4W8BA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with xxlg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
386
structure length
386
Chain Sequence
KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Exo-xyloglucanase
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 157
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8bA00
4ZEPA 3ARWA 4J3XA 1CZ1A 3K46A 4CN1A 2X05A 4ATDA 4JCLA 4MB4A 4YPJA 2XWEA 3BLPX 1XH1A 5C71A 1J0ZA 4AWEA 4CVWA 5M3WA 3B9EA 4AYSA 5GNZA 5BYWA 1EOMA 3PZUA 2ZUUA 3RM9A 2CHNA 1CXFA 1BYDA 4PUEA 1GCYA 3WNLA 1WDSA 2VC9A 2G3IA 2PWEA 3DC0A 5A8NA 3BLKA 4V27A 4D6GA 1VFMA 1PBGA 2DQXA 4JKKA 2O9TA 2X1IA 1VEMA 3K1DA 1RP8A 3WL1A 2B31A 5E09A 1MW1A 1ECEA 1TMQA 1R7OA 2YL9A 1GOKA 1BHGA 2V3DA 4JFVA 1GOIA 1W9UA 2WWDA 3A4XA 2E3ZA 1BG9A 3VO0A 1B3WA 1OGGA 1W2VA 3ZM8A 4LYRA 2W91A 1J9YA 3UERA 2DPEA 3ZMRA 1DHKA 1V0KA 2VX7A 3ZSSA 2YA0A 1VENA 3GYCA 1C7SA 3LPPA 3BXWA 4PCSA 3AHYA 2PBOA 4JIEA 5IHSA 3PBGA 4PMUA 1E6QM 3T0BA 1KBBA 2OWXA 3W26A 3AFBA 1CLXA 3RJYA 2JIEA 1KGUA 1SYTA 3MSDA 1IV8A 1B31A 1EO5A 4MTVA 5CLTA 1TZ7A 4M56A 4E4PA 4B9ZA 3A4WA 4LPCA 3BMVA 3CUGA 2CBJA 1HP4A 4NRRA 3D3AA 5A1AA 5AY7A 2GJXA 6CGTA 2BY2A 2OWWA 4PMNA 2W92A 3NYDA 4CUCA 5FIPA 3W4RA 1MWOA 1W3LA 4AEFA 3GH7A 2XTKA 1JD9A 1PPIA 2ZX8A 2OYLA 3N17A 2JIWA 1XRVA 3W29A 5ECUA 1V6XA 1J0JA 1E73M 3N18A 1PX3A 3VDCA 8A3HA 2ZX9A 3JUGA 2PC8A 1VEOA 4RE4A 2OSXA 3T0DA 2ZICA 5CPTA 2EPOA 2VCBA 2YKKA 4P7QA 3VMNA 5JIPA 1D3CA 3AIQA 3KL3A 3NDYA 2CITA 4KGJA 1XGZA 4JHOA 3F5KA 2CHOA 4C7FA 3MKKA 1JZ5A 4UFHA 3SCSA 4JKLA 3OG2A 3THCA 2XYLA 4U5KA 4WIWA 2EPNA 2W63A 3W53A 3L4VA 1BGAA 3KWXA 1OWQA 2WLZA 3DHPA 4MB1A 1GOQA 2QPSA 2VTFA 5GNXA 5BXSA 1EGZA 1QPKA 3WNKA 2ZWZA 4UFLA 4J3TA 1VB9A 2XVGA 4WKHA 3TTQA 3THDA 4H2CA 2D20A 5AYBA 2PBGA 4HPHA 3U5UA 3U7VA 5M17A 1BYAA 3IAQA 4ZENA 2A3EA 3CUIA 4JFSA 2BS9A 4P8UA 2O9RA 3L4XA 4ZXLA 5GNYA 3FNDA 4OJYA 4LYQA 4KMQA 1LG2A 1E1FA 2WMJA 1DWFM 1UOKA 2JALA 2EEXA 3BSGA 2WSKA 3HU7A 4L4PA 4PMVA 3VNYA 2E40A 1GJUA 4D1JA 4AW7A 1JZ4A 4H8HA 4UFJA 1V0NA 1CXEA 4MJ2A 5HOSA 1B90A 1K9EA 4IPLA 3WL0A 4JHZA 3M46A 3QOKA 1TA3A 1OM0A 1MQPA 1Q6GA 1BVZA 2QLYA 4PTMA 1EA9C 1I1WA 4P7RA 3GXFA 3M6DA 1D7FA 1JF6A 2W67A 1KFWA 5HDRA 1CXHA 1CECA 1J0KA 2HISA 1TCMA 3KL5A 4P7OA 5D9MA 1MW0A 3WDPP 1J11A 1UR2A 5BRPA 1JZ7A 2FGZA 1GUVA 1KWKA 3VU2A 3SCQA 3VMOA 4D71A 5EMYA 3SCTA 1VRXA 1RPKA 3D5HA 2J25A 2PI6A 2WYSA 5C8BB 1M04A 4NZCA 1IZKA 3U57A 2E4TA 4OKDA 3OZPA 1Y7VA 4PTVA 2QHAA 1S46A 1WAWA 3VUPA 5CG0A 3DYMA 3FAWA 2V5DA 1EIBA 3PZIA 1G5AA 4J7RA 4KRTA 3WMSA 4C7DA 5I78A 3L4TA 2WW5A 3NSMA 3AIBA 1RP9A 4U33A 5EFFA 1KR1A 1UD5A 4JFUA 1QVBA 3NJ3A 2NSXA 4Y7EA 3AHVA 2VX4A 5EB8A 1CLVA 4PMRA 1JFHA 3CHEA 1XD0A 2VCAA 1JYXA 4M29A 2J7DA 1JGIA 3AQUA 2WMKA 4OIFA 4JFWA 3BAYA 4WLCA 2WZIA 3UESA 1E71M 5C70A 1G0CA 4YHEA 1UR1A 2Y5EA 1LF1A 1PJ9A 2WMFA 1HL9A 2D24A 1E6ZA 1OD8A 3EMCA 1V0MA 3QGVA 1HKIA 4AD1A 3IJ7A 3SUSA 1NP0A 2WBGA 4ACZA 2OYKA 3ZJKA 1L8NA 5CLWA 2A3AA 3WBEA 5FCZA 3W28A 4CU8A 3A4AA 1ODZA 2CETA 4PBGA 1BPLB 3ARPA 3AMCA 3VGGA 1HT6A 3VX1A 1DWJM 3UR8A 1M01A 5EBAA 2EPMX 2J74A 2UY2A 2VUYA 1GQKA 4E8DA 1U33A 1UKOA 1UWQA 2QF8A 2WHMA 1HJSA 1GONA 4HZ8A 3PTMA 4XX6A 1UR4A 2YBUA 1CIUA 1V6YA 1WPCA 4KH2A 3EDJA 4MAZA 2WKLA 1E6PA 3CHCA 3UETA 4QP0A 4AIOA 4D6FA 4TTGA 1WB0A 3AMLA 8CGTA 5I3DA 3WD2A 3W82A 4CCCA 4W88A 4U31A 4TUFA 3BCFA 3AIUA 2WMGA 3T2PA 1FH9A 2JF7A 3VIPA 2WZEA 4UOZA 3ARVA 3VM7A 3ZQ9A 1UD4A 1Q6CA 4GQRA 2J47A 2YLLA 4JFTA 4F66A 1V6VA 1UG6A 2ZOXA 1UR0A 1CGXA 3OB8A 4DWSA 4AD3A 2XFRA 2XIIA 4D6EA 9CGTA 2G8ZA 1M03A 1W32A 1B2YA 2CESA 4YN5A 3RMEA 3OGSA 1Q6EA 3CZEA 2DSUA 1J0HA 1KQZA 3SUUA 4D6DA 3VIMA 4JKMA 4M1RA 1ZL1A 5CPSA 3SCUA 4W84A 3MUZ1 3BAJA 3MSGA 4W5ZA 1WZKA 3EYPA 3MUY1 3WH6A 4B3LA 4W93A 3MMUA 4FF5A 3WH5A 1EH9A 3AI0A 3SIMA 4AY1A 1W3KA 1G9HA 3FW6A 3K8MA 4J3UA 4X0NA 2BY1A 4PMXA 1BLIA 2W5FA 3PZQA 3DYOA 3VTRA 2WZHA 4V28A 2W61A 1SMDA 1JZ8A 3WD4A 1VF8A 1QNQA 1KCKA 5E0FA 2F61A 4HZ6A 4C7GA 4P7NA 1OD0A 4WF7A 2ZE0A 3OZOA 1RH9A 4L4OA 4PN2A 1E3ZA 5I79A 5D9PA 4BF7A 3KZSA 3KEHA 3WH9A 3ZJ8A 2OSWA 4H41A 3CMJA 1F4AA 3VX0A 1MFVA 1DWIM 1UR9A 5CQ1A 1G94A 1B3YA 5FOOA 2ZXQA 4MDPA 5A3HA 1CGTA 5D4YA 1HXJA 3PZOA 4X9YA 1JL8A 3M7SA 1OIMA 3OLIA 3PZMA 1J0YA 4EKJA 3WFLA 3GNPA 2ZXAA 2BVDA 2YLAA 2YA2A 3OLEA 3TTYA 1W3HA 4UQEA 4BQ4A 4WK9A 1VJSA 2WSPA 1E4NA 4AD4A 5BXTA 1HIZA 2CBIA 1R85A 3CUJA 5CPQA 2XJ7A 3VPLA 3WNPA 2GK1A 3UG3A 3ARYA 4ATWA 2X09A 3ZT7A 4JL1A 4D72A 4DWSC 5A8MA 2GJXB 3CZLA 2EPLX 2ZXDA 2OWCA 4ML4A 5CJ5A 1E0VA 2E9MA 2EPKX 1V3JA 3E1F1 1UA3A 2JF6A 3CTTA 2J7CA 3MUIA 1OB0A 2JE8A 3AOFA 4V2XA 3SCPA 1BGGA 1HVQA 2AOSA 4LGXA 4PEEA 4NRSA 3K4AA 3AHTA 3PZVA 4GO8A 4MAVA 5HBFA 2VO5A 2ZX7A 3WUGA 5A6KA 2CBUA 4P7LA 1ZS2A 4GI8A 4BZYA 5LA2A 5IDIA 1US2A 4R27A 2VX5A 2J77A 1W91A 5E0CA 4AIUA 4EK7A 3MS8A 4HOZA 3WN6A 2GDVA 3GXMA 2XPKA 5I5RA 2D3NA 2J7GA 2PWDA 4WKAA 5DFAA 2XFYA 4PCTA 5A2AA 1AMYA 1E9LA 3T0AA 2EXOA 4W5UA 4CGTA 2FHFA 1OIFA 3OGRA 3WDJA 4MPKA 3GDBA 1B3XA 4J3WA 1CTNA 1KXHA 1HJXA 1MXDA 1UD3A 4S3JA 1E56A 4BQ2A 3M07A 2CEQA 4N42A 1V02E 1XH2A 1KXTA 