1AZ2A

Citrate bound, c298a/w219y mutant human aldose reductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
314
structure length
314
Chain Sequence
b'SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 84
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az2A00
1YE4A 3FX4A 3VXGA 2PDIA 4JIHA 2IQ0A 2NVCA 4EXBA 2HEJA 1XGDA 3BURA 2P5NA 4PUWA 1PWLA 5LIYX 4GQGA 5HA7A 2HDJA 1M9HA 2PDNA 2PDHA 1K8CA 4JIRA 3R6IA 5LIXX 4WDUA 4JTRA 2VDGA 4DBWA 4PUUA 4QXIA 3F7JA 3Q67A 4AUBA 3EB3A 2PFHA 5LIWX 1ZQ5A 4RPQA 4JTQA 2ALRA 4JTAA 3UZYA 3V0UA 4XZIA 3CASA 3UWEA 3H7RA 2FZBA 2PDYA 2BP1A 2PDUA 3UZXA 3QKZA 1FRBA 4XAPA 4ZFCA 4JIIX 2HVNA 3V35A 2DUZA 2PDCA 3LEPA 4XVEA 2PDGA 4FA3A 2PDLA 3LZ3A 1AZ1A 2PDJA 4Q7BA 2FZ9A 4LB3A 1LQAA 1AZ2A 1PYFA 2IS7A 3LZ5A 4GCAA 1Q13A 3O3RA 3V36A 1ADSA 3R43A 3H4GA 1ZSXA 1AH0A 1Q5MA 3UGRA 3RX2A 1ZUAX 1OG6A 1YE6A 4FAMA 3V0SA 3WBXA 3V0TA 2IKGA 1X98A 2F2KA 1HQTA 4PMJA 1X96A 4XK2A 2J8TA 5KETA 2IPFA 3M64A 1QWKA 3LNMA 3M0IA 4YS1A 5AZ0A 3C3UA 2PZNA 3O0KA 1EKOA 3GHTA 3FJNA 1RY0A 3GHUA 4JQ3A 4ASTA 1XJBA 3R8HA 3T42A 2IKIA 2R9RA 2FGBA 3LQLA 4DBSA 4GIEA 4ICCX 5DANA 2ACQA 1HW6A 2I17A 4LBRA 2PDWA 3H7UA 2PDFA 4MHBA 3LN3A 1VBJA 2INEA 2ACUA 4LAZA 3LBOA 3KRBA 1C9WA 1S2CA 3CMFA 3DOPA 3R94A 4DZ5A 4GQ0A 4NKCA 1Z8AA 1ZGDA 2ACRA 1AH4A 1R38A 1JEZA 3P2VA 3DN5A 4LBSA 3BCJA 3UFYA 2FZDA 2A79A 3WBWA 3WBYA 3RX3A 2ISFA 4HBKA 3B3DA 3CAVA 5AZ1A 4FALA 4H8NA 3R8GA 3CAQA 4L1WA 3G1RA 4PRTA 2PD9A 3R58A 4HMNA 3S3GA 4PRRA 3UG8A 3WCZA 1S1RA 3LQGA 2I16A 3BUVA 1MRQA 4Q3MA 4H7CA 3UZZA 2IPWA 2PDXA 4QBXA 4WRHA 2PDMA 3U2CA 1UR3M 4JQ2A 5JH1A 4I5XA 1XF0A 3NTYA 1SM9A 3CV7A 3D3FA 1IHIA 1PZ1A 4XZHA 4QX4A 2PDKA 4XO6A 4LB4A 4WGHA 1YNPA 3LENA 1EL3A 2PF8A 2FVLA 2IQDA 1T41A 4XVDA 1VP5A 2PD5A 3CV6A 5M2FX 1Z89A 4LAUA 3GUGA 4FZIA 1RY8A 1QRQA 3Q65A 4IJCA 4IJRA 4WDXA 2F38A 4JQ1A 3N2TA 4QR6A 4XZMX 1US0A 1PZ0A 1IEIA 2IPJA 2BGQA 4XZNX 5LIUX 4DBUA 4JTDA 2PEVA 3ONCA 1MZRA 1EXBA 4L1XA 2HE8A 3G5EA 3UP8A 2IKJA 2WZTA 3RX4A 2NVDA 2HE5A 2WZMA 3ERPA 3R7MA 2PDBA 1EF3A 1AFSA 1A80A 1S2AA 4OTKA 1X97A 4WDWA 3LD5A 2DV0A 1AH3A 1YNQA 3MC5A 5HNTA 3BV7A 2AGTA 1RALA 3EB4A 4GACA 2FZ8A 2QXWA 3N6QA 4XZLX 2BGSA 3GHSA 2HV5A 4YU1A 3UYIA 4GA8A 2R24A 4YVPA 2INZA 3M4HA 3EAUA 2CLPA 4IGSA 4YVVA 2PDQA 1MI3A 5C7HA 4YVXA 4G5DA 4JQ4A 3UZWA 3COTA 2DUXA 4XO7A 5JH2A 3MB9A 4PR4A 4GABA 4WEVX 5HNUA 1GVEA 2ACSA 1LWIA 4WDTA 1J96A 4R9OA 3WG6A 2PDPA 3GHRA 1S1PA 2IKHA 3LUTA 2HVOA 1Z9AA 4EXAA 1T40A 4F40A 5LIKX 4JQAA 1Z3NA 3ONBA 2IPGA 2C91A 4JTCA 1PWMA
chains in the Genus database with same CATH superfamily
4RNIA 1KW1A 4FO4A 1VCFA 3UBPC 1A5BA 3MP3A 3T78A 3BURA 3OG2A 5HBFA 3K8KA 1J0YA 5D05A 3KVKA 4PB3A 3ZFHA 1VR6A 1SMAA 4HNCA 5HNRA 2J9XA 3ZSTA 2BXZA 1ISWA 4G7FA 2ZQ0A 3BZGA 2YCLA 3OODA 3MY9A 4P7LA 4K7YA 2OCZA 5CZKA 3ITLA 3NQ2A 2Y63A 4QXIA 1CGXA 1D7FA 5E5CA 1WDSA 1N82A 2XH7A 3AXHA 4ZOBA 2QQ6A 4DJED 1ZQ5A 3S9IA 3NL6A 3QC0A 3PJWA 4MYXA 4PMXA 4X0VA 4XAYA 1EC8A 3TJLA 2VKZG 5CEWA 2I1OA 4GBDA 4RV3A 5TQLA 4ZQRA 1YTDA 2PDYA 1X6UA 1PO9A 1QI4A 2QS8A 5M03A 1EC7A 3UXAA 3ANUA 2CKRA 4BI6A 2YR1A 1VFLA 2G41A 5E6YA 3CPGA 3IUDA 1B4KA 5F4WA 1WZMA 2J78A 1TTQA 4ZXLA 3LZ5A 3NQGA 4B92A 3RRAA 4C6QA 1EUNA 1OM0A 3VIOA 1WDPA 3MUZ1 1FHUA 5CJ5A 5I09A 1YPXA 5D33A 3MZ2A 2WC3A 3H70A 1IZCA 4ZB5A 3B97A 1F7BA 3F4DA 3U2ZA 2A3EA 2V5BA 1R7OA 3VIJA 1E1FA 4FLQA 1RXOB 3MI3A 2Z27A 1I6NA 3EMCA 4BQ3A 3MP5A 4G6CA 5C7VA 3OPSA 4HZ8A 2G97A 2ZUUA 5ECVA 2F8QA 1U33A 4US6A 1EKOA 1UJQA 1M04A 1G01A 3ARVA 4S2BA 4ASTA 4ZB0A 1MZHA 4QE1A 1YBQB 4M7SA 3W71A 2E28A 3DYMA 4NP7A 5I24A 3THQA 3VDBA 3T2QA 3M0KA 4K1GA 4NQ1A 3L4VA 2I17A 1HJSA 1P1XA 3NPWA 3QRHA 2WB5A 3LBOA 3CH0A 3ITGA 3NSMA 5BXRA 3M1ZA 2OQYA 2VRQA 5F2LA 1NF0A 1DIKA 3E9AA 5BWAA 1CGUA 4CQDA 2QVNA 3N6HA 4KEUA 3R4IA 3O2LA 3UF9A 4PMQA 4IG2A 1MQPA 1R38A 3IIXA 3KBNA 3FJ4A 3TA9A 4J28A 5BMXA 1L0PA 3CUZA 1J6PA 4GYPA 4BF5A 2YCKX 2YDSA 1IGWA 2QCMA 4FR1A 5FF2A 1MSSA 4YIWA 2BVYA 4MUPA 1FVPA 2CPUA 4V28A 4HMNA 2X1SA 2QDGA 3TSBA 4RZ5A 1P0BA 3KS6A 1CW2A 4Q3MA 4F0HA 2J74A 1PVNA 1AL7A 5FSEC 3KEHA 1WX0A 1UA7A 1G0CA 3NM1A 1A5SA 1FXQA 2GDUA 3PG8A 1Q4NX 4O1CA 1JAKA 3LOTA 4PTVA 1KBLA 1ZAHA 5AHIA 1ODUA 2Y8VA 4S3DA 1SJDA 1W8GA 1SFLA 3LA4A 3HPFA 4QFUA 3SFWA 3PK7A 2FPTA 3NGJA 2VOTA 4JFTA 3RDKA 3GKFA 3DFOA 2IQDA 3UWZA 4KWSA 2CC0A 1O6IA 2PRHA 3L5MA 3AIEA 3NOYA 3FJ6A 3QFWA 1RK5A 1AW1A 4FZIA 3QSTA 4INFA 2QGYA 4LTSA 4M82A 4JQ1A 4F2BA 5BOOA 1ECEA 1V6VA 1W5MA 1VB9A 4A3UA 4UQAA 4F0MA 3MDWA 3W7EA 1PZ0A 4A3QA 4FLRA 4Z42C 1UROA 3WQCA 3S6TA 2PE4A 5BXPA 4NXKA 3UNTA 1QPQA 3SZ8A 3MS8A 1PJ9A 4XD4A 2Y24A 1VPYA 5FIPA 6TAAA 3OYZA 2HE8A 1WKYA 1TPFA 2VDIA 4BKNA 1GJWA 3OO2A 4WY0F 1PSCA 2NWRA 2ONEA 2Q3RA 1MFUA 3FA3A 1XIJA 4HHPA 3B8VA 1ZBKA 4B5VA 1L6SA 3QR1A 1AH3A 4AZCA 4GIRA 2DSWA 3A4WA 1VFUA 3GIQA 1EGVA 3G1VA 2AAAA 3R8RA 2YSWA 4S3BA 1D3CA 1LOQA 2ZZ5A 2D73A 5EFFA 3W7QA 1B4EA 3M0LA 3RU8X 5AYIA 1EO5A 1OFQA 3LHYA 4Q7NA 4JN7A 1E9IA 1S5NA 1UB3A 2VFHA 2PC8A 4WKFA 4WJ8A 3RCMA 4WR3A 3L0KA 4WEVX 3NIYA 3UG4A 4GXPA 4IX2A 3P7YA 3H2FA 1FHVA 1BRLB 3WBAA 3CHEA 4V15A 