3B4YA

Fgd1 (rv0407) from mycobacterium tuberculosis
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
332
structure length
331
Chain Sequence
ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELAMNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROBABLE F420-DEPENDENT GLUCOSE-6-PHOSPHATE DEHYDROGENASE FG
publication title Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 117
structure length 331
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.98.2: Glucose-6-phosphate dehydrogenase (coenzyme-F420).
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 3b4yA00
2B81A 1BRLA 1RHCA 1F07A 3B4YA 1NFPA 1BSLA 1XKJA 4UWMA 3B9NA 3RAOA 3B9OA 4US5A 5AECA 1LUCB 1YW1A 1LUCA 4US5D 5LXEA 2I7GA 5DQPA 1EZWA 1TVLA 1Z69A 1M41A 3SDOA 3FGCB 1FVPA 3C8NA 4J2PA 1NQKA 3FGCA 1BRLB
chains in the Genus database with same CATH superfamily
2MUCA 3CNYA 4Y8EA 1V8EA 2UY2A 3UWVA 2QLYA 2E8ZA 2W91A 1JD7A 3GHRA 2WSPA 4TOQA 4O28A 3FHAA 4GGBA 1RY8A 4WXZA 3WKZA 4EPKA 3S5NA 1KQZA 4IT1A 4QJ4B 1UZ1A 1X1OA 3YPIA 3FDGA 4BR1A 2GVEA 4EWND 3GHSA 1FA2A 2ZCGA 2RFGA 2C1IA 2BVTA 4JS3A 4RCXA 2WSQA 2FGBA 2QYGA 4R34A 4RDVA 5FJJA 1KB3A 3KOXA 1M9HA 5D37A 3RG6A 2IPGA 2Q09A 1L6YA 2AL1A 4EPEC 4Z1AA 1WKEA 2O9PA 4I6KA 2PTYA 4FXSA 1ZUAX 4NU7A 3NNTA 3E5PA 4UQ9A 2CLKA 3F2DA 4R9OA 1QAPA 1LG1A 5AKQA 4US6A 1RP8A 2YZ5A 3G8RA 2OZ0A 3ABXA 3LRMA 1U1HA 2I16A 3URBA 4KMQA 3ABZA 3NPVA 2XZ9A 3LBMA 2P8CA 4HSOA 4ZBCA 3S2JA 4GUGA 2IKJA 1R87A 2GWGA 3TW7A 3AROA 1K02A 1US3A 1IT0A 4B5SA 1EIXA 1R2RA 1JPIA 4GC4A 4YWIA 2WMFA 3T2OA 1A5UA 4FOKA 4B9ZA 3CV6A 1UROA 1A5MC 2A1YA 3IUIA 5BWAA 3MTWA 1CX9A 4WUIA 2PFHA 3THUA 1UR9A 1A3XA 1XSJA 1QTWA 4M82A 1H11A 1Y0EA 5AHFA 2H3BA 1A49A 4WY0B 1OGGA 1A5BA 4O50A 1RCXB 1DE5A 3T2PA 2Z25A 3T81A 5JH2A 3TTEA 4QGCA 1Y7VA 1XYMA 3HMCA 3L9CA 4J1OA 1FWEC 3ALFA 3EB2A 1ME8A 1XDLA 3DGRA 2NX1A 1LUCA 3VGGA 1V3MA 4JTIA 4TVUA 5LGZA 1K77A 4Q22A 3U2CA 4NNCA 2Q8XA 4LV9A 3DKLA 3MV01 3UZXA 2Q02A 4QE4A 3RIKA 2YCKX 3EPMA 1B0IA 3K2GA 1HW6A 3MJYA 4YLWA 5CAHA 1VYRA 3NQEA 3SFWA 4P8XA 3U4AA 1UKQA 4UFJA 2P1FA 4XISA 1P6BA 1HKWA 4PMOA 1UUOA 5EMJA 1HQTA 3BLEA 1I45A 4QEHA 2BHYA 1U30A 1RA5A 3MA8A 2BZNA 2H8ZA 3S4TA 3CHFA 4YS1A 4GY0A 1TWZA 3HGSA 4TU1A 4MZYA 1RPKA 3K4AA 4ORMA 2P10A 3E0WA 1FQ0A 4MB1A 4LBUA 1QNQA 2ZWYA 4NZ1A 3JZEA 2Y85A 4NNAA 3GVGA 2KAUC 1XSIA 3AIRA 1Q2SA 2WSKA 5HBFA 4RDYA 3SW6A 1XV8A 1ZRQA 3QLLA 4W8LA 4PTNA 1QPOA 1U33A 4WDWA 4JQ1A 1WV2A 5TBOA 2XM1A 4C60A 2DZAA 3EOLA 5C7HA 4GG9A 1NOFA 3CL7A 3OEXA 3UQNA 1FWHC 3BCFA 4ZENA 1VC4A 4Q4PA 3AS1A 4K38A 3CAWA 4OT7A 1H61A 3PTQA 4GVGA 1OIFA 4WK9A 1OX4A 3OJGA 1QVBA 1GOWA 1A5OC 1GOIA 4H9UA 4W88A 3PZVA 3F03K 4LT9A 3DX5A 3HJEA 3PUGA 4NJHA 2WYSA 1E40A 2ZE0A 2OG9A 4XX6A 1A80A 4AX6A 1GTEA 4OBTA 2BV9A 4IGHA 3W7LA 2XVNA 3B40A 4O13A 4F0LA 2J8TA 3LERA 2GGEA 1GQKA 4ZO7A 1I0BA 2PGWA 2VEKA 1VENA 1MXDA 3F2CA 5I02A 3DOPA 4GH1A 1H41A 2QCFA 2V0TA 3PZTA 1BYBA 3UERA 2CU0A 5A5WA 1A0EA 4GHRA 5FJUA 1MW2A 1HF6A 1JXJA 3IV8A 3EKLA 4FO4A 2OMAA 4IUOA 4M19A 1KCXA 3TX9A 3TC3A 3O16A 4QG6A 2D20A 2GDUA 3GVVA 2J7CA 4O14A 3AALA 1P43A 5C2CA 3MCMA 4QDPA 4H6EA 5CH9A 2C18A 3OU8A 2WNNA 5CGQA 3I65A 4RKAA 3THQA 4QP0A 1O60A 2PCEA 3OTRA 4NZ5A 1PKMA 2QS8A 3N11A 1BXBA 3NCOA 4S2BA 2ZVRA 2VGIA 5FJRA 4ZO9A 1TZ7A 2J6VA 2C15A 2Z0IA 3BO9A 2REQA 3W24A 1T96A 1ZCOA 2HK1A 4L4MA 2VEGA 3GTNA 4I9TA 3VNJA 1OFBA 3WBYA 2ZZ6A 2I17A 3EB3A 4A8IA 3M64A 4LF2A 3KRUA 3TEVA 4OZOA 2E5DA 3PFRA 4JTCA 4GGHA 1NDYA 3WFAA 3HB9A 1HGWA 3OVPA 2YBTA 1LL7A 3ZMRA 5BXTA 1CGYA 1NDVA 3ZLGA 1GVQA 4NQ1A 3G8EA 3K46A 4UTUA 3Q94A 3QZAA 3E1F1 4RNFA 5BMWA 5J04A 1I2PA 1PL9A 2QDEA 4BQ5A 1SJCA 2VR2A 2BGNE 3GFZA 3PBWA 1IV8A 3VIGA 4HOXA 5AB3A 3LNPA 1XIBA 1LYXA 5AVHA 5FF7A 4PRTA 3R13A 3UJEA 4MY9A 1RAKA 1OBAA 1PAMA 2WPGA 3CM4A 1HFBA 4J3WA 4ZQPA 1X8CA 3UWZA 1IZJA 1ZP4A 1UWUA 5EU9A 4HHLA 2C16A 1PTDA 2CERA 3F4NA 3A9IA 1R5YA 4FLOA 4UIOA 3U5YA 4XD4A 3G1FA 3VU2A 1X7IA 3TMQA 2QMKA 3SJ3A 3RX4A 2RDUA 1OVDA 3M47A 2PGRA 3WCZA 3GTFA 5CZSA 4QG8A 6CGTA 3QV7A 3VKBA 4WZHA 3KDNA 3SFKA 2CWNA 3NZ1A 2Z1VA 3HFTA 5F4WA 1BEUA 1BF2A 4JTJA 1CBGA 1EUAA 3W27A 4I7UA 5CC6A 2W0UA 2VCBA 5AFDA 4LUSB 1C3FA 2FZMA 1FDYA 5M3WA 1ZJAA 4DNHA 3GIQA 4QJ3B 3ZR6A 2RDWA 1XCWA 4AD4A 4WJEA 3CV7A 1VEMA 2ZADA 1WCGA 3V1PA 1WBJA 4DJEC 4ZB5A 5ABGA 1TYGA 1B3YA 5C9ZA 1I1WA 3U57A 5CJMA 1V6UA 2FZNA 1H63A 2QZRA 1EH9A 3EOUA 2XSXA 1JCTA 2PDHA 4XD5A 4A3QA 2VR5A 1VEPA 3EEZA 4B16A 1K8XA 3S8HA 3CL6A 1T8XA 3QV8A 1I0DA 7A3HA 1GKPA 1E6RA 3ZS4A 3S9YA 3A47A 3I6TA 4DO5A 4DHGA 3QMRA 4X2RA 1QHZA 1FVPA 3K8KA 3QTPA 3CASA 3SSJA 4Q8WA 1GVEA 4WXYA 1QI5A 4D71A 1CGWA 2GGJA 2PWUA 1SJDA 4Q7IA 1TQJA 4MYAA 2YCLB 1FWFC 4I9AA 3U9IA 3TOYA 3MYOA 1TVPA 1KBJA 4ZE5A 1Z3NA 6REQA 1EBGA 1U5JA 3KBNA 3LK6A 5DXXA 3OP2A 5KITA 4OGZA 1REQA 1UYQA 3AXMA 1JEZA 1DP0A 4JL2A 5C9UA 1PWMA 1J93A 2X8RA 4GVHA 4RZ4A 4WX2A 2ZYFA 1C8QA 2FFIA 5EL1A 1GOMA 4GJ1A 4AHQA 2NV2A 4IPJA 1E4LA 3CUZA 1DJWA 3WLLA 2CEQA 4WQ6A 2AL2A 4O17A 2P5NA 4S3FA 2WSYA 3BLFA 3GNNA 3GXTA 3BW3A 3W9ZA 4HHMA 1BSIA 2A3EA 4OUIA 3AZTA 1MWOA 1VJSA 3IARA 5BXPA 1T0OA 2CHOA 3HFYA 3QC0A 4Z2HA 