1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
1EO5A 2VMFA 2A3AA 2QF8A 4W8LA 4H8UA 3VIHA 4H04A 5CLTA 1UH4A 1Z32X 4CU7A 2AMGA 3T2OA 5BXSA 2BFGA 1QI4A 3VPLA 2CBUA 4XUYA 4P7OA 5A6LA 2WBKA 4HPGA 3SCTA 3WH6A 5DFAA 4PMDA 1J0JA 4UOQA 1B3VA 3UR8A 3F5JA 5DT7A 3TTYA 2ZOXA 3NJ3A 2DIJA 2QPSA 2YJQA 4K68A 5A6KA 1I1XA 2OWXA 2BVYA 2VQUA 3WD4A 5FD0A 5I3DA 5AY7A 1E70M 1WDQA 1GZJA 1XSJA 4P7LA 3VGDA 3I3BA 1F4HA 5KEZA 1JZ5A 1C3FA 1C90A 1CGYA 3LPOA 2VJXA 3AIVA 5CPQA 4PCTA 4MB5A 1FFRA 3ZMRA 4F79A 4E8DA 3O9NA 5JIPA 3SCRA 5AYIA 1CLVA 3VIIA 2WK2A 3N13A 2YKKA 3AS3A 4P8XA 4U2ZA 3PZMA 1QI5A 5GNZA 4PMVA 3WQ4A 2WHLA 1E5JA 2VRQA 3WD1A 4UR9A 1K9DA 4HTYA 1JIBA 1GONA 1VENA 3ZO9A 1UKSA 2X8RA 3WNPA 1HF6A 4W8BA 4LXFA 2VRKA 3HMCA 5ABFB 2QV4A 2VZUA 4FF5A 1ZBVA 2JALA 4CCEA 1H11A 4D6FA 4MNJA 3BAKA 3WBEA 1Q4NX 2Y8VA 2DSKA 2WCAA 3VUPA 5ABFA 4W7WA 4F66A 4TX6A 1EQPA 3WELA 1R7OA 5A6BA 1NWRA 3ARVA 2BXZA 1CXLA 1HJXA 5D9MA 3AXIA 7A3HA 2YDSA 3ECQA 3OGRA 3WEOA 1V0MA 4P8WA 4GZIA 1BQCA 1RH9A 1XH0A 3EDEA 3AHTA 4AEEA 1AQHA 3BAYA 1E4MM 1TUXA 1CGTA 1QI0A 2WZEA 1QI2A 3RO8A 2VI0A 4PMYA 5LA1A 4L4OA 2EQDA 3HU7A 2X09A 1BHGA 3KL3A 4UQDA 2YBTA 3VD4A 4F9DA 3HN3A 1N82A 2FH8A 1CZ1A 4HOXA 2WB5A 3WQ8A 1B2YA 1XCXA 4V27A 3AI0A 3HJEA 2ZIDA 3CGTA 1CTNA 4PTXA 3ZSTA 2QLYA 4MTVA 2CPUA 1J01A 1V6YA 1JI2A 4KMQA 2O9OA 2BHYA 4A3YA 2VZOA 4M81A 4PSPA 4UFMA 2VUYA 3K4DA 1HT6A 2BHUA 4OUEA 5I78A 1ZU8A 1JXKA 3N17A 2ZX5A 3JUGA 3OLIA 3SCWA 4FLSA 2WVUA 2CETA 1OB0A 4WK9A 4M8UA 1QI3A 3EDDA 4MB4A 4GI6A 2J79A 2JFEX 1W9DM 3NSMA 3KE0A 2XPKA 5CQ1A 1R7AA 3VDCA 3WMCA 2V3GA 2PWEA 5EFDA 3SUUA 4PMRA 5F7UA 1W9BM 4CD5A 1O7AA 1EIBA 4CN6A 3U57A 1C7SA 3WDPP 1UD2A 4MNLA 2VR5A 2D23A 3CUJA 3BAJA 3U5UA 4LGXA 1JDAA 1GOMA 3CIVA 2WXDM 2XVKA 2QMKA 1G1YA 3AQUA 4HA1A 5A6AA 1ISWA 5CLWA 1XH2A 5I23A 3PN8A 2CCRA 1CNVA 2UY5A 1OIMA 4PMNA 1WAWA 3SCPA 2ZX6A 2J7BA 1CDGA 3AIWA 1LF1A 1HVXA 4Q22A 3GDBA 3FAXA 5AYBA 3ZJ6A 1O6IA 4OOUA 4H7VA 4AZ6A 2D20A 4AZBA 1ZJAA 1E6NA 3GXDA 1XSIA 4GQQA 3SUTA 5C8BB 1TMQA 4AD5A 3FNDA 3VNYA 3UETA 3WKZA 2WBGA 1BYAA 1MQPA 4W84A 3POHA 2J62A 3ARQA 3T0BA 1SYTA 1K9EA 1U2YA 1Q6EA 3MUAA 4PMXA 3VILA 2B31A 2XFYA 4UOZA 1OD0A 4KRUA 5D4YA 4OIFA 3ZJ8A 1W9VA 1WDPA 3BAWA 4CN1A 1CXHA 4AD1A 4D71A 1FOBA 1DWIM 4PMOA 4BZYA 4M24A 1CPUA 1VAHA 3ZQ9A 2GFTA 2XM2A 4QLLA 2V38A 3CZEA 3ZOAA 1PX3A 3W24A 3WL0A 2BY3A 2FHFA 2Y5EA 2D3NA 2ESCA 2Q8XA 4D6GA 2RGMA 1IZJA 3GZAA 1UA3A 2WMJA 1NP2A 3MANA 1A47A 1PIGA 3QGVA 1FHDA 1TVPA 1E3ZA 1HNYA 2YA1A 3VMPA 1JL8A 3DYOA 1W1VA 1JYXA 4H8VA 4B9YA 5DEZA 3M07A 4ZEPA 4IM4A 1KB3A 4C90A 1OBAA 2J47A 4PYSA 4FLQA 1GVYA 3BCDA 1GQIA 1VJSA 1MFVA 1W3JA 1UD5A 3ZSSA 1BPLB 3TP4A 1KWGA 3K1DA 4L4PA 1J0KA 1GNXA 2YDRA 5TD4A 1UA7A 3WNOA 1JG9A 3TA9A 4RE2A 1JYNA 2PI6A 2ZUNA 1MXGA 2E8ZA 1LJYA 2D3LA 1OT1A 1UD8A 1OD8A 2XG9A 3AIRA 1VBUA 5GPRA 3AMKA 2ZUWA 1PZ3A 4CUCA 3IAQA 4HZ7A 2DH3A 3SCSA 3K46A 4N0RA 3WD3A 4CD8A 4H2CA 1MW1A 4FK9A 2NW0A 5A8QA 1VIWA 1W9PA 3GXIA 2Y24A 2VT0A 1TA3B 3CTTA 3ZT6A 1D7FA 4W88A 4JFUA 3WQ5A 4PTVA 4MPKA 3U7VA 1H09A 2W92A 1JAKA 3WSUA 1TA3A 2J77A 1UR0A 1JZ3A 1C92A 5I0DA 5ABGA 4AD0A 1KGWA 4ZFMA 1NWSA 1ISXA 2X0HA 4WKHA 5A8NA 3THDA 1PJ9A 1B1YA 4PTMA 1FP9A 1ITXA 4EKJA 3OB8A 1UZ4A 2G4FA 1FA2A 1BVNP 4JIEA 4BF7A 2FDMA 4GZEA 1X6NA 1WO2A 5HNNA 1BGGA 3FW6A 1NARA 2BNJA 4P7RA 1EXPA 3VOCA 1GOWA 1US3A 1H2JA 1V08A 1W91A 2PWDA 4IISA 2JE8A 3ARSA 4W89A 3AS2A 4ZE4A 3WDIA 3VDAA 5HDRA 1TFVA 3WY1A 4B15A 1YQ2A 1KCLA 1QOXA 4B9ZA 3OIHA 5A6MA 1B90A 1GCYA 4GI9A 3WIJA 1J10A 4MJ4A 4J27A 4EAMA 2GSJA 3WDQA 2W4XA 2O92A 4PEEA 3ARZA 1XYFA 4GIAA 1DWJM 6TAAA 3ZT5A 1E4IA 1B0IA 1OCQA 2EO7A 2WCGA 4WSKA 3W25A 1E43A 3CHCA 3SURA 2DSUA 3RMEA 1NOWA 2VRJA 3ZR5A 5ECUA 1IV8A 4TUFA 4WSJA 1OGSA 1NH6A 2W66A 1GOQA 4BQ3A 1KBKA 1MWOA 3AMCA 1XGZA 2XVLA 1E56A 4QLJA 4MDOA 1HL9A 1CIUA 4BQ2A 3VGFA 3PZOA 3UERA 2EBNA 1UKTA 4JFWA 5IHSA 1BAGA 2EPNA 2AAAA 1HJSA 3VIMA 2WCSA 3RM4A 4U3CA 1DHKA 1QNOA 1EDTA 5GNXA 3VGHA 3CZKA 4HZ8A 2XYLA 4JCMA 4HMDA 2EXOA 3VIFA 3AIEA 3UESA 5AC4A 4UFHA 4MNKA 4CD6A 1ZL1A 2WNWA 2DSVA 2YIHA 4DUXA 3OA5A 1XC6A 3NCOA 2NT0A 2XM1A 3VX1A 1TE1A 1CEOA 2YDQA 3PBGA 2W5FA 3GH7A 2WSKA 1LQ0A 1MYRA 4C7GA 1R8LA 4AIEA 3OBAA 4JZ5A 1PX8A 1HX0A 5DO8A 4BQ5A 4PMQA 3WUFA 2XFRA 4U5IA 5I24A 1X6LA 1J0YA 3AISA 1LL6A 3A47A 1Q6DA 1KGXA 2E9LA 5JBEA 4S3KA 4UNIA 1TVNA 4ZXLA 3AHXA 3GM8A 3N15A 3VIKA 5KZ6A 1BF2A 3WBAA 2E9BA 1FH7A 1QHZA 2D24A 1KCKA 1H41A 4F8XA 1WKYA 4AZIA 5HPOA 4GXPA 1ZJBA 1E40A 1VB9A 2J7GA 3ALGA 1RP9A 5CGMA 1UHVA 3WF3A 9CGTA 2C0HA 4D1JA 3NUKA 5IFPA 2XSAA 1R86A 6CGTA 3MSGA 2PWFA 1UKQA 1E6ZA 1OIFA 2ZX9A 3APGA 3ARPA 4HA4A 4EK7A 1C8YA 1QW8A 2UY4A 1XD0A 3OZPA 1GJWA 1E15A 1VEPA 4J3SA 3WH9A 3TONA 2PB1A 2G41A 3QR3A 2BS9A 4NRSA 2J7FA 1Y7VA 4RE4A 3AMLA 2E8YA 3AHYA 4AZHA 5BWFA 1OT2A 1CXFA 1HN1A 3WD0A 3WUGA 1XHGA 3BAIA 3OLEA 2WVTA 3SUSA 1WP6A 1J0HA 1CGWA 1E6QM 3N11A 1ESWA 1UR2A 3GNPA 1KGUA 4KGLA 2WLYA 3SCUA 2BY1A 5A69A 1UD6A 2J25A 1V0KA 5LA0A 4ATWA 1Q6GA 5JUVA 2XJ7A 3MU7A 2G3IA 1RD6A 3MUY1 2OLHA 5FOOA 3F4VA 2PBGA 1OSEA 4X0VA 2XWDA 