3GQYA 3MJYA 5E93A 1W9DM 1DQWA 1TRIA 4D8ZA 2NSOA 4KW2A 3KDOA 1RK6A 2V30A 4LF2A 2DU2A 1CZ1A 1IXPA 3KE0A 3QOMA 4I9MA 1DJWA 1Q6QA 3JW7A 4YTTA 3MUAA 4M24A 3BH4A 2JK2A 3RNDA 3LCHA 3WUFA 5L9FA 3QXBA 3GTHA 3UXLA 4DF0A 2TSYA 4PCSA 3ARYA 4G8TA 1W3HA 2WSRA 4AQLA 3NGFA 3TYAA 3LHUA 3WFLA 5BNKA 1PL9A 4CLMA 4CCCA 3SRHA 1DIDA 3CL8A 1EZWA 2PFHA 5EMLA 5LYRA 1W9VA 4JTQA 4LYPA 2NLIA 3UA3A 4FP1A 1Q6LA 4KWVA 4C91A 4XAPA 5DY2A 1SO5A 5EL1A 4A35A 3VZYA 5DCBA 5ABTA 1E0VA 2G95A 3IJDA 2W66A 4FA3A 5FL1A 2E9BA 5I3KA 2P10A 1DIOA 1M7PA 2DDXA 1EJSC 4D6CA 1M53A 3T9PA 2XIMA 4JDBA 1PYFA 2GGJA 4KWWA 4WUIA 2WZEA 2PP3A 5EMMA 1FXPA 5D2VA 3B0UX 4TTUA 2VT0A 1C8YA 1D8WA 2JF7A 3MU7A 1QATA 2ATMA 1LLWA 3M47A 3WF2A 4CGTA 2BZNA 5D02A 2DZXA 3EOUA 2IKGA 3BANA 2UV8G 2VWTA 4X22A 5F2GA 3GC4A 2YLAA 1W17A 4H9TA 4NT0A 3RU6A 3W4RA 5EMUA 4PBGA 4DQWA 3K13A 3PPFA 1SJAA 1W3JA 1RLDA 4Q4MA 2F84A 1QOQA 3RR1A 1V08A 4QJ1A 2WNQA 3MA8A 1JCYA 4AX7A 1A5UA 3FKKA 1AJZA 5D4YA 4DJDA 3UY8A 4PFMA 4QS6A 4QHRA 3DDMA 2DIJA 2FGBA 3CC1A 4AD5A 3LQLA 5C54A 1IIGA 1MQRA 4DN1A 7TIMA 1VAHA 3FSUA 1A4LA 2D3LA 2Y61A 5HQMA 2INFA 3TQVA 2ZUNA 4J2PA 5BXSA 1XYAA 7CGTA 1GPWA 2MUCA 1F5ZA 3QW3A 3S6DA 2VWSA 3STEA 4HPHA 2DEPA 1YBQA 2YXOA 4F0LA 1DJHA 5IDZA 3OVPA 2QUUA 5CPLA 5G2IA 1ZGDA 3N3TA 1Q2SA 3E12A 3BSHA 1F3EA 2OXNA 4YHEA 3IUHA 2W0UA 3BCJA 2J7EA 3EX4A 3AO0A 2BY2A 3WDHA 1HO1A 4J3TA 5GNXA 3W7OA 3B3DA 3FK4A 4I8DA 2NXIA 3G1HA 2IXUA 3OZMA 2XSAA 3G1RA 2XZ7A 1RPKA 3NZQA 1Q7QA 5CQ1A 4XBSA 4PRRA 1W9XA 4EWJA 4RJEA 3TQKA 4BQ2A 4B15A 1Z69A 3P67A 1B9ZA 1XLDA 2CITA 5J5DA 2ZC1A 2IPWA 4KRZA 1JZ2A 2JQXA 5U7SA 3RG6A 4J3VA 4GVIA 2GJNA 5DBTA 3VCNA 3SUTA 1X1NA 4R88A 4CN4A 2EJAA 1TRDA 2YPIA 1DWFM 4X61A 3UA4A 4NILA 3L4WA 4GQRA 2XZ9A 3NURA 1OX4A 4D1JA 1JDDA 1RQBA 4X3ZA 5CPOA 5KZEA 4JX5A 4D6FA 3SCVA 5XIMA 5M2FX 4MIMA 3APYA 3G8RA 4H1ZA 1EP3A 4C5YA 2V9DA 3FV9A 4WDXA 3ME3A 2QUTA 4L80A 5XINA 4U28A 5FI8A 1CXLA 3P60A 1CYGA 3W1NA 3CQIA 3TH6A 2A6LA 3MV11 3L5LA 1RBOB 5C70A 1Q6DA 5LIUX 1LL7A 3ATZA 3GW3A 1W54A 3W7KA 1R7AA 3LBMA 2XDFA 3VMOA 3W7HA 5HUOA 1PDZA 4FNQA 4ML9A 2BODX 3M5VA 4IIFA 1LLZA 1UZ4A 3A23A 1UKSA 4DYJA 1XLHA 1LUCB 2VFEA 3I3EA 5AVHA 1NOUA 3AALA 1IWPA 3NM3A 1VJIA 3H7VA 2I9EA 2HSAA 1Q7ZA 4L9XA 1ZBVA 2DSZA 2J66A 3NL3A 3G6MA 3RO6A 3EDKA 1FFRA 4M0XA 2PTYA 1MRAA 3IJ9A 1TE1A 2WCAA 1FY6A 2VR2A 1P4CA 2R24A 3FAWA 2DT3A 3K46A 2VOMA 3PFRA 3KOZA 4TVDA 4YVPA 3LYEA 3DYPA 5GVJA 2WCGA 2VYOA 3EOEA 4EWND 3DERA 3QZ6A 1ZALA 4ZMGA 3LSBA 3GTIA 2DT0A 1XYFA 1GQIA 1ZU8A 3CO4A 5JH2A 4IPPA 3GXIA 3EKZA 3QHNA 2VD9A 3U2EA 2DPEA 5HNUA 4QDPA 2FFCA 1EPXA 1LWIA 4WDTA 4UIOA 4QCFA 4GUHA 1XC4A 5I79A 1YTEA 3B0VC 1W32A 2PDPA 4MNLA 1EIXA 1K7XA 3HOJA 5G2HA 4HU8A 1NEYA 4F2UA 4EXAA 2OLHA 3FGCB 3RCNA 1Z3NA 3EWZA 4F40A 1XKJA 3W82A 2GJXA 2C18A 4XD5A 2X16A 2PWEA 1BQGA 4IL0A 1UMYA 1YE4A 1XG4A 2XVKA 4I7VA 2DZWA 3KOWA 3LM7A 1B54A 1KCXA 5AYZA 3URNA 4F4RA 2MANA 1GVFA 2QCNA 2WWDA 1NOWA 3WMLA 4I9JA 2HEJA 3SADA 1P0KA 3HN3A 1A53A 3U9IA 4S3EA 1K9DA 2BOGX 3GYEA 4KWOA 3SCSA 3D47A 2Z24A 3DG3A 4GUIA 1XYLA 1NWUA 3CGTA 5HA7A 1EH9A 1M9HA 2FH8A 4X0NA 4CD5A 2PDHA 1K8CA 3GSMA 2TRSA 3TXZA 4PZVA 1LBMA 3L0NA 2G3JA 2Z1VA 3PPGA 1GPFA 3VI2A 4PTNA 5G1MA 4MLJA 2GGIA 4EANA 1JJKA 3VTRA 1GJPA 2ZA1A 2FDSA 3HU7A 1BGAA 1Y5VA 1DHPA 2REQB 2J7FA 3V0UA 4QLKA 3W3OA 2GZXA 1PXGA 5A8PA 3GXMA 3BLPX 3CYVA 3WJWA 2R8WA 4QG8A 1HKKA 1Z7AA 2DUZA 2C13A 2OPJA 4UOZA 1LQ2A 3WLLA 5LKYA 3CUXA 3VGHA 1NDWA 3W1UA 2C79A 1FDJA 4P7RA 1QW7A 3WQ4A 1E51A 5LA2A 3EKGA 3GWQA 5I3DA 4FEZA 1L2QA 3MCNA 4Q7BA 1JQVA 3W1XA 4MFEA 1S5MA 3XINA 1QXLA 4LB3A 3NFUA 4XBJA 4UTWA 4HVXA 2A7NA 2ZVRA 1FWDC 1QR7A 3WLRA 3BL3A 3ITTA 4KQNA 1IEVA 2X30A 1VRXA 2ZE3A 1DTNA 1YE6A 2ZE0A 3NCOA 4JZ5A 4KGLA 1UC4A 4ADUA 1EPVA 3INPA 1OX6A 2F2KA 1V6YA 4OV9A 1WQ5A 1HXJA 2E9LA 2ZDRA 2VM8A 5GNYA 2QJGA 3A3XA 4C7GA 3HGJA 3CHFA 3BWWA 1BWLA 3BOLA 3E0WA 4LVAA 1AD1A 3GK0A 3TTQA 3A4JA 3IJLA 4UQ9A 3B9DA 4JTUA 4DXXA 4YWSA 1IT0A 4UFMA 2P8CA 1ZJBA 3W2KA 3MT1A 5T26A 4N9DA 1DXEA 3WQEA 1PPIA 3OP2A 4CNOA 3B9NA 1BVWA 3WH9A 4MJZA 1E6NA 3DC0A 4XIAA 1VFOA 3A64A 2YCEA 1IWBA 4N2YA 5A6MA 4FXFA 4DZIA 4HPJA 1HJXA 2FPYA 4GGHA 1WO2A 2IMRA 1JUKA 3GY1A 4S1FA 1EDGA 4QJ4B 2Q8ZA 4RDYA 3L4YA 3PWAA 3ZOAA 3VD3A 3QW4B 4MJ2A 3D46A 3LPGA 3KBWA 1L8PA 2HPIA 1DJZA 3FN9A 3BW2A 1HP5A 2YJQA 4LC6A 1Q6FA 1GK8A 4JTTA 2V5LA 3R11A 1HKWA 1L6FA 1I2RA 4KFOA 2FHFA 2HVMA 3W7CA 2WNZA 1UH4A 1KXTA 4JX4A 1BKSA 3KL0A 4GC4A 3OHIA 1I4NA 1WUEA 3TTEA 3O8AA 1BTMA 1UP0A 4HSHA 2BNJA 2QEZA 1FCQA 3KVJA 2CXGA 2GGEA 1F6YA 3V75A 4IFRA 1S1RA 3E2VA 2JBMA 1N55A 3C5QA 3SQMA 2QVHA 1H1YA 5K9DA 4KPLA 4XSMA 1W5NA 3WNMA 4PRWA 3RPTA 1MNZA 3IK4A 1X7FA 4OV4A 4AZHA 1EJRC 4GUFA 3WQDA 4ZBCA 1V0NA 3BG5A 3U2CA 1CWYA 3AISA 2VZOA 1XISA 3O0FA 3PANA 3FFSA 1OK4A 1TWDA 3UWWA 3IIPA 1Y65A 5A2AA 1SGJA 4X9YA 1L2UA 4A2SA 2C16A 1E1CB 4YCPA 3MUIA 3A3HA 4PTXA 1FFQA 3DAQA 5EBUA 2QR6A 1MEWA 1JGIA 2AAMA 1K9TA 3GNRA 1TV2A 1V02E 1KFWA 3GVGA 3W7NA 5JBEA 5AHLA 3IPWA 3WNNA 5EBAA 3VIFA 4O1DA 2QMJA 2UY3A 4C6EA 4FX7A 4FNRA 3UG5A 1J4EA 2O9TA 1U5HA 4TVUA 3VDGA 1UQYA 4OOZA 3S46A 