX9A 1OJXA 4FXSA 1N8FA 4AF0B 3L5AA 2A4AA 2CZEA 3NPWA 3IIOA 1YPFA 2X1TA 4AMAA 3EWUA 3T7VA 1WAUA 4MZYA 2E5BA 4C1KA 1SZNA 4Z1CA 1ZY9A 4UTTC 1QO2A 5HNRA 3PM6A 3M5XA 2YW3A 3W1NA 4PL2A 3UPWA 2TMDA 3U2OA 3UZJA 3IVUA 3TK7A 2ABBA 5I3GA 3C2OA 3W7GA 3DH7A 4ZQMA 2JKPA 1KBJA 4HPJA 3HB9A 2NWSA 3W87A 3RMJA 1TSIA 2JKEA 3W7IA 1IIGA 3NQAA 2YGYA 2DZWA 3LXCA 4PC8A 2VC6A 1YYAA 3NL6A 3IGUA 4JTEA 3NNTA 4WY0A 1S5VA 2ZZ7A 4AHOA 4K37A 2BSLA 2FIQA 2GUUA 1LLWA 4M6PA 3RK8A 4S2CA 1FWNA 3P5ZA 3CWNA 4LU0A 4QAIA 2VEKA 2RDTA 1M7PA 1IXQA 4R34A 1MSSA 3SY5A 2KZHA 1DJQA 2OX1A 1PIIA 3IIVA 3G1FA 3TA6A 1RV8A 1LZOA 4JTGA 2DZSA 3OVPA 3N34A 1OFPA 2C0AA 3PVFA 3TMQA 3P5YA 1SZEA 1NF0A 3CIXA 3G1DA 5AYXA 1FWTA 3B05A 3L66A 3E0IA 5G4WA 3PSWA 4YL2A 1QWGA 3QEZA 5D09A 3DFQA 1F76A 3G1AA 2XFWA 3KFTA 4UFIA 3W72A 5E1QA 1TRDA 3NQDA 3W2LA 2VEIA 2Z2UA 3W2UA 3LRKA 5AFDA 4LT9A 1MEIA 2H3DA 3GXPA 5CG7A 4CNNA 5CZ0A 1Q3NA 3W1AA 3B8DA 1W3TA 3OG3A 1W56A 3GR8A 4QITA 1OHLA 1W5PA 4FIRA 5D2YA 1J4EA 3LV5A 4DF2A 3C2VA 1IXPA 1MEWA 3B04A 3QW4B 5CPMA 2A6LA 3O05A 1QPOA 2V2CA 1SPQA 3NEVA 4UMCA 3A21A 3ATYA 3W7RA 3MI6A 3NA8A 3LOTA 3A9IA 1SFLA 3GAYA 3NPVA 5F4XA 4JTKA 3FYOA 4FXRA 4ZQPA 1R2RA 4NXKA 5LHEA 4TO8A 3MBDA 4O0KA 3W1PA 4N9BA 5AB3A 2A21A 4LY8A 2Y88A 3UY7A 4OT7A 4LW7A 5KZMA 4Y6GA 3BARA 3R5EA 3A23A 3F4NA 4JN6A 1GG1A 3BG5A 3VI2A 5LNSA 1YXCA 1EP1A 5DY2A 2Q3OA 1P1XA 1GYNA 1TPFA 1PV8A 1R30A 1AL8A 1TB3A 1P4CA 4KFNA 4XKYA 4DELA 1Q6OA 3L9CA 1X8FA 4IMCA 4JR5A 3OA3A 2Y89A 3EXSA 2V5LA 2QCDA 2R91A 1VCVA 2BLEA 1A5BA 1EWDA 1FXPA 2WSYA 5TQLA 2J24A 4O8RA 5FEPA 2V9DA 4OWGA 3G24A 2NX9A 5C6MA 3NO5A 2I14A 1F5ZA 2NV2A 3O63A 5KINA 5HR7A 1PHQA 3NQ8A 1GVRA 4KKXA 1XL9A 1TTPA 1OVDA 4MJMA 2V5BA 2YCEA 1NFBA 2C13A 3STEA 1PHWA 1DHPA 4O14A 3PUOA 2QCFA 4HT3A 4PFMA 3CU2A 2GVGA 5F4SA 4WUIA 3C2EA 3W7NA 4GFSA 3NL3A 1ICPA 3NPXA 3QC3A 1P0NA 5LZLA 1TIMA 1YXYA 4IMEA 1B9BA 1OFAA 2Z0IA 1WBHA 1MEHA 3UY8A 2ZDRA 1ADOA 5EMUA 5CPNA 2V0TA 3QJAA 1YADA 3P8IA 3G1XA 4IXXA 2WSQA 1LBLA 3U8GA 1LRTA 5EBUA 2A7NA 3C2RA 1H50A 4NJJA 4UR7A 1BKSA 3W73A 1RR2A 3OVQA 3PBVA 1KLZA 1UJPA 1Y0EA 1K8YA 5FF4A 3NVTA 1TREA 1O60A 3M47A 1FWRA 1XCFA 1KFJA 1EUAA 1B3OA 5LNVA 3W7EA 1KM3A 4EVZA 1W5OA 4BI5A 4POCA 3TKFA 1CI1A 2V81A 4GNJA 4O1BA 2Y85A 3W7QA 1JCNA 3G8RA 3SGUA 3LI1A 3QF0A 5LNRA 4Z1AA 2H8XA 3TROA 3LLDA 4UUIA 3OHIA 4YLWA 3FFSA 5D04C 5AHFA 5I3KA 4CCCA 4LVFA 1VLWA 1XBVA 4OGZA 3NL2A 3MI3A 1HL2A 2OT1A 1K8ZA 1GVOA 1Z41A 5D37A 4HPXA 1SFJA 3B4UA 4A2RA 1TTIA 4LRSA 2RHGA 5CPOA 3SJ3A 4QJ1A 1L9WA 3NQ2A 3PR2A 1H7NA 3VFLA 4Q33A 3GAKA 3UZ5A 1DVJA 3QQ0A 5BNKA 1KFKA 4FX6M 2D73A 5I3HA 2J9XA 2ZZ2A 1XI3A 1PS9A 1UASA 3C8FA 3PSVA 4K6AA 2ZTJA 1Q6RA 1NVMA 1IXNA 3PUEA 1VCFA 1U5JA 3TC6A 3RU6A 5AHLA 4KWVA 4O10A 2QCLA 1JCLA 2YFNA 3ZWSA 3LX9A 1K7EA 2GVLA 3HGRA 3LXBA 3ABRA 2EPHA 3KVKA 3T55A 3H55A 1R2SA 2UV8G 2VFFA 3W76A 1HFBA 2VXNA 1QPQA 2ZZ5A 4ZQCA 2FQIA 4MIMA 3QPYA 5DELA 1JCMP 4X22A 3EEGA 1JUBA 5HJLA 2I9EA 2BZNA 2TPSA 1NF7A 2B0MA 4OBTA 3GB6A 3P82A 1OFDA 4K7YA 2X2GA 2ZZ6A 3N3MA 3W07A 2E6AA 5AHNA 2QAPA 4HIBA 3EKZA 4XTIA 1L6YA 4UTUA 1XC4A 5T26A 3G18A 3BGJA 3L5LA 3CLMA 4UTWA 2FPTA 3IVTA 4NQ1A 1FWSA 3BK0A 2EF9A 4I9AA 5KMYA 4O50A 1JCYA 1GOXA 1ME9A 3GNDA 4NUWA 4LVBA 3NL5A 1IXOA 4Z0SA 1A5CA 2ATSA 4MLJA 1H7PA 4AHPA 2VFIA 1VR6A 1VYRA 2OJPA 3IGXA 3IIPA 4Z1DA 5C54A 4JYDA 1ZNNA 1UUOA 1X1OA 2ISWA 2R94A 3B03A 4OU1A 4K36A 4A21A 5I3IA 2ABAA 4AHQA 5U7SA 2YYTA 3EXRA 5FF2A 3LRMA 3ABOA 2ALDA 3HPZA 3L2IA 3RF9A 2NUYA 2WQPA 3FOKA 1GT8A 2C16A 3GX9A 3QSRA 2E1DA 2TYSA 3NQ6A 5D33A 4AXKA 4RKAA 3BG9A 4MZ8A 1I2RA 1P0KA 3V75A 1JUKA 4QSHA 1XXXA 4RZ6A 1ZAJA 2YX0A 3W85A 4AVFA 1EX5A 3NAVA 4GC4A 5LKYA 4YCPA 1TPDA 2QEZA 4GBUA 1M7OA 1H63A 1DQXA 4WXYA 1DJNA 4Y8FA 4O52A 1JR1A 2QDHA 3CTLA 5D38A 3MUXA 4GUHA 1FCVA 4AH7A 4OV4A 3KRUA 4IGHA 1G7UA 1SO6A 2P0OA 4JY8A 1ZFJA 3BVJA 4O1AA 3MWAA 3CEPA 3PAJA 1IF2A 3PULA 3QMSA 3A5VA 3PBYA 3VKJA 4JTSA 3NM1A 3R89A 4FNQA 4NJGA 1I2QA 3L68A 3S0CA 1ME7A 4M6VA 1TQJA 2B7PA 2GQ8A 4MKNA 3LBMA 5SWUA 3UNDA 2VFHA 1TV8A 4MFDA 3EX1A 4UIOA 2YFOA 4JTLA 3QH2A 4UXDA 1TTJA 4UTWC 2OCZA 2BTMA 4PODA 1OFQA 3GDTA 3NQGA 3I7RA 2FJKA 1LBFA 3W88A 3M5ZA 3WJWA 4UR8A 2B7OA 3W6YA 6ALDA 1HTIA 3MO7A 3BW4A 3E02A 3W84A 3MMTA 3N73A 4BI7A 4LNYA 3BLFA 4DBDA 4JTJA 3P81A 2W0UA 1K3UA 4KFOA 1V5XA 3USBA 3FA5A 4N6EA 4FX7A 5FI8A 3TSMA 4OV9A 4YMZA 3NQVA 3CB8A 3M44A 4Z0JA 3ABQA 4JEQA 1GQNA 1I45A 3S9YA 2J6XA 4A29A 5BW6A 4DQWA 1ONRA 4JTUA 2YZRA 3G22A 1HO4A 