4ES4A

Crystal structure of ydiv and flhd complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
206
Chain Sequence
b'SDCYFLPIRDNQQVLVGVELITHQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cyclic di-GMP regulator CdgR
publication title Structural insight of a concentration-dependent mechanism by which YdiV inhibits Escherichia coli flagellum biogenesis and motility
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 67
structure length 206
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4es4A00
5M1TA 4RNFA 3PJTA 4KIEA 3TLQA 3PJWA 4F3HA 3HV8A 3KZPA 3PJXA 5MKGB 4J40A 3SY8A 5MF5A 4FOUA 4RNHA 3N3TA 4Y9NA 3U2EA 4Y9MA 4LJ3A 4Y9PA 4HJFA 3PFMA 3S83A 4Y9OA 2R6OA 3PJUA 4HU3A 2BASA 3GG0A 3GG1A 3HV9A 4Y8EA 2W27A 3GFXA 4LYKA 4ES4A 4AG0A 5MKGA 4HU4A 4AFYA 4FOJA 4FOKA 3GFZA 4RNIA 4F48A 4RNJA 4Q6JA 3GFYA
chains in the Genus database with same CATH superfamily
2PF0A 4PB4A 4A2SA 1DWAM 1QNSA 3KVLA 4GQBA 4J3ZA 1BQGA 3PWIA 4OHQA 4Q4RA 3F5KA 1VFLA 2NUYA 2VOMA 5I3IA 1YTDA 1DIEA 5M2FX 2P76A 2WC3A 1NQ6A 4JDBA 1IXPA 1S5WA 2OQHA 2QNEA 5FOOA 2OEMA 2QCFA 4KIEA 1K70A 1GVIA 3PZTA 1US3A 3VDGA 3BMWA 4JTHA 4A3YA 3NNTA 5F1UA 2J8TA 5HQEA 3HZ3A 3H2MA 3MMWA 3G8EA 1QR7A 1XS2A 4JTFA 4QAWA 5F2GA 1QUMA 4RZBA 4GACA 1AL8A 3ELFA 1BWKA 2IS7A 3GDTA 5AY7A 3ZLGA 1JULA 1QK2A 4YWSA 3OGVA 4DZ5A 1OCQA 2RGMA 4R9OA 4ERIA 3LPOA 1AQ0A 3C0SA 1MFVA 3V0TA 3WD2A 3AIBA 3U4AA 3NJ3A 2Y8UA 2PDYA 3CLWA 2J9YA 1MZRA 4MY1A 2AGTA 4UMAA 1V3JA 1W1YA 4J7RA 1ONXA 2OKTA 3RR1A 1IZJA 3VZYA 3MB9A 1XRTA 3CUHA 1PTGA 3DGBA 4GJIA 4GZJA 4HHHA 3ARWA 2A6NA 4P7OA 4ATDA 5FSDC 4AZ7A 1H11A 4NNCA 2WVUA 6TIMA 2WQDA 2PS2A 2R1NA 3GHSA 2BV9A 7A3HA 4ML4A 1H7RA 2V3GA 3M47A 4O19A 3UG4A 1VPXA 3UWUA 4F48A 1MRAA 4Q4QA 3GDLA 5CKSA 2BFGA 4PUKA 4FNUA 1GVRA 2VM8A 5AB3A 1LYXA 3E0VA 3TMLA 3DX5A 1ZS2A 3WDJA 2VFFA 3KTXA 4WSJA 3OYZA 4ZQPA 1GJPA 3KOYA 3G1XA 1QBBA 5DRIA 1W8GA 4A8IA 3KHJA 1PSCA 3RYSA 3GDKA 1JF6A 5H8PA 1YBQA 1EX1A 2J47A 2R9RA 2WMIA 3VZXA 1KXQA 2ZWZA 3HU7A 2CLLA 4EOUA 4XZHA 3UD6A 3HG3A 1S5MA 2OYMA 3U57A 2CXGA 4PR4A 2C1GA 3EDKA 2W66A 4JN8A 2W62A 2WXDM 3RAOA 3OBAA 3ALGA 3NEVA 3NQ6A 1P48A 1HTIA 3FYYA 1GQJA 1DBTA 2VEMA 2XUCA 2QCEA 2PC8A 4R7WA 5CJNA 3C3NA 4U4MA 5C6MA 3BOFA 4DPQA 3PZQA 3RLVA 4ZZ9A 3AUOA 1A5NC 2Y5JA 1UWAA 1TV3A 1YBQB 1F9CA 4RDYA 3ATYA 3TYBA 2V30A 5G5IA 4CEXC 1BSLA 5AC7A 2ZUMA 1EKOA 3WMCA 3QMTA 2VZSA 4MPKA 3AZTA 4JYFA 1KO0A 3NDOA 3TQKA 3QY7A 1JUKA 1TFVA 4H9XA 1RBLA 2PDNA 1W3KA 2PU1A 3E96A 1AD1A 3I3BA 3PBMA 3AFBA 3W7LA 2FKPA 4Z2KA 1QVBA 5LXEA 2JFEX 3N17A 1ICPA 1CPUA 1LL7A 1T7LA 2H9AA 1EUNA 3NQVA 4AWTA 1FRBA 4D6HA 2EGZA 2ISWA 3UYIA 1ZL1A 4MIMA 1XM3A 3GC5A 4NILA 1MDRA 3IACA 3IV3A 1AH0A 4FMVA 2W6RA 5AZ0A 1ISWA 1JYNA 1R87A 1NP0A 4ZBCA 1OX4B 2PLCA 4PMNA 2Y7DA 2ODOA 1S1PA 1UD3A 4HT3A 2YJQA 3MUXA 5IXEA 3TU9A 3IVSA 4PMXA 3VUSA 1CLXA 3IS4A 4O52A 4AMCA 2J9XA 3KXQA 1W1A1 1E4LA 1US2A 2QJGA 1KCLA 3L5LA 4RDWA 4GWEA 4MF4A 3K8LA 4MB5A 4O0QA 4FX7A 1E6PA 4EF8A 1KRMA 1X1OA 1RK5A 1K8CA 5I07A 4MKVA 1JDEA 2BHUA 1E6NA 2GGIA 4MFEA 2H9AB 4HHMA 2O9PA 5FEZA 3VINA 5K7JA 3QV7A 3VGEA 4AC1X 5XINA 3ZVIA 2FZMA 2X1SA 1UKTA 5IDZA 3OU8A 4ZO8A 1MYRA 4IGMA 2R6OA 1AH3A 4OUEA 2A4AA 3ZOAA 1NQKA 4HOXA 1LZOA 2JIEA 1RD6A 1HZYA 1XYAA 1S2WA 2JALA 2F38A 1V0LA 2MNRA 3C0LA 4PMYA 1YDYA 2OMAA 3J7HA 4QDWA 5HQMA 4IUGA 3WLSA 4XVDA 4DUWA 2ALDA 1B4KA 2NXGA 1WZKA 3CV7A 4GJ1A 1H7PA 4ROQA 1R2SA 1S38A 3PZIA 4HIBA 4EPBC 5C7HA 4JNYA 2FJKA 3A4JA 3HMCA 4J40A 4E2DA 1A4LA 2WSQA 3BSMA 4YS1A 3UW6A 4ICCX 4AYSA 4JTAA 3MT1A 4JQAA 3GG0A 2DIKA 2VRJA 4LNCA 4KEMA 5CZJA 4GBDA 3QMRA 4G5DA 3CYJA 1CGWA 3ARYA 3NDZA 2NW0A 2E68A 4PA8A 5AYZA 4JFSA 1HKKA 2JQXA 1PDYA 3T4WA 4HNTA 1RV8A 3PUEA 3DUGA 3G1AA 1AVAA 3PBYA 4BS0A 4JTSA 3PHAA 4UNLA 2ONEA 4FAMA 2Q6ZA 5IDIA 4XZLX 3ES7A 1IXOA 1TVLA 1CYGA 2WJFA 1FDJA 2VURA 2G95A 1GZ1A 2VVNA 3FIGA 2WJDA 1V77A 4YTQA 3W6YA 3KE0A 5CSYA 1GUVA 3WDQA 3UNDA 3PWGA 3PSVA 4F0LA 3GXTA 2OYKA 3MZNA 1RLCL 4PBEA 5G4HC 2Q71A 3VC5A 1RP8A 2DW6A 1PWMA 1M1BA 3IANA 1ZJIA 1RZMA 4MGGA 1U22A 1R30A 3GW3A 5BRQA 1G69A 1PPIA 1OFBA 3LY0A 3OVRA 1IEVA 1PE1A 5A6KA 4XG1A 1A3HA 1J10A 1UWUA 4O4WA 4OV9A 4FSAA 1X96A 2E0PA 4FXJA 5DY3A 3RMEA 4PMDA 2HJPA 2JK2A 4AYGA 4JICA 3ONBA 4O57A 2Y24A 5ABFB 2EF9A 3LMYA 1LQAA 1Q8JA 5GQBA 3NSMA 4U2YA 2ICSA 3LPGA 2OLHA 2Z29A 3W7NA 2OSYA 1QU4A 3HF3A 5F7UA 3H2CA 4JKMA 1DQWA 3N2MA 5J04A 3L66A 2VWTA 3UZYA 3QQWA 1GOKA 4UXDA 2QUVA 4C6OA 3NYDA 4LUIA 1WKFA 3TIMA 2PDMA 2YLLA 3PBVA 2ZDRA 2A3EA 3LPPA 1FX6A 3EEGA 4AX7A 3HTWA 4Z17A 4JX6A 1SJDA 4UTWA 1F3WA 2QJMA 2A21A 2QKFA 4R33A 5FI8A 5BOOA 2BSLA 5I3DA 1A0EA 3V0UA 4KWOA 4M81A 2CHRA 3WUBA 2F6KA 3B8SA 5FD0A 1E4MM 3W1NA 3KOZA 4C60A 2Y62A 3CEUA 2QEZA 1VB9A 2ZXAA 2WNNA 4YJ5A 2NUXA 3ZLHA 4UBPC 1FWEC 4QQ3A 4U3CA 3B9OA 4XAYA 1GONA 1B3XA 4FNSA 2QAPA 2NV2A 3SECA 1VKFA 4GI6A 3FGCB 4INFA 2VP8A 5EMMA 1XR2A 3EWBX 2OLSA 1MSSA 5A6MA 2ZKMX 3LD5A 4CD8A 4MWAC 5ABHA 5JBDA 1Q65A 3W1UA 1GT8A 4LANA 1KKRA 3R13A 2GFTA 1WE5A 2WSKA 2C13A 4HU8A 3AU2A 5E70A 2B7OA 3LGGA 4AEEA 5HDRA 1V8EA 1OFRA 4G1KA 1GHRA 2SFPA 4XISA 3PY2A 1DJQA 1DQXA 3DFQA 