4ES4A

Crystal structure of ydiv and flhd complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
206
Chain Sequence
SDCYFLPIRDNQQVLVGVELITHQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cyclic di-GMP regulator CdgR
publication title Structural insight of a concentration-dependent mechanism by which YdiV inhibits Escherichia coli flagellum biogenesis and motility
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 67
structure length 206
sequence length 223
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2012-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4es4A00
3PJUA 4FOUA 4Y9PA 3GG0A 4RNFA 3SY8A 4Y8EA 4LJ3A 3U2EA 4FOJA 4Y9OA 3GFYA 3KZPA 3PJTA 3PJXA 4FOKA 4LYKA 4F48A 4Y9NA 4ES4A 5MF5A 3GFXA 5M1TA 4KIEA 4Q6JA 3HV9A 4J40A 3GG1A 3PJWA 3TLQA 4Y9MA 4AG0A 3N3TA 4HU3A 2W27A 3PFMA 4RNJA 2R6OA 4F3HA 4HJFA 4HU4A 4RNHA 3S83A 4RNIA 5MKGA 5MKGB 2BASA 4AFYA 3HV8A 3GFZA
chains in the Genus database with same CATH superfamily
3PPHA 3S6DA 2OGJA 4PRWA 4M6UA 1GQJA 1HKWA 1HW6A 2CU0A 3QY7A 6CGTA 3URBA 1SQ7A 1SU5A 2V9DA 3VTRA 2DSVA 5REQA 3BOLA 4REQA 1PVNA 3EWUA 1E40A 4PCPA 7REQA 1JCNA 1Q2RA 2ZRUA 3WD0A 4U28A 3BOFA 3IRDA 1QUMA 3NM3A 4GZ7A 3CPGA 5FL0A 3BE7A 3S2LA 1OD0A 2CIPA 2P10A 3MO4A 3N3MA 4F3HA 3VD9A 3GU9A 5E5CA 1B3YA 1TPB1 5I00A 5J5RA 1VFLA 4DXXA 3AZRA 2J7HA 1BWVA 2OWXA 1IEVA 1DE5A 2CLHA 2VFFA 3UGVA 1K1DA 4ZQRA 3JUGA 3ZVHA 4PUEA 4G6CA 4DJDA 1GTEA 3S6OA 4AD4A 1Q4WA 5D33A 5REQB 2DZWA 4ZQNA 2G3IA 3PBGA 4X60A 3CM4A 3EWBX 5EFDA 3W76A 7REQB 1UWTA 3C3NA 1E9ZB 3W23A 3LGGA 2FTWA 1GW1A 2WSQA 2QZRA 5AVNA 2Y8VA 1VENA 1Q13A 3F5LA 4DEFA 1M01A 4GG9A 1HP5A 4D2JA 2VC9A 4W7UA 4DF1A 3EX1A 2OLHA 3WLQA 3HQOA 4FZIA 2POZA 4NZJA 3CAVA 4QHRA 3ISIX 2ZXBA 4Y8EA 1N2VA 3UT0A 3XINA 3AI0A 4IQJA 5AC6A 4F48A 2WMIA 2R82A 3AMLA 4CEUC 2SFPA 2YLLA 3BC9A 3AS1A 3ZVHB 4DBDA 3LRLA 1HJSA 4LS0A 3L7RA 3UJ2A 4QCEA 1XDJA 2DSWA 2PCQA 4IZGA 3GU2A 5EL1A 3K8LA 1CECA 1IXPA 1NM9A 1V79A 1WPCA 2ZYFA 2G3JA 4YWIA 4J9JA 3UYCA 2OSWA 1EP2A 3CWHA 3IIXA 4AEFA 3GS6A 1ZQ5A 4M0XA 4WGXA 1KGWA 1J0JA 4MLJA 4L4OA 1A4LA 3GK0A 1QHOA 4JD4A 2WMIB 1XKYA 2X1RA 4KFPA 4MF4A 4UWMA 1HJWA 4WSJA 2J7EA 1DJYA 4OV9A 3LQLA 3CO4A 2PDBA 4GX9A 4KKXA 4DNMA 1H49A 4F0KA 1EP3A 3MWAA 4XIMA 4DAIA 2TRSA 1HL2A 3QPYA 4ENLA 3G5EA 5CZTA 4HSNA 4I6KA 2VZVA 3SRHA 4KWVA 1OD8A 1XL9A 2YIHA 4MAZA 2J8TA 2J7BA 4G8TA 3HG3A 1TV2A 5MKGB 3N6QA 3ITXA 1HXJA 1MW3A 1V03A 2FB2A 4IP4A 3DFHA 3W24A 2B7PA 3W29A 1LQ2A 3OTRA 3V16A 3O0FA 4WOZA 2ZX7A 2DIJA 5F1VA 5G5IA 1V6TA 4MB5A 1UWAA 4ILSA 3WQEA 4RZ6A 2EPMX 2PDQA 4I8YA 2VFIA 2ZUTA 3H7UA 3NDZA 1NDZA 3NQ8A 1RA5A 3EPOA 1R0MA 2WQDA 3OLIA 3SCNA 5AC8A 1JGIA 3WQVA 4DLMA 3W7HA 1J8VA 4PUKA 1EJXC 2J79A 8A3HA 2ZZ6A 5EMKA 3PTKA 1X1NA 4ZEPA 2NSXA 1I8JA 3I7QA 5B7ZA 5HMEA 1V0NA 2GVLA 3T0CA 5ABFA 2DSUA 1XLDA 3GSMA 4L4MA 1EIBA 2BVTA 2CZ5A 2QGHA 1EJTC 4CU7A 3WNPA 2O4QA 3M16A 3L0GA 1UQZA 3KWXA 4GQGA 2G41A 1P0BA 4K68A 3AU2A 1E6SM 5J8LA 5AB3A 1AODA 1B5TA 1O94A 3R12A 4DBUA 3CEUA 1ZBWA 1TTIA 4CQ8A 4FALA 1G67A 4F2TA 4H9YA 2G37A 3VNLA 4TX8A 1TG7A 1Q4NX 3I65A 5FSDC 3W73A 3O6CA 1SMDA 4R3UA 3K4AA 1F3TA 3LQGA 2YL6A 3TZFA 5ABFB 3NL5A 2PP0A 4OTKA 3WQFA 3KVMA 3DX5A 1A5MC 1MQPA 4RCXA 1CXIA 5LIKX 4GYKA 4LSBA 2OLSA 3C61A 3C0JA 3JS3A 4ACYA 1U2YA 4AIEA 4GO8A 1W9XA 4B5XA 4ATWA 2NQJA 3R10A 2F6UA 3WEOA 2VUNA 1C91A 1V3MA 5BYWA 3HGSA 1CLKA 5MHBA 1RVKA 1DHPA 5DCEA 1YTEA 4LYPA 2KZHA 3TQ0A 1S1PA 2ZZ2A 3H70A 1A3HA 3LENA 1TMLA 4AIUA 3LCXA 5C55A 5T9CE 3SCRA 4WCJA 1E4MM 3SSJA 1IE7C 4GQRA 4HA4A 5XIAA 2QDHA 2QUNA 3AS2A 3NQGA 5M1TA 4GY0A 5GQBA 3UNDA 1I9CB 3LI0A 1Y5XA 4AVOA 3W1QA 3GFZA 4RNFA 3BCFA 3MCOA 1W8GA 1DQWA 4CQBA 1U83A 4IXXA 4B91A 2VDGA 5B80A 4WY0A 1SFSA 2VMFA 3W26A 2YDSA 2J27A 2EKCA 1BPLB 5F2IA 3IEBA 3BV4A 1W31A 2AQWA 2PDNA 1Z32X 4D72A 3TEVA 2A7RA 1TFVA 1ZCCA 4W93A 3UA3A 5DEZA 5C2XA 3LYEA 2QCMA 3WQWA 1UC4A 1XKJA 4ACZA 3K1DA 3R13A 2NX1A 4EXQA 1AD4A 3W7QA 1MZHA 1KLYA 5EBUA 4J7RA 1V3HA 3DC0A 1WDWA 4OV4A 3WMLA 3T09A 4ECLA 4AWTA 3WLMA 3CZ8A 4WY0B 4TVDA 3L4TA 3PNZA 3NVTA 3MKKA 