4ES4A

Crystal structure of ydiv and flhd complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
206
Chain Sequence
SDCYFLPIRDNQQVLVGVELITHQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative cyclic di-GMP regulator CdgR
publication title Structural insight of a concentration-dependent mechanism by which YdiV inhibits Escherichia coli flagellum biogenesis and motility
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 206
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4es4A00
2W27A 3PJXA 5MKGA 3GG1A 3HV8A 4KIEA 3PJUA 4FOUA 3PFMA 4LYKA 4Y9NA 4Y9PA 3U2EA 3GG0A 4F48A 3PJWA 4HU4A 4Y9OA 4Y8EA 4Q6JA 5MF5A 4RNJA 4LJ3A 3TLQA 3PJTA 5M1TA 4F3HA 2R6OA 4HU3A 3S83A 4ES4A 4J40A 2BASA 3GFZA 4RNIA 4RNHA 4AG0A 3GFXA 4HJFA 4FOKA 5MKGB 3HV9A 3SY8A 4Y9MA 3N3TA 3KZPA 4FOJA 4AFYA 3GFYA 4RNFA
chains in the Genus database with same CATH superfamily
3RXZA 1B54A 2CZ5A 2ZX8A 1SFTA 3CBWA 3KZSA 4B5SA 5HWJA 2BOEX 3AQUA 3S5OA 3VIIA 4PTVA 4LAZA 1RQEA 4TX9A 1OD0A 2BOFX 2V2DA 1R7AA 3GBEA 2P8BA 3S83A 4HA4A 1XR2A 1JD9A 5A94A 4AZCA 5E0CA 3R0DA 2HISA 4MNJA 3HBLA 3DFYA 2UY3A 3W7EA 3GSMA 4HTBA 4IQJA 3I7QA 4ZODA 4ZQCA 1MFVA 1VCFA 5AVNA 2Z1KA 3UR8A 3AIBA 2WSKA 3B9DA 4TMCA 3G1AA 1QI5A 2QCFA 3L4WA 4ZOBA 1JYNA 1FXPA 5D37A 3M0XA 4JFSA 4QJ5B 4KGJA 3CXOA 3USBA 5FAJA 2WPGA 3WBAA 1Q4WA 1E5NA 1B4EA 1DJHA 3TNOA 3QGVA 1WZLA 4C7FA 3C0JA 1XIBA 4GQGA 2PAJA 5DCBA 3RIKA 1MXSA 3E9AA 4JY9A 4OKDA 3B8IA 3SFWA 1WZKA 3QBUA 1H61A 3AO0A 4B4HA 1LP6A 4M1BA 5FJUA 5FL1A 1J11A 2HNHA 2OSYA 5CAKA 2H3BA 4DYJA 1KGUA 1R8LA 1ZBVA 2ZX9A 2PDUA 1LTDA 4G7EB 1MNZA 3BAXA 4XKYA 3QPZA 3JVAA 1DEDA 3ITVA 3LQGA 1EUNA 5CJNA 3ARZA 1IF2A 5F4WA 2AKMA 1WV2A 3CZKA 2YFOA 3K1DA 3OW1A 5I3JA 5G4HC 1GVOA 4QGCA 1LWJA 2YW3A 1T41A 3ONBA 3W84A 3WL1A 1TPVA 3QHOA 4KFOA 2OG9A 1U2YA 1YXDA 2JGYA 4DB7A 3UNTA 2F61A 3OLEA 5DT7A 3TTQA 3CGTA 4TVUA 3UWEA 4PMDA 5JBDA 4IH3A 3N4EA 3QYQA 1FA2A 4GX8A 5FJPA 3H22A 3DIPA 3N6QA 4IPLA 4AYSA 5TF0A 1VQTA 3ZJ7A 4D6DA 4Q22A 1EXPA 2QKFA 1GQKA 3DYPA 4E2DA 5CGQA 3IJ9A 4BQ4A 4J5NA 1A5NC 1WBHA 3IK2A 2W66A 4PMZA 1OFBA 3WN6A 4GMEA 1EZ2A 1QBAA 3C8FA 1EQPA 1W1A1 3REQB 4PEEA 4U3AA 1PPIA 3G22A 4AD0A 5H1WA 2X40A 3VNLA 3TX9A 1VJIA 2ZX5A 3E0IA 1JFXA 2VX6A 1DPMA 4D6CA 3ZOAA 2PEVA 3ICJA 4J9JA 5DCEA 1CX9A 1A80A 2WLYA 2B7NA 5AVHA 2J8TA 1REQB 3L65A 3A21A 1BEUA 3WD2A 4XZLX 4ALDA 3MUAA 3AS1A 2Y24A 1E6QM 2CZDA 4KH2A 3FJLA 3O16A 1W9PA 3VZXA 1OYAA 3VIMA 2E5DA 2FJKA 2FHFA 1UBSA 2Y5JA 3W1LA 3HG3A 1FDZA 2CLPA 4QDPA 1QI2A 3WJSA 1WO2A 3R11A 2V81A 4XKMA 1PWLA 4Q8OA 1O1HA 4I90A 1T8XA 2O7SA 3UWVA 4CCZA 5E9XA 2NUXA 1GVIA 1LT8A 1OFEA 1IE7C 1WB0A 3CL7A 1GPFA 1ISWA 4R7WA 1ZAHA 3GC2A 3AXKA 1S2UA 3WDHA 2CETA 1Z42A 4HNUA 4XB3A 4WOZA 4DZAA 4H8HA 4PTWA 1TWIA 1KM1A 3U2OA 4GUIA 1FHLA 3WENA 4EX4A 3D3AA 3W1NA 4ZL1A 1VZWA 1MEWA 1G01A 2PTWA 3G18A 4FEZA 1VHNA 4KCWA 5D2VA 2CLHA 5CZ0A 1OCQA 3ZJ8A 3OVQA 3W72A 5EMUA 3B8DA 3LPGA 1UZ4A 3EMZA 5AHLA 5D09A 1XYMA 1O5XA 5IM51 1CZ1A 5AOUA 3NNTA 1CYGA 2J62A 4MUZA 3PN8A 2FVKA 1R47A 4JDYA 4V2XA 3VMOA 1J12A 4FNTA 2C19A 3IIVA 3HGJA 2RGMA 1Y5WA 3IIPA 3IRDA 4D2JA 2ANUA 4Y96A 1RLDA 2WBKA 4Y9NA 4QNEA 2ATMA 5CSUA 4LANA 4DZ5A 1K4HA 4PMVA 2P0OA 4DWSD 5FD0A 4PB5A 4ZXOA 2FPTA 4WRHA 3DESA 4F9JA 2HS6A 3TXVA 4ZSTA 3UVIA 1IEQA 1TV3A 4JN8A 2CNCA 5GVJA 3G1SA 2D2OA 2E6AA 4GFSA 1BGGA 2OR2A 1CXKA 3CJPA 3W86A 1WXJA 3GG8A 2A2IA 1I9CB 1W1IE 4KIRA 1NFBA 2GUYA 1GHRA 2OSXA 3PSVA 3C86A 3S4TA 3VU2A 5E6ZA 3FHQA 1UOKA 3GLCA 1VRDA 4WEVX 3H24A 3MBDA 4AEFA 1V02A 3NM3A 5T26A 4X0NA 1ZL1A 1GOXA 4UR9A 4PTNA 4C6JA 2ZRUA 2Z28A 4GVHA 6REQA 3MDWA 3GAYA 3M5VA 2KAUC 5A6JA 3GNPA 3WLPA 1YNQA 4R9OA 3AI0A 4MY8A 3VUPA 3RR4A 4DWSC 5CZSA 1XCXA 3EWUA 1OGBA 3LG3A 4ML9A 1T6MA 1CLXA 2VR2A 3R5EA 4WY0B 1P6BA 5I07A 1KFJA 2W63A 3IJLA 2PC8A 4W89A 2AGTA 1FH7A 2VO5A 1OFRA 4M6VA 4NXKA 3NDOA 2EPHA 4PTMA 1KBKA 5C2CA 2ZADA 3GTFA 3F4WA 3U7BA 3PZUA 1P1MA 5B80A 4KWVA 3V36A 4J2PA 1EEXA 3DXIA 2WMFA 5HMEA 3K8LA 3EOSA 3VD4A 1NU5A 9CGTA 2GZXA 4ECLA 2CHOA 5GPRA 1HVQA 3FAXA 4OQVA 1RR2A 2VEIA 3N04A 1W17A 1YE6A 3MVTA 1W31A 1JDDA 1XBVA 2WCAA 1ENUA 1EP1A 1ZENA 3H7UA 3PZVA 5FSEC 5EL1A 2PLKA 4MB5A 5AYXA 2ZE3A 5AHFA 3LD5A 3K8MA 5A8MA 4G1NA 1XLFA 4TUFA 1ITQA 4LUTB 3L12A 2E25A 3GO2A 1XIFA 1UKQA 4K8EA 2NV2A 4WJEA 4WUIA 2VNCA 1LZOA 2H8XA 2ZXQA 2G4FA 3M64A 1YNPA 4HSOA 1R7OA 1WKEA 3PJTA 1K9EA 4OU1A 2EJAA 3TC3A 1PVNA 4H7VA 2PF8A 3RITA 3CZLA 2A7PA 3UWQA 2Z1VA 3EPOA 3GNDA 5CLWA 3TKFA 1EBGA 2QF7A 3OVGA 5AHNA 3OZYA 2O56A 4NNCA 5HANA 2Y7DA 5REQA 4GISA 3CU2A 3IPWA 2GK1A 2VEMA 2VX7A 3L2MA 5D9PA 1LORA 1QPQA 3STGA 3F2CA 3ZVIA 3N2MA 5CKSA 2CC0A 5XINA 5D05A 1JUBA 4QX4A 3KOFA 2W4XA 1OK4A 3T81A 4HU8A 4BF9A 3GE7A 2YW4A 4UTUA 4NX0A 3PNUA 1UHVA 4XZBA 1NIUA 2NQ5A 3IV8A 3DBNA 4Q7IA 1ZFJA 4DUOA 2GFTA 1J10A 1Z8AA 3RLHA 3C0SA 1AQMA 3ABXA 3NAVA 4FSAA 1FFRA 3ES7A 5HNNA 2C14A 3KS5A 3GYEA 3N2CA 2FHBA 1F73A 4AY1A 4R27A 2ZUTA 3WLHA 4UXDA 1SFLA 1ZBKA 2QUTA 1F7BA 3GXTA 5FJIA 4CQBA 2GQAA 2PBGA 2DZWA 3DI1A 5D30A 2INEA 1QI0A 1JPIA 1Z69A 4FA3A 1RAKA 3F2DA 3OZPA 3TSMA 2WPBA 2WBGA 1CB2A 3FSUA 3KVMA 3KRBA 4XAGA 