1AZ2A

Citrate bound, c298a/w219y mutant human aldose reductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 84
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az2A00
3LBOA 3LN3A 3WBXA 1S1PA 3UGRA 3CV6A 3CV7A 3B3DA 3R94A 3V0UA 4XK2A 4Q7BA 3LENA 2PDYA 1RALA 3M64A 2I17A 4LBSA 3CMFA 2PF8A 2F2KA 1AH0A 4XO6A 2PDWA 2C91A 4DBUA 4IJCA 1EXBA 3FX4A 2PDMA 4JQAA 1AH4A 5C7HA 1VP5A 4HMNA 1ZSXA 3LQGA 3LD5A 3GHTA 3GUGA 1J96A 3U2CA 2NVCA 3UP8A 3R6IA 3C3UA 3DN5A 3M0IA 1HW6A 5LIYX 3UWEA 3O0KA 4PUUA 3KRBA 1Q5MA 1Z8AA 3R7MA 2ALRA 2CLPA 2PDQA 3UZXA 1XGDA 1C9WA 2FZ9A 4XZLX 3EAUA 3S3GA 2ACUA 3EB3A 1S1RA 3R8HA 1RY0A 4XZNX 3UZWA 1GVEA 3G5EA 4PRRA 1EL3A 4JTQA 4WDUA 3BV7A 4DBWA 2AGTA 2PZNA 4GIEA 4FA3A 3FJNA 5KETA 2BGSA 2IS7A 2J8TA 4I5XA 1EKOA 4GABA 4JTCA 3H7RA 2VDGA 3D3FA 2IKHA 4XVEA 4WDTA 2PDPA 4YU1A 2FZ8A 3LQLA 4EXBA 4EXAA 1X98A 2IQ0A 1VBJA 2DUZA 2QXWA 3MB9A 2PDHA 4XZIA 1OG6A 1S2AA 2HE5A 2IKIA 2FVLA 5HNUA 3BURA 2PDJA 2ACRA 3COTA 3UZZA 2F38A 2HEJA 4NKCA 4GCAA 3QKZA 4ASTA 2INEA 2I16A 3N2TA 4JQ1A 3VXGA 1AH3A 3ONBA 3V0SA 2R9RA 2HV5A 4AUBA 2PD9A 4WDWA 4LAZA 3CASA 3BUVA 1ZGDA 4FALA 3ONCA 5AZ1A 3R43A 4HBKA 4WDXA 2PDGA 3V0TA 5HA7A 3LZ5A 1ZUAX 4JIRA 1XJBA 3RX2A 5LIXX 2IPGA 1JEZA 2IPJA 2PEVA 2BGQA 4XZMX 5AZ0A 1MZRA 1AZ1A 1K8CA 4LBRA 3LUTA 4WGHA 4JIIX 1FRBA 5HNTA 4XAPA 2PDLA 3WBWA 2IQDA 2PDUA 1MI3A 4JQ2A 2PFHA 2FZBA 3V35A 4ZFCA 3LEPA 4WEVX 4YVXA 2ACQA 3GHUA 4GQ0A 2PD5A 4GQGA 1YNQA 2PDFA 4G5DA 3UYIA 1PZ1A 1QWKA 1SM9A 1PZ0A 4DBSA 4LB3A 4JQ4A 3DOPA 3RX4A 3M4HA 1LWIA 2HDJA 4XZHA 2IPFA 2INZA 1PWLA 2DV0A 1T40A 2NVDA 3N6QA 1IEIA 4ICCX 3UFYA 4WRHA 1Q13A 2PDIA 1ZQ5A 2R24A 4MHBA 3BCJA 4QR6A 2WZTA 3Q65A 1PWMA 5LIUX 1IHIA 4H7CA 2WZMA 4YS1A 4XO7A 4FAMA 1YE6A 5JH1A 2IPWA 4PRTA 3T42A 3UG8A 1YE4A 4OTKA 1AZ2A 3P2VA 4L1XA 1LQAA 1HQTA 4PR4A 1M9HA 2PDNA 1UR3M 3GHRA 4YVPA 4QX4A 4JIHA 4JTRA 1PYFA 3O3RA 2DUXA 2PDKA 2HVNA 4JTAA 4YVVA 2PDBA 3CAVA 1Z9AA 3H7UA 3R58A 3MC5A 2FZDA 3Q67A 2P5NA 3WCZA 4L1WA 1X96A 3H4GA 4LAUA 4XVDA 2HE8A 4H8NA 2FGBA 1ADSA 4F40A 5M2FX 1YNPA 4QXIA 1X97A 3NTYA 2IKJA 1T41A 4GACA 4LB4A 3UZYA 2BP1A 4RPQA 4QBXA 2ACSA 3WBYA 1XF0A 1Z89A 1US0A 1Z3NA 4Q3MA 1AFSA 3CAQA 4PMJA 4IGSA 3LZ3A 3R8GA 4DZ5A 2HVOA 4PUWA 1RY8A 2PDCA 3WG6A 5JH2A 5LIKX 4FZIA 5DANA 2PDXA 3G1RA 4GA8A 3GHSA 2ISFA 4IJRA 1QRQA 2IKGA 3LNMA 4JTDA 1S2CA 1A80A 1EF3A 4R9OA 1R38A 3RX3A 3F7JA 2A79A 3V36A 4JQ3A 5LIWX 3EB4A 3ERPA 1MRQA
chains in the Genus database with same CATH superfamily
3WK1A 5SWUA 3OA3A 4RZ4A 1TMQA 2FPYA 3SGUA 3IPWA 2PPGA 3UGRA 4C1NA 2YCLA 4W4QA 5C2CA 3B8VA 1YKWA 4V28A 1XG3A 4GIRA 4TR9A 4N02A 5HPOA 2QUUA 3WLJA 4NXKA 3UXDA 3L2IA 5DF0A 4ZQOA 4P7LA 1EJWC 2WMGA 2G0WA 2I56A 2QJHA 4HMNA 4O1CA 4ZR8A 3S2LA 4AQLA 1TJ1A 1XBVA 4I5RA 2OB3A 3W72A 4QE5A 1GQJA 3UP8A 4ZGYA 3C3UA 4B2DA 2YXXA 1Q3NA 3ZR4A 1XSJA 2E0PA 2ZRXA 5JBDA 2R1NA 3HGOA 3KFTA 3K46A 4EPKA 4BWLA 4DQWA 3I6TA 3WNLA 3EB3A 3FJ6A 3WD4A 3AIBA 3OLEA 4MSSA 1X1OA 1V93A 1RY0A 4O53A 1TRDA 4OV4A 2Q8ZA 5HJLA 3FHAA 4H2HA 3M47A 3P8JA 2EGZA 1YXDA 2XU2A 1VIZA 1GORA 2AGKA 4MNJA 2ZKMX 5AVNA 3AAMA 3AQUA 1JRBA 1M68A 1Q6DA 1GVQA 2HXUA 1TZ9A 4I5UA 4O54A 2PSNA 3D0CA 2R1MA 2CLIA 4DYJA 2IQ0A 3TVAA 1J2WA 5E9XA 1NQ6A 2CESA 2I14A 2PLCA 1YBQB 2WJZA 3W7DA 4DY1A 1W9DM 4AY7A 2OYKA 3BSMA 1QNVA 3TJXA 3AFBA 1JG9A 2VGBA 1E0UA 4LUSA 4E4PA 2ZUSA 4JNMA 1TCMA 5G1TA 2HQAA 1Q7ZA 4TOQA 3NM1A 1BLIA 1M1BA 4AG0A 4R3UA 1XRVA 3U4AA 3H8AA 3AXIA 1UUQA 3E74A 4UMBA 1VS1A 1EGMA 2XHYA 3DZ1A 3C8NA 2Y63A 4N2YA 3ID7A 5HK4A 2P1FA 1AVAA 2UZ9A 1M6JA 3ONCA 4UTKA 1TIWA 1TZ7A 1VQTA 5FF7A 1WXYA 4CQ8A 3V0TA 4JNYA 7ENLA 1O5QA 4TX9A 5G2IA 4RDYA 3LCXA 1FFRA 1NF0A 3WD1A 3ZJ8A 3NL5A 3CQIA 3VC5A 3GIYA 1SSDA 2BXYA 3M0XA 3NEHA 4KESA 4URIA 1JGIA 4DJDA 3FYOA 4XTIA 5EBUA 4RDZA 2VC7A 4HMCA 1W8SA 4EAYA 1H3GA 1Y5VA 4C60A 4PCPA 3IJ9A 3CO4A 1YNQA 2EG7A 3WQEA 1SM9A 3M1ZA 4LYQA 3GH5A 4YMZA 4O0ZA 1ZNNA 3DKLA 4M6VA 1UYQA 3UZJA 1UD4A 2YB4A 3WH6A 2CZ5A 2GQAA 2CLMA 5TAOA 2PWEA 2RHGA 3UA4A 5AC5A 4AZHA 2BODX 1OF8A 1WDDA 3M46A 1FA2A 2HWGA 1OB0A 1AMKA 2WPGA 1IIGA 3MO4A 3CUFA 1E9YB 3Q58A 1KFWA 4ZODA 4RV3A 2G37A 3UJFA 3BO9A 2WMJA 4L6OA 1VHCA 2WWDA 1TPEA 4MJZA 4NXSA 2QCCA 1V6UA 3W3OA 3VPLA 4TQTA 3VD9A 5JH1A 3UPBA 5JQ9A 3S1WA 2C7FA 1B3OA 1IXPA 3PAOA 1XC6A 4LVDA 4POCA 1H7PA 3E6EA 5HMSA 4JTFA 3U9IA 1KO0A 1EYWA 3L5LA 1BRLB 3BLPX 8RUCA 3AXXA 1Q6FA 2D0HA 4H4IA 3SJ3A 4ROQA 1DL3A 2I57A 2QV4A 2GK1A 4YYFA 1V77A 5BRBA 5D9OA 5FEWA 4E8DA 2NUYA 2HE8A 4M3PA 3LM7A 2CLOA 1QOXA 4BCEA 1KQYA 2GGGA 1HFBA 1H5VA 1F05A 1E6NA 1BWVA 1FWEC 4NNBA 4LS2A 3GFZA 3E0VA 3FXYA 1UP2A 3CQJA 2HSAA 3HN3A 3VIHA 3LRKA 3HBLA 3M5ZA 3S83A 4YHEA 1A5UA 4IFOA 2PI6A 4CVUA 3LCHA 3CLMA 3HTWA 1BHGA 3C86A 1US2A 4OZOA 2VFHA 4I9TA 1QK0A 2A5HA 7CGTA 3NAVA 1UR4A 2PDXA 1KRBC 4EX4A 1MQQA 3KBWA 4ZO7A 3CB8A 4HTYA 3DXIA 4HYVA 3WQVA 4R9OA 3FNDA 1I1WA 1FHDA 4O8RA 1L2QA 2CEQA 4PUKA 4HCLA 3UR8A 4NVTA 2QV5A 3RJXA 1BSIA 2PTYA 1VRDA 3QFWA 1MUWA 3HJEA 4D1IA 2PP1A 5M3WA 4AFYA 4XZBA 2PWVA 4IG2B 3RF9A 3II1A 4TX6A 3W1RA 1GKRA 3UWVA 3HPXA 2IW0A 3G0XA 1YBQA 4H6QA 