2G50A 3T81A 4R3UA 2DFAA 2PEVA 3W38A 4YN5A 3RIKA 3G3MA 3B0XA 5D2TA 2F6KA 1LTDA 4GY0A 3IK2A 4P8UA 1Q65A 1PKMA 1VBUA 4L4OA 2ZXDA 3OLIA 3FDKA 4OTKA 3WUBA 4UTFA 3HM7A 4RZ4A 4GG9A 2QUNA 5JBFA 2ISWA 3RN6A 2JKAA 4GFSA 4I9AA 3S2NA 5J8LA 4HHLA 4K8EA 1TPVA 2WM1A 4XZLX 5BW6A 3EX6A 2BGSA 4FXJA 2HV5A 3VNIA 4YU1A 4QSHA 2DGAA 3UPMA 3M5ZA 4M81A 2VMFA 3MWAA 1TFVA 1LUCA 3OIXA 3P0WA 1OFBA 4GNKB 3ABZA 4I9TA 4YVVA 4GXWA 2PDQA 5C7HA 3P80A 3NVTA 1EO7A 2WNNA 2AMXA 4JKLA 1RVGA 3FLUA 1TVLA 4MB4A 1EJVC 4EE9A 4RXFA 4GVGA 4GYFA 1JGMA 1D3GA 2ZTKA 1T99A 4J5NA 1OD0A 2AGKA 2Q3OA 4KEMA 1BXBA 3LLXA 3OBKA 1JYVA 2AQVA 4MKNA 2W67A 2O4QA 4K6AA 3THDA 1HJWA 3U6WA 1JL8A 1XDLA 2G4JA 1AG1O 1UZDA 5F1VA 2VNCA 3HG2A 3FDGA 4MADA 3BOFA 1KD0A 2P3EA 4IMCA 3WYZA 4A4AA 3TWBA 1NQKA 3WH6A 2IQ0A 1JPMA 3T2OA 4UUIA 2PTXA 1AD4A 4GBUA 1G7VA 4Q33A 1B3YA 5HOSA 4OHQA 4O4WA 4Z2IA 4DWSD 4IH3A 2YA1A 4H41A 4TIMA 4V27A 3AMKA 1XLGA 2PTDA 1SZGA 2GUYA 2Y88A 3FGCA 4S23A 3II1A 1JF6A 1ZRQA 5F4XA 4GX8A 4PC8A 5E0CA 1OD8A 3NWRA 3GFZA 3VKBA 4AY1A 4NAEB 4KIRA 4RPQA 1K4HA 5CSYA 4LF1A 4RDZA 4NZ4A 1DJQA 1W9UA 1E0TA 3OIHA 3LRKA 3CB8A 3VM7A 1UP2A 3W1TA 3UWEA 5CPSA 1O4UA 3GE7A 3A4AA 2VFIA 3HGOA 1MNSA 4K1WA 2GK1B 3LEPA 4M6PA 3LX9A 5C9XA 1NF7A 3C3NA 2CEQA 4DB7A 4J3WA 5CPNA 4C1LA 4H9YA 1Y5XA 2WV8A 3HG5A 2JKEA 4DJDC 1BYBA 2YCIX 2REQA 3HTWA 4O52A 3HF3A 4DHGA 1UKQA 1V6TA 4IPIA 1DVJA 4Q4QA 3PP7A 3EEGA 3CUIA 1FWFC 1UKPA 4AWSA 2P8BA 2KZHA 4NI8A 4GJ1A 7PTDA 4K8HA 3UJ2A 1ZUAX 2PGFA 1WOAA 1XM3A 2RDXA 3GYCA 3P93A 4QP0A 1KM0A 1O1HA 1VFFA 1NFBA 3V0TA 2CERA 5E09A 3TYZA 4Q4OA 2GQ8A 1AQHA 3EDFA 3V18A 5KEZA 4IQDA 4LVBA 2QPSA 5KETA 4Q8QA 1U1UA 3S2JA 1MW2A 3GR4A 4K38A 1GOWA 3D5HA 1D2KA 4Z0SA 4C6JA 4HK7A 3EDJA 2C6QA 4A8NA 3PWGA 1TQXA 1VF8A 1F3XA 4QITA 4EACA 1A5AA 3WDRA 3ARUA 3O0KA 4LS2A 1EYWA 2BY0A 3S1XA 1XX1A 4HP5A 2XIIA 3TP4A 3T42A 4RW5A 3SY5A 1XRVA 4W7VA 4XKMA 5A6TC 4U33A 3T4WA 2DZAA 2ESCA 4IFKB 3IIZA 1S39A 1DWAM 2J9ZA 1EHNA 3BMVA 2PZ0A 1KRCC 2GOKA 3L66A 1EEPA 4D1IA 1XG3A 3BAKA 3SQLA 3WDPP 3CMFA 3TEVA 2Y70A 4PCPA 1BEUA 2FJKA 4EKJA 1ITXA 2W27A 3E2QA 5HANA 2CZVA 3R12A 4M51A 2BOFX 4IMGA 6A3HA 3S5NA 3BAYA 3FAXA 3CBWA 1V6UA 3UR7A 1RD6A 1WDRA 2DIKA 4UCGA 3VVGA 4DAFA 1Q63A 2OWWA 1UG6A 5F4SA 3WNKA 3EXRA 4LS0A 5EMKA 2FZMA 4IFOA 2ZRYA 3WEOA 1J5TA 5C9WA 3AZTA 4AIEA 1OB0A 1ME9A 4OJYA 1XW8A 3VCCA 4DUXA 1MRQA 1A49A 2YBVA 3VGFA 5LNUA 4QBXA 1UD3A 2ABBA 3ISIX 4WRHA 2PDMA 3VOGA 4JQ2A 1GOOA 4Y9MA 4B3KA 2EGZA 1DE5A 1Q85A 3VA8A 4XUYA 4YXGA 1ZP3A 1KBJA 3EOOA 3R1ZA 4ATLA 1H0IA 1MW3A 2YFNA 1J0ZA 1TB3A 3OYXA 4DNHA 3OG3A 4QJ5B 1FWHC 1EL3A 1XINA 2X40A 4XVDA 4ZL1A 1NP2A 4Q22A 2PF0A 3GBEA 1JNDA 1YQ2A 5E6ZA 1OK6A 3DFYA 3G1YA 4S39A 3HFYA 4HT3A 1TPUA 4L65A 3B04A 1J2WA 2P1FA 2BVWA 3P0XA 1LOLA 1I60A 5FJJA 5HDRA 4Y9AA 3QVQA 1I9CB 3WNLA 4TUFA 3L68A 4GX9A 3VU2A 2A85A 4AZ7A 1W2PA 4CCDA 1VGAA 1L9WA 4CD6A 1C8VA 3WLQA 4JIEA 1RVKA 3G5EA 2YL5A 2IKJA 1PCKA 3HJZA 2WZTA 3ITVA 2D24A 2ZRWA 1GT8A 3DH7A 3WSUA 2DVUA 3WQVA 4DI8A 3TN5A 3MP4A 3PZVA 4RLIA 2HROA 1QNQA 3C61A 4XTIA 2I5QA 4I8YA 4JY9A 5A3HA 5BRBA 5HATA 1OYCA 3SCUA 1S46A 1M7JA 1RALA 4B9YA 2FYMA 1RUSA 3TN3A 1NTHA 1W2VA 3VDCA 4W5ZA 3GM8A 3T09A 5D9MA 5G4EA 3QZEA 2BG5A 1CGVA 3MKVA 5KZ6A 3PZIA 3Q94A 5DMMA 4I90A 3DZ1A 4U4MA 3FCPA 2CWXA 5IRPA 2CLPA 4LVGA 6PTDA 3ARXA 3NVDA 2VGIA 4NNCA 1W91A 2Y6ZA 1JPHA 5JVLA 3TNBA 5AHEA 2GFTA 1EGZA 3W02A 1BXCA 3HV8A 2NUWA 1BSIA 3S6OA 2YZ5A 1KB3A 2Q09A 4QQUA 5CSUA 5LZLA 3IACA 2OZ3A 2ZUWA 2A21A 5C5YA 3CB3A 4MWAC 3STFA 5D37A 1S1PA 3VINA 1ENUA 3LUTA 3JS3A 3L2LA 4LX4A 3PB0A 3N04A 2X2GA 4ZGYA 1LRTA 2QZRA 3W2JA 4BY3A 2UY5A 5FACA 3AOFA 4HYVA 3GU9A 4REQB 3VXGA 5A8GA 1UUQA 5AC4A 1JPDX 1B9BA 4YCOA 1GVOA 3QH2A 5I3JA 1KFKA 5CKSA 1NFGA 1YTKA 4CU8A 2NLYA 3NO1A 1PWLA 1FWWA 1UKOA 1SSDA 3H22A 1Q6GA 3G6LA 4IOTA 3PZQA 2HDJA 4WXYA 3SCQA 3BSGA 2QT3A 4UTWC 3IRSA 3DCPA 3KLKA 4ZFMA 3UWUA 3W6MA 1JD7A 5FJTA 3BTNA 4H8HA 4PUUA 4UZUA 1US2A 4RZ6A 3DKJA 3UVAA 3RXZA 3ID7A 3AMDA 1OC5A 4XUGA 3O06A 4L6HA 3TQPA 1D8CA 3BGJA 4UQCA 3L5AA 1FUYA 4JTJA 1F3WA 2HCVA 3G0UA 2GWGA 3VUSA 3T0TA 4LQ1A 2PDGA 2D3NA 2O7SA 4Q8VA 3T1GA 1VIZA 1T7LA 1XD1A 3VFLA 3QC3A 3DESA 3QY7A 3N73A 5M3WA 3NO5A 4NAEA 1JULA 3BZJA 4JOMA 1J5SA 4ZTYA 1EA0A 3W01A 4RW3A 4AVFA 3QTPA 3N34A 5A6BD 3O3RA 3MSRA 4JTHA 2WHMA 1GQNA 1KV5A 2NXGA 3GG8A 4NRRA 2WW5A 1WE5A 4N6EA 3W2NA 3SGGA 4ZE5A 3GZ3A 3Q37A 2E1DA 2HK1A 2GK1A 6REQB 3V0SA 1JXJA 1UOZA 2L5HA 1IR2A 5CZJA 3VUPA 4AX6A 1KBBA 2EKCA 2PLJA 4OQVA 1RJQA 3LNMA 3GTXA 4HHHA 3BLDA 1UWAA 3K4DA 3W7DA 3DYOA 4RE4A 2O92A 1EBGA 3PN8A 5A6KA 4H6EA 3WLIA 1UR0A 1RY0A 1RR2A 3T05A 3DGBA 4PB4A 3F4CA 1EYEA 4L4MA 1FBAA 1NELA 2D23A 3SUVA 2DVXA 4LBRA 3GZAA 2PDFA 1TPC1 1C90A 3ABOA 2D0HA 3SIMA 1IWAA 2FVMA 1POJA 4GKTA 4Q8MA 4LAKA 3CTTA 4YPJA 4J4KA 5FF3A 3AS2A 4E2VA 4N9BA 1VCVA 4GINA 4CVWA 2DZUA 9CGTA 3ARTA 3P84A 1Z48A 4IFKA 2E5CA 1KC7A 2OYLA 3RK8A 2F7FA 2FZDA 2A79A 1BXNA 4JTSA 1KM1A 2V38A 3OLEA 1VHCA 3LCLA 1QI2A 2EG7A 1ZAJA 4WY0B 4TV6A 3UR5A 3EWBX 4PRTA 1F8MA 2OODA 5E0FA 3AS3A 3MQTA 3TJ4A 2I16A 3AHXA 3RAOA 1H4PA 2J9YA 2SFPA 