1EBHA 4HZMA 3PN8A 2ZRWA 3I4EA 1HVXA 4HNCA 4KGJA 1XC4A 3PK7A 3SN0A 4CEUC 3EWWA 4C6LA 3NL3A 4UQDA 4IX0A 1KV8A 1A5LC 1UKQA 2R1LA 2VDHA 2VCBA 1CBGA 3C2RA 2V5CA 1H51A 1M7JA 4EAMA 3G0SA 4FLQA 1N8FA 3P7YA 3B8UA 4NHVA 3DHDA 5IRPA 3K2GA 4AWEA 1ZJBA 3W70A 1W5PA 3TMQA 4Z1YA 1XV8A 2FZBA 1WYIA 4MDPA 5CZSA 3GO2A 2HNEA 4MWAB 4NQ1A 3VA8A 1K8XA 4XZNX 3RU8X 1OG0A 3TONA 4IXXA 4JFWA 3HPSA 4RW3A 1BTCA 3CQ0A 5BW6A 1LT7A 5AN7A 3TR2A 1XSJA 1UHVA 3S8HA 5H8UA 3TAKA 1R3WA 3W82A 1R7OA 5H2ZA 2WC4A 1BQCA 3B0VC 1YADA 3IGUA 2VGFA 7XIMA 1Q6RA 4YVXA 3IJ7A 2VQTA 3MBFA 3W01A 1XFBA 4RE4A 3IJLA 3KHDA 7PTDA 5BRPA 3K1GA 5C8BB 2XGBA 4YYFA 4FALA 5CLWA 4N02A 1VC4A 4GYFA 3OPSA 4MJZA 3ENLA 4CLMA 1XUZA 4DWSC 3QGAC 3C2VA 1SJAA 3CL8A 1H7XA 1PIIA 2VFIA 1WNOA 1EP2A 4MHBA 2P88A 4C90A 3GSMA 4DWSA 3E38A 1JNEA 2PBGA 3LNMA 2NUWA 3MBDA 3L2IA 3E12A 2BZNA 4ONVA 2VR2A 2Z2UA 3VKBA 2DIEA 1Y8BA 3WENA 4GX9A 3HG5A 3KL0A 1TZZA 2G5WA 3WH8A 2ATMA 5CBIA 5G2HA 4C1KA 4W5ZA 4V2XA 4FA3A 1T6MA 2Y7EA 1F05A 5FL0A 3N6QA 4WJEA 5HUOA 1IF2A 5ABGA 3H12A 3RPMA 4IMGA 4H9TA 3V7PA 1KM1A 3WQDA 4CNOA 4IUOA 2HEJA 1YQ2A 3SRHA 2VUYA 2PTWA 3SQMA 2GQ9A 2NQ5A 3TNOA 2E1DA 3WBWA 5FAJA 1E55A 2CBVA 4DWSB 3DECA 2C1HA 4EANA 4ZB0A 4CD5A 2V6AA 1BWLA 1FQ0A 1TPEA 4UIOA 5A6AA 3LTSA 4LV9A 4OU1A 5F2IA 5DBUA 2R82A 3E0FA 3NUKA 3IJ6A 4JIQA 4IIGA 2C15A 4Q4KA 4DXKA 1JCNA 2VC7A 3OIHA 3O6AA 3P0XA 2GOUA 1V79A 3GUGA 4GIRA 4FS9A 4L4LA 4QROA 4QJ3B 3BLKA 3RCMA 3UJSA 2WCGA 2YFNA 2YW4A 2AL2A 1E43A 1PZ0A 3W24A 1FWIC 2ZICA 1V02A 3D3AA 1R6WA 1AFSA 4RKAA 3OYXA 2FYMA 3VGDA 1GW1A 4WOQA 1D7KA 4JTRA 4MZ1A 3VKDA 3R0DA 4K1WA 4MNJA 1EDGA 1KM3A 4OECA 3SSZA 1MW3A 1ZHAA 3UWEA 1XLKA 4HVXA 2I17A 2X09A 1KFCA 1OC5A 4GNKB 4XQ6A 4Z0SA 2PBOA 2DZSA 3VNIA 4KCWA 4DJFD 1EC9A 3KBJA 3PTQA 4GH1A 3N19B 3WF3A 1JZ7A 4LJ3A 1V93A 3BW3A 5CG7A 1L6WA 1HIZA 1QPOA 1VRXA 3KWSA 1XYBA 2YDQA 1BXCA 1A49A 1EZWA 2H3BA 3LXBA 3QQ1A 3QXBA 2XIBA 1O5KA 3CAKA 4LRTA 2AL2B 4AHQA 5C54A 3OIXA 2ZC8A 1R8LA 1JPDX 1E4IA 5HJLA 4PEEA 1OT1A 5BNKA 2Y5SA 2Z26A 1SW7A 3DG6A 3EWUA 4MPQA 5CPQA 2NX3A 1UWTA 4UNIA 3TN3A 2PWVA 4GXWA 1J0ZA 1LLWA 4LAMA 4G56A 1JZ5A 1H5YA 1TQXA 3CWHA 1UR3M 1DJNA 3QGKC 3F2BA 1S3HA 3FXGA 3N4FA 4ZA0A 4LU0A 4DUOA 1Q4NX 1J6OA 1GVEA 4E38A 1Z6KA 4JCLA 2PTXA 4OE7A 2OSWA 4PCTA 4CNNA 4OUIA 1QNOA 3SCQA 4BF5A 3B8DA 4WKFA 2F6XA 3L4WA 1WDWA 1RD5A 3KTSA 2V3EA 2JGYA 5GJMA 5A6BD 3AROA 4JQ3A 4AQLA 4B91A 1EIXA 5HPOA 3NEHA 4YU1A 4K38A 3HA1A 2HE5A 5AZ1A 3UG5A 5F4SA 4IM4A 2TRSA 1VCFA 1EF2A 3P81A 3W28A 4Z1DA 3IEBA 2YBTA 1FWGC 4A3QA 2EG8A 4MLJA 4V28A 4P8XA 1KBKA 2EAWA 3RGTA 1LJYA 1UZ1A 4WSHA 1G67A 3VIKA 3AQUA 3CAQA 3AXHA 1KXHA 4IWWA 1TX2A 3W38A 4DZHA 1DP0A 3T78A 3AIQA 4HZ8A 3JZUA 1XJBA 3S5ZA 2DZVA 3SEPA 2WZHA 3TOYA 3DC0A 1RA0A 4LBUA 2QIWA 1EJRC 1XSKA 3CNYA 2E25A 2X16A 1JRBA 3VCNA 2VUNA 1V0MA 3KBNA 1KWKA 4AFYA 3GY1A 1HP4A 1MNZA 2HNHA 4LXFA 4FXSA 3UEQA 1L2UA 2V5LA 3HQNA 3C2OA 4Y9MA 4IIDA 4Q8MA 4GUGA 4UQ9A 2QUUA 2J25A 3EKLA 5CBBA 3D3FA 3BPWA 3DYPA 3BH4A 4TOQA 5L9FA 2V63A 8XIAA 2Z25A 3GYEA 1DWGM 5A1AA 2P5NA 1LUCB 2YL9A 1XLFA 2DORA 4S1FA 1XSIA 1JZ3A 3D0CA 4Y7EA 1Z44A 4AEOA 4RJEA 3CZLA 1XKJA 5AYYA 2C71A 4I9TA 1U2YA 2BGNE 1ELSA 3FJ4A 3N13A 4J3WA 3ZR6A 4Q4OA 1BPLB 4GO8A 5IOBA 4LVFA 4N0RA 3TYDA 3BW4A 3GNPA 3SUUA 3ZJKA 1DVJA 3ARRA 3M43A 4BA0A 3XINA 5CSRA 5CEWA 4ACZA 2VFGA 4DJFC 2PDHA 1O95A 1LWHA 1E9YB 1MXSA 3VUPA 5CPOA 4NZ4A 4DJFA 1QO5A 1I8JA 5CPLA 4RV3A 3LZ5A 1KM4A 3ARVA 4UFJA 2DZBA 4BF9A 4PCFA 3CU2A 4NZ3A 3UT0A 3MQTA 4WKHA 1AW1A 1TMLA 1QPNA 2DZAA 5K3VA 1WV2A 2WMKA 2C1IA 3SJNA 1H62A 3A4XA 3R43A 3WG6A 3AXIA 3R58A 2ZWYA 3DZ1A 3W7CA 2A7NA 4H9ZA 3TWAA 4ACZB 1Z7AA 4GISA 3CIVA 4QCFA 3P5ZA 4ASTA 1FWTA 3IGSA 4J3XA 4GI8A 1G7UA 3N2CA 1RY0A 1F3TA 1FOBA 4E2BA 3LN3A 1C8VA 4JR5A 2UZ9A 2NQZA 4GKLA 3M9YA 2G97A 3EX3A 1WZMA 1W1ZA 1TCDA 1ZQ5A 5D02A 3M0JA 5JIPA 2XPKA 3KRBA 2V67A 2CLKA 3GAYA 1IXNA 3GVQA 3NFUA 2J7GA 1JYXA 2GQ3A 2HISA 1GK8A 5ECVA 3S3GA 1VBHA 4PE8A 2EPLX 5IBXA 5HINA 3WQ4A 3M4HA 3SI9A 3O6CA 5A6BA 4D6EA 1JPKA 4IQEA 5KZDA 3UZWA 3LCFA 2VZTA 4JTLA 3IIPA 3UPMA 5HMEA 4ZGYA 5AHEA 1FWFC 3NGFA 1PEZA 3GHTA 3GAKA 1X38A 2PP1A 2XIMA 3C86A 1IWPA 3C3UA 3MHUA 1W5MA 3WD3A 3B8WA 1SZRA 1W3IA 2QZRA 5D32A 3T8QA 2J7HA 3W37A 2D0FA 3RILA 2VC9A 4M3PA 2YIHA 4ZMGA 5IFTA 4GI4A 2DEPA 4KPLA 3IK4A 3U5YA 1H1ZA 1RXOB 1NP2A 4GG9A 4RNJA 3G6MA 4L4MA 1H49A 1DWHM 5CC6A 1YXDA 4TO8A 4TV6A 1EDTA 2O9TA 2RDXA 3L0GA 3O3RA 3WEOA 2ZVRA 3EBVA 3URQA 1EUAA 2V5JA 3LS9A 5REQA 3F4DA 4K3ZA 1KLYA 4W89A 2OU4A 5DRCA 3T55A 1WAWA 3TZFA 1H1NA 2GSEA 4PFHA 3UGVA 2FB3A 2C8NA 2PLMA 1PDZA 3FJ6A 1XYLA 2ZRVA 5A2AA 3GNOA 1NH6A 3UXAA 2G3NA 2I5IA 5KTLA 1JI2A 2X1RA 3KBMA 1KGXA 3GDRA 2FGBA 1PX8A 4Q6XA 3M44A 3PZ9A 2Z1XA 5LKYA 3PBWA 1Q13A 1ONRA 4I90A 3EOOA 1QPRA 2C0AA 4M82A 1CGYA 1CIUA 1CZ1A 1NU5A 1WXYA 1E1FA 2JEQA 3KP0A 1LG2A 3RITA 2WLZA 3UVIA 2DZPA 3NZPA 3LNPA 3UWVA 5AFDA 3VFLA 1I1WA 5REQB 2A79A 4B5SA 2AKMA 3INPA 1OEPA 3ZVHA 4Y9OA 3RJXA 2BWGA 1FXPA 4DF2A 5I6SA 2Q02A 4F9DA 2O55A 1TV5A 1G94A 4PMUA 5JMUA 3OZPA 3W1AA 1N7KA 1O1HA 3B9AA 4W5UA 5ABTA 2NSXA 1AQHA 4Q8TA 2P3EA 4MNKA 2VR4A 1YMYA 2CEQA 