1AZ2A

Citrate bound, c298a/w219y mutant human aldose reductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
314
structure length
314
Chain Sequence
SRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPYAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVAALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The alrestatin double-decker: binding of two inhibitor molecules to human aldose reductase reveals a new specificity determinant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 84
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1997-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1az2A00
2IPWA 2FVLA 3R7MA 3EB4A 4ASTA 2FZBA 5JH1A 1XF0A 3ONCA 4DBSA 4MHBA 4XO6A 1HQTA 1GVEA 3T42A 2PDFA 1S1RA 1ZGDA 1QWKA 5LIXX 4L1WA 2DUZA 1AH3A 4GIEA 2NVDA 1EL3A 3Q67A 5HA7A 3UG8A 4DZ5A 2IKGA 2I16A 3V36A 2ALRA 2IQ0A 3P2VA 3DOPA 2IPJA 3CMFA 4YVXA 1LQAA 1IHIA 3BURA 4XZIA 3LD5A 4XK2A 1C9WA 3N2TA 3V35A 3WCZA 3QKZA 1IEIA 3LENA 3M4HA 2HV5A 3UZXA 3UZZA 3VXGA 4JIHA 2F38A 3UP8A 4F40A 3COTA 4XZNX 3R58A 3CASA 3R43A 2ISFA 3Q65A 3LQGA 4EXBA 2PDWA 2PDXA 1X97A 4LBSA 2HEJA 3S3GA 3CV6A 3LBOA 2HVOA 2FZDA 4FALA 1PZ0A 4DBWA 2PZNA 2PDKA 4JQ2A 4PRRA 4JQ4A 2INEA 4EXAA 3WBXA 4JQ3A 3UFYA 1HW6A 3R6IA 1A80A 5C7HA 2PDJA 3M64A 4YU1A 1YNQA 2PDHA 1OG6A 3CAQA 3NTYA 3WG6A 4GA8A 4I5XA 2PD9A 1Z9AA 4LAUA 5HNUA 1ZQ5A 3LNMA 1YNPA 4GCAA 1AH0A 1LWIA 2PD5A 4YS1A 2I17A 2J8TA 4PUUA 1VP5A 2PDCA 2INZA 3UGRA 2PDIA 4QXIA 4Q3MA 2PDUA 4OTKA 4XVDA 3BUVA 4H8NA 1EKOA 1S1PA 2PDYA 3KRBA 2VDGA 3F7JA 4JQAA 1YE4A 1ADSA 2FZ8A 3GUGA 4XZMX 2HVNA 2ACSA 1Z89A 4LB3A 2PDQA 3MB9A 2P5NA 2ACUA 4ICCX 4PMJA 4PR4A 1AZ2A 2PDGA 5LIKX 4QBXA 4XZHA 3V0TA 1PWLA 3FJNA 4RPQA 4JQ1A 4LAZA 1RALA 4JIRA 4IJCA 3H7UA 5AZ1A 4Q7BA 2PDPA 3V0SA 1Z3NA 4JTQA 3GHUA 2IQDA 3U2CA 1K8CA 3FX4A 2PDMA 2BGSA 2DV0A 2QXWA 1EF3A 1US0A 2R24A 1EXBA 4NKCA 4XO7A 4IGSA 2WZMA 3UYIA 4IJRA 5LIYX 2IKJA 4FZIA 1VBJA 1R38A 1YE6A 4WDUA 2PF8A 4FA3A 3R94A 2A79A 2IPFA 3CAVA 2ACQA 3WBWA 4JTAA 3H7RA 1RY8A 4GACA 1X96A 1S2CA 3GHTA 1ZUAX 3RX3A 4PRTA 3CV7A 4XVEA 3ERPA 4R9OA 3UZWA 3LN3A 1XJBA 3BCJA 4HMNA 1MZRA 4LB4A 5KETA 3R8HA 4FAMA 3C3UA 1JEZA 4H7CA 2AGTA 4JIIX 3LEPA 2R9RA 4XZLX 4GQGA 4YVPA 2ACRA 5DANA 5HNTA 2BGQA 1FRBA 3N6QA 3H4GA 3RX4A 5M2FX 1UR3M 1MI3A 4WEVX 1RY0A 2HE8A 1M9HA 1XGDA 4XAPA 1PYFA 2PDBA 2FZ9A 1ZSXA 1QRQA 3B3DA 3UZYA 1X98A 1AFSA 4HBKA 4LBRA 2F2KA 1S2AA 4WDTA 1Q13A 5AZ0A 3ONBA 4WGHA 4JTCA 3G5EA 5LIUX 2IS7A 2PDLA 2C91A 4JTRA 4PUWA 4GABA 2FGBA 3G1RA 3MC5A 3UWEA 1Z8AA 4WRHA 2IKHA 2PDNA 1T41A 3RX2A 4DBUA 1T40A 2NVCA 4YVVA 3O3RA 4G5DA 3LZ3A 4ZFCA 1PZ1A 2PEVA 2HE5A 2BP1A 1J96A 1SM9A 4WDXA 4QR6A 3LUTA 2IKIA 1AH4A 3WBYA 2CLPA 2IPGA 3GHRA 3LZ5A 3V0UA 4GQ0A 4JTDA 3LQLA 4QX4A 3R8GA 4AUBA 3BV7A 3DN5A 3M0IA 1Q5MA 2DUXA 5JH2A 3EAUA 3EB3A 1AZ1A 4L1XA 2WZTA 3O0KA 3GHSA 1PWMA 2PFHA 4WDWA 3D3FA 1MRQA 5LIWX 2HDJA
chains in the Genus database with same CATH superfamily
4YTUA 3NL6A 1Y65A 1QWGA 2J7BA 1JCMP 5EFDA 3RU6A 3LHYA 1FDYA 3WFZA 2FLIA 2J7HA 1E6XM 4C6PA 2CLIA 1Q7ZA 3OP2A 5E5CA 3UXLA 2PP0A 1HVXA 1I2NA 3AJXA 1TE1A 2B7NA 1AH3A 3SB0A 4ML9A 1XIJA 4LOCA 4D6GA 1W1PA 3W7IA 3T08A 2AQWA 4L64A 1HKKA 3H8AA 4PUJA 3FIGA 4DAFA 4W9TA 3U4FA 2V30A 4ZO9A 2Q8LA 1J93A 3S6DA 4ENLA 3WELA 2OX1A 5A6KA 1O60A 3LD5A 4U2ZA 5F2LA 1GCYA 3IIPA 4Z42C 3E0WA 1PXGA 1G6CA 3P84A 1NP0A 2D2HA 1MRAA 5G4EA 6ALDA 2DPEA 1VEOA 5DXYA 4Z2LA 2Y7EA 3EPOA 1ONEA 2BMBA 4Y96A 1GGOA 2NQLA 1ZCCA 3PHAA 5MHBA 5C8BB 4R5EA 3R43A 3LDVA 3WH7A 2EPMX 2VFEA 4E6MA 3OGSA 3KOFA 2I14A 4EXBA 3N4FA 3EMZA 4WKFA 3B8UA 4AMCA 3VD7A 2OGYA 3H55A 2FH6A 3CZKA 2WYSA 1HKVA 3LBOA 2XN2A 4HOXA 2AAAA 4QE1A 1XPGA 4GJJA 5DCDA 4MF4A 3UGVA 4D6CA 3H2CA 2Y70A 3E1F1 3LCFA 3DGBA 3WJYA 1U5VA 1OCBA 4DRSA 4LVGA 5FL1A 3FS2A 4U4MA 1LRQA 1XH1A 2HRWA 1DL3A 3E96A 4FLOA 5I79A 3DYMA 3OO2A 2VELA 3BSMA 1W9XA 3KS5A 1Z69A 2Z2UA 1P6CA 4A8NA 1EZ2A 4HK6A 2ZVRA 4LGXA 2C8NA 2Y5EA 1VIWA 1YDVA 3LGGA 1VP5A 5CPMA 1YDNA 2VFHA 2XISA 2CZDA 3CYVA 1XIIA 4CNNA 1QO5A 3RO6A 2PWEA 3TFXA 4M6VA 9RUBA 3BUVA 3KVMA 4LBUA 1A3WA 3FEMA 4KCUA 3RR4A 4JQAA 3CO8A 4CU7A 3GUGA 2QGHA 4MGGA 4B3ZA 3RRAA 4CNSA 1X39A 3ES8A 2DZVA 1D2KA 3TCSA 3NQBA 5KZMA 3H4WA 2Z1SA 5IDZA 1F2JA 4MDPA 3ORWA 3DEQA 1WX0A 2Q8XA 2F8QA 4L9XA 4DHGA 1YYAA 1O6IA 1OD0A 4DIAA 5E9AA 2ZUVA 1VPXA 2G5WA 3W23A 1CI1A 2C1HA 4C60A 1UC5A 3LG3A 1K9FA 4RLIA 2R24A 1F8MA 3AS3A 1KTNA 3P74A 1DWAM 4HOWA 1V02A 2WZMA 4B5TA 3WJZA 2E68A 4GNVA 4Z1AA 2CPUA 4MB1A 2C13A 2CKRA 4XB3A 2QR6A 1W54A 1FH7A 1DQXA 1J0IA 1SFJA 3NQMA 1XSJA 3R8RA 5HPOA 3GTNA 3WQVA 3L0NA 2RJGA 3PWGA 1R2SA 1X96A 5IBXA 1YKWA 1XLCA 4CNUA 1S5NA 2D3LA 2DSUA 5HMDA 3K5XA 4NZ5A 1DXFA 2FB3A 3FKRA 3CZEA 3RMJA 3FNDA 1E4IA 4ERIA 4ZQNA 2GVLA 3OA5A 1IYXA 1CXEA 1NQ6A 1QJWA 3GXPA 4EE9A 2HBXA 4XKYA 4HSHA 4CVUA 1OSEA 3AMCA 1R3YA 3WLIA 1V77A 2V38A 4LUTB 1LDCA 1EGMA 3NWRA 3T55A 3EWUA 4NJHA 2HNEA 4HPNA 1G7VA 4JTIA 1E3XA 2EG6A 3KEHA 4J2PA 2VCBA 2PCQA 4XAFA 2Y1HA 2AL2A 1XR2A 2Q6ZA 2VXNA 4ZODA 3TQVA 4RNHA 3WLQA 1MW0A 3NO5A 1IR2A 1JULA 5HANA 1S39A 2X30A 3EDEA 1W2VA 4LSBA 4IIBA 4P8VA 5C2GA 1VFSA 1VYPX 