1K9FA

Crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
676
structure length
671
Chain Sequence
GYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKAPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Geobacillus stearothermophilus {alpha}-Glucuronidase Complexed with Its Substrate and Products: MECHANISTIC IMPLICATIONS.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords alpha-D-glucuronidase
total genus 274
structure length 671
sequence length 676
ec nomenclature ec 3.2.1.131: Xylan alpha-1,2-glucuronosidase.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03648 Glyco_hydro_67N Glycosyl hydrolase family 67 N-terminus
A PF07477 Glyco_hydro_67C Glycosyl hydrolase family 67 C-terminus
A PF07488 Glyco_hydro_67M Glycosyl hydrolase family 67 middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1k9fA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 1k9fA01
3.90.1330.10 Alpha Beta Alpha-Beta Complex Alpha-d-glucuronidase, C-terminal Domain Alpha-glucuronidase, C-terminal domain 1k9fA03
1RP9A 1HVQA 2YJQA 4ACZA 2F8QA 1W9UA 3VIFA 2J7FA 1CZ1A 4HA3A 3SUUA 3MV11 1W1VA 4WJXA 2EPMX 2ZX8A 1YHTA 4UTFA 5DMYA 2WSKA 3WBAA 2JE8A 4MJ4A 1CXEA 2WW5A 3EDJA 4KRTA 4UQAA 4PTMA 4CN1A 5JBEA 1KFWA 2YBUA 3AHXA 4M56A 1R86A 3POCA 1HKJA 4GZEA 2WWCA 3ZT7A 1B3ZA 1UKPA 1CECA 1OT1A 4S3KA 1CTNA 3SCSA 4K68A 5KEZA 4NRSA 4MB1A 3LMYA 3AHYA 2YDSA 1H2JA 5IHSA 4P7NA 3WNKA 1CIUA 3IJ9A 3W26A 3T08A 1CGXA 1SR0A 2GJXB 5E9AA 1G01A 3WQWA 4J3TA 2QV4A 4Z2GA 1M03A 3UEQA 4XV0A 1BG4A 3RM9A 3GM8A 4H8UA 1TE1A 3N9KA 4DM2A 4YHEA 3AS2A 3EDDA 5CXPA 4UFKA 2G3IA 4H8HA 3SCVA 4OJYA 2ZIDA 2BS9A 4H2CA 1E6RA 3CGTA 2J7EA 1JYVA 2VL4A 1JF5A 5A95A 4PMYA 1W1YA 1CDGA 3ARZA 1JDAA 3AIVA 5A69A 1OGSA 1PIGA 4MNJA 2GDUA 2ZX5A 4Q7NA 2GK1A 1A47A 6CGTA 2WC7A 1NM9A 4W5UA 5I2UA 5A6LA 3AIUA 1QW9A 1HJUA 1H09A 3BC9A 4UFMA 3VIOA 2F61A 3ZJ8A 1GCYA 3FY1A 1GQIA 1UG6A 1WKYA 3HJEA 3VDCA 2VOTA 3WEOA 1V08A 2WC4A 2VI0A 5HXMA 1LJYA 3MANA 1OSEA 4F9JA 3WL0A 3EDFA 3FHQA 2ZUUA 4RL3A 4J3SA 3DC0A 4FF5A 2GJRA 3WD3A 4BQ4A 3CH9A 3OGRA 4UQCA 2BVTA 4ZFMA 4W7VA 3ZQ9A 3WMCA 5E09A 5EMYA 3WH5A 1E3ZA 3ZO9A 3WSUA 3K4DA 1CWYA 2WMHA 1RD6A 3SCQA 1FP9A 1ODUA 4YHGA 3W6LA 3WD2A 3AXIA 4UCFA 4WKFA 3CHFA 2PWFA 2WZIA 2Y8KA 5GNXA 4JAWA 5A2BA 4W8LA 3ZIZA 2V38A 4JKMA 4OOZA 3TTSA 2WVTA 3W24A 3EMZA 3GZAA 2J7CA 2W66A 2W92A 2YLLA 2VZOA 4ZXOA 1AQHA 4HMEA 3A6OA 2DQXA 4P7LA 1JIBA 2D3LA 3T2QA 3VUPA 1HJVA 4IISA 2D23A 3BAIA 4D1JA 4BQ5A 3CUIA 4EK7A 3AMDA 3MKKA 1BFNA 1P6WA 1E4IA 1QNSA 4JFSA 1WZMA 4XZBA 3E1F1 4ZXLA 1ZBKA 1BYBA 4GXPA 3QOMA 2E9LA 2WYSA 3VGEA 1UKSA 3ARVA 1J9YA 2Z1KA 3N1AA 1J10A 5A6KA 3ZJ6A 3W29A 2X1IA 1DWHM 2PB1A 2GDVA 4L4OA 3WH9A 2C7FA 1CLXA 2OSXA 2GJPA 5BCAA 4KWUA 1W3HA 3SEPA 3VGBA 4TTGA 5D9PA 1OD0A 1KWKA 4AC1X 3W0KA 2BY0A 1WDQA 3PTKA 2XVLA 2CBIA 3ARSA 4UQEA 1GHSA 4CN4A 1MW0A 2FHBA 3IAPA 1CGVA 1V02A 2PC8A 2WVUA 4JFWA 4EAMA 1G9HA 1XV8A 3CMGA 1VFUA 3EDKA 1LL4A 1BQCA 1VEPA 1DWFM 1KR0A 1W3KA 2VT0A 1OGGA 1HJXA 1VFOA 3AIBA 2WMKA 3IJ8A 1WZLA 3VIIA 4TVDA 1E43A 3BAKA 2CERA 3M6DA 4J3XA 3WMBA 1WZKA 2EPLX 4BZYA 3MUAA 1V03A 2PWDA 1V6YA 4PMZA 4DM1A 4LYQA 3LPGA 1E0VA 1TFVA 3VD3A 1BG9A 3VIMA 3GH7A 3GXIA 1CXKA 4MDOA 3K8LA 1J12A 1NOFA 5A6BA 2WK2A 3L4UA 5D9MA 2CKSA 4J7RA 5A3HA 1UA7A 4M8UA 3VD7A 4B3LA 2XHYA 1W9VA 1WE5A 1CXHA 3AMGA 4NI3A 5LA0A 2DH3A 4AW7A 5EB8A 1FHLA 2EBNA 2DT3A 3MO4A 1NARA 2XVGA 4GPNA 3F4VA 3CHCA 2D22A 1X6NA 2XWDA 1KGWA 1XC6A 3VX1A 1QI2A 4JFVA 6TAAA 5E6YA 1ZBCA 1RPKA 2UY5A 1H11A 1OWQA 3CHEA 4W8AA 5AYBA 4BA0A 3U5YA 2VURA 2EPOA 4WKHA 2WB5A 2X8RA 5DFAA 2OYKA 3JUGA 1BTCA 3WIJA 2XGBA 4AISA 1J0ZA 2VRQA 2D1ZA 1JXKA 2V3DA 1GNXA 4AIOA 2WPGA 1A3HA 3UERA 1KCKA 1TG7A 1QW8A 1WP6A 4HU8A 3AMLA 4P7QA 2VCCA 3PHAA 4PUEA 4F9DA 3AZSA 4A4AA 1UKOA 3WQ8A 2UY4A 1TA3B 2CITA 3VIKA 5JIPA 3G6MA 3VGDA 1E0WA 2QLYA 3MV01 4JHZA 4N0RA 1C8YA 2E8ZA 2W5FA 4W89A 5FOOA 1UKQA 4UQ9A 1E6PA 4D71A 2CNCA 3CUFA 3G6LA 5D9NA 1C91A 3RCNA 1XSJA 8CGTA 2VQUA 2PWHA 3AIEA 3ZJKA 2E4TA 1XYZA 4LX4A 3ARUA 2VTFA 3EYPA 2YIHA 4U5IA 1QBBA 2W91A 2D2OA 3WDJA 2JIEA 1JZ4A 5E0FA 3SURA 3QR3A 4TOQA 4HMCA 1GOWA 2CHOA 5EFFA 1WAWA 3POHA 4CCDA 2EQDA 3CZLA 3ZR6A 1B30A 1O7AA 3N13A 4W7WA 4AY1A 5AY7A 3BGAA 1R7OA 3WUBA 5F7UA 2VR4A 3RILA 5CGMA 4GQQA 3SCRA 2D3NA 1E71M 1UH2A 4OIFA 2DT2A 1CNVA 1UZ4A 3AHTA 4PMNA 2ZOXA 2DIEA 2WMGA 1DWAM 1KGUA 2VRJA 4YPJA 3EDEA 4M82A 4GQRA 2Y2WA 2J7HA 5ECUA 2Y8VA 2AMGA 4CN6A 2OWXA 1JYXA 4URIA 2VX6A 4PSPA 4UNIA 1W9DM 2YA0A 2ZWZA 1ISWA 3WNOA 5HPOA 5A6BD 3SCPA 4A3YA 3WF0A 3GTNA 1KCLA 4CD4A 2WXDM 4QLLA 3IAQA 1R7AA 1JL8A 3ZSSA 3AJ7A 4NZCA 3K8KA 2XSBA 2J7DA 4J3VA 2WVVB 3VGGA 4PTXA 3N11A 4JKKA 1EDGA 4RE3A 5HNNA 4AZCA 2WNWA 1US2A 4MAVA 2QF8A 1HN1A 2NW0A 1PEZA 4ZEPA 3PZOA 4NRRA 1WCGA 3N17A 3MMUA 5D8WA 3UG5A 3L4ZA 1MWOA 1QI4A 3GDBA 1J01A 3SUWA 3TTQA 3VGFA 1V3IA 1KBBA 1JXJA 1M53A 1PZ2A 2A3HA 3I3BA 2VVNA 3MUY1 4GKLA 4UOZA 3MSGA 1E55A 1E73M 4WF7A 1OINA 2DSUA 1MVYA 5E0CA 1QI5A 3GYCA 6A3HA 2DGAA 2ZX9A 3NYDA 4S3JA 5GPRA 1CGUA 1UUQA 1LF1A 4LXFA 3W4RA 1BF2A 4UFJA 1B3YA 1VAHA 1HP5A 5GNZA 1C92A 1W9PA 4CCCA 3AMKA 1DTUA 4AXNA 3BSGA 1VRXA 2VX4A 4V28A 1C8XA 