4ES4A

Crystal structure of ydiv and flhd complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
206
Chain Sequence
SDCYFLPIRDNQQVLVGVELITHQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight of a concentration-dependent mechanism by which YdiV inhibits Escherichia coli flagellum biogenesis and motility
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Putative cyclic di-GMP regulator CdgR
total genus 67
structure length 206
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4es4A00
4HU3A 3GFXA 3S83A 4KIEA 3N3TA 5MKGB 3HV8A 4Y8EA 4HJFA 4RNJA 3PFMA 5MF5A 4J40A 4F3HA 4HU4A 3PJUA 3TLQA 4AG0A 4FOUA 3KZPA 4RNIA 3GG0A 4RNHA 4Y9NA 4Q6JA 2W27A 4LYKA 5MKGA 3U2EA 3HV9A 4AFYA 4LJ3A 3SY8A 4ES4A 4Y9PA 2R6OA 3PJTA 3PJXA 3PJWA 4FOJA 4F48A 3GFYA 4Y9OA 3GFZA 4Y9MA 5M1TA 3GG1A 4RNFA 2BASA 4FOKA
chains in the Genus database with same CATH superfamily
3L2LA 1HJVA 4FP1A 5G2IA 1OC5A 4HP5A 1LLZA 2FGBA 3M0MA 1O7AA 2A6LA 2Z1VA 3HA1A 4XVDA 4JYEA 5K2ZA 3HG2A 4I3GA 4DO7A 4JKKA 3QW4B 1HJQA 2D0HA 3WSUA 1XPGA 1UJQA 3OQ8A 3VKBA 5AECA 2WMIB 3CV6A 4UNKA 5K3VA 1UWQA 4P8XA 2ZZ5A 4J3ZA 3TXVA 5KZDA 4KGJA 2ACSA 4N7QA 5LA0A 5F2MA 4QDMA 4OT7A 4NAEA 2AAAA 4NI8A 1C8QA 2GSHA 3GTIA 3CGTA 2ZWYA 5HJXA 3B97A 1HKKA 2FH8A 4NSBA 3WLNA 1EX5A 3GUWA 3DBPA 3WX7A 1HZYA 1QPRA 1XPYA 2WVVA 4Z2LA 4CN1A 3TN3A 2YOCA 2QYGA 2V3FA 3TVAA 1NP0A 5HBFA 3E1F1 4S3BA 5FSEC 1W17A 5CG0A 4Q8UA 3W7MA 2G8ZA 3S3GA 4MLRA 4O50A 3A47A 1TE6A 3GG7A 3WBWA 3UXIA 1NFPA 3OBKA 5AHFA 4D6HA 3N2BA 3IWPA 1VF8A 4CD7A 1PKLA 3W7IA 3UXKA 3EDKA 3QHOA 4ZEPA 1OGSA 2Y7EA 4NL1A 3H8AA 4N2YA 3GNRA 2E1DA 4LYKA 4Q6JA 3M6YA 1WNOA 1FWJC 1WXYA 3UWUA 1TPB1 1TELA 3R43A 3VCNA 5HA7A 3QMTA 4MZ8A 3AMLA 3IVUA 5JXQA 4AVNA 1DJXA 4C7DA 1NQKA 3MUIA 1JFHA 1TMHA 3TN5A 3VDHA 1XBYA 1H7WA 1F9CA 1XBZA 3C0LA 3P0WA 4ILSA 4DBEA 5CPTA 2R24A 5A6BD 1W1B1 1J5TA 1QI0A 2OSWA 4IP4A 1V8EA 4HTBA 4S3KA 5CPSA 1A5LC 3OVGA 1HO1A 2C16A 2D2OA 3GK0A 3AHVA 3KTSA 4JNZA 2PP1A 1ZBKA 1C9DA 2MNRA 5E6YA 2R1NA 3QBUA 3RX3A 2OB3A 4O53A 3WD2A 4JCLA 5AYBA 3W71A 5FCZA 4EPBC 1ZBVA 4NVTA 3SCRA 1ECEA 3VMOA 2J6XA 1YDYA 4LQ1A 2DT3A 5HPOA 3GUGA 4AIOA 3AS0A 5HANA 4M1RA 1YIXA 5K9CA 2WZHA 5TAOA 1VFTA 1QPQA 4AUBA 2F2KA 3WJSA 1RPXA 4OWGA 3M0JA 4NZJA 4DZAA 2CZEA 1EXPA 1G69A 2IPWA 2CLFA 4HOXA 1HJWA 3WK3A 3R4IA 4U2YA 5C55A 3STGA 2Y88A 4JKLA 1VCFA 2DW7A 2R14A 2J25A 5DRCA 1E51A 4DLMA 1JCTA 2P0IA 1FOBA 3FYOA 1FKXA 1DEDA 3LX9A 4FXSA 4LYRA 1QVBA 4TX8A 4HYVA 3SI9A 4EX4A 4CNSA 1CXIA 4NJKA 4PSPA 3HN3A 3U57A 2VQUA 1O66A 1U5JA 3R0KA 3FK4A 3NURA 4FLSA 4QR6A 1QR7A 3JZEA 2ZYFA 4JY9A 2VFIA 1QTWA 4DUVA 4HZMA 5DY3A 1VCGA 2XTKA 2ZA2A 3W2UA 4W7VA 2QDGA 3EWCA 5HUOA 3TJ4A 3SCSA 3CPGA 1EP1A 2J9ZA 3VFLA 1PIGA 3AZTA 1WBHA 5F2IA 1Z8AA 4PBEA 1YNQA 2QR6A 2XUCA 4WJ8A 5BW6A 1IR1A 2PWVA 3GIQA 4WUIA 3E0VA 5TBOA 4RLIA 2WCSA 2OLHA 1B4KA 3LCWA 2WHLA 2ZE0A 2PTWA 2ZC1A 1J18A 2F84A 3SCVA 3P7YA 5FSDC 3W83A 5A6TC 2DPEA 5I5RA 1S2TA 1YDVA 3D0CA 5XIMA 1IT0A 3CWNA 4I7UA 6XIMA 1YPXA 1BTMA 1JDAA 3DCPA 3SN0A 2CWNA 1E1FA 3EX3A 2QF7A 2NV1A 2I57A 2ZUTA 4B5TA 1A5UA 3W25A 3PAOA 5F2GA 2GZXA 4GH3A 4IPNB 2F6XA 3AZRA 3T05A 2C1GA 4EF9A 2G50A 1RZMA 4R7JA 2YL8A 3VO0A 3WCZA 4OGZA 5BWFA 4D8LA 3DFSA 1KCXA 4CKQA 2CLOA 2G3IA 4YWSA 3CZJA 3N14A 4AY8A 4JY8A 5G2HA 2WKLA 2PB1A 4DZIA 4CUCA 2ISVA 3QXBA 4FLQA 2XIQA 3VU2A 5I09A 3G1XA 2PF8A 1WDSA 4NJJA 5H8MA 3P82A 4C6CA 1F74A 3EZ4A 5ECVA 1QO2A 2Y4SA 3P84A 1OY0A 3VFCA 4PR4A 5LIKX 4QISA 2B7PA 1VFSA 3KVLA 1KM0A 4HSOA 4H6EA 3VD5A 1JUBA 3I3EA 3WFLA 4X61A 3MSYA 3SJ3A 3KRBA 1DJNA 3CL7A 2WNQA 2W9MA 5D2TA 5DT5A 3P93A 3EOLA 1T8XA 1EC7A 4N6EA 7TAAA 3W75A 1NVMA 2VURA 4XB3A 4ERGA 2IXVA 3GYCA 3ALFA 2XFRA 4D6GA 3RDKA 2A0NA 5DANA 2YKKA 4GYJA 1D8WA 3AYSA 1CLXA 4K8HA 3HMCA 4H6KA 4MZ1A 7TIMA 1JZ3A 4LV9A 3F7JA 4C6EA 3BZGA 4GG9A 2W79A 4W86A 3L5AA 2FPYA 4QBXA 3AISA 4GABA 3U2CA 1M6JA 1AW2A 3IVSA 5FAJA 2R6OA 4FX8A 3UR2A 3VABA 4E4PA 4B3KA 3RLVA 1YNPA 1REQB 1XM3A 3B4YA 1N7KA 3N04A 2ZZ6A 3V4BA 1L2UA 1XD1A 4X60A 1X98A 5XINA 1L9WA 2WOQA 1OG0A 5C9ZA 4RE4A 2OZTA 1GZGA 1BGAA 2GOKA 1S1RA 5C70A 4JQAA 3L21A 3ZR5A 4XKYB 4W93A 4DBUA 1TIMA 2QZRA 4LUTA 1K8YA 1HT6A 2OO6A 4JHMA 2NWSA 2EG6A 4YMZA 2QCGA 3CQHA 1ONWA 3I65A 3DENA 3B8TA 4JX6A 2PTDA 5KZMA 1VQTA 4IJRA 2XU2A 1TPFA 1OF8A 4E4FA 1XR2A 4PUDA 3U2EA 3U2OA 1O4UA 3NG3A 1Q65A 1QNPA 1TZZA 1HF6A 1AK5A 3ZMRA 4QJ4B 3WLSA 1B4EA 5AHIA 1B3XA 4ZE5A 2DZUA 2GSEA 3GRIA 5C8BB 1S1PA 3I68A 3MANA 3NR0A 5IXEA 3GDBA 1O95A 3NDYA 3BQ6A 3USZA 3Q65A 1A5KC 5A8PA 3BJTA 1K4HA 4K68A 2VNCA 1UQYA 3AIQA 4HN4A 4Q33A 3WD1A 2BV9A 3EGJA 4A3QA 4EOUA 2HJPA 2XPKA 1A47A 5I3HA 3PANA 3GX9A 1Q6FA 3UXLA 1G4EA 2HV5A 3GAKA 2FKPA 5CXPA 3AIRA 4HYRA 3ANUA 3BW4A 4RV3A 1F8IA 1L8PA 3VKJA 1VS1A 3APYA 2CBJA 3F2CA 4G9PA 1ISXA 3H7UA 1AQHA 3CHDA 2AQVA 3I6TA 2Z27A 4FXFA 2G96A 1IF2A 3Q4DA 3QZ6A 1BF6A 3MTWA 4Q4PA 4ZO6A 3SRKA 3O0FA 3M47A 4ASTA 4QG8A 1ZAJA 1OK4A 3BCFA 1P0NA 4OTKA 1VJSA 2YL9A 1P1XA 2PDMA 2PF0A 2XH0A 3GXTA 1J6OA 4QRNA 1Z89A 3MYOA 4YVPA 2PODA 4KKXA 2AL2A 1OHLA 2GGGA 2VCBA 1UBPC 5IOBA 3DGBA 3AIVA 2X1TA 2V69A 4N4PA 5EY5A 4MF4A 2V8ZA 