1D3HA 1YLVA 1OK6A 1YTEA 3L5MA 1RD5A 4JDYA 3GK0A 3LTSA 1VZWA 3WK2A 1VCGA 1FY6A 5IBXC 4LWWA 1AW1A 3DHDA 1H7XA 4UFJA 3H53A 2X30A 3P8JA 3ZS4A 3RLUA 3S1WA 2GJNA 4KFPA 3GDLA 4WQ6A 3P62A 4OHQA 4UMBA 2ZZ3A 1ALDA 2H90A 3JS3A 4LS0A 4UC5A 4ZVJA 3UWWA 4A2SA 4LV4A 1XUZA 1JRCA 4CQ9A 4HSOA 1VPXA 2C1HA 4G1KA 5DBUA 3W22A 5K2ZA 3ZWTA 2Q3RA 2ISVA 5A5WA 2V2HA 4NXSA 2YDAA 1ME8A 3VE7A 2ZFAA 3W7KA 4L4MA 4JD4A 1VH7A 3Q94A 4IMGA 3PUDA 5AHIA 3DENA 4FB7A 3SW6A 1RPXA 2G5WA 3BO9A 2Y63A 3HGJA 1OX4A 2C19A 1TQXA 1I2NA 3SIZA 4IX2A 3IGSA 1FDZA 3GKFA 3N14A 4A22A 1N55A 2WJZA 4AWUA 4DO4A 2TSYA 1QOPA 3TR2A 3UPBA 2FTPA 1MXSA 3DFNA 1PCKA 2RFGA 2YYUA 3N2MA 3P84A 4Z1BA 4PH6A 1SW7A 5L9FA 1SR9A 2DJXA 1QMLA 2QAFA 3I7SA 4JIQA 4O57A 3L67A 1H1YA 1TMHA 4O16A 1ZCOA 3QRHA 1DL3A 1FQ0A 1BEUA 2CLEA 3S5OA 1PVNA 2Y62A 1JQVA 4K8EA 2A1YA 3MP4A 3W7OA 4M7SA 4UMAA 4IQLA 3MHUA 4S1FA 5DBTA 5LHFA 1LROA 2CLMA 4O18A 3SR7A 4JTIA 1ZENA 1NAL1 4TU1A 3F4WA 3W71A 1EP2A 4JY9A 1KM1A 2G96A 3GXTA 4LVDA 2FLIA 3E96A 3W2NA 2NUXA 2E6FA 3F1QA 1OFEA 1K7XA 4JNMA 2FDSA 1G6CA 3MI2A 3LHYA 2NWRA 4RLIA 2PE4A 3HG2A 3MJYA 3IIZA 1A50A 3O6CA 5C55A 3LM7A 3QW3A 1GG0A 5HUOA 5HWMA 1LDCA 4UTKA 1SSDA 4WY0F 1EA0A 2QKFA 3EKLA 4NX5A 3EB2A 3M16A 3A5FA 4MVAA 4QQ3A 5KZEA 1GZGA 2DZXA 1OYBA 5AC7A 1DOSA 2CLIA 1TCDA 2E68A 4UFHA 4ML9A 3W23A 4JYEA 2Z1BA 4UFMA 1CW2A 4EF9A 1YTDA 2FFCA 3LHVA 5LNWA 4AF0A 4MUZA 3G1SA 4NZFA 3UWZA 1JULA 2J9ZA 4EF8A 4X3ZA 1G4SA 1W5MA 1KFCA 5J5DA 3I7QA 3NXFA 5TIMA 2AAMA 4HNUA 2HSAA 4U4MA 3W7LA 2QUTA 3TQVA 4JGDA 4Y9AA 2A0NA 2EAWA 3HOJA 4DPQA 4W9TA 1EWEA 1AW5A 3LCFA 1RZMA 1W0MA 1XUUA 3T78A 2VFGA 1TYGA 4HNVA 5H2ZA 1W3NA 3CT7A 3P67A 5BMXA 1LOLA 1LRQA 4HNTA 1W5QA 1LORA 3PB2A 4PTNA 2QJIA 2Y7GA 2NXGA 1FCUA 1TRIA 1EPXA 4LVAA 3D0CA 4EOUA 1QDSA 4NJHA 4O19A 1X6UA 1IGSA 4CNOA 5CSRA 1SU5A 1XFBA 3G0XA 3WK0A 5D2TA 2PURA 4O17A 2BXVA 1O5XA 1T0OA 1SO3A 3TW6A 1OF8A 1S3HA 4WXZA 4LV9A 1OF6A 5D02A 3FKRA 2X1SA 4GXMA 2CLOA 3UWUA 1AG1O 2WSRA 1GEQA 1U83A 3ANYA 1VYSX 3LCHA 5G4EA 2A5HA 2CZDA 2V82A 4JTFA 3C0JA 3G8EA 3S5YA 1Z48A 5G5IA 3LXAA 4YXGA 4OQVA 4N4QA 5AN7A 4X9SA 1FDJA 4GUFA 3TNOA 4IPIA 3DHFA 2PC4A 4K8HA 4QIUA 1QOQA 5CZTA 4JICA 5ABTA 1EP3A 1GJPA 1H61A 2DZVA 4NNAA 1T99A 3W9ZA 1WX0A 3W7CA 1X1ZA 1F6KA 4BK9A 1WBJA 1QCWA 1SO4A 3HQ1A 3TU9A 3P60A 4JYFA 1TJRA 1ZAHA 1H1ZA 1NSJA 4AAJA 3T4CA 2PCQA 3FKKA 1RVGA 2CW6A 3KXQA 3OIXA 3L0NA 1VLIA 2HS6A 1OABA 3L0KA 4JX4A 3W70A 1SQ7A 3OEXA 3STFA 3ZR4A 1FWWA 4XBKA 1LM1A 1TPEA 1VS1A 1BWKA 2ISSA 3LHTA 2C18A 3TCEA 1K8XA 1OFBA 3MP3A 2V2DA 3NG3A 3O6DA 1W8SA 4N6FA 1G4PA 3NZRA 3GVGA 1W54A 4LC8A 4GE8A 1TPUA 3G1YA 2X16A 4ADTA 4PEKA 1H7RA 1Q6QA 4MPQA 1VJIA 3G1VA 4XBSA 1F05A 3UD6A 3KAOA 4JS3A 3DU0A 1KFLA 2LLEA 3MYOA 5AC6A 4O4VA 4BI6A 2G97A 3TE9A 3A22A 4RJEA 5EA9A 3W7MA 2Z6JA 3GZ3A 2HS8A 3SGZA 2O7SA 3HO8A 3DFOA 4XQ6A 5DXXA 1TTQA 5A8GA 1W5NA 2ZYFA 2VOMA 2X1RA 3S1VA 1H7WA 4MYXA 2QCGA 1LLZA 2DJLA 3KOFA 1JQXA 4LS2A 1GYLA 1KV5A 5E0KA 3LCIA 5HINA 4I7WA 1XDMA 3V1PA 3M1ZA 5F1VA 2A7PA 3P61A 3DFSA 1TPB1 5DY3A 2WNNA 5AHEA 4LS1A 1YTKA 2C6QA 4DO6A 1FBAA 1EIXA 3WJXA 5AHMA 3KVJA 3TV8A 3HBLA 2F7FA 4IXHA 2CLKA 3W7JA 5K9XA 4FNRA 1TV7A 4MY1A 3P74A 1WA3A 1OX5A 1HO1A 3SI9A 3TJLA 1GPWA 1D9EA 1V7YA 7TIMA 3UQNA 3R2GA 3TMLA 4AEOA 4QM1A 3E9AA 2GOUA 3UWQA 3K30A 4RXGA 3G3DA 3GDMA 1DBTA 1HUVA 3SSJA 2J88A 3UWVA 5CZJA 1T8XA 5F2MA 3BV4A 4NZJA 2QCMA 3IRDA 3S1UA 2QCCA 5HWNA 3TXZA 2E6YA 5FESA 3WK3A 3TSDA 1A5SA 1KLYA 4O13A 3RNDA 4DEFA 1KM0A 2J27A 2QCHA 3NQMA 4R33A 2VEPA 2WO5A 1DORA 3A24A 3TC7A 2HMCA 4I7VA 4TIMA 3VCRA 4FNSA 1ML1A 3LTYA 3W1LA 4O0ZA 1KM5A 2X1UA 4P61A 3W3OA 1TPC1 4QISA 5AYZA 4X2RA 4WY0B 2FPYA 3TSBA 5I3JA 5H91A 2RDUA 3EWYA 1EEPA 4NNBA 2CZ5A 4E38A 3OVRA 4LTSA 2Z6IA 1ICSA 3C3NA 4Y96A 2Q8ZA 3W86A 1W1ZA 4WOZA 5E93A 4E2DA 1FDYA 4RV8A 3GR7A 5EYWA 1G4EA 3DI1A 1QR7A 3RLVA 4BFAA 5LNUA 3T40A 2ZBTA 3S8HA 2E09A 3TAOA 4UTIA 3GDRA 3KVLA 1S5WA 2C3ZA 2BWGA 3HJZA 3LV6A 1S5TA 3OBKA 5AOUA 4A3UA 3BPWA 2F84A 4IUOA 3PBUA 1OFOA 3O16A 1J5TA 3CHVA 4LUIA 4BF9A 3GNNA 3TQ0A 3R13A 2CU0A 5DN1A 3N9SA 3LDVA 5C2XA 2JBMA 4CCEA 1VYPX 5K7JA 3VNDA 3DGRA 3QQ1A 2DZTA 5F4WA 3PC0A 4JTHA 5HWJA 1GVQA 5DCEA 4AB4A 3HPSA 2PRHA 5CGQA 1B4KA 4B5NA 2RDWA 1EUNA 4M19A 4LRTA 1UCWA 1JVNA 2VELA 3HG3A 3M41A 2O7QA 4O28A 2WNZA 4IOTA 3BW3A 1XKYA 3UXAA 1JCJA 4XUGA 3LGEA 1Z42A 4FHAA 2Q8LA 2V8ZA 4O12A 3KRZA 3ZFHA 2NX3A 3NQCA 1WDWA 2HTMA 3DBPA 3NM3A 3TQKA 4YCOA 3W74A 4PL1A
chains in the Genus database with same CATH superfamily
