1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
3FHAA 2WHKA 1HKJA 4M81A 1VBRA 4FLQA 2WMJA 3TOPA 7CGTA 3N17A 1C8QA 1V6UA 4MB4A 3KZSA 3W53A 2WAGA 3AFBA 3WQ4A 1JG9A 1H3GA 5JIWA 3WFZA 4P7RA 1GCYA 1FH8A 1UWQA 1TVNA 1KGXA 2W5FA 3VD3A 2O92A 2WLYA 3ZR5A 4OKDA 1UA3A 4W88A 2WZHA 3AIVA 1MQQA 4TVUA 3WF1A 3GNOA 2NT1A 5GQBA 3EDFA 1ISXA 2VC9A 5HBFA 1JI2A 4URIA 1UKTA 4OBSA 1FP8A 3VDHA 5HOSA 1PX4A 2VQUA 5E70A 1JZ4A 3S6TA 2V5CA 5FKYA 2BVYA 1MW0A 3QHNA 1ZBKA 3AJ7A 4M29A 4MAZA 2DQXA 4HMEA 4WKAA 4DWSC 2VZTA 5KEZA 1BYBA 1SFSA 3AHVA 1E6PA 3OBAA 4ZXLA 4D6IA 1OD0A 4IPLA 2JIEA 1E3XA 3W82A 2ZUVA 1BTCA 1US2A 4HA3A 4WK9A 1GQIA 1MYRA 4J28A 3W6MA 4JFTA 2UY5A 2YDSA 4MTVA 4QLKA 1W9BM 3WY1A 1J0KA 3K1DA 4W8AA 5FCZA 2QMJA 1WB0A 3JUGA 5D9OA 4WKHA 1WDPA 1ECEA 2DIJA 4CU8A 5D8ZA 1OIMA 1CXKA 3POCA 4P7QA 4WJXA 1BLIA 1ISYA 1O6IA 3B8SA 1E43A 4WSJA 5DO8A 2VRQA 4V2XA 3I3EA 4AYSA 1H4PA 4H2CA 3VIPA 4Z2LA 3LPFA 3VVGA 3FAWA 4AIOA 3J7HA 1K9DA 3GM8A 2J47A 2VCBA 3PTKA 2J62A 1HT6A 1EH9A 1I1XA 8CGTA 5LA0A 1E73M 3WNPA 3ALGA 2CETA 3AZSA 4P7LA 3T0DA 3BSHA 3WD1A 4W7UA 2DSUA 1J01A 2FH8A 1DEDA 2VX7A 4H7VA 4MDPA 4ATWA 1QOXA 3WDPP 4BCEA 2EBNA 3IAQA 2CERA 3VD9A 5EB8A 2VX6A 1YHTA 2BFGA 4QLLA 3N18A 5ABGA 3AXIA 4GQRA 9CGTA 3ZT6A 1KGUA 3CHDA 3TP4A 2JIWA 2DGAA 1ZB5A 5A69A 2WSKA 2Q8XA 4BQ3A 2XVPA 3OZPA 1R7AA 1TUXA 1OBAA 1QNQA 2XUCA 3DYPA 4P7NA 4AZ7A 2GDUA 5CPQA 2X0HA 2JF6A 1G9HA 3VGBA 1PIGA 1O7AA 3ZJ8A 3CO4A 3T2PA 1GUVA 5CG0A 1W2VA 3DHUA 1CTNA 1TR1A 5FD0A 3K46A 3MSGA 2VR5A 4AXNA 4HZ6A 1QW8A 3SCQA 2D20A 1CYGA 2F61A 4TUFA 3BH4A 3L4XA 4J3VA 1OWQA 2AAAA 2ESCA 3BGAA 2V38A 1VJZA 3EDEA 3QGVA 1MQRA 1W91A 4UQAA 3ZOAA 3NUKA 4E4PA 3ZJ6A 3WN6A 3QHOA 4F66A 2UWFA 2DH2A 2YKKA 4V28A 4MPKA 1VFUA 1E40A 3ZR6A 1JDDA 1VAHA 1E5JA 3ARQA 4FF5A 4F9JA 4QFUA 4TXEA 4L4OA 1GQKA 1UWRA 5CQ1A 1XSJA 4XV0A 2XFRA 1ZL1A 3N1AA 4N0RA 3VNYA 5D9MA 1CXFA 1C7TA 1EHNA 1EHAA 2GK1B 1KB3A 2OYKA 1C8XA 1WDSA 2D22A 5AYIA 2FHBA 4PMQA 2A3EA 4CCDA 4UQBA 1E70M 2JFEX 1PPIA 1B3VA 1OGSA 2ZX9A 4Q22A 4EANA 2ZIDA 1MQPA 2VRKA 2WMGA 2XFYA 5M3WA 4NRRA 4AD2A 3IJ8A 4CU6A 1CGVA 1QNOA 2BV9A 2XFFA 1UR9A 4V27A 3O2LA 3PZVA 3PZOA 3AS0A 3GNRA 4QAWA 1JZ3A 3AMCA 3A4XA 3POHA 1UWTA 1UUQA 1R8LA 2W61A 1B1YA 4E8CA 3VX0A 4OJYA 4DUWA 3AHZA 2D3NA 3AIEA 3BAKA 4XZWA 1U30A 1ODUA 2RGLA 2VQTA 3VIGA 2CBVA 1AVAA 3NYDA 4ACZB 4CVWA 4UFHA 1H09A 1I75A 4ZXOA 3OGRA 5IHSA 2WC3A 4JFSA 1MFUA 1HJSA 3WD0A 2CHOA 3FW6A 3DHPA 2BS9A 2QPUA 4UOQA 2CKRA 3APGA 4LGXA 3G6LA 3KL3A 3GH5A 4R5EA 3EMCA 1AQ0A 2YA0A 1D3CA 1HX0A 1KCLA 1UH2A 3BCFA 3WMBA 1BSIA 1VFFA 1WNOA 1V3JA 1US3A 1XV8A 4LQ1A 3NSXA 3EMQA 4ACZA 6A3HA 2WMKA 2OYLA 1UH4A 4OZOA 3AIUA 4XB3A 1NM9A 2AOSA 2PBGA 4P8UA 5I24A 5CSUA 2XGIA 1JZ5A 2WMIA 1GQLA 4D71A 4Z2KA 3L2MA 5A2AA 3T09A 5DEZA 3UCQA 3MMWA 2Y5EA 4OOZA 7A3HA 3RO8A 4CN6A 3IJ9A 1RH9A 5CJ5A 5JUVA 3GDBA 1W3LA 2D0HA 4UQEA 3LPPA 2DSVA 3KE0A 1E5NA 1V3MA 2BXZA 2W4XA 1VEOA 2VZSA 2WNWA 1Q6EA 2BY0A 4PMVA 3K8LA 4HTYA 1UHVA 1HP4A 1K9TA 3A6OA 1W3HA 3W38A 2YDRA 4UQDA 5JBDA 4AEEA 1WKYA 3GBDA 5EBAA 1MVYA 2B31A 4PEEA 1J9YA 4UNIA 1XSKA 4AW7A 4CN4A 4U3AA 2WMHA 1JI1A 3T2QA 3WELA 4PN2A 2CBJA 1MXGA 1UQZA 5EFDA 2OWWA 2Z1SA 3OIHA 1J11A 3HN3A 3VM7A 1OIFA 3CZJA 3A4WA 1E72M 1L0PA 2OWXA 4LPCA 1QI5A 3WEZA 1KXTA 3NSNA 1AQHA 3AMKA 3M07A 1NH6A 1JFXA 3OLEA 3VINA 1UYQA 4KRTA 3SCPA 2IXVA 5I3DA 3THCA 1B3WA 4GPNA 2D3LA 1BYCA 4CD8A 1E71M 1J10A 4GI9A 2Y2WA 1J0IA 1W2PA 4JFVA 2E4TA 3WF3A 1EO5A 1LLOA 1JXJA 1OINA 4AD0A 3OGSA 5M03A 1VJSA 1W9DM 3PZMA 2WLZA 4PMUA 5ABFB 3FNDA 1CEOA 3U57A 3VX1A 4AWEA 4CD5A 2C7FA 4J27A 1KCKA 1C7SA 1H5VA 2DSWA 1G01A 2BY1A 1GJWA 1KFWA 3AHTA 3TTSA 6TAAA 4DWSA 2CEQA 2ZXQA 4FK9A 2GSJA 2JALA 1GOIA 5A95A 3CH9A 4B9ZA 3UR8A 2HISA 1CWYA 5C8BB 3PZTA 4UZUA 3ZIZA 2JEQA 3ZJ7A 3ARRA 1LG1A 4C91A 1KR1A 1CGTA 1KXQA 5A8QA 2WB5A 1UKQA 1GQJA 2WBGA 1KBKA 3W24A 4M82A 2E0PA 1UA7A 3KEHA 3MANA 1FFRA 1M01A 1CNVA 3N12A 1QI4A 1R87A 4KMQA 2VJXA 3WL1A 5DMYA 4AIEA 7TAAA 2XPKA 1C3FA 1BGGA 2YBTA 5D4YA 2GVYA 4CD7A 1QI2A 5DFAA 2OSXA 4Z2GA 1JZ6A 4LYQA 3OA5A 1JGIA 3WF4A 1DWAM 3PZNA 3B9DA 2W63A 1ISZA 5A6KA 2WMFA 1WO2A 1QBBA 1E6ZA 1EXPA 2W92A 4UFLA 5A2CA 2C8NA 1J12A 2WC4A 4DM2A 1NOWA 2WCAA 3PTQA 2DT3A 4AZ6A 1QI3A 1E0XA 1AQMA 1W9PA 1BG9A 1XCWA 1EGZA 1RP9A 4H41A 2WHLA 2YL8A 2PWHA 3I3BA 2J7CA 4JZ5A 1NARA 3O6AA 1TCMA 1KGWA 4MNJA 1TA3B 5A6LA 4P8XA 1XYZA 1CGUA 3AYRA 1B3ZA 3F5LA 1V3LA 4JKMA 4TTUA 3N11A 1OM0A 2DT0A 1NWTA 1CBGA 3VIMA 2WZEA 4BF7A 2D0FA 3VMNA 1JYVA 1QNRA 1CLXA 2WVSA 4P8WA 3WQ6A 1Q6GA 3SCUA 2J8FA 3UERA 4MNLA 2YIHA 3ECQA 1BFNA 3ZSSA 2WM0A 1NWUA 5I77A 1JL8A 2CITA 1QI0A 1CZ1A 3WNOA 4WF7A 1GHSA 3KL0A 4DUXA 4AZGA 1R86A 4U2ZA 4W84A 4LXFA 4WIWA 5ABHA 3ARPA 3AMGA 3WIJA 5A8NA 3PZQA 1W1PA 3U5UA 3WQVA 4UFJA 3FXYA 2W66A 1CLVA 3F4VA 1LL7A 1JIBA 2YA2A 1HP5A 2J7DA 2XWDA 4CCCA 1K9FA 1ITCA 3FN9A 1UD3A 2VMFA 2E9BA 1OCQA 3L4TA 1TVPA 1UR4A 2GJPA 2VR4A 1CDGA 4W89A 2GDVA 1W1TA 3CHCA 4MJ4A 2CBIA 3VIFA 4AZCB 3WDRA 3DC0A 1V6XA 4XUYA 1GORA 2PWFA 5I6SA 5BRPA 1AMYA 1V0MA 4H04A 2WBKA 3WBAA 3HU7A 4W7VA 3CZ8A 