3A4AA

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 238
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3a4aA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4aA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3a4aA02
1UKSA 1EHNA 4CKQA 2OW7A 3BAIA 1O7DC 1N82A 2ZX8A 1OWQA 3OGSA 2W63A 3W6MA 3OG2A 1WZLA 2NT1A 1LLOA 3ARZA 1HJXA 1D3CA 2WSPA 4FMVA 4D1JA 4TX8A 5M17A 1E43A 5CGTA 1DWFM 1R8LA 2YL8A 1UASA 2E8YA 2ZUTA 1UQZA 1V02E 3AS1A 3S2CA 1EGZA 3F5LA 2XWDA 2FHCA 2WPGA 4D6JA 3WKZA 4GI6A 4WKHA 1ZS2A 5A3HA 3NUKA 1JYNA 4QCFA 3WQ4A 5E6ZA 4AZBA 1JDCA 3RCNA 2PWDA 1W9XA 3BC9A 4CD7A 3T09A 4BA0A 2YDSA 1M53A 2D2OA 1GZJA 4HOZA 6TAAA 2EPKX 2W4XA 4Z2JA 1MQQA 1JAEA 2ESCA 5I6SA 3WH8A 3BUBA 3JUGA 5E0FA 4TTGA 4NZJA 1JF6A 1TFVA 1YQ2A 3DYOA 3VNYA 2WVSA 3K1DA 3AZRA 3RJYA 4DWSD 2ALWA 1JNDA 2F7OA 1B30A 5A94A 3A3HA 4ACYA 2W61A 4Z2IA 4RL3A 2J7HA 1B0IA 3A21A 3K8LA 3CGTA 7A3HA 3MS8A 4WSJA 1ESWA 3FW6A 3AIQA 4PMXA 4J3SA 3SCWA 1TQTA 3WD3A 1UD2A 1GOWA 4GIAA 2WVVA 3CZEA 2VI0A 1WDQA 8A3HA 3WY1A 3ECQA 3BUPA 1S46A 3WD1A 1V3JA 1H2JA 2DT2A 3GXNA 7CGTA 1BYDA 5ABHA 4YPJA 3AXIA 2WC7A 1CGTA 1CYGA 1HJSA 4AZCB 2G3IA 4EANA 1MW0A 4S3KA 2JE8A 1VIWA 2UY3A 3EJQA 1E4IA 3WUFA 1ZJBA 3HMCA 4XZBA 2FGLA 1J0HA 1E73M 3FN9A 3RM8A 2WM0A 3GNOA 3ZJ6A 4GZIA 1C8XA 4FLQA 3J7HA 1W9PA 1JDAA 3VX1A 3K46A 1TA3B 1JYXA 4MB3A 2CIPA 3AHVA 4W84A 2VO5A 4D6EA 1WP6A 2QPSA 4NI3A 1VRXA 1QHZA 2EEXA 2FE0A 3CHDA 4AZGA 2WMGA 3NYDA 1NQ6A 5M3WA 3WNMA 3LXBA 2A3BA 4PYSA 3CZKA 1ZBWA 4TVCA 1ISZA 1W3HA 1ODZA 4WF7A 2BHYA 1CZ1A 4W86A 3QHOA 3VX0A 1R87A 3EMQA 3AHZA 4J3VA 2V3EA 1UWSA 5E1QA 2YBTA 1JG9A 5A6BD 1JL8A 2F1BA 1HKIA 1TVPA 3W27A 4WIWA 3VIGA 3VMOA 4KMQA 4JL2A 1EH9A 3S6TA 2V38A 2E9LA 3IGUA 3GDBA 4OKDA 3GBDA 3W6LA 3N04A 2CETA 2WZIA 3W0KA 1R75A 5HXMA 2E3ZA 2V3FA 4NXKA 3A22A 1DP0A 4PMDA 2WVTA 4UCFA 2W62A 4P8XA 4D1IA 3CZGA 3LRMA 4P8WA 4PTXA 4CN6A 3HG3A 1TG7A 1FA2A 2X1IA 2J78A 3MUIA 3AXXA 1OT2A 3KLLA 4D6FA 2VZSA 4HTYA 4UQ9A 1M7XA 2WW5A 2VCAA 1K9TA 1US2A 4HZ7A 2D73A 1XYFA 4J7RA 2Z1SA 2WHKA 3OZOA 1JIBA 3CUFA 2O9TA 4OBSA 4CVWA 4FNQA 3ZR5A 2PF0A 1GVYA 2J79A 3BCDA 3SCNA 3VIMA 3SURA 3MO4A 3SCTA 4WLCA 1HNYA 4PMNA 3ARVA 2CITA 1KTBA 3CO4A 4JHZA 1V6XA 2CHOA 3A4XA 2G3JA 4UZUA 3BVXA 1R46A 2D1ZA 3NIYA 3I3DA 5JIPA 1DWJM 3AHYA 4HA4A 3A4AA 1BG4A 1L8NA 3WDJA 1GCYA 5TD4A 1E6SM 3EDEA 4UOQA 3B9EA 3MMUA 3BAWA 4GINA 2Y5EA 2RGLA 5E9AA 5JBFA 1JZ4A 3AQUA 1QWNA 2OLHA 3ARSA 3ZO9A 1E4LA 3WD4A 2J75A 1CXFA 4HZ6A 4DM2A 4TXEA 1WDRA 3VGGA 1D7FA 2FYVA 3DYPA 1QNPA 3VGHA 3AYRA 3BUIA 4A3YA 2UY2A 1NOWA 2OSXA 1VFMA 1X6LA 1ITCA 3SUWA 3T0BA 1HVQA 2W67A 3MUZ1 1LL4A 1US3A 2J7EA 3EMZA 5E0CA 5ABFB 1E6QM 4AC1X 1HXKA 4E4PA 1LG2A 1HVXA 2WSKA 3AZSA 5IFPA 2W5FA 1I75A 4AZ5A 4ZE5A 4DO6A 1Q4NX 1NWSA 1JZ8A 1CXIA 5HPOA 4H2CA 3AJ7A 4DWSA 3WQ8A 5I23A 1H3GA 5AC4A 4LYPA 7TAAA 4ZXOA 1V08A 2D24A 2D0FA 5BXPA 2E0PA 3ARWA 1NWUA 5CZKA 3MV01 3MUY1 3VILA 1H11A 3FY1A 4H04A 4JHOA 3BVWA 1E1FA 1FH8A 5A8OA 1ISXA 3G6MA 1MXDA 4JIEA 2XHYA 1UWIA 4X0NA 1E6RA 4UQAA 3APGA 2VUYA 2WMKA 1C7SA 1QNOA 3DHUA 3N13A 3PZOA 3CH9A 1E3ZA 3LRLA 3PBGA 3AMKA 4NRRA 3OIHA 4KWUA 4CD5A 1WZAA 2X8RA 1OGBA 3UCQA 4FNRA 3IJ8A 2Y8KA 4YHGA 1WB0A 2DSKA 4ML4A 2PB1A 2Y24A 3D51A 2YDRA 1VJZA 3ARXA 5DEZA 1XD0A 1DWAM 2WANA 1J18A 2YOCA 4B3LA 3GXTA 4D6CA 1UKPA 4AMXA 5FL1A 2BY3A 4CD8A 1UOKA 5GPRA 1HN1A 3POHA 4UFMA 1HJVA 1NM9A 3FAXA 2BS9A 1P6WA 3A5VA 2V5CA 1GOKA 2ZE0A 2C8NA 3N12A 2XVNA 3EJSA 1HL9A 2WHLA 2VNCA 1UR2A 3WDRA 2ZX9A 1T0OA 3TA9A 2FHBA 1QI4A 1CECA 5JUVA 4GQQA 2GJRA 2Y8VA 1G94A 4V27A 3GXDA 1XCXA 3D4YA 1X6NA 2GK1B 3BMVA 1UH4A 3RO8A 1R33A 3L4ZA 3F5KA 1HT6A 1WCGA 1MQRA 3TTOA 1SR0A 3LX9A 4UTFA 1SMDA 3D50A 4CCCA 1FHLA 1J0JA 4AEFA 1MYRA 4W85A 5A6BA 2XJ7A 3DC0A 4UOJA 5IDIA 1ZBCA 4AXNA 4DO5A 1E6NA 4LX4A 4PMYA 4BS0A 2DIEA 3D5HA 4U2YA 1OCQA 1J0KA 1W9DM 1CENA 1SYTA 1E6PA 3GYCA 1BGGA 5D4YA 4UNIA 1AQHA 3N9KA 2HISA 3PZVA 4UQEA 2QPUA 1J0ZA 4MNLA 2OWCA 3FNDA 4HA3A 3OLGA 5EBAA 2VT0A 1EO7A 5FCZA 3FAWA 2ZXDA 1NOFA 1BPLB 3M7SA 5CPQA 5A6SA 4QDMA 1V3MA 4Z2KA 1G5AA 5LA1A 4ATWA 2WKGA 2WNWA 1H09A 5A95A 1OGSA 5F7UA 5LA2A 3WF1A 2VVSA 3WL1A 3KWXA 4XX6A 5A8MA 3FXYA 3WD2A 4D6IA 3BUQA 1UD8A 3AZTA 3WF0A 1UA7A 4JL1A 1B3VA 3WY2A 3WUGA 5HNNA 4GI9A 3U57A 1W3KA 1E4MM 4AD4A 4BQ3A 3TP4A 1B2YA 1H5VA 4MJ4A 3LMYA 1WDSA 3VDAA 2VZUA 4U5IA 4NZCA 1IZKA 4UQBA 1VENA 2F7QA 4F66A 1WZKA 1XH1A 3WENA 4XZWA 3GBEA 1MXGA 3FHQA 3DX1A 2QMJA 3L4UA 4AD5A 3AI0A 5AC5A 1E4NA 3KEHA 3IJ9A 4RE4A 1V3IA 3WF3A 4B15A 3EMCA 1UD3A 2F8QA 6A3HA 1MWOA 4OZOA 2WHJA 2CBIA 4C7FA 3RMEA 2DSWA 2PWFA 1KWGA 2CCRA 1GVIA 1E6XM 4GO9A 3GNRA 1UD5A 4AIEA 1PAMA 1BLIA 3ZQ9A 3AYSA 4FNPA 4W87A 4V2XA 4J3TA 3MI6A 4Z2HA 2JALA 4U3AA 2AAAA 4MNKA 3MU7A 5M5DA 2XVGA 1JI1A 1KCLA 1EO5A 2CHNA 1Q6DA 4GQRA 4TVUA 1TQVA 2VX6A 3VGEA 2ZUWA 4TUFA 1FFQA 5EMYA 2XIBA 5A8QA 1VFFA 1ZBVA 1QNRA 2XM2A 1RPKA 6CGTA 2X09A 1C8QA 1NWTA 1PIGA 3RILA 1PBGA 3GXMA 1FP9A 3AMLA 3L2LA 1HF6A 4EKJA 1EQCA 3WDHA 1D2KA 4AD1A 5GNXA 2WVVB 1UQYA 4P7RA 1KXHA 1HP5A 3BSGA 3ALFA 5DMYA 2EPNA 5CPTA 2YFOA 1MFUA 4D6HA 1C92A 