3LPPA 5HMSA 1W2PA 4ALDA 4I9TA 4WCJA 3CLWA 4ZE5A 2ZZ1A 3GC5A 1KTCA 1GJUA 4TX9A 4O15A 4QE4A 1YW1A 4AXNA 3AXIA 4D2JA 5B80A 4P2VA 1LP6A 1TZ9A 1V51A 4GXWA 5FJIA 2HVMA 5G2IA 4E4FA 3KS6A 1J6PA 4B4HA 4NNCA 5U4NA 4R3UA 3R58A 3I65A 1W9BM 2CCRA 2HVOA 5GPRA 4ZQOA 3GTIA 1B4EA 3MMWA 3QQWA 3F2BA 2FZNA 1QAPA 4NP7A 3W25A 4IQJA 5JXQA 2REQA 3MHFA 5J5RA 4GO9A 3GUGA 5CC6A 3B06A 3G5EA 4M3PA 2IKGA 4CNTA 1YDOA 2B31A 1F2JA 2VKZG 2DIEA 3VYLA 1TR9A 4YVPA 3VDBA 5CG0A 3AS2A 3QY7A 1IEXA 1W9UA 3SN0A 1KW1A 1PL9A 3REQA 3RX2A 1W32A 2OZ3A 1B3YA 4C7FA 3MPGA 1HG3A 1W31A 1WDQA 3H54A 3E0WA 4DUOA 4WSJA 4AD2A 4UFKA 4H9TA 3WH5A 2VDHA 2ZWYA 3JRKA 4Q8TA 5A6BD 1E6NA 3TTYA 1JNEA 3CH0A 1EJTC 3JU2A 4LEQA 3SCOA 1E73M 1KQYA 3TTSA 3PZGA 4BR1A 3SADA 1P48A 3BSGA 1K03A 2YSWA 3QHMA 3VDGA 4CGTA 4MFEA 4N9DA 4PRRA 3CK5A 2ACSA 3KBNA 4MYAA 2VZTA 1US0A 2Z1SA 2O56A 4AWTA 3EB4A 1BGGA 1GQJA 3VX0A 1DQUA 4MKSA 4GJ1A 1R2TA 1YDVA 2ZOXA 4LVGA 1O1ZA 2GQ9A 3BLLA 3GYEA 2FHFA 1IE7C 3TJ4A 1ODUA 3HZ3A 1G0CA 3WENA 2WOQA 5KZDA 1Q6EA 2OSYA 3G6LA 5CJ5A 4EACA 3CPUA 3T05A 5XIMA 5EPDA 3C6CA 3M9YA 1R6WA 1OG0A 1VFMA 5H8UA 1EQCA 3SFKA 4B4FA 4ZXLA 3L4TA 1TPVA 2NUWA 3XIMA 3KM8A 3ZSTA 3R0KA 1SFSA 4HZ8A 4QS6A 3PZNA 2QCEA 5FF0A 4JDBA 4LALA 2FMOA 3H23A 3FJ6A 3W2MA 4L6HA 1QNSA 4HKPA 3LRLA 2YB4A 4O1CA 2YJQA 1YPIA 4P8WA 4J3UA 1SUXA 5E9AA 3LCXA 1EB3A 3WX7A 1JIBA 1S5NA 4WD0A 4XAPA 1E4NA 3K8LA 3UVIA 4GH3A 4TMCA 2GGIA 1XH1A 3LERA 3W1TA 3M7WA 2I9UA 4H7ZA 1XBYA 3DECA 3SN1A 1CXFA 2E5DA 4FNUA 3RILA 3L21A 4FOJA 4JIIX 1XX1A 1TPWA 5DO8A 4YNGA 3N9KA 3GIQA 4GH1A 3K46A 2EKCA 1IEQA 3C61A 2CFFA 3DDMA 4PCFA 4NJIA 4CD7A 2YDRA 1W9PA 2PD9A 4GYKA 4WVXA 3URNA 1CGXA 3C5QA 3PZTA 3CASA 4LUSB 2GK1B 1UC5A 3MU7A 3LCLA 1UR3M 4S38A 2IPJA 4H9VA 4MY8A 2W79A 3ARRA 2V30A 1O12A 1JFHA 4OUEA 4PTMA 1Q4WA 1C7TA 4AZCB 2XN1A 3N2CA 5D2XA 3DZ1A 4IGNA 1YDYA 3YPIA 4WSHA 2EHHA 1DXEA 1ESWA 5DCBA 2FB3A 2QGYA 2ACUA 4F9JA 4GO8A 3OPSA 2X0SA 1DJGA 2Z1WA 4EWJA 5D2VA 5HR6A 1FHVA 3B3DA 4O1DA 3LYEA 3FS2A 5DT7A 1Q63A 3SRKA 4M82A 3ABZA 1H3GA 4HPHA 3SIMA 2XM1A 4TV6A 1DQWA 2EJAA 1OIFA 4UTJA 4AX6A 1F3TA 1Z69A 3IJLA 3HG4A 1JYWA 4LFYA 3UYCA 4JCMA 3THQA 4RK8A 4FI4A 4PB4A 3WJSA 2RKXA 3AYVA 4MB1A 3CB3A 3THAA 3SUUA 1PKMA 3PTDA 3DOPA 3T0CA 1TO3A 1MZHA 2X2YA 4WOQA 2OGJA 2J9YA 1WE5A 4PTWA 1V4YA 3QSTA 5H6HA 3AISA 2PGFA 4MNMA 2OYLA 4NU7A 2OU4A 5K4XA 3S2JA 3UF9A 1V8EA 1L6SA 5HBFA 4DJFA 3ISIX 2D2OA 5AC8A 3V7PA 1Y5VA 3BW2A 3MDWA 4AQLA 4UR9A 2DVUA 1R3YA 5KTLA 2QF7A 4Z17A 1UR9A 4K39A 4PBGA 3W1QA 1JZ2A 3FIGA 3F4CA 3K4WA 2ZX5A 3ELFA 4CCDA 3EXTA 4RXFA 1I75A 1NDWA 4FR1A 2P50A 3NR0A 1ZRQA 2FB2A 1KWKA 2WZTA 6XIAA 3KVMA 2VFEA 1QASA 3L4XA 3U57A 4ROQA 4F0LA 4MZ1A 3V5CA 2ATMA 1V6TA 1YXDA 4M56A 5E6YA 2PTDA 1UB3A 2J66A 5IBXA 4NILA 3DYPA 2NV9A 4JIPA 5G2WA 1IWPA 4CU6A 3MW7A 4Y8EA 5A1AA 4MWAA 4MY9A 1DKWA 4DO7A 1X7FA 4H4IA 4UTTA 3ERPA 1W37A 4AFYA 3W0KA 2VM8A 1XDLA 4FEZA 1AD4A 4LX4A 2HVNA 1CEOA 4U28A 5KSWA 3ZQ9A 3LHWA 3MCMA 4K7VA 1EHAA 1RQEA 5CJNA 4M24A 2PDNA 3IK2A 4F0MA 3CM4A 3S2LA 3SCQA 3GXNA 4GQ0A 4LC6A 3H2FA 4L4OA 4OIFA 1W6TA 3CMGA 1K6AA 1F6YA 1VHNA 1B57A 4DYEA 4I7UA 4CU8A 1FX6A 3C8NA 2ACRA 4U10A 1LCOA 3W38A 1EA9C 1GVSA 1YNQA 1ECQA 3VO0A 3QR3A 1XSJA 1E6SM 1JUEA 3CPRA 3QV8A 4H7CA 1M7JA 2L5HA 4IPJA 4DJFC 3NPUA 4DF0A 4W4QA 3SSZA 4JKLA 3PFMA 5MHBA 1PZ0A 4B15A 2FZ8A 1VRXA 1UKOA 5FAGA 5JU6A 3W7DA 4NVTA 4V1XA 2EXOA 3O06A 1LQ0A 3DFPA 1KTBA 4UNKA 5F1UA 3QYQA 3O0FA 5CPQA 1HJWA 4DO5A 4MDPA 1KXVA 3MZ2A 1S2UA 2WMGA 3TX9A 3MUAA 1OJXA 2ZUNA 4FOKA 4FXSA 3MCNA 3L5AA 2V38A 4ZCWA 3R94A 4LYPA 2E5BA 4M1RA 4J3ZA 1XYFA 4C1KA 2YDSA 1ZY9A 4UTTC 1QO2A 1E9IA 5HNRA 1DYSA 1E0TA 3LQGA 3OZOA 2V5DA 2HDJA 4GFIA 3U2OA 2OWCA 3UERA 4C65A 2ABBA 1FP8A 4B2DD 2F6UA 4UNIA 3S2CA 2A3CA 3ZM8A 3I3BA 1R3RA 3RMJA 1C91A 1TSIA 1IIGA 2XZ7A 3LEPA 4LY4A 4PC8A 1EDTA 5FAJA 2BXZA 4WY0A 1BYCA 1S38A 4IP4A 4M6PA 3WZ0E 4DM2A 3UZXA 4S2CA 3PPFA 1CGYA 4DXKA 5A94A 3KW3A 4QAIA 4Z2LA 1M7PA 4GQGA 3VIIA 1PIIA 3ITTA 2DZSA 1CGWA 4ZO6A 3PVFA 3TMQA 3UBPC 4MKVA 1ISWA 1EJRC 3CIXA 1FWTA 3WLLA 3PSWA 4L65A 1GW9A 3QEZA 3ZR6A 4UFIA 4AEEA 3W72A 4Q8UA 2I16A 2XFYA 8A3HA 4DJDD 3LRKA 1QHOA 2ICSA 3WQ5A 1MQQA 5CZ0A 5CBIA 1DXIA 3BLOA 2OYKA 1KRCC 2Y5JA 4Q6XA 2WMJA 3A3XA 5LIYX 4FXFA 2CKSA 3ZOAA 1LWHA 5A8NA 2GSEA 2YL5A 3B04A 3QW4B 5CPMA 2V63A 4GYFA 4QR6A 1PDYA 2V2CA 1FTXA 3VGEA 3GAYA 4U3CA 3FYOA 3RCNA 1R2RA 4NXKA 4E8GA 3MBDA 3W1PA 1AJ0A 4NY2A 1XF0A 4OT7A 2D2GA 4LW7A 4FS9A 