3RM4A 3WH6A 4HP5A 3UCQA 1WPCA 1U30A 5E6ZA 5EFDA 4UQDA 5ABHA 3VD5A 5IXEA 3CPUA 5HDRA 4B15A 2Q8XA 1W3JA 3IJ7A 3OG2A 2NT0A 4CU7A 1WDSA 4LGXA 4LYPA 4E4PA 4C7FA 4DUXA 4M29A 1ITXA 1JFXA 4PRWA 2E0PA 2E8YA 3AZRA 2BVYA 1NOUA 1M04A 2BVDA 1OB0A 3W27A 1Q6CA 4OOUA 1QBAA 4AD2A 2VNCA 4MDPA 2A3EA 5BXSA 1ISVA 1QHOA 3MMDA 2V5CA 4PMXA 1VJSA 1AVAA 1ODZA 1EHNA 4FLSA 5A2AA 1KWGA 4C90A 1TR1A 4FMVA 3L4XA 4AZCB 1VIWA 4QCFA 1EQPA 3A4XA 3GXMA 1E4MM 2WWDA 1ISYA 1JNDA 2PWEA 2FGZA 3AXXA 3AYSA 1E40A 4IPNB 4DWSB 1EDTA 3B9DA 2V3FA 5CPQA 1CEOA 4AEFA 5IFTA 3WDPP 4XX6A 3KL5A 3ZMRA 2YLAA 1L0PA 3WUGA 3LPPA 4ATLA 2WMIA 4AZHA 1BAGA 5LA2A 3RMEA 4B3KA 1HL8A 1B2YA 2V3EA 4EKJA 5A6SA 1F4AA 1UWRA 1XRVA 1MW1A 4OBRA 2D24A 1GQKA 1G0CA 2GK1B 3VDAA 3GNRA 1RH9A 2OSWA 3BMWA 4P8XA 3NJ3A 2XG9A 1M7XA 1CBGA 5CPSA 3WDQA 7TAAA 1E56A 1K6AA 2RGMA 1CXLA 1V3HA 3WL1A 1FP8A 2VZVA 3MU7A 1E6NA 4CGTA 3L2LA 4PBGA 3WNNA 3THCA 1UQZA 2YL6A 1UWTA 3FW6A 3CMJA 1KQYA 1J11A 4OUEA 3F5JA 1VB9A 1W9BM 2VZUA 3DYMA 2BY1A 1E1EA 4JL1A 1S46A 2DSWA 1PZ3A 4WSJA 5D4YA 4W7UA 3VM5A 1V0LA 4HZ6A 2J8GA 3ARTA 2QMKA 3GBEA 1E6QM 3OLDA 4WIWA 1E15A 2IUZA 4AD0A 1GOIA 2VX5A 4LYRA 3KZSA 5ABEA 3VM7A 4HMDA 5GQBA 1KR1A 1R8LA 4ML4A 3WDRA 5KZ6A 1ISZA 4D1IA 2J47A 3J7HA 3BAXA 2UWFA 4R27A 4XUYA 4AMCA 1HX0A 1X1NA 3I3EA 4AD1A 3BAJA 4Z2LA 4HA4A 3MS8A 1E70M 1D7FA 3PZGA 4GI9A 2VCAA 4CKQA 1JYWA 1XHGA 1L8NA 1SFSA 5BXPA 2BXZA 4HOWA 1UR8A 4UFIA 5I6SA 2JEPA 5I5RA 4LPCA 2G4FA 1CGTA 3O6AA 3L4VA 1V0MA 2X0YA 3NDZA 3CIVA 2WHLA 3MSDA 1UOKA 4IM4A 1E72M 4JFTA 2OWCA 3W6MA 1UWQA 2WVSA 3CZEA 2WMJA 3UETA 3VINA 1G94A 2ZWYA 3AZTA 5D8ZA 1DHKA 2RGLA 1PIFA 1LL7A 3RIKA 1AMYA 1PX4A 2O9PA 3GH4A 4RE2A 1B1YA 4AYSA 4GZJA 1QNQA 3WD4A 1OBAA 1XSKA 1IV8A 2JFEX 2V3GA 1GVYA 2ZUTA 4AZ6A 2XUCA 2J62A 3FXYA 2DH2A 3OB8A 3BCDA 3WEZA 1HP4A 2B31A 1OM0A 4HOXA 5BYWA 1WDRA 3DHUA 4U2YA 1EO5A 3VIGA 3BAYA 2WLZA 2VQTA 4D6HA 3CUJA 4DWSD 4PTVA 1BYAA 1JAKA 4CD5A 4UOQA 4MAZA 1J0IA 1UYQA 2ZXBA 4W87A 5JBFA 3AHZA 1UWSA 1ITCA 5DEZA 4UZUA 1I1XA 1GQLA 1HKMA 3FNDA 1K9DA 5M03A 1NWUA 1PAMA 1XSIA 2XFFA 1UR2A 2NSXA 1UD4A 4C7DA 1UD3A 4CUCA 4XZWA 4CU8A 1JD9A 3M46A 1O6IA 2ZUWA 4P7OA 3DYPA 3NDYA 3ECQA 3RPMA 3BMVA 3W38A 2JALA 3SCUA 3PZUA 3F5KA 4PSRA 1QNRA 1VENA 2A3BA 2O9OA 5A8PA 1ESWA 3ZR5A 1HJSA 2DSKA 1EXPA 2QPUA 4IUGA 4FK9A 1B0IA 3K46A 4A3HA 3NIYA 3AFBA 3WD1A 3THDA 4KGJA 4J27A 4UR9A 1Y7VA 3ZJ7A 1V6VA 3AS0A 3WQ4A 4TX6A 4CVUA 1QVBA 1WNOA 4EE9A 3OLEA 1Q6EA 4CCEA 2A3CA 1UD2A 2VMFA 2E3ZA 3CTTA 5CPTA 1MW2A 3VIJA 1W2VA 2NT1A 4AD5A 5C71A 3U5UA 3VX0A 3WDIA 1B9ZA 3W37A 3OIHA 4MNKA 5A8MA 4IPLA 4D6EA 1B3WA 4AZ5A 4DUWA 4HPHA 1CPUA 3WMSA 1E9LA 7A3HA 1KXHA 1BSIA 3RM8A 3PZNA 2CIPA 4QAWA 4F8XA 4F66A 5A6MA 1FFRA 4D6DA 2BNJA 3CZJA 1KXQA 4KMQA 1W3LA 3AIWA 1E5NA 1XH1A 3L2MA 4MTVA 4YN5A 3KL3A 4N42A 4PMUA 4BQ2A 2XFYA 3GH5A 1NQ6A 3N18A 4HU0A 1M01A 5FIPA 5I78A 4OKDA 4AZ7A 4CD7A 2D20A 3WEMA 1NP2A 2J75A 3BLKA 1CXFA 1Q6FA 2ZXAA 2OLHA 3UESA 4MB5A 1TMQA 3EBVA 4LQ1A 1HJWA 3WFLA 1JZ6A 2VVSA 2X0HA 2CYGA 3TTOA 3HU7A 2WANA 2WHMA 1ZL1A 3PZTA 1UD8A 2WM0A 5DO8A 3HMCA 4MPKA 1EIBA 1MQQA 4HZ7A 3WELA 1H5VA 1H41A 2GSJA 5C8BB 5IDIA 1AQMA 3ALGA 1H4PA 1MQPA 4AIUA 1LL6A 1WO2A 2JIWA 2G3JA 1PPIA 2FDMA 4HZ8A 4D6GA 1JD7A 3ZT5A 5GNYA 1FHDA 4W85A 1MFUA 1N82A 2ZX6A 3KEHA 1GOQA 1BYCA 2PBOA 1XH2A 4AZIA 2XM2A 1Z32X 3U7VA 3SCNA 4PMQA 2ZICA 2CBVA 4GO9A 2CHNA 3NCOA 3AMCA 1UA3A 1BHGA 4HOZA 1ZS2A 3W81A 1SMAA 3MUZ1 2ZXQA 3HN3A 2J78A 5D9OA 3L4WA 1JZ7A 1GOMA 3OBAA 3VGHA 1KQZA 3VDBA 1B90A 4KGLA 3B9EA 4Q22A 3VD4A 4MNLA 5EBAA 4ACYA 3ARRA 5CLWA 1GJWA 4JCMA 5FL1A 5I0DA 3TOPA 1NWSA 4DUVA 4TUFA 4B9ZA 4P7RA 3N12A 2WVVA 1QOXA 1TVNA 1G5AA 5A8OA 7CGTA 2VZSA 4TVUA 1U33A 1LG1A 1VJZA 2O9RA 3SCWA 3TA9A 2IXVA 5M17A 3AICA 1VBUA 5I24A 1FOBA 5LYRA 3T0DA 4U5KA 2A3AA 2D0GA 2W4XA 2XIIA 3CO4A 4E2OA 5JUVA 1E6ZA 3D3AA 2AAAA 1OCQA 1GHRA 1EHAA 1NWRA 4JKLA 4PN2A 3T09A 5DT5A 4ATDA 1XD1A 3WNPA 3ALFA 2ZUVA 4H8VA 5BRQA 2BHZA 3LPOA 3VNYA 5BWFA 3CUGA 4AEEA 1JFHA 4X0NA 1IT0A 4HPGA 3WUEA 1HKIA 4CVWA 1EA9C 4PYSA 3T0BA 4WK9A 1E4NA 1DWJM 1HVXA 4QCEA 4DWSC 2EO7A 3GNOA 2ZUNA 5M5DA 4PEEA 2J74A 3CZGA 3VOCA 2G41A 1XYFA 4AD4A 5BROA 1PX8A 1HIZA 4TTUA 3W53A 4W88A 2OYLA 1GOOA 3VIPA 1TUXA 4AZGA 4C7GA 4QLJA 2VC9A 1ZU8A 1OD8A 1GUVA 3ZOAA 5BXTA 2FHCA 3BAWA 1CXIA 2YKKA 3AYRA 3NSMA 1J0YA 2WAGA 4P8VA 2AOSA 2GJXA 1UQYA 1FH8A 4RE4A 1JF6A 4WSKA 1UWIA 4GIAA 3GXFA 1FH9A 5E70A 4CD8A 1BPLB 5AC5A 1C93A 2XWEA 1UR4A 3DECA 2GFTA 5JIWA 2J7BA 4PMVA 3SUSA 2ZUSA 4AWEA 4PCTA 1I75A 2WZEA 3PN8A 2YL9A 3EMCA 2BFGA 1CGYA 1V3MA 2XPKA 1W91A 2CESA 4GZIA 1KB3A 1GORA 3F5LA 5CSYA 4GI6A 3AROA 3WH7A 4DWSA 5ABFB 1JAEA 2XVKA 1XGZA 3D5HA 4D6FA 3VPLA 3PZMA 1EQCA 1H1NA 2FGLA 1QHPA 2IXUA 4HA1A 2WLYA 4CD6A 2DSVA 3NSNA 1Q6GA 2FHFA 1PX3A 1C7TA 3FHAA 2DIJA 3OZOA 3PTQA 2OWWA 4M24A 1JYNA 1EOMA 1SYTA 3K4AA 3VU2A 2XM1A 2XTKA 5BRPA 3II1A 1E5JA 3AISA 4D6JA 3S2CA 5C70A 1NWTA 4FLOA 3VMOA 4X0VA 4J3UA 4OBSA 3CUHA 2YOCA 1B3VA 1CENA 1EOKA 3L4TA 3M7SA 3IANA 2DT1A 1VBRA 3BSHA 2X05A 2CBJA 1R85A 2WSPA 2OYMA 1K9EA 1YQ2A 3VMPA 3BXWA 4GO8A 4JL2A 5A94A 2XGIA 1J0JA 4QDMA 1C7SA 1CGWA 2WCAA 2CETA 2CPUA 1GONA 5LA1A 4U31A 3A47A 1AQ0A 2WBKA 1W1TA 