1AZ2A

Citrate bound, c298a/w219y mutant human aldose reductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az2A00
5HNTA 3M4HA 1Z89A 2FZ9A 3Q65A 3BURA 3V36A 3LBOA 1X97A 4GACA 4JIHA 1YE6A 1S1RA 4JTDA 3LQGA 4GA8A 1UR3M 2HDJA 3P2VA 4JIRA 3H7RA 3VXGA 5HNUA 2HE5A 4QXIA 4XVDA 3CASA 4GQGA 4WDTA 3UZYA 3R7MA 4JQ3A 2PEVA 2F38A 4JTRA 3UWEA 4I5XA 2PZNA 4JQ4A 5DANA 2IKIA 2R9RA 3S3GA 4LB4A 2HE8A 2PDBA 2HVNA 3LD5A 4DZ5A 2ACQA 4GCAA 2PDWA 2DV0A 2ACUA 3RX2A 4EXBA 4YVPA 3RX4A 2QXWA 3LQLA 1PZ0A 4JQAA 1ADSA 3CMFA 4PUUA 1EF3A 4ASTA 4WGHA 2FGBA 3FJNA 4IJCA 1AH3A 4GIEA 3LZ3A 4WDUA 1Z8AA 3V35A 4FALA 3H7UA 2AGTA 3BCJA 4XZNX 4DBUA 4L1XA 1EXBA 1EL3A 5LIXX 2ACRA 1FRBA 1AFSA 4H7CA 1AZ1A 4QX4A 3B3DA 2PDPA 1Z9AA 2PDNA 3M64A 4H8NA 3ONCA 4DBSA 3LUTA 3UG8A 5AZ0A 4AUBA 3UYIA 4FAMA 2R24A 1AH4A 2ISFA 1PWLA 1K8CA 1YNQA 4IGSA 3ERPA 4ICCX 1ZQ5A 1PWMA 3GHUA 3CV7A 1JEZA 1HQTA 1XGDA 1AH0A 3GHTA 2HEJA 4FA3A 1YE4A 1AZ2A 4JTCA 2DUZA 4FZIA 2PDGA 1HW6A 3LN3A 4YU1A 4HBKA 3LEPA 3GHRA 1US0A 1C9WA 4L1WA 4JQ1A 3LZ5A 4PR4A 5AZ1A 3UZWA 3MB9A 2PDYA 1QRQA 2INZA 1ZUAX 4XO6A 3R58A 4G5DA 1S2CA 1Z3NA 1PZ1A 2IKJA 3U2CA 2CLPA 4PRTA 4XO7A 3KRBA 2P5NA 2PDMA 4Q7BA 2J8TA 4JIIX 2PD9A 4JQ2A 3NTYA 4XK2A 5KETA 2BGSA 4OTKA 2PDIA 3UFYA 4WDWA 2PDHA 3V0SA 1X96A 4XZMX 5JH2A 4WDXA 5LIYX 1VBJA 3O3RA 1S2AA 4F40A 1A80A 3UP8A 1IEIA 4EXAA 2BGQA 2PDJA 4PMJA 4ZFCA 2PFHA 2NVCA 2DUXA 2WZMA 3C3UA 4LAZA 4LAUA 2PD5A 1IHIA 3O0KA 4QR6A 3ONBA 3DN5A 2FZ8A 2PDKA 3H4GA 3UGRA 1ZSXA 3G5EA 3EB4A 4HMNA 3M0IA 3UZZA 1T41A 2F2KA 2IKHA 3V0TA 1ZGDA 3WCZA 3GHSA 1T40A 2FVLA 3QKZA 1MRQA 3BV7A 1MI3A 4XZIA 1RY0A 1LWIA 3F7JA 2ALRA 2HV5A 2IKGA 1PYFA 4R9OA 1RY8A 2IS7A 2IQDA 4DBWA 2C91A 4YVXA 3V0UA 5JH1A 3R43A 4NKCA 2PDFA 3COTA 3LNMA 1YNPA 3N2TA 4RPQA 4GQ0A 3DOPA 2BP1A 1M9HA 2WZTA 4JTQA 1OG6A 2IQ0A 2ACSA 2VDGA 2I17A 4IJRA 1X98A 1XF0A 3GUGA 3N6QA 2PDUA 4XVEA 2PDCA 3MC5A 3G1RA 3EAUA 2IPGA 4LB3A 5LIWX 5M2FX 4PRRA 4YVVA 4WRHA 1LQAA 4JTAA 2IPWA 5C7HA 2FZDA 2INEA 3R8GA 3LENA 3BUVA 1EKOA 2PF8A 1Q5MA 2FZBA 4XAPA 4LBRA 3FX4A 5LIKX 1VP5A 4YS1A 3R94A 3CAVA 1R38A 2HVOA 1S1PA 1XJBA 3CAQA 1GVEA 4WEVX 3WBXA 4XZHA 1MZRA 1J96A 2PDLA 3RX3A 3WBYA 3WG6A 5LIUX 3WBWA 1RALA 3R6IA 3EB3A 4PUWA 2IPJA 3CV6A 1Q13A 2IPFA 3T42A 2PDXA 3Q67A 2A79A 3R8HA 3D3FA 4Q3MA 2I16A 1QWKA 4XZLX 2PDQA 5HA7A 4LBSA 3UZXA 2NVDA 4MHBA 1SM9A 4QBXA 4GABA
chains in the Genus database with same CATH superfamily
1TJ1A 1WCGA 4H1ZA 4QISA 1FWDC 2VENA 3M5YA 4BF7A 6TIMA 1RZMA 3DYOA 4B9ZA 3TAOA 2BOFX 1S1RA 1US2A 4NYYA 1PDYA 2NQ5A 1H49A 1XLBA 1J5SA 3CPGA 3NPXA 2INFA 3R25A 4S3BA 3SY8A 1J11A 1MEIA 3K30A 1Q2RA 4AZ7A 4W8AA 4JTRA 1UZDA 3UETA 3VOJA 1HKVA 4JQ4A 4LC6A 3VOHA 4Z0JA 2CBIA 2BS9A 3OZYA 3C2OA 3CGTA 3EA1A 2ZUMA 4E0CA 4JCMA 3TFCA 3EOLA 1XLHA 3JR2A 4C60A 3TSMA 1DJQA 3OLDA 2ACUA 1W9UA 4EXBA 1P1XA 4WR3A 4I7UA 3SIZA 3AJ7A 2CLIA 4JQAA 1TPH1 1YMYA 1EF3A 3ABZA 4FNRA 3NEVA 3VIKA 3AIRA 4LUSB 3DFHA 3TC7A 3W02A 1E55A 1QI3A 4MWAB 5EFFA 3TNOA 4JZ5A 3ABXA 4RNIA 1W3LA 4Z1DA 4MKSA 2QDHA 4ADUA 4DNHA 4KRTA 2Y63A 1HJVA 1BYCA 2E6AA 4JEJA 1UWTA 3FJ6A 3UXDA 3SSZA 4X61A 1LLOA 3KX6A 4NZFA 3HGJA 3UZ5A 3ONCA 2J9YA 1NY1A 4UTLA 4LXFA 3TYAA 1H61A 2CZDA 4PMNA 1W5NA 3WQCA 5C9RA 3ECQA 1QPRA 1ZCCA 4KWUA 4RXFA 5FL0A 3GK0A 4QROA 4OU1A 4NJKA 3TLLA 3VINA 4LRSA 1QI2A 1SFSA 2BODX 3W2NA 4AG0A 2BSLA 4LV9A 5I3KA 2I56A 3KP0A 1B30A 1HXJA 1XINA 4RCXA 2PP1A 3U3HA 3DDMA 1MQRA 2OT0A 2W62A 3WK0A 5A6BA 3QHOA 1O95A 1B1YA 3VMPA 2ZOXA 1RVKA 2CEQA 5KINA 2YYTA 1RD6A 1ZJAA 1K02A 1PZ1A 2BOEX 2B4GA 2AL2A 1I4NA 3ARSA 3IJQA 1KQYA 3GWQA 3EA2A 2H6RA 2CCRA 1W1B1 3Q37A 1FCUA 5EBAA 3SRFA 4O53A 1RQEA 4DUWA 2JEPA 4CD7A 4LAKA 3TKFA 3W2LA 1KFKA 3REQB 3WJYA 3MUY1 1UR1A 2F6UA 3QYQA 1VZWA 2GGHA 3S9IA 1XPYA 1QXLA 3AMKA 4KWWA 2WCGA 4M29A 2PGRA 4F40A 1IT7A 3UESA 1YDVA 3RDKA 5AYZA 3UP8A 2ZRZA 2QPUA 5G4EA 3E0IA 5AHLA 3VYLA 3LHTA 4KBXA 3HQ1A 1CECA 1H3GA 1OIFA 4MJZA 4AWEA 4Q8VA 3HO8A 4LAZA 3THDA 1NOFA 4DYKA 3W1LA 2OELA 3RPTA 4PTDA 1EWDA 2WPBA 2XVKA 5I07A 4ZTXA 3OZOA 3SQMA 3WLKX 4Y8EA 2VUYA 5CC3A 4ATLA 3EDEA 1ZGDA 2BOGX 4PUMA 4RZ4A 2C16A 2REQB 1UR8A 1TWWA 3UJ2A 1UWSA 4Y7EA 4RV3A 3MI6A 5HDRA 3M7SA 4L61A 2DDXA 3WD3A 1GW1A 1YTEA 2BFGA 3II1A 1PYFA 4QHRA 2F9RA 3C61A 1ADDA 3H12A 3BJSA 3TR2A 3VD5A 1XUZA 1OY0A 2FHCA 4GQ0A 4LTSA 1T0OA 4AIBA 2G3MA 3CEUA 4IX2A 1QHZA 1FCBA 3D46A 2QGHA 2WZTA 3O6DA 4JTQA 4Z0SA 5BOOA 2VDGA 1U5VA 2E3ZA 2PWUA 5FCZA 2EXOA 2ZXBA 4C6CA 4AC7C 4QLLA 3W6LA 1DHKA 3OA5A 1DWIM 2NUYA 3LG3A 4XVEA 7A3HA 1GOQA 3UCCA 3W88A 1AQ0A 4JGDA 4MPKA 3LXAA 2WWDA 3TN5A 3N2CA 2AQWA 5F1UA 3TTEA 1Y0EA 2YL8A 1DV7A 4JTAA 2INEA 3GTFA 3K1DA 5DCDA 3LENA 4OGZA 4QITA 1JG9A 3WNKA 4H9TA 1D3CA 3WQFA 4MKVA 4DO7A 4ERAA 3BAIA 2QF8A 1RK5A 3WJSA 3F03K 3PBVA 2QJIA 2OMAA 2BDQA 4KS0A 2YA0A 3RLHA 3WF2A 5JUVA 2VC9A 1XDLA 4EKJA 2ZIDA 5H8MA 3BAKA 3RG6A 4HJFA 1MXDA 2CPUA 2XIOA 2PWDA 5CJMA 2NV1A 1ZENA 2X09A 3WG6A 3OYXA 4EVZA 1RALA 5HJLA 5K3VA 2PUZA 4BK9A 1KM2A 1A0EA 4IOTA 4XAFA 3B0UX 4KH2A 1JDDA 4IIEA 4YTRA 4K3ZA 3ZR5A 3DFPA 1UG6A 3WLMA 4CUCA 1W17A 4HYVA 