4KCUA 1O5XA 3EDFA 4HZ6A 3IAQA 1GG0A 1L6FA 2PGFA 1NTHA 1FH7A 1XLHA 4DUOA 4C1NB 1Q7QA 1LT7A 3OODA 4IIBA 4DLMA 4D8ZA 1FH8A 1WQ5A 2PWDA 3OQEA 4NJKA 4S3KA 1SO3A 4TXEA 4O19A 1TJPA 5AYYA 5G1TA 1E0TA 4URIA 3T2QA 4EXQA 1V93A 4B4HA 3ZWSA 2J7DA 2WCAA 1JYXA 5TD4A 5DO8A 5ENLA 1Z41A 1TX2A 4MY8A 3L68A 1LWHA 2FH8A 3NO5A 5D2YA 3A12A 1JCYA 1XYFA 4BEUA 4C1LA 1EL3A 2Z2UA 1RQBA 5I3DA 3TJXA 3R4IA 3VM7A 3BH4A 3WDRA 3RM9A 4GZIA 1XRTA 2VDIA 3LTYA 1N7KA 5HULA 4UTHA 3V75A 1WB0A 1E0VA 4N4PA 5G1MA 2ZC1A 4GQ0A 2P76A 2ZXBA 1RPXA 1TZ9A 2HE8A 1VHNA 3QQWA 2VRKA 2X42A 1RK5A 2VURA 3W1UA 2PUZA 3SRKA 2Z4GA 2OXNA 4FA3A 2JFEX 1JQVA 2PF8A 3R8RA 2E6YA 4OHQA 3PSVA 3VDBA 5FD0A 3HV8A 5L6UA 2O92A 4OU1A 1ZBKA 4NAFA 1UWSA 3C86A 4XBSA 3WBEA 3CQKA 3KWSA 1F8MA 4H8NA 4JFSA 2OOGA 4JDBA 3RILA 4ECLA 2VCAA 4Q6JA 1ZP3A 1GQLA 3QR3A 5CPMA 3SZ8A 4DPPA 4NIRA 2FZDA 4UZSA 1HKKA 3KBSA 4PB5A 4HYVA 1JIBA 2CCRA 4MFDA 3I3EA 5AECA 4J3SA 4E2OA 1S2CA 4DJEA 1QPNA 2TRSA 3WMSA 1C29A 4PMQA 3CBWA 3I4EA 2WW5A 3WDJA 2VZTA 1Z42A 5KZ6A 2J79A 3N9KA 1P0BA 1GVOA 3CZGA 1S5MA 4XAFA 5E6ZA 3AIEA 1JXKA 3EWDA 5K9DA 2ABBA 2F8QA 1ZZMA 1R3QA 2HEJA 1UR0A 5AYZA 3AHTA 4P61A 4Q8NA 4UCGA 1YBQA 4DVOA 4H00A 4CCZA 5D8WA 3N6QA 1S2WA 2GUBA 1IEXA 4QNEA 2ZUMA 3URQA 3CH0A 3QR0A 2RGLA 4MUPA 3VILA 1W37A 3GFYA 4P7LA 3BSHA 1EEPA 3OZMA 1E5JA 3OHIA 1LCOA 3EX2A 2VX6A 1BRLB 3W7QA 2H6RA 5CPNA 3W1XA 3VE7A 5IRPA 3A21A 1UG6A 3E3HA 4IIHA 3S6TA 1UWIA 1YHTA 2NQZA 4CKQA 3KOZA 1E56A 4C7DA 4O15A 1UBPC 1GPWA 3ZWTA 2ZX6A 1QW9A 3LZ5A 5FJPA 3H6OA 1SZNA 1LL6A 1W6TA 1G0CA 2Z00A 3QMTA 3ELFA 4ADTA 3CUHA 4DJDC 4TTUA 3OA5A 4WD0A 1MI3A 3UR8A 1VFTA 2QUVA 4NT0A 1CIUA 1Z6KA 3STFA 2J25A 3GDKA 4IMDA 2Y2WA 1J6PA 1RBOB 3O3RA 1VCFA 2X41A 3B0VC 1U22A 1J4EA 4JX5A 4JKLA 4LB4A 2HDJA 4LOCA 2WJDA 4Q33A 2NVDA 4X2PA 2ZDSA 4NZFA 3PHAA 2QNEA 2J6XA 4R53A 2ZZ7A 1Q66A 1L2QA 1XQKA 4MJ4A 2WWDA 2C19A 2V2CA 1SMAA 4IXXA 2BY1A 3TYAA 3FHQA 2C91A 5AHNA 4DBWA 1B57A 2YCJA 1CXHA 1VRXA 3VIKA 5IBXC 1DBTA 1XUZA 3S5OA 2E0PA 1A3WA 3U0HA 5A6AA 1E3XA 4XIAA 3E2RA 3ARWA 1BF6A 2E6FA 1AVAA 3RXZA 1IWAA 1TA3A 1YYAA 2OQHA 1NOUA 4E2VA 1M3UA 1OD8A 4OIFA 3W87A 3EDKA 4F48A 1FTXA 2Y8UA 5D9OA 1WZAA 2J24A 4Z1BA 1BLIA 3BANA 5JBFA 5I3JA 4MDOA 5D32A 1UP3A 4PYSA 4JQ4A 4KESA 1FRBA 5FJOA 3AMDA 3GUGA 3N2OA 3UCQA 1OX5A 1VP5A 1J01A 3UJ2A 1MSSA 1UKOA 4RNJA 2XFFA 3W85A 1OINA 3V5OA 4KWVA 2OZTA 4RZ5A 5REQA 3IIVA 4W7WA 4ZODA 4JNYA 2DVTA 2OQLA 4DQWA 1WNOA 4BKNA 3DAQA 4GOAA 1FCQA 2G4JA 3MCOA 1LOSA 3THDA 1HN1A 1B2YA 1E4NA 4GFSA 4WEVX 2W5FA 1TMQA 1F3TA 4GI9A 2JKPA 2RH9A 2VTFA 5JUVA 5LKYA 3SAZA 5C9RA 2YJQA 5GJPA 2H8XA 2V3DA 1UMLA 3KL3A 1KWGA 2G3MA 1E9LA 2HVNA 3ZLHA 2EHHA 1JPMA 4E2DA 3ARQA 1BQCA 3QHOA 3AS0A 3GQYA 3WEZA 3AS3A 3UY7A 1QMLA 4S3BA 3LA4A 1C7TA 2RUSA 4JEQA 3BXWA 5XINA 2E28A 4P8UA 2GQAA 3B97A 2B81A 1XRFA 2VGFA 2SFPA 3RUBL 4NASA 4QX4A 2JEQA 4F3HA 3OBAA 2HQAA 3STEA 1CEOA 1W9BM 2XIBA 4O1FA 3IVTA 3WH7A 3HQ1A 3BLDA 4AZGA 5C2GA 3UPMA 2GWNA 1OT1A 2YW3A 4EK7A 2IXUA 2PD9A 4CU7A 4LUTA 5AZ0A 5CJNA 4PCSA 3GUWA 2FH6A 1ZNNA 3W7OA 2CWXA 1RBAA 3PTDA 4DM2A 3D3AA 2ZUUA 1I1XA 2ZZ5A 2W4XA 4KFNA 1JAEA 1X1NA 2ZZ1A 2YDQA 3HG3A 1FY6A 2OWXA 4RXGA 3TXZA 3CK5A 2Y1HA 4DJDA 2X16A 4DWSB 1S46A 2EPLX 1ICSA 2OT1A 4D6EA 4Q8TA 3BAKA 4UC5A 4K1GA 2EPHA 3N6HA 1M7OA 3PWGA 3ABOA 2UBPC 3M43A 3IJQA 4ZOAA 3A4XA 1AH0A 2IPFA 1X97A 3FKRA 3N04A 4HNNA 3GKFA 4MOZA 5FJTA 4DF2A 2I14A 4ZB2A 3T0CA 3RPMA 1BYAA 5DX7A 4AWTA 4P7OA 1ZQ5A 4MKNA 2J8FA 3CUGA 3ZJ8A 3TW9A 4MMWA 4IJRA 1FWDC 5D02A 3C0LA 1BG9A 5HUOA 1ISWA 2C8NA 4MWAE 2FIQA 2ZKMX 3GR8A 3EB4A 2VT0A 1M7XA 3UGVA 1YEYA 5IBXA 3EA3A 5FCZA 2PDYA 1TJ1A 5EA9A 3APYA 2EPOA 5D9PA 1TV3A 2TPSA 3ITOA 3GB6A 1XS2A 3FVMA 1SFJA 2INZA 3GU2A 3W01A 4GIEA 1ZAJA 5F2IA 3H23A 1MQRA 4IWWA 3CZEA 4FP1A 1M03A 3W1QA 4MLJA 3C2EA 1HL9A 4AYSA 4V27A 3LX9A 5A6BA 4HCDA 4HNTA 4E0CA 2CLMA 1C92A 2F7FA 1LBLA 1EC9A 3ARTA 1D2KA 1TVNA 4GVIA 1ECQA 1VFFA 2XIMA 1HJQA 2PP3A 3WD4A 4CCCA 4H8UA 3PWIA 1CGVA 4JIIX 3ZR5A 3ITGA 4GE8A 4GUFA 1XIMA 1QT1A 4B9YA 4DM1A 2P88A 1IZKA 5DFAA 3Q2DA 4S39A 4DUWA 5KEZA 1PX4A 1MDRA 4C1KA 2IW0A 3C2OA 4D6IA 3UCDA 6ALDA 1JFHA 2WSRA 3GXFA 3G0SA 1B3XA 1XGDA 2J62A 4CNOA 2CYGA 1RXOB 3LBOA 2DH3A 1YE6A 4AW7A 3GBEA 4GK8A 1R3WA 3CWOX 4FX7A 2ISWA 3T08A 3F4DA 3RJXA 1LF1A 3B0PA 1QOXA 3CS2A 1KCKA 3CUJA 1EJUC 1OC7A 2J7HA 2ALDA 5IHRA 1FWAC 1FWGC 4Q32A 1DQXA 3FXGA 1XF0A 5K4ZA 4WKFA 1PX3A 2V3EA 2YDSA 1OADA 5CBBA 3RU6A 1XKJA 4HA0A 3CWNA 3EMCA 1ZCCA 3EWXA 5J5DA 2XN0A 4MKVA 2OEKA 4HT3A 4PC8A 1TCDA 3F4WA 1CECA 4XWUA 2O9RA 2Z6IA 4FSAA 4BA0A 1J5TA 1ITQA 4R3UA 2C6QA 5A8PA 1VKFA 4EVZA 3MHUA 1V51A 5DEZA 3NDZA 3LTPA 3ZZ1A 4Q4OA 1EP2A 4LAOA 4ALDA 1Q6LA 4Z17A 1RVKA 3KCJA 1ZGDA 3HM7A 1M53A 3OA3A 3DN5A 1UBSA 3NQVA 3XIMA 1W3TA 2WVVB 4TX9A 4JN7A 4JTQA 4EXBA 3K5XA 2XSBA 3QGKC 3SI9A 4HYRA 3H7RA 3JZUA 4JKKA 1ICQA 4XVDA 1GPFA 2NLIA 2D24A 3NQFA 3R7MA 3NM1A 5DY2A 2BOEX 1QU4A 3GC4A 2WVTA 2ZE3A 4DRSA 3V16A 4HN8A 4MB4A 1I2NA 5HQLA 1Q5MA 4PUNA 4F2UA 2Y7EA 2VX4A 1OZMA 4DJFD 4FNUA 4QEEA 4ZFMA 1M41A 3EDDA 4QS6A 3UG8A 3TA6A 4YCPA 4CD8A 1JYNA 3C6CA 2NX3A 4NJIA 4ZXOA 1H1NA 2OX1A 1AUSL 3S1UA 1DJXA 