3A4AA

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 238
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3a4aA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4aA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3a4aA02
2VCAA 1QNOA 3AFBA 5A8OA 2YBTA 4DWSC 1NM9A 1PZ2A 1B30A 4D71A 5I24A 1C8XA 4BZYA 4WJXA 4CD7A 1W1TA 3T08A 4W87A 1J0JA 3GXMA 4ZENA 4D6JA 5C71A 4J3SA 2PWFA 2J79A 4NZJA 2ZWZA 1R33A 4W8AA 2CHNA 4EE9A 1XD1A 1JD7A 2ZOXA 3CLWA 2ZWYA 1BVNP 4F79A 5HPOA 2VC9A 4ATDA 1FFQA 2WHJA 3DYMA 3U57A 3WY2A 4FNQA 3WQ4A 2A3EA 6A3HA 3BC9A 2EQDA 1XSJA 4ATWA 2PWDA 1BYBA 5I3DA 2GJXB 1R34A 2EACA 2V3DA 3W53A 3QR3A 3GBDA 1W32A 1E0WA 3KL5A 4HZ6A 3BUIA 1CLVA 4J3VA 3VMNA 2YBUA 2CEQA 5HBFA 5E70A 4AIEA 3CUJA 3QHMA 1BFNA 3RJYA 3CMJA 1QVBA 1ISWA 1HVQA 3D50A 4XX6A 4AIUA 1JXKA 3U5UA 1PX8A 1FH7A 1GOWA 3VIOA 2WK2A 1L0PA 3U7BA 5GNYA 3S5YA 2WWCA 3NCOA 2QHAA 5LA2A 2JF7A 2J47A 1V03A 4MDOA 3VSVA 1E40A 2EPMX 1D7FA 2VT0A 3KEHA 3AQUA 4OUEA 4TTGA 1E73M 1GQJA 3G6LA 3AMGA 3A3HA 4IPNB 3OLDA 1VFFA 1FA2A 4BA0A 1ZJBA 3D4YA 4W8BA 4B9ZA 2W62A 1A47A 3L4YA 5EMYA 1KQZA 3EDKA 4CD4A 3LXAA 4IM4A 3VU2A 2XGBA 5AYBA 1EDQA 1ZBKA 2VZSA 3CH9A 2EPKX 2YDQA 1XYZA 2EPOA 5ECUA 2XPKA 3WDHA 3S5ZA 2VTFA 1J0ZA 4W5ZA 3LXCA 4UQCA 2E8ZA 1H2JA 2VUYA 3AIWA 4PTWA 3A23A 2PWHA 5DT5A 1ESWA 2VZVA 4AXNA 1FP9A 4HU0A 3WF3A 5HDRA 4K68A 1O6IA 4EK7A 3RMEA 2V38A 4W7UA 4R5EA 3W6LA 5CLWA 1V3JA 3DHUA 3PZMA 2FH8A 3BGAA 3WNNA 4GINA 1V3HA 2WHLA 3GXTA 2ZUNA 3ARVA 3TTSA 1H3GA 4PMYA 2WLYA 1E4NA 1UG6A 3W6MA 2FH6A 2CKRA 5IFPA 3CZEA 2J78A 2VX7A 1GQIA 4D6IA 4L4PA 3WUGA 1QX1A 4TVCA 3AXHA 4GKLA 1W1PA 3AMCA 4J28A 3AZTA 4OOZA 1UHVA 1L8NA 2YL5A 1WZKA 1C3FA 1VF8A 1HTYA 1B1YA 1J10A 4X0NA 4EAMA 5DFAA 3T0BA 1R87A 5ABHA 3CZSA 2VX5A 1UKSA 1W3KA 1IT0A 1QHZA 4JKLA 5A6BD 2GUYA 1UR2A 2BXYA 4DO6A 2CBVA 2VJXA 1UA3A 3SCUA 2DSVA 3SIMA 3SEPA 3TV8A 5D8WA 2J75A 2ZX8A 3WDIA 4PMRA 3K4AA 3SUSA 1JYXA 4C7FA 2EEXA 1UWUA 3LRKA 2ZUTA 1CENA 2D3LA 1JZ4A 5CG0A 2CESA 1AQMA 3VDHA 4PTMA 1RH9A 3GXPA 1K9FA 4ACZB 5HNNA 4AIOA 4QP0A 3OIHA 2G3JA 3BVTA 2ZUWA 2FGLA 4BQ4A 1FFRA 1LL6A 5JBDA 2OW7A 3S6TA 1CXEA 3WL0A 2W61A 4V2XA 1JD9A 3BUQA 3K8LA 2YKKA 1UD6A 3NSMA 5BXPA 3BVWA 2A3BA 4PMUA 1HJSA 3POCA 1V0NA 1W9DM 1W9VA 1K9DA 1GJWA 1HL9A 1XCWA 5EB8A 2YL6A 4U2ZA 4B3LA 1JFXA 1FHDA 2CYGA 1MQPA 3LRLA 3QGVA 4UZSA 2XSBA 1WZAA 3UCQA 1UR4A 4UCFA 1UKTA 2DQXA 3VGHA 3WNOA 3EJSA 3AMDA 1WO2A 1H11A 1JGIA 1JZ7A 3AMKA 1HNYA 5BWFA 1CIUA 7TAAA 2VR4A 1GZJA 4GO9A 1TQTA 2DSWA 4D6CA 2XGIA 3WSUA 1NARA 2IGTA 2FDMA 2E9LA 1H5VA 3PN8A 3WNKA 5A95A 1VFUA 1EIBA 2E9MA 1GHRA 3L4WA 1KQYA 2YIHA 2YLLA 3WQ6A 3WY1A 3A47A 1MW2A 1AQHA 4URIA 1ISXA 3EJUA 4QCEA 1QW9A 2WKGA 1BF2A 1I1XA 1UYQA 4AD3A 3OGSA 4E8CA 2EAEA 2EBNA 4CGTA 2J7GA 4PYSA 3B9EA 4W7VA 4GQRA 4AZBA 3GH7A 3WD0A 3A4XA 3WQWA 3CBWA 2VX6A 3VPLA 1NH6A 1P6WA 1UZ1A 3PZIA 3VIJA 8CGTA 1UD5A 3EBVA 4CD8A 1MQRA 2VZOA 5E6YA 3VD7A 3CO4A 3HU7A 5JUVA 4W86A 1UOKA 3VGEA 4TX6A 1XSKA 3WD3A 1W1YA 2XYLA 2C0HA 8A3HA 1VEOA 4W88A 2X0HA 2GJPA 1CXFA 1CTNA 5BRQA 2GJRA 1BG9A 3SCSA 1VFMA 3BUDA 2A3CA 2XHYA 3A24A 1WDSA 2Q8XA 3BAYA 1V02E 3NDYA 3CHDA 3AISA 1QNSA 3MUY1 3NDZA 1SYTA 2WSPA 2WMJA 2GJXA 1U30A 4UQEA 5BXSA 5FOOA 3UEQA 4MNLA 1PJ9A 3CUFA 4H8HA 3ZR6A 1WNOA 1WDQA 2EPLX 3TTYA 3NSXA 1UR9A 1V3KA 4HTYA 3WBAA 2XM1A 2J8GA 1OD8A 3RJXA 3CZGA 7A3HA 1EOMA 4HOZA 1E5JA 2RGLA 1EXPA 2WANA 2YDRA 2F1BA 1PX4A 2XWEA 2WYSA 3AHVA 1QI3A 3VO0A 1JXJA 1JNEA 3VD9A 4U2YA 1HJXA 3BAXA 1HT6A 3N9KA 4JFSA 1RD6A 1OGGA 3AS0A 3MMUA 3BAIA 2FHCA 1OSEA 3BAKA 3ZIZA 2D0FA 1AVAA 1ZJAA 4B9YA 4LGXA 2WSKA 3ALFA 3H55A 3VDBA 1UWRA 1DP0A 1LWHA 4M56A 4B16A 4WKFA 1NWSA 1C7TA 1B3YA 2VVNA 2J7BA 2WCGA 5DEZA 4NZFA 3FNDA 2XVNA 3WDPP 1VBUA 2JIEA 2XFYA 1UZ4A 5A69A 2CERA 1AQ0A 4PMNA 1MQQA 5AC4A 4WKHA 3ARUA 1EH9A 4RE2A 1J11A 2PI6A 3AZSA 3K8MA 4D1JA 4J7RA 3FY1A 5KEZA 3SCVA 3WQ8A 3CGTA 4S3KA 1WP6A 1E15A 4TVUA 3ZT6A 3MSDA 2WBKA 2F7QA 4UFHA 3L2MA 2WC3A 3AHZA 5EFDA 1V6UA 3WQ5A 1KTBA 1J12A 4AZIA 4TVDA 3F4VA 1LWJA 2QLYA 4DO5A 1HJQA 2D3NA 5EFFA 1SMAA 2DPEA 4AC1X 1CZ1A 3AS1A 4NRRA 2G3NA 5A8QA 3TOPA 1E3XA 5ABFA 1E1EA 3WDRA 2JEPA 4RL3A 1UKPA 4D6HA 3CHFA 2CKSA 1A3HA 2WKLA 3VGFA 1E9LA 4ZEPA 3KZSA 1E72M 2Z1SA 1KXTA 1KGUA 4CD6A 3NIYA 5I6SA 2YL9A 3ZSTA 1DWHM 3DHPA 2BHZA 1JYVA 1HXKA 4FF5A 4NRSA 3OGVA 3WUFA 5CSYA 2WCAA 1US2A 3GH5A 3UR8A 4AZCB 3ZMRA 4HA4A 1TMQA 1MFUA 4UNIA 3L4UA 5ABGA 1TVPA 3FHAA 4OIFA 3WH7A 4CVUA 4R27A 4XV0A 4DWSD 3OBAA 3BUPA 1HJWA 4ACZA 3ZJ6A 3PBGA 3HG3A 3S2CA 3BMVA 5A8NA 5A6AA 3VINA 4WKAA 1JZ2A 3BSHA 1CYGA 3MO4A 2BNJA 1GNXA 4OZOA 5I5RA 2WVVB 3OG2A 3MV11 3VGDA 4RE3A 2OYKA 4UTFA 1UH3A 2V3FA 4LYPA 4AD4A 4J3UA 1AMYA 3N04A 4MNJA 3AXIA 5A6LA 1GOOA 2CNCA 1QNRA 3PZGA 2XUCA 4PMXA 3VSUA 1E71M 2ZIDA 4H41A 3OA5A 4PMOA 1JDAA 2AAAA 4MB3A 3POHA 3GYCA 2X09A 3H54A 1R75A 3SUWA 3VM5A 4W93A 3GXFA 1KXHA 4NI3A 3HG4A 1GQLA 3CPUA 3G6MA 1EGZA 1HKIA 3WMBA 1PBGA 4HA1A 4YN5A 1UWQA 4FK9A 3W0KA 3RCNA 2F7OA 1OBAA 1CDGA 3L2LA 1ZBVA 3NJ3A 4D72A 4HU8A 3OLIA 3WDQA 5AY7A 2OLHA 1KGXA 1V6YA 3FAWA 3VIGA 5LYRA 1UH4A 2DT0A 