1QI0A 2WMJA 3W53A 1BTCA 4KRTA 4AD2A 5A2BA 1O7AA 4ZENA 2XN2A 1U30A 4JKLA 4M24A 3B9AA 3ARPA 2VL4A 2DGAA 5BROA 1QI2A 1KBBA 4XB3A 1B3XA 3CZ8A 4FK9A 4WSKA 5CG0A 2O92A 2VRQA 2GSJA 3SCVA 4ZXLA 1QI3A 5A6MA 1W9UA 3A24A 4MAVA 5EB8A 4TTUA 2YKKA 3POCA 2MANA 2ZX7A 2ZXBA 2GJXA 4QLLA 2GJPA 2F7RA 1GUVA 3AS2A 2VZVA 4YN5A 3VTRA 1W2VA 4X0VA 1UZ4A 2QV4A 3BVUA 3PHAA 1KB3A 1OD8A 2J7GA 4AISA 5C70A 1E15A 2J7BA 1V0MA 1UD6A 2EABA 2BNJA 1KFWA 1ZJAA 1UHVA 3EDJA 2VR4A 3IAPA 1H0GA 4URIA 1HL8A 3A6OA 4NX0A 2J4GA 1PS3A 1I1WA 2J8GA 4QLJA 5I0DA 2IXUA 3CHCA 1UWQA 1BQCA 3CMGA 5IHRA 1EIBA 1QBBA 3WD0A 1QOXA 1M04A 5CSYA 3PZNA 3ZR6A 2X2YA 5BRPA 2NW0A 3WH7A 3PTKA 4B9YA 1KXQA 2F61A 2YL6A 3PN8A 4CD4A 3S5ZA 1EXPA 5FOOA 1V3LA 3CUGA 2IXVA 3WMBA 1TZ7A 3ARUA 1X1NA 4M82A 2BVTA 4DO4A 2UY5A 5D9MA 3BUDA 3UEQA 2CXGA 3QGVA 3U5YA 3QR3A 2DQXA 1GOMA 3W82A 2DH2A 1UKQA 1DHKA 2VQUA 5C8BB 4CN4A 3DX3A 3AMGA 2BXZA 3PZUA 2WCGA 4AZCA 3KL5A 1EOKA 2UY4A 4MNJA 1EHAA 2DPEA 1VF8A 2XIIA 1EDTA 3GXFA 2EO7A 2BXYA 5CQ1A 5DT5A 4MB4A 4GZEA 1LJYA 3CPUA 1MW3A 3OGRA 4GO8A 3W38A 2WWDA 3ARYA 1JYWA 1A3HA 2PWGA 3I3BA 2D3LA 1KQYA 1AQ0A 4CUCA 5I24A 3PTMA 5FIPA 3BCFA 1E5NA 5FD0A 3EJRA 4M29A 1J0IA 3OBAA 1PEZA 5A2AA 2ZUNA 3TTQA 4W7VA 1HJWA 1HIZA 2J7CA 2XN1A 5LYRA 4CGTA 3MV11 3AHTA 1V0NA 4IPNB 2FHFA 1EOMA 2FDMA 2WZHA 1V3KA 1H41A 4LYRA 4C7DA 4Y7EA 4KRUA 2QHAA 1FH9A 4DWSC 3W28A 4W89A 2CNCA 4JCLA 1DEDA 3N17A 1QHPA 5LA0A 4EAMA 5CLTA 3WL0A 3NDYA 1BVNP 4AMWA 2EBNA 1W9BM 4HOXA 2V5DA 1BYCA 4J27A 2EPLX 1JD9A 2WVUA 3VIKA 3F4VA 3QHMA 3FHAA 2RGMA 4JFTA 5I2UA 1ISVA 3A4WA 3W81A 4AEEA 1J9YA 2OYMA 1Z32X 3BVTA 4JZ5A 4ACZA 1CGVA 3ZJ7A 3WNLA 3A23A 4P8VA 2IUZA 3VDCA 5CGMA 5EFFA 4E8DA 4DUXA 2DT0A 1ITXA 4MAZA 4M56A 5DO8A 1JZ3A 3RIKA 4AW7A 4MTVA 1CXLA 4AZ7A 4DWSB 4WKFA 4PEEA 2YLLA 4UQCA 1IZJA 1ECEA 1GQKA 3CC1A 4CVUA 3PZ9A 4HU0A 3WQ5A 3BAJA 3ALGA 1BFNA 2WMIA 3DDFA 4JKMA 4AZHA 4EE9A 4BQ2A 3AFBA 4CU6A 1JD7A 2WZEA 4UFHA 1VEOA 1ISWA 1RD6A 1SMAA 4NZFA 1U2YA 1E9LA 1J01A 3WELA 1JNEA 1JXJA 1F4HA 2J77A 3MMDA 3QHNA 4D71A 4PUDA 1IV8A 4DM1A 3N15A 2VX7A 5GNZA 4OOUA 3VDHA 3O9NA 2G3NA 3IANA 1NWRA 1H1NA 4PBGA 4PTVA 1GQIA 3M6DA 2ZWZA 1UR9A 4N42A 4HP5A 3VIIA 3W25A 1BF2A 3PZGA 3CLWA 1QNSA 1TCMA 3B8SA 2XGBA 1CGXA 4JFWA 1KGXA 3WEMA 3VD7A 4TX6A 3W24A 1KBKA 2YL5A 4UFJA 3TONA 2XVPA 1PX3A 2D3NA 3SIMA 4MDOA 2G4FA 1FP8A 5DFAA 2XWEA 4LPCA 2C0HA 2WHMA 2YDQA 1UUQA 4BQ5A 1GOQA 3SCOA 1E72M 3U7BA 3EJPA 3CZJA 1V3HA 3ARTA 3RPMA 3WDQA 2PC8A 3CZSA 1W3LA 3ZJKA 2A3CA 1R86A 3BXWA 2ZX6A 3T0DA 1F4AA 5D8WA 3L4TA 2BY0A 4CCDA 1KGUA 9CGTA 1E0VA 4FF5A 3SUTA 2JIWA 4Q7NA 1GOOA 3CHFA 1OGGA 3WQVA 2CERA 3SUSA 4AWEA 3VGBA 3N11A 3II1A 5ABFA 4UR9A 5BCAA 5D8ZA 2CBUA 2X2IA 2QLYA 4BF7A 4K68A 1L0PA 3T2QA 1E56A 2VX5A 3AIVA 4M81A 5A8NA 2JEQA 4D6GA 4D6DA 2WLYA 1FH7A 4PN2A 1Q6GA 1DWIM 2NT0A 3WH6A 3MMWA 2VVNA 3CBWA 2DSUA 2BY2A 3F5JA 4JKKA 3PZTA 3D3AA 4F9DA 5BXTA 1OT1A 4NF7A 4AD3A 3DHPA 4OIFA 4W8LA 1OB0A 3DECA 3VGDA 1O6IA 4W7UA 3DDGA 3LXCA 2YL9A 4FNTA 1CIUA 2EXOA 1WO2A 4MDPA 5A69A 3HG5A 1VAHA 1E5JA 1AQMA 1QVBA 2WC3A 3RM4A 1UWRA 3WNNA 1HTYA 3UG3A 2E9BA 3UR8A 2EACA 1WE5A 2OYLA 1UH2A 4TOQA 5BXRA 4QCEA 1V02A 3EJTA 5E70A 3EDDA 4B9ZA 1W1YA 1E1EA 3WFZA 4MADA 4DUWA 4P7NA 5IHSA 5DT7A 4PTWA 3LRKA 1A47A 1CGUA 4M80A 2J74A 3U5UA 3BMWA 1UH3A 4U2ZA 1KR1A 3T2PA 1B1YA 2C7FA 4ATDA 1UA3A 4FLSA 4HMDA 5I3DA 3AIBA 3W29A 1MW1A 1R47A 4PMOA 4KGJA 2VCCA 2EPOA 1Y7VA 2ZIDA 2VRJA 3T0AA 2BV9A 1PPIA 5I77A 3TTYA 4KGLA 3BLPX 3VD3A 3TV8A 1QHOA 4J3XA 1MFVA 4UFLA 3GXIA 2F7PA 1JZ5A 5DF0A 2DEPA 1XCWA 5JIWA 2WAGA 4XUYA 1R85A 3T08A 1U33A 1LQ0A 1OM0A 1R7OA 1UWTA 1VB9A 3GZAA 4OOZA 4W7WA 3WH9A 3DX0A 1E0WA 2WKLA 1WKYA 4ZE4A 1QX1A 3WF2A 2GDUA 4LYQA 3UETA 5JBDA 1VBUA 3WBAA 1TQSA 4EK7A 1OSEA 4CU7A 1KTCA 2VX4A 2PBOA 3LPFA 4AZIA 2Z1KA 5M03A 2WCSA 1Q6EA 4V28A 4BCEA 5JBEA 4QLKA 3NSMA 3K4AA 3GNPA 4F79A 1GNXA 1G1YA 2JIEA 1OIMA 4AY1A 3N18A 3IK2A 1GQJA 3ZIZA 4M8UA 5KZ6A 4IM4A 5HDRA 4OUEA 4J28A 1CLXA 5D9OA 3VSVA 2W91A 1JYVA 3VD5A 1XSIA 4PMUA 1KQZA 1WPCA 2XVKA 1LG1A 4W88A 2CBVA 2DH3A 1GOIA 1QW9A 2NSXA 3OB8A 3N1AA 5AYIA 3B9DA 3WF4A 1BYAA 3CMJA 1Q6CA 2ZXQA 3BAYA 5AYBA 1NH6A 4GI8A 4E2OA 2BY1A 2VMFA 2OWWA 2GJXB 5HOSA 4LGXA 1GHRA 1W3JA 1JDDA 2V3DA 1DWHM 1NOUA 4X9YA 2G41A 3CUIA 1I1XA 2J7FA 2XN0A 1K9DA 1TVNA 1KCKA 1W1TA 2WCAA 3AICA 1ZB5A 5ABEA 2QMKA 4FLOA 2CKRA 1PIFA 1BG9A 3GXPA 1NP0A 3ZM8A 3VM5A 2F2HA 2XFRA 2PBGA 4HU8A 3AMCA 5A6AA 4OJYA 5I78A 2GDVA 3NSXA 3TTSA 2VZOA 4MNMA 1CGYA 1LL6A 1W91A 5CPSA 1GHSA 2VJXA 3MANA 1XC6A 5A2CA 2F1AA 1TR1A 3RDKA 4MB5A 4H8VA 4FNUA 1G01A 2AOSA 3KE0A 1GJUA 1BHGA 4AIOA 2DIJA 3MSGA 1K9FA 1GPFA 4HPHA 1R34A 2ZUMA 2E9MA 1AMYA 4Q22A 3AIUA 2BHUA 1OIFA 2VTFA 4H8UA 3BSHA 3WEOA 4AZ6A 1HKMA 2XYLA 4YHEA 3GH7A 3AS3A 1B3ZA 1KXTA 1WAWA 1WZMA 3CZLA 1V6VA 4IISA 2G8ZA 3H54A 1NP2A 5ECUA 2YA0A 3L4XA 2YBUA 5GQBA 4FLRA 1AVAA 2XM1A 3TOPA 3D4ZA 2BVYA 4PRWA 2F18A 1VBRA 3UERA 1W32A 2HVMA 1JGIA 1CXHA 2ZUUA 5D9PA 1YHTA 3ARQA 5I5RA 1NARA 3AISA 2A3HA 4IPLA 2D20A 5BXSA 4ATLA 4PMQA 3WQWA 3VGFA 2XG9A 1OINA 1TQUA 1XHGA 4PTMA 1UD4A 1LF1A 1QWUA 