4BS0A 2O9OA 3NDZA 1W1VA 1CIUA 3QOKA 5A6AA 2EO7A 3WNMA 3NSMA 3WSUA 4H8UA 4AZBA 3VD4A 3VDCA 2J75A 4XX6A 1ZS2A 1UD5A 1BVZA 1G1YA 4ML4A 1CXEA 3AXXA 3CZKA 4JFWA 2WW5A 4FLOA 3CBWA 5A2BA 2WYSA 5IDIA 1GONA 3ZMRA 3UR7A 3GXMA 4BZYA 1Q6CA 1WCGA 5CGTA 4W93A 5A6MA 2XHYA 4HPGA 1VFOA 2G3IA 2BHZA 2J78A 4KGJA 5BCAA 2G3NA 5ABFA 1NP2A 5A8OA 1W3KA 5JBEA 3WDJA 1PEZA 5D9NA 4FMVA 3D5HA 1FH9A 4HZ7A 2VRJA 1EIBA 3PZGA 1ISWA 4B3KA 1BHGA 4TTGA 5I78A 1E4MM 4AD3A 2VCAA 2V3FA 2YL6A 3CMGA 1KQZA 4D6DA 2YLAA 3B9EA 3GBEA 4GO8A 3ARUA 4MAVA 1V6YA 4Y7EA 4UFIA 1PBGA 3WNKA 3VDBA 4FLSA 3RIKA 3QR3A 3WF0A 3MKKA 8A3HA 3VGHA 2YBUA 4NSBA 1QNPA 2DEPA 3II1A 3TTOA 2GJRA 5ECUA 1B3YA 4KRUA 4U3CA 2VTFA 2VNCA 4M1RA 3T0BA 3ARYA 1D2KA 2BHYA 4GZIA 2ZWYA 1G5AA 1PZ3A 4Z2JA 4GZJA 4R27A 3AXHA 5A8MA 3RM9A 4MNMA 4MJ2A 1HN1A 1G0CA 3SCSA 3VPLA 2WHMA 5AYBA 2RGMA 2WVVA 3ARXA 1UR8A 2GJXB 3S2CA 3W25A 1GVIA 3AMLA 2WKLA 4QP0A 3L4UA 1UD2A 3PBGA 1WZMA 5I5RA 1HXJA 2X0YA 3K8KA 3VD5A 2VVSA 4U31A 4PUEA 2PB1A 1H0GA 4PBGA 1BYAA 2BHUA 3ZM8A 3WF2A 1YQ2A 1TE1A 4DM1A 4E8DA 4UCFA 2EXOA 4AZIA 2VCCA 4HPHA 1X6LA 2XVNA 3W81A 3L2LA 3AICA 1CECA 4GQQA 3MMDA 1BAGA 4Q7NA 5CLTA 1U33A 1K6AA 4QCFA 1VBUA 4B15A 1ZJAA 2X8RA 2E40A 3EDJA 1R7OA 4UFMA 3VGEA 3AROA 1V08A 1UG6A 2Y4SA 2O9RA 1UD4A 3MUZ1 1HNYA 2A3AA 4TOQA 2X1IA 3RJYA 4U5KA 4U2YA 1HKMA 1ESWA 3QOMA 1M7XA 1JD9A 4JFUA 1JDAA 4RE3A 2Y8KA 2CHNA 1UD6A 4PMRA 1UKOA 4CU7A 5I0DA 4AD1A 4TVCA 3WUFA 2GK1A 1UZ1A 3AS1A 4NRSA 3WH5A 4UR9A 3W6LA 3VDAA 3VOCA 1KBBA 1XC6A 5E6ZA 1GOKA 4Z2HA 3AS3A 3G6MA 2IXUA 5CPSA 2DT1A 3VMOA 4JKKA 2XSBA 5DF0A 3AHXA 2XG9A 3EYPA 4UQCA 2OYMA 1V0LA 3OLIA 3SCOA 3RPMA 1EO7A 1WP6A 2VO5A 3PTMA 1Q6DA 1XH1A 4PMZA 4IPNB 2GJXA 3W29A 5BXSA 1MXDA 4AD5A 2WCSA 2W91A 4FLRA 1E6SM 4WKFA 4BQ5A 3ZT5A 2BVDA 3VM5A 3N9KA 5A6BA 3ARSA 1J0JA 3EBVA 4P7OA 2NSXA 2VZUA 3SUWA 2PC8A 3VKKA 1PIFA 3MSDA 2XJ7A 1NOUA 3VO0A 2CNCA 2A3BA 2Y24A 5CSYA 5CXPA 1UZ4A 1HJXA 4HMDA 3AIBA 3GXDA 3ZQ9A 1ZJBA 1E4LA 2C0HA 5E9AA 3WBEA 3VIOA 4F9DA 1X6NA 3SCTA 4HA4A 3K4AA 3GTNA 2CCRA 4GKLA 1QHZA 2VVNA 3VILA 1VIWA 1UR1A 2DDXA 1B3XA 2A3CA 5BXTA 2XVKA 1HJQA 4LYPA 1B90A 1D7FA 1DWIM 2XIIA 1XSIA 1X1NA 2FDMA 1V03A 3BLKA 3PZ9A 4C90A 4C7DA 1B30A 4QLJA 3W4RA 1EA9C 3BSGA 4GO9A 1E55A 1LWHA 2EQDA 4ZFMA 1VFMA 1HL8A 3WD3A 3W26A 2VUYA 3BC9A 3F5JA 4X0NA 3SUSA 1NWRA 3WH6A 3DECA 1KWGA 2GUYA 4YHGA 2WMIB 5AC5A 3UETA 1P6WA 3GNPA 1XYFA 3CZEA 1DWGM 3L4ZA 1CENA 2J25A 2VL4A 3SUVA 1GOQA 3SEPA 1V0NA 4JL2A 3ZJKA 5A6BD 2ZUSA 1H0IA 1JXKA 1L8NA 3WKZA 4NI3A 3WDIA 3WL0A 1UWUA 2WWDA 4GINA 4Z2IA 1EQCA 3CUIA 1M03A 3CTTA 2CBUA 5HXMA 4HA1A 4A3HA 1GOWA 1LWJA 1KQYA 1V0KA 2VOTA 4IISA 3EMZA 3DYMA 2ZICA 4C7FA 1EOMA 2OLHA 3AZRA 1KR0A 3WQ8A 2G41A 4CD6A 4J7RA 4HU0A 2WCGA 1C93A 1U2YA 5D8WA 2V3DA 3NDYA 4UOZA 2G8ZA 5BXPA 4GXPA 4BQ4A 2ZX8A 1CXLA 4AZCA 3W0KA 5CPTA 3MU7A 2XTKA 1VEPA 4JL1A 4AZHA 3TA9A 4AD4A 1UWIA 1XGZA 2J77A 3GH4A 4IM4A 2CXGA 2EJ1A 2X05A 3NIYA 1BPLB 2DIEA 1VRXA 1IT0A 4AISA 3AYSA 3GYCA 1J0ZA 3GXFA 1JFHA 5M5DA 1WPCA 3QHMA 4CUCA 1E9LA 1MFVA 1J0HA 1HJWA 3RILA 1K9EA 4XZBA 5IFPA 1HKKA 4GIAA 1JYNA 3B9AA 1JF6A 4PSRA 4BQ2A 5BXRA 1OGBA 4JIEA 1OSEA 2G3JA 4IUGA 2V3GA 1LL4A 4D1IA 2YDQA 2J7BA 2V5DA 2HVMA 3IAPA 1TFVA 1ZU8A 3MO4A 2WSPA 1DWJM 1UR2A 3ARWA 2VX4A 1EDTA 3VU2A 1DTUA 2ZXAA 3AMDA 1HVQA 3WQWA 3OGVA 2MANA 3AIQA 3SURA 2UY2A 1GHRA 1DP0A 3WDQA 1G94A 3U7VA 2J7GA 2VT0A 4D72A 3RM8A 5DT5A 3MUY1 4HOZA 1V02E 1GVYA 3NCOA 1XD1A 4KWUA 2QPSA 2VI0A 1QPKA 3M46A 2NW0A 3CGTA 3M7SA 5IHRA 5E09A 5BWFA 1Z32X 3L4YA 1S46A 4B9YA 2UY3A 3SUUA 5TD4A 3I3DA 4M8UA 1LL6A 2PBOA 4MNKA 5CZKA 2QV4A 4S3JA 1QNSA 4LYRA 2WK2A 1ODZA 2XIBA 2FGZA 5EMYA 2WXDM 2E9LA 3OLDA 2DSZA 4AIUA 1QBAA 1Y7VA 1WDRA 1UD8A 1W9UA 1E4IA 1NP0A 3IK2A 4JHZA 4W85A 4MB5A 5GNZA 1OT1A 1H11A 5I23A 2NT0A 2E9MA 3BAYA 4W7WA 4MB3A 3THDA 1B2YA 1SYTA 1SMAA 4W87A 4OIFA 3VNZA 1FA2A 4AY1A 3OG2A 1JYXA 1CGXA 1ZBCA 1I1WA 2CKSA 3PZUA 1QW9A 1BVNP 3GZAA 3KL5A 5C70A 1KXHA 3W37A 4EAMA 4PYSA 4YPJA 2DSKA 3CLWA 4H8HA 4HOXA 3VGDA 3WEMA 1VF8A 1XH0A 3CIVA 2OSWA 4M80A 5FL0A 4CGTA 3VMPA 2YL5A 4H8VA 3RM4A 3AS2A 2J79A 3WMCA 1C92A 2WWCA 3UG4A 4YN5A 1VB9A 2JE8A 2ZUUA 5EFFA 2EPNA 2WZIA 4D6GA 2IUZA 3VIJA 4PMXA 3TTYA 4JAWA 2EEXA 4L4PA 4A3YA 2CYGA 3WENA 4W5UA 4CKQA 5BRQA 1UKSA 3TONA 4PRWA 6CGTA 5BYWA 4ZEPA 3PZIA 4D6CA 3L4WA 1B31A 1XHGA 2V3EA 5E0FA 4M56A 1MW1A 3PN8A 3FAXA 4HP5A 3FY1A 3CUJA 5GNXA 1V3KA 2YJQA 1J0YA 5GNYA 4OUEA 1CXHA 4EK7A 1C8YA 1HL9A 2J8GA 4WLCA 3EDDA 1GOMA 1GOOA 2O9PA 3BAIA 3VTRA 1V3HA 5C71A 4UTFA 2BY3A 2ZUMA 3IJ7A 2D24A 1IZJA 1OGGA 3WQ5A 2JF7A 3BAWA 3W28A 3BMWA 4UFKA 2EPLX 2A3HA 4AZ5A 4S3KA 4EKJA 3AQUA 2YOCA 4DUVA 4W8LA 1HVXA 2XVLA 4GZEA 2CPUA 2BNJA 5A6JA 1ZBWA 2OWCA 1RD6A 2AMGA 3VUPA 2WVVB 2WC7A 1RP8A 1SMDA 4C7GA 4N42A 4NF7A 1JAEA 4NZCA 1E1EA 1TMQA 1HIZA 2VURA 3O9NA 4J3UA 3RMEA 1EQPA 2CESA 4U33A 4RL3A 3CHFA 1KWKA 1OT2A 2BVTA 3CUHA 4QCEA 4CCEA 2D2OA 3OZOA 2J74A 2Z1KA 3FHQA 3VD7A 4D6JA 3HMCA 4OBRA 2FH6A 3BMVA 1M53A 3AZTA 2WPGA 4KGLA 5FOOA 2XM2A 5GPRA 1XRVA 4J3SA 1KXVA 3BLPX 1ZBVA 