3SQLA 3WX7A 3KBVA 2OX4A 2PCEA 2AGKA 3A3WA 2P76A 1EQPA 4H00A 4M1RA 3GG8A 2WLZA 3VU2A 4ZGYA 4UZSA 5K2ZA 1NDWA 4PB4A 4LAMA 3E12A 4MKNA 1A3WA 4ACZB 3BAKA 2GWNA 2F2HA 1TZ9A 4GUHA 3W1XA 7ENLA 4X9YA 3SQSA 1JDAA 3G1HA 3TTQA 1CZ1A 2OVLA 1JR1A 1EDGA 1M7XA 2BHZA 1A49A 1C8YA 1RXOB 2GSEA 3VNYA 4M81A 2Z28A 2V3DA 4H9XA 1KNWA 4WD0A 1SZNA 4K1WA 3W0KA 3N12A 3SY5A 1E43A 3QM3A 3AJ7A 4HMEA 4Z0JA 4ZO7A 4UFLA 2EPNA 1IWPA 5GPRA 2JE8A 3FAXA 1U22A 4XWUA 1F6PA 1HFBA 2FH8A 3VGEA 4QJ5B 2Y6ZA 3IGUA 1KLZA 4Q6JA 1J01A 2DJXA 2WWCA 5EYWA 2O9PA 5C9WA 3NQVA 3D46A 5E93A 4UTFA 3O07A 1Q3NA 3RGTA 4P8UA 4JTFA 2E8YA 1J10A 3BGAA 3MV01 1J0ZA 1J11A 1AL8A 1LCOA 3OYXA 1KXHA 8XIMA 4FNQA 2WMFA 5BWAA 3L4UA 1LG1A 1SO5A 2XZ7A 1KCKA 4JQ4A 4NUWA 2OO0A 4FOUA 1ITUA 3WCZA 1CEOA 3ITYA 4I90A 4JHMA 1ZPTA 4I3GA 1I45A 1EJUC 1W9BM 1LOQA 1E71M 5CLWA 3BAJA 3FA4A 2UBPC 3I7RA 1VCGA 1CXHA 2W91A 1TB3A 5I09A 4CQDA 3OBKA 2WNNA 5DXXA 3QV9A 4N0RA 4W87A 2Y7GA 4B4FA 5KETA 3WL0A 1B31A 1NF7A 2FVKA 3L66A 1W3LA 4LRSA 4C6BA 1J93A 2PDHA 2J9XA 3EWZA 3QSRA 5T26A 3L4YA 3WF3A 4PB5A 1IZKA 1CT5A 4MFEA 2UY3A 4PTNA 1AQHA 1BXNA 3DBNA 4GYFA 3OZPA 3EOEA 3T08A 1L6GA 5A6TC 4PBEA 3FOKA 3IIZA 1TKKA 1FP9A 1YPFA 2HPMA 3LCGA 1UR9A 2YB1A 2VQTA 4BF9A 3WEZA 2EBNA 2BVYA 3VD3A 2GJXB 3TAKA 2ZA2A 2WNQA 4QISA 1LRNA 2C0HA 4FXFA 1J4EA 2PZNA 3E02A 4XTDA 1XR2A 3LV5A 4NZ5A 3CWOX 4FAMA 4L4PA 3SN1A 3T42A 1UD3A 1TUFA 1IQ8A 4GVIA 4OZOA 3Q4DA 4TTUA 4JTQA 5HULA 5FL1A 3K2GA 1W3JA 5DCDA 4IX2A 3T40A 3HJEA 3SGUA 1WP6A 5PTDA 2W79A 1VQTA 4YL2A 1V8EA 3BLPX 1NF0A 2HJPA 1TPFA 1OEPA 1Q2SA 1KFKA 2CHOA 4INFA 3UXAA 3IIVA 3ITLA 1FUYA 2EG6A 3GDTA 4H7CA 3W6MA 2PGEA 3WQ6A 4LEQA 3NDOA 4C7DA 4RK8A 2FJKA 2E1WA 4GACA 2NV1A 5T8GA 4TV5A 6TIMA 4RR4A 3VKJA 1ZSXA 2R94A 3LLXA 4H6EA 1J6PA 3M9YA 3G24A 1N8IA 1OFPA 2J7DA 3H4XA 4ZFCA 1E0UA 3OZYA 1E5JA 1UKSA 3ABZA 1GEHA 4MGGA 2QAPA 4D6FA 3TYAA 4AYSA 1Y8BA 3TXVA 1EYEA 2GFTA 3SGZA 3OA3A 3W1PA 4DI9A 4HMDA 1MXGA 4HA0A 1XSJA 2V5KA 4UTTA 3NNTA 1V0LA 2Y5JA 4QBXA 3P0XA 2VELA 1IYXA 2EF9A 2GGEA 2CLFA 1KWGA 4PN2A 1SPQA 1KBIA 4C6IA 2PBOA 5C5YA 1UOZA 3WK2A 5D8WA 3N9SA 5AN7A 1XFCA 5CGMA 3W7GA 3VGHA 4YN5A 2VFDA 5CGQA 3PG9A 1JF5A 1L2UA 3W7EA 1D8WA 1LOSA 2DY3A 1DXIA 3W53A 3LHYA 1ADSA 2BASA 2VX4A 1KFJA 2XISA 1FWIC 1XLEA 4LTSA 4JX6A 1DL3A 3TXZA 4W7WA 3VABA 3D5HA 3R0DA 3RMJA 4B5SA 1R3YA 4Y2WA 3BG9A 1ONEA 3WLLA 4MJZA 1TIMA 2CZVA 1UD2A 2I5QA 1PDYA 3FS2A 4F0SA 1CWYA 4O12A 3LU2A 1H63A 4FNSA 1D2KA 1K7EA 4QP0A 2DZPA 2WW5A 3THAA 5KITA 1MDLA 5CG7A 3BZJA 1BTCA 3MKCA 4AHOA 4JX5A 2YCLA 2TODA 2X09A 1WE5A 3C2VA 2VC6A 3VI2A 1JULA 4M6QA 4FSAA 3G1SA 4R7OA 3P93A 2JKPA 2E67A 5I02A 2B4GA 1EX5A 2FDSA 5GNYA 4AZ6A 4P8WA 1SFLA 3B03A 3HGJA 3FNDA 4C7GA 5C9UA 4ATDA 4YHGA 1S2VA 3BLOA 3HOJA 2FZBA 2E0PA 4GIAA 3UZWA 4GY1A 2ESCA 1WA3A 2PD9A 4GZEA 4GHRA 3NA8A 2YLAA 3WMBA 1A47A 2VD8A 1GOQA 4GXPA 4C1NA 5CSRA 1VFMA 2YCLB 1AQ0A 3FYOA 1EWDA 5CPTA 3ANYA 1KKOA 3TFCA 1HNYA 2OOFA 4B5TA 3UPMA 5HAOA 3C2RA 3POHA 1UBSA 1Y0EA 4R7JA 1OADA 3GAKA 3NG3A 1GT8A 4MAVA 1BXCA 2IKIA 1H41A 3VZXA 2GVEA 4PYSA 1FWTA 4QRNA 3SCUA 2VFEA 1BQGA 3LTPA 1QI2A 4I7WA 2GQAA 1MW2A 1VZWA 3TP4A 2FZDA 4C1NB 1A80A 1FCVA 1H7NA 4QCFA 3BG3A 3W81A 5LA2A 3W2JA 1KM2A 1W9PA 2QQ6A 4GVFA 1JDCA 1RK6A 1QPKA 3UR5A 2I56A 2PU1A 4Q4MA 2PDIA 4NIRA 1V08A 3KUMA 5EMUA 4AD5A 1T41A 2YL5A 3MUZ1 1TYGA 2GGJA 4RXGA 3QEZA 1JIBA 1WBJA 5BWFA 4XISA 1RHCA 3OBAA 1JZ4A 2WMKA 2PDLA 4QE4A 4NI8A 3A13A 4V15A 1JXJA 1OY0A 2Z2AA 4JIQA 1I0DA 3WKZA 2D24A 4UQCA 2BXYA 3N4EA 4P5UA 3TIMA 3MJMA 1R30A 1QW7A 1PYFA 3B8IA 2A3BA 3T6CA 5U7SA 2EPLX 2VJXA 4S3KA 4S3FA 4CNSA 3NEVA 1TUXA 3OW1A 2FZNA 4E4PA 3CLMA 3U4AA 3E6EA 3V1PA 4C91A 4QFUA 1WDDA 2OYKA 1VP5A 1JZ8A 5BU9A 5D32A 3ZVIA 3IACA 4V28A 3ALFA 2QS8A 3T2QA 5M5DA 3I68A 4R33A 4Q8MA 4ZQMA 4AWSA 2PP1A 2VGIA 4OOZA 1VPYA 3W2MA 4LB4A 1KXVA 1GGOA 1R3VA 5G2WA 1IT0A 4PRTA 3IK2A 4IUGA 3RILA 3ZJ7A 5GJPA 4WXYA 4PFMA 3UD6A 3AMKA 4JTGA 1PCWA 1H4PA 2ZUMA 4X3ZA 3MC5A 2ZWYA 2R1LA 3RLGA 2GQ8A 1H0IA 3L4WA 1SJBA 3LCHA 1EXBA 4MMWA 4MVAA 4ZO9A 3R4IA 3AHTA 1UZHA 1JG9A 1MDRA 3WDHA 