1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
b'GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-D-glucuronidase
publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
1LJYA 4PMDA 1ECEA 1U30A 1R7OA 1E0WA 2E3ZA 2J8GA 4AYSA 1E3XA 4W7VA 1GOWA 2B31A 1EHNA 3IAPA 4AZ7A 1XYZA 3W28A 4NRSA 5CPTA 4YHGA 2WK2A 2J7BA 3WF1A 1EHAA 3L4UA 4YHEA 1QNPA 1I1WA 5IHRA 2ZXQA 3SURA 3UG5A 1UD8A 5LA0A 1GOOA 2WW5A 3AIBA 2VVNA 2DH2A 3W38A 4UQBA 2WANA 4EE9A 2WLZA 3FXYA 2YOCA 3SCTA 1EO7A 3WQ5A 5A6LA 4TXEA 1G9HA 4UFKA 1X6LA 3OIHA 1I1XA 1PEZA 3HJEA 2D2OA 5A6AA 3PZGA 1K9TA 1B9ZA 3ARRA 4P8UA 1ESWA 4TOQA 1KXQA 2DSZA 3PZVA 1JZ2A 3EDJA 3MSDA 3A4XA 4OZOA 4QCEA 4M29A 1XSKA 2ZUSA 4KGLA 3RMEA 2WMKA 1E15A 2WHJA 3VIIA 3WF2A 1QPKA 3S6TA 1V3KA 1W1PA 1HJXA 2OSXA 3AISA 4JL1A 3LPOA 3MO4A 1E9LA 1M03A 4Z2LA 3PZ9A 2DEPA 2J78A 4JL2A 4PMRA 3WNMA 3AS0A 2CYGA 1FHLA 4W7UA 1XH1A 1Z32X 2VZUA 2ZX5A 4MADA 1BAGA 1Q6CA 3RM4A 1Q6GA 5ABEA 4M81A 1W9DM 3IJ8A 1QI5A 4MB5A 4J3XA 1C7TA 2EEXA 3DYPA 5ABHA 2C8NA 3U57A 3VGEA 1HL9A 1HXJA 4ATDA 4DUWA 4RE3A 4H2CA 4UZSA 1UR0A 7A3HA 1UWUA 3WEZA 3UERA 1JDAA 2VVSA 3N9KA 1ZU8A 4UFJA 4LXFA 4P7NA 2ZUTA 2D3NA 4DM1A 2O9PA 5IFTA 5E6YA 3M7SA 4ATLA 3KL3A 5M5DA 3AMCA 3AXHA 4H8UA 1HJQA 5E09A 4UQDA 1GW1A 3GTNA 1QHOA 4AD0A 2ZUUA 1QI2A 4JFUA 4GI6A 4IISA 2DDXA 4UCFA 4D6IA 4C7GA 1CENA 4EK7A 3UETA 4HOWA 1R86A 3DYOA 3N04A 1E4NA 1J11A 1HIZA 3MMDA 3T0BA 1TVPA 1UKPA 3WQ4A 2JEQA 1OIFA 2MANA 4JZ5A 5TD4A 1HJSA 1GHSA 2DSUA 4ZXLA 1KWKA 4EAMA 4W5ZA 3THDA 1JDCA 2WZIA 2J8FA 4PSPA 2PI6A 3U5UA 3ARYA 5A2BA 1J9YA 5A6BA 2TAAA 4R5EA 4GQQA 2G4FA 3TTSA 5CXPA 1BQCA 5DEZA 2WB5A 1VFMA 3W6LA 3CUIA 1VEPA 2V5DA 1BGGA 4PTXA 1VFOA 4B15A 4GQRA 4AIEA 4WKFA 1W9XA 4WK9A 5A3HA 3O9NA 3AMLA 3NSXA 3T0AA 3ZJKA 3NUKA 3RM9A 3NSMA 3APGA 2YLAA 2XWEA 4D1IA 4BS0A 1C8XA 4FLOA 3VINA 2XYLA 4NI3A 3F4VA 5DMYA 5HPCA 4CUCA 3AI0A 3ARZA 4AZCB 4ZEPA 3MANA 1ZB5A 4HMCA 3O6AA 3QHMA 4HZ7A 3L4WA 2XTKA 4CCEA 1K9FA 4P7LA 1RP9A 3OLGA 1JZ7A 3BCFA 5ABFB 4WKAA 3VIFA 5EB8A 1UUQA 1LWHA 3WD2A 3N11A 3TOPA 1BYAA 1JD7A 2XPKA 1PBGA 1BLIA 4DUVA 3MMWA 5A94A 3VD9A 4JKMA 1JG9A 1AMYA 3I3BA 1XSIA 3ZJ7A 1IV8A 3E1F1 1NOFA 1BF2A 3CO4A 5ABGA 2VI0A 2QPUA 3CLWA 3CMJA 1GNXA 4GXPA 1AQHA 1UZ1A 3QR3A 1DWIM 1N82A 2WC3A 1UR9A 1PIGA 4LYQA 4HU8A 3AROA 3GBEA 4OIFA 2EO7A 3RM8A 5LYRA 4AY1A 5D8WA 2FHFA 2G41A 3B9DA 2ZUMA 4UOQA 1E6XM 3WQWA 4FLSA 2CPUA 3ECQA 1FP9A 4QDMA 2J4GA 2V38A 1EQPA 4YN5A 4W93A 1PX4A 1Q4NX 4X0VA 4IPNB 2EQDA 3WD3A 4OUEA 1GOIA 2CBVA 4JCLA 1KGXA 1RP8A 1ISZA 2UY4A 1JD9A 1QHZA 1Q6DA 2VURA 2D0GA 3CPUA 2XIBA 1MXDA 2WMIB 5E6ZA 1UYQA 3WQ6A 3RJXA 1V3JA 3OZPA 2GDVA 1JZ5A 1BVZA 1WO2A 1VFUA 3UCQA 4AIUA 3F5LA 4BCEA 4C91A 2X2YA 5IDIA 2WCGA 3W81A 3VIJA 1QBAA 2XGIA 3WDHA 3AIEA 5CG0A 4Y7EA 1PAMA 1V3IA 1SMDA 2QPSA 3OLEA 3I3DA 2DH3A 1W91A 3L4ZA 4GPNA 1CGVA 3RPMA 3WD0A 1QNRA 1J0IA 4E8CA 1KGUA 5HBFA 3MUAA 3PZUA 2G8ZA 2DPEA 1KQZA 2X8RA 3W37A 2JE8A 1UD6A 4MJ4A 1EDQA 4UFLA 4XB3A 1OB0A 2YL5A 1J0JA 5D9PA 3WMCA 1HT6A 1NP2A 3ZSSA 2X1IA 4QP0A 2YA1A 1LL7A 2CIPA 4U33A 1PX8A 3T09A 2PC8A 3NYDA 3K46A 1R7AA 2CBIA 1HKJA 2D24A 4IM4A 4AZ5A 3K4AA 2WSKA 4D6FA 4PRWA 2DT3A 3FN9A 1EDTA 5C70A 3M07A 4XUYA 4KGJA 4CD7A 2CERA 2DSVA 1WZKA 1VBUA 1MXGA 1MVYA 4AZ6A 3VVGA 2Y24A 4DUXA 4D6CA 1QNOA 3CH9A 3VNYA 1E6QM 4S3KA 4RE4A 4L4OA 2YBTA 4Z2HA 1LQ0A 3L2LA 3ALFA 1BYBA 1CGYA 3TONA 3VIOA 3VDAA 3EDEA 3ZO9A 2W61A 2WWCA 5KZ6A 7CGTA 2BY1A 1F4HA 1R85A 2ZXBA 3SCQA 2VQTA 1E56A 3VIPA 3L4XA 4LPCA 4UOJA 4PCTA 3PZNA 4E8DA 1XH2A 3WH5A 1XD1A 1WPCA 1JNDA 1JAKA 5CLWA 3CTTA 2V3GA 4JAWA 3SUVA 4HA4A 1E5JA 4TTUA 2G3JA 5A6KA 1UD5A 3F5JA 5A2AA 1A3HA 5LA1A 2D22A 2VTFA 1KXHA 1UZ4A 5FIPA 2YDSA 4W88A 4AWEA 3EDDA 5JBEA 3G6LA 1OBAA 3T2OA 2BY3A 4WLCA 3WDPP 1OD8A 2XVNA 3N1AA 2XIIA 3DHPA 1V3HA 1IZKA 1GOQA 2O9OA 3WUEA 2YLLA 4P8VA 1SMAA 1EOMA 3S2CA 4MDOA 2XVGA 2HVMA 1CZ1A 2WCSA 4J27A 3FHAA 3OBAA 3AQUA 4WIWA 5BRPA 4V28A 1HL8A 2EPKX 2VZOA 2ZXAA 4PMZA 2V5CA 3AXIA 1BGAA 4HU0A 3QGVA 3JUGA 2JFEX 4CKQA 4PMOA 1KFWA 3A3HA 2VZTA 1GJUA 1UR2A 1H1NA 3VO0A 2QV4A 1CIUA 1CWYA 2VX4A 3OLIA 1TCMA 2WMHA 3BAJA 1H11A 3THCA 1TZ7A 1LF1A 3AMDA 3VGHA 4CU6A 4PCSA 1ZBKA 2E9MA 2J7CA 2V3EA 3BSHA 1B3YA 3UESA 3RIKA 3VIGA 4HZ8A 1VENA 3AIUA 1C8YA 4R27A 2J74A 2CNCA 2EPOA 7TAAA 3EMCA 1ISYA 1B0IA 3BLKA 1ZS2A 1CNVA 1JYVA 3OB8A 4PUEA 3WF4A 1H4PA 1MWOA 4V2XA 2UWFA 2WVVA 4GINA 1XSJA 3IJ7A 4BF7A 1S46A 1HX0A 1EA9C 1E6RA 3WNLA 4KWUA 1UWIA 2DGAA 4EKJA 5A1AA 2VCCA 1WZLA 1CXLA 3N13A 3WBEA 4UFHA 5I78A 2BHYA 3VILA 4DWSC 3D3AA 2OYLA 1NWUA 3GYCA 5A8NA 2FHCA 1KB3A 2Z1KA 3N15A 4D71A 3OG2A 4A4AA 5FOOA 4V27A 1W1VA 1KR1A 3W29A 1BFNA 2W92A 3VIMA 3W27A 1EIBA 3AZRA 5AYBA 4PTWA 1E72M 2VZVA 4ACZA 4AEFA 5A8PA 2DT1A 1C7SA 3CZLA 2PBOA 2A3CA 3CMGA 5GNZA 4BQ4A 3TP4A 5JBFA 5CGMA 2IXVA 4PN2A 5FCZA 5BYWA 2PWDA 4FK9A 1DTUA 1J0HA 2GK1A 3WH7A 1UG6A 1AVAA 5A6MA 4L4PA 4C7FA 1EQCA 1WCGA 1QW8A 2WBGA 3CUFA 4AW7A 4ZE5A 2EXOA 1GVYA 2YDQA 3K8LA 2CCRA 3OGRA 3W6MA 4CN4A 3EDFA 5BXPA 1NWRA 1QNSA 2VNCA 2VR4A 2GFTA 1QI0A 1RPKA 1V6WA 1HKMA 4JIEA 1E4IA 4QCFA 3VNZA 