3F4NA 1UD6A 2WLZA 3LPOA 3OU8A 4MSSA 5LNSA 5DY2A 3WF0A 1KXHA 1TPFA 4C6OA 3WELA 4KFNA 4DELA 4HB7A 1Q6OA 4JR5A 3ARVA 2DY3A 3OA3A 2Y89A 4PUUA 2E8YA 3OW1A 1LL6A 2V5LA 3NEHA 2XINA 2R91A 1A5NC 3DIPA 4O8RA 4RZBA 3G24A 1FWGC 4LYQA 3NO5A 1F5ZA 4PUKA 3VOFA 4IFKB 4L9ZA 4DUVA 3UXLA 3H70A 1UR8A 1UD2A 1XYCA 5C8BB 3EOUA 3HU7A 3W6LA 1PHWA 1DHPA 4TTGA 3PAOA 3A3HA 5F4SA 3IUHA 4MHBA 2R1NA 3NPXA 3UJRA 1S5MA 1EC9A 3UETA 1B9BA 4D6HA 2PDMA 3BDKA 1MEHA 3UY8A 3VGHA 4YYFA 3U8GA 3CUXA 3WD4A 3II1A 1GQIA 1KNWA 4NJJA 1GORA 1XHGA 3PZOA 1BKSA 1RR2A 4OJYA 1GKQA 2D3NA 3PBVA 1KLZA 2J7BA 5DFAA 1L8NA 1M01A 4CD4A 3OLDA 1EXPA 4FOUA 1K8YA 4QJ5B 2VX5A 3NVTA 2P88A 1C8QA 1FWRA 3KTSA 1EUAA 3SCRA 5LNVA 1R3VA 1KM3A 2C8NA 1W5OA 5B7ZA 3TKFA 1CI1A 2V81A 1GJWA 1JCNA 1Y8BA 1CT5A 1JYNA 3CZJA 1XLGA 2J8GA 1TX0A 4Z1AA 2BFGA 4GG9A 1NDVA 1F3WA 3FFSA 3HPAA 1V0MA 4GABA 4MNLA 4ZODA 1HL2A 1H4PA 4XVEA 5FSEC 2BV9A 1HL8A 4XD4A 5JMUA 3B4UA 2CHNA 1RPKA 5BZAA 5M3WA 2OB3A 1L9WA 4I9JA 4Q33A 1P7TB 3WNKA 2D73A 5I3HA 4Q4RA 3V16A 3C8FA 3VOGA 2VR4A 4K6AA 2ZTJA 3VNLA 1Q6RA 1NVMA 4IICA 1CXLA 1EF2A 3PUEA 1U5JA 1FWFC 1BXNA 3BLKA 3EWCA 5AHLA 1MZRA 3DG3A 1JCLA 3AMCA 3ZWSA 1BVWA 1R2SA 3H2AA 4DBWA 3WD0A 2VFFA 3SQSA 4QP0A 3UJ2A 2PAJA 2OZ8A 4X22A 2BGNE 1UP3A 1MVYA 2SFPA 1NF7A 2I57A 4K7YA 2WQDA 3T8LA 2PDPA 3OP2A 1AVAA 1M3UA 4HIBA 5CSYA 3WQOA 5HNUA 5T26A 1J2BA 3L5LA 7ENLA 1ONWA 3ANUA 2FPTA 3UJSA 1PJ9A 3BK0A 1FWEC 3VIKA 1D7FA 3FW6A 4O50A 1JCYA 4GGHA 1OB0A 1GVEA 3JUGA 2QUNA 4LVBA 1VBUA 4DZAA 1A5CA 4MLJA 3WH8A 1YHTA 1VR6A 2PDQA 5C9UA 1US3A 4JYDA 3GQYA 4F2BA 1UUOA 2R94A 1R3SA 1GZJA 4QGCA 2GVYA 3EXRA 4L9XA 3M7SA 4KCUA 4R7WA 1JPDX 3WQFA 4F40A 1UD4A 3L2IA 3E0FA 4W89A 1HL9A 2W62A 3QSRA 2XU2A 3WNOA 4ENLA 3V5OA 1UWRA 1I2RA 3T6CA 4QSHA 1ZAJA 1EX5A 4G2DA 4GC4A 5LKYA 4YCPA 1TPDA 3KZPA 2JF6A 3NDYA 1DJNA 2Z2AA 2QDHA 3N3TA 5LIWX 1HW6A 1FCVA 4AH7A 3KRUA 3EEZA 3UCCA 3BVJA 3BOXA 3CEPA 4X0NA 4U31A 3VCCA 1GHRA 2QW5A 3A5VA 2GZXA 1OD8A 4NJGA 4GLEA 3S0CA 3BURA 4M6VA 3CUZA 3HJEA 3MUZ1 4NG3A 3RRAA 4NAEB 2Z26A 3WMSA 3GC2A 4JFVA 4AYGA 1V0NA 3FK4A 4JNZA 2OWWA 4JTLA 1PX4A 3QH2A 3VOJA 2OCZA 4C7DA 2ODOA 4PODA 3WNMA 4TUFA 1LBFA 6ALDA 3GU2A 4IP7A 3NO3A 1I9CB 1MW0A 4NF7A 2PLKA 4BI7A 3V0UA 1TV4A 3NGFA 4JTJA 3SQMA 1YNPA 4R9OA 1SJDA 1V5XA 4YTSA 3FA5A 1ZL1A 3TSMA 4WDWA 4GY1A 2W27A 3CB8A 4GZ7A 1GQNA 1I45A 2XDFA 3S9YA 2J6XA 4A29A 4DY1A 1OSEA 4JTUA 3OA5A 2YZRA 3W81A 2GGHA 1YLVA 1DE6A 4US6A 3L5MA 1RD5A 3T07A 3GK0A 2KAUC 4NAFB 1I1WA 1FY6A 2WSKA 4LWWA 4HPNA 1AW1A 1EL3A 4WR3A 3VKCA 4WKAA 3H22A 4UFJA 4Q7IA 1M9HA 3ZS4A 3KLLA 4JNYA 4ACZB 3WG6A 3S1WA 4KFPA 1EDGA 1Q6FA 2D0HA 5ECVA 1GGOA 2XFRA 3QZ6A 2PS2A 2PTZA 2WCAA 4UC5A 4ZVJA 3K2GA 3PZQA 4WDXA 2C1HA 3CIVA 4IUGA 3V36A 3F4VA 1XLJA 3W22A 5CBBA 2ISVA 3PHAA 3OGSA 2YDAA 4NZ3A 1ME8A 4LB3A 5CPSA 1VH7A 4R5EA 5AHIA 3SW6A 1RPXA 5AYIA 2Y63A 3BICA 2C7FA 3CZEA 1TQXA 1XKJA 3N6HA 1Q6GA 3S6OA 4UQAA 2BY0A 3OJGA 3KWXA 3WEMA 3W27A 4A22A 2VYOA 2MANA 4JHOA 4IGMA 2OOFA 3RG6A 3BMWA 1MXSA 3CZKA 3DFNA 2YYUA 3N2MA 3P84A 1FWJC 4C6BA 1SW7A 3GNRA 1Y5WA 4JIQA 1OQFA 4O57A 2OSWA 1TMHA 4H9MA 3S5OA 1PVNA 3WQDA 2A1YA 2X0YA 3NJ3A 2HISA 3MHUA 1NM9A 2PLJA 2CHRA 2IKIA 5LHFA 2CLMA 3U2ZA 1ZENA 4TU1A 1FKXA 3GXTA 2FLIA 3E96A 1YBQB 3W2NA 3WBXA 3PBMA 3N2BA 3F1QA 3O6AA 4JNMA 3GTHA 3LHYA 2J75A 1TA3A 1PB0A 4F3HA 1K8CA 2X7WA 2XTKA 4P8XA 1IZCA 3SCTA 1XJBA 5MF5A 3QW3A 4WY0F 3GH4A 1EA0A 2XISA 4RDZA 1A3XA 2QGHA 3WF2A 1AODA 1GZGA 1PUDA 2XH4A 3VMNA 1E56A 4UFHA 3DFHA 3W23A 5B7YA 4JYEA 3B8VA 2V67A 2FFCA 3LHVA 7REQB 5FSDC 4IM4A 4AF0A 1E1CB 5EFFA 4W8BA 2AAAA 3TYBA 1G4SA 5J5DA 4OZOA 4HNUA 4DJFD 3TQVA 2D1ZA 3NZQA 5C2CA 4Y9AA 1KBLA 3HOJA 4W9TA 1EWEA 2OEJA 1OGBA 1PZ3A 1XUUA 3T78A 3GZAA 3SCVA 4FLRA 5BMXA 3AJ7A 3P67A 1G1YA 4PTNA 4NI8A 2QJIA 3VU2A 1FCUA 1TRIA 4GJIA 1ZB5A 3ITCA 3BOFA 1YRRA 3B4YA 3ICJA 1H1NA 4CNOA 1GKPA 2VWSA 1VF8A 1T0OA 4Q8OA 2CWXA 2J62A 4PMRA 2Y5EA 4QCFA 1EZWA 4QG8A 4IPNB 4WXZA 4LV9A 3DUGA 2QLYA 3MT1A 1OF6A 4MWAD 4GXMA 3UWUA 2WSRA 1GEQA 3ANYA 3LCHA 3GHSA 2A5HA 3C0JA 4GK8A 5JQ9A 1XLEA 1YPXA 3FXGA 4A05A 1JXJA 4UQCA 1Z48A 4KT2A 5G5IA 4E3VA 4OQVA 5A6JA 1S2VA 2AL2B 1C3FA 4AZ5A 3M0VA 3LGGA 1T99A 3KHDA 3BJFA 3NSXA 1X1ZA 1F6KA 1QCWA 1E40A 3CAWA 2HE5A 8RUCA 1QT1A 3VX1A 1JDCA 2VWTA 4B9ZA 4HMDA 3T4CA 1AMYA 4I5UA 3R6IA 3HMCA 5BOEA 3OIXA 3L0NA 1MUWA 4M81A 3SCNA 1T5AA 4U5KA 4K1WA 3STFA 3ZR4A 4PCSA 1MRAA 4RW3A 1BWKA 2ISSA 2J13A 3TCEA 1UKSA 1OFBA 3MP3A 3Q45A 4XVDA 3FAWA 4JHZA 