2OX4A 2YSWA 4W86A 1ISZA 1QWKA 3H2FA 3PZNA 2WVSA 3VGEA 4PCFA 1OG0A 5HATA 5A3HA 5DCBA 4C65A 3VNDA 4JCLA 3H2OA 1QPQA 4NP7A 3W1AA 4H9UA 2HBVA 3QC0A 1DTNA 3VNKA 1VQTA 4LC8A 3WBEA 3Q65A 3QKEA 4O11A 1S5MA 3EEGA 2YFOA 3HV8A 5LSMA 2HDJA 1V3JA 1W3KA 1C92A 2MANA 2VFEA 1Q7QA 3PTMA 4RX0A 1VPXA 3R10A 4U3CA 5BMWA 3TYEA 1J10A 3BLPX 2E77A 3G1VA 5KEZA 4GYPA 2BXVA 4GI4A 3K4WA 3LTYA 4LVDA 1R3VA 2G5WA 3H6OA 1J0ZA 1J93A 4PFMA 1KLZA 2ZVIA 3TE9A 3RK8A 1OX5A 1B2YA 1OT1A 4DZ5A 3SRKA 2J7FA 4RDYA 2VT0A 2J9ZA 2QXWA 4NJGA 3LQLA 4QRNA 2FVKA 3LU2A 4QS5A 3C4UA 2OTDA 1EX1A 3B0PA 3A4XA 1IWPA 5CG0A 3APYA 3RU6A 3OG3A 3RILA 1FP9A 4O0QA 4GYKA 3H4XA 3NM1A 2O9TA 3CYJA 2VEGA 1QI4A 3A13A 1CWYA 2NUWA 2GK1A 1FWFC 4C1LA 1DWJM 4ZB2A 3AZSA 3O16A 4UTHA 4DBSA 4IIDA 4TIMA 5CSSA 4EF8A 3WQ6A 1UPPA 1JYWA 2R24A 4HKPA 1AH4A 2WLYA 4DJFA 2XSXA 4ZOAA 1GOOA 4G7EA 2XFYA 2CNCA 3UR7A 2QF7A 4N7QA 4N9DA 4D1IA 4O0KA 4QJ1A 3VIOA 2RKXA 3MJMA 1J0YA 2OR2A 5LHEA 2X8RA 1IGWA 3GKAA 2C3ZA 3TWBA 4LS1A 3LHVA 3MQTA 1OK6A 4CCCA 3WDRA 3WYZA 3NDOA 3LX9A 3CIXA 2EKGA 4CU7A 2V0TA 3BW2A 2B7NA 2WMKA 1YDNA 3ZJ8A 2JKEA 3PAOA 3OZMA 4GYFA 3HF3A 2D2HA 3QMTA 3VD4A 1YKWA 1OF6A 3EDJA 3RCMA 1WPCA 1ZBVA 5J04A 4UR7A 3PB0A 4XO7A 4DZHA 1KXQA 4XV0A 2PDMA 1FDJA 3GG0A 4W87A 4LOCA 4KCVA 2XGZA 1EH9A 1UR2A 1VRXA 4HPHA 1O6IA 3C8NA 4TX8A 1UQYA 3KFTA 4AZHA 4D8ZA 2V3DA 3HN3A 1QOPA 5AC4A 1JZ7A 3LRMA 3ABSA 4BWLA 1N8IA 3VIPA 1RSCA 1S2AA 1BEUA 1LORA 4C6IA 2Q6ZA 4M8UA 4F0HA 2FQIA 4AD5A 1VPQA 1E73M 2Z1XA 1Y7VA 5DXXA 4K8HA 3UF9A 1TO3A 1P0BA 1XCFA 2IMRA 2ZUVA 5HMDA 2X05A 1DKWA 3STFA 1J0KA 1X39A 2NVCA 3R11A 1W2VA 4IUGA 4G2DA 1B0IA 1LLZA 3BMVA 1CLXA 3LSBA 3BMXA 4Q8WA 3BAYA 4RZ6A 1HKWA 1TVLA 5KITA 1TJRA 3DN5A 4B5SA 1SU5A 1MW2A 3H4GA 3G3MA 3PUDA 4P7LA 1KCXA 1OFRA 3KRUA 2ZWZA 1OSEA 4UNKA 1NP2A 1TMHA 3NPVA 1QOXA 3TIMA 1JCNA 1FWRA 3O1NA 1MDRA 3GHSA 4EWND 2E40A 4O1CA 2OOGA 3FSUA 4C6OA 4NZ5A 1ZAIA 4XD4A 3T2OA 1MI3A 2WVUA 1KGXA 3VGBA 2HV5A 5GPRA 4JTSA 1E56A 1RY8A 4UTIA 4QAWA 4OHQA 5EGRA 2DZTA 1PIGA 2Q01A 3KBVA 3EWBX 3GTHA 1B3WA 4RZ5A 5AHMA 1M5WA 3IAQA 4M56A 3NZQA 2PRHA 3HURA 3SEPA 4LJ3A 3R8RA 1W1TA 2YOCA 2XSAA 1B54A 3GD6A 1P0NA 2I17A 3KZPA 4E8DA 1PKLA 4W88A 4PL2A 2PCEA 2ICSA 3ANVA 1F76A 3ITLA 5CSRA 4J9JA 1Q7MA 4ATWA 2WMJA 4BKNA 1PV8A 3N4FA 4AYSA 2RGMA 3K8KA 1DIDA 1G69A 3AYTA 3AXIA 1W37A 4B92A 4DF2A 3I6TA 3OBEA 1X6UA 3W7QA 2FGZA 2VZTA 1SPQA 1RCOB 3WKZA 1TV4A 6ALDA 4WX2A 1ZJBA 2RFGA 4LS0A 1M01A 1E0WA 1K9FA 3R13A 3V3WA 2Q8LA 4IQEA 3V75A 3BLIA 1ISVA 2G96A 2V81A 3NZRA 1Q5MA 5FJRA 3SCSA 4J27A 4I6VA 8XIMA 5A8MA 2WLZA 1TWDA 3IIVA 1OC6A 4HPNA 1I0BA 5FSEC 3W73A 1OBAA 4HGXA 4P8WA 4WHBA 4LUSA 5C54A 3UQNA 2XZ9A 1XJBA 4LRTA 2VEIA 4MWAA 1KFCA 2VX6A 2PDLA 4UFHA 3VKAA 8RUCA 2DJLA 3OVPA 2GDUA 4XD5A 2VVNA 3TTQA 2QJMA 4N02A 3UY7A 3W7DA 4XZ9A 4ENLA 2OT1A 3P80A 4A05A 5CKSA 3HGRA 3S9ZA 1HG3A 2A79A 3MJYA 3WNMA 3D3AA 2DZXA 1EJWC 3UJSA 5DEZA 2VQTA 3W81A 2I16A 2F7FA 1IXQA 3AC0A 3PZMA 1FHUA 2ZYFA 2YXGA 2FKPA 4LBSA 4HOZA 2ZUNA 3PBGA 1G5AA 1SM9A 1TB3A 4Q4SA 4AZCB 4NQ1A 4HQVA 4X2PA 4CD4A 2CKSA 1SO6A 2R1KA 3UZJA 3SO7A 4Z1CA 4BQ5A 3OVGA 3LMYA 3QVQA 4MTVA 3OBKA 3TLQA 1YXYA 4D6DA 3AIWA 2BHZA 1MW0A 3GAKA 1IXNA 3ZM8A 2QCHA 2E4TA 3GVGA 4JFSA 5BRPA 4HK6A 3CASA 2XUCA 4WDTA 4WKHA 3B8SA 2RUSA 3N29A 3TJ4A 3NGFA 4O16A 4JYFA 3UPMA 2CBUA 1UIPA 1Z41A 4QFUA 2IKIA 2C14A 4GH1A 3ZWSA 3W7GA 1BQGA 2ZE3A 4J40A 1C8QA 4D1JA 2HVNA 3S5OA 1KBJA 2D2OA 2W79A 3SADA 1O1HA 1LT8A 5I06A 3VM5A 5EY5A 5KTLA 5BNKA 3REQA 5REQB 4IIBA 1NOWA 4ACYA 8XIAA 3UWYA 1G9HA 1XLIA 3PPGA 5K9CA 4YN5A 3F2BA 4S38A 4TVCA 1R2RA 2HWGA 1M53A 3ARQA 1T6MA 2BASA 1EC7A 3KHJA 4J3XA 3V35A 3TYZA 4CEUC 5C9WA 1PX4A 1VYPX 3CL6A 4UTFA 4GG9A 1EXBA 5T9BG 1V3MA 2ACRA 4IMAA 4WLCA 1PHQA 4HU3A 5CZTA 2V3EA 3QPYA 3VAVA 3RHGA 5E09A 3QJAA 4N4QA 4H9XA 5HXMA 2VZOA 2ISFA 1PWLA 4HA3A 3E6EA 4WVXA 2OO0A 3VCRA 4CKQA 2WMGA 1O12A 1HJQA 4GYPC 1DJWA 1WDSA 1NF7A 1KTBA 3ZJKA 2DUZA 4DJDA 1QCWA 4Q8QA 3TSDA 1C8VA 1VCVA 2Y8KA 4LYPA 4WQ6A 5IDZA 1J0JA 1JYNA 5CAHA 2VD9A 4LEFA 1M7PA 3NO3A 3RGTA 4LGXA 3WO8A 1PIFA 2JGQA 3BK0A 2AKMA 3CHEA 1OFAA 2VQUA 5EB8A 3WQWA 1U1HA 3L0GA 1U5JA 1XLLA 2P5NA 2DORA 3M5ZA 1PTDA 3SN0A 3GFYA 2GOKA 4ICNA 4JQ2A 3SAZA 4FX7A 4L4MA 3P62A 3C3NA 3KE0A 5DY2A 2PDHA 3CUIA 2G3NA 1SYTA 2BG5A 3PTQA 3PZ9A 3HG5A 3L2LA 1A5OC 5I3IA 4Z2GA 3HG2A 3LB0A 4NNCA 5HJXA 4C6KA 2O56A 4IL0A 1GVFA 1O7AA 2VZVA 1NARA 1NFBA 4MJ4A 2NLYA 2OYKA 1IEIA 3SUTA 1OD0A 5TBOA 2WJFA 2A5HA 3EWWA 4H6EA 1JXJA 4E6MA 1GEQA 4PMJA 3GDBA 4RDZA 5F1VA 6CGTA 4L9ZA 3BSHA 1WO2A 2WC3A 2EPLX 4WOZA 1M6JA 2ZDRA 1K70A 4GI8A 3SR7A 5HUOA 3M5XA 2NWRA 3MKKA 4ZO6A 1OFBA 3GH4A 3QLDA 3M0IA 1E3XA 4M5PA 4JEQA 4OVXA 4E38A 3DIPA 3BICA 3CO8A 2R14A 2F2HA 2P1FA 9RUBA 3BV7A 4A3QA 3VKJA 2QCMA 3AHYA 4JTKA 3NZPA 2XWEA 1W56A 3VNZA 3OGVA 4NSBA 3S6DA 5KZMA 2DPEA 3QGAC 1SJBA 1SFJA 3A64A 3EYPA 3R12A 5JQ9A 4H6KA 1YX1A 1ZP3A 4AY8A 3A4WA 4V27A 1VJSA 3DECA 5LGZA 2BP1A 2VRQA 3VC5A 5I6SA 4OUIA 1DQWA 4RPPA 3VD9A 1JPIA 1A5AA 4PUNA 3U5UA 3GVQA 4C6NA 1F3EA 1OG6A 1QVBA 3STGA 3VOFA 3I68A 1UIOA 5G2WA 