2XSAA 1UD5A 3SIMA 2V5DA 4EANA 1EH9A 1LQ0A 1UZ1A 1JZ2A 3WBEA 1V02E 3ARYA 1ZBWA 3B8SA 2QPSA 1OGBA 2JF6A 1DEDA 3OGVA 4J3WA 1V3KA 1BYDA 3KE0A 2GVYA 1FFQA 2XVNA 2DDXA 3A3HA 2HVMA 3LPFA 1W2PA 4D72A 2PWGA 5CLTA 4AIEA 4V2XA 3VDHA 2E9MA 2JEQA 5FL0A 3ZT6A 5CJ5A 3M07A 2JF7A 2VR5A 2CEQA 2W63A 2ZXDA 4H41A 1GZJA 3GNPA 1UHVA 1QNOA 3PBGA 1G1YA 2XFRA 3S6TA 2WCSA 1LG2A 2YDQA 1TVPA 5A1AA 1UR1A 1V6XA 1MW3A 4PMDA 1TA3A 3A4WA 5CSUA 3OLIA 2VJXA 1DWIM 2DEPA 3UR7A 5AYIA 2J77A 1VF8A 4ZENA 3ARXA 3UG4A 2BXYA 4OZOA 4GINA 3BCFA 3EMQA 1C3FA 1EDQA 3MMWA 4Y7EA 2UY3A 4W86A 1HNYA 2WHJA 1B3XA 3PZ9A 3VO0A 3WQ5A 2O9TA 1E0XA 1JGIA 2C8NA 1H3GA 4Z2JA 1GQJA 3QGVA 3K8MA 4QP0A 1MXDA 3WF4A 5I79A 1BLIA 1V3JA 2Y4SA 2WKGA 4MADA 4V27A 4JHOA 3WY1A 2DPEA 4U3CA 1VEOA 1UR9A 4KH2A 1UH4A 3SCTA 1B31A 4P8UA 4H7VA 3KL0A 1RP8A 2WKLA 2E40A 3WH8A 3PZVA 1V0KA 3W82A 5TD4A 1IZJA 1E6XM 1GW1A 2YBTA 1F4HA 1MYRA 3GXDA 1H0IA 5DT7A 2G8ZA 4WLCA 3UR8A 3AXHA 2VCBA 4PMOA 1TZ7A 4JFUA 5DF0A 5JBDA 3FAXA 1C8QA 4FLQA 2O92A 3PZIA 2XVPA 1UR0A 4M1RA 3DYOA 3OGSA 1C90A 2VRKA 3FN9A 3QHMA 1D2KA 2VUYA 1J18A 3WNLA 3SUTA 1KBKA 3CHDA 3TTYA 1GJUA 9CGTA 2X2YA 2EEXA 1KXTA 1WB0A 2BY2A 3UG3A 2MANA 2J79A 5CZKA 4NSBA 1UD6A 2QHAA 2FH8A 1BVZA 1D3CA 5HOSA 3VILA 4B16A 4BS0A 4JCLA 4JIEA 3N15A 3AS1A 3VD9A 4C91A 1QPKA 4UFLA 5ABFA 4ATWA 4WKAA 3RO8A 2WMIB 3WQ6A 4HTYA 3AIRA 3VMNA 4U33A 4ZE5A 4Z2HA 2F2HA 4NF7A 2VX7A 5FD0A 1VFFA 2D0FA 2PBGA 4ZE4A 2VO5A 1E4LA 4MNMA 4M81A 4E8DA 1JZ8A 4F79A 2EPNA 4TXEA 3IK2A 3RJYA 3QHNA 5FKYA 1R87A 1EGZA 1ZJAA 3CLWA 2Y5EA 5AC4A 1KXVA 2CKRA 3ZM8A 1CYGA 1XCXA 2J8FA 3BH4A 1ECEA 3WKZA 1ZB5A 2YL8A 1BGAA 3ARWA 4GI8A 1ZJBA 1E6SM 3T0AA 3RJXA 5FCZA 4M80A 3K1DA 3WDHA 4TX8A 2E9BA 1NH6A 1LWJA 2CXGA 1ZBVA 5ABGA 3AIQA 2XIBA 1FH7A 2W62A 2VZTA 5CG0A 3W25A 4Z2IA 4D6IA 1HL9A 2WHKA 2WZHA 3MUIA 2UY2A 1V3LA 5A2CA 3PZQA 4QFUA 3U57A 3T2PA 4UFHA 3WF2A 2WCGA 1XH0A 1NP0A 1OIMA 3A4AA 1EO7A 3WQVA 1E1FA 2EPKX 1MXGA 2TAAA 5A8NA 2ZE0A 3SCOA 3VIHA 3QOKA 4PTWA 1I1WA 3QHOA 1W1PA 1V0NA 3OLGA 3NSXA 1BGGA 4J28A 4JZ5A 4U2ZA 1Q6DA 1H49A 4U3AA 3AOFA 3L4YA 1KGXA 3WF1A 5A6AA 4MB4A 5IHRA 3I3DA 1JZ3A 1W9XA 2ESCA 1QHZA 1JI1A 5I23A 1MQRA 3WD0A 1TCMA 1XCWA 2HISA 4UZSA 3WUFA 2EJ1A 2G3MA 1W32A 1XD0A 3WNMA 2ZUMA 2DSZA 8A3HA 1V6WA 1DP0A 1QNPA 2J4GA 3VVGA 3TONA 4FLRA 2CCRA 1UKTA 4R5EA 1J0HA 3GBDA 2BHUA 3W28A 1JNEA 1ISXA 1E3XA 1Q4NX 2WC3A 1UWUA 2YA2A 1PJ9A 1HF6A 4W8BA 1OT2A 1HKKA 4E8CA 4Z2KA 5I3DA 3RDKA 1V6UA 4BF7A 1UH3A 4AZBA 5A8QA 3WF3A 1K9TA 1LWHA 2J7GA 4PMRA 3OA5A 1HXJA 2CBUA 4L4PA 4W5ZA 4AD3A 2EXOA 1JDDA 2WBGA 3TP4A 2YDRA 4D6CA 3N04A 1NOWA 3WFZA 3T2OA 1QI0A 3APGA 4UOJA 4UQBA 4MB3A 5HBFA 3AI0A 1IZKA 1GOKA 2G3NA 3AS3A 1OIFA 3O2LA 1JI2A 5BXRA 1MFVA 4ACZB 2BV9A 1WDPA 2J25A 1CLVA 2XYLA 5CQ1A 3VTRA 5I77A 2BHYA 3SUVA 1HJQA 1VEMA 2YA1A 1QI3A 4TVCA 2Y24A 2OSYA 5HPCA 2PI6A 3CZKA 4PCSA 1VFMA 2Z1SA 2FH6A 3VKKA 1FA2A 3NUKA 5CGTA 1X6LA 3DHPA 2ZX7A 3VNZA 1JZ5A 4W93A 5A6JA 4QLKA 2X09A 1HT6A 3PTMA 2C0HA 3CBWA 4B9YA 1BVNP 1PBGA 3B9AA 4MJ2A 4W84A 2BY3A 1DWGM 3ARPA 4CU6A 3U7BA 1JG9A 5IFPA 3WENA 2QMJA 3WN6A 1WZAA 3CZ8A 4BCEA 4BQ3A 2W67A 3O9NA 3ARQA 4KRUA 1GPFA 1US3A 3FAWA 1GVIA 1SMDA 5M3WA 3OZPA 2YL5A 2WMFA 4XB3A 4H04A 1U2YA 4PUDA 2DT0A 2D0HA 1J0KA 3BLPX 1LLOA 3ZSTA 4P8WA 3AHVA 2GUYA 3KWXA 2PF0A 3AQUA 1K9FA 2W61A 4X9YA 2XJ7A 1JDCA 1H0GA
chains in the Genus database with same CATH superfamily
1PDYA 4N9BA 4K1GA 1BTMA 4IWWA 3SUUA 2OU4A 2H9AA 1WKFA 3WLSA 1KFLA 3DBNA 3AALA 3HPFA 1O94A 1N2VA 4JQAA 2H8ZA 4J2PA 1XLKA 2I5GA 2WW5A 4O1FA 1W5NA 4KRTA 4BJHA 1RY0A 3B04A 5K9DA 1XIGA 3B0XA 3GTIA 3M47A 1KFWA 1F76A 2BWGA 1PUDA 1OT1A 3KBWA 1H7XA 3JU2A 2BZNA 2YDSA 4XBKA 1HO4A 3WNKA 1CIUA 3W26A 1XIJA 4MF4A 4DN1A 4M6VA 1JDEA 1SR0A 3WQWA 3AO0A 4ORMA 1FKXA 2JGQA 3WZ0E 2QV4A 2YX0A 4Z2GA 4EPDC 1EA0A 2NV9A 3R58A 3SN1A 4CNSA 4YHEA 1FDYA 3IIXA 4UFKA 4GYJA 4IIFA 1DJNA 1E6RA 3CGTA 4OWGA 4J5NA 2VL4A 5G4HC 5A95A 4XKMA 1NF7A 1W1YA 4N6EA 4O19A 1PIGA 2GDUA 1UC4A 3M0ZA 1JCNA 1IXOA 3UY7A 5HULA 5D2YA 4DXXA 5G4WA 3VIOA 2FVMA 2CU0A 2F61A 3AU6A 3O6YX 1GCYA 3FY1A 1PZ1A 4GLEA 2FZMA 3N29A 1NU5A 3QGAC 4I5RA 3GR7A 2V6AA 1IR2A 3COTA 1OSEA 2DUAA 2CLKA 4C1NA 4EOUA 3BG3A 1EX5A 3GB6A 1QATA 5HNRA 1R3SA 4IHCA 3KVMA 3WD3A 4BQ4A 3VA8A 3GK0A 3B4YA 2BVTA 6XIMA 4ZFMA 3R25A 1VR6A 2YXOA 2NV1A 3R10A 4O54A 5REQA 1T96A 3GAKA 2VFGA 1Q7ZA 3UVIA 2X0SA 4Z0JA 4TR9A 1BD0A 4UCFA 4HIBA 1HO1A 4IG2B 4WQ6A 2PWFA 2ABBA 4GACA 3T8QA 4JAWA 4Y9AA 3CH0A 4Q8QA 4W8LA 3ZIZA 4JKMA 2WVTA 3W24A 3EMZA 2ZA3A 2W66A 3E2VA 4ROQA 3CQKA 3P3BA 4K8HA 3NYZA 2YFOA 4AWUA 2VZOA 1EJRC 4BK9A 3EWUA 4HMEA 3VYLA 4NY2A 2IPFA 2PLKA 2OQHA 3KDOA 4IISA 3TCSA 3QY6A 4I6VA 5EY5A 3CQHA 4BQ5A 3H2MA 3CWNA 1P6WA 4TO8A 2VUNA 4JFSA 1WZMA 4REQA 3E1F1 4GJIA 2R1NA 2GUUA 3KS5A 1FHVA 3I4EA 4GXPA 1UPPA 4OFCA 4S3EA 1JCXA 3N6JA 3VGEA 5DY3A 4AVNA 3OPSA 3N1AA 1J10A 4Z0SA 3ZJ6A 3W29A 4U10A 1SO6A 3HG3A 2X1TA 4YVXA 4OGZA 3BLDA 3PJXA 4KWUA 3VGBA 1GG1A 1PDZA 4JN6A 3W0KA 5HJXA 3P81A 4HJWA 2XVLA 5IOBA 4RZ6A 3ARSA 5CH9A 2FKPA 3LHZA 2PTXA 3IAPA 1V02A 3RK8A 2PC8A 1F7BA 3BW3A 4A21A 3UU0A 1OFDA 1HUVA 4HN8A 3SGUA 1DPMA 1W37A 1O68A 1EFZA 4LNCA 1KR0A 1W3KA 2VT0A 4BF5A 1OGGA 