5E0CA 2YL9A 3SCNA 2XGBA 2FHFA 1H49A 3F5KA 3N04A 3E1F1 2FHCA 1UOKA 1H41A 1V6VA 4CVUA 2DT2A 1DHKA 2W67A 3CZGA 1N82A 3BXWA 2CIPA 4B16A 3WEOA 4YHEA 3UG3A 3W27A 3SCVA 4CD4A 2PF0A 5FL1A 3WDHA 4UZSA 1BYDA 1WAWA 2Y8VA 4F79A 3SIMA 4PUDA 2PWEA 5A1AA 1MW3A 3LPGA 5A8PA 2PI6A 1E6RA 1HJVA 2BXYA 1PJ9A 2ZUTA 1JF5A 1F4AA 1WZLA 2G4FA 2X09A 1NOFA 3WH7A 1LQ0A 1CGWA 1W32A 3WH8A 2QMKA 2XVGA 1PX8A 4PMNA 3CHEA 3ZSTA 3A47A 5A94A 4EE9A 1NWSA 2J4GA 2WVTA 3BAJA 1HF6A 2J7HA 2WKGA 4W8BA 1TG7A 4HMCA 1QHPA 1UKPA 1FFQA 1E4NA 4CN1A 1CXIA 4PTXA 3RDKA 3D3AA 5HNNA 1JAKA 3GH7A 4QDMA 3K8MA 1SR0A 3N15A 1B0IA 1E6XM 2J7FA 1WZAA 1V6WA 5D9PA 1JZ8A 1A3HA 3WH9A 3VGFA 1CPUA 1VEMA 3AIRA 1W9VA 4M24A 2QHAA 4D6FA 4PMDA 4F8XA 5AY7A 3LPOA 4LX4A 3SCRA 1MW2A 2ZUWA 3WUEA 1GZJA 4KH2A 2GFTA 4ATLA 1LF1A 2W62A 4ZE4A 1W9XA 4PCSA 5CGMA 3RJXA 2ZXDA 3N13A 3CUFA 3UESA 5I2UA 1BGAA 1E56A 3GXIA 4WSKA 4BA0A 1WZKA 1C91A 3HJEA 4UOJA 5CLWA 4ATDA 4D1JA 3MUAA 1NQ6A 3ZT7A 3CPUA 3WNNA 3CZLA 4PMOA 1GJUA 2E8YA 2FGLA 4X0VA 4HOWA 1IZKA 2PWDA 4J3TA 1FH7A 5LA2A 2X2YA 3L4VA 3AIWA 4PMYA 1E6NA 1OB0A 3TTQA 2PWGA 2VZOA 3MMUA 2VZVA 1JNEA 1BG4A 3UEQA 1PZ2A 5LA1A 1JYWA 4PTMA 1W3JA 1C90A 3AISA 1DWHM 4MDOA 4J3WA 5KZ6A 1FOBA 4ZE5A 2E3ZA 3MV01 5F7UA 4OOUA 1HKIA 2G3MA 4X9YA 5A6SA 4JKLA 3RCNA 1WE5A 5IXEA 3LMYA 2ZX5A 3ARVA 4PCTA 1JZ7A 2ZUNA 3VGGA 1R85A 1W1YA 2YA1A 5HDRA 1EOKA 1QVBA 3T0AA 4D6HA 5JIPA 1DWFM 5ABEA 1IV8A 2D0GA 2YLLA 1XD0A 2JEPA 2XM1A 4HU8A 4E2OA 1UWSA 1V02A 4D6EA 4P8VA 5M17A 4MADA 1TZ7A 5LYRA 1GW1A 2XWEA 4DWSB 1TA3A 1E6QM 2TAAA 1FHDA 4GI6A 1E15A 2BY2A 1OD8A 1EDGA 1Q4NX 1J18A 3MS8A 5HPOA 1EDQA 3ZO9A 4U5IA 4TX8A 5I79A 2XSAA 1GNXA 1PX3A 2ZX7A 3AOFA 3SCWA 3WUBA 5JBFA 3A3HA 5IFTA 2ZX6A 4ZENA 4UQ9A 1MWOA 1JD7A 5A3HA 3WD4A 2XYLA 4AC1X 4AEFA 3T2OA 2WHJA 4JCMA 3VIKA 4DWSD 3KWXA 2J7EA 2ZXBA 1E0VA 3U7BA 1JZ2A 4ACYA 1UH3A 4MB1A 3SUTA 3U5YA 1LG2A 3K4DA 4AMCA 2ZWZA 4W5ZA 1B9ZA 1PAMA 2WANA 4W86A 1HJUA 5HPCA 2EPKX 3WMSA 4JCLA 1E0WA 2D1ZA 1VENA 1H2JA 3CMJA 2F2HA 3CUGA 2WVUA 1FP9A 2OSYA 4GI8A 4JHOA 1XH2A 3BAXA 2DH3A 2F8QA 3WNLA 2ZE0A 3AI0A 1E3ZA 1F4HA 4TX6A 3OB8A 3WD2A 1WDQA 3A4AA 2EPOA 2UY4A 1ISVA 5FIPA 3MV11 1H1NA 5BROA 3EDKA 3WUGA 4RE4A 4PSPA 3BCDA 2DPEA 4J3XA 3VIHA 2ZOXA 1ITXA 1E1FA 4HZ8A 3ALFA 3VIIA 2EPMX 5E6YA 1BF2A 1V3IA 3UG5A 3NJ3A 1LJYA 3ARZA 3M6DA 2D23A 1GPFA 4A4AA 1UQYA 5AC4A 1Q6FA 2QLYA 2QF8A 1QHOA 5DT7A 2E8ZA 4PTVA 1A47A 1RPKA 3T08A 2VX5A 4RE2A 3IANA 4PTWA 3MUIA 1BQCA 1UR0A 3WFLA 4B3LA 3ARTA 2O9TA 1FHLA 3AHYA 4K68A 4TVDA 1JNDA 3PHAA 1XCXA 1M04A 3DYOA 1JDCA 3OLGA 1CGYA
chains in the Genus database with same CATH superfamily
2V2HA 1VBRA 3JR2A 4O0QA 3QC3A 5C2GA 3N17A 2PGEA 1W1A1 3W53A 1YXCA 4LCSA 2C6QA 3WFZA 1PWMA 1FH8A 1TVNA 2A1YA 1FWHC 2Z1BA 2WLYA 4OKDA 1V79A 2WZHA 1A5BA 3CK5A 3B0UX 3CL8A 4F2TA 2QUMA 4EPDC 2GVEA 3FYOA 5CAKA 3EDFA 3GSMA 3FFSA 1F76A 1N55A 3GC5A 3DFOA 4URIA 3VDHA 1S39A 1TV4A 2HVOA 2ZZ6A 5HOSA 1OFPA 1T8XA 5EA9A 1KFKA 2V5CA 5FKYA 2PDLA 3QHNA 3AJ7A 4DBWA 4AXKA 4ZTXA 4KIRA 3QQ1A 1NY1A 4JQ2A 3HO8A 4ZXLA 4IPLA 2JIEA 5CZSA 1E3XA 1F5ZA 3W82A 2MNRA 3CIXA 4J28A 4FOKA 2UY5A 2YDSA 4QLKA 2J9YA 1WUFA 5KMYA 1J0KA 3BZGA 2OKTA 2NX3A 3WLPA 2WSQA 4WKHA 3ANUA 4AWSA 1CXKA 4NT0A 4WJXA 4DO5A 1ONXA 1BLIA 3F4DA 1LUCA 3CQHA 1E43A 5DO8A 3I3EA 4AYSA 3PJWA 2P8CA 3LCXA 2D2HA 5FEXA 3Q45A 4HU3A 4B4HA 4C6BA 4DBDA 3GM8A 1RVKA 3LI1A 3PTKA 5LA0A 1E73M 2CETA 3T0DA 1V5XA 1HGWA 4W9TA 3DG6A 2EKGA 2DSUA 2VFHA 1J01A 3LRKA 2BSLA 2DIKA 4KBXA 4MDPA 4JTGA 3FLUA 3IAQA 4R53A 1VC4A 4GKTA 1YHTA 7REQB 3N18A 1FWEC 4CQAA 5FAJA 3ZT6A 3SZ8A 1J79A 3CHDA 2DGAA 1DXFA 3O0KA 4BQ3A 3QZEA 1QNQA 4IX2A 4E3TA 2ZDSA 3C3UA 1ZFJA 1XLCA 3PS7A 4C1KA 4KT2A 3M6YA 2PDBA 1G9HA 2GQ8A 3ZJ8A 3OBKA 4HN4A 5FD0A 3M0YA 4L9XA 2ZA3A 1Z44A 4AXNA 3P0XA 1FCVA 2X0SA 1CYGA 2F61A 3BH4A 5E93A 4UNKA 1F8MA 2FDSA 4AFYA 1JCJA 4LUSB 4GY0A 4LF1A 1OCNA 4GIRA 3SJNA 4E4FA 3QHOA 5C9UA 3VKDA 3IUIA 1LBFA 3ZR6A 3G8RA 3TYUA 3G0UA 4M6PA 4ZQMA 4AHQA 4ZBCA 1OFEA 4BI5A 1ME7A 2EF9A 5M2FX 4DI9A 1ZL1A 3N1AA 4B91A 4LV4A 1V4YA 2OYKA 3QSTA 5AYIA 4DLFA 1QCWA 2HWGA 2QUUA 4PMQA 3VNKA 4HVXA 4I9MA 1PPIA 1VBHA 4AB4A 1OGSA 3G1FA 2Y61A 3IJQA 2XFYA 4NRRA 3IJ8A 4HB7A 3R2GA 1VD6A 2KAUC 3O2LA 3I6TA 3PZOA 1T99A 3A4XA 3U2OA 3GG8A 1HL2A 1UWTA 3TU9A 3W7DA 1FY6A 5CGQA 3IEBA 1K7FA 2OXNA 3VX0A 3E2SA 2D3NA 3AIEA 4A8IA 5DXXA 1WKFA 4XZWA 3BL3A 2VQTA 3VIGA 3NYDA 3A23A 3OGRA 1KRAC 1S1RA 4JFSA 4K36A 1RJPA 1HJSA 2E25A 3WLMA 3DHPA 2QPUA 3MCNA 4UOQA 2CKRA 4EP8C 3KL3A 3FGCB 4LS0A 3NM3A 2BODX 3NNTA 2YA0A 1AQ0A 1GVSA 3HGOA 3T0CA 2HPIA 4H9ZA 4Q4QA 3PWGA 1VFFA 1WNOA 4FO4A 3ABZA 2X2GA 3GXNA 3C0SA 2IW0A 2V63A 4YLWA 5TAOA 4ACZA 2EAWA 4XVDA 2WMKA 1UH4A 4GYFA 4XB3A 1G69A 2NXIA 2P1FA 4GVGA 1S2AA 1C29A 3U6WA 4FNTA 3TV8A 4RR4A 3L2MA 1OK6A 3T09A 1XF0A 1QRQA 3F7JA 3FJLA 3MMWA 4UTMA 4OGZA 4HTBA 3UYCA 2X1TA 2QUTA 1P6CA 1VEOA 2VZSA 5AECA 2WNWA 1HP4A 1S2VA 1F05A 2QQ6A 4KIEA 3JZEA 1ML1A 4FS9A 4LAMA 3QPEA 4BI6A 5C2XA 4IICA 3EXSA 1MVYA 3UZYA 2EGZA 5G5IA 2R1KA 2B7OA 3ZR4A 5GJNA 1FHVA 1JI1A 1O60A 4J1OA 3T2QA 