1BYCA 4PMVA 5HOSA 2EADA 3UR7A 1E6QM 4GZJA 4U3AA 3PZUA 1UWIA 1FHLA 1KR0A 2Y4SA 1TQWA 4B15A 3ZT5A 1YQ2A 3SCRA 5FKYA 2W91A 1VFOA 1K9EA 4ZE5A 2C8NA 1TA3B 1U2YA 1HP5A 3IJ8A 4MNKA 1US3A 3O6AA 4AW7A 1BYAA 1J9YA 2DT3A 4W5UA 3M6DA 1GOKA 2ZX7A 1XYFA 5D4YA 1V02A 3VIHA 1XH1A 1EQCA 1UKQA 1XSIA 4QFUA 4M29A 5GPRA 3DX1A 4FLRA 1TE1A 1KFWA 3QOKA 4HOWA 3VIPA 2CIPA 4LYRA 4Z2LA 5CJ5A 1O7AA 2DT1A 1V3MA 4H2CA 3VIMA 5I77A 2OSYA 4A3YA 1KWKA 5I0DA 2JF6A 1BPLB 1D2KA 3B9AA 2YFOA 1E6PA 1EO7A 1VEPA 4C7DA 3K4DA 3AS3A 1RPKA 1R46A 2J25A 4YHGA 3D51A 1GOQA 1C91A 1Q4NX 4DM2A 1IZKA 4U33A 4PEEA 3TTOA 6CGTA 3DDFA 1LQ0A 3ZQ9A 3T0AA 3ZT7A 3BLKA 1ZB5A 2XM2A 3NSNA 1GQKA 2ALWA 1BTCA 2VI0A 4NF7A 3UESA 2E0PA 4HMDA 1V08A 5AC5A 4BF7A 1CLXA 3K8KA 1NP0A 4W89A 1NOUA 4HZ7A 5EBAA 2CITA 1W3LA 1HKJA 4PUEA 2VQTA 3VNYA 4LX4A 3TA9A 5A2CA 4FLSA 1HN1A 4C7GA 3CIVA 1HP4A 4Z2GA 3LXBA 3LMYA 4WSJA 4H8UA 5C8BB 4MB1A 3LX9A 5I23A 3RM9A 5JBEA 4KMQA 3UG5A 4AWEA 4UFMA 2WWDA 2RGMA 3MV01 4UQ9A 2WVUA 4J3TA 4H04A 4MJ4A 3TONA 2WMKA 5ABFB 2VRJA 3VTRA 3VD4A 3PZTA 2Y8VA 4P8XA 3ZM8A 4KH2A 3AHXA 1E70M 1UR8A 3HN3A 4RE4A 3MSGA 3F5KA 2XG9A 1VENA 4TXEA 1E1FA 1B31A 1W9PA 4QLLA 2JALA 3NUKA 3WUEA 2D1ZA 3CZNA 1KBBA 3WBEA 2AMGA 3F5LA 3WFZA 3GNRA 4PMDA 4UFIA 5E9AA 2G8ZA 4D6FA 3KWXA 3WUBA 1CGTA 5BCAA 1VBRA 2HVMA 1G01A 2PB1A 2QMKA 3ALGA 3A22A 1JZ3A 1KB3A 2FHFA 3AZRA 1E6ZA 4AYGA 2JIWA 1GHSA 1W9XA 1ISYA 3VDCA 2XWDA 3BSGA 4FMVA 1G0CA 1HXJA 4E4PA 4UFKA 3I3BA 3D3AA 1BHGA 1PIGA 4JZ5A 1ZBCA 1OIMA 4P7RA 1B3ZA 4OJYA 1BGGA 1PZ3A 4TUFA 4UOJA 2BVTA 1WDRA 5A6JA 3IJ7A 1WKYA 1XRVA 3IAQA 1B2YA 1UUQA 2VOTA 1GVYA 5CQ1A 2NW0A 1W2VA 2BXZA 2GSJA 4AZCA 4PTXA 3CTTA 2W5FA 3CZKA 1EDTA 4FNRA 2WHMA 4U5IA 4F9JA 4N0RA 2VX4A 1MW3A 2UY4A 9CGTA 1E5NA 4AMCA 3HMCA 3CV5A 4B3KA 3GH4A 4WLCA 2DSUA 4OKDA 1QW8A 1KR1A 3AIQA 4JIEA 2J7EA 3FAXA 3K1DA 2E40A 3ZJ8A 2OSXA 2WVVA 2VMFA 1EA9C 4TOQA 3SCNA 2WMIA 5C70A 1GONA 1JAKA 2WMFA 1JF5A 2X05A 4LYQA 1FOBA 4M80A 1JZ8A 1C93A 3WH6A 1W3JA 2F2HA 1FH9A 1H49A 1M04A 2X2YA 1Q6EA 4DM1A 2CCRA 2E9BA 4M24A 3VDAA 2YJQA 1E43A 3ARPA 5E6ZA 1VEMA 1Y7VA 1QI2A 2DT2A 4PUDA 2XN0A 4BQ2A 1ODUA 2UY5A 3AIRA 4ZE4A 2FE0A 4GI6A 4A4AA 2FHBA 1MXGA 1OINA 5LA0A 4GI9A 4AZHA 4YHEA 1DWJM 2ZXAA 3F5JA 3THDA 2W92A 3L4VA 1B3XA 1B3WA 3MU7A 4CD5A 2CPUA 2BY2A 4GQQA 2ZX5A 3UETA 3WFLA 4JFWA 1UWSA 3PTKA 1HKKA 3UERA 3W37A 1R47A 3ARQA 5M03A 4IPLA 2V5CA 3WD2A 1QWUA 4XZBA 3WD1A 2F8QA 3D52A 1J0KA 1U33A 2UWFA 1CECA 1ZU8A 3MUAA 4PRWA 2F7RA 4V27A 2G4FA 5BXRA 3WY4A 3BLBA 3VILA 2PF0A 3AYRA 2WXDM 3I3EA 2Z1KA 2XJ7A 5GQBA 3WF0A 4GZEA 1TA3A 2D22A 4UFJA 4WF7A 2WAGA 1DHKA 2O92A 5I78A 4FNPA 2J7CA 2YDSA 3RO8A 1VRXA 1VIWA 1BGAA 1CNVA 1FP8A 3VVGA 2X8RA 1C7SA 1XH2A 3WEZA 2OYLA 2XVGA 3BMWA 3WQVA 1C8YA 4AZ7A 5DO8A 1V6WA 5AYIA 1MYRA 1Q6CA 1NWTA 5FD0A 4CCDA 4GZIA 1G5AA 1XC6A 2ZUVA 4UQAA 4U5KA 1OB0A 4OOUA 1VB9A 4HPGA 3UG3A 2UY2A 1ISZA 2DIJA 2VQUA 1QBAA 3AJ7A 3FXYA 4M8UA 1X6NA 5KZ6A 2CHOA 4Z2JA 1H0GA 2E3ZA 3VNZA 3BLPX 5BXTA 1LJYA 1OD0A 1UQYA 1QI5A 4CVWA 4GPNA 2XFRA 1UASA 5D9PA 4DO4A 3OZPA 3CHCA 2BFGA 3QHOA 4CN6A 3EJTA 3M07A 2EJ1A 3AIBA 3APGA 3PZOA 4JCMA 1NOWA 3VUPA 1ECEA 3BUBA 5E0FA 4JHOA 4GO8A 4CCCA 2BY0A 3DC0A 1WZLA 1JZ6A 1W9UA 4X9YA 5JBFA 2EO7A 1H0IA 1JIBA 1BG4A 2YLAA 2DH2A 1TQVA 1BAGA 2W63A 4AYSA 4MB4A 3AI0A 3AIUA 1EHNA 4M81A 3SCWA 4BCEA 3SCQA 3H53A 2BY1A 5E1QA 4FNTA 4CCEA 3WEMA 2J77A 3SCPA 4V28A 3A6OA 5A6MA 3CUGA 2E4TA 1UR1A 1QNPA 1X6LA 1XHGA 2V3GA 4E2OA 3AXXA 5D9NA 3VSTA 5JIWA 4JFVA 1Q6GA 2WC4A 2Y2WA 1PX3A 4QDMA 2PC8A 3WENA 4CN4A 3II1A 3WNLA 1J01A 4H8VA 3MS8A 3EMQA 4WSKA 1QNQA 3KL3A 3WMSA 3WIJA 3W25A 2FGZA 2IXVA 2BHUA 2X2HA 5IFTA 3ZO9A 2XTKA 1CEOA 3CC1A 2VZUA 1NWRA 4BS0A 4TTUA 1W91A 4HMEA 3KE0A 3TTQA 1WE5A 4Z2KA 5A2BA 4JAWA 1QPKA 1UD4A 3N18A 4PTVA 2GDVA 4LQ1A 4P7LA 1WB0A 1JNDA 3IK2A 1CPUA 1SMDA 1ITCA 1E6NA 2MANA 2ZUSA 3BH4A 3W24A 3GZAA 4CUCA 1CGUA 3IANA 2D20A 3DX3A 3SCOA 4J3XA 1IV8A 1GOMA 4DUWA 1QBBA 4FNUA 2PBOA 1YHTA 4LXFA 2CBUA 3AYSA 1XCXA 4P7NA 4ZXOA 3ZJ7A 5IXEA 1GUVA 3CUIA 1I75A 3MMWA 1XGZA 2E8YA 1JDDA 4HOXA 2GK1B 3LPFA 5FIPA 3D5HA 2DIEA 2X0YA 3WMCA 1W9BM 4UQDA 3L4ZA 2WMIB 5I2UA 2ZXQA 5JIPA 1OT1A 1JFHA 1KCKA 1TZ7A 1GVIA 4HMCA 2IUZA 2W4XA 2WHKA 3VX1A 3PTMA 2VRQA 2ZX6A 2VRKA 1B0IA 1WAWA 4M1RA 3LRMA 3KLKA 4YPJA 5A94A 3K46A 2F18A 3A21A 1SZNA 3MKKA 3KL0A 2O9PA 5FL1A 3CUHA 2DH3A 2X2JA 3ARTA 3WD4A 3BAWA 1LLOA 4TX8A 1NP2A 2ZXDA 1OM0A 2XVLA 1OGBA 1ZL1A 4J27A 1W1VA 3PZVA 2VVSA 4FLQA 3WNPA 4JKMA 3ZSSA 3VMPA 1CWYA 3WH8A 1CGVA 3GTNA 2CBIA 2G3IA 1X1NA 1XH0A 1JYWA 2CBJA 4MAZA 1CXIA 3J7HA 4IUGA 3LPPA 3ECQA 3D4ZA 2CETA 3OLEA 1VJZA 3WNMA 3N17A 4AD5A 1PEZA 3GNPA 3EJRA 2EABA 2J74A 4QAWA 3UG4A 3CZ8A 1QHPA 2OW6A 3N1AA 4DWSA 2YFNA 4UZUA 3PHAA 1SR0A 3W4RA 4DUVA 1KTCA 3VX0A 1HWWA 4UOQA 3VD5A 1QI4A 2OSWA 2F7PA 1UQZA 4AY1A 5FL0A 1H09A 4BQ5A 1GORA 2J4GA 1JDCA 2WLZA 3AOFA 2ESCA 1WDPA 1VAHA 3T09A 2QF8A 2XIBA 1ITXA 4ACYA 3WEOA 1BLIA 3N12A 5CZKA 1CXLA 5M5DA 2OWCA 1SFSA 2JE8A 1PAMA 1XV8A 3DX2A 1GW1A 3QHNA 2NSXA 1ODZA 5A6SA 1UD8A 3L4XA 1E55A 5CXPA 1E6RA 3HG5A 4A3HA 3M46A 3WDJA 3AMLA 