3B4YA

Fgd1 (rv0407) from mycobacterium tuberculosis
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
332
structure length
331
Chain Sequence
ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELAMNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Oxidoreductase
molecule keywords PROBABLE F420-DEPENDENT GLUCOSE-6-PHOSPHATE DEHYDROGENASE FG
total genus 117
structure length 331
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.98.2: Glucose-6-phosphate dehydrogenase (coenzyme-F420).
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 3b4yA00
3B4YA 1TVLA 2B81A 2I7GA 3B9OA 1LUCA 4US5D 1BRLA 1M41A 1NQKA 3FGCB 4UWMA 1Z69A 4US5A 3C8NA 3RAOA 1FVPA 1XKJA 1BRLB 1YW1A 1EZWA 5DQPA 1F07A 1LUCB 4J2PA 5LXEA 1RHCA 1BSLA 3B9NA 5AECA 3FGCA 1NFPA 3SDOA
chains in the Genus database with same CATH superfamily
1F74A 3ARZA 1YNYA 3IK2A 5A6BA 1JDEA 1XRVA 4JKKA 2R1NA 4X9SA 1PYMA 3WFAA 1RJRA 5BU6A 1JQXA 4ACZB 2VQTA 2Y70A 4RE2A 1YYAA 1ZGDA 5F2LA 1OX5A 4OIFA 1Q7MA 3WEOA 1H5VA 4HMNA 3EB2A 4KWVA 1UG6A 1K4GA 2OT0A 4DO5A 2H8ZA 3UG8A 3NXLA 3SGZA 1AL7A 3GVRA 3PM6A 3UYIA 4GLEA 2WB5A 3MVTA 4JGDA 1PKMA 2ZXAA 3BO9A 3AYRA 1FDZA 2GVYA 4TIMA 2ESCA 2NQ5A 1RH9A 5CLWA 3QSTA 1TJ0A 3H24A 4NQ1A 3W7DA 1JD7A 3QLDA 1ESWA 2VTFA 3H55A 5A2CA 1JRBA 1ITCA 5C9WA 3QKZA 3ZT5A 1XYAA 3VMOA 3EX6A 5B80A 3QH2A 1US2A 2ZZ1A 3AC0A 4H9MA 1JL8A 2OJPA 1I0BA 3TR9A 3WDIA 1S5WA 1XG4A 4RV3A 1SW0A 1ZBCA 1AFSA 4J3VA 5AHEA 2IKJA 1C8VA 1VYRA 1FX6A 2A3HA 2EKCA 4AZIA 5IRPA 4XTDA 4TTUA 4ZFMA 5E9XA 2DJLA 1RCXB 2EEXA 3FLUA 1FWHC 4FK9A 3UG5A 4ATLA 5D4YA 5LA2A 3T55A 2CYGA 4M1BA 1C8XA 4POCA 1DV7A 1GVQA 1C92A 2B4GA 1XIFA 1G4PA 4ZMGA 1ONRA 5C8BB 1Y65A 3NOEA 3ZXWA 2QJIA 3QYSA 4Y90A 3B4UA 4LVDA 3TC3A 1BXBA 5C7HA 3HMJG 1W5PA 2WVVB 4DPPA 2OWCA 4DI8A 3M41A 1OFBA 1ODUA 5FF3A 4H2CA 2QLYA 5FAJA 1QBBA 1KRAC 4B5TA 1CYGA 2EG6A 1TSIA 1JCMP 1NWUA 4Q8WA 3VMNA 4AXNA 1K6AA 2J7DA 2CLHA 4ZSUA 1OFPA 1KFBA 3KL3A 3G0XA 1QHOA 1YTKA 4DBEA 1XH0A 5A8OA 3QR0A 3CAKA 3SUSA 4BEUA 3L4YA 4F0KA 2PDWA 5I0DA 3CIWA 3HGJA 2QW5A 1L6WA 2VQUA 4HU4A 4HP5A 5K9DA 4GABA 5K7JA 4L56A 1WOBA 1GPWA 1QRQA 1YE6A 3O6DA 4MJ4A 3STGA 3UPMA 1ITXA 4C6IA 4NAFB 4NKCA 4CQDA 2ZTKA 4Q8UA 2J9XA 4ZTYA 1PAMA 1XCFA 1V0KA 1H2JA 2IPWA 3GFYA 4UFIA 1OYCA 3VUSA 3DXIA 4QJ1A 4I5RA 2X2YA 1NAL1 1ME9A 4L9YA 4AHOA 3F1QA 4H9VA 3CL7A 3URNA 3KM8A 4HMCA 2J13A 4I3GA 1PKLA 4DZIA 3LZ3A 4Q7IA 4EX4A 4ZOCA 2B7PA 4AZBA 3CB3A 5HR6A 4GXPA 3A13A 3AWNA 3DFQA 2I9EA 3MT1A 1B54A 4RLIA 3UXKA 3G22A 1IEIA 2R1MA 4FAMA 5HK4A 5REQA 1RP9A 2F38A 2E6YA 3DIPA 5C0QA 4PMXA 3TYDA 1W3LA 3SB0A 2Z1VA 2Z25A 3WH9A 2QDGA 3PSWA 1JF5A 4KS0A 3MJMA 5K4ZA 3WQVA 3M0LA 4L65A 2G3JA 5AC8A 2VFEA 4DJED 3GYCA 1W1VA 4MIMA 1O95A 5EFFA 1QI5A 1R2SA 1G67A 4B15A 2PRLA 4GD0A 4PYSA 3W85A 3IIOA 1K8ZA 1R9ZA 3VCRA 5A6SA 4GJIA 2OQHA 3VAVA 1HO4A 1GVOA 3DFOA 1OZQA 1UB3A 1Y5VA 4L7ZA 3FNDA 3W74A 2V5KA 4ZOAA 3VFLA 4YYFA 4Z0JA 1V08A 2I16A 3RNDA 1H7RA 3P62A 3MW7A 2YFOA 2B7NA 3S46A 4FP1A 4IGHA 2WMGA 3R58A 3MYOA 1XDLA 3VZYA 4LF1A 2NQJA 4R34A 4NP7A 3NWRA 4DZAA 2ZX5A 1EKOA 4O28A 2J7HA 4Q8PA 3E0WA 4ZO9A 1LRQA 4JTSA 2ZUSA 1LBMA 4NZ1A 4H3DA 1G01A 3C2RA 3O0FA 3WLJA 3WJWA 2ACQA 1ICQA 1EQCA 4L1WA 2P88A 2UY5A 2QCEA 5AHLA 4Q8TA 3V75A 2I5GA 1KLZA 4QEHA 1UR0A 3W25A 3KP0A 4O19A 2GK1A 3R2GA 2DUXA 3C0QA 3U57A 1HJWA 2X7VA 1J4EA 3DGRA 4YS1A 3W2LA 5F4SA 3N34A 4AIBA 1KTBA 1ISVA 2EAWA 4YVXA 1I2PA 1KFKA 2GVEA 2VEGA 4H41A 4GVGA 4L6DA 1J0IA 3LLXA 5JBEA 5LKYA 3KOYA 4WLCA 4RV8A 3P2VA 1UR3M 3K4WA 6REQB 3UNTA 4LBUA 4N9DA 5LNSA 4F0HA 4ERAA 3D46A 4MF4A 1J01A 2GSJA 4JYFA 3WBWA 3LMYA 3HPZA 3DC8A 1EHAA 4KRZA 1WKFA 1XIDA 2BHUA 3BGGA 2VRQA 3NQFA 1YXCA 5D32A 1DOSA 2OWXA 5FESA 3KVJA 4AZGA 5DXXA 3PNUA 4GIYA 4PCPA 1SPQA 2RDXA 1NQ6A 4NX0A 5B7ZA 3M0HA 2Q01A 3W76A 1W32A 3M6DA 4CVWA 1UQYA 4C7FA 2GWGA 1TKKA 3TW9A 1IZKA 4S2BA 1W56A 3C0JA 2RDUA 2QS8A 3VNDA 3BCFA 4AVOA 2YCJA 1TV4A 8TIMA 5J04A 3NZRA 1ZQ5A 3WD3A 3TH6A 2CZEA 1X39A 4B5VA 1V77A 2V3FA 3QJAA 1OZMA 2ZZ7A 3U7VA 4NJHA 3OGVA 3QFEA 2EPMX 1YXDA 1QPRA 4UNIA 3LHVA 3WLMA 2F61A 3ES8A 1QK0A 1Q7QA 1TR1A 1K4HA 3KS6A 3PS7A 5CPSA 3NEHA 4PUKA 1MRAA 3LBCA 3QV8A 3AZTA 3MSGA 1VPQA 1HO1A 4HA0A 5CPOA 1RLDA 2L5HA 2NT0A 2XHYA 3PVFA 1J0ZA 5TBOA 1JZ6A 1KO0A 4RDVA 4GFIA 3FCPA 1R3YA 1WV2A 1Q6OA 2VC9A 1DE5A 1XFCA 1PVNA 3QF0A 4B2DD 2FZ8A 3JUGA 3S4TA 2BV9A 1NJJA 3YPIA 3SM0A 1H50A 2H3BA 3WQDA 1K9DA 4JQ2A 4O4WA 1MUCA 2E6FA 3KOFA 5BROA 2EJAA 1JPKA 4UMBA 3TN3A 1D3GA 3MUAA 4U3CA 3TYEA 3UR8A 4I8YA 4J4KA 4GOAA 1QPOA 2V68A 4GACA 2X0HA 5GNYA 5EA9A 4MDPA 3GU2A 4GYFA 2PODA 5C5YA 1HX0A 3GNRA 3U48A 2GZXA 4ICCX 1ADOA 3DHUA 4J28A 5I03A 3FXGA 4CQAA 3EMCA 1S1RA 1EJXC 5FEWA 1VHCA 2NVCA 2CERA 3GBDA 3W1NA 5FSDC 3DOPA 1A5NC 5AZ1A 3BAXA 1OFDA 4LUJA 4CCCA 3CV6A 3W70A 2VYOA 4ZEPA 4MPQA 3LZ5A 2Y24A 3VU2A 3EKLA 3LOTA 1HZYA 1A3WA 3MKKA 5C9ZA 2QCNA 4TQTA 1O94A 3UP8A 4IIFA 3U2EA 3EPMA 1LUCA 1KGWA 5CC6A 2AAAA 3Q45A 4ILSA 4UTWC 1SZNA 5HWJA 4PRTA 1JG9A 3A6OA 2H6RA 3TN4A 3MQTA 1VZWA 4Q4OA 3R6IA 5EL1A 1CI1A 4QJ5B 4EOUA 5HULA 4PEKA 3MY9A 4XKYB 4JL2A 4F8XA 3F2DA 3TSMA 4ZQPA 1RXOB 2RDTA 1JYNA 