1BG4A 1W9VA 2Q8XA 3VUPA 1MFVA 1KCLA 5ECUA 3GBDA 1QBBA 2OWCA 4P8WA 1OWQA 2FHBA 2D3LA 1SFSA 4C90A 4KH2A 4HTYA 3W82A 1C91A 1JYWA 1U2YA 3MUY1 4D6DA 2ZUNA 4CN6A 1HF6A 1M53A 1PX3A 1LL4A 4HMDA 1E1FA 1US2A 2CKSA 1FH7A 3GXDA 3VMPA 3IJ9A 2VUYA 4B9YA 1JZ4A 3ARQA 2A3AA 3WDQA 1UH2A 1W3KA 1WNOA 2WPGA 4MNLA 2Y8VA 1IT0A 2Y4SA 3ARPA 3ZT6A 1VB9A 3SCRA 4D72A 4RL3A 1MW0A 4M24A 1UR1A 3PTQA 3FY1A 3WIJA 4URIA 1B90A 1HJVA 3BSGA 1PJ9A 1B3ZA 3BCDA 1W9PA 1GOKA 4AZBA 2O9RA 1JXJA 3VU2A 4ZFMA 1QW9A 3AYRA 2CETA 3WENA 5IFPA 3MUIA 2VR5A 4XZBA 3VTRA 4CCCA 4J3WA 3UR8A 3WEMA 5E0CA 5M17A 4B3LA 2JF7A 2QHAA 3VD3A 3WL0A 1JF6A 4MJ2A 4LGXA 2OYKA 4D6EA 4AMCA 1GORA 5CGTA 3U5YA 3WDRA 2ZX7A 3CHCA 4B16A 4PMNA 1B2YA 1XV8A 1KBKA 4PBGA 1ISXA 1NARA 4OBRA 3AOFA 3ZT7A 2IUZA 2VJXA 1E4MM 3PZOA 4W5UA 1DWAM 2FH6A 4TUFA 4QLLA 1R87A 2JEPA 4MNMA 2ZX9A 1KXVA 3OLDA 2UY3A 3AZTA 3CUHA 3BAKA 5D4YA 4W87A 3ARWA 1XC6A 2GUYA 3LPFA 5E70A 2FGLA 2OWXA 3CHFA 3KZSA 1B30A 5AY7A 6TAAA 1E40A 1UD2A 2J79A 5A8OA 1NQ6A 4QLJA 3CZGA 1WP6A 3ZMRA 1OT2A 4E4PA 1ZBWA 4JHOA 2C7FA 3AHYA 4K68A 2WC7A 2J47A 1HP4A 1P6WA 5A2CA 5A6BD 4UR9A 1J0ZA 2ZWZA 1BYDA 2CXGA 1HVQA 4Z2IA 1ITXA 2XUCA 3SCWA 3PTKA 1ISVA 4WJXA 1LWJA 1EOKA 1UA7A 1WDPA 3ZM8A 1JI1A 1JZ6A 3U7BA 4MB3A 3BAWA 4D6HA 1JZ8A 1E71M 5I77A 5GQBA 3KWXA 4H8HA 3ARUA 3CGTA 4HP5A 1NWTA 3ZJ6A 1GJWA 3VDHA 4OJYA 1UH4A 1UD3A 1JDDA 5E0FA 1VEMA 2VX5A 1UWQA 2J75A 1GUVA 4UFIA 4N42A 3SCVA 4DWSA 1JIBA 1V0KA 3VD7A 3VX0A 1HN1A 1LLOA 4UQEA 1V6XA 3N18A 4EANA 3J7HA 2V3DA 2WHKA 1KBBA 2XVKA 2CKRA 3WH6A 3B8SA 1ZJBA 3TTYA 4MB4A 3BLPX 1KGWA 1YHTA 2XFFA 3QHOA 1WZMA 1JFHA 4S3JA 4AISA 3WDJA 3WQ8A 1E6PA 1W3HA 4GZJA 1X6NA 5A69A 1XHGA 3WDIA 2D0FA 5I5RA 2A3BA 4J3UA 3T08A 4M1RA 5FKYA 4Q7NA 4BQ2A 1B3VA 4JHZA 2WSPA 2BXYA 4X0NA 5I3DA 2VL4A 3GNOA 1CDGA 2W62A 5BCAA 1PZ2A 3EYPA 1UKQA 3BAYA 1UR4A 1H5VA 4J28A 1ZBCA 5CSUA 1DWJM 2NSXA 5D9OA 1BYCA 1UH3A 4QFUA 1CGUA 5A95A 4WKHA 1V3LA 3DYMA 1FP8A 2YL8A 3WMBA 1JGIA 3W0KA 3BMWA 3SCUA 4F79A 3OZOA 5LA2A 1V0MA 2IXUA 5HOSA 3AIQA 4W8AA 1PIFA 4CU8A 1AQ0A 4D6JA 1J18A 3CIVA 4XV0A 4U2YA 2UY5A 1VFFA 2PBGA 1XYFA 2XVLA 1CTNA 3SCOA 1GPFA 1CLXA 1CEOA 1MYRA 2DSWA 4HA1A 5E9AA 4FLQA 2XWDA 3NCOA 4UNIA 2DT2A 4W85A 2WKLA 2DQXA 5C8BB 2DT0A 3QHNA 3BAIA 3ALGA 5EFFA 5GPRA 2XG9A 5FL1A 3MU7A 1UD4A 1W9UA 4FF5A 1CXKA 2E8ZA 2OSYA 3FAXA 3PZIA 4GO8A 3PZMA 3ZQ9A 3VOCA 3WH8A 3MS8A 4BA0A 4TVDA 2D0HA 1NH6A 1OGSA 2VO5A 1H3GA 1EH9A 4CN1A 2BVYA 2FGZA 3GH7A 4J3SA 4AIOA 1B1YA 2GJXB 1HKIA 4Q22A 1L8NA 1QI3A 2BHUA 2VCBA 2CBUA 1TA3A 4UZUA 1BG9A 1NOWA 1UKOA 2ZUWA 3FAWA 2OWWA 2VMFA 1JYXA 3SUUA 4TTGA 5I79A 5HPOA 4J3VA 3AIWA 2WVVB 2ZX8A 2AAAA 4F9JA 3CUJA 1KWGA 8CGTA 4P7RA 1YQ2A 4AZGA 1TVNA 2J7GA 2PF0A 5BWFA 1KQYA 3LPPA 4TVCA 1E6NA 1TFVA 3IAQA 2PWFA 2VZSA 2YDRA 2O9TA 3PBGA 1Q6FA 2X0YA 1W1YA 4J7RA 1H49A 6A3HA 5FD0A 2VRJA 3K4DA 1H2JA 1M04A 3EBVA 1DWFM 4M80A 1H09A 1W3LA 4GI9A 3VGFA 1K9DA 2BHZA 5KEZA 2ESCA 4BQ5A 5JIWA 1XH0A 1I75A 3ZR6A 4ACZB 1JNEA 4U3AA 2EPNA 4IUGA 4PMYA 4P8XA 3A4WA 4U3CA 1B31A 2DIEA 3AS3A 4HZ6A 3VD5A 5AYIA 1J0KA 1EDGA 1EXPA 2E9LA 5CJ5A 4U5KA 1VIWA 3PZTA 1GQJA 3AXXA 2GK1B 4JKKA 4XX6A 2BY2A 2EPMX 3RDKA 1UQYA 4ZXOA 2YA2A 4AD4A 3AS1A 4AXNA 5JUVA 2GJPA 3PHAA 4UOZA 1OGBA 1M01A 2GJXA 5AC5A 2W91A 2AMGA 2XHYA 2WLYA 1MW3A 2QMJA 4N0RA 1WZAA 3CUGA 5I23A 1G01A 5A8QA 2OSWA 3HU7A 3TTOA 3EMZA 3AHXA 5EFDA 1E3ZA 4AZHA 2JIEA 3RJYA 3WEOA 3KL0A 3K8KA 2WCAA 4UQ9A 2PWGA 3WQVA 3AYSA 1G1YA 4PMQA 2EBNA 1W3JA 2GDUA 5CPSA 1UWSA 1WKYA 3GNPA 3VGBA 3VDCA 2QMKA 4MNJA 1UWRA 3IANA 4D6GA 3GZAA 4MAVA 2WWDA 2JF6A 4MB1A 1FH8A 4LYPA 2WHLA 4HA3A 3NSNA 3AMGA 3BXWA 3BC9A 4KRUA 3NDZA 1GHRA 1VJSA 2J62A 5D9NA 1UA3A 1V0LA 2PWEA 3HMCA 5M03A 2VCAA 3KL5A 3VGGA 5BXSA 2YBUA 2J7HA 5HXMA 1VAHA 1ZJAA 2NT0A 2E0PA 1U33A 1JFXA 3UEQA 1QOXA 3VMOA 3BAXA 4GO9A 2CITA 4HPHA 4AEEA 1BPLB 1KCKA 2ZIDA 2BV9A 2X05A 1CECA 1DHKA 2GSJA 5A8MA 5F7UA 2UY2A 3VPLA 2J25A 1JXKA 4WF7A 5DO8A 1HJUA 1V0NA 4W8LA 2WXDM 3OGVA 4PTVA 2YA0A 3NIYA 5BROA 3KEHA 3WNPA 4B9ZA 3DC0A 1UKTA 2WM0A 3BGAA 4QAWA 2WZEA 5DT7A 1Y7VA 2XFYA 3CZJA 4CD5A 4HMEA 1BSIA 5I2UA 3QOMA 1OGGA 1E5NA 2VC9A 1MW1A 2W5FA 3EMQA 3K1DA 3TA9A 3WL1A 4H04A 2YL9A 5BRQA 1US3A 1E4LA 2D1ZA 2RGLA 1ISWA 1GZJA 5HNNA 3WNKA 4F66A 2G3NA 1WE5A 2Y8KA 3POCA 3LMYA 3GM8A 1CXIA 4H41A 3WKZA 3K8MA 3SCSA 2VQUA 1H0IA 2PB1A 3ARTA 4Z2KA 3B9EA 1VJZA 4A3HA 1AQMA 3GH4A 1XD0A 2ZICA 3PTMA 3L4VA 3VX1A 3F5KA 2XJ7A 3AS2A 1OCQA 2BNJA 3CZEA 4F9DA 1V3MA 3A6OA 1JYNA 4AC1X 4KMQA 3OGSA 3U7VA 2WC4A 2CHNA 3SUWA 2E4TA 2XVPA 2J7DA 5CQ1A 5AC4A 3SEPA 4OOUA 1NP0A 1TE1A 4H8VA 1GOMA 2E40A 2W63A 3GXMA 4BQ3A 5EMYA 1G94A 2E8YA 9CGTA 4CU7A 2WMFA 2BVDA 4AD2A 4JFVA 1JF5A 3LPGA 3ZR5A 1J10A 1C8QA 1D7FA 1M7XA 4FMVA 2BXZA 5FL0A 3AFBA 4BZYA 4DWSB 4CVWA 3CZ8A 1W1TA 3WSUA 3L4TA 5CLTA 3NDYA 1B3XA 8A3HA 1JI2A 4UTFA 2V3FA 3ARVA 4CD8A 2Y5EA 3FHQA 1EO5A 2BFGA 3NJ3A 4AD1A 1K9EA 3W53A 3CZKA 4ZE4A 2F2HA 1DWGM 1CXEA 1GQLA 2XGBA 1TR1A 1UOKA 3W26A 2JIWA 1BVNP 2WVUA 1E1EA 4CGTA 3G6MA 3L4YA 3BH4A 2WMJA 2VX6A 3SCPA 3PN8A 4PSRA 4AD5A 4P7OA 3SUSA 1W2VA 