3A4AA

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 238
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3a4aA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4aA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3a4aA02
1AVAA 1CPUA 4MDPA 3ARQA 2YDQA 3AXXA 1HIZA 1GJWA 1R46A 2G3JA 4Q7NA 1ZB5A 3VD3A 1KWKA 3CHEA 4AMCA 2W92A 4CD7A 2ZX8A 1BYDA 3RIKA 1V6YA 3ZJ7A 1W32A 5JBDA 1CECA 4HTYA 3AHZA 3PTQA 3MUIA 1JAEA 2YLLA 3N15A 1GQLA 5EBAA 4W7WA 1PZ2A 3SUSA 2ZICA 4W86A 4DM1A 4W8BA 3CHFA 3GNOA 4HOXA 3MSGA 1GW1A 1UA7A 3EMZA 2WBKA 1ODZA 1GONA 2YLAA 2EPOA 4N42A 5A8MA 1VJZA 1V3MA 2VX5A 1U33A 1D3CA 4KMQA 1DWHM 2D0GA 1VENA 4OIFA 3CZLA 2W5FA 5JBFA 3EJRA 1HKJA 4M80A 1M04A 3VIMA 4AD5A 3W81A 2CERA 1W2VA 3ZOAA 5IDIA 5JBEA 3OG2A 5I79A 1AMYA 2VTFA 1C7TA 2X2YA 4E2OA 3VSUA 5A2AA 2X09A 2W61A 1K9TA 3WQ5A 2J8FA 3FHAA 4W88A 3CZEA 2WPGA 1HF6A 5BXPA 1V6VA 2BVTA 3POHA 1BGGA 3WELA 3ARRA 1QNQA 1KR0A 1B30A 4FNSA 2XVPA 1E0VA 5ECUA 1WB0A 1H1NA 1PX4A 5ABGA 4P7NA 1MVYA 1FH9A 1E43A 4K68A 5E6YA 2XGIA 3AHTA 5A6SA 3VPLA 3VSTA 1ITCA 2V3FA 1C8QA 3GBEA 3HJEA 1EO7A 1XH0A 1NWTA 3EYPA 3QOMA 4BQ3A 3L4VA 2A3EA 2CKRA 2DPEA 5D8WA 3SUUA 4PBGA 4GI8A 1NWRA 3AMGA 1BLIA 2CHOA 3WSUA 2YFOA 1ITXA 1GUVA 1PBGA 3SCVA 3EDJA 3GZAA 1NWSA 3PZIA 1EDTA 2AOSA 4IUGA 5GNYA 2VOTA 2OYKA 4P8WA 1E71M 2VRKA 2QHAA 4GXPA 1E15A 1CENA 4U2YA 4CVWA 1CWYA 4J3SA 3WIJA 5FCZA 3N13A 3W28A 1VIWA 2DT1A 3F5JA 2VL4A 4WK9A 1VEMA 1HL9A 4P7QA 3ZSTA 2GFTA 2G4FA 2XM1A 4S3JA 4AW7A 1XV8A 1Q6CA 3VDBA 3OZOA 3SCQA 4TUFA 3SUTA 2BXYA 2DSKA 1UR9A 4F9DA 2D0FA 1UH3A 1JD7A 3OLEA 1UWRA 3BGAA 3QHOA 4CD5A 2YL9A 1V0NA 2ZWYA 1F4HA 5CXPA 4Y7EA 1R86A 3CMJA 3KL3A 1FOBA 1WNOA 1J11A 4J3TA 2O9PA 1H09A 4UFIA 5ABFA 5E0FA 4U31A 1QHOA 2OWWA 4DUVA 4UQCA 2DSWA 3PZUA 5CSYA 1W9VA 4DUXA 4D6HA 3N04A 4L4PA 1L0PA 2F7PA 3VGGA 2YOCA 1MW1A 4UFKA 4ACZA 3K8LA 2GJXA 4A3YA 1XYZA 3BAYA 3VU2A 1XC6A 1XSIA 3DYOA 2YFNA 2XFYA 3ARSA 1TQUA 3SCTA 2XVGA 2CBIA 1TUXA 3FW6A 4BA0A 3FAXA 1TQVA 2BNJA 2ZOXA 2CNCA 3WL0A 1B3WA 2GDVA 4NF7A 1BG4A 5KEZA 5D4YA 4TTUA 3RMEA 3MUZ1 1GOIA 4NRSA 1MXDA 1W9XA 2IUZA 3HG2A 2Y2WA 2OSYA 1W91A 2X1IA 2Z1SA 3W29A 3LPPA 2CBJA 3M46A 1YHTA 4WJXA 3BMWA 5A2CA 4TVCA 5IHSA 1UASA 3PZOA 3WH9A 3HG5A 3D52A 1LG1A 1HJVA 5A95A 3WD1A 4AD1A 4NZJA 3CZSA 2XYLA 3TV8A 5JIPA 3WNPA 2XWDA 3VIJA 1UH2A 4MAZA 3SCSA 1E70M 3MO4A 4D1IA 1EA9C 3BUQA 3VGEA 3CBWA 5A3HA 1B3ZA 3FNDA 3WMCA 3L4UA 1V3JA 3F4VA 1TG7A 3SCNA 4RE4A 2XN0A 2WHLA 4GI9A 3A4XA 2V3EA 1VEPA 5I0DA 3IAQA 4PYSA 1XRVA 3MSDA 4AWEA 3VDHA 2WXDM 3PZQA 2DT0A 5E1QA 3FXYA 4TTGA 3ZMRA 3CH9A 1B0IA 2DT2A 3A4AA 1G5AA 4P7LA 3AS1A 2F1BA 2XUCA 1R47A 3B8SA 1QI3A 3D4YA 3VIGA 2PI6A 3W27A 2V5CA 4JFVA 1E6QM 5AYIA 2E40A 2DT3A 1EIBA 1V6WA 3BUDA 2Z1KA 3I3DA 4RE2A 4U33A 1RPKA 4Z2IA 3T2PA 4JIEA 4AZ6A 3NSNA 4HZ8A 4W93A 3GH5A 5ABFB 3BSGA 4CD8A 2ZXDA 4JHOA 4H41A 4LGXA 4TOQA 5BCAA 3OA5A 1BF2A 1WE5A 2J25A 3MUAA 3G6LA 4ACZB 2JEQA 1PEZA 1CXHA 1UD2A 2GJXB 4M8UA 3VO0A 2PWFA 1JYXA 1H0GA 5HPCA 2W67A 3EDKA 2WAGA 1HJWA 1TA3A 1KTBA 1EQPA 4DO6A 1B1YA 1Q6GA 3VMNA 4UQEA 2X2IA 4OKDA 4D71A 2J4GA 1LF1A 4WKHA 1LWJA 4V27A 3MV11 1V0LA 3H53A 2J77A 4EAMA 4MJ4A 1I1XA 2O9RA 2J78A 2J79A 4ZENA 5A2BA 1XD1A 3WENA 1ZBWA 2G41A 3K8KA 1WDPA 3EDFA 5M3WA 4CUCA 4UOJA 4QLKA 1ISWA 4PMYA 3LRMA 2WCSA 2XM2A 5M03A 3BVXA 1R85A 1W1VA 2VZTA 3W82A 4NZFA 1TQTA 2YDSA 3N1AA 1X1NA 1WZMA 4AD4A 2J7FA 1MWOA 2OW6A 4PMVA 2FGZA 1D2KA 5A6KA 1UZ4A 2J7CA 5A1AA 5M17A 4JFTA 2WC3A 5HPOA 3BAWA 3VINA 3BUIA 4QCEA 1E3ZA 1BG9A 1C91A 4Z2GA 3MI6A 4M24A 5I5RA 1TQWA 1ZS2A 3LPGA 1K9FA 5IFPA 1BYBA 1UWQA 1JNEA 5EMYA 3WF4A 1O7DC 4ZXOA 1CGXA 3WNMA 1B2YA 2OSXA 5CLWA 1CEOA 1VJSA 2WVUA 2VQUA 2XGBA 3M7SA 5E0CA 4OOUA 5D9MA 3CZGA 3L4WA 1FFRA 4CU8A 4Z2JA 3VGDA 4XZBA 3W26A 1QBBA 3L4TA 3UR7A 3ZJKA 4AD2A 4AXNA 1BGAA 5FKYA 4ATDA 1L8NA 4URIA 3IANA 3N9KA 1U30A 2CHNA 2ZUTA 5EFFA 2YKKA 1W1YA 3RJXA 3SUVA 1G01A 4F8XA 2JALA 3BCDA 2YA0A 1CGYA 2XIBA 2AMGA 3QHNA 1O7AA 4TVDA 2ESCA 3VX0A 1S46A 2E9BA 4PMQA 3KWXA 1PIFA 2PB1A 1WO2A 3IGUA 1XGZA 3WQ6A 1MW0A 1J18A 1LJYA 1JZ2A 3AICA 2J7GA 2QPSA 1OD0A 5CSUA 3UG4A 2VR4A 3WKZA 1QW8A 4PCTA 4UFHA 2WSKA 4HPHA 3AIEA 1E56A 2WHKA 1J10A 1MFUA 1BSIA 4A3HA 1V3LA 3UETA 4Z2LA 1US2A 1B90A 1WZLA 2G3MA 1KXHA 5FOOA 1ZU8A 3ZIZA 3NUKA 4YHEA 2FE0A 1TA3B 2ZE0A 3QOKA 4D1JA 3EDEA 3KL0A 4NZCA 3UEQA 3RM9A 3PZGA 3U57A 1JZ6A 1NP2A 2EPKX 2VZVA 1SYTA 3WMSA 4PCSA 4P7RA 1J0JA 3FN9A 1TQSA 1E4LA 4XV0A 4W87A 2EABA 1JZ7A 2AAAA 1MQQA 2GJPA 1NWUA 2C0HA 1ZJBA 3HZ3A 1GHSA 1UWUA 4PMNA 1CIUA 4P7OA 1UKOA 2J62A 3WD0A 1LL6A 5CZKA 4ATWA 1KQZA 2E3ZA 5CGTA 4PSPA 3ZT5A 1ISXA 3ZR6A 1U2YA 2JEPA 3AIQA 1JDDA 4AIOA 4RL3A 3WNLA 5I2UA 4OUEA 3A3HA 1JGIA 2FYVA 1JG9A 4C7FA 4AMXA 3EBVA 1KWGA 3OLGA 3VGBA 2Y8KA 1SMAA 2PWEA 2VRJA 4KGLA 2V3DA 3GH7A 2BY1A 2CIPA 3PN8A 4CN1A 3S5YA 1JYNA 4ACYA 2XFRA 4GZEA 1PAMA 4V28A 4W7VA 1ESWA 4GIAA 1PX8A 3A24A 1V3IA 4W5UA 4BQ5A 1J0ZA 4UZSA 3AMLA 3CMGA 1EHAA 3EJSA 3UG3A 4QDMA 1CGVA 3LXAA 2DSUA 1NARA 1QPKA 4QP0A 2WC4A 1UZ1A 4XB3A 3DX3A 2EPNA 5A6BD 3DHUA 5DT5A 1UQZA 1HVQA 3BSHA 1B9ZA 