3CUGA 1JNDA 1CENA 1ISVA 2PF0A 4PCSA 4LX4A 4AZ5A 5C71A 2VURA 2OSYA 4MDPA 3U5YA 1QNPA 3WL1A 2J7HA 2DGAA 2J7DA 4B3KA 4ZE5A 3M6DA 4WJXA 1UWUA 3RM9A 4XB3A 1WDSA 4Z2JA 3VMNA 1EDQA 5A2BA 4AZGA 3GBDA 1G01A 3OLDA 4UFLA 4WKFA 4PRWA 2Z1SA 1E5NA 4EANA 5A6SA 2OSXA 2VX7A 3SUVA 3WNKA 2WSPA 2ZXAA 3BMWA 4WIWA 1JGIA 2VCAA 3LMYA 4CGTA 2JEPA 4QP0A 1LG2A 1BGAA 4Y7EA 2DIEA 1UR9A 3BCFA 2XIBA 2CIPA 1VFUA 1CXIA 3WN6A 3WF0A 3UG4A 1EA9C 1H1NA 4ML4A 4E2OA 2WYSA 4CCCA 3MV01 3BLPX 1QVBA 1DWHM 4UZUA 1HJWA 1EDGA 2YL6A 4PTWA 4ATDA 2VC9A 2XGIA 1E6XM 2ZE0A 2A3EA 1G94A 2XTKA 3CZ8A 1GJUA 1MFUA 2BY2A 1XYZA 1FHLA 2AOSA 1E0WA 1W3KA 4WF7A 1PPIA 1KQZA 2FHCA 4DWSD 4R5EA 2E9MA 1VFMA 4RE3A 3W82A 1UG6A 1UQZA 4DWSB 2EJ1A 4IUGA 4NI3A 4TXEA 3ARUA 1GQLA 3W38A 3W53A 5FL0A 4CD7A 4PN2A 3WEZA 4URIA 4D1IA 3IK2A 2YBUA 4MNMA 4XZWA 5A3HA 2WC4A 3AJ7A 4M80A 1KWKA 1HJVA 2BY0A 3CZJA 4CU6A 3AROA 2XGBA 5A8MA 3VU2A 3MO4A 3WNMA 5FCZA 3VKKA 1QW9A 3VVGA 2DT1A 3CBWA 5ABEA 4J3TA 4HPHA 3OGVA 1NOUA 1EGZA 2J74A 3VIGA 3CUIA 3CMJA 3VIOA 2X2YA 3GNOA 2E4TA 2WWDA 1X1NA 3WH7A 4LQ1A 1MQRA 2O9PA 1R87A 2YLLA 5D8ZA 1TR1A 5CSYA 4MB3A 1RP8A 3L2MA 4P8VA 1UR1A 1E1FA 4PBGA 4UFIA 1H0IA 1DTUA 1NWTA 3A4AA 3VD7A 3CZLA 3RJXA 3T0AA 2OWCA 3THCA 1EOKA 2WVSA 3AIUA 3AICA 1AQMA 4J3XA 3O2LA 1VRXA 1W2PA 2BXYA 3BGAA 3L4VA 5CZKA 1US2A 3S6TA 1BVZA 2GJXB 2UY3A 1JNEA 3IJ8A 4AC1X 2WMFA 5A8OA 2FGLA 4EE9A 2CHOA 4D6DA 1UWTA 2GJXA 2ZXDA 3NYDA 2HVMA 2D0GA 1LL7A 1J0IA 1EH9A 3A3HA 5ABHA 2X1IA 3MUZ1 1KXQA 4Z2KA 5HXMA 2WLZA 5BRQA 3ARYA 3DC0A 3AFBA 4UFJA 4UQ9A 1CGXA 1UWSA 3UG3A 3FN9A 3UEQA 1GVIA 3U7BA 2QMJA 2W61A 1Q6FA 2PBOA 3POCA 3N12A 2DH2A 1B3ZA 2J78A 1ZS2A 5HOSA 1V3IA 4NZCA 2J4GA 4OZOA 1C91A 4NF7A 1E6SM 3GXFA 2V5DA 1BSIA 2DT2A 1W9XA 1PBGA 2GDUA 2PC8A 2WHKA 1BG4A 2WANA 2W62A 5A6JA 4AD4A 5DF0A 4D6IA 1R85A 2CBJA 3SIMA 1CGVA 3N18A 2X0YA 4PMUA 1DWAM 5D9NA 2D2OA 1C93A 3VD9A 1JFXA 4MB1A 1DEDA 2QHAA 4AXNA 3ARXA 3K8KA 5C70A 1WNOA 3ARTA 1TG7A 1U33A 1MW3A 1EQCA 1OM0A 2VCCA 3DYPA 3BLKA 4JKLA 3VGBA 3RM8A 3N04A 4M56A 1J11A 4UQAA 3CUHA 1QNSA 3WFLA 4C7FA 1W3HA 1XCWA 2J8FA 4AEFA 3ZJKA 3NSNA 2CYGA 4BQ4A 4M29A 2C7FA 3MS8A 5LYRA 3WF4A 1HKIA 1VBRA 2GJPA 1JD7A 1NM9A 1SR0A 4R27A 3VGGA 3TOPA 4XZBA 5I5RA 1QBBA 2WMGA 4E8CA 3ZIZA 3W6LA 3WQWA 5DT5A 3QHOA 1EO7A 1UUQA 2ZUSA 4TTUA 4QAWA 4W7UA 3PZIA 1OINA 2VZVA 4JAWA 1JDDA 2W63A 1UKOA 3L4UA 2Y4SA 5BROA 2WW5A 3AZTA 1DP0A 2YA0A 4GZJA 3W81A 2V3EA 1PIFA 1V3LA 1GQJA 3VINA 5BXTA 2D0FA 7CGTA 5HBFA 3EDJA 5M5DA 4ACZB 3SUWA 1H0GA 4W93A 3ZT7A 4P8UA 4MAZA 1OGBA 4WKAA 1OWQA 1ZBKA 3PZNA 1UR4A 4C7DA 2V3DA 3NDYA 4ACZA 3ZJ7A 3AOFA 1XSKA 3K8MA 1LL4A 4H8HA 2VX4A 4D72A 3AS1A 4TVDA 3BXWA 1B3XA 2XSBA 2WMHA 1VEMA 2XUCA 4LPCA 3VX0A 2VCBA 2A3HA 2PWHA 4QLKA 2DSZA 1GOIA 4YHGA 3WQ6A 4Z2IA 2Y2WA 1IZKA 4NSBA 2VNCA 1DWFM 3AIBA 3EYPA 4CD4A 1GHSA 5AC5A 1G0CA 3WQVA 1LWJA 1GUVA 2TAAA 2DPEA 3D3AA 4HA3A 1JFHA 3PZGA 2XHYA 2ZICA 2E40A 2OYMA 1DWGM 2G3JA 4TTGA 3VDBA 4HU8A 3FHQA 1ZBCA 5IHRA 2GK1B 1GQKA 5M03A 3IJ9A 1CBGA 1ECEA 4HU0A 2WAGA 3SCQA 1CGUA 2GK1A 1M04A 3SCVA 3QOKA 3SCNA 1UZ1A 1CECA 4GQRA 1QNQA 4JHZA 1D3CA 2F61A 3B9EA 1H4PA 1UQYA 2NSXA 1MW2A 3OZOA 1V02A 2W67A 2GDVA 5D8WA 4JFVA 3PZTA 5CJ5A 5A95A 2J75A 1JF6A 2DEPA 8A3HA 1E3XA 4AD2A 3WDRA 1JYWA 3CH9A 4J3VA 1HIZA 3WH8A 6A3HA 1C8XA 1JZ7A 1BYDA 2G8ZA 4UZSA 2V3FA 3AHVA 4J3UA 1EHAA 2WHJA 2VZTA 4ACYA 2IUZA 5A2CA 1ITCA 2YOCA 3CHDA 3G6MA 4HMCA 3GNRA 3RILA 3KL5A 2MANA 4JL2A 4Z2LA 2QPUA 4JCLA 4JFTA 1MQQA 4H41A 3N1AA 4PUDA 4TVCA 1B30A 1E0XA 2DT0A 1M01A 1E55A 3GBEA 4OBRA 5CPSA 5E9AA 2XVGA 1K9FA 1JAEA 1QNRA 2OYKA 1V03A 5CXPA 4OJYA 4UTFA 3EMCA 3ZR6A 1W1PA 2WKGA 3DHUA 1MXDA 4F9JA 1VJZA 3IJ7A 2OYLA 3WNLA 3AZRA 4QCEA 1CXKA 1J9YA 4AYSA 1V6VA 2D1ZA 1WB0A 3PTKA 1NWUA 3VO0A 4MADA 3T09A 1J12A 1HVQA 1PX4A 3BC9A 4NRRA 5HPCA 1I75A 1JD9A 1M53A 4TVUA 4PUEA 2Z1KA 4GI8A 3T08A 4FMVA 3O6AA 2J7CA 4J28A 2EPMX 1RPKA 2BHZA 1K6AA 1G5AA 1HP4A 1UYQA 5EMYA 4XX6A 2XWEA 1J0ZA 1QPKA 3L2LA 1HJUA 5A6BD 1WZAA 3CHFA 3GH4A 3RPMA 1C7TA 1E4LA 7TAAA 4UCFA 2YLAA 1K9TA 1KR0A 4HOZA 3VMOA 2E3ZA 2XVPA 2XFFA 3SEPA 3PZUA 1XRVA 4TOQA 1BTCA 3F5LA 3WNNA 1P6WA 1UH2A 2DDXA 5I77A 3WF1A 4QFUA 4J3WA 2O9TA 3ARRA 2JEQA 3W6MA 5E0FA 3MV11 2D22A 2Y8KA 4X0NA 3CLWA 2CNCA 4JKMA 3BH4A 3L4ZA 3AS0A 5E70A 1CXEA 3ZM8A 2WWCA 4LYPA 2OWWA 1V0NA 2F8QA 4XV0A 5BRPA 3CHEA 3W26A 4YPJA 1E6RA 4V28A 4D6CA 3WF2A 4GINA 3WDHA 3AZSA 4P7QA 1L0PA 1Q6CA 3QOMA 3TTQA 3B8SA 5E6ZA 2WMIB 3GYCA 3QHMA 5EBAA 4UQEA 3ARWA 1V02E 3FHAA 5LA2A 3K8LA 2X05A 3WUEA 4FLOA 2VO5A 2WMIA 5A2AA 5BYWA 4PMZA 4U3AA 3AYSA 1SFSA 4ZENA 3S2CA 1ZB5A 2BV9A 3CO4A 4J7RA 1WE5A 3FXYA 5GQBA 3KWXA 3M7SA 1AVAA 3CPUA 3AMDA 1UR8A 4AD3A 1PEZA 2CESA 4U33A 4D6HA 2EPLX 3W28A 4MAVA 4IPLA 4U2YA 3VD3A 4D6JA 4GPNA 3NDZA 2V5CA 1KQYA 4Z2HA 1B31A 2FH6A 4IPNB 4A3HA 2GVYA 1WDRA 3I3DA 1ODZA 1ODUA 1U30A 4W5ZA 3M46A 2JIWA 3OLGA 2VX5A 4C91A 1E0VA 4JKKA 1VF8A 3E1F1 1ZBWA 3AHZA 8CGTA 1XD1A 1E72M 4DWSA 4V2XA 2G3NA 3RCNA 3T2PA 1LWHA 3WH5A 5FIPA 3EDKA 3NSXA 1SMDA 3GTNA 1QHPA 2WZHA 3A6OA 4GO8A 1V3MA 