1AZ2A

Citrate bound, c298a/w219y mutant human aldose reductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 84
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az2A00
3BURA 2PDFA 3S3GA 4WGHA 3CV6A 2J8TA 1PYFA 2PDHA 1EXBA 2INZA 3UZYA 2FZBA 1EKOA 4LB3A 2FZDA 4PMJA 4WDWA 3RX3A 4IGSA 4WDUA 3NTYA 3RX4A 2PDNA 3R7MA 2PDGA 2C91A 5C7HA 1X97A 4XO7A 1PZ1A 1AH4A 2FGBA 3O0KA 3COTA 1Q5MA 4LB4A 3M64A 5LIXX 2HDJA 2HEJA 3CASA 3V35A 3Q67A 5LIWX 1AZ1A 1ZUAX 2PD9A 4AUBA 4ASTA 2FZ8A 4FZIA 3T42A 4EXAA 4JTRA 3H7UA 4ICCX 1XJBA 3M0IA 2PDBA 3LD5A 1K8CA 4YU1A 1R38A 4H8NA 5HNTA 2IPJA 2HE5A 5LIKX 2PDUA 1M9HA 3GHRA 4PUWA 1LWIA 4JTAA 1US0A 2HVOA 3MC5A 1S1RA 4GA8A 3UWEA 3BCJA 4IJCA 4XAPA 3LEPA 3GHSA 2PFHA 3LENA 4R9OA 4WRHA 2PDPA 3H4GA 2DV0A 4GQGA 1SM9A 4LBSA 3LQLA 3FX4A 1XGDA 1C9WA 1MZRA 2ISFA 4F40A 1S2AA 4XZMX 3R58A 4YVVA 4QBXA 1Z3NA 1ZGDA 4JQ2A 3R94A 5HA7A 2PDWA 4QX4A 4GACA 1YNQA 2DUXA 2I16A 4WDTA 2BGQA 3R8GA 4XO6A 2ACSA 2P5NA 3BUVA 4DZ5A 2IS7A 4DBWA 4GABA 2IQDA 2NVDA 3LBOA 2PDKA 4PRRA 4LAUA 4IJRA 3UP8A 2HV5A 4GQ0A 5KETA 1AH0A 4L1XA 3V0UA 4XZLX 2BP1A 3UFYA 4DBUA 2F2KA 2PD5A 2DUZA 4JIIX 2PDJA 4JQ1A 1QWKA 3VXGA 3BV7A 2R9RA 1X96A 2PDXA 3UZXA 2PZNA 2HVNA 3CMFA 4I5XA 4JQAA 1YNPA 3N6QA 5LIYX 2IKJA 3LZ5A 1X98A 1AH3A 3EB4A 4XK2A 2PDLA 1ZSXA 1YE6A 2NVCA 2PF8A 4JQ3A 5LIUX 4YVXA 5M2FX 2IKHA 1FRBA 3UZWA 1HQTA 4XZNX 3V0SA 3M4HA 4JIRA 1RALA 4WDXA 3H7RA 1AZ2A 2ACRA 3ERPA 1MRQA 1HW6A 3DOPA 3N2TA 1OG6A 3O3RA 1LQAA 1Z9AA 2BGSA 3KRBA 2IPFA 3WG6A 4JTCA 4PR4A 5JH1A 1ADSA 4GCAA 3WBWA 5HNUA 3V36A 1Q13A 4QR6A 3QKZA 4FAMA 3R43A 2AGTA 3P2VA 2ACUA 1T41A 3GHTA 1XF0A 1EF3A 3Q65A 4LBRA 1PZ0A 2IQ0A 1QRQA 3D3FA 4XVEA 2VDGA 1VBJA 3LUTA 2IPGA 3F7JA 1YE4A 2WZMA 5JH2A 4H7CA 4XZIA 3EB3A 4RPQA 1JEZA 3WCZA 3UZZA 3GUGA 1AFSA 3EAUA 4XVDA 1Z89A 3ONBA 3U2CA 3G5EA 1GVEA 1IHIA 4YS1A 3FJNA 4Q7BA 1UR3M 3MB9A 2PDMA 2CLPA 4FA3A 1PWLA 3CAVA 4XZHA 4PRTA 3ONCA 3R8HA 4ZFCA 3R6IA 5DANA 4L1WA 3DN5A 2FVLA 1S1PA 1S2CA 4Q3MA 1T40A 4EXBA 2IPWA 2I17A 3CV7A 2PDIA 4NKCA 3V0TA 2R24A 4JIHA 4FALA 3LZ3A 4HMNA 2INEA 2ACQA 4GIEA 4QXIA 1EL3A 1PWMA 1RY8A 2PDYA 5AZ0A 3UG8A 4JTQA 2PDQA 4WEVX 2A79A 4G5DA 3C3UA 4HBKA 3WBYA 1RY0A 3LQGA 4MHBA 3RX2A 4PUUA 1VP5A 2FZ9A 3CAQA 2HE8A 2IKIA 3UYIA 1Z8AA 3G1RA 2PEVA 1ZQ5A 4YVPA 1J96A 3WBXA 1IEIA 3LNMA 1MI3A 2ALRA 2WZTA 2PDCA 3LN3A 4OTKA 4JTDA 2F38A 4DBSA 3UGRA 3B3DA 3GHUA 2QXWA 1A80A 2IKGA 4LAZA 5AZ1A 4JQ4A
chains in the Genus database with same CATH superfamily
3MPGA 3N2XA 4BCEA 2ZYFA 1W3KA 4LQ1A 1EC7A 1N8FA 1OCJA 2JQXA 3KTCA 1J12A 2GQ8A 1ICPA 3KLKA 1HKMA 1FTXA 2YDRA 1SW7A 1KFKA 3W1RA 5FOOA 3OQEA 1TUFA 5T26A 2QDHA 2GJPA 2YFOA 3A4XA 4L6DA 1NWUA 3MMUA 3D0CA 1GPFA 3PULA 4H8HA 3O15A 2NVAA 1JDDA 3OVRA 4IIEA 2OKOA 1V5XA 4X9YA 1RR2A 3PFRA 3K30A 3P60A 1NP0A 3BL3A 3C61A 5E0FA 3WF4A 1J6PA 4LH8A 4W5ZA 2FKPA 4CNTA 3RITA 3MANA 2QUMA 1CNVA 1JQVA 1JZ6A 4GJJA 4URIA 3VD4A 4P7LA 3M41A 2HE5A 3OO2A 4QSFA 2Z0IA 2ZXAA 5DRIA 4LWWA 4IIBA 4AZ6A 3ITLA 3W1TA 1YBQB 2ZFAA 5E0CA 1TA3A 1E0XA 1LRNA 1NDZA 3GC2A 3BCJA 4LAOA 1U5JA 3L66A 5CZJA 4JKKA 2EPMX 3R13A 2RFGA 3GTNA 2PFHA 3VFCA 3LENA 1F2JA 4WRHA 3C5QA 1WKDA 2J62A 3FS2A 1Y0EA 1MW0A 4PTNA 4KWWA 1VENA 2QJGA 4WX2A 4DJFA 2O7QA 2VRKA 2PBOA 3S42A 3NFUA 1ELSA 1EP1A 3ELFA 2ZZ4A 2TSYA 3EX4A 3A13A 5E70A 1JGIA 4P7OA 2R8WA 2WJFA 2ZX9A 3TNBA 3L0GA 3QV6A 2AGKA 4J40A 3C2OA 1VFLA 1CXLA 2NXIA 1M68A 3VO0A 1QK0A 2RDXA 2HVMA 3WEOA 2QGHA 3GTFA 3FHAA 2WW5A 4L1XA 4S3CA 1ZP3A 4XBSA 3E96A 4FX6M 5AVNA 3S2NA 3CEUA 2WHKA 2VC9A 9XIMA 5H2ZA 3BV7A 3ITVA 5I06A 3A12A 1WKYA 1UASA 3QQ1A 3XINA 1R9XA 3I68A 4O8RA 3WK1A 3V3WA 3STPA 5AC5A 4QJ5B 4DI9A 1YBQA 1I45A 1CENA 4XV0A 2E28A 4JNZA 2PGWA 4Y90A 4JTKA 1AUSL 3LPPA 4M6VA 4R5EA 1WAUA 4QHRA 3IJQA 3BLKA 1YTKA 2XM2A 4HJFA 4MJZA 4XBKA 2WNQA 1RJPA 2NX3A 3WL0A 1FRBA 2P88A 3RHGA 5I5RA 5EGRA 6ENLA 4HZ6A 3PPCA 5DT7A 1TWIA 3WH9A 5LHFA 4M1BA 2C0HA 4GIRA 2VUNA 3ME3A 5CBIA 1WBHA 4R33A 4GPNA 4KBXA 1AJ0A 1LQ2A 4NHVA 2FDSA 1I1XA 3UNDA 1WZAA 3UCDA 3BSGA 5HMSA 2IXVA 4LUSB 4BKNA 2C0AA 3BWWA 1VPXA 2EKGA 4PR4A 4HD5A 2UWFA 4NP7A 1BYAA 1JXJA 2Y8VA 3NEVA 1JD7A 4K7YA 4C90A 4QR6A 4HCLA 4ZO6A 3UWQA 2AGTA 1H2JA 1GYMA 1P0NA 3ARVA 4ORMA 3OYZA 2PC4A 2B7NA 3T05A 3LHZA 2WV8A 3PAOA 1QI0A 4HJWA 4IUGA 2DJLA 4OE7A 4DWSC 1H7OA 4PCNA 1B3XA 1P48A 3QQ0A 3QY7A 3K1DA 1WDPA 3NPXA 2BASA 1EWDA 4HK7A 3U5YA 3NOYA 1JEZA 3OHMB 3WCZA 1OZMA 3EDDA 4J1OA 3STEA 1E70M 2JEQA 2PSNA 3BLEA 3G5EA 4MAVA 2XVGA 3BTNA 1G1YA 1V6TA 1SVDA 2WWCA 3H2MA 1KBBA 2VZUA 2ALDA 3KDNA 1UUMA 2BVYA 1HJUA 2W91A 3OA3A 3QPZA 1WPCA 3LMYA 4QE1A 1U83A 3VUPA 3M0KA 3Q58A 4CVWA 4LS1A 4IHCA 3WBEA 3QC0A 5H91A 3BMXA 3UCCA 3BSMA 4U2YA 4L1WA 2X0YA 3DN5A 2FVLA 1GVYA 1FCUA 5EBUA 2I7GA 3RILA 5CKSA 1SW0A 3VMNA 4JOMA 4HGXA 5BRPA 3BZJA 4U3AA 4IZGA 3E2QA 4JIHA 1RAKA 4C6KA 1TZ9A 4BR1A 3EMQA 2WC3A 4QXIA 3P67A 2XIQA 4JTSA 1M1BA 2A79A 3QHNA 4G5DA 3WBYA 4E2DA 3ABSA 2GFTA 3IPWA 1EX5A 2C1IA 4D6EA 2XIOA 1W9PA 2BFGA 5E6ZA 1VFTA 5D04C 3KVLA 4ADTA 2Z27A 5C9ZA 1FHLA 4UMCA 4GGHA 1BYBA 3MKCA 4U4MA 4J3TA 1WUEA 4J3SA 