3A4AA

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
total genus 238
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3a4aA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3a4aA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3a4aA02
4L4PA 1FH8A 3AIRA 4GIAA 3WNNA 2D23A 4TX6A 3IGUA 4Z2KA 3AZSA 1PZ2A 3SUSA 1CENA 2ZX9A 3BCDA 4D6CA 1JGIA 1C7SA 1K9DA 1J12A 5CLTA 3O9NA 1HVXA 3WDJA 3DDFA 4CN1A 4QCEA 3BGAA 2DDXA 5A8QA 2XVGA 2ZUSA 2VRQA 1KR0A 1KBKA 3MS8A 2A3BA 3GXTA 3H53A 3WEOA 3OGVA 5CXPA 4W8AA 1B31A 2D73A 1OBAA 2OLHA 1B0IA 3BCFA 1H0GA 1L8NA 8A3HA 1VAHA 1NWRA 3PZQA 3W82A 2JALA 2WBGA 3MUAA 1PPIA 4D71A 1ZBVA 9CGTA 3LX9A 3VMPA 3NCOA 4HPGA 4ZEPA 4HMCA 3OGRA 3HG2A 5CZKA 1JZ6A 1JZ4A 2VX6A 8CGTA 2X2IA 4Z2LA 1Q6EA 3WUGA 2VCAA 4YPJA 1QI5A 3GXFA 2JE8A 4FNQA 1DWIM 3GXPA 4RL3A 1TQTA 1XCXA 1QI0A 3FHQA 1JXJA 4P8WA 2QPSA 3QOKA 1TQUA 3VDCA 1E5NA 2WMIA 1UQYA 3ARYA 4AY1A 5CGTA 4AYGA 4M1RA 4UQAA 1OWQA 4NSBA 5IFTA 2VOTA 1KXQA 4CCEA 4ZXLA 2OW6A 3D52A 3WUFA 3VDAA 1OIMA 1KTBA 1R86A 1PS3A 4D6DA 3B9AA 3SCRA 2G4FA 2W4XA 1QI4A 4LXFA 1LLOA 1QPKA 2TAAA 1UASA 1ITXA 3N17A 1W2PA 3F5KA 1GHSA 4AZGA 1UR8A 1CGTA 2EACA 4GI8A 4FK9A 2WMJA 5EFFA 3OLDA 2ZXAA 1HJUA 3EJQA 2JF7A 3U5YA 3WD4A 2J7DA 3VNYA 3VIPA 3AXHA 3J7HA 2VURA 6TAAA 3MUIA 2O9OA 2YIHA 1UZ1A 3ZJKA 4GINA 4AEEA 1OCQA 2GDVA 3M46A 4D6GA 2A3EA 3AISA 3CZJA 4A3HA 4MJ2A 3BC9A 1H09A 2C7FA 2W91A 4K68A 2X1IA 3LRLA 1NOWA 3SCUA 3G6LA 2G41A 2W61A 5IXEA 1LG2A 1UWRA 4PTXA 1UWIA 2VO5A 3A22A 5A6MA 1K6AA 4KRTA 2CETA 1W3LA 3AIBA 2J7HA 2X05A 1V3MA 3MKKA 3BLBA 3GXDA 2IXVA 1F4HA 1F4AA 2GK1B 1XGZA 1V6WA 1E4NA 1BYCA 3OGSA 4W84A 3N1AA 4LYQA 4P7QA 3BUIA 3H54A 4FLSA 1E73M 5FD0A 1CTNA 4PMNA 2X0YA 1L0PA 4GZEA 5A94A 3DECA 4GI6A 1TQSA 3QHOA 5F7UA 4LQ1A 4NI3A 3CMJA 1G0CA 4XB3A 5HBFA 5D8ZA 1BG4A 3BSGA 1FFQA 3CZKA 4GKLA 2OWCA 4GPNA 3K4AA 1G5AA 3LXAA 1E55A 3WQVA 2G3IA 2XPKA 3DX2A 1ZJAA 5I6SA 4J3TA 2Z1KA 1M01A 3WD1A 4JCMA 3WL0A 2EO7A 4YN5A 4JIEA 3VSTA 1UKPA 1TE1A 4PEEA 4QLKA 1UYQA 3MUY1 5CSYA 3EDKA 4U31A 1V02A 4AW7A 2VL4A 4MADA 1LG1A 1MW3A 4H7VA 1IT0A 1VJZA 5DO8A 3WBEA 1WAWA 3BAWA 1V03A 3CMGA 3WNKA 3AIQA 1J0HA 1TQWA 2AMGA 3UCQA 2J62A 1UKSA 3N9KA 4JHOA 2ZUMA 5D9OA 4J3SA 2VI0A 4S3JA 1UA3A 3F5JA 3WF3A 5BXPA 1Q4NX 3NSXA 4BQ4A 3M6DA 3NYDA 1DTUA 2WKGA 4H8VA 2IXUA 2XGBA 1BFNA 1VFUA 2YJQA 4TVDA 4FLOA 5E6YA 3VTRA 1MW0A 1G1YA 2GJPA 2DSZA 2CESA 4MB3A 2YDRA 1MW2A 2XVKA 3DX0A 2RGLA 3VSUA 4B9ZA 4DO6A 3OLGA 3WNOA 4FLQA 1CBGA 3K4DA 1UD4A 3ARTA 2V3FA 4FNTA 2JEQA 4HZ6A 4LYPA 1CNVA 2W5FA 2J77A 3A6OA 1KQYA 1KB3A 2CHOA 5IDIA 4TTGA 1E6SM 1W9UA 3D50A 4AMWA 1FHDA 3AS1A 1H11A 4JKMA 4PMYA 1GUVA 4P8XA 5I3DA 1DEDA 3VGBA 3EJTA 1RD6A 3WH6A 3HG3A 1QW9A 4QP0A 4A4AA 1AMYA 1FA2A 1XSIA 2PWGA 1XYFA 1UR2A 3BUBA 2WZEA 3L4ZA 4WKHA 3K8LA 3ZT6A 1V08A 3VNZA 3G6MA 3WH8A 1K9EA 4JCLA 3CBWA 4CCCA 1DWFM 1NWSA 3A23A 1E1FA 1B3ZA 2XJ7A 3TTSA 4UFJA 4DO4A 1LWJA 4OJYA 1E0VA 4UR9A 3CLWA 2CKRA 4RE2A 3S5ZA 4AMCA 4F9JA 2WLYA 2GDUA 3THCA 1W3KA 1HIZA 1Q6DA 3WD0A 3NJ3A 1GJUA 2FGZA 3F4VA 4W7VA 2FH6A 2WCGA 1HWWA 1W9PA 1JFXA 2DT1A 3D3AA 3D4YA 3W53A 5HXMA 4MAZA 5I5RA 1H0IA 4IUGA 3BLKA 2O9PA 4CUCA 2AAAA 2CNCA 3SCQA 2EBNA 2BY1A 1IV8A 3PZVA 4AISA 5BXRA 2CYGA 3ARQA 2CXGA 4NZJA 3ALFA 1MYRA 5BYWA 2VZSA 4BQ3A 3L2MA 2EPMX 3BVWA 2F7PA 2WSPA 3OB8A 3H55A 1DP0A 4ACYA 4UOJA 4JZ5A 1U30A 3CHDA 2F1AA 2VNCA 4QDMA 3S2CA 2O9TA 4CD7A 2BVTA 2WYSA 3ZM8A 2ZICA 1V6XA 7CGTA 4JL1A 1WDSA 1RP9A 4CGTA 2CCRA 3FXYA 3IJ7A 4E4PA 5EMYA 3KLLA 2BFGA 3KWXA 1QNOA 1CYGA 1JYNA 1CWYA 5DEZA 1KGWA 2E40A 2EPKX 3E1F1 3HJEA 4JHZA 5A8PA 3DC0A 1K9FA 3PZMA 1JYXA 4XUYA 2XFRA 1R87A 4AD3A 2JEPA 2CBIA 3JUGA 2G3JA 3AQUA 4NX0A 1EIBA 2Y8VA 3EJSA 4CD5A 1NARA 1H49A 1HXJA 1CEOA 4JFUA 5A3HA 1Q6FA 1CXIA 4N0RA 2YKKA 4AC1X 3BAXA 1XHGA 4XZBA 3WQWA 2E8ZA 3WMBA 4E8DA 4WK9A 1QHOA 3BVVA 2D22A 4P7NA 4CD4A 1B90A 1X6LA 1SZNA 1KGXA 2VQTA 4PCTA 1ZBCA 5A2CA 2NSXA 1AVAA 3AMKA 1TFVA 2DEPA 5A8OA 2YLLA 2WC7A 2XN1A 2OW7A 4UFMA 2CERA 4M29A 1JF5A 4CKQA 1JDAA 3W28A 4J3WA 2OSWA 3W38A 4HMDA 1DWJM 3AHVA 1HVQA 4ATDA 4PSPA 2WXDM 2DSWA 5ABFA 2CHNA 4W89A 2XGIA 3VPLA 3NUKA 1R85A 1OT1A 3L4TA 1J0KA 1CPUA 3PZ9A 3ZJ8A 5A6BD 2YDQA 4EKJA 1FH7A 3WQ8A 2BXZA 2UY5A 1BPLB 1LQ0A 3WEMA 1V3JA 4MTVA 3IAQA 3BMWA 1UH3A 3FAWA 3RIKA 2ZX8A 1EHNA 1E4LA 1OGGA 3PTKA 3WDIA 1CECA 1JNDA 2W67A 3B9DA 1KR1A 5HNNA 5HPOA 1DWAM 1LL7A 2WB5A 1XC6A 4M80A 5CJ5A 2J47A 5BRQA 2ZWZA 2YOCA 3CUJA 4UCFA 3VD4A 3HMCA 1KWGA 2XUCA 4UOQA 4HU8A 1WDRA 2BVDA 2OYKA 2WHJA 1ISWA 4UQDA 4JFTA 3WL1A 1JF6A 1Y7VA 3QHNA 5A95A 2ZXDA 4DM2A 4QCFA 1OM0A 5E09A 2DIJA 2J78A 3LXBA 3VIMA 1UR4A 3FY1A 1I1WA 1EOMA 4UOZA 4HPHA 3PZGA 1UR1A 2ZUUA 1E6PA 1LL4A 3WY3A 1KCKA 5CSUA 2F61A 2OYMA 1V3HA 1E4MM 3W26A 4WLCA 1WZMA 2D1ZA 1ZL1A 4UTFA 1DHKA 2YFNA 1GOKA 2ZOXA 1B2YA 2HVMA 3TONA 4FNPA 3PZIA 4M24A 5GNXA 1GQIA 1J18A 2E9MA 1EQCA 1K9TA 1QBAA 2EJ1A 4PN2A 4EANA 4TVUA 3EDJA 2WPGA 4DWSA 3AXIA 1EXPA 5LYRA 3PN8A 4W7UA 3T2PA 3ZQ9A 4BA0A 2DT3A 3GM8A 5IHSA 3SCNA 2PF0A 4P8VA 2BS9A 3ARPA 2PI6A 3VDBA 1S46A 1GJWA 3EJRA 3CV5A 4F8XA 1BQCA 1OIFA 4UFLA 