3C2YA 4KEMA 1QHPA 2GDQA 4IG2A 1KWGA 4OV9A 2FGLA 2OYLA 4Z2LA 1T8XA 1JCLA 3HMCA 4JFSA 4D8ZA 4W88A 1KR0A 2WVSA 1LG2A 5D9MA 3S8HA 4IF2A 2WCSA 3KBVA 3QV6A 1FH9A 1CEOA 3EKGA 1KFCA 4E8CA 2BY2A 1B90A 3HZ3A 1UWIA 2NW0A 5CJNA 2XSXA 4W7UA 3W1PA 3P5ZA 1J12A 3T42A 3R8GA 4XSLA 1I9CB 3FS2A 1MDRA 4O54A 1OG6A 2A4AA 2HV5A 5DMNA 3UYCA 4Z08A 3BQ6A 1PE1A 1XJBA 1X8CA 3G18A 3L5MA 4NAFA 1UMYA 3H2EA 1YPXA 1ZY9A 2WMHA 2NUXA 3R43A 2V3DA 4XUYA 4DJEA 3ZT7A 1C7SA 4F2BA 3PWIA 3M43A 4I7VA 1J2BA 1U2YA 3FY1A 3WL1A 4IXHA 1EXBA 1RP8A 4GIEA 4B3KA 1QI2A 4TV6A 1GNXA 3UCQA 2Z2UA 1TTJA 2IQ0A 4I90A 3IVSA 4Q4MA 3UD6A 1AQ0A 2Z1SA 3RMJA 4AFYA 2XIQA 2GJNA 1YBQB 3LCHA 2QCHA 5C70A 3VM5A 4GXMA 2QUUA 2QUMA 3K2GA 3N9RA 1MO0A 3GHSA 3E74A 3SSZA 2J77A 3M0IA 2PWVA 3UW6A 1E4NA 4E8GA 3WDJA 1WYIA 4A3QA 4ROPA 2WBKA 3FOKA 4HYVA 1GOIA 4MZ1A 1BLIA 3DYOA 4WY0F 3O1NA 4QSFA 5HBFA 3LPGA 4AWEA 3HFTA 3UGVA 4C1LA 4MLJA 3LV5A 3MU7A 2QULA 3EA1A 2PDHA 4D8LA 1B1YA 2JKEA 4PFHA 5LA0A 4E2OA 1SR0A 4JX5A 5HMEA 2XVGA 2HVOA 4HZ7A 4M19A 1BEUA 1BSIA 1OT1A 3V0TA 3RN6A 1UZ1A 3GH4A 5I3KA 3SJNA 1EX5A 3H53A 3FEMA 1D3CA 1Q6FA 3GZAA 4Z2HA 2NQZA 2GJLA 2Z7GA 4PSPA 1U5JA 4I6KA 2HJPA 5T26A 2ZYFA 5GJPA 1U5VA 2ZXQA 3K8KA 2GGEA 4CNPA 3MCNA 1E72M 3B8SA 4HPHA 4AWTA 1REQA 2XM1A 2HZGA 4OFCA 4XZNX 2J24A 3WZ0E 2ACSA 3M6YA 4CD8A 5E6YA 2ODOA 1Y5WA 3EX2A 2P8BA 3B0XA 3XISA 2ZKMX 2Q8ZA 2NX9A 2BLEA 4HYWA 2WKJA 2GQ8A 5CC3A 1UROA 2VUNA 2X05A 3SY8A 1BVWA 2Q8LA 3IJIA 4L80A 1P48A 1VFHA 2EHHA 3DN5A 4A4AA 1TIWA 5IBXA 1J0YA 2D0FA 4RPPA 5LHFA 2E9LA 1K7EA 2VX5A 4Q4PA 1E0XA 5DT7A 1GZGA 1JCXA 4NI8A 3QN3A 2QT3A 2O9PA 3BGAA 4UTWA 1XR2A 1OCQA 1ISYA 3W6MA 1HJVA 3LGGA 4AY1A 3W83A 3E1F1 2EF9A 1SZGA 2VKZG 2W62A 4OGZA 1I1XA 3DENA 3EDKA 4W8AA 4WJXA 3FW6A 5DY2A 1JZ3A 2I7GA 2GVGA 1ONEA 3HGRA 2PTXA 1W6TA 4QBXA 3ARWA 4J27A 1KQZA 3GW3A 4MY1A 5HOSA 4Q8OA 3INPA 1E4LA 2EPNA 3MA8A 4LGXA 3QRHA 2WV8A 3SCWA 3NNTA 4Z1BA 2PU1A 3D5HA 2P1FA 3SRFA 1RBOB 1TZ7A 3IGUA 4ORIA 2Y0FA 4R88A 3USZA 1CZ1A 3L0NA 3UVAA 3AOFA 1OF6A 4LEFA 4ZQCA 3L4UA 4IUGA 3TIMA 3ITYA 2OGYA 5JMUA 5HNUA 2Y2WA 2XH7A 1BD0A 3W84A 4P8WA 5FAGA 4LVAA 4K3ZA 3S1GA 6TAAA 2ZUWA 2Y4SA 3O07A 3ZJKA 5FEXA 3VGDA 2PFHA 4GFSA 3E2SA 4ZQOA 3QLLA 4HKPA 4WR3A 4X61A 3KS5A 3W72A 2PPGA 2OFJA 1JYXA 4P5UA 2NT1A 4JKMA 1XLDA 4PMQA 1W9DM 3GIYA 1XLHA 4UFMA 4WDWA 3AIEA 1E40A 1SFLA 4JNMA 4QITA 4GWEA 3TU9A 3VPLA 5K9XA 3DFPA 4WY0A 1W9VA 2ZUUA 3JU2A 4S3BA 3BARA 1ZB5A 3CS2A 1QI4A 4C6PA 2XJ7A 4I8DA 5JH2A 2O0TA 3TMLA 4F79A 4UTLA 4IXXA 4GH1A 1NFGA 3COTA 3ARTA 3QW4B 4IMFA 3V4BA 4PBFA 4IHCA 1O5KA 1WKYA 4WKHA 3BWWA 4W5ZA 1XUZA 1RBAA 2ZA2A 3PPHA 3CAVA 4XAGA 2G3MA 3NVTA 3ALFA 3GXPA 1W0MA 3G77A 2DSVA 1DWFM 3VGGA 1RD5A 1RBLA 2ASHA 3BMXA 1XBVA 4US5D 3SCNA 3DGBA 4CNUA 1EEPA 4BI6A 3BV4A 4S3AA 3KBNA 2XYLA 4E4PA 4Q7BA 4PTWA 5DT5A 1Q4WA 4M80A 4DWSB 4GQ0A 1U83A 4DO6A 1JPHA 4OECA 3VILA 1DWHM 4DXXA 4IH3A 3PWGA 4UR9A 2INFA 5CZKA 1W3TA 4AD4A 5FJOA 3LQGA 2Y89A 2CU0A 4QFUA 3ZR4A 1PZ1A 4J2PA 4KFNA 5TAOA 3MP4A 2QCFA 2RH9A 2AQOA 3K1GA 4LCRA 5IFTA 5XIMA 5FJRA 5JVLA 2YIHA 4G1NA 4N6FA 5F2MA 1BYCA 5AOUA 1KRCC 5BXPA 1SJCA 2BVTA 1SVDA 3DERA 1EPVA 2WZIA 4HMDA 4H6RA 4GY1A 4M5PA 3VOFA 4YYCA 4H00A 2QAFA 2CLMA 3BLKA 1OFEA 2ZWZA 2E40A 3AMGA 4JEQA 1E1EA 1RZMA 3W2MA 2WM1A 1EA9C 2CLPA 3PZUA 2VUYA 1GVEA 3HGOA 3ABOA 3BSHA 5KETA 3W7KA 3NR0A 2C79A 1VRXA 2RAGA 4HJWA 3BLLA 1O1HA 2HBVA 4MUZA 3M1ZA 3AHXA 1TRDA 1AMKA 1RA5A 2AGKA 2O7QA 4M1RA 1DWAM 3TQKA 5JH1A 1WXJA 4R5EA 1C8QA 2W4XA 4HN4A 1DJHA 3H4WA 3DAQA 3ZSTA 2PRMA 1EHNA 3M0KA 4A6GA 2V3GA 3D47A 4BZYA 3SBFA 3R89A 4C6KA 2E1WA 3EKZA 4OZOA 3HM7A 1JZ2A 2W0UA 4QR6A 1ME7A 4GO8A 3GY1A 1KKRA 5BW6A 2V82A 3TSDA 1HN1A 4IGSA 4L5ZA 4NX5A 4WK9A 3FA4A 1W3HA 3NOYA 2CITA 2ZRZA 4LF2A 2FTWA 1LT7A 3AISA 1VJZA 1GZJA 2Q6ZA 3TR2A 3V36A 2XGIA 5MF5A 2C16A 3WN6A 3QC0A 4GG9A 5A95A 3SEPA 1H09A 4ONVA 1SJAA 3LBMA 3MO7A 1EP1A 3M5YA 1MXDA 4HNOA 1AMYA 5A2AA 1AL8A 1Q6EA 4GGHA 1G7VA 1PTGA 4ATWA 2OSXA 4PCSA 4EXBA 1QPNA 4OJYA 3F5KA 4QDWA 2ZRUA 2Q3RA 3IACA 2PF8A 4V1YA 3W75A 3G0SA 4H83A 4ZTXA 2ALRA 3FDGA 2GVLA 2DT2A 2HNHA 3W6YA 1C93A 1LDCA 2CWXA 5LNRA 5DX7A 5BOOA 5EMMA 3I68A 1EJUC 4HHLA 2BS9A 3W27A 5C6MA 4DWDA 3H2MA 1XW8A 2QQ6A 2G4FA 1TWDA 4J3UA 3VZXA 2YCIX 1E1CB 3AYTA 3HPFA 3SUVA 4F2TA 3MV11 4LW7A 3TE9A 3S5YA 5JBDA 4O0QA 4DNMA 3W7LA 1EBGA 3CZJA 3BW4A 5BRPA 1VJIA 1M7PA 3RPDA 4AEFA 1C91A 1X6UA 1JF6A 1XLAA 2BZNA 1TIMA 1T40A 1ISXA 4CNTA 2MNRA 4PODA 1CECA 3BMWA 4RZBA 3NL2A 1GQKA 1QAPA 1YLVA 2WSPA 2G41A 2VC7A 3E0VA 3W1RA 4LYQA 3EX1A 4HA4A 1ZJBA 3PPFA 1E70M 4IM4A 3CZ8A 1O1ZA 3LS9A 4FX7A 3IJDA 3WUBA 1YPFA 3LENA 1LORA 2P8CA 2RJGA 4E0CA 3CUIA 2O7SA 4KIEA 1XYBA 2PE4A 3I4KA 1F07A 3ZLHA 1BVZA 4GY0A 1R3QA 3UWZA 3NDYA 4Z2IA 5EMLA 3NVDA 2YCLA 4TXEA 4G7EB 1HUVA 4MTVA 2QPSA 2W5FA 4DF1A 2Z26A 1UC4A 1ZNNA 2Y8UA 1D2KA 1S5MA 2GOKA 3GR7A 4JBRA 1ONWA 3LPFA 2ANUA 3FAWA 3RLGA 3KHJA 5DFAA 5AFDA 1NOFA 5KSWA 1FKXA 3LMZA 3LCGA 4MYAA 4W84A 3S2MA 1VBRA 2OCZA 1VRDA 2XUCA 4MWAA 4U5KA 5JU6A 1JULA 4LS0A 4DUOA 1QW7A 5PTDA 3RLUA 4A8LA 3C2FA 3S5OA 4EP8C 1KV8A 3LUTA 3VGHA 4DBDA 1TTPA 4YTTA 4XG1A 1SR9A 2QJGA 2FTYA 