3A4AA

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
total genus 238
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3a4aA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4aA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3a4aA02
3LPFA 1ZL1A 1WNOA 3BH4A 4AZCB 1V3HA 2WHLA 2ZUVA 1RH9A 1P6WA 4AZIA 1J18A 1UWSA 2WZIA 3SCSA 1E5NA 1SMDA 3J7HA 2ZXQA 3K8LA 2XWDA 2X0HA 4ACZA 5A8MA 2F7QA 3VNZA 3T09A 4UQBA 3A47A 4V27A 1CXKA 5A3HA 3VTRA 4AMWA 3L4XA 3MV11 4AIEA 4UZSA 3ARVA 4HA1A 1UH4A 1V03A 3MUAA 3L4YA 1E4IA 4MB5A 3WDJA 5EBAA 2ZUMA 4H7VA 1PX4A 1BSIA 4OZOA 1GVYA 2O9RA 2CNCA 5JBDA 4QCFA 1EOMA 3CH9A 2EABA 3I3EA 4JCMA 4RE3A 1EH9A 4TX8A 3H54A 4W85A 2E9BA 1HN1A 3W24A 3G6MA 3VDHA 1KQZA 2EPNA 3SCRA 4YPJA 2PB1A 3WD0A 1J0IA 5EB8A 3F5JA 4TVCA 3TV8A 1MW3A 2VMFA 1KR1A 2VURA 2CITA 3MO4A 1RD6A 4ZXOA 4U33A 4UQAA 3VD5A 2J8FA 3DX0A 1VEOA 1NP2A 1WDSA 2B31A 4P8XA 3KLLA 2WBKA 3B9DA 5HXMA 2XHYA 3WEOA 1CGXA 1VEPA 5GNXA 4PTWA 1DTUA 8CGTA 1BLIA 5FD0A 2G3IA 4NXSA 4PMZA 5D4YA 1U30A 3WD3A 1B31A 1ECEA 3OBAA 2J77A 3NSMA 3BAWA 2XUCA 4AZBA 3ARQA 3AICA 3SIMA 3F5LA 1E6QM 3AXXA 3VIKA 4TTGA 1LQ0A 1JFXA 2W61A 4B9ZA 2J7HA 2WMJA 3WN6A 3BSHA 5AYBA 3D3AA 2O9TA 4DO6A 1GHSA 5A8OA 5A6JA 5DO8A 4TOQA 3SEPA 1CLXA 4FLRA 2E9LA 4JIEA 2WMKA 2VX7A 1MXDA 5D8WA 4FNPA 3WY2A 1K9DA 2XFRA 3O9NA 4X0NA 2XN1A 3WSUA 2VCBA 2GDVA 1W1PA 2BY1A 4CD8A 2Y5EA 1CIUA 3THCA 2XG9A 4CD7A 1XC6A 4FNQA 1UA7A 2J7BA 1IV8A 2E4TA 3JUGA 2EXOA 2YBUA 2Z1KA 2X09A 4JAWA 1KGXA 3W53A 4D6JA 5EMYA 2PC8A 4AZ6A 3DX3A 1V6XA 1HVQA 2QMKA 3EDDA 1EO7A 1W9DM 3B9AA 3WEZA 2MANA 4H8VA 1WZLA 2X0YA 4U5IA 1XYFA 3BCFA 3ZJ8A 4BS0A 1UD2A 3WF0A 1WP6A 4CU6A 1KWKA 4D71A 2VCAA 2E3ZA 4DWSA 1JD7A 3M6DA 3SURA 3VIHA 3BAYA 1C7SA 2GDUA 4FLSA 1QWNA 2E8ZA 4URIA 4EE9A 4LYQA 3THDA 1W9PA 3MUY1 1XSIA 1HL8A 1JL8A 3IANA 1C8QA 2XM2A 1EHAA 2Y8KA 2XGIA 3IJ8A 1BAGA 1QHOA 1IZKA 1UOKA 4IPLA 5CPQA 5BXRA 2D22A 3A24A 4UFHA 1V3MA 1WKYA 3CHEA 3OA5A 1GHRA 5A94A 1PZ2A 1B3XA 4AIOA 1JNDA 3BAXA 5D9PA 3WF4A 3WQVA 3WBAA 3S5YA 1HXJA 1GCYA 4XUYA 1VJSA 3CMJA 4UFKA 3OZOA 3L2MA 3FHQA 1JDAA 4QDMA 3WH9A 1BYDA 2YOCA 1U2YA 5CLWA 1DWIM 1QNRA 3WBEA 2FDMA 3HG5A 3HU7A 2UY3A 2VZUA 3U5UA 2CESA 4X9YA 3SCOA 2BHZA 3L4VA 3KL5A 1BGAA 1QW9A 2OLHA 1KQYA 4ML4A 3WF2A 1HX0A 4UOQA 4JFUA 3OLIA 4W8LA 1VFFA 4CU8A 1E55A 1V3IA 4P7NA 3EDEA 2J7FA 5I77A 4GZIA 3L4TA 1EHNA 3UERA 3PZUA 1JZ5A 4OUEA 5D9NA 3TP4A 3LPOA 2X8RA 4DWSB 3N04A 1NP0A 1L8NA 1PX3A 4J27A 5KEZA 3HZ3A 2WYSA 4J3XA 1EA9C 4GI8A 2VQUA 2CHNA 3EDJA 1JG9A 4OOZA 2Z1SA 3FHAA 3SCUA 1QOXA 4IISA 5FL0A 3PZGA 2GFTA 3MMDA 4F79A 4PSRA 3CUHA 5DFAA 5CSUA 1FHLA 1UD3A 3ZOAA 3WH8A 1JZ2A 4W7WA 2BY0A 2WVTA 4PMRA 2W62A 3WDHA 3FNDA 4CD4A 3TA9A 2J79A 1UQYA 2ZX8A 1E70M 1V02E 1PIFA 2IUZA 1H41A 2EPLX 3VIGA 4H2CA 3VD7A 2JEQA 4HMEA 5A1AA 1EGZA 4S3KA 3AOFA 5BXSA 1ODZA 3VO0A 1LG2A 2JALA 1QI0A 1TA3B 4MTVA 2F7PA 1DHKA 1E40A 7A3HA 1J10A 1B1YA 1ISZA 4WLCA 3SUVA 2WCGA 3GTNA 4JFWA 4W87A 3IAPA 1C8XA 1KXHA 3DX4A 3ZT5A 1JF5A 1JFHA 3GXFA 1W9UA 3UG4A 4AYSA 3GXMA 2BY2A 3UESA 3AXHA 1G94A 3AFBA 4HTYA 3GNRA 3M07A 1UG6A 4CKQA 2XPKA 1G01A 4BQ3A 1H0GA 1JYWA 3BSGA 4PCTA 1UWQA 3N13A 2PWHA 3WQ8A 2YL5A 1C91A 3WNOA 4A4AA 3CMGA 3RDKA 1UR4A 1HP4A 3CO4A 4LGXA 3NDZA 5M03A 4DUVA 1EQCA 1HKJA 1E0XA 2JF6A 1JNEA 3MKKA 3U57A 5DF0A 2WMIA 3BUQA 1JXJA 5A8PA 3ARRA 1MYRA 1H2JA 4GPNA 4LPCA 4HOWA 5GNZA 2VTFA 3WEMA 4BZYA 4UTFA 4W7VA 4AEEA 1UR8A 3SUTA 1H49A 3FXYA 2WMFA 4W84A 3GNOA 2VX5A 3VPLA 2WHJA 3AMKA 4QLKA 4HZ7A 5A6MA 1O7DC 4GI6A 3AYRA 5BRPA 2D20A 1E6PA 4UZUA 2JIWA 5I0DA 2PF0A 1GOQA 5GPRA 3MI6A 3EDKA 3SCPA 1E3XA 2D2OA 3WH6A 2J7DA 1V3KA 2WMHA 2DDXA 1QI3A 1US3A 3POCA 1MWOA 3BVTA 5HPCA 3WQ5A 4JL2A 1NOWA 1W1VA 4W8AA 2EADA 2G3MA 3A5VA 5A6LA 2PBOA 1UH2A 1HJSA 4FLOA 3AHZA 1E15A 3WY3A 3S5ZA 1ZBKA 2PWEA 3H53A 1CYGA 1BYAA 4GQRA 2C8NA 2VC9A 2FH6A 3GXPA 1HJWA 2J75A 2OWXA 3K4AA 1H5VA 3CZEA 2WXDM 5A8QA 3HG3A 2VVSA 3VM5A 3UG3A 4FF5A 4PCSA 3PZMA 5ABFA 5CG0A 1OINA 1BVNP 3WD2A 4PUDA 3D4YA 2QF8A 2WKLA 3VGEA 5CQ1A 2DT2A 5I5RA 3RILA 3NIYA 4KH2A 3F5KA 4IPNB 1GJWA 3DYOA 2Y2WA 3T2QA 5A69A 4J3TA 2E40A 1VFMA 2ZXAA 1SR0A 1KGWA 5D9OA 4JHOA 4Z2IA 1QNPA 4R5EA 3FW6A 3WDPP 1O6IA 2NSXA 4NF7A 2V3DA 2NW0A 4Q22A 4D6CA 5TD4A 4J3VA 5A2AA 3SCVA 4B9YA 1QI2A 5I2UA 2GJPA 1HL9A 1QW8A 1V3JA 5I3DA 1W3KA 1CGUA 3VD9A 1AQ0A 1XCXA 4XX6A 1K9FA 2F8QA 1UASA 4AD4A 5JUVA 2D23A 4UQEA 2CKSA 4GXPA 2BS9A 2DIJA 1WDPA 4DM2A 3EJPA 3CHDA 2XGBA 2DSWA 3AS3A 2DIEA 5ABGA 3AIWA 2WVVA 4JL1A 5CPSA 1F4AA 3WNMA 2WZEA 2XJ7A 3GBEA 3W6LA 2EPOA 5IFPA 7CGTA 3KL0A 3WNPA 1TQUA 1T0OA 3B8SA 4OKDA 5BXTA 1HKKA 3VMNA 3ZM8A 4W89A 1UKOA 2RGLA 1A3HA 3PZOA 2Y24A 2YDSA 1X1NA 3VSTA 3I3BA 1PPIA 4UNIA 4WJXA 3LPPA 3OZPA 3VUPA 3W27A 3A4AA 3D5HA 3PZIA 2FHFA 4PMNA 1NM9A 3BMWA 4CUCA 2VI0A 4NXKA 3ARWA 5I79A 3NCOA 4YN5A 4W88A 3WD4A 4UQCA 5ABHA 3N11A 1LL4A 3MU7A 3VIPA 3EJSA 2HVMA 1E9LA 3VKKA 1GOIA 3WNNA 2A3HA 1OT1A 1E6SM 1TE1A 3VIFA 3CZNA 1TQWA 1S46A 1KWGA 3A21A 4JFVA 3IAQA 5HOSA 4UCFA 4MDOA 1QWUA 1FFQA 2G41A 5A2BA 2QMJA 4FNRA 1M04A 4DUXA 5A6SA 1OGBA 1UKSA 3RPMA 2YBTA 