3QHMA 4XZWA 1LL7A 4OBSA 2DT0A 2DH2A 3ZIZA 1G1YA 1H0IA 3VDHA 2VL4A 3VIFA 3ZR5A 4AMCA 4Z2KA 5I77A 3WNNA 2VNCA 3W24A 2YDSA 2IXVA 4IM4A 4CN6A 4AZGA 5CSUA 4E8CA 1W9VA 1XV8A 1PZ3A 1UWUA 4GIAA 4H7VA 2ZUMA 1QHZA 2VRQA 3AICA 1E4MM 2J4GA 1UZ1A 2W62A 5DF0A 1C8YA 3AYRA 3N11A 3SEPA 2GVYA 5IHRA 5A2CA 1Q6FA 1LLOA 3N13A 1MW2A 2ZUVA 1QNSA 3TA9A 4P8WA 5ABFA 3PTQA 2V5CA 3I3EA 3VM5A 1W9BM 2YL6A 4WSJA 2GDUA 2GSJA 4B3KA 4EE9A 5E6YA 1I75A 2XSBA 1ITXA 1VFFA 3W27A 3UG4A 1MXGA 3KL0A 4TTUA 1VFUA 3VIHA 1H49A 1J18A 2Y8VA 1BYCA 1FHDA 3WF3A 2Y4SA 2XM1A 4X0VA 3EBVA 2XIBA 1J01A 3GTNA 1LL4A 1GPFA 4AISA 4MNMA 3AIWA 5A6MA 1PIGA 3WMBA 1UZ4A 1W1TA 2J75A 1B3VA 1VEPA 3N9KA 1TE1A 3CZJA 3WNOA 2W66A 2YBTA 1JI2A 1E5NA 2J79A 3AHXA 2XVPA 3HJEA 4W8AA 2CERA 3WF4A 3S2CA 1BVNP 4PTXA 2WCSA 4XV0A 1H11A 5CGMA 2PWGA 3A47A 4B16A 2X2YA 4W7WA 3WH8A 4UNIA 1X1NA 1ZBVA 1CBGA 4W89A 3UG5A 1C92A 3OBAA 4AD2A 3CLWA 2WMIA 3OLDA 4F8XA 1QNPA 3NDZA 2J7BA 2FGLA 4PMQA 4H8VA 2GFTA 4M80A 4H8UA 1IT0A 3WY1A 3CZ8A 2VI0A 1E3XA 3VIGA 1JF5A 2O9PA 2VZUA 1N82A 3SURA 4LX4A 3ARUA 4QCFA 2OYMA 2YIHA 2YDQA 2D22A 4Z2GA 3L4YA 1E55A 5BROA 1OGBA 3APGA 1MVYA 2WC3A 3TTSA 1AQHA 3BSHA 4HA1A 2J62A 2GJPA 2VQTA 5HNNA 1HF6A 1HP5A 5I2UA 1XCXA 3CUHA 3CUFA 4AZIA 3LPFA 1VJZA 1E6NA 1DTUA 1R86A 4KGLA 2BHUA 1UH3A 1JZ3A 1JYVA 2DSZA 3QHNA 4PTWA 1WE5A 3I3BA 1R7AA 4UFMA 3GNRA 4W85A 2WVVA 4BCEA 2HVMA 4YHGA 1JAEA 1K6AA 2CKRA 3GXDA 5DMYA 5FL1A 1CYGA 4PMZA 4BQ3A 1K9TA 1WDRA 2VCCA 4UTFA 1H2JA 4GZIA 4EAMA 4AZHA 2VURA 1UD2A 2WVSA 4UQAA 4A3YA 5HXMA 1UKPA 4JAWA 3WFZA 2DSVA 5DT5A 2VQUA 3LPOA 4NSBA 1E5JA 4W8BA 4EANA 5BCAA 1OCQA 2ZXBA 4N0RA 1A3HA 1UQZA 1P6WA 4LQ1A 3VIIA 1FA2A 3VINA 1TFVA 2VRKA 1EQPA 2EJ1A 3ARRA 3GXIA 3WELA 1NQ6A 1E4LA 3CO4A 1M53A 2YOCA 2WBKA 3ARZA 5A6SA 1J10A 1UWIA 1GOWA 3VD5A 4LYPA 1ODUA 4CCDA 1ISWA 1GHSA 2E8YA 4PMDA 5E6ZA 1B3ZA 2E8ZA 4PSPA 1CWYA 5FD0A 2WWCA 4AZBA 4ACYA 4AD0A 3WD1A 3ZR6A 4TVUA 4CVUA 3WEOA 4GPNA 3ZJ7A 1VBUA 4XB3A 7CGTA 2DGAA 2UY5A 4UQDA 1NWTA 2DSWA 1CXKA 4JZ5A 5A8OA 3VIOA 3PZNA 2Q8XA 2CIPA 1EQCA 4UZSA 4Z2HA 3WUEA 1V3LA 1WO2A 2D0GA 2WVTA 1DEDA 2NT1A 1QNOA 1X6NA 4OZOA 1G01A 1JDCA 5AC4A 1ISVA 3AIRA 3WDIA 1DP0A 4MDOA 3L2LA 1E4IA 3VVGA 2WXDM 1HKJA 2XG9A 2UWFA 1ZBWA 3WF1A 3IANA 5GPRA 4W7VA 4TVDA 5A94A 3ZSTA 1V3HA 2VOTA 4CN4A 3VKKA 1NWUA 3WUFA 4BA0A 1QOXA 2EO7A 1YQ2A 3EMZA 1W1VA 2AAAA 2UY3A 2G3NA 3BCDA 4MNLA 1B1YA 4TOQA 3II1A 5IXEA 5I6SA 1ISYA 3POCA 3WEZA 1CPUA 3F5JA 4P8XA 3W38A 5CGTA 4MB3A 2IXUA 4CD4A 1SR0A 2VZTA 1TVPA 2VVSA 2YJQA 2ZX5A 1BG4A 2G41A 2VVNA 3AHZA 4A4AA 1WNOA 3MV11 4ZE5A 3B8SA 3WQ8A 2PWFA 1EOKA 1FP9A 4DWSD 1QW9A 2NT0A 2VJXA 2RGMA 4U2ZA 5D9NA 3NSNA 5EFDA 1GJWA 3L4UA 4QDMA 3T2OA 3AS0A 4XUYA 4HMCA 1GORA 1E43A 4HP5A 3ARSA 4NI3A 1Q4NX 3W6LA 1UWRA 1XSIA 1CXLA 1GOMA 3PZTA 1WZMA 4QCEA 1XC6A 3WEMA 1JXJA 2QV4A 1NOUA 2NW0A 1WCGA 3MMWA 3WF2A 3FAXA 1UH2A 2YA1A 1UD8A 5DT7A 1PX8A 2WCAA 4F9JA 1OGSA 4U2YA 1E0XA 3FHQA 2D2OA 3EDEA 5GQBA 2WAGA 4FLOA 2F2HA 4MADA 1K9FA 4TX8A 1CEOA 4CU6A 2XWDA 2DT3A 1OT2A 4U3CA 2A3HA 1MW3A 4OOUA 3AMKA 2YDRA 5JBEA 2F8QA 4HOWA 2X8RA 5KEZA 1XHGA 4F79A 3ARTA 4D6CA 1HKKA 4CKQA 2BVYA 2EQDA 3WDRA 1UYQA 5E9AA 3B9DA 3SUVA 1W1PA 3DECA 3MUAA 3WQ4A 3RO8A 4GI6A 1CGVA 2ZUSA 5ABFB 4GZJA 1WP6A 3ECQA 1JYWA 3QOMA 2VZOA 5TD4A 2CKSA 2JEPA 4XZBA 3F4VA 4GO9A 1HL8A 5LA0A 1QNRA 3AS2A 1EDTA 3U7BA 5JUVA 1YHTA 4CD5A 1FOBA 2BFGA 1TUXA 3L2MA 4FLRA 5A6BA 4W8LA 3VMPA 3AZTA 5FKYA 2WHKA 1ISXA 4UQBA 4ZXOA 3L4ZA 2WPGA 2XSAA 3TP4A 5A6BD 3UEQA 1IZJA 1CGWA 3VDAA 2WVUA 4UFIA 1JYNA 2OLHA 3ZT5A 1SMAA 2CCRA 4AZ5A 3OIHA 1EXPA 1XCWA 1ZJAA 2XGBA 4AEEA 1U30A 1TR1A 5KZ6A 3IAPA 3MV01 2WCGA 2BY3A 5A2BA 4NF7A 1NOWA 3L4WA 1BF2A 2A3CA 5A95A 4R5EA 2J8FA 3FY1A 4IUGA 2JEQA 4M24A 2C0HA 4UCFA 3MANA 4GQQA 2D3LA 1JAKA 2VZVA 1V3MA 3FHAA 3GNOA 3O2LA 1H3GA 3T2QA 4H04A 2A3BA 3HN3A 1LG1A 3GZAA 3MMDA 1OT1A 2IUZA 1VFOA 3W0KA 1W3JA 3I3DA 1FH8A 1H41A 2O9OA 1MFUA 3OGVA 2VX6A 4HA3A 1FP8A 3QR3A 1JZ6A 4CD6A 2WMIB 1FH7A 4D1IA 4FLSA 4MB5A 4U5IA 4AZCA 1HN1A 1NARA 1QI5A 4Z2JA 3VIKA 4A3HA 4GZEA 2XVKA 4AD5A 2BXZA 3CZKA 1QBAA 4GXPA 1KWGA 3VNZA 3O6AA 3CMGA 4WJXA 2XUCA 4TXEA 1KB3A 2QMJA 4UFKA 3AROA 3BAWA 4PMYA 3N12A 4OOZA 2C7FA 5A6JA 2EBNA 2TAAA 3WENA 1D2KA 2VMFA 3U5YA 5BXRA 4FK9A 5CZKA 1BQCA 1GQIA 1VIWA 1ZBCA 3F5LA 3O9NA 2DIEA 4M82A 5DO8A 2CYGA 3ARQA 5HPOA 3CH9A 1XD1A 5E70A 1E6XM 4J28A 3NIYA 5A6AA 3NSXA 1TA3B 1UKQA 1WDPA 3SCOA 2DSKA 1U2YA 2CXGA 4DM2A 3FXYA 4K68A 3SCRA 1NP2A 1E40A 2WANA 5D9OA 3CGTA 1UHVA 1J12A 1QW8A 2YL8A 4LXFA 1WDQA 4CD8A 4Z2LA 1OBAA 1GQJA 3VD7A 3VILA 3IJ8A 1JFXA 2FH8A 3AJ7A 3AISA 1ZJBA 2WVVB 1C3FA 2BXYA 2DEPA 4RE2A 4F9DA 1LL6A 2VT0A 1WZAA 2D23A 3WUBA 4DM1A 2CPUA 2BHZA 1C91A 3SCNA 3K8LA 4GINA 2VRJA 2XVNA 1QHOA 2DDXA 2QMKA 3PHAA 1GW1A 5BWFA 4HA4A 3QHOA 3AMDA 3CHDA 2DIJA 1W9PA 3AXXA 3BC9A 1HKMA 3AIVA 1UA7A 2VR5A 3RPMA 5JBFA 4D6HA 3AMGA 2MANA 5HPCA 4ZE4A 3GM8A 1QI0A 4HMDA 1KR0A 1O7AA 1WZLA 2W4XA 5D8ZA 3J7HA 1NOFA 2WHJA 3WDQA 3OLGA 2DT2A 1GVIA 1US3A 3VD4A 4Q7NA 5CSYA 5A69A 1PAMA 1C7TA 3WIJA 4MNJA 3WQ6A 1EHAA 3RJXA 3NCOA 1ZB5A 1AVAA 4AZ6A 