4LC6A 3D3FA 1HJXA 3DHDA 1VFOA 4OVXA 4BKNA 1N7KA 3BAKA 4W4QA 2CERA 3M6DA 1TV5A 3CB3A 1WZKA 3IJ6A 3MUAA 4FXJA 1AD4A 1VPQA 1UCWA 3KVKA 3LPGA 1TFVA 3NQGA 4KS0A 4XBJA 2NWSA 4JTIA 3SN0A 1GKQA 2J88A 3K8LA 1J12A 5A6BA 3LHVA 1G4PA 4KW2A 2WK2A 1OFEA 3L4UA 2QUTA 5D9MA 2CKSA 4RNHA 2OELA 3LNMA 1UA7A 5A3HA 3DZ1A 2DH3A 4AW7A 1FHLA 5XIAA 2TSYA 3V36A 3PVFA 3LENA 1S3HA 4K8GA 1X6NA 1GVSA 2QUUA 4XBSA 3VX1A 4DZAA 4JFVA 1IT8A 4Q4RA 1U5VA 1K1DA 4ZQNA 3CHEA 5BOFA 3WO8A 3U5YA 3WG6A 1LBLA 2V63A 2E25A 2EPOA 4WKHA 3TR9A 2ZVIA 1MUCA 5DFAA 3JUGA 3WIJA 1TMHA 3OOQA 2D1ZA 4NZFA 2J13A 3FYPA 2WPGA 1A3HA 1TG7A 1GVEA 3O0KA 3RAOA 3AMLA 1WBJA 4FEZA 4P7QA 2YW3A 1XLMA 4PUEA 4F2TA 1TA3B 2ZRYA 3L2IA 5F1VA 2BXVA 2CITA 1SFJA 4US6A 4GOAA 4A22A 2QJMA 1Y65A 1JPHA 3KCOA 3HGRA 1E0WA 2QLYA 4N0RA 2WJFA 3M0MA 1T41A 2CNCA 3CUFA 4CQ8A 3FIGA 2V5JA 4ERGA 4E2DA 1GGOA 1XSJA 2NXGA 2INZA 3Q45A 1QR7A 3TW7A 5FESA 1XYZA 4LX4A 3W7KA 2FLIA 2YIHA 4KCUA 1MI3A 4BI5A 2JIEA 4WD0A 2F6KA 2Y0FA 3SIZA 4TOQA 4EPBC 4HMCA 1Y5VA 3A3XA 3NL5A 3W7QA 3TK7A 3ITOA 2EQDA 2VKZG 3IRSA 5AKQA 3N13A 3BGAA 3EB2A 3IUDA 3WUBA 2ZA1A 5F7UA 4PCPA 3RILA 3TW6A 4TMBA 1BKHA 4GQQA 1TE6A 1K8CA 2PCEA 1E71M 5AFDA 2P1FA 4OIFA 2DT2A 1EP2A 4PMNA 1MEWA 4B4HA 2F7FA 2DIEA 1JPMA 1DWAM 3ENLA 4YPJA 2GVJA 2J7HA 3E2SA 2AQOA 1VS1A 4CN6A 4NYUA 1PTGA 2OWXA 1EJVC 3HQNA 2VX6A 2YA0A 3SN4A 2VDGA 3KOXA 1UWAA 3Q94A 3BLLA 3BOFA 3FYYA 3KHDA 3WLQA 2Z26A 5A6BD 5HPOA 4HHMA 3WF0A 4CD4A 3L0KA 1UOZA 5AB3A 1QWGA 2J7DA 2WVVB 3VGGA 1FBAA 4IGHA 3N11A 3LHWA 2P8CA 1XX1A 4A8LA 1H60A 3FSTA 3VFCA 4MZYA 3G1VA 4PR4A 3MBFA 4MAVA 4GH1A 1FKWA 1OYCA 1ML1A 4GX9A 1K8YA 1V51A 2HVOA 3UG5A 5D8WA 1MWOA 1Z48A 3GDBA 1CT5A 1V3IA 3B8WA 3OVQA 1IHIA 1JXJA 1QCWA 1KFEA 3T9PA 3G24A 1PWMA 4NILA 4OV4A 5GJPA 4XG1A 5E0CA 3HOJA 5CPMA 6A3HA 3TFCA 1XL9A 4S3JA 4KEVA 3VUSA 4LXFA 3WCZA 3QF0A 4A8RA 2IQ0A 3LGDA 2W3ZA 5I02A 1KM4A 1B9BA 2OODA 4GRSA 4C6QA 3AMKA 3WJXA 1DTUA 4AXNA 4RZ4A 2JGYA 1VRXA 3RM4A 4AX6A 4DB7A 5I3KA 1P1XA 1AMKA 3I4KA 4E5TA 4ZO6A 2E6FA 2PDYA 5CPLA 5G2WA 3A21A 3CPUA 2E77A 4B15A 3RITA 3CYVA 1WOAA 3OG2A 5FJTA 2F2KA 1DJHA 4CU7A 5K2ZA 4LYPA 4E4PA 1U1JA 1JFXA 4PRWA 1DJIA 2ACRA 2H3DA 3CV2A 1JCYA 2Q3RA 2VHLA 2O4MA 1IXPA 1PTAA 2BVYA 2AKMA 3UYCA 1NOUA 2BVDA 1OB0A 2VEGA 3W27A 1FQ0A 1FTXA 3KCLA 3W85A 4OOUA 5U4NA 2A5HA 3TJIA 4K6AA 4PMXA 3R79A 1V77A 2DJXA 1KWGA 1KM1A 1TR1A 4Z42C 1H51A 1TKKA 1CLKA 4QCFA 3S83A 3A4XA 1X8FA 1RBOB 1F8MA 4NT0A 3S2NA 3E3HA 5AN7A 1I2QA 1V4YA 4IPJA 3EEZA 4FPSA 3B8IA 1CB7B 1OCNA 3WLIA 1C9WA 1EGMA 4WY0A 3OHIA 4YTTA 1WQ5A 5EMLA 3HA1A 3NVTA 1L0PA 3S42A 3QZ6A 4ATLA 4AUBA 4JTUA 3A9IA 4B3KA 1NELA 1UWRA 2VGFA 1JCLA 2OSWA 4GQBA 4GVHA 3RCMA 1AG1O 4ASTA 1JJKA 3M0LA 3GUGA 3EGJA 3WDQA 4NJIA 1T40A 5IDZA 1K6AA 3L68A 4RW3A 2NXIA 1XLGA 1U5HA 1FP8A 2VZVA 4UWMA 1KM2A 1ONRA 3THCA 1UWTA 3FW6A 3UT0A 1M6JA 3FJ4A 2BY1A 2QDDA 1S46A 3ZFHA 3VK5A 4A29A 4JNZA 2ANUA 1QRQA 4YL2A 2WKJA 3GBEA 3RU8X 5LNWA 3O8AA 4YWIA 1E15A 3M1ZA 1F73A 1O66A 1GOIA 2VX5A 4KESA 1QAPA 5ABEA 2EG6A 4MWAA 2IMRA 1R8LA 4ML4A 3WDRA 3BO9A 5CSSA 1XYBA 2Z2AA 3TOYA 4NNBA 1B3OA 1K7XA 5EMKA 7TIMA 3M7WA 4R27A 2ALRA 2OLSA 4AD1A 3BAJA 3SRKA 4AX7A 4Z2LA 4O15A 3M44A 3U4FA 3PZGA 4M0XA 4GUFA 1RK5A 1SZNA 4XK2A 2YB4A 3VOFA 1CGTA 3S0CA 3BQ5A 3W6MA 4RDVA 4GY0A 3VINA 5D03A 3AZTA 1KFKA 2RGLA 1PIFA 4EPKA 3RIKA 1S2VA 1PX4A 1B1YA 2QDHA 3WD4A 3EX1A 1IV8A 3LERA 3STEA 5B80A 3DBPA 5KZDA 1FWNA 4AZ6A 4O1BA 1GG0A 3FXYA 3OB8A 3BCDA 4OV9A 1QK2A 1HP4A 4C6NA 5D30A 4KRZA 1WDRA 4S23A 3W3OA 2HRWA 1FWRA 4HG6B 1EO5A 3VIGA 2C91A 4H9VA 1SZEA 1XFBA 2YXXA 2ZXBA 1A4LA 3AHZA 3PB2A 1ITCA 5DEZA 1ZGDA 2C79A 1I1XA 3ZVHB 4DNHA 5DQPA 4PFMA 4LEFA 1EKOA 1T7LA 4DLFA 1NWUA 2ZFAA 1UR2A 5ENLA 3M0VA 1WA3A 1UD3A 4HNUA 4O1EA 2PZNA 1E51A 1Z41A 1EJ7L 3S2MA 1YNYA 4XD5A 4PSRA 1QNRA 4A3RA 2O9OA 1DJXA 1T99A 1YYAA 2DSKA 2QPUA 3UNDA 3AFBA 3WD1A 2X41A 3THDA 1F6KA 2A4AA 3A5FA 1SR9A 3T0TA 3P5ZA 5G2HA 4I9TA 2F38A 3AS0A 4DYKA 3GDMA 1QVBA 1W5MA 1Q6EA 2FDSA 4CEUC 2A3CA 1UD2A 2WOQA 3LK6A 4ERAA 3VIJA 1JQXA 3H2OA 2NT1A 3ANYA 4IFOA 2ZDSA 3U5UA 4AF0B 3WDIA 1E9IA 1JCTA 9XIAA 2ZRXA 2WNNA 3WMSA 1E9LA 4DJDC 5TNVA 3MYOA 1W54A 3RM8A 4JR5A 1PYFA 4L4MA 1HZYA 1FUYA 4D6DA 2BNJA 2RAGA 3W88A 4IT1A 3R8RA 4KBXA 1E5NA 1YPFA 1IIGA 3L2MA 3W1NA 4MTVA 3Q58A 1DE5A 3HGSA 2EKGA 4PMUA 3W23A 4CQDA 3GH5A 1J8VA 3C2YA 3EOEA 4ZQCA 1TSIA 2D20A 2Z7GA 3SW6A 3WEMA 1EZ2A 2J75A 3QRHA 4QQ3A 4IIGA 5FSEC 3WJSA 4MB5A 3EBVA 4LQ1A 4JGDA 3PAOA 2VVSA 1TWWA 4J4KA 4UNLA 3HU7A 1ZL1A 3PZTA 1UD8A 2B0MA 3HMCA 4MPKA 2V30A 4V33A 4C1LA 3ITGA 2FVKA 2ISFA 5H91A 1H41A 2GSJA 5C8BB 3BK0A 3U0HA 3ALGA 4JQ1A 1RQHA 1TX0A 3NQMA 1H4PA 4AVFA 4AIUA 1WO2A 2JIWA 1PPIA 2AL2B 1JD7A 3ZT5A 5GNYA 1BXBA 1MFUA 1N82A 2VFIA 1P0NA 2TMDA 1S2WA 3ZLFA 3T4CA 3SCNA 1RLCL 2CBVA 4BY3A 1ZS2A 2INEA 2ZADA 2Z1XA 3NQ8A 5H8PA 1XYMA 3OBAA 3VGHA 3VDBA 1B90A 3JRKA 4E38A 3B9EA 2B7QA 4MNLA 5EBAA 3FKKA 5D2TA 3M0YA 3KX6A 1NEYA 4L64A 3RR4A 3KRUA 4ZOBA 5I0DA 4TUFA 1V5XA 1QOXA 1G5AA 1Q4WA 2B7OA 1C9DA 5F1UA 4TVUA 4QXIA 1MEHA 3TA9A 5M17A 2Z1WA 3SB0A 3G1XA 1FOBA 1YTKA 2Z1VA 5LYRA 2OCZA 2OEKA 4L4LA 2A3AA 1VCVA 4N2YA 1KRAC 1E6ZA 1FCQA 3H7UA 3P7YA 1NWRA 3PPCA 5CC7A 4PN2A 