3UG3A 5I79A 4R5EA 4FNUA 2XHYA 2XTKA 1WKYA 3VILA 3VOCA 3WEZA 1Q6CA 2UY4A 3WF0A 2YBUA 4HA3A 1UD2A 1CLXA 4MB5A 1FP8A 4PCSA 2PBGA 3ZT5A 1B3YA 2Q8XA 4P7RA 3DX1A 1GOMA 1JDDA 2J8FA 4CVWA 2W62A 1RPKA 2OSYA 3AZTA 4AZIA 2CITA 1JYVA 1TZ7A 1MXDA 4HA1A 4PYSA 1GNXA 4IM4A 1WZAA 1JIBA 4GZJA 1HJXA 4V28A 1QWNA 4JKKA 2V3GA 1SMAA 2EPOA 3BUDA 1KXHA 2ZX5A 5EB8A 4W87A 3OIHA 1JFHA 1HTYA 1E9LA 3WH5A 1XD1A 2VVNA 4D1IA 3PZNA 3VD7A 3L4UA 3CZ8A 1JL8A 1PX4A 4AMXA 3AICA 2J79A 2OWWA 4BCEA 2BVYA 2AOSA 3BAKA 3W0KA 1HKIA 5BRPA 1W91A 3AYSA 1PIFA 1KGUA 4U3CA 4NRSA 3KLKA 4HMEA 3OZOA 3VX0A 4Z2IA 2EADA 3QHMA 1JD7A 3OZPA 1PX8A 3POHA 5A6LA 4BQ5A 3O6AA 3UEQA 4AEFA 2Y4SA 3AHXA 3GH5A 1MQRA 4UFIA 3BSHA 3ZR5A 1W1YA 4LX4A 2X0HA 1BF2A 1NM9A 3AMCA 5JIPA 3BUPA 1KTCA 3EDEA 4PMUA 3WMCA 3IANA 4W5ZA 2VT0A 3BMVA 1BLIA 2J8GA 5GQBA 1W9VA 4NXSA 3WDPP 1W1PA 3AIUA 3A5VA 1TR1A 3VUPA 4R27A 2E3ZA 3RM8A 5I77A 4BZYA 3MSGA 1UWQA 1XH0A 3VKKA 1KCLA 1U2YA 3W24A 3GTNA 4ML4A 3ARXA 1FP9A 1V0LA 3AS0A 5TD4A 1HP4A 3WDRA 1EOKA 3FAXA 4LYRA 4XZWA 3TTOA 2EPLX 5M17A 3T0DA 3OBAA 2QV4A 2VC9A 1GQKA 1EDTA 1HF6A 1QW8A 1GQJA 4U33A 2PBOA 1JXKA 1WZLA 2FHBA 1E43A 1UR0A 3AJ7A 3WNMA 4WIWA 5AC4A 1KWKA 4MB4A 1EGZA 2GVYA 1V0KA 3PTMA 3EDDA 1FHLA 4AZ7A 2O92A 2DT0A 3OLIA 5D9MA 4RE4A 4S3KA 4LGXA 2WHMA 5CLWA 1O7DC 4GZIA 1EO7A 4J3UA 1UOKA 4PMRA 2DSVA 3W6LA 2PWFA 1B30A 4D1JA 5BCAA 2UWFA 2CIPA 3BAJA 3AFBA 1MVYA 3UESA 5FKYA 3CUIA 1H4PA 4TVCA 5IHRA 4TXEA 3CPUA 4F66A 2CKSA 4C7FA 5JIWA 1SFSA 3TOPA 1QX1A 3HG5A 1J0ZA 1BTCA 4PSRA 2WM0A 2VCBA 3WQ6A 2PWDA 4M81A 3KL3A 1VENA 2J75A 5DT7A 3AMLA 4UZSA 1QNPA 2F2HA 5A8NA 1Q6GA 3ARUA 3W6MA 1V6VA 5A8MA 2GSJA 5CPSA 1W9BM 2G8ZA 5GNZA 4J3XA 4U2YA 1W32A 1D3CA 5ABFB 1QHPA 1TA3A 1JDCA 4NRRA 2B31A 4D6JA 1MW1A 5DFAA 2VVSA 4E2OA 4D6EA 2EXOA 5EBAA 3PZOA 4HOZA 2J7EA 1V3KA 1GVYA 4IISA 3MV11 2XSAA 5I2UA 4ZFMA 1H5VA 1UHVA 3NSNA 4AIEA 1J01A 2A3CA 5EFDA 3EMCA 1C7TA 1W9DM 3VIIA 4OKDA 3WF4A 1GONA 4KGJA 3AS2A 2F7RA 1HJVA 3L4VA 1VFOA 4OBSA 2J74A 3UG4A 3CUHA 5AYIA 4P7OA 4B9YA 1UA7A 1M7XA 3VGHA 5M3WA 1HJQA 4UNIA 1HL9A 2PWHA 4C7GA 1UWSA 2PC8A 2NW0A 4MJ4A 2DGAA 1EO5A 1WP6A 1XH2A 5ABGA 1TVPA 2CBUA 4B16A 3ALGA 3WMSA 4QAWA 3RILA 3WDQA 1VJSA 2WWCA 5A69A 3SUVA 2YBTA 3LPPA 3D5HA 2VX4A 4UFKA 3CHCA 1J0IA 2DT2A 1JD9A 3CZLA 3LXCA 3WY1A 3U7VA 3K8MA 3A4AA 4M56A 4AYSA 1HXKA 4PMDA 5FCZA 5KEZA 2NT0A 2D20A 1CGWA 1CXLA 1JG9A 2WNWA 3VMOA 3A21A 5BXTA 1OD0A 4AD0A 3CZGA 1W1TA 4WSKA 3VIFA 2WSKA 4H04A 3N18A 4W93A 5CGMA 3CGTA 1R8LA 4Z2HA 1ZJBA 4L4OA 4W85A 4Z2JA 4W88A 1E71M 2BV9A 2WVVA 2GUYA 2VZVA 4PBGA 4MB1A 2DQXA 2WWDA 2GK1A 4ZXOA 3T0BA 1E40A 2OSXA 3LPOA 5HOSA 2QMJA 3WQ4A 1OT2A 1C3FA 3AIWA 1DWHM 5AYBA 3K46A 2EQDA 3CZNA 1TG7A 1FOBA 1GCYA 4B3LA 4EE9A 1I1XA 1GW1A 1MQQA 3IAPA 3MUZ1 1ISZA 4V2XA 2A3HA 3MSDA 2Y5EA 4CD6A 1HX0A 3U57A 3AROA 3T09A 4JFSA 3F5LA 1G94A 3AYRA 3ZSSA 2VR4A 4TX8A 1XV8A 1VBUA 3IJ8A 1NWUA 3KL0A 3LMYA 1I75A 1XCWA 4MNMA 4AZCB 2WW5A 1GOIA 4CU8A 3DHPA 3RM4A 4N42A 3WD3A 2XSBA 4MNLA 3AIVA 1MWOA 2VX7A 4KMQA 4MNJA 1EHAA 1C90A 4D6HA 3WD2A 1BSIA 2E4TA 4URIA 1V0MA 4QLLA 3CO4A 4PMXA 3L4WA 3GH4A 1M53A 1J10A 5ABHA 3GNPA 3VIOA 4GQQA 1WB0A 1ISYA 3RMEA 2DSUA 2RGMA 2BHUA 5LA1A 3L4YA 2F1BA 1ESWA 4CVUA 3HU7A 5I0DA 1VBRA 3T2QA 1V3IA 6A3HA 3WY4A 1R34A 2QLYA 4PMQA 3SEPA 4PUDA 2VZOA 2VQUA 3AHZA 4ATLA 4KH2A 4DWSD 3TTYA 5HDRA 1HKKA 2WHKA 3MV01 3SURA 1PZ3A 3RDKA 3RJYA 1QVBA 4AIOA 4PMZA 1E1EA 1ZBKA 1BYBA 5CQ1A 1CGXA 4GO8A 1QNQA 2WMKA 4ACZB 4XX6A 4DO5A 3AXXA 5BWFA 4LPCA 1W3JA 2XG9A 4FLRA 1YQ2A 1X1NA 3DDGA 4CD8A 5JBEA 1VFFA 4X9YA 5D4YA 2JIWA 2VRKA 4UZUA 4FNRA 1JZ5A 1QI3A 4AD2A 2V3EA 3ZR6A 1QNSA 3WKZA 2IUZA 3VGEA 3FHAA 5ABEA 2QF8A 2HISA 2UY3A 3VIKA 1KBBA 5A6AA 4GXPA 2J7GA 3A3HA 1H3GA 3ZT7A 1VFMA 2F7OA 2V3DA 1MFUA 2GFTA 1ODUA 3W27A 2FH8A 1BYDA 3CUGA 4X0NA 5CPTA 1B3WA 2FGLA 1TCMA 2WK2A 3DX4A 1J11A 2XVNA 4HP5A 4AIUA 1GOWA 1NOUA 3GBDA 2EAEA 4WF7A 2DH2A 4AZ6A 2Y8KA 4ZE4A 4PMVA 1GORA 4UQCA 3IJ9A 2VZUA 2C0HA 4CCDA 1A3HA 1UQZA 4W8BA 3WIJA 1MQPA 1QI2A 3WSUA 3UERA 4DWSC 1GHRA 1UWUA 5E0CA 1NQ6A 1ISVA 3NSMA 4U3AA 4ATWA 3VIJA 2XWEA 5E9AA 1PBGA 1E72M 4W8LA 5D8WA 1E56A 1BHGA 3GXIA 3PHAA 1ISXA 4ZENA 4NF7A 1UKQA 3RPMA 2J25A 1E6QM 2WAGA 2BHYA 3CIVA 3WUEA 1VEOA 1BGAA 1CXKA 2ZUVA 2ZX7A 3SUWA 2WVTA 5D9PA 3OA5A 3HZ3A 4F79A 3GNRA 1QNRA 3THDA 5E0FA 4IPLA 3AI0A 3PZTA 1B9ZA 1NP2A 3HN3A 4PTVA 2FHCA 1WDPA 3A4WA 1E15A 3U7BA 3WQ5A 5CPQA 5I78A 4HZ7A 3MO4A 2YL5A 2Y2WA 1E5JA 2YDSA 4WKAA 2JIEA 2JF6A 3GYCA 1GVIA 2D3NA 1JZ3A 4DWSB 1CDGA 2FYVA 2C8NA 2XM2A 2MANA 3I3EA 1M04A 4KWUA 4JFVA 3KE0A 1H2JA 1J0YA 4TUFA 3ZO9A 5ECUA 1E0XA 3IK2A 2WHLA 3WDHA 2YL9A 1UD3A 3WN6A 1E4IA 4MDOA 1HP5A 5E1QA 2CBVA 2VMFA 2BNJA 1G9HA 2BHZA 2BXYA 2WC3A 2VX5A 3DYOA 1HT6A 4P7LA 1BVNP 3APGA 3GH7A 4GO9A 3WENA 2BY0A 3BLPX 1V6YA 2WZIA 2DH3A 4IPNB 5AY7A 3M7SA 4JFWA 2D0HA 4AZHA 1XH1A 5GPRA 2OWXA 5A2AA 5C70A 1AQHA 1NOFA 1E6XM 4DM1A 2V38A 1X6NA 4OUEA 3S6TA 2ESCA 1A47A 2VJXA 2DIEA 2BY2A 2ZE0A 4YHGA 1CXEA 3L4XA 5A2BA 1R7AA 1UZ4A 1HNYA 2WCSA 1PJ9A 3FNDA 4MNKA 1PEZA 2D0FA 3WUBA 5M03A 3TP4A 3HG4A 4OGZA 