2O92A 1WKYA 1FHLA 4S3KA 2E9LA 1JDDA 1EO7A 2WMHA 4AC1X 4D6JA 4AZ7A 1W2PA 1JI1A 4OUEA 3GBDA 4TX6A 4HTYA 4U3AA 3WMCA 1O6IA 4ACZB 4AXNA 1HJWA 3EDDA 1JIBA 1JD7A 1C93A 1VAHA 3AXHA 5M5DA 3WQ5A 1GQLA 3BH4A 4CCEA 7A3HA 1A47A 1PEZA 1C90A 3RILA 3T08A 3WNMA 1X6LA 1C8QA 2FHCA 1MYRA 2ZUTA 3CBWA 1EDGA 1E1EA 3SUWA 1GOOA 3VDBA 1UQYA 4Q22A 2C8NA 3VGBA 1DWHM 3POHA 2V38A 3EDFA 3TOPA 3WSUA 1AQ0A 4HOXA 3N04A 4URIA 2YL5A 4DUVA 4P8VA 2ESCA 3BAXA 1TG7A 2V3GA 2G3MA 3ZJ6A 4BS0A 4DUXA 4HMEA 1GHRA 3RM8A 2ZX6A 2Y24A 3AZRA 3WQWA 2XVLA 1K9DA 3WH7A 4IISA 4KWUA 3VOCA 4KRUA 3CHFA 2J78A 4JL2A 1H1NA 1JXKA 1C8XA 1UKTA 3IJ9A 7TAAA 2Z1SA 3PTKA 3PZGA 4B15A 3FN9A 5BRQA 4DWSB 3AZSA 2WK2A 1F4HA 3K4DA 4ATLA 5JIWA 2OSYA 2ZIDA 4ZFMA 4M8UA 1E6RA 4WSKA 4UR9A 3IK2A 2GUYA 2J7HA 3N15A 3A6OA 3UCQA 1E0WA 2DT1A 1QHPA 1J0IA 4MJ4A 3RDKA 2G4FA 1B0IA 2BVTA 1ESWA 2PWHA 1V6WA 6A3HA 1KQYA 2Z1KA 1UR8A 4JCMA 1UWSA 1XYFA 3WD0A 4BQ5A 3CZGA 1KBKA 1R8LA 4E2OA 1CGUA 2DH3A 3VD9A 5JBDA 3RCNA 3WBAA 3ZOAA 4GI9A 4IPNB 3PZ9A 1EHNA 3TONA 1BFNA 1LQ0A 1XH0A 1B30A 1LWJA 1ITCA 3AS1A 4FMVA 5ABGA 1HNYA 1FFQA 5DEZA 1W9XA 2J7EA 3HMCA 1NM9A 3BGAA 3ALGA 3GH5A 5AYIA 4J3SA 1E6SM 3LMYA 1TVNA 4UOJA 1H0GA 3CIVA 3W6MA 5IFTA 1EDQA 3W25A 1H4PA 1ZBKA 2XFFA 4HZ7A 2V3EA 1HX0A 3RM4A 4J27A 3EMQA 1E70M 1M7XA 3VGDA 2J8GA 2ZWYA 4W87A 4PRWA 3N1AA 2J7FA 3GBEA 5A8PA 1E15A 3ZO9A 5FL0A 3VGFA 2PF0A 1W1YA 2FDMA 3B9AA 1CXIA 1ISZA 1L0PA 1V3IA 2GK1B 1JNDA 1HJVA 3WKZA 4PMOA 3AIEA 4QLLA 4AIEA 1VBRA 2WHLA 1R87A 4UZUA 1CENA 5I0DA 2XGIA 3TTOA 4OBRA 1MQQA 3DYPA 4MNKA 2X0YA 1CDGA 1V08A 2BHYA 4UQCA 1KCLA 2WM0A 3GH4A 3SUTA 1KGXA 1KGWA 1GZJA 3G6LA 2E9BA 3T09A 2UY4A 1NWSA 1JDAA 2FHBA 1FFRA 4PYSA 1OINA 2WKGA 2JFEX 5BXPA 4QLKA 1SFSA 4W86A 3AYSA 1QI4A 1CGYA 1I1XA 4HU0A 2X0HA 4UQ9A 1Q6DA 3PN8A 2RGLA 4J3VA 3WF0A 1QI2A 4RE3A 1V6UA 3K8KA 2D1ZA 2CBVA 1BYBA 3BMWA 4QAWA 3CPUA 3MO4A 4AZCB 3UR7A 3WQVA 4TVCA 2ZUNA 1UD6A 1JZ2A 1KXQA 3SCVA 6TAAA 1E72M 5IFPA 1GNXA 1LWHA 1B9ZA 1H09A 1PZ2A 2GJRA 5ABEA 3KE0A 3AXIA 3MU7A 1MQRA 3G6MA 1HJQA 5A6LA 3BAIA 1DWGM 1XSKA 3LPGA 3W37A 2FH6A 4WKFA 1HVXA 2G3JA 2D0HA 1UUQA 4FLQA 4Z2IA 4GKLA 1Z32X 5AC5A 1ZU8A 5M03A 2ZUWA 2E0PA 3ARXA 1GVYA 5A8QA 4B9YA 3W81A 1NH6A 3AS3A 3RIKA 1QBBA 4W7UA 2BV9A 2WC4A 1V3KA 5LA1A 1JG9A 4UOQA 3EDKA 2WC7A 2WLYA 4HPGA 1BAGA 2V3FA 1BSIA 4HU8A 2CNCA 5D8WA 4CD7A 3SCWA 1JNEA 5CXPA 1LJYA 3BAKA 4DUWA 1PIFA 2PB1A 3VIJA 3WDHA 1UH4A 3ZT6A 4QFUA 4QLJA 3OA5A 1DWAM 3VGHA 2D0FA 1KXVA 1HJUA 2VZSA 4M81A 2VR4A 2Y8KA 1BTCA 2BNJA 5LYRA 2QPUA 3NUKA 5I24A 4D6IA 1H5VA 1V0LA 1RD6A 2AMGA 2Y2WA 1PX4A 4PSRA 1CNVA 1NWRA 5ABHA 2BY0A 4CU7A 2XHYA 3WD3A 3S6TA 3VGEA 3ALFA 1XSJA 4RL3A 1AQMA 1UKSA 3DHUA 3VD3A 5F7UA 4PUDA 2XM2A 1XYZA 1OSEA 1UWTA 1V03A 5I23A 2WNWA 1V02A 2WB5A 1QI3A 3A3HA 1W9DM
chains in the Genus database with same CATH superfamily
4ZEPA 4ZB0A 3CWHA 1H63A 2POTA 2HNEA 2V67A 3HF3A 3W71A 4ATDA 4YPJA 1IYXA 1YDNA 5FAJA 2Z1WA 3BLPX 1XH1A 5C71A 4CVWA 2W27A 1TJRA 3OBKA 5BYWA 4O8RA 2ZUUA 2WJFA 4JXCA 1NEYA 1WDSA 2VC9A 1VBHA 2PWEA 2Z28A 3BLKA 4V27A 3DFNA 1PBGA 2DQXA 2O9TA 1FDZA 4DI9A 1F5ZA 4ECLA 2QNEA 1T0OA 5DRIA 4F2UA 1ZENA 3DFOA 3MHFA 4OVXA 1Q45A 3EWYA 5I00A 2WWDA 1B3WA 1W2VA 2Y7GA 4LYRA 1OY0A 2PP1A 4Z1DA 4IPJA 8XIAA 1KV8A 3W7MA 4R7OA 3M7WA 1VBJA 1V0KA 2BASA 2VX7A 2YA0A 2R9RA 4GXWA 3W85A 3LPPA 4RZ6A 4NHVA 4IMGA 5D37A 4PCSA 2PBOA 4PMUA 3RR1A 3PB2A 3T0BA 2YGYA 1TMLA 4GQBA 1CLXA 3RJYA 3VAVA 1B4KA 4LVFA 3MVTA 3BGJA 4MTVA 5CLTA 1TZ7A 5D2WA 4EP8C 3M5YA 4E4PA 3A4WA 4RK8A 4V33A 3XIMA 1Q7ZA 3BMVA 3OU8A 2CZFA 2CLIA 4RDWA 3N25A 2OWWA 3E9AA 3G1SA 5FIPA 1CB2A 5AVHA 2GGGA 1W3LA 4U4MA 2ZX8A 3TQKA 3N17A 1KV5A 4JDBA 5TIMA 1RXOB 1E73M 5I03A 8A3HA 3CV1A 3MI6A 4X2RA 4FR6A 5TNVA 3F5KA 3W2KA 3IGHX 3ZLGA 1QK0A 3OG2A 1MMFA 4U5KA 3BLFA 2W63A 3ITLA 3IARA 3L4VA 1OWQA 2QKFA 1GOQA 2VTFA 2ZZ7A 2ACRA 4RNHA 2WSRA 2XIQA 5BXSA 4H1ZA 1KLZA 1RBOB 4JIQA 3THDA 2WKJA 4IL0A 2ODOA 2ZZ3A 4HPHA 2ISFA 2D2HA 4I8YA 3U5UA 1KC7A 3IAQA 3SN1A 2A3EA 4ROPA 5KZDA 1XLJA 4JFSA 1H7NA 3OBEA 4P8UA 3NVDA 2O9RA 2Q02A 3L4XA 1IE7C 4IQJA 4KEZA 4IGHA 3VZZA 1NY1A 1J5SA 1E1CB 1TO3A 2JALA 2EEXA 3L0GA 3F4DA 1DTNA 1CLKA 2E40A 4PMVA 3VNYA 3RPDA 1K7EA 2HBVA 1FKXA 1GJUA 4CQBA 4H8HA 4UFJA 1KLYA 3CMFA 2DZAA 3ICJA 2OOGA 3S5OA 3TLQA 4I5RA 1XG4A 4JHZA 1XIFA 1TA3A 1OM0A 5TQLA 1JPDX 3GFZA 3GXFA 3O07A 1JF6A 1U22A 3CB8A 4JX5A 4C91A 2DZXA 1DXEA 1KFWA 4PEKA 3BVJA 1CXHA 4IGMA 3B0VC 1J0KA 4P7OA 3PFRA 1W3NA 5D9MA 2VGIA 1MW0A 4RX0A 4B92A 3WDPP 4GUJA 1J11A 1RY8A 3N19B 4AWTA 5BRPA 3HGJA 4ZOAA 3JZUA 2FGZA 4M7TA 3VU2A 4K7YA 5EMYA 4QRNA 3HG3A 2OVLA 1VRXA 2YXXA 2PI6A 4MZYA 2WYSA 3QF0A 4NZCA 1IZKA 5CCZA 3KVMA 3V0SA 3B0YA 3Q45A 2NX1A 3KWSA 2QHAA 3P84A 3F7JA 3VUPA 3DYMA 5REQB 2DUZA 2V5DA 1NDZA 2YR1A 4HIBA 3KS5A 3OVQA 4KRTA 3WMSA 4C7DA 2FGBA 4QJ4B 4U33A 5EFFA 2YCIX 1UD5A 1QVBA 1DQXA 1XD0A 1PHWA 2VCAA 4HKPA 1W5MA 1XJBA 2PLCA 3UWYA 3MWCA 2DZWA 1T99A 1W1B1 1VHCA 3VCCA 2WZIA 1E71M 5AC8A 3EA3A 3BURA 5BU9A 4PH6A 1RCQA 1LF1A 1PJ9A 1E6ZA 1OD8A 1SSDA 4LT9A 3IJ7A 5A5WA 3W1QA 1L8NA 1RV8A 2Q01A 2EG7A 3OZYA 1S39A 3QW4B 