2D2OA 5I09A 4AY8A 1TV7A 3IGUA 3W83A 4GC4A 1VH7A 1QBAA 3U8GA 2DSVA 1N8FA 4PUJA 4ES4A 1W17A 3OW1A 1P48A 1I8JA 4KS0A 4IP7A 4GLEA 4S3CA 4HPGA 3CHDA 4DBUA 1MNSA 3EWXA 1K02A 2WBKA 4DJFC 3MMTA 2B7OA 1VZWA 3VIGA 1M3UA 3VUPA 4ADUA 2IMRA 2O9TA 3ZFHA 5HR7A 3C56A 4N7QA 1J01A 5T9CE 3N25A 4J3XA 4KMQA 1XINA 3ITGA 3OHMB 4C6LA 1UKSA 3DECA 3I7QA 4ZB2A 4NX0A 3MKCA 1W1ZA 4JL2A 5C6MA 1H41A 2FZ9A 1JD9A 4AY1A 4GNVA 1RD6A 3UPWA 4BQ5A 4GY1A 3NIYA 3RUBL 1UD6A 2V0TA 4UMCA 4IGMA 4NILA 1FCUA 2WO5A 1EUAA 4LEFA 5A8NA 3DFSA 3G1DA 2OQLA 2HJPA 4HSOA 3VD3A 1UR0A 4AZCA 1JDEA 1XW8A 5E93A 1OD8A 2G41A 1S39A 3ZT7A 4WKFA 1XLJA 3GVQA 4I9MA 5LGXA 3CZKA 4YWSA 1K7FA 1DIEA 1KBJA 2Y61A 1LM1A 1W1IE 1QOQA 4PYSA 1I4NA 2FDSA 3W2UA 3OODA 1QPQA 3A22A 5CSUA 2QCDA 1SUXA 3N6HA 3S4TA 2IKIA 3E96A 3CTTA 5HNUA 4LAOA 3XISA 2DIJA 1SR9A 3JZUA 1HGWA 4D6JA 3VOGA 4K36A 4QLKA 3PBYA 3TW6A 2PRHA 4UC5A 3ITXA 5BRQA 4ENLA 3OBEA 4W85A 3IAPA 3N2TA 3LXBA 1NOUA 4UZUA 4OUEA 1EHNA 1XIGA 3BJTA 1H2JA 4QG6A 4GYPA 3EDKA 1WOAA 2A7RA 3RMEA 2XFRA 3ITVA 1GJPA 4NJGA 1PTGA 2EKCA 3EBVA 3THCA 4H3DA 1JNDA 3SY8A 4EPDC 5D9MA 4CCEA 4MIMA 1F3XA 3NL2A 4BI6A 3I6RA 1GYMA 4KPLA 3FSTA 4C90A 4LS0A 3I3EA 4GWEA 1EQCA 4RW5A 2Q71A 1JCMP 4QCFA 3SN0A 4ADTA 3GZAA 4WKHA 3IRDA 4OOZA 2E77A 2IQDA 2QJJA 4NZ1A 1C8YA 6XIAA 4GFSA 2PFHA 2FZBA 4ZCWA 3OIXA 3LEPA 3CU2A 3WJSA 1WA3A 3WENA 2F6XA 3WLNA 5IRPA 2Y8KA 1UD5A 2BOEX 3EWDA 1X39A 3GK0A 4MKVA 4GUGA 4JTKA 4AZCB 2C18A 3TROA 1O68A 2VMFA 1J0IA 1P0EA 3AO0A 1LORA 1VJIA 3NPUA 2HCVA 4DUWA 3OVPA 4JTTA 4W5ZA 4GI6A 4W88A 1PTDA 1DIOA 2PRMA 3GYEA 3REQA 3NSNA 4PRWA 4A3RA 1QBBA 4IF2A 1HO1A 2B4GA 2Y70A 1O1HA 2CBUA 4HHHA 3OU8A 3QR1A 3TOPA 5M03A 5C5YA 1YRRA 3PP7A 4HSNA 1KTCA 1TVPA 4U4MA 4H7CA 2WZMA 3T6CA 3AXKA 3ZSTA 5FESA 1QPNA 2WSKA 2PC4A 1K4GA 2WQPA 1B4KA 4NZCA 2HTMA 4OTKA 2H8ZA 2PDNA 2DSKA 3PY2A 1EC7A 1XXXA 3W7RA 2Z24A 3LA4A 1PKYA 3CHFA 3TTSA 1I0DA 3VOFA 2RH9A 3R58A 4FLOA 5G1YA 2REQA 1BQGA 2DVXA 3WEMA 4AF0A 3FCPA 2A1YA 2TAAA 1NH6A 2ANUA 2FKPA 1KFEA 1E4NA 3H4GA 1UWRA 1MEHA 3VGHA 1ADSA 1XI3A 3DERA 4MJ2A 3WUFA 3L5AA 3LMZA 3ZZ1A 2OEKA 3GVVA 1IF2A 1XP3A 5ABTA 1A5OC 5D32A 2CLEA 4QCEA 1OX4B 1XIHA 2Y88A 5XIMA 3MCMA 3PR2A 1M04A 2V9DA 3CAKA 1TPFA 2BY2A 3R89A 5BXTA 1ZJBA 1K77A 1XIEA 3ES8A 1CGVA 5E0CA 3L7RA 4H9TA 3PF3A 3M5VA 1MW0A 2CBVA 3QQWA 1S3HA 3GE7A 5HAOA 2WC7A 3QN3A 5GVJA 2P0IA 1UP3A 2HRWA 5C9UA 1AK5A 4NYYA 3WFZA 1ZCOA 1BVNP 2UY3A 4I9AA 2GGHA 3NVTA 1FWSA 3MT1A 5E9AA 3VNZA 1TTIA 3D6NA 3M0KA 3N18A 5I02A 4MPQA 4K8HA 2FVKA 3PZTA 1ZBCA 3BOFA 3ZT6A 3E02A 1EBGA 3AWOA 4IMGA 2NT0A 1G67A 4AMAA 3SW6A 3M6DA 3WBXA 3CV6A 1F6PA 1GT8A 4DZIA 3TW9A 1GJWA 4B15A 1G94A 4PL2A 1LWHA 4JNZA 4TTGA 2WLZA 1ZZMA 3URBA 1XFBA 3ARSA 3AALA 5I3DA 2FZMA 3APTA 2GOUA 7ODCA 4UTMA 1A5BA 3BWWA 1V4YA 4EF8A 2E1DA 1DQXA 3L2LA 1K9FA 3KHDA 1J96A 1TREA 4HHLA 1T5AA 2ZZ5A 3R13A 1PKNA 5FEPA 3DN5A 3DFTA 1GYLA 4ZTXA 4UOQA 1NARA 1IE7C 1K03A 5TF0A 1XC4A 4ATWA 4E2VA 1XRFA 2WCGA 4GD0A 5M5DA 5D2VA 4UCFA 4GVGA 1XGDA 4DBDA 5D33A 1TWZA 1VYRA 2ACUA 5A8OA 5FL0A 1WAUA 4KRTA 4S3JA 1KV8A 3OBKA 4XKYB 3K5XA 1SZNA 1WE5A 2YYTA 1DJIA 2UBPC 5DT7A 1ZBWA 1NFPA 5KITA 3CHVA 2B7NA 1OCJA 1KR1A 3GFXA 3EX2A 1TE6A 3GB6A 3L65A 3W7LA 4UQEA 4Z2JA 2Z2BA 2DT0A 4IL0A 1EKOA 4U5IA 2ZC8A 1FVPA 4PMXA 3NO5A 4HPXA 3TYAA 4A05A 4LCRA 3UJRA 3QMTA 3ZVHA 3NPXA 3B8TA 3QHNA 2CHOA 1W32A 2WVUA 4NZ5A 4BQ4A 1EO5A 4XZIA 1S2AA 4J3UA 4Z08A 3Q94A 2A0NA 1O5XA 1V3KA 3WDJA 2CLLA 1VR6A 4G1KA 4XBKA 3JW7A 3T09A 3W7GA 4CCCA 1E15A 3NWRA 4DO6A 1UHVA 3EX4A 5CJMA 3AS2A 2ZZ1A 1E6XM 3M43A 3ITLA 2I5IA 1XDJA 3ECQA 1TJRA 5CPSA 3QPZA 1G7VA 2PCQA 1Z41A 4KCWA 3TR9A 5ECUA 4W7UA 2L5HA 3GG1A 2YIHA 4XWUA 1U22A 4ZVJA 4PCTA 1T99A 1U1HA 4JR5A 3W1NA 4CEUC 4AVFA 5CGTA 5MKGB 3GTIA 3TC3A 2OTDA 1W5QA 4ML9A 4D2JA 4M7TA 5FF4A 5GNXA 4GQQA 4AVNA 4UNKA 3G8RA 1DJQA 4ML4A 2Z7GA 2QUTA 5E1QA 2X1UA 1SZEA 2XIMA 1OGGA 3SSJA 2QMJA 3I7RA 2EPKX 2GUYA 4EXQA 1TTJA 1HKVA 3LTSA 3VTRA 3LZ5A 1FTXA 2PRLA 5LIXX 2FTPA 3OG2A 2X0HA 4UCGA 2F6UA 3B4UA 3AMGA 1DWGM 2YGYA 1CECA 2ZZ7A 1F74A 4FNUA 4O16A 4PMQA 4P8XA 4L1GA 2Z2UA 1V0MA 2QT3A 1KKRA 3G6MA 1CXHA 3KDNA 3H12A 3MVIA 4GX9A 1HX0A 1JF5A 3IVTA 4OU1A 3P67A 1N7KA 1DJNA 4PBEA 1WPCA 4GQ0A 3OOQA 1RQHA 4O1FA 1XIJA 2PDFA 2X2GA 1NWUA 2OJPA 3T8QA 4WIWA 2P88A 1H7NA 3KWXA 5IOBA 4TVCA 2CETA 1HTIA 3DOPA 2HDJA 1OEPA 3L4ZA 2OCZA 1YADA 6PTDA 1MEIA 3N9KA 3WNOA 2GGIA 4LCSA 3U2ZA 1Q2SA 3NZPA 4HPJA 2YL5A 4D1JA 4GXMA 4C1NB 3NA8A 4YTSA 3QQ1A 3DFNA 5CSYA 3G18A 4R33A 1TQXA 4DPQA 4N0RA 1GTEA 3VDCA 5DBUA 4O1EA 3NQDA 2OPJA 4DXKA 1LOSA 3WO8A 4V2XA 5TQLA 2WVVA 3GFYA 3MUZ1 1GVIA 3ZWSA 4CQAA 5LIUX 3KBJA 1EPXA 3LLFA 2BLEA 3BAXA 4MGGA 1FWWA 2YX0A 4FR6A 4HB7A 4PRTA 3AXHA 2XVKA 3C8FA 8TIMA 2SFPA 3H2AA 4KT2A 3P61A 1XR2A 2NXHA 1PXGA 2H3BA 4FLRA 2Y5JA 1BKHA 1H50A 1PL9A 3W85A 2P3ZA 3S5OA 4JTAA 3MU7A 5EFDA 3GW0A 1XQLA 3ARZA 1VFOA 1CXFA 1NOWA 1W8GA 5C55A 3KTSA 4LUIA 2IXVA 1E56A 3F4NA 5CEWA 4Y9OA 3DG6A 3H2EA 3MI2A 3G3MA 1F76A 3O2LA 4I7WA 2IKJA 3GC5A 3VZXA 1F6YA 1BFNA 3IIXA 3HQ1A 4NQ1A 4BQ3A 1T41A 3SADA 2C15A 3CYJA 3ABOA 