2WMKA 4O0KA 1FY6A 3LXBA 4HMDA 3GYCA 3THAA 1Q6RA 2BMBA 1IEIA 4S2CA 2VFEA 3A6OA 1Q7ZA 2I5IA 3BICA 5I3HA 4QE5A 1YPIA 2E09A 1KBKA 3CIXA 4S2BA 1UPPA 1VRDA 2CHNA 1PHQA 2QCDA 3TROA 3YPIA 1XLBA 2D23A 4HNUA 3BGJA 3HPSA 3UPBA 3WQWA 5F2LA 4DX3A 2B4GA 2ZZ7A 4DAFA 2EO7A 2FVKA 5AZ1A 1J93A 3UWZA 3EOEA 1UOKA 5DMMA 2EEXA 4NZ4A 4XSLA 3GVRA 3VIJA 4E3TA 3M9YA 2FZDA 3NQBA 4LF2A 4WJEA 2DDXA 1BF6A 3PJTA 1UP2A 4Y8EA 4O0QA 1OFEA 3IIOA 1PZ1A 5F2IA 3TYUA 4NNBA 3QXBA 4QDWA 2YDAA 3MUZ1 4GYPA 1SSDA 2J25A 5HPCA 2WLZA 3VIOA 4C6JA 3V35A 3MJMA 2HS8A 4AEFA 3PBYA 2YXXA 4GK8A 1AD1A 1U1UA 4O1AA 3KCOA 1UWUA 4KCWA 3T42A 4EXAA 2OZ8A 3AOFA 1YADA 1VGAA 2DZUA 1I1WA 2X2GA 3BLDA 2ZX5A 3TNOA 1M9HA 3NZPA 4IPPA 4FX7A 3N9RA 4QG8A 5K9XA 3L0NA 4LEQA 3ABXA 3ZJ8A 2Z1BA 4M1RA 2JF6A 4QQUA 1QDSA 1ZENA 2WPGA 3PZQA 5AHFA 3E5BA 3ARQA 3I65A 6XIMA 1JPKA 2J8GA 1UROA 1ME9A 4V2XA 3PTDA 2XSXA 3FX4A 1A47A 2CBIA 4GVHA 3P5YA 1XYLA 3CYVA 4GO9A 5C6MA 3NZRA 4IIHA 2ZUVA 1VRXA 1R85A 5CSRA 3PB2A 2P8CA 4JQ2A 2PPGA 1YNQA 4UXDA 3RLVA 1IGSA 3H12A 4HMEA 3O07A 2PWHA 3MTWA 2E6YA 2A3BA 3N25A 1V3KA 1DHKA 1M3UA 4XAGA 2O55A 4HZ7A 2V2CA 4DB7A 4NI3A 1UKOA 6XIAA 4ZBCA 5I3DA 1LWJA 4J2PA 3S83A 4A3UA 1HVXA 4DBUA 4AQLA 1QW9A 1QFEA 3H22A 4NX5A 2I5QA 1QWKA 3T2QA 4OJYA 1CTNA 3BW3A 4NAEB 3WQCA 3B0YA 5HNRA 1WE5A 4IM4A 4JQAA 1KCZA 3M07A 3U8GA 4IMAA 4DWSB 5K4XA 2Z2BA 3DYMA 4RL3A 2P3ZA 4ZTXA 1F6PA 4K2SA 2BY1A 1SGJA 3CAWA 1UR9A 1SJCA 4KERA 3NQFA 3MZ2A 2GVYA 1MYRA 4IQDA 5C2XA 5AC7A 3WH5A 2DFAA 3NAVA 3TQKA 1MUMA 2ZE3A 2A7RA 1QW8A 1TYGA 3WMSA 3R0DA 4XISA 5C5YA 3MHGA 3KBJA 3PNZA 3E38A 4UR8A 1DWJM 3OW1A 1UH2A 3BJSA 3LCLA 2FTPA 1XICA 1H5VA 3ARPA 2X7VA 1VLWA 1QI3A 2D1ZA 1JPDX 4K6AA 2WJDA 4Q8NA 4MYAA 3EBVA 3FAWA 3O3RA 3N6JA 1QT1A 4UFKA 3USZA 5LYRA 3LM3A 2XGIA 1XDMA 4RPPA 4UBPC 3T8LA 2RJHA 4AX7A 3ZWTA 1IXNA 4A22A 3SBFA 4HHHA 4H6KA 1J9YA 5IHRA 4GFIA 4NF7A 3AMLA 3VZZA 3S5ZA 2Q09A 2DZSA 4NAFB 2VUYA 2OLAA 4RZ4A 2YL5A 2CBJA 2WZIA 4DWSA 3B06A 1JDFA 2AMGA 4GVIA 4H1ZA 3O16A 2D2OA 3VD3A 2REQB 4O57A 3CIVA 3BLPX 2ZC1A 5FJPA 4Q4KA 1AFSA 3P3BA 2ZA2A 3MYPA 4XVDA 2GGIA 4I9JA 1I2OA 2QT3A 4UTUA 2VCCA 2Y88A 3IV3A 1B4EA 4NZ1A 4L6OA 1AL7A 4OHQA 1YDVA 4F0SA 1XBZA 5I00A 1L6FA 3CUJA 1XL9A 3TE9A 3TYCA 4I9MA 4KIRA 1G4TA 2X8RA 3N2OA 1V0LA 4Y6GA 2ATSA 1EC8A 1X1OA 1J0KA 5D05A 3F4CA 3TMLA 4GUFA 2GOUA 3CZ8A 2WSPA 2F6UA 4UWMA 4M29A 1T40A 3F2DA 3QZAA 5DY3A 3CV7A 1NDYA 3HPXA 1KV5A 1FCQA 1A3WA 1GTHA 4NYYA 1ALDA 2O9PA 2Y24A 4UTIA 4F2BA 3S1UA 4I3GA 2PDYA 1PWMA 3SY8A 1VKFA 3KCLA 4QDPA 1RK6A 3TVAA 3R5EA 1CGYA 2VQUA 2QCLA 4F0HA 8XIMA 3JVAA 3F5KA 4NX0A 3KL0A 1R47A 3RX2A 4NAFA 4IGHA 1K6WA 3WLTA 4WUIA 2WHMA 2ZXDA 2EPHA 1K6AA 4AVFA 1TMHA 2A7NA 3WLKX 1FVPA 1QCWA 4FNRA 3DC0A 1BVWA 3OGRA 1HT6A 1SW3A 4H9YA 2REQA 1SR9A 4N9DA 1BVZA 3PHAA 1HJXA 4D72A 1V3IA 2F38A 3JU2A 4QNEA 2WBKA 3H26A 3ES7A 4B5XA 3PR2A 3VGDA 1AJ2A 3ZLGA 1JVNA 4OFCA 1CXFA 3VKBA 4PB3A 1PDZA 3B0XA 5MHBA 2CZ5A 4LUIA 4S38A 3GW3A 4WDUA 1IWBA 5BW6A 5CAHA 2CLFA 5EMLA 2FGBA 4CEXC 1XG3A 1VAHA 2O4QA 4GJIA 3WUBA 2CEQA 3EXTA 5LIXX 2TAAA 3CT7A 5IFTA 4E38A 2YCEA 4BFAA 1OFAA 5HINA 3A3XA 3WJZA 1FBAA 4ZZ9A 2GDVA 3FGCB 1NVMA 4PEEA 2OKTA 3N4AA 4AWEA 1BYDA 1JNEA 2V69A 2AOSA 4XZ9A 1BRLA 1RLCL 2ZDRA 1K02A 1XIEA 3SQSA 1V02E 3HM7A 4Z42C 3U0HA 2OZTA 2J9ZA 1BF2A 3MT1A 3DHPA 2GGGA 1XHGA 1GKRA 4IPLA 2DV0A 2WM0A 2QKFA 3TW7A 2NW0A 4KRUA 1IXOA 4ZENA 1VJSA 1SM9A 3QPYA 4F0KA 5HMEA 2P53A 3RFAA 4GKLA 5FD0A 3FAXA 5M03A 1TB3A 4XD5A 3AYVA 2V9DA 3TN4A 3R58A 4N9CA 3W1LA 2H3DA 1Z3NA 3DGBA 3TX9A 4MG4A 2OWWA 3B8DA 3OPSA 1A3XA 3N9SA 2V81A 1TTJA 3CB8A 4GOAA 2EGZA 2ACSA 3G1SA 3G1DA 1RV8A 4W5UA 1YKWA 4Q8UA 3B9NA 3WNPA 3GTHA 5G2IA 4QLKA 5A6LA 1X7IA 3TA9A 1I2QA 1UQZA 4D8AA 5FAJA 4GXPA 1WX0A 3V18A 4CNOA 2PU0A 1EQPA 3GVGA 1QMLA 1KB3A 3CUHA 4AXKA 1OIFA 3R0KA 1OYBA 4P7RA 1UHVA 1WOAA 1R3SA 2XH4A 1SFLA 1ZBKA 2PZNA 2CERA 3MMWA 4JTIA 1TCMA 3P0XA 4JTEA 1J79A 3BAJA 2IKJA 1X98A 3BVJA 1QUMA 4ZSUA 5A5WA 3MI6A 2VWSA 4B5SA 2QEZA 1HKVA 2OOFA 4BQ2A 1YE6A 1JULA 3WUFA 2WKJA 4NJHA 6REQA 1AW2A 2D22A 2RUSA 1O5QA 5CC6A 1G7UA 3VE7A 1HTIA 1Z6KA 4PMVA 1CCWB 4AAJA 3GK0A 3RPDA 2YOCA 5EMYA 2BG5A 2P0IA 3UWYA 3IJDA 1KV8A 4HPHA 3ERPA 1EB3A 4D71A 3S6OA 4JXCA 4H83A 2VL4A 1VR6A 1KRCC 4DBEA 4XTDA 1CXIA 4EANA 1W8GA 1UD6A 2WZHA 2QZRA 1GZGA 3PWAA 5REQA 3DHFA 4TV5A 2E6AA 5A1AA 4CQ8A 3UWWA 1WDSA 4QSHA 1AG1O 1GZ1A 1JI2A 1U33A 2TRSA 2GK1B 3IGHX 2FYMA 3LUTA 4PB5A 3VGGA 4OQVA 3CLMA 2IPGA 3ARZA 1PIGA 2PRMA 1EJSC 1E4MM 5JH2A 3QTGA 1EGZA 3CIWA 1JZ5A 4W89A 5JVLA 4GNKB 2YB1A 5GJNA 2OG9A 4HP5A 3N13A 2Q01A 3PZ9A 5D4YA 5I2UA 1OF8A 1YRRA 2OSYA 1SZFA 5CLWA 5BMXA 1GG0A 4HIBA 2GJLA 3BW2A 4AZCB 4I8YA 3GTIA 3DECA 3ANVA 3ZYZA 1UR0A 5GJMA 2DQXA 4NQ1A 2A5HA 1A5SA 3W2KA 5GNXA 4JX4A 4PFMA 5U7SA 4ZFCA 2F84A 3URNA 3TEVA 1OX4B 3EDFA 1UWQA 4M80A 1NSJA 4AISA 5E0KA 2KZHA 4QLJA 5DMNA 3SCTA 3IACA 1ITUA 2VURA 3N04A 3TAOA 3O7UA 3AICA 3AS1A 5BMWA 1OD0A 1YMYA 5A8NA 3WLMA 2INEA 1Q8JA 3SCPA 1QO5A 5CC5A 2ZX6A 2DJXA 2FB3A 5HOSA 1GHRA 3W27A 3WNMA 3RR4A 1NQKA 3ZJKA 4XD6A 3EXRA 3LPGA 3GDBA 3M16A 1ISVA 7REQA 