5K2ZA 5FCZA 3IJ6A 5DMNA 1LDCA 2Z2BA 1EIXA 2CETA 1BPLB 1OF8A 3VGGA 1TIMA 3H2AA 3VX1A 4D8AA 1AD1A 2EPMX 1VRDA 2UY2A 2YDAA 2VUYA 4DPQA 1GONA 1WV2A 4XX6A 1UR4A 4TQTA 3W88A 5FEWA 2YBUA 1X97A 1B54A 4AH7A 3MSYA 1WPCA 1Q13A 2BSLA 2WKLA 4XD4A 4AIOA 1WB0A 3W82A 2UBPC 1RA0A 5U7SA 1H50A 5BOFA 2P0OA 2YZRA 1U5HA 2WMGA 1FH9A 4IUOA 3ARVA 1CX9A 3S4TA 4GQRA 3PBYA 3IJLA 2YLLA 4O1DA 4F66A 2ZOXA 3RMJA 1UUOA 2C1GA 1P1MA 2HK0A 1FCVA 2FPTA 1EWDA 2XIIA 3A23A 2AKMA 2DW6A 2CESA 5EL1A 4LUYA 3WJSA 1OVDA 4LBUA 3O0FA 4M1RA 3P61A 1ZL1A 1K6WA 4D9PA 2ZZ6A 1WZKA 3MUY1 3WH6A 2PDXA 4KIEA 1A0DA 4FF5A 1EH9A 3WG6A 4LTSA 4AY1A 1U1HA 1Z48A 2BY1A 4O57A 3VTRA 1XIJA 2WZHA 2E6FA 3WD4A 4C6MA 4QE5A 1DKWA 1VF8A 1T7LA 1XLBA 2F61A 3LRKA 4C7GA 4PCPA 1OD0A 2O55A 2UV8G 1U5JA 1Y5XA 2RUSA 1SW7A 3W7RA 4HPXA 1E3ZA 4JEQA 5I79A 4BF7A 4XO6A 2V5JA 4LUTB 3FYYA 3CMJA 1ME9A 3P81A 2OEMA 2C15A 3VX0A 1MFVA 1DWIM 4H8NA 3I6RA 1BKSA 4C6DA 1G94A 2Z00A 1S2AA 1AZ2A 1GZGA 5I3JA 3NGFA 5D4YA 2GOUA 3PZOA 1OIMA 2I56A 3OLIA 1M68A 1J0YA 4IIDA 4HGXA 3QLLA 4K3ZA 3LGDA 2WSPA 3V5OA 3C5QA 1KM4A 1HGWA 3B4YA 2PD5A 2YCLB 2GK1A 2X09A 5A8MA 4JQ4A 3CZLA 5EMUA 1LLWA 3EKGA 5FF7A 2EPLX 2OWCA 1HG3A 3H4WA 2PUZA 4N2YA 2E9MA 3LI1A 3ZYZA 1W1IE 3C0JA 3QYSA 1XLHA 1AJ2A 4V2XA 1HVQA 1V7YA 3M0MA 4PEEA 4D8ZA 4GBDA 3SBFA 4GYJA 5HA7A 3IPWA 2HE8A 5EMMA 2DP3A 3H7UA 5HBFA 4KCUA 5A6KA 2CBUA 3GC4A 1ZS2A 4BZYA 3DX5A 1OYCA 4NNBA 2YCKX 3BJSA 5LA2A 1JUBA 1US2A 4ADUA 1E9IA 2J77A 1W91A 5E0CA 1UR3M 4HYWA 5MF5A 4EK7A 4OQVA 3S1VA 5EU9A 1KTBA 4ZO6A 2GDVA 3GXMA 2XPKA 2D3NA 2J7GA 5HWMA 5F2IA 2XFYA 4IFOA 4JIRA 4PUJA 5FA5A 2GWGA 3TC3A 3GDBA 1K8CA 3DG7A 1FWAC 4Y8EA 2QCDB 2HPMA 1MXDA 3VNDA 4AHPA 4BQ2A 2CLHA 2CEQA 4N42A 3DKJA 1R5YA 1KXTA 5H1WA 3QHMA 1MUCA 4O52A 4D8LA 2DH2A 1G1YA 3VDHA 4BI7A 3VDGA 1EBGA 5I77A 3W24A 4AZGA 1YADA 4E8CA 4EX4A 1W9VA 4GIAA 4DNHA 3LEPA 2NQ9A 2P1FA 3AICA 4G8TA 3LBMA 1C8YA 5IHRA 5A2CA 4I3GA 1LLOA 4IMAA 1XYCA 5ABFA 2C79A 2FZBA 2JK2A 1W9BM 2YL6A 4Y96A 4B3KA 3QY7A 1I75A 1JULA 1B57A 2FQIA 1SUXA 4MJZA 4L56A 1ZZMA 2Z2UA 1H1ZA 2NX3A 1PTGA 1RZMA 4N6FA 4L6HA 4JS3A 4B5UA 1MZRA 4GVGA 1J18A 3REQB 5KZMA 3GG1A 3WLMA 4UB9A 1UBSA 2QZRA 3H53A 4GUFA 1LL4A 3GK0A 1PE1A 4AISA 4ILSA 4NJJA 3E6EA 1UZ4A 3V0TA 1W1TA 5C9XA 2W9MA 1SSGA 1TPEA 4HBKA 3NEVA 1FWWA 3L23A 1AD4A 4TMCA 1O66A 3A24A 4PTXA 3EOEA 3LLFA 2HMCA 3L68A 1PB0A 5CPNA 1XKYA 3ABXA 4UNIA 4AAJA 1XLIA 1UUMA 1C92A 4AD2A 3CLWA 4AIBA 5K4ZA 1RA5A 3VNJA 3NDZA 2FGLA 5CZJA 2E5BA 3CZ8A 3PBVA 3B40A 4W4QA 4L61A 3I7RA 4XSMA 3KRZA 4LNCA 3MTWA 5I06A 2QCLA 4TV6A 6XIMA 2YIHA 4HPJA 2G95A 4LV9A 1XLLA 3TNBA 2ACSA 1MVYA 2WC3A 3KHJA 4GWEA 3BSHA 2W3ZA 3HQNA 4C5ZA 3QKZA 2VQTA 4O15A 2ZQ0A 3EOUA 4J9JA 3GU2A 1HF6A 3CUFA 4AZIA 3LPFA 3CB3A 3UXKA 4LWWA 4HVXA 4KGLA 4PA8A 2BHUA 5BZAA 4R88A 1XIBA 3N2TA 1JYVA 1EGVA 1WE5A 3I3BA 1R7AA 3VI2A 2VELA 1EJSC 2QJIA 2Y5JA 3B8TA 4LY8A 1JAEA 1EFZA 2PDKA 1R3YA 4BQ3A 1K9TA 3W7GA 4L65A 1H2JA 4GZIA 2VURA 4DIAA 3S6DA 1XX1A 3LHVA 1FWTA 3PPHA 1QAPA 1JCMP 1IXOA 3S5YA 5DT5A 2VQUA 3LPOA 3DZ1A 5D2TA 1L6SA 2WPBA 3OVPA 1A3HA 1TSIA 1P6WA 2GWNA 3VIIA 3ABSA 2PDHA 1VFHA 3DH7A 4CNUA 1NQ6A 1XLFA 2WSQA 4AG0A 2YZ5A 2WBKA 1JGMA 3ATZA 4A22A 1HGYA 1UWIA 2FMNA 1MNSA 1M9HA 3URAA 2QT3A 1MSSA 1GHSA 1XIMA 4BWLA 1RY0A 3C61A 4N9DA 1MDLA 4NG3A 3ZR6A 3PBMA 2INEA 3NPVA 4HSHA 4M1BA 1TZZA 5LNWA 3M0XA 1AODA 1NWTA 3R11A 4B5SA 5A6TC 4JZ5A 1W1ZA 4OGZA 5FSDC 3VOGA 2Q8XA 2QUTA 5HJYA 3HA1A 4ZO7A 2HBXA 4KKXA 4MYAA 3WUEA 2YFOA 3H12A 3PPGA 2D0GA 3AYTA 1QNOA 4B5XA 1X6NA 1H7WA 1G01A 2WXDM 3R0KA 1O60A 1ZBWA 4MJMA 1G4PA 5A94A 3TV8A 1FWIC 4CN4A 1NWUA 1YW1A 4PGLA 8XIMA 1YQ2A 2XINA 2G3NA 4A35A 3LI0A 3POCA 4PB3A 3H7VA 1CPUA 3EWXA 5CGTA 1S5MA 1DJYA 4KWVA 1B4EA 3GUGA 3KDNA 1SR0A 3L65A 1PWLA 2G41A 4JTIA 4LVBA 4EPKA 1WNOA 3R0UA 1EUNA 2DQWA 3B8SA 1FP9A 4DWSD 1QW9A 2RGMA 1YNYA 4AVFA 2TODA 3NSNA 2HDJA 2QW5A 5D9NA 5SWUA 1GKPA 3CL6A 4BWLC 1JPIA 5DY3A 1TV8A 4US5D 1Q4NX 3NQVA 4OWGA 1Z8AA 3PZTA 4QG6A 4ZQOA 4QCEA 1W5QA 1G69A 2QV4A 3CQ0A 3EKLA 3FAXA 2YA1A 5DT7A 1PX8A 2WCAA 3ITCA 1DL3A 1XYMA 2ADAA 1TB3A 4PCNA 3FHQA 3S5ZA 4I9MA 4MADA 1K9FA 1RQBA 3S47A 4IT1A 1U5VA 3EX2A 4ZO8A 3PC0A 3BLIA 2B7PA 4NJGA 1XHGA 1Q4WA 1SJDA 3ARTA 3RLHA 3URQA 4D6CA 1F8IA 2EQDA 4S3AA 3E0IA 3ABZA 3B9DA 3SUVA 1W1PA 3MUAA 3GE7A 4OE7A 1TR9A 2BOEX 1NF0A 4AF0A 4GUGA 3P93A 3WLOA 3ABOA 1QOPA 4MVAA 3H55A 4I8DA 4Q7BA 1JYWA 5CPOA 4L4MA 4HHHA 3TYDA 1JDFA 4KQNA 2H9AB 4GO9A 5LA0A 3RXZA 1EDTA 5H6HA 4KERA 1P0DA 4DZAA 3VMPA 4UQBA 1FWBC 1K8XA 4AY7A 3UEQA 1IZJA 2FB3A 3C0SA 3O63A 1KM1A 4IQEA 5TAOA 1SMAA 1K77A 1XG3A 2CCRA 3OIHA 1OC7A 1EXPA 3B4UA 2XGBA 2VUNA 1U30A 2PP3A 5KZ6A 1EJVC 1MXSA 4MUPA 2BY3A 3LXBA 5A2BA 3K13A 4NF7A 5E5CA 2VXNA 5A95A 4M24A 5CJMA 3MC5A 1V3MA 3GNOA 4B3ZA 3PWGA 4MWAD 4O0ZA 3W1XA 3SR7A 4GCXA 1LG1A 3MMDA 2PZ0A 2CWXA 1W3JA 3QPYA 1FH7A 4E0CA 1W6TA 3O06A 4AZCA 4JYFA 4U5IA 2R1NA 2IKHA 3IIOA 4A3HA 2QGYA 1QNVA 4GZEA 3MI2A 3DG6A 2J9ZA 2BXVA 3U2OA 1ZHAA 4C1NA 4B5TA 1PL9A 4GXPA 3SECA 3VNZA 3OHMB 2XUCA 4FAMA 3KBWA 1UP0A 3BE7A 1NFBA 2QMJA 2VEIA 3BAWA 3CAQA 4PMYA 1WX0A 2FJUB 1RLCL 