1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
5TD4A 4PMZA 3I3EA 4CN1A 3WIJA 4ACYA 2JE8A 1E6ZA 1AVAA 2WMKA 4WKFA 1CXFA 1ZU8A 2X2YA 1BYCA 4BQ2A 1W9UA 4B3KA 4B9ZA 1KGUA 3ARZA 1CECA 1CDGA 4D6CA 3TA9A 2CKRA 3GBEA 1Q6EA 3M6DA 5AYIA 2DEPA 3GXMA 1BF2A 5E6ZA 1VB9A 1ZBVA 1R85A 4DUVA 1KB3A 3BH4A 4E8CA 2W92A 3OA5A 1DWFM 2WHJA 1E4IA 1CTNA 1RP9A 1PIGA 3BAXA 3AS1A 2ZUUA 2OWCA 1GOIA 3CHCA 1EXPA 2J25A 4H04A 1GNXA 2VQTA 1GOMA 1E0XA 3NSXA 4UZUA 1LL4A 1KGWA 1W1YA 1QPKA 1ZS2A 3AZSA 1FH9A 3WF4A 2Z1SA 1KR1A 2GDUA 1HKIA 4NSBA 1UH2A 1UKTA 1W9DM 2DIEA 3BAWA 1B2YA 1X6LA 1JZ3A 3K4AA 4UQDA 2XVGA 5A8MA 3POHA 4M82A 1J12A 5HNNA 1E5JA 4KGJA 2VUYA 2QLYA 1I1WA 4PMDA 4CD8A 2J74A 4HZ8A 2ZUNA 4D6EA 2VC9A 1E4MM 1ISVA 4R27A 3PZGA 1QW9A 4D6DA 1HP5A 2CBJA 1UZ4A 4GPNA 2WSPA 1CYGA 4EANA 1GVIA 5GNYA 3W0KA 3SCWA 2YLAA 5CPSA 1Z32X 4B15A 4D6GA 1G0CA 4W87A 5DT5A 4AIUA 1C3FA 2WC7A 1JIBA 4OOUA 3EMQA 2GVYA 2BVTA 3CLWA 2CHOA 2VCCA 1J01A 2WCGA 1TR1A 3ECQA 3KZSA 2WLYA 4PMUA 4MDOA 4KH2A 1WZMA 3WNOA 1HKMA 4TVUA 3AMDA 2VX4A 1PZ3A 3FNDA 5LA0A 3VD7A 1OB0A 2W63A 3N11A 4HPGA 2GUYA 3ARRA 3AMGA 4CD6A 1CXLA 2G3MA 1KCLA 1QNQA 4AC1X 1HJSA 3M46A 2XWEA 4CD5A 4OOZA 4ZFMA 4UQ9A 4U2YA 3PN8A 1LG1A 2WZEA 2BXZA 1LWHA 1UR8A 2J8GA 1AQMA 5F7UA 1FHDA 3CMJA 1XSKA 2FDMA 1J0IA 1V6VA 4DWSA 1CGYA 2BNJA 3ARQA 3T2PA 4H41A 1V03A 1E6SM 1EIBA 1VFFA 5A94A 1ZJBA 4PCSA 1GOKA 1QI0A 1W3HA 3HJEA 3RJXA 1KXVA 4XZWA 1DTUA 4A3HA 2YA1A 4UCFA 4HOZA 4WSJA 1JZ5A 3F5LA 3BAIA 4CD7A 4L4PA 1PX3A 1B0IA 5A6SA 2FGZA 4UFLA 2FHBA 4W86A 3EBVA 1E6NA 3DHUA 4AD2A 1KQYA 4Q22A 5DMYA 4CUCA 2ZOXA 3A4WA 1XSJA 5A2AA 4AZ5A 4S3KA 5IDIA 4FF5A 1JNEA 3BMVA 1OGSA 1V3MA 1P6WA 3TTSA 1KWGA 5HDRA 1HVXA 1FHLA 3IJ7A 3NSNA 1JZ2A 1W9PA 3RM4A 4H8HA 4CCEA 5C8BB 3ARUA 1QHPA 3CPUA 2VX6A 5ABFB 3VO0A 5D8WA 5A6BD 4QP0A 5HXMA 1NWRA 1KFWA 1QNPA 1PX8A 2Y24A 5CZKA 2Q8XA 5A8NA 5JBFA 4FK9A 2D22A 5KZ6A 3MV11 3DECA 1UR0A 3JUGA 1KBBA 2PWDA 3VDCA 3CZGA 2FGLA 3UR8A 3T0DA 4UR9A 4YHEA 1G94A 3VM5A 1UUQA 1W2PA 4JFWA 4D1IA 5D4YA 3WH7A 5A2CA 4ML4A 4H8UA 1GVYA 2GJXB 1JF6A 1E0WA 3WDQA 4KRTA 4IPLA 1ODZA 1V3LA 5GNZA 4W88A 3UG4A 1WZLA 3OIHA 3W24A 2YL5A 3UCQA 1FH7A 1ZBCA 4P7OA 1B3WA 3W53A 2AOSA 3NDZA 1M7XA 2CETA 3K1DA 3WFZA 3WL1A 1PZ2A 2X0HA 2OSWA 1RH9A 1OIFA 3WQVA 3ZSTA 1VF8A 3WMSA 1B3YA 3GXIA 4HOWA 2GK1A 4OJYA 1V6UA 2AMGA 4OKDA 2J7GA 1QHOA 3CUGA 4ZENA 1DWHM 4X0NA 1WZKA 1UR2A 3WQ5A 1D2KA 4Z2HA 4MB1A 4EKJA 1C8YA 3W29A 3VD3A 4D72A 4QLLA 1QNRA 4DUXA 2XVNA 2YIHA 1TG7A 3CZLA 2MANA 3VGEA 3KL0A 3WNNA 3IAQA 2OYMA 3N18A 2XWDA 1JAKA 1HJUA 3SCQA 3NIYA 1UKSA 4DWSC 1M53A 1E6QM 1A3HA 1C90A 4N0RA 2XJ7A 4KMQA 2J7HA 2J79A 1JXKA 2DH2A 1BYAA 3CUIA 1WZAA 2WAGA 1GHRA 1LWJA 2BHZA 4ZXOA 2YLLA 2ZX6A 3LPGA 3TTOA 3BSGA 4U5IA 2GDVA 5A95A 4J3VA 4EK7A 3IJ9A 3WUBA 1NOFA 1TFVA 2W67A 4CU7A 3ZR6A 3CZJA 2V38A 4MTVA 1NH6A 3MMDA 3N17A 3ARYA 3QR3A 3W28A 1E6PA 2WBGA 3PZ9A 3VINA 3VMOA 2D2OA 4HA3A 2RGMA 3VUPA 4UFHA 5DFAA 5CPTA 2YDRA 1H11A 2XG9A 4AMCA 1EDTA 3FHQA 3GDBA 3CUFA 3AZRA 1JG9A 4TTGA 1U2YA 3MUZ1 4W8BA 2WVTA 4J27A 3LMYA 5D9OA 4Z2JA 3EDKA 2VQUA 3W37A 1QI4A 1XHGA 3N13A 3SCUA 2BXYA 1LL6A 4Q7NA 2GJPA 1ODUA 4YPJA 4GQRA 5KEZA 4BQ3A 2V5DA 1CZ1A 1VEPA 2ZIDA 4GINA 3NSMA 3WNKA 2DSVA 5BXSA 1XC6A 4GZEA 4C7GA 1XD0A 1HT6A 4CCDA 2PWGA 1BAGA 2PWEA 3NJ3A 3AHZA 3PHAA 3VGDA 2EO7A 3WUEA 1H0GA 4LYQA 4OBSA 4HU8A 3A47A 3PZOA 2OYLA 3WF1A 4AD5A 1NM9A 4HA1A 4M24A 3S6TA 4L4OA 2OSYA 1BGGA 4LX4A 4KGLA 3W6LA 3TTYA 3W81A 3ZQ9A 3B9DA 1MYRA 1UD2A 3WMCA 3WD4A 2X09A 3WF0A 1TA3B 2YA0A 4JCMA 5FD0A 5A6LA 3CZEA 5I23A 3PTKA 4BQ5A 4OZOA 2A3BA 4AIOA 1R8LA 3GZAA 2NT1A 1US3A 1Q6GA 1W3LA 3AXHA 2JIEA 1W3KA 1CIUA 2PF0A 5E9AA 1E6RA 3W26A 1M03A 3OLGA 1H09A 2ZX7A 3CBWA 1H1NA 3VIPA 3SCOA 1F4HA 2V3EA 1WNOA 3FAWA 1FOBA 3VGFA 3WN6A 3SCVA 3GH5A 3F5JA 2J77A 1WDQA 1OM0A 2RGLA 3WEOA 4CN6A 1B9ZA 3II1A 4UQEA 5BRQA 4JFSA 1E40A 1W1PA 4HTYA 1FP8A 1BSIA 2VR4A 1E3XA 2OLHA 1UWQA 1GONA 1VENA 1JAEA 1NWUA 2XFYA 3WF2A 2HVMA 3D3AA 3DHPA 1L8NA 3THDA 2OSXA 1NOWA 1C7SA 3GM8A 2G3NA 4NZCA 5LA2A 4V27A 1BFNA 1PBGA 3EDFA 4ZE5A 1MVYA 4S3JA 1GPFA 4J3TA 2VMFA 2QPSA 4MNJA 4CD4A 4TVDA 4JFUA 5ABFA 1LG2A 4OBRA 3AZTA 3PBGA 1HXJA 4FMVA 1BPLB 1DWAM 1KXTA 2E9LA 4WKHA 7TAAA 1UR9A 1I1XA 7A3HA 2JEQA 5I3DA 3THCA 2VZOA 1FP9A 1WP6A 4UOQA 5I6SA 1UD5A 2XVKA 2WK2A 3W6MA 4AD3A 3MUAA 2EBNA 2GK1B 4PN2A 5HPCA 2GJXA 4XB3A 1E0VA 3WDRA 5E70A 3CH9A 3ARVA 1H5VA 1TZ7A 1BTCA 2VZVA 3RM9A 2YL9A 2VNCA 3FN9A 8A3HA 2YDSA 4HA4A 1MW3A 1JDCA 1UWTA 3M07A 1IZJA 2WZIA 5JIWA 3GYCA 4HMEA 1DHKA 2WVVB 4W8LA 2WXDM 1HL9A 2EQDA 1WO2A 1XRVA 3EDEA 3OG2A 5BYWA 2W91A 4W5UA 4W7VA 3RILA 3IK2A 3VNZA 4GQQA 1LF1A 1Q6FA 3WKZA 3NDYA 2E3ZA 3UETA 1M01A 1JDAA 2UY3A 4TOQA 3WNMA 5LA1A 3O9NA 4YN5A 1ZBKA 4AZGA 2XM2A 2D3NA 1CGXA 3WF3A 4H8VA 2OWWA 3PZIA 2JEPA 3NYDA 3WEMA 3S2CA 1R7AA 4E4PA 5BROA 3SCNA 1A47A 1JYNA 2JFEX 1SMAA 2NW0A 4QDMA 3VMNA 2VOTA 4JFVA 1WDRA 4B16A 4QAWA 4MB3A 1ISZA 5A8PA 1B3VA 4RE3A 4C90A 3N9KA 2VT0A 1JI2A 1V02A 1W9XA 5BXTA 3AICA 5BRPA 3VMPA 3VIHA 4D1JA 3PZUA 1EGZA 1I75A 3CHEA 5LYRA 