3CBWA 5DF0A 3B9AA 2G3MA 4PTMA 2WMGA 4NZCA 1OINA 4PMVA 4J3TA 4ZENA 2F61A 3RO8A 3HN3A 1CYGA 3W24A 3WD4A 1VF8A 1E0XA 2ZX6A 4QLKA 4UQCA 1NOUA 1HVXA 2WZHA 5C71A 2C0HA 1F4AA 3VD4A 1E55A 1A47A 3A4AA 1UQZA 2VT0A 3VMNA 2QLYA 1O7AA 3VIHA 3OA5A 5GNXA 3GXIA 1HNYA 2XFRA 5DFAA 1QI4A 3VKKA 4W86A 2VX7A 3ZJ8A 2WYSA 3WF0A 3UR7A 2GVYA 5EBAA 2E9BA 4ACYA 4M82A 4CVUA 4AZIA 3WFZA 3FW6A 1FHDA 3PZQA 1V02A 2W4XA 1WB0A 4F8XA 4PUDA 2CHOA 2BS9A 1C92A 3DHUA 4TX6A 1UHVA 3ZSTA 1XGZA 4D1JA 4NF7A 1PZ3A 4GZEA 5CZKA 3RCNA 3CHDA 1ODZA 3UG4A 2WBKA 2G3IA 1VEOA 1XCXA 2CBJA 3VGDA 3O2LA 1CXFA 4WSJA 1FA2A 1D2KA 1OIMA 3AHTA 1XRVA 1KXTA 4HPGA 1E73M 2NT1A 1CXHA 1R8LA 3WH9A 1D3CA 1ITCA 1E6SM 4LQ1A 2J7EA 1NWSA 4LYRA 1DWHM 3WUFA 1BHGA 4OKDA 4JFSA 4P7QA 2X0HA 5BXTA 2W67A 4YPJA 2RGMA 2X09A 2VOTA 3EDKA 2PWHA 3TTQA 1W32A 4LX4A 3W25A 1TA3B 4HOXA 5M3WA 1CBGA 1EGZA 4PEEA 1E0VA 2D23A 1IZJA 1H41A 2ZXDA 2XM1A 1C3FA 4AZCA 4HOZA 4U31A 1OSEA 3L2MA 1V6VA 4KRTA 2FH8A 4DWSD 1FFRA 4M56A 4TX8A 4W89A 2AOSA 1MQQA 2YL6A 5ABFA 3VM7A 2Y2WA 1E43A 3WFLA 3ZIZA 5CSYA 1E70M 3MV01 5HDRA 3WBAA 2WVSA 5IHSA 1V6YA 4PMUA 3VDBA 4AD3A 1JL8A 3ARXA 1TMQA 2XSAA 3N17A 2Z1SA 4MNKA 1TG7A 4JKLA 2ZOXA 4OBSA 1HKKA 1RH9A 2YJQA 3M46A 1DP0A 3MV11 1J01A 4WSKA 1OM0A 3KE0A 3WF3A 1QVBA 2WAGA 3WNNA 3AHZA 1J12A 1OT1A 2OLHA 1V08A 1GQKA 3MSGA 1UR8A 3VM5A 3AICA 1G5AA 1OD0A 3T2QA 1LG1A 2F8QA 4W84A 1GQIA 2A3EA 3SUTA 1JAEA 1W2PA 4Z2GA 2BY0A 3WUBA 2XSBA 3MUZ1 3WY1A 2VRQA 3QOKA 4JCMA 1ZL1A 4MTVA 1VRXA 3WNOA 1DEDA 1H0GA 2J7FA 2J77A 4MAZA 1MFUA 4NSBA 5I6SA 4GZIA 2D20A 1MW2A 4ML4A 1RD6A 1FH9A 4A3YA 2OYMA 3WUGA 3AIVA 1CGXA 4UFMA 2DIJA 4UQAA 3W4RA 5I24A 3GDBA 1C90A 5D9MA 4FLRA 4TVUA 4MDPA 2WHMA 1V6UA 2WMIA 3AJ7A 3N12A 1GVIA 1B3WA 2FDMA 3DECA 2HISA 2XM2A 4RE2A 1UWTA 6CGTA 5DT5A 4GI8A 4M8UA 1GONA 3RILA 4PMXA 1ODUA 2NW0A 1Q6EA 1PPIA 2GJRA 4OOZA 1ZBVA 1BTCA 1QNQA 2YIHA 1O6IA 1WDQA 5IXEA 3WELA 3SCNA 5JIPA 1VBRA 1QHPA 3GNRA 3VIKA 2CESA 4JFTA 1W9BM 4U2ZA 1MQPA 4NRRA 1HP5A 1WDSA 1CLVA 3GXFA 5A6JA 3AMKA 2O92A 5JBDA 1HJWA 2BVTA 2W66A 3ZOAA 1WAWA 2WVTA 4H7VA 4U5IA 3T2PA 5A6SA 3MKKA 1NM9A 1JZ3A 3AHVA 2EPLX 3M6DA 1SR0A 2CEQA 4JFWA 2ZE0A 1L0PA 2WKGA 4GKLA 4CCDA 1XCWA 4DM2A 1GCYA 1K6AA 4W8BA 2EJ1A 4GIAA 1SYTA 1WDRA 2QF8A 3MMUA 1J0YA 2ZWYA 4IPLA 1KR0A 2JALA 3AIRA 1FOBA 1TUXA 2DSKA 4X9YA 4MPKA 1MQRA 3WD1A 1LG2A 5GNYA 4XZWA 1FFQA 5BXRA 1CGTA 4Z2JA 1C93A 3GH5A 4CD6A 1X1NA 5D8ZA 4E2OA 5CPQA 4B3KA 1V03A 3AZSA 1LL6A 3UG3A 3WN6A 3T0DA 5I0DA 1UKSA 3IK2A 3CHEA 2A3HA 2YKKA 3D5HA 3I3EA 4W7WA 4CD4A 4ATWA 3SIMA 1CGWA 1V02E 1E6ZA 3ARSA 3ZT5A 1CPUA 3FNDA 2ZUVA 2WNWA 4C7DA 3POHA 3A47A 3WMSA 3BMVA 3II1A 1G0CA 4PYSA 2VRKA
chains in the Genus database with same CATH superfamily
4PMDA 1ECEA 3PPGA 2EG6A 2QNEA 3CPGA 2ZZ1A 4AYSA 2P8CA 1JCXA 4FXSA 4JIRA 5HULA 3L66A 5D37A 5CPTA 3WF1A 1EHAA 3W7PA 4YHEA 5IHRA 3UG5A 5LA0A 2GGHA 4E2VA 2DH2A 3W38A 3ERPA 1PE1A 4JD4A 2OJPA 2YOCA 4YTUA 3V0TA 2AL2B 2R14A 1EO7A 4LEFA 3UWZA 2XH2A 1OFOA 1A5NC 3WJXA 4Z0JA 3TZFA 5BMXA 1K9TA 5G1TA 3TJLA 4JNYA 1CI1A 3ZLHA 1CB7B 1KXQA 2B7OA 1O60A 3NVTA 1VGAA 5C9XA 2DSZA 3T55A 3UD6A 4JQ2A 4HCDA 2WMKA 2E09A 1TTPA 2WHJA 1QPKA 3KBWA 1V3KA 1Q8JA 1BWLA 4R53A 1W3IA 1K4HA 2FDSA 1M03A 3NXFA 3PZ9A 3CJPA 3QFEA 4JL2A 4LH8A 4JTLA 4F4RA 4IMCA 3M0KA 4E4UA 1FHLA 4J40A 1NQKA 3ABXA 1TCDA 2F6XA 2AQVA 1QI5A 3T1GA 4GXWA 1NDYA 4FI4A 2QJHA 4UMBA 3T42A 3EB4A 3VGEA 3FXGA 1HL9A 4IMDA 1MMFA 4X60A 4H2CA 4HNLA 1VKFA 4N9EA 3THUA 1UWUA 3QV8A 3PNUA 4DBEA 3QEZA 1DJNA 5D2VA 4KS0A 2Z29A 3ZXWA 4E5TA 3GVRA 5IFTA 1Y0EA 4IXHA 3KL3A 4QNEA 1V77A 1H62A 1HJQA 4JTQA 1GW1A 1SZRA 1QHOA 2Z26A 2ZUUA 3B97A 4UCFA 3PANA 3HOJA 1SO3A 2UZ9A 1UB3A 4M3PA 3V4BA 5CZSA 4C7GA 1YDVA 3DYOA 3N04A 1E4NA 2PPGA 1M7OA 1HIZA 3A24A 1TVPA 1UKPA 4F48A 3NURA 3WQ4A 4B92A 1V79A 3Q37A 2MANA 4JZ5A 1GHSA 2DSUA 2PC4A 2UV8G 3UU0A 2PWVA 4MY8A 2PDIA 1Q66A 2PODA 4KFNA 4QDPA 1GGOA 4PBFA 2TAAA 3GAKA 4R5EA 3TTSA 2DW7A 5DEZA 3L21A 3L65A 1R3WA 1VFMA 2WB5A 3CUIA 3NEVA 1BGGA 4EPBC 1VFOA 3CT7A 4QGCA 4V1YA 3UZXA 4WKFA 5D30A 4WK9A 5A3HA 3NO5A 3K4WA 3AMLA 3T0AA 3CO8A 1XWYA 1Q7MA 3RM9A 3ELFA 5H6HA 4ECLA 3PK7A 3C86A 2VYOA 2HE5A 5HMDA 4NI3A 4I9JA 2CLEA 4Y6GA 5GJPA 3AI0A 4QJ5B 5HQEA 4ZEPA 1V51A 4HZ7A 5T9CE 4FB7A 2OZ8A 5L6UA 1K9FA 1F3WA 2H8ZA 2PTZA 3INPA 3ABRA 1JZ7A 5ABFB 2WSQA 2OB3A 3VIFA 1QT1A 1EJRC 3W7GA 4FR6A 1UBPC 1JD7A 1FDYA 1L6YA 3W6YA 2TODA 2PLMA 3IJ6A 2V2CA 4HPNA 3VNMA 1TQJA 5ABGA 3VOIA 5D38A 3M6YA 3MP3A 4C6CA 1N82A 4GH3A 1W17A 1PIGA 3NTYA 3AROA 4DF2A 4AY1A 4HMNA 2G41A 8TIMA 1TPB1 4MZ8A 4WDWA 4NJGA 4O12A 1FHUA 2XIQA 2OFJA 3NG3A 3Q67A 2EJAA 3QV9A 3TN5A 4IPNB 2V5LA 5T91A 1ML1A 4IL2A 3ZVIA 1RP8A 2FVMA 1TIMA 1Q6DA 2VURA 3VKDA 2D0GA 2XIBA 4JTRA 1MXDA 1DXEA 1IEIA 3TUUA 3H6OA 1H1ZA 1YE4A 3BJTA 5IDIA 1QBAA 3HGSA 3C4UA 4MYAA 1PAMA 2QPSA 1R38A 3WBYA 3RPMA 3EWUA 3XISA 1QNRA 2G95A 3CV7A 4UC5A 4HNCA 1P6CA 5HBFA 3AUJA 2D2HA 3MKCA 2DPEA 4AX7A 2X8RA 3F4NA 1KM0A 2G50A 4LS1A 2QJNA 3C0QA 2E6AA 4I6KA 1UD6A 3W23A 3LBMA 4MJ4A 3MHGA 3DKJA 3FA3A 1YLVA 3I6RA 2RHGA 4ZCWA 4N2YA 4IQJA 