4H8HA 4F9JA 2A3EA 1ODUA 1J12A 1V6UA 1WNOA 2DSZA 1E55A 2FH8A 4E8CA 3HZ3A 1SZNA 3VUPA 1KXVA 3K8MA 3OLDA 1TQWA 2WK2A 4UFKA 3I3EA 3VMPA 3VIOA 1PX4A 1R7AA 2J25A 4MPKA 1DWGM 1JZ2A 3HG4A 3WNOA 3ZSTA 5CJ5A 4JCMA 1K9EA 3RM9A 4BZYA 4HOWA 1HX0A 4WJXA 3WY3A 1VFUA 3PTQA 4W8AA 2ZXAA 3QOKA 4UOZA 1CNVA 4JAWA 1UG6A 3ZOAA 1C8YA 2UWFA 2EAEA 4F8XA 5A8PA 3VINA 4HMEA 4Z2LA 4GKLA 2XPKA 3BLBA 1XSJA 2OSWA 4AIUA 1C3FA 2J62A 4PMVA 1MVYA 2ZICA 3M07A 1WDPA 4W5ZA 2VURA 2VRKA 3VSUA 2J8FA 2JFEX 2WC4A 3K8KA 1UZ1A 1HWWA 2EADA 2VR5A 4U31A 1HXJA 5HBFA 4ACZB 1XH0A 5KEZA 3OA5A 3VO0A 3KL3A 1TUXA 1C90A 1W1VA 3VPLA 1TA3A 3O2LA 4A3HA 2X2JA 4JFUA 1J0YA 2J47A 2ZX5A 1CLVA 2YA2A 3NDZA 3VU2A 4AD0A 4C7GA 4H7VA 4CD6A 2W92A 3U7VA 2YA1A 4GZJA 1FFRA 4ZEPA 3VIJA 2CYGA 1H4PA 3THCA 1RH9A 4D72A 5AY7A 2WMIB 1BYBA 2OW6A 4NXSA 4AYGA 1HKKA 3WQ6A 3LPGA 2BHZA 4AYSA 1KWKA 3MUAA 1VEMA 4CN1A 4OBRA 5D9NA 3VKKA 2A3AA 1CTNA 2ZUVA 3M46A 3WBEA 4PCTA 2WWCA 1XGZA 1B90A 2EQDA 3L4VA 1RP9A 3UG4A 1E71M 2JEPA 1PJ9A 4B16A 4JFSA 1HJQA 3GM8A 2FH6A 5A6JA 2VQTA 4MB1A 5A6KA 1ZBKA 2DT3A 4U5KA 3VDBA 3SCSA 1TE1A 2V3GA 1QNQA 2D0GA 2OSYA 1XRVA 3L4YA 3VIHA 1EA9C 3EDKA 4H41A 3CV5A 1W9VA 4P7QA 2XVLA 4W8BA 4LXFA 1PZ3A 2PI6A 2XTKA 2OWXA 4OGZA 5EFDA 3ZMRA 1CXEA 4HA1A 1KGWA 1FHDA 4PUEA 3S5YA 4J3WA 1G9HA 1BSIA 1UR1A 3CTTA 5E6YA 1V6WA 5GNYA 4CU8A 1E3XA 3SCPA 3AIEA 2B31A 4ZFMA 1E6ZA 3GH5A 3NJ3A 4GPNA 3VOCA 2W66A 4DUVA 5I79A 1EDGA 1GW1A 5CXPA 3WEZA 1Q6FA 2WB5A 3QOMA 2YJQA 1W1PA 4N0RA 3H55A 3OLEA 1V03A 2WMHA 2X2HA 4UQDA 1FOBA 2XSAA 2GVYA 3WY4A 2VC9A 3EJUA 4HMCA 3VD9A 2WMFA 4NSBA 1E40A 1JF5A 4IUGA 3KZSA 2WYSA 3UG5A 1M03A 2Q8XA 2EJ1A 1M01A 2E4TA 3KLKA 3L4WA 3UR7A 3SUVA 3IJ7A 5IXEA 3LXAA 5BWFA 1LWHA 1G0CA 1ZL1A 3VVGA 3O6AA 2X0YA 2WBKA 4CCEA 2IGTA 2YIHA 5A6LA 3NCOA 3OGVA 3PZMA 1XSKA 3VD4A 4UZSA 1HP4A 1GONA 1UR4A 1VJSA 1XH2A 1EDQA 1UYQA 1PZ2A 3HN3A 3BAXA 4PCSA 1BAGA 1BVZA 3OLIA 3DX4A 2YLAA 3CIVA 2TAAA 1UR8A 3ZT6A 2O9RA 1QW8A 4UFIA 2XGIA 3BLKA 3AS0A 2ZUSA 1CPUA 3PZQA 1H49A 4R5EA 4RE2A 5E09A 3GTNA 1HJUA 2XFFA 5IFTA 3IAQA 1SFSA 2QF8A 3EDFA 3WFLA 1OBAA 3L2MA 2DSVA 5A1AA 4WKAA 3BGAA 2ZOXA 1KR0A 3CUHA 2D0HA 3W4RA 1JFHA 1XV8A 1C93A 2EPMX 1UWUA 1CWYA 1UKTA 3D52A 2O9PA 2WBGA 1JI2A 3ZJ8A 5ABGA 4FNSA 4JFVA 4U33A 4J3UA 1UR0A 3WSUA 4B3KA 4AMCA 1LWJA 2GUYA 4BQ4A 3K4DA 1JZ6A 2D22A 4NRSA 4P8UA 3VIFA 3ZT5A 1W2PA 4QP0A 2BVDA 4P7OA 1JXKA 2VCBA 3AOFA 3VIPA 1TMQA 1C91A 2X05A 3AIRA 1VFOA 5BRQA 4GXPA 3VNZA 1E70M 5CLWA 2DDXA 1ZU8A 3WNKA 2X0HA 3DYMA 4PSPA 2DT1A 1BGAA 1E0XA 1IT0A 3SCQA 5HPCA 2YFNA 2XSBA 3MSDA 2VZTA 2WXDM 2VOTA 4P7LA 4MJ2A 4W5UA 1B3WA 4R27A 3ARRA 5FKYA 5C71A 8CGTA 3H53A 1VEPA 2WLZA 3WIJA 1DTUA 1OD0A 1JAKA 3AIWA 4Z2GA 1K6AA 1MW2A 1PX8A 3EYPA 3AMDA 5FL0A 2Y4SA 3VM7A 3HJEA 3BH4A 1ISYA 3OZPA 3WUBA 4QFUA 3NSNA 2AMGA 3SEPA 3HG2A 3EBVA 1CGWA 3WMCA 3E1F1 3DX2A 1QBAA 2GK1A 4A4AA 5BYWA 1QPKA 1EQPA 1B3YA 3CUJA 4PMRA 4W93A 3MKKA 4S3JA 4PSRA 1MQPA 2D23A 2BFGA 2ZWYA 4KH2A 4PMZA 4RE3A 3LPOA 4L4OA 4U3CA 1J11A 2CKSA 1JZ7A 1XD1A 3BVVA 3T2OA 3LPPA 1XYZA 3W37A 4HZ8A 1B31A 2JF7A 1J10A 1V0KA 2E8ZA 2XUCA 2CBJA 3RJXA 3VSTA 1UKOA 3SCRA 3SUUA 4L4PA 3W26A 5CSUA 3SCUA 3WDPP 1HKJA 1RP8A 3ZT7A 3GH4A 4M1RA 2G3MA 2J7DA 3CZNA 2GFTA 3UESA 3WNPA 1V6YA 3G6LA 3THDA 3AROA 1QI5A 1V0LA 3HU7A 1CXKA 2CPUA 3WH5A 4QAWA 1GQLA 4XV0A 3A47A 1GORA 3WUEA 2CEQA 3WDIA 2PWEA 3AXHA 1CEOA 3BAKA 2Y2WA 3VMNA 2FGZA 3PZIA 3WN6A 4TVDA 3AHXA 2E40A 4LQ1A 1GJWA 3WMSA 1B9ZA 1C7TA 3KL0A 1H0IA 1CBGA 1CDGA 3CHEA 4WK9A 2O9OA 2OYKA 3ZSSA 2CESA 2PWHA 1JFXA 1LL7A 4HPGA 2JF6A 2XFYA
chains in the Genus database with same CATH superfamily
5FO2A 1BD2A 3N2BA 1QKZL 4ISVB 5DEFB 3QIUA 2ICWB 5L88L 3B40A 1SY6H 5IBXC 3W6MA 2ZYSA 4OQ1A 4IG2A 1T5WB 4ONGL 4JG0H 4I5BA 4OFYD 4D9LL 1S1PA 1V02E 4FR1A 2GSIA 1AMKA 4UTAH 1XBVA 3WQ4A 2ZCGA 4ZXBA 2HTLD 2MQ0A 1TYGA 4HOZA 6TAAA 2EPKX 4NWUL 5GRVK 2X1QA 3UVIA 2WXNA 6XIAA 3B9VA 2E7LA 1JNDA 3KW7A 3E0IA 3UWVA 2R56H 1V8HA 3VK5A 4RL3A 4L8SA 5EEWA 3KLSA 2Z7YA 3GU9A 2V33A 2HLAB 2Z1VA 5GSRA 3MR9A 3BLEA 1WDQA 2E25A 3JSSA 2R83A 1YC8A 5BO1H 2DQDL 1V3JA 1JHLH 2A3TA 5GISL 4LASL 4XBEL 1G7IB 4AX6A 3O6FB 2BM3A 2J9ZA 2EIJB 2J2ZB 2VMCA 2O72A 2BRRH 1ZS8B 3EJQA 1LQBC 3GZOA 3OZYA 3D25B 4JTIA 4D8ZA 2QCDB 1F4YH 3CFBB 3QUKB 4DSYA 3CAQA 1SZGA 4JPWL 5J12B 5FM5O 3HS8A 2X4NB 4FABH 3W6YA 1R3KA 4NKMB 2GGIA 5DYFA 5G4MA 1J48A 3QUMA 4X7SH 4NI3A 5GXBB 2EKCA 3SYQA 1PB0A 4RFNC 1G1KA 4J3VA 1UWSA 2GTWA 4LK4A 2J6EA 4WWKA 5K9OA 2QCHA 1QLEB 1JJUA 4CC0A 1IGYB 3EFDL 5ERWA 1OX4A 4AAJA 5D1XE 5HULA 4K71C 4NZ3A 1U8JA 2LTQB 3A22A 5LQBH 3QYMA 3LZRA 3VTMA 4EVZA 2FVMA 2E77A 4JM0A 1M7XA 2NXZC 3MTRA 1E2ZA 2OEMA 1UJTA 4QRPA 5SX5K 3KPSE 2B16A 4ZAKC 3DESA 3FYYA 1MHCA 4WUKH 1RQBA 1NCCL 2P52A 2B15A 2A79A 3SE4C 2ED9A 3H24A 2G3JA 4DZ8B 2VLKE 4QKXB 4ENED 3K5XA 4JQAA 2X88A 1KM1A 1RULH 1KOAA 4LVHB 1F3JA 4J39A 1JZ4A 3E0VA 4WFEE 3HFMH 4G6AD 3L1GA 2PP7A 1EEQA 3ARGD 2I7GA 4ZQKA 2R9HD 4N5EC 4TV3A 1QNPA 2VEPA 2KZKA 4YK4B 3NGJA 3WFHA 1FYTA 4PY8I 1HVQA 5ALCH 2IFFL 1TEGA 1C1EL 4JEQA 2X1XR 5LGKA 4JFFB 2ZAIA 3VJ6A 1HXKA 4BQ6A 