1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
4Z2GA 4MB3A 3TTYA 1AVAA 4B16A 4MNKA 5TD4A 4CCDA 1X1NA 4DUVA 2WW5A 5CZKA 1WAWA 3ALFA 5M5DA 2BFGA 5A8NA 3GNPA 2YA0A 4Z2HA 1CNVA 1Q6EA 2GFTA 1GNXA 1WDPA 4AD3A 4D6GA 5IXEA 2CIPA 2AOSA 3VIHA 4MDOA 3VPLA 2W63A 3VINA 1QHOA 2GVYA 4U5IA 1BVNP 4D72A 1ODUA 1Q6FA 1C8XA 4QLJA 3VGDA 3QOKA 3ZT5A 1XSIA 1E9LA 2J74A 3BAKA 5BXPA 4AWEA 1LLOA 4BS0A 4CN6A 4LYQA 2ZUMA 1XSJA 2RGLA 4QCFA 2CHNA 2Q8XA 5IHSA 3TTQA 4FLRA 4HOZA 4JCLA 1LL7A 2DT3A 4H41A 3TTOA 2J8FA 2CBVA 4U2YA 1NP0A 4PEEA 4PMXA 3CUHA 4YHGA 3B9AA 4W87A 4QFUA 2WZIA 2XYLA 2A3AA 4BQ2A 1DTUA 1PAMA 3ARQA 3DHPA 1GPFA 4D6FA 4UFLA 1X6LA 4OUEA 4Z2JA 1V3KA 3S6TA 3VO0A 5GQBA 1MQRA 4TX6A 1UYQA 1UH3A 1KR1A 3BH4A 1KWKA 1CDGA 4AZ6A 1A47A 4J3VA 3AZSA 3GTNA 1LWHA 3MO4A 2VCAA 3PZIA 4UTFA 7CGTA 1H5VA 3CTTA 2J7DA 2O92A 2WB5A 3AS3A 5A8MA 4UZUA 2IXVA 3ZJ7A 4TTGA 1PX3A 4XZBA 5I6SA 2BV9A 1CBGA 3N17A 1NQ6A 4AIUA 2HISA 1RPKA 1K9DA 1H41A 2DH2A 3POCA 4ATDA 2E9BA 5CJ5A 3K4DA 5HPOA 4AD4A 4J7RA 4DUXA 1UWIA 1FH9A 9CGTA 3AIUA 4PMYA 4P7OA 3CBWA 1KCLA 4OKDA 4V28A 3CZJA 2ZUVA 2YL5A 2Y8VA 4OJYA 5JBFA 3W81A 1NWRA 1V6UA 1W32A 3VD5A 3ARPA 1NH6A 2BVTA 4MDPA 2DEPA 2E8YA 5C71A 5E6ZA 1VENA 2D23A 3QOMA 4BF7A 4LYRA 5GNYA 4DWSC 2J62A 2YL9A 1W9PA 4HMEA 1KGWA 2ZX5A 1VF8A 2J4GA 2OSXA 1CGWA 2VZVA 4H8HA 4W84A 3GBDA 1QW8A 3CHCA 3UERA 3N04A 1R86A 3APGA 3BXWA 2BY2A 5A3HA 3NIYA 5BXTA 2VX7A 3AISA 3WMBA 3VNYA 1NARA 2BY3A 3CO4A 1OCQA 1HJQA 2YL6A 3IJ8A 4CD4A 1P6WA 5A8QA 4UR9A 4IISA 4QAWA 2GJPA 3L2MA 3VGEA 3L4ZA 3BSHA 1UH4A 4QCEA 1WZLA 4Q22A 4UOZA 3VGHA 1W9DM 2FHFA 1E4NA 4PSPA 4GQQA 4P8WA 2EXOA 1BHGA 1G5AA 1SR0A 3AXXA 4H04A 3THCA 4JL1A 2J7GA 2DPEA 1UWTA 3AHYA 4WKFA 3T2OA 2ZUNA 3MANA 1MFVA 1XD1A 4P8UA 2RGMA 3FW6A 2ESCA 3WN6A 3SIMA 1B3XA 2J77A 2WSKA 3VM5A 1QI2A 3SCWA 1OIMA 5AC4A 2Y8KA 4U2ZA 4M56A 1JZ7A 3WL1A 2WCSA 3BSGA 3GNRA 1CEOA 3TA9A 4HZ6A 2X0HA 3FNDA 5A8OA 2GDVA 1E4MM 1EOKA 4XV0A 4Z2KA 4XUYA 3UESA 4AIOA 3PZQA 1R87A 2W67A 1V02A 1KGUA 3CUFA 3WNMA 5JBEA 4WKAA 3WBEA 1E6SM 3AZRA 4A3HA 1ISYA 4UOJA 3ALGA 2PBGA 3U57A 4FLSA 3BCDA 3W27A 1B2YA 5A6SA 4DWSD 4MTVA 1DWGM 3W38A 3L4VA 5HOSA 1BYCA 4P8XA 1CXIA 1JNEA 4M81A 4MADA 3EDFA 4UQBA 2EQDA 1JG9A 4AY1A 4H8UA 1TCMA 4W7UA 2UY5A 2A3BA 3AMKA 3FXYA 1ZBKA 2YA2A 1K9EA 3CPUA 4UFHA 2XVLA 4DM2A 5IHRA 1DWIM 2J8GA 2EPNA 1NWTA 3UR7A 1BFNA 1HJVA 1HL9A 1BGGA 1E4IA 1C92A 1ZL1A 3OLEA 4B9YA 4CCEA 4X0NA 2VJXA 4HU8A 5A8PA 4OBRA 4MB5A 2ZXBA 3B9EA 1V6VA 1E56A 3ARRA 1GHSA 2XVNA 3CUGA 3RJYA 3RM4A 2WZEA 1UR0A 1OD0A 4PMDA 3PTQA 3BAWA 4XB3A 1F4HA 3AOFA 2WM0A 3GXFA 3GXIA 3PTMA 4CN1A 3T09A 2OWCA 3OLDA 2BHUA 4ZENA 2VX4A 4EANA 5E0FA 3T08A 2OYKA 3K8KA 2C8NA 1NM9A 5CG0A 3GBEA 1HKJA 4J3TA 2OWWA 5D9OA 4PMOA 4AEFA 4F66A 1JF6A 1KGXA 2QPUA 1GOQA 3ARWA 1E0WA 1E3XA 1W2VA 5HDRA 2VTFA 4JHOA 3VTRA 4JKKA 1NWSA 3N15A 1O6IA 2WANA 4NF7A 2WMKA 5D9MA 3RPMA 4AD0A 4IUGA 1C8QA 1MW2A 3W0KA 4HZ8A 3KE0A 1YHTA 1CXKA 2PC8A 3ZSSA 1E6NA 4PMNA 2XFRA 1C93A 2G3NA 3HN3A 3FAWA 1HX0A 1SMAA 4E2OA 5EFFA 1H11A 1QVBA 3GXDA 1CXFA 1QPKA 1EQPA 1W3JA 1BG9A 4F9DA 4H7VA 1E4LA 4S3KA 4HOWA 5A6LA 1KXVA 1BPLB 1CGVA 6A3HA 4PSRA 1W3HA 3FY1A 2A3CA 1OSEA 3SURA 3AXHA 1UG6A 1HT6A 1MQPA 3WF1A 1WZMA 5I24A 1TVPA 5JIPA 5C70A 3K46A 5IFTA 2VURA 1UR8A 3UG4A 1J0YA 5HBFA 2VO5A 2WVVB 1FHLA 4D6DA 1OT2A 4CD6A 4PBGA 1PZ2A 1MW0A 1V0MA 2F2HA 4TXEA 1UR1A 2GJXB 2CBUA 5E6YA 3OZOA 1MXGA 2WK2A 3NSNA 1US3A 1V6WA 2Z1SA 1GHRA 1E6XM 4JHZA 1E1FA 5LA1A 1DWAM 2J7CA 1B3YA 1DWFM 1JZ2A 2NT1A 3SCOA 3OGRA 1X6NA 5ECUA 1UA3A 2VOTA 5FIPA 2JEPA 2CNCA 2D22A 2WKLA 5I78A 1Q6DA 1V0LA 1JXJA 4UQEA 4AISA 4NRRA 3WIJA 4JFSA 4WKHA 1E72M 2MANA 1IT0A 1UR2A 3ARVA 1JZ4A 2J25A 2ZWYA 3NJ3A 4GO8A 1EO5A 3MUY1 1ZJBA 1RH9A 4JFTA 3DYOA 1KWGA 1GVIA 2FHBA 2QHAA 4WIWA 4WF7A 2NT0A 4CKQA 1E1EA 1JF5A 5AY7A 4W89A 3WF2A 5CQ1A 4X0VA 1KQYA 1GOOA 1UWQA 4M80A 1QW9A 4PUDA 3DHUA 4U3AA 5ABFB 3MS8A 1V0NA 1GZJA 3GH5A 2WAGA 1MWOA 3ZQ9A 1JGIA 1QI3A 1V3IA 1J18A 1EDTA 4A4AA 1K6AA 3M7SA 5CSUA 4CD8A 5CLWA 1CWYA 1HJWA 2O9TA 1Q6CA 3A47A 3AIQA 1W1VA 2ZWZA 4KH2A 4GO9A 1J0IA 1UWUA 4W93A 4LGXA 1W91A 1TMQA 1S46A 1ZJAA 4ZE4A 3PZMA 4TUFA 3BAYA 1IZJA 1HP4A 1R7OA 2VCBA 4L4PA 2D0GA 3U7VA 2E9LA 3A4AA 3T0BA 3O9NA 4J28A 4BQ3A 1GOKA 2WSPA 3MSGA 3BMWA 1B3WA 3WUFA 4B15A 2OSWA 3BCFA 4IM4A 1K9TA 2WHJA 3WD1A 4AD1A 4CVWA 5BCAA 1ODZA 2AAAA 3VMPA 5DF0A 3OG2A 1JYNA 3WDQA 1XSKA 5CSYA 3PZNA 3NYDA 4PCSA 4XZWA 2FH6A 3WEZA 4IPLA 4RE2A 2CETA 3ECQA 4GPNA 1JNDA 3ZR5A 3N11A 4CU7A 2EPLX 1VJSA 2D0HA 1L0PA 3AHTA 4AMCA 1W1TA 4GI8A 1UD5A 3VIPA 1JD7A 4M1RA 4ACZA 2WWCA 1E6PA 1B0IA 1UKSA 4LX4A 1GOIA 1TUXA 3W82A 1PJ9A 3N13A 1U33A 1W3LA 2ZX6A 2UY4A 4WLCA 2ZE0A 4D6EA 1VEMA 1UUQA 3AS1A 1XGZA 1ISXA 3L4WA 2X05A 2E40A 1AQ0A 4HP5A 1TR1A 4MJ4A 2CYGA 5A2CA 5I23A 3VIIA 1YQ2A 4ZFMA 4PMUA 1MXDA 4TOQA 3KZSA 4GQRA 3WQVA 1CGXA 3PZVA 4KMQA 2DSUA 3M46A 1CECA 3MMUA 1ESWA 5IFPA 5A2AA 2ZX9A 1E6QM 4AZHA 3AICA 2G4FA 1AQMA 4U5KA 2WMHA 1BLIA 2J47A 1VB9A 2VCCA 4LPCA 2BXZA 1XYZA 1KBKA 4Z2IA 4Z2LA 4AZGA 5A6MA 3WDIA 3DECA 3WBAA 1TA3B 