5H8PA 1E5JA 1EZWA 1LCOA 3VX1A 5LNVA 1KGXA 1EJ7L 2PGEA 3DUGA 1TELA 3RCMA 2A21A 4JTDA 1AJZA 3ITTA 3WN6A 1R8LA 3ARYA 1SMAA 3G3MA 3OLGA 3LXCA 4Q6JA 1EP3A 1S2WA 4AHQA 4GINA 2VGFA 2V63A 3PSWA 1A80A 1GJWA 1LROA 2AKZA 3RYSA 1V08A 1WZMA 3FDGA 3W1MA 4EPBC 3RPMA 4JQ4A 1DJXA 3STCA 5FESA 5FJUA 4D6CA 4O8AA 2PGFA 4AW7A 4WDWA 2H3BA 2UZ9A 4IGSA 1OX4A 3E2VA 5C7HA 3THUA 1XSKA 2A6NA 1FQ0A 4CNNA 3IAQA 4K3ZA 4L9XA 5CJMA 3S5YA 3VKJA 3CASA 4YTTA 3Q67A 5LA0A 3CK5A 4M3PA 4I6KA 7TIMA 3R0UA 4XD3A 4NILA 4AUBA 1M01A 5XIMA 1Q6CA 2FZ8A 3U3HA 1Z48A 1KO0A 3PZTA 4L6HA 4A29A 4KWUA 3C8NA 2PDBA 4WGXA 2ZTKA 1QJWA 1VQTA 1R38A 3WMLA 3ZLFA 3ZVHB 1O7AA 1K8YA 3S8HA 3HG3A 3CHFA 1V8EA 2ZUTA 1SO4A 4AEOA 3BG3A 3CMGA 1US0A 4MUZA 5PTDA 1R46A 2OO0A 1LJYA 1JCTA 3EX6A 3P80A 1O5KA 4O11A 2ZRVA 5AECA 3O8AA 3TWBA 1B4KA 1DXEA 1J0ZA 1REQA 3OZMA 4HU4A 3SM0A 4MZ8A 2C3ZA 1FWCC 1E72M 5D2YA 1D3HA 1EGVA 1IEQA 2E68A 3TFXA 5XINA 6CGTA 2OX4A 3CWOX 3W2NA 1GOXA 4KKXA 2V5CA 2QIWA 3NQ7A 1PCWA 2DGAA 2DSWA 4YL2A 4GISA 4E3VA 1R3WA 3S5NA 4ADSA 3AMGA 1IIHA 3AISA 1PTDA 3JRKA 4HOXA 3EWUA 3UZ5A 4MPQA 2OYMA 1EX1A 3F03K 1R86A 3QMSA 1GPWA 4B16A 4GH3A 1DP0A 1HP4A 2ISVA 3E0VA 5HDRA 1A4MA 1I0BA 5T91A 1SO3A 3G1VA 1S46A 4HYWA 3GIYA 5M17A 1OX5A 2HZGA 1B30A 4S3EA 2RGLA 3NZGA 3WQOA 1IZJA 3HB9A 3LPOA 3PAJA 2CETA 1UZ4A 4BWLC 2XIBA 3U7VA 4TVDA 1QI2A 3LBCA 3ZVHA 3E0IA 1G94A 1NF0A 2HVNA 3AYTA 4I7VA 3LX9A 2PP0A 3NPWA 3D46A 2X42A 3N2BA 3PUEA 7ODCA 3ZOAA 2J47A 1S39A 3BE7A 5DMYA 2OMAA 4GVGA 4XAZA 3FVDA 2GWNA 4OV9A 4ML4A 3TQPA 3HMCA 2IKHA 4MWAD 2QQ6A 2X09A 1JUBA 3IANA 5I3IA 1OG0A 4PUKA 1CWYA 2QMJA 1CGTA 1CLVA 4UZSA 1HJWA 4HNCA 4UMBA 2FHFA 5LA1A 4X0VA 2A6LA 4ZQRA 2CWNA 2NWSA 3ABOA 5JIWA 4B3LA 3UY7A 3TTSA 2DH2A 3GZAA 2TMDA 5JXQA 1E1CB 4JL1A 1LBLA 1UCWA 2DSUA 3S9ZA 3ZT7A 4NASA 3GVQA 3STFA 2HBXA 3WKZA 3KRBA 4CNSA 3BAXA 3N15A 1HL2A 1V6YA 4AWSA 1NY1A 3UERA 3CO8A 1PXGA 6TIMA 4P8UA 3QKZA 4QEEA 1UA3A 1DJWA 1M7XA 4XB3A 4TMCA 4GCXA 1F6YA 5C7VA 1BSLA 3Q65A 3S9IA 1H60A 3W7JA 4XVEA 3PVFA 3HV9A 3KUMA 5C8BB 2Y63A 2YXGA 3C4UA 1S5WA 3W22A 4D9PA 1VD6A 1VYPX 5D9MA 2IXUA 3A64A 2C71A 4NZCA 4NZ3A 4J3UA 4UCGA 2G3NA 4XZWA 3TW6A 1CLKA 5I23A 3EOLA 3T4WA 3D5HA 3SY5A 3GDLA 3M0HA 2HJPA 3I4KA 2VRJA 4FLSA 1TJPA 3NZQA 4L4PA 3S6DA 3C2VA 2C79A 1Y5WA 2PTWA 3UG4A 3MUXA 1IHIA 3W73A 4UMAA 1CXKA 2FB2A 4Q7BA 3GBDA 1CEOA 2V68A 2G96A 1OC7A 2VTFA 3AHVA 1R6WA 3TCSA 4DELA 4FA3A 4ERGA 4PFHA 1A49A 1BYCA 2AKMA 4O19A 2BV9A 4G7EB 2YZRA 2WVVB 4NYUA 3UWUA 4PE8A 1AODA 3LY0A 4RXGA 2VGBA 4HK5A 2ZRXA 3BQ5A 1UR8A 4EKJA 2W67A 1CZ1A 1OABA 2HNHA 3E0FA 3TXZA 3PBUA 3IEBA 3WLNA 1F4HA 4LNYA 3SCRA 3UPWA 3IWPA 2FFIA 3VIPA 3L5LA 3SIMA 3SADA 3W7RA 3Q4DA 4WEVX 1FWNA 3I7SA 3T0TA 4PBFA 2E40A 1KM0A 1C90A 2NWRA 3OOQA 3GAYA 5DX7A 3WLOA 4LVBA 4HNVA 2V30A 4P2VA 1XH1A 2XWDA 3K1GA 2Z7KA 3SIZA 1ZQ5A 4AZHA 1CYGA 4PULA 1MI3A 3H2NA 2RHGA 3ZT6A 3KBNA 4INFA 2Q8XA 1H0GA 3CBWA 4MNJA 1ZZMA 5A94A 4DBSA 4B9ZA 4K39A 4LV9A 1XLFA 5CPOA 4Z08A 1RQBA 4MWAC 4PUNA 1WDDA 1TPFA 3W87A 5AC6A 5DEZA 1V4YA 1FDJA 4H4IA 4L56A 1GORA 2PTDA 1QTWA 3B05A 4ILSA 1PYFA 1GYNA 4G7EA 1GKQA 5DT5A 2J7EA 3LDVA 3IVUA 1XXXA 2NV1A 4W93A 1X97A 4XO7A 2VEPA 4ZQPA 2J13A 3M46A 1X8FA 1MDRA 1XLMA 1JYXA 3O0KA 3SI9A 1ZTVA 2W3ZA 3W1AA 1HZYA 2ZIDA 4QS6A 2CZEA 3BC9A 3P81A 3DFSA 4OUIA 8TIMA 3N17A 2OB3A 4GNJA 1NDVA 3T2OA 3VOGA 1C92A 2EBNA 2VEIA 4GYJA 3LD5A 2C1HA 3S5SA 5D37A 5JU6A 3NG3A 4C6MA 3AC0A 1L8PA 3N1AA 1CXEA 3CWNA 1TJ1A 1S1RA 2JEPA 4AHPA 2YKKA 2YPIA 4TIMA 2EAWA 3D3AA 1WV2A 1PS9A 2VWTA 4WKAA 3QR3A 3SGUA 2QR6A 1W9VA 2QPSA 4ZXOA 2DVTA 2VOMA 3KVJA 4CVUA 5A2BA 3IUDA 1FCBA 3T09A 3F2BA 4UTMA 3FYOA 5HBFA 4ZB0A 5DMLA 1Y5VA 1B31A 4I9TA 4C6FA 2ISFA 3BAWA 3RN6A 4XZMX 3L5MA 5HJXA 1WKFA 2KAUC 4GACA 1B9ZA 4D6HA 3HQ1A 1Q2SA 4Y8FA 4B5VA 3CT2A 1KQYA 4O15A 3BUVA 2OQHA 3MHUA 3QPEA 1YHTA 4RX0A 1UWRA 4IMEA 2V2HA 1RHCA 4FNQA 4V33A 1E6PA 5AN7A 4U28A 2BP1A 3DXIA 1PX4A 1F07A 4KFOA 2JKEA 2F2KA 4RDVA 2CZVA 1M6JA 4H01A 4NJGA 4JFUA 3EWYA 2F8QA 1Z32X 1N7KA 3GXFA 4BWLA 3UWVA 3SECA 3TDFA 2QPUA 3WLJA 5D2XA 3AQUA 3T4CA 1DORA 2V2DA 3W76A 1VBGA 1YNPA 2NV2A 2D0GA 3H55A 5CPLA 1CI1A 2CWXA 3LZ5A 4JHZA 5E09A 3GLCA 3L4YA 1UPMB 2BNJA 5HPOA 1VIWA 2B7PA 1KFEA 4GYFA 4Z0SA 1JZ2A 3N18A 3W7IA 4Z2HA 4EF8A 2VENA 2X0HA 1XFCA 3W2MA 2R94A 1J8VA 1TSIA 5I3JA 3Q2DA 4Q7IA 4PMZA 1CW2A 5EMMA 3AIVA 3FHQA 1MEIA 3OZOA 4TOQA 1PBGA 4IG2A 2E8YA 1VBHA 3ANYA 3PWIA 4QP0A 2RJGA 2E5DA 1AZ2A 1OFPA 4DZAA 4MF4A 1X7FA 4EE9A 5A95A 3P7YA 3ITGA 1L6GA 4D6DA 1BQCA 4QDMA 3WY1A 2E25A 3AMCA 1TZ7A 1G4PA 2P10A 3R89A 3N19B 2ZUUA 2NSXA 4Y9OA 3PBVA 3SURA 4JTCA 1GYLA 3G2GA 4CLMA 1D2KA 2CHRA 3TC7A 4V1XA 3S5OA 1QPOA 4KCUA 5HULA 3EYPA 4LYQA 4U33A 1EFZA 1LOSA 2OQYA 4UFJA 5T8GA 3QGKC 1ZU8A 4BF9A 3BLOA 2W66A 1OYCA 1PZ0A 4NU7A 2HMCA 1TUXA 3SRHA 4CD4A 1ZBCA 1P0EA 1V3JA 4IMFA 1VYSX 1IWAA 4MB3A 1J18A 3O6AA 2WZMA 1TV7A 2ICSA 4ZTYA 1A5BA 4MY9A 1DIDA 1HO1A 3EB3A 3NVDA 9XIAA 3EX3A 3RO8A 1RH9A 3L7RA 1DE6A 3BQ6A 3UZJA 4Z2LA 3B8UA 2QCCA 2WMGA 3GR4A 3L21A 3OHIA 4YTQA 3LCGA 2DIKA 2FGZA 4I90A 1US3A 2YYTA 4JKLA 3FXGA 