4W8BA

Crystal structure of xeg5b, a gh5 xyloglucan-specific beta-1,4-glucanase from ruminal metagenomic library, in complex with xxlg
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
386
structure length
386
Chain Sequence
KDAQAIAKDMYPGWNLGNTLEATGSGLDAETSWQPTLTTQQIIDAVKAAGFKSVRIPCSWDIHSDSNGEIDAQWMARVKQVVNYCINDGIYVVLNDHWDNGWIEVLGFSKSSSSYQAVDEATITSKITRLKDLWTQIANEFKDYDEHLLFAGLNEPFQEYSLFSGHHEELTPILCRYNQAFVEAVRATGGNNAQRTLVVQGPSTNINSSVNYMTADKLPETAGRLMVEVHYYDPGQFCGTFDASGDNAFYFWGAANHSTDHNATYGEEAYMLSQFGLLKTAYTSLGYPVIIGEYAALQRTISGDQNKHNASVKYFYQCVNEYATNNGIIAFAWDTNDTNGLNSEGGSSTIIDRANSAVVGNNAMEGVKAGVAAGKWPFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Xyloglucan Specificity and alpha-d-Xylp(1 6)-d-Glcp Recognition at the -1 Subsite within the GH5 Family.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Exo-xyloglucanase
total genus 157
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w8bA00
3F5KA 2VCCA 3CZJA 4LXFA 1W9PA 3NDYA 5A8OA 4EE9A 2RGLA 1B3XA 3TP4A 1H4PA 1P6WA 4CCCA 4AD5A 5GPRA 1W3HA 4UFHA 4N42A 4XB3A 1EA9C 1YHTA 1EIBA 4WSJA 3T08A 3PZMA 4M82A 4ZENA 3PBGA 4U5IA 5I6SA 4XZBA 2YL6A 4M80A 3GDBA 4R27A 1O6IA 4HA4A 2GJXB 3MKKA 2WMJA 3T0AA 3VMOA 2CKRA 3FAWA 4MTVA 1HVXA 4JKLA 1C8QA 1BYAA 3WH7A 1OSEA 3JUGA 4AWEA 4M29A 3AIUA 2BVYA 5C70A 1UR4A 4MJ4A 1WP6A 3IK2A 3SCRA 2VTFA 2CPUA 3N9KA 1KGUA 4PCSA 1V3LA 2A3AA 4L4PA 4AZIA 3IANA 4EKJA 3W53A 1BG4A 1XC6A 3WELA 5AC5A 2WB5A 8A3HA 5AYIA 4QCFA 1JZ2A 3WDQA 1UKQA 3GH5A 2DPEA 4GI9A 1QW8A 1OWQA 3GH7A 5EFDA 1CGWA 4ATLA 4CN1A 1XCWA 3ARXA 3ZO9A 1G9HA 2VX7A 3GYCA 1V08A 1PEZA 3VIGA 3OGSA 3L4TA 3OA5A 3KE0A 3O6AA 3CH9A 1CXFA 5A6KA 5FD0A 3GM8A 1MVYA 3TOPA 4LPCA 1JNDA 4JFUA 1BQCA 1K9FA 2D3NA 2YL5A 5JBEA 3BSHA 1BYBA 4HMEA 1FP8A 4PMNA 3S2CA 1B90A 3CTTA 5D9OA 2JF7A 4W86A 3B9EA 1UKOA 1JF6A 4QLKA 3VX1A 2BHYA 1QNSA 3POCA 2BY1A 1J0HA 4FK9A 2CYGA 4CD6A 1LF1A 3D5HA 1E71M 3WDPP 3UEQA 4DM2A 2J74A 3ZJ8A 1HKJA 3PZQA 3W26A 4HMCA 1A3HA 4NSBA 4JIEA 4GQRA 3BLPX 4RE3A 1QBBA 3U5YA 2O9OA 2VQUA 1UG6A 4PMYA 2WPGA 1W9VA 2ZUWA 1Z32X 4W7WA 2BS9A 2VZUA 2XSBA 3OLDA 5A8PA 4KH2A 1GHSA 4CVUA 1RPKA 1FFQA 4AIOA 3G6MA 1E70M 3QGVA 1ZBVA 2QMKA 2VOTA 1CDGA 1QOXA 5HXMA 5BYWA 4ATWA 1QNQA 4AD2A 2FHFA 3GZAA 5M5DA 2UWFA 1H2JA 1VJSA 4JFWA 4OBSA 3MMUA 3RIKA 2XTKA 3U7VA 1JFXA 3DC0A 3BLKA 5A69A 2X8RA 4GIAA 2ZWZA 3KL0A 5C71A 4AD3A 1GPFA 4AZGA 2V3EA 1F4HA 2BY3A 1F4AA 4A3HA 3PN8A 1HKIA 4H8VA 1GNXA 3WDHA 4B9YA 3EDDA 2F2HA 1VF8A 2DH3A 1V02E 3ECQA 1V0KA 7A3HA 4V28A 4E4PA 4AZHA 4H41A 2VX6A 2PI6A 1NWTA 1XYFA 1HL8A 5E9AA 1DWIM 3WUGA 2WMGA 1ZJBA 3VNYA 3CUFA 1UWUA 1OINA 1G5AA 2G3JA 4AZ5A 3AZRA 5EFFA 3PZVA 5A6AA 1JXJA 1J0JA 3MV01 2WC3A 4PN2A 2DSUA 4ACZA 1UYQA 2O9TA 4URIA 3VIOA 5HPCA 1TVNA 1AQHA 1OIFA 1BYDA 2X2YA 4QLJA 2IUZA 4M56A 2VI0A 2WKGA 4S3JA 4UFKA 1RP8A 2DGAA 3THDA 1H0GA 3A6OA 5EB8A 3WH6A 1PJ9A 1V02A 2ZWYA 5CLWA 1UWIA 1B9ZA 5I78A 1NQ6A 4FLRA 2Z1SA 4U2ZA 4GINA 4MDOA 3KL5A 4W8LA 2G3MA 1CGTA 1W32A 3W38A 2VVSA 2ZUNA 1JDAA 2VR5A 3BAYA 1WDPA 1E1FA 3N1AA 3PTMA 2OSWA 1H11A 3AHXA 2OYKA 4B3LA 5M3WA 2EPKX 4S3KA 4V2XA 2BXYA 2ZUUA 4WKAA 4M81A 5CZKA 3VGEA 5E70A 1XSJA 3IJ8A 3OLEA 3RMEA 5AY7A 3UG4A 3TONA 2J79A 3AS2A 4PYSA 3M7SA 2YDQA 3PZ9A 4JFTA 3B9DA 4EAMA 1VEOA 1W3KA 3VDAA 4U33A 2J7CA 2WSKA 4D6CA 2XIBA 4WSKA 3BC9A 5I2UA 2YIHA 3CUHA 3AJ7A 5LA2A 3VIFA 5FIPA 1J10A 5ABFB 4OUEA 2DSWA 3OLIA 2G41A 5CXPA 4N0RA 2VT0A 4KRTA 1HF6A 1I1XA 1XHGA 2DSKA 3NUKA 4AZCA 1ECEA 3VD5A 3FW6A 3K46A 4UQDA 3BSGA 4HZ8A 1H09A 4W89A 4KGLA 3HU7A 4PMXA 4GPNA 4C7DA 4CVWA 2XJ7A 5BXPA 3VIKA 2O9RA 1EGZA 3W81A 1WZLA 5ABHA 4YHEA 1KGXA 1HXJA 4WIWA 1UD6A 1GORA 4P8WA 5AC4A 2QLYA 5F7UA 3T2QA 3CO4A 3RJYA 4AIUA 2XPKA 2C8NA 2ZE0A 1C7SA 3T2PA 2GSJA 3WIJA 2WZIA 1XSKA 2PBOA 2V5DA 2O9PA 1CPUA 5BXRA 3QR3A 1NARA 3AZSA 5I5RA 1JZ6A 2VRKA 3GXFA 2CERA 4AW7A 1ZB5A 5JIPA 1V0NA 2D0FA 2BFGA 1HN1A 4D6JA 3CIVA 4ACZB 4LQ1A 4AD0A 3RM8A 5M03A 3QOMA 4JFSA 1XSIA 1VFUA 3OG2A 3KWXA 2E8YA 4DWSD 1SFSA 3BGAA 1IV8A 3N11A 1B30A 1E4IA 4MADA 1CGUA 1A47A 1KB3A 4Z2JA 3CUJA 1LG1A 2VZTA 4MAZA 3CUGA 4OBRA 1NP0A 3VPLA 2VQTA 1CXIA 1NOWA 4H7VA 1B3VA 1HJSA 4HPGA 4JCMA 1ZBKA 1E5NA 5A94A 1JFHA 2XVKA 4P7LA 4ACYA 3NJ3A 1KR0A 1VEMA 4GKLA 4P7OA 3THCA 2PBGA 4ZFMA 3K4DA 3EMQA 1PAMA 4FLSA 4GZJA 2GJRA 4PCTA 1ISYA 1PZ3A 4W8BA 2VX4A 4MDPA 2WCGA 1K6AA 3ZMRA 3GNPA 5A8NA 3AXHA 2VX5A 2WMKA 4W85A 3MUAA 1KWGA 1BGAA 1ITCA 1XD1A 4UZUA 2VRQA 1JF5A 1LLOA 2QV4A 3SURA 1PIFA 3WBAA 2XG9A 2DT3A 3K8KA 2BY0A 3G6LA 3RO8A 2WVSA 1JYNA 4RE2A 2WM0A 3MV11 1E4MM 1KXQA 3E1F1 1EO7A 3AI0A 1JYVA 2WWCA 1Q4NX 2W61A 3F4VA 1ODUA 5AYBA 3CPUA 4GI6A 2CKSA 4OZOA 4AD4A 3N13A 2JF6A 1B1YA 4J3UA 2VZSA 2JE8A 2ZX7A 4GZEA 2BXZA 4ZEPA 1E0WA 1U30A 4YN5A 1CECA 5D9MA 2MANA 1B3WA 5CPSA 3WY1A 1VRXA 1C8XA 2DIEA 2XM2A 3UR8A 3FXYA 2J7BA 1NP2A 4OOZA 1VENA 3WD0A 3K4AA 3WKZA 2VR4A 1R8LA 4KMQA 3IJ9A 4TTUA 4CCEA 2WXDM 1OD0A 1BVZA 2D3LA 1TUXA 1H0IA 1XH0A 4JZ5A 4HMDA 3WF1A 1XGZA 4PTWA 1S46A 5KEZA 1W91A 3DHUA 5LYRA 3RILA 2PF0A 1E0XA 3A3HA 3IAQA 1XH2A 5A8QA 2QPSA 1EDQA 5DT7A 9CGTA 1V6WA 3WQVA 5A95A 4IM4A 3EBVA 3O2LA 4NZCA 4D1IA 2ZXQA 4P8VA 3L4VA 1UR1A 3WBEA 1BG9A 