2JGYA 1QO2A 4B2DD 1DORA 5A6KA 3CYVA 1VCGA 4HNTA 1J2WA 2Y7EA 2CKRA 1CGXA 1NP0A 3W1RA 1FWHC 3PG9A 5H8PA 4MY9A 5M2FX 2GJRA 4LVFA 4Y96A 3NO1A 4DN1A 4X9YA 2Z27A 3KVMA 1KCKA 4XZBA 1ZL1A 4JNZA 1XSJA 3PZOA 1TVPA 1HZYA 4IL2A 3VE7A 4XBKA 3P5YA 2BY3A 1VFUA 1JCLA 2AKZA 3W75A 5FF2A 3GR4A 5AC7A 3FGCB 5M17A 3R0DA 1OF8A 2E1WA 5LIKX 2OQLA 3G1SA 3G1HA 5K4XA 4WCJA 3AYRA 1HJXA 4JTJA 4HHHA 5CEWA 1CZ1A 4QCEA 4I90A 3PJUA 3WEZA 2OYMA 3WBXA 3O9NA 3IJLA 1GZJA 1GKPA 1PS9A 1H63A 1TELA 2YBVA 3KRSA 4JFTA 4GGBA 1NDWA 2IPFA 3MUZ1 1LBLA 1F8MA 1SGJA 5I24A 2ZWYA 2ZRYA 1OX6A 3A5FA 1Q63A 3QQ0A 4WKFA 4LVAA 1VFMA 2OCZA 4XZLX 2O0TA 1YW1A 4PMQA 4CN1A 3EOSA 2NVDA 4BZYA 2WZEA 4MHBA 1BSLA 1QPKA 3AROA 4IF2A 3HFYA 4WOQA 3H54A 1V3LA 4LUYA 3GW0A 2FVMA 4C7FA 1Z89A 3W3OA 3EZ4A 1MYRA 2WW5A 5E9AA 5DCEA 1U2YA 3HFTA 3SCVA 4S1FA 1E9IA 2D24A 1NQ6A 3MDWA 5TQLA 2QCGA 1X6LA 3DC0A 2UY2A 2D1ZA 2Y4SA 2F38A 2XDFA 5A6TC 3GVVA 1W0MA 4W8BA 1UZ4A 5HANA 1KKOA 2DZUA 1EP2A 4XSLA 3W01A 1FWNA 4MB3A 4KETA 4GBDA 2VFHA 2DV0A 3RX2A 2J8GA 4UC5A 3F1QA 3DKJA 2Z28A 2GWNA 3GSMA 2FPYA 2PTDA 2KZHA 4AAJA 3LCFA 3VZYA 5A2AA 1IGSA 1XI3A 2O7SA 3FYYA 3H7UA 4R27A 4E2BA 2JFEX 4WY0B 1JZ5A 4L1XA 5HWMA 2WSYA 2XZ7A 1R30A 4U3AA 3KHDA 4AHQA 3AIQA 4H7CA 1XLGA 4C7GA 1XYMA 3PY2A 3BOFA 3LV5A 2QDEA 3C0JA 4ES4A 3B05A 4UTKA 2HMCA 1UKQA 3UYIA 2OX1A 2BHUA 4FAMA 1EIBA 2D22A 2Y5JA 3PZGA 4DJEC 4IGSA 4XBSA 1PAMA 3TTYA 4W85A 1V6YA 4K37A 1BSIA 4FS9A 1SR9A 1XXXA 4GNJA 2X42A 1DJZA 3FCPA 3DFOA 5A1AA 1EEXA 3VILA 1KXHA 3C0LA 4EE9A 1GQKA 4US5D 2ZKMX 3URBA 4GPNA 4YU1A 1X8FA 4AFYA 4UR8A 2GJNA 2QT3A 2VWSA 1B5TA 1S2VA 3GYCA 1LJYA 1G94A 1AVAA 4QQUA 5HUPA 3CV2A 5D8WA 1SJCA 4L6OA 2V5DA 3L68A 3DFYA 4BHYA 1R86A 2D0GA 3ID7A 3VZZA 1SMDA 1UD4A 4P2VA 4XBJA 3L5AA 2Z1KA 2DEPA 4XQ6A 3ANUA 4PYSA 3GXDA 3B8DA 5RUBA 3BG3A 2NX9A 4RE0A 5AFDA 2FTWA 4K7YA 4MVAA 2ZX9A 2I9EA 3H7VA 1SR0A 1DL3A 1VEPA 2J6XA 2OZTA 3V0SA 2BLEA 1K7FA 3CBWA 4GNVA 2B7OA 2OJPA 3W7EA 4BEUA 3DHFA 3ANYA 1OD8A 2X30A 3MHGA 1XBXA 3CUZA 3IVTA 4TQTA 2VC5A 1NF0A 3FKRA 3LI0A 4G8TA 1HL8A 2QYGA 1WOBA 4PUKA 5C2CA 3E49A 1IR2A 3GXNA 3NNTA 3W6YA 2CZ5A 1IZCA 1RAKA 2YYUA 1C3FA 1EXPA 3KOFA 1H5VA 2XN0A 4H8UA 1DWFM 3U8GA 1ZALA 1UA3A 1SZRA 1GKQA 1KR1A 1VLWA 4H6QA 3GZAA 4QDMA 4HTYA 5K2ZA 1MQQA 1YBQB 3UJRA 1TMLA 3S2LA 3CUHA 4FXSA 1TPEA 4QG8A 5BWAA 4J1OA 2XHYA 4PEEA 3T78A 4B3ZA 1CGUA 4CU6A 1RLCL 1R85A 4O4VA 3ZYZA 1JUEA 3NOYA 2HSAA 2Q3RA 2QIWA 5FIPA 3OOQA 1RQHA 3APTA 2KX9A 2UV8G 2FLIA 1EP3A 3UCDA 1XFCA 3V0UA 3E2QA 3UXIA 3GIYA 4AZCA 4NNBA 4WGXA 5DT7A 3QW3A 4M6VA 4A8NA 4WY0F 3AIVA 3W1XA 1AJZA 4DB7A 3WF4A 4JTHA 1AQMA 1AW1A 5EMYA 2WSKA 3DC8A 3DENA 4AHPA 3QMSA 1TE1A 1HO1A 2TPSA 4EWJA 6ENLA 3XINA 2EGZA 1L2QA 3ITXA 4IFKB 4KPLA 4WRHA 1E4NA 1UH3A 5FJOA 4M24A 4MLJA 3PSVA 2FZDA 5CGQA 5GJMA 4NNAA 5FF3A 2WMIB 1FWSA 2GVEA 4X3ZA 2Z24A 3WUEA 3CHFA 3M0LA 3EDKA 1VS1A 1LP6A 3MSRA 3W22A 2W5FA 3OBAA 2FZBA 4MKNA 5REQA 1XWYA 3FX4A 1Q6GA 4AHOA 1HNYA 1QNPA 5BYWA 2HJPA 3QV6A 4YS1A 2PTWA 1H7XA 2FPVA 3GNPA 4QQ3A 3LHUA 4ZR8A 3EKZA 3B04A 4PTWA 3PZIA 6A3HA 2QCEA 2NQLA 3U9IA 1A3HA 1F61A 5SWUA 3GDKA 4Q8MA 1BRLA 3QY6A 4MGGA 2EO7A 1W91A 3T2PA 3B9DA 3MHFA 4NILA 4KESA 5I3GA 4AZ5A 4PZVA 1NEYA 1A5SA 3EOEA 5FSDC 1EB3A 1DVJA 5FJJA 2GL5A 1OJXA 3DHPA 4X0NA 3CC1A 4GY7A 2X0HA 2XGBA 5CZKA 4Z2JA 3GVWA 2A3AA 2E67A 4MYAA 3OGSA 4TMCA 1AMKA 4HMDA 5BXSA 2IW0A 4N2YA 1UB3A 4AISA 3IACA 3NQEA 1V77A 2CWNA 3PBWA 3WY1A 4ZQCA 2PEVA 1E4IA 4B9YA 3E74A 3H2AA 4I5XA 3TYCA 1LL6A 1W3NA 4BFAA 4P8XA 1V02E 3KLLA 3POHA 2UY4A 3NG3A 5CGMA 2HE8A 1W1IE 3F4DA 3ZLFA 2PLJA 1JGMA 4QM1A 4C6LA 2B7PA 2ZC8A 3AO0A 4HNNA 1XRFA 2DY3A 3K13A 4MB1A 1ZBCA 4MYXA 4ASTA 4AY1A 3L4ZA 1UWUA 3FJNA 5BU6A 1KRAC 4GVHA 1RV8A 3KL5A 3BLFA 1H09A 2A6NA 3GG1A 1DPMA 1FHDA 3O07A 2D69A 1HP5A 4UMCA 4A3UA 2EF9A 4GIRA 1XKJA 4J2MA 4HHMA 3VKDA 3OGRA 1B90A 4GUGA 3S9YA 1QU4A 2V69A 4CLMA 1EJVC 3BVJA 3U6WA 1B3YA 3UG8A 1QHOA 2O4QA 1Z69A 5J5DA 3S83A 3GFZA 4N9CA 4U5KA 4K68A 3TC3A 3S8HA 4C91A 4DZAA 3W53A 1TUXA 4QS6A 1JEZA 1XIBA 3RITA 4QE1A 3G8EA 1GZ1A 3GHTA 2VP8A 5M1TA 2DQXA 4MIMA 4J3TA 4L4PA 3LNPA 5DELA 3S5SA 4GVGA 3N13A 2Y62A 1CIUA 3V16A 3BQ6A 4PB3A 3FEQA 3P8JA 3W23A 4LWWA 4ZMGA 4XG1A 3GTNA 4QJ3B 3UJEA 1E0UA 2H3DA 3MCNA 2YLAA 4HSNA 2PTYA 1EP1A 3WLNA 4UTTC 4Q4MA 3KBNA 4R7WA 2EG8A 1MO0A 3CZ8A 3N11A 3CIVA 1JFXA 1TWSA 1V79A 4F3HA 3KAOA 1E51A 4Q7BA 3USZA 3W07A 4HPXA 2J62A 3W85A 3N04A 3QV9A 3DFTA 3UBPC 3I4EA 5CBBA 1HL2A 3I3BA 3NXLA 5HWNA 3FJ4A 4S3CA 4A35A 4IISA 4WDXA 3RXZA 2CU0A 3D47A 1F2JA 4JY9A 1VYSX 5AY7A 3KL3A 2FH8A 3M16A 4GO9A 2NT1A 1GPFA 2W0UA 3GDLA 4L4OA 1Z42A 2ZZ3A 4GXWA 1JF5A 3W71A 3TYBA 4W7UA 1VBUA 1C7TA 5HQMA 1FQ0A 2GJPA 2P8BA 4PTMA 1ICPA 2R94A 3FGCA 2PU1A 1GTEA 1JYXA 4IMCA 2DSWA 5KSWA 1Q3NA 3N2BA 1XC6A 3RJYA 1S3HA 1TZZA 1UD3A 3HM7A 1E72M 1BAGA 4H9ZA 1IEVA 1JZ2A 7PTDA 5JXQA 1DEDA 1NQKA 4Y8FA 2V5LA 2DT1A 1TIMA 1S2TA 2JKAA 1UA7A 4B5XA 1W9XA 1D8CA 2VR5A 3NPWA 5LA1A 1W1PA 4ZXLA 1I9CB 4CQDA 2W3ZA 5EMUA 3I7RA 2C71A 2VOMA 4JN6A 2PI6A 3WDPP 1PJ9A 2PWHA 1KRCC 2QKFA 4K39A 3OPSA 4L9XA 5C6MA 