4ZOBA 3LTPA 2X1TA 4NNCA 3ABZA 2IW0A 2WJEA 3R11A 1GK8A 1UG6A 3WDPP 2VZTA 3BMVA 4MWAB 2X30A 3JR2A 3RM9A 4C1NA 2JF7A 1ONWA 3PANA 3GDKA 1KR0A 3CAVA 1T8QA 3L68A 1KRMA 4DWDA 1OFRA 4NXSA 3N73A 1TJRA 4FPSA 2J88A 2GJNA 1EA0A 1KR1A 2L5HA 3MO7A 3BJFA 5JQ9A 2QMKA 3CZGA 2VEMA 4O1CA 3L0KA 2OSXA 4EWND 1S2CA 1ECQA 4L61A 1XRFA 1W1TA 4U3CA 2CZFA 3FK4A 5FEXA 2I17A 3GNNA 4NL1A 4AMAA 4W85A 1JR1A 2V38A 3LZ3A 2FTYA 4KWOA 4DNMA 3SRDA 1UZDA 2GSJA 1TIMA 3SFKA 4IQEA 3G0SA 3AU6A 4WVXA 1L2QA 3DIPA 1P0KA 2CW6A 4XKYB 5E9XA 2ZBTA 3VDHA 3EPMA 4RDZA 3LI0A 1AW1A 3RO6A 2J7DA 4B3KA 3T0CA 2V5KA 1IR2A 1S5NA 5F4SA 1B1YA 3IK4A 2X1UA 3LNMA 4QQ3A 3VILA 4CEUC 3EWXA 3BXWA 1RA0A 2CLLA 3LU2A 3OGSA 1DWHM 3OJGA 4GC4A 1O66A 1LLWA 1XINA 3DFQA 3E2RA 1RQHA 1HL9A 4KRTA 2DQWA 1HP5A 2EJAA 3B0UX 2DORA 4PUJA 5JBDA 4MNLA 2PDFA 1XLCA 2J8FA 3VIMA 1YDYA 2PDHA 2WLYA 3UZYA 1ZPTA 3QMTA 4LB3A 4MJ4A 3HMJG 4LX4A 3TJLA 4PMJA 4GBDA 3LG3A 1QNRA 4AIUA 3LMZA 1P0BA 5CPQA 2RDTA 4V1YA 1IV8A 4UTWC 2I56A 3EDEA 4TX6A 1W3HA 1V03A 4KPLA 3WQPA 1A5OC 3M64A 4OOUA 4RZBA 2NT0A 1XQLA 5G4WA 3CM4A 3MJYA 4QGCA 3LHUA 4LBUA 1QU4A 3KBMA 3KDOA 4GXWA 5CH9A 3ZR6A 5FL1A 2BODX 2WANA 3ICJA 2ON3A 3A22A 2PAJA 3DZ1A 2ZA3A 5ECVA 5FAGA 1TRIA 4Q8OA 3BOLA 5HNTA 2XSAA 7PTDA 2V8ZA 4ZODA 3B8WA 4FLRA 5I77A 4LAKA 4K8GA 2GUUA 1W6TA 2QCFA 2XPKA 2SFPA 4B3ZA 2QV4A 3B0PA 4MFEA 3WUGA 3TAKA 4C1LA 1A5MC 1EJTC 2JALA 3L4ZA 2ODOA 4IJBA 4WLCA 2V0TA 1S2VA 3A23A 4GVFA 4E8GA 3KOWA 4UQAA 1ISXA 3GR8A 1Q7QA 4PCFA 5G5IA 2VVSA 1MMFA 4GZEA 3IJ9A 2NQ9A 4PGLA 1H61A 4PCPA 3LYEA 1S2AA 1NOFA 3UD6A 3P61A 3SUVA 3WL1A 3W88A 4QBXA 4DXKA 5EPDA 4R3UA 4C6QA 4PMDA 3R8GA 2OZ0A 4UOQA 4EPEC 2IS7A 4HNNA 1LF1A 2IQDA 1OCQA 3H53A 4P8XA 3VGFA 3BG9A 2DUAA 1U5HA 3GG8A 2DVUA 4Z1AA 2DT1A 4ERIA 3B9DA 3LBMA 3PZIA 1H09A 4WSJA 2ZQ0A 4Q4OA 4DYKA 3V0UA 3WQDA 1XWYA 4X2PA 1X6UA 1H63A 4WF7A 4LUTA 4MJMA 4YWSA 3AROA 4NRRA 4B5UA 1TTPA 4FIRA 3V4BA 4KETA 5M1TA 4CQCA 2POTA 4FB7A 1RUSA 2VO5A 1ZB5A 3NNTA 3PTMA 4Z1CA 2Z24A 3T0AA 2B31A 5JIPA 1RBLA 3N6QA 4DJFD 2YL8A 1XBVA 2OEMA 2X7WA 3N9KA 5CEWA 2QPXA 3QMRA 4EWJA 3AMKA 2BDQA 3WQ6A 1LDCA 4S1FA 3WQEA 1JIBA 3SJNA 1ICSA 3AHYA 2F2HA 2UY2A 3W72A 1L2UA 1FWJC 1GW1A 4UOZA 3LHYA 3H7RA 2NZLA 3LV6A 2WXDM 3SFWA 1JPHA 1L6WA 3P5ZA 5CPMA 1JCYA 2G41A 1I6NA 3KHJA 4GFSA 1XYAA 1O60A 2J66A 3W0KA 2C7FA 4IUOA 2JIEA 2GL5A 4PSPA 3OP2A 3NGJA 3Q94A 1Z9AA 4F0MA 1UR4A 3SUUA 3KTSA 5AVHA 3J7HA 1CB7B 1EOMA 1TR1A 2VX7A 3SSJA 2W5FA 2NX1A 1FWHC 3GH5A 3II1A 1K03A 4DXXA 4GHRA 1P4CA 4WKFA 1E55A 1T6MA 3WMBA 1EF3A 4MOZA 1GOOA 1UKPA 2EKCA 3WJWA 4WR3A 4TUFA 5G1TA 1XCXA 1UP3A 3VINA 4U5IA 2GWGA 1CGWA 2WCGA 1BSIA 2H8XA 1XGZA 1FH7A 2ZZ2A 5J8LA 3WQ5A 2VCBA 1Y5XA 2Y2WA 4J7RA 2VVNA 3MY9A 1QASA 4PYSA 4XAYA 1R3RA 4NVTA 2RAGA 4XKMA 4OBTA 1N55A 2CLIA 1F3WA 3VIIA 2O0TA 4A4AA 4DIAA 4PMRA 3NZ1A 4S39A 3CB3A 4JTJA 2PRLA 3KEHA 3UR5A 1A5LC 4CN1A 3I3DA 3W25A 1SU5A 4AYGA 3MMDA 2QUUA 1IEXA 4LCSA 2HISA 3HTWA 1F8IA 3TR2A 1E43A 2V5BA 1NTHA 3V7PA 4JYDA 2XVPA 4YPJA 2OJPA 1P6CA 4JHMA 4FHAA 3RG6A 3FLUA 4UTJA 3N29A 1FFQA 4W8LA 3MVTA 3H21A 1IE7C 3C3UA 3MQTA 3NQMA 3WD0A 1KFBA 4GD0A 3THCA 4TU1A 4L65A 1I2RA 4JDBA 3GU1A 3HQNA 2FZ9A 3HURA 3AS0A 3DFYA 2OLSA 3H70A 3MV01 3W7KA 2QIIA 4DJFC 3MYOA 3VDBA 2BY2A 4AF0B 2WZTA 4JFWA 3GS6A 3KBVA 1ZS2A 4O54A 3EX1A 3UGRA 4MGGA 3THDA 4ATWA 5A8OA 2X40A 1LRTA 3LI1A 1IWPA 2BX7A 1WQ5A 1YXCA 2EPOA 3OLEA 3DCPA 4GY1A 1XUZA 3S3GA 1J0YA 1C8XA 2J6VA 3G6MA 1TE1A 3UF9A 3DU0A 4A3QA 2E1DA 1FWIC 4DXVA 4KIEA 4ADUA 4HU3A 4H9XA 1SMDA 1E1FA 4HA4A 4E8CA 4I5UA 1M65A 3A9BA 3T08A 1ONRA 4CKQA 3H23A 2WBGA 4CU8A 2OWXA 1UD3A 1OCNA 4ZB2A 3AUOA 1I9CB 5B7ZA 3DI1A 3FXYA 2GVLA 3FDKA 3GD6A 2C19A 4H19A 2EPKX 1LT8A 2EQDA 3REQB 3M0IA 3N3TA 1NM9A 4NRSA 2IPJA 3EA2A 1W91A 1WA3A 4GI6A 3W70A 1L9WA 4DEFA 1PJ9A 3K13A 3QFEA 1YNYA 3T8QA 4AF0A 4AIOA 1H41A 1XLDA 2XUCA 5KZEA 4CQDA 4OU1A 5LNRA 1XR2A 3GDRA 1HGWA 1GVOA 3K4WA 3BOXA 3LQLA 3DC8A 2EJ1A 4BEQA 5K4ZA 1E6QM 4AZ7A 4H8UA 3MSGA 3L65A 4LRSA 1V0NA 3NXFA 5LSMA 1LG1A 3HGJA 1HKIA 4X9SA 5BOFA 4TVUA 1R3TA 1ZGDA 3GRIA 4DJED 1LT7A 2Q02A 4X60A 1TVPA 1XC4A 2ZA1A 4WDTA 1W1VA 3N4EA 1S5MA 2AL1A 1KM4A 4KGLA 1XUUA 5J04A 3RJXA 2E6DA 2PDKA 4RW5A 3IAPA 4PRRA 2WMHA 3P74A 3TMQA 3PWGA 3L23A 3H54A 3FSUA 4PTVA 4DLFA 4QCEA 4UC5A 2BY3A 4JICA 2PD5A 2DUZA 3JZEA 2Y4SA 2QYGA 5C0QA 3GNDA 5SWUA 1TPH1 1KKOA 3K46A 5CPNA 4QS5A 3TTYA 4RE3A 5LZLA 1K7FA 1FDZA 5LNSA 3WJXA 2YA0A 5TAOA 4I5XA 2ZE0A 4ZGYA 3AXKA 3KLLA 2F61A 3I3EA 5HWJA 3WF3A 1ITXA 2WM1A 4S3AA 3GKFA 3ARWA 4XUGA 2ZUMA 1AH3A 3WJSA 3KOXA 3EB4A 1N8WA 3ISIX 2GJRA 1LBMA 1DJNA 1E9IA 1A3HA 4JQ3A 2Y89A 3ZJ7A 5I3GA 2JE8A 3LTSA 2MNRA 2Z7GA 3TUUA 3V0SA 5CZ0A 3CV2A 3G24A 5EFDA 2UBPC 2X1IA 3LCHA 3PP7A 1NEYA 1SR0A 4GKTA 3IS4A 2XIIA 3EWZA 3O2LA 1V6UA 2NQHA 3WK3A 3DYPA 1VBRA 3PK7A 1XSJA 5CC3A 1H62A 5DF0A 4L64A 5EA9A 2AL2A 5BXPA 3QRHA 4YTSA 2G0WA 1NFPA 5KZDA 4HNLA 2R1NA 3TC3A 3QOKA 1UR2A 1K4GA 4Y9PA 2C8NA 3ARTA 2QUTA 4R7OA 5TQLA 1W1B1 3KM8A 1RPKA 3NA8A 4PCSA 3M5XA 1ZJBA 3GHTA 3AXMA 1C3FA 1XH2A 2QAFA 1W3IA 2OGYA 2VDGA 4RCXA 1VBJA 3VNMA 