1LDCA 1PZ2A 4NUWA 1QUMA 4IMAA 4AZHA 4GQGA 2Y7FA 3HMJG 4CU6A 1GOQA 4JIHA 1SZEA 1LLZA 2ZDRA 3JVAA 3TQVA 2PP1A 3BGJA 1PJ9A 4W9TA 4ZQNA 3E2VA 3FJNA 1LUCB 3D6NA 4J3VA 4IQLA 2OGJA 4JY8A 4M81A 3UETA 3UWEA 4D8LA 3KEHA 1RP9A 3UWQA 2FFCA 5LYRA 3RO8A 2A7NA 5AYXA 3WH9A 1TIMA 3M7WA 1R9YA 4MNJA 1DJYA 4GUHA 3TONA 2QJIA 4XZBA 1WXZA 5DELA 4XKYA 3VA8A 2Z27A 4HNOA 4AAJA 3WK0A 1RZMA 1G94A 3AC0A 1DJIA 1ZBVA 2DVUA 2IPWA 1AZ1A 3SCRA 4RL3A 3IANA 2FDMA 4PTMA 4P5UA 3GFXA 1NFPA 4FR1A 4M80A 5I00A 4D6FA 3DI1A 4XAYA 1UJPA 3WD1A 2BXVA 3WFLA 3WDIA 1LJYA 3CPGA 2D69A 4PMZA 5E6YA 4R7OA 4MZ1A 4F79A 1JCLA 3GH4A 1XHGA 5MHBA 4CD5A 1K4GA 1UD4A 4C7GA 1KTCA 3PZIA 4ATLA 3VO0A 1FFRA 4GINA 1Y5VA 4KRZA 1OYBA 4B4FA 1W2PA 3AYTA 1NDZA 5G5IA 4DI8A 5HXMA 2A6NA 4JQAA 2D0HA 2JIEA 2BDQA 1FWNA 4GY1A 1KGXA 1FH9A 1E55A 3WLTA 5CC3A 5BCAA 4YIWA 4NZ4A 1TR1A 5GVJA 3EX6A 2XGZA 3C3NA 3L23A 4PUWA 4ZSUA 4UTKA 1E51A 2ZC8A 3AUJA 1R86A 2VGGA 4Q8PA 4DBDA 4AEFA 5ABHA 2OWCA 4AYGA 3XISA 3FAWA 4J9JA 4NX0A 3VD3A 3M5XA 4S1FA 1XGEA 3TKFA 3QH2A 4Q8VA 1IEIA 5CLTA 3MKVA 3EDEA 1GJWA 5T9BG 4QITA 3CQ0A 4PZVA 3BSGA 2WC7A 1UP0A 4KFPA 1XLAA 4HSNA 4DYKA 1KC7A 3QM3A 4M24A 4OV4A 3VDGA 1OGBA 1W8SA 1J9YA 1ADDA 2QQ6A 3GD6A 1EZWA 3VABA 4QJ5B 4DAIA 1GYMA 1QCWA 2AQOA 2CNCA 1YIXA 2PDPA 2VEIA 3MW7A 2G95A 2Q01A 2I57A 5HQEA 1TE6A 2O4MA 4HTYA 2YA0A 4ES4A 2F84A 4HN4A 1VPYA 5HQMA 2WZMA 1L9WA 4AXKA 4MPQA 5E93A 5EYWA 5AZ1A 4LGXA 1PIIA 4JKMA 1U5HA 1QR7A 4BQ4A 3PZQA 4LB3A 4LH8A 3ABSA 3WQEA 3ZSSA 3AXXA 3TLQA 1S5TA 4N9CA 1G4PA 3R25A 4JYDA 1EXPA 1TUXA 3WJWA 1V77A 3OLEA 2X1RA 3F5JA 3EX1A 3BW4A 5HUPA 1XYCA 5BOOA 3N9RA 2REQB 3FA5A 3TWAA 2NXHA 3PNZA 1R3VA 4PMJA 2VD9A 3S42A 3VNIA 1AW2A 3VGHA 4JCLA 1V3KA 3WDPP 4XZMX 4FIRA 5G1YA 3CQHA 4UFKA 4WGXA 2HXTA 3TAOA 5AYBA 1IYXA 4J3UA 3WNOA 1BTCA 3W70A 3VDHA 1ML1A 5A95A 3I6EA 3OIHA 1O94A 4MNKA 1W1A1 1ZENA 4QHRA 2FHBA 2XHYA 4QRNA 1QPQA 3MI2A 4REQA 3T6CA 3W29A 4M29A 3CIVA 1YDYA 3QW4B 1KBKA 1TQXA 1SGJA 1XIIA 2CLOA 2Y7DA 4FLQA 3N1AA 1UH4A 3AJXA 4RE2A 5IDZA 5LNWA 3EMZA 3KRBA 5M03A 3IGSA 4EP8C 4ORIA 2NX9A 4V1YA 1DJGA 3TMLA 5DBUA 3LPPA 4HPJA 2E8YA 2OSWA 4O18A 1VCGA 2OYMA 3G22A 3MT1A 2ATMA 1JVNA 3ZVIA 2BOFX 2GDQA 4ZL1A 3W0KA 1SZFA 4OBSA 4JTDA 3A22A 3SRHA 3NG3A 1EPXA 3H7VA 2VYOA 3MO7A 4UFMA 2WKLA 1WAWA 3FOKA 3S1GA 4AEEA 1XBVA 2CXGA 5K4XA 1BKSA 3PUEA 4GYPC 4O4WA 2VC9A 2HZGA 5M17A 1W5MA 5LIXX 2W3ZA 3NA8A 2EO7A 3WO8A 3VYLA 4HMDA 1XLEA 2Z7GA 5AHEA 3GXIA 1RY0A 1ZAHA 1K9EA 5FF0A 4DELA 3HO8A 5D9NA 1F07A 3SM0A 2GSEA 1XW8A 2FGZA 1V6TA 4UB9A 5BOFA 4FI4A 3UXAA 2Z1KA 4HU4A 4YVVA 3KHJA 1XYLA 2VZVA 2QJMA 3R0UA 3FA3A 4OV9A 3W76A 3GAKA 1V6WA 2ZRVA 2CLHA 4ZZ9A 3B05A 3VKAA 4DNMA 2GGGA 4GKLA 3N14A 3H26A 4Y6GA 3LXBA 3KBMA 3DDMA 3IRDA 2OELA 2ZRWA 1OWQA 3A3HA 1NH6A 4PL1A 4H2HA 3W25A 4JTSA 3ITTA 2RAGA 2VD8A 1ZJBA 3IUHA 1J0HA 1KGUA 1I6NA 1KO0A 3PBMA 1F05A 1LL4A 3SR7A 3CAQA 4Z1DA 3BAYA 4GISA 1LM1A 5LA1A 1F4HA 1ZB5A 2A7RA 4UNIA 2WMGA 4Y96A 3WH8A 3WNPA 1A5SA 4JTEA 4G7EA 1UWQA 4F8XA 4GFIA 3KAOA 4PMVA 3HN3A 4JR5A 1Z8AA 2G0WA 3MKCA 3WL0A 4H3DA 4J28A 1DJHA 1VFOA 2PBOA 3B8SA 3W23A 4QM1A 1DXIA 4LYRA 2AL2B 4UNKA 3L65A 2HNEA 1OCQA 4F40A 3DBNA 4IMFA 1UKPA 3K8LA 4UXDA 9XIAA 2W6RA 1OSEA 4HHHA 3F2BA 4LYKA 1P1MA 2J77A 4XUGA 3CL8A 1BD0A 4LTSA 3TH6A 3FGCB 1AJ2A 1S2VA 4JEJA 1OJXA 1NIUA 3GHTA 3LGEA 3WQOA 3UYIA 5LNVA 2OVLA 1KFKA 3H2EA 5I24A 2IKIA 1DV7A 1R7OA 2VP8A 4D6JA 4WJXA 4IX2A 1E3ZA 2X1UA 1K1DA 1QOQA 3MUCA 4WHBA 3NR0A 4A05A 2HPIA 3M5VA 2J75A 4XTDA 1CGUA 3LG3A 1LRTA 1QATA 5IFPA 3LZ3A 2BXZA 3F5LA 3UG5A 5HR6A 4ZQRA 3VINA 1VR6A 1KRBC 1EOKA 4R88A 2Q8ZA 1S39A 1CYGA 1DWJM 4YTSA 4FAMA 4WKAA 3W86A 3I3DA 3WLIA 3T8QA 2OT0A 3SB0A 3BE7A 2HJPA 2PZ0A 3WQ5A 5ABEA 4C91A 1AW5A 1SVDA 3LU2A 3KS5A 3CQIA 4D1JA 2ODOA 4B2DA 4BF7A 4MB5A 1QWKA 4AF0A 3P2VA 1EKOA 3ATYA 2QR6A 5G2IA 2WJZA 3OVGA 4IZGA 1P48A 5HANA 1R85A 2DSZA 1F74A 1QI3A 3AFBA 7REQB 1S5WA 3QLDA 4FEZA 1YADA 1H1YA 5AHIA 3UA3A 1A4LA 1YMYA 3TQ0A 3T7VA 4L4LA 4CU8A 3E2SA 5FSEC 3WLJA 4MWAB 3FK4A 1ESWA 4LAZA 5C54A 1J0KA 3M0ZA 4TTGA 3WBAA 3OGVA 1TPVA 2C14A 1A5CA 3TZNA 2P0OA 1BSLA 1T41A 4GYPA 4HU8A 4K1WA 3R10A 4GXWA 2ZFAA 5DF0A 1E6SM 3ITCA 4LAKA 2DZXA 1EJTC 5EFFA 4H8VA 1TRIA 4LW7A 4BFAA 1TPC1 3WF4A 3L66A 1F9CA 4GXMA 4WSKA 3SCOA 3IIZA 4UQDA 1HKVA 1S2AA 1HUVA 2WMKA 3BAWA 1UWRA 4KFOA 3QMSA 2PTXA 2BWGA 4ZR8A 2PRMA 3HQOA 3KLLA 4W87A 1J96A 4EF9A 1HGYA 2BMBA 2PU1A 5AVNA 1PZ0A 3T1GA 3W72A 1M1BA 3WD2A 2FB2A 4AY7A 5FKYA 9RUBA 4WDUA 1UR2A 3R8HA 2VRJA 3D0CA 3R2GA 4B5NA 3K30A 1JR1A 5CEWA 3WFZA 3PY2A 3O1NA 4DO6A 4XZ9A 3MP5A 2WO5A 5FL0A 4JZ5A 4PULA 4KIEA 4NRSA 3VXGA 3B8VA 1ENUA 4CD4A 1AJZA 1DHPA 2WKGA 3PULA 1BVNP 3CJPA 4Z0JA 3A24A 5KZDA 1L8PA 3JRKA 4IICA 2YW4A 1Q6OA 3P14A 1QPRA 3ITXA 4NF7A 3T8LA 1M68A 2YXGA 3BJTA 3FNDA 3P3BA 1KRMA 3KUMA 4C6BA 3DBPA 1MXGA 3HG4A 1I2OA 2OEMA 1DPMA 3I4KA 4PR4A 3SY5A 2Y6ZA 4S3CA 3SY8A 2WKJA 4AH7A 3FCPA 3H55A 5C5YA 3RLHA 4GYJA 1UP2A 3IIXA 1JZ7A 3F5KA 3VIMA 1PVNA 4PFHA 1JQXA 1GCYA 3V1HA 1L6SA 3RPDA 3UEQA 4IQJA 3LGDA 4XZIA 1KFEA 2ZIDA 3WYZA 1G01A 4OKDA 3MB9A 4M3PA 2DT1A 5I6SA 4HP5A 2P50A 2NUYA 1MFVA 1Q7ZA 1MMFA 