4QROA 3CQKA 1BYBA 1DJZA 2BP1A 4DAIA 5I3IA 1EKOA 3WLHA 5D38A 4GINA 1UWTA 1OZQA 4J28A 1IWBA 2P10A 4IMCA 2NQJA 1GG0A 2REQA 3N34A 5D2WA 2XVKA 4PUUA 1W3NA 2PBOA 3THUA 2QJJA 1WX0A 5D9PA 8A3HA 2H9AB 4NJIA 1CENA 5EMKA 4YWIA 3HQPA 1PVNA 3G1RA 3BUVA 1WOAA 4UTFA 3MMTA 5U4NA 2DJXA 5A8GA 5CZSA 3NSXA 4M6VA 3VUPA 3QYQA 4GKLA 3FVMA 1IWAA 2Q09A 2EBNA 3H2MA 3QQ0A 4AY7A 2D2GA 2BNJA 2Y8UA 4H9UA 1FXQA 1QASA 4WSJA 1GOXA 4KEVA 3VUSA 4MNLA 4QHRA 1US2A 3DKLA 1R3WA 1C8YA 3B0XA 3KBMA 3NM1A 3URAA 1KLZA 3MUY1 2VGBA 3H53A 3ZVIA 5A69A 1V6XA 2AAMA 1ZP3A 2PS2A 3GU1A 4XTDA 4H9VA 1MYRA 1Y8BA 4XAGA 4JQ3A 2J24A 2VI0A 4NRSA 3KBJA 4WX2A 1W56A 2PURA 1AVAA 4DPPA 2YX0A 1B9BA 4IP5A 1JDEA 4IMGA 2OODA 2WANA 3CUZA 1CXFA 2ZCGA 1T41A 3O6CA 1S2CA 2ON3A 1L8NA 1KLYA 3PPHA 3F4NA 3WNKA 2A7NA 2ZUMA 3SR7A 2ZIDA 1L0PA 3KZSA 2QCDB 2YXOA 4YVXA 1IIHA 1JUEA 1XIHA 2JKAA 5H2ZA 2TODA 4UFKA 4L7ZA 1GOIA 2DZWA 5AYZA 4BQ5A 4LYQA 1UD5A 1FH7A 2VTFA 3TONA 2I9UA 3A3XA 3IGHX 3TW6A 1QBAA 1MWOA 4Z2KA 3MQTA 2X8RA 3W84A 1PPIA 2GQ9A 3T0AA 1J96A 1KR1A 2R94A 3M5ZA 3EWWA 4JHZA 3T4WA 4P7NA 5B7YA 2DIJA 2V5JA 1FWEC 3BL3A 1ZY9A 2PDUA 1HKIA 1GJPA 1XLHA 1RCOB 3TYUA 3WUFA 4GZ7A 3JS3A 3CT7A 3S2CA 4Y9PA 3N29A 4CVWA 3VOIA 4ZFCA 1DXIA 2H3BA 4C1NA 1FWHC 1W5PA 2C79A 4LUIA 3WD3A 4GE8A 4GJ1A 2R1PA 1OFPA 3RCYA 2Z25A 4UCGA 1TWSA 3LGGA 3U2ZA 3PZMA 2P76A 1K7FA 2WZMA 4ES4A 4PMNA 3R11A 1GYNA 5A94A 4JX5A 2PGWA 3NSNA 4CVUA 3WKZA 4LOCA 5G2WA 3PBUA 4QJ1A 3P6LA 3ZO9A 6REQB 3MCMA 2QJGA 1QK0A 1G01A 1YTEA 5AZ1A 1EJTC 2P3EA 5D04C 4HHLA 1RBOB 5AC8A 1A3HA 4GGHA 4GBDA 1LG2A 3DYOA 3PK7A 4GCAA 3UJEA 3AOFA 4H8HA 5FEPA 3W01A 2IMRA 4UTTC 3CPRA 3TROA 4OV9A 4ZFMA 2OGJA 4HK5A 4J4KA 3QTPA 2JALA 3GD6A 4UXDA 1BSIA 1P43A 1VIWA 4TVUA 1DWGM 1MDLA 4LVFA 2J75A 1FWGC 3VMNA 2IKJA 2VFFA 3LHUA 3HG3A 2REQB 2BODX 2NZLA 4EKJA 3NO3A 1EQPA 1CEOA 3O8AA 1IEXA 1K7XA 2ZC8A 1TPWA 3PZTA 4XD4A 5M03A 4WKHA 1ELSA 4MFEA 1E1CA 3BAJA 3UU0A 1KCKA 3VD4A 3LCFA 8RUCA 1KFKA 3UBPC 4F0SA 2QF8A 1AMKA 4GIAA 2WVVB 2B7NA 1JCJA 4P5UA 5C54A 4M56A 3W7OA 3S2MA 4N0RA 1DQXA 1NU5A 4KWVA 3UCDA 1GEQA 4BF9A 1G7VA 3GH7A 3NNTA 1NWSA 3N4FA 2V0TA 4AWUA 3PG9A 2Z6JA 4MNMA 5C9WA 3WQ6A 3VC6A 4CCDA 4IL0A 1RJRA 3QW3A 1H1YA 3DZ1A 1MNSA 3VD9A 3PNZA 4B4HA 1X6LA 5CQ1A 3S2JA 1B5TA 5F2LA 1V79A 4MLJA 2D69A 1ONRA 4KFNA 3ALGA 4KFOA 1W3KA 1I9CB 1QXLA 1K02A 2ABBA 3W76A 1KV8A 1UWRA 4TOQA 1V08A 1OCQA 2ZRXA 3BLDA 2JFEX 3WJXA 5C2CA 2WC7A 3MU7A 3VOJA 3W4RA 3MV01 1J0JA 2G0WA 1M9HA 1JYVA 4HD5A 1A4LA 1BG4A 4JTKA 2PZ0A 4RE3A 1KBIA 3ITYA 2R1KA 4BJHA 2Y8VA 1J0HA 4IG2A 4GVGA 3KFTA 3E0LA 3OLDA 4HPJA 4JQ1A 2A7RA 2JGQA 4AZIA 1VHCA 1PIIA 2I1OA 1K9TA 2TMDA 3QM3A 4F2TA 2E0PA 1LOQA 4GOAA 1FBAA 3TU9A 1Q6LA 2VZUA 3OG2A 3L4VA 5D02A 4DJDA 2E6AA 4O12A 2GJXA 3BMVA 3MVIA 1O1HA 3OQEA 3S6OA 7A3HA 2DEPA 3S9YA 2C91A 1XBXA 4ZXLA 1QBBA 2DU2A 2ZUUA 1G67A 2FQIA 3R94A 1N55A 3WEMA 2OPJA 4DX3A 4BFAA 3UA4A 2Q8LA 3TW7A 1EC9A 4EXAA 4L9XA 1W3JA 3VM7A 1Q2SA 4DXKA 2PCEA 2FB3A 3ABQA 3UESA 1R5YA 3T1GA 2WLZA 4H9XA 5HINA 2XSAA 1OFQA 3GXDA 4W8AA 3N6HA 2ZDRA 1I6NA 3KW3A 3TKFA 4ZCWA 3MHGA 2ICSA 3FDGA 4PUWA 2J62A 2XFWA 1RY0A 3ENLA 4BQ2A 1LOLA 4Q8PA 4KWOA 2D23A 5CC5A 3BOLA 1GUVA 2CITA 2ZXDA 4JNMA 3HPXA 1BRLA 4WK9A 5IFPA 4F2UA 1T8QA 2JBMA 2X2YA 4AX6A 4TXEA 2HISA 3NIYA 1H7PA 2VENA 1K7EA 1ADDA 1Q45A 3NQGA 5EKYA 2C0AA 1UH3A 4NY2A 1ZAHA 3VIIA 3IUIA 4MWAC 5E0KA 2GJRA 3SIZA 1V6TA 3SUTA 4MY1A 3FJNA 1VENA 4M8UA 2RJGA 4ML9A 4C60A 4BEQA 4A29A 2HRWA 1EUAA 4QAIA 4S3AA 4S1FA 3T09A 4AC1X 4OBTA 3PC0A 3AXXA 1LBFA 3W7PA 4MG4A 3IV3A 2CZFA 2B7QA 4LNYA 3L12A 1GT8A 4PCPA 1MNZA 4YYCA 4MAZA 3LHYA 3BJSA 2FZNA 1EO5A 3S6DA 3BW3A 2YXGA 5EFFA 3V16A 1ESWA 5D8WA 4FEZA 3VOCA 3VX0A 3BURA 4DF0A 5FJTA 2EPOA 3LHTA 4DLFA 4J35A 9CGTA 2PWFA 3H24A 1HKWA 3CU2A 4A2SA 1R3QA 3GG0A 4JTFA 2YDQA 4A2RA 4MJ2A 2GGIA 1I2RA 1W0MA 4LEFA 4UR7A 5CPLA 5HMEA 3BMXA 1E0WA 3T7VA 2QW5A 3CPUA 1DJWA 4KEZA 4C6QA 1I2QA 5TF0A 4QEHA 4Q8WA 3CMJA 1EUNA 3EEZA 4D6DA 3GZ3A 3JUGA 3PNUA 1G7UA 3HV9A 1OD0A 1ZJBA 5A8MA 1JD7A 3G1VA 3QC3A 4JDBA 2WZTA 3B0PA 4O54A 3P80A 2WMGA 5EU9A 3VVGA 4A8NA 1K4GA 3S83A 5BCAA 5A6SA 4GHRA 4B5XA 4C91A 3PAJA 1XDMA 1XLCA 4O18A 4O11A 4I9TA 1NWRA 3PWAA 3DYPA 3TQKA 5BOOA 5CPMA 1XKYA 3ZSTA 1TVNA 1RQHA 6ALDA 1EH9A 3U3HA 3H12A 2E6FA 2EPLX 5LXXA 3TJIA 1Y65A 4O16A 2DQXA 1DBTA 4U10A 2CHRA 1W8SA 1HUVA 1UP0A 5LNUA 3QRHA 2PCQA 4LUSA 1E5NA 3H26A 2HE8A 3G3MA 1MW2A 3G77A 2Y70A 4FS9A 5FF4A 2J8TA 1NF7A 3FEQA 3FKRA 4IF2A 1X8FA 3WBYA 5DQPA 1V3IA 2V2CA 2XGIA 1V7YA 3VM5A 3THDA 1EIBA 4XD6A 5DFAA 2E4TA 4GIEA 1S3HA 2XN0A 1GQKA 1W1PA 3WLKX 4KESA 2ZUWA 1JPKA 4ICCX 4DEFA 3R25A 3LCIA 3MHFA 4FO4A 4CCCA 4LBRA 3UYCA 1IGWA 1JZ7A 4Z42C 1V5XA 4MY9A 4ZXOA 4K7YA 2PDKA 4UR9A 1LWIA 2EXOA 2DSKA 4Y90A 3WFZA 2VOMA 1NP2A 3RPTA 1Q66A 5M3WA 5HNRA 3TXZA 2HZGA 2VZVA 4CEUC 3WMLA 3BWWA 4ZGYA 4IMAA 2EG7A 3LMYA 3ZLHA 1Y7VA 1SW0A 3K1DA 4JS3A 1IXPA 4RE0A 3VX1A 1NH6A 3UZJA 4RNFA 2VXNA 2EJ1A 3W1LA 2FZ8A 3W7HA 3PFMA 4YTQA 1UKSA 3WNPA 1JULA 3CS2A 2ATMA 2OZ8A 3H2NA 1UD3A 1S5WA 3L23A 2E09A 3VGFA 4XX6A 3T78A 4EIVA 3M1ZA 3B0VC 3AQUA 3H4GA 1JR1A 2X41A 2VKZG 1PB0A 1IEQA 