3TTYA 1JYWA 3VKKA 4W7UA 1KCKA 5M5DA 3CPUA 3WDQA 2WYSA 1E0XA 4CGTA 1E6SM 2F2HA 3BCFA 1FA2A 2PWHA 3BAKA 1W3JA 4EE9A 3KLKA 2GDUA 2E9MA 2XVNA 1W3HA 3ZM8A 4NXSA 2O9OA 2PBGA 2ZUMA 3OGVA 3RJYA 1J01A 3AS3A 4AC1X 1GHRA 2XVLA 2NW0A 1OINA 5GNXA 4UTFA 4W5ZA 4PTWA 3VD7A 3S5ZA 2ZX5A 4AEEA 1E9LA 2JF7A 3MMWA 1OSEA 1QNPA 1QHZA 2JIEA 2E8YA 3K1DA 1KBBA 1TVPA 1AQMA 1IZJA 4P8UA 2Y5EA 4AYGA 2J47A 3WD3A 3BVWA 4HMEA 2WANA 3UCQA 1JZ3A 1NOWA 2CETA 3PTMA 4MNJA 1ZBVA 3ZSSA 4HMDA 3VGHA 1UWTA 4BCEA 3AHYA 4AMWA 1KR1A 2ALWA 4CD6A 5BRPA 3LXCA 6TAAA 2PC8A 4J3UA 2DQXA 3K4AA 4PMUA 3AIRA 2E8ZA 2RGMA 2BY0A 2DIJA 2J7EA 1TVNA 5I6SA 3AYRA 4L4OA 1LL7A 2D0HA 3F5KA 1HL8A 4AD3A 2VZSA 1QI2A 3M6DA 2CXGA 3D4ZA 1HKMA 1JI1A 3ECQA 1EHNA 3OLIA 1EDGA 3H55A 1J0KA 2PBOA 4C7GA 3PZVA 1UD3A 1Y7VA 2WW5A 1K9EA 5A6AA 2WWDA 3GXPA 4JKMA 1UD4A 1WPCA 3W0KA 4U2ZA 2HISA 3GBDA 3EJUA 2BHUA 4FNUA 3T09A 1OIFA 5EFDA 3WH5A 3WQ4A 4PMOA 5AC5A 2EACA 3WNKA 3CUFA 3FY1A 1TE1A 3SURA 2EEXA 3QR3A 4D6DA 3PZNA 9CGTA 1VBRA 5FIPA 2X05A 3T0AA 2D20A 4AZIA 2FH6A 1QNSA 4LQ1A 4FMVA 2VVNA 2YBTA 1B3XA 1V08A 2UY3A 4NSBA 2GSJA 2ZIDA 2OLHA 2WZIA 4YN5A 5BRQA 3L4YA 1R87A 3WEZA 1HJXA 2EO7A 4LYPA 3WQWA 1GOKA 2ZX7A 2QMJA 1LWHA 3A4WA 3GNPA 4GO8A 1E1FA 4UQ9A 2WKGA 4OZOA 2XWEA 4FF5A 3BAJA 4HA3A 3AMKA 3VD5A 2D23A 4AZBA 4PTVA 3CHCA 5GNZA 8CGTA 1JAKA 2D3NA 3AIBA 1MQPA 3MV01 4FNQA 5BXSA 1HJQA 1R7OA 3W38A 2OYMA 3BLKA 2E4TA 1WKYA 4B3KA 1MFVA 1B3YA 3HG4A 4AZHA 4DO4A 2CKSA 2WHJA 5GPRA 4PMDA 1GNXA 3THDA 3GH4A 4J3WA 1H5VA 1BVZA 2NSXA 4CVUA 1UKTA 3WDJA 4MNLA 3PZTA 1JD9A 3B9AA 4QFUA 3CC1A 1HJSA 3N12A 5I77A 3W25A 3NSMA 4W89A 3WEOA 3BMVA 5AYBA 1DP0A 3PZMA 2XSAA 1CLVA 1EXPA 2OW7A 2X0YA 2J7DA 4BQ4A 3AJ7A 1CDGA 4WLCA 3T08A 5LA0A 2UY2A 2VO5A 1PZ3A 3AYSA 3DDGA 3EJPA 1VEOA 2TAAA 1ZL1A 3WBEA 3AXHA 1BQCA 1C3FA 4MADA 3WDRA 1UA3A 1WP6A 5A6BA 1XD0A 1GPFA 3EMQA 2YA1A 1IT0A 1CYGA 2C7FA 2ZXQA 4WKFA 5EB8A 2ZXBA 1V03A 2VT0A 2VNCA 3THCA 4H7VA 1VFMA 3K8MA 4JKKA 3MS8A 4W85A 2VQTA 4CD4A 3SCWA 1V0KA 3KLLA 5CGMA 3E1F1 4PUEA 4F79A 4AEFA 2EADA 3MU7A 5IFTA 2W66A 1EGZA 2OYLA 4PTMA 3WN6A 1PIGA 3S2CA 3DECA 1GOOA 2GVYA 3WF1A 5KZ6A 2WMHA 5FL0A 1QWNA 2WWCA 1UKSA 1VFUA 1DWGM 1KXQA 3AOFA 5F7UA 2V3GA 3AIVA 3AISA 2WC7A 1XH2A 3RILA 1KGUA 2VMFA 4UZUA 2UY4A 4CKQA 1OGBA 3CLWA 4AY1A 1BAGA 1HKIA 4MAVA 4H8HA 2C8NA 3KE0A 3BAXA 2VJXA 4UFMA 1DWJM 1UR0A 1W3KA 2JFEX 4ML4A 4JFUA 4PUDA 2B31A 1W3LA 3K4DA 3WD2A 2ZUNA 2FHFA 1QW9A 3ZJ8A 1I1WA 2VCCA 1E1EA 1HXJA 4FLSA 1FP9A 5BXRA 4NI3A 2HVMA 4J7RA 2CCRA 5CLTA 1V6XA 1HJUA 2F7RA 3D50A 1V02A 2EBNA 4DWSC 1DWFM 1JDCA 3HU7A 4D6JA 2DIEA 1IZKA 1MW2A 4UCFA 1XCWA 5E6ZA 4D6GA 5A8QA 3APGA 2BFGA 3T0BA 3WNNA 1CGTA 4NX0A 3SEPA 1NM9A 1H11A 3RCNA 4U3AA 2EAEA 1H4PA 1W1TA 5DMYA 3ARYA 3BUBA 3AS0A 4U5IA 3II1A 3ARWA 1BVNP 1W1PA 3IK2A 1R7AA 2A3CA 3A6OA 1UHVA 2DSZA 4X0VA 1GVIA 3SIMA 3DYPA 1EH9A 3CHDA 4MB3A 1OT2A 2CPUA 5CG0A 3TTSA 4UNIA 1C90A 1XHGA 3B9DA 3ARPA 2EQDA 4HA1A 1W2PA 4CCCA 3OZPA 2WMKA 3VIKA 3ZJ6A 2CBVA 1Q6EA 4CN4A 3WDIA 4C7DA 4R27A 1HNYA 2UY5A 2BHYA 4NRRA 2QPUA 1MQRA 1UWIA 3VOCA 4E8CA 3HG3A 4H2CA 4D72A 1W9BM 3W53A 3BVTA 2O9TA 3EJQA 1C8YA 4M81A 1QI0A 2CITA 4GQRA 1E6ZA 4HMCA 2GJRA 2WVTA 2VI0A 2D1ZA 2XSBA 3AMCA 1CXFA 1VBUA 1NH6A 4GI6A 1TR1A 4W84A 1DWAM 3WBAA 1E4NA 4PTXA 3FAWA 3T2QA 2WMFA 3ALFA 1DTUA 1O6IA 5C8BB 2WVVA 1QNRA 2VX6A 1WDSA 5AC4A 2WLZA 3VVGA 2Q8XA 2QF8A 4X0NA 1XCXA 3CGTA 2XN1A 1NQ6A 1E6RA 4MDOA 3CUGA 1BTCA 1E6PA 2UWFA 1HX0A 4CCEA 4OJYA 4FLRA 1ECEA 2DH3A 3CO4A 4JHZA 5I23A 3VMPA 1BYAA 3FHQA 1RP8A 4M29A 3TOPA 3CTTA 3N17A 3IJ8A 7A3HA 1WCGA 3GM8A 4B16A 4OOZA 1YQ2A 3GDBA 5D9OA 4DUWA 5JIWA 1MW3A 1UH4A 3WUBA 5FD0A 2VC9A 2J75A 1E6NA 3AZTA 3VTRA 2YA2A 4JFWA 1A47A 1JF6A 3EMCA 3VIOA 1ISYA 5GQBA 3VD9A 8A3HA 3L2MA 3WNOA 3BAIA 4JKLA 3BVUA 5CQ1A 1JYVA 1UKQA 1UR4A 3O6AA 2W91A 2EJ1A 3RO8A 1VF8A 4HP5A 2XPKA 4TVUA 2JF6A 2J7BA 2JE8A 1ZJAA 3CZJA 4F66A 1HT6A 4J3VA 2CBUA 2BHZA 2G3NA 2FHBA 3H54A 2WCAA 4WKAA 4PMZA 1XH1A 3LXBA 1WAWA 4JL1A 5ABEA 3WDHA 1E3XA 1D7FA 4F9JA 1EO5A 2YJQA 3WUEA 2DH2A 2W63A 1JIBA 3AQUA 4JCLA 1EQCA 4E4PA 1JDAA 3PHAA 3UESA 2X2JA 2E9LA 3S6TA 1DEDA 1BFNA 4ZFMA 4AYSA 2Y24A 2DGAA 1UD8A 4PRWA 1V3KA 2J74A 4OBSA 1OM0A 4V2XA 2IXUA 1M53A 2WZHA 4DWSD 3WDPP 5A69A 2F7OA 1AQHA 3MMUA 3N11A 3LX9A 3RM4A 2YL6A 5IXEA 1RD6A 4KRUA 5DT7A 4UR9A 4H8VA 1UD6A 5HXMA 3ZR5A 5FL1A 3VDCA 3GXMA 5JUVA 1PJ9A 4HOZA 2VX7A 1OWQA 4MTVA 2VR5A 3G6MA 3O9NA 3HN3A 2WVVB 3UG5A 2F7QA 1E73M 3L4ZA 1HN1A 4HPGA 1EOMA 5E09A 1DWIM 1QI5A 3B9EA 4ZE4A 1UG6A 4KRTA 3AI0A 1CXEA 4IM4A 3BLPX 4IISA 1H0IA 2FH8A 1R34A 4GPNA 3SUWA 1HKKA 1W9UA 3TA9A 1W9DM 2GK1A 3MUY1 1OB0A 4EKJA 3VIFA 3SCUA 3W6LA 3MMDA 5AY7A 3ALGA 4NXKA 2Y8VA 4XUYA 1ODUA 3ZT7A 3OB8A 3WFZA 1SFSA 2ZXAA 2ZX9A 1JFXA 1UR8A 2XJ7A 4A4AA 4MB5A 5A8NA 3DX1A 1GOQA 2WK2A 3BXWA 1LL4A 2V38A 4LPCA 3A21A 2E0PA 4JL2A 5D8ZA 6CGTA 3A47A 1KBKA 4BF7A 5A6JA 1JXKA 3NCOA 3AZRA 2FGLA 1BPLB 5CJ5A 4TXEA 1SR0A 3AIUA 1UR2A 2CESA 3D5HA 4RE3A 3QGVA 1CXKA 4UOZA 4N0RA 2ZWZA 1XSJA 2A3HA 4QAWA 3AZSA 3NSXA 1OIMA 2X2HA 3U5YA 2D3LA 4UQDA 3DX0A 2QLYA 5IHRA 3WQVA 