5AHNA 3O07A 2HTMA 2QGHA 4OWGA 3GB6A 1ZCOA 4JGDA 2Z1KA 2AKZA 1KGUA 3ZYZA 3QYQA 4CQBA 3W1QA 2NUXA 3UPWA 1V3KA 3GH5A 5AHFA 3WF0A 1SPQA 4JKKA 1H1ZA 4AD3A 5HAOA 3GD6A 2PDKA 1B3XA 4WK9A 1VD6A 3F5LA 4X2PA 1E55A 1R3WA 4LUYA 3N9SA 1VP5A 3BICA 3CV6A 4H7VA 5JIPA 4U2ZA 3TYEA 4OIFA 1M01A 1EZ2A 2BGNE 3RUBL 3E6EA 3GUGA 4KCVA 1OFAA 3WJSA 4LCQA 2V3GA 3W73A 1BLIA 1IEIA 1P1MA 3PPHA 3TAKA 3P8IA 2BSLA 4MDPA 4XZNX 3ZT5A 1LLOA 1TMQA 1WDDA 4N4PA 3GFYA 1O94A 5D9PA 3WMSA 1UWSA 1JZ8A 5K4ZA 3M9YA 3VC5A 1M41A 3EX1A 1J2BA 3RX4A 1XLLA 3WH7A 2WANA 4J3UA 4JX6A 3KRUA 4KGJA 2CXEA 3DC8A 3PUDA 1GUVA 1L6WA 4GC3A 1DYSA 3KW3A 5BROA 2H6RA 1SZNA 4GISA 3MMTA 4KERA 4CU6A 1E5NA 2AL2B 4MUZA 3FJLA 3BJSA 4F0SA 4AYSA 3WENA 4ZOEA 3POHA 1EOKA 3VX1A 2I14A 4DWSB 4DXKA 1HIZA 5EYWA 3SDOA 4BZYA 2VX5A 1UHVA 3EZ4A 4RE2A 2A7PA 2Q71A 7REQA 4BWLA 2ZZ4A 2OFJA 5JU6A 1OFPA 1FH9A 3PZGA 1CCWB 2V5KA 3ZIZA 4D9PA 4NXSA 3SGUA 3QZAA 1L8NA 1YDYA 2VX7A 4PUMA 3NL2A 1MXGA 3TYBA 3G2GA 4R9OA 1V3HA 2X7VA 3WFAA 4EPDC 4IGMA 1HJUA 3A22A 1Q66A 4IMAA 2DT2A 4HJFA 1F73A 4W93A 2NQ5A 2I9UA 3UJRA 1FCUA 1QO2A 5C2GA 4U2YA 4JFWA 2IPGA 4JTCA 2PGEA 3BLEA 1I0BA 4CQ8A 3SAZA 1K77A 3GBDA 1HL8A 3GS6A 1VYRA 3VOFA 1VCGA 3I7SA 2EF9A 2D1ZA 4C1KA 1PV8A 1O5RA 4R27A 1OCQA 2NUYA 2QCDB 3F4VA 2WPGA 4QM1A 1OQFA 3TJXA 2I56A 3EWYA 2DP3A 5I2UA 2PDNA 5AN7A 1ITUA 1R87A 1TELA 3Q58A 3PWIA 2OU4A 4XKYB 3NDOA 3MPGA 2GVJA 4LW7A 2VURA 5A8OA 1QK0A 2VRKA 4REQA 4PMZA 5BOFA 1E15A 4FIQA 4GI9A 3ABRA 4H6RA 3F2DA 1UA3A 1U83A 4O1FA 3UZYA 1FKXA 4IIEA 3SQSA 1CXFA 4DJFD 5K2ZA 5AC8A 4PSRA 5FD0A 4ICNA 5KITA 2XN2A 1SYTA 3EOLA 4Z0JA 1FWTA 4JIQA 4E38A 1IT8A 1SO4A 3G1XA 3V5OA 1P0NA 3VMPA 4Y96A 3GNDA 3EWXA 1L6GA 2QCLA 3GC5A 4N9EA 1K70A 3K1GA 4ACZB 1SR9A 1KCKA 3WL0A 3VKCA 1DV7A 4AWEA 2J6XA 3HO8A 3K8LA 3WN6A 3W7GA 3QYSA 5I00A 4GCAA 2GDQA 2GWNA 1PAMA 3PZOA 2WZHA 1OCNA 4JICA 1QUMA 3L4XA 1KRMA 3H53A 4PMOA 1AJ0A 1PKLA 2XVNA 4UMCA 5HXMA 2J25A 3AHYA 1BKHA 2G37A 2A3BA 1LROA 1V79A 1P48A 2GYIA 4MNKA 2V5DA 2A5HA 4MYAA 2JF6A 3M07A 3SECA 3STGA 1W6TA 1J0KA 1LBFA 3BQ6A 2WJFA 3W28A 4PMVA 3R2GA 4FX8A 1W5QA 4Z1YA 3BOXA 2ICSA 1TV8A 3MANA 1VJSA 3ZSSA 4MY1A 4MG4A 4DVOA 6REQA 4B3ZA 3S5OA 3G0SA 3E5BA 3KHJA 5E9AA 1BF6A 2ZYFA 1VYPX 4O12A 4HKPA 4UWMA 4OZOA 5CSRA 3RMEA 1KM3A 1N2VA 4LEFA 3VMNA 3L12A 3WQ5A 2XUCA 1QO5A 5LHFA 4UTUA 4H9VA 4GLEA 5ABGA 1VBJA 4N0RA 4JHZA 3O6DA 3IV3A 5ECUA 4GY7A 7TAAA 1M03A 3NO3A 5I6SA 1TQJA 3W7RA 1TWWA 2XG9A 2FB2A 1S5VA 4XWUA 4HU3A 1JZ5A 3QM3A 2OKTA 2WQPA 4PUNA 2WSQA 1AH4A 4YHGA 2GOUA 4C1NA 1TPB1 2PRLA 3P2VA 3DN5A 1QNRA 3AHVA 3NXFA 4YNGA 3APTA 1IR1A 5TBOA 4JD4A 2QMKA 1WP6A 3PR2A 1DEDA 1VRDA 1YDOA 3LMYA 1ZJHA 1OIMA 3S3GA 2HWGA 4HA1A 1UPMB 4TVCA 2VP8A 5D9OA 1K7EA 1XDJA 3R0KA 4QLLA 5FJOA 3FW6A 1XLEA 3B9EA 4R9XA 3IV8A 3FHQA 4GJIA 3UR8A 3B8UA 3GRIA 4IQLA 4QNWA 3RRXA 4H04A 3NXLA 4I5XA 2RUSA 2BY3A 4PFHA 1B0IA 3EMQA 2XFWA 4A6GA 4WY0A 1PZ1A 1HTIA 4QX4A 1LOSA 2C3ZA 3R13A 1I2NA 2PTWA 2PF8A 4UFJA 1F74A 2ALDA 4KT2A 1B1YA 1HP4A 4NJJA 2H8ZA 2W63A 3NUKA 4G1NA 1TPH1 5CC7A 2J7DA 4LAUA 3WUEA 4GYKA 4C6NA 5CLWA 5T8GA 1US0A 1XLIA 1E6RA 3GAYA 2H3BA 3NAVA 1H1NA 3CH9A 1YMYA 3SURA 3JR2A 1QBAA 1W3NA 1QNSA 4U3CA 1PTDA 3TTSA 4HA3A 1IV8A 3WMBA 3C4UA 4HNOA 4FOUA 3KCJA 4ADSA 4Y9NA 2GVEA 3A24A 3BJFA 4EVZA 3VC6A 2NX1A 1VBHA 2CYGA 1HKMA 3GNNA 1FWGC 2E6AA 1UUMA 3QJAA 2WC4A 2QDEA 3WQWA 1WB0A 3HPAA 2FHCA 3SJNA 2DV0A 3KCLA 2DZBA 3MSDA 4O0QA 2BVDA 2YA2A 1NQ6A 3W86A 1IEXA 1J18A 4A21A 4ADTA 2V82A 4F79A 4C6LA 4ORMA 2VXNA 5K4XA 5DQPA 4H00A 2EEXA 1KV8A 1S2TA 2VGFA 3BDKA 2CBUA 4IPJA 4DZHA 3N4FA 4MWAD 2QJMA 4R7OA 2F6UA 2ZZ1A 5TF0A 1XIMA 1BSLA 5C9RA 2O4MA 3RM4A 3VDHA 4LJ3A 3CAWA 1OF6A 4DWSA 5BCAA 4GE8A 4WSJA 1MWOA 2IKHA 2BV9A 1U2YA 2CWNA 1E0XA 2X0HA 4AZ6A 1B5TA 2DZSA 2R1KA 4JTLA 4CNTA 1EB3A 3LSCA 3NEHA 4NL1A 1B3VA 3U8GA 4BI5A 1GOMA 3ELFA 1ADOA 4CNPA 1R6WA 1I8JA 4JFUA 3GKAA 2DJXA 2P5NA 3AXKA 2QJJA 4AWTA 2D0FA 3N1AA 3LLFA 1RV8A 1ME8A 1DL3A 1FWCC 1DOSA 4JIRA 4WDUA 4YTUA 4JTRA 1XYBA 4MB3A 4DBWA 1OT2A 1WBHA 2DORA 4JHMA 4JN6A 3IUIA 3QPEA 1NARA 3F7JA 3M0YA 1Q6CA 3OJGA 2PC4A 2V2HA 2DW6A 2UWFA 5FAGA 2WVUA 2FFIA 5GJPA 1N8WA 2QCDA 3PS7A 3ZQ9A 1XCXA 2TMDA 1TZZA 3SRKA 5IHSA 4GH1A 1TMHA 4FNSA 4ZFCA 1LL6A 4NNAA 1E6PA 2OLAA 4XKYA 3TC3A 1V7AA 4PN2A 4V1XA 3A9BA 5K7JA 3CZ8A 3S0CA 1XBVA 3ALFA 1M6JA 1X7IA 1QHZA 2G96A 3C8FA 3HV9A 2W91A 3EA2A 1I2QA 1LQAA 3EDEA 4ZEPA 1CBGA 4W89A 4UTKA 4DBEA 1GVSA 2X41A 3UG3A 4W4QA 1NWSA 1KBKA 3MSGA 2PU0A 2J6VA 3AXMA 4UQEA 1ONEA 2CLMA 4LCSA 1YHTA 5FEZA 2PS2A 2C8NA 2Z1BA 1C9DA 3E5PA 3URBA 4GWEA 3S4TA 3EOSA 1BYAA 2HZGA 1TPWA 4UTMA 3S1VA 3ZVHA 3SN0A 5XIAA 3LI0A 3BMXA 2EPOA 4HTBA 5D30A 3DFTA 3W1RA 2H9AA 4NZCA 2PZNA 5LA0A 4DXVA 3WF3A 1SQ7A 4UNLA 5HR6A 4DM1A 1OFDA 6XIMA 3CV2A 3B8DA 5IM51 3A5FA 3QMSA 4P8WA 4H9MA 4L6DA 1QVBA 2GJPA 2WOQA 4ICCX 4NZ5A 4O8RA 2DH3A 4DELA 4JTGA 3S5ZA 1VS1A 1V03A 4IXXA 4A8IA 1C9WA 4P7OA 4X60A 1UZHA 4PULA 2A6NA 1SMDA 3QSRA 3TDFA 4KIEA 3O9NA 1A3HA 4OU1A 4OVXA 3HPSA 2AOSA 4GKLA 1ITCA 4GQ0A 2E8YA 3PZMA 4QE4A 1G6CA 1EX5A 1WDQA 3VGEA 3CQ0A 5LNSA 1JEZA 3IIOA 