3ZSSA 1SR9A 2X1IA 1LL7A 1R2RA 1CB2A 3HBLA 4JQAA 1TWZA 3NYDA 3UWYA 3K46A 3KHDA 2CBIA 4B5SA 3K4AA 3FN9A 3M07A 2DSVA 1VBUA 2Q71A 5AC8A 3VVGA 2PTWA 4GJIA 5FF4A 4X3ZA 2RDUA 3D47A 3ATZA 3WK2A 1E6QM 1KRBC 4RE4A 3B8WA 1YW1A 1A0EA 1DOSA 1TRIA 3EDEA 3ZO9A 5CC6A 2W61A 1GEQA 2I9EA 2WWCA 4EP8C 3SCQA 3VIPA 4LPCA 4UOJA 4PCTA 1IZCA 1XH2A 4A3QA 3N3MA 5I07A 3T07A 4ZA0A 4HJFA 3CNYA 1Q65A 1E5JA 4TTUA 3MQTA 1KM1A 3EZ4A 1UD5A 3LCXA 2CU0A 2D22A 1UZ4A 3DEQA 2YCLA 4GIYA 4K6AA 3EDDA 3XIMA 4NNCA 1YADA 1TJRA 1XG4A 1Z44A 3N1AA 3T8QA 1GOQA 2O9OA 3REQB 4P8VA 1RBOB 2XVGA 2NQ5A 3FHAA 1ELSA 1F6KA 3GR4A 4OBTA 1XW8A 3UJFA 5BRPA 4V28A 1XIJA 2ZZ2A 4QG6A 4PMZA 4V1XA 2OGYA 1BGAA 4HU0A 3N4EA 3DI0A 2ICSA 2PDJA 1OFQA 3LV6A 3VO0A 5CC7A 2A3LA 3BAJA 3N2BA 1ZPTA 1H7NA 1DE6A 1DBTA 1CT5A 3VKBA 2Q01A 1H1YA 3VGHA 1ZBKA 2OT1A 2J7CA 2V3EA 5TAOA 3M0JA 4G7EA 4DPPA 3GVWA 2F6KA 1BXNA 3P8JA 3MPGA 3EMCA 4XZ9A 1PV8A 3WF4A 4CCZA 5EU9A 4V2XA 2CLLA 1F3TA 4E3VA 2VGGA 2R1LA 1YNYA 1QW7A 1S46A 1KA9F 1EA9C 3WNLA 2BXVA 3BLEA 1S5MA 3GK0A 1DQXA 4JPGA 2IQTA 2VCCA 3D46A 4H7ZA 1UP0A 1XKJA 3D3AA 5MKGA 5T26A 3SB0A 2Z1KA 3N15A 2VC7A 4WSHA 4ZOAA 2RH9A 4A4AA 3KS5A 4V27A 3W29A 3A5VA 3CS2A 3GC4A 2C1GA 4H9ZA 5AYBA 4HU3A 4LFYA 1SW7A 2Q3OA 1C7SA 4PODA 4WUIA 5GNZA 4BQ4A 5JBFA 2IXVA 4PN2A 3TYEA 3L0GA 2Q8LA 3TC3A 2VKZG 3W7CA 5BYWA 2GK1A 1UG6A 1AQFA 3OBKA 4O1DA 4C7FA 1EQCA 1UZHA 1S1PA 2QCNA 2PTXA 4ZE5A 2EXOA 1GVYA 4AHQA 2ZC1A 1XJBA 4Q4MA 3EDFA 5IBXC 4HK6A 2INFA 2OLAA 1GTHA 3BQ6A 3VUSA 2GFTA 1QI0A 3SY8A 1M7PA 1V6WA 1A5UA 4RDWA 4QCFA 1BG4A 3CQ0A 2FB2A 4GIRA 3VUPA 1MFVA 1KCLA 3GBDA 4P8WA 2YYUA 2DZWA 2FHBA 1RUSA 2D3LA 2RJHA 3ONCA 4YNGA 2GYIA 4WEVX 3C2VA 4D6DA 1TZZA 4M6UA 3EKGA 5CBJA 1Z7AA 4DO6A 1PX3A 4JGDA 1US2A 4LWWA 2CKSA 1FH7A 3VMPA 3W70A 3IJ9A 3W02A 2VUYA 3QGAC 3W2MA 3ARQA 3FOKA 3AWNA 2E6YA 3W1UA 4MNLA 4K39A 3OJGA 2Y8VA 4E2BA 2Y4SA 3LGDA 1P1XA 2ZCGA 3SRFA 2I5QA 4RL3A 1UR1A 2D73A 4C1NB 3WJSA 3WIJA 4URIA 1G7VA 4Q7IA 3EWYA 4ZO7A 3NZQA 1HJVA 3SJNA 1B3ZA 1W5MA 1WKFA 1BKHA 2P8BA 1W0MA 1LZOA 3OBEA 2RKXA 1OFPA 3A13A 3VU2A 3U2OA 3U2EA 3AYRA 5TBOA 3MUIA 4GC3A 1GJPA 5CBBA 3NQCA 3LB0A 1XCFA 3ZZ1A 4XZBA 3VTRA 3M47A 5B7ZA 4J3WA 3UR8A 3PWIA 3VK5A 4LBUA 4ZOCA 5FSEC 2YW4A 1ALDA 4GY7A 4LNCA 2QHAA 1SUXA 5HA7A 1JF6A 4L5ZA 1IQ8A 3FS2A 2D69A 1GORA 3TFCA 3L67A 2JK2A 3TWBA 4PBGA 4KFOA 1ISXA 1U1HA 4B2DA 4H8NA 2IUZA 1E4MM 3PZOA 2POTA 3C61A 1DWAM 4BFAA 3TW6A 3P5YA 2JEPA 1KXVA 1UOZA 3IPWA 4LAOA 4JTGA 2JKPA 3CUHA 2FPVA 4ZB5A 4W87A 4HT3A 1G67A 2O55A 3LPFA 2WM1A 3KZSA 1B30A 4NZ5A 3BLFA 3QVQA 4O11A 4ZOBA 1WYIA 1MSSA 1WP6A 1WX0A 3V16A 1TJ0A 1MDLA 4K68A 4RLIA 4PL1A 5A2CA 4UR9A 2ZWZA 1BYDA 1O66A 1XR2A 4DO4A 2Z1XA 1HVQA 6XIMA 3PY2A 1ISVA 1FDJA 2QT3A 1WDPA 3ZM8A 4YU1A 3DDMA 1KV5A 2H6RA 5TQLA 1ME7A 1Q4WA 3V75A 2R91A 3ARUA 4HP5A 2GWGA 1UH4A 1IHIA 3GHTA 2J75A 2QCMA 4UFIA 4N42A 1V0KA 3VX0A 3G3DA 4EAYA 5T9BG 2NZLA 2WHKA 2NVDA 2VWTA 3W7OA 1KBBA 2XVKA 1EZ2A 3VOJA 4QM1A 4TR9A 4C65A 3BL3A 1W3HA 4GZJA 1X6NA 1XLEA 5A69A 2QZRA 3CB3A 3T08A 4J3UA 5FJRA 1HZYA 2XH0A 3PF3A 1LLWA 4JHZA 1JCLA 1YDOA 2WSPA 2BXYA 4X0NA 5I3DA 4XZHA 3VNLA 2VL4A 4NZ4A 2P3ZA 1RK5A 4Q8NA 4PCPA 1RCOB 1UR4A 4DLMA 3JZEA 1US0A 4JYEA 2YCEA 3V5OA 4J28A 5CSUA 3BK0A 3B8VA 5D9OA 1BYCA 4YVXA 4GCAA 5A95A 4WKHA 1PDZA 2HXUA 3GXNA 3R4IA 4NNBA 1QATA 2KAUC 3SJ3A 3SCUA 1FWJC 1V0MA 1TV5A 2Z0IA 1AQ0A 3UXDA 3GG1A 4O15A 3VNJA 3TVAA 1W37A 5AC6A 1ZCCA 5FESA 3KOWA 3A4JA 2DSWA 1MYRA 3QZ6A 4H19A 3L9CA 1GVEA 3O16A 2DT0A 3E2VA 3BAIA 2IKIA 5EFFA 1QMLA 3QZEA 2XN2A 4US6A 2WO5A 1TELA 3PBVA 2GGEA 3R13A 4XD6A 3S1WA 1MRQA 1XGDA 1XLBA 4GO8A 3BGJA 4ZQOA 3EWZA 4DX3A 1OFRA 3BV4A 3AAMA 1FXPA 3MS8A 2H9AB 2D0HA 4MJMA 1KBLA 2E25A 4ORIA 3GH7A 2Z24A 4J3SA 4AIOA 2F7FA 4NJIA 2VCBA 4E3TA 2DZXA 1TA3A 3MSRA 5TIMA 3FAWA 4TTGA 5HPOA 1PZ0A 1GG0A 1S5NA 3NZPA 4G1KA 2ZX8A 4F9JA 3CUJA 4M0XA 4HJWA 1NFPA 5BWFA 1KQYA 3AXMA 4TVCA 1E6NA 4QITA 5EMUA 3IAQA 2A2IA 2PWFA 2E1WA 3PJTA 2GVEA 3G3MA 3SADA 4TO8A 3K4DA 2P76A 2NQHA 1M04A 3M44A 3EBVA 4EIVA 4R34A 2FLIA 5FEXA 1WKDA 4M80A 1EJVC 5I06A 4PR4A 1XLLA 4WHBA 3VGFA 1PSCA 2BHZA 3CU2A 1JEZA 4ACZB 4PFHA 5C6MA 4IUGA 5CKSA 1KBJA 3CH0A 4EOUA 5HWNA 1B31A 1REQB 4EWND 2DIEA 2VGIA 1J0KA 5I00A 3W87A 1VIWA 3PZTA 4CQCA 4XX6A 1RXOB 1ITQA 2IMRA 5CBIA 4HU4A 4ZXOA 2YA2A 1YXCA 4AD4A 4AXNA 3PHAA 1S5WA 5AC5A 3ORWA 2AMGA 2V6AA 4JHMA 5FSDC 5I23A 3W7EA 1LROA 1THFD 4LVBA 4PCFA 3AHXA 5EFDA 5K4ZA 4LT9A 2Z2UA 4DXVA 3KL0A 3K8KA 4UQ9A 3TZNA 3NPUA 1TVLA 1JRCA 3QZAA 2EBNA 3MTWA 2GDUA 2W0UA 1MUCA 2ZA3A 4DXXA 3TN4A 1UWRA 4D6GA 3BTNA 4XAZA 1S2AA 3ITTA 2BZNA 1PYMA 3DGRA 4MAVA 2WWDA 3F2CA 2Z2BA 3P60A 2PDCA 4XSMA 5AOUA 4ASTA 2GUBA 1C29A 2A21A 3W88A 1IWBA 3BXWA 3EB3A 1R0MA 3USZA 1UA3A 3H7RA 1V0LA 4N7QA 3UR5A 1ICPA 1E9IA 5M03A 2ZRVA 3PJWA 3KL5A 3VGGA 4QROA 4GY0A 4J3ZA 5C7HA 3S4TA 2NT0A 2E0PA 2E6DA 1FRBA 3UEQA 1QOXA 2PA6A 3VMOA 3W86A 1W54A 4KEUA 4HPHA 1BPLB 1GYLA 1KCKA 4AB4A 3DFQA 3THQA 1CECA 2GSJA 4LRSA 3KOXA 5ECVA 3QV7A 3M4HA 1LTDA 1HJUA 1V0NA 3W7NA 1ZUAX 3NQ6A 2YA0A 3NIYA 5BROA 3LA4A 2YBVA 3T81A 2PURA 1T5AA 