2RGLA 4HMEA 2YA2A 1JZ4A 4UFKA 2VVNA 1UWQA 5E6YA 1A3HA 4W5UA 5DMYA 2ZWZA 4DUWA 3AIQA 4AISA 2ZXQA 3K4AA 1H49A 2CITA 3WENA 5BXRA 4QCFA 5CG0A 4JL1A 4LYRA 3AMGA 2HISA 3GXMA 1AQ0A 2JIEA 2C8NA 3EDFA 3L4YA 2CXGA 4AZCB 1UWRA 4CVUA 4B3LA 4S3JA 1BYCA 1E1EA 1JZ2A 1QHOA 3N9KA 4W8AA 4AZCA 3CUFA 1GPFA 5EFFA 1H3GA 4KRTA 2VR4A 4CU8A 2D0HA 1JYVA 4UQCA 3WMSA 4UQBA 1KBBA 2YL8A 3BSHA 3CZGA 1CYGA 2XVNA 3AXHA 2GJRA 4W85A 3ALFA 4N42A 4DM1A 3LPFA 3WD2A 4GO9A 1CWYA 1C8QA 1E4NA 1M03A 1WZLA 1SMAA 2NT1A 3OG2A 2YL5A 1NP0A 2CEQA 4CCDA 4HP5A 1I1WA 1BYBA 3DECA 5CPTA 1E9LA 1FH8A 3MMUA 1NQ6A 4BS0A 2CKRA 1HKKA 4AIUA 3L4WA 1GOOA 1B3WA 1UKPA 4GKLA 1JZ6A 2WC7A 2VX6A 4QDMA 3A4WA 2WHMA 1S46A 1VFFA 1J18A 3PTQA 1GHRA 2DT3A 1ISZA 1CLXA 4TX8A 3TTSA 2WMKA 1BG9A 2CBIA 3LPGA 2WVVB 3L4TA 1TZ7A 5M17A 2IXUA 5FKYA 3VM5A 2CERA 3LPPA 1W1YA 1PZ2A 1WPCA 3G6LA 5I2UA 2ZUTA 3D5HA 1BLIA 2W91A 2WVVA 4E4PA 1GOKA 4CVWA 4JFSA 1VEOA 3RIKA 3EMQA 2ZUUA 3B9AA 4X9YA 3W37A 1XH1A 3OGSA 3MUIA 2VL4A 3CMGA 2FGZA 1BFNA 1HKMA 4RL3A 5D9OA 3VDHA 3WFZA 4A4AA 2A3CA 1JDCA 4Q7NA 5FL1A 1OGGA 1G9HA 1UWIA 2F2HA 3PTMA 4AY1A 1GORA 2BVDA 3PZQA 2IXVA 2WM0A 4BA0A 3MMDA 3VM7A 4Z2GA 1HL8A 1QBAA 4YHEA 3RDKA 1H5VA 2VZSA 5M3WA 3TTOA 3KEHA 4M82A 4DUVA 1KXTA 3MKKA 2WZIA 4AWEA 3UR7A 3AXXA 4KWUA 1UH3A 4ZXOA 1EHNA 4AW7A 4MJ2A 4B16A 3MMWA 3SCOA 2ZWYA 1B9ZA 4BCEA 4WLCA 3T0DA 4JHOA 1E6PA 2J8GA 1W9UA 2ZXBA 5JIWA 1V0LA 1UD4A 2EPKX 4D6EA 3VTRA 1E71M 5A94A 3B9DA 3EMZA 3BAXA 3W0KA 3IAPA 3W4RA 3FAWA 4DWSC 5I79A 1XV8A 1LG1A 2ZUMA 5IXEA 2ZX7A 3UCQA 1MW0A 1V6UA 1LLOA 4AZ7A 2EPOA 2G3MA 3VGEA 1KXVA 1M7XA 1HKJA 1FH9A 1KR1A 3W27A 5GNYA 2XIIA 1W1TA 3GH5A 1V6XA 3DYMA 3T2QA 1UD3A 5IFTA 4UOJA 1HP5A 2DSWA 3NIYA 3WMBA 3PZVA 1L8NA 2E0PA 5JBDA 5BXPA 3VD5A 3BMVA 4W86A 3UG5A 3PZ9A 1JZ8A 1AMYA 1TCMA 5A8PA 3WDJA 5CSUA 2WPGA 3MSDA 1W32A 1WZMA 5IDIA 2VTFA 2ZUVA 4M1RA 4FLRA 2VVSA 1KXHA 3L4XA 4OBSA 1FP8A 3BSGA 1NOFA 3VIPA 1IT0A 2CKSA 2PWGA 1E73M 1JF5A 4P7NA 3VIJA 4HOWA 4ATLA 1VFOA 5D9PA 3DHPA 2O9RA 3A4XA 4YN5A 1FFQA 1UOKA 1V3JA 2VQTA 4CKQA 5JBFA 4AIOA 1EOMA 4U5KA 3WEMA 2J7EA 3J7HA 5BCAA 2WC3A 1PAMA 1V6WA 4KGJA 1HJQA 3I3EA 4OKDA 2WKLA 1JI1A 1W2VA 4LYQA 2CHNA 2EEXA 1WCGA 4PSRA 3KZSA 4W7VA 2JF6A 3RJYA 4CN4A 1HXJA 3F5KA 2OSWA 1JXJA 4OOZA 5A1AA 2YL9A 1YHTA 5E09A 3KL0A 2CBVA 3VNZA 3IANA 4W87A 2JF7A 2UY2A 1B3YA 4DM2A 5I6SA 2DQXA 2A3BA 5E0CA 5CGTA 3FY1A 2ZX8A 4KH2A 1ISYA 1V3KA 4HZ6A 3II1A 2FHBA 1GW1A 2GUYA 1V3HA 3WUBA 3AYRA 4U31A 2VOTA 3PHAA 1W3LA 1KFWA 1F4AA 2UWFA 3QHNA 1D2KA 3EBVA 2BVTA 5EB8A 1MVYA 4AMCA 3W29A 1WZKA
chains in the Genus database with same CATH superfamily
2VMFA 4RR4A 3USBA 1F6KA 4HNUA 1IEWA 3MW7A 1AW2A 5BXSA 1CB7B 3CUZA 2X7VA 3GNDA 4P7OA 5A6LA 4HPGA 4QSHA 3B3DA 4ZCWA 5DFAA 1X1OA 3NQGA 4PMDA 3RNDA 3UR8A 3VABA 5DT7A 2ZOXA 3FV9A 3HFYA 1K8YA 3GDKA 1I1XA 2VQUA 2BVYA 5I3DA 5AY7A 3SO7A 2ZTJA 3PULA 3FA3A 4P7LA 3VGDA 1EWDA 4DAFA 1R2TA 3WLMA 1R0MA 1JZ5A 1C3FA 3WQGA 3CUXA 3AIVA 1TWSA 2NQHA 2I16A 4PCTA 2FZBA 4GYKA 3ZMRA 2INEA 5JIPA 1S5WA 2J9XA 4RZBA 1MRQA 4N9CA 3N13A 2VWSA 4U2ZA 3QRHA 1JQXA 1FY6A 4EX4A 3LHUA 3WQ4A 4UR9A 1YE6A 2PP3A 3DXIA 1OX4B 4X22A 2RAGA 4ZFCA 1PCKA 3GS6A 3VNKA 4C6BA 4OV4A 2X8RA 5AKQA 5T91A 2VRKA 2DV0A 5CPLA 4D6FA 4MNJA 3W75A 1D7KA 2IQ0A 1XPYA 2DSKA 2GOUA 1EQPA 2BG5A 1KBIA 4JTLA 2V5BA 1LZOA 1NWRA 2HXUA 2BXZA 1CXLA 2RJGA 2XN0A 1ML1A 3UXDA 3JW7A 1BQCA 5DXXA 3IIPA 1RH9A 2IKJA 4O10A 2RDXA 3BAYA 2V5JA 1UIOA 3WJWA 4ZTXA 2Y70A 4R7JA 2X09A 4HIBA 3FDGA 2YBTA 3GD6A 4XBSA 1XJBA 4N9DA 4F9DA 4DBEA 4HOXA 3P60A 3W7LA 4ROPA 3WQ8A 3G3DA 1B2YA 2QLYA 3UNTA 2CPUA 1IWAA 1XBVA 4B2DD 5HANA 2VD9A 4PR4A 4KMQA 2O9OA 4U28A 3N4AA 2VZOA 3WJXA 1HT6A 4O1AA 4DAIA 1ZU8A 3LYEA 1XYLA 4A8LA 4N6EA 1O5XA 3W70A 3RLUA 4GACA 4V33A 4GI6A 1TTIA 1XYMA 1ZCOA 3NSMA 1QPQA 1SSGA 1N55A 2PWEA 3R12A 2ZZ4A 1KFJA 3HV8A 1W9BM 2J88A 4I9AA 3QY8A 4EXBA 3UW6A 3R89A 5CPNA 1EIBA 4G7EA 7ODCA 3U57A 3WDPP 1UD2A 2DVXA 4ZQMA 2QGHA 1A4MA 1NDYA 3CUJA 3U5UA 1JDAA 4NAFA 1UROA 2WXDM 2WNQA 3ABRA 3TNOA 1T41A 1I2QA 3V3WA 2HE8A 5HR6A 3KBJA 4F0SA 1DJIA 2PDCA 3DKJA 1ONEA 1RJRA 5I23A 3GFYA 1GG0A 3H23A 4QBXA 1L2UA 2J7BA 1LF1A 5CZJA 3KUMA 4DJDA 1TPC1 1H62A 2DQWA 3KOFA 4Z17A 4DXXA 3BLIA 2NXHA 4JXCA 1XSIA 5D30A 1UBPC 3GYEA 2WBGA 4ENLA 3HQOA 3POHA 1REQB 2JKEA 4FX6M 3VA8A 1AA1B 1PTDA 1Q7ZA 4OU1A 3EA2A 3MUAA 4PMXA 3FGCB 4GVGA 3EKZA 4UTWC 4MWAD 1TJ2A 4H19A 1LBFA 1EFZA 2YW4A 3ZJ8A 4CN1A 5BNKA 3TJIA 4AD1A 1A5BA 4QLLA 2V38A 3ZZ1A 3CZEA 1TJ0A 4Q6JA 4GIRA 1QO2A 5KZEA 5C5YA 2Q8XA 5I3HA 2CZ5A 2R1NA 2BLEA 2OT1A 2DZTA 3GZAA 4TQTA 3OW1A 4KIEA 1A47A 3KVKA 5CZTA 3QGVA 3RXZA 1SPQA 3A4JA 3QR0A 1TVPA 5FACA 1E3ZA 4H8VA 1MUWA 4B9YA 4ZEPA 1PWLA 4C90A 4PYSA 4EPEC 5T9CE 3RCMA 3BCDA 4HQVA 1MFVA 4GJ1A 2A7PA 2HQAA 4IL2A 1BPLB 1KWGA 4L4PA 4HPNA 4G5DA 3A13A 4KEVA 4JIQA 2YDRA 4TV5A 1FWCC 1P1MA 1J5SA 3LCFA 3WQCA 5CC3A 4FNUA 2PI6A 4K6AA 3QJAA 2E8ZA 1GVEA 3WLJA 2E6AA 3QV6A 3N6JA 1KM4A 5CC7A 2XG9A 4K2SA 2WJDA 4ZOAA 2EG6A 5AECA 5GPRA 3TC3A 3AMKA 2OODA 4A3QA 1PZ3A 2YDAA 3IAQA 4UBPC 2DH3A 3K46A 3EA3A 