1PAMA 3TE9A 1S39A 4DWDA 2Y85A 1Q6EA 5A3HA 2XWEA 1TVPA 4HSOA 4UFIA 3UJRA 5DY2A 4K1GA 4ACYA 1JIBA 2VGIA 5LNVA 3FSTA 2Z6JA 4XD4A 3D6NA 2YX0A 4LY8A 5LIYX 2DJLA 1KC7A 1Y65A 3ZVHB 2PWFA 1LQ2A 4AH7A 4TTGA 4TX6A 3WLNA 4RPPA 4PGLA 1TJ2A 4GBUA 1XD0A 1B9BA 2GJLA 5F2MA 3AC0A 3SCNA 1NARA 1IT8A 4WDUA 1RVKA 4YCPA 5LA1A 1V03A 4RR4A 3IIVA 1HQTA 4ILSA 1HUVA 3B9EA 1V51A 4RXFA 4JGDA 4GI9A 3QRHA 4DYKA 2DVXA 1WCGA 4L4OA 4P8WA 2PLKA 2BHYA 2VVSA 5D37A 4DIAA 1BTMA 4KKXA 4WJ8A 2JKPA 4NIRA 3OGSA 3PULA 4DXVA 4DVOA 3T9PA 1DV7A 4XZ9A 3FVDA 5D2VA 1YKWA 3DESA 5E93A 1AK5A 3MSGA 4UC5A 2ZZ2A 4B5UA 4S2CA 4E8DA 1YXYA 4Y2WA 3QSRA 3CIXA 4X0NA 1E51A 4EPDC 1AMKA 3NGJA 1B0IA 2QF7A 1B4EA 2C0HA 4EX4A 3IAQA 3RDKA 4R5EA 2W5FA 4J2MA 1DORA 2X2YA 3V16A 2J24A 4I5UA 3G8RA 3NOYA 4UTTC 3TYZA 5AECA 1RJPA 3PUGA 4HA4A 1AMYA 2G41A 3AJXA 2A7PA 3QZ6A 3W71A 4M7SA 1MI3A 1YPFA 2YL5A 4NZ1A 1DTNA 3LDVA 3R10A 6ENLA 3WLTA 1ECEA 4KGLA 4UTTA 1QHZA 5FKYA 3JZEA 2J27A 2A6LA 4DNMA 2ZADA 3KTCA 4GINA 4NVTA 5JH1A 3GXIA 1OHLA 3N2XA 4HPXA 3KCOA 5E1QA 2A1YA 1CXLA 2G8ZA 7REQA 4U2ZA 3UXDA 3RLUA 4F4RA 4Z1BA 4UWMA 1TV2A 2BXZA 2ZX5A 3TQ0A 3XISA 2QV5A 4O1EA 4GOAA 4I9AA 1MWOA 4MTVA 3QHOA 3SGGA 1UP3A 4H2HA 2YBVA 3C2YA 4QSFA 1W3HA 3WMLA 1Q7MA 2B4GA 2XDFA 1BAGA 1HW6A 1C92A 2WHJA 2RUSA 4ZTYA 3WNKA 1E6RA 4B15A 4CCEA 2QS8A 4FOKA 3H4XA 2Y88A 4HMDA 1QASA 3LTYA 2ADAA 3CPGA 3MP3A 3SY8A 2DY3A 1YRRA 3L0NA 1BVWA 7REQB 4QM1A 2D20A 2CPUA 4H8HA 1OSEA 4H6EA 4N6EA 5JQ9A 2GUYA 3A9IA 3URAA 2J7EA 1VJSA 3V5CA 1QHOA 3W0KA 4GO9A 1UWSA 3O05A 3HQ1A 2DGAA 1WDPA 3FHAA 1W9VA 3MVIA 1TWWA 2V3DA 4AIEA 3I7SA 1WUFA 1QOQA 1QWKA 1NWRA 3TROA 4PCPA 1J93A 4TMBA 1ZBKA 3PF3A 3TZNA 1NWSA 4Z2IA 3GQYA 3UF9A 3L4ZA 1W54A 3D5HA 3N12A 1HJSA 2PEVA 2EPHA 1A5SA 1D7FA 3W3OA 1ADDA 4BEUA 3MI3A 3APGA 1FHLA 4HTBA 3R5EA 3DYOA 3OLEA 1G4PA 2V68A 3QBUA 4QGCA 3CUJA 2CZFA 5KSWA 3LXAA 5I0DA 3VGBA 4AZGA 3L4YA 4IFKA 4EF9A 1K77A 1TE6A 4MDOA 3VM7A 1EA9C 1OQFA 4JIIX 2UWFA 1K7XA 4WK9A 5LA2A 4H9VA 2AQVA 2W4XA 3CLMA 1Y5WA 3G3MA 4QG9A 3FW6A 1P4CA 3KP1A 3RCNA 2DT3A 2TYSA 2CLOA 4LV4A 1UP0A 8XIMA 3CEPA 2JF6A 2DSUA 1V0NA 2WJEA 4CD4A 2GUBA 4PTVA 2WHLA 5HNRA 4Z2GA 3POCA 3WCZA 4KERA 3H2AA 3QPZA 3N4EA 3L12A 4LAZA 4M6PA 1KTNA 1D9EA 1DL3A 3AIEA 3NM1A 3ATZA 4IFKB 4KESA 3WL1A 2IQ0A 3TW9A 4MKNA 1XIFA 1JXJA 1RH9A 3W7DA 4A8LA 4QLKA 4U3AA 2PGRA 2EO7A 1NFGA 4IMDA 4BEQA 3MKCA 1C7SA 4GRSA 5CLTA 3GNRA 4EWND 3N4AA 1XBYA 4R3UA 4H7ZA 1ZLPA 4BQ2A 5E0KA 3ANYA 4GCXA 4EACA 3OGRA 5FA5A 3QFWA 4HTYA 2P3ZA 2WMHA 3P3BA 4DF1A 3GYCA 3UR7A 1SYTA 4CN4A 3WIJA 2HE8A 4IJCA 1LBFA 3VKJA 1OABA 3NZ1A 1AUSL 2GWGA 3CB8A 1W1TA 4M5PA 1XYZA 3F7JA 4GK8A 4E3TA 1H61A 1R9YA 4XUGA 5E9AA 3PTDA 3A24A 4O12A 1UKPA 1PYFA 2WW5A 2VFEA 3EOEA 1SU5A 3LHVA 4NRRA 3LGDA 3I10A 3F2CA 3GBEA 1XGEA 2PF8A 1FWJC 2VJXA 3L0KA 2V2DA 4GA8A 1HKIA 4FB7A 5U7SA 3I6EA 3W7RA 2FQIA 1R3TA 2ZC1A 2OJPA 2OSXA 2O9OA 3U3HA 4PL2A 3L5AA 3NQBA 1CNVA 3AIRA 2VX5A 3L23A 2J8FA 4CQDA 4L80A 4WXYA 3ITYA 4TV5A 4GHRA 4X22A 3H7RA 4O11A 1PS9A 3KOWA 4JCMA 3PNUA 5HWMA 3S42A 3LV5A 1Q6CA 5KEZA 1V3IA 3EWCA 3RRAA 4F40A 3B0YA 3B97A 2V69A 1CXHA 4MY8A 3U9IA 3W75A 4W87A 2CXEA 1XLDA 5FL1A 1GVQA 5T8GA 1M7PA 3WX7A 2P8CA 3BL3A 4PEKA 2E40A 3R8GA 3LX9A 3ZT7A 1ALDA 3WLQA 2W67A 1OJXA 4AXNA 3PPCA 4CVWA 2QPSA 4PN2A 1UD4A 4JTTA 4E6MA 3BAWA 4IX2A 2VZOA 1A5MC 2PU0A 4ML9A 3DBNA 1XYCA 1SFLA 4HN4A 1TVNA 2C18A 2HS6A 2QJNA 2XVKA 3OO2A 4MAZA 4H04A 4P2VA 1UB3A 4C5YA 5HNUA 3VK5A 4NAEA 2BOEX 3KEHA 1H5VA 3EGJA 2PTDA 3GBDA 3M0ZA 5AHMA 1XH1A 2ZX7A 2VZVA 4RXGA 4C6PA 3MU7A 1XIEA 5DCDA 3GFYA 4S3KA 3EWYA 3RFAA 2DZUA 2G4JA 4C6MA 4FR1A 4RNHA 2I7GA 3SFKA 1TPC1 4QLJA 1OYAA 1EC8A 4ZOEA 9CGTA 5LSMA 2BXYA 2Y8KA 3H2NA 3ZJ8A 3GC4A 4YLWA 2OWXA 3BGAA 3GDBA 3NXLA 3AZRA 1R7AA 4FR6A 3SRKA 1XI3A 3LA4A 3BE7A 3TTOA 1GVOA 4JFVA 1OBAA 4OTKA 1E6ZA 1WXJA 4NAEB 1Y5VA 2D22A 4H7CA 2YL8A 3B04A 2JF7A 1LWJA 4XSLA 2E67A 3M46A 4EWJA 3QVQA 4S38A 5C0QA 2QVNA 3TA6A 1QBAA 3BJFA 3UY7A 5EMUA 3S1WA 1R3RA 1JYWA 5DMLA 1HT6A 1PX4A 1XISA 3S0CA 2CW6A 4H83A 4C5ZA 3CBWA 2VC5A 3WLPA 2P50A 1QATA 5EGRA 1TYGA 3SZ8A 4K36A 4F0SA 1XDLA 3MKVA 3QKZA 1SJCA 4KS0A 3TJXA 3RR4A 4C1LA 4JL1A 1QRQA 3KUMA 4D2JA 6XIAA 3APYA 2EQDA 4AD5A 3UZJA 4WDWA 3WLLA 3HFTA 1W91A 3BTNA 1R85A 4J9JA 2VEIA 3STEA 1JCYA 4AWSA 1HF6A 3ZSSA 1WDRA 5GNZA 3B40A 2JIWA 4R34A 1PTAA 3GX9A 4JTKA 3HQPA 1OT2A 3WDHA 4JTIA 3EPOA 1AODA 4O54A 3CIWA 4ZQCA 1LRQA 2QDEA 1CGVA 4LAOA 4R88A 3ABZA 2CZDA 4D6GA 5CGMA 4KH2A 2YB1A 7ODCA 2V9DA 1GOIA 3BZJA 4TTUA 4CN6A 5D04C 3T44A 1VFOA 4MAVA 1FY6A 1H1YA 1XIGA 4BI7A 4ZR8A 4GYPC 2J79A 3DFHA 3DERA 3W7HA 4F79A 4O1BA 3EB2A 2AQWA 4N9CA 4DZAA 1MFUA 2DVUA 4M29A 4O28A 2GK1A 1LORA 3F4VA 3STPA 4UFLA 2XH4A 2DP3A 1ZSXA 3KOFA 3W2UA 1AQMA 2WANA 5DQPA 1E6QM 3SW6A 5HANA 4R27A 4F9JA 5I24A 5KMYA 1IGSA 2J74A 1DXIA 1VBRA 1R2TA 4S3DA 4DJDD 4ZXLA 2OZTA 4REQA 2ISDA 3GW0A 2QGYA 3BGJA 1TMQA 3IJ8A 1ITXA 3W84A 3COTA 1RUSA 5A8PA 3EMQA 2P53A 2VYOA 4WR3A 4Z2HA 3VMNA 4AMAA 4YTTA 3VO0A 3U8GA 4LEQA 1TMHA 4XX6A 3IRDA 5CC3A 3G0XA 5BMXA 4NT0A 4AEFA 3W7PA 1A5KC 3S6OA 5EPDA 2Y70A 1I0DA 1DXFA 1HJUA 4NRSA 4WDXA 4NASA 4FXFA 