4ES4A

Crystal structure of ydiv and flhd complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
206
Chain Sequence
SDCYFLPIRDNQQVLVGVELITHQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight of a concentration-dependent mechanism by which YdiV inhibits Escherichia coli flagellum biogenesis and motility
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Putative cyclic di-GMP regulator CdgR
total genus 67
structure length 206
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4es4A00
4ES4A 4LYKA 4HU4A 4J40A 4F3HA 3S83A 4Q6JA 3PJXA 4F48A 2W27A 3GG0A 4RNHA 3HV9A 3PJWA 4LJ3A 3N3TA 3HV8A 4RNIA 4Y9NA 4KIEA 5M1TA 4FOJA 4FOKA 5MKGA 4RNJA 3KZPA 3GFXA 3GG1A 3U2EA 4RNFA 4AFYA 4HJFA 3GFYA 3PJTA 4Y9MA 3GFZA 4Y9PA 4HU3A 4Y9OA 2BASA 3TLQA 3SY8A 5MKGB 4AG0A 4FOUA 3PJUA 5MF5A 3PFMA 4Y8EA 2R6OA
chains in the Genus database with same CATH superfamily
1XCWA 3E9AA 3HG2A 4H3DA 2YGYA 4OVXA 3H55A 2D23A 2J77A 4PL1A 5IM51 1H7WA 1Q8JA 2E8ZA 4NX5A 4GGHA 1IE7C 4PB4A 1PB0A 4HA3A 3IRDA 1MUMA 2P1FA 4DXKA 2BDQA 1JUKA 3MC5A 3KP0A 1RQBA 1DJYA 3U0HA 2NZLA 3RRAA 1H1YA 3NYZA 5D8ZA 1D9EA 1Q6QA 4YN5A 3ZS4A 2OMAA 1S2AA 3OEXA 3PSWA 2F7FA 2VURA 4H9MA 3C2VA 4RNHA 2ON3A 1XV8A 4DAIA 1UH3A 9XIAA 3BMXA 3ICJA 1EC8A 1ODZA 1PKYA 1KRAC 4ICMA 1UPMB 3S4TA 3ZYZA 1PX8A 4K7VA 1AA1B 3B9OA 3PTMA 3AIBA 1OJXA 1X97A 3FGCB 4UTWA 2C7FA 2LLEA 1ICPA 3VILA 5DMMA 3W7CA 4FAMA 2BVWA 3V3WA 3QFEA 2XJ7A 1LL4A 1TE6A 2R1KA 3B4UA 3PS7A 4J1OA 1HVXA 3LHUA 2FVMA 2DSVA 4DWDA 1G0CA 1J0IA 3NQFA 1C8QA 3NXFA 5ENLA 1JAEA 1UR9A 5KZEA 4M3PA 3NR0A 3TFXA 1PTGA 4GUJA 4H6RA 1CX9A 2C8NA 3U3HA 1S5NA 4DM2A 3W1QA 2ISFA 4DPQA 4PBFA 5F2IA 4N9EA 5C9WA 4UNKA 2IKHA 1LOQA 2VO5A 3B8DA 2FZNA 1EJXC 3EBVA 5LYRA 3GHRA 3CV7A 5CSUA 1TCDA 2ZXAA 1GZJA 3L4ZA 4HU4A 2WCAA 2PDBA 2G4JA 1VBGA 3ATZA 3UFYA 4RUBA 1FVPA 2VDIA 1BF2A 1WKFA 2YIHA 3WQOA 4J5NA 2B7PA 2ISSA 3N9SA 4HBKA 2V81A 3TAOA 1H5VA 1ME8A 2IQTA 2ODOA 3WL1A 2DW6A 4I5XA 2FZBA 1IT0A 1GOWA 3PJXA 2FKPA 2HCVA 1WOBA 1VBHA 1XBXA 1CDGA 4L4OA 2BXVA 3B0UX 2ZIDA 2RFGA 2QW5A 1TPC1 4RW3A 3BV7A 4KH2A 4KRZA 4ZXLA 4Z1BA 1Z48A 2FMNA 4JXCA 4BKNA 1BVNP 3T2OA 1HO1A 2CERA 1SJDA 2FHCA 1XCFA 3FNDA 3HPSA 3LK6A 2PLKA 2PWUA 2BX7A 3VO0A 2XDFA 2XN0A 4WRHA 3WY1A 3TW7A 1JQVA 2QCDA 4OKDA 5FF7A 3NO3A 4F0SA 2G3NA 5LIUX 1M5WA 4LFYA 4LBRA 2DJXA 4JQ2A 1R3VA 3UR2A 1B3VA 1ZZMA 4C91A 1ONWA 1F76A 3P62A 4YTUA 4LAKA 5A2BA 3W2JA 3MJMA 4HPXA 2EEXA 5IXEA 1R2RA 3M5ZA 1B4KA 2PDXA 1TTQA 3FW6A 1WDSA 4FX8A 3PN8A 3RNDA 2HVNA 4FNUA 3FS2A 4Z17A 3TTYA 2A3AA 3BCJA 3VD3A 2BASA 3EB4A 1XI3A 3VD5A 3FJ6A 4JDYA 3QHMA 3TA9A 4EAYA 1E4LA 3N19B 1TWIA 2QPSA 5DX7A 2I17A 1ZPTA 4ZVJA 4KGLA 2JF6A 1DXEA 2REQB 4GYPA 2ALDA 4OFCA 1X8CA 2ZX7A 5IFTA 3CZLA 1J96A 4OECA 1TE1A 2PP1A 4BI7A 4Q4MA 3L4VA 4W9TA 1J9YA 4QEEA 3P74A 2P5NA 3O05A 2QF8A 4HK6A 1HJWA 1R5YA 4C6NA 3ITGA 3IJDA 3AI0A 4HCDA 4P8WA 3UJEA 3GR4A 1G4TA 2FYMA 1K7XA 1W56A 3FYPA 1JEZA 1PAMA 1BXNA 4FXFA 4V15A 1X8FA 1KCLA 1CXLA 2ZZ1A 1JGMA 3RX3A 1E56A 2IPJA 2ZVRA 3LA4A 2HNHA 1B90A 1KXVA 3MT1A 5CC7A 4F66A 1RK5A 1XFCA 3EDJA 3AMCA 3TLLA 1IGWA 3EWZA 1F6PA 4HPHA 1BRLB 4LY4A 1T8XA 2GQ8A 4B15A 4DJFA 1GOKA 2X7WA 1JCNA 3B9NA 3WFAA 2WVUA 1HXJA 4KQNA 1AH0A 2I5GA 2PTZA 1YXDA 4G7FA 5D05A 2WHJA 2AQOA 4NUWA 4GISA 4UFMA 3TYEA 1JNDA 4MWAD 3NUKA 1V0KA 3I3EA 1KQYA 4LPCA 1H7RA 3MVIA 3Q37A 4MAZA 2Q71A 7XIMA 1VYSX 2BG5A 1DVJA 4A3RA 2WMKA 4GH1A 1SFLA 3R89A 4F0LA 8XIAA 3LENA 1SW0A 5CLWA 4HIBA 1AQHA 4E3TA 4XUGA 4IXHA 4KWWA 1QK0A 1S38A 1TMQA 2H9AB 3S2NA 3SW6A 1PL9A 4PMQA 3TR9A 3TUUA 3VMOA 3L68A 1UR4A 2DDXA 3QSTA 3U7BA 5TQLA 4KW2A 4DO7A 1NOWA 4QXIA 4O28A 4PCPA 4JCLA 2G3MA 3JW7A 3MUAA 1V77A 1NJJA 2DZVA 4QG6A 4WY0F 2ISDA 1HP5A 3W38A 2PLMA 2O4QA 3OLDA 2WHLA 1YTDA 1LUCB 5CSSA 4PULA 3CLWA 5G2WA 3TQKA 4NJGA 4CQ9A 3QGVA 3GXMA 3SM0A 1XR2A 3KVKA 3U6WA 4DZAA 1XPYA 2Y7GA 1MI3A 4ZBCA 4GQRA 1IEQA 4ML9A 3LLFA 3G1RA 4J3VA 4RE3A 1TWSA 2YZ5A 1U5VA 3SQLA 4ZEPA 1A5CA 1DWJM 3CL6A 4F2TA 3LQGA 5D38A 2RDWA 3OYZA 4EPBC 4YCOA 4QHRA 4Q3MA 3WK3A 4B4HA 3MKKA 5LZLA 3MMWA 3N2OA 2WSRA 4QG9A 3MI2A 3TW6A 2WXDM 4UTHA 4HSHA 5CGQA 4JN7A 3SUUA 3MANA 3VA8A 3FJ4A 1F07A 4QTGA 4C6JA 4M6VA 1S5VA 3MP5A 2ZTJA 1SO3A 4YTQA 1PKLA 4BFAA 5KZ6A 2J13A 3F5KA 3EOEA 4Q6JA 3O63A 1RXOB 2XSBA 5G2IA 4KCVA 1YXCA 3V35A 1B54A 4UR7A 4G7EA 4XKYB 4KS0A 4IUOA 2FVKA 3HOJA 5GNXA 3ARZA 2FVLA 4BY3A 3MCMA 1FXPA 3MBFA 3TQ0A 2BGNE 4LBUA 3WMSA 2INZA 1F3XA 4EOUA 2WOQA 5H8PA 3QGKC 4EX4A 3IIOA 2GJPA 1M1BA 1Q7QA 1EJ7L 4JFUA 1WNOA 5TIMA 4Y8FA 4N9CA 3CUHA 3L4XA 5E9AA 2RDTA 2X2YA 2YX0A 3B8WA 3G5EA 1UC5A 1XQKA 1TCMA 1QR7A 1HG3A 4XIMA 3P61A 2XISA 1BVWA 4ZO9A 2TPSA 1CZ1A 3V5CA 3F2CA 2E6DA 2BGSA 2Y89A 1UD5A 4D6HA 4JPGA 3WLKX 2XFFA 2PZ0A 4PYSA 5H2ZA 5LKYA 3AS2A 3HG4A 3TIMA 3MWCA 1NELA 3GG7A 2V38A 4GH3A 3ITXA 1BSLA 2A85A 1GYNA 4NJIA 1EEPA 1XRVA 1MFUA 1Q66A 2D2JA 3LCFA 3N11A 4NILA 1QWKA 1XD0A 4MB4A 2GJXA 1ONEA 2WM1A 3VD4A 1UKPA 3FDGA 3LLXA 2AQWA 2PE4A 5AC5A 3UJRA 4FA3A 3GFXA 4NIRA 4ZQNA 3F2BA 5T91A 3B05A 3DHFA 3NZPA 4E2DA 4Y96A 4W86A 3EKGA 2W62A 1UUOA 3URBA 1A5OC 1P48A 1C91A 2X0YA 3BGGA 3S8HA 4FLOA 