2GJNA 4OUUA 2HG5A 4S2BA 5EORH 1T96A 4L1LA 3GHTA 1I3UA 4KWSA 3HV9A 3VRIA 2WQWA 5CZKA 2D7OA 4YHLL 4JY8A 5KOMC 4G9FB 1XUUA 5I15L 1U22A 3MLRH 1E6RA 4RZ5A 4MZYA 2EDBA 1M3IA 1U3YA 2AW2A 2BFVL 1HIMH 2E5BA 4R33A 4I2XE 4PM1A 1WZAA 5BMXA 5E8OB 4LVBA 3IJ8A 1FDLL 5DJAB 3RY6C 4YHGA 2VISB 4JFDA 3ZRCC 2FWUA 1VJZA 1BIHA 1IZCA 4O00A 3QUMH 2E28A 1FGVL 2ARWA 5LUMA 4M93B 4QJ4B 4N0UE 3ERPA 4TO8A 4XGZB 4K7VA 4Y4HA 1QPXA 4DKAA 4Y19B 1MI5B 4G6KH 2J6EH 1HILA 1SLVA 1K77A 2YZ1A 3H2AA 5T1LA 3V4UL 3UWYA 3PHQB 2EYRA 1MWAH 1X6NA 2DL2A 1LEIA 1XW8A 1F8IA 1OX5A 5D8JL 5EPMB 1RJYA 3TYGL 4ODXB 1Y5VA 4DFIA 3EO9H 4Q8BA 3Q6FA 3DC0A 5IDIA 5D7SH 4RFOL 3MRMB 4LBRA 4PJXB 3B9KB 4M4RA 3X14A 4Y4FD 1RUAL 3PZVA 4HA3A 4Q7DA 1F74A 4R9OA 5KW9H 4UCGA 3BZ4A 4GW5B 4F8LA 2RJMA 2BP5M 3EWWA 1OGSA 4OZIB 4L29A 1QOKA 3SSGA 5E99H 2J8OA 2V2WB 4MVAA 1SBSL 4NWTL 3H4XA 3W11D 5EUKB 1M9HA 4NILA 4YSSA 1TWSA 4AD4A 2GI0A 4N2KA 2E5CA 2WSDA 5FECB 2G50A 2GSGA 3NCJH 4BZ2L 5EU6B 4OLEA 3TUUA 5IQOA 1JNLL 3PWPD 1IZKA 4GUPA 1VENA 3M4HA 3WENA 1ODAA 3KEHA 4LBEA 1V54B 3KS0H 1S7TB 3RMEA 1SO3A 2X9XA 4W87A 4MJ5B 4V2XA 4XVOA 5A6IA 5HD8C 2DEXX 3QQNA 4O02B 2AV7B 3SDDC 4TVUA 1FFQA 1LTDA 4R0LC 2NLYA 5K1VA 4HG4K 5FUZH 5D7JB 5B1JA 4AD1A 3C8HA 3PUOA 2XACC 5AVVB 1FLRH 2Q3OA 3DBPA 1RVFL 4A2HA 3PBYA 3IUIA 1KJMA 1DIKA 1ICPA 3PJTA 5JHBA 4F24A 1NVMA 4OGAC 2AEWA 1GGBH 3KWVA 1K5NB 4FERA 4FP8L 1V93A 4EF3A 3V9CA 4NSKA 4EXAA 3U36B 4W4OA 2C9RA 2DGAA 3K74B 5F6HI 3EWCA 2BVPA 3ZE0B 4OF5A 3M1BB 5TQ2H 4HX1A 1ZNNA 1O75A 1N64H 2MANA 3JYCA 1X5YA 5LGZA 2VH5L 3HO8A 4X0VA 1O5QA 2XZZA 4HS6B 4FZ8H 4X4KA 5DLLA 3E49A 4G1EA 4I1PA 1N8WA 3W2LA 2PYFA 4OLZH 2P8MA 1I1WA 2UXTA 1R1CA 4H25A 4F37K 2DZVA 1OF8A 5FF2A 4Z7VF 2NW0A 4P23D 1A0DA 5ITFA 3ZLFA 1XGYL 2F61A 4UB0H 4CD4A 4GFSA 4HPXA 4B2DA 3NACH 3PAJA 1YPZB 3ARUA 1KB5A 3BUDA 3WG6A 2N1KA 1NBVL 5C0CA 2DQXA 1I2QA 3PJXA 2ADGB 5B8CC 4YWGH 2J24A 1XL6A 4BFJA 2ICWJ 3O9WB 4MJIB 5IVXA 3EWZA 4XVUD 4C4BA 2BVUA 4ZMOA 1TSRA 4MNJA 1W1IE 2JI1A 2EEDA 4LB3A 1D6VL 3BGJA 4WGKA 2QDHA 3Q9QA 3NIGE 4LEOA 1SOSA 4MM1A 1R3IL 4Q89A 3DIPA 3HHSA 4TSCH 3KD4A 4TMCA 3O3EA 3OXRA 2XX0A 5B7YA 1IM3A 5J56B 4NAFB 1H41A 1JCMP 1CZ8H 4KRUA 3PXJA 1NUNB 1ADSA 3N17A 4GBUA 2WNZA 1FNFA 4YFEA 1KBLA 3OX8A 2OX5B 4NO0A 4INFA 3JWDL 4XX1E 1RERA 1G43A 2XGZA 3KTSA 4AEEA 1FE8L 2ZQ0A 4ACZA 3S37H 3RVXD 2BDNH 4MUPA 3N40F 1PTAA 3NJHA 4P8VA 5EFFA 4Q0XL 3H56A 4BK9A 1QMUA 1U8NA 3F7KA 2ZP9A 3KRBA 4TTDD 3PP4H 1AG1O 4KRPD 2F74A 1VEOA 4XSLA 1ISWA 4Y89A 1J01A 3MA9H 3O41B 1LEKA 3LBCA 5GGSB 2R91A 1PVNA 4KPHH 1A3XA 1ILSA 1O9ZA 4GMTL 1HQRB 3P4MA 2ZWZA 4JPSA 5KVDH 1QNSA 4X5XB 2GGEA 1DIEA 5F88B 2EG7A 1QSEB 4MDOA 3VCLB 2C0HA 5K9JL 3KYOB 1BBJB 1GA2A 3LEXB 1A25A 4KKZA 4K7PX 2OSLA 2QADB 3ARTA 4WGVB 3S88L 2BMBA 3T0DA 1SYSB 4ENZA 1KGUA 9CGTA 1EEUA 3FB8A 3C2EA 3SUTA 3CFTA 3AT0A 1MFBL 4JB9H 1EZVY 3VGBA 4E9YA 5CSRA 4JHBA 1KB5H 3F64A 5IV2B 2XH4A 1E7VA 1MF2H 5E8NA 1V7NL 4L4VD 3RWDB 4XP4L 1C9WA 4QIUA 4O0QA 1G6RL 5FKAA 4P46D 4X98B 3QEUB 4KKPA 1P6AB 3WE6B 3KPPB 3PHOA 3VI4A 1I31A 3PAZA 4LCWB 4PB0H 2R2EA 4A68A 5GGSY 5AZEH 5K9CA 2AQPA 3QE5A 1F45A 1I4FA 4MDPA 3C5ZA 1SXSA 5CEYA 1AXSA 3DG6A 4YLWA 2EDXA 3B7TA 4QRSB 1TJGL 2V5SA 1KV8A 4BHYA 4O1EA 4QCEA 4PTWA 3IPEA 1HHHB 4LHUG 3IDYB 2Z0IA 3MJWA 1RAMA 3EH2A 3C2VA 1KR1A 2JKXA 2FR4A 1F3EA 4KF1A 4RGMC 2J20A 4P2RD 6ALDA 5DWUL 1W0WB 4P9MH 5JNYA 3GVRA 4WI6A 4GH3A 4WCJA 3UGVA 4Z7QB 1JZ5A 1UWAA 1HINH 4S1RH 3AAZB 4M62L 4AJ0A 1GC1H 1OM0A 3GZAA 4PJFB 3DX0A 1AW5A 3QNZA 3LKNA 3T77A 2KL6A 3CN4A 3KPNB 2X6VA 4RKAA 4Q9QH 1Y8BA 1PZDA 5JHLH 2CM5A 2R7EB 3MGTA 4PLOB 2Q01A 1I1YA 2JKRM 4RDVA 3E0LA 4TNVF 4HZ1A 4C56B 4HCRL 5B7EA 3S48A 1GNXA 5DD6B 1H62A 5D2LB 3EPNA 2R1YA 7ENLA 2K7QA 4YHMH 1W0VA 5HDRA 4GACA 1BZDA 3UC0H 4HLZH 3M64A 3HPXA 1ZDSA 2XU2A 3DROA 2H41A 2Y7MA 4WNQB 5AYIA 3B9DA 4IPPA 4CSTA 3BPNC 1AUSL 1I8LA 4TQ8A 3UNTA 3WQEA 4GI8A 1CUOA 4JICA 3D3VA 5HJYA 5FJJA 1KV3A 4WDXA 1UZ8A 2QUTA 4TULH 2ENSA 4PPTA 3FYIB 1PYWB 5D7IE 1VACA 5I3JA 1FWIC 3BI9X 2WJ5A 2ZF9A 4HU8A 3DSFH 3QRGL 4M5SA 2VJXA 2K6ZA 2OR9L 4H8VA 4TU1A 2VW4A 4NQED 1EGJA 3B8IA 3ILDA 2YPKA 1F90H 2ZUMA 3THQA 4Q22A 5FA4B 1OIFA 3UYCA 3BD5A 2IGFH 4BFFA 4YHEA 2IG2L 4MMZA 5D9SA 3IETA 4JHUA 4KDTC 1E67A 5IJVB 2PDNA 2Q6WA 1MCEA 3CWOX 5I5JA 3MV8A 3WK0A 4H0IA 1FZKB 3HZMA 3ZYOA 2AANA 3B7YA 2W07A 5HHNA 3DH7A 4Z17A 1W32A 4LF2A 2QJDA 1KB9J 4PJ5B 5EL1A 4LVOB 5LGXA 1UM5L 1R3HA 2JQXA 5FCUH 3ROLA 4X9BA 3VFLA 4DPCX 1I8UA 4NO3A 5D96B 4V1YA 3IJSA 2VR8A 1TQWA 1XTMA 9XIMA 2DZBA 2RHEA 3N19B 5JO5B 1A5LC 3TZVD 4JM4L 5DSCA 4YDMA 3WY3A 5GZNC 1ZCOA 2ZNWA 2O1AA 15C8L 2XPKA 2X6CA 4G8FA 3NABH 5E4EC 4AIUA 5CBIA 5D02A 1EJOL 1EEZA 3M07A 4W5ZA 3RR1A 2HRHA 5BQ7B 1COBA 5PAZA 4ZS6C 2EADA 3L7FB 3OA5A 1TZZA 1D2PA 1NICA 1TVBB 2HCZX 1UWGL 2WTRA 2V2XB 2C3HA 2X2JA 2CWNA 1PZ5B 1CLVA 3WEAA 1U93A 4QG8A 5E2WL 1X9QA 3CV6A 4NJHA 3SJVB 5KSUA 3M17B 2Z7WA 4GLRI 3MRJB 2BHZA 2CXKA 3AREC 4HHHA 4W9IC 2FSEA 2UXVA 2Z31B 3NIFF 1DBKH 4JZNA 3SGDH 4DGWC 3P14A 3SODB 1BVOA 4UTIA 3L7RA 4XG1A 2C1PB 5MERA 1QFWH 1EJWC 2BZDA 1B3IA 1FVEB 2Z34A 3GSQA 2DV0A 