3N34A 3W7HA 1AL8A 3URQA 3EPNA 3BO9A 4WY0F 1J0JA 5TD4A 3F2CA 4BA0A 3DFQA 4FX8A 3FDKA 4FNTA 3B9AA 2CLLA 3PF3A 3ABXA 2B7QA 4O1AA 4N9BA 2YDSA 4BWLC 2F61A 3KOWA 3PN8A 4OZOA 2BZNA 3KBWA 1TZ7A 5EY5A 4JNZA 4RXFA 3VGFA 4ZQRA 2W3ZA 1Z8AA 1EP1A 4E3VA 2Z4GA 5I03A 5B7YA 1OFPA 3NL5A 2P53A 3NQ6A 3O3RA 2PRLA 1T6MA 1FWDC 3U2OA 1DJXA 4ZFCA 1YXCA 4UZUA 4JX6A 4HNVA 5C55A 4GYFA 2BODX 3WQ4A 4O1DA 2HE5A 5BYWA 4P8UA 2PBOA 2VEGA 1E0TA 3VKAA 1A0DA 5A6SA 4WDXA 2B7OA 1TPEA 1XCWA 3IJ7A 2C79A 4MNMA 1WAWA 4UIOA 4DELA 1CGXA 4AC1X 1W1TA 3TYDA 5LXXA 4RV3A 2WM1A 1ODUA 5CCZA 1UUOA 3U5YA 4QDPA 4V15A 3L4ZA 3BGGA 4GGHA 4RE0A 3VNJA 1CLXA 2Z6IA 3CJPA 1DBTA 5E9XA 4JY9A 3VIMA 1EF2A 2AL1A 3W1AA 3ABRA 4WQ6A 5D02A 4JL1A 3ABZA 3R79A 4AD1A 5LIWX 6PTDA 4F0LA 5H2ZA 4CNPA 2HDJA 2F9RA 3BOXA 3TN3A 5G4HC 1EB3A 1Y5VA 3ARQA 2PWFA 2VTFA 3K46A 1W3IA 3ALFA 4WOZA 1PVNA 3ONCA 4DBSA 3KZSA 4AWTA 1ISWA 3KZPA 1Q63A 1ZU8A 4LV9A 3S2LA 5BMWA 3TN6A 5CPOA 4W88A 4G56A 1WPCA 4Q8VA 1ZJBA 5CPTA 3WLHA 4H9VA 3UCDA 2HQAA 1QT1A 2BY2A 3OJGA 3GS6A 3HG2A 1JZ8A 4D8LA 3V36A 4RW3A 3VK5A 2FZNA 3I7SA 4DJDD 4EAMA 3AUOA 4ZCWA 1LQAA 1K77A 4JNMA 4MZ8A 3WQGA 4FPSA 2VRJA 3C8NA 7REQB 1M68A 1MEIA 3S5SA 2NT0A 1EC7A 1XC6A 1GYLA 1SJBA 5AVHA 2WKLA 2PMQA 3T8QA 1RCQA 2JEPA 3KP1A 5FJUA 5KEZA 3COTA 3S42A 4HMDA 3PG9A 3RNDA 5BOOA 3W26A 3LQGA 2CLEA 2ZADA 3CM4A 1OZQA 3N13A 1L6GA 3A21A 2D20A 4DO4A 3SEPA 4CQBA 2V6AA 1H49A 1Z32X 2XIOA 2ZTJA 4JTEA 3PB0A 1AUSL 2FZDA 3S2MA 1PE1A 1FH9A 1GTHA 3ECQA 2INEA 3KE0A 4EXAA 2WVUA 2V2CA 4ZXOA 2AQVA 4IPJA 2HWGA 3RCNA 1N8IA 5AYZA 2VZUA 3UWUA 3VI2A 4NJGA 1KM1A 4FNPA 3OZYA 3GIYA 3FJ4A 4HNTA 1BVZA 5BZAA 4JIQA 3WN6A 1WV2A 1HJXA 1Z9AA 1B9BA 3M7WA 3SM0A 2J79A 3HGRA 3F5JA 5HAOA 2ZC8A 3WD1A 1HL8A 1TKKA 2ZTKA 2VEFA 3AROA 2WXDM 3O15A 4B9ZA 2V8ZA 2DJXA 1OGGA 3SQMA 1Q6GA 3I7RA 3D3AA 1AW1A 3L5MA 2J7FA 1POJA 3VNMA 4PRWA 2GDUA 3S6TA 3NQGA 2OR2A 3MUY1 3ZWSA 2BFGA 2DZUA 2VDGA 1E5NA 3DHPA 1Q7MA 3ZJ7A 4J3UA 5RUBA 3I68A 1LBMA 1I2PA 4Q8NA 4PMQA 2DZXA 2ACUA 4GYPC 3A4AA 1UR9A 1WOAA 3BMXA 3IIVA 3LPGA 4NF7A 3W29A 1GT8A 4MADA 1TPB1 1DHPA 2QCDB 2VI0A 1W3KA 1D7KA 3UEQA 3BG5A 4I8DA 3RGTA 1Q6CA 3KCOA 4Q4RA 4QTGA 1RSCA 2E0PA 3BLDA 3GHUA 4DEFA 3W1TA 1B90A 2EEXA 3APTA 3EB2A 1KFJA 1TPVA 1FWSA 1GZGA 2VRQA 4PC8A 4QEEA 3CU2A 1UASA 3NEHA 1VENA 1EA0A 2QQ6A 4OWGA 4NKCA 3ES7A 2UY5A 3VKJA 1A3XA 5F7UA 2X8RA 4GG9A 2PGFA 3EOOA 1W8GA 2W66A 3QR0A 1YE6A 1WP6A 4WDUA 5IFTA 3RF9A 2WO5A 4M80A 4HN8A 2YCKX 1E5JA 4BKNA 1KC7A 4M24A 2ZFAA 1E3ZA 1U83A 3UT0A 3TTEA 3MMDA 2WMHA 4XD4A 2NXIA 3AI0A 5A2CA 5CC7A 5DELA 4PGLA 1CWYA 1GZJA 3LBMA 3GYCA 5HK4A 1QNRA 2J7GA 3WENA 3DI1A 4MKSA 3SADA 4BF5A 4M8UA 3KBMA 1NDYA 3TW9A 5CAHA 4S2BA 1DJIA 3CZLA 4EWJA 3D46A 3W73A 3GKAA 4H8UA 4PTMA 1LT7A 3TYBA 3N14A 3U48A 1UQZA 4AWSA 1Q8AA 4LYQA 3IRDA 4OECA 4M6QA 1K7FA 4GY1A 2O0TA 4IUGA 1GOOA 3OQEA 3CC1A 4K8HA 2HE8A 1XGDA 1D8WA 2R8WA 2GOKA 2XPKA 3W1PA 5DY2A 4UTUA 3QMTA 5KZEA 3PPGA 2AKMA 1T99A 3MKKA 4HPXA 1KRBC 1GW9A 2OLHA 3IGUA 1OHLA 1E9YB 1D3CA 5AHEA 3BAXA 3W84A 4WJ8A 1FY6A 4J4KA 2WLYA 1UG6A 1VLIA 3ISIX 3HPZA 1BQCA 4J3VA 5HQLA 2Z7GA 3FYOA 1R2RA 2Q02A 1QO2A 1EJUC 3BLPX 4OV4A 2GGIA 4RE3A 4H9XA 3MUAA 1XH2A 3TYUA 5D03A 4C6LA 4ZQMA 5BWFA 4ZZ9A 1YTEA 3S9YA 4QR6A 3WDPP 1IR1A 2X2YA 4GVGA 4H7ZA 3URBA 2FGZA 3UBPC 5BXRA 4JIPA 4JZ5A 4XZWA 5BRPA 3QPZA 4GXMA 4L80A 2X40A 3QHMA 2XGBA 2D2OA 4GXPA 2QUUA 3KLLA 3AZRA 1J12A 1KCKA 3UJFA 2PTDA 8XIAA 2VC9A 3CL7A 3F4WA 3I3BA 5FCZA 5K9DA 1SUXA 2J62A 4HB7A 3LBCA 2BWGA 2OXNA 5E1QA 2XTKA 2ZZ6A 5HATA 3VKKA 1DWHM 3DKJA 3L5AA 2YBTA 5AY7A 2G3NA 3PZTA 3EBVA 3H53A 1RR2A 5GPRA 1E73M 3MCOA 1IQ8A 2O56A 3PBMA 3DAQA 5TIMA 4JX5A 2BY1A 4AZGA 2V3FA 1UW9A 2C6QA 4QIUA 2QMJA 3CIWA 3P6LA 1NF7A 1S1RA 3KRUA 3DECA 3BL3A 3I4EA 3UG8A 4GD0A 2VWTA 2V68A 4KCWA 3M44A 3N2CA 2BNJA 3DOPA 4P7NA 5DX7A 2ZA3A 3CMFA 3M46A 4NAFA 4IXHA 4PEEA 3NPWA 4KIRA 1R3VA 1SO5A 2VR5A 4LUYA 3LENA 2D0GA 4O0KA 1YPFA 4J9JA 4GVHA 2PS2A 1V6XA 3QH2A 3P14A 2F38A 4WJXA 1S2VA 3MSDA 1CB7B 3CGTA 2YIHA 5L9FA 5I23A 4DM2A 4HYVA 3ELFA 5JBEA 2HEJA 1A53A 3F4CA 5FJTA 3HPSA 4WHBA 4E0CA 1B1YA 5AC4A 3N2BA 1NWSA 4JQ2A 3N3MA 3NYDA 3LPOA 2NX3A 3EEZA 2HZGA 1OX4B 3QF0A 3H24A 1XLIA 1VJIA 2DQWA 4J40A 5H91A 3QFEA 1H41A 3C5QA 4KEVA 3VZXA 1BRLB 1KGUA 3F5KA 3WD3A 4AZIA 2QCFA 3RPDA 1P7TA 2D0HA 4XAYA 1CXHA 3L4XA 4D6IA 1XBXA 1GVYA 2FDMA 4NZCA 3TEVA 2W92A 4WLCA 1FWHC 1LWIA 2GVYA 1W1A1 1EIXA 2B0MA 4YLWA 1FQ0A 1PHQA 3AU2A 4NG3A 1C8QA 1NSJA 4ZE5A 1GOIA 3B03A 3IVSA 2ZE3A 5A6JA 1BGAA 3EOUA 4HU0A 1EJ7L 4CEUC 5FF4A 5LNSA 3N12A 2X7WA 3NO1A 1ADSA 3EZ4A 1BYCA 3C2VA 4IG2A 1PEZA 1H7WA 4RK8A 1DJZA 1TTPA 4N6EA 5E6YA 4I3GA 2AOSA 4O4WA 1CLVA 1Y5WA 1GVSA 4JYDA 3DBPA 3UESA 4XAZA 2FTYA 4D1JA 3V0SA 5HQMA 4R53A 1UMLA 4UCFA 4O1FA 5AKQA 2E4TA 3BAYA 3PUOA 5AHLA 4IOTA 5AC7A 2QULA 2FB2A 3BARA 4MDOA 2REQB 1AQHA 2G4JA 2WBKA 1CB2A 3W7RA 2IW0A 5CLWA 5LIYX 4ZEPA 1XL9A 2E6DA 1X7IA 4J3ZA 2VX6A 1JPDX 4MUZA 3MMWA 3W2NA 4F2BA 1RY8A 3D47A 3FDGA 3NFUA 3UD6A 1CDGA 2ZIDA 1EQCA 1JYWA 1ITCA 3LCHA 4A4AA 4YWIA 3Q58A 1FWCC 4RPPA 3M7SA 5ABFA 3NDZA 4HMNA 3OOQA 3MDWA 4P61A 2F2HA 3LNPA 1OFQA 3SCVA 2ZXDA 2V5LA 