3G24A 3W81A 3G22A 2BY1A 4O14A 4OWGA 1A4LA 1L9WA 3WBYA 3OBAA 5B7YA 1Q6EA 3RITA 4WOQA 3IIPA 1OY0A 3PNUA 1JZ4A 3MY9A 2W63A 1C93A 1B3XA 3ARUA 3ZJ7A 1B3ZA 4PTMA 5I3HA 4M56A 1YLVA 2DQWA 4O12A 3G1RA 4ZXLA 3GZ3A 4KEUA 4JKKA 4GI9A 2E09A 3GHSA 2VL4A 4C7GA 1RK6A 2YA2A 4PMZA 4J3TA 5EU9A 3UVAA 5CBJA 2KZHA 1VYPX 2JEPA 1TSIA 1KC7A 2CIPA 3ZT5A 1DWIM 3C61A 4K2SA 1QO5A 3SY5A 4X0NA 2NQLA 3M6YA 4GJIA 3SN1A 4M6UA 4Q7BA 4UB9A 4WJXA 2FTYA 2ABAA 3ARWA 3EWYA 1BXBA 1EEXA 2I7GA 2E67A 3T4WA 2YB1A 1KTNA 1EC8A 1CEOA 1E55A 5C70A 3OHIA 3NYZA 2AL2A 1LOQA 4LNYA 3V4BA 1DQWA 3VFCA 1FP8A 4O13A 1WZMA 4H9XA 1ISYA 4D72A 4PUEA 1QAPA 3QXBA 4FNPA 2J77A 3OGRA 3L21A 1LQ0A 1YDVA 2QMKA 4JFVA 1G9HA 1FOBA 3U2EA 1KLZA 3EA1A 3QY7A 4EP8C 4GZEA 2CZVA 9XIMA 6A3HA 1KM3A 2XINA 1UBPC 2FHBA 1YXCA 1ICSA 3R8HA 2Z2AA 1XLBA 5AHNA 1WBHA 1W9XA 5E09A 3UQNA 1OVDA 1AW5A 4M6QA 4H7VA 1FWJC 1QK2A 3U0HA 2BHYA 2QCHA 1SZGA 5KETA 3PB2A 2NQ5A 5D05A 2H8XA 6REQB 2YL8A 5DMLA 4ZO8A 1ECQA 4JTCA 5REQA 3DAQA 1AQHA 3HV8A 5I3JA 4Q8MA 1JUEA 1QI4A 5HQEA 1ISXA 3AIWA 1E71M 5H6HA 2PDHA 1MUMA 4RKAA 2ODOA 4PUNA 1ZHAA 2XFFA 3BJFA 3T7VA 1QI3A 4DWSC 4UQAA 3OQEA 1DXIA 2E5BA 3ABZA 4H8HA 1J5TA 4E0CA 3PB0A 3E2SA 4V15A 2WC3A 5KEZA 4HNLA 3DBNA 1VCVA 2OKTA 2C3ZA 2XH0A 4P7NA 4AEEA 1F2JA 3OVQA 3PUDA 4OUIA 3VXGA 3I10A 1SJDA 1KW1A 3OO2A 5FJJA 3IUIA 3BW4A 2VHLA 4Q4RA 4AW7A 4LAZA 4GBDA 4KCVA 2Y62A 1ISZA 3S1VA 2VGIA 4NAFA 5FKYA 3WDIA 4XAYA 5HJXA 3B8IA 4HBKA 1A5MC 3FW6A 4MM1A 2PDGA 1JJKA 1W6TA 3V3WA 4JIRA 1V02E 4ILSA 1S3TC 2ZOXA 5L6UA 1F5ZA 2IPGA 3MVTA 3NSMA 2AAMA 1H7XA 3MCOA 1QOPA 1TX0A 4O57A 1AZ1A 3MI6A 1K8CA 7REQB 1J0HA 2GWGA 3HFYA 5CZSA 2Y89A 5L9FA 2OX4A 4O1AA 4FF5A 4LOCA 1FP9A 3LX9A 1Q6LA 3ZMRA 3W7HA 1VCFA 3OQ8A 1W0MA 4R85A 4M5PA 4M24A 1JGMA 3KOZA 2ZVIA 2E28A 4X3ZA 2TYSA 2MANA 3B04A 5M17A 1PZ0A 4DN1A 3UD6A 4JYEA 1QJWA 5EMMA 4D71A 3LMYA 3VINA 1O6IA 3N13A 2GJLA 1IEIA 4AZBA 5A6BD 4LYKA 4HP5A 3TN4A 1W1YA 1NDWA 2J74A 1Q13A 3SN4A 5I23A 1JUBA 3TONA 1LJYA 5LKYA 4F79A 1E70M 4E4UA 2DT1A 1L6GA 1NM9A 1CXIA 3ARPA 3GTXA 1XLCA 3E49A 1DWAM 4MDOA 2QPXA 5TD4A 1F3TA 1QR7A 1B90A 1K9TA 3C5QA 1SW0A 3A9BA 3G1VA 2Z25A 3GAYA 2RJGA 5D37A 4PB4A 1CNVA 3RR4A 3HPZA 1SQ7A 5FF0A 4QE1A 4FNRA 2GJPA 3GU2A 5H8MA 3CK5A 3FFSA 4K6AA 5CG0A 3S6TA 1Q7QA 2ZX8A 1CX9A 1BWLA 1KM6A 1TWWA 4W5UA 2J7CA 1UC4A 1G4EA 4NZFA 1W1A1 3AHTA 1JYVA 2BVDA 1CT5A 2DZSA 4MAZA 2PURA 1O1ZA 1A0DA 3NQ2A 4JX4A 2Z1KA 5A69A 4H8NA 3OB8A 3LCFA 4F40A 4ZB0A 1M53A 1IT7A 4PTDA 4OE7A 4Y8FA 5KZMA 3KP0A 4C6QA 3TIMA 4S3BA 4HZ7A 4UMAA 1XQKA 1EJXC 2QUNA 3FKRA 4K38A 3DHFA 1XF0A 4LY8A 4DWSB 2VUNA 5D2YA 3VKKA 5BXSA 4ZQNA 4N42A 4HPNA 4OIFA 1DBTA 5CXPA 1TV4A 1UR8A 3YPIA 3HURA 1XIBA 4PMNA 1ME8A 3ALFA 2VGFA 2XFYA 5JH2A 3E12A 2P50A 4FZIA 1JI1A 3GNNA 5BW6A 4FXFA 1EJVC 1QDSA 3PZGA 1K9DA 2ISFA 5U4NA 3LS9A 4D8AA 1UD3A 1IR2A 1J11A 1WXJA 2BASA 1V3HA 2XDFA 1E6PA 4BWLC 4JTLA 1NIUA 3NQEA 3G3DA 3VIFA 2Y8VA 3O6YX 4LJ3A 2D3NA 4JFUA 3LBCA 1E9LA 1S1PA 1X8CA 3EXSA 3CL7A 1RHCA 3L5MA 1VB9A 4L9YA 2GPTA 1Z7AA 3O1NA 2DSZA 1PBGA 3ARQA 5LA1A 2I17A 3L4YA 2QS8A 1EHAA 1KBIA 4WUIA 1BKSA 1VBGA 4GZIA 2VCBA 4H9UA 4C6NA 4GG9A 2C91A 4BEUA 2A7PA 5IHRA 3A3WA 4IG2A 4UTWA 1VP5A 1GVFA 1Z42A 3CEUA 1VIWA 3U7BA 3GUGA 3WH8A 3FS2A 2C0AA 1DQUA 1Y0EA 3WELA 3F03K 2VO5A 2P8CA 3PJXA 1NFBA 1NU5A 1JZ8A 2QAFA 3AWNA 3M9YA 5D2XA 3VABA 3WY1A 3EAUA 4S38A 5C54A 2ISDA 1S1RA 3PTDA 6ENLA 3FHQA 2VX6A 3MO7A 2Q3RA 3OZMA 1JUKA 3WF4A 3U2OA 4PRRA 3LY0A 1OZQA 2XTKA 1VJZA 4LYRA 3AYSA 3S2CA 2WCAA 1EJ7L 1OINA 1CCWB 2VDHA 3W1XA 3RU6A 3PSWA 2OMAA 3ELFA 3LRMA 4JDBA 3MUXA 2WV8A 4W8BA 1HJVA 1EIBA 1T6MA 4IQJA 5MHBA 2R8WA 3TKFA 1YDNA 4Z1AA 1JXKA 3QY6A 1UR1A 3H7RA 1ONXA 3WJWA 3HF3A 3HA1A 4DUXA 4E3VA 3E2RA 1PTAA 3BLEA 3DFHA 3OA5A 4KH2A 3BZGA 1SFSA 2QDGA 4ONVA 1EIXA 4M8UA 3KRSA 3JVAA 1CGXA 2J7GA 3HO8A 2WKGA 1E5NA 1HO4A 2QJGA 2GOKA 1RA5A 4QRNA 2FVMA 4U10A 3P0WA 1V3IA 1R3VA 4KQNA 4JYDA 4DELA 4L56A 3CT7A 1JPKA 2A85A 4WSJA 3TCEA 3IIZA 2X1RA 5K2ZA 3QV8A 1UZ1A 4D6GA 1BF2A 1FHUA 3BLKA 2EPHA 3BQ6A 3GQYA 5BNKA 1CYGA 1A47A 2FQIA 4BQ2A 4L4OA 3KVMA 2ZA1A 4HU8A 2ZZ3A 4B90A 4W84A 5IDZA 3EXTA 2HXTA 1YIXA 3PZNA 2OELA 1IZJA 4IL2A 1TX2A 6CGTA 1C7TA 3QEZA 2J47A 3W76A 3GO2A 3R4IA 2WBGA 1TWSA 4F0LA 1NP0A 3BE7A 1RPXA 2CYGA 1KFJA 3IS4A 3ANYA 5HA7A 1KRMA 3MV11 3V5CA 3BTNA 1BVWA 2OZ3A 1UZ4A 4QROA 3H6OA 2AL2B 4Y9NA 1E4IA 1KRAC 5BXPA 2G8ZA 3QF0A 4R27A 4M7SA 2OLAA 4XAPA 3W2LA 2PDLA 1UWSA 3B8SA 3AOFA 4H9VA 2Y8UA 3BVJA 3L66A 2E9MA 1V0KA 4AZIA 1IT8A 3QSRA 1ODZA 3MP4A 4Q7NA 4X0VA 1Z69A 4IICA 3ABSA 4HK7A 1UPMB 1TE1A 3SRFA 3FGCA 3NQVA 1YTDA 1EBHA 3TXZA 5LSMA 3ATYA 4YXGA 2BBFA 4W7WA 3W6MA 2DH2A 3M4HA 3SRHA 4XZHA 1QPOA 1Q6CA 3SO7A 1QCWA 4JTIA 3S42A 4MY9A 1BD0A 3ITTA 3SCUA 4R53A 3SQMA 4MY1A 4WZHA 2DT2A 3WLKX 3ORWA 3UXKA 3A5FA 1OFOA 1P7TB 2YCLB 4OT7A 1XGEA 1PX8A 3KW3A 5FF3A 1DE5A 1GZJA 3SR7A 4AEOA 1GTHA 3M07A 3MDUA 3CPGA 3V18A 1HL2A 3TYZA 3CUJA 4QQ3A 4CN1A 4S3GA 3TZFA 1D9EA 3QV7A 3BLOA 5DRCA 3TSBA 1GOMA 1Q65A 1H62A 3TTYA 3EOSA 3PBUA 4LXFA 5IBXC 1LQAA 3CIVA 1X38A 2EPOA 2QDEA 4YVPA 5LXEA 