4WV1B 3ZU8A 2HWGA 3HVDA 2ISWA 2YPLD 3ML9A 1UXWB 1HHGA 1MFNA 1FHDA 5DMJB 1G9HA 1MHHB 2P24B 3MKGA 4NQ1A 1T22A 4IBTA 3TIDA 4EIZC 5FUCC 1KJVA 2OMZA 5JHDE 3GE7A 3W0WB 1R5VA 5I79A 5BXFA 1MCRA 2NZ1A 3QOMA 4MHHG 4LALA 4HSHA 1FOBA 5CUSH 1JGDB 4F7PA 1XIWC 2A21A 3N6QA 1MCPH 3L4WA 3D9AL 3GS4A 3F6JA 4NUPA 2WBKA 1TTFA 3OGVA 4IJTA 5D70L 4UZSA 1D6EA 5E6IB 2XNAB 5HDOA 1CT5A 3AT9A 2QR0B 3OLIA 1HXMB 2CDEB 3MNWA 3L45A 2CBPA 4ETQA 1KLUA 1J4EA 4Q8PA 4P61A 1HQTA 5KVFL 1UTDA 2QF8A 2IKJA 3MJ6A 1BFOA 2ZT9C 3PWIA 1THAA 3QPQD 1CF8H 3VFWB 2QLVB 4NNBA 4KKQA 4MIMA 4HKZB 3GSUA 4J3UA 1HKVA 4Y8FA 3MP4A 3RWFA 3FGCB 3KVMA 5EF1A 1P2CB 5FC9A 2D22A 3MNVB 5IB1A 1FCGA 3DXAA 4YJZL 3P11H 5AL8A 3USZA 1O5KA 4UM8A 4YHPA 1E70M 4HBQA 1O9VA 4PSPA 4BH8A 4HF5L 4JPGA 1NCAH 2OX4A 3IN2A 1MHPH 3O7UA 4XOEA 4OH2A 2DU2A 2GC4C 3EGDA 3BWAA 4U1NB 8CGTA 4YL2A 3KLAA 1JXDA 3G9AB 1ZEAL 1HNFA 4YMZA 3MRKA 2CLRB 4N5UA 2DB8A 1EKOA 2Y4SA 3VM7A 4YWIA 3VXMA 3N2MA 2ZONA 2ZZ3A 4K94L 5T33L 1WWBX 2QVFB 4PJ9C 5XIMA 2AZAA 3Q1EA 1JZ7A 3W37A 3FEQA 2V2HA 4HJGB 1D7BA 3FV9A 5I8EA 2Y25A 5I00A 3C4UA 4H4NA 4E9XA 3WDPP 3ZT7A 3GD6A 4ENLA 3HE6D 1NBQA 2W59A 4LLAA 4XHJC 1YEGH 4PJBF 5D38A 1AR2A 2WLJA 1GORA 4Z7WE 2MOGA 5DD3H 4JN7A 3ZHKA 4QQ3A 3VMNA 5FF6B 2HXAA 1G0DA 1JPSH 5FEZA 4M00A 5DUBB 5C2BH 3ZKND 4BH7A 4K5MA 1WA1X 3NJFA 3WD5L 1Y0LB 1RURL 4E4FA 5DRXA 5EMLA 5JXEC 2AVFA 1UYWL 1KLGA 2VC2B 2OW7A 1JWSB 3OGSA 3D2UB 3LD8C 3OG2A 2R2HA 1N3NA 43C9A 4NFDA 1E43A 4I0PB 4YZFE 3FCBA 3D39D 4JGMA 2AQQA 3LVTA 2UUDK 1JBJA 2BOGX 3GDLA 4F0LA 4IKLA 2PWDA 3BC9A 2IMMA 3EFOB 3O3BB 1XCTA 2D2OA 2WZMA 1SVZA 4GXWA 1TRDA 3CHOA 5IOPB 2NUTA 3CUPA 1PQZB 2P80A 3K1DA 3RCYA 4ZBCA 3RJYA 2NX5D 1GMEA 3SDXA 3F6LA 4HXAH 3EYSH 4NZ5A 2WXHA 4ACYA 1N6QH 3ZXAC 1NY1A 2C3WA 3NVDA 4M5ZH 4Z7VA 2UWEA 4GIAA 3CZEA 1G9NC 1LO0H 4YIQA 1RKRA 3FQRB 1X5KA 1CFBA 3NJIA 2PO6B 1HJSA 1T03L 1NCNA 1P84J 1A1OB 3LKPA 1GT8A 3ITCA 1AL7A 4EF8A 4XTDA 1AO7E 2R8WA 2ZZ4A 4DQOL 1EZSA 3WTXA 1AK5A 1C8XA 2R0LL 4GMSH 1HL4A 4X80L 1U36A 3J7HA 4LAQH 4PV9B 1M65A 4MB3A 1Z1WA 1F8TL 4HIHA 4S10A 4Z1BA 3LXBA 1PL3A 1BJ8A 3HC4L 1A80A 4QSFA 3RYMA 3Q06A 4XB8A 2WNQA 3D05A 1CZ1A 1DYZA 1GVEA 3ZPDA 3TJEH 2YXWA 2JQZA 3HA1A 2LE9A 2V7NA 4S1SH 2MH4A 1QNZL 5J1AB 4IU2B 3CIWA 3VE0B 4YXHL 4KK9C 2BNRD 2RDUA 5JDSA 1QLEL 3H9SE 3S5LG 2G60L 1DXIA 1QPRA 4HALA 1I1AB 2H8XA 5AB3A 4WI9A 3HPZA 4LF1A 3O6ML 4PTXA 3TN0A 4CN6A 2KLTA 2WW8A 3QAZC 3S5OA 5T1DH 1R3YA 3ERXA 2WWNA 5KVDE 2BSLA 2NTFB 5ICYB 4ZO7A 3B0XA 3CUFA 3BMXA 2HG0A 4QEEA 3ZYJA 5CSSA 1BXCA 2IOIA 5TDPB 3BP4B 3APTA 3VABA 6TIMA 4Q6YA 2I9TB 4E9TA 1A4JB 4HSQA 2CIIB 4P5TA 3NIYA 3I3DA 3HN8A 4ZUVB 5L6YL 2HUEA 5IGXL 3B97A 1BMGA 4LCVA 1GAFL 1ITUA 3GKAA 3TC7A 3QI9B 2Y5EA 5C0CE 3AQUA 5DFTA 1QWNA 4NM4L 4XKYA 1CICC 3MGOA 3ZO9A 2ZYHA 5D93C 4BY3A 5IVXE 5CCKL 4HCLA 3HJ0A 4P5MB 1MQKH 1NMAH 2IH8A 5C0GB 1D5ZB 2IAMD 5GS0C 2CBTA 4E41D 2OP4L 1HVXA 4Y5XB 1R3QA 1INEH 4Z08A 4AZ5A 4YBHA 1ONRA 4DO6A 4CJ0A 3STEA 2INEA 1W1ZA 5E5CA 3CVIH 1HGWA 4QQUA 2D24A 4RV3A 4GXVH 1MHEB 2H3NA 3W07A 2E0PA 1S7SA 3IGFA 3BVWA 4RBPH 2GVLA 2Q7AA 2NUWA 1MCBA 1C7SA 1QNOA 4PRAB 2VELA 3MV7E 2NWRA 2XHNA 3L7EA 4E0CA 5EO9B 4NRRA 2WLIA 2V63A 3VFOA 1JCKA 4LS2A 2Y24A 5I1IH 3AXLA 3HR5A 4LVFA 4O54A 1XDLA 4G8GE 1UOKA 3FU6A 5PCYA 2XVNA 1DE4A 2WHLA 1DXFA 3LNIA 1DPMA 4I7VA 3Q8EA 2A4CA 1MN4A 2RHGA 4RDZA 1A6WH 4A3RA 1EZWA 3L4ZA 1OP3H 3R4IA 4JYFA 1SVCP 4DP6X 4US5D 1RK7A 1NSNH 2ZYRA 4HC1A 2DEWX 2DJ4A 1SJCA 3BOVA 5ILTH 3HW7A 2K4WA 4UOJA 5H2ZA 3JWNH 4M7ZB 4FXKC 2DIEA 1W5OA 5ID0A 1S2AA 4NZUH 1Z9NA 1BGGA 3FCUB 3P4LA 4YS4A 2F38A 1IFGA 4MNLA 3FB6A 4A2LA 1EO7A 2ZXDA 2DDQH 3FMGL 3JTTA 2HFFB 3KP0A 1HEHC 4RDBA 1QFEA 4JJ5B 3MJ7B 4AQ8A 1JHKH 1A50A 4XPAL 2QUMA 4HPOL 1HXYB 1SW3A 3KPLA 3D8MA 4OCNC 1VKXA 1PHQA 3HHMA 4DCQA 3QMTA 4LIQL 1E5YA 1ZA3B 3QDGB 4ODHH 1MEXH 1T1YA 2EH8L 3MI3A 1LRTA 2OL3A 1FFNB 4AX7A 1GS8A 2CO3A 2DSWA 2PWFA 2H3BA 5H6HA 2JJSC 4G6FD 1XINA 3M0HA 1T6BX 4Y8DC 1G7PA 4O19A 4P2QD 3NNTA 5TFSH 3HGOA 1FN4A 3IVUA 3LM3A 2VDNB 3UOAB 1PZBA 2EDJA 1JZEA 3VAEA 2I7SA 5D1QB 4JDYA 4O02L 2F8VA 5F9DC 4J4PD 4IIBA 1QP1A 1TTGA 2GGHA 1FP9A 2QHRL 3ZKXC 1ZAJA 1YECH 2WVVB 1LLZA 1TEYA 5C9JB 3MBXH 1IXOA 2Y1HA 2EPNA 4L9DA 2YFOA 4W4NA 1C92A 4UM9D 5C07A 3KNBA 5A2BA 4ZENA 2VR6A 1XLJA 4RDYA 2VGFA 5G4WA 1M68A 3ZGIA 3TA3B 2VRQA 3R4DA 1NGYA 3WLNA 5I6KA 1F9CA 2X44D 2PXYD 3UTPD 4WQ6A 4TTUA 3DX5A 4IKJA 3PNRB 5LAXB 3A6CL 2V67A 1TYRA 1F0LA 4PRHE 2AQ1A 5IUSA 3TEVA 3B9NA 1RFDH 4K8RL 3MC5A 1E2VA 1CK0L 2OB3A 1TE6A 4S3CA 3MRHB 4KHTH 3HPLB 5EY5A 4R7OA 3CHCA 1BQCA 2BSTA 4BKLA 4C6BA 2H90A 1MRFL 1QSFD 1KXQA 4ZDHA 3PN8A 3LB6D 4NRXB 4QT5B 5HYSG 1WUNT 4QG9A 4XRCB 2X4OB 3QZNA 5C6PB 3EEGA 3W7KA 3IAGC 5L8JB 2FJFB 1V55B 3QS3A 3I6EA 3REWB 4NRZB 4RIRA 3U5YA 3D3VE 4MRCA 4HHAB 3QR3A 4MY9A 3W5MA 4UDTA 2R23B 4M61A 4QTIL 4TLKA 3BH9B 3N1QC 4CSPA 2NZ9C 3LSOB 2A7NA 4DKFH 1D3GA 2VN5A 3DI0A 4H5SB 3NP4A 3BVJA 2PS2A 4L4JA 1UC4A 3I3BA 3NQMA 3PAYA 1WBXA 2V2DA 1NU5A 3K80A 3RX5A 3P84A 2OL3H 3BPOB 1UWEL 4IICA 2BNUB 4RFNB 4PJDB 5C08A 4NENB 5I66A 1UVQB 1R24B 2D4DA 3UXIA 2MNWA 2QTEA 2WUCL 