3WD3A 4FK9A 1F9CA 3NO5A 4JIIX 1J2WA 2Z00A 3CTTA 2PDLA 1TA3A 1UR0A 1E9YB 3W1PA 1JZ3A 1V5XA 3HMJG 3ZS4A 4AD0A 5CAHA 2VHLA 2XN1A 4GI4A 1X38A 1UR3M 5A8NA 1B1YA 4O0QA 1FP9A 5DANA 1TWDA 2R1MA 4IMFA 4DO5A 1UZ4A 1BVNP 3GXPA 1X6NA 4NX0A 5TF0A 3FW6A 4WJEA 4HVXA 3BDKA 1SO4A 4GCAA 3GUGA 3NQ2A 1GOWA 1US3A 1I45A 1TR9A 1OZQA 2PWDA 4PFMA 1QNVA 3M41A 4IISA 3FOKA 1FWSA 3ARSA 4EVZA 1S2VA 3WDIA 4B15A 1YQ2A 1KCLA 4KW2A 1QMLA 3IK4A 2QCLA 2E6YA 4GI9A 3IIZA 3A12A 3WIJA 5HNUA 3EPNA 4J27A 3OODA 4MM1A 4BWLC 1K4HA 2O92A 4PEEA 2Q6ZA 4BI6A 6TAAA 3ZT5A 4B92A 4ML9A 4ZO6A 3LCXA 4WSKA 1E43A 3CHCA 3SURA 4DBWA 2Q8ZA 4HN8A 3WQOA 3ZR5A 5ECUA 1YE4A 4RPQA 2VEGA 2Z0IA 1OGSA 4WDTA 2R94A 1GOQA 1LRTA 1MWOA 1IEXA 1E56A 1RQEA 2ADAA 1QK0A 3DZ1A 1G7UA 3EXSA 1HL9A 4YJ5A 3RLHA 4H6QA 4C65A 3E0LA 1BAGA 2EPNA 5J5RA 3T0TA 3TK7A 1RHCA 1V7AA 1UB3A 1LDCA 3CZKA 4HZ8A 4QJ4B 4PUKA 2QJJA 3VIFA 2AQOA 3HG5A 3MA8A 1QK2A 2WNWA 1YXCA 2DSVA 4RX0A 4MOZA 4LAMA 1U5HA 1OK6A 3OA5A 1XC6A 3NCOA 2NT0A 5HUOA 3FJLA 2QJMA 1I6NA 2GPTA 1GK8A 3GH7A 4FR6A 4NT0A 4ZO8A 4WDXA 3UFYA 1VFTA 4XAFA 4AIEA 2XDFA 1HX0A 4PMQA 3WUFA 4OECA 4RV8A 2CLIA 1RPXA 1IZCA 4LVDA 2DFAA 2E9LA 5JBEA 1U1JA 2HSAA 5FSDC 3DGRA 3AHXA 4KPLA 2WJEA 3W7EA 1BF2A 3QGAC 5KTLA 3WBAA 2D24A 1M7PA 5H8MA 2QCCA 5BOOA 3PJTA 2OGYA 5J5DA 4AFYA 4MKNA 5DMNA 4LC8A 4WXZA 1VB9A 2XIJA 3MHGA 3LCGA 3ALGA 1A53A 1Q6RA 3CB8A 5G1TA 1ZFJA 3NUKA 5IFPA 2PWFA 4JN7A 1UKQA 2ZX9A 3APGA 5AYZA 4AVNA 4HSOA 4Q7IA 5A6TC 1FCUA 4IQEA 1IIHA 3NGFA 2BS9A 3H2NA 2H3BA 4L65A 3IPWA 4IIGA 4O1DA 2E8YA 4JN6A 3MPGA 4AZHA 2Y85A 3WD0A 5LXEA 3WUGA 3BPWA 3W7GA 3T42A 1CGWA 1E6QM 1KTNA 1O5QA 1SQ7A 3BCJA 3E9AA 1XQLA 4KGLA 2WLYA 3SCUA 5B7YA 2Z6JA 2PODA 3R5EA 5FAJA 4HNOA 4GY1A 3MKCA 2VEMA 3TX9A 3MUY1 3BG3A 2IPGA 4XD3A 3VOGA 4EXAA 3NZRA 2PF0A 4PCSA 4Q8QA 1LBLA 4LX4A 5D33A 4AZ5A 3HV9A 1QNPA 4EIVA 2J7HA 2J7DA 3L0KA 5FA5A 3TYAA 4WJXA 3U0HA 1OFDA 2RFGA 3FVMA 3K13A 3THQA 1KRAC 2Q02A 4R7WA 1FDJA 1EDQA 1OC5A 3UCCA 2J24A 4AZGA 1ZQ5A 3OO2A 4NNBA 5DQPA 3GAKA 3M0VA 4EANA 4GNVA 2NWRA 2Y61A 4PCFA 3JVAA 2IKGA 4ADSA 1IR2A 3H4GA 5FEWA 4CQDA 1Q2RA 4RLIA 4CGTA 2JEPA 3NTYA 4Y7EA 2DIEA 3AO0A 1CXIA 2ZVIA 3WN6A 3KOYA 4EF9A 1CW2A 1P1XA 4ML4A 3TWBA 2F6UA 1EP1A 4RDVA 4YYCA 1KKRA 4FHAA 1EDGA 1FWGC 1XL9A 3W87A 2P3EA 3P80A 3TVAA 4G1NA 4JTUA 1BXNA 3VOIA 2ZZ3A 2G5WA 3KVJA 1XYZA 2AOSA 3MHUA 1E0WA 1AFSA 4MPQA 4WF7A 1KQZA 1NTHA 3TAOA 3KBVA 1FBAA 2DW7A 1H50A 4DWSB 3W7DA 4NI3A 5EJ1B 3TMQA 5FL0A 4CD7A 3WEZA 4URIA 4H7ZA 4C6QA 4XZWA 3H2CA 1MDLA 2ABAA 4M80A 5CSSA 3AROA 4L1GA 4MKVA 2A79A 3TEVA 3NQDA 3QTPA 4V1YA 2G0WA 4XTDA 4M7TA 2DT1A 3H12A 1JRBA 2Z1BA 3E0FA 1GOXA 3W1NA 3CUIA 4A8NA 2X2YA 3A5FA 4X3ZA 2UBPC 2E4TA 1WXZA 3E2RA 3UPBA 3C2YA 4NXKA 1DIOA 4KEMA 2PTZA 1UUMA 4MB3A 3L2MA 1UR1A 2Y89A 4JGDA 1ZZMA 1I0DA 2G37A 3M5ZA 2C91A 4R7OA 4AB4A 5CZSA 2XN2A 3CIXA 1SO3A 3BJTA 3CZLA 3WJZA 1JGMA 2BVWA 3CH0A 4F0MA 4C6EA 4AIBA 1EOKA 1AQMA 1TJRA 1Q85A 1XUUA 3KOXA 2ATSA 4MYAA 1TJPA 4RXGA 3BGAA 1YKWA 1J6OA 2OX1A 4UB9A 1US2A 3S6TA 6REQB 1BVZA 1OZMA 2GJXB 3KBNA 1HGWA 5AYYA 2UZ9A 4YLWA 4EE9A 5F1VA 4Z0JA 2CHOA 1XPGA 1UWTA 2BOFX 3S2NA 2Z7GA 3WX7A 3GNNA 2D0GA 2I56A 5ABHA 2YB4A 5D04C 3L9CA 3PAOA 3KCLA 3LGEA 3MUZ1 4Z2KA 5HXMA 5BRQA 1O94A 1S5VA 3RLGA 2XH4A 1W1B1 1RA0A 4AQLA 3MMTA 1Q6FA 2PBOA 3LM7A 3POCA 3N12A 3WQEA 2PCQA 2J78A 3IJDA 5HOSA 1XQKA 3GDMA 1BQGA 3FCPA 3P67A 4NF7A 3OOQA 3I7SA 4L80A 3DG7A 3WLTA 3TSMA 7TIMA 2WHKA 2WANA 3E96A 3AAMA 2REQA 2W62A 4ZSUA 1QR7A 4GBDA 2JQXA 1I60A 3SIMA 4PMUA 5A5WA 3VCNA 3K1GA 1DEDA 4AXNA 3GO2A 1WNOA 3ARTA 4ICMA 3CIWA 3VC5A 1Y5WA 4RZ6A 1U33A 3UR2A 4MFEA 3SY5A 1TB3A 1EQCA 2VCCA 4JKLA 1GTHA 1X8CA 4E2BA 3LQGA 1Q65A 1NJJA 3IJLA 2PDPA 4Y8EA 1KV8A 3WFLA 4C6OA 4PA8A 4LALA 4AEFA 3GSMA 2CYGA 3CV6A 5D03A 1OFPA 3G1VA 1HKIA 2GJPA 2DU2A 1ICSA 3W7NA 3JS3A 4R27A 4DBUA 5EKYA 3W6LA 3WQWA 3NQMA 2F6KA 4D9PA 3O3RA 1EO7A 1UUQA 2ZUSA 4TTUA 1EJVC 4FX8A 1UKOA 1ZJIA 5BROA 3AZTA 1DP0A 3PPGA 3W81A 1DJXA 3A64A 2V3EA 3WMLA 4AYGA 3VINA 4NG3A 4YTUA 1Z89A 4A2RA 4A22A 3CQHA 4RW5A 3RR4A 2FYMA 1MUCA 4NP7A 4WVXA 1AJZA 1OGBA 4WKAA 4LRTA 1Q63A 4C7DA 3NDYA 4ACZA 5H8UA 2QQ6A 2AQWA 4H8HA 2VX4A 3VKDA 4TVDA 4D72A 1KRCC 2IQTA 1D3HA 3BXWA 2HV5A 4HNCA 1VEMA 5FJPA 2TPSA 4AAJA 3FFSA 5HR7A 4YHGA 3BTNA 5EMLA 4H9UA 4L7ZA 3WBWA 3IGSA 1YMYA 1L6FA 1IZKA 4NSBA 2VNCA 3GKFA 4XAGA 4XD4A 1VPQA 2MUCA 2TAAA 4Y9AA 2W9MA 1JUBA 5CZ0A 2XHYA 4MJMA 3QV8A 4TTGA 1UPPA 3VDBA 2PEVA 3R10A 1P7TA 5IHRA 3E2SA 1XLJA 3S5OA 4H83A 4KKXA 3T8QA 2GGIA 3W2JA 3IJ9A 1XIEA 4HU0A 2WAGA 2ZDRA 2GK1A 3L67A 1BWVA 1M04A 5B7ZA 1QNQA 2R8WA 1D3CA 3SGZA 1KD0A 2P53A 1MW2A 3OZOA 1MEIA 2GDVA 5CBIA 2WJFA 1JF6A 4JTTA 1P0BA 5DY2A 3WDRA 1XCFA 3CH9A 3A22A 2J8TA 1C8XA 6A3HA 2G8ZA 1TPFA 5CPOA 2R1KA 2R24A 3DH7A 3G0UA 4LANA 1J5TA 4J3UA 4S2BA 1O1ZA 3P5ZA 3S1VA 2IUZA 4ACYA 4P2VA 3LLFA 2YOCA 4DO7A 6PTDA 3FYOA 3KL5A 2J27A 2OVLA 4IFKA 1RY0A 4JCLA 4DF1A 1Z3NA 1SFJA 3NOYA 4F48A 3N1AA 4GVFA 1YRRA 1TKKA 2DT0A 3CT7A 2YXOA 5KETA 3ONBA 3B8UA 3GBEA 3TFXA 4QNWA 3F1QA 3U9IA 3ZR6A 5HK4A 5K3VA 3IJ7A 