1WUEA 2HCVA 3SZ8A 5FKYA 9XIAA 4XUGA 3GIQA 2PDXA 3PJUA 4IT1A 4K7VA 3Q45A 4GNJA 4HVXA 1EA9C 1W1TA 1TPC1 3WLTA 3H54A 4NXKA 4UR9A 3N13A 1ME9A 3GXIA 5KZ6A 3VKAA 1CENA 2WVUA 1NSJA 2OPJA 2D2GA 3EZ4A 4Q8UA 4O16A 1YEYA 3NWRA 3TC6A 4Q4PA 1E56A 1M9HA 4PR4A 4BWLA 4Y96A 1UD6A 5KZEA 4KERA 3PHAA 3UY7A 1CXKA 4O4VA 1ZALA 3AIRA 3O3RA 1E9LA 1XIHA 3KRBA 4D9PA 3MMUA 4KWUA 3STFA 1KA9F 2XGBA 4LCRA 3VUSA 1VBHA 1ZCOA 2CLEA 1KTBA 4IXHA 3KZPA 2VZSA 3QGAC 3R5EA 3I3EA 4U31A 4C6MA 2O7QA 3OGRA 4JTJA 2DT2A 4GYJA 1W91A 3WMCA 3FJ4A 3STPA 2I1OA 4MKSA 2D1ZA 3CZKA 4HHPA 5BU6A 3LXAA 2VT0A 3G8RA 4KFNA 4UNIA 2X05A 1KKRA 4F0MA 3O06A 3LHUA 1E0TA 1FKXA 3W71A 1BSLA 1GEQA 4HU8A 1UWIA 3CZGA 4BQ2A 5G1TA 3P81A 5EFFA 2ZRVA 1ONXA 1A0EA 2WNWA 2EPOA 4G5DA 1KBKA 1JZ3A 3KOFA 1ISXA 3WK1A 5LZLA 3LBMA 1V5XA 5CBJA 3AISA 1FWEC 4UFIA 4GI8A 3UWQA 2PLJA 1FCBA 1FH7A 1TMQA 4UBPC 1K4GA 3MP5A 3E5PA 3W07A 2JKEA 3TH6A 1E6XM 4EXBA 4AVNA 2PFHA 4HNVA 2ZVIA 4GYPC 2YA0A 1F5ZA 3V5FA 3ZYZA 4WKHA 4NNAA 1MRAA 2CW6A 1BYBA 2F2KA 3UNTA 1UC5A 3DHDA 1P0DA 2YA1A 3GNNA 2OO6A 4HZ6A 3UXDA 2BY1A 4O18A 3CUHA 1XI3A 2YB4A 2PS2A 4F79A 2GDUA 3TVAA 3T4CA 1Q66A 1LL4A 2Y85A 4RUBA 3DENA 3STCA 5U4NA 4BFAA 1E9YB 3PPFA 3UXIA 3CL6A 1VGAA 2VOTA 2ISSA 3WH8A 7PTDA 4OVXA 5D04C 5FA5A 4IMAA 3GHTA 3MDUA 2HSAA 2QCLA 3WDIA 1RPXA 1YMYA 4PBFA 1X6LA 2NWSA 2VRJA 3E2QA 1BAGA 4GLEA 1U1UA 5E9AA 2J47A 4EPBC 1UH2A 3UWEA 1EC8A 2CLMA 3LNPA 1B4EA 3VKKA 1GOMA 1P43A 4HPGA 2WVTA 1XBXA 2DSZA 2ON3A 3ANUA 4R7WA 1EC9A 3G1RA 5LNVA 1K8XA 3UEQA 3MT1A 1RY0A 4DPPA 3P80A 1VH7A 4HHMA 4RE3A 1VFFA 4LEFA 5AHEA 2QV4A 2YX0A 2B81A 5KEZA 1DHKA 1V0MA 4A3HA 1WXJA 4LC6A 4HK6A 3QR0A 2VR2A 3TA9A 2H9AB 1V6WA 2A3HA 1E6PA 1EC7A 1JCTA 1X7IA 1RVGA 4CNTA 2XZ9A 2BVWA 4AD3A 4NAFA 3EA1A 4U2YA 3W6LA 1G4SA 1TMHA 3VIJA 5CPSA 1EBHA 3DKLA 1LT8A 2RH9A 6XIMA 4UQAA 1YTDA 1JL8A 4BKNA 2WKLA 1XRVA 3TOYA 3IWPA 5DRIA 1W1IE 3TR9A 1E4NA 4QAWA 5HNTA 3OLGA 2CKRA 3W88A 4B3KA 1Q6DA 5K4XA 5CKSA 1OG0A 1PEZA 5G4EA 1QMLA 1YNQA 4LANA 5DT7A 3KS5A 1QOQA 1KGUA 5TAOA 1B9BA 4QJ4B 3RU8X 2PDKA 3B06A 5HJLA 4GNKB 1QNOA 4NAFB 4LY8A 3FIGA 2BVDA 3BL3A 4Z2JA 2E5DA 1G94A 4W5UA 2QHAA 1L6WA 4HN4A 1KM6A 3QVQA 4FLRA 3EXTA 3QW4B 1Z3NA 1UOKA 3GG7A 2BX7A 3C0SA 4RLIA 1WOAA 3GBEA 2JKAA 5EBAA 2GVGA 4GH1A 2WKGA 2H8XA 3UR8A 3NGJA 4Z2IA 3VOIA 4A8NA 1PTAA 1LL6A 4DIAA 2RGMA 1RLDA 5DMLA 2HK1A 1GOIA 2PWGA 1DYSA 4ALDA 3O05A 1C8VA 1BRLA 1OQFA 1PKMA 2TMDA 3CUFA 3K8MA 3IRSA 3MBDA 3GUGA 1NTHA 1TQJA 3PUDA 3OOQA 5HWJA 4KEUA 3ZQ9A 1O68A 3F7JA 2KX9A 3FFSA 5A3HA 3HZ3A 4Y9PA 3HBLA 2CLPA 3S9ZA 1W1PA 1L0PA 5FD0A 4XBSA 3LEPA 3CZEA 4WHBA 4BK9A 3UCDA 3RM9A 1KM5A 1WUFA 1LQ0A 4N6EA 4BI6A 2FPYA 1OGGA 1KRAC 3BARA 4YCPA 5D2VA 4I5XA 3PM6A 1EPXA 4XV0A 4DZ5A 3R0UA 3PZGA 1BRLB 5E1QA 3DFTA 1H50A 4GIYA 4ZO8A 3WJZA 4O13A 2VWSA 3BSHA 3RRXA 1LLOA 3CMJA 1SJDA 3PF3A 1GPFA 1US2A 3W7CA 4DJEC 3T0TA 4ZVJA 2XFWA 3DHUA 2WBKA 2PDFA 4DO4A 3T2PA 3PZQA 3V35A 4QEHA 4KEMA 5LA1A 3BLFA 1N55A 3WK0A 3S2CA 1OBAA 2XHYA 2PB1A 3LHTA 1I0BA 4DAFA 3EX3A 3FX4A 3VGDA 4UTIA 2V8ZA 4WIWA 2A1YA 4PA8A 2QPXA 1EKOA 5CSSA 1KBLA 3K4WA 4P8VA 2YR1A 1JFHA 4O1EA 2QW5A 4RW3A 3LM7A 2ANUA 1XIMA 4RZ4A 4FR6A 3FXYA 1E70M 4A2RA 3QV7A 3CHFA 3LCIA 3TAOA 2OR2A 3BG5A 4ASTA 2A3LA 4XO7A 4IQDA 3FKRA 3P84A 1XLMA 3MBFA 1UG6A 3W02A 3S46A 1JI2A 1HN1A 5CQ1A 4HKPA 4CCEA 1EXPA 4NI3A 1YPXA 1NARA 1F3WA 1TTPA 3DFNA 4F9DA 4JTRA 4N6FA 4MG4A 1LUCA 3NZRA 2BXVA 3ENLA 3M1ZA 3UY8A 3KBMA 2GJPA 2ZX6A 4C6QA 4HMNA 1I2OA 1J0IA 4QROA 3TK7A 5AYYA 1V6UA 4MPKA 4Q8WA 5GVJA 1KXTA 5DY3A 4LCQA 4ZB0A 1VBJA 2YOCA 4ZENA 1POKA 3I6RA 2PBGA 2DZVA 3UCQA 1J79A 1OGSA 3BDKA 4MOZA 3L68A 4P7QA 1H51A 3PG8A 3EWYA 1RBOB 4YPJA 1NH6A 2Z6IA 4ZODA 1DKWA 2ZBTA 5FEWA 1F05A 2DFAA 4HP5A 3HU7A 3W72A 3P74A 3I4KA 1GKPA 1CW2A 4WK9A 3LCFA 5A6BD 1LUCB 5HJXA 2ZZ5A 2XPKA 2V30A 4JL1A 4P7LA 4YTUA 3FW6A 3W74A 3CAWA 4G9PA 4ZQCA 1DIOA 1SSDA 2I5IA 3HA1A 3VXGA 1KM1A 1PX4A 4M24A 1TJ0A 3CTTA 4AD1A 4OBRA 3L0NA 4AD2A 4N9DA 3M46A 1FWGC 3M5ZA 1ZHAA 3SUVA 4A05A 4RXFA 3BLDA 4LT9A 4EWND 1W37A 3TTOA 3NO1A 3MHFA 2FZMA 3HPSA 1H11A 