3IVTA 1ZJHA 2BG5A 4C60A 1BVWA 3T0CA 1O4UA 1X98A 1EC9A 1MRQA 2CHRA 3SJNA 1OVDA 3LPOA 4BHYA 3CUGA 2YPIA 4FP1A 4CVWA 1JVNA 2VD8A 3S47A 4N02A 1E4NA 1DWJM 2B7NA 4L6OA 2IPJA 1AH4A 2EO7A 3DN5A 2ZUNA 1Q8JA 4ZCWA 3FEQA 2PP0A 1Q8AA 4PEEA 4S3DA 4AD4A 1PX8A 4TTUA 3KTCA 4W88A 1PHWA 3NPVA 3FGCA 1JEZA 1TUXA 4C7GA 3GD6A 2VC9A 1OD8A 4R9XA 1GUVA 4DPQA 3BAWA 1F74A 1CXIA 1J0YA 1XR2A 3M0HA 5BU9A 2WAGA 2AOSA 2DP3A 4ENLA 3W2LA 1FH9A 4CD8A 1XIFA 1C93A 1YTDA 2XWEA 1K4HA 3DECA 2GFTA 2J7BA 2R91A 3Q4DA 3KP1A 5I07A 4PCTA 2O7SA 5I06A 1P6CA 4QE5A 1YDOA 1LP6A 2GJLA 4QS6A 4O28A 2CESA 2VDHA 3UCCA 5CSYA 5C2GA 3AXMA 3AROA 4GI6A 3WH7A 4DWSA 2GSHA 2GYIA 2VENA 2W27A 5BOEA 4HMNA 5C2CA 1EWEA 4CD6A 1Y0EA 3GU9A 3IJQA 2FHFA 1PX3A 2DIJA 1QDSA 2OWWA 4EIVA 1O5XA 2E67A 1XRSA 1UB3A 4JEQA 2XM1A 2WJZA 1EJUC 3S2CA 1NWTA 4FLOA 4PTDA 3VMOA 2L5HA 1RY8A 2YOCA 1B3VA 5G2IA 1EOKA 3L4TA 2QW5A 3M7SA 3IANA 1A0EA 1PSCA 3LHTA 5K7JA 2HMCA 2O4QA 4GCXA 2X05A 4IX0A 3RLHA 3VFLA 1L6SA 4IPIA 2CBJA 2YYTA 1K9EA 4M6QA 1PCKA 3VMPA 3BXWA 5A94A 2XGIA 4QDMA 1BWLA 1C7SA 3LD5A 4QG9A 4AY8A 5LA1A 1NDZA 1PKNA 3KS6A 4U31A 2WZMA 2WBKA 3N4FA 1UD5A 5DX7A 4EANA 1UZ1A 1JZ2A 2BTMA 4X2PA 1V02E 3ARYA 2QF7A 3B8SA 4IF2A 3KAOA 1DEDA 1SO3A 3OGVA 1V3KA 1J96A 1FFQA 2DDXA 3A3HA 4HBKA 2HVMA 1J2BA 3LPFA 4GZ7A 1N8FA 2DY3A 2UBPC 4V2XA 4L80A 3VDHA 3TYDA 3N14A 2JEQA 3WBXA 2G37A 2YGYA 5HWMA 2F6XA 4HSNA 2WV8A 1G1YA 2XFRA 2FZNA 2ONEA 1Z89A 2ZTJA 3IGSA 2CZVA 3NAVA 3C4UA 4JNMA 3S46A 1DWIM 1W1ZA 3BARA 4O57A 4XSMA 1MDRA 1VF8A 2BXYA 4JXCA 3BUVA 4WGHA 2ZZ6A 4NZ4A 5DMMA 1W8SA 1B3XA 2QCEA 2RDUA 4Z2JA 3NL3A 3KRBA 2E1DA 1FDZA 5M2FX 3K13A 1J5TA 4FNPA 4L61A 2WKGA 4MADA 4V27A 3N2MA 1VEOA 5KZEA 3QV7A 3SCTA 4P8UA 4ROPA 4MWAD 4CNNA 3KL0A 4OE7A 1BRLA 3LN3A 4JBRA 1VCFA 2E5CA 2C15A 4XO7A 3LU2A 1E6XM 1GW1A 5FF0A 3GXDA 4LY4A 3T42A 3NGFA 3UR8A 4I8YA 4IL2A 4JFUA 1Q6LA 3CEPA 4JX5A 3DYOA 2DU2A 1C90A 3FN9A 2CZ5A 3D46A 1TTJA 2VUYA 5JVLA 3BV4A 4A6GA 4RZ5A 2E6YA 3SUTA 2UV8G 5IBXC 3CHDA 1ME7A 3F4WA 3ME3A 5D38A 2X2YA 2EEXA 3L5MA 1KXTA 1WB0A 3UG3A 3G0SA 2J79A 2QHAA 2FH8A 1IE7C 4E6MA 3WLRA 2CC0A 3VD9A 4UFLA 3A12A 4M5PA 3FX4A 1RLDA 3GFXA 3RO6A 5B7YA 1YPIA 4HTYA 3AIRA 3DCPA 3QMSA 1R3QA 1VBHA 2QT3A 4U33A 2XN2A 1ZZMA 4JTGA 3T6CA 4IJBA 4ZE4A 4KWWA 3CV1A 3EA1A 1XXXA 1EYEA 2PD5A 3UY8A 4TXEA 3RJYA 2LLEA 3PFMA 3QHNA 2X42A 3SRHA 3H8AA 3CLWA 3EZ4A 5AC4A 1DV7A 1XCXA 3BH4A 3WKZA 1NQKA 2C6QA 2YL8A 1ZJBA 1FWFC 3IIVA 2PRHA 3VDGA 4PBFA 2ZRVA 1OYBA 1LWIA 4K3ZA 4J35A 4GA8A 4M80A 5EIYB 3K1DA 4TX8A 1IGWA 1ZY9A 2I9UA 3DFNA 4LF1A 2VZTA 1TCDA 4CNUA 4AH7A 4QGCA 1V3LA 3VOJA 4Q8UA 1GKPA 4H6KA 4UFHA 1TPEA 3WF2A 3TXZA 2WCGA 1LCOA 3PBWA 2OZ8A 4ZQPA 4AEOA 1OIMA 2FFIA 3H70A 3IPWA 4PTWA 3QOKA 1I45A 4JIHA 5J5RA 4YLWA 1Q6DA 3HQ1A 5GVJA 4LW7A 4MB4A 4HK6A 1JZ3A 1SU5A 3CB8A 1VGAA 1QHZA 1JI1A 3W7OA 2R1PA 4FS9A 3K1GA 3CV6A 1TCMA 3WUFA 3N3TA 4RR4A 4UMCA 2ZUMA 2DSZA 1RALA 1SGJA 3MWCA 2NLIA 4WOQA 3VVGA 2PDCA 3AC0A 3M5YA 3STPA 1J0HA 5HR6A 2PDLA 2OQLA 3QQWA 1Q4NX 1UWUA 3DFYA 1PJ9A 4W8BA 4LUSA 4AZBA 5A8QA 1HG3A 3FCPA 2J7GA 3G8RA 4X2RA 4B5NA 4L4PA 4AD3A 4UUIA 2WQDA 4OQVA 4G9PA 1IQ8A 2QAPA 3DKJA 4D6CA 3N04A 3SSJA 4I9AA 4JTLA 4UOJA 3PJWA 4MB3A 4UTTA 3V7PA 1P7TA 3RLGA 4EF8A 1GOKA 1AZ1A 3BE7A 2G3NA 4H00A 1OIFA 4DPPA 3PBVA 1PWLA 3ORWA 1JI2A 1YE6A 5DCDA 2J25A 1CLVA 4KERA 3A24A 3VTRA 2BHYA 1VEMA 1QI3A 1VPXA 3LV6A 1F2JA 3NUKA 3DX5A 1A0CA 4ZB2A 2ZX7A 4J1OA 2FPTA 1QNVA 1S2AA 3S5ZA 3VKDA 1HT6A 3GG1A 2P0OA 1UZHA 1EYWA 3B9AA 3Q67A 3VCRA 4MJ2A 4W84A 1DWGM 1P4CA 3WENA 5I3IA 2QMJA 3WN6A 1UROA 5KMYA 4QDWA 4UXDA 4A35A 4HN4A 3DEQA 3KBSA 1P0DA 2BGNE 4YU1A 4Y9NA 3FA4A 1YDYA 1SMDA 5DBTA 1FWDC 1M7OA 3OZPA 3U2OA 2WMFA 1U2YA 3UNTA 3BPWA 1WYIA 3ONCA 4PH6A 3BLPX 3FA5A 3NQFA 3AHVA 1MDLA 3KWXA 3GLCA 1TUFA 2XJ7A 5CAKA 4GNVA 1A80A 4UTUA 1LZOA 1W9UA 2ZTKA 4IZGA 3UWVA 3EOLA 1FCVA 3GC5A 2EPMX 1XJBA 1DQXA 1YHTA 4UTFA 5DMYA 2BGQA 2PDBA 4RUBA 4RNFA 3S8HA 1DE6A 3TN4A 2FYMA 3M16A 5AVNA 3ABZA 2R1KA 2FMNA 4QROA 4MUZA 5DY2A 3AHXA 5E93A 1R86A 4JIIX 1GTEA 1KKOA 4GZEA 2WWCA 3ZT7A 3FJNA 1B3ZA 1UKPA 3ITYA 3L21A 4S3KA 3SR7A 1VYPX 1CTNA 3WBYA 1KCXA 2QV5A 1R3RA 4OECA 1W1A1 3QW3A 1KBLA 4LBSA 4P7NA 4GY1A 2V5LA 3T08A 1POKA 2OX1A 4FNRA 1CGXA 3NO3A 5E9AA 2HPMA 3B05A 3A64A 4AG0A 1UP0A 1R3TA 3UGRA 1XCFA 4ILSA 1M03A 4B91A 1BG4A 3IGUA 4H8UA 3PWAA 3AS2A 1EB3A 5CXPA 4H8HA 5EU9A 4OJYA 3L0NA 2BS9A 3NZRA 4PGLA 3SI9A 1JF5A 3ARZA 1JDAA 3BGJA 4MNJA 2ZX5A 2I57A 1OCJA 4IQJA 2GK1A 1VPYA 3GNXA 4F0KA 1A47A 3DFOA 3IARA 4IXHA 3UP8A 1WUEA 1H09A 3ZLGA 3ZJ8A 2HE5A 3HJEA 1GQNA 1V08A 3GVQA 4O11A 1I0BA 4G56A 1LJYA 5IM51 4Z1AA 4PZVA 2G97A 3R2GA 3FHQA 2ZUUA 1YNPA 3GFZA 4EVZA 4DAIA 1ME9A 3B40A 4UTTC 1NDYA 4FF5A 4V15A 4B92A 4AVOA 5C9ZA 2GJRA 4HK5A 4GNKB 3CH9A 2CLPA 2WPBA 2C1IA 3M5VA 3O3RA 4UQCA 3RX2A 3W1TA 3ES7A 3S9ZA 1WKDA 5HMEA 4W7VA 3ZQ9A 5E09A 4QR6A 1SW0A 3WSUA 4R88A 3SCQA 3KM8A 2C18A 1FP9A 2GQAA 2GQ8A 1SUXA 2QZRA 3W6LA 3WQPA 3MI2A 4TMCA 3F2DA 3AXIA 4AHPA 4P5UA 1QPOA 4X3ZA 2A3LA 1EC8A 4ZOAA 2HZGA 3W7LA 1MMFA 1GWJA 4IMFA 1AZ2A 4YMZA 4M6UA 1R0MA 2YLLA 4LBRA 4NJKA 2X2GA 4I9JA 1H1YA 4ZXOA 1AQHA 4MY8A 3HTWA 2BBFA 1OG6A 2DQXA 1ONXA 4FNSA 1JIBA 2D3LA 2WZTA 