3AZRA 4HYWA 1A5NC 3NYZA 4DB7A 4AVFA 2G3FA 2NWSA 4X9SA 2HS6A 3PM6A 3LNMA 1WB0A 3PTKA 4LYKA 4IF2A 2YW3A 4LY4A 4Z08A 3LHVA 4O28A 1T0OA 2QIWA 3KW3A 1EZ2A 5C6MA 4NZ3A 1JDFA 4GI8A 3B8DA 1KLYA 3O6AA 2CU0A 1RPKA 3LDVA 3NL5A 1G5AA 1UYQA 5EMYA 4XX6A 1MNSA 4W9TA 1QPKA 3VCRA 4L64A 2FVLA 3CHFA 1E4LA 7TAAA 4UCFA 4KWWA 3P81A 2E3ZA 2PMQA 1P6CA 4TOQA 1P6WA 2DDXA 2EHHA 1DL3A 1OCNA 1FCQA 3ARRA 2QDGA 2PDFA 3MV11 4Y9OA 3CLWA 2JK2A 1HTIA 2IPWA 2QAFA 3CQKA 5DCBA 4AMAA 5E70A 3I6EA 2ISFA 4UTUA 3PY2A 5BWAA 1XIIA 2OWWA 3GX9A 5BRPA 3W26A 4YPJA 3BW2A 3DI1A 4D6CA 3BARA 1DJZA 4GINA 3WDHA 2R1PA 4P7QA 1L0PA 3H24A 4QRNA 2WMIB 3GYCA 3QHMA 4EF8A 4GUHA 3ARWA 4H9YA 2FGBA 3Q45A 5LA2A 2EAWA 2VYOA 3W73A 3SGUA 1K6WA 4DJED 3LM3A 5DN1A 2PC4A 4U3AA 3TJLA 3M0HA 1WE5A 2CHRA 1PDZA 4UNKA 5GQBA 3G2GA 3CV2A 4PULA 5REQB 1UR8A 4Q4KA 4U33A 2P8BA 3GFXA 4AXKA 3W28A 4D6JA 1XLKA 1F05A 4GPNA 2YCEA 1TE6A 5ECVA 2V5CA 1B31A 4A3HA 3D46A 1U30A 2QZRA 3LEPA 1OHLA 3H2OA 3AYVA 2AGTA 2DUXA 2V9DA 3M46A 1Q8AA 2NX3A 3N2BA 4DO6A 1EJUC 3B4YA 1PTGA 3W02A 3RR1A 3T4WA 3R58A 4NZ4A 4DQWA 3BQ6A 3UZXA 4K7YA 3H7RA 3UWQA 4L4MA 3RCNA 4O1BA 5AOUA 2DJXA 1X98A 3UXKA 5CKSA 4ZGYA 3A6OA 4GISA 4B5XA 2GGGA 4HMEA 4UFKA 4WR3A 5CC6A 1A3HA 3PWGA 4HT3A 4AISA 3K4AA 1H49A 2R6OA 3WCZA 2SFPA 1XGEA 2Z1WA 4QCFA 5XINA 1S5MA 3AMGA 1FWAC 3GXMA 4A2SA 3NDOA 4PL2A 4DIAA 4UTIA 3M1ZA 3N6HA 1W1ZA 1E1EA 1QHOA 2FZNA 1EF3A 4HA0A 3N9KA 3UWUA 4AZCA 3P6LA 3HURA 3PBVA 3NGJA 1JUKA 3SIZA 4RCXA 3V4BA 4CU8A 1JYVA 3QY7A 4H9ZA 4QS6A 4UQCA 3P8JA 2GOKA 5HQLA 1KBBA 2FPTA 3I6TA 3KCOA 2EKCA 3MY9A 4RW3A 2ZA2A 2ZTKA 4W85A 4N42A 1RBOB 1H7XA 4DM1A 1EJTC 2YBVA 3C4UA 4NHVA 1NU5A 1E4NA 1M03A 1P0NA 4OT7A 4X61A 3R0KA 1M9HA 5HMDA 3OG2A 1NP0A 2BDQA 4HP5A 2PLCA 1E9LA 3CQ0A 1HKKA 1MMFA 4ALDA 3ZVIA 1JZ6A 2VX6A 3OZYA 3KCJA 1F8MA 3PJXA 3O63A 4QTGA 3MI3A 1ADOA 1UC5A 2CBIA 2Y88A 1TZ7A 1M6JA 4GCXA 3NQ7A 4TV6A 1JCLA 1VFLA 3G6LA 4FS9A 3CO8A 1BLIA 1GOKA 4C6CA 4CVWA 4JYEA 3V0TA 3NEHA 3RIKA 5CEWA 3B9AA 1ITUA 1XH1A 2C6QA 3HPAA 3IGUA 4QSFA 3EEZA 2ZYFA 1BFNA 4GG9A 4A4AA 3PBMA 3AUJA 3PNZA 4Q7NA 2I5QA 5DELA 4DX3A 3QY6A 1GYMA 1UWIA 2F2HA 5TAOA 3XINA 3PZQA 4GJJA 2IXVA 2WM0A 1H7WA 3W1RA 1O12A 3MMDA 4GWEA 2B7NA 2VZSA 5M3WA 1Q2SA 2BXVA 2O4MA 2INFA 4DELA 3QC3A 3A9BA 3RU6A 4WSHA 3UGVA 3OPSA 4AWEA 3GTXA 5FESA 3PG9A 5G4EA 2PS2A 4O4VA 3R8GA 4M6QA 3SCOA 4BCEA 4WLCA 2QULA 1P0EA 5T26A 1DJYA 3G1YA 5JIWA 3GVQA 5C55A 3LTYA 2EPKX 4D6EA 3VTRA 3QR1A 3B9DA 3QGKC 3EMZA 3W0KA 3IAPA 4DWSC 3LI1A 2QS8A 2ZUMA 2PDQA 4K7VA 2ZX7A 1V6UA 1RVGA 2EPOA 1KXVA 3HIJA 3UU0A 3L12A 4A35A 4AF0A 3W27A 5GNYA 2XIIA 1H1YA 1V6XA 3DYMA 1UD3A 4C1KA 1DOSA 1R3TA 4B91A 2DSWA 3MUXA 1OEPA 3GXTA 3UZYA 2PDBA 4EP8C 1K77A 4I5RA 4ZB5A 3VD5A 1BXCA 4W86A 4C1NA 3KBSA 3PZ9A 2NVCA 3OVRA 1AMYA 4Q8PA 5A8PA 4PGLA 5CSUA 2HRWA 3ONCA 1PWMA 3LCWA 2WPGA 1W32A 5IDIA 2VTFA 1KXHA 4FR1A 4CQ9A 2QIIA 3BLLA 5JMUA 5FJIA 2Q09A 4LCQA 1VIZA 4DJFD 3PNUA 3HM7A 3BVJA 2QVHA 2PDWA 4OBSA 3RO6A 3W83A 2VDHA 2W79A 1FP8A 2V30A 3VIPA 1IT0A 1RALA 3VIJA 1VFOA 1K03A 3W88A 2GVGA 1Q6LA 4DJFA 1UOKA 1A0DA 4QJ1A 2VEFA 5E5CA 3NO3A 3NPVA 4OFCA 4U5KA 1YDOA 2J7EA 3OIXA 5BCAA 2QYGA 1TPB1 3MDUA 4C6LA 4OKDA 3TZFA 1JI1A 1W2VA 2CHNA 3BG5A 4IICA 3TYZA 1EYWA 2X1TA 1J4EA 1YIXA 3O1NA 2GUBA 1LT8A 2YL9A 1RQHA 2EJAA 3IANA 3QLLA 2UY2A 1W5NA 3UNDA 4N7QA 4PTDA 1F5ZA 4S3CA 3I10A 3MVTA 3P84A 2ZX8A 4Y9MA 4K3ZA 1V3HA 1LROA 1IHIA 4U31A 4O50A 1W3LA 2BVTA 1W1IE 3UY7A 1EO5A 2A3AA 3PUOA 1D8WA 4HTBA 3M0JA 4H8UA 4H04A 1UH4A 1DIDA 2WBKA 5FJOA 4YL2A 2VM8A 3DN5A 2QXWA 3QYQA 4OTKA 3F5JA 2J6XA 3RRXA 3TTYA 2EGZA 1LWIA 2QPSA 4K68A 3PSVA 5HJXA 2VFDA 4ZB0A 3EWDA 2P50A 5LIKX 1WDQA 2F7FA 1FVPA 4JQ4A 5KEZA 3H2EA 3W7HA 4JN8A 4S3EA 5MHBA 3EB2A 1FFRA 4GY0A 4NI8A 3I7RA 2PSNA 4UIOA 3WLQA 5C9XA 1IE7C 2NX9A 4NJIA 4GVHA 1QI5A 4CNSA 4PMVA 1E5JA 5AVHA 3S1WA 1K9DA 3TYEA 4JHMA 1WXYA 5I3IA 1ME9A 3WBYA 1LCOA 4UXDA 1VP5A 3RMJA 4A3RA 3WNPA 4LXFA 3HMCA 1SW3A 4FF5A 1Q66A 1H11A 1V4YA 3WBEA 3L23A 4PUWA 2YGYA 2WCAA 1YDYA 5D37A 3T1GA 1B3OA 3DFSA 4UTJA 3S6OA 3W1QA 1R7OA 8TIMA 1WOBA 3ARVA 1HJXA 4Y8FA 5D9MA 3OGRA 4JTRA 1SUXA 1TVLA 4P8WA 4GZIA 3SRHA 5ABTA 2IPFA 3MI6A 1DPMA 2NVDA 1E4MM 1ZGDA 2I17A 1CGTA 3H53A 1QI2A 3UBPC 2VI0A 3T8LA 4L4OA 2EQDA 3HU7A 4ZR8A 1OK4A 4XBJA 4RPPA 3HN3A 3W2LA 1CZ1A 5DRCA 2WB5A 4YMZA 1XCXA 1R3RA 4V27A 3AI0A 3HJEA 2Y62A 1QDSA 4JTEA 3CGTA 4A29A 1CTNA 4PTXA 3UQNA 3ZSTA 3FVDA 2I1OA 1U22A 1OVDA 4QG6A 1LOSA 2VUYA 3IS4A 3K4DA 4OUEA 5I78A 4IMCA 5BW6A 2ZX5A 1NFPA 1AJ0A 3OLIA 3L0GA 3SCWA 4FLSA 2WVUA 1OB0A 1TPWA 4WK9A 2Z28A 3TW9A 1DJNA 4IP7A 4AY8A 2J79A 2JFEX 4FNTA 1Z42A 4CQBA 3WMCA 2V3GA 4GUGA 4M6PA 2GVEA 5EFDA 2Q01A 1VGAA 3LV6A 3ZXWA 1XIJA 1UJQA 1S2AA 3LA4A 1O7AA 4JPGA 3CAQA 4NAFB 3O16A 1OYBA 1XLCA 5BMXA 5CPMA 1GOMA 1VC4A 3JRKA 3CIVA 1L9WA 5HWJA 3OVGA 4DUOA 2A7RA 4FP1A 4XZ9A 5A6AA 3BLFA 1FDZA 2QNEA 5CLWA 2P0OA 2QUUA 3IV3A 2CW6A 1DVJA 2CCRA 3M47A 1CNVA 1VJIA 1OIMA 4HPXA 1WAWA 4LU0A 3AIWA 5LGXA 5E0KA 4G56A 3V5FA 4I7VA 3P82A 2OU4A 1R46A 5AVNA 2FQIA 4AZBA 3P62A 1E6NA 3SUTA 