1V0KA 1R2TA 3BQ6A 3OGVA 1BLIA 5GJPA 3WMLA 5CAHA 3RILA 2WANA 4O28A 1ICPA 2WNNA 5HINA 1V93A 2XSXA 4FNUA 2VFFA 4TIMA 2V5KA 1DJYA 5K7JA 1QW7A 3VMNA 4ERIA 4K3ZA 3IUIA 3KWXA 1K9DA 1XF0A 2DH3A 3GIQA 1XLKA 3QTPA 3CMJA 3PWIA 3TJLA 4IQEA 3URAA 7REQB 1WPCA 2ZUSA 1TV5A 4TV6A 4QDWA 1MO0A 5ECVA 1H51A 3W2MA 3VGFA 2E7FA 1YHTA 2WSYA 1KM6A 2DQXA 1TPC1 5C9UA 4RZ5A 4D8ZA 3AYRA 4GBUA 3DYMA 4JTSA 1UD3A 2YCLB 3VGDA 1DIEA 3SGGA 4I9AA 5HNTA 3GW0A 2J7FA 3F5LA 5C0QA 1Q4NX 3N29A 3ENLA 3MB9A 3PZGA 1TUXA 2GVJA 3GDKA 4MVAA 2C91A 1O94A 1RD6A 4N9CA 4B90A 4XZ9A 1S3TC 1R3SA 1UPPA 3TFXA 1TPUA 2FTYA 3KCLA 1NP2A 3H70A 1PWMA 2UY4A 4OUIA 1KFWA 2XGIA 2XH7A 4ZFMA 2VGFA 1VENA 3U7VA 2Y63A 1EGVA 2W6RA 4LY4A 3CUGA 1BF6A 2Z1SA 8XIAA 1YDNA 1M41A 4QG9A 1OBAA 3W81A 5KETA 1Q6EA 5G4WA 3D0CA 3NVDA 4Y9MA 1GYLA 1A5BA 2Y7EA 1I4NA 4H6RA 1CW2A 1M03A 1GTEA 2WWDA 4TV5A 1UIPA 3LSCA 2E6FA 3BK0A 1D9EA 4KWWA 4I6VA 3BCJA 3B97A 1QMLA 2RDUA 1GG1A 4GQRA 4QCFA 4B91A 2WQPA 1UUOA 2DORA 2ON3A 4HCHA 3WQPA 2WJFA 4CEXC 1PJ9A 3OLDA 3XIMA 1ELSA 2P88A 1OCJA 2YJQA 1RHCA 4DNMA 1QVBA 5AHEA 3GH5A 1OADA 1KM3A 1R3WA 3UCDA 1HQTA 3ZSSA 3S9IA 1KR1A 3R12A 3AC0A 2V0TA 4IIEA 4OGZA 2ZC8A 1E9ZB 1PCKA 3UJEA 3VOFA 4IIHA 2PDIA 3TH6A 4AXNA 3M9YA 1D7FA 4PCNA 1GK8A 2PDPA 1DOSA 4S3DA 2ZXDA 1VLIA 3L4UA 2R1NA 4FX7A 1JFHA 1VB9A 3M0MA 4MKNA 5DRCA 2CW6A 2HPMA 4XV0A 5CPMA 4MPQA 9XIMA 4MUPA 4LUIA 3ZSTA 4GZIA 4Z2IA 4RXFA 3U9IA 1MUMA 4GQ0A 4RNJA 2OO6A 3MO7A 4RL3A 4RDWA 3G6MA 3WMBA 4QEEA 4Z2JA 4PFMA 4K6AA 4AH7A 3C0QA 3LYEA 2HV5A 1GJWA 1VYPX 3KL3A 3PF3A 1X6NA 1YTDA 2Y7FA 1UH3A 4I7VA 3UGVA 1ZAIA 3BICA 4DF1A 4WSJA 4JKKA 2VWSA 1QATA 3LHUA 5LGZA 3NQ7A 2OX4A 1UIOA 3W7KA 5EY5A 3U4FA 5E5CA 4FNPA 1C8XA 3AS0A 1LL4A 3GX9A 1CGYA 1FX6A 4H41A 4HHHA 1MEIA 3N6HA 4WXYA 1JGIA 4IG2B 1ZZMA 1V03A 1W6TA 1GW9A 5AECA 2PWDA 1F76A 2TODA 5C2GA 3NL6A 1TJ2A 3SBFA 3VKDA 4H8UA 1X6UA 2MANA 1PTAA 3RK8A 3LGGA 1J0HA 1TWZA 2OSWA 2J7DA 3MW7A 3DG3A 2DZUA 4ICNA 5T9CE 1XLAA 4JN6A 1FWRA 2E28A 5CPSA 3GDLA 3FVDA 4YTQA 1QW9A 1YTEA 2XFRA 2DIEA 2Y62A 2Z1WA 4GJIA 5BRPA 3S6OA 4AZ6A 4Q4KA 1IEXA 4D1JA 2VZUA 4KCTA 5C6MA 3W2NA 3WKZA 4CLMA 3OA3A 1EJXC 1EX1A 3BLEA 1R3QA 1ICQA 2V3EA 2UY2A 1YMYA 1NJJA 5LNWA 4X0VA 1F07A 4KWUA 4KS0A 4LV9A 5DF0A 3M16A 2X2YA 2XVPA 2V5LA 4C6NA 4ERGA 2ZZ5A 4QNWA 3T2QA 3PZQA 1FBAA 3MS8A 4NKCA 2DT3A 2X0YA 4O10A 2I14A 1EJ7L 3U5UA 3PWGA 4F79A 3T0TA 1EYEA 2CZEA 3W7QA 3LEPA 5H91A 1BSLA 4OHQA 2NSXA 5E0KA 1P0DA 5FF2A 1M53A 1GT8A 1J2WA 1OYBA 3SCVA 1X39A 3V7PA 4AZCB 3R94A 3SEPA 4FX6M 2GOKA 1TR9A 1KXHA 5A69A 1N2VA 4URIA 3EWXA 2VEPA 3T4CA 1UR2A 3WQCA 4J3XA 1CLKA 3FXYA 3H2FA 1MRAA 1S2WA 3M0YA 3CWNA 1XBYA 1HP5A 5DANA 3GB6A 3CHVA 4LFYA 2P76A 5FF4A 4FMVA 3QZ6A 1TPB1 3CV1A 3SR7A 5I6SA 2CERA 1VCVA 2FPVA 3B06A 3ZVHA 1XG4A 5CSSA 3FDKA 3O6AA 1H7PA 1XRVA 3GBDA 1PYMA 3UZWA 3W87A 3AXXA 1FWBC 3G0UA 4J4KA 4LX4A 3WK1A 3BGGA 1HO1A 3MKVA 1D3HA 2Z26A 1AQFA 1HKJA 4XG1A 3VCNA 4IXXA 1QPKA 2A3LA 4GX9A 1EF2A 4HK6A 3LTSA 3JU2A 4QAIA 4JTKA 1VLWA 4I9MA 1HG3A 4XKYB 4DO6A 1J6PA 3SCWA 1OF8A 3V5FA 3W26A 3BMXA 4JYEA 1CXHA 2DZBA 3RX3A 3S6DA 1TMLA 2E4TA 4EWJA 1E9YB 1K1DA 4HMEA 3TQPA 4MWAD 2BVYA 5IOBA 5FCZA 1XYLA 1JDAA 1R9ZA 3LRMA 3WD0A 1GPWA 3A13A 3TE9A 1CT5A 4PGLA 3W85A 4XZMX 4JOMA 4GWEA 5T8GA 5F2IA 4XAFA 3W2LA 4XZIA 1G0CA 5T91A 1EC9A 2VVNA 4PH6A 4ZXLA 4A2RA 1YXYA 2CBVA 3WLTA 3UQNA 1MWOA 2C0AA 1JNEA 1EOMA 1OGGA 4F2BA 2PDQA 1CNVA 1V6WA 5LXEA 3EWDA 3BOXA 3CHCA 1OX4A 1IWPA 3QMSA 3DKLA 2GLKA 4WQ6A 1RUSA 1E5JA 2CZFA 2XIMA 3VK5A 3NOYA 4ATWA 2ZOXA 3NSNA 4MWAC 4JXCA 2OPJA 2BX7A 1QUMA 2DSVA 1JJKA 3T0CA 3VX1A 3AU6A 3B05A 2B31A 4E4UA 1R85A 1ZP3A 1F6YA 2WNZA 1E9LA 3P67A 3NCOA 4O1BA 1FWIC 2G97A 1TJPA 2HWGA 5HQEA 2I1OA 4WKAA 2H3DA 4MB3A 3IJIA 5A6LA 4RV8A 4Y9AA 4Q4SA 4I7WA 2FPYA 3WQOA 4BHYA 3BW3A 1Y5XA 2Y70A 2QHAA 3UPMA 2CLOA 3WLNA 1IYXA 2BDQA 4P5UA 1JQXA 3NOEA 3V4BA 1F8IA 4OT7A 1RP8A 1GYNA 3GNNA 2GYIA 1BFNA 4W88A 3BMWA 2IQ0A 2Y5SA 4GKTA 3R58A 3OG3A 3Q67A 1IR1A 2NV9A 3LN3A 3H7VA 3E49A 1UG6A 3LV5A 2WOQA 3VNZA 1PKLA 5CGTA 3VZYA 4UZSA 3XINA 1TO3A 1JVNA 4MF4A 1LLOA 2ISWA 3S6TA 1NVMA 5I03A 3KCOA 4FIQA 4NHVA 2HK1A 3VFCA 3VIOA 3ARTA 3WF2A 5AHMA 2BG5A 3VPLA 3H2EA 4C6OA 1YPFA 1EJWC 1XPYA 2AQOA 2OEKA 2PP0A 5IBXC 2NT0A 2A85A 2PLCA 4YVPA 2YXXA 1UMLA 5BRBA 1CXEA 2BVTA 2WHLA 5JBFA 3WFZA 4C6FA 5G1TA 2VEGA 2BFGA 1XDMA 4IF2A 1UWIA 4LVGA 3L68A 5B7YA 1PIGA 2D2HA 3BUVA 1JDFA 1JNDA 4A4AA 1ZB5A 4H6EA 4LU0A 4AYGA 3T8QA 1PX4A 1XSKA 3A24A 4Q6XA 1UD6A 4GI9A 3L67A 3GR7A 2GDQA 2ZVRA 4AZ7A 2FVLA 5IDZA 4LS2A 4BEUA 3BWWA 3VDBA 4RNFA 4P7LA 3BMVA 3Q37A 2VTFA 3RG6A 4HZ6A 2PA6A 1XDJA 1LCOA 3G2GA 1TTPA 1GONA 4L7ZA 1E51A 5A6SA 4A8IA 3SRKA 6REQB 1J0JA 2AL1A 1S1RA 3W07A 3IUHA 3LUTA 4EF8A 3BAWA 1OSEA 4W5ZA 4CUCA 4J2MA 4M56A 3IWPA 1QTWA 1JCMP 4WVXA 4EP8C 3LHZA 3QQ1A 5LGXA 1DL3A 1NELA 4XD4A 1U1UA 2V2HA 3RPMA 4KMQA 1CGXA 3T78A 1U5JA 3QMRA 4IMFA 3CZEA 1V7YA 1N8WA 4FPSA 4AVNA 3C2YA 3QF0A 3UZXA 4HQVA 1OZQA 2C16A 1IIGA 3K4DA 3W70A 1AH4A 3EXTA 3R0UA 4XAPA 1DJXA 5BMWA 3HJZA 4H6QA 3TW6A 3L5MA 1FFQA 5BWFA 3H7RA 3UWZA 4PN2A 3BQ5A 4PUUA 3CO8A 3CT2A 1XIDA 4B5TA 4NF7A 