4W8BA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with xxlg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
386
structure length
386
Chain Sequence
KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-xyloglucanase
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 157
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8bA00
3WH9A 3AHTA 2ZUMA 3SCVA 3WQ4A 1QI5A 4AZHA 2XFRA 1VEMA 2DSKA 4A3YA 1D3CA 1VBRA 4PYSA 3ARPA 5ABEA 1B3WA 2OLHA 4K68A 3S6TA 4CD8A 2JE8A 3VX0A 2J77A 2WMIB 3O6AA 4MB4A 5LA2A 3RDKA 1XC6A 1PIFA 1TCMA 3QOKA 1V6UA 1W9UA 2VRQA 5GNZA 2O9PA 3UETA 4UFKA 2D24A 1QI4A 1BF2A 2WZIA 5JIWA 4FF5A 3AOFA 3GXFA 2VRKA 2E9LA 3WDQA 3CZ8A 2ZIDA 2VZVA 4H04A 2XJ7A 4UZSA 1JYWA 2JEQA 2XSBA 2UY5A 3HJEA 3TTQA 1QW9A 1CZ1A 4M80A 4X0VA 4GZIA 1M53A 2BY1A 1W3JA 1HJQA 1WAWA 1VF8A 5D9OA 3BAIA 1WB0A 2OSYA 4LX4A 3RMEA 4KRTA 4W8AA 3GNOA 3BLKA 2WHKA 1H1NA 1E0WA 4ZE5A 4S3KA 4AZCB 4JAWA 1UWQA 4JKKA 1CXEA 3WFZA 1C92A 1AQ0A 2J4GA 1WP6A 3VMNA 3UG4A 1C8QA 2WNWA 1WZKA 5A2AA 2GJXB 2GFTA 3VGHA 1UZ4A 2BVTA 1KBBA 1V6XA 1EDTA 1HIZA 3RIKA 5FL1A 1V02E 1V02A 2VZUA 3VKKA 2CBIA 2VI0A 3WH5A 1ZBCA 1V3IA 3K8LA 3MSDA 3S2CA 2A3HA 3GBEA 5C8BB 4QCEA 3ARSA 1BAGA 4DWSD 1CLXA 2WVSA 3SCUA 4A4AA 3AS1A 3AZTA 4C7GA 4PMRA 1VBUA 2J7HA 3AZRA 1XSJA 4NF7A 5ABFB 2DDXA 4U31A 1MVYA 3ZJ6A 2XIIA 1BYBA 1EIBA 1UH4A 1EOKA 3AS2A 4U5IA 1CENA 4CKQA 5JBDA 2JEPA 1JD7A 3WBAA 1JG9A 4F79A 2WKLA 1LWHA 3L4WA 4HU0A 4ZENA 4W5UA 3VD4A 4TOQA 1TVNA 2VZTA 4QCFA 1KCLA 3WF4A 1QPKA 1QBBA 1WDQA 5IDIA 1XD1A 3U7BA 3A4AA 2J25A 3A4XA 1UWTA 1C8YA 3K1DA 1HX0A 1Y7VA 4CN4A 1G9HA 2ZICA 2OYKA 1E4MM 2OWXA 3WNMA 2RGMA 1H4PA 1A47A 2UY2A 3GM8A 4TVDA 2W4XA 4H8HA 2YIHA 5E6YA 5E0CA 3ZT6A 3VIGA 1XHGA 2ZUUA 2QPSA 3AMLA 2DSVA 3A6OA 2AAAA 2D0HA 1DWHM 1TZ7A 3AIUA 3T2OA 1GNXA 3PZGA 2Q8XA 5JBEA 1UR4A 4CVWA 2DT2A 3N18A 5A6LA 1GONA 1UWSA 3MO4A 4AD0A 5I24A 2GDUA 5E0FA 3N12A 3U5UA 1OD0A 1KFWA 2ZX5A 1G01A 4H7VA 3PZOA 2DGAA 3WD4A 2W5FA 5EMYA 4PMUA 2XWEA 3CPUA 1VEOA 4M1RA 1O7AA 3OBAA 1H49A 1V03A 2BHYA 4D6GA 2J79A 4PBGA 5D8WA 1UQZA 1VIWA 2G3MA 4M24A 3WDIA 3VUPA 4BQ4A 1D7FA 1JIBA 2GVYA 3AIBA 4D1JA 1W3LA 3GH4A 2MANA 3N11A 4PMNA 2E3ZA 4M81A 4CU7A 1DHKA 4AZIA 1I1WA 2C8NA 3D5HA 2YBTA 1V3JA 5A8QA 3W6LA 8CGTA 3IJ9A 4EAMA 4X9YA 2FH8A 3MUIA 3BMVA 4UOZA 3UEQA 2WMIA 3WIJA 3SCWA 4ACYA 4UQAA 1UYQA 5CGTA 3D3AA 3WENA 2CESA 1E1FA 1UG6A 2G3NA 1JL8A 2WVVB 4R5EA 4PRWA 2W91A 3EYPA 2EPMX 5A6MA 3FHQA 4P7NA 3N1AA 3T2QA 1WCGA 3HMCA 1ODUA 2WMFA 3TTOA 3EDJA 1JDCA 1UR8A 1V3HA 2A3CA 3W82A 3THCA 3WELA 3WH7A 2XM1A 2D3NA 1K9DA 3WDHA 4MNLA 1G1YA 3WEOA 2PB1A 2E8ZA 5I79A 3QGVA 3AISA 3PZIA 3PZNA 1Q6GA 1HP5A 1WPCA 1KCKA 5HDRA 2X2YA 3QHOA 1C7SA 3TA9A 4FLSA 4UQBA 1JXKA 4KGLA 2CKSA 2D20A 3TP4A 4V27A 3RM8A 2BHZA 1Q6FA 1ZL1A 2VX7A 1HJVA 3GTNA 1X6LA 3DC0A 3BC9A 5A6SA 5BWFA 5BXRA 3AMCA 4HOWA 3EDKA 2J8GA 2PWHA 2JF7A 3VD7A 2CETA 1HKMA 1V0KA 3QHMA 5A6BA 3KL5A 1NQ6A 3L4YA 4C7FA 3RCNA 2G3IA 1B3ZA 2XIBA 1V3KA 2J7EA 5BXSA 1V6VA 2ZX7A 4F9JA 1MYRA 2BXZA 1EO5A 2NSXA 3ZR5A 1B3YA 1C93A 1WDRA 3BCFA 4UNIA 3VMPA 3SUVA 1LL6A 3PZVA 1W9BM 4PMOA 4GO9A 1SR0A 3NSMA 4Y7EA 3HU7A 1EA9C 3GYCA 3ALGA 4UQCA 3GDBA 5A6BD 1WDPA 3WDPP 3SCTA 5M03A 3T0DA 4TX6A 3KE0A 2QHAA 6TAAA 3WH8A 3NSXA 5IFTA 4IPLA 1JFHA 4MAZA 1GUVA 1OGGA 1UWRA 1TG7A 4B15A 3AXIA 1JZ3A 2XVKA 4B9ZA 5IHSA 3CZGA 4MAVA 2WW5A 5AC5A 1EDQA 2CYGA 3IK2A 2QMKA 3WF1A 1FFRA 2EXOA 1C8XA 4AIOA 1JDDA 4D6FA 2W62A 1V0LA 4MNJA 1UD5A 2WCGA 5D9PA 1QNRA 2FH6A 4AZGA 3GH7A 3VVGA 2E9MA 3MU7A 4AEFA 2A3EA 4OIFA 3ARQA 4JKMA 1G94A 3SIMA 1HF6A 3MV01 4TUFA 3FN9A 2V3GA 4W88A 1PZ3A 5CXPA 2PBOA 3ZOAA 3CHFA 4JFUA 4UOJA 1B30A 2V3EA 2EJ1A 4CGTA 1JF5A 1JAKA 1JZ4A 1MW2A 6A3HA 1J01A 1MXDA 5FOOA 1E73M 5A8NA 1ITCA 3FAXA 4FLRA 4U3AA 2ZXBA 1NH6A 3VNZA 2QV4A 2X0YA 2J74A 4Z2IA 3WSUA 1KQYA 1KGWA 2ZUVA 5A1AA 4MDPA 2VCBA 4V28A 1WE5A 4WLCA 1E5NA 1ZBVA 1DTUA 4JHOA 1E6SM 1MWOA 1GQKA 4L4PA 2YL8A 1W1TA 2XFYA 4CD5A 1EDGA 2DH2A 1WDSA 4HPHA 4Q7NA 2BY0A 1BGGA 2WPGA 3F5LA 3VO0A 3VGDA 1R8LA 1NOFA 1FHDA 1VENA 1Q6EA 2NT1A 5DO8A 3VGFA 5EFFA 1J0KA 1JNDA 1LG2A 5A95A 4U2ZA 4D6JA 5FCZA 3ARZA 2WBKA 4QLLA 1SMDA 2CBUA 5DFAA 1E6RA 3SCOA 2WVVA 4J3UA 1GPFA 3CGTA 4UQDA 1EO7A 1R87A 3VM5A 3SURA 4JL2A 2JIWA 3BXWA 1C3FA 1XCWA 5JIPA 4E4PA 2Z1SA 3W0KA 4ZXOA 1GOMA 2GDVA 2CHOA 2HVMA 2ZWZA 4LYQA 3ARWA 1UH3A 1OIFA 1W2VA 2QF8A 1BVZA 5EFDA 1PJ9A 1KGUA 2VZSA 3NDZA 3WQ5A 2FHBA 1HVXA 3BAWA 2WC3A 2XVLA 3B9AA 1NP0A 2XYLA 1VB9A 4HA3A 4Z2GA 3BSGA 5E70A 3T2PA 1E0VA 3IAQA 2VVNA 1TMQA 2FGZA 2W63A 4IM4A 1LJYA 1HXJA 2V5CA 1MQRA 1YHTA 3ZR6A 4D71A 2YL9A 2CCRA 3PTQA 2O9TA 4PEEA 4Z2KA 2VR4A 2YL5A 3EBVA 3CUIA 5CPSA 1G5AA 2FGLA 3NUKA 3EMCA 4HP5A 1CYGA 2WYSA 3TOPA 1UD2A 1JZ6A 1HJUA 1CGUA 3AZSA 1W3HA 4JZ5A 4CN1A 2VMFA 5ABHA 3OIHA 3L2LA 5CPTA 4RE3A 4P7QA 3QR3A 2G3JA 1ISVA 2XUCA 1W9XA 3F5KA 3SCPA 3DYMA 4J3XA 1E6NA 3MANA 1PPIA 1UUQA 2WMJA 4HOZA 2XPKA 2WSKA 5CSUA 4XUYA 1I75A 3ZQ9A 5BXPA 2BVDA 1E3ZA 3FNDA 1LQ0A 1BYCA 1H0IA 5BRPA 4BA0A 1W1VA 4WKFA 3WDJA 4AC1X 1H3GA 2E40A 2WZHA 5I6SA 4UOQA 1QNQA 1NM9A 1MFVA 1BSIA 4GXPA 