4LVAA 2FJUB 2X0HA 2NV1A 3UR2A 2VWSA 4H41A 7CGTA 5DCEA 3KZSA 2V38A 4FLSA 2OZ0A 3GDMA 5A6LA 2CKSA 1PYMA 4A6GA 4PB3A 3B0XA 2ABBA 4CQAA 4FXRA 1EF3A 5DBTA 2D0HA 1GCYA 2R91A 1SW0A 5GJPA 5DF0A 3N6JA 3E2QA 4ATWA 4YTSA 3HG4A 4D6CA 1PZ1A 3CUXA 4FLOA 3T09A 4AVNA 3BLLA 1E0UA 1W5OA 4QJ4B 2E6FA 3CZGA 1GQIA 2PDLA 3PS7A 1OINA 1SVDA 1RHCA 3KZPA 1UQZA 3H22A 4R85A 4XIAA 2XVGA 1WA3A 2YXOA 5C2CA 3VYLA 2E8YA 2UY4A 1OGSA 3D46A 2G3MA 1MDLA 2XSBA 2YCLA 4AD2A 5CG0A 4HZ6A 4MB1A 4FOUA 2DZXA 4DN1A 5CJMA 3I68A 5KZMA 1WXZA 1AZ1A 4K39A 4GY1A 1ISYA 4BK9A 3AAMA 4JKKA 3O7UA 2GJNA 1VIZA 5J8LA 3ONCA 3BVJA 2WBKA 1KR0A 3JVAA 4OBSA 4F0HA 4ZE5A 3AWNA 5D2WA 1M41A 1CB7B 1QO2A 1RALA 1E15A 1WDQA 5LIWX 1Z42A 3OVPA 2D2GA 2Z24A 1OK6A 2QVHA 3AYVA 2YCLB 1AH4A 4PUWA 2DSKA 1ZJHA 1O5QA 1W1B1 3WH9A 2WCAA 5DELA 1J0YA 3W7KA 3RMJA 1GOOA 4S23A 1YPIA 3RPTA 1WPCA 4ZFMA 3UCCA 3STGA 4MB4A 1YLVA 4OGZA 3TLLA 1Q6OA 1QCWA 3SIMA 1P6CA 1OFOA 2NZLA 1OADA 2J75A 4H9MA 3MUZ1 2Q09A 2ZUNA 4X63A 1VPYA 3QY6A 1VIWA 2Y1HA 3VIJA 4JY9A 2GJXA 4DLFA 2G3FA 2J78A 1AQFA 1OCJA 1RA5A 3LYEA 3UR8A 3LBCA 4Y8FA 3WBYA 1NSJA 3QH2A 3AHVA 2CNCA 3VGGA 3FY1A 1FTXA 1V6WA 3AHXA 1S3TC 4JEQA 3WMSA 4KRUA 4Q33A 5A8OA 1UR9A 2WPGA 1YYAA 2GQAA 4IPNB 1UZ4A 4M1BA 4MM1A 1FCUA 3P2VA 3N2OA 2WYSA 1CDGA 1JAEA 3FYOA 5GVJA 2ZE3A 4ZOCA 2PRMA 4AZIA 4EXBA 1LLOA 2C91A 4G6CA 4DYEA 3NQ2A 3VE9A 3PSWA 4GLEA 4DJDA 3ABSA 4WZHA 4QNEA 4C65A 2IPFA 1FP8A 2QUMA 1GZGA 1ZP4A 2FFCA 3DFSA 4QR6A 3GU1A 2HQAA 2E5CA 3FAWA 3A47A 3HV9A 2NT1A 2D24A 8CGTA 3GVRA 1RK6A 1JCMP 4IOTA 3THAA 3IIOA 3SUSA 3LRMA 1YXCA 5EA9A 3MCNA 1XKYA 4ADUA 3NQMA 4XZIA 2X1UA 3L65A 4UTIA 3DEQA 3ZWSA 3HBLA 4OBTA 1K6WA 3MUAA 3ZSTA 4FP1A 5FF3A 4HN8A 5DMYA 3SGUA 3N6HA 1NTHA 1J5TA 4ERGA 3P67A 2EJAA 3TKFA 2QPXA 4RDZA 4YN5A 1YNYA 1NDVA 1FDYA 4IICA 1SO4A 2HBXA 1F4HA 4Y8EA 3W86A 1PVNA 4BJHA 9RUBA 2BHZA 3G1SA 5FIPA 1HO4A 1OWQA 4DLMA 4IXHA 3CUGA 4HK7A 4ZENA 2HVMA 4L4PA 1W9DM 3Q4DA 1GKRA 4Q8VA 2O4QA 4B4FA 5HJYA 4PCSA 2YXXA 1EJTC 4ZE4A 4YPJA 2FZNA 1J8VA 4GIEA 2XG9A 3NYZA 1CX9A 1KM0A 2ZXDA 5LNRA 3KWXA 1UR1A 3HMJG 1AD4A 3ZFHA 3M0YA 1VCGA 3WK1A 1B54A 1FWBC 4N7QA 3Q65A 4RUBA 4AUBA 5JIWA 3GS6A 2J8GA 3Q45A 2ZCGA 3E6EA 1PL9A 1CLVA 2GGGA 3VMPA 4L64A 2WV8A 1ZAIA 4HQVA 3I6RA 1UZDA 4MSSA 4D71A 4MKSA 1Q7ZA 2EPMX 4PH6A 3VABA 5RUBA 3LGEA 3GFXA 5I7GA 3HM7A 4NUWA 1UH2A 3T0TA 2C79A 4YWIA 2XVNA 1UPMB 2XN1A 3OZOA 3K1DA 3G6LA 1U1JA 1EFZA 3HQOA 3WQGA 4B5NA 4GZ7A 4HA0A 2QCMA 3EXSA 4YVPA 1YEYA 2OO0A 3FEQA 5DANA 5DCBA 5AC4A 1OGBA 1PCKA 1KCXA 4I9JA 3W2MA 3GXPA 5TIMA 2PWUA 3WK0A 4HNNA 5D9PA 1F3EA 1SMDA 3UG8A 3FA5A 2QDGA 3ITXA 4DUXA 4IGNA 4Q8OA 1HX0A 1B3WA 3EXRA 1M68A 4DO5A 4RZ4A 2DT0A 1ICQA 3SSJA 1B31A 2PDWA 2J7BA 2I9UA 3QPEA 3OG2A 3LG3A 4O16A 1NAL1 3QSTA 4TVUA 4QIUA 2A3HA 2EHHA 1CEOA 1SZGA 4P8VA 1W1PA 3TX9A 4ZL1A 3DU0A 4CCDA 4EVZA 3BAJA 4S3AA 3WK2A 1R3VA 2CESA 2VFDA 4GFIA 4RCXA 2Y4SA 4RZ6A 4E4PA 2YCKX 3WQPA 1W9BM 2JEPA 4W84A 1H0GA 3REQB 3HGSA 3A6OA 4EXQA 3HO8A 4EXAA 5E0CA 2BX7A 1QHPA 3S1XA 4RNIA 2CZEA 4UOQA 3CUFA 3U0HA 1G6CA 3GHUA 3MCOA 1L6FA 1AW2A 3QC3A 4GJJA 3VFCA 5HWNA 3IJQA 1GG1A 1OFQA 4WGXA 2CLPA 3MDUA 2Y2WA 1FWSA 3WJXA 1EX5A 3FJLA 4LS1A 3RUBL 1GVSA 3BOXA 5AHNA 3E2VA 2OTDA 2A85A 2D3NA 4H8VA 3TN6A 1J18A 1MEHA 3VOHA 3KW3A 2H6RA 1XYFA 2PWEA 1CXFA 2GVGA 2PAJA 1K02A 1W3JA 1C8QA 2I16A 2YOCA 5I3HA 1XIBA 3TYUA 3VILA 3NIYA 3W27A 3BJTA 1GQLA 1GQKA 1JAKA 1OC6A 2NQJA 3T1GA 5GJNA 3TP4A 1EYWA 1DE6A 3KL5A 2ZFAA 1G5AA 1K9EA 3S47A 4HNUA 4KWSA 3NO5A 4AVOA 4MYXA 1RQHA 2VL4A 4ZEPA 1ZU8A 4HHPA 3N15A 3O06A 4XZMX 2WZEA 3R4IA 5JBEA 2O7QA 3FLUA 3FN9A 4L9YA 4XIMA 3ARUA 4I7WA 4LT9A 2W91A 4CU8A 4MMWA 4EE9A 4V33A 1Q8AA 2HK0A 2PP0A 3VKKA 3TSMA 4JX4A 3FOKA 3OZMA 3QEZA 2ZE0A 2X30A 3NPXA 1LP6A 3BAKA 1OD8A 2JKEA 3P6LA 3I6TA 3L5MA 3AIUA 3BXWA 4O50A 4GXMA 4BHYA 3GTXA 3ZMRA 1EQCA 1W3NA 3DN5A 1U1UA 2R1MA 4O10A 3SUTA 1JNDA 4Z42C 3VGFA 4MFDA 1CT5A 3PJTA 3SUWA 1RJRA 2I1OA 3TN5A 4JTQA 4GGBA 2CLEA 2OZ8A 1WBJA 2ZUUA 1E1EA 1GPFA 3VI2A 2BY1A 5DMMA 1JI1A 3QR0A 5JXQA 1EJSC 4Z0JA 4HCLA 2HWGA 2Z0IA 3B8IA 4LB4A 1TSIA 1QOPA 3WNPA 1IEWA 2VTFA 1A5CA 4HMCA 4XKMA 5G1YA 2XH2A 3S4TA 5FAGA 1G4EA 5LHEA 1B5TA 1TR1A 4PRTA 3PBUA 5A8GA 1J11A 3S2CA 1E5NA 4CN1A 5K9DA 2FGLA 3THQA 1F5ZA 3EOUA 1JCTA 4BCEA 1QPQA 1ZZMA 3WL0A 2Z6IA 4HA3A 3HPFA 4N4PA 3FKKA 4Q8NA 1ZB5A 4OOZA 2EEXA 2XGZA 1MVYA 3JUGA 1E9LA 4KEZA 4P7LA 5HK4A 1NDWA 1LRNA 4HGXA 4AXKA 1K8YA 4IHCA 1J12A 5HQLA 1IEXA 4S3CA 2ZZ3A 5TQLA 2RHGA 3VD7A 4R53A 4BWLC 1BHGA 1W2VA 4OV4A 1DWJM 4L56A 1DJWA 2QLYA 1C9WA 3AXKA 4O1CA 1SFTA 2YLAA 3BURA 4BWLA 1QI3A 1B1YA 1RCXB 1UR8A 4BFAA 2ANUA 3HPXA 3L2MA 2AL1A 5T9BG 5K2ZA 1RPXA 4IQJA 5HR6A 3W2JA 5IHRA 3SCRA 3RPDA 3CT2A 4B5WA 3B0PA 4ZFCA 3W25A 1A0DA 3NZRA 2VX6A 1BG9A 2FMOA 2WM1A 3Q37A 3MSDA 2YL6A 1UIPA 1QJWA 4XTDA 5TD4A 3HURA 1JYVA 4HNVA 1KTBA 1VFTA 4Z2JA 1SZNA 1I2RA 2FMNA 2NVAA 3AU6A 2J4GA 2GDUA 3WF1A 2EPOA 3CB3A 3ALFA 3UESA 3W53A 3FHQA 3G2GA 1Q2RA 4PSPA 3DAQA 1F73A 1EWEA 5AC5A 5K4ZA 4IP5A 1DEDA 3M07A 4H19A 4OZOA 1U30A 3TAOA 5DX7A 1P0EA 4K7VA 1LF1A 1WBHA 3QR3A 2ZTKA 4DELA 2A5HA 1OX4A 2WO5A 1F7BA 3WDRA 