2FGZA 4AZCB 2X8RA 1VJZA 3VIJA 3VKKA 4UCFA 1RD6A 1WKYA 5M17A 1VFMA 2J7HA 4PMQA 2IXUA 4LXFA 1HXJA 3WELA 2BHYA 5DO8A 1Q6GA 3WSUA 5HNNA 2FDMA 4HPHA 1PBGA 4QDMA 4V2XA 5FOOA 5D9NA 4PMVA 3N18A 1OGBA 3VOCA 4BQ4A 1W9BM 1NOUA 2W5FA 4MNJA 2WKGA 4HMDA 3I3EA 4W7VA 1B30A 2XFFA 2EPOA 1PIGA 5I77A 1UZ1A 3WFZA 4TVCA 1UH2A 2OSYA 3CHFA 3RO8A 1BYAA 3AHXA 2WNWA 2XVKA 3VIOA 1PPIA 3BAXA 3GZAA 2NW0A 1C3FA 3WH9A 4ZEPA 1CENA 4UFIA 2FHCA 2CPUA 3WUBA 4PUEA 2YA1A 5IDIA 1B3ZA 4PTMA 2V3FA 1GVYA 1EDGA 3KL3A 1WP6A 3OBAA 3WUGA 1M7XA 2ZXDA 4JIEA 1LF1A 2EPKX 3UCQA 3WF4A 3ZT7A 1ISZA 3WEOA 2YKKA 4AYSA 1VRXA 1W1YA 2BVDA 5FD0A 4HU0A 3PZGA 2GSJA 2WVVA 2PWDA 4U3CA 4DWSB 3VDBA 3AYRA 1H09A 5EFDA 3PN8A 2VZSA 4QLLA 5EB8A 5I2UA 1EQCA 1UWRA 3HMCA 2WBGA 1RP8A 2WHLA 3WDJA 3HJEA 3CZGA 2YL8A 4NSBA 3TP4A 3BC9A 2VVSA 2WVUA 3TTSA 4A3YA 1GORA 2YLAA 3A4XA 3AI0A 4M24A 1UWSA 3A4WA 3AMCA 3I3DA 4W85A 2DSKA 1J01A 2PBOA 5A6KA 3D5HA 3THDA 2IUZA 1HIZA 3MKKA 4HPGA 2XM1A 3W53A 4URIA 1E3ZA 2ZOXA 4RE4A 4DUWA 1FH7A 3W25A 3CMGA 1JFHA 3AXIA 3PZTA 1KR0A 2ZUWA 4C7DA 3RMEA 2XVPA 2VC9A 4PMRA 1MYRA 1UKQA 3CZ8A 2V3DA 4CD5A 5BRPA 1J0KA 2J7BA 3EDEA 4ATLA 1V3MA 2X0YA 4CGTA 5AYIA 1QBBA 3II1A 4C91A 3WQ6A 1ZBWA 2VZTA 2JF6A 1ISVA 3J7HA 1MW1A 4AEEA 1JL8A 1J11A 1GUVA 4PCTA 2G3MA 1ITXA 4UFKA 1Z32X 2V38A 1BSIA 3MSDA 1U2YA 3AHZA 4CU8A 2VRJA 3WH7A 3ZJ8A 1GJWA 1LL4A 4OOZA 5GNXA 4DWSA 2VQUA 1JZ6A 1GONA 4W8AA 1AMYA 1SMDA 1O7AA 1OGGA 2XM2A 2XSAA 3BAJA 5BWFA 2CXGA 3AIVA 1EH9A 3F5KA 4H2CA 2WCAA 3AIBA 2YOCA 3CHEA 2C7FA 1BAGA 2GDUA 4BA0A 4CN4A 2V3GA 3VGGA 5I79A 3AS0A 3UG3A 1VFUA 5D9PA 3HU7A 3KL5A 4GINA 3AIEA 1J9YA 1UD6A 1C8YA 5A6JA 3SUUA 1W3KA 3EDDA 2GUYA 3OGSA 3WY1A 1MVYA 3EMCA 1HNYA 1EGZA 5CPTA 1CXEA 2VVNA 5D8ZA 2WMJA 3DYPA 1ZB5A 4PTVA 4AZIA 2O9RA 1KXTA 1FH8A 5A94A 3VU2A 1B1YA 1VBUA 3PZ9A 3WQ5A 1HN1A 3RM9A 5CLTA 3WL0A 5ABHA 1XC6A 3WNOA 4W5UA 4JCMA 1H4PA 4NZCA 5A6BD 4EE9A 2XIBA 2DDXA 5JIWA 4TVDA 4EK7A 3WQWA 4CD7A 4M82A 1W9XA 5EMYA 4W88A 2WMGA 3WH5A 5BYWA 1EXPA 4YN5A 1LQ0A 3ZJ6A 1EHNA 3WH6A 1DEDA 3CZKA 2OWXA 3RILA 2DIJA 1FOBA 4EAMA 3ARTA 1R85A 3LPGA 3ARZA 3PZOA 2WHKA 4HA4A 1E73M 3SCUA 2DSWA 2EEXA 2A3HA 1ZBVA 4AZ7A 4EKJA 3ARSA 2WMIB 3T0DA 2YJQA 2CHOA 4FF5A 5BRQA 2G41A 3UEQA 3VD7A 1OB0A 1CGYA 2GK1A 3WNLA 3GH7A 1VIWA 3W28A 1J0JA 3GH4A 4D6CA 1W1PA 4HA3A 4GI6A 3NUKA 3MUAA 2DSZA 2D2OA 1R8LA 2QF8A 1VFFA 4CCCA 2XVGA 2WMIA 2VR4A 3RDKA 2VQTA 7A3HA 5LYRA 3SUVA 3U5YA 3VVGA 3AZTA 2B31A 4D6JA 1BTCA 3ZR6A 2UY3A 3FHAA 1KXHA 2GJXA 1LG1A 4MPKA 4R27A 2ZX8A 4AW7A 2PWGA 1V03A 3LPPA 3MUZ1 3CMJA 1E71M 5AYBA 4C90A 2CEQA 3OIHA 4JFWA 1QNOA 3CZLA 5DT5A 1H3GA 1OGSA 1ZBCA 5GPRA 2CITA 2VNCA 3DC0A 4UQDA 3SCPA 1HVXA 2F61A 1SYTA 2CKSA 3LPOA 4HOXA 4WSJA 1JXKA 2BHZA 4U31A 5AC5A 1L8NA 5CPQA 1JDCA 1E70M 1TE1A 1WNOA 1DHKA 1G01A 1XH2A 1GOWA 1CGUA 1J0ZA 1V3JA 2QV4A 2QMJA 2E8ZA 1WB0A 1V6YA 3UR8A 4FK9A 3G6MA 3VM7A 1UD8A 1JZ8A 2XFYA 3WQ8A 4D1IA 3WDRA 3U5UA 4C7GA 1G1YA 1V3LA 4KGJA 3GM8A 4OBSA 1TZ7A 1WO2A 1C7TA 3E1F1 1H49A 2XPKA 1JZ3A 4GXPA 2G3JA 2E9MA 1H2JA 3T2QA 1HJSA 3N9KA 2XG9A 1LG2A 5DFAA 1PEZA 1J10A 5ABGA 3CHDA 5DMYA 1C91A 2VRQA 3PZUA 1WDRA 4LYPA 1Y7VA 1HL8A 1TFVA 2JALA 3CIVA 3ZO9A 1E55A 1WZAA 3MU7A 4NI3A 4JL2A 2TAAA 8A3HA 2VZUA 1BYDA 5A6AA 2D3NA 3NSMA 1GQIA 1IZKA 1ISWA 3AIWA 3SCRA 2X1IA 1CIUA 4J3SA 3BLKA 4W7WA 2Y24A 4AXNA 1HP5A 2XJ7A 1NOFA 3WFLA 4H8VA 3T0AA 5A95A 1XHGA 1D7FA 3A6OA 4AD5A 4AC1X 2VZOA 3VD9A 3L4YA 5E0CA 1WDQA 2W4XA 2WC4A 3AQUA 3ZOAA 5I3DA 2BY0A 3WQ4A 4NRSA 3WF3A 1GQLA 3W6LA 1M04A 3VDAA 4JKLA 1XV8A 3RCNA 2CBJA 2J79A 1IV8A 2PWFA 2W92A 3WMCA 4ZXLA 2ZUTA 4W8LA 1QOXA 2DIEA 3OLIA 1FP8A 2DT2A 3PBGA 3ZM8A 4ATWA 1VBRA 3ZSTA 3AIRA 1G94A 3VNZA 2F8QA 3FHQA 3LMYA 4B3LA 4YPJA 3K4AA 3AFBA 1I75A 3MUIA 2EPMX 4LQ1A 1DWHM 1GCYA 4TX8A 1QBAA 4PN2A 1XCWA 3CH9A 4ML4A 1CGTA 1V0KA 2WHMA 2JEQA 3ARYA 3WDPP 1CZ1A 2D24A 3A3HA 2WLYA 3AROA 4B9ZA 2CKRA 2D3LA 1GOMA 2PF0A 1J0HA 3AYSA 4P7RA 1CLXA 4PYSA 2VX5A 5FL1A 1B3VA 4M8UA 1LJYA 4ZXOA 1E15A 2ZXQA 4HTYA 3VIFA 5HXMA 2DT0A 1UD3A 2BY1A 3AMLA 3MMWA 1B90A 5FL0A 2CBIA 4W8BA 2DH3A 3SCQA 1BF2A 5FKYA 3IJ7A 1K9FA 2C0HA 3WD4A 3OZPA 1XYFA 1VEOA 4MAVA 4PMZA 1OM0A 5JBDA 2PWHA 4JFUA 5FCZA 4R5EA 2W91A 1UOKA 2WBKA 3SUWA 2FGLA 4BZYA 5BXRA 2WVSA 3IJ9A 3F5JA 1V3HA 4WJXA 1HJXA 3TONA 2X2YA 1B31A 2VL4A 4ACZB 3WD3A 1H0IA 3KL0A 3EDJA 2WCGA 3DYMA 1HKMA 2XWDA 2Y5EA 1A3HA 1XD0A 5A69A 1UA7A 2BNJA 2DQXA 3F4VA 1CYGA 2VUYA 3WDHA 3FAXA 1OINA 2DT1A 2OLHA 8CGTA 1J12A 5E70A 1VEPA 5D4YA 1ZU8A 1ZS2A 1JI2A 3PHAA 1D3CA 2BVYA 1E6RA 1JYXA 1BVZA 4E8CA 5F7UA 3GYCA 2D20A 2O9OA 4JAWA 4GKLA 3QHMA 2E0PA 3VILA 2UY2A 2EBNA 1H1NA 4PTWA 4W5ZA 4D6HA 3KWXA 2WLZA 2EO7A 4L4OA 1XCXA 5EBAA 3WNKA 3EYPA 4IPNB 3EBVA 7TAAA 2DGAA 4P7NA 4C7FA 5BROA 4MB1A 4X9YA 4OOUA 2E3ZA 3VMNA 4AZCA 1CXLA 4Q7NA 1LWJA 5KZ6A 1HF6A 3WMSA 1HVQA 4P8VA 3SCSA 1RP9A 3D3AA 3WNNA 4FLOA 2WMFA 3K8MA 1H0GA 4N42A 2J78A 3EDKA 1EA9C 1XH1A 2A3EA 2OYLA 2GK1B 2PI6A 3L2LA 1XH0A 2YDQA 2YDSA 4W86A 4YHEA 1HKIA 2W62A 4MNLA 2CCRA 2XTKA 3WEMA 3N12A 1I1WA 3S2CA 2XGBA 3NDYA 