2ZX5A 4QX4A 1L8PA 1Q4NX 4ZOCA 1EJRC 3WQFA 4UFKA 1DYSA 5GJPA 2NX1A 5HOSA 3IRSA 1W1VA 3SUUA 4X22A 4LAMA 3AC0A 4QHRA 3UR5A 3Q67A 1IXNA 4RE0A 1F9CA 3W7QA 3MJYA 4XVDA 2V69A 3DCPA 4MYXA 1MDLA 4UTJA 2FH6A 2VM8A 1JZ5A 4PUDA 4Y9PA 2VXNA 1MYRA 4NAEB 1RV8A 4H6EA 1NOFA 4JCLA 5LNVA 3TU9A 3BG5A 3OGVA 2BXVA 4F0SA 1Q2RA 4X2PA 1QT1A 4YTRA 4UFHA 5BMXA 4H41A 3TCSA 4WKAA 4UOZA 1L0PA 1QVBA 3F5LA 1ZALA 1CXEA 1D3HA 4YCOA 2Z00A 2OGYA 4CKQA 5AC4A 2BHZA 3WK2A 2YJQA 5DLCA 3IANA 3H24A 2FB3A 1K7XA 3LLDA 3THQA 1LUCA 3ARXA 3BH4A 3QTGA 5HMFA 1DJYA 1YEYA 3ZLGA 1TPDA 1A80A 5F1UA 3S1UA 1PX4A 2Q02A 5DCEA 3MMUA 4IIGA 1FWTA 3LGDA 2Z6JA 3S9YA 3QYQA 3EB4A 3B9OA 3QTPA 2CNCA 3LBOA 3AMLA 1PVNA 1P0BA 1XPGA 3TMQA 1LBMA 2BZNA 4B91A 3B3DA 3R94A 1GG0A 3PZOA 1RCQA 2H9AA 3M64A 3ES7A 5LA2A 3U6WA 3I65A 1GZGA 4B5XA 2F2KA 4L6DA 2ZXAA 1W9VA 3O05A 2D3LA 2Y4SA 3KDOA 4DHGA 1S2TA 3VU2A 3KAOA 1ITUA 1KXTA 3SUTA 3GVGA 2ZRWA 2QCDB 2XWDA 3O07A 3BLFA 2ZTKA 1ZSXA 2V5CA 3IUDA 3LPOA 2JKAA 5FEZA 3U2CA 1TIMA 4K7VA 5CCZA 3E0WA 5LIYX 5D02A 2O4QA 2RGMA 3O0KA 1EGVA 4TO8A 2WKLA 4Z2KA 4B3LA 4PUUA 3WJYA 4DO4A 5HQLA 4X61A 4WY0A 2G3MA 3MTWA 2X41A 4P8UA 1UASA 3NL3A 3QGKC 3WJZA 4W7VA 1U30A 3SCRA 2J24A 4UXDA 5FIPA 3VYLA 4QDPA 2REQB 1H11A 4H04A 5A2BA 3UZWA 3H4XA 4GMEA 3TA9A 3T0AA 7REQA 3D5HA 1E43A 3N2MA 1HN1A 8A3HA 3THUA 1XIMA 4WXZA 3VKCA 1XGZA 3STEA 5CSRA 1RCOB 4LUTB 1WOBA 2WNQA 2JIWA 1L6FA 2J8TA 3H4WA 4KRZA 3W29A 3CWHA 3LPFA 3MHGA 4MG4A 3T05A 2E8YA 3D3FA 1GPWA 4A21A 1R2SA 4NAFB 2PDPA 3RNDA 2YZ5A 3WUBA 4LALA 2GWNA 4AXKA 3SAZA 2QXWA 5PTDA 5I79A 4XX6A 3CZGA 4HA1A 4DJDD 3VDAA 4CCDA 4HMEA 3P74A 3PZQA 1ZAJA 3B8WA 2JALA 4DJDC 4Z2IA 4Q32A 2B0MA 2CERA 1EDGA 3REQB 4GUFA 2X42A 2J7EA 5C9ZA 1JDCA 4CNTA 3SRDA 4DXXA 2V5DA 3GTHA 3UW6A 4BF7A 4FLSA 4GFIA 2PB1A 3R10A 3WFAA 3V0SA 4NASA 3VIMA 4M80A 4AUBA 3IIVA 3AICA 3OZYA 2DT3A 1P0NA 3R11A 3WF2A 4JTHA 2WXDM 4TX8A 5ABFA 1EZWA 3B97A 2WHJA 3B0VC 1V6VA 3PULA 4OBSA 3HG4A 1DHKA 4Z0JA 3AYRA 2EQDA 3VX1A 3PM6A 2C1HA 2ALDA 2AMXA 3DFQA 3URQA 4I6VA 3IJ7A 2PEVA 3W02A 4ZOBA 1VLWA 3TH6A 3GDRA 7TAAA 1DXFA 4LBRA 2P10A 7TIMA 1CLVA 3L9CA 2OLHA 2R91A 3AZRA 4PBFA 1GQKA 5K7JA 4DJEA 4G8TA 3L4WA 1A3XA 5AFDA 2GJRA 3VIJA 1JZ6A 3P60A 3GHUA 1BPLB 5IBXA 5CAHA 4CNOA 2VRKA 1IGSA 4PFMA 2XYLA 3HFTA 2GGJA 2YL6A 3E2QA 1XH2A 3R5EA 4YPJA 3WLOA 3CIXA 3RX4A 5D8ZA 1M41A 3H55A 3GKAA 4J3VA 3W28A 1Q6QA 3TZNA 2NVDA 3T81A 1CXLA 1OYCA 3ANVA 4KGLA 4WRHA 2HPIA 3Q37A 5C0QA 4K8EA 1K6WA 3P84A 5TIMA 1E9ZB 2R24A 2C1GA 1MDRA 5FAGA 1UUOA 2EBNA 4GQBA 2WMHA 4DWSD 2O9PA 3CAWA 4O1DA 5F2IA 1ALDA 3K8KA 2F9RA 1UZHA 3BK0A 3WF0A 3KVLA 1J5SA 1V6XA 1CDGA 3GC2A 3BAKA 2XFWA 4C6DA 1O66A 1R7OA 2OWXA 1AZ2A 1XLLA 4CLMA 1M9HA 5XIAA 2J66A 2V8ZA 3QHMA 5HNRA 4YN5A 3AUOA 1Z32X 4NHVA 3F5KA 3W38A 1EPVA 5FSEC 1ZRQA 4NF7A 1XD0A 4GCXA 4B9YA 2E1WA 5CLTA 2DGAA 2WSRA 1FH7A 3TJ4A 1WQ5A 2Q3OA 4QISA 3MSDA 5AHFA 3NVDA 2R1KA 2I9UA 4QG9A 3LBMA 2QNEA 1V5XA 1QMLA 1JFXA 1B30A 4GOAA 1UH3A 3EXRA 8CGTA 2V6AA 3BAJA 5K9CA 4Y8EA 3LG3A 4A8RA 4HZ6A 3CWOX 1X97A 1EF2A 4L9XA 1CLXA 2YDSA 5DELA 1LLOA 1JDAA 4PFHA 2VEGA 1QNPA 2D1ZA 2GGEA 4RPQA 4TVDA 2YCJA 4IIBA 2CHNA 4U3AA 1Z89A 1US0A 4QJ3B 2FGLA 1DTNA 2V5LA 2XVGA 3UWYA 4DJFA 2C79A 4DZ5A 4WK9A 4JTGA 3L23A 3H2FA 4IOTA 4AZGA 3W87A 3I4EA 2ZQ0A 4WJEA 4IMAA 2VFGA 2A3BA 2BVWA 3APGA 4B9ZA 6TAAA 1XG4A 3PN8A 1IWAA 1V6YA 4DX3A 2PU0A 3V36A 1P6WA 3WH9A 3EEGA 2DUAA 2OZTA 3VE7A 4DM2A 3ENLA 1PE1A 2JKPA 2PTZA 3CV7A 5A6KA 5G4HC 3BL3A 3CO8A 2YBUA 3CWNA 1OK6A 3UEQA 2QIWA 1XISA 4U33A 5FF2A 5JIPA 2QHAA 3VMOA 2BS9A 1HUVA 2WB5A 2AKMA 3W37A 2PMQA 3BMXA 1O7AA 2Q09A 4AMCA 5LA0A 4C6CA 4UFMA 4ZBCA 3GDKA 2BB0A 2PGEA 3CHEA 1J4EA 5HUOA 2V81A 4XIMA 1CGWA 3P6LA 3P80A 1JQVA 5CQ1A 3PBMA 4JDYA 3N9SA 1HW6A 4UBPC 3UWEA 2VTFA 3KX6A 1ZLPA 1IWBA 3FYYA 3KRBA 4CNPA 3FA3A 4US6A 2BHUA 2CWNA 2OOGA 3EPMA 2Y7EA 1C9WA 3WQ4A 1IYXA 4ZFMA 4LVFA 5JUVA 3O63A 1OHLA 2A3CA 1VRXA 1AQMA 3MQTA 3LHTA 3TJIA 3OEXA 4J3ZA 4R9XA 1Z6KA 4FNSA 4WDUA 3EX3A 2V5KA 1XYFA 3QC0A 4O4WA 4CGTA 1ISVA 3POHA 1RLDA 3UESA 4RR4A 2TSYA 2RAGA 1UCWA 1ZCCA 1I45A 1WZLA 4EXAA 4NZJA 4Y9AA 3VDBA 3QMRA 5KINA 2GJXB 1HVXA 3BXWA 3MB9A 5REQB 3OZPA 1KM5A 2PF0A 1UR2A 4BKNA 4F8XA 4XISA 4H9MA 2OODA 2XIJA 3N04A 3IV8A 3QW4B 3MUY1 2E6FA 3GRIA 2NT1A 5C9XA 4RX0A 3UJSA 3WJXA 5AHEA 3ITOA 1TV5A 3O9NA 2LLEA 4EOUA 4A29A 1JIBA 2WCSA 1TTQA 4IFKB 1MRAA 2ZDSA 3N6JA 4GVFA 3AS0A 4K39A 4I9JA 3T2OA 4BEQA 2RJHA 1XCFA 1LT7A 3ONBA 3S5SA 1D3CA 1OX4A 5DX7A 4IUOA 5K4XA 3E0LA 3IGHX 2DU2A 1I2QA 2HK1A 4GUHA 2WSQA 3MA8A 4DO7A 4E6MA 3R43A 1M65A 4WDXA 2BV9A 3L12A 4P7OA 3W7IA 1SJCA 1VFMA 1ZUAX 2EJ1A 4A2SA 3NQGA 3QH2A 3ZOAA 4DAIA 3GG0A 3XINA 1YHTA 5EMYA 3VOIA 1AQ0A 2PBOA 4JTEA 2WVSA 1AL8A 1Q85A 2HZGA 5DMYA 4LPCA 5LNRA 4HHPA 1A5AA 2X2YA 4MB5A 3WQDA 3EWZA 1F3EA 1D7KA 3P8IA 3TTEA 1CBGA 1AJ2A 5CAKA 3Q4DA 4JQ2A 1CB2A 4LWWA 5CZKA 5F4XA 3KOXA 1JR1A 4HPHA 1Y8BA 3THAA 4GH1A 2YW4A 4OOUA 1KBBA 4W9TA 1UH2A 3TQVA 2PGWA 3A21A 2WHKA 4G9PA 4DBSA 3IJ6A 3O8AA 2V5JA 3V1PA 5ABFB 3QGAC 4B5NA 4ALDA 5EMJA 3NM3A 1L6YA 4FX6M 2IPFA 2INZA 1VBRA 1IR1A 