3F4VA 3L4VA 1K9EA 3AS2A 3D5HA 2BY0A 2XFFA 5AC5A 2O9RA 2DT2A 3WQ4A 4BF7A 3WENA 1X1NA 3CTTA 1W2VA 4V28A 3AROA 2J7FA 2X8RA 4B3LA 5FL1A 3VDHA 3DYPA 2VZTA 5EMYA 1ZL1A 3AI0A 1J0YA 2ZXQA 1UZ1A 1EH9A 3BCFA 2CEQA 4M80A 4AD1A 3VU2A 2WM0A 3WMBA 3AIVA 3QHOA 3EDDA 4LYPA 4DWSD 3L4UA 1MFUA 4Z2GA 3BC9A 2F61A 2VZUA 1W1VA 2D0HA 2ESCA 3ZT6A 5IHSA 3FAXA 2BFGA 1NWSA 3IAPA 2VRKA 4BCEA 3TP4A 1XCXA 1OINA 3QOKA 1IV8A 3K4DA 4AZHA 5I79A 3MV01 4Y7EA 1KQZA 1OGGA 2G4FA 1OBAA 4WLCA 2UWFA 4PMYA 2ZUTA 1BG4A 1ITCA 1O7AA 1E4NA 3VIFA 3OZOA 3T09A 1IT0A 1TA3A 2VURA 2QHAA 1EHNA 1UD3A 4H2CA 2CYGA 2WW5A 3APGA 1GW1A 3MSDA 2E0PA 2V3DA 5AC4A 2O9TA 3BMWA 3KL5A 3OLEA 1J9YA 2ZX9A 2W66A 4ACZB 3VGHA 4GI8A 5JUVA 4J3UA 4AZ7A 1AQHA 1E3ZA 4TTUA 4PSRA 1HJVA 1PAMA 2CBVA 1OIMA 4GZIA 3PZMA 3WL0A 1S46A 1PJ9A 3VGGA 4UFMA 3BAYA 1WCGA 5A8OA 2WVSA 5M3WA 4C7DA 2PC8A 3AHTA 1HP4A 3WD1A 4FLQA 4PMRA 3ARSA 3CHFA 4M8UA 1WE5A 2WNWA 5E0FA 1UWRA 2VRJA 5A6JA 1EA9C 3RO8A 4UFKA 3L4YA 4TX8A 4A3YA 3VX1A 1KXQA 3ZM8A 4NRRA 1JZ8A 1JFXA 4ZXLA 2C8NA 3WD2A 1QOXA 4UQCA 3AS3A 1CLVA 4GZJA 3SCTA 1JNDA 3SURA 1CGUA 3B9EA 1XV8A 2QF8A 2UY4A 3ARXA 3T2OA 3WH6A 4AWEA 5CLWA 1QI3A 1ECEA 2GSJA 2ZX5A 1V3JA 2DT1A 4J3XA 4J3WA 4P8WA 4BQ4A 3AISA 3N12A 5A6BA 1HF6A 4U3AA 3CO4A 3WFLA 1H3GA 5FCZA 2D23A 2YJQA 5DEZA 3WSUA 3U5YA 1B3ZA 2ZXDA 4P8VA 1EO7A 4UFJA 2X05A 4URIA 4AYSA 3T0BA 2FHCA 5M5DA 1VAHA 3ZSSA 2GJRA 3WY1A 4BS0A 4XUYA 2QMKA 3SUTA 3RM8A 5HPOA 3RMEA 2WVVA 1XYFA 2PWHA 1DWJM 4AZBA 1UH4A 3OZPA 3AXXA 3AYRA 3MSGA 4IISA 1KXHA 2J8FA 2DPEA 3WDPP 5ABGA 2Y5EA 1XH0A 3LPOA 4NRSA 2CKSA 2BS9A 3W27A 4PMOA 1R86A 2A3EA 1DWIM 2YL8A 2XVLA 3AIUA 2YKKA 2CCRA 2WB5A 2VX5A 1JD7A 1MW2A 1MQQA 1QBAA 1UH3A 3WUGA 1E55A 4PSPA 1MQPA 2XVPA 1B31A 1MFVA 5JBEA 2CPUA 1MWOA 3DC0A 3UG5A 2Y8KA 4AY1A 2A3CA 3BAKA 1DEDA 3SUUA 1J0ZA 1WPCA 1F4AA 1HKJA 1E4LA 5I2UA 2J7DA 4UTFA 3CZKA 1VBRA 3AS0A 3OLDA 1MW0A 1SMDA 3AMLA 3SUWA 1HX0A 1HIZA 2XPKA 4UQAA 3N1AA 3UEQA 4X9YA 2PBOA 2DDXA 4IPNB 4PMXA 1PEZA 4CCCA 1BG9A 2CITA 5A1AA 4CU8A 4HMDA 3BSHA 2HISA 5FIPA 3AYSA 2WLZA 1UWIA 2ZICA 1ITXA 2A3HA 2EPMX 1DWGM 2Z1KA 5I77A 3VD9A 1EOKA 4AD0A 1PPIA 1US2A 1GORA 1WAWA 4RL3A 4DUWA 5A2BA 3W82A 1HJWA 1JDDA 2BVDA 2BHYA 5M17A 2YBTA 1BQCA 2Y2WA 1NQ6A 1E1EA 2YL6A 1LQ0A 1E5NA 4JHOA 1V0LA 2EPOA 4PTWA 3G6LA 2OYKA 1GHSA 4D6HA 5HOSA 2ZXAA 3ZJKA 3QGVA 2DSUA 4ATWA 5A6AA 2W62A 2DT3A 4KWUA 1Q4NX 3IANA 4TUFA 1E56A 4XZBA 4PMQA 4JHZA 2VVSA 3EYPA 5CXPA 4GO8A 9CGTA 3SCPA 3ZJ6A 4PTXA 1K9FA 3ZT5A 3UESA 5FL0A 2DQXA 2XIIA 4U3CA 4N42A 4GXPA 2VI0A 4M29A 1HVQA 1H2JA 1E70M 2J7CA 3AOFA 4MAVA 4OIFA 3RCNA 3NUKA 4P7LA 3RPMA 4P8XA 2C0HA 2PB1A 4PMVA 4CKQA 2QPUA 1EDGA 1Q6CA 4Z2KA 1V02E 1EOMA 1Q6DA 1SFSA 4ACZA 4LQ1A 3KL3A 4FLOA 3VOCA 1B30A 4W5ZA 5GNXA 1OSEA 5EB8A 2CIPA 2WCAA 1NARA 4UNIA 2ZWYA 1W9VA 3TTQA 4UQBA 1VRXA 3WD3A 3DYOA 1CGVA 5EFDA 1O6IA 3BLKA 2JIWA 1UD4A 2CBUA 2VRQA 2E4TA 2WANA 3PZVA 2WWCA 4AISA 4P7RA 2Y8VA 2W5FA 2VO5A 2E8ZA 4MB5A 2IXUA 2VCAA 1GJWA 4AEFA 4DM1A 2UY2A 2D1ZA 4QFUA 5FKYA 1EHAA 1V3HA 3AIWA 1MXGA 4ZE4A 4BA0A 3SUVA 2XSBA 2WCSA 1HJXA 4OUEA 3WD0A 4DM2A 1TVPA 1HL8A 3CUJA 5I0DA 1ZBWA 1JI1A 3OGVA 1RPKA 2J4GA 1UOKA 2XGIA 5CSYA 4GO9A 3OGRA 3VDBA 4F8XA 2OWXA 4KRUA 4BZYA 3K8MA 3ARWA 4W8AA 3U7BA 1R87A 3CIVA 4YHGA 3MS8A 3WDIA 5JBDA 3WNPA 3AXIA 3KE0A 5C71A 3AMCA 2A3AA 3VVGA 1ISYA 1VEOA 1J0KA 2VR5A 4NF7A 4W85A 5ABEA 3VD4A 3T2QA 3W38A 1J0HA 4M1RA 2E8YA 3GTNA 1W1TA 1V6YA 4JFTA 4V2XA 1R7OA 2WMIA 5HBFA 1U33A 3LPFA 5E6YA 4WK9A 1HKKA 1VFOA 2WZHA 1GZJA 3K8KA 2VCBA 1C8XA 3BXWA 3ZJ8A 1CXEA 5D9PA 2J47A 3WELA 1KCKA 3PZQA 5BCAA 1AMYA 2XFRA 2NSXA 3ALGA 1J11A 4XX6A 2CXGA 1BHGA 1H4PA 2WKLA 3QHMA 1LJYA 3AIEA 1KBKA 3RIKA 3EDJA 3L4TA 3CMGA 2VZSA 2WPGA 2ZUVA 4HU0A 2G41A 1VJZA 3AHYA 1XYZA 2W4XA 4NI3A 1QW8A 1QVBA 3ZO9A 5IHRA 1UHVA 1W3JA 2V5CA 1EO5A 1E72M 3WUFA 1G1YA 2CERA 2XYLA 3ZMRA 5CPQA 4JIEA 1JGIA 2J62A 1NWTA 3VM7A 3WNLA 3MUY1 3VGBA 3DYMA 5E0CA 1CXKA 4PBGA 1FFRA 3VKKA 5C70A 4W84A 2J78A 4W7WA 1GQLA 1ESWA 4FLRA 3MKKA 4GKLA 3AIBA 2CESA 3ARTA 4H7VA 4F9JA 5A6MA 2XHYA 3OGSA 2D0FA 1UG6A 2WMJA 1XCWA 2D24A 4J7RA 4A4AA 5I24A 4WSKA 4FLSA 3QOMA 1W91A 4PCTA 3VIIA 1JF5A 5A3HA 5EBAA 3GNPA 4MADA 1V3KA 4MNLA 4D6FA 6A3HA 1X6NA 5FOOA 3VTRA 4UOZA 2IXVA 1JZ6A 4Z2LA 1HJQA 1JYVA 4GI9A 2CBIA 1C8QA 2W61A 1ZB5A 4AXNA 2DIJA 4AEEA 4CU6A 2XGBA 4HOXA 1TCMA 1MXDA 3ZJ7A 3AHXA 4QLJA 1UA3A 3PTMA 3VIGA 5CSUA 5JIPA 4JZ5A 2DSWA 2EPLX 4JKKA 5D8ZA 6TAAA 2VJXA 3CZ8A 1BYDA 1H0IA 1YHTA 3FY1A 2D0GA 2ZX8A 3WQ8A 1HNYA 3HU7A 4HZ6A 1UKOA 1E71M 1N82A 1PIFA 1UYQA 1WKYA 2EPNA 3T08A 1UA7A 2WSKA 3O2LA 3VX0A 3E1F1 4JCLA 4IUGA 3ARPA 2J7BA 2ZXBA 1B1YA 1NOUA 2WMGA 4M56A 3VIKA 3IJ8A 2YA2A 1C91A 2DH3A 4U31A 4PRWA 2WHLA 3F5KA 2BV9A 5IFPA 1CNVA 1E15A 2QV4A 1CWYA 4AZCA 1V0NA 4EE9A 3HN3A 2WYSA 2XSAA 4ATLA 4LGXA 1ISXA 3BGAA 1C7TA 3AJ7A 3UR7A 1JL8A 2PBGA 3VILA 3WBAA 3A4AA 3PTQA 3M7SA 1FH8A 4P7QA 2O9OA 1D7FA 3L4WA 1BVNP 1V6WA 5ABHA 1C92A 4Z2IA 1OCQA 1HN1A 1JZ4A 3LPPA 1K9TA 2E40A 2WC3A 1OD8A 4JAWA 3O6AA 2BY1A 5BXPA 1ISWA 3UERA 1C93A 2CNCA 