1R33A 3POCA 1WCGA 4D6FA 1US2A 3DX3A 5A1AA 4H41A 4A3YA 3AMDA 3ARRA 2YFOA 4OOUA 1OB0A 4QFUA 2WBKA 3LRKA 1VEMA 1QBBA 2UY2A 3LPGA 1JZ2A 5FOOA 1CIUA 5A6JA 1XSJA 3CHEA 5KZ6A 3D51A 2ZX6A 5E70A 1BVZA 2XVPA 3VM7A 3VGDA 1CGVA 1R46A 5FL0A 1VRXA 3VINA 3AZRA 4QLJA 5DF0A 4ZE5A 1WZKA 4J3VA 2WCAA 3WNLA 3MU7A 4Q7NA 2XYLA 3AHYA 4UFHA 4B15A 2J7BA 4BF7A 2WMFA 1XYZA 1FFRA 5IFPA 1CXFA 3GXNA 2EABA 3BAIA 2E9LA 2Z1SA 4CU7A 4M8UA 1GPFA 1ZB5A 1ODZA 1V0NA 1SMDA 1B1YA 3N04A 3T08A 3VDHA 3OG2A 2WVSA 2J7FA 2VUYA 4YHEA 1HL8A 1NWTA 1UG6A 2X2HA 4J28A 5AC5A 5A6BA 1TMQA 2F8QA 3TA9A 3RM9A 1C8XA 3D4ZA 4U5IA 4Y7EA 4C7DA 3W37A 1LL6A 3B9EA 4GQRA 4D6IA 2W66A 4PUEA 2QPUA 3SCPA 1DWGM 3WFZA 4DUWA 2WC4A 3MANA 2XN0A 2ZUNA 1JAKA 3NDYA 5BROA 4FNSA 1CLVA 1EDGA 4HOWA 2XIIA 5D9NA 1UD6A 4MDPA 2WMGA 3PZUA 3SUUA 4HA4A 3WY2A 1BGGA 4AZCA 4RE3A 1U33A 3EMZA 1B3VA 5LA2A 1JI1A 1W1VA 3NIYA 5HPCA 3CTTA 5CG0A 3SUTA 5JBFA 1MFVA 3GXMA 1QHZA 4U5KA 1PAMA 3VGGA 3QR3A 4HOXA 1TUXA 3RJXA 5A6KA 1ZU8A 4M82A 4NZCA 1JAEA 3N15A 1LWHA 2FE0A 3VX1A 4GI9A 2ZWYA 1QWUA 5DT5A 5C71A 2X2YA 1AQMA 1GOQA 3BVXA 3EJUA 3UG5A 3RO8A 2WZHA 1IZJA 4FMVA 3UR7A 3ZJ7A 3WF1A 1M03A 3VD3A 3N13A 3VMNA 4P8UA 3W25A 4AWEA 3EJPA 1LF1A 5E6ZA 2WVVB 1VIWA 2V5DA 1SYTA 4H2CA 4CN4A 1MXGA 2VZTA 1CXHA 4TTUA 3SCOA 1C8QA 1C91A 1R75A 1VF8A 1OSEA 1US3A 7TAAA 2WMHA 3S5YA 1UD8A 6CGTA 1SR0A 2XM1A 3ZJ6A 3TV8A 3EMQA 3WH7A 1C8YA 3MMDA 3VSVA 4D72A 3VGFA 2VRJA 1ITCA 2YLAA 1OINA 4UQ9A 1E0WA 3AHTA 3ARVA 4WKFA 4WJXA 2XWDA 4UQBA 4E8CA 2D0GA 2EEXA 5I23A 1HJWA 1Z32X 2G3NA 3N12A 3U5UA 3W29A 4UQEA 2W92A 2CEQA 1NH6A 2F18A 1UUQA 2YA0A 3KL5A 4H8HA 1T0OA 3CHFA 2BY3A 4J7RA 3VD5A 1TQVA 3SIMA 3SCSA 3BH4A 4PRWA 3TTQA 3MMWA 5JBDA 4AZBA 2D2OA 3T0AA 2YL8A 2E8YA 3I3DA 3VIHA 1HKMA 3VO0A 3ZIZA 3VU2A 1XD0A 3UETA 1EH9A 2FHFA 3AOFA 3WF2A 2PB1A 3WH9A 4PTWA 1LJYA 1JYWA 4EK7A 3L2LA 3BAYA 2Y24A 2WKLA 2CBJA 4CN6A 2W63A 4X0VA 1E6NA 1W2VA 1UH2A 1E6ZA 2G3MA 3ZSTA 3ARSA 4B3KA 1JZ8A 2X09A 1YHTA 4OBRA 2XIBA 4TOQA 4J27A 4MPKA 3O2LA 2WANA 1PX3A 3VM5A 1KQZA 1WDQA 5M5DA 1WO2A 4DUXA 2VR5A 1NP0A 2JFEX 1ZBWA 1W3HA 1J9YA 1V6UA 4WSJA 1H41A 3DYPA 3DYMA 1V02E 1XRVA 3BVUA 2J4GA 1GQLA 1ECEA 5A6SA 2E9BA 1UWTA 3KEHA 2OYLA 5FIPA 1BG9A 2ZUTA 3QOMA 3CUFA 3T2OA 4Z2GA 2YA1A 4AXNA 3A4XA 3KZSA 4XV0A 2O9RA 2IGTA 1H1NA 2ZXBA 1CZ1A 1E3XA 3WFLA 1JZ7A 5GNYA 2WVUA 4W7WA 1J0JA 1HJSA 1XSKA 3I3BA 1JNEA 3SCWA 3ZOAA 3NDZA 2J7CA 1GOOA 2XN2A 2YL6A 1R47A 1TVNA 4CU6A 3K8KA 2ZXQA 2X2JA 1QOXA 3DHUA 3AIEA 2D24A 3M07A 4OIFA 4BQ2A 5JUVA 1EDQA 2E0PA 4NZFA 4ACZA 3LRMA 5LA0A 1R7OA 4FF5A 2NT1A 2GJRA 4KGLA 1W9XA 1KXVA 1VEPA 5C8BB 1PIGA 3VIGA 4PTMA 1AQ0A 3CH9A 3CZSA 3MMUA 1E6RA 3EBVA 1EQPA 1D7FA 5DMYA 2DPEA 2V5CA 4BS0A 4OZOA 1BYAA 3ZMRA 1E70M 4AD5A 1G01A 4H8UA 3FW6A 2VTFA 3GNOA 3CZEA 3ECQA 4HU0A 3W81A 4JL2A 3ARWA 5FL1A 1O6IA 2GJXB 1OD8A 4U2ZA 2XFFA 3WNPA 2XFYA 1WNOA 4DUVA 2QMKA 1OGSA 4HZ8A 3BUQA 1UD5A 4AZ5A 3PBGA 4PMOA 1WE5A 1KXTA 3EDFA 3SCVA 3WBAA 7A3HA 1GZJA 3EYPA 3SCTA 1VB9A 2A3AA 3AS3A 3RCNA 4NXKA 4W86A 2ALWA 1N82A 1JI2A 3K1DA 2DSKA 3VVGA 2ZUWA 1FH9A 3ARZA 3A47A 5BXSA 1C93A 3VD9A 1HN1A 1BAGA 1CGYA 1V3LA 3MI6A 2WMIB 4KRUA 2VCCA 4HTYA 2WLZA 3CC1A 1WPCA 1UKOA 3OLEA 1D2KA 1B3XA 1RP8A 4MAVA 4V27A 1UH4A 3W4RA 4Q22A 4JAWA 2GJXA 3AMGA 3QGVA 4F9DA 1CGUA 3B8SA 1KFWA 3BVTA 1ZS2A 2ZIDA 4AD1A 3FN9A 2EPNA 3GDBA 2F7QA 3BXWA 2FDMA 3II1A 1TA3B 2QHAA 3N11A 3PTQA 2X8RA 3UR8A 4W5UA 4JKLA 2D3LA 1C92A 2PWEA 2YA2A 3GZAA 3GBEA 2XVLA 5I24A 4OOZA 1UKTA 3A24A 1O7AA 4AD4A 3WELA 1IZKA 1UR9A 1RH9A 1HKJA 3LPFA 2CPUA 1OGBA 1E3ZA 4EAMA 1P6WA 1EA9C
chains in the Genus database with same CATH superfamily
4L4PA 2EC8A 4Y5XA 2J8TA 2P8MB 1CICB 1E4WH 2E27H 3AIRA 5G2IA 2FJUB 2R2EA 4FQXB 3SPGA 2HFTA 4TX6A 3HTLX 1F61A 3VQ1C 1D5IL 2CGYA 1TJHH 4UYPA 1IXQA 3GMRB 3FYEB 4ZFOL 1EC9A 4GBUA 5ACZB 1AZBA 4HETA 2G97A 2SODB 4FKKA 3D08A 4ZX6A 4C6IA 4JFXA 3BCDA 1O5PA 5GGSB 3W3OA 1P84J 5DLMH 4LARH 4JNXA 1R3HA 1JUKA 2QEZA 3G1RA 1YYLL 5LAXB 3O9NA 2V37A 4FG4A 4UMGA 4M8QB 1JWUA 3DDFA 3O8XD 4FQ2L 4M6NH 5H2BB 1AH1A 4XP9H 1TG8A 3MACH 5MHSD 2DDXA 3U82B 2MHAB 4PL2A 2XVGA 4QHLB 3S5SA 1KR0A 5A8QA 1KBKA 4OJDH 4R7NA 4XWOC 1S3TC 2B4GA 2WYHA 2PTYA 4PG9A 1VJIA 2P48B 4X22A 4PRHB 5FW7A 5CMAA 4D0BB 2A3BA 4TQIA 4AQEA 5EEVA 2FSDA 3E6FB 3OSKA 3Q2NA 4W68A 2NY4D 4BELD 1DJSA 4OLYH 5FA4A 2TSBA 1ITQA 5GISL 4X5QA 5CSRA 5FYLD 1T03L 4KEMA 3VFLA 5JVLA 3UY8A 5DEFB 2D73A 4E2VA 2OLHA 5F7EL 8A3HA 1HXYB 1EFXD 5FF2A 4XGZA 1NWRA 4AD4A 4XBGB 1LLAA 3NAAH 1CZ8H 5JIIA 2WBGA 3RYMA 3C60C 4WHYH 3PREA 2R6OA 9CGTA 2DUZA 4N02A 3OR7B 4GRLA 3IWVA 4N2DA 3NCOA 1NU5A 4YTSA 3VRLF 2B81A 3HBPA 5MENA 3OGRA 2VR8A 1KGYE 4I8YA 3GYEA 4PJXA 4PY7B 3ABMB 1C1EL 3EBGA 5IJDC 1OFDA 2VX6A 4Z2LA 6PTDA 1Q6EA 4A2GA 5H8UA 2VCAA 1FCCA 1QNVA 1UWFA 3MRQB 1M6UA 2CR3A 4P5MA 4U4BA 4LP4A 3GXPA 3MREA 5TDPB 1XCXA 3LV3A 5CGYD 1ES0A 5GGQL 1QI0A 2PLKA 3NZHL 3O3EA 5TE6L 4LIQH 3QORA 1Q7MA 3DHJA 2HXTA 3AUJA 3QOKA 1TQUA 3D7PA 2A73A 5HHOA 1UQYA 3IDYB 1IBZA 5I73C 3PR2A 3T04D 4R8WL 3PY9A 5D04C 1KKOA 4LU5H 3SODB 4V1XA 2QUUA 3B5TA 4Y2OB 3SIKA 4AYGA 4YX2H 