2VQUA 2XPKA 1W8SA 4N6FA 2VI0A 1ZP3A 3TN4A 4ZO9A 3K8MA 2X16A 3ES8A 5CEWA 1H7RA 3R0UA 1VJIA 3G1VA 1S2CA 3AXKA 2Z29A 3UZWA 1PIGA 3MYOA 5RUBA 4BI6A 5C9XA 5EA9A 4HNCA 1DJWA 2PPGA 4I3GA 2NLYA 2HS8A 3TP4A 2O7SA 3DFOA 2XIJA 1J11A 5GNXA 3NQBA 2ZYFA 3LY0A 3UJFA 4GC3A 3GNPA 5FD0A 3RLGA 4P7RA 1H7WA 4PSPA 4LS2A 2YLAA 4AIEA 3LCIA 4Q8NA 2BS9A 3V1PA 2QMJA 5F1VA 1UP2A 2A7PA 5D9MA 2JEPA 1ZLPA 1RD6A 4R85A 3B97A 3EA2A 3ZLHA 2WNNA 1FBAA 1QPKA 1JI2A 3VIGA 2PODA 3K1DA 2NSOA 2D3LA 4PRTA 1HT6A 2CLKA 1FHLA 3ITVA 3QV6A 3K5XA 2FH6A 1TV7A 3F5LA 3P74A 1HO1A 3MVIA 1GPWA 4TOQA 1D9EA 3OLIA 4W5ZA 4BEQA 5IFTA 2I7GA 3TMLA 4LANA 2GOUA 4RXGA 3WQ8A 2UBPC 3LK6A 3KS5A 1JDAA 1HUVA 3VIPA 3SJNA 1AQHA 3E0LA 4S3EA 1KKOA 3QV7A 1GUVA 1F9CA 3BV4A 2YDQA 1UOZA 2PZNA 2XIBA 3S1UA 2PF0A 5HWNA 1XSKA 4ZB5A 2E6YA 5EFDA 1SM9A 2PWVA 4WIWA 3RNDA 4DEFA 1XIDA 3MKKA 4Z2GA 3AHYA 1XD0A 5H8MA 4LXFA 2WO5A 4CEUC 3BCFA 4DWSB 5EU9A 1BXCA 1F8IA 4I7VA 4TIMA 3IJ9A 3N1AA 1QBBA 1WZLA 3GO2A 3WNLA 5A6AA 4O0ZA 4P61A 1HJUA 5DEZA 1TPC1 1HIZA 3RMEA 1C7SA 5REQB 3TSBA 1XSIA 3BL3A 2CZ5A 4ZSUA 3W86A 1EEXA 4B3LA 1W1ZA 4E2DA 2ZXAA 3GFZA 2CBJA 4B92A 3WLIA 3WDIA 4YS1A 4AEFA 4W5UA 2PEVA 4M0XA 4BFAA 3S8HA 5A6MA 2E3ZA 2PWDA 3PZVA 4QE1A 3CGTA 4UTIA 2GQ3A 1MQPA 3GDRA 1RVKA 4H2HA 1WZMA 4HMCA 4MF4A 2EG8A 3T42A 2BB0A 1Y7VA 2P53A 2DUAA 2MNRA 2POTA 3UXIA 3ES7A 4LAOA 3CHVA 4BF9A 1S46A 3GNNA 3BQ5A 3K1GA 1NOUA 5DN1A 2QJMA 5C2XA 5T9CE 1A49A 1A4LA 3DGRA 3VVGA 2I5IA 4JTHA 5HWJA 5DCEA 3SAZA 1A47A 2E28A 2HQAA 3VNYA 4PCTA 3GG8A 3CJPA 2VC9A 4PN2A 4LRTA 2X09A 3M41A 3BW3A 1KGUA 3RPMA 3EDDA 3UXAA 1W1B1 3MKVA 2V8ZA 3W28A 1QATA 3JZEA 3DHPA 4UQEA 2NX3A 3APYA 4WJ8A 3WLPA 2E9MA 1E55A 3DBPA 3WMLA 1NH6A 3GXFA 3RM9A 1RY0A 4DB7A 5I5RA 4NJKA 1J2WA 3CZ8A 3ARQA 5A8OA 2O92A 4DBEA 1BKHA 1JCTA 5G1YA 3LHZA 1QPRA 1UROA 3UG3A 5I3FA 4L4LA 3FLUA 1VEPA 2FPVA 2PDKA 3GC4A 3QFWA 2CESA 1SZGA 1VBRA 3NZPA 1THFD 4H7VA 4JAWA 3PZMA 1VQTA 3MHGA 3P2VA 1NOWA 3XISA 1PO9A 3GG0A 3AO0A 4G8TA 1EO5A 2ZA3A 2C91A 4P5UA 4Q32A 3AHZA 3UR5A 4M5PA 2Q01A 1LTDA 3TFXA 2Y0FA 3FGCB 4HN4A 1DJXA 1NFPA 4TVDA 4Q6JA 1ZPTA 3CC1A 2DW7A 3QY8A 3S42A 1D3GA 2HK0A 3TW7A 2ISFA 5CKSA 1X8CA 4RNHA 2WMIB 1KXQA 1F07A 1K77A 1Q5MA 1O5KA 2ZRZA 3QZEA 4XWUA 4HQVA 4CNPA 3S6TA 4MUPA 4KWWA 1BAGA 3PBWA 2W6RA 2Y61A 2NW0A 3CO4A 3B9OA 4NT0A 1QFEA 2BGSA 3WLSA 1L6GA 3ITGA 5LGZA 1MQRA 3WBEA 4S3JA 1EYEA 5D2WA 3GY1A 4UTHA 4IZGA 2J74A 1XLMA 1WQ5A 3QTGA 3R43A 4D8AA 1ICQA 2P8CA 2AGTA 4FO4A 1HKWA 3LMYA 1ENUA 2Y7DA 1UR1A 3CHCA 1H0IA 3UT0A 4DX3A 2YIHA 3CWOX 4L6DA 3N13A 1G67A 3TXVA 2FJUB 2ZRUA 3GU1A 3LSBA 4U2YA 2A85A 3HF3A 3U4FA 2OO0A 3FY1A 4XIMA 4D1JA 1GNXA 4HK6A 3CUHA 3A4WA 3KEHA 3Q58A 5JIPA 4QNWA 1UH2A 1V6UA 3EOLA 4HU3A 3HG5A 2NXIA 1AL7A 4HHLA 5D30A 3WKZA 4S3KA 3B0VC 3WDPP 2H8ZA 2RAGA 3H2MA 1B3XA 4RNIA 1WNOA 1E51A 3WDRA 2CLHA 2VFDA 1AW2A 1EKOA 3TZNA 1LBMA 2XVPA 2DEPA 1XQLA 2G3FA 2V3GA 1W3KA 3CZGA 3SCWA 3TOYA 3VM7A 2GLKA 3ABSA 4E6MA 3GKAA 4F48A 2PDFA 3DN5A 1RJQA 3NYZA 5JH2A 3TEVA 2GJXB 3P80A 4GCAA 1D2KA 1KKRA 5FJOA 2WV8A 1VFFA 5G2HA 5EY5A 4MADA 3H4WA 3BG3A 1WOAA 3QOMA 5DCDA 1Q4NX 1QPNA 2WPBA 1FOBA 2XGIA 3VE9A 2YPIA 2WYSA 3BQ6A 4ORMA 5BMWA 1REQA 3MBFA 5G1MA 1XG3A 3TTQA 3G1HA 2X42A 1F6PA 5LSMA 3MY9A 4ORIA 4PA8A 3SZ8A 4RE0A 2WC7A 3W1RA 2QPSA 2OFJA 1QVBA 3H2OA 4FNPA 5IM51 4OOZA 4WZHA 3WBAA 3HPXA 5AYYA 2JGQA 4PGLA 4YTRA 3E12A 4B3ZA 3HGOA 3M5YA 3BCJA 1O66A 3LPFA 1KBIA 2ZZ4A 2CNCA 3C0QA 1XBXA 1QI5A 2OQYA 5C9ZA 2PBGA 4HYRA 4JQ4A 3VD5A 1Q2RA 1HVQA 3S9ZA 4JTQA 4IL0A 3TH6A 4L7ZA 4MTVA 2NQLA 3E2QA 3ZVHA 3M0YA 1B30A 2GJRA 3CZLA 3CWHA 2C15A 2P10A 3FVMA 4L6OA 3AXMA 2H3BA 5DANA 1VFLA 3L4YA 1PTGA 2CLFA 3WJYA 1NQ6A 4XAZA 2NX1A 1C92A 2BMBA 1R7AA 2BASA 4Z2HA 1KCXA 4E2OA 2VDGA 4AX7A 1W3IA 4IFRA 1E9ZB 2PGRA 1V6VA 1GTEA 4O11A 3LBCA 2PWFA 3T0BA 1TV2A 3GLCA 4R53A 1IIHA 3P3BA 4D9PA 3H7VA 5CZSA 2B4GA 4L64A 1G7VA 3JR2A 3V0SA 2OKTA 4UTMA 1P0EA 4PMNA 1EXBA 4TMBA 3M0HA 2G3IA 1PYMA 3L7RA 2R8WA 3QM3A 3WBWA 2O9TA 2VEGA 4P7OA 2ZVRA 2PMQA 3CL7A 4Y90A 3RN6A 1OZQA 1BWLA 4E4UA 1H62A 4GVGA 1NEYA 2E77A 4WKHA 2YR1A 3R4IA 1UWAA 1UG6A 5C5YA 4IMAA 4E2BA 1FWBC 2ZUVA 2Y8UA 4CQ8A 1I2OA 2X40A 1QNOA 1TE6A 4DF1A 1QW7A 3WF1A 4HJFA 4GUJA 5HULA 4Y2WA 4AVOA 1KFBA 3O6YX 4YHEA 3VNKA 7A3HA 2GSHA 4J4KA 2AMGA 4IHCA 5CPLA 3DKLA 3W7HA 2DT0A 2JK2A 3IWPA 3TYAA 4QLLA 3AQUA 3PTKA 3AAMA 3RJYA 1K4HA 5FCZA 1YE4A 2A7RA 5FL0A 3KLKA 1DE5A 1FWAC 3SO7A 1LOQA 2JIEA 4DUWA 5I23A 3KZSA 1J6OA 7ODCA 4US5A 