5AVNA 4RZ4A 4DXVA 3QM3A 3VGFA 3HPXA 3KWSA 4NZFA 4KKXA 4YNGA 1PZ2A 3VX1A 2QUVA 1LG2A 3SJNA 3CZKA 4HTYA 4Y90A 3H2MA 3ZLFA 1IHIA 4GCAA 2V5KA 1EIXA 2OWWA 5HULA 3NNTA 3I6EA 3CNYA 2AL2B 1O68A 5H1WA 1CENA 2PZNA 1CXEA 2AAMA 3XISA 3WDPP 4JN6A 3URAA 2WHMA 2DW7A 3HA1A 1A0DA 3L4WA 3NQ8A 5TNVA 3RYSA 3KW3A 4U3AA 1P0DA 4YMZA 4LU0A 4OJYA 1B9ZA 2DSKA 2NV9A 1DIDA 2BODX 4QE5A 3BWWA 3FIGA 4H7VA 1X7IA 3PY2A 4XAYA 5TBOA 4HVXA 1UR3M 4QX4A 2G8ZA 2C71A 2YZRA 3O6YX 5HWJA 2A21A 4D9PA 3O15A 3ME3A 1HVQA 4MZ8A 2EPOA 3WBYA 1TX2A 1KGXA 3KOZA 2PDJA 4U5KA 1R3RA 4XAGA 3GTHA 1JAKA 1Q7ZA 3M0YA 3WDQA 2CZDA 3VIKA 1QI4A 4JTIA 5CG0A 3K8MA 4JQ1A 4XK2A 1S46A 4A4AA 3NL2A 3L4UA 2FDSA 4WSJA 4CEUC 4IICA 4XZLX 1POKA 1G7UA 3W24A 3C2FA 4MUZA 3HGRA 2NUWA 2QDHA 3W83A 1E3XA 4CN1A 3GDMA 4LXFA 4WSKA 3RMJA 3OHIA 4OV4A 5CJNA 3N13A 4EPEC 3F1QA 2NVCA 1PHWA 3KL5A 1PZ1A 2G50A 4FLQA 1NF0A 1V5XA 4X63A 1KV8A 4S3GA 4KEZA 3WUFA 1EJVC 2C0AA 3P8IA 2GVYA 1NVMA 2GUUA 5FEXA 1LP6A 4Q8OA 1ADOA 1G9HA 2CBIA 1BAGA 3T07A 4ILSA 3KOWA 2QCCA 3A13A 4E2VA 3WF0A 1NH6A 1E0VA 5XIAA 4B5XA 1XG4A 2PDFA 4H83A 2QYGA 5FCZA 3VUPA 3KAOA 5JUVA 1S39A 3UG4A 1W3HA 1FCVA 1PCKA 1FHDA 4UTTA 1Q6OA 1EL3A 3HTWA 2EPNA 3W76A 3WQ8A 1O5RA 2PD9A 2NT0A 2AOSA 2Y0FA 2XVLA 3QPEA 4ZCWA 1IV8A 1AMYA 1XSJA 3UYCA 4LUJA 4M6PA 1W3IA 1XLMA 3ARVA 5I3FA 3OODA 1LJYA 2Q3OA 1UD2A 4IXXA 2XGBA 4DF1A 2PCEA 3NGJA 1BYBA 3FN9A 2YKKA 4PRWA 3KBVA 4W88A 3W1TA 2OGJA 1F4HA 4K36A 1NQ6A 4CCEA 4DELA 3GLCA 3R0DA 3THAA 2BHYA 5CCZA 3SB0A 2HBXA 4IGHA 1A5KC 4C6KA 1UH4A 1XIJA 3LXAA 3S1UA 2VR2A 1Y65A 3RILA 2A2IA 3C8NA 4MPKA 4Z2JA 4CD8A 1OG0A 4UZSA 1XYMA 4NZ4A 2EPKX 2Z26A 3S2JA 2FZ9A 3TYCA 2J9XA 4N6FA 3PJWA 1KFEA 1ECEA 3BAKA 4GZJA 4PMOA 3P5ZA 3AIEA 3C2OA 4ADSA 3GU1A 1JCXA 4I3GA 5A5WA 3BO9A 2CLKA 3BLLA 3TWAA 1PYMA 1ICQA 3ZXWA 1E6XM 3HQOA 3MYOA 3DCPA 1L2QA 2I5IA 1U1UA 4IMEA 4LNYA 3KZPA 4I90A 1GOIA 3D3FA 4EKJA 2UZ9A 4TX9A 5CPLA 1HKIA 5M3WA 3NL6A 3FJLA 3TN5A 4PB5A 3UCCA 4CLMA 1UR2A 2J4GA 2YL5A 2QCDB 2D22A 3QV9A 3SCOA 2B7QA 2XZ7A 2V2CA 3KOYA 1M7OA 2GVEA 1J79A 4L9YA 4LWWA 4LV4A 4E2OA 5CGTA 2VR4A 5AKQA 3UA4A 1KCZA 3F4VA 1RALA 4PZVA 5KTLA 2Z1WA 3BSGA 1AZ1A 4CD7A 3PAJA 2C79A 3SCWA 5CSYA 3VGDA 4PCNA 1OVDA 2VCBA 2OO6A 1GORA 2O9OA 3WCZA 3CUXA 3U2EA 4XVEA 4ACYA 3NZRA 2GUBA 1TFVA 2EPHA 3E49A 2HMCA 2G3JA 5MF5A 4XD6A 1RPXA 3G1YA 4P2VA 2PWHA 2HS6A 2R1PA 1C7SA 3VNLA 4DF2A 3THDA 4GC4A 3PNUA 4YXGA 4FLRA 5BRPA 1NU5A 1OCNA 5AYIA 1VBUA 1ZY9A 3AHZA 3STCA 1XW8A 3EX4A 1VFTA 3F7JA 2FHBA 2VFGA 5A6TC 3BMVA 3VGGA 2WZIA 1G4EA 4A3QA 1ZGDA 3VIGA 3N25A 4DJEC 4L1XA 3CUIA 4JFSA 2G0WA 3W73A 3WL0A 4HNCA 4BQ5A 1A3HA 1GG1A 4H9TA 3H7UA 4KFNA 2XINA 1F8MA 1H62A 1ZJAA 1TSIA 1XLEA 4NY2A 3E02A 5FF3A 4JS3A 3TN4A 1F2JA 1E0WA 4IQDA 2HNEA 2VKZG 1LRNA 1QPQA 1E6ZA 3B04A 3L2MA 1U33A 3IAPA 4HCHA 1RK6A 1BSIA 2GSEA 2OEMA 4UUIA 1XBZA 4AF0B 1R86A 2GK1B 3GKFA 2IXVA 1FA2A 3N2TA 4AMCA 5BXTA 3UWVA 2BV9A 2DV0A 2PC4A 2Z24A 4KEMA 4ZB0A 4JTEA 3S9IA 1VFUA 2UY2A 2HVOA 1HJQA 4F48A 4Q8VA 3AO0A 5D4YA 2GPTA 4F40A 3OZYA 1FP9A 3R0KA 4EXBA 4W7UA 1ZCOA 4WY0A 1BG9A 1ZQ5A 3PZQA 3ALGA 1KQZA 5G1TA 1Q6GA 4GVIA 2OOGA 1UD6A 1EF2A 3E96A 5FF2A 6TAAA 1WX0A 1QHZA 3IAQA 1CLXA 1M7JA 5FAJA 3WK1A 1GPFA 2WMJA 4Y9PA 1HFBA 4XTIA 1L6YA 4HK7A 2J88A 1K9DA 1S2VA 4F8XA 3BARA 5I0DA 1ZUAX 4WY0B 4MWAA 3DHDA 4HT3A 1W1YA 4DJEA 1UOKA 4JKLA 5D2WA 1B30A 2GVJA 3AUOA 4ENLA 4PEKA 4WJEA 1ZALA 4KCTA 4NX0A 2AL2A 1KFWA 5EPDA 4WZHA 1ONRA 1RLCL 3TOPA 4UFJA 2VCCA 4XTDA 1NM9A 2QMKA 2OJPA 2QPUA 4IX0A 4WEVX 3NZGA 1R3TA 3GDLA 4D1IA 4RJEA 3BJSA 3TYUA 1MEIA 1S2CA 4DBDA 2OODA 3R7MA 3NQCA 3KCLA 1K7FA 3VABA 3IUHA 1JRBA 2C91A 2PRLA 5ABHA 5GPRA 1F74A 3TJXA 4ZOCA 3UA3A 4QIUA 5BWAA 2HBVA 4DBSA 1KWGA 4A8IA 3ARYA 3G1HA 3VZXA 1A5UA 2ZQ0A 3KTCA 3N4EA 4ZQOA 4UCGA 2YCIX 3DBPA 7A3HA 5EFFA 4HMCA 1QW7A 3N2CA 1A0CA 2QCHA 4H04A 4OV9A 1JPMA 1FFQA 4K1GA 4PR4A 4Q8MA 4EANA 4JIPA 5H8UA 1WO2A 3W29A 4XD5A 2GZXA 3CBWA 2VWTA 3V1HA 1LCOA 3SRFA 1FFRA 8XIMA 4YTRA 1W8SA 3ITCA 4GZIA 2A7NA 3CO4A 1QO2A 3U48A 2GSJA 2VZOA 2RGMA 4D6DA 3WF3A 3SGZA 3VD7A 4CD5A 3GUGA 3LUTA 1JVNA 1VBRA 4AAJA 3RK8A 4PRTA 4PE8A 1MEWA 3W1MA 4MY9A 2VFFA 4AZ6A 3EDEA 3O1NA 3MA8A 2FMOA 2GJLA 4R27A 2R6OA 4PTMA 2Z1VA 1L6GA 3C8FA 4JICA 1TPVA 1XLGA 3APTA 1B0IA 2XIQA 3WF4A 4AB4A 1EOMA 1CGUA 1ALDA 3SCQA 3PUEA 3PUOA 3ZSTA 1SZEA 3WUBA 1XCXA 5LHFA 2PGFA 4RCXA 3NXLA 1UQZA 3G3MA 3AJXA 4EWJA 2WC4A 4OIFA 4GLEA 1AL7A 4H41A 2QCFA 2QCGA 3MCOA 4E8DA 4XWUA 2YBVA 2CLEA 4R53A 4UR9A 2W66A 3UG8A 2DUZA 4ERIA 1XBYA 3M0VA 3ZWSA 4QNEA 3DI1A 4G7EB 2QLYA 5DBTA 4JTHA 2KX9A 5BRQA 3TJ4A 3PZTA 1EP3A 2IW0A 2VEGA 3NL5A 2BZNA 3LRKA 4C1LA 4D2JA 1VB9A 1QFEA 1DIOA 2VL4A 3M16A 2ZE0A 3VCNA 2G4FA 3VE9A 2E1WA 2ZC1A 5BOEA 4Q7IA 4J40A 3VIOA 2XGIA 4RW5A 2VFIA 5XIMA 2WCGA 2A5HA 4MB3A 2Z28A 1X1ZA 3BJTA 4IMAA 1TREA 4IL0A 4YL2A 3B8VA 3VDBA 3QOKA 5I78A 2D2OA 4N4PA 4C90A 4XX6A 1LWHA 1QASA 1HKMA 4IP5A 3LZ5A 4LCSA 1THFD 1REQA 1PDYA 5J8LA 4HJFA 4JKMA 4MKVA 4EWND 3CUGA 3B8UA 3DFOA 1EDGA 3EPOA 4G5DA 2PA6A 3PTKA 3CQJA 4LAUA 4XBJA 3H54A 5FIPA 1FWWA 2V8ZA 4DF0A 4S2CA 1QJWA 3BE7A 3E0LA 3N4AA 4JEJA 2P0IA 3F5JA 