1YDVA 4HU0A 5LIKX 2WAGA 3EA3A 4GVGA 2VR5A 4QISA 1EL3A 3W2KA 1V7YA 2E6YA 3TSBA 3RG6A 2DSVA 4GVFA 3DC8A 5DEZA 1EJWC 1FBAA 3QV9A 1WP6A 3MMTA 2XFWA 3W74A 2V81A 4E2VA 3I7QA 3ME3A 4L6DA 4O1DA 1T8XA 4IMFA 3GD6A 4PMJA 3M7WA 2WMGA 2YKKA 5G4WA 4ERAA 5BROA 1UMYA 1ZTVA 2POZA 3TJ4A 2NLYA 2DQWA 1J6PA 4F0MA 5EBUA 2VD8A 3NL2A 1MO0A 1SMAA 3WQWA 3NXFA 2QW5A 4C6QA 2W27A 2EXOA 3SRFA 3WLHA 4N6FA 4PBGA 1BLIA 1GHSA 3HOJA 3LLDA 3UBPC 3USZA 3VOJA 4YHGA 3UVAA 1KCZA 3EZ4A 3H4WA 4NJGA 1C7TA 1V02E 1P0BA 3TXVA 3BCDA 3GIYA 2ON3A 4QHRA 3SCTA 4A21A 3GNXA 3LV6A 4NSBA 4RX0A 4D72A 3N9SA 3K13A 5I77A 4MWAD 1UWQA 3NVTA 5LIUX 1V5XA 3NURA 3WD0A 1AJ2A 4PTWA 2MUCA 2WHKA 1Q5MA 1GOXA 4MG4A 2CERA 3PFRA 1TWSA 4I9MA 2O0TA 2KX9A 3QZEA 1WUEA 5FCZA 2UV8G 5HMFA 5TBOA 4DB7A 1G1YA 2I56A 1RLDA 5D9NA 3L4VA 2ZX6A 3HIJA 1UD6A 1U33A 1XGDA 3WDPP 2Q8ZA 5B7ZA 3MY9A 3M6YA 3LM7A 1MQQA 4A3UA 3L4TA 2WM0A 1HFBA 4KCUA 4C6EA 3W6MA 2IKIA 3DBPA 1JQVA 1VJIA 3A64A 3N04A 3CC1A 4E8GA 5AYBA 5LXXA 3SUVA 4P7RA 3AIVA 2ZTJA 3S9IA 1XIJA 4WF7A 5CAHA 4X61A 4JY8A 3W07A 3MC5A 5AOUA 3JS3A 3SR7A 4H8NA 5M3WA 3MHGA 5ABFA 2HVNA 3G1VA 2YPIA 4UOZA 2HXTA 1D3GA 4O53A 2ISFA 4WUIA 1ESWA 1SFSA 4AY8A 2YZ5A 5CZTA 3KRZA 3P82A 5BRBA 1UR4A 2V82A 2YYUA 3DFYA 1QI0A 1IE7C 3R94A 4L1WA 2XGIA 5EB8A 3UZZA 5CH9A 3VDCA 2NQ9A 1DJIA 4ICNA 1FWHC 1TUFA 1TWIA 2QQ6A 1WX0A 1UKOA 1JGIA 3H2FA 2R1KA 1MUWA 2Z2AA 4AD1A 4DWSD 1JQXA 3WF4A 3VDBA 3OA5A 4D1JA 3TN4A 3VOGA 1UA7A 2C19A 4WVXA 5XIMA 4A35A 3MJMA 3HFYA 4RV8A 3CZKA 2C6QA 3Q58A 1TPDA 2VOTA 4LQ1A 3W29A 5BOEA 4CU6A 4FNPA 3MJYA 4Q4SA 2YA0A 3O9NA 4CUCA 2RDWA 4AVFA 3I65A 1UROA 1FWNA 1UD8A 3H2EA 4U31A 4GQ0A 2ZZ7A 3YPIA 7TAAA 3TC6A 3E1F1 1AW5A 3UGRA 4I5RA 2ISSA 3OZYA 2OOFA 4QLLA 1A5OC 1V6TA 1JG9A 3LCIA 1E0TA 1C29A 3KBSA 3OJGA 1SPQA 3P74A 5A5WA 3A12A 3LHZA 3NVDA 3SCSA 3CPUA 3LBMA 3V3WA 2UBPC 2IKJA 3FGCA 3MVTA 4IT1A 2J77A 4XTIA 3MP4A 1XRSA 3TW7A 3W72A 3WFLA 1YHTA 2PDGA 2V5BA 1CGXA 2GQ8A 1VYPX 2V2CA 3LI1A 3C2FA 3QQ0A 3UG3A 4DBUA 3PWAA 2FHFA 1VQTA 5D8ZA 3N14A 2W9MA 1C3FA 3R79A 2CHOA 1GOMA 4IF2A 1PKYA 4H6QA 4KIRA 2E9BA 2GL5A 2QR6A 4NF7A 1HN1A 2OQLA 4LYRA 2PSNA 2QV4A 1UA3A 3EYPA 3CM4A 2I14A 2R94A 4ATLA 3WLJA 2QMJA 3EPNA 2J7CA 2XVPA 4B3LA 4X2RA 1HKWA 4H8UA 3GTHA 4RW5A 1L8NA 3BSHA 1QOXA 1GPWA 1VBGA 1MNSA 3RCYA 3IVUA 5B7YA 1H60A 4KWUA 4Q3MA 1XG4A 5CC5A 4LUYA 4BQ5A 3W7MA 2Y8VA 5FEPA 3EPMA 3NL5A 2CYGA 2G37A 4MWAA 3T2PA 5A8NA 5LNWA 4V15A 5EBAA 1ONEA 3QTPA 3NSNA 2Z1SA 3SQLA 3UQNA 1N2VA 3RM9A 2DQXA 2FH6A 3DYMA 3KBWA 3WQCA 1ZPTA 1FWWA 4NZCA 3GXMA 1PXGA 5FJOA 4HJWA 1TV7A 3GTNA 3NO3A 4BQ3A 2FZDA 3T42A 5HULA 2W92A 3GXNA 4HB7A 3ZYZA 5KITA 1NDZA 1A0CA 2BMBA 3RRXA 3VIIA 1A53A 4HOWA 1TPVA 1Z89A 3LCLA 4FI4A 1ML1A 2J9ZA 1QNPA 3M0IA 3FXYA 1V08A 1EEPA 3LXCA 3CJPA 1UMLA 2P0IA 1EB3A 1KNWA 1EPVA 3U7BA 3F2DA 3VU2A 1XDMA 3ISIX 2DPEA 1AZ2A 2RAGA 3RK8A 3LQGA 2ZZ6A 4W9TA 5HNTA 1SO5A 1FHDA 3V1PA 1WB0A 2FTPA 2YBUA 3T4CA 2UY3A 3AMLA 3DHFA 4Y90A 1V6VA 3WZ0E 1SM9A 3G18A 1UJPA 3BWWA 3GM8A 3WN6A 5D03A 2OGJA 2BASA 4ZQRA 3WDIA 3O15A 2WPBA 3GB6A 3ARXA 3G1RA 1R5YA 4GUJA 3IUIA 2WJZA 1R3YA 3H55A 3U7VA 2YDSA 3QR1A 2YXGA 5C70A 2IPJA 2BOGX 2OZ3A 1KXTA 3MI6A 3SCPA 1DWIM 6TAAA 1R3SA 4FZIA 1THFD 3BK0A 4GVIA 8A3HA 4EIVA 3GU2A 1N8WA 2QJJA 1CB2A 3DOPA 3V5FA 2PDUA 3OG3A 1MMFA 3PJXA 3UCQA 3CHEA 4DAFA 3TFCA 1I2OA 1DIDA 3LCGA 3NPVA 3HGRA 4I6VA 4IG2A 1IXQA 1KXVA 2XFFA 3PG9A 4J1OA 1BVZA 3R12A 5IM51 1QNRA 1QI4A 4NNBA 1DWFM 1A5AA 2Q8LA 1GEHA 2PUZA 1CW2A 4LS0A 2W3ZA 3ITVA 2PWHA 2OKOA 4Q8QA 2PC4A 3BLEA 3GTFA 3KS5A 3EMZA 1OYCA 4JQ2A 4PODA 2I5QA 2H3DA 2ACSA 3M5ZA 3MW7A 1E1CB 1ZRQA 4GUFA 5GNXA 3LSBA 4JQ4A 2ZRYA 2ZUVA 3K4DA 1FDZA 4X0VA 1QFEA 5E6ZA 2RFGA 5HWJA 4YCOA 1QW7A 4QQUA 2NX1A 2WNWA 3B4UA 3BW2A 4NI8A 3EKZA 2WKLA 1HGYA 1OYBA 3W4RA 5IHSA 3AMKA 1LOQA 1TPUA 3A23A 1OD0A 3SQSA 2F6UA 4IG2B 3HGOA 1VEPA 4FOJA 3ZR4A 2CBJA 3L4UA 4CU7A 3K5XA 1C90A 2MANA 2VEPA 2XINA 3WLOA 4S2BA 1VP5A 4WD0A 3IJIA 1XL9A 4WY0A 1J01A 4Q32A 2HV5A 1OY0A 4HPJA 3S9ZA 2V0TA 4PBFA 4W8AA 4WY0F 1BKSA 3NPWA 4FIRA 4FK9A 2ESCA 3N1AA 1CXEA 1PWLA 3QY8A 2VGBA 2Z4GA 1O68A 1UOKA 4IP7A 1JCLA 2DZWA 2DH2A 4DQWA 1EZ2A 4CNTA 5I23A 3KLKA 3NR0A 4NX5A 4GNJA 3OW1A 3VC6A 4KFOA 4C6DA 3BOLA 4O17A 1SR0A 3MYPA 4W8BA 1EH9A 2R1PA 2DW7A 3GIPA 1H3GA 3RX2A 3A21A 1CECA 1EWDA 4WY0B 4I5XA 1I2QA 4Y9AA 3HV8A 5A6TC 1UBPC 3A5VA 2ACQA 1E9IA 3PB0A 3EA1A 4V1XA 5E5CA 4UOJA 1XXXA 3EXTA 4D6JA 5D2TA 3M0XA 4IIEA 1GEQA 1WQ5A 3S5OA 1ONWA 5TNVA 2DH3A 1RQEA 2PRHA 1EGVA 4KF1A 4XB3A 2HPMA 3NQAA 4PSRA 1SO3A 2NSOA 4B3KA 3WJZA 2DT1A 1BD0A 3AS3A 1XLLA 4FO4A 5D2XA 3ERPA 3G1HA 3V0SA 3WQEA 3H53A 2INZA 3ID7A 3R11A 4JYEA 1DXEA 2BG5A 4UZUA 4IMCA 3EB4A 1JZ6A 3SAZA 2XYLA 8TIMA 1F8IA 3TJIA 3UZXA 3Q94A 4X9YA 3AO0A 2GSJA 2KZHA 5HR7A 4YVVA 1NOWA 4GIYA 1E4NA 2ZA3A 1AJ0A 1W5QA 2CHNA 1WKDA 1QW8A 4DJEC 1GVYA 3W1XA 1VR6A 3BICA 3CGTA 3F03K 2AQOA 4JPGA 1VCVA 5A8QA 3N2BA 3WEZA 3MTWA 3QFEA 4FPSA 3ZJ7A 1JF5A 3S5SA 3W2LA 3RXZA 4LGXA 4KRZA 5C9ZA 2D73A 4R9XA 2OLAA 3S1GA 1F8MA 3H23A 2QCCA 1LUCA 1OFAA 4DF0A 3URBA 2FDSA 5G4EA 4HPGA 1BGGA 3LPFA 4LF1A 1TIWA 3GR8A 1ZBVA 5FF0A 4LB3A 3V5OA 