2WCSA 3CXOA 3D6NA 4PMXA 3L4YA 2BHYA 4TX9A 1UBPC 3H4GA 3F5LA 1TV8A 2VGFA 2OZ3A 4JS3A 5FAJA 1GVIA 3PUGA 4D8AA 2WB5A 2LLEA 4GQRA 1QRQA 3ARSA 3BK0A 4AIOA 1ITUA 3B97A 3DC8A 3M1ZA 4C7GA 2VZSA 9XIMA 1A4MA 2Y24A 1WKEA 1AQ0A 4GZEA 5C9UA 1MNZA 1R6WA 1RBAA 3UJEA 1B54A 3PB2A 3UPWA 4DYEA 5CG0A 4LX4A 2ZVIA 1O1ZA 2Y85A 1ECEA 2XVKA 1OM0A 2DZSA 1HZYA 3LCWA 3W1NA 3A3WA 1BXNA 1SZEA 4AIBA 3A4XA 1PZ1A 4GKTA 4AZBA 4YCPA 3R5EA 4LFYA 5D32A 1QNQA 3LSCA 4W7WA 3S46A 1KR0A 3GHRA 4MG4A 1VFHA 1SO6A 3HA1A 4US6A 3CHVA 3GDLA 3DYPA 1BTCA 4N9DA 1ZPTA 1OFOA 2YCJA 2CLFA 1RK5A 3NGJA 3E2RA 3RK8A 2D73A 3LCXA 1S5VA 3KBNA 3C2EA 3PTKA 4YL2A 3AIUA 3W2KA 3USBA 4BQ2A 1KKOA 4G1NA 4H6QA 2GK1B 4QHRA 1FWEC 3IARA 5FESA 3N9KA 3ZJKA 2PODA 1KM4A 4Z08A 2V5CA 2GVEA 5KZDA 5B80A 3CB8A 3CAKA 4MWAE 3A3XA 5CPQA 2GFTA 1KR1A 3ZYZA 3HBLA 5MKGA 5EMKA 4P7RA 3GDTA 3TNBA 2O4MA 1WUFA 4DJEC 5LIXX 2NVDA 2Z7KA 4IH3A 1LORA 1J5SA 2XZ9A 4J5NA 2DP3A 3WNLA 2CLOA 3W7PA 4MLRA 1GG1A 5ABHA 3VGEA 1XYCA 2CLMA 1WZLA 2Y4SA 4XK2A 5G5IA 1P4CA 5A6AA 3SSZA 4F2UA 1GPFA 1U1UA 2NQ5A 4O17A 3GVQA 5HR6A 2XU2A 3NPVA 3N4EA 3SCRA 1JPIA 4W8BA 1IEXA 1NU5A 3UP8A 1S3HA 4K1WA 1QASA 4DZIA 3PZMA 1TE6A 1PIFA 5IDIA 1GEQA 1K7EA 3CK5A 4M1BA 4YIWA 4ZENA 4GZIA 4E8CA 3ZJ8A 1HJWA 1GEHA 1W5OA 4AH7A 3HB9A 4JQ4A 1ZY9A 3W6MA 1VCGA 3KL0A 4U2YA 1J01A 3T09A 1MZHA 2V5DA 4B9YA 1J8VA 1NH6A 5HMEA 1ITXA 4AMAA 4MJ4A 1DWGM 2NW0A 2J78A 4YYCA 4LT9A 4UFIA 2DZPA 4V1YA 3TTSA 2V2HA 4I7VA 1I45A 4IX0A 5HWNA 1Z7AA 1KNWA 1XGEA 4GY7A 1VEMA 1B3WA 2PLKA 3HV8A 1KCLA 1HUVA 4GBDA 1X8CA 2PD5A 2DSVA 3VNKA 4PUUA 1DXIA 3V75A 2BY0A 3OU8A 3UGRA 3WF4A 3W2LA 3B4YA 3WDRA 1E72M 5J5DA 3IJDA 2J8GA 2J7CA 2PDYA 1LG1A 3FW6A 1RJQA 1DJHA 3EX1A 4J3TA 3HFYA 1H7OA 1UWUA 4QAWA 4JICA 2C0AA 4LAOA 3WNPA 4H9TA 4LCQA 4UFLA 3STEA 3AUJA 2QJNA 4PMJA 4W89A 3VGDA 3WH8A 5FEXA 4AD3A 4DNHA 4IPPA 4CLMA 4UTMA 3EPMA 5FAGA 3M41A 1JCXA 1W37A 4E4PA 5AZ1A 4Q7BA 2WNWA 4Q33A 3C8FA 1CNVA 1TG7A 4NJKA 4DAIA 2WMFA 1TR1A 4KMQA 4MY9A 4EACA 2XWEA 3IUDA 3NJ3A 1O66A 3DFTA 1XD1A 2VRKA 1EO5A 2XIBA 4JN6A 1EF3A 3CHCA 1P48A 1US0A 3QR1A 5AHMA 1VBUA 4Q4SA 3EYPA 1TJ1A 3NDOA 3LTPA 2JE8A 3PG8A 2ZUMA 3U3HA 1EYEA 3MUXA 1GYNA 2DDXA 3AO0A 1JAEA 2VC7A 4OFCA 3VX0A 4UQ9A 2EAWA 3BQ6A 3OZMA 5KINA 5I24A 4ZOBA 3IGHX 1EDQA 3H70A 3RJYA 4OJYA 2OZ0A 5F4XA 3A12A 3CV2A 2WVSA 1V0NA 3VMOA 2VEPA 4H41A 2VENA 3PJWA 2QV4A 1QI0A 1TPWA 1MZRA 3FVDA 4I9MA 1V02E 4N7QA 3UNTA 2JGQA 3QTPA 3KHJA 3C3UA 3L2IA 1I0BA 2VM8A 1JEZA 3B0VC 2FDSA 4JHOA 3H12A 5HMSA 3T0TA 3AFBA 1JL8A 1Q85A 5G2HA 3ALGA 3CZGA 2G37A 2QJJA 4JFUA 1UP2A 5HJXA 3NQ8A 3H2OA 1GOMA 4KF1A 3GKFA 3GXFA 1OFEA 1FX6A 3TAKA 3T81A 5C70A 3ZVHB 5CSUA 3N04A 5HBFA 1CEOA 2QPSA 4Q6XA 4A2RA 4ORIA 2WBGA 2YX0A 3U4AA 4KWOA 2FQIA 3TXZA 3CQHA 4JTCA 4CCZA 3QV7A 3G5EA 1F74A 3QHNA 1RUSA 1UZHA 2C91A 3WLRA 5T9BG 4FNQA 2BXZA 2ISWA 4QCEA 1S5TA 4PEKA 2Y89A 1R3QA 2ZA1A 2R6OA 1ME7A 4Z2HA 3NQFA 4LUIA 2D1ZA 1TWSA 3MO7A 4H6KA 1FWIC 3WNNA 2FHFA 1W1ZA 3M5YA 3TJ4A 4AEFA 1OT1A 4PTWA 2E9MA 4GZJA 2W91A 2J4GA 3AHTA 1Q8JA 4F79A 2D2JA 1EH9A 2UBPC 3UWVA 1HGWA 1FH8A 2PE4A 4L1GA 3UYCA 4DQWA 1WZAA 3MBDA 4S3FA 2ZRWA 1YTKA 4GO8A 3HIJA 2JGYA 4JNYA 3TOYA 3QQ0A 1C29A 3TYCA 5I02A 5U4NA 4Y9PA 3AJ7A 1JNEA 4BK9A 1QW9A 1O95A 3R0KA 2E1WA 5J5RA 1H63A 3QC0A 3AXMA 4C6FA 2ZX9A 3KWSA 2ZXAA 1TIMA 2GGHA 3OZOA 3U5UA 5HNNA 4B15A 2JQXA 3SN4A 4HYRA 5XINA 6CGTA 1KXHA 2FH8A 1K9DA 2YFOA 3RG6A 2P1FA 2WV8A 2FVLA 3G2GA 2VGGA 2HISA 3IIZA 4GWEA 3WL1A 2GK1A 4L4PA 1C91A 3BPWA 4MHBA 1ODZA 5CZ0A 1H7NA 5EMUA 3VKDA 2WSQA 4L4MA 1TWDA 2ESCA 3FGCB 1UUMA 1I9CB 3OHMB 5BU6A 1CENA 1XUZA 4A6GA 2P8BA 2QAFA 1MW3A 1CXKA 5IM51 5CQ1A 1JCJA 2O7SA 3CNYA 3AAMA 4LVAA 5A2AA 3BSGA 5CJ5A 3MDUA 5I3FA 3BLOA 2VL4A 4FOUA 3E2QA 2PF0A 2P3ZA 3ZOAA 4JN8A 1N8FA 1OCJA 4HHLA 1EJRC 4FIQA 1A5SA 1VHNA 1QXLA 1FCUA 3NO3A 3PTQA 3VD4A 4PE8A 3M0XA 1J0YA 2Y7FA 3QYQA 4ZO6A 1TQJA 3T05A 4JYFA 1WDRA 5CEWA 3MCNA 1ELSA 2P10A 4W8LA 2GWNA 2PDXA 1HP5A 2JKEA 3Q94A 2J9ZA 4NILA 2BVYA 4QFUA 4IPLA 5HINA 1JI2A 4H7VA 3QKEA 4FALA 3TLQA 3QPYA 4IP7A 1F5ZA 1F3XA 1RVGA 1UH4A 1PX8A 5DO8A 2OKTA 1LL4A 4WXYA 4FOKA 4LUSB 3AIQA 4D2JA 5LA1A 4Q22A 2ZBTA 4QG9A 5AFDA 4C6JA 3MJMA 4MYAA 3ATZA 4ZVJA 3KL5A 4Q8TA 3P81A 4MJMA 1BF6A 2PBGA 3CHDA 4ERAA 2I17A 2C15A 3UW6A 1KM6A 3KOYA 3BLEA 4FK9A 4V33A 1RH9A 4HPHA 4Y8EA 5GNYA 1B2YA 3A23A 4HNOA 3RFAA 4XBJA 1GQJA 5JVLA 3F1QA 2A4AA 4B5WA 2OWXA 3VNZA 4LNYA 2ACSA 2A3AA 1DJGA 4LAMA 2VNCA 2YOCA 3K4DA 3B4UA 3RCYA 4E2BA 4M6UA 5BWAA 5LIKX 4PODA 5CZKA 4QEHA 5AYYA 3UXDA 3EWYA 4CD4A 4FMVA 4XZHA 4TVCA 2I57A 2KZHA 4JGDA 2OVLA 2I5IA 3GXIA 4AF0A 3H7UA 3E12A 1MUMA 4Q8QA 4ATDA 1OX4A 1UD3A 4IMDA 4L61A 3U2CA 1OGSA 3OIXA 1K8CA 1LCOA 1UHVA 2A7RA 2O9TA 5CSSA 5FJIA 3ANVA 3RRXA 4DJFD 1TV3A 1CECA 2ATMA 1IEVA 2Z0IA 2WVTA 2KX9A 2ZZ7A 4IJRA 4PH6A 4FZIA 3GXDA 4Y9MA 2VR4A 2GZXA 3GH4A 4GI6A 4UBPC 3VU2A 3GU2A 3WF3A 3EXTA 3WEOA 2ZWZA 4R7JA 1QI5A 3W88A 4C6DA 1FA2A 3SAZA 3VFCA 2W0UA 2VX5A 2C71A 1OY0A 1KM2A 1OT2A 4JD4A 4O1EA 3LX9A 2ZCGA 4R33A 1C93A 4MKNA 2OEJA 4DXXA 4FAMA 1JD9A 4IFKB 1IWPA 4UC5A 1QHZA 2J77A 3WIJA 2VGBA 1TA3A 1A47A 3QLLA 2CLKA 3BJTA 1QNOA 1NARA 