4JL1A 5K9CA 2X30A 2GL5A 1PHQA 1GKQA 4A2RA 2VDHA 3W1LA 3N2BA 2UY5A 1R46A 1KD0A 4W5ZA 3FX4A 4HA3A 1NARA 2GFTA 3CAKA 3VTRA 5A2CA 3NSNA 2QJHA 4AQLA 2BX7A 1VBUA 1XDJA 3U7BA 5EMMA 2YB1A 1O5KA 2V67A 1NELA 4I5UA 2BODX 3CPUA 1Y5XA 5EMUA 4A4AA 4C5YA 2EPKX 4J40A 4O0KA 1RA0A 3CC1A 3T0BA 1NJJA 1J79A 4O57A 3SN4A 2GYIA 3O0FA 4BK9A 1WE5A 2DSKA 4EF8A 2Z7KA 1JYVA 2PD5A 3DYPA 3NL3A 2YLAA 3GZAA 3DKJA 3CEUA 3MKKA 3T40A 2H90A 1EX5A 3IVSA 2QF7A 4ZMGA 4Q3MA 2DT3A 3KBVA 3MUIA 3ZVHA 3ZLFA 1O4UA 3K13A 1F61A 2QAFA 4WOQA 2TAAA 2A0NA 1WXJA 2WNWA 5FEWA 1ZBCA 3UU0A 3TC7A 3ARXA 3O6CA 4D72A 4PUKA 2HPMA 2Y8VA 3LY0A 1FWTA 3SGZA 2DY3A 4R85A 3WUBA 3UW6A 3SCSA 4L64A 3A5FA 1TSIA 1CGTA 2V82A 4JN8A 2D23A 5REQB 2PTWA 3SCWA 3WLPA 3DI0A 1Q6RA 1KLYA 3LCXA 1H4PA 2P3EA 3QR1A 2QIWA 1D8WA 1V6VA 2GDVA 1QJWA 2C71A 4B92A 3GNOA 2OODA 1ONRA 3NL2A 1KM0A 2Y5SA 3PBGA 3IVUA 2NQHA 3EPNA 4ONVA 3G5EA 3SY1A 2YDAA 4LS1A 3E02A 1VAHA 3WZ0E 1KFBA 4OWGA 4GABA 1NSJA 3U2OA 1F4AA 1EWEA 3JUGA 3DFHA 2ZA2A 4XIMA 1VPXA 3W26A 4FK9A 1OGSA 1ECEA 1R9XA 3VKDA 3P84A 4JN6A 1S3HA 2DZTA 4IGMA 1TMLA 1NFBA 3L0NA 7ODCA 5M1TA 2YA2A 3RMJA 2CBVA 2PLJA 3EX4A 3OHMB 4C6MA 3C5QA 3U2ZA 5EMYA 3Q37A 4I7WA 4UZUA 5IFTA 2DW6A 4XVEA 1FUYA 1KA9F 4MG4A 2J66A 3A9BA 5CQ1A 1UWTA 2DPEA 1BVWA 3W6YA 1V7AA 2XUCA 4HSHA 1KR1A 2F6UA 1YTEA 1QFEA 3L5LA 1JZ5A 5EBAA 1JUEA 2WMIA 2QXWA 1K8ZA 4QFUA 2WK2A 1AL8A 1XFCA 3GXPA 1K6AA 1BXNA 1E4IA 4PUJA 3OG3A 3C0QA 3RPTA 1AMYA 5CZ0A 4MIMA 1EB3A 4IFKA 3SEPA 2ZZ4A 2DV0A 4ZB0A 2HSAA 3M0IA 3QYQA 3P80A 1RV8A 3SIZA 4FX6M 3M0YA 3GC5A 3RCNA 4AY8A 4HA4A 1TZZA 1R8LA 2XH7A 3FKKA 3LCIA 2RJHA 4HHPA 1UPMB 1G67A 3N29A 4LVAA 1T5AA 4BS0A 2NWSA 3LXCA 3ONCA 3E5BA 2X09A 1SR0A 3KL5A 3V5CA 1Q4NX 1J12A 1ZTVA 2P3ZA 3WMCA 3VGDA 2ZRYA 4E3VA 4FS9A 3KP1A 3PNUA 1M7JA 2PDMA 4F0RA 1HKJA 3V3WA 1GORA 1VB9A 1OCJA 1M65A 3GM8A 3W7RA 4MY1A 1WOAA 5BRBA 4O53A 1GHRA 5D2TA 4XSMA 4KRTA 4S3DA 2B31A 1C93A 2WC4A 2A3HA 2Y24A 2OJPA 3EXRA 3ZJKA 4C90A 5ABFA 3IGXA 2FHCA 5HJLA 4H19A 5CAKA 2DZUA 1NDWA 1G6CA 3CZJA 4G56A 2XFRA 4V28A 3GG8A 2G3JA 1LG2A 1NVMA 3ANVA 5FEZA 4IIFA 2Z1BA 3LHWA 3H2AA 4WKHA 1CXLA 3OGRA 3W00A 3P81A 1FWCC 2R9RA 2CPUA 1I2QA 2R8WA 4WY0F 3AAMA 2R1NA 5CJ5A 1FWIC 3C4UA 4H9ZA 1TFVA 3LD5A 1DVJA 5FACA 1EP1A 1B30A 1VH7A 2W79A 5CGTA 4UQBA 4Q4MA 5JBEA 3B9AA 4L6OA 1KXTA 4WLCA 3H22A 4GX8A 4WY0A 1SFTA 2BY0A 4KPLA 2Z29A 1TUFA 3U5UA 3QOKA 2PWGA 3HURA 3CT2A 4DX3A 4P7NA 2FJUB 5F2LA 1IEQA 2BGSA 3KTXA 4XZLX 1HG3A 1K8CA 1NWRA 1Z89A 1J0JA 1H7XA 3GHUA 1O5RA 5EMLA 5LZLA 3FS2A 2JGYA 2NUWA 3V35A 1HL8A 1XLGA 3RLUA 3H4WA 1EFZA 3SUTA 1MZHA 3NJ3A 3BURA 2ICSA 3R58A 3LI0A 3P5ZA 1HKMA 4WR3A 3AHZA 5BW6A 3NTYA 4DEFA 3L4YA 5RUBA 3RLGA 1Q63A 3L0GA 4FNRA 1OABA 2QMJA 4UQEA 2AOSA 3ABQA 2C79A 3REQB 2FPVA 1US0A 1KR0A 2PDGA 3UGRA 3NZGA 5BRQA 2G5WA 3S5YA 4KCTA 4HA1A 4Q8QA 3G77A 3SQLA 1N8IA 4AMAA 2NSOA 4JX6A 3E38A 2AQVA 4DXKA 3U48A 3BCJA 1CTNA 4GY7A 5HNTA 2PGEA 5E5CA 2E5BA 4DIAA 4EPDC 2JALA 2CHNA 3PP7A 4Q4RA 4X61A 4UQAA 2NSXA 4D9PA 4M51A 4W8BA 2Z2BA 2WZEA 2PBGA 4WSJA 2L5HA 3ECQA 1RJPA 3N2CA 4KH2A 3DG6A 5FF2A 1FOBA 2UY3A 4S3JA 5HINA 2ZUWA 4M6VA 3RRXA 2GOUA 4NAEA 2QCDB 5XIMA 3DHUA 1FHDA 4NILA 3QY8A 2V38A 2FTWA 1KQYA 2BGQA 4LVDA 5EGRA 2WXDM 3M0JA 5DCBA 4B3ZA 4G1NA 3MUAA 1AFSA 5A6SA 3NQGA 2VXNA 3OBEA 4LRSA 4AVNA 2GOKA 3S1WA 2XYLA 2PWFA 3UZJA 4BI7A 4E4PA 3IJ7A 4E5TA 4YTTA 1GW9A 2PWVA 3NM3A 1R3TA 2CKSA 3MP4A 3WY1A 3MP3A 4HNCA 3SUWA 4RNIA 5CSUA 1P7TB 1HTIA 4FLSA 2XH2A 1SW7A 3DXIA 3F1QA 1W3HA 1G5AA 1QW8A 1BWLA 4DJED 1NWSA 3CHCA 4LVGA 3BOLA 4V2XA 4U2ZA 3NZRA 5G2WA 3TTQA 1TJ2A 3UNDA 4DXVA 1CXEA 3S5SA 3QQ0A 1VIWA 4ATDA 4S3AA 1FKWA 4GYFA 4RDZA 3WF0A 3W7MA 2WLZA 3WQCA 4QAWA 3PTMA 2ACUA 3N19B 2A6LA 4YYFA 3NQ2A 4J2PA 5LHFA 1H1ZA 1R2SA 1S5VA 3DFNA 2AMGA 2B7PA 4K3ZA 1DORA 1DEDA 1F6PA 3CLMA 1BWKA 3N18A 2EKGA 3TR2A 5TAOA 3WLKX 5HMEA 2G50A 4NP7A 3VCNA 1OHLA 1JZ3A 2XZ7A 2O7SA 3AU2A 1JRCA 2DUXA 1PKYA 3G1VA 4DZHA 3FJ6A 2OLHA 1G9HA 3AIBA 4JTKA 3NXFA 4B5TA 3L4ZA 4I9JA 4IGSA 2VL4A 2JKEA 1XINA 2D0GA 3BMWA 2DUAA 2X1TA 4L4OA 4ZO8A 3TTSA 2VQUA 5FSDC 4EXAA 1E1EA 4XAPA 1QOPA 5T8GA 4DI9A 4MVAA 3FYOA 1IF2A 4S3EA 7TIMA 3WQ6A 2Q71A 3MBDA 3G18A 3FY1A 2RDXA 2QVHA 3SURA 5BROA 5CSRA 1EJ7L 4L1WA 4W5UA 2J7FA 3NWRA 4C6FA 3PPCA 1Y5WA 4O12A 1LOLA 2DJXA 1UKSA 4D6DA 4WDTA 1AA1B 3SGUA 2D73A 3HPSA 1PZ3A 1Q6QA 3CHVA 3T0DA 4M7SA 3VIJA 2XWEA 1GJPA 3I6RA 1EDGA 1O1ZA 2C7FA 1N8FA 2AKZA 2IKGA 1MEHA 1X6LA 4IPIA 4C6IA 4HNUA 5A94A 4JYFA 1PIGA 4QCFA 1OG0A 4GX9A 3DYOA 3NPWA 3EKZA 1UC5A 1VBJA 4DZAA 1JCXA 2GVLA 3T9PA 3W2KA 3URNA 1KXHA 2PWHA 3PBUA 4MYXA 3TTOA 2OYLA 3PAJA 1EXBA 1SZRA 1UR4A 3BGGA 1TTQA 4PSPA 4PH6A 4PODA 5E0FA 2HV5A 2J8GA 2J9YA 3SIMA 3OVRA 4FF7A 4LJ3A 2QCCA 1PYMA 1V4YA 1W3NA 5C8BB 5JMUA 4ICCX 2VX5A 2XN1A 3NAVA 4GD0A 3W1AA 1J11A 2OKOA 1Z48A 1DWFM 3U4FA 4O1CA 3MYPA 1XSKA 3VNKA 1K03A 1UZDA 1LZOA 3KW3A 1PE1A 5CSYA 1E6QM 1XH0A 2DGAA 1O12A 1E4MM 2AAMA 5CG0A 3INPA 1YLVA 5DMNA 4JBRA 4AISA 2CXEA 2LLEA 2FVLA 3R12A 1IZCA 4PMRA 2R91A 2XIQA 1BKHA 3ANUA 3DYMA 2Z28A 3NUKA 2YDRA 2PDKA 3WNMA 4IFRA 2XISA 3W74A 3H2CA 2V69A 3RR1A 2J9XA 4E6MA 2CBIA 