3VCNA 2YW3A 4PRRA 4IIBA 1LLZA 2ZVIA 2HRWA 1G6CA 3ZQ9A 3PUEA 4E3VA 5M17A 4K6AA 1AQHA 2FB3A 1VFOA 3M16A 4JIRA 5GNXA 1DTNA 1HJXA 1ZPTA 4WY0B 1CXFA 4Z2GA 1H1ZA 2TODA 2PSNA 3OBAA 4A3UA 4PCFA 4L6OA 1TCMA 4Q22A 3RF9A 2QXWA 2BSLA 3O6CA 1BGAA 1P0EA 4XIMA 3S5SA 4A3RA 1B3VA 1TX2A 1I60A 5C54A 4ERIA 4G7EA 2I14A 5FJJA 5KINA 4XBKA 2RJHA 3K8LA 4CD7A 5C2XA 1NSJA 3KXQA 3NQ7A 2BGQA 2Q02A 1WXZA 2GUBA 2VFDA 4C6OA 4IOTA 4BQ5A 4JNYA 1Y8BA 3CQ0A 4JQ1A 3CH0A 1PHWA 2E9MA 1JAKA 3UZJA 4GRSA 2ZVRA 4CUCA 1QNQA 3KUMA 1GEHA 4X0VA 4J3WA 4MB5A 2QPUA 1LLOA 5D02A 3H12A 3ZLFA 3KDNA 1XKJA 4UOZA 3S2LA 4DM1A 3BPWA 3QGAC 1ZALA 1FXPA 3PN8A 2XH0A 3QVQA 1E1FA 2PP3A 1VIWA 4O18A 3HJZA 3I6EA 1FWGC 1UR1A 3RIKA 1EA0A 2F6XA 2FZMA 3P82A 2YLLA 2NUWA 3NCOA 2RDWA 5AN7A 4PSRA 1E9YB 1P4CA 4REQB 3VKDA 2YA2A 2JEPA 4W8BA 1GVRA 3U4AA 3O9NA 4OOZA 3CQKA 5AHMA 5D2YA 4KT2A 1ONXA 2Q3OA 4E8DA 4YCOA 3P8JA 2VFGA 5DELA 3IIPA 1CTNA 3F4WA 3L4TA 4N9BA 2YYUA 3K8MA 2WW5A 1ICSA 1WUEA 1ZRQA 1A5UA 2ISSA 3IAPA 2FHFA 3M64A 3VNMA 1MUWA 1EWDA 3GNXA 3W1LA 1TPFA 3SJ3A 2POTA 4DZ5A 3G1XA 3GH5A 4C1NB 3GNNA 4JY9A 3U3HA 3WNMA 4LPCA 3OZMA 2FKPA 1EEXA 2E8ZA 3KWXA 3GDKA 3WCZA 2GDUA 3QQ1A 4HK6A 3B9AA 2PDUA 1IT8A 1V79A 4PFMA 3PTKA 1UP0A 4HU3A 5HMDA 1IEQA 2GQAA 1PWLA 2ZRVA 3LD5A 3R11A 3WD1A 1AH4A 7A3HA 2X16A 2AOSA 3R8HA 4LNCA 2PRHA 2PBOA 2XZ9A 4ATDA 4BKNA 4JR5A 3V18A 3J7HA 3VK5A 1JR1A 1K02A 3KTXA 3PHAA 3RM4A 4C6FA 4K8EA 5G4HC 4NASA 4AC1X 3VIFA 4UOQA 4I7WA 1JVNA 1TV5A 5MKGA 4D1JA 2CPUA 4GZJA 4CVUA 2P3EA 4AWUA 1XC6A 2E67A 3A47A 1TPDA 3CUZA 4S39A 2C18A 1JGIA 1L9WA 5HMFA 6ENLA 4KEZA 4FNTA 4XIAA 4AAJA 3UPWA 2ZX9A 4AIEA 4JOMA 4MOZA 3MSRA 1OEPA 1FCUA 1DWIM 2FLIA 1XLJA 4H1ZA 4IICA 2Z1KA 1H7XA 2VD9A 1V3MA 1IWBA 3GG7A 3SURA 8RUCA 3R13A 3GR8A 1L6YA 4IIGA 1KWKA 2YCEA 6XIMA 4GUHA 1R3TA 3BCDA 5G2IA 5DCDA 3EDFA 1Q5MA 1GGOA 1LJYA 2XGZA 5AYXA 1VCVA 3OG3A 4J1OA 3OHIA 3U8GA 3UCCA 1VYPX 1KKOA 1MEIA 2NWSA 3GSMA 3DH7A 3NPXA 5F4XA 4O16A 1FQ0A 1Z48A 2CKSA 3SCVA 4QAWA 4Q4KA 4LB3A 1UH4A 2VI0A 3IGXA 2WJEA 1GHSA 1XFBA 2PDKA 4Q4SA 2DSZA 4X63A 2RHGA 1R87A 2X1IA 3WJZA 2WHJA 3HFYA 3GG0A 1IGSA 4IQDA 3EYPA 3BAWA 4A2SA 3QHOA 2CCRA 1W3KA 3CZGA 4O1DA 2D69A 2J25A 3TCSA 1QUMA 2DZTA 3RILA 1R46A 3SFWA 2A3AA 3V35A 3ITVA 1QWKA 1LUCB 4BS0A 4C6LA 2D2HA 5CPQA 2FIQA 2ZXBA 2Y5JA 3STCA 2DT1A 1PSCA 3ZSSA 4E5TA 3FFSA 2A5HA 1UP2A 4JYDA 3WQOA 2QMKA 1JDDA 2VMFA 5B7YA 4Z1DA 1ODZA 4N4QA 3NQ2A 3A4JA 1AQMA 3L23A 3NAVA 3WNPA 4JTCA 4I9MA 3L12A 5BWAA 1XM3A 1FWEC 1UYQA 4MLRA 1V3KA 3C2EA 3U6WA 3BTNA 3EDDA 4DM2A 3SN4A 3UF9A 3RM9A 1TPH1 4IL2A 4S23A 3BDKA 2PWGA 1LBFA 2WNZA 2GJPA 2W27A 3VKCA 3TJLA 1XH1A 3AXMA 3OZOA 2XFWA 3WFZA 1GTHA 1YDNA 1VC4A 4XKYA 1VFMA 1A0CA 1S3TC 1A4MA 4XKMA 3K4AA 5F1UA 3WBEA 1S2AA 3UERA 2NV9A 2VDIA 1V8EA 3EX4A 3S6TA 3WLTA 2NUYA 1PWMA 3NSNA 2HE8A 3C8NA 4MWAB 1GVFA 1F3TA 3T8QA 1BAGA 3T0AA 4KEVA 3AXKA 3W7OA 1WDQA 1K8YA 4Y8FA 3EWZA 3KTCA 1Z42A 4DIAA 4GNKB 3LRLA 3O06A 5G1YA 4A21A 3PPGA 4D6CA 3H2OA 4E38A 1SO4A 1X7IA 4QXIA 4M24A 4J9JA 1GW9A 5G4EA 1H49A 1E3ZA 2POZA 1XYFA 3PZIA 1BFNA 4NHVA 1MW2A 4C5ZA 5TIMA 3SRKA 3PK7A 4C7GA 2ZE3A 4H8HA 5HJXA 3S5ZA 2CWNA 3R0UA 3OA5A 3TN5A 4X22A 4S3EA 3WELA 3MUZ1 4ES4A 3N12A 1LL4A 4L61A 3WQGA 3W53A 3MP3A 3SIZA 4JTJA 4HN8A 1XIGA 4QROA 3BURA 4LV9A 4OBTA 4L4OA 2WMIA 4F0SA 1W1PA 1ZU8A 2OZ3A 2XIJA 2V0TA 2WANA 2X8RA 3CPGA 5E0KA 3BL3A 4RE3A 2J7EA 3C56A 1DIKA 3TTQA 2GWNA 4BQ4A 5EGRA 4JTDA 1N7KA 2W91A 5EY5A 2CZFA 4CKQA 1CT5A 1JDAA 1DHKA 2YZ5A 1XKYA 1ITUA 4ZO8A 4QJ4B 3R4IA 1ZCCA 1EB3A 3SW6A 2VGGA 4HPGA 3E0IA 1RUSA 2BODX 1Q2SA 4S3DA 3CZLA 3E2VA 1GPFA 2R14A 5GJMA 4W85A 2G4JA 2YOCA 3WLKX 4NZFA 1CB2A 4JTAA 1D3HA 3QR3A 2VC6A 5CBBA 5C9UA 3CB8A 3BW2A 2ICSA 3VX1A 3W7NA 4S3JA 3NJ3A 4RE0A 2KX9A 4CU7A 1VFSA 4BR1A 2YA0A 2NQLA 5CG0A 5HATA 1H61A 1PO9A 1WDRA 3ITXA 1SO6A 4NSBA 4QG8A 4O15A 3IEBA 2BOGX 2NQ9A 3MO4A 1Q2RA 5IOBA 1PZ2A 1US3A 3NL5A 1JRCA 3NM3A 4IPLA 1UD3A 3CQHA 1YBQA 5TQLA 3IVTA 3CHCA 3QMRA 3R12A 2C7FA 2XTKA 4G1KA 1J79A 4NXSA 4M81A 2HVNA 1TVNA 3LM7A 4IT1A 1RPXA 3N2CA 1GUVA 1H7NA 2J9ZA 1FBAA 2VENA 3LRMA 4DYJA 4B4FA 2BG5A 3UJRA 3MB9A 3U0HA 3QMSA 1HP5A 1FFQA 5C9RA 1P6WA 3MMDA 1XGEA 1XSJA 3KEHA 2IS7A 2WSQA 3WDHA 4LS1A 3VO0A 3L4XA 1WXYA 3AIVA 2F2HA 2O56A 3N9SA 3VCCA 1KCKA 4GXWA 5T9BG 4L4LA 1VKFA 3W82A 4JD4A 1WDDA 1JCTA 3MSYA 2PDQA 3PR2A 1RK6A 4EPKA 1ZENA 1TB3A 4LBRA 2OPJA 3ARYA 3RMEA 4OVXA 3O16A 3VI2A 4WSKA 3TROA 4RPQA 4FEZA 2ZX6A 1FRBA 2OT1A 3WLRA 4M7SA 1N55A 4J5NA 2Y62A 2WNQA 2EO7A 1NQKA 4PULA 2HBXA 4LAOA 4HU8A 3ITCA 3GXNA 3B9DA 1IIHA 1H0GA 2CHOA 5HUOA 3PZVA 2QV4A 1XLMA 1R9XA 3LPPA 1TWSA 4D1IA 3EOSA 1AZ2A 1R2RA 3RLVA 1BHGA 1A3HA 2H9AA 4DPQA 1DE6A 2GQ9A 4YL2A 5C71A 1POJA 4R9XA 4S3CA 5I78A 3CHDA 1V3JA 3C0LA 2GL5A 2EG7A 1NM9A 3FYPA 5I23A 4US6A 1NWTA 2AKMA 4AQLA 5DO8A 8XIAA 4IZGA 3IWPA 2YR1A 1ZHAA 5A8NA 4FOJA 4LUYA 1LWIA 4U3AA 4PUEA 3ZS4A 1W1IE 5IHRA 5CSSA 3W1MA 2CLEA 4Y9PA 1F6PA 3CT2A 3GXDA 3DG7A 3V7PA 3LYEA 2ACUA 3IUIA 3PP7A 3OYXA 1H3GA 3WQ4A 3DC0A 2QHAA 3VIJA 2OG9A 2AL2A 1Q6RA 3P3BA 3T7VA 5XIAA 4AVFA 4BHYA 3EXSA 3UZ5A 1UCWA 1F73A 4AD0A 1Z89A 1SM9A 2PLJA 1XIEA 