3TNBA 3A23A 1TWSA 4LVAA 1XW8A 2NWRA 2OTDA 1PJ9A 3CQHA 1B4KA 5CJMA 3TQVA 1M41A 1UUOA 3ARRA 4POCA 3LHVA 1G4PA 3QRHA 5G2HA 4AZBA 2AKZA 2HTMA 1B3XA 3VM7A 1X98A 4YMZA 3IVSA 3T2OA 1Q7MA 2GQ9A 1MW1A 5TBOA 1VJIA 2J6VA 4L80A 4EF9A 2VP8A 2YJQA 3M4HA 4TXEA 4GBUA 1QO5A 3E9AA 3W1UA 4OFCA 4HGXA 4Z2LA 5G4HC 3TROA 1TPUA 4LX4A 1X39A 1EZWA 2B7OA 4LVBA 3WNNA 3UXKA 2HS6A 3BJTA 2J7CA 4WRHA 1YDYA 2JEQA 2PGRA 5I24A 4C6KA 3WNLA 3JRKA 2WKJA 1QDSA 4ZB2A 1FWSA 4K6AA 1DV7A 3BVJA 1MUCA 2I7GA 1KFEA 2CEQA 3QKEA 3SCWA 3SIMA 1CBGA 3EDDA 1ISWA 3Q67A 5F4XA 2ODOA 3RMEA 1E3XA 1UR0A 3D47A 4HT3A 1QW8A 4H83A 1AUSL 1BFNA 1V3KA 3KW3A 3P14A 1XBZA 7XIMA 2CWNA 5FJRA 4E3VA 1DWJM 4B5NA 2IQ0A 4Q3MA 2GVYA 1RV8A 5L6UA 1QW9A 2QCNA 3Q2DA 3M07A 2A2IA 4B4HA 2Z1KA 1MFVA 5DRCA 3N6HA 4EP8C 1K7XA 5IBXC 3THUA 1A5CA 1TCDA 2Z2BA 2OSYA 1CB7B 3E0VA 3L23A 3L5AA 1CIUA 3IJ8A 1QBAA 2VQUA 1NOFA 4WXZA 1U33A 4LVGA 1ODZA 3PFRA 4XTIA 2WZTA 9RUBA 1UH4A 1FCQA 3S5ZA 1H0GA 3B04A 3R79A 4CNPA 2VVNA 4HOZA 5LIXX 1JPMA 3KRZA 4D6HA 2BHUA 1T40A 1J2WA 5FAGA 3RNDA 4GPNA 3B0VC 1H7OA 4XD5A 2O9TA 4IUOA 4WUIA 1WZAA 3Q58A 2C6QA 3L4XA 2XVNA 1G7VA 3W6YA 5I79A 2VOMA 4RDYA 4JHZA 3BH4A 4KW2A 3G0XA 4YVVA 1PX3A 3PZIA 2VVSA 2EJ1A 1JDFA 4XAFA 2D73A 3A3HA 3S2MA 1V6XA 1MUMA 1I2PA 1VEPA 7CGTA 1XINA 2X16A 5DQPA 4F0HA 4FEZA 3W9ZA 3ABSA 2R1MA 1GYLA 1EF2A 4MNKA 1AZ2A 2V82A 3FA5A 1OFRA 2XYLA 2XIQA 1YDVA 5CSYA 4LVDA 3S3GA 3LRMA 2ZRWA 1I1XA 5FEXA 3GIYA 1NP0A 3T05A 4GC3A 1KFBA 1JZ6A 3TJXA 1MUWA 2ZX9A 1BQCA 1M68A 4K8HA 4PUNA 1H7PA 1FDJA 1F4AA 1GQLA 3SY8A 3H24A 1ZJIA 3W1AA 4E2OA 4ZE4A 5HWNA 2HRWA 1OX4A 1IWBA 4I6VA 1PAMA 4PCFA 3MMWA 2DQXA 4UIOA 4KMQA 4LAOA 5H91A 3V7PA 1R9YA 4J3SA 2ACRA 1SUXA 1FXPA 2HROA 5CGTA 4MWAD 2Z7KA 5CXPA 4TO8A 1NWSA 3CO8A 2A4AA 5D2TA 4DM1A 1PWMA 1QPOA 4EANA 2OCZA 2P0OA 2YDAA 2CPUA 3V0TA 1M1BA 3H2OA 1WZKA 4HYRA 1CGTA 5AKQA 1IEXA 2FB3A 3EKZA 4CU8A 1OX4B 2VEMA 3H7VA 1C8QA 3MUY1 1XIDA 4KETA 3VNMA 3QFEA 2ZX8A 4US5D 1FHDA 2X2YA 3II1A 3P5YA 2PMQA 1VKFA 4HTBA 5JBEA 4QR6A 3FDKA 1CGUA 3CMGA 3TN5A 2RDUA 4JNMA 4AIOA 3ELFA 1TJPA 3K4DA 4UB9A 1UMYA 5AC7A 4BA0A 4JTHA 1FWRA 4NNCA 3SFWA 4O8AA 4H9TA 2PWVA 1P0KA 3UZYA 4OU1A 2XWDA 4AX6A 3ARQA 3QR1A 4FXSA 5CJNA 1NJJA 1M5WA 4LF1A 2AQOA 1E6RA 2AKMA 2BOEX 4JCLA 1F8IA 3C0LA 4XSMA 3AXXA 4NZCA 4G7EA 4EOUA 3E5BA 3LBCA 4WJXA 1GK8A 3LZ3A 4XZNX 4NHVA 3WH5A 3SEPA 3U3HA 3SCQA 1U5HA 2C8NA 5K3VA 2EPHA 4HD5A 4IMEA 4MM1A 1NP2A 4EVZA 3DECA 4WLCA 4GNVA 1QXLA 3MA8A 1WOBA 1XYFA 4U10A 1O95A 4HNNA 4OWGA 3OJGA 4C60A 1TJRA 2ALRA 2QMKA 3WFLA 3HURA 4IPLA 4O52A 2WHJA 4L9ZA 3SGGA 3VZZA 3PBMA 4DF2A 3U48A 1OWQA 3I3BA 1XG4A 3WUGA 4RDZA 4WVXA 3U5YA 1I75A 4G7EB 5D02A 2WJEA 4JNYA 4BQ3A 4J2MA 4J35A 3FLUA 2ZDRA 3KCJA 2WANA 1EYWA 4LCSA 3W7MA 2EKGA 1VPXA 4L6DA 4R9XA 3PZ9A 3PUGA 4ICNA 2YL9A 5FEZA 5M3WA 1OT1A 3L65A 3BQ5A 1GJUA 5K4ZA 2WMGA 3CUXA 1OFBA 4UTKA 3TA6A 5HNRA 1IZJA 1Q5MA 2Q8ZA 4IF2A 4PEEA 3AOFA 3B9AA 1VPQA 3CT2A 1HF6A 4Q33A 3GDBA 1MZRA 1R3TA 1BVNP 3B05A 3CASA 2Y8UA 4OOUA 2PF0A 3MCNA 1PIIA 1TQXA 4FB7A 1ODUA 2CWXA 5BXSA 1IT7A 3GD6A 2EQDA 3WSUA 4TV6A 2Z24A 3ZJ8A 4I9MA 2WJDA 3VK5A 1S3TC 1HKIA 4CD5A 1G5AA 3UVIA 3ONCA 1PZ0A 1EO7A 3H55A 2QIIA 1LORA 3UWVA 3GDKA 1AK5A 2PGWA 2VO5A 3SY1A 4GIRA 1UKOA 2NVDA 4KCTA 4HJFA 4OJYA 1WX0A 4TX9A 4PMXA 3NCOA 3KVJA 4CNUA 3UJEA 2V5JA 1ML1A 5IDIA 4RDVA 5JMUA 4B16A 5D37A 3LLFA 1UWSA 3AQUA 2D2JA 4W8LA 2V69A 4R85A 4KWSA 1MO0A 4DN1A 3POCA 2ZA3A 4DF0A 4BS0A 3TW7A 3ZJKA 2E9MA 2OEMA 4PUMA 1RA0A 3NM1A 5I3GA 3F4CA 3GVVA 4M29A 5AHFA 4JTEA 4H6KA 1POJA 1QNPA 2QLYA 3VX0A 4HPNA 4O1BA 2FHFA 5JXQA 3NFUA 3IGSA 1GYMA 3SUUA 2C1IA 1EL3A 4IMDA 2CC0A 3QPZA 2R24A 3CB8A 4BEUA 2OU4A 3CB3A 3U5UA 4F0RA 2J24A 4QSFA 4DBWA 2NUXA 3QXBA 2HVNA 2A3EA 1U5JA 5BMXA 1HUVA 3RDKA 4AZHA 4I9TA 4OHQA 1DQUA 1OF6A 3NOEA 2PURA 1UROA 3T0DA 3ARTA 5I07A 1JF6A 1V02A 4UFJA 2QJIA 4GI9A 2YPIA 4YTTA 3ITCA 5A6BA 3Q94A 3S0CA 3THCA 4JYEA 3B8DA 3B9EA 1JRBA 2CITA 1S5TA 1ZY9A 3RUBL 1BSIA 4RZBA 2P88A 2PUZA 3WFZA 2BG5A 3KRUA 4UTWC 4CN4A 1R85A 4JTLA 5DT5A 3CZLA 3A5FA 1E0XA 1O12A 4CU6A 3PUEA 