1N2VA 5DYOB 4GFTB 4DN3H 1NJ9A 5ISZB 4Q14A 3L3JA 4YDZA 3N1PC 4PR5B 5LA0A 3UDWC 3MV8E 5D7LA 4K71B 4WO4C 1OEZW 3RKPA 5T1KB 2IUZA 5D2XA 4E8DA 1ZP3A 3DTXB 4KVPA 4XVSH 3PP3K 4OSUH 1KM3A 4N24A 2F53D 3ZLHA 4Z7AA 2EE9A 4ZAKB 1BVWA 2FO1A 2F5BL 3NFPA 4OCXL 2VDPH 3ZO0A 1SBBA 1E5CA 4QDWA 3ZLQC 3NQIA 4MKMA 1AD9A 4GVHA 4D71A 1EX0A 5AFDA 2VAAB 1NWRA 1R6WA 1Q9OA 4OGQC 5MHSD 3F5WA 4B50A 1MRAA 2ICEA 4FA6A 4W9FC 2EDLA 5LNSA 3KJ6L 3MXVL 4QE5A 1QFWM 3DEQA 4K8EA 5I30H 5AN7A 3QNFA 1ROWA 1LWIA 1G1OA 1NWPA 5F8RC 3SCMC 5DMGD 3W9EA 1G9MH 4ZX6A 4CCDA 4CRPA 1L6FA 5JPMA 3L5MA 5E2UL 1E0VA 3UYPB 3MCMA 4JFQB 4FOKA 3RIAK 1UA6H 1J6PA 3RVUD 4GG6E 4JNMA 3AQDA 4NS0A 3AFLA 1YYLH 4K68A 2V9UA 1AI1H 5EMJA 4J5NA 2F19H 3BDYH 2WLYA 4Z0XA 5D7KD 3S35X 1RY0A 4WEMB 3TBWA 3W2UA 3HMWL 4OZFB 5IVZB 2LU7A 3PQYB 4LCYB 2RFXA 3A4DA 4G82A 3S46A 4JNYA 1N67A 4IFOA 3W57A 4HTBA 4IOTA 2YL9A 3OQRA 2CJ3A 4WY7H 5GGTA 2V9RA 1JN6B 3MBWB 5SX4H 2X0UA 4QS5A 3VFUB 2B0SL 4OCWL 1U91A 1W1YA 3O6FD 5G1MA 5KSBA 2ZTBA 3WFZA 3VI4F 1ZHKB 4UAOC 3SD5A 1XRFA 2VLMD 5EHFA 3F7LA 3UBXG 5BMFH 4P9HL 1UH3A 1A1MB 4FQQA 1ZALA 4F92B 1LUCB 2FB4H 1N55A 3GS7A 4PJEB 5T3ZL 2WWOA 4JTRA 4UFLA 4MAYC 5AYUH 5D71H 3BO8A 1T6MA 1U33A 1R7OA 1UWTA 3NQEA 3GY1A 1EAQA 2VWEC 3FFDA 3GZKA 2J6WA 3UETA 5JBDA 1I7ZA 2FTWA 1TFHA 3DO7B 1YJDC 3VC5A 4YBQC 4AZIA 1DSWA 5DHYB 3OAUL 1Q6EA 3U1PA 2OZ4L 3KM1A 3NSMA 2YD6A 1KN2H 1U2HA 4UIKH 1J7VR 4FQHA 2JKTM 4LCQA 3MRNA 4MYWB 1CLXA 1HKFA 1UM4H 5HYIA 3LAFA 2FPVA 3L66A 1Q72L 3IE9A 3Q5YA 1YDPB 3CMJA 3DKJA 2FEDD 2GAZB 1LT8A 4H9XA 5LNEA 4K07A 3WMQA 3N44F 3ILEA 2VEFA 2VXSL 5A43C 2AJXL 5IQ9A 5IJBC 2O7SA 5FV1L 5HNRA 5ANMB 3BEWA 5F2MA 1G6VK 1J5OL 5HA7A 1I0DA 4R0LB 4TRPL 3MRFA 5DVNA 3D34A 2QUUA 2P49B 3S83A 3IFPA 3EUUA 5EU5A 3BK0A 4HPHA 5E4OA 3IDXL 3MRPA 2XYLA 4LW7A 1KXTA 1KPRA 2NLJB 3G6JA 1EEXA 3OVPA 1FFOB 4L9LA 1T3FB 3C5JA 1FSKC 2PGWA 3BP7A 3K0YA 2IDSA 3FTGA 3S9IA 4JFFD 2C9QA 1RIVH 2WBJA 1CDHA 4UV7H 2Y7EA 1GHFL 3X11B 4J3ZA 1OANA 1E4XH 4W1TA 2O5XL 4H7ZA 2PZ0A 3PABB 1V6UA 2DSZA 4PLKC 4G9FD 3UJIH 3GFYA 2H6OA 4R7DB 4LFHD 3I3EA 4TVPE 2IPKA 3VIOA 2WINA 3FRPA 3PV7A 2CO6A 2R1NA 1LO5A 1SYVB 4M6AA 2ABBA 4MA8L 4UOZA 4KVNL 1UG6A 4B3EA 4NQCA 1MLBA 3SKJH 1XSJA 1KV5A 1FIGL 1O6SA 4TF4A 3OXSA 2XPYA 1U83A 1HWWA 2VR5A 4U31A 2IBGA 4Y19D 4YSDA 3EJYD 3CX2A 1EHLH 1MI5D 5HHMB 2UZXB 3UGXA 3CQKA 2HMIC 5BV7B 2HMCA 5F0PB 5KVEL 5DEGA 3SDCD 3FOLB 4Z7VE 4R96B 4NUGH 1O9WA 1ZLPA 1CVRA 3ESVF 4D72A 3K6SB 5AY7A 3U7YL 2AP2A 4FJZA 4JR5A 4EN3C 4S38A 2OW6A 1NBZB 1POKA 2JJUA 4PRPB 3SSZA 1BBDL 4NAMA 4DF1A 3RWGB 3M7OA 4JPVL 4ZTPH 1PLGL 4DJEA 4N1HB 4LSDA 1YDVA 3IE4A 2FZBA 5FA3A 3U1SH 4DK3A 4HKXB 1M7OA 3MV9E 3BHBB 3LOWA 4GGHA 4W8BA 4LXFA 3VFTB 2Q71A 5EUOB 1W17A 4OGZA 4AUBA 2HE5A 1CXEA 1XC4A 3DCPA 4DAGH 4HNTA 5HJLA 1DVYA 1V6WA 5GNYA 4WENB 1DFBL 4J1OA 4O28A 5AYTA 3SCPA 2VXQL 4NN6C 3GH5A 2LGNA 5EU6D 1SHSA 1XCQA 3GPSA 1ETZA 3FT3B 4MXVF 4XCNA 4X0KB 4PFEA 1JPMA 1JQXA 2DJLA 1A7BA 4EQ2A 4I1NB 4UQDA 1MIEL 2WYSA 2YEVB 3IMBA 2Q8XA 3H3PH 1BQGA 4A1RA 4WDIB 1LDPH 4UNUA 4ZPTA 3N43B 3BJSA 3S3PA 3L9BA 1XSKA 1JTPA 3JWNE 1YTDA 2Z8WC 1VJSA 3MREB 3HN3A 4U1MA 3CIVA 2TAAA 1D5XB 5H2BB 3B8WA 4LLUA 1SZRA 5B38B 3IYLW 1UFGA 5D7JD 4N6RA 1XTLA 2EDEA 4KJYA 1SFSA 2JF1A 3B8DA 3HAEB 3CXFA 2O6DA 3QP3A 5A1AA 4BXVA 1I8AA 2OPCA 2V17H 2W0FB 2ZOXA 3FQTB 1T1XA 3NR0A 1UWUA 2KDYA 1AQDB 1K7XA 1S5TA 2PDGA 5AC7A 4MFHA 3MA7B 4KRLB 4LGRB 1A49A 3TV3L 2A83A 2VC5A 1NFAA 2VEIA 4ODTL 3RIFF 4MCYB 1DANU 1RXOB 3QVQA 4XH2B 4MWFA 1BIIA 1L7IH 2A3LA 1XYMA 1B4JL 5I1DB 4PY8J 1ZU8A 3DGCR 2ISFA 2K4AA 1F11A 3LKSA 3WIAA 3T05A 4G1NA 3K2UH 1DE5A 1OD0A 1TTJA 3QUXA 2FNWA 1CFQA 3W88A 4KZEH 2CUAA 4NC1C 5F89A 1MAKA 4FAAB 1MCNA 1Y1UA 4KRMB 4BK8A 2QGCA 4GEIA 2A6IA 4RZCA 2CKSA 2MCPL 2I85A 3X13A 4I85A 4JZOB 4DVOA 5LG6A 3PCYA 3MBFA 4N0YL 4HFWB 3MHFA 4Z78A 4MJID 3B2UC 5DTFA 1WTGT 1DUZB 1I7RB 3R1GH 2HT4C 2D03H 1OTSC 5F71A 3ECWA 3C8FA 1V6YA 4FI8A 4QHKI 3QUGA 3ZL1A 4JHWL 1UWYA 2VL5B 3DXIA 3VCCA 3WDIA 1CEOA 4KAQL 3DFSA 3OYZA 2E40A 1QU4A 1QRNB 1DBMH 1H0IA 2MMXA 4QNWA 2ZKHH 3VXNA 3BWZA 3TYUA 1R0AH 4TQEL 4D0BA 4H9VA 4APXB 2Q8ZA 4JTCA 1K2DB 1HH6B 5IW6B 5LIUX 3NA9L 1QRKA 4CMHC 1P5UC 3PUDA 1L7TH 2Q9OA 4D1JA 4PS4H 4QXUL 5JU6A 4I1RA 1EGZA 2Y2YA 2VZ1A 3T1FB 3URAA 1P4UA 1JYNA 1F3XA 1OTTC 2X4PB 4AZBA 1Z5YD 3LIUA 1A6AB 5FYJH 4MMWA 3KYAA 4ICMA 3MY9A 1CWVA 4Z6AT 4PJGB 3DYOA 1LM1A 1WKFA 5DHVA 2DQEL 1KC5H 3Q2NA 3H2FA 2XTJC 1LK2A 1HOEA 2YRZA 3VG0L 1U3HA 4N9GA 5DJZB 3BJLA 1QXLA 4FX7A 3IPBA 4FI4A 4IS6B 4YSCA 8A3HA 2Y5SA 1E6OL 5JLZB 4Z1DA 1ZHBB 3AXIA 4LZKA 4AZCB 2DN7A 3SDXF 5DGRA 2ZTJA 2YMOA 5EIVA 5GJSL 4X7TA 1E4IA 3HMCA 3RU8L 1ZV5A 4JO8A 4YEEA 1QSED 3ILQC 2UWEF 4Q8QA 4OM1H 4W9GC 1I53A 5CC6A 1GS6X 2QADD 2NQZA 5J9PA 3BYTA 4W84A 2PCPA 3B1TA 3QDMB 1X7QB 3O6CA 3S3BB 2HJPA 4XMWA 1ZBWA 1PO9A 2DLTA 4FG0A 1BJMA 3JTSA 2BOCB 3PPGA 3MJ8A 3TFKD 4GOSA 1ZY9A 4M8RA 1BZ9B 3QSKB 2H2PD 1RVGA 4OZ4A 4MCMA 2K8MA 2J72A 1AS6A 1ZAGA 5F6HJ 3L6FB 1RBOB 2EDQA 1A3LH 1J9SA 2FB2A 4HK3N 4DPQA 3URQA 1DP0A 2GIMA 4LCWD 2A74C 2JB6A 3LRMA 1PBYA 5H4YA 4MCZB 1L6XA 