4BI5A 3G5EA 3MP4A 2F2KA 4P61A 3WQEA 1T96A 2OWWA 3M0HA 8RUCA 4HZMA 4RX0A 4HGXA 1J5SA 2F9RA 2HBXA 3RMJA 5A8OA 3B9OA 4GO9A 3LHWA 3STCA 1A5LC 3HPZA 4RE4A 2TRSA 3FYPA 3SY8A 1XS2A 1EDGA 4RZ6A 5BCAA 4I9TA 4N02A 4DUXA 5LNVA 1FHUA 1W1VA 2QJMA 3UY7A 1YQ2A 1RA5A 5LA1A 4K7VA 2G4JA 2A4AA 4H9ZA 3KHDA 4EWND 1DWAM 3CYJA 5AKQA 2ZTKA 3T8LA 3UCQA 1TMQA 3HTWA 1JPDX 5DO8A 1A0DA 4IP5A 3B8WA 1XWYA 1TJ1A 4A05A 1XGZA 1KV8A 2BVWA 2Y8UA 4Q8VA 1JZ3A 1DWJM 4WD0A 3AHZA 4XD6A 2R6OA 4M81A 4UTTA 1EUAA 1UP2A 2FB3A 3VYLA 4AX6A 4N9EA 3T40A 4P8UA 1ISZA 1IWBA 4ZEPA 3EOEA 5REQB 5F2LA 5D33A 4JD4A 2GK1B 4KEZA 2QEZA 4RKAA 3I3EA 4JTCA 4HNVA 4J27A 1BVWA 3PZOA 1AZ2A 3G8RA 1XLHA 1LG1A 4B3KA 3M46A 3MKCA 3VNYA 1P0KA 4FO4A 1RY8A 1WNOA 4IICA 3WFAA 2XM1A 4M0XA 3M07A 5D4YA 2CESA 4MB1A 5TD4A 1JZ4A 2V9DA 1HJXA 2X7VA 1T99A 3PK7A 3MO4A 3LTPA 4HNNA 1GVFA 3RM9A 3LI0A 4HNOA 2QPSA 2F7FA 4D8AA 3RLVA 4KESA 4QJ3B 2Z25A 2XINA 4X2RA 5JMUA 1YADA 2VGGA 1BYDA 3AWNA 4WOQA 2G3IA 2XVLA 4PZVA 4DO4A 3DENA 1RLCL 2QXWA 3KLKA 3HPAA 1FY6A 3ABZA 5AN7A 4K38A 2D73A 4E2OA 2YFNA 3ZIZA 2A7RA 2QCNA 3U6WA 1NEYA 1KBLA 3UP8A 4UMAA 4MFEA 3CH0A 2YSWA 2VC6A 2EF9A 5CGMA 2BNJA 3HIJA 3NYDA 1TSIA 4GI4A 3HB9A 3NO5A 4PE8A 3NPWA 4E2VA 1DJNA 1TELA 1EX5A 1W3HA 3VIFA 1U5VA 1OFPA 3AIEA 3VOCA 2GUBA 3G24A 1X38A 3OHIA 1US2A 2CZVA 2DP3A 1GKQA 2PDKA 3L0KA 4CVUA 2P3EA 3VC6A 2DH2A 5SWUA 1JI2A 5MKGA 1Y7VA 4HMDA 4N2YA 3STFA 4I5XA 2ZE0A 3W01A 3NQ2A 1W1YA 2NLIA 2PGRA 3E6EA 5IXEA 1OQFA 4YTRA 3XISA 1PE1A 1NFPA 1VKFA 3UZJA 1E56A 4YYFA 3W7NA 3TYCA 1E0XA 1SVDA 3UJFA 4AHQA 4G2DA 1K77A 3ZZ1A 4YHEA 1IXPA 4K68A 4DYKA 3UR7A 1FWEC 3EB2A 2ZZ2A 2RDTA 3WQFA 1VFHA 1JF5A 4WJ8A 3CL8A 1M1BA 3QEZA 1H4PA 3CZ8A 4HNCA 5I7GA 1S38A 2OLAA 1RQBA 3RO6A 3VOIA 1OVDA 1S2TA 2RUSA 4BJHA 3PZ9A 5JVLA 3G1FA 1HXJA 4IL2A 4DLMA 5D03A 6PTDA 3TQVA 1OX5A 3C61A 3WK3A 3WF1A 1XHGA 4BY3A 2E6DA 1IT8A 5BZAA 2P5NA 5I79A 1V6YA 2PWGA 3N2OA 3NG3A 3SUWA 2IMRA 5LNRA 1KR0A 4H83A 4JEJA 1ME7A 3VGBA 1MQRA 1DXEA 3P74A 2C15A 5HAOA 2RGLA 4BI6A 1MDRA 1Q2RA 3RM8A 1VFSA 4NX5A 4IHCA 1R2RA 1BXNA 1RPXA 1QPNA 3K5XA 3GAKA 1ODUA 3IV3A 3C8NA 4P2VA 3ZYZA 3T4WA 4IX0A 4UNIA 1WZMA 2PD5A 4AZHA 3WLJA 4J1OA 4C6IA 1L2UA 3OZOA 1EP2A 4MZ1A 2A3AA 4DQWA 2YDSA 3N6JA 1DIKA 5HA7A 1TPDA 2IXVA 3QSTA 1LF1A 4YMZA 4QFUA 3WJWA 1PDZA 5AZ1A 4JFVA 1IGWA 4PMRA 2PP3A 3R4IA 2CYGA 2PC4A 3SURA 2W62A 1UR3M 4QE4A 3CUHA 4X9YA 1FWGC 4ZTXA 4F0SA 1CB7B 4RNIA 2H9AA 1G4SA 4D1IA 3BJFA 4GGBA 3L4YA 2DT1A 1IIHA 3BVJA 4XBKA 3HQOA 3IJ8A 2E8ZA 3TTSA 2BVDA 3B8TA 1R3TA 3BAIA 1IEWA 4CD7A 3E12A 1UD2A 4LYRA 2WHJA 1VEPA 2QPUA 4IGNA 4CCCA 4NSBA 3OBEA 2FFCA 4DBWA 2CXEA 4L64A 1O66A 3A3HA 3CQIA 3KCJA 2WMKA 1QWKA 2A21A 1VFFA 4EF9A 2VI0A 3UU0A 2XFFA 4M19A 5GNZA 3EZ4A 4UC5A 3SQLA 2PDXA 3ZR4A 4C6EA 3WUBA 4K8GA 2IPGA 1SMDA 3FA4A 4OVXA 3TR2A 2WNQA 3STPA 3G1RA 2ACSA 4J3WA 3QY6A 4HA3A 5DXXA 3CMFA 5H8UA 3C2VA 4AAJA 3EPNA 4KFNA 5JBEA 3WDPP 4GFIA 4ONVA 4C1KA 2RJGA 1YLVA 1TG7A 3GNXA 1H1YA 3FY1A 1GGOA 3UG3A 2PDJA 4FXRA 4JEQA 1UA3A 2BHZA 2V30A 3UERA 3LRLA 1SW0A 1V6VA 5F4XA 1ISYA 1QDSA 3KP0A 3P84A 1VBGA 3WDIA 3AU2A 4S39A 1WUEA 1B9BA 1DJWA 2ZYFA 3P3BA 2VT0A 1P4CA 2HRWA 4B16A 5CBJA 3L23A 2ZFAA 4AD1A 1TRIA 4WLCA 2QDGA 3B8SA 1Q7MA 3E5PA 2XG9A 3ZT7A 4GYFA 4M6UA 4O1DA 3APGA 4LT9A 2IQTA 3GIPA 4AEOA 4JKLA 4IIGA 3CEPA 4F0KA 2GGIA 2A0NA 3BLKA 2V5CA 3K8KA 4D8LA 3PNZA 5G1YA 1G94A 4B2DD 2XVGA 1DP0A 4XD3A 4L56A 3RUBL 3S5ZA 4ZQPA 2HS8A 1I6NA 4AVOA 4MZ8A 4QQUA 1OIFA 1B3ZA 3C0LA 3QHMA 2NXGA 4FXSA 4LVAA 1GKRA 5BOFA 3M4HA 6TAAA 3UETA 1ZALA 4PTDA 3MZ2A 3BW4A 3B0XA 2D1ZA 2J66A 3MA8A 2B7OA 4KCVA 3AHYA 5G1MA 4ACZA 5TIMA 2V5JA 3LCGA 3SCRA 4A2SA 4FR6A 5CLTA 3WEZA 4B9ZA 1XW8A 4U2YA 3PS7A 2ZICA 2J79A 1XLMA 1EEPA 1GUVA 3WLLA 2BXYA 4KKXA 4CNNA 1AW1A 4HSHA 2OZ0A 1FH9A 4Z2KA 2G3FA 4GQBA 1GZGA 4DJFD 5J8LA 2QCHA 4JX5A 4FNRA 4QRNA 4S3JA 3VD3A 1E6ZA 3UXKA 1O60A 3CM4A 5A8QA 1Q6GA 3KBMA 3MJMA 1XIHA 4TTUA 1N55A 1JZ2A 4ZQNA 2J6VA 3CIXA 1KA9F 4JCMA 3QOKA 2BXVA 2PU1A 1NFGA 4PBFA 3VGEA 4PL2A 3WY1A 4AZ5A 4C60A 4R34A 4Q8NA 4MJ4A 2ZUVA 1Q2SA 1W2PA 1CGVA 1UWSA 3FYOA 2FZMA 4F3HA 2VOTA 2GL5A 3BG9A 1R30A 1E4IA 2Z27A 4YPJA 1UWUA 1S2AA 2ZQ0A 3CB8A 3VILA 2QCGA 3WNNA 4DJFC 4PMQA 2QUUA 2I57A 3KOYA 2V69A 4HOWA 2CXGA 3MP5A 3EX3A 4UTHA 1E4MM 2IUZA 3R43A 4H8VA 2WW5A 3QGAC 1DQWA 4DIAA 1X1NA 2QYGA 1LOLA 3EAUA 1GVYA 3TZFA 4LF2A 3SUVA 1UH4A 2AGKA 4L6HA 5I06A 3O0KA 3HPSA 2Z4GA 4YTSA 4JTAA 4MGGA 3EEZA 1W8SA 2E3ZA 1JF6A 4LGXA 2QCMA 4DLFA 1BKSA 1G7UA 2CEQA 3IARA 3VVGA 2WMJA 1LOQA 4UR8A 1JCYA 3ARQA 1JXJA 3ABSA 2BSLA 5EB8A 5M5DA 2J6XA 5FKYA 5A2CA 3N19B 1TPH1 4JTIA 3CMGA 4KEVA 4JTRA 5MF5A 1E6PA 4J3UA 3QRHA 5HK4A 1XX1A 3VIHA 3AUJA 1GOWA 4HMCA 3PAJA 3BO9A 5KTLA 1AW5A 2ISVA 4Q3MA 1HJUA 3GW3A 4A3HA 1AMYA 1F8MA 2QGHA 4O14A 3ALGA 2Z2AA 1FWCC 3C2FA 1PO9A 5HDRA 4FS9A 1P1XA 3ZMRA 1Q6RA 3UF9A 1A4LA 3NL5A 2HCVA 2YXGA 2VXNA 2D2JA 4AMAA 4TX6A 3BLDA 4A3YA 3ANYA 1GW1A 1E73M 4W5UA 3AROA 4L1WA 3BV7A 3RO8A 1C9WA 4KGLA 3UR5A 5M2FX 2V6AA 4CQ9A 4C6MA 4WDTA 1V7AA 3GDRA 3QYSA 3DECA 4LEQA 2R1MA 2JKAA 3L21A 1OINA 3EMCA 4E38A 3BL3A 1J0ZA 4NZ3A 3CZJA 2H6RA 1JXKA 