1ECEA 2Z1SA 2WHLA 3W53A 1RCXB 3FJLA 3I3BA 3ZM8A 1H1NA 1W3LA 1Y7VA 3HGSA 4DF0A 1MXSA 1PZ2A 4RE2A 3HJZA 5MF5A 3VKKA 1FX6A 1RJQA 4G7FA 4WXZA 3SCNA 1R3QA 4QRNA 3NQGA 3NL3A 3S2LA 1GVEA 2DSZA 3NQ2A 3W7GA 3G1HA 1THFD 3SCSA 3L4XA 3VNKA 1U30A 1KBLA 1UBPC 2VGGA 1IGWA 1F73A 3B03A 3HQPA 4GYPC 4A21A 4AD0A 4PRTA 1M41A 1P6WA 2QCMA 3WNOA 1X38A 3ONCA 4DJEC 3AHTA 3OBAA 4JKMA 4O52A 1L6YA 2A0NA 4MYXA 1DXIA 1KTNA 4Q4SA 1SO6A 2YX0A 4NT0A 4LEFA 1S1PA 3Q45A 1EIXA 1KQZA 1D8WA 2CCRA 3CUIA 5BXSA 4DUWA 4JIEA 4RE0A 3B9EA 4FK9A 5A6JA 3DDMA 2ANUA 2HTMA 2PLCA 1VEMA 3GX9A 2D73A 4DWSD 3A24A 4TXEA 2R6OA 4D6GA 1J01A 1UOZA 3E9AA 3GKAA 1GEHA 3GAKA 1PZ3A 4O10A 3G8RA 2ZUWA 4IGNA 5CG7A 1I2NA 4G8TA 4HCHA 4UNKA 1O95A 3FKRA 1GOMA 4GMEA 4JTTA 4Z2IA 1WDQA 3A47A 3VPLA 1OX6A 4Q8TA 3MCNA 4LYKA 4YTUA 1DIKA 2O7SA 2G3MA 1BPLB 5CBJA 1FCVA 1HFBA 1EBGA 1H7PA 1W3JA 1CGUA 2YDSA 2Q8ZA 2QHAA 4CN4A 2OELA 4CQAA 4J3VA 8A3HA 1BVNP 2PWGA 1HO4A 1KGWA 2A3HA 4LS0A 4AD2A 3WLHA 4GC3A 4O12A 2Z25A 1V51A 2INZA 4ATDA 4F0LA 2FZBA 2P0OA 1BTCA 3QHOA 1PKMA 3NL6A 2VELA 3F5JA 3TYDA 3CXOA 3H6OA 5H8UA 3ABQA 2EXOA 3NXLA 4CNUA 4M6UA 4Z2GA 4C6DA 1UWIA 2HBVA 3CU2A 2HEJA 1MO0A 3W6LA 1OGSA 3HPAA 4CCCA 1VEPA 3IARA 2CNCA 2BXZA 2P8BA 4H6EA 2CZDA 4KS0A 1DYSA 3T81A 2VD9A 3OIHA 3R25A 4EACA 4FLQA 4Q33A 3C0LA 4JS3A 4IGMA 1XD0A 5DN1A 3A3HA 4K7VA 1POKA 4PA8A 3DI0A 4C6EA 1XIIA 1UR1A 4YU1A 4DUVA 2E9LA 2QS8A 3H2EA 4GLEA 3UR2A 3TZFA 3O6YX 2DEPA 3QEZA 2WOQA 1LUCA 5CJNA 2R1KA 1KD0A 3URBA 3PUGA 4O4WA 2FH6A 3G77A 4IL0A 3AALA 2WHJA 4AZGA 1Q45A 2DVXA 2YCLB 4BY3A 4OZOA 4AFYA 1FP9A 1T5AA 4Z2KA 1ZHAA 4IPNB 3BPWA 3IJ6A 4DF2A 4GQGA 3HF3A 4O53A 1W2PA 3U9IA 1R0MA 1YDOA 2WKGA 5GPRA 5IXEA 4DY1A 1RP8A 1LL7A 1OADA 2OO6A 1YYAA 1PPIA 1JNDA 4F40A 6ALDA 3C0SA 4LV4A 2QCHA 3UXAA 2YW4A 4YVVA 4O13A 4A6GA 1VFOA 3R94A 4HOZA 2BOGX 1VFUA 4HPNA 4HYRA 3TV8A 4IPJA 1PB0A 4PRWA 3K8LA 3UNTA 5G4EA 2NVDA 2WQPA 1L6SA 1YPFA 1T8XA 3QLLA 1X8CA 4LAUA 4WJXA 4GY0A 1VLIA 3JUGA 4MZ1A 4LFYA 4MVAA 1TCDA 1TJ0A 5A3HA 3FJ6A 3L2IA 4XZLX 3TSDA 1E73M 2VD8A 2A3CA 4L4OA 2WNNA 3ANUA 2YSWA 3TC6A 4ZO8A 2H9AB 4S3FA 3T55A 2DT0A 1GQJA 2VFDA 5IRPA 3VGBA 4AVNA 3QY6A 2GVJA 4LF1A 4RNHA 3AFBA 1VBUA 1X96A 2QCDB 3CL6A 3UETA 3AXXA 2E6FA 3N12A 1U2YA 3IGUA 1QXLA 3P8JA 3ZLHA 2OODA 2DW7A 3KRUA 2YYUA 4HKPA 3CUZA 1MVYA 1HJVA 2YCLA 1W54A 4XK2A 3QR0A 3T6CA 3WNKA 2AQWA 3W07A 4C7FA 4OGZA 2J77A 4DPQA 4AB4A 3TJXA 4YVXA 4TTUA 2CLOA 2OGJA 2PCQA 1RCOB 1R9ZA 5RUBA 1NELA 1HQTA 1E0TA 1YTDA 4ONVA 4H2CA 4TX8A 4IIDA 1TMLA 3DFHA 2XINA 2YW3A 1RSCA 3HFYA 4EOUA 1PL9A 1MEWA 2GPTA 1VJIA 5TNVA 2ACRA 1R87A 1QOPA 3DOPA 1OG6A 4KFNA 2VJXA 3W2LA 3EA1A 4DRSA 4Q4PA 1XKYA 4IFKB 1DQXA 3LXAA 1ENUA 5D38A 3NQAA 1WB0A 3LCXA 3ARXA 4LY4A 4ZSTA 8RUCA 3NQCA 3VK5A 1ADSA 3ENLA 1LBFA 5HNUA 3A21A 2VRQA 1EUAA 3DHDA 4JDYA 1TFVA 1ZY9A 4CD6A 1DJYA 2H9AA 4EF9A 3Q37A 1P6BA 3CQJA 4KF1A 3WQ8A 1DIEA 5G1MA 1WYIA 2VR5A 3DX5A 4DM2A 1PUDA 1TG7A 3P0WA 1FHVA 4ZOEA 5CXPA 4MWAE 1W9BM 3MKKA 3MZNA 1PTGA 4FXFA 4GRSA 4D8LA 1PAMA 5K2ZA 3AZSA 3PZUA 1VEOA 2IMRA 2JK2A 3GNOA 4AD5A 5FEZA 2PLKA 1XS2A 2P1FA 1FWSA 3A4JA 3AWNA 4L80A 1Q7MA 3TTQA 3ONBA 3ITXA 3FN9A 2PBGA 2PMQA 4X63A 4YS1A 1BG4A 2QUNA 1HG3A 5A6AA 2WSYA 2PDMA 3ARUA 1KBJA 2GJXA 1PX3A 1KFWA 3SCWA 2JGQA 5JBFA 1NOWA 4HOWA 5EFFA 2HS6A 1SFJA 4MNKA 4C6IA 3L2MA 4ES4A 3GBEA 2Q3OA 3QQWA 4DJEA 3PB0A 1XIFA 3PUOA 3FNDA 4NJJA 4IFKA 1EJXC 4LTSA 1PIIA 4HHPA 4M51A 5F4WA 4M8UA 4I5RA 3HA1A 3RXZA 4ZE4A 2IUZA 1JRBA 1J4EA 5LGXA 3FY1A 4YMZA 3WX7A 2QVHA 3S1WA 3FYYA 3S46A 4US5A 4C91A 4FS9A 2E9BA 3KHDA 1B3YA 3FYPA 2NUYA 5BWAA 3W7MA 2CFFA 3SAZA 3QJAA 3RDKA 4O50A 2WVTA 4HBKA 4DO4A 3MP5A 3WDHA 4RW3A 1U5VA 3FOKA 3WQFA 1VC4A 2XHYA 3DKJA 4O1FA 3PZVA 3S1XA 1VP5A 1AD4A 2YFNA 4PMQA 2ZVIA 2XZ7A 3G1RA 1FKWA 1QR7A 1OFDA 1IF2A 3WK2A 4JY8A 2XFRA 2GGEA 2ZZ1A 4DAIA 3IK2A 2Y8KA 4WHBA 4OTKA 2DPEA 4BQ3A 4ZL1A 1TJ2A 3FEQA 3VNYA 4JPGA 3LM7A 1LWHA 4EVZA 1DE5A 3GHUA 3U6WA 3G8EA 4PL2A 3BAIA 1PWLA 3IIPA 1XW8A 1A5UA 3VOFA 3M5VA 1P5BA 5FIPA 4W7WA 5CZKA 3LPFA 3G1YA 1J6OA 2PDGA 2VOTA 4JR5A 4D1IA 1CX9A 3QGAC 1JAKA 3UEQA 3UCQA 4RNFA 5DCDA 3XISA 5B7YA 2PWUA 4B90A 1KBIA 2A2IA 3K2GA 5GNZA 3APYA 2WKLA 4O16A 3ZMRA 3BLIA 1YW1A 4BQ4A 4QJ3B 3WH8A 3BH4A 3VU2A 2D3LA 3B97A 2WPBA 4GQBA 4ASTA 1BG9A 4OT7A 2AQVA 2G3FA 4H9ZA 3WELA 2XDFA 2GOKA 3IIZA 2A3EA 4DNHA 3IGXA 3VE9A 1DJQA 3E2SA 1TKKA 1E56A 2XN1A 4DJDD 4GA8A 5I3KA 3WDQA 5DBUA 1GOWA 4O1BA 1B90A 1EC9A 4PSRA 3VM7A 5I79A 2J7GA 3WYZA 1GONA 2J79A 2KX9A 2PDPA 3GXDA 4JN7A 1DJZA 3GXIA 3SDOA 3S2MA 3ATYA 4GI4A 1QAPA 2Y62A 3AIWA 5A6KA 1RP9A 3FFSA 1A5NC 4S3JA 4US6A 5A8MA 5CSYA 5A69A 1QATA 3RU6A 3U5UA 3UXDA 2DZVA 3GZ3A 3QZEA 2Z6IA 1M53A 5C9XA 5HUOA 4ZMGA 3C2FA 3QFWA 1BXCA 3CL8A 3CUGA 2CBUA 4EIVA 3UQNA 1UKQA 4KCVA 3GSMA 1XD1A 1E40A 4FLOA 3TTEA 1P0DA 1MWOA 1CXHA 3VABA 4MB1A 2QV5A 3SY1A 5CLTA 3VKAA 4AY8A 2XWEA 2HWGA 3NCOA 3VUSA 2W61A 5D9OA 3TYAA 3CPGA 5FJRA 3W84A 7CGTA 1K8XA 4GQRA 3NPVA 1EDTA 4PC8A 4UB9A 2PDXA 3JW7A 1O1HA 5EYWA 2B81A 1XLEA 1YLVA 4M19A 3TZNA 1C91A 1VFMA 3C8FA 4YHGA 1AMYA 1QBBA 3GE7A 1K3UA 