2C7FA 4C6QA 3WENA 4J5NA 2V5KA 4L1GA 5CZKA 1WOAA 4QG9A 1ZBCA 3ELFA 1I2NA 3C2YA 3O9NA 5DO8A 4LS1A 3ARQA 4CQAA 1E6XM 4GJIA 5F2LA 3NIYA 3BJTA 2OZ8A 3NSXA 1UIOA 2C14A 3L2IA 3M5ZA 1M5WA 5C0QA 4AX7A 4E38A 1DYSA 1HTIA 1VCFA 2WANA 1TELA 2C19A 3NDOA 3CGTA 3SGUA 3HGOA 4Z2LA 2PDWA 1VH7A 3MKCA 3FYOA 4C6PA 3G0XA 2QCFA 3IJ8A 2FH8A 3AJ7A 1GVRA 1ITUA 2A21A 2AKZA 2WVVB 3E02A 4GIYA 4F9DA 1LL6A 2VT0A 3FGCA 4RZ4A 1WZAA 4MFEA 1NAL1 4DI8A 2BHZA 2FFCA 4J1OA 1ZCCA 4JYEA 4HQVA 4C6LA 4UCGA 3TLLA 1X1OA 2E6YA 2DDXA 1MZHA 3A9IA 5BWFA 4HA4A 3CHDA 1US0A 5M1TA 4IGNA 3TUUA 1KCZA 2E1WA 2VR5A 4E2DA 1P48A 2OXNA 3IJIA 1UP3A 3AMGA 4I90A 1P0NA 1WZLA 3VA8A 3EA1A 1NOFA 2WHJA 3WDQA 3OLGA 2DT2A 4GGBA 2I5QA 3LXAA 3EWDA 5XIMA 4XUGA 3WQ6A 1XIIA 4PULA 3M41A 1ZB5A 2CLKA 1Q66A 4AZ6A 2O92A 3CWOX 2FTPA 4E4UA 3CAKA 3UU0A 4GFIA 2WMHA 1TWWA 4AC1X 4AZ7A 1JI1A 3W7JA 2XDFA 4TX6A 6XIAA 5HJXA 1NQKA 2YYUA 5M5DA 3V36A 3WQ5A 3BH4A 3N73A 1A47A 1MNZA 2E67A 1O68A 1PEZA 3RILA 4WXZA 2CWNA 4NASA 1GOOA 4BR1A 4NJIA 1EWEA 4IG2A 5LHFA 5CAHA 2CW6A 3TOPA 3V4BA 3MBFA 4HOXA 5HQEA 3NPWA 1KW1A 4J35A 1A4MA 3TWBA 4DUVA 4A05A 4P8VA 3W87A 3BAXA 4DJDA 4GLEA 3ZJ6A 4GH3A 4HHPA 4GY0A 3R13A 4E2VA 1WBJA 4Q4PA 4HMEA 1GHRA 2ZX6A 4RPPA 3KOYA 3MUXA 3AZRA 3V75A 3KS6A 1KFLA 2XVLA 5G1MA 3WH7A 3CHFA 1V6TA 2ONEA 4JL2A 3WBYA 1UKTA 2EKGA 2QJHA 1XLDA 4MSSA 2CC0A 3LB0A 2A6NA 2ISVA 3PG9A 5AHIA 2ZC1A 1F4HA 1W5PA 3K4DA 1VCGA 5LIKX 2OSYA 4Q8VA 3GC2A 4R9OA 1IF2A 4M8UA 3C4UA 3UJRA 1POKA 1XGDA 2PF8A 3NO5A 1W3IA 3OQ8A 3WLTA 1E0WA 1V4YA 4L1WA 1QHPA 3MBDA 1O5RA 1OCBA 2V68A 3C2EA 3RUBL 1P4CA 3U2ZA 3H21A 1PHQA 3GNDA 6A3HA 1KQYA 3S46A 3EXSA 1DJNA 3GDKA 4E2OA 3TKFA 4AU0A 1L6FA 1OX5A 3ZOAA 2EG6A 4GI9A 1NVMA 4Q3MA 2HROA 1B30A 2J6VA 3NL5A 3KRBA 2J7EA 4MKNA 3WQCA 2EGZA 3B9NA 4DJFD 3RRAA 1E6SM 1BXNA 3P3BA 3PUEA 1KM0A 1RALA 3LLXA 3P0XA 4Y9PA 4QDPA 1ZBKA 1HX0A 3TQ0A 1M7XA 3VGDA 4O8AA 3TYCA 1E51A 4ZQNA 2GLKA 1P5BA 1PZ0A 4GYFA 1ADOA 1XYBA 1YKWA 2PF0A 4QNEA 2FDMA 3V5CA 4PMOA 2ZZ5A 3AIEA 3LCLA 4Q8UA 4AIEA 1VBRA 1MEHA 4UTJA 4QX4A 1R87A 3DGBA 1POJA 2Q3OA 1YNQA 2XGIA 4E3TA 2FB2A 1PTAA 3TTOA 4NAEA 1MQQA 2ZYFA 5FF2A 3W7PA 4UQCA 3SUTA 1KGXA 3FJNA 5MHBA 3O7UA 4KETA 2XH7A 2BOGX 1TQXA 4B90A 1B9BA 3T09A 4UTWA 4Y9MA 4AHQA 3LSBA 4Z17A 4H9YA 1FFRA 4PYSA 1OINA 1VYPX 2VC6A 2JFEX 3GFYA 4LC6A 4QLKA 3LX9A 3SFWA 1RR2A 1OZMA 5DELA 1I1XA 4UIOA 2FPVA 3MA8A 4UQ9A 4Y8FA 3B9OA 3WF0A 2D1ZA 2CBVA 3GR7A 1FDJA 1R9ZA 2QJGA 1EC7A 5GJMA 5REQA 2ZA2A 3MO4A 3WQVA 2AQWA 2ZUNA 3R58A 1ZTVA 4KW2A 5D38A 3N2BA 4XBJA 1GGOA 4FNSA 4RV8A 1E72M 1B9ZA 1PZ2A 5ABEA 2IS7A 1M7PA 1D7KA 1A0CA 3MU7A 3SY1A 4DJED 5A6LA 1R30A 1XSKA 2G3JA 3AWOA 4K8EA 4Z2IA 3CASA 4QROA 4B5NA 2X16A 5AC5A 1AL8A 2ZUWA 4DQWA 3NM3A 1HUVA 4A21A 1ZP3A 2R1MA 4TU1A 1GVSA 1V79A 4AQLA 1S2WA 2CLFA 4O14A 1LRQA 3AS3A 4G56A 4ZR8A 2BV9A 1NU5A 4UOQA 4UTWC 1FHVA 2Z7KA 3UPWA 1FWCC 3SZ8A 4NXKA 4HU8A 2CNCA 3UA4A 3KRUA 2LLEA 4CD7A 1JR1A 2A3LA 4DUWA 1BWKA 3USZA 3R4IA 2A7RA 4KEVA 4QG8A 5JH1A 1ZNNA 2WJDA 1DJGA 4H83A 1DWAM 3VGHA 4DVOA 1HJUA 1XFCA 3JRKA 3RR4A 1I6NA 2UZ9A 1GEHA 5LYRA 4K36A 1RBAA 4FXJA 1RD6A 4PSRA 1PX4A 1R3VA 2G37A 4CU7A 4S3EA 3WD3A 1REQA 3G0SA 1UIPA 4CNPA 4RL3A 4L4LA 1KRAC 3LM7A 1UC4A 4C6NA 3DHUA 3VD3A 1OSEA 3U3HA 2GGJA 3BZGA 5I23A 1ONWA 1W9DM 3R10A 3I7QA 4YWSA 4J3XA 3PM6A 3K46A 4IXHA 3W6YA 5EPDA 1XBXA 1FWDC 3U8GA 1FWNA 4LCQA 2ABAA 4HHLA 1J0ZA 3WZ0E 5M3WA 1RPXA 4JYDA 4TO8A 3FDGA 1EOMA 3PZUA 4WDTA 5FEPA 3O6CA 3WNLA 3H54A 5A8NA 2D2GA 3R2GA 3UWUA 4D6GA 1YBQB 1VFMA 1J6OA 3GD6A 4F0RA 2GDQA 1RP8A 1DIOA 1ZQ5A 3WL1A 2PPGA 3R12A 2ATSA 1ITQA 1MW1A 1ECEA 4S3GA 3LHTA 1EX5A 2YL9A 2DUXA 4XAGA 3AAMA 3KOXA 1GOIA 1W9UA 3OW1A 3ZR4A 3I4EA 4JY8A 2E3ZA 1BG9A 3VO0A 3FVDA 3H70A 2Z1VA 1HL2A 4UR8A 4Y6GA 3U0HA 2RAGA 3UERA 4LNYA 3PS7A 2DPEA 4LUTA 3ZMRA 1G4SA 5HATA 4QR6A 1U1UA 2AQVA 1LRTA 1VFLA 2DVTA 1C7SA 3STCA 3WLHA 4NT0A 1YXCA 4NVTA 3LXCA 3TR2A 3W07A 3TW6A 4A2SA 4JIEA 1HQTA 3PBGA 1KBBA 3R0DA 3GNXA 3QQ0A 1EO5A 3TR9A 4C60A 3V18A 4NILA 3C3NA 2YCLA 2CBJA 1HP4A 5A1AA 5AY7A 2DV0A 4TIMA 2HJPA 3AO0A 2BY2A 4PODA 4IFRA 4QE1A 3LD5A 4C6KA 3NQ2A 5C9ZA 2X1SA 3PF3A 1MWOA 2XN0A 1PPIA 5C9RA 4LSBA 3N18A 1J0JA 1PX3A 4G7EB 2VDIA 3JUGA 1PKYA 2OSXA 2ZICA 5CPTA 4XAPA 1I2OA 2EPOA 3RN6A 2YKKA 4P7QA 5CPLA 3CWNA 4CEXC 4KGJA 2CITA 3PP7A 1XGZA 4JHOA 3G1DA 4V1YA 5J8LA 3FCPA 1VKFA 3SCSA 2YSWA 3THCA 5D04C 2BOFX 5KSWA 2EPNA 3YPIA 4MB1A 2WLZA 3DHPA 5GNXA 4XO7A 1EGZA 2Q8ZA 5DXXA 1GKRA 4LCSA 3WNKA 4WQ6A 2ZWZA 1UJQA 4UFLA 2HZGA 1MDRA 3S2MA 3TTQA 3JR2A 4H2CA 2D20A 3IUDA 4LAOA 5D09A 1H51A 2ZTKA 3KHDA 1D3HA 3G0UA 3WJYA 3A4JA 1H61A 4H00A 1LBLA 3N2OA 2QCDA 5D2YA 4UTTA 3LBOA 1C9DA 4ZQCA 3AXKA 2I57A 4I7VA 3B8UA 4OJYA 3KUMA 3STEA 1LG2A 4FXFA 1E1FA 3UD6A 4L1XA 1TX0A 2WMJA 1DWFM 4H3DA 1Z42A 3HU7A 1F07A 2WZTA 4YMZA 3UBPC 3KOFA 2WQPA 2P5NA 3G22A 4D1JA 3E38A 4AW7A 4DBUA 4QJ3B 1W56A 3E2VA 4LB4A 5HOSA 3OJGA 4IPLA 3WL0A 3QOKA 4PE8A 3GZ3A 4UTMA 1QJWA 2DY3A 4PTMA 3EA2A 2QUNA 3M6DA 1J2BA 3GYEA 3EB2A 1KRBC 1DOSA 5CBBA 4O18A 2AGKA 2HISA 2PWVA 4FIQA 4WXYA 1JZ7A 3MB9A 2HVNA 2XFWA 4DF0A 1NTHA 3SCQA 