3VE7A 1P6CA 1OB0A 1POKA 3UT0A 2EXOA 3H2FA 4PMYA 4M51A 1KW1A 2PDPA 4PTXA 1PS9A 1BGGA 5KEZA 2W3ZA 2OTDA 3GD6A 3S83A 3PBVA 3T0DA 4U33A 5CQ1A 2XFFA 2JIEA 5AECA 2VEFA 3O8AA 2PWDA 5BCAA 3GU1A 2V8ZA 4D72A 2IKGA 4AZ6A 1DQWA 4HOWA 3ISIX 5FJIA 4NZ5A 4WQ6A 4DUXA 1A3XA 2I9UA 4LTSA 3OG2A 2WXDM 1DTUA 3N2XA 3KL5A 1LYXA 2WKLA 2DP3A 2DORA 5FIPA 1NWRA 4TMCA 3LV6A 3BLEA 3FIGA 1US0A 1WBJA 3AIRA 4JTFA 4QG6A 1OX4A 2VEMA 1PHQA 4CQ9A 5CZTA 4HCDA 4UCFA 4XTIA 1XG3A 4HZ6A 4UMAA 4EPEC 3T4WA 3SDOA 1HJUA 7REQA 2CETA 2J88A 3EWYA 4Q32A 4DYEA 3ID7A 2VRKA 1XGZA 1R8LA 1FXQA 1IGWA 3MHUA 4AZCA 4K8HA 4IISA 4V28A 5IDZA 5AYYA 1Q4NX 2OR2A 3TJ4A 4XO7A 5HANA 1B57A 4WXYA 1F2JA 3GX9A 2XIBA 3VIGA 4DJDA 1J8VA 3W2NA 1KQYA 3W1XA 1MWOA 1OIFA 4JS3A 1Z69A 3OIHA 2VX7A 3UEQA 3VE9A 3H70A 2ZQ0A 5AC4A 1IEWA 5LGXA 2D23A 1NELA 3BW3A 4AX6A 2YL6A 5J5DA 1YX1A 1QBAA 2V81A 1WZLA 1TUXA 1UUOA 1MFUA 2ZRXA 1UHVA 1L8PA 4AD5A 1ALDA 3FA5A 1BWKA 4JN8A 2WC7A 3CAWA 4GH3A 1RY8A 2XVKA 1QWGA 3LI1A 4JX6A 3AZRA 2WJDA 1BG4A 3DFNA 5ABEA 2Z2BA 4HA1A 4L9ZA 3CLMA 1WQ5A 5A1AA 1M3UA 2GGIA 2A3EA 1DWGM 4Q4QA 2PS2A 2OZTA 5BYWA 5E9AA 4Q3MA 3B04A 1F3XA 3PJTA 4AG0A 4TX9A 4JPGA 4KMQA 1GTEA 4ZOBA 3C4UA 1M01A 1O66A 1S2WA 5G1TA 1JDCA 4JTGA 4XVEA 2Y5SA 1X1ZA 4LC8A 5I24A 2EPKX 3PJWA 4H9YA 3V5OA 2YX0A 4Y9MA 4QIUA 2DIJA 3ORWA 2INZA 3TLQA 1FWCC 1M7OA 1WE5A 4V15A 3QBUA 4Y2WA 2VZVA 5FF4A 3SCSA 1ZFJA 4S3KA 1UPMB 1TWWA 2DVXA 2QKFA 3EOEA 1A49A 4LWWA 5H91A 4RDYA 4UR7A 1BWVA 1NEYA 3W7PA 3IV3A 2WPGA 1ZL1A 3I3EA 1WBHA 5BOEA 4PMJA 4W5UA 1LQAA 2RGMA 3ENLA 3DU0A 3GU9A 1BKSA 2OZ0A 3CEPA 3IIZA 2X42A 4ZB0A 1H11A 4RXGA 3NG3A 4LUTB 3D3FA 3EA2A 3GHRA 2AQWA 3AHTA 3KAOA 1CGVA 4D71A 4XAZA 3LQLA 2C1GA 4IIHA 1V3HA 1XP3A 1FH8A 2XN1A 5CZSA 3CBWA 1C3FA 1FCBA 1A5SA 3JVAA 1IXPA 2TPSA 1R2TA 5I2UA 3O2LA 3O3RA 1KM0A 1UW9A 3UZZA 4MJMA 4B5UA 1OJXA 1IXNA 2GUYA 1KXQA 4IPJA 4GBUA 4B5WA 3QY6A 3F2CA 3UWUA 4PUUA 1EGMA 5AC7A 4JDBA 1VPXA 4JTHA 1L2UA 1D8CA 4CNSA 4FNQA 2O55A 3VX0A 2DT3A 4JTRA 1B3OA 1I2NA 2C1IA 4JAWA 3QV9A 3UCDA 3H6OA 1V6YA 2VO5A 2GDVA 3HBLA 3WKZA 4V33A 5E0CA 4MZYA 1ME8A 3D3AA 5CCZA 1QOQA 3EGJA 3MKVA 3WBAA 4OKDA 3BG5A 4PCTA 1W2PA 4MJZA 4PA8A 4WF7A 3ANVA 2ZDRA 1V3IA 4AF0B 4JIEA 1EUNA 3KFTA 3IUHA 2QCGA 3G1DA 3GKFA 1IEXA 4MWAC 3B0UX 3IUDA 1A0DA 4XISA 3AS2A 1UZDA 3MUCA 1AODA 2C13A 1EJSC 1TPEA 3W9ZA 3UZWA 1DL3A 3WG6A 2OYKA 3BOFA 1UUMA 3H7RA 3RU6A 1N2VA 3CC1A 4H19A 3CV2A 4O1BA 1Z9AA 3M0MA 1LOSA 2ZA3A 4AF0A 3A23A 3AXIA 2OEJA 1HP4A 4PUDA 3G24A 1L6SA 5LNUA 5H6HA 2QIWA 4NJKA 2CLKA 2A2IA 1B3YA 3DDMA 2D3NA 1AH0A 1IF2A 1P1XA 2HXTA 1E0WA 1HKKA 1DKWA 4UQ9A 1W3NA 4UTIA 2V38A 2Y61A 2O4MA 3EMQA 1QI3A 4K2SA 3WUFA 1G4SA 1V0NA 1PDZA 3NZGA 1OCNA 4ZR8A 4U2YA 3EWDA 1WA3A 1MRQA 4QQ3A 2VC5A 4UTJA 1GW1A 1OBAA 3CZKA 3WENA 1ECEA 3E5BA 4OBSA 3C8FA 1XV8A 4I7UA 3OLEA 4FXFA 1EC9A 5D30A 4DEFA 3SO7A 3PJUA 3HA1A 2YGYA 2X30A 3NIYA 3GH7A 2DH2A 5I00A 4IQEA 1QDSA 2O9TA 2WVTA 3E12A 1CDGA 3AXXA 1A5AA 1WAUA 1HL8A 2DDXA 3AS0A 3G6LA 3S9YA 4QNWA 4ICNA 1W91A 4O1CA 5J5RA 3GVGA 1VFUA 1U5HA 1S2TA 4GZEA 4GX9A 5EMYA 4F0RA 4JIQA 4GQBA 1AH3A 4J3XA 3GR4A 4BY3A 3ABQA 1LL7A 2A7NA 1I0DA 1F6YA 4WOQA 2VGFA 1J10A 1U33A 4H9ZA 1AW5A 2ZUMA 2HPIA 3G1SA 2V69A 2IPJA 5XINA 5D9NA 4RX0A 4CNNA 1AA1B 4GI6A 4HT3A 5ECVA 1TA3A 2R24A 1V6XA 2Y7EA 3NGFA 3PZQA 1EO5A 3A3XA 3VM7A 2QJHA 3TYCA 3KBWA 3W2KA 1S38A 4CQBA 3PUGA 4PN2A 3PZTA 3W7IA 1OCJA 4N9CA 4JQ4A 3KRUA 3REQB 4XQ6A 3OBKA 1QATA 1HF6A 3AIQA 4DJFA 3V0SA 2YSWA 4WIWA 2VNCA 4F66A 3E38A 4PMDA 3NDZA 1MEWA 3AMKA 3I7QA 1BQGA 3OGSA 2OLAA 1FWDC 3QR1A 4O52A 2UY2A 2ZOXA 1I4NA 4TVDA 2ZUVA 3B8IA 1PIFA 1UWAA 1YKWA 1WPCA 4K38A 2FQIA 3CYVA 1SJDA 1XIMA 2RGLA 4ZFCA 3CPRA 2VP8A 1GOOA 4GVIA 2WMFA 2FVKA 1M7XA 1VEMA 5FSEC 1X96A 5LIKX 3KDOA 2WCAA 4FB7A 1K03A 4ZO6A 2NLYA 2ZADA 2FDSA 4HHHA 4R85A 1ENUA 3N2TA 1GJUA 4AD3A 4JIIX 4INFA 2PLKA 4LY8A 2X7WA 3QGKC 4C1NA 1VHNA 2YDRA 2BXZA 1E5JA 2FVMA 1JQVA 2G5WA 4LSBA 4KPLA 2VRJA 3USBA 3I7RA 1P0DA 1XYCA 3UFYA 1HT6A 4AIOA 3POCA 4A8IA 3DG6A 1G7UA 4UQDA 4YU1A 3LU2A 1DPMA 2OKOA 4UFLA 2W67A 4L1XA 2YBTA 4WX2A 5I3FA 1FP8A 3S1UA 1CB7B 1EOMA 1V02E 1A5KC 1B3ZA 3W29A 4HTBA 1FHVA 1RHCA 5I3HA 1UMLA 3UXAA 1GYMA 1M1BA 4QLKA 5G2HA 1H41A 3MKCA 1D9EA 1FHDA 3DKJA 2BASA 1Z8AA 3N17A 5T91A 1VFFA 5DF0A 3VMPA 2G96A 3W7EA 5HNRA 1HVQA 4XZHA 3WLLA 1SQ7A 4DWSC 3DX5A 3KRSA 3ANYA 2BGNE 1FWIC 4WD0A 3N2MA 1TTIA 1XCWA 3UR5A 5FEPA 1D7KA 4FIQA 4FXJA 4AISA 2ZZ3A 1HKVA 4P7OA 5AC6A 1KNWA 1OSEA 1VAHA 3UR7A 2B7OA 2Z29A 1QNRA 2G37A 1NDVA 3SFKA 4F3HA 1HW6A 1TV8A 2VURA 2UZ9A 1TMLA 2P76A 2BGSA 4ZE4A 1KBIA 2AQVA 2BFGA 3WNLA 3IGHX 1W5OA 2P0OA 3ARXA 2YCKX 4ZB2A 3T6CA 2G3FA 3CHEA 3NYDA 1S1PA 4N2YA 5K9CA 3DCPA 3M0JA 4XD5A 2ZIDA 2EPOA 2HWGA 2DJXA 3MBFA 4GA8A 5HINA 2V5BA 1EIBA 3F5LA 4CCDA 4QJ3B 3N19B 3CL8A 4LANA 2ON3A 4EKJA 1MDLA 5D09A 4FF5A 4I6VA 1EF2A 4H8NA 1MW0A 3IJQA 2CBJA 3A9IA 3F03K 1XD0A 4YTRA 4B92A 2PCEA 1DBTA 2VEPA 1GORA 3IRDA 2CLOA 1HKWA 5DBUA 2Z6IA 3P7YA 3SECA 3UXDA 1S2CA 4ENLA 1OX4B 1K70A 1CWYA 2CIPA 5ABFA 1TO3A 4QE4A 1BSLA 4LUIA 1TG7A 1YTEA 2ZWYA 4KIRA 1J11A 1VH7A 5D2XA 1M41A 5CPTA 3WDPP 1ZJAA 3I65A 