1OCQA 4HP5A 2FYVA 3WELA 4HPHA 2Y8KA 1JYNA 1O7DC 3AHTA 3IGUA 2AOSA 2BVYA 3N13A 1HJVA 4AZ5A 4E8DA 3BCDA 4AEFA 3WY3A 2O9OA 2G41A 2WZHA 1E4MM 4ML4A 3EJQA 2J8FA 1HIZA 4AD1A 3B9DA 2VZTA 2BY3A 3GXDA 4OBSA 4CU6A 3RILA 3SCTA 2J62A 4F66A 1UR0A 2BV9A 3ARYA 4FLOA 3ARXA 4JFTA 1EDGA 4PMQA 4CU7A 3SUVA 5LA1A 3EDEA 4D6DA 4EANA 2B31A 1MVYA 2D0GA 1E0XA 1QOXA 4L4OA 1JG9A 1MWOA 2IXUA 5CSUA 4HZ8A 2O9TA 5A3HA 2D2OA 3VIKA 3EDDA 3EMZA 4NZCA 3PTQA 2VO5A 3W82A 3BXWA 2D73A 3VIIA 3AS2A 2F1AA 3EMCA 1MW0A 5D9MA 4D6GA 5CGTA 1NQ6A 1T0OA 3OGRA 1B9ZA 1NWUA 1BSIA 4KGJA 2WCSA 4ZXLA 4XUYA 2ZUMA 1GCYA 1CGXA 3MI6A 4FNSA 1LG1A 5GNXA 3AICA 3WH5A 1V3IA 5HPCA 4MJ2A 1R7OA 3PZNA 4U31A 3PZ9A 2WW5A 3VOCA 5FCZA 1WCGA 1LG2A 5E0CA 1JL8A 2GDUA 1MW1A 1F4AA 3BCFA 2WM0A 2D24A 4Z2IA 3W81A 4P8WA 3MMDA 1CGWA 4OBRA 5F7UA 4S3JA 3GBEA 3ARZA 2O9RA 1OT2A 2J7HA 2WC7A 3SUUA 4MPKA 2C7FA 4PBGA 4UFLA 5BRPA 3DDGA 5M3WA 1F4HA 2WNWA 5M17A 1G94A 4MAVA 1LL4A 3O9NA 3W29A 2EPNA 3RM8A 1KGWA 2WZEA 3DX0A 2DGAA 4P8UA 1E4LA 5DMYA 1H41A 1C92A 2WVSA 4DUXA 1HJUA 2VR5A 1OGSA 1KBKA 3T0DA 2W67A 4P7OA 2QMJA 2BHYA 3BAJA 1LL7A 3EDJA 2WBGA 2WB5A 1UD2A 4P7QA 1ZS2A 3VGBA 4JL2A 1C90A 3CMGA 1JAEA 2ZUUA 4WIWA 2D23A 2GVYA 2GK1A 1QWNA 3OLGA 4X0VA 2J7DA 1G1YA 4GIAA 3RPMA 4QCFA 2X2IA 3ZR5A 1UWTA 3GXNA 4GI8A 1M53A 2WVTA 1GOIA 3EYPA 4F8XA 3WH9A 4JHZA 6TAAA 3HG2A 1UH2A 1QHOA 2BVDA 3T2QA 4D6EA 5A6BA 1MFVA 1E0VA 2PWGA 1R86A 2A3AA 3M7SA 1B90A 1E6XM 3MUIA 2VURA 5CPSA 1DEDA 1HX0A 1IZJA 1EHAA 4D1IA 3VIFA 1BQCA 1D3CA 4DWSB 1GPFA 4W84A 4KRTA 4ATLA 4J3WA 1CXKA 3A4AA 2A3HA 3GM8A 5BYWA 1W2PA 3CZJA 4W7WA 2PBGA 2JFEX 2Y5EA 2XVPA 1TQUA 5D9OA 3SUTA 2QPSA 1V0MA 1HF6A 4AEEA 1NOFA 3OB8A 2XVKA 3RIKA 2XN1A 3ZOAA 5GNZA 2XFFA 1Q6FA 2DEPA 4JKKA 4AD2A 2YL8A 4MNMA 3MUZ1 3AROA 1UD3A 1TR1A 4PMZA 4XB3A 2DDXA 2XN2A 3WF4A 1OIFA 4NX0A 4KWUA 3WF2A 3VGGA 3HZ3A 3W26A 3BVXA 2YA1A 4W8LA 5A2AA 4AMXA 4W85A 3VMOA 2X1IA 3ARWA 5HXMA 4KGLA 2VL4A 4CN1A 4MB5A 4Y7EA 2UY3A 3N15A 1B3VA 1VJSA 1GJUA 1CBGA 1K6AA 1EO5A 2XSAA 5A8PA 1PIFA 4IISA 1KXQA 4JL1A 4JCLA 4MTVA 1TG7A 4Q7NA 2NT0A 1E6SM 3DYPA 1R7AA 3B8SA 3WL1A 5BROA 3DECA 3A4WA 2OYMA 3W38A 1CGYA 3FW6A 1TFVA 2BS9A 3OZOA 3LPOA 4PCSA 5A8MA 4UR9A 4Q22A 3T2PA 1J0YA 1Q6DA 4CKQA 1DWFM 1M03A 3ZJKA 4AD0A 1K9TA 1N82A 1R85A 5I79A 1S46A 4H7VA 4QLJA 1PS3A 4XZWA 1J0IA 1HKMA 3DX4A 4M82A 2ZX9A 1RP9A 4PSPA 2Y24A 5DT7A 1E4IA 4HA3A 1TQSA 1I1WA 3W27A 7CGTA 1DWIM 1KXVA 2VCCA 5IDIA 3RM4A 1UA7A 3KLLA 1DTUA 1TCMA 3QOMA 4AISA 3CHEA 3T2OA 3LPGA 1EOKA 3ARSA 2DSZA 1G9HA 3PZQA 3FN9A 1CXHA 4F9DA 4EKJA 2GFTA 5ABEA 2OWWA 2PWEA 4PSRA 3GDBA 5CPTA 3WKZA 1V6VA 2VCBA 2HISA 1R8LA 2OWXA 3E1F1 2QPUA 5IHSA 2G3MA 2TAAA 3A5VA 4AZ6A 1XD0A 3AIEA 2QV4A 4AMWA 2JEQA 2V3EA 1KWGA 5E09A 3EDFA 2YA2A 1V0LA 3IJ9A 1M7XA 3MANA 4GXPA 4WK9A 4NSBA 5IHRA 1TUXA 3AIVA 2D0HA 3N11A 3AHYA 4OGZA 3L4TA 1WPCA 1J18A 2XIIA 2W66A 1Z32X 2ZICA 1HVXA 1H4PA 3ARRA 2DSKA 1M01A 1DWAM 1TVNA 3WF1A 2YOCA 1OWQA 1H1NA 4KRUA 2WZIA 1QI0A 1DWGM 4UQBA 2EXOA 1FH8A 3CZLA 1V3LA 2F61A 3I3DA 1JF6A 5DF0A 1ZBWA 3VD3A 1J0HA 2CXGA 3BVVA 3VM7A 2ZE0A 4U3CA 5CGMA 5A6KA 3JUGA 3FHQA 4Z2HA 4P8VA 3EJPA 1E56A 5TD4A 2WMGA 3TP4A 3U7VA 1MXDA 3GNOA 4UOZA 4BQ3A 1KCLA 1ISVA 1RP8A 1C8QA 3W28A 2VNCA 2YA0A 5CLTA 1PPIA 4NXSA 1UKOA 3NYDA 1JI1A 1HL8A 3BVUA 1W3HA 4MDPA 4JFUA 3VKKA 1BVZA 3RDKA 3SURA 2ZXBA 1LF1A 4CU8A 1JZ5A 5D8ZA 3WN6A 1V0KA 2WMHA 4PN2A 4QLKA 3U5YA 2NT1A 4MADA 2WPGA 3THCA 3HJEA 4PCTA 4NXKA 3IAPA 1WZMA 3O2LA 1JI2A 5A1AA 4AZGA 1E3ZA 1V6XA 4N42A 4ZFMA 3GXIA 1EQPA 3DYOA 2J7FA 2V5DA 5CPQA 4LPCA 1BYDA
chains in the Genus database with same CATH superfamily
4G42B 5F2GA 1K70A 1DEEA 1KCXA 4BV1A 4ADTA 3CDZA 2PXYB 1H5BA 3O63A 5DZOA 4NZJA 4EE9A 1GSMA 2YN3A 4LBRA 4WIQA 5HHMD 2WXJA 3HC4H 3BG5A 3RFZA 3U0PA 3I9IA 1TTIA 3FQUB 5A2LH 4JFYA 3MA9H 4FNQA 3OPSA 2WAQA 5C0CA 4EZLA 4LGSB 5I3DA 2HFFA 1PYWB 1CLOL 5CF3A 3QAZB 2CO1A 1QQDB 3UTZA 2WJ5A 4UI2A 1AI1L 4X6CA 5AZ2L 1IVTA 2FQEA 4WW1B 4Q6KA 4M7KH 4EN2A 2NXHA 1BQ5A 3SBRA 2JF7A 5DC9B 3AWNA 2EPMX 4PV9A 4J8QA 4OUEA 5L4FA 4A7SA 4BA0A 3L3JA 4R2GD 4PLKC 2QCGA 3W0WD 1FLRL 4PYGA 2APXA 4CD4A 4AUBA 3QUXA 3F84A 1XYZA 2EPOA 2VTFA 5KAQF 3ABKB 5I1JL 1VRSA 4HU0A 1KYDA 4Z3JA 5EYWA 4QISA 2YB4A 1LOLA 4S0TD 1UYWL 5K9QI 3V0SA 4NUJB 3ARVA 3E80A 4PGBA 4PJGA 3R94A 5E00B 1PYMA 3BK0A 1XH3A 1D9KA 4KVCL 4D6IA 4LP4A 1MZHA 2EDFA 3OAYH 2VDKB 2CDFA 2WZ5A 1Q9OA 4PJFE 2GTWA 3M17A 3UX9B 2I5QA 5TDOA 3PLYA 1KPRB 2BSRA 5A7EA 4IIGA 2ARWA 1IT0A 3AUVA 1GMIA 1KLGA 3A9IA 2IV8A 4BQCA 2NX9A 2JJWA 2XN9A 3QPKA 4HWZB 4EBQL 3G6JF 2HT4C 3SUSA 3EBAA 2PO6D 1OCWH 3DVNA 3RL2B 1CENA 3RX7A 4N8CL 3MDUA 3PWGA 4BFIB 4BQ4A 4GYFA 1FFRA 4KY1H 3QV8A 4KVNL 5DZAA 4V2XA 4DEPB 4IX2A 1ICSA 4FF7A 5D2NA 1KFCA 1GJWA 3L3OA 1E28B 3E1ZA 1NDMB 3V2AR 1FHDA 5HANA 4ONFL 5KSVA 4UZSA 2D69A 2DQEL 1ZHAA 3DGDA 3VTMA 1QO2A 4B5EA 1KTJA 4XP9L 1PZCA 1CFNB 2EYTA 1WBZA 4WU7B 3V0AC 1KG0B 3KPSD 4OUUB 5EOCL 3SDDA 5JXQA 2QVIA 1SYSB 4M8QA 4MS8D 4MMYB 2YIHA 1AQHA 2MUCA 3QDMB 4K5OA 4QCEA 1HXMB 4ONGL 3KMDA 4JO4L 3B9EA 5F7KC 4K23L 4UAHA 5DUPH 3S8HA 4I77H 4REQA 