4HGXA 5BU6A 1OABA 1BVNP 2DSVA 2VO5A 3OA3A 3H8AA 4PUKA 1M7OA 2G3MA 1DORA 3I7RA 2NWSA 4UR7A 3KL5A 2BBFA 3TC7A 4H8NA 5CXPA 2DW7A 1R2SA 4FF5A 4D71A 1TV7A 1Q45A 1MW0A 1A5NC 1QCWA 4D6IA 5AC6A 3BLOA 3VNDA 4E0CA 3OBEA 2ZXQA 4BEUA 2TPSA 2GGGA 1W0MA 3CK5A 3F5JA 2WC7A 2C71A 4GO9A 3ES8A 4PMNA 1UR3M 1WNOA 2FJUB 4LY8A 4RV8A 2XVPA 5DELA 1YEYA 4DNMA 1FDYA 1FWSA 2F61A 3N18A 3CV7A 2VX6A 4OT7A 3RLVA 3SSJA 3W83A 4IISA 1GZ1A 1WXYA 1RD5A 3OLGA 1X8CA 3MJMA 1XP3A 3AU2A 4AZIA 3NDZA 1XRTA 1GKQA 3CNYA 3GLCA 1Y8BA 5DN1A 1R3SA 1UCWA 4RUBA 3NQFA 2Y7DA 1ZJAA 3IWPA 4FK9A 5FEWA 1CLXA 2F9RA 4BWLC 4JNYA 2OX4A 4O54A 3N4EA 1XHGA 2FTPA 4QRNA 3HBLA 3WQPA 1ICPA 3BLLA 3O6YX 3ONCA 3D6NA 4A22A 5FSDC 3UYCA 4K68A 2EJ1A 2QHAA 1G4PA 1DBTA 4Q4SA 1VBGA 5HMEA 2HE5A 4AU0A 5EGRA 1IE7C 4IGNA 3TCEA 4QQ3A 4QJ3B 5FA5A 1GCYA 3WQGA 3OQEA 3ARPA 1NAL1 2CNCA 4QDMA 3BV7A 4PUDA 1EQPA 5HJYA 3A9IA 5BXTA 3VOIA 1XH0A 3GXDA 1H50A 1ME7A 1F05A 4PCTA 4TX6A 5H2ZA 1K9FA 5FJUA 3RPDA 5CCZA 2VVSA 4C6DA 4LAOA 3M4HA 2GVYA 3GTNA 2W3ZA 1Z6KA 4J3XA 4LU0A 2QV5A 2Z29A 2O7QA 4EK7A 3E2RA 1MDLA 3ARSA 1ECQA 3W7MA 3I3DA 3THAA 3GUWA 4OKDA 3UJEA 3QV8A 2FVKA 3PG9A 3AIUA 2V2CA 4S2CA 3KBJA 3S5SA 3H21A 2PWUA 3USZA 3SCTA 4M56A 3UETA 1PHQA 3AUOA 1V51A 3M0MA 4S3FA 3SW6A 4L1GA 1BAGA 2OEKA 3M43A 4LUTB 4NX5A 1U30A 5GQBA 2XIBA 4CD7A 2FTWA 2FQIA 3N9KA 3LTYA 4N9CA 4I3GA 3ZVIA 3HPZA 1OFOA 3CPUA 3T2PA 3GNOA 3WLTA 5K3VA 3IANA 1I2OA 4ZSUA 2AQWA 3GO2A 4P8VA 1QPRA 2QJIA 4LH8A 5HPCA 4QAWA 1WUFA 5HJXA 1UC5A 1D3HA 3KLLA 1GG0A 4B16A 3CZLA 1JD9A 1GTHA 4GNVA 1NOFA 3DHFA 4U31A 4D6EA 3RCYA 2PLCA 3H2MA 2A4AA 1AQ0A 3RLGA 1QTWA 4GI6A 3W22A 1CIUA 4LS1A 4IIDA 1LP6A 1TR9A 1KNWA 4RR4A 3KOYA 4D6DA 3MI2A 2E6FA 1GGOA 1JQXA 1E1EA 3TW6A 5A6BA 3QLLA 1K4GA 4UTTA 1RLCL 1AVAA 4MAVA 4ZOAA 4W87A 5GJNA 1GOKA 2NSXA 4Q4RA 3OGSA 3VNLA 3M6DA 3F4NA 3RMJA 3AICA 3HZ3A 2PDLA 1KTNA 3CJPA 2VEMA 4WCJA 3TR2A 4E3TA 1TPDA 5IFTA 5HWNA 4JCLA 4LAMA 3WK2A 4FOKA 2CLKA 4L9YA 2Z0IA 1OX4B 1AH0A 2VGBA 3MCMA 1UASA 1OG6A 3DECA 1Q8JA 3I6TA 4PODA 3GXNA 4GY1A 3LGGA 2QPXA 4IGHA 4NRSA 2WQDA 1HFBA 3KDNA 1KLZA 1IT7A 2D22A 2CBVA 2JEQA 2DZTA 4YS1A 5CSSA 3EXTA 4JEJA 3F2BA 3BSMA 1RCQA 3EWUA 1GEHA 3VFCA 1V7YA 1KXQA 3GHUA 3GXTA 1GOIA 4FNPA 4QISA 4HTYA 5A5WA 4AC1X 1J93A 5EY5A 4EAMA 4GH3A 4UOQA 3UZJA 3U2OA 3MWCA 1W3KA 3IAQA 3PZUA 3N6JA 3QY8A 2O9PA 4O19A 2FZNA 2OT0A 4DPQA 4FSAA 1RCOB 3F5KA 3ZT7A 4IQJA 1QNVA 1ZBCA 4EIVA 1CEOA 3PHAA 1MUWA 4DUWA 4WX2A 1LRNA 2ZWYA 3ZMRA 4AEEA 4XZWA 3QV9A 3RO8A 3SIZA 2EG6A 5KINA 1QFEA 3FA4A 4Y90A 3LV6A 2FB3A 1V3IA 1QJWA 4WIWA 3KVLA 1X1ZA 4KFNA 1GYNA 5I07A 4QS5A 1ODZA 1W1PA 1O1ZA 4DX3A 3I3BA 1V3JA 1Z32X 4A2RA 3QN3A 3VKKA 1ZJIA 2E4TA 1EDTA 2VI0A 4HK6A 3M44A 4RDWA 3DENA 3TIMA 1H51A 3VZXA 3TCSA 1PE1A 1SZFA 1CB7B 1JCJA 3R58A 1UKTA 2OX1A 4P2VA 4U5KA 3TNOA 3UG8A 3XISA 2BOEX 1PIGA 2YFOA 2FGZA 2PRMA 4Z2KA 3TA6A 2GJXB 1JI1A 1W3LA 3NSNA 3RFAA 1J0IA 2YBUA 4M3PA 4FLOA 4W7UA 1DWJM 2R1PA 2RGMA 3QY6A 4NZJA 3WEZA 1R5YA 1KLYA 1R3TA 5GJMA 4QAIA 2PCEA 4L5ZA 1OSEA 1KRBC 3BLIA 4JIPA 4LB4A 2Z00A 2J7HA 3DI0A 4GPNA 1CXIA 1HZYA 3LLDA 1PCWA 3U4AA 3SY8A 1BFNA 3IS4A 4I5RA 3F03K 3UZ5A 4O1AA 5H8UA 3HQOA 4MWAB 2F38A 3VK5A 4B3LA 1QPKA 3AMGA 3N2TA 1PIFA 2ZX6A 5I06A 3CHVA 2RAGA 5F1UA 4MTVA 5JXQA 3GR7A 3SEPA 1H61A 2QCEA 2IPJA 5HNNA 1H62A 5TAOA 3T0BA 4BI7A 3GNXA 1J9YA 3T0DA 2E68A 4YYCA 2QPUA 1UR4A 3VD7A 5C2XA 2J8GA 2EPLX 1Q7MA 2BHZA 4DRSA 4QROA 1C7SA 2VC6A 2WZMA 1QNOA 3LPFA 4DWSC 2PDBA 2H8XA 3FEMA 3SN4A 1NM9A 5DT5A 2PBOA 4C60A 3GNPA 1Y7VA 4YLWA 3G1FA 2JKPA 5DCEA 1Y5WA 2XGBA 4N4QA 1M68A 5E70A 5GPRA 3OZPA 2VZUA 3B8TA 3CZEA 1R86A 3BK0A 4HCHA 1FCBA 4K36A 4KCWA 2BXYA 1XIBA 1UJPA 5H8PA 1BQCA 2VQUA 3NA8A 1Q3NA 2FGLA 1OYBA 1XFBA 1KWGA 2NV2A 3TAOA 3GG1A 4BCEA 1W3IA 3LPPA 4Q6JA 5ABEA 4LXFA 3VGDA 1H5VA 1QU4A 3N2CA 4HIBA 4LBUA 2JE8A 3P6LA 4ZVJA 4DF2A 5I0DA 5LNRA 4IZGA 3DHUA 2CETA 4Z2LA 1J6OA 3PNZA 3EMZA 3NDYA 4PR4A 1S3HA 4B5UA 4O18A 2BX7A 4JFVA 1GYMA 2EPKX 3GU1A 3OB8A 5CBBA 3TFXA 1FDZA 4ORIA 4KKXA 4M80A 4IT1A 3LERA 3C0LA 3FYOA 3SR7A 5HQEA 3FNDA 3ONBA 5AY7A 3RITA 5I5RA 4DUOA 2CLFA 2ZUMA 2YDQA 4L64A 1PWMA 4PL1A 1A50A 1OBAA 4TMBA 3FX4A 2CLHA 3WDQA 2R1NA 3TMQA 2GSHA 4I7WA 1RCXB 2QW5A 2QUMA 4JIHA 1LDCA 1DWHM 3PBWA 4RXGA 1T96A 3QHOA 4DJFA 4NU7A 3NQAA 3SRDA 2PGWA 3U4FA 1A0DA 4DPPA 2Y8KA 1Q6OA 1XV8A 1IEQA 4HK5A 4B90A 4LEQA 3HG4A 3A5VA 4E4FA 5IOBA 4TQTA 4BEQA 4LUTA 1F61A 3DFNA 1QMLA 2J7BA 2XM1A 1KA9F 3S2LA 2XWDA 4OFCA 4QG6A 2Y4SA 3ZM8A 4E2OA 3DFSA 4HSNA 4Z1AA 2QUVA 2XM2A 1TWSA 2QULA 3SUUA 4V2XA 3A3WA 1JI2A 2BVTA 4JTAA 3GG7A 3WLJA 3T6CA 3EWWA 4DZAA 1HKIA 1VEOA 2X1TA 3RHGA 5B80A 1GW1A 3CASA 1VPXA 3ICJA 2A1YA 3G3DA 2WJZA 2BP1A 3UU0A 1ZTVA 4H8UA 4XBKA 4JIIX 5FF0A 3Q2DA 3AJ7A 1JZ3A 2OO6A 3K2GA 3MVIA 2PDCA 4YTQA 4LYKA 2RHGA 4Q8PA 4XVEA 4ZENA 5EA9A 4IWWA 3DBNA 4W5UA 1AZ1A 1ISYA 2ODOA 1GW9A 3P82A 3ZJKA 1VFTA 4GZJA 3LPOA 1W1TA 4H3DA 1KGWA 2CIPA 1ADDA 1G7UA 1XLJA 1IIHA 1JG9A 4WGXA 4X9SA 3SY1A 2Z1SA 4IMDA 2G8ZA 3CIXA 1O5KA 2O9OA 2V0TA 4YTSA 3UGRA 1OC7A 5DXXA 4GUJA 3EX3A 1GHRA 1OYAA 3O16A 1TZ7A 1HQTA 2BHUA 5E1QA 