2EACA 2YA2A 2A3BA 2WB5A 2ZICA 1QI5A 1EDGA 3WIJA 2DH2A 2QPUA 5HNNA 3A4XA 1V6UA 1WZMA 1W2PA 1GUVA 2QV4A 1E72M 3WY1A 4LYRA 1E4LA 1OD8A 2XN0A 3TONA 1PIGA 1CDGA 2IXVA 4CCDA 2JEPA 2VT0A 3D4ZA 1XD1A 4UFJA 3NYDA 4LQ1A 3HG4A 1EDTA 4MDPA 6CGTA 5AC5A 3VMOA 3W28A 3CUGA 2YIHA 4FLQA 1SYTA 1WE5A 3VGGA 1GJUA 3MMWA 3PHAA 4OGZA 4MNMA 3ZO9A 2J62A 4K68A 5DT7A 3WDRA 1GNXA 4W5ZA 3RM8A 3T08A 5DT5A 2PBGA 3ZT7A 1DWFM 3DYPA 4PMVA 2VQTA 1CGTA 1ITCA 1E0WA 3EBVA 1FH7A 4EK7A 2V3GA 4GZEA 2XIBA 1TVNA 4Z2LA 3AZTA 3RM9A 4PUEA 1JF6A 1WO2A 3LXCA 1GOKA 5JIPA 2XVKA 3K4DA 4U2YA 4HA4A 1J0HA 1V0MA 2CBIA 4WKAA 3WKZA 5FIPA 4M56A 9CGTA 4KMQA 1RP8A 5AYIA 8A3HA 4PYSA 3LRMA 4PEEA 1B30A 2CIPA 3BVUA 3VD3A 1X6NA 1HVXA 4GO8A 4J28A 3BVXA 4BQ2A 1RPKA 3VIIA 3LXBA 1E71M 1NWRA 1V0KA 1ZBVA 3ARXA 4UFMA 4ACYA 3GXIA 2DSKA 1BGGA 2AAAA 4UQ9A 4F8XA 3AS0A 4UQDA 1TFVA 1LG1A 5E9AA 4U5KA 1C3FA 2XSBA 2OYMA 2G8ZA 1JZ7A 4D6DA 4YHGA 5M17A 4Q7NA 1LL6A 1AVAA 2QHAA 4D6FA 4AD2A 3GZAA 5HPOA 5AY7A 1H11A 4LYPA 3VX1A 5C70A 4E4PA 2ZUNA 3VIMA 3CUFA 1W2VA 4J3UA 2CYGA 2VVNA 4OJYA 2CETA 4ACZB 1OBAA 2ZWZA 4WK9A 1XV8A 2VZOA 4CD5A 2FH8A 1MQQA 1WDRA 4A3YA 1XSKA 1WB0A 2W67A 2W5FA 5A8NA 4V28A 1J01A 3RMEA 4H8UA 3NSXA 3L4WA 1B3ZA 1MVYA 3RJXA 3ZT6A 1CXHA 3A6OA 1OWQA 2NT0A 3MMUA 3IGUA 1WZAA 2VL4A 2VR4A 5IDIA 2J7EA 3W26A 1Q6CA 1OM0A 3AI0A 4H04A 1W3JA 4HP5A 1Q6FA 3CHFA 4DWSD 1BQCA 3KLKA 3ZSSA 3FAWA 1UUQA 3AIEA 2BXZA 1TZ7A 2WCAA 1B0IA 1UA3A 3LRKA 4AIUA 4TVUA 3A4WA 1H1NA 2BY3A 2JFEX 3U7BA 1QI4A 1K9EA 2VOTA 1R85A 4D6GA 3WDIA 3IJ7A 2JE8A 5E6ZA 1VBRA 1UD8A 1YQ2A 2WHKA 3AROA 3FN9A 1OD0A 3VINA 2X2YA 1R46A 1JIBA 3EJTA 3O2LA 1BPLB 3EYPA 4NI3A 4D1JA 4ZENA 2BVDA 1JAKA 2G3NA 4WKFA 3RO8A 4MB4A 1D7FA 5IXEA 1ISWA 1V0NA 3AIUA 4FK9A 3AMLA 3UETA 3SCQA 4DWSC 4N42A 2YFOA 1E6XM 4F9DA 5ABEA 1CGWA 4JZ5A 1KXVA 1D2KA 2UY4A 1TQSA 1GZJA 3CLWA 2OYKA 1HF6A 2A3AA 3BLPX 1R33A 5CSYA 3AJ7A 1GOWA 1E56A 3K46A 1KTBA 3N15A 2WNWA 1W3LA 1J12A 3OLDA 2CCRA 1VF8A 4XZBA 3PTMA 3CGTA 2XM1A 3AHXA 3ZJ7A 2EAEA 4KRTA 2VZVA 1TVPA 2J78A 5A6KA 1OCQA 1HJXA 4JHZA 5FKYA 2YJQA 4XV0A 3AHYA 1I1WA 1D3CA 1VENA 2IGTA 3WMSA 5D9MA 3RIKA 1KR0A 3WF1A 2RGMA 4KGJA 1UR2A 4DUWA 2X05A 2WLYA 5LA1A 1EQPA 1UZ4A 4U3CA 4NZCA 3K8MA 5E1QA 3ZJKA 4E8DA 2WZHA 4B16A 1QX1A 4Z2HA 2F1BA 3L4UA 1W9XA 1ISXA 2E9MA 2J74A 1NWTA 1KBKA 1CXIA 1LLOA 1QPKA 1KTCA 4HZ8A 1KGUA 1HJVA 2D0FA 1US2A 4NZJA 5JBFA 4ZE4A 2A3CA 5CPTA 2G3JA 3KE0A 3PN8A 2CBJA 2D3LA 4W5UA 3RCNA 1PZ3A 2XFFA 4KGLA 2OWWA 3PZQA 1HNYA 1CLVA 3SUWA 2WVUA 3MV01 1R34A 1CENA 3M46A 3BAIA 1XGZA 2CXGA 1HT6A 1GQKA 3VGDA 3GDBA 3O6AA 3VM7A 3UR7A 2ZX6A 2DSVA 3BCDA 5I23A 3E1F1 1UH3A 2D73A 1BG9A 3N1AA 2GK1B 4N0RA 4PSPA 3IK2A 1XHGA 4D1IA 2XSAA 3ZIZA 1E43A 4AMXA 1MQPA 3LRLA 1V3LA 1OGGA 4P7QA 4P8UA 3SCNA 1DWHM 4C7DA 3WY4A 4MAZA 5I24A 4W93A 3PZ9A 1BYCA 1QHPA 1KXTA 3WFZA 5A6BA 1B9ZA 3WMBA 1WCGA 4W8BA 3GH5A 2W92A 3OGRA 1B3WA 1M7XA 3EJRA 4DM1A 4AZHA 4TUFA 3AIRA 5BYWA 2WKGA 2D0HA 1DWJM 1CXFA 3ARZA 1NQ6A 2WAGA 4CVUA 1B3YA 3NDYA 1JXKA 3W4RA 2OSYA 1NWSA 3VX0A 3GH4A 4P7RA 1FA2A 3W38A 1W9VA 2DSZA 3ZQ9A 4P7OA 1V6YA 4IUGA 3WH5A 2EQDA 2F18A 1KFWA 2BXYA 1OIFA 3WENA 3EDFA 3BAKA 4B15A 4OOUA 2CHOA 4NX0A 3EJUA 3APGA 3QHOA 4OIFA 4UOZA 3VIOA 4M1RA 4HPHA 3LXAA 3CIVA 3WL1A 2V5CA 2OYLA 2WC3A 2F61A 1ZBWA 1PJ9A 3ARPA 2OSWA 3OG2A 2VRQA 1R7OA 4XB3A 1JD9A 4PMQA 1C90A 1PS3A 2GK1A 2WPGA 3WD1A 4RL3A 1BHGA 1J9YA 1UQZA 3N12A 5JIWA 2XTKA 5A95A 2CKRA 5CJ5A 2VZTA 1HJQA 4IM4A 2WW5A 1CEOA 1E6NA 1QNSA 2YL8A 4D6HA 4OBRA 4PTMA 2YDQA 1R8LA 4AZCA 3OLGA 1FH9A 1KCLA 4M81A 2VX6A 3CHCA 3W0KA 3D52A 3WNKA 3W25A 3OIHA 2ZX9A 2PWGA 4AWEA 2EPKX 3PBGA 2GUYA 2Y4SA 2WK2A 3II1A 3ZR6A 3AS1A 2ZX7A 4M80A 4ATLA 3WUFA 2V38A 1HIZA 1E1EA 3CZ8A 4MNJA 1E3ZA 4PTXA 3WFLA 4Z2JA 1H09A 3GYCA 1MFUA 1PEZA 3DDGA 3NJ3A 4BQ5A 4J3SA 4PMUA 5C71A 2A3EA 1UWUA 3WUGA 2FHCA 4FNSA 4HMCA 5FOOA 4D72A 5KZ6A 2GVYA 1IZJA 1N82A 2O92A 5I78A 2WMGA 1UWRA 3WELA 5BRQA 3CZKA 3VNYA 2J47A 5AC4A 3CZSA 3WL0A 4NRRA 3T0AA 2WM0A 1KXQA 4RE4A 4MNKA 1I1XA 3MANA 2XFYA 1E4MM 2W4XA 1CZ1A 3DX2A 2OW7A 1XH0A 2FE0A 5BROA 4WSJA 3TOPA 3AMGA 3CZGA 5F7UA 5BXPA 6A3HA 1HXKA 4MJ2A 1I75A 3CPUA 1ESWA 2DEPA 2BVTA 4Z2GA 5LA0A 1L0PA 3BLBA 3VU2A 2CERA 3PTKA 2EBNA 4PMYA 5GQBA 2WLZA 5IHRA 2EPMX 1E6RA 5CLTA 4P8WA 4B3LA 1XH1A 3CUIA 1M53A 2C0HA 2VX4A 4H41A 2CEQA 2DQXA 1ITXA 4Y7EA 2X2JA 2WANA 1CGVA 2WSPA 3GXTA 3QOMA 1GOMA 2VUYA 1E5JA 5A6AA 3OLEA 1QBBA 2ZUSA 2O9OA 4GI9A 1UR1A 2FGZA 1MQRA 3SCWA 1NOFA 2DT1A 4QLJA 3VVGA 1LJYA 1F4HA 1WPCA 1O7AA 2VJXA 1JI1A 1W3HA 3ALFA 1JDDA 3BAJA 1HKMA 3HMCA 1JI2A 4CN1A 3T0DA 3MUZ1 3AS2A 5E70A 4TVDA 1TUXA 1C8YA 3T2PA 3FY1A 1W1TA 3ZMRA 2BV9A 3DHUA 1A47A 3LPGA 2ZX5A 4CD6A 4FNUA 3DECA 1UD5A 1E73M 4LX4A 4TTUA 1R47A 1NWUA 3PZNA 3GNPA 4CVWA 4YHEA 2F7RA 1XCWA 1G5AA 4GQQA 2W63A 5HBFA 2GJRA 1GQJA 1W1YA 4AD5A 1VB9A 1MFVA 1VIWA 3CUJA 4DO4A 1UKPA 3EMZA 3S2CA 3W37A 1RP9A 1TA3A 3TTSA 3VGFA 3WDQA 2ZUUA 2ZOXA 1UR0A 4R27A 3T2OA 3SCTA 1MW2A 1CECA 4TXEA 6TAAA 3GXDA 1OIMA 5LYRA 5FCZA 1AQMA 3BVVA 3DDFA 4C7GA 5DEZA 1K6AA 4MADA 3VSUA 1FHDA 1OT2A 3EJQA 5A2CA 2E0PA 