4OBRA 1JYXA 4RE2A 1QW8A 3CUFA 1EQPA 3EDFA 2WVTA 1PX4A 1L8NA 3SEPA 4P8UA 1UR1A 3PZQA 1OIMA 4DUXA 5CSYA 1UKSA 3VGEA 3W81A 2CBJA 4E8DA 1E6QM 3L2MA 1OGSA 4W85A 4ML4A 3SUTA 4AD3A 3L4TA 1JZ5A 4U5KA 4CN6A 1JZ8A 2VZOA 2CBVA 3A3HA 1NOWA 3LPOA 2TAAA 2J7BA 5A6JA 1V0MA 4PUDA 3APGA 2WWCA 1KBKA 1J0YA 3BMWA 1E4IA 1GJWA 3OA5A 1KXHA 4GZEA 4LYRA 4JFTA 1UD6A 3VIIA 5CG0A 4IISA 4IUGA 2A3AA 3BLPX 1QI2A 4TVCA 4PMXA 1BHGA 2WVUA 2UWFA 4CD4A 3ZSTA 1JZ2A 2EO7A 2WKGA 2A3BA 2UY3A 4ACZA 2VURA 3W6MA 3AHYA 4M82A 4W8LA 5M3WA 1KB3A 5IXEA 4ZFMA 2GUYA 1E6XM 1MW3A 2D1ZA 2J75A 5HPOA 1CDGA 4W93A 1EGZA 2D23A 2J7FA 4J3VA 5CPQA 4JCMA 1UR0A 2VX4A 4HZ8A 2OSXA 2YLLA 1SFSA 3NSNA 2QPUA 5HPCA 1QVBA 4GZJA 3TONA 1MW0A 1NWSA 2V3FA 3BAJA 5I2UA 3VIKA 2DSWA 1B1YA 5I77A 3N9KA 3PHAA 3CZJA 2ZXAA 4UZUA 1KXVA 1IZKA 3I3DA 1AQHA 4MPKA 3MKKA 5E6ZA 1CECA 4Q22A 3TTYA 1UD8A 3AIQA 1WZAA 1SYTA 2JALA 3GH5A 3LPFA 4NRRA 1R7AA 2C7FA 3WD2A 5DMYA 1CXHA 2FHFA 2XSAA 3DYOA 3PZUA 3UCQA 3WN6A 1E6ZA 3WQ8A 4P7RA 3W38A 1FH7A 1UH2A 3KL0A 3N17A 2GK1A 1UD4A 1UZ1A 2DT3A 4DM1A 3M46A 1ODZA 5HBFA 4W7WA 5FIPA 3WNKA 5D4YA 4HMCA 1UWIA 3NCOA 4WSKA 3VILA 7A3HA 5CJ5A 4OOUA 3AI0A 2OSWA 1ZS2A 3CBWA 1QNSA 5A94A 3AJ7A 1OB0A 2ZX8A 3IAPA 2GSJA 2BXYA 4W84A 1ESWA 5FD0A 2OWCA 2EPKX 4AYSA 3AYSA 3T08A 1MQPA 4HZ7A 1US3A 4V2XA 1PAMA 4GQQA 5ABGA 2W92A 5GQBA 3VIMA 3J7HA 2D22A 4UCFA 4ATLA 4U2YA 4DM2A 3B9EA 2VVSA 3WD1A 3VM7A 5I3DA 3AHVA 1LL7A 1H41A 2CIPA 4W7UA 3U57A 1E5JA 2BV9A 3MUY1 2VQTA 5A2CA 2XM2A 3M6DA 4U3CA 5GNXA 3SUUA 1ZJBA 3POCA 5KZ6A 4W5ZA 2GJPA 4WIWA 1E1EA 2XHYA 3ZMRA 4W87A 1WNOA 2WHJA 1GOOA 4ZE4A 4U33A 1R85A 3K4DA 1PX3A 1GZJA 1HVQA 3WMBA 1LWJA 4B3KA 3F4VA 1AVAA 2YA1A 1QNOA 4OJYA 1GQJA 2DIJA 3G6MA 5LYRA 2PBGA 4KMQA 1JXJA 3ARYA 4LPCA 2BFGA 2CITA 1FP8A 1CGYA 3FHAA 1J9YA 2DIEA 2E4TA 3AIVA 4MJ2A 2WLZA 1XYFA 1E6PA 2CXGA 4PTXA 2XTKA 4TXEA 1ZBKA 2XFFA 4CU6A 5BROA 4J3TA 1NWRA 4E2OA 1M04A 2X09A 1EHNA 3W29A 1UR2A 1RPKA 5AYIA 5EBAA 2EQDA 3VIJA 1WO2A 3CZEA 3A4WA 1KR1A 1VJSA 1OINA 1GOIA 3FY1A 4R27A 3KZSA 1IT0A 3DECA 1DWIM 1XH2A 3T0AA 3WBEA 1O6IA 3PZMA 4PMYA 1E43A 4PMZA 1V3LA 2O9OA 3AMKA 3UERA 3I3BA 1HL8A 2BHUA 3PBGA 4CCDA 4YN5A 3AROA 1E70M 1UWUA 4UFIA 2WK2A 2C0HA 3CMJA 2V5DA 1QHOA 3CZLA 4D72A 2EPNA 4UTFA 3RO8A 4M56A 3SUSA 5D9NA 1W91A 3PZTA 3AHXA 3WF2A 2WMHA 3O9NA 5DT7A 5D9MA 2FHCA 1ISXA 4TTGA 1XSKA 2X8RA 2G41A 5M17A 3VD9A 1KXTA 5A2BA 1UA7A 5CLWA 5IFPA 3ZSSA 1BFNA 3MUZ1 4D6DA 1E55A 1WKYA 1BLIA 1J11A 1RH9A 1CGTA 4AZ5A 2CNCA 1JF6A 4IPNB 4JKLA 1TVPA 1H11A 3VD3A 4Z2LA 1W3KA 1C90A 4WK9A 1JFXA 4HA1A 4FLQA 1OBAA 1J0HA 4MADA 2XVPA 4AWEA 3CUHA 2YA2A 1JD9A 2AOSA 4ACZB 3SCSA 1W32A 1TUXA 1UKTA 2JF6A 4C7DA 4D6HA 4TVUA 1CXLA 1E40A 4GI8A 1M03A 1W9PA 2DSUA 1AMYA 3ZJKA 3WH6A 5TD4A 3FXYA 2XVNA 2YDSA 5GNYA 3WUFA 5HNNA 4P7LA 4AD4A 2WMGA 3VU2A 2F2HA 5M5DA 3EDDA 4JFWA 3CLWA 1HKJA 4AD1A 4M8UA 2Y24A 1MQQA 3AIRA 1UKQA 3U7VA 3POHA 1JYVA 5DT5A 3QOMA 1KR0A 2YDQA 4P8VA 2EEXA 4GKLA 3CTTA 4CU8A 4BQ3A 1PBGA 1R86A 1IZJA 1E0XA 3EMQA 1FP9A 5F7UA 3MMUA 4BCEA 2IUZA 4CCCA 4BQ2A 1QOXA 3ECQA 1JI2A 2J78A 4X0NA 2WZEA 3ZJ7A 2GJRA 4P8XA 1AQMA 2Y2WA 3VDCA 3GZAA 4PN2A 2DEPA 2VRJA 4H8UA 3OLDA 2JIEA 1UA3A 1BGAA 2ZXQA 1EXPA 3LPPA 3QHNA 2GK1B 2YKKA 5A8PA 1V08A 1VJZA 3IANA 3CO4A 4BF7A 3VNYA 5I78A 4CCEA 1UQYA 1RP8A 3OLEA 4CUCA 2J62A 2IXUA 1B9ZA 3DYPA 2YA0A 4LXFA 1GQLA 1UHVA 4P8WA 4KGJA 1CWYA 1ZB5A 2WBGA 3ZJ8A 4DUWA 5DEZA 4PTMA 4AD5A 2DT1A 2EBNA 3M07A 2WHMA 1B3XA 1W9VA 2F61A 1M7XA 1S46A 1XCXA 3NYDA 4DWSC 1CXFA 4N42A 2CERA 4NI3A 3ARTA 3K46A 5A3HA 1QI0A 4XX6A 4GI6A 4BZYA 5BYWA 2YDRA 1GVYA 4W7VA 2WWDA 1VAHA 2YL6A 4JCLA 2ESCA 3BAYA 4MJ4A 3MV11 3ARXA 4TX8A 1GW1A 1K9EA 4GIAA 3MUAA 5BRQA 4ATWA 4JIEA 2YLAA 4FK9A 2EPOA 3PTMA 1JI1A 4RL3A 2Z1KA 2J7DA 1JNEA 1BG4A 2WB5A 2DH3A 2V38A 5DF0A 1LLOA 1BPLB 4XB3A 1RP9A 3CUGA 1DWAM 4CD6A 3WUEA 4JFVA 4AZBA 5HXMA 3KWXA 4J3SA 4UFLA 4CD7A 1QI3A 5A8MA 2ZXDA 4LYPA 1TA3B 3K8KA 4URIA 4JHZA 3W28A 4AMCA 3VDAA 2G4FA 3KEHA 2W66A 3VGBA 1PIGA 1E72M 1NWTA 2BY2A 4PMVA 2WANA 4H2CA 4DWSA 1KGXA 3GBDA 1VFMA 4MTVA 1E3XA 3AICA 4J27A 3THDA 1QNPA 4H8VA 1OT2A 3RPMA 3MSGA 3NDYA 2F8QA 1H5VA 3CZKA 4AY1A 1R7OA 1UKPA 2D2OA 5ECUA 4HU8A 1OCQA 1BTCA 1BQCA 2PWFA 1HKIA 1J0IA 1W9DM 3WNNA 1WZMA 1I1XA 2VQUA 1ISZA 4PCTA 1JGIA 1U30A 1MXGA 5AY7A 3CHEA 2Y5EA 3CHDA 3RILA 4UQ9A 1U33A 1E4NA 1K9FA 3ZT5A 5BCAA 3M7SA 2VNCA 5E9AA 1W1PA 4OBSA 4QFUA 2CKRA 5A6KA 3PN8A 4HMEA 1CBGA 4NSBA 4QAWA 2VR5A 1Q4NX 1V6YA 4FLOA 1GVIA 5I23A 3BH4A 1N82A 3OGSA 3AS0A 2J7GA 1BG9A 1GOKA 3WF0A 1F4HA 5LA0A 3VD5A 4HPGA 3NIYA 1V6WA 2RGLA 2CEQA 2V3DA 4AIEA 2PF0A 1XYZA 1XSIA 4L4OA 1HJSA 4B16A 5HOSA 2WCSA 3PTKA 4ZEPA 3WQ6A 1DEDA 3N13A 2VCCA 3VTRA 5CGMA 1IV8A 1FFQA 2WSPA 7TAAA 3BGAA 4ZXLA 4WKHA 1SMAA 3CIVA 3WEZA 4AISA 3W27A 4MDOA 1OM0A 3IJ7A 4NRSA 3DHUA 5JBFA 3NJ3A 4M29A 3UR8A 5IHRA 1CTNA 4H41A 3B8SA 3AS3A 1ZU8A 3AXHA 1CEOA 1BYDA 4WKAA 2E9BA 1NARA 1V3MA 1LG1A 1HN1A 3WKZA 3CHCA 3SCNA 3OGVA 1LF1A 4AD2A 3ZO9A 4OOZA 4F66A 4KWUA 2O9RA 1HT6A 1QHPA 3FAWA 2FDMA 1CLVA 1J12A 3WD0A 3RJXA 1B0IA 3DHPA 3UG3A 2NT0A 3EDEA 2WC7A 3VIHA 