3VMOA 4D71A 5C8BB 1XLAA 1M04A 3L12A 1EJXC 1X7FA 3U57A 9XIAA 2ZRXA 3DFHA 3I4KA 4QISA 4PTVA 1XXXA 3ZWSA 3VUSA 5AFDA 2FTWA 1GVOA 5CG0A 3R79A 3TYAA 1K7XA 1EIBA 3PZIA 4O0KA 3C2FA 5DANA 2WW5A 5H91A 3AIBA 1BXBA 4FZIA 3RYSA 1RP9A 3AALA 4Y2WA 2V63A 3ISIX 4LJ3A 3KTSA 3GS6A 5EBUA 3IVTA 2PDIA 3MZNA 4YXGA 4MLRA 4S23A 3NJ3A 2OZ3A 3C8NA 1JFHA 3SN0A 1EP1A 4K8HA 1I2PA 1JYXA 2V5LA 3AQUA 4JFWA 3NQBA 3TDFA 1Y65A 4IFKA 2NZLA 2A4AA 3BAYA 3SRFA 3FSTA 3TN5A 1G0CA 3WLNA 4JTFA 2B0MA 3W74A 3ES8A 3HQPA 1A49A 2ZADA 4RXFA 3SUSA 1NP0A 4ACZA 5J5RA 4DO4A 3CK5A 3WBEA 5T8GA 1LT7A 3OTRA 3LY0A 1LM1A 1EP2A 5D2VA 4PBGA 3AMCA 3B8DA 1S2TA 5LXXA 2NQHA 2QDEA 4XZMX 4E8DA 5EYWA 1UKOA 2WHMA 1GVEA 1HJSA 4HZ8A 1YNPA 7REQA 1TPUA 1CIUA 1H1YA 3U4FA 1X8FA 2BWGA 3M64A 4KH2A 3EDJA 1W3TA 4MAZA 1PYFA 4NZ5A 3UETA 1IQ8A 4DAIA 4QM1A 4D6FA 5I3DA 4WOZA 1M1BA 4CCCA 1ME8A 4TUFA 3PUOA 5HNUA 3SQLA 4MWAB 1XRTA 2JF7A 1EYEA 3VIPA 4UOZA 1SFTA 2ALDA 4LH8A 2PTWA 4R7WA 2OCZA 2X2GA 2OX1A 3FA3A 3BSMA 1DXIA 4YYFA 4S3CA 3M0IA 1UR0A 3OB8A 4DWSA 9CGTA 2G8ZA 1M03A 1B2YA 4MUZA 3URNA 2H8ZA 4J2MA 3SM0A 1J0HA 1KQZA 1QPNA 3SUUA 4EXBA 4JKMA 5K7JA 2F6XA 4C6BA 1GZ1A 4W84A 3MSGA 4W5ZA 3C86A 4LUJA 3A5FA 4ZSUA 1J79A 2HSAA 4W93A 1HZYA 3SY8A 1OCJA 4J3UA 4X0NA 2HWGA 1WXYA 4Q7IA 4PMXA 4UTUA 3UNDA 4V28A 4LW7A 1SMDA 1JZ8A 5BNKA 3NAVA 1QNQA 1KCKA 5E0FA 1TTIA 3S8HA 5C2XA 2D73A 1DV7A 4HZ6A 1WKDA 1ZLPA 3T8QA 1PVNA 5LIYX 4GUIA 2HXUA 4R33A 1OQFA 3T44A 4I9AA 3EXRA 1IIGA 4MF4A 2OTDA 2DFAA 3ZJ8A 4REQA 3MJMA 4IX0A 1F4AA 1UR9A 4GBUA 4FB7A 1B3YA 5FOOA 2ZXQA 3ZWTA 2EAWA 1OFPA 5A3HA 3P60A 1HXJA 3AXMA 2YYTA 3M0ZA 3Q58A 2OX4A 2JGYA 4BQ4A 2PTYA 3T8LA 1VJSA 1KCXA 5BXTA 2BGQA 1HIZA 2CBIA 3BOFA 2I1OA 5CPQA 2XJ7A 3WNPA 4IP5A 3UG3A 3ARYA 3LMZA 4NY2A 3ZT7A 4C90A 2HV5A 4DWSC 5E1QA 2GJXB 1AG1O 3LCHA 2A0NA 4XD6A 1QT1A 1ZPTA 3M1ZA 3E1F1 1UA3A 4GYKA 3CTTA 1OB0A 4WOQA 4PB5A 3LTYA 4H9UA 2AOSA 4LGXA 4H6RA 3DESA 3AHTA 1LROA 4MAVA 4LFYA 2ZX7A 4TV5A 3WLRA 2VEFA 3C2OA 1U83A 1QATA 3EOOA 1MO0A 3RCMA 3E0LA 5BWAA 2QYGA 2VX5A 4YVVA 3OYXA 4I6KA 4AIUA 3UF9A 1TCDA 1OX4B 2I17A 4HOZA 2NV9A 1JPMA 1K02A 1IGSA 5I5RA 2YFNA 3NOYA 2GGIA 1BF6A 4GK8A 3NL3A 5A2AA 1AMYA 1E9LA 3N29A 3GFXA 3P5YA 3HPFA 1ECQA 3OGRA 3WDJA 1KKOA 3KBJA 4IIHA 3FKKA 1GVQA 3R8RA 1G4TA 1HJXA 3TSDA 3NXLA 3VOJA 4PBFA 1R47A 1XH2A 1NFPA 3M0LA 1LL7A 1OFRA 2DT0A 2CZEA 3ZIZA 1XINA 4ALDA 3ZR5A 3GAYA 3KBSA 5CJNA 4Z2KA 3DAQA 5JQ9A 3WNNA 1YX1A 5HUPA 3EB3A 3I6EA 3W83A 4CN6A 1XV8A 1UWUA 1DQUA 1UZ1A 2IPFA 3PJXA 3AYRA 3N11A 4IJCA 1Q6FA 3N13A 6REQA 1MW2A 2ZUVA 3TA9A 4P8WA 2V5CA 4HNCA 1KTNA 3I3EA 2DJLA 3UT0A 1QPRA 2CHRA 2GDUA 2GSJA 2NQZA 4EE9A 5E6YA 4YS1A 3TAOA 1VFFA 3QSRA 1YTDA 4H4IA 4H9VA 3NURA 1MXGA 3UZWA 2HXTA 4TTUA 2BODX 2Z25A 4MWAC 2JBMA 3ABQA 1BYCA 1OK4A 1F3WA 4S3BA 2E25A 4WY0B 1XRSA 1MRAA 2EPHA 4DF2A 1TPB1 2RJGA 1RJRA 3T07A 5A6MA 1PIGA 4UC5A 3N9KA 1OFAA 1TE1A 2VFDA 2W66A 3WNOA 1E5NA 2DZTA 3HJEA 4QIUA 2ZDRA 2XU2A 3WF4A 3GU1A 1BVNP 1S1RA 4XV0A 5CGMA 1RJQA 4XTIA 1N55A 3NVTA 4CQ8A 1TV5A 1ICQA 1CBGA 3BOXA 2J9XA 2A5HA 4LYKA 4NU7A 2QCEA 3BZJA 1SR9A 1RD5A 4WHBA 3UG5A 5CBIA 3OBAA 4NZFA 3EWBX 4F8XA 1QNPA 3U4AA 4BY3A 4PMQA 2GFTA 3RX4A 3N34A 4Q4QA 3W23A 3SN4A 3W73A 1Z3NA 3A64A 3WY1A 3A21A 1RUSA 2FYMA 2VZUA 4LX4A 2IKGA 3FYPA 3LRLA 4A2RA 2DVUA 3ARUA 1S1PA 4QCFA 1SFLA 3UVIA 4I6VA 2OYMA 3OYZA 5BROA 4H6EA 4NYYA 4ZCWA 3UW6A 4GVFA 3TTSA 4F3HA 1AQHA 1EA0A 4IIGA 5PTDA 4HA1A 3MW7A 2J62A 4IIBA 1VLWA 1IXPA 2Y8UA 5JXQA 4QXIA 5FJRA 2V30A 3IUHA 4MKSA 4JTTA 3H24A 3NM1A 4LCRA 3BO9A 2Y1HA 3QHNA 2I7GA 2OPJA 4W85A 1IR2A 2WVVA 4BCEA 2HVMA 1Q5MA 4WDWA 3U6WA 4G2DA 4AHOA 2Y63A 3NGJA 1CYGA 3BWWA 1O4UA 5I09A 1WDRA 4UTFA 2E6DA 4IF2A 4AZHA 3PSWA 3P8IA 2AL2A 4HN4A 1FY6A 1WOBA 4Z0SA 4JAWA 1RVKA 1OEPA 5AC6A 2ZFAA 3CV6A 1GW9A 1E5JA 3HM7A 2F38A 4W8BA 4HK5A 4EANA 1OCQA 2ZXBA 4G6CA 4GX8A 3ZS4A 4XD3A 3NA8A 3V35A 1RQHA 1EQPA 1L2UA 2PDCA 4NZJA 2WM1A 1M53A 2YOCA 4N4PA 3TK7A 2H8XA 4HNTA 3BV7A 5A8GA 2PDGA 1AW1A 2R14A 4E4FA 2E8YA 2E8ZA 3UPMA 3BK0A 1F8MA 2WWCA 2CLLA 4NYUA 3WEOA 1VBUA 3ITGA 7CGTA 1E0TA 4UQDA 1IWAA 5HULA 3EEZA 4KCVA 1AFSA 3UVAA 1SGJA 3G24A 4UMBA 3VIOA 3PZNA 2QCGA 2BDQA 5J04A 4NAFA 4WEVX 2BG5A 3W7OA 3CYVA 4C6FA 3NPXA 5C6MA 4DWDA 4QTGA 1DIEA 2PCEA 4XAFA 5AC4A 3WLIA 5D03A 2HVOA 3QN3A 2QIIA 1HKJA 2XG9A 2UWFA 4IICA 5CBJA 4IPPA 1V3HA 3VKKA 3DFQA 3SADA 5DXYA 5XINA 5JMUA 1J4EA 5AVNA 3THQA 2UY3A 3BCDA 4TOQA 1ADDA 5I6SA 3W2MA 1IHIA 3TW9A 3VE7A 4MB3A 2NQJA 1PWMA 3NEHA 3AJXA 1Z6KA 4CD4A 2BBFA 1TVPA 2YJQA 4M6UA 2Z7GA 4AX6A 3C2VA 3MV11 4L6DA 1D3GA 2VJXA 4ERAA 4O4WA 3IK4A 1J6PA 4KWSA 2R1LA 4O13A 1FQ0A 3T2OA 3AS0A 4XUYA 1SW3A 1Q85A 1GORA 2A2IA 4HMCA 5HANA 4DJFC 5I3HA 1CXLA 4TMBA 5K3VA 3T78A 2BVWA 3ZVIA 3LLDA 1WCGA 3MMWA 2XIMA 4GQGA 1EEPA 5G1TA 2OT1A 4NNCA 4F9JA 1OGSA 1KA9F 3LNMA 2ZKMX 1E0XA 4A8NA 2D2OA 3EDEA 5GQBA 3NFUA 2F2HA 3W72A 5C5YA 4TX8A 1I0DA 3SSJA 1FWGC 5T9CE 4YL2A 4U3CA 1MW3A 5EKYA 1Q7MA 4OOUA 3TEVA 3DFPA 5DCBA 4ADTA 5JBEA 2F8QA 3WX7A 3SB0A 2Z1XA 2X8RA 3QM3A 1HKKA 1W17A 4GIEA 3T7VA 3A9BA 2GQ3A 3WQ4A 3SO7A 2PMQA 3RO8A 1CGVA 3KM8A 2ZUSA 