2FHBA 1OGSA 1WZKA 4QLLA 7TAAA 3ARYA 4PMOA 1HWWA 4MPKA 4AZGA 3AMDA 3QGVA 2PWFA 3VDCA 2UY5A 1B90A 1G1YA 3SUUA 2EEXA 3MS8A 1BFNA 1FFRA 2HISA 3OGSA 2WWDA 2WCSA 3UR8A 5E0FA 1TQVA 1BYBA 3ARTA 3SUSA 4MAVA 5A6BD 2ZWYA 1E1FA 4JKMA 2YLAA 3HN3A 3LMYA 2EJ1A 4PTVA 1JYVA 4UR9A 3AIQA 1BF2A 4TX6A 4ZE5A 3VILA 1SFSA 1H3GA 1CTNA 3H55A 5FL1A 2JF7A 3AZSA 2PWDA 5BWFA 1TR1A 1R75A 1QNQA 1FP9A 4AD1A 2OW6A 4L4PA 3PTQA 3DX1A 4U2ZA 3D50A 4BA0A 1PAMA 2JIEA 1XYZA 5E0CA 4HPGA 2Y8VA 3BUDA 4NZFA 3K1DA 1G0CA 1GONA 1WAWA 2O9PA 3ZSTA 1JZ3A 1OB0A 3A23A 3ALGA 4S3JA 4KWUA 1M03A 4JFTA 3AISA 3QOKA 1VFOA 1AMYA 4C7FA 4H8HA 5JBEA 1C93A 2VZSA 2UWFA 4J3WA 2QPSA 5ABFB 3HJEA 1GQIA 3BUBA 4CCEA 4NRSA 2WC7A 4PMDA 1J0JA 1FOBA 4KRUA 1Q6EA 1UHVA 1TMQA 4ATDA 5M5DA 2V3FA 3GBDA 2F1AA 1QVBA 3OGVA 3VGBA 2YL9A 3CBWA 3ZR5A 3PZVA 1PX8A 4X0VA 3WUBA 3QHNA 2WHMA 1UWIA 3A22A 1GW1A 1GQLA 3UEQA 1R7AA 4AC1X 3W29A 1CXLA 4ZEPA 1NH6A 3POHA 1V02A 1ODUA 1Q4NX 3VDAA 4JCLA 4EKJA 5CXPA 3N9KA 1EXPA 1FP8A 5CGTA 3WQWA 4CN4A 1V0LA 1E0VA 2FGLA 4EAMA 1SMAA 2J7GA 3L4ZA 1GVIA 4E2OA 3WQ4A 2XVPA 1VEMA 3BVWA 5DMYA 2XWEA 1R87A 2V3EA 4PN2A 4ZFMA 2VNCA 1XD0A 4BCEA 1PBGA 1E6ZA 3ARSA 3N18A 3VD4A 3KL3A 4P8VA 1DEDA 2G4FA 3TTOA 5GNYA 3UG5A 1VBUA 2YKKA 1XSJA 4NSBA 2VRKA 2OWCA 2GSJA 1K9TA 4CCCA 4XZWA 1HJUA 2F7OA 3D51A 2DT3A 1KCKA 3CZLA 1V08A 5EFFA 3BUIA 1LL7A 4L4OA 2TAAA 2DSUA 1R86A 3DYMA 2QLYA 2X2HA 2XN2A 3F4VA 1ZB5A 1JZ6A 5CGMA 2VCCA 4AMCA 1KBBA 3AHTA 4GINA 4GKLA 4PMXA 5E09A 3G6LA 5HDRA 4LXFA 1CWYA 3VSVA 2IXUA 3GXNA 3U5YA 4AISA 1ISVA 1B2YA 1CXEA 1MW1A 1SZNA 1B3VA 1V6VA 1C7TA 4CGTA 3ZJ6A 1Q6DA 1V6WA 2ZXDA 4PBGA 1ZU8A 4BQ4A 2W91A 5ECUA 3WNLA 2BFGA 1KB3A 1UWTA 2DPEA 2WWCA 1X6LA 4HZ6A 4D6EA 3I3DA 2ZUTA 4MNLA 1EOKA 2ZIDA 3HG2A 1UR9A 1JAEA 4B3KA 1GORA 3MUIA 1Y7VA 1BG4A 1JYNA 1W91A 3DHPA 1C92A 1LWJA 1U33A 2CBUA 4WKHA 4AZ5A 4ATWA 4WSKA 4AY1A 1ZJAA 3CC1A 1GOOA 2UY2A 3OB8A 4JKKA 4M29A 4RE2A 2PI6A 2D1ZA 2VRJA 4D6IA 4U3AA 2X2IA 3S6TA 4AD0A 1H4PA 4A3HA 1LWHA 4PRWA 3QR3A 2YDRA 1DWGM 1UD6A 2CBVA 1J11A 1ZBCA 1DP0A 1W32A 1Z32X 4QP0A 4M8UA 3W6MA 2VR5A 1OSEA 1ISYA 3BGAA 4WF7A 2VO5A 1VAHA 1TG7A 2E8YA 1J0KA 3MSDA 4MB1A 2DH3A 4UFIA 1JZ4A 4FMVA 1MW0A 4ZXLA 3ECQA 2WVVB 3AHVA 2YFNA 2ZE0A 3BC9A 4FNTA 2YA1A 2YA0A 1UKQA 2D3NA 1UZ1A 2W66A 1ZS2A 3BLKA 1J0ZA 2DT0A 3VOCA 2J25A 3QHMA 4BF7A 1TQTA 2BHUA 2XYLA 4AXNA 3AZRA 2DGAA 2F2HA 2ZXBA 1BTCA 2XVLA 3VIJA 2OSXA 4P7LA 3UCQA 1FH8A 5IHSA 1JZ8A 4CN6A 5CZKA 1QNOA 3MSGA 1MXGA 1VJZA 2WSKA 3ARUA 3VDBA 4HA3A 2V5DA 3VMPA 1BVZA 4WIWA 3FAXA 1QBAA 3RJYA 2D24A 3CV5A 1G9HA 5M3WA 4AEFA 1WDQA 2ALWA 1J0YA 3VGHA 3T0BA 2BHYA 3KWXA 3IJ9A 4M82A 1DWAM 1EIBA 3WQ6A 2WVSA 1CGYA 3LX9A 4E8CA 3BUPA 3AQUA 4UOJA 4OBSA 4JKLA 3NUKA 3EMCA 4GO9A 1NOUA 3DC0A 4HOZA 3M7SA 4GZJA 5BCAA 1UYQA 4F9JA 2J8GA 3CTTA 4HU0A 2FYVA 1UKTA 1CPUA 5D8ZA 2WC4A 3WH7A 1LF1A 3AXIA 1CBGA 4QFUA 1E4NA 3B9EA 3AYSA 3NSNA 4DO5A 4AD3A 4HOXA 1M01A 2C7FA 4J7RA 1EDQA 3WUEA 1UD4A 3KZSA 1HTYA 2XVGA 3PZTA 3W81A 2GJXB 3U7VA 1HP5A 4U31A 2XVNA 2AOSA 5I6SA 3EMQA 4M24A 5E6YA 1JYXA 1YHTA 4CU7A 2J7CA 4JFSA 3CZJA 1CNVA 2ZUWA 4QCEA 3KEHA 1ZJBA 4W7UA 5C8BB 5LA2A 2CPUA 2GJXA 4MJ4A 1GPFA 3RM4A 3TTYA 1XH2A 4AYGA 2BVYA 3A3HA 4W86A 3GH7A 2XIIA 3TTQA 3AIBA 1JGIA 2NT1A 4MB3A 4UFLA 1EO5A 2WMIB 1XRVA 1W9BM 2EO7A 1H0IA 3WMCA 4Z2KA 4HU8A 2X1IA 3L2LA 4F66A 3N17A 2YLLA 4AW7A 1QHZA 1AQHA 3BMVA 3AIVA 3AMCA 5EFDA 1NARA 4QAWA 2YL6A 4GIAA 3BXWA 3GM8A 2J4GA 4HMDA 2AMGA 1TCMA 4V2XA 1HKIA 1Q6GA 3WF3A 2WBGA 2ESCA 1VRXA 5IFTA 3K8KA 2D0GA 4EANA 1VFUA 3W82A 1JDCA 2BNJA 1IT0A 4AZ7A 2Q8XA
chains in the Genus database with same CATH superfamily
1DDHB 3LPFA 4N85A 4YSPA 3WJJC 1NDVA 1BM3H 3BH4A 1V7YA 1ZL1A 2YX0A 2HUEA 4AZCB 3GQYA 3BV4A 3E9AA 4UAOB 1TZ8A 2YC1B 5TDPA 1P6WA 4TSAH 1TWIA 4HWEH 1IO4C 1UWSA 1AQKL 3QXAB 3SCSA 1XR2A 1NMCB 4NO0D 1OVZA 1NKOA 1RVKA 3LG3A 5A16B 1K03A 2IKIA 4BA8A 1SMDA 2Y25A 2ZXQA 3K8LA 2XWDA 5FW7A 3F4CA 2HG5A 4KIEA 4ACZA 5A8MA 5AC8A 5IR1B 2F7QA 4N25A 4K38A 3ILPB 4V27A 4RLIA 1CXKA 3B7SA 1TTCA 2G2NA 1RL1A 3B40A 4MWAA 2G4EA 4HLEA 1ZAHA 3MV11 1GVQA 3E2QA 3ARVA 3IS4A 4HYWA 5CZ0A 5AB3A 1YEWA 2XA8H 1G84A 5G1TA 4HWNA 2FB2A 3UPMA 3MGTA 5IG7B 3O0RL 4NY2A 2BIIA 4N8VB 5EBAA 1W15A 1LE5A 1GA2A 3QUXB 4IS6B 4ZUVA 2HSAA 2O0TA 4GBDA 3KLDA 2FGWL 1LM1A 4DPPA 1NCWL 1VCAA 1K8DB 2BVEA 2NYKA 3OJMB 4CA4A 1YYCA 4NT0A 1BSIA 3DGBA 1QLFA 1IIKA 3JVFC 3VXOB 2OEJA 3K80A 4RR4A 5ID0A 1T0NA 4EPDC 1W8OA 1BQRA 2BK8A 4UR7A 3SRKA 1INDL 1N6QH 1UZHA 5JBDA 1KYOK 3N2XA 3AY4A 4QCFA 4NCC1 5IWLA 1ACXA 5CILH 5DT1H 2MCAA 2GTWA 3F5WA 4LPXA 2RCSL 4L5FH 4G8AC 2WJ7A 4F3FB 1KPRB 1XINA 4WTZA 3THUA 3W72A 1I9IH 4K7FB 2UZXA 1IGYB 1FE8H 2Q3ZA 3V36A 1HN1A 5HDBB 4E2VA 2WCPA 3G6MA 1KJVA 1X5XA 4JQ3A 2AJVL 2CLZB 4XBPA 1MHEB 4HD9A 2VP8A 5GVJA 3MV7A 2PB1A 1S2TA 1YAZA 4R5XA 2HG5B 4TVCA 5A2FA 5J1AA 3WJSA 2VMFA 1E5AA 3GHEH 1TFHA 4P4KC 2VURA 4EF9A 4V1DE 1TTBA 3MO4A 4JDTL 1A1MB 1UM4L 5EIIA 1FWFC 3PP7A 4ZXOA 2AXFB 1LNUB 3CSBA 5ID0B 1BTMA 4M5YH 3O3EB 4XZHA 1ICPA 5T8GA 5IZ7A 4U3HA 4XBKA 3S5SA 3RBSA 4NQDB 2ED6A 1UZGA 1QFPA 3WL9B 2E46A 