2ABAA 4EPDC 4UUIA 1VR6A 2PPGA 4AZ5A 3M0LA 3H4WA 3DDMA 3IJLA 2VZOA 3VNJA 4MY9A 1BYDA 4NZ1A 3UWZA 1FWJC 4B3LA 4B5VA 2IMRA 3LTSA 3GXFA 1DQXA 4FA3A 3MUIA 1D3CA 2H6RA 2C71A 3TW9A 3QQ1A 2C91A 5GJMA 3QTGA 3KL5A 1XSIA 4K36A 3PZMA 4MTVA 4IGMA 3N73A 2QPUA 1TVPA 1VFUA 3T7VA 1OFDA 2ZUSA 1F61A 4V1YA 1KM4A 3AALA 3QQ0A 2EJAA 4AHQA 2GPTA 2ZOXA 1N7KA 4C6CA 3KE0A 3NQDA 2VRKA 2I16A 3P67A 4BQ4A 5CZKA 3AZSA 2W92A 1XHGA 2V2DA 2VI0A 4LS2A 1LL7A 3ARZA 4L6HA 5DXYA 3IJ9A 1E15A 3EX6A 1XLFA 3U4FA 5DN1A 4O14A 1A4MA 3W1NA 3EEGA 1PTGA 2XSXA 1L2QA 2DDXA 3KS6A 3L12A 4Y90A 1DJXA 2A7NA 1B3ZA 5E70A 1JD7A 5M2FX 2HBXA 3QMSA 4U2ZA 2AMXA 1H7XA 3MS8A 3OQEA 1DOSA 5AECA 3FA3A 3T8QA 4S3AA 1ZAHA 1XGEA 1EGVA 2XUCA 2A6NA 3GC5A 3LG3A 3SM0A 3H7RA 1XLGA 3M47A 2PDCA 4G7FA 4LV4A 4UQ9A 1EJWC 3S4TA 4BR1A 3G1VA 2FZ8A 3B8WA 2Z00A 3DI1A 4ERIA 1BXBA 1QI0A 4J1OA 1XUZA 4Z2GA 3ARSA 3VIKA 1OCBA 3W38A 2HBVA 2ZA1A 4AAJA 1AJZA 1Z69A 4E2VA 3PTMA 3CHDA 5JBFA 3GNPA 3WNMA 4RV3A 4DWSC 3VINA 1XYBA 3P62A 4W86A 4DJFC 4HPXA 3TN3A 2OT0A 2QUMA 4ZB5A 2G96A 4DY1A 1F9CA 5HOSA 3M0JA 4NSBA 1I2RA 1RAKA 3SUTA 4M3PA 1E51A 3O8AA 4A3UA 3WDJA 3OU8A 4ZXOA 3CQIA 3CAQA 2NQ5A 1LWHA 4M7SA 2X0YA 4PGLA 1K8YA 1QBBA 4C6DA 4M1BA 3DH7A 5I23A 4LBRA 4L61A 1EJRC 1L9WA 1T96A 1V3LA 3LY0A 4TUFA 5A8PA 1DJWA 4OT7A 4KWWA 2ZDSA 4CEXC 3W2LA 1DXFA 2DGAA 3OG3A 5JU6A 3AICA 1V6YA 4BI5A 1TV8A 3WK3A 3GDRA 4R5EA 4Q4QA 4QX4A 2YBVA 3QLDA 3LHWA 5JH1A 3N2OA 3WF0A 1S46A 4DELA 1A0CA 2B31A 1CYGA 1S5MA 4KFOA 3LTYA 3EYPA 4JFTA 3TYZA 1E72M 1QI4A 1B3VA 4Q4RA 1B3OA 3E0WA 1IIGA 3R8RA 3GTIA 3TSBA 1IEWA 1XRTA 5IHRA 3AMDA 3CJPA 3C2OA 2HISA 3TYCA 4HU0A 2PODA 2RDWA 3W25A 1ZAJA 2NUYA 3S2JA 4K39A 1E5NA 4B9YA 2E1DA 1KFWA 3VGFA 2YGYA 3WLKX 4DQWA 4AZIA 2CHRA 4JX4A 2QJHA 2FVLA 1QHPA 2VENA 1L8PA 4FX6M 4IP7A 1GORA 4AVFA 1DVJA 2AAMA 1XYLA 1K77A 1Q6OA 2RDTA 4GYPA 5LNSA 4CN1A 3H23A 3GIPA 3DHFA 3DCPA 4FLQA 4JAWA 1KFLA 3OEXA 4N9CA 4HCLA 3S5YA 1XLAA 2VEFA 3BW3A 1MNZA 3CIWA 4E8DA 1S5VA 4B5UA 1Z8AA 1KO0A 1KQZA 4AZGA 3OBEA 1A5UA 1A3XA 4MWAA 1OGBA 5FEPA 5FJUA 3T78A 5B7YA 2W3ZA 1JAEA 1HO1A 4AWUA 5LHFA 1TV7A 5HUOA 3TTYA 2IPWA 1MXDA 3N34A 3R43A 1XYAA 4HNOA 4HSOA 2QGYA 2ZUWA 4GJJA 4A3QA 3LGDA 3M0VA 1O7AA 1HKKA 1SW7A 2YFNA 2WPBA 1DORA 4G56A 3N2TA 3LPOA 2CLOA 4GC4A 4US5A 3GR8A 2XGZA 2YCJA 2D0GA 1OFOA 4LUTA 4XD4A 3IJDA 3KBNA 2E9LA 4MWAB 3RIKA 1AJ2A 2V2HA 3MYPA 4OUEA 1P4CA 3R89A 3DXIA 4XAGA 3B8UA 5CZSA 5BOOA 3SN4A 3QJAA 2A3CA 4ADTA 5C70A 3T9PA 1ESWA 1BKHA 2CETA 4PMUA 2DUXA 5DMNA 4O17A 2V0TA 5XIMA 4IM4A 1QO2A 2ZUUA 4GK8A 1W5MA 3OVPA 3VOCA 1RALA 5AC4A 3FVMA 3QN3A 5K9CA 3AIWA 2QR6A 5A8MA 1RD5A 1TIWA 3OG2A 2X30A 3N29A 3F5KA 2IPGA 3GTHA 2OEJA 3BSMA 9CGTA 1XDMA 1NOWA 1YDNA 1SSGA 2VCCA 3ERPA 3N2BA 1OSEA 3KTSA 2R9RA 1MWOA 1DJHA 4RPQA 3W3OA 2Y4SA 2DVTA 3GHRA 3U0HA 4G1NA 1JQVA 4XZWA 5ABTA 1LWJA 4K3ZA 4N42A 1W54A 1VD6A 1XIBA 1Q45A 4PUDA 4Q32A 1TV5A 4OBSA 2MNRA 3CH0A 3ZR6A 2QNEA 5JQ9A 1A50A 1OABA 3TYUA 5JUVA 2G3MA 2J9YA 2G4FA 1HJUA 3BO9A 3OYZA 2G4JA 4BEQA 3OIXA 4I9JA 2XM1A 3MV11 3LBOA 3P5ZA 3RFAA 4NASA 3KWSA 2QYGA 1KFCA 1BWKA 3PR2A 3I3DA 2H3DA 3HFYA 1VLIA 4D6JA 2DU2A 1RP8A 2POTA 4GOAA 1Q8JA 1ZBCA 2BFGA 3MHGA 4WF7A 2J9ZA 4M56A 1IIHA 3QV6A 4JS3A 4UMBA 4ZZ9A 1PS9A 2J8GA 4R53A 3IS4A 1GQKA 1PX8A 2A7PA 4PMYA 3CUGA 4X0NA 3G1FA 3VCRA 2OFJA 4GQ0A 5G2IA 3PTQA 2TSYA 3E96A 2W27A 4NRSA 4JEQA 4Z2HA 5LA0A 1Q7ZA 3CMFA 3DFYA 1J2BA 1GWJA 3EAUA 3MMDA 4OIFA 2EPKX 1A5OC 5LXEA 5FJIA 1JNDA 1AW5A 2GDQA 5LIWX 4IPNB 3VD5A 1R6WA 1V3IA 2OWCA 4M8UA 1JYVA 4ROPA 2P0IA 3AIVA 3STEA 5D9NA 3GW3A 1Y7VA 3M0MA 3U7VA 1TREA 5DBTA 3EBVA 2HEJA 3PJWA 2A21A 2FDMA 1ICQA 1RJRA 5K7JA 4PFHA 1QOPA 4GZJA 4KGJA 1JVNA 5MKGA 4L1WA 1HP4A 1K8CA 4CLMA 3OZMA 1BEUA 1MQQA 2FIQA 2FVMA 4J4KA 1U1JA 1R5YA 1XGDA 2DZTA 1W6TA 3QMTA 3FV9A 1J12A 1U5VA 3NXLA 1G4EA 3RM4A 5CZ0A 1FWWA 2PAJA 4NJIA 4V27A 4M6VA 2OGYA 1TZ7A 3BAYA 5LNUA 3TYBA 5CPNA 3RLHA 1LDCA 3KCLA 4ADSA 1ZAIA 2RGLA 1RBAA 4RL3A 3UPBA 1OIMA 4MZ8A 3O15A 1FWCC 1AQMA 2QCDA 2ZWZA 5HUPA 3IUIA 4MLRA 4ZTXA 1RK5A 1VYSX 2WPGA 1JQXA 3MDWA 1OK4A 3P3BA 2XH4A 