1W0MA 4F0SA 1N2VA 3B40A 1RA0A 3URAA 4WSKA 3U2ZA 4HZ7A 4KWWA 1DKWA 4UR9A 1M03A 1WO2A 2CNCA 2PDBA 1PPIA 1VPQA 4UZSA 4AQLA 4A3QA 1K70A 2XH7A 4DXKA 5XIMA 2PRHA 5CPSA 5TF0A 1X98A 4UXDA 4H04A 2V5BA 3GG8A 2ON3A 4LBRA 3R1ZA 4UUIA 3UY8A 1ECQA 3DHDA 3AU6A 2EHHA 1PJ9A 3EDFA 4RUBA 2DZAA 2GDQA 4JTHA 2G97A 1LWHA 5FSEC 2AGKA 1GVOA 2GJLA 1SFLA 3PWIA 2NWSA 3E0IA 4LVDA 5A94A 3MC5A 2PA6A 5EGRA 1VHCA 2YDQA 3IWPA 1T41A 5D2TA 2VZVA 2ZZ2A 2TYSA 2PAJA 4DBUA 1GK8A 4D6HA 2D0FA 5GNZA 7REQA 1ICSA 2WC4A 1ZBWA 1XIMA 4M82A 1BQGA 4IFOA 1JPMA 5CPLA 4EF8A 1Q3NA 5ENLA 2HK0A 2HMCA 1U5JA 1V3HA 4NL1A 4GUIA 4IIFA 3CHFA 4FO4A 4XKMA 3SJ3A 3UA3A 1WKYA 1UWAA 4GUJA 1IXOA 3DN5A 1HGYA 4QRNA 4OUIA 5JH2A 2ISSA 3RJXA 1B3VA 3EWWA 1UA3A 2QDDA 1DOSA 4MVAA 4N6FA 1PDYA 2QF8A 3IJLA 3P61A 3WYZA 3PBGA 3O0KA 2GWGA 1PWMA 3FV9A 2PFHA 3A4JA 1F05A 3PPHA 1ZENA 1HKJA 3S2CA 4NRRA 5D2YA 1PTDA 2DORA 4GFIA 3ZMRA 3TSMA 3WH6A 1YXYA 1E1EA 2X1IA 1JG9A 1UIOA 6XIAA 3H21A 4BR1A 4GVIA 4ZR8A 3ITYA 4NXKA 3A5FA 1XLMA 3ZVIA 2FIQA 3NCOA 5A6LA 2VMFA 3SRDA 2X09A 1UR2A 4N4QA 3TNOA 3P62A 5KZ6A 3QZEA 1TTIA 3Q67A 2RJHA 3B0PA 5ABTA 1VH7A 4HK5A 3TTYA 1OIFA 4QLLA 3FLUA 4ATWA 3FGCA 2ALRA 4AFYA 2Z26A 5EA9A 3E5PA 3MHUA 4FLSA 4XUGA 3ZQ9A 1RAKA 1I1XA 3P8JA 4S3CA 1B3ZA 2WHJA 3EA3A 1SW3A 4R3UA 3CUZA 1W31A 1M5WA 2ADAA 5D9OA 1UWQA 3WQOA 4H2HA 4H9UA 2OT1A 2REQA 2UWFA 4D8ZA 2YFNA 2Y5JA 4HHMA 4LCRA 3WUEA 4J7RA 4CVWA 2RGMA 4ZOCA 3TMLA 1RD5A 1I6NA 2PDWA 4AHPA 1VFLA 3C2RA 4QG8A 4PB3A 1J2WA 3B8SA 2YBVA 4URIA 2YLLA 3NSXA 2WM0A 4AVFA 1TJ0A 1TYGA 3L12A 4L56A 2R1LA 3EWZA 2DT0A 2J47A 4U5IA 2XFYA 5T9CE 3VX1A 3T1GA 4LS1A 2X41A 3HO8A 4G6CA 4J3WA 3LTSA 2PDJA 5D9PA 3LXCA 3LHUA 1N82A 1TREA 2O9RA 3NTYA 3WLPA 1HJQA 4DPPA 2GUYA 5CBIA 1TJ2A 3BWWA 4MNJA 3TN4A 1G9HA 4U31A 4PSPA 4O4VA 3BLKA 1AH0A 1V3JA 3V16A 2Q71A 1EO7A 2RGLA 4FNRA 1C3FA 5JMUA 2ZZ3A 2XZ7A 4M0XA 1TO3A 4HPGA 5FEZA 3WUGA 4AZHA 1RQBA 4YN5A 4F2TA 2GGGA 1EJWC 4NQ1A 1HT6A 1KV8A 1EIBA 2EPLX 4UFHA 3UWZA 3MA8A 2J8FA 1ISZA 4J28A 1LZOA 4R7OA 3BICA 2V3GA 4XZMX 3VOGA 4EANA 3LPFA 3K30A 4CD5A 3VTRA 2C16A 3N19B 3RAOA 3EOLA 3TXVA 2WANA 2H8ZA 3N3TA 2GVGA 2BASA 4ZA0A 3VNLA 2DZTA 5D9MA 4GINA 3AIWA 1NFBA 4HCDA 1CTNA 4AY7A 3T4CA 4W86A 1AD4A 3WNOA 4PUDA 4LEQA 1JZ4A 3EOSA 4GHRA 3F2BA 3G22A 4CCCA 3ABOA 2CU0A 1S5MA 2YJQA 1KFKA 1EGVA 5HMFA 6ENLA 1UYQA 3FAWA 4EOUA 3EWDA 2NX9A 3VC5A 3W1XA 3BZJA 1KO0A 3QJAA 1TMLA 4U10A 2XGZA 1KFLA 1ZJIA 3P8IA 3T40A 2H6RA 3WUBA 3SI9A 3HQ1A 2WSPA 3BGJA 2Y62A 2OJPA 2Z6JA 3CBWA 4MLJA 1BKHA 4GKLA 4MFEA 2BSLA 3TA9A 1E6PA 2YA1A 5DFAA 4PMYA 1RP8A 1XDJA 4IZGA 3ZR5A 2NWRA 1OX6A 4XVEA 1FCVA 1V6TA 3S5YA 3OYXA 1TJPA 1AMYA 3BLFA 4AISA 1ZZMA 2AL2B 1F4AA 4PTXA 1XCFA 1XYMA 2YCLB 3WLOA 5TBOA 3HN3A 1LP6A 2ACRA 3DH7A 1SFTA 4MY1A 4C65A 1OC6A 3L67A 4HJFA 1UR3M 1MI3A 1ZAIA 1ALDA 3UR5A 2UY2A 4C6IA 4KRZA 5IXEA 1LROA 4ML4A 4PFMA 1W1B1 3GAYA 2Y2WA 3NUKA 2FZ9A 1YADA 3BAKA 3CZ8A 3PJTA 3L4TA 4Z1BA 1W1IE 2F2KA 3HG4A 3SR7A 3IUIA 4AD5A 3ONBA 1KWKA 4ORMA 3TIMA 1FWTA 3VUSA 1CIUA 1FTXA 3MP4A 1DTNA 3MHGA 3VYLA 1A0CA 4QS6A 2X7VA 3W2MA 1T40A 2XFWA 1S3TC 2RDWA 4QDWA 4B2DD 1UH3A 4IMGA 4XZ9A 2NQJA 8TIMA 2QDEA 1SZGA 4MTVA 1UWSA 4P5UA 1QNPA 3WLNA 4RDZA 1UKOA 3W81A 1GQNA 4JAWA 4DO5A 2IPGA 4U3CA 2WK2A 5GJPA 3LZ5A 2V81A 2I7GA 1LRTA 1VBHA 2V5JA 2VZOA 5TQLA 3AXIA 3T0CA 4RZ4A 4M5PA 3QEZA 7CGTA 1Q5MA 2PPGA 4BCEA 5CH9A 3M0MA 1KBIA 2A3LA 5JU6A 3YPIA 1SVDA 2YL9A 2DVTA 1AL7A 4IG2B 1XSKA 4RX0A 3C52A 5EMLA 3T9PA 4AU0A 1J4EA 1DJNA 5DQPA 4POCA 2BS9A 4QISA 1ZL1A 2UY4A 4JFVA 1PKNA 5CGQA 4O19A 3EWXA 1NDVA 4HA3A 3ZT7A 4MWAA 4ASTA 4HZMA 4PBGA 1ZCOA 3KBVA 5JH1A 1ZP4A 1F7BA 1GQIA 3CL6A 5GVJA 5F2GA 5E0FA 4UTTC 3ZT5A 4FI4A 3G0UA 1OCQA 3LRKA 3WMSA 1X8FA 2FGLA 1K03A 5ECUA 1GPWA 4TIMA 4PFHA 4JY8A 4M29A 2NVAA 4PMZA 2OCZA 5G1YA 1GVQA 3TJIA 1HJSA 4GQQA 3JU2A 3LHVA 1YDYA 1OF6A 2IQ0A 4C6CA 3R2GA 3KAOA 3HJZA 2QS8A 3THAA 2J27A 2CERA 4LH8A 2GVJA 2ZOXA 2YW4A 5LGZA 1RJRA 3TYAA 3HU7A 2YCIX 1KB3A 2VP8A 5IBXC 1VD6A 4P7LA 3WCZA 3SY5A 5E70A 1HNYA 3M4HA 3WDJA 2NUYA 3IV3A 4RW5A 1NDWA 2Y6ZA 4HP5A 3LK6A 3M0YA 1P0EA 3MY9A 3FXGA 1Y0EA 3GH5A 1O94A 3VOHA 5CC6A 5C71A 1OF8A 1Q6OA 4A22A 2BOGX 1J0KA 1DWJM 1G4TA 4YHEA 2GL5A 1J2BA 3VNYA 3H2NA 1EOKA 3TP4A 3S9IA 2J6VA 2A0NA 1HL2A 3A13A 3MT1A 4KFOA 1MMFA 3PZNA 2EXOA 2DSZA 4CQAA 2PZNA 1XLHA 1J10A 3QTGA 4PRRA 4GYKA 5G1TA 2XM1A 4C1NA 4HOZA 4MAVA 1F4HA 3RM8A 4JQ3A 3BLLA 2CBIA 3MSYA 4NZ3A 3RR1A 5DBUA 1XD0A 1ZJAA 1Y8BA 1UD2A 1FBAA 3T7VA 1EPXA 3LTYA 3U6WA 3LM3A 5J8LA 3S5ZA 1XGZA 2EKCA 3L5LA 1CBGA 3AZSA 1F3TA 2OYMA 1I2QA 1YNPA 2Z27A 2QCEA 1JGMA 4LJ3A 2J8TA 1UR0A 3L66A 5JIWA 3FAXA 3A5VA 3C86A 1WQ5A 7TIMA 3SFKA 3HG5A 4HNNA 1H5YA 2CBUA 1OYAA 4M3PA 4JR5A 1KFEA 3QOKA 3PZGA 4HZ8A 3PSWA 4O13A 1Z48A 5BNKA 4UTKA 1NFGA 3C0LA 4ZOEA 3UR8A 2F6KA 3MS8A 2J6XA 2DUAA 3WBAA 3LI0A 3KRZA 3TC6A 4LC8A 2GGJA 1UH2A 3BAWA 1XIEA 5I7GA 4PZVA 3EKLA 1KCZA 2B81A 4QBXA 2H8XA 4YWSA 3L23A 2Q8ZA 4RCXA 2ZRUA 1RALA 4LNCA 3WLSA 4GIRA 3ITTA 1KTBA 5K3VA 3DI0A 4HA1A 3W38A 1XIGA 1GQLA 1F3EA 2C1GA 3O05A 4C90A 2DT1A 4ZQOA 3QMSA 4NZFA 4XO7A 4JYEA 4LAKA 4Q8WA 4NI8A 1R38A 2VGIA 3MZ2A 4J2MA 