2EXOA 1U30A 2BY3A 3W25A 1K6AA 4U33A 1MQRA 1CLXA 5GPRA 4F79A 4WF7A 4RE2A 1PX4A 2WWDA 2E9BA 1KR0A 2O92A 1LLOA 1J18A 2BY2A 3I3DA 3GNOA 2EEXA 3A3HA 2WBKA 1W9BM 4HZ7A 1V0MA 2JF7A 1QI2A 3RDKA 3MMUA 3BAJA 4MJ2A 3FW6A 1VIWA 1GOWA 3AQUA 1GQJA 5AYBA 3SUSA 1Y7VA 3CGTA 4AD4A 1WDPA 1TUXA 1E43A 3GNRA 1J0JA 3VIMA 3EMCA 4WIWA 1V3IA 4MNMA 1OD0A 1V0KA 3SCRA 4MJ4A 6CGTA 4WJXA 1DP0A 3AHVA 3UG3A 1CGTA 1FFQA 4HP5A 4C7FA 1J10A 1QNSA 3GH4A 3SEPA 3N15A 2WMIB 1XGZA 3ALFA 3GXDA 1XD1A 3HMCA 3NCOA 1UQZA 3W4RA 2FH8A 1XH2A 2YBUA 4LXFA 3MO4A 1EDQA 5ECUA 3WQWA 4CVUA 2AAAA 4QCFA 4PUEA 3T0AA 1EQPA 5DF0A 2ZE0A 5M03A 1B90A 2FH6A 3B9AA 3J7HA 3ZOAA 2G3JA 4D6IA 2GFTA 5CGMA 4AZ6A 1XH1A 4EAMA 1GOOA 3FHAA 2NT0A 4UFIA 1H41A 1VFUA 5CQ1A 3GH7A 3WDHA 2WMFA 1CBGA 2DT0A 1M04A 2PWFA 3FXYA 4JL2A 4F66A 2WVUA 2D20A 2O9PA 4C91A 1K9DA 1WB0A 1IZKA 2D3LA 1QHZA 1VFMA 1E73M 3K46A 4W89A 4ATDA 2F8QA 2XM1A 4MPKA 5BXRA 4CGTA 3OB8A 1BYBA 4M81A 3VD5A 1LL7A 4J28A 2CHNA 3BCDA 1RP8A 3PZTA 3WDJA 3VIJA 4HMCA 4JL1A 3KEHA 1SYTA 1VBUA 2G3IA 2WMHA 5CLTA 3TONA 2F2HA 1YQ2A 1CENA 1WDSA 2QMJA 4CN4A 3MU7A 3PZNA 1JXJA 5CJ5A 3SCSA 1CEOA 4QLKA 4AW7A 2V3FA 1BVZA 5A6KA 2X0YA 2JALA 5D9MA 4PUDA 4JKMA 1L0PA 1VEMA 5E09A 5I5RA 5I78A 3WH5A 1GQKA 2ZWZA 1UKQA 4QCEA 4U5KA 3VPLA 1FA2A 4GIAA 2WHMA 1BGAA 1G01A 4IM4A 3G6MA 3CHDA 2VL4A 2WC4A 2X1IA 3QHNA 3AIRA 1G5AA 1ZJAA 1JYXA 1JD9A 2FHFA 2G8ZA 4HPHA 5GQBA 4E2OA 4TXEA 4X0VA 5DT7A 3U5UA 1EQCA 2VTFA 1QNOA 4WKAA 4PMNA 3L2LA 2YDQA 4PTVA 1UWUA 4PEEA 3EMZA 1G9HA 2XIBA 1UD6A 2JF6A 1JZ7A 2C7FA 3VIOA 3VDAA 4B9YA 1GJUA 4W93A 4J3SA 1OWQA 3I3BA 4PYSA 3GBDA 4LYRA 7CGTA 4K68A 4PTMA 1CXIA 4MAZA 3ZT7A 1AQ0A 1GUVA 4DWSB 3AFBA 2BVYA 1B3XA 2V3GA 4MB4A 2EJ1A 2DSKA 2VX7A 2ZUMA 3CUHA 1V08A 5DO8A 3U7VA 1KGXA 2WHKA 1OT1A 3K8LA 5CGTA 4AZCB 1OT2A 1E9LA 1UQYA 3L4ZA 4UZSA 1CXHA 3AMKA 4UOJA 3TOPA 3VNYA 4TVCA 3GXFA 3MUIA 4AIEA 1NP0A 1V6XA 1XSIA 2J75A 3U57A 2BHUA 3MANA 4E8DA 3L2MA 3L4XA 4F9DA 2J7EA 1JYWA 4RE4A 4P7NA 1H49A 1D3CA 1W32A 4P8UA 4R5EA 1UR1A 5AY7A 3WH8A 5IFTA 2UY5A 2YOCA 3WH9A 4MDPA 1GOQA 3A4XA 4LPCA 2ZUSA 3ZIZA 5D9NA 3WQ6A 1CPUA 1JFHA 3SIMA 3RJYA 4TX6A 1E6XM 5A69A 2VVNA 5IXEA 3WBEA 3KWXA 3OLIA 1NP2A 1GCYA 3OBAA 1RD6A 1TE1A 1KWKA 2EPKX 1UWSA 2PI6A 3ZR5A 3AIQA 1OGBA 4D71A 1UR4A 1QI5A 3BLPX 4W7UA 1QBBA 4AZIA 2B31A 2DGAA 3POCA 8CGTA 2ZUWA 4CVWA 3WEZA 2XUCA 4MNKA 5EFFA 4D6JA 3MMWA 1SR0A 3N04A 4XV0A 2Y4SA 1UKPA 1E1FA 1MW1A 3B8SA 1UD8A 4JKLA 2DSZA 5CG0A 2XTKA 5A8QA 1GQIA 2IUZA 5BWFA 1VJSA 2E9MA 3A6OA 4GI6A 4ZEPA 1BLIA 2TAAA 4U2ZA 1CGWA 2WKGA 1TMQA 1TVNA
chains in the Genus database with same CATH superfamily
1XLBA 1ZRQA 5G1MA 3UWYA 1W5NA 4PZVA 2WMKA 1CXFA 4XZHA 1POKA 1YBQA 1W9UA 4B3KA 3NDOA 3ARZA 2R94A 7TIMA 1XR2A 4D6CA 3GIQA 3GBEA 4JGDA 1I4NA 5AYIA 1BF2A 1A3WA 3MT1A 5E6ZA 1VB9A 2FFCA 4E2DA 2C19A 2EKCA 4LY8A 4NAFA 4ICMA 3W07A 5HR7A 3HOJA 3BH4A 2R1MA 4MY1A 3OA5A 4P61A 4YJ5A 3KBVA 2ZUUA 3CHCA 1GNXA 1TPB1 1GOMA 1E0XA 1VFSA 4GCXA 4MLJA 1AK5A 3V18A 1Q4WA 3KXQA 4UTMA 3V1PA 1XFBA 1W1YA 2PDWA 3UWEA 1ZAHA 4YXGA 4JTQA 1XIFA 3UGVA 4M6PA 2WZTA 3BAWA 1RZMA 1JZ3A 4NZ3A 1OY0A 4JX6A 1KA9F 3BVJA 2DUXA 2FJUB 1KW1A 2J74A 3E0VA 2VC9A 1E4MM 3HZ3A 1ISVA 1QW9A 4DHGA 7ENLA 1UZ4A 3TFXA 3UCCA 3GS6A 3FGCB 2QJGA 3KP1A 1QWGA 3STEA 1KKOA 3QVQA 3W0KA 3GSMA 1UPMB 3N4AA 4AIUA 4M19A 1PVNA 2V6AA 1JIBA 1ICQA 4QSHA 4ALDA 4R85A 4Z0SA 1SSDA 1WZMA 4G7EA 3WNOA 1W1ZA 2OZ0A 4NG3A 3FNDA 2PRHA 2BBFA 4KBXA 2W63A 4TU1A 3ARRA 1X8CA 3TWBA 4WJ8A 3TMQA 1T6MA 4IIHA 1FKWA 1KCLA 5I3FA 4PA8A 2FKPA 1QNQA 3M46A 4S3AA 4OOZA 5HUOA 1IT8A 1TMHA 1XX1A 3KHJA 3BE7A 2ICSA 1LG1A 1MDRA 3NQ8A 5KMYA 1YXCA 3WQCA 2FZ9A 4S3BA 3CMJA 2YXXA 5DY3A 4YCPA 3E2VA 1JJKA 4DWSA 4YNGA 3S2MA 4GVGA 1ZJBA 3B40A 3RJXA 2AGKA 2X42A 1F8IA 2YA1A 4MZ1A 1GTHA 2ZCGA 4HBKA 1B0IA 4C65A 5KITA 4HNTA 4UFLA 1K8XA 3GAYA 2OMAA 4WUIA 3DHUA 3SECA 4AD2A 5J04A 3FA3A 3G1VA 2NQ5A 3A4WA 4AZ5A 1Q7MA 1PWLA 4QBXA 1OGSA 1P6WA 1VGAA 3PTDA 3P6LA 3RLGA 3NSNA 3HGJA 3RM4A 1DKWA 3BLFA 3W88A 4CNPA 2VX6A 5ABFB 1VPQA 1NWRA 4GKTA 5AC6A 1KO0A 2Y24A 5CZKA 2DW7A 1F9CA 2NUYA 4PUWA 4DJED 3MV11 3JUGA 2ABBA 5FAGA 1KBBA 4QNEA 2JK2A 2NVAA 4XKYA 4CQ8A 2DQWA 3T0DA 1RXOB 1Q7QA 5D4YA 1LRNA 2I5GA 2JQXA 5I09A 1I0DA 1ODZA 3OBEA 3W7GA 3FLUA 1WZLA 3LBMA 4HKPA 5DN1A 1FH7A 4LANA 3HM7A 4INFA 4JY8A 4AU0A 4NXSA 1RH9A 3WQVA 1VF8A 3GXIA 4OKDA 4ZENA 2EGZA 3UG8A 3QF0A 1GW9A 1C8YA 4GGBA 4JQ2A 4QLLA 1TV7A 4GQGA 5F2IA 2XVNA 3ABQA 3KOYA 4JN6A 2YIHA 1VRDA 4PBEA 3UF9A 2MANA 4YLWA 3IAQA 5CPMA 4XBJA 2PRLA 3F2DA 4Q8WA 3EXTA 3SCQA 3NIYA 1UKSA 4Z0JA 1E6QM 4Z1DA 4BWLA 4K7VA 4KMQA 4X2PA 1JXKA 2JKEA 4C6IA 4ZSUA 1N55A 2D73A 3C0LA 3M0LA 3LHWA 1GHRA 3M0ZA 2ODOA 3TTOA 1XKJA 4EACA 3PB2A 2YXGA 4J3VA 2H9AA 4O12A 5FJOA 3LCLA 1GG1A 3URNA 1TFVA 3WLQA 3CZJA 1R3RA 3SJ3A 1HL2A 4LU0A 3N17A 3RX3A 2D2OA 4H01A 4HA3A 3GHRA 3S8HA 5D30A 3VUPA 1A3XA 4UFHA 4AHPA 5CPTA 1DXFA 4HPNA 2QF7A 3Q67A 3GC2A 4DB7A 3MP5A 3RAOA 4PMJA 3WCZA 3GDBA 3VKAA 1FUYA 2G97A 5AYXA 5HWMA 4J27A 1Y5WA 4N9EA 1QOPA 2VQUA 5J8LA 3SCUA 1LL6A 2ISWA 2P88A 4Q7NA 