3VDHA 1JAEA 4B9YA 2WMKA 1V0NA 1DP0A 3RM9A 1GORA 4D6EA 3WMSA 2DSZA 3W24A 4OUEA 2YJQA 1CXIA 1KWKA 1U2YA 4F8XA 4XZBA 3A47A 5CQ1A 3OLIA 4PSRA 5JUVA 3GNRA 4UFHA 4UFJA 1J10A 1Q6DA 2PC8A 1CPUA 4JL1A 4EANA 3VIOA 3CH9A 7CGTA 2X1IA 2YBUA 3WD3A 2XVGA 2OWWA 1GJUA 3ZIZA 2PWDA 1EH9A 1GHSA 2X0HA 3G6LA 2BS9A 3VMOA 1EOMA 3GXMA 3SCQA 2OYLA 2DPEA 1BVNP 2BNJA 2BVYA 2J47A 4QLJA 2G8ZA 1FA2A 1E15A 4EE9A 2QMJA 4YPJA 2Y4SA 3VINA 1CGXA 1D2KA 1GCYA 4MB1A 1ZJAA 5I0DA 1B31A 3TTSA 2J8FA 3UESA 1KQZA 4KH2A 9CGTA 1OSEA 2CHNA 4CVUA 3WL0A 3WUBA 1CIUA 2ZUNA 2ZX6A 1Q6CA 3LMYA 3IJ8A 4D6IA 1ITXA 1B3VA 3VOCA 3OZPA 2D0GA 2J7CA 4Z2HA 1CXKA 1UR9A 3GNPA 4HMDA 1OT1A 2XWDA 2VOTA 1QHZA 3PZ9A 3L4UA 1FHLA 4E8CA 3RM4A 4ATDA 4OKDA 2O92A 1H0GA 3WF3A 5C70A 4N0RA 4A3HA 3CUJA 3BSHA 4MNMA 3WL1A 2VUYA 4NZCA 1B2YA 3AIWA 3JUGA 4JFSA 1K9TA 4W86A 2HISA 1H2JA 3ZT7A 5AC4A 3I3EA 5CLTA 1CGWA 1TA3A 2OYMA 5A6AA 1RD6A 3WNOA 5FKYA 3L4ZA 4PMQA 4AZCA 3FW6A 1HJWA 1UKOA 4KRUA 3ARVA 1HL9A 4LGXA 4AW7A 3LPGA 2WCAA 4OZOA 1J0ZA 2E8YA 1QBAA 1UD3A 3W25A 3W4RA 2B31A 1E71M 1GOQA 4J28A 4P7OA 1B90A 3MMWA 1ZBWA 5A8OA 2WHLA 2GJXA 1M01A 4FMVA 1C91A 1TR1A 2NW0A 4BS0A 3L4VA 1W1YA 2PI6A 4W8BA 1L0PA 4AXNA 5C71A 1ECEA 6CGTA 1E56A 3BAXA 1KWGA 2XGBA 2ZX9A 2WC4A 2Y8KA 4RE4A 3N04A 1UOKA 2VL4A 3RJYA 1US2A 1VRXA 1H09A 1ISWA 2QLYA 3GXIA 3OG2A 1JDAA 2CPUA 3BAKA 3AFBA 1HNYA 3HN3A 3WUGA 2XG9A 5ABFA 1DWFM 3SCRA 3VIPA 4BQ5A 1MFUA 2W61A 1GHRA 4DWSB 3U5YA 1OD8A 1XV8A 2ZUWA 4HTYA 3WFLA 4GO8A 2ZWYA 3W26A 3ZM8A 1MW1A 2AMGA 1VEPA 2D0FA 3ARUA 4PUEA 4EK7A 4TTUA 1Z32X 1YQ2A 3MMDA 3MS8A 3B9DA 3UR7A 1E9LA 1GOWA 5EB8A 4AZ6A 4MB3A 1EQCA 4XZWA 4DUVA 4AZ7A 1HKKA 1PZ2A 1A3HA 4UR9A 2DQXA 2EPLX 5D8ZA 1P6WA 3CMGA 2D3LA 5CZKA 1TFVA 3WQWA 2WAGA 4WF7A 1EHAA 1GQIA 1TE1A 5BXTA 5I5RA 3L4XA 4F9DA 3F5JA 5E09A 1G0CA 3OB8A 4MB5A 1CNVA 2WXDM 3WY1A 3UG5A 1HP4A 1K6AA 2ZUSA 4WJXA 1XGZA 4PTWA 4D6CA 2W67A 4J3WA 1XRVA 3KL3A 1DWGM 3BCDA 4HOXA 4QDMA 3ARRA 1HJXA 2UY4A 2VJXA 4HZ6A 3E1F1 1NP2A 2XGIA 1E4LA 5FL0A 2IXVA 3AYRA 1JZ7A 1XH1A 1W2PA 1J0JA 1X1NA 4QP0A 5KEZA 1LL4A 1DWJM 5GPRA 1OWQA 3T0BA 4B3LA 5LA1A 1FOBA 1OGBA 1J18A 4XV0A 8A3HA 3OZOA 2YOCA 4LQ1A 1FH8A 1X6NA 1PEZA 3K8MA 3VPLA 3WEMA 3AQUA 1C7TA 3VX1A 3T09A 4W89A 4YHGA 3AXXA 3VGGA 2WLYA 3W53A 1F4AA 3GXDA 1XD0A 2PWEA 2VX6A 3WNPA 1NWUA 3W37A 3OLGA 4WSJA 3K4AA 1VFFA 3AMGA 1PX8A 2VT0A 3WMCA 2ZE0A 4GQRA 2VCAA 3AHZA 3SUWA 4PTVA 4GINA 2ZUTA 3EMZA 3II1A 4EKJA 4PCSA 2E0PA 1BYAA 3WDRA 3WNLA 2BY3A 1CGVA 4GPNA 4AEEA 1ISYA 4PMDA 2JFEX 3AIEA 4UQEA 1NOUA 2X05A 4QLKA 1VFOA 4HA4A 4PSPA 1WZLA 4S3JA 1XH0A 2VTFA 3O2LA 1JYNA 2VO5A 2VX5A 2WM0A 3AMDA 4J7RA 4D1IA 1FH9A 5AYBA 3ALFA 2Y8VA 3VIFA 5A69A 2ZOXA 4UFMA 3OGRA 4GI9A 2DT0A 3WQVA 4YHEA 1VFUA 2VC9A 3N15A 3VDBA 1KXQA 4AIUA 4Z2JA 2PWGA 4MNKA
chains in the Genus database with same CATH superfamily
3WH9A 5ABEA 1VBRA 4Y9AA 2ON3A 2OLHA 4AY7A 2A7PA 2CZDA 2WMIB 1BWKA 3O6AA 3U2ZA 1XRFA 3E0WA 2O9PA 4UFKA 4S3CA 5DRIA 2DVXA 2WZIA 1BF2A 2FPVA 2ONEA 2C1IA 2ZIDA 4MFDA 2VZVA 2OZTA 4Q4QA 4G56A 2XJ7A 4UZSA 5DRCA 2VXNA 2FJUB 3HJEA 3VOIA 1QW9A 3DH7A 4X0VA 1W3NA 4GZIA 4M3PA 1M53A 2BY1A 2GVGA 5D9OA 4FI4A 2OSYA 1PDYA 4LX4A 3SFKA 3LSCA 3W7JA 4ZE5A 4S3KA 5K4XA 1PS9A 3PBUA 4EPDC 2P10A 4JKKA 5BOFA 1Z69A 4MLJA 4JX5A 1C92A 4PTNA 3KVKA 4JDBA 3VMNA 1FWCC 2WNWA 4NAEB 4YWIA 2F6KA 3N4AA 4OE7A 1WZKA 2GJXB 3PBVA 1UZ4A 2BVTA 2BOGX 1HIZA 4JQ4A 3RIKA 5BZAA 3H8AA 4FXRA 3W2MA 3F7JA 1R2SA 2YGYA 2BGNE 3WH5A 5EGRA 3BV4A 5CBIA 2ZA2A 1GVSA 3BURA 3ARSA 3QY6A 4C6JA 4DWSD 3BDKA 3SCUA 2OKOA 1VH7A 3FKRA 5T9CE 3UJSA 1XSJA 5ABFB 3OP2A 1PYFA 3FXGA 3M5XA 3T42A 3APTA 3LTSA 3AS2A 4U5IA 1CENA 5TQLA 5JBDA 3KRUA 2JEPA 1JD7A 3SSJA 2QUNA 3HPZA 3GR7A 2WKLA 4W5UA 4KCVA 2UV8G 4W4QA 4LBSA 2ZTKA 2PDKA 3NQAA 1QBBA 1W8GA 2QJIA 3G18A 5IDIA 3LBMA 3FLUA 5IM51 4ZB0A 3DENA 4OHQA 3GHUA 5J04A 3IS4A 1AFSA 1HX0A 2PCEA 3VCRA 1BTMA 3BW3A 2JK2A 1UP2A 2ZICA 1E4MM 3WNMA 5AN7A 1A47A 2UY2A 4AF0A 4TVDA 4B2DA 3LS9A 5E0CA 1E1CA 2CXEA 5REQB 1EX5A 3ZT6A 4I5UA 3KBMA 3AMLA 1IWPA 3H70A 3NVTA 2PGFA 3N2OA 3T81A 1AJ2A 3AIUA 3EKZA 4IGSA 3H6OA 1UR4A 2GGHA 2DT2A 3KUMA 3N18A 3C0LA 1XDLA 2OLSA 1IHIA 5I24A 1SO5A 2GDUA 1KFWA 1FWWA 2ZKMX 2DGAA 2WNNA 2OQLA 2R1MA 3W2NA 1AA1B 1VEOA 2V9DA 1GZGA 2X0SA 1O7AA 1X7FA 3OBAA 1H49A 4TMCA 4Z42C 1A5KC 2C91A 3CHVA 4LNYA 1V03A 5DY3A 4C5ZA 2HRWA 4Y9MA 3TJ4A 3EEGA 3LGEA 5D8WA 4FIRA 2G3MA 4WY0B 3WDIA 3E9AA 3FJLA 4BQ4A 3S1UA 3ISIX 2GVYA 3ITOA 2MANA 3WG6A 4M81A 2INEA 4H19A 4CU7A 3REQA 2YBTA 4LBUA 8CGTA 1ZP3A 3IJ9A 2C14A 5JMUA 4JTJA 4IMEA 3S5ZA 5L9FA 1UYQA 4A8RA 4P5UA 1E1FA 1UG6A 2G3NA 2H9AB 1XYAA 2GUUA 3MP3A 1CW2A 4GCXA 4M7TA 5TF0A 4P7NA 4OV4A 4ORIA 1A5SA 4NZ1A 4C1NB 1ZENA 1ODUA 2Z4GA 3TTOA 3EDJA 3WELA 2J27A 3WH7A 3V36A 1XJBA 1G1YA 3GD6A 3QPYA 4K1GA 1D3GA 4YCPA 2WJZA 2P76A 1Y5XA 3TXVA 3WZ0E 4K8EA 5HDRA 3QHOA 1JXKA 5BNKA 3B40A 4XBJA 1YPIA 1ZJIA 5AOUA 4Q8MA 2C71A 3TROA 4GD0A 1ZL1A 2IKIA 1X6LA 4C6QA 3P14A 3DC0A 4EIVA 3EWYA 4MYAA 5BWFA 1F3WA 2Q01A 3NPWA 2J8GA 2PWHA 3CH0A 2JF7A 4C6FA 4LAUA 2V82A 4Q4PA 4I3GA 4A2SA 3SADA 5A6BA 2PDYA 4PE8A 5E1QA 