3VUPA 3W1XA 5K4ZA 1VFTA 3WQCA 3GIQA 4XKYB 2YYUA 3MKKA 2DQWA 2R8WA 4AQLA 3FA3A 2BDQA 2I7GA 2ALDA 1ZBKA 3BLIA 3B8TA 2XIOA 2PDWA 3HPXA 4XAPA 3QOMA 4LEQA 4MM1A 3R7MA 1TELA 1A5SA 2RFGA 3M41A 3ARVA 1J9YA 2AKZA 2Z1KA 4I6KA 2TRSA 3USBA 4E4FA 2PB1A 4EP8C 4L4OA 2C7FA 1CLXA 2OSXA 2P50A 2GJPA 5HNUA 5BCAA 3K30A 1XYCA 2OXNA 3W1QA 3NL6A 2KZHA 2ZZ1A 3QW4B 2PDMA 1OD0A 1RHCA 3W07A 1KWKA 4HK7A 3LCLA 1OFQA 1VZWA 3L9CA 2CBIA 1DXFA 2FHBA 3RX3A 1CGVA 1TV4A 1UUMA 2PU1A 4RV3A 3QTPA 4QEHA 1S1RA 1MO0A 1YADA 2R94A 1BQCA 3C56A 3PULA 2YCIX 1VFSA 1TZZA 2WMKA 1WZLA 3VIIA 1ONWA 2GPTA 2PODA 1H5YA 4BZYA 1JPIA 5H8MA 2X30A 2O55A 3UGVA 4DM1A 3WK1A 1TJ1A 4GHRA 3QMRA 1E0VA 3VD3A 3LTYA 3GH7A 3TQVA 1M3UA 3OU8A 3GXIA 2BODX 4Y8EA 3APTA 4MDOA 4HNCA 1T0OA 4OBTA 3P93A 1P48A 4J7RA 1F3WA 1R47A 2DZVA 5LA0A 2OO6A 4WCJA 2EBNA 3I6RA 1NARA 3C0QA 4GWEA 1A49A 2QVHA 4GPNA 4QTGA 3LUTA 3F4VA 4NAEA 2HK1A 2D22A 1XWYA 1XC6A 2HXTA 2QUMA 4Q8VA 1QI2A 1OFAA 2HK0A 5J8LA 2R1LA 2OT0A 3GSMA 4HSHA 6ENLA 5E6YA 1ZBCA 2VDIA 5CEWA 3APYA 1OWQA 3EEGA 1I2PA 4BA0A 4L5ZA 1S5NA 1F07A 2X8RA 1RUSA 1ZQ5A 2XGBA 1Q66A 1V7AA 5CZTA 2VRQA 1JXKA 1ZAHA 4JY8A 4LAOA 3AUOA 4J3ZA 4AIOA 5EJZB 2I14A 1JCJA 3H21A 2G96A 4HU8A 3WQEA 3CC1A 2JKEA 2OLAA 3C5QA 3ES8A 4MMWA 1UKOA 3WQ8A 2BOGX 4ADSA 4IIHA 3IACA 3UCDA 4IJCA 4JX4A 2E5DA 2VEFA 2C19A 3XISA 3VGDA 3MV01 4JHZA 1C8YA 5FOOA 2YXGA 4D71A 3EWDA 3G3DA 3FV9A 4BFAA 2ZCGA 3IV8A 1RCQA 5L6UA 1QOQA 2GUBA 4HYWA 1S2UA 3UJ2A 3E0LA 2FZ8A 2E4TA 1S39A 3B0PA 3ARUA 2VTFA 4DXVA 4MLJA 3P0WA 3AUJA 4JQ4A 3WDJA 1JZ4A 2EF9A 2J6XA 2POZA 3N73A 4MGGA 4HNLA 3W2JA 2CHOA 4JTEA 4DF1A 3AWNA 5EFFA 2PWUA 1WAWA 4US5D 1R9XA 3NQ7A 3ZR6A 3WX7A 1O7AA 4W7WA 2YZRA 4YXGA 1KFCA 1R7OA 4BEUA 2VR4A 3UD6A 4AFYA 1ONEA 2I5IA 3VABA 3UWEA 2D3NA 1E1CA 1RZMA 1YEYA 5LIKX 3W7HA 5D04C 2WMGA 1QMLA 5LGZA 3EDEA 4GE8A 4O52A 4QITA 4ZQMA 3MB9A 4Z17A 2AMGA 5CPNA 4B5TA 5K9CA 3DGBA 2HS8A 1K77A 3VZXA 5EKYA 1ISWA 3RLVA 3RF9A 2EGZA 3HM7A 4QLLA 3IAQA 1IEIA 1JL8A 1VD6A 4NZCA 4JKKA 1Z8AA 1EDGA 5HNNA 5C6MA 5LNVA 1W3NA 2QF8A 2NWRA 3FOKA 2R24A 5A5WA 3P14A 4ZEPA 3PZOA 3IWPA 3N2CA 3N17A 3LG3A 4CQAA 4ICMA 1J01A 3TTQA 3VGFA 1NFGA 4MWAE 2Q8LA 1PZ2A 3I3BA 3MSGA 1E55A 4WF7A 1OINA 1MVYA 3EXTA 2NQ5A 1QI5A 4NU7A 5AVHA 5GPRA 5I09A 3OG3A 4JN7A 1F61A 1HP5A 1TIMA 1DL3A 1O1ZA 4R53A 3W7NA 1ECQA 2FQIA 1UASA 3KDNA 1GVQA 4MSSA 4DJEC 2QCNA 2HNHA 2YFNA 5E6ZA 5EFDA 3QQ1A 3PC0A 1J79A 3VD5A 3A9BA 5F2LA 1REQB 4GXMA 4FXRA 4PC8A 4R7JA 5HDRA 3IJ7A 1QASA 2ISVA 1WDSA 3GUWA 3R11A 1OJXA 4C7FA 2NX9A 4LS1A 4M29A 2E0PA 4QQUA 3AZRA 3BVJA 5FAGA 2GQ3A 2X7VA 4RV8A 1BRLB 1U22A 3E02A 3H55A 1AQFA 3QSTA 1P5BA 1B57A 2A3EA 3LDVA 1H1ZA 1W8GA 4DNMA 3AYTA 5BRBA 3TC6A 3MMDA 2V5CA 4ZMGA 2E7FA 3O05A 2FZDA 1ODZA 1EHNA 4NZ1A 5A2AA 4C90A 4FMVA 3BG5A 3L4XA 1VIWA 1EQPA 1HKWA 3N34A 1DHPA 1E4MM 4EACA 1TPDA 1JNDA 2FGZA 4B3ZA 3AYSA 1E40A 2PP1A 4LS0A 1SZFA 3IGHX 4X60A 5HANA 4PRTA 1YE4A 4AEFA 3WDPP 4FA3A 3KL5A 3ZMRA 2A6NA 1WAUA 3DFHA 4PE8A 1H7OA 2WMIA 2ZBTA 5C7VA 1BAGA 1X6UA 2QJGA 2RDXA 3MI3A 4Q6XA 5BMWA 6REQB 5A6SA 4ZO8A 1CCWB 1DKWA 4OBRA 1GQKA 1G0CA 3XIMA 2GK1B 1ITUA 1KTCA 6XIAA 1MSSA 1RH9A 2FFCA 2JQXA 3GIYA 3BMWA 3MY9A 1IEWA 2OOFA 4P8XA 1C29A 2C13A 3FVMA 1M7JA 3MP4A 2QCGA 3CV7A 5CPSA 2OPJA 5FI8A 2HXUA 2DW7A 4AC7C 2O56A 7TAAA 1E56A 3PP7A 3NQVA 3CPRA 3N4EA 3LXAA 1V3HA 3WL1A 3MU7A 1TYGA 4QNWA 3TKFA 1PL9A 3V3WA 1E6NA 2BLEA 1TVLA 1OADA 4CGTA 3OVGA 1XLHA 4PBGA 2YCEA 1FWWA 2YL6A 4LH8A 3TLLA 3KLKA 4QHRA 3BICA 2VZUA 4GUJA 1X1OA 2Q8ZA 3USZA 2GWGA 2DSWA 4W7UA 4HNOA 2Q01A 3G1RA 2J6VA 4HZ6A 3UWZA 4WIWA 2V82A 1EGVA 1O95A 3IUHA 2D2HA 3V1HA 1XGEA 1I8JA 1A5OC 4FR6A 3ABQA 1J6PA 4KT2A 4NQ1A 3U8GA 2VC7A 4A2SA 2J47A 2RJGA 3J7HA 2V2CA 5DN1A 4MY9A 1BQGA 2UWFA 3GQYA 3TA6A 3GIPA 3HPZA 3TQKA 1X1NA 3I3EA 3M0IA 4I8DA 4XAZA 4GI9A 4CKQA 1JYWA 1XHGA 1L8NA 3P67A 4XWUA 3LXBA 1UR8A 4UFIA 5I6SA 1WXYA 1JGMA 3L4VA 2MNRA 3NDZA 3CIVA 2WHLA 3WJZA 3GZ3A 4JFTA 4EF9A 1ZRQA 3GW0A 4UBPC 2WMJA 2FJUB 1OF8A 1TPWA 3CWOX 1AMYA 2O9PA 1VBGA 3GH4A 1K7EA 2X1UA 2GGEA 2GJNA 3UJEA 2ZYFA 3MC5A 1OBAA 2GVGA 4Z1BA 3INPA 3OYZA 1U1UA 3L5AA 2XUCA 2QDGA 2J27A 2B31A 1OM0A 5C9XA 4ZTYA 4D8LA 2NQHA 4LRSA 2WLZA 2VQTA 1PTDA 4D6HA 3DKLA 3CUJA 4DWSD 3CAVA 1JAKA 4CD5A 3REQB 1KBJA 1EWDA 3HV8A 1SJCA 3VOHA 3R43A 2Z27A 1UWSA 5EGRA 3MBDA 4DRSA 1AL7A 2NVDA 4HPNA 3PB0A 3VCNA 1ALDA 3DGRA 4RDZA 4CUCA 4XZWA 2PMQA 3OBEA 2ZUWA 3DYPA 3ECQA 4JTQA 3RPMA 3BMVA 2JALA 2CXEA 3SCUA 4KFOA 7XIMA 1VENA 4TX9A 4IUGA 1B0IA 3GHSA 1Q3NA 4FX7A 1KM0A 2ZZ2A 2NX1A 3EPNA 2J8TA 4KGJA 4J27A 1DIKA 3RN6A 3W86A 3ZJ7A 3BLFA 2Y62A 3W7IA 2QEZA 4CVUA 4EE9A 4QBXA 4PL2A 3P60A 3WLLA 4YWSA 2E3ZA 3CTTA 1LOQA 3GHTA 2W9MA 2QJIA 2PGFA 4E2BA 1H62A 4QAIA 2PP3A 3W37A 3E0WA 5A8MA 2NUXA 3FDGA 4AZ5A 4QDPA 4HPHA 3HPSA 1KXHA 3PZNA 2CIPA 4QAWA 4IX2A 1W3IA 5D32A 2HV5A 3WLPA 1KXQA 3TDFA 3DENA 1OX4A 1W3LA 3OYXA 1LM1A 1QO2A 4PUMA 3TLQA 1O1HA 3PWIA 3ISIX 1VC4A 3H23A 1U83A 2E5BA 3NOYA 2ZE3A 1NQ6A 3BLOA 5K3VA 4M7SA 2BVWA 2E09A 5I78A 4AZ7A 4CD7A 4MUPA 1DVJA 1NP2A 1P43A 1CXFA 5FF4A 3RGTA 4GYKA 4R7OA 3LRLA 3E2QA 1TMQA 2Q71A 4MOZA 3TC3A 4C6PA 1HJWA 1GPWA 5HUOA 3LZ5A 2A7NA 1LOLA 2WANA 2ATSA 2WHMA 3T1GA 3TC7A 