1TTJA 3P62A 4BQ3A 4NX0A 1TWIA 4PBFA 4GZEA 3UPBA 1HT6A 5AVHA 3MI2A 1DQXA 2PWEA 3NJ3A 5CKSA 2EO7A 3WUEA 3P93A 1U1JA 2BXVA 1D7KA 3A47A 3PZOA 2OYLA 4HZMA 4GYPA 4AIBA 6ALDA 1LUCA 1XLHA 4KGLA 4PCFA 3WLPA 1F6YA 3H7UA 1MYRA 3WMCA 3EB2A 1RV8A 4BQ5A 4XO6A 1KC7A 1R8LA 3GZAA 1US3A 2E25A 4PB4A 4UUIA 2ZA3A 3S2NA 2ZA2A 1V4YA 2E5DA 2DUAA 2PF0A 3R25A 4UB9A 4ERGA 3CBWA 3DOPA 3VIPA 3FVDA 3DAQA 2V3EA 1WNOA 1K77A 2AMXA 5D32A 2ZRVA 4LS0A 1Q6QA 3URAA 3FJ6A 3T40A 3WEOA 4UQEA 5REQB 3E12A 1CB2A 2GDQA 1FP8A 1RY0A 5HINA 1BSIA 3W1MA 4DQWA 1VENA 1FXPA 3A23A 3DEQA 3H53A 1KM2A 1W3IA 3THDA 1B4EA 4WCJA 2G96A 5LA2A 7XIMA 4ZE5A 4FNUA 6ENLA 3E6EA 1KLYA 1J2WA 4DBEA 5FEZA 1UPPA 3NPUA 4A21A 5EU9A 1HXJA 1BPLB 1DWAM 2QJJA 2E9LA 3C5QA 4A2SA 1QT1A 4JTEA 4CNSA 2JEQA 3JS3A 4WQ6A 3THCA 4WY0F 1AD4A 3ES7A 3L9CA 3F7JA 2DZXA 4Z1YA 1H63A 2WK2A 4Q8MA 1K7EA 1H7WA 4PN2A 2GJXA 3KVLA 5AB3A 2VZVA 1RALA 5AHIA 2VNCA 3FN9A 2EKGA 3DGRA 4HA4A 3SR7A 1E1CB 3GYCA 5CG7A 2WXDM 4B90A 4W5UA 3QW4B 4JR5A 3NDYA 2I7GA 1AUSL 1K8YA 4TOQA 3DFQA 3RX4A 1XPGA 2AKMA 4AZGA 3QFWA 4CQAA 3K13A 4O1DA 2PURA 3WF3A 2OWWA 1GVSA 1X98A 5HR6A 2JEPA 4R33A 3WEMA 3EGJA 1P0BA 1S5WA 5BROA 4C6QA 3HF3A 3SCNA 3T9PA 1W3NA 3V16A 5T91A 5BOOA 2B7NA 2VOTA 4RDWA 3ISIX 2OZTA 5ECVA 2VT0A 5LIUX 3N2MA 1JI2A 5DMNA 3F1QA 5I06A 5BRPA 3VMPA 3TYZA 1QW7A 1I75A 3CHEA 3NOYA 3L4VA 3KCJA 4H00A 3D5HA 5AC5A 4P02B 3R5EA 3CTTA 5K2ZA 2X7WA 1NJJA 4GC3A 4B3LA 3CQIA 3PJWA 5EMYA 1GG0A 2OZ8A 1Q5MA 1J0YA 1VQTA 1MNSA 1EH9A 2GUBA 1LQAA 3GKFA 4U10A 3WMBA 4JDYA 3AIVA 3ZVHA 3FSTA 3M16A 3Q45A 2KX9A 4ML9A 5M1TA 1W1VA 1WBHA 1AH3A 1EP3A 2D0HA 2ESCA 2Y63A 1L6YA 3V4BA 1N8FA 1NWSA 3H22A 2V82A 2ZRYA 1F6KA 3N6QA 1PZ1A 5D2YA 1A5AA 2HVOA 1TPC1 2ISVA 3K4DA 4QHRA 4RCXA 1A50A 2Y61A 3P0XA 1L6SA 3MV01 3QZ6A 1KCZA 1E0TA 1OBAA 2ZUTA 4GUIA 3IVTA 1ITCA 3A3WA 2CZVA 4GVHA 1WV2A 3FEQA 1TA3A 2VURA 2FVLA 2QHAA 3WLKX 1UD3A 1U5JA 4H2CA 2CYGA 1GW1A 3ITCA 3C2OA 1DQWA 4K39A 2OOFA 3OLEA 1M3UA 1XYBA 2NVCA 5AN7A 3NO5A 3KRUA 4PSRA 4ZOAA 1HJVA 5HMDA 3S2JA 3GIPA 3BURA 5FSEC 1RJQA 4K8HA 3CV7A 3PZMA 2J6XA 4DZAA 1PJ9A 1G67A 1TIWA 3T55A 1UJQA 4WDWA 4ZB5A 4S38A 3VGGA 1WCGA 1ZPTA 2CLKA 2CC0A 5DANA 2PC8A 3WD1A 4PC8A 3IVUA 4NQ1A 4FALA 4PMRA 3ARSA 3CHFA 3OYZA 3GXPA 5AYYA 4IG2B 3SRDA 4IZGA 4JX5A 1UJPA 3RO8A 4R7WA 3ZM8A 1MNZA 3HQNA 1SW7A 1JFXA 2DIKA 3P2VA 3RRAA 4UTTA 1SZGA 1X8FA 1QASA 1JEZA 4NJKA 2I9EA 5IRPA 4M7TA 1CLVA 2XH2A 4IPIA 5AYZA 3GY1A 4NZ1A 3B9EA 1NDWA 3S83A 3UNDA 3R94A 1MUCA 2UY4A 5K7JA 3WH6A 4KF1A 3QBUA 1V3JA 2DT1A 3CK5A 4BQ4A 1AW5A 3AISA 3E9AA 3G5EA 3WLRA 4U3AA 1XLKA 2QCMA 4TV5A 2D23A 3G1HA 2TYSA 6REQB 3U5YA 1W6TA 3OIXA 1EO7A 1WYIA 1RVKA 2X05A 4YMZA 4JTRA 4GVIA 1I8JA 3ZSSA 3WY1A 4XUYA 1LBLA 3SUTA 3FIGA 2FIQA 5HPOA 2WVVA 1XYFA 2PWHA 1DWJM 3OZPA 4HNLA 4LCRA 3HG3A 3N25A 3PUOA 3CLMA 3MSGA 1KXHA 1ALDA 5ABTA 1TPDA 3UWUA 1XH0A 3N73A 3LPOA 3HURA 4NRSA 3H6OA 1Q8JA 3GTIA 3HIJA 3LEPA 2BS9A 3W27A 2VFEA 3NWRA 4MFDA 4O0ZA 2YL8A 2CCRA 3HTWA 1JD7A 3W2UA 1MQQA 2HNHA 2FPTA 2WQDA 1MFVA 5JBEA 3DC0A 2PTXA 3UG5A 3S3GA 2BVWA 3WQPA 1C9WA 5D2XA 3URBA 1F4AA 2E6DA 2PAJA 5K9CA 5BMXA 4TX9A 3WLLA 4AAJA 3FS2A 4UNKA 4GG9A 3CZKA 1NU5A 1Z6KA 1J79A 1XBVA 4N9DA 2XPKA 4UQAA 2OELA 3BQ5A 4LH8A 3OVPA 3ICJA 3PUGA 2PBOA 4QJ3B 3UD6A 4OUIA 4HMDA 5LHEA 3QYQA 1LZOA 1HGYA 3AYSA 2ZICA 3R12A 2Z1KA 2ZKMX 5I77A 3VI2A 3OOQA 3QKZA 5KZMA 1LRTA 4AD0A 4LVAA 1PPIA 1TZ9A 3O6YX 1UP0A 5C0QA 4BFAA 3PP7A 1W5QA 3UPWA 4AVFA 4L1WA 3W82A 5HJXA 1FCQA 1Y8BA 5AOUA 1E5NA 4JHOA 1OK4A 1YE4A 2PD9A 4A2RA 1M5WA 4R9OA 1GHSA 3H2AA 4D6HA 2ZXAA 4LUSB 4A29A 5A6AA 1H7XA 4KWUA 1Q4NX 3IANA 3IV3A 4LVBA 3Q2DA 3CPRA 3QQWA 3FJLA 1FDZA 2GYIA 2Q02A 4D8ZA 2O56A 3R58A 3ZJ6A 4PTXA 4NU7A 2HE5A 2XIIA 2Z27A 4LEQA 5AFDA 1HTIA 3UYCA 3ZLHA 3S1UA 4I5UA 3SW6A 5F2GA 1E70M 5DBUA 3G22A 2J7CA 1YTEA 1DVJA 3FEMA 3EX3A 2A1YA 4RZ4A 3NGFA 4O8AA 4XAFA 2QPUA 1Q6CA 5CC5A 3G18A 1Q6DA 3IWPA 4GBUA 1B4KA 4EP8C 3VOCA 3KL3A 4JN8A 4QS5A 4XIMA 3P8JA 4FNTA 3NQDA 5TAOA 1OHLA 5MKGB 4LCQA 2OEKA 1W9VA 4NVTA 3DYOA 2JIWA 2PGFA 3WQGA 2GQ3A 3W1AA 1WAUA 1QPRA 2V9DA 4FNSA 3GHUA 2E4TA 2X2GA 4AISA 3NQMA 4BF9A 4AY8A 1H61A 4HA0A 4US6A 2VCAA 4AEFA 3DZ1A 4Q33A 1G7VA 4JQ3A 2D1ZA 4Q4MA 1J96A 1V3HA 4XTIA 1DJXA 3OU8A 3L5MA 4L9XA 1VJIA 3W1UA 5KZDA 3USZA 3I7SA 4G1NA 4Y9PA 3PBMA 6XIAA 1NDYA 3V5CA 3G0XA 1VFHA 1DIEA 1JI1A 2BG5A 2J4GA 4GUHA 2X30A 3IRDA 1IT7A 3VDBA 2OWXA 4HJWA 1BKSA 3L5LA 3K8MA 4RPPA 1R87A 4UTKA 3DC8A 2A3AA 3VVGA 4O54A 1ADOA 3VOHA 3CEPA 3TNBA 3NM3A 4HU4A 4EX4A 5PTDA 4W85A 1L6GA 5DCEA 3T2QA 2NQ9A 3R6IA 4M1RA 2FTPA 1V6YA 4K8GA 1IGSA 2WMIA 3RO6A 1HKKA 3DFOA 5FJRA 2WZHA 2DVXA 2VCBA 5HNTA 1GGOA 4ORMA 2GL5A 1CCWB 4HNNA 3TYUA 2D2JA 3R1ZA 2NSXA 4LBUA 2FZBA 1H4PA 4AF0B 4U4MA 1MDLA 2WPGA 3LLFA 6TIMA 1NELA 1Q6OA 3R89A 2V69A 2A2IA 3ZO9A 5IHRA 1FWHC 3B3DA 1EO5A 1FHUA 3BWWA 3TMLA 2X1SA 3UZWA 2QKFA 3WNLA 3LD5A 3MUY1 1FFRA 3VKKA 4OBTA 2YCEA 3MKKA 3AIBA 2ZADA 4DJFD 4F9JA 4KT2A 2VEPA 2WMJA 1XCWA 3TUUA 3SB0A 4DELA 3QOMA 3L0GA 5A3HA 1IEVA 2VEKA 6A3HA 4GMEA 1X6NA 4UOZA 3CB8A 2IXVA 4GZ7A 