4N7QA 3L4YA 1V3KA 2ZX7A 3D6NA 3QSRA 4YJ5A 4L7ZA 1QW7A 1C93A 3VMPA 4G8TA 4DIAA 4OT7A 2YBVA 3WQFA 3SUVA 1LL6A 2PDIA 4PMOA 3Q67A 3UNDA 3NSMA 3ALGA 3ATZA 3GDBA 1YXDA 1IIGA 1WUEA 1WDPA 2SFPA 3KE0A 4LS2A 4X3ZA 2Q02A 2FZ9A 7PTDA 3KLLA 4QE1A 3UW6A 3UZZA 2OOGA 4MF4A 1GUVA 2W3ZA 3G1YA 3V1PA 1GYMA 4C6OA 3NYZA 4GWEA 1Q4WA 3P5YA 5DCDA 5EU9A 3LOTA 4QITA 2FVKA 5D02A 1OC5A 3STEA 3M0VA 5C7VA 1RVKA 3P93A 3WF1A 1FFRA 4XBKA 5CBJA 4AIOA 2W62A 5C0QA 1UD5A 2WCGA 1QNRA 3A3XA 3Q58A 3UZYA 4Y9NA 4BI5A 1OCNA 3AU2A 4NZ4A 4P2VA 1Q13A 4Z1YA 4O0ZA 3RYSA 3EWBX 3HPFA 2V3GA 2XSXA 2FQIA 2GPTA 5FAGA 4NL1A 2Z0IA 3CHFA 3LHTA 2E6AA 2NXIA 3I4EA 4DXXA 2QVNA 4HB7A 4UMCA 1UBPC 3SIZA 3U8GA 1JZ4A 1MW2A 6A3HA 7ODCA 1OX4B 1E73M 4I90A 4U3AA 3RR4A 1POJA 2DW6A 2X0YA 2EPHA 2IPGA 4Z2IA 1YADA 1KGWA 2OR2A 1KKRA 3DESA 2QDDA 4RXGA 2DZPA 2ZRVA 4HKPA 1UIOA 4KEUA 1T99A 3LSBA 2XFYA 4PC8A 4PCFA 1OEPA 4DBWA 2BMBA 3CUXA 3HPSA 4LTSA 3F5LA 1FHDA 1VENA 1XCFA 1GVFA 1JNDA 4J3ZA 3OQ8A 1J6PA 1X39A 4U2ZA 3ARZA 2WBKA 4QLLA 2CBUA 5FF7A 1E6RA 1DTNA 4FNRA 4PMJA 3PVFA 2F38A 3HV9A 4QJ3B 1C3FA 5JIPA 4E4PA 3G24A 3C2VA 4PRRA 2A6LA 4ZXOA 1GOMA 4GHRA 4BHYA 2ALRA 4RDVA 1UH3A 5T91A 3URQA 3KTCA 2QF8A 1Q2SA 3OOQA 3CASA 1PJ9A 1KGUA 1F3XA 2FHBA 2Y7GA 3BJTA 2OZ8A 1TV7A 3BAWA 1NP0A 3FS2A 4HA3A 4I9JA 5E70A 1E0VA 4X9SA 2VUNA 2VYOA 2VVNA 4HN4A 1TMQA 2FGZA 1DOSA 4F2BA 3QMTA 4MZ1A 4NU7A 2YL5A 3FA5A 5CPSA 2FGLA 7ENLA 1HGWA 4IG2B 3LRMA 1XUZA 2V5BA 2XIQA 1T40A 3W23A 3RRAA 1FHVA 3P60A 1BXCA 1ISVA 2XUCA 4IMAA 4CNNA 3DYMA 1E6NA 2QJJA 3MANA 2QUMA 2WMJA 1JCXA 2XPKA 3CNYA 4MKSA 3ZQ9A 4IFRA 3A64A 1TIWA 3VE7A 2ZFAA 1Z8AA 1LQ0A 1H0IA 4B5SA 3M7WA 3LV6A 3WDJA 3CL8A 1H3GA 1OYBA 2I5QA 1V93A 4LUJA 3LM3A 1QNQA 1MFVA 3DFPA 1TJ1A 4JEJA 4DJDD 2NLIA 4RE2A 1PIIA 1QW8A 1HL2A 3URAA 4XUGA 2FB2A 4A29A 4UCGA 1PX4A 1L8NA 3VKAA 4GH3A 3BOFA 3EX4A 4P8UA 2R6OA 3PZQA 1OIMA 2QUTA 3VNDA 3INPA 3S9YA 4PCNA 1UKSA 3VGEA 2V2CA 1HO1A 1IXNA 4Y90A 4WZHA 3SUTA 5LXXA 2YCEA 5I03A 4WUIA 1JZ8A 3KDNA 2VZOA 2ZDSA 1X38A 2J7BA 3W2LA 1IEXA 3IACA 5C9ZA 3APGA 1TRDA 1UASA 3U2CA 3BMWA 5CJNA 3OA5A 4GZEA 4CNOA 3NQ8A 5FEPA 4I5RA 4IUGA 2XDFA 2A3AA 4LUTA 1QI2A 3LGDA 4CQ9A 3OTRA 1B9BA 1SZNA 2VC5A 1YXCA 3NQ6A 1JCYA 3W7NA 3ZSTA 2EG8A 4R33A 2HMCA 2WKGA 4WDTA 2NXHA 1QAPA 1RV8A 3HOJA 3ITTA 1KB3A 2HE5A 5CGQA 5HPOA 1CDGA 1LZOA 1OFQA 5AB3A 2D23A 2J7FA 4PZVA 5CPQA 1JPMA 1UR0A 2VX4A 2YLLA 4MG4A 3UA4A 1R47A 4KCTA 1IEWA 1RAKA 1BKSA 1VD6A 4ECLA 3VIKA 1B1YA 5I77A 2V69A 1SO3A 4UZUA 1PWLA 4Q4RA 2ODOA 1WXYA 3MKVA 5E6ZA 4Q6JA 4Q22A 2PLJA 2R94A 1WZAA 8TIMA 1KW1A 3GH5A 1R7AA 5G2WA 2X7WA 3KZPA 3VZXA 4NQ1A 4QRNA 5C5YA 1CXHA 3UCQA 1E6ZA 1QRQA 4P7RA 1EJVC 3F4WA 1BRLB 2GK1A 2NSOA 2Z7KA 3SECA 2RKXA 4FXJA 3M46A 1KRCC 4HHLA 7A3HA 5CJ5A 3KLKA 2OSWA 5GJNA 1QNSA 3K4WA 3TYDA 2A6NA 1VBGA 3PUGA 2GSJA 1ESWA 1AD1A 1M5WA 4UTUA 2DIKA 1GEQA 4RDYA 4LH8A 2VEGA 1A50A 4GQQA 4H9ZA 4B5NA 4H7ZA 3NZ1A 5D09A 2V6AA 3J7HA 1H63A 3JVAA 4L64A 1LL7A 4F2UA 4S2CA 1E5JA 4ERIA 3DU0A 1W1A1 3VABA 3PK7A 2XM2A 2GJLA 4L9YA 1X1ZA 3CIXA 4EVZA 4KT2A 4WIWA 2XHYA 4RX0A 3TYZA 3IPWA 2PAJA 1WNOA 4O14A 4JGDA 1A53A 3LTYA 4A05A 1XPYA 2X7VA 3FOKA 3K4DA 5I3GA 1LWJA 5A6TC 1FWNA 1K77A 3B3DA 2A0NA 3IGXA 1GQJA 2V8ZA 4ML9A 4L6OA 3IEBA 1XLDA 2CITA 1CGYA 3PSVA 3IGHX 5G5IA 1J9YA 4MJ2A 3FYOA 2WLZA 3S9IA 3W83A 3VOGA 1D7KA 3NXFA 3ES7A 4LANA 4Z1DA 4XD5A 1PDZA 3TR2A 2TMDA 3VIJA 4IIEA 4F2TA 2F7FA 3NEHA 3QPEA 1XFCA 1N8FA 5F2IA 1W8SA 4KETA 3MZ2A 2FDSA 1GYLA 3T0AA 4XD6A 2JGQA 4WJ8A 1LRNA 4FR1A 3W7DA 3L23A 3MY9A 1TV3A 1E43A 2CWNA 4UNLA 3QVQA 1HTIA 1DE5A 2V63A 2BHUA 4L65A 4NAFA 4YN5A 1EYEA 2TYSA 1UOZA 3CMJA 3M5VA 1MEWA 3UR5A 1F6PA 1L6YA 2EPNA 2QAPA 5D9NA 4B90A 3DGRA 4TO8A 1RCXB 2WMHA 5D9MA 2PRHA 1UBSA 1XSKA 5M17A 3VD9A 2GVEA 3QYSA 1XBVA 1E9YB 4NYYA 3HG2A 1IGSA 2BSLA 3MUZ1 3FJ6A 4D6DA 4NY2A 1WKYA 3KBNA 3GUWA 3GTXA 3S1VA 4JTQA 1CGTA 3DHFA 3U9IA 4GVGA 5DCEA 3V18A 1H11A 3S6DA 4FNQA 1XIIA 3GVQA 3JRKA 4IFKB 3RLVA 1X98A 3TC3A 1QU4A 3W85A 1C90A 3GQYA 3UWVA 1LROA 2YYUA 4MADA 1W5QA 2QCFA 1RSCA 4AWEA 3PJUA 3R4IA 4S3FA 1XIEA 1DL3A 3M47A 1MUMA 4ACZB 4IH3A 4S3BA 4C7DA 3NNTA 1M03A 4KWVA 3UGVA 1O94A 3OPSA 3FXYA 1K8ZA 5GNYA 3WUFA 3R7MA 1MRQA 1VYRA 3C0QA 1LRQA 1VFTA 1MQQA 1MSSA 5C9RA 4E38A 4JYEA 3FGCA 2REQB 2TPSA 5DT5A 1S2UA 4EAYA 3E2RA 2A1YA 2W6RA 1Y5VA 4N6EA 3N73A 1PBGA 3URBA 1R86A 5TBOA 1LT7A 3C2YA 1E0XA 1YPXA 3CB3A 4HYWA 1F05A 3MMUA 4CCCA 3ECQA 4ZOEA 2AGKA 2Y2WA 1TV5A 1Q7MA 3GZAA 4QDPA 2VRJA 3GUGA 4GQBA 1UA3A 1AODA 4MWAB 4K37A 2ZXQA 4DEFA 5A8PA 4POCA 5EMLA 2CLEA 4O4VA 1F5ZA 1RP8A 3BG5A 2J62A 3GZ3A 5AZ0A 3KOXA 4Q8TA 3UPWA 1EF3A 4GCAA 1GQLA 4KGJA 1ZB5A 2WBGA 3DUGA 5DEZA 4Q8NA 5C7HA 2EBNA 3M07A 2HCVA 3DERA 3MJMA 2FMOA 4LU0A 3WLOA 2X40A 3KM8A 3K46A 2NX9A 4QEHA 3MJYA 3G22A 2WZMA 4BZYA 5BYWA 4DRSA 2PDUA 2UBPC 2W79A 2YL6A 4JCLA 4UMAA 4Q4MA 1AW2A 3AXKA 1GW1A 1K9EA 3P7YA 1Q45A 3M0ZA 3NO5A 1S5NA 4GIAA 4A35A 3H21A 3T44A 4KEMA 4G7EA 2D2HA 2I9UA 3IGSA 3BLLA 2NXGA 3PTMA 4Q4KA 2Z1KA 3IJQA 4N9DA 1V7AA 2DH3A 1XPGA 1LLOA 2EGZA 4XB3A 2PDCA 2J8TA 2Y5SA 5F4WA 2F2KA 4OBTA 4XO6A 1POKA 3W7LA 