3VIGA 5E0FA 3EX4A 4O1EA 2V2CA 1QI4A 3WLIA 1YDVA 3TSDA 4AIEA 5CC7A 3H12A 2YDRA 1G4PA 1Z7AA 1V0MA 3O15A 1U1JA 1K03A 1BYBA 2PP1A 3ITCA 1Y65A 5HMFA 3PJXA 3F4VA 3NL2A 2HXUA 2R1KA 5C9WA 4ZO9A 3GKFA 4LEFA 4P7NA 1F4HA 3FXGA 1F61A 5HWMA 5J04A 4NVTA 4V1YA 3R8GA 1ZRQA 1MZRA 2O9RA 5CSYA 4L1XA 5DMYA 2VR5A 2VEFA 3QZEA 4IJBA 3RJXA 2NX9A 1XIJA 2G37A 3CUZA 5HR7A 3GC4A 4NRSA 1R9YA 1ZSXA 3E0LA 3EWBX 1BG9A 3B03A 4AIUA 1IEVA 2XM2A 5IHSA 2G3JA 3QW4B 3L66A 4TU1A 5KINA 1B31A 3S8HA 3ITTA 1XC6A 2YCEA 1SZGA 1V4YA 3NGJA 5IRPA 1QOQA 1EA9C 2QPXA 3W24A 2DV0A 4XISA 2PWUA 3HA1A 3AYVA 3P6LA 3OO2A 3CUXA 1XH2A 1I60A 4DF2A 4NP7A 1H5YA 4ZB2A 3MDUA 1HVXA 1XP3A 4MYAA 1F3WA 2Q01A 3NXLA 1H0IA 2E68A 2PWEA 4NASA 3KWSA 1H63A 4GACA 4HSNA 3R0KA 3MUZ1 3TC7A 2VQTA 3OIHA 3P62A 3TLQA 1O68A 1JPMA 4LBRA 4IJCA 4PL1A 3MI6A 4HK7A 1UR4A 3N4FA 3E0FA 4TOQA 1BWLA 4M24A 3W1RA 1ZP4A 4KRUA 4O16A 1IGSA 1FDYA 2YA0A 3A12A 3SY1A 3QKEA 2WHMA 4PUMA 4QITA 4H3DA 2W9MA 2VUYA 2CU0A 1XINA 4GY1A 3M0KA 4BWLC 9XIAA 3UW6A 3DHDA 3EA3A 1FWHC 4LUSA 5J5RA 2FJUB 1FRBA 4OTKA 2GPTA 3OYXA 2ZZ6A 2J24A 2BY0A 4YS1A 1MXDA 4GK8A 1BQCA 4N4QA 3BLFA 1DBTA 1G9HA 5XIAA 1BKHA 2ZBTA 2WAGA 5DMNA 2E67A 2DGAA 4CQDA 2IKGA 3PTQA 4B5UA 1XM3A 2WVVA 1TUFA 3MU7A 4EKJA 3RRXA 5I02A 3I6RA 2E9LA 2CHRA 3COTA 4RXGA 2QV4A 2OEJA 4GYJA 4BKNA 4Z2HA 1A5OC 1MXGA 3UYIA 4S23A 1K7FA 3TNBA 4MWAB 3VNKA 1AG1O 1M01A 4G9PA 2CWNA 1W5MA 2PDLA 2DZPA 4DBDA 3O06A 1XH0A 2HNEA 4RR4A 3W29A 1E3XA 3KVLA 2HROA 1M3UA 1W0MA 4Q6JA 3ID7A 4Z17A 5TAOA 3WLOA 1YE4A 4MY1A 2GWGA 3A5VA 4XIMA 2GJXA 3VDGA 2CBUA 3OJGA 3EWZA 1KFEA 3TOYA 3VI2A 3W7LA 3GHTA 3DHUA 3EKLA 2WB5A 1WOAA 4EK7A 2J8GA 3N14A 4XAZA 1KQZA 1OK6A 3ITGA 4L6OA 4HOXA 1UWRA 1EPVA 1U1HA 2VL4A 5K9DA 3A5FA 2XN0A 4H19A 5PTDA 3CPRA 3GXFA 3M0LA 1VBJA 4MM1A 3PANA 5BNKA 1VR6A 3L0NA 1IV8A 3K2GA 1BD0A 3W2JA 4NNAA 1WCGA 3CPGA 3GTXA 2XIOA 1WUFA 1PUDA 2V3FA 4QG6A 1KV5A 2YPIA 2YLLA 2ZZ7A 3GD6A 5AC4A 3WD3A 2VKZG 1WDRA 1ME8A 4MOZA 4NRRA 1JCXA 3PBWA 2DZTA 2CWXA 4DJEA 3T42A 3E2VA 3NZGA 1N82A 3TYEA 4YXGA 3WMSA 1FP8A 3AMCA 2BODX 3VUSA 4LAUA 2GQ9A 4QIUA 1QHZA 1KGXA 3MMUA 3TWBA 4O17A 4RDYA 3E1F1 4HZ8A 4MADA 4PODA 5U7SA 3THAA 4RW5A 3M43A 4EPKA 2IQDA 2WSRA 2TSYA 5FJTA 1OG6A 2Z7KA 4Y2WA 2JIEA 2OT0A 3CTLA 5H2ZA 2OEMA 4QDMA 3TN5A 1W1ZA 2CIPA 1DJZA 3EPMA 1OC7A 5ABHA 3WDRA 1SM9A 1VRXA 2WCSA 3IVUA 4E3VA 1S1PA 1W3JA 2YL5A 4J7RA 1NDVA 4KIEA 3AXMA 1DYSA 4CCEA 2D3NA 5AC6A 1E43A 3R25A 3EKGA 2YB1A 2X1SA 1VFUA 3W2KA 3W25A 2GVGA 3QMTA 1LBFA 5JIPA 1U33A 3NZRA 1UA7A 4JIIX 4HA0A 7TAAA 5FACA 3A3WA 3VE9A 1I2PA 2A5HA 3WNKA 3BJTA 5LZLA 1WAUA 3SW6A 2FIQA 4DI8A 1V5XA 5MKGB 3BLIA 3ISIX 2DSZA 1P6WA 3SN0A 1KTCA 4YIWA 3NQBA 4UQCA 1GQJA 1E0UA 5IFPA 2PD9A 3LENA 5CC6A 1RCXB 1MI3A 1M7JA 1S5WA 1G5AA 3UPBA 5CPOA 2AAMA 3II1A 2QAPA 3POCA 4OV9A 1VYSX 4GI6A 2QUNA 3LCXA 3A23A 4QSFA 2WMIA 3LCWA 3CQ0A 3QQ0A 3VINA 3TW7A 3SUTA 2X41A 2FTPA 4GUFA 4H8NA 4JY8A 3CUIA 3UWYA 2X30A 2Y5EA 1KD0A 2OO0A 3B04A 4W93A 1XDLA 1GJPA 3VM5A 3AIUA 3W1UA 1LT7A 4E8GA 4QSHA 3CV2A 4S3EA 3CTTA 1B3XA 3NURA 5I3GA 3AHXA 2KX9A 1Z89A 3KRZA 3D46A 4IP7A 1KNWA 2RKXA 1UJQA 2DZSA 2CLLA 2OZ8A 3DC0A 1AVAA 3P5YA 1HF6A 5A6AA 2R1LA 3SIZA 2X0HA 2GUUA 3LLFA 3S1WA 4GJJA 1MDLA 2D69A 4H4IA 1NH6A 3ANVA 2Q02A 3QFWA 3EB4A 2GGHA 1KCLA 3W28A 1XBXA 3P14A 4WK9A 2DY3A 4GYKA 2QS8A 3M0ZA 2MUCA 4GXWA 3ZWSA 1W1PA 1DWGM 1FDJA 3T0DA 1BQGA 3MY9A 3VOHA 3UYCA 4Q4PA 4MB4A 3S2JA 6ALDA 3G1HA 1FXQA 3PY2A 1S5NA 1DTUA 4GA8A 2XUCA 4X22A 4O52A 4MYXA 2H90A 2H9AB 1TWWA 3G1YA 1I8JA 5DLCA 1JYXA 4AIOA 2OXNA 2FLIA 2GGEA 3M5XA 4C1NA 4B5XA 2HBVA 3INPA 3F1QA 3LCHA 4O11A 2CFFA 4L9ZA 4IFKA 1TQJA 3LBOA 4G1KA 3MKKA 5LA2A 1OABA 3TOPA 4M51A 4QM1A 4FX8A 3HG4A 3EB3A 1I2QA 2V5DA 1U5HA 4Z1BA 1QT1A 1XUZA 3QQWA 1IZCA 5CPNA 1DIDA 4HPGA 3NQVA 1S5VA 2P1FA 4Z0JA 5EBUA 3MUXA 1OT2A 1H09A 1ZPTA 4LOCA 5ABGA 3TJIA 2X16A 3CK5A 1R38A 1VF8A 1SFSA 3K4AA 4ZOCA 3ZR5A 1UKSA 2G41A 2C1GA 3AALA 1KM5A 3FV9A 2FKPA 4GE8A 4YHGA 1UD4A 3JZUA 2Y89A 4FAMA 3W76A 4LVBA 3NWRA 4TX8A 1Z9AA 2ATSA 4A22A 1L9WA 3LNMA 4TMBA 2PRMA 3PPCA 1JDEA 1B5TA 1L0PA 3MHUA 4DEFA 1FOBA 3CZGA 3M5ZA 1GQNA 3QKZA 2Y6ZA 4IUOA 4YVXA 5A6TC 2R24A 3R89A 2QCEA 5GQBA 1VD6A 4WDXA 5D2XA 4KCUA 1H60A 2J9ZA 2WO5A 4ZO6A 4Z2GA 4PYSA 2A79A 3LMZA 1HN1A 3EXSA 1UR0A 1OZMA 4IQDA 1EDQA 4RV3A 1ZY9A 4ZR8A 3UZYA 2ZUNA 1JRCA 4CVWA 3Q58A 4Y8FA 3WZ0E 3F2BA 4O13A 3U48A 5CH9A 4W8BA 4O1CA 2Q8LA 4O8RA 1V0NA 3TROA 8CGTA 2DPEA 3NEVA 3WF3A 4ZVJA 4E8DA 5M17A 4DJDD 4ZOEA 1Q6FA 4AX7A 1ZCOA 1J8VA 2G0WA 3WX7A 5I0DA 1EJSC 1TB3A 1S2VA 1OFOA 5C71A 3HOJA 5BYWA 4A35A 3BW2A 3WIJA 2WVUA 3BLOA 3TN6A 1FUYA 3RCYA 3E74A 1CXFA 1IWAA 3RCMA 4JR5A 5HPOA 3AAMA 5BRQA 4QQ3A 4ACZB 4TQTA 4AVFA 4HVXA 3H6OA 3U4AA 1HL2A 5G2WA 5D2TA 2PWHA 1MUWA 1JL8A 4HKPA 4EANA 3AJXA 1JZ8A 3NVTA 4CNTA 2BV9A 3GK0A 3KEHA 3A47A 5AYYA 4IGMA 4Q8WA 2Q3OA 4HPXA 1LRTA 2VD9A 3S2NA 2R9RA 2W67A 4FLRA 5ENLA 4US5A 1NF7A 1V08A 2QJIA 1W5NA 2XGBA 1UD8A 1KM4A 3UXIA 3WMCA 3MZNA 4NU7A 4J3SA 3SRDA 3MSGA 4Z2LA 4AD2A 1UW9A 4BCEA 1LQ2A 4R85A 3P61A 3WUEA 1T0OA 3GH7A 5ABFA 1O4UA 3SFKA 4JL1A 1KXVA 3NQAA 3VABA 2PPGA 2WJEA 