1BEYL 4P4RB 1S9XB 4Z7QB 1K8ZA 1IGML 2A9AA 3P8IA 1NDTA 3ARDD 4ZUVB 5E2JA 1SQMA 3KLLA 4W9IC 2FB4L 3CBJB 4N1CA 5HXMA 3L7FA 2AI0L 4XWOD 3Q9PA 5D1ZB 1SM3H 2WNXA 3BPCA 3CE1A 1CGXA 1VEPA 2DYRB 2FT7A 5AAMC 2ENJA 2EVIA 4H6RA 3RHWK 4HMNA 3TE9A 2C7UA 5XINA 1QVOA 4JPIB 3QEUB 1FVEB 1DTUA 1R3KA 2F8OA 3QFJE 5EZOL 3ULUH 2HLEB 1U8LA 4Y4FB 5G4OA 1N0LB 5FD0A 2G3IA 4NXSA 3APTA 1DBJH 3DARA 3EGDA 2ADYA 4B4FA 3M0ZA 3GG1A 5I3GA 1UM6L 1HH9A 2VERN 2XICA 3D3VE 3OBAA 5FAAA 5ICUA 5LG6A 1A5OC 2RA1A 2QCCA 4HNTA 2VIRA 2J77A 3NSMA 4N2FA 4GRMA 2DY2A 3FO9B 4QRTB 1J96A 4WJ8A 4MAYD 2RQEA 4UU9A 3UZJA 4DX3A 4LP4A 3LQAL 1DANT 3SIMA 3F5LA 1QZNA 3CVHL 4GKNB 2E59A 1TYGA 3QISA 3LRSB 1CDIA 1SN2A 4KZEH 3FTXA 3BJ91 2MOGA 4KI5D 3AXXA 4IMCA 3V5CA 3OKKA 1HW6A 3TJLA 1PU0A 1XF3A 2Z34A 4U6HB 1LQ0A 3DIVA 1JFXA 1W17A 2OMZB 1KIPB 3IIZA 2L7QA 3FA5A 4NJGA 2J7HA 1IEQA 3BD3A 1PZSA 2B1OA 3QDHA 3QCTL 4UC5A 4IL2A 4PJIF 1EAQA 1PKQB 3EFOB 4OVVA 4JDVA 3S3CB 3PWIA 2CHRA 5AYBA 3CZFB 3NEXA 5DVKA 2Z7GA 3KOYA 4UTAA 1GHSA 4M6PA 1EC9A 3UXKA 5FM5O 3MQTA 2P8LA 3SEPA 3RIFK 1TX0A 2D2CC 4JIEA 4XC3H 1W16A 5E6IC 2PF8A 4XZ4A 2DPKA 4F2UA 3NFPB 4YLWA 3U1PA 4L0YA 1ZT1B 4Y2WA 3EPMA 3C3UA 1SYSA 3KLAA 2EO1A 4J3OH 5GGSB 1K9DA 4RNIA 1LP9E 4FTVE 3HFTA 4F20A 3W86A 3ULUL 1OZMA 4XTIA 1TKWA 1XLBA 3RUGF 1MCWW 3L0GA 4MSWB 1H6EA 5IV2B 5HYJA 2FD6H 2PDYA 2BY1A 3VFSA 3V9EA 2DJXA 1WRFA 3TIEA 4DPQA 2G9HA 2X42A 5AHEA 2H3KA 4GRWH 5DR5H 1CIUA 2ESVB 2P8PB 2PTUA 1U8IA 4Y5YC 4PJCB 3PUDA 1YA5A 1IGMH 3THCA 1TZHA 2RUSA 4DZAA 2FJHA 4P8QA 1JHTA 1BIIA 3LZRA 3C08H 4P3CH 1FFNB 1RLBA 2JKPA 1XZWA 5C9WA 3QJUB 2J7BA 2QCMA 4TMPA 4YDJA 2HZGA 3C61A 4A8RA 2XWTA 3MRKA 2Z8WC 1MZYA 4MKMA 3DSNB 2EXOA 3JUGA 3T0CA 4F58H 5ILTH 3EOTL 4ETQA 3U4BL 5C54A 2YPKB 1G6VK 3BIAX 4PUKA 5F1VA 2E7DA 2XIJA 1Q94A 2B0SL 1IM9A 3KPOA 1AO7A 3IKKA 4Q89A 5EMYA 5GS2H 2GTZB 4YHNA 3QA3B 4TV3A 4J8QA 4WO4B 1HNFA 2F74A 4XO5A 4ACTA 4MJID 1FAIH 3RWHA 1HVQA 2VGBA 4HK5A 4LUJA 3RL1A 4X7SL 3SQBA 4G8IB 1OHLA 2CA4A 2NY2B 4LSTH 4Y5VB 1EO7A 3O9WB 5D6CA 1W9DM 3ITOA 4WIQA 3R18A 2MANA 3AZUA 4DJEA 2NNFA 4Y5YB 5INDA 1TETH 1OC5A 5EU3B 3DROA 1US0A 4FQQB 4OIIH 3BE1L 4PFMA 3ZK0A 4X2RA 2J57A 4GMTL 1K8IB 2EDHA 3LZNA 4HKXB 4Y7OC 1MY7A 2X0YA 1UATA 3QZOA 1XRSA 1CD8A 2HX9A 1AW2A 4MPQA 3G1RA 3GWQA 4V1XA 5SWSD 4R9OA 1XYFA 3QUYB 3MXVL 1KY7A 5IQ9B 2J20A 4Z42C 1MNZA 5JQIB 2GQHA 2ZRUA 3IS0X 4C6NA 2Y1AA 3IXTA 4FZEL 1KWKA 1S7UB 2E3ZA 1EEUA 4PJGA 2WIMA 3UAJA 1RSCA 3TQPA 5BRZE 2WXPA 3V5HB 2GZXA 4LNYA 4PY7A 1JN6B 4ZXBD 1IBHA 2VDNH 3M6DA 3NP4A 4NZ8A 2PCEA 3H2FA 4L61A 2J73A 4ZW3A 5DX7A 4W9KC 2K8QA 5C2BH 4JFZL 5DSCB 4HNNA 4PS3A 2ZFAA 1Z9SA 3MA7B 3PG8A 5BUPA 3F7YA 1F07A 5B38A 2HTLC 3UO8B 1W9PA 3IPBA 3UC0H 4NAFB 1IGCH 3RHWF 3Q45A 4U1GC 5LJYH 1G7HA 2R15A 2A83A 4G80B 1YNLH 1N7KA 4HA0A 1KJMA 4QQUA 1KTRL 4WQ6A 3CK0H 4I18B 5TJWK 3AUOA 3NCEB 3GSNH 2DKUA 5I16B 4PB0H 2DKMA 3IJ8A 4M43H 3BUVA 5IFAL 3CQJA 5T3ZD 1X5FA 5FM5M 3W0WA 5LIUX 4ZXBB 3PWPE 4WW2F 2UWEA 3SKUD 4AKOA 1R9FA 3C2OA 1UOKA 8XIAA 4NHVA 3P0VL 1EGJA 3D5OF 4Q7DA 5DHVA 1CCWB 3A24A 4YDNA 1S7QB 1YE4A 4UFHA 4I48B 4S3EA 2DQUH 4JG0H 4NB7A 1WKYA 3I2CH 5DRXB 2BMKB 3DXAD 1BWWA 4AI7A 4AV4A 1GHRA 3N19B 1N6UA 3LXUX 1AP2A 4R7NB 1JNDA 1KD0A 1VPOH 1D2PA 2FZMA 4S23A 3PFQA 7FABL 3N6JA 5D9PA 3WF4A 3VFWB 2OTWB 3ESOA 3WQVA 2PTTB 1D7CA 3S5YA 2OJEB 3VQMA 1TTPA 4WJEA 4ECNA 4UV7L 5IIEA 3R8GA 5CCZA 1XKYA 3MVTA 2BP5M 1WTGT 1ICQA 3JWDH 5FHAL 5F7EL 3H9HB 4GBUA 1NLDH 3UW6A 3QFGA 1CK0H 5CGYC 3GZ3A 1BYDA 1ID2A 3FEQA 3K5XA 4O18A 2YOCA 3TYFA 3ZGIA 4JHMA 4AT6B 4TU1A 3N73A 2J24A 4LY4A 3W7NA 1BZ9B 4GBXB 3OYXA 4GMSH 4CBZA 4R4NC 2UY3A 4O1CA 5IB1B 1RVFH 2FDMA 1LK2A 2VM8A 4R84A 5F70A 3V52L 4QRQB 2FZBA 3KG5A 1HCVA 3D85D 3ZYOA 2LFGA 5IMLB 1WFIA 5I8EB 1B0GA 3L0KA 3S5OA 5I74C 3KGTA 5K9QI 2J6XA 3L3IA 1QW9A 2XSKA 5HI4C 3VWJC 3FB8B 3A13A 1NDZA 3KUMA 4ML4A 4IRZL 3R7MA 4HS8L 4HBKA 3MR9B 1OHQA 3KCWA 3WF2A 3QVQA 1HX0A 3I75A 1FPTL 4HKZB 3FQ2A 2DJUA 1OP3H 2NY6D 1KBVA 2GHWB 2ADFH 4K8RL 1FKWA 2FIRT 5DRZA 5FX3A 3OLIA 2NSQA 5D70H 1N2VA 4A68A 4JTAA 3S9ZA 3QDME 2V9RA 4O58H 4XOAA 3W26A 2HTKD 5EUKB 1BQUA 2JK5B 1FCGA 4I0PD 5I8CA 4Z7VB 3B7RL 3PJLA 2X4TA 4PL2A 4OUEA 4OSUH 3DMMA 4WFGD 1FH2A 2E76C 3VI3A 4DCQA 3D8MA 3MLTB 5L6YH 3PQYD 4OJAA 2QNEA 2X8RA 3LK6A 4YHZH 1KEGL 1L9RA 4DWSB 3N04A 2NXGA 4AQ1B 1PX3A 4YL9A 5KEZA 3O6MH 2VQUA 2GSMB 1HZYA 2B8OT 3SCUA 4IISA 1J1PH 1VGKA 1YMYA 1ZQ5A 1ZVYA 4G1EA 4LEOB 1MRCH 5CJOL 5KBKA 1K3ZA 1RJCA 4LT7A 3FFCA 4WVRA 4X99A 5DJAA 5F7MC 2BGQA 3MMDA 4GYKA 3R06B 4FL4C 4YHOH 4LSSL 1G4EA 4LCYA 1GZPA 4GQ0A 1OTTC 1RJRA 2X0VA 3ZOAA 1ADQH 4WW2C 4R0LA 1OF6A 2IAMD 1AO7D 2AQPA 5IF0B 2NWSA 4TNWF 3JV4A 1U92B 1XH3B 4JHAL 4AGMA 2W62A 1TJIL 4M8QA 3LDBC 4JO2L 4X5XB 4Z7NE 5CKAA 3FNDA 5DHXB 2Y62A 5D7IF 4ABUA 1UQYA 5D2LA 2D7OA 4JZOB 4OCXH 1QOQA 5ADPH 1PIFA 2VH5L 2ZDRA 2D03L 2IG2H 2QADD 2EPLX 7PTDA 3WMLA 3VIGA 4JTRA 1BFVL 1J1XL 1MVFA 4WNSA 3BL3A 3QIBC 1OP4A 2ERJC 4QCIB 2YGYA 4EBQL 4WKZB 4GLRI 5D02A 4D7PA 4U3XA 2PPGA 4XSLA 2PP7A 1SF3A 3AYVA 3QCVL 2HBXA 1BVKA 1V4YA 1JVKA 3B2VL 4K71C 5D9SA 2C3GA 1U3YA 2AK1H 