1EGZA 4E2DA 4O0QA 1NWTA 4X0NA 4QCFA 1RBOB 1D3GA 3WMCA 3RLUA 3BSHA 4LQ1A 4F3HA 3GWQA 5F4WA 2GJPA 2HPMA 1E1FA 5D30A 1DVJA 4K2SA 1V6WA 2VHLA 2YB4A 2YCLA 4Z2KA 4PBEA 2VUNA 3KM8A 4P8XA 3BCJA 4IGNA 2FJUB 5IFPA 1I2OA 3TSDA 5K9CA 4WSJA 5GQBA 2VC5A 3R8HA 3P7YA 4Y6GA 3GDKA 2ZRZA 3IUHA 3W1LA 4GX8A 3T6CA 2OQYA 3AWNA 5BRQA 5AHFA 3FK4A 2R9RA 1P6BA 3SY1A 4B92A 1OQFA 2VWSA 5A2BA 2GLKA 3ABQA 3PAOA 5HNTA 3RN6A 3TQKA 1FRBA 1N7KA 3H7VA 3VAVA 5HNRA 5JIPA 3QY8A 3GTIA 5M03A 1FXQA 4I5RA 3M5XA 3W25A 3N2XA 2W62A 2A6LA 3DIPA 1V93A 1W3NA 1DE6A 4HIBA 5I3HA 1E71M 4JBRA 3TX9A 1LT8A 1Q13A 4RZ6A 3O6AA 1HL9A 1KBKA 5CSYA 1FWAC 3VILA 2JEQA 3KW3A 1S2UA 2PC4A 1W3LA 4F4RA 1JZ5A 4IP5A 4KCVA 4QS5A 2E7FA 1QDSA 3WBEA 1QATA 3W1RA 2BX7A 1JDEA 2OODA 3F03K 3GTFA 2EGZA 3R25A 4HMCA 4CD7A 1PTAA 4QGCA 1QPRA 4UOQA 4HNCA 4ACZA 2NSOA 4NNAA 1W91A 5A69A 1MEHA 3GDMA 4QJ5B 3Q37A 1TPDA 3W2JA 3CHEA 4GMEA 3G1AA 4D6JA 2YBUA 3LUTA 1BXCA 4UQEA 4HK7A 5PTDA 1CCWB 4GUFA 1DJQA 4C6BA 3UWYA 3W9ZA 3T44A 1P0NA 4L6HA 5JXQA 3PJUA 4J3SA 3W28A 4JIEA 3LYEA 3BV7A 3APGA 4XISA 1OK6A 1BWVA 5FJPA 3LPPA 3W22A 2FTWA 2Y7DA 3TJLA 1LL7A 1THFD 3VGHA 4BF9A 1QR7A 3AXXA 2R1KA 2WZTA 4QSFA 5I00A 1S38A 4AC7C 1M65A 3D3FA 2PLMA 4A2SA 1C8VA 3LMYA 1IE7C 1G69A 2PTZA 4HSNA 1H61A 4BEUA 4MMWA 1MO0A 3EB4A 5C9WA 2FZBA 4GIAA 1FHLA 3W82A 1M7XA 4AVNA 3V4BA 4L4LA 1D7FA 1HQTA 3L21A 1RQHA 3RCMA 3ZIZA 1UZDA 1JDAA 5FACA 3T07A 3WLKX 4B91A 1YHTA 1J6PA 2QZRA 3L4UA 4LY8A 3A64A 1IV8A 4R85A 3DFYA 1JUBA 3GTHA 1QUMA 5I2UA 2QCLA 2Z25A 2WCAA 2Y88A 2V69A 3PZQA 2QUTA 3S47A 4CU6A 1GKQA 4C6QA 2QDGA 5D05A 2XSXA 3PBVA 5REQA 4IWWA 5H6HA 1VYRA 3OZPA 2HTMA 2EG8A 1WKDA 3PJXA 3W7DA 3GXMA 2ZX6A 1ML1A 4ZB2A 1BHGA 1IZCA 3UZZA 4JIHA 5F2IA 1JQVA 3G1FA 1IF2A 3UWWA 2CETA 3A24A 3N17A 2G41A 1NELA 1NM9A 1QCWA 1L2QA 3RO8A 2DZWA 4CU8A 1KQYA 5FF2A 1Q6RA 2HVOA 1U33A 1VGAA 2NXGA 2ZZ1A 4Y90A 1B3YA 4B4FA 3W1QA 1KA9F 1I4NA 1MSSA 5CLTA 2FVKA 3L68A 1MUWA 4DVOA 1W17A 4XBSA 2BHZA 4XSMA 1E0UA 1HW6A 2TAAA 4UNKA 4PMUA 2E5CA 5AB3A 1YNQA 1ZBKA 1XIHA 1JRBA 1IWAA 3CAQA 4XTDA 3PS7A 3EMQA 5LKYA 4I5UA 4O50A 1FP9A 1V8EA 2G50A 2TODA 3B9DA 3ZM8A 4PCTA 1RP9A 4TTUA 4YS1A 1E0VA 4MM1A 4GI4A 1FFQA 1I60A 4E38A 2C18A 3IJ8A 3TFCA 1TX2A 3B8TA 2PDCA 3VIHA 1OADA 4O53A 4N42A 2ZUUA 1V0KA 1PCKA 3W7QA 4E4FA 1S1PA 4UQCA 3SFWA 3F7JA 4Y9OA 2QVNA 2YPIA 3B05A 3FJ6A 1EWDA 3NAVA 3M47A 3IK4A 1REQA 3C4UA 4IUOA 1M7PA 1R9XA 1BRLA 3B04A 4UMAA 4GC3A 3DC0A 3WDHA 1VCVA 3B9OA 3GVWA 2YCEA 1PZ2A 5F2MA 3ZSTA 3R89A 2IMRA 1OG0A 3ITOA 3VDGA 1C8YA 2WMIA 4UQBA 1Z3NA 3ID7A 2IQTA 2VFGA 1AD1A 1KKRA 3DGRA 3IJ9A 3ZT6A 2MANA 3IEBA 2E6AA 3MYPA 2VC6A 3TH6A 1M04A 1RLCL 3PNUA 2WPGA 2Q3RA 2B31A 3ANYA 2WHMA 3TJXA 1WDPA 1CXLA 1KFBA 3T8LA 1X1OA 1UR1A 1Q6LA 5HXMA 4O52A 1ZJHA 1P1MA 1A50A 4BF7A 1JR1A 2A79A 1L6WA 4DUOA 3W7CA 3WBWA 3GC4A 1HKIA 4D6FA 4M6PA 1LG2A 2YZ5A 2QKFA 1XC4A 4XG1A 3VA8A 3HZ3A 3DESA 1IIHA 4A05A 2H3BA 1S2CA 2FHCA 1HIZA 1TQXA 4LV4A 3LN3A 1XG3A 3CUGA 3W7EA 1XJBA 3ANUA 1R0MA 2WVVB 3GDRA 3QZAA 5C9ZA 4PTNA 4OGZA 1XDLA 4KETA 1IT8A 1TPFA 2GQ9A 1CPUA 4CD8A 5E0CA 2AGTA 1SJAA 3UERA 4GX9A 4PL2A 3RITA 3A6OA 2OQLA 2OO6A 4QG6A 4UNIA 4DI9A 1WBHA 3VO0A 3D0CA 3N6HA 1MDRA 1Q2RA 1JIBA 2NQ9A 2R1NA 3O7UA 4HQVA 4WEVX 5CC5A 3E5BA 3RMEA 1NQKA 3ITXA 3QPEA 1PIGA 3USZA 4UFKA 2H9AA 2EPKX 3VGGA 3JRKA 1GUVA 1S46A 4NRSA 2F7FA 5U7SA 4C6MA 5I3IA 4ILSA 2VJXA 3O16A 3B8VA 4DUVA 4W8AA 5LIUX 3SY8A 1A0EA 1B57A 1PBGA 3PP7A 1LOLA 1LRNA 4JTRA 3ABSA 1VF8A 4QQ3A 1BEUA 3RLVA 3UWEA 1MDLA 1ENUA 4WRHA 2CLHA 4XD6A 4B3KA 2AQOA 2PGWA 1A5NC 2E67A 4ONVA 3EX6A 3GFXA 1IZKA 5ECVA 3CUFA 2NLYA 3STGA 3W1UA 4FB7A 3MV11 4JTKA 3SGZA 1LLWA 2CITA 2W79A 1LBLA 1HKMA 1QFEA 3PANA 1WXJA 5BOEA 4ZO7A 1R2TA 4HA0A 3GFYA 3WH5A 2PSNA 2VX7A 1F6KA 4GQ0A 3HFTA 1TPUA 3RHGA 4HU4A 4NIRA 1EX1A 4ZTXA 5FL0A 1EFZA 4ACYA 4HSOA 3WZ0E 3TQ0A 4CEXC 4RDYA 1EDGA 3AXKA 3PTDA 1P0BA 2E6FA 2VOTA 4QJ4B 5K4ZA 4R88A 4K1GA 1OYCA 5G1MA 3RM9A 2ZRXA 1UQYA 4RE2A 2B7PA 3MYOA 4K8EA 2A5HA 1JZ7A 3OG3A 4Z17A 3W7LA 3L7RA 2VQTA 4IQDA 2D2GA 3KLKA 3N6JA 3L2MA 4GBUA 5ABGA 1NAL1 4UTWA 1LTDA 1BAGA 5HUOA 3OVQA 3H2MA 4YTSA 2W6RA 1VRXA 2BV9A 1YEYA 3O1NA 1EUAA 1UCWA 3AQUA 1R3SA 5HPCA 4RNIA 4L6OA 2QV5A 3V5CA 1V08A 1E6SM 3W6LA 3GLCA 3RUBL 4GCXA 2XN1A 4IL2A 3QV9A 5BOFA 4UTFA 2XM2A 2G3MA 3NL2A 4QJ1A 3T4WA 2POTA 4EPKA 3FSUA 4IGHA 4YVXA 1UKPA 3H54A 4GI8A 4A29A 2Z1KA 1YBQA 3K1GA 4PUEA 3NNTA 4GC4A 1JPKA 4I7WA 4IMAA 4S39A 3UZ5A 4ZOAA 3QKZA 4AWUA 3W7OA 3OW1A 4DBDA 3RLHA 5REQB 2Z00A 4D72A 5CC3A 2C1IA 4J3XA 1QPOA 1ZTVA 4P8WA 3B8IA 2ISFA 3OPSA 4YTRA 3CEUA 4W93A 1VLWA 2XVLA 1V4YA 3NIYA 4C6OA 1XYAA 4WJEA 4JOMA 5I09A 3HGOA 2J88A 4K68A 5A8PA 1ZHAA 1PZ0A 4BWLA 1NP2A 5HR7A 2QJHA 1DYSA 4JHZA 3ZS4A 3FOKA 4AD2A 3JZUA 4F8XA 3BAJA 4ZQCA 3A3HA 2V82A 3N25A 4CNOA 3RILA 4LANA 1ISVA 1FP8A 1XINA 3EX4A 1GHSA 2BTMA 2L5HA 1YLVA 4I5XA 3W76A 5H8MA 1L9WA 3E9AA 2G3IA 4YJ5A 4NAFB 1ONXA 1CGYA 1HF6A 4A8IA 1VFMA 5FSDC 1QHPA 4GCAA 3RPTA 3K8LA 3TYEA 3WF0A 5TNVA 1E4MM 7XIMA 1W9PA 5M5DA 1UC4A 4Q6JA 1RJPA 3FA5A 2P88A 3N4AA 3HGSA 3TN5A 4IIHA 1YMYA 1REQB 1TA3B 2Y61A 4KS0A 2BLEA 4FF7A 4JTSA 3KS6A 1GOXA 2EO7A 