4ALDA 3A5VA 2PDLA 1MUCA 4YN5A 4Z17A 4DLMA 2O56A 3SO7A 1EO7A 2AAAA 1IEVA 1F3XA 4JEQA 3IUHA 1GVRA 2E8ZA 3WUEA 1G5AA 4RDWA 3URAA 4M24A 2FH8A 1KCXA 1TV4A 3UG5A 1HF6A 1TWZA 1ZLPA 1A0CA 2PS2A 5D2TA 3LHVA 1R30A 1ZBVA 3AU2A 5E6YA 2ZZ6A 2QULA 5FF4A 3VAVA 1XGEA 1OY0A 2C13A 4RKAA 3BSHA 1LM1A 3EXSA 5ABTA 1BRLB 3QBUA 5JH1A 1H7NA 4L9YA 5HWMA 1DJIA 4LC8A 2ZICA 3HN3A 4AG0A 3HOJA 2Y8UA 4B5WA 3GH7A 3AXHA 2GDUA 1IT7A 3D3FA 1VS1A 4YXGA 1KCKA 1H0IA 1YPXA 3F7JA 1J11A 3W75A 4EPDC 3WLPA 1HJQA 2D3NA 1UWAA 4DJDC 3CS2A 3RM8A 1XLAA 3UU0A 3UZZA 1JG9A 3EWDA 4C1KA 5I78A 3W2UA 1I60A 3CLWA 4AY7A 4H3DA 1TVLA 3QF0A 2CLPA 4D8ZA 1DWIM 2XFFA 3TOPA 2EHHA 4O14A 5L6UA 4YYCA 2CXGA 3WD2A 3U48A 2NQ5A 1QHOA 3IIVA 4DZHA 4Q8QA 4QG9A 1OQFA 2WC4A 3SEPA 1JCJA 3AZRA 1LOLA 4W9TA 1V02A 2I9EA 3I7QA 4AWUA 5CSUA 1BGAA 2XVNA 4LOCA 4JY9A 4IP4A 3UXKA 3V0TA 2R24A 5HJYA 1RZMA 2EF9A 3R8RA 3W7CA 4MNMA 1B3WA 5FACA 4F66A 3I6RA 3UG8A 1PTAA 4ZVJA 2BTMA 3QW4B 4B2DA 2A3AA 1W56A 5EB8A 2XM1A 3HZ3A 1B3VA 2VZOA 2PWEA 3ITYA 1TPWA 3B04A 1RBOB 1A5AA 2WK2A 4KWVA 4UFIA 1ONXA 1NARA 2TPSA 5D8ZA 6REQB 3TR9A 2G3JA 3NUKA 4C6NA 3IV8A 3GFXA 5D03A 4QROA 4WY0F 4GUHA 2G4FA 3CJPA 1IZKA 2LLEA 2CU0A 2GVEA 1MW3A 3EOUA 3B3DA 5HNNA 2NX9A 2YA1A 3KRZA 2W79A 5KTLA 4PMYA 1SFTA 3BURA 7ENLA 3I6EA 1VCGA 2QW5A 4MDOA 4HU8A 2J9YA 5GVJA 2NLYA 1BEUA 5REQB 3APGA 3AWOA 3WNNA 1W8SA 1EDQA 1XKJA 4IFRA 3R7MA 3UVAA 1N82A 2VQTA 1OCBA 3P93A 5HQLA 1OINA 1AH4A 3H2CA 3N11A 4JAWA 5D9NA 5IBXA 4F2TA 5C9RA 4MM1A 1GJUA 1B0IA 3VFLA 1ADDA 1F3EA 1XYZA 4P61A 2J9XA 1XH0A 1B9BA 2DH3A 4X2RA 3G1XA 4R85A 2FJUB 2FPVA 2G4JA 3TOYA 1FWBC 4JTRA 4MIMA 4IICA 3KOYA 4KCTA 4PEKA 1TMQA 3NQDA 2BVTA 3S9YA 4P7NA 1O4UA 1GT8A 3MC5A 3OZYA 4ROPA 1UH3A 1Y8BA 3UWEA 4JFVA 4IIGA 4BA0A 4DN1A 4PN2A 4XAPA 8CGTA 4FMVA 3LRKA 5DBTA 1TPEA 3UY8A 5LKYA 1FA2A 1B2YA 1DHPA 3V75A 3LCFA 2G37A 2Y7GA 3FCPA 4JIPA 1XX1A 1FDYA 3UG3A 1P7TA 4PUDA 1FWGC 5C2GA 1JYNA 4J5NA 3NYZA 4YTRA 1AW5A 4N6EA 1KXQA 4DF1A 4NIRA 2ZX8A 2Z6JA 3I4EA 3IJ8A 4IOTA 4A8LA 4UTTC 1FXPA 2J7BA 3OVPA 4E2VA 3VIHA 4PMUA 4CU6A 2OR2A 2ZRUA 3RCYA 1W1IE 7REQB 3R10A 4J3ZA 3EKLA 5FF7A 1S5TA 1TIWA 2QCGA 1XLGA 2ZRWA 3L67A 1GNXA 4TMBA 4UFMA 1Q4WA 3VXGA 3UZXA 1XBXA 1Z44A 1W9UA 3PPFA 1EDGA 4ZB5A 3THQA 2A3LA 4KWSA 2X0SA 1VFFA 3NIYA 4ZA0A 4WXYA 1OWQA 3CHVA 3ORWA 4JNYA 4A2SA 4M81A 2WJZA 2UY3A 3W3OA 4DO7A 1ISWA 2FLIA 3VI2A 1QNVA 5LA2A 3CPRA 3BARA 3G1AA 5LIUX 1Q2RA 3CAKA 4KMQA 3PF3A 3T0BA 4NUWA 4QFUA 5D32A 1PSCA 1W1PA 1EP2A 1MXGA 2R91A 3AMDA 1KNWA 3KWSA 2CITA 1RALA 3PN8A 1UC5A 5KMYA 1JYVA 1RVGA 5CSSA 1GUVA 2YXOA 1EOKA 4JTLA 3N2TA 2D2GA 5DCBA 3DKLA 3EOSA 4BZYA 2J7CA 3QYQA 3QZ6A 5HR6A 4LW7A 3CEPA 1NF7A 5G2WA 2HPIA 4UOJA 1V6VA 3MW7A 1EQCA 4E6MA 3CHDA 2ZXBA 3CQHA 1F4AA 4QG6A 4I8DA 1WDWA 1POJA 4FF7A 4XAFA 4XIMA 1KA9F 1ME8A 5BYWA 3VTRA 1ADOA 1H49A 3NDYA 4I9AA 1NFBA 3BW4A 3C2YA 3IJIA 4FAMA 4WKHA 4DZIA 2GDQA 3R43A 3QVQA 2EPNA 3VZXA 1WZLA 1XF0A 4V27A 3V16A 4O4VA 2INFA 3T7VA 1C8QA 5IFPA 3GUWA 1REQB 1E9ZB 5IOBA 1VB9A 3N2CA 5DXXA 3KS5A 1FKXA 1ZNNA 4IL2A 3M7SA 3UGVA 1FXQA 3HU7A 4FNTA 2WB5A 3DGRA 1H7RA 2YCKX 3B8VA 2ABAA 4GZIA 1QI4A 2EG7A 2PP1A 4DJDA 1WBJA 3DFPA 1O5RA 4RPQA 3VDAA 4OOZA 4Y9AA 5ENLA 3LERA 1MZHA 2A7PA 3MB9A 3CHCA 3QW3A 2VZSA 3WD3A 3LRLA 4PTXA 3ZVIA 1OHLA 1JZ7A 1K9TA 4IQJA 4MDPA 1UZHA 5HQEA 1SJBA 3PG9A 3BGGA 4JBRA 1M7OA 1UIOA 4YCPA 3ZIZA 3MP4A 4RZ5A 2TYSA 7A3HA 4PMXA 3LK6A 3MI2A 2XIMA 2YLLA 3FKKA 4FF5A 2OQLA 3R1ZA 3SUTA 4ENLA 2PWDA 2CPUA 1I8JA 2I5GA 2PDIA 2W4XA 4R9XA 4MLJA 1NWRA 3HJEA 1V93A 5KEZA 1E0WA 5FJOA 3MWAA 3AJ7A 3BCDA 4ZE5A 1RY8A 2CESA 4A35A 3L4UA 3O06A 4J35A 4ZXLA 3PZGA 1D3GA 1XLJA 1S2TA 3CV1A 4LUJA 4X61A 3BO9A 4LPCA 4PUUA 1ME7A 4PCTA 3BGAA 5BU9A 3RLGA 4DUXA 4KEUA 4MAZA 4MLRA 5CG0A 5CAKA 3H4XA 1S3HA 4JD4A 4XX6A 2YJQA 4RZ6A 3B9OA 1CDGA 1US2A 1DV7A 3SGZA 1BTMA 2PTYA 1TPUA 1RBAA 2R82A 1WXYA 3PY2A 1MNZA 4IF2A 3VNDA 2QGYA 2QXWA 3KE0A 4QLLA 4B5TA 2D0FA 1SZEA 4ICMA 3STGA 3NSMA 3GU9A 3GG7A 4LAZA 1D7KA 1JCLA 3HPFA 2F9RA 2QJHA 4F2UA 1OD8A 2HXUA 4MB4A 3LHTA 4AXNA 5DLCA 3P8IA 5CGTA 4UQEA 4A8IA 5IHSA 1NP2A 2BOEX 1S3TC 3PPHA 1JFHA 1U1HA 4YIWA 3TU9A 3VM5A 1EJWC 2FQIA 1H5YA 1QBAA 3NSXA 3A3WA 1D9EA 5G1YA 1I0DA 2PWVA 2E67A 3UJFA 4J27A 7TAAA 1XISA 1TPVA 2Z00A 1EJVC 3RM4A 3PG8A 2V3EA 3TH6A 1MRAA 3H7UA 3C86A 2IQTA 1RPXA 4LUSA 2QF8A 2PI6A 3CZLA 1PX8A 1W1ZA 3MUY1 1OSEA 4PUWA 4C60A 1LWIA 5CZTA 4Q4MA 4GO8A 1H4PA 4W8BA 4GX9A 4FSAA 4A8NA 1VH7A 4Z1YA 4LVFA 4F79A 3VGEA 3W1NA 4HTYA 1W5OA 1G6CA 2Z2AA 3W24A 1XC6A 5DXYA 3RPTA 1B54A 3WDRA 3EPNA 3OODA 5A8PA 4NZJA 5EY5A 4O18A 1CGXA 4UIOA 4G6CA 4KEMA 3C2EA 3VOCA 5I09A 2WVSA 1TVNA 3KAOA 4IXXA 1Q65A 4F0RA 5DQPA 4HK6A 4GQQA 2G8ZA 2G50A 1PHWA 5HA7A 1QNQA 2PDWA 3A4AA 2DUXA 2I16A 2I57A 3R79A 4ATLA 2FDMA 4GIAA 5A2AA 3OVGA 5G2HA 1H11A 3IRDA 2W62A 2F6XA 4UTTA 4E4UA 4DBWA 1IT0A 3KZSA 1C7TA 2GQ3A 3GIPA 4S3KA 1C29A 4CCDA 3CZKA 4GJ1A 2OCZA 1FHDA 4LANA 4J2MA 5I6SA 1JJKA 2RH9A 1A4LA 5BCAA 1UW9A 3O0FA 1R2RA 3NJ3A 5ABGA 2FHCA 5D02A 4Q6XA 1OJXA 3DHUA 2FMNA 4DUOA 1N8IA 4AC1X 4JN8A 3QV7A 1E4LA 5LIYX 