3VK5A 3WELA 3LHUA 4MUZA 4CQ8A 1KW1A 3G1YA 5EFDA 1H7XA 2A6LA 2V2DA 4GIEA 2GJNA 4PTDA 3VM7A 5FJRA 3CZJA 2A85A 3MDWA 1FX6A 2OWXA 3VA8A 3W73A 4LPCA 6TIMA 1QI5A 1EUAA 1AQHA 3W7MA 4O8RA 3UWEA 3CUXA 1NH6A 3VINA 1UYQA 2QCEA 3SCPA 1B3WA 2RDUA 3O6YX 3SM0A 4GPNA 1U5VA 2D3LA 4JDBA 3ZWSA 4I3GA 2BOEX 1GYMA 4LJ3A 2F6KA 1J0IA 1XIMA 1W2PA 4TR9A 1JXJA 3I6RA 2BXVA 2Z27A 1S5NA 1A0CA 3FNDA 3H7VA 3U57A 3C2FA 4CD5A 1F2JA 1UC4A 3WJYA 2I9UA 1TELA 1H5VA 2Z1VA 2DSWA 1G01A 2BY1A 1GJWA 1VYRA 3AHTA 5EY5A 2NSOA 4DWSA 2CEQA 4IQDA 2HXTA 3CMFA 1GOIA 2NVCA 4IGNA 3CH9A 3WLKX 1P1XA 2NX9A 3IJ6A 2FMOA 3QR1A 4QISA 3W71A 1UASA 1TTIA 4JQAA 3VCRA 2WB5A 1GQJA 5EIYB 3GKFA 2WBGA 5XIAA 2PP0A 4RJEA 4J9JA 4X2RA 3RCYA 3MANA 4AG0A 4I6KA 4KMQA 3WL1A 2IKHA 1T6MA 1C3FA 3AWNA 3MVIA 1AD4A 3VCNA 3PJXA 2OU4A 2GVYA 3GU9A 2RHGA 3PWAA 5DFAA 3BJTA 1JZ6A 4DQWA 3CWNA 3VUSA 1JGIA 3WF4A 1DWAM 1QBBA 4UFLA 1J12A 5ABTA 2WCAA 3EPOA 5H91A 4O16A 1QI3A 1H1ZA 4M6QA 1BG9A 2OR2A 3HPFA 1XCWA 4Q4OA 4QJ5B 1NARA 3W74A 1KGWA 4MNJA 1TA3B 1CGUA 3M5YA 3T0TA 2ZVIA 2DT0A 3BPWA 2WZEA 2HK1A 3ZLGA 4PUKA 4AUBA 3NO5A 4LY4A 3WQ6A 3ECQA 1MMFA 1LDCA 2Q6ZA 1JL8A 2CITA 4O18A 1MEWA 4PBFA 1Z48A 2C3ZA 3CTLA 3T1GA 4DUXA 3OQEA 1TJRA 4AZGA 3TUUA 4Y8FA 5C55A 4AVFA 3OZMA 3FYPA 5G4WA 3M0KA 1F3TA 4NXKA 2I7GA 3MPGA 3PZQA 3U5UA 4O14A 3S5YA 3V1PA 4PFHA 1X1ZA 3DCPA 4JN7A 2PS2A 4KERA 3B04A 1CLVA 2DZWA 3F4VA 1JIBA 1IF2A 4ONVA 1JQXA 2YA2A 1HP5A 2J7DA 3JW7A 1ITCA 1OCQA 4YVPA 1W56A 1PO9A 4W89A 5CZ0A 4B4FA 4AZCB 3WDRA 4ALDA 3CV6A 4WRHA 3NL6A 2PWFA 4NYYA 4JOMA 3VXGA 5I6SA 1AMKA 2TMDA 3LS9A 1RK6A 1YPXA 1WBJA 4P5UA 4MY9A 3N9RA 4GBDA 2CWXA 2ZRUA 4RK8A 2G95A 4HHHA 3RRAA 4XIAA 1XLMA 3MT1A 3EOUA 3QOKA 1B4EA 5AZ1A 2ZTKA 3A21A 2XZ7A 3W1XA 1YXYA 2QS8A 4ZZ9A 3WNMA 3W7PA 3ORWA 2E6YA 2ALDA 2VEMA 3WMLA 4ML4A 3TZNA 3AXXA 5HA7A 2YCLB 3M0LA 5LIYX 3KCJA 3PR2A 1P0EA 3CBWA 3C2OA 3HPZA 2DZXA 4I90A 4BZYA 1Q6CA 2E1WA 5A6MA 1VFOA 1JPIA 2Y7FA 2ON3A 1U5JA 1DHPA 4R7OA 4L9YA 4M5PA 5A8OA 1DJXA 3RN6A 4K38A 5D9NA 4FMVA 3D5HA 5EPDA 3USBA 2XIOA 3D0CA 3B97A 2QJIA 2VRJA 3GO2A 4HYRA 3GB6A 3MQTA 1E4MM 5HJYA 2V3FA 1NVMA 1NIUA 2Z25A 3O6CA 1XFBA 1KM5A 3O15A 1GVFA 3GBEA 1XWYA 4GO8A 4MAVA 4Y7EA 1V6YA 1PBGA 3VDBA 1Q5MA 8A3HA 2FGBA 3VGHA 3BICA 3ITVA 4AEOA 1GKQA 1OX6A 1R3TA 3RFAA 1RHCA 4DJEC 4P61A 3R10A 4FNPA 1FWIC 4M1RA 4PEKA 1N2VA 4G7FA 4JNYA 3NVDA 4GZJA 5GVJA 5CSRA 3DFQA 1ZP4A 5A8MA 3RM9A 3SCSA 2OEMA 3VPLA 3T40A 3ARXA 1SJCA 3CPGA 5LXEA 3UF9A 5D04C 3ES8A 4Q4MA 4GD0A 3L4UA 5PTDA 5G4HC 2WJEA 4MMWA 5I5RA 4LRTA 1S2TA 1L8PA 2GL5A 3KVJA 2PC4A 3RGTA 3EA1A 7ENLA 2EXOA 1YDYA 2QULA 4BF9A 2D73A 4Y9MA 5CLTA 5DQPA 1U33A 3GTXA 2C19A 4R85A 1VBUA 2GUUA 3UY8A 1R7OA 4XSLA 2H9AB 2O9RA 4ZB2A 4AF0A 1I2QA 4JTHA 2FTPA 3AC0A 4GUGA 4TOQA 4XBKA 4XAZA 3UJ2A 3GHTA 4V1YA 1L6SA 3OVQA 4IPPA 3W7OA 2C15A 1ESWA 2NV1A 3QOMA 1M7XA 1O4UA 4HSOA 5LNWA 1KLYA 1VPYA 1GVRA 2CHNA 4CU7A 3S42A 3WUFA 3PG8A 4QE1A 3TYBA 3BLDA 3QC0A 1KFCA 1Z3NA 4Z1CA 4PFMA 3AS3A 3V4BA 3C2EA 1TE6A 4JKKA 3K1GA 4RPPA 2PLJA 1V0LA 3QKEA 4ZVJA 1XBYA 4R3UA 2HK0A 3N25A 5GJMA 3A22A 1MXDA 4AD5A 4LCRA 4DJDC 4QHRA 1JJKA 3VM5A 4Q8MA 5A6BA 3DKLA 1FWFC 4L64A 2QCCA 2NSXA 4GQBA 3VKKA 3LQGA 2W27A 4GYPA 1PIFA 4JN8A 2H90A 2XJ7A 2Z28A 4TMBA 2OT0A 3F1QA 3UBPC 2A3BA 4ICMA 3NO1A 1L6FA 4HMDA 5CC7A 1ZJBA 2Y7GA 3P5YA 3HPAA 3WBEA 5U4NA 4EWJA 5FJJA 1UMLA 3SCTA 4FHAA 3K4AA 2NQZA 1EZ2A 1IT7A 2X1UA 3BWWA 3A13A 2HMCA 4PL2A 4ROQA 3MKVA 1B90A 5HMFA 4Q4KA 3QV7A 1F3XA 2FDMA 3NPVA 3PZ9A 4C90A 4C7DA 3W4RA 4QLJA 5HJXA 1FWTA 3F4WA 4OHQA 2DZSA 4Z1DA 2VUNA 4GABA 1WDDA 4GC4A 3W26A 2VUYA 3BC9A 3VNJA 3RHGA 2HS6A 4JNMA 3UG8A 3W23A 1P43A 4JTSA 2AQOA 4PRTA 3B8UA 2F9RA 3KTSA 3STGA 2QVNA 3UETA 1DQUA 2BVWA 3GNPA 1XYFA 3ZS4A 1I0DA 1XQLA 1G67A 4DZHA 3NEHA 4DZAA 3EEGA 1H7RA 3WKZA 3WL0A 4IMCA 2PCEA 2P0IA 4Z2IA 4IJCA 3M64A 3QBUA 2E7FA 3KBVA 3CHVA 3ANYA 4NXSA 4HA1A 1N8WA 4ZB0A 4A3HA 1LWJA 1KQYA 1F73A 2BMBA 4JXCA 1RY0A 1BSLA 4I5RA 1ZCCA 3VNIA 3EMZA 1BWLA 3LMZA 3VZXA 1EOMA 5HMDA 2OLHA 3AZRA 2XU2A 1V77A 2G41A 5F4XA 2PTDA 4HU0A 2WCGA 5D8WA 2E5DA 1LOLA 3BVJA 4OT7A 4D8AA 2QT3A 4BQ4A 4AZCA 3W0KA 3CM4A 1W0MA 3H2CA 5CPTA 4AZHA 3RNDA 3LBOA 4QSFA 1Q6RA 4N9BA 4AD4A 1UWIA 1A4LA 2Y63A 2X05A 1IT0A 4AISA 2YGYA 3VKJA 4X3ZA 3FSUA 1MDLA 4JDYA 3RUBL 1E9LA 1MFVA 5IFPA 2CLOA 2Y6ZA 4GIAA 4DLMA 3CXOA 4PSRA 1SJBA 1J6OA 4MZ8A 5BXRA 1OGBA 4EWND 1DJGA 1UUMA 6REQB 4IUGA 3NZ1A 3WLJA 1LL4A 3CV1A 1EEPA 4MKVA 2HZGA 3UJEA 3MUXA 3MO4A 2WSPA 3T78A 4V33A 3VE7A 3WQWA 4NAEB 2MANA 3V75A 3B8TA 2UY2A 1ZLPA 1GHRA 4FSAA 3RM8A 2QAFA 3CAKA 4JD4A 4CNSA 5DCDA 5EBUA 1GVYA 4KWUA 3PFRA 2QPSA 4G7EA 2VI0A 5AC8A 3M46A 2ISVA 2ZZ5A 2Z6JA 4GNVA 5E09A 4BJHA 3M0ZA 3MP5A 2OCZA 4UNLA 3CLMA 3SAZA 4M8UA 3EXRA 1A0EA 3C2VA 1TMHA 4PR4A 3RMJA 4LYRA 2WK2A 3DDMA 1ODZA 4JIQA 4OQVA 4GUJA 2XIBA 2QJMA 1R0MA 2WXDM 1NTHA 2H9AA 1DYSA 1M7OA 1KTNA 5CPMA 3OLDA 5LGZA 3RK8A 1WDRA 2OQYA 1E4IA 1NP0A 3IK2A 3MCMA 5TIMA 4PUUA 2HXUA 2X7VA 2Q02A 5AKQA 1R38A 5G1MA 4MB3A 3BGJA 1B2YA 1SYTA 5LNRA 1OFAA 1FA2A 1SFJA 3FV9A 1W5OA 2CKSA 1QW9A 