1JDCA 3AYSA 7CGTA 3WD3A 2Y8VA 3BMVA 3VKKA 3W24A 1NWSA 2NSXA 1CIUA 2JIWA 1D3CA 5CSUA 3WDRA 4M1RA 1CLXA 4DWSC 1V3KA 1ZL1A 1E55A 2Z1KA 2CITA 5JBDA 3ARTA 3WMCA 3AZTA 2CBIA 1FHLA 3PZTA 3B9AA 1V6YA 3AHVA 4D6IA 4UFMA 2NT1A 1WDSA 1J18A 1VJZA 3EMCA 4HA1A 4RL3A 5CLTA 2PWHA 4ZXLA 1AMYA 2VC9A 1JZ4A 5D8WA 3N15A 3SEPA 1QHPA 2D24A 4CN6A 4J27A 3VMPA 3GBEA 1CEOA 4F8XA 1KCLA 2ZX8A 3BAWA 4XUYA 4AZCB 3GH4A 3T0BA 1OBAA 3W6LA 4DWSA 2CCRA 1X6LA 2J7HA 4X9YA 3CHEA 5HOSA 2YA2A 1BYCA 1CXEA 1H49A 3APGA 2J8FA 2YJQA 6A3HA 1JD9A 4WLCA 5HPOA 3AXXA 4AEFA 1JZ8A 1LWJA 4CU7A 5CQ1A 5A6JA 2D0GA 3I3DA 5CPTA 1DP0A 4PMZA 1BHGA 1WAWA 2E3ZA 1B3YA 2E40A 1FH8A 2VZVA 4GO8A 3WH8A 1M01A 3UCQA 1IZKA 5ABEA 2EPOA 4W7VA 5JBFA 1VAHA 3SUSA 2WSPA 1GQLA 3AIEA 1VIWA 1WCGA 4PMVA 1FH9A 3SCSA 3UESA 1V6VA 2CEQA 3N12A 1TA3A 4JHOA 1JI2A 1B31A 5DEZA 3WEZA 3GXIA 3AHZA 4L4OA 2BV9A 4PTMA 5FCZA 3BAKA 2QMJA 2EO7A 4HPHA 2D0HA 3GXMA 2XVNA 3CZKA 4P7QA 2ZUVA 4F79A 2XVPA 3UERA 3MS8A 4D72A 1TA3B 3WFLA 1NH6A 4XX6A 2CHNA 4D6FA 4UQBA 2DT0A 1DWGM 1W1PA 1Q6CA 3WQ4A 4DUWA 3MMDA 2WZHA 4JL1A 3LPPA 1J0KA 5EMYA 2VCAA 1CGVA 4QP0A 1ISXA 5I0DA 5D8ZA 1E43A 5BRQA 2JALA 1US2A 1QNRA 3AHTA 5A8MA 2YA1A 2Y4SA 6TAAA 1JAKA 3GTNA 4UQ9A 3D3AA 3NSNA 1FOBA 2OYLA 1H3GA 5FL0A 4UFIA 1C91A 2J7EA 2F8QA 1C7TA 2WVUA 3WF2A 4Z2GA 4PTXA 1E6RA 2O92A 1XD0A 4UNIA 3WN6A 3VINA 3WENA 1HP4A 4EK7A 5BWFA 4D6HA 3PHAA 2X1IA 1UH4A 1JG9A 2VO5A 1G94A 1TMQA 1UH3A 1V0MA 4NRSA 1L8NA 1K9EA 2B31A 5BCAA 4TVDA 5CGTA 3KEHA 5JIWA 2ZUMA 1CGXA 3AMDA 3BXWA 1UKSA 2VURA 5A6BA 4J28A 4BCEA 2E9LA 5DMYA 2XGIA 1JYXA 4D71A 3PTQA 4Z2HA 3AHYA 4HOXA 3AXIA 2YA0A 1KQZA 1OCQA 1UQYA 3W82A 1B2YA 1I75A 1K9DA 3M07A 2XFFA 3WD4A 1NM9A 3ZIZA 1R7OA 2XM1A 3J7HA 1V3IA 2DDXA 2GFTA 4TX6A 4GZIA 1UWRA 4PBGA 3II1A 4AEEA 1QI5A 3WH9A 5A1AA 3OLGA 1YQ2A 5HDRA 3EYPA 1WKYA 3SCQA 2NT0A 4HOWA 1JNEA 4QCEA 5CG0A 3VVGA 3TA9A 2V3FA 2QF8A 1ISVA 4UTFA 3LPGA 3CUIA 1G1YA 3WNLA 3W6MA 1E1EA 4LGXA 1UR0A 3WFZA 3VUPA 1DEDA 3VGDA 4UQCA 1E4NA 1OT2A 1NOUA 1C3FA 3PZIA 5IDIA 3IJ7A 1J0YA 1UZ4A 4MB4A 4JL2A 3B8SA 3SCVA 4U2YA 1CZ1A 1GZJA 1OD8A 1TR1A 3ARSA 4P7RA 3CGTA 2GJPA 2ZX5A 2EEXA 1BVNP 3KZSA 2RGMA 3ZT7A 3OB8A 1J0IA 2V3GA 2A3EA 1UOKA 2WBKA 2QHAA 1OB0A 1WB0A 4UCFA 2Q8XA 1GVIA 2DQXA 2DH2A 2PWDA 2CBVA 4B9ZA 1M7XA 4CKQA 5I24A 2J7DA 3SCWA 4CD7A 1OIMA 1CTNA 1JZ7A 3MUIA 2V38A 4WKFA 3EDKA 1UD5A 4U3CA 2CBUA 4W5UA 1J9YA 3VD3A 1EHAA 4PUDA 3AICA 1KXTA 2QPUA 4TVUA 5HBFA 1J11A 1W9UA 1HVQA 4H2CA 1PZ2A 3W27A 1C93A 1WO2A 3A4WA 4XV0A 1UWSA 2A3HA 3VIHA 3ZQ9A 1LJYA 1DWJM 4TVCA 4A4AA 4Z2LA 1XRVA 1WE5A 1CXKA 1IZJA 1KXHA 3EDEA 3M6DA 3WH5A 4UOZA 1C8YA 1NWUA 1R87A 5A6SA 1MFVA 2JEQA 3SCOA 3WF3A 4H8UA 1JI1A 3A4XA 4QFUA 5GNYA 3UR7A 1G01A 4C7FA 1XH1A 4CU8A 2CNCA 1E5JA 5M17A 1VFMA 1BAGA 2CXGA 2J47A 1OGBA 3ARVA 1ZBWA 4UFJA 1E9LA 2Y2WA 4J3SA 1GHRA 2PB1A 2A3BA 1UQZA 3A47A 1BFNA 4GI8A 1SR0A 2VL4A 5GNZA 2WAGA 1W9BM 4ZE5A 1CNVA 4LYQA 3VM5A 4P7NA 3W0KA 1W2VA 1OGGA 2ZIDA 1PX8A 1WDQA 4OIFA 4E2OA 2FHBA 3TTSA 2YBUA 1KBBA 1GONA 2W4XA 2FHCA 2J4GA 2W5FA 5FL1A 4J7RA 5I79A 3SUVA 4UOQA 4CD5A 5A6BD 4Y7EA 1XYZA 2PC8A 1VBRA 1EOKA 1MYRA 3RM4A 1R86A 3WQWA 3EDFA 1QHZA 5CPQA 4TUFA 1SMDA 3WF0A 3LPFA 5E6ZA 1E0VA 1E15A 5CGMA 4W87A 2YBTA 3WL1A 2J75A 4H8HA 1MQQA 2CIPA 1KWKA 5D4YA 2D2OA 1W1TA 2J7GA 3MUZ1 2IXUA 3ZT5A 1KQYA 1DTUA 2FH6A 1MFUA 1E4LA 1M03A 1ZJAA 3DECA 2PWEA 3GXDA 4Z2IA 1JZ5A 4CN4A 3WUEA 3N04A 4U5KA 2A3CA 4R5EA 1FHDA 1U2YA 5IFTA 2WKLA 2ZXDA 2Y8KA 4FMVA 3ALFA 4BQ3A 4MJ2A 2WANA 2EPLX 3M46A 1JD7A 4UZSA 3T0DA 1E6ZA 4IPNB 1GQIA 3BAIA 2WHLA 1UUQA 2W67A 4CUCA 4TX8A 4E8DA 1LL7A 1WZAA 1HNYA 5E0CA 3EDJA 3QOKA 3VGBA 2WYSA 4TTGA 1V0LA 4PEEA 3ZOAA 2YOCA 3QHNA 4BQ2A 2X0HA 3WUFA 4RE4A 4UQEA 2CETA 4J3WA 3OGVA 5FKYA 3POHA 4DM1A 1UR9A 1LQ0A 1GJUA 2XFRA 1FP9A 3RPMA 4X0NA 3ARYA 4ML4A 1E6PA 1HJUA 2VNCA 2F61A 1UR8A 1QI2A 1W2PA 4FF5A 1E6XM 4KGJA 3VGFA 3VGGA 2WCAA 1TE1A 3UG5A 1DHKA 4C7GA 3WEMA 1V3HA 3AS3A 3AYRA 1QNPA 3VD9A 2J78A 3ARUA 4MPKA 3WDIA 3PZUA 2JFEX 3WMSA 3BCFA 2WLZA 2WNWA 3CMJA 2EBNA 1TVPA 3O9NA 5TD4A 1UZ1A 1V3MA 2WBGA 2WC4A 2GUYA 4A3YA 2E9BA 2GJXA 1ZBCA 2J7FA 3T2OA 3VOCA 1Q6DA 4UQAA 1GUVA 3I3BA 3RCNA 3LMYA 4WKHA 4ZXOA 4NF7A 3L4WA 2FH8A 1VFFA 1G0CA 1JYWA 3CZ8A 3WQ6A 4JKMA 5A2CA 2UY4A 3AIBA 1CGYA 2TAAA 1MW3A 3HMCA 4MNKA 2G4FA 5D9PA 1GQKA 3FAXA 2G3NA 1BLIA 4K68A 1B0IA 2WWDA 3A4AA 3VDBA 1CLVA 3W25A 4DUXA 4BQ5A 2C7FA 1TFVA 1QBAA 1TG7A 1H5VA 2J62A 2WMIB 1QI3A 4PMDA 3OBAA 4PSRA 1CBGA 1WPCA 4JCLA 1CWYA 1HJQA 3FHAA 1J01A 2XIIA 4M24A 4Z2KA 3WDJA 1GOIA 2GK1A 1E56A 1MW1A 4AD1A 3WD1A 3I3EA 3AQUA 1UWTA 3VM7A 4UR9A 1E73M 4F66A 3L4ZA 2WMIA 3WNPA 3VU2A 4BZYA 1RD6A 4DUVA 3VGHA 2E8ZA 4X0VA 1EH9A 2BVDA 5I77A 1WZKA 2OSXA 1W3LA 3CBWA 3VD4A 2D23A 2ZX9A 1HP5A 3SCTA 3ARQA 2EXOA 3VDHA 4MB5A 4PSPA 5A2BA 3BMWA 1ESWA 2AOSA 2WLYA 1ISZA 4JAWA 1MXGA 3ZR5A 4V27A 3AMLA 3KL3A 2OSYA 5IXEA 2XGBA 4MB3A 4BF7A 2XFYA 2CBJA 3MU7A 2EQDA 5ABGA 2E4TA 2XWEA 1CXLA 3SCNA 1QNOA 2BHZA 7TAAA 2YKKA 1EQPA 1E40A 1OT1A 2J25A 3VX0A 4W8AA 3S6TA 4Q7NA 3RM9A 4CCDA 1GVYA 1Q6GA 1GQJA 2WVVB 2WW5A 1LWHA 3BAJA 3WSUA 5DO8A 4M8UA 2CESA 1BSIA 6CGTA 2OWXA 1CXHA 5IFPA 3L2MA 1QVBA 1LL4A 3RJXA 