4V1DD 4K3EH 4CD8A 4I9WE 4QRRB 4IBUA 4I90A 1Q9WA 4UV7H 5F1SA 3IUHA 1IC7L 4E2DA 2NY4D 4A2GA 2X44D 5EMMA 4RRPA 1TX2A 1CXFA 3GO1L 3SCSA 1OP4A 4KO5A 1GKEA 2HROA 4GRWH 2Q8XA 1IQDA 3QPXH 3QZWA 4IICA 3RK8A 4MNHB 4PFEA 1GGCL 1PJ9A 5IQ7L 5AVSB 3PNRB 1G43A 1FYTE 1OX4A 4JKWA 3HAEH 4HKZB 3V5HB 1DFBL 4NI8A 4LWWA 5DLLA 1B4EA 3ZHFA 4IQLA 1OM3H 3EOAA 1DP0A 3MLSL 5I0ZA 4P23D 2CERA 3MUCA 4WY7H 3QRFM 5AC4A 3DXAB 4OV5B 3Q5TA 2DQUH 4D1JA 3FY1A 4XVUD 1CE6B 4HCLA 3MVTA 4Q33A 2VERA 3C6LD 1MCIA 2TODA 4HNTA 4GAAA 2C1HA 2VN7A 5KZCD 4ORIA 4JFPA 1I8IA 1AJ7L 3I6GB 43CAB 1A4LA 3GRWA 2BNQD 4X8CA 1CD1A 3KZSA 4UTJA 4AK2A 2Z1SA 4XVSH 1UXSA 1H50A 4DGUA 1TVDA 3UC0H 4HS3B 3QHZL 4HWEL 4HXAL 1ASOA 3P7YA 3DMMC 3EJZC 3GFXA 2UUDK 2EIKB 4O18A 3O11B 4XD5A 3MRNA 3JXAA 2WCAA 3GH5A 3A6CL 3M16A 5BS0A 5CCZA 2DLFH 5DHYA 4OFDA 3TAOA 4MNQA 3QR2A 3CU1A 3VINA 4D94A 1ZCRA 1PF3A 3QS2A 4FNLH 3N34A 4D8PB 2WYZA 1GNXA 2H6PA 4I89A 4P9HL 4XCFL 1IHIA 5DLML 2Z28A 2J5LC 4XO3A 4G6ML 4LDLB 3SE6A 1GOOA 5KBPA 4AEOA 2OAAA 2OEMA 2GBTA 1S3KH 3X1GA 4N02A 4R8WH 3MRQA 3WLBA 2VLKA 1UM6H 4UT6L 2DUAA 3LZOA 3DEQA 4RDBA 3LZFH 1MEHA 4MQXC 1MRFH 3O15A 4EN3D 5H94B 1IB5A 2CD0A 4Y9CA 3M41A 4LUSB 4E3TA 3BH9B 3ENLA 2WZ6A 3BE7A 1AZRA 4FQXB 4AQOA 5L4IA 1KENH 4F91B 4C59B 1NEZA 1BYAA 1J9YA 3W74A 1RUSA 1MCBA 4NKCA 4W6XB 2C5DC 3DX1A 5L88H 4BWTA 3VIPA 4XXCC 5EOCJ 1IM3D 3D33A 2DT1A 2IAMA 3MUHL 4Y4HB 4XC3L 2BWDA 3BT2H 3KPNA 4B9JA 2O5XH 1I8UA 3V0WH 4NENA 5ICXA 1MFBH 3TN0B 4RV8A 4AV0A 2NQHA 2MNUA 3DDFA 3MXVH 2VLMD 1NGZA 2N7SA 3BLKA 5B7YA 1HZYA 1PVNA 4YIQA 4HYVA 2XKUA 2B59A 3BGFB 1I2PA 4PUJA 3VRLF 4N4QA 4JM4L 4G8EB 2OK0L 5GGTL 2VQTA 2B08A 4HKBB 4NYLA 3ERXA 1LVEA 2WWNA 4C7GA 4Y5YA 2EXWC 2WY3B 1YXCA 2V2DA 1XL9A 2HSIA 4LOVA 4DXXA 3CFDB 4AL8H 3PTDA 4NUMA 1EAPA 3SM0A 4WEEA 3ZRSA 4R4FL 4NZDA 4IOFC 4LAJH 4X9SA 3OKMB 1LWRA 1ZLVH 3GMNB 2XG9A 1B31A 3V7MA 3KYAA 3P4NB 1P5UC 5GSRB 2JALA 2VWEE 4WZHA 1M71A 3FONA 4JJ5A 3THAA 4BDVB 3O81A 3VFNA 3STCA 5L7XH 4Z3FA 2AFNA 4WGXA 2F15A 2E9GA 1V4YA 1EUUA 3MJ9H 3C60D 1DSFL 4BZ2L 3HFMH 4GLRH 4P49A 1XF5A 1JPTH 3W0WA 2BNRE 3BSGA 4FMVA 1GY1A 3CPRA 5AEAA 3GSRA 3PDDA 1N64L 5LXXA 1P1XA 1ZBCA 4KHXH 1PZ3A 4KKCC 4MMXB 1R3HA 4AAJA 3WTWA 2BXZA 4J3OC 4MJ6A 3CTTA 1BXUA 5H37H 5K3VA 4YYFA 4OCYH 1BM7A 2A6DB 3R8RA 4PJIA 4HK3N 2HVKB 1OEZW 3S35X 4JIEA 3I02B 4OT1H 3ICJA 3ZDZE 1MCQA 5J13C 1U3HC 1YEEH 2YD6A 4K94H 2WMIA 2IPTL 5HWMA 5F96H 1U8QB 2X2YA 2R1MA 1E43A 1DJGA 5CSSA 1YYLH 4IFOA 1E9YB 5CAKA 5BO1L 4GI6A 2PO6A 2XU9A 5DEFB 2WP3T 3GFUA 3CFUA 1FCVA 3MU7A 5K9JH 3CCHB 1LO5A 1UWSA 3CV2A 5HAOA 4LCQA 5DK0B 3JV6B 5IFJB 3TBWA 3JUYA 3RCMA 4S3GA 1QFPA 2NY3C 2UWFA 3B2MA 3KVLA 5CJOL 3EPOA 4H00A 3UTTE 3RA7L 1G6CA 3IDIA 4RWYH 4CGUB 3R12A 3IEAA 2RDUA 4WWPA 5FAAA 5G4NA 2F6AA 1K7FA 2OYLA 3DJRA 1HKFA 5D70L 3EYUL 5DO8A 3ETBJ 3BOVA 3EWXA 3JVGC 3SE9L 2CKBL 3C5ZD 1XC6A 2XBZA 5H4ZA 2NY6B 1PY9A 1DSWA 2JGQA 5D2YA 1GT8A 3VH8A 3FGCB 1M5WA 3VFCA 3W2LA 1RBOB 4N6EA 4N2YA 5I8KL 1Z9MA 2FDBP 4YHZH 4ZFQA 2YXVA 3O2WL 1HH6B 3QQ9C 1A25A 4HPNA 1H6UA 4V1DA 5AHLA 1INEH 4FYQA 3APGA 2PMZA 4XPGH 4B5XA 4YDKL 1L9SA 1I8AA 3Q58A 4UUJB 4BSWA 4O4VA 5AVUB 1JIBA 2W63A 4TUOB 4IKLA 4FNTA 5CP7A 4CCEA 1LBLA 4L4TB 4PJ9B 2V3GA 1Q6GA 2KH2B 4XBGA 5E8NB 4QXWA 4BQ6A 4NIKB 3WQOA 5E4EB 4OVUA 2CLZA 4NAMA 3ZE1B 1ZA6B 3AQZA 3KCJA 2XJLA 4Y16C 1WE5A 5C0IB 4XPTL 1PMYA 2CO4A 3VTTA 5A2KH 3KYOB 5HDBF 2Q7YB 1XP3A 5D7HA 3F7LA 4L05A 1DN2A 3CN4A 1IV8A 2ZUXA 1FORH 1P0BA 1PU0A 4GUQA 3PQYA 1CGSH 5I07A 4X6DB 4CC4C 1A8JH 4HHAA 2A7BA 3ZHNA 3HUJE 4J1UB 3B03A 1MNUH 2G5RA 4PI0A 5DURB 3KRSA 2OZTA 3U2SA 2AEQL 4WJEA 4QRUB 3UGVA 1RU9H 1H7PA 1IM9B 4P4KB 2C9AA 4Q9CA 1E51A 2VQ1B 1LEKA 2F1EA 4KRMB 2R29L 4NGHL 5CZXD 1L5GA 1MJJB 2O6EA 4QI3A 3BEVB 3FYYA 1T66D 1QWKA 4FB7A 1Q5MA 1FFNA 4P5UA 5HD8C 1BYNA 1X38A 1ZY9A 1HINH 2H4EA 2CBIA 4N2NA 1LK3H 3KDMA 5E94A 2YW4A 1N6VA 4PJCF 3GDTA 3J7HA 2Z6FA 2JJSC 3GG8A 1ZCCA 3RB5A 3IWPA 3TJEL 2Q7NA 1KC5H 3VYOA 1JPGB 4L9ZA 4HWBL 5EN2B 2F7PA 1OP5K 1UQZA 2XG5B 4PB9L 1CICD 5BJTB 4FQCL 3KP1A 3MX0A 4GG6F 1G0YR 1U6AH 4OTXL 1NAKL 3UXLA 4OGAD 5ADPL 5DMJB 5A6SA 3EZ4A 3CM4A 4DEFA 4HJJL 3QORB 3FO1A 3UP8A 1LILA 4M6AA 2FYVA 5JZ7D 3PS7A 4AY7A 1J2BA 1NMBL 1Q1JL 1ZSXA 3QPEA 3WY3A 4YDMA 5CP3H 2GTQA 1RCXB 4LUTA 1YEYA 4JIPA 3S1UA 4EN3A 2BY3A 3ME3A 4F66A 1DVSA 3ARYA 4RGOL 2GY7B 3RU8H 3TH3T 3ROLB 2ZZUT 2EF9A 2V8LA 2VHLA 1KBGH 1Y5VA 4OZGA 1MWOA 3QJTB 3F83A 2TYSA 2D2OA 5K33A 3KRUA 5AD0B 1KEGL 3HG1D 1OJXA 2OMZB 5CGTA 1NQ6A 2ZOOA 1ZE3H 4U1JA 1SGJA 4XUYA 3MI6A 2P8LA 3SGKA 2FMNA 2GEQA 3W1PA 2WW5A 1WCGA 1A4JB 1GW6A 4WJG3 1DBKH 5AB1A 5LXVA 1AQFA 4Z2IA 1UVQA 2GSIB 1YECH 4HJ0C 2VDHA 3RLHA 2BMBA 2QZQA 4F1ZA 2BOBB 5GS0H 3D87B 4HUWA 4PV1C 4LU0A 4PV8B 2APTA 2WTRB 3W29A 4PS8A 3RM8A 3VG9C 3ZFHA 3OKKA 3MLTB 2DGAA 3LERA 1TV2A 4QDPA 3PVFA 4NHCH 5CSZA 2BHYA 2WB5A 5HMDA 3IM1A 3CMGA 4F8LA 1M42A 2LAAA 4IOIB 3G6JB 2J7DA 3C5SA 1AHKA 2JH2A 5C7XL 1EA0A 1EC7A 2QVFB 2MNWA 5HGDA 1UH2A 3VW3H 1WQVT 1NWPA 4V1XA 1NBVL 1HHHB 2FX9H 3C60A 4EIGB 3LDBB 4LPWA 3MRDA 3BKYH 5E2WL 2ATPA 4YNYB 2XZQH 3KWSA 4ODBD 1NCTA 