3VOIA 4PUJA 1O5XA 4R7JA 5EYWA 5T26A 1NJJA 1VRDA 3IIXA 4JZ5A 1P6WA 2YR1A 4J4KA 1FH7A 3R25A 5MHBA 3EAUA 4BQ4A 1E0WA 2VQUA 2OWCA 3W7QA 3DFPA 1S1RA 4ZQOA 3CZ8A 3GTIA 4F8XA 3OTRA 2B7QA 1OF6A 4UR8A 3CHCA 5I03A 5I00A 1M7XA 1UUOA 1VZWA 3TDFA 4D8ZA 3ARTA 3U48A 1V6YA 1IZCA 1ZENA 4WJXA 4E2OA 2VHLA 4I7UA 1XLGA 5TF0A 3EDJA 5LZLA 4GH3A 4P5UA 1EHAA 4LC8A 5DT7A 1VHCA 1E56A 3G1DA 2WVTA 3G3DA 3M64A 4GC3A 4UB9A 2QJIA 1V0KA 3OBKA 4ORMA 3DFTA 3B3DA 3G5EA 1JEZA 1RAKA 1ZY9A 2BXVA 1TWZA 1BG4A 4Q6JA 4M0XA 3N29A 3S6TA 1BYCA 3NDYA 4JTCA 1X97A 4GKTA 1DQUA 3T2QA 3AISA 2O9RA 4RE2A 4IQDA 4B9YA 4JTEA 5CAKA 4QAIA 4WIWA 1LDCA 2YGYA 3BCJA 2E1WA 3Q67A 3WQFA 4HBKA 5I78A 1WDSA 4DM1A 3K8MA 3M0KA 4U33A 4KEUA 1HKVA 1GWJA 1K8ZA 2WZTA 4GZEA 2BDQA 2WC7A 3Q2DA 1KFBA 1KR1A 4V1YA 2P10A 4CKQA 3H6OA 4HU3A 2BVDA 4A05A 2E5DA 5DLCA 2TMDA 3XIMA 3THUA 1TZ7A 2HS8A 1XPGA 2ZUWA 2HBVA 3TV8A 4GXPA 1E70M 4QG8A 4L65A 4S3FA 3GU9A 2O7SA 3W73A 3GE7A 1LOSA 2BGQA 4LFYA 2FHCA 4CQCA 3N34A 4JKLA 3PBGA 2F61A 5MKGA 2NWSA 1R3QA 4CQBA 1IR2A 4OFCA 1YNPA 1FWCC 2BGSA 3VNMA 1KGWA 3C0JA 3UJFA 3P61A 1QK0A 4PUNA 4XK2A 4WSKA 3B9DA 2R14A 3S1VA 4M80A 2F7FA 4PC8A 4U10A 3VDAA 5C71A 1X6UA 3CXOA 1ZCOA 3UPBA 3PP7A 4V27A 2V5DA 2QT3A 2W63A 3U2OA 3E2RA 3QW4B 2RH9A 5D8WA 1EJVC 2PZ0A 3AJ7A 2X8RA 2ALRA 3CWOX 4E8CA 1EGZA 1BEUA 3GHRA 1O94A 2GDVA 3T2OA 2PDCA 4NZ5A 3TTYA 3BAXA 3W7GA 2GPTA 4J5NA 5MKGB 4C7DA 1XW8A 1W1IE 2JBMA 4IIBA 3VD5A 4E4FA 4ZODA 4NL1A 5BU6A 1JXKA 3TC7A 1V4YA 3MA8A 3WF2A 2Z1KA 5C9WA 2WMJA 3LRKA 4GY0A 3BANA 2TODA 4L7ZA 3VZZA 3IV8A 2WMIB 1CLKA 2P8BA 2QF8A 2Z00A 1H4PA 2OOGA 3WJYA 3SY1A 1AA1B 5E0FA 1NWUA 3W6LA 3RX4A 3VCRA 6ALDA 3E0WA 2WVVA 1WZLA 3NWRA 4HKPA 3UZ5A 2NWRA 3LCWA 1JZ2A 3A3HA 1BF6A 1DTUA 4K8EA 1F6PA 3K4AA 2X0SA 3NPUA 3POHA 1XCFA 1UCWA 1M01A 3HG2A 1MEWA 5FF4A 3LB0A 2C7FA 1IHIA 3H7VA 4QS5A 2O92A 1HJWA 4UTUA 3TSDA 3N11A 1JJKA 1WZAA 1J79A 3PPHA 3CZJA 1SGJA 4AZ5A 4TMCA 4XKYA 1PUDA 1H09A 4RZ5A 1DJXA 5CBJA 1RQBA 5C7VA 1TELA 1VLWA 3EWDA 4ZQNA 2D2OA 1G4SA 5T91A 3U6WA 2PODA 3BGGA 3VE7A 1P1XA 4QTGA 3ZZ1A 4WCJA 2E8ZA 3W85A 3S46A 1X8CA 5CZKA 2CC0A 2WVVB 4IFRA 3QV8A 1CCWB 4NZJA 3TQVA 2Z1VA 2NQHA 3VIPA 1D3HA 3DGRA 1Q45A 4L61A 1UWRA 2CBUA 2VGGA 4GY7A 5CPMA 1POJA 2HSAA 1E0VA 1Y7VA 4M6VA 4AHOA 3UY8A 3P0WA 4G9PA 1HVQA 4Z08A 1ADOA 4PRRA 3SURA 1Y5XA 2EPNA 3WNMA 2Y7GA 4O13A 4UTMA 4AF0A 4ZVJA 3VPLA 1K4GA 4XKYB 3W22A 3RN6A 1B57A 5A6SA 4MZ8A 1KRCC 1QWGA 4DUVA 4UTLA 5CGTA 3F4NA 1GYMA 2CU0A 3A13A 4OT7A 1R47A 1XX1A 4M6QA 4PCNA 3W9ZA 3HJZA 3AWOA 3OVGA 3WELA 4F0KA 3C8NA 1W1VA 1ZP3A 3BG3A 4N9DA 3UCDA 1PIFA 4KWWA 2X0YA 3OQEA 2GVLA 4IMEA 4H4IA 3DKJA 4XV0A 2CBIA 1NWTA 4BF7A 3B0UX 3L2LA 3SBFA 4QE1A 3P8JA 4QCEA 4CD7A 3BLDA 4FNTA 3MMDA 4CCZA 3NQFA 3OEXA 3WNLA 4OIFA 4AF0B 1VEMA 3E74A 4K68A 2AMXA 1RBAA 2NLIA 2QMKA 3AI0A 3WLIA 5C9XA 2VXNA 3BV7A 3T0CA 3SY5A 1VLIA 4C7GA 2A7RA 3GVGA 5LGXA 4RPQA 1QI2A 2NVDA 1E6XM 4GQRA 1O6IA 4J3TA 1OCBA 1TTIA 2VMFA 1M3UA 1DIKA 4FIQA 3B06A 1LLZA 1TA3A 1M6JA 1L6SA 4B90A 2WNQA 4QG6A 2ISVA 1V6UA 5M17A 3ITTA 4O8RA 5EFDA 1UJQA 3KOXA 4MLRA 1F4AA 3C2EA 2XIQA 1E6SM 5BZAA 4KRTA 1S5NA 4S3BA 4YL2A 3WBEA 2HK1A 2E09A 3CAVA 4J3SA 3TCEA 1HL8A 4P7QA 1A5UA 3MUIA 5C55A 3B8VA 1XD1A 3NQ7A 3GNDA 1NF7A 2XM1A 2IUZA 4M6UA 1ITQA 1WKYA 3H8AA 3NQ8A 3KM8A 4FHAA 2Y61A 1X6NA 4BI6A 4LSBA 4J27A 4LVBA 2FLIA 1J0JA 5CPTA 1TA3B 2INFA 4JHOA 4GMEA 2V2HA 2BLEA 3ANUA 1CGUA 4XZWA 4XUYA 1YTEA 2XFRA 3PAOA 3CV6A 2AKZA 4YMZA 3SIZA 2BBFA 1O66A 2QUNA 8RUCA 1XCXA 4HPHA 2OO6A 3R7MA 1DYSA 3AHZA 4Q8PA 1M03A 5H1WA 1RBOB 3MANA 4IPLA 3A3WA 1EOKA 2DSZA 2DZTA 1J9YA 3CASA 4D9PA 3PANA 3WJSA 2OEKA 1PKMA 1S2CA 2FGZA 4DBWA 4UTWC 1E40A 1TV4A 1QTWA 1FCBA 4JXCA 3TFXA 4HP5A 1DIOA 1XH0A 2OYLA 3LHYA 3NQCA 3RLHA 5C5YA 2PURA 3TUUA 1ZJAA 2ZUSA 3PJUA 3E5BA 2X7WA 4HNOA 4GFSA 4YNGA 3ABQA 1SR9A 1YIXA 2HXUA 3SJ3A 3VOFA 1F76A 3FEMA 3MSYA 1DJZA 4M19A 1P5BA 4F3HA 5I06A 1TWDA 4L6OA 2IPGA 4DBDA 5HBFA 2CKRA 3KRUA 4MUZA 2WSRA 4M7TA 3UJEA 2QPUA 1P0DA 3WNNA 1RY8A 3IUHA 4IP4A 3KS6A 3E3HA 5J5DA 3H24A 1K7EA 3AYSA 5LNUA 4B4HA 1EP3A 3R2GA 4KQNA 2ZA1A 4LBRA 2QAFA 4WLCA 4IZGA 3BDKA 4D6DA 3O16A 1XRVA 3O8AA 4DRSA 3BLIA 4QJ1A 1AJZA 4JIEA 4S3JA 4H6RA 1TJ1A 4N2YA 1TRDA 1ZAHA 2ZZ1A 3URNA 2VC6A 5AC8A 4ZO7A 1OG6A 4KWVA 2D1ZA 1WO2A 2VELA 5D9MA 4I8YA 1X6LA 3GXDA 4NU7A 3H54A 3ZO9A 2J88A 3CTTA 4W7UA 1XG3A 3AUJA 1TJ0A 3M5XA 4LALA 3MMUA 2V8ZA 4L1XA 1J4EA 5D9OA 3I7RA 3MI2A 4QXIA 2VX7A 1O4UA 2ACUA 3EX6A 5K9CA 1W32A 1X7FA 3SGZA 1KB3A 2X1TA 4HJFA 3NCOA 4A4AA 4GYJA 4L5ZA 3QYSA 2Y6ZA 4HCHA 2G0WA 4GPNA 1UR2A 5FACA 3UWQA 3DI1A 4JX5A 3MHFA 2YA2A 4B92A 1NDYA 1R46A 2FTYA 2QULA 1QNQA 2PRLA 1KM2A 2ZDSA 2AAAA 4Z1CA 2W79A 2BY3A 3H26A 4JTUA 1UC5A 2VNCA 2I9EA 3IGHX 2NXIA 2Z28A 3JRKA 3LI0A 1A80A 4WDTA 3VDHA 1PV8A 3SM0A 3RJYA 1I6NA 2DSWA 1K9DA 1Q66A 2C16A 2VEFA 2ZX9A 3VNZA 4GQQA 2OT0A 3PAJA 4OQVA 1U83A 1GW9A 5A94A 3WQ5A 3L4XA 4LOCA 5IFPA 1TX0A 4IGSA 3I3EA 1TTJA 3BLPX 4NI3A 5HJXA 1PKLA 2XTKA 4LAKA 4AU0A 3LSCA 5H91A 5HUPA 4HNLA 4M8UA 3II1A 1OM0A 3GC2A 4LVGA 4JTGA 4AIBA 3CWNA 3ZS4A 3U4FA 1ZNNA 3GKAA 2FPVA 3GVWA 1KV5A 1KTCA 4PFMA 