3C2RA 3UXDA 4KFNA 4JIIX 2CXEA 2IKJA 1TZ9A 4GJJA 5D2XA 2P88A 4WX2A 3F4VA 3VABA 1HL8A 4HA0A 3U7BA 1YTEA 2NVDA 4CD5A 1FOBA 4OUIA 3L2MA 1DJIA 3JZEA 4RV3A 2Z6IA 4W8LA 1TWDA 1ISXA 4ZXOA 3L4ZA 1EB3A 4DNMA 4JNYA 1CGWA 3IV8A 4UFIA 2QCHA 2OLHA 3TFCA 1DBTA 3NPUA 1XP3A 2FMOA 3BPWA 4R9XA 5DBUA 2O7SA 4AEEA 1X1ZA 3SJ3A 3IAPA 2AAMA 2ISWA 2WCGA 1BF2A 1A4LA 2A3CA 1JQXA 4O1FA 3QPEA 1VHNA 4R5EA 3OVRA 3FY1A 3GVVA 3GG0A 4BEUA 1UB3A 4UCFA 5EMKA 1QMLA 3ITVA 1PXGA 3T05A 4DJEC 3LK6A 4GQQA 4O4VA 1ICPA 3O2LA 5LZLA 1H3GA 4H04A 5HNTA 4PUWA 3HN3A 1G7VA 1TMHA 3GZAA 3UWQA 1S2CA 2IUZA 3W0KA 4Z08A 2EKCA 1FH8A 4IP4A 1MFUA 3OGVA 3S2LA 1FP8A 1JZ6A 4CD6A 4FLSA 4MB5A 3A5VA 1HN1A 1KRCC 1QI5A 2ZTJA 5FF0A 2Q3RA 2XVKA 3KRSA 2BXZA 3IEBA 5HINA 3P62A 1QBAA 5FESA 3IVSA 4WJXA 3KCJA 3G1AA 2PCQA 3AROA 4UFKA 4XKMA 4OOZA 3BG3A 1D2KA 2BP1A 3LCWA 3KCOA 1BQCA 1I9CB 4ENLA 4YVPA 3F5LA 4O50A 4FOUA 4M82A 3M0KA 2Y89A 4X60A 3CH9A 5E70A 2HTMA 3GR8A 2P50A 1TA3B 2VFEA 1TPC1 1Q2RA 2VFIA 1NF7A 1K03A 3CLMA 4DM2A 4GUHA 4MGGA 3FXYA 3R8HA 3SCRA 1NP2A 1E40A 3TXZA 5D9OA 4UMCA 2O4MA 2YL8A 3M44A 4LXFA 1WXZA 3SAZA 3CV2A 1IIHA 3LHUA 3DC8A 3AISA 3BW4A 1ZJBA 3BG5A 1C3FA 1LOQA 2DEPA 2TMDA 1YXDA 5EA9A 2GQ8A 3CQKA 3JW7A 3PNZA 1LZOA 1QHOA 3S1WA 2QMKA 1SZEA 1GW1A 2OB3A 3LCIA 4IIEA 4GHRA 3HG4A 2GJLA 1HKMA 4Y9OA 3QXBA 5JBFA 4D6HA 2MANA 4ZE4A 1QI0A 4HMDA 2VP8A 1AJ0A 3EPMA 2W4XA 5HR6A 3O3RA 3J7HA 3ZVHA 3VOHA 3TN3A 1ZAHA 4PFHA 5A69A 1M65A 1QR7A 1PAMA 1C7TA 3WIJA 4H2HA 3QYQA 3HGSA 1I2RA 4OECA 4FNTA 4OHQA 2P8BA 5LNUA 2Y6ZA 1RCOB 4D6JA 1W2PA 4OUEA 1HJWA 3EDDA 1JIBA 3PVFA 1JD7A 1C93A 3D6NA 5DLCA 5K4XA 4EXAA 1GQLA 1YBQA 4CCEA 1QPOA 1YDOA 2A7NA 3T08A 2A7PA 1C8QA 2ZUTA 3CBWA 4JQAA 4JX6A 2NUWA 3E5PA 3VDBA 3CIWA 3VC5A 3W9ZA 4BEQA 2H3DA 3CNYA 4F0KA 5LGZA 2C8NA 5EY5A 2ALRA 4V1XA 3EDFA 1GJPA 3LNPA 4OT7A 5E9XA 2GOKA 3MUCA 2V3GA 4PB4A 2IPGA 4D2JA 4PR4A 4L80A 1UMLA 4DUXA 4DJDD 4YVXA 3GTIA 1DIDA 3C52A 4KWOA 3N2XA 3QY8A 2Y24A 1A5LC 4KWUA 4ZODA 1H1NA 3DN5A 1KNWA 4JTLA 2PDFA 3W1MA 1A80A 2Z1SA 4JN7A 3EPOA 4Q4RA 3PZGA 4B15A 4CNSA 4LVDA 4HB7A 4Q4MA 3S3GA 5DQPA 2I14A 4ZFCA 5I3GA 4A3QA 1SJAA 4R7JA 3N15A 3KOZA 3MP4A 1KRMA 4A8LA 2CLMA 3FKRA 2QV5A 3BOLA 1J0IA 1B0IA 2BVTA 1VD6A 1ESWA 3TOYA 3WJZA 4GE8A 2G4JA 3W75A 2Z1KA 5DCDA 4JCMA 4LBRA 4DXVA 1XYFA 4BQ5A 2C1IA 3IVUA 1EC8A 1CGUA 3VD9A 5JBDA 4C6OA 4N9EA 4IPNB 3GTXA 3LU2A 1EGMA 2JKAA 1EHNA 4GVIA 1XH0A 2ZZ1A 3QGKC 3LN3A 8RUCA 3KOWA 1THFD 1W9XA 2QF7A 2Y7FA 3ALGA 3A12A 3L5LA 3LMYA 5M2FX 4UOJA 1H0GA 3W3OA 3IJDA 3CIVA 5IFTA 4Q8TA 1OFOA 2VWTA 2XFFA 2TSYA 3M0VA 4CNNA 3RM4A 4J27A 1E70M 4YTQA 3VKBA 2J8GA 2ZWYA 5FEXA 1XBYA 4JEJA 2X40A 2NQLA 5A8PA 3B06A 3VGFA 2VFHA 1TTJA 1L6YA 2GUUA 2XH0A 3B9AA 1CXIA 1ZAIA 9RUBA 1L0PA 3UXAA 2GK1B 3WKZA 1JCYA 4FP1A 1GT8A 1CT5A 1FWRA 1UC5A 3IIXA 1CENA 4JTJA 5I0DA 2QVNA 1EJUC 4OBRA 3DYPA 4F4RA 3GTFA 2X0YA 1V08A 1KCLA 2WM0A 1KGWA 2KX9A 1GZJA 4O54A 3G6LA 5LNVA 1GVFA 5HQMA 2E9BA 1A53A 3V1HA 2UY4A 4MY1A 4J2PA 4HNUA 2R91A 3QQWA 2WKGA 3PPFA 3VZXA 2V8ZA 3A13A 5BXPA 1SFSA 4AMAA 4P2VA 1EC9A 1A5KC 1Q6DA 3LBCA 3PN8A 2RGLA 1IXNA 4RE3A 3NQ6A 3K8KA 4GXMA 4S3DA 3BMWA 3VKJA 4QAWA 2PDJA 3F2BA 4WD0A 4B4HA 2X1TA 1UD6A 1YPXA 3EAUA 1KXQA 3EB4A 6TAAA 1GNXA 1LWHA 1H09A 4DEFA 1R2SA 3KE0A 1QASA 1QCWA 5FJPA 2KZHA 3GDMA 5CG7A 2OQYA 1DWGM 3SI9A 3LPGA 3KLKA 3HFYA 4AYGA 1UUQA 4FLQA 3DDMA 4C6CA 4PC8A 1DJWA 3MT1A 3FJ6A 3LHZA 3KBNA 4NJKA 2NX9A 4JN6A 3T9PA 4R34A 3EZ4A 1QDSA 2OQLA 3G3DA 3MMTA 1NH6A 4GQ0A 4DBDA 1I8JA 1D8CA 1YPIA 1PZ1A 2F7FA 1V3KA 1YXYA 5J5DA 3EDKA 2WC7A 5KETA 4LS0A 2OKOA 1RQEA 3B97A 4HPGA 1BSIA 1UOZA 3AC0A 3Q65A 5LIXX 1JNEA 2IQDA 5CXPA 1Z7AA 1LJYA 4LUSA 1PIFA 3VIJA 3VK5A 2J24A 3QW3A 1OFQA 4LVGA 4M81A 4XAZA 3QQ1A 2VR4A 2OT0A 1LYXA 5CC3A 4DO6A 4D6IA 3QV9A 1CNVA 2OGYA 2PA6A 1NWRA 3BW3A 5ABHA 4L9YA 3TX9A 2OEKA 2PDPA 1FDYA 3UZ5A 3MYOA 1TYGA 3VGEA 1XSJA 1AQMA 5C2CA 5CAKA 1PYMA 1R46A 3N4AA 2VFGA 4BF9A 4PUDA 4JTUA 4ZQPA 3WLSA 3OIXA 2PDNA 3BLOA 2WNWA 4QE4A 1KBIA 3A3HA 2ATMA 5D02A 1LQAA 3ARWA 2OQHA 3PPCA 3ITTA 5K9XA 4CN1A 5LXEA 4MB4A 3TVAA 4I7WA 2DJXA 2XWEA 4JTCA 4AWEA 1QRQA 5GNZA 2X30A 2ABBA 3RM9A 2CHNA 2XIJA 4I9JA 1CXFA 4WVXA 4PUEA 1GCYA 4INFA 2RDUA 4NX0A 2Z0IA 3N2MA 5IOBA 2WJEA 1M3UA 2X1IA 1ZP4A 3HPAA 3CO8A 1CI1A 5E09A 3B8VA 2GVGA 5B7ZA 1TMQA 2PLMA 4JY9A 1GOKA 1BHGA 1SFJA 2V3DA 4JFVA 4IH3A 3BLDA 4DO5A 3GHSA 1UPPA 5D33A 3A4XA 1OGGA 3ZM8A 3G1FA 3S9ZA 3TYEA 3IS4A 1DHKA 1R9XA 3ZSSA 4QEEA 5FEZA 1VENA 5CZSA 5C54A 2BGNE 3BXWA 5B7YA 3AHYA 3P6LA 3T0TA 1E6QM 3DERA 1YTKA 1EEXA 3N9SA 1SYTA 1IV8A 3NOEA 1B31A 2I5GA 4WDUA 4RNJA 3CIXA 4LPCA 3NNTA 3CUGA 2AL1A 3EWZA 4HD5A 1F61A 1FCQA 2GJXA 6CGTA 1Q8JA 3GNNA 4UTHA 1YE4A 2Z4GA 2J8TA 3BJFA 3NYDA 3MO7A 3DCPA 4CUCA 3W4RA 2DUAA 3M0HA 5BMWA 4AEFA 4DBWA 2XTKA 3QZ6A 3W29A 5ECUA 3WQFA 1V6XA 3VDCA 1ZCOA 2ZX9A 1Q7QA 2PC8A 1TREA 4RE4A 1T96A 3T0DA 2XH2A 5FJJA 5JIPA 3AIQA 3KL3A 4LAKA 4RDZA 1XC4A 2CHOA 4C7FA 3MKKA 1P0EA 2Z24A 4I9TA 4HNVA 4UFHA 2J27A 4FO4A 1XLKA 2EG8A 3LGGA 2XYLA 3IJQA 1VPQA 3W53A 1EPVA 2PTXA 3KWXA 3S1GA 2QPSA 2ICSA 2ACQA 3W7LA 2VYOA 1PUDA 1G4EA 