3R12A 3KL5A 5C70A 5FAGA 4RDYA 5FF3A 3PANA 4JYEA 4NASA 1VF8A 3CIVA 4NJJA 4AH7A 3GNDA 3QTGA 1VGAA 1D9EA 5FL0A 3TYDA 3VMPA 5DMLA 3EB4A 1C92A 1X96A 2Z7KA 3GKAA 5HINA 8TIMA 3HG3A 3I7RA 4AY8A 2ALRA 2IUZA 4QG6A 2FPYA 1FWGC 4XD5A 4F3HA 1PHQA 2CYGA 2DZBA 2FVMA 2DVTA 4CKQA 1F3EA 4PRWA 3MCOA 1UB3A 5BYWA 4D6CA 4NX0A 1XHGA 4X22A 4DF0A 3W7GA 3MW7A 4K3ZA 3PN8A 4KS0A 4HT3A 2ASHA 4XTIA 1TSIA 5GNXA 3CUJA 2YJQA 2NV9A 1J0YA 1X6UA 5GNYA 4Q8VA 4US5A 4DBUA 3KOWA 3JRKA 1RLCL 4I8YA 1L6YA 3DXIA 3TW6A 2YXGA 4WLCA 1E9ZB 2OT1A 2O9PA 4GA8A 3ICJA 3VTRA 2Z7GA 4DPPA 3OIXA 3P8IA 5D30A 4XWUA 1BKHA 1WAUA 3QXBA 3P2VA 3FS2A 3WQ5A 4FPSA 3BAWA 4UFKA 2A3HA 1IYXA 1PV8A 2XVLA 3QM3A 2Z26A 4HSHA 3Q58A 1ZBWA 4MWAD 3WLIA 5EJZB 3OBEA 3F4CA 4XZHA 4JTCA 2BLEA 2V5LA 5AC7A 2OJPA 4O12A 3R94A 1JAEA 2WZMA 1HIZA 3O9NA 3L0NA 3ITTA 3CHFA 3LCFA 1IR2A 4LBUA 3HTWA 4OBRA 1QOPA 1M53A 4IHCA 4JBRA 6ALDA 1W1IE 2WPGA 5FOOA 4DAFA 3VOIA 5GPRA 5HNRA 4GQGA 1PKLA 3BLLA 2WM1A 3SCNA 2XGBA 2FHFA 5D37A 1XYBA 2A79A 4UBPC 3GNNA 1EF2A 1TVLA 1V6VA 2DT2A 1DHKA 2W67A 5SWUA 1EYEA 4IJBA 4QDPA 3UFYA 5EL1A 1N82A 4QEHA 1QOQA 3KRBA 3EXTA 1FWNA 1E51A 1G4PA 3OVRA 2VFEA 3S83A 4H2HA 4MY1A 1WAWA 3CYJA 4F40A 1IT8A 4EXAA 1T5AA 3EOEA 1MW3A 3WG6A 1KC7A 5A8PA 3LRMA 2PGRA 3T81A 5AB3A 3OYXA 5FF7A 4TMCA 3OYZA 4I7WA 3BE7A 1X8FA 2X09A 5I7GA 2PP1A 2J13A 3NO3A 3ZSTA 3W7IA 3URAA 4EE9A 4J2MA 2J4GA 3WLTA 1KFLA 2NLYA 3W2JA 3NQBA 2YFNA 5FSDC 1JRBA 4HMCA 4WJEA 1BQGA 1UKPA 2VEGA 1E4NA 5BZAA 1CXIA 3D3AA 3HFTA 3Q65A 1SR0A 3GR7A 5MKGA 1JPMA 3G24A 3P67A 4KEVA 4QG9A 1NELA 1VEMA 1UP3A 3GVWA 4PMDA 4F8XA 4S3EA 4LX4A 1XGDA 4RKAA 1MW2A 3M0IA 3TK7A 1QPRA 5CGMA 4M7TA 3GVGA 4IGMA 3SECA 3H23A 3UESA 1E56A 2FIQA 3I7SA 1ZP3A 3A4JA 4UTHA 1ADOA 3D3FA 3IWPA 2IPWA 3ZT7A 3U0HA 3QQ0A 3CZLA 4EXBA 1XDMA 2YDAA 4HOWA 4FIQA 1IZKA 2J6VA 1M5WA 4PMYA 5AHLA 4R9OA 3UZJA 3HF3A 3BLFA 3MMUA 2VZVA 1MEIA 4GUIA 2PDMA 1IR1A 4J3WA 1NF0A 2DZAA 4OOUA 3OODA 1YBQB 1M1BA 4KKXA 4C6FA 3RCNA 4IX0A 1A49A 2GOKA 3LMYA 3WJZA 4WOQA 1W8GA 1RZMA 2ZUNA 4KFNA 4O1BA 2YA1A 1JCNA 1QVBA 3TMLA 4CQBA 5ABEA 2YLLA 2B81A 2OOGA 2VFDA 3A5FA 1V02A 4M6VA 1ZCOA 1TZ7A 3IS4A 5LYRA 2BZNA 2XWEA 4C6DA 2PUZA 1TA3A 1AODA 3DG7A 3G77A 1E1CB 1E15A 1SR9A 1QWKA 3C61A 1F9CA 1GOXA 1AK5A 1Q4NX 4XSMA 1J18A 3MS8A 5HPOA 4EPEC 2PLMA 4C6QA 3ZO9A 2VGIA 4IQEA 4LS1A 4PUWA 3GHRA 2XIQA 3WUBA 3D46A 2JK2A 1ZAIA 5JBFA 3C86A 3A3HA 2ZX6A 3HJZA 3OVGA 1I2NA 4UQ9A 4GOAA 5A3HA 2XYLA 4AC1X 3UWZA 1TB3A 3VIKA 4DWSD 4RZ5A 2I5QA 5HQEA 1FWJC 2A3LA 3PK7A 5JMUA 3EPMA 1B5TA 3GFZA 3U7BA 1WX0A 1UH3A 2QAPA 3U5YA 1LG2A 5REQA 4ZFCA 4QQUA 1Q13A 2WANA 3EX3A 4RUBA 1EBGA 4E38A 4IMEA 4JCLA 3S6OA 2G37A 2FLIA 3SDOA 3GHUA 2F2HA 3CUGA 1FP9A 2ZA2A 1XH2A 3LHVA 4CEUC 1UMYA 2ZE0A 2VELA 4H6RA 1PZ1A 4F48A 3OB8A 3WD2A 1WDQA 2G3FA 3A4AA 3H26A 5AFDA 4YYFA 2VGBA 2W6RA 4KCTA 3B0PA 4K2SA 3EDKA 3WUGA 4RE4A 3W86A 3DN5A 4YTRA 3QVQA 3KCOA 3R79A 3N4AA 1XLJA 3ARZA 3LK6A 2O0TA 1FUYA 4Y96A 4H4IA 2Y89A 1Q6FA 3NZQA 1NU5A 4LVAA 1TPB1 5DT7A 3P84A 2E8ZA 4PTVA 3BK0A 4DWDA 1XIJA 1XRTA 1OYAA 4GY7A 1TRDA 3TYCA 1UR0A 2O9TA 1XCXA 3G22A 1M04A 1ADSA 3DYOA 2V5KA 5D2TA 2WHKA 1HKJA 1PKYA 2ZYFA 3NOYA 3BG3A 3O6DA 4CNPA 1EX5A 4A3QA 2Z6IA 3WQ4A 4XK2A 1JG9A 4KFPA 1YMYA 3FEQA 3PSVA 3VD3A 3AWOA 4ZQPA 3RR1A 3AIVA 5CPLA 3IUHA 2REQA 3ITYA 1SSGA 1MNZA 5HATA 3C52A 2A7NA 2A0NA 2YW4A 3QJAA 3B9NA 4QNEA 5HBFA 1JI2A 4XQ6A 4J35A 1FP8A 1W37A 5HUOA 1XC4A 5E70A 3FVDA 1MW0A 1ZBKA 4AWTA 3HV8A 3R6IA 2DQXA 4WKAA 4JTUA 2X7WA 4DWSC 4E6MA 5KEZA 4NAEA 1SFSA 3AHVA 3EOOA 2XDFA 5BU9A 1L9WA 3L5LA 3EA3A 3DX5A 3H7UA 4LRSA 4CCZA 1A53A 1WBHA 1BTCA 1GQIA 2PDPA 4JFTA 5T91A 4MTVA 3BURA 1U83A 1RA0A 2J24A 1WB0A 3JUGA 3E3HA 5D9OA 5FEWA 3VOGA 3NDOA 4FI4A 3QV6A 3POCA 1UZHA 1VH7A 1ISYA 1O6IA 1L2QA 3B8SA 4WY0A 4WSJA 4PUNA 7XIMA 4QX4A 2QKFA 2EPHA 3LPFA 3EOSA 4RCXA 4AIOA 4G2DA 3J7HA 1K9DA 2J47A 4DYEA 2PPGA 2J62A 1EH9A 3UWQA 4HCHA 5LIXX 4IGHA 3ALGA 1QTWA 1IIHA 1NQKA 4P7LA 3BSHA 4QAIA 3BARA 3TYZA 2GQ3A 3PG9A 4W7UA 5HUPA 4Q4SA 2FH8A 1DEDA 4QG8A 4ERAA 4BCEA 3TYEA 1G7UA 1V8EA 5EB8A 4ZOEA 5FJUA 4QLLA 4CQ9A 4XO7A 4ZSUA 3TP4A 2JIWA 3ZXWA 1BVWA 5A69A 2FYMA 3OZPA 3R8GA 1TUXA 5HK4A 1OBAA 4O57A 3I10A 1ZPTA 3KTXA 3OZYA 3LCGA 3UT0A 2X0HA 5H1WA 1UWAA 3T2PA 5F4SA 3EWDA 1W2VA 2WNNA 1I9CB 2VR5A 3G8EA 2E6AA 1EKOA 4DNHA 1TYGA 2JKAA 4JIPA 3SCQA 3GW3A 1MDRA 3KCLA 3EWXA 2WV8A 1A5UA 4TUFA 3L4XA 5HWMA 2PDIA 3TR2A 1OWQA 3LGEA 3R89A 2V38A 6XIMA 1YTEA 1MQRA 3NUKA 3VFCA 1Y8BA 3P60A 3ZJ6A 1O1ZA 3CAVA 2ATMA 1XRSA 5FF2A 4RNHA 2DH2A 4JX5A 1SVDA 3OJGA 1P0DA 3ATZA 4RDWA 1VAHA 1P6BA 1E5JA 4LOCA 4QFUA 1J6PA 2ABBA 4NJGA 4L4OA 3FVMA 3V0SA 2GOUA 2XIMA 5I3JA 4XV0A 1X8CA 1XRFA 4N0RA 3VNYA 3LN3A 1W5QA 4ZB5A 1KB3A 3H2MA 3LBMA 3TOYA 3PVFA 4A22A 2A3EA 4CCDA 3G3DA 3QEZA 5EYWA 4QJ3B 2DUZA 1GG1A 1B3VA 3E5BA 4E2VA 1XPYA 4YTTA 3UQNA 2ZIDA 3NXLA 4H6KA 1BKSA 2QCGA 4AD2A 3KDOA 1TZ9A 2POZA 2O4QA 3W7QA 2G97A 3PZVA 4HKPA 4QAWA 1FXQA 1A50A 2W61A 4E0CA 3AHZA 1K7EA 3E0LA 3V36A 1ONRA 3E2QA 4DVOA 2RGLA 3V5CA 3RLHA 4MKSA 3I65A 1I75A 3QZAA 1RK5A 