3QFWA 3KFTA 3FGCA 4JKKA 2YR1A 2RJGA 2QJMA 2OR2A 3CUJA 3RM8A 5A6BA 3RLGA 4PSPA 3M7WA 1JUEA 1GQIA 2OZTA 3WLSA 4IPNB 1K3UA 1A53A 1QBBA 3A5FA 3BUVA 4JTCA 1JZ2A 3B9AA 4WR3A 3WLHA 3GM8A 2G5WA 2OSXA 4AVNA 3DZ1A 3VIHA 4N02A 3IJ6A 4E0CA 3B40A 3NQDA 2OLAA 2EG7A 3NDYA 3I68A 3GE7A 1TPFA 4L56A 2VX4A 1QT1A 4O0KA 2FTYA 1ZFJA 4H2CA 5BMWA 3TU9A 4O12A 3GNDA 2QR6A 2DIJA 3IGXA 3L5LA 3BXWA 1NDVA 3KP1A 1O60A 4PMVA 1NQKA 1NP0A 3OGVA 3U57A 3HMJG 2O4MA 3G18A 3GG8A 4FIQA 3BICA 2FJKA 3UF9A 2HQAA 2ZDSA 3P60A 1DWIM 2Y70A 1AW5A 5EMMA 5BXSA 3E2VA 3NCOA 5LA1A 4N9DA 1W1TA 4CN4A 4AWUA 4LUIA 3COTA 3PR2A 2WLZA 3OZMA 9XIMA 4TO8A 2D24A 3EKLA 4JY8A 1V6WA 2E28A 1E51A 3PSVA 2ZRUA 5K9CA 3UPWA 2BOFX 1VH7A 1XDLA 3QKZA 3W1RA 1UH2A 2E9BA 5C7VA 4DJDA 4CKQA 1W3NA 4O18A 1CLKA 4BWLA 2OFJA 3O7UA 1PXGA 5GJNA 1P6WA 1SM9A 3ZZ1A 3FSUA 2NSXA 7REQB 4GJIA 1BRLA 3B0YA 3OVGA 4Z2HA 2HPMA 1SVDA 4B3LA 2A4AA 3SJ3A 4IGSA 4Z0SA 4M7SA 3VM5A 1T41A 3FFSA 2O9TA 4QR6A 2RKXA 3L4YA 1T6MA 1VFFA 3TAKA 3TZNA 1EH9A 4BF7A 5FJPA 1XF0A 1GQJA 3WZ0E 3POHA 1BQGA 4L5ZA 3D6NA 1RCXB 1VQTA 3QMTA 1AD4A 1LL6A 4XSMA 1IEXA 1O5QA 1CGWA 3I4KA 2H3BA 3S5NA 4BQ3A 4LEQA 4IG2A 5CPTA 5XINA 2NX1A 1LLWA 3GS6A 1TMHA 4B5SA 1BGAA 3AFBA 3VD9A 4U33A 3RO8A 1W9VA 1H61A 3ABOA 2ZYFA 2XVKA 2RHGA 1D7FA 4MDPA 1DJQA 2V3EA 2NXIA 4GY0A 5CZJA 1Z6KA 3D46A 1K9TA 4JL2A 1D3GA 1UD8A 2B4GA 4M6UA 3FAWA 5EMYA 1HZYA 2HDJA 2XIMA 5CJ5A 1LRQA 4POCA 3ARTA 3SRHA 1Y8BA 1W8GA 4FS9A 3KCJA 1X1OA 2BNJA 4GPNA 1W9BM 1TUXA 1AVAA 1RJQA 2PC8A 3MHGA 1R47A 2GUYA 1EZWA 3BZGA 4PCTA 1B9BA 1XC6A 1I2NA 4CVWA 3NQ7A 3WQWA 4ZXOA 1GOQA 2OB3A 1Z3NA 1U5HA 4RKAA 3PJUA 2DORA 4FZIA 1QTWA 4IUGA 2VEMA 3VOHA 1FX6A 2WKLA 3CYJA 3CLMA 1UIPA 2QIWA 2NQ5A 2RGLA 1CB2A 2Y61A 3QC3A 3C0LA 3CPRA 1XRFA 1YXYA 1M03A 1R9ZA 2OLSA 4G1NA 4K39A 5AZ1A 3VMPA 3IV8A 3UZYA 3PPCA 3VVGA 4HN8A 4QCEA 1DWGM 4F9DA 4V1YA 3AJ7A 3LYEA 5DXXA 4L4MA 3CB3A 1G5AA 1WZAA 4DZIA 1DQXA 3KM8A 1C92A 3H7RA 5A2AA 4GJ1A 5JH2A 1PX4A 1XLBA 4JTJA 4RNJA 3GDBA 4CD6A 3SUWA 2H90A 4ZO8A 3VUSA 1NWTA 3GTFA 3TTOA 5C6MA 3S9YA 3QW4B 4BF9A 5CEWA 3OP2A 4ZFMA 3AU6A 2ZUUA 2ACSA 3TEVA 1FWTA 4JGDA 1JPHA 4PUKA 3UWUA 4GGBA 4AXNA 4MPQA 4BI6A 3GZ3A 3WLLA 4GHRA 2DT1A 1JZ8A 2P10A 1DHKA 3VC6A 1UKTA 3SCTA 4GQQA 1CXHA 1QW8A 3AHXA 3R5EA 1M68A 3CAVA 3GTIA 4JR5A 4NNBA 2G37A 5LA2A 3G6LA 5I77A 2YFOA 5FAGA 4V1XA 4LUYA 3GVQA 2VM8A 4F3HA 3WQDA 3LHZA 1MNZA 4FHAA 1OCQA 5D2TA 4XD3A 3F4CA 5CPOA 3LHWA 3HN3A 2B81A 4C6IA 4TV6A 2OQYA 4X60A 3MUCA 4C5ZA 1XX1A 3S1WA 1TZ9A 3GIYA 1YE6A 3KHDA 1OADA 4RE0A 3S2CA 3LTYA 2XIIA 1H7XA 5AZ0A 3U7VA 2F6KA 4EE9A 5KSWA 3NO1A 2YB4A 3IVSA 2BY0A 3IJQA 2QHAA 1CNVA 2VEKA 1QO5A 1BQCA 3D3AA 3UYIA 2CKRA 3MUY1 3GKAA 1E0XA 4KWUA 1EA9C 1EUAA 1XIMA 3WDIA 5D30A 3ITLA 1TTJA 1SW3A 5DO8A 3TJLA 1AQMA 2GWGA 5BROA 5K2ZA 4AW7A 1FWFC 2GOUA 4Q4QA 1MQPA 1A5LC 2XSXA 5FI8A 2OKOA 3AC0A 4A6GA 3RM9A 1XLCA 2ESCA 1LOLA 3BGAA 3AU2A 3PWAA 4XQ6A 2VI0A 2F2HA 1EXBA 2CHOA 3P6LA 2I14A 1LL7A 1C7TA 4WSHA 4UC5A 1Z42A 2IKGA 4O16A 1PBGA 3OW1A 3G1DA 4Q7NA 1YE4A 1IIGA 4XBKA 3S1GA 1RBAA 4I7UA 1UWIA 1KKOA 3EWCA 4AF0A 1C90A 2HS8A 3CK5A 1O5XA 1JDAA 3SCNA 3CEPA 9RUBA 2QCMA 5CQ1A 1UA7A 1HKJA 1SSDA 4HJWA 2JBMA 1O95A 2PAJA 3NPXA 3KRUA 1Q6DA 4AIOA 5CAHA 3JRKA 5D03A 5EA9A 3W6MA 2PTYA 2BSLA 1GVRA 1ITCA 4AU0A 1EEXA 3PZNA 5D33A 3T8LA 4UFIA 3UWYA 5EY5A 1KM2A 3RLHA 3VDAA 1O6IA 1EJUC 4Q8UA 1E5JA 1TKKA 1PV8A 1MXSA 3DHUA 2CESA 1JF5A 3N6HA 4IL2A 5DXYA 3GUWA 3W82A 2EBNA 1H7NA 1RBLA 4BQ2A 2VC7A 3GW0A 4M7TA 1XIIA 5A6LA 2FH8A 4D6GA 5FEWA 3DIPA 4AHQA 3CMJA 2PU1A 2J7GA 2H8ZA 2YCEA 1HX0A 4JX6A 4UQBA 1CB7B 1YNYA 1XJBA 2A3CA 4PMRA 1R9XA 4RPPA 1FDZA 1IWPA 1OFEA 5LNSA 3WNKA 4QRNA 4FX6M 5C2GA 2ICSA 2PRMA 1OF8A 5FOOA 4LRTA 4JQ3A 1UWRA 1CTNA 4P8VA 3N3TA 3R0UA 1M3UA 1NOUA 1K9EA 2PDLA 4QNWA 4M1RA 4PMXA 3AOFA 5LIKX 3VZZA 2CLLA 2ZZ7A 4H4IA 2XM2A 4DWSD 2E5CA 2Q8ZA 2F2KA 4Q8QA 4J3SA 1JGIA 1D8WA 3WBWA 1EC9A 1XLIA 3LD5A 3HM7A 3VE7A 2OT0A 1FWSA 2Y8VA 3P80A 1GEQA 2G97A 3U5YA 2GQ9A 4LYKA 5LA0A 5A8OA 4F4RA 3WLJA 3HJEA 3OBKA 5A2CA 1P43A 4ADUA 4QDPA 2CXGA 4GBDA 4KEUA 4B92A 3R11A 3QXBA 1U1JA 1TRDA 3E3HA 3K8LA 5CPSA 3BPWA 4ATDA 4GYJA 3UY7A 1BHGA 4IP4A 3CMFA 3G77A 4C6CA 3SO7A 3UZ5A 1FTXA 1WYIA 3W28A 4P5UA 1TV7A 4XB3A 1K8XA 3VOGA 1KWKA 4IFOA 5I06A 2BOEX 2WJFA 1RQHA 1UZ4A 2VQUA 2D3LA 2ZUMA 4N7QA 3R43A 1OYAA 3VNJA 3WJSA 3LQLA 3NL3A 4TMCA 3O0FA 1DJXA 3MMDA 1CGYA 3MCNA 4Q8NA 5I3GA 2NUXA 1QHPA 3V75A 4S3JA 4TXEA 1E6SM 2J27A 1A3WA 3MWAA 1VEPA 1RAKA 5M5DA 3BAXA 1S1RA 1ODUA 1YPXA 5ABGA 4CCCA 1GEHA 3AS0A 3KDNA 4LCRA 3MDUA 2ZICA 1MW1A 1YX1A 4YU1A 1EQCA 1GKRA 1SYTA 4K7YA 3NSNA 3KE0A 2VR5A 2F38A 5CPQA 3UWWA 3QVQA 1EWEA 4ZL1A 1V0MA 1JPIA 3TSMA 1QNRA 1SR9A 3OZOA 1H7PA 2ACQA 3WH8A 1T96A 2CEQA 3M0LA 3W86A 3E0FA 4NP7A 2P8CA 1PKNA 3NPUA 2QVHA 2JGYA 2D69A 1XLDA 2VP8A 1NWUA 1RP8A 3EGJA 1R7AA 2CWXA 4GI9A 2ABAA 4LS2A 2D0FA 2OZ8A 3T09A 3FVMA 2E7FA 4IOTA 5T26A 1VJZA 3A4JA 3W7DA 3LCHA 3QSRA 4E5TA 3CPGA 3WLMA 4TTUA 2C3ZA 3CS2A 2DZBA 5JBDA 5E5CA 4B3KA 4J9JA 3UZZA 1UB3A 4HN4A 1ITXA 4OOZA 3O3RA 1Z44A 3S6DA 1MW3A 2G96A 1P4CA 1KM1A 4L80A 3LY0A 2FTWA 4Q4PA 3RHGA 