4HGKC 2O61B 4UQAA 1YNPA 1OAXL 4JFYA 5IFTA 1LO4L 3WK2A 3AABA 1CT8B 1KJ2B 2WNNA 4CCEA 5A8GA 3RAOA 1ZMYA 3MHGA 1SEQH 1HINL 4Q0XH 3VE9A 4OB5H 1OAXH 2ZZ3A 5DMMA 1HXYA 2WKOA 1DXFA 43CAA 2BOCA 5C07B 3QN3A 2DV0A 3KDOA 2PC4A 4S1RH 3FVMA 4YTQA 5C54A 2DKUA 4AJWA 4KK6C 4F2MA 4LXFA 1ZJHA 2W4XA 3BL3A 2UZPA 3MZGB 2DLFH 1R17A 2FJHA 2HG5A 3FU7B 2OTWB 5K1VA 5H8PA 4IU3B 4KZDL 3EFFB 3PFMA 1W2PA 4PJ7F 4GLEA 1UR8A 2EACA 4HGMA 3NQBA 4FR6A 2NV2A 5LXGH 4FK9A 2WMJA 1E6JL 2YAFA 3OLDA 4F4RA 2GVGA 4LHQB 1XCQB 2R1MA 3IFPA 4C1LA 2VURA 6TAAA 1MFEH 3MUIA 1XXXA 4S1RL 3N42F 2H2SD 1UZ1A 2OZ4H 1BAFL 3ZJKA 1LOQA 2VWTA 1WFMA 3GF8A 1IAOB 5JXAL 1FQ0A 4PJDE 2JQMA 1MFDL 4H9UA 1II4E 1XUZA 3RDTD 3CZJA 2W88A 1WCQA 1AQDB 3IN0A 2DWEA 1K3IA 2FBRA 3QDJB 5GGVH 4MJ2A 5KS9F 1P43A 2HLEB 3BP5A 4QO1B 4H83A 4R9XA 1WXJA 2PW2A 4WJ5A 2A83B 3QEUB 1RIVL 5B38G 1ME7A 1WUFA 2QUNA 3LRLA 4J12A 2X1IA 3GD6A 4K68A 1NMAL 1SN5A 5EBWA 3N9GL 3S88L 1MZRA 4O0ZA 4QM1A 3SCUA 1T99A 5IROA 1N8OE 2I5GA 1RSYA 4LGRB 4PTUA 1JPFB 2EECA 4I2XA 4JHAL 3DGDA 4EI5D 1PKLA 3LB0A 2FPVA 4NQEA 3P8IA 2X4QB 4OZFA 4DEPC 5A6MA 4M62L 4MZ3A 1JVOA 5CC5A 3HPJA 3SJVA 1SY6A 5ICXB 4C6QA 5I6OA 3N85L 4ODWB 2Q87A 3CK5A 1OY0A 3GHUA 2AQNA 3R19A 2X05A 4XBPA 4YFEA 3D0AA 1KY6A 4Y4KC 1CBVH 2Y0FA 2E46A 5B7YA 1HH9A 2D31B 4WRHA 5FOBB 4AVJA 3FQWB 1FNAA 4MD0A 2X7WA 4IBLT 4HCHA 3BJ91 1UWEH 2R59A 4FERA 5F2FA 4UTAH 4TV3A 4P8QA 1OG6A 3QZBA 4B9GA 2F5BL 1UB6A 1UJ3C 3L7FB 5C07E 1EKOA 2ZCGA 5CSZB 1E73M 2RFGA 3INUL 5DRZB 3RKPA 1KJ2H 3HGRA 3O9WA 2QQ6A 4XBJA 3WIFA 5KINA 3SAZA 4ZUVA 1BVNT 4H0IA 3CAVA 4H40A 4F7MB 3WTUA 5BS0A 5A94A 3EX4A 3H9HA 4N20A 1LQBC 3BUYB 1H9DA 2XWXA 1SJXA 1ZS8B 4G6JH 5FS5A 2PDUA 4WD0A 2F74A 3QWQB 4LEEA 5F7UA 1SVBA 4N9GB 3KS0H 5H35B 1G0CA 1A7BA 3CMJA 4H9MA 4NP7A 1P2CB 1BG4A 1FFQA 3MT1A 3FONA 1A1MA 5D8ZA 1JK8A 4A05A 8FABA 1D5BB 5DA4A 5KSVA 3CZKA 1YBQA 4PPTA 4G8FA 2BGQA 2QKFA 4GPNA 4DN4H 3VVVA 1CI3M 1QRNB 3QDAA 3K4AA 1BQUA 1NUGA 5FUOH 4LHUA 2EKCA 2QT6A 4FQQB 4IMKC 4Z9KB 3LXAA 3BLIA 1DIKA 1UMYA 2JJSA 2X30A 1KPRB 2I9EA 4GFTB 4YLWA 4XBPB 3C5JB 2Z1KA 1A3XA 3WD1A 4MMXA 2JB5L 3GRWA 1E27A 4OM0L 1IO4C 3VSTA 3QI9C 3RWDB 5DA0B 2N7SA 1HK6A 4XVJH 1UKPA 2LLEA 2GJ6A 3IT8D 3ULVC 2Z4QA 4PEEA 1KFJA 2X0SA 3L3KB 3HC0A 4H6QA 1DBBL 1XQ4A 3EDKA 3QMSA 1WEJH 2ATMA 1AZZC 2Z00A 3W73A 4PV8B 3TLLA 5C5YA 3MI2A 1Y5VA 2VL4A 3KVKA 4QGCA 2IPKB 4GRWF 3WTVA 4BE6A 1F73A 3W7QA 2EH7H 3TYBA 3QV6A 4X4YA 3L9YA 5AD0B 1HYRC 5I30L 4LFHD 2HTKC 4NNCA 1M3IA 1VFHA 2OODA 4S3DA 1RK0A 2EYRB 3JXAA 3BP6B 5CILL 3I75B 1SEBA 3A13A 3DTDA 1SXNA 4WI3A 3A64A 4UTJA 1BP3B 1QBML 1W0VB 3FDWA 4PRHE 5LAPA 3V9CA 1A25A 4ADJA 4JHAH 1IT0A 5IESL 3L9BA 3EEGA 1F3RB 4OWGA 1OE3A 25C8H 5F7HA 2AMGA 1KFAH 2Q01A 2V0TA 3DHFA 4ERAA 3I6EA 3MR9B 1Z1WA 2YPVA 2P7TB 3DFYA 3LIUA 3K6SA 1CLOL 1IEAA 3EWZA 3F5JA 5EA9A 4FHAA 1Q4NX 1NEZA 5I3GA 1MPAL 1E67A 4HIPA 4X83A 3FB5A 5ABZA 2VLJB 4RNIA 3ARDB 5L0QB 2J9XA 3NYDA 4G8AC 3QRGH 4WEVX 1I9RH 4ZZ9A 1ZA6B 3SECA 2IXUA 1VFUA 3ARFD 2VXTL 1XCFA 2OK0L 4M6PA 2INFA 2NY7L 4TQHA 4MRCA 4Y1AB 5DUJA 1G1YA 1I7UB 4FFZH 5DVOA 2DSZA 1IC7H 2ZVIA 3STEA 2XISA 3IWUA 3RWCA 1O5QA 4U1KA 1PZCA 5G4EA 2ATAA 1ZIBA 3QDHA 4NCC2 35C8L 3L3DB 3LNIA 4RIRA 4U1LA 1WUEA 3ZDXF 4J2MA 3RXZA 3QZWG 5LXGL 4E5XA 4HCRL 4FXKA 2DMHA 4DO6A 5G5DA 2EDYA 2B8OT 2EXSA 4F15C 3BPLC 5IEKA 5ABTA 2PLCA 2BASA 4XVTH 4IK6A 3Q6FA 3OAUL 4JTLA 4ZB0A 2P46B 2QDWA 5H4ZA 1AQ8A 3HAEB 3TJPA 2WLIA 5FJTA 4O5LH 5FYKD 3BW2A 2B1HH 2EUVA 3DFPA 4YSSA 1X7FA 3H56A 1URLA 2IPWA 5CU9A 2WTRA 4OB5L 3I9PA 1SJHA 1E1CA 1EVTC 2W5FA 3NIFB 5C0RL 4NAJA 1Q6QA 1EV2E 2FWOB 3S4SG 2HJPA 2DQEH 3MYPA 2Y69B 4POCA 4KXBA 3KVDD 2AJZA 1OTSC 5TDPA 1GCFA 3PFUA 3ZMEA 4A7QA 3VVWA 4F2BA 5MEOA 5JW4R 4CD7A 1NA8A 2BNUB 5F9JA 3RI5F 2BVUA 2CHOA 4QEHA 3GSUB 3OC5A 4IPPA 2PP0A 4TTGA 2IOOA 2L0DA 5IFHH 1W9UA 3H3BC 3NK3A 4WUUE 3REWA 4CC0A 1HQTA 2I5IA 4GRWE 5I1GH 3VTAA 1H11A 1ZT4B 3IJHB 1Z7AA 1NGYA 5FJJA 4MF4A 4HUWB 1YEIL 3S3DB 3ZE2E 1GUVA 5AZUA 5I3DA 3WHXA 3VGBA 3GHRA 4G82A 1MJUL 4O2FB 4PJ9A 5C08B 4LCRA 3Q48A 5G5DB 4G7YH 5DUPH 1I9RL 2GTWB 3FXIC 3D25B 3AREA 2FX9H 1JPTL 1AMYA 1EGJH 3QNXB 4LLDB 4UQ3B 4XPGH 5E5MB 1EJ8A 1V93A 2TODA 3VXME 2DQUH 3DX9B 5KVEH 4XMVA 5C7VA 4FFWC 4F1SA 1A9EA 1R3LA 4G9DB 4MDJB 2VD9A 4WVXA 1BVWA 3R8RA 2FQGA 1A6UL 3HI6H 3RY5A 4YDZA 4RMTA 3LNEA 1OAZH 4AF0B 2JCCF 4Z17A 1F6AB 4EDWH 2VN6A 3GNNA 1NWSA 5FCUL 3T7VA 1DE4A 5GGTH 1DBKH 1CLYL 3K2UH 3FUFA 5CJOL 4YO0A 4AJ0A 1B0RB 1HQRA 4JN8A 3S9DB 3QJVB 1PKMA 2Y5SA 2WSDA 4DVRL 1LWJA 1T6WA 3VFGH 1QJWA 4G6JL 1LRTA 4CA4A 3C5JA 3HN5A 2A9NH 3AM8A 5K9JH 3ANVA 3S5ZA 3UETA 4AMCA 5FYKE 1FL6A 3ES6B 4HIHA 4KTDH 5IOBA 1WEJL 4I3SL 2WLMA 3THCA 4YXGA 3JW7A 5I03A 5MI0C 5GS1C 2FGZA 4HVXA 4NJ9L 5DCBA 2FZDA 3IXAB 1OK6A 3F4VA 1MWAL 4O16A 2VKXA 4QF1A 1DLHA 1ACYH 2Y7SA 3EGXA 3P0YL 2QVTA 5E56A 5IMMA 3HO8A 4QMEA 4X4ZA 4Y4HA 4XVSL 4CMHC 4QKTA 3MMEB 3QXAA 2HPIA 4O2FA 1CD1B 5C08A 3U7WH 1W9PA 3WYZA 3D4YA 1P4UA 4K71B 4XMLH 3NEHA 4Y4HD 4NAFA 3W53A 1ZDQA 5C9RA 3AREB 2J7LA 1A7NL 3H9SB 1NFDF 3E3HA 2FZ9A 3O3DA 4WFHD 5I5RA 1Q9OB 3BLKA 1FP5A 4BQBA 3GFZA 