4PUNA 3WNPA 4RZ6A 1SO5A 4AQLA 1T0OA 3BGAA 4WRHA 3WLNA 2PF8A 4AUBA 4LY4A 1SSDA 3GIPA 1TZ9A 1BSIA 3ZFHA 4IJCA 3QOMA 4GQBA 3G1YA 2W5FA 3HURA 3JZUA 4KERA 5AYZA 2VEKA 5JMUA 5BRQA 2RGLA 4P2VA 1GZJA 4ZTXA 3G5EA 3VZYA 1JGMA 2PDKA 3W2UA 3LMYA 3NWRA 3KBNA 2FZBA 3E2SA 4FA3A 2PDMA 4RNHA 3T4WA 1VFTA 1VJZA 4A3HA 2PDNA 4LJ3A 3PTMA 3VX1A 1HKWA 5I3KA 1SPQA 2PU1A 3A3WA 3W1TA 1M65A 1UC5A 4NXSA 1Q7QA 3LUTA 1R2SA 2B4GA 4DELA 1TTIA 3MDUA 3GUGA 4XO6A 5I09A 1NP0A 1WQ5A 2C71A 5CAHA 4BQ3A 1G94A 1EKOA 1IIGA 2AKZA 3LPGA 3B9OA 4L4MA 2QDDA 1M7XA 5FL0A 1MDRA 3AFBA 1OVDA 4J9JA 4US5A 1W1A1 4HA0A 5FAJA 2P0OA 3L4TA 5EYWA 1UUOA 4RDVA 1DQWA 1B3XA 8A3HA 3EB2A 1XLGA 4UTFA 1LT8A 5LNVA 3AU6A 2P5NA 4CD8A 3FHQA 1UIPA 4QSHA 5H8UA 1XYAA 3NJ3A 1K9EA 4MZYA 1VFHA 1DWGM 1CXEA 4X9SA 3GG7A 3EX1A 2YCJA 3W26A 2JIWA 3DERA 4K37A 1E1EA 4S3AA 3AUOA 3IS4A 3SCPA 3FFSA 3PN8A 4PRTA 1OF6A 5DF0A 1SZGA 2PLCA 4D8AA 4ZENA 4G7FA 2F61A 3S6OA 5EIYB 3W24A 2P3EA 2ZX6A 1NOUA 4A2SA 2C0HA 3QPZA 1A47A 1U1UA 1UQZA 2OQYA 3GXIA 3U0HA 5HNTA 4JYDA 2XFRA 2G0WA 4PB4A 5DFAA 2VX7A 2XZ7A 2NUXA 5M2FX 2GJLA 4M82A 3UCDA 4S3GA 1R3SA 3HZ3A 4JOMA 4GH1A 1K70A 1QCWA 1V02A 2OOGA 5CG7A 2BS9A 1C92A 4GZEA 3NQDA 3UZYA 3LHYA 2WBKA 1F05A 3TNOA 1VEOA 2OXNA 3MHUA 1XRSA 2FVKA 2QCGA 2POZA 2Y6ZA 1D2KA 4DBUA 3AHTA 2JKEA 4JTDA 1OK4A 4H6KA 2NT1A 4WJ8A 4NQ1A 3IIVA 2QDEA 2PTDA 2P1FA 4GWEA 4LQ1A 5E1QA 1NWSA 3HQNA 4LYRA 3V36A 1BHGA 3RU6A 5BXTA 2RGMA 4AH7A 3DI1A 2PWHA 4QXIA 4KT2A 3W25A 1DJIA 5M3WA 4PEEA 1E51A 4HOZA 3MP5A 4F0SA 1RJRA 3UR2A 1V6VA 4KRTA 2FH8A 1DJXA 1ADDA 1FFRA 4M56A 4I7VA 1P7TB 3UWEA 5ABFA 1L6SA 1KFCA 3RCMA 4A35A 4ZQCA 3VM7A 2Y2WA 1JUKA 3TW9A 3LDVA 1JDEA 4IXXA 2QXWA 4FXRA 3MV01 2ABAA 4XBKA 1EWEA 2WVSA 3USBA 4B5TA 4LVAA 1KFJA 2O7QA 4G8TA 4U28A 1J6OA 3MDWA 2XSAA 3N17A 2Z1SA 1TG7A 1X97A 4DZHA 1HKKA 4Y8FA 1RH9A 2YJQA 4JICA 4WSKA 4PGLA 3WF3A 1QVBA 1P48A 1I2RA 2DY3A 3WNNA 1XYLA 1K02A 2BWGA 4I5UA 1GQKA 2W3ZA 2A3EA 4H7CA 1JAEA 1DTNA 4FAMA 4A2RA 2NLIA 2A7NA 2INEA 2XSBA 3VOFA 1HGYA 1ZL1A 1I8JA 2DFAA 1DEDA 1W56A 2J77A 1VPQA 1D3HA 4NSBA 1MW2A 1RD6A 1EC7A 4XIAA 3WUGA 3AIVA 3DGBA 2DIJA 4UQAA 2OODA 1C90A 1N7KA 3PAJA 4DWDA 1V6UA 3N12A 3VE7A 3VKJA 3LSCA 1GVIA 2OLSA 1B3WA 4RE2A 3E12A 6CGTA 4Q6XA 4H3DA 3O8AA 4DRSA 4LUSB 4LAZA 1ZBVA 4M7SA 1F3EA 3M0XA 1QNQA 3GRIA 4JX5A 3SCNA 1OG6A 1VPYA 2ZZ6A 1RR2A 3S5ZA 4MKNA 2DV0A 4NRRA 1HP5A 4XZIA 3ES8A 3OG3A 3GXFA 5A6JA 4WX2A 3S5SA 1SJBA 2W66A 3L5AA 3ZOAA 1WAWA 2WVTA 5G2HA 3ITCA 3LCGA 3O15A 4H7VA 3TJ4A 3PNZA 5A6SA 1NM9A 1JZ3A 3GG8A 3LMZA 2EPLX 4GQGA 1EGVA 3P8IA 4KEVA 4Q3MA 4ZQMA 4DM2A 4JQ1A 1H51A 3SGZA 4AEOA 3KM8A 2HSAA 4NU7A 3QRHA 3GG0A 4YCOA 1VCVA 4H9TA 4PULA 5LZLA 1WDRA 1WBHA 3KCLA 3CAWA 3WK0A 3W1QA 2ZRWA 2JALA 1G4SA 1FOBA 4GIEA 4JN6A 4LVDA 1FFQA 1CGTA 1C93A 1X1NA 4XISA 3U2CA 3NZRA 4IG2A 2WZMA 4HPJA 4B3KA 3TC7A 2HNEA 4C5YA 3WN6A 4Z1AA 1WXJA 1DE5A 2Y70A 4ATWA 1TREA 4LB4A 3FNDA 2ZUVA 2WNWA 5E0KA 4C7DA 4OE7A 3BCJA 1BSLA 1NFGA 5JH2A 3A47A 3WMSA 1G0CA 4KFPA 3TKFA 1Y5XA 3SFKA 4QIUA 1LJYA 3LTPA 3OHMB 1P0KA 4ZB2A 4S3BA 1JJKA 3IGXA 1R7OA 5L9FA 4W7VA 3U4AA 1EHNA 3IAPA 1U5VA 4B4FA 4AZ7A 2OO0A 3O6CA 2ALRA 4NRSA 2WK2A 3L4UA 3MBDA 4BF9A 4EXAA 4L9ZA 3FEMA 1QNPA 2ZXQA 1DPMA 4Y9OA 2ZZ3A 2ATSA 1NU5A 3TSDA 4KCTA 1GOOA 2VVNA 2OKTA 3KWSA 2WANA 4EE9A 5AECA 3L12A 4Y9NA 2ISSA 3W7HA 2AQOA 4C6JA 3M0HA 1KC7A 1E0UA 2FZ8A 3DHDA 5LNWA 2ACQA 3EX2A 5HMFA 5AC7A 3ARRA 1T40A 1ESWA 1R3YA 4PMJA 4CLMA 4IFKB 3DFTA 3A4XA 4QCEA 4M29A 1XSKA 4PB3A 3HQ1A 3NQMA 4O19A 1E15A 2H8XA 3WF2A 3F1QA 1HJXA 3AISA 4JL1A 1OZQA 3LCLA 3FKRA 3MO4A 1E9LA 4O13A 3LERA 3S5OA 4Z2LA 2C13A 4IPPA 1RAKA 1QOPA 3HG5A 3WNMA 3AS0A 1GYMA 3KRSA 1EZWA 4W7UA 1XH1A 1XIEA 1BAGA 3K2GA 2IS7A 1Q6CA 3RM4A 3LCHA 1UMYA 4C6MA 3PBMA 3ZLFA 1OZMA 4M81A 1GKRA 1G7UA 1WAUA 1X6UA 2Y85A 3EWWA 3CT2A 4HYVA 3JS3A 4ZBCA 4ATDA 4RE3A 2DW6A 1Z41A 1UR0A 3WEZA 4LC8A 5JU6A 3N9KA 5J5RA 4P7NA 4H6EA 2VM8A 2ZUTA 3CMFA 4DM1A 2O9PA 4J2PA 2I17A 3AXHA 2NXHA 4ZMGA 3W7RA 2FJKA 3GTNA 3ISIX 2NQLA 1QI2A 1IGWA 2DP3A 4GI6A 2OX1A 3T78A 4IISA 4D6IA 5KITA 4DJFA 3W85A 4K8EA 5J8LA 3QF0A 3TIMA 1TPVA 4EPDC 1J11A 6PTDA 2IKHA 1FWBC 3PAOA 2QUUA 3PG9A 2ZZ5A 3CC1A 5TD4A 4DVOA 4ZXLA 1XLMA 4YJ5A 1DJQA 4W5ZA 1XDJA 4GE8A 1LRTA 2PCQA 3G1RA 2J8FA 3H12A 2PI6A 2AQWA 1W31A 4XD5A 1J9YA 3PJUA 3TW7A 3M0YA 5K2ZA 2XH4A 1BQCA 3NM1A 4DYJA 3W6LA 2FFCA 3OO2A 4B15A 3H4WA 4GQRA 2FZDA 1W9XA 2VWSA 3O9NA 3NSXA 2V67A 3ZJKA 3BW2A 3GHUA 3E2RA 1XBVA 4YVPA 2YLAA 8XIMA 4FLOA 4QHRA 4Y90A 3GIQA 1ZGDA 4EPEC 1FCUA 3B8TA 5M1TA 1H7XA 4CUCA 1O5RA 1S3HA 5DMYA 3MI2A 1OX6A 2RJGA 3ARZA 4KQNA 4AZCB 1PVNA 3ZVHB 4HMCA 4C1NA 3V1HA 3O6AA 2XTKA 3PSWA 2ACUA 2DVUA 4US5D 3VABA 3DUGA 4YTSA 4P7LA 1ICQA 2VFGA 3OLGA 4LVFA 4ZQRA 2HJPA 3BCFA 4KIEA 4LAKA 3OP2A 2J24A 1UUQA 2D2JA 4EF9A 1LWHA 3WD2A 3ITXA 2WZTA 1PBGA 1F61A 3OEXA 3MMWA 5A94A 4JKMA 3MO7A 3OW1A 1IV8A 3GX9A 3E1F1 1BF2A 4LYKA 3DENA 5AFDA 1GK8A 3KTCA 5EJ1B 1YTDA 3TYZA 3CLWA 2ZDRA 3CMJA 4GXPA 1AQHA 3WQOA 2WC3A 3QKZA 2GGIA 4LYQA 4OIFA 5I3FA 4FNPA 5C5YA 2MNRA 1YPIA 3M5XA 4P5UA 3M16A 2ZUMA 