2PDPA 4FF5A 3GNXA 3H2FA 3DI0A 3NZ1A 1HKKA 3TP4A 1A3XA 5MKGA 4I8YA 3OVPA 5A8MA 3HG5A 4MLJA 1SJAA 1TJ0A 1SZFA 5BMXA 2FGBA 5LIWX 2PODA 2CBJA 2JEPA 3A9BA 1UWSA 1VFSA 4DJDC 4WDUA 3O0KA 4W87A 1AMKA 4ZQCA 2CCRA 4GVGA 2ABBA 3B3DA 1ZP3A 4PFHA 3W7KA 1H1NA 3M5XA 4FB7A 1XUZA 4IWWA 5FJIA 5DFAA 1S5WA 1IZCA 1O1ZA 1ZAJA 4TR9A 1F05A 3P67A 2X2GA 4DY1A 4ORMA 4HYRA 2INFA 3ECQA 3GH4A 1WP6A 3MSDA 3N2BA 5FEPA 2CETA 3ARSA 1WB0A 3R58A 3SCVA 3RCMA 5I07A 3GDTA 2P50A 4C1KA 4F79A 2YJQA 1UCWA 1QOPA 3ONCA 1WE5A 4W7VA 4K8HA 3WDRA 2CLHA 4L64A 2HXTA 2R24A 4L4PA 4JIHA 4X9YA 3WJZA 3RM4A 2B7NA 5A1AA 2XPKA 2ZZ6A 1R9YA 3WDJA 1FUYA 4KBXA 2OEJA 3WG6A 1B3XA 3CWNA 1L8PA 3T0TA 3FK4A 2E8YA 1FQ0A 4PCFA 3KHJA 3VKBA 1RVKA 3MBDA 1JF6A 3ES8A 5G1YA 4QJ3B 3DEQA 4NRRA 4RR4A 1BTMA 4J7RA 2DT2A 1QMLA 3MUZ1 1KLYA 2J75A 3WO8A 4AMAA 4HHHA 4YYFA 2I9UA 3EXRA 3NOYA 1FXQA 4IIGA 1IWAA 3WX7A 1GYMA 3TLQA 3DENA 2ZWZA 3VGHA 3XINA 4S23A 2GGEA 3QZEA 3OVRA 1I6NA 2DUXA 1OG6A 1XDJA 4KFOA 4C6EA 1OZMA 3I7RA 1UYQA 2EPLX 3CYVA 1P7TB 4ZZ9A 5HAOA 3TZFA 4P7QA 1DEDA 1OSEA 1QPOA 1XYBA 1G6CA 4ZFCA 1E1CA 2VUYA 1QXLA 1FWIC 3GBEA 3V5OA 3QKEA 3SR7A 5G5IA 1TA3B 2XIJA 4LC6A 7TIMA 3H4XA 4WDWA 3ZT7A 1I8JA 4IMCA 1HTIA 1W9DM 2EHHA 3QY8A 2WWCA 1FWNA 3WH5A 4I8DA 1EDTA 1VKFA 1JCLA 2O7SA 4JTTA 3BG5A 5LNWA 4NAFB 1HQTA 3CMGA 2D2GA 1Q4NX 3QTGA 4QE4A 2V5DA 3S5OA 3SURA 4TV5A 3WBAA 3WENA 2UV8G 3T55A 2OZ3A 4DJFC 2Y62A 3RPMA 1JDCA 1UQYA 3QMSA 2FH6A 4BK9A 4JD4A 1ZAHA 1V6YA 5G1MA 1Z7AA 2WVVB 2AAAA 1VPYA 1T99A 3BSMA 4LOCA 4DYJA 3OPSA 3GTNA 1EYWA 3QR3A 4KEVA 4ZTXA 2C13A 6XIMA 1VHCA 4GX9A 3M9YA 4QS6A 2NX3A 4YTSA 1XIFA 3NSXA 4GI6A 4I9MA 4Z2KA 1LG1A 3TH6A 4MNKA 1SQ7A 1J0KA 2DZAA 1E9LA 4NZ1A 3VYLA 3QHOA 2GWNA 1LQ0A 4UXDA 1KXQA 3CH9A 1XD1A 2NWSA 1X1NA 4AZ5A 1CT5A 2V2HA 4FSAA 2E0PA 1HW6A 3AIUA 1BD0A 3AZSA 1S3HA 2XTKA 4H1ZA 1M7PA 3Q45A 3N9RA 2BY1A 1O12A 5LIXX 2B31A 1ZRQA 3TC3A 3V0SA 4DO5A 2A79A 1GW9A 2YCKX 3SFWA 1LWIA 2CLFA 1PTDA 5CGMA 3L67A 5HMEA 4MJMA 1Q13A 1V6UA 3VKCA 4JX4A 5IRPA 2YDRA 1FWJC 5I24A 3SN0A 3OIXA 2IS7A 4JHOA 1TB3A 3A5VA 1JQXA 4J3TA 4S3BA 5I02A 2WV8A 1CXKA 3UU0A 1I2RA 2PDHA 4AWEA 1AUSL 3GNRA 1E43A 3GXDA 2ZKMX 3NPVA 1T40A 3SSZA 1V93A 1J11A 1I45A 1Q63A 2VX5A 2G3FA 4DYKA 1DL3A 3GR7A 4NVTA 4HOZA 4J2MA 5DMYA 5EBAA 1R8LA 2HTMA 1BTCA 2HROA 2QVNA 2Z2BA 2Y7EA 1XC4A 2J79A 2V67A 5AY7A 4CQAA 4W93A 2A3LA 1WKEA 4O50A 2QCLA 1FDJA 1VRXA 3HO8A 4E8GA 3NQVA 4Q32A 1SO5A 3ARPA 4OZOA 3UCDA 5AHFA 3KRBA 2YFNA 4JQAA 1AG1O 3K8KA 1ZAIA 4QLJA 2TAAA 4REQB 3IIVA 1EX5A 4UTMA 3FLUA 2DIKA 3PUGA 4QQUA 3TMQA 4AZCA 3HQNA 3G8RA 1DHPA 3AZTA 1V02E 1EGZA 3V1PA 1Q6EA 5CPNA 5C9XA 3N6JA 2PU0A 4L61A 1IQ8A 4LT9A 4S39A 3TYAA 4DX3A 2CU0A 3G22A 1KRCC 1FP8A 2Y1HA 3PWGA 2PWDA 1E6RA 2QS8A 3VGBA 4JYFA 4NASA 2AGTA 3SCUA 4O53A 4MADA 3W1LA 3FVDA 3FDKA 1X6UA 4RNIA 3NDZA 4WKFA 3CT2A 4MGGA 1DXFA 4J28A 1UASA 1Q4WA 2WVSA 4AZ7A 3SRDA 3OBAA 4GO8A 4CD4A 3DFYA 1AL8A 2PWGA 3R8GA 1GWJA 2BMBA 2EAWA 4PTXA 3L65A 3STPA 3PBMA 1NEYA 2W0UA 1J5SA 1F73A 2Z1SA 2QUTA 2YPIA 3KLLA 3OGRA 1XYFA 2E1DA 1HN1A 3M0JA 2J25A 4I6KA 4DZHA 3OZPA 5D02A 3V36A 2RUSA 4MMWA 3EB2A 4QLKA 4K2SA 4MB5A 4P7RA 3KL0A 4ICCX 5DQPA 4TVDA 1XIHA 3QPYA 2F6XA 4JHMA 1EP1A 1SGJA 4XSLA 3W2KA 2E9MA 3UY8A 3M7SA 1JCYA 1V3JA 4GXPA 3EB3A 3DFPA 1IEWA 3G1VA 2RAGA 3SIZA 3UD6A 1P1XA 4UTLA 2FZ8A 3RLVA 1LRTA 7ODCA 5DF0A 3B8IA 1UHVA 3OGSA 5I3DA 4GNJA 5CXPA 3HU7A 3KWXA 5E0KA 2P8BA 3RX2A 3CGTA 4U2YA 3O16A 1M9HA 4GACA 3DGRA 3C0JA 3GVGA 4GRSA 1NARA 3LV6A 1J0YA 5GJPA 4B16A 4F0HA 3U5UA 3MUXA 4D6FA 5FD0A 4HA1A 3HGSA 4MF4A 2VEPA 4AZHA 4IP7A 2CHRA 3BK0A 3LRLA 4OT7A 1JD7A 3I3DA 1VZWA 2ZUNA 3WMCA 3WLQA 3WSUA 3K5XA 2YL8A 1MSSA 4PB3A 5AC4A 2V5JA 3H7VA 5RUBA 3OTRA 2WMHA 3NIYA 3A4XA 4YVPA 2WQDA 2NLIA 3AXXA 2FPVA 4AG0A 3WNOA 3E2QA 4HQVA 3ZVHA 4EF8A 2E77A 1KD0A 3L23A 2YLAA 5D9PA 5BOFA 1VFHA 1OINA 5AHEA 3J7HA 4J3WA 1AQFA 3WQPA 5LIYX 3BG9A 3NURA 2QDDA 1KTNA 1GGOA 4AISA 3AIRA 3WJWA 3ID7A 1ITQA 2PLCA 2ZOXA 2NVDA 2EJ1A 1KFLA 2WK2A 5KITA 1X6NA 2O92A 1XLAA 3TW9A 1FDYA 1E55A 4HZMA 1CEOA 2W5FA 5FKYA 1TV2A 3RF9A 4W8LA 1JFHA 4N6EA 3OO2A 3BL3A 2VVSA 1BVZA 1OFQA 3ABZA 4ROPA 3WH7A 2AMGA 3MY9A 5A95A 1C3FA 5EYWA 1GT8A 1TRIA 4JIQA 3NEHA 2JIWA 4EIVA 4Z0JA 1Q3NA 2DZUA 1GZGA 2HE5A 3W7MA 1KA9F 3W22A 5D8WA 3N29A 1PUDA 3GBDA 1DPMA 1KM0A 3HPAA 1TPWA 3P0WA 5B7YA 1UJPA 4NZJA 2OYLA 1QATA 1XG3A 1J6PA 6CGTA 5G2HA 4LCQA 1R30A 1YKWA 1RY8A 4KF1A 3W2MA 4D6EA 1FOBA 1KV5A 3AYSA 3U4FA 4UFKA 2X1IA 3E0VA 4EACA 1TTPA 4PL2A 3AHTA 5BWFA 3IEBA 1QPRA 1PZ3A 4L65A 1UR8A 5HNNA 3USZA 4ZSUA 5FSDC 3VOIA 4WK9A 1DBTA 2A1YA 4FOJA 5F4SA 2Z7KA 3CTLA 3NAVA 3ABXA 1UZ1A 4OWGA 4O0ZA 4B90A 3R4IA 3NA8A 1BPLB 3W6YA 5JXQA 3Q94A 3ARUA 3UZXA 1W2VA 3II1A 2CFFA 4AH7A 4D8AA 4LGXA 3VCCA 3NQBA 4QE1A 3GG0A 1RJRA 3W9ZA 4JX5A 4ZQMA 2DJLA 3LU2A 4PMUA 3WKZA 4DN1A 3DOPA 1LTDA 3WLTA 5E9XA 4DO4A 4CNSA 1DQWA 1GK8A 5FA5A 4LSBA 2J7DA 3G1SA 3OLGA 2XFRA 2R14A 1Q85A 3H2EA 3W0KA 8RUCA 1V02A 1GZ1A 1K77A 5BOOA 3FYYA 5B7ZA 4H00A 4LANA 1UPPA 3LXBA 2F6UA 1BKSA 2CZFA 4HPNA 3MJYA 4QCFA 1V3MA 4L7ZA 4QLLA 1P0KA 3NQ6A 1S3TC 4Y8EA 2BY3A 5DMNA 3ZMRA 4AZCB 