1ZJHA 1QQDA 2MTPA 2GCYA 3OPSA 2A9DA 2IOOA 3F4DA 2DLEA 4HTYA 5CH9A 4OF7A 4I18A 4W9CC 1JGUH 3B0YA 3K5RA 2V7HB 1H6FA 5FLUA 4XMUA 1PZUB 3QFDB 3QGAC 4N2MA 1FZJA 3DC8A 1KXQE 2I27N 1I4NA 1R46A 3ZE2F 4I7ZC 6PAZA 3AREB 5T3ZD 3WQDA 2ARJQ 3G0XA 3B3DA 1FKXA 5C0JB 5I0WA 1ICQA 3G1XA 5BOZG 4XT1C 2KLRA 3N3TA 1M2VA 4KOCA 1CVSC 1G7QA 3TYZA 4GQBA 5DHVH 4BDVA 4PB9H 3HLKA 3CBRA 4O1DA 2H1PH 3EMZA 5ABFB 4NJAH 4C56D 1EAPA 1IT7A 4ZE5A 3GUGA 3DA0A 3FYPA 3H2MA 3NIFE 4OCMC 1L9MA 4CVZB 4LCCA 3OC8A 5IIEB 4R4FL 1T21A 4N90D 1LT7A 3C2OA 1E1FA 5A8OA 1YRKA 4NN5C 3S2LA 2KC0A 5D5MF 2WMKA 4XBGB 1H7OA 3RHGA 3PV6A 3Q94A 3KBJA 2YUVA 4FQCL 1JGEA 1E4WH 3CX5J 2CDGB 2R0KH 1NAMB 4M6NH 4IQHA 2DJMA 3UR2A 1GXEA 1YY9C 3MACH 4PREB 4K8GA 3K1GA 5IB5B 4YSQA 1P6WA 2H6PB 2ZP0T 1LP6A 4K55A 4E42A 3N12A 2VQ4A 2BNQA 3DSNB 2WQSA 1R4XA 4IBQA 3I65A 3WFBL 4QRRD 3UGUA 1E9YB 4NUQA 4ALAC 3IXAB 5DMIH 2GK1B 3STGA 3E8UL 1FL6A 5I3IA 43CAA 2HVNA 3LPWA 4Y5VA 4NNXB 3J27A 2CM6A 1JCTA 2HSIA 4N2BA 2V2CA 3S0CA 2K78A 4HNCA 5A6BA 2XJ7A 3LUTA 4DP8X 1OCQA 5F9OH 3V0TA 2ZA2A 4XNZC 1H7WA 1JK9B 1FCQA 4XE5B 4MMXC 2DS4A 3P5ZA 1IAOB 3QW9A 4LKCA 2WKGA 1AD0B 4PJ5D 5D72L 3NCEB 4Y4KC 4Y2DC 1DVXA 3UO1L 2OTWA 3DGGA 3FUEA 2K0RA 3EOLA 5A8MA 4AYDC 3CFJB 3NEHA 4JL1A 1EJTC 4YGVA 1NCDL 3W2JA 4A6GA 1OW0C 1H5VA 3DTUB 4N0FB 2CLEA 1H3VA 1P7QB 2IOMA 1QWHA 2F7QA 1T0MA 1ZSHA 3ETSA 4QOKE 2Q10A 1TJ2A 1FZOB 1RI8A 1JWUB 1TITA 2E74C 3NIDE 4LF3A 5CSZB 2MQCA 3L3DB 5IJCC 3QHFL 2PN5A 4OFIA 3RE0A 5MKGA 1GVIA 3X2QB 3LV6A 1RJPA 3MAWA 3FCSB 5ADOL 1Q6RA 4OJCA 4Q2ZA 2GJLA 3UVAA 2B4CC 4ADJA 1XAKA 3OKNB 3C08H 2QNEA 3CEPA 5A8QA 3SJVD 1UGKA 4EPEC 3VXTA 5A2KH 3WUWA 2VGBA 4AQAB 1PFOA 2DVTA 4IMEA 2ALDA 1MZYA 2OTDA 3TX9A 4RISL 4FNLL 3A9BA 1OEPA 1F7BA 3LQMA 1UC6A 3NH7L 2H8PB 3PJSB 2DIKA 1KIUB 2GJ6B 5E7FA 5B80A 1X96A 3WLLA 1O7SA 4WSKA 3LD8B 4K6AA 1X7IA 4PJBE 5DRNA 1AGDA 1YAZA 2C1IA 2ESVA 4HK6A 3HG1B 1W9UA 4NVTA 1OP5H 4N2DA 4NHCH 4LC8A 5IG7A 1SDAB 2EUXA 3OR7B 4FXSA 3W0WD 3GSWB 4FG4A 3QQ1A 4LLYA 2FJGB 4RLIA 1UD6A 2VXTH 3K6NA 1ZJAA 5CZ0A 2XXMB 4G5ZH 2FZNA 2ACQA 3GIZH 3X3GL 4LSVH 2C15A 1QBBA 3WFAA 5CBJA 2JCWA 3QDJB 3GLEA 2X0WA 5E6ID 2CR0A 5E5LA 4BYHA 4MJMA 3THUA 4FA3A 3GR4A 1BD2E 3T3PB 1KCRH 3EW3B 4MLIA 4E2VA 3QGVA 1HSAB 5D1ZC 4GAYB 4XC1L 1RUMH 4PJ8C 3RPTA 1FWJC 2WSYA 3PZUA 2YYTA 1JGVH 2J8UB 3SGEI 1HUVA 2MQ3A 1A8JH 4WY0B 5LNUA 1AZBA 4I48A 3OGRA 1AGFA 4GO8A 1ZLUK 5L7XH 3F2BA 3FU9A 1ZRQA 1M1BA 1NIFA 4XVTL 2X7LA 5CJXA 5JZ7C 3GQFA 3C2RA 2P88A 5FYJU 5DQPA 2B2XL 5A2JH 4QNEA 1NANI 4LE8A 1OGAB 2AJYH 1VHPA 2HTMA 4PTUA 5D1ZI 1DN0A 2EDYA 4Y7OC 5FJIA 3HHRB 5TQ0L 4M3KB 4EN2A 4PW4A 4HOXA 1BYCA 1T2QL 3QHMA 3IMRA 4GCXA 3CVCA 3X3FL 1J9YA 2ZOLB 3TPUA 5AVWB 2HK0A 3CQFA 4X4YB 3UJJL 1Y6NR 1KEML 1VPOH 3QUYC 5G4HC 3N1GC 1KBGH 2G2RA 2C9SA 3EOBB 4ZMVA 4M6OL 3VW3H 2C3ZA 3I6KB 4GC3A 3OJDB 1XWYA 3IVKB 4U05A 2PF8A 1WQVT 2HBVA 1AR1C 2X40A 1QNVA 4GSDL 1Z9LA 2XCMC 2DQIL 4NQCE 3CC5B 1JXJA 3NM1A 3QHNA 4AX3A 1EGJH 4HUWA 4YXKH 2IADB 4OLUH 2Y7SA 3TNNB 4OD3L 4HP5A 4JO1L 5U7SA 1HSBB 4Q8OA 4HDIA 1CICB 1NGXB 3G5YB 2FBOJ 5B4MD 1C9SA 3UTQA 2FJHB 4X6EB 1B0GA 2EIMB 3R06B 4F2EA 3RPMA 5D7EA 5IB4B 1W3LA 1DQJB 1FHNA 3TO4D 3CVHB 5C09B 4G5DA 3UTZA 2BY0A 5E9DB 3BARA 5DO2D 3D2UD 2GW5A 4QRPE 4J3OD 2PW1A 3NN8B 4I0PD 4QTHB 5EO0A 1ZGDA 5BCAA 2BSEA 4LFHG 3OMAB 4M81A 4QHNB 1J9RA 2NMSA 4PUKA 1NKRA 3EX3A 5TDNB 2L7JA 4JKKA 4M7LT 4RE0A 3D4GA 1MJUL 3LNEA 1OP9A 3HZVA 4GSRA 1ANUA 5DRIA 1GSKA 3VKJA 2AKRB 1L8PA 4C6IA 2PGEA 4W7UA 3UY7A 4PGZA 1KFBA 5ESVA 3HBZA 4F2MA 1N0LA 2AGKA 3TR9A 1FYTE 4B4HA 5FOBB 1KFAH 3FRUA 3VGAB 5F7FA 4XNYH 4HUUA 3T8QA 2CRZA 1SEBB 4IIEA 4LLVA 3BQ6A 2CCLA 3CO8A 3HMXL 2R6OA 3SDAD 5IROA 3UJRA 1MW1A 5EF2A 2G4EA 5C9WA 1PPIA 1KFJA 2WZPA 4KGLA 1TYEB 5IR1A 3AACA 4FXKB 4LCRA 1KY7A 5L2KA 3DIVA 4LQFL 5KSBF 2KZHA 2CHXA 4ZA0A 1XIHA 1VZWA 3THMH 5FYJE 4APQA 3NZ8A 3BXNA 3EGSA 5GZOA 3DX7B 4KTEL 4JFDE 4XOCA 4JAMA 2VX4A 3FSWA 5M03A 5AVZB 4HT1L 1DSFH 1VBGA 5AW2B 2JXMB 4F9LC 5LBGA 4XBKA 5D4JA 3KOXA 1YN6B 2WAQA 1RLDA 3FO2A 1JYVA 3SQSA 2APTA 1WWWX 1KQZA 1I1AD 2HZGA 2DLHA 5KINA 4MDJA 1AXIB 4UUJA 1R9YA 1ED3B 1XLEA 1KGCD 4EBQL 5CFHA 4HPYH 3LTSA 3IFNL 3U46A 4FQLH 2R2BA 5FGRA 5EU3B 4I3RL 2B9AA 5HOSA 1GHRA 5JW3H 1WFTA 2C91A 3BKYH 5G5DA 1TVNA 2I5YL 2IQ0A 1TWIA 1A7PL 1JE6A 2CKRA 3L1EA 2PBGA 2WCPA 2ZZUT 2P7TA 3I02B 1MIMH 3G5ZB 4HK0A 3IDIB 3OM3B 4ZYKA 3QI9D 3NFSL 5EOCJ 5IB2A 4BSWB 1AD4A 1T7LA 4DEPC 2VTFA 4H8UA 1J87A 3IRCA 1VDGA 3GWQA 1X9LA 2ISVA 4DAFA 1YADA 3JXAA 3VFMB 3FO0H 2EP6A 5FUOL 2WYIA 4XPGL 2X3CA 1HH9B 3T04D 1A7OH 5IQ7L 4BFAA 4JIQA 3HC3H 3VGFA 3GSOA 1TDQA 3G6JF 3WGUB 4GB9A 2PTTA 1JRBA 4MYAA 1V27A 1YEHH 3GMRB 2WO2B 4U1HB 3IKKA 4HNOA 4UAHA 1ZK5A 3RDJA 4FQJL 3QOKA 3RG1C 3RNKA 1KIRA 4HMEA 2YCKX 1GZGA 3G6AA 1FHUA 5I9QB 3OU8A 2UY7A 3CV2A 3G3DA 3KVJA 5E0QA 3FCTA 2WC4A 3NZHH 3HI1A 2WXFA 1TQJA 5DD5H 4JKWA 2AK1L 4FZEL 1N8IA 3GK0A 2NTSP 1KT2B 4O58H 2HE8A 1FNSL 5AAMC 2BOEX 1J0YA 1VFBB 2G5BB 5BV7L 3MA8A 2XYBA 4NERA 5LN4A 3GMMA 4XNQB 5DJ0A 2CYGA 1QTWA 3MBEA 4IRSC 2WMIB 1HKKA 2G97A 3MUAA 5D9NA 4CN1A 2YSSB 4NT6A 