1QWGA 1O5XA 1Z69A 4AAJA 1BVNP 3OA3A 3GWQA 5BMWA 4Q7BA 3TN6A 1HP5A 4WSKA 4L6OA 4W84A 4HNOA 3OVQA 4M80A 5HWNA 1TWIA 1UH4A 3S2NA 2GVLA 1TTIA 4D9PA 2HBXA 1P7TA 2Q3OA 5LIUX 4S3FA 1KQYA 3R0UA 2B81A 3NCOA 3OZYA 3TA6A 3SCTA 3GW3A 4O19A 4CU8A 1UD4A 4JTSA 4DF2A 3CUXA 1GCYA 2QMJA 3GHTA 4F4RA 1ISZA 1V02E 4HTYA 5HJYA 3SN4A 1F7BA 2ZRZA 3LCGA 1XW8A 2DH3A 4AH7A 4DY1A 1C90A 2DSWA 3L7RA 3GVWA 3SQMA 4Y2WA 5I03A 1WDPA 4AZGA 3LYEA 5EBAA 3K8KA 4X0NA 1CWYA 2DJLA 2NW0A 4XKMA 4JTAA 3ZJ8A 1VC4A 2L5HA 2F61A 3SGUA 3N4AA 3ATZA 2QVHA 4HVXA 4ZQPA 4FR1A 2NQZA 3BGGA 2CLHA 3RRXA 1W9PA 3WD0A 1KBBA 1TRDA 4C6DA 4E0CA 1MMFA 4FHAA 4XZ9A 3QGKC 4GNJA 4J2PA 2IPJA 1B54A 1J0IA 3MI2A 5EFDA 3W7CA 1F4HA 3QPZA 2NSXA 3FYPA 4RL3A 1DXEA 1RH9A 3VOGA 3FW6A 1XXXA 4IFKA 3W1AA 4IH3A 4B2DD 3CL6A 2EPNA 1XLLA 4RJEA 3HGRA 2PUZA 4XAYA 1SM9A 1XRVA 2OGYA 4DJFC 1QMLA 3KWSA 4N42A 1Q5MA 3AUOA 5DCBA 3KHJA 3KX6A 4YS1A 3TC6A 3ANYA 1GKRA 4TTUA 2ADAA 3B8IA 3G0SA 3C86A 2PTYA 1MXDA 1H61A 1M5WA 3LNMA 3OA5A 1E40A 1RBAA 4QNEA 2RDUA 4AD0A 3NYZA 3BGJA 3NL3A 2CNCA 1PL9A 6A3HA 1EX1A 4C5YA 4C5ZA 2YZRA 5FL1A 3RLUA 5D05A 1TPUA 4UQBA 5J8LA 4ZQCA 4ICMA 3R79A 3TK7A 3M7WA 3WQ4A 4C6KA 1DJIA 4AYSA 5E0FA 4IQDA 1K3UA 1BHGA 3CK5A 3WUEA 1IEVA 2CKRA 1TYGA 4YVVA 1EYWA 3FKKA 4NAEB 3N9RA 3E2QA 1YX1A 1RQEA 3BAWA 3WNOA 4KH2A 4GUHA 3NQAA 2EHHA 1HKVA 3WUGA 5A6JA 5D03A 4Z1BA 1DJYA 5ABGA 1L6YA 1T6MA 5D8ZA 5G1TA 2PDLA 1LRQA 1JNEA 1CTNA 3IK2A 2X1IA 2GLKA 1YLVA 2JF6A 3F4VA 3MSRA 3LG3A 3S47A 3WBEA 4L1GA 1U33A 3U5YA 4D2JA 2ZX9A 1L6WA 2BSLA 5LHFA 1AW5A 1PHQA 2W0UA 1SGJA 3EXRA 3G1YA 4IFOA 5BXPA 3F2BA 3WLJA 4IIGA 1P6BA 1H09A 4YIWA 3NAVA 3LOTA 3UG8A 1EEPA 2FVMA 4YTUA 3LPFA 4AYGA 2QMKA 3M0VA 3CBWA 3W1XA 3WK2A 3MCOA 3WO8A 5MHBA 5AYXA 3ARTA 1OM0A 1X96A 2DP3A 1XLFA 4Q8MA 3N2XA 2OKOA 4RZBA 1UKOA 4HU0A 1FHVA 1UW9A 1A53A 1SJCA 4U5KA 1F05A 1E3XA 1VD6A 4GI8A 4KIEA 2NT1A 4FNUA 4L5ZA 2VMFA 2JEPA 1XLBA 3ARUA 4PL2A 3A13A 3N2OA 3N2TA 2ZXQA 4H9ZA 4AXKA 3UVIA 4PMOA 4FALA 1KKOA 4RPPA 4H7ZA 2H9AA 1THFD 3HG4A 3U4AA 2I5QA 3A4AA 2E67A 1R2SA 3LRMA 3U8GA 3PY2A 3OHIA 4C1KA 5DMNA 4NIRA 3C0QA 4K37A 5GNZA 5DX7A 4XO7A 3WF2A 1XL9A 2I9EA 5GJNA 2HNHA 2ZBTA 1MVYA 3W24A 2I56A 4IJBA 2XM1A 4UFMA 3IUHA 5I3KA 4AHOA 1Z9AA 1E1CB 3W26A 3P67A 4B9YA 1VCVA 4MB1A 3IS4A 4FLRA 3BAIA 4J27A 4K3ZA 5CC7A 4PUKA 2E8ZA 3C2FA 2XVLA 1X8CA 3B9OA 3NGFA 3S42A 1BYDA 3W73A 3CZ8A 3V18A 4K39A 5D2YA 1XDLA 2KAUC 1J11A 2YZ5A 1Q6OA 1UG6A 5CCZA 1LUCB 1Q6GA 5I3JA 5JH2A 2DW6A 4AMCA 4Z1AA 2FMOA 1EOMA 3NQ6A 4Z1DA 1JZ2A 3EDJA 1GHRA 1R47A 4LS0A 4R85A 1Q6EA 3EYPA 4C6NA 4GYKA 4MPKA 4DBSA 4KEUA 3B03A 3WELA 4AIEA 3USBA 4MHBA 3ZYZA 5ABTA 3Q58A 3NDOA 4B2DA 1GOKA 3PZ9A 2WHJA 4GO9A 2IS7A 2YCLA 4WVXA 4DWSA 1XV8A 2BGQA 3I6RA 3RPDA 3TTYA 4E2OA 3C3NA 3AAMA 4IXHA 1RA5A 3GTHA 2J7BA 3EMQA 2PGRA 1UC5A 3LV6A 2ZZ4A 1F73A 3W72A 1XIDA 1H3GA 3A22A 5G5IA 4H83A 3FN9A 3VIPA 2WC3A 3CNYA 8TIMA 4AW7A 1M7OA 4B91A 3CYVA 5CG7A 1JPDX 1VGAA 1S2VA 1O6IA 1R87A 4NASA 4NZ5A 3G24A 1J9YA 3NPVA 1PS9A 4P61A 4YTRA 3LCHA 3W2LA 3UFYA 3GW0A 2VFHA 4UTMA 1XJBA 4PRWA 4AMAA 2F7FA 3M0YA 5KZEA 1HFBA 1V0LA 4NXKA 4MADA 3TJXA 2ZA3A 3L2IA 2V5BA 5CPQA 4M0XA 4M29A 1JG9A 3STCA 3WNLA 4LUYA 2TSYA 4R33A 3EWUA 1GONA 4GUIA 4NILA 1Y5XA 5BOEA 2V3DA 2G3FA 2Y6ZA 4TUFA 1R2TA 3C56A 2YB1A 4MGGA 3DHPA 3LHZA 5FJUA 1K9FA 3UWZA 3EOSA 3WEOA 1Q8AA 4IJCA 3UW6A 1E0XA 3R7MA 3UERA 4FNQA 2X1SA 3LGEA 4J3WA 3WJYA 3OIHA 2CXGA 4FIRA 3PBMA 4JIIX 4CNNA 1FWNA 2V30A 4FSAA 4F9DA 2OEKA 1V93A 4AWSA 4P7OA 2I5GA 1XLDA 3VGGA 4LS2A 3KP1A 3D6NA 4E8CA 3PS7A 4PCTA 3LA4A 4U4MA 3VE7A 4OJYA 2WJZA 3R8GA 2QIWA 4DIAA 1KGXA 4HPNA 1WXZA 3O7UA 4IP7A 4NJHA 5H6HA 3SUWA 5A2BA 4TX9A 2CLKA 2Z6IA 3F4WA 1H63A 4ALDA 2AKMA 4C1LA 3DEQA 2C0HA 4A3YA 3L4WA 2EPHA 1ME9A 3WG6A 2BOGX 4UZSA 3WLLA 1MW1A 2VVSA 4HT3A 1D7KA 3SSZA 2JEQA 2UV8G 1MO0A 2D22A 5JVLA 2WNWA 1HNYA 4XG1A 2V5DA 3TTQA 3RX4A 4GXPA 4J7RA 4LEQA 3A5FA 4OU1A 3EDFA 4ACZB 1UKQA 5FJIA 3W28A 1TIWA 4PMZA 4BY3A 4LB4A 5FJOA 4NAFB 4ZTYA 2QUVA 3QF0A 1QOXA 3PN8A 3CZKA 1P0KA 2OKTA 4ZOEA 2D2HA 3SY1A 3VNIA 4JTQA 3C2YA 2DY3A 5D9MA 1HP4A 4GFSA 4KRTA 5JBFA 2WMKA 4ERAA 2DFAA 1PO9A 1GQNA 2J8FA 5FKYA 4O52A 4F48A 1CGYA 1RQBA 3QSTA 5D33A 2NQ9A 4ROPA 4O10A 5I06A 2BOEX 2X05A 1J5SA 1C8XA 4C90A 2PLMA 2PP0A 1PTGA 2E1WA 3PB2A 1W3TA 1XC6A 3IUDA 3S6TA 2R1MA 3NFUA 4Y9AA 1KXVA 3ID7A 4WDXA 1YHTA 4H8UA 2D3NA 4C65A 3GXMA 1S3TC 2XDFA 3XINA 1EF2A 4RUBA 1PIFA 3SCWA 1ALDA 3N15A 3ZR6A 4MUPA 1Z44A 1XIJA 3UEQA 2AQWA 2DORA 4GQBA 1SO4A 3M9YA 1OX4A 1PTAA 5EL1A 1TTQA 4PMXA 1GNXA 4IPPA 3NQBA 3W6MA 3DUGA 2W6RA 1AG1O 3EB3A 1XUZA 3KL5A 3WL0A 3OYXA 1Q4WA 3EB4A 4Q8NA 2EKGA 4CQCA 2X1RA 3MPGA 4PRTA 1K6WA 5LIXX 1H1NA 4GI9A 5FF3A 1DJGA 5A3HA 1RXOB 2QUTA 1TV5A 1UUMA 3L65A 1A0EA 3SGGA 4AF0B 1F76A 3W9ZA 3RUBL 1Q7ZA 3K46A 3PBVA 3T8LA 1ZGDA 3G1FA 3ORWA 5JBEA 5LGXA 1YXCA 3PSVA 1F4AA 2OEJA 3II1A 4GQGA 3UETA 1CLVA 4QJ5B 1VEPA 3EAUA 5U7SA 3FA5A 2AL2B 2BVYA 1F3TA 1SW7A 2IPGA 5JMUA 3NZPA 1XLAA 4Q8TA 3G1HA 3OZOA 3BLIA 1ZHAA 5SWUA 1T0OA 3FSTA 1W1ZA 1A3XA 4IUOA 4QE1A 4DHGA 5HQMA 2C1IA 4CD4A 4NU7A 3E6EA 3ZVHB 3VIJA 5G4EA 3B0UX 2V5KA 