3DYMA 1E6QM 4TOQA 5A6LA 1UD2A 3AIWA 2WHMA 2BY2A 3AIRA 1AQ0A 4DWSB 3TTQA 4HU8A 1H1NA 2BVTA 5CJ5A 1ZS2A 3L2LA 4W5ZA 1MW2A 1BTCA 4PRWA 3CHCA 1GJWA 3L4YA 3IAPA 1H41A 3AIQA 4HU0A 1FH7A 3WUBA 2VVNA 3ALGA 3OIHA 1KGWA 2V3DA 2ZXBA 2GDVA 3W37A 3K8LA 2UY5A 4CD8A 1GOQA 2J77A 2W63A 3ZR6A 3NCOA 2OWWA 4HTYA 4LYRA 5I23A 1EDGA 4KWUA 2NW0A 4NRRA 1UH2A 2YLLA 5DT5A 4U31A 3WF4A 1PX3A 1MW0A 3FY1A 1UD4A 3GBDA 1NWRA 1UD3A 3AMKA 1W9XA 1R85A 2VRJA 1D7FA 1ISWA 2DSZA 4LYPA 4AZ6A 3WEOA 1JGIA 4JHZA 3WMBA 2Y24A 1PBGA 4HOZA 3HJEA 1KXVA 2C0HA 2FGLA 2EJ1A 4FLOA 2VMFA 3NYDA 3AFBA 1J12A 5BRPA 2XVGA 4MB1A 5BXSA 2W91A 4GXPA 5FOOA 1DWAM 1Y7VA 4FLQA 3VIIA 1OGSA 2GK1B 4QAWA 2VUYA 3AMCA 4JFVA 2ZUTA 2D20A 3ZJ6A 1ODZA 2WCSA 2G3IA 3CZLA 2ESCA 1Q6FA 1UHVA 3UETA 1VB9A 1HT6A 1CYGA 3PZOA 3WQ5A 3TTYA 1V3JA 3AS1A 3NIYA 1MWOA 1QI4A 4D6EA 1KBKA 2WHJA 1SMAA 4F9DA 1VFOA 3DYPA 4LX4A 1K9TA 2XWDA 3NSXA 1ZU8A 1OM0A 1BPLB 4PMOA 4YPJA 4CU6A 1N82A 1UD8A 4AISA 2ZICA 2ZX6A 1HKMA 5I3DA 3MO4A 2OYMA 2ZXAA 5BROA 3ZM8A 5DFAA 1EHNA 1GOKA 4AMCA 3ZSTA 3VO0A 3U7BA 1VEPA 3ZT6A 4HA3A 3AIVA 1TCMA 1O7AA 4BA0A 2WVVA 5C8BB 3ZSSA 4OOUA 2V5CA 2OWCA 1HKKA 1GOMA 4B15A 1TZ7A 4MNLA 4B3KA 1U33A 2PWGA 1GCYA 4IPLA 2XUCA 1W1YA 4GQQA 1HX0A 1SYTA 2GVYA 2XSAA 4EANA 1EO5A 3NSMA 4ATDA 1UA7A 2WK2A 3AOFA 2X09A 3ARPA 1GOWA 4MNMA 3WNOA 1Q6EA 3PTKA 4MNJA 5E0FA 3WNKA 1XV8A 2XVLA 3VMNA 1PIGA 1E3XA 2FDMA 4B16A 1HJXA 1VBUA 2DEPA 2VZOA 4H04A 2YLAA 4AY1A 3RDKA 3MSDA 3VIPA 2ZUSA 3ZJKA 1BGGA 2IXVA 5A3HA 1JXKA 1CENA 4AZBA 1JDDA 3VTRA 3CMGA 1JZ3A 1E6SM 4F9JA 1X1NA 3VD7A 3FN9A 3W29A 1PX4A 2X05A 1JL8A 3MSGA 4HZ6A 1UR2A 2XYLA 4XZWA 3CZEA 1W3JA 5GNXA 4YHGA 4OKDA 3GNRA 4BQ4A 1X6NA 1NOFA 5HNNA 1W1VA 4UFLA 3PZNA 1FFRA 3VIMA 2AAAA 1IT0A 3CLWA 1JAEA 2W92A 1EXPA 8CGTA 1HJVA 1M53A 2UY3A 2WMFA 4BS0A 3WL0A 4E8CA 1GOOA 4D1JA 1QPKA 3MMWA 5BXTA 3OZPA 2W66A 3WQ8A 3L4UA 3NDZA 4MAVA 1MQPA 1PPIA 1M04A 2D1ZA 1EOMA 2DT2A 1WZMA 1WDRA 5A6MA 2D22A 5LA0A 4UOJA 3ZJ7A 2FGZA 3ARWA 5IHSA 3OGRA 2VJXA 3HN3A 1C90A 3AMGA 3K8MA 4OJYA 4J3VA 3PZGA 3OZOA 3BH4A 3T09A 3VIJA 1AQMA 1RP9A 1US3A 3DYOA 3CHDA 3U57A 1E3ZA 2DSVA 2G8ZA 4IISA 4P8XA 5LA1A 1LG2A 3AS0A 2JIEA 2VCBA 4W88A 2CHOA 2X0YA 3SUTA 1XCXA 5KZ6A 2DT1A 3QHOA 1KR1A 2WMHA 5ABFA 3SCUA 1HIZA 4PUEA 1BF2A 3BAXA 2YDRA 4AC1X 1R7AA 1UWQA 1FA2A 4Q22A 1MXDA 1QI0A 4U3AA 5DF0A 1D2KA 5GQBA 4WK9A 2EPNA 1UA3A 1MQRA 4PMQA 1KCKA 3BCDA 1EQCA 3AROA 1QHOA 2WHKA 5E09A 3FHQA 3QHMA 1QW9A 3LPOA 2WZEA 2PWFA 1W9DM 3K1DA 4TXEA 3UG3A 1DWFM 5E6YA 1C92A 3SUUA 2YDSA 3ARZA 3DHPA 5ECUA 1KFWA 4P8UA 3VNZA 4PMUA 4WJXA 1L0PA 1WNOA 5JUVA 2DIJA 1E6NA 3N17A 2XHYA 3F5LA 4PMRA 4JKKA 1UKTA 2EPMX 3WD2A 3GNOA 1ITXA 1RH9A 1V03A 3WNNA 2HVMA 4QDMA 1GW1A 3CHFA 1HL9A 3W4RA 4PTVA 5CSYA 4WF7A 3N18A 4D6GA 4W93A 3CZGA 3SUWA 3SIMA 4NI3A 3U5UA 3SCPA 2ZOXA 4KRUA 3MANA 4AYSA 4HZ7A 1E72M 5IHRA 2BHUA 2GDUA 1UKPA 4HP5A 4ZE4A 4J3TA 4CGTA 2BNJA 1DWHM 1HJWA 4AXNA 1J0ZA 1I1WA 2UY2A 2YL8A 1V6UA 4D6DA 4AIEA 4W7UA 1AVAA 2OLHA 3TTOA 3VDCA 3FNDA 4CD4A 5EBAA 2E9MA 2YL9A 5D9NA 3W28A 3MUY1 3WNMA 2AMGA 3ARRA 2J8GA 2W62A 4J3XA 4IUGA 2WVTA 3EMZA 2HISA 3F5JA 3VILA 1B3ZA 4QLLA 2E0PA 2WC7A 2Y5EA 4AZ7A 1JIBA 1LL6A 3L4XA 4W84A 4GO9A 2JEPA 3AISA 1EDTA 5A2AA 1V6XA
chains in the Genus database with same CATH superfamily
2VCCA 3PULA 2INFA 3CPRA 3CZJA 3NDYA 5A8OA 2RGLA 1G4EA 3L2IA 1P6WA 3SADA 3CYVA 3M9YA 4IX0A 1W3HA 1EA9C 3M64A 1YHTA 3SDOA 1HZYA 7ENLA 4ZENA 3I4KA 2NWRA 5I6SA 1O6IA 1KRAC 3KM8A 5FF3A 3BOFA 3W71A 3TC7A 3MKKA 3ICJA 1OYAA 3K1GA 1C8QA 4S1FA 1BYAA 4UTKA 3N25A 2BVYA 4NZ4A 3AO0A 1YEYA 1NDZA 1KGUA 3H2OA 2ZRYA 3IANA 3W53A 4LJ3A 4Z0SA 5AC5A 3URQA 4RPPA 2X40A 8A3HA 1LRQA 1JZ2A 2G96A 3NL6A 1VBHA 1OQFA 3D47A 3P2VA 1AJ0A 1UC5A 4L7ZA 1KM6A 3W7RA 2VX7A 3GYCA 1V08A 3PTDA 1PEZA 3EOEA 5EY5A 3O6AA 5A6KA 5FD0A 2DZAA 2TSYA 3URAA 4RDZA 2V6AA 3TOPA 2WSQA 4LPCA 1X6UA 1BQCA 2YL5A 3ITOA 3KWSA 4LY8A 4NJHA 5C7HA 1BYBA 3URNA 2Y7FA 4LRTA 5D9OA 3C0QA 1HKVA 3BK0A 4FNRA 2CLEA 3DI0A 2JF7A 3TQKA 2V63A 4NYYA 2VYOA 4ICCX 3B9EA 1UKOA 3DFPA 4DRSA 2BHYA 1QNSA 1MZRA 3LEPA 3ABZA 5AECA 2NXHA 1J0HA 5LNRA 1Z69A 2QR6A 3D5HA 3I10A 1PUDA 2YCJA 3LYEA 3EPOA 1HKJA 3QKZA 1TQJA 4HMCA 3BLPX 4K38A 4F3HA 1QBBA 3U5YA 1PZ1A 1UG6A 2WPGA 1XBYA 5HULA 1FWFC 4NZ1A 4O1EA 4O1CA 1Z32X 3W7KA 1DL3A 2WKJA 1RA0A 4V1XA 4A8LA 2BZNA 1YBQA 2QIIA 1RPKA 4AIOA 5HA7A 3GHTA 4J2MA 1RPXA 4JTFA 3P5YA 2G95A 1QOXA 2FHFA 1JCLA 1MDRA 3B8IA 1P0DA 2OU4A 2RUSA 3MMUA 1YE4A 3TH6A 3U7VA 3C8FA 5I03A 1JFXA 3DC0A 1FDJA 2X8RA 4DJDD 4AD3A 3OVQA 1KV5A 1V77A 2YCKX 3N2MA 3S9YA 1HKIA 4H8VA 2E68A 3WDHA 4X2PA 3HPZA 3EEGA 3U2CA 3EDDA 4PUWA 3QMTA 1XIBA 2F2HA 2YYTA 1VF8A 1OK6A 3WLPA 4BWLC 1DJXA 1LUCB 2QUTA 3NXFA 7A3HA 4DBDA 2PC4A 4AZHA 2PI6A 4NL1A 1HL8A 1TZ9A 3WUGA 3W87A 3M0HA 3V3WA 1NFPA 4ALDA 3L5MA 1TV7A 2HK1A 5A6AA 1E51A 5D32A 4ACZA 1UYQA 2KX9A 3EX2A 5HPCA 1XLFA 3UJSA 1JQXA 1OIFA 1TPH1 3H53A 4QLJA 3P67A 2VI0A 5HMEA 3CH0A 1H0GA 3N9SA 1PJ9A 2ZWYA 1B9ZA 5I78A 4MZ1A 4HNOA 4REQA 3NQVA 3KL5A 4W8LA 5FF7A 3UY7A 1W32A 3W38A 2VVSA 4KEUA 1F7BA 5F2GA 5IRPA 3W72A 2Y1HA 4YYFA 2OYKA 3LB0A 5M3WA 3KTSA 4V2XA 1R38A 2Z1VA 2ZUUA 4YWSA 1JUKA 4M81A 3VGEA 5E70A 