3U0PB 4N2IA 3OZLA 4PB5A 2Z31B 2AAAA 3EA1A 3RX5A 2R1KA 2HRWA 3G04A 3W11D 3IGAA 4V2CB 1MWAH 3VRIA 1XKYA 1ED3B 3KLSA 3VE7A 4HEME 4OV9A 4AISA 3PGFH 2MPAL 1WYJA 1PZ5B 3VI4B 1UZDA 1KD0A 2OCCB 2X4NA 2J44A 4YXKH 4RDZA 2A74C 4NZJA 5JW4Q 1X5XA 1A6TA 3ALXA 5DC0A 3TYFB 1GYAA 1T40A 5BYWA 2VZSA 4BQ3A 2IOMA 3IBOA 3FPYA 3IVTA 3JYCA 1H63A 3HMWL 5KYXB 1KELH 1SJBA 4I48A 3QA3B 4MZ1A 1EB3A 4HHGA 1U8QB 3FFOA 1CLYH 1KF9B 5F96H 4Z7NE 1A3WA 3QUYB 4WK2B 3B4UA 3OBEA 1ZT7B 1RQEA 2ZUYA 3N2XA 4QJ3B 2F1AA 5DU7A 4YHZL 4N6RA 4MCMA 5FXCH 4GRMB 4AIZA 3BWWA 4PUJA 3CB3A 2ZRUA 4L29B 3GQYA 4QDMA 3QUKB 3BPLB 3HI1A 3O3AA 1LBMA 3EH2A 5SX4I 1GOFA 1SMOA 1V05A 2WIMA 2PR4H 2VDRB 1INEH 3H2MA 1ZOXA 4PP2A 5FHAH 4OAWB 3STZB 3ZM8A 3MRBB 5MI0B 1E6JH 7CGTA 2J20A 4GXVH 2R1LA 4LSTH 5JMRA 2XA8L 5I1CL 1E8XA 2ZF9A 3ZDYE 4RFOL 1VKXA 3KBHE 1YDYA 5D09A 5JBFA 1YNTF 5EMYA 1ETZB 2NXZC 2BFGA 4JRXB 2Q2EB 3F62A 1XGUA 5AUMB 2VXQL 1JYNA 2VWSA 2Z9TA 1CWYA 3A12A 3EZ4A 3MWCA 3ESVF 1VF5C 1CCWB 2ITDA 3B8UA 1K02A 4BDVB 3ULVH 3LY6A 4JFEA 1KGWA 3FQYA 1AFSA 2GQ8A 5A8PA 3DC0A 3ECBB 4IQHA 3QTGA 1K9FA 2Q8BL 2BMKA 1JYXA 5C2CA 4N1CA 2E59A 1URZA 5JW3H 1R3KB 4R4ND 1FFTB 3D39E 2GCYA 1FZJA 4RDBA 2KMWA 2WBJA 1KKRA 2FRGP 2WWMC 3FK4A 3TIDB 3MV7B 2AK1H 3CFCL 2G3JA 4A6YH 4O5LL 4IHCA 4R8WH 5B4MC 1LQAA 4MWAC 2QPDB 2XWZA 2HTLC 4US6A 1SVDA 3VA8A 4O1FA 4IKLA 1MCPL 2XOTA 3QW3A 1FBIH 2X1WL 1I8UA 2EIDA 2IC2A 5DS2A 1ZE3H 3SPJA 3P62A 2IPGA 3BHBA 2CC0A 4HIEB 3FFCB 4I18A 1NARA 1DJGA 4CD5A 2P80D 4P46C 3IMUA 5F2MA 4E41B 1ZIAA 3KPMB 3QUXB 4HD5A 1HXJA 4ICMA 4ZNEE 3LS4H 5E4EB 1RXOB 5I1AB 3QF0A 1K5WA 4GG9A 4NNBA 5EF0A 4Q32A 35C8H 4R96B 1A4BA 3SW6A 3VXGA 3RLGA 4F48A 2EVHA 1VADA 5F1IA 5TQ0L 1G4TA 1Q4WA 5FJOA 3ISIX 3FTVA 2Q8LA 1OLZA 3VG9B 3UXIA 3MR9A 3G5YB 4MMYA 5EMUA 3NFUA 1Z66A 1A14H 4WK9A 4L1HA 5HWJA 4JO1L 5I2IB 4LFHG 3SDDB 4P7NA 4UB9A 2HDJA 1EJOH 1X6LA 4TNEA 4P2QB 4F80A 5IK3A 3E49A 4XSMA 4NB7A 4DTGL 4Q33A 5DQ9A 2NXZB 1G9ML 3LOTA 3O4LE 2QADC 4W6YB 3DNKA 4XMPL 1OC6A 5GGTA 4ES9A 3ULVL 5AOJA 1T5AA 2XN1A 3N1MC 3VDGA 3RWHB 5JHMA 2OW7A 1FZJB 2AABL 3QI9B 1AG6A 1DVFA 3W7LA 4HYRA 4M29A 1KXVC 4P57B 4LBEB 3LEXA 2GG1A 1E5UI 3G5VB 3S36H 1RXLA 3MRPA 4XNBA 3HGJA 4HYVA 3DOIA 3TK7A 4OZGA 1MHPL 1EHKB 2OSWA 1XW8A 1W80A 1DWJM 4PGEB 3AHVA 3PWPE 1WJ3A 4OVVA 4Y9EA 5DD6B 2BM3A 1KNOA 4X6CA 3GSOB 1C1EH 1EO8L 1MJJB 4Y5YA 2A9CA 4AIBA 3V6OA 2WXDM 2DSWA 2W81C 2XWTB 3BUVA 4HNLA 2QUMA 2CHNA 1YNLH 4YTRA 1A0QH 4ZX5A 2VXNA 1QT1A 4OD3L 5HNNA 4XVJL 2Y3NA 2PR9A 2WO4A 1R85A 1PD0A 3P60A 2VXSH 3ZJ8A 5A6BD 4IP7A 2J5LC 3FCTB 4M61A 1FHNA 3S1XA 4AX7A 4UTKA 5F96L 1E4WL 4QRRB 4W70A 3T9WA 3VFWA 4JPSA 1MCSA 5GJTH 3WQ8A 1C5CL 2UY5A 4OCWH 2DIKA 2V30A 3EYVA 4MD5B 2X1OA 2E9JA 4FKHA 3BO8A 1OAKL 2K6WA 2E74C 3N41B 4H6KA 4XP5H 3FAWA 4XCEB 5INDB 3EJJX 4YDVB 1OGGA 5D9SA 1HC1A 3BLFA 4L4MA 4NUJB 3PTKA 3QPZA 5D4JA 3CSBA 1N64H 3S35X 3WDIA 1VYPX 4JRLA 3WFAA 1T4WA 3LGDA 4XP5L 1EZVY 4BEQA 3TFKD 1NY1A 2GOUA 2AJVL 3HNSL 3DKHA 4EF3A 4P2VA 5F9AC 2A77L 5ESAA 1XC6A 4ZFOB 3SE4C 4DXXA 4JR9H 4DP1X 1OQOA 1UXLA 5GJSH 5BRQA 4DP2X 4U10A 3RURA 3TYAA 4DWDA 2V2DA 3IV8A 4GW1A 4FYRA 3TIEB 5JDSA 1MDRA 2F54D 2ZWZA 1IQDA 1N67A 3F84A 4K3JH 3KPSE 4FJ6A 4LSQH 4XMXA 3TA3C 1CFMA 1XMWA 4EI6A 4X6BB 1S5WA 3HMCA 1KWGA 2SEBB 4JNYA 3MCYA 5C2BH 2J9ZA 3E5BA 4FFWD 1LCOA 4OQTL 2O5NA 4UAHA 4XAWH 4DJFC 3UTZA 1EZ2A 4Y9GA 1DVTA 2A1YA 4UIMB 4GXWA 3WL1A 1JF6A 5IJVB 1UWGL 1G4MA 1LK2B 3KH4A 1JPFA 2ZXDA 3GI8L 5BMWA 1U8OA 1QPPA 3IETB 3QDMD 1OHLA 4LHUB 5EPDA 5E09A 4ZQCA 1MCFA 4ZZKA 3UBHA 2FKPA 1EXHA 3GEFA 2HPMA 1PCKA 2XTSA 2I32A 5J4MA 1DLFL 1TYJA 4ORGB 1PSCA 2PTXA 4JQXC 3PCYA 5F4SA 5LHFA 3K74B 1UR4A 4YWGL 3FY1A 5EZPA 3ZRSA 2H6PA 4LCVA 5HPMA 3H2EA 4X42A 2CHWA 3WOVA 1OFPA 5BRBA 2OOFA 4LHJB 4UOZA 4X2RA 3X13B 1FIEA 4HPHA 2BP5M 1FL6B 3ES6A 2FYYB 3ARDC 3OKMA 4UDTB 1T0NA 4KK8D 4YBHA 5C0IA 5L0QC 1E6PA 1WV2A 4FAMA 1KCKA 3P2BA 4FMKA 5J3HC 1ZHBA 1AW2A 5CSUA 4O1DA 2FMNA 4N8PA 1E4MM 2G5WA 4Q9RH 1EJSC 4HFWA 2B7DT 2C13A 4Q74A 3W26A 2R0KL 4NQCA 4HLZG 1ZL1A 3LZFL 1A7QH 1TKWB 1VGKB 4XH2A 5EUKA 3B9NA 4C56A 4DPCX 2YGPA 1YEJL 4WEBH 4YHOH 1GVRA 2DZBA 1DVUA 2DW6A 2HVMA 4M61B 2ZD0A 3RLUA 4MAUL 1Z9AA 2YPKB 3RFZB 4B27A 4FNPA 4LMQI 1QLEB 5HHVH 4YOKA 5D72H 4O0KA 1LM8V 2HT2C 4PRDB 2EXYC 3PZIA 1EP3A 4GVFA 3GO1L 1FZKB 5HHNA 4GVHA 2D7TL 4HUNB 2FBJH 4YIWA 1FPTH 4QXUL 3UU0A 2J8UB 3NPXA 4LSSH 5L7XH 1KJVA 2BDNH 3MV7D 3NMEA 3LVTA 3F7LA 1CDCA 1K9TA 1W1A1 4HULB 3LS4L 2EJ1A 4JANA 4BHUI 4Y9PA 2DZAA 5KSAC 1XF3B 5EL1A 4TNWF 3PQYA 3HC3H 3ZE0E 2WPGA 4IRSC 4AYBA 5MEPA 1K72A 1U4EA 4KZDH 1Z3NA 2FIRT 1PZ1A 2PS2A 3O3RA 4DWSA 2XV0A 3PN8A 3O9WC 1QFPA 3ME0A 4ODTL 1HHKB 3WXWH 2VDNB 5KS9E 4ZUWB 2DD8L 2IGFH 3ZQ9A 4W7UA 3DIDA 3HNVH 3NFNB 5AVRB 2AC0A 1MY7A 4LU5L 4Y88A 2AV7A 4BA0A 1BVLA 1TCRA 3GBMH 3EKCA 2E4FA 3GM8A 2DT3A 3TYUA 1Z9SB 3ZU8A 2OJ1A 2VMEA 3CU1A 2PF0A 3ZDZF 3CIXA 1BM7A 3MJ7B 3VDBA 1OVZA 4DEUA 2DWDA 3EJRA 3P82A 1GQNA 4L9ZA 1YC7A 2HXAA 2X1SA 4NQCB 4HKBA 3V6BR 4F9PC 4G7RB 1OIFA 2B7QA 5ADOH 3TYCA 2DI8A 3QJAA 1Z48A 4HNVA 4JLRB 1IB5A 4A6YA 2PRHA 3UG3A 1ONRA 3GW3A 3WGVB 