2DFAA 2NZLA 1VS1A 3PTDA 4G7EA 1R2SA 4MFDA 4NJIA 3ARPA 2FDMA 2VFIA 4DVOA 3EWYA 3GKAA 1MVYA 3IIXA 5I3FA 1JD7A 5FEWA 2IPWA 4LCQA 4WR3A 5F4SA 1F9CA 4IX2A 1YPIA 3DFHA 2PE4A 3EYPA 3P60A 2R14A 1OM0A 3SY5A 3TV8A 4ROPA 4C6DA 3CQJA 4CNUA 4C6LA 1Y0EA 1Z48A 4JYFA 3MMWA 2XZ9A 4QR6A 3RDKA 4DZHA 5A6BA 4J3VA 3GTIA 3HF3A 5JU6A 3GUWA 3UG8A 2B7QA 4W7UA 1EJTC 4OOUA 4GRSA 4BF5A 1W3KA 4JL2A 4C5ZA 4CQ8A 4CNSA 1TJ0A 4JTLA 4PMJA 1Q6OA 4IQLA 3UG5A 3KLLA 4CN4A 1M7PA 1FCBA 1W3IA 2ZIDA 3DG7A 4JFTA 5A95A 3HPFA 1HJQA 3I7SA 4ZQRA 1H7RA 3PUDA 3NFUA 1LWIA 5F1UA 4ADTA 3REQA 3IJ6A 4M5PA 2DEPA 3EX6A 3GU1A 1QI3A 1XYCA 2DZXA 2IKHA 5HUPA 4QCEA 1R46A 2O9TA 1BVNP 4MNKA 3M7WA 2Y88A 4ZCWA 3P2VA 2CPUA 4O1FA 4Z08A 1VBHA 4I8DA 1UP0A 1NTHA 3W71A 5DRIA 2UBPC 2GVLA 3IJDA 4GVFA 1RA0A 4HBKA 4NZJA 3UZ5A 1OCNA 5CC3A 1WDWA 1M65A 4IIFA 5BROA 3AWOA 5C5YA 3W7DA 4NZFA 1E1CA 1Q85A 4V15A 1H1NA 4OWGA 1ZAJA 1G4TA 3DZ1A 4Y8EA 1QRQA 3TSBA 3AICA 2O92A 3CYVA 1UR9A 3E3HA 2VZOA 3KBVA 3V0SA 1MQPA 1NOWA 4AZGA 4BR1A 4HJFA 1VEMA 2INFA 3GHRA 3NJ3A 3UEQA 4V1XA 2TYSA 2VC5A 3V5CA 3K30A 3GXIA 3AXIA 2VM8A 1XD1A 2JE8A 1IZKA 4K36A 4XSLA 3VOJA 1X6LA 3H23A 4N42A 4IPJA 3L4TA 3HMJG 3N15A 4LBUA 4FNSA 4J35A 1A3HA 3RCNA 5E6YA 1GEQA 3SAZA 2DJXA 1O1ZA 4XX6A 3OZMA 4ZB0A 4GHRA 3BSMA 3FKRA 1K8XA 4DJDA 3S1UA 2OMAA 1GCYA 1CGWA 3ARWA 1UC5A 1JQVA 3D47A 4PB3A 2XVNA 4K37A 3GDMA 4IXHA 5A3HA 3SQSA 3OGSA 2VRQA 2Q3RA 4GXPA 5KSWA 2VGBA 3NIYA 1O5KA 3H2OA 3SECA 5BW6A 5I77A 3BLPX 4K2SA 4ZZ9A 2V82A 4PUNA 5I24A 3H2AA 3MHGA 5BXPA 2J47A 1QNSA 2Z1XA 3KZPA 4DXVA 2WJDA 3N1AA 4M6QA 3PP7A 3LU2A 1QPOA 1VFOA 1VBUA 2NUWA 3EGJA 2YX0A 3WQVA 6CGTA 3QV7A 1ONXA 4ES4A 4CD5A 1AH3A 2PURA 1TZ7A 5XIMA 2JKPA 1DKWA 2DUAA 1EJRC 1WX0A 4UOQA 2OKOA 4PEKA 3U57A 1IQ8A 3G77A 3NGFA 4AMCA 4L4PA 2A7NA 2QGYA 4W9TA 4L4OA 4S2BA 3TJXA 2GSJA 5EKYA 1M7OA 4LW7A 3UG4A 2J7GA 1M68A 4L65A 1W3LA 2NXIA 1CTNA 2FTWA 3VFLA 2XIJA 1XIMA 4LF1A 3USZA 2HMCA 1G69A 1VIWA 1XQKA 1X1ZA 3P5ZA 3GUGA 2ODOA 1IT0A 3OQ8A 4AHPA 1NDZA 2SFPA 4WY0F 4F66A 3AJ7A 2JFEX 1M6JA 2NXHA 1G6CA 1TVNA 3PG8A 4P7OA 3BURA 3W38A 1IR2A 1POJA 3IRSA 3GTNA 4O4VA 4UIOA 1DE6A 1JDCA 4JQ4A 7TIMA 2DDXA 4D6HA 4GNVA 3THUA 3WQGA 4LUSB 4WIWA 3CAKA 1JZ5A 3M0VA 1QPRA 3W02A 4JTEA 2HTMA 2YA1A 1ITXA 1SZRA 7XIMA 2FHCA 4C6CA 3KVKA 4Q4MA 1RCOB 1RJPA 3STEA 4W4QA 5AB3A 3W4RA 2CCRA 4ML4A 3GDBA 4TVCA 3OYZA 2NWSA 5F2MA 1R87A 4MKVA 2IXUA 5E1QA 4MAVA 4DPQA 4DN1A 1DTNA 3PBMA 4W87A 2WVVB 1EO7A 2PGFA 1NDYA 1XYZA 2OLHA 1SJAA 2BY1A 2ESCA 3PPFA 3DFSA 4LAOA 4GIAA 4IZGA 4REQA 2JGQA 4XSMA 2XH0A 3GM8A 1B3WA 1N8FA 1OC5A 2PCEA 3PM6A 1JPKA 2DU2A 4JIPA 1AJZA 3UVAA 4LUTA 2J7CA 2I16A 2OZTA 3W7HA 4L4MA 1B3OA 3TEVA 2BHUA 4UCGA 2VQUA 4YTTA 3W7JA 2YBVA 1KTNA 2V63A 1F6PA 1O7AA 1WBJA 2GJXB 4MDPA 1QK0A 4NJJA 3DGBA 3QLLA 1PBGA 3BDKA 2PDMA 3LPFA 4MZYA 2NT1A 4PMYA 3PUOA 2XVKA 4XTDA 3TUUA 4AIBA 1YEYA 3GH4A 2D23A 3RYSA 1GVQA 3T2PA 3Q65A 4UTJA 2R8WA 3WF0A 3O3RA 2QUMA 2WQDA 3CO4A 2Q8XA 5I3HA 3LOTA 2YKKA 4PA8A 3W6LA 2A6LA 4PUEA 3CB3A 4NAFA 1FCVA 2CKRA 1C3FA 1CEOA 3KW3A 1TFVA 4X61A 3V3WA 4C7GA 4AC1X 5DT5A 4B5NA 4IMEA 2DUZA 2ZZ1A 2YDQA 4IIBA 2WZTA 3IACA 3GU2A 3H55A 4BK9A 4L5ZA 2X1RA 3W0KA 5FAGA 1VP5A 3GS6A 1EFZA 4UTLA 3W74A 2XN2A 4QS6A 1ISXA 1CLVA 3BPWA 2J7EA 2YDAA 4W84A 3GR4A 3KL0A 4F0RA 3U3HA 2XFYA 2I7GA 4C6QA 1MSSA 1EL3A 2D22A 3DHFA 3APYA 1V3JA 5AYZA 3WQDA 1Q63A 4H00A 1SO3A 3WLRA 4IMCA 1C29A 2HE5A 4LY8A 1T40A 2VCBA 4V28A 4JNMA 4CQAA 2VENA 4R53A 3O8AA 3F4NA 3R8RA 2ABBA 3G1XA 4H9TA 3BTNA 4LS1A 1IXNA 1M7XA 1DHPA 2GGJA 3B9NA 1EWEA 2BTMA 3C2EA 4QISA 3KOZA 1ADOA 3VKAA 1FWJC 1OX6A 1UP3A 4PRRA 2V68A 3UNDA 2WC4A 4JQ1A 1KFCA 1TYGA 1FKWA 1A5SA 5DBTA 3UXDA 5FI8A 2Q8ZA 3RMEA 1BHGA 1ME9A 3CV7A 3WEOA 1D8WA 2Z0IA 1TRDA 2CBJA 5JQ9A 4HHPA 3K46A 1HIZA 1PEZA 1UUQA 5G5IA 1EGMA 2CLIA 1FWNA 3R13A 2NVCA 5KEZA 1TPFA 4JCLA 3KE0A 2HVOA 4RK8A 3KXQA 1TV7A 1TV4A 1EC8A 2C7FA 3SCPA 1ONRA 3IGUA 4XUYA 2GSHA 1ML1A 3WBEA 1RPKA 2X0SA 5FOOA 1TA3B 4JHMA 2NX1A 2OJPA 3WBWA 3ERPA 3H2MA 2Y4SA 3LHYA 1O6IA 1XLCA 2FVMA 5GNYA 1JYVA 4LUJA 3LI1A 2ONEA 3P80A 4S3FA 4R88A 3CLMA 1GOIA 1TTIA 1PHWA 4HZ7A 5G2HA 4EPDC 5I23A 3QN3A 3W9ZA 3B0UX 4J3TA 1NP0A 1EOKA 4MAZA 5HNUA 3T9PA 2XH4A 1FWFC 3L7RA 2F6XA 1UZHA 1VBRA 5HPCA 2WMIB 1TCDA 4U5IA 4KWOA 3FIGA 2I5IA 3WYZA 1W32A 3UZZA 3LPOA 4OECA 1FWSA 1B9ZA 2FZBA 3NTYA 3SCUA 3MWAA 3UPWA 1FWAC 1GWJA 2D0HA 4UOZA 1JAEA 3EA1A 3TTYA 2J8FA 2PZ0A 3NM1A 3GR8A 3WH9A 1QWGA 3UBPC 3CASA 2EKGA 5CZTA 2AAAA 3BAYA 4NJHA 1US3A 2ALRA 4GJ1A 4GY7A 4JPGA 3VCRA 1AA1B 5F7UA 1EF3A 1THFD 5DMLA 2YOCA 1XLJA 3UFYA 1TREA 1SQ7A 1K7XA 1HKVA 4CNPA 4D71A 1WKFA 1Z6KA 4AUBA 5C54A 5A8PA 3T1GA 2W0UA 1KBJA 1ZJIA 1DIOA 2VR4A 3W1XA 2OYKA 2W27A 1V77A 3V35A 4F0MA 5DN1A 2CLKA 3MI3A 3T7VA 5FESA 1S5MA 1ZTVA 4TTGA 3SSZA 1P7TA 2QV5A 3QPEA 1C92A 2EO7A 1GVRA 1OHLA 1TE1A 3MUCA 2WZEA 2V3GA 1XLDA 3VO0A 2WMHA 1W56A 1DHKA 5IDIA 3UT0A 1H50A 2DIJA 2ZUMA 2IPJA 4C1NB 1M04A 2Y8KA 4U10A 4CEUC 1XBZA 2G5WA 2C0HA 4IFKB 1V79A 1ZU8A 1XKYA 3MUIA 1TTQA 3VKCA 4OUEA 4YCPA 2PTZA 4QJ1A 4ZQMA 1YKWA 4PCSA 4LALA 4Z1YA 4S3CA 3DAQA 5LNSA 3GDTA 1F5ZA 2QW5A 4YN5A 4FF5A 