1E15A 3CUJA 3U2OA 1H7WA 3PR2A 2ZX7A 1M9HA 3P60A 1XRTA 2XIBA 4KFPA 2WK2A 4MDOA 3W7PA 3W26A 3L67A 2MNRA 5DMYA 3GU9A 1ONEA 4BS0A 2TMDA 3IARA 3VCCA 4MAVA 3S0CA 1ESWA 2AMXA 4LB3A 2PCQA 1LQAA 3S1VA 5E5CA 3MKCA 3TSBA 3UG3A 4BQ4A 2WWCA 1WDRA 1PTGA 4YHEA 3SCQA 3PZVA 3A9BA 3DYPA 3IRSA 1Q6OA 3ZLHA 6REQB 2J13A 3ITGA 1NWUA 3CB3A 1X8CA 4I5RA 2DUAA 1E43A 1Z44A 4IP5A 1OCBA 4C6BA 1YXCA 4QIUA 1E1CB 3IAPA 2R1LA 5I0DA 4JAWA 4HHPA 1AW2A 3ZT6A 5M5DA 3BDKA 2CBJA 1J96A 4WY0A 1FCVA 3KVKA 3W1NA 4A8LA 5F4XA 3P5ZA 5AC5A 4O15A 5K4ZA 3FXGA 1ZRQA 1A5BA 3QOKA 3T55A 1VENA 4ZA0A 1K03A 5ABTA 3IJDA 1ZPTA 3S1GA 1DIOA 2OEMA 2PDQA 1QASA 1KWGA 1E6XM 1EEPA 3G6MA 3QV7A 2OEJA 1K4GA 3TJIA 3W7NA 1XBVA 3FAWA 1O1ZA 2PAJA 4BA0A 1I2RA 3TA9A 4EK7A 4NZ1A 2C19A 3SRDA 3E9AA 4UNLA 2C1IA 3OVQA 3QZ6A 3TQPA 3RLUA 3AHXA 3MMTA 4QXIA 1KTCA 3ZR4A 3BL3A 1OCJA 1HUVA 2Q8XA 3MYPA 3TN3A 2OSYA 3AYVA 2G4JA 3TNBA 4PSRA 2ZBTA 4NXKA 2Q09A 1BGGA 1UD2A 3AU6A 2D3LA 2YGYA 3OJGA 3S3GA 1O4UA 1QPNA 2AMGA 5C0QA 2XU2A 1ME8A 1YRRA 3QR0A 3LS9A 2GUUA 3GC2A 1GT8A 4DXXA 2W63A 3M44A 4OWGA 4H04A 4LPCA 1R0MA 3WX7A 2FGBA 2WMHA 4DBDA 1L2UA 4GIEA 3CEPA 3MWAA 4J5NA 4C6EA 2CLEA 4UFLA 3G1YA 3BCJA 2E7FA 2GVYA 3GM8A 3URNA 5A6BD 5LIXX 1CBGA 8A3HA 1FRBA 3UJFA 2XTKA 3LCHA 4QX4A 1Q85A 1H11A 5JVLA 1Z9AA 1LUCB 2A1YA 4W5UA 3WK2A 2WHLA 3V5OA 3VDGA 2XWDA 1JVNA 4IP4A 3R0UA 1YBQA 1PZ3A 3N2MA 1DHPA 1HQTA 1E5NA 2RJGA 3E12A 3P3BA 4LF2A 4ZQMA 4FZIA 4EX4A 3GXMA 3JU2A 1AQHA 2XIIA 5AN7A 1H7NA 1W8GA 4CEXC 2QDGA 1U83A 3LZ5A 5JBDA 1EYEA 5BW6A 3ARVA 1EA0A 2H9AA 1DXIA 1ONWA 4XKYB 3VCNA 5BRBA 1WP6A 2NT0A 3CAWA 4WSKA 3OA3A 3PTKA 1ZAHA 9XIAA 4ZXOA 3CTTA 2QCFA 2H8XA 4UZSA 3IJ8A 3VE9A 4TTUA 4HN8A 1RXOB 2QPSA 4XK2A 3UWZA 5KETA 2PDIA 3RO6A 4R7OA 1R9ZA 1V6TA 3B06A 1VFFA 1JPDX 4AX7A 1JF6A 3MYOA 1F6YA 4CVUA 2DSVA 4CNUA 3O3RA 2V67A 4IFKA 1VBRA 3M43A 4PFHA 2ZRWA 4MDPA 4MFDA 2WMIA 1E9YB 2YPIA 4F48A 1LRQA 1MXSA 3AAMA 2Q8ZA 3PBUA 2Y0FA 1W2PA 2QMKA 1ICQA 5JIWA 4P7NA 1JL8A 3L5MA 4GZEA 4HOXA 3C2VA 1TV2A 3PFMA 3PUOA 1VBGA 2JIEA 1FA2A 1U5HA 3ZT7A 1V03A 1VRDA 1XH0A 3KVJA 4QSFA 4AEOA 3O7UA 1Q2SA 1TPVA 3IEBA 5FEXA 3OHMB 4F2TA 4IICA 2ZRUA 3N12A 3LCWA 1XYBA 3LM7A 3DUGA 1IEXA 3PN8A 1KD0A 1HX0A 3L0KA 3KBMA 3RIKA 8CGTA 1Q7ZA 3S46A 3HU7A 3C86A 1BLIA 1XH1A 3NQ2A 1A5LC 4O1BA 5GJPA 3EXTA 4R85A 4DXKA 4AZIA 1MSSA 4IGNA 4JFWA 4G6CA 3B0VC 3L2MA 1XPGA 1X38A 4NKCA 4D6FA 4KEVA 5AHNA 4HA0A 3EWXA 3F4NA 4ZTYA 3TZNA 3KBSA 1FTXA 1EYWA 1R3TA 4JYEA 3ZS4A 3IK4A 2AL1A 2G37A 3WSUA 3HJZA 1RBOB 1GOIA 2BVTA 1YPIA 2PDUA 1W9VA 2NQJA 3NQBA 4NG3A 3UWQA 3LGEA 3G1RA 1CLVA 2P76A 3TXZA 3HTWA 2DSZA 1EOMA 3N15A 4IJBA 3R8GA 2I57A 4PE8A 2P10A 3TTSA 4OE7A 3URAA 3AQUA 2PF8A 5MKGA 2A4AA 1A49A 1GYNA 1V0NA 3BMWA 4LBRA 1G4SA 3QQWA 2XFRA 2ON3A 4OOZA 5I09A 1D3HA 4Q6JA 1NJJA 3CIWA 2XVPA 3P0WA 2J47A 4DWDA 1PB0A 5HMSA 2XM2A 3M6DA 3SUWA 4WEVX 1UP2A 3TOPA 1G7VA 3RX3A 2V2HA 3PK7A 3GW3A 4H2HA 3R6IA 3W84A 3TC6A 5HJYA 2VFDA 1MW1A 3A6OA 4UOZA 3OP2A 1R3YA 4U2ZA 3CHDA 3NL5A 3DU0A 1TRDA 1MFVA 1ITQA 1CX9A 4WXYA 1S38A 4NJHA 1NDZA 1LDCA 4YLWA 4H9MA 1ZJHA 3CL7A 2P0IA 4HU4A 4HA1A 1ITUA 3CUGA 1M7JA 3PZTA 4MZ8A 4MZYA 3ELFA 4ZB5A 3V1HA 1EGVA 3AMGA 1LCOA 4UFIA 1MUCA 1NDYA 3ABRA 4LY8A 4IPIA 2TRSA 5DLCA 1QNOA 1P4CA 1V4YA 3GNDA 4NYUA 4GK8A 3UY8A 4Q4QA 2R9RA 3SB0A 2X1SA 1FWCC 3STEA 4NZ3A 1WKYA 2YBUA 2WKLA 3BZJA 3EDDA 1QDSA 3CPUA 4PB5A 4DF1A 4F0RA 3NGJA 3T6CA 2P3ZA 2OOFA 3C2YA 2DT3A 4Z1YA 1NH6A 1SO3A 4X2RA 2DZVA 2PP0A 2VOTA 5CXPA 2QV5A 1YEYA 4YTUA 5IDIA 2G50A 2D2JA 2W92A 5HPOA 3E5BA 1JNEA 4ROPA 4OZOA 1K1DA 4PA8A 3U4FA 4LAOA 1Z8AA 4CCDA 3HV9A 2WOQA 3XISA 1KBKA 1W3IA 1CW2A 2I5GA 1TWZA 3VABA 3EWUA 5FESA 1GG0A 4RDWA 5GVJA 1DOSA 1YLVA 3VMOA 2GDQA 2E8YA 1E3ZA 5HR6A 1KO0A 1RHCA 3R89A 4FB7A 4LNCA 3LUTA 4Z2IA 4NL1A 1KB3A 4D6JA 3TP4A 1JR1A 4DYJA 1LM1A 5LGXA 1JUBA 3BH4A 3H23A 1PYMA 1F3XA 3O06A 3TROA 5B7YA 3ALGA 4ZSUA 3A47A 1CPUA 3TCSA 4RW5A 4C6JA 1WBJA 3LOTA 3AIUA 1H41A 1ZBKA 1VC4A 3TZFA 4O1EA 5M3WA 1C91A 3FXYA 3HGOA 1Q45A 2OWXA 4NIRA 2Y89A 3EPNA 1Z3NA 2J9XA 4ZVJA 1NTHA 3PUGA 4K38A 3KCLA 2WPGA 4I5UA 3KRBA 1V6UA 3N6JA 3O63A 3OLIA 5D09A 1YPFA 3SUSA 1GCYA 3BLKA 2PGEA 4XIAA 1XQKA 1XM3A 4EOUA 3FLUA 4GXMA 3KOWA 3IJIA 4P8VA 1NFPA 1XLEA 2VM8A 4XSMA 2QQ6A 5TF0A 3F4VA 3ARZA 3GUWA 1VBJA 1R8LA 4FNQA 1R2SA 4H00A 3MANA 4ZL1A 6REQA 1LRNA 1RP8A 3FOKA 1LL4A 4HSOA 2VHLA 2VL4A 3MP3A 4DI9A 2WZMA 1XH2A 3CMJA 9XIMA 5AECA 1E1CA 1GVYA 5G2HA 2WNZA 4DO4A 1SZNA 2C13A 4NVTA 2BVYA 3RO8A 2HVMA 3WMLA 5BROA 3JS3A 2ONEA 3FDGA 3T1GA 1NELA 4AYGA 1KR0A 3NURA 1BFNA 3IANA 3QSRA 1F4HA 3CMGA 3CZLA 3UWVA 2I5QA 5IHSA 2W67A 4M1RA 5AHIA 1I2NA 2HS6A 1KV8A 3TV8A 3VA8A 3MBDA 4HZMA 4IMFA 2ALRA 4GOAA 4KEUA 5D8ZA 4KWSA 4B4HA 4R5EA 5HQLA 4MG4A 2Y1HA 4YVXA 3T8LA 3TN6A 2X40A 1JFHA 1FXQA 1RBAA 3S2JA 2DIEA 1JZ3A 2GVGA 5FEZA 1XYCA 1UYQA 3U7BA 2W6RA 1G6CA 1GYMA 4HNVA 3LRKA 2YDRA 2A0NA 3K46A 3QOMA 4XTDA 5DN1A 1EO7A 3SUVA 3N6QA 4M19A 1VYRA 2GVLA 3B8VA 2G8ZA 4Q6XA 1Y5VA 1EBHA 3WK3A 3BCDA 2BB0A 2IPGA 1OYBA 3GNOA 1B9BA 1C90A 4TTGA 4FR1A 3CH0A 4FHAA 2Y88A 1DXFA 