3QGKC 1E6XM 1KKRA 1XFBA 4KCWA 1X38A 2J9XA 3P14A 4B91A 2X7VA 3KP0A 3S0CA 1FP9A 2V5JA 1A49A 4TMCA 4W93A 1PX4A 4C6PA 4N9CA 4N02A 2EQDA 3RFAA 4JR5A 4FOJA 1GOIA 2CBVA 1S39A 1MEIA 4GQ0A 1JD9A 1K6WA 1QHZA 4FHAA 3PS7A 3ZWSA 3GU9A 3BLDA 5EMKA 3OZPA 1JZ5A 1RD5A 1BVZA 2Y8UA 3DKLA 4RPPA 1ZNNA 5D2YA 4C6EA 1W6TA 2WCGA 1LUCB 3R1ZA 2XGIA 3WDHA 1GOXA 1LCOA 4Y7EA 2O7SA 3KVKA 3OLEA 2DH3A 1W91A 3R6IA 1CGVA 5BMWA 1P0BA 1K8CA 2ZTKA 4LB3A 4JY8A 5LIKX 3LZ3A 3MUAA 1XPYA 2A7PA 2EPHA 2G8ZA 2FYMA 1H7RA 1VCFA 2XINA 3O1NA 1PXGA 4EX4A 2HVNA 2JE8A 2YPIA 1EJWC 4YTQA 3GTIA 4EXQA 1S2VA 4RW5A 4XB3A 1OB0A 1J0JA 1KTBA 3VNIA 1J79A 2PAJA 1NP2A 7XIMA 1BRLB 4U33A 1PX8A 3T09A 4H6RA 1XYMA 1R7AA 4RE0A 1TJPA 3N9RA 3NL3A 3QC0A 1HKJA 2D24A 4IM4A 4AZ5A 4Q8QA 5C70A 4O14A 4KGJA 3UJ2A 4CD7A 2C1HA 3AXKA 1MXGA 3LNPA 4OHQA 3DZ1A 4JY9A 3CH9A 2ZBTA 2A79A 2F38A 3VNKA 4S3KA 4XVEA 1HGWA 3VZXA 2YBTA 1W5QA 4I5XA 4QR6A 4F0KA 3L2LA 1TPWA 3H55A 1BYBA 3IGUA 5REQA 4B5VA 3AJXA 1TPH1 1VC4A 3RNDA 4G7EB 5G4EA 1AD1A 2B7QA 4JTAA 1P4CA 1XBYA 1AA1B 2ZXBA 3GDMA 4QEEA 3S1GA 5BZAA 2VQTA 1E56A 4FXJA 4RZ5A 1P5BA 5G1MA 4E8DA 3WH5A 1A3WA 3FA5A 3SQMA 1WPCA 1JNDA 3NL2A 1JAKA 1UJQA 4LBRA 4XBSA 1QPRA 4E38A 4IQLA 3F5JA 5E93A 1O5QA 1UROA 1A3HA 5LA1A 3B0UX 2VTFA 3EWXA 4W88A 3U4FA 1EX1A 5JBEA 1OBAA 3T2OA 4REQB 3HFTA 3VI2A 1V3HA 2INZA 1Y8BA 3W3OA 2J6VA 2YLLA 1VQTA 1SMAA 1RK6A 5FJUA 4C6DA 5HJYA 3S2CA 4MDOA 5MKGB 1H60A 1CZ1A 2WCSA 4B5WA 3W84A 3EX3A 4WIWA 1XDLA 1HL8A 4RJEA 2EPKX 3LHVA 1VLIA 3IRSA 3QGVA 2JFEX 3RU8X 1KFWA 1QWGA 3A3HA 5AHEA 3K30A 4HYWA 2GPTA 3AO0A 1H1NA 2I56A 2QV4A 1CWYA 1TCMA 2WMHA 3LX9A 4GUHA 3FYPA 2PDHA 1RQHA 1TZ7A 4HK7A 1LF1A 4CU6A 4PCSA 2E9MA 2SFPA 1A5MC 3URQA 2X1UA 1RLDA 2CC0A 1B3YA 1EYEA 3R12A 4GYFA 3VIGA 1VENA 3AIUA 4R27A 2J74A 3B3DA 2CNCA 4M51A 1B0IA 1CNVA 1I4NA 5EGRA 4PUEA 1ONEA 3P93A 1TWSA 3A3XA 1QK2A 1I2OA 1Z9AA 9XIAA 1HX0A 1E6RA 1GVFA 1PHWA 5HJLA 4KWUA 1AZ1A 4FZIA 1ZJHA 1TR9A 2H3BA 4OV9A 2ZRUA 2XN0A 4EKJA 1YIXA 1WZLA 4U4MA 3CAKA 1O68A 3KRZA 4UTHA 2BHYA 3UJEA 1DIOA 3VILA 5H8PA 3GYCA 2GZXA 4UBPC 2FHCA 2CXEA 1KB3A 1JQVA 3WO8A 4JTSA 1N2VA 1BFNA 5EY5A 3STEA 4ZL1A 1EIBA 1LBFA 1WUFA 3E38A 4CEUC 1E72M 4ACZA 4AEFA 3STPA 3H7VA 3CZLA 4WY0B 5DXYA 5DX7A 1REQA 4JTKA 3E9AA 4QJ4B 1FKXA 2YCIX 3M5ZA 4L4PA 4LF1A 4BR1A 1PKMA 5LNUA 2WBGA 4LTSA 3STGA 3T40A 3K8LA 3OGRA 4UTTC 3W6MA 2QW5A 4GVIA 2IPWA 2VD8A 5D2WA 1NWRA 1POKA 3P74A 2VR4A 2BOEX 3EXRA 2PP3A 4DJDC 3VNZA 5MF5A 1W9VA 2GQ9A 3Q45A 4Z1BA 4WR3A 3G22A 2OWCA 4IQDA 1SW3A 3B0YA 3OHIA 3WLTA 4Q7BA 3M5VA 3FJLA 1C91A 1JYWA 1U2YA 4D2JA 3FYOA 1OCBA 3H26A 1DKWA 3TMLA 4S2CA 1XICA 5FEZA 1LL4A 4H9VA 3W07A 3IGHX 4QX4A 3GW3A 1EB3A 4B9YA 3TYBA 2A3AA 2VFHA 1WNOA 3KVMA 3ARPA 5CZTA 3NAVA 3LGEA 3GNXA 3MA8A 2PMQA 3SCRA 3RYSA 3FY1A 4GK8A 1ONXA 3GKAA 4GCXA 3P7YA 3HPSA 3V35A 3SN1A 3LBOA 1W9PA 3CV6A 1GOKA 1JXJA 1GTEA 4ZFMA 3EXTA 4IP7A 3S2JA 3UPMA 1QW9A 2CETA 3UVAA 3T4CA 1QWKA 1TV3A 2BX7A 5IFPA 1SJCA 3TAKA 1XPGA 1LP6A 3E6EA 3WK3A 1Q6QA 1I45A 1QJWA 6XIAA 3RX3A 2WSRA 3VD3A 1K8YA 1XIDA 3APTA 3OODA 5HWJA 1DL3A 4OGZA 3CHCA 4B16A 5RUBA 1ITUA 1B2YA 1LWIA 1KD0A 1NDZA 1KBKA 2ATMA 3IV8A 3AOFA 3F4DA 3ZT7A 2VJXA 1I0DA 1X8FA 1P0EA 2P10A 1W3NA 1R87A 1F07A 4XWUA 3SDOA 4DJFD 1HUVA 4ERAA 3BAKA 3N25A 3ARWA 4PTNA 4NHVA 2FGLA 2TSYA 4Y9AA 3CHFA 3KHJA 2X1SA 3W1AA 5AY7A 2J79A 3UCCA 2QCCA 4QLJA 1S2UA 3ZMRA 1OT2A 2VEGA 3VDGA 1FWHC 2WC7A 4XAGA 1HP4A 1KTCA 3NQVA 3G24A 1IXOA 2Z2AA 3IWPA 5BNKA 4DF1A 2R1PA 2CXGA 3SCWA 2PFHA 3PTKA 2R1MA 4CNTA 4S2BA 3V3WA 4UNKA 5HANA 1UA7A 3CQHA 2HCVA 4QISA 3C0JA 4GUGA 5AHMA 3BAWA 4D6HA 1DJGA 4A29A 5GQBA 4H8HA 3CGTA 4DQWA 4UMAA 1NWTA 4UUIA 2Q6ZA 1JDDA 5E0FA 1VEMA 3BVJA 1AFSA 2QCFA 3W2NA 3H2NA 1U22A 2ISWA 2ZKMX 1JIBA 4NL1A 2Q09A 3VD7A 1HN1A 3G1SA 2CLOA 1LLOA 1UUMA 3C6CA 4EANA 3J7HA 3L0NA 2J27A 3BJFA 4DNMA 3B40A 4MB4A 3BLPX 3M0MA 1HKVA 1YHTA 1SZEA 1JFHA 1MI3A 3B4YA 1E6PA 4XVDA 3H7UA 1D3GA 4FEZA 3CWNA 1B3VA 1E9YB 2OELA 2RDWA 4WDTA 3ITOA 3VCCA 1OC6A 3CASA 5ABTA 1R9ZA 4UTTA 3ABZA 2GSHA 3CAQA 4GUFA 5XINA 4DYEA 2X7WA 1XIFA 4GNVA 1PWMA 4QFUA 2HS6A 4CNUA 1FP8A 3R8RA 3W74A 3E5BA 3WMBA 2IQDA 3G1DA 1XUUA 3W0KA 4MKSA 5A6TC 4QRNA 4QBXA 4QG8A 3OZOA 1QFEA 5LA2A 4MZ1A 2IXUA 5HOSA 5EMMA 3AIQA 1L8PA 1PIFA 4CU8A 2A7RA 4IPIA 1E1CB 3RG6A 1SJDA 1C9WA 2PDPA 3CIVA 1KRCC 2UY5A 3PPCA 1VFFA 2NUWA 3KRUA 1SGJA 3TNBA 3SCOA 3GHSA 2YX0A 5E9AA 5AVNA 4FLQA 2XWDA 2DT2A 2DJXA 2DQXA 1HG3A 5FF2A 4A6GA 3QHNA 2GSEA 4GGBA 5GPRA 2XG9A 3C8FA 1EGMA 2I57A 3WLPA 2PDWA 5FL1A 1ZP3A 2YB4A 4KETA 1CXKA 5A5WA 3PZMA 2HE8A 2VGFA 3ZQ9A 1GT8A 2YZ5A 4BA0A 3P0WA 1OGSA 2VO5A 1EH9A 3O07A 3TYDA 4DPQA 3BARA 4LUYA 5TNVA 1HKIA 1QI3A 2BHUA 1FKWA 1VPXA 5DCDA 1NOWA 3WJZA 5F2IA 2VMFA 5HINA 3QPYA 3LTSA 4UMCA 1OADA 4PE8A 2ZA2A 3WLLA 4J3VA 2OG9A 2WVVB 1FWNA 3UWUA 1KWGA 3VCRA 4P7RA 1YQ2A 4AZGA 4YL2A 3TC6A 2PF0A 1PTDA 3LPPA 3V0SA 4GFSA 4GABA 3MZ2A 2VZSA 4YXGA 5BOFA 1Q6FA 4A3UA 4JDBA 1WKEA 3E74A 4JTEA 4LBSA 3WBWA 3HF3A 6A3HA 2VRJA 3DESA 3B0XA 1H2JA 2B81A 1DWFM 3HG3A 5CH9A 3SIZA 6ALDA 5I7GA 3DXIA 4GI9A 5FJOA 1NF7A 1V7YA 