2J55A 2MKWA 3BD3A 4HH9A 1TZAA 4HNCA 1GYVA 1RUKL 2F2KA 4FP1A 3BUTA 4AD2A 1VHNA 3K0WA 2NUTA 4F92B 1U8IB 3ZTCC 5JXED 1U8NB 5G4WA 4CDHA 3C9NA 2WWKO 2WYTA 1QR7A 5HDQL 4UOW1 2TPSA 3QV9A 1NIDA 2G9HB 3H3BC 2GQ3A 4JFEE 2UUDH 5B39G 4E2BA 3LN5B 4JL1A 4HWUA 3DYPA 4S39A 5JOEA 3VYPA 3QULA 1TFVA 3WD5L 4KPLA 3TO2B 1BZDA 3FBQA 3IFNL 1KN4L 1T8QA 3TVMC 4K1GA 1FPTH 2CLMA 2NX3A 1J0IA 1ACCA 4OCWH 1V05A 5F6IC 1RLBA 4M00A 3UJEA 3F4DA 3DV4A 3FMGL 1TCMA 1O5KA 5KVEH 4AISA 3P67A 4QYOB 3QPYA 3N40F 4HTBA 1ZPUA 3GBML 2C16A 3N6QA 1T40A 4F9DA 1O5XA 4ENEC 5ABEA 4F7EB 4PBDA 3QO1B 4DOHB 3WKZA 2B15A 5FLVA 2NW3B 2P8BA 4ZX3A 3LEYH 3E1F1 1X5KA 5D5MF 3V1HA 1TPUA 3A5VA 1FGNH 5CU9A 3LTPA 2BERA 2PCFB 2D7OA 3EDFA 3C5ZA 5FYLE 3C87A 4G80B 5KN5B 4OGZA 3L4TA 5F7HA 3Q45A 3QZBA 1L9PA 4HKJA 4I1NB 1H4PA 2Y6TE 2DORA 5AQ0A 7TIMA 1NLDL 3DURB 3BWZA 1AW1A 4L3EE 1QEWA 1PKYA 2WXGA 3THMH 4MGXA 5B3JE 4Q52A 3K4WA 4C8XA 4FAAB 1V3LA 2V2XB 5DF0A 4I3GA 2Q9OA 3E2HC 3JUGA 3L95B 3WFBH 1YNTA 3HFYA 5G2IA 1P5VB 3OD3A 3WAJA 4P2RB 5KSAB 3PL6D 4DP8X 4XP4L 4U1KA 1HFUA 2NT1A 4D0DA 4E6MA 5J0BA 5A1AA 1OHZA 1XXFC 4NJ9H 4HCRA 5C6TL 1WBJA 2YEZA 1N6QL 4DBEA 2IBZX 1SPDA 2FO4B 2EPHA 2OKMA 3PNWA 2VCAA 3U9PH 4PJ8C 4FZ8L 1ZVSB 1NFPA 2KZBA 2VC5A 3SYPA 3BSZL 4P2OD 3U6XS 3PL6C 2H1XA 1U4FA 4YLWA 2CHNA 3ZO0A 4EACA 1WFNA 2F84A 4YYCA 2ATKB 2VC2H 1FFQA 3V0JA 3TN3A 1T5XB 2FPYA 4LW7A 5DK3A 3B4YA 1DANT 2GJXB 2XNAB 2W0FA 2V3DA 3QR3A 1UOVA 1BKSA 4HKXA 4GW1B 4NNPH 4Q9BA 3TT3L 1A6UH 3VACA 4NAEB 3V5DA 1QVBA 4LAUA 2BH0A 3D50A 3OG6B 4Y4KD 3BPCA 1PTGA 1L7TH 4RX0A 4FLHA 3D2UB 3X13B 1QRQA 3VSVA 2IF7A 2RA1A 3QZMA 3UYIA 5F9OH 1E73M 2EE3A 2E6PA 1QTPA 1KNOB 4ABQA 4W8BA 4XGZB 7ODCA 1MREH 4QDGA 1U8HA 1DQIA 3LEPA 1GH7A 4FA3A 3B04A 1A7RL 2VDKL 1H2JA 3PNUA 1D2OA 4XHJC 5A7BA 4F57L 5HDRA 1KFAL 4Y4KC 3IGHX 4HJGA 5CLWA 1L9RA 1OTUD 1FP5A 4LFHG 1CICA 1XXXA 3S42A 4APXB 4PN6A 3VXTA 5EBMA 5LHDA 2ROXA 3BVNA 1KB5B 2QHRL 2V0TA 3W1LA 1QFWI 3GJFB 3DFHA 3T6WA 3COTA 4OOZA 3UJFA 2V2CA 1YXYA 2BSTB 1M05B 1C3FA 5ERWB 1AY1L 3MNWB 1WXZA 4RRPG 3AABA 2I07A 4YSPA 4OF6A 2GUYA 5TFSL 3D4GA 1BWWA 2BXYA 2B5IC 1GC1L 1T04B 3MLXH 4KFZC 1ACYL 3L0NA 4YDJA 3UJRA 3U4AA 2XC8A 3D46A 3W83A 4GC4A 4WI0A 2OYPA 2N4IA 2ZUWA 4EPKA 5A8GA 3H4WA 4HT1H 4D9LL 3K8LA 4DP9X 3NSMA 2IWEA 3V6OC 3TH4T 1K9DA 3HG1A 5FW8A 2R1PA 4JFDA 4JK0D 2XSBA 1WXJA 2RALA 4A29A 1UKTA 1BWVA 2IH3A 3C2EA 4IMCA 4LK4A 3MJYA 4LOEA 3GAYA 2FZ8A 4DF2A 4AC4A 1HNYA 1ADQH 4YFLI 1LJMA 4TR9A 4MNGB 2HZHA 4EVZA 4Y89A 2EVJA 1ZFJA 3LV3B 5J6HB 2A38A 3RF9A 4H83A 3G0XA 2PCPA 2YSSA 5M7QA 4U49A 4ACTA 4S1RL 2V2HA 1A4KB 3FQNA 4A68A 4GYKA 3GB6A 3BV7A 3NDOA 1Z44A 4YDVA 4HIBA 1MQRA 5E6YA 1C12A 5F3HA 3AJXA 3MBDA 3FS2A 3IVKB 1XEDA 3BRDA 1IFGA 3VGEA 1UWEL 1NKRA 1W1YA 1CFQA 1AS8A 1GYUA 1YPZE 5XIAA 1CB4A 2E25A 4XD4A 4MYWB 1IGJB 3FRPG 1WDSA 5AENA 2JB5H 2EUZA 4KDTC 5FOOA 4OZFH 5EH1A 3FFCB 5E5MA 1TTFA 4ZW5A 1WNOA 1WS8A 1V3KA 1XFBA 3MRRA 4X9GA 4G1MB 2LLLA 3CXFA 1W0MA 3IJEA 3IKCA 5FIEA 5DZJA 4TLSA 5LWYL 1QI3A 1KXVC 4ZZFA 3L12A 2J20A 1D8CA 4JFSA 4MG4A 1OSEA 5HPMA 1H8NA 2DQIL 3M7WA 4GY4A 1W1A1 2YSWA 1L0XA 3IJIA 1S7SB 4KESA 2XVNA 3AFLA 2XFYA 1Z3GL 3B7SA 4G7FA 3QYCA 2YWYA 4KXZH 4O17A 1H3XA 1Q0YH 5D9SB 3W5MA 4J2QA 1UG9A 5H2BB 4KFPA 1G7LA 3M0MA 1R17A 3MREA 2HX8A 4YO0B 1CZ1A 5DFVD 2MQGA 4AYBA 2BMKB 1D5XB 3EPNA 2REQB 3JW7A 4QJ3B 4CNIB 1A4BA 3CHFA 4YHKL 3Q8AA 1HSBB 1A3HA 4ZEPA 5J8LA 4XMLL 1DL7L 2R59A 3ZLHA 1EP1A 5JOFB 2DU2A 3TR2A 2R7EB 1Q94A 3LUTA 4RMTA 2IS7A 3UR8A 4FXKC 1HYSD 3QH3A 5ABGA 4DJFC 4OI9A 1OTSC 1M68A 3GLAA 4M1DL 5F4WA 2DZVA 3Q44A 5H35B 4Y1TA 1AGDA 3UY8A 2GPZA 4ZS6D 2DQTL 3GFYA 4RE3A 5C0CD 2NWRA 4WHTA 5T3XD 4TQ8A 1FCCA 2G2RA 3LY6A 4G6JH 1BJ8A 1W0WA 3B2XA 2CO7B 2XUCA 2KDYA 3LKQB 4UIKH 4MB3A 4ZFFA 4MHHG 1NAMH 1FUNA 3OZMA 4LP8A 1GZPB 2OMYB 3SOBL 1RUMH 2X4NB 3D25B 4X80H 3W0KA 1L9MA 3U0WL 3RFZC 4P9MH 3CHPA 4PUBH 2X4UA 3FAWA 1YG9A 3LS5H 5ITBL 4IRSB 4GRLC 4GYJA 4UM8A 5HJGA 5MEPB 4FQPA 4ZUVA 5AALA 2PDMA 1VS1A 6ENLA 3QUXD 1KZQA 3QDJD 2GQ8A 5ALCH 4U1GB 3KTXA 3ATZA 4Q6IA 3OZYA 4HOMA 4AW7A 2RCSH 4C6DA 4JFXB 1GOKA 2E7CA 3CMOH 4XO5A 1TE1A 2APWA 1UOWA 1ED3B 4L29A 4LYRA 4KRZA 4UTAH 4NQVA 1I7ZB 3QJRB 4FA6A 3ELQA 3I2CH 3RVTC 1U91A 4PJEB 2J25A 1LNUA 3X1NA 5E6UB 2JCCF 7FABH 2VGBA 5IBLC 4U3XA 1V8EA 2XN9D 4GG6B 1S7RB 4LPTA 2HVJB 4GD0A 1QZNA 4KDVA 5FUZL 3PWPB 3ZYJA 3SKNB 4Y9AA 1ONRA 4H8UA 5AFDA 2AK4A 4JQ2A 4N9GA 1D9KC 4UFMA 2WBJB 1TVHB 3PXLA 3JWNH 3NRQA 3ZZLA 3FOLA 4JTDA 2YRPA 4UB0H 4Z77B 4Q74A 1R0MA 5CR8A 4EUPA 5IBUG 1PL9A 2C9VA 3WBEA 1XGTA 1ORSA 2AMGA 1UWXK 4QRTA 4P3DB 1CD8A 3E49A 2O1AA 5CCJA 1R3WA 3MO1A 3O8AA 2VFIA 4HFWB 2GJ6D 4OLVL 3ARBC 4I18C 1YDOA 5TQLA 3CK0L 4M7JH 5HP5A 3FTYA 3Q8CA 1KTDA 1UJ3B 5GHWH 3D3AA 4RDZA 2HPIA 1UJPA 4LFHD 2BSSB 2G50A 5D2NC 2FLBT 4BH8A 4P7RA 4TUFA 1V7AA 4MDJA 2YXGA 1XRVA 1RZGB 1T5WB 3D1MC 3VH8G 1Y6NR 1M4KA 2YXOA 2ZZ5A 1HESA 3GH4A 2F58H 1JCNA 2CBQA 1MEXL 3KPPB 5CC7A 1XF2A 5AW1B 3SDDC 3AIQA 4Z08A 4A35A 1NFKA 5C9RA 2WXOA 2Y7QA 5GSVB 4MLIA 4XODA 4IMLB 3CE1A 1GONA 3RUGB 4IPPA 3VI2A 1OK8A 2QGDA 3CH0A 4DKDC 5EUKB 4Q8UA 3MUJA 