1DHKA 1FH7A 4GKLA 4HOWA 4CU7A 6A3HA 2O92A 3WF3A 1WZAA 3TP4A 2WB5A 2ZUWA 2PF0A 1N82A 3CUHA 4M56A 5E70A 2ZUUA 5C70A 1P6WA 3BH4A 4QCFA 3VIIA 2EXOA 3GNRA 3POCA 3W6MA 4PMRA 2WCGA 1RH9A 5I3DA 2YBUA 3SCOA 3CZKA 4Q22A 4KGJA 2GUYA 4ATLA 5A6MA 1C8XA 1GQJA 4FLQA 1KFWA 1SZNA 3DC0A 5BXTA 5LA1A 1JZ8A 1UUQA 1JL8A 4CCDA 4JCMA 4WF7A 2YDRA 1CGUA 1M7XA 1E5NA 1QI4A 2FHCA 2RGLA 4XX6A 5A8PA 4IPLA 1E0WA 3BUPA 4J3XA 1CLXA 3ARZA 3JUGA 4W8LA 1J0IA 1ISZA 2PWDA 1KXTA 4PMXA 3OLDA 5CPQA 3WD4A 4YPJA 2VURA 5TD4A 2F61A 4FNRA 1C7SA 3HMCA 2GK1B 3RM8A 3T2OA 7TAAA 2D73A 3PZ9A 3SCPA 3VIPA 3WY3A 4UQBA 2NT1A 3CZNA 4XZWA 1V6UA 4HU8A 1VRXA 2PWGA 3O2LA 4DO5A 4P8VA 4X9YA 2XHYA 3I3EA 2DEPA 1PPIA 1XYFA 3DX2A 5HDRA 4D6IA 2VCBA 2QV4A 5DF0A 5C71A 1JZ5A 2X0HA 1VAHA 4U5KA 3AS2A 1LLOA 1H2JA 1E6XM 2VVSA 3AHXA 3J7HA 5LA2A 4ZE5A 3WF2A 1EOKA 1UR1A 3DX4A 2JIWA 3WF0A 3W4RA 3WH7A 1GOWA 2DSVA 1OCQA 3OGRA 3GXIA 4B9ZA 3VIHA 1KGXA 4Z2HA 4DWSA 1I75A 5CPTA 4TX8A 4JFSA 2YL8A 4HU0A 4AD0A 3NYDA 4KWUA 4U3CA 2VZOA 4EANA 1QNOA 3LMYA 3LRLA 4UOQA 3VNZA 1HXKA 3ARTA 4DM2A 5HBFA 3CUJA 1VFFA 4R5EA 5D9NA 1JFHA 5DFAA 1CXLA 5CPSA 1UD5A 1Q4NX 3PTKA 4YHGA 3CV5A 2DDXA 2WZEA 1J12A 3PBGA 2XIIA 1A3HA 2WKLA 1V0MA 1QX1A 2EPLX 4JAWA 2IXVA 4LXFA 2WBGA 1WDRA 5I24A 1ZBCA 5E9AA 3AIWA 3IJ9A 1X6NA 1FP8A 1SMDA 3TTQA 4HZ7A 2VRQA 2F1AA 4QLJA 3D51A 1B31A 3AHVA 3NDYA 3VX1A 5DEZA 4AZ5A 4BS0A 3W37A 3NDZA 5A6LA 1KTCA 2A3BA 3VDAA 1UQYA 2WMGA 3TTOA 4ZEPA 2ZX6A 4MPKA 4UQAA 5HOSA 1B3VA 1GOMA 2ZUSA 3CIVA 1CBGA 2YIHA 1FFQA 4PN2A 4E8DA 4AZGA 2BY3A 1JNDA 4H04A 2WMIA 2OSWA 1UOKA 1K6AA 1R8LA 3EJTA 1FH8A 1VB9A 2CEQA 1KQYA 1J0HA 7CGTA 1K9DA 4GZJA 5D9PA 3OBAA 2YL5A 4WSJA 3WH8A 5DO8A 2Y4SA 2VUYA 1R33A 3WY1A 4MJ2A 3RPMA 1PS3A 1J9YA 1JF5A 1C93A 1GORA 3L4XA 2F8QA 3ARXA 1E4MM 4FNPA 1E40A 1IV8A 5HNNA 1TMQA 2NT0A 3N18A 1E72M 3TONA 4AZ7A 5A8OA 1JZ4A 4UFJA 5BYWA 1T0OA 4AIEA 1G1YA 1X6LA 4D6FA 3VNYA 2G3IA 1M03A 1NP0A 2XTKA 3OIHA 2WVSA 1ZBKA 3U5UA 1RP9A 4ZXLA 3BC9A 3RDKA 4CN6A 1H3GA 2BVYA 3AXIA 2D24A 2WHMA 1Z32X 1US3A 3ZQ9A 4H8UA 3WY2A 4OBRA 3W24A 2WSPA 3ZT6A 1QOXA 3F5LA 3OGSA 2G8ZA 1UKPA 4WSKA 1TFVA 1V3HA 3MKKA 3GXFA 4DWSB 1CZ1A 1GZJA 2BV9A 1KCLA 3U7BA 2IGTA 1UWSA 1GJUA 1AQ0A 4TX6A 2VCAA 4AZCA 3WMBA 1MYRA 4PEEA 3MANA 3AMDA 4JZ5A 3D3AA 1NOFA 1LQ0A 3DYMA 3QHMA 1OD8A 2FDMA 2J7HA 2BVDA 1LG2A 4GO9A 1OBAA 3NIYA 4FNTA 1KXVA 1UYQA 2W4XA 2OWXA 5LYRA 3IAPA 4OGZA 1WZKA 5ABHA 1G9HA 3AFBA 1TCMA 1H49A 2EPMX 3GYCA 4D6CA 3VILA 2XVKA 3GTNA 1TZ7A 3WFLA 1E4IA 3VMOA 1HTYA 2WLYA 3I3BA 3WEMA 4WIWA 3GXDA 4PSRA 1QBAA 3ZO9A 1PX3A 2QMKA 3LPFA 1W9PA 1KB3A 3UERA 1E55A 4M1RA 4S3KA 2J8GA 3U7VA 2F18A 3A22A 1F4AA 4KH2A 3VGFA 4D6EA 1CGWA 4J28A 4MNKA 1HWWA 3GXNA 3WY4A 1FHDA 4LX4A 5BWFA 1CNVA 1FHLA 1BHGA 3KEHA 3BVVA 3NJ3A 2D2OA 1J0YA 2VX4A 1GCYA 2MANA 3T0DA 4J27A 4M82A 2X8RA 1XSKA 1HP4A 3DDFA 1EDQA 2WMIB 4GINA 1GQKA 2ZUVA 1CTNA 3VUPA 4BZYA 1HVXA 4LYQA 1E5JA 4P8XA 3A23A 3EDDA 4B15A 4CU6A 3DHPA 2XFFA 1H41A 4MB4A 3IJ7A 3A5VA 3BLBA 2V5DA 1JI2A 3M07A 3CUIA 4FK9A 4EK7A 3GXTA 4AISA 2WM0A 1GQIA 2BY2A 3VD4A 3ARUA 4W8AA 4IPNB 1NOUA 3L2LA 4B3LA 1CXIA 4LYRA 1KGWA 3ARVA 2WMJA 2XG9A 3AROA 1ISVA 1JXJA 3K46A 3WUGA 1G0CA 2OWCA 4FLOA 2XN2A 3VSVA 1R75A 1MXGA 3LPOA 4GZIA 5BROA 3VM5A 1Q6FA 1BYCA 3WQ8A 1OGGA 3WL1A 3KZSA 2WNWA 2W62A 2BXZA 4QLLA 4AZCB 1V02E 4HZ6A 1G94A 4MNMA 2BS9A 3UR8A 5I78A 1Q6DA 1WDQA 1GVYA 3LRKA 4B9YA 4Z2KA 1VFOA 4UFLA 1QVBA 4AIUA 2A3AA 1OT1A 2CYGA 5A94A 1QHPA 1QWUA 3SCRA 4BQ2A 2D22A 3VM7A 2VZUA 3WUFA 3KL5A 4MB1A 1M01A 1C92A 4GQQA 3WH6A 1HP5A 3CZ8A 4HA4A 1OGSA
chains in the Genus database with same CATH superfamily
2G2PA 4MXVE 4NO5A 4MDPA 3B7RL 1HAUA 5IMLA 3QEUA 2ZSVB 3HE7B 2BODX 4R7NA 4I8YA 3O6ML 5K1NA 2ZX8A 4OZGF 3LHUA 3FUNA 3ZYJA 3FVMA 1GQLA 3CHFA 4Z7QB 1U8LB 3TEUA 4QIRA 1FYTA 3C56A 4WW1A 1U33A 1FLRL 5FIEA 4HCLA 1OWWA 3EJRA 1M04A 2WLLB 3VIMA 1V7ML 1BV8A 3S34L 1VESA 25C8L 2B59B 4XPHH 3KPLA 3KYOB 2J8FA 4F3FB 5BXPA 1IKNC 5GRWA 5EIIG 3GZOA 3QJRB 1WB0A 4AQ1B 1TB3A 3MRQB 32C2B 3RX5A 5ABGA 3HQPA 2YYTA 3ULUE 1RUPH 5L4JA 4YL2A 5FC9A 3VSTA 2G5WA 3HJEA 3CCHA 4CNPA 2VW4A 3GR8A 2BW5A 5MKGB 3OKEA 4HBCL 5C7XH 4Q56A 1OK0A 1UWEH 4OFQA 3Q67A 3UJTL 3R89A 1ITXA 5I3FA 3H1ZA 4XPBH 3RPTA 4G7FA 3PZIA 1OF2A 2AOSA 3G6DL 3HPFA 1AYRA 4GMSH 1E71M 3U4KA 4U2YA 3JWNE 3V18A 4HJ1A 2G4FA 1TRDA 12E8H 4W9JC 2GT9B 5IOKA 5I74C 3UAJC 2EECA 1T83A 4OIBA 4AQ8C 5LKYA 4Q7DA 4CD5A 1Q0XL 1NMAL 3B9KA 3ZVHB 3SR7A 2OGJA 3CMJA 3TFBA 4JFZL 4Z3JA 1NDWA 1QHOA 2Y5JA 2APVA 4DUXA 5GGSA 3R8QA 3L3IA 1D3GA 1BQGA 1VKXA 3MN8A 4FTVA 1KOAA 1BJ8A 3QV8A 2NLYA 4PWIA 4XP4H 4U0RB 4YPGA 4XNXH 2V81A 1TUXA 3ESVF 5HHOE 3L45A 1QRQA 1ZHLA 2EKCA 3QTGA 2ZCKL 4X6CF 1QZNA 4M1GL 3CFTA 1DBBL 1RZ8A 5IJKC 1MJJB 4XN9A 2A6JA 5A2CA 3QH2A 4BZ1L 3UXIA 2D3JA 4OU3A 3RPKA 2HH0H 3CZSA 3B9OA 3TV8A 2GUBA 1PHWA 4M6UA 3QZWA 4OFPA 4OGYH 3NJXA 5JW4N 3IDJB 4WHCA 4Q3MA 2C71A 2VELA 1I1FA 3TFCA 1Z3GH 4JTJA 3UJIL 4PUJA 3Q01A 3RNQB 4X42A 1I9CB 4PJCB 5E1QA 2A73A 1MFDL 1DQLL 4X61A 1J5HA 4PFEA 4W4NA 2I14A 3V5HB 4NWTH 3EJZC 3DFYA 1HXYB 4NNCA 5D7JD 5HTSA 2B0SH 