3B4YA

Fgd1 (rv0407) from mycobacterium tuberculosis
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
332
structure length
331
Chain Sequence
ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELAMNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE F420-DEPENDENT GLUCOSE-6-PHOSPHATE DEHYDROGENASE FG
publication title Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Oxidoreductase
total genus 117
structure length 331
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.98.2: Glucose-6-phosphate dehydrogenase (coenzyme-F420).
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 3b4yA00
1BSLA 5DQPA 1TVLA 3B9OA 1XKJA 1FVPA 1EZWA 3SDOA 1NQKA 1LUCB 1Z69A 3FGCA 1RHCA 3B9NA 4US5D 1M41A 5LXEA 3FGCB 5AECA 4J2PA 3RAOA 1YW1A 1BRLA 3C8NA 1F07A 1NFPA 4UWMA 2B81A 1LUCA 3B4YA 1BRLB 4US5A 2I7GA
chains in the Genus database with same CATH superfamily
3VCCA 4XAPA 3WD1A 3P67A 3RM4A 3CEPA 4NZ5A 1FWDC 1BVWA 4IIEA 4CU6A 3PUGA 3W86A 1J6PA 4TX9A 3AQUA 4ZB0A 5A8OA 3VINA 2V5KA 3WJZA 3U9IA 1QWKA 5AB3A 4G7EA 2WXDM 3T4WA 4FAMA 1M03A 5CC6A 5A6MA 3L2IA 3LTYA 4S2BA 3KOZA 2AQVA 3R79A 1TPB1 4YHEA 2OWXA 1XICA 4P7RA 3O1NA 3C4UA 3F03K 3FYPA 4AFYA 2RDUA 4GUFA 5H8MA 4UR7A 3IWPA 1QVBA 4C6PA 4W89A 1RHCA 4C6DA 1XDMA 4PL1A 3NZRA 4IMAA 5HWNA 4E2DA 1BD0A 1NQ6A 4DRSA 3N2TA 3SO7A 2Q09A 1AQHA 4BI6A 3KWSA 1RP9A 2D0GA 1K3UA 2ANUA 4MB3A 2PDKA 1H7RA 2XVKA 3DBPA 4M8UA 3TVAA 5ABFA 3ENLA 5F1VA 2ZUNA 1E1FA 4QJ5B 1XH1A 4FF5A 4X63A 3LHTA 3NFUA 3ECQA 1IWBA 1S46A 3GHRA 2Z00A 1UWRA 2WNZA 4WCJA 2PLJA 3JUGA 5FA5A 1VHNA 3MP3A 4LTSA 3W7GA 5CGMA 1UH3A 4UTHA 4Q22A 4LUSB 4HTBA 3DFPA 4GQGA 4JTJA 4XD3A 4RJEA 2R24A 1XV8A 2YA0A 1GYMA 2YCLA 1KRCC 4M1RA 3K8MA 1E6NA 4AIUA 3MZ2A 4AZ7A 4EAMA 3BCDA 5CBBA 3B8SA 1FA2A 2QYGA 2WVVA 1L6GA 2A6NA 2WMHA 4DB7A 5FF2A 1HKVA 2ZX8A 3MKKA 2DT2A 4UQAA 3TSBA 3CUHA 2CLIA 4EVZA 1XFCA 2E68A 5DRIA 3S47A 2R6OA 3MDUA 3F5JA 3BLPX 1ADSA 3U5YA 4A8NA 3C0JA 4RDYA 1JJKA 3QLLA 3DYPA 4TR9A 1MEWA 5LA0A 4IM4A 1KLZA 1I2QA 3LPFA 4YIWA 3AIRA 1MUCA 2OODA 1EWDA 4XG1A 3SUSA 5LXEA 2W79A 1FWWA 2G95A 1VEOA 1V3MA 3W7HA 5LKYA 2NVAA 3RIKA 1KM1A 3HA1A 3UW6A 4ATLA 4L4LA 4ROPA 1CW2A 4MKVA 4OGZA 5LYRA 4R7WA 4AX6A 4O8AA 3SI9A 2Z24A 1J0ZA 3LA4A 1Q7QA 2PTYA 2WVTA 3SY5A 1X6LA 2A79A 4CKQA 1AJ2A 3TAOA 4ZGYA 1UZ4A 2J79A 4ZFCA 1FTXA 4WXZA 4A8LA 1D2KA 3VOHA 4Q8VA 3C2YA 2DW6A 3GG0A 3A4WA 3VDGA 1OC6A 4P7QA 3EKGA 4QTGA 3B8IA 1J2WA 3LCGA 4DELA 3UXKA 2I16A 4ZO7A 4KEUA 3AWNA 1IEIA 4AC7C 3W28A 1OCNA 4C60A 4N0RA 4AG0A 2GUYA 2G50A 3AXKA 4IOTA 3OYXA 4GI4A 1Z89A 2P1FA 3WZ0E 3TKFA 5DX7A 2HVOA 2QPSA 1ONWA 3BDKA 2F38A 2XHYA 3VM7A 2CWNA 1UH2A 4AD2A 1G4PA 5A8GA 3IIXA 3UXIA 3SQMA 3AROA 3TK7A 3N12A 4X9YA 3FDGA 5CSRA 3FXYA 2X40A 3W2UA 2PWGA 5A2CA 4JICA 1SJDA 3M0XA 4IISA 3KTSA 3KVJA 4K7YA 3LTSA 4MKSA 1QJWA 1MXGA 4C1NA 1BQCA 1US3A 5CPNA 4TVDA 4E2VA 1I2PA 2VRJA 3GNOA 3QZAA 1UKOA 1EJXC 1HJQA 4PRTA 3VD3A 4H9YA 4QLKA 2OQLA 2Z2UA 2QCLA 1CEOA 4UFMA 4QSFA 4BF7A 3VD9A 1IHIA 4QJ3B 3CU2A 2V0TA 4LBRA 1M5WA 1QW9A 5K3VA 3TP4A 1KM0A 3EDEA 3ZSTA 2YFNA 6XIAA 2OYKA 3G2GA 1I1XA 3RLHA 1TMLA 4MDPA 5DBTA 5IFTA 1BRLB 1P6CA 2OR2A 4NNAA 2J74A 3K4WA 1RD6A 1HF6A 2E9BA 2A6LA 5DMMA 2ZC1A 1MZRA 4MDOA 3BOLA 3P80A 3AYVA 3IS4A 4ZL1A 2BMBA 2V9DA 3RHGA 4MNMA 2E09A 1F5ZA 1DHPA 2VFIA 3FOKA 3M0JA 4LYKA 3B40A 5DMNA 1LLOA 3AHVA 3GXPA 5EMLA 1C9WA 1XYFA 4Q4MA 3LPOA 3CPGA 3MHFA 2RKXA 4HOZA 2CZFA 1P7TA 1QDSA 2JK2A 2W67A 3BSGA 3ZLFA 2PDIA 2F2KA 3OGRA 2WKLA 1XYBA 3N25A 1AH4A 3O16A 4R27A 2HVMA 3C8FA 1V6XA 4J40A 1W8GA 2EPLX 3MKCA 2H3DA 1LT8A 4GC4A 1QPNA 3NQ2A 5EBUA 1K8CA 2E25A 1QUMA 4HD5A 5DLCA 2RJHA 3M16A 3KZSA 4UMBA 5D02A 2YR1A 3HTWA 4UTFA 4IGSA 1F61A 4GY7A 1QNVA 2ZRUA 3NL5A 4IXHA 1ZBVA 3VDAA 3DG7A 4IIHA 5EMMA 4DUOA 1L2QA 3L4VA 3JRKA 2V3GA 3VIHA 4O14A 4XKYB 1EO7A 3ATYA 4PFMA 5CC3A 3IACA 1KRAC 1RALA 4RZBA 1B31A 4JOMA 2JBMA 3VKKA 4E0CA 4AZ5A 5A6BD 1UD5A 1AW5A 4DN1A 4EKJA 4KRUA 5GNYA 4Z2KA 1JQXA 4HN8A 4UQ9A 1H7OA 2IKHA 2VVSA 4QX4A 4ECLA 2DSZA 4DBSA 3AXXA 3W82A 3CO8A 1C8VA 2VOTA 4B5SA 4MVAA 3HG4A 4B15A 2WWCA 5IHRA 4XAFA 5JXQA 2JIWA 4ERAA 3FN9A 1ECQA 3SRDA 4ZQCA 2OKOA 2ACUA 4H41A 3ZR4A 3NQMA 5H8UA 4JTTA 2DY3A 3QF0A 2FTYA 2BGNE 3KLLA 3IV3A 1MUWA 2HCVA 1L0PA 4DNMA 6XIMA 1XBVA 1HVXA 4J4KA 1U2YA 3H4XA 1SZNA 3CK5A 1DTUA 3VGGA 4FNRA 5BCAA 4NXKA 5BOEA 2FH8A 5F4XA 3S9ZA 4NX0A 4H00A 3VGEA 4GO8A 1LQ0A 3PBVA 1DWFM 2XGIA 1BFNA 3PZTA 3U0HA 1BVNP 1V3HA 3NQDA 4I9TA 2E8YA 1VEMA 3CIXA 1VAHA 4OUEA 1PYMA 4HNCA 3B9EA 1HXJA 3TTQA 2WHKA 4Y9MA 4DO5A 2Y4SA 3FNDA 2DZWA 4HSHA 4GVGA 1M41A 1O4UA 1OG6A 4N9CA 3G1SA 1IXOA 4IJCA 5HAOA 2Z4GA 4WY0F 4MHBA 4YU1A 1VFFA 4WF7A 1Q85A 4HJFA 2IUZA 5CCZA 2JALA 4A35A 4PMNA 3B8DA 2AAMA 5BYWA 1LP6A 4MYAA 3LRKA 3GU1A 4K68A 4JAWA 3WQ6A 1V0KA 3GDMA 3NPVA 2DZUA 1UD6A 4PR4A 1J9YA 7ODCA 2OSXA 1GEQA 3O06A 4DZIA 1AODA 3EPMA 2AQOA 1XLIA 5HJYA 4HPNA 4LYQA 1PHQA 3W9ZA 3WEZA 3QGVA 5I3IA 3UFYA 5BNKA 2E28A 4ZO6A 2A1YA 4RW3A 2PDUA 2Z2BA 4KH2A 1XGZA 4NU7A 2X09A 1JQVA 3OGSA 2YXOA 4NL1A 2H9AA 1IEWA 1W1A1 3WQGA 4F0SA 3WL0A 5B80A 5I3FA 5KITA 4ZB2A 4C6JA 4MUZA 4BEQA 3W7DA 3PS7A 3GG1A 