4FNUA 2APFA 2VXQH 2WLIB 2J88H 3RVXC 4AL8H 3ATBA 5AENA 3ISRA 5L8JB 2IPFA 1GEQA 5E5UB 2X4OA 3NZHH 5ACZA 5LWYH 5HJXA 4YHMH 1AR1B 4QHMB 4C56E 3MZTA 2OQYA 5KVFE 3SE3A 1IM9D 1MJ7L 4DH2A 4ICCX 3CIWA 1MPAH 3QJSB 3ARFA 5HDOA 1SY6H 5EGRA 2CGRL 4KFMA 5T9CE 5E94A 2EDBA 3NP3A 4N8CH 3TSBA 1PFOA 1E5CA 1FP8A 1Z5YD 1W72L 1B3YA 4UAOB 2O56A 1VSCA 2JLLA 3AG4B 1M56B 3ARDA 3DX1A 2YMXL 4AX3A 2XIDA 4PJEE 4ZFFB 1SBSL 1J05A 1HCVA 1QBMH 3MVSA 3N2CA 5I00A 5CLZA 1FNSH 1UYWH 4KX7A 2W62A 2CO6A 3CBJB 4H25B 2CITA 1EANA 3NJLA 4ZAKD 5CO1A 1JGDB 3GHBL 5JLZA 3CVBA 1ZUAX 1Q0YH 3TU6A 1GNXA 2BZCA 4KV5E 3MN8A 2I5YH 2UYLA 4LCYA 3D05A 4XNMB 3DK0A 1ZGLM 1MCWM 1YE6A 5FFOA 4J2PA 2BH0A 5LNVA 1REQB 3SGZA 1QUPA 4PJCE 2BC4B 4F58H 5C2XA 2P1FA 3Q2CA 2M83A 4QWWD 4MAYA 1SLWA 4ZO8A 4CSPA 2Z2AA 3KRUA 4K8EA 4H0LC 1JK8B 3D6GA 4XNZB 2KDGA 3FF7A 3GTVA 1KXHA 5B1BB 4A55A 1MRCH 4GG6F 2I17A 4KU1A 4R97C 1IBGH 3LB6C 3OIHA 2F53A 4J5NA 1XPGA 5KZMA 5GJSL 3DI2B 3Q8AA 3WH5A 1BXNA 2ZC1A 5FUOL 3F6IA 3GSXB 4G59C 4KETA 5KANG 2X42A 1BQSA 3SZ8A 5BNKA 3NPSB 1IR2A 2AJSL 1GTEA 2PZNA 1F76A 3I6SA 1YPZB 1FWJC 1SM9A 3P7YA 3RWEA 5AYYA 5TDNB 1RZ7H 4BM7A 1AP2B 4KO7A 5IVOA 4YAQA 1XIBA 4E9WA 4RNRA 5E6IA 1G69A 2J79A 1S78D 4DJEA 3MV8E 1KNOB 3B3IB 2WHVA 1XISA 2OWWA 4BCEA 1NDTA 4O4YL 4NQCE 3CAFA 2NY3C 3FL7A 4XCYB 3W86A 4JIPA 4TUUA 4F57H 5IJKC 1PIFA 2WQ8A 2ZCKH 1KGUA 2NUTB 1WCBA 2NR6C 1N8IA 4EXAA 4U3CA 1M9WA 5B8CA 4NRSA 1H7WA 4ZTPL 3QNYB 1BFTA 2FFCA 4JHMA 4OFCA 3Q8FA 1T21B 4PY8J 4QJ5B 3ULUC 2YCKX 1SNRA 4N9GA 3UGEA 3G04B 2OX4A 3C8DA 3WLWC 2C79A 4OCMC 5TGBB 1G7VA 3LVEA 3W7NA 2I69A 1DVSA 5TTRA 3S3GA 3EKLA 2GZXA 1KJVB 3LI1A 1HCFX 2FQEA 4FRWA 3RRXA 3OZPA 4GE8A 1PX8A 3MCKB 3KTSA 5A6LA 3KOYA 3JTSA 3RK8A 2UWEB 1PLCA 4U1MB 4URTB 5E99H 4H6RA 2FJFB 1FHVA 3O6AA 4XSLA 2NRDA 3GMRA 2BRRH 3GH5A 5D1QE 1GGCL 4UDUA 1MQRA 4XPGL 4OZHE 4YPGA 5KBLA 3ZR5A 2QVMA 4JN1H 3HJZA 2FB2A 3AREC 2VLJA 4K7PX 3GVWA 5C7HA 1IGIL 5E7FA 3S48A 5DJDA 3V4VB 3PFQA 5KTLA 1BV8A 4FEMA 4K3GA 2GY5A 2V6HA 3DK2A 5A7BA 2ADYA 2OXNA 2JH2A 4W5ZA 1ZTVA 3WMCA 2WQSA 3PWUA 4PU2A 5DURB 1KIQB 2XIJA 5T9BG 3M0LA 1H3UA 4JNZA 2EEBA 5E5RB 2ZZ4A 2OI9C 2PO6D 4RDQG 4EVZA 1ECQA 4JO4L 4TO8A 3FSTA 1RVFH 5I66B 4GXUM 4Z7WB 3WDPP 1W1PA 3AIUA 4OV5B 3QJXA 5CAYB 1MAML 1HZYA 1CVSC 1TR1A 3VUPA 4PS8A 3MRJA 2TRHA 3TBVA 4P46B 4G1MA 1AS8A 2WOYA 4BBWA 4BZYA 4E9XA 3QIWC 2F58H 1NFDE 3X11B 4WY0B 1JBJA 2XNAA 2DJXA 3W24A 1QAWA 2QZQA 3BOFA 2QVHA 3P2VA 3O0LA 3ARXA 4RJEA 3QUMA 4F3FA 1IBHA 4Y90A 1WBYA 5E6UB 4MA3B 2Z2UA 2EC9T 3C2SA 3Q6GL 5KOMC 3CAWA 4DYEA 3JU2A 2KZKA 2BSSB 4PTTB 4PJBB 4GH3A 1JCTA 3OBAA 4NYLB 4EI5B 4NHUB 4MCYB 5IQLA 2WXOA 3QWRD 4E42A 1XF5B 3CXHK 4LSUL 4E36A 1OYAA 3BAEH 2VC9A 1EDTA 3AYVA 1D5ZB 3FT1A 5I73B 3D48R 1GQJA 1KFKA 3Q3GB 1QPNA 2UXGA 5EU6B 4U33A 2HK1A 4GRSA 2V7HB 4N0UB 3V6OE 5C6TL 1U8HB 3JVAA 1D9KD 5FYJD 3WIHA 2E5BA 3IIPA 3T0VA 2ED7A 1QPOA 3CEPA 2K8QA 2RCSL 1VFLA 3DIPA 4ALDA 5AC4A 2R83A 5M95B 5JW5B 1BQ5A 1EGZA 1A9BB 5IOPB 3I50L 1Z9MA 3LXUX 4HIEA 4I18B 1DQIA 2DN7A 1MZHA 1NSJA 2ZKHL 2VUKA 3LZFH 3PTMA 1SYVA 1KCRH 1H5YA 5LIUX 1NELA 3SQBA 2O92A 1CLOH 1COBA 2DT0A 2IPTH 2NX9A 4XO7A 3B6SB 2WTRB 3G1SA 4FFVC 3OLIA 3E0LA 1JMXA 4OI9A 2UXVA 4MGXA 4OAWA 4HK0B 1TQJA 3QIUA 2GT9A 1S5IL 3EYFA 4F93B 2V2TA 4GZIA 1DBBH 5F88A 1AAJA 1UOKA 3IWPA 2PKDA 3PANA 4KJYA 4RZKA 3PJLA 1F90L 4WJ8A 4EIGB 3LJ3A 4L4VD 3DTUB 1X5MA 4WFFE 3HPAA 4I48B 3VW3H 5I30H 5JPMC 3PGDA 1MVYA 2Z7WA 3BZFB 4YZFF 2BRRL 1EEQA 2LQRA 4LLAA 1IBYA 2CKBL 3BFWA 3DMMD 3HEIB 5E03A 4BQ6A 4DKTA 1D7DA 2AJUL 1HUVA 2XN9A 5T1MA 1FV1A 5ESQA 2DIAA 4LLMB 4MCNA 2HTLD 1U93A 3F00A 4MZIA 5C0CE 2C3VB 4KRPB 2I7GA 4C7FA 3LTSA 5JIWA 1X4YA 4YR6B 5D96C 4KHTL 3UAFA 1SFSA 4OVXA 4YLBA 2NXZD 5IREA 2W0UA 3MRPB 5AW2B 4S2BA 4DQWA 3MRBA 1SJEB 1GZ1A 1THCA 3CCHB 4FQHA 2EZ0D 1ZLUH 5DUBB 3VI3E 5H2BA 1RIUL 3GS0A 3KH3A 4WGKA 3NL3A 2OCFD 4M81A 3X12A 2J75A 5D1XB 3AMLA 2KZHA 1XGRB 1TSHA 2APVA 2WLLB 2ZCLH 1J6OA 3R4IA 3ROLB 3BPNB 3DX5A 5C6WH 3QJHA 3B6SA 3GC5A 1WIPA 3RY4A 5A8NA 4XBGA 4ANKA 1ORQB 2J73A 4XPAL 1Q6GA 3HB3C 2NUYA 2QCMA 4PIRF 1O94A 4FOUA 3UXKA 2J55A 2CD0A 5A8MA 1DBKL 1GYWA 2XV3A 4OV4A 1W9BM 4NPKA 4O50A 4RNHA 4PS3A 4J3XA 2JJSC 3H8AA 5D2LF 4PJAF 5B4MD 1IGJA 3O11A 5FAAA 1MDLA 4LW7A 1D3CA 5ABFB 1BOGA 4Y4KB 2ZOKB 3HZMB 1A64A 1HHJA 1GYCA 2G37A 4ZFQA 1JDCA 4N25A 4E9QA 1A6TB 1FF5A 2PTDA 2B31A 3WBAA 4ZMAT 1P0KA 5HQMA 1MW1A 2FCBA 4HWZA 4WKFA 2J6EA 3DRTA 4OGXH 3CNYA 4D6EA 3T3ME 1BQHB 5KVEL 3BLOA 1EQWA 3VKDA 3X3FL 2NW2A 4HOZA 2P5EE 1DSFL 4PG2A 3WTSA 1GY2A 3ZXAC 3FYPA 3IIZA 4CNSA 4JPKH 1OD9A 2IDQA 2WUBH 1AD9B 4KI5F 5GZOD 2OT1A 1TPXB 1U6AL 3QIBA 1Q9OA 4PH6A 4YS1A 4RUBA 4G6KL 1ZLDA 1ZLWK 3MMTA 3DO7A 1AGEB 2X89D 4JAMB 4M5YH 5E1AA 5AKSA 2JKIS 1XLJA 1N5AB 1T04A 4ZFOA 3GE7A 4E41E 4JTUA 2JI3A 1X9UA 1QA9A 2DEXX 3D3VA 4KOCA 3SDXF 3O06A 3VKJA 3V0EA 5EFDA 3MRJB 3EOSA 1C7TA 4WGHA 1SO3A 4DJDD 4C4KO 5IMOA 4UTUA 4OKDA 1A4JA 3EZJB 4KGJA 1Y0LA 4LL4A 1GONA 1A5SA 2F7RA 1CTOA 1NFIA 4YL2A 3L4VA 4XZHA 1QUNA 2HT4D 4GKTA 1JK9B 3X14A 3UG4A 4LCUB 3UYRH 1TPC1 1N0XL 1S7XA 4P5TB 4TULL 3NJXA 