2PDQA 3MB9A 1I2RA 1SR0A 4M81A 2X05A 2P5NA 3TUUA 1H09A 2EQDA 1LOQA 4KGLA 3GR4A 4OQVA 4QM1A 3HPXA 2GQ8A 4TUFA 1C7TA 4S38A 5DN1A 4R9XA 1XICA 1BYAA 3SRFA 1V7YA 2ZKMX 3BOFA 3JS3A 4JTQA 4OT7A 5D8WA 4TX6A 3T2OA 1XRSA 4UMCA 1Y7VA 1JF6A 4DJFA 3ZFHA 1VBRA 2DSWA 2JALA 2PB1A 3POCA 3SGUA 4IQJA 3G6LA 1EC9A 3GDBA 2Z1WA 4XD5A 1RA5A 4HZ6A 4S1FA 2IKJA 3G3MA 4AY1A 5JBDA 1OINA 4Y9NA 2BY3A 5A6BA 1EQPA 1KLYA 2IPFA 2GSEA 4UTTA 1GJUA 1UOKA 3O9NA 3ARWA 3EGJA 4XAGA 2ZUWA 2WVVA 3SUWA 4OVXA 2YR1A 1JFXA 3RX3A 1TX0A 2OFJA 3CV7A 1L2UA 1J18A 2TSYA 2ZA2A 4QQUA 5FJRA 1BSIA 2VD8A 3WSUA 3WX7A 3BCDA 4H6RA 4LB4A 2OZTA 3SQSA 5DLCA 1ICQA 4MAZA 1ZFJA 1GWJA 2ICSA 1H60A 2DW7A 4WUIA 5T8GA 4PBFA 4JDBA 4GI9A 3DXIA 3GUWA 3U8GA 2RDUA 3BC9A 3VDCA 3P5ZA 1OVDA 4WX2A 3KRSA 3MI3A 4WXZA 4GQBA 3MBFA 3RX4A 3GZAA 2VDIA 4OBTA 3VCNA 2CYGA 3FFSA 3KXQA 1WE5A 3UY7A 1RY0A 4OOUA 4L9YA 4MOZA 4X3ZA 1LQ0A 2CWNA 4IT1A 3H2EA 4AZ7A 2EKGA 4IGMA 2E09A 3R13A 1V6VA 2MUCA 1WOBA 1F6PA 3GBEA 1XYBA 5DMYA 1UWIA 2XG9A 1BXBA 4YTTA 5EMMA 3IIOA 4NU7A 4W7UA 3W1MA 4MB3A 4O11A 3AMGA 3K4AA 4XV0A 4V28A 2O4QA 3FKKA 4M7TA 4H01A 3FHAA 1PO9A 4YVVA 1UD8A 5I3DA 1RCXB 4G2DA 5EMJA 5CZTA 1P43A 1X6NA 3PSVA 3SBFA 5I06A 1B3OA 3IV8A 1QI4A 5LYRA 5A95A 3UJ2A 3BV4A 3VPLA 3MW7A 4W7VA 5D2WA 2F6XA 3OA3A 1DEDA 4GOAA 4TVUA 3II1A 3UF9A 2HK1A 1W9DM 1ZRQA 4KESA 4OE7A 3PY2A 1QW7A 1V3MA 1D3HA 4UFMA 1IZJA 4X61A 3RLGA 4B2DA 2BGNE 3Q45A 3AHXA 2NUWA 1QOPA 3LI1A 2DUXA 2QEZA 2WC7A 5EMYA 4DZHA 4E2OA 3W75A 4D9PA 3O2LA 1JZ3A 4ATLA 1J79A 3NVDA 1TSIA 3I65A 4L7ZA 1XBZA 4DO7A 1FVPA 1OBAA 3NM3A 1NOWA 2PTYA 5FOOA 1Q66A 1MEWA 1N8WA 3W87A 3E0LA 1XLGA 2Y0FA 4MWAD 5C5YA 1PV8A 3GH7A 2IPWA 3WL0A 4U3AA 1IWBA 3F4NA 1PUDA 4OHQA 3R11A 4FIRA 5I0DA 1JI1A 1W2PA 2W67A 2OLSA 3THQA 4Z2GA 4H9YA 3TDFA 5K7JA 4S3GA 2ZDRA 5LNRA 1HFBA 2VO5A 3I6RA 4GUGA 4GVFA 5B7ZA 1AW5A 1E9LA 3BW3A 3W07A 2CZEA 1ISXA 1EJXC 2ZWYA 2CHNA 2ZRYA 1AQMA 1HTIA 3STPA 3VIFA 4AB4A 2PGEA 3M0HA 1US3A 4XZIA 2E1DA 1BG4A 3FA3A 2NQZA 2A6NA 3WD4A 1IEIA 4LTSA 2NSXA 1UP3A 3S1VA 4WGXA 4PCNA 1IXQA 3K1DA 1T7LA 2Z1VA 1NWRA 5LA0A 2A7PA 3AMKA 5K4XA 1XKYA 4F48A 1A5KC 1HJUA 1Q4NX 3DFSA 3W70A 2Y8KA 1DQWA 2FJKA 1JCTA 3S4TA 2OPJA 3G1XA 5BMXA 4JX4A 3NQ7A 3KDNA 3QQWA 1UPMB 1O68A 1NIUA 3AYSA 1KTCA 3FY1A 3MCMA 1GOWA 3LXAA 3UFYA 4IJBA 1JQXA 3MKVA 3PPCA 4PCSA 4DUWA 1ZNNA 3R0DA 2I9UA 2PC8A 4EIVA 3CMGA 1JUEA 3SCSA 4JFSA 3EDKA 2G0WA 1SR9A 3CYJA 4BY3A 4LPCA 3HURA 2XIMA 1VEPA 4DPQA 1HN1A 5D8ZA 4FXFA 4I7UA 2BHUA 4KRTA 4X2RA 4MWAB 2EPHA 5IRPA 1KW1A 1PHWA 3PK7A 4OTKA 2I5QA 3CT2A 1IXNA 1CGUA 2QVHA 3M0KA 4DBEA 2XFFA 3EEGA 4RL3A 1YE4A 3P3BA 4C6NA 1H7PA 2YDAA 1B0IA 2WLZA 1GG0A 4PR4A 2R14A 2Z28A 1YX1A 1K6AA 3PNZA 3GK0A 4LAZA 3PR2A 4UFJA 4Y2WA 1ADOA 4K38A 1EWEA 1QNVA 1FDJA 3CV1A 3U9IA 4Q8PA 5K9XA 1B4EA 5D2VA 1M7OA 4ACZB 4LF2A 1A49A 2VCCA 2E6YA 5C9XA 3PZ9A 1PKLA 1OFAA 3VKCA 3UYIA 1N55A 3I6TA 3GVRA 1VBJA 1GTEA 1C92A 4TV6A 2P50A 3HOJA 3C61A 2XIIA 2XIQA 3WK2A 4BI6A 1PDZA 3AMDA 1QAPA 1TV2A 3R0UA 5E93A 3HJEA 1W56A 4JFTA 3UR2A 3UVIA 1EC8A 1XYFA 7ENLA 1DJWA 2ZX8A 1E9IA 3SURA 4FOJA 2INFA 3D5HA 2QCMA 4DM1A 5TAOA 1H4PA 3NQVA 1XV8A 1V3LA 3VABA 3O06A 1MUCA 2CFFA 3C2OA 1LYXA 1W5QA 4HA4A 3W7GA 3CO4A 3S9ZA 1R85A 4NAEB 4KPLA 1KM5A 4H7CA 2QT3A 3TCEA 3NL3A 3QV6A 4HVXA 3QMRA 2OEMA 1EEPA 4NASA 6A3HA 5DY3A 4KWVA 3C2FA 3O6CA 4NZ1A 3OEXA 5FIPA 3L65A 3N6QA 4ZBCA 1UP0A 2OB3A 3M0ZA 1WBJA 3VZZA 3HMJG 3WK0A 2E40A 3THUA 3S83A 1GKRA 2C19A 5I07A 4ICNA 3ZSSA 5I3GA 3DBNA 4HPJA 3LLFA 3VMPA 4ROPA 3W01A 3LCGA 3GIQA 4HBKA 3PFRA 1HO1A 1K02A 4E4UA 4U5KA 5FKYA 2HSAA 2Y8UA 4RZBA 4WGHA 4JHMA 1XYLA 3RIKA 1FCQA 4YYFA 1O7AA 3C3NA 4X60A 1VFOA 4JL2A 4WIWA 1DHKA 2FGBA 4YPJA 1TWWA 3M0VA 2PDNA 3KVKA 3NQDA 3TONA 1FDZA 1NJJA 2OMAA 1KM0A 2GYIA 2F84A 3PWAA 3LHTA 5LGXA 4LALA 4XIAA 4B5UA 4FHAA 4RDWA 2X42A 3THDA 3WEMA 1L6SA 2PEVA 7A3HA 1R87A 4W5ZA 3T0AA 4F0HA 4AZ5A 4YXGA 4CQDA 4AY8A 4CQCA 2WC3A 4AXKA 2QUNA 2IUZA 1OFRA 1ZB5A 1K1DA 1VFFA 5HUPA 3M5VA 4WKHA 4O16A 3QGKC 4QNWA 2X0HA 2IXUA 1A5BA 1XX1A 3WD0A 1R3RA 1AZ1A 1AG1O 1Q65A 3B06A 3GNOA 2OKOA 1TV7A 1KLZA 1MFVA 4LXFA 3OBAA 1B3XA 1H62A 3VCRA 1K3UA 3WLTA 1XIDA 3RPMA 2QCNA 2CHOA 1V79A 4PMNA 1OX5A 4TMBA 2Z24A 1FFRA 2V9DA 2FKPA 4DF1A 1JD7A 4AWEA 3N29A 5AYXA 1MVYA 4KEUA 2V67A 4KFNA 1LF1A 1H0GA 1GVEA 2ZQ0A 1R46A 5AYBA 5GJMA 4C1LA 1KXVA 1F6YA 4GIEA 2ZYFA 3J7HA 4LWWA 1DE5A 4LU0A 1QHOA 3WLLA 4CD6A 5BCAA 1AW2A 2XN0A 2JKPA 4L6DA 3A4WA 1E0XA 1V0LA 1O5RA 2V63A 3ZJ6A 1OIMA 3A9BA 5GJNA 4PYSA 4CNTA 2G3FA 3SCOA 2WMIB 1FXPA 3TSBA 1B30A 1BVNP 5FF3A 3M16A 2QW5A 2XWDA 2YSWA 1TWZA 4GYPA 1C9WA 4YTQA 3NZGA 4HHPA 3RU8X 1W6TA 3VDBA 1RPKA 3TMQA 1WZMA 3MI6A 1WXZA 2HV5A 3UZXA 3NXLA 4WOQA 2WNQA 1XLLA 4LVFA 1EPVA 3DG6A 4MB5A 4BI7A 2TRSA 4XZNX 1EX5A 3Q65A 2GGEA 3GRIA 7PTDA 1WAUA 1AA1B 2E77A 3FEQA 3CWHA 2I9EA 1OEPA 3VIIA 5BRBA 3KOZA 2XSAA 1H0IA 3LCLA 5KITA 3K13A 2XSBA 3JR2A 4AVOA 2XINA 3BH4A 2PDKA 1PX4A 2Q01A 1ITQA 6REQA 1TMQA 1V6YA 3E02A 3SCWA 3CIXA 3R6IA 3HMCA 2VFIA 4O54A 3KL3A 2OU4A 2PDHA 2D3NA 4TO8A 4GA8A 1Q7QA 1RK6A 3ZO9A 1A3HA 2VQUA 3CH0A 5CXPA 3AHYA 4FR6A 3KTSA 3WJXA 2OT0A 2E8YA 2OTDA 3VD3A 