4UDTA 1JNHB 3DX8B 5EZLB 1QO5A 4K7YA 4RXGA 4GXMA 2ICWA 3TW6A 3RFAA 1UB5A 1OCBA 5IUSA 1GGIH 3GMRB 4AVHA 4ANXA 4TV5A 1FE8L 5EDXA 3IDJA 4NHUB 3G5XB 3ARFA 1BW8A 4X4YB 5INDA 4YUEH 2GGEA 4UU9A 2Y06L 3UA3A 2PF0A 4KCWA 4PQXA 5KYNA 4TPRL 5IVXA 2NZ9C 4IJ3C 4Z7OE 2YDSA 1Q90A 5C0EA 3RNQB 3BMWA 3DUUB 4AZ7A 5AZEH 5JORA 4CCDA 4LOUD 1ZALA 3LH9A 5DMGC 2X7LA 2Q02A 4DEWA 4UQAA 5KJ7E 2IH1A 4D8ZA 4UYQA 2IWGA 4LCIL 1OKEA 5JLZB 2CHOA 4L3FA 1A5FH 4O2CB 2DM7A 4HYWA 3VXGA 2JWYA 1NF7A 4GAJL 3HI6H 4ODUB 1TG8A 4I5BB 5CM1A 4BH7A 3AU1B 4CQDA 1IAKB 3L1OH 5BS0D 6XIMA 2E46A 4MNQD 2YLAA 4B96A 1JUFB 5DQDL 3SRDA 4Z7WF 3IDYC 5KYYB 2GVGA 3JWOH 3IACA 4Y2DA 3MI3A 4B91A 4I5UA 1P6AB 1P7QB 3FH5A 4F2FA 1U1JA 3IJHA 3FQTB 2CMRH 5I16A 5EZJB 3S2LA 2FJSA 3II1A 3D3FA 1F8IA 3BQ6A 1AW2A 3SRFA 4L4TE 2Z1PA 4J3OF 4JGNA 3O16A 4AXWB 3UXDA 3CSBA 5A2BA 2QUUA 1FZOA 1UD4A 5EG6C 4F2MB 3ZE1E 1FL5B 2DQDH 4HS6B 2Y63A 1JNDA 3M5VA 5JW5A 3N2MA 5GJTL 4AF0B 5D5MB 4FOKA 5BQ7A 3WGVB 2H7WA 3U2JA 5GGRA 2FZ3A 4HCIA 1M1SA 1DUZB 5IXEA 4YAQA 3HRZA 3DXIA 4HEPG 1ZLDA 5FAJA 5B39A 1WOBA 3CXHK 1JDDA 4LSRH 3NCJL 2HXAA 4HNNA 5I06A 4YZWA 3WO3B 1TWIA 1S39A 4KK8C 4Z78A 4S2CA 4HMCA 1AG6A 1A9EA 3MOBL 3EX3A 3GU1A 1N59A 5JYMA 3K46A 3SOTA 1KM2A 3CUHA 2X2JA 3NPSC 3TXZA 3N85L 5DRWA 3B7TA 3BZEA 1NFGA 2CJUH 4EEEA 4Z17A 1X1NA 4YTSA 1TWZA 4FN0A 2GJZB 1JZHA 5C0DB 2WHVA 3N17A 1D5BB 3HE7B 3THQA 1EGJA 5BZDA 3CZ8A 1AXTL 1SR0A 4GMSH 5K59E 1Z5LB 3G77A 1A7BA 4KX8A 2WNXA 4L5FH 4U1MA 2SEBA 5EFIB 3LHAA 2IAMC 1NEYA 1EANA 3MUUA 1KBWA 4PBFA 4EDWL 2QF8A 2WSQA 3BPLB 4DY1A 4JDTL 1VGKB 1QUPA 3PG9A 1B0RA 3RIAK 3VCCA 1PS9A 1M7DB 3CQFA 3UMTA 1ZGLA 3DA0A 5KOMC 4I6VA 3AAMA 1I45A 5HQLA 3UC2A 1UD8A 4TKWA 5ES4B 3V0HA 4YWIA 3FS9A 3CFEB 4PJXE 1W6TA 3IGUA 1R38A 4IQEA 2WQSA 1KACB 4Y5YC 2VUNA 3OP2A 3N41F 4BK9A 1F58H 4OD2B 4TVSa 4XPFL 2E7LA 2WWOA 2IDFA 1TZZA 1K03A 4PL1A 5J6SA 3LIUA 2K7QA 4FQHA 4LSPL 2FVNA 5TH2B 3QDJA 4R0LB 4R85A 3REQA 3P0VL 1U93A 1Q13A 3T0EB 2R9RA 1X4YA 3DX6B 1SR9A 1JG9A 2HB0A 1N4XL 5I0XA 4HZ8A 2BVEA 2WQWA 2BOFX 1T0NB 1XX9C 1OALA 3HPFA 1IBYA 3U30C 2EC9T 4PTNA 3G3DA 1ZP3A 3M8OL 1GCYA 1LG1A 3TOYA 4NKMB 1I2QA 3P77B 4YSRA 3TEXA 4R2GC 3GSUA 3RWHB 3MRBA 3T2NH 2HLEB 3AAZA 2K4AA 2A85A 2GDUA 1F3TA 1Q63A 2CLPA 4C6BA 4P8WA 5CWSA 3DIFA 2QT6A 3M5ZA 1MAMH 4FCAA 2CR6A 2WQPA 2O9RA 3L9EA 4PUMA 2CHRA 4US5A 2NV1A 4MDRA 4FFTA 4PBGA 3LCIA 5HHPB 1ORQB 3VG0H 5CMAA 4H25A 3G1FA 2AEWA 3DX0A 1WT5A 1JWMB 4DETA 2H2SD 1R3KB 4P7OA 3BZJA 4BHYA 1C90A 5I1GL 1PB0A 3TWCH 5EUOF 2A7PA 4PGLA 2X2IA 3TEYA 4FP8H 1SQ7A 1DIEA 4TSAL 4S1DD 1WHOA 3EYPA 1JRHL 4JHZA 1XGUA 4OBTA 2PO6C 3UZJA 2YGNA 1Y6MR 5AW7B 2PWGA 4HIQA 5ESAA 4ZK8A 3RPIA 3QIBD 2QSVA 5I18L 1T8XA 4M48L 1YJDC 4HNVA 2I56A 2GJ6A 4L0YA 4F3FA 1FDZA 2CGRL 4MFHA 3VWKD 3HS0A 3W22A 2AQWA 3SKJL 1BXXA 3GM8A 4ALDA 1KFEA 2ZPKH 1RCOB 1UOLA 3G6AB 5E2VL 3UZQA 4N6FA 4YHIA 1TUFA 3OKNA 4HXBL 2XXCB 4KWUA 4TV3A 2ESVB 2GIYA 2VXTL 2EEBA 1N19A 1AHWA 3VMOA 4X6BB 2VM9A 4MS8C 1RZKH 1KM4A 1VJSA 1HNGA 1EVUA 4JO1H 1PIFA 2FLRT 3V95A 1HQRB 3W38A 5FC9A 4AT6A 3EOUA 1V51A 4XZ9A 1WIUA 3EYFA 4U3SB 5F7LB 3FUNA 2J1XA 2NY4C 2VL5A 2WV3A 2O5ZL 2QW5A 3V4PB 3KLAB 1G7JB 5E0QA 4BYHA 5ABDE 3QOMA 3FFDA 4NCDA 4JX5A 2AERT 4Q8OA 4HX1A 2CU0A 3PQYD 4JM0A 1NUDA 4QHPA 2YD0A 1X1OA 2ABBA 4IGBD 3TCXA 5A2JH 2DWSA 4EKJA 4CADA 2OFQA 2OR8A 2VCBA 2FUQA 5T5FH 3WS3A 3KOYA 1ZP4A 4OCNC 3UR2A 5EEUA 1VFAA 2MJWA 2TAAA 5ACMA 5CEZL 3IEBA 2V3EA 4JIHA 4L1GA 4DOHE 1M1XB 2YA2A 3KAAA 3G1XA 4OGQC 4QS6A 3VCLA 3S8FB 2JKWA 5KYXA 2YARA 5I00A 5CEXA 1NDGB 3R8GA 5EZPA 4P5TB 3D3VB 1WPCA 1KYAA 1DIKA 5EDSA 4RAVB 1TZIA 4P23C 4MPQA 4DK6A 5L0QB 1J1OH 4PHZA 5BOEA 3EADA 4PCNA 4K8RH 1QI0A 4O10A 3FRPA 3OKLA 4GAGL 4UQBA 1R3RA 4XVUC 4NZ8A 4P5KA 2WUBH 1S5HA 3VD3A 1KCVH 4PG9A 2EXTA 2PW2B 5A6KA 4KTGA 5K9OA 5CEZE 3C6LC 5TD4A 5EC1A 1JHTA 1KCLA 3QJUB 1AYOA 3NEEA 4X8JB 2WIIA 3U8GA 3K2GA 4QHUA 5IJDC 1WFJA 2R91A 3H7UA 4PN2A 2WP3O 4L4LA 1JHKH 4JG5A 2J72A 4NXKA 1XRFA 2B0SH 3JWDL 1YQVH 4P05A 2I9LB 1RH8A 3WQCA 3JV4A 4OZHE 1C5DA 4H0GA 1LE5B 1B30A 2LTQC 1E67A 4YCOA 4ZENA 4A6YB 3W7QA 1W72A 5DYFA 3SY1A 4ROQA 4F0LA 1ME7A 3CLWA 1VYSX 2Z64C 3C5QA 4RJEA 3HZYB 1UOZA 1RJCA 4NOFA 1JV5A 5LGKA 3L9CA 3KR3L 2KPWA 4PJDA 2XINA 5EF1A 1IQWH 3VFLA 4GUCA 4D9RD 5AYUH 5FSEC 4JKPL 3ZGHA 1CFTB 4NUGH 2WJZA 4PL2A 3ALXA 4DK3A 3VMNA 1UBPC 4H4NA 3REWA 1BFNA 3CMJA 4AGOA 3OBKA 4ES9A 3KS5A 5JTWA 1EEZB 3MMEB 4OJCA 1P4LB 5AFAA 4EN3C 1NFDA 3NA9H 1IC4L 2J7LA 1ZSHA 4LS0A 2K3TA 3CC5B 3G6LA 4ESKA 3AMGA 4OSUL 2I69A 3BAEL 3VRJA 1A47A 5AWNL 4HK0A 1GTNA 4ELMA 1G9NH 5IMMA 1DBAH 3LXAA 4OZIF 1KB5L 1CK0L 1BD2B 2PWHA 2V7NB 4M6VA 4R97C 1T5KA 3AYTA 3GI8L 1SHWA 4ODXA 2W65A 4ZSOE 1V3JA 3DHUA 3SGKC 4A3RA 2JCCB 4ANWA 4ODWA 4GINA 2XACC 1C5CL 3WJLA 5INCA 1XTLA 3NL2A 1H3GA 3CHOA 1BWKA 4Y2OB 5IF0A 2P53A 1EV2E 3NSFA 1F3JB 3H9YA 4KRPD 4GKLA 5E6RB 4J28A 1I8JA 2GLKA 4AC7C 1VF8A 3LNGA 2AQ1A 3H9SA 3VRLE 5BRBA 3PFUA 5MEND 1M1BA 3UO1L 1SOSA 1IILE 1JVNA 2FX8H 1IF2A 1J48A 3V0GA 3GMOB 2J9ZA 2AKRB 3SIMA 4ES8A 3FSVA 4A8NA 2AAVA 1S38A 3I84A 4YDIL 2VIRA 5CG0A 3U83A 3HE6D 