1M65A 4IIEA 1T96A 3HQNA 3NO1A 3VNJA 3POHA 2WC4A 1C9DA 4RE4A 5MKGB 4AU0A 3KWSA 1PKLA 2IPGA 4G7EA 4LQ1A 3U5YA 1JDEA 3W83A 2DGAA 3A6OA 1T8QA 3QPEA 5CGMA 3PY2A 4ZB0A 2CLLA 3ONCA 2WJDA 2WWCA 4AZIA 1GVYA 1OX6A 1OIMA 3M6YA 1OX4B 4S2BA 2CWNA 2CPUA 2UWFA 2VUNA 5K9DA 1QO5A 1OWQA 4U33A 2NXHA 3O2LA 4XAGA 1JZ4A 1QW9A 4UCGA 3BZJA 3EX4A 1SO5A 1I0DA 1MO0A 5F2GA 4GRSA 3STCA 1AK5A 3M0ZA 4ATWA 4XK2A 4FLQA 2GJLA 3AJXA 1UQYA 2ZA1A 2QUVA 2ZE0A 2H9AB 3WLQA 1QK0A 3W2JA 1D8WA 4FX8A 5AKQA 4JTTA 1J01A 4Q8PA 3WQPA 4CU7A 1PYFA 4GIRA 3P14A 3EWZA 3M64A 3W7PA 2G50A 3GIYA 1QHZA 3EX2A 3PWGA 3TDFA 5CGTA 1W8GA 2VEMA 1BTMA 5FEWA 3LNMA 3IACA 3AHVA 4GHRA 3SRHA 3LLFA 5LA2A 5FF7A 3DFTA 4N4PA 2VX6A 4XTDA 2ZA2A 1K02A 1LOSA 5F2IA 1V3HA 2NVDA 2F8QA 3F2DA 1UKPA 1LG2A 2E9LA 1JCXA 1S39A 2YA1A 3PWIA 1KFEA 3LZ3A 4ICCX 3AOFA 1A5LC 4WHBA 3CHDA 2GQAA 4GUGA 3LCWA 2OSXA 2C0HA 4RZ5A 2XN0A 4C1NB 1DHKA 1POKA 2RUSA 2A4AA 3FHAA 3EYPA 2CZEA 1YPFA 4XBJA 4AMAA 1N8IA 3T7VA 2CZVA 4MZYA 1QNRA 5EMJA 3CXOA 1KB3A 1JFXA 2YW3A 2CC0A 4PL2A 4KMQA 3VAVA 2EPNA 2TMDA 1YX1A 5M17A 3TK7A 1UZ4A 3C2OA 1XLHA 4XISA 4DNMA 1XICA 1HKMA 3L2LA 3B8SA 3W87A 3W7IA 2YGYA 2DZWA 3LXCA 3I6TA 1UR2A 4LCQA 2YKKA 4JTEA 2DT2A 5JBEA 2ZZ7A 4AHOA 1OGGA 3CV6A 4XZBA 3W4RA 1GOKA 1XLIA 3P5ZA 1D7KA 4KWSA 5E5CA 5HNNA 1ITCA 4KRZA 4R34A 1MSSA 3SY5A 3IIVA 4KESA 3TJIA 1RV8A 2WVVB 3N34A 1D3CA 1IV8A 1OFPA 1XRVA 2C71A 6REQA 3G1DA 3VM5A 2XVNA 3AUOA 4HOZA 1QWGA 2BHZA 4LUTA 1E3XA 3DFQA 4CQDA 3G1AA 3WFZA 2ZUMA 4N42A 3TR9A 1IEVA 3MMUA 4J3VA 4YTQA 4G9PA 1TRDA 5E1QA 3NQDA 4GKTA 2VEIA 2Z2UA 1BHGA 2GOKA 2HNHA 1MEIA 1OC7A 4UTFA 3S2MA 4CNNA 1JZ3A 1LT8A 3ANVA 3GR8A 3U5UA 2GUYA 3GG1A 3QZAA 2QVHA 3LV5A 4DF2A 3U7BA 1BRLB 2DH3A 2A6LA 4FPSA 1HNYA 5A8PA 1SPQA 4DLMA 5EB8A 5DX7A 2WM1A 3A21A 1WAWA 3W7RA 3MI6A 3NOYA 3NA8A 3SUVA 3BC9A 1SFLA 5A8MA 4ZQPA 1JZ6A 1PX3A 3ID7A 3TYDA 3VINA 3P0WA 2VUYA 1XG4A 5AB3A 4LY8A 2Y88A 4BCEA 3E2VA 1A5OC 1EDQA 3BARA 4Y6GA 3VZZA 3VDCA 5BXRA 4URIA 1YXCA 1VKFA 1GYNA 1NWSA 1PV8A 1AL8A 2FFIA 1P4CA 4YVVA 4IMCA 2HEJA 1YMYA 1R87A 1GYMA 2G0WA 2BLEA 5FEPA 1VEOA 2WZIA 1H41A 4DJEA 5HR7A 1PHQA 2X0HA 1P0BA 1XL9A 1TTPA 2V5BA 4F9DA 1A80A 3ZJ6A 2BVWA 4PFMA 4U5IA 4NZ4A 3DCPA 3NL3A 3QC3A 1P0NA 2ADAA 1J9YA 1WBHA 5EMUA 4E4PA 1UR0A 5CPNA 2WVTA 4IIFA 3P8IA 3QTPA 2GDVA 5I6SA 4GCXA 1LBLA 3C2RA 1H50A 1CECA 4JQ2A 1GK8A 4GBDA 3OB8A 3LBOA 3T2QA 3UYIA 5FF4A 5J8LA 5CC7A 1IZJA 1O5RA 2PDWA 1E15A 1XCFA 4JN8A 2Z00A 1KFJA 1B3OA 3S47A 3RIKA 4QJ3B 5C9RA 5CZKA 4O1BA 1XCWA 3W7QA 2OODA 2FGBA 1TUXA 4JTAA 4OVXA 3TROA 3KCJA 4UUIA 3KOYA 5CSUA 5D04C 5AHFA 4CCCA 4LVFA 3CTTA 1X97A 1VLWA 4L1WA 1XBVA 3BH4A 4OGZA 3MI3A 1K8ZA 3L4ZA 4Y9PA 1ADDA 1ZUAX 1Z41A 1DPMA 4HPXA 4D6CA 4MAZA 4A2RA 3MV01 2VEFA 4LRSA 2RHGA 1K9FA 3CAKA 4QJ1A 3FAXA 3MJMA 2CHOA 2EG7A 3VFLA 3PR2A 2PDIA 4DJEC 3UZ5A 1KFKA 1SGJA 1K9DA 3HPFA 1DWIM 2DPEA 1GQKA 1X6NA 3TC6A 3RU6A 4O10A 2QCLA 2GWGA 4J5NA 4H00A 3BAIA 3NXLA 2GVLA 2OPJA 3HGRA 3PNZA 1TWWA 3EDEA 1A5KC 3AIVA 3RR4A 1XLCA 2FQIA 2WMHA 1MXGA 4MIMA 5DELA 4B5SA 2PDJA 4D6IA 1R0MA 1J0HA 1DTNA 4UZSA 3OO2A 4CNUA 1Z9AA 2I9EA 2BZNA 2JIWA 2B0MA 1UR4A 4LPCA 1R9ZA 2QDDA 4IPLA 4HZ7A 1OFDA 4HOXA 3WH9A 3TONA 1TX2A 3GS6A 3W07A 2VD9A 4XAYA 4ZFMA 2QAPA 3TCSA 4ZO8A 4BQ3A 4XTIA 1JL8A 4I5XA 4HVXA 4UTUA 3G18A 1ZJAA 1S2AA 4NQ1A 3IVTA 3IJ7A 1W1VA 1VENA 2F6KA 4I9AA 1PDZA 3JZUA 3DERA 5KMYA 4ZTYA 2R1MA 3MUY1 3B9AA 3NDZA 1X1NA 1ME9A 3GNDA 1IT0A 3IJDA 3Q67A 4Z0SA 1BSLA 2ATSA 4AHPA 2BG5A 3DGBA 3I4KA 3IGXA 3ZJ8A 4LUSA 5C54A 5HNTA 2GK1A 2EKGA 2XM2A 4GIAA 4U2ZA 3SUTA 1JI1A 1X1OA 2ISWA 4A21A 5I3IA 4K36A 1WDDA 1LL4A 5AVNA 3HPZA 4A3RA 4AZCA 2NUYA 2O55A 5I79A 1WZKA 5BXPA 4NZCA 1JZ8A 1GT8A 4P7QA 1GOIA 4JL2A 3EGJA 5D33A 4RKAA 1Q8JA 3BG9A 3VILA 1YNYA 1NTHA 2QEZA 2YCLB 1VEMA 4GBUA 1M7OA 4OECA 4JCLA 1JYVA 1BTCA 1DQXA 4XSLA 4PMQA 4WXYA 3UR7A 3GVVA 4Y8FA 5D38A 3MUXA 4GUHA 4PTXA 4IGHA 4DYKA 3GXIA 1SO6A 3B9DA 1ZFJA 4O1AA 1EOKA 1SR0A 2XSXA 3RDKA 2O4MA 1IF2A 4JTSA 3NM1A 3QLDA 4FNQA 2F6XA 2BHYA 2QPXA 3L68A 1EO7A 2XVLA 3BSMA 4MKNA 3WD3A 1V93A 4W7UA 4H04A 1E6RA 4GJJA 1WKFA 1CXEA 2BODX 3UNDA 4F4RA 4MFDA 1G9HA 3EX1A 1TWIA 3E0VA 1POJA 2FJKA 3I7RA 4KCWA 3W88A 3M5ZA 1HTIA 1RK5A 4Y9MA 3CMFA 5A95A 5LIKX 3E02A 2J79A 4C90A 3N73A 4WGHA 1C8YA 4IQDA 3T08A 4LNYA 3WQVA 3BLFA 4GVFA 2JF7A 4QRNA 3USBA 3AIWA 1PXGA 4N6EA 1F8MA 3ECQA 4TVUA 4UOJA 1UKQA 1WKYA 3AIUA 5EMMA 3M44A 3A12A 2RGLA 1EH9A 2A3BA 1KRBC 5BW6A 4DQWA 2VX4A 4GI9A 1LF1A 1D3HA 