4QLKA 1QHZA 4KGLA 5M3WA 1PX8A 4CU6A 4XX6A 1QI4A 2PB1A 1UKPA 4K68A 1NWUA 2W66A 2DSVA 3SCVA 2CESA 1US2A 4ACYA 1BQCA 2YBTA 2ZXAA 4J3XA 1UQZA 2BS9A 3BGAA 2QLYA 5C8BB 3L4XA 4JFVA 1MQQA 1QNSA 3WF0A 4D6IA 2WYSA 4GI9A 1CLVA 2XIIA 2ZIDA 3VD4A 3SCTA 3ZJKA 3KEHA 2D1ZA 2VRKA 4JKMA 1JAKA 3ZMRA 1FA2A 2JFEX 1FHDA 1NP2A 3IANA 3WD2A 4TVUA 1JDAA 4J3UA 3EMZA 4Y7EA 2FH8A 2WC3A 4OZOA 1WPCA 1R7AA 3CGTA 1ECEA 1FP9A 3L4UA 2XSBA 2BXYA 3JUGA 4U33A 4AIEA 3M07A 1MW3A 5LA0A 1BG4A 5A6BA 4MAZA 2VX6A 4UFJA 4WK9A 4PRWA 5CPSA 1VFOA 3SEPA 2D0FA 4KRUA 3AJ7A 3CUJA 3GXMA 4WSKA 1GJUA 4HZ7A 4UQAA 3ZIZA 1AQHA 1FFRA 1NOWA 3OGVA 2O9PA 3AMGA 4MB4A 4ZE5A 2WC7A 3O6AA 3OA5A 4BCEA 3VGFA 5A1AA 3GDBA 4RL3A 5I0DA 4D1JA 2JIWA 2WXDM 3L4TA 2YIHA 1V02E 4UQ9A 5D8WA 4DM1A 3VIGA 2VI0A 4J27A 5LA2A 3T2PA 1CXHA 3CLWA 5DEZA 4OIFA 1W9VA 3B8SA 4AD2A 3VIMA 3VDHA 1BGAA 2XHYA 3BAIA 3SCNA 3W6MA 4P7QA 3TOPA 1KCKA 4CUCA 4V27A 3VUPA 3WKZA 3CUIA 4MJ2A 3POHA 3CZEA 1UQYA 3G6LA 2QMKA 5JUVA 1PZ3A 2XWEA 1UR4A 5E9AA 3WUEA 1CPUA 3ARXA 2XUCA 2PWEA 1HKKA 3O2LA 1QNRA 4F9JA 5ABFA 4B3KA 2CERA 5I5RA 1E40A 1U30A 2JIEA 4E8DA 1TA3A 1EO7A 4UQCA 3VMOA 1UD2A 2V3EA 2ZX7A 1UHVA 4GZIA 3AMDA 1CTNA 3NSXA 1C7SA 5E09A 1WCGA 3MV01 1E0VA 3OLGA 1UR9A 4D71A 3W37A 3UETA 3MV11 1KB3A 3SUSA 1VAHA 1G9HA 3QHNA 1PIFA 5CGTA 1E6ZA 1FFQA 2J7EA 1V08A 3MMDA 3M6DA 3PTKA 3K8LA 2EJ1A 3VX1A 1M53A 3I3BA 1ITCA 1UKTA 4E4PA 4GZEA 3SUTA 1GQKA 3RIKA 5KEZA 1JI1A 1Q4NX 6TAAA 3ZT6A 3ARUA 3B9DA 1PX4A 1EHAA 3EMQA 2WVTA 3BMVA 3VX0A 1DWJM 1UZ4A 1E5JA 3IK2A 1E43A 1HJUA 1LL6A 1JYWA 4KWUA 4S3JA 3U7BA 4PTXA 1KFWA 5DT7A 2NSXA 1E5NA 3IAQA 2ZUSA 2VR5A 1EIBA 3BLPX 1BYBA 4RE3A 1M03A 5GNZA 3W4RA 1QI0A 2VT0A 3RM8A 4MNMA 5CXPA 1M01A 1JFXA 1JIBA 3AS2A 6CGTA 2E4TA 2YDRA 2YBUA 1JZ5A 1UKOA 2X09A 3OB8A 3W29A 5BXSA 4FLQA 4F8XA 2Z1KA 4BQ5A 3F5LA 3WH8A 5A2BA 1QHPA 4KRTA 2XGIA 3QGVA 4AZ5A 2ZICA 2QPSA 1OWQA 1OT1A 4JZ5A 3WNPA 2YLLA 1QNQA 1GQJA 3LPFA 3WD0A 1QI5A 4J3WA 1WDSA 1SFSA 2J7FA 2GJRA 1DP0A 1TVNA 1WZKA 4GZJA 4CVUA 4F79A 4P7LA 3VGBA 3QHOA 3AHVA 1D2KA 2J75A 1JYVA 1TG7A 3W26A 2Y2WA 1UD4A 1C90A 3UG5A 1G0CA 2W61A 2WWDA 2ZUUA 2AMGA 1OD8A 1WE5A 1KBBA 1EOMA 1E0XA 3NDZA 5HPCA 2HVMA 1JAEA 3WENA 1MFUA 1KXQA 4QP0A 2UWFA 1JD9A 2JF7A 3W24A 1OIFA 1B9ZA 5CGMA 1OBAA 5ABEA 2WZHA 3FN9A 2OYMA 2G8ZA 1F4AA 2VMFA 1W2PA 4UOQA 3IAPA 4UFMA 1N82A 4N0RA 4AZBA 1KQZA 4TTUA 3VIKA 2G3IA 1V6XA 4GIAA 3QR3A 1QNPA 4HA1A 1EDQA 5M03A 1GW1A 1I1XA 1XRVA 3GNOA 4HMCA 1W9UA 3K1DA 2Y4SA 3NCOA 3VDCA 2WPGA 2JE8A 3RJXA 4FMVA 3VD3A 4UNIA 1JDDA 2V5DA 3N1AA 4M29A 4UZSA 2V5CA
chains in the Genus database with same CATH superfamily
3GUWA 4ALDA 4MB3A 3TTYA 4MYXA 4MNKA 3UR5A 3S9ZA 3G1YA 4DUVA 5CZKA 1TRDA 5EY5A 4LTSA 3GSMA 5A8NA 3M5VA 3GNPA 1VCFA 3A23A 2PURA 3CQKA 2PLJA 4Z2HA 1QMLA 1CNVA 1Q6EA 3QTGA 2GFTA 1O66A 3LD5A 3N2OA 5FJUA 2CIPA 2AOSA 3VIHA 3L9CA 2W63A 4AF0A 2XIMA 1BRLA 1TV2A 3APYA 5FF7A 3MWCA 4U5IA 4GABA 3F1QA 3TCEA 1EC9A 3W88A 3ZT5A 1E9LA 2PD9A 3EEGA 1JPDX 5BXPA 4BS0A 4LYQA 2ZUMA 1XDJA 4ZTXA 4IFOA 4QCFA 5LIUX 1F76A 4RZBA 2Q8XA 2QCNA 1ITUA 4P61A 1LL7A 3MJMA 5HUOA 1TYGA 2CBVA 1MUCA 4LUJA 3MTWA 4FX6M 4PMXA 2B7NA 4NQ1A 1IGSA 2CU0A 4IIBA 4YHGA 4ROQA 1G6CA 3O6CA 4R3UA 4NNCA 4LCRA 4PRTA 3LBOA 4A35A 1NFGA 1PAMA 4Z42C 3ARQA 1GPFA 7REQA 1R3SA 4GKTA 2FJKA 1UYQA 5HWNA 1UH3A 5LIXX 4AZ6A 4IX0A 4AY7A 2W27A 5FEPA 1T8XA 2CLEA 1LWHA 1ZCOA 4XZMX 1XLJA 1A3XA 1JDEA 4O10A 2WZMA 2WB5A 1HFBA 3AS3A 5A8MA 4G7FA 3W7KA 2ATSA 4TTGA 2XDFA 3OVPA 1PB0A 1YDYA 3B9NA 3FYPA 5AC8A 2HISA 2WJDA 4ATDA 3GW0A 5HPOA 4J7RA 4DYJA 9XIAA 1UWIA 1A4LA 1LBMA 1GKRA 4PMYA 1H1ZA 4US5D 3LDVA 3WLMA 4JTCA 4V28A 3A9BA 3STEA 1FWCC 2ZUVA 4DJFA 1BVWA 1FWEC 3QPZA 1P0NA 3H26A 3W81A 1QK0A 1WYIA 3LA4A 1NWRA 1V6UA 4JTUA 5DXXA 4D8ZA 1NH6A 3TNBA 3WCZA 3GTXA 5C71A 1XJBA 2WSYA 4CNPA 5E6ZA 1VENA 3NG3A 3QOMA 1KGWA 3TSBA 5LNRA 5A6TC 4G8TA 2J4GA 5AHFA 4H8HA 1EJTC 1ZP3A 2OO0A 3UERA 3ABOA 1S3HA 3APGA 3NR0A 2QUVA 3EWYA 3ZVHB 5A3HA 3SRDA 2PS2A 2BY3A 1YADA 4FI4A 4IISA 3L4ZA 1R38A 1UH4A 3LM3A 1VRDA 4H9ZA 4S38A 4PUKA 4JTFA 3S6OA 3C52A 1XG4A 4AWTA 1XD1A 2ESCA 2YR1A 3LK6A 2VFEA 2J77A 3KBWA 3WQFA 2F2KA 4GVHA 1TQJA 4KFNA 4U2ZA 5E9XA 3WL1A 3BSGA 3GNRA 2C18A 3C2VA 3MKVA 5HNRA 3H70A 3H23A 1XXXA 1KC7A 2RH9A 5A8OA 3LI0A 4G7EB 4Z2KA 4HJFA 3NQFA 3UESA 1TRIA 4EVZA 4IGSA 3QGKC 3S1VA 1V02A 1KGUA 2Q02A 2TPSA 4GA8A 1UIOA 5K7JA 3AAMA 1AJ0A 1N8WA 2F7FA 1OY0A 4HSNA 4GOAA 3HQNA 4PFHA 4HJWA 1FWFC 4JTTA 3SN0A 3C2FA 5CCZA 3ALGA 5AHLA 4LUTA 3GG1A 4O53A 2IQTA 3FJNA 4E2BA 3S5YA 1ZCCA 1KLZA 1UJQA 1JNEA 4JX4A 2NLIA 2BP1A 2NSOA 1LM1A 1RK5A 4JICA 2QJMA 3VKJA 3QY7A 1J4EA 3NFUA 5D2XA 4DM2A 4RZ4A 5IHRA 4ADUA 1R6WA 2QPXA 3UR7A 3V5CA 1HJVA 1XL9A 1RHCA 1BGGA 1Q6RA 2VM8A 1C92A 3W7PA 1TR9A 3UCDA 3OLEA 4CCEA 2XFWA 1KRMA 4KFPA 4MB5A 2ZXBA 1KO0A 1E56A 3ARRA 1GHSA 3RJYA 2ATMA 1HZYA 1K7XA 4X63A 2OGJA 4XB3A 3BO9A 4KIRA 3PBWA 4RW5A 4UTJA 3K8KA 2OWWA 5C9UA 2OVLA 2YFOA 4F66A 1JF6A 4FP1A 5CPLA 3NQGA 3VTRA 4JKKA 3N15A 5LXXA 1L2QA 5I07A 4MKVA 1MNZA 4O1AA 5CC7A 2DZPA 3N2BA 2IQDA 2O56A 4HKPA 