1TKKA 5FJPA 2VCCA 1TUFA 1QO2A 1X1NA 5A6AA 1R3QA 4P7QA 1TPH1 5JBEA 4HN4A 2EF9A 4A4AA 2XG9A 1TG7A 1ZB5A 3UZ5A 4DBEA 3VO0A 3BCJA 2P53A 3IJLA 3S9IA 4YLWA 3Q65A 3EA2A 1N8IA 1CXKA 3JU2A 1U83A 2E8ZA 1IHIA 2OQHA 3NNTA 3MZ2A 3BAWA 2JGYA 4U2YA 4Y7EA 1AQFA 3M0YA 2Y1HA 4MJMA 1YE4A 3S46A 2O56A 2H6RA 3WNNA 3U7VA 1UR3M 4JTRA 1PYFA 3IJDA 3H26A 3UERA 3GR7A 4A3YA 3WBEA 3SGGA 8XIAA 2OEJA 1OT1A 1LLWA 2FZNA 3E3HA 2FZDA 2WQDA 4ZL1A 2EG8A 1LRQA 1OM0A 1HZYA 5ABGA 5TBOA 3T78A 1K6AA 1X96A 2CITA 4IMDA 4UIOA 5T9BG 1PZ3A 4J3WA 4FOJA 4UTLA 1TQJA 3NTYA 5CBBA 3HG5A 4MWAE 5D04C 5D38A 3AIQA 2ATMA 4FHAA 4QDWA 1GONA 4P8VA 1IXQA 3IVUA 4LB4A 3AHXA 1GPFA 4F0KA 4QBXA 3RO6A 5DBTA 1A50A 4OJYA 3H2MA 1R9ZA 4HSHA 4D6IA 2V2DA 5BWAA 2VNCA 4DLFA 3VKAA 1A5CA 2O9RA 1U2YA 1CB7B 1SFTA 3DEQA 1XUZA 2ZX6A 3HG3A 1JPDX 3TP4A 3FVMA 3L68A 4X9YA 4PMRA 2E9LA 1I75A 1VEMA 1ICQA 2VX7A 5I3GA 3IK2A 4CNUA 5FSDC 4UFIA 3QLDA 2PLKA 4MFDA 1S38A 1IZKA 5JXQA 4Y6GA 2VC9A 1OC7A 2QVHA 4DI9A 1EF3A 5FAJA 3RX3A 2DZXA 1GOXA 4XAFA 1GYNA 5GNZA 5HQMA 1EGZA 3WLIA 2X09A 3U3HA 4IX0A 3G1AA 1H60A 5MKGA 3LN3A 4ZQRA 2W9MA 5CPTA 3W74A 3PWAA 4UFJA 4OV9A 4PL1A 3KLLA 1Q7MA 2QLYA 3MMWA 1PV8A 3AJXA 2VJXA 2X30A 2A3LA 3HU7A 2FB2A 4M81A 4GBUA 3WLSA 2O0TA 1ONRA 3A24A 2QCMA 3AUJA 5LGZA 3KRZA 2WANA 5BROA 5FCZA 4KWWA 3HV9A 5CC5A 1G4SA 4NL1A 3JRKA 1FXPA 3FX4A 4CD8A 5CPQA 1E4MM 4CD7A 1R3SA 1R46A 1OC6A 4XAZA 2BY0A 1ZJAA 4M1RA 4LCQA 4Z1BA 1WYIA 4GNKB 2NVCA 4GYPC 3M0IA 1H1ZA 3ZVHB 2OWCA 4JFSA 3EDEA 2XM2A 4ZEPA 1Q5MA 3GR4A 3N2XA 1MW3A 4ZE5A 4JHMA 3DHDA 3NG3A 3ZWTA 5FJTA 5EY5A 3KVJA 3MDWA 3SCSA 1H63A 3QQ0A 3EDJA 1GZ1A 1KLYA 1SO6A 2QQ6A 2YCIX 1GVEA 4B16A 2I1OA 1THFD 3TAOA 4JTQA 3AJ7A 1OD0A 3B05A 3LB0A 1L2UA 4S3AA 1NDYA 4GI4A 4Q8WA 3ZIZA 2XWEA 4F48A 4M6PA 3W7JA 4KCUA 1V3LA 2PUZA 1M7PA 3MHUA 5H8PA 1KXHA 3N73A 4C65A 1P0KA 2VI0A 4FI4A 3CTLA 1KWKA 5AC7A 4AWTA 5CJ5A 3UWWA 1H1YA 3CUXA 2Z7KA 5C7VA 2J25A 3VNLA 3WD2A 2QCLA 4LU0A 5RUBA 4BS0A 2HE5A 3MCNA 1TVLA 4TU1A 1KFCA 1VD6A 3O6AA 1QHOA 2QULA 3LTPA 3SSZA 1QXLA 2PDJA 4F0RA 4HOWA 3UZZA 3B0XA 2YA1A 4U5KA 3KBNA 2NX3A 4KWOA 3KCJA 1BRLA 3FAWA 2B7PA 1QHZA 3GKFA 3NFUA 4LX4A 1E72M 4NJKA 4NZ4A 4CU6A 1RVGA 1Q6RA 1VYSX 4N4PA 1HGYA 3DX5A 1OX6A 4FS9A 3SBFA 4O17A 1AH3A 3IVSA 2WNWA 1GGOA 3N34A 2INFA 4ZZ9A 3GYCA 2GSJA 1W3NA 3AZTA 3BGJA 5IHSA 3F2DA 1UBSA 2DH3A 1ZL1A 1K1DA 1RA0A 1XD1A 5H8UA 2P76A 1E0VA 3CJPA 4HNOA 2NQ9A 3W53A 3GX9A 2VD9A 2A2IA 5I3FA 1GW9A 4ZE4A 1ZTVA 3K13A 4DNMA 3F5JA 3PJWA 2BGQA 2MUCA 2FHFA 4QITA 5AZ0A 3UA3A 4BJHA 3FY1A 3UJEA 4JIIX 1TPWA 1JYNA 4GY0A 4EVZA 3BW2A 4ORMA 5H91A 1JCJA 1EJSC 1RBLA 3GNPA 5FJIA 2OXNA 3SUVA 1GUVA 3VNYA 3GTFA 4ZFCA 2O55A 3N3MA 3RCNA 5I00A 4WEVX 3KBMA 1TZZA 2B81A 4BR1A 3C2VA 3EZ4A 5GPRA 2NWRA 1VBHA 2C16A 4ZXOA 3WLTA 3WNPA 1DJGA 1D7FA 3URNA 1ZU8A 2G97A 1A53A 3W23A 4KEVA 4HMDA 4RJEA 1M5WA 2NWSA 1VF8A 3CV1A 4WSHA 9CGTA 1LDCA 3AISA 2DFAA 1ZJIA 4ICCX 3V7PA 1EJUC 3CLWA 4YJ5A 4L4LA 5C9RA 2VC6A 1H4PA 3NQFA 1C92A 3C2EA 2WPBA 1UOKA 2WK2A 3S0CA 4XTDA 5I03A 3T8LA 2ZADA 3PUOA 1R5YA 3PBGA 4PCSA 3A6OA 4PEEA 4AYSA 1KR0A 1DE6A 4S3FA 5I3IA 3PZMA 2QGYA 2E40A 1JZ3A 3WDHA 1V51A 5AYIA 4YTQA 2H3DA 2FHCA 2W91A 1XUUA 1HJXA 4XO7A 2V3DA 3BQ5A 4L4PA 3C3NA 3NPVA 4UZSA 4FPSA 4UNIA 1RUSA 2OSWA 3P2VA 3AHYA 3AHZA 1BQCA 4MZ8A 3CUIA 2QIIA 2ZA3A 3CC1A 3NQ7A 2CPUA 1E1CA 1OFDA 4R7OA 3F4WA 3S5YA 2A21A 2Z1XA 4IQDA 4AF0B 4Q4KA 3R2GA 4NNAA 3WDRA 1CW2A 1IV8A 1VPXA 2GSHA 5HULA 1UIOA 3OLDA 1JFHA 1VFLA 2F8QA 1NWTA 2NW0A 5F7UA 4UTTC 1JQXA 4LVGA 4JHZA 4S3EA 3FDKA 3W2JA 2RUSA 5JVLA 2CWXA 1JCYA 1ML1A 5DQPA 3NQ6A 4IPIA 4S2CA 2BP1A 1E1FA 2OGJA 1KTBA 4ATDA 1IQ8A 5EMUA 2VDIA 4CCZA 3MSRA 2HISA 3DG3A 3SQLA 2ZWYA 3B9AA 3WQ5A 2NV1A 3MUAA 1VFSA 4IIEA 3KUMA 1YTKA 3GUWA 1J2BA 2DEPA 3WG6A 3DG7A 3WEOA 2Z28A 4GJJA 3R79A 4DUVA 1BYAA 1I2RA 3NDYA 1QRQA 3LNMA 1NP2A 1S2CA 4RL3A 5FJUA 2OT1A 5T91A 3UR7A 2YDQA 3KL5A 2WWCA 1MMFA 2EHHA 3L4XA 3E5PA 3W71A 3DFYA 1FXQA 3KBSA 4XD6A 4DJED 1U33A 4BF9A 1QNRA 2DZBA 8XIMA 1TCDA 1R0MA 3W70A 4H19A 3RLVA 3BARA 3LENA 4O0QA 4PULA 2C0HA 4G6CA 3P82A 1EFZA 4DB7A 1ADDA 3RR1A 2E3ZA 3CMFA 2AMGA 1S5VA 1LUCB 1OYAA 5A8PA 3MP5A 2EKGA 1WDRA 2J88A 4FXRA 5D4YA 4GVHA 3VKBA 3DHUA 2VQUA 1MW2A 2ASHA 5FJOA 1VLIA 1PZ2A 1EWEA 4HA0A 1QI0A 2BNJA 3A12A 1HJSA 3EPNA 3R7MA 2VX4A 4MLRA 2CLPA 2V3EA 3C0JA 4MADA 1REQB 3T0CA 2HMCA 2C14A 4X60A 4XSLA 4KIRA 1FWAC 3VUSA 3AIUA 4IT1A 3T55A 2HPMA 4IH3A 1OFPA 1REQA 4B2DD 5FOOA 3SQSA 5HXMA 3KLKA 3WX7A 4F2BA 3G5EA 4RXFA 2E6YA 2VYOA 5JU6A 4XV0A 1GEQA 4KW2A 3LV5A 1DP0A 1MSSA 4GISA 1NVMA 2ZYFA 4QEHA 4UQDA 1JZ7A 4JKLA 4CEXC 3GVRA 5HNNA 3VIPA 3GDLA 3NQ8A 4C1LA 1WKFA 2Z1WA 3LQLA 1EDTA 4RDVA 3FA4A 1RJQA 2WOQA 3SJNA 1NWRA 1VBJA 2CBIA 2DUZA 1U1JA 1T96A 2FMNA 1LLZA 2JE8A 3BGGA 4HNNA 2XIQA 2EEXA 2QCFA 3VFLA 4C6OA 3DHPA 3KOYA 2AKZA 3RCYA 4J5NA 3LU2A 1B5TA 1FWFC 4NUWA 3M0JA 2HEJA 3EOEA 1A4MA 1OFQA 3VNKA 1PDZA 1WBJA 3W2MA 3LCWA 3V5FA 1QATA 3VOJA 1EZ2A 4C7FA 3STCA 2AQVA 2I5QA 2VEKA 1E6SM 3UYCA 1SMDA 2PWHA 3TEVA 1HT6A 1V3MA 1LYXA 4PGLA 2HV5A 1X7IA 3UR2A 4IMCA 4MPKA 2QUVA 