4M29A 2QAFA 3AIEA 2NXIA 3TZNA 1QI2A 3OO2A 5FJIA 2CU0A 2HNHA 1EP3A 2VENA 2OOFA 4WSJA 2VDGA 2O7QA 1ZL1A 1AUSL 3DFNA 3ZFHA 2CIPA 4AEOA 1XUUA 5T8GA 2NQHA 4D8LA 3WF2A 1T0OA 1H7NA 3LXAA 3SN1A 4ZQNA 1S5VA 5BRPA 2VNCA 3GXFA 4WJXA 4AIOA 4JTFA 3XINA 1KQYA 5TD4A 4PCSA 1UMYA 1OF6A 1CXEA 5I3HA 2V2CA 1JG9A 4PULA 4KEVA 3KHDA 1QO5A 1XRTA 3DIPA 4NZJA 2NLIA 4B9ZA 2OQYA 1JPDX 1JF6A 3OHIA 2ZC8A 3MV11 3VIOA 3PAOA 2YLLA 3BOFA 5AC7A 2QHAA 3DZ1A 2WZMA 1HJVA 3HPAA 1BTMA 3W6MA 1JULA 2TPSA 1EDGA 3OPSA 3WBXA 3N4EA 3WMCA 5HATA 2QJJA 2R1MA 3SURA 2EPMX 1ZCCA 5EA9A 2B7PA 4A21A 4AVOA 3MMUA 2WVVB 2ZICA 3UU0A 1FDZA 4H2HA 3V75A 4WJEA 3OVPA 3N2MA 4F2UA 3VDCA 4FLSA 1ESWA 1SFJA 4HZ8A 4S3KA 5D33A 4F9DA 3WLHA 1OT2A 4NX5A 1CLVA 4FNPA 4WQ6A 3CWHA 1M7XA 3WL1A 2CERA 1JUBA 4V33A 3OP2A 3M44A 3RCMA 1K70A 3LCXA 2D73A 3VGBA 1QHPA 1EF2A 1VFHA 3BJFA 3JZEA 2D1ZA 2TYSA 3AMCA 3Q65A 3FX4A 1W3TA 1Z6KA 2QLYA 5A8PA 1R9XA 4ONVA 2DZBA 3RX4A 2WANA 2J88A 1KA9F 2G4FA 5CPLA 4Z1YA 3EOUA 3R0KA 4IPLA 4B3ZA 5B7ZA 3H23A 2IW0A 3I7RA 2VO5A 4IFOA 3ZWSA 1WBJA 2GQ3A 2ZZ4A 3ARPA 4DJFA 3LNPA 5K9DA 2PMQA 4AIEA 5FKYA 3MYOA 1GJUA 2YL8A 2XIJA 3GQYA 1VS1A 1X7IA 3PBMA 3O07A 4FR1A 3II1A 5EL1A 2CNCA 2FZ8A 3RR1A 5HQMA 1TTQA 1AJZA 4Q4OA 4PRRA 4OUIA 3ZR6A 1VB9A 2EGZA 5I23A 3BVJA 2VFGA 1XIMA 2JGYA 2A3HA 2E67A 4GZEA 3T8LA 1Q6RA 3ABSA 3F2CA 4G7FA 4CN4A 3CHVA 2JEPA 3W7CA 4AH7A 1JAKA 1PTAA 2FZNA 1ADDA 3KL5A 3QV8A 1JIBA 1RA5A 1BWVA 1SZGA 4L64A 4QEEA 2CC0A 4GVFA 3LI0A 1VR6A 3MVIA 2GWGA 3TTOA 3T05A 4JTKA 1C7TA 4QNEA 4DZ5A 1J93A 2J4GA 4WLCA 4ZOEA 2PWVA 1QATA 2HJPA 1GG1A 4E38A 4L7ZA 3UVAA 3T2PA 4MKNA 3KVMA 5FL0A 2C91A 4IUOA 3WLOA 1F76A 1DHKA 4R53A 3L0NA 1EDQA 4C1LA 3H2AA 1X96A 3B97A 3ZT6A 1GEHA 2HK1A 2QDGA 3UGRA 4JHOA 3CHCA 1YHTA 5I0DA 3BV4A 3PB0A 3NYZA 1V8EA 1QR7A 3OG3A 5ENLA 3EKZA 1CGUA 2CZVA 3R8GA 3RPDA 4A05A 5IFPA 3EWCA 5KETA 1CLXA 3KOXA 5EBAA 4KESA 1BHGA 3PJTA 1EC8A 2J24A 2J6XA 2DJLA 3O2LA 1VIWA 2BOFX 3LX9A 1PHWA 3CUFA 1CGTA 1UPPA 3E0VA 1QBBA 4UFIA 1XIFA 3WLJA 3UG8A 1FH8A 4DWSC 2XUCA 3MUCA 3PSVA 1EPXA 1A50A 1WYIA 4H19A 4XTIA 3TONA 3OHMB 4XIMA 5MKGB 4AQLA 4KGLA 4JTAA 4K8HA 5G4EA 5L9FA 2QGYA 3R13A 3RO6A 3UY8A 1KCLA 1RLDA 3LEPA 3WLIA 5LXXA 4LW7A 3SJNA 1XC6A 1E9YB 3C86A 4DO7A 4I90A 3H54A 4CD4A 3L0GA 3GTNA 1RV8A 1T8XA 2CETA 1OX4A 5G2IA 5FL1A 3S5NA 1JDDA 4Y90A 1Q66A 2FGLA 3R89A 4IHCA 1DE5A 1UR3M 1VBUA 4QQ3A 5AHMA 2DDXA 3CZGA 1NVMA 3VIIA 5J8LA 1TA3A 1XCFA 1Z7AA 4P8UA 3GR4A 1KRBC 5I07A 4LFYA 2P76A 2J25A 1A0DA 4ZQOA 1VP5A 5HBFA 3UA3A 4EPKA 5LIYX 1OEPA 2NW0A 1B4KA 4MY1A 1GQIA 1OQFA 1POKA 5TAOA 2OEMA 4ZZ9A 4HCLA 4LUTA 1FDJA 4UFLA 3PY2A 4Q4RA 3OGVA 2G8ZA 1K7FA 4IZGA 2X0HA 3CAVA 3CV6A 1SW7A 1CB2A 2JF7A 4FNSA 3APGA 2WCAA 3IVUA 1KFEA 3WD2A 4O4WA 4GE8A 4FNTA 3WH7A 4Z1BA 2FGZA 2PUZA 4RDZA 1ZY9A 3V4BA 1H3GA 3BICA 5FF3A 2A5HA 4U5KA 4JTGA 4MWAC 4DUVA 4GQQA 2X8RA 5C8BB 3D46A 3ANUA 3AYSA 1Y8BA 3BG3A 3JZUA 5A69A 3G8EA 3FS2A 2XZ7A 8XIAA 4HSOA 4IPPA 1YIXA 1TPVA 2RJGA 1SW3A 3AXIA 1TB3A 2ZZ2A 1J0KA 5JH2A 4JCLA 4OFCA 2ZA2A 2D23A 3BLKA 3FEQA 3WNPA 2YIHA 3KRBA 2OLSA 4H6EA 3B8WA 1A53A 3OZYA 4W8BA 3GSMA 4G9PA 1TPWA 2RFGA 4C1KA 4QJ4B 3UZ5A 3UZWA 4DZHA 3DOPA 3WMBA 1C8YA 1FDYA 3SN4A 3IGUA 3HV9A 1E0VA 1O60A 4GY0A 3PNZA 5DT5A 3A21A 1U1JA 1B3XA 4HT3A 1KGXA 1R9ZA 5HMSA 4DJDD 3QPEA 1B9BA 4FIRA 3VVGA 3T9PA 4J2MA 3IVTA 4YS1A 4XD4A 5DFAA 2VC6A 3S5YA 2ZE0A 1ME9A 3TYUA 2C1GA 3AI0A 3A24A 4RUBA 2DORA 3DHPA 3TCSA 3WELA 4QBXA 5AHFA 1XL9A 4LB3A 3M6YA 3TN5A 3IIZA 3XISA 3LS9A 4G56A 3KBSA 1PX3A 1YTEA 2X2YA 3G18A 5G1YA 1GW1A 1NFBA 3OG2A 1RPXA 4ES4A 1YYAA 4I7VA 1XUZA 1UR9A 4K8EA 5F2LA 2R1PA 3MUIA 1MW3A 3TNOA 1IZKA 4DJEC 5A3HA 3ITOA 4S3BA 3FLUA 5HWMA 3USBA 3RK8A 1A47A 1WKDA 4RNFA 7XIMA 3VOIA 2WVSA 3W7JA 3NQVA 1KFBA 5AZ1A 1WXYA 5XINA 2Z0IA 1VJZA 4HJWA 1A5LC 3T40A 2VWTA 3IK4A 4F0LA 2FPYA 2OVLA 3KX6A 3N4FA 1F6YA 3CLWA 2H9AB 3GKAA 2PWDA 4O17A 3VM5A 1CX9A 3GXIA 2YBTA 2PD5A 2YA1A 4XZHA 2NX3A 1XPGA 2R14A 3AUOA 4LC8A 4QE4A 4TVUA 1NSJA 2AAAA 1DXIA 1VYRA 4HSNA 1Z9AA 4AWEA 2YW4A 1AD1A 4P7LA 3TNBA 3EDFA 4ZMGA 4ICMA 1CIUA 4GK8A 2GZXA 5MF5A 4PFHA 1S3HA 2QPUA 3EWZA 3V5FA 3PZMA 2XJ7A 4J3UA 5ABHA 3OLGA 4D2JA 2R1LA 3FXGA 4KBXA 4BQ2A 3N2BA 4PUDA 4I6KA 3WBYA 2OG9A 4LEFA 1U22A 1NQKA 2ZA3A 4FNUA 4D6JA 3LDVA 4YCOA 1EQPA 1UKQA 3RUBL 1Y5XA 4XKMA 1EUAA 3A5VA 3H22A 1EHNA 3HQNA 4LAMA 1AD4A 3K30A 3WF3A 3MUZ1 4YTRA 3NDOA 4NZFA 3UNTA 3PZVA 4DLFA 1RQBA 1CBGA 1R3QA 2YJQA 1C93A 3CC1A 3GXMA 3G0UA 4FB7A 4AD1A 2HBVA 1JCXA 4O18A 1ECEA 1EHAA 3R2GA 1Q63A 1JZ3A 1PZ2A 1I2RA 4CEXC 4H8VA 3R4IA 3NO5A 4KPLA 3BMVA 3MWCA 3PF3A 4JFTA 1WAWA 3CH0A 1UD3A 4GKLA 1OIMA 5CQ1A 2BGSA 4O54A 3FJLA 1HL8A 2Y6ZA 1WOAA 3IAPA 4FK9A 1AL7A 3QY8A 3N13A 3W1RA 2YB1A 5CKSA 3S42A 3H4WA 4H8HA 4IP5A 2VURA 2ZUVA 3RAOA 3NSMA 4IX2A 2OO6A 3F4VA 4Y9OA 1YPFA 2NWSA 3SW6A 3W37A 3LY0A 4OZOA 4HZ7A 5REQA 4PMDA 3FK4A 4QEHA 4GRSA 3J7HA 4QJ1A 3NAVA 4MB1A 3UR7A 2G3NA 3H7UA 2WZEA 9XIMA 2NUWA 2OMAA 1UWAA 4QCEA 3T78A 2PC8A 4KIEA 3UJ2A 3WFZA 1OWQA 1Z42A 3N15A 3UPMA 3CASA 1J5SA 2X0YA 3LZ5A 2QF8A 3DFHA 4JIIX 4EWJA 1LRTA 1FUYA 4D6IA 3AHYA 4GUIA 4WHBA 6TIMA 3CPUA 1VBHA 4XBJA 