4AD0A 4CQAA 1A5MC 1C8QA 1K8YA 3QRHA 3W0KA 2V69A 3ANUA 3KE0A 1YHTA 2PC8A 4PMNA 4ENLA 3T78A 5LGZA 3CO8A 2I5GA 3VNMA 3DFOA 4AB4A 2G3NA 4U4MA 1GTEA 3GHRA 3HN3A 3KBVA 3N14A 4WVXA 1QVBA 1J6OA 1RY0A 3AJXA 3E6EA 1E4LA 4S3KA 3UZZA 3UZWA 1XCFA 5A6LA 1KXVA 3USBA 1VIZA 4PSRA 5H8PA 3GXNA 1GYNA 3BLEA 3GR4A 5D04C 1O5XA 4MY8A 2VEMA 2JK2A 3CQIA 1MQPA 3VNLA 1BQGA 5JIPA 3UG4A 3DFNA 3LBCA 3N4AA 4D6DA 5MKGB 3OVQA 3UPBA 5CAHA 1YW1A 4CQDA 4MZ8A 2J27A 4ICCX 3C56A 5JVLA 1US3A 1V6WA 1P0EA 1GHRA 5LXEA 3BICA 3KUMA 4EIVA 1B3YA 4QHRA 1A5LC 2NZLA 3I7QA 1X6NA 4ZSTA 3NYZA 2VOTA 5CAKA 2HBVA 4LY4A 4UQEA 4WKHA 5G2HA 2HDJA 1E72M 4HD5A 3ARVA 4XKMA 4EPEC 3PNZA 2J25A 3NJ3A 4KPLA 4IP5A 1KWGA 3WYZA 4WIWA 1XPGA 3EX4A 1FCVA 2X41A 3IEBA 1Q13A 2P3ZA 2XIQA 1BSLA 1VPXA 2OQLA 1EC7A 1UPMB 4GJJA 2I16A 3O3RA 5ABFB 3GDTA 4B4FA 2XU2A 4RNFA 2GL5A 1A5UA 2WAGA 4QS5A 1JGIA 1QI3A 1J18A 3CAVA 1YE4A 4A4AA 3U2CA 1XKJA 4HGXA 4I9MA 1J96A 4G2DA 3R7MA 4H2HA 4WCJA 3VOHA 4ZO9A 2O9TA 4IPPA 2SFPA 1XRFA 2PZNA 3E12A 1XLIA 5FJIA 1S46A 4Q32A 1VP5A 1ZJAA 1SGJA 5C54A 4C5YA 4ZE4A 2V9DA 1EYEA 3NZQA 3PZMA 4JEJA 1IZJA 3DAQA 3DEQA 1XBVA 4L4PA 3DFSA 3VI2A 1Y5XA 3T0BA 4GIRA 1GOKA 2HE5A 5FSEC 2WSPA 2JKEA 1FWDC 2YYUA 4IQDA 3V0SA 3KBSA 1TQXA 5DRIA 4LBSA 2FZBA 4A22A 3P80A 5TQLA 1SW0A 3XIMA 1ODZA 2AAAA 3OG2A 1XSKA 3VOJA 4JNYA 1OABA 4G7EA 4IPLA 4RE2A 1FXQA 3FOKA 4IWWA 4Z1YA 1IWAA 2AL2A 2Q3OA 4CU7A 4IXXA 2J6XA 3EB3A 4GI8A 4IIFA 1JD7A 1BF6A 2QDGA 1QAPA 1E6PA 4OT7A 1O12A 3LOTA 1FWSA 3LUTA 4JTQA 3N13A 2A3LA 4HNOA 1LBFA 3EWDA 4AYGA 1TPWA 3AXMA 2NX1A 4OBTA 3PUEA 4D6EA 1VEMA 1UUQA 2WQPA 3L4WA 1K8XA 2CYGA 1MXDA 4GQRA 1FWNA 1CGXA 3M5YA 4KMQA 4UCGA 1OFOA 1CECA 3MMUA 1X97A 5A2AA 2REQB 4C6EA 4AZHA 1A5AA 1BLIA 1Q8JA 2J47A 1TPVA 1XYZA 3HMJG 5A6MA 3FEMA 5IBXA 1LDCA 3FX4A 3WDIA 1OEPA 3QKEA 2I57A 4Q4QA 5K9CA 4PFMA 1AW1A 3VKKA 3MPGA 3EAUA 1H7NA 4LXFA 5HQMA 4LALA 1UP2A 1DJNA 5LGXA 1Q6GA 3WSUA 1JCJA 2Z24A 4HPHA 1PBGA 4DZHA 1OGBA 3VOCA 5H8MA 3LEPA 4BQ4A 4MNJA 2YB1A 4HMDA 2XZ9A 2EPOA 2OZ0A 1EX1A 2FB2A 1VYPX 3WFZA 4DBDA 3MCNA 1BYAA 3HG5A 4AHPA 2C79A 3BAXA 1RQBA 5JH1A 4F0LA 1H51A 2NW0A 3WH9A 2Y89A 2CLFA 4ZEPA 2FHCA 4F3HA 3QZEA 4JYEA 1XLAA 1GVYA 2HCVA 3ZLGA 8XIMA 1WP6A 1EL3A 4PMJA 2ZXDA 4E3VA 3R4IA 3WF4A 3WEOA 1DXEA 2BVDA 3PZGA 3L7RA 3TC6A 1XYCA 4DWSB 2CLLA 3MHGA 3VDBA 3NO5A 1H09A 4D2JA 4Y96A 4QLLA 3HQOA 5I2UA 1EQCA 1ICQA 3A21A 1RP8A 1ZENA 1O94A 3TP4A 3BC9A 2FTWA 4A3YA 1GORA 4R7JA 2CZDA 2PTZA 1UWSA 3A4WA 3I3DA 1HKVA 1J01A 3W07A 2PBOA 4ZMGA 4M7SA 2IUZA 1DPMA 3KCLA 3B0UX 2POTA 2XM1A 2WPBA 3W53A 5AYXA 3OVGA 1JFHA 3NQ2A 1XLGA 4C7DA 4J9JA 5AVNA 4EWJA 2C6QA 4JTLA 5F1VA 2IKHA 3HM7A 1BXCA 4JQ4A 3M0KA 2NX9A 2J7BA 1NAL1 3Q58A 4ATLA 3QV9A 4JIPA 4JTJA 3II1A 5EMKA 2JF6A 1OX4B 5I06A 1MW1A 3QBUA 1R3QA 1W8GA 1OK4A 1GUVA 3P14A 2Y7EA 1R2RA 2CLHA 1ITXA 5AHMA 1BSIA 3AU2A 2QW5A 4N9BA 3ZJ8A 1NFBA 4GCAA 1JZ6A 3F03K 4W8AA 1SMDA 1O7AA 2Q6ZA 2VENA 1OZQA 3F5KA 4K8GA 2TYSA 4HNNA 2IPJA 4IP4A 2GJNA 4IUOA 2V3GA 3SIZA 4H9MA 3C3UA 1RQEA 3URNA 3ITGA 1VPQA 1G7VA 2QUTA 1UD6A 3PNUA 1O95A 3SUUA 1W3KA 3D46A 1FWBC 4YWSA 4UNKA 3W1RA 1KM4A 1KM1A 4HBKA 2QJGA 5CPTA 1CXEA 2WSQA 3QLLA 5D8ZA 3RR1A 2HBXA 4PTVA 2WNNA 1RR2A 2V82A 1QXLA 5F2LA 3WZ0E 4WZHA 1V93A 2PDXA 4BI5A 4LFYA 1BD0A 4GC4A 4W5UA 4JCMA 1POJA 2X1SA 4NZCA 5A6BD 2XIBA 1KRAC 2PDNA 5JIWA 3H4WA 4TVDA 3VZYA 1T41A 4EK7A 4D8LA 2CC0A 1VHNA 4CD7A 3PPCA 3VZZA 6ENLA 3R89A 3HQPA 4ZR8A 4IG2B 3TJIA 3GX9A 1LQ0A 5EA9A 3ZJ6A 2PP0A 3TC7A 2OWXA 4V15A 5I3JA 3ARTA 3ARZA 4K39A 1XC4A 5DBUA 4GUFA 1MRQA 4HPNA 4OU1A 3W76A 2OXNA 1ZBVA 4AZ7A 4I3GA 3LMZA 3PS7A 1TZZA 1F6PA 3T0DA 3RRXA 3O0FA 2CHOA 4FF5A 4RPPA 1UZDA 2GOUA 4M6UA 2A85A 2OEMA 3UEQA 4NAFB 3EOUA 3EOSA 2C0AA 1J0JA 3XISA 3EA3A 1SO5A 4D6CA 4DY1A 2I5IA 1OCBA 2Y63A 2DZAA 4ZQMA 5CBIA 3T9PA 2V6AA 4UTKA 3W73A 4H3DA 4G9PA 2QF8A 5G1YA 1XYLA 4YLWA 2XVGA 3E02A 4FS9A 3OP2A 2VQTA 5LYRA 3NM3A 3VVGA 3DU0A 2VEKA 4O18A 1TZ9A 2INFA 1R3YA 2PU1A 3ZR6A 1TWZA 2UY3A 4DXVA 1G7UA 2PDLA 4P00B 1AH3A 3B97A 3HPXA 4EXBA 4AW7A 1YX1A 3CMJA 5AYBA 3UF9A 2Z1BA 4PUNA 3GC4A 3RGTA 3GIPA 1ZBCA 2X2GA 1X7IA 7REQB 3QY8A 3GYEA 1SYTA 4N4QA 1D8WA 3M4HA 1JXKA 3NPWA 1L8NA 1A5SA 1GVSA 1S39A 3U6WA 3LCIA 1WNOA 1GVFA 5LHEA 2VEFA 2ZTJA 1J0ZA 1F73A 3RG6A 3LU2A 1WB0A 3TQKA 5DCDA 3DESA 3WQ8A 4D1IA 4G1KA 4I7WA 1N7KA 1Q2RA 3IIXA 1PUDA 2CLOA 1W3NA 3AYVA 2Z00A 3C8NA 3TIMA 4GXPA 2E9MA 1H2JA 3T2QA 3RU8X 1HJSA 1H7WA 2ABAA 2A79A 3M0MA 4L6OA 1LG2A 3TMQA 1J10A 1KBIA 3W1QA 1ADSA 2QCLA 4IQEA 1HG3A 1C91A 1WDRA 4JQ2A 1EA0A 3CIVA 4Q4RA 3B8VA 5DCEA 4NI3A 1OHLA 2BSLA 4NJGA 2TAAA 3WG6A 1QW7A 5CZ0A 4J2MA 4PCFA 3V1PA 4JPGA 3OQEA 4K1WA 4DBUA 3FKKA 2XJ7A 1YBQB 3WFLA 5A95A 2OGYA 1FCQA 1D7FA 4UTMA 3OPSA 5A5WA 2VZOA 3SADA 5C9XA 5E0CA 2W4XA 3AQUA 2IW0A 5I3DA 3W9ZA 4AU0A 4HQVA 2PDQA 2CBJA 4H6RA 3CUXA 1IV8A 4LVBA 2ZUTA 4W8LA 2H90A 1WKEA 3QW3A 5PTDA 1I2QA 4YXGA 3VNZA 2F8QA 1GJPA 4L9YA 1XIMA 2BGSA 1I75A 2V2DA 4C6KA 5EKYA 1A0DA 4LQ1A 4Q4KA 3RLGA 5FACA 3UG8A 1CGTA 2WHMA 1Q45A 1K7EA 3RLVA 3ARYA 1KFBA 3WDPP 5F4SA 4CQ9A 2D24A 