1F7BA 4ZRGA 4QP0A 5JPNA 2DBLL 3DSFL 1LL6A 1AL7A 4YTRA 5JBDA 3ELFA 2ZCKL 4FSAA 4J9JA 4BHUA 4IHOA 4PMUA 2WMPA 5PAZA 1CBVH 4WTWA 1ZT4A 4Q58C 4B3LA 1RHCA 4HHPA 2JKEA 1ZLWH 1MQPA 3HQPA 2FZBA 5FECB 4UQ3B 3KCWA 3LXUX 4FFZH 4MCNA 2J5LB 3C60C 4TU1A 1P7TB 4Z5RA 3L3HA 2AP2A 3X3FH 1ZWIB 4F3HA 1GZJA 4PWFA 2CRZA 3MJ7A 2FDMA 1G7HB 4IMKA 3SN1A 5BMXA 3DX7A 4TQEL 3APFA 2ZZ2A 4MNGE 2EIJB 1SVZA 5E1AB 3MU3A 2C3VB 3GKWL 2CO6B 2HS8A 4BFNA 3GT6A 1BQKA 3GNXA 3OKYA 2R1LA 1I9JH 5BRQA 2GJRA 4N6RA 5FO9B 4QQUA 1VCGA 3EYOA 3OAZH 3GLZA 1MJ8L 4DTGH 1F4YH 3SYAA 3OSVA 4LLAA 3CVCA 4IX0A 5HGGS 1DLHA 3ONCA 4OQTL 1H3PH 2PP8A 3E9TA 3BJLA 3JYBA 3QIBA 1T83A 4NO0B 2HTMA 4QHNB 3FFCE 4GQ9L 2X1WL 1NFBA 3FKRA 5T1MB 3VWKA 4E8GA 1RVGA 1QAPA 4Y9OA 4RMBA 5DZVA 5KUMA 4PJBA 3NMEA 5IG7A 1V7NL 3BW9A 5CPLA 1ZJAA 32C2A 1UA6L 5G1YA 4XD3A 3M4HA 4NQDE 1RZFL 2F5BH 3HQOA 5HA7A 5EOTB 2NY7L 2L7UA 2H8PA 4DX3A 2ZG3A 4QBXA 2ORBL 3ARUA 3O45A 4GCXA 5IHZA 4AH2A 3K8MA 3NFPA 4TSCH 3R7MA 3SCVA 2Y3NA 4JZJA 3C5ZC 3WNJA 4N8VG 4HZMA 3WI9A 1NUNB 3FIGA 3C0QA 1RQHA 2GFBB 1TJHL 3KYMA 5EFFA 3QDHA 4LEFA 1P5UB 3QNXB 4KTDL 2NV2A 4CNPA 4ZNEA 1MQ8A 3V9EA 4YS4A 4BFRA 1YNLH 3VGFA 5CS7A 2QEJA 1K7EA 1EUAA 3VXSB 3F1QA 3RWFB 1PQZB 4A05A 4QY8B 3RIFK 1YMHA 1XGPB 4IBSA 1WCBA 4TUJB 4JKNA 5B7ZA 4ZS7L 1HIMH 1UWAA 2ZOLB 3GR8A 3L2IA 3DBNA 4Q56A 1C16A 5E23A 4KJPD 4AQEA 3S2CA 1WKEA 3EUUA 1N0XH 4IGBA 4N25A 3V7AG 2O61B 3BGJA 4JHWH 3VGDA 1TEGA 2QKIC 1FIEA 1Z8AA 2M26A 1XBRA 2GKIA 4HIEA 4F58H 4PTTA 1HQ4B 5J13B 3L5AA 3PZGA 2BVPA 4PJHA 1U3HB 3SBQA 1J8HA 1DIDA 5G4HC 3NZUA 2VSKB 3LKRA 3UJIH 4A3QA 4K7FB 3CO8A 4ZPTB 4H0LC 3S6CA 4LLQA 5KSBF 3RCNA 4AQZA 3Q5OA 2E75C 4EUPG 3OKDB 3DC8A 3KX6A 1CLYL 1PO9A 1YDVA 2HJKB 4I5XA 3VFSB 2GZXA 4FTVB 1YEDB 1AXSB 4RZ6A 2R1WB 4WDIB 4BGLA 4LU5H 3TT1L 2VW6A 4PGCA 1TA3B 4S3CA 5CZXC 3U2OA 2NY3B 1US3A 3LMJL 1T66C 1WA0X 1XYFA 3KPRD 4FLRA 3DZ1A 3IGAB 4HOWA 4K5PA 2BCKB 2OL3B 3DFQA 3P3YA 2JF6A 5FW7A 2NQZA 4TMBA 4LMQI 1S9YB 3GNDA 3PJSB 4X7CC 3D51A 1XBZA 1A6AB 5SX4I 4G6KL 4GK8A 4PEEA 3BE1H 4HEPA 4F33B 3ZT7A 2XM2A 4L8BA 2HPOA 5AW2B 4PJEE 4G3YL 1HILB 5EEXA 1U21A 4YDLB 4BF7A 4UILH 2YR1A 2GAZA 4W89A 4N0UA 1NOUA 4QRAA 4K38A 4FOJA 4F5CA 4AMAA 5HJ3B 2DUZA 1MFCL 1YMMA 1CICC 2PDGA 4TO8A 4MB1A 3RAJH 5AW3B 2QDDA 4WWID 4G5ZL 4XC1H 4OGAC 5JA8B 1EJVC 2CNYA 3MBFA 2LLEA 4X83A 4H04A 1U8JA 3PGFL 3WTVA 5JZ7C 3N41B 1IT8A 4FFYA 1D9EA 3WXVH 1I1FA 1QNZH 1ZMYA 4JFDD 1M2VA 5ESQB 1DE4A 2NTFB 3DROA 4HJIA 5CGBA 4D0CB 1KO0A 5GRWA 3LRSB 1HE7A 4JXCA 1U1UA 3MV7B 1JZ3A 1OIOA 1RI8A 3XINA 2OLSA 2R2BA 4RNIA 2EYRB 2P5WB 4UFKA 5E24E 1X5IA 3M1ZA 2VXQA 3USBA 3IFPA 1B3ZA 4G1KA 4JUSA 1GKPA 3ARGB 2PDIA 2HYMA 4LASL 5CQ1A 4HV8B 4BFJA 4XTIA 2GSJA 1URZA 3H4HA 1ONQB 1TCRA 2NQCA 2CXEA 4N0RA 2VDQH 2W81C 3QJHB 1FL6B 4UM9B 2KQMA 5GJSH 3MODL 5CN1A 3QFGA 4ALAC 3ZJ8A 1T1YA 4RE0A 5IIEA 1VPXA 3QW9A 3V4VA 4M80A 1BRLB 5MENA 3VXNB 3B4UA 4KK5D 4L4VB 4G9FD 3IMUA 4X6CF 4H26A 3RUGE 2WN2A 2VLJA 4N9DA 2CHXA 2VE6B 1PXGA 3AIRA 1G7IB 3AQXA 3CWOX 1FZMA 4HALA 4YHPB 1H7XA 1MXGA 1GVOA 1GAFH 3HE6A 1TNNA 1MCPH 5C0QA 1EXGA 3S7GA 3P3UA 4IIZA 3PTKA 5TE6H 3K71A 1HKKA 3MRPB 2R0ZH 2C3WA 4QG6A 4MJIA 5KTLA 4KZ0A 2AABH 4JN6A 1G9MC 3W2UA 5GQBA 4I48A 3KS6A 3MUGA 1CNVA 2LW3A 1FP8A 5C7HA 2X8RA 5JNYA 4IRJD 1F0LA 2JKPA 3UXFA 4PJGF 2OQJB 3QG7L 3U2IA 2G3FA 3UP1A 2WZMA 4RXFA 1OAKH 4GWEA 2BJML 4DPPA 3T71A 3FB6B 3LKOB 2VDMH 4LKXB 4MJHA 4O57A 2CR0A 4F27A 5JXEC 3W7CA 3CHCA 4CN6A 2KZ1B 4N2CA 3QKZA 3STZA 2P45B 5FXCH 2GC4C 4G8GD 2VR3A 4NRYB 3T2LA 2J24A 1W9UA 3P4LA 1JGVL 5HVHC 4O1CA 4ZR8A 2J5WA 3LA4A 1RA5A 3HPLB 3GMQB 3LHYA 5A6MA 2YO3A 1VGEH 1N5YH 3L3KB 4H7ZA 3HMXL 3FCGA 4JFVA 2B3IA 3GJEB 1A2YB 4LCYA 4IKIA 3WNLA 3HBPA 2CDEA 2YS4A 2BIIA 4R96A 5I8OH 3L08A 1D5ZA 3O0RL 3KVMA 2XTKA 4LUIA 1P6FA 4BS0A 4IEFB 4HIJA 5DJ0A 3O6LH 1FWEC 1TE6A 5DEGB 4N24A 4YPGB 3GF8A 2OT1A 3RNKB 3ZL2A 1SMDA 2BOCB 3W24A 2NYZA 3P02A 4HHHA 3ECVA 3S37H 3NA8A 3ZJ7A 1NICA 5DHVA 5DRZB 3NACH 4KEVA 2UX6A 3R4DA 1F86A 3H8NA 4FX7A 1A7OH 4H8WC 3PJXA 4XAKD 1RXOB 4U1SA 5BV7C 3LS9A 3B0UX 2F18A 3LZ3A 2PTDA 2O9PA 3ZE2F 4PHXA 1OM0A 1AD9A 3NJMA 5T1JA 3RWGA 5EU6D 3WNPA 5I19H 3ML9A 2R4SH 3PABB 3QCTL 1E4WH 5HNUA 2GOKA 2Y5QA 1MWAA 2J73A 5AG9A 1WWBX 1W1IE 3PUOA 5EZIL 2QBWA 3L5XH 4DUVA 3QQDB 2MTAA 4UV4L 1DQML 1XLMA 2PUQT 3V9CA 4UNVA 2QYGA 1QI4A 1CF8H 1CVSC 2P1FA 1VADA 2D31A 2AK4D 2B7PA 2WXIA 4X7DC 2VKZG 4HLZG 1ZTXL 3WEOA 1RIUH 1EIXA 5LAXA 3A3YB 4RV3A 1OPGH 1T22A 4NSKA 1TZGL 4P8QA 3H42H 4P2OC 5BVPH 3QBUA 1N5AB 4NRXA 2F7IA 1E6RA 4HEME 3FCTA 4HSOA 1L6PA 2E27H 1MEWA 3WLQA 3KW8A 4KAQL 3GGWB 1HJVA 3L6FB 3FFSA 3TVMB 1M3UA 1FV1A 2ED7A 1JFQH 1EFQA 1BBJA 1BV8A 1IGCH 5F6IB 3W2NA 3BN3B 3MRFA 3FTVA 5IMOA 2DYRB 3AACA 2UVFA 2EIZA 3U36B 2IXUA 1W80A 2HAZA 3NQAA 1J5DA 5KW9L 1EXHA 5HGHA 1XCTB 3OC5A 1OYAA 3KPRA 4E41B 2D7NA 8TIMA 1RFDL 3IGKA 1YEJH 5LNUA 4Z76B 4OZIB 3P30L 4NQSB 2FQDA 4GJIA 5D37A 2XY2A 2H3XC 1ETJA 4FKKA 4I0PD 1U8OB 1KCSL 3O6MH 1UTDA 4X6EB 1BEUA 1MFDL 5AUMA 4U7MA 3MRLB 1QCWA 5DDHB 3CN2A 4MPKA 4IFKA 2PDKA 1N67A 4Y2LA 1OTUC 4NJAH 1UURA 1BZ9B 1RJQA 