3NOYA 3CH9A 4FOUA 4XBJA 3UVIA 4QGCA 5ABEA 4AHQA 2WC4A 2YSWA 3WMCA 3EOUA 3MPGA 5I5RA 1BGAA 1V03A 4E5TA 4LH8A 2XUCA 2Y0FA 4H9YA 4DLMA 3NEVA 1U5HA 2GL5A 3CUZA 3LV6A 3OVGA 1G7UA 1RPKA 2C1IA 4XZMX 1KGXA 1MZRA 3EPOA 4HYRA 2NQHA 5KZ6A 4P2VA 1UWTA 1QW9A 3RO8A 3TC7A 1FQ0A 4MKSA 3U5UA 3TFCA 5FL1A 3QGVA 2YCKX 1MXGA 4XKYA 1TMLA 1V8EA 1P7TA 1W2PA 3UY7A 3GDMA 2IQTA 3W7CA 4AC7C 4JIPA 4GIYA 1C90A 4WJ8A 1EP2A 3FV9A 5G5IA 5LZLA 5XINA 4BFAA 3NDOA 3S9ZA 4YCPA 1PZ1A 1POKA 1JDDA 5AYYA 2YOCA 1PKLA 1E1CB 1UD8A 1UIPA 5G4EA 3FKKA 3A9IA 2GFTA 1R85A 2POZA 4C6BA 1T40A 2X7VA 3B9DA 3GXTA 3SCNA 3GC4A 1NELA 3UFYA 2QPUA 2TRSA 2OSXA 4G7FA 4QIUA 3UPMA 2QDDA 4HT3A 4QR6A 1IZCA 3GIPA 3O16A 5CH9A 2D73A 4D9PA 1Z48A 3KS6A 1PWMA 4Y90A 1W5MA 4D8LA 1TYGA 3VD5A 2FMOA 3DESA 1WP6A 3QSTA 3LPPA 2G50A 2OZ0A 3C0LA 4B5TA 4NNCA 3GLCA 3B0YA 1MWOA 3UG8A 3MKKA 1ONWA 4Q33A 4PTVA 3NZQA 1VC4A 4L1XA 3VAVA 1R2RA 4WY0B 2FPVA 2BMBA 2J7BA 1W9UA 2DQXA 3IK4A 4DM1A 1TELA 4WVXA 1HKWA 3MS8A 3HQPA 3C4UA 3MC5A 4NX5A 3MWCA 1ME9A 4JFWA 5B80A 1RAKA 3WCZA 4C5YA 1UROA 3B03A 1LTDA 4IJBA 4IPJA 1OQFA 1JCXA 4TV6A 2J8GA 3SEPA 1JZ2A 1BEUA 2ISSA 2QJIA 2XN2A 4H83A 4N6EA 5A94A 1PAMA 3BV4A 4XD4A 4S3KA 4EKJA 2WW5A 3UCDA 5GNYA 2R6OA 2PA6A 1C3FA 1FBAA 3Q2DA 4LSBA 1LOLA 3FDGA 4JY8A 2Q8XA 3VA8A 4MZYA 1WKEA 4A8NA 4Q3MA 1SMAA 1AFSA 3CAQA 4PH6A 1B54A 4IGSA 1PCWA 1QNQA 3CZJA 3SFKA 4NSBA 3CV2A 2J75A 2P8BA 2GVEA 3H7VA 5DANA 2A7NA 1NY1A 4I6KA 1HKIA 2WYSA 4PN2A 4QSFA 3LCLA 5BMWA 2YLLA 1GJUA 4KWUA 4HIBA 4Z2GA 1XIFA 4IISA 2RDWA 1R87A 1F6KA 1GEHA 5F2GA 1QU4A 3VNJA 5LXXA 4BI5A 3QJAA 1MRQA 2X40A 1HJWA 3W6YA 2V30A 2YFOA 4RZ6A 1FHVA 3UT0A 4AIUA 3LRLA 1B9BA 1LL6A 2V3GA 3TFXA 4FOKA 2ZVRA 1FX6A 2TODA 3L2MA 3QMSA 4GYKA 4UFLA 2JEQA 4DF2A 1L8NA 2PTXA 4QAWA 1QI5A 3W25A 3EKZA 4M51A 3CIWA 4GZ7A 1AH0A 4QG8A 1W37A 4INFA 2A3AA 1L6WA 4ACYA 1BYDA 5C7HA 1IWPA 3TMLA 5ABHA 1KCXA 1I60A 1KCZA 5A6BA 3K1GA 2OFJA 1R30A 4CQBA 1WDPA 4MWAB 4HU0A 3RPDA 4J40A 3CZEA 2WSPA 4MNKA 2DP3A 2OG9A 4TIMA 3T08A 1Z8AA 4MOZA 3FA5A 2ZA2A 4FXSA 1K8XA 2X0YA 4EWND 5D9PA 3W1UA 4PMDA 4KWSA 1NWSA 2CW6A 1U1UA 2DDXA 3M16A 4AD5A 1BWKA 3FN9A 2D23A 1BYCA 1CGYA 3FJLA 5HWNA 1LL4A 1F8IA 3WIJA 1P0DA 3WL1A 2J9YA 3ZO9A 2AL1A 1ISWA 3EWWA 3PFRA 2GLKA 5GJNA 4JTUA 5AHLA 4JTJA 2EPLX 2IS7A 2VRQA 2D2HA 3RLHA 1JAEA 3C2YA 1TJPA 1HF6A 4AHOA 2IKHA 2EPMX 4XVEA 1UW9A 2WNZA 4A6GA 2Z1SA 4A3HA 4XAGA 4BY3A 3EOLA 4KF1A 3F2CA 2F61A 3E1F1 5M1TA 4NIRA 4QLJA 4LEQA 2ACRA 4AVOA 1LL7A 3CH0A 1NDVA 1X6LA 1TPB1 2IUZA 3K8MA 1DHPA 1XDLA 3MP3A 3CZLA 1MO0A 3CPRA 4HK6A 1A3WA 5DMNA 4O18A 2I16A 1W54A 3CL6A 4EPEC 5DN1A 4JQ1A 5F2LA 5DCDA 5E0KA 3H2NA 3ZM8A 1R2TA 5G2HA 2NUWA 3VOCA 1PO9A 4D6FA 1DPMA 5A3HA 1J93A 1BAGA 2YKKA 1FWIC 3EX6A 2QF7A 1TV8A 4EANA 3NYDA 2Q6ZA 3VIOA 2WM0A 4ZB5A 2Z0IA 3N11A 2ICSA 2ZX7A 2VVNA 4Q4OA 1J79A 3N3TA 3R12A 2YR1A 4PSRA 1MQRA 1CI1A 4A35A 2MNRA 3KTCA 1YPXA 3LHVA 4GPNA 1DJXA 2FDMA 1X7FA 4KEZA 1US3A 3WH5A 3MUCA 3LGEA 3BAIA 4HCHA 3BSGA 1AL7A 3V35A 4HHMA 1XCWA 3C6CA 2ZUMA 2W92A 5CGMA 4YVXA 3IJQA 1W1PA 5HANA 1SO5A 2PZ0A 4J2PA 4QJ1A 1E6QM 5EFFA 3EB2A 3NZ1A 1UC5A 5HDRA 3UNTA 1FWRA 1OBAA 2FJUB 1OGBA 1R47A 2E5DA 3K8LA 2DSUA 2GDQA 3NQMA 2YYUA 1E40A 1VAHA 4K1GA 4JXCA 4LYPA 3PK7A 1MUCA 4O4VA 1BSLA 2P3EA 1Q63A 4FEZA 2ZICA 3NQBA 4QEEA 3CEPA 1XLHA 3W07A 4CNSA 2OSYA 2DVUA 1VFHA 4H01A 1DORA 4QS6A 4B3ZA 1XICA 3HGRA 2O92A 1J6OA 1IGWA 1LG2A 2G3JA 1JYXA 1X8FA 5J8LA 4L5ZA 3MHFA 1XLFA 2XSBA 3SCVA 3O06A 2CZFA 4LVAA 3VGFA 1GW1A 3OP2A 4IXHA 2A3EA 5FD0A 5F1VA 1VCGA 2CU0A 3OLGA 1KFLA 4AB4A 1I1XA 1C9DA 5C2GA 1TA3B 4G7EA 1Z9AA 2HBXA 4IM4A 1HL8A 4IQLA 3MSYA 4DYEA 4HU4A 1X6UA 1R3RA 3TSDA 2XIIA 2JQXA 3M44A 4WGXA 4ZMGA 1HKJA 2Y85A 4N4QA 2OO0A 1OC5A 2ZXQA 3A4WA 1ZY9A 3BMWA 4C6KA 2OX1A 3P7YA 3PC0A 1DOSA 3G8EA 2FGBA 4NU7A 2NLYA 3TUUA 2QVNA 4YTTA 2QJNA 3KOWA 2F7FA 4O28A 1XYAA 4DJFD 4PZVA 3UZYA 1UB3A 1H1NA 3RILA 3UCQA 3E38A 2D2JA 1T8XA 5E6ZA 2OKOA 3OGSA 2ISVA 5JBFA 3G1YA 4JS3A 5CGQA 1UMLA 4Q22A 2D0GA 3EWCA 1H09A 1DTUA 3NURA 4H8VA 1EC9A 2VRJA 4REQA 4GJ1A 1B9ZA 3H2OA 5I0DA 3B9EA 3WKZA 4S2BA 1Q6OA 5FI8A 4H9ZA 3PANA 4EAMA 3POCA 1A0EA 1JYWA 2DZPA 4V1XA 5K4ZA 2QF8A 1W3KA 3QR0A 4NI8A 3RAOA 1Z44A 4WXYA 1KM4A 4IFKA 5A6JA 1ZJHA 5HPCA 4ZOAA 5J04A 2XH4A 3KZPA 3OIHA 1PDYA 3R0UA 2FTWA 2HBVA 2PS2A 3QOKA 1TVNA 4DEFA 1RSCA 3ERPA 5LNSA 4JY9A 4GUIA 3GXPA 1XYLA 4MWAC 4IXXA 1IEWA 1RALA 4J2MA 4M29A 1DWHM 4MWAD 3HPAA 1AD1A 3CUGA 1PJ9A 3MUIA 1K7EA 3G1XA 1Y65A 3O15A 1B4EA 4XO6A 3DDMA 3R0DA 3AMCA 4GH3A 4IJCA 3WQWA 2ZWZA 2RGLA 3GM8A 2C13A 3K4AA 1VKFA 3V1HA 4LF2A 3TC6A 3LD5A 4LTSA 1JL8A 3GSMA 1Y7VA 2E9BA 1KRCC 3GNOA 1E3XA 1W31A 3NUKA 4DVOA 3UGVA 4YHGA 4JD4A 3DYPA 1XX1A 1GOKA 2ALRA 3CXOA 3GIQA 4IQEA 4D6DA 1NQKA 1PCKA 4FP1A 4Z1YA 4FNQA 3OG3A 1N55A 5CPMA 5HMDA 2Z27A 2J27A 2J9XA 3QBUA 2F84A 1S5NA 2W79A 2JF6A 4OBRA 1EP1A 4HNTA 4XZNX 3BLIA 3H2CA 3KCOA 4KFNA 3UWUA 3BLLA 3L4VA 1FDYA 3VKDA 1JCLA 4DBWA 3PG8A 1F4HA 3ZSSA 1V02A 1A49A 1RBOB 4PB5A 4O52A 3S5ZA 2WAGA 1R8LA 5T26A 3LCIA 2Z29A 2QGHA 2R1PA 3J7HA 1K70A 4EXBA 5DMMA 5I3KA 3BLDA 