3T0BA 2VGIA 3H8AA 4PBGA 3M1ZA 2V8ZA 3DFTA 1PKMA 1P43A 2KZHA 1KFBA 2YZ5A 5FF0A 4PMXA 4DO5A 2Z00A 3W53A 4B5VA 1KLZA 1UKPA 3AIQA 4UFHA 2HSAA 1GTHA 1HKIA 4QLKA 3PZMA 4IL0A 4HYRA 4LCRA 3AMDA 3PBVA 4ZMGA 1QCWA 3O07A 4MKSA 4EACA 3TVAA 1TV8A 2XWDA 1ONEA 3V1PA 4S38A 3FSTA 3O6YX 1HNYA 3ZLGA 3PZIA 1JUKA 2GQ3A 2V67A 1SJCA 1TKKA 2QMKA 3DHPA 5KZEA 4M80A 5A1AA 4BA0A 2HJPA 1H7WA 4FLSA 4AFYA 4S3AA 1I0BA 4DF0A 3VDCA 2VFEA 1K3UA 1FH8A 3GNRA 3CHDA 3A6OA 1SR9A 2O4MA 1KCXA 3LHVA 2OOFA 3O6DA 4G6CA 4HNLA 2HE8A 1C7TA 1HL9A 2JQXA 5ABEA 1GOOA 1QOXA 1G1YA 4YU1A 3TWAA 3OLIA 3U2EA 2WLZA 1D8CA 3MCOA 4HPNA 3M0IA 5JXQA 1KM2A 3Q45A 1CCWB 2JF7A 1HKMA 3DERA 4XZNX 3P93A 4B3ZA 5ABTA 4BS0A 1JCJA 4S3BA 2CBIA 2Y61A 1LL7A 2A3CA 3BC9A 3RJYA 4OBSA 2Q6ZA 3NQEA 4QJ4B 2QQ6A 6ENLA 3VKKA 2O0TA 3LDVA 4RZ4A 3ZR6A 4V33A 1XQLA 3V16A 4C7DA 1S39A 3V75A 2O7QA 3I4KA 4GVGA 1PSCA 4GBDA 3M5YA 4FOUA 2WVTA 4AY8A 2W79A 3W00A 2VOMA 4AXKA 1MFUA 4UFLA 1GQLA 4W7VA 3BXWA 1HKKA 1K6WA 4YL2A 1I75A 1HJWA 3AMKA 1X97A 2FH6A 4GYPA 2P8CA 2ZZ3A 3B9AA 4AW7A 1QNPA 1OC6A 1JZ6A 4O0QA 4JNYA 3PFMA 1WXZA 1DJIA 3W88A 3CWHA 1SZFA 2PGEA 2NQJA 4ZOAA 4AISA 4XVEA 5CXPA 1WZAA 4P7RA 4R7JA 1DWIM 4DAFA 4L4LA 1OF6A 4EPBC 1HP4A 3B8UA 3M41A 1TQXA 1MYRA 3NQFA 3ECQA 5ABFB 3AFBA 2EPKX 3W1PA 3KBJA 4XIAA 1E1EA 3KBWA 1EP3A 4AEEA 3THDA 2BZNA 3KOWA 4GI8A 5IHRA 3WEMA 4DO7A 1K6AA 3EDKA 3WJYA 3KUMA 4FXFA 4HP5A 5EMJA 3BARA 2FMOA 1ADSA 2PUZA 3BE7A 2OX1A 1T8QA 1BYAA 4RZBA 6A3HA 3AIRA 3MI2A 2Z24A 3PWAA 4G8TA 4FALA 2NQZA 2ICSA 3A4AA 2J77A 3LQLA 2NX3A 2J9YA 1VIZA 5B7ZA 4WDWA 4WX2A 3T09A 2PRHA 1PKYA 5FF3A 2TPSA 3TYZA 3BSHA 4HPJA 3SDOA 2ZTJA 2E9MA 2NVDA 3WQWA 3EMQA 3JS3A 4LCSA 4O15A 2PZNA 1VCGA 1EWDA 3QHNA 4XK2A 4O18A 5D2YA 4UTTC 1B90A 4MSSA 2HZGA 3HG5A 3BZJA 2OVLA 2XIIA 1ADDA 4DBEA 1JIBA 1HT6A 2I56A 4ERAA 1O12A 1BYCA 4PFHA 4N0RA 3QPYA 2W92A 1GVSA 3H2CA 1L8NA 2ZDSA 5AY7A 1L6FA 2EKCA 3OPSA 4MMWA 1UR1A 1V3MA 3GXNA 3H4WA 4PULA 4A3QA 6TIMA 3H4GA 2Z6JA 5HOSA 1TVPA 2J7BA 3RHGA 2I9EA 3W37A 1GOQA 3GXPA 1KXQA 4S2CA 4N6EA 2REQA 4LJ3A 2ABAA 1SZNA 2YB4A 3QY7A 4CU7A 3M7SA 4ZE5A 1E1CB 1UWQA 1WKYA 1TPWA 3R6IA 2VZVA 2G96A 2PDHA 1DXIA 3DCPA 1AD4A 3I10A 5CSRA 4JDBA 4PBEA 3PTMA 1PV8A 1QJWA 2JKEA 5M1TA 4GY0A 1CGTA 3LHTA 3NZ1A 3EBVA 1DV7A 2PODA 1TTJA 3ARXA 3EOOA 4HT3A 3WG6A 2XSAA 3ARSA 4MTVA 4UTKA 1QOPA 4DWDA 3TTEA 3V1HA 4JYDA 1WOBA 1HJVA 2AMXA 1K9FA 3QM3A 1W54A 2RDXA 2Z29A 2VRKA 3W2UA 4GINA 5LIWX 4C65A 3PAOA 3OBKA 3NQGA 4EPEC 2PS2A 3GY1A 1BGAA 2X42A 1KW1A 5FL0A 3GXDA 1Q7QA 2YYUA 4H2HA 1OGSA 1Q3NA 4Q4OA 3S1VA 3R1ZA 3DUGA 4YTUA 2DZVA 4HHMA 2BGNE 2I9UA 1P5BA 1OEPA 4AF0A 1PZ3A 2NQ9A 1PL9A 4GH3A 3ZT5A 2XYLA 4ZQOA 3W7CA 5D04C 1EQCA 3WNMA 3IS4A 2E40A 4QE5A 4QHRA 4IMAA 1E6RA 2C79A 4Q8TA 2QCDA 1YX1A 4UTIA 3WH6A 1GNXA 4YLWA 3CPUA 4XVDA 1YW1A 4S3GA 3VNDA 1D3CA 2EPOA 1YDOA 4ATDA 1XL9A 4UB9A 2XPKA 2ZA1A 3GFZA 3GFXA 3MJYA 2HQAA 3JW7A 1MNSA 1UPMB 4NI8A 1U83A 1A5KC 1J0YA 4XAYA 1W8GA 4LVFA 4ZO7A 2B4GA 2QMJA 2IS7A 1FCQA 3KX6A 2VZSA 4HCLA 3FDGA 3AS3A 3C2OA 2NQLA 1JGMA 2A3HA 1BWKA 1MW1A 4Q4RA 5L9FA 1UQYA 3OBAA 1GKPA 4RCXA 1J0IA 4I6KA 1BRLA 1KLYA 2F8QA 4AB4A 3QTGA 5G2IA 1H49A 1W9UA 1TPEA 2YL9A 2QUVA 3ELFA 3PZTA 1ISVA 4ZTYA 2ACRA 3OIXA 1WDSA 2PTDA 5K3VA 3LGDA 3UGRA 4LNCA 1R9XA 4R9XA 2VVSA 3W6YA 4PRTA 3NSMA 4IPNB 1V0LA 3FYYA 1HZYA 1LRQA 1DORA 2GOUA 4W86A 3VTRA 3U0HA 2OT1A 2YBUA 2QAFA 4LUYA 2AOSA 2PLJA 1E4NA 2J7HA 3L5LA 4IMGA 4GCAA 4LRSA 1K70A 3N12A 2VDHA 3LPPA 3PPGA 1SU5A 4CCDA 3V0TA 5D02A 3OVPA 1AK5A 1RALA 1UUMA 1WE5A 4JN7A 3VM7A 2DVUA 4REQB 4E0CA 3WH7A 4IFOA 1AFSA 1RBAA 1JUEA 4CD6A 2P0IA 3AUOA 3R2GA 3D5HA 2ZC1A 2ISSA 1D3GA 2VURA 4RE0A 4LTSA 2INZA 3VDHA 3FS2A 2A3BA 1RSCA 5CQ1A 3LERA 3OQEA 2VX5A 1NWUA 1L6WA 1QASA 4DUVA 2EPMX 4KETA 5LKYA 3L4ZA 3MBFA 4JIHA 1MQQA 4D6IA 4JTDA 1E70M 2ZUUA 1ALDA 2PTXA 4UQAA 4GPNA 2BHYA 3SZ8A 1E72M 4I9JA 3CV6A 3ZQ9A 1BVZA 4EXAA 1UWTA 3KDOA 1OD8A 1H7XA 3GVWA 4M1RA 3G3DA 1UKOA 4BEQA 3QLDA 2A3EA 2BB0A 1HW6A 4DBSA 1KGWA 1YIXA 5EGRA 4W7WA 2FQIA 1F3EA 4NIRA 3FX4A 4NAFB 2XDFA 2X1IA 1KQYA 3U5YA 3PR2A 2HPIA 4LB4A 3JZEA 3N34A 1VPQA 2X1UA 3V5OA 3DFOA 5AC8A 1UKTA 1XJBA 4UTMA 3H21A 2GJPA 4R3UA 3M6DA 4N7QA 3MMTA 3EA2A 4U2ZA 1QU4A 4AQLA 3FGCA 4PMNA 1DJQA 3SO7A 1MRQA 1NAL1 2XU2A 3HGOA 5JIWA 3QVQA 1F74A 4Y9PA 4E3TA 4WHBA 3OLGA 3N2XA 5I3KA 3HGSA 4JBRA 1BTCA 4XZHA 1PKNA 2OELA 3QSRA 4X63A 3AYSA 5DCDA 4QBXA 3U2CA 3AOFA 3QZAA 4XZWA 3TN3A 2JIWA 3FW6A 4H2CA 4TXEA 4MWAE 1US0A 3MPGA 3VD7A 1PX8A 1XLGA 5C9ZA 5K2ZA 1BAGA 5HATA 3WF4A 3VCCA 4YWIA 2OWXA 3ZLHA 2RHGA 2O9PA 2PF0A 4YYCA 1W9XA 2WCGA 3JRKA 3FAWA 3UD6A 3HQNA 5BU6A 4ZGYA 3W7PA 2Y2WA 4DWSA 4A6GA 1FWTA 1VYRA 1MZHA 3QV9A 2PWVA 1LWHA 3CAQA 3IVTA 3PFRA 2Y8VA 5RUBA 1RK5A 4FP1A 2C1HA 3M47A 3Q94A 2ZKMX 3VOGA 5A2BA 4QROA 1M5WA 1ECQA 1XPGA 2F38A 3A4JA 1JR1A 4D72A 3TCEA 3CL6A 1LROA 3PB0A 2BWGA 1D7KA 4Q4QA 3E0WA 3TMLA 3MSRA 3S2LA 1N7KA 3LZ3A 4HTYA 3S1XA 3MYOA 4H9UA 3RU6A 1VPXA 2HK0A 3CC1A 5HULA 4U33A 3THCA 2C6QA 1UOZA 3S1GA 3BG3A 1FCUA 3E02A 3WK2A 1T7LA 1P48A 2OGJA 2DT0A 5I09A 1C7SA 5D38A 5D9MA 2PDCA 3QV8A 3MV11 2GGGA 2NUYA 2ZRZA 4WSKA 