2GFTA 1VENA 1ONRA 3UEQA 2VQTA 3EA1A 1QK2A 1RR2A 2HRWA 2ZIDA 5KEZA 3W01A 4CVWA 1XHGA 1MDRA 1M7OA 1EO5A 1KXQA 1TQJA 3MSRA 3Q67A 5BXRA 4PEKA 2WPBA 2WO5A 3H2MA 3OBKA 3QMTA 1TVPA 3ARUA 3S2NA 2ZRXA 1B1YA 1OGBA 1TJRA 1TE6A 1KM3A 1JD7A 4A4AA 2Y0FA 2JFEX 2Z1SA 1TIMA 4H8UA 5G1MA 1GTEA 4M81A 1GVRA 2QVHA 4ZO9A 1F3XA 5D38A 1JXKA 2QKFA 3WQ5A 4BI7A 4O50A 5TQLA 4HPJA 2PDNA 3CEUA 3A4AA 1BXBA 1VLWA 1BPLB 3UWVA 1ICPA 4QDMA 3W1TA 3ABOA 1KD0A 1Q7ZA 1FKWA 3UVIA 1KWGA 3AYTA 1GVSA 2HMCA 2DP3A 1EA0A 4MG4A 3TWBA 4RE4A 4IX0A 2WKGA 3W7KA 3W7OA 3W7IA 2B7QA 1N8WA 1FHUA 4WVXA 2FTPA 3BLLA 3K8LA 1HKWA 4NNCA 2PU0A 2YA2A 3OYZA 2ZQ0A 3BLFA 3MHUA 4AU0A 3W26A 4MAZA 3LYEA 3BSHA 1DORA 3VA8A 1NOUA 3VCNA 1TUXA 1PVNA 4KIRA 3AHXA 1HUVA 1QNSA 1K6WA 1EDTA 5GVJA 2Y5SA 2O9OA 2GVGA 2JKPA 2X41A 3GRIA 4JQ2A 1YXDA 4GUJA 3TYCA 1MSSA 2WW5A 3T55A 4S3AA 4LUJA 3VC6A 1RSCA 4R5EA 4PMJA 3B8TA 2J9XA 3PSWA 4S3FA 5HUPA 3PNUA 1EJ7L 3O6YX 2GJNA 4MPKA 2H8XA 4GI8A 2QAPA 3N18A 3OW1A 3IRDA 1E73M 2NX9A 1RJRA 4IIFA 3RPMA 1REQA 1VBJA 2CBUA 2VX5A 2WM0A 3MSYA 3QW4B 1S1RA 3FGCB 3N73A 3VNLA 3CB3A 3GS6A 1V3JA 1XINA 4GC3A 2AL2A 3AZSA 1UKPA 1YDVA 4B16A 1Q5MA 1X97A 3P74A 3DG6A 2GSJA 3HB9A 3PULA 2H8ZA 3W1MA 4M7SA 1TPH1 1XSIA 4FHAA 4QS5A 1HJWA 2UY3A 5A2BA 1OX5A 4GACA 4C6OA 2QUUA 4FXFA 4CNOA 1Y5VA 2Z7GA 4QP0A 2C18A 3AS0A 1XRVA 3BANA 2WNQA 4AX7A 3T8QA 2RH9A 3QEZA 4YL2A 1DPMA 4RV3A 3ZS4A 1QI4A 5T9BG 3MHGA 4OU1A 3P0XA 5HR6A 3DX5A 2ZRZA 3FJNA 4QGCA 3REQA 1R30A 3EX1A 4UWMA 4M6UA 4WY0B 4F0HA 3BQ6A 1A3XA 4LUTB 3K5XA 4KWUA 1JYXA 1BTCA 1ZZMA 4X60A 4DZAA 2FMNA 3UBPC 1KR0A 4ZEPA 3UA4A 1CENA 1LLWA 3ARXA 4RK8A 1JZ5A 3UCDA 3WLLA 2XINA 1JZ7A 4RZ4A 5F7UA 3ARWA 1UROA 3VIFA 1XFBA 4L4OA 4MJMA 3CMFA 1EEPA 4CD8A 1KM4A 4P8VA 1G7VA 4C6BA 4AIBA 1CDGA 2WLYA 4KEZA 2XN0A 4JTLA 1EP2A 4BCEA 1L6FA 3AMGA 3KOYA 2VTFA 2GUBA 5AC5A 4DXKA 4PMQA 4LWWA 2ZUWA 4H9UA 1EOMA 1SQ7A 2NVCA 1L6SA 1DOSA 3FY1A 2Z6IA 3EOEA 3LCFA 3SCOA 3RCYA 4BHYA 1DQXA 4OV9A 1A5UA 1V4YA 3U48A 2CKSA 3WD0A 3KFTA 3T0AA 2QCMA 1XCWA 1DQWA 1NM9A 1VZWA 1J8VA 1NDYA 3FYYA 1ODUA 2NT0A 3W1PA 3GTHA 4CCDA 1JPHA 5IBXA 3MJMA 4D6DA 2D2JA 3TEVA 1SFSA 1QHZA 3W53A 2PWHA 3VFLA 4S23A 4GGHA 3BW3A 4LCSA 1R6WA 5LNRA 3LG3A 4ILSA 4L6HA 3ES8A 3NSXA 4D71A 3S9YA 3M0HA 5J5RA 3AC0A 1EX5A 3RRXA 4ZXOA 2BVWA 5C54A 1XYAA 1UR8A 3BO9A 4AD3A 1EPVA 4KWVA 4AZIA 2J7FA 3DC0A 4PRWA 1K7XA 3NA8A 2PZNA 1D3GA 2PE4A 1K02A 1S1PA 4PEEA 2BXVA 3VX1A 3KAOA 3AIWA 1O66A 4AEEA 2PDLA 5M3WA 3L4XA 2LLEA 4HPGA 1YBQB 1Q13A 5JBEA 4K8GA 1XQLA 2W27A 1NH6A 1OYAA 4O1AA 3G1FA 4TX6A 3NQFA 1RVKA 5DT7A 3A3XA 3CUZA 3WUBA 1JFHA 3DN5A 5D8ZA 3MI6A 4I8YA 2TAAA 4XSLA 2HDJA 3R1ZA 2W5FA 5E0KA 2XSBA 3NUKA 3P2VA 4U33A 3APYA 1ITCA 4HNNA 1A5CA 2A3LA 3N4AA 2NVDA 1TWWA 4AD5A 2G3JA 3LLFA 2BOGX 3IPWA 2IS7A 3OLEA 4JIEA 4E2OA 3BH4A 4PUWA 4BKNA 3C0SA 4DX3A 1GOIA 4NVTA 2VZSA 1AZ1A 3SJ3A 1LLZA 3N6HA 2D2OA 5T91A 1R85A 4K2SA 4C7FA 1E71M 3ARVA 1TUFA 1J2BA 1SVDA 4IGHA 5LZLA 5DEZA 5AVHA 1XIDA 3G77A 1IYXA 5FEWA 1R2TA 3TU9A 1T7LA 1BWLA 1RCXB 5CSSA 4D8ZA 3B3DA 4QNWA 2WJZA 1R3WA 1JCNA 3NURA 3LOTA 1ML1A 2F6UA 3HZ3A 2Q6ZA 1XH0A 1AW1A 3TYDA 2ESCA 2UWFA 3EX4A 1NDWA 1VC4A 2OFJA 3NR0A 4ASTA 1TYGA 4XUGA 1B3WA 3SCTA 3CNYA 3W2JA 2Z29A 1RP8A 4GJ1A 1NP0A 4HKPA 3UR8A 2XM2A 4UTMA 1LRQA 3LUTA 3KE0A 3MMTA 5I3JA 1BF6A 1CXFA 1XIIA 3M64A 3P82A 3URQA 4AVNA 3K46A 1S2WA 2BODX 2I56A 3THAA 4NSBA 1GORA 4XZIA 3NM3A 2PURA 4A3HA 5FJOA 4M6PA 1KFCA 4CN1A 4HU0A 3S83A 1VYSX 1E3ZA 4CGTA 4JCMA 1QNQA 2CPUA 1OINA 5FAGA 1FWEC 3I7QA 2P3EA 2G5WA 1ME8A 4FLOA 4GJJA 2XVGA 1KTNA 1EXPA 4AD4A 2E6YA 1JYVA 1V93A 1TWIA 1O12A 4P8XA 1EFZA 1QCWA 2F84A 1DWAM 2X16A 1E1CA 1HKKA 1PX4A 5HPOA 3TA9A 1M3UA 3DCPA 1GYNA 3U2OA 3FV9A 5JMUA 3KL3A 3AIUA 1IXQA 4UTKA 3VKCA 5K4XA 2NQLA 1OFOA 4BY3A 1OGGA 1T99A 1WUFA 2ZZ3A 3VK5A 3W7MA 1SW0A 3DI1A 2ALDA 1UUMA 3A4XA 1Q2SA 3MCNA 3E96A 3MP4A 3TTYA 3BURA 1B5TA 3ONBA 1TREA 3T42A 4Q8TA 4WZHA 1O5QA 2BS9A 4CQ9A 1JZ8A 4WIWA 5JVLA 5A2AA 5BWAA 2E77A 4AHOA 3CPRA 2VCCA 2ZXQA 3NTYA 1QNRA 4JTSA 5HNNA 3GDRA 5HQEA 2WHMA 4AZ6A 1VFLA 4BF9A 2R1KA 2Q02A 5AHEA 5XIAA 1RBOB 4UTWA 1K4GA 4UQBA 3MWAA 4IXXA 3BK0A 3PWGA 1FWJC 1P48A 2EKGA 4HCHA 1R2RA 4JIRA 1OFPA 2OB3A 1W1ZA 2YFOA 5T9CE 4ICNA 5LIWX 3M0MA 5E5CA 1QNOA 5AECA 3QQ1A 2GK1A 2MUCA 4GIAA 3M43A 1FFQA 1KQZA 3M07A 3L2LA 2PB1A 5EGRA 3UY7A 2QDDA 4D8AA 2HZGA 2WMGA 1RJQA 3WEOA 4YTTA 3P84A 5FEZA 4OKDA 3GTXA 2QS8A 1LL7A 5D09A 4PBGA 4F0RA 3LBMA 3CV1A 5DY3A 2PGWA 3W23A 4GNVA 4QS6A 3DYOA 4Y9NA 3TE9A 4FA3A 1IEXA 1UASA 1YE6A 1OK6A 2OJPA 2CZ5A 3TQKA 4GI9A 5KZDA 3VE7A 2DZVA 4N02A 4L80A 1R87A 3N6QA 3BGAA 1UQZA 1PZ0A 3BARA 3G1XA 4GWEA 3U2CA 3GY1A 3MCMA 1CYGA 5E93A 2WV8A 4DWDA 1ZBCA 4KFOA 4E8GA 1E43A 1M9HA 1PYFA 4I7UA 1J01A 2E3ZA 4XAYA 3ARQA 1E6QM 3CXOA 4HA4A 3HPZA 3QOMA 1J0YA 1O5RA 1OF8A 1BQGA 3NQEA 3AIVA 1CXHA 4JIHA 2EXOA 1IT8A 4TVCA 1PE1A 2YDRA 3TDFA 1VQTA 2Y7EA 3NQCA 1XLCA 2PSNA 4GZIA 5LA2A 3W84A 2ZDSA 1BGGA 1OC5A 3BZGA 4XZ9A 3RMEA 2GL5A 4PUKA 2CBIA 5A6JA 1KFWA 1TPC1 4KMQA 1XP3A 3IJQA 1XR2A 3WH6A 2D20A 4DIAA 5I02A 1NDZA 2EJ1A 3ABQA 3VYLA 1Q65A 3H2CA 4PCFA 4TX8A 4O1EA 1XJBA 3WQ4A 3LMYA 