1KM3A 4ZR8A 4R53A 3VC6A 2C6QA 4PL1A 4TTGA 1SJDA 1TX0A 2HK0A 2WCSA 5AHIA 1V3HA 3WLIA 4JTGA 2WZEA 3SRFA 4EP8C 1MEHA 3GM8A 3KVKA 4UFLA 1M7PA 3UZWA 1XLIA 3NO5A 4POCA 3WIJA 5CBBA 1KXTA 4AMCA 2Z1VA 1K70A 4UR7A 3P62A 1GQIA 3NL5A 1TV2A 3CH0A 1WO2A 2Q8LA 1HKJA 2VEGA 2CKSA 5HANA 4I7UA 2BHYA 4ICNA 1WP6A 4HSOA 1ZJHA 3WSUA 4H9VA 3T78A 5EMUA 5U4NA 2BGSA 2OEJA 2J74A 3C3NA 2WNZA 3QOMA 1ZP4A 2QLYA 3WNLA 2DW6A 1L0PA 2O9RA 2XZ9A 5CGQA 2ACUA 3BJTA 1ML1A 5TF0A 2VXNA 4J4KA 3MDWA 3T0DA 1EEPA 3DERA 1GG1A 1G0CA 3NDOA 5C2CA 1AA1B 5FEWA 4PMNA 2I14A 1WKEA 5EKYA 2OXNA 6PTDA 2WMJA 2RDUA 2VKZG 3ARRA 3AYSA 3GC5A 4HMCA 1E5NA 4P7QA 1JCMP 4XZIA 1GHSA 4GH1A 3E3HA 2QDGA 5AC4A 4FNSA 2ZZ3A 4IIFA 4PB4A 5IDZA 1Z89A 3FA3A 4A3RA 3P14A 2O4MA 1D3CA 2PURA 1Q63A 2GYIA 3PUDA 3VIKA 4HVXA 3UXIA 1JZ4A 3CQIA 3MUIA 3NEHA 3M0MA 1V0KA 2GUBA 4W88A 3GVVA 3UT0A 2XN0A 4ROQA 4IWWA 2DZWA 2VGIA 1O68A 3W1QA 6A3HA 4PTWA 2VFFA 4ACYA 4RJEA 1SZGA 4Q8WA 2QUVA 1R3VA 3FSTA 1C8YA 2EPLX 1BHGA 4C5YA 1ICQA 3QV8A 2QCEA 3LTYA 3W2JA 4NKCA 3RK8A 2J6XA 2VC7A 3BANA 4ERAA 2XTKA 3I6TA 1EEXA 1SSGA 2D2JA 5D2WA 1TRDA 4MMWA 1X6NA 3VZYA 4HZMA 1NWTA 1FWEC 1J2BA 4FO4A 4LUYA 3VIGA 4WD0A 1O1ZA 3UA3A 1DTNA 5LNUA 2YLAA 5LNWA 4GE8A 1GKPA 4MZYA 1IT8A 3UYIA 5HUPA 1LP6A 1W9XA 4V28A 1XDLA 4MSSA 1MNSA 1V77A 4YVPA 5FJIA 1MQRA 4IG2B 4J3WA 2PDCA 3V1HA 1XM3A 2HK1A 3GWQA 2WNWA 4PTMA 5A2CA 4NAEA 4UFHA 3WLRA 1Q6DA 3GXNA 5M5DA 1WOBA 3M1ZA 1KWGA 3TCEA 4QE4A 4H7ZA 4S3BA 1E51A 2GGHA 2BVDA 3PFMA 3G18A 4WGHA 4B91A 4N9EA 3WD4A 1EXBA 3U2EA 3EWCA 4M0XA 1VIZA 3MWCA 3OQ8A 3VCNA 2W0UA 1J2WA 1UMLA 5A6MA 4XIAA 3G0UA 3U57A 3CC1A 4QJ1A 2X16A 3E0WA 5M3WA 2DU2A 1SZRA 2QDEA 1V6XA 2WSQA 4B5NA 2BWGA 4MKSA 3HBLA 3KTXA 1Y65A 3C6CA 4KEVA 3SN4A 1R2TA 1Z41A 3RJYA 5A8QA 5K3VA 3T9PA 4KRZA 4U2ZA 1E9LA 4FZIA 3W26A 3D6NA 1E6SM 1OF6A 3AHXA 3LSBA 5F2MA 3E5PA 1XI3A 4U5KA 1VCVA 2XU2A 1T96A 3M0JA 3NQEA 1GOQA 5KINA 2PDUA 2ZOXA 3OG3A 4XSMA 4JTAA 1IR1A 4AIBA 1ZJIA 3RRXA 4C1NB 2HVOA 3GNRA 2ATMA 4PUMA 3DBNA 3F4WA 4IJCA 1H51A 2YDQA 2PP3A 3AZTA 3OB8A 4CGTA 1ZL1A 2ZCGA 1KGUA 3R4IA 2DZBA 2DSVA 3O1NA 2WMIB 4W8AA 5BWFA 4LBSA 5HAOA 2CLKA 2VMFA 4O28A 4QNWA 1V3LA 3TJ4A 4HA0A 3CNYA 2RGMA 5K9DA 2J24A 1OGGA 1KTCA 1K7EA 3QC3A 3M0YA 3NO3A 3NQ8A 4XD4A 1TPC1 3HV8A 1FWDC 3I7RA 2Y5SA 3M43A 2JFEX 3DFNA 3KVMA 1RK5A 3B0VC 2BGQA 4LVAA 3KOZA 4XO6A 5CJ5A 4LALA 1TWDA 4W7VA 2ZC8A 4CCZA 3TWAA 4IH3A 3MKVA 5A6SA 2ISSA 2G95A 2OSWA 4H00A 1DJGA 2PTXA 4Q32A 4WQ6A 1TPB1 3IUIA 1EF2A 3WEZA 4K36A 3NURA 2CYGA 4Z1DA 4HPJA 4XBJA 3U4FA 3UFYA 1GZJA 2GQAA 4J3XA 1F74A 4PBGA 3VNIA 1W37A 3F4VA 4Q4QA 2VX4A 1K7XA 1NOUA 2X1RA 4JL2A 1JPIA 3ALGA 1LL6A 3BDKA 1D7FA 3WQVA 3GVWA 1MUWA 1N2VA 3RU8X 3U7BA 1Q3NA 1UJQA 4G1NA 3UESA 3AHZA 3D47A 5AC8A 4FOJA 1W31A 1CLXA 4W87A 3WFZA 3KRSA 2DY3A 1VZWA 2YB4A 4NG3A 2J27A 1TR9A 4GUJA 2C1GA 4M7SA 2V67A 3VOIA 1CBGA 2WMIA 4H7VA 1M5WA 1E1EA 2I9UA 1JZ3A 1JI1A 4OWGA 1IZCA 1ODUA 3TJIA 4C6LA 3TFCA 3CZEA 4LJ3A 5FF2A 3HG5A 4FX8A 4WK9A 3KZPA 4FOKA 1NH6A 2BXYA 3VD5A 3BK0A 3NL2A 1RD5A 2NQJA 3N34A 5T9BG 9RUBA 1FWAC 2DZPA 2QDDA 3NPUA 1WDRA 1X6LA 4IQLA 5JMUA 1CB2A 1LQAA 1S2UA 4LVDA 4IFOA 1KRBC 4QAWA 3N3MA 1JRCA 3CQ0A 3EX2A 2FZNA 4OV4A 3PBGA 2NXHA 3GO2A 8XIAA 1E71M 3GB6A 3WF1A 5I07A 3TTOA 3DG7A 1E6RA 3O6CA 1VJZA 2IQ0A 3VNLA 4Q8VA 1QNSA 3GQYA 4IMCA 4D2JA 4GZJA 3W81A 3TSMA 1FFRA 3EWWA 5C9WA 4HPGA 5HATA 1E6XM 4H7CA 3MHFA 3FGCA 3F4DA 4MADA 1F9CA 1W9DM 3RUBL 3ZO9A 2GVGA 4PH6A 1UUQA 1MW2A 4R7WA 3S0CA 1W2VA 3BV4A 1IXPA 3U2CA 1WXZA 1VHCA 3FJNA 3HQOA 4QM1A 1NDWA 3V5OA 1B3OA 1UR3M 4AH7A 4HNOA 3V5CA 2C15A 1GGOA 5EL1A 2FTWA 4UZUA 2V5DA 1JYWA 1XSIA 2NT1A 1E0VA 1WUFA 3KCJA 3WLLA 2D69A 1ZAHA 3OEXA 2B7OA 4MFDA 5HMFA 4XWUA 4LUTB 3V5FA 2B7QA 3WH7A 4MPKA 1HXJA 3EDJA 3CUFA 4K37A 3WFAA 1MFUA 3IJ7A 3TN6A 3P82A 1XPGA 3M0XA 4WZHA 1Q6EA 1EPVA 1UP0A 2BZNA 4Y7EA 2E1WA 3AO0A 5BROA 3MVIA 2NQZA 1EL3A 3H24A 4L4MA 3CL7A 4UUIA 3O9NA 2UV8G 1CPUA 1DVJA 3UR8A 1IQ8A 1BGGA 5GQBA 2G5WA 4C65A 4KESA 3LQGA 4MHBA 2JKPA 3FEMA 3GIQA 3U2OA 3VYLA 2RKXA 1BWLA 4S3GA 3K8KA 1KRAC 4KEZA 3SR7A 5LHEA 1ODZA 9CGTA 2VFIA 3BLLA 3B40A 3WDJA 1VPQA 2HPMA 4GX8A 3RRAA 5AYYA 2ALRA 1XRTA 2CLMA 3UJSA 3LN3A 5FJJA 3VKDA 1GJPA 3L4TA 4C6BA 1UD2A 1DQWA 1R5YA 1RQEA 4E5TA 3U2ZA 1SFSA 5D09A 5EBAA 3B9AA 1PO9A 3LNPA 5AY7A 3A9IA 2UY4A 3LOTA 2BBFA 1QPKA 4AU0A 3CV6A 2PU1A 1FWRA 1J5TA 2CHOA 3L2LA 4R88A 1JXKA 2VR2A 5J5RA 1K9FA 3RX3A 4WSKA 3NTYA 4HNTA 3RX4A 1E9YB 1FH8A 1X1NA 3WJYA 1DJHA 5F7UA 4DYEA 3COTA 3AXIA 4GXMA 4LB4A 3VCCA 1LTDA 4G56A 2HDJA 5D33A 4TVCA 4F4RA 2Z2UA 3PTQA 4FXSA 4O0ZA 4OIFA 5LIWX 3O6DA 1JDEA 1EYWA 3VIFA 4FR6A 3H2AA 1UMYA 4LGXA 4W7UA 1J0HA 1BXNA 1TTQA 3PNUA 4O17A 1HKKA 1XJBA 1G4EA 2VC6A 2WWDA 4IP7A 4AX6A 4BEUA 3UVIA 3BAKA 4H8NA 2GQ9A 1IEWA 3W28A 3VKCA 4I7WA 1KM1A 2O9TA 3GHRA 3RGTA 1MFVA 1TX2A 4RE4A 4DM1A 3TIMA 3KOFA 2JKAA 2ZDSA 2OLHA 1C7SA 1V7YA 4MKNA 3XIMA 5F1UA 3RLHA 1DWFM 1LORA 5TD4A 1DIOA 3BG5A 3EKZA 3DFOA 1JDAA 2GK1A 3QSRA 3GHSA 3ECQA 3WLSA 2BHZA 1EJRC 2W63A 2B0MA 3T44A 3FIGA 2ZUSA 1QW7A 1WXJA 3WBAA 2ZKMX 3SN0A 3RLUA 