1E3ZA 4A4AA 4F4RA 3AAMA 4I7VA 4PCTA 3WH9A 4URIA 3IUHA 1UA7A 2OXNA 5EB8A 2QCEA 1S2AA 3E2RA 3NQBA 1OFQA 5I3KA 3CYJA 4K2SA 1AH4A 2VKZG 2HXUA 3WFAA 4CD7A 3ARPA 4R88A 1UP2A 1Q6RA 4HCHA 3BPWA 1Y5VA 5FIPA 3PZTA 1UKQA 4MKVA 5F4WA 3DEQA 4PCSA 2D20A 1YDOA 2YDQA 4UCFA 2QCDB 4Q8TA 4D8AA 2C18A 4ZOCA 3GC4A 3JVAA 5FACA 3AHYA 4B9ZA 1UR1A 4XBJA 4Z1YA 3W7RA 5T9BG 1JDEA 3RX2A 3VC6A 5AC5A 2O9RA 3KZSA 3W1RA 3QZAA 3B8VA 3HFTA 1F6YA 5HJYA 2P8BA 3H21A 2Z29A 3PBUA 3AC0A 4UR7A 2ZTKA 4IL2A 2V3FA 4JICA 4W84A 3RPMA 3ZT6A 3F03K 5DANA 2HK0A 2ZFAA 1XIGA 3ICJA 4Q7BA 3ZM8A 1WXZA 3DU0A 4FS9A 1LLZA 4MJMA 4FNRA 3NTYA 4HSHA 4GA8A 4JTUA 4GUGA 4RE2A 1C90A 4WKAA 3CYVA 4F2UA 3GH5A 5MF5A 3M5VA 5H8MA 3KOZA 4G2DA 5KTLA 1W17A 1OYAA 3RPDA 1FBAA 4KS0A 1EOKA 1CLVA 3L67A 1SR9A 4YJ5A 1ITXA 1TX0A 2GGIA 3TR2A 1HVXA 4QDPA 1XH1A 2VFGA 2ZCGA 1W3NA 3GVRA 1OCNA 4EKJA 3BGJA 3XIMA 3VILA 1REQA 4DLFA 3K8KA 3GO2A 1B54A 3DFQA 1FXQA 3E74A 3NXFA 1PWLA 4HOXA 1A0DA 1EDTA 2WZEA 3P7YA 3VNDA 1Q85A 3QTPA 3P60A 3LXBA 4H19A 3DKJA 1DXEA 1QCWA 3KOYA 3KOXA 2ZADA 1IWAA 5LNWA 1UHVA 3ATZA 1R8LA 3AIQA 2ZC8A 3QOMA 4S39A 3SDOA 4BF5A 5LSMA 2XU2A 3WN6A 1VBUA 3N2XA 5D9MA 5IOBA 3G3DA 1X8FA 2C1GA 1X38A 4HZ8A 1HJXA 1ZJBA 4GFIA 3N2MA 1JXKA 2XH7A 1WV2A 1BGGA 3VGBA 4A2SA 1OJXA 1Z42A 1XQLA 3PAOA 1REQB 4XZLX 5JIWA 2OX1A 1NELA 1GCYA 3OO2A 2DZSA 4IGSA 4KCWA 4KWOA 3W7JA 2WC4A 1THFD 1H1ZA 3R7MA 3MI6A 3NAVA 2QCHA 5D09A 4KEVA 2X1IA 4WQ6A 4X9SA 3P61A 1ME7A 3ZLGA 2O0TA 4AC1X 5A6KA 3QF0A 4DO5A 1UR4A 1E73M 1HJVA 3PZVA 2CLKA 2ICSA 4GUFA 3A4AA 1Q8AA 3HMCA 1UP0A 4A22A 3EEZA 3SUSA 3INPA 3O2LA 1PL9A 2CBIA 1QPRA 1LRTA 2WSYA 3M5XA 1GNXA 3VA8A 1FP8A 2FJUB 5KSWA 3GVWA 3B3DA 5DCBA 4D6EA 3K13A 3UG3A 5AVHA 2V5BA 4J27A 2W6RA 1MVYA 3UBPC 1EJSC 4H9UA 2PWFA 1TTJA 3R8HA 4GI6A 3CEPA 1OFEA 5F1UA 2CHNA 4DWSD 2BGQA 4PMVA 5D9OA 1TX2A 3PPGA 2NXHA 4CN6A 1MSSA 4UR8A 4C65A 1XLBA 1XYZA 2HXTA 2ZKMX 1M7OA 3V1HA 3NZPA 2EGZA 2O7SA 1JCLA 4O10A 4Q6XA 4QE5A 1W3KA 1IGWA 2J25A 3QPEA 1KV5A 1LOLA 4NYYA 3ZMRA 1WAWA 1W5NA 2O9OA 2RKXA 2WQPA 4NRRA 2BHYA 3NYZA 3N2CA 3IVTA 5LHEA 1UASA 5I03A 3KLLA 2X1SA 4J3XA 4YLWA 5AHLA 3JR2A 4F9JA 4PMDA 2V5DA 3GTFA 1FWBC 1HKJA 7A3HA 4MJ2A 4O1FA 3WD1A 3BK0A 1F74A 2QXWA 2QDGA 4Q8NA 5HXMA 2X42A 2ATMA 4LWWA 4RE4A 4E2BA 2QPSA 4YU1A 1L6SA 4OKDA 1ICSA 2O55A 2J77A 2MANA 5I3IA 4D6CA 4PMOA 1R86A 1RJQA 1KD0A 2E6AA 1JYWA 4IIHA 1JRCA 2XSBA 2WC7A 4GBDA 5JBDA 2F6XA 5C54A 4QG8A 1BVWA 5JVLA 4IL0A 3AIUA 1JYXA 1DBTA 1FWFC 2E25A 4XX6A 1AMYA 2VZTA 4WJ8A 2HE8A 1S38A 4YYFA 4QSHA 2WLYA 3NDYA 3D0CA 2GJXA 4IMGA 3TONA 3S9IA 1DWGM 2ZICA 4MJ4A 3HB9A 4AY1A 4ES4A 1OHLA 1S2UA 3RG6A 3AYSA 3JU2A 5A94A 3HO8A 2Y5EA 3V18A 4RNHA 3S83A 3HJZA 3WLNA 4AEOA 4P2VA 1J18A 2FHBA 1ZTVA 2GGGA 3OODA 3KFTA 1BTMA 3MZNA 4KIEA 4ZR8A 4AY7A 1G7UA 1W3IA 4PRRA 1TJ1A 2E09A 5BW6A 1VFOA 2JIWA 4ZOBA 2G3FA 3HIJA 2XVKA 2RFGA 5DFAA 3H8AA 1FWHC 1O66A 1XIJA 3UGRA 4U33A 4PTMA 4W89A 3O6AA 2VEGA 3FJ6A 3HQNA 1TWWA 4JPGA 4NZ4A 1VBGA 5LKYA 1F8MA 2DZXA 5C71A 4DZHA 4I5RA 1TA3A 3UVAA 2NZLA 4UNKA 4JN8A 3BURA 2TYSA 1W1VA 2WJFA 1IHIA 1D7FA 4XAZA 3HG2A 2HNEA 1KR0A 1TJ2A 5KINA 3GHSA 2DT0A 4LGXA 2OZ8A 2AL1A 1QATA 2EEXA 1M53A 2PDPA 1DP0A 2X0SA 5JH2A 3UETA 1EUNA 4BF7A 4L7ZA 1DIEA 2XN2A 4ATLA 2DVUA 1BKSA 4HK5A 3WYZA 3C3UA 2HDJA 3W7LA 4HTYA 1W1ZA 3SSZA 6ENLA 4JIPA 3GXPA 1B0IA 1QVBA 3CIVA 5AHNA 5A1AA 4OE7A 1TA3B 4L1GA 1R3RA 3MQTA 2OZTA 1J5TA 4UNLA 1AZ1A 1T5AA 2X7WA 4N7QA 1XJBA 3TDFA 3OB8A 4YTSA 2Z7GA 2WJZA 5E0FA 2X41A 4TU1A 1GW9A 1PO9A 2Y5SA 1BYAA 1ZZMA 4PSRA 3A9IA 5TIMA 4UCGA 3G77A 3OLEA 1QNRA 1RPKA 2FTPA 4FXRA 2XGIA 1UZDA 1XUUA 1XP3A 4J3VA 4EPEC 3S42A 4OBTA 1P7TA 3WG6A 4CD6A 4GX8A 3PWAA 1P48A 4LALA 1BLIA 1SZRA 3MHUA 1QK0A 2IKHA 3CT7A 2NQ9A 3QC0A 3MJYA 4QS5A 1B1YA 1SO6A 3U8GA 4ORIA 3NR0A 2GQ3A 4LOCA 2F38A 6TAAA 3GYCA 4M82A 4BQ5A 4EACA 2XTKA 1M7JA 2PRMA 2GZXA 4D6IA 1HTIA 3NPVA 4AIBA 2QCCA 3KL3A 5J5DA 4LNCA 2Y7DA 3ZR5A 3FHQA 1P7TB 4GISA 2Z1XA 1C3FA 1V6VA 2GVJA 3BXWA 4B2DD 1VIWA 5G4WA 3FJLA 3MP3A 3EA2A 2Y63A 3ZXWA 4S3EA 5AFDA 2XFRA 4BWLC 4U4MA 4HNUA 3GHUA 3BWWA 