3VNZA 1REQB 4LV9A 2V82A 6PTDA 1XIEA 1V77A 1BYCA 1SUXA 3UCCA 1Z48A 4AF0B 2I7GA 3NXFA 4MPQA 4HB7A 3TX9A 1FP9A 2HNEA 2A3BA 5CZ0A 3LRMA 3CL7A 1YMYA 4N4QA 2ZTJA 3VKJA 4WSHA 2PP3A 2FMOA 1OSEA 1TV8A 3SUWA 5BRQA 4L9XA 2FJKA 2XVNA 1SYTA 3H2OA 3NQBA 3O0KA 5ECUA 7A3HA 5HNTA 1CNVA 1XKJA 3UWQA 1TV2A 4LAKA 3PBUA 4I7WA 4Q8UA 1OT1A 4D1JA 3STFA 1KXHA 3GU9A 4QR6A 3BXWA 3OVRA 2QQ6A 4FZIA 1JL8A 3RN6A 3F4NA 3O63A 3BLOA 3PTMA 3I6EA 4Q8QA 4JTCA 4QE1A 2QCNA 1V03A 3D5HA 4H8NA 1KO0A 3UYIA 2JKEA 1JVNA 2I5GA 2QVNA 7REQA 4DBEA 1UUOA 4GMEA 5FJRA 1GNXA 3WENA 1W32A 5D2TA 1GZGA 4HNUA 2BY1A 3WH5A 3DGBA 4PBFA 4WK9A 1W0MA 3BAYA 3QSRA 3SUTA 2I17A 4RPPA 5HNUA 2ZX7A 3ZIZA 3MV01 1VFSA 1N2VA 1EBHA 3N34A 4LANA 1ZSXA 2WC3A 3THDA 3O6DA 3EWDA 3AIQA 4H01A 1SFLA 2QDHA 3MVTA 2OO0A 2PDJA 4S3EA 5G4HC 4JQ3A 2ZX9A 3QM3A 5EFDA 1PPIA 4Q8NA 3A3WA 3FKRA 1IGSA 1C8QA 1V6WA 2AMXA 1W5QA 3H70A 3VE9A 1KM2A 4MUPA 4DHGA 2OGJA 4AMAA 4CQDA 3LCHA 1L9WA 3VIKA 3SRHA 1UR1A 3TQVA 2WSKA 4C65A 4TIMA 3T09A 3ABRA 3EGJA 3AUJA 3OJGA 3EB4A 5GJMA 2J9ZA 1A0EA 3TC7A 3LN3A 2DIEA 3WDHA 4C6EA 5FACA 1UD8A 3ZQ9A 4S3DA 3KOFA 1PKLA 3HN3A 2ACSA 1OYBA 3W83A 1Q6QA 4LU0A 2C13A 3EEGA 1QAPA 2DH2A 3BG9A 3M0ZA 3TW6A 3N04A 2F61A 3A3HA 1ELSA 1I2NA 1OCBA 1RA0A 1YPIA 2C16A 4C7GA 1EOKA 4S3GA 2OLAA 5EPDA 3PUDA 3S1VA 4TUFA 2QJIA 3HQ1A 4AZHA 2V3EA 3HBLA 1Q45A 4YTSA 2IQTA 2YBVA 2J78A 3W25A 1E56A 3BZJA 2GJLA 2B81A 4UMCA 2WSPA 2B7OA 2C0AA 2ZXDA 5BXPA 1L2UA 4GYPA 6ENLA 5I7GA 5M03A 1XLEA 1TRIA 4UTUA 3S2LA 3U57A 2VC5A 1EGMA 5BW6A 4DAFA 1VBGA 3UWUA 4CNTA 3ZJKA 3GFYA 1WOBA 1CXKA 3FA5A 2ASHA 4D1IA 3UR2A 1RY8A 1J0JA 4JEQA 3LRLA 3I3DA 3NCOA 1FCUA 1GJPA 4LS2A 3PP7A 4NAFB 2QGHA 2IPFA 4Z2LA 3CYJA 3WYZA 4HGXA 3T44A 1E6RA 4FMVA 2DUAA 4WKHA 3FSUA 2WWDA 3BGJA 1T8QA 1XIBA 2I1OA 3V35A 3LGDA 4H6KA 5ABGA 1MVYA 4PCTA 4BWLA 4K7VA 1J11A 2WMKA 3GDBA 4GH1A 3MS8A 4OOZA 1PJ9A 3U6WA 4XZWA 3QY7A 3AHZA 4CCEA 4O19A 1KLYA 4GBDA 3WNKA 3CIWA 1EGVA 5FSDC 3CHEA 4N9BA 3HG3A 1AMYA 2Z28A 3K1DA 1G9HA 3VFCA 2NV9A 1NY1A 4QITA 3FEMA 1A0CA 4JQ1A 1Q8AA 3I68A 2YXXA 5HNRA 3ZSSA 2BHZA 2PDPA 2FDMA 1E4MM 1AW2A 5U4NA 4LS1A 1VFOA 2NQJA 1PX8A 4B3LA 2VGBA 3KRUA 1W3LA 3GHTA 2A85A 4HK5A 1OCQA 5CGTA 1KBBA 2ZA1A 1AK5A 3IJ9A 1WKEA 4ML9A 4LAOA 4K1GA 2WAGA 4S1FA 1M68A 4KRTA 1W8SA 2ABBA 4WDTA 4MIMA 3EWBX 1H1NA 5DCBA 3EWXA 1LROA 2J7CA 2CLKA 3D3FA 3EDDA 2EHHA 4QAIA 3A5FA 3EAUA 1LOLA 4U28A 3LV5A 3TOYA 3NVTA 1GPWA 4F8XA 1UOKA 5DN1A 3I7SA 4FALA 1KXTA 4MB4A 4BZYA 1VFTA 1VCVA 1OZMA 3DG3A 1BWKA 1MW1A 3E12A 4LUIA 1XRFA 1DWGM 2D0HA 1E6SM 1QBAA 5GJNA 5E09A 1H1YA 4H9TA 4IIBA 1JZ2A 3E2RA 4US6A 4DJFC 4O0KA 2ZRYA 3S6OA 1MQRA 4L4MA 2WJEA 3NGFA 2GVJA 2B4GA 3PZNA 4ZOCA 3VDBA 4FEZA 4MWAB 2DIJA 2Z1BA 5RUBA 1W1PA 2IQ0A 3DBNA 3VC5A 3IEBA 1EP1A 1CTNA 1SO6A 4J1OA 4V1YA 2CLHA 3W6YA 4LX4A 1ZTVA 4LXFA 1IF2A 2FYMA 3EXSA 1G5AA 1B0IA 3W7RA 3WY1A 4KWWA 4IFKA 4GUHA 2EEXA 2DZTA 1Q6DA 5G4WA 1B4EA 5L6UA 4WUIA 5CLTA 1KCKA 3NZGA 3TJIA 3TA6A 2ZUUA 3ZLGA 1DL3A 1U1UA 4POCA 1HJXA 3VZZA 3H4GA 3UJSA 3DESA 1NARA 3I4KA 1SO4A 3WQVA 1Y5WA 4LGXA 2PDFA 4HNVA 1J0HA 4JD4A 2CLPA 3IARA 1W1B1 1W1IE 1VFUA 3PG9A 1C3FA 4TOQA 5MHBA 4RDWA 4LRTA 3PTKA 3KBMA 1JZ6A 2PDXA 4RXFA 3AMLA 3GFXA 4AZCA 4US5D 3WJXA 1F05A 1BYAA 3A64A 4GNKB 1UBPC 3PANA 2VHLA 2Z6JA 3VDHA 4R85A 4DYEA 4Z2HA 2GGEA 3JS3A 4JGDA 3CZJA 1ZP3A 3C0QA 1XLFA 1I0DA 3AS3A 4ZQPA 1SMAA 1HFBA 3U3HA 3EXRA 1XF0A 1W9UA 1VJSA 5EMKA 3KP1A 2GUUA 2V3FA 5DQPA 3UXAA 2AQWA 4FIQA 3ZMRA 3GTFA 4B5VA 3M0KA 2W62A 1FHDA 4OBRA 1GHRA 2VEPA 3SIZA 3SSJA 2C1IA 4HHHA 4GVIA 1JGIA 2PDGA 2KX9A 1S2UA 3ATZA 3S8HA 2WJDA 1IIHA 3SCVA 4R9XA 1Q4NX 3VMPA 4ZCWA 2ONEA 4CQCA 4AWUA 3IJ8A 1FKXA 5LA1A 3EB3A 2W6RA 1YRRA 2GSHA 2G41A 3TN6A 3WF1A 2VR4A 1FFRA 1US2A 5DXYA 1KC7A 5CZTA 2GJXA 4IICA 2D24A 3R94A 5K9CA 1CXLA 1G7UA 3RRAA 2DSVA 4LC6A 3GE7A 1D9EA 3CWOX 1I75A 4DWSD 3EOOA 3L7RA 1DE6A 5EU9A 1JI1A 4IQJA 2J8TA 3PHAA 3IJIA 3NZ1A 3TMLA 1BYDA 1ZS2A 2P0OA 3GIYA 2FVKA 2QIWA 4NYUA 4IG2A 3EA2A 3GO2A 3UXLA 1JNEA 1CI1A 3DH7A 2O0TA 4FLRA 4D6EA 2BZNA 1F4AA 1GQKA 4F9JA 4NJJA 1OGSA 1H7WA 2ZXBA 2FZ9A 2V69A 2X1RA 5FIPA 2D3LA 4Y8FA 5E9XA 3WLKX 3TV8A 5HK4A 1CCWB 4PZVA 4US5A 2PDMA 1DVJA 1UZHA 4LY8A 4HPXA 2PI6A 2DV0A 1KTBA 3P5ZA 2NZLA 2WMIA 3CUIA 2ZX5A 5AC6A 3LD5A 3LLXA 1TV3A 2OSWA 1A4MA 1A5OC 3E0WA 4GA8A 4A3RA 3DYMA 1QPQA 5ECVA 2OXNA 4EPEC 1C9DA 2E1DA 3CB8A 4I5XA 4L56A 1VCGA 2CFFA 4TQTA 4PC8A 5CG7A 3TCEA 2EG8A 5AHLA 4YLWA 5D30A 1MEHA 1QHOA 2VJXA 5JQ9A 2FVLA 2JEQA 2O4QA 2VP8A 2FIQA 3VNMA 1WCGA 2WB5A 1HNYA 6A3HA 5F2GA 3S9IA 2QMJA 1E0UA 2XWDA 5JIWA 3RJYA 4JKLA 3WH9A 4BJHA 7REQB 4FXRA 3VIPA 1LM1A 1AQ0A 4JIPA 4JX6A 4HU4A 1S38A 2WNWA 2WMJA 3DI0A 3EPNA 4JTDA 4M51A 2VFFA 4L6DA 4CEUC 2J27A 3VNIA 5A8NA 4MWAD 2Z1KA 3MBDA 2OLHA 4JX5A 3BSMA 3WQOA 1JUKA 1E15A 2D2GA 2OYLA 1G6CA 2O9RA 1VEPA 2RHGA 5LNSA 4IH3A 1FWSA 4NYYA 5DMYA 1MO0A 2OZ3A 3T07A 4IJRA 3VCRA 5D37A 1XWYA 4C6CA 1FCBA 4FX8A 5SWUA 1O1HA 3QY6A 4B2DD 2GJRA 2W63A 3N14A 5D9OA 1BYBA 3K13A 2J13A 3Q94A 3T4CA 4F4RA 1LG1A 3CQHA 4MJZA 1KXVA 3MQTA 4W7VA 3H53A 2JF6A 4PUMA 3IANA 4C6IA 1I9CB 1W9VA 1EC9A 1TR1A 1AH3A 2HK0A 3LGEA 5DO8A 