3LSCA 3S47A 2ZX8A 2CHRA 4A2RA 1E6RA 2QLYA 3KBWA 3QHNA 1T5AA 4F66A 4RUBA 1A5KC 4H9YA 1JQVA 2GYIA 4F2UA 1LOLA 3NM3A 2HISA 4NUWA 1VKFA 4F79A 2ZE0A 4D6CA 1MMFA 1KM6A 4E5TA 4RV8A 3G8RA 1FCQA 1R3QA 3MI3A 3CLWA 2CYGA 2WAGA 4DJED 3POCA 4FIQA 5EKYA 5G5IA 4LY4A 3IGUA 3NXFA 1XX1A 4CVWA 4LUJA 4R7JA 4AX6A 4QG6A 3CWHA 1M03A 5D2WA 3WDJA 1UROA 2Z1WA 1LUCA 2GWGA 1JDCA 1R9YA 2OLHA 3AWNA 4ROQA 2PF0A 4LFYA 1PXGA 2YL5A 4HPGA 2YCJA 1Q8JA 4HZ7A 3AZRA 3V5FA 4REQB 1UR0A 2G4FA 4AZ6A 3ZJ7A 2Y5SA 2PC8A 5G4HC 2QJHA 3GBDA 5CQ1A 3RM8A 2W61A 3MV01 3ZR6A 4JTTA 3MU7A 2A3LA 2H8ZA 3NQDA 4BY3A 4K8GA 3GXTA 4PC8A 1NOUA 5FL1A 3QXBA 3QGVA 3P2VA 4JIRA 4TX9A 1RA5A 2IXVA 3E1F1 4CD8A 3T8QA 3W6MA 1DIKA 1U1JA 1J4EA 3D6NA 4O14A 3DYMA 3MZNA 4XKYA 3SCUA 3F4CA 4DY1A 4CGTA 2V9DA 3OEXA 2VFGA 4AB4A 2PDBA 6PTDA 5U7SA 3SJ3A 4GHRA 3FVMA 2BY0A 2QUVA 1GORA 1L9WA 1UCWA 1XFBA 4A8IA 4PMUA 4QAIA 1FWEC 3G77A 4I9TA 1V8EA 4GYJA 4OJYA 1A53A 4H8HA 1XLFA 1AH3A 3BPWA 3T2QA 3UPBA 5FA5A 2IQTA 1VD6A 5CPOA 2VC6A 1XLJA 1LG1A 3IIOA 5ABGA 4B2DA 3THCA 3WLHA 3LHYA 4KFNA 3C5QA 1EL3A 1LL7A 1SW7A 1EJSC 3FS2A 2ZXQA 4J7RA 5C70A 4QDWA 4BI5A 3E2RA 2CHOA 2A3BA 5HINA 3M0KA 3ORWA 3U57A 1QUMA 3GKFA 2V8ZA 1W5PA 5F4WA 3W0KA 2QDDA 1UWRA 4N6EA 3S4TA 1TPUA 2WSRA 3VKKA 5F7UA 1NFGA 1UKPA 4KCUA 4LYRA 3QFWA 2J24A 1V7AA 4URIA 5AYBA 3W24A 3VDAA 5F2MA 2A7NA 5T26A 1QT1A 3LY0A 2Q3OA 4FPSA 4GY1A 3QYSA 4BQ2A 2PDGA 1PEZA 1P0DA 5I3FA 5F2GA 1C9WA 4L1WA 2NXGA 1UC5A 2YB4A 5AZ1A 5HOSA 4AIOA 4GI9A 1PO9A 2J25A 4EPKA 4EACA 5F2IA 4PL1A 4R3UA 2YCEA 4UFJA 4K8EA 1R5YA 1JDFA 2Y85A 2Z1SA 1XC4A 2J88A 4PRTA 4PUEA 1XW8A 5MF5A 1AODA 4AD3A 3VKCA 1OZMA 1R87A 1S46A 3W7LA 1R46A 3SGZA 2X2GA 4O54A 1R3RA 4JNMA 3PVFA 1VB9A 4M82A 1JQXA 1V0MA 1QNQA 4KKXA 1XYAA 3PF3A 4E2OA 4L5ZA 4RNJA 2GOUA 4XZMX 4PMZA 3MPGA 5JH2A 2GFTA 3E2SA 4WUIA 3LCIA 1OWQA 4RR4A 1OGBA 4AH7A 2PMQA 5GNYA 3MT1A 2YIHA 1FKXA 4IT1A 3WF0A 4CU8A 5A2CA 4GQBA 4M6UA 4AWSA 3RCYA 4KGJA 1VIZA 5AOUA 3AZTA 3FHAA 3N6HA 3ZVIA 3ZO9A 1CENA 1S5NA 1XP3A 1CGVA 4CCEA 1FWWA 4YTTA 1VFOA 5E6YA 2YLLA 3W27A 2ZZ2A 3EX1A 1MFUA 1WZKA 4PN2A 3MMDA 2QS8A 2Z6IA 2V63A 3BXWA 4ZO8A 1O68A 1JNDA 2VGFA 1BHGA 3QZEA 4YHGA 5TIMA 3SCTA 4HSHA 1GUVA 3DFQA 1TPFA 4LBUA 2OKTA 1W6TA 3SCOA 3WCZA 3CL8A 4BQ3A 1TREA 2Z26A 1B3ZA 2FVLA 4O17A 3HG3A 3RR4A 1ISXA 3L4XA 2RDXA 3MHUA 4QNWA 4GZIA 5GNZA 3DG7A 1Q6CA 1QOQA 5LXEA 1HKKA 1AW5A 1GHRA 3ITTA 3VO0A 1I75A 1UASA 2CZEA 1HKIA 3MCOA 1GOWA 3I6RA 4POCA 3WEMA 2E09A 3SN4A 1Z7AA 3ALFA 3M9YA 4FMVA 4HYRA 2A3HA 5AC6A 9CGTA 3NYZA 4GLEA 2OWCA 4AC1X 1OABA 3WLSA 1A4LA 3H22A 2FMNA 3LPOA 4DBEA 3SQSA 4DWSC 2YCKX 3VD7A 5G1YA 1SO5A 4MY8A 1TPC1 4B3KA 4DELA 3WQVA 4PTXA 3RJXA 1YNYA 1PX8A 2F8QA 4MSSA 1OT2A 3QLLA 4A3HA 3KDOA 4MNKA 3EAUA 2G3JA 1NU5A 1I0DA 2CBVA 4YVVA 7CGTA 1VFTA 4H01A 3RRXA 1GOXA 1BYBA 4FNTA 4RXGA 3WLJA 1F8IA 2Y5EA 1KXTA 8TIMA 2XISA 5D9PA 3I3EA 4O19A 1T96A 2OVLA 1WZAA 1K9EA 3CZGA 2QGYA 1KM0A 5K9DA 2ZUTA 3FNDA 4FF5A 3ES7A 4XUGA 3V1PA 4D8LA 3TX9A 1B57A 5GQBA 3IV8A 2HVOA 1S1PA 1VEMA 2XH4A 2XINA 1KV5A 2ADAA 4E4FA 2V2DA 1SZFA 3XIMA 3HG4A 3KL0A 1EDGA 3TH6A 1EHAA 1PKMA 2GJLA 1ADOA 3FIGA 1MNSA 4LCSA 4U4MA 2GDVA 5DRIA 4M6QA 2YJQA 1B3XA 3S1XA 3SBFA 1ZB5A 3RRAA 3CU2A 1O66A 5C7VA 2VJXA 2OXNA 1B4EA 3UYCA 3G1XA 4AEEA 2ZZ7A 4DO5A 4JNYA 3H8AA 1EGZA 4QBXA 3N18A 3LPFA 1KFEA 1JAEA 4LEQA 3PZQA 3RCNA 2B31A 4J3UA 2BY1A 1A47A 3GDTA 1K77A 3NA8A 4GIYA 4WD0A 3ABQA 4RK8A 2PS2A 1H7OA 2H90A 3KS5A 1RJRA 3RLGA 3JUGA 3IGHX 1FY6A 1KFWA 2VYOA 2CWXA 4XVDA 3VI2A 3E02A 4ILSA 4L6HA 3ES8A 4FLSA 4MMWA 3LYEA 3VDCA 4S2CA 4I8DA 3WZ0E 2ATSA 3UWEA 1XL9A 1VAHA 4JKMA 1V6VA 1UMYA 4UQ9A 1KM1A 1P43A 4NU7A 1T8XA 3WENA 1SW0A 1WKFA 1C29A 4FOUA 2AGKA 3ZSTA 3UVIA 4QE5A 3O6AA 1TTIA 5EBUA 3GAYA 4WXZA 1HKMA 1CXIA 1W1YA 3WNOA 4Q22A 3VIJA 4OFCA 3WQ5A 3GZ3A 2BMBA 3I4KA 4IJCA 4RNHA 3H24A 1Y8BA 3UG5A 5D2VA 2TODA 4O28A 5B80A 1QFEA 1KCLA 2Y2WA 4DBUA 2HRWA 2NXHA 3A23A 4YYCA 1IZJA 1R47A 3GC5A 4WF7A 1O94A 3ARTA 3UCQA 4JXCA 1X7IA 4HZ6A 1RCQA 1LBFA 4ZQNA 1F05A 3DHDA 4GKLA 5EFDA 3EKGA 4NI8A 3HIJA 3L23A 1CXHA 1WAUA 2CLHA 5C9XA 4ML4A 1K8CA 3AUOA 1K8ZA 1LWJA 3NL6A 1C7SA 4NJIA 2ZZ4A 3W2MA 3FY1A 2HBXA 4CQ9A 1ODUA 3VVGA 3CQJA 3N25A 2Z2BA 2XVNA 1YE4A 1V6WA 1SZGA 4BI7A 1RPKA 1LZOA 2CZFA 1S3TC 3H2CA 2C0HA 4L9YA 1L6YA 1P6CA 4H83A 1EUAA 3BARA 3U2ZA 1E1FA 3CZJA 4XD3A 3AALA 3ARPA 4PR4A 2YXOA 2Z6JA 3DHUA 2V68A 1HL9A 4PULA 3E2VA 4H8VA 2Y70A 3ZSSA 4JFVA 1GOKA 1ZUAX 2J7BA 1XYLA 5AHFA 2DJXA 2XG9A 3VZXA 1TR9A 2VO5A 1S2CA 3EMZA 4KIEA 4XX6A 3EWZA 1DYSA 1FUYA 3QR3A 4TOQA 3RLVA 3IGXA 2DZPA 1ZP4A 2PD9A 1CXKA 2BGSA 4AXKA 3BSMA 4PTVA 4RZBA 2D2GA 4HK5A 4IUOA 3LGDA 2PODA 3FYOA 2EQDA 4CQ8A 3G22A 5LIYX 4KWVA 4C1NB 5E70A 3L2IA 2QAFA 4F9JA 4H6RA 1KM3A 3GRIA 5CAKA 3AIEA 3DCPA 1FFQA 1PKNA 1G67A 2ISWA 5A94A 2F61A 2E9LA 2L5HA 4DEFA 2DVXA 1FHVA 1KKRA 1FWBC 3E3HA 1W3HA 4N9BA 2ZZ6A 2ZXAA 3GE7A 1JCJA 4QE4A 3P8IA 3TCEA 4IZGA 2E68A 3M5VA 5CSUA 4MJ2A 2HK0A 2P88A 4JX6A 3BV4A 5G2IA 1WDQA 3BZGA 2E8ZA 2OU4A 3H70A 2PDKA 1DQXA 4I9MA 3THAA 1ML1A 2QPXA 4ZO9A 3A12A 3AUJA 3G5EA 