1E51A 3VOFA 3A9IA 3GUGA 3QQWA 4LUYA 2QQ6A 2D3LA 2FPYA 1J0HA 3FGCA 4ECLA 4HYVA 2AGKA 3IVSA 3KZPA 4M8UA 4HTYA 4NJJA 4U10A 4TR9A 1PDZA 1B90A 4ES4A 3IS4A 1NSJA 4HPXA 1BF2A 2I9EA 2DU2A 2W6RA 5H1WA 4B91A 1L6YA 4MAVA 4JFUA 2OZ3A 4R5EA 2IPFA 4WSHA 5B80A 1V3HA 2CZ5A 2VL4A 1ONWA 1IT7A 3EDJA 1KBJA 3DYMA 2Z25A 1XD0A 1UA7A 2BNJA 2DP3A 1VHCA 3FAXA 1OINA 4FIRA 3IJQA 8CGTA 1J12A 4S23A 5D4YA 1ZU8A 3R58A 5EBUA 3TAOA 3QYQA 1LCOA 1BXNA 5F7UA 1OFQA 4C6BA 2PUZA 7TIMA 3MMTA 2A2IA 3QHMA 3LV6A 1I9CB 3E0VA 1U5HA 4D6HA 2WLZA 4O17A 4LJ3A 4IPNB 4PCPA 3N2MA 3U9IA 1A4MA 5HR6A 2FZNA 4PR4A 4EF9A 4X9YA 1Z9AA 3TN3A 4AZCA 5M2FX 5KZ6A 1HVQA 4P8VA 4O0ZA 3D3AA 4KWWA 4Q4OA 1H0GA 2BGNE 1KKOA 3BGJA 4NL1A 2YZRA 4Q6XA 3CV2A 3EDKA 1EA9C 4WHBA 1XH1A 2A3EA 2YCIX 1XG3A 3LV5A 1Q4WA 1L6SA 3EOEA 4ZSUA 3HURA 4NJHA 2R24A 1HKIA 1XLDA 4MNLA 4ERIA 1I1WA 3CT2A 3NDYA 4QLKA 3USZA 5M3WA 5DN1A 3TW7A 4K36A 4Y9PA 2PB1A 1NWUA 2DSVA 3IV8A 1OG0A 4ACYA 1EYWA 4IFKB 4J3XA 2BS9A 5C8BB 2ZVIA 3BUVA 3QY6A 4JFVA 4LSBA 1QNSA 3MBFA 2WYSA 4GI9A 4IIEA 3SCTA 3JS3A 4JKMA 1UBPC 3ZMRA 4GYKA 1FHDA 2AL2B 2C1IA 1K70A 4OZOA 1RK6A 2UV8G 1T40A 1FP9A 3S1WA 1Q3NA 2XSBA 3L4UA 1K4HA 1V5XA 1MW3A 3FYYA 1NQKA 1XICA 5A6BA 1XIJA 3VKCA 4LNCA 4UFJA 4C6MA 4Q33A 3TUUA 3CUJA 3W2NA 4ZOBA 3H2OA 2OR2A 1HW6A 4ZE5A 5D33A 1S1PA 4BCEA 3VGFA 1XYBA 4A8NA 4PCNA 4D1JA 2JIWA 2OU4A 3FK4A 4JX6A 3HFTA 1V02E 4S39A 4J27A 4LB3A 3T2PA 1CXHA 4AD2A 2OKTA 3O15A 3LRKA 3VDHA 3OG3A 1GG1A 3NPXA 2XHYA 3DC8A 3W1NA 3WK1A 4V27A 3P8IA 3WKZA 4ZB2A 4MJ2A 4ZOAA 2A1YA 4DNHA 5E9AA 1CPUA 2RJGA 3O2LA 3IGSA 2R91A 1WX0A 5T26A 4L7ZA 4WGHA 4YTTA 3MHUA 1YPIA 1EO7A 3VMOA 5HA7A 4XBSA 2YCLA 5H91A 3IUIA 5AHIA 3VABA 3RF9A 2OELA 1WXJA 3QYSA 4MY9A 3R25A 5E09A 1E0VA 3G8RA 4D71A 4KESA 3MV11 5DMNA 1PIFA 5CGTA 4IPJA 1XPYA 1R0MA 2YXGA 3M6DA 5D2VA 1F74A 3WLHA 3LHTA 3KOYA 1UKTA 2PLCA 3RIKA 4F2TA 3IJLA 1H7RA 3DBPA 5KEZA 1JI1A 4L4LA 3ZT6A 3C6CA 2WKJA 1GVOA 2MUCA 4A8IA 1PX4A 5AC6A 2WVTA 2UZ9A 3VX0A 2PDYA 4JTGA 3GVWA 1CT5A 1UZ4A 2PDJA 4UB9A 3L21A 4MJMA 4ADSA 1IR2A 3CB8A 3U7BA 1AH4A 4PTXA 1Q5MA 3GB6A 4QROA 3AU6A 2ZFAA 1KFLA 2FMOA 4RE3A 3UJSA 2EJAA 5GNZA 3V3WA 5CZSA 4MNMA 3FXGA 4ZQNA 3T6CA 2YBUA 1SZRA 4F8XA 1AODA 3CYVA 1TJ1A 3F5LA 1EC8A 3WBWA 4KRTA 3QGVA 3T4CA 4LV9A 2WV8A 3PP7A 3HO8A 1QNQA 1DE5A 1VH7A 1QI5A 1V51A 3I6TA 1WDSA 1FBAA 1ZAJA 2Z2AA 2NXIA 3SI9A 3BLLA 1DP0A 1EX5A 1MSSA 1XLMA 4F79A 2WJZA 4P7LA 4NHVA 3VGBA 4F0SA 1D2KA 5KITA 3GTIA 1JYVA 2Y2WA 1GVEA 3FV9A 3UG5A 2ZUUA 4EPDC 2FYMA 1VZWA 1WDDA 1OF8A 4NKCA 4LUIA 1EOMA 5CPNA 1E9IA 3WENA 5DQPA 4RUBA 1E0TA 1XYMA 3UY7A 1KXQA 4KIEA 1A0CA 2WNZA 2JF7A 1RD5A 1SJBA 2J9ZA 1B9ZA 5CGMA 2P5NA 3M41A 3Q94A 1RA5A 2OYMA 2G8ZA 1TB3A 1C29A 4UFMA 4A3RA 3VIKA 1V6XA 5M03A 5K4XA 3E2QA 4LB4A 3NPVA 4AWUA 4HMCA 3TNOA 4GY0A 4JDBA 1W6TA 3BJSA 4L64A 3BCJA 2JE8A 3FYOA 1G4PA 5EPDA 2PZ0A 3DKJA 4WR3A 4UNIA 1JDDA 4UZSA 3UA4A 4LAMA 2V5CA 1JQVA 4PULA 4O19A 4Z2GA 1YXCA 4DX3A 3T0TA 5KETA 4NAEB 1M41A 2R1LA 2WW5A 1WAWA 2RUSA 2BFGA 3S4TA 2YA0A 2ADAA 2CWNA 3FA4A 4AD3A 1F61A 2E5DA 4D6GA 2A5HA 4MFDA 4AX7A 4MDOA 3VPLA 2V8ZA 4GGHA 3VINA 4F0RA 1RLDA 1BVNP 1KW1A 4D72A 1IXQA 4H6EA 1VJIA 2WZTA 2V67A 2VEGA 3IRDA 4O13A 1IQ8A 3LN3A 3L68A 2CHNA 4LNYA 2HK0A 4Q6JA 4MG4A 3O1NA 1YTKA 1YMYA 3OW1A 1JPMA 3VXGA 2R9RA 3VOIA 4HOZA 4H41A 4HYWA 3PANA 3QM3A 2DIKA 3PFRA 3CUHA 3UXDA 2P3EA 3B9AA 4NXKA 1X96A 2WZIA 3M0JA 4BQ2A 2PCQA 1KM3A 3DHPA 1PWLA 4WOZA 4OUEA 1V3KA 1Q2SA 5CGQA 3W02A 3R12A 5GQBA 1MQRA 2VD9A 2Y5SA 4N02A 3GLCA 2GDQA 2OOGA 2CXEA 3ATYA 4E0CA 1PKLA 3TW9A 4ZO6A 4DQWA 4WGXA 1EZ2A 4UTWC 3S5OA 3MO4A 2VCAA 4NZ5A 3PZIA 4LBUA 4UTFA 1VBGA 1H5VA 2XINA 4RKAA 3CTTA 4PL1A 5MKGA 2O92A 1CB2A 3ZJ7A 1NTHA 4XZBA 3N17A 1NQ6A 1RPKA 3POCA 3ME3A 5CJ5A 3ID7A 3K4DA 1X8CA 2DUAA 5EL1A 3UZXA 4PH6A 1JCTA 3BGGA 5JBFA 5E0KA 3KHDA 5I3KA 4QITA 4N6EA 2X30A 1M7OA 1JUBA 3B9OA 1AUSL 3ARPA 4H4IA 4O1EA 2BVTA 4MDPA 6PTDA 2MNRA 2L5HA 1TTIA 4WRHA 2D23A 4BF7A 4LYRA 4DWSC 4RK8A 2YL9A 1ADOA 1W9PA 2ZX5A 1B3OA 3HG3A 3UXKA 1VF8A 3PBUA 1I2PA 2CZFA 4PTNA 1MI3A 1QW8A 3QC0A 3TQVA 1ZGDA 3N04A 3P5YA 1R3TA 2OLAA 2BY2A 3MP3A 4LF1A 4ICMA 1DL3A 3G0XA 3DG3A 5DMMA 3WQDA 4IL0A 3NOYA 1TV5A 4S3BA 2NQJA 4QJ5B 1MO0A 4LC6A 1P6WA 2XH0A 5A8QA 1IEIA 2HNEA 4QAWA 3OJGA 3L2MA 4ZCWA 3VGEA 3BSHA 1WAUA 2ZC1A 3R94A 4A6GA 4A21A 4Y6GA 3DENA 2Y70A 3DFQA 1E4NA 1OCNA 4I9JA 4NNAA 4PSPA 2A0NA 5RUBA 4P8WA 3NQ6A 4GVGA 3AXXA 1N8FA 4GUJA 5E93A 2DPEA 4FSAA 1H60A 1UWTA 3AHYA 3I68A 3RHGA 1MFVA 3RNDA 2EKCA 3FJ4A 1W5MA 1W5NA 5K9XA 3VM5A 1WKDA 1QI2A 2XIJA 5AC4A 2CWXA 4S3DA 2Y8KA 3C0JA 2YFNA 3SGZA 1CEOA 2Y88A 4NAEA 4HTBA 3TA9A 2HJPA 2GDVA 4ASTA 1E4MM 4XV0A 1S5MA 2R14A 3PAJA 4MWAC 3B06A 3OO2A 4Z08A 3CUFA 3M43A 3WNMA 3N9SA 3NGFA 2PLKA 1SSGA 3GZ3A 1A5CA 4HMNA 3P2VA 4ZODA 4A3HA 2QNEA 5LIYX 1T8QA 4UOJA 4AVFA 2HPMA 3U57A 1KM0A 4DWSD 2QAFA 4MTVA 1DWGM 3L4VA 1T7LA 3KLKA 1BYCA 1IWPA 2O4MA 7PTDA 4JN7A 4M81A 3P0XA 1G4EA 1JDFA 2EQDA 3E96A 3UNTA 2GGHA 4H8UA 1M6JA 1XLBA 4GD0A 3HTWA 3GG8A 3LG3A 4UFHA 3R6IA 1TPEA 2XVLA 1XIBA 3H2EA 3SZ8A 