4WXZA 4ZFOB 1GVQA 3TYFA 1G1OA 2P8MA 4OLEA 4U1IA 3A3WA 4LGXA 1IJNA 2SEBB 1SHWA 5L8KB 2QELA 3GU9A 1E3FA 4C47A 4OBTA 1QA9B 4DP6X 1KJ2L 4YXHH 5E6RB 4GIOA 3U46B 2CIIA 4W68A 3W1QA 3KLDA 1BFTA 4UWQB 1MFAH 5I71B 3G0XA 3CDZA 3K13A 3H53A 2GPTA 2OJEA 4ZAKD 1RZQA 1WDPA 2J5LB 4Z7WB 3ABRA 3W07A 1WLHA 1KGCE 4IGBD 2C15A 4QQUA 4XSMA 3BT0A 5DMKA 1X1NA 3MP4A 4PWKA 3P0XA 1P7QA 3RWHA 4S1QH 4WGHA 5FA3B 3QAQA 2XV0A 1J79A 2MHAA 3WLBA 4HIQA 1TQWA 4EN2A 1QRNB 3KXQA 5CAHA 4JO4L 2A0LD 2IIJA 4H6QA 1P7BA 2VQUA 2VDGA 4ZFFA 1JDEA 1ELSA 4JANA 1A7PL 2V2HA 4ZYKB 4A2MA 1JFQH 3N9KA 4NM8L 1IBGH 3MCLL 3LCHA 5HQEA 3CFDB 4OZHF 4WW2C 5EEVA 3BCDA 4FFTA 1CGYA 1A49A 4GGHA 2I60L 4ICNA 1EDYA 4NJ9H 3ULVC 3EO0A 3UBHA 4MJ6B 1MW0A 2VC7A 5T1DH 3VXMB 3ZRCC 3PNZA 5D96B 1U3HB 1JGEA 3REQA 1G1KA 4JQ3A 4A3HA 1A4KB 2LQRA 4P2AA 4YHEA 2IXQA 4GQ9L 1HCFX 3C0JA 1Y18A 1DCEA 3WMSA 4PCSA 4OCSH 3UZYA 3UY8A 4XV0A 5I73C 3MRMA 2Q20A 4JQ1A 4R53A 1TITA 4FEIA 3NQVA 3PGCA 3FDWA 2OKMA 3TBTA 5FYLD 3WGVB 1KPUB 2XCMC 2IKIA 4WJKB 5BVJA 4RL3A 2YMTA 3CC5B 4NX5A 3IMBA 1ACYL 3QIWB 4QDPA 3AB0C 3OLGA 4BINA 2OCJA 3QQNA 5AYYA 1L4IA 3ARDD 2F38A 1GZQA 1OAYL 3LM3A 4ACYA 4ISVA 3BW3A 3T6ZA 4L9DA 1XB6A 3MUHL 3LKSA 4Y16D 2PABA 2BCKA 1B9ZA 3VOIA 2BVPA 3T3PF 5MEPA 2ZXEB 2DI7A 3QE5A 4ODUA 3BCFA 1CVSC 3UZWA 4LVEA 1G7PA 1O95A 4KVCL 3W75A 2YD7A 2WM1A 5F2LA 1IEBA 4FHKA 2G3XA 1EVTC 4CJ1A 3QJAA 4UTFA 4K3JL 1JERA 2YXOA 3HPAA 3HMXL 2QJDA 5KTLA 2P49B 4AYGA 1TNNA 2WQRA 3LEYL 4JQIH 2IG2L 4HMDA 6TAAA 3BK0A 4XZUB 3HRZA 4CNUA 2B1OA 3F5KA 4WDTA 5ANMB 3L9BA 4LSVL 4E9WA 5K9QG 4Z6AT 3V4PB 3HZYB 2H4EA 4DF1A 4C7GA 2D7QA 5FO8B 4P4KC 1SOSA 4M48L 2EGZA 4JYDA 1G0XA 3SY0B 4ODWA 2HISA 2V67A 3NL6A 2HWZL 2HLAA 3O6YX 4A39A 2FECI 3FY1A 1A3QA 5MENB 2CJUL 4D6DA 4RFNC 4QT5B 3T0AA 2AK1H 2AQQA 4GFXA 3NACL 3L1OH 4YDKH 4LVHC 3HUJE 3TF4A 3STLA 6TIMA 5E2UL 1DQDL 4Z0BH 3RKPA 3QB7C 1GYNA 4MNGB 5E00B 2D3NA 3S96A 4D8AA 3AIBA 1XF2A 3MJMA 4FNQA 3GLAA 3DI1A 1WKYA 2OT1A 4HK7A 3ITOA 2CCWA 1GNXA 3G6JA 1GAFH 5IMMA 4M6QA 1RMFH 3ULUD 1HHHA 3SBRA 4UUJB 1I9JH 2QAPA 1A7NH 4DH2A 5JQ6L 2DLTA 1SLWA 2HNHA 3PZMA 3R6IA 2ITEA 4TV3A 4JO5A 2VLJA 3DVIA 1XR2A 1HU8A 2V82A 3UROR 4KJQD 1GPOH 1G7JA 4WTWA 4K3GA 2XRAL 2YA1A 5MHBA 3K1GA 5F88B 1MCSA 2IH3B 4YN3A 3KR3H 2VT0A 1AZBA 3Q06A 2NV1A 3M86A 1I60A 1DL3A 2VQTA 1LO5B 5KZCB 3QG6B 3KLLA 3ERXA 5CGMA 4AEFA 1OG0A 2MOQA 5BU9A 1OKEA 1FRBA 4XP6L 3VFWB 2GVYA 4AQLA 4JRXB 4LC8A 5FL0A 2DJXA 1J5OH 4N5ED 3F7JA 3S0PA 2HJLB 3IUHA 4GG6B 1M71B 1QTWA 3LTSA 3OMAB 1M6OB 2FBOJ 4CKQA 1KV8A 2ED9A 4OGXH 1BP3B 1WZ1L 4MTMA 4AY1A 1GEHA 3S6CA 1JGDB 3OO2A 5T1MA 2KLSA 2G4JA 2LLEA 2PO6A 5HHOD 1JPEA 1ZTXL 4MMWA 2FCBA 4X4ZA 1WHOA 4DWSC 3A6CH 4B4HA 1OAQH 3IE9A 4TQEL 3DURB 3KYMB 1YN7B 1N3NB 3QJHA 3V5FA 5FOBA 5A7EA 4WFGE 3GSXA 5DA0B 3UZVB 3HG1D 1SQ2N 1W1TA 5C6TL 2DQFB 3CN2A 4X83A 3WXWL 1UHVA 2G4EA 3MGTA 2CCVA 2ZE3A 2IPJA 4A2FA 3VUAA 1UZHA 5CD3B 2E09A 4D8PB 1J1PL 2MQCA 3GKZA 1QR4A 1E5ZA 4JO1L 2Q10A 1M1XA 3HG3A 3UR5A 4X8GA 5DS1A 2ZKWA 2VI0A 4MMXB 4GMEA 3X17A 4JREB 2PGRA 5HGHA 4GKNB 1A25A 4FI6A 2Q9OA 1CE1L 4QM1A 1ITBB 4JTSA 5EU6E 5HI5D 3FTYA 3VVGA 2H2SD 1O5QA 4RMSA 1MO0A 1XCXA 1JCKA 1XLJA 3QJQB 1FNFA 3UO1L 5LNEA 3ATEA 2C0AA 1MF2H 2D8KA 4AX7A 4G7EA 3O3EA 4HJ0D 3IF1A 3NT0A 5JIWA 1ZTMA 2WLLA 5DUMH 4YMPA 1BX2B 5B80A 1EJRC 1INDL 4URTB 4ZQTA 2O55A 5L2KB 1POKA 4OLUL 1KGCD 3MRIB 2HT2D 5AC6A 2WXKA 3VYLA 2NQLA 4D0BA 5JMOC 4H19A 4YHZH 4O13A 1IXQA 1QAPA 4YXKL 1CCZA 2JSFA 3P4NA 1JUEA 4GSDH 4WKAA 4JL1A 5MKGA 4B2DA 1F6AA 3AO0A 1WKDA 4Y4KC 3RFZC 1FWCC 4JYEA 1DJHA 1BFNA 2DOCA 4MY9A 1X9RA 3EPOA 4KKZA 1JZHA 1EZ2A 3KG5A 2KX9A 3BKML 3CXHJ 2XFXA 5A69A 3GS6A 4HK5A 4RAHA 2RGSA 1SBSL 5JUVA 1X7QA 3F65A 3G6MA 3O9NA 1XH3A 4NQSA 1W5OA 3L3HA 4OCMC 4OZFA 4HPGA 2QVIA 1EOMA 1XO8A 2FJSA 4Y8EA 1YPFA 4PJAE 4DP0X 3W85A 4I3RH 1YEKL 4EWND 3PWNA 2IQTA 4BYHA 5KMYA 3AY4A 2XIDA 1NIFA 1N7MH 3QNZB 2VDRL 3SCUA 1VCFA 1BVNT 5DMLA 3IDYB 3B2MA 3WKYA 5JPNB 4RZCA 4HXAL 4NIYE 3S88H 4NJAL 1HSAB 3DDMA 1NDGA 1N2RA 3CFEA 3Q05A 2FR4A 4BEIA 2ENYA 3FB7B 1Q3NA 3RJDA 5FGBA 3EBIA 4MZ3A 4XMVA 4WJG3 1DQJA 4Q74A 5KBMA 3A4DA 3B5HA 4KI5F 4HNLA 3NCOA 3GS7A 4PJ8D 4UANA 2QVFB 1IKOP 3MV8B 1JZJA 4QRBA 3LPWA 1HEJC 2QGDA 3VGAC 2TRSA 2A3LA 4AKOA 5FK9A 4ADUA 3KCLA 3FK4A 5IBXA 2X2HA 2G75B 2PGFA 3WQVA 3TJEH 4KTDH 3BE1H 4X99A 5E6UB 3IDJA 3D8MA 4RXGA 4KKAC 3TEZA 4TLTA 2EYRB 3MDJA 4AYEC 5C55A 3K2GA 2BDNH 2QUUA 1YBQA 1AGBA 4UTBL 4QY8A 3CQFA 5AN7A 3Q2NA 1JP5A 4IS6B 3MCG1 4RNJA 1T1YA 2GUYA 2DVUA 4GKTA 2PU0A 1SZNA 1E67A 3L13A 2VLKA 3H12A 4YSOA 1N8FA 1CGUA 2VXQA 3M0YA 2E59A 2R2BA 1E0WA 1J0IA 2JELH 1KCSH 3WTYA 1FG2A 1W37A 3F58L 4P2RE 3P3YA 3NSDA 4DJDA 3Q2CA 2G9HA 1H15B 4RVBA 2GK1B 2VUKA 4QNEA 1SR9A 4P5UA 1J9CT 2RIKA 4WZHA 3RK8A 4JJ5B 1V7MH 3SDCC 3QZEA 2ISSA 3I3EA 2DEPA 3CHQA 5LGZA 1JZ5A 1II4E 4OD3H 4PLNC 5LA2A 4JZOA 3MQTA 3V9CA 3WF0A 3G5VA 4FFVD 2HS8A 1BMGA 1MHHB 3TC9A 3P5YA 2FX9H 1YEFL 1A5BA 4L9LB 3K1KC 5H94A 4TX8A 2EDXA 4ACPA 2Q8ZA 3BQUA 4HBCH 4L4VE 4OSUH 2FB3A 3BO9A 1NFIA 2APFA 2IBZY 5F89B 2WLNA 3V5KB 2XIIA 1FL5B 3H22A 3RY5A 2WMPA 