1SFJA 3BW3A 1TJ0A 1LRQA 4M6QA 1DXFA 1JPIA 4XX6A 3W84A 1OG0A 1E6QM 1FP9A 1XIEA 1W56A 3ZT6A 3UEQA 1XPGA 3B8SA 4URIA 1IGSA 4AW7A 1SO6A 1R30A 2WMIB 2NQJA 2X2YA 1OY0A 1TTPA 4ATDA 5IXEA 3GHTA 3TV8A 4ZCWA 1IXNA 2YBTA 3GXFA 1XGEA 3OVQA 1A3XA 5E9XA 3VIIA 4Q7IA 3EB2A 1KFEA 2E0PA 1ZENA 1BYDA 2YL9A 3NYZA 4MJMA 1YKWA 1HW6A 3PJXA 4Q6XA 1T5AA 3QPZA 4ZA0A 3TR9A 4MHBA 1HL9A 3QEZA 2G5WA 3AIQA 2XFYA 3LU2A 1UWQA 5REQA 4AB4A 3TYCA 4CD8A 3ANYA 3L4UA 1TTJA 4DZ5A 4GGBA 4D72A 1FCVA 3EWDA 1M5WA 3M5YA 3HMCA 2PP0A 4B5TA 5D04C 5DMYA 4HNLA 3PVFA 1FTXA 3WLHA 1KQZA 1VEPA 2WMGA 4JTFA 4HB7A 4AH7A 1ESWA 2V2DA 3QV6A 3TOPA 3OZOA 1EQCA 3ZO9A 3Q4DA 3KOFA 1THFD 1TCDA 4OUEA 1E6ZA 3LQGA 3RGTA 3L2MA 1US3A 4HZ6A 2Y85A 2YIHA 4PMYA 2EKGA 1WZAA 1DHKA 4W88A 2QAFA 1OC6A 3K1DA 2RDUA 1W1ZA 3TOYA 1TJ1A 2PAJA 5FL0A 4OBSA 4MNJA 2X09A 3L0GA 3IGHX 3WX7A 1VFSA 3AMLA 1MXDA 4NZ3A 2P76A 1XYCA 1JRBA 3PBVA 4AEOA 1TREA 4Z17A 1T41A 3W1AA 3URAA 2WKLA 4WJEA 5A8MA 2WAGA 4WJXA 3KTSA 3MYOA 4NY2A 2VUYA 3C0SA 4QNEA 4UB9A 4DLFA 1TSIA 4HMDA 1XQKA 3QKEA 1EA9C 2Y1HA 1T6MA 4C7FA 1QNPA 2HK0A 1CENA 4LWWA 4D8AA 1NFPA 3H2NA 1B90A 1E4LA 1JFHA 3I65A 3TLQA 1XLMA 2BGQA 3TQ0A 8XIMA 4PMRA 3B05A 1V02A 3GXPA 4R7JA 2CBJA 4WOQA 3UXIA 2NT1A 3G18A 4L4LA 3PB2A 2V6AA 4JL1A 2BMBA 1PUDA 3P81A 3AYVA 1JAEA 4A3YA 1ZB5A 2GVLA 3K8MA 2ZRZA 2J62A 2WVSA 1K7FA 3W1MA 4MWAA 1E4MM 3PNUA 4WDWA 1MXSA 4PEEA 3ECQA 2PWGA 4GK8A 2WLYA 1E4NA 3UESA 3GDTA 4J2MA 4BS0A 5I3FA 1S5TA 3S2CA 3CUHA 1A0CA 3IGXA 4OE7A 2FZ8A 4MOZA 3UXKA 1DWGM 3ENLA 4Y8EA 2FHBA 3UYIA 3WL1A 1EBHA 1N7KA 2RGLA 4PUJA 3E0FA 2VDHA 2PUZA 2INZA 4U5IA 2ZWZA 1FX6A 1CGWA 1W9PA 1E6XM 5AOUA 1WDWA 3NG3A 3KAOA 4YVXA 2OZ0A 3P5YA 3COTA 4O17A 2DUXA 2OZ8A 1AA1B 3BVJA 3STCA 4LVDA 1XH2A 1EJUC 3VILA 3TU9A 2WVVB 4PYSA 4QLJA 2QCFA 4KETA 4H9UA 4W8LA 1H2JA 1HKVA 5FEPA 2LLEA 3IVUA 3OEXA 4UTTC 3WFZA 1J11A 5H6HA 1UWRA 1NDVA 4JL2A 4XAZA 4JEQA 2WWCA 1WZLA 4XSLA 3QBUA 4AZBA 4I5UA 4WZHA 3MMWA 3EX2A 2NVCA 4D6GA 2R6OA 3U0HA 1MQQA 5ABHA 3TTYA 5G4HC 4NZ1A 2OLSA 3QQ1A 3CUGA 1P0EA 4B5NA 4ERAA 3R79A 3T7VA 4JY8A 1K8ZA 4AAJA 1KM2A 1R9ZA 4D6JA 3WKZA 5DMLA 1CNVA 3WK0A 2B7QA 4AF0B 2OVLA 3QQWA 3W6YA 1K9EA 3EEZA 3AXXA 3MHUA 4CQ9A 3E2SA 1F76A 5EB8A 4B2DD 2VC7A 4F0RA 4A3RA 1VKFA 5DY3A 3MMDA 1EX1A 2HISA 3WQFA 2PDUA 3REQB 6XIAA 4HA4A 1PHWA 2ZXBA 5E0KA 1ZP4A 3V35A 3U5YA 3W1LA 2OQHA 3NOEA 4E5TA 4ECLA 3P8JA 4LOCA 1VEMA 4RNHA 2NV1A 3EGJA 4ML4A 3M7SA 5CJNA 2IXVA 2YLLA 2FZ9A 5MF5A 3EKLA 3WNPA 1RH9A 3EPMA 2AQOA 1EJTC 5LGZA 4IIHA 2PODA 3EXSA 4C6PA 3USBA 3R43A 2WO5A 1P6BA 2GJLA 1TCMA 3WZ0E 4TV5A 3KOXA 5CC6A 3TK7A 2WSPA 2V3FA 4X63A 5DEZA 1CXHA 1VQTA 3N2MA 4AY7A 1R2RA 2ISVA 3FSTA 5DMNA 4B5XA 4E3VA 4HMCA 4IP5A 3DUGA 1JZ7A 2I7GA 4AISA 3K5XA 3L21A 3S2MA 1Z41A 3ABSA 4IP7A 2CZDA 1W1VA 5IHRA 2PLMA 3KXQA 4K39A 2GQAA 3M6YA 4EX4A 4Z2HA 3R5EA 3H2EA 3QOKA 3O63A 1JDEA 5DANA 2CLLA 3FYYA 1DJNA 1W5OA 3PF3A 4PB5A 4HNVA 1A5MC 3IJ7A 4NUWA 2INEA 2WMIA 3DEQA 4Q32A 2VEIA 3WK3A 3W23A 3W2LA 3KRBA 5AECA 5D2XA 1FQ0A 1BHGA 3S9YA 4Q8OA 3MCOA 1S2CA 5CPQA 4O1EA 3NJ3A 3BG9A 2R14A 3S47A 4FF7A 3UPBA 2ZADA 1PZ2A 4PBEA 3QTGA 4JYDA 4MVAA 3I6EA 1NJJA 1ZY9A 4YYFA 3CO8A 1VHNA 1YXDA 4A29A 1E0UA 5C8BB 3PBUA 3UWQA 1WA3A 2Z1XA 1SR0A 4UFIA 4WKAA 1CB2A 1CTNA 2YZRA 3GDRA 3CAQA 3WUGA 2TODA 2AL1A 1TTIA 2GUBA 1FP8A 1VFMA 3VYLA 2YA0A 1OEPA 3WH8A 2VC5A 3DI1A 2ZA2A 5B7ZA 3AUJA 2NV9A 4M19A 1UD4A 1QBBA 4LUSA 4FX6M 4PMDA 3LXBA 3DHDA 2Z7KA 5B7YA 4YTRA 4NG3A 4H01A 1QI3A 1KM5A 1ZBWA 2XSXA 4J7RA 1F4HA 4Q8TA 4XG1A 2YXXA 3TWAA 3TKFA 3B40A 4HMEA 1FWBC 2ZXAA 4LRSA 1XGZA 1M7XA 3BG3A 3IGUA 4MZYA 2TYSA 1CGYA 5GNZA 1FWIC 2OMAA 1EC9A 1KQYA 2GSJA 1CPUA 3VIHA 5T9CE 3FKRA 3L4ZA 4B4HA 5IDIA 1YXYA 1Q6RA 2X1RA 3AHTA 3V5FA 5AC5A 4XZMX 3VO0A 4EF9A 3GDKA 4AXNA 1H7OA 2Z6JA 3BO9A 1EJ7L 1NH6A 2YKKA 1JUEA 3NQBA 1MFVA 1RQEA 1MZRA 4Q8NA 4L1XA 1RZMA 3DG6A 2WBGA 1TJ2A 3H6OA 5C71A 1CXKA 4Y8FA 1O68A 2ZUSA 1EF3A 2B7PA 2C1HA 3UWYA 1A5KC 4V1YA 2OOGA 2XPKA 2O0TA 2D20A 3LNPA 2NX9A 1YNQA 4TMCA 1EGMA 4LC8A 8A3HA 2E09A 2BY1A 1BGGA 1XSKA 4GACA 4C6CA 3MZNA 2R1MA 5CGQA 2X8RA 4MGGA 4AIUA 3BC9A 2YGYA 2Q8LA 4DJFC 1ALDA 3WDIA 1GVIA 1VIWA 4MY9A 3UWVA 3EAUA 3JUGA 2ISSA 3M46A 5DO8A 3P74A 2ZX7A 2ZBTA 7ODCA 5HQLA 2EPNA 3TMLA 1H41A 3DGRA 4JQ4A 2E8ZA 2ZA3A 2E6DA 1F8IA 1JYWA 4O10A 1UD6A 2EPHA 5G4WA 2ABAA 3PTQA 3LHWA 3HA1A 4A8RA 3WH5A 3T08A 3W0KA 5D2WA 3MUXA 1J96A 1W9BM 1JYXA 4BHYA 3ITCA 3GHRA 1ONWA 3VIGA 3IEBA 4PCNA 3N29A 2JIWA 1Z9AA 1RPXA 1OFRA 4C6KA 2G4FA 2PCQA 1H3GA 1XIIA 3ZLGA 4JYFA 5C9UA 3OHMB 3SM0A 4NVTA 1C8QA 4M5PA 4UBPC 1FWNA 1FHLA 2PDIA 2QAPA 1P6CA 4C5ZA 4LSBA 5JQ9A 3PBMA 3B8WA 4AD2A 1K02A 1RA5A 1BYCA 4B9ZA 2WVVA 1KCZA 3IAPA 4HYWA 4O8AA 4HHMA 3C6CA 2X7WA 1EIBA 1F2JA 5LIYX 4M7TA 3EPNA 3NQEA 1FH8A 2WXDM 1G1YA 4JNMA 1RJRA 3PC0A 4U10A 1BPLB 5I3HA 3LHTA 2BWGA 2ADAA 5AYYA 7A3HA 1AODA 3LCWA 4XV0A 2NQLA 2I5GA 4M1RA 2VVNA 3GTFA 3B0PA 4FPSA 1F3TA 1XLAA 1O7AA 3H7RA 4GQQA 3QMTA 5CAKA 4FI4A 1PS9A 4Y9OA 3W26A 1XDMA 5D9NA 3DFQA 1RJPA 2GQ3A 4DYEA 1Y0EA 4NYUA 2WMHA 8RUCA 4AF0A 3KZPA 3LZ3A 1UQZA 2Y5JA 1ONXA 5BOEA 