2NSOA 5D2YA 4GQRA 3PZQA 3FSTA 5CGQA 1A80A 1LYXA 3P3BA 3GVQA 1PBGA 1YDYA 5AYXA 5TIMA 4MNKA 4WD0A 3FJ6A 5EMJA 3SUUA 4IMCA 3GUGA 3WLSA 4XVEA 4PH6A 3GVVA 1RUSA 1G94A 3WQ8A 1EGZA 1UB3A 1MXSA 3U2ZA 2VKZG 4WKAA 3DFTA 4M80A 1UWTA 5A94A 3F7JA 3SBFA 3N29A 3L68A 1QI5A 5BROA 3T2OA 3QVQA 1UIPA 3PK7A 4E4FA 5AN7A 4HA3A 3CHFA 5B7YA 3UZXA 3L4TA 4A29A 3OOQA 1OG0A 2DJXA 1T41A 1P0BA 2V38A 4DJED 3HGSA 4ZVJA 2DZXA 3O3RA 3KTXA 2OWWA 2VM8A 3K8KA 3LZ3A 5C5YA 5LIUX 4XK2A 2GPTA 1QI3A 3KRZA 4DBDA 2G97A 5I3DA 2PP1A 1U5VA 3V3WA 4HVXA 2VXNA 3DKLA 1T96A 3RNDA 4KT2A 3A22A 3T81A 3W1AA 2IPWA 3P5YA 3DFYA 3U4FA 1H09A 5FD0A 4C6LA 3KS6A 1W1VA 1V6YA 4U3CA 1G4SA 4KCWA 1XKYA 3LENA 4DUXA 3EXTA 5DBUA 1QMLA 1UOZA 4R7JA 2VFDA 3PPCA 2FZMA 3QXBA 3BLEA 1F3WA 3QR1A 4FOJA 3WQWA 1HKJA 1UYQA 2F9RA 3RDKA 5EYWA 2WC7A 3OLDA 2JGQA 4G6CA 3OIXA 1XLDA 4B2DA 3V1PA 5CBIA 1WZLA 2XSAA 5C9XA 3NEHA 5D04C 3KUMA 2P50A 3GR7A 3KL0A 4EE9A 4LBSA 4AXKA 1QT1A 3GDTA 5C9UA 1UUQA 2G3MA 3AHTA 2BG5A 1NJJA 1UMLA 5DCEA 1WDDA 3DAQA 1JFXA 4IMFA 1SJCA 4KETA 4NAEB 4H2CA 1G1YA 3AU6A 4XIAA 4L6OA 1G0CA 2DZSA 4GXMA 4URIA 4J7RA 3PZGA 1OM0A 3BW4A 3VAVA 1GOWA 3SSZA 1GVQA 2FZDA 3BOXA 4U2ZA 3NG3A 3U7BA 1B3ZA 1SR0A 4TTGA 3BAJA 4DF0A 4IP7A 1GQNA 2R8WA 2ZVRA 3NSNA 3G8RA 1XLHA 4HHMA 1JZ4A 1M1BA 3MU7A 4U31A 1CECA 4V15A 3VOGA 4FX6M 4LNCA 4PTXA 4GYFA 1OFBA 3VO0A 3H24A 4IPIA 3HV8A 3ZT5A 3L65A 3EB2A 4O16A 3GBDA 1A5NC 5JUVA 1ITQA 2BXYA 5AFDA 2PF0A 2XVPA 3M47A 3N9SA 4M82A 3L12A 3UNDA 4IGNA 2DUXA 2D69A 2HS6A 2O7SA 4JZ5A 2FHFA 4GYJA 2QJGA 5FOOA 1NOFA 2HVNA 3UWWA 3KCJA 1W3IA 4YMZA 4L4PA 3APTA 1J18A 3W1UA 3NL3A 4KQNA 1PTGA 1RY0A 4R3UA 4I5RA 2VEFA 1OK4A 3CV2A 3I3EA 2VGGA 3LPGA 3TW9A 5CBJA 2V8ZA 5LHFA 1JCYA 3WUEA 3FFSA 5EMUA 3E2VA 1QXLA 2EPOA 3SRKA 1IV8A 1J79A 1AQFA 3WDRA 2ZADA 1FHVA 1DIEA 2JQXA 2QCDB 1EIBA 3H7RA 4KS0A 1UC4A 3RM8A 3S3GA 4JTIA 3CUJA 2E5BA 1D3CA 1GGOA 1H7PA 1M53A 3Q45A 2GGGA 3FKKA 5CXPA 2EJAA 2H6RA 5K7JA 2ZVIA 1KGUA 5GJPA 1NWSA 2FGBA 1SR9A 3G1RA 2G3FA 1SFTA 3NYDA 1CWYA 3GH5A 3C61A 1XIJA 3GBEA 4IMGA 4YTQA 3AISA 4IFKB 3UG3A 4O4VA 4OTKA 5C7HA 3C3UA 3GLCA 1WV2A 4FOKA 2XIMA 4IFRA 4EXBA 2WZTA 2HQAA 3RLVA 1A49A 2XISA 1F8IA 3UJEA 3S6TA 1SPQA 2AKZA 1RH9A 2I9UA 1SO3A 1BKHA 2DH3A 1BSLA 5CC5A 4UNKA 2AGKA 3I3BA 3KBJA 4JBRA 5K4ZA 1TO3A 1TFVA 4X2RA 4GFSA 5GQBA 4IQEA 2VDHA 1HKMA 1A5KC 4AHQA 1PCWA 2ZKMX 1L8PA 3DENA 1Q6OA 3QFEA 4S2CA 1HW6A 4BA0A 1QTWA 4IJBA 3R25A 1X8CA 5BZAA 4EK7A 2XZ9A 4PL2A 2XDFA 1FXQA 1TMQA 1NP2A 3CTTA 4XVDA 4TMCA 4G7EB 4J2PA 4MY8A 1SM9A 3AYRA 2DUZA 1TIWA 5HQLA 5CPSA 4X61A 5A6BA 4AUBA 5A1AA 1PIGA 1DWJM 1ITUA 4GCAA 3WBAA 2VFHA 1XC4A 4HZ6A 2CYGA 1XD0A 3NL2A 4GYKA 3UYCA 4LVAA 1JGMA 5AOUA 4B90A 5G2HA 2XVLA 5CZKA 3M0YA 1OVDA 4Z42C 1LUCA 2QV5A 3MBFA 3EDJA 4RPQA 1ZFJA 4BI5A 1UP3A 1OFDA 2R9RA 1BGAA 1DP0A 3N6JA 4MJ4A 4F2TA 1HIZA 2J7EA 3S46A 3E6EA 4D72A 2BHYA 1W5MA 4ERGA 4GQ0A 1C7SA 4OWGA 5ABFB 4KF1A 1TPEA 1I2OA 3PPGA 1IE7C 5E6YA 3VD4A 1F3TA 2ZCGA 4Y96A 3M7WA 2C71A 4HA1A 1P0NA 4K39A 3WNMA 1TR9A 2VT0A 3RG6A 1H5YA 3R43A 4OT7A 5HMDA 5JBFA 1IEVA 3G24A 1J5TA 3QQ0A 3GD6A 3WUGA 1DJNA 3QMRA 1CT5A 3SQLA 2Q3RA 1WDRA 1AVAA 3BCFA 2Y7DA 2B7NA 4AYSA 4E8CA 1H51A 2YCLB 4AY7A 4RNHA 2PLCA 4IG2B 1G4EA 2Z2AA 3O6AA 1IWAA 4CNNA 3FAXA 2ZUMA 4Q8PA 3CZKA 1NF0A 1TKKA 1WDWA 4JQAA 3TLLA 1C29A 4Z1AA 1UH4A 2WLZA 4E5TA 4JDBA 1AFSA 3UQNA 2VEIA 2NQ5A 3KTCA 2YLAA 1S2VA 5EFFA 1TRDA 2PLKA 1A3HA 2CZDA 1V0NA 4UB9A 1H63A 5M2FX 1JXJA 3KLKA 4GIYA 3ES7A 1YQ2A 1P0KA 2INFA 2OZTA 3TC3A 1XSJA 4MNJA 1HN1A 4WDUA 1V0MA 1EIXA 4I8DA 3UWYA 3QLDA 1FWCC 2WMIB 1ONXA 4EXAA 4KERA 2BTMA 1W6TA 2YZ5A 4ZODA 3H21A 2WK2A 5FCZA 1PB0A 2QW5A 4PB3A 2J66A 2VGFA 3N17A 4M6VA 3E49A 1UR4A 3IUIA 1SZEA 4EIVA 5HXMA 1Q6EA 4UZUA 4B5UA 3I4EA 3QH2A 3QYQA 1GOXA 4HU3A 4LCRA 3C2OA 3S0CA 2C15A 2I14A 4F48A 4LF1A 4LF2A 1TX0A 1XLLA 2BVDA 1GT8A 5G2WA 1GTHA 1ODZA 1PKNA 1XBZA 4XB3A 3ID7A 1ISYA 3URBA 3W85A 2CHRA 3W87A 2XH0A 2Y85A 2C0HA 5IBXC 1S5MA 5BOFA 3RJXA 4IL0A 4GIEA 1W91A 1S2CA 4DM2A 3MPGA 1EC7A 1ZJBA 1LL4A 1R2SA 3VOJA 1E5NA 4IPNB 3WDPP 3V0UA 1H0GA 1FWFC 3QSTA 4JEJA 1GJWA 3M41A 3QYSA 1TJPA 4XISA 3CL6A 3EEZA 3QOKA 5AKQA 4HU8A 3CZEA 2BHUA 2ODOA 1O68A 3V5CA 1P6BA 2XG9A 3QW3A 3RM9A 4QLJA 4O1CA 1XRSA 2Z1VA 2J7HA 3USZA 3GYCA 3QHMA 3EWYA 3W1NA 3LSBA 3B9NA 1DEDA 4ZTXA 4PE8A 3OLIA 4O13A 2A2IA 4CQ8A 4HMEA 4IIDA 2P3ZA 3PTDA 1US0A 3L5AA 1JPMA 2WCGA 4ERIA 3DC8A 3SR7A 3W02A 4XKYA 2VEGA 1OD8A 1ZNNA 1VIZA 3AAMA 1M6JA 4JL1A 2NV1A 4PA8A 4GKTA 2ISWA 3WLNA 2DZAA 3R0DA 4C1NB 1V79A 1ICSA 4IL2A 3HM7A 4EAYA 3WFLA 1Q6GA 3CZLA 4AISA 2R82A 4YVXA 2Y89A 1K9EA 2XN2A 3HU7A 3IK2A 1FX6A 3WF4A 1V3LA 3LM3A 3AICA 4H3DA 3SB0A 2HTMA 4Q3MA 1AG1O 2VWSA 4JTUA 3VTRA 3T0DA 4RCXA 4A6GA 3OA3A 4UOJA 3WJSA 3MY9A 4QXIA 3F4WA 2VYOA 1B9ZA 2V5LA 5E1QA 3TROA 2O92A 2XYLA 4IT1A 4O10A 2HISA 3CUGA 1XX1A 2W0UA 2CLFA 1QO2A 2KAUC 3S1UA 1QOPA 2WSYA 3SDOA 4GUGA 2VEKA 2INEA 4LAUA 3N3TA 4XD5A 3G3MA 3KXQA 2Z7KA 3O9NA 4C6QA 1QI0A 1RQHA 1UZDA 3R6IA 2ALRA 4JDYA 2EG7A 4D6HA 5HULA 3F5KA 3FHAA 3PZ9A 3EBVA 4WR3A 3KW3A 3BC9A 4MFDA 1ZBKA 1CLKA 1PDZA 2J6VA 3ZJ8A 4GHRA 1OC7A 2EPKX 2Y5JA 