3W7RA 4AD5A 1JQVA 1ADDA 3UETA 2ZCGA 1MQPA 1XBZA 4W84A 4GNKB 3LLXA 2J62A 1ALDA 3ARQA 4BWLA 2GVJA 1SYTA 3AU2A 1K9EA 1Q6EA 2GGEA 3W6YA 4XD6A 3TLLA 4RNJA 2OT0A 1DJHA 2HVNA 3NQ6A 2EG7A 3MYPA 3S5YA 1QCWA 1W9VA 1WDPA 3NAVA 1JPDX 3JZUA 1FOBA 4PMOA 5AYXA 1E0UA 3ZQ9A 4XTIA 3COTA 3N3MA 1I2NA 4WY0A 3URQA 3TN3A 5GJMA 2Y5EA 2D3NA 1XYAA 4J35A 5I3FA 4D6GA 5CAKA 1IZJA 2OXNA 3I7QA 4H2HA 1GVFA 3W1LA 1UA3A 3BUVA 3FEMA 2WMJA 3KDOA 3MANA 6TIMA 4KCVA 4XBKA 2YPIA 3QMSA 3W7KA 4C60A 4JNZA 1HNYA 2YA1A 3PB0A 3VZZA 2DZUA 1LM1A 4U4MA 1JYXA 3M07A 4I6KA 3S42A 4FLQA 2ZZ1A 1GQIA 2HZGA 3CL7A 3SQMA 1W3JA 2FTPA 4NZ1A 2TRSA 1YYAA 3TP4A 3K1DA 2HNEA 3QM3A 1LUCA 1UP0A 1J0KA 3YPIA 2MNRA 1ZCCA 4JTIA 5TD4A 1JG9A 1P6BA 3T07A 4RE2A 4LS1A 1WBJA 1RVKA 2CLFA 1LJYA 1I2OA 5HJYA 3PWIA 5LHFA 1KM0A 1OD8A 1L2QA 2G4JA 1X7FA 4UC5A 3H70A 4ZB2A 3DX5A 3IARA 4XK2A 3ME3A 4E38A 1FWWA 1XLHA 4HZ7A 3SCSA 4N0RA 4CD8A 3P74A 1VIWA 4JQ2A 2VT0A 1TA3B 1R3YA 2E5CA 4ZQNA 1D7FA 4AU0A 3UYIA 1H09A 1DQWA 2J77A 1FWFC 4M19A 1KGWA 4ZFMA 1ISXA 4NIRA 3LU2A 1YBQA 4WKHA 2PDYA 3S1XA 1I8JA 2FTWA 4YWIA 1ITXA 4GX8A 5EJZB 4DNMA 1FHUA 2E1WA 1KCZA 2XSXA 4NUWA 1FXPA 5HAOA 3E02A 4LBUA 1NAL1 4O18A 1NVMA 5LGZA 1PYMA 1R47A 1W17A 3T81A 3VDAA 5HDRA 1TFVA 1NFGA 1VQTA 4RNHA 1V7YA 4PRRA 5I07A 4DF0A 1GCYA 1IXPA 2ZKMX 2E5BA 2GSJA 3WDQA 3E5BA 2GYIA 3QXBA 2W4XA 2PDGA 3ARZA 1XYFA 2Y0FA 3TN6A 1JPKA 2QEZA 2DSUA 2VRJA 1AD4A 3CPGA 3IUIA 4TUFA 3AU6A 4F0LA 1FWEC 1NH6A 2W66A 4BQ3A 3TKFA 2I14A 2XVLA 3S9IA 3U2CA 1M7OA 4QLJA 4QAIA 3QH2A 2D2GA 1CIUA 1YTKA 4BQ2A 3VGFA 1GVOA 2Y7EA 3K5XA 2AAAA 1AK5A 1W3NA 5G2IA 2C19A 3VIMA 3RM4A 4TR9A 4TU1A 1EDTA 1AZ1A 4O0KA 2VGIA 2V63A 1FCVA 3EPMA 3F2CA 4KERA 5JXQA 1AL8A 3QFEA 4CD6A 5MF5A 1P48A 3ZLHA 2Z27A 1TWWA 1XWYA 4ICNA 1KO0A 2ICSA 2Z1VA 4HYVA 3GIQA 1ITQA 2W5FA 4HB7A 1LQ0A 4XKYA 2FFCA 2Y6ZA 3W7CA 5C7VA 4Q4PA 4XZMX 3OBAA 4JZ5A 1GJPA 2XFRA 1PHQA 3EB3A 3N9RA 4UTHA 4LB4A 3MCNA 5CCZA 1BXBA 1QHZA 4ZZ9A 1IIGA 4ZQOA 1KCKA 4F8XA 4AZIA 3LTSA 4GXPA 3KLKA 3DFOA 2INZA 1FCBA 1RP9A 5CGMA 4IT1A 1WAUA 4C6DA 3HQ1A 3O05A 3SRFA 4PCPA 3MSGA 4HA4A 1OIFA 4DY1A 1C8YA 2UY4A 4A8RA 4LS2A 3MYOA 2H9AA 1E15A 3ZLGA 4XZIA 1DXFA 4J3SA 1NIUA 4GYPC 3LQLA 2PB1A 3QR3A 1SZNA 1J8VA 2BTMA 3QFWA 4B3ZA 1AG1O 3H2MA 3R0DA 5BWFA 3E5PA 1XHGA 3OLEA 3M7WA 4JR5A 3UXIA 1WP6A 5E9XA 3LRKA 1PIIA 3GNPA 5CG7A 3I65A 4H1ZA 1JJKA 3P93A 4YTSA 2J25A 4CNUA 1T7LA 2XJ7A 2C1GA 3WG6A 5AHNA 4HHPA 1RD6A 3NPUA 2Y7DA 3L7RA 3F4VA 1EX5A 2PBGA 3TCEA 3CUGA 4AHPA 2HBVA 1H7RA 4WZHA 4IMAA 4MDPA 3U5YA 4Z1BA 1EJWC 3GTFA 4I3GA 3CHVA 4KEUA 1JVNA 3RM9A 4XB3A 5LNUA 4EXQA 4Z2JA 1WUEA 3VMNA 4LUTA 4WKFA 4UFLA 2WQPA 2PGWA 4H01A 1F7BA 4AWTA 5FAGA 1E5NA 4KF1A 4L9YA 3WNKA 2ZXAA 4FXRA 5JU6A 1FHVA 4LV4A 3UZZA 1J79A 1JGIA 1NSJA 1YDVA 4QP0A 1PCWA 1BGAA 3IV8A 1HG3A 5EL1A 3H7VA 1SFTA 3Q4DA 2R9RA 3PBYA 1EA9C 2F84A 2QCNA 3GVRA 3BLPX 1QVBA 2V81A 3LGGA 1K7FA 1HJWA 4GXWA 2CXEA 2ZE0A 1ME8A 1AH0A 2WSYA 1GJUA 1MFUA 4K36A 1NDVA 1TPEA 4DYKA 4YTRA 4I7UA 1KM6A 2E9MA 1SZGA 3TYBA 4HHLA 4RE3A 1QASA 2AKZA 3XISA 5H91A 3W38A 1UPMB 3W53A 1XLAA 2Z26A 1BSLA 4D1IA 1JUEA 4US5D 5A3HA 2WC4A 3NL2A 4DZIA 2NUWA 2D2JA 3ES7A 3LERA 4GQGA 4JS3A 2Z29A 1SFLA 3BURA 2ALDA 4IIFA 1YX1A 1Q6OA 4LC6A 3UPMA 1QW9A 3VVGA 3C0JA 3CBWA 4HZMA 3P5YA 3OGVA 3NQ8A 1EGZA 3FX4A 3CMJA 3VIOA 1B4KA 3GR4A 2WWDA 1C8VA 4LQ1A 4ZMGA 4OGZA 3GHSA 2YLLA 3BLDA 1N7KA 4UTTC 1KFKA 3GC5A 5D8ZA 3G1FA 5JVLA 5CSYA 3O0FA 5FF7A 3C6CA 3C3NA 5MKGA 1E1FA 3FDKA 4IIEA 3VUSA 1H0IA 2FPVA 1NWTA 1CX9A 1XGDA 3VD7A 5IBXC 3RJXA 3R2GA 4XG1A 3T44A 1OG0A 2PE4A 1I9CB 4QEEA 3O2LA 4FSAA 5C9ZA 1G69A 1P0KA 1MRAA 3TYCA 3FGCA 3B4UA 3NL6A 3DGBA 3W74A 4WGHA 1RD5A 2PGEA 3U2EA 3CJPA 2UY3A 3OHMB 3IJ8A 3TUUA 2WMFA 1K70A 5A8OA 2FGLA 5AC6A 3E12A 4UCGA 2QUTA 4D6DA 1W5MA 3HB9A 4IXXA 5EPDA 1SW7A 1EH9A 1UASA 2X1IA 1O66A 1KXQA 3B04A 3LI0A 3EXTA 4MY9A 4UFJA 3W7IA 3UG3A 5LNWA 3GKAA 4DLMA 2PZ0A 5F2LA 3HA1A 2QCMA 2HS8A 5L9FA 1IT8A 2J4GA 3EGJA 2REQB 3VOHA 2C1HA 1IYXA 2DT2A 2QDEA 4QM1A 3P3BA 1W9XA 2GDUA 4WGXA 3MKVA 8XIAA 2QJIA 4ZQCA 5DF0A 3RLVA 1ZJHA 4D6IA 4IJCA 1S2WA 2CBJA 1DWAM 2Z24A 4X2PA 5C7HA 2NZLA 1JFXA 3LHTA 2QHAA 3ARXA 1VCGA 4K38A 3IIVA 1IWPA 1MW3A 4B5TA 2XISA 4HK5A 4BEUA 2QCFA 1QUMA 3HFTA 3DYPA 3NL3A 4XO6A 3RM8A 4ILSA 1QPNA 4UQAA 3OHIA 1H60A 1YXDA 3PG8A 4PUJA 1EF2A 4C7FA 1W3TA 4L1WA 1OABA 4HU3A 5I7GA 3W2KA 3ZJKA 2ZRUA 4M29A 2C7FA 3GHUA 3URNA 3S2MA 3WF4A 1SR9A 4WOQA 4IIDA 4E8CA 3FSTA 4GLEA 1DXIA 1NELA 2VC6A 3GVVA 4LVBA 3NFUA 3R8HA 1H7OA 2W63A 3NNTA 3MTWA 4G7FA 2YA0A 3UCDA 1J93A 3DDMA 2XZ9A 4LAUA 3UWEA 4BR1A 2JKPA 3N2MA 4QXIA 2Y1HA 5BXTA 2D0FA 4LJ3A 4LAOA 4ACZB 1H0GA 3KXQA 3C8FA 4TO8A 3PFMA 3ZT7A 4MAZA 1XS2A 3M6YA 5FF3A 1UR4A 2OOFA 1VYRA 1KM2A 1WDWA 1LL4A 1O5RA 4LCRA 3QVQA 3R43A 2XSBA 4ERAA 2WMHA 2XUCA 2PD5A 4F40A 3BOFA 3E0WA 3R13A 4QLKA 3G24A 2GL5A 2IS7A 4KFNA 1A5OC 2P88A 3BW3A 2I7GA 4R3UA 4RK8A 5DLCA 3IVTA 4BF5A 2H6RA 1FTXA 4L9ZA 4GA8A 1BD0A 3AIBA 2A21A 3EYPA 3QLDA 4CD4A 4MWAC 4LF2A 1FX6A 1G0CA 3WQVA 1LWJA 4TX9A 1GUVA 2DPEA 3D3AA 2J6VA 2Z2BA 1JFHA 