1BWKA 3G1SA 4DJEC 3PBWA 4G2DA 3TQPA 5CBJA 4AWEA 2BTMA 4XK2A 2O4QA 5CC3A 1XD0A 1SU5A 2AQOA 3UF9A 4QM1A 3GFZA 4DM2A 5F7UA 2ZWZA 3BK0A 3R1ZA 3M5YA 2GWGA 5K9XA 3IJ8A 3ZT5A 4I8YA 5B7ZA 2H8ZA 1Q3NA 3C2EA 4NYUA 3R5EA 1KRMA 3KDOA 3AYTA 4JFVA 2JKEA 4ZENA 1RLCL 4LH8A 3R8RA 4S3DA 4PUMA 2ZZ2A 2RGMA 2XH4A 3O2LA 1ZUAX 2PFHA 1KM6A 4TIMA 3G6LA 4CU7A 4FB7A 3FX4A 2ISSA 3VKCA 4ZSTA 1I2NA 3KBVA 2DIEA 1JUKA 3MDUA 3Q37A 4YU1A 1E9IA 5LNRA 3R8HA 1M68A 4WD0A 4AD1A 1W5NA 1UP3A 1O60A 2Q01A 4W4QA 5HWMA 5EMLA 2OWWA 4O1CA 1AH3A 4JIQA 1EOKA 2B0MA 1OFRA 3H23A 4PBFA 1CDGA 3NQEA 3LS9A 4Q4OA 1SSDA 1FDJA 5CPNA 4O1AA 3UD6A 4HU8A 4ADUA 1SVDA 2PU1A 1JCXA 1W1TA 1XLJA 3BLPX 3DKJA 2CZVA 3PUOA 3T2QA 5KSWA 4YTSA 4AD5A 1UR3M 1QATA 2WM0A 1VFOA 5EMJA 3VNMA 2X0HA 4D6JA 4IUGA 2XZ7A 3EKLA 3OGVA 4PYSA 3F03K 1IQ8A 3UG4A 3P74A 4CD6A 3Q67A 4L4LA 3V1PA 3OBEA 1E6RA 3O6AA 4X22A 4QDWA 1QWKA 4WDTA 3TNOA 3CIXA 4H7CA 1Q8JA 2WSQA 4R27A 2Y5EA 2Z2AA 4QG9A 5CC6A 1S39A 3C0SA 3KM8A 1US0A 3K8LA 1H5YA 1PEZA 1KFBA 2O9RA 3URBA 1VKFA 3ARQA 1LORA 5HQEA 1EZ2A 3SAZA 3GTXA 1OFOA 3N13A 3QZEA 3LD5A 4PMUA 3T8QA 2MANA 1ZJIA 3HPSA 5D9NA 5M17A 3VIOA 1VYPX 3H2EA 4ZB5A 4WGXA 3ZQ9A 3VDCA 1OX4B 4HNCA 4H41A 4UC5A 3RM4A 3ZLFA 3K8MA 3ABOA 3M0IA 4S3EA 3GHUA 2TYSA 2TAAA 3WQOA 3M0XA 4QCFA 4XVEA 1R86A 4DRSA 1MSSA 3RYSA 4XD5A 3J7HA 4Z2GA 3NQFA 4ERIA 4JTEA 1GQLA 1OC6A 2FDSA 2O4MA 4OHQA 4RKAA 1KCLA 2POZA 3KOFA 1JL8A 3WLOA 3LZ3A 2BMBA 3EWZA 3DIPA 3MVTA 1GJWA 3N3TA 4PTDA 1T40A 3SN1A 4UWMA 2Z4GA 1IZKA 1G4TA 1Z3NA 3CHVA 3DN5A 3NPUA 4FNTA 4CQBA 2OCZA 3NA8A 2ZICA 2E5CA 4WKAA 1IYXA 2E5DA 3R58A 3UZYA 1JEZA 2BASA 1ZL1A 2QJHA 2WVUA 5HQLA 3MUAA 3VD7A 1XYAA 1B3WA 4JZ5A 4NXSA 2W4XA 3RIKA 4IIDA 1GVQA 2NV2A 5ECUA 1O94A 4BHYA 1LF1A 3B9NA 1SZNA 4CQ8A 1W1A1 2EKCA 9XIMA 1KV5A 1H62A 2RHGA 2HDJA 1KM4A 3MSGA 3GDRA 1R2RA 2IKIA 4W7WA 2CW6A 5E6ZA 3GZAA 4XZLX 5KITA 4J3UA 4UOJA 2ASHA 3WL1A 4PCSA 4IIBA 2Q02A 1EYEA 1EEXA 3C3UA 4UFLA 1XCWA 4MB5A 2YFOA 2DUXA 4HJWA 1W32A 5DXXA 1QI5A 2CETA 3WH6A 3FGCB 2F6UA 4GPNA 2FYMA 5BZAA 2WLYA 3ARVA 1JNDA 1LWHA 3D5HA 3MWAA 3QV8A 2Z28A 4GX9A 1UD2A 5G1YA 2DZSA 3P14A 3HURA 4F3HA 1J4EA 2C71A 3O15A 3W53A 3ANVA 3WMSA 4AFYA 4I5RA 1VPQA 3V0UA 2V63A 2F38A 1IEWA 2GQ3A 4C6LA 3B9AA 4PCFA 3CUIA 1SO3A 1SMAA 4GZJA 4ADSA 1JDDA 1XLMA 2ZE3A 1P5BA 3E0WA 3NL6A 3P5ZA 2CLIA 4AG0A 1LTDA 1EJVC 4JTJA 2DSVA 2FZMA 1TCDA 1N8IA 3RJXA 4GZEA 5AYIA 5BXSA 2WW5A 3VZZA 3AC0A 3KTCA 4YJ5A 1PCKA 1ZZMA 1GW9A 4YPJA 1AJZA 2J9YA 4R7OA 2PGFA 1PDYA 3LB0A 3TX9A 2V38A 2ZX8A 3VNJA 3WLRA 1DIDA 2A3EA 2VO5A 4HMNA 1R0MA 7CGTA 4REQB 1L6SA 3DOPA 2ZDSA 1BVWA 1KTNA 2VC5A 1EJ7L 1R85A 2C15A 1BQCA 4HU3A 4H2CA 6TIMA 2A7PA 2ZZ7A 3AYVA 2HXTA 3NUKA 1HL2A 3K30A 2GK1B 3U48A 1A3WA 1SYTA 1SUXA 2WHMA 3GVVA 1DTNA 2EO7A 3AMKA 4ACYA 3O3RA 1IT8A 1O12A 3RF9A 3LPGA 1LBLA 2UY2A 3GNXA 3O9NA 3H7VA 3V1HA 4O57A 3DXIA 3I7RA 1YKWA 3PB0A 2W3ZA 1PWLA 3QKZA 2QEZA 2Z1XA 3UXDA 2Q8XA 4DUXA 1JQVA 1ZQ5A 3UR5A 2BY1A 4BF5A 3HJZA 1CX9A 4RXGA 2Z7GA 2ZOXA 5AYYA 3HMJG 1QFEA 2NT0A 2PDGA 3AXIA 3PBYA 4X9SA 2V6AA 4GX8A 4YLWA 2QQ6A 3RILA 3N19B 3H22A 4Q4KA 4DWSB 4Q32A 1QHZA 4ZO9A 3MMUA 1OFEA 1AQFA 3BMWA 3W7DA 2FGLA 2ATSA 3WLIA 3NZQA 3GHRA 4LGXA 1YYAA 3W70A 3YPIA 3E12A 5CBIA 4XTIA 3FA3A 2XGBA 3CASA 3EMZA 3EDDA 3TZNA 3DDMA 1JRCA 4Z2IA 3WQ5A 3KBNA 2GGJA 4FA3A 3S5OA 1OQFA 4P7LA 2HROA 3I10A 1NDVA 2E9MA 4DELA 1E6QM 2C3ZA 1HKJA 1OJXA 2JIWA 3GU2A 4L56A 4ZO7A 1JF6A 3IIVA 3GG1A 3T0CA 5A5WA 2PDIA 4QIUA 5AY7A 1XBVA 2PWDA 1ITXA 1FDYA 5TD4A 2CFFA 1BTCA 4O8RA 3WIJA 1PZ0A 3QLLA 1DTUA 4ZO8A 5A6LA 1RY8A 4ATWA 2YCIX 2NLIA 1JVNA 2XIOA 3UZZA 1Y5VA 1XYZA 1R3VA 1D8CA 5AHNA 1JZ5A 3PUGA 3PZUA 1PXGA 3BG9A 5D2VA 3ONCA 3G0UA 2Y7FA 2QPXA 3W6LA 1W8GA 4XAZA 3W82A 4GISA 3LV5A 6CGTA 4DJED 4AEOA 4NZ1A 1WKFA 1EDTA 1QW8A 3PPCA 3NOEA 3SO7A 4HOZA 2QULA 5CPOA 1WDRA 1XC4A 1EGZA 5FACA 1AZ2A 1LQ0A 1XP3A 3LGDA 1KFJA 2GVGA 1O1ZA 3OW1A 4TX6A 4UTLA 2YCJA 1UPMB 2VRJA 3A64A 4DQWA 3JR2A 1K70A 4R9XA 4UOQA 3TH6A 4DWDA 2P3ZA 3G18A 1C3FA 3CZGA 4HU4A 2LLEA 3W22A 2BHZA 3FSUA 3N12A 3UZ5A 1WBJA 3K4AA 3CIWA 2VZTA 4DJDD 4GFIA 2WBKA 3NQ7A 4KCWA 3WQ8A 5FOOA 4XAFA 2H6RA 4BEUA 4Y9MA 4A3RA 1VEMA 2NX3A 3QMSA 2DSZA 3W2NA 3OIXA 4HIBA 1OT1A 1XSJA 5CEWA 3GU9A 3XISA 3N9KA 3ZOAA 4J1OA 4Y96A 4O8AA 1KNWA 2BZNA 3POHA 4GD0A 4GY0A 2V9DA 4HPGA 5HMDA 1LUCA 3IGSA 3L0KA 1TV7A 2IW0A 2PSNA 2WCGA 2DVXA 2PDCA 3S5SA 5CZTA 2NX1A 2CZ5A 3BZJA 3MP5A 3DERA 5LGZA 4EPEC 1QPNA 4DJFD 1V77A 3UY8A 1ADSA 2R1LA 2CXEA 1E4NA 4DBDA 3O0KA 3LN3A 5BRQA 3AJXA 2Z0IA 1ITUA 1KD0A 3P0XA 1O5QA 2OG9A 1H7OA 4HHMA 5LNWA 3S1VA 1XG3A 1UOKA 1JAEA 1XLKA 1CXHA 3A5VA 4JKMA 3ES7A 4W7UA 2OQYA 3QQWA 2PTZA 3LUTA 3T44A 3W1TA 3ARZA 1ICQA 4UQEA 4XZIA 1VFUA 1EZWA 3W7EA 1ECQA 3NQ8A 4PTNA 4XZNX 2EPKX 5A6KA 4F9JA 1OABA 2HXUA 1KR0A 1K9EA 1U1JA 2VL4A 1WZMA 2XVGA 4CQDA 1FRBA 4FIQA 4DYJA 1UUOA 1IXQA 2E25A 1A80A 4D1JA 1ZENA 3KVMA 5LZLA 3DAQA 3C2OA 2Q3RA 2NXIA 5HUPA 3G5EA 4J3SA 4DNMA 2F6KA 3D3FA 4KS0A 3I7QA 1W9XA 3EB2A 1KXQA 4ADTA 3EX4A 3VDBA 1H1ZA 4IGMA 4U5IA 3C2VA 1SZGA 1QRQA 1J6PA 1A5BA 2NVCA 3N2MA 3V35A 2F2HA 3NVTA 5AZ0A 1I0BA 3B8UA 1PE1A 