2COVD 5LBGA 3C6LD 4QRPA 5C86A 3MRRA 1Q45A 1TA3B 4GQ9H 4EZMA 4LCWD 5U7SA 2VJ0A 2VJ8A 3OYZA 3BX7C 2GAZB 3JWNG 1XPGA 2EXTA 4NZTH 4WEMB 5TQ0H 1J10A 3ZTJG 4KS0A 5JR1L 1ZANH 4NU7A 4Z1BA 3T1FA 4YE4L 2JJUA 1I2RA 1IEVA 4Q4SA 3V7MA 2W59A 5FCSH 4BWLC 3MRDB 2CR0A 1IC4L 4PJEB 4XBEH 3TH4T 3UROR 4DWDA 1VRDA 4JFWA 3BDKA 4XMKH 3OOQA 4LCUA 3SDXA 2JIXD 5A7BA 4EXBA 3N85H 3ZT5A 1JF5A 1PSKH 1JFHA 3CVIH 1AHKA 3JZEA 3U9PH 4PS4L 1DJSA 4PGJA 4XTDA 2DB8A 4RV8A 5BMXA 3PWUB 2QQKH 2OJ1A 1NGZA 2YARA 3GXMA 4AYSA 4DP5X 4RDVA 5D30A 5F1IA 2HAZA 2CH8A 1A1OB 1RZKC 3E2RA 2HFGL 5DEGA 3AXHA 5EOCJ 3UESA 4QTIH 3TO4B 1J8HE 4YFLI 3WBXA 3UJTL 3PDOA 2GAZA 5CZVL 4O14A 2Q86B 1G01A 2E6DA 3NFSL 5DRNB 3SI9A 1H0GA 4B3ZA 3MYPA 4D9PA 1EHKB 3O6LL 4OV6F 5J0BA 4XQ6A 2R1MA 2PWHA 5IREA 4TUKL 3LN3A 4PL1A 4IYKA 4A4AA 1VPYA 3VQ2C 3IGLA 3GDKA 1C16A 2GJ6A 2W07A 4G7VL 2E5CA 3NDZA 4LBUA 4PTDA 1JMXA 5HMEA 5M03A 4NKOB 3GBLA 2DYSB 3V4PL 5HJBA 2K3TA 4WJKB 2JF6A 1A49A 1LXMA 3DEQA 1R6VA 1JNEA 2X4QA 3QDJD 2HVJA 3N9RA 4PRHD 3CZUB 4GOSA 3HNTH 1OOAA 1IBGL 1O0VA 2WMIA 3BUQA 3IMSA 3U36A 3NOEA 1MYRA 4DEPC 4JGUA 4PWFA 1MHHA 1CD0A 5DLMH 2NY6C 2PYEA 5T5FA 5C08E 3KYMB 4FQJH 1DFBL 2F5BH 3QFEA 2VTFA 5IF0A 4AHPA 1YN6B 3BJLA 3QEQD 2H9GA 2F58H 3U25A 4NRXA 3DGCR 4S1FA 1H49A 4PJ5B 4WWPA 3N5AA 2VX5A 2DQGH 3H2AA 1R0AL 5AYYA 3PDGA 2GIMA 2E3VA 2PCFB 1A7NH 4HZ7A 4Z08A 1LO3H 5A6MA 4S3GA 1E27B 3F4DA 2R69H 1NGYB 1ADOA 1SN5A 4JN1L 4PBWD 4X6DB 4BD4A 4R7LA 4F37K 5KJRL 3VKAA 1AZCA 4QCIA 3DOPA 4E41D 2ESVD 2YW4A 4L6DA 3VFUB 5KZEA 5KBLA 2OYPA 4IU3A 43C9A 1SJHA 3GI8H 3PGCB 4CC0A 4D8PA 5I1JH 4UBDC 3WIIH 1EX0A 4YHYB 4IPIA 3LS5H 4BKNA 2P8BA 3RLGA 2O5NA 5K9CA 1EWHA 2HWZL 3TH6A 4ICCX 1FZMB 5GS2D 1EXHA 1V3KA 3BDYH 2DDXA 3PPCA 4N6QA 5HQMA 3BVTA 3PQYA 4XP4H 2O1AA 2CRIA 4QNPE 5CJBA 2CLKA 3WTTA 2P5WD 2DLIA 3P2DA 3UP6A 2PCQA 3TEUA 3HNSL 4PUBL 4X99B 5IMMA 1JBJA 3FS9A 4V1DD 2Y7NA 4N1EA 3A5VA 1HI6A 4UTUA 1RZIB 3BSMA 2BOCB 2PBOA 4LVAA 2D7QA 2HKFH 1CWVA 3FRPG 4LRNH 3UMNA 1XBXA 2IH1A 2VWSA 1GSMA 5IMLA 3KXQA 4CLMA 2NV2A 3RA7H 4ONHA 2FZ3A 1AS7A 1BYAA 2FTAA 5F97E 3OMAB 3MFFB 3R1GH 2AABH 3F62A 4JG9A 1HJWA 2J75A 3K4AA 1BZ9A 2QQNH 2WLHA 4U05A 2CZDA 1KGIA 3DMMB 4PGCB 2WXDM 4FXGB 5A8QA 3TBVB 2HT3D 4A7VA 3CSFA 3DFHA 4IRSA 4B91A 4WDIA 3F7VA 4AGNA 4BY3A 3UG3A 1GJPA 1RIVH 1F3RB 4Z0XA 4PCSA 1PZUB 1KYAA 5DUML 2YGQA 4JQVC 3ULVL 1C5CL 1ZJIA 1M9SA 3JV6B 4Z76A 2IH3A 1D8WA 4BK9A 3OJGA 3Q2CA 1GGIL 1QBLL 2WKLA 1SJEA 4AF0A 1KCZA 4JNXA 1AACA 3RILA 3W39B 3AREB 2CZEA 4TQIA 1ZSDA 4KH2A 1GOFA 3TGXA 3CYVA 2V9QA 1NAKH 4UT7H 2ZQ0A 4X9SA 2OB3A 1P5VB 1Y8BA 3IIXA 1R5VA 1QSEE 3FSOA 6XIMA 1L9WA 1VFMA 3DJSA 3SDAB 4QNWA 1XF4B 1ZGLB 1KGWA 1RUMH 2YD1A 4OZHE 4ALAC 2DZUA 4Z2IA 1F8TL 1WYIA 1MRQA 3IUHA 1LT8A 3WDPP 1KYOJ 3VACA 2HN7A 3LRSA 3U0HA 1DVFA 2WNGA 3YPIA 4D6CA 2KI6A 4WI4A 1XMEB 4JHVA 2Y85A 1SU5A 3D0LB 4P04A 4G9FB 5A2AA 4EIBA 2XXMB 3SCVA 2RFXA 5LBSA 2H32A 4UU9B 5I75C 2Z1WA 1RK1B 2C9PA 3IDJA 4HETA 4Q58C 5ESQA 3G04A 5F96H 3T04D 1QI2A 4CDHA 7REQA 1ET8A 2QXWA 2GJPA 1HL9A 4RV3A 1KTLB 1JJUA 1I1AC 3MOAH 1S6NA 2F84A 1Y07A 4YXLL 3CDGA 1CGUA 4FKKA 3TTEA 3RI5K 1N0LA 1HESA 3K72A 3MWCA 2BMKA 3EWYA 4QRAA 4QTFA 2OO6A 5HWMA 4KEVA 2JGQA 2VABA 5BU6A 2QYGA 3REWA 1FSKC 1TEFA 2KZKA 1AMKA 4PJGB 4UQEA 3NCMA 5E2UH 4FOKA 2DIJA 3PHOA 3IXTB 4PTTA 1QOPA 4DM2A 3CHDA 4OZIA 1BEXA 4FEZA 3APDA 4IOSA 4KESA 1SVCP 5I6XC 3AIWA 4JL1A 1F4AA 3WNMA 3RBGA 2V2CA 3EX1A 3W6LA 2EPOA 2WXHA 4ZTXA 4Z95L 3WNPA 5DK0A 5B1CA 1AXSA 1IAOA 5ERWB 2W3ZA 4HFWA 4RFOL 3B8SA 5GRWA 3SBWC 3HJZA 1IJNA 2BIOA 4KK8D 2WTRA 1SXZA 1HKKA 3AGVA 1SW0A 3VMNA 4W89A 1UVQA 4N22A 4JTCA 4F80A 1PCWA 1LDSA 3Q2WA 1P5VA 3IWUA 1XCTB 5FFOA 3P69A 1JNNH 4F24A 3N4EA 1YUHA 1NCJA 4HKJB 2VQ1B 2ZE3A 3RCMA 5IMOA 3I3BA 3VSTA 5DC9B 4JY6A 1RCQA 4WJXA 3CDCA 3HFMH 4K8RC 3OZPA 5T91A 4BFNA 3QXVA 3W27A 4MA1C 2G5RA 1VS1A 3GSRB 2QQ6A 3D5HA 3QGAC 2ZSVA 3B3BA 4DYJA 1G9ML 1Q5MA 3QQDA 4Y16D 2PGWA 3MI3A 1IM3D 1YY8B 4KQNA 4DZ5A 1NM9A 2WXQA 2F7IA 3O2DL 4CUCA 3OG6B 2P5WE 5D1XA 4BUGA 4ZFGH 1YPXA 3SE8H 3H4GA 1JWUA 3BDXA 1OM3L 1KNOB 2WZAA 1K8DA 1ZXKA 4UV4H 5KBDA 3NCOA 2OFJA 2VDQB 1KIRA 3STLA 4GS7C 1MLCB 1FNHA 1G7JA 2C3VB 4YK4B 5FUOL 2LABA 2P43B 5TK2A 2CWXA 2Q3RA 3WXWL 1IXNA 5KYWA 3N11A 5F7NC 3DGGB 2K9UA 3EJSA 1EVUA 1MCQA 4FXKC 4M7JL 4EDWL 1OO2A 1KV5A 5BOEA 1PF3A 1ILSA 1TVHB 2F54A 3TZVB 4DZ8A 1E6SM 5ICYB 3B9OA 3BURA 4TF4A 5C9UA 4AYFB 3CZNA 4I85A 3TJXA 3C2YA 4QY8B 1ES0B 4CVZB 2NUXA 3IAQA 3BKCL 1E9QB 4UCFA 4MDOA 5HOSA 2EKGA 5K9KA 4FNRA 4FXLA 3FQXA 4IJTA 4KO5A 1VGAA 1JCTA 1FCCA 1R3HB 4UB0L 5E99H 1NU5A 3BMXA 4JTJA 1OGBA 2B59A 3O9WC 2PMQA 1OCWL 3IDMA 2C1PA 1GAFL 5AW3B 4U28A 4ZO9A 5LN4A 2OR2A 3RPMA 1GG1A 2D31B 1F4XL 1J87A 1I8MB 1NBVL 2YA2A 4O0ZA 2R8SH 2J2ZA 1AFVH 4NC2B 1QRKA 3LB0A 4LF3B 2OZ8A 3BGJA 1NCIA 1W0VB 1FG2B 2XHNA 1QTYT 3DJTA 2BP1A 2B77A 2GYSA 5HHMB 3EYFA 4CQ9A 1AGFA 1JWSB 3EO9L 2A7NA 5D2NA 3E9UA 1MREL 3NO5A 3TNMA 1DSFH 2GUOB 5K2ZA 3MLYL 3N40P 3AU6A 5HNNA 1SJCA 1KPVB 1V6UA 1RK7A 3A4XA 3RIAF 3R10A 3MGOB 2RHEA 5H37A 4IXHA 3SADA 3MLVL 5GZNC 1SSDA 3QUHA 5AOKA 2CLVB 2QV4A 