1P7TB 2E40A 2OYMA 3KVMA 3ITVA 5LKYA 2GQAA 4CQ8A 3PJWA 2GK1B 2IKHA 3VK5A 1CBGA 2FB2A 1CGUA 3SCVA 3QOKA 1UZ1A 3LY0A 2QVNA 4J9JA 2V8ZA 2F61A 3B9EA 2NSXA 4Q8MA 1V02A 4Q8WA 3QV7A 5F2IA 4JFVA 4C5YA 3GNXA 1FWIC 2YFOA 8A3HA 4AD2A 2DVTA 1JYWA 2Z7KA 4J3VA 1Q6QA 2QUMA 4IP4A 1HIZA 1MXSA 2CLPA 1BYDA 3LZ5A 4L6HA 3VCCA 2V3FA 4WXYA 2NV9A 4G1KA 4GQ0A 3VNMA 2WHJA 3C2VA 4IFKB 1LQAA 2V82A 1ITCA 3B03A 1K8CA 1RV8A 5I3KA 2IMRA 3CHDA 4HMCA 3P2VA 7REQA 3ANYA 3UP8A 3LNPA 4JL2A 4LS0A 1RA5A 2P8CA 4Z2LA 2FMOA 2ZA1A 4LH8A 2NLIA 2FJKA 3UZ5A 4OQVA 1V77A 2DZXA 2PDXA 4L4LA 4PUDA 5FJJA 4GABA 1E0XA 1M01A 2BX7A 1E55A 4S3AA 5E9AA 3F2DA 2YZ5A 4OJYA 1OFRA 1TTPA 1W1PA 2WKGA 3DHUA 4F9JA 3C52A 3IIOA 4QCEA 4RJEA 4YCOA 1V6VA 1AH4A 1E9IA 5I03A 2DUZA 4N9BA 5HQMA 1NWUA 1Q7QA 3HBLA 3T09A 1J12A 4UTMA 1HVQA 1PX4A 3BC9A 3SY1A 3U2OA 2G97A 1ZALA 1M53A 2Z6IA 1WDDA 4RUBA 5LZLA 1YADA 3MUCA 4DYEA 2W0UA 1TV7A 3HTWA 2AL2A 1XBXA 3BJSA 4HCLA 4N02A 4QR6A 1EBGA 2OEMA 3MZNA 1LLWA 4EWND 3B9NA 1J0ZA 4DZ5A 3L2LA 3MJMA 3TQVA 2XH0A 4DBSA 1VHNA 2YLAA 4BFAA 1K9TA 2BGQA 1ZUAX 4HOZA 3SW6A 3B0UX 2XFFA 1WBHA 3R0UA 3ZWTA 3KRUA 4Y9PA 2YB1A 3EOLA 5I77A 3WF1A 2O9TA 3GHTA 3UG8A 3LBMA 2D22A 1BKHA 2Y7GA 4X0NA 4NX5A 1K8ZA 2CNCA 2ACSA 3P61A 1LP6A 3H21A 3T55A 4DF2A 1BF6A 2CZVA 2VFFA 4LYPA 2F8QA 1QPOA 3MJYA 1UUOA 1U1UA 2FIQA 3HGOA 3AZSA 3NZPA 3NO1A 4OUIA 4R53A 4Y9NA 3QV9A 4NY2A 5BU9A 3MBFA 1KFEA 2TODA 3O8AA 3FHAA 5BZAA 1OC7A 3WUEA 3RK8A 3KTSA 5FF2A 5A2AA 4PMZA 5J8LA 3GU2A 1SFSA 3V36A 2BV9A 4K39A 3WQDA 3L21A 3N25A 1XLIA 4LVGA 5EA9A 4WEVX 4R9XA 3WK3A 4GNJA 3HG2A 4U2YA 3DHFA 4F3HA 2ABBA 1JCYA 2FH6A 4IH3A 4GRSA 4O13A 1ODZA 3GUWA 4W5ZA 1XLLA 4DPPA 3ITLA 1F3XA 2C0AA 4JQ1A 2E28A 1VD6A 1ZBWA 3M0MA 4UWMA 4DWSA 4V2XA 1LBMA 2PDKA 2AGKA 2YCLA 3MDWA 3T2PA 4M0XA 2XIQA 3NSXA 2JBMA 3AC0A 1EJSC 1QHPA 2WZHA 4GO8A 2Z2UA 2CLHA 3CWNA 1BKSA 3PUEA 2VVNA 3GIPA 3W22A 1ONRA 3AIQA 2ZXQA 3LENA 3WENA 3QW3A 5BXRA 2PU1A 5CG0A 4LYRA 4HBKA 2HISA 2JIEA 4F0HA 3HPXA 4DJDD 3L4YA 4GC3A 4AZCB 4LBSA 4NJHA 2ISWA 4R88A 4S3JA 2WV8A 2ODOA 1IF2A 3N2TA 2B0MA 3D3FA 5EFFA 3GC2A 4C5ZA 5AHEA 4KRTA 2WKJA 1F61A 4S1FA 3DENA 3W7OA 1UOZA 2PTYA 4UQBA 3EXRA 2TSYA 2YL8A 3CZGA 2OPJA 1CYGA 2XVNA 3JZEA 3NA8A 3WQPA 1GKQA 3GE7A 4Y2WA 2VKZG 1R2SA 1LRNA 1UBSA 3NR0A 1C8QA 1UCWA 2ZE3A 2Z1XA 2YL5A 4IX0A 2O4QA 4CCDA 1I1WA 4H8NA 5BRBA 1NQ6A 3L4WA 1GOOA 4B5SA 2WC7A 3W72A 1CLKA 4JDBA 3LUTA 2HBXA 4UTLA 2WO5A 1WOAA 1CLXA 2DT3A 4W4QA 2WMKA 4QJ5B 4KWOA 4F2UA 5M17A 3R7MA 4NJJA 3LPPA 1TWIA 3STFA 4DI9A 1RR2A 2ZUTA 3M5XA 2W91A 2WVVA 4E4PA 3WQFA 3O6YX 1M7JA 3C5QA 4X9YA 5G5IA 5DY3A 3KDNA 3MUIA 3NVDA 3CMGA 4IL0A 3TW6A 3PPFA 3SRDA 1HKMA 3VDHA 2A3CA 3G1XA 1JDCA 3N6QA 1OGGA 5FL1A 2OGJA 1B57A 4JEQA 4LV9A 1XYCA 3IACA 2ZRWA 1UZHA 2QDHA 1HL8A 4JYDA 3GW0A 4FNSA 4YHEA 3RDKA 4HJWA 3URBA 1ZAHA 2DZSA 3WBXA 4DUVA 3MKKA 3BO9A 1Z6KA 3UR7A 4KT2A 1A5KC 4C1LA 4KWUA 1UH3A 5TQLA 4XISA 1EHNA 4AW7A 2GUUA 3KOWA 1E6PA 2J8GA 5EYWA 1UD4A 3WO8A 1VZWA 4JOMA 1KCXA 4PB3A 3NQCA 3IUDA 1E71M 4KIRA 4R34A 1XV8A 2AKMA 4Q8NA 2HVOA 4NJKA 3L5MA 4PMJA 3M9YA 1M7XA 4GQBA 2P1FA 3SADA 1FH9A 2DZAA 4O12A 1SVDA 3KHJA 4C1NB 2X1UA 1W54A 2ZRYA 3Q67A 1F07A 3ABZA 4MKSA 1H7NA 1IGSA 4MY1A 1S2CA 2J13A 1WZMA 4IIBA 4LFYA 1RCXB 4M1RA 1OCJA 4FLRA 4UR7A 2RDTA 4PEKA 5AFDA 3U3HA 4JYFA 3LXAA 1RCOB 3BSGA 1NOFA 2VC7A 4GYFA 2PWGA 4P7NA 1GZGA 2VC5A 3DHPA 2O9RA 2FLIA 4LF1A 4C6KA 5DMMA 2VR2A 3B8IA 3W1TA 1M5WA 1V3JA 4BK9A 1UP2A 1X7IA 3FS2A 3W9ZA 4CKQA 4ZOCA 3KS5A 1EOMA 1SU5A 3WEMA 3EA1A 2ZADA 2G95A 1HO1A 1HJQA 1UMLA 3G1RA 3ITCA 3G1AA 1WCGA 3CYJA 3KZSA 5HINA 4W7VA 4CN4A 1THFD 1HXJA 4PUMA 2OSWA 4XKMA 1OFOA 3TWAA 2YCJA 4NZFA 5E09A 2A1YA 3H55A 3KL0A 3VNZA 3UVAA 2V2CA 3N73A 2QKFA 1HL2A 1B3YA 4J40A 1TELA 4LEQA 5I6SA 2CC0A 3OBEA 5E0CA 2OELA 2GVLA 3TA6A 3AALA 2GUYA 4WQ6A 2E09A 2VOTA 2P0IA 1F4AA 1D2KA 2QPXA 5EB8A 1MVYA 3G0SA 4BY3A 2GSEA 3W29A 4LAKA 4DXVA 3KRSA 1B4EA 4ICCX 4W8LA 3LCIA 3WLLA 1TZZA 1KBJA 1Z32X 2AMGA 3VPLA 1NEYA 3CC1A 2CBUA 4XUYA 1IXQA 1ZAJA 3TQ0A 2ZZ5A 2DIJA 1A5SA 2YJQA 3WD4A 4GYJA 2OEJA 5B80A 2PLKA 3EX2A 2YYUA 3I3BA 1F4HA 1PVNA 3LPOA 5H2ZA 2VJXA 5CPQA 4F79A 5FI8A 3SCRA 3V1PA 2OO0A 5AYIA 1CLVA 1FWRA 1R3WA 3TR2A 2WK2A 2YKKA 3AS3A 4P8XA 1BTMA 5U7SA 3S1UA 5GNZA 3PPCA 3ITXA 4DBDA 4M7SA 2WHLA 2C3ZA 3WD1A 2V69A 2XZ7A 2O0TA 4HTYA 3ERPA 1JIBA 2EG8A 3ZO9A 1Z8AA 3TE9A 3HQPA 4W8BA 2GSHA 2QV4A 2VZUA 1ZBVA 2WSRA 1TRDA 1V93A 4CCEA 2QCDA 1SZEA 3BAKA 5CJNA 1Q4NX 2Y8VA 4O0ZA 3S5SA 5ABFA 4F66A 4TX6A 4KFPA 2PPGA 3WELA 5A6BA 1EP2A 3RPTA 3FLUA 1TV2A 2CWNA 2PTDA 4KBXA 7A3HA 4FNQA 2POTA 3WEOA 5HJLA 2RJHA 1T6MA 1XH0A 3EDEA 3GAYA 1TPH1 3AHTA 3L66A 2BOGX 3SDOA 3KM8A 2ZBTA 1TUXA 4CNNA 4IMEA 1TJ1A 4IP5A 4LEFA 4UNLA 2I5GA 5LA1A 1BHGA 3UWVA 3VD4A 1IXOA 1N82A 2FH8A 1K4GA 3U8GA 3QKZA 1VLWA 2ZIDA 4PODA 3GQYA 3QMRA 3U4FA 3PR2A 4MTVA 4NQ1A 1DJGA 1JI2A 4A3YA 3M0LA 2FKPA 2OX4A 3HG4A 5TBOA 3V7PA 2ISSA 3CNYA 3STPA 1VH7A 2CETA 1XFCA 4M8UA 1QI3A 1X39A 3CM4A 3LMZA 4MB4A 4Q4SA 3KE0A 2XPKA 5F4XA 2RHGA 5KZMA 3USZA 3APTA 4XSLA 1G4SA 3HPZA 3MBDA 