3TIMA 1MFUA 3WD0A 3AALA 1U1UA 4HMNA 4LGXA 3G6LA 1TR9A 4R5EA 3EMCA 4S23A 1HX0A 5IOBA 4WGXA 4ROPA 4LVBA 3WMBA 1BSIA 3RXZA 1V3JA 3TXVA 3FJNA 3LLFA 4PULA 5AHMA 3EMQA 2FZ8A 3PM6A 6A3HA 3GIPA 2ZADA 3TEVA 4OZOA 4MZYA 5I24A 4AC7C 1JZ5A 3B06A 2WMIA 3ITOA 4Z2KA 1XICA 7A3HA 2RJHA 1EPXA 3RO8A 4CN6A 5JUVA 2D0HA 3STEA 2C1HA 3N2TA 3R0KA 3HMJG 1V3MA 3GG1A 2W4XA 3G1AA 5G1TA 5C7HA 5MKGB 1HW6A 3LQLA 3L65A 4FXJA 3A6OA 1THFD 4NIRA 3S0CA 2YDRA 2QPXA 3G3MA 4AEEA 2QJNA 3TTEA 4M0XA 5EBAA 1EZWA 4PC8A 4PEEA 2PDQA 1MSSA 3U9IA 1JGMA 1UJPA 2YCKX 1PTDA 4PN2A 5LNSA 1MXGA 1UQZA 1Q85A 3S6DA 4N9CA 2OWWA 5H8UA 5AC6A 1J11A 1OIFA 2PDXA 1E1CA 2FPTA 4FZIA 1E72M 4Y8EA 4G7EB 3VKBA 4JQ3A 3AMKA 3UPMA 3IIVA 2CHRA 4KRTA 3MUCA 2WOQA 5I3DA 1P1MA 3GVVA 4OECA 4HNTA 6XIAA 2E67A 3GXPA 2PDNA 4TIMA 2YZRA 3R43A 4NQ1A 3AU6A 1XYCA 3LG3A 4XAFA 2Y70A 8RUCA 1E71M 1J10A 3M0MA 5BOOA 4LH8A 4GI9A 4GVFA 1CW2A 4JFVA 2E4TA 3W01A 4XAYA 1VJSA 1W9DM 4XBSA 4DZIA 2WLZA 3VX1A 1CEOA 1TV8A 1EJSC 3UR5A 4J27A 1KCKA 1SPQA 2FTYA 1C7SA 2TRSA 3TDFA 3QYSA 8XIAA 2HSAA 1NSJA 3TTSA 1QASA 1D8WA 4FK9A 4NZ4A 4GFSA 3WK0A 4B2DA 1Q7MA 2HISA 5KZDA 1CWYA 3PZTA 4UZUA 3TN3A 3ZIZA 3QLDA 2IQDA 1ZHAA 2JEQA 1V7YA 4ZODA 3OU8A 4QROA 3HPSA 4O1CA 4C91A 2Z00A 2IQ0A 2I57A 1SZFA 3XINA 1EFZA 3DHFA 4M82A 1S5WA 4G8TA 1UA7A 2AQWA 3E0FA 1RCOB 3UJSA 5EMJA 1FFRA 1KRCC 1XKJA 1CNVA 2TODA 4YNGA 2CLFA 4S38A 3KOFA 2VJXA 4MF4A 4AIEA 1BXBA 2XPKA 4F2UA 2ZCGA 4IFKA 2DY3A 4GXMA 3UXIA 4JN6A 5LSMA 2H8ZA 4ZOBA 2OSXA 1DJYA 4Z2GA 4LYQA 4CNNA 4AYGA 3BJFA 3PZNA 1ISZA 3M44A 4KETA 4HYVA 4DM2A 1PIIA 4IH3A 4D9PA 4GXWA 2CU0A 1W9PA 1DKWA 3PBUA 2G4JA 3PAOA 3FIGA 2YCIX 1RP9A 3EX2A 1DJWA 3NR0A 3SY8A 4CQCA 4C6IA 1XIDA 2QF7A 1TCMA 3B0XA 4GISA 3DFSA 3ATYA 1XYZA 3K2GA 4FA3A 3TWBA 3F5LA 1OM0A 5MHBA 1CBGA 3M16A 2R8WA 2VGGA 3BOFA 1A5KC 4XAGA 1Q6GA 3SCUA 1TX2A 4MFDA 4MWAA 2J8FA 3UERA 3GUGA 4MNLA 1BFNA 3ZSSA 4N9EA 1NWUA 4YL2A 3S1GA 3NVTA 4XZIA 1QI0A 3M5VA 1CZ1A 2VWSA 1R86A 2E77A 3GC4A 4LXFA 1SJDA 3MZ2A 2CW6A 3ARPA 3AMGA 2ZZ7A 4U4MA 3UA4A 1W1PA 3CIWA 4NZ5A 5JH2A 3SADA 1Q7QA 2D69A 3C0JA 4KEZA 2W66A 3MSRA 1UZDA 1IEQA 1RUSA 4Q8PA 1K9FA 3FN9A 1WKDA 3WLHA 1DE6A 5D03A 2VXNA 3L4TA 3LENA 2GJPA 3Q2DA 2VR4A 3OO2A 2GDVA 4MJ4A 1DL3A 1GZGA 3I6EA 1YDVA 2CBIA 3ANVA 1V6XA 3M0VA 4XUYA 1GORA 4D8LA 5C0QA 3KHJA 1GTHA 2YCLA 4DXXA 4H04A 3WBAA 2OX4A 2WBKA 5DLCA 3GIYA 4ZQRA 1RA5A 1S3HA 1QNVA 1W1VA 1FWBC 4A8LA 3S5OA 2D2JA 1YDOA 4LSBA 4GIYA 3U2EA 1C9DA 1ZZMA 4DAIA 5HNTA 3NSMA 3WSUA 3G1HA 3NXFA 2C18A 2QV5A 3APTA 2RDWA 1CXEA 3CZKA 6PTDA 1H61A 2WW5A 1EP3A 5FESA 1GGOA 3GRIA 1GONA 3UR7A 3TA6A 3P82A 2B0MA 4EPBC 3H24A 5F1UA 2R94A 3LXCA 3UP8A 4O13A 4BHYA 2BHZA 2J78A 2OGJA 2DFAA 3VKAA 1PEZA 4GRSA 2QUVA 1F7BA 2Q01A 3FKKA 2QUNA 1ENUA 1ISWA 5CAHA 1TKKA 1BHGA 3NG3A 3CMGA 7TIMA 4D6DA 3KVLA 4ZQCA 2Y1HA 4R34A 3ARUA 1KO0A 4FX8A 2GQ9A 3BW3A 1VPXA 3RIKA 2QCLA 1YTKA 3MHFA 5DBUA 4I8DA 4K39A 2YBUA 3U4FA 3AUOA 2JQXA 4YTSA 4JX6A 2HVNA 1FQ0A 2DEPA 4M1BA 2GJRA 3URNA 3E49A 4U3CA 5HWNA 2GGEA 1LQAA 2FFIA 2VNCA 1D2KA 4GZIA 1PZ3A 4Z2JA 3LV5A 3GAKA 4R27A 3NA8A 3TJLA 3MDUA 4NNBA 4MNMA 4FXSA 4LBRA 5AYBA 1EPVA 2RGMA 3AU2A 5KSWA 4UMAA 2H8XA 3LHTA 5CBJA 3W25A 5HJLA 4QP0A 3GWQA 2H6RA 1WZMA 3W22A 5JXQA 3IGHX 3A9BA 5F2IA 2BHUA 3O0FA 3STPA 3TW7A 1TE1A 4UCFA 4AZIA 2H3BA 4C6LA 1X6LA 2XVNA 3W81A 3L2LA 3AICA 3MMDA 1LLWA 4Q7NA 1BD0A 3RX4A 5I3GA 4LBSA 3RLUA 3SR7A 2E40A 2FZBA 3EDJA 4WQ6A 4WY0B 1O66A 1PCWA 1QATA 4AAJA 3AROA 1UG6A 2ZRZA 3D6NA 1HNYA 3QY6A 3SRFA 4FX6M 1XP3A 3RJYA 4N2YA 3NURA 4U2YA 5KZEA 1HKMA 1LTDA 4XKMA 2PD9A 2HNEA 4HNUA 5BNKA 1QPQA 1RAKA 5I0DA 3W76A 4AD1A 4FIRA 4N4PA 3FGCA 3VDAA 5HQMA 2FB3A 1VZWA 4UB9A 1RBLA 2CLIA 1MO0A 2IXUA 4ECLA 5CPSA 1SJAA 3HM7A 5LHEA 2NQJA 3BOXA 4QIUA 1HKVA 5DF0A 3LRLA 2OYMA 3UU0A 1XG4A 3OLIA 1GEHA 3CC1A 4R88A 4GMEA 3PTMA 1Q6DA 1XH1A 1YW1A 3W29A 1IXQA 3DBPA 1E6SM 3RG6A 4MWAE 1L2UA 3ZT5A 4FF7A 2BVDA 3N9KA 3ARSA 2NXGA 1J0JA 3EBVA 3ZFHA 2Q3RA 3W07A 2PC8A 3T55A 4Q7IA 1AW2A 4X2PA 1GKRA 1IXNA 3H6OA 4AVOA 3VO0A 5FJPA 4KCUA 4UC5A 5CSYA 2EG7A 1HJXA 2DW7A 3AIBA 3GXDA 2QIIA 2GGHA 3HG2A 4DYKA 3CL7A 1EUNA 2O7QA 3QPZA 4HA4A 3DFNA 2I9EA 2ZRYA 2OX1A 4DHGA 3FDGA 3LDVA 4GKLA 4AX6A 4IQJA 2VVNA 1E0UA 1VIWA 1Z41A 1IE7C 1B3XA 4WXZA 4LC6A 2XVKA 1HJQA 2UBPC 4FEZA 2X1RA 2RDXA 1DWIM 4Z1YA 1XSIA 3R58A 1PVNA 1X1NA 5BU6A 1OF8A 1V03A 3PPHA 1DJQA 4Q8WA 1B30A 2BX7A 3IJLA 3K4WA 3WQDA 1OCJA 3L5MA 1AZ1A 1E55A 2EQDA 5G1YA 3VOFA 4ZFMA 2NV2A 3C5QA 2HEJA 3F5JA 3GU2A 4PGLA 4ZSTA 2DP3A 4GVHA 3VNMA 3JVAA 1NWRA 3O07A 3DECA 4J2PA 3NOEA 2Z29A 3O1NA 1KWGA 2GUYA 5D32A 1FCQA 5GJPA 5LIUX 3IIZA 1K7XA 2Z2AA 4Y2WA 4NL1A 3VFLA 4S3CA 2OO6A 2H3DA 3CZEA 3H4WA 3MTWA 1Y5VA 1CENA 5I03A 1EC9A 2EG6A 2VL4A 4L1GA 1GOQA 3SEPA 3P93A 4JL2A 4KWWA 5A6BD 2ZUSA 1CLKA 3VOHA 3BQ5A 2YYTA 3TH6A 1P7TA 3CWHA 2WWDA 5FA5A 3ME3A 4CNTA 2CZ5A 5DCBA 3TN4A 1IZCA 1RY8A 5HXMA 1O1HA 4NKCA 5AHFA 1V0KA 3TNOA 3SGZA 2ZICA 3P5ZA 3O06A 3WFAA 2YPIA 1NFBA 1HGYA 1ZY9A 4I5UA 3JS3A 1XR2A 4YJ5A 4J7RA 3O8AA 5KZMA 1U2YA 1D3GA 3SQSA 3NDYA 2OKOA 1MZHA 