4L9ZA 1SO4A 4GFSA 2GJXA 3G1YA 2INZA 3TROA 4X22A 4PULA 1UZ4A 5DBTA 1A5CA 1QU4A 3S5OA 1IXPA 3QBUA 1QPKA 2FPTA 2HVNA 3SGGA 1JNDA 1Z89A 3XISA 1IT0A 5EKYA 3CUJA 2PLJA 2CIPA 4ZQPA 4Y8FA 1XIFA 5DT7A 3FJNA 4LUTA 4CUCA 5EYWA 1GOQA 2VEIA 4JIRA 1I8JA 1EA9C 4XUYA 1W1YA 4JKMA 3MSGA 3SUVA 3AIEA 4S3KA 2XIJA 2VVNA 2NV1A 3VUPA 4CN6A 1M3UA 3QXBA 5L6UA 1UR8A 2PDMA 4HCLA 3VMNA 2RKXA 2DV0A 3WFLA 2XVGA 3ZR4A 5IHSA 3VNIA 1V3KA 2WMJA 3A47A 3WQ8A 6TAAA 1YXDA 1ZAJA 1OFBA 1MXSA 3I3DA 4NSBA 4B5VA 1I75A 2E28A 4M7SA 3GNDA 2MNRA 1P6WA 4H9MA 2PF8A 3IIXA 3DHFA 4GY0A 4FF5A 1E51A 2OEKA 3ZXWA 4C1KA 3G77A 1G5AA 3LGEA 3B9EA 4JTUA 3HTWA 2OZ8A 1P0KA 2EBNA 2ISDA 2YDRA 4O8AA 4KRUA 1B4KA 1XSIA 1TRIA 4G9PA 2J75A 4W85A 2VYOA 3GQYA 4Y7EA 4FP1A 3H2FA 4K7VA 4A8RA 3EA2A 2Z2AA 3MWCA 3R4IA 2FFIA 4AEEA 2VFDA 1PYMA 2XDFA 1DIEA 1SSDA 1R30A 4JIIX 3TVAA 4AF0B 3CLMA 3MJYA 3QY6A 5BU9A 1EBGA 5F1UA 4TU1A 1UWTA 3FA4A 3HQOA 3WUFA 4QLKA 2NT1A 3EX2A 3NQ2A 1VPYA 5M2FX 3M5ZA 3OBEA 4N0RA 5DMNA 1A5MC 2G4FA 3MUIA 4AYSA 4QE4A 1GJWA 2PI6A 1FCBA 2JKAA 1WB0A 3ME3A 1ZSXA 1POKA 1JDFA 1KCXA 3PBYA 1IIGA 3LCIA 1E9ZB 4HU8A 2QUVA 3QFWA 3VD5A 4FS9A 3NPXA 1FHVA 2C7FA 3MP3A 5LA2A 5HJLA 1T8QA 2QLYA 4M56A 4I6VA 5M3WA 3NVTA 1KBJA 4PUWA 3QQ1A 3G8RA 3N9RA 2QIWA 1QK2A 5HULA 3P93A 3EKZA 3RX2A 3M9YA 4GNJA 1PAMA 4G5DA 3MP5A 3W0KA 1VFUA 4A3YA 3UXIA 1H2JA 2BP1A 4H4IA 1EBHA 1SM9A 4H6EA 2VOMA 1LL6A 5FEWA 1L0PA 1SYTA 2IKIA 2OSYA 3DENA 1SGJA 2CLPA 2PP3A 1E6QM 3W71A 3GXNA 5FD0A 3GBDA 3IGXA 3H2AA 2PU0A 4GE8A 3PFMA 3MUZ1 5I3KA 4QX4A 3ZLFA 3OLEA 4AUBA 2UV8G 4B16A 4PUMA 1JZ2A 4JEQA 2YKKA 4MZYA 4CQ9A 1M1BA 4L4OA 4IHCA 2PUZA 3PPFA 2Q09A 3GHSA 3U7BA 2A3EA 4MJ2A 1MRQA 2PRMA 1UD6A 4LW7A 2YYTA 4MIMA 4F9DA 4WVXA 4G8TA 3CEPA 1H7RA 1UKQA 1XDMA 2V3EA 3ITCA 5AOUA 1E0WA 4QNEA 3L0KA 5F1VA 4HNUA 4S2CA 4XO6A 4BHYA 4LRSA 1JPHA 1ZALA 1EUNA 2V3DA 2VFFA 1PCWA 3E3HA 2PDFA 2OSWA 1G4PA 3WLMA 5BW6A 1H3GA 4ZFMA 3CQKA 2WWCA 3ZR6A 3SN1A 1TZZA 3GTXA 3GM8A 2EG7A 1W5MA 1XQLA 2OELA 4PUKA 3SDOA 4DZ5A 1FKXA 3P82A 2IKGA 4LYPA 1FUYA 2DY3A 2I16A 3LM7A 4Z1YA 4IIGA 4N2YA 4ECLA 3H23A 1QOXA 5D4YA 3WNMA 4B4HA 3BURA 2ZC1A 1XBYA 1JGIA 1XW8A 3AALA 4ADTA 4KCTA 3W6YA 1M6JA 1TWIA 4IMEA 3NYZA 3AIRA 3HG3A 1QK0A 3OYZA 4X2PA 1Z44A 4AAJA 3VKBA 4HU3A 4IPIA 4MWAC 4ES4A 2X1UA 2DW6A 2X1TA 2XVNA 3KBJA 2P3EA 8A3HA 1F9CA 1YRRA 2VT0A 2CKSA 4U33A 2BVWA 4I9JA 3U7VA 5C7VA 1TUXA 4F0RA 2IXVA 2BVDA 4B3LA 4G7FA 1S2TA 4JCLA 4PL1A 2D22A 4IFRA 3CUHA 4HTYA 3TC7A 2C0HA 4OBRA 2JFEX 3T0DA 2GQ3A 4RDVA 4MYXA 5DRCA 5MKGB 3TTQA 3VM7A 3G0XA 3HPAA 3SJNA 1QMLA 1NEYA 2WJZA 1WDDA 1QW8A 1SJCA 1V5XA 3GW0A 4NZ4A 3WJWA 1OG6A 1NVMA 1RV8A 2FVMA 3KDOA 1S5WA 8XIMA 1R3TA 5HQEA 4S3BA 3AISA 1EEXA 2V5KA 4O15A 3CTTA 1G01A 2RDTA 1I1WA 1LWJA 3GNNA 3JVAA 2XYLA 5CZSA 4XZBA 1U30A 3E49A 2H90A 4DY1A 5LSMA 3NZQA 4CCDA 4PB5A 3GU1A 3R12A 1CGWA 4LY4A 1XQKA 4XBKA 3S2NA 3GR7A 4HD5A 3TZFA 5T26A 5I77A 1VC4A 4FNUA 3I6EA 5E0KA 2EJAA 3FCPA 4LB3A 1JAKA 4X0VA 4R7WA 3LV5A 1CXIA 1R9YA 1YDOA 3C56A 3IPWA 1GZ1A 3DFNA 4C6EA 2PDGA 4IXXA 3KBSA 4UR7A 1DJYA 5AECA 1W1VA 3C0QA 5XIAA 3V0TA 4D1IA 3TU9A 3TYZA 4WZHA 3PM6A 3WH9A 3BG9A 2P0IA 4TQTA 1SJDA 2JIEA 4BQ5A 3H26A 4IJCA 1CZ1A 3LA4A 4OOZA 5EU9A 1YBQB 2P0OA 2IQDA 4CN1A 3BG3A 3UPBA 5EPDA 1DV7A 4FXJA 3VDAA 1E6NA 3WQPA 4GZ7A 2BGSA 2PWDA 1TVNA 3W7NA 1UD4A 3OLIA 3LHWA 4IGSA 2W4XA 3ARXA 2UZ9A 1TPC1 6TIMA 4OKDA 3TTOA 3NSNA 1TCDA 3R94A 1U2YA 1R5YA 1SFSA 5ABEA 3S1XA 2VEKA 1L8PA 4L5ZA 4FEZA 5C9RA 4HT3A 1ZUAX 3VIPA 3G1SA 3IJQA 4PRTA 1JYVA 3F2DA 3REQB 4C7DA 3UPMA 3KP0A 3ERPA 4KFPA 3BOLA 5G2IA 4WSHA 1RPXA 4PUNA 5EFFA 3DG7A 3DERA 3DZ1A 1E15A 2JF7A 8RUCA 3FVMA 3H6OA 1BTMA 4XSLA 3MI2A 2WSRA 3EKGA 2YXXA 2EPOA 3MMUA 3ZLGA 3U0HA 1UBSA 4IPNB 5A1AA 2A3HA 3TR9A 3QLDA 4GH3A 3IAPA 3FXYA 3OG2A 1YNYA 4IIDA 1BD0A 4XAPA 1XRVA 3QHOA 1K4HA 3VD9A 4UB9A 1SW0A 4NZJA 4E3TA 4AD4A 4YMZA 1AFSA 1ZAHA 3LRLA 3FSTA 4REQB 1VRDA 2YXGA 2DH3A 2DEPA 1PS9A 3NZ1A 2D24A 4IX2A 1SU5A 1XIBA 1LLOA 4IF2A 2WNNA 1BYBA 1RQEA 3LHZA 3EWCA 2OG9A 3WJSA 1XLEA 1U1HA 1JYNA 1XH0A 3VFLA 2ONEA 1R86A 1TV5A 3W24A 5C0QA 4US5A 3HQPA 5HJYA 1E4LA 2YL8A 3G24A 2QDHA 4H00A 4G1KA 4LVBA 3PULA 1QI2A 1SSGA 3RM4A 3NURA 3W86A 3CPGA 1KXQA 1AQFA 2NLIA 1E6RA 4CKQA 4TX8A 3AC0A 1J0ZA 4PCFA 2HBVA 3LV6A 1M01A 3V0UA 4ZL1A 1RBLA 5A8MA 3E2VA 3TWBA 1HKWA 1NF0A 1VZWA 1WKFA 1Q6EA 4G7EB 1KFWA 1TJRA 3ZVHA 3LXBA 3ARZA 3EB3A 2CW6A 4UOZA 3POHA 4TV5A 5CZJA 3TWAA 4IQLA 1TB3A 9CGTA 4WK9A 3S1WA 5G2WA 3ARUA 4ADSA 1H11A 3T2QA 1JYXA 3L0GA 3OLDA 1JUKA 3IACA 3NZRA 4ADUA 3DDMA 3LSBA 3S1GA 3S1UA 3QZ6A 3CWNA 3R7MA 5EBUA 3CWOX 3E0FA 3TV8A 5I3JA 1YPIA 3AYTA 3B9NA 1W32A 1EDTA 4GJ1A 3DYOA 2C14A 2A21A 4NI3A 4A3RA 2GUBA 1P5BA 2Y8VA 4C6KA 1Z41A 4OU1A 2HS8A 4I8YA 4L1WA 3NZPA 2X2GA 5HA7A 4I6KA 4LUSA 4ERGA 1MW2A 1XPYA 1O1HA 1YIXA 1XCXA 4H8VA 2UY3A 5HWJA 3W83A 3P2VA 1QBAA 3M43A 1OC5A 5LXEA 1IHIA 3WQ5A 3TK7A 4MB4A 1MWOA 1SZRA 2VX4A 3SO7A 1RLDA 2A2IA 4GPNA 1V7AA 4NJIA 2WJEA 1DORA 2VCAA 3G18A 3GY1A 1FWBC 2CEQA 2KAUC 2R1MA 3WQ6A 1Z6KA 4DLFA 5KMYA 1WDQA 4MNKA 3R58A 1PB0A 4V2XA 4PSRA 4YNGA 3VOFA 4DI8A 1LOSA 2PZ0A 1X97A 3NQCA 4LBSA 4EPBC 