1C8VA 1G4PA 3S42A 1S7QB 4NJAL 2OZ8A 5AYIA 4ODXB 3T0EB 3O8XC 3GDLA 4B9YA 1XCTA 3WIHL 2H8PB 3VGHA 2V9RA 3QJRB 3QULA 2HKAA 4WKXA 5IB2B 1EJUC 4OZFH 3F7QA 1DXIA 1HJQA 3W7GA 3UYOD 4OFIA 1GVOA 4PJ8A 2PWHA 3W39A 2PC8A 2ANUA 1QFUL 2OSLB 3ZKSD 1I8MA 1QR1B 1A14L 3STZA 1JV5B 1U83A 3TBWB 1ZPTA 4MJ4A 3QSKB 1JE6A 4UNTA 1UXSB 2A7RA 2H3BA 3ES7A 2HP4A 2ZZ7A 1CCZA 4JMXA 3V7MA 3RRAA 3QUKA 2YSWA 3DX9A 4PV9A 2ZFAA 4B3ZA 3CZFA 4PGCB 4R7WA 1FYTE 2V8LA 4KT2A 4NHVA 5E93A 3URAA 3NM3A 3URNA 4R26L 4E2DA 5CU5A 2KH2B 3LHUA 2DQTH 2ZG3A 3Q6GH 3PE9A 1E8YA 4NC0B 3LBMA 4PTMA 3VYNA 5ABGA 1RSCA 3S5OA 1AE6H 4NRYB 1A4AA 2OZ4A 5CCKL 3N44B 3KCWA 4IOSA 4QAWA 3EYFB 2V2TB 4UTWC 4PTUB 4PVMA 3C5XA 1PYMA 1VDGA 2Y85A 4QT5A 3UH8A 2WWCA 2OJPA 2A9DA 4PJHE 2A6DB 1DN0B 3CVHA 3LPPA 3ZE2B 2YBTA 3D5HA 3V6ZA 3JZYA 4XNZC 3LD5A 2GUOB 5C97A 2DJSA 3CZLA 3LXCA 3OGCA 1ZTXL 4R5VA 5HHMB 1R3IL 4HPYH 1OW0C 1M3UA 3LNMA 4JS3A 3K8MA 3K6SB 1I1YB 1GGCH 2YUVA 1YDPB 2AZUA 2W8CA 3EJZC 3EUUA 3NACH 4JB9H 4JRWA 4R9OA 2V9QA 4PMDA 4UNKA 4RZ5A 3CX5K 3MA7B 5EC1A 2PEVA 2ZJSL 2BP0A 5BVJA 4OZIE 3QQ9C 4JVUA 4OTKA 4X61A 4FHBD 3RHGA 5D32A 4IBSA 4G6KH 1CGWA 2VC2L 4GAJL 1CXLA 2ISDA 1Y8BA 7PTDA 5GS1B 1MG2C 1MEIA 2J72A 1P7HL 3VMOA 3A21A 3KYAA 3PWPA 1W6LA 1XICA 4BZ1L 1B3IA 4GVGA 4NLHA 4ATTA 1ASPA 5BOZG 4O2EB 3SGJC 2Z35B 3CZGA 4F2EA 3KP1A 1L7TL 5JPNB 1PKNA 1QSEB 4TN9A 4Y0GA 2QTVA 3KPLA 4R3SA 3CYVA 1RCYA 3HS0C 3LHWA 4N1HB 2M26A 3VIFA 4RGND 4OLYL 1L9PA 5IM51 2EIZB 3CGTA 3GFUA 4Z2HA 2MOQA 3HZVA 5HYIA 4M7LT 4OCLC 5DZLA 1OGPA 4HS8H 4F8OA 3ZKQD 1EMTH 3C6LB 4Y1AE 3ULUL 2MPAH 1AIFB 1GGYA 1O5KA 3RX2A 3BQUC 3F2CA 4JFZH 3GTIA 5LVEA 2IG2L 3WLHA 4S2SB 3WLLA 4WVRA 2AKRB 1U41A 3BZ5A 2CHDA 1WH0A 2VLJE 4V1YA 3UTPE 2NY1B 4PBGA 4J8RA 1QD0A 4MB1A 2DQXA 1KPUB 1CE6B 2HUHA 3UWYA 3Q2DA 4HGXA 5ID1A 3N0PB 2BOGX 4GQPH 4KRMB 1H5BB 4ADUA 3DXAB 2CIKB 2DQDL 3WQ4A 1KN4H 1OT2A 1KIRA 3EOTH 4ONGL 4XHQA 4F5CE 2V33A 4QAMB 5B3JF 1H7XA 1OCNA 1U3HC 1RJRA 3CZNA 3L4CA 2FPYA 1NANH 4AGLA 3WCZA 3C60B 1I1XA 1GW1A 2ZZUT 4MXVE 3PBMA 1MQQA 1TJ1A 3QMTA 4V2XA 1CBVL 1EPFA 2C1PB 4O0QA 1LD9A 3GG0A 4IOFD 1WBXA 4WWKD 3RLSA 3N85H 3MDWA 2EXWC 5KYYB 1SXSA 3U57A 3MO7A 3AROA 3NYZA 1O68A 3F5LA 3IE9A 4O57A 2LLGA 2EEAA 3D39A 2YWYA 1CN4A 1FVDB 1MLCA 3CN2A 1S7SA 4GRWB 3A6BL 4WW2C 3M0VA 2VR4A 4BWLC 5MHBA 5EUOB 5I26A 3ME3A 5DEGA 4F33A 3L95A 1AZNA 2F53D 3U0TA 1A02N 3TDFA 3LMYA 2MJWA 4ACTA 1ZLVH 3QIBD 4IRZL 1AKJD 1UWYA 1PZAA 4LBAA 2HTMA 3HAEH 5LDUA 4XKMA 3RM4A 3EHBD 2QBWA 3QDGE 4EMZA 4QRUB 4IGMA 1P7TB 3V55A 5MHSE 1MWOA 3JV6B 5AVSB 3P0VH 4F2TA 1YPZA 4MNJA 1EHAA 3ZLHA 2Q2LA 3WD2A 1BSIA 3C60A 3LV5A 5K9XA 3KJ4C 4HGWB 3UJJH 3JZEA 1CC3A 4GH7B 1HKLH 2DM2A 1MCDA 5FGBC 4BWUA 3TFCA 3L4WA 3GH4A 1BWLA 2HT4C 5C7XL 5ABHA 4K2UL 2YC1A 1DZBA 3BAEL 3SGJA 3CN0A 2V7NA 2WTPA 2VGBA 3V5DA 1CD1A 3BZ4B 5GRUH 2FZBA 2DSUA 1JZJA 4OJFH 1Q0XL 3WV0A 4E3VA 4JTKA 4Z1AA 5HJBA 4MNQB 1XLDA 4HIIA 4WXZA 2O5XL 3E2SA 5ITBL 5AVZB 4WX2A 3PWPD 3GG7A 3VG9C 3BGJA 4Q6JA 4AWTA 1BXBA 3T2QA 2AW2A 2GYSA 2F8OA 1V3IA 6A3HA 1ZLPA 3N1AA 7ENLA 4N2CA 2P26A 1F4WL 4JTHA 1JTPA 5CCKH 1XVSA 1YPXA 1E4HA 4X80L 1E7VA 2VQUA 5XINA 1EOKA 5D4IA 1LMKA 1CB4A 3GDMA 3ZDZE 3FQUB 3J07A 2XN9D 2D7NA 5MEND 3PJWA 4B9KC 4YYFA 5E6IC 1LLZA 3W83A 5HDRA 4ZUWA 2YXOA 1J9TA 2JB6A 4E4UA 3KVQA 1S7TA 3MV01 1EWDA 1PZ3A 4Z7UF 5SWUA 5KVFH 1NBCA 1AI1H 3HJ0A 1BYBA 3AY4A 3HUJF 4ANWA 2JIXD 2Y1VA 4GO8A 4J3BA 4YCPA 3GQFA 3QHNA 4HWNA 3ULSB 1RBLA 4HCLA 3L3HB 1CVRA 4O02L 4JFDB 1MHHA 3BSMA 4DO5A 5C9ZA 1HFUA 1AH0A 3S97C 5ANMA 3UYRL 1GXEA 1XL9A 2IKJA 2EZ0C 3AXXA 2FIKB 4NCC1 3AWEA 3BE7A 3OZYA 3QUHA 4XAGA 1U5HA 3D2UB 3G6JA 4M8RA 2B4CL 4K8RH 4O9HL 4R90H 1J1XL 5JBEA 1XDMA 4P4KD 1FL5B 2N1KA 3TF7C 3GZOA 4E9VA 1ZHKA 4X9YA 2QNEA 1KIUA 5E6SB 2JCCE 3MU7A 5G4OA 2JIWA 4K7VA 2YAPA 1SBBA 3ORWA 1IAII 4JDEA 2NY4C 1ZVSB 1H8SA 2POTA 4MNHA 2IAMB 3D4GA 2V3EA 1U3HB 3TEYA 4NQQA 5IVXB 3MLPA 3ILQD 3CSYB 2VDLB 1WWAX 3TNBA 4UTMA 4RDQF 3CFTA 3CU2A 4ZB2A 2V17H 3L3JA 3OKKB 3C5ZA 5HVHB 4LPXA 2R1YA 1A8ZA 4GQGA 2I9LB 2GFBB 1XGEA 3MMEA 5IJBC 1U8PA 3EF4A 3FB8A 2BERA 2HVJB 3KZ8A 4PUNA 1MCNA 1S7TB 2NUTA 3P3SA 4FDWA 4GXPA 4L3EE 4NZUH 3WK1A 4DJED 2K9UA 3VZZA 2ITEA 2QDDA 3TJXA 4GAAA 2J7GA 3UP8A 3L13A 4IOTA 1JV2B 1L0QA 3C9NB 3F2LA 4J2XA 4AXKA 2HLAB 4ADSA 2YPIA 1MFUA 2IFGA 5C6MA 4KK6D 3ZW3A 3P67A 3R4RA 4L3EA 3KYNB 1KBWA 2FH8A 2XPZA 1NDZA 3W1XA 4NC1C 3S96B 3CUGA 1GHFH 1OE1A 1A3RH 2FIQA 3DFNA 2B3IA 4G8EB 1CL7I 4XB7A 2BGSA 1TCMA 3QFDA 4NI6A 4DZHA 3DURA 1ALDA 1J11A 1F13A 1TT6A 4L5FL 4FP8H 2YS4A 5DVMA 3KXFE 3W71A 3NP4A 1B54A 3L5LA 1GMIA 3GBDA 3ONBA 5C0GB 4TV5A 4WF7A 1DQTA 6XIAA 2DH2A 4PJBE 4N68A 5D7JD 3DKLA 4ALAL 3N43B 2BSTA 4J9JA 4JQ3A 4PMVA 3A6BH 1IHIA 4LB4A 1YEEH 1H15B 1KJ2L 3IDJA 3NABH 5D4QA 4JM2F 3O41B 4M7ZB 2HMCA 3B8VA 1FJ1A 1QEWB 3VFOB 2UYLB 4XNMA 4Q56A 5T5FH 3Q58A 2O5ZH 2X53A 4RPPA 1LE5B 5JXEA 3TAOA 2ICCA 2HX8A 2W0PA 1D9KB 2VABA 1XEUA 4DESA 3CWGA 4CNNA 1JGDA 1DL7L 3X12B 2GJLA 1OTTD 5C0FA 4JTIA 3SDAA 4MNGE 3ATAA 4CW1A 4YWIA 4DGWC 1UWUA 3LNDA 5HVGB 3SKMB 3VFPA 5E0CA 4L5FE 5DRNA 4AB4A 3INUH 4MSWA 5I6PA 