2CZVA 3IUIA 3SIMA 3KWXA 2IKHA 3AS2A 1VF8A 2DZBA 2GSJA 2NVAA 3AS3A 3STCA 2E6YA 2WNQA 5CZ0A 1T40A 1XIHA 3F5KA 1QBAA 1RBLA 3UEQA 2X16A 1PCKA 1TX0A 1KNWA 1DQUA 3CPRA 1ZU8A 1RK6A 3DFSA 3F7JA 4B5TA 1XS2A 3G6LA 1GVSA 1EWEA 1A50A 1MNZA 4REQA 2RH9A 4XKMA 2C91A 1PKYA 3AU2A 5JH1A 3RYSA 1WKDA 3COTA 4JHOA 3L5LA 5CLTA 4B5NA 3E0FA 3WNLA 1E40A 1YNPA 4YJ5A 2BY2A 4D2JA 2QV4A 2WBGA 1ME7A 2PP3A 3C2FA 3B0XA 3DI0A 3WLTA 4AWUA 1JPMA 2O92A 3U5YA 3QV8A 1V0LA 4NF7A 4W93A 2ACSA 1QNSA 1DXEA 1ZTVA 3EKLA 1MWOA 3PWIA 3G1FA 3GIQA 2PB1A 4TVDA 1CTNA 3WEOA 2PC4A 2BWGA 1OEPA 4AZGA 4IGMA 1LQ0A 2YZRA 2ZUSA 5EMKA 5LIWX 1DIEA 2RJHA 1FWIC 2B7QA 5E93A 3N19B 1IXPA 4Q4OA 4LV4A 4JTFA 4AY7A 3NPUA 4X9SA 4PB4A 1F7BA 4UFMA 1XDMA 3AXHA 1V51A 2VRKA 1AUSL 3UG4A 3W2JA 4DIAA 4C7DA 1GHSA 3CH9A 3GDRA 3HPZA 3NAVA 3BOLA 2OODA 4LCRA 3A24A 3QBUA 3EPOA 4W5ZA 1CB7B 5T8GA 4OV4A 3Q94A 2HPIA 3PS7A 1EC8A 4Y9MA 2FZMA 3CS2A 3WH9A 1TZ9A 2G95A 3MTWA 2VD8A 4S2BA 3RFAA 3W7IA 3B4UA 4BR1A 3WDIA 3WQGA 5I2UA 3PB2A 3IV3A 4S3KA 4J28A 5HNRA 2E6DA 3DX5A 3SCWA 3NVDA 3BE7A 2IPJA 1TKKA 1F73A 1UKOA 1Q13A 3G0SA 1XG4A 3HQOA 1LRTA 4O1AA 4DQWA 5U4NA 2R82A 3S5YA 2PWVA 3WK1A 3R8HA 4L1GA 3WN6A 4GKTA 3H2MA 5BRQA 5DFAA 4CQAA 2ZDSA 1T8QA 1TPB1 3E96A 3B4YA 1M65A 4L7ZA 2REQA 1UUQA 1K7EA 3LBOA 3KCJA 4QJ5B 2J7EA 4XTIA 4A4AA 3QY8A 4S3GA 3GO2A 3NL2A 1GW9A 4HTBA 4JS3A 2XSBA 4ERGA 3GH7A 4LT9A 2IXUA 1E1EA 2CESA 2FB2A 1QBBA 2PLCA 3WJWA 2DH3A 3FYPA 5AVHA 3AXXA 2DVTA 2G3FA 3HJEA 4IMEA 1TIWA 1W1A1 1A3XA 2FYMA 2VEKA 4GIAA 2O9PA 3RPDA 5I3DA 2J7CA 4I9JA 4RW3A 1TVNA 4LH8A 4DJFC 1D2KA 1M04A 1W5QA 4I9AA 1XRSA 3VNLA 1H51A 5ABHA 2CETA 2R1PA 4D71A 5H8UA 4CNSA 1AJ0A 1KWKA 3VUPA 1QI5A 3U7VA 3ARXA 4JFUA 3EOUA 1AFSA 3WFAA 1KLYA 3H2NA 2GSEA 1Z32X 1OHLA 2O4MA 3W70A 4HIBA 5HNNA 4NZ4A 3UGVA 4LUTB 5JBEA 4AUBA 3Q58A 1A5UA 1YPXA 2WZIA 2O9RA 3L7RA 4NI3A 5CC5A 3CHCA 4PTNA 3QMRA 3WQ4A 3PNZA 1IYXA 4Y90A 1P48A 3CHVA 4LALA 2PLKA 3FDKA 4D6IA 2VX4A 3MY9A 4KERA 4BEQA 2FIQA 2ZZ1A 4OT7A 3QRHA 4ZEPA 3K4DA 4AVOA 3PSWA 2QMJA 4YPJA 3FA3A 4LUIA 5CJNA 4XO6A 2DIKA 3GNRA 4BWLC 1BG4A 2WJZA 1EJUC 4GY0A 1IIGA 1KM5A 3CWOX 2JEQA 2XH7A 5AVNA 3SGUA 1XRVA 4L64A 2Y8UA 1OFDA 3JZEA 3NYDA 3K4AA 5XIMA 1RR2A 4EANA 2QW5A 3GR8A 1V0KA 3N4EA 1J6OA 3KDNA 1IQ8A 4Q8TA 1ZNNA 3PJXA 3WQDA 4IHCA 5L9FA 2FMOA 2HK1A 1TPDA 1IXOA 3LK6A 4CN4A 1IZKA 5KZEA 3AIBA 3BGJA 3INPA 1UH4A 1H2JA 3K1GA 2BGQA 1ZZMA 3WLQA 1QATA 4TV5A 2ABAA 3GC4A 4PMOA 4CNNA 3AMDA 1KRBC 1FFRA 1XV8A 2XPKA 3L0NA 3N34A 2WB5A 5IM51 4HNUA 4UQCA 3HPSA 1X7FA 3C3UA 3DG3A 1GJPA 1QTWA 1BWVA 1XISA 3ONBA 1NIUA 1V3IA 4LVBA 4UIOA 1E6SM 1XLMA 3CQHA 1CGTA 4HMNA 1QK0A 2OGJA 3V0TA 4A6GA 2VFFA 4O10A 5EPDA 4I3GA 4HPJA 4JTLA 4M51A 1MRQA 3I7SA 4GUFA 3AOFA 1ZBWA 3E0WA 2DT0A 4KIRA 1YADA 1OFPA 3AI0A 3CTLA 4N4PA 2C1GA 4GX9A 2C7FA 1WXYA 4CQBA 1OX4B 3VOCA 1J12A 2GQ3A 2XH2A 4JIQA 5EL1A 1FXPA 3VU2A 4Q8UA 2XN1A 2BV9A 4IXHA 2BHYA 3N9KA 2WKJA 2VXNA 2HQAA 4B5WA 3MUXA 2HNEA 3WMCA 3MMWA 3TW7A 3Q45A 1X98A 2VCAA 3IUDA 4K6AA 2C1HA 2YR1A 3C2RA 3A3HA 1ALDA 2GQ8A 3L4UA 1NDVA 1YYAA 2HZGA 1D8WA 1TZ7A 1Q8AA 1FH8A 1H50A 3J7HA 3K8LA 2NSXA 2Y7FA 3UR2A 3LMZA 2ZA1A 4MWAC 3G2GA 3MVIA 1LOSA 5A8NA 3IPWA 4P7QA 3PBYA 4W7WA 4ECLA 4M6PA 1UOZA 3QR1A 4L4LA 1N8WA 1MXGA 4JYDA 1REQB 3W9ZA 3CO4A 3VFLA 4B15A 3NCOA 1JDAA 1UMLA 1CXLA 1JCMP 1OCQA 3E38A 4E4PA 4K1WA 2A85A 3CAQA 1GVEA 4FOJA 4XZHA 1M41A 2ABBA 3MI2A 3S5ZA 3SCPA 3DEQA 1VPYA 5LIUX 4GJIA 1TQXA 3B9NA 3N14A 3EB3A 3VX1A 1W5OA 4JTIA 3H55A 2A7PA 4IQJA 3OZPA 4ZOEA 2CIPA 3P81A 1GOMA 4OECA 4X60A 4S3EA 3P61A 3MUAA 1BQCA 2DP3A 3UT0A 2V82A 4UMAA 3LXCA 4HCLA 2D0HA 4GNKB 1VJZA 3WJXA 3WUGA 2J8FA 3VNIA 2KAUC 3TWAA 2W66A 1GQLA 1W9PA 2ZX5A 2W27A 4LYKA 3H4WA 4UOQA 4GABA 5IFPA 3DESA 4M1BA 1EJXC 4JR5A 5BMXA 4YCOA 3VUSA 3MW7A 3WBAA 4DF0A 1UR3M 4HNOA 3HPAA 3TYDA 4HNLA 4LNYA 2WSPA 5CPSA 7XIMA 3UD6A 1UKTA 4IH3A 2V3FA 3BJTA 4JQ3A 2Z7GA 3UNTA 3S1WA 1SVDA 2NQHA 2NW0A 3T08A 4AMCA 4KFOA 3PM6A 1B3VA 1POJA 4O52A 4CCZA 4KCTA 3ATYA 2WMFA 1XD1A 3CJPA 2J79A 2OLAA 4OUEA 4O4WA 1BPLB 2ATMA 2VZUA 3BTNA 1EGMA 3IGSA 3S6OA 3JW7A 4UTUA 3B97A 3EPMA 1UJPA 2NLIA 3MV11 1PZ0A 1GK8A 3M6YA 1HVQA 3BAWA 4C1NA 4H2CA 2DT2A 5DMNA 4YTSA 3A5VA 2JK2A 4WDUA 5CPLA 1W1VA 4W7VA 3ENLA 3MWCA 4AD1A 1NSJA 2G0WA 2WNWA 4P61A 4JL2A 4GJJA 1MZHA 1VEOA 1EZWA 4DNMA 3GFXA 4DJDC 4J4KA 4IPNB 2X1TA 3LLFA 3F2DA 3JZUA 2CXGA 4W9TA 2Z25A 2A6LA 3ARUA 4MWAE 2PDNA 3W1QA 4H8NA 2GSHA 3SI9A 5FAJA 3B9EA 1CEOA 3VGFA 2E5CA 1WNOA 4JIEA 5E0KA 3VMNA 3ZWTA 1PCWA 3VGDA 1FWAC 2J7HA 3LCXA 1AD1A 1HO4A 4DUXA 1IWBA 3GTIA 3WD1A 2V6AA 3BC9A 3THQA 2Y7DA 2J7DA 3N2OA 7TIMA 1AH0A 4XAGA 3FW6A 1J6PA 2WHKA 3MKVA 4NX0A 3S2MA 2Y61A 4GZJA 4A3YA 3MCMA 1SZEA 3NL3A 4IFRA 4WJEA 2CXEA 1JIBA 4MB5A 1OFEA 1GNXA 4NAFB 4TU1A 3WDQA 3NSXA 4KEZA 1S39A 1W9DM 3KCOA 5LA0A 5AB3A 4FNPA 3UW6A 4DRSA 1BTCA 3N17A 2WQPA 2JF7A 4G5DA 3T9PA 1HGWA 3UWUA 1TWIA 2O7QA 4ZODA 1AL8A 7ODCA 4ONVA 3GY1A 1WA3A 4FLOA 1Q6FA 1Q65A 1W54A 3KUMA 4DUVA 3P74A 1J2BA 4NY2A 2AAAA 3L12A 2E25A 4DLFA 2DZSA 4ACZB 5IOBA 4C90A 1OB0A 5IXEA 3CQ0A 4OTKA 4GISA 