2J6EA 5B1AB 3MJ8B 3DHDA 3Q48A 3W5MA 4XNMB 1A6VH 1M6UA 1JVNA 2RR3A 5DJAB 2ADGA 1TWSA 5DEZA 4G7YL 5A6LA 4K8HA 4P2QB 2M2DA 4GUIA 4JFZH 5CCJA 4U6XB 1MNNA 5CCKH 1T0MA 1XHHA 2O5XL 2A6LA 5F3HB 1A9BB 4MJ6A 4I9JA 1V7YA 3GG8A 1U93B 4JE0A 1BIIB 3VWJC 1K9DA 1U3HA 4ODTH 1R33A 4GFIA 3O3UN 1AHKA 5G2WA 1DN0A 4TV5A 2GK0B 2BSED 2YPVL 1AFSA 4G6KL 5DMNA 5I5IA 1G1YA 4D6FA 2M83A 1ZBKA 3U5UA 4XD4A 3BI9X 1RP9A 3BC9A 5I7GA 2GIMA 4I48B 1XLAA 2R7EB 3NXLA 3TJ4A 4BSVA 3MKKA 3N2JA 3LN4B 1J8VA 3X3GL 5AYTA 3UCRA 3UA4A 4F24A 3D3AA 3NWRA 1QU4A 4HUVB 2CKBB 3CC5A 3EOBA 2YGNA 3NIYA 3FQ4A 3V4LA 1PV8A 1BEYL 4YSSA 4RUBA 5TNVA 2NR6C 3UJIH 4Y9BA 3N1FC 1RK7A 2L04A 1E4IA 5AG9A 3UQNA 1HTYA 1MFDH 3H2EA 1DQLH 4P5KB 3QKZA 2B2XL 2FBRA 2H0EA 3TIDB 4UNLA 3VGFA 2EDBA 1HI6B 2DS4A 5HYIA 4CW1A 1PY4A 3IJQA 2MANA 5C0AA 4AUJA 2BS71 1XSKA 3C9NA 1T04B 2QQNL 1XTLA 4ZMVA 1TPB1 4ASTA 1I8KA 4LYQA 3GQYA 3NL5A 3C2FA 3VTMA 4WFGD 1S8DB 4BHUA 1E4WL 4YTUA 3TNOA 5D6DA 5GS1B 5IVXB 1H41A 3BLBA 3BHBB 1OW0A 3AU2A 4NRYA 5U7SA 3LQZA 4FK9A 3N41F 3UU0A 2QT6A 2P1FA 1TX2A 5HJLA 3VD4A 4XVJL 4B9PA 2HAZA 4PVBA 5KYUA 4M6NH 5HYSA 3QV6A 2EEBA 2OX5B 1SM9A 1ZGLM 4FLOA 4PW4A 3MRGA 3V4PA 2H8ZA 5C7ZA 5FHAH 4UMCA 3QNXA 2VC2B 2CUAA 4R97B 1HOCB 1DPMA 4Y4FA 3NA9L 4LBEA 5AAPA 3JYBA 1J96A 5XIMA 5IBLC 5AVZB 1U8NB 3LG3A 4O9HL 5EU6D 4OCXL 1A6UL 4X7TA 4PJEE 4O2FA 4G80B 4OAWA 4NM8H 1V6YA 3ZJ7A 1XDTT 4FZ8L 4OTKA 3MCLH 1S2AA 2AV7B 2EDLA 3QWQB 1H6EA 3P8IA 3EH2A 4WJ5A 4G7VL 1LHZA 3CQ0A 1GW1A 4ZUWB 2YK1L 4N8VA 4YDVB 4O58H 1V3MA 2WY3B 2D0GA 1AKJA 3WNIA 2W5FA 4M80A 1N0XL 2VN3A 4LW7A 5BWAA 2HBXA 2R6OA 4PUKA 4Z1DA 3PPFA 5DBUA 2FMNA 3FHAA 4HQVA 5JHDE 5HUOA 4C6MA 3IEBA 3APNA 4G8IA 1K8DB 2XVPA 4JZNB 4Z5RA 4UUJA 4GNVA 3GQFA 4R8WH 2AAMA 4E9XA 1MVUA 2A9BA 4DW2H 2W1NA 1SYSB 2AQTA 3W86A 1E2VA 4FOJA 4PCYA 1NWRA 4HZ1A 5IJVB 3STZB 3K5SA 5G1YA 1LP9F 3EDJA 4R9HA 2R56H 2APWA 1NC2D 5IB1A 1O1HA 2D03L 4E0RA 1OAYH 2R0WL 4O4VA 5G2HA 1F4YH 4QJ4B 3WIJA 3F5JA 1SXNA 3WKPA 1TTUA 1R38A 3TFXA 1RA5A 4B4FA 1N5YH 5AZEH 4NO5B 5BRBA 5IMLB 3QEUB 2D0FA 4R7NB 3QHOA 4S2CA 5F97E 1V0NA 4B92A 3LERA 4ETYA 3WE6A 3KDOA 3ZPDA 4Q52A 4PGBA 3APDA 5FXCH 5HYQA 5KAQF 2GJ6A 2PDUA 2V2CA 1XM3A 3V36A 3VFCA 4YZFF 4U1LA 2Y70A 1FYTB 4XCCH 4WW1B 4AXKA 1MUWA 1XSIA 1NF7A 2VJ0A 1T1ZA 5JR1L 4DYEA 2J21A 3BVDB 3B06A 3GU2A 1OTUC 3N4AA 3KYMA 4IHOA 2GQ9A 5D4YA 3MUZ1 3KPLB 5KJRH 1X5IA 3UZVA 4YTTA 2EH8L 4RRPM 3MV7E 4Y4HB 3W29A 3OZYA 3AY2A 1CLZL 1D6EA 1NUDA 4LSVH 5AAMA 4AD1A 4HU4A 3CCHB 4J40A 1AR1D 2OB3A 1CFNB 4EWJA 3R8GA 4GAYA 1A14L 3E7JA 4X2PA 3OKEB 4M48H 3MO4A 4EP8C 3F4VA 3RR4A 1TG7A 4K4KA 4BUGA 1OF2B 2WHLA 4GI9A 1QJWA 5EBWA 4AU0A 3AADB 4DCQA 4ZNCD 4XVOA 5ICZA 2F5BL 1MDTA 2NTSP 4KZ0A 4R6UA 2DT2A 5I3GA 3I4EA 4KJPD 3IIPA 5AW4B 4N90E 4KNUA 4JFVA 3AGVA 2ACUA 4RJEA 2CWRA 3I3DA 4G72B 3MU3A 5A6TC 3B9KB 4P2RD 2K1MA 3CIWA 3LBCA 2XH7A 4ZMXA 4UT7H 1ZNNA 2AVGA 3NSNA 1ED3A 4KKXA 2V8MA 3MODL 3DVFA 5GGSB 3L3IB 2EDJA 4MKSA 1KY6A 2XG4A 4ODSL 1VKXB 4FTVB 2WZ6A 1OM3L 3WD5L 4NPYA 2V5BA 4KQNA 2RUSA 1ZLEA 1EQPA 3RF9A 4YPGB 4Q6KA 3EOLA 1BXAA 4QHUA 4EQ3A 4GS7B 1Z48A 5AHNA 1ZHLB 1HWHB 5BS0B 2J77A 2J79A 3P14A 5A2BA 4H6EA 1BDYA 5EUOE 1RZ8B 4QLKA 1ISWA 5I6MA 4L4VD 2A6JB 4MYXA 5ECJE 4DZ8A 1TQTA 2NCEA 4AD4A 5C0BD 4PMVA 4QWWD 3L5LA 2QTEA 1S1RA 2C3XA 3URQA 2EE9A 3QZWB 2YGOA 4DQAA 2YXWA 4S3CA 4I2XE 5G1TA 1S7XA 1YYLL 2DI8A 3W2MA 3WF4A 1O7DC 3HGOA 2WGXA 1I1FB 2KUTA 2XGBA 1A6AB 2VN4A 4XP5L 4OOUA 3DA0A 3RGHA 1XG4A 1U3YA 4Z2JA 4I7UA 2WWNA 3SE3C 5E6IA 5INCB 4I0PD 2A73B 4WVXA 3UGVA 1ZJIA 5G2NA 4XP6H 1NKOA 5GS0C 2J8TA 2XSXA 3PL6D 1T21A 3WIIH 4UTTC 1XDLA 2I26N 1Q1PA 4LE8A 3FO2A 3E0VA 3RRAA 4N0UA 5H4ZA 1I2NA 4HEPA 3TYFB 1X5XA 3AICA 2P8MB 5CSUA 1A3LL 1X9QA 3SDDA 4M7JH 1JPGA 3OVQA 4YX2H 3RY6A 1BSIA 5C0QA 3IN0A 4EBQL 1MQ8A 1B90A 4B5WA 2FE0A 1YEYA 3I6TA 3QOKA 4XZIA 5EA0L 2CIIB 5FUCE 4WENB 3BN9C 1NP2A 4ES9A 1BECA 1P1MA 3M7OA 3CDZB 2WSQA 4HKPA 1E4LA 2EABA 3OKDA 2V6AA 1VYRA 4YSTA 1WIUA 2OJEB 2AANA 2QPFA 4IP7A 3G24A 3MV8A 4DSYA 5JMRA 1R3YA 2E3ZA 5T91A 4LAQL 4KX9A 1ZHKA 3F7LA 2PTTA 1OLZA 5DMKB 1I1AD 4F7MA 2C79A 1RVFH 1DO5A 1P7QB 3RWHB 1ZQ5A 3V75A 3KRUA 2MHAB 3WLBB 3GH7A 4RZ6A 3L9CA 3SGJC 2UZXA 3PNRB 4W7VA 1ESWA 5LQBL 4Z0SA 5LJYH 1Q8JA 4ZFFB 4JANB 4O1FA 1CE1H 4D8LA 1QEXA 5DT5A 3TJLA 4IL0A 2FLBT 2A7RA 4EE9A 5C0RL 4LSQL 3FONA 4Q8VA 2G50A 1GHFL 2XVNA 4PRTA 1R3QA 2ALAA 3QY7A 4WUIA 1MWAH 1U42A 4PYHA 3WSQL 3EO0B 3RUBL 3BEVA 1H15A 3T81A 2O7QA 2YCEA 5CJOL 3MLPA 2A21A 4FI7A 1KIQA 1DCLA 1JGEB 1KIPA 2E6DA 3REQB 2X53A 3GSNA 1IZJA 4XD6A 3E8VA 3PTMA 4EN3A 2IXQB 4OLUH 3RQ3A 1GYMA 2X9YA 1K6QL 2ZOOA 1Y18B 5BRPA 1YTKA 1KUMA 4JRLA 3DX8B 2DM7A 4PMUA 3BICA 5IIEA 3O2VL 4MFEA 5CFAA 3MRMB 2CKBL 3W7IA 4YXKH 1B0RB 1BD0A 1LMIA 4C6OA 3O11A 3PGCB 3TBTB 5TTRA 4MAYD 5EMJA 1J0KA 5I1EH 1K9EA 3U1PA 5BVJB 2BHUA 3IGSA 4UT6H 3V0AC 2NY1B 3MLRH 1OEZW 5F89A 3V5KA 5CPOA 1GZQB 2KZWA 1MJUL 2NX1A 5HANA 1F5ZA 3QI9D 2NXZD 2OXNA 4ISVB 3VWKD 2UY3A 3WLTA 4H01A 4GVIA 4P46D 3P4LA 3SKUD 1LE5A 3LKSB 4NLAA 4R7VA 4LYPA 4LQFH 3WQWA 4I1RA 1NBCA 3ES6A 5MEPB 3VXRE 4ODUB 1RD5A 2WKGA 