2X41A 4ZQMA 2GLKA 1U1HA 1P6BA 2OQYA 3CPRA 4GNVA 1K1DA 5D38A 2VCAA 5DT5A 3V18A 1TRIA 4FEZA 4N4QA 1XLIA 4YHEA 4NJHA 4AG0A 4TVCA 2ZZ5A 4MJ2A 4EP8C 1IZKA 1DPMA 1YE6A 1FCQA 3C4UA 3OVQA 1TPH1 2IKGA 3DFNA 2WB5A 3IARA 3M5VA 1C93A 4H00A 4QBXA 2QUTA 1XLMA 4NJKA 3AHYA 4AWUA 4UTFA 2RKXA 3BAIA 2BVTA 1A4MA 3CUIA 1QXLA 4JHZA 4IQLA 2IMRA 4WX2A 3BMVA 4AY1A 4G8TA 5HMDA 1Q85A 2D2HA 1PHWA 3M5YA 5GNYA 5KZEA 2NVCA 1W3LA 3L67A 5FEXA 1IWBA 2E77A 4DXXA 1QPKA 1HXJA 1UR0A 4XVEA 3W76A 3PZMA 5LGZA 3K8KA 5FJIA 3IPWA 1O12A 1PTDA 4K8GA 3QMSA 3W7IA 5BMWA 1GYNA 2R8WA 3M0LA 2IXVA 2FIQA 4PTDA 2I57A 1SW3A 4LPCA 2J7FA 1B9ZA 1EJUC 1J2BA 3DENA 2V3FA 2VRKA 4RNFA 3QF0A 5HAOA 2PDIA 4PMQA 3N3TA 4GD0A 5KETA 4BY3A 4A29A 1PCWA 1FUYA 1UWIA 4WRHA 5JH2A 1XINA 2AOSA 1VGAA 4ALDA 1MXGA 3PTMA 1EDQA 2GDQA 9XIMA 1W37A 3ICJA 1GVFA 1TPB1 5D09A 2NQLA 2E7FA 2BS9A 1V3MA 3GKFA 1HJVA 4K6AA 3GG1A 1F07A 3MCMA 1TTPA 5C9RA 1PX3A 4WXZA 1TO3A 4G7EA 3CQIA 4A3HA 1UH3A 4TQTA 1NOUA 3FAXA 4MOZA 3LTPA 4GZIA 2IKHA 4GGHA 1UASA 1ICSA 4C6IA 4QEEA 2B31A 3AYRA 3LEPA 3MPGA 4G7FA 1MW1A 3ARQA 5FF2A 1MZHA 1TPWA 3UWYA 4K37A 5I02A 4EK7A 1Q6DA 4HMEA 1B3OA 2JE8A 3IAPA 4HMNA 4WOZA 4XBKA 4Q7NA 4IGHA 1LTDA 3O63A 4LVDA 3CS2A 1AG1O 1X98A 2F2HA 5HNNA 3KCJA 2HZGA 1RVGA 2A2IA 2ZBTA 3M6DA 3E49A 1NFPA 4LEFA 4MJ4A 1MRQA 1UC4A 4FF5A 3TA9A 5I2UA 4JN7A 4KFNA 5D05A 1X1ZA 4G7EB 1JD7A 3U2EA 3LU2A 3GRIA 3W81A 4BZYA 5FF7A 2CLMA 3N25A 5A2BA 1VPQA 3TVAA 1SJBA 4UUIA 3CV2A 3LHTA 3N9KA 5K4XA 1JCJA 4MJMA 1VEOA 2PA6A 5CCZA 2XIIA 4Y9PA 3L7RA 1BF2A 3MP5A 1GNXA 3BMXA 1VD6A 4YIWA 4W93A 4AB4A 4UCFA 4LC6A 2INEA 1GTHA 3QJAA 2E9LA 1R2RA 2OODA 3P8IA 5FESA 2EPKX 3DFOA 2QCGA 3V4BA 1LL6A 3EB3A 3TH6A 3RF9A 5D2YA 5LNSA 4PTXA 1T5AA 4K2SA 4GC4A 3QM3A 4GE8A 5BOFA 2CLIA 3HN3A 4KW2A 2YW3A 5I3GA 3QHMA 4ES4A 4TIMA 2QCLA 2YB4A 2NXHA 1EO5A 2Y5EA 3D47A 4FLRA 4GYPA 3CH0A 4QRNA 2BVWA 2QDHA 3AOFA 1Z9AA 3VCCA 1T41A 4HU4A 4UMCA 3B05A 3UR5A 5C2XA 1Y0EA 3ABXA 1U5VA 1POKA 4ZB5A 4I8DA 3LMZA 4Y9NA 1I4NA 2A3BA 3W1PA 4S3EA 2YCEA 1W6TA 4PMRA 4DZIA 1Z8AA 4DYJA 3KDNA 1JFXA 4KCVA 4D6IA 5M5DA 3CUZA 3T0AA 4KEVA 1S2UA 3CAWA 1XC6A 4UTJA 3WEMA 4CD6A 3BSGA 1IGWA 1XLJA 1XF0A 3APTA 5JVLA 4QDPA 2GSHA 1LCOA 3MV01 1CWYA 1LBLA 4JOMA 2WQPA 3R0UA 3TTQA 3USBA 2XM2A 4DBSA 4M1RA 1WOBA 2YCJA 2DU2A 4Y6GA 1EXBA 1DKWA 3GFZA 3LERA 3MO7A 5A6JA 2VI0A 3HB9A 1SFJA 3W83A 4QP0A 1G9HA 4NXSA 1W5NA 3WD4A 3QV6A 2XIOA 2HROA 3EX4A 3NL6A 5BXRA 1J2WA 2RDTA 3EX1A 3W1LA 4C6FA 4JFUA 4XD5A 1IQ8A 3A9BA 3WQVA 2F9RA 1N82A 3M0HA 3FV9A 1Q7QA 5M03A 2VT0A 5U4NA 1OX6A 4AD4A 2DT2A 1J0KA 2QGHA 3SB0A 3QGVA 3LCXA 3GH4A 4UFKA 4X60A 1H50A 2EBNA 2HRWA 2B7PA 1NEYA 2OWWA 3GH7A 3HGJA 3SCVA 1I45A 4AZBA 3KRSA 2PI6A 2Q3RA 3VAVA 1XHGA 1HL2A 2QHAA 7TIMA 4B5VA 1I9CB 1JDDA 3JR2A 3LHUA 4CQ9A 4PUEA 4C6NA 1EA0A 1KBBA 2EJ1A 3GG7A 3AHTA 3SADA 3UXIA 1RSCA 3F5JA 2OT1A 1VBUA 3W1MA 3QPYA 3P93A 1BXNA 3SDOA 2XFYA 1QDSA 4Q4MA 3B9NA 1GGOA 1VBJA 4PULA 4FNQA 4C6BA 1B3YA 5E09A 1QNVA 4B5TA 1TQJA 3CMJA 4K8HA 1DJHA 4MUPA 3KVJA 4AY7A 4PYSA 1OF8A 3MV11 5BWFA 4JIPA 3THCA 2UY2A 1UQYA 5HA7A 2TSYA 2XZ9A 5KZ6A 3DXIA 1XRFA 6REQA 1G0CA 4Q4PA 4JHMA 4DI8A 5IBXC 1D8WA 3AS1A 2X1IA 2YFOA 3F4WA 4IH3A 1I75A 3UU0A 3FFSA 1ISXA 3A5FA 3UPWA 4E4UA 7ENLA 3S1UA 1W9PA 3UERA 2OXNA 1NF0A 3TLQA 3W88A 4LCRA 5FJTA 3A22A 3FCPA 3WO8A 1JZ4A 2VCCA 4QSHA 1XBZA 3EA2A 3VNKA 4KCTA 2J6XA 1R86A 4C6CA 4JFTA 2YSWA 4H2CA 4OVXA 3MZ2A 1VFSA 1YDOA 6CGTA 5AHIA 2XN2A 4X2PA 4KBXA 2F2KA 4RDVA 1UKSA 6XIMA 1MW0A 1XCWA 6REQB 3FNDA 1PJ9A 1US0A 3LENA 3EDFA 1BYDA 2Z7GA 4JS3A 3C0QA 4MVAA 1JPIA 4LX4A 3DKLA 5CQ1A 3TWBA 4NKCA 3OLIA 2IXUA 1O60A 3TW6A 1FH8A 5C9UA 1S2TA 2W0UA 1T8QA 4W7VA 1OB0A 1OFEA 1KFJA 3CQJA 1AL7A 2CFFA 5BXTA 4WGHA 3AS0A 4O4VA 3RU6A 3DHUA 5DXYA 5F2LA 2G3IA 5EMKA 1R9ZA 1QAPA 4IISA 2W61A 1NVMA 1ADSA 2BP1A 2E28A 3VIGA 3PZUA 3GVVA 3IJ9A 3QC0A 4L6HA 1KM5A 2IQTA 3FSUA 5FSEC 1DHKA 4CNSA 3WH6A 4BKNA 3K46A 3W1RA 1E3XA 1JD9A 2FZ8A 4MADA 4XO7A 1KFKA 1ZBCA 1BYAA 5HOSA 3R8HA 1LL4A 5JBFA 3DG3A 2ZUTA 1R9XA 2PWDA 1ISVA 2WCSA 1TV8A 3BUVA 3MS8A 1F3XA 3ARSA 4Q7IA 1ZAJA 3WMBA 4LYKA 3B4YA 3PVFA 3WK3A 3MUY1 3AMCA 5I3KA 1YTKA 2Z2BA 3CMGA 3ZT5A 1M7OA 3IJDA 5FJRA 1PB0A 4CVUA 1IR1A 4NP7A 3KL3A 4UMBA 4DO7A 1DJYA 4FF7A 3VTRA 1GYLA 2OX4A 3FYPA 1SZFA 3VOCA 5TAOA 1E5JA 3TYEA 2X42A 2EKCA 5I79A 2ATSA 1ZCCA 1H63A 4B5XA 1L6YA 3ORWA 5FJUA 4HHLA 2GGEA 4U5KA 4J2PA 1XLHA 2F8QA 2REQA 3MKKA 1EIBA 1Z41A 3UA4A 1XPYA 1EC7A 4GABA 2XH7A 1XUUA 1RCOB 6A3HA 3STFA 5SWUA 1XDJA 2OVLA 1JGMA 1K9TA 3KDOA 3GG8A 2DVTA 1GKPA 3BCFA 1UZHA 5CGQA 1QMLA 4KFPA 2E3ZA 1L2QA 3ITGA 3O0KA 1HL9A 1B3ZA 3O6YX 1BVNP 1PHQA 3TC3A 2B81A 4JN6A 1KBIA 1E71M 1WKEA 1V6XA 2GVEA 3IVTA 3A4AA 5DMNA 3T81A 2BVYA 4QEHA 2BY0A 3MWCA 2AGKA 4HD5A 4K7YA 3V35A 3TYCA 3KCLA 2X2GA 4NYYA 4XBJA 1QW9A 1WOAA 1IEIA 3NSXA 4PMZA 2PCQA 4HK6A 1L8PA 4ZXOA 1JL8A 4AZCA 3DIPA 2REQB 4B9ZA 4OOUA 3PNZA 1UOZA 2OGYA 4MNMA 4H6KA 2ZXBA 1BXBA 4ZTXA 4U28A 1KRAC 4I7VA 3O6DA 2Q01A 1XP3A 1S2AA 1VAHA 3LZ3A 3STCA 1XWYA 4E3VA 2VD9A 3QLDA 2PLJA 3RHGA 1XICA 4PB5A 2OFJA 1TCMA 1MUCA 3SO7A 4LH8A 4HK5A 2BTMA 3GZ3A 2OB3A 5CXPA 