2G8ZA 5BXPA 1EJRC 1MRQA 3GXTA 1GJPA 5K7JA 3GR4A 1RD5A 5C5YA 2XTKA 3TA9A 4DYJA 2GSEA 3H22A 3EKGA 2J77A 4FNSA 4IM4A 2CXGA 1VIZA 4ZO7A 4B5UA 1AW5A 2FMNA 1FWRA 3B4YA 3QZ6A 4WR3A 3N34A 4S3FA 1JFHA 1ICSA 5M5DA 4CUCA 3RILA 4C1LA 1IEVA 3ZLHA 3B9AA 1X7FA 1XIHA 3A64A 3NPUA 1TCDA 3LU2A 1W6TA 3RLGA 2BGSA 3H4GA 4IWWA 2YDQA 2V5DA 1OFBA 2HVMA 3W1PA 1XLIA 4NZ3A 3IAPA 1TFVA 2VM8A 4C1NA 1DWJM 3ARWA 4LVGA 2VX4A 3P6LA 1HVQA 3ITGA 1U22A 4L61A 3QY7A 3U7VA 2VT0A 1OEPA 4S3AA 3R7MA 1DE5A 4HOZA 3NCOA 3P61A 5B7ZA 3RITA 1TPWA 2RAGA 1PHWA 3IVTA 5BWFA 5K9XA 2VKZG 1ALDA 3GVRA 5C2CA 1VFSA 3SUUA 2VR2A 3K30A 5TD4A 1R3VA 3SQMA 3URBA 3QMRA 1DXIA 3SI9A 3V1HA 2IPJA 2E9LA 5M1TA 4DPQA 1KKOA 2DSZA 1QBAA 1UD8A 1W9UA 1A4MA 4X61A 3L67A 5GNZA 4MB5A 3Q94A 3R8RA 4ORIA 4DY1A 1H11A 1A5CA 2E9MA 3BAYA 5HULA 4YWSA 3KP0A 3KBWA 1ADDA 4W87A 4DUOA 4AY1A 3S5NA 3AAMA 3DAQA 3LHZA 1I1WA 2YXXA 5C9WA 1BVNP 1FWAC 5I06A 2F6XA 3WQEA 3EZ4A 1KXHA 1G7VA 4PYSA 4P2VA 3VGDA 2OSWA 4CNOA 4DBEA 4LEQA 2X41A 1SZRA 3BO9A 2QNEA 1XIEA 2FPVA 3RM4A 3AS2A 4BKNA 1VB9A 3MBFA 4NNCA 4IPIA 4C6EA 4FX7A 3CH0A 5H8MA 3FA5A 4A3YA 4K6AA 4W5UA 4JTDA 3TONA 3N6HA 4PA8A 3PZIA 2VEIA 4Q6JA 2V3EA 4JTAA 4M56A 4EACA 1EJUC 1SW0A 3PB0A 3KW3A 2I5GA 3PY2A 3FA3A 3NYZA 3FA4A 3SSJA 4OVXA 2J8GA 4LAZA 3NTYA 2E5CA 1F6YA 3BAIA 5I00A 1V3HA 3A5VA 5C71A 4UTFA 4ES4A 3IJ7A 1R6WA 1JPHA 4A8RA 3KWSA 3GQYA 4IOTA 5C7VA 3SBFA 5AYYA 2GDQA 4PUJA 4S3KA 4LAOA 3QPYA 3AQUA 3E0VA 2QW5A 3W1MA 2ADAA 3D47A 3F03K 2NQ5A 3LCHA 2DU2A 3OPSA 2WVVB 4YIWA 3E6EA 3M43A 1AJ0A 4NZCA 3DG3A 1E1EA 3MKCA 3OEXA 3RMEA 1OX4A 1ZAHA 3GTFA 1KWKA 1OT2A 3CUHA 1M41A 2D2OA 3WQPA 3FHQA 4O52A 1HQTA 3HMCA 4EPKA 4PZVA 2PAJA 5T26A 1SSDA 4GBUA 4KGLA 2XM2A 3O3RA 4J3SA 1SO5A 5E0CA 4Q33A 1TV5A 3UR2A 2OMAA 3CAQA 2ZQ0A 1FCUA 2P0OA 3N04A 4O1EA 3N9SA 3TFXA 1F6KA 2FHCA 3IK4A 1UOKA 2VYOA 3W7RA 3C56A 4XUGA 4KEUA 4B2DD 1TWDA 5ECVA 4B16A 4YHEA 2PP3A 2PF0A 2V5JA 2BWGA 1DTNA 1BTMA 4ML9A 2ZRVA 1ZENA 3LPGA 4PODA 4GJJA 3ABQA 3LHWA 3F4NA 4GGBA 3K5XA 1JF5A 1F4AA 4LYKA 1R5YA 4Z1AA 2QDDA 3MZNA 1LQ0A 2FZ9A 1CGWA 2XVGA 5D2VA 4IIGA 2HTMA 1XISA 1BRLB 5A94A 2QXWA 3VYLA 3PTDA 4AF0B 3EAUA 3TAKA 2WVTA 2QJGA 4QEEA 5LZLA 1XIIA 4R7JA 3G1VA 1R47A 1WYIA 1Q6LA 5HAOA 1MUCA 4PTXA 3W2UA 3LCWA 3GH7A 1BF6A 1B0IA 1UPPA 4HHMA 1LBMA 5D9PA 1JZ8A 3WH9A 1DJIA 4IIEA 1ZGDA 3TC7A 1DOSA 3E2RA 3ABXA 3V35A 1X98A 1B3OA 4KF1A 2ZUWA 3MB9A 2XH4A 2GFTA 4ATLA 1LF1A 4ZE4A 2R91A 4PRRA 4INFA 1BGAA 4WSKA 4K7YA 1WZKA 3HJEA 2ZZ3A 4UOJA 4E8GA 5T9CE 3L2IA 4A35A 3WZ0E 1GJUA 2E8YA 2FGLA 3IIPA 2NUYA 2PWDA 4C6JA 1FH7A 4RLIA 5E9XA 3APYA 1E6NA 5LGXA 3TLLA 1K4HA 1AA1B 1UBPC 5EKYA 1JNEA 1WDWA 5LA1A 1JYWA 4PTMA 3TXZA 1XINA 1FOBA 4ZE5A 4LB3A 1XLHA 3AXKA 2FVLA 4X9YA 3WJXA 5A6SA 1TX0A 3UZXA 4NHVA 3PBMA 4QJ4B 3RYSA 3GY1A 1WE5A 1BWVA 1Z8AA 3EKLA 1H50A 4QQ3A 3ARVA 1R85A 5HDRA 1EOKA 1TPC1 1XQKA 3HQNA 4WDUA 3T0AA 4D6HA 6REQA 1K3UA 1UWSA 3SY1A 5M17A 1EF3A 4AU0A 1NDYA 4DWSB 4FXRA 1KM2A 4UR8A 1EIXA 1ME8A 4NX5A 4GI6A 3ITXA 2C91A 3NL3A 1I0BA 2BY2A 4JTEA 1EDQA 3LX9A 1EP2A 5I79A 1NJJA 1A80A 2ZX7A 4F0HA 4MZ1A 3FSTA 3TJIA 2VEFA 4GY1A 1W54A 3KRZA 4OUIA 4IP4A 3MVTA 3H4XA 4AEFA 4L6HA 2WHJA 3S9IA 4BWLA 2ZXBA 4YVXA 1GYNA 2YSWA 4KESA 1JUKA 3N73A 4MB1A 3VC6A 4AMCA 1I8JA 4W5ZA 3H7RA 2WNZA 1XW8A 1W5NA 4ERGA 1PAMA 1WOBA 1EXBA 3ID7A 2PODA 3DIPA 4IMGA 1E0WA 3LBCA 3S2LA 2V67A 4HG6B 4JHOA 1IWAA 3CQKA 1VKFA 3PUDA 3NZGA 5FF0A 2HQAA 2PU1A 1T0OA 3DFYA 1ISVA 5FIPA 3MV11 5BROA 2OGYA 4J3XA 4GACA 2NQHA 2ZOXA 3HGRA 3ALFA 3T05A 3VIIA 2EPMX 3UG5A 1ICQA 3NQAA 2HE8A 2B7QA 4MWAB 4HD5A 1CI1A 5DN1A 2VEPA 1GQNA 4JTRA 2FZNA 1X7IA 2QLYA 3TX9A 4FOJA 2QF8A 1QHOA 1HO1A 1RPKA 3IRDA 1WXYA 3TSDA 2VX5A 2PGFA 1BQCA 4F0MA 4RX0A 4TVDA 1OF6A 3PHAA 3OLGA 1SUXA 1P0NA 2YBVA 4M81A 3VNLA 2EG8A 3IJDA 1X97A 1DBTA 4FLQA 2WMJA 3KUMA 3TOPA 7CGTA 4NJIA 1FDZA 1C8QA 2JKPA 1V6UA 3BJSA 4LW7A 1TTJA 3WX7A 1BWKA 3AFBA 3BDKA 2B7PA 5JIWA 1GCYA 1UWQA 1S2UA 2XH2A 3MWCA 4W88A 1MQQA 4O53A 5D33A 1ISXA 2VC9A 2PD5A 2YR1A 4X63A 1UKTA 4PCPA 4OBSA 3BMXA 3TLQA 4HNLA 4YCPA 3NQVA 1XLKA 2R1NA 4LFYA 4MAZA 1Y0EA 5G2WA 2VZTA 5D05A 4ZO8A 1BYBA 1S3TC 4RZ6A 3PBYA 2J9XA 1E6PA 2ABAA 1IWPA 1XJBA 2AL1A 2ZUVA 1RCQA 1US2A 4HA3A 1MYRA 1KBIA 3W6MA 2IMRA 1W9BM 3WY1A 4W8AA 1VCFA 3I68A 2Y5JA 4C1NB 3DFPA 1ECEA 2DIJA 3OHMB 3GDRA 4CU8A 5D8ZA 3PPCA 3KOYA 1HKWA 4P7QA 2ZC1A 4M51A 4DELA 3QY8A 3BLIA 3E12A 2VRQA 4LUJA 3CQJA 4NUWA 4Z2LA 1SO6A 3VVGA 3HV9A 4LUYA 3PB2A 2VCBA 4LUTB 3KBSA 1HT6A 1XS2A 4DNMA 1R9YA 8CGTA 3WNPA 3AZSA 3W7LA 2R9RA 1YTDA 4NY2A 4I7UA 1HTIA 4DBSA 1MZRA 4YVVA 4RXFA 2VX7A 4QE4A 4O11A 4ATWA 3WDPP 3VD9A 5I3FA 2QEZA 2VX6A 2BFGA 5ABGA 3AXIA 3OA3A 4GQRA 2HCVA 3HQOA 4K1GA 2ANUA 1RLDA 1ZB5A 5BW6A 2XN2A 4ENLA 3T8LA 4DZ5A 4RXGA 1YX1A 2XUCA 4LV9A 4GLEA 3GYEA 3DYPA 3R1ZA 3WBXA 4AZ7A 1UROA 3T7VA 2EKCA 3TAOA 4C5ZA 4AX7A 1XG3A 2JF6A 3VGBA 1Q2RA 3E96A 4JR5A 3CO4A 4UTKA 1GUVA 1QWGA 1VFLA 3S46A 1UP0A 1CTNA 1TR1A 3G0SA 3BGGA 3K46A 3AYVA 5BOFA 4BWLC 4HNOA 3C2RA 2E6DA 1JULA 5CBIA 3P62A 4J3VA 3CEPA 4S3BA 3BGAA 1K6WA 3LA4A 3QGVA 