1VPXA 4PSPA 3Q58A 5AVNA 2PBOA 3BCJA 8A3HA 1A5SA 1P7TB 3B03A 1XG4A 2YL6A 4UUIA 1W2VA 4J3ZA 4O1DA 1N8IA 2V5CA 4DXVA 3UCQA 3QC3A 1H1ZA 2D22A 4NUWA 2UBPC 4IQLA 2WHLA 3TFCA 3HGRA 4NF7A 4YCPA 1XLJA 3ABZA 5CSYA 3TH6A 1B30A 4X22A 2VUYA 5E70A 3SIMA 3NQAA 4HK7A 4ZFMA 4AYGA 3NGJA 2Z25A 1W3NA 3TTEA 4B91A 1H0IA 4RKAA 5I79A 2KZHA 1O5XA 4UNLA 4MADA 3WQPA 2NUXA 1BG4A 5IXEA 3G22A 2Z1WA 5C2CA 2HPMA 1AH0A 1W1TA 1J10A 4AW7A 3W1LA 4R9OA 2PBGA 4KWSA 4OHQA 5J04A 3IRSA 2PU1A 2JE8A 1MMFA 5F4SA 2A4AA 3WNNA 4ZXLA 2WKJA 3HPFA 1DJZA 3PN8A 2YYTA 3C2VA 2Y62A 1DJIA 2PODA 1VBRA 1MQQA 3STEA 4NZCA 2ZRVA 3IJ6A 1XLBA 3LU2A 4IUGA 5A5WA 1Q6LA 4PTWA 3TR2A 1FXPA 4M24A 3TJLA 5E0CA 1GVYA 4C91A 3BJSA 4FP1A 5CPOA 1OABA 4IIGA 3WQEA 5K2ZA 1BEUA 2OX4A 2VC9A 1LRNA 4FR6A 3W1QA 3WEMA 1W37A 3W2LA 3A13A 3GZAA 3PZOA 2NSXA 4JFUA 3WLQA 4LALA 3UT0A 3ISIX 2XFYA 1KV8A 3FVMA 3C56A 4M5PA 4EPBC 1A5MC 3LXBA 1F7BA 4N42A 3E38A 3O15A 3MSDA 1TZZA 3FVDA 4H4IA 3ELFA 2AKMA 4W7WA 3CYVA 2Y5EA 5H6HA 1DJXA 1O1ZA 1UZ1A 3AMKA 3T6CA 4DAIA 2Y24A 4UTWC 1XQKA 5PTDA 3MYPA 4G1NA 3THUA 1X98A 4W87A 4Z1DA 2Q8ZA 3VNDA 3GK0A 1GKRA 3N2CA 4GJIA 1WDPA 1G4TA 3DDMA 4XUYA 1MW2A 4DXXA 2PP0A 2HROA 1Q6CA 1OHLA 3H2NA 4HNLA 2EF9A 3TMQA 3R8HA 3HURA 1GZ1A 4UTJA 3QV6A 1JPKA 4GNJA 1YNQA 4YWIA 1MNZA 3N19B 4DI8A 2PTWA 1E6PA 4W5UA 1Z8AA 3HMCA 4Q6XA 1NFGA 3CQIA 1SMDA 2ABAA 3JVAA 4QISA 2DSUA 1V02E 1ZJIA 4XSMA 3LK6A 4MLRA 3UZZA 4JQ4A 3MMWA 3C5QA 3BGGA 3PBYA 4MZ8A 4NZ4A 2VDIA 5IDZA 1JCJA 3G6MA 1L6YA 2WM1A 4J3XA 2CEQA 1W5NA 1XLKA 2OELA 2ZE3A 4AY1A 3K4AA 1IXPA 3Q2DA 5GPRA 4H6RA 2VZTA 3PJWA 4ORMA 4U2YA 4EX4A 1IT7A 3AOFA 3E02A 1O5KA 3W2NA 2WQPA 3IIVA 4PBEA 5DELA 4X2PA 2POZA 1N82A 3VGFA 4JNZA 2WBGA 2GSEA 3RLUA 4HNOA 3S2CA 3BAWA 1YE4A 3KBWA 1WNOA 2WQDA 3PUEA 3ZZ1A 3N1AA 2PLMA 2DT3A 4AY8A 3C2EA 3CAWA 3KM8A 3KHJA 1HKIA 2A7RA 5AHIA 4N9EA 4RNJA 4NKCA 1LUCB 3CQ0A 1KBLA 4KCVA 1PTDA 4MY9A 1IXNA 3IGSA 2TODA 4FSAA 4M6QA 1KR1A 3PTQA 1YW1A 4N7QA 2OOGA 3UESA 3VOCA 5CPMA 1QK0A 4PMVA 4ZE5A 2E5DA 5I77A 1B90A 2BDQA 3VUSA 2Y61A 3CT7A 1PUDA 3WQCA 3GAYA 4JN7A 1XG3A 2PGEA 1J6OA 1ZP4A 4EACA 2VQUA 5KZEA 3H6OA 5DY2A 1L8NA 2BSLA 5D2VA 2HPIA 2CITA 3QQWA 4BQ3A 3SN0A 5CPQA 1F07A 3DU0A 1DJQA 4LEQA 4DJDA 3RYSA 1RK5A 3KP0A 5E9AA 4A8IA 4O1BA 3EMZA 2XH2A 1Q4WA 3KDOA 4MYXA 4QE5A 2XH4A 4Y2WA 3WO8A 8RUCA 1R46A 3LV6A 1UHVA 4YYFA 4OECA 4HZMA 3WCZA 2A0NA 5D2WA 4G5DA 2PRHA 3W6LA 1IGWA 3OZMA 4HP5A 1B3YA 1WKFA 1YPXA 3F1QA 3W73A 3LHWA 3M6DA 1J4EA 2XU2A 3B06A 3GIQA 3HFYA 2VVNA 5AHNA 2FHBA 2QJNA 4UOQA 1WP6A 1W9DM 2YDAA 4BR1A 3CLMA 4YNGA 3WQDA 4EPDC 2TMDA 3GYEA 3UPBA 4XBSA 2VR5A 4WRHA 1M7PA 1YNPA 1UQYA 1ZHAA 5I78A 4UQCA 4N6EA 1E4NA 2O9PA 4Q7NA 4ZQMA 4CCZA 4JKKA 4L9ZA 2EKCA 3UZJA 4RE3A 4F2BA 1OD0A 2V2DA 3C52A 1I45A 3THQA 4F3HA 4MLJA 2GJPA 2E40A 2BBFA 3LHUA 4RZ5A 5D05A 5ABTA 3LBOA 3B8UA 4Y9AA 2EG6A 2QCCA 4CD6A 3OQ8A 1FP8A 1HL2A 4HOXA 4CNSA 2VRQA 3T2QA 3NJ3A 2VR2A 2J62A 1I6NA 3D3AA 1RLCL 4AVFA 1RD5A 1O95A 2QR6A 4Z2GA 1W9PA 3QRHA 1QPOA 4H1ZA 5HINA 1NEYA 3L21A 3LPPA 2C6QA 3WSUA 2QXWA 3EOLA 5MKGA 4Q6JA 1B3OA 2A7NA 4B9YA 3SCNA 1XYZA 5EMYA 4GX8A 1PCKA 3W24A 3W1XA 4UTTA 2OKTA 3LXCA 4FO4A 4RE0A 2VX4A 1ITXA 3I65A 4W5ZA 3ICJA 3GNRA 5C2GA 3G6LA 1UKTA 3NWRA 4B5TA 1IT0A 4FPSA 1FH7A 2YKKA 4I6VA 4LOCA 4M56A 2ZZ6A 1XGDA 1O7AA 2ISFA 3L4ZA 4DBUA 3LB0A 3OZOA 1U1HA 3DGRA 2YCJA 4I5UA 3PM6A 4ZOAA 4NI8A 3AO0A 2F6KA 1F6KA 2QNEA 3W70A 3QKZA 2O4MA 1EJSC 1RCOB 3GDLA 4DEFA 2CXEA 1DTNA 2YCEA 3NPUA 5CSUA 4GFIA 3R11A 1MXDA 4RXGA 1WZMA 3DHFA 1TVLA 4GYPC 6REQA 3T08A 4R7OA 3VKAA 2RGMA 2G37A 1LJYA 1LWHA 3OVGA 3AMDA 3K1GA 2A21A 2GGHA 1NIUA 1JYWA 1MRQA 3R7MA 4REQA 5BOOA 4UNIA 3S1XA 1R9YA 4C7DA 1XDLA 3VGHA 2ATSA 3AZRA 3A12A 3TJXA 1E6ZA 2ZOXA 4GXWA 3PZIA 4P61A 2WCSA 3DXIA 3R8RA 1TPFA 1VD6A 4HHLA 2P88A 3RMJA 1QPRA 1SJBA 4H9VA 2PDCA 1DBTA 4AD0A 2OPJA 4DPPA 5I2UA 1M01A 3L66A 4BWLC 1F2JA 4DI9A 1QOQA 1WO2A 3CAQA 4UC5A 3EX3A 4JYEA 5FEXA 2C8NA 2VRKA 4V27A 1FWAC 1XSKA 3TYAA 4H04A 3E1F1 3PUOA 1JR1A 1OFAA 3W4RA 1UA7A 3WD4A 4A8RA 4JY9A 2O9TA 2XIIA 4F79A 1UJPA 3AALA 4GZ7A 3WLMA 5IDIA 3PAJA 1GOMA 2CBVA 1J0IA 2V68A 3W07A 1MFUA 2E6AA 5CEWA 3IUDA 3NDYA 5D8WA 1NU5A 1OX4B 1EA9C 2DT0A 1UWSA 3B9AA 4LJ3A 2QEZA 3F5LA 4GVHA 1GCYA 3CQJA 2Y7GA 3PJXA 1P1XA 1W3HA 3L4WA 2DSWA 4JHZA 4KCTA 1TA3B 2P8CA 3S5ZA 1UWQA 1E0TA 1XXXA 2PCQA 2PC4A 2XIBA 4NJHA 1DIOA 1ZRQA 1GOOA 1KFKA 3TUUA 3BV7A 1C8XA 1DXFA 1VGAA 3VD7A 3BJTA 2PDHA 1R7AA 3BLIA 4NRSA 1WDSA 2Y8UA 4BFAA 4Q33A 1K6AA 4JS3A 2Y8VA 4BQ5A 4MNLA 5KTLA 2DSKA 2Y7FA 2O56A 3NO3A 4ROQA 2A7PA 4QFUA 2W66A 4ADTA 2PTZA 4CNUA 4HN4A 3D47A 5KMYA 3PR2A 3P6LA 4FF7A 3C0LA 1QW7A 4FOUA 4OIFA 3RFAA 1Z32X 1FWBC 2F8QA 3AWOA 2YYUA 3OBAA 1G67A 3W38A 4PUEA 5D32A 4FS9A 3STGA 2HE8A 1FHLA 2L5HA 4Z08A 1WB0A 1FWGC 3ITLA 2XFWA 2E9LA 1H2JA 5M5DA 3ZR5A 3W7NA 1P0EA 1ME7A 2PF8A 3Q37A 4GXPA 5HUOA 3TC6A 1EJWC 7TIMA 1KCZA 1X1OA 1TTJA 3IAQA 3E0LA 4DJFD 3IVSA 3UXDA 4UQDA 3GUWA 3IIPA 2J9YA 4Q7BA 2CLMA 4WOQA 1BXCA 3CT2A 1BVZA 4GBUA 4UZSA 4JL2A 1M7JA 4Z2JA 1P4CA 2P53A 3RO8A 1VRXA 3WX7A 2CLOA 3NOYA 3CHDA 7TAAA 3F4DA 3FYOA 3VILA 3VX0A 2JKAA 4Q8OA 1W56A 2C14A 