2OO0A 4DUOA 1W5MA 1XXXA 3LMYA 1GKPA 2FDMA 1OK6A 4R7JA 1XIDA 5HNRA 4ERGA 3HFTA 1EP2A 2ZE3A 1H60A 4NXKA 1MUWA 4L4LA 3PZGA 4C60A 2J7FA 4CQBA 4JTQA 3PZUA 4BEUA 4GBUA 1WKYA 4GMEA 4WJXA 3BCDA 3GO2A 4CNOA 3IK2A 4O54A 3MDWA 3HFYA 4I6VA 4D6CA 2TYSA 3WD2A 3GHTA 4XG1A 1YNQA 2GGGA 2ZRWA 4AVFA 4IG2B 3WMBA 3WNNA 3KCOA 2Z1KA 4YTTA 2F8QA 3BVJA 3PBUA 1LUCA 1OFPA 2YXGA 3WFLA 3IPWA 3THQA 2BS9A 3EWYA 3WLOA 3TTEA 3I65A 3L9CA 5BNKA 7CGTA 2VC6A 3MO7A 3UJSA 4FEZA 3UR7A 5C2CA 1E6PA 3MQTA 4JNMA 4PMJA 3O06A 4XVDA 4QG8A 3VIFA 1IEIA 3UG5A 1FH9A 2DT3A 2HK0A 2YDSA 4OOUA 3E5BA 4BWLC 3DUGA 4AY8A 1OT1A 1R3YA 4PRRA 2IKIA 3ZQ9A 1FWHC 4QDMA 3WBXA 4AEFA 4UTKA 4H9XA 2VQTA 4NG3A 4FXJA 4IGNA 2OZ0A 3TOYA 2ZX6A 3WJXA 3DYMA 2OU4A 5I03A 2FGLA 2HEJA 3N6QA 4MNMA 2PF8A 4NZCA 3VU2A 4R33A 1QDSA 3VMNA 4RXFA 3VNIA 2E67A 3AMLA 1WBJA 3R12A 4WOZA 4RE4A 2PI6A 4CNTA 1VHNA 4UBPC 2Q01A 4FF7A 3GH5A 3GK0A 1ZBCA 3N18A 5DRIA 1TELA 2EQDA 2J7CA 4W8BA 3RPDA 3T2PA 1B5TA 2Y6ZA 3FCPA 3PNZA 1D2KA 2NVAA 4FX7A 1VEOA 3LGGA 2Y8UA 4Y9MA 1N8WA 5GNZA 2VELA 4JNYA 2ZUSA 5J04A 3M47A 2J8FA 3EWDA 2EG6A 4IIBA 4XZIA 3EOLA 3PP7A 2VWSA 1MRQA 3EPNA 3HV8A 3W00A 5M17A 3ZVHB 3GXPA 1H50A 3SUSA 3UR8A 4C7FA 4WKAA 1QU4A 5I7GA 3WQEA 5HDRA 4OU1A 3S83A 1J01A 1WUFA 4KRUA 1VFOA 4GXMA 4L6HA 1QI0A 4Y6GA 4X61A 4MZYA 2GDUA 4XAPA 3T4WA 4J3UA 3VOFA 4LUTB 3AZRA 2QJIA 3ZT6A 4ZOEA 3H23A 1F7BA 1U30A 2PTDA 1IEVA 4WLCA 3B9DA 4DBUA 4IF2A 5EGRA 1CCWB 3ZOAA 1JRCA 3TYDA 3SADA 4G9PA 4HSOA 6A3HA 7PTDA 5A94A 3SI9A 3DFSA 1WDQA 2BHZA 4REQA 1LBFA 4ERAA 2VHLA 4DEFA 2FTPA 4JCMA 2O7QA 4S3DA 2UWFA 1UR0A 3HV9A 3W53A 2X41A 1TWWA 1NTHA 2PDIA 2VX6A 2DZPA 2XGZA 4AD4A 4P7LA 4IJCA 3TC7A 1LF1A 4CUCA 1XLHA 1IXOA 3KBJA 2PFHA 3SGGA 4HMEA 2X40A 1XGZA 3AXHA 1C29A 1I2QA 4XBSA 1I2PA 5IBXC 5BZAA 1QI2A 2TRSA 3KRZA 1TV3A 5AECA 3TVAA 3UXLA 4W5UA 3TYZA 1KFKA 4Y9OA 3S5ZA 4AUBA 3QMRA 1YBQA 2GQ3A 4PUMA 1B3OA 3PANA 4R85A 4M19A 4BA0A 4U3CA 1HNYA 2FFIA 4GYFA 3EX2A 3OBEA 3AWOA 3AS3A 4LX4A 2ZZ5A 3VNYA 4MWAB 1QI5A 1GUVA 4ZB2A 2CZ5A 2Y63A 3O6DA 2BB0A 5IOBA 3STGA 1BF6A 4LALA 5JMUA 4LS1A 1ML1A 1UA3A 2FPTA 2I57A 4GI8A 1FBAA 1FCQA 1VYRA 4D71A 2DY3A 2YSWA 4QBXA 4RZ6A 3KLKA 4CNPA 3EKZA 3OQEA 5CLTA 1PPIA 4EK7A 2X1TA 4C1NA 3K4DA 3W7EA 5CSRA 3BOLA 4E4UA 3MSGA 2L5HA 3BSHA 3PFRA 5EKYA 4C6LA 2ZA3A 3MP3A 4ROQA 3AROA 3ZJ6A 3IS4A 3VOCA 1BXCA 2GGJA 3MPGA 1DP0A 3EAUA 2VFHA 3CIWA 3P84A 5EMLA 1EPVA 1PYFA 1TO3A 1HP4A 1K8ZA 4QEHA 1P5BA 4YS1A 5JQ9A 3WBEA 3KVLA 1VPQA 3UWQA 4A8RA 2X42A 1CW2A 1YW1A 4I9JA 4P8XA 2A6LA 3VDHA 4C5YA 2ZZ4A 2QJJA 2Y88A 3LNMA 1SUXA 2UY3A 4UWMA 4C6MA 1C8VA 4HHPA 1KBLA 1GYLA 4JTDA 1MZRA 3V0TA 4A3HA 3JVAA 1DIEA 2WVTA 4K37A 4WJ8A 3VC5A 3GYCA 1NFBA 2Y24A 4A21A 2ZRZA 1UBPC 2J9ZA 3WUEA 4O8RA 4NSBA 1JZ6A 1KGUA 3HB9A 1WXJA 1VRDA 3EWBX 3JU2A 4R88A 1TZ7A 3GRIA 5HBFA 1H2JA 3UNDA 4XZNX 2QUNA 3VIIA 2C19A 3EA3A 2WZTA 4JDBA 4IIEA 3AIVA 3CO8A 3WH9A 4U2ZA 1GW1A 1F6KA 3W07A 4HHLA 2OT1A 4MG4A 1OC6A 4CNNA 3A21A 3GH7A 4GABA 4JY9A 1ISVA 1A4MA 3AMGA 4PTDA 3TQPA 4ZE4A 4S38A 4JTKA 1LT8A 4LV9A 1BXBA 3GAKA 2D3NA 2G41A 3SIMA 1KB3A 1BEUA 3PZIA 2E4TA 4BI5A 2WYSA 3UG3A 2PCQA 4CVUA 2FJUB 3LMZA 1OGSA 4ZA0A 4O10A 4Y9NA 3RMEA 1XP3A 3N34A 6ALDA 1FHVA 2VFEA 2WJZA 4GWEA 1KLZA 1NP2A 2YL6A 2ANUA 1X98A 2KAUC 1XLJA 3MB9A 4BS0A 5CH9A 2ONEA 2VGBA 1E1EA 4AY1A 2WAGA 4PUNA 2XUCA 4XKMA 2UY4A 3BAJA 3BV4A 4O1BA 4S3KA 5L6UA 5K3VA 3CV2A 1UKQA 4LVFA 2DFAA 3WUGA 3CL7A 4JFVA 4URIA 1WDDA 3LZ3A 2WBGA 5MKGB 3H70A 4TVCA 2R91A 4H9ZA 3UXKA 3M44A 1ZHAA 3MP4A 3M0XA 4HHMA 4Q4KA 5C8BB 9CGTA 1AD1A 4FNTA 4H6KA 1K70A 2Y8KA 1B1YA 2BXYA 2XWDA 1HJUA 1GVSA 1K8YA 4GQBA 3M07A 2NQZA 1HF6A 5JBEA 2PLJA 1FWCC 3E6EA 1OBAA 2R8WA 1J10A 2FB2A 4E2BA 3S46A 3DG7A 3C3NA 2H6RA 2D73A 3U2CA 5AHIA 4Q22A 5D9MA 3LHTA 4TU1A 1RA0A 2DP3A 2WPGA 1VPXA 5I2UA 4DBWA 3EOOA 1US0A 1KXHA 3AYRA 4GO9A 1UOZA 2C1GA 1LWJA 3VIPA 5AYZA 4GY7A 4EXQA 1LLOA 3S1VA 3E5PA 1EYEA 4AXKA 3KTSA 1IXPA 4UR8A 1NAL1 4S3FA 1L9WA 3URQA 1S1PA 5LHEA 3DKJA 4A35A 4US6A 2OVLA 1RCOB 1VF8A 4AQLA 4PUDA 2CBUA 3P2VA 3JUGA 1HUVA 4B3ZA 4CCDA 3SUTA 1XS2A 1J6OA 1RQEA 3BZJA 4B5UA 4QJ5B 4HU8A 2QZRA 1AODA 1JIBA 4Y9AA 4AHPA 3DX5A 3GYEA 3POCA 3FHQA 2B0MA 3FA4A 3VAVA 3DFHA 3LCLA 4C6FA 4U5IA 1BYCA 4HU0A 2GOKA 3CAKA 3G24A 3RJYA 2ZTKA 3E74A 1D8CA 1VIZA 3C2EA 2YCLA 2Q02A 2QCEA 1CLVA 1BG4A 2HXUA 3G2GA 3NQMA 4QSFA 4JBRA 3IWPA 4JFTA 4U28A 4CQCA 1KRBC 3V4BA 3LLDA 3LERA 4JN8A 2ACRA 2PRHA 4LC8A 3A6OA 3I7QA 3VKDA 3O8AA 1GQNA 1B3YA 4LB4A 3W85A 2V3GA 1KBKA 1TR1A 1RP9A 4RZ5A 2NSOA 4WXZA 1XYLA 1DTNA 3ABSA 3MKVA 3K30A 1IIHA 3M0IA 4O17A 2C0HA 2Q3RA 3OQ8A 1XGDA 2WZMA 3CT7A 3ITVA 1QI3A 3PB0A 3M1ZA 1JFXA 1CI1A 3IJIA 4IFKB 1W9PA 4FLSA 6PTDA 5A6JA 3KBNA 5ECVA 1N55A 1NF7A 1L2UA 4EP8C 1TV8A 4LUSB 2Q8XA 4E4FA 3OLIA 4CU6A 1UWTA 3VK5A 5F2GA 1X6LA 4KCUA 2V6AA 3BLOA 1C9WA 1XWYA 7REQA 3KTXA 4CGTA 1QW9A 2ZC8A 5EU9A 3INPA 3B4YA 2VC5A 2XH0A 3PTDA 3VKAA 4C6OA 1HKVA 4DLMA 4AIBA 1AJZA 3DBNA 1FRBA 2HWGA 1IR2A 1W5PA 3RIKA 3GXIA 3LN3A 2YA2A 1MNSA 3HMCA 2JKEA 4K3ZA 5FESA 3LCXA 2VDHA 2JEQA 3PZ9A 1SFTA 5CZTA 3KUMA 4Q4RA 3NQ2A 2P3ZA 3ARWA 3I6RA 2DT0A 2Z25A 3LTSA 