3IJ8A 4I6VA 3N19B 3OLEA 1U5VA 1UBSA 4YMZA 3UG4A 2OG9A 4DHGA 1C8VA 1FDYA 1Z44A 3B9DA 4EAMA 4U33A 4L9YA 2J7CA 1GWJA 3NQ7A 3UWQA 1FY6A 2WSKA 1J2WA 2OZTA 3BC9A 2YIHA 1SZNA 5LA2A 3VIFA 4MOZA 3TOYA 2DSWA 2HV5A 2W27A 4KWSA 4KRTA 1XHGA 1I1XA 2Z6IA 4MWAB 1E9ZB 3VD5A 3FW6A 1MUMA 3K46A 4GQBA 4W89A 2HJPA 3TV8A 4GPNA 4C7DA 2A7NA 1TJPA 1EGZA 1F5ZA 3ITGA 1VS1A 1WZLA 4YHEA 3NOYA 4JGDA 2OQLA 3L67A 1JPMA 3LCWA 1GORA 2QVHA 3UYIA 3LV6A 1OFBA 4AIUA 1GK8A 2XPKA 1EKOA 4JTQA 1KO0A 3UPMA 2GSJA 3WIJA 1BXCA 4NIRA 3Q37A 2O9PA 4H9MA 2QUUA 1CPUA 3EXSA 1KBLA 3GXFA 1VKFA 3LCFA 4ZZ9A 3CNYA 1HN1A 4D6JA 1OC5A 3EAUA 4AD0A 4BJHA 3PPCA 5M03A 3QOMA 4B3ZA 4JFSA 1XSIA 4PL1A 1VFUA 3KWXA 3LOTA 1SFSA 2POZA 3ERPA 4GUFA 3N11A 4UR7A 4CQCA 1EJXC 2YFNA 3FXGA 3RPTA 1XGDA 1TUFA 2NUWA 4O18A 2NQ5A 3CUGA 4OBRA 3VPLA 3CU2A 1NOWA 5TAOA 1HJSA 1ZBKA 1ENUA 5A94A 4ENLA 2PBGA 1YDOA 3EMQA 3VE7A 4GZJA 2INEA 3KOXA 3AXMA 1W8SA 4IICA 3N4FA 4MZYA 2VX4A 1R5YA 4DXVA 4RXGA 3LTPA 4A8RA 4W85A 2G97A 4UIOA 1BGAA 3RAOA 1AK5A 1TV2A 1X98A 4UZUA 2YR1A 2QCFA 1PHQA 3KW3A 2E1WA 4GOAA 2V9DA 1OC6A 2VR2A 4A2RA 2VGIA 4IFRA 3P60A 3GNNA 1TPFA 2OZ0A 4JR5A 2BY0A 1JYNA 4RE2A 2WM0A 3B0PA 1JYVA 2WWCA 3TSDA 3F4VA 3N6JA 2L5HA 4EPEC 1ODUA 5AYBA 3GC5A 2XIMA 2P3EA 3HPSA 1RCXB 4LNYA 1OFRA 2NV1A 2NLYA 4O0KA 1S5NA 1ME9A 1ZQ5A 3TYAA 2BXZA 1E0WA 1U30A 4YN5A 1CECA 2MANA 4XD4A 5CPSA 4FPSA 3WY1A 1O5XA 2QT3A 1F3XA 3MWAA 2CZDA 1VENA 1R3VA 2IPJA 4KIEA 3UT0A 1ZUAX 2D3LA 4K8GA 3H2AA 1IZCA 3EKZA 4L61A 3DHUA 1IYXA 2WSYA 3EA2A 1VQTA 3K30A 3W7CA 3LHTA 3IAQA 1EGMA 5LNVA 5A8QA 1P4CA 1Y0EA 1ZCOA 3QGAC 3W1RA 3LSCA 2BDQA 1N8WA 4ADSA 3GG1A 5FACA 1JQVA 1V6WA 4HQVA 5A95A 3BLFA 2P0IA 4L1GA 4JTHA 1SW0A 3T78A 4Q4MA 1BG9A 2TYSA 1RVKA 3RLUA 1PCKA 5CC6A 3W24A 1D3CA 1XLCA 3GFZA 1A49A 1DE5A 3LU2A 4C6NA 4CLMA 3XINA 3O8AA 1CLXA 4DWSC 3DGRA 1FWSA 1V3KA 2R1KA 4B5WA 5JBDA 2ZTJA 4F0SA 3WMCA 4O13A 5CSSA 4JBRA 1LT8A 1GOXA 3FJLA 3WBWA 3SY8A 2VDGA 2WZTA 1DKWA 3PNUA 1VJZA 3UQNA 1YPIA 4RDYA 4RL3A 5CLTA 3N15A 4KETA 2WJFA 3TYBA 3VMPA 4C6IA 1CEOA 3VUSA 4EWJA 1P7TB 4AZCB 1DJHA 3CMFA 3ZWSA 3W6LA 4W9TA 2ZZ1A 4LF1A 3KVLA 4QNEA 1DJQA 2O7QA 1R6WA 2F7FA 3APGA 1JD9A 3AXXA 1JZ8A 1LWJA 1FXPA 2V5JA 4MYAA 5A6JA 4I8DA 3TJIA 4PMZA 1SO3A 3EXTA 1AJZA 1FX6A 3UCQA 1IZKA 5ABEA 4GWEA 1G67A 3SUSA 1ZP3A 3C6CA 1DV7A 1SQ7A 1R9ZA 1T7LA 2ALDA 2NSOA 1WCGA 4Z17A 3LXBA 4DX3A 3UESA 3SZ8A 3GIYA 4NJKA 1V6VA 3KCOA 3IK4A 2VGBA 1TA3A 3NL5A 3LGDA 1B31A 2BV9A 4O53A 2XSXA 1XLEA 3WBYA 4DZ5A 1I8JA 3MS8A 3MP3A 3SFKA 1NH6A 1I45A 2VOMA 2CZVA 2DT0A 3MBFA 4Y9MA 3SB0A 4FNTA 3WQ4A 1ME7A 4DO4A 2WZHA 4S39A 3H23A 3G1XA 2YZRA 5KZEA 3TYDA 3MZ2A 1J5TA 1MXSA 1ISXA 3TFCA 1IGWA 4KF1A 5I0DA 2QPXA 1E43A 2Q3RA 2FPTA 5BRQA 1P7TA 3E12A 4XD6A 5LGXA 2P88A 2QF7A 4PMJA 3OZYA 4DI8A 3KTXA 3W6YA 4ERAA 2OYLA 2J7EA 4PUKA 4MG4A 2QZRA 3W2LA 2WVUA 4Q4SA 4Z2GA 5DLCA 5LGZA 4MWAD 2YYUA 1S5WA 3S5SA 4UNIA 3VINA 1XLAA 1A5NC 1FBAA 2EG7A 4EK7A 1DJNA 2QUMA 3SQMA 3U9IA 4D6HA 3CLMA 4GFSA 1TKKA 2PAJA 3NZRA 1G94A 4POCA 4JEJA 1V0MA 2Q09A 4NRSA 2B31A 4HYRA 3QRHA 3BXWA 1A80A 5PTDA 1ONWA 5G1MA 1REQB 1F8IA 4J5NA 2UZ9A 4D71A 2VXNA 3PTQA 4Z2HA 2FTWA 2BG5A 2GQ9A 3KRBA 1OCQA 2PS2A 4PRTA 1B2YA 1I75A 4LCSA 5HMSA 1RALA 3RK8A 4WR3A 2XFFA 1KKOA 4UCGA 3JZUA 2J9ZA 1K4HA 1FTXA 3M44A 4G7EB 4MLJA 3GHUA 3LCXA 3J7HA 1V3IA 2FYMA 3L0NA 3OLGA 5HDRA 1ALDA 3HGRA 1O5KA 3VVGA 3GNXA 4CNPA 4V33A 2OT0A 3WNLA 1V93A 2Y61A 1J5SA 1VH7A 4NJGA 4UTMA 1NOUA 3AC0A 3LA4A 1ADDA 1KM4A 1UZ4A 4JL2A 3MCOA 3TW7A 4U2YA 2Z1XA 3L5LA 4IP7A 4QIUA 4GVFA 1CZ1A 4DZIA 3COTA 3MPGA 3CGTA 2OOGA 1JCJA 3QXBA 2FJUB 3M0JA 1YADA 4GUHA 1WB0A 3KOFA 4UCFA 2Q8XA 2DH2A 3UPBA 4AWTA 4NU7A 2WO5A 3WQGA 4IMFA 3SCWA 4CD7A 3TQ0A 4B90A 2V38A 2X1SA 4RZ6A 4UMCA 2CBUA 2BOGX 1KFEA 4W5UA 5JXQA 1FWRA 1C29A 1XFBA 3H21A 1PKYA 1FWHC 3IS4A 1A5KC 2VC5A 5HBFA 1J11A 2W9MA 3U3HA 1PZ2A 3W27A 1C93A 4XV0A 5LNSA 4DI9A 4GIYA 4QSFA 2DFAA 4AYGA 3EX6A 3W1UA 5G4EA 4Z2LA 1O94A 1XRVA 1OYCA 1CXKA 1R3SA 5AN7A 4FEZA 1IZJA 3BLIA 2X1RA 3DBNA 2PDKA 3WH5A 4IHCA 1R87A 1MFVA 4H8UA 3A4XA 3UR7A 1G01A 1H63A 2C3ZA 3LLFA 5HK4A 2ONEA 2X16A 3S5YA 2J47A 1ZBWA 1E9LA 1GHRA 3A47A 3UVAA 4XZLX 4ZMGA 4GI8A 1ADOA 3QR1A 2PSNA 3CAVA 1SR0A 3W0KA 3AUJA 3BE7A 3VCNA 4F2BA 3DBPA 4OIFA 3UP8A 3WLSA 3TTSA 3G1AA 4IP5A 1XUZA 2J4GA 3WFAA 3DFNA 4J7RA 3RMJA 2GQ8A 1LQ2A 2NXIA 3LCIA 4K8EA 5A6BD 1XIEA 1XDLA 1V7YA 2ZZ2A 4G7FA 4FP1A 1SFTA 1AODA 1D9EA 1MYRA 2Q71A 1R86A 4Q8VA 3WQWA 1QHZA 1QJWA 1OFPA 5CPQA 1SMDA 4A3UA 2YB4A 3WQFA 2XU2A 5E6ZA 2FPVA 1G6CA 1E15A 4RZ4A 4W87A 2YBTA 1NVMA 3WL1A 2Q6ZA 2J75A 4ZB5A 1MQQA 2CIPA 4ML9A 1DJGA 5DCEA 4R88A 3CWOX 2J7GA 4B5NA 4HHHA 3WG6A 2FH6A 4BHYA 4O16A 3EOUA 1E4LA 5GJNA 1M03A 3QVQA 1JZ5A 3WUEA 2H90A 1W1A1 1Q13A 3GDMA 1DIOA 4AB4A 3EEZA 4IT1A 1FHDA 3BARA 5IFTA 2ZXDA 2HROA 4IQLA 1Y5WA 1T99A 3OYXA 4I7VA 4MJ2A 2WANA 5DELA 3BG9A 2X41A 1JD7A 4UZSA 3I6EA 4IQDA 1Z9AA 3S2NA 2W67A 4TX8A 1YXDA 1WZAA 1MUCA 2TRSA 3TIMA 3BPWA 1GGOA 4S3FA 4TTGA 3MW7A 3QHNA 4BQ2A 2X0HA 2Y0FA 1Q45A 4ZO9A 4NASA 4RE4A 4UQEA 3OVRA 4TIMA 3POHA 4DM1A 1W5PA 1VC4A 4H6RA 3DG7A 3RPMA 3BVJA 4JX6A 3QTPA 4ML4A 1E6PA 5EMLA 4HTBA 3STEA 3PS7A 1TMLA 1UR8A 