4YPJA 4CQ9A 3U6WA 3PJTA 3QPYA 1TTIA 3P0XA 4M8UA 3W22A 1DIEA 3GG0A 4LPCA 1DYSA 1M01A 4KRUA 1GQJA 2WLYA 3I10A 2TYSA 2FPYA 2RGMA 1A5AA 1VJZA 3R6IA 2WM0A 2OSXA 1FCVA 1A0DA 1TREA 1XIFA 1YXCA 4YVXA 2YX0A 2VFIA 4UOJA 2BHUA 2CFFA 2YCLA 2PCQA 2ESCA 5LIKX 2QAPA 1EP3A 3EOSA 1PHWA 2QGHA 2C0HA 3HU7A 3R0DA 3TSDA 5JBDA 3L4WA 1Q6FA 4PBGA 3R1ZA 5D04C 3OQ8A 2HS8A 3VX1A 3RF9A 2PODA 4QCEA 3GY1A 3R43A 3GR4A 5DCDA 2Z26A 2G3IA 4MAZA 3AU6A 5D9MA 5I78A 3BICA 3QN3A 3AIUA 1MQPA 3W4RA 4D1IA 5G4WA 4GH3A 3EWBX 1W9UA 4ZGYA 2R6OA 4HCHA 3O0KA 1EJRC 1LBFA 1J18A 3QRHA 2HCVA 1X38A 4UOQA 2BXYA 5JIPA 3WH6A 2ISDA 2GUUA 3OYZA 2VZSA 3HZ3A 4K2SA 4H4IA 3HQNA 1H0GA 1F73A 3P6LA 2EQDA 2AGKA 2WHKA 3ZXWA 1HJVA 3B0UX 3KOFA 3R0KA 4EKJA 2X0HA 4RV3A 2BFGA 3SBFA 5LNSA 2QVNA 4B3LA 1K7EA 4C1NA 1QHPA 4LVFA 1LTDA 4DPQA 5GJMA 4O10A 3H7UA 4LBSA 3BV4A 3O06A 5HJXA 5HWMA 1TJRA 1V02A 1TO3A 3PS7A 3AMGA 1OEPA 3B0YA 3LMYA 1YNYA 4WRHA 1VFLA 1P4CA 1NEYA 4MUZA 2TMDA 1UZHA 2Y88A 4TVCA 3LDVA 4IHCA 4HU3A 5A6TC 5IOBA 4C6CA 2DJLA 4DJDD 3WENA 2NV1A 3WN6A 1DQWA 3IK2A 1TTJA 1H50A 1A5KC 1UKTA 4Q4QA 1QK0A 2VFGA 1SPQA 2BS9A 2QW5A 3H12A 4AIUA 2DVXA 4OBRA 1QXLA 1SYTA 3STGA 2V3FA 1V0NA 1JPKA 2ZOXA 3PANA 1SQ7A 1MW1A 3M7SA 3RJYA 1PZ1A 3O05A 4L7ZA 1UA3A 2WNQA 4DWDA 1UR8A 1PDZA 4PCNA 2VEMA 4OVXA 3BZGA 4QLLA 3NL6A 3ZO9A 4DYJA 3POHA 2DFAA 3HG5A 2FMOA 1NAL1 3TSBA 5HJYA 1BWVA 4FX8A 2Y4SA 5LIUX 1HO4A 2X2GA 1OYAA 4J3ZA 3VNDA 3IV3A 2V81A 2HBXA 4MZ8A 1NOWA 2EEXA 3N4FA 4HNLA 2TODA 1ZAIA 3S2MA 3LXAA 1XP3A 2GK1B 5JQ9A 3TWBA 4CQ8A 3NEHA 4ZOEA 3COTA 2XH0A 3NDOA 4IP4A 2E9LA 1OT2A 4HPXA 4J4KA 3BJFA 3C2FA 3PTKA 5I23A 3PN8A 4K6AA 2QCEA 2VCCA 4HQVA 4NYYA 3QKEA 3RHGA 3E96A 1D9EA 3OO2A 3SCPA 1MNZA 5A6BD 3W7IA 1GEHA 4AD2A 3KDOA 2IMRA 4DUXA 2DSUA 2CLFA 2V5LA 2QUMA 4DF1A 1UHVA 1V5XA 5CSSA 3M0LA 3OLIA 1CXKA 4KS0A 1EA0A 4M6UA 1XLJA 2D1ZA 4Q7BA 3NL5A 3LM7A 1UA7A 4E4FA 5BYWA 4PCTA 4PMNA 2ZUVA 4DN1A 1W1B1 1UMYA 4CVUA 4CD6A 2OLSA 2V63A 2QJJA 4R27A 2ADAA 1JDAA 3E0IA 4QE5A 4GUIA 1GVFA 3ISIX 5GPRA 3FV9A 5D09A 4V1XA 4YJ5A 1NQ6A 3L2MA 3GW3A 5I3IA 4W85A 4O0QA 3A4WA 4J3XA 5J5RA 3AYSA 2F6KA 3LS9A 2DUZA 2GJPA 1J6OA 4UCFA 5A6LA 3KCLA 4AZ7A 3PBVA 1U2YA 2WQPA 1DJNA 4KBXA 2XVLA 2A2IA 2R1KA 2YLLA 3T44A 3UPWA 3QC3A 5HPCA 2A21A 1N82A 3GWQA 1O7AA 4PMDA 3IJ6A 6TAAA 2J47A 4FALA 4Z2JA 1C9DA 2PE4A 3WLSA 1BRLA 2F38A 4U10A 1OF6A 1FWRA 2QDGA 2PDNA 4R33A 3BW2A 2YXOA 5U4NA 4KT2A 4QG9A 2WNZA 1T8QA 2VUNA 3VKCA 3ORWA 3HBLA 2CIPA 4J5NA 1PV8A 1XXXA 4U31A 2FYMA 3W7EA 2A85A 4CLMA 2CZFA 2OGYA 4AF0B 4AZCB 3UR7A 3AOFA 1NWUA 3KL0A 4DWSC 2JF6A 3E2QA 3UZYA 4E8CA 2ACSA 3MVTA 4CNNA 1GVSA 3AICA 3SCNA 4ASTA 4JYEA 3THCA 3M0XA 4GBDA 2C1HA 4WGHA 3ZJ7A 3LEPA 1BYDA 5CG7A 1TCMA 3WQVA 1EDQA 2QV4A 1EQCA 1K9FA 3SN0A 2PZNA 3GSMA 4H1ZA 1VFSA 4BWLC 3GG7A 5C0QA 4Q8UA 3N3MA 4TMBA 2WCGA 1Y8BA 1SM9A 2NV9A 3B9NA 4E38A 1VD6A 1S2UA 3S1XA 1EC7A 1ISYA 2CC0A 3BV7A 1C90A 4X3ZA 3BG5A 1X7FA 3VZZA 3VZXA 3NGJA 2V5DA 4MNMA 2FLIA 2CHRA 3T4CA 1AW1A 3TC6A 2Q3OA 3TU9A 1KFWA 1UW9A 1KW1A 1U1JA 4IL2A 4US5A 1JZ8A 3OZPA 1TV8A 4KEMA 3WK2A 3TNBA 4NVTA 3WF3A 4ATWA 4F9DA 4OQVA 3N25A 2BNJA 4KWUA 2YCEA 1OFQA 3QPZA 5AN7A 2E09A 3DECA 3CUIA 1KRAC 2WAGA 3DU0A 1M7PA 1H2JA 2E7FA 2ISVA 4NI8A 1WDSA 5B7YA 1PKLA 2DZWA 1EGVA 3FYYA 3PSWA 1HJXA 4H7VA 4ADSA 3UZWA 3SRDA 1LRNA 3PUDA 3CO4A 1IGSA 3OBKA 9CGTA 2DT2A 2D22A 2CETA 1EQPA 2JK2A 2CLPA 1W56A 1YPFA 3RM4A 2RJGA 3AYVA 4CNPA 3U3HA 2AMXA 1VGAA 1UQYA 3DUGA 4EPBC 3T05A 5D38A 3SCTA 4B90A 4W8AA 3VM5A 3C2VA 1G4TA 3VC6A 2AGTA 5AHMA 1LROA 4A3HA 4NNBA 3MSYA 2DW7A 3RMEA 3UZZA 3P0WA 3PZOA 3LQLA 4GQRA 5DRCA 3CXOA 3VIIA 5BU9A 1YNQA 3LN3A 4U28A 4UFIA 3VGFA 4PTVA 2DORA 4QE1A 3TJLA 3CWHA 4HK6A 4F0SA 1W9VA 2R1PA 4L9YA 1LLOA 3W6LA 4L9ZA 1FWJC 4XD6A 3O2LA 1EBHA 3VFLA 4HMNA 2V5KA 1IIGA 3W1NA 5FAGA 3NQ8A 3PJXA 4MTVA 3WLOA 5LXXA 1C9WA 1Q6GA 5U7SA 4CVWA 3CIWA 1TPH1 1AH4A 1ODUA 4BI6A 1E0WA 2VEFA 3PG8A 2Z1WA 1HJUA 4MNLA 3S83A 2WQDA 3C56A 1G69A 4K39A 2PDXA 3KTSA 1F8IA 3TDFA 3BOXA 4IH3A 3ONBA 1W54A 4HJFA 4XK2A 4C7FA 1LORA 2I9UA 3HPZA 2UY4A 1QBAA 3TVAA 5L9FA 4Z2LA 3NYDA 3PF3A 1EA9C 1UD6A 5DY3A 2HNHA 2XIIA 1VIZA 2ZRZA 3DEQA 1YTDA 4H41A 1TMHA 5M5DA 3IK4A 4DXXA 1ZSXA 1JF5A 4A21A 4YNGA 3WNKA 1THFD 3C2YA 3NVTA 3LI1A 3GU1A 2CZEA 3NQ7A 1EYWA 3QF0A 4UMCA 2BOGX 4DWSA 4ROPA 4F0MA 3RO6A 1PKNA 2EXOA 1JCJA 1VBGA 2DZSA 1QBBA 3CEPA 3UNTA 2HISA 3W2JA 3WMBA 4JFTA 4FNTA 4ZOCA 1JZ6A 4I8DA 4M56A 3CGTA 2ZX9A 1JI2A 3O8AA 4DO7A 5HK4A 3ZOAA 3W1RA 3SSZA 1POJA 5I09A 1TWIA 3OPSA 3CZLA 4BWLA 2Z24A 1R6WA 4KIRA 3KZPA 4LNCA 3P8IA 5EBUA 4M1BA 2HXUA 4FXFA 3IAPA 3AXIA 4Y90A 4QDMA 1M6JA 1B90A 1FX6A 3A3WA 5T26A 3TZFA 2BVDA 1CLVA 1WDWA 3OG2A 3M0HA 1JL8A 4ZQMA 3SQMA 2QJGA 3UY8A 1OCNA 4LX4A 1DWAM 3IPWA 4W86A 2R1LA 1ZALA 1R0MA 4ZFCA 4QXIA 1F3EA 4U5KA 1AMKA 7TAAA 5IHSA 5TQLA 1NU5A 2VVSA 4W7UA 3O15A 5EB8A 4EANA 4TMCA 3LCFA 3DFSA 3KWXA 2MNRA 1TV4A 3D47A 4WCJA 2PP0A 3WLHA 4K8EA 3VD9A 3L5AA 3VMNA 1AD1A 2PDUA 1GOKA 4A3RA 1JPHA 3BAXA 1EGZA 3TN4A 4C6EA 1E5NA 1R30A 2I7GA 3GVQA 4PUEA 1TIWA 4HD5A 5A3HA 2JGQA 4LEFA 3GVWA 1QI0A 1F5ZA 5KINA 1U1UA 2D2JA 1D8CA 1XC6A 2WMIB 1TELA 