2X6CA 4XPAH 1E72M 3LLFA 2X53A 4ONGL 1Z9NA 5IFHL 4QITA 1P5UA 5AD0B 2DM7A 2XN0A 5CIPA 1WH0A 4DEWA 4LIQH 4NZRL 3LZQA 2XACC 1A6AA 5SX5K 1OP5K 3IGHX 4AX6A 4ZBJA 4PEKA 4QRUB 3RIFF 1QJWA 3WMPA 5KVDH 2IV8A 3UTQA 1T5WA 4AVJA 4PJ7F 1XD1A 1CLOL 5JDJA 1TV3A 4YUEH 3HI1B 1XL6A 4LQ1A 4U3SB 4LEEA 1UTDA 2HH0L 3GG7A 5IESH 1EDTA 3OR6B 1K6QH 2J8UA 2ZCZA 3P77A 1VA9A 4Y8AA 3KZ8A 3H9ZA 3TZVD 4K5MA 2FZ8A 3G8EA 3VMOA 2GUOA 4XAKE 2RJMA 1LO5A 1P0SE 5FA4A 1J8RA 3HE6D 1NUGA 3VXME 4U10A 1XWVA 3A5FA 4NO5B 1VPXA 5KOVC 4GO6B 2E6YA 4FLQA 1WFUA 1C1EL 1GJUA 1WE5A 2JXMB 3DOSA 3LKOB 5ESVB 3CL6A 1CLOH 3KP1A 1ZHKA 3WDRA 2J62A 2P0IA 5E2VH 3T4YB 3NQMA 1NTDA 1PO9A 1ZV2A 3D85B 1FVCA 1JPEA 5DZAA 2H5UA 4PFEA 5EBWB 5C09E 4JLRA 1QPQA 2JBMA 2IPTH 3M1BA 3MLUH 4D9RD 2PBGA 3KRZA 5JMUA 2DORA 5D7LE 1GKPA 2XI9A 1SJMA 5ESAB 4GBXD 4ONGH 5E1HB 2AGTA 3URAA 1YDPA 1S5WA 4WY7L 1IILE 4BZ1H 4N2BA 1N6VA 4Y1TA 3QEUA 2CJUL 2R2HA 4LEBA 4WUUB 5DEGB 2XIBA 4JEGB 3A4JA 4ZPVA 3D46A 4IQEA 1C12B 2OZ4L 3NCJH 1JF6A 4QHKJ 5AYQA 3JZ7A 5C07D 1J2WA 3B9KB 1GOKA 5DFVC 4P0DA 4Z5RA 3Q6GL 2VXTH 3HE7C 2YXXA 4AM0B 3K4DA 1J5SA 1J0HA 5CP3H 3UT0A 1CU4H 5KYYB 1XPYA 1KN4L 3LIZL 3O4OB 4F0LA 5F1UA 2H8PA 3UYPA 3ZRCC 3D2TA 4N2YA 2Z4QA 4N8VG 1OCWH 2VC2B 4F33A 5GGVY 3RITA 5E51A 2CUIA 5XIAA 1O1HA 1NC4D 1FQ0A 3QIWC 5EEWA 5I15L 5J1AB 4PYSA 4E5XB 4JTHA 3NURA 1G7UA 1PY4A 1X6NA 3HRZA 3QG6A 3VD3A 4GO8A 5HHOB 5AAPA 5IHLB 1UP0A 1KJVB 1BVKB 5AEAA 1TJ2A 2VN7A 1IGYA 1RPKA 1GKRA 1V0KA 1U3JA 4FFYA 4LLWA 4UFMA 3IDUA 4ACYA 4M7JH 3EKZA 4LNVA 3IM1A 1K4GA 5KYUB 3ZXAC 3T77A 1S39A 1BGGA 1QR7A 1S1RA 3ZHLA 4GG6B 2AAAA 2PDHA 2TODA 3G2GA 2OR9L 3AS0A 3GS0A 5DJCA 5FO7A 1FX6A 1L9PA 2O72A 1TFVA 3HHRB 4Y7MA 4BSVA 4GYJA 1TTJA 3BISA 4L4VD 2I5YL 4IMEA 3QFDB 2AQVA 3QJVB 4U5KA 1CVRA 2DQHH 2OYMA 3VD0A 2F0CA 3KRUA 5DA0B 3ANVA 1YG9A 1POJA 4XNZB 5M17A 3RWGA 5CSBA 3EXLA 1LL6A 3RNKB 5DC0A 4WSHA 2CO7B 5EPMA 3VXRE 1AVAA 4IPPA 4NP7A 3KWSA 4XKYB 4XX1E 2QJDA 1RD5A 1UA6L 4KI1A 5C70A 1SYVA 1OKEA 1KFLA 2EG6A 2ZUNA 1VZWA 2WZ0A 3KVDD 4LASL 5IM7B 2EGZA 1L9SA 3CDGB 2QUVA 4TULH 1OBAA 4LVBA 4ACZB 1WD8A 3LMJL 1UADC 4Z7UF 5I19L 1NFDB 3OKNA 1OYCA 2W8CA 2QADB 1CQYA 4PV9B 2VZOA 3V4BA 3EHBB 1CFMA 5ETUA 1S5TA 2J9XA 3VJ6B 2WLNA 4H0HB 2IPGA 1HK6A 3VI3B 1KPUB 4PJFF 1H3PH 1BIHA 3OXRA 2OKTA 3TVMB 4A04A 3LOWA 1D7KA 4IG2A 4NPYA 5HD8C 4LQFH 2W5FA 4FF9A 2NZLA 4V28A 2B08A 4TVSa 1J01A 3LSBA 5JIQA 4H8UA 3CUPB 4DRSA 2J7LA 2R82A 4LCQA 4I18C 3IJLA 3AT0A 5E7FA 5F88A 4JFED 5C0AE 4BQ9A 2B0MA 3NRPA 5A7EA 4DSYA 3LS9A 4RDQG 2QV2A 3ZT6A 1CXHA 3MR9A 3STZA 3V95A 3I4KA 4LCSA 1TREA 5KANG 1ZSDB 4B0MM 1OK4A 1GKEA 1Y1DA 1OWQA 2BDNH 3TBYB 2VL4A 4KFPA 2HKHL 2WXLA 3MLSH 1Q6OA 4YXLH 3VTAA 4V1DB 4ANWA 1TELA 3UA3A 5J8LA 1FO0B 3QORC 3OKDA 1W3JA 3STEA 4QLRA 3D05A 3K6SB 1K85A 5CJXC 3MV8B 2TMDA 4TMCA 4DWSD 1BQCA 3IJIA 1Z5HA 1EJWC 4JBRA 3ABMB 2E7MA 3W85A 4Z7QE 3H2OA 3KLKA 5LKNA 1I82A 5AUMB 1ML1A 4P4KA 1UOVA 1HYSD 2DW6A 1OP9A 1B0IA 5F0MB 2WCAA 2DWEA 5E2TL 5I17A 1KFKA 3JZYA 3H9HA 1RZFH 3LHAA 2VWTA 1XBVA 3QHFL 1H3XA 2YKLL 1XFBA 4JVWA 4LRIA 15C8L 5E1IA 2EUWA 3CV2A 4AVFA 1RUML 5DVMA 5IKCA 1R85A 4D6GA 3IJ7A 4M1DL 4XN5A 1TJMA 3JUZA 4HVBA 1WXJA 2XG4A 3AROA 2WHKA 5HK4A 1IEAA 1OD0A 3VINA 2EDTA 1R46A 2L3BA 1TPFA 5IM51 1EZUA 2NDGA 3MJGX 5AW2B 2QFPA 4PJAF 1PKMA 3O2LA 1BPLB 4S2SA 4IP7A 2XPGB 5FJRA 3EG9B 1GEHA 4REQA 1IB5A 4L9LB 5CG7A 3AM8A 5C09A 1U2HA 3V0JA 2AKMA 3O81A 1T1ZB 2BVDA 1COBA 2G3NA 3LERA 4EIVA 4MVBD 1IQWH 1JVLA 2WINB 3MUGA 3ZE0E 3S37H 1IEHA 4Y9BA 1AGDA 1KBGL 3MRBA 1NCHA 1QTSA 2EXYD 2I9LA 5DUJA 3C5ZA 3AIUA 3E6FB 3AMLA 3K91A 2VR3A 4YK4C 1DQIA 3B0YA 4FK9A 2AHIA 3OXRB 3HE7B 4HWBA 2YAPA 1QFWM 4AL8L 1REQB 1UT2A 2WKOF 1I9RL 3ULVF 1GGBH 3Q3GB 3QPXL 1BOYA 1TVDA 2K70A 1R3JA 4LIQE 5SV3A 1KXVA 5CMAB 3VB8A 3T05A 1Q38A 4V2BA 4OCYL 5E6ID 4NJKA 4PJ9C 4UMAA 1PZBA 3HLAB 3IDGA 3CEUA 3NDOA 4S0TD 2YYUA 4LGXA 3T7VA 3CLWA 4RETB 2IPFA 4YX2H 2NY5H 1B0WA 1R24B 3BLPX 1S9VB 2WZPA 4QR6A 4DELA 2A73A 2VZ1A 5INCA 3QQ0A 5CEXA 2ACQA 3SYCA 5AB2A 5CSYA 1CICD 3AJ7A 3T0EE 3N44B 5A6TC 3BE7A 3F7RA 4TLTA 3ZUCA 3K46A 1Z3GH 4JG5A 3VRJB 2L7UA 5HHOA 5KN5B 2KAUC 5CP7A 3I6LE 3N15A 3NIFE 1GK8A 2WNWA 1W3LA 1N2RB 1NC4A 3OLDA 4A6GA 3PJUA 2CCRA 4KXZH 4WDTA 4XZBA 3AHXA 1BDYA 4UYQA 1MVUB 1IFHL 3V0VA 4ZB5A 1PY0A 5EFIA 5AOJA 5ISZD 2DQIL 3IFOA 5D7LD 1JRHI 2NOYA 1TVPA 3W7DA 2J78A 1IC1A 5C0GA 5A6KA 1L0XA 1WEJH 3DURA 5ITBL 4WWID 5FYJE 1JDFA 1HJXA 2V5SA 3IF1B 4XXDB 5FKYA 3ASNB 1O7DE 4LVOC 1MN4A 3WO8A 3GKWH 3NQIA 3UJIL 3WHXA 9XIAA 5FDWA 2HT3C 5F6IB 2E09A 1KTDA 3ZDYB 2P28B 3H22A 3HR5B 3R0KA 2OL3L 3TEXA 4A3YA 5DMGC 1OVDA 5LNEA 1S5MA 4DUWA 1A25A 3IT8D 2X05A 4PCFA 1E7VA 4IRJC 1XYMA 5E9DE 2LTQB 1INEH 1XR9B 4U3CA 4NZCA 2I9LB 4E8DA 2EIKB 4MFDA 4MXWH 3HB3C 5I1KL 3HTLX 4RX4A 5FHBL 2WZHA 4FQJL 4H4IA 4WWKC 2Y7QB 2EYSA 2X10A 3MAWA 5HHXL 1U1JA 2QCNA 1L6GA 3QUYD 1FVCB 2DQFB 2BB0A 2UXTA 1CLKA 3RTQD 1W9XA 2MTAA 3ES7A 4BQBA 1ISXA 2E9MA 2A99A 4XIMA 4DJDA 3VFVB 4Z7WA 2XJLA 4LCRA 1CXIA 5EU6D 4Z0JA 1DO6A 1KTCA 2EILB 3II3A 2W0FA 3MA9H 4GKOA 3DOSB 5KBMA 3UVIA 3PL6A 4AKQA 4HZ8A 3GG8A 