1OK6A 3EMZA 1XLKA 1VZWA 1VCGA 3VTRA 4L9YA 2X30A 3P8JA 1B2YA 1VD6A 3BAJA 3KL5A 4WQ6A 1SJBA 1KCKA 2PBOA 4OHQA 4UMBA 2ZZ3A 3QHOA 4LS0A 3FJNA 2FTYA 3UWWA 4A2SA 2W3ZA 4H6EA 4W8LA 1JRCA 4CQ9A 5DBUA 3WQGA 5K2ZA 3ZWTA 3LGDA 5A5WA 4AZHA 2NQ9A 3VE7A 4L4MA 4YWSA 3Q94A 1EC7A 4IMGA 4QROA 2GGGA 4FB7A 3VDAA 2YB1A 2G5WA 4NL1A 3GNOA 3HGJA 3D47A 2C19A 2JFEX 1FDZA 5A6SA 1NDZA 2CXGA 3TN5A 3N14A 2IKHA 2WJZA 2C1GA 4PMOA 4AWUA 3HV8A 4DO4A 4I90A 2TSYA 1QOPA 3TR2A 4ILSA 4OBSA 2PDXA 3U48A 2BNJA 2ZIDA 2A3HA 1PCKA 4Z2JA 2RFGA 1RAKA 1KR1A 2V5JA 2TAAA 4Z1BA 3CNYA 1OBAA 1SR9A 1WZAA 1DJHA 1UPPA 3IV8A 1LLOA 3SCPA 5LIUX 1H1YA 3QGVA 2ZXQA 1ZCOA 2QJNA 2HXUA 4QS5A 3H2EA 1HVXA 4DI9A 2QVNA 3KDNA 1JQVA 3L4UA 4M7SA 1Y65A 4O18A 1RBOB 3SR7A 4JHMA 3ARWA 3ITXA 1ONXA 3AHXA 1RHCA 2TODA 1JD7A 3AXXA 4MM1A 1OFEA 5C9WA 1K7XA 1DJIA 3EBVA 4RLIA 5C7VA 3IIZA 1A50A 3UG8A 1AH0A 3LM7A 3WEOA 3VKKA 1SSDA 1FWDC 3EKLA 3FX4A 4NX5A 3EB2A 3ZJKA 4RE2A 4MVAA 4QQ3A 5FJPA 1B1YA 1JDFA 1OYBA 1DOSA 2E68A 1TCDA 4F0RA 2BVTA 3DFYA 4ML9A 3B8IA 1CW2A 4DIAA 4EF9A 2VJXA 1XDJA 1RCQA 4FF5A 3Q4DA 3W26A 2DV0A 2J9ZA 2UY3A 3MB9A 4EF8A 2R9RA 1KFCA 2PWUA 3OHMB 2Q71A 3NXFA 2D22A 2BOEX 4EXAA 1A0EA 3R79A 3W7LA 2WZEA 4JGDA 5IFPA 4DPQA 2PTXA 3PP7A 1AW5A 3R25A 1ZSXA 3WNPA 1W3LA 2J77A 4H8NA 4HOWA 4YHGA 1W3NA 3CT7A 3M07A 1L6FA 4US5D 1W5QA 2YZ5A 2Y7GA 4LVAA 3D0CA 4JTCA 4EOUA 3LQLA 4MJ4A 2HROA 3DESA 1QDSA 4NJHA 4O19A 4J35A 2EPLX 5GJPA 3W00A 5ECUA 2WKLA 3AS0A 1DWJM 4LUYA 1XFBA 4CEXC 2F2HA 1E4MM 5TF0A 5H8PA 4M80A 1SO3A 2VZSA 2OVLA 2Y24A 1OF8A 4H01A 5EBAA 2DZAA 3UJEA 4NKCA 5I09A 1XRTA 3FKRA 4FR6A 2X1SA 3WBYA 2VDIA 2QXWA 4PUNA 3DEQA 3ZSSA 1OZMA 1IQ8A 4QJ4B 1GCYA 1ISZA 4IISA 1XISA 4YXGA 5AN7A 4X9SA 4GUFA 1BSIA 4GX9A 4ZEPA 2EO7A 1JYXA 4G1NA 1QOQA 2W66A 5CZTA 4Q8MA 3SRFA 4S3DA 1EP3A 2VHLA 2D0GA 1WX0A 1UUQA 4ZENA 3FXYA 4BK9A 2X8RA 3SCSA 2I17A 2G8ZA 3TU9A 2D2HA 4PFHA 1ZAHA 4C6FA 4C91A 3TLQA 4ERIA 4CNSA 2W67A 3QKZA 4AAJA 4BHYA 3FKKA 4A3QA 5BYWA 3KXQA 4A6GA 2HS6A 1OABA 3W70A 3OEXA 1FWWA 3L12A 3UW6A 1TPEA 1CXHA 4Q22A 2C18A 1MI3A 2CKRA 4GYJA 3NZGA 1K8XA 3M0XA 4JFUA 1R38A 1XC6A 1G4PA 3NZRA 3GVGA 4LC8A 4GE8A 1VB9A 2WVSA 4XIAA 1TPUA 2J4GA 3WEZA 5A6LA 1UZ1A 3GBEA 4MPQA 1F05A 3UD6A 2V69A 1U1UA 3DU0A 2LLEA 2G97A 3MCOA 4CVWA 3QY6A 5I0DA 2J7CA 2O9RA 3HO8A 5A8GA 1W5NA 3ZXWA 5JBDA 1ZZMA 4IFKA 1W91A 2VOMA 1Z7AA 3WF4A 1CGTA 2A3LA 2ZX6A 4MYXA 1LLZA 2DJLA 4P7LA 4GY0A 1JQXA 1KV5A 3I6EA 4I7WA 3VOCA 1FWIC 3M1ZA 1WXYA 3P61A 1TPB1 3M0KA 4HJWA 1EJUC 5AHMA 5FKYA 8CGTA 1O7AA 2IUZA 2XIOA 3C2YA 2F7FA 1XR2A 4D8LA 2W9MA 5K9XA 2VR2A 2FZBA 1TVNA 1OX5A 4HTBA 2ZUSA 3SI9A 3TJLA 2G4FA 5HDRA 1V7YA 2ZX8A 3N04A 7TIMA 4Q8WA 2E1WA 2JQXA 2VO5A 3M0LA 3SSJA 2KX9A 5E09A 1G94A 4Q4OA 5KZ6A 3RO6A 1AJ2A 2VQTA 1AD1A 4J1OA 5F2MA 2XH2A 2QCMA 3ZZ1A 2QCCA 4IT1A 4Q4SA 1FP9A 3FNDA 4GIEA 3UXKA 4O13A 2V3FA 1KM0A 1ITQA 4RL3A 2VCBA 1EZ2A 2V6AA 3U2CA 3OQ8A 1OD0A 1DORA 3A24A 1T41A 2PZ0A 3VC6A 3TC7A 2HMCA 3AUJA 3TYCA 3VCRA 4FNSA 3WSUA 2BVDA 4G5DA 3W1LA 4DBSA 1B5TA 3OQEA 2B81A 1DTUA 5AECA 2PTYA 2X1UA 5DF0A 3W3OA 4QISA 4WJXA 5AYZA 4X2RA 2IQ0A 5I3JA 2C1IA 2RDUA 2WJEA 4NNBA 2Z7KA 3OVRA 4Y96A 2Q8ZA 1P7TA 4HTYA 3BJTA 4RV8A 4HA3A 1BQCA 3QR0A 5CH9A 5EYWA 1G4EA 4HCDA 3DI1A 1QR7A 3HM7A 1BG9A 3MSDA 5HAOA 1XIFA 3IANA 4QDMA 3KVLA 1CB7B 3WUFA 3HQOA 3LV6A 2PSNA 1S5TA 2PUZA 4A3UA 1Q13A 3BPWA 3H4XA 1CNVA 2F84A 4D6JA 2DSKA 3A64A 4GVHA 1OFOA 5ABEA 4LUIA 3TQ0A 3R13A 2CU0A 3WH6A 2XIIA 2JBMA 4CCEA 3VNDA 4CD6A 3QQ1A 3FVDA 3PC0A 2QT3A 1R8LA 3H26A 2OLSA 4QLJA 1UIPA 4DJED 4MG4A 4B5NA 4RDWA 2RDWA 3ALGA 4M19A 2NSXA 6A3HA 3B0YA 2FHBA 2IW0A 4IG2B 1B90A 1AJZA 1QI2A 4CD5A 1EBHA 4ZB2A 4XUGA 1TCMA 4FHAA 2GFTA 3AYRA 3KRZA 3ZFHA 3NQCA 3GRIA 3XINA 5BWAA 2HTMA 2P8BA 3NM3A 4PL1A 2QDGA 1A5AA 4IFOA 3O0KA 2OGYA 1GOQA 3G3MA 4XKYB 5GJMA 2PDUA 1RBLA 4KBXA 4KETA 3AWOA 2QCDB 1A53A 2R82A 3LI0A 3GR4A 3AU2A 3E5BA 2C14A 1ZBVA 1CPUA 3T09A 1XRFA 2VP8A 3WFAA 3VFCA 3CIWA 4WJEA 2BX7A 1ITXA 1XIIA 3CQKA 1NU5A 3DX5A 1IWBA 4L5ZA 4IMDA 1U5VA 1I4NA 4R88A 3WQWA 4E8CA 2ZCGA 5BRBA 4MGGA 3WL1A 3D46A 3A4JA 3TYZA 5I7GA 4R7OA 3MP5A 4AD3A 4I8DA 1OM0A 3WLJA 1OT1A 3W75A 3BLIA 2XWDA 4Q8VA 1QI3A 2WZHA 4Z2IA 4JTRA 1AUSL 1E6PA 1IHIA 3WLOA 3RR1A 4REQB 4NAEA 5FJRA 4GY7A 2UY2A 3MQTA 2QV5A 1AQ0A 5EL1A 2VVSA 3WDQA 3TUUA 2H6RA 3SB0A 5K3VA 1HX0A 3I4EA 4K2SA 1SW3A 3IEBA 1GTHA 3RFAA 5K4ZA 3KRSA 4C6PA 1V79A 5A6KA 2OWXA 1Q6LA 3CUGA 3W1XA 2HPMA 3KBWA 4H2CA 5CAHA 1SZRA 3HIJA 4HZMA 