3BJTA 5LSMA 1KD0A 5DO8A 4OTKA 1JPKA 4F2UA 3O15A 4HZ7A 3WELA 4A8NA 3R13A 4R3UA 3TX9A 2Y61A 1H5VA 2VP8A 5IDIA 2R82A 3HQPA 1MQPA 3T78A 4IIDA 5EMJA 3E2RA 2FDMA 4HZ8A 3JZUA 2PDPA 3CQJA 1FHDA 4W85A 2IKHA 4ALDA 5D05A 2WM1A 3EB3A 4IMAA 1XH2A 2XM2A 3U7VA 4GC4A 4PMQA 3S1VA 4ICNA 2ZICA 4EWJA 2CHNA 2ZC1A 4O50A 4HOZA 1QT1A 3W81A 1P6BA 1SMAA 3MUZ1 2ZXQA 3HN3A 3B03A 3ABRA 1GOMA 1KQZA 4NIRA 4Q22A 3UPWA 4GMEA 2OEJA 5F4SA 1F8IA 1GJWA 2CZEA 5BMXA 3GY1A 1NWSA 1PKLA 5DRIA 2J66A 2RUSA 3GHUA 3LEPA 1TV7A 4LUTB 4AF0A 4MIMA 1TVNA 1FVPA 2D69A 3GG7A 3JS3A 1VJZA 2QCDA 4NAFB 4JX6A 3AICA 1VBUA 3MT1A 5HJLA 1EZWA 4UTWC 1ICSA 4E2OA 4HT3A 1X8CA 4R7WA 2B7PA 4L1GA 5CBIA 4JKLA 5KTLA 2PLJA 4DJFD 5DT5A 3H4XA 3XINA 2NV2A 1NIUA 1GOXA 2ZUVA 1K6WA 3O6DA 5BRQA 2C3ZA 3S4TA 3QBUA 3WQGA 1JFHA 4JTAA 3ABXA 2NQJA 1ELSA 1IT0A 3ANVA 3DG6A 1FX6A 3AWOA 5C9RA 1R30A 3CHVA 2QIWA 4PYSA 1FRBA 1HVXA 1RAKA 3UZWA 3T4WA 3Q37A 3M64A 5M5DA 3TSMA 4IP7A 1OFOA 3CZGA 1XYFA 3E9AA 5BROA 1HIZA 1K8ZA 2XZ9A 1A5CA 4Y9OA 4AB4A 4QLJA 4HJFA 2PEVA 1ZU8A 5BXTA 3ZOAA 3TYCA 2JKAA 3TYBA 3LLXA 2GJXA 3W70A 3PPFA 1SVDA 2E6AA 3MZ2A 4RE4A 3OQ8A 2ZRZA 2Y5SA 1AJZA 2P3EA 5AC5A 3C52A 4PMVA 1J5SA 1A5NC 2ZUSA 3EKGA 2QCLA 4ZOCA 3FEMA 3PUOA 4LALA 2BFGA 3C61A 1CGYA 2EG7A 1V3MA 4MFEA 1KB3A 3EA3A 1GT8A 3HGOA 5ABFB 1K3UA 2J9ZA 1EQCA 4H9MA 1QHPA 1UMYA 2ZA2A 4HA1A 2P76A 1QU4A 3N19B 4ZODA 2DSVA 4Z1DA 3IIPA 4LAZA 3FHAA 3CQ0A 3NZPA 5FJRA 4DZHA 1QW7A 2Z29A 5F2MA 2Y89A 1JYNA 1W17A 1EOMA 5AECA 3GU1A 3K4AA 3PSVA 4FOJA 5HMDA 2R9RA 5BRPA 3CPGA 4D6JA 4MG4A 2R6OA 5C70A 1AFSA 4X0VA 3CUHA 2P88A 4CQCA 4E0CA 1CENA 1A3XA 5FJIA 3ITTA 4MYAA 3RUBL 3VKBA 3BSHA 3DUGA 1TIWA 2WSPA 1A5MC 2OYMA 4WX2A 1TJPA 3BG9A 4K36A 3W7GA 1MZRA 2A7PA 4GO8A 2ASHA 5BNKA 4DXKA 4QSFA 4M6PA 3TXVA 2EJAA 2CETA 3C2OA 1IT7A 1BXNA 3A47A 4DBWA 2W6RA 3UZXA 3SIMA 1LQ0A 1NSJA 5TQLA 3CM4A 3WBEA 4O8AA 3KOZA 6PTDA 1I4NA 3UW6A 3MCNA 4YTQA 3M0JA 2GVYA 2GGIA 4JIPA 3M0XA 2PWGA 4AIEA 4H9TA 5HMFA 4UMBA 1LBFA 3N9SA 4IG2A 3ZT6A 2W63A 2ZXDA 3W6YA 1XLIA 4LNYA 3LRKA 1FXQA 3P6LA 1UHVA 1BF6A 3S6TA 3NOEA 2WCSA 5I00A 2J9XA 5A1AA 1Z7AA 1TJ0A 1MW3A 4O18A 4QIUA 3QYQA 3HG4A 3B4UA 1OYAA 2DEPA 3BL3A 4WR3A 1G4TA 4OZOA 3R0UA 3BCFA 3EPOA 3EWXA 3RRAA 4DI8A 1C3FA 4L9ZA 2WHJA 3VO0A 2O9TA 1E0XA 2C8NA 3CO8A 1H3GA 1GQJA 3QGVA 3V1PA 3V18A 4QP0A 5EJ1B 3C2FA 5I79A 1BLIA 1UP3A 3QR1A 1V3JA 2WJEA 1ZJIA 5LNUA 4CNTA 3TR2A 4ZFCA 3WY1A 2DPEA 2XIJA 3N2OA 3W2MA 1V79A 1B31A 3O1NA 3PSWA 1RP8A 2WKLA 5AHNA 2OZ0A 3G1DA 2E40A 3QY8A 3WH8A 3PZVA 1V0KA 3R94A 5TD4A 1IZJA 1BWVA 4O12A 1F4HA 1H0IA 4H7ZA 5DT7A 4WLCA 5DXYA 1MUMA 4XD6A 2VCBA 3IGXA 2OQYA 5JBDA 3FAXA 3PZIA 3OGSA 4M1RA 4F48A 2J24A 2GOUA 3QHMA 4EXQA 1K7FA 3CL8A 1J18A 4YCOA 3PUGA 1H7WA 1KBKA 3GX9A 4JY9A 2ZZ3A 3W7DA 2MANA 3SSZA 2QDEA 3S5YA 4GH3A 1YXDA 5CZKA 5HOSA 3RLUA 1Q63A 3NQEA 2BMBA 2QR6A 4JIEA 6TIMA 1XPGA 3NFUA 5ABFA 1UBPC 1R2SA 2WMIB 3WQ6A 1S5TA 4F2BA 4NF7A 2WQPA 4DWDA 2VO5A 1Z6KA 3L7RA 4JS3A 4MNMA 4M81A 4F79A 2G4JA 3IK2A 1EGZA 5TAOA 5C5YA 3TNOA 2Y5EA 3ZM8A 4FX6M 1A5LC 1CYGA 1ECEA 2CLEA 1ZB5A 4GI8A 4QJ1A 2W79A 4QE4A 3T0AA 4Q8WA 3RJXA 5FCZA 5LIWX 4XTDA 3ATZA 5T8GA 3W22A 4K7YA 3WJYA 2VFDA 2OG9A 3M5XA 3AIQA 2XIBA 1FH7A 2W62A 5CG0A 3H4WA 4GFIA 3MUIA 5FA5A 3PZQA 3U57A 3G3MA 1OF6A 2WJDA 1S38A 1NP0A 1EO7A 1E1FA 4BI7A 5A8NA 4DBSA 3VIHA 3AJXA 3AXKA 3QHOA 4WDWA 1W1PA 1BGGA 1X39A 4J28A 3L5LA 3DFPA 1H49A 3NO1A 4U3AA 3MP3A 3L4YA 2GVEA 4UTJA 3WLKX 5E5CA 4RK8A 1XCWA 3BSMA 1V6WA 3ZZ1A 4PUKA 1QNPA 3S5SA 1H63A 3VNLA 3TONA 3ELFA 3STFA 1EUNA 4QEEA 2YA2A 1AK5A 1HKKA 3W1MA 3R4IA 4UCGA 1V6UA 4F0RA 3L0GA 1UH3A 3ZWTA 1K9TA 4GVGA 3H53A 2I17A 4PMRA 2CBUA 3UWWA 5LHFA 3CIXA 5CJNA 5G4EA 1JDDA 3GW3A 2WBGA 3MJMA 3TP4A 4NZ3A 3WFZA 3T2OA 3CT7A 5HA7A 3APGA 4Z08A 5EMMA 3W02A 1IZKA 4V1XA 3NM1A 4EPEC 2H8XA 2D2JA 2PA6A 1WDPA 5DANA 4KEMA 5CQ1A 3W84A 1HJQA 3KBNA 4TVCA 2HS6A 5HPCA 4N9EA 3VKKA 1FA2A 5LIUX 5CGTA 3C2RA 2OZ3A 4O4VA 5G1MA 3S2JA 4JTSA 1OABA 3W1RA 3D47A 2EG8A 1DJZA 1JZ5A 4W93A 1XP3A 4TU1A 2X09A 3QZAA 3KRSA 3LCGA 1V8EA 3EOUA 3CBWA 4GYFA 3W01A 3L23A 4PULA 4CU6A 3U7BA 4UNKA 4PODA 3CZ8A 3TZFA 3NWRA 1NF0A 2E6DA 2VEIA 4Y8FA 5CZJA 2ICSA 4U28A 2PUZA 4S3BA 5FEWA 2WSYA 3FAWA 2PRMA 3JW7A 1MXSA 4H04A 1GW9A 1VYSX 3TEVA 2DT0A 3NQAA 1XISA 2NVAA 3MI6A 3WLHA 2H9AB 1WXZA 1G7UA 4X9YA 2PTZA 2VFFA 3TJLA 4C6JA 1RP9A 1HVQA 4ACZA 1P7TB 2J7FA 2Z24A 4HA3A 1W1VA 1G67A 1LOSA 2WSKA 2JE8A 4MJ4A 1YXCA 3ZXWA 1FWEC 3TNBA 3DXIA 4DJFA 5CAHA 5HUPA 4Q4SA 3EDJA 4LC8A 1GVRA 4CNOA 8XIMA 4UQAA 4ZSTA 3UPBA 4HHHA 3NA8A 4PTMA 4CN1A 5JBEA 5CZSA 2YBUA 5DLCA 3POCA 4BF9A 4H6EA 1CECA 2DUXA 1RQBA 3SCSA 4K68A 4MB1A 3LMYA 1L6YA 5JXQA 1H2JA 3U2CA 4I5XA 3IJ9A 2ATMA 3GNDA 4I3GA 3ZWSA 1G01A 3DERA 3EAUA 4Y6GA 4JTCA 4MY1A 3OO2A 4XQ6A 4DLMA 3UEQA 2X40A 3SQLA 1SO4A 4XV0A 4O0ZA 3RM9A 3GM8A 3LCFA 3QR0A 3PANA 5FAJA 1TE1A 3N9KA 4DM2A 4HNNA 1VHCA 3SCVA 3NO5A 2HVNA 4H2CA 2OJPA 2J7EA 1JYVA 3U3HA 1I60A 2D73A 1OGSA 4Q7NA 2CWNA 3E0VA 4QX4A 6CGTA 3NEHA 2DZBA 4W5UA 3SM0A 5A6LA 3AIUA 1QW9A 4UFMA 1OFPA 3PPGA 1E0TA 1UG6A 3VDCA 2VOTA 2WC4A 2VI0A 5HXMA 3UQNA 1QOPA 1QUMA 4IICA 2ACSA 1VJIA 3WL0A 4JTDA 3I65A 3BGGA 1OX4B 4RL3A 3BJFA 4ZBCA 4J3SA 