6XIMA 3VX0A 3RM4A 1A5SA 4RNIA 4H8UA 3N2BA 5BU6A 4H2CA 3L4TA 1KM2A 2FYMA 3AIRA 3TWAA 3RLUA 3P5YA 4HNUA 3GY1A 2R82A 3M7WA 4HJWA 4V1YA 5CPNA 2OYLA 1HL9A 1W1B1 2A6NA 4GI8A 1UQZA 4NJHA 5DCBA 3W7NA 2VGGA 3W1LA 3CT2A 3EDDA 1RJRA 4UTHA 1J12A 4UTWC 3G0SA 1RQEA 3RXZA 3SIMA 4A3QA 3CQ0A 3BICA 1TFVA 2DORA 4A22A 4AD2A 3ABXA 5E6YA 3KL0A 1U5VA 1HP4A 1J18A 1ITQA 3GG7A 1FWBC 2QZRA 1EA0A 3PBVA 4LRTA 5DT5A 3ZR6A 3W7OA 4AISA 3EYPA 3BSHA 3T0DA 1YPFA 3DI1A 3RX2A 1LQ2A 3T2PA 4DIAA 4JTSA 3IAQA 3WQOA 4LUJA 1Q8AA 4OFCA 4XUGA 4DZHA 1X6NA 1KBKA 3WEZA 1OK4A 4DUOA 1AD4A 4KFPA 3LHWA 1FDJA 1TB3A 4PB3A 3WBWA 2PBGA 2DJXA 1KM0A 4HTBA 3E2VA 2GVYA 2X05A 1DJWA 3PWGA 2YCEA 3TYUA 1POJA 3EMQA 5ECVA 1K3UA 4FF7A 3NOEA 4QNWA 1J0ZA 4RNHA 2ZE0A 5K9DA 4JN7A 1CGUA 3LCGA 1QI2A 1O94A 3B0UX 4Q8VA 3IV3A 1QWKA 3VCRA 4QDMA 2X16A 1F61A 2JGQA 4UR9A 1LWIA 1XH0A 5GQBA 4ACZB 2VELA 1YW1A 3A5VA 3N6QA 3T40A 1W3TA 1EWDA 3QVQA 4N9EA 1V6TA 1P1XA 4LVBA 3AYTA 5EGRA 4RZ5A 2OU4A 3IARA 4UR8A 2W4XA 5BWFA 4EK7A 4MNLA 3USZA 2BOGX 3TJLA 3W26A 1KV5A 1QTWA 2DZUA 4S3DA 1HG3A 4GX8A 3WNKA 1E6RA 4CN6A 5A1AA 2D20A 3B9NA 3LSCA 1LRTA 3HM7A 4LC6A 4PMVA 4CU8A 1GHRA 4M1BA 3LK6A 2WJDA 1BTCA 3L4UA 2KAUC 2W67A 1UZDA 1GOQA 1RP9A 1HQTA 3GHRA 2PWDA 3QKEA 3H21A 4F4RA 2VUYA 1E4LA 4Q6XA 3WD3A 2BDQA 3C0SA 4KGJA 1PS9A 2ZE3A 3IWPA 1JXJA 3NXFA 3LOTA 3FJ4A 4LW7A 4HJFA 3DYOA 1E0WA 3W1MA 1P1MA 3PUGA 2VVSA 1QHPA 2W66A 3KEHA 3GD6A 1QPKA 2PTWA 1F7BA 5C2XA 3B40A 5DRIA 3CPUA 4F2UA 1M7JA 2PWGA 4HNVA 3W75A 5CC6A 2JIEA 4Q8QA 2BX7A 2E25A 4K1WA 3WF1A 2Q01A 1N2VA 4J3SA 3KP1A 1WNOA 2XM1A 2V3FA 3ME3A 1I0BA 4NZ3A 3NL6A 3U48A 3AMKA 1XLMA 3GS6A 1S5TA 2ZRZA 4B5WA 1W3HA 3DKJA 3WL0A 1XFCA 2BGNE 2CC0A 4TXEA 3RM8A 2FPTA 3GBDA 4H1ZA 3WMBA 3I4KA 3S6DA 4MB3A 1FUYA 3GXNA 4I7UA 2HROA 1UJQA 4DYKA 4GA8A 2D0FA 2PLMA 3VVGA 4GYJA 1PX3A 1SJAA 4IJRA 4N9DA 2OR2A 3SURA 3WFLA 3GXIA 1FCQA 2VZOA 4JTDA 4B5SA 2ADAA 1OGSA 3T4CA 4FNTA 2A79A 4FX8A 2BFGA 5HWMA 1E3ZA 3TQPA 2WHLA 2QKFA 4LUYA 3QC3A 3C2RA 3N19B 1M01A 4O10A 4UTUA 2WHMA 1SZRA 4D6EA 3V0UA 3W00A 1E5JA 4IGHA 2PDYA 3WK3A 2J7HA 1P4CA 3QPYA 3TTQA 2NQZA 1I2NA 3CHCA 3H22A 3T2QA 2VC5A 1JRCA 2X0SA 4JIQA 2HK0A 5DY2A 4PUMA 4K68A 4JKMA 4KETA 1M7OA 1LCOA 5G2WA 3C0QA 3PWIA 4V33A 1FH8A 3RCMA 1B1YA 3RK8A 4C6IA 3HGJA 2XVLA 3O6DA 4XQ6A 3XIMA 2HVMA 1H7RA 5KZEA 2VKZG 3G6LA 3DENA 3IACA 3EMCA 2VEFA 2FJKA 2V63A 3M0LA 2PDQA 5H1WA 1I9CB 1OG0A 2ZX9A 3ITYA 4HD5A 5ENLA 3S8HA 1TPC1 2CXGA 1XH1A 3P0XA 2UY2A 2PP3A 3S3GA 2XVNA 2PCEA 3LM3A 2PWFA 2BG5A 2JFEX 2GJXA 3LHZA 2G3IA 5G4WA 4R5EA 4AHPA 4FIQA 3K2GA 4JN6A 1FKWA 5B7ZA 3RYSA 2ZCGA 2PZNA 1H7WA 3QW3A 4RE3A 1H7OA 1YPIA 3TNBA 4TUFA 1WDWA 4X2RA 4LY4A 3TLLA 4PMOA 1HKKA 5TNVA 4L7ZA 5CZTA 1V0LA 1ENUA 1VFFA 2XSXA 1VHNA 3WLQA 3STFA 3VZZA 3ZS4A 4M82A 1TMHA 1DIDA 3TX9A 2CFFA 4NYUA 5LHEA 4TVUA 1WKYA 3LI1A 2VURA 4P8WA 3SGZA 3GH7A 1TV3A 1VBUA 3SECA 1OG6A 1UA3A 4I8YA 3RU8X 3NQCA 4B5VA 1OX5A 2W61A 3AMDA 1V6WA 3A64A 1TO3A 3N1AA 4DPPA 4PBGA 3M0VA 3SIZA 2VENA 3GNDA 4GUJA 4NKCA 3TYDA 2DY3A 4O1BA 5AYZA 3UXAA 4S23A 1EUNA 3DBPA 3WLLA 1O5RA 3UETA 4HYWA 5I6SA 1J10A 1C8QA 3WUGA 3FAXA 3WLPA 2QCEA 3SB0A 2PE4A 4ERIA 1FWNA 2TMDA 3W27A 3WMSA 2E6DA 5D30A 4YIWA 1XBZA 2EG6A 1J0KA 2GVJA 3LNPA 1TWIA 2CHRA 5AYXA 3TYEA 2B7QA 1A5LC 1FWGC 1TRIA 3N9RA 4G7EB 3VNMA 4ZO6A 2ZXDA 3TE9A 1TA3A 1KB3A 3USBA 4AXNA 4ZSUA 4WX2A 1PYMA 1QNOA 3ABRA 1PHWA 1TV2A 2CKRA 1WUFA 3ANUA 1TPVA 3FIGA 2A3HA 4DF0A 2WSYA 4IZGA 4WR3A 2WJFA 3WDQA 5KSWA 2Y24A 2QW5A 3T07A 2CLHA 2W62A 1ZP4A 1RZMA 1B3WA 2YA0A 1MVYA 3IJ8A 3DU0A 1RQBA 3K4WA 3ITCA 4AZ6A 4IPLA 3W1QA 3EMZA 4Z17A 5CKSA 2HS6A 3M7SA 3O0FA 2FGZA 1PWLA 3VE9A 2NSOA 1FH9A 5D8WA 5D09A 4NRSA 3N2CA 4DZAA 3LERA 4HU3A 1RP8A 3SUSA 2PC8A 1W3JA 2NXIA 3W24A 4OECA 1PSCA 5BOOA 1VFTA 1RBAA 2G4JA 3MSGA 1BG9A 1NF7A 4J7RA 3WUEA 1MW1A 4QSHA 2CZDA 1G6CA 2J78A 1KBLA 1H51A 4TMCA 4FX7A 4XZWA 3FOKA 2ABBA 1TJ0A 4RE2A 1KFKA 5A6LA 1UR9A 1MZHA 5F2MA 3ZVIA 5I07A 4QQUA 1W2VA 1HP5A 3H7UA 4XG1A 2WLYA 1AW1A 3ZJ6A 2FFIA 3VCCA 2ZZ4A 3EKLA 4AC1X 4JZ5A 2PAJA 2UV8G 3N4FA 2J79A 1QFEA 2WJEA 4AU0A 6TIMA 2YXOA 3PZUA 5U7SA 4F66A 3GU1A 4ORIA 3AU6A 1AMYA 3R25A 4MMWA 4O11A 1YNPA 1QW8A 4CQCA 3GVWA 1I2OA 3N12A 1HVQA 4XBSA 3DH7A 3NZRA 4CU7A 1UUMA 1OFEA 1RD5A 4WQ6A 5DXYA 2CZEA 2ACSA 4BHYA 1DXEA 4HN8A 5AN7A 4C6MA 3MI3A 2OQYA 2CBJA 4B3KA 3P3BA 4PMJA 1LP6A 4C7DA 4GZJA 4PMUA 2F2HA 2V2HA 1KNWA 3OYXA 1UMYA 4AX6A 1OCQA 2J6XA 4LF1A 1ESWA 4EACA 3TAKA 4X9SA 3WQGA 1EX5A 4NT0A 1E0TA 4ERAA 4B5UA 4A8IA 3ARTA 5HATA 4Y96A 1KQZA 4US5D 4HQVA 4G2DA 2OYMA 3F7JA 4MDPA 1KXQA 2ZZ6A 2XIBA 2J8FA 2V67A 2VFDA 3H23A 4QP0A 1QASA 5DO8A 1PHQA 2OOFA 3V5OA 1M03A 2BTMA 3VI2A 1VPYA 2J9ZA 2RKXA 1SVDA 3UWZA 1XKJA 5HWJA 4GKTA 3SCPA 3TN6A 3W01A 4XK2A 3RM9A 4ZOEA 2YXGA 2DZTA 1LBLA 1I2PA 4LBSA 3VGDA 3TN5A 4IIDA 4O8AA 1K8YA 1W5OA 2NLIA 3T1GA 2WMFA 4J35A 4UWMA 4JEQA 1GOIA 2NVAA 2PDWA 2OEMA 4O19A 4G1NA 3KXQA 3RPTA 4Z1DA 3E9AA 1JCNA 4ERGA 3FVDA 4Z0SA 2Y5SA 5FJRA 3IJIA 4E2BA 3GHTA 1OADA 2VZSA 3Q45A 5E0FA 5A8MA 1S5MA 3RRXA 4GO9A 1UG6A 3QPEA 1JD7A 4CD5A 1UPPA 3PZVA 