4AXNA 3MYPA 1RCQA 2V82A 3DX5A 4QS5A 1ZLPA 5K7JA 1UQZA 3NL5A 4JBRA 2DDXA 3RXZA 2J9XA 1TWDA 1A50A 3NO1A 5BXRA 3O6YX 3VI2A 2VDHA 4NF7A 4AD2A 3SZ8A 1PDZA 2KX9A 5A2CA 3WFAA 3BE7A 3AWNA 3EWDA 4DZHA 3VE9A 4XISA 3LSCA 4M1BA 3PTDA 3GXNA 4AB4A 3GIYA 3LPOA 3FV9A 1HJSA 2VC7A 1G6CA 4F0KA 3VAVA 2QPUA 2YPIA 4GVIA 4K8EA 4YTTA 4FNRA 3ZWTA 4ZTXA 1VR6A 3DESA 2RDWA 3VIHA 1NEYA 3ITGA 3VOHA 2XZ9A 2V68A 1C7SA 3LBCA 4A4AA 2ZFAA 3SY8A 1VZWA 4DUWA 4RXFA 2DVUA 3RM8A 2NXHA 1HN1A 1FWRA 2Y62A 1EQCA 3QGAC 2VDIA 3STFA 4Z2HA 4HHHA 3GY1A 2Q6ZA 3EX2A 1XH1A 1IXNA 3CUJA 4MAVA 1NFGA 4BI6A 3SCOA 5J04A 4LUTB 1E6NA 5CAKA 3M0LA 3HFTA 3T2PA 4OUIA 3UJ2A 3HGOA 1VJIA 2WSKA 3CV1A 3VA8A 4QEEA 5CJNA 2FH6A 3A23A 1CB7B 3AMDA 4C6MA 2Z24A 2XH7A 4XV0A 3HGSA 1EPVA 2BLEA 2WSPA 3PJXA 3F1QA 1JPIA 5CLWA 2UY4A 2VEPA 4GGBA 3GNPA 5C2XA 5JIPA 2CESA 1R3RA 3W2JA 1JXJA 3UJRA 3HQOA 2GQ8A 4MWAD 3QVQA 3GC2A 4JTCA 1GGOA 5GPRA 1VFMA 3CH9A 4O14A 2XIIA 1XRTA 1ZJHA 3SRFA 5F1UA 3ZSSA 1TPC1 4WGHA 4N9EA 1CGXA 2OQLA 4PL1A 2YYUA 3WQPA 3UP8A 4UBPC 4J40A 5HR7A 2GDQA 2ODOA 3NEHA 5F4SA 3W00A 1BG9A 1RJPA 2BVWA 4AY1A 2HE5A 5I07A 1KCZA 4H7VA 1B3OA 5DRIA 1LT8A 4AD3A 4DYEA 2XVPA 1LCOA 3RMJA 4NYYA 1I60A 1PKNA 2PDXA 5CGQA 2I5IA 5A6BA 1B30A 4XIAA 5CJ5A 2G4FA 1C93A 2ZRUA 3HZ3A 2P5NA 2AKZA 3IK4A 5HK4A 3B9DA 1K77A 3KDNA 4MOZA 3GYEA 1FWWA 2OR2A 2C14A 5C9RA 3EOUA 4RZ6A 4K7VA 1Q13A 1NF0A 4GIYA 4RZ4A 3FXYA 1J10A 4FXJA 2C1HA 3ZS4A 3OZPA 1I1WA 5HULA 1JRBA 1ISYA 1V6VA 1KM5A 3N6QA 5E09A 3NSMA 1XHGA 1M65A 3E3HA 1ONXA 1G9HA 1EA0A 4K1WA 2PLJA 3G8EA 3QJAA 2QS8A 3QPYA 4KCTA 2PZNA 3I4EA 3VGEA 1H0IA 3WN6A 1PYMA 2BBFA 2VM8A 3CAVA 5DN1A 3F4DA 5EMYA 4JYDA 3MKVA 2F9RA 4IX0A 4H4IA 3STPA 4HYWA 2BX7A 1UP2A 2ZTKA 2PDQA 1V3LA 4D6CA 3WDHA 4JICA 2VC9A 1LBMA 3QV9A 1U83A 1FDZA 2GDVA 2A2IA 2ZRWA 4I5UA 1KBKA 3S1UA 2A4AA 4IG2B 1EHNA 3GR8A 2ESCA 2E77A 4PSRA 3S9ZA 3QY8A 4AD4A 3W74A 1I8JA 1E3ZA 4C6BA 2Y8KA 4N4QA 3BO9A 1FWFC 3F5JA 1NTHA 2C8NA 3K5XA 4FNSA 3N73A 4LVBA 3UA3A 1K1DA 1MUCA 4IMDA 3BLFA 3AS2A 4GJIA 5A8QA 3K4DA 3OB8A 4L9YA 3T42A 4A6GA 1XINA 1F5ZA 3GVGA 2QCDA 2FDMA 3MHUA 4Q22A 4PUNA 5CSSA 4M6QA 3S5NA 4KQNA 3ARWA 3GXIA 1GYLA 4NT0A 5HXMA 4AZCA 4OE7A 4WDWA 2VZOA 4D72A 1VFHA 2CERA 3HTWA 3IJIA 1XCXA 3M46A 1CYGA 3LLFA 1E1EA 1UR0A 4LBSA 4LVGA 3UPWA 4KRUA 1YPIA 4DB7A 4JXCA 1E56A 1HKMA 1GOQA 3BAKA 3V0TA 4DYKA 1ICPA 3PG8A 3NPXA 2NX9A 4JOMA 3HF3A 4UUIA 2WVTA 5JUVA 4Z17A 5AOUA 3NJ3A 3VNZA 4H3DA 4JN7A 2QT3A 1IHIA 2OYLA 4BR1A 1DWIM 2QGHA 3H21A 4H01A 2JF7A 4RDVA 3LI1A 3V5FA 4V33A 3BLLA 5L6UA 1FWSA 1R3YA 5EB8A 1EF3A 1CI1A 2VUNA 1P7TB 2IPFA 1UKPA 3KCOA 1TMQA 4EPKA 3A12A 3HPZA 4R7WA 1VP5A 1UCWA 3GFYA 3T40A 3I6EA 3LCXA 4IMEA 1T96A 3UNDA 3W23A 2D20A 2FJKA 4P7QA 3GHSA 4QE5A 2W63A 2RJHA 4PUEA 1HJXA 3ES8A 1K8CA 2O9TA 2PPGA 3B3DA 1DP0A 4YYFA 3IIXA 1TVPA 4PFMA 3AU2A 3TFXA 3AWOA 4DUOA 1GPWA 2V2DA 4UOZA 4IPIA 3N4EA 4MKSA 1GOMA 4HA4A 1CGWA 4TVCA 3LEPA 1RVGA 4EWND 1BLIA 3TCSA 3QV7A 1ZFJA 3C8FA 3PZVA 1TJ2A 3LPPA 3ZT6A 4W8BA 2VT0A 5AHEA 1QOPA 3NO5A 2HTMA 3TYAA 4N9CA 2Y85A 3LBMA 1DWHM 3QFEA 4JQ4A 4JCMA 2X16A 3T55A 3CAKA 3IANA 5LHEA 1IE7C 4H9YA 3B8DA 3S1GA 4CNUA 4IT1A 1DE5A 4IOTA 1QU4A 2QAPA 1JDCA 2OO0A 2HNEA 1OFAA 1IT7A 4I6VA 4HCDA 1HO4A 3M6DA 5GJMA 3UJSA 1PHWA 3DG6A 5HMSA 3CM4A 3GM8A 4FPSA 4DXVA 2OWXA 1I0DA 4NHVA 3QLDA 1JD9A 5HNTA 5I77A 1J93A 1BAGA 1MEHA 3E96A 3LSBA 3TN4A 2BOFX 3NVDA 2YR1A 2R82A 4TMBA 2ACRA 3DYMA 2V3EA 1E9YB 4PEKA 4DI9A 1F6KA 1DKWA 2YCLB 5LA2A 1KM3A 1CXEA 3RX2A 1XICA 1PYFA 3RCNA 2W62A 2GGEA 4XIMA 5HMFA 5I00A 4LJ3A 4MWAA 1PZ2A 2JK2A 4MMWA 3LMZA 3ZLGA 1T7LA 3W1RA 3GXPA 1H2JA 3LTYA 3QGVA 2YDRA 3WYZA 3W38A 4GYPA 4S38A 4DF1A 3N11A 5JH1A 3V5OA 4PTWA 3BG3A 2I14A 3R0DA 4F8XA 3ABSA 4LUJA 4GQRA 4HPHA 1KGUA 3E74A 2NQ5A 4J3TA 1N2VA 4S2BA 4LVDA 2YA2A 1EPXA 1FFQA 3OPSA 4AEFA 3F2DA 3TWAA 4WIWA 1JXKA 3PM6A 5DO8A 4WLCA 4WOZA 1JDFA 1IWPA 4HNUA 1AH4A 3R2GA 3E0FA 2Y61A 3TOPA 4MY8A 3WQGA 4PMYA 1M41A 2ZXBA 3WK0A 1ZP4A 1WAUA 1XYFA 2CZDA 2PP3A 4PULA 3UWWA 2Z1BA 4NX0A 3MWCA 1MQPA 1YBQA 2J7GA 5DCEA 4LTSA 1TCMA 1OFDA 1L2QA 3TAOA 4PE8A 2ZX7A 3WNMA 3WK1A 3LLDA 4NG3A 4L1WA 4ZSUA 2GJXB 4AQLA 2A1YA 1MQQA 2WBGA 4JIHA 2EF9A 3IEBA 4LWWA 3N2CA 3RGTA 1SFSA 3FHQA 2NQHA 2GWNA 5CKSA 2HS8A 4BZYA 1MI3A 4L80A 5FJPA 1NELA 3KTXA 4WY0F 2YCEA 4MNJA 1C7TA 3ARRA 5D4YA 3U4FA 1S2WA 5H8UA 2IXUA 4PTVA 2NSOA 2CYGA 2O0TA 2ZX6A 3UG5A 4WOQA 2WSRA 1EJXC 3AHYA 4W89A 1AL8A 4G8TA 2BY0A 3ABRA 4DWSD 3O07A 2QDEA 4P2VA 1FHLA 3K4WA 4PUJA 2E3ZA 3AUJA 4F66A 2YLAA 1FWAC 4HMCA 3O1NA 4OECA 1WZLA 1KRCC 2PA6A 3VZYA 2D3LA 3C6CA 3GSMA 1UD6A 1W3HA 3UWQA 4FOKA 3XIMA 3VNDA 1QHPA 1VJZA 3TLLA 3PUEA 4F0HA 3ELFA 1JI1A 2FB2A 2Y24A 3U7VA 3EA3A 3BANA 2A3AA 3EWYA 1A5SA 2BXZA 3APGA 3FVDA 4XUYA 3IJQA 3TAKA 1ME7A 4JD4A 1R46A 1D3CA 4LUSB 2Z29A 1ZPTA 2GUUA 4URIA 1JGMA 4M19A 1WDWA 2VR2A 1UPPA 2XH2A 4UNIA 2JKPA 2DT1A 2O56A 1DXFA 2WKGA 4V27A 2OYKA 2OU4A 4B3ZA 5FA5A 4DWSC 4D8AA 2CHOA 1TQXA 3H2CA 4HB7A 4OUEA 2G95A 3ITTA 4FMVA 1RK5A 3CUHA 4PBGA 4S3CA 4CNTA 3M0ZA 2E28A 3L0GA 2TRSA 2ZADA 4JN8A 1ZRQA 1V6YA 4QSFA 3DG3A 2ANUA 4JTGA 5AHLA 1W91A 1H0GA 4L9ZA 