3KW3A 1Z42A 3JU2A 4EXAA 1RA0A 1W8SA 3WQPA 2QR6A 2V68A 2REQA 3SQSA 4HU8A 3HPFA 3TSDA 5A8PA 1T6MA 2GUBA 1X8FA 1V6VA 1T5AA 2WZEA 2YXOA 4PMDA 3GFXA 4N9EA 4YL2A 5EMLA 1F4HA 4HYRA 1BWKA 1ZHAA 3L5MA 4CN1A 3IACA 3NQBA 3OLDA 3MYPA 2ZBTA 2C8NA 4GX9A 1NM9A 4MKNA 5CG0A 3GBEA 4AEFA 1KGXA 1AQFA 3VA8A 5FF3A 1GEQA 3FSTA 6ALDA 2WANA 2P0IA 2ISWA 2WMKA 2ODOA 5D9MA 3JRKA 3QV7A 1W1ZA 1MW2A 2NXGA 4HZ8A 3QFEA 3V35A 3T07A 3ABQA 1TWSA 4FXRA 3ZSSA 1E6NA 3R11A 3P6LA 1UOZA 5U4NA 2PGRA 1SMAA 2DZBA 4WOQA 3NQ7A 1W3JA 4H7VA 3UWEA 4YYFA 4OVXA 1BXBA 4DBWA 1EGMA 2PPGA 1SJAA 3LCXA 3G5EA 6A3HA 4JOMA 2Z2UA 2AQVA 1REQB 1W3HA 3FY1A 1KV8A 2A3CA 5KZEA 4O15A 1EJXC 2FGBA 2A7RA 3AXHA 3VC6A 4DN1A 1UG6A 1HT6A 3VCNA 5C70A 2VURA 3W2JA 3HZ3A 4TMCA 4ZQOA 1I0BA 1FHLA 4LEFA 4KWOA 4CD6A 1OX4A 1PZ2A 3H4GA 5D37A 4BFAA 1H50A 3RPTA 3L0GA 2QCDB 3TXVA 2QV5A 4IMCA 4AHQA 4DJEC 2CBUA 4C6OA 2I56A 2BOGX 1MXGA 3NSNA 3LLXA 5FAGA 2Z1SA 1VC4A 1Z69A 4BWLA 5AECA 4JHZA 1E1FA 1QOPA 1M7JA 1YKWA 3V16A 1U83A 1JZ2A 3EOLA 1B4KA 4I5UA 4JN6A 3TV8A 1PCKA 2QJJA 2JEPA 5I78A 1V0LA 3GDLA 1EUNA 2R82A 3SQLA 3U0HA 2MANA 2ZWYA 5M1TA 1U1UA 1EO5A 2PTWA 1RH9A 3DYOA 1GVIA 1YXYA 3EB4A 4O8AA 1XQLA 3GE7A 3WLNA 2NT0A 3HGSA 3I10A 1Z6KA 2ZZ2A 1W5PA 4P02B 1U1HA 3WF2A 4DELA 4RPQA 1XLEA 3M1ZA 1SR9A 1UWQA 3EPNA 4M80A 4PUDA 6XIAA 3QTPA 1SZNA 4GNJA 3GW3A 3GH5A 5HQLA 3GXTA 3S2MA 4XSLA 1MWOA 4CNNA 1P7TB 1ELSA 1K6AA 3UVIA 4QBXA 1J2BA 3D47A 3W7IA 4JNMA 3A47A 1JCLA 1SZGA 4IJCA 1JRCA 1W1VA 1V8EA 4IG2A 1GK8A 1J0IA 2FVLA 1F9CA 1XIEA 2NQZA 3U8GA 5C0QA 1C9WA 3LHYA 4UIOA 1R7OA 2VCBA 3PB0A 2D0GA 2O7SA 1NDZA 4NT0A 1I4NA 1B3WA 1BWVA 3O7UA 3BCFA 4G6CA 4IM4A 2HWGA 3DHDA 4AD1A 2Z4GA 4XKYB 4ZFCA 3WDQA 1F3XA 3HFYA 4UTWA 5CSYA 4AEOA 3NYDA 4Q7BA 4PCSA 3UJ2A 4JIHA 3ERPA 2FJUB 2CETA 4GPNA 2ICSA 2DVUA 4XZNX 3GHTA 3FJLA 3ZR5A 1UBSA 3IVTA 4JTIA 2EPLX 2D0HA 3ZLHA 1L0PA 1FHVA 2FVKA 4O4WA 1W1TA 4X2PA 1UD5A 4Y8EA 3VIPA 4XAZA 2Z2BA 4IMGA 3SFKA 2VDHA 4ACZA 3TN5A 4LX4A 1GOIA 1BKSA 2FIQA 4HPJA 2EG6A 2ZX6A 2E67A 4WLCA 1QWGA 3WLLA 4A29A 2V5KA 1NEYA 3SY1A 3MP5A 3NZ1A 3RFAA 1XGZA 1XIHA 1ISXA 1ML1A 3HOJA 3VIIA 5FJPA 3B0VC 3DZ1A 4DVOA 3KXQA 2FDSA 3WQVA 4DO4A 2DSUA 4QQ3A 4S2CA 3W2UA 3NQCA 3MY9A 4MPQA 5HJLA 3H53A 1S5TA 3PB2A 3PBMA 2BXZA 5FEWA 2RDTA 3CM4A 1F3WA 1XBXA 3CAKA 3ICJA 3M16A 4C6NA 4GCXA 2QCDA 3H22A 3UWYA 1U5VA 5AB3A 4DI9A 1JRBA 3V4BA 3A13A 2X8RA 1VJZA 4Q8PA 5DANA 1HTIA 4UMAA 2VEPA 3PM6A 1RD6A 1WKYA 1VFMA 2J7HA 3P0WA 4FX7A 5GJPA 1J2WA 4RR4A 2IXUA 3PWAA 2BHYA 4YMZA 4AF0B 4Y90A 4QNEA 1OG6A 3NVTA 3TVAA 2OJPA 1Y5WA 3W01A 3H7RA 4DBSA 4PMVA 3L0NA 2AQWA 1AH0A 1B30A 1IXNA 5I77A 2KZHA 2C14A 1UZ1A 3GVRA 5HATA 3G3MA 3IIOA 3CV6A 4I7VA 4TVCA 3CHFA 3G24A 2YX0A 1GEHA 4YCPA 1EWEA 4DAFA 5CSSA 3R43A 2J9XA 4GY1A 1PPIA 4I7UA 3GZAA 1XW8A 2V5LA 1CENA 4UFIA 3PVFA 3WUBA 4PUEA 4P2VA 5IDIA 1EDGA 5DELA 3OBAA 4W9TA 1M7XA 4ORIA 4EPBC 1PCWA 1LF1A 4NAFA 2ZZ3A 3UCQA 4DZAA 4GK8A 5FD0A 2Q09A 3CJPA 3WMLA 1QU4A 2GSJA 4PUMA 3JZUA 4GISA 4MKSA 4BHYA 1XBYA 4PZVA 3W3OA 1E0UA 2G95A 4R9OA 3U2EA 2PAJA 4UXDA 5L9FA 1UWRA 3HMCA 3YPIA 4DNMA 4OECA 3DCPA 3TWBA 3WDJA 3CU2A 3HJEA 2YL8A 3V18A 5I3FA 3DIPA 3W7DA 4HB7A 4B2DA 2VVSA 2P0OA 2QULA 3LRMA 3TTSA 2OCZA 2YLAA 3A4XA 4M24A 4XO7A 2G97A 1GYLA 2DSKA 3A22A 4K1GA 4NP7A 4C1KA 3W7HA 3D5HA 3SGUA 5C9ZA 3CTLA 3UJRA 1E3ZA 2DZSA 2V5JA 2ZOXA 4RE4A 1YEYA 2AAMA 1XGEA 4O11A 3PZTA 1KR0A 4MLRA 3CQHA 4KERA 1Z7AA 4PMRA 3RXZA 5HUPA 4B5UA 3I65A 2ZTKA 5BRPA 3VK5A 1JR1A 4BY3A 4WDUA 1D9EA 3G1VA 2D2JA 1TMHA 3MCOA 3NXFA 2X0YA 5AYIA 1XFCA 4AEEA 1J11A 4ROPA 4UR8A 3B04A 2G3MA 2Y7DA 1WOBA 2BMBA 2V38A 3MSDA 1U2YA 3AHZA 4XD3A 1GJWA 4ZGYA 1LL4A 3N2CA 3P93A 3T44A 2YCJA 8RUCA 4GBUA 1AMYA 1EJWC 2XM2A 4HNCA 4NVTA 5BWFA 2CXGA 2DY3A 2RDUA 3AIVA 1EH9A 1RAKA 2EG8A 4H2CA 3CHEA 2C7FA 1BAGA 3KP0A 4CN4A 5D02A 3QF0A 3VGGA 2ISVA 2GYIA 3AS0A 4AC7C 4GXWA 5D9PA 5IDZA 3MT1A 3AIEA 3MHFA 1J9YA 3W00A 1C8YA 5GJNA 2YB4A 3RLHA 3W2MA 4Y8FA 3EDDA 3ONCA 3TJLA 1NF7A 2XGZA 3HJZA 3G0SA 1MVYA 1TWWA 5SWUA 1EGZA 3O05A 4FZIA 3EKGA 2VVNA 1R3WA 1VFHA 1M7PA 3BV4A 3DYPA 1ZB5A 3P62A 4NZFA 4TV5A 4AZIA 1FH8A 3VU2A 4Q8VA 1A5KC 1HN1A 1IGWA 2JKPA 3RM9A 1J93A 1XC6A 4UTTA 4MSSA 1SSDA 1K02A 1EBHA 1JCMP 3WJZA 4A3UA 2DDXA 1JEZA 4KCTA 3ISIX 4ZO7A 4W88A 2WMGA 3WH5A 1YNYA 2C71A 1EXPA 1ZTVA 4GNKB 4DO6A 4KWVA 1EHNA 1DEDA 3CZKA 3PPGA 4DEFA 3KRBA 1FOBA 3FDKA 3U48A 4GVIA 1R85A 3L2IA 3LPGA 2PE4A 3FFSA 3T8QA 3N6HA 4GWEA 1EWDA 5HMDA 3BZGA 1OYAA 2DSWA 3OBEA 2JGQA 3T8LA 4LANA 2GQAA 4XAGA 4FNQA 1NIUA 3WJYA 1XI3A 3ARSA 3CIXA 1P4CA 1KV5A 1VLIA 3C86A 2DZUA 3WNLA 2BODX 3GH7A 1SVDA 1VIWA 1GPWA 1EUAA 3KTSA 4HA3A 4GI6A 5FEZA 2AKMA 1H7XA 2DSZA 1ME7A 1R8LA 2YW4A 2VR4A 1OFAA 3UXAA 4NASA 1LOSA 7A3HA 2BDQA 3CT7A 4NUWA 3U5YA 3SGGA 3CEUA 2B31A 2GVGA 3HGRA 4YNGA 1LRQA 4QM1A 1ZJIA 3FHAA 2EKGA 4CEXC 3GKAA 2ZX8A 3W1TA 1LZOA 1W1B1 2CEQA 5DY2A 1QNOA 4IL2A 1F2JA 2H6RA 5GPRA 1OGSA 3S2JA 1JULA 4GVFA 2F61A 3CEPA 1FCBA 1W37A 8TIMA 3IPWA 5KMYA 2BHZA 4U31A 1V4YA 4MUPA 1BTMA 1W17A 3M0LA 3WBXA 1TE1A 1DHKA 4Q8MA 5C7VA 1XH2A 4O16A 