4IFRA 4NILA 4F8XA 1ZBCA 3M0JA 2BY2A 7PTDA 1AJ0A 5I3DA 3TQ0A 4QS5A 3LCFA 4NZCA 1FKXA 1KBBA 3TP4A 1O5QA 1ZJHA 5LIXX 4B92A 1LQAA 1W3NA 1E40A 1Z44A 5KZ6A 2PLMA 1U22A 3GC5A 1LG2A 3GVRA 2XISA 1YBQA 3CHEA 2PI6A 4V27A 4HPHA 1A3XA 4KFPA 5C2XA 5CZJA 3GVVA 1HL8A 3N4AA 3HV8A 2JBMA 3E0VA 2QDEA 3LBCA 4XD5A 4EXQA 4LC6A 1AJ2A 1K8YA 1DE5A 3UJRA 1W2VA 1BTMA 1KRAC 3QY8A 3W82A 4FB7A 5A8NA 4OV4A 1P6CA 3B0VC 3VIPA 1QNRA 4HD5A 3TAOA 5K9CA 1DXFA 3BOLA 4DYEA 1L8PA 5CBBA 1DVJA 4ORIA 5CZKA 4DXKA 3I6EA 2BGQA 4JNZA 1JI1A 3A22A 2WKGA 1TJRA 3VA8A 3NYZA 1I1WA 1R0MA 2LLEA 1LQ0A 4IM4A 4KPLA 2EAWA 2YCJA 3VNIA 5HWNA 4FOJA 2FGLA 3KBNA 4J3ZA 1EKOA 3ZO9A 4AD3A 5HBFA 5H6HA 4JHZA 1HKWA 4S1FA 3EKZA 3IVSA 4UQ9A 1K7EA 5KZMA 2UZ9A 3ATZA 4JKMA 1P7TB 4A8LA 4YJ5A 4AD4A 1GJUA 3NQ6A 4M82A 1H2JA 2XWEA 5LYRA 4JIQA 3LY0A 2NQHA 3G8EA 3TDFA 3CEUA 2I17A 4EE9A 1H1ZA 5BXSA 3ITXA 1F3XA 3AHVA 3CIWA 4JS3A 1XLLA 5K4XA 3TYAA 4F2TA 1P0NA 3K4WA 5HMDA 3D6NA 2E6YA 1J93A 1O95A 3DU0A 3EDFA 4DRSA 5K4ZA 1K8ZA 1A5UA 3PBYA 2GJRA 4AWTA 5LXXA 2OFJA 2A6NA 3HN3A 1SZEA 3PJUA 3S47A 4Q33A 3CAVA 1WA3A 2UWFA 2AL2A 1I0DA 1AUSL 1GZJA 1Q65A 4IP4A 2OQHA 1PZ0A 3OHMB 3RX2A 2DZAA 4QTGA 4FI4A 3N13A 4AY7A 1PAMA 2HDJA 4UTWC 4DZIA 3ATYA 1QK2A 3CUFA 3N9RA 4ROQA 1HGWA 1NF0A 1UWAA 1VAHA 2QJJA 2BLEA 2J74A 3DN5A 1PYFA 1QHOA 1B1YA 4ILSA 1Q5MA 2OKTA 2XIQA 1KBIA 4C6PA 4K7YA 5CJMA 4F40A 1SJBA 2C1IA 4MHBA 2DT2A 3EWCA 4BQ2A 3W27A 2QT3A 2IPFA 1PTDA 2YYTA 5I5RA 3KHJA 1WDPA 4R7OA 2JF6A 4I7UA 4MNMA 3OEXA 2ASHA 1RK6A 3ZVHB 4O57A 2ZX7A 3SUSA 4E6MA 5HXMA 1TIMA 5EFDA 3BGJA 1FHVA 4QLJA 2GJNA 4QE1A 2FDSA 1DQUA 4H1ZA 5E09A 3WUFA 3NQCA 4GNJA 4UQBA 2ADAA 5E9AA 1LM1A 4O19A 5FSDC 4GCXA 4IIDA 1I2RA 3GU9A 2ZWZA 5EBAA 3UXLA 1SO5A 4BFAA 3S9ZA 4L6DA 4NNBA 4JTUA 2F84A 3KDNA 4MDOA 3SIMA 3HQ1A 1XGEA 3FNDA 5BXRA 1W5OA 3MV01 5T9BG 1KKOA 4E4FA 4HYVA 5KZDA 3FK4A 4WCJA 4LYQA 2J13A 4KRZA 4FOKA 4Y7EA 1ZJBA 4D9PA 1X7FA 1VGAA 4UNKA 1W1TA 3FJNA 4R5EA 2J25A 1LLWA 1FHDA 1X8FA 4GUHA 4RDVA 1TWSA 2V5BA 4UOJA 3G6LA 4E4PA 2E5BA 4UNLA 3S5NA 1TX0A 3TLLA 5LSMA 2CKSA 1CI1A 5JH2A 4JX6A 2D3LA 2FFIA 3ITYA 3EX2A 2J27A 3D3FA 1XD0A 3R7MA 2FZ8A 4UCFA 1E6NA 4HIBA 5FA5A 4BQ5A 1DJGA 1NOUA 4BQ3A 3APTA 1O5RA 3YPIA 3VNJA 2C18A 4UR7A 4UBPC 4NT0A 2NSOA 1ESWA 1OX4B 3T08A 1H7OA 3TA9A 4ATLA 3LNPA 2GDUA 3WBYA 3QR1A 1JEZA 3LXBA 3WUGA 3DC8A 4O4WA 2CITA 3AIWA 3NL3A 2OZ3A 2G3NA 3G1DA 2OU4A 1J4EA 4ZO8A 1F05A 5KITA 1WQ5A 2ZZ4A 2EPLX 4QAWA 4CD8A 3AZSA 2C13A 1XV8A 1I1XA 2ZRVA 3QH2A 1YDYA 5IFTA 1QHPA 1B3YA 2PDWA 1KCZA 2Y85A 1PX3A 4DJED 2FGZA 3ZXWA 4JHOA 3L2LA 2NV1A 2VDIA 1B57A 2EPNA 3P7YA 2OYMA 3LB0A 1D2KA 5AC7A 2PDNA 4DY1A 3RPDA 1SYTA 1Q6QA 3FA3A 1IZJA 3IIOA 3NR0A 3ABRA 3PSWA 3VD9A 3PZNA 1EHNA 4Q8QA 2HXTA 3CWOX 1RV8A 2NVAA 5D2WA 4P8WA 3N11A 4A29A 3GG7A 3WQ4A 5EMLA 4UZUA 4H9YA 4UTWA 4ZENA 1ZS2A 2PDYA 4ACYA 2YIHA 1S46A 2FZ9A 2JEPA 3GG0A 3H2NA 3NO1A 4JTQA 4RE2A 1EXBA 4ICMA 4HU3A 1AQ0A 4JZ5A 1GYMA 2Q71A 1JG9A 5AYBA 3P0XA 4YWSA 1C8YA 1ZUAX 3RAOA 4RE3A 4YCOA 3HZ3A 1W5PA 3O2LA 1VFLA 5CC5A 3DGRA 1PZ2A 3QXBA 1V8EA 4DJEC 5TQLA 2ACQA 4INFA 3HO8A 4GG9A 3MMDA 4U31A 2EG7A 2VCAA 3ITOA 1NARA 3RRAA 1A5AA 3NSXA 3TN4A 1YYAA 3PVFA 4Z0SA 3IK4A 5FIPA 4Q7BA 4K8HA 4N6FA 3S46A 4LNYA 3MTWA 1R3YA 4IGSA 2VELA 4IWWA 3I6TA 1AMKA 3DOPA 1KTBA 1NDWA 4U3CA 4LAKA 3VIJA 3EXRA 3T0AA 3NZPA 5LIUX 1WDDA 3G0SA 4AZBA 1OIMA 4Q7NA 5LA0A 5A6KA 4CN1A 7CGTA 5HNRA 1EJUC 5C7VA 1NWSA 1QNQA 3ARVA 3HMCA 2REQB 3SUUA 4GUGA 4M8UA 1TMHA 1L6YA 1ITCA 3LLDA 3RR1A 4Q32A 3W7MA 5E93A 1TR1A 3LZ5A 4IISA 1SO4A 3QR0A 2G50A 3UWWA 3R10A 1C90A 1GORA 1RP9A 1A0CA 1A50A 2QJGA 1I2OA 1A47A 2DIKA 3PUGA 2QZRA 4F48A 4DHGA 3LMYA 3KM8A 2DW6A 1SSDA 1W91A 4NZ5A 3UWUA 2YA2A 1XIEA 2DQWA 2J88A 3E5BA 1XKJA 4LBSA 3HV9A 1ZNNA 3AISA 1EBHA 3A9IA 4LRTA 1QO2A 4CNOA 3A64A 1PIIA 3WD1A 2G3MA 1QR7A 2FB2A 2PDFA 1EYWA 1GVEA 4TVDA 3LM7A 4RPPA 3TAKA 2Z7GA 4ADSA 3CIVA 3UY8A 1W9DM 4EAMA 4K1GA 3VKBA 1KB3A 1XLIA 1RBOB 2HEJA 2ISFA 3AIVA 3ZJ6A 3RPTA 4HU4A 3NEHA 2PGWA 1XYAA 4MY9A 3SCTA 5HJLA 4HU0A 1PS9A 1LL6A 2O4QA 3FEMA 3WLMA 4JIEA 2QULA 3E2SA 4RUBA 4AF0B 2PCQA 5M3WA 3L9CA 4DM2A 5I2UA 1L6SA 1J9YA 3B4YA 3VC5A 1A5CA 3ES8A 2Y0FA 2VC9A 3P82A 1K9TA 4XQ6A 2PU0A 1NOFA 2QCDB 5I00A 3T05A 1V6TA 1SO6A 1XH1A 5K9XA 1MW0A 4Y90A 1LUCA 3JR2A 5DELA 3TC6A 1RQHA 2WM0A 1XCFA 2AQWA 3MQTA 1YNYA 1LBMA 2OWCA 2VFHA 3LA4A 4AWEA 5GJMA 1QXLA 2W3ZA 5D8WA 1L6GA 4PR4A 1ZLPA 2NW0A 4X2PA 3NDYA 2W5FA 4CD4A 1B0IA 1JCTA 1JCLA 1VH7A 2CLFA 4UFJA 4FK9A 1JRBA 5CPTA 3DX5A 5A8GA 1SR0A 3N73A 1KCKA 2B7PA 3SADA 4O50A 4D6EA 3F5JA 3WNPA 4HNTA 1BRLB 2GQ8A 2ZUWA 1LRNA 2VFGA 3BAJA 3SCOA 4KEMA 4PC8A 3TZNA 4OBRA 2G95A 4EOUA 2F2HA 1WKDA 3OODA 3O6CA 3VGHA 3T2OA 4XO6A 3BAKA 3KBSA 4OBTA 4PUJA 1SPQA 1XRTA 4WJXA 4GGHA 2ALDA 3MWCA 4N4PA 4MWAA 3TW9A 1UC4A 3FEQA 4IJRA 1I2NA 1UZ1A 1E0VA 3L4XA 4HN8A 4ZSUA 2PB1A 4RDZA 4NQ1A 3KRUA 1KM0A 1EDTA 3RGTA 1KRMA 1CIUA 3O63A 4LYPA 5DX7A 3K1GA 4I5RA 3KL5A 3O0FA 1H62A 3WELA 1F3TA 1XRSA 4A3RA 8A3HA 1GQIA 1V51A 4UFMA 3VX0A 2DW7A 1E9IA 1EC7A 3ZT6A 5HJXA 1A5MC 2OQYA 1LBLA 2PBOA 1F2JA 2XGZA 3EOUA 3AXHA 3SN1A 1J96A 3GQYA 3BLLA 