4XD3A 5JIWA 3CTLA 5C9UA 2VC6A 2ZZ4A 4U3AA 1AG1O 2EPNA 3VAVA 3TROA 1IE7C 4U3CA 3DIPA 1UPPA 4JNZA 4HZ6A 2QUVA 5AYIA 2E9LA 3ONBA 5HWMA 1GQJA 4JKKA 4W4QA 1Y65A 2A1YA 3SQSA 3W7QA 2EPMX 1BTMA 1UQYA 3N9SA 5K9XA 1KW1A 2GJPA 4UOZA 2GJXA 1SZNA 2HZGA 1AZ2A 2W91A 5DANA 2XHYA 2WLYA 1MW3A 2QMJA 4N0RA 3CUGA 5A8QA 3M5YA 5EKYA 4Q8TA 1FXQA 3WQGA 3KTXA 4JNMA 5CPLA 1E3ZA 4X61A 4AX6A 5DBTA 1DJYA 3GXPA 4NX0A 1TJ2A 4O1BA 4O4VA 4MKVA 5CPSA 3TLLA 2QKFA 1WKYA 4XAFA 1VBGA 4LUSA 2Y1HA 3VGBA 3CUXA 3VDCA 1ZALA 2QMKA 4MNJA 3IANA 1R47A 1NJJA 1L6WA 2FVLA 2B0MA 1FH8A 4LYPA 4I8YA 3A21A 1XC4A 3NSNA 1BKSA 3BC9A 4AMAA 3G0UA 1VJSA 3U8GA 3DBPA 1F73A 1P6BA 1S2TA 4QG9A 1EP1A 3HMCA 4MIMA 4OTKA 5BXSA 4IGMA 3FJNA 4Y9PA 1ZJAA 3G1HA 3BG5A 1JFXA 3UFYA 5EMJA 4WVXA 4ZTYA 4E6MA 3N4AA 2YR1A 2ISVA 3PBUA 2Q3RA 2BB0A 1DHKA 5A8MA 2UY2A 5H1WA 1OC5A 3LY0A 3VYLA 4AXKA 5FF7A 4W8LA 2WXDM 3B8DA 3VZZA 4PCNA 2D2GA 1KRMA 2GGJA 2B7PA 4CQ8A 3D3FA 4GXMA 1AD4A 5GVJA 1F9CA 5AZ1A 1UKTA 2VFIA 4QAWA 5DT7A 5CSRA 3R79A 4C6LA 3CZJA 4CD5A 2NV1A 3MZNA 4NAFB 5EBUA 1E5NA 4H83A 1TQXA 3WL1A 3LTYA 4H04A 2YL9A 3RX2A 3U48A 2D1ZA 1YBQB 4NT0A 5HNNA 3GVQA 4MOZA 4F66A 1WE5A 5LIWX 4S23A 4ZB0A 4B3ZA 1CXIA 1FDZA 1G4PA 2GQ8A 3WKZA 2PB1A 3KW3A 2P53A 4GZ7A 4Z2KA 3QKEA 3IVSA 5FF0A 1JR1A 2Y88A 1TPC1 3AS2A 2BNJA 4ADTA 1V3MA 4RXFA 2G96A 4KMQA 2VC5A 5FJJA 2V5BA 3OGSA 2WC4A 4X2PA 4HHHA 3SUWA 2XVPA 2J7DA 4B90A 2BTMA 5CQ1A 2E5DA 5AC4A 3SEPA 4OOUA 1TE1A 4H8VA 2E40A 2W63A 4Q8MA 4WXZA 5AYYA 1J5SA 3C5QA 4UTIA 4CU7A 2X16A 4DZIA 2CHRA 5J04A 4IFKA 1JF5A 3NQAA 3G8EA 6TIMA 3F7JA 3GZ3A 4BZYA 1O12A 5I3IA 1ZAIA 1O4UA 3P0XA 1EC9A 4ZSUA 2V3FA 3R43A 4NVTA 2R94A 2ZDSA 3UY8A 3VOGA 4O53A 2QYGA 2QCDB 1NELA 2BOFX 2F2HA 4ZGYA 3M0ZA 4YYCA 1TR1A 3PUDA 4NZJA 3NPVA 3TR2A 1CX9A 4JEJA 3L4YA 4A3RA 2AGKA 2QS8A 4WQ6A 2E68A 3B04A 4XIMA 4MF4A 2WMGA 3ZLGA 3DU0A 4Q33A 1A5CA 1UZDA 4DZ5A 3RO8A 1CYGA 4GVHA 1E0XA 4QLKA 4UQCA 2OPJA 5C71A 2QAPA 4ENLA 3A4AA 1TIWA 1O7AA 2QLYA 3L2IA 3VIHA 1S5TA 5GNXA 1GVQA 2BP1A 1QI4A 2OZ3A 1Q7ZA 2C0AA 1DIDA 4HQVA 3RPDA 4GC4A 2GVYA 1KNWA 2PP1A 4H9YA 1Q85A 1H7OA 4A22A 4CVUA 4IIGA 3PWAA 3WFZA 1PKYA 5AHIA 3EGJA 2W4XA 1WB0A 1QPQA 4PBEA 4LC6A 4NIRA 3RN6A 4ERGA 5CJMA 1UHVA 1XGZA 4NF7A 5CZKA 3WQFA 2A6LA 3LGGA 2IPJA 3ID7A 1GQNA 5FJIA 4PH6A 2NV9A 1EFZA 1ODZA 3LEPA 3LCIA 3HM7A 2C3ZA 2G3IA 3FKKA 1Z6KA 1CXFA 4O0KA 3UA4A 1OIMA 1RV8A 2W6RA 5LHFA 3H4GA 4KKXA 3WH9A 1D3CA 2XZ9A 2ZADA 4GISA 3WUFA 4JFSA 4P7QA 3U3HA 2X0HA 3TK7A 1UJPA 3KOFA 2W67A 2X30A 3ANYA 3V18A 3UNTA 2BASA 3TTQA 4F2TA 2D23A 1H41A 3UG8A 2DZPA 4FSAA 2ZXDA 5FEWA 4IL0A 3N2XA 4AZCA 3ZVHA 4U31A 2DZVA 3WQDA 1OSEA 3O6YX 5I3HA 5HR6A 3CWOX 4W89A 2AOSA 1MQQA 2YL6A 5CPOA 4DI9A 3CIWA 3S9ZA 4MG4A 1JCYA 1WV2A 2CWXA 5HDRA 3WBAA 2Q8ZA 3V0UA 3IIZA 3WK1A 1EWDA 4YVVA 1B3OA 3E2QA 3VDBA 1EC8A 4BKNA 3EX6A 2ZQ0A 4AYGA 2WJDA 4M6QA 4Y9MA 4GBDA 3KE0A 5C9WA 5GJMA 3W9ZA 1O5KA 3MJMA 4NJHA 3OTRA 4WOQA 1LG1A 4LOCA 5C55A 1W3TA 3JW7A 3SUTA 4OVXA 3PM6A 1TYGA 1K8ZA 3SECA 3BG3A 3WUBA 3EX4A 3R0KA 3WY1A 2VRQA 1H50A 3H53A 3JR2A 3EA1A 3YPIA 3OVRA 2OVLA 4MTVA 1VRXA 4DJDD 3LM7A 1J4EA 3E3HA 3MC5A 1ADOA 1LRNA 5I6SA 4NILA 2D20A 4S3FA 2Z1VA 2OYMA 3PBWA 3GDBA 1NTHA 5D9MA 4FLRA 5LSMA 4IG2B 3AJ7A 3S42A 1GZ1A 2FGBA 4BEUA 3CL8A 1EJUC 3H54A 2XM2A 4IGSA 3I7SA 1AL7A 4M8UA 1GONA 1YKWA 1LUCA 4FPSA 3LRMA 1HO4A 4PMXA 5AB3A 1ODUA 5FA5A 2GJRA 1BTCA 1FWFC 4GJJA 2XSXA 1WDQA 3WELA 1G69A 5LIUX 1A53A 2HROA 1QHPA 3VIKA 4DB7A 1C9DA 1MQPA 5BOEA 1WDSA 2OEMA 2PWUA 3QYQA 5JBDA 3UJSA 3PUOA 4M1BA 1KBIA 1C8VA 3KP1A 3SN4A 1LOSA 3MKKA 3KRBA 4AU0A 2Y7FA 4NZ3A 5C9ZA 4LANA 3B03A 1TPUA 3ITLA 4BWLC 3LN3A 1L0PA 3R11A 4GKLA 1BRLA 1XCWA 1K6AA 3PSVA 4W8BA 3OIXA 1R9XA 4YMZA 2EJ1A 3FGCA 4GA8A 1EF3A 4DI8A 2QF8A 5DBUA 2WV8A 3MMUA 3T8LA 1GG1A 4IICA 3JVAA 4IPLA 1KR0A 1VCGA 1OYAA 2V2HA 3NQGA 3AIRA 5JVLA 2DSKA 3WD1A 1PTAA 1RVGA 2OT0A 4UTWC 4LF2A 4Z2JA 4AG0A 3DFHA 1IWAA 1V03A 3B06A 2VD9A 1A5SA 1UKSA 3WQEA 5I3GA 2YKKA 3D5HA 3I3EA 4CD4A 1LYXA 3ME3A 1CGWA 3FDGA 3ES7A 3SY1A 3ZT5A 1CPUA 1XLKA 3TN3A 1PL9A 2A85A 4PYSA 4JTCA 4KEMA 1U30A 1HQTA 2V8ZA 3CM4A 1E0WA 3ATYA 2E3ZA 2J8GA 4B4HA 1E3XA 3KCOA 5B80A 1GOWA 2B31A 3RMJA 1VYRA 1XYZA 3W28A 4IOTA 4REQA 3GTHA 4YHGA 4I7UA 2J7BA 1K77A 4FNUA 1MZRA 2VHLA 3SURA 4LW7A 2GOKA 4RDYA 2WW5A 3GD6A 4H9XA 3AIBA 4IJBA 1FWRA 4H9UA 4UQBA 4EF8A 2G97A 3C3NA 3QQ0A 3SCTA 2CZ5A 2IW0A 3WQ5A 5A6LA 4AF0A 3RR1A 4AFYA 4TXEA 1G9HA 1XP3A 4UFKA 1X6LA 4P61A 2A6NA 3HMJG 1I1XA 4GBUA 1TMHA 4AIBA 1PEZA 3HJEA 2CWNA 2WJEA 4YS1A 2CFFA 4YWIA 3EOSA 1EJXC 3RXZA 3UYCA 2D2OA 5A6AA 3URBA 4P8UA 4OT7A 4Z1CA 4AHPA 1R30A 3TFXA 4TOQA 4JQ4A 1XUZA 2QCHA 3PZVA 1JZ2A 1AODA 3IVTA 4ROQA 3CYVA 2WNQA 3RMEA 2X2GA 3VIIA 2FTYA 3S6TA 1W1PA 4FNSA 4R7OA 3IUHA 4KEZA 2DEPA 5IDZA 4LV9A 2DZBA 4PMRA 2VDGA 1QU4A 4H6QA 2BVWA 2CYGA 3WG6A 1QO2A 5D04C 3UVIA 1YX1A 2VZUA 1Z32X 2ZX5A 4MADA 2XU2A 4DNHA 2Z00A 1Q6GA 4LALA 3GC5A 1P1MA 4JEQA 2A5HA 3G2GA 3IJ8A 4HHLA 5AYXA 5PTDA 2PZ0A 4MB5A 4J3XA 4FX6M 3NO1A 1ZSXA 3CHVA 3DYPA 5ABHA 1TX2A 1HXJA 3N14A 2O56A 4J5NA 1TV4A 4UTMA 1KFLA 