2B81A 3NQCA 2D2GA 4Y90A 3OGRA 2PFHA 4JYDA 3W7CA 1DIDA 4MWAB 3WMCA 1DJQA 1W3TA 1E3ZA 1YPXA 3K4DA 1Q45A 1CWYA 4JTHA 4O13A 4GUGA 1RD6A 3W83A 1R2TA 1ODUA 3T40A 1YBQA 1KA9F 3ICJA 3CAWA 1J6OA 4FF7A 3WD2A 4HGXA 4S1FA 4MPQA 3RPTA 4QM1A 3CHFA 4NASA 4YTSA 5U7SA 2WZIA 2Y8KA 5GNXA 3E0IA 3P5YA 3NEVA 1K70A 3V0UA 5A2BA 4C6MA 2HE8A 2V38A 2PRLA 3QVQA 3TTSA 2XH7A 4JPGA 3IIOA 2Y7EA 3GZAA 3BDKA 4KF1A 3UJSA 2J7CA 2G0WA 2C71A 4FOKA 1V93A 4RDYA 1Z42A 3TYAA 3KHJA 3C0SA 3N6HA 3A6OA 4P7LA 1S3TC 2ZRUA 3SO7A 4D1JA 4POCA 3CUIA 4EK7A 3AMDA 4KWSA 4HVXA 3QMTA 4FZIA 4IH3A 1AW5A 3WLJA 2OEMA 1PXGA 3U2EA 2PTWA 4CNPA 4XZBA 3EOSA 4ZXLA 1W1IE 1ZPTA 1BYBA 3N25A 4FNQA 2I9EA 4AMAA 1OK6A 2WYSA 1YBQB 1UKSA 1WUFA 5A6KA 1JPDX 3LI1A 3O16A 3UFYA 3OJGA 1W3HA 1KM3A 3SEPA 4TTGA 5D9PA 5FJUA 3PNUA 4GIYA 3DC8A 1TMLA 2FJKA 2BY0A 1WDQA 1GHSA 2YCJA 2XH2A 3BCJA 3GXPA 4AY7A 1NDWA 2P3ZA 4JFWA 1AD1A 2CZFA 4A8IA 1VFUA 3HF3A 4PB3A 3KLLA 3EDKA 4ORIA 1RBLA 1LL4A 1XLDA 1DWFM 3TYZA 4LT9A 3NPXA 3QPZA 3B9NA 3CXOA 3W2UA 3IJ8A 4TVDA 1E43A 1VLWA 5DMNA 2DZTA 4J3XA 4V1YA 3W7EA 3WMBA 1ZUAX 5F4WA 1XLAA 3IV3A 5KINA 3N2XA 1BG9A 3VIMA 4TV5A 2TYSA 4IFKA 4JIRA 1CXKA 4XD4A 4G1KA 1NOFA 3W76A 3VD7A 1I2NA 2YB1A 4B3LA 2XHYA 1W9VA 3LCWA 1CXHA 3AMGA 4ICCX 4NI3A 3LXCA 5IBXA 5EB8A 3EWYA 1J93A 2DT3A 4MHBA 1OK4A 2XVGA 1LROA 1VCGA 3QV9A 1I2OA 3SY8A 4ZO7A 1NFPA 4GD0A 4A3UA 1UIPA 2A2IA 4FX8A 5LIYX 6TAAA 1XKJA 3GYEA 3GVWA 3K4WA 2UY5A 1H11A 1TWDA 2YZ5A 1UJPA 1NVMA 5PTDA 4BEQA 5FJOA 2OYKA 3GDKA 1BTCA 4UTLA 1DJGA 3LS9A 1J0ZA 1IEVA 4A05A 5I3JA 1TTPA 3HMJG 3SDOA 5G1TA 4JN8A 4O10A 2V3DA 1GNXA 1QWKA 4KWOA 2JKPA 3UERA 1KCKA 1WP6A 2XU2A 2ISSA 2DW6A 4HHPA 1IIHA 2OGJA 1M9HA 4J2MA 2VCCA 3PHAA 3MSYA 2UY4A 1VBJA 2C14A 1TB3A 5JIPA 4X61A 3TMLA 4ZZ9A 4KEUA 4UR7A 4W89A 2YCLB 1A53A 3LLFA 4UQ9A 3F7JA 1VQTA 4HTBA 2BASA 3B0VC 3G6LA 4H9YA 5FEXA 4ML9A 5L9FA 2X7WA 2VQUA 2VWSA 1RK6A 2GZXA 3AIEA 3S1UA 3ZJKA 3SRFA 2FZ9A 1AJ0A 3WQFA 4H6RA 5TIMA 3B97A 4PUNA 1XBZA 1WBHA 5FF7A 1QBBA 2D2OA 4GISA 2DZPA 5E0FA 4C6OA 3SURA 3P8IA 4FALA 5E0KA 5BW6A 5K4XA 1GOWA 1EL3A 1LRNA 4CCDA 1Y8BA 3GNNA 1B30A 3UXAA 4AY1A 4AHOA 4Q7IA 4E3VA 4F3HA 4Q8PA 2QJHA 5CGMA 1DORA 2HBXA 3C86A 3SCRA 1UH2A 3SQMA 3UZJA 1H61A 1CNVA 3AHTA 2ZOXA 1VP5A 2VRJA 4LAKA 1TPH1 2PGEA 1SW7A 4MFDA 2QXWA 5ECUA 3CAKA 2Y8VA 1JYXA 2IW0A 1KTNA 1W5OA 4URIA 4IQEA 1W9DM 1B54A 3C8NA 2QULA 4E3TA 4IGMA 1K4GA 4NX0A 3WNOA 3QSRA 1Q7QA 3GTNA 3KXQA 4NJJA 4L7ZA 4LF2A 1TREA 2NLYA 3ZSSA 3K8KA 3NXFA 2XSBA 4H6QA 4KCVA 2X1RA 4EXBA 4PTXA 4XSLA 3R0KA 1YKWA 4HCHA 3TH6A 4AZCA 5MF5A 2WNWA 1HL2A 1US2A 3UBPC 4GJJA 4UTMA 2Y7FA 2QIIA 3ATYA 1HN1A 4FB7A 4W9TA 4NRRA 1I2RA 2XN1A 3MMUA 3NNTA 5DELA 1QI4A 3SUWA 1XIEA 3HG5A 5RUBA 2Z25A 2V5KA 1JRCA 1F5ZA 2A3HA 3GC2A 5DBUA 4GKLA 4DYJA 1FCBA 4DJDD 1AA1B 4GIRA 3THQA 4PRRA 3NYDA 1CGUA 1LF1A 3BZJA 3W4RA 3IK4A 3KVJA 1BF2A 3MSRA 1A5UA 1TQXA 4DZIA 1PHQA 2VFHA 3DFQA 4KWVA 3EXRA 2VX4A 3WH6A 4V28A 1C8XA 3RXZA 1HGYA 4HP5A 3UG8A 3UCQA 1LLZA 1U30A 5HR7A 1J4EA 1A4MA 3EKZA 5ABHA 4NAEB 2RDTA 4DBEA 5IXEA 1W3JA 3KBVA 2PTDA 2NT0A 4P61A 3WYZA 4UB9A 1LT7A 4RW5A 1XIIA 4REQB 1ITXA 4JEJA 1XM3A 4JQ2A 5KETA 3V5OA 1M04A 2XINA 5D02A 1VIZA 3GHRA 3I68A 5LXXA 3O7UA 1CI1A 1QBAA 4AD2A 4G7FA 4MLRA 1R3WA 1ISVA 1QHOA 5DRCA 1PYMA 2HDJA 1VJSA 4HYVA 2PDJA 5T91A 5T9CE 3LI0A 2WWDA 1ISYA 1FWTA 2QCDB 4LOCA 1XDMA 1YRRA 3AXXA 4GGBA 4HCLA 3B9DA 2AGKA 3GDTA 3W1UA 3HFYA 2EKCA 3GU2A 4DF2A 3VKCA 1WV2A 4AWSA 1CW2A 4M19A 1TWSA 5M1TA 4UIOA 2YLAA 3WUGA 3LPPA 1SJBA 4X22A 5LA2A 2A21A 4K2SA 3RMEA 1HL8A 4WY0B 2BX7A 1B2YA 2V3EA 4PA8A 4EKJA 1F4AA 4JTRA 1Q65A 4LVDA 1XRVA 1MW1A 3IUIA 3W7PA 2D24A 2ACUA 3ITXA 3ABSA 4J9JA 1OCBA 5D2VA 1XRTA 3PK7A 2YDAA 3BW4A 4Q8OA 3GR8A 3C0JA 4NG3A 3DG7A 3UVAA 2PDHA 1CBGA 3E5PA 2PTYA 3UZZA 9RUBA 4C5YA 3OBKA 4HNVA 5SWUA 2FTYA 1P0EA 3L2LA 4UTHA 1DBTA 2NSOA 1XG4A 1KQYA 3F5JA 4WXZA 3LSCA 4HHLA 3TYUA 1VB9A 3NXLA 3G1FA 4JL1A 2IPWA 3MMTA 4WSJA 1PZ3A 5D4YA 5GJNA 3VM5A 3LQLA 3LM7A 3UWYA 1UC5A 2OO0A 1V0LA 5B7ZA 3U6WA 2J8GA 3H2FA 1E6QM 4WXYA 4Y96A 2IUZA 4LV9A 1ZFJA 4AD0A 1OX5A 4H4IA 4LYRA 3VM7A 2V5BA 4HMDA 4LY8A 5GQBA 1KR1A 1OC6A 4G7EA 3WQDA 5AHMA 5KZ6A 4N9CA 2Z2BA 1ISZA 4KFPA 5I3FA 5E1QA 4H9ZA 1LTDA 4G5DA 3BAXA 4H8NA 4GKTA 1Q6RA 3GFYA 4NX5A 1HX0A 1ZSXA 3A13A 4IFRA 4HA4A 3MS8A 1D7FA 4LV4A 4DJFC 2VCAA 4B90A 5BXPA 1SFSA 3R5EA 3E5BA 3PFRA 2JEPA 4LPCA 5G1YA 4RDWA 3MSDA 4IM4A 1UWQA 2GOKA 3C2VA 2WVSA 1G94A 2ZWYA 5D8ZA 1KFBA 1LL7A 4F0HA 1FHUA 3H6OA 2Y7GA 3ONBA 4RE2A 1OFBA 4F0LA 4AYSA 3QQ0A 4GZJA 1QNQA 4KCWA 1XSKA 2CLLA 2VFEA 1LT8A 1TRIA 4IP4A 1LRTA 3NL2A 4LVFA 5LHEA 2J62A 2CWXA 3EX6A 4HOXA 2WNZA 3DHUA 1Q13A 3KP0A 3LLDA 3IJLA 3U4AA 4PTVA 2YW4A 3LHYA 1XLLA 4W87A 1J0IA 1TQJA 5AHFA 3TUUA 4HKPA 4NXSA 3O07A 3B0YA 1GQLA 4NXKA 1HKMA 3FNDA 1K9DA 3E96A 4MKSA 4N7QA 4BI6A 5M03A 1EC7A 1PAMA 1XSIA 2XFFA 1KO0A 3NTYA 1BKSA 1UD4A 1O60A 2FPYA 3ZYZA 3R1ZA 4LYKA 5D2XA 1OHLA 4P02B 4CU8A 1O6IA 5JQ9A 3GAYA 3NDYA 3ZVHA 1DQWA 4ZA0A 3W38A 3QTGA 3RRXA 3PZUA 3SQSA 1ZHAA 2A3BA 4LJ3A 5A8PA 3ZR5A 1EXPA 3LRMA 1VHNA 4R85A 4A3HA 4Q7BA 1TJ2A 5FJPA 3ITLA 2NX3A 5HMSA 1T6MA 3PBUA 2VD9A 1BEUA 4Q8MA 2QCHA 1X38A 4UR9A 1DJYA 2FMOA 1SW3A 5D33A