4XO6A 5IHSA 5DXXA 3NOEA 3MO7A 3AXHA 2IMRA 3PZUA 4PMRA 5HANA 2YXGA 1R38A 2E6DA 1D3HA 2OZ8A 2GQAA 1C90A 1JRBA 4LVFA 1UKSA 1I1WA 3TW7A 1GHSA 2YBUA 3OZPA 3UJRA 1Z69A 1ZUAX 5HMFA 4GO9A 3RLGA 3L23A 1CXIA 3WLPA 1WAUA 1GW9A 3MB9A 2GVEA 4HBKA 2ZUTA 3A23A 4NASA 1E72M 2PA6A 4GLEA 1GZJA 2B0MA 3ANVA 2GQ9A 4OJYA 3D6NA 3E2QA 2CBJA 4LS0A 2PFHA 4AHPA 4K36A 1SZFA 2C79A 3H26A 1V7YA 4LT9A 3C6CA 2CLEA 1AJ0A 4O15A 2ISVA 4P5UA 5LGXA 3B0VC 1RJPA 1RBLA 5BXSA 4LYRA 4QG9A 2NXGA 3S6DA 3GIPA 2ISSA 4Y9PA 4H9XA 1I4NA 1RBAA 2VMFA 1FVPA 3WLRA 3SCQA 2OCZA 3PVFA 2H90A 1W9BM 2X2GA 3M4HA 3KVLA 3DKJA 2HV5A 4LPCA 4L1WA 1TV7A 2YX0A 3CIVA 1EYEA 1ZLPA 1R3SA 2BY0A 4P7NA 1V0LA 4UCGA 3MUAA 1EWEA 4PTMA 1OIFA 3A6OA 4GINA 1TSIA 3LCLA 3U4AA 4PMUA 2UY4A 4PTVA 3ZXWA 1MUMA 3V0TA 1GYLA 1FWRA 2VUNA 3LLDA 5BXTA 3VUPA 3AFBA 2HBXA 3QZ6A 4GISA 2AGTA 1P5BA 3ZYZA 4GH3A 3AJ7A 3G1HA 2OT0A 1RVGA 2E1WA 3NL6A 2BVTA 3NM1A 2BGQA 4MWAE 4QROA 3UD6A 4LNYA 4A2RA 1Q3NA 3I6TA 1KWKA 3UPWA 5LIKX 3QPZA 1GVIA 5AYBA 1JNDA 4OBTA 1XLGA 4Q4KA 2IKJA 3SFWA 1TWDA 5CH9A 4AAJA 1GG0A 2CHOA 3G0XA 4IWWA 2NX1A 3UR5A 3QFWA 3VOFA 4R34A 4UFHA 3LQLA 3MI2A 5A6SA 2E8ZA 3GB6A 4PSRA 4ML4A 1DYSA 1A3WA 3CAKA 4RLIA 4ATDA 3BG5A 3P93A 4BF5A 4KGJA 1UD4A 3W7PA 2BLEA 4GOAA 1WX0A 1ZPTA 3URAA 2IKIA 3WMSA 1BXNA 3GNPA 3P60A 3GKFA 1UW9A 4HK6A 3UP8A 4YXGA 4V2XA 3WK3A 4E4PA 2NQZA 4H7ZA 1OBAA 4WJ8A 4N9DA 3ITTA 4IF2A 5AZ0A 3KWXA 1JCLA 1Q6FA 5FESA 2OU4A 2ZWZA 3B9DA 3N3MA 4ADSA 3TQPA 3WBWA 1ISXA 3P8JA 3GNDA 1PAMA 4PODA 4PN2A 2BV9A 1X7FA 5D9NA 1UPMB 2EPHA 4GABA 1R8LA 4QIUA 3LBCA 4DPQA 1VPYA 2V63A 3EX2A 1FWNA 3CWNA 1EXBA 1WA3A 2PTXA 5E0FA 3AS1A 4HYVA 1LF1A 3SGZA 3ZJ6A 9CGTA 5HOSA 1E5JA 3BUVA 4NT0A 3BE7A 4XZNX 4LVGA 4AZBA 1W3KA 4NP7A 2CKRA 1F3EA 3COTA 3MJYA 1C91A 4H7VA 1XD1A 3VGDA 3KOWA 3ITVA 1YX1A 5REQB 5HDRA 3SY1A 3QGKC 1H50A 4AB4A 2BFGA 1YKWA 1MNSA 1ENUA 1FWHC 1W5OA 5I3KA 2GVYA 3P62A 1T40A 1FY6A 1R47A 5H91A 1ICQA 4I9MA 5U7SA 3MMDA 4CCCA 5AC8A 5TBOA 3FGCA 4O28A 3T1GA 3WF0A 4BS0A 3V5OA 2DVTA 4A2SA 2XGBA 2VZUA 1VKFA 1NWTA 3VMOA 2PRMA 4W4QA 1ZAIA 2VD9A 3ALGA 3R10A 2WZIA 1HG3A 2F7FA 1U33A 5GNXA 1DJWA 3TJ4A 1GPFA 3B8VA 1IR1A 3NXLA 3ABXA 1D7KA 3WJYA 3EWWA 4MF4A 3QBUA 5M17A 4DF1A 2DW7A 3GHSA 2W3ZA 4PMZA 4G2DA 3F2DA 3GG8A 3ARYA 1XIGA 3MTWA 4FNQA 4J3WA 1M04A 2ZZ7A 2PTDA 1GQJA 2GDQA 3GR8A 4ENLA 3MW7A 5D9MA 1EBGA 3AXMA 4D6FA 2J8GA 5BMXA 2NT1A 2WSQA 1OZQA 4WY0A 5HJLA 1X6NA 3FA3A 1OYCA 5C6MA 2E6FA 4PMYA 2ICSA 4NG3A 1B2YA 4R88A 4CU8A 4OBSA 1UR2A 3HPSA 1CGWA 2WNNA 6REQB 2WZHA 3BL3A 4HIBA 3RR4A 1EF3A 1WE5A 4EOUA 4KEMA 4REQB 2FLIA 1NAL1 4INFA 3W7EA 4C6KA 2OWCA 1TE1A 1R3YA 4ZE4A 5I6SA 3BLDA 5CC7A 4O12A 1HX0A 5A6LA 3O0FA 4CVUA 3GXDA 2XWEA 1RK6A 2CWXA 2XH7A 1DKWA 1E9IA 4RL3A 2QDEA 2XM1A 2Q3OA 3L5LA 3DEQA 2W92A 5C9WA 4W88A 4S3JA 3SEPA 6ALDA 3W29A 5BU9A 4DYKA 1QU4A 1E55A 1VCFA 4LUYA 3SGUA 2XSXA 3EMQA 4ORIA 1NTHA 2P5NA 3GWQA 3EWUA 1LCOA 4XWUA 5EB8A 3IJ7A 4E6MA 4B4FA 1P6WA 1S5NA 2HE5A 1ZAHA 3H8AA 3NQ6A 4NI3A 4D6GA 3V7PA 4ZSTA 1EUNA 5F4WA 1TJ2A 1TCDA 1YTKA 2DIKA 2AL2B 3CMGA 2X7VA 3U7VA 4S38A 4G1KA 1C92A 8XIMA 4I9JA 3QN3A 3U8GA 4L1GA 1E4IA 2Y88A 3WK2A 2ATMA 5KINA 1Z44A 1UWUA 3P14A 4UXDA 1TCMA 3SY8A 1GONA 1ZGDA 3OTRA 3RCNA 3INPA 3W74A 1K03A 1OJXA 4BK9A 1HO1A 4DF2A 2Z27A 3W22A 4ZR8A 1LG2A 2WSRA 3G1VA 2INZA 5C0QA 6CGTA 1H7XA 2X1SA 3JR2A 3ARRA 3HIJA 3QJAA 2FH6A 3IJLA 3REQB 3T7VA 3VNKA 4UBPC 4LBUA 1X1ZA 1YBQA 1W17A 4YTUA 4IQDA 3MANA 5LNUA 2FJUB 1HJUA 5EY5A 3GX9A 3CQKA 3MT1A 2W91A 4CD7A 5DANA 5A8QA 4JTQA 3TZFA 2VC7A 5AYYA 1FRBA 3VU2A 5D2XA 1GK8A 1A4LA 1IQ8A 2DGAA 3PWAA 2QZRA 4KFNA 5CJNA 3O8AA 1SSDA 1ZQ5A 3W00A 2QJHA 4ZA0A 1E70M 1M65A 3M46A 1KKRA 3OODA 1LQAA 3ZVIA 2UY5A 1XS2A 3LSCA 1JCTA 3TLQA 4NJIA 2REQA 4QAWA 5BRBA 3QC0A 1Q7MA 2OEKA 1MDLA 2NV2A 3N9RA 3NQ8A 4PCNA 1R3VA 4KFPA 2FPTA 1GQLA 2ZBTA 3O05A 4DVOA 3TXVA 5C71A 4UCFA 2TRSA 3LI1A 3WNOA 1S5TA 3C8NA 3A4JA 2MNRA 2IKGA 4NRRA 5HA7A 2I5QA 4HYRA 2QPXA 1V02A 1JEZA 1K1DA 4JNYA 1KM6A 2BWGA 2NWRA 1IZCA 3W7LA 3SFKA 5I24A 1KNWA 1U83A 4PTDA 4Q8MA 4HMCA 4LV4A 4H7CA 3IGHX 4HMDA 3QZEA 3GC5A 2B31A 2X1UA 3VNJA 1K4HA 2E5CA 1GVEA 2VCAA 1O6IA 2YZRA 3G3DA 1KCXA 1EZ2A 4JTRA 4FXSA 4Q8WA 1FWTA 1YDNA 2CXGA 3FHQA 4WKFA 4AWTA 4QG8A 5FAJA 4J28A 1HZYA 4LRSA 1X1NA 4PMOA 2A3CA 4ZSUA 2C3ZA 1MRAA 3MO4A 1DQUA 3ZVHA 1DV7A 2QULA 3TTSA 5LHEA 1J96A 2SFPA 5G5IA 2BOEX 2R91A 5H8PA 1XYCA 2C1HA 4GIRA 3EMCA 2ZWYA 4Q32A 4U5IA 1TMHA 4RNIA 3WD3A 4Z0JA 3V18A 1VFMA 3SADA 2V5DA 4NILA 1CB7B 5LNVA 3GZ3A 1JD9A 4MZ1A 4C90A 2V81A 1PIIA 2WJFA 4MSSA 4HMNA 5LIXX 1R7OA 1ZENA 5HMEA 2D0FA 3B0XA 3MUY1 2PDYA 4HNTA 4JXCA 4O1FA 1EH9A 4EF9A 3NDZA 3GVGA 2FZBA 5AYZA 2AOSA 3V36A 4K3ZA 4GPNA 3MC5A 3SCSA 1PWMA 2OGYA 3ONCA 5ABEA 3GTIA 3LGGA 1MEIA 4ZTYA 4M0XA 8TIMA 1N7KA 3VIMA 2Y1HA 2EPNA 1JPIA 2QJMA 5F2IA 3THCA 3PFRA 4HA0A 5A6TC 3SCRA 3FA4A 1KB3A 4H9ZA 3MZNA 3MSGA 3W27A 2GQ8A 2DQXA 3ARZA 2W4XA 4Q4SA 3OQEA 3PFMA 1E4LA 3E0IA 1H61A 3B04A 3GVWA 3GM8A 4YJ5A 3S2MA 4NJKA 3WDQA 2VX7A 4IP4A 1ZB5A 1W9XA 1NF7A 4X0VA 4E8DA 2ZXAA 1E3XA 1D8WA 2DPEA 4ACYA 4O53A 2A3EA 1S2TA 1I0BA 1LBMA 4H83A 3QV9A 2FTWA 4X3ZA 3YPIA 