2G0WA 1H7NA 4H9MA 2HRWA 5D38A 2B4GA 3DI0A 3WN6A 1Q8AA 3L12A 3T6CA 3O05A 4F66A 4V28A 4MPKA 3MJMA 2Q8ZA 1NDZA 3SO7A 4PH6A 3N3MA 4IMFA 4Y90A 1JDDA 2OFJA 3ARQA 2CZEA 4F9JA 3CYVA 2FZMA 2E28A 4TXEA 4UMCA 4C6NA 1GQKA 1UWRA 4N02A 5CQ1A 2ZZ4A 3MHGA 2PE4A 3QKZA 3LM7A 1C7TA 2GK1B 9XIMA 3RRXA 1C8XA 4GH3A 4J40A 1F61A 1WV2A 1G4TA 2KZHA 3ERPA 4GCXA 1E70M 1WA3A 2JFEX 3HGJA 4Q22A 3PUEA 5DXYA 3UJRA 3SQLA 3NWRA 1CGVA 1QNOA 2BV9A 4G5DA 2VC6A 3GTHA 2XFFA 3MI2A 1UR9A 3AS0A 1EJVC 1SGJA 4MSSA 1R8LA 4LAKA 1B1YA 4E8CA 3CAWA 4OJYA 4AY7A 1R2RA 4DUWA 4A3UA 1U30A 3ZVHA 1J2BA 1AVAA 4CVWA 4UFHA 2GGGA 5IHSA 2YCEA 2CHOA 5TQLA 3FW6A 4GUHA 2BS9A 2YX0A 4MOZA 1TPFA 3APGA 4B5XA 3M0HA 3GH5A 1LROA 3N2OA 4C6MA 5JQ9A 1UH2A 3EWZA 3BCFA 4A29A 4IIFA 1OQFA 2TYSA 1US3A 4QBXA 4O17A 1XV8A 4LQ1A 1Q6OA 3NSXA 4AVNA 1PWLA 3VZYA 3AIUA 3TJ4A 3U4AA 1NM9A 2XN1A 1V51A 2IKGA 3BV4A 4AIBA 4Q8NA 2PBGA 3KXQA 4ICCX 3H21A 2VFIA 2XGIA 2NLIA 2C1IA 3L7RA 1RSCA 3MC5A 5A2AA 1B9BA 1GVEA 4GZ7A 2Y5EA 4OOZA 2QIWA 3IJ9A 3U2CA 5CJ5A 3GDBA 1W3LA 4UQEA 4V15A 3LPPA 2DSVA 3S5SA 4PUMA 1Q6EA 9XIAA 4JYFA 3K8LA 1CB7B 4Y9NA 1UHVA 1K9TA 1ZALA 4IIDA 4UQDA 1I4NA 1EGVA 1WKYA 2BB0A 3QN3A 3CV2A 5D2WA 4IIHA 3T44A 1IGSA 4TV5A 4UNIA 1XSKA 4AW7A 4U3AA 2DZUA 3S2MA 1JCLA 2QCHA 2CBJA 3EB2A 3CT2A 3VZZA 2Z1SA 3OIHA 3EWUA 3RLVA 3HN3A 4V1XA 2DQWA 1L0PA 2WJZA 4JNZA 4A8NA 3GFYA 3NSNA 1JQVA 3W75A 5C9RA 3M07A 4BI7A 3P74A 1JFXA 3OLEA 1F8IA 2FFCA 2PDJA 2IXVA 2ZE3A 3THCA 4OBTA 1OX5A 3TR9A 2ZRWA 1W8SA 1HG3A 3KAOA 4WDWA 3KHDA 1BYCA 4JEQA 4CD8A 4RV3A 4O1DA 1M68A 3ITLA 5T9BG 2Y2WA 1W3NA 5C9ZA 4F2BA 3WF3A 1LLOA 1H51A 1OINA 4AD0A 5M03A 2GYIA 2R6OA 2CLKA 1JCMP 4O54A 3PZMA 4PMUA 2NWRA 3SSZA 5HMSA 1X1OA 4MYXA 5HNUA 4KWOA 4HA0A 1KFWA 4C6KA 6TAAA 3UWYA 3BW2A 2NWSA 4HYWA 1KBJA 3ABRA 4O0ZA 2ZXQA 4Q8QA 4XIMA 4GYPC 4B9ZA 3UR8A 3IPWA 1LRTA 2FJUB 1AJ2A 1RCXB 2ISFA 2QR6A 3ZJ7A 3THUA 4REQB 1H7PA 1KR1A 3ZVIA 1M3UA 2BGNE 1CGTA 5A8QA 3GK0A 3W24A 5FSEC 3VAVA 1AZ2A 3KEHA 3LY0A 1M7PA 3PUGA 3ABSA 2CZVA 1D7KA 3GS6A 3N12A 3M7WA 1JUBA 2WQPA 1R87A 1FTXA 1VFTA 3VE9A 3N29A 4TV6A 2GGIA 1BGGA 2YBTA 4TO8A 4H00A 5D4YA 1QR7A 3M47A 4LS2A 3A3XA 1QI2A 4OTKA 3PP7A 5FJTA 3TMQA 4XBJA 3CWOX 3QFEA 5U7SA 1LT7A 2W63A 5A6KA 2WMFA 1E6ZA 4HK7A 2W92A 5A2CA 3PPGA 1FKWA 5FJOA 2WC4A 1NOWA 2YB1A 2DT3A 1E0XA 1AQMA 1EGZA 2WHLA 2X30A 3SRDA 2YL8A 3I3BA 2J7CA 4JZ5A 1TJ1A 3O6AA 1FWDC 1MNSA 4JEJA 5A6LA 4P8XA 3CUZA 1B3ZA 1IHIA 4M6UA 1V3LA 4JKMA 5LNUA 1SW3A 1AQFA 1M7JA 3VMNA 4BF7A 1DJNA 3QF0A 1NFPA 2REQB 1XLLA 2WVSA 1HUVA 4IP5A 8XIMA 2I5IA 2ZDRA 4WF7A 2P88A 4KW2A 1TTPA 3XISA 1JCYA 4U2ZA 4YTUA 3TWAA 2O55A 3I7QA 1OYBA 1ITUA 1DIDA 1ME9A 2INFA 3LUTA 4L9ZA 3WIJA 1QU4A 1KKRA 2HDJA 3W84A 2J88A 3WQVA 5LNVA 3FXYA 1LL7A 1PXGA 2XWDA 1YNPA 4CCCA 1UD3A 2VMFA 2E9BA 2GVLA 4GI4A 3NGJA 9RUBA 2L5HA 1XXXA 1UR4A 2NQLA 3HQPA 1Z7AA 1CDGA 4TU1A 1W1TA 5CJMA 3H54A 3T4WA 3VIFA 1YXDA 3DC0A 2ZRXA 4ZMGA 4A6GA 4C5YA 4GNKB 5BRPA 1V0MA 3GDMA 4H83A 4GYJA 4W7VA 4K8EA 3CZ8A 2PDHA 4BS0A 1Q8JA 2O9OA 1R2TA 4BF5A 4S39A 3ZZ1A 4WZHA 3NDZA 1CIUA 1AL8A 1RJRA 4L5ZA 1JCTA 5A6AA 1POKA 2EO7A 4PCNA 3CJPA 2IPGA 1PTAA 1DJZA 3DBNA 5BMXA 4AZBA 3VD4A 3EWYA 3GG7A 4XX6A 1ZS2A 1UD5A 1EA0A 3CQ0A 3T8QA 4S1FA 4JFWA 4FLOA 2XIJA 2INEA 1S5MA 4L6DA 2WYSA 5IDIA 3ZMRA 3GXMA 1XBZA 3PC0A 1QDSA 1O94A 2AKZA 5CGTA 4LF2A 2XHYA 4HPGA 4FXFA 3W6YA 4PMJA 2G3IA 4AHPA 4KGJA 1AH4A 1R3QA 5ABFA 1W3KA 5LIKX 5JBEA 2PTYA 1GKPA 3LGDA 3SN4A 3WDJA 5F2MA 4O8AA 1EIBA 4B3KA 2OODA 5I78A 3T4CA 4AD3A 5CBBA 1KQZA 1Z6KA 3W88A 2E5BA 3TNBA 2WQDA 3RAOA 3HFYA 3MP4A 3WLRA 3WNKA 4FLSA 1YYAA 3QR3A 3N2BA 2QCFA 4HPXA 3WF0A 3MYOA 4X9SA 4K1WA 1EYWA 3GTIA 3O16A 1UPMB 4WSHA 3OHIA 3BW4A 4NSBA 1XYMA 1QNPA 3TTOA 5ECUA 1B3YA 4DB7A 1FDYA 4I7VA 2UZ9A 4WJ8A 3STCA 2BHYA 2ZWYA 5LHFA 3KBJA 3UZ5A 3TCEA 3FYYA 4IPJA 3EPNA 2FZDA 3AXHA 3TKFA 4GK8A 4BR1A 2E1DA 1KBLA 2WHMA 3P8JA 4UIOA 2WVVA 3VC5A 1UR8A 3DH7A 1GVIA 1KCXA 7REQA 2WKLA 2VHLA 4L1XA 1HXJA 4PB3A 2X0YA 3K8KA 3VD5A 2VVSA 4U31A 1A5OC 1KLZA 4PBGA 3Q67A 4EVZA 1BYAA 3ZM8A 2QJHA 3LB0A 4L80A 4E8DA 2YYUA 4S2BA 4HPHA 1CECA 3W87A 1HO4A 4RPQA 4JQ4A 1YNYA 4WEVX 3HG5A 1CT5A 1NDWA 4B15A 2X8RA 4UFMA 3VGEA 4NAFA 2Y4SA 4RZBA 2DORA 1UD4A 3MUZ1 3FDKA 1MI3A 4LB4A 1XKYA 1AUSL 2F84A 3P0WA 1TPVA 1JDFA 2ONEA 1EGMA 1F3WA 4JFUA 4RE3A 2Y8KA 1EB3A 4PMRA 1UKOA 3LXBA 1Z42A 4TVCA 1RQHA 2GK1A 2PMQA 2HBXA 1UZ1A 2QGHA 1Q63A 2V68A 4UR9A 3A12A 3GLCA 3VOCA 5E6ZA 2VP8A 4J4KA 2DT1A 3VMOA 5HR6A 2XSBA 3AHXA 2XG9A 3EYPA 3H55A 5DBTA 1FWCC 4HZMA 1PL9A 2VFFA 1XIFA 3RPMA 1EO7A 1WP6A 3GX9A 2E68A 4PMZA 4IPNB 5BXSA 3NFUA 3HQ1A 1W5PA 3BZJA 1DORA 2W91A 4XZLX 4FLRA 3UGRA 4LALA 4WKFA 4BQ5A 4LNYA 1P0BA 3ONCA 3TQKA 2HS8A 3N2MA 2CNCA 2J66A 2Y24A 5CXPA 1UZ4A 1FWWA 3ZQ9A 4JTJA 4M7SA 4P02B 3GNXA 3SRKA 3UWVA 1KFBA 5AHEA 3MBDA 5AZ0A 3VIOA 4F9DA 3YPIA 3CV7A 3M1ZA 3GTNA 1XBVA 1RQBA 3W02A 5IBXC 1ZAJA 3M9YA 1QHZA 4ZA0A 3VILA 3SGGA 1PCKA 2D2GA 1EJ7L 3H70A 1UR1A 2QYGA 2DDXA 3EGJA 4ZO6A 1KA9F 2AAMA 3GU1A 1QK0A 1R3YA 3CT7A 4LYPA 1IIGA 4JPGA 3TQPA 2XIIA 4XKYA 3B03A 2VD9A