3VXUE 2D7OA 3V5OA 5F3HA 1G7PB 5AENA 4ODHL 3S1GA 3L16A 4Y2DC 1IEBB 1U93A 5D7IE 1KPRA 1BIIA 3C5SB 4W9ZA 5JHDD 4DF0A 4AZHA 1R3LA 2FECL 3VI4F 3N6HA 2KLTA 1JNJA 4UDTA 1RZKL 2DWDA 1OCBA 4MNLA 2DZWA 5ICXA 4OF0A 3VOJA 5I77A 1PFOA 3WEOA 1F1AA 4MJ5A 2R4SL 1A0QL 3SZ8A 3IPBA 3T6XA 1UA6L 5T3XD 3LENA 1CDGA 1MCIA 1EJSC 5LA0A 2B7OA 4MGGA 1PZ3A 3FN0L 1R3VA 3THUA 3RIAK 3LDVA 1W8GA 4BHUI 1WP6A 2P4AB 5SWZA 4WKFA 3BMXA 1BZEA 2HLAB 3Q65A 3HNVL 1EAPA 2XWXA 3N85L 3F6JA 4UTBH 5TF0A 5TF1L 1B88A 1D5RA 5CIPA 2DTSA 3K91A 1TZOA 4P5KA 5I16A 1ME7A 4PG2A 3SKMA 1EPXA 2A79A 3ZLGA 3MB9A 3AISA 1FRGL 3ISYA 4V1YA 3KDMB 3LGGA 4BF9A 1MIML 4I8DA 4MAVA 4UB0H 1HI6A 1MHEA 3UACA 3STLB 2Y8UA 1Q1JH 3CQKA 1JZEA 4YTRA 1K4HA 4XC1H 4H8NA 5EZIL 3UZJA 1XF2B 4N9GA 1S8DA 1C5BL 3JVFC 5A2KH 1GVSA 1TZ8A 5KITA 5GS1A 5IVXA 1NEUA 4NP7A 1I4FB 3MV7D 3OODA 3N34A 5IMMB 3WNNA 5IV2B 1ZLPA 4GRSA 1HHHB 2K4AA 1GGBL 3MZNA 4KAQH 4OLZH 2I69A 3MBXL 4F2BA 2AGKA 3MJ9H 2VLJB 1IC7H 2OP4L 1ZDSA 1YA5A 1XHGA 3CBJB 3DPBA 4RBPH 1V6TA 3R4IA 1AACA 4IRSC 1K85A 5BW6A 1Q6EA 4FQ2H 4CN4A 4F57L 1KBGH 1G7JB 1ZHNA 4A8NA 3GDCA 1JK9A 2D1ZA 1UJ3C 3U4FA 1KBWA 2H3XC 4N90D 4CQ8A 2BOGX 5F7DA 3RBSA 1GQNA 5GISL 1BSLA 2ADJA 2A7BA 4WFFE 2YQ3A 4LV4A 5DUBA 3CUGA 4K2UL 5FCUH 2VJ8A 3TWCL 2F7FA 3FK3A 3FF8A 2O5XH 1OLLA 5I1JL 3CTTA 2G0WA 5T1MB 4F7EA 3I6GB 4ZB0A 4XPTL 5CZVH 2PO6B 1AQKL 2FEDC 4XMPH 4DEWA 3OHXC 2Q6ZA 3HAEG 1U8HA 1H7OA 3DK2A 4KZCA 1WDWA 4XAFA 5K9JH 2QDHA 3N2MA 3L3JA 8A3HA 3TT1L 4DPBX 1JWUA 3QJHB 1QLEB 5FOBB 4NZ3A 1IWBA 4G6KH 1UKQA 2WBXA 3GSXB 4XN4A 4JZNA 4WIQA 1SJMA 4L8CA 3FEQA 2VSCA 4JVWA 1YVLA 2VEFA 3SDAC 1E3XA 2HX9A 2YJQA 2DH2A 4QSHA 1SYSA 4QXWA 3G9AB 5FEWA 1U8IA 4I5UA 1U3JA 1GS7A 1MDAA 1ILSA 4JMXA 4U10A 2UX7A 4IJ3C 5LBSL 1YDNA 1G9NC 2XKUA 1E65A 3BQVA 5HVHB 1NFPA 1LEGA 1M1XB 5JYMA 2EYTA 1Q9OB 1K3UA 3GRIA 4Q8PA 5IXEA 2CALA 5HGHB 2WXHA 4I5BA 4EXKA 2QW5A 1P5UA 3V0DA 5HHOA 3VDCA 1PD1A 2FPTA 4BJLA 1CMOA 4XMWA 4NYUA 4XG1A 5J6HA 4B5NA 2Z31D 3PSWA 2R82A 2DIBA 1GGOA 1H0IA 2QCLA 3RCYA 4PJFE 4APQB 2QQNH 5E5RB 3US9A 4G7EB 4FE9A 2HRWA 3O3EB 4EUPH 2JB5L 3WFZA 2I17A 1FNGA 3ZMEA 2CO3A 1NMCB 1JFXA 3IF1B 2HNEA 5A8NA 2HLEB 4M7KH 4FXJA 2IFGA 5JHAA 4QXGH 1QDSA 3CN3A 3C3UA 4Y4HA 4TSAL 4D0BB 4M1BA 4O53A 3MUGA 1K72A 2VDMB 5L9DL 4WI8A 5D1XE 2IQ9L 3HTLX 2ZWZA 1SZFA 3P4NB 2ANUA 4PL1A 5FA4A 4HJJH 3GIYA 1CFNA 3EWXA 3TBSB 1UG9A 3IGKA 1I6NA 1F6AB 4U3XA 3IAGC 1IMHC 2FNBA 4W81A 2FRGP 4G6AC 2PF0A 3BWAB 5I1GH 1TNMA 2OCFD 2EEDA 4PLKD 1ID2A 1RY0A 5H37A 4ZSUA 4FNLL 2E9GA 2QUVA 2XFXB 3P81A 4NQVA 2EG8A 4B3VA 4IXHA 1KGJA 5EZPA 4XNZC 1A3RL 1X7QB 3ZE1B 1G9ML 1WFNA 1XH3B 1ZVNA 3SYAA 4HMNA 4NQSB 3L3HB 4OZFB 1F3XA 3DMMD 1EXGA 4G7VH 3TQ0A 1ISZA 4PMXA 3PWNB 1I9EA 3SHSA 2BVQA 2IQAA 1TWDA 7TAAA 5JXED 1CDJA 1CB4A 5HR7A 3B5TA 2GSEA 1N0XH 3C2RA 4RZCB 4GAAA 3STCA 1NDGB 5DEJA 4TIMA 1N2RB 3CFEB 2FR4B 5DX7A 5F7FA 1H2JA 2VDNH 2J3SA 1DQJB 3ZLQC 5BS0A 3X2QB 3N29A 1OGAE 1F45A 1ZD6A 4HSHA 5DQPA 3RPDA 1OCQA 1N12A 3T0XA 1IBYA 5ABZA 3HG1E 2HT3D 5I76B 2VUNA 3MCNA 4MKTA 1J5IA 3NYDA 5FK9B 3CPGA 4IMDA 3ENEA 3BLLA 1HXKA 3LSOA 1JFHA 3H9SE 3THML 4X99B 1M68A 1TPXB 5EC1A 2LFEA 4YHOL 1A6AA 3BKYH 5LSMA 1TYRA 1YBQB 1AGBB 3OVPA 4QY8B 5INCA 4JTGA 4GFSA 2AZAA 3PYCA 5CBAA 3VXRD 1XQ4A 2H0JA 1T1YB 3VXUD 1O12A 4OJEH 3QUMA 4PB0H 5T5FH 2VLKB 3WJXA 4QR6A 4KPHH 4KXBA 4BK9A 2R2BB 5CSZA 3DSFL 3MA9L 3O0RH 3OHIA 1NSJA 5AOIA 1FG2B 4Z0XA 4U7MA 4PJ8A 2G9HB 3KWTA 1ACXA 1TMLA 4WSJA 5G4MA 4I87A 2BSDA 4K8RD 2RAMA 1CFQA 1CL7I 2C91A 4JRWA 3K2UL 5RUBA 1RK0A 4JB9L 3TEVA 1FGVH 4JZOB 4AIEA 2G3IA 2EH8H 2WVSA 4F7CA 3G5VB 4P5RA 2BVYA 4TVSa 3TN0C 3NP4A 4ALAC 2VENA 4GJJA 1V3HA 5H94B 1AQ0A 2AJVH 3KAOA 3BQUB 2INZA 4XWOC 4JLRA 1PO9A 4KRPD 3EO1A 4KFZC 4LPTA 1OBAA 1NFIB 3ZZQA 4M5ZH 2W4XA 3M88A 1G9HA 3Q44A 1CQKA 3BPNB 3GYCA 4HNNA 2KERA 3VMOA 2WMPB 2XQBH 3ABGA 3FQXA 2PRMA 4PSRA 2NXYD 1O75A 3E12A 2QMKA 3SO3B 2FQGA 1A5AA 2ADGB 1G0YR 3L3GA 1F74A 4I4WA 1U8OA 4J28A 1FHDA 1NMBH 2O61A 4ORMA 2OR2A 1T0MB 3H3PL 3MODH 1E4KC 1OSZA 1T8XA 4GINA 3IB4A 3VZYA 1FWGC 4ODSH 4LCIL 1E5JA 5E7BA 3WLQA 3UL4A 4N28A 3V35A 4CDHA 2PXYC 4X5WA 3EX3A 1ZZMA 3U9PL 1DN0B 1WIPA 3GXTA 4XBEL 3L21A 4TNFA 2Y7NA 3DAQA 1WBZA 3DX8A 3LQLA 1Q38A 2JTYA 4LEXL 3IFOA 3UIYA 1KPVA 1B0RA 1L9PA 1XIWC 3MZGB 1R75A 3LPOA 4HK0A 3MVSA 1Q6FA 4BSVB 3RHWK 3HUJA 5D4HA 5ADOH 2NPLX 2W62A 2BXZA 1T0NA 3UXDA 1Q6DA 1M7JA 1OGTB 1GVYA 3EW3B 2GUUA 3EOBB 5AL0A 4BQ2A 5TQ2L 1LK3L 3OJ2C 3CU2A 2UUDK 4TNWF 3NZRA 4WFFD 2NMSA 2NQ3A 3AXXA 2Q8AH 2PA6A 4OZIF 2GOKA 1YPZF 2JI1A 3AQYA 1L8PA 1T8QA 3BDYH 1UB3A 1SO4A 1N4XH 2BASA 1PZ2A 2H1PL 2VYOA 4AL8C 4CW1B 1NBVH 2WXMA 1IT7A 1F3EA 2J9ZA 5C0AB 5MI0C 3MWAA 3C9NB 4JQXA 2AJXL 1HKJA 5IQ9A 5K9DA 4JKPH 3C5SA 3EH3B 1I8KB 1AJZA 1X7FA 5LBVA 1RPQA 4IJTA 5IWLA 3W2DH 1W31A 1K9TA 2B7NA 3ZYZA 3SGZA 4NRYB 3LQZB 1WS8A 4IIQC 4FNSA 2P50A 4KUCF 3P1VA 3UZXA 2LR4A 5CBJA 4P7NA 7ENLA 3RVVD 2X16A 3T4AC 3IJYA 5KYUB 5HYSB 3WTSA 5CWSA 1XF1A 3ZWSA 4BCZA 4CA4A 4LESA 4WWKC 3MRGB 2P46B 1UOWA 1FWRA 3L3OC 3QNXB 5J13C 3C6EA 5J8LA 2N0MA 1EDTA 1FH5L 2GBVA 2HCVA 2JKTM 1GOFA 