2JALA 4PMYA 2VTFA 4MLRA 1GQJA 3UU0A 3O05A 1O5RA 5CLWA 4UBPC 1GZGA 5CJ5A 4U2YA 1D7KA 4PMXA 2RHGA 3GH5A 1UR9A 3C2EA 4M7SA 4N6FA 1HP4A 1VH7A 1A80A 1ZFJA 4TXEA 3HBLA 2C15A 1UKSA 3GU1A 2BNJA 3MA8A 1DJXA 1A5CA 1ZHAA 4DAIA 1JI1A 3HQNA 3NQGA 3QM3A 1RP9A 3UWWA 4RNFA 1XIJA 4QP0A 1OM0A 3N4AA 1EZ2A 3DXIA 3H21A 3HPFA 4AEFA 3PWGA 1UJQA 3WUBA 1S2UA 1TTQA 3O0KA 2V3GA 4GQQA 1TV3A 3BW3A 1U22A 1ICSA 1UBPC 3RAOA 4MUPA 1I2PA 3FA4A 4KRZA 3AS0A 1MUMA 3N3MA 1BF2A 3UZZA 4CD6A 2VUNA 4MJMA 3SECA 3O15A 3EX3A 4KEMA 2BXYA 2VMFA 3GTXA 5B7ZA 4S39A 1AJ2A 1N8FA 3OTRA 4XAYA 1EOKA 2YX0A 5ENLA 3EX6A 3RNDA 2QHAA 3WUFA 1RUSA 2PE4A 2QZRA 4Q4KA 2J4GA 4MAZA 5D4YA 4R9OA 3RU8X 2X1RA 3I3DA 5H91A 4PCNA 4B5UA 1A4MA 1A5NC 1L8PA 4Q32A 1YIXA 1TA3B 2WYSA 1QK2A 4UOJA 3UXLA 3S2CA 1DJHA 5D37A 4KWOA 4WIWA 2MUCA 4NASA 1HT6A 1ENUA 3WL0A 1EPVA 4Y6GA 5I3HA 1UD5A 2ZXDA 3TXVA 5CBIA 3D0CA 1WYIA 5D33A 1VFHA 1F3WA 1ZCOA 4C1KA 1B9ZA 1CLKA 2P8CA 1HN1A 3PPFA 3W4RA 2FHBA 2ZFAA 2DU2A 1FP8A 5DRCA 1O5XA 1R2TA 2X1UA 1XBZA 3WLPA 1XLDA 1TMQA 2IPWA 3HMCA 3STPA 4D6HA 4UZUA 4O1FA 1CYGA 1EJRC 3QTGA 4WJXA 1R3SA 4GO8A 1UZ1A 2FZNA 2QIIA 3LI1A 4ZB0A 4AWTA 1L6WA 3VNYA 4HU8A 4LVGA 3UERA 4UMBA 3FV9A 3ICJA 1G01A 1W8SA 2ALDA 4HP5A 2X7WA 1P5BA 4UTWA 4IMDA 2CLFA 1WDPA 3JRKA 1HJWA 3AS1A 1R7OA 4QGCA 2H3BA 1VFLA 2YFNA 4EF9A 1U1UA 5LNWA 1WDDA 2G3IA 4PCSA 2VDHA 1F5ZA 4V28A 5CH9A 1MEHA 4DPQA 3RUBL 2W9MA 1P0KA 4IIFA 2WO5A 4ZO7A 1WAWA 1C8XA 3WDHA 1OGSA 4U31A 4PEKA 5XIAA 4LUTA 1M7OA 4DPPA 3OHIA 1XBYA 1I1XA 1K8YA 1LG2A 3UZXA 2OG9A 2PRMA 1JCYA 2I5IA 1YXDA 5IRPA 3KM8A 3B03A 2SFPA 2YDQA 5HNTA 3ZIZA 1GTHA 4ZE5A 1DBTA 1OYCA 3A4AA 3BURA 4OKDA 4Q8PA 1X97A 2RDWA 1WZLA 1GVIA 2E6FA 3TMLA 1EQPA 1SO4A 2FH6A 4J3ZA 2TSYA 3ZLGA 1UD8A 4GQGA 5FEPA 1XD0A 1IWAA 2E5DA 3WF3A 1C93A 4WZHA 2YL6A 1ONRA 1VR6A 3SFKA 4Z42C 3HOJA 2NX3A 1LOQA 2PZNA 4FLRA 5A69A 5DANA 1OK4A 4H3DA 2P0OA 2QVHA 3OW1A 1KA9F 4WSHA 2V5JA 4PUDA 2D0FA 3FAXA 3KTCA 2POZA 4FIRA 3M47A 5CBJA 2PDWA 3T09A 3TOYA 2XGIA 1EX5A 1W9BM 4YVPA 4B5VA 3EXSA 1XICA 2D23A 5CC7A 6XIAA 2F6KA 4HJWA 1W3TA 4HN4A 4TV6A 2I1OA 1TX2A 1CXFA 2NV9A 1JPHA 4GC4A 3C6CA 3EXRA 3H53A 3W7JA 3VPLA 4GFSA 1Z6KA 3GG7A 3LXBA 4X0VA 3LBCA 3MSYA 3B3DA 5AYYA 5HAOA 2V5CA 1OIMA 3PTDA 4EPBC 5JU6A 1IF2A 4B4FA 4Y9OA 4HK7A 4GE8A 1S2WA 4TMBA 3T81A 3QC3A 5HK4A 3PP7A 4D8AA 1DJYA 1PWMA 3G0XA 4K2SA 3APGA 3Q4DA 2EBNA 3QQ1A 5FI8A 3NIYA 1XGDA 2J77A 3LTPA 2ZVRA 4AF0B 2VWTA 2OO6A 3WNPA 3LCGA 4JICA 1IEWA 1HTIA 4UQAA 2WVVB 2YCLB 3EA3A 3N3TA 1PBGA 4HBKA 4L56A 3CT7A 3LEPA 3WQOA 1FDYA 2VX7A 3L4TA 3MS8A 1FWTA 3T4WA 4QLKA 3KLKA 3MB9A 4DWSD 3KRZA 4DJEA 2D73A 3IIZA 4HT3A 3B40A 4PMVA 3SFWA 3IJ9A 2VGBA 3P67A 4JPGA 1OX4A 1LYXA 5H2ZA 5EU9A 2R91A 5E1QA 4GJ1A 1HFBA 1XCWA 1OYAA 1XIGA 4UCFA 2Z4GA 3H26A 3CK5A 3UFYA 4WDWA 3TUUA 3PJTA 1I2OA 3O6CA 4IIHA 5D38A 4Y9AA 5DF0A 4EPEC 2FGLA 3BJFA 5CGTA 2YCIX 3TJXA 2NWSA 3SCRA 3W2KA 3BCFA 2JF6A 5K9XA 1FHLA 2F6XA 3WFZA 4GVIA 5FJPA 3EWCA 4ZFCA 1REQA 2PFHA 4QJ4B 4IG2B 2XIQA 2OZ0A 1BRLB 3QGKC 1XIDA 4MF4A 4KGLA 1P6BA 5CZSA 5D2XA 1AQFA 2X41A 5TNVA 1E5JA 3CNYA 3DFNA 4F0LA 2E28A 3CZKA 3U48A 3WLRA 3V5CA 1J9YA 3EB4A 3VNMA 2J6VA 2F2KA 1GQIA 3MDUA 3PG8A 4JN8A 3C56A 1GVRA 2V2CA 4TX6A 3QKZA 1V5XA 4BJHA 1GKRA 1PSCA 3S6TA 4HMEA 1RY0A 1WXZA 2VELA 4B16A 2OSXA 4LW7A 1LWIA 1D9EA 1IE7C 1JULA 1XUUA 2IKGA 1G0CA 3KWSA 5D9OA 4MM1A 1TYGA 2IS7A 4BI6A 4ZQRA 2IQDA 3M0MA 4JDBA 2PA6A 3K8MA 3AMCA 4JL1A 3VDHA 4JN7A 3VX0A 2W4XA 4CNPA 1XCXA 3NSMA 4UB9A 2EPHA 3W7MA 2J27A 1GJUA 3WIJA 3BW4A 5LA2A 3BWWA 4RJEA 3R1ZA 1GVQA 1V02A 1QHPA 2DGAA 3P14A 3NUKA 4JHZA 1US3A 3B9OA 5C2XA 4Q7NA 4MNJA 1TTJA 3QZAA 3TW9A 3TYUA 4AXNA 3CQIA 1S5TA 1GVOA 5A95A 1DWAM 3EGJA 1EA9C 4DAFA 2EPKX 3UR8A 4DX3A 4GQRA 1W32A 4B90A 5EMJA 3UA3A 3W37A 2AQVA 2DVUA 3G0UA 4H9VA 4XISA 3PPCA 5DMLA 1EKOA 1WQ5A 4LSBA 2HROA 5FACA 4XB3A 4JKLA 4AZBA 1F4AA 3I65A 4XAPA 3OQ8A 2YA2A 3QW4B 1D7FA 3GVRA 5HPCA 3QFEA 2E1DA 1R38A 1EO5A 3RF9A 3TONA 4PMDA 3W7HA 1NAL1 1WZMA 2DQWA 3AHZA 4GBUA 3IRDA 1RJPA 2HXTA 5AYXA 4IWWA 4IGHA 3TR9A 2DZAA 3MBFA 4QLJA 3WQPA 3VOIA 4LX4A 2Q02A 1LQ2A 2WM0A 2XH0A 2PSNA 1XIEA 1CNVA 3W1PA 4IXXA 2VEFA 3LPGA 1XYZA 3D3FA 1PUDA 4GGHA 4ATDA 2WZHA 3KBJA 3PAJA 2ODOA 5A6JA 3GLCA 1KW1A 1TV8A 4NT0A 2PPGA 3VD3A 1AD4A 3IK2A 3NQFA 2Z7KA 5C9ZA 1H0GA 3EDFA 3TTOA 4NAFA 3LLXA 1XLAA 4ZQPA 6TAAA 3H7RA 3VXGA 5LXXA 4C6DA 1V7YA 2FB3A 2HE5A 3UZYA 2J66A 5DXYA 1WKEA 4IX0A 4AMAA 1E6NA 2DW7A 4ZBCA 1ZAJA 3L66A 7ENLA 4E2VA 5FOOA 4UTWC 2PURA 2CERA 2R1NA 2QCDB 3FEMA 1O60A 4YCPA 1BGAA 1TCMA 1SW3A 3EX2A 1RCXB 1ODZA 2FJKA 4PCTA 3T0TA 4UR9A 4LB4A 4LCQA 2ZRVA 3S2NA 4CQCA 4ACZA 3UPWA 3WMSA 5DY3A 4QCFA 2OB3A 4Q4RA 4H7VA 2GGGA 2PTZA 4FK9A 3M0VA 4PODA 1QAPA 2Y24A 2Z2UA 3LGGA 5GNXA 5HMFA 1LF1A 4PUUA 1RVGA 1P7TB 3OODA 5ECVA 4UNIA 3CM4A 3P0XA 5D9MA 3QN3A 4O0ZA 3WELA 3LBMA 3WLOA 3EOOA 5DMMA 4AVNA 4LF1A 1XDJA 1XSIA 3NQMA 4XZNX 2PLMA 1Y5XA 5HULA 2GPTA 1UWIA 4HCHA 3VC6A 3QTPA 3BLOA 3M64A 4FXRA 4KW2A 4JOMA 4NAEB 2EG7A 4V33A 2B0MA 4FI4A 3W76A 4PMRA 2WC7A 3FFSA 4FNUA 3TEVA 2QJJA 1H60A 4RE2A 