1P48A 3WLTA 2Q8ZA 1CXLA 5MKGB 1B90A 2YIHA 1K8XA 3HO8A 3NZRA 1H51A 4TV6A 2QJMA 1DORA 5D09A 2WXDM 3MUZ1 1IZCA 1HW6A 3A24A 4ORMA 1TJ0A 1AMYA 3PJWA 1CGUA 5DEZA 2AGKA 4FI4A 3F5LA 3U5UA 4BWLA 4HOWA 2XJ7A 3ZFHA 3W1QA 3ICJA 1BGGA 3O16A 4ZQRA 4HN8A 1I4NA 3WLPA 1GYMA 1UR2A 1XSIA 2I16A 2VWTA 4CGTA 3ZZ1A 3KXQA 1MEIA 1AUSL 2RUSA 3CL8A 4AX7A 1LDCA 4RPQA 4AZHA 2IKHA 3CLMA 4Q8VA 3W1PA 4AHQA 1YE4A 2NVAA 5FF0A 2VX5A 1IZJA 5HAOA 1Y5WA 4O15A 4YN5A 1SQ7A 1TB3A 1GTHA 1PKYA 3LU2A 3VNKA 3T0TA 3G1AA 5AVHA 2ZUVA 1W6TA 4N9DA 4IGNA 4JNYA 4HBKA 1LRNA 2ZRVA 4QQUA 5I79A 4C1NB 2POTA 1V0NA 3GC5A 4B5VA 4MKNA 3DI0A 1O5RA 2B7OA 1TX2A 2VX6A 1ODZA 1GZJA 4GQQA 1TWWA 2WMHA 1W9UA 2O92A 3CO4A 1OSEA 3RR4A 5E93A 1BF2A 5F4WA 4YXGA 5E0CA 2NUWA 6ENLA 5HNUA 1DWJM 4PB3A 3AICA 4JTLA 3SRDA 2GDUA 3BCJA 5DMYA 4FOJA 3GG8A 4TQTA 3C61A 1AQ0A 3PTQA 3AS3A 1TX0A 1GTEA 3DG7A 4GI4A 3SSJA 5KEZA 4A35A 3C8NA 4L1XA 4AEEA 3S8HA 3RLGA 3IJ9A 4ZOBA 3W88A 1F3EA 1SFTA 1N8WA 1V4YA 3VINA 2DZTA 2D73A 1EIXA 3BARA 3SADA 1ZU8A 1XDJA 4GYPC 1V0MA 4MJ4A 2E8YA 2EPMX 2ZQ0A 2VD9A 2E7FA 1GVYA 2WJEA 2AMGA 2DV0A 3CIVA 2ALRA 2V5LA 2GYIA 4N9BA 3CWOX 3CUFA 1OB0A 4ZB2A 4Z0JA 3R6IA 2A21A 2YLLA 4ZB0A 2G3NA 4MIMA 3IPWA 2WPBA 3DFTA 1NOFA 3MKKA 2MUCA 1A5NC 3SQLA 4GVFA 1XYCA 5FIPA 5CSUA 2ZXAA 3SEPA 1PZ3A 1QNVA 3ITOA 3MW7A 4I9MA 2ZKMX 4R9OA 1Z32X 1SR9A 4X3ZA 4PTXA 4R3UA 1UWAA 5E70A 3NTYA 4KERA 1TR9A 4EPDC 6PTDA 3KP0A 3BH4A 4Y7EA 4KW2A 1RUSA 5AC6A 5BU6A 3N17A 2WYSA 5IM51 1X39A 4O1EA 3QV6A 1TTJA 3AZSA 4G7FA 1TPDA 1VPYA 4HPXA 3C2RA 1REQA 1CLKA 3PTKA 4U28A 2Z2BA 3VXGA 4K36A 2PDBA 2BHUA 3O6DA 3QR1A 3CHCA 3IJ7A 4PA8A 4XD3A 4QSHA 1EBHA 4FK9A 5C71A 1XGZA 3TMQA 4RR4A 2HMCA 5H91A 4IPJA 1QAPA 5IRPA 4Z1YA 1JIBA 3ZT7A 3DFYA 4Q4QA 1V03A 1QNSA 4LAKA 2VX7A 1BKHA 2R9RA 3H4WA 1CPUA 4MB3A 3VGBA 3PR2A 4D6FA 3FCPA 1Z7AA 1V0KA 9XIAA 4B3LA 3MT1A 1C91A 4GACA 3BC9A 4Y9OA 1J0YA 1PTDA 3H7RA 1TR1A 3NGJA 4KRZA 1ZB5A 2W67A 3TYBA 4JDYA 3WLQA 4E2BA 2ZVRA 2J79A 3MUCA 4HCHA 1A0CA 3IRDA 3QMRA 2XN1A 4GXMA 3GKFA 2A79A 2C6QA 1UOZA 2YCKX 2V3GA 5AB3A 2Y5JA 8XIAA 2FJUB 3T07A 3RO8A 1J79A 3MO7A 4NX5A 1YQ2A 1SJBA 3B06A 3LK6A 3QOKA 1AD1A 2UZ9A 1UROA 4UCFA 5A8NA 2HPIA 2CBUA 1TKKA 2RDTA 1XGDA 4ATDA 2PLKA 1KC7A 4A3UA 1EWDA 2VUYA 3ISIX 1EJSC 3B8WA 3LQLA 3QPEA 2X0SA 1H7XA 3CLWA 5BMXA 4ACZA 4CD8A 1TVLA 4H9MA 1V6WA 4E5TA 4QITA 4IWWA 3MBFA 4JIEA 3I3BA 2E68A 3L4TA 3PZNA 2WNZA 4YHEA 5T9BG 5ABEA 1ZBCA 4U2ZA 3SCUA 4FX6M 1P1MA 4AZ7A 3AMGA 1QUMA 4HZ8A 4ZZ9A 1OCBA 1ZBWA 4OBSA 1FY6A 2PLCA 1H4PA 3FJ6A 4EAYA 5J5RA 4FNPA 1B2YA 4UFIA 3RFAA 4XAPA 3AS1A 3OOQA 1E0VA 5B80A 3ARSA 1GOWA 1FP9A 2OT0A 4EAMA 3L67A 4GO8A 1DQWA 1UZDA 3OLEA 2O9PA 2QJNA 2QVNA 5CZKA 1AA1B 4XZBA 2YJQA 2BS9A 1AJ2A 2QCEA 3IVTA 1SZFA 3A9IA 3CT2A 3EOOA 4GBUA 2B31A 3FHAA 4JGDA 3SCNA 4IIEA 1B3VA 4RDWA 1ZCCA 4TMCA 1FUYA 3REQA 1JYNA 4YNGA 5IDZA 4QTGA 1GK8A 4D71A 1R9ZA 1NOWA 2OQHA 3BXWA 3RITA 4GA8A 3ARXA 2E9LA 5K9DA 3NQMA 3VMPA 4B92A 3STEA 3BSHA 2QCCA 3BAYA 2DQWA 4EK7A 3EX6A 1SO5A 3L5MA 3NZGA 3WH9A 3T08A 2D0FA 4WY0A 2HVNA 2WV8A 3O05A 2C19A 3WDIA 3E02A 1XWYA 4PEEA 3TNBA 1GKPA 2B4GA 4M51A 1AH0A 1OADA 3DFNA 4JAWA 3GH5A 3P62A 1GQJA 4R5EA 1E4LA 1FWIC 4QX4A 1QI2A 2HPMA 3PBGA 2UBPC 4C6JA 4XZHA 1DV7A 1WXJA 2Z7KA 3KRSA 4NJGA 1LL6A 2W27A 8CGTA 3WLMA 2OZ3A 3M64A 3KVKA 1E70M 4M82A 2XIJA 4LXFA 3VKDA 1KBLA 2ISDA 5CJMA 2J66A 2PC4A 4NRRA 1MUWA 1G4SA 4LAMA 4AU0A 4X2RA 1VPXA 3LRKA 4HSNA 4W5UA 3AROA 3TYDA 1XYBA 3A6OA 5H8PA 3OODA 1UHVA 4DI8A 1K03A 3KL3A 3LHWA 3W86A 2GJNA 5C2GA 1UUQA 3NEVA 3WH5A 1V7AA 4PGLA 1G5AA 3B05A 2GL5A 3BLKA 2PRHA 1W54A 2FZDA 3M7SA 5K4ZA 3WDQA 1MXGA 4CN6A 4NZFA 3E49A 3S1WA 2WJDA 5GQBA 4PMQA 3W81A 3LXBA 1VYRA 3ITXA 5M1TA 2QAFA 1M04A 4WKFA 3L4UA 3P61A 3TTSA 1OF6A 5EBUA 3WQFA 1R7AA 1OCJA 2XGZA 3UWVA 4US6A 3P3BA 1FFRA 1OYAA 1E5JA 1ISWA 1X7FA 1TREA 4LPCA 3MMWA 2BWGA 2VRKA 1ZNNA 1DIKA 2FZBA 1KA9F 1S5NA 1E43A 1UZ4A 3BQ5A 5E1QA 5G4HC 5M2FX 3EDEA 4JQ2A 4PN2A 1EDGA 4MTVA 1S5TA 2D2JA 4DJEA 1D3GA 3GFXA 2YB4A 2PC8A 1KFLA 2FHBA 4A3HA 1A4MA 2CU0A 3GR7A 1XS2A 5DMMA 1G1YA 4LCSA 5RUBA 5LYRA 4OVXA 3I7SA 1DQUA 3S2LA 1ZSXA 5DBTA 1X7IA 2J7HA 2Y89A 4GCXA 4F40A 4KGLA 3LENA 2V5CA 2J7DA 2XWEA 5FEWA 1BPLB 3PSWA 1VAHA 3LQGA 3P5YA 3P60A 1WCGA 4KFPA 4PODA 2D0GA 3DHUA 1JCLA 3SM0A 1AD4A 3N25A 3PVFA 4A8LA 4W88A 4L65A 2DZPA 3WJZA 2Y1HA 4L4OA 4UTJA 1XIBA 1AL7A 3THCA 3UG3A 3UWYA 1N8FA 1RHCA 2PTXA 4ZOCA 2P1FA 1PX8A 3FGCA 4H9TA 4FF5A 1TPVA 1LRTA 4BA0A 4K2SA 4LT9A 4WY0B 1NWTA 4KWSA 3GDTA 2PRLA 2WJFA 2VFDA 4QLJA 2DSUA 1J0ZA 3WQEA 3MO4A 1R9XA 4V2XA 3TQ0A 5BRPA 4LC6A 5IDIA 3RJYA 3TE9A 4M24A 2VEMA 4W8LA 4PMJA 1V3JA 3N18A 3UPBA 8XIMA 1OINA 5JIWA 1Q63A 5I3FA 4KT2A 3U6WA 4M7TA 4LVAA 3SQSA 1I75A 3QY6A 3L9CA 1QPKA 1KM2A 3VPLA 4Y6GA 1E6PA 2FTWA 1TV4A 3W6YA 2ZZ1A 3OEXA 5FI8A 2CLPA 2FLIA 3DI1A 2C13A 2A5HA 3AFBA 4HNNA 1FKWA 4ICNA 3RG6A 4ZR8A 1V3MA 3TP4A 3NWRA 4GJJA 2WMIA 1JCMP 2VGFA 3KZPA 3LRLA 1XGEA 3RK8A 4DO5A 1KFEA 1KM1A 2G37A 2AOSA 2INEA 1UR8A 3E2SA 5KMYA 4KIRA 2WB5A 1D7FA 2H90A 2P53A 3IV8A 4WRHA 2GUYA 4LRSA 1ZAIA 3IACA 3QYSA 3QSRA 3VDGA 1PSCA 1CCWB 3SUSA 3HG5A 3M16A 3TCEA 