2XTKA 4GCXA 4UFKA 4TO8A 1W3JA 3P0WA 3M1ZA 2ZRWA 2IXVA 1UCWA 5XIMA 1OCJA 2PDBA 3V1HA 1V3IA 2BP1A 5C55A 2IPGA 1W5PA 3GG7A 1YXCA 1LL6A 1E9LA 2YPIA 1W31A 1H5VA 5IOBA 1YLVA 2XPKA 2FKPA 3JW7A 3QR0A 1GKPA 2DFAA 4GI6A 1F8MA 3RX2A 3AJXA 3AZTA 3M7SA 3B0PA 3N9KA 3V0SA 5FJPA 4ZQRA 3RGTA 2X1TA 4I9AA 4UIOA 5IRPA 3TYZA 2UY2A 3VMNA 5CAHA 2ZZ1A 4I3GA 1A5AA 3WUFA 4QSHA 1RAKA 2BB0A 2A3AA 4PYSA 4QHRA 4FX7A 1TJ1A 4W7UA 1H41A 3IIOA 3K2GA 1DWIM 4KKXA 5DRCA 1ALDA 3MCOA 3PBGA 4N6FA 4J3VA 4JTEA 2VOMA 4EP8C 4HQVA 5T26A 1MYRA 2PAJA 4P8WA 3CH9A 3IV8A 2GYIA 2FPVA 2FVMA 2QCGA 3PBWA 1DJGA 2TSYA 1HGWA 4KW2A 4Q4PA 4J3SA 1E1CB 3W81A 2UZ9A 5CAKA 4PUUA 4L9YA 2QUMA 1ZCOA 3OEXA 1TVNA 4PUNA 1E40A 3F2BA 3L4UA 1UP2A 4W8LA 3S1WA 1JDAA 3KBVA 4LVBA 4Z1CA 3ZWTA 2FB2A 2VCBA 4N2YA 3OVQA 7ENLA 2BY3A 5CZSA 4ATWA 1JDCA 1Y65A 3TOPA 2V30A 1BKSA 2DVXA 3E74A 4OOUA 1POJA 3G1YA 5FEPA 1A5BA 3ITYA 1EL3A 1N8FA 4PB4A 3TR9A 4P2VA 3UG5A 4U3AA 1MZHA 3M5VA 1FWIC 1PKMA 2V3DA 4ACZA 1FQ0A 1WDQA 1KRMA 2QT3A 1QASA 4OVXA 1RPKA 2RDWA 1PWLA 1GKQA 5LNWA 4UR9A 5HPCA 1BG9A 4XQ6A 3T0CA 4AF0A 1SU5A 2BVYA 2ACQA 1TX2A 2R94A 3RX3A 4HHPA 5LGZA 5CPTA 1DJHA 3DECA 4ZO8A 3H2EA 1KTCA 2DEPA 2WBKA 4YHGA 2VZVA 3HQOA 3L9CA 3S4TA 2YW3A 2VZOA 2QMKA 3B0YA 5K9XA 4RR4A 1P0DA 4L5ZA 1EYWA 4YYCA 4W85A 3LQGA 4QCFA 5CLWA 2DQWA 1QWGA 2E4TA 3M0LA 2J75A 2GK1B 3M9YA 3TN3A 2CW6A 5JBDA 5CJMA 3WBEA 5AYIA 3I6RA 4GX9A 3NEVA 5C7VA 3RF9A 3QHOA 1V6VA 1WBHA 3A9BA 4WEVX 4NNBA 1GVFA 4OV4A 4YVVA 2VELA 4NIRA 1JYNA 4XX6A 2Y2WA 3M5XA 1LDCA 4OQVA 2ON3A 1DIDA 1S39A 4QM1A 1GUVA 2EQDA 2WC4A 3DFQA 4WGXA 2PS2A 1VH7A 2YSWA 2EBNA 1OX6A 1Y0EA 1IWPA 3EYPA 1E0WA 3PG8A 3T0BA 4O57A 3SAZA 1LQ2A 4U4MA 2E9MA 3S5SA 2BY2A 3TXZA 3BTNA 1TG7A 4PCPA 1V7AA 3NPXA 1QFEA 1XM3A 1WZAA 4WX2A 2GWNA 4YN5A 3QKEA 1ISZA 2OX1A 4DBWA 1JAEA 1TPUA 4J35A 4JYDA 2PDWA 1G01A 1I60A 3CJPA 5GNZA 1XDJA 3TSDA 4O0ZA 2FFCA 3HJEA 3NZQA 1YDOA 1S3TC 5FJUA 2GOKA 1WKYA 4MAVA 1KV5A 3GHUA 1BLIA 3PPFA 2J7BA 1Z41A 3WFAA 2G4JA 1VJIA 4GD0A 1UBSA 2Y8KA 1QPKA 1HL9A 4GGBA 1TZ7A 2YL9A 1SSGA 4LB4A 5HR7A 1MWOA 4PUJA 1JCMP 3FW6A 4LYPA 5IM51 1UP0A 4A3YA 1Y7VA 2GDVA 1FOBA 1HQTA 3GFZA 1F4HA 2RAGA 4RDVA 3MDWA 3LCIA 3SGGA 4F0KA 1XBXA 2BASA 3E2SA 5FSEC 5KZ6A 3P8IA 5CJ5A 2VI0A 4A3UA 3VIJA 1E51A 3WDIA 3IJDA 4CN6A 1E0XA 1V51A 4MZYA 2X7WA 3OIHA 3WN6A 3NVDA 4CQAA 3BW2A 5FJTA 3SZ8A 5FF0A 2ZYFA 2J7DA 1OB0A 5G1TA 3G0SA 2QV4A 5BMWA 4DM1A 3UG4A 2PDQA 2YOCA 4MOZA 4DYJA 1KGWA 4CUCA 3GXTA 3A47A 3HOJA 2V5BA 1OFQA 4DUWA 4GQBA 1NWUA 3W72A 5E6ZA 3LHZA 3P81A 3C2FA 4C5YA 2RGLA 3T0TA 2ZTKA 2YDSA 3VIGA 4JYFA 4L65A 3VABA 3STPA 2OSYA 3GAKA 4JFWA 3S1GA 1LOSA 5JU6A 1LZOA 3TAKA 4NZ3A 5LSMA 4QDPA 4NAFA 2DVUA 3WNLA 4QG6A 1BSIA 4R33A 2YGYA 1EKOA 1JDEA 3ARSA 3VZYA 3OA5A 3UGVA 1MFVA 1YADA 2Z26A 3KBNA 4GZJA 3CL8A 2GLKA 2YDQA 3OB8A 1HT6A 3QR3A 2REQB 2GGJA 1XGEA 4AWSA 3MKVA 1EJUC 4IMEA 1AMKA 4XV0A 1LBFA 4NQ1A 3WDJA 4DWSA 4NZ1A 3HFTA 3B4UA 1EJVC 2Y63A 4W93A 3QMSA 2NQ9A 3H7VA 2DU2A 1L6WA 2YCIX 3NQ7A 2CHNA 3EX6A 5CZJA 3EOSA 3WK1A 3EPOA 3ZJ7A 1HJSA 3NIYA 3KCOA 1CGVA 2RDTA 1AZ2A 1JF5A 4CLMA 2WHJA 4YWSA 3HMJG 1HO4A 1X8FA 4F66A 1QRQA 2NUYA 4WGHA 4ZB5A 1X38A 3W76A 1LBLA 5I03A 4B92A 1R5YA 5FF7A 4F0MA 4XAGA 1DWHM 2VX6A 4HOWA 4V1XA 3ZVHB 1NWRA 3R58A 3UERA 3P7YA 3SQSA 4CQBA 3AIBA 5DMLA 3FJ4A 4PMXA 1AQMA 1SO5A 3E5BA 3HF3A 1ZU8A 4K38A 4E4UA 4EANA 1R0MA 2BNJA 4QRNA 3HJZA 2XFFA 2J77A 4L1XA 3DFSA 1VYPX 2PGFA 3PB2A 3POHA 4PTNA 4CD5A 4DY1A 4FLQA 3HPXA 3UETA 2X0SA 5DCDA 4U10A 5DF0A 4E3TA 1K9FA 2P8BA 4EXQA 1ZBWA 1YEYA 1HP4A 1NELA 4L61A 5C9ZA 2VFEA 1WPCA 2X30A 1MQPA 2GGIA 4GY1A 2ACRA 3W2KA 7PTDA 2ZUSA 2OYMA 3ZM8A 1V6TA 2PGRA 2PCEA 3ORWA 1DIKA 2GOUA 3BMWA 3URNA 4K6AA 1XISA 4MWAA 1FCQA 4QDWA 5I5RA 1Z3NA 1EX1A 4C6FA 3G1AA 3BPWA 5FI8A 1PL9A 1TPDA 1R86A 3VXGA 1ZAJA 4QLLA 4H6QA 1EZWA 1PEZA 4KCUA 4G8TA 4O52A 3KS5A 3S2JA 3P61A 3EKLA 5HWJA 4JNMA 2FB3A 1FH9A 1PO9A 4C6MA 4PB5A 3VPLA 1R3RA 3D0CA 9XIAA 4DJDC 3BWWA 2HS8A 4M7TA 3GW0A 2ZDRA 4Q7IA 3RU6A 3CS2A 3ZO9A 3CV7A 3DUGA 3C2RA 1LOQA 4AZGA 4MTVA 1QW8A 4X9SA 3OBEA 3OU8A 5C9RA 4EF8A 3L2MA 4KRZA 1JRCA 2QIIA 4WOZA 4AXNA 3TN4A 2ZX6A 2AMGA 3GXNA 4ZOBA 3WMLA 1VF8A 5I00A 2QF7A 1V5XA 1SJAA 2IPJA 2IQDA 1TV5A 4K1WA 3W3OA 5A6KA 1UR0A 1U5HA 3PJUA 4B5XA 1XPYA 1OFEA 1KW1A 4UQEA 3GNXA 4V28A 1F74A 2HWGA 3BAKA 1RXOB 3UWEA 4F40A 4AC1X 1NFPA 3KRSA 4TTUA 4BQ4A 3WK0A 1CPUA 1H62A 3EDKA 2Q01A 3WG6A 1K8ZA 1WXJA 3IUHA 1H49A 3WLTA 3ZLHA 1UA3A 3UZYA 3TFXA 1K9DA 3G1DA 2CCRA 4B4HA 3MA8A 3W7QA 4Q4QA 1VLIA 3ITGA 3N11A 2QCFA 3ITXA 4JFSA 1ZJHA 1F9CA 1TWSA 3IGXA 4XD6A 3SECA 3WIJA 2F2HA 1THFD 1F6PA 3BMXA 4B5NA 3TQ0A 2PEVA 4S39A 1GWJA 4DJEA 4WDWA 2J7GA 3WJWA 2WPGA 5F1UA 2AL1A 8CGTA 1VPQA 2I5IA 3W0KA 4JFVA 3ANYA 3EA3A 4P7OA 5TF0A 4CNPA 1U30A 4O8RA 1MI3A 1P1MA 1YNYA 4X0NA 1K8XA 2PWEA 2V6AA 1JI2A 4IPJA 2IXUA 4DNHA 5JIPA 3VZXA 3PWIA 4TXEA 3W2MA 3BAIA 4NXSA 2G96A 3MI3A 2J8FA 1JDFA 1JUEA 3RPTA 2MANA 3GVRA 2CZEA 3E0FA 2WMFA 3S5OA 4UTTC 4JIQA 2W61A 4A22A 1TZ9A 3HQPA 3GU2A 4DO4A 4MFEA 3QGAC 4WSKA 1IR2A 1PIFA 1LWIA 4LUSA 3GDKA 4HCDA 3F4CA 1DJYA 1IEQA 2D2HA 4LH8A 4Z2IA 2V5JA 4E3VA 1KM5A