3L5AA 1HGYA 2H8ZA 4W8LA 3TFCA 1S2CA 5I3IA 3CLWA 1Q6LA 5DY3A 3ARYA 1XSJA 4OJYA 4AWSA 1XSIA 3TCSA 5C7HA 4C1LA 1JZ7A 3AMLA 1J79A 3KFTA 1JULA 4LQ1A 3GNOA 3B0PA 1XUUA 4F2UA 3HGRA 4LAMA 1OFQA 3URBA 4EVZA 1VFTA 2YZRA 3IUDA 4GVIA 1E3ZA 1EJVC 1CENA 1AH0A 4JX4A 3PULA 4L9XA 1KRCC 1RJRA 2OGYA 3RX4A 2EHHA 1AQHA 1FVPA 2AMGA 4RPQA 4OFCA 4F9DA 5FJRA 3I7RA 5JH1A 3WQ6A 2WZHA 5AZ0A 1UQZA 4MLJA 4X9SA 3GRIA 4LC8A 2D0GA 2ZRYA 4CKQA 2OODA 2Y7GA 5TNVA 1XYBA 3L2IA 2X05A 3IIZA 1V3KA 1Q6DA 4PSPA 2B81A 4PCPA 2VFDA 4U28A 3H26A 3P8JA 3WLKX 2WZIA 1EO5A 3WO8A 3O1NA 3PTKA 4JICA 3TK7A 3N9KA 5IBXA 2HVNA 1PXGA 4IPIA 1BWVA 1H41A 3CHFA 4WZHA 3FGCB 1OYCA 3PHAA 3BV4A 1VFMA 2Q09A 4US5D 1G4EA 3TMQA 1OFDA 1P0EA 3VZZA 5LHEA 3QJAA 2GWNA 3LCLA 1HFBA 2QLYA 1S5TA 4MG4A 2X09A 4PUDA 1E15A 3JUGA 4NAEA 4DELA 1SW3A 2OCZA 3HQPA 2PMQA 1UZDA 4RNHA 2WSQA 5E70A 1Z32X 4JTGA 3GXMA 1VJZA 3PB2A 1CGUA 1A53A 1J6OA 3SJNA 2EXOA 4PUKA 2J78A 1ECEA 3EDDA 4A8NA 1W9BM 3DDMA 4PCTA 2D2GA 3MT1A 2FZDA 3OGRA 1JCNA 4U4MA 4E2BA 1JYWA 3UJSA 4DWSB 2P3ZA 1QNVA 3C3NA 3OB8A 4DI9A 5CBIA 4FLOA 4KT2A 4DAIA 1LYXA 4I8YA 3NQDA 5DMMA 1W9VA 4L80A 5A6BD 4KERA 4CQCA 4CU8A 3TYBA 1SFJA 4EAYA 4KW2A 3I68A 4H7CA 4ZE4A 3K13A 4O0ZA 2W91A 4P7QA 4AU0A 2WNWA 3ITLA 2IKJA 3OOQA 4HOZA 2WKJA 2ZWYA 1UR8A 1YRRA 4DBUA 3O05A 3QW3A 1NY1A 4H9MA 3NQ8A 3ZWTA 4IOTA 1OWQA 2EBNA 1HX0A 4NJGA 3QV6A 4YVVA 4HN4A 2X8RA 4P8VA 1Z41A 1EGZA 1LLZA 5F1VA 1RVKA 1RVGA 2WYSA 2GVEA 3W6MA 3VAVA 4PCFA 5G4EA 1Q66A 4ZB5A 4F4RA 3HURA 3S9YA 2BGSA 3J7HA 3SCQA 3LX9A 4WKHA 1AL8A 3QC0A 4GUJA 1UYQA 2X7WA 5A2AA 5EMMA 3GYCA 1EHAA 3S2CA 1CPUA 3KTSA 1E6XM 1OCBA 1EH9A 2YL8A 3GG1A 3W7RA 4KEUA 5A5WA 1T5AA 5DQPA 1FWWA 2GJLA 3HJEA 3TQKA 1ZBWA 1YBQB 3H54A 4B4FA 1UH2A 3EWWA 3WJZA 2QR6A 5GNXA 1DWHM 1IT7A 3KAOA 1MEHA 1C9DA 2AKZA 2DUXA 4FNQA 1BG4A 4GABA 2QF8A 2XJ7A 3SCNA 3FCPA 1POKA 2YR1A 4NG3A 1DQXA 1SJDA 5BU9A 3FOKA 3EX1A 2BXZA 1V3IA 2ZXBA 1MW3A 4ZBCA 4GC3A 5DY2A 3TYDA 3N3MA 2YBTA 1B2YA 5AC5A 2Z2UA 4NYYA 1K4GA 4FIRA 2RH9A 2DSUA 2Z6IA 3MC5A 2OTDA 3O7UA 3KOXA 4Z1AA 3W7OA 4Q8UA 3DYOA 2FYMA 1UROA 3S2MA 4WXZA 2WXDM 3FJ6A 3CAWA 1E55A 2R82A 3W7IA 2WMGA 4GZ7A 1C8VA 1FP9A 4L61A 4N9BA 4RW3A 3V0UA 4G56A 4KWSA 4C90A 5CPQA 3LSBA 2WC7A 2E1DA 4MIMA 3DI0A 3IGSA 3SRHA 3G0XA 2YCKX 4PRWA 1PZ1A 3N2BA 2FGBA 4JFUA 3H4XA 4GIYA 1VEOA 4H9XA 1SUXA 1TVLA 5BOEA 4LB3A 2WZMA 2ZX6A 1WDQA 2VC7A 2PTYA 2VZTA 3QFEA 1GOKA 3L4VA 3W1TA 1LOSA 1UB3A 2AL2B 2C71A 4MJ2A 4UQEA 3B4UA 4LV4A 1BF2A 4H04A 4P8XA 2O55A 3POHA 4O54A 4DJDC 3QOMA 2VWTA 1W5QA 2BOGX 3TR9A 5BMXA 1C93A 1NQ6A 4BF7A 3TA6A 1XG3A 3BZGA 3NPXA 1GOMA 5M03A 4WF7A 3GHSA 4O1AA 2PFHA 2WV8A 1QBBA 2DSWA 4NJKA 2POZA 5F2GA 2QVHA 3SB0A 1Y5VA 3CH9A 4H6KA 4HHLA 1X7IA 4LPCA 2RAGA 4NXSA 4Q8MA 3FHAA 3GWQA 4F0HA 3ANUA 2PRLA 3F4CA 2QJNA 3HFYA 3FKKA 3C3UA 3TJ4A 2C3ZA 3E2QA 3F03K 3N18A 2VD8A 4HK5A 3SN4A 4I5UA 4JTFA 3ZJKA 3IANA 1Q8JA 5ECUA 8TIMA 2Y1HA 3HPXA 3G3MA 3AMGA 4WSHA 5CEWA 2V3DA 3LXAA 6XIMA 4H01A 4AD5A 2F6UA 3ARRA 3DEQA 1H7NA 4JTHA 1EIBA 4GZEA 5D8ZA 4GO8A 1UASA 3MHFA 3DH7A 3BG5A 4TR9A 1R5YA 3EOLA 1XGDA 3S42A 1PCWA 4OZOA 4JFWA 2WC3A 4O8AA 3W23A 1B3VA 1A0EA 1A4MA 2L5HA 3EEGA 1XIGA 3DBPA 4RJEA 3S0CA 4DM1A 4B15A 4ZFCA 3WDQA 2XN1A 3P8IA 3GTHA 3ZFHA 4CGTA 2WVSA 3P0WA 3QGKC 4HYWA 3V18A 4A21A 3WK0A 5FJOA 4WGHA 5CG7A 3OTRA 2QCLA 2IKIA 1V6XA 3WJXA 4OE7A 2F6KA 3N25A 3UJ2A 5EU9A 3LV6A 1SSGA 3MUY1 2C8NA 2GDVA 4QG8A 1E0TA 4TO8A 3KTCA 3CQKA 2VCCA 1REQA 2ZA2A 4GIEA 4DX3A 1GEHA 4KF1A 2VP8A 3TTOA 1KXTA 2XTKA 1CECA 2BMBA 3NO3A 4XTIA 1EA0A 3ZM8A 4B5WA 3WBXA 2E0PA 2DVTA 3W1AA 3OG2A 3T6CA 1SW7A 3T07A 3GZAA 3IEBA 1H11A 1I45A 4KBXA 4MNLA 4A3UA 4L1GA 1EPXA 4RLIA 3AZTA 3UCCA 1QW8A 4N9DA 5EMYA 1Y8BA 1LJYA 4GZJA 1XCWA 1RH9A 5D9NA 4AWUA 3AZRA 4IUGA 1UMYA 3GHUA 3RN6A 4Y9OA 5EMKA 2R94A 3EDJA 3CUJA 4LWWA 4C6BA 4Z1DA 1TCMA 4E5TA 2VHLA 5FEPA 2VYOA 5AFDA 2E77A 3HFTA 1UJPA 1QNOA 1YTKA 1WP6A 1QFEA 4AC7C 2BP1A 3ONCA 5KMYA 1XLEA 4HJWA 4D6FA 3RLUA 1WAWA 1NQKA 2E5CA 5HMSA 4D6JA 2QVNA 1KWKA 1J5TA 5J5DA 2OB3A 4UFKA 1IXQA 5GJNA 2P53A 3LS9A 2HVMA 4WGXA 5AYIA 3NPUA 2X1TA 4A8RA 1XYFA 1V3LA 2VUNA 3WSUA 3NZQA 1AODA 2EJ1A 4Y6GA 2BY3A 4BI7A 3NUKA 3C5QA 3CNYA 4JTTA 8XIMA 2XIBA 4JGDA 1N8IA 2EEXA 4HB7A 3LGEA 3FLUA 1FTXA 1M9HA 4QLLA 1C91A 2A1YA 1H3GA 3RLGA 2YXOA 1HJSA 3BANA 1K02A 2ZRXA 3VXGA 2JALA 1AW2A 1K8CA 3NDZA 2B0MA 1XI3A 1Q8AA 4IPPA 4D6GA 4UMCA 4NYUA 2XHYA 1W37A 3L0GA 4IGHA 1BXBA 4F0LA 2WM1A 3AYTA 4JQ2A 3WQ5A 3S5YA 1CXLA 1A3WA 3CS2A 3SI9A 3LXCA 4EXBA 5HUOA 4NL1A 3N3TA 1VPYA 1U30A 2QIWA 2D20A 4O0KA 1AZ1A 2JEQA 1UCWA 2NLYA 2VX4A 4O53A 3LCIA 3W75A 4LS0A 2QDDA 3ME3A 3IJ7A 2D0FA 1IHIA 4UMBA 1E71M 4K1WA 3FN9A 4B2DA 1YXCA 2QCCA 2R1PA 2JK2A 3I4EA 2QNEA 5FEZA 4WY0A 2OQLA 3GFYA 1XISA 4DXXA 4H9VA 3URQA 1F4AA 5EFFA 2D24A 3KS6A 3VMPA 1X8CA 1BPLB 3ALFA 1R86A 3B40A 7ENLA 3OA5A 4MJZA 4BZYA 2UY5A 1SMAA 3F4DA 4B9YA 4GLEA 4FR1A 4ADUA 2DSKA 4GIRA 2YLAA 4PB4A 5L6UA 1ZGDA 2FH8A 5HQLA 3TIMA 3E96A 1KFLA 1EZWA 3RFAA 2P10A 1E1FA 3MCMA 1NM9A 1VC4A 4UTFA 4PUWA 4NZ4A 3UA4A 2WWCA 4DJFA 3WH8A 4PSRA 4FXJA 5LIYX 3AS2A 1R6WA 4LSBA 3B3DA 3MP3A 1P0BA