3LI0A 4V27A 1JZ8A 3C3NA 3NQ6A 2X1RA 3AI0A 3I7SA 1FY6A 4MFEA 3CYJA 3G1HA 4PR4A 3NL3A 4EANA 5F2IA 4N9EA 3NPVA 3NQGA 4XWUA 1K9TA 1PIIA 4IX0A 3AU2A 3MI3A 1KB3A 1G9HA 2J6XA 4QSHA 5HPOA 2I1OA 4C6MA 3VC6A 2Y7GA 3AROA 2Q71A 2E68A 3GVVA 2FGBA 3G1AA 3SCUA 2DGAA 4J3SA 2GJXB 4P8UA 1A5BA 1KFJA 4F0LA 4HPJA 3WDQA 1SMDA 2XWEA 3B97A 4ZBCA 3N25A 4V2XA 4Z2KA 4ICMA 1VFLA 3AHVA 4UTTA 1WDPA 2XH4A 1TPUA 4C6DA 4M82A 4W7VA 3OPSA 2PLMA 4FSAA 1N8FA 3WD0A 4JTIA 3MDUA 2CC0A 3MHGA 5U7SA 1GKPA 2A79A 3CUFA 2QZRA 1ZAIA 1XIJA 2VELA 2UV8G 4ZXOA 3QM3A 3GM8A 3RU8X 2ZICA 1QTWA 1UD5A 4IGMA 4E2DA 3T09A 4OOUA 4MUPA 3WQPA 4JZ5A 3MHFA 4TO8A 3H2NA 3HPAA 7ENLA 3B0PA 4GC3A 2PLCA 3STEA 4XX6A 4EWJA 3ZYZA 4YWSA 2F8QA 1X1OA 2YL8A 3VOIA 3N6HA 4GCXA 3VABA 2FB2A 2GJRA 4RNIA 5DMMA 5G1MA 1MI3A 3WYZA 1K1DA 2PWUA 3G0UA 3OU8A 3GBEA 3ARQA 2VOMA 2ZZ6A 2XIMA 1FVPA 3W7MA 1V5XA 5JXQA 4FNSA 3L5LA 1QJWA 1EC7A 1NVMA 5DQPA 1M5WA 4MKSA 3LN3A 2OEMA 2DZWA 4HNNA 1Q66A 3HURA 2DIEA 3MSDA 4HSHA 2OYMA 3FJLA 3L4WA 3TTEA 1AZ1A 1PJ9A 4JKLA 4FLRA 2V3EA 3GVQA 3WQFA 1EJTC 2WZTA 2V5JA 8A3HA 2C3ZA 4M56A 4ASTA 1BTCA 4C6CA 2AKZA 3OJGA 3STPA 4Q8QA 1W37A 3C52A 3TV8A 3M5VA 3GTNA 3IV8A 2OEKA 1KRMA 1TPC1 4G2DA 3CLWA 4FXSA 1XD1A 1MVYA 2YDQA 3VNIA 1VPYA 1YDVA 2REQB 5LIWX 4AUBA 2YA1A 1TJPA 1U1UA 1OFAA 1UBSA 5HPCA 1MEHA 4UR8A 4J7RA 2EJ1A 2F6UA 3AUOA 1UKPA 3BH4A 1E6ZA 4JN6A 1KTNA 1EXPA 1HKJA 2V5LA 4KCTA 2VXNA 3QQ0A 1LOQA 4Y7EA 3FK4A 3WLHA 4UTKA 1JIBA 2YBUA 2R91A 1EYWA 1XLGA 5T8GA 2ZX8A 2QUTA 1F4HA 3NPWA 4O8AA 1SSGA 3HJEA 4LT9A 4H9UA 1SZFA 1UWSA 3HO8A 3C86A 3V1PA 5CH9A 1M7JA 5EMKA 2GQ3A 1KCLA 1S5VA 5FD0A 1OD8A 5FL0A 2OZ8A 4HD5A 2PDBA 1UWUA 3WH6A 4ACYA 3RPTA 1A5LC 1WDWA 2WPBA 4Y9OA 4DELA 3E5PA 3LHZA 1PEZA 2HS8A 4YNGA 3WL0A 4G8TA 1PKYA 2XFRA 1S2VA 4HGXA 5KZMA 3UXLA 4A8RA 5A8MA 1Q3NA 3QZEA 3UJFA 2JFEX 4WDUA 5E5CA 1H0IA 2VGIA 4BCEA 3PFMA 1VQTA 4NF7A 1F9CA 3LB0A 2PU0A 3SQMA 3W38A 1RJPA 3L68A 4WDXA 4D6DA 3NXFA 1WUFA 1Q6CA 1XBYA 5L9FA 3N6QA 4LBSA 5JUVA 5ABGA 3JRKA 3L9CA 4O10A 3R94A 2HPMA 1TWZA 3P60A 4DRSA 5FEZA 4ECLA 4Y9AA 3E0FA 4OT7A 2E28A 1RQBA 2F6KA 1KXHA 4PTNA 2GGHA 1QW9A 1VD6A 2GK1B 2J74A 2V63A 4EAMA 1LWHA 4LYRA 3IIVA 1IE7C 3CMJA 4PTVA 3WSUA 2YL9A 1Q6LA 2ZUNA 2VVSA 3KBMA 3DZ1A 3NQVA 4IP5A 1HL2A 3PBWA 4DUWA 3TQ0A 3RYSA 3G8EA 4PTDA 3KVKA 5A6KA 5DMLA 1C29A 1B4EA 3MPGA 4PBEA 2VOTA 2PDIA 2V67A 4B5XA 4IJRA 4LALA 1W5MA 1IHIA 1TFVA 2C14A 5FA5A 1MXSA 2IQTA 4PBGA 5HWMA 4BEQA 3AUJA 2YXXA 4A29A 4KGLA 4IX2A 5FCZA 1QI0A 1KM4A 2CFFA 1TREA 5FACA 5HNTA 2YXGA 4GC4A 4EPDC 2GVJA 2UWFA 1E55A 4CU8A 4TVCA 1B9ZA 1B5TA 2REQA 1FA2A 1FOBA 4QHRA 1OY0A 5AY7A 3SY1A 1FKWA 4N6EA 2J79A 3D0CA 2YFNA 1FHUA 3WUGA 3AJXA 1XLBA 3AYSA 3OW1A 3UY8A 4H2HA 1XBZA 5SWUA 3LCLA 2VZOA 3N73A 1QMLA 3OVPA 3UA3A 3RX2A 3VDAA 1ITQA 1WZMA 5DY3A 4AHQA 1EL3A 4LEQA 1DORA 2ISDA 2C19A 2ZE0A 1OFOA 1NTHA 4N42A 4GHRA 2XFYA 1FWAC 3RO8A 4R7WA 1BYDA 3IPWA 4O1AA 3R7MA 1E0VA 1E9LA 2XDFA 2E09A 1NARA 1DWJM 4O1FA 3WF4A 4O1EA 3PB2A 3EAUA 2TYSA 2UY3A 2YB4A 3S47A 2QJMA 3QEZA 2W6RA 3UWQA 3GHTA 3CL6A 4TMBA 4L1GA 1DXFA 2Z28A 4HNTA 5DXYA 1VEPA 4NT0A 3DHPA 1VLWA 4LNYA 3OQ8A 1L2QA 4FR1A 2OB3A 1EP3A 2E25A 3TW7A 1QOXA 3A9BA 4J40A 3GAKA 5K4XA 4L4MA 1FH7A 1IZCA 4FLOA 4LVFA 3K1DA 2EQDA 1I75A 4W89A 2YPIA 5G2WA 4J3ZA 1YDYA 1JDFA 3BZGA 4TX8A 3TA6A 2DZUA 1CW2A 2VD8A 4MB4A 1EP2A 7ODCA 1XPYA 1JZ4A 3LA4A 3F4NA 2DZSA 1EJ7L 1TUFA 4JFVA 5M03A 1XRSA 3ANUA 5MKGB 2DV0A 5D8WA 3C2VA 2RUSA 4YCPA 4C6BA 5FJUA 4OE7A 1IXQA 2PP1A 3JZUA 2VCBA 4OWGA 3ARPA 5A6TC 4JFWA 4QDPA 3FDKA 3MP5A 4KRUA 1T5AA 5CBIA 2A3BA 1XUUA 3VKBA 1CGTA 1PPIA 3PAOA 4MNMA 4R27A 4O17A 1KCZA 3H7UA 4R3UA 2I57A 3S1XA 2G0WA 2YW4A 3DESA 4HJFA 3N4EA 1RD6A 4RE4A 1TPWA 2WLZA 3BXWA 2V5CA 1AVAA 4QCEA 2Z1WA 2J7GA 1OGBA 3AJ7A 1KLYA 4DBWA 1EZWA 1YIXA 3V16A 5A6MA 1TWIA 3HGSA 5T9CE 4IFOA 3HV9A 3RDKA 2J66A 4IFRA 3MUXA 5GVJA 1P6BA 3B9EA 3TC7A 3DFSA 3NQEA 4LAKA 3LGDA 2OGJA 1OYBA 1RALA 2AL1A 3MS8A 5LYRA 4AY8A 4F9JA 4GK8A 5GNZA 1UQZA 1U1JA 1XF0A 3AZSA 4P61A 1DJYA 3TK7A 3GTIA 3EOUA 4PMNA 2OODA 4NYUA 4FXRA 2VZUA 2PDXA 3KP1A 1CNVA 1OF8A 4PTMA 2HQAA 1JI1A 1Y5XA 4YHGA 5HJLA 2I5IA 4GVFA 4ZSTA 1CENA 3VD7A 4RK8A 2Y63A 3OP2A 3QPZA 3T0BA 2BY3A 3M0YA 1O6IA 1LCOA 1XC4A 2VFFA 3WEZA 1FDJA 3Q67A 1TPVA 3KZSA 3V1HA 4M6VA 3BZJA 3HPXA 3L0KA 4M3PA 1X7FA 1QXLA 4H7ZA 1E6XM 3S2JA 4JIPA 1VBHA 1DYSA 2Z1XA 2BNJA 2QVNA 1N8IA 1TMQA 5IHSA 5LGZA 4CEXC 4A3YA 4UWMA 1W8GA 2H90A 3DI1A 3A3HA 5M3WA 2FYMA 1KM6A 3M4HA 4DJFC 2XVPA 3VTRA 2A7RA 2ISWA 4ZQNA 4LQ1A 1EJWC 2FZBA 2TAAA 3CM4A 4N7QA 3RR4A 4YJ5A 1KBLA 2WNNA 3W7CA 4H9XA 3IJ7A 1W2VA 5A2BA 2CBUA 4JTQA 3T0CA 3PAJA 5F2GA 1D8WA 5LHEA 2J75A 3PPCA 3N3TA 1YTDA 3MDWA 2OVLA 4GJ1A 3IANA 4AWSA 4M8UA 4RJEA 4IMAA 4LX4A 1H51A 3GDLA 3M46A 2WQDA 1CXLA 2Z0IA 3EWUA 1Q7ZA 3QW3A 1JPIA 1V0LA 3EA3A 3IS4A 3T2PA 3VD5A 2HDJA 1K7FA 3T1GA 3PFRA 4Q6JA 4LC6A 2IKIA 3HIJA 2ISFA 1NDZA 1GZ1A 2FVLA 3ZZ1A 1EIXA 3KRBA 1EDTA 2X1TA 1XINA 3LK6A 2BY0A 1Z44A 3UWWA 2SFPA 4PMVA 2GGJA 2VDGA 3VNJA 1WKDA 2XVNA 4D6GA 1DJXA 1CLVA 1AUSL 3CUGA 1HNYA 1KBJA 3VOJA 5DBTA 4FS9A 2JF7A 3A64A 2BXVA 1GVIA 2FJUB 4GINA 1SO5A 