1GG1A 1IR1A 2O9OA 3VIIA 5FEWA 3DH7A 4YTQA 4U5IA 2HEJA 4HB7A 3NQCA 5C2GA 4JTCA 2GGIA 4YMZA 1UZHA 1S5VA 4J3WA 5A8OA 3HMJG 3K5XA 3MP4A 3M46A 3LN3A 4F0KA 2FPTA 4AIUA 3GHRA 1US0A 3RN6A 1O5KA 3TK7A 4PBFA 4GMEA 2QULA 1CGYA 2AAMA 3DI1A 3L65A 1UHVA 3R58A 4C6FA 3ME3A 1ME9A 5H6HA 4IPJA 2VURA 1W5MA 2XFFA 4CN6A 1EC9A 2C0AA 3PBMA 3OYZA 4C5ZA 4TUFA 2CLPA 1TA3A 4GUHA 5C5YA 3FN9A 3SCNA 2HS8A 2FTYA 5XINA 3FA5A 5JIPA 2YL9A 1QMLA 3WD4A 3WLLA 3ARWA 1OFQA 3SN1A 3VGHA 4R34A 1KBIA 3ITOA 7REQB 3RPMA 1BVNP 1VHNA 4UUIA 2YDAA 3IIXA 3IVUA 3SM0A 4UTTA 3SY1A 4EAYA 4GRSA 1DJGA 3N9RA 3KOYA 1I1WA 4Z1BA 2QCLA 3HB9A 1R7AA 3WH7A 3QEZA 4O57A 1S5WA 3BSGA 4L80A 2CLOA 1F9CA 3N9SA 2FFCA 5E0CA 1F3TA 1F6PA 4KCWA 2PD5A 2POTA 1W1ZA 2F84A 3OLGA 3SDOA 3SJNA 3TJLA 2OEKA 4FP1A 4GI6A 4FSAA 3U4AA 3PWAA 2RAGA 4V2XA 4IQDA 2VR2A 4H7ZA 3EMQA 5BZAA 4YNGA 4Y2WA 1XGEA 3GB6A 4KT2A 3SUUA 1O5QA 4RL3A 1L6FA 4W4QA 1JRCA 3GQYA 3AISA 3YPIA 2NQ9A 3A21A 3WNNA 4DBWA 2NZLA 1PTAA 2G41A 3AMLA 3L9CA 1GONA 4AQLA 2BX7A 2WC4A 1TJ0A 1HVXA 3W1UA 1EUNA 4MNMA 1DWHM 3W87A 5D02A 3MMUA 3UXAA 1RJQA 2QJGA 4IJRA 2VFIA 2OZ8A 2P3EA 1UUMA 1R9XA 1EPXA 1CXEA 5I77A 1JAKA 2WCAA 4N9EA 2ANUA 1BKHA 1E6PA 3BQ5A 3R0KA 5DX7A 4QEEA 1WXJA 1H62A 5KZDA 2BGNE 4M7TA 3W7RA 3BG9A 3DBNA 4O1DA 4GWEA 4B91A 4MZ1A 1YTDA 3HQPA 4DJFD 5M03A 1SUXA 2P53A 5HMEA 1AK5A 3VKBA 2QR6A 5D04C 3EWDA 2ASHA 3LRLA 1MQPA 3LERA 3WF1A 5D32A 5C8BB 3NQ7A 4O50A 4E2DA 4Z1AA 2ZZ5A 1TV7A 4MB4A 5LYRA 5LZLA 4GUJA 3A9IA 3N2XA 2Y7GA 4CNTA 1SSDA 1UD6A 3S42A 4H19A 7TAAA 5LNSA 1ONXA 3UA4A 2OZ3A 3I6EA 1OZQA 3UXKA 3L4YA 2PTXA 2UWFA 1AG1O 5I7GA 2I9UA 3P7YA 5CPNA 3WBYA 3C52A 5FAGA 4S3AA 2E5BA 4PUWA 1YDOA 2IUZA 1AA1B 4QTGA 4V15A 5D2TA 3HZ3A 3QHMA 1IT0A 3T0DA 3Q67A 1P6WA 3NQVA 2WVTA 4ZSTA 4PBEA 4Q3MA 4FR6A 2XVGA 4PH6A 2FDMA 3B8UA 3BLEA 4F4RA 1UUOA 2CW6A 1UWQA 2H9AB 4AW7A 4AF0A 1KBBA 1KGUA 4HU0A 2JIWA 1BYDA 2CHNA 2FZ9A 2ISVA 1ISYA 2E0PA 2WVVA 2YCLA 2GJXB 1K9DA 1SQ7A 4KRUA 4ERIA 1OINA 3JVAA 1XSKA 3DERA 3CV1A 4GD0A 5HNUA 3UVAA 4O8RA 4IM4A 3AXKA 4W8LA 1DJIA 2C18A 4AU0A 5CPMA 3LPPA 1K8XA 2CLLA 4V1YA 4JY8A 5FJUA 3NSNA 2NUXA 1ZY9A 1JZ8A 4Y9PA 2JKPA 1GPWA 3EWYA 1F74A 1C9DA 3GG8A 3RM9A 4X63A 3NQ8A 5A8PA 1H7RA 2VC7A 4IMGA 3LDVA 1UH2A 2ACQA 2D20A 4NX5A 4IFOA 3M41A 5D2YA 3GX9A 3SSJA 3KXQA 1JD9A 1FBAA 4A21A 3SURA 3RX4A 3NQAA 3ZZ1A 1BTMA 3TQVA 5TAOA 5AHEA 3NR0A 3CMFA 4WGHA 3ITYA 1EBGA 1K7XA 1OC5A 2Y6ZA 1WE5A 2PWFA 2VGIA 4FALA 1PVNA 1WV2A 3KW3A 4ORMA 4JTEA 1LTDA 5A6LA 2QVNA 1UOKA 4O18A 4UTJA 1UC4A 5D30A 2XIMA 1AZ1A 4ML9A 1NWSA 4UCGA 1BWKA 5G1MA 4YXGA 4R53A 4IG2A 4U28A 3CLMA 3V7PA 1UP3A 3KVLA 4RDVA 4XUYA 5FF4A 3W25A 3WQEA 3A4JA 3HA1A 1NWTA 2Z1BA 2VCCA 4MADA 3ERPA 5LNRA 4ICCX 3KP1A 1GGOA 3GHUA 3B0YA 3EX4A 3BANA 3BAXA 4AD2A 4DYEA 1EQCA 2OKOA 1F07A 1QJWA 2ZA3A 1JRBA 5F4SA 1KFLA 1OVDA 4PCPA 1JXKA 2D3NA 5EMMA 1NM9A 1PHWA 2VDIA 1H7PA 3KOXA 4S3FA 1G4TA 1BF6A 1P1MA 2PDYA 4ZOBA 1XKYA 3W7OA 2INZA 4DM2A 1KBLA 1GYLA 1PPIA 3BGAA 2JE8A 3P93A 5HR7A 3ITVA 3NEHA 4KF1A 4JHMA 3U2CA 3QF0A 3I7QA 2WJDA 1VCFA 2A7RA 4EAMA 5A6SA 2ISDA 2WV8A 1E0TA 2BBFA 4MWAD 4JIIX 3BO9A 3TDFA 5E6ZA 1PDZA 1E9ZB 3NWRA 3CUFA 1H0IA 4PGLA 1T7LA 2GUBA 4GFIA 5MKGB 3T0BA 1A3WA 1WUFA 1CT5A 2YDSA 3B8TA 3F5LA 5DT5A 2RDTA 2EEXA 3ZJ6A 3OIXA 1GQNA 2HPMA 3ARYA 4MPQA 1EFZA 1DTUA 4A8RA 4N0RA 2HTMA 3NQ6A 4EXAA 3TA6A 3PPHA 1XHGA 4MFEA 1KRMA 1HIZA 4ZENA 4IPPA 2Y8VA 1GEHA 3GDMA 3M7WA 1ZS2A 2O55A 2PBOA 2ZCGA 1FWJC 3NJ3A 4WKAA 1BYAA 4NXSA 1KM4A 4QR6A 4E4UA 4ORIA 4HD5A 2FZ8A 4OIFA 3GYEA 3R79A 3NFUA 5H1WA 1T41A 4GINA 5D05A 5BCAA 4ADSA 5A6MA 2X0YA 4G9PA 4GVFA 3ZVHB 1EDQA 4YL2A 1X1NA 3N73A 1BXBA 1JD7A 3QPZA 1EJTC 4A29A 1ELSA 5CG7A 4L6DA 5ABFB 2GGJA 4GUIA 4ZGYA 5EYWA 3P82A 3Q2DA 5BWFA 2EAWA 3RR1A 3LNMA 5BOFA 1UQZA 2EG6A 1G4PA 1H1YA 4ZOCA 1FDZA 4RPQA 3T4CA 1J8VA 3T0AA 5JBFA 2R8WA 3GIPA 4Z2HA 1IIHA 4MOZA 3GS6A 3W28A 4FX8A 2TAAA 3E0VA 3GBEA 3LM3A 3T0CA 3VOGA 1XF0A 4TO8A 4U33A 4OBRA 4P8UA 2Z0IA 5MHBA 1XYFA 3EMCA 4BF5A 4HOWA 4O8AA 2QCDA 5CC6A 5T9CE 3BLDA 2ZICA 4J3SA 3ZMRA 4PRRA 3KTSA 3W2UA 6XIMA 2PWEA 5C7HA 2QUUA 4IP7A 5IBXA 2EHHA 1KTNA 4X22A 3KTXA 3WH8A 5D9NA 5LKYA 1TPWA 1N82A 3WH5A 3TAKA 3M0YA 5FKYA 3TVAA 3M0ZA 5FF0A 2ZADA 4DJDD 3CWNA 3PJWA 4W84A 3T40A 4A2SA 3NVTA 3ISIX 3GNNA 1P7TA 1E4LA 3DGBA 1KC7A 3B8IA 4Q4PA 1XLCA 2CLKA 1BVWA 1K6AA 4I7WA 4OV9A 1JJKA 1OC7A 1SMAA 3EEZA 1IV8A 2AOSA 4NRRA 1ITXA 2EJAA 2VKZG 2WQDA 1I60A 1V08A 1TRIA 4GXPA 4E8CA 3CV6A 4AIEA 1X6NA 2CLMA 3FSTA 3T42A 2EKCA 2XFWA 3M07A 4NAEA 1V6XA 1J01A 1MEWA 3SZ8A 4C6MA 5I78A 4XIMA 1TQJA 1E70M 5D03A 2QAPA 1LLWA 4DZIA 2WM1A 4HVXA 3NTYA 4F9DA 1SJAA 1XIFA 3SQLA 5I23A 1C8YA 2V5KA 4YIWA 1V3HA 3M4HA 3WLIA 1J18A 5BXPA 4QNEA 2VCBA 1YE6A 4JTDA 2UBPC 3LQGA 4PRWA 1VLIA 1KCZA 1M1BA 3P6LA 5I00A 3O6YX 4JTUA 1I8JA 3R7MA 2EPMX 4S3DA 4P7OA 3C8FA 2OQYA 1EJ7L 3B9AA 3KS6A 2V30A 1CI1A 2X1IA 3PNUA 5E0FA 4JTGA 4F0MA 1DE6A 4C6QA 4ADTA 1L8NA 3USBA 3LD5A 3BAJA 2E9BA 1G4EA 1AL7A 1W31A 4JIPA 1K3UA 4DWSB 2B81A 1TJPA 1R6WA 2VGGA 3LTSA 3IUHA 1FH7A 4LU0A 3AXMA 7REQA 2WHJA 1ADSA 3NO5A