4J3SA 1TPB1 1QI3A 1Z3NA 3B8VA 3EAUA 1NQKA 3W28A 4S3EA 3VKCA 3VDAA 1PO9A 3VGBA 1PIGA 2Z1VA 1HG3A 1NWTA 5G1YA 4H2CA 4KPLA 3UPMA 1W5NA 1E3XA 4Z17A 4NUWA 3N9SA 3NGFA 4AEOA 4IQEA 3KVLA 3TNOA 3RPMA 1TV4A 1XLLA 1H5VA 4REQA 3AYTA 2D2OA 1OCQA 2FZBA 4EXBA 5DANA 4HSOA 3PPHA 1J0IA 1ZSXA 1QFEA 1WZMA 2VQUA 4PCTA 4NXKA 3RMJA 4JR5A 4FZIA 3U0HA 1JGIA 2W0UA 1EC9A 5EMJA 4GKTA 2R1PA 4UQ9A 5FEWA 5G2IA 3N2CA 3UY7A 3PBWA 5BCAA 3QTPA 5F4XA 1Q63A 5DY2A 1W1PA 1AW1A 2CKRA 1NF7A 2W27A 4NSBA 3SRHA 4FLOA 3HM7A 2DJLA 3CQJA 3P62A 3BH4A 3AS0A 4I9AA 3WF0A 2I7GA 1IQ8A 2I16A 5HUOA 1IXQA 2Z27A 5A8GA 5HJYA 4ICNA 1V6WA 4WX2A 2PF0A 1J4EA 2XZ9A 5LNVA 5D05A 3OHMB 1TX0A 2E09A 3LZ3A 1FCQA 2HK0A 3GTFA 4R34A 3SGGA 7TAAA 2BZNA 3BGAA 1K3UA 3B0VC 3CIVA 5CC7A 3HV8A 4AISA 3GHTA 4GK8A 3W27A 4US5A 1ZAJA 3DHUA 2PA6A 1HZYA 3SM0A 4IHCA 8RUCA 1QO5A 2BGQA 4CEUC 3B8SA 2HK1A 1VS1A 4WKAA 1V3MA 3TZNA 4EPBC 1KCZA 3WQDA 1TPUA 1WXZA 3OGVA 4HHPA 1DJHA 2NVDA 3MHGA 3ZO9A 3B9OA 1XQKA 3QKZA 3A5VA 1QHPA 3FAWA 2AMXA 1Y65A 2FDMA 3CWHA 4H9YA 1J12A 2VC6A 1B0IA 4O1FA 3DHPA 3HJZA 3T55A 3VDHA 1JAEA 1EZ2A 3W22A 2VHLA 3N14A 3W24A 3KXQA 4JIIX 3FYYA 1IZCA 4CNTA 3A47A 2I17A 3OLIA 4PSRA 3HZ3A 5JUVA 2Z25A 3BO9A 2QGHA 1WKDA 4UFHA 3DN5A 2PC8A 2TRSA 3CH9A 7CGTA 3WD3A 2B7QA 3D46A 3OODA 2FPTA 2OWWA 1GJUA 1FWRA 3GNNA 4FO4A 4N02A 1QATA 4KEZA 2X0HA 2BS9A 4GC4A 3N6HA 3WQEA 4QLJA 5FSEC 3T0TA 4I7WA 2VFIA 4EE9A 4F4RA 5CPLA 4XK2A 3S5YA 1ICQA 1ENUA 5C2GA 4AHPA 3KBVA 5I0DA 2BLEA 1B31A 3W1MA 3TTSA 2J8FA 3WK0A 3EB2A 4KH2A 2CHNA 4CVUA 2GSEA 2ZRUA 3WUBA 1CIUA 4AXKA 3LMYA 2J9YA 2PU1A 4D6IA 3G1DA 1BWVA 9XIMA 3OVGA 5DXXA 3GXNA 3OZPA 2D0GA 4FNSA 1CXKA 1UR9A 4KBXA 1ZUAX 3OW1A 2A5HA 1FHLA 4RPQA 1DIOA 4HBKA 1H0GA 4FNUA 3FA4A 4LYKA 4N0RA 3BSHA 4MNMA 4NZCA 1B2YA 3ES8A 3N25A 1IR2A 3O8AA 2Z24A 3NOYA 5CLTA 5CZ0A 1MEHA 3M0IA 3WNOA 4KRUA 1K02A 2PDMA 3ARVA 4GLEA 1HL9A 2E1WA 3EX2A 5DQPA 2WCAA 2X2GA 3G2GA 3HPXA 3W25A 2IKHA 4NAEA 2J13A 2E7FA 1O5QA 3LHVA 3W72A 4DPPA 1B90A 2GJXA 4FMVA 4IT1A 4QM1A 2NW0A 2OLAA 4BS0A 4YU1A 3DBNA 3ZLHA 4FF7A 4W8BA 4UMBA 1U1JA 2YW3A 1ECEA 3R1ZA 1AUSL 2PUZA 1HQTA 1E56A 3BAXA 4DO7A 1KWGA 1B54A 4NVTA 2WC4A 5I07A 3N04A 1UOKA 2VL4A 5E93A 1JDEA 2ISDA 2XN0A 1H09A 3OG2A 3W00A 2CPUA 3BAKA 1HNYA 5ABFA 1DWFM 4BQ5A 2NQHA 1VJIA 4DF1A 4XD4A 3WLHA 2ZUWA 2VDGA 2CFFA 1SM9A 4O15A 1SSGA 4PUEA 3AWOA 4EK7A 4TTUA 1YQ2A 4AG0A 1UP0A 3WLKX 4O52A 3N34A 3BG9A 1VFLA 4RZ4A 3UGRA 2HQAA 3QC0A 4MB3A 1O68A 1EQCA 2PFHA 3H24A 1KRAC 5I3FA 3QQWA 2VKZG 2E1DA 1A3HA 4UR9A 5KTLA 3KCOA 3CMGA 2D3LA 5CZKA 4E3TA 4NX5A 1TFVA 4QG9A 3PY2A 1EHAA 1GQIA 1TE1A 2VFFA 1LDCA 3HQPA 1AL8A 3PFRA 2WXDM 2G95A 4HN8A 4LY8A 4ZL1A 4L5ZA 5REQA 1LYXA 4UTHA 3H23A 1ME9A 3ABZA 3KL3A 3Q94A 1DWGM 3BCDA 5BRBA 3RN6A 3RITA 3TYUA 3ARRA 1JQXA 3E1F1 5H8PA 3QLLA 1E4LA 5FL0A 2Y62A 3VKBA 3DFSA 3PWAA 1M3UA 1W2PA 1T8XA 2QT3A 3UXAA 1X1NA 4AWSA 4EOUA 5HQEA 3QJAA 4OQVA 4FS9A 4QNWA 3WJWA 1DWJM 4K7VA 4B3LA 4AF0B 1FOBA 4LVGA 2PMQA 2YOCA 2IQDA 2NV1A 3WX7A 4F40A 2FTWA 4ZOAA 3VX1A 1C7TA 1XIMA 1QT1A 2A85A 4E2VA 1HUVA 4N4QA 3GXDA 1JCNA 3QRHA 2F84A 4JTIA 4C6BA 2Z1XA 5LIYX 1VFFA 4OGZA 1PKLA 2ZE0A 2IMRA 4I8YA 2V2DA 3WDRA 1KV5A 2BY3A 4GOAA 4I6VA 4PBEA 5XIAA 1XBXA 1EYWA 1NOUA 4NJIA 2X05A 1L6WA 5DLCA 3E3HA 1RA5A 5JVLA 1ZHAA 1GVEA 4RW3A 4JIHA 3WLIA 3WBXA 4O8RA 1XYLA 2H9AA 1Y0EA 4ZOCA 3ANYA 4E8GA 3ALFA 3VIFA 4RNJA 2ZOXA 4XTIA 3UJFA 4GI9A 2DT0A 1A5LC 2V0TA 4C1NA 3AYVA 5HJLA 2CZEA 3DFQA 3EX6A 4MNKA 3AHTA 1BSLA 1R3WA 2DV0A 5HAOA 1D3CA 4LEQA 4EPEC 4YMZA 4K68A 1O12A 1U83A 3S6TA 5LA2A 1XC6A 5LIKX 3SQMA 2NV2A 5RUBA 1TTJA 2VRQA 5GNZA 3IV8A 4UTIA 5AECA 2O7QA 3VOHA 5JIWA 3K1GA 4O28A 2VRKA 3KHJA 2E9LA 3MVTA 3WDQA 3UFYA 1JRCA 3RLGA 4NHVA 3QY8A 4H04A 3UJRA 2JEQA 4V1XA 2OX1A 4M80A 1M65A 1A5AA 1XKYA 3MHUA 1W1IE 3RPDA 2DZSA 3B8TA 4KRTA 2IQTA 4W8AA 3BLKA 5DMLA 1I8JA 3PG9A 4TMBA 4JAWA 1CXEA 2E6YA 2ZRZA 1BVWA 5K7JA 1XWYA 2PP0A 2L5HA 1JCTA 1XBZA 3GC4A 3WQGA 3WYZA 3DX5A 4GZ7A 1E0UA 3EWUA 1KBBA 1OK4A 1H50A 1V02E 2E68A 1YDOA 2VZUA 3N4FA 2CBIA 3PTDA 1ZP4A 5CZSA 4QCEA 1VCGA 5FI8A 2P53A 1BAGA 1KM0A 3RCYA 2QQ6A 4A4AA 3AS1A 4C7GA 1Q85A 4PMRA 1VBUA 4M1BA 1TTQA 4NF7A 4HK6A 3TCSA 5G2HA 3E2VA 3LD5A 3CXOA 2QCMA 1EOKA 1FRBA 3USBA 4HZMA 1PUDA 3C8NA 5EPDA 1LWHA 4HU0A 3TN4A 3VD4A 4TOQA 2VZTA 4QCFA 4H9VA 1NF0A 3QZ6A 1G4EA 1WDQA 1XD1A 4XWUA 2Y61A 3U7BA 4KKXA 2QS8A 1UWTA 1SO6A 3QQ0A 3XINA 3BE7A 4DJEA 3K1DA 3TLLA 2QGYA 1VGAA 1O1HA 4CN4A 3DFHA 1ZAIA 2OWXA 1G4SA 1H4PA 3W7GA 3UZ5A 4H8HA 1FWBC 2B7NA 3VIGA 3GB6A 2ZUUA 2DSVA 4WOQA 4K38A 4GY0A 3A6OA 1OX4A 3ANUA 3VKJA 1OX6A 1KBLA 1TKKA 5JBEA 1JGMA 3RO6A 3HO8A 3CYVA 3S2LA 3O06A 1HKVA 4G1KA 1OD0A 2ZX5A 1G01A 4H7VA 3PZOA 4IJBA 3N4EA 2WJEA 5EMYA 3WK2A 3TW6A 3BW2A 1QPQA 3CPUA 3NR0A 3UJEA 1N55A 1OZQA 5DX7A 1EJSC 4IPIA 3VFLA 1EF2A 3TWBA 3V4BA 4LVBA 2YW4A 3I7QA 1P6CA 5IBXC 1NDZA 2VFDA 1D7FA 4KCUA 1JIBA 5J8LA 4BR1A 3AIBA 1W3LA 3URNA 4PMNA 1WQ5A 2E3ZA 2YCIX 1XYBA 1YNYA 4CQCA 1I1WA 1LT8A 5CAKA 4LUIA 1WDDA 5A8QA 3W6LA 1MDLA 4RUBA 2FH8A 3MUIA 5I00A 1KRMA 4UOZA 3DG6A 3WIJA 3SCWA 4CQDA 2WQDA 1TUFA 3DEQA 4MY1A 