3T8LA 4FF5A 4KGJA 3PSVA 1I2OA 1S1RA 3W73A 4C7GA 1OF6A 1V3HA 5DMMA 3AYRA 3TZFA 2HZGA 3LMZA 2DVXA 2WNWA 5C7VA 2OB3A 3KOYA 1NAL1 4M6UA 3GR7A 1SZEA 3T2OA 1GUVA 4QS6A 3DI1A 2GZXA 4IJBA 1Q4WA 1WDDA 2RFGA 1G0CA 3DENA 3CZ8A 1WXZA 2TAAA 3Q65A 1MW3A 3ES8A 1R0MA 1PWMA 1CLVA 1OX6A 1U5JA 4DUXA 1FCBA 4TV6A 1RQEA 4HPJA 2GGJA 1GVRA 4MGGA 3GTXA 2WMIB 4PMDA 2RDTA 4PSRA 4TR9A 3QPZA 1J01A 3VNMA 2NVDA 2DZSA 3HO8A 2Z1WA 4M24A 3W74A 3LHWA 2QJIA 1E56A 4LYKA 1MW1A 3IVSA 2V8ZA 3FYOA 3PSWA 1UWTA 4NQ1A 2WMIA 3AU6A 3ONBA 5D05A 2ABBA 1F3WA 1RD6A 4X0VA 3DESA 4MUZA 2BVDA 3MHGA 1I0DA 3GG0A 3MT1A 1ZALA 5I3IA 3FA5A 2D23A 4LAOA 3SCTA 4NNAA 3BJFA 5FAGA 3NZ1A 3N2TA 4UMBA 4XKYB 3M0XA 4B4HA 2PP0A 3N4AA 3KL3A 7TIMA 1FWCC 1M1BA 4KT2A 5ABGA 1B4KA 2VWSA 2E4TA 1CXLA 4IL2A 1QNOA 1LDCA 7TAAA 2YKKA 3VX0A 1RD5A 3S6TA 4IMGA 2VEFA 1Q6GA 1GQJA 2WW5A 3NVTA 3C5QA 2QW5A 5DO8A 1M6JA 2QCLA 1QOPA 1P5BA 1XJBA 4H83A 3PK7A 3CQJA 1A3WA 1YXCA 3RJXA 3DYMA 4ADUA 4GYFA 4QSHA 5A6LA 3AIWA 3XISA 3QW4B 4M1BA 1AQ0A 1J4EA 1KTBA 1D8CA 2PTWA 1MSSA 5HQMA 4NZ3A 1MW2A 4PRWA 3TXZA 3A9IA 3CHCA 1GJWA 3L4YA 4XG1A 1YW1A 1KA9F 4JTDA 3OIHA 1KGWA 2ZXBA 1QCWA 1WBJA 1YIXA 3QC3A 2UY5A 1KM2A 2BVWA 5K3VA 3NCOA 1EDGA 4UB9A 2NV9A 4NRRA 2QJNA 3P93A 3WF4A 1LOQA 1K4GA 3VK5A 1MW0A 3FDGA 3GBDA 3NQ8A 1UD3A 4C1NB 2REQA 3EOLA 2GJNA 1D7FA 1ISWA 4CNOA 4LYPA 4JTAA 1BVWA 1XLIA 5CZTA 3GKAA 1TTQA 3WMBA 4OECA 2PDXA 1PCWA 2B7QA 2EJ1A 3ELFA 1LORA 4UNKA 4O8RA 2XVGA 4MB1A 4PCPA 2W91A 4XZ9A 3VFCA 4JTTA 5HJLA 4FLQA 3S4TA 3A4JA 3VIIA 3GZ3A 2ZTKA 1W17A 4XAGA 3OBKA 3D46A 5H8PA 3GX9A 3Q45A 2ZUTA 4ERGA 3ZJ6A 4LS0A 1QMLA 1Q6FA 3BGJA 4JTEA 5HUPA 5REQA 4YVVA 3S9IA 1MWOA 3QV8A 1KBKA 2ZA2A 3DYPA 1F05A 1P6CA 3D6NA 4Y96A 4PMOA 4YPJA 1N82A 1P1MA 2OO0A 5BROA 4N9EA 1O68A 1WAUA 3EB2A 3D0CA 5DFAA 1EHNA 1RY8A 1UJQA 4JQ2A 4UWMA 4EF9A 1VEPA 3ZT6A 1F74A 3N3MA 1ZNNA 1MRQA 5DXYA 3SN0A 4IG2A 4DJEA 4LBUA 2OWCA 2AGTA 4H6KA 3BJSA 2J88A 2Y62A 1GCYA 4IPLA 2XUCA 4H9ZA 3C2VA 5M1TA 1JCXA 4JXCA 5CBIA 2ISFA 1B57A 3H26A 1M7OA 3CASA 4AXKA 3NSMA 4IXXA 2WK2A 3AOFA 3ARPA 5CCZA 4XO7A 4MNMA 3RX2A 4LAUA 2FTPA 3C0JA 3WNOA 1VYRA 5E0FA 3CQIA 2DEPA 4JHMA 4O0ZA 1LP6A 3MSDA 3UCCA 3ZJKA 3TW9A 1R46A 5A3HA 1JXKA 3R1ZA 1JDDA 3LRMA 1E6SM 1XBXA 4YJ5A 5DBUA 5LKYA 1R47A 3O0KA 4Q3MA 3BW3A 4HZ6A 3MI3A 3TWAA 4XZWA 2XYLA 1NJJA 2C18A 1O12A 3WLTA 4ZL1A 1W3JA 1EP2A 2H8ZA 3N3TA 2PEVA 1X6NA 5HNNA 2VDHA 5BZAA 3EKLA 3VIMA 1HTIA 4LVGA 5ABTA 1HJVA 2NZLA 2ADAA 1M53A 4UBPC 4E0CA 4YVPA 4E8CA 2WJEA 4LTSA 4XWUA 2OGYA 1TWWA 1QPKA 3MMWA 1EIXA 4KWWA 2W66A 3A22A 3BQ6A 3C8NA 3EPNA 3WLKX 4A22A 1T41A 1TRDA 3O6YX 3PG8A 3KLKA 3ZWTA 1WDRA 5A6MA 2XIQA 3DG6A 1PIIA 1TPDA 3SBFA 2VJXA 1YDNA 1Z48A 4OJYA 4HJWA 4J3VA 3T09A 3ISIX 1US3A 1PO9A 5F4SA 4JNMA 1E3ZA 1J2BA 3NXLA 3MZNA 4IISA 2JIEA 4N2YA 3V5OA 1KLYA 3AWOA 1EB3A 5KZ6A 3NPVA 3ZLHA 3R4IA 3QHOA 2E6YA 3TU9A 5BNKA 1IWPA 5ABFA 1TJ1A 3BAXA 2YDRA 4NAFA 1LWIA 4Q22A 1R3TA 3AXKA 1OHLA 4U3AA 1NDVA 2GSEA 3B04A 4X3ZA 3LHUA 2CZEA 2DJXA 4PE8A 4HSHA 3ANUA 3FYYA 3UXDA 3VKJA 1UA3A 4PMQA 1KCKA 1VFTA 4XSMA 5KTLA 2O4QA 3AROA 1QHOA 2WHKA 5E09A 3TXVA 3FX4A 3LPOA 2ZE3A 5LIXX 1W9DM 1J6PA 4TXEA 3RXZA 3URBA 3ARZA 5I3FA 1R3YA 5HINA 1KFWA 1SJDA 4P8UA 4PMUA 3B0YA 4NYUA 1W1ZA 1WNOA 3W07A 4UTTA 3L68A 3N17A 2Y85A 3CPGA 4JKKA 3LGEA 3UZJA 1T96A 2PDHA 4QE1A 1ITXA 3ITCA 1GTHA 2HVMA 3QFEA 4QDMA 2OKTA 4HVXA 1ONXA 3W1QA 2WM1A 1TIMA 3IIOA 3BUVA 3UZ5A 3SUWA 4JN6A 5EMUA 1H1ZA 3FVMA 3LHVA 2BSLA 4AYSA 1E72M 2A6NA 2ZDRA 5IHRA 4E3TA 4BKNA 1UKPA 2YCIX 1DQUA 4ZE4A 4J3TA 2J66A 4DAIA 3V18A 2BNJA 4AXNA 3UA3A 2UY2A 4LSBA 1EJWC 1V6UA 5AZ0A 1XF0A 2OEKA 3PWAA 2BMBA 5EL1A 1W8GA 2ALRA 3MHUA 3MUY1 2PTYA 2J8GA 5E9XA 4H7ZA 2BP1A 4NX5A 2C6QA 1VPQA 1AH3A 3DEQA 2HISA 4IMAA 1LBLA 4QLLA 2YXXA 2Y5EA 1NELA 3U48A 1PKMA 3GU9A 3AISA 1EDTA 1QXLA 4LU0A 4QR6A 1XLDA 4DPQA 8TIMA 1V8EA 2XN0A 3S46A 4DPPA 4EE9A 1B3XA 1EPXA 4Q8MA 3NQDA 4Y6GA 4GYJA 4CCCA 4GCXA 1FKWA 4C1KA 1RY0A 4X9SA 1EIBA 3VKDA 3W2JA 1KLZA 3R11A 3PZMA 4M82A 1HKWA 4B5XA 3PBGA 1GKQA 2IQDA 4DXXA 4XZBA 2XISA 3E2VA 5AYZA 4HA4A 3P84A 1TPC1 4LT9A 3T0AA 3VMOA 3E0FA 4XVEA 1YLVA 3JW7A 1HVXA 1PTAA 2XGZA 4HCLA 4JKLA 4Q8PA 4IIFA 3WH7A 2EPHA 1DIEA 3TYEA 4EXBA 4QJ3B 1VHNA 4GVHA 1U22A 1L6WA 4MWAA 3PBVA 3SIZA 1PS9A 1UR4A 3IK2A 4LUSB 2CPUA 3KBWA 5C9XA 4PCSA 2A3AA 4NJJA 5AHMA 2C79A 4GIEA 3QY6A 4PBEA 3RU8X 1XC6A 2WNNA 1BF6A 4S3CA 2RH9A 2PODA 2X1TA 1UKQA 3SGGA 3GH5A 1SJAA 3CEUA 2DPEA 4ZCWA 4JY9A 1QW8A 2P0OA 3GH7A 1M9HA 3QYQA 5EFDA 4ATLA 4L6OA 3IARA 3IVUA 3VC5A 3VIGA 4UTTC 3HQNA 3OGSA 3L4TA 3OA5A 3KE0A 3CH9A 3VOIA 3GM8A 5CG7A 4AFYA 3CWNA 3C4UA 1MVYA 5FJPA 1OFOA 4FOJA 1JNDA 1JUBA 5JBEA 4HMEA 1FP8A 3HTWA 1PKNA 3SSZA 1PYFA 4E4UA 3TAKA 4W86A 1JPKA 3CT7A 4QLKA 3VX1A 4IIGA 2BGSA 3WLOA 3M16A 3L23A 2VFDA 4S3EA 3HBLA 1D8WA 2CYGA 1UP2A 1YDVA 2RKXA 5K7JA 3MHFA 1TPUA 4IWWA 3WDPP 3OU8A 2ISSA 4DYJA 3PZQA 4CNUA 4JIEA 4GQRA 2HNEA 3KCJA 4RE3A 1SUXA 2VQUA 4TMBA 1XIHA 4PMYA 2QXWA 3N6HA 5HQLA 4Y9NA 1RK6A 4IFKB 1R9YA 4J9JA 4WX2A 2ZUWA 4W7WA 1M7JA 2XSBA 3OLDA 5A8PA 1TVLA 4ZOAA 3SY1A 1VCGA 1FFQA 3G6MA 4DZHA 2J9XA 4O54A 1ZBVA 1UPPA 1KCZA 3S5NA 5M5DA 3GU2A 1XIGA 4WY0B 4RLIA 1JJKA 