3SUUA 5F7UA 2PTWA 5U4NA 4PBFA 9RUBA 4ZA0A 4CD5A 4IGMA 1X96A 4CN6A 3TYDA 2VEIA 3LG3A 4MNLA 1VPYA 4HYRA 1R3VA 4ZOBA 2D23A 1F3EA 4LUYA 1I0BA 2XVKA 2GWGA 2QMKA 1EYEA 1G1YA 1MI3A 2X7WA 3PBWA 5D2TA 2OZTA 3AQUA 4HA1A 5H6HA 1YXYA 1XW8A 1XH2A 2OZ8A 3PN8A 3UXAA 3NZGA 3QZEA 1CCWB 2H8XA 2WZTA 4PMNA 3SCPA 1PL9A 2ZX6A 1HVXA 4Q22A 2W3ZA 5AYBA 3LZ3A 1O6IA 2GDQA 4UUIA 3IGXA 4H7VA 4PB4A 3UYCA 4OV9A 4AZ6A 1XP3A 2D20A 4P5UA 4GQQA 3SFKA 3HG3A 3E6EA 2PP0A 3FNDA 5JH1A 1QRQA 4XIAA 3IRDA 3NQEA 4J1OA 3ELFA 5LXXA 3T0BA 2VD8A 3IJ6A 1U2YA 4ERGA 1M68A 4Q6XA 1B54A 3BGJA 2E6FA 1KKOA 3VILA 1EEXA 2XFYA 1OD0A 4IOTA 4KRUA 5D4YA 1FWJC 4WY0B 4DYJA 3GHRA 1AD1A 1CXHA 4D71A 7ENLA 8RUCA 1DWIM 4BZYA 1CPUA 3BQ5A 3ISIX 1Y0EA 4D8LA 3W3OA 3W24A 3IVUA 2BY3A 2O56A 2FHFA 2O7SA 1FXQA 1MEWA 1R9YA 3B0YA 3ATYA 4JX4A 4B5NA 2RGMA 3S47A 4H9TA 1NP2A 3LK6A 4H6KA 1NF7A 3G8EA 1PIGA 4LBRA 1G4PA 1R6WA 4JTFA 3A5VA 3VMPA 4Q7BA 3DYOA 3ABQA 1W1VA 5DEZA 5C9WA 3REQA 1OBAA 1PKNA 3B05A 4GXMA 4AVOA 1GVYA 1LUCB 1VJSA 4ZQRA 4B5UA 1UD5A 1XF0A 4IQDA 1L6WA 4P00B 3ZSSA 1RSCA 3TFCA 1U5JA 2L5HA 1XYBA 4IJBA 1UA7A 3N9SA 4QQUA 1B5TA 3EPOA 1JYNA 3TDFA 4DJEC 3GTIA 4ORIA 2ZUNA 1MXGA 1S3HA 3QZAA 4MLRA 1OT1A 2C15A 1UD8A 4M3PA 1U1HA 4KS0A 1VYPX 2ZUWA 5HMEA 3TSDA 1G67A 3TMLA 4Q4QA 3H26A 4NZ5A 2D69A 4KETA 3DFQA 3NM1A 3K4WA 2NW0A 4WOZA 1H7PA 2Y24A 3MO7A 3BG9A 3TW7A 4I9TA 1GKRA 4JFUA 4PTVA 4MPKA 1YBQB 2W92A 1JAKA 1NY1A 3KTCA 1C92A 1QAPA 1OX6A 3H6OA 5AC7A 3THDA 3ID7A 1PJ9A 3QQ1A 1XLGA 4GYPA 3HPFA 1W8GA 4PTMA 4YU1A 4EKJA 4C6JA 3OB8A 1FA2A 4JIEA 2YX0A 3EWWA 2FDMA 3WJSA 4BF7A 1FWTA 5F4WA 1OFQA 5HNNA 1WO2A 3H2AA 5HMSA 1NARA 4BHYA 4E8GA 5EBUA 5EMKA 2R1LA 1EXPA 5CSRA 4F4RA 1W37A 1V08A 1WKEA 3BL3A 2PWVA 1T96A 4ZE4A 2A7NA 3DFYA 1SZRA 4NAEA 5K4ZA 3OIHA 1B90A 4MJ4A 2GLKA 1PO9A 1R5YA 4YVXA 1WKDA 2X40A 3OA3A 3SM0A 1PS9A 3LB0A 3FXGA 3EEGA 1LYXA 3RMEA 1NOWA 1IV8A 4WSJA 3QW4B 2OQYA 4OBTA 3TQKA 1XGZA 4LUSB 4E3TA 3WLHA 2R14A 3MB9A 4QISA 3QSTA 4BF9A 1GZ1A 3WLRA 4JTGA 5IDZA 1VBJA 4M5PA 4H9XA 3UERA 4JEJA 4JFWA 1S2TA 4QE4A 3ANUA 4MZ1A 2ATMA 3KP1A 3G5EA 5GVJA 4U3CA 1DHKA 1QNOA 3VGHA 3S83A 4XIMA 4HMDA 2XIMA 3AIEA 4MNKA 1W5PA 4XSMA 3W7JA 3PPHA 3TJXA 1GVRA 1ZHAA 3CV7A 3EWYA 4GZ7A 3PTDA 4WCJA 5D2VA 4XKYB 3K30A 3QPZA 3RUBL 3RU8X 1TE1A 1CEOA 2PRMA 2YDQA 2WSKA 4GMEA 4JTCA 2D73A 5F4SA 1D8CA 2DORA 3A9IA 3C61A 5DO8A 4BQ5A 3IWPA 1A50A 5K4XA 4G9PA 2H90A 3WLPA 3I6RA 4H7CA 4ORMA 1ZY9A 5I24A 1X6LA 1YLVA 1LL6A 3F7JA 3A47A 4D8AA 4S3KA 2Q3RA 3DERA 1TVNA 4ZXLA 5K2ZA 3N15A 3VIKA 4US6A 4FAMA 4Q4OA 5LIYX 1FH7A 1H41A 1WKYA 3BSMA 4FO4A 3GG0A 1SZFA 4O17A 1ZJBA 1PKYA 4N9EA 4UTTA 3WF3A 4DI8A 3H7UA 3CQJA 1S5NA 4JX5A 3ITOA 4D1JA 2XSAA 4GVIA 2H9AB 6CGTA 4HKPA 3EKLA 5C2GA 1E6ZA 3PANA 4DZHA 1YEYA 1QW8A 3V5OA 3NVTA 1Y5XA 3OZPA 1EZWA 3WK1A 1GJWA 5IBXA 4HU4A 3WH9A 3P0XA 2G41A 1Y7VA 3LD5A 4RE4A 1RXOB 3G1DA 1J0HA 3N11A 1ESWA 1J96A 3ZVHA 3SECA 3WLNA 2BY1A 1UD6A 1V0KA 1MNZA 4ATWA 5JUVA 1I4NA 3MU7A 4M51A 1VCVA 3S2LA 2VFEA 2PDNA 1OSEA 2XWDA 1JNDA 1CENA 1ISVA 4GJIA 2VFGA 2I9EA 4ROQA 5C71A 2VURA 3QTGA 1SJCA 3TAKA 4DJFC 4LUTB 4B3KA 2V5KA 3M6DA 2YFNA 3OYZA 1WDSA 2B7OA 3RHGA 3TC6A 4YS1A 3GBDA 3OLDA 3W2UA 4PRWA 2E5DA 1VKFA 3AYTA 1IGWA 3V0SA 4Q8OA 5A6SA 2Q3OA 4I9JA 3OTRA 3SUVA 2WSPA 1J2BA 3EWUA 1TX0A 3APYA 3BMWA 4QDPA 4WIWA 2VCAA 3LMYA 4GE8A 5BU6A 2Y7FA 1LG2A 3BLOA 3I4EA 3CWHA 3R11A 2CIPA 4HNVA 1EGMA 2RDUA 3K2GA 2OLAA 3UG4A 4AWUA 3TU9A 1H1NA 3A21A 4Z1YA 2WYSA 4CCCA 4JTDA 3LHYA 1TPUA 2E1DA 4UZUA 4B2DA 5F2MA 2H8ZA 1CI1A 3LN3A 1W1A1 2A3EA 1G94A 2XTKA 5T9BG 4E2VA 1XIFA 1W3KA 2FHCA 3MP5A 1VFMA 3W82A 2EJ1A 3RF9A 1K7EA 5LIXX 3ARUA 1S38A 2C18A 3R4IA 5G2HA 2X1SA 3FK4A 5F2GA 1SO6A 1JPIA 2YBUA 4MNMA 2HJPA 1QOPA 2HMCA 1O1HA 1HJVA 2DIKA 3GVWA 3WNMA 1VFHA 4I7WA 5FCZA 3UJ2A 3VKKA 4I5UA 5ABEA 4HPHA 1NOUA 1TTJA 1TCDA 5FEPA 2J74A 5DXYA 5AZ1A 4LTSA 1TV4A 3SFWA 1MQRA 2PAJA 2O9PA 4RXFA 1R87A 5MKGB 2CWXA 2JGYA 2OG9A 3QEZA 4I9MA 5HWNA 1TR1A 4HSHA 4P8VA 3UT0A 4A6GA 2X16A 3U2ZA 1LORA 3A4AA 3W1UA 3M0KA 4QE5A 4LRSA 4RNIA 4RKAA 1P43A 5J04A 3THCA 2WVSA 3AICA 3QQWA 3DFTA 1VRXA 5D02A 1F8IA 2P10A 4TMBA 4E4FA 2QGYA 4L5ZA 4RZ4A 3L4VA 5CZKA 3ZWSA 1N2VA 2WQDA 4KCUA 4MWAA 1JNEA 3W71A 2BBFA 5G1YA 2ZDSA 4GH3A 1K1DA 5K9CA 1EJXC 1DE6A 3L5LA 2ZXDA 3MHFA 3BK0A 3N14A 1J0IA 3A3HA 8XIMA 4XZNX 3OG3A 3JU2A 3LRMA 2WLZA 2DY3A 3ARYA 4TIMA 3AFBA 4UQ9A 1EJ7L 3UEQA 3C2OA 2W61A 3LBCA 2FVKA 1B3ZA 1SJBA 1F3WA 2H3DA 4NZCA 4YWSA 3GTHA 1PTAA 3EWZA 1YTDA 2EKGA 3GXFA 1RY8A 2A3LA 4FXJA 1BG4A 1TSIA 1X8FA 4ZQPA 3GR8A 3Q94A 3E3HA 5A6JA 1YTEA 4AD4A 4L6OA 1RBAA 1R85A 4V1XA 6XIMA 2GQ9A 1CGVA 1HO4A 2NUYA 2X0YA 4AH7A 4OVXA 1C93A 2OQLA 5I02A 3VD9A 4JD4A 1XLBA 2NXIA 3K8KA 3C2FA 1XIBA 2V0TA 4GIEA 1ICQA 4R85A 1E51A 1EX1A 3T9PA 4ECLA 2GQ3A 4FNPA 3NG3A 3SBFA 3N04A 1UIPA 4M56A 4ZO9A 1DHPA 1J11A 1ME7A 1TX2A 2YSWA 1QNSA 1TPDA 1W3HA 3W01A 4ZOEA 2P3ZA 1XCWA 1JDEA 3NSNA 4MUZA 1OF8A 5C9UA 5LYRA 3S5NA 2PURA 2OO6A 1UP3A 3KTXA 1SR0A 3VGGA 5I5RA 1QBBA 1EGVA 4REQA 4H00A 5CBJA 4O1FA 4O53A 1A80A 5C54A 1XRTA 3CEUA 4W7UA