4IMFA 3LYEA 5IM51 1XRTA 4QFUA 4QNEA 1RH9A 3F2BA 3KVKA 4XZLX 3B06A 1BTMA 3GDTA 3WF3A 3QYSA 2XZ9A 4J9JA 3A13A 3TTOA 1EOMA 1XL9A 1UJPA 2YDAA 2GVGA 4EPBC 3A47A 1BXCA 4JGDA 1EL3A 2BSLA 1L6SA 1F4AA 3W73A 5CG7A 2W6RA 6REQA 4GIEA 1KKOA 3LXCA 4MNMA 3GXMA 3FJNA 4PTWA 2ZUUA 3HPFA 2BGSA 3MZNA 2OVLA 4JN8A 4MB4A 3THDA 4K8GA 5BOFA 4YU1A 2FZ8A 4GK8A 1OIMA 2Z4GA 2VZUA 3P14A 3PPHA 3EWBX 3W7PA 4QLLA 1KA9F 1ZAHA 1CWYA 3RJYA 5HBFA 3BJSA 4AZ5A 1JPHA 1JI2A 3BANA 4L64A 1CIUA 5HJYA 1YXYA 1F3WA 1E9IA 1VEOA 2H90A 1H61A 4AYGA 4S1FA 1DWJM 1KGUA 3QKZA 5JMUA 3EA3A 3MKVA 2R9RA 3TQ0A 1CENA 3MANA 4AH7A 2PD9A 4WDWA 4F2TA 4GKLA 2R1LA 4R88A 2PWUA 3CASA 1B3VA 4H6KA 3QM3A 3CBWA 3LPGA 4QAIA 1S2UA 3ZR5A 4CD6A 5A6MA 2WZEA 4RNFA 4LV9A 3G2GA 3P81A 4UTIA 2VWTA 4ICMA 1XJBA 2PTDA 1LBFA 1PIFA 4RV8A 4Q6JA 3MYOA 3BG9A 1PUDA 1OFRA 4GHRA 2YBTA 5HR6A 3TWBA 3N14A 2NZLA 5HNTA 2PDUA 2G95A 1C8XA 3SCTA 1KCKA 2UY4A 4HNCA 3TSMA 2ZBTA 2XZ7A 2PD5A 3CYVA 4GC3A 4UNLA 1UWUA 1LT8A 1ODUA 1XYBA 3M5XA 1H49A 4HA4A 5A95A 1V08A 2P0OA 3L0NA 5KZDA 4C6JA 3DGRA 4CN4A 3FSUA 1A3HA 3R0KA 4I7VA 3QV9A 3QHOA 4F9DA 2RFGA 4D6CA 2G3NA 3NXLA 3LSBA 4TTUA 2X1IA 5CLWA 4ZENA 1GG1A 2YLAA 3OPSA 1ZBVA 2WMIA 4E8CA 2JK2A 3PTMA 3DIPA 2ON3A 3VILA 4LUSB 1ZPTA 4WSKA 3LHYA 3VM7A 2XH2A 2O7SA 1GQIA 1YE6A 4GQRA 4U3CA 1UOZA 2PGRA 4UTFA 3ALGA 2XN1A 4HVXA 1FWHC 5EA9A 5AC8A 5CPOA 1E73M 3GU9A 2W3ZA 4ICNA 2FIQA 1A0CA 2WZIA 3BPWA 3FK4A 2O7QA 4MYAA 2XIOA 3HMCA 1MEWA 3O3RA 5EYWA 4WF7A 4KBXA 3SCOA 2HVNA 3W7MA 1TR1A 5I77A 3EOOA 5C8BB 4QTGA 4EF9A 3CAVA 3GXFA 1GKPA 3TN3A 5EMKA 3UG5A 4G56A 2P5NA 2ZC1A 3GXDA 1E51A 1ADOA 3PUEA 1P5BA 2CKSA 1B0IA 1BGGA 1H0GA 1FHLA 4FO4A 5A2AA 3SY1A 2WVVB 4P5UA 5M2FX 2A6LA 4QXIA 5DXXA 5HINA 4AZ7A 4JFTA 4BK9A 3WNMA 3EEZA 4GIAA 1YQ2A 3AIEA 3P5ZA 3PG9A 4QJ4B 1IT0A 1LRNA 1WKDA 4E4FA 5CC7A 1BG4A 1OIFA 1B31A 1T0OA 3E0IA 4L80A 3HG2A 1KD0A 3G1HA 3HMJG 4JL1A 5DY3A 3TV8A 1SPQA 4EWJA 3AZSA 1B2YA 3IUHA 5MF5A 1RY8A 1Q66A 3BCDA 1UH4A 3WN6A 5LIKX 2NV2A 3PSVA 4XB3A 4ACZA 3OTRA 4LQ1A 2DPEA 3CGTA 4W8AA 5BU9A 2VFEA 2OLSA 4AWEA 3RDKA 3UWQA 1WZKA 2GDUA 1OWQA 2PP0A 2ZZ2A 4QM1A 1PIIA 2W5FA 1MXDA 5EB8A 3URAA 2V5BA 1UKTA 3N15A 3TQKA 1KXVA 3PJTA 2VT0A 3KS5A 3C2FA 2GSEA 1W5NA 3SZ8A 1R3YA 3QLLA 1KM1A 2XJ7A 1WDQA 1XCXA 3H54A 4J28A 4ADSA 1D2KA 3B4YA 2HNHA 3BZJA 3WSUA 1ELSA 1J0YA 2PF8A 2DW7A 1AA1B 2ZUVA 1XIDA 3HZ3A 1QNSA 2ZFAA 3VD4A 2G4FA 4MUPA 5G1MA 3I7SA 4X63A 4ZO9A 1EDQA 2ZUWA 3NPWA 3STGA 3MV01 4FSAA 1XBYA 3U4FA 3R6IA 3PTQA 1HKMA 3AU2A 3TDFA 4NJIA 3GAKA 3M5YA 3CZ8A 1R3TA 4PEKA 3VZYA 4UQCA 3S6OA 2D24A 1XPYA 2D22A 4REQB 4NG3A 3RLGA 2DIKA 1QWGA 2GQ8A 3N17A 4FA3A 4W86A 3UG4A 1NSJA 3M0ZA 3V75A 4FIRA 2Z6IA 4FMVA 3W86A 4XD5A 2Y7DA 5EPDA 2VDGA 5I24A 2Y6ZA 3QZ6A 1ZP3A 4WDTA 1UP0A 1N8WA 1MFUA 2EAWA 2DZVA 2ESCA 1OT2A 2ZRVA 5CBIA 2PLJA 3OJGA 3W0KA 4BA0A 4MUZA 2E68A 1NDZA 1W9BM 4Q8NA 4AD3A 3OVRA 4MFEA 1GVYA 2YL9A 4M19A 3QRHA 1AJ0A 3VDHA 1GVSA 5F4WA 5AC6A 5DFAA 5I2UA 4LT9A 1KFBA 1HJQA 2V2CA 1ONEA 1ZFJA 2DZAA 2INEA 4W8LA 3IGXA 4U31A 1FCVA 1MNZA 4IPPA 2QAPA 4E3TA 1A5NC 4LNCA 4Z1CA 4UQBA 2VP8A 4A8LA 1V0NA 4RCXA 1E6ZA 1NJJA 3BUVA 5I7GA 5H2ZA 1WO2A 3TLQA 4Q4SA 4O0KA 5EL1A 3NGFA 1J8VA 2I9EA 3NR0A 2DVTA 3ZLFA 3BOXA 1UWQA 1T7LA 3R8RA 4IP5A 1C91A 5IFTA 2IPJA 4WLCA 4US5A 2JKEA 4IFRA 3GDBA 4Z2HA 1IEVA 4KRUA 2QEZA 5DEZA 1EJTC 2AAAA 2RDXA 1GVOA 2ISWA 1E0XA 2VR2A 4HZ8A 1KWGA 1OJXA 2J7FA 4E2DA 4ZQMA 2FFCA 2AQOA 3W7EA 4U28A 3RPMA 4WHBA 4WY0F 1JNEA 3UXLA 3GWQA 2DSWA 3NCOA 4Y9MA 3E5BA 1XLDA 1FWCC 1SU5A 1G4PA 3TK7A 1BXNA 1XLKA 5E5CA 2GDVA 3U5YA 1AODA 1RK5A 1RXOB 3VGBA 2VR4A 3BC9A 3PZ9A 3MMDA 4I90A 4LB3A 1FCBA 1G69A 3FYPA 4N9CA 3IEBA 1XLIA 2ZIDA 4JHOA 3TR2A 3IIOA 4U2ZA 3CB3A 1G0CA 4DWSA 1OFAA 2RDTA 1K8ZA 3IGSA 1PKMA 4GINA 3JZEA 4Q7IA 4OKDA 1EX1A 1EB3A 1ZQ5A 3CS2A 4UUIA 1Y5WA 3F4CA 3G0UA 3N4AA 1EA9C 2GZXA 4GXWA 4MF4A 2R14A 3WQCA 1V3JA 4LGXA 2GYIA 1YDOA 3RHGA 3VCNA 4JEJA 2A4AA 2NSXA 3WLRA 3VD7A 3WQ8A 1LZOA 4GYFA 2EPNA 1Y5XA 2IPWA 1GNXA 4B92A 1DIKA 1GVRA 3CMJA 4H00A 3NJ3A 3S5NA 4DI8A 2XSAA 1FY6A 1XYCA 1RJPA 3FXGA 3AYVA 1R86A 2DUXA 1FKXA 2Z1VA 3QOMA 4RNJA 3SUWA 4PA8A 1EXPA 2BY3A 5AY7A 5AECA 3FLUA 4KEMA 4GE8A 1P6CA 3HPSA 4RZBA 4RLIA 1SW3A 1NFGA 1R9XA 3JS3A 1UQYA 3B0PA 5BOEA 4ECLA 1R7AA 4JIEA 4FK9A 2HNEA 3TNOA 2DIEA 1GOWA 4GNJA 4MWAA 2BVYA 3GNXA 4JOMA 1UWIA 3AIVA 3PFMA 4WOZA 4HKPA 4YYCA 3PTKA 2Y2WA 1AUSL 3D47A 4WCJA 1LROA 3ZJKA 3VOHA 1S2VA 4Q4MA 2QYGA 1RR2A 3A4AA 1WX0A 3QZEA 4YTUA 3W1TA 3ICJA 3H70A 3HGSA 2ZUNA 2FLIA 4CD4A 3NSXA 3A4XA 1ZBKA 4E2OA 5D2WA 1J6PA 3W88A 3QFEA 3BGAA 5LYRA 3SCQA 4OHQA 3UBPC 2X1TA 1DJZA 3LDVA 2QDHA 4YL2A 4ROPA 4AIBA 2VFIA 1CPUA 3UJ2A 4PODA 3S1XA 2W0UA 5EBAA 1GQLA 4Q8OA 4MTVA 3RGTA 5I06A 1GKQA 1K9EA 4FB7A 5AB3A 1V7AA 5D03A 3TYCA 2J7DA 1CGTA 2YBVA 2GQ9A 1BF6A 4AD4A 3PNZA 4LFYA 1QW7A 4ZTYA 3VC6A 2R94A 1WB0A 3MJMA 4B4FA 3DC8A 1XDMA 1XHGA 1PEZA 4BZYA 1F8MA 2WMIB 4RK8A 1WV2A 1P43A 1GCYA 1EXBA 3NO1A 2PDMA 3VK5A 2NQJA 2CLKA 4AEFA 1A5KC 4OBTA 5BZAA 3LQGA 4AWUA 5AHMA 1D8CA 5LNWA 3VM5A 4TV5A 3KZSA 3GW3A 3TXVA 2G5WA 2XN0A 5