4WEVX 3VNMA 1UC5A 4B5TA 1O5KA 2CESA 4UTWC 1JL8A 3LCWA 4E5TA 3SR7A 2FZ8A 2EPMX 5A6MA 1V51A 1U1UA 2NQ9A 3FHQA 3N1AA 3T2QA 1WCGA 1NFPA 3MTWA 2PSNA 2HJPA 3HBLA 3MDWA 4KWSA 3THCA 4FHAA 3TW7A 1K03A 4JYFA 3W7QA 3WDHA 1U22A 4LSBA 4K36A 4TV5A 2OEJA 4O4WA 4GE8A 5IBXA 1ONRA 5I79A 3GE7A 5EMKA 3T78A 3PZIA 4Q6XA 4I8DA 3RLHA 1J2BA 3LY0A 3U3HA 1KCKA 2ZYFA 4I5XA 4Q32A 3TA9A 5KZDA 1D8CA 4FLSA 4Z0JA 1GK8A 2D20A 3KFTA 3TP4A 4B5XA 2BHZA 1IT7A 1WXJA 3DOPA 3WLNA 3LA4A 1L6SA 1TMHA 3S9ZA 1R2TA 3DFYA 3BQ5A 2QF7A 4H3DA 4HOWA 2Z6JA 4E4UA 4UB9A 3WLQA 3VD7A 1N8WA 4UTWA 1V0KA 5IRPA 3CS2A 3NQMA 3UA3A 3MYPA 5GJMA 1NQ6A 4FXFA 2J7EA 5BXSA 4F9JA 2BXZA 4PBFA 2NSXA 3EB4A 2ISFA 4R7WA 1B3YA 1WDRA 3LBCA 2OODA 4UNIA 3DI1A 4HVXA 1QCWA 3T4CA 1HFBA 4GO9A 3TJXA 1EA9C 1GVRA 3SDOA 4UQCA 4L9XA 1VHCA 1H7RA 1FWGC 4ICMA 3WDPP 3SCTA 3T0DA 4UTTC 5FAJA 3MO7A 3ABQA 3NQEA 4US6A 3NSXA 5IFTA 4B5WA 4IIGA 1R3RA 1ZAHA 2NUWA 4HQVA 3H2FA 4B15A 4V1YA 4R3UA 1RA0A 4B9ZA 3CZGA 2O56A 4MAVA 4K2SA 1EDQA 1FWDC 3IK2A 2QMKA 1C8XA 3MP4A 1JDDA 3BK0A 5DELA 5D9PA 5U7SA 4S1FA 5C2XA 2Q09A 4H6QA 2DZTA 1DIEA 3LEPA 5FF2A 4TUFA 3G77A 1KLZA 2E67A 2J66A 3HPAA 2OMAA 3MA8A 3XISA 3B8UA 2NUYA 2QKFA 3GSMA 1TQXA 4WDUA 3UXIA 1B4EA 2V3EA 2PLCA 3I7RA 4CGTA 3M16A 4UTTA 4LB3A 1J01A 3G1HA 5FOOA 1ITCA 2O4MA 1S5WA 4FX7A 1V6TA 1NH6A 4BF9A 3SFWA 2J74A 4O1EA 2PDQA 3SRFA 3LUTA 3E0FA 1WE5A 4XBSA 2BP1A 1E6SM 4GY1A 1MWOA 1GQKA 3H4XA 3HB9A 3U48A 1TCDA 2HWGA 1XKJA 1FXQA 2VENA 3S2JA 1EDGA 1WDSA 4HPHA 4HK5A 1WYIA 4H00A 2WPGA 2FPYA 3VGDA 4NZ3A 1JULA 3MC5A 3W7EA 3TR9A 5EFFA 2PPGA 4GYKA 3FKKA 3EWDA 1SMDA 5DFAA 3SCOA 4HCHA 2WVVA 1GPFA 3CGTA 3G0XA 5LNRA 2Y1HA 1XIJA 1GPWA 3VM5A 4Q8UA 2VEFA 2X1RA 2FFCA 1A5NC 2E5CA 4QBXA 4ALDA 2JIWA 3BXWA 4GBDA 1XCWA 2INZA 3G3DA 2Z1SA 3PANA 3W0KA 3WLRA 3RR1A 2Y6ZA 2HVMA 4NI8A 4LYQA 2GQ8A 3ARWA 2YCLB 1OIFA 3QM3A 3TQVA 1REQB 3WQ5A 3NDZA 1EJUC 2DUZA 2WC3A 3B9AA 1VB9A 3MWAA 3IAQA 1LJYA 4ZTXA 2AGTA 4OFCA 4XAPA 3P5ZA 3NQBA 5K9XA 4D71A 2OZ3A 1MQRA 3ZR6A 5I7GA 4ZCWA 4JS3A 4PEEA 3BARA 4WHBA 4PA8A 2CZFA 3NG3A 3EMCA 4HP5A 4GACA 3FYPA 1UD2A 1JZ6A 2BG5A 4HT3A 1ZTVA 1W5PA 2Y5JA 2G4JA 4IUOA 4F0SA 2OELA 2UZ9A 2OT1A 5CPTA 1GYNA 1EWDA 4RE3A 4P7QA 5PTDA 1FKWA 2G3JA 1JUEA 5CC5A 3S83A 3F5KA 3SCPA 1F73A 2GZXA 1HGYA 3OG3A 1EGVA 4A2RA 1AJZA 2NLYA 4HOZA 4RE0A 1XG3A 4B91A 1TZZA 2BVDA 1E3ZA 4V15A 3G3MA 5H6HA 4YCOA 5BRPA 3CJPA 2G97A 5I6SA 4JTAA 4NILA 1BSIA 4OBRA 4WXYA 3GVWA 4QSHA 4RCXA 8XIAA 1UROA 1AW5A 1SW0A 2FKPA 3EDFA 1ELSA 3SEPA 1UR1A 1Q8JA 1ME8A 3T8QA 1QPNA 3L0KA 3E38A 5CSYA 2CC0A 4ZQRA 1DJQA 3KOWA 4JTFA 1GT8A 4W85A 3NL5A 4ML4A 3FDGA 2V5LA 4DX3A 1SO4A 1XISA 3NPVA 3L21A 3U2EA 1ITUA 2TAAA 3MVIA 2OXNA 4PUDA 3VCCA 3QF0A 1CX9A 3RFAA 2QDGA 2WWCA 1J0YA 2B0MA 2WZTA 4IFKA 4L9ZA 4IQDA 4JY9A 1EEPA 4HCLA 5LSMA 1OYCA 4IISA 3CV1A 1P43A 5C54A 4MWAC 3BLPX 1GTHA 4PMXA 4KWWA 2O7SA 3ZVHA 5EL1A 3TC6A 3CK5A 2OEKA 4XKMA 1JZ2A 6ALDA 2P1FA 4DPQA 3BLDA 2A3BA 2UY3A 4ACZA 3P82A 2VWSA 4M82A 1TREA 5M3WA 3PAJA 2ABAA 1E6XM 2J75A 1YNPA 1O1ZA 4W93A 4IQJA 1XLHA 4J3VA 3W9ZA 3GTIA 1EP1A 3OYXA 1SFSA 3LDVA 4WJEA 3QGKC 2PGRA 1E9ZB 5LNWA 1QVBA 3TZFA 4C6PA 3SY5A 4Y8EA 1R3TA 1XIBA 3L5AA 3CZJA 3OO2A 4PL2A 3NZQA 4KQNA 3CL7A 3Q45A 1OZMA 1SJBA 5EY5A 1LUCB 4YL2A 2FMNA 3GWQA 5HR6A 4JBRA 1UD8A 4UUIA 2AKMA 2JALA 3NDOA 3WD2A 3DXIA 4KIEA 1XYCA 4R53A 3PUOA 5DN1A 1KC7A 1UH2A 3IJLA 4MWAA 3N17A 3W84A 4IIDA 3PFMA 5LXEA 3LBOA 4O1DA 4IX2A 4ZMGA 5HBFA 1FWTA 3H2OA 3GXPA 4F0MA 5I3KA 4OTKA 1Z44A 2PURA 2BODX 4WSKA 1KFJA 3FVDA 3GG8A 3CBWA 3I7SA 1KM3A 5AC8A 1TVLA 1XLFA 3BOLA 4PGLA 4IGMA 3W1AA 3MB9A 2GJNA 4JIRA 3IAPA 2FZMA 3GAYA 2BXYA 3FCPA 3N6JA 4F0LA 3E12A 4KFOA 1N2VA 1K7FA 1O95A 2EPKX 1XFBA 3AYSA 1PAMA 3LK6A 3IWPA 6TIMA 2ZZ5A 3QW4B 3LHZA 1XIGA 4UIOA 3LLDA 4DM2A 3B9EA 4LVAA 1MXSA 1OFPA 2I57A 4S3AA 3AHVA 5U4NA 2CIPA 2BV9A 2VQTA 4LRSA 3WCZA 3M6DA 3QQ1A 4PR4A 3SUUA 1ZJBA 1T8QA 1XM3A 2GJPA 3W7KA 2E5BA 3ZMRA 4W87A 1DORA 3B8DA 3WJZA 3IK4A 4GXMA 1UIPA 2Z28A 3N3MA 1PX3A 1HVQA 1P1XA 4JTCA 5FACA 2PDNA 1M1BA 2YA1A 2PDPA 2DIJA 5LYRA 2PBGA 3SB0A 1JXJA 1XW8A 3B9NA 3DI0A 1LOQA 2BFGA 3FHAA 2DIEA 3AIVA 1H1ZA 5T8GA 3S47A 3TIMA 4TXEA 6XIAA 2ZADA 1ZBKA 1XLBA 3I10A 2D2JA 3W75A 4JOMA 2DW7A 3K13A 1M04A 2X09A 5AYIA 5EBAA 3ABSA 3W2JA 3GFYA 1KA9F 2EQDA 4XZMX 4N9CA 1WO2A 3CZEA 3G0UA 1KR1A 3HG5A 5AHEA 3NWRA 1ICSA 1JCMP 4R27A 2PD9A 3KVJA 3ZS4A 4QIUA 5C6MA 3PZMA 1FHUA 3S2MA 1V3LA 2O9OA 3I3BA 1HL8A 4H9MA 1JUBA 3AROA 1E70M 1UWUA 4UFIA 1NU5A 4GNKB 3FA3A 2H90A 3L67A 5HMDA 3CZLA 4D72A 4UTFA 1RJPA 1SSDA 2QCDA 1QASA 1DQXA 1DKWA 5DT7A 5D32A 2ZTJA 4XKYB 4TTGA 2GLKA 4XAYA 2G41A 1BXBA 4KESA 5EMUA 1SZRA 3DHDA 4M6QA 1F07A 5A2BA 1UA7A 5CLWA 1UZHA 5IFPA 3GIYA 5C9UA 1S5TA 1E55A 4Y96A 3ZYZA 4K7YA 1GGOA 2V5KA 4DO4A 2X42A 3VD3A 2PGEA 1TMLA 4PL1A 4WK9A 3HURA 3LLXA 3FK4A 4FLQA 3M9YA 1J0HA 4F0RA 3W88A 2XH0A 3KRZA 3O16A 5HNTA 4I7VA 1TX2A 4XTDA 3G1AA 1Q7QA 1W32A 3QR0A 3O0KA 4D6HA 4TVUA 4GI8A 3GXTA 3MPGA 3WH6A 4DYJA 4E2BA 2Q8ZA 5TD4A 2XVNA 2YDSA 1GG1A 4P7LA 4AD4A 2WMGA 5M5DA 3C0JA 5KINA 3O6CA 4KRZA 3EDDA 3H4WA 3NA8A 3PBMA 2I14A 