2B81A 4K7YA 4NJHA 3EAUA 2W61A 2SFPA 2VKZG 4HU3A 3HV9A 2XGBA 2P53A 3ZJ7A 5CGQA 4YVXA 5FJUA 2DSWA 2EPLX 4JKKA 1V7AA 3G3MA 5T9CE 2VD8A 4F48A 1TVLA 2ZX8A 1VHNA 2Q3RA 1ZCOA 2Y89A 4FXRA 3M5XA 3PBYA 5LGZA 3H7RA 3T08A 3TH6A 4JYFA 3O2LA 5CAKA 3HFTA 1B1YA 3QW3A 3TCEA 3STFA 1IEQA 4YCOA 2YA2A 3RU8X 4IP5A 1C91A 2DH3A 4PRWA 4WX2A 4N4PA 3M0JA 3LCFA 3EA2A 1CWYA 1THFD 4QJ1A 4YWIA 2X0SA 1P1MA 3W1XA 2H3DA 4IMCA 1FDYA 1ISXA 3N2TA 1EP2A 3AJ7A 3P14A 2OEMA 4QDPA 3LCHA 2PBGA 4S39A 4M0XA 3WBAA 3PTQA 3VFLA 3I7RA 4B4FA 4Z42C 3O63A 1QU4A 1BVNP 1V6WA 3W87A 3TJ4A 2MUCA 3WJZA 5ABHA 3F2BA 5BU6A 4Z2IA 2P1FA 1HN1A 1JZ4A 3RCYA 2PPGA 1MI3A 3ERPA 3CO8A 1P0EA 1U30A 3C56A 4U33A 1MQRA 1CLXA 4ZMGA 4RE2A 5LGXA 3ZYZA 3CASA 3W7KA 3U4AA 1T8XA 1SFLA 1S1RA 3PJTA 3QGAC 5EBUA 4FNQA 3I3DA 3GNOA 2CLFA 3A3HA 4JIHA 3FVMA 4IGMA 2I14A 3CXOA 5EGRA 3ITTA 3FK4A 1GOWA 5AYBA 1Y7VA 3CGTA 3BOXA 3R2GA 3L7RA 2J24A 4MNMA 3SCRA 5CSRA 3KX6A 5F2MA 3PBVA 4F2UA 4JICA 3AHVA 4FEZA 4KS0A 3B8DA 4C1KA 1J10A 1J5TA 2ZRUA 4FXFA 3VZZA 1R3WA 4NASA 4KIEA 1PB0A 2G3FA 3IIPA 3WLOA 4N02A 3ZVIA 5D02A 1EDQA 1YKWA 1DXIA 4H7CA 3EWYA 3WQWA 4CVUA 2AAAA 4AVNA 1EQPA 1RPXA 3P61A 1B90A 4RXFA 4JTUA 2FH6A 4BI7A 3J7HA 1TREA 5CGMA 4EAMA 1Q13A 4GUGA 4UFIA 1H41A 3MI6A 4LWWA 5CQ1A 3WDHA 1MSSA 3VABA 3TA6A 5LZLA 3DU0A 5L9FA 2FJKA 3DXIA 4PUMA 4C91A 2BX7A 5EJ1B 4GXWA 2ON3A 2PTZA 2D3LA 2PE4A 1HKWA 1VFMA 3R4IA 4TV6A 2PDQA 4MPKA 1TV3A 3VD5A 3VIJA 4HMCA 3GDRA 4XO7A 3L66A 3PZNA 4DWDA 3H2OA 1I9CB 3HFYA 2RFGA 2ZQ0A 2QULA 2BMBA 1F3EA 2X1RA 4AW7A 2V3FA 3INPA 2X0YA 3MPGA 1L0PA 4HCDA 1VEMA 5E09A 1CX9A 2PDUA 5I5RA 5LNRA 4RW3A 4CNNA 3DESA 2FZMA 4ICNA 4HCLA 4LOCA 2YB1A 4QCEA 2WHMA 1G01A 2G37A 1FWDC 2GVJA 1DJHA 2WC4A 5CSSA 3QHNA 2Y7FA 4GLEA 2QCGA 3NR0A 4LAKA 3UWVA 3PSWA 2I57A 1GKPA 4ZR8A 3H2NA 2J8TA 4E2OA 1GVRA 3U5UA 1YMYA 3DFSA 4ERAA 3GVRA 4PEEA 3FX4A 3EMZA 2NV1A 2XN1A 3VDAA 1V8EA 4OGZA 5AHMA 3DHFA 2PDFA 2A0NA 3ZT7A 1AQ0A 3FYOA 4IOTA 3AFBA 4HHHA 1YLVA 1F2JA 4JIRA 2VX7A 2ZUMA 4CLMA 1S3TC 1SZNA 2PDIA 3K8LA 4G5DA 4AZCB 1EEPA 4HGXA 5FF4A 4DJEC 1OT2A 1E9LA 1PE1A 4JTFA 4UZSA 4UOJA 1LLWA 4TVCA 2B7OA 4F0RA 3WLNA 4JS3A 2Y1HA 3MUIA 3O1NA 4AIEA 1V6XA 3NZRA 4JHMA 5DLCA 3EKZA 2IKJA 2GQAA 3REQB 3FA4A 4R5EA 3LV5A 5MF5A 1UR1A 5AY7A 2RDWA 3TTEA 1M7JA 2YCLA 4MDPA 3GX9A 1LDCA 3A4XA 2HVNA 2Y62A 4B3ZA 3WLTA 1EFZA 3SIMA 3TN4A 3AU2A 3L67A 3T4WA 2VVNA 3TV8A 5IXEA 1DIDA 1LM1A 3S4TA 3UVIA 3KCLA 4JTAA 2R1LA 4B2DA 2EPKX 3AIQA 1I60A 2F84A 4NJGA 1JDFA 1UR4A 1WXYA 1QI5A 2REQA 2CLHA 1QBBA 3G1SA 1XG3A 3NZPA 2DGAA 2ALDA 3POCA 3NPXA 5L6UA 4MNKA 2NUWA 4IIBA 5EFFA 2Y4SA 3XIMA 3H24A 5CPOA 4O52A 4RNHA 3W2LA 1MW1A 3U3HA 3B8SA 5G4WA 1EX5A 3DGBA 1AH4A 2YZRA 1XIGA 4KWOA 4ZEPA 4O10A 3W70A 1CGWA 2FGBA 1AVAA 1ZAJA 4OV4A 1ZJHA 3S47A 3QYSA 4Y8FA 4BQ2A 5K9XA 4LS1A 2FB3A 4K3ZA 1A5NC 1KGUA 3DN5A 3ITVA 3TA9A 5I3JA 1Q6EA 2DEPA 3GXMA 4OWGA 3E0FA 1W5OA 3E02A 2GVGA 3P3BA 3QKEA 1KFBA 4IFKA 3P5ZA 1E4IA 1CTNA 1RP9A 1PIGA 3BAXA 3AS1A 1FXQA 4JOMA 4LAZA 1EXPA 4IIEA 2BOFX 3NSXA 4A22A 3MDUA 2NWSA 2PS2A 1LL4A 4R7JA 3RR1A 2ATSA 3GHSA 3T1GA 3OVQA 1QPKA 3GG8A 1FH9A 1XQKA 2Z1SA 1QO5A 1KKRA 2Z2UA 4NSBA 3WBWA 1K7XA 1W9DM 4C6OA 1X6LA 2O4QA 3K4AA 4UQDA 4L1GA 4F2TA 2XVGA 5A8MA 1S5TA 4FXSA 1SQ7A 1E5JA 3FDKA 2VUYA 5J5RA 4PMDA 2CLMA 4S3CA 2ZUNA 4D6EA 4R27A 4D6DA 3FCPA 4ECLA 3FOKA 4EANA 5C7HA 4AHOA 3NZGA 3KFTA 1Z32X 4B15A 4A8NA 1S2TA 5C9WA 5DT5A 3EA3A 1C3FA 3FKRA 2WC7A 2GVYA 2CHOA 1J01A 2WCGA 3BO9A 3VKCA 3KZSA 3GTFA 4PMUA 1R38A 3I7QA 4DZIA 4KH2A 4F3HA 2ASHA 4I6KA 4TVUA 4TMCA 3FSUA 1SUXA 3MY9A 4JQ4A 5E1QA 3U6WA 1XDMA 2WJZA 3N11A 4HPGA 4E38A 2GUYA 1YNYA 3KTSA 8XIMA 4DF1A 1M1BA 1CXLA 4MKSA 1HJSA 2XWEA 1IIGA 1YPIA 4H9UA 2ZRXA 1KBJA 3P82A 5D04C 2VM8A 4U2YA 4B5UA 1WA3A 1JUEA 2QDEA 2GPTA 2QCDA 2ISSA 3W72A 3UW6A 5SWUA 1XSKA 3OJGA 4MSSA 2EG8A 4M6QA 1QMLA 1BXCA 3NQFA 2HNEA 4QE4A 5JXQA 1V03A 1VFFA 4FX8A 1GOKA 4ZO6A 4TIMA 2GGEA 2PLKA 2HS8A 1P6BA 4C1NA 4DO7A 1W8GA 2QVNA 1H1ZA 2FGZA 5IBXC 2VFIA 1SFTA 4IIGA 4Q22A 5DMYA 1ADDA 1P7TB 2ZOXA 2FPVA 4PR4A 3SQSA 3OQ8A 1EZ2A 1V3MA 3M5ZA 3TTSA 1YEYA 4PRRA 1KWGA 3MUCA 3IJ7A 4LTSA 1W9PA 3KVKA 4O14A 1VFTA 4H8HA 4CCEA 5C8BB 4NJIA 5XINA 1QHPA 3U2OA 3CQJA 3VO0A 4EPKA 4QP0A 5HXMA 1KFWA 3M41A 4UC5A 2I56A 4GUFA 3W86A 4QG6A 4G1KA 2Q8XA 3OA3A 1A0CA 2D22A 2V8ZA 4YU1A 4KWWA 2PZ0A 3UY8A 3VDCA 2PP3A 1QPOA 3NVTA 3CZGA 4B92A 4UR9A 3VM5A 4D1IA 3WH7A 4ML4A 1XGDA 1GK8A 3WDQA 4IPLA 1IEXA 4DZ5A 3RN6A 3UWZA 3OIHA 4NNBA 2YL5A 4GH1A 4NHVA 5XIMA 4DVOA 3CIWA 3CH0A 4DJDC 3NDZA 3K1DA 4HNOA 2F38A 2X0HA 2WO5A 3C52A 3PY2A 4L4LA 2J7GA 1R2RA 4LUTB 2F7FA 1KTNA 2WJEA 5DXXA 3C61A 1D2KA 2V0TA 1QJWA 4EKJA 1F73A 3W29A 3VD3A 2ISDA 2Q8ZA 5E5CA 3PR2A 3N34A 3W02A 2EF9A 2I1OA 2OYMA 3N18A 1R9XA 1JAKA 3TSBA 1HJUA 2CWXA 4YTSA 4ZTXA 3IIOA 1A3HA 4XD3A 1C90A 4LB4A 3ZS4A 2HK0A 2J79A 3GLCA 2QJMA 3KBSA 2DH2A 3C86A 2WAGA 3NO1A 1LWJA 4DRSA 3W73A 2YLLA 3LPGA 4OVXA 3BSGA 3KZPA 5BZAA 3M4HA 3VOJA 1HZYA 3HGSA 3WUBA 3P7YA 3A3XA 3ARYA 3QR3A 2ISFA 5HATA 1E6PA 3LQGA 1T8QA 3PZ9A 3VINA 3FGCA 2QXWA 