1UWQA 3GQYA 1JYNA 1S2UA 4PMDA 1SZNA 2XN1A 1E3ZA 4HNNA 3PUDA 4QGCA 4DJFD 2VXNA 4KIEA 1IXNA 4JYDA 4R34A 4IMFA 4NL1A 1XDMA 2PD5A 1VJSA 3LPOA 4NT0A 2WNNA 1TJ1A 1A5MC 2ZUTA 5C54A 4HU3A 3PB2A 1JI1A 2HRWA 4EAMA 5F7UA 1XKJA 3C61A 5D09A 4E8CA 1DIKA 4GX8A 1ICSA 4GIYA 3PHAA 2QGHA 3A23A 3CHCA 3APYA 2IXUA 2E5BA 2X16A 3QZ6A 2YCJA 2WNQA 3P7YA 2PTXA 1WKDA 3WNMA 1TX0A 4MZ1A 3M0ZA 2R1NA 3EX1A 3JS3A 1J2BA 3PVFA 2BHUA 5DY2A 1TYGA 1EBGA 1JULA 1YYAA 3I10A 3PAOA 4ZODA 1KGWA 4EF9A 3MYPA 3UGRA 5CAKA 2YXXA 3G0XA 1FY6A 3GX9A 1YLVA 1WAUA 3RRXA 2ZXDA 1DJWA 5DELA 3GZAA 3P81A 1K4HA 5BCAA 3QZAA 3BQ6A 3AYVA 4QM1A 3W7OA 3AIWA 3S3GA 3NQGA 1GQLA 1MMFA 1KKRA 3MO4A 4TUFA 3OHMB 1G94A 2BY2A 5M1TA 4L6DA 3STEA 1CGXA 2Z0IA 5FF0A 3GW3A 1GVFA 3BURA 2ASHA 4WCJA 1JDEA 4ZOAA 6ENLA 1E6NA 3N9KA 5HMDA 3BANA 2VRJA 3T05A 2DVXA 3C86A 2Z6JA 3WLPA 2XVNA 4OUIA 4H01A 3IRSA 2VOTA 2PGEA 1G7VA 5A3HA 3EMZA 1CIUA 3BAWA 1AZ2A 4NI8A 1F3TA 2J9YA 2P0OA 1V08A 4MNJA 1ADDA 4HA0A 1J0HA 3GC4A 3ZJ7A 1V6XA 1YPIA 4M29A 4MKSA 5KETA 1YQ2A 2CWNA 3WLRA 1MDLA 1PO9A 2WPBA 1EGMA 2EF9A 1YTKA 3W27A 2XFWA 2OKTA 4O1FA 3FSTA 3L4TA 5U4NA 3PZVA 5EFDA 2VGGA 4N0RA 2PWVA 3GXFA 1VP5A 1QVBA 1FHUA 1OX6A 3VIJA 4DIAA 1MZHA 2XH2A 2D20A 4AHOA 4EPKA 3PTQA 3I4EA 1RPKA 1KTCA 1MWOA 3RN6A 3W7NA 4ZENA 1R46A 2Z2UA 3GDKA 1LT7A 3R8RA 2AMXA 4DI9A 3OA5A 1S5MA 3F2DA 1US3A 3K46A 2HVMA 3ZR6A 4FP1A 4FXSA 4DXXA 2FFCA 4KMQA 4RNFA 3T0AA 2V68A 4GYPC 1R2SA 2YDAA 4WOQA 4LTSA 3IACA 1F3EA 1Z41A 1YADA 1FWDC 1QPNA 4O0QA 2HK1A 4AEEA 4IQJA 4D8ZA 1ZJIA 1ZTVA 4ECLA 4GFSA 1N8FA 5SWUA 3CM4A 3T4CA 5E6YA 3SGUA 4JFWA 5AYYA 1ONXA 1N2VA 1ME9A 4L1WA 5CG7A 1P6CA 4XZBA 1OFDA 3AHYA 4HA4A 4ZOBA 1WPCA 3LPPA 1RH9A 2GQAA 2X1UA 4B9ZA 2I16A 4O11A 5FEZA 4W8AA 1CXFA 1PJ9A 1HGYA 4H8VA 1PZ0A 3ES7A 2ZUWA 4D72A 1VAHA 2J6XA 1Q2SA 3LB0A 5AC7A 3MW7A 3CZJA 4N4QA 3MI6A 2FHFA 1JL8A 1GPWA 2E6FA 1B3ZA 1W1PA 5EB8A 1V0LA 3AMDA 3VGEA 1W3KA 4WHBA 4MVAA 3UWEA 1XHGA 1YTEA 2NXHA 2I9EA 2R1MA 5E0FA 1UD4A 2CLIA 2Z1XA 3M0MA 1EA0A 2XVPA 3I6TA 2POTA 1QNVA 5CZSA 2QJNA 1MO0A 1F6YA 5EBUA 2DH3A 1E15A 3ZJKA 2CHNA 4IQLA 5J5RA 1IWBA 2GJRA 3ZJ8A 1EUNA 2WZHA 1E70M 3PBGA 4A8NA 4HSNA 4UNLA 2BLEA 1OYCA 2R94A 4I7WA 1XBVA 2FLIA 2ATMA 4PBEA 1GOXA 1C93A 2XH7A 4MLRA 5DT5A 2ZDRA 4PUWA 5T8GA 5K7JA 3REQA 4LF2A 3BTNA 3JZEA 1JYWA 1OD0A 2VUNA 3AAMA 4O1EA 1V6VA 4A05A 2ZBTA 4BR1A 2JK2A 2BGQA 4YIWA 3U2ZA 1W3JA 3NVTA 2NUYA 4AD5A 4O4VA 1W1B1 2AKZA 1JZ3A 3UXIA 3AICA 5AHMA 3L5AA 3QQ1A 2WNZA 4JTUA 1YEYA 1TVPA 3MVTA 3K13A 4MSSA 4PMYA 4Y7EA 1TJ2A 3QPZA 4QITA 5HQLA 5GNYA 4HMDA 2DZSA 5CPMA 5FJUA 1H4PA 4FR6A 1SJBA 4O1AA 5C0QA 4CU7A 2V3DA 3D0CA 3LPFA 2F84A 4B2DA 4V28A 2E09A 3B97A 3GTXA 3IV3A 4GINA 5HMSA 5REQA 4A2SA 4LNCA 4W4QA 4F0MA 3T78A 4PSRA 4K8GA 3Q4DA 3S5YA 3NM1A 1JJKA 1EQPA 3W02A 3T0BA 3H12A 2WZEA 3KXQA 3A24A 3E2SA 4B5TA 2CLPA 1PIFA 5H6HA 1MVYA 1BYAA 1E5NA 3ATYA 4LJ3A 3HURA 4HKPA 5GQBA 1OFBA 1EHNA 3KX6A 2WMFA 1NDYA 1VBJA 1U5JA 5G4HC 2C14A 4G56A 3TK7A 5I5RA 2PWEA 4AC7C 1VFMA 1VEMA 4GFIA 3K1GA 2EPMX 1EIBA 3DESA 5DEZA 3T81A 1MXGA 4BCEA 4HYWA 1LM1A 3ARQA 3KS5A 3URNA 5BRBA 5FJOA 3DAQA 3TV8A 2VGFA 2ZZ2A 5DBUA 4UOZA 2I1OA 1XICA 4ZO6A 2XM1A 3S9ZA 3QN3A 1DJNA 5F4WA 2PWFA 2QV4A 2V9DA 2XU2A 4TOQA 2WMGA 4MUPA 1ISYA 1W9XA 1WDRA 3F03K 2VMFA 1AK5A 3PBVA 1IF2A 3N2MA 1OABA 4O1DA 2J8TA 3HGOA 4NXSA 1QRQA 5JU6A 4B4FA 3BC9A 1V4YA 3L0KA 1EX1A 1HT6A 1YDNA 3C6CA 2QPXA 4PFMA 2XZ9A 3QEZA 1WBHA 2CLMA 1R3WA 4GIAA 3I7SA 1GQKA 3H21A 5AVHA 5ABEA 3TNOA 4HYVA 1RVGA 4R7OA 1FWEC 2YA1A 4QFUA 2J24A 4HZ8A 3GVWA 3AIQA 2VRQA 1XINA 1E4NA 3N14A 4JIRA 2XWEA 1NOFA 1SSGA 3DFTA 3W88A 1WXYA 2RDUA 2V3FA 4HZ7A 3HPZA 2YDQA 2VENA 3DC8A 1EWDA 2HISA 2A7PA 4U4MA 4IFRA 4GG9A 1OEPA 3ARRA 3MS8A 4JIIX 3A3WA 2VT0A 3LSBA 2DH2A 1JUBA 4INFA 2XIBA 1UIOA 5HPOA 4O52A 3PPFA 1YIXA 3TONA 3R6IA 1E9YB 4M1BA 2OX4A 3ITOA 3F4DA 3EDDA 4A3UA 5FJTA 5HANA 4KETA 1H41A 2W91A 4A2RA 1C9DA 3W3OA 1IXQA 2IMRA 5IDZA 3HQPA 3IJLA 4IIHA 4BJHA 1H09A 4ZQRA 2VEIA 4AZBA 4X2PA 3UW6A 1TV5A 5AYXA 2JE8A 2PPGA 4KT2A 3EOSA 2PDUA 3WQCA 2I7GA 2WWDA 1ZJHA 3LBMA 3Q58A 4ACZB 3W81A 4HGXA 2I5QA 5AOUA 1TIMA 3OIHA 3T6CA 1H0IA 3ORWA 4JTFA 1GKQA 5HOSA 1WDPA 5JVLA 4J4KA 2W79A 2X1RA 4WGXA 3BOXA 4DUXA 5IBXA 4BHYA 3W6LA 4U10A 2W6RA 4S3EA 1GJWA 4EVZA 3OOQA 3DU0A 1OGBA 1TQXA 2A3BA 3V0UA 4HZ6A 5DCBA 3L0NA 3UXAA 1JZ4A 4KESA 3UPBA 5BU6A 3TX9A 3S5SA 3CUZA 2EO7A 1K4GA 4ZGYA 2VZTA 5HNUA 1DQUA 3CZEA 3AMKA 1NSJA 2R82A 4YWSA 1H63A 1PHQA 1JPDX 2QJGA 2Z29A 3MUIA 2WBKA 1R3QA 3C2RA 1TVLA 1EXPA 1W37A 2PBGA 2QAFA 2YYUA 4B5NA 1V3IA 5HUOA 3R1ZA 4HOWA 1JG9A 3CV1A 4RZBA 3NTYA 4DO6A 4JHZA 5JIWA 3QLLA 3N1AA 4IJBA 4FOKA 1T5AA 2X05A 1L6FA 4PTWA 4GCXA 3TROA 1B31A 3RUBL 1NIUA 1I9CB 3ZFHA 5D9NA 2BWGA 4GVHA 3TQVA 4XO7A 2ZCGA 3CC1A 2CYGA 4CQ8A 2E6AA 4OE7A 3MV01 3Q67A 1KC7A 5FL0A 1I60A 4X0NA 3GC2A 1XIBA 3UESA 4HK5A 5H8MA 4PMNA 4NRSA 3AXMA 1KNWA 5GVJA 3UZJA 3EA2A 1K6AA 2VX7A 5U7SA 4E3VA 5AYBA 2ZFAA 5ECUA 3W26A 2OYKA 3WMLA 2UY5A 4KWVA 3WQ4A 1G67A 4AX6A 2PDCA 1GJUA 2Q8LA 2AGKA 2GVLA 4AX7A 2JKAA 1P6BA 4M56A 4JTRA 1WUEA 2DEPA 1H0GA 3A64A 1J18A 5E6ZA 3BLKA 3L5MA 3CAQA 1O7AA 