4AD1A 4M8UA 3R8HA 2Y24A 2YB4A 1Q2RA 1JYVA 3QOMA 1KR0A 3PNZA 4GBUA 3M0MA 3CTTA 4WRHA 2Y88A 2WKJA 3LX9A 1QXLA 5ABTA 1FP9A 3OZMA 2IUZA 5I3HA 1JI2A 3VNJA 3W1NA 4PFMA 1XG4A 4X0NA 2WZEA 5HINA 2GJRA 2YZ5A 4P8XA 3VDCA 2DEPA 4H8UA 3OLDA 4LRTA 1EXPA 4WDWA 1VJZA 3IANA 4MY9A 4Q4SA 2R8WA 3VNYA 1XLIA 1UQYA 1S2AA 3OLEA 2VOMA 1B9ZA 2HDJA 4O1BA 1B4KA 4JTDA 1UHVA 1XIDA 4AB4A 4G9PA 3AC0A 4AD5A 2DT1A 2GQ3A 2WHMA 1W9VA 5B7YA 3UR2A 1S46A 3FIGA 1CXFA 4N42A 2CERA 4NI3A 2FFIA 3MQTA 2X41A 4A8LA 4XX6A 1PVNA 4H01A 2HNHA 2YDRA 1GVYA 2P3EA 3G8EA 4W7VA 1VAHA 1VCFA 4MJ4A 3ARXA 1JJKA 4TX8A 1FWJC 4ZOBA 1I6NA 3B0PA 1F61A 2CWXA 3F2CA 3GU2A 3QC3A 4QG8A 2YLAA 2EPOA 2A7RA 3W7CA 1BG4A 2V81A 2AKZA 4DJFD 3CT2A 4ZTYA 2YX0A 4CQAA 1DWAM 3W7OA 2WSQA 4XZHA 5H8MA 1NJJA 4M19A 1K4GA 3KWXA 4UFLA 2GUBA 3IIOA 2ZXDA 4C91A 4LYPA 4AAJA 3MSYA 4URIA 4JHZA 3OJGA 3GIPA 4AMCA 4S23A 1OADA 3KEHA 1SZGA 4QXIA 1E72M 2BWGA 1H7OA 1ZNNA 2BY2A 5JU6A 2WANA 1PTAA 4LV9A 1T6MA 3WBYA 3GBDA 1VFMA 1RBLA 4HPXA 4GXWA 3AICA 4J27A 3PWIA 1W5MA 3THDA 4LCSA 4ZB2A 1OT2A 2QW5A 3BLOA 4FXSA 4BJHA 1BTCA 1BQCA 1FX6A 4X61A 3PPGA 1W9DM 3CWNA 1I1XA 1UPPA 1QOQA 5AC7A 4FAMA 1U30A 1XIHA 3CHDA 3RILA 4IOTA 4KIRA 4C6IA 3F2BA 1DJYA 3ZT5A 3W1UA 2WNZA 2PRMA 4L6HA 4ASTA 4LUSA 5A6KA 1CBGA 4EWJA 2VR5A 1Q4NX 3PPFA 1LLWA 1QNVA 5I23A 3E5PA 3ITVA 6ENLA 1F4HA 1RY8A 2DVTA 1IR1A 5AVNA 4EF9A 1LOSA 2DQWA 2V3DA 1LBFA 2E28A 1QPOA 1XSIA 2NQLA 3SSZA 5HOSA 2IKGA 1TWZA 2WCSA 2ZRWA 3LHUA 3JU2A 3IRSA 3WQ6A 4RNIA 4GYFA 5CGMA 3A9BA 2WSPA 5LGXA 4AWUA 4JXCA 1CLKA 3OYZA 4WKHA 1GTEA 1OM0A 1OG6A 4GYPC 1ZQ5A 3LM7A 4A22A 5JBFA 4PFHA 4PODA 3NJ3A 4M29A 3UR8A 2ACRA 2H8ZA 1JCLA 3AO0A 2J6VA 5LIUX 1EA0A 1CEOA 1BYDA 3TJIA 4GQGA 1FCVA 3PJTA 3WKZA 3CHCA 3ZWTA 3SCNA 2CLIA 5CJMA 4XZNX 2INFA 1U5JA 4DWDA 3BGGA 4ORMA 3O63A 3ZVIA 4AD2A 3BWWA 4F66A 3GVVA 1F6KA 1Z41A 1DPMA 2NX3A 3F4DA 3WD0A 2W9MA 2FVMA 3EDEA 2PDFA 3VIHA 3H26A 1GORA 3WMSA 3KVMA 5J5DA 1KFCA 1U2YA 2ATSA 1VRDA 3HFTA 3QV7A 3O3RA 7REQB 5MKGB 2XH4A 1WUFA 3GNRA 2IS7A 4RV3A 4EANA 1Q6DA 3FDKA 2XZ7A 5AYZA 4J2MA 1P0EA 4GYPA 3GXMA 4A3RA 3HG3A 5AC6A 2J47A 4H9TA 3NQ2A 1FA2A 3STGA 3QFEA 2Y4SA 4ICCX 5ECVA 1D2KA 2HROA 1K8YA 1GCYA 5I3IA 4WVXA 1YKWA 5DXYA 3S4TA 2GSHA 4ZO7A 2ACUA 2FJKA 1DXEA 3P6LA 1W1B1 1OSEA 3WL0A 3NM1A 3IJ8A 3CWOX 3VOCA 2QJGA 1RXOB 3GNPA 3IIVA 2VOTA 1QHZA 3L4UA 1EBGA 3RM4A 1N7KA 3CV6A 3WFAA 4YXGA 4A3UA 5C70A 1UP3A 1BKHA 4GNJA 4A3HA 1XUUA 3WL1A 3RF9A 4BEUA 4JFSA 4GJ1A 1H2JA 3STFA 2C0AA 3R0UA 3CU2A 3HQNA 1TA3A 3A23A 5A6AA 4AHQA 2XN1A 4PB5A 3L4ZA 4KS0A 5HQLA 1D3HA 3FW6A 3CAQA 1IGWA 1HJWA 3S5OA 1QBAA 1UD3A 4JTKA 2GQ9A 1E71M 3NVDA 4W9TA 2Z6IA 3UYCA 2E77A 1ZBWA 4JQ2A 4H8NA 1TR1A 3L4VA 2C1GA 4HNNA 4AXNA 3N2XA 1A0DA 4HMNA 1ZCOA 3R0KA 2XGBA 2ZX9A 2OZ0A 4FX8A 2AQOA 1ME7A 2OB3A 5LZLA 3O07A 3EKGA 1LORA 3GU1A 1ISWA 2R14A 2QLYA 3GXIA 5CAHA 2PDGA 2XG9A 3SCRA 3VIPA 2W61A 1C8VA 3RHGA 2GQAA 3E0IA 3U5YA 1OD8A 1YDVA 6PTDA 2OO0A 3WFLA 2ZWYA 3W26A 1VEPA 3ARUA 3THAA 4BWLC 4AVNA 3MKCA 4K39A 3P8JA 3W7MA 5H91A 1E9LA 4PTDA 3JW7A 5EB8A 4AZ6A 3KS5A 3MUXA 3EOUA 2OO6A 3AAMA 1M7OA 1HKKA 1PZ2A 3M64A 3P0XA 1H7WA 4IZGA 1XICA 2DQXA 3GRIA 1NELA 4MFEA 4UR8A 5CZJA 3V5FA 1TWDA 4Q7BA 3WQWA 4WF7A 3W1XA 1MZRA 4QSFA 1C9WA 4I9TA 5EMMA 3F5JA 5E09A 1V7YA 2NQZA 4IMDA 1W54A 5AHIA 3OHIA 3AWNA 3ME3A 4JD4A 3UG5A 2ZUSA 2ZZ6A 4LS0A 2POZA 1OX5A 3IRDA 3CPRA 4J3WA 3I6EA 3LXCA 1B57A 1VP5A 4A3QA 4HOXA 1W6TA 1HJXA 4H9UA 2VJXA 3TW9A 1NP2A 3CEPA 1OY0A 1AD4A 2IXVA 4HNUA 3ID7A 4IP4A 4YVPA 4BF5A 3R58A 5EYWA 1TWSA 4RXFA 4BWLA 3N2MA 1OFRA 4DBSA 1LL4A 3NO1A 2ABBA 4JN6A 2YXGA 3W87A 2WNQA 1OGBA 4KF1A 4XV0A 3ABXA 4GC3A 4ONVA 3HGJA 3OZOA 3PJXA 1FH8A 1X6NA 2ALDA 4LS1A 4INFA 2H3DA 3UNTA 3WEMA 3DKJA 3AQUA 3T09A 4NX0A 4O0QA 3AXXA 2OPJA 4C90A 2G50A 3VNIA 4PEKA 1LM1A 4BY3A 3H7RA 3WNPA 3OLGA 3O6YX 1TPC1 1SUXA 2QEZA 3GKFA 3K4AA 1VHNA 1SU5A 5JH1A 3AMGA 2VT0A 1PSCA 2G5WA 3LB0A 1CB7B 4CNUA 3T7VA 4PTVA 2FZNA 1S5VA 3EMZA 3HTWA 2X1TA 3II1A 3KWSA 5JXQA 1F8MA 3K2GA 4PCSA 3RCMA 2E0PA 1BYAA 1KFKA 4DHGA 4AEEA 1WKEA 4PMDA 2HXUA 4GVHA 2FB3A 2NX1A 4CCZA 1TPDA 2ACSA 4E0CA 2HEJA 4J5NA 3E49A 1VZWA 4S3JA 4XZIA 2VTFA 3GS6A 4JTSA 4J7RA 3WJYA 3IGUA 1RLDA 5KZMA 1VC4A 1R6WA 2VC7A 3UZJA 4WXZA 2Y8VA 3XIMA 4UFMA 1M41A 3WQVA 1VFUA 3T40A 1K1DA 3GAKA 4MUPA 1VFSA 2PWGA 3WLJA 4ZSUA 3SCVA 4AZHA 1QI5A 4FNTA 1VEMA 4JTTA 2DSKA 4YTUA 4PYSA 4A3YA 3ARPA 3BMXA 1TJPA 4CD8A 2JE8A 3UT0A 4E3VA 4EACA 3W3OA 4HJWA 1PIFA 1TCMA 3QOKA 1V6UA 1QI4A 1H5YA 4FF5A 4YWSA 2G3FA 3AOFA 3SN4A 1RALA 3EOOA 3V5OA 3B0YA 2WJFA 1LLZA 2C13A 2XIMA 2XSBA 3QMSA 2UY5A 1HO4A 4AYGA 4MVAA 3V1HA 1HJQA 1WAWA 1VF8A 1NDVA 2ICSA 3BAIA 3M1ZA 3RMEA 2OEMA 4JTEA 2QJNA 3GNOA 2BXVA 3NQ7A 1E0WA 3N2BA 3KAOA 4Q7IA 2PLKA 3RX3A 3K5XA 3LHWA 3DDMA 4ZQMA 1XXXA 3WFZA 1AQ0A 4ZR8A 2J4GA 1GKPA 3UG4A 3W1TA 2Y7DA 4DELA 4HHMA 1V6XA 1EDTA 3R94A 1F3TA 3KBJA 1VPQA 5FL1A 1FXPA 2NQ5A 1MUCA 1X96A 2VI0A 1XX1A 4MYXA 1P1MA 3THQA 4OU1A 2JBMA 3GBEA 1EFZA 3QZAA 2WVSA 3MCOA 1P5BA 3B8IA 3VCNA 3AZTA 2BVWA 1X6UA 3U6WA 2DDXA 4U31A 1MVYA 3C3UA 3ZJ6A 4HJFA 3WK1A 3EWWA 4Q3MA 1UMLA 