4JFWA 2AKMA 4GJJA 1XIFA 2X42A 3E9AA 3RIKA 1YNPA 2XTKA 4XD3A 4K1WA 3S47A 3P8JA 2ON3A 3T0TA 1KTNA 4O1BA 1O1HA 1F4HA 2BY3A 1FWEC 4A3HA 3PN8A 4QISA 5C9UA 3MA8A 1G69A 4A3QA 3CAWA 4MUPA 3WLJA 4V28A 1GVOA 2OLAA 3NQ2A 2VX6A 2P50A 2ISDA 1DWIM 1B4EA 1ZJBA 2I1OA 1L2QA 4AVNA 1G5AA 2G3JA 4AZ5A 3AZRA 3E5PA 3LI0A 3PZVA 5EFFA 5KSWA 1J0JA 3MV01 4H6EA 4PN2A 1W5MA 4QRNA 4IF2A 1VPXA 3FFSA 2O9TA 4URIA 1I2QA 1KRCC 3NL3A 4LAMA 4N9DA 1JGMA 1K8CA 4PBFA 3RUBL 3VNJA 4YTUA 3A64A 4S3JA 1RP8A 3THDA 4EXQA 4M6VA 2FJKA 2Q3OA 1JPHA 1V02A 3ITXA 3F2BA 3A5FA 4FLRA 4U2ZA 4GINA 1W6TA 4PA8A 3H7UA 2G3MA 2QEZA 1CGTA 2DORA 4LY4A 1XRFA 2IMRA 3GVWA 1WDPA 3N1AA 2OSWA 3GRIA 3UZYA 1ZPTA 4ZSUA 4D8ZA 4B3LA 4WDXA 6REQB 2ZQ0A 3NG3A 1DIDA 3A3XA 1JCNA 5LHEA 3AS2A 5K2ZA 3C2FA 3PZ9A 2RHGA 3VDAA 1GYNA 1NFBA 3V0SA 4K7YA 5I2UA 4KCVA 4RX0A 2DUAA 5ABFB 3APTA 3F4DA 4OUEA 5H91A 2DVUA 1QPNA 2G41A 2F6XA 5CXPA 2VT0A 1HF6A 4AZCA 1WXJA 3GTIA 5I7GA 1EC9A 1SU5A 4L9ZA 3HFYA 4G9PA 4NG3A 1TQXA 4IJCA 4ZODA 4HZ8A 1H09A 2R24A 3LM7A 1QPOA 3HQPA 2VP8A 2XJ7A 5BXPA 1TX0A 5ABHA 1KGXA 5KITA 3RCYA 1W5OA 4GVIA 1UD6A 5G2WA 5AC4A 1NF7A 4OUIA 2C8NA 2ZE0A 3QPYA 4B5UA 3NM3A 3M47A 1SW3A 1RXOB 5KINA 3S0CA 1XLHA 3QR3A 3GW3A 5I5RA 1JZ6A 2VRKA 4AW7A 2NX1A 3U6WA 4DYEA 1VCFA 1TTJA 3CAQA 4IUOA 3VZZA 4D2JA 4H19A 1RA5A 1MUWA 3TSMA 3W7HA 4CQAA 2GDQA 3CIVA 2Z00A 1W56A 2WV8A 1JPDX 3SFWA 1WV2A 2NQ9A 3FSTA 1S3TC 5JMUA 4MADA 3UGRA 1KB3A 4Z2JA 3FEMA 4TX9A 1LG1A 1AJ2A 3BLLA 4YYCA 3ITLA 5TF0A 1CXIA 4GABA 1GKPA 2YX0A 1NQKA 1B3VA 2V2HA 3QR0A 4JCMA 2BGQA 1E5NA 2IKJA 1JFHA 2OZ8A 2A0NA 4P7LA 4ACYA 1VEMA 4P7OA 3THCA 4FLSA 1W54A 1BEUA 3LHZA 4W8BA 4GNJA 3ABXA 1YRRA 3G18A 4MDPA 2PP3A 3QV6A 1AH4A 1K6AA 3M5XA 3AXHA 3MP5A 3ONCA 3SM0A 3W86A 4DWDA 3AJXA 1LQAA 3IIXA 1LLOA 3E74A 2QV4A 3WBAA 1PIFA 4FX6M 3TLQA 2XG9A 3EX3A 4IG2B 3GVRA 3G6LA 3R10A 4Y9AA 3ES7A 1EO7A 1H62A 3G0UA 2W61A 4N6FA 4GI6A 4GH3A 4JY8A 2CKSA 4FI4A 3PBUA 3N13A 4ZO7A 2GJLA 2CW6A 2JF6A 1YDYA 3UBPC 2VZSA 2ZX7A 1QTWA 3IRDA 4LFYA 1NU5A 3HJZA 1TJ0A 3CEPA 2A1YA 3HM7A 4P2VA 5I00A 3ITVA 1B3WA 1C8XA 1DJZA 1JRBA 5F1VA 2TPSA 4INFA 3GR8A 3UGVA 1A3XA 4K37A 3FXYA 4JTKA 2J7BA 1F73A 2YZ5A 3TROA 4DBUA 4L1XA 3IJ9A 4KMQA 4CCEA 1BWKA 3SRDA 1KRBC 2I5IA 1FUYA 2WXDM 3U8GA 4A35A 1A4LA 2V0TA 2P8BA 1XGZA 4XK2A 4GH1A 5KEZA 1W91A 3PAOA 3RILA 3S1XA 3SJNA 1OFQA 1RHCA 3W7NA 2DZWA 1E0XA 2WSRA 3FLUA 4R85A 1GYLA 1IR1A 4Q8TA 9CGTA 3WQVA 2IS7A 3EBVA 4IM4A 4D1IA 1PKLA 4Q8OA 3S1UA 1JDCA 1UBPC 3AYSA 3WD3A 5C9RA 3W22A 5AC7A 3ANYA 3G1RA 1LOLA 5LXXA 3WJXA 5HUOA 2OO6A 1E55A 3IVTA 2C13A 3PZTA 3B9AA 3G8EA 4UFMA 2AGKA 3BO9A 4PB3A 1XDJA 5BOOA 3NEHA 3EMCA 7ODCA 1GG0A 2QCDB 4D8LA 3T07A 5D8WA 4QNWA 1QHPA 4CN6A 4NX0A 2J6VA 3GBEA 5LIWX 5I3JA 3BAWA 3QKEA 2GOUA 3IV3A 1UPMB 3C56A 1UP0A 1OADA 2ZADA 2J7HA 4X9YA 1Y65A 3CHEA 4WOZA 1DORA 4IXHA 2J8FA 2YJQA 4CQBA 4G2DA 4FIRA 5F4WA 5CQ1A 1UOZA 1DP0A 4PFHA 4Q8QA 1BHGA 1WAWA 4N9BA 2E3ZA 5KETA 1B3YA 4LCQA 1M01A 2JGQA 3N6QA 3UWVA 2EPOA 4W7VA 1X8CA 5JBFA 1VAHA 1EX5A 3S2JA 1VIWA 2A2IA 1CW2A 5CJMA 4GGHA 2CEQA 1XLJA 3N12A 4R9XA 5DEZA 1YNQA 4DAFA 1K02A 3GXIA 3AHZA 5FCZA 1T8XA 1EX1A 2JGYA 2J8TA 3GXMA 5AHEA 1A53A 1CT5A 4GG9A 3SGZA 4YCOA 3GFYA 2P53A 2XVPA 2NV2A 3UERA 3W7PA 2EGZA 4G8TA 4FR6A 4D72A 1TA3B 3VA8A 1KM3A 1H7XA 4XX6A 4CEXC 1OG0A 3PPHA 3ABSA 4DF1A 2WJZA 3RU6A 1R3WA 4N7QA 4O15A 3TN4A 4DUWA 2PU1A 3MMDA 1YNYA 4KWVA 1J0KA 2VFFA 1MMFA 2VCAA 1CGVA 4QP0A 2DV0A 1M7PA 3BTNA 2PCQA 2JALA 4DB7A 2OTDA 5KZDA 3UXLA 5IDZA 2OOFA 3GTNA 4MF4A 4UQ9A 4R7JA 2P8CA 1H7NA 3D3AA 4Z0JA 1FOBA 4G5DA 1KTCA 3W70A 5LNUA 4QQUA 1H3GA 5FL0A 4UFIA 2NLIA 4MMWA 2CFFA 3NQMA 3V1HA 1GJPA 1S2CA 2YSWA 4XKYA 4K1GA 3HMJG 3NAVA 3WQEA 3R58A 2J13A 3RRAA 2X1IA 2NQHA 5DRCA 1JG9A 5FI8A 3K5XA 5BCAA 2ZVRA 5CGTA 3KEHA 1THFD 2R1MA 5JIWA 2ZUMA 3AMDA 2BX7A 5DQPA 5A6BA 2O0TA 3MY9A 4J28A 2E9LA 3CK5A 5DMYA 2PDFA 5D03A 5CJNA 4LB3A 4FOUA 3PWIA 2OVLA 2E5CA 3C86A 2Z25A 1Q2SA 1KQZA 1AD4A 3IGXA 3IGUA 4WJEA 2OKOA 4G56A 1QPQA 1W1B1 2BGNE 2AMXA 1XR2A 3E0LA 4MWAE 4RW5A 4Q4RA 3ZIZA 1IE7C 4AHOA 3FJ6A 1UWRA 1F07A 1QI5A 3CAKA 3G77A 3SCQA 2XIJA 3BG3A 3H2EA 4HOWA 1JNEA 1IEIA 4S2BA 3TA9A 4PTNA 2V3FA 1ISVA 4UTFA 3MVIA 3CUIA 3W6MA 3SRFA 1QATA 1UR0A 3PBYA 3RO6A 3WFZA 5MKGB 3H2NA 4UQCA 3QW3A 3IJ7A 3GAYA 2A4AA 1I6NA 4MB4A 1MO0A 3B8SA 3I7RA 3SCVA 2PLCA 3WX7A 3P0XA 1DPMA 1GZJA 3M0ZA 3ARSA 4AF0B 2GJPA 2ZX5A 2EEXA 2RGMA 3ZT7A 3UR5A 1O5QA 1J0IA 4NUWA 2A3EA 2QHAA 1F8MA 5U7SA 4KFNA 1TX2A 2PWDA 4HNTA 3G1FA 1RQBA 1Q2RA 3L21A 3B06A 1OIMA 1CTNA 4PZVA 3LI1A 4ZTXA 3DG3A 3H24A 4AY7A 3E3HA 3U0HA 3EDKA 5D2WA 2VGGA 1XIMA 4U3CA 4HYVA 1XM3A 5DANA 2A7PA 1EBGA 2E28A 3E2RA 2BASA 4TVUA 3IGHX 3B40A 4O1DA 4GNKB 1P1XA 4H2CA 1UWSA 2DUXA 3CXOA 4JD4A 4JIPA 2G3FA 4EAYA 1G4PA 4RKAA 1A5UA 1DWJM 1OX4B 2BLEA 2BWGA 3OIXA 5BMXA 2CLFA 2GUUA 2AQVA 4XBJA 1D7KA 5U4NA 2I7GA 5GNYA 3WCZA 1E5JA 5M17A 1DXFA 4LVFA 1OGBA 4H6QA 3ARVA 5CKSA 2Y2WA 2DZVA 4J3SA 3G22A 1SZFA 1TREA 3ZLFA 1DVJA 2PB1A 2A3BA 1UQZA 2HXTA 3QC0A 3RITA 5GNZA 1CNVA 1W2VA 1TV4A 1UJPA 3I7SA 1SPQA 1PX8A 1WDQA 3DFQA 2FHBA 2YBUA 1A5AA 3DFOA 1B5TA 3MYOA 1F9CA 5I79A 3SUVA 3LQGA 4CD5A 3M5VA 1NIUA 3S1VA 2WQPA 3S42A 