4JY9A 2VGBA 1AW2A 2Y6ZA 4J2PA 3IACA 1FCBA 4UR8A 4TTGA 3MUZ1 3QGKC 2WVTA 3OHIA 4GY1A 1XHGA 1J2BA 4KEZA 5KSWA 1ODUA 3PC0A 3BV4A 3OQEA 2XU2A 1VEPA 3AC0A 4B91A 4D2JA 4LSBA 5BXSA 1J4EA 5EL1A 2BGSA 1OCBA 3ITYA 3O6CA 1XD0A 2VOMA 2RJHA 4NT0A 3EX4A 4Y9OA 3K5XA 4WOQA 3AHZA 1H0GA 4LYQA 1ZENA 4O4WA 4ZO7A 3WF1A 4HA1A 4M24A 4NI8A 3U48A 4L4OA 1X38A 2AL1A 1BGGA 1VH7A 4CEUC 4L56A 4ZQOA 3T8LA 3WD4A 1VPYA 2YA0A 1F61A 3UA3A 3PTKA 2QDHA 2A3BA 4AIOA 4D8LA 2NT1A 1Q6GA 4WXYA 1T5AA 2JIEA 4XKMA 1XPYA 3B8UA 1CIUA 1D8WA 2YYTA 1MUWA 1XXXA 4M51A 1E6RA 3W26A 3AXKA 1M03A 3OLGA 1H09A 3T0CA 3JU2A 1VLWA 1F4HA 5U4NA 2GWNA 1FOBA 3VGFA 4H9VA 3LGEA 3NEVA 3TYDA 3TN3A 3BICA 4FX7A 3PNZA 3F5JA 4ICCX 2RGLA 1OM0A 2A4AA 4I3GA 3II1A 3NL6A 1XYMA 3KOWA 5BRQA 4JFSA 1E40A 4G8TA 2CLEA 4XZIA 1ECQA 2OLHA 1GONA 3UBPC 3W83A 5LKYA 2DVUA 2YPIA 3QSRA 4YTTA 2XFYA 4C6BA 3G8EA 3W7IA 3D3AA 1L8NA 3MWAA 1C9DA 2OSXA 2QUVA 2KZHA 2ACQA 1EB3A 4GGHA 2QPSA 3M9YA 2FQIA 4CD4A 3HPAA 1RCXB 5ABFA 3AZTA 2F2KA 4C5ZA 4WKHA 3XISA 1I1XA 2X41A 3E96A 4MJZA 2QUTA 1LOQA 1EUNA 1XCFA 3CYVA 3S9YA 4HIBA 4GC4A 3BTNA 1JUBA 3LBOA 1WP6A 1A4LA 4UOQA 2PFHA 4AD3A 2FTWA 1XRSA 3MUAA 3ONBA 2PZNA 2BODX 3VK5A 4XB3A 3WK3A 1OFOA 1E0VA 1ZTVA 3WDRA 3NQCA 1H5VA 2ONEA 1PS9A 2YL9A 4ADUA 8A3HA 5EA9A 1EF3A 1JDCA 3SM0A 1UWTA 5JIWA 5C7VA 4HMEA 3VXGA 1HL9A 2VC6A 1QK2A 3OG2A 2W91A 4W7VA 2IW0A 1WX0A 1LF1A 2E3ZA 3UETA 1JDAA 2UY3A 2GQ8A 1EC8A 4UR7A 2XFWA 5LA1A 4QITA 1ZCCA 4YN5A 2D3NA 1XISA 2IS7A 1QXLA 4EWND 3GTHA 3O0KA 3GKAA 4LVGA 1TJ2A 3C2EA 4W4QA 7REQB 2HK1A 2JFEX 1SMAA 1ZZMA 3B0XA 3RCMA 4ONVA 2V2DA 3VC6A 1ISZA 3UCDA 5A8PA 3TU9A 4RE3A 5HWJA 3N9KA 3R11A 4LFYA 5TBOA 1GYLA 4Q3MA 3W2JA 1V02A 1W9XA 4AC7C 4GACA 3AICA 2CFFA 4JTIA 3TFCA 3GIYA 3PZUA 1YTKA 1W54A 3KBMA 4Q4KA 3LMZA 1F3TA 2CXEA 1GYNA 3R0DA 3OBKA 2E5BA 3AS2A 3A12A 2W0UA 1PKMA 3E2RA 2DT2A 3WQ4A 3H4XA 4UMAA 3W7NA 3MUXA 3AROA 1Q85A 2J7FA 1TWDA 5FL1A 3VDHA 3DYPA 3GB6A 1XBXA 2VZTA 1B54A 1YNPA 2YYUA 3AI0A 4RZ5A 4LV9A 2XH7A 2CEQA 1D8CA 1WQ5A 4KFPA 3T05A 4IGNA 3S1WA 1ZHAA 4NZ4A 1X1OA 3G0SA 1P48A 1R9YA 5FF3A 3EDDA 3CQ0A 3E0LA 1VS1A 3ONCA 1WXZA 1XF0A 5IHSA 1U5HA 3MMTA 3IAPA 2VGGA 4BCEA 1RA0A 3MHGA 2BTMA 3N6JA 1RBAA 2WZMA 3H23A 3DFYA 3IGHX 1L6FA 2IKHA 3NPWA 3NQVA 1IV8A 3STGA 3D47A 5HQMA 2FLIA 1FVPA 3W71A 2HTMA 5HULA 3OODA 4AZHA 5I79A 3NQ7A 4Y7EA 1KQZA 1OZMA 4GYKA 3UGRA 1YDNA 1OGGA 3PWIA 4GQBA 2UWFA 4Q8UA 3TYBA 3T44A 3VIFA 3OZOA 1IT0A 5CPNA 2V5LA 4ZB0A 2WSQA 1UASA 2WW5A 4C60A 3APGA 5LNWA 3MSDA 3DH7A 4ZQRA 2E0PA 4Q32A 2I16A 4V1XA 3BMWA 3DKLA 3PPHA 2YGYA 1J9YA 4ACZB 3VGHA 5JUVA 5CZSA 1AQHA 4LJ3A 2NUXA 5HJLA 5JH2A 3LV6A 1OIMA 4GZIA 3RG6A 3S0CA 3WL0A 5CC3A 1TX2A 4NUWA 3T4CA 2GLKA 3BAYA 2V5KA 1VC4A 3C2VA 4YIWA 5REQA 4PL1A 4FLQA 4KERA 4M8UA 1WE5A 4O1EA 5E0FA 2P8CA 1EA9C 1TB3A 4UFKA 2YFOA 3AXMA 1KXQA 2OT0A 1JZ8A 1IR1A 3BW3A 4ZXLA 4DXVA 3VKBA 3NGJA 4GFIA 5F4WA 1R9ZA 1QOXA 5C5YA 1R47A 2Y5SA 4GISA 4GZJA 4PRTA 3SURA 3N9SA 5DRCA 2QF8A 3ARXA 2PTWA 3WO8A 1ECEA 3NURA 3OZYA 4EWJA 1OFQA 3GR8A 3R13A 4P8WA 4O0KA 3N12A 1TTPA 1HF6A 5A6BA 1OCNA 1DIKA 2HJPA 1EJSC 1H3GA 2OZ3A 3KVMA 5CBBA 2Y7EA 2CZFA 1PHQA 4DJFC 4O8RA 3HQOA 2VEGA 3TW7A 1O94A 4URIA 4AYSA 3KW3A 5M5DA 1A5MC 2GJRA 4ZO9A 2FB2A 4QGCA 3B4UA 4EVZA 1E1CA 1ZP4A 3RMEA 1VYRA 4AZBA 1UH4A 1L2QA 4Q4OA 2J8FA 4B5NA 2CKSA 3SAZA 1J5SA 2C13A 3I4KA 3OEXA 4O0QA 4PMOA 3UJSA 1SZFA 2R91A 4LV4A 3AIUA 3BJTA 5TIMA 2YKKA 4H7ZA 4DY1A 2WB5A 1R3SA 1EPXA 1QBAA 4GJ1A 5I3HA 3W76A 2E09A 2XVPA 4BI6A 2CPUA 1MWOA 2H90A 2Y8KA 4PUJA 2E28A 3BAKA 1DEDA 3GXTA 4BF5A 3KLKA 3NAVA 1WPCA 2Z1XA 1HKJA 4HSOA 2DVTA 4O4VA 4REQB 1G4EA 1TJRA 3AS0A 3PAJA 4JYEA 1MW0A 3IJDA 1VZWA 1HX0A 4DNHA 1DJYA 3C2RA 1JRCA 4S2CA 3E2SA 3TK7A 2QCLA 3GXNA 2DDXA 2HROA 2DUZA 5A1AA 2DZWA 4KIRA 1HUVA 3BLDA 3NQAA 2GUUA 4ZA0A 2DU2A 1BF6A 3DFPA 1PZ0A 1UWIA 3MZ2A 4PUKA 4QDWA 1U1HA 3BLOA 1US2A 4M6VA 2Z1BA 3IEBA 1K1DA 3O05A 5M2FX 1TMLA 3GUWA 2BVDA 2DW6A 3QPEA 1Z3NA 2OXNA 2YBTA 1NQ6A 1E1EA 1O5RA 1LBMA 4C1LA 2OYKA 3ZJKA 4JXCA 1S3HA 1MEHA 2FTYA 1NF0A 2DT3A 3BCJA 3O3RA 2WSRA 1KFLA 4KWVA 3AWOA 3C4UA 4DYKA 1XRFA 1PWMA 1E56A 2C71A 4PMQA 3MHFA 2X16A 4YL2A 3EYPA 3SCPA 2VEFA 5FL0A 1ONXA 4U3CA 4GXPA 3W85A 1GEHA 4LT9A 2QUNA 3RGTA 3AOFA 5EMJA 4IHCA 1TJ1A 3RCNA 1DJQA 3JRKA 3RPMA 2Z26A 4P8XA 4BHYA 1XL9A 4O53A 2HZGA 3EPNA 2OKTA 1EOMA 4Q4PA 3CMFA 2Y88A 4P5UA 1UW9A 3RUBL 4UMBA 4N9BA 5T9BG 2C6QA 1B30A 3SFKA 4W5ZA 1RD5A 1QPNA 4ERIA 1RVGA 2C1GA 4GI4A 3PFMA 3RYSA 2J6VA 4EXAA 2W3ZA 1VRXA 3TQVA 5EFDA 2PEVA 3PF3A 1WOBA 1FHVA 5AKQA 1G6CA 2WANA 4P7RA 3TR9A 2Y8VA 3G1DA 2W5FA 1YYAA 3LTSA 1J8VA 2VO5A 4MB5A 4IG2A 1GJWA 5DCDA 1MXGA 4AB4A 1B9BA 2CLPA 1Z8AA 3LI0A 1QCWA 2QS8A 4N2YA 1HJXA 3S46A 1EA0A 3WD0A 4DM2A 2OB3A 1TVPA 3GNDA 1WUEA 3EWDA 1HL8A 3MTWA 3HQ1A 5I0DA 1ZBWA 1OJXA 5IOBA 3VC5A 2UV8G 3GWQA 3OGVA 4LUIA 4L7ZA 1UOKA 2I9UA 3GDTA 4HHMA 1ZSXA 4F8XA 4NL1A 4RUBA 4BZYA 1FRBA 3N4EA 2EHHA 3TYCA 4W8AA 2E68A 3LGDA 3MS8A 3WDIA 5JBDA 3WNPA 2IQTA 5C71A 5EJZB 1ISYA 4GRSA 1AJ2A 2VR5A 5ABEA 3VD4A 4GE8A 3W38A 2C91A 3GTNA 1P0DA 