4WD0A 3URQA 4NYYA 1JIBA 4YL2A 2IUZA 2OGYA 1AZ2A 2CZFA 2IS7A 3M41A 3P14A 3W85A 5FJRA 1G69A 4JN8A 3C2RA 3MSYA 2VZSA 3V36A 3KRZA 3PZTA 1SJCA 3WJZA 1ML1A 3REQA 2RDTA 4HNTA 3G24A 1Q5MA 1R47A 4H9ZA 4RX0A 3N11A 4GO8A 1R3VA 1RBLA 1YW1A 2D2HA 2YL6A 2VQTA 3BE7A 1R3YA 3S5YA 2C19A 4AMAA 3BJTA 1PKNA 1AQMA 2JALA 3TSMA 4O14A 1A5OC 3ATYA 4PCFA 1QWKA 4NJGA 5DX7A 3QR0A 3FVMA 3EBVA 2POZA 2H3DA 3SI9A 2G3NA 3L7RA 4UFHA 4DO4A 3FJNA 1QI0A 4L4PA 5EPDA 1KRAC 5CZTA 4LANA 2EPMX 1X8FA 4ROPA 4H9XA 1VJZA 2IKIA 4XD6A 3S1WA 1UR1A 4GIEA 3MO4A 2QCGA 2IQTA 1XQLA 4IXHA 2BB0A 3VIKA 9XIMA 4HPNA 3I4KA 4RL3A 5BWFA 4LAZA 2PURA 3EA3A 4Q4PA 1SO3A 4P61A 4ERGA 5PTDA 3C2VA 3GH7A 1EWDA 1VLWA 3BCFA 4P8XA 7REQB 3R94A 3V7PA 4ATWA 4GIYA 5HWMA 1JCMP 2V68A 4NAFB 1W5PA 4LY4A 4MJ4A 3VM5A 2YB1A 3L67A 4Z2JA 3WBYA 3LXAA 1XYZA 1KR0A 1TKKA 1G4EA 4HBKA 1BD0A 2A3CA 3P62A 3RLUA 2Y2WA 1B3WA 2Y62A 3C0JA 3R8GA 5I77A 4MM1A 1TR1A 1UYQA 3HFTA 4IX0A 4S3CA 2C0HA 1IEWA 3TROA 1JDFA 5EMJA 1EJXC 4H7CA 4KRUA 3W76A 3GVQA 2PDXA 3AWOA 2XH4A 1CDGA 1J01A 1AJ2A 4H83A 3UVIA 3WY1A 4HA0A 2ZRUA 5JH1A 3KCOA 2Z26A 5C55A 4AWUA 5HWJA 4ERIA 2NT0A 1XF0A 2H90A 3HIJA 5HMSA 1SM9A 4LGXA 1NY1A 1IHIA 3H4WA 2YCJA 1KXVA 2ZRXA 2ZKMX 1YNPA 3GIYA 4M1BA 1WXZA 5H1WA 3NZGA 4GYJA 4O0KA 4LT9A 4IIGA 4MNMA 4H6QA 2XH2A 2C15A 4RCXA 3WNOA 1V6XA 1RY8A 2OSXA 4UTJA 1DIEA 1PTGA 1E9LA 2D69A 4TXEA 3W9ZA 3GVWA 1V5XA 2R1LA 3UNDA 3HGSA 4F9DA 3BCDA 3I10A 1UD2A 3RJYA 1TZ9A 4JTDA 5T91A 3UP8A 5SWUA 2P50A 4PTMA 4QIUA 2NVDA 2ZOXA 3CYJA 3CQKA 1A5CA 1LCOA 4UOJA 3NZPA 1J0JA 5FAJA 2JEPA 3LI1A 2ZZ2A 3LD5A 2ISDA 2V63A 4FHAA 3MC5A 4P5UA 3AIBA 2W92A 3CAKA 3ARZA 4PE8A 1P6WA 1S38A 1QT1A 2AGTA 1FA2A 3CEPA 3KRSA 4C6OA 2Y8UA 3QF0A 5EMYA 1I1WA 3QGKC 3SRFA 2CHNA 3M0VA 3PPCA 2OQLA 3W6LA 3VNKA 1O95A 2OR2A 3RLHA 1OIFA 3FIGA 3KBVA 5A8QA 2OKOA 4H2HA 2D2OA 3PTDA 1FWJC 1XC6A 5FEXA 2A0NA 4QG9A 3QR3A 3H12A 1EFZA 2Q02A 1G67A 2J4GA 2GVGA 3U57A 4CEUC 1ZLPA 3KHDA 1NDYA 4CVUA 8XIAA 6TIMA 4Z1DA 2PP1A 4BQ4A 4MFDA 1UWIA 4RNFA 3NQDA 5A69A 3E1F1 1PIIA 2HPMA 3UJSA 1VZWA 2HVOA 3PAJA 4UMAA 4WOZA 1DXIA 5LIKX 2ZZ7A 2GUUA 5FJIA 2DQXA 1WXJA 3LK6A 2YYUA 2HMCA 1P7TB 4M6UA 2GJRA 1E9ZB 2F6XA 2ZX9A 5AC7A 4CQAA 4HCDA 1ISXA 2ZIDA 3TE9A 2BFGA 3PM6A 3V4BA 3ZXWA 4R5EA 5HPOA 3AI0A 4IMEA 5A6JA 3BGGA 3UW6A 1XIDA 4OBTA 2WVTA 1Z44A 3E0IA 3AROA 4R53A 4Y6GA 3KTCA 3AJXA 2WK2A 2W9MA 3K4AA 5FCZA 1XICA 2HNEA 3BMWA 3TN6A 2PWVA 1YX1A 3MKCA 1K1DA 1C29A 2J47A 4C1NB 3OVRA 2D2JA 5EKYA 3TC6A 5JBDA 2YB4A 2J27A 3Q67A 3DX5A 5CLTA 4GVFA 3WMCA 3E49A 1XLCA 1Q4WA 1ZL1A 3NQVA 3W70A 3V1HA 4KEZA 5G5IA 3TYUA 2WSKA 3KFTA 1TUXA 4IF2A 4XZIA 4AY8A 2EAWA 1ZS2A 1XSJA 3F2CA 2YDAA 2YW4A 3N4AA 4AD1A 1KCLA 3W00A 1ZFJA 4UMBA 4JFSA 3AZSA 1HVQA 4JHOA 2XINA 1YNYA 3QV7A 2Z1WA 3I68A 3IIVA 2PSNA 1U5VA 1N8FA 3APGA 1GVQA 3P3BA 3G0XA 1SU5A 1XI3A 1WCGA 3K4WA 3V5CA 3SUSA 3C2OA 5AVNA 3AMCA 2BXVA 3B0YA 1W1B1 3KZSA 3SCRA 3IRDA 1Z42A 4EXQA 2YXGA 1ZCCA 1LF1A 4LALA 3EYPA 3BQ5A 2VL4A 2OT1A 4UC5A 4TOQA 2X05A 1C3FA 4H8VA 1SUXA 1T8QA 3NEVA 2W5FA 4NJHA 3U7BA 1MUMA 5LSMA 1SVDA 3M0JA 1W1IE 1SFSA 2FMNA 1NWTA 5LHEA 2RKXA 1KTCA 4Z1CA 3R0UA 2CZ5A 3C3UA 5DFAA 4G1KA 3NQ7A 4O13A 3ZJ7A 1BRLA 1YYAA 4WXZA 1XJBA 3ITXA 3R8HA 3ZZ1A 4ZO8A 3F1QA 4H4IA 1S5WA 2RJHA 4UCFA 3MMUA 4MLRA 2I57A 4AHQA 5H91A 3ZR4A 4HN4A 4C7DA 4AD4A 3LN3A 1XIGA 1H0GA 2ACUA 1ICSA 5LGXA 1LQ0A 1JVNA 3AZRA 5CG0A 1XS2A 1OCJA 3H23A 4XAGA 4X2RA 4AIOA 1V93A 3OQ8A 4QCEA 4CQCA 4GMEA 3T44A 2CLOA 3HQPA 2JGYA 1XBXA 4F8XA 1E3ZA 4S3AA 2E25A 4L56A 4J1OA 3TN4A 3C2YA 1CECA 4OGZA 3CPRA 4JYEA 4IIBA 2P0OA 2DIEA 3UFYA 3P5ZA 3R25A 2ISFA 3MBDA 1TX0A 1OGBA 2ZDSA 4FALA 3CWNA 1H5YA 4Z1BA 1ZZMA 2RH9A 4UNIA 3WF4A 4AZ5A 1C91A 8TIMA 4KEVA 3BUVA 3NZRA 2Z28A 3TYDA 1UWTA 2WMKA 2GL5A 2NW0A 2CFFA 4ZODA 3LRMA 4NAFA 3KS5A 7XIMA 3R89A 5G2WA 1E40A 1ZAIA 3GIPA 4JS3A 1JDAA 1QW9A 3DKLA 3GU2A 1DPMA 5K9XA 2DSKA 3AYSA 2VRJA 4E6MA 2HJPA 5TNVA 1KKRA 3AIRA 2PWHA 3VPLA 4MMWA 3NTYA 1YDVA 3ITYA 1QAPA 1XH1A 4A3HA 2ON3A 4XZHA 2A7RA 4LFYA 4B5SA 4BA0A 3P61A 1OGGA 1AUSL 2YYTA 3POCA 1R3QA 4AFYA 2WSYA 2E40A 4GYPC 1KR1A 1HN1A 4KESA 4XTDA 1RSCA 4O1BA 2ZICA 5FOOA 3KWSA 1QOPA 2XGZA 3N9RA 4JPGA 4E8CA 3D3AA 5I3GA 1GVYA 3C0QA 1EEXA 4GJJA 1LJYA 1DE6A 4ZR8A 2Y5EA 4EP8C 4QGCA 1KFJA 4HSOA 1XSIA 1YLVA 3GH4A 5LXXA 2WJEA 4F0KA 2VEPA 1DTUA 3CIWA 4YJ5A 5L6UA 5EU9A 1EXBA 4CCZA 1TIWA 4P7NA 5G1YA 3PUGA 4CEXC 2KAUC 2C7FA 4MKSA 4RE0A 1C92A 3OU8A 5LA1A 4IM4A 1R85A 3CLWA 2FPVA 1NVMA 1AFSA 1A80A 3O15A 3UQNA 3PFMA 4KFPA 3H26A 4XZ9A 3GC2A 4XD3A 1WAUA 4NHVA 5CBIA 2B7OA 1VC4A 2B31A 2XFRA 3UY7A 3B06A 3BAJA 4GA8A 4HU0A 4O15A 3G1DA 2JFEX 4ZQMA 3WLPA 2AMGA 4JBRA 2POTA 3S83A 3RF9A 1YDNA 2EG8A 4JTEA 1JCNA 3OVGA 1IZJA 4G5DA 3ZVHB 1JDCA 1Q2RA 3KUMA 4IJBA 4PTDA 2H9AB 3MUCA 3BAWA 4DF1A 4PL2A 2WKGA 9RUBA 5I7GA 3T40A 1LORA 4GZIA 1SW0A 4LV4A 1LZOA 1YPIA 1T40A 3H55A 1J0HA 1X1OA 3LHVA 1XIHA 4RKAA 2DY3A 1V8EA 4FR6A 3WDJA 4FNUA 1SJBA 3MHGA 1XGDA 4W8BA 5RUBA 5DXYA 1RAKA 4RPPA 2IW0A 3DIPA 4IHCA 3WD4A 3N2XA 4MWAE 4B2DA 4PUWA 1QW8A 3LGEA 3TW9A 1QDSA 2X0SA 3TLLA 1LG1A 1H09A 1M65A 