2NZLA 2VI0A 3MBFA 1P0DA 4IOTA 4F4RA 1TV7A 4I90A 3A23A 4LY4A 4PL2A 4JFWA 2W66A 3M44A 1V0MA 1TG7A 1TPEA 3PZNA 1HP5A 1VPQA 1S5NA 4AHPA 3AHVA 4D6CA 1JDFA 1L0PA 1ZLPA 3CMFA 2ZICA 3LCHA 1UH3A 3P74A 1Q6EA 1AD4A 4XKMA 1XFBA 1I60A 2QKFA 1WDPA 3Q58A 3M4HA 3V36A 3CZKA 3GNXA 1EC8A 4BY3A 1H51A 3EWWA 1E1CB 1XRVA 1PUDA 5LNRA 4AZBA 3MUZ1 1QO2A 3MMDA 4LF1A 2CLEA 3M41A 2WVUA 3VDCA 4E8GA 1JZ4A 3QZ6A 4UQCA 4NZ3A 1O1HA 3VOCA 2QV5A 1UZ4A 1J2BA 4NG3A 3PAOA 1CLKA 5A8MA 3PB2A 1UOZA 1TV5A 5LNUA 1SSDA 3GYEA 2WV8A 2EPNA 1B54A 2PAJA 3GH5A 2F6XA 1D7KA 1KM2A 4MFEA 4JIEA 2GGHA 5JU6A 2R94A 7CGTA 2ZRXA 3B03A 4QR6A 3WNNA 3WUEA 1OF8A 1WDRA 3WDQA 2WVVA 3BZJA 3TE9A 2NUXA 1K70A 4C6PA 5ABFB 3W1MA 4I8YA 5KETA 5HWJA 1SJBA 3IJDA 1Q3NA 1MFUA 4BJHA 1DWIM 3VK5A 3EMQA 4M7TA 3TJ4A 2YPIA 5HPOA 1MW3A 3NZQA 3NOYA 5DBTA 3ZR4A 4AEOA 4F9JA 2XJ7A 1E15A 4NY2A 3W82A 1IIHA 1K3UA 2CZDA 1EF2A 2JKAA 3A4AA 4JIRA 4JHOA 4GJJA 1AQ0A 2BSLA 3CAVA 1SUXA 3UESA 3W7JA 3WJXA 1EYEA 4CQAA 4IJCA 5CC7A 3N34A 3D5HA 4UFHA 1R3YA 3QBUA 1JI1A 3R8GA 1FP8A 3ITVA 2FHFA 2TSYA 3VOIA 3FW6A 2QGYA 4RLIA 3ZYZA 3G1HA 4PE8A 4HZ8A 1OB0A 1EIBA 3OB8A 1JAKA 3OZOA 3E49A 1DIKA 1FXPA 4Q6XA 4LUIA 4JY9A 1R3SA 3TTYA 1KXVA 3LRLA 4YTUA 3CUFA 2BLEA 3N4EA 1XLKA 4X9SA 3MSDA 2XFWA 2B7OA 4BF9A 5F1VA 4EWJA 3LTSA 2QEZA 1XYBA 2X0SA 3EOOA 2BHZA 4H9VA 4CQCA 4Q4SA 3WQPA 2VC5A 4BHYA 4PB4A 3V0UA 2UWFA 3QZEA 3LHTA 3R94A 2JEPA 4F66A 2OCZA 4HU0A 3P82A 3RN6A 4GCAA 4HPNA 3W7CA 3LCLA 4FOJA 4XAGA 3MHGA 4MSSA 5DN1A 3O7UA 3W2UA 2I5QA 3W7GA 2EG6A 4GI8A 4JOMA 3B04A 3C3UA 1JUBA 4HKPA 1B5TA 3F4CA 3KVKA 4QJ1A 1PXGA 5H1WA 1E9IA 3ES8A 2A3BA 1RD5A 4KWWA 1L8NA 3TIMA 4QROA 1XBYA 3MI6A 1RJQA 3P67A 1F3XA 4RPPA 3AHYA 2Y70A 4ACZB 2QCLA 3CZ8A 4UTTC 3V18A 1XC4A 3FVDA 3RDKA 4CN6A 3NPUA 1KKOA 8TIMA 1XYAA 4B2DD 2CW6A 3HA1A 3WSUA 4QISA 1UC4A 1XLIA 1S1PA 3L0KA 1SSGA 5GQBA 6XIMA 4IG2B 3OOQA 2VUYA 3QJAA 3GRIA 1GQIA 2BTMA 3VMPA 2NQ9A 1BFNA 1T40A 1J2WA 1E6XM 1YDVA 1RK6A 4GBUA 2HS6A 1XPGA 3THAA 5G4EA 2NT1A 1KXQA 4UTJA 1W9XA 3P60A 2XPKA 4NAEB 4UMBA 3GDRA 1GW1A 3BDKA 2ZVIA 2QPXA 3K4WA 3LCWA 3S9ZA 3DFYA 3FLUA 1FWBC 2NXGA 3H54A 3V7PA 1WPCA 4JXCA 3EA1A 3USZA 2OZ3A 1V6XA 5GNXA 5FA5A 3CO8A 2PTZA 3UG3A 4YN5A 4X9YA 7XIMA 2POTA 3AWNA 4E8DA 2IQ0A 3ZM8A 4WJ8A 4JPGA 3ENLA 3L4TA 1DL3A 5I7GA 4XAZA 1ZHAA 3NFUA 4O1AA 4GCXA 2J4GA 4U3CA 2XFYA 2PDWA 3LLXA 4L5ZA 2OPJA 2XVGA 4GI4A 5H91A 5DMMA 3KRZA 4AXNA 5G2HA 2I9EA 3M16A 3TCEA 4MAVA 2PS2A 2QF8A 3LLDA 1TJ0A 1KCZA 2B4GA 2E3ZA 1MQQA 4XZWA 3TNOA 3LYEA 2E4TA 5E09A 1A5NC 1SO4A 2V2HA 3MZ2A 2G37A 5GNZA 3TUUA 2W67A 4LCRA 4O1BA 1BGGA 5JXQA 4FB7A 4GZEA 3CV2A 3NZPA 3RCMA 5XIAA 5BNKA 1KRCC 1XYZA 2HBVA 1VQTA 4RUBA 3WL1A 1P6WA 5D03A 1FHUA 4KEVA 1E43A 1TPB1 1CWYA 3B8TA 1YE4A 1W2VA 3W2MA 1KTBA 1WBHA 1KWKA 1PTGA 1DXFA 1AQFA 3B8IA 3SO7A 1K6WA 1W5PA 1A3HA 1V0LA 1MUCA 2QT3A 4GA8A 2NW0A 1FKXA 1HVXA 2WWCA 3S3GA 4AD5A 2V8ZA 4I3GA 5B7ZA 5LSMA 2BY3A 5CZTA 4UFLA 3NQBA 1HJSA 1EWDA 5AC8A 1XWYA 4XO6A 2P8BA 3HPFA 5HNUA 4KGLA 1DTUA 5K3VA 4QLJA 1JF6A 3A64A 2J7BA 3C8NA 4AIBA 2YL8A 1PBGA 4JICA 1K7FA 2GZXA 5DRIA 2E9MA 1YQ2A 4B3KA 1KM5A 4BCEA 3L7RA 3H24A 3M07A 3SRFA 2F2KA 4XTIA 3GNPA 3ZFHA 2NLYA 4DBEA 4XG1A 4N7QA 1JPDX 3POCA 3P5YA 5FL1A 4RZ6A 4A8LA 4E3TA 1ELSA 2DIKA 2VEPA 4Z0SA 4IMCA 3T78A 3OLDA 4ZQOA 2QDDA 3OYXA 4YMZA 4S2CA 3U2EA 3V4BA 5GJNA 2WHLA 3HPAA 4GNVA 5HDRA 3WD0A 3KE0A 1MUMA 1RD6A 2Y89A 2J7GA 2ASHA 1XL9A 4EX4A 4JTUA 2DZPA 5A8OA 4K8HA 5HMFA 5H8UA 1Q7MA 3S2CA 4WVXA 3W73A 3WLNA 3SADA 1OFAA 3N17A 4B5XA 1PIFA 1WUEA 2VFDA 4N6EA 1US2A 1G7VA 2ZBTA 1RCOB 2VZUA 3GC2A 1IE7C 4IIEA 1B4KA 3QYSA 1FWSA 3UP8A 4Q8MA 3GXDA 4MWAC 2GVGA 4JTTA 4O8RA 5FF4A 5A8GA 1JGMA 1HIZA 4X0NA 2A5HA 2Z1XA 4QNWA 4CD7A 4ZOBA 3VMOA 1P0NA 3E12A 4O1EA 4WF7A 4AWEA 1W3KA 1QHOA 2E1DA 2IQTA 4Q8OA 5HNRA 3H4XA 5I07A 3PVFA 1V7YA 1J0ZA 1B3ZA 3U7VA 4A2SA 4UTTA 1QRQA 4A8NA 4I5XA 1I9CB 2XGBA 1DJQA 3RCYA 4IFOA 4X0VA 1VJIA 1B3WA 2PRLA 1UWAA 1WZMA 5CLWA 3GK0A 4QSHA 1RUSA 3EZ4A 1OX4B 1BG4A 3OIXA 5GNYA 5LHEA 3LSCA 3E0FA 3T07A 3AI0A 5K7JA 4AD0A 3W2NA 4NHVA 4TQTA 4J35A 3AYRA 4XBKA 1KM4A 4CN1A 4C6QA 3A5VA 1QI2A 5IM51 2C1GA 3XINA 2QCGA 1E72M 4OUEA 3PR2A 4AD3A 4ILSA 1O68A 5F7UA 3R79A 1EUNA 3LRKA 1YPXA 2XINA 3PWAA 3CMGA 3HG2A 1X98A 4C6DA 2NT0A 2QPUA 2ZQ0A 1TE1A 5EY5A 3TXVA 4PN2A 5HAOA 2WMJA 2VOMA 3Q67A 4O54A 2QCHA 3NOEA 3BMXA 3DZ1A 1W31A 3IJIA 2YA1A 4KW2A 2A3CA 4E4UA 2OO6A 2G4FA 2C0AA 4IL0A 4JGDA 4LY8A 4PMYA 1Q2RA 4J27A 2A4AA 2CLLA 3AZSA 3VI2A 2PPGA 3VIOA 3L12A 4IP7A 3GH7A 3B06A 4BZYA 1CGXA 2V2DA 2YIHA 2ZXQA 4M0XA 3LLFA 3IS4A 3MC5A 3MS8A 3CHDA 1Q65A 4P2VA 3ZQ9A 3VNZA 5SWUA 4LC8A 3G1AA 4N42A 3PJWA 4Q7NA 2QJNA 3BLOA 3ARRA 4M6PA 3K1DA 3DHPA 1HXJA 3CYVA 1Q6DA 1JFXA 4OOUA 1KFCA 3KOWA 4FXJA 3V5FA 3WLQA 4AHOA 5C70A 3UPBA 2YFNA 5A6KA 1X8FA 2DQWA 1FHVA 4DY1A 1LQ0A 3W38A 1N2VA 3BCDA 3UCCA 3FGCA 3ID7A 2DSWA 1Q8JA 1HT6A 1OFEA 2X05A 1C8VA 1LQAA 1PCKA 2VKZG 4O1DA 1XLFA 7ENLA 3EWZA 2QUTA 2PTDA 4ZA0A 4BQ2A 1SO5A 1CDGA 2YGYA 2GSJA 4QIUA 4ERGA 3WQ8A 4G2DA 2XDFA 3VIHA 3W71A 3VZYA 3WD3A 1FFQA 1XRSA 2J88A 4UR7A 4ZTXA 1UPPA 2POZA 4L9XA 5E9AA 2ONEA 3I7RA 4OTKA 