3DHDA 4WVXA 3LB6D 3LQGA 5JBFA 3RAOA 5TE7L 3V4PH 1U8OB 2ICWI 3T3ME 3DFOA 5PTDA 3TFCA 1KDJA 4M1GH 3ZE2B 2APTA 2D3LA 2P47B 5DHEA 2BOFX 3NQCA 1YMMB 4W5UA 3SN1A 5RUBA 4CNTA 3PAYA 3LKRB 3BN3B 4LUTA 4Z78A 1T5WB 1YDPB 3WK1A 1SYSB 2HP4A 2VDLL 2XQYG 3KLAB 2ITDB 1O94A 3IMRA 2HG0A 4HDIA 2OWWA 1CLVA 5CZVH 4EIGB 2OX4A 2GY5A 1G4RA 5LN8A 3M64A 3AUJA 3BD4A 3UAFA 2EDJA 3MV01 5D9SB 5FHBH 3HIJA 5I1KH 3PAJA 3AU1A 3OKDB 4D94A 1MZZA 4G8GA 5KSVA 1SFDA 3HBLA 1OTUC 3WG6A 3BT2H 1HT6A 3K2UH 1NGWB 5FF0A 3QY8A 1AKJD 2FJSA 5C6MA 3NOIA 2O4MA 1PKQA 3EFOA 2X3CA 4G43A 1ONXA 4NO5A 3QPQD 2JJSC 3NABL 5F7AA 1UH3A 1UOWA 3R19A 2PLCA 1ZV5A 4UQ2B 5F2IA 5GZOD 1Z48A 2OMZA 1DKWA 4PUNA 4XBEL 2GK1B 2CO3A 4OZIE 1D9KA 1SF5A 4L5FE 3TA3A 3OZMA 2XU2A 3PU7A 4WFFD 3X3GH 3R8RA 4IOIA 4N86A 2UVFA 1ECQA 3E9TA 4IIBA 1MEXH 3LNHA 1DFXA 3V1HA 4FR6A 5DMGD 2WMPB 4N3UA 4XPTL 2VRAA 2X89A 1MQPA 2AAMA 1SY6A 3LRLA 3QG7H 4N9BA 2F8IA 1MUJB 4ZZFA 5T5FH 4P5UA 4NQQA 1GZPB 1PHQA 3CNYA 1GIGL 4E6MA 4F4RA 4P7QA 1MFNA 5D2LF 5F8RC 4P8UA 2JTDA 3B2VH 5E4OA 2VDPB 3G6JF 3LSCA 4RW3A 1I8KA 1UWGH 3NYKA 4IW4C 4ZYKA 4FCHA 2QKIA 4MAZA 4YR6A 2EDYA 1CLCA 4K15A 3RUGB 3ALWA 4MJZA 2XXFA 4BZ2A 1OE2A 4RAHA 5BU9A 2FJKA 3WJMB 5BV7H 1QVOB 5FO8A 1B2WL 2ALDA 1QRNB 5ALBL 1B9ZA 1UXMA 1OT4A 2WHVA 3NN8A 4DF2A 3DI3B 2X4UA 3DGGA 4FN0A 4OIBA 1XJBA 1USZA 7TIMA 1WCGA 2F68X 2GPZA 1M9HA 4YX2L 4XZMX 1VRSA 4W8BA 3ZE0F 4H5SA 1WAPA 4JFXA 1A5UA 3GH5A 3S2AA 3KPRE 2XWBB 5CP3A 1B3WA 4K6AA 4ZG1A 4K7YA 1N5AA 4RDBA 1KNWA 4R9HA 1O66A 1RY8A 4YXHH 1PLCA 1NGPL 3QPXH 2E6PA 1CICC 1GGBL 4S0SD 3QFDA 1HKWA 3CMFA 4AZHA 1DVSA 1IC5H 3D12B 4LB4A 3T1WA 1DWJM 3ZKMD 1A6TB 3PXHA 3S88L 2YBVA 1W6LA 4L6HA 1KBGH 5KYUA 3GKAA 1BQLH 3R0DA 2WJDA 4HXBH 4I3RH 1N0XH 3SE4C 3VI4B 2ID5A 4QGYA 3VX0A 1ZT7A 5DJDB 1TV8A 3PC0A 4YMZA 3HHSB 1XL4A 3FB7A 4JFOB 4ZGYA 4OKVA 3W56A 2ZYSA 3LENA 4R4ND 5F3FA 1G4TA 2GCYA 1NFPA 1CTOA 5F9OH 4PD4K 1W9VA 3OGCB 3QXBA 4IUGA 4JM2A 1C5DA 3BAEH 4GYPC 2F18A 4LV9A 4K3EH 2ZCLH 3T1GA 3SR7A 3BEWA 3WENA 3EDFA 5ISZA 5AZ2L 4F9PC 1KXTB 4MCYA 3M0KA 2PRMA 15C8H 4CBPA 1YEFH 4PFHA 4YPGA 2EUZA 3RPDA 4OIFA 3QZWA 3Q2LA 1RZFL 3CCHA 5F9WC 1X6UA 1QR1A 4QX4A 4HPHA 4YEFA 1GGCL 3S48A 2KZWA 3LXAA 4TQEL 3CIVA 4ORIA 2QGHA 2I07A 1FPTH 3B03A 1AZ2A 1PD0A 2C1IA 2GL5A 3OV6A 3CU2A 2CDEA 4EIUA 4FXFA 3V2AR 2L04A 1PJ9A 2IH9A 3PWJA 4UNKA 2JV6A 5DC2A 2OSWA 2R1WB 2VRQA 1AG6A 4XB3A 3RJQB 1WGOA 3V6FA 1PZ5B 1C90A 3KXFA 2FK9A 2I7GA 3D9AH 4P23D 1MWAL 2WPGA 4BJLA 5FEBA 2WTRB 4KNSA 1NC2B 2IPUK 1GC1C 4R3SB 4YDLC 3UIZA 3C0QA 2GPTA 4RX4D 1BYPA 3WAJA 3N12A 4IOTA 2UWEB 2X4RB 4RBPH 1ETZB 2DL9A 3ZTCC 5A95A 4KVPA 4GRWE 1RZ8B 1UIPA 1N55A 1YC7A 4GEJA 5FJOA 2RGSA 4JO8A 4MHBA 1A6VL 4X7CC 5BPPA 3CSTA 2AQ2A 3NIFF 4I18A 3P81A 1EBAA 5CEZL 3WFDH 1RHHA 3WLSA 4D6HA 3C6LC 4F40A 1H60A 3G0XA 4HJJL 3REQB 4AZCA 2OCFD 4NHCH 3U79A 1R8LA 3OXSA 1E1CA 5I6MA 2VX6A 5B38B 3CHCA 1XB8A 3X14A 2FL5A 1VPOL 3MRFB 1T4KB 4PCKA 4XAWL 1WZ1H 3HGJA 4ORGB 3U2OA 4NM8L 3W25A 3X11A 1FL5B 3QC5X 1HHKA 1MCKA 4S0HA 3OIHA 2AITA 4INFA 1TX2A 2DQUL 4Q2ZB 3UH8A 3DH7A 2C71A 3QIUB 2CD0A 1DE6A 4JX5A 1JN6A 4J1UB 4IFKB 3AREA 1V51A 1BZ8A 2X1PA 3V4PB 3ITGA 2GUYA 1ZHLA 2J56A 3KOFA 2YXOA 1JGEB 5C08A 1KOAA 3QULB 4YXKL 5IOKA 3TVAA 5D8JL 4QRRA 3ZR6A 4ADTA 5F2GA 2PXYA 3IMTA 5CKGA 3WUFA 4ATLA 4TS6A 2EH7H 4UIMA 1AS8A 4MNJA 4WXYA 4PTXA 4Z2JA 3QJFB 3W1ZA 1KBIA 2Z24A 3PWLB 3UC2A 4GBXC 1YXCA 1FLTX 4YSRA 1SOSA 2G75B 4HBQA 3FTVA 4B5EA 1I4FB 2EG7A 2X6MA 1I1FB 1HOCB 5C0JA 4WK2B 1Z69A 1K4CB 4ZX5A 1YIXA 4JFZH 1KM0A 3KVQA 4N9OB 43CAA 1OK6A 1SJAA 1PDYA 1UWUA 3CQKA 1L7IL 2G60L 4N2NA 4DKAA 2J9ZA 4YDIH 1JSYA 3GYEA 1LCOA 2A1YA 4JDEB 2P5PA 2BOCA 2A6DA 2Z0IA 3RVVD 2Y36L 3BH9A 3ZQWA 1R9YA 1XIHA 4XO3A 3O3AB 3DV6A 3QAZB 4PRPA 5EC1A 3TASA 1F6KA 3S2JA 1MSPA 5BZWA 3S1UA 3LV3B 2WMGA 5CH9A 5JYMA 5I78A 3HO8A 1KYUA 3NJXA 2GC4C 2NTSP 4DZBB 3QUZD 3OPSA 1OSZB 2H7WA 3C8KA 5CAHA 2NWRA 3CZSA 5DQPA 4JDEA 3C5SA 4RRPA 4ZXBC 5SWZB 3L65A 4PH6A 5LIKX 2NR6C 3VI4F 4IGMA 4ZOEA 3G3LA 4RE4A 3L6FA 2G9HB 1F4YL 4FLHA 3C4UA 1VCGA 5D5ME 4AYBA 2VXTL 1F2XK 1MCEA 3NG5A 3ZHDA 1TYRA 4X98B 1FV1B 1HQRB 4X7SH 3CSYB 1X98A 5FO8B 1V7NL 2YEZB 3QP3A 3QTGA 4J4KA 4GYBA 2IJ0C 1UBPC 1FAIL 4PRBA 1MWAA 3WAKA 3DFPA 4JICA 4IIEA 4LAMA 6XIAA 2NRDA 4OZGB 2JKTM 3VH8B 4AH2B 4QRPE 3MO7A 2B0SH 4UTCA 1YBQB 5AYXA 2YCKX 2NNXA 3CZGA 5F7UA 3LV3A 5I5MA 2AJSL 4GG8B 4UIMB 5ILTL 2HTMA 3KP0A 3T0EA 3GHBL 4K5LA 2J8OA 5KSAB 2Z3FA 4BE6A 1I75A 1QKZH 4XXWA 5HGBB 5F1SA 4BSWB 5E5MA 5EU5A 1BXAA 3VNKA 4W4OC 3SN0A 1A6WL 1FYHB 4Y16C 3H2MA 3C08L 1XF5B 3LAFA 3KYMA 1KFJA 1HIMH 2BVTA 1CGSL 2XZAH 3CNKA 3U7YL 1EGVA 1ME8A 3C8DA 3DPDA 5CSZA 5LIWX 1TQBC 1BJ8A 3VU2A 4ROPA 1WS8A 5D2LE 3OGOE 2H6PA 3HPLB 4ZO7A 5IB4A 4Y9PA 3ISRA 2FL5B 3UNTA 3NVQA 4M6MH 2R4RH 1KLFB 1POKA 4N2CA 1A8JH 5DYOA 5DUPH 4MD4B 2H2SC 4QWWD 4X7FC 2GWNA 2XH4A 3O15A 3RB7A 1T83C 2ZCKL 3FN0L 2H9AB 2WPBA 5ABAA 4O02B 2CJSA 3QV9A 4K3JH 1DVXA 4DOHB 1FI8C 4RA3A 3ZKQD 2DQXA 1K6QL 4DBEA 3ME0A 4L4VB 5IESL 3DJ9A 3AU1B 3WFBL 1KCRL 3SDOA 1ETZA 3CXHJ 1EXBA 5AZEH 3KYAA 5AYTA 2PURA 4XC3L 3HF3A 