1NQ6A 3C6LA 2GGGA 3DMMC 3PPGA 4Z0XB 2EVGA 1H3TA 2Q20A 3QUGA 2UY7B 1V4YA 3SO5A 1PBGA 3QUZD 3UYPB 4W8LA 4PTDA 3WXVH 1ISXA 1X96A 1H9VA 5E6ID 4HSCX 4Q8WA 4ZENA 2XA3A 2IQDA 3KRSA 4K7FA 2XU9A 2ARWA 3G6AA 4RAVA 4U6VH 4ICXA 1TZ9A 3RPMA 4X4XB 2ZAGA 1A7RL 1HHKA 5EU5A 5C0EA 5DJXB 3SN4A 4G43B 2XZQL 3UWVA 1RERA 2J56A 3OC8A 3SOBL 3H42L 4E8CA 1U8PB 2BHYA 1JHLH 3FB8B 1B4RA 1VEOA 4TU1A 3QCUH 4GSXA 3WQFA 5GGTL 5AOUA 2RJGA 2UWEE 1CXKA 1JWMA 4CCZA 3ECBA 4ZPTA 2ZDSA 3SUWA 2YR3A 3D2UD 3FNKA 4XCEA 2YQBA 5EIIB 2A3LA 2SFPA 2HWZL 3EZ8A 3MA8A 3OA5A 3BQVA 1QEXA 3QZEA 2I9UA 3VFUB 1NTDA 2PMZA 3B8WA 4WWKB 3DFSA 5JU6A 3PZTA 2YSSB 3HN3A 3OAYH 3C5SA 1NLBH 2C1IA 4HZAA 2CGRH 3F4DA 2EXWD 1UWAA 4IRJA 2FL5B 4QYOA 1ZPUA 2MQCA 3T77A 1X97A 5KVGH 3NCXA 1B4LA 1JZHA 5CPLA 1ZAGA 1RUPH 2YCIX 5JPMA 3MO4A 1DO6A 1RY0A 1U8JB 5D70L 3TNNB 2EYTB 5CFAA 2NSOA 2Q7YA 4PD4K 2YL5A 3RPDA 3S36X 1J9RA 4KI5D 4MHHI 3T6XA 2JIEA 2NXYC 4AV5A 1U8LB 2JF6A 2LAAA 5D7LA 2A4EA 3U4BH 3SBWC 1M6OB 3O2VL 4FFYH 2C8NA 2EVIA 2V2HA 4RR4A 1G7JB 4TIMA 1YPZE 2I26N 2WYZA 3QXBA 5D7EA 1KBGL 2R2BA 4PJIA 1M04A 2VLKA 1KFBA 4KWUA 2YKLH 1ICQA 5ELIA 3CXHJ 4NO0A 4RAVB 3FN0H 4Z1DA 1H2JA 4D3CH 1UQSA 5FV2A 2ZA1A 1J0YA 1ZHLA 3ZO9A 2CALA 4Q89A 2AKZA 3TLRA 1GW9A 3CPGA 5ECUA 4A3UA 1I0DA 4MA8L 2WHLA 4DB7A 2BFVL 5IK3B 4KKNA 4QEEA 4C91A 1NKRA 4W4OA 3UA3A 5LBGA 4PV8A 8RUCA 3MYZA 1QSED 2ADGB 5E1QA 5D2NC 4ZAKC 3THMH 4PGJA 3V5FA 5ALCH 3RWFB 2HLFD 1F11B 2BNJA 1ZSDB 1J96A 1G9HA 1D7BA 4NKMB 5TE6H 1R3RA 1E9QA 2A4AA 5AW5B 4K6AA 1OYBA 2EDHA 4QXTB 1BXAA 1FNGB 2J2ZB 1K4GA 3GH7A 1JERA 2Q7NA 5B38A 3UZXA 4YBQD 4KRNA 1PL9A 2X4PB 3CV7A 1Q1JL 2BSCA 2Z92A 3LTVA 5EU3B 5T8IA 5IHZB 1YTKA 4KFZC 2VFHA 3EO9L 4NDMA 1W3IA 2WZIA 4IPNB 5HNRA 3M7SA 1T1XA 4WEMB 1SFDA 5GPRA 4UT9A 5IMOB 1QR7A 4JFFD 5I1IL 3TCLA 3BD3A 2OWXA 3LUTA 2X1TA 4KCTA 3Q5TA 4LS2A 4MY1A 2WNXA 5J13C 5AVHA 4J1UB 3ZN6A 1X5FA 2F8IA 3JS3A 5AHLA 2EIJB 1A1MB 4ZOCA 1AQHA 1BQKA 1KJ3L 1Q9LB 3EFFA 5CD5D 4K3JL 4LSQL 4O15A 4G2AA 4DM1A 3CASA 2G0KA 4FFYA 1X6NA 5GRXG 4K9EL 4HD9A 4CMHB 1NDWA 3BJFA 2DZXA 3S6TA 2Z4QB 2ESCA 1KFAL 3QIBB 3BRFA 5TQ2H 2E47A 2JKSA 3ZBMA 2VC5A 3MZ2A 4J3OH 2XY1A 5K9OB 2AHIA 4FXJA 1UWXH 1E27B 1N64L 3RG6A 2R9RA 5LG6A 1TTBA 1X39A 1QK0A 1BZQK 3BWSA 3TSDA 3G7TA 4KO9A 1MCEA 1DTNA 5E08L 4M6QA 2R69H 3M0XA 3V4LA 2LVCA 5FO9B 1R7AA 4WI9A 3KWSA 4OV6F 4GQZA 3EAUA 3CBRA 1EZSA 4YVNA 5AUMA 4HKZA 4Z42C 3JWDL 4BK8A 3KBWA 3AU2A 3FQRA 1ITUA 2XWJA 1SFHA 5JHDE 3TP4A 2XXMB 4PJ7A 3B0PA 1DANT 3GMPB 1Q2SA 4HZLA 1NCAL 1PZBA 4WI7A 4DP9X 1MI5D 2A99A 5LGHH 4MA1C 3UPRA 3DX3A 1LBLA 2DZWA 1NINA 3GB7A 3D46A 3DXAD 1LO0L 3PJSA 4JX0A 1OB0A 3UCDA 3LRKA 2Q76B 3RU8H 4WJKB 1NAMA 1JZ2A 2UY2A 1MI5B 1R9FA 3OYZA 1RAKA 2EKSB 4DAIA 5ENLA 5C09D 2IWFA 1IZCA 3S2AA 3EXLA 4HF5L 2F6UA 1M05A 4HISA 3I7QA 3CYJA 3Q13A 4OSUL 4WKZB 3WHE1 2F15A 4J23A 4LCCC 5AN7A 3P4NA 2V17L 2NY1C 3V7AE 5D2NA 1NPJA 3U36B 3VM7A 4KMLB 3VGDA 5DJ0B 5AWNL 1C9WA 4JHBA 1YO4A 4UB0L 3CUXA 1XLAA 4WV1B 5TQ2L 1KTRL 3H2CA 2JNZA 1IAIM 3GVGA 4DVRH 3N9GH 4G80B 2PP8A 1A4CA 2VQ1A 4J3VA 4H25A 4MJ5B 5IW3A 2WCAA 1M7DB 1J48A 3UO8B 3LKNA 3AHYA 4UFHA 4NNYA 3EYSL 3FMGH 3UP6A 5T3ZE 1NAKL 4BF7A 5GRYA 1FFRA 3B40A 3JWOL 2CZNA 4LE8A 3NR0A 3OPZL 3WLIA 1NBYB 5I1IH 3GIPA 2EIKB 1WBYB 2DI7A 3B0YA 2ZOLA 2Q02A 4DBEA 1VPQA 4CU7A 3CQPA 3N1FC 1OFQA 4N2GA 4M8UA 3U1SL 3ARDD 4WJG3 3UPRB 2CLZB 4RXGA 4GUPB 1OF2A 2J1YA 4O02H 4QHNA 4I9MA 3V0DA 1QSFA 4JTGA 3LZLA 1H15A 1XB3A 3HCVB 2VUYA 4DP4X 2OT0A 4R84A 1KTNA 4MPQA 3UNDA 5I3FA 1SW7A 2ZYSA 2LABA 3ESOA 1AGEA 4K15A 1NWTA 2ZRYA 4AEHH 1UG6A 5L2JB 2F8QA 2G30A 4R5TA 4G6AC 1EF2A 4P9MH 1I60A 2DLFL 1BW8A 3SGEI 1GVSA 2Z2BA 4LB3A 4TX9A 4MKTA 2X4SB 2OL3B 4QY8B 3E38A 2B1AL 3REWB 3PG8A 3H3PL 4QBXA 2ZPKH 3HB3D 5HY9A 3SKMA 1LL6A 1QPRA 4NNYB 1TZHB 2JXMA 1A4LA 3HG1A 4JFDD 3R7RA 1X8CA 4D6IA 4E3TA 1EP2A 4E41A 1WDDA 1JPGB 2YXGA 3RJYA 1DQLL 2ATPB 4QSFA 1N6UA 4LKCA 1RZ8A 4FEZA 3KR3L 5TJWK 1BIIB 4FYTA 5AOLA 3WIIL 4HJFA 4DUWA 4JO1H 4X7TB 3U0WH 2WC4A 2XN0A 1IIGA 2V67A 1JVLA 2C9XA 3TKFA 2K78A 3UC2A 3NDYA 4A04A 4WGXA 3WBXA 3PGDB 4ONHB 3NJJA 5KW9L 3GO2A 4QJ1A 4LSVL 4NPYB 4HIJA 2UZYB 5MENB 4C47A 1CLVA 2ZWSA 3MV9B 5FWRA 4HZMA 1YRKA 1FNFA 5D9NA 2FX7H 1EZLA 3DETD 1SO5A 1UFUA 4JX4A 4FB7A 3M1BA 2Z0BA 3PZUA 3RY6C 3BFQG 4AG4H 3LENA 3P3TA 5C86A 4HK5A 3SUUA 5EEZA 3CLEL 4PV9B 3WY2A 5D5MF 2OCJA 1E9YB 2CHRA 4RE3A 1TVHA 1U33A 2LU3A 4LOFA 3GZPA 3ZYJA 2ENPA 2BLEA 3B97A 1XGQB 1UKOA 1JI1A 1E3FA 1NPUA 4H9VA 3TBWA 2AANA 3K6IA 3CTTA 3QORB 3G6LA 3SUTA 1EJWC 1MFVA 1YLVA 4E8GA 1E50A 1AO7E 3OZKA 4AQ1B 3NG3A 3W2KA 3NN8A 3SKUD 3ZTJG 2YD6A 1G7UA 4RWYH 1T0MA 5F72S 5HHPB 4YHIA 5BO1H 2JKRM 3APFA 1Q9WB 1N0LB 3AT9A 3LRGA 4HXAH 4YVUA 4IPJA 3APCA 1WBXB 4LAUA 1GGOA 3VAEA 3HPLB 3RJXA 1ZU8A 2CLHA 5BO1L 2EAWA 4PJEF 1IKOP 1G7MB 2FE0A 3PS7A 4IRZH 2RJHA 4XK2A 2NUPA 3SGDH 2HE8A 4QRPE 4AXWB 3IDXL 1EFQA 4GX9A 3ESMA 5J5RA 1GOQA 1JJUA 2GWNA 3ALWA 5AALA 2PDKA 4EIVA 4XX1E 3DBSA 2DYPA 2APWA 3EKZA 4UC5A 3IJ6A 1Z3GH 1F97A 1I9CB 1IT9H 1SEBB 4FMVA 3QA3A 4JPKL 3ZUCA 1OEPA 4AGQA 1QTPA 4FX6M 1IFHL 4C58B 3LRSA 4Y8DC</