3AC0A 4GQGA 4E8DA 1DKWA 3GR8A 4J35A 2CLIA 3PAOA 3NQ6A 5CH9A 3KVMA 3R6IA 1GQKA 2RFGA 4S3JA 1R0MA 4Q8UA 2VDGA 5TIMA 3CQJA 1P7TA 1JZ6A 4J27A 4AUBA 3JU2A 3PSVA 4HZ7A 1JUBA 1NDZA 2BASA 2UY4A 3FXGA 1QPOA 5LNWA 1KBIA 5HR7A 2OSWA 4XB3A 4O28A 2E7FA 3O05A 3B03A 2W4XA 1FRBA 3BAIA 1E3XA 3UJFA 2HVNA 1JCLA 3E0VA 3UT0A 2CZEA 4C6IA 3KM8A 5F2MA 1UZ1A 3XIMA 5DLCA 1GOQA 4G56A 3G77A 3GDBA 4GOAA 4ZOCA 5A95A 3WLNA 1BG4A 3V1PA 2XFFA 4M8UA 2OOFA 2HBXA 4NSBA 4MF4A 3PTKA 3H2AA 3G1SA 4CU7A 4O11A 1DJIA 4N02A 2PWFA 3MTWA 1HT6A 3JZEA 3NQCA 3HURA 4CKQA 3WBXA 1X98A 2FDMA 3ARQA 3LCGA 4WSHA 3U7VA 2DJLA 2IPFA 2WM0A 1O5QA 3DG7A 1DJXA 1RP9A 4F66A 4HPGA 4DJEA 4Y9PA 1WV2A 1TO3A 5AZ0A 2DZVA 1CT5A 2Q6ZA 4MPQA 3LY0A 3VX0A 2VEKA 3DHPA 1XD0A 2NVAA 4MY8A 1QI5A 4GVHA 4DY1A 3GDLA 3SUWA 4WLCA 3CV1A 4OOUA 1I45A 2XN1A 4OECA 3OZYA 4NI3A 3TUUA 3UGVA 4IPNB 1OADA 3CHDA 3W74A 1RQHA 1BWKA 4NJKA 2DZPA 2GQ9A 2V3EA 1AQFA 3E02A 4QEHA 2BS9A 1R9YA 4O53A 2W62A 4Y2WA 2PDWA 3H7UA 1D9EA 2QJNA 3WLSA 1JYNA 1X38A 4JNZA 8CGTA 1UUOA 1K8YA 2VZVA 3VOJA 2CU0A 1PX8A 2OEMA 1WOBA 3ZWSA 1JNEA 2FLIA 1V0LA 2UZ9A 3S42A 3LBCA 1XR2A 1ISZA 5HUPA 5D09A 1W31A 1HG3A 3DOPA 5M5DA 3BPWA 2EO7A 3HPXA 3RILA 2QKFA 1XIFA 3W7IA 3N15A 4N42A 3NPUA 5CGTA 3IJ6A 4E8GA 4E2DA 4LBSA 2VR5A 3LV5A 3RX3A 4CCEA 5AZ1A 1JCTA 1B2YA 3CIVA 4RK8A 1T8XA 4ENLA 4US5D 4AD0A 3IJ8A 2G0WA 1TA3B 2OWCA 1GG1A 3W07A 3R10A 1EXPA 2ZZ3A 4KH2A 4WHBA 3UXDA 4I6VA 3VD9A 2ZTJA 3E38A 3DBPA 1OGSA 1A47A 3UZZA 4W9TA 3IVSA 3LMZA 1E43A 3WF1A 4L9ZA 1QK2A 4N7QA 3UD6A 1EJWC 2OO0A 1BVZA 1FH7A 5DCDA 3WEMA 3PZNA 2HQAA 1V3LA 1L6YA 1WAWA 5M1TA 2XSBA 4WGHA 3W2UA 3UCCA 3V3WA 2FVLA 4HOXA 2PD5A 4Z08A 4NNBA 5JUVA 4NIRA 3FYPA 3CU2A 1GQLA 4AHPA 3O6AA 1XLBA 1E0WA 3Q65A 4KWUA 4POCA 4QEEA 4BFAA 2GSEA 4C6MA 1J79A 1DWIM 2P0IA 1TV3A 4DWDA 1LL4A 4XAFA 3AXIA 4PGLA 3YPIA 4AG0A 1OJXA 4LYQA 4LRTA 4DBUA 3CT7A 4CN1A 1MUCA 2HS8A 3JZUA 3D0CA 1U1JA 1UP3A 3AIWA 3G8EA 1BF2A 3E0LA 4RZBA 1IXOA 1H7NA 1HO4A 1S2AA 3W87A 5A2BA 2QV4A 4GCXA 4DYKA 1XPYA 5HK4A 2HNHA 1OHLA 3LM3A 2CESA 4WSKA 3KBMA 1CGTA 1SW7A 1I75A 1LG2A 2A3LA 4BR1A 3TTOA 1SZRA 2X1IA 4UTIA 2QXWA 3TFCA 1EUAA 3A12A 3C2FA 4LNCA 1GORA 1RP8A 1E5JA 4UXDA 2Y0FA 2GDVA 2VCAA 3CL7A 2ZX8A 5KSWA 5CPTA 4TX8A 4EPKA 2VENA 3ARWA 2VX4A 3OOQA 4CNUA 1NIUA 4ALDA 4ZSTA 3SGZA 3TX9A 4JKMA 3UZWA 4BK9A 5CJMA 4LVFA 3M0ZA 5BMWA 2XIJA 2DT1A 1HF6A 1H7WA 4B5WA 3E96A 3M5XA 2DVTA 1WZKA 2O55A 3CZKA 4J9JA 4F3HA 5D03A 1K03A 5A6AA 4JQAA 1VFHA 1MYRA 2PTZA 4G7EB 1V3MA 1EP1A 2Z6IA 3TJIA 2WNWA 1IZKA 1PEZA 2DQWA 1X6LA 1JF5A 3NPXA 5KMYA 4HN8A 3AS1A 2QDHA 2XGIA 4MZ1A 1A4MA 3W29A 5I03A 4C65A 4ILSA 3RYSA 1E1CA 1GYLA 2B7NA 3L9CA 1RHCA 3MBFA 3GAKA 5CC5A 3ZS4A 5LIXX 1AMYA 1XKYA 4YWIA 3PSWA 3GVVA 3MW7A 5FKYA 2XTKA 2E5BA 1H7XA 4ES4A 1CLVA 3W88A 3TZFA 4GXMA 3AYTA 3EB3A 1OZMA 3TONA 3CL6A 4DM2A 1YRRA 2ALRA 1HGWA 6ALDA 1K6AA 5FF4A 4CNNA 1TUFA 4WF7A 1FWRA 2WPBA 4DO6A 2QCCA 4AXKA 3ZWTA 1UH2A 3LCIA 5TD4A 3OGVA 3QKZA 1TVPA 4W84A 4GFIA 3ZJ8A 3AS0A 4KRTA 3C52A 2A2IA 2V8ZA 4RE3A 3ZJ6A 1MDRA 4K37A 3SCNA 3T8QA 4HOWA 4HJWA 3S8HA 3VD5A 5H8MA 3S1UA 5BRPA 4L6OA 1DJGA 2PDJA 3C8NA 4I6KA 1YADA 3AFBA 5IBXA 5KZDA 3WD0A 1EOMA 1E73M 4JAWA 3IJQA 3LDVA 5CZSA 2X42A 2WBKA 2OYMA 1H7PA 3OW1A 2J7GA 1POKA 3N17A 3W27A 3W1PA 1SSGA 4FAMA 3RPMA 3DFHA 2XJ7A 4PMJA 3VCRA 3Q45A 3TXVA 3LGDA 1X96A 3A6OA 3T07A 3S9ZA 3HJEA 4FLSA 2OEJA 4J40A 1LT8A 5A6SA 1LWJA 4U3AA 2PA6A 3M64A 2Z2AA 4O57A 1GZJA 2VELA 3B9OA 1FHDA 4PMUA 3BGAA 2UY2A 5C6MA 1XYMA 4ZQCA 1WBJA 3DU0A 3S1GA 1ONRA 4MB5A 3PZ9A 4QE5A 4JXCA 2VC9A 2R9RA 3J7HA 3KTXA 3U3HA 4NF7A 4DBSA 2OELA 2HS6A 1IF2A 4R33A 5AHMA 3CTLA 4PH6A 3FHAA 3IARA 4W85A 2YW3A 5U4NA 4MKVA 3HQ1A 3WQOA 4UNKA 2VEGA 3MKKA 4UTHA 4LCRA 2PWDA 4DO7A 4MAZA 3STPA 1H49A 1G4SA 4ACYA 4Q8WA 3VOHA 2OWXA 1V0KA 2ZUVA 3ABXA 4KCTA 3FVDA 2NX3A 2PBGA 1O60A 2YOCA 2XVGA 4QSFA 3UCDA 4NKCA 1R8LA 1PKYA 1DJYA 4PUEA 2ACRA 1P0DA 4GD0A 4EPBC 4AYGA 5I02A 2XU2A 3IVTA 3L2IA 4M6VA 1QOXA 1XCFA 1MMFA 3W81A 2V3DA 3CZGA 4W7WA 3WBWA 3VKAA 4IP4A 2GLKA 2XISA 2Y5SA 3FY1A 3BV4A 1I1XA 2DUAA 4D8LA 2WLZA 2VGGA 2AKMA 2EHHA 1H63A 2CCRA 4IPLA 4DLMA 3FS2A 2J7CA 1TPEA 2F2HA 2Y7EA 3ZR5A 1E6SM 3VZZA 2JIEA 5CGMA 3CQHA 4S38A 1E56A 4HNUA 1GOXA 5I78A 1V4YA 3PJUA 1GKPA 1KKOA 1VH7A 2ATSA 3VE7A 3B8IA 1M3UA 2PMQA 4PTWA 5BU9A 3ZR6A 4C6FA 4J3ZA 4XO6A 1FKWA 1TA3A 5T9BG 1PB0A 1CXEA 1EHAA 3EA1A 1H7RA 1UR9A 3K30A 2J8FA 1HJQA 2V81A 4K7VA 1K6WA 3UCQA 2QYGA 3VKDA 3M7WA 1QRQA 1XWYA 1G5AA 4IJCA 4IJRA 1GTEA 1MW1A 1A3WA 3AIVA 1B3ZA 1VBRA 1UW9A 3BLKA 1XLKA 1XFCA 3O6CA 3L4TA 3C2EA 2J77A 1C7TA 4KMQA 1EP2A 6ENLA 1TJPA 2Y89A 1PX3A 2HRWA 3BAXA 4JTKA 3ZLHA 3H54A 2Z25A 1UD5A 3VKJA 1KM4A 3FXYA 3W25A 1XUUA 2TAAA 1UMLA 3LG3A 2CW6A 6CGTA 1MEIA 2JGQA 4DBDA 1U22A 5AB3A 3NPVA 3ERPA 5J04A 2FKPA 2PI6A 1YIXA 4GNJA 5HMFA 3SSZA 2WMFA 2O56A 3N2OA 2UBPC 2G3IA 5I23A 4HQVA 5HINA 2WHLA 1JPKA 1EF2A 2FH6A 5CPMA 4DUVA 2R91A 4WKHA 3MVTA 2PGRA 1PDYA 3EB4A 3N14A 4GZEA 1QHOA 3VABA 4F2TA 1WKDA 3CMJA 2DSUA 1VPQA 1NSJA 1ZNNA 1AK5A 1SZEA 4OBRA 2D2GA 4IL2A 3HB9A 4BJHA 2FIQA 4LUIA 1KXHA 2J79A