5HBFA 1U33A 3LPFA 3WQEA 5FAJA 4QE1A 4WK9A 2WNQA 3PUEA 4S1FA 1CI1A 1GZJA 4GYPC 3ZJ8A 1CXEA 4Q8TA 4FPSA 4R88A 3DIPA 2QJIA 4O57A 3MKVA 4HMNA 3DKJA 2HPMA 1Q66A 2O4MA 1BHGA 3LM3A 3CQHA 3KAOA 3PPGA 1AZ2A 2ZZ3A 5H8UA 3RIKA 4LUJA 3W75A 1KRCC 3B97A 4HU0A 1ME7A 5DMLA 1XYZA 1QW8A 3LX9A 1QVBA 5GJNA 1W3JA 2E67A 3B05A 5DBTA 4FXJA 1G1YA 2CERA 2XYLA 3I4EA 1PTDA 3P67A 1JGIA 2J62A 3W9ZA 3WYZA 3DYMA 3PFRA 4ZSTA 2DZSA 4W84A 1GQLA 3A5VA 4GKLA 1IXQA 3LZ3A 3ZXWA 1SZRA 5A6MA 2XHYA 3KRBA 2C1HA 2D0FA 1SGJA 4J7RA 1KCXA 2XZ7A 4FLSA 5A8GA 4S23A 3TYAA 4LVDA 1JF5A 2DORA 3GNPA 5EBAA 4MADA 1QATA 3MO7A 1E9IA 5FESA 4HSHA 4RNJA 4XVEA 1JZ6A 3RU6A 3KUMA 4AWUA 1JYVA 4GI9A 3ORWA 1C8QA 3ABZA 1TTIA 4AXNA 2ACSA 2DIJA 4FF7A 3SY5A 4HOXA 1TCMA 5JIPA 1MO0A 1LROA 5D8ZA 1KV5A 1XYAA 3VOIA 3NEHA 5AZ1A 4A8IA 1YHTA 1UIPA 4HG6B 1S39A 3HU7A 3BG9A 2PGWA 5KZEA 3GO2A 3FDGA 1N82A 3S5SA 1PIFA 4ZGYA 3VUSA 2WSKA 4WZHA 3VX0A 1YXYA 2WJDA 3HPFA 3E1F1 4LRSA 5EMLA 2FFIA 3ARPA 2J7BA 1ZFJA 3VIKA 3IJ8A 3ES8A 4U31A 3KBWA 4Q4SA 4HJFA 3ZLGA 4NZJA 1QR7A 5IFPA 1CNVA 4Y9AA 3B9OA 4EE9A 4IT1A 2WYSA 2XSAA 4MJMA 1G4PA 4H2HA 4LGXA 3GFYA 3RLVA 1OX5A 4ZL1A 4IJBA 4HB7A 3VILA 1H62A 2OQYA 3A4AA 2P5NA 3CT2A 1MUMA 1C92A 1CB7B 1VYSX 1OCQA 2OQLA 1P6CA 3KVJA 2VEMA 4OFCA 1GZGA 1C93A 1Y5VA 2CNCA 3WQOA 4OV9A 3R43A 4K37A 1TELA 3W25A 5MKGA 5KETA 1XLJA 2PLCA 5GPRA 4F79A 1QRQA 3V7PA 1JRBA 1TRDA 2WWDA 4JEQA 1A5SA 3H55A 1LLOA 3I6RA 2BY2A 4IMEA 3TOYA 1W9BM 2PCEA 4HZ7A 4BEUA 4IQDA 5JH1A 1Y5XA 1MZHA 5BW6A 3RDKA 3MMUA 3BAJA 2BGQA 5DCBA 4MJ2A 1F6PA 3FW6A 4BJHA 3AQUA 3SUSA 5EYWA 2V5JA 1J0JA 1D3GA 1V0KA 4MJ4A 4PFMA 1MMFA 3HO8A 3ELFA 3KS6A 3UG3A 5D03A 1A5BA 4C7FA 2W9MA 3SEPA 3MP4A 1JCXA 2WMIB 1R3TA 1WKDA 3GXDA 3NCOA 3W4RA 2YBUA 5EIYB 4HCHA 1G69A 1A5KC 3T0AA 4ZZ9A 2Z29A 2VGIA 4N6FA 5M03A 2GVEA 4YYFA 3T8QA 3SRHA 2G3JA 1NEYA 5AECA 5D38A 2PWUA 1GOOA 1A49A 3GH7A 2WMFA 1W1B1 2PWFA 4L1XA 4JL2A 3AO0A 3T07A 4F66A 4HK6A 3W1RA 4K36A 3NVDA 2A3LA 3FXGA 2Q01A 5DELA 3LTYA 1TTQA 2XIMA 5BXRA 4I8DA 3OB8A 2XGZA 1LL7A 4S2BA 4J28A 2CHNA 2POTA 4B5XA 4DO4A 1FY6A 2WMHA 3TONA 3KTXA 4NZ5A 2QMJA 4OU1A 3MU7A 3O0FA 1EBHA 3EA1A 3L0KA 1W1IE 1K70A 3GW0A 1BVZA 5A6KA 3T7VA 5J5DA 2JALA 5CZJA 2DZVA 1SO3A 4PUDA 4UCGA 3JZUA 2VENA 5I78A 3TZNA 3TAOA 1R2SA 2A79A 1OG0A 4JTLA 5D09A 4S3EA 1XIJA 1VBJA 2PU1A 2W27A 3CHDA 1IEWA 1ENUA 2HQAA 1JYXA 4JTDA 4DI8A 1RJRA 4AX6A 2HS6A 1OFAA 1GOXA 1YDOA 4HPHA 1R6WA 5GQBA 1SSGA 4OECA 4ILSA 4LS2A 2Z25A 4MWAE 4TXEA 5DT7A 1EQCA 2VTFA 5HUPA 1DJZA 4H9MA 1QNOA 4PMNA 1Z9AA 1UWUA 3COTA 4JDBA 4ZOEA 3EB4A 3NQ2A 2CZEA 3WX7A 5LXXA 3GTXA 4J3SA 3I3BA 4PYSA 4LYRA 1OX4A 3MVIA 2H8XA 4K68A 1CXIA 1H1YA 1LCOA 1OEPA 1GUVA 3F4NA 2F9RA 4MB4A 3CUHA 1V08A 3U7VA 1KGXA 5H6HA 1OT1A 3GUGA 4EAYA 5D37A 3UZ5A 4HPXA 2QCCA 5LHFA 3GYEA 1CXHA 3AMKA 3VNYA 1KBLA 2V67A 4WVXA 3GXFA 3W7RA 2DJXA 1FX6A 3BPWA 2J75A 1S2WA 3N29A 3ZFHA 2VFDA 4E8DA 3L2MA 4V1YA 1TV8A 1JYWA 4LCSA 4P7NA 2NQLA 5BNKA 5FF7A 2UY5A 5CEWA 1GOQA 4US5A 1Q65A 3UJRA 4RE0A 5D9NA 2IQ0A 1CPUA 3TJLA 4GNJA 5EKYA 3GNNA 3MW7A 3K1GA 3WBEA 1Z89A 3OLIA 1QFEA 1GCYA 3OBAA 5HQEA 2PI6A 3N2XA 4MYAA 5C2CA 8CGTA 1SO5A 2G5WA 2R1NA 3MMWA 1SR0A 3N04A 3TROA 1YADA 1TPH1 1TR9A 2OKOA 1TWZA 3STCA 1GKRA 1UZHA 4MWAD 3R8HA 3SGGA 1AD1A 3KRZA 3GFXA 5BWFA 1VJSA 2E9MA 2INZA 4GI6A 3FA5A 4U2ZA 2VWTA 2WKGA 1TMQA 5TD4A 4IQLA 3I3EA 4CN1A 3WIJA 3HJZA 2JE8A 1E6ZA 1BXNA 1UUOA 4WKFA 5C6MA 4X2RA 1P0KA 2V2CA 2NVDA 1UUMA 3VOGA 2QDGA 2VXNA 2YW4A 1CECA 4AEOA 1NIUA 2Z2BA 3BLLA 3TYEA 2ATMA 1ZP3A 4NIRA 2Q6ZA 1V93A 3RXZA 3B8VA 3WJSA 4L61A 4BY3A 3PUDA 4IIDA 3W2MA 2PUZA 1JCLA 3EWBX 3E74A 5IBXA 1OQFA 3LY0A 2OWCA 2H6RA 2VQTA 1OF6A 4DO5A 3TN5A 4UZUA 4O19A 2EAWA 3TQ0A 1KM6A 2O0TA 1ZALA 1KGWA 5H1WA 2WNNA 1ZS2A 4KEUA 1KR1A 3S1VA 2GDUA 1UH2A 5K3VA 3TJIA 1IEIA 1WXJA 3V36A 4A3QA 4E6MA 1BWKA 2QDDA 4M82A 4KGJA 1GQNA 1I1WA 4O50A 4CD8A 3BGGA 4HZ8A 3TR2A 2YBVA 3KBNA 4Y96A 1HP5A 4FB7A 2ADAA 5FACA 3M0HA 3W7HA 2WSPA 5T26A 1CYGA 1GVIA 3N2OA 5GNYA 4B5WA 3SCWA 3O06A 2YLAA 3PM6A 3MCMA 5CPSA 3LHUA 5BOFA 4D6GA 1LOSA 1YE6A 3CLWA 3EMQA 2VCCA 4A35A 2GGGA 1O1HA 1V7YA 3MBDA 3ECQA 2WLYA 4MDOA 1RJPA 1NQKA 3FFSA 1HKMA 4DJDA 4KCWA 2VX4A 1PZ3A 1BEUA 2POZA 5LA0A 2RJGA 1TE6A 3KWSA 4XG1A 4LF2A 4NXKA 1NDVA 4FA3A 2BP1A 7ODCA 1EWEA 3MKCA 4AC1X 2PC4A 3BARA 2IPJA 4CD5A 2VP8A 2VELA 3XINA 1K7FA 5AHNA 3QM3A 3ABXA 3PN8A 2NQZA 1F05A 2WZEA 1LWHA 2GJNA 1AQMA 1KM3A 1FHDA 1J0IA 4MFEA 1EEXA 3GDKA 1Y65A 3ARQA 3T2PA 2C18A 1EIBA 5A94A 3V0TA 4Z1CA 1I6NA 3AWNA 1QI0A 3M0VA 4MYXA 1KXVA 4H3DA 5CAHA 4XZWA 2ZZ1A 4A3HA 2GJLA 4UCFA 4HOZA 4WSJA 1BRLB 3SGZA 3KOXA 1JZ5A 3F5LA 5I03A 1EIXA 2Z24A 4GWEA 1PX3A 4L4PA 4Y9MA 3GFZA 3T81A 3EWWA 1S5VA 1E6NA 1FWIC 3DDMA 2AQOA 3KLLA 1KQYA 3REQA 4CUCA 1UP3A 1XSJA 4L6OA 5A2AA 1IYXA 5IDIA 4A3RA 2B7PA 4FF5A 1JNEA 3BMVA 1W3TA 4DAFA 3T0TA 3OVRA 5HDRA 1FHLA 5HA7A 1JZ2A 4PTDA 3QLDA 5D2WA 3ARUA 3VDGA 3QV6A 2NXHA 3LHVA 3UXIA 5A6BD 4B4HA 4Q8OA 4NZFA 5A8NA 2RDTA 1UR0A 1H51A 1X96A 2Z1VA 2Z7KA 2PWDA 4DF2A 1WDDA 2FGLA 2IKGA 3CV1A 1AJZA 3CT7A 4YHEA 1UUQA 