1W1A1 3H2NA 2OQHA 5BRBA 1W5OA 3A64A 1UP3A 3LDVA 4JNZA 3ABRA 1EP1A 3HF3A 1YHTA 2VCAA 3A6OA 3GZ3A 1RD6A 5A2BA 4FMVA 1XDLA 2FMOA 4S38A 2PLMA 1VYPX 2FYMA 4A8LA 2VTFA 3RXZA 3L4VA 4JTDA 1YQ2A 2ZC1A 4IPIA 4Q4SA 4Q8VA 3OHMB 5C2CA 2YBTA 3ZWSA 3TKFA 2E6YA 3FVDA 1TVLA 1V51A 1QNQA 3MW7A 3H2MA 3WLJA 2QF7A 3NPWA 1AW1A 3L9CA 2P5NA 2QMJA 3KLKA 4H8NA 1K9FA 2PU0A 5TQLA 3VIIA 5FOOA 3W00A 3TCSA 1SVDA 1BF2A 2AL2A 2V3EA 1XV8A 4KRTA 5F2MA 3FCPA 4JCMA 4QE1A 3L2IA 1JJKA 1HJQA 3UERA 1SYTA 5FJJA 5AZ1A 5FCZA 1WXYA 3TU9A 3VX1A 1XLCA 2R91A 4DZAA 3FHAA 4CCCA 3HM7A 1EX1A 2OZ3A 3QZ6A 1YADA 3MB9A 4Q8PA 5C2GA 1GZ1A 2XWEA 3ARUA 2CBJA 3WQ5A 4WSHA 3DC8A 4J5NA 3CZJA 5I77A 2AL2B 5H1WA 3ATYA 2NQLA 2G5WA 4BI7A 5D2YA 3PZUA 2UY4A 1QNVA 3CK5A 3GFYA 1PIFA 3DZ1A 4S3BA 1J0YA 1R7AA 1ZGDA 3E0FA 1K4HA 4FPSA 4O0KA 3W28A 3CHVA 1UJPA 1I1WA 2JALA 3O9NA 3V36A 1R2SA 5DY2A 2V3GA 3W7PA 3G2GA 2NXIA 4KBXA 2VGBA 3LOTA 4GVGA 3CIXA 1XLJA 3WF1A 2E9BA 2BS9A 4IIFA 3IAPA 4UTWA 1V02E 1YW1A 2ISVA 4C5YA 1TPH1 3ZIZA 3LM3A 1RH9A 3SURA 2X0HA 3SRFA 1Q6GA 4DYKA 2FQIA 1RQEA 1PV8A 4Y9NA 3S1UA 3M0KA 4OQVA 2ZRYA 2Z1BA 1O5QA 1HG3A 4UMCA 4QITA 3M5YA 2P3ZA 1TPEA 3EA3A 3CUJA 1R87A 3GUWA 1Z48A 3NPXA 1QJWA 3EOOA 4ZSUA 3GLCA 2DW7A 2D2HA 2GYIA 3LMYA 4B3ZA 3GVGA 3S5OA 2BMBA 2GSJA 4HB7A 1EEXA 4TMCA 1W9DM 3VIPA 1O5XA 3NYDA 4MSSA 3UF9A 3L5MA 5I6SA 4X63A 3EX4A 2PSNA 3TSMA 1YE4A 3VUPA 4FOJA 4S3CA 2BLEA 3PJTA 1XYMA 2PRLA 1GHRA 4M80A 3VD4A 3LNMA 2E8ZA 2YYTA 5AZ0A 4ZL1A 4JZ5A 3DI0A 2DVXA 2R1PA 1J5SA 2RJGA 4AXNA 4B5WA 3R25A 2QUUA 4UQEA 4MB4A 3BAXA 5D38A 4DI8A 4DHGA 3LV6A 1VC4A 1R3SA 5HWMA 2Z0IA 5DELA 4AU0A 4AXKA 3A5VA 3EOLA 1CB2A 3D3AA 3PSVA 3S1VA 4Q4OA 4U5KA 4MNMA 2ZXAA 3NQ2A 4XB3A 1E4LA 3ZR4A 1OCJA 2DV0A 1YBQA 3FYYA 3VFLA 1MEIA 3LMZA 1Q6FA 3HV8A 5LGXA 3EKLA 2CZFA 3FEQA 3M0HA 2DT1A 1JNEA 3VOHA 4ZSTA 4MZYA 1K6WA 1CXFA 4DWSA 2ZUNA 4DJFA 1AMKA 5ECUA 1BYCA 1WQ5A 3COTA 4NJHA 2VRQA 4REQB 1PTDA 2D2OA 5D30A 3GW0A 3PBVA 3THDA 4PBGA 4TVCA 3CQKA 3MU7A 3EWXA 4NILA 1YBQB 3QW3A 3AHXA 2G0WA 4MZ1A 2V67A 2Z2UA 3GTNA 4GI4A 4L9YA 4IIEA 3WBWA 3F2BA 3H2CA 4E5TA 8RUCA 3VKDA 4DWSB 1ISZA 1QR7A 3UA4A 4C6JA 5FF3A 1FH8A 4DUVA 4Z0SA 3R11A 5I3JA 1K9EA 2A0NA 4LV9A 1NFPA 5FJOA 4LC8A 3VMNA 1H09A 1LRQA 2C1HA 1X1ZA 3TJIA 2D0FA 4NXSA 3M44A 3VNIA 3OPSA 2VGFA 6A3HA 1RR2A 5C9RA 2OWWA 4AY8A 4PL2A 3CQJA 1S1RA 3SQMA 3H26A 3WDRA 2H8ZA 4O1CA 3CTLA 2WM0A 3AYTA 2OSXA 1VEOA 3QR3A 1EIXA 1GJWA 4ERGA 1W2VA 1ZBKA 2OB3A 2NQZA 2I14A 3D3FA 2PD5A 1LG2A 5HNUA 3HPFA 2GUUA 2L5HA 4GQQA 1GVQA 2Z26A 4FLOA 3VM5A 1EGMA 4XZMX 3TW6A 3W82A 3NQFA 4JL2A 5BCAA 4WOQA 5E0CA 1XD1A 5I3FA 2ZZ7A 2BSLA 4L5ZA 1RSCA 3KL0A 1YRRA 2DUZA 4QXIA 4L9XA 1A5SA 4OECA 4X61A 3CQ0A 2F84A 5GJNA 2GWGA 3ZLHA 1FWDC 3O0KA 3AYRA 1G01A 3W85A 2P8CA 2NV2A 2Y7FA 1FCUA 2FGLA 5BOEA 2WB5A 1KB3A 3MANA 2FFCA 1H5VA 1W3TA 2DP3A 4O1DA 1Y5WA 3B97A 2PP3A 3AU6A 4IQLA 3W7IA 3M6YA 4NL1A 4GXMA 3N17A 2O92A 2DJLA 4DXKA 2GOKA 5HQMA 3P2VA 1TPVA 4CD8A 4MWAE 3JW7A 2XIMA 4O19A 3HPAA 1FTXA 3NQ7A 2H9AA 4O15A 1TRIA 2Z1VA 1L8NA 3C2YA 4HBKA 4B90A 1E6ZA 1GQIA 4RZ5A 2IKGA 1Z44A 3MI3A 3PBYA 2QCFA 4DUWA 5I06A 1UA3A 1BG4A 4YIWA 3EMQA 4N4QA 5AHMA 3P82A 4IPPA 4CKQA 2Y8KA 3BICA 1RLCL 3H2FA 4ZXLA 3BV7A 4NT0A 1PHQA 3H12A 4EX4A 1A5AA 3GNXA 4QAIA 1IZCA 3IV3A 5EU9A 1C93A 3ES8A 4ZTYA 4K8GA 1UZ1A 3NQCA 1EUAA 2WC3A 3IIOA 2YXGA 1HKMA 2GJNA 4AISA 3KX6A 1GZJA 2CLIA 1WKDA 2C15A 2R8WA 4DX3A 1WZMA 1LROA 5HATA 2R14A 3WUEA 3H2AA 4ZQOA 2WK2A 4MB3A 3V0SA 4PH6A 2VEIA 4CNNA 4NU7A 1V4YA 4QQ3A 3DIPA 1DE6A 3RF9A 3UG8A 1X7FA 2G8ZA 4GUJA 1FA2A 4GKTA 1GVFA 1EWEA 2IQDA 3R1ZA 5C8BB 2GOUA 1ENUA 1TWIA 3DUGA 4I5UA 1VS1A 3EXRA 3I6TA 3GKAA 1OG6A 3Q65A 1OX6A 3PVFA 4GCXA 5LIYX 4IMFA 5M17A 1ALDA 4YVXA 2OT1A 4AC7C 4GIEA 2ZE3A 3CV1A 1KXQA 3G8EA 1AFSA 2J75A 3RAOA 1QK2A 1UYQA 4W85A 3W70A 4LAZA 3AS0A 2NLYA 1JZ2A 3EB2A 3W4RA 3RCNA 1YYAA 2Q3RA 4FNTA 4IP5A 4GFSA 4H7ZA 3FGCA 4UTMA 2HNHA 4M6PA 3KBWA 2PC8A 4XVEA 1XH2A 3W7KA 4MYXA 3B0XA 2DORA 2CXEA 2BV9A 1H7WA 4H9VA 4FF5A 3UYIA 1QNSA 4O0QA 5BXRA 2JF7A 1Z7AA 4B2DA 1GOWA 1UPPA 2AMGA 1FHUA 