1LROA 3T4WA 4LUSA 2GVLA 3RM4A 3O07A 3MI6A 4IPPA 2FZMA 4LUJA 1EEXA 1AA1B 1RVGA 2VC6A 4H8HA 3NTYA 1GW9A 3PM6A 3LLXA 2D2OA 5CC3A 2IXUA 5G2HA 3W2KA 4NI8A 1DTUA 4AMAA 1FRBA 4C6JA 4HB7A 4C6KA 4EX4A 2PWEA 3GXDA 4Z2IA 4CN4A 3NA8A 2YGYA 3PVFA 4JICA 3WJSA 2E5DA 4FNPA 4WOQA 4H9XA 2WKLA 2WNQA 3V35A 3MMTA 3U2OA 3W7MA 3HPAA 4M51A 3GVGA 4DIAA 3UNDA 1TWSA 2EPLX 2F38A 4CNNA 3LLDA 1GQIA 4LVBA 4EACA 4CUCA 4E8DA 1LL7A 2OQYA 1NEYA 3QEZA 3MB9A 1LLZA 3EDJA 3QOKA 3VGBA 3VXGA 3DUGA 1NDWA 1V0LA 3ZOAA 2YOCA 3CIWA 2FMNA 3HQ1A 4CQ9A 3VOHA 3MI2A 3H55A 4H9TA 1LQ0A 3DFSA 1GJUA 1TWIA 1EC7A 3S5OA 2UBPC 1H60A 2ZCGA 1J96A 1AW2A 3NQGA 1GQNA 4Q8NA 3HG4A 3UXAA 2F61A 3PJTA 3P80A 1W2PA 3VGFA 3VGGA 2WCAA 4PB4A 1GVSA 1U1UA 3AS3A 4LRSA 3VD9A 2J78A 3ARUA 1R2TA 4HU3A 4V15A 3STCA 3GDTA 2OJPA 2JFEX 3WMSA 2HPIA 1OZQA 2JQXA 4FO4A 2EBNA 4W4QA 4HU4A 1L6YA 3A12A 1V3MA 2GUYA 1XQKA 4XZNX 1HFBA 2J7FA 3S9ZA 3N4EA 1ZP4A 3RCNA 2Z7GA 5D09A 4NF7A 3EOOA 5L9FA 4IH3A 1WKFA 5F2LA 3L4WA 2FH8A 4C6LA 1MEHA 1JYWA 5HANA 3UWEA 3VNIA 1LOSA 3AIBA 4MNKA 2G4FA 3T05A 4LC6A 1QOQA 5D9PA 4R9OA 2GLKA 1PE1A 3A4AA 5BU9A 2R1LA 3VABA 3A3WA 5HWNA 1VGAA 2C7FA 1RZMA 1TFVA 4IGNA 3G5EA 1Q6RA 1QBAA 4FOKA 2D2HA 2J62A 4ZB2A 2FKPA 1A0CA 1HO4A 1CBGA 1CWYA 1GKRA 3WDJA 4RE0A 1GOIA 2GK1A 2Y5JA 4FXSA 4MKVA 1B3OA 3KX6A 3TYCA 3AQUA 4ZVJA 4UR9A 1E73M 1CB2A 1QO2A 4F66A 3FGCA 5EMKA 4M19A 3WNPA 3VU2A 4LAKA 2IQ0A 4Y90A 6REQA 1W3LA 3VD4A 1K8ZA 2ZX9A 5CSRA 3RR4A 3VDHA 5A2BA 4PSPA 2EHHA 4F48A 3M0IA 2AOSA 2GVJA 1MXGA 3AMLA 2EF9A 2OSYA 4HPNA 3LRLA 4JTLA 3T8QA 2RJHA 2B7PA 3TCEA 1LCOA 4JYFA 3G0XA 2EQDA 2FFIA 3GDRA 2BOFX 5KMYA 4GISA 3IUIA 3W75A 3RRXA 3RM9A 2QGHA 4CCDA 1GVYA 2WVVB 4FA3A 4KS0A 1KCXA 3C0LA 1D3GA 3WSUA 4M8UA 5CAHA 3ZYZA 3L2MA 2PDIA 3QTGA 2I14A 3VYLA 4GRSA 2W0UA 2BY2A 1X1ZA 3AIRA 4R3UA 4RDWA 3FEQA 2J24A 3TUUA 3UJEA 3GE7A 3U2EA 3CV6A 2R94A 4W5ZA 3L2LA 4L4MA 1S3HA 3PP7A 3TEVA 1SR9A 3GC4A 3O0FA 3OO2A 2VENA 1YX1A 4HU0A 3WUBA 4GLEA 3P81A 3S1WA 1TO3A 3PC0A 4WXZA 2J77A 1DJIA 2W63A 1Z8AA 4LUTB 2QVNA 4KWUA 3CYJA 1UH2A 3OEXA 1BKSA 1HGYA 3FY1A 1UD4A 3RPDA 1NWRA 3QMSA 2VRJA 3PFRA 2VWTA 3V5FA 1N8FA 3KLLA 1W3TA 3HQOA 1VRDA 5DXXA 7PTDA 1JGIA 5CPOA 4O50A 3AU2A 2PGRA 3HJEA 1TB3A 5IOBA 3NYDA 4QEEA 3TSBA 1SW7A 3P61A 4OV4A 4P5UA 5A8GA 1LT7A 1EJ7L 1FDZA 1Y7VA 3O63A 5AOUA 3L66A 4IP4A 2OEMA 4X63A 4PFMA 4ASTA 4QAWA 3C52A 3UZXA 4NAFB 3GS6A 3GQYA 1EPVA 2ESCA 4A21A 2OX4A 1HT6A 3PZOA 4JIQA 3WQ5A 3TTYA 1V3JA 1VIZA 2HXUA 3AS1A 2QJMA 4C91A 2QUVA 4D6EA 3E5BA 2WHJA 1SMAA 1DOSA 1KFJA 1YMYA 2J27A 1PWLA 1UB3A 1ZU8A 3ZZ1A 2Y8UA 5DBTA 4CU6A 5CPMA 1H1YA 3OQEA 2ZICA 4A8IA 4S3AA 4EIVA 4C90A 1TPEA 1E1CB 5HWJA 2OYMA 2Y7DA 2DZPA 3FCPA 1K03A 5M2FX 1KFCA 2CHRA 3VO0A 1AG1O 4HD5A 1YE6A 1XX1A 2WVVA 3A5VA 4Q4OA 4TV5A 3PY2A 4ZQPA 1GOMA 1TZ7A 4FZIA 2QAPA 4MNLA 4B3KA 2PWGA 2JKEA 1OFEA 3A23A 3PBMA 4O1AA 3CL7A 1KM1A 4YTQA 3KBSA 4JOMA 2XSAA 2NVCA 2NQLA 4ROPA 1QASA 4ZBCA 1N55A 4ATDA 1K6WA 1UA7A 3REQB 1P6BA 3DFTA 1GOWA 3S83A 4DYKA 1Q6EA 3R8RA 3HG2A 4FX7A 3W7OA 4KIRA 1VBUA 1QK0A 2VZOA 1TCDA 2YLAA 3F03K 3VIPA 1H50A 3GHRA 1CENA 4AF0A 4AZBA 5JU6A 4HHMA 4H9UA 2J6XA 1XFCA 4BEQA 4XSLA 4F9JA 2PDYA 3FN9A 3W29A 4DBSA 2X05A 4WHBA 1AW5A 3W7GA 3KHJA 2A5HA 3LZ3A 1IXPA 3H2MA 4LS1A 3GTHA 4YHGA 4IJRA 4YTRA 1GVQA 1NOFA 1W1VA 3TQPA 4CNTA 2E77A 1OF8A 3PZNA 5T9CE 1JAEA 2PDGA 2W92A 4LALA 1EXPA 3GKFA 5MKGA 2CLLA 2Z26A 4JIRA 4D1JA 1G7VA 3WLQA 1V4YA 1ZJIA 4WRHA 3OZPA 1H7OA 2ZBTA 1MQPA 1XLLA 1M04A 1ZRQA 2D1ZA 1NTHA 3EWBX 4ES4A 3N2BA 4M0XA 5MF5A 3TNBA 3VOJA 2D22A 1KFKA 4LVAA 2FGZA 1VR6A 4HYWA 1RJRA 1C90A 3AMGA 3DXIA 3PZGA 4LUIA 2PLMA 4ZOCA 3VIJA 1H7WA 1AQMA 3DYOA 1H5YA 3CHDA 1F61A 3U57A 3OP2A 4QITA 3GR4A 4DJFC 4P8XA 3UWYA 3M5ZA 1FHUA 2E5BA 2DT1A 5B7ZA 3KS6A 1KC7A 4FF7A 3GB6A 2WMHA 5GJMA 3G3MA 2VFGA 4XD5A 5FESA 2JKAA 4XVDA 3H22A 3NWRA 3E2SA 1D2KA 1OCBA 1PSCA 1KRMA 3U4FA 2ACRA 4CEUC 4DBWA 1XL9A 2WNZA 2XH4A 3QHMA 1BTMA 3LNMA 1PV8A 1K3UA 2PWFA 2OPJA 2XH7A 3BZJA 2YDSA 1IXQA 1Q5MA 5ECUA 1QR7A 1OCJA 3STFA 4DLFA 4WCJA 5LIYX 3W84A 5JUVA 3B8TA 5AFDA 3F5LA 1BWVA 3UU0A 4PMRA 2ASHA 1AH0A 2EPMX 4HPXA 1K7FA 1OC7A 1RH9A 2Z27A 3WNNA 5AB3A 5AHIA 3WQOA 1GW1A 3R0UA 5FF2A 4WDWA 1HL9A 3W4RA 5CSYA 3N18A 2BTMA 3SIMA 3U5UA 1XRTA 2B7NA 4MZ8A 4HZ7A 2EKGA 2GDUA 5REQB 2DZBA 2QDDA 4CGTA 1OX5A 1J0ZA 1I1WA 2YL8A 4GMEA 1NY1A 1AVAA 3VDCA 4CD4A 2HQAA 2E9MA 1ZHAA 3ARRA 3T55A 3CT2A 3MJYA 3PAJA 1UIPA 1Z42A 4QG6A 2WVTA 2F84A 3TN3A 4AZ7A 4JPGA 7REQB 2NUXA 1ZAIA 5EPDA 1W9PA 1EJUC 1J79A 2XH2A 1G7UA 5G4WA 3W7QA 5GPRA 4UFHA 3UD6A 3BG5A 4XB3A 3MJMA 4ZQMA 2GQ3A 4Z08A 1X1OA 1PDYA 4FIQA 4WSJA 3T08A 2ZZ3A 4DJFA 1SVDA 3RLVA 3SN1A 5FEWA 4M80A 3GDBA 3BLEA 1R3RA 2OODA 2WMJA 2CKRA 1RCOB 3FAWA 1XYBA 4B4FA 3Q94A 5HJYA 4OV9A 4RXFA 3AIUA 2F6KA 1XI3A 3N14A 4D8AA 5C70A 4MJ4A 4Q32A 1WP6A 3BURA 4YNGA 4L4PA 4ZSTA 4YVXA 1GVFA 3MKVA 3T40A 3W1MA 4Q7IA 3WELA 1LUCA 4QDPA 5AYIA 4QCFA 2PD9A 2E1DA 4GXWA 4LB4A 2Y88A 2PF8A 2CLIA 1TWDA 1XCWA 3ARXA 3L0GA 3HB9A 1G9HA 4PULA 4GC4A 2PDJA 4IPIA 1UC4A 3TMLA 3IEBA 1RUSA 4ORIA 4I5UA 4EVZA 3VC6A 2RDUA 2XIOA 4JFUA 2D3NA 2HE5A 3EWWA 3B8UA 4PMNA 1P43A 4HCDA 3S2CA 1B90A 1Q7MA 3CTTA 3M1ZA 4U10A 