1SO6A 1W2PA 4JFWA 4LAOA 3W22A 5A2CA 4H8UA 4A8RA 1GVYA 5G2IA 4X9SA 4HYWA 5GNZA 4W88A 1Z41A 3APYA 1NDZA 3UCQA 1W5PA 3MDWA 5LNSA 1B3WA 3CV2A 1L9WA 2AOSA 1M7XA 5EMUA 4K1WA 1PZ2A 2OSWA 1OIFA 3ZSTA 1B3YA 1VYPX 1T99A 1B3OA 3LCWA 2GK1A 2VDHA 4GX9A 4DXKA 1QHOA 3QTPA 1ITQA 4WR3A 1X1ZA 1DWHM 3BLIA 4HN4A 5G1TA 1FWNA 1TRIA 2IQDA 4KCTA 3WQ5A 4MB1A 2D2GA 1Q6LA 4D72A 4DUXA 5AHEA 3FYPA 3IIZA 1TG7A 3CZLA 1RR2A 4I5XA 3KL0A 1U1UA 1Z69A 1M65A 2XWDA 3E0IA 1XWYA 5G5IA 4JTHA 1EYEA 5C2XA 1M53A 1PXGA 3D46A 4N0RA 4HNVA 1JCNA 3PSVA 3UWWA 2VGFA 1PO9A 4HK7A 2C14A 3O16A 3CUIA 1WZAA 3V0UA 3LNPA 4DLMA 2BHZA 1TX0A 1TO3A 4NYUA 4LW7A 3GQYA 1HW6A 2WNZA 2YXOA 5A95A 4BKNA 4EK7A 3M5VA 1XS2A 4GA8A 1NOFA 1EBGA 1K4HA 3IS4A 2ANUA 1A53A 3SQMA 1M68A 2V38A 3RHGA 3RITA 4MTVA 1NH6A 3SY8A 3AAMA 3EWXA 4UTUA 4ZQNA 3VMOA 1XLEA 1XLGA 1Z44A 4XD6A 4XSMA 1PTAA 1JPHA 1UIOA 4KPLA 2AL2A 1Z48A 1H11A 2XG9A 3G1AA 3PWGA 5DFAA 4AMCA 1RCOB 2FMOA 3H21A 1JG9A 5AZ0A 1U2YA 1HKVA 1KTCA 4W8BA 2BOGX 3OZMA 2QUMA 4WY0B 1PSCA 1DYSA 5D9OA 4Z2JA 2J27A 3EDKA 2GSEA 1OFDA 3N13A 1KM4A 4MZ8A 3S5OA 2Y85A 4YPJA 4GQRA 5KEZA 2QCDB 4IIFA 2V5DA 4O15A 1ZQ5A 2ZIDA 4GINA 3NSMA 2DSVA 4IX2A 4FOUA 1XC6A 1KNWA 1EX1A 5CPLA 2PWGA 3PHAA 3PNUA 1E51A 4JTCA 4OBSA 1P1XA 4E3TA 1NM9A 4MKVA 3H12A 2OSYA 4LX4A 3H2CA 4PODA 3PANA 2FZNA 3W81A 3TLQA 3ZQ9A 3B9DA 1UD2A 2X09A 4UIOA 4RK8A 2ZA1A 4JCMA 3VNLA 5FD0A 5A6LA 3CZEA 5FEXA 5I23A 2HRWA 1O12A 4Z17A 2XH4A 1W3LA 3AXHA 2XN2A 1W3KA 2A6NA 2ZZ6A 3TX9A 1JGMA 1XIIA 1AA1B 2DV0A 5E9AA 3LU2A 4ZCWA 1H1NA 3GZ3A 3EKLA 3C0JA 1XC4A 4BI5A 4RNFA 1A5CA 3WN6A 3GH5A 2J77A 4CN6A 1QOQA 2ZVIA 3KS5A 4R9XA 1E3XA 3CHVA 1P7TA 3ATYA 3LUTA 3Q37A 1KRAC 1JAEA 1NWUA 4O1AA 2P8BA 3DHPA 2W6RA 1AFSA 3NFUA 4RX0A 1X39A 1C7SA 4RZBA 4H6QA 1MRQA 3EDFA 3HPZA 1HGWA 4HN8A 4QG9A 1GPFA 5JU6A 1XLFA 2VMFA 1I2NA 4MNJA 4TVDA 3SN4A 1LG2A 2DZPA 3FV9A 1KXTA 2J9ZA 7TAAA 4A05A 3KP0A 1UR9A 3ZWSA 1SW3A 7A3HA 4IQEA 2RH9A 4LALA 5I3DA 3VNJA 4DI9A 3BOLA 3KOZA 3W2KA 1FP9A 5I6SA 3W7EA 2XVKA 4B5TA 1XDJA 5IDZA 1TJPA 2EBNA 1DPMA 4AYGA 3UZZA 5E70A 4XSLA 1PV8A 3ARVA 4GCAA 1BTCA 1XUUA 3RX2A 5HMFA 3CWOX 1ONRA 2PDNA 1YXDA 2YDSA 2FPYA 3NTYA 4V15A 2WZIA 1W56A 1TJ0A 4WDXA 4W8LA 3BV7A 1WO2A 3EDEA 1XIMA 3RILA 2ZRZA 4Y6GA 4LUTA 1H50A 3WKZA 1M01A 1JQXA 1XQLA 3CM4A 4CQBA 3O9NA 1TPUA 1ZBKA 2C15A 3IJQA 1XFCA 5HMSA 1BWLA 4H8VA 3BQ6A 3AU6A 3PZIA 1S2AA 5LIWX 3CL6A 1I2QA 3NYDA 1DIOA 4X3ZA 4E4PA 4IWWA 1TVNA 1ITUA 1WDWA 3GR4A 4JFVA 3G1YA 2WV8A 3W7PA 4QAWA 4MB3A 1Q6RA 2A7NA 3G2GA 4DNMA 4F0LA 3EWUA 3L68A 1LOLA 4DN1A 2YCJA 5D05A 1IXNA 4IXHA 3ITOA 1IXOA 1QPQA 3THQA 3VIHA 1T7LA 1EGZA 3PWAA 1W0MA 4LBRA 3NXFA 5LYRA 3F4VA 1XICA 1OC6A 2IPWA 4RDYA 4BK9A 4GNVA 4HTBA 2BY0A 1FWWA 2XFFA 3LCXA 2O9RA 1IF2A 3WENA 4V28A 1REQA 4LY4A 5B7YA 4NYYA 1DORA 4O13A 1T96A 2R9RA 1XINA 1ELSA 1KFKA 3CTLA 4G7FA 3DFHA 3BCFA 4DO6A 4M80A 4AD1A 1R0MA 4GJIA 3VU2A 1X7IA 4DJFA 4M7SA 2OX4A 1OK6A 5FI8A 4WDTA 1PDZA 3IGXA 5HNRA 1NFPA 3NZ1A 4LYPA 4ZQMA 4DWSD 2XN0A 2Z7GA 3W1TA 1VCGA 2F61A 3H7VA 3UXLA 3W1PA 3ZT6A 4JIIX 4KETA 3AYVA 3R0UA 3N4FA 2VRKA 2E6FA 3WQFA 3TP4A 1XCXA 4QE5A 1OINA 3QOKA 3MI3A 4QAIA 1V6TA 5TQLA 3NQ6A 3DBNA 1RQBA 3ITLA 4IJRA 2PRMA 1FWFC 1XW8A 2O7SA 3E3HA 3H8AA 2X7VA 3OHMB 2G4FA 4WLCA 1YDYA 4PMYA 1AH0A 1BG4A 3T09A 4EXQA 4Q6JA 3R8RA 4FP1A 4DPQA 2PLJA 4IP4A 2E7FA 1EHNA 2TMDA 4O11A 4JBRA 3N2BA 2V3DA 5AC4A 2O9TA 3HQPA 1NTHA 2W66A 2PDPA 1PKYA 4YS1A 4GI8A 2OLAA 1IGWA 1E3ZA 4FNRA 1PAMA 3NQEA 3ANYA 4X60A 1DQUA 1BVWA 4LVFA 4RKAA 5B80A 5E0KA 4O17A 1N8WA 5BU9A 5A8OA 3M0YA 3NL3A 4JNYA 1M7OA 3W7LA 1O5KA 3AHTA 1HP4A 4FZIA 1R2TA 3L12A 2ZVRA 1Q2SA 1K4GA 2WNWA 1Z42A 2YB4A 3W1LA 5A6JA 1S38A 4NAEB 3WLMA 1DXEA 3L4YA 5RUBA 4TX8A 4A3YA 2QIWA 5JQ9A 3VX1A 1DTNA 1W17A 3YPIA 3CQKA 3QMSA 4GIYA 4ZBCA 3NA8A 6XIMA 3QQ0A 3AS3A 2QPXA 4HNCA 4A3UA 2ZZ2A 2BWGA 1JNDA 1CGUA 1XGEA 4E8GA 4EOUA 2FZ8A 1XV8A 3SDOA 3T2OA 4AWEA 5CLWA 3LN3A 1QI3A 2GSJA 4E0CA 3CB3A 3IIVA 3BG5A 2RDXA 2ZX5A 3IK4A 4AXKA 2PDLA 1I2OA 1ZY9A 4MWAB 1HQTA 3RLUA 4NKCA 1SW0A 3GE7A 4WRHA 4LC6A 4DAIA 5DEZA 4L6HA 1FBAA 4MMWA 3EX2A 1RBLA 1WKEA 3S6DA 2GGJA 3WLSA 1EGVA 5LIYX 3QZAA 2FHCA 1BSLA 1VAHA 2Y7GA 1TUFA 2QMKA 1GT8A 1YW1A 3S5ZA 1M7PA 3EPMA 3GU2A 4ADTA 1OABA 5I3IA 1XLAA 3PJXA 1EC9A 3AYRA 4K1GA 4FNPA 3RR4A 2DPEA 5ABGA 4F40A 4QSFA 2BB0A 2WPBA 1FWTA 1XIBA 4HNUA 1KD0A 2A3EA 1IQ8A 2XVLA 4PL2A 1ZUAX 3LERA 4DF0A 2VX5A 3WUGA 1B31A 7REQA 2A3CA 3VFCA 5GJMA 3SUUA 5LXEA 5AC7A 5F1VA 3DBPA 1J0ZA 4JEJA 3S2LA 3TE9A 1JPKA 1VBRA 1GVOA 2R24A 3N2CA 3OLDA 2PCQA 1HIZA 2QYGA 3N1AA 1Y0EA 4X9YA 4IPNB 1EWDA 1JPDX 4PMXA 2CITA 2V63A 4XUGA 3OP2A 1WKFA 4CU8A 5KINA 1LT7A 3RK8A 1A0DA 3QQ1A 3LGGA 3BSHA 3ITGA 3NOEA 5FIPA 5C55A 1ITXA 2A3HA 2EPMX 4H6KA 4ORIA 4WHBA 4XD5A 4M1BA 1YPXA 4S3GA 3VD9A 3CWNA 1IR2A 5FJTA 1DJNA 1WAWA 1FWCC 5E93A 1HJWA 1OADA 2BHYA 3RFAA 2WQPA 2P0OA 2QCNA 2Y2WA 4J1OA 5E9XA 3MP3A 1R5YA 3PVFA 4M5PA 1JQVA 2OGJA 4HYVA 5AVNA 3QGVA 2DSUA 4QIUA 2W62A 3WLIA 4US5D 4JHZA 4R34A 2I5QA 2Z6IA 5CXPA 9CGTA 3ZT5A 1K9FA 3EZ4A 3MQTA 3LHYA 4N42A 3EOUA