2IALA 4Z77A 4PGEB 3B83A 3QIWC 4BINA 2YJLA 3AY2A 1PJ9A 5I1JH 4HQQL 4KIRA 5DVKA 4Z3GA 2X6MA 3C5XA 5CJ8A 2H1XA 4LANA 5A6JA 4MB1A 3BWWA 4PQXA 2EYTA 1BTMA 1JVLA 5SWQB 4G80B 4B5WA 1E5UI 3IPFA 5BNKA 2OWXA 4DZBB 1W72A 3V0VA 3EYUH 4R7XA 1XL9A 1K4DB 4XVEA 3W70A 2GFBB 3EHBB 4CU8A 1IGFH 1R5IA 3DIFB 1SJEB 4WO4B 1E6ZA 2LLGA 1RBAA 1GZHC 3VOCA 3TSMA 4AYEC 2HJKB 3QDGD 1L9PA 3W7DA 2Z1PA 1T89A 2DBLH 2XU9A 4MTMA 3AT8A 3LMZA 1WA2X 4CMMA 3DFPA 5D5MA 1JF5A 4C6LA 3ATZA 4RWYH 2HKAA 4JZJC 4XNXH 4DEFA 3SE3C 1I9JL 1G0CA 5HHOB 2AJVH 3NCYP 4O8AA 1E27A 1IEXA 3VD4A 1GPOL 4JFOA 2WZAA 2Z4GA 1KTDA 4DW2L 3MN8A 3BAXA 3TCLB 2AEPH 4QY8A 5D1QD 2YDAA 3K6DA 3ZT6A 2NNRA 4OIAA 5I7GA 4XO6A 1WCBB 3DV4B 2E7BA 4DGUA 3WFLA 1LMIA 3V4BA 5GS1A 6PCYA 2VEKA 1WUZA 3KBFA 1CT8A 4YCPA 4PUBH 4RK8A 3ZZ1A 2CR6A 1JI2A 4AI7A 5K9QI 3TQPA 4JY5H 5C2GA 4L7ZA 5ESAA 2R1XA 3TA3D 2FQFA 1IWPA 3W87A 4IW4C 3KS6A 2VCBA 3LI0A 5BRQA 4RMWA 1I85C 3EWXA 4O2CB 2KLSA 1M9WA 1C5DA 1KLFB 4FOUA 1WH0A 5SWSA 3F7RA 5MEPA 1ZUAX 4LEQA 4CL7A 1L6PA 4PWJA 5AWNH 4Q4SA 5BU6A 1XGPA 3ARRA 4FALA 4DHGA 2WLLA 3H12A 4RGOH 4L2LA 1KTNA 1HZKA 5B1BB 2YOAA 2YW3A 2W1NA 2E9GA 3TBYA 3DX8A 4DP0X 2V4LA 2YMXH 3SEPA 1IC4L 1Q94A 3DMMA 1TZIB 3D08A 4BUGA 1T4KB 3NPSC 3RGVC 1QBAA 4BCZA 1EC8A 4V1XA 2ZWYA 5LAPA 4PMZA 4L4OA 3BQ5A 1WWCA 2ID5A 5C0DA 1NFDB 1D5MB 3OODA 1JZHA 3RJXA 2EE3A 2XVBA 2VUOA 1QJWA 2OO0A 3SUUA 1E6JL 1P1MA 3CFDB 1W72H 4UTCA 4MA7L 1TIMA 5F7EH 3GGWA 2GEEA 4XSMA 3CH1B 1FWHC 3NQDA 3H8NA 3VKBA 4W9TA 5GRZA 2QT3A 1V7AA 1J1PL 4AY7A 4MAYB 1OM3L 2QQLL 5M95B 3VI4E 5FYLL 3OF6D 4AM0B 2ZXGA 3H4FA 3B8YA 2NQ9A 3E6FA 4DQWA 3SGKA 5BOOA 1YY8A 2ZX8A 4R9XA 2YB4A 5ISZD 4GRSA 1HJXA 2WSPA 1MG2C 1LE5B 5J13C 4ADUA 1ET5A 3N2OA 2F0CA 3WKZA 4GI6A 1ZS2A 4TL5A 3NUKA 3GI9H 4JDBA 2CBQA 4OIIH 1JDCA 2Y8UA 5LIWX 3BQUC 1MQQA 5FR3A 1IAIH 3QG7H 3VNYA 3QEHA 1IC1A 2OV0A 4GT0A 2ZOUA 3NK4A 3JVGC 3HB9A 1E1CA 1OAQL 4ZAKD 4OY9A 7A3HA 1BCIA 4PMXA 5DC4B 1S5HB 2YXGA 1K8DB 1ASPA 3UU0A 1DJNA 1UEYA 4DTGL 4MZRA 2Z00A 1H2JA 4YPJA 3GJEB 3U9IA 4GUIA 2G3IA 2WXIA 4HC1H 5IW1B 3S9YA 3P8JA 4MJJA 2WM0A 4Z5RB 4XP6L 2VDQH 4NIYE 4FL4C 3C60D 4HEMA 3VQ1C 4HN4A 3LHAA 5EZIL 3MZ2A 3CXOA 4HSNA 4OCRH 4DX3A 1UW9A 4QNPF 1DEEA 1BFTA 3SY6A 4P4RB 5IT2H 4AZGA 3CSTA 1NJJA 2PWVA 3LZFL 4Z3IA 3HPJB 1FVCA 1BM7A 1S7XB 2AGJH 1MFAL 4JFXB 4AGNA 1FC2D 3ASNB 4N9BA 5EBMB 1IE4A 4YLBA 5T3XH 1JEZA 3QPKA 3W27A 2PDBA 4JL2A 3S6TA 1ZENA 3GDBA 3NEOA 3N04A 3W0KA 2ESVE 4HGWB 4K0OA 3UZVB 1OZTG 2GTZB 3IFLH 1L2UA 4X4ZA 1HKLH 1TG7A 1T5XA 3AU6A 1LRNA 1XGRB 3CFCL 2AJUH 5E8PB 4JY6A 1AGBB 3O07A 1AJ7H 3M0VA 3ANVA 4ZFQA 3QNYA 4WCYL 1NTDA 4P59H 7PAZA 2ZNXA 2YXOA 2J79A 3D48R 4WOQA 3N9SA 4BK5A 3CIAA 1FG9C 3LCXA 4P2OA 1E4KC 4R84A 5JORB 4BEUA 1KTBA 1Q9LB 5E0KA 4PR4A 1AIZA 3U2EA 3L5XH 1DVFA 4PFMA 1L8NA 1UZDA 2QGBA 4FCAA 1D2OA 3PWLB 1M71B 1JPFB 3TPKA 5IRPA 5TE4L 1Q0XH 4B90A 2NXZB 1JZDC 2Y62A 3OAYH 12E8L 4B5TA 5AKTA 3VGGA 1D7FA 5CCGE 3KPOA 4AQEA 3DYPA 5IHLB 3AYRA 1WUEA 1I3RA 4GJ1A 4EZJA 4HWBA 1HHIB 3MUZ1 4RSVA 3N9GL 5I8CB 2W5FA 3K0WA 5K7JA 2GHZA 4WAFA 4XOAA 4FQ1H 5DJDB 2IWFA 4JRYA 3HIJA 5D30A 4YUEH 4LSSH 3B06A 4ZUSA 3SDYL 3P4OB 1H11A 1ES0A 5FIEA 4Y1AB 1FH8A 2FLIA 3TVMC 2DM3A 2WJFA 3B4UA 3QK0A 1KGYE 4MLJA 1P5VA 4U6VH 1XX1A 1Z5HA 3IJLA 1ZGLP 2YDRA 3ARXA 3NCXA 1NAML 3W86A 2WANA 1M7DA 5D55A 2JI2A 1OAJA 1I8JA 3TS8A 4UTBL 1YPIA 2YD3A 4AVHA 3KW3A 2JLPA 5B7FA 1F2XK 2OLSA 4NM8H 5CPOA 2YQBA 3X17A 1IIGA 4OCYH 3HG0A 2D7TL 3WDRA 3FOKA 2AEQH 3NPUA 5DJXA 2CKBA 1XCXA 4LOCA 5ALBL 4RPPA 2A73A 5GJTH 4PJHF 3KZPA 1HT6A 3RBGA 2IH1A 4NQSB 5KN5A 4FB7A 3M47A 3HUJA 3D50A 4XNUH 2R29A 4AEFA 4WTWA 3AADB 1YMHA 4TKWA 1ZBCA 5I3HA 1E6NA 4MFDA 3DOSA 5E5MB 4JPQA 3ZTNL 3V5KA 1DVQA 4MLRA 5EBAA 3PSVA 1G0XA 2QQQA 1BKSA 1PCSA 3VXOA 2V8ZA 4ATWA 5D6DA 3TOYA 2O5YH 2AJ3A 3XINA 3FNKA 3ELQA 5E08H 4WDTA 3E6HB 5FGCE 3RG6A 3WTYA 5J6GA 1XGQA 5EOCL 3FS9A 1X5XA 1A7QL 4KO5A 3WY2A 2QKIC 4XAPA 5DBUA 3GTXA 5KBDA 1OZQA 2R8SH 2R0ZL 2IPFA 3OHXA 1X4ZA 4UQBA 4F66A 4HG4J 5EF0A 1MXGA 1GIGH 2JVUA 4JY4A 1H7PA 4B15A 1UD3A 3RJOA 1J6OA 1MWOA 1WBJA 4ZO8A 2ZRWA 4OZOA 2CBIA 2J88L 2YBRA 3FJ4A 2AKMA 4HWBH 3SY0B 4X8JB 2NWSA 4NL1A 2Z29A 5HHMD 3ZZLA 4IGBC 3VH8A 3MI6A 5I75C 2CO7B 4XMZA 3ECBB 2TSBA 4GIEA 3DXAE 4ZMAT 4MJ6B 4BD4A 1OD7A 2WMPA 1VC4A 1N6UA 3WLKX 2JGQA 2X09A 3FSVA 1A9BA 5MP6H 1PBGA 3WKQA 4PRPD 4KEUA 4LLWB 4FRWA 1ET7A 4XCFL 5FM5M 3QORA 1YRRA 2WMJA 5C6TH 1BTCA 4PRNB 2VDGA 3KYMA 1XCFA 3VXME 1Z3GL 2WNKA 4J3OG 2PDUA 2YUZA 1HAUA 2G30A 3MQIA 3SDDB 4BIKA 2E6AA 3GHBH 5A6MA 4EMZA 2PR4H 1QCWA 1A5CA 2XN9A 5D32A 2NNFA 2PDIA 1P1ZA 4B5XA 2Y7DA 4ODSL 2CKBH 1E15A 3OKOA 2EICA 3V3WA 2EXWC 1JS4A 4J5VA 1DBJL 3KPQB 1IGSA 5GGTH 5BJTA 2XTJB 3WBXA 1LYXA 4YVUA 3L5LA 4UYQA 2GQ3A 4GHRA 4ELDA 1XDTT 5TE6L 4M82A 1TJMA 1ONXA 1REQA 4OQTL 3AGWA 4KKNA 1LD9B 4OLWH 4WW1B 1IVTA 3US0A 1T80A 5C0EB 1OJXA 3BX7C 1TZGH 1EOKA 1IO4C 2BXYA 1CG9A 1RZKC 2DWDA 1CW2A 4E5XA 1LLAA 2PWGA 3VXPB 3LQZA 3O05A 2LABA 3P30H 1CDUA 5DQDH 2J55A 4NJ9H 2FTYA 5T26A 4HN8A 5LGJB 3MROA 3SDXE 1TZ8A 1JNNL 2B7QA 3GS0A 1S7UB 3VB9A 5B8CB 2WXGA 1TVDA 1EFQA