3VE9A 4TVDA 4I9MA 3UJRA 1TVLA 1DOSA 4NSBA 4A6GA 3BOFA 1KM3A 3KCOA 3W7NA 5JIWA 3PZMA 7PTDA 2OB3A 4LSBA 5B80A 3NQCA 4S3GA 3FJLA 4N2YA 3VNLA 4GQQA 4V33A 4KEUA 3TLLA 1WX0A 2E9BA 3ICJA 3N15A 4RK8A 3UT0A 4O11A 3S0CA 2P53A 2VHLA 5AC7A 2E68A 3TFXA 2DP3A 3VNYA 4NYUA 4H83A 1O66A 4F2BA 2PA6A 3ME3A 1CW2A 4YWSA 1TKKA 4Q4KA 5HR7A 7REQA 4EOUA 4KCVA 2V68A 3MSGA 3CLWA 1L6GA 1TRDA 4AVFA 4AG0A 3FXYA 3MY9A 1L2UA 3NSXA 5A6JA 2RKXA 4AZ6A 4MWAA 4FIQA 3BLLA 4M1RA 2PURA 4LYQA 3CV1A 4U2YA 3VOGA 3GZ3A 1GVIA 1Q13A 4GYKA 4GACA 1CNVA 1WA3A 1VBRA 3B0XA 4HB7A 3TROA 5KZEA 4W4QA 5LXEA 1H09A 4LYPA 1K4HA 4PTXA 3LV5A 4NKCA 5A8NA 5CPLA 1OFDA 4A35A 3FIGA 4C6KA 1D7FA 4KWSA 2IQDA 3AQUA 1VFMA 1QW7A 2QCNA 4QS5A 2H9AA 4S23A 3TAKA 2ANUA 4UTWC 5FAJA 3C0JA 2FTYA 3TR9A 2XIOA 3QTGA 1XPYA 3KX6A 5I77A 1K9TA 4DBSA 1CI1A 4P7QA 6PTDA 1MNSA 4GJIA 5EMKA 2UV8G 4AFYA 3MMUA 2PDFA 3QEZA 4LUYA 6REQB 4PGLA 1EJSC 1R47A 2HE5A 1REQB 1CPUA 3AJ7A 3LUTA 1A0CA 2WZTA 3SN1A 4QQ3A 4AU0A 4XZNX 3UXLA 3QFEA 1LWJA 1JUKA 5D30A 1D3CA 3LHZA 1H5VA 3AZRA 2WJEA 2HTMA 2YL6A 3N9SA 3TN3A 4JIQA 1ZY9A 2B7NA 2GJLA 4GXPA 1TWSA 4PUDA 2E67A 4PBEA 4Y9PA 4H6RA 4JTFA 5HNNA 3B9EA 3BQ5A 4AC1X 4ZE4A 2WBKA 1C7SA 1OFRA 3W1TA 1TPUA 1F2JA 5I5RA 5A69A 1SJAA 3KBJA 2BBFA 3SGGA 2WANA 3D46A 3KS6A 1OD0A 3CYJA 4ICNA 3LPGA 4IF2A 2WVSA 4B15A 1SZGA 8XIMA 3MDWA 3MO4A 3LNMA 3SUUA 4PTWA 3TSMA 2FZ9A 5CBJA 4EE9A 2NVCA 1I75A 4PB3A 4GMEA 1E1FA 1T6MA 2Y8KA 4D2JA 4J7RA 3W02A 4NJJA 3LCGA 2XVKA 3DCPA 1H7WA 2OZ8A 3EXTA 1ZFJA 1D3GA 3OZYA 4HIBA 4ZTYA 2X40A 4HJWA 1R3RA 2PDBA 1UASA 2J78A 3MWCA 4CQDA 2OR2A 1TV2A 2ZZ2A 2R14A 3G1XA 3RITA 5DCEA 2PB1A 3GBDA 3IACA 4LBRA 4L1GA 3VIPA 3M9YA 5FOOA 1AH3A 2FTPA 4KWOA 1XM3A 1BHGA 2J7EA 4H9XA 4AB4A 2NVAA 4RE0A 4MPKA 4GVFA 1N55A 2GQ3A 1GT8A 4NRRA 2V6AA 2FVMA 3DC8A 1P5BA 4GO8A 4YU1A 4YCOA 1PYFA 3PC0A 2CESA 3B8UA 1NF0A 1EZ2A 4MADA 3DHDA 4L6DA 2A3LA 3EWCA 4PFMA 2VFEA 3LSBA 2O9OA 2HVOA 5LGXA 1JZ2A 3WUFA 1H62A 1TB3A 4ICMA 4G1KA 5CPOA 2INEA 3HGRA 2OTDA 8CGTA 4KEZA 4JFVA 5DMYA 2X1IA 1XIDA 3FN9A 3LM3A 1LT8A 2PDJA 4RR4A 1P6CA 4A29A 3BVJA 3W81A 5M2FX 1KGWA 4UNLA 4KGJA 1NM9A 2BASA 1QNRA 3AXKA 3W7HA 3UYCA 4C6JA 3NURA 3QSTA 4IPPA 4PMXA 2VGBA 4NAFB 1RVGA 3WDHA 4NXSA 5I3HA 4JNZA 4YYCA 3LHVA 3T09A 3S9IA 4QLKA 4BF5A 3TYDA 4FNPA 3N2TA 1GZ1A 1ADSA 5F2GA 1H60A 4GO9A 3URAA 4L1XA 4KERA 1I2RA 4QSFA 3SJNA 1NWTA 2IUZA 1DIDA 1EHNA 2PDCA 3I7SA 1OIMA 1KFLA 5PTDA 1VLWA 2VOTA 2G3NA 1H0IA 3OVQA 1DXEA 4W84A 1IEVA 2DU2A 3IRSA 1V03A 1W3IA 3UF9A 3DG7A 2X1SA 3BPWA 3LHUA 3NQAA 3T42A 4GUJA 4XSLA 3P8JA 1ISVA 4Z2KA 4UTWA 1WO2A 1U5VA 2WHJA 1AL7A 1EDTA 1LWIA 2QIIA 2WZHA 1FCUA 2E77A 3IGUA 1YBQB 1IEWA 3CQJA 5I79A 5FIPA 2GQ9A 1EOMA 1IR2A 3CB8A 2VZOA 2YSWA 1W5NA 4O0ZA 3UJSA 3NVDA 5K2ZA 2KX9A 3G1SA 2E6DA 3ZT6A 1D3HA 3TJIA 1B4EA 1IT8A 1GJUA 1RQEA 1LLWA 1XQLA 1IHIA 3UD6A 4CQBA 4LALA 3AMCA 1IWBA 5AOUA 1HKIA 5A1AA 1F3WA 1FBAA 5I03A 1AJ0A 2XG9A 4V15A 4CGTA 3NGFA 3C52A 1AG1O 4RDWA 3W6MA 5D05A 1KFJA 2O55A 2ZTKA 3H70A 1KNWA 5C7VA 1E71M 4GIRA 1TWWA 1QPKA 2F2HA 2D3LA 3M1ZA 2BVWA 1FHLA 3BG3A 3A3XA 1W1ZA 3EGJA 1O6IA 2J13A 2E6AA 3N73A 5HATA 3QHMA 2ZA3A 3ARVA 2QULA 3L67A 3KFTA 2R82A 1U83A 4DAFA 3P62A 3BC9A 3SCVA 2EAWA 3TYCA 4LVBA 1OM0A 3TYZA 2Y5EA 3UVIA 2FZ8A 5E9XA 2FGLA 4RNHA 3N2XA 1K9DA 3KXQA 1UH2A 4G6CA 1TPWA 1ITCA 2OO0A 3NPXA 1E0UA 1IWPA 1YX1A 3GR7A 1JNDA 1KBBA 1ME7A 3BGAA 4H7CA 3EA2A 3S2LA 3DHFA 4YHEA 2WJFA 3I7QA 4PEKA 4JDYA 4W93A 4UBPC 4RE4A 3CHEA 5E1QA 3W7PA 3RR4A 1N8WA 4EAYA 4FNQA 4JTAA 2PC8A 3MUXA 2BY2A 1A53A 1X6UA 5HOSA 4FF5A 2G8ZA 1YDNA 3DH7A 4YL2A 4NZCA 2Y5JA 4Y8FA 2ZUNA 4HK7A 1TA3B 4AD1A 3MMTA 1TR9A 1XLLA 4XBJA 3PUOA 4L56A 2XH4A 1ONEA 1KLZA 3KVMA 1HNYA 3HV9A 3G0XA 1WKYA 2DIEA 1DIOA 4PRWA 3R89A 3MCNA 2ZWZA 3ARSA 3L5MA 4ROQA 4QQUA 1P0KA 1H7OA 3EXSA 2INFA 1DQUA 1JNEA 3AIQA 1WDDA 4C5ZA 1A4MA 5G4HC 1UIOA 3FSTA 3G3DA 4MJZA 1Z32X 3MPGA 4H7ZA 1YNPA 3OW1A 2ZUTA 2ZTJA 3NYZA 2GJXA 4LAUA 3WELA 2PSNA 2CLIA 4Y9MA 4AWSA 3GE7A 1MUWA 5D4YA 1V79A 3QVQA 4GC3A 5KSWA 2WB5A 3GKAA 4R5EA 3ABRA 2HMCA 2FKPA 3BLIA 5CPQA 3VC5A 5DANA 5E0CA 2Q3RA 3H2FA 5AC5A 1XIJA 2JE8A 1IGWA 3NEVA 1XIGA 1YW1A 3ES7A 1J0IA 4N9BA 8A3HA 4JX4A 3TN6A 3BTNA 3O6YX 2J27A 3HGJA 1KM1A 3A6OA 4P7RA 1DE6A 5A6MA 4N0RA 3W88A 3VUSA 4UOZA 3MVIA 1KV8A 1MEWA 2XSAA 3T0TA 1OY0A 3IEBA 3ATZA 3N4AA 5E0KA 1QNOA 4ADUA 4CNSA 1RQHA 2ALRA 4H01A 1JDDA 3REQA 4IX0A 3QSRA 3HOJA 2WZIA 1S1RA 2VR4A 1GONA 4IQDA 5MKGA 4GWEA 6ENLA 1SR9A 2YCIX 2HWGA 1OFOA 5DQPA 4CNTA 2FDSA 4IISA 4Y9OA 3UBPC 1PEZA 1E0XA 4YXGA 3RFAA 3AMLA 4RW3A 3KVJA 2WPBA 2P0IA 3A13A 3RRAA 4LUTB 4H8HA 1ICPA 3C61A 4F0HA 3E6EA 1XGZA 1G1YA 3Q45A 4G7FA 2ZX7A 1RJRA 3O6AA 3VPLA 4J3TA 3PB0A 4KF1A 3GTIA 1NP2A 1HP4A 4FHAA 2YYUA 5LIYX 4DB7A 4TUFA 3GYCA 4ZO6A 1SMDA 3VD4A 1VS1A 1RLCL 1RALA 3FJ4A 5J8LA 2QCDA 4A8RA 4P8VA 2A3AA 1XX1A 1XD1A 4F2TA 1XICA 1JCMP 2OYKA 5DXYA 4TX6A 4OJYA 5F2MA 4H9TA 1QK2A 6XIAA 3W84A 5FESA 4POCA 4WIWA 3S1VA 3BWWA 4OOZA 9XIMA 4IQEA 3N3TA 3MUY1 4NZJA 2VNCA 1Q6CA 2FJKA 5I2UA 1CZ1A 4QDWA 1MDLA 2GVJA 3GVRA 1CENA 4Y7EA 1JDCA 3TN5A 3UR2A 1K7XA 1P7TA 3M6YA 2NQLA 1NP0A 4Z42C 3DFQA 