3LI1A 4JNZA 4MHBA 3TCSA 3CXOA 4AZGA 2ZX8A 4GKTA 3VIMA 4S3CA 3R25A 4O4WA 3O6AA 3EMQA 1E9IA 1CECA 1K9FA 3TN3A 1K03A 4GJJA 2DZTA 1VIWA 4YVVA 1RJPA 3DYPA 4LVBA 4X0VA 3TTQA 2C16A 1XIEA 3G0SA 3LX9A 3QV6A 3B9EA 2X8RA 1DWHM 4DBEA 2PP3A 1F4AA 2Y5EA 2GLKA 1UWUA 2WQPA 1Q6FA 3S47A 3NDOA 3TC6A 4HNUA 2EKGA 2PDYA 2RDXA 5HJYA 4PTNA 1W1ZA 5C9UA 3YPIA 1YHTA 5K4XA 1RHCA 4ZSTA 2PS2A 2YW4A 3CQ0A 3QBUA 3ALFA 1VENA 2R1LA 5K9DA 1GONA 3TNBA 2X0HA 3ZM8A 1ZBWA 3NGFA 1XKYA 1H49A 1VD6A 2CC0A 1U2YA 3UR5A 4Q4OA 1R87A 1EC7A 1Z9AA 1WQ5A 5KZMA 4LH8A 3VNKA 5K4ZA 1M6JA 4OBSA 2CITA 1LROA 2ACUA 3W7HA 4A22A 2BTMA 2OWXA 5CZKA 3FYOA 4ZTYA 5BW6A 8TIMA 3UJFA 4GI4A 3A9IA 3C56A 4HNVA 2XHYA 1G01A 3WQGA 1M01A 2GGIA 4DUVA 4F0RA 8CGTA 3N15A 4FOUA 3DH7A 3LI0A 3FXGA 4MY8A 2J62A 2O9PA 4MAVA 2OQLA 1RA5A 4M51A 1XH1A 5AFDA 1W1IE 4PC8A 1JCTA 3QV7A 3GU9A 5A8GA 3W1UA 4LQ1A 5IFPA 2J7HA 3PPHA 3UJ2A 5HK4A 1QNPA 3EDFA 4RV8A 3KEHA 2WSYA 3MKCA 4XZ9A 5D04C 4UMAA 2QEZA 1CGVA 1V6TA 5TAOA 4DUWA 3S2MA 2JQXA 2V30A 1ISWA 3OA3A 3TN6A 5HMFA 2Q09A 4WGHA 1B2YA 4HCLA 1FCBA 3IK4A 1RD5A 1MQQA 1WZMA 2Y4SA 1JD9A 2F9RA 3HGJA 4LF1A 4PH6A 3WDHA 4XAFA 2YCLB 4PTVA 4M0XA 4QDWA 1Q8AA 3CHEA 1P0NA 4DPPA 3PBYA 1L6SA 2WNWA 3FAXA 2GDQA 3BDKA 1XPGA 1E1FA 1TJPA 3N2XA 1FKXA 4DHGA 4NF7A 1VCFA 3EYPA 1PE1A 4NKCA 4FPSA 3BW4A 2OYMA 3GAYA 5HXMA 5HINA 2Y2WA 3SCRA 3AXKA 4G1KA 1IT8A 5I3HA 3KS6A 2E25A 3H53A 4N42A 2PDMA 5I6SA 3CU2A 3EDKA 3BMWA 3QY6A 3T2QA 1XRTA 3TTSA 3FOKA 4JL1A 4DJDD 1ZBVA 2HZGA 4MIMA 4RDYA 1XFBA 2ZZ3A 2I56A 4ADTA 5LNRA 1JDDA 1F5ZA 1LLZA 4ICNA 4JOMA 1OY0A 4MOZA 3ANVA 4LUTA 1RUSA 4UZUA 2GK1A 3EA1A 3PULA 5HPCA 4K8EA 3ZVIA 1MFVA 5I3KA 1RCQA 1OM0A 1I0DA 3GNOA 3TSBA 3WEMA 2FZDA 3VTRA 4LVGA 2NV1A 1FWGC 1P1MA 2WHKA 3P82A 3S6OA 2E40A 5C5YA 4US5A 1R7OA 1NDZA 1JYXA 1TJRA 5A6KA 4GA8A 4HPJA 3GIQA 1ZJBA 1EKOA 3S2LA 2J66A 3ANYA 2PGWA 2TMDA 2QXWA 1BLIA 2RJHA 1ELSA 1F61A 3OYXA 3UGVA 3XIMA 3GHSA 3M46A 1VCVA 3L12A 1J93A 3B8SA 3W1PA 1PDZA 3I3BA 2BVYA 3L21A 1V51A 3HJZA 2XG9A 3L7RA 2OSYA 4JYEA 1R3SA 1O94A 1OD8A 3DERA 3IJ9A 4RLIA 4Z1AA 3LHYA 4I5RA 4MM1A 4NAEA 3N3MA 5HQEA 2KZHA 4O8AA 3T40A 6REQA 4E6MA 4WKHA 3W87A 4H8NA 4IPLA 1TWDA 4K68A 3K4WA 4J27A 2W92A 3CV6A 4H9UA 5HA7A 2DZXA 4D8LA 2CNCA 4WDXA 2NT1A 4AZIA 2QT3A 4DZ5A 1AW2A 2DUAA 1FHLA 4P8UA 3VI2A 2O9RA 4Z2LA 4W85A 5EMJA 4UQ9A 3KL3A 5FJJA 3EWXA 1OFAA 3N17A 3UXDA 4RX0A 4JTGA 1E4IA 1YPFA 1KM5A 1CPUA 4MJ2A 1B57A 1XYAA 3P3BA 3QLDA 1BYDA 4FIRA 3H6OA 1IYXA 2GSHA 1QBAA 1WDWA 4IX2A 1RBOB 3RPTA 4UMCA 1AJ0A 3ITYA 2QAPA 2ATSA 2Z4GA 5J5DA 1OYBA 3ZR5A 1E6QM 3FEQA 2VZSA 4ASTA 3FJNA 2EKCA 1POJA 2QDEA 1UROA 1SR0A 4UTJA 3UP8A 3LDVA 4AD1A 3WF2A 3S42A 4G6CA 4HP5A 1AH3A 4M6QA 3G1AA 3WQ5A 3D5HA 2WANA 3WK0A 3B0PA 4UTTC 5F2LA 4MJZA 1E1CB 4ZR8A 2GJNA 1W32A 4AVOA 4GZ7A 3IIZA 3SCSA 3CHVA 3T42A 3RR4A 4GC3A 4MNLA 4W89A 4AWTA 3WFZA 3NYDA 3M5VA 3WELA 4PA8A 1JPKA 2C1IA 1DJZA 2JALA 1QNOA 2PDGA 4XZWA 5E1QA 2OGYA 3R94A 1RSCA 4W84A 4GUFA 3G0UA 1YNPA 3CZGA 5A6BD 1GTEA 3QF0A 2VZUA 4HMNA 2NV2A 3WD3A 1HL9A 2QKFA 2X30A 2ZVIA 4OBTA 4C7DA 4IJRA 4IMGA 1W31A 4LEFA 3KBSA 3CPUA 4V27A 3E1F1 1TPB1 1M53A 4DJED 2C6QA 2MUCA 4AYGA 4O1CA 4GE8A 1ESWA 3PJTA 4X22A 3IVUA 2WKGA 2DSZA 1F3WA 1CXIA 4O14A 3U8GA 3KZSA 3LSCA 1UC4A 2ZA2A 4TX8A 5FF4A 4D6JA 5HR7A 3MV11 1K1DA 2POZA 5FACA 5DCDA 1W1A1 2WMIB 3FXYA 4L9XA 1EGVA 4M24A 1FWBC 3NFUA 3RITA 3LOTA 3K2GA 3IARA 2W61A 3SY8A 2NX9A 2DGAA 1H3GA 5H91A 3NWRA 5HJXA 3CHDA 5D9OA 4PUJA 3PWIA 3UQNA 3S1XA 1B3WA 3V16A 2INEA 3BAIA 3SSJA 2V69A 3CEUA 2FQIA 3R8HA 5C70A 3E0WA 3EMCA 4LY8A 4JTAA 4MB1A 3WD1A 2Y7DA 1KBIA 4N2YA 1N82A 3BLDA 2BVTA 4BF5A 1YDYA 1I4NA 1J5TA 4WIWA 2DVTA 3VINA 4XISA 3KBWA 2ZXQA 5ABTA 2IKJA 3BG3A 2VVNA 3UNTA 1R38A 3OJGA 4AEOA 2GVGA 4LAZA 1J8VA 1QPKA 1KFCA 1G4PA 4ML4A 4MY1A 1RV8A 4XKYA 2GDVA 4IIFA 1CWYA 1JI2A 3QOMA 1OT2A 2PDQA 2A6NA 4IQEA 4QAWA 1XYCA 3SZ8A 3LPGA 2W4XA 1XLLA 3ZSSA 3VNMA 1U22A 1QK2A 4CQDA 2XIOA 3AUJA 2O55A 5EMKA 4C6PA 2CW6A 3N04A 5C9ZA 2JIEA 1UKOA 2OPJA 2OWCA 4AY7A 5KEZA 2A0NA 1W5OA 1OIMA 5I09A 1OQFA 1VYPX 5LGXA 3FKRA 1KO0A 1XLKA 3EOUA 1X39A 3M5YA 3NG3A 2YL9A 3OU8A 3M41A 1GHSA 1GHRA 3MMUA 1ENUA 3W01A 3W7RA 3VCRA 5BU9A 3IIXA 3M43A 3UETA 6XIAA 2GFTA 2ZWYA 4FNQA 2TSYA 2E68A 1US2A 1HGWA 3LBCA 3IANA 4YVXA 3L2LA 3GDRA 1E72M 5CBJA 3SUVA 4YPJA 1S2WA 4H9VA 3F4NA 3VX0A 1L8NA 3RU8X 4RE2A 2XFYA 1Z32X 4AIEA 2TODA 3PZMA 3REQB 3M4HA 3CJPA 5JBFA 1DE6A 2PMQA 3NQEA 3VZYA 4LUSA 3W23A 1V7YA 3W7PA 3WLNA 3A47A 3GC5A 1UZDA 4HD5A 3SN1A 4MJ4A 1OCJA 1XYZA 3TXVA 1PSCA 1S5TA 3T7VA 4B91A 4RDWA 3W7LA 3QW3A 2G95A 1EO7A 2NWRA 3BLPX 1ZENA 2V5CA 5CZ0A 3AYTA 3C4UA 2D1ZA 3JZUA 1XISA 4L6OA 3BLEA 4NZ3A 4F2UA 3T8QA 3ZO9A 1NY1A 3SY5A 1SJCA 2OSWA 1H11A 4IZGA 1A4LA 3VKJA 1UP2A 2Y7FA 3PZOA 5CC6A 1R85A 4G2DA 4C1NB 1Y0EA 2HE8A 3M6DA 2VD9A 1F9CA 3QJAA 3RJXA 1IZKA 2V2DA 2ZXBA 5HQMA 3G8EA 3GXNA 1XH2A 3NM3A 4PBGA 1AJ2A 2UBPC 3ONBA 4DNHA 3QV8A 1MQRA 8A3HA 1RZMA 3NO5A 4LW7A 1Q45A 2V5LA 1OK4A 3BJFA 1VC4A 2AQVA 2CLOA 4ACZA 4FI4A 4FNSA 1Q2RA 5A6MA 1QNQA 5A6AA 3EX3A 1PIIA 1U83A 2P88A 3VDGA 3CHFA 1HJVA 1GTHA 4AWSA 1SO4A 1W2PA 4F2BA 