2R82A 3VZYA 1JF6A 5JQ9A 2QCNA 3RHGA 3OA3A 2PE4A 4CD6A 1P0BA 1E71M 3TR2A 3UEQA 2J74A 2PPGA 1LM1A 4PCFA 3NDOA 3A9BA 2OMAA 2ACSA 1W9VA 2PRMA 5D2XA 4ZO8A 3DFYA 2BS9A 5L6UA 1GHSA 2ZRWA 1CX9A 3RNDA 3VFLA 4YTTA 1E70M 3VKAA 4KFOA 3KDOA 3RGTA 1RQHA 2VOTA 1CDGA 1AMKA 2PTZA 3EXRA 5BYWA 2HCVA 1QNQA 4AD2A 2UWFA 1H2JA 3A13A 3V5CA 1ZFJA 3ZR4A 4Q4KA 2WJDA 4LEFA 3BLKA 5A69A 2R14A 1X97A 1EUAA 2Y7GA 3G1DA 3H7VA 5EKYA 4AZGA 3GUGA 2V3EA 2PGEA 1RBLA 2FTYA 3TKFA 4B9YA 1GNXA 4WXYA 3THUA 2DH3A 3QSRA 4GBDA 2DZTA 2FIQA 4S23A 4DF0A 3UWUA 4QAIA 1Q6LA 1V0KA 4E4PA 4DBEA 4H41A 5HWMA 2A85A 1S5MA 2FPYA 5E9AA 2WMGA 1S38A 3NOEA 4A29A 3CUFA 1UWUA 4ICMA 1OINA 1ZSXA 4S2CA 3FKKA 4K3ZA 1JXJA 4WZHA 2WC3A 2DSUA 3VCRA 2GGGA 4C65A 3SO7A 1TV8A 1XGEA 3NM1A 1AQHA 3B9OA 3UCDA 1DYSA 2X2YA 2XFWA 2IUZA 4M56A 2V69A 3W85A 3K4WA 3EX4A 2WKGA 4QXIA 1IT8A 2PLKA 4UFKA 5IM51 1CI1A 2R1NA 3NVDA 2HBVA 5CLWA 2Z1SA 1UWAA 4MDOA 4TMCA 4U28A 4E6MA 1JDAA 2VR5A 3BAYA 4DUOA 3STGA 1H11A 1EWEA 3FJ4A 3G1SA 3IJ6A 4I7UA 3SAZA 4R7OA 2ODOA 4S3KA 4QE5A 4O11A 1UMYA 4NILA 4WKAA 1XSJA 1QU4A 1EJTC 4J35A 4IIHA 5AY7A 1WXYA 3BWWA 4PYSA 3M7SA 2YDQA 2DP3A 3RR1A 1VEOA 1W3KA 2P3ZA 4QG9A 4EPBC 3R13A 4E2BA 3IPWA 4AUBA 4F0HA 3AJ7A 3MWCA 4H9VA 3IUHA 1O95A 4LCRA 5FIPA 3L0KA 1IEXA 4UNLA 4N0RA 3CV2A 2DSKA 1ECEA 5DN1A 1V7AA 1UMLA 3HU7A 3USZA 1Q8JA 2FVLA 4NP7A 2VD8A 2QS8A 2AL2B 2GWNA 1IWAA 2DUZA 4HNLA 3QV9A 4LV4A 4I9TA 1L8PA 5E93A 3KCLA 4GYPA 3T2QA 3CO4A 1FWBC 3NR0A 3QFWA 1C7SA 1EGVA 3T2PA 1NDYA 4AHPA 1XSKA 3WO8A 1VJIA 2NX9A 4Q33A 3QGKC 3H12A 5BXRA 2GGHA 2PTXA 3AZSA 2C1HA 3GU1A 2HPMA 1UZDA 3L9CA 1VHCA 5CC5A 3IIPA 1ZB5A 2QQ6A 5JIPA 2D0FA 3W7JA 4IGHA 1M41A 2Z24A 2IPFA 2E8YA 4DWSD 3GAKA 3WK1A 4Z1YA 1QW7A 1B30A 1YTDA 1CGUA 1A47A 1ONEA 4G1NA 3CUJA 3E49A 5FJUA 5LSMA 2VZTA 4MAZA 4M7SA 1NP0A 2XVKA 1GPWA 4JN8A 2BBFA 4ZFMA 3W7EA 5K4ZA 3QMRA 1PAMA 4R33A 4PCTA 1PZ3A 4IFOA 3NQEA 2V81A 3WYZA 2WCGA 3G24A 3LQLA 3GVQA 3ZMRA 5A8NA 3T9PA 5MHBA 2VX5A 3NQAA 2MUCA 3MUAA 1KWGA 1EC8A 4A2SA 4OQVA 2XINA 4PEKA 3SURA 4KKXA 1X38A 2VEMA 3BW4A 3U4AA 1B54A 2GQAA 1JULA 1I60A 2DT3A 3FOKA 3MV11 3RF9A 4ZB0A 4G7EA 4N4QA 3T1GA 7XIMA 1R9XA 1Q4NX 3TQVA 5AKQA 1RV8A 4GJIA 3BCJA 4OZOA 3DKLA 2YCEA 4RDVA 4J3UA 3UYCA 2PDWA 4EOUA 3THQA 2FDSA 5C9WA 4GZEA 4IFKA 4FNUA 1S2UA 5D9MA 3GO2A 2YPIA 1VRXA 1TJ2A 4HK7A 6ALDA 2XM2A 1UW9A 3UR8A 1UUOA 1F76A 3GNDA 4K36A 3WKZA 2VR4A 3MVTA 1BVZA 3B97A 2XZ9A 1TUXA 1H0IA 1XH0A 4JZ5A 1XPYA 1WOBA 4HMDA 5T9BG 4PTWA 3WF1A 1S46A 1GEHA 3A3HA 4C1NA 2VDIA 1XH2A 4JX5A 1VD6A 4QE4A 5DT7A 2PZNA 4P8VA 3L4VA 4M6PA 4LEQA 2QGYA 1EXBA 4HKPA 1XLMA 3WBEA 3LG3A 4C5ZA 7CGTA 2BB0A 1LYXA 3VKKA 4RV3A 4YLWA 2CZFA 5HNRA 2NSXA 1CIUA 1FKXA 4GYKA 5CSUA 4S3DA 1MEIA 2NQZA 4M1RA 1ZL1A 4JQ3A 3DDMA 2Z1KA 3ARTA 3KRUA 2A6LA 1DE6A 2DW6A 4E3VA 2PWUA 2CBIA 1G4SA 4H00A 1V6YA 2ZZ5A 2PDNA 4D6IA 1VPYA 1QWGA 1VZWA 2NT1A 2HE8A 4IPJA 4H01A 3NQCA 2PDUA 2LLEA 5GVJA 3GK0A 1J18A 4MJMA 3KFTA 1L6GA 4GUJA 4NAEA 2PWHA 4ZXLA 2GSHA 4RNFA 4DELA 2VUNA 2D24A 3SEPA 3TMQA 3EWYA 1FWDC 3CB3A 3OHMB 1KM5A 1KCLA 2ZX8A 4F8XA 2C19A 4XUYA 4DJEC 4UXDA 3GH4A 3T0BA 1OBAA 5G4HC 4PUNA 3BMXA 4H2HA 1CXEA 3BLDA 3GIQA 1H49A 3W1NA 3F2CA 3P6LA 6A3HA 2POTA 5HATA 4ZQNA 4M7TA 5IBXC 3I3DA 3LN3A 2E40A 1FH8A 2PD5A 1GEQA 2VZVA 1K7XA 4DJDA 2FVMA 3KAOA 1TJRA 1I2NA 2I56A 1K1DA 3M7WA 4QDWA 3E96A 3JU2A 4GVGA 5G1YA 2CLOA 2WSPA 3AIEA 3HV8A 4L4LA 2NQJA 2XH0A 1FWAC 4IOTA 3REQA 5DRIA 3WEZA 1OCNA 2C1GA 2MNRA 3WJWA 4L4OA 2QMJA 2EO7A 3BJTA 2QIWA 4HPHA 2XVNA 1RBOB 1N7KA 3NPUA 5C5YA 2NX3A 2ZUVA 4F79A 3GHSA 1W3NA 1G4TA 3NFUA 1V51A 3WFLA 5FEXA 1U1JA 3KDNA 3UPWA 1W31A 3GFXA 4UQBA 3E0VA 3O06A 1W1PA 1Q6CA 2RDWA 2OXNA 1WOAA 3ZLGA 6PTDA 4JL1A 3LPPA 2QCDA 4L64A 2FZNA 1OY0A 4JEQA 3TN5A 5XIMA 2OEJA 2VM8A 4Q7BA 5EMYA 4GJ1A 5HJXA 3M0MA 5D8ZA 4CQ8A 4RV8A 4O12A 3KBJA 3TVAA 1QNRA 3AHTA 2HWGA 1RLDA 4X61A 4BK9A 4FXJA 3NSNA 2P76A 3YPIA 4I6KA 5C2XA 4MYXA 3PG9A 2Z6JA 2F8QA 1XW8A 3LM3A 5D30A 2V68A 3HF3A 4GD0A 4PTXA 2AQOA 1E6RA 2HVNA 1YTEA 3AYTA 4JN7A 4OBTA 1XD0A 3MKCA 3CL6A 3WN6A 3CC1A 1HP4A 1AL7A 1T6MA 3B9NA 2ZA3A 1UH4A 5CEWA 1TMQA 1UH3A 4LF2A 4S3BA 1L8NA 3LDVA 3VAVA 1X8FA 1J93A 1CGXA 3MTWA 1UKSA 4MKSA 1KD0A 1ZAJA 4BFAA 3HGOA 4BCEA 4O10A 2XGIA 3W9ZA 3M6YA 3C2EA 4UC5A 4AX7A 5C2CA 1U83A 1SZRA 3LNPA 1UQYA 2DZXA 3W82A 4F0KA 1K9DA 4GCAA 1FWNA 3WD4A 3W1LA 5CZSA 3A24A 2XM1A 4GY0A 2I5GA 2DDXA 4TX6A 2GVEA 3II1A 4AEEA 1YQ2A 2E6DA 1JEZA 2YCLB 3DH7A 1WKYA 5DMNA 1IEVA 1Z3NA 1FWIC 2QCCA 2NT0A 3NO5A 3PNZA 2CXEA 1VBGA 4IMCA 1BWLA 4QCEA 5CG0A 4ZOBA 2Q02A 2QF8A 3TC6A 4RJEA 2V5LA 2D2GA 3LPGA 1IWBA 1G1YA 2Y63A 3V16A 1E1EA 1VLIA 3VUPA 4ZO6A 3KOWA 1DEDA 2FB2A 1Q6QA 2FZ9A 2FZDA 1IHIA 1OT2A 2YBVA 3C3NA 4IIDA 3PZIA 5I3KA 3CS2A 4BF9A 2CLKA 1TR1A 1GVEA 4P7RA 3TYZA 4FS9A 3KZSA 3CB8A 4KESA 4LUTA 5CAKA 4I9JA 3N2OA 2V3GA 3BQ5A 1UOKA 2WBKA 3ORWA 4DO6A 1GVIA 3RYSA 3BGGA 2CBVA 4B9ZA 1M7XA 3TNOA 3B3DA 4CKQA 3O1NA 4E8GA 5I24A 1JZ7A 3CV7A 4WKFA 1UD5A 1J9YA 1QO5A 1NF0A 1XC4A 2QPUA 4IIEA 3DGBA 4NY2A 4X60A 5DCDA 1HVQA 3E2QA 1WO2A 3A4WA 3FGCB 2A3HA 4JTSA 3V0TA 1LJYA 4LANA 3U2ZA 3KUMA 3IJIA 4TVCA 1DTNA 3T0CA 1WE5A 3BV4A 4KCWA 3M6DA 3NGJA 3QYSA 4UOZA</