2FMNA 3N12A 3G6MA 1H3GA 3TQKA 1QO5A 4IPNB 3APTA 4A3YA 1HVQA 4AZ5A 3G24A 1GYLA 4LRTA 2IPJA 3FFSA 5CXPA 8XIAA 2ZRUA 1O5QA 3PPGA 2DEPA 1YTKA 3IJ8A 4RJEA 1RCQA 2JQXA 3VIFA 8RUCA 1XLCA 4K7YA 1DTNA 4Y9NA 3M5ZA 3BUVA 2B0MA 1R7AA 2OFJA 2PEVA 1VYSX 5C71A 5H8MA 1AODA 1H7NA 3BMVA 3WF1A 1QI4A 2EJAA 1B1YA 2V30A 4JIPA 3HIJA 4G8TA 1NQKA 5DT5A 1BVZA 3WX7A 2G3FA 3GXMA 3MQTA 3PFMA 2FPTA 3B9OA 3NO1A 5AHLA 4R9XA 3FA4A 3EKGA 1IXNA 2O7QA 4IPLA 3PPFA 1JJKA 2DIJA 3L2IA 1WAUA 1Q85A 4JTHA 3EEGA 3GTHA 1XG3A 4OFCA 2EJ1A 5CKSA 3EYPA 1EF3A 4A22A 3QPEA 3H2MA 3MI3A 3E9AA 1NY1A 4HGXA 3L4UA 5F1UA 4RXFA 2EBNA 2A7PA 4XD3A 3VUPA 4IIDA 4YHGA 2E25A 1MVYA 3H2OA 1TTPA 1OC6A 3W1PA 2ZXAA 1WDQA 3WNLA 3KOYA 1UOKA 1PS9A 5AY7A 4WOZA 5CGMA 3M46A 3QQ1A 1W1TA 5EPDA 3M0KA 2CZVA 4IXHA 1PTAA 2R1MA 4RW5A 1GOOA 1ODZA 4HZ7A 4IIGA 4XO7A 3G3MA 3C0SA 2UZ9A 4TIMA 2E5CA 1BQGA 3WLMA 5BRPA 1E6PA 5I3GA 2OWWA 3IJ9A 4FNSA 4HK5A 2XIJA 2DDXA 3QKZA 2ZZ3A 4K36A 4RZBA 1E6ZA 1EEXA 1AZ2A 2XGIA 2I5IA 4FPSA 2OU4A 3STPA 4XQ6A 4US5D 4D6HA 3TV8A 4KKXA 4TV6A 4O8AA 4TO8A 2VQTA 4GIAA 3TW6A 3L4XA 3QFWA 2PLKA 2O4QA 4D6GA 4AVOA 2OLAA 1JYWA 3VGBA 2OSYA 2B7QA 5F4XA 2PMQA 1H7RA 3GX9A 3B8DA 2EKCA 4X63A 3IIOA 2VENA 4IMGA 1WXYA 1XH2A 3AIWA 2WBGA 4AMCA 1XJBA 5EKYA 1J5SA 3GXNA 1W91A 3PZ9A 1KBIA 2EPMX 2VM8A 1R2TA 2MANA 3W3OA 3K8MA 1UIPA 3STCA 3EAUA 2H3DA 2AAAA 1YXYA 4MGGA 3FEMA 1GKRA 1XKYA 3ARYA 1CB7B 3VD7A 1M5WA 4IM4A 4JTLA 3USBA 3ALGA 4K37A 1W8GA 4N9EA 1S2TA 3FSUA 3JU2A 3WJZA 2JIWA 2PF0A 5T9CE 5TF0A 3UVAA 4M6QA 2X2YA 3IWPA 2WMHA 1JD9A 1Q45A 2WC3A 3N2MA 4HBKA 4FR6A 2YKKA 3GS6A 2D2HA 3WEMA 1BTMA 2BP1A 3WJYA 4H04A 3UJFA 4IGNA 4LCQA 3C8FA 1GVYA 2ATSA 4JFUA 2VFFA 3ZSTA 4PMUA 3ARPA 1ISZA 5TNVA 3O07A 1LOQA 4HOZA 3W75A 2YYTA 2EF9A 4UTFA 4YVPA 3SUVA 1WP6A 2C3ZA 2J74A 5H2ZA 5FEPA 3IGHX 4JTGA 2Z6JA 4HVXA 2GJNA 1OK4A 5FF3A 4ENLA 4PTDA 1QNVA 4XKYB 1XR2A 3WLRA 2G96A 3ITLA 2DZVA 1ITXA 2VJXA 4LS2A 1SFLA 4GNKB 3G1DA 4AC7C 3BARA 3HJZA 3Q65A 5EFDA 4HNVA 1W1VA 4INFA 1GEQA 4O16A 1XCFA 3P93A 5ECVA 2VRQA 6TIMA 1OYCA 3O6DA 3T4WA 1C91A 3NIYA 3HF3A 1IR1A 4DF0A 3CIXA 1W9DM 1E70M 4DYEA 2WM1A 4CCEA 1XLDA 1P0EA 3CH9A 3MJMA 4U3AA 1AQMA 1GGOA 4HPGA 3RK8A 1KCLA 2ISFA 2NQJA 4NL1A 4PRRA 2Y7GA 1NF7A 3TQPA 3CPRA 3ARZA 3WQFA 4RX0A 4S38A 1DHKA 2ABAA 1R9ZA 3QY7A 3P7YA 3T55A 1HJWA 3T0AA 2VX7A 2OKTA 2OEJA 2Y0FA 4ERIA 4GIYA 5C6MA 4F0KA 1HL2A 5A2AA 1KKRA 3B4YA 3C2RA 1MRAA 2Y61A 3GNRA 3VGEA 3FAXA 3QOMA 2C13A 4C6LA 3PBYA 4YTQA 1MYRA 4LFYA 4DWSD 5FJIA 1S3TC 4AZIA 1YPIA 1AQHA 3PPHA 1UJQA 2FZBA 1J0YA 4Z1YA 3MSRA 3SCUA 1YDOA 5T91A 3LPOA 3TYUA 2OOFA 2V9DA 4X22A 4YTRA 1VZWA 1BGAA 3B9DA 2YOCA 1OQFA 3DFOA 3G1YA 1CT5A 4U33A 1B3VA 5AYIA 1Y65A 4NJGA 3EBVA 1X1ZA 3UWWA 5ECUA 4ML4A 1YRRA 3SECA 1NFGA 1UR1A 2KZHA 3UZ5A 3G0UA 1ME9A 3O63A 2BG5A 3MHFA 4DJFC 3GW0A 3B3DA 1TWDA 5I3KA 1LP6A 4UUIA 2IXVA 4GNJA 4LUSA 1OCBA 3AO0A 4GPNA 1EO7A 3ARUA 4PBFA 3OLGA 4GI6A 2GK1A 1DWHM 1B9BA 4RV8A 3U8GA 4QBXA 2R24A 4UR8A 1W1YA 3V0SA 3B4UA 2VO5A 3W37A 4CNUA 3DG3A 3WQDA 5JVLA 3ZIZA 1F7BA 2AQWA 3MU7A 5H8PA 1E6NA 4IJBA 3L4VA 1XG4A 3VKJA 3CT7A 2DT0A 2A79A 1UB3A 2Y63A 3SDOA 3IUDA 3H2NA 2NQ5A 1W3JA 5C9XA 2Z1SA 1ZPTA 1UD2A 1UQZA 4LQ1A 4CCDA 4LAMA 3JR2A 3ZT7A 1E9ZB 1GG1A 3GNDA 5D2XA 3AUOA 1EGMA 1IT7A 2X7VA 3F7JA 3WBXA 4CUCA 1KTNA 4Z2IA 1HO1A 3QY6A 1F76A 2V5BA 1CCWB 1Z7AA 3DFTA 3AWOA 3W7DA 4NI3A 3RU8X 4QAIA 2GSHA 3BSMA 2NWRA 3CTTA 3RAOA 2PWEA 3EPOA 3VVGA 1ONXA 2EGZA 1MZRA 4REQB 5D2VA 2CBJA 1W1PA 2BB0A 2DSVA 1XISA 1YKWA 2ZX5A 3K1GA 3NO3A 1EHAA 3TFCA 5BXRA 1RHCA 1V3LA 4EIVA 1V0KA 1W9PA 3M0MA 4H2CA 3NQDA 5DMLA 5HA7A 1ALDA 4HZMA 5I06A 3W53A 4JTRA 3TYBA 1VHCA 3BL3A 4XV0A 3TYEA 5AC4A 1OX6A 3LGGA 3QXBA 3WF2A 2VC7A 4UMAA 1WUFA 2ZA1A 3DGBA 5K9XA 3WQ4A 1TPDA 1YXDA 3TOPA 3IJLA 4CEUC 2Q8LA 5BOEA 2IS7A 3LQGA 1G4EA 4LWWA 3LV6A 3VFCA 2Z2AA 4AZCA 2CITA 4KCWA 4AY1A 3EWYA 4UR9A 5H6HA 1DJZA 3DC0A 2V5JA 1V6YA 2ISSA 4DBUA 1KBLA 1O95A 1QWGA 4B5UA 3ERPA 5BU6A 1OC5A 3DFPA 3MWAA 1ISXA 4X60A 3L21A 1C8XA 1XBXA 4Z08A 3WMLA 4XZHA 1PDYA 4GZ7A 5F4SA 1SFSA 1IQ8A 3L2LA 3NDYA 3W28A 1VEOA 1P1XA 2PDLA 3N6JA 3EOEA 1HZYA 1RBLA 3LBCA 1KV5A 4LS0A 3LPFA 1ZL1A 2CZ5A 4D8AA 3W83A 4ACYA 2E1WA 3KVLA 5I0DA 3EX3A 3BLKA 4LNYA 4L4PA 5CC5A 3GDBA 3VDAA 4RE3A 2V5CA 5A2BA 4R7WA 3GDLA 4A3UA 2H9AB 1DWGM 3VAVA 1Q8AA 4NXKA 1PWLA 3HPXA 3E74A 4PUUA 5C55A 1HX0A 3HQPA 2DZBA 4O4VA 4DZIA 3CB3A 3S46A 1JG9A 4GRSA 1EX1A 4LANA 2QUUA 2HVMA 1EPVA 2YR1A 1H5YA 2YL9A 2QUNA 3AHXA 3UWYA 4G7EB 4K68A 3II1A 3WK1A 1H49A 3OGSA 3R11A 3SQSA 3BK0A 1ITUA 4N6FA 4HPHA 4L80A 4U5IA 5HWNA 4DJFA 3ANYA 4QTGA 2PU0A 1PPIA 1BPLB 3QGAC 3VCRA 1CXFA 2HRWA 3CMJA 1A50A 4DO4A 2GPTA 4I7VA 5IDIA 1A5LC 4C6NA 3GTXA 3S47A 1BXCA 2YBUA 4XB3A 4PCFA 1J10A 3MMWA 5D8ZA 1E73M 4UTMA 1OG6A 3NXLA 1ONWA 1XI3A 3A4JA 3M5YA 2XN2A 1FP9A 3WJSA 4I6VA 1V3JA 2XM2A 4AUBA 1VFUA 1IXOA 3WH5A 4R7JA 5CPSA 5KMYA 2Y62A 5BZAA 3FYPA 3G6LA 3RM8A 3E0LA 3QHNA 4BQ3A 1C8YA 3VOFA 2GQ8A 1Z44A 2X0YA 3TA9A 4IP5A 1MRQA 4OECA 1SW3A 5A8QA 1SU5A 3PZGA 1VCVA 2PI6A 4ZEPA 1MW0A 3GDTA 3D3FA 1IXQA 1H7PA 3LMZA 1UD8A 1T7LA 5KTLA 3DIPA 1EJVC 2GGIA 2E40A 4JHMA 1GQNA