3ITGA 1ZP4A 3BJFA 3TYBA 2B7QA 3U2CA 4I9TA 3OVRA 1PL9A 2FFIA 1CXEA 4HSNA 3TEVA 4NY2A 3WMLA 3QYQA 1AJ2A 1Q6GA 1F3EA 3QHNA 3VVGA 4ZQMA 4RCXA 4H7VA 3SCTA 4H6KA 1FDYA 3WFLA 4YVVA 3UA4A 3LCIA 5CSRA 4R7JA 1UKTA 3RJYA 3VD4A 2C1HA 1Z41A 2X0SA 3OB8A 3W4RA 5GQBA 1LG1A 2P53A 3AS3A 3VGEA 3PY2A 4XD4A 3APYA 2A85A 5A8QA 1M68A 5BRBA 1VGAA 3LTYA 3TWAA 5LIXX 3ZR5A 1E1CA 3SZ8A 3PZGA 3WK2A 3LRKA 3AICA 3VGBA 3QHMA 2J8GA 2CHNA 3NQ8A 2VDHA 1KM1A 4AZHA 4PH6A 3WLIA 1GJPA 4CN4A 4ADUA 3QMTA 4BF9A 3SUUA 2CZ5A 1BVNP 1JYVA 1T6MA 2QVHA 1CXHA 3FV9A 4FPSA 1KGUA 3TTSA 1F5ZA 3THQA 2PGRA 4K8GA 3UJSA 1MZRA 1QR7A 6TIMA 3I4EA 2J27A 1S39A 3E2RA 4LVBA 3BVJA 5LZLA 1V6VA 2CEQA 3WMBA 7XIMA 4LOCA 4B2DA 4EVZA 1KRBC 1PZ0A 1VBJA 4JICA 3AHZA 5FJTA 4ROQA 4JYEA 3LCXA 4BF5A 3GIPA 4MNKA 4CD4A 1OM0A 1R30A 1E51A 2VR4A 4M7TA 5U4NA 1JNDA 1OWQA 1PZ3A 3NYZA 1DP0A 1Q45A 4R7OA 1PCKA 2IPGA 3EOLA 3LLDA 3RFAA 1LZOA 3QOMA 2Z00A 3F2BA 4XBSA 3FSUA 4QQUA 4KKXA 3CNYA 4IFKB 4FO4A 4AXKA 2CLIA 2A7PA 7TAAA 1OK4A 1ZBWA 1S5TA 4KWSA 3TNBA 1KM5A 4PL2A 1R7OA 2DSKA 3GO2A 2IUZA 1ZUAX 4RW3A 2C6QA 3AALA 2A3LA 3E9AA 1AJ0A 2WHLA 3LG3A 1SJBA 2QGHA 1MQPA 4IIDA 4DJDC 3THCA 1XBXA 3GG1A 2O9OA 5LNWA 1JCYA 5DN1A 1XLLA 4OUEA 4MMWA 1TRIA 3QPEA 2A1YA 1V6UA 1TELA 3W88A 3N2OA 4WJ8A 3FXYA 1VEOA 2XZ7A 4UC5A 2FMNA 4B90A 1UOKA 3OLGA 3RO6A 3G1RA 4RNJA 1UP3A 1UIOA 2Z6JA 2C71A 4D6JA 1K9EA 4QP0A 3U5YA 3DBNA 2VM8A 3A4WA 2E5BA 2OELA 1RA0A 4YPJA 2FH6A 1UA7A 3O0KA 4URIA 4O50A 5I02A 1HJQA 3S0CA 3W7RA 2PAJA 3VXGA 4XZIA 1XLEA 1S46A 4NAEA 1XISA 2YZRA 1RPKA 4KEUA 3L2IA 1E5NA 4R9OA 4XBJA 2X41A 4K1WA 4QM1A 2PBGA 3ONCA 4L6HA 4GUJA 3TAKA 3FJ4A 1NH6A 2IPFA 2D2JA 2QCMA 3M44A 3MMUA 1H7OA 1DIEA 1FTXA 1SSDA 4FA3A 4UTFA 4WEVX 1RCQA 3B4YA 4UXDA 1LRTA 2OSWA 1XGDA 1P7TB 1BF6A 1J5TA 1R0MA 2EPLX 5ABFB 1VBUA 4DWSA 1CXIA 1TQJA 4P7NA 8CGTA 4QNEA 3T81A 3CGTA 2FPVA 5KITA 3WNOA 1QU4A 3KHDA 1OHLA 1P1MA 4DF2A 3FKRA 1PYFA 2HMCA 3PTDA 3VYLA 3UWEA 3B8UA 3OYZA 3WQ8A 5I3IA 4OTKA 3DYPA 2D0HA 4A05A 3FHAA 4LVGA 1TPB1 1TCDA 4RR4A 4FZIA 4ML4A 4Q4RA 5CC5A 2YB1A 1J6PA 3U4FA 2J47A 2IW0A 4RDWA 1J93A 2MUCA 5REQB 3MV01 3TMQA 4I5XA 3VKAA 1DJIA 1OABA 2Q8XA 3S9ZA 2BDQA 3PULA 1MQQA 2FMOA 3F4CA 4AY7A 5G4WA 3FYOA 3TZNA 4I9JA 3AQUA 1LQ2A 4D6IA 3K4DA 3VD9A 5LIYX 3RX3A 6CGTA 4ZENA 6PTDA 4CCEA 3WBYA 4EK7A 1SO3A 4UIOA 3NURA 4NZJA 3H2CA 3EZ4A 1W3JA 3WLOA 3S3GA 3DFTA 3QV7A 3B8VA 1SW3A 3W23A 1AD1A 3EEZA 3CUHA 1IWAA 5F4WA 5AYIA 4DN1A 2QYGA 3T4CA 4RNHA 3A4XA 1DJQA 5CBJA 3VOHA 3JS3A 1OINA 3BOLA 1BQCA 3O05A 6REQA 4YVPA 4EACA 3PJXA 1ECQA 1MSSA 3I6TA 4K37A 2ABBA 3NSXA 4DX3A 2XWDA 1HJSA 4JHZA 1KR1A 2DZPA 3GNOA 4E4FA 2FZDA 1O5XA 3P81A 3UPBA 3UY7A 2EBNA 4HK5A 1ZJHA 4Z2JA 1GOMA 4R33A 4P8XA 1KCXA 2DT0A 4P7QA 1KM2A 3H2AA 1RJQA 3APTA 2CNCA 4HTYA 3RITA 3OEXA 2PTZA 3HN3A 4NUWA 2PA6A 5IBXC 3WUEA 1B3XA 4MVAA 1J0KA 3LBOA 3PNZA 5HR7A 4PMUA 5EBUA 1TE1A 1CLXA 4JL1A 1UD6A 3S9IA 1XYLA 1W8SA 3G1VA 2NQHA 2B31A 3P0XA 1UKOA 1OG0A 1E4IA 4B5NA 2WCGA 2WZEA 3ARUA 2FGZA 3WQWA 2ZFAA 4HNLA 3UVIA 2VZSA 1VFTA 2PP0A 1YMYA 5D38A 2GLKA 4UBPC 4AVNA 4DY1A 3MWCA 1Z32X 3WY1A 3DECA 4WXZA 1JGMA 2WZMA 3DYMA 2BTMA 3W7HA 2HVMA 2OWWA 1UH3A 1JPMA 3PSVA 1UBPC 3VDHA 4OUIA 4U4MA 1C7TA 4CN1A 4Z1CA 5E1QA 3LCFA 3NQAA 4KESA 4MAVA 3NDOA 1IWPA 3BV7A 3AXHA 3LGEA 3R0DA 4QDMA 1FWTA 1ZBKA 4E2VA 2YL5A 3BMVA 2ZUTA 4J3TA 4JIHA 4UFJA 3WF0A 3E6EA 2D20A 2DU2A 3AYVA 1W17A 4US5A 1V7YA 3UESA 3BLDA 2OX1A 1JXKA 1V6TA 1RV8A 1XX1A 4Q6XA 3PTQA 2FJKA 2PC8A 3B8DA 4ZA0A 5C2GA 4O11A 3IK4A 4I9AA 2HNEA 5FOOA 2P5NA 1E4MM 1ZLPA 3RJXA 4YHEA 2DH3A 1ISZA 1G5AA 3OIXA 1IEVA 5L6UA 3UWVA 3BC9A 3GAYA 4ML9A 4QISA 4NXKA 4QEEA 1R3RA 4NU7A 3R10A 3GW0A 1Q65A 3A21A 3BUVA 4UZUA 1YHTA 5I3JA 3E02A 1ZAJA 5FKYA 5EBAA 1EDGA 4WDTA 2XSBA 4DUVA 1P0NA 3KE0A 4IQJA 4IMGA 5LSMA 3B3DA 3WIJA 4AW7A 1OFQA 2XVLA 3ARSA 4CD5A 1Q8JA 1SW7A 1OYAA 4ORMA 3L65A 3T08A 4DJEC 1KGXA 3PBMA 4Q33A 2DZBA 3OO2A 4LRSA 3UG4A 3QY7A 3TWBA 4B91A 3IAQA 4UTUA 2F9RA 3UXIA 4GUFA 1A50A 1SGJA 1R38A 5FF7A 2PI6A 3VIHA 4C65A 1YXYA 4LYPA 2ZXDA 4L9XA 1BPLB 4A22A 1EWEA 1NFBA 3VNKA 2VEIA 4JFTA 4DVOA 4GQQA 3WD2A 1JNEA 3R25A 1AG1O 2BHZA 4FLSA 2WBGA 2QF7A 3TTYA 4IJCA 4YTQA 2PDLA 5CXPA 2R6OA 3FJ6A 1ADSA 1TJ1A 4K1GA 1F7BA 2WSYA 4WOZA 4K68A 1NY1A 1XL9A 1SUXA 4AD2A 5CPNA 5CSUA 4PGLA 3NO3A 4CCZA 2NV1A 3UZYA 5BXRA 4IMEA 5D2VA 2D2GA 3HPSA 2DW7A 3MZNA 3RM8A 1GJWA 4N02A 1TA3B 2CXEA 2E77A 4ZGYA 4UB9A 4RZ5A 4CQ8A 1P0BA 2WMJA 3GNDA 2V2CA 3LTSA 4C91A 3W01A 3P93A 1EH9A 3GKAA 2PURA 3ERPA 2O9RA 4GIAA 4C7DA 2CLLA 3GLCA 2QJNA 4JTUA 5CGQA 1TTQA 1F6KA 3AIUA 3KVMA 2BOFX 4QCFA 3WQ5A 4AZ7A 3M5XA 3NSMA 1HFBA 2YJQA 3HB9A 1H62A 1XLKA 1BKHA 3N6JA 3SRHA 2R82A 3ZOAA 2CHRA 1AJZA 1A5OC 3MI6A 4LUTA 2WVUA 4XZLX 1VLIA 3LXBA 4UFHA 1TZ9A 4QG9A 5HQLA 3ABRA 3ZM8A 4FHAA 1YE4A 3QTPA 2GGGA 1ZS2A 1TV3A 2O92A 4LV4A 5GPRA 3SIMA 1W1TA 4FF7A 3RUBL 1XPGA 1R3SA 3Q2DA 3ZVIA 5KZEA 4GYPA 3DUGA 1WAWA 1FWFC 3GQYA 4B9ZA 1J96A 4RNFA 1G69A 4JXCA 2JALA 1BYAA 2Z4GA 3W1UA 3XIMA 3MANA 4IGNA 3RR1A 4GNVA 5A5WA 2PDMA 5F7UA 3GC5A 1LQ0A 3GXFA 4IMCA 4LFYA 4PB5A 4FX6M 3QXBA 1LL6A 2ABAA 3HTWA 1DJZA 3HOJA 3GB6A 