3UERA 1JDAA 1ZU8A 4UFJA 4LXFA 4XTIA 3QLLA 3O6DA 2D3NA 3MVTA 3W1NA 5AHFA 1EPVA 5E6YA 3UA3A 3UQNA 1SFTA 4JXCA 1EP3A 1FUYA 1OHLA 4WY0A 4H8UA 4UQDA 4O1CA 3GKFA 1TWWA 4P00B 4LS0A 4TIMA 2DDXA 3OVGA 3VXGA 2JBMA 3HB9A 1CENA 4HOWA 1UASA 1DHPA 2VENA 3S2NA 3LCWA 3S5YA 3T0BA 3HG2A 2JEQA 1Q2RA 1HJSA 1H61A 3AYTA 1KWKA 2J9YA 3LK6A 1JDCA 2OZ0A 1A5LC 4PSPA 1Q6LA 1WOBA 3B0VC 3MMTA 5A6BA 1NIUA 4Q8OA 4GQQA 4DIAA 4FP1A 3M9YA 5CXPA 3C2FA 2X42A 3BJSA 3HQOA 3I7RA 4ZZ9A 4BWLA 5HK4A 2HK1A 4K7VA 2CZFA 4MPQA 2V5DA 2R6OA 1SO6A 2HVOA 4AIEA 3LQGA 2W9MA 1EUNA 3L7RA 4PUUA 4PZVA 3NUKA 2ZRXA 3NSMA 1UBSA 4C6OA 2XWEA 4BS0A 2V30A 2ZTJA 3TH6A 2XYLA 3C2RA 3MBFA 3LLXA 1YDYA 3U9IA 1TV2A 3WBXA 1B5TA 1ZB5A 3QHMA 1T7LA 4CCEA 4UTWA 4R33A 4NYUA 3KBJA 4RR4A 2RDXA 5CEWA 3O06A 4WKAA 3NO3A 5EB8A 3TV8A 3SRHA 1WUEA 1RBLA 1XI3A 3R2GA 3TOPA 1BYAA 2XPKA 4UWMA 3OVPA 3HGOA 3RHGA 1JG9A 3I3BA 3ZJ7A 4AVNA 4O57A 4RV3A 4DO5A 1VHNA 2VI0A 3R58A 3LD5A 4IIDA 5FAGA 3QR3A 3HJZA 3AC0A 1MRAA 3A22A 4PC8A 1X98A 2EO7A 1RY0A 1O5XA 4O17A 1XIBA 1M41A 1EBHA 5D8WA 1QDSA 4YTRA 2ZZ7A 4ML9A 1FWTA 4S39A 4KRZA 2CPUA 4JTHA 1V6TA 1NFBA 4WXYA 3UGVA 1TWDA 2AAMA 3KZPA 2J4GA 1KLYA 3CUZA 3M0IA 4YN5A 2RAGA 5HATA 4X0VA 3G1XA 5HQLA 3LHUA 3QBUA 4OUEA 1FHVA 1KGXA 2R9RA 3NOEA 3D0CA 3I7QA 3CQKA 2ACRA 2BGSA 5AHLA 5REQB 4MMWA 3DFSA 2WMIB 5E6ZA 4ZSTA 3RJXA 1V3JA 2MUCA 1WO2A 1XLFA 1VFUA 3UCQA 4AIUA 3T0CA 3SQLA 4C91A 3LBCA 2E6FA 2HV5A 3W81A 2PP0A 1W1ZA 5CG0A 1V3IA 2JGQA 1JCMP 2CLHA 3I3DA 3L4ZA 4GPNA 7TIMA 3OU8A 3FVMA 3N19B 1KGUA 3S6DA 1IIHA 3PZUA 3NDOA 4ZO8A 2XN1A 1X7IA 3ENLA 5F2GA 1KQZA 3RGTA 5DMMA 3M0VA 1AH3A 1T41A 3IARA 3BOLA 1EDQA 5D9PA 2QGHA 1NY1A 4G2DA 1ONWA 2OMAA 1HT6A 1EJSC 1IXQA 4QP0A 3LHTA 2CIPA 3TOYA 8XIAA 5D09A 4YCPA 2PC8A 3EWCA 2DUZA 2PGRA 4DN1A 4PRWA 1EDTA 1A5BA 1A80A 1W8GA 2CERA 3E96A 1ENUA 1SSGA 3C2EA 4AZ6A 4NG3A 3A9BA 2Y24A 2QR6A 4POCA 4L4OA 3C3UA 4Z2HA 1LQ0A 1CGYA 1H63A 1XKYA 1I2NA 1LDCA 3MCOA 1BEUA 4XK2A 2VDHA 2OX4A 5KZ6A 3SM0A 3L4XA 4OU1A 1RLCL 1ZAJA 1RCXB 4NJKA 1XD1A 3BPWA 3VE9A 1AJ0A 3SGGA 1X39A 3KDOA 5CLWA 3SUVA 4U10A 2PE4A 2G3JA 5A6KA 3QH2A 3CPRA 5A2AA 2CZDA 1KXHA 4Q32A 5FIPA 1XINA 3G6LA 1WA3A 1E1CA 2PDQA 2XVNA 3RPTA 4IT1A 2ZRYA 3G18A 2HVMA 4J27A 1Q6RA 3E02A 3KAOA 3AQUA 3GNDA 1KKOA 2VZOA 2V5CA 1OK6A 3BQ5A 2X0SA 1GJUA 1UR2A 3DX5A 2E7FA 1CIUA 3HPAA 3OLIA 2AMXA 4DY1A 1H11A 1X7FA 2RFGA 3FEQA 3P3BA 2PS2A 4LVGA 3W2LA 3THCA 3AMDA 5KZDA 1U83A 2XDFA 1K7FA 1YXYA 3R25A 1A5OC 2EKGA 1XF0A 4GVGA 2EPOA 3TQVA 4Z42C 7TAAA 3TEVA 1ISYA 1KO0A 3OB8A 4QS5A 5DMNA 3S2MA 3ZYZA 2WVVA 4GINA 3R5EA 3QTPA 1XSJA 4XSLA 2GGGA 3DFPA 1Z8AA 3MI6A 2Z6JA 1ZZMA 4GMEA 2YZRA 4C60A 4RPQA 4YWSA 3MI3A 4FNQA 2DGAA 3H2EA 3QYSA 5A1AA 3EA2A 3W76A 1CXLA 3HGRA 4L1XA 3N13A 3WBEA 3IJQA 4E0CA 5I78A 2NUYA 7ENLA 4PA8A 2X1TA 3BZJA 3I65A 2HS8A 3RITA 4HK5A 3PBYA 4D71A 2XGZA 1TJ1A 1LBMA 3OG2A 3SRDA 8RUCA 1KR1A 5K9CA 3AZRA 2OQLA 3KDNA 4PTWA 4L64A 5DXXA 2VZVA 1YYAA 3N2TA 5A8PA 1WXYA 4JS3A 2A3CA 2Y62A 4RUBA 3W71A 2GUUA 3TE9A 3TP4A 1YTKA 3CYJA 5FCZA 3P82A 1HO1A 2PWDA 3GDTA 4FK9A 3L68A 5LGXA 1DTUA 1J0HA 5A6MA 2YXXA 1WXZA 2HBVA 1QW8A 3CUFA 1AW1A 1LQAA 2YB1A 1NDWA 2YDQA 2CCRA 3HPZA 4CN4A 2C18A 5F1UA 4S1FA 3W73A 4XZMX 1QNSA 3NL6A 4GD0A 2VNCA 1JDFA 4KWSA 3CL6A 2NWSA 4F2BA 1PTGA 1HKMA 4JIEA 1E4IA 3KVJA 3DC8A 3FSUA 1G6CA 2Q8XA 1M1BA 4EPKA 4A05A 5ECUA 4LV4A 1QBBA 4ZVJA 4DJEC 1OWQA 2ASHA 3GWQA 4C90A 1D8WA 4MY1A 2GJNA 1KM2A 2ZUNA 3L5MA 4R85A 1M53A 3BO9A 4NYYA 4RZBA 1E1FA 4IH3A 2FKPA 3GXDA 5F2MA 4CNPA 3NPXA 1UH2A 1W3KA 2WPGA 3E5PA 1PIIA 1VB9A 4XZNX 1QXLA 1MW0A 3ANVA 1PKNA 4C1KA 5CGQA 1F6PA 3N2CA 3RAOA 3LG3A 4DEFA 3V7PA 3VKCA 4XTDA 3W7LA 5FF3A 3C0LA 1A0CA 3QW4B 1V5XA 4TU1A 3WENA 4B5XA 1ZY9A 4ONVA 1AW5A 3C56A 4CCCA 3WEMA 4A8LA 5E0CA 2OGJA 1FWSA 5M17A 5LNSA 4B3LA 4L65A 3WL0A 4EACA 2REQB 3S1VA 4MJ2A 3E0WA 2OYKA 4IIHA 5KTLA 4AMCA 2X40A 5CGTA 2F2KA 3IK4A 2ZX7A 3VC6A 4PMNA 3Q58A 1EYWA 1XV8A 2PLKA 2NSOA 1CW2A 1NARA 4DBSA 5DRCA 3NA8A 3R10A 1F76A 4W5UA 4BI7A 3CEPA 3URAA 2GLKA 4NAFA 4TUFA 4QLLA 1GPWA 5HNUA 1POJA 4C6FA 2UY3A 3R0DA 1JCTA 3A23A 3M1ZA 3PTDA 1XC6A 2GUYA 1YBQA 1Q6OA 1EX5A 1NEYA 3CWHA 1FCVA 4XQ6A 2QVHA 1UD2A 5TF0A 5A8OA 1NQ6A 3S46A 5CJNA 3KX6A 5K7JA 3MT1A 4E4PA 4JHOA 3AHYA 3HO8A 4IUOA 4R88A 5A6BD 1J0ZA 4A8NA 3C2OA 2E5CA 1JCNA 3NZ1A 1Q2SA 4X2RA 5KZEA 4AWTA 4WJXA 2JKAA 1LWJA 4B2DD 1EOKA 4I5RA 3NZGA 4MB3A 3R8GA 3GR7A 2HEJA 4ZOEA 5I77A 3KWXA 3N6HA 3QFWA 4LS2A 2FIQA 3ZJ6A 1GJWA 1UD3A 4XBJA 1D9EA 3T0TA 3QY6A 2VELA 4ICCX 1GUVA 4IIBA 2QGYA 4LAMA 4QAIA 3SO7A 4HTBA 3OZYA 4IP4A 4QQ3A 1V6XA 3LXAA 3N18A 1TV8A 4DBWA 2BGQA 2CLIA 3WH6A 1R3QA 3IV3A 3QW3A 2JQXA 4QNWA 2XFFA 5DELA 3QHOA 1AK5A 3RCYA 2QCDA 4S3JA 3WDJA 3WQ8A 5IOBA 2YXGA 3B8UA 2PTYA 2D0FA 2QUMA 1KM4A 1R5YA 1R6WA 3KBSA 5T8GA 3HA1A 4O16A 1CDGA 1PZ2A 1UKQA 3BAYA 1A50A 1AJZA 1ZBCA 2VFDA 1FWAC 3CK5A 2NSXA 1DIEA 2G4JA 2OU4A 3W72A 1PB0A 4RDZA 4IGNA 2FTPA 4CQBA 4PB5A 1SFJA 1TX0A 4TQTA 1JGIA 3ABQA 4X22A 1CLKA 3SI9A 3TQ0A 3GXTA 2QV5A 3Q65A 3TQPA 4D6JA 3EOLA 2HBXA 4XV0A 4DJEA 1EEPA 1T6MA 3IJIA 2PBGA 1EJ7L