1HKWA 3H7VA 1XGDA 1C9WA 1C9DA 1FP8A 1KKRA 1MZRA 4CNPA 1NIUA 5JUVA 3GFYA 2MUCA 3GNXA 4ZOAA 3DESA 3EZ4A 4AHOA 1F7BA 3W85A 3DFTA 1XIGA 4AZCA 3GDMA 3SQLA 3F2CA 2OT0A 4BF7A 4JTUA 2V6AA 5F2GA 5HWNA 4ORIA 3MUCA 1WCGA 2WQDA 4IJRA 3VD9A 2PLMA 6TAAA 5DCEA 2Z26A 1W3NA 4IXHA 2ZRYA 1FUYA 4H2HA 4EK7A 4QCFA 1TWWA 5T9CE 3W7QA 2WMFA 3S2JA 1MW1A 4JQ1A 1BD0A 3LCIA 3APTA 5L9FA 1ZFJA 1CECA 4UTKA 5HMDA 4HN8A 4CUCA 4H9MA 2Y7EA 3MBFA 4FR1A 5DO8A 2BB0A 3MCMA 3POHA 2Q71A 1QPNA 1R2SA 3SUSA 1Q4NX 1FOBA 1S38A 2ZTJA 1FWTA 2VCAA 3TONA 4O1DA 3U4AA 4W4QA 4R27A 5E5CA 4FIQA 3IIXA 1BWKA 2BXVA 3W86A 3LRMA 2VM8A 5FL0A 4XUYA 3GY1A 3H8AA 4KFPA 5AB3A 2OVLA 5BU6A 3WFLA 2OYLA 4MB5A 3AJXA 3W7NA 3S47A 1BKHA 1EBHA 2D2HA 3W29A 5XIAA 3RR1A 1MRQA 1TV8A 5KITA 3OBEA 1KLYA 3BMWA 4HSHA 2YCIX 5A8GA 2DZXA 5CQ1A 3FJ4A 2QVNA 3LGGA 4BHYA 4B92A 2NSOA 3WG6A 1GVQA 1W5MA 4NZ5A 1GVFA 1Q6LA 3GXPA 4UTFA 3RAOA 1K4HA 4CQBA 3PZMA 3SUWA 5HR7A 4JGDA 5G4HC 4LXFA 3VDGA 4OBSA 1TQJA 4MTVA 3TQVA 1T41A 5FA5A 4ZQOA 3M5YA 4FI4A 1LOQA 4H41A 2VX6A 1H1ZA 4C7DA 1HL8A 1TO3A 3TW9A 3SCVA 1YE4A 3IVTA 4WSHA 3W83A 2BS9A 3QV9A 4E2OA 1YXDA 5TBOA 4BK9A 4HT3A 4A2RA 1CGVA 1OT1A 2Y70A 4E4FA 5FKYA 5ABFB 2ASHA 1JD9A 1A5CA 4REQB 1Q85A 2V3GA 4F3HA 2V5LA 2NUXA 3UJRA 3M0ZA 3KXQA 3S4TA 3W23A 4JNMA 4DO6A 1XYFA 3M6YA 1HJSA 1OC6A 3E12A 3EDKA 2XG9A 4CD7A 3WD1A 1VPYA 2VHLA 1JZ8A 4GI8A 3GW0A 3T40A 3EMZA 3RIKA 3EPOA 4A3YA 4RUBA 3TP4A 3K8MA 4YCOA 2DT2A 1GW9A 4LCQA 3FA5A 1PVNA 1RCQA 4WOQA 3HG4A 3E6EA 2D20A 2Y85A 4TO8A 3POCA 4WY0B 3GXMA 2OWCA 1EYEA 2Y6ZA 3MSDA 1UH4A 3SCQA 2BY0A 5AZ0A 4KGJA 4JTQA 2VDIA 2PDQA 3VDCA 4C5ZA 1RY0A 3NM3A 2Z28A 4QISA 4RXFA 1XLKA 2PE4A 2DSKA 4UTHA 5A6TC 2ZZ5A 5EMJA 3QN3A 4D1JA 3BOFA 1FH9A 4PUEA 2QJIA 3H2OA 2IKIA 3VMOA 2ZUNA 2PEVA 1CIUA 1PKLA 3ZSSA 4BI6A 1J96A 3WBXA 4F8XA 3TKFA 4EXQA 1G7VA 1AVAA 1F76A 2H8ZA 1C93A 5D30A 1YEYA 4JCLA 1RLDA 4FNUA 5ABFA 3WEMA 4REQA 3OA5A 2CXEA 3W82A 1JDCA 1UJPA 5I0DA 3TA6A 4LY8A 3BCFA 3UYCA 4CD5A 1I75A 5AHEA 2IKGA 4R7JA 2AL2B 3CUXA 4I6VA 1K9DA 1DL3A 4G2DA 2ZRZA 4N4QA 4US5D 1A53A 2NLIA 4H6QA 3SGGA 1B5TA 1UA7A 3NWRA 2FJKA 2R1LA 3OBKA 4BI5A 1WAWA 2C91A 1KM6A 2VX5A 3W4RA 1F05A 4X22A 1LQ0A 2V5JA 4ZFMA 3W38A 3PZOA 4WY0A 4J9JA 1DOSA 4OKDA 4AC7C 3KL3A 3N6HA 1AZ1A 2DZAA 4NJIA 5KZMA 4H04A 5GNYA 4C7GA 1E1CA 4J28A 4NXKA 4RNJA 3GXTA 4NNAA 4YLWA 4BF5A 4YNGA 4JFTA 3LCWA 1W5NA 4HCDA 2XISA 1EGMA 3DG6A 3M47A 4N9BA 2DT3A 7XIMA 4BI7A 1PEZA 1ZJAA 3M44A 4WOZA 1G4SA 4Q4RA 1K77A 3GNPA 2QJMA 3KFTA 4NSBA 1XIMA 1KFJA 1O94A 3W1XA 1W5QA 4C6PA 4ZQNA 1ZAIA 3B4YA 1OFOA 3DAQA 4JHOA 3NDZA 1OIMA 4PBEA 3LEPA 4BJHA 1UUOA 2I1OA 1EPXA 3EB2A 1SPQA 2V82A 3SN1A 3E0LA 1XLHA 4NI8A 3FVMA 4XG1A 3WF0A 2VFHA 1JGMA 3F4NA 3UR7A 3ZR4A 4KT2A 4LYRA 4GI9A 1G67A 4ML9A 2WVUA 1KM5A 4C6OA 4E8DA 3HFTA 3VX0A 3IVSA 1OK4A 3GYEA 3IRSA 2OEKA 1V7AA 3CQKA 1K1DA 1MQPA 2XSBA 3OVQA 4N6FA 4GABA 4ZO7A 3NSNA 3TYEA 2WVVA 3WH6A 2HV5A 4GQ0A 5KETA 1ISZA 1AH0A 4TR9A 1J0IA 5I03A 5D2VA 4HZ8A 4MJ2A 3VVGA 1B3ZA 3B8TA 4QEHA 2E9MA 2FFCA 1TV3A 2PDJA 3QY8A 1ISYA 2ISWA 3AUJA 4FP1A 2R9RA 3TLLA 4M6PA 3LS9A 3ITCA 4KQNA 2ISDA 1K9EA 1JPMA 1AL8A 3DEQA 4FNPA 4Q7NA 2VC5A 5FF3A 3FA4A 1Q66A 1TTIA 4HN4A 1UKTA 1JAEA 3TQ0A 2PF8A 3C52A 3IJLA 2FMOA 5M2FX 3W74A 5TIMA 3SW6A 1PE1A 2PF0A 3PBWA 1ZAJA 3M4HA 4JIRA 1MXDA 2PUZA 3VMPA 5JBEA 4DHGA 1HGYA 4Z1BA 3TYBA 4DQWA 5DRCA 5KSWA 1XBYA 1G01A 1PKNA 2Z1KA 1A50A 1SQ7A 3K5XA 2IPFA 2YA2A 3OYXA 3SJ3A 2VI0A 5H8MA 4OUEA 3WBWA 1JL8A 4JX5A 3NO1A 2W27A 3V36A 4NY2A 1Q13A 1LUCB 2WAGA 2QJJA 3USBA 2HRWA 3ZQ9A 1TPDA 1XDJA 2Y7FA 1P1MA 3P2VA 4LSBA 2WCAA 2NUWA 4ECLA 4LBRA 4O1EA 3WQGA 2VZVA 2QF7A 3N2MA 1LLOA 2PWFA 3E74A 1RD6A 1SUXA 4M56A 5BXTA 4QTGA 1OBAA 1X39A 2OFJA 1LLZA 1V3MA 5B80A 4LVGA 4CU7A 4HPXA 1JFXA 1AQFA 4PODA 4ZOCA 3KL5A 1UQYA 1JQXA 1W17A 4EPKA 4G1KA 3TN3A 1JF6A 2WSRA 3AAMA 5C9UA 3QM3A 4K38A 3W1UA 3LLFA 1UYQA 4RV8A 1MSSA 2A85A 2V3DA 2OOGA 1G9HA 2BVWA 4DBDA 3DG3A 2PLJA 4Q8PA 1HUVA 1S5VA 2HCVA 3SRKA 1O6IA 2CLEA 1U22A 1XRSA 3NQVA 3ZR5A 1A0DA 1QOQA 2Q3RA 2OT1A 3CMJA 5DANA 1Q6QA 1J10A 3CZJA 4RDYA 3W6MA 4AZBA 1W0MA 2CLHA 5MKGB 1VFSA 2Q6ZA 3LLDA 3UXLA 1VF8A 2PTZA 3CH9A 2R1MA 1KTBA 5I24A 4TX9A 3AIQA 1KM2A 4JZ5A 1DWGM 3PC0A 1XRVA 3M0LA 4DVOA 4FALA 3UJ2A 3EWBX 3QSTA 2ACQA 4OBRA 1G69A 4Q8MA 1Z42A 2XGZA 2O92A 1HNYA 2PCEA 2GUYA 2Z29A 3QGVA 1QNPA 4H6RA 4JTFA 2Y5JA 1KWKA 2ESCA 3A4WA 1XYCA 3QLDA 2ADAA 2W92A 3G6LA 1EHAA 3NYDA 4Y96A 3ZT5A 1M03A 1Z8AA 4MY1A 1OT2A 1OFQA 1Z7AA 2PA6A 1OEPA 1QOXA 2X1SA 2YBVA 1O12A 3PJUA 4YYFA 3B8SA 4TQTA 2ABBA 1E4NA 3KP1A 2DZTA 1AQMA 2YGYA 3AIRA 4Z2JA 5FCZA 3LSCA 4Y9MA 5FI8A 3W00A 1V79A 1KW1A 5LGZA 1PYMA 5KZ6A 1HN1A 1ITQA 3ZS4A 4IX2A 4GWEA 3NGFA 5AYBA 2ZXQA 5AOUA 1ZALA 3ZFHA 1NWSA 4LCRA 1D8CA 3QR1A 2E5CA 2Z4GA 2WC7A 4S23A 1GTEA 3I10A 2H6RA 3NR0A 4M7TA 1EKOA 2VDHA 4L9ZA 2AAMA 4X0NA 1BXBA 4RLIA 3S6TA 4B2DD 3ID7A 1UB3A 2E4TA 5MKGA 3H4WA 1E15A 1BWVA 4RV3A 1E6ZA 2E7FA 2ZADA 4GY7A 1M7JA 4HA1A 4YHEA 3RCNA 2ZX7A 4M5PA 1UBSA 3P84A 3BAYA 3AIUA 3TSBA 1ZUAX 5LXEA 1KXVA 2GSHA 3PSVA 1DBTA 2NQLA 4GNVA 5HQMA 2YZ5A