1GG0A 4Y4FB 2O26U 4H8PA 2F9BT 4LBEB 3FCBA 3V6OC 4M4PA 3JXAA 4UR8A 1T22B 1DOSA 5HDOA 3TNMA 5T1KD 4J2MA 1G87A 4X7TB 3ZKSD 4JEGB 4O2FB 4OAWB 1F4HA 2W6RA 2QV5A 3PV7A 3W72A 3KDMA 2UZIH 1HO4A 1GZHC 1W72L 2F6AA 4QXUL 2HPTA 4A2EA 4LSQH 5ABFA 3CSGA 1NEPA 4WJ5B 3TX9A 4D6HA 3LV6A 1RK5A 1XIFA 3IRPX 3LGEA 4N8VB 2EVIA 4R7LA 1AKJB 2LU7A 2WGNB 1BVWA 2H90A 2CHWA 2OMZA 3NEXA 3FAXA 2P8LA 4J4PC 1I4FA 2FVKA 2DM3A 4G8IB 5D1XD 5IV2A 3F4WA 4Z5RB 4V2CB 1DE6A 5DJ0A 3HPXA 4M93C 2Z1XA 3DSNA 1HJVA 2HVNA 3SB3A 4CNOA 1LQBC 2RQEA 3MBED 3TJHC 1MVUB 3GK8L 5C5YA 3CH8A 4WHDA 3P2DA 3U7WH 4FQLL 4UDUA 4OV4A 4IRJD 5C7HA 4JM2A 2ED6A 3SCNA 4ZW8A 5IB1B 2GGGA 2OZ0A 3QZOA 4E0RB 3P8JA 4NB7A 1QR7A 5DWPA 2IKJA 2LAAA 2OQYA 1DSWA 1P1XA 1R47A 3QIBC 4O02H 3U48A 1M7DA 2PCFA 1UXLA 2DT3A 1PZCA 4NO0D 2EZ0D 4LU0A 3WE6B 1E5UI 2AJUH 4PGBB 4MD4A 4W93A 5HYQB 2GJ6B 5JIDA 1FWNA 5IFAL 1IEIA 1P4UA 4U1LB 4UOW0 4P07A 1E28A 3TA4D 3LYEA 3I6GA 2DUZA 3O45B 4JDYA 3OKNB 3FPXA 1T1ZB 2XPZA 2ITDA 1BREA 5FAGA 1OGAD 4D71A 5AKTA 4BQBA 3W74A 4Z08A 3ZXAC 3OD3A 4IHOB 4IMKA 3R7RA 5HI4C 3LRMA 3ZDZE 4KFPA 1MLBA 1W1VA 1HILA 3H9SD 1D6EB 4PREA 3GO1L 4MGXA 2J7FA 3ZMNA 3SE9H 3RB5A 5F44A 4GAYB 3S47A 4PJAA 1ZLSH 4NP9A 2IGFL 3B0UX 3BEWA 4G59C 3OAYK 3H26A 2NQ9A 3M7SA 4KMTL 5EBWB 4XVTH 1Q9OA 2YUXA 3BWSA 4DCQB 3EOUA 5ICZB 4X6BA 3DRQA 5IB5A 4RLIA 3MX0A 1TWZA 2QCMA 4DETA 1VCGA 1ZSXA 1Q0EA 3IANA 3QHFL 3TASA 4K94H 3T3MB 4IGNA 3S3PA 4GT7A 1HK6A 2XSKA 4QJ5B 4O5LH 4QNPE 5AVYB 2R29H 3KD4A 3LQGA 3HFMH 1ED3B 4IKNA 4WGVB 5DR5L 2QPSA 4APQA 4IBUA 4HPHA 3AIEA 1WV7T 2XG4B 1RBAA 1U8JB 4NPYB 3UCDA 1LWIA 4MCNA 1THCA 3EDEA 4NZCA 3U57A 3IGAA 4IPPA 1MFMA 4QHUB 4FYTA 2VZVA 2CDFA 3E3HA 3WN5C 1JVOA 3FN9A 5FYKH 2R1KA 4GH1A 1UKOA 3P2BA 3OL2A 3EFFA 4K3DH 1JJKA 3ZR6A 4DZ8B 1IE5A 4OW6A 1OVDA 3TBSA 3QYMA 1JG9A 4AMXA 4LDLB 1FHUA 1Q6QA 4X98A 5AW7B 1C1EL 3S5LA 1FQ9C 2Y8KA 2Q7NA 4NKDB 3BWAA 4WHYH 3CX5K 1S7XB 2B4CH 4CN1A 2CLKA 3NESA 2A9NH 4HCDA 4H2HA 1TETL 2X88A 3E5PA 3A24A 4BQ5A 2N3JA 3QNFA 1ZCOA 2QZRA 3O1NA 4X50A 5DTFA 2VXQL 1I8LC 1H63A 5E6IB 2WC4A 2JK5A 1XUZA 3DX3A 4ZFOL 1OX6A 4FG2A 3DO7A 1W15A 3TTYA 5GGVL 1T21B 4UTWC 5M5DA 1KKOA 1RZ7L 4Y9PA 3E9UA 1OF8A 4Q89A 2PPDA 4P5TC 3KLKA 1FO0A 4HX1B 2Q3OA 5L4MA 1PW3A 3FO2B 4DGIL 1UWXK 3BP6A 4N0UB 4Q97A 4ADSA 2OZ4L 1I1YA 3AS3A 4B9JA 4U7SA 2GTZA 3QO0B 1BWMA 4XPTH 3NCWA 3SDDB 3MMWA 2ZF9A 1JPGB 4L4VA 4WWPA 1QHZA 4NQUA 3FTWA 4TPRH 3LB6C 4EOWL 3H8NA 1CLOH 3HBQA 4NWUL 4H25A 5AVWB 3FSZA 3ZSSA 3EYSL 1UWTA 2NNCA 1KDIA 5AVVB 3KHDA 1PHQA 5D03A 4LEOA 1V8HA 4KJWD 1XMWA 3OKDB 3S46A 5I6SA 2IWFA 2OK0H 5IJDC 2UVFA 2EUWA 3C5QA 5I76A 1ZV9A 3HC4H 3WUWG 3OLIA 4B5VA 1ZHKB 4I0PA 1XC4A 2PTTB 3PZVA 2PF8A 5MHSE 1KN2L 1Y7VA 4F7MB 4WO0A 3CAQA 4U2ZA 3PL6A 4JO3H 3WUZA 2QDEA 1OIFA 5LBSH 4P48A 3GMNA 5D7JB 3OJDA 4GK8A 3W1NA 4IJBA 4LT7A 4RDWA 5EG6C 3ZX1A 3NP3A 2J1KA 3LK6A 4B3EA 3QR3A 1KJ3L 2UZXB 2Z4TA 4HCFA 5F7HA 1QNSA 4M7ZB 5IBTL 4YN5A 3VC6A 3R0KA 3BKJL 1S2WA 1HJXA 3O6MH 2RAGA 2ZX7A 4B9KC 4WGKA 1LWHA 1V93A 1H8SA 3BPCA 3FONB 4F0HA 5F6HJ 1KLZA 1BKHA 2NX9A 1GC1C 1FCVA 1BVOA 3BEVB 3APFA 1FLRH 1O6SA 3A5FA 1KIQB 2QVMA 4FRWA 4IGBB 2BG5A 1KIPB 4J3WA 3S34H 1YAIA 3GSNB 3TSMA 1E9QA 3WDJA 1I1AA 25C8H 4JN8A 4EN3B 3NFSL 4W89A 3T5WA 3KMDA 2GGHA 4OLWL 1K3ZA 5IIEB 2FLMA 3NGBB 2UY2A 3BD5A 2VO5A 3O11B 1NM4A 3O41A 3LNMA 5EY5A 2Z25A 3FCPA 3HC2A 3GSWA 1GPFA 2ZXQA 3UJTH 4RV8A 3Q8BA 5B1BB 5C0BE 3G6DH 4NUGL 3WLKX 1QAWA 4GXVL 1V0KA 3L5MA 3MXVL 3QC6X 5KVGL 5IFTA 1REIA 5FLVA 4PTMA 3DECA 4E9YA 1DJQA 1SN0A 2DWSA 4LK4A 3TIMA 1QWNA 5E2VL 3BJTA 1S9XA 2GI0A 1LE5B 1G9MH 3UZ5A 4KROD 4UZUA 1Q0XH 1NMAH 4FF9A 3M7WA 1DORA 3ES6B 4ZQCA 2Y36L 3QPYA 3FB8B 1P5VA 3WD2A 2ZUNA 1QW9A 3BV4A 3GB7A 1X7IA 3OKLA 1L0QA 5T26A 5EOCL 3ARBC 4MJID 1KPRB 1VJIA 2X2UA 3UABA 1AMXA 2BWDA 2F7RA 2OMXB 3C75A 3PY2A 1R3LB 4LF2A 3IWVA 3URAA 2WYHA 4IDJL 5E6ZA 4G8GE 1H3XA 1PY0A 4UDTB 4HU3A 2DWDB 4NQXA 2ZCKH 4K73A 4M1GH 5ICXB 3BV7A 3O4OB 2C9PA 3V4PL 3GTHA 4MJ5B 1DBBH 5EEYA 5GJSL 4PJEA 2DSZA 4BZ1H 1JNNL 4YVUA 3VWKA 1FL6A 1R3JA 4IDLA 3RVWD 5DCCA 1IWAA 3TESA 1OGTA 4AY0A 5SWZB 5TJWK 3EJQA 1DIDA 3N2TA 2N01B 3PSVA 1P69B 3ZYIA 4WEBL 1NH6A 2BOCA 1EAPB 1JK8A 4YOKA 5MEOA 3BH9A 3ZLFA 3QORD 1IGIL 1PNCA 5CIPB 3TH4T 2VEPA 1F86A 1IFHL 2NRDA 5I16B 2O56A 5JHDA 3SKMB 1QSFE 3Q7JA 3W1LA 1NFDF 4PCKA 3SYCA 4JHZA 1MHEB 3FHQA 5JZ7D 3IVSA 1H1YA 3LZOA 3CFKA 4HYTB 3H4FA 4HUCA 5CN1A 4Y2LA 2HROA 4O1BA 5CCHE 4N9GB 1KJ2H 3K81A 4LP4A 3CNYA 2KQNA 3VD9A 5F4XA 3CDFA 1NDMA 1BXCA 3FZUC 3SE4A 1Y6MR 4LRIC 2E1DA 1XIJA 1KT2B 4HCRA 1ZJAA 4NI6A 3URBA 1TREA 1QMLA 4J3VA 3EWBX 4JGNA 1QMUA 3W84A 5ABEA 4I9MA 1EF2A 2QCNA 1JIBA 1WFMA 1AG6A 3DPBB 5DMJB 3IUIA 4U1GB 4EMZA 2YGPA 5M95B 1W3TA 1DVYA 2D7NA 3LD5A 1YHPA 1ZHNB 1KCVL 3N2OA 6FABL 4JO4H 2HP4A 5J0BA 1CTMA 2R1YA 3N11A 1JK9B 1ME9A 3RM4A 4GO6B 1D2PA 1T22A 2H5UA 1KFBA 4A7GA 2P10A 5F7DB 1WEJL 1A7PH 2HBVA 1Y1UA 1ZP3A 2ADJB 4OR1A 1IAII 1PTDA 1U5VA 5DUBB 4KRTA 4IM4A 3NJJA 3MV7A 2I60H 5B7YA 2CM6A 2A7PA 2OEKA 4EKJA 2XIOA 1R2TA 3ALGA 4L9YA 3UWYA 4PS8A 1GZGA 5BJTA 4XUYA 2QUNA 4F7EB 1IC0A 1ETA1 