3QOMA 4I9TA 1D5BA 4OCWH 3PHOB 5A6AA 1SHSA 2ITDA 3JVGC 3OLEA 2PGEA 4OD1L 1C5BH 4IH3A 1HHHB 1MXSA 3MDJA 4LIQL 4NZRH 1OAYL 2VE6A 3G08A 3MROB 3HAEB 5CFHA 2VABB 1NKGA 2ZUSA 5BRBA 3KW7A 3D39B 5TIMA 1GS8A 4HZLB 3C12A 5B22A 2OMBA 2FGZA 1HZHH 3D30A 2IXQA 5AOMA 3WS3A 5I1AB 1UR1A 4B9IA 4H00A 5I3HA 3WFCL 3ZXWA 1NOFA 4O2EA 4PG9B 4AGPA 2DT1A 1KTLA 4LFHD 4L9XA 3FUDA 3HAEG 3V6BR 4FG2A 1KFBA 1LJYA 3IEBA 3VKDA 1W3HA 1S9XA 1R3WA 1HKMA 4E8GA 3FOKA 3HMCA 4GVFA 1IBYA 1TJHH 3IU4H 4G9FA 4H88L 2DM3A 1G87A 5E70A 4H83A 4F7TB 4US6A 2EKSA 3CN2A 1A1MA 1RVGA 4XCCH 2OTUA 1NBVH 1G4SA 4GJ1A 3NXLA 2I24N 5FKPB 4AC4A 2Y72A 3OF6D 5LUMA 4P57B 1TPDA 5F7HA 1K72A 4AX7A 2V5MA 2XPYA 2PDKA 3DECA 2V8MA 4FNUA 1T0PB 3ORJA 4HISA 4HIPA 1QSEB 3WV0A 3AUVA 4WUUD 1IGIL 3PZNA 1RXOB 1EJ8A 4M0XA 3IK4A 4Z7VF 2VMEA 1NGZB 1KPRA 1DCEA 1QFWL 2PP8A 3K0WA 4XZUB 1S7XB 4QDGA 4WO4D 5DZPA 4GQQA 1YTDA 3F03K 4WRHA 1T03H 5DMIL 1HSAB 1P5BA 4U1IA 1W1YA 4OF3A 2PDMA 4H8WL 5D7JA 3JV6A 3ARBD 4Z76B 1BQSA 1Y5XA 4R88A 3SDXB 4Z3GA 2X1UA 5DVOA 3GFUA 1RR2A 3GHTA 1EJFA 3RVVC 2OMYA 5IB3A 1R4XA 3Q13A 3UBGA 2NY2C 3DURB 4NQSA 4W68A 1JUBA 2HVKB 2H26B 4GYPA 1M9WA 3TJPA 2NW2B 3CQFA 3M7FB 1UM4H 1RZGA 3T1FB 2PDCA 1MJUL 4FA7B 1RP9A 3O2VL 3GLZA 4MD5A 1OM3H 3SE8L 1P1ZB 1U8HB 2CMRL 2G5BA 4YC2B 4WHYG 3VFTB 2NLIA 3JT0A 5D71H 1TA3A 3TTSA 3I6KB 4KDTA 5IROA 1G7LA 3TN0A 4GKZA 3GPEA 5HYSB 1G9MH 2J88A 5FGCE 4NNPH 4OKVB 2N1TE 4I3SL 2HJLA 1YHPA 3E3QC 4UILL 3T2OA 1T8XA 1UR0A 3V7PA 1MW2A 3PAZA 1CECA 6TAAA 3GXDA 1OIMA 2ITCB 1VD6A 1WG3A 4KPHL 3VC5A 3DDFA 4H19A 2DAVA 5AFAA 3TCSA 5DEZA 4C7GA 5EDSA 3W02A 3JTTA 1OQXA 3O3BB 1GYAA 5D93C 1AQFA 2E0PA 2FHBA 2IBGA 1A6TA 1U8MB 4FFYH 5KSAD 5KVGH 2DL2A 3G6AA 2DZEA 5J89A 1R3IL 3JV0A 2A6JB 3ARYA 4HCGA 5CKSA 4G7QB 2FPTA 3QUZA 1U4EA 3C5XA 3Q3GA 1HWWA 3IV3A 2BWIA 4Z95H 5DANA 1A8ZA 1BF6A 2H0FA 4XWOC 1I8LC 2X4TB 3RWDA 5KTEH 4A29A 4B5XA 2FGWH 1H5BC 2HFEB 2PGRA 4OQTA 1B90A 3EXJA 1A5CA 4XOBA 1DJNA 3GR8A 4B16A 3QEQA 2PPEA 3IJHB 3UJ2A 3UADA 4JM4H 2AEPH 1EJUC 3IPEA 1SHXA 3U0TA 3TLRA 5HHQA 1BFNA 1JPMA 2Z2BA 3M44A 43C9B 4O4VA 3O0FA 2WV3A 3MBWB 4X5QA 4DQWA 3ZE1B 2PMZA 4L9LA 4GVIA 3ULAB 5DTFA 5E0FA 2Z8SA 1H6UA 1BYBA 1L9MA 1LOLA 4AY0A 1OB1B 5LNUA 1VACB 4M1CD 1CDCA 4PWGA 2XG4B 4HJ0D 4JFFD 4R7XA 4IX0A 4JQ2A 2DLFH 2QUTA 4B90A 1LWRA 1E1FA 2OM5A 1RI8A 3W11C 3LHWA 5FA5A 3NG3A 4PMJA 1J9SA 4UMGA 2BSSA 4L8BA 1EEYB 3ATYA 3QY7A 4ZE5A 3MOQA 1H3GA 1MAMH 2C16A 3SN4A 1VGEH 4JN2A 1U22A 5JOPD 3CWNA 5KS9E 2R6OA 4HH9B 3BSZA 1CO1A 5EOCL 4LBRA 5FL1A 2AVGA 5BWFA 4RMBA 4LY8A 5HUOA 4NGHL 1QFOA 4L64A 5D1ZD 1U8OA 1FP9A 1RUQH 3NCYP 3TX9A 4GW4B 4KMTH 5C9RA 4AUUA 3GVWA 3PTQA 3BLLA 5AVXB 4ZZKA 4A6YB 4YSAA 4OF0A 4Q9BA 1EFXD 1A7OL 1PAMA 5HQEA 1FNLA 2OPCA 1XYZA 2XJKA 1WUEA 5EO9B 4JPGA 2X1OA 4NZFA 2JFCA 3T8MA 2VEPA 5ACZA 4JFDA 1QK2A 1C9DA 2Y7GA 1GONA 3VXUD 5HR7A 4KX8A 3ETBF 4JHBA 3HE6C 1FWBC 1BAFL 5E56A 4HSCX 4Z3EA 1ZWIB 2VL5B 4MA8H 3DOHA 5I18H 1L5GA 3RVTD 5C0BD 4LUTB 2GOUA 4Q4RA 3ELQA 2PW2A 1T1XB 3QIUD 3FU9A 4Z1CA 1SJVA 2IFGA 3L2NA 4YNYA 4JFTA 1FL3B 4U1KB 4TV6A 3D4GA 2IQDA 1MQ8A 2W9DH 1MFCH 3LD8B 2JKWA 3OKLB 3VD1A 1OFDA 1VFOA 3J2PA 3DFSA 2CHWA 1FF5A 1NFDA 3OKNB 3W23A 2YD2A 1SW3A 3P73A 4IICA 3STPA 5ABFB 3HJEA 3Q94A 5H37H 1GQIA 3B05A 4J3OD 4L29A 5B3NA 4G1MB 4L3AA 5DBTA 1E5YA 1T7YA 1BWMA 3G0SA 3M0MA 3RUBL 4JB9L 4OZFH 5ITBH 2E68A 1VQTA 4DEFA 5DS2A 4LRNL 2NY7L 3I9GL 2Z64C 2CHDA 1Q6EA 1O6TA 3RTLA 4A3QA 3LKNB 5G4MA 1SGJA 4GNJA 5I07A 3HN8A 3ZDXF 5B7YA 3GBDA 3OGVA 3IETA 5D72H 1CLZL 2CO7A 5EPMB 1NFBA 1QVBA 2JNZA 3C5JA 3GBMH 4GXWA 1X5YA 4P23B 2BNRA 3CTLA 4G9DB 1ERNA 3ZR5A 3MUCA 3I6SA 4PG2A 5IQ9A 4H01A 4AIBA 3OJDB 1T7XA 1KIUA 2W88A 4LK4A 4X4ZA 1NBZB 1BD2E 4FG6D 3WUBA 1EDHA 3CHQA 3NMEA 3MGAA 3IIVA 4OGAC 2OTDA 3ECUA 1EXUA 4RH4A 3G5XA 1PKYA 5GSVA 3LS5L 2JIXB 2GKIA 1MCPH 3B9KC 3ITYA 4X6BB 5DSCA 3GRWA 3D18A 3QJTB 3GI8L 3S7GA 5KVEL 3F83A 4ICMA 2IWGA 3PIQA 4YIWA 4A2LA 3VXPB 3ITTA 4JN7A 4JRYA 1MHPL 2XFWA 2YQ2A 4XP6L 3SSJA 1CXLA 3D06A 5HGAA 4BFOA 4S3CA 3EGSA 1WITA 1ZE3C 1GL4B 3EH2A 3VYPA 4BI6A 1LO3L 1Q4NX 1A7NL 1Y6KR 2NY0D 4GEIA 1XGTB 4MMZA 5AVYB 2CG9X 2B1AH 1DQKA 1NGQH 3FCSB 2LU5A 3ZE0B 5CXPA 2F54E 3GNML 2OX5B 3R25A 2AJUH 4EPKA 1B3JA 2F58L 4MRCA 3FFCB 1E0VA 1V0LA 3DETC 5T1LA 2XPGA 3TYAA 1JHTB 1MFMA 1GVIA 1OGTA 1XLFA 3NJVA 1F56A 1QEWA 3NIDE 1D9EA 3WBWA 5H6HA 1PG7L 2V5RA 4A2GA 2IALB 3UXAA 1RZMA 4F2MB 1WYJA 4LV4A 2XC8A 3QQ9C 5EO1B 5BZZA 3TIEB 1GZHA 3DXIA 2E1WA 4O1DA 3TL5A 3GLEA 3NL2A 4LL4A 4ZFMA 3QDGD 1RJQA 2ZNWA 4ZPVB 3C8NA 3EEGA 4XUGA 3WJZA 4G59C 3ARSA 1V5XA 3UR5A 1N8IA 4EXPX 3ATZA 3VD4A 2V2TA 1WWBX 4JMNA 5EIIG 3FYPA 3MB9A 3MV7E 1RFDL 3P8JA 5E8OB 4BKTC 1N70A 3UG5A 5I6PA 1ITUA 5F44A 3IWPA 5EC2B 4ZNCD 4CCCA 4IQJA 1HJUA 5H35A 1DQLL 3TR2A 1TJ1A 3QBTB 3T4YA 1A5NC 3TH3T 1Y5WA 2ADJA 4IF2A 4AEOA 4JN6A 4OBTA 1LBLA 2K9FB 1M42A 4MMYB 5LBVA 1YMHA 5EO0B 1X9LA 4OB5L 4XVUC 1NBQA 3WJYA 1LTXA 1FP5A 1FFOA 4O54A 3N3TA 4NQVB 4PGZA 2OSLB 3LZPA 1KY6A 2DQJH 1QSFD 2TAAA 3TJHD 3O8XA 3VFSB 3TURA 1LL7A 2DSUA 2FZ9A 4OB5H 4OZGF 4D8AA 3ZLHA 3B8VA 1NBCA 4QEGA 2X2HA 1RBOB</