2VURA 4LYRA 4AIOA 3B40A 4HPGA 3L65A 3AYTA 1W3HA 1HKKA 4RCXA 5AZ1A 2ZRVA 3AFBA 5LYRA 3WQEA 5DXYA 1TV5A 2PFHA 3PG8A 5BOOA 1H2JA 1UBSA 1EIBA 2POZA 1W2VA 3K13A 4D8ZA 3E2SA 1C90A 1E70M 4GZIA 2OTDA 4LCRA 4TR9A 4NAFA 4KIEA 3GFYA 3I68A 1K70A 3DI0A 4AW7A 4IMFA 1O95A 4NHVA 2JKAA 4KEMA 4ACZA 3WMBA 1HXJA 1WUEA 3C2FA 2EGZA 4PMDA 2VRKA 2CIPA 3AI0A 3VUSA 3R0DA 2FVMA 2Y8KA 3V3WA 6XIMA 1VFTA 2DP3A 4EP8C 3UGVA 4V2XA 4MLRA 3N9RA 4ICNA 4DAIA 2UY4A 3INPA 3UWEA 4Q7BA 1WCGA 1RH9A 4X9YA 3AC0A 1XH0A 2Y7EA 2VX7A 1RCOB 1TWZA 5IRPA 2VD8A 4CN4A 3VABA 5FOOA 1EBGA 1YDNA 4U3AA 2PU1A 3OIHA 4QFUA 3IJQA 1OK4A 2DT3A 4N9CA 1MW1A 1WDRA 1L0PA 4ZBCA 3KBJA 1XM3A 4KW2A 3W6MA 3KCOA 1KV8A 1FWHC 5GVJA 3ATZA 4B5TA 4BWLA 5I2UA 4S23A 4LF2A 4Z1YA 3B8UA 1TPH1 4IJCA 4BA0A 1AMKA 5K9CA 3GUWA 4MOZA 4AVNA 5BOFA 3Q37A 7PTDA 3W1UA 3IV3A 1EX1A 1JAEA 1ADSA 2AMXA 3OZMA 2IQTA 3ZT5A 4F2TA 3TIMA 4ONVA 2WC3A 4KEUA 4XV0A 5HK4A 1WKDA 3CH9A 1YBQA 3QFEA 1HKJA 4CQCA 1V02E 1Z3NA 2RH9A 4GUIA 3CHFA 2YA0A 4BY3A 4DAFA 3WJZA 3OZPA 1NP2A 5IXEA 2W92A 4EWND 4L4PA 4D72A 1TUFA 4KERA 4J3WA 1PKYA 3H7UA 1B9ZA 1TV3A 3AMGA 1GWJA 3EDFA 4W87A 1M6JA 1C93A 4FF7A 1LWIA 5M03A 5DLCA 4C6NA 3WO8A 2EBNA 2ISDA 2Q02A 2WAGA 1BQGA 1BVNP 3N2TA 7REQA 1O4UA 4IIGA 1E1CA 4IH3A 1IWAA 3VNZA 1DWAM 1WOBA 3GDKA 1KTNA 3U6WA 1QNVA 2NVCA 4M7TA 2WHJA 2A2IA 3GXMA 2FTWA 3TYUA 1JNDA 2DDXA 3N2XA 3GVRA 3S6DA 4UFLA 1XYBA 1WB0A 3DAQA 3T44A 5AYBA 3B8WA 2JEQA 3NSMA 1RQBA 3FDGA 1MDRA 4RV3A 1TFVA 4BWLC 4M8UA 3B9EA 4M51A 4KIRA 4EIVA 1H5YA 2R14A 3MKCA 2A6NA 2XG9A 3N6JA 1H51A 1ECEA 1NY1A 2R6OA 4JFTA 4TTUA 1KD0A 1RSCA 3AALA 3CV2A 1G69A 2VZOA 4J7RA 3VPLA 2QS8A 4JX5A 1F3XA 4PMXA 3NGJA 2V3EA 2W63A 2GDUA 2Y5SA 3KTXA 2QULA 1VC4A 3NQFA 3AS1A 2QJHA 3V0TA 3W2KA 5AC4A 3CQ0A 4ADUA 4UTLA 3CL6A 2BY1A 2ZDSA 3W1MA 1Z44A 2XVKA 2X7VA 1CGUA 4LBSA 3R12A 1KA9F 2DQXA 3NOEA 3T1GA 1BYAA 4FIQA 2F9RA 1TVLA 1UUMA 2QCNA 5AC5A 2AL2A 1YEYA 1YE6A 2HE8A 3NQEA 4A35A 1SW0A 2BY2A 4ADSA 5FL1A 3H7RA 1GW1A 4H6KA 2B7QA 3TVAA 4HHHA 2A3EA 1XLBA 4UQDA 4IIDA 2J7FA 8XIMA 1VRDA 1M41A 4UCFA 1UBPC 2QYGA 1MMFA 1F74A 1GOMA 1R85A 3UR8A 3C56A 4QTGA 2D23A 4B5VA 2ZUTA 3CAQA 4XZWA 5ABFB 4QEEA 2JALA 4QDWA 1XW8A 2OYMA 2ZTKA 4M6QA 1VGAA 3R10A 4HBKA 3GW0A 3T81A 2XIQA 5EKYA 3MC5A 3TW9A 3C0SA 1H11A 3I10A 2OEKA 2IPFA 2PRLA 2VCCA 2BBFA 3WLTA 3F03K 4ZXOA 3MYPA 2TRSA 1F61A 3SUSA 1JZ5A 3VXGA 1E6QM 3DKJA 3K8KA 3KP1A 4RR4A 3GHRA 3B0PA 4YYCA 5D05A 3TA9A 1O6IA 1XGZA 2ZRWA 4JZ5A 1ZALA 4BF5A 4NZ5A 4FLOA 2ZRXA 4PMZA 4ATDA 2GDQA 1T40A 3I6RA 2ZUWA 1E9LA 2CEQA 5F2LA 3N11A 2QJJA 3N19B 3PB0A 3OG2A 3STGA 1OFRA 3WK1A 1Z8AA 3UU0A 3I3DA 2OZ0A 4OE7A 2E0PA 2HCVA 3G0UA 2INZA 2AL1A 2V5CA 4IJBA 3HFTA 3O07A 5FF3A 2ZKMX 1F73A 2X1IA 1KWGA 2IMRA 3LCGA 1JF5A 4XO6A 1LG1A 2Y1HA 2B7NA 5A69A 3MANA 2NQHA 4GA8A 4A4AA 4M6UA 3WUGA 2Y7FA 2XN2A 4DPPA 1UJQA 1P5BA 2BY3A 3L0GA 1L8PA 2DU2A 3E3HA 1DWFM 1E5JA 1N8FA 4MB5A 3F4DA 4K3ZA 3OYZA 4FSAA 2X1TA 1FFQA 1WAUA 4MPKA 1CLXA 2DVTA 1CXIA 2YL8A 4YN5A 3TWAA 3PM6A 1XYZA 4NI3A 4DVOA 4V15A 3W1NA 4GACA 3UPWA 5IOBA 2DW6A 1LUCB 1HGYA 2HRWA 4PR4A 1O1HA 6PTDA 3N15A 5I3GA 3W7GA 3DH7A 2CXEA 4ZQMA 1SJAA 3VZYA 4DWSA 1CWYA 2JKPA 2VGGA 1VAHA 3IRSA 4HPJA 3HB9A 4X61A 2NWSA 2HBVA 2VC6A 4MMWA 1M04A 3NL6A 1S5VA 5REQA 2BSLA 4ZOBA 2GUUA 5DQPA 1LLWA 5GJNA 4KEVA 2HBXA 1FWNA 1QRQA 2PCEA 4TV5A 5HPOA 4ZO7A 1LWJA 4HCLA 2IPWA 1SYTA 2FDMA 4ZOEA 3BCDA 4AY8A 4H6QA 2BHUA 1ZBWA 2C0AA 4LAMA 2PDBA 3ME3A 3P5YA 3VOHA 5AYXA 3B05A 4YL2A 2Z25A 2WHLA 4IP5A 4XG1A 2IXUA 4ROPA 1MW2A 2VZVA 5BRPA 5XINA 3W2LA 4H83A 3VD7A 4PUDA 4LT9A 2YCIX 3GXPA 5CG7A 2AKMA 3IS4A 1FWCC 1Q3NA 4GZJA 3S3GA 1BLIA 1W3TA 1W56A 3B9NA 4QITA 3ARSA 1J4EA 1Q2SA 3USZA 1UP0A 1IXPA 3KOXA 4RE3A 3NEVA 4UMCA 2HPIA 3PANA 4UOZA 3A9IA 5F4XA 2O9OA 4EANA 4JTKA 4FXRA 2Z24A 5LHEA 4TO8A 4N9BA 1XIGA 4QBXA 4DWSC 3D3AA 5KZMA 3RCYA 1XLLA 3A23A 4HMNA 1GG1A 4JN6A 4DZ5A 4FAMA 2Q3OA 1P1XA 4KWUA 3BV7A 3OVGA 1IYXA 1MNSA 1TB3A 4CVUA 5A2CA 3L9CA 4QAWA 3EXSA 3CQHA 2E9BA 1NWUA 3EA1A 1A5BA 1EWDA 1FXPA 5TQLA 2J24A 1S1PA 1A5MC 2V9DA 3MSRA 4OWGA 3ARXA 2NX9A 3ARYA 2XJ7A 3P93A 5C6MA 2I14A 4YTTA 5KINA 1GVRA 4KKXA 4FA3A 4MJMA 3VGGA 2FGLA 2YCEA 3V35A 1NFBA 3STEA 5A6TC 4O14A 3W24A 3PUOA 4HT3A 3CU2A 4HZ6A 2GVGA 4JOMA 3W7NA 3GWQA 4GFSA 3PN8A 5CC3A 2XHYA 5A3HA 2WBGA 3FGCA 5LZLA 1TIMA 2PD5A 5GQBA 2WLYA 1ZTVA 3MA8A 3L4VA 4TX8A 4JKKA 2Z0IA 3G6MA 3U3HA 2V0TA 1MDLA 3G1XA 2A7NA 4UR7A 3T8QA 3OVQA 1GEHA 4LGXA 4RPPA 1UJPA 1MFVA 1A0CA</