2WSPA 3GUWA 4YTRA 4A2RA 4NAFA 1WDDA 3REQA 1B3VA 4LBSA 4TR9A 1OZMA 4JQ1A 5DFAA 3VNJA 5C2GA 3AXMA 3WBXA 4PUMA 1I60A 2WKGA 1VFFA 1KM6A 3UA3A 1UYQA 4IJBA 1VYSX 1PO9A 3P5YA 1ITCA 4AZCB 3OODA 4D8LA 2GGJA 1P43A 4JIHA 3WUGA 4TVDA 3S6DA 5EMLA 1IT0A 3KX6A 4GCAA 4XSMA 4B2DD 4AD3A 5BXSA 3WSUA 1P1MA 4HYRA 4RK8A 1Q4WA 1FKXA 3VNLA 4CNPA 1EXPA 1IT7A 3S2NA 5KINA 1BSIA 4A8RA 1XBXA 3PPGA 4O15A 2ZVIA 1S2VA 1MUMA 4NAFB 3DHPA 4POCA 4NJJA 1FA2A 4S3GA 4UQAA 3LBOA 4C7FA 2J13A 4H9YA 2P1FA 4OWGA 2WOQA 1OVDA 1VF8A 1OFPA 3BQ5A 4EPEC 4MNLA 1CXIA 5A69A 3EMCA 3PR2A 1ZBWA 4XAGA 1GTEA 1DJGA 3TQPA 3RM8A 3R6IA 4JEJA 4G2DA 2PE4A 1FFQA 4I3GA 3THDA 3G24A 4LNYA 3PUDA 5LIXX 1TE1A 2D3LA 2DUZA 1KBLA 1L0PA 1XYMA 5BWAA 1Z69A 1S46A 1EPXA 2WZIA 5AHLA 1DE5A 2PGWA 3DG7A 4LW7A 4LYQA 4I6KA 3DCPA 3P84A 2ZXQA 3ECQA 3CQHA 4MY9A 2D23A 1CI1A 2G3JA 4WHBA 4RE0A 3VKCA 4RLIA 4QFUA 3CZEA 1LROA 1PZ2A 1TJRA 1GG0A 3ARPA 2NV9A 3TEVA 4HSNA 2PDQA 2P0OA 1ISZA 5CPNA 1JVNA 3B8TA 4A22A 3N73A 4W4QA 4P8UA 1FKWA 1F61A 3V36A 4WQ6A 3WQOA 3VNYA 2H8XA 1KFEA 2UY5A 4NYUA 3VIHA 4N9BA 4D8AA 4WKAA 1JZ8A 4O1AA 4IFOA 3ZIZA 1JPHA 4EKJA 1HP5A 5PTDA 1HNYA 2RJHA 3PUOA 2O4MA 1M04A 3FKRA 1W8SA 1FWDC 1XQKA 2XU2A 4GUIA 2OX1A 4C6JA 3OA3A 3FVMA 3GLCA 3UXLA 1H7NA 2Y0FA 1I2NA 3PTKA 1L6GA 1J0HA 3OLGA 3R89A 1GJWA 4PMVA 3UETA 1PZ3A 2IPWA 3QKEA 3AIWA 4MZYA 2Z7KA 3PB2A 2DUAA 2FDMA 4DM2A 5A2CA 1V3LA 1UP2A 3QLLA 1VJZA 3T05A 3C5QA 4PTMA 1YX1A 5F4WA 4UR9A 1KFWA 3WLMA 5L6UA 4QS6A 1BWVA 3E2SA 4LY4A 3N9RA 1W31A 2VDGA 2F84A 2G96A 3BARA 3MUCA 1YE4A 3WFZA 3H7UA 3RNDA 1KKOA 5G2IA 1VHNA 2DDXA 3V1HA 1Q6LA 3ZM8A 1NIUA 3ZXWA 1L9WA 5CZ0A 1KD0A 2DFAA 4A8NA 2EKGA 2A3AA 3C8FA 3M41A 4UQCA 5HPCA 4H1ZA 4FX8A 1XLAA 3HPZA 5H8MA 4XBSA 2B0MA 3GR4A 4J3UA 2G4FA 4LCSA 4QNWA 1OZQA 4DI9A 3G1FA 2PTYA 1W3TA 2ABAA 1UH4A 4JNMA 3T6CA 2PDFA 3C6CA 1TB3A 1C8YA 4DY1A 4MWAE 2PDBA 4URIA 3RO6A 4MB3A 1ZUAX 2HMCA 2ZQ0A 3PC0A 2TPSA 4LUSA 3MSRA 3VM5A 1MW2A 1P0KA 4MYAA 1A3WA 3ABRA 3PZNA 3EDDA 5J5RA 2BNJA 3EOSA 4W7WA 1Q6QA 1ENUA 2GVJA 4IPIA 3NQEA 3IIZA 3TYAA 3T08A 3AMGA 1HKJA 2WVSA 3UP8A 3PZVA 2NT0A 2H90A 5CJ5A 2ZZ4A 2QYGA 4PUUA 3E0LA 4NXKA 4JIRA 4ZSTA 3EKGA 4B2DA 1UUMA 2YA1A 3T40A 3M16A 4NX0A 1X8FA 1NY1A 4AW7A 1KQYA 1I1XA 1EP1A 1V3KA 4LRSA 4F2TA 4HYWA 5GPRA 3VX0A 4C6KA 2E6AA 4LUSB 5T9CE 5DO8A 5AYIA 1JCXA 4BR1A 3CQKA 1E0XA 4IPPA 3AYTA 3IK2A 5LHFA 4JD4A 3F5LA 4F2BA 2BY2A 5AHFA 4RE3A 1KCKA 5D4YA 1O5RA 3KVMA 2JGQA 4XO6A 2ZRZA 3TR9A 3SCUA 3KFTA 5F4XA 4M56A 2FPTA 2ASHA 2CIPA 1K6AA 3ES8A 1C9DA 3EWXA 1KWGA 2EG7A 2BB0A 2GGHA 4CNUA 2XJ7A 2PDXA 5FJPA 1JDCA 3E9AA 1H7WA 3ZJ6A 1Q6FA 3LRLA 5A95A 2OCZA 1B90A 4PMOA 4UQEA 2FZ9A 4ADTA 2CZVA 3LM3A 2TAAA 5M1TA 3RM4A 1T99A 3O1NA 4P7NA 5EMJA 4KT2A 4PZVA 4UTKA 3L21A 3A4WA 1IIHA 4L9ZA 3UJ2A 3F1QA 2ZYFA 4LF2A 1RPKA 3MDWA 3P62A 4H7VA 1Z32X 1M53A 3BZGA 3CHVA 4UR7A 1B30A 3OLDA 1FCVA 1YW1A 2FHBA 3WJWA 3PZOA 3RLGA 1HKMA 1B2YA 1H7OA 1XFCA 1SQ7A 2VO5A 1UPPA 3EX2A 4A3RA 3LQLA 5EY5A 1FWRA 3WUEA 4Z2LA 3W7EA 1UG6A 3OHMB 4LUTA 5D33A 3ZT6A 4XD3A 1JPMA 1UBSA 5CPSA 3NOEA 5AVNA 2XIJA 1RR2A 4L1GA 4NY2A 1A5BA 4Q8WA 5BXPA 2Z27A 2PGEA 2A3CA 3GXFA 1W56A 3GNNA 4Q8UA 4JTJA 4HZ7A 5ECUA 3W1TA 2L5HA 5XIAA 3JW7A 4OKDA 5DN1A 2Q3OA 1NM9A 5EKYA 1KGUA 1CGTA 2QXWA 3ARZA 1LWIA 2FH8A 5JUVA 1VENA 1K7FA 2E6DA 3O0FA 1XIMA 1HG3A 2QIIA 3BC9A 3VIOA 4NJIA 2H8ZA 2Q8XA 3TOPA 2GYIA 3VGHA 3VKAA 4RL3A 3ZR5A 3GK0A 2QCNA 1W0MA 3AS2A 3K4WA 2VDIA 1VH7A 1XLCA 3BQ6A 4XAPA 3NZGA 4TU1A 1HJXA 1VFMA 4LUTB 5CC7A 3W00A 3BV4A 4H01A 4X9SA 2WBGA 2FFIA 1EEXA 3BLFA 1ZALA 5EL1A 1Q3NA 2CZ5A 3BG9A 1MXDA 1UD2A 2E9MA 2PDPA 1V3HA 3H21A 4LCQA 4TX8A 4C1NA 3C61A 4Y96A 1H41A 2GZXA 3H70A 1E72M 3QN3A 4UCGA 1OIMA 1MQPA 3CHFA 3CTLA 4PL1A 3SRDA 3S5YA 1F74A 2PMQA 1Q63A 5E6YA 3FJNA 1KRBC 1NFBA 1XQLA 4XWUA 4ORIA 4DHGA 3ITLA 2XH0A 1GZJA 2ZIDA 3TTSA 3QOMA 1DHPA 1M65A 1EGMA 1UD5A 2YYTA 3P14A 4Q22A 3AZSA 1FHUA 2A3LA 1LQ0A 4X3ZA 1LM1A 4Q7BA 3ITCA 4B16A 5I09A 1I2PA 3TK7A 1S5VA 2FVMA 1FVPA 1Z3NA 4GVHA 4ZCWA 3NZQA 1TKKA 2VENA 3TJLA 1IIGA 4C1NB 2DV0A 3E02A 4AC7C 3TXZA 4DNHA 1KFLA 4ICMA 1EJXC 3L68A 2XWDA 3S83A 2Z1WA 3H4GA 1SSGA 3AXXA 4L9XA 3WY1A 1CENA 2PZNA 2YCIX 2J7DA 3W02A 5CSSA 5JU6A 2PDJA 2WKJA 4KMQA 3UWWA 1R38A 2PD9A 2HCVA 1W2PA 3CK5A 4UQBA 1I0BA 3W26A 4UTHA 1GORA 1X1NA 2POTA 1MEIA 2XHYA 3CH9A 4XD6A 1JRCA 4OBRA 1V7AA 1HO1A 2E5BA 1KQZA 2WK2A 4F0RA 3N18A 1GKQA 3ANVA 3LUTA 4IIFA 3NA8A 1X39A 4JNZA 2ZA2A 1BGAA 3WNOA 4HPNA 4GX8A 2AAMA 1EOMA 2VEKA 4LYPA 4O18A 2FVKA 4NG3A 4IL0A 2C14A 5AYXA 4ZB2A 4ADSA 2CETA 1GJUA 3EWZA 4GUHA 3O07A 4D6FA 4JL2A 3KBVA 2G50A 1OX5A 1H2JA 1ODUA 3EDEA 3WKZA 2GJRA 2GK1B 2CWXA 5FEWA 1XH2A 1FP9A 2ZX8A 2DJXA 1P0NA 4ENLA 1KBJA 2OG9A 1TIMA 1PKNA 4WEVX 1YPXA 3PG8A 1MQRA 3W7JA 5BCAA 1GOWA 3R1ZA 4M24A 4JTDA 4REQB 5EU9A 4AD0A 4OJYA 3E0IA 3BO9A 4J28A 2BOFX 2LLEA 1TTQA 2CITA 3W23A 2J66A 1A47A 2PP3A 5HMSA 4B3ZA 3T0DA 2ZRUA 4IMAA 2XVLA 2HVOA 3VD9A 2PFHA 4LTSA 5EFFA 3OQ8A 3CO4A 2BODX 1TREA 2CWNA 1JUEA 3GR7A 1WAUA 3N2TA 2VFHA 3G1YA 1XIDA 3WLKX 1IYXA 4O8AA 4YYCA 2WWDA 3M0MA 2PB1A 2B7NA 3AICA 3KLLA 4AX6A 5I3JA 4TXEA 2XISA 4ROPA 1OCNA