4H3DA 1XFCA 3RYSA 3AS0A 4H9ZA 1JXJA 4FNSA 3OIHA 3UCQA 4TR9A 4Q8UA 4K8GA 4S3AA 2GQAA 3DX5A 1A80A 2GJRA 3BLIA 2HNHA 2YL5A 4J35A 3EXRA 2WW5A 4AD0A 3S8HA 3ZZ1A 3H4XA 1AJ0A 3E2SA 1PKMA 1PIIA 2DVUA 4X9YA 3S5NA 2J66A 1W9VA 5HNUA 1L8NA 3BW4A 2YXOA 4KERA 2BB0A 1UR4A 3BMWA 4WR3A 2PGRA 3TOPA 4LUJA 3GB6A 2J7DA 3BVJA 3QN3A 4NY2A 3PBUA 5A5WA 2EJ1A 4PA8A 3GNRA 1FWFC 1AMKA 4CN4A 3QYSA 4DZAA 4DJEA 2E3ZA 1EOMA 4QXIA 4Q4OA 4S23A 1L6YA 2JBMA 2QCCA 3VM5A 4MY8A 1R9ZA 1EKOA 4UWMA 4K36A 4PTVA 1T5AA 1YPXA 3P0XA 2FZ8A 4ZSUA 2ASHA 3T2PA 3MSRA 2CBJA 2WKJA 3F4VA 3OHIA 3LS9A 2FMOA 5D33A 2E5BA 1B9ZA 3IAQA 1XKJA 1KRCC 4ICCX 4PCPA 3UJRA 1MXDA 3TA6A 1FWRA 2QF7A 3UCCA 4FXSA 4OBSA 2ABBA 2CC0A 4QJ3B 1K8XA 4PMOA 1EP2A 2VZTA 2AAMA 2WWDA 3GAKA 3G6MA 1A5AA 3MMTA 1GQKA 1LBFA 4WF7A 3QC3A 1XI3A 1K4GA 3QVQA 1EXBA 3AYVA 3GFZA 2CXEA 4NYYA 1SZFA 4GH1A 2ALDA 4KEZA 3WMLA 2P76A 1P0DA 4M19A 4QE5A 5LZLA 2WZHA 3UVAA 1UD5A 1U1JA 3AOFA 4GXWA 2X0YA 3APYA 3Q2DA 4DJDC 2R94A 2G8ZA 2I1OA 3P5YA 5CKSA 3HF3A 1WXYA 3DFPA 3AMLA 3B0YA 4IMFA 1ZBVA 3XIMA 1OGBA 3P80A 1HX0A 4IL0A 3E6EA 5SWUA 7TAAA 3TR2A 4XD3A 3BTNA 4LYKA 1JDDA 1H50A 5CGMA 1XLAA 4IISA 3GG7A 1SQ7A 3G1VA 4AX7A 1F3WA 3QGAC 2FZMA 1LQ2A 3IVUA 3VCCA 3ZLHA 1NY1A 4A35A 2PTWA 1LUCB 2QCGA 2DT3A 1DIOA 1E1CB 1XYZA 4GQGA 1NFPA 1G7UA 4NHVA 1VBGA 1X1ZA 5KTLA 3AYRA 4AX6A 4KEMA 2YW3A 3W7MA 1VFTA 3AHVA 1V3IA 4PMVA 3TW6A 1PZ3A 2OWWA 1GOKA 4BS0A 4XQ6A 1M9HA 1WNOA 2RAGA 1P1XA 1XLJA 3V18A 1OJXA 4D6DA 3WKZA 1CGTA 5LNVA 3I7QA 4IM4A 4US5D 3GXTA 3GYEA 3W53A 4LYRA 1S2AA 1PTGA 4JKLA 2QYGA 4Z2IA 1HP4A 1GORA 3AICA 1UKTA 1A4LA 4JDYA 1JZ6A 1JCYA 1EHNA 2DSKA 4NYUA 2IS7A 1QI3A 4GABA 4EPDC 4OIFA 1ZP3A 1JCNA 3G1RA 3ITVA 2QJMA 3EMCA 4YHGA 3NGFA 5A8GA 3SIMA 2WNZA 2G95A 5D04C 3H22A 1XLDA 1QPQA 4LS0A 4O12A 3E0VA 1E43A 2ZICA 1J96A 4A8LA 4MFDA 4Z0JA 4UNLA 5FI8A 1F8IA 4BJHA 2WQDA 1AH4A 4Q7IA 1CW2A 1W8SA 1SO3A 1XWYA 2X1SA 2W9MA 2DGAA 4FX6M 2WSKA 3BXWA 4AHOA 4RNFA 1Y5XA 1OZMA 3UG5A 4RV8A 4N02A 1V51A 4JTFA 3M0IA 1O4UA 2POZA 1JDCA 1BGGA 4IP4A 4ALDA 1JF5A 2HS6A 4H2CA 4L1XA 1ZLPA 1TFVA 4G7EA 1DWFM 3OVGA 1BG9A 1T0OA 3ICJA 3BQ5A 2QPXA 4S3JA 1CYGA 3EDJA 3OB8A 3K4WA 3CS2A 2VR2A 3GO2A 1FWWA 4K6AA 1VS1A 3WF1A 5FJOA 3WQFA 4O1CA 3UZJA 3ITGA 3EA1A 4Z2JA 3EDDA 2OOGA 4ICMA 1MXGA 2F6UA 3V7PA 2WHKA 3KTCA 2NXHA 1ZGDA 4NX0A 5DCBA 3W74A 1K8YA 3VE9A 4OV9A 2OYKA 2DVXA 3K2GA 4CGTA 4DXVA 1AODA 5AVNA 3WMBA 3IS4A 5H1WA 3UQNA 3SCQA 3MPGA 3PC0A 2H3DA 3SIZA 3O8AA 5DF0A 3ARVA 1TTJA 3O6YX 1WZKA 1RHCA 1G67A 2BOEX 4QP0A 3SCPA 5A8QA 2ZZ4A 4NVTA 3V5FA 9XIAA 1LJYA 1KGXA 1W3TA 2QCHA 3A9IA 4WY0A 5J04A 4KIEA 3LGDA 5I6SA 4D6EA 1WYIA 3IJ6A 1G94A 2NX1A 1U22A 1BWKA 3EX3A 4E8DA 4KGJA 3CMJA 5JQ9A 1Q4WA 1RZMA 5AN7A 4DBWA 4C5YA 1UKSA 3WK1A 2PP1A 1VJSA 3G8EA 4O14A 1GYMA 1HVQA 1TPH1 4XKYB 1Q6DA 2QHAA 5M17A 4JTTA 1G0CA 1OCNA 1Q6QA 3DUGA 1WUEA 3WG6A 4RR4A 5CBBA 1HXJA 1JXKA 1ZS2A 3QOMA 2I5GA 1FOBA 1NOUA 2W63A 1TUFA 3I10A 3KVLA 4HHHA 3LNMA 4UR8A 4K39A 3QSRA 4EK7A 3SSJA 3MVIA 2TPSA 3DFOA 4UTLA 2RFGA 3S2JA 3K8MA 3W2UA 4KWUA 2JIWA 3GW3A 6XIMA 1G4SA 4O10A 2DJLA 5CJMA 4DWSA 5FJJA 2QPUA 4DWSD 1NDZA 4H8NA 1PKYA 1XBVA 2OWCA 1H7XA 3KRBA 3FHQA 1RXOB 2ANUA 4C1NB 1W3HA 3GNPA 1OB0A 1UPPA 3GNXA 3M6YA 3SECA 4A21A 2JF6A 3BJSA 1AZ2A 2DH2A 3HM7A 4I9TA 3UG3A 3JUGA 3MU7A 3GR8A 1PWLA 4JQ1A 4B5SA 3VVGA 3KFTA 3QRHA 1DPMA 4GLEA 1TCMA 2RH9A 3V1PA 3PZUA 4X9SA 1DTUA 4IMCA 4R27A 4BFAA 3CB3A 1E70M 3W27A 3WFAA 1RCOB 1F73A 3WDIA 2QXWA 1GJPA 1GVFA 3SQLA 4JXCA 3CAWA 3VOIA 4W84A 4EF9A 2VVSA 4HJWA 2ZRVA 4N9EA 3BAIA 2QJIA 2Q3OA 3UR7A 2OSXA 2HXUA 4BZYA 4JFWA 2YB1A 2NZLA 3MHFA 1ME8A 4B90A 3UJSA 2D23A 3L2LA 2E9BA 4KQNA 1R8LA 4HGXA 1HG3A 4MPQA 1ADDA 4V1XA 3OODA 3TC3A 3CAVA 4WKAA 1TRDA 2WSYA 3NEVA 4Q7NA 5ABFB 2YYUA 3VNDA 1F76A 2BDQA 4HMEA 1KXTA 2XFRA 4R9OA 1QOQA 4GK8A 1H1YA 4J27A 4DWDA 2HPIA 1AVAA 4Z1DA 2DT2A 5KETA 1K7XA 1V6UA 5E09A 2W61A 4MUPA 4BI5A 1C9DA 3C6CA 2ATSA 1SZNA 4DWSC 1J6OA 3LEPA 2FFCA 3I4KA 1VQTA 4YVPA 3P67A 4JKKA 5DANA 3SUSA 2BGQA 5DXXA 2O55A 1SMDA 4EP8C 1VYSX 5CG7A 5EB8A 4WD0A 1R7AA 3GZ3A 1SW7A 5H8PA 5D9NA 4ZB0A 1AJ2A 1BPLB 5AC5A 2V2DA 4XIMA 5AZ0A 2HVMA 1UA7A 1Z42A 2OO0A 3O07A 2BXYA 3TAOA 3SUTA 4AW7A 1RVKA 2BVTA 2VKZG 4GO9A 4DYJA 4N4PA 4TTGA 1EZWA 5LHEA 1UOZA 3WQWA 2XH0A 4XWUA 1ISYA 5A6MA 3URNA 1XLFA 1OC7A 3ARRA 1OD8A 4AEOA 3JZEA 3G1HA 4A3UA 3MTWA 1KV5A 5D2XA 1ICPA 4Q4QA 1K8ZA 3IANA 3M0LA 4BQ4A 3CIVA 3GG0A 4GRSA 4KW2A 3SRKA 3WBYA 4O28A 3OLGA 5FEPA 5D38A 5CBJA 4LRTA 3R8GA 3O0FA 3UNDA 4N9CA 1S2WA 4UQDA 4WCJA 3UXKA 3EAUA 1M7JA 4RNJA 5LHFA 2Z2BA 4W87A 3OBKA 4LC6A 1FWNA 3IVTA 1EYWA 6REQB 4ZTYA 4AZCA 1A5OC 4WDWA 1UJQA 3W4RA 4AIEA 2CCRA 1QBBA 4TVDA 3B8DA 1XISA 4ZXLA 1UUQA 1NOFA 4I90A 3AXHA 3IGSA 3QV8A 4Z0SA 1EXPA 1QVBA 2AKZA 3BANA 4P2VA 3KOXA 1BFNA 1XF0A 3GU9A 1KWGA 3CQ0A 3WQCA 1VKFA 4DJDA 4E8GA 2I56A 3P0WA 3SRHA 3T42A 3N18A 3VINA 1MQQA 5EL1A 2CESA 2ZUTA 1L6FA 1IT7A 1UWRA 2A85A 4REQA 2GPTA 5FA5A 2PTXA 2DUZA 2FTPA 2FYMA 1IEWA 1X38A 4O8RA 1FWJC 3VIJA 1R7OA 3CQIA 2O9PA 3N73A 1NWUA 1X7FA 3KVJA 2WHLA 2VD9A 3G3DA 3W72A 4C91A 3JW7A 3MQTA 5DEZA 3VIKA 4GYJA 3ARPA 1PL9A 2QCDA 3TQPA 2