4CQAA 4DZ5A 2ZUSA 3MKCA 2VGIA 3HQNA 3VIFA 5A95A 2Y5SA 3EMCA 1H7RA 3CMGA 5PTDA 1ADOA 1WDDA 1X97A 3GIPA 4B90A 2PDFA 3HJEA 1KGWA 4HQVA 1HVXA 1NDWA 4KCUA 3MY9A 3VIKA 4JEQA 2CEQA 3CV2A 2XG9A 1F6YA 1H11A 2QCLA 1LQ2A 3ZWSA 5G4WA 1SZEA 2ONEA 5MKGA 1J01A 1XIEA 4CNPA 3NQ2A 4GRSA 3URQA 1RA0A 7REQB 4NUWA 3NXLA 1U1UA 3WMCA 3EWBX 1OX5A 2XISA 2J4GA 3BCDA 2FTYA 3MSDA 2BHYA 2X2GA 2DZVA 4O0KA 2XVNA 3SB0A 1A5OC 3HPFA 3TFCA 4KPLA 3LM3A 4G7EB 2UY3A 4P7RA 3IAQA 1TA3A 3CO8A 4QE4A 3FIGA 3PP7A 1NIUA 4QLKA 3QY7A 1YTKA 2PDYA 3M07A 3IJDA 4H6QA 5FEXA 1N82A 1PUDA 2GVEA 1Z41A 4UIOA 3MA8A 2YBVA 2WSYA 1G0CA 3AXMA 3C5QA 1MW0A 3NDZA 3WH7A 2J7CA 2BY3A 2QDDA 1WA3A 4MJZA 3L4XA 1ODUA 5E5CA 2H3DA 1TRIA 1KXTA 2FTPA 4WZHA 3M5XA 3LXCA 4ZOAA 3BLEA 2V81A 4QJ3B 3BSMA 3G8RA 4LU0A 4UTKA 1RLDA 3K2GA 1RVKA 4MPQA 1B3YA 3HOJA 2YBTA 2OLSA 3EKZA 2J7EA 1AJ0A 3QN3A 4HMEA 2NV9A 5D37A 3VDAA 4UTTA 4BS0A 5LXEA 4QXIA 4ATLA 3AU6A 3DBNA 3H2FA 3HBLA 1OX6A 4XZMX 4UMBA 3W87A 1L6GA 1Q6QA 3WF4A 5HJLA 1MQRA 3SURA 5BYWA 4O0ZA 2X09A 1FP8A 3GVQA 1P0EA 3C52A 1A5AA 1DWAM 1TPH1 3C4UA 2DIKA 4P8UA 3APTA 3SW6A 1WPCA 3CB8A 1VBGA 1FCUA 2HS6A 3UY7A 1RV8A 2ISFA 5ABFA 2FHFA 3GLCA 3MZNA 2NUXA 4NAFA 4LNCA 4PTMA 4MFDA 4M3PA 3W27A 4HJFA 7ODCA 2JE8A 3W07A 5CSYA 1F3WA 3TSMA 4S2CA 2GK1A 2CLEA 1EXBA 2BFGA 1WZKA 4UR8A 1QJWA 3TIMA 1H5VA 3SCPA 3OVRA 3WBAA 4GC3A 1YRRA 2FMNA 5IHSA 2E9BA 3GAYA 1S5MA 1JQXA 4JIPA 3QR3A 3V36A 4DBWA 1UBSA 3TW9A 4IPLA 4ONVA 3A4XA 4GKTA 2INZA 1VYSX 4OFCA 2YDSA 1A5MC 5T91A 4DVOA 1E73M 3PZGA 3KOXA 2J77A 1YTDA 1EL3A 1QDSA 1GVIA 3DC8A 3NQVA 3W7RA 2WQDA 2C18A 1QCWA 1TV3A 1NFBA 1AODA 3WQDA 4JTRA 5CGMA 1M1BA 4XSLA 2QCHA 1M3UA 1B0IA 2VRQA 1CGTA 1PJ9A 1FA2A 4LS1A 1KXHA 2D1ZA 3W85A 2WC4A 1P0DA 3CJPA 2DZXA 4JX4A 3JRKA 1OWQA 4LFYA 1SMDA 3L68A 5GNXA 3SUUA 4AZ6A 5F1VA 4DN1A 2FVLA 3TA9A 4QAWA 4UTIA 2XIBA 1A0DA 3VCCA 2FVKA 2XYLA 4J5NA 4WEVX 3FJ4A 1VB9A 1DIEA 4JPGA 1X1ZA 2VC6A 1JZ6A 3IAPA 4E2DA 2OELA 1LQAA 2G41A 3KLKA 1XLGA 2QV4A 4OV4A 1E4IA 1QK2A 1GOOA 3SJNA 4Y9NA 1EP2A 2HBVA 2X7WA 1XKJA 1R30A 3CEPA 4A21A 5BXTA 4U33A 9RUBA 3NOYA 2PD5A 1BXNA 2FFCA 4MKVA 4TO8A 1XI3A 4EXBA 4CEXC 4KWWA 4D8ZA 3TDFA 4G1NA 2HSAA 2VYOA 4OZOA 3GS6A 1Q2RA 1IEIA 2YA1A 1PKMA 1JGIA 2Y7DA 4AIBA 1RCXB 2AL1A 4AHPA 4XKYA 4HKPA 1VRXA 1PV8A 3ITLA 4QLLA 3P8JA 4DAFA 4KWUA 1R6WA 3RU8X 4JTTA 1QW9A 4LX4A 3HV8A 1US3A 4NQ1A 1FH8A 3AIEA 3L4YA 3FS2A 4FAMA 3W7LA 3QOMA 3ECQA 2YGYA 3S5ZA 3FXGA 3WZ0E 2VVNA 3EEGA 3OVPA 2G3MA 1MXSA 2CCRA 7XIMA 2W61A 4AISA 2PWUA 3BICA 4B5SA 3UWEA 4O0QA 3WNNA 2ZUNA 3CV7A 4JFTA 1BKSA 4PMRA 4H1ZA 2RDXA 1DHPA 4CLMA 3JW7A 2DUAA 1P4CA 3CWHA 3EOEA 2VR5A 2XFYA 1EJWC 3QR0A 5D32A 1MFVA 4LC8A 4UQCA 4O4WA 4OOUA 4E8DA 1PX3A 2Z26A 1TV8A 4H19A 1W31A 3W2KA 1QNQA 3G6MA 1HQTA 3U0HA 1Z48A 1NY1A 4IQEA 3M43A 4MUZA 1MW3A 3QZAA 3ARYA 3GB6A 5ABFB 2ZA1A 2P0OA 3T0BA 5A6MA 4W85A 1VFLA 4JFWA 5MF5A 5E9XA 2VEKA 4BQ4A 3L5LA 1FQ0A 4JTDA 3ZIZA 2RGLA 2XIMA 4I9AA 4ZA0A 4N6FA 1EJUC 4KBXA 1VEOA 1WKYA 4LAUA 3CTLA 3ZXWA 2DZAA 4GYFA 2PEVA 3LCLA 1SW3A 3A21A 1R7OA 1TJPA 4R53A 2WHKA 4GUFA 2ACQA 2VHLA 3TC7A 2O7QA 3E9AA 4C7GA 1D3HA 4JTHA 1VIZA 1D9EA 1SPQA 2PI6A 4C7FA 1CBGA 4RDZA 4Q3MA 1MRAA 4XO6A 4J3XA 1YEYA 4X9YA 5BWAA 1PBGA 4MDOA 1VHNA 3TYCA 1CZ1A 1MDRA 3CHFA 1YXDA 2QCMA 1OC7A 1HVQA 4MWAB 1W37A 4ZL1A 1M01A 3Q2DA 1FWTA 2O7SA 5FEZA 5AHMA 1OYCA 4TR9A 3OU8A 4RDYA 1E72M 1RP8A 4E6MA 2UY5A 1DL3A 3GNNA 3CH0A 4XBSA 1V6UA 5HNNA 4GY7A 2XM2A 2QXWA 3R89A 3VTRA 3RPMA 2PBGA 4R88A 3W7GA 1H7NA 3LBOA 1B3ZA 1SZRA 1EA9C 1XF0A 4E38A 1QW7A 1OZMA 3KLLA 2J78A 4MM1A 3OTRA 2QDHA 4LYPA 4A05A 4MNKA 2WM1A 1VLWA 3SGZA 3WENA 4ZE4A 3AIWA 4EWJA 4US5D 3GC4A 1KTBA 4MDPA 3GDLA 3LNPA 1BRLB 1LT7A 2INFA 4S3JA 3SRHA 4Q4SA 1A49A 1S2AA 2FPVA 2J47A 3NQCA 4RNJA 3S4TA 4M6UA 2WO5A 4P8WA 2Y0FA 3POCA 4EACA 4C6IA 4PRRA 2EQDA 3KAOA 5EGRA 3W02A 4LB3A 5M5DA 3W0KA 1PX4A 4IL2A 1U5VA 2VR4A 2GVJA 2GJLA 3QHMA 2X30A 3BSGA 3WH8A 3DECA 3D46A 3KOWA 4M5PA 4PCNA 3OJGA 4QNWA 4O28A 1SFLA 1SR0A 2NQLA 1OYBA 1WZAA 3P8IA 2XSBA 3TUUA 1IV8A 4BQ3A 2EAWA 3KE0A 4B5NA 1G4PA 2PWGA 3BPWA 3UXAA 4B5UA 3GTNA 4XSMA 2J7FA 5CAHA 1VLIA 4AC7C 4UTUA 2YXXA 4HK6A 3KCJA 5E9AA 1ZALA 3T4CA 3GNDA 1ITCA 2Z2UA 4CNOA 1CXKA 3PJTA 2YSWA 3PF3A 2CKSA 2VFGA 4L6HA 2HK0A 4B5WA 1JZ8A 5FAGA 1XCFA 2NLYA 3VCRA 4AWTA 2ZTJA 5GNYA 1EJRC 3GH4A 3RMEA 3W1NA 4LCQA 3L2MA 4C6PA 2CBVA 4GIRA 4CN4A 1YNYA 3UQNA 3Q94A 3ABXA 1NDYA 1TMLA 4W9TA 3QEZA 4LANA 3TEVA 4G56A 3FEMA 2WWDA 1BXBA 3CQJA 3TYEA 1KWGA 1UR1A 2Z1KA 2JGYA 1YBQB 3AIBA 2AGTA 2ZX5A 1YE6A 2IKGA 3DFHA 2YW3A 2Q71A 1GHSA 1WO2A 2OJPA 4JL2A 2WMJA 3ERPA 1NQ6A 3TSDA 4WQ6A 5IBXC 4ENLA 5CBBA 2OVLA 2HCVA 2QLYA 1UIOA 1M7JA 1CB2A 3AXHA 3A9BA 1NWUA 4LALA 3AIUA 2OSXA 1VBUA 3KBSA 4KCVA 4OIFA 1CT5A 1WE5A 4RE2A 4QG6A 3QTGA 3AI0A 4PB5A 1E0UA 1OGGA 3IRSA 3THAA 1UA3A 4O4VA 2OXNA 3CXOA 1B31A 2P8CA 4AVFA 1I2OA 3NL2A 3PZQA 1FTXA 3VGHA 2Y2WA 5D30A 3DFQA 3UNTA 1E71M 3W1MA 1X1NA 1GVOA 2HVOA 3IARA 2G4JA 3R10A 5GVJA 4HGXA 4RW5A 4V15A 2A3LA 5DLCA 6REQA 1NSJA 4QP0A 4US5A 1CGVA 1TJRA 3MJMA 5TIMA 2P50A 1VBRA 3WDJA 3UZWA 4FX7A 1H50A 4WXYA 3K13A 2QHAA 5T8GA 