4CKQA 3CV2A 3E6EA 5AFDA 1S5MA 2OQHA 1TVNA 3TYEA 2ZZ7A 3WF4A 1KV8A 1QPKA 2H6RA 4HSHA 1PV8A 3A4AA 2J25A 2Z2BA 4O16A 4PUUA 1R9YA 1ONWA 1JPIA 3S5SA 2QULA 3BLFA 1Y7VA 3WMLA 3TTEA 5FJTA 5TAOA 4IMFA 2OYKA 5DBTA 2RGMA 4FALA 2CLHA 3HQ1A 1MO0A 1VPXA 3TX9A 1Q66A 5HNRA 1V4YA 5E6YA 1XHGA 3TA6A 1T0OA 4QQ3A 2XU2A 1A80A 3S0CA 2D0HA 1P0DA 1DWHM 4X63A 1YTEA 2QPXA 3T2OA 1GNXA 3A21A 3GTHA 3UXLA 1AZ1A 1FBAA 7TIMA 1QDSA 1T41A 3H2EA 4CVWA 5A6LA 1GONA 1DHPA 1UWSA 3MO4A 1V8EA 4B2DD 5E0FA 3N12A 3CMFA 1OYAA 2PTZA 3WD4A 4PMUA 3ITCA 1Q7ZA 4CLMA 2XWEA 4GUFA 3W1RA 2HVOA 3BCJA 4D6GA 3QV6A 3SGUA 2J79A 4L56A 1UQZA 1VIWA 4M24A 5BMXA 5D30A 5LHEA 3BZGA 1W31A 3SJNA 1VYSX 1BD0A 4D1JA 3N11A 2QJMA 2RDXA 5CEWA 3V0UA 3C4UA 1DHKA 4AZIA 2C8NA 3D5HA 5TIMA 1V3JA 1F8IA 2VDHA 4X9YA 2P50A 1U5HA 2YCLA 1B5TA 4M51A 2OT0A 4AFYA 1REQA 4C1KA 1KRBC 2ISSA 4EF8A 4ACYA 1MUWA 1EB3A 3TKFA 4ADUA 5CGTA 3CM4A 4J4KA 3D3AA 4JN8A 3QH2A 5CPNA 4XZ9A 2WVVB 1UC4A 2YCKX 1Y5WA 3QW3A 1KM5A 3LI0A 1OCJA 3GK0A 5CPOA 1OFEA 3PAOA 3HMCA 2WMFA 4GX9A 1PKYA 3GG0A 1JDCA 1UR8A 1V3HA 3SAZA 3RK8A 4AUBA 3WEOA 2PB1A 1IE7C 3H53A 2PE4A 3QGVA 3GO2A 3VFCA 2ZZ1A 1LRTA 1Q6GA 5E9XA 1TO3A 3HGOA 1WPCA 2X2YA 3SW6A 3V5CA 4KGLA 2CKSA 4Y9OA 1YBQB 4XIMA 4V27A 4HYRA 4DBEA 2DZBA 1RLCL 2VX7A 1HJVA 1O66A 2BTMA 3GTNA 1BQGA 3ORWA 3BC9A 3AMCA 3EDKA 3JS3A 3L5MA 2YPIA 3QHMA 3KL5A 1P0KA 3IJ6A 3H4GA 3KCJA 4C7FA 3TV8A 2XIBA 4GGBA 1V6VA 1LQ2A 4IXHA 4RJEA 3ZR5A 3BCFA 1ECQA 2Y85A 4OWGA 2Z29A 9XIAA 3PZVA 4Z1CA 1W9BM 1QMLA 5A6BD 1OABA 3GW3A 4ZQNA 4IL2A 4LEFA 4YYCA 4IICA 4TX6A 3DG3A 2QHAA 6TAAA 2A3LA 1GOXA 3UWUA 4MAZA 1UCWA 1TG7A 1YW1A 4RDWA 2QNEA 4H6RA 5IHSA 3UF9A 3ZFHA 1SJCA 2WW5A 4H83A 1DIDA 2CYGA 4G5DA 2EXOA 4MNJA 2CLLA 3B05A 1Z42A 4AZGA 3GH7A 2KAUC 3TUUA 3VVGA 3LCHA 1UW9A 2E9MA 1U5VA 4L4MA 4AEFA 4OIFA 4HNVA 2R9RA 4UTLA 1G94A 4RNFA 4CQ8A 3SIMA 3MV01 4DN1A 1Z6KA 4NZJA 3FN9A 3KP1A 3ZVHB 4GVFA 2V30A 4HIBA 1UZDA 3EEZA 1Y8BA 4HPNA 3MDUA 3ZOAA 3UWQA 2PF8A 4JFUA 4UOJA 1LP6A 1LUCA 1QWGA 1B30A 3SY1A 2EJ1A 4UNKA 1JF5A 1QR7A 2PDBA 1QK2A 1MXDA 2RJHA 5A8NA 4FLRA 2HBVA 4E2DA 3V3WA 2A7NA 4FP1A 3VNZA 3S8HA 2YCJA 2ASHA 2YXXA 3WSUA 1KQYA 2ZUVA 3FVMA 1X7IA 3U4FA 2VCBA 2HVNA 1E5NA 3LXBA 3EGJA 1DTUA 4JHOA 1X8FA 2P3ZA 4S3DA 4L4PA 3PP7A 2YL8A 2PWVA 2DH2A 4TQTA 4BK9A 4Q7NA 2BY0A 1BGGA 1UUMA 1ADSA 1FWAC 3VO0A 4N4PA 1NOFA 3CQ0A 1EUAA 3QR1A 4LF1A 3T6CA 3VGFA 4RKAA 2DUXA 1LG2A 2Q6ZA 4O11A 5GVJA 3VXGA 4JNZA 5BW6A 4JNMA 4X60A 4NJKA 1PKNA 1EO7A 1R87A 4RW5A 4DJDC 4BFAA 1KKOA 4RV8A 1RJQA 4MUZA 1WKFA 2AAMA 3PULA 2GDVA 2CHOA 4XQ6A 2ZWZA 4LVDA 1JPDX 1I2PA 5EFDA 4Q33A 1NY1A 2VZSA 3RLUA 1AQFA 5I09A 1E0TA 4YTQA 1XQLA 4IPJA 4L61A 5F2MA 3BUVA 3EB3A 2RFGA 1JCJA 3BSGA 4MHBA 3T2PA 1R3VA 2W63A 2MNRA 1L2UA 3B03A 3BZJA 3MT1A 1S39A 4DB7A 1HXJA 2V5CA 1YHTA 4D2JA 3CB8A 3DC8A 2CCRA 3D3FA 3PTQA 2O9TA 2Z7GA 3GDKA 1G5AA 1GVOA 3ONBA 2WYSA 3UG8A 3FSUA 3AZSA 4QX4A 1GEHA 4TX9A 5FJUA 3W02A 4JZ5A 5ABHA 4GIYA 1OFBA 3OA3A 5LHFA 3O1NA 4EX4A 3QR3A 2HS6A 1RQHA 2HV5A 1W9XA 4DJDA 3P2VA 4J3XA 4DXKA 1PPIA 4MJZA 5CSUA 5BXPA 5DCBA 2JGYA 1VR6A 3FNDA 1UJQA 1G4TA 1S2WA 2QZRA 4BA0A 1SW7A 3O0FA 3RGTA 2VFEA 4AC1X 4ADSA 2WZHA 4UOQA 5KITA 3UXKA 4ZSTA 3CUFA 1A5CA 3R10A 4C6DA 4GUIA 1ZALA 3OBKA 4UR7A 1EJRC 2ZA1A 1CCWB 1PB0A 4Z0SA 4XKYA 2E25A 3PJWA 2QDHA 1F7BA 1OFOA 2CBJA 5SWUA 1DE6A 2NV9A 3UP8A 2AL2B 1JZ5A 4U5KA 5I3JA 4CN6A 1TV8A 3HF3A 3T1GA 3LPOA 4XAGA 5A6JA 1V0MA 2OX4A 3BTNA 3P8IA 1KBKA 1VIZA 1HW6A 2ZZ4A 1E4IA 4LYRA 4JFTA 3KX6A 1QPRA 3L65A 3VIIA 3EA2A 4IF2A 4TVCA 1I45A 4JHMA 1BHGA 2WVUA 2QIWA 2QCDB 2UWFA 3GLCA 4R85A 4CD4A 4HNCA 4PUMA 2EO7A 3KRSA 3RPTA 2FIQA 4W8LA 5IXEA 4ZFMA 5ENLA 5B7ZA 2GUYA 3A24A 1P48A 1AL7A 3UYIA 4HZ8A 2OSXA 3LQGA 5EKYA 2QPUA 3E02A 3P84A 5HPCA 3C3NA 3LENA 3TONA 1MW0A 2V3FA 2EJAA 1LQAA 1K7XA 4IIHA 3H2NA 5I2UA 3QV9A 2QR6A 3CC1A 3N9KA 4JTHA 4DO5A 4IMCA 3PHAA 1W37A 2ZXAA 2FVLA 4CQBA 1IZKA 1CB2A 1ONEA 3I3DA 1AQHA 2QDEA 5LGZA 1TTPA 1DJZA 5C9XA 2ZC1A 1V77A 1V5XA 3LCIA 3SO7A 2HXTA 5CBBA 4RPPA 1SGJA 1SYTA 3LPFA 1EL3A 3TCEA 4XIAA 3EA1A 1EEXA 2XSAA 3PZUA 1WA3A 3W38A 1EPXA 4TV6A 4DO6A 3NTYA 1TPFA 3ZLFA 3F4NA 1UD4A 3NZPA 4PH6A 4DM1A 1KFBA 4W7WA 5FIPA 1FWEC 2VEMA 4GG9A 5FESA 1UWIA 3NCOA 3R25A 3VILA 4OOUA 1GW9A 3AI0A 3BVJA 1ZS2A 3AJ7A 1OB0A 2ZX8A 3GYEA 1EBHA 4TIMA 2IQ0A 3MI6A 1DVJA 3IUDA 4W84A 5FD0A 3KBSA 4AYSA 3T08A 1MQPA 3OQEA 4J2PA 4MPQA 4DY1A 4V2XA 3EPNA 3WLPA 4MY8A 3VIMA 2VD9A 1OQFA 4UCFA 4ATLA 4PUJA 4GNVA 2ZA3A 2VVSA 3UZWA 3M4HA 3STPA 3MCNA 3ABRA 3BOXA 5I3DA 2C1HA 1H41A 1IF2A 3E2QA 1IXPA 3R13A 3TQPA 3N6QA 4GJJA 3OU8A 3LG3A 4HHHA 3MUY1 4IGHA 1FWSA 1IEVA 5A2CA 1A49A 2X1SA 5FJRA 3QSTA 3POCA 5FF4A 5BU6A 3O6DA 1US0A 1E1EA 1W3IA 3M41A 1EJTC 2WHJA 2WSYA 4MSSA 4U33A 4XG1A 4D8ZA 1R85A 4C5YA 3SRKA 9RUBA 1GZJA 1RZMA 2FGBA 3CQKA 1YEYA 2GGIA 3I6TA 1AVAA 4AX6A 2HSAA 5HWJA 1S3HA 3ARYA 4MKNA 1FP8A 4ZFCA 4WDXA 1ADDA 4HNTA 1AJ0A 1XYFA 1E6PA 2CXGA 3G1RA 3CL6A 1I9CB 2XFFA 4J3TA 1RHCA 1DBTA 5HWMA 1NWRA 4OV9A 2BOFX 3COTA 4E2OA 3E0LA 2PC4A 3PC0A 3W29A 3T05A 4QTGA 3M6YA 1VJSA 1G4PA 1OINA 4DZHA 1GOIA 3FY1A 3KZSA