2CZVA 3I10A 1J0HA 2NWRA 2P10A 3W86A 1Q8AA 4YWIA 2OQLA 2J7FA 3R5EA 3BLOA 3ATYA 3FSTA 3NZPA 3LEPA 1DXEA 3H22A 2D22A 4QS6A 3AU6A 1Z3NA 3PZMA 1W1A1 2F7FA 3LDVA 5HQMA 4XAPA 3T2QA 2NXHA 3ONBA 4HNUA 1EJRC 3UGRA 4EWND 1NOWA 4JTKA 2DQXA 5HNNA 3TXVA 4ZVJA 1JCNA 1K8XA 3LHUA 1A0EA 3BG9A 5E0FA 1RCOB 4DYKA 2QCDA 3W07A 3B9NA 3HG3A 4BJHA 1XICA 3CAQA 4LAUA 3Q94A 1O68A 4KFOA 3KLLA 4X2RA 1PCWA 3SQLA 2Z24A 1LOLA 4FLQA 1CGUA 3EXTA 2NXIA 5RUBA 5TD4A 3L21A 3O6AA 3SGGA 3N13A 3UETA 4BI5A 2XH2A 3KL0A 3W1TA 3K5XA 4Z17A 4ACZA 2OMAA 1PKNA 1KV5A 1W9XA 3CWNA 5A69A 4BQ2A 3IRSA 2VFHA 1VYSX 2BXYA 4M29A 5BRQA 1PX3A 4P7LA 2AGTA 4D8AA 3CXOA 1JZ5A 1PIGA 1HGWA 3CQJA 1GYNA 2WMKA 3GVWA 1UD4A 1M03A 2YDAA 3BJSA 4W4QA 1TV2A 3VIIA 3S6DA 1JYWA 4GY7A 4DLMA 4PUJA 3RHGA 1HG3A 3OVGA 3FEQA 1TVLA 5E93A 3VKKA 3WLSA 3KBSA 1O5RA 1OCBA 3BAJA 4NNAA 4HOZA 2O4QA 1HKIA 1NP0A 3Q37A 1JUBA 3SI9A 2J8FA 4UQCA 1NOUA 3VFCA 4C60A 3W1AA 2ADAA 1XYMA 4GYJA 5LA1A 1R3WA 3AMCA 4GUGA 2HK1A 4KQNA 2A6NA 4PL1A 3IARA 4KW2A 1R6WA 1ISWA 4EF8A 1HXJA 2GYIA 5AHIA 4PB4A 1DIDA 3BSMA 2IXUA 2CXGA 4IPPA 1HL9A 1AQFA 3VIKA 1A5CA 4DI9A 4GO9A 1C9WA 1VCFA 5EMUA 1J6OA 4O13A 1QO5A 1IQ8A 4HPNA 3VGFA 3TFXA 1FHLA 1UR2A 4GGBA 2WAGA 4F2UA 4HVXA 1O7AA 4MFDA 5CZ0A 2WWCA 1TYGA 4JX4A 4IIEA 1VBGA 2PMQA 3W3OA 3A3WA 2TSYA 5HDRA 2P3ZA 1WZAA 4NZCA 3C3UA 5CZJA 4N4PA 3DHFA 5EU9A 2INEA 4UNLA 3FAXA 3BLPX 3MUIA 1UIPA 2OO0A 3M5ZA 4E4UA 5LXEA 3UNDA 1J9YA 3NL6A 4GX8A 2PDYA 2H9AB 4PC8A 4LCQA 4GYPC 2E5DA 3BJTA 2WKGA 4UTTC 3AIWA 1QPQA 3OLIA 3RCYA 3TLLA 5CSYA 3SADA 2G95A 4KRTA 2TRSA 4DJFD 3SAZA 1OIMA 1GQIA 1W31A 1KTCA 4OV4A 3L0GA 5H8UA 2H3DA 1HGYA 1B9BA 1VCGA 1K77A 2DFAA 1WO2A 5KZDA 1H7WA 1F8IA 3LX9A 1X38A 3B05A 3P5YA 4AMAA 3GYEA 1LT8A 1YDOA 2J9YA 2H8XA 5CLTA 1RK5A 5FI8A 4AH7A 1R3VA 2VR5A 1S2UA 4IUOA 3WF2A 4AU0A 4BA0A 4GI8A 1E71M 4UOJA 4WHBA 1EO7A 3P84A 3UQNA 4V1XA 3ZWTA 5IDIA 3F4VA 3WQ6A 1BG9A 5JQ9A 1X6LA 7CGTA 2Z7KA 4C6JA 4OHQA 1MZHA 1Y0EA 4GJJA 2HCVA 3CTLA 3OA3A 1K9FA 2C91A 3V3WA 3PC0A 3R1ZA 2ZTJA 1JI2A 4WCJA 4I5UA 1R5YA 2OOGA 4CGTA 3PG9A 1GHRA 4YLWA 3SN0A 4H8VA 1IT7A 1I1WA 2PDCA 2HTMA 5GJNA 5DLCA 1B31A 5D9OA 3O15A 1A47A 4ERGA 1WB0A 4XAFA 3DG3A 2VR2A 3ECQA 1M65A 4GYKA 3W71A 3CU2A 3AAMA 3VOGA 2ZZ2A 3KZPA 3CWHA 3SGUA 3ZJ7A 2PGWA 2WYSA 4PEEA 9XIMA 4WUIA 3EMZA 3NPUA 5LIUX 2WC4A 3S2NA 1QCWA 3WO8A 1UJQA 3SCPA 3WMSA 1BWLA 4XV0A 4RUBA 2W61A 1VF8A 3CMGA 1J2WA 3IGSA 3JW7A 4QX4A 1OADA 1G4TA 4XB3A 2WJFA 4N0RA 1W9BM 1XIBA 3F5JA 2EGZA 1PV8A 4Q8MA 4C6NA 3RCMA 5A8PA 4FOKA 3T07A 2X2GA 2BVWA 2W63A 4P2VA 4OQVA 5AYBA 1P43A 1OC6A 4XZ9A 2BMBA 4Q7NA 4JHOA 4E6MA 4XD6A 4KERA 3VDGA 3U7BA 2R94A 1RQHA 3CIXA 3RRXA 3GC4A 1OC5A 3DFYA 2WVVA 1RAKA 3GXIA 4LJ3A 3WF3A 1AW2A 2QV5A 3MMWA 1XH2A 4KH2A 1O60A 2BX7A 1GOQA 3TQPA 4ZCWA 2E7FA 3GHUA 3TXZA 3VIPA 1PX4A 3VDBA 1NWSA 3VIMA 3EDJA 3RAOA 3TJXA 1PX8A 2HK0A 4A2RA 4MADA 1ADDA 1TQXA 1XIIA 2OO6A 1MNZA 1IT0A 1KBKA 3ZWSA 2JF6A 4GIRA 4WSHA 2YBVA 2QUVA 3DEQA 3M07A 2JBMA 3O7UA 5BMXA 2FPYA 3WH5A 2BWGA 3P67A 5C9XA 3GTXA 3BICA 2WWDA 3VIOA 1ZTVA 2GPTA 1CXKA 1I2QA 2X40A 3PTMA 2OXNA 1OVDA 3IIXA 3PF3A 1S5NA 3FX4A 3GG8A 4A8NA 4E3TA 4MG4A 4AZCB 1PDYA 1MMFA 1UJPA 1WOAA 2G8ZA 3WNNA 5FF0A 5IM51 3D6NA 2VCCA 1U22A 3NZQA 1FP9A 3RGTA 4DHGA 4F48A 2Y7FA 2PDNA 4S3FA 5CJMA 3H8AA 3EDEA 3XINA 3P80A 2ONEA 4B16A 3N14A 1E73M 1DJGA 5KZ6A 1QFEA 2A0NA 5EPDA 4LH8A 1PBGA 5C7VA 3IVUA 1IR1A 2P50A 3B8TA 6A3HA 1GT8A 1H1YA 1JAEA 2F2KA 2UY4A 2NSOA 3ABXA 2PDFA 3L4VA 4KBXA 4QAIA 3KRZA 4WZHA 3RRAA 1UKSA 1ZP3A 1MW1A 3OQEA 2E9BA 3PWAA 4NIRA 3LSCA 1OQFA 4O12A 4WKFA 3ZFHA 4YMZA 1SFSA 2PB1A 3W6LA 4MAZA 1HVXA 4Y8EA 2DZVA 1KD0A 1UR8A 5G5IA 1JCJA 7TIMA 3ES7A 2ISVA 5DCEA 2YKKA 3T78A 4QE1A 2V2DA 3H21A 1A80A 5MHBA 2JEQA 5D04C 1CGWA 2FZ9A 3H4XA 3LCWA 4F9DA 1E56A 4S38A 4GNJA 5I09A 1F61A 3WQEA 4DAIA 3TVAA 4HB7A 4XAYA 1EUAA 1HQTA 4EXAA 5D37A 2J62A 3U2OA 4PMZA 4LAMA 3TAOA 3TUUA 4W7WA 1MNSA 3ELFA 5CG7A 1JD9A 1Y7VA 4MNJA 3EWWA 3V0UA 5F1VA 1EGZA 4YTSA 5HWNA 2R1KA 1XXXA 1E15A 5D03A 1GVYA 4JCMA 2FZNA 3TKFA 1R85A 3H4GA 5HXMA 1TMHA 1L6FA 1SFTA 2XINA 3HV8A 1NDYA 2Y5EA 3U5UA 2DZAA 2OQYA 2XG9A 1KC7A 4GMEA 2PZNA 2WO5A 1V03A 2VVNA 2QCDB 2VHLA 3GDMA 4MPKA 5ABTA 4HQVA 3E2QA 4FI4A 4NZ3A 4AMCA 2NLIA 4HBKA 5HQEA 1PTDA 1AK5A 4LUSA 2DVUA 2E5CA 1FWJC 1EQPA 2UBPC 3R0KA 4WVXA 5CAKA 1ICPA 4H04A 4C6EA 2OOFA 4O4VA 1DXIA 3MYPA 3W00A 4RZ6A 4K7VA 4D6FA 4JN7A 5BWFA 1M04A 1GQLA 3WMCA 1JPDX 3G6MA 4HZMA 2J78A 1JEZA 4JTEA 5AKQA 5M2FX 3ZLGA 2YYTA 4CQCA 5H8PA 1G94A 1BTMA 3NQMA 1H63A 4KF1A 3GIQA 4MWAD 1A5MC 2J8TA 3SRDA 3W22A 1VP5A 3BANA 1GOXA 2Y85A 1EBHA 4AD1A 3APGA 3WK3A 4GI4A 4GISA 4G7FA 2WJZA 4K7YA 1WNOA 3VUPA 3W28A 3K46A 4GKLA 3EWBX 3A12A 1YEYA 3CUXA 2G3NA 2Y8VA 4DWSD 3H23A 3LSBA 3P0WA 3WBXA 3KLKA 4GKTA 2D2OA 2DEPA 1ELSA 4GCAA 3BCJA 4U5IA 3TX9A 3M9YA 4NL1A 4AX7A 5EFDA 3OODA 2AL2B 1DJNA 3N4FA 3T44A 1KFEA 4LAZA 3W73A 1QHZA 4QLJA 1QNOA 1EJVC 3R79A 1XIHA 1EFZA 4HMEA 3LY0A 4K39A 3ALGA 1GKQA 2NXGA 5DMYA 3NQBA 4ZE5A 1PB0A 2D1ZA 4JY8A 2BHYA 3FN9A 4FR6A 1V6WA 4JTLA 4UQBA 3VKJA 2NSXA 3TC6A 4W9TA 3BGJA 1OX6A 3T05A 3VDCA 1JUEA 3QSRA 4H6EA 