3AUJA 1CGUA 2VGBA 4H9VA 4NJKA 2R6OA 1V6YA 3BG5A 1EPVA 3G6MA 1TWDA 3GFZA 3WDRA 3U5UA 2C15A 4O4VA 1V3LA 3GM8A 2PDFA 1TZ7A 1WO2A 2GPTA 2JGYA 3E1F1 1IIHA 5FF0A 4DO7A 5CKSA 5AN7A 3FEQA 4WDWA 1L6GA 1PHWA 2Y85A 4O57A 5DFAA 1PEZA 4H00A 2I17A 5HMSA 4QGCA 3CHDA 2VRQA 1V79A 3WJSA 3G1HA 3PSWA 1EJRC 1HL8A 1I60A 1E55A 1FX6A 3PWGA 4XD5A 3UPMA 5FJRA 1UCWA 1BYDA 1FWTA 2PDUA 1QFEA 4JTEA 3GY1A 3UJFA 1IZKA 3AIWA 1R3RA 5FJJA 4W7WA 3UU0A 3NDOA 4H8VA 4TX9A 3C2YA 4C6IA 1L2UA 1XHGA 1HKWA 3KS5A 3RO6A 3PR2A 2QKFA 3WLRA 3VD9A 4E2VA 5CZTA 3L4YA 4IX2A 2WC4A 3RYSA 3XINA 2BY0A 1GWJA 3WQ4A 3EXRA 2JKAA 3LTSA 3W6LA 4M6QA 5BU9A 3LYEA 3CWOX 4QISA 1RPXA 3VDAA 1QT1A 4JKLA 2W92A 5DRCA 3APTA 4LY8A 3OU8A 4IJRA 2P8BA 1UUMA 3LENA 1FP8A 1EFZA 3MW7A 3GR7A 2ZDRA 4ATWA 1VBRA 3ZSTA 2NQ5A 2Y61A 1G94A 2YBVA 1B4EA 2DFAA 2RAGA 3K4AA 1I2RA 3AFBA 4GJIA 1OC7A 4JIRA 1V7YA 5HMEA 1DWHM 1PXGA 1GCYA 3TCSA 1XCWA 3PWIA 4ZB5A 3CH9A 4ML4A 4QRNA 4DZIA 3KTCA 3UZ5A 2WLYA 2J9YA 2CKRA 1GOMA 3AYSA 4BF5A 1CLXA 2CLIA 4R34A 3GC5A 2VX5A 5FL1A 1B3VA 2DZTA 2PODA 5G2IA 1LJYA 1UD3A 1WOAA 3AMLA 1GZ1A 2ZZ4A 3LQGA 5FL0A 1POKA 4W8BA 1TKKA 3E74A 3IJ7A 1R2TA 4DPQA 3OZPA 1XYFA 3VNJA 4FR1A 1G4TA 2B81A 3R8GA 3MSYA 1OFBA 4PMZA 2VDGA 1W31A 2FGLA 4BZYA 2QCGA 5CBJA 1BRLB 2WVSA 2E6YA 5LIKX 3O6DA 3TONA 4FA3A 4C6LA 3KL0A 3TU9A 4RNIA 3TAKA 3ZZ1A 1TV3A 3O6YX 1A3HA 2Y5EA 5A69A 4FO4A 2PRLA 3NAVA 4H9XA 3F4VA 1CYGA 4Q4PA 3WDHA 1TIMA 2OLHA 2DQWA 3QMRA 1VEPA 3G2GA 1ZS2A 1OFEA 3DG7A 3PHAA 5CG7A 3W85A 1D3CA 3LTPA 2POZA 3NL5A 1MZRA 4ZTYA 2E25A 4FX8A 3Q37A 1OJXA 2D20A 1H63A 3MCMA 4JAWA 3QV8A 2E0PA 2PDWA 2UY2A 5AYYA 1Y8BA 4DLFA 1SZFA 4PTWA 4W5ZA 1DJGA 2F38A 4IH3A 5CEWA 4FIQA 3BW4A 3QSTA 1WQ5A 3BMXA 2Z7GA 5HNUA 4MB1A 4XKYA 3VMNA 1GVRA 3W7EA 1S2UA 7ENLA 3SCSA 3DGRA 1R5YA 3H7UA 3VUSA 4PL2A 4JD4A 3NQAA 4IMDA 2TODA 2INZA 4LRSA 3KWSA 2GK1B 5I09A 3L2LA 1XH0A 2YDQA 4W86A 4YHEA 2W62A 5BWAA 3N12A 3S2CA 1QHZA 4DF1A 4XX6A 1QI4A 4E4UA 4K68A 2W66A 1YYAA 2CESA 3LCLA 1BQCA 2YBTA 2ZXAA 1PKNA 1AA1B 2ALDA 3W87A 3GDMA 1UJPA 3BGAA 4F2UA 3M6YA 3A4JA 2C16A 3WF0A 2XIIA 3TROA 1ZLPA 3KLLA 4BEQA 2VRKA 4IXHA 1JAKA 3UZJA 2JFEX 4LH8A 1NP2A 4JY9A 4TVUA 5I00A 1ZY9A 1G67A 2G96A 4GE8A 3SN1A 3O0KA 1GG0A 4YTUA 5DY3A 2QEZA 2BXYA 3JUGA 1K8CA 2HRWA 3JZEA 4IMAA 3EGJA 1SPQA 3FVDA 1BG4A 2RHGA 4QQUA 4Q8WA 4IT1A 4WK9A 4LVFA 2P8CA 4KRUA 1DIOA 3VOGA 4HVXA 5G4WA 3R8HA 2ABBA 4UTUA 2WJEA 1AQHA 3IIVA 1NOWA 4W4QA 3AMGA 3GHSA 3OA5A 4HHMA 1DTNA 3C0SA 4BI6A 4RL3A 5I0DA 1SJDA 1FDYA 1K77A 4KFOA 3SM0A 4I8YA 4UQ9A 2BB0A 4X61A 4DM1A 3BLIA 3VIGA 1ONEA 4KKXA 3CLWA 3KBJA 5A8GA 2PP3A 4DJFC 3BAIA 3B05A 4P7QA 3TOPA 1KCKA 3RCMA 3HGOA 3CZEA 1UQYA 2ZA2A 2XWEA 3GK0A 4WY0F 2XN1A 3WUEA 3A5FA 2GWNA 2XUCA 1FWGC 4J5NA 4F9JA 1QNRA 1ALDA 2W3ZA 2CERA 3KFTA 4LUTB 4UQCA 2ZX7A 4XO6A 3TDFA 3OTRA 5LSMA 3NSXA 2B7OA 4R33A 2PLMA 3UWVA 4FOJA 3MV01 3V36A 1UR9A 3W37A 3UETA 1K8ZA 1HQTA 3MI2A 1G9HA 1E6ZA 1TIWA 1FFQA 4Y9NA 1V08A 5I3HA 3SW6A 4JIQA 4QDPA 4LS1A 1W5QA 4FXFA 3VX1A 2OTDA 4O0QA 1DJHA 1MNSA 2A7NA 1ITCA 1UB3A 2DJXA 4YIWA 1XLLA 1G4SA 1GQKA 2XN2A 3ARUA 5HJYA 3FDGA 3B9DA 4XISA 3EMQA 4ZZ9A 3SO7A 4AXKA 1UZHA 4DJDC 3AO0A 4CQCA 3NZRA 4PB3A 4KWUA 4L61A 2NSXA 3IAQA 1Z89A 1MMFA 4CQBA 3MZ2A 5CXPA 5BU6A 3PPHA 4RDZA 3W29A 3S1XA 2Z1KA 2QIWA 3WH8A 4LT9A 3H2CA 4FOKA 3RPDA 2O0TA 3BQ5A 5D32A 3VCRA 4FOUA 1UASA 2ZICA 2QPSA 1FWIC 3QH2A 1OT1A 1QK2A 2ACSA 3WNPA 2YLLA 1GQJA 4HIBA 1IF2A 2Q01A 1SFSA 2I9UA 2B0MA 4UNLA 2GJRA 1AJ2A 1PE1A 4TO8A 4IP7A 1F5ZA 4CVUA 3VE7A 5AFDA 3QHOA 1YIXA 4B90A 2J75A 1HO4A 4PBEA 3W26A 1UD4A 1C90A 4F40A 2WWDA 1ENUA 4FNPA 1KBBA 1S2WA 3DOPA 1NELA 4RZ5A 5HPCA 2HVMA 4LAZA 1WUEA 2OFJA 2D73A 4N7QA 4DRSA 3B8UA 1NJJA 1F4AA 3RN6A 6REQB 4LUSB 3IAPA 3M0HA 3Q4DA 1N82A 3LLDA 3N3TA 5JH2A 4KEZA 4LC8A 1I1XA 1XRVA 3CPGA 4F48A 3GNOA 1WUFA 3ITTA 2WPGA 3RJXA 1A53A 1Q66A 5EMMA 3N1AA 4M29A 1W9XA 3REQA 1W56A 1AVAA 3ELFA 4B16A 3NZGA 2G50A 3LSCA 3A12A 5AZ0A 3KOXA 5TD4A 1X1NA 7ODCA 2Y0FA 4FNTA 3FA3A 4Q4MA 4R85A 3BG9A 4NU7A 5LKYA 2H3BA 1EP1A 2NUWA 5HINA 1WDPA 3CL8A 3BDKA 5D2TA 4NYUA 2ZRZA 2YSWA 1SO6A 3VCCA 4FALA 3M7WA 1B9BA 2PRHA 3PAOA 4QLJA 1C8XA 3IJDA 3QOKA 1P1MA 3BAKA 3TFXA 3RITA 2E6FA 4CN6A 3ZLFA 5D2YA 3CASA 3UFYA 3EA2A 2RGLA 3BPWA 3SJ3A 2ZADA 4E4FA 4QG9A 5IHSA 3EEZA 1TPUA 4FLRA 3TTOA 4JTKA 5K4ZA 1NP0A 1OYCA 1EPXA 2ASHA 3EZ4A 1V6TA 3E0FA 4W87A 2ZZ1A 3QPEA 4EPKA 3EX3A 4QFUA 2XYLA 2A3AA 5CJMA 4FXJA 1DTUA 3P7YA 4D6FA 2HE8A 3UBPC 3F4CA 4OUIA 3GNDA 3VO0A 4YTRA 4GQ0A 1F7BA 1KR1A 3BH4A 1REQA 3E0IA 4C6CA 1CDGA 2IPWA 2JQXA 3G1FA 4J3VA 5AOUA 3AZSA 3PULA 1F6YA 3F2DA 3GU1A 4S3GA 4E6MA 3TZFA 7CGTA 3E5PA 2J7DA 2QDEA 2C13A 2IXVA 3F4WA 4MWAA 1EF3A 2H3DA 1XIFA 1PX3A 1DORA 4J1OA 1CBGA 1LRTA 1K9DA 1H41A 3H2AA 3UPWA 4AD4A 2Y5JA 4DUXA 9CGTA 1FH9A 4I5XA 4RJEA 3UZYA 3TA6A 3KOZA 3AIUA 1QPNA 1THFD 4OKDA 3B03A 3CZJA 3G8EA 3BJFA 4X22A 1RCXB 1RVKA 3FCPA 3ITYA 3R0KA 5C5YA 1SFJA 4N6FA 2DEPA 2R1MA 3EWWA 2J62A 4HMEA 3WK3A 3URAA 2PU0A 2V63A 4W84A 2FFCA 3CHCA 1R86A 3BXWA 4AVOA 5BXTA 2VX7A 1ITQA 3AISA 4ONVA 1CB7B 