1BYAA 1OFBA 3TTOA 3U9IA 1XLIA 1KB3A 3DHFA 1C29A 4UTWA 1BVZA 2G3JA 4GNKB 1GEHA 2PDHA 2VWSA 2BDQA 5H1WA 1EP3A 1FXPA 3IIPA 1DOSA 3VKAA 3TV8A 1U1HA 4CQ9A 1TQJA 1D2KA 4HNTA 4WR3A 1XFCA 1OIMA 1EO7A 3H6OA 1I1XA 1H60A 4DO6A 4JTIA 3VK5A 3WEZA 3INPA 4IGSA 3MB9A 3LXAA 4K1GA 1YDNA 4UQ9A 3ARPA 1FVPA 2CBIA 1BEUA 3MV11 4B15A 5EYWA 2ZVIA 1MUMA 1MEWA 4MB4A 4I90A 1TV2A 2CWXA 1R3SA 2WKJA 5LNVA 4BI7A 5TNVA 3VC5A 3TTEA 2KZHA 1XQKA 3TC3A 1IXOA 1LROA 1RD5A 1OT2A 2VD8A 1IGSA 2GQAA 1EC8A 1ENUA 2WAGA 2HEJA 3H2AA 4E2VA 4GQ0A 3I4KA 2QGYA 1GORA 1DHKA 5C7VA 2OOGA 1KO0A 3W7NA 1OBAA 1J0KA 4IX2A 3TYZA 2BY2A 1VFFA 1Z42A 3DFPA 3AALA 4P8VA 1E6SM 3I3DA 4MJMA 3OGSA 1U5HA 2YFNA 1EFZA 3CAQA 1YADA 2DH2A 4GK8A 3B40A 5D9OA 4GVHA 1W1VA 4HMDA 2A3CA 3OBAA 3SFWA 2W91A 1SJDA 3MUXA 4POCA 4I7WA 3KEHA 3MP3A 3QHNA 5AVNA 2BVTA 1U22A 4RNIA 1KFWA 5EMMA 5A8OA 4Q6XA 3DH7A 4MYXA 4RW3A 1PCWA 2WPGA 3WUBA 3S1XA 1B57A 1ME8A 2GSJA 4A8RA 3KS5A 1HJUA 1FCVA 4WDUA 2W92A 4Z0SA 1WUFA 1XFBA 3RM9A 3V5CA 4ZODA 3KS6A 4E4UA 4AIUA 1YW1A 2YA0A 2ALDA 2EEXA 1R9YA 1OEPA 1OIFA 1E6ZA 5I78A 3DGRA 3BDKA 4H8VA 1WV2A 1H41A 1UR9A 4V1XA 1UJPA 1XYMA 2HVMA 1YMYA 2XINA 2X42A 3K1GA 4XBKA 4DM1A 1LOSA 2PRMA 1O5KA 1BD0A 1UWSA 4QCEA 1AZ1A 3M4HA 4E3VA 5AFDA 4HA3A 1TZ7A 4UMAA 3RHGA 4TV5A 3AXKA 1TG7A 1OVDA 5C7HA 3HFYA 4IGHA 3F4CA 2VX4A 2VZSA 4PFHA 4DJDC 2G5WA 1W9DM 2QPSA 1F3XA 3SUVA 3JZUA 5DY2A 1B9ZA 3G2GA 1BXCA 2OEMA 2UWFA 4KETA 2FHCA 1EWEA 2GJPA 3H70A 1JF5A 4Y8EA 3QC0A 5C5YA 1NDZA 4J2MA 4WJXA 4WSHA 1W1IE 1LP6A 3IIOA 2NVDA 4NI3A 5HPCA 1LLOA 3AHXA 4BK9A 3GNOA 1XRFA 3B4UA 4HCLA 5CZ0A 1XSKA 3T0DA 4U31A 1JYWA 4ROQA 4O13A 3DHDA 4IHCA 1LYXA 4ZVJA 5A1AA 1RSCA 3V7PA 4FOUA 1BYCA 2E5BA 3AYRA 2RH9A 3FNDA 5L9FA 4Z08A 3KRZA 2AMXA 4WCJA 1OK6A 4AZBA 1J2BA 2NUYA 3KOZA 4MYAA 1ZJAA 2J8GA 5ENLA 3AHZA 3JVAA 1ONEA 1GW1A 1XX1A 4PZVA 5I0DA 2RAGA 4ML4A 2EJAA 3RAOA 1HXJA 2A6NA 1W2VA 5DMLA 3IIZA 2OYMA 2HQAA 3M44A 1XRSA 2BVDA 2BB0A 4IMFA 3UT0A 1FH9A 2R91A 1BWVA 2RFGA 3FFSA 2GVYA 4B9ZA 3PPGA 1WAWA 3SY5A 2CLMA 3ATYA 1JCNA 4UQDA 3N3MA 4MVAA 3LTPA 4QQ3A 3ZM8A 3UPMA 1S5VA 3VYLA 2PDPA 4M7SA 4D6EA 2TPSA 3EPMA 2NWRA 5JU6A 2PAJA 2NXGA 5AC4A 3ITVA 4BF7A 2OX4A 4CCEA 4LBUA 4V28A 1J12A 2WMFA 1KTCA 4YL2A 4LV4A 2YBUA 3FJLA 1IR2A 3EKGA 3O06A 1QT1A 5I3DA 3W3OA 3HU7A 3CQ0A 3DC0A 2WVSA 3E2VA 3B8SA 2OOFA 3B04A 4PMVA 6TAAA 3PULA 3RRAA 3KL0A 3MDWA 3RN6A 4HZ6A 1FHUA 1RR2A 3IJ6A 3MMDA 1P0BA 5C9UA 3WF0A 1LL4A 3NXFA 4QS6A 4L4PA 3GTFA 2FFIA 1WKDA 4F2BA 2E6DA 3W7JA 2VOTA 1LG1A 2PE4A 2W5FA 4LY8A 4ZMGA 5BRBA 2ISWA 1KQZA 2QCFA 1W5QA 4OOZA 1TTPA 1UWIA 3CAWA 3HM7A 5KINA 1UA7A 1J8VA 3VGDA 1XLEA 1QOQA 3PWGA 3AHTA 3EA1A 1S38A 1KKRA 3GE7A 4UMCA 3EWXA 1UYQA 1UH2A 5BROA 3PUDA 1E0TA 3NZ1A 1L6FA 2QKFA 2C7FA 3R13A 1POJA 2A3BA 3EPOA 1WQ5A 1YXYA 1ZS2A 2OZ0A 4A8IA 1FCBA 1UASA 3KRUA 2P8BA 3W37A 5AKQA 4YCOA 1AW1A 4JYFA 4K38A 3TR2A 4Q7NA 1V02A 1EGVA 2VCCA 3THQA 3MBDA 3C0JA 4FR6A 2I7GA 2ABAA 3S46A 1XG4A 3RNDA 4OQVA 2FGZA 1XIMA 2OSYA 1R38A 1EHAA 4I8DA 1SO6A 3WMBA 2GFTA 4BCEA 3HPAA 1C8VA 4IIHA 4JFUA 2Y63A 1U2YA 1E9ZB 5LIWX 3PZOA 3SFKA 2IUZA 5A2AA 3URNA 3MCNA 4INFA 3IJLA 1LZOA 4MZYA 1DE6A 4GZIA 2FZ9A 4I9JA 4DPQA 4K8GA 1DIOA 3W7KA 4Q4MA 3VKKA 1TO3A 3UYIA 4UFJA 1JJKA 1R3TA 1WB0A 1CW2A 1SJAA 2Z1SA 3VIGA 2ZRYA 2YDAA 3PTMA 4J9JA 1LJYA 1TSIA 3BLOA 4M6PA 3E38A 5FL0A 1ICSA 4BWLC 4TVDA 1QPOA 4BI5A 2W66A 4XUGA 2GOUA 1W3LA 1M03A 1PAMA 1Q6RA 1E6XM 4OBRA 3TOYA 1BFNA 1HX0A 1O68A 1M7PA 1NARA 3MS8A 4S39A 1V3KA 3GVRA 4H6RA 3W7QA 5C9XA 4NNAA 3UR7A 1RALA 2CPUA 4AVOA 3CHEA 1BWLA 1VBHA 3VZXA 2SFPA 3RO6A 1C9WA 3LTSA 2DT0A 1T99A 1UC4A 4NNCA 1TJ1A 4EVZA 4IM4A 4PH6A 1Q7QA 4GNVA 4N02A 5I6SA 1K6AA 2V67A 1YPFA 3MZ2A 4ZBCA 4GUGA 4G1KA 3SBFA 2X7VA 3TQVA 1LM1A 3M0KA 3WBXA 3UR8A 1OCNA 1UZ1A 3BV4A 3BJFA 3LY0A 2DVTA 3EA2A 1HL9A 5HWJA 3OZMA 3CZEA 2OTDA 2O55A 4LF1A 2J6VA 4GWEA 3VOFA 1FWDC 1K9DA 3R12A 1VBJA 4JEJA 4PMDA 1ISVA 3CEUA 3ZJ6A 2OFJA 5K4XA 3KVJA 3NQDA 4G5DA 3OLIA 1NOUA 4V1YA 1WKEA 5FESA 4Y8FA 2Y7GA 5REQA 1CIUA 3A3WA 5HATA 4UTWC 1J2WA 1ZTVA 2GGHA 3EBVA 1B1YA 3A4JA 4CD5A 4DJFA 4UNLA 2OLAA 3ABZA 3M41A 1X1OA 3KBWA 5DXYA 3TMLA 4L4MA 3TLQA 4LAZA 2CHNA 1X38A 5DELA 4UB9A 5LKYA 5D2XA 4D6IA 5LA1A 4GC4A 5HR6A 4QDPA 5BU9A 3UJFA 3GBEA 3MI3A 4QGCA 5I02A 4IFKB 3WDRA 1WUEA 3VNLA 1JCYA 1Q7MA 4UFHA 5HDRA 4CCZA 3LDVA 4IICA 3NPWA 3A3HA 4NKCA 5AC5A 1QO5A 4X2PA 1F07A 4I6KA 3RU6A 3WQVA 3TJLA 4IQJA 4WF7A 3B8VA 5AC7A 3PHAA 1PZ1A 5EA9A 2BXVA 1LWJA 3P81A 4RCXA 3F5KA 4C6OA 3TZFA 3OO2A 1DWFM 2A3HA 3GO2A 4H8NA 3HQ1A 2EG8A 1W9VA 1TUXA 4PC8A 2WZIA 4ZQMA 2F8QA 2QJIA 1EGMA 3ITCA 2PDWA 2D24A 4WHBA 4H00A 1QI3A 3WJWA 1GVFA 2J13A 4HA1A 3UGRA 2VFEA 4O1BA 3NYDA 4J3VA 4LCRA 2WWCA 3N1AA 4NP7A 2Z1WA 4NZCA 1PWMA 3EXTA 1GJUA 1RPKA 2QNEA 5FF7A 3GXFA 4EF8A 1UB3A 1XH2A 1GPFA 2OMAA 1FWCC 5I7GA 1XIGA 1NAL1 3S5YA 4U3CA 2PU0A 3S0CA 4ORIA 4B4FA 2HWGA 2QUNA 4FF7A 3OHMB 3L66A 1Q6CA 1UD8A 1CNVA 2DUZA 5CH9A 5EPDA 4AZCB 3UCQA 4RNHA 4UZUA 3OYZA 5KETA 2WZEA 1HGWA 3FYYA 3G1DA 3FDKA 3WQWA 3LI0A 4LF2A 4E3TA 2BXYA 3QH2A 5IHRA 1F61A 1DJHA 1OGBA 3Q45A 2PDJA 4B16A 1TE1A 4JN6A 1AFSA 1H49A