3TCEA 4KGJA 2DUZA 1XWYA 1NIUA 1G4EA 5BOFA 3HF3A 2HSAA 1CX9A 4DJDD 2I5QA 1F05A 3NM1A 3WLPA 3CASA 3DI0A 2QEZA 2DVTA 3K30A 3B06A 3H54A 3L66A 6XIAA 3CZEA 2X1UA 5DRIA 1W3IA 1W5QA 2Y8KA 4E2BA 1OK6A 4ADTA 2ZA1A 1KFWA 2QNEA 4GQRA 3ABSA 4EF9A 4XZBA 1GKRA 3N15A 3TOYA 3AS1A 5E09A 3WK0A 1NDWA 2WQPA 5CPLA 2VJXA 3WX7A 1EYEA 1YNQA 2RKXA 2E3ZA 3UZXA 2LLEA 4UTMA 2I17A 4M0XA 2QMJA 4QTGA 3S5NA 4U10A 5EYWA 1DQXA 1HIZA 3TFCA 1UWRA 3MI2A 3UG3A 2NVAA 5AYZA 3TOPA 4BQ3A 5K3VA 3RLHA 3URAA 3VINA 4NRRA 3QC3A 1EC8A 4GUIA 4RW5A 3LLFA 1BYBA 1TVPA 4IJBA 4BWLA 4DO7A 2NZLA 1XLFA 2IQDA 3PZOA 2E6AA 4C5YA 4DF0A 4K36A 1RVGA 3HQNA 4ALDA 4UZSA 1XLCA 2OLHA 1V51A 1QW8A 4MZ8A 4RXFA 2ATMA 3TA9A 3EBVA 5KMYA 2J4GA 2VT0A 3MC5A 3E3HA 2HE5A 2PF0A 1DQUA 3QKEA 1MW3A 3TYUA 5I5RA 2V6AA 3KWSA 2QCCA 4ZQRA 2R1LA 1GQNA 4ADSA 3OHMB 3FVMA 1GG0A 1EOKA 3URQA 3Q65A 3RXZA 1FWBC 2JQXA 5BMWA 3T8LA 1KA9F 3OBEA 3HQPA 1Q13A 4JQ3A 3ITOA 4MGGA 2XPKA 3L2LA 2QDHA 1SZRA 1DEDA 3ZIZA 4HYRA 3FKKA 3LXAA 4R53A 3W0KA 3A24A 4FX8A 2XIIA 1GOWA 1UWTA 4EAYA 1SYTA 3K13A 1MFVA 3UR2A 3EOOA 4DNHA 2CBVA 3FHQA 5AHFA 3SR7A 1R9YA 3L4ZA 1VJSA 4IL0A 3EXRA 4O53A 3PBYA 1J0JA 3IJ6A 1W9PA 2D24A 1WP6A 4YXGA 3G1FA 4HPXA 3A22A 4LS2A 2JKAA 4WSJA 2VGBA 5M1TA 2YXOA 1D7FA 1RLCL 1FCQA 3FA3A 3RPMA 1C90A 1CBGA 1GVSA 3AFBA 4REQA 3W37A 1B4KA 5EB8A 1XSIA 4MB3A 5I07A 3N11A 4DXKA 4PZVA 2DUAA 4Z1AA 1IIGA 4JEJA 2GSEA 1I8JA 8XIMA 3ME3A 5JIPA 1MQRA 2QDEA 1Q6QA 4H8UA 4C6QA 2P0IA 2VEKA 1Z7AA 3I3DA 3CO4A 4KCWA 1IZJA 1NFPA 3WNKA 4PUWA 2OSYA 2ACRA 4MY9A 4ZODA 2QR6A 5CGMA 3W24A 1FCVA 1VIZA 4U28A 2KZHA 9CGTA 1WZKA 4F0MA 3A5VA 3QGVA 2Y1HA 4RDZA 4O14A 2FHCA 2ZC8A 1UR4A 4Z1YA 4TVUA 1RY0A 4UNKA 1WDSA 2FPTA 4MJ2A 3HG2A 4XUGA 2XGBA 1IV8A 3GDTA 2DIKA 1UKQA 4JQAA 2ZZ5A 3C0SA 1ZBVA 4DO4A 4DLFA 3BG3A 3KW3A 3NUKA 1K8CA 2C8NA 2W66A 3DKLA 3GXTA 3GNPA 4TU1A 4D6EA 1E3XA 1IYXA 1AW1A 2HROA 4XZMX 3LXCA 1QOPA 1H1NA 1G1YA 4CLMA 2W79A 3POHA 3G2GA 4AB4A 5H8MA 4W86A 4NJIA 3LERA 2XISA 2EKGA 3VNYA 1LLWA 2C0HA 5DANA 4HSOA 1Q85A 4UMCA 1F3WA 3VA8A 1L0PA 2I56A 4PRWA 4S3GA 2WHKA 3GUGA 4X0NA 4GZ7A 1P0KA 1XHGA 1FUYA 1I2OA 3ITTA 3TP4A 5HUPA 4XZWA 1EF3A 1M9HA 2Z27A 3PUDA 2AMXA 2DY3A 4HA3A 2W9MA 5LNVA 3W1QA 4Y96A 3ICJA 3M7SA 3MCOA 5A6AA 1QVBA 4ZO7A 3NEVA 5IXEA 1OGGA 1VR6A 4IMDA 4CNOA 3LNPA 4JFUA 1C9DA 3PANA 4WJEA 2FFCA 5HA7A 5BU9A 3CV1A 4EIVA 1CLKA 2JGYA 3BLFA 3RK8A 1QK2A 3H7VA 3L7RA 2VWSA 2WMIB 2WHMA 3OTRA 3ZO9A 3W2JA 5CAHA 3TYZA 2PUZA 3LHTA 3MTWA 3ARVA 1LTDA 2VZTA 3CHFA 1E0UA 4ZOEA 1JFXA 5I79A 5AZ0A 4LUSB 3BAKA 3NO5A 5A94A 4UUIA 3OLDA 2EG8A 3KX6A 4X9YA 3W2UA 3CTTA 1GOKA 5I3GA 1REQB 3MZ2A 4HHPA 3N04A 4RL3A 1FWNA 2CKRA 1ZJIA 4B5SA 4DZHA 3W02A 3N2BA 1GONA 4QS5A 3STFA 3W81A 1BXNA 5KTLA 4PB3A 1H7PA 1HKMA 2FH8A 3PG8A 1XCXA 3SQSA 3AMDA 3BQ5A 3ZVHA 2VWTA 1K7XA 5A8GA 4X2PA 2GOUA 3KTSA 4AYGA 4MNLA 3OZPA 2QIIA 1N82A 3G3DA 3AHYA 3QTGA 5HJYA 2WSKA 1LBLA 1YW1A 4B9YA 3ZR6A 1X6NA 1UWQA 3C5QA 1U1HA 3MJYA 3WLQA 3AO0A 3S1WA 4XO6A 3TZFA 2DSUA 1W1YA 4NAEB 1VS1A 4XSMA 2PTDA 5TF0A 3O6YX 3NQCA 5M5DA 1FWSA 4QE5A 3BSGA 1PUDA 3B40A 4GI9A 1ZZMA 1BRLA 2Z1BA 3CK5A 3KOWA 2IXVA 3GTHA 3GC2A 4M6QA 3BAIA 2J7BA 1R86A 5ECUA 3P8IA 3Q58A 3WDRA 2WZHA 4H7CA 1R47A 2WNWA 2X1SA 3ARRA 1E0TA 4WRHA 3SCRA 2D73A 4NG3A 2Y88A 4P8VA 5D05A 5AB3A 3FGCB 4A35A 5A6BD 4AIUA 2HS6A 3BE7A 3VZZA 1PTAA 3T9PA 3NQDA 1F8MA 1RSCA 2FHBA 2R8WA 3ZMRA 4D2JA 4IQLA 1QPKA 4KCUA 4JDYA 1FWRA 3QZ6A 2A21A 1T99A 3B9OA 4MWAE 4B4HA 5ENLA 1YRRA 2QJJA 2EPHA 3EB4A 3RG6A 5JBFA 4BK9A 3CH9A 3JZEA 2ZX7A 1E6QM 5I06A 3QZAA 1JJKA 3II1A 3TN6A 3V5FA 4MSSA 2YLAA 3A5FA 4NJGA 1UZ4A 2FDMA 3L5AA 4HOXA 3GZ3A 3FGCA 1XQKA 1GWJA 3CMFA 4KWWA 1L8NA 4AEOA 1QASA 1E6RA 5FF2A 1GCYA 4L4PA 3G1YA 3PBGA 3TQVA 1Q6DA 1OT2A 1XI3A 1GYLA 4IFKA 5C55A 3E96A 1E9ZB 5JIWA 4X60A 4PMOA 1V02A 1J18A 4Q8VA 4XD3A 1UUQA 4TX6A 3KCLA 4S1FA 3WLNA 2WLYA 3QY8A 3P6LA 4U2ZA 3N4AA 3THUA 3SY5A 3NGJA 3NA8A 1RR2A 4QLLA 1DJWA 3GE7A 3MBDA 4GPNA 5ABHA 1EX1A 2FTPA 1Z6KA 2VX4A 1EPXA 3M0VA 2BY1A 2QAPA 5AVNA 3BLIA 1V93A 1GK8A 1CGXA 2MANA 4NYYA 2XM2A 3ZVHB 5E70A 2BBFA 1V3LA 4ZB5A 3UWYA 4P7RA 2R9RA 2QPXA 3W7QA 5DRCA 4LYKA 2PZ0A 2PD5A 4ZZ9A 4NZ4A 2E4TA 5CEWA 1LRNA 4ZL1A 2JIWA 3VOCA 5I7GA 3THAA 5IFPA 4HIBA 3AWOA 1SZEA 3WK1A 1KXVA 1EGVA 4GBDA 4AHPA 2OLSA 3TYAA 5BNKA 2E6DA 2JKPA 3B03A 4DAFA 2J7CA 2CZDA 3WD4A 3S6OA 1KM3A 3TSBA 5I3DA 1VENA 3LPOA 4DBSA 4WKAA 4KWUA 5C2CA 3QOKA 2Q09A 2DZXA 1T96A 4FMVA 1OC7A 4LY4A 4GE8A 1W1B1 1OFRA 3NFUA 3UU0A 4G56A 3FVDA 2BB0A 1UA3A 3GS6A 3WQCA 2XU2A 4FIRA 1F4AA 1LF1A 1TZZA 2VX6A 4DBUA 4AC7C 5A6JA 1MXGA 4Q8NA 5FJPA 3W26A 1ZCOA 1BXCA 4TOQA 2NVDA 4LB4A 3GDBA 4FNUA 3CWOX 3EPOA 2PDJA 4KWOA 2NX3A 2Y7DA 1EDQA 1X1NA 4Z42C 1QO2A 4HCLA 3MMTA 4OBRA 2PWEA 2E8YA 4PUNA 3P61A 2A6LA 1GG1A 1E43A 1XYZA 2E1DA 3MUY1 2V30A 3OOQA 2PC4A 1F76A 3N3MA 3NO1A 4M6UA 4QRNA 3ZT6A 3I6RA 1RQEA 3GUWA 1W5NA 2IMRA 3KCJA 4NILA 1T0OA 3TJIA 3P14A 2PD9A 1B0IA 3C2OA 4MYXA 4UFKA 1CIUA 3W87A 3E49A 3IJ8A 4IP7A 4XVDA 1QT1A 2ZCGA 4UQAA 3LM3A 2PGFA 2KAUC 1B2YA 3WH8A 3EEGA 4U31A 1B30A 2DSWA 2DPEA 3CIVA 4GVHA 3TW6A 3VC5A 4UQEA 3EB3A 2ATSA 4KFPA 2DQW