4IG2A 1Q0YL 4IX2A 1U8HB 5ABAA 2XH2A 4KNTA 2WK2A 4PW3A 5BNKA 2K78A 4JNXA 4JL2A 3FLUA 3L3JB 4GQ9H 1JWUB 4OUUA 4KO9A 5EN3A 3FJLA 4RCXA 1SR0A 4LEXH 4L8CB 1R2SA 4OIAA 1EZVX 3LCWA 2QR0A 5LIKX 1ZVHA 2QL1A 3SAZA 2Q2EB 2HMID 1U8IB 4HOWA 4F91B 5T3XE 4HH9A 1ACYH 3PR2A 2Q2LA 1LK3H 1LEGB 4FXKA 4PMRA 2EUXA 3GFUA 2EYTB 3CLEL 5B39B 1NFGA 4BFIA 5IR1B 4I5BB 3KBNA 1P5UB 5HHOB 1ETJA 3ATBA 4TVPL 4UV7L 3V7AG 1M7XA 4GC3A 1B3OA 1WICA 5A8PA 5J6HB 3KLQA 3WKQA 1N8WA 1NTDA 1T7LA 1TEYA 1Y5VA 5EUOA 2PWDA 4HJEA 2VURA 4YYFA 4JFDD 4KVCH 3RM8A 7PCYA 3PZ9A 3WY3A 2AJXH 3A4EA 3O45A 3L8QA 3OKNA 4K3JH 3APYA 1FNGB 3O8XC 1NCCL 4I2XA 3HMXH 4AQEA 3GXUB 3QUZC 3LEYH 1UR1A 1P0SE 2FIKA 2PWUA 3HKZA 2IG2H 4E4UA 3SGKC 4YFLI 4H4NA 3WIFA 4NKOA 2QCEA 1IBZA 4B5XA 3W2KA 5MHSD 2F8XC 3MUGB 2YL8A 5JQ9A 3SDXF 4AD0A 5F1UA 5FA4B 5TQ0L 2WTOA 1RUAL 4LFHG 4UINL 1QACA 5GJTL 5DFAA 3FUEA 4M9OA 1PTZA 2IDCA 3GEFA 4GUPA 3AC0A 1J12A 2HWZH 1C5CL 2Z31A 4BFJA 3SGGA 4JCWA 1QX1A 3J27A 2WN2A 3C8KA 2CJUH 2O6PA 4NQVB 3TDFA 2VRQA 2F1AA 3U4AA 4QLJA 2W60A 4IIFA 2C1GA 2QCHA 1OPGL 3NACH 1FC1A 5HBBA 3MWCA 4Q7IA 1MI3A 1E90A 1W72H 2QZ5A 1RQBA 1XBRA 4P2OC 4LBRA 4RPQA 1FCQA 1CBGA 3PBWA 2BZCA 5E2UH 1DQDH 1FH8A 4KT2A 2ICES 4KXDA 4ZOBA 2BVQB 2IQAB 3ITGA 4EI0A 5E56A 3BN3B 2PKDA 1U8JA 3NZGA 1C9WA 5DZNA 1TV3A 1E72M 5BYWA 5EEUA 3VH8B 2XQ0A 3K71A 5B1CA 2YQGA 2EDRA 1NP0A 1SVBA 3VXTB 1US3A 5JQ6H 3QSRA 1RCYA 3W24A 2A4CA 2PDQA 3OIXA 1S9WA 1GZJA 3U7BA 4YK4C 4GRWE 5K59F 4KQ4L 2NY3D 3CASA 4PEEA 3H9YA 3MLZL 4DTGL 3H70A 2KC0A 4FQLH 2NQ5A 3LSOB 2AQOA 5DRIA 1Z66A 3CVHA 4NKDA 3ARFD 2XRAH 1GVRA 5EC1B 4IM8A 3HS0A 5HHPB 1U6AL 1W0MA 1CL7L 3WFLA 1X4ZA 4LCCC 5E9NA 3KM1A 3TO4D 5DA4A 4ES8A 3LPFA 2W27A 3UERA 3FQWA 4KXAA 5JORA 5CBAB 1NANH 3E9AA 1O9ZA 4X6DF 1EV2E 2FDSA 3QUMB 4KTEL 4MA1C 2P48B 2XGZA 4HX1A 1WZ1H 2DWTA 5CSZB 5IFAH 1ECZA 3GSNL 2GIXA 1UQSA 2Z65C 3QDHA 3QO0A 4Z0XB 4BZYA 3WS6A 4Q4MA 4PJ8B 4ZX6A 5GZOC 2Y1AA 2VD9A 4G8GD 4B15A 1OAKL 2VGFA 5KN5B 1ZTXH 4WI2A 4QD2E 3IJLA 4HH8A 1CFQB 1EC7A 5CPLA 4TQEH 5FJIA 1AKPA 1RK0B 5F7EL 1SVCP 5IB3B 1P84K 4KO5A 3QEHA 3DIDA 1OYCA 5CKGA 4GUFA 4PBWD 4KQ0A 2ETWA 4LYRA 4F7CB 3IMUA 4F1SA 1KGWA 1UR3M 1JXJA 5C6TH 1CD0A 4L61A 4U28A 4KKCD 2K6ZA 4LDEB 1KLUA 3WXWH 4INFA 2Y1YA 3H9ZA 4JPQA 2UZYA 4MNMA 4NNYA 3VXRA 2ATAA 4JLRB 2VXTL 4H6RA 3K5XA 4UFLA 3VXUA 1J1PH 3EO1B 5E51A 3FO9B 4JO1H 4FQHA 5D7JA 1RUML 3INPA 3KL5A 2W5PA 1P6BA 3ZS4A 5D7IA 1M01A 4M00A 5DT1L 5B7EA 1X5MA 1DXIA 3DFOA 4MZYA 1HIZA 1QSFD 3QEQD 4Q7NA 3FQXB 3KOYA 2W92A 1TTRA 2PDCA 1M3IA 4OLXL 5A2JH 1U8QA 4QE5A 3MUIA 3N2XA 3L3GB 1M7UA 4I4WB 1U8OB 1TXKA 1J5DA 5KETA 3SCMD 1FDYA 4N8CL 3UO1H 3RGVC 1ODZA 3FJ4A 2O61B 1OCWL 1B0GA 5FYLL 1BZ9A 1VLXA 1QTYT 2JKXA 1P6FA 1OSZB 5EZOL 4DWDA 3O0LA 1YIXA 4AD5A 4ZAKA 3S8GB 2ZDSA 5IQOA 2W9EL 2X4TA 4IGBA 2XVBA 4ELKB 3CEPA 4IMGA 1INDH 4X5WB 1JULA 3GG7A 5F8QC 1CIDA 3CQJA 3ARRA 2XWCA 2GITA 4BQ6A 3HZVA 4MD0A 5AALA 3H2OA 3F6LA 3K6DA 1WBZB 4BJHA 2HTKD 1ITCA 3IFOB 1EO7A 1XH0A 4ZMAT 1KPVB 5HMDA 3LQAL 1U91A 3B5GA 2JJSC 4ABUA 4ONVA 3REWA 1G9EA 4UAOC 4HK0B 1PZ0A 3HUJB 3WSUA 1S7UA 2YFOA 1T0NB 4LGPB 1D9KD 1DZ0A 1NEZG 1JPFA 1QOPA 5ETUB 3AQZA 1TPH1 2FNWA 4MYAA 3L66A 4OH2A 3BKMH 2WXFA 1V7AA 5GRUL 4XO6A 5GXBB 5FB8A 4C4BA 5KVEE 1SBSH 5CXPA 3MDWA 2HE8A 1FOBA 5IUCA 1WBHA 3HZKA 2KPNA 3DUUA 1RZJL 3FB8A 1V54B 2E5CA 1YEKH 1E0OB 1MW1A 3PGDA 3ARGD 5FX3A 4J2PA 2VDRH 4BCXA 3N43F 5IQ9B 3DETD 2OMXA 4HXAH 5EBMA 4NJAH 2I7GA 1G7MA 4NWUH 3IIOA 5J56B 3RVUD 2X30A 5EBGA 1WA3A 1DBAL 3OPSA 4L5FE 5AZ0A 3BMWA 4TVCA 2VC2L 2REQA 3ARDA 3MSYA 1LG1A 3OM3B 4EIUA 3UP8A 1UEYA 3IJYB 4NZJA 1V7NL 3RKDC 5CWSB 3VIJA 4XI5D 5F93C 1GMIA 2YS4A 4ABVA 2JWYA 3USZA 4X9GA 4Y16A 2QGHA 3UR2A 4A7QA 3O4LE 3LMZA 2V3EA 2Z00A 1RBLA 4BCYA 4WU5A 4C4UA 1QPXA 3OHMB 3TNMB 1G4PA 1K1DA 3EPMA 2PI6A 5AYIA 4RZKA 3RCMA 2Q7YA 5KANG 4FKEA 3VK5A 4H20L 4IMFA 3CS2A 4LOEA 1ZS8A 3P40A 1Y0EA 5CJ8A 2RACA 5ABFB 4Q6IA 5DGQA 1EAOA 5PCYA 4FABL 2Y7LA 3FQNA 5HGDA 3GGWA 2WOYA 4Z3HA 3F58H 2AEIT 3MVIA 4KEUA 5EIIA 1XAUA 5GRZA 4C54A 3VO0A 4AF0A 2Q09A 2WNGA 2HLFD 3V4UL 4HEME 2EIDA 1GVOA 2OMZB 3M0VA 1LF1A 2P8LB 3BG5A 1NDTA 5IT2L 2KMWA 3ABMB 4HJIA 1WCBA 4XX1G 1KT2A 4ZENA 3CT7A 1JPHA 1NAL1 4PMYA 2ZA2A 5DJ0B 5F6IB 3BVXA 1OABA 3CFMA 1YEFH 4DXVA 3DSNB 1QG3A 4DEFA 3IKKA 2LV4A 5GGRY 4QUOA 2N0KA 4JFTA 2MRYA 3L5JA 2WC3A 3ZHLA 1I8IA 1XLIA 3BUIA 4BFBD 1C91A 4UDUB 2XQYG 2WOBA 1UWQA 5J06A 1XXDC 4PJFA 4JM2B 5CLWA 3S9ZA 1E4XI 3WJYA 4NUGH 5DFVC 3DXIA 2P80D 2VEMA 3MXVH 3SODB 3VGDA 5KVGH 4AH7A 2R4RL 4G9DA 1WD8A 4FXRA 1HCYA 1MCFA 1M7DB 2PCFB 2W38A 4G7YH 4ORIA 2ESCA 1SJHA 1UM6L 1MAML 4MD4B 1J18A 1EJWC 1TEGA 5DXXA 1QW8A 5D1XA 4UFHA 2FATL 1Z9PA 1SEQL 1E28B 1PCSA 2OTPA 2P3EA 3DJ9A 1XXFC 2EUZA 2J1WA 2ITDB 2AF2A 3NDZE 4IDJH 1B57A 5HJGA 4M9PA 4Y5YA 3RL1A 4DGYL 4ZDHA 2YPVH 3NAVA 4IRJA 2G4GA 4UQIM 5IKCA 1NC2B 3FJTA 3G3MA 3GAKA 1EJOL 5FCSH 1MLBB 3ZT5A 4XO3A 2VZ1A 1HILB 4PREB 5I00A 3AIQA 3WNLA 3X3GH 1K2DB 5DMGD 1HE7A 4OUEA 2HKHL 2FYVA 4YTSA 3UYOD 5F4SA 1KWGA 4PJAB 1SMAA 1IGSA 2VH5L 4NO0A 2R0ZL 1JTOA 3IETA 3BEWB 5E5CA 4Y5VA 1BEYH 3LOTA