5LN8A 4Q9RH 3PWNA 3H6JA 3E2HB 3O9NA 1UM4L 3B5HA 1DBML 4M43L 2VR5A 3ARFD 1PWLA 4GNKB 1IGYA 3VGBA 4JAMA 3NCYP 1QWNA 4Y88A 1FKWA 2RQEA 1KM0A 3WBYA 5IW6A 6TAAA 4AX7A 4UTBH 1IE7C 3IJ6A 1QBLH 1BZ8A 2BRRH 2PLCA 2NCEA 3E3QE 2I16A 3PDOB 4NQEB 4PJ8B 1NWOA 3ARFC 1GYNA 1K4CB 3A4AA 4HIPA 3FKUS 4DGWC 4AIBA 3CTLA 1L7IL 1YBQB 4GIRA 3QDME 3GDCA 3QW4B 4N0YL 5EB9A 2XFFA 1Q6FA 3KOZA 1S7XB 4WI8A 5HI5D 2C9XA 3OGOE 2YPVA 4XB3A 1F5ZA 3HZ3A 2FWUA 1HOCA 4QRRE 2FR4B 5TE7H 2W9MA 1XIJA 3ECBA 3VFOA 4Y2DD 1B3VA 3GU9A 2W94A 2ESVE 3V4PL 5ENWB 2OG9A 4C4UA 2R1NA 3LGDA 3KHJA 1NKGA 5DVLA 4G9FA 2OYMA 3FW6A 3LKNA 4J2XA 2CBTA 3BPNB 5T3ZH 3QVQA 5DVNA 1J0YA 4OHQA 1FN4A 1M03A 3N91A 1WA3A 4LLUB 3SB0A 2D4DA 2EEFA 1E6JL 1KJ2A 5HYQB 4ZOCA 2Y24A 1E4IA 1TQSA 3WLLA 3NK3A 4PJ6A 1UA7A 3LCFA 3MXWL 4PB5A 3CT7A 3EYVA 3NM3A 1I3UA 3OR7B 4LF3B 2H26A 3DJ9A 3GM0A 1Y18A 4RK8A 4PSRA 4GAFB 2VERN 3EJJX 4FYRA 5I1DA 3DXAE 4IRJA 5ECJE 4TUKL 4AMWA 3OJDA 3ZTJG 4PJIF 4R83A 5FOBA 3NK4A 2OEKA 3CT2A 2DEXX 2J13A 1CTMA 1J18A 5AYTA 4ABUA 2B5IB 3NEXA 3PP3K 5B4MD 3HRZC 3Q8FA 4IRZH 3S9ZA 1OP5H 2XXMB 4ZNCD 4YMPA 4G8GA 3BRFA 1OZQA 3K2MC 2CR3A 2OTWA 5DFVC 3LIZL 1N0LB 2Z34A 5IB5B 4XCYA 2QR6A 2MH4A 1T0MB 3WUWB 1PPIA 4JTLA 5FF0A 1UGNA 5J5EA 4A6YL 1P1ZB 5HDBB 3CQHA 3QIUD 4IOTA 3T4CA 5D1XB 4DVRL 1FH5L 3KWVA 2A4CA 3SDXA 1JEZA 1R5IB 3QJZA 1COBA 2FCBA 4GUFA 1V6XA 4L8SA 3NG5A 5IK3A 1IT9H 1HYSC 1A1MB 1H5BC 4J4PA 3VNJA 3SBWA 4ZI8A 3ULVD 4YEEA 5FJTA 3QR0A 4W87A 3HC0A 3GXMA 3O05A 4N8VA 1J8KA 3WIHL 2HFEA 4AGLA 5I3IA 3TCLB 2NNXA 1RJZA 3WXWH 4ZS6C 3TBSB 4NJJA 2Y1ZA 2QDWA 2XG4B 4Z3IA 3OX8B 2ACUA 1X5MA 5HNRA 3FDGA 1X98A 5CZVL 4Z42C 4XNYL 1SJEA 4RMSA 1TIWA 3W84A 4A7VA 4QT5B 3WKPA 1WAPA 1F6KA 4PJCB 5HYJB 1J1PH 1UP0A 3H3PH 4LV4A 1XGQA 4BWUA 4N0FB 1BVKA 1PCXA 2WWCA 3NCOA 5EU6A 3ZGIA 2E7LC 3TU6A 3L65A 5K9QG 3RRXA 4TTGA 1JBJA 5KVGL 2XPGA 3QUXC 3OLDA 3FOKA 1ZJBA 4GVFA 5I6XC 5L2JA 4EOUA 5EMYA 2E3VA 4W6WB 2WJ7A 3FLUA 4NZUL 1BBDL 4KHTL 3EGXB 4QXTA 4US5D 1TZ8A 2XPKA 1K3UA 2DI8A 3D48R 4AEHL 2V81A 3WF3A 1K8DB 4BKLA 4F20A 1EYEA 4W9ZA 3G08A 3WO4C 3I75A 1BD2E 3U6RB 1UM5L 2VM3A 2ZDRA 3DHJA 2BP0B 1E4NA 2E86A 2CM5A 3QUKB 4W9TA 5E2UL 1C1EH 3IJLA 1EEUA 1IJNA 5T1KD 4A7GA 3LB6D 2R83A 1A6ZA 3H9HB 4RMUA 1L8NA 2LV4A 2FECL 3INOA 5F7DA 2VX5A 1FRGL 3OU8A 2XY1A 4PWEA 2HPTA 3IYLW 3VCNA 1OD9A 2VJXA 4UTIA 2DSVA 4JTJA 3RTQD 3K4AA 4RISH 1WT5C 1G1OA 2ZUTA 3SADA 4B5ZA 2XT1B 1FWAC 2AJZA 2PDBA 2YK1L 3ES6B 3PUUA 1CL7L 2Y22A 3L3OC 4PJ7F 5CLYA 4M5SA 3LB6C 1UD6A 4FQ2H 4WRLA 1YTDA 4IXHA 2A4AA 3OZ9H 1AIFB 2QADD 5EU4B 4OE7A 3H2PA 1YEFL 4W9FC 3FQWA 1T4KB 2NLYA 2WBXA 3UCQA 4UCFA 3R8BB 3GD1C 3C8HA 2HCVA 5EA9A 2NXZB 1LRNA 1DUYB 3F7QA 3HS0C 3NSCA 1XR2A 4ES4A 4KTEH 1TEFA 3IIVA 1P9MA 3CDZB 1FFTB 1IGSA 4I0PA 5HR7A 4X0KB 3NCEB 2E9MA 1MW2A 3NJHA 1EJSC 4I3SL 2CG9X 3IF1B 2XRAL 1GVRA 5DWUH 4X6FB 4W4NA 1UD5A 3TIEB 2ZAGA 4GRLB 1YO4A 3AREB 3WJMB 2I57A 4DJMA 1QNVA 4PRDA 1IEHA 2XYLA 4Q4EA 1KEML 1G4TA 1UACH 2GJPA 1W5MA 2E77A 4D3CH 4I5RA 1BG9A 4F2UA 4RWHA 3KPQA 2XV2A 3MLVL 4WOQA 2X16A 1R3VA 4OZGF 1NLBL 1I2NA 1SYTA 1T21B 5BXSA 1AQDA 2YEQA 2ITCA 4OV4A 4DGVH 1UR9A 2PUZA 2J8GA 4G7YL 1LROA 2NQJA 4KFOA 1IX2A 2FT8A 3NH7H 1JXJA 2PDXA 4M6PA 3BAIA 3BZ4A 4BJLA 3ZIZA 3GRGA 3PPFA 2VDIA 1PDZA 2ITEA 3OPZH 5I0VA 2A6JA 3LH2H 2X2UA 1F90L 3O3DB 1A6WL 3FNDA 3S5SA 2CCVA 5IB3A 2ILLA 3SRKA 5JW3L 2ID5A 5AB3A 1XDTT 2BRQA 1J79A 4UZGA 4XMPL 5LNDA 3LQAL 2CDFB 2WBKA 4LOUC 1V6UA 4WY0F 3UCRA 4JM2D 2HE8A 3MW7A 1T6WA 4BEUA 3QARA 2NXYD 1Q6RA 4DN4H 5A8QA 5LCVH 1S8DB 4MBOA 3AT0A 3GD6A 4YS1A 3RJOA 2OSLA 3OF6A 3V35A 4OIBA 3K2IA 3QY6A 2POTA 1KC7A 2YPIA 1KXTA 4YXKL 1SBBA 4GLRI 4LSBA 3ARBB 4I18B 2R51A 3ALPA 3OMZA 2ZKXA 1MI5A 3VXSE 4F0HA 2CWXA 5D2NB 3TVAA 1MFUA 3MVSA 4R9XA 3Q1SH 1XBVA 3FT2B 5I2IA 5H4YA 3O6KL 3F7JA 1JZ2A 4R7NA 3CHRA 1UCTA 3UXKA 1TMLA 5J1TC 2V63A 3P60A 1H3WM 2MRYA 4IQHA 1TPFA 5CIPB 1SY6H 4JO2L 3SDDB 4X6DE 1WBHA 2FYYA 4N2FA 4F93B 2XQBH 2ZBTA 5A16B 4ZFOA 5EA0H 4DZAA 1JDAA 1HW6A 1J5OL 4G7RB 2X09A 1FWRA 1AJZA 3ILQD 2XWBA 3HZKA 5DCBA 3R19A 1U36A 2PEVA 2NNRA 2QR0B 3PGCB 3LN4A 1BOYA 4W68A 4FK9A 2F7OA 1PKOA 2EUXA 1FG9C 1ZBVA 3T0VA 4LE8A 3S36X 2A1WL 4HD5A 3BISA 3BFWA 2D7PA 1E6QM 4LVBA 3FU6A 4U3AA 3PZUA 3RLVA 4GG8B 2OL3L 3G9AB 3GMPA 4GMTL 1E9QA 4MKVA 4PMEA 3ZHKA 3AB0C 1R5YA 1LYQA 5IGXH 4RETB 4FA7B 1X7IA 2ADGA 2V5KA 2P8PA 4FTVE 5U7SA 1SVCP 3O6AA 2ZX7A 2XWTA 2C4FT 1UKQA 1DDHA 3TBTA 2ON3A 5GRXG 4IJ3B 2IALB 2O5NA 5FB8A 3QIUA 2XZAL 1RALA 1F9CA 1I8LA 3ZW3A 1OWRM 3N0AA 5K4XA 3GKFA 3MMTA 3B7UX 3H9SD 1ZB5A 2DDQH 3T8LA 1U92B 5MHSE 1CLXA 3K91A 1NFAA 5EBAA 4X7TA 5KBLA 4S11A 2H9GB 2QQ6A 2N7BA 3F3HA 3QC0A 3WJLC 1ZJIA 1EHLH 4WSJA 3HFFA 3ULUH 5I23A 1HH9B 3TNMA 1FWHC 1GCFA 4M62L 4XN5A 2F8VA 3ARDD 3WX7A 3IDYB 3IRSA 3P2DA 3LAFA 3VD4A 3U0TB 3B3IB 3HN3A 5EORH 5F2LA 1YNTF 2Q3AA 4HQVA 5E0KA 3MOAL 3AT9A 4QLLA 5F7NC 1WGOA 2HG5B 1CGTA 4C6QA 4MS6A 2HVMA 4K3GA 2QMKA 1Q8JA 1XG3A 1FZJB 4BK5A 3SFWA 5JPNC 1E6ZA 2PYFB 1QD0A 4NP4H 1NGYA 2WZPA 2GTZB 4TVPD 4LVFA 1SNRA 1K8IA 1BHGA 3MV7E 1XTMA 5BU6A 3N2JA 2A4ZA 2VDRH 4JG1L 4WHCA 4A67A