3WD4A 4XUYA 1H7OA 2WSQA 4LYPA 3H8AA 3LGDA 3A12A 1ZL1A 1OWQA 1WZLA 5A6SA 5HNTA 3UCQA 4A29A 4HNOA 5I00A 1XL9A 1LORA 3DN5A 1DV7A 3LNPA 4IH3A 4QJ4B 1PWMA 1H51A 2VJXA 2RH9A 3HG3A 4X9SA 4Y2WA 1T7LA 1LOSA 4GQGA 1IR1A 5I23A 4DQWA 2PF0A 3KOFA 1ZB5A 4ORIA 3UERA 3IJ7A 2WB5A 3APGA 3GD6A 2VC9A 3IIPA 4Q4SA 4AC1X 4BEQA 3GVVA 3FA3A 1K6WA 4Z1DA 3ZLGA 1P0BA 3U2OA 5M03A 2ZADA 1P7TA 1MEHA 1X38A 4IGMA 3EWWA 3V7PA 3AWNA 1KFJA 1WXZA 4K1WA 4PN2A 1XUUA 2ISWA 1OCBA 4QAIA 1FH8A 1XSKA 1RY0A 4S1FA 1EJTC 2YBUA 2J47A 5LSMA 4FR1A 5EMUA 3EPMA 2P76A 1IT7A 1EPXA 3NOEA 3C0QA 3ENLA 3LS9A 2J78A 1EDQA 2VD8A 3RX4A 4NJHA 4FMVA 4M80A 4XAZA 3FHAA 4GVFA 4LS0A 5HATA 1P0EA 1W6TA 4LRSA 4CCZA 4K38A 3SEPA 4AFYA 3G1XA 2WVVA 2OG9A 5BXRA 3BW2A 1L6WA 1PTAA 4C7GA 1PX3A 2VNCA 3H2AA 3EZ4A 4DI8A 4O57A 2DIEA 4DWSA 4YCPA 3U9IA 4C6DA 2QULA 2P3EA 3GB6A 3VFCA 4LVAA 1TR9A 4FXRA 4PUUA 1LQ2A 3MHUA 5DANA 1OZQA 2VOMA 4XZHA 2Z1BA 4J35A 2WC7A 5G4WA 5CBBA 5HJLA 1OC7A 3CQHA 1TUFA 1V3KA 1TQJA 1Z69A 3EXSA 3DDMA 4US5D 3O2LA 3EX6A 2QGYA 3SY1A 1UW9A 1FWAC 4R3UA 3TYBA 2W9MA 3RCYA 3LGEA 4JAWA 3ZR4A 3LM7A 4DWSB 3TA6A 4AYSA 2VTFA 4YHGA 5LNUA 2NXGA 1CGTA 1EFZA 4G8TA 1K02A 4R5EA 4S2BA 1D3CA 1KR0A 4GIRA 5DN1A 3R79A 5FSEC 1V3LA 4QISA 3LBOA 1PS9A 2FGZA 3AISA 2H8XA 4X2RA 3M0HA 2X7VA 3BQ5A 4F0KA 4GOAA 7ENLA 4OGZA 5D2YA 3H2CA 3GXTA 5I79A 1H5YA 1J4EA 5REQB 4HOXA 1VR6A 3HQ1A 4QJ1A 3QTPA 1GG0A 1UP0A 1DJIA 2OXNA 3L2IA 2GJXB 5LXXA 1V0NA 3HPFA 4Q33A 5DLCA 4HTBA 1REQB 4JEQA 2ZUVA 3CTTA 3QH2A 4RL3A 4I9AA 4PODA 1KXTA 4LB3A 4NJJA 2W27A 4E4PA 1BWKA 1TTIA 3TJIA 2NQHA 5AHLA 3GNNA 1VFLA 3OVQA 3W2NA 4H2HA 5CKSA 1LYXA 1C8XA 1TPEA 1UMLA 4UQEA 1DWAM 1MUCA 4DRSA 4LVDA 2DPEA 2FZMA 3C2YA 3DECA 2PDNA 2QDGA 1M04A 3H22A 4UNIA 3RCNA 5D37A 4A3YA 2WC3A 1ITUA 3SCPA 2V63A 3CIVA 4R9XA 1E71M 3ERPA 2VEFA 4XD4A 1WCGA 5HUPA 3W1AA 1B4EA 4E38A 5DY3A 1YDVA 1GJPA 4GNKB 3DFNA 4TMBA 1EB3A 4ES4A 1G4SA 2ZRVA 4UOJA 2ZX5A 4Z1CA 3A4WA 5ABFB 3VNZA 2OLHA 5TF0A 3RU6A 1NWSA 2IPGA 3LHVA 3CH0A 4MYAA 3TXZA 5E09A 1AH4A 5AHNA 2Y5SA 4BZYA 3WQVA 4IT1A 3IVTA 3U4AA 5B80A 1VLWA 3R2GA 5A69A 3GHUA 1LBMA 4JTSA 1HL2A 1CYGA 5IHRA 3LXCA 2BXZA 5CC3A 4J3ZA 2VDGA 1Q6RA 1TVNA 1UWAA 4HB7A 3W1NA 3TWBA 4ATLA 1M65A 4H7ZA 3ABRA 4MYXA 1ZNNA 3F5LA 3WIJA 2OQHA 4Q6XA 3H2NA 3GG1A 3PG8A 2GGHA 2Q6ZA 4ZE5A 1ADSA 3IJ8A 1TPH1 4NQ1A 3P8JA 4PEEA 2PB1A 4PCSA 5T9CE 1BKHA 1N8IA 4GQ0A 1EF3A 3DHPA 3TR2A 4J2PA 3BCFA 1HO4A 1KM3A 4NNCA 1TWZA 5FJRA 2DU2A 3V5FA 4GXWA 1JCJA 2CKSA 2A3EA 1GVEA 1WAWA 4DWSC 3PG9A 3RLUA 3TKFA 3UVAA 2YA0A 2E3ZA 3LCWA 3FKKA 3CUFA 3AS1A 3B0VC 4UTFA 4S3AA 3RGTA 3E2RA 3UT0A 1JXJA 1K7EA 1XM3A 3BW3A 2NQLA 3OB8A 5C7HA 3VM7A 2X1SA 4W7WA 1GCYA 3SDOA 5DRCA 2XYLA 4IMDA 2YB1A 2ZA1A 5DMLA 1Z89A 3LG3A 3W75A 4J3XA 4GKLA 2C18A 3QGAC 2JGQA 4MFEA 3H4GA 1DTUA 1Q6LA 1MXDA 4YWIA 1PVNA 1ZS2A 3QYSA 6REQB 1ZP4A 1A80A 2Y85A 1G1YA 3WEZA 2OCZA 2Z00A 4D1JA 5KMYA 1UUMA 1W17A 2O56A 2DQXA 1BWVA 4MWAE 4AD3A 5A8NA 4DNMA 3WQFA 2YXOA 3HZ3A 4WXYA 4KWSA 3TCEA 4DB7A 3MMTA 5I3IA 4P7OA 1OHLA 1W91A 3GWQA 3GU2A 2BP1A 4UQAA 2QMJA 3B03A 3KOXA 4JIEA 1JNEA 3CQIA 5TD4A 4TX6A 4FALA 1A5BA 1DKWA 3H24A 5KZDA 1C8YA 2OX1A 3BAYA 3N4FA 3PK7A 4KIRA 5CJMA 1U1HA 1UD3A 1UZHA 4Z2GA 4KCWA 2BBFA 2HJPA 1YBQB 3C52A 3WQ6A 3WJYA 4KERA 4ONVA 4KRTA 3WNLA 4ZMGA 2WSKA 4IFKA 4M82A 3KRSA 3NVDA 4UFHA 2EG8A 2WO5A 1HJXA 4RK8A 1W3LA 4C6QA 4IIDA 1EOKA 1MDRA 3DG6A 3SQMA 2YYTA 2CPUA 3IGSA 2CZVA 3B0XA 1OF6A 4OUEA 5BXPA 3TMLA 2PGRA 2ALRA 4JTLA 4MKNA 4OBRA 2DQWA 5AB3A 1MYRA 1RD6A 5F1VA 4L9ZA 1VLIA 1ZU8A 1R2TA 3QQ0A 2J7BA 4PUEA 4ALDA 4WD0A 1VS1A 5F4XA 4UOQA 4H7CA 2B7OA 1KM6A 2Y5JA 3WF1A 3T0CA 3GNPA 3A4AA 2NQ9A 4O13A 2EGZA 1KM4A 1V8EA 2E5DA 4PMZA 1J2WA 1KTBA 2EXOA 3BGJA 1TPUA 1JCMP 2DSUA 2QNEA 3VPLA 2PEVA 4M5PA 2ADAA 5DT7A 3P14A 1QNSA 3MSYA 3C0SA 4UIOA 2D2HA 3NZQA 3QR1A 1RR2A 2AL1A 3O9NA 4M81A 1SMAA 2ISVA 4NYYA 4H6EA 3RG6A 3O6CA 3PPGA 2NQJA 4H19A 1SFSA 1Q65A 4Q7BA 2BOGX 3CWOX 4MFDA 3VFLA 3LCIA 5D32A 3EWUA 5LGZA 1XQLA 1FCUA 3C5QA 4ZB5A 2WJEA 3LRMA 4H6QA 5I3JA 4C6BA 3DFQA 3P0XA 4GIEA 1TV4A 4Z2IA 3T9PA 2DSWA 5FL1A 1OX5A 2XVGA 1F8IA 4H8UA 2V82A 5HR6A 2YLLA 4JQ4A 2JF7A 1PIGA 1DJGA 2CIPA 5F1UA 2QF7A 2XSAA 3DXIA 1QOXA 1Q5MA 4K6AA 4D6IA 4TTGA 1MW2A 4I5UA 4FO4A 4M8UA 3W7QA 4TVUA 3CWHA 3VKKA 4YYCA 3W84A 3P5YA 3OG2A 4QP0A 3VNDA 1PKMA 4B5VA 4HNLA 1D7KA 2HPIA 5CC5A 3WH6A 4BQ4A 1FWRA 1WV2A 3GSMA 3D47A 1SZRA 3W71A 4KFPA 2DZWA 4OTKA 2WLYA 3M6YA 1LZOA 4RDVA 3RDKA 3CB8A 3FY1A 3CIXA 5BYWA 1QAPA 4IPPA 1A49A 5PTDA 3OLEA 1J0ZA 1LBLA 1SW7A 4HPGA 3W7JA 3Q65A 1YMYA 5D2VA 1GVOA 1V3HA 4DVOA 2PDWA 1N7KA 3MSRA 1GOMA 1KCXA 2IQ0A 3HF3A 1GVQA 1O66A 2F61A 2FPYA 5CBIA 1M41A 4EXAA 6TIMA 4ZQPA 2REQA 1GOOA 2GYIA 4UTWC 1ZSXA 3W2LA 4WQ6A 5HWMA 3BOFA 1KW1A 4IPJA 1GNXA 3EEGA 3NJ3A 2IUZA 4XIAA 3R13A 5A8QA 3W37A 1BWLA 4OHQA 2VZVA 5IHSA 4CN6A 1NWRA 4B5WA 4H8HA 1JDFA 1IZJA 2XN2A 2VRKA 3JR2A 3PF3A 3ZIZA 3C3UA 1XIGA 2ZRXA 4U31A 3M0KA 2J7EA 1UP3A 3SRKA 1EO5A 2W3ZA 3ABQA 1E73M 3RFAA 2CBVA 3E38A 4Z1YA 3RAOA 2ZX9A 1AFSA 3A3HA 2D0GA 3AXIA 4WUIA 3MU7A 3CASA 3PC0A 2J6VA 3IUDA 1DORA 5E93A 1EJSC 2SFPA 3W2UA 2R9RA