1NARA 2X7VA 1OCQA 3T05A 2YL6A 1EJUC 4CD4A 2GJPA 2IMRA 3O63A 4QCEA 4S3FA 4UOZA 3LXBA 1LUCA 1PL9A 4MLJA 4DI8A 5DMLA 4A3QA 1IR1A 4GQQA 4NYYA 1VLWA 2EXOA 4HU3A 2VWTA 1SR0A 2EAWA 4JL1A 1VBJA 5CBBA 4U28A 4WKFA 4GC3A 2RGMA 2RDXA 1FWWA 1JUEA 3FW6A 4FB7A 1KM6A 4NZ1A 4HHPA 2WSKA 2QAPA 1OIMA 1RALA 2B4GA 1E1CB 1LQ2A 4UTTC 5T9BG 3TYUA 1VS1A 2H8ZA 5TIMA 5CPOA 5C6MA 2Z1WA 1DV7A 4MZ1A 4HZ6A 5H6HA 2X0HA 3FNDA 4M6VA 2ZA3A 4MHBA 1EOKA 4AIOA 2QJNA 1U5JA 1VFTA 3PZQA 1R87A 3M0XA 4H7CA 4FPSA 1A5OC 2W67A 4AFYA 3NL2A 5EIYB 1DXIA 1WDWA 4WKAA 3AZRA 2FPVA 2PBGA 4FLSA 3BCDA 2Y7GA 4HCLA 2KX9A 3G1SA 5A6SA 3W38A 5HOSA 4JX5A 2CHRA 3HB9A 5REQA 4P8XA 5I7GA 2PF8A 3ES7A 3EDFA 2QGYA 1JG9A 4AY1A 1TCMA 1VPYA 4W7UA 2UY5A 2A3BA 4GACA 3FXYA 1ZBKA 4JNZA 2I14A 1OK6A 3UT0A 2YA2A 3UWQA 3CPUA 3LRLA 4IFKA 3L66A 1IIGA 1H5YA 1DWIM 2J8GA 4NIRA 1NWTA 1BFNA 3K30A 5REQB 1ZJHA 1YTEA 3DHFA 4B9YA 2PDKA 5LNWA 2VJXA 5J8LA 4OBRA 2GUUA 3MSRA 2O55A 4H19A 3NTYA 2XVNA 3CUGA 1Q6OA 1UR0A 1OD0A 4GH3A 3GXIA 2OLSA 3T09A 3LXAA 3UP8A 2OWCA 4G56A 4ZENA 2VX4A 4EANA 5E0FA 2FMNA 4OHQA 3T08A 2OYKA 1ZFJA 5AKQA 1EP3A 1HKJA 4BJHA 4DB7A 3WLSA 5D9OA 4PMOA 3NQ8A 2BBFA 2QPUA 1GOQA 2ZZ6A 3ARWA 1E3XA 1UPPA 5HDRA 2VTFA 4JHOA 1NWSA 3VNDA 1RJRA 3AYTA 2P50A 4NF7A 4XVEA 3HPAA 4IUGA 3BV7A 3TLQA 1KA9F 5CPMA 4ADTA 1CXKA 4JTHA 4NZ4A 2XFRA 2VYOA 5G4HC 3FAWA 3UCCA 3P67A 3QC3A 1H11A 3GXDA 2DZWA 3RRAA 1CXFA 1QPKA 2Q8ZA 3STPA 3M5XA 1BG9A 4F9DA 4HOWA 1LOQA 3GVQA 4DLMA 5T9CE 1P0BA 1XX1A 1TREA 1BPLB 1CGVA 1AZ2A 4HK5A 3FVMA 3CK5A 1OSEA 3RAOA 3SURA 1GOXA 2INEA 2Y8UA 1ZQ5A 1TPH1 3WF1A 1TVPA 1L9WA 1LUCB 1UR8A 1J0YA 4PEKA 5HBFA 5LNVA 5FJTA 3L0KA 4N9CA 1OT2A 3TW6A 1EXBA 1V0MA 3G3DA 2F2HA 1EBGA 1RQHA 1UR1A 3GIYA 5E6YA 3OZOA 5EJZB 3LLFA 1K4GA 4K38A 2P76A 3M0IA 2QYGA 5MHBA 5LA1A 4CQ8A 1DWAM 2J7CA 2NT1A 3OGRA 4WXYA 5ECUA 1CCWB 3TYDA 1UA3A 4DIAA 1Q6DA 1NVMA 3P81A 1RY8A 3IV3A 1M5WA 1TPFA 1XRTA 3WIJA 3NNTA 2GGJA 2X1TA 3HG2A 3OODA 3OVRA 1ME8A 4GO8A 5G1TA 3AWOA 2I1OA 3MUY1 4KS0A 3TSMA 2QHAA 4O1FA 4WF7A 4L1XA 3CPRA 4S2BA 2DZVA 3K5XA 1E1EA 3BSMA 1IT8A 9XIMA 4X0VA 1KQYA 1GOOA 3ABXA 4N9DA 1QW9A 2QVNA 3AWNA 3CMFA 3DHUA 4U3AA 3UWZA 3OHMB 1V0NA 1GZJA 1D3HA 5BMXA 1UR3M 3CYJA 4OGZA 1V3IA 1EDTA 4HK6A 2PSNA 5CC6A 1YDVA 4MMWA 5GVJA 5DBTA 1JJKA 5CSUA 5CLWA 4GIYA 4I9AA 1CWYA 3JR2A 3UYIA 1Q6CA 3GNNA 3TTEA 4HHLA 3W1PA 4B5WA 2ZWZA 2F6UA 4A05A 4KH2A 4W93A 4WD0A 1W91A 4UTHA 5F4WA 3SY5A 4TUFA 5CJNA 3HIJA 1HP4A 4C1NA 3U7VA 4BWLC 2E9LA 3N29A 1RUSA 2O7QA 3A4AA 4BQ3A 1RZMA 3WK2A 4AUBA 3MSGA 2FTPA 4KT2A 3QR0A 3RK8A 4HNTA 1UW9A 3WUFA 2OSWA 3M44A 3ENLA 3L65A 2HVOA 1D8CA 4XTDA 2OQYA 3MBDA 1IZCA 4XZWA 4JQ3A 3WEZA 3MJYA 2VXNA 3ABSA 1AD4A 2VFFA 1JNDA 3Q65A 4I8DA 3TYZA 3O8AA 4QG8A 4CNOA 1O1ZA 4Z17A 1YTDA 2G3FA 1UKSA 1B0IA 1PJ9A 1LWIA 3HV8A 3U3HA 1D3GA 4RX0A 1JCYA 2W9MA 3BK0A 3GS6A 2C19A 1OQFA 1PIIA 6REQA 2YCEA 3AS1A 3SRFA 1TPDA 4E5TA 1AQ0A 1X7FA 4PC8A 4HP5A 3WLPA 4OV9A 1TR1A 2PDGA 5I23A 5A2CA 4ZFMA 2NX3A 3KZSA 4ILSA 4JQ1A 3QKZA 4DF2A 3M46A 1ESWA 5IFPA 2ZX9A 1PV8A 2HK1A 4H9UA 2G4FA 1XYAA 1AQMA 2WMHA 4LBRA 4EACA 1W54A 1RBOB 1FHUA 1KBKA 4Z2IA 2QJHA 4Z2LA 4AZGA 3L5LA 4NI8A 2ONEA 3QW4B 3C4UA 1OVDA 3DECA 5I3IA 1S5VA 5FAJA 5H8UA 4AZCB 3GNXA 4O8RA 4Y2WA 3VIJA 4UCFA 1X39A 5M17A 2FZ8A 4PMQA 4CNSA 4LS2A 3W7JA 5G5IA 4O14A 2VR2A 3QLDA 3SSZA 3T55A 4H6QA 3L5AA 1RSCA 3W1MA 5HNNA 1LLZA 4V2XA 2HS6A 2ZRYA 4KEVA 4DJDD 3N18A 3FGCB 2RJHA 2W5FA 1IHIA 3I3EA 4W7VA 4RDYA 1GKQA 1AW2A 1OC6A 3WLQA 2OSYA 4IPIA 3RO8A 4YYCA 3H2FA 2ALRA 3AHXA 1AMKA 4WUIA 3NA8A 3LNMA 1MEIA 2RKXA 4H83A 2CZEA 3KVKA 1QATA 2CPUA 3GTHA 4PTMA 2V3FA 4CEUC 3B4YA 4XAPA 5B7ZA 5K2ZA 4WXZA 2EPKX 5AVHA 3BWWA 4HSHA 4XWUA 1IEWA 3LHUA 3R79A 4AYSA 4V1YA 4HU0A 3UXLA 2WVVA 2PWDA 1RLCL 1EF2A 2FLIA 3U4FA 3AYRA 3W72A 5EFDA 3MC5A 5IBXC 2VZSA 4GY7A 5TBOA 2HVNA 3LBMA 3M0YA 1JPIA 4OV4A 2VWSA 3K2GA 4Q8QA 4QS6A 1C8VA 4MVAA 3WLIA 4RDWA 2D69A 1MEWA 3BL3A 4K6AA 5LNUA 4S3CA 3CH0A 4Z1CA 4HPGA 2GGEA 3BW2A 4URIA 4IQLA 4GI4A 2ZZ5A 4DUWA 2E28A 5TF0A 4QSFA 1KTBA 3CMGA 3EWUA 5E5CA 2VC9A 1MYRA 1UKQA 3B0XA 3OYXA 3CZ8A 2V3DA 5HMFA 4CD5A 1V3MA 3H12A 1QBBA 2VZTA 1JL8A 2Z26A 3JW7A 2NV1A 1Z32X 1LRNA 1JQXA 1DYSA 3B0YA 3MQTA 3Q67A 4RV3A 2H9AA 4DWSA 2VQUA 1GONA 1FUYA 1OGGA 4K7VA 3BAJA 5BOEA 3UWUA 3E5BA 4MM1A 3UY8A 3EPMA 2WCAA 3AIBA 3R8RA 2WM1A 4Q7IA 2GDUA 2E5BA 4BA0A 1U1JA 7XIMA 1W1A1 3UG3A 1VFUA 2XH4A 2YXXA 3Q45A 1WV2A 3DBNA 3KL5A 1W5OA 3E2SA 2R94A 4MY1A 4MIMA 5D2WA 2P88A 3S47A 1LOLA 2QCMA 3DGBA 3EX1A 3WX7A 3OGSA 3WY1A 3IK4A 3V5FA 1YXDA 1Y5VA 2PP1A 3SB0A 3IIZA 4JXCA 4NY2A 2O9RA 5A94A 4ZL1A 1VBUA 3PZ9A 3WQ5A 2D2HA 5MF5A 4GMEA 2BVWA 1R2SA 5ABHA 2QCFA 3SJNA 4LWWA 1Z8AA 1H4PA 3WBYA 1NF0A 4EE9A 5LHFA 3UD6A 4JTDA 3FSUA 3WQWA 3KS6A 3E3HA 1NDYA 1WXYA 5J5RA 3WH6A 3TEVA 5IOBA 4EAMA 5BOOA 1PO9A 3PZOA 1S5WA 2WHKA 3WQOA 3LSBA 2IKJA 3DXIA 4HA4A 3SCUA 5BOFA 2NUXA 3S5SA 2EEXA 1IE7C 1TE6A 2A3HA 4NG3A 2GGGA 4EKJA 4DJED 1S2TA 4HZMA 3GHUA 4UBPC 4QTGA 1M65A 4AQLA 1Y0EA 1DJXA 4LYKA 4HU4A 2A7PA 5BRQA 5L6UA 3LS9A 4A8RA 1VYRA 1OB0A 4S3AA