4J3TA 2B4GA 4WKHA 3QC3A 3TFXA 1OZQA 1VQTA 5AYBA 4ZA0A 3U7VA 1YDYA 4EPBC 4H19A 2V6AA 4ZENA 1PKLA 2H3BA 5IRPA 4O11A 2PRLA 2Y7DA 2BS9A 3UA3A 1DE6A 3QTPA 3KCLA 1JRBA 2P8CA 2V9DA 5FJIA 4LYQA 1S3HA 3V0UA 3PJTA 4RCXA 4KIRA 1UOKA 3BSGA 3G8RA 2C0AA 1JZ4A 4Z1AA 1R3SA 3LHWA 4GOAA 1K9EA 4PL1A 4QAIA 2QUUA 1R0MA 3O15A 1MQPA 2B7NA 1EA9C 1ENUA 4P7RA 5C7HA 5H8PA 1D7FA 4WGXA 5EMJA 2W67A 1I2QA 1Z44A 1SO6A 1CECA 3KL5A 4ICMA 1TCMA 3UCCA 4YTSA 3WQGA 3P7YA 1UR2A 1XDLA 4GNVA 1PCKA 4YYCA 2NVCA 1GUVA 3KBMA 2CLPA 1KWKA 4M6QA 5EGRA 3MCOA 3SCTA 1RPKA 2NV1A 3D5HA 1GWJA 2FZ8A 2ZRUA 1XBZA 3QR0A 3GHTA 1OX6A 3UJFA 3B3DA 2AMXA 1OFBA 3ENLA 5HMSA 3H2MA 4OKDA 1Q6RA 1N8WA 3WK2A 1BQGA 1WAWA 3RLUA 3FAWA 2PODA 2VEMA 4J7RA 5I78A 1XUUA 4TR9A 3FJLA 1KR1A 4IQLA 1VC4A 3GXNA 2V2CA 5EB8A 3L5AA 4PMRA 5ENLA 4ZOBA 3CHEA 4ZQRA 2W0UA 1KM6A 1XCFA 4OIFA 1TJ1A 3NXFA 1TPH1 3NR0A 3VFCA 2ZA1A 4ES4A 5C70A 4YHEA 3I6TA 1UR1A 2Y5EA 3H2NA 3VC6A 2WMFA 2OMAA 3BLLA 4WJEA 4AF0B 4GIRA 4KEUA 1V0MA 5AHEA 3QGVA 4LANA 4AD1A 2GVJA 2WBGA 2OYKA 3RNDA 3VYLA 2A3AA 3VOFA 4UMAA 1V51A 3W28A 3LSCA 1P7TB 1SZFA 4AEOA 3NQ8A 3LUTA 4Q4KA 3ARPA 1HT6A 3R7MA 2Q71A 1DWJM 1M01A 4IMCA 5EBAA 1L6WA 2FDSA 2J74A 4AWUA 2ZZ4A 1GQKA 3E12A 2Z26A 1MUWA 3OVGA 1UWQA 1IEQA 3U9IA 3UNTA 3DFTA 4DLFA 5G2WA 1V6YA 4GC3A 4FPSA 2PTDA 3CHCA 3BANA 3AMLA 8CGTA 3WD2A 4AFYA 3RX2A 3RLGA 4DUOA 3AU6A 1IWBA 4W88A 3SFKA 1EBHA 4F0MA 5KITA 3UWVA 4EXQA 3BCFA 3AIUA 5AN7A 2FVKA 3CM4A 3T2PA 2WZEA 3CQJA 2QAPA 3VM7A 3WYZA 1A0EA 3H23A 4JFTA 1V6VA 1UG6A 1TV2A 1CGXA 3L21A 4AD3A 4D6EA 3F2CA 4X3ZA 1UROA 1WKEA 3RMEA 4F40A 1Z41A 4AB4A 4EPDC 1Q6EA 3QPZA 4D6DA 5FSEC 2GPTA 3APYA 3BAJA 3MY9A 3MUZ1 4EOUA 1VR6A 3EYPA 4B3LA 1RJPA 3AI0A 4Q4SA 1G9HA 1AW5A 3FW6A 3KW3A 1BWVA 2QEZA 2W5FA 4K6AA 5CGQA 3DYOA 1M7OA 1N8IA 4HN8A 1KBLA 4QITA 3EOLA 3GX9A 3QV8A 4MLJA 4C65A 3CUZA 4UNLA 3GSMA 4WF7A 2ZE0A 3OZOA 4H01A 1RH9A 2JKEA 3NO3A 3IWPA 2Y88A 5D9PA 1LUCA 3TU9A 3WH9A 2OSWA 4H41A 2WSYA 2VC7A 4NXSA 5CQ1A 3RAOA 2QUVA 5HMFA 5HUOA 1VPXA 4MDPA 4YNGA 1E0UA 4X9YA 3M16A 1JL8A 5I7GA 2Y5SA 2VENA 3MP3A 3PZMA 4FX6M 3NTYA 4GI4A 2Z27A 3NZGA 3WFLA 3GNPA 2ZXAA 4EKJA 1DHPA 4YCOA 2BVDA 2YLAA 3TTYA 3OLEA 4PUMA 1OYBA 1E4NA 1ONRA 1V7AA 1VPYA 3MDWA 4RNIA 2V69A 4ATWA 4WGHA 2PDYA 4Z0JA 1EKOA 3QR1A 4AUBA 3S9IA 3DU0A 4LS2A 2ZXDA 5CJ5A 3CAVA 1XKJA 3N6JA 4X61A 3OQEA 4MY8A 1DVJA 4YTUA 4JTQA 2WNZA 1E0VA 2EPKX 1V3JA 2QDHA 4XWUA 4GABA 2VFFA 3MUIA 1OFEA 3FLUA 1ZUAX 3SCPA 2QJJA 3PJUA 3QMTA 2VR2A 1Z9AA 4UTIA 2GVEA 4B2DA 4LC8A 2PRHA 4P7LA 2C16A 4PTDA 1XBVA 5C55A 2C71A 4R27A 4XZIA 4POCA 4XZLX 5C2GA 2PGEA 3ID7A 3KBVA 1UZDA 1W31A 4DY1A 3WN6A 3W7QA 2PWDA 5DFAA 4PCTA 5KMYA 2EXOA 4WCJA 4W5UA 2X1UA 4MWAE 3TTEA 1WYIA 1B3XA 1FBAA 1OK6A 2VGGA 3A3WA 4J3WA 3I7SA 3K2GA 1BRLB 4S3JA 1T8XA 4IG2B 3VKCA 1JRCA 1XM3A 1V5XA 3VIFA 2PAJA 1SZNA 4AMCA 2YDSA 4IM4A 4DLMA 3EWUA 4H7VA 1PZ3A 3C8FA 3VCRA 3HJZA 1L6GA 2ZUMA 2J4GA 4O1AA 5DF0A 4H7CA 1XF0A 3SEPA 2GVYA 4O17A 2QUMA 5T91A 3S1XA 3PTQA 3RX3A 3WFAA 1R3TA 3GKFA 4IWWA 2ZVIA 4RKAA 4WSJA 3UQNA 3PG8A 1XS2A 3W27A 3UG4A 4HK7A 1F7BA 1MEWA 1B5TA 3KL0A 3S0CA 4PUKA 1LRNA 4F0LA 4MG4A 4ZSTA 1F6PA 3CL7A 3ONCA 1DE5A 3L0KA 3WF3A 4X0VA 2XIBA 1J01A 1HKVA 3GTNA 5AHNA 1LCOA 3S2NA 3B0XA 2TPSA 1UWAA 4MNMA 1JPKA 5AHFA 3FA5A 3FV9A 3LM3A 3WMBA 3LS9A 3DENA 1B3VA 3PSVA 3C6CA 2OG9A 3RU6A 2YBTA 4Q6JA 1JI2A 2J79A 3AHXA 2XVPA 4O1BA 1PSCA 2VEPA 4DN1A 3W2LA 3TJ4A 5F2GA 3UWWA 3P0WA 2RJHA 2FZ9A 2WCSA 1H11A 1E9YB 4C5YA 2PWGA 4Z1BA 4FEZA 3A47A 1SPQA 3E0FA 4W7WA 3WH8A 3N6QA 3T42A 3PBWA 1ALDA 3GDRA 3UJEA 3KTXA 3EWCA 3OLDA 4PCFA 4KCTA 3C0LA 2J7BA 1JCTA 2XIOA 4H8UA 1J8VA 1A5OC 4M7SA 3T0CA 3K30A 3NL6A 1E3XA 3HPXA 1JF5A 2O9PA 1N82A 4LB3A 3WMLA 4N4QA 4AWSA 2PLJA 1SW0A 5E0KA 1C29A 1E55A 1OGBA 1Q6QA 1UBPC 3CT7A 3APGA 1W5NA 1Q65A 1LBFA 3TJXA 1ZSXA 4NAEB 3DGRA 3STFA 2GJPA 3SSZA 1KKRA 3NQCA 4PBEA 4ZB5A 5I2UA 2WQDA 1JEZA 3CUHA 4FNUA 3LENA 1E6NA 1A3XA 1TPVA 2R82A 3ANVA 4KT2A 1QWGA 1UH3A 7ODCA 1JZ3A 1XPGA 2DSZA 3ERPA 3DUGA 3GNRA 3GY1A 1BXCA 4YHGA 4FOKA 3VOIA 4FS9A 1K6AA 2QQ6A 1Q63A 3GXDA 4LAUA 4RXGA 3CHVA 5FL1A 4IHCA 3O1NA 1OFDA 4PMZA 3EX4A 4HK6A 4S2BA 2VCCA 4DPPA 3LZ3A 2WVSA 4MKVA 3QFWA 3NZQA 4Q8OA 4WZHA 3THUA 4CLMA 5HXMA 4H6QA 4PZVA 2V81A 2G97A 3WFZA 2DSVA 2XISA 9XIMA 2HE5A 4S39A 4NSBA 3O05A 1FKWA 5BCAA 2O7QA 3LDVA 4N0RA 1LT8A 1UQZA 4LQ1A 3VINA 1TFVA 4Z1YA 1HW6A 5I3KA 3USBA 2EJ1A 1E4LA 5BRBA 1YDVA 4XIMA 2BMBA 3BDKA 2X41A 3ARZA 5A6SA 1J10A 2DVXA 3S1UA 2VEKA 4G7FA 1AA1B 4PUUA 2VGFA 4E6MA 2ZVRA 1S5WA 3GVRA 4LYPA 3GHRA 3GVGA 4PMDA 4ML9A 3NQDA 3T4CA 5FD0A 5ECVA 1F3TA 1AL7A 4ACYA 4AD0A 4DJDC 4TVUA 3W7EA 4G9PA 4GPNA 1KFBA 3VNLA 3ZJ7A 2GUBA 4CNTA 4XB3A 1M7JA 2DGAA 1XYLA 2DSWA 5B80A 3BQ6A 1CXKA 5A8OA 4LV4A 5BOOA 2CIPA 2VD9A 1EQCA 4RNFA 4UZSA 2V0TA 4Z2HA 1SU5A 5LIUX 1V3LA 1WO2A 2TRSA 1DEDA 5BU6A 2NT1A 1E1CA 1YPFA 1D9EA 3E74A 3AWNA 1O94A 4GRSA 4U28A 2R1KA 2P3ZA 3AIRA 3WDIA 3L2LA 3VVGA 2QXWA 3G1YA 3WF1A 3IANA 2HPIA 4M51A 1JQVA 1NDVA 4P61A 5GPRA 4TVDA 4DZHA 3ZSTA 2BX7A 3GW0A 1REQB 3WUFA 4BA0A 1QOXA 1PTDA 4KRZA 5AHMA 3QEZA 1W1VA 2Z29A