2W4XA 1UUQA 4NZFA 2DPEA 4Q8OA 1XLKA 3U7BA 1MXSA 4WKFA 3AHZA 3KRSA 4U3AA 3UQNA 3WLIA 3B9NA 5A8NA 1NWTA 4DUXA 3MKVA 1C8XA 4L6OA 3MY9A 1XGZA 2WCGA 3S8HA 3TTSA 4PCNA 3A12A 3CS2A 2GJRA 2VC5A 3FGCB 1W0MA 4K7YA 2DW6A 3PB2A 4ML9A 2V5LA 3RX3A 1S39A 5E6ZA 2I17A 2YZRA 4GXWA 5FSEC 3KM8A 2FTYA 3N19B 3TTEA 4IMCA 3RYSA 4HU4A 2A6LA 3HQPA 3I10A 2WHMA 2WBGA 1EZ2A 1K9TA 4HYWA 1E4IA 3QYSA 1KCZA 2XVGA 1FOBA 3R6IA 1CGWA 3U2OA 1LLWA 3AXHA 2Y62A 3NO5A 4HIBA 1R2TA 3CLWA 3BCJA 3CU2A 3S9YA 3GDLA 2B7NA 4A8IA 3OVRA 1DTUA 4IPJA 3GXTA 4MY8A 4I8DA 2Z1WA 5HINA 4M51A 4JR5A 1RCQA 2ACSA 1C7TA 4GVHA 2VNCA 5IHSA 2R1KA 4JXCA 5A2CA 3VIFA 4QLKA 4ERAA 3R0KA 3IJ7A 1KM3A 3THQA 4D71A 2IXUA 3SBFA 3W27A 3WBYA 3CL7A 1FKWA 2F8QA 2ZZ3A 2UV8G 1W9VA 4IFKA 2PTDA 4JIIX 1HZYA 5A95A 1J6OA 1SZGA 3O6DA 2H3BA 1SM9A 3G22A 3CUIA 2PWHA 4PMZA 1OFAA 4CNOA 1NQKA 1Z9AA 3MSDA 5JIPA 3LS9A 4RNJA 2J8FA 1WO2A 3MUCA 1YLVA 3K30A 3BQ6A 3TQPA 3MCMA 2ZXDA 2JEPA 3BMVA 4FF7A 1KW1A 4LPCA 5AYXA 1CNVA 2P3EA 3PUOA 4HK7A 2XM2A 4IH3A 4PTXA 3RJYA 4DZIA 4IFKB 2WNZA 2ZZ1A 1VBRA 1EEPA 1ZP3A 2QJMA 1HL8A 4PMJA 3GDMA 4ZE5A 4AHPA 4N9BA 2XIBA 1SJCA 1YXCA 1Q6QA 2YXXA 4S1FA 3AXKA 4UOJA 3GNOA 5HQLA 4MIMA 4NP7A 4JY8A 1XWYA 3WQCA 1GOOA 3RPTA 3AZTA 4LAKA 1Q65A 3TWBA 2G50A 5F7UA 1DWAM 1LT7A 3CC1A 4FX7A 2D3NA 2HMCA 2NVCA 1GVYA 5ABHA 4KRUA 2YW4A 3TN4A 3GR4A 2E7FA 1FDYA 1EJ7L 2QDEA 2Q01A 3DG3A 3VDCA 4WDUA 3TQKA 1NVMA 2WO5A 4IJRA 1PPIA 1JCYA 2BOGX 3W7NA 4TOQA 3WENA 5H8PA 3ZS4A 3KVKA 5EMYA 3NVDA 1YKWA 3IGHX 2A3AA 3QY6A 2DEPA 1XLLA 1E1EA 1RUSA 1Z6KA 1NFBA 1IEIA 3SRKA 2OKOA 1PKNA 1TV4A 4RE0A 3RO8A 1L6FA 4EXAA 3CH9A 2XVLA 4PSPA 4X2RA 4QTGA 1Y65A 4GABA 3CL8A 2QVNA 2CESA 3B8TA 5CPOA 4UZUA 4BCEA 2QT3A 2WHKA 3WLRA 3CV7A 3G18A 4XKYA 4GRSA 3PP7A 4PUJA 1IV8A 1ADDA 5HK4A 2PDYA 3S1WA 3S6TA 4GKLA 2ATSA 3B0PA 2Z1SA 3SADA 1K8ZA 4KF1A 5CPQA 3PBWA 5KZMA 3ORWA 2I9UA 4M7TA 4E2DA 1OYBA 2DSKA 3W1LA 4HYVA 1P6BA 2C7FA 3AS3A 1SFJA 1ZUAX 6PTDA 3B40A 3QZEA 3MVTA 3RR4A 3QC3A 2J62A 1RJPA 3EOSA 3BLKA 3HPZA 1PSCA 3T44A 2BY2A 2E4TA 2JQXA 1E55A 3DFOA 3A4XA 3M0YA 4XKYB 3WBXA 1TVNA 4FIQA 2W61A 1EHNA 4Z1CA 5H8UA 4GJ1A 4H2CA 4M5PA 1QWGA 3TSDA 4C6EA 3NL2A 4IOTA 1YNYA 2D0HA 3W86A 6XIAA 1OT2A 2QF8A 3AHVA 2OQLA 4U3CA 3FY1A 3F4DA 4LU0A 3A47A 3ABXA 2OYMA 2Z25A 3VCCA 3OGVA 2OMAA 1AH3A 2E40A 5FJTA 1VB9A 3IPWA 4E8GA 2E5BA 5CBIA 4QJ3B 4JY9A 4JOMA 4HQVA 5LIUX 2OJPA 3N15A 4WDWA 5C0QA 1K02A 4PL1A 3APTA 1EJVC 1T7LA 1W56A 4DYEA 3LERA 3LN3A 2JBMA 3TE9A 4Z1AA 2C79A 3NSXA 2HE5A 4BJHA 3UU0A 1P1XA 3SO7A 1S5NA 5A6AA 3VIOA 3BLIA 1IT8A 1WBHA 4RDWA 4JQ1A 3JZUA 1F73A 2XDFA 1JPDX 3PS7A 3L21A 1X6NA 2IPJA 3SI9A 1PDZA 3UG4A 4MNJA 4PTDA 2F9RA 3WZ0E 1WB0A 2ZX5A 3F1QA 3U9IA 3MPGA 3T0AA 7ODCA 4MFDA 1UWRA 3WH7A 1ISYA 3APGA 3GH4A 2PE4A 3IV8A 1ECEA 1EHAA 3DBPA 4A21A 4EK7A 1WDPA 5F2GA 4JFVA 3F2DA 2WZHA 1VF8A 5EMMA 3NO3A 1KTNA 3NZ1A 3BMWA 4DBEA 2FZ9A 3KCOA 1DWIM 1IR2A 3BJFA 3A22A 1J0HA 4H1ZA 3W01A 4HOWA 5DO8A 3SCPA 1WKYA 3MSYA 3VVGA 3C5QA 4GE8A 3JZEA 4ML4A 1K9DA 3QKZA 5XINA 3DOPA 2INFA 1YXDA 3I4EA 4AZ7A 2ADAA 4FI4A 5C9XA 4O53A 3UZXA 3ZZ1A 3ZFHA 8CGTA 2FMNA 2E77A 2NT1A 2IS7A 4F8XA 3QBUA 5KMYA 3WD3A 1LWIA 3OVGA 2BB0A 2YBUA 3OQ8A 2Y0FA 5I7GA 3SCOA 4DM2A 2VYOA 1GKQA 3O16A 1H1YA 2NX9A 4PE8A 4O1AA 3PWGA 2QJNA 3CXOA 4AX7A 4AF0A 1EQCA 1NY1A 2WM1A 1GVIA 3KTCA 1XX1A 3T1GA 5EMLA 2J7GA 4YTRA 1GPWA 2CCRA 2Y88A 4HZ7A 3DFSA 1LTDA 4AW7A 3WF2A 1DJNA 1SO3A 1TZZA 2Q6ZA 4HHHA 3QY8A 2IPFA 3LXCA 1N8FA 3L2MA 5CZJA 3GWQA 4KESA 5A6JA 5T91A 4JTAA 4FR1A 3URQA 4LRTA 3CPUA 1YX1A 3M0XA 3WH6A 2YKKA 2WWDA 4QIUA 4W4QA 1TV3A 4GQBA 3MP4A 3DAQA 3E0IA 4LVFA 4JQAA 4RKAA 1V77A 3BW2A 3IANA 4H41A 3UFYA 4AF0B 1PZ1A 4BHYA 3NIYA 2C16A 3RK8A 5H6HA 3B0UX 1E1CA 4A3RA 3L2LA 1UJQA 4XAYA 3V3WA 3OVQA 2VL4A 1ME8A 3FJNA 2GUBA 5LGZA 5M03A 1HKVA 3W75A 3ITVA 3F4VA 1CGYA 4JIHA 4P7RA 5CLTA 2WHLA 1P0NA 3EB3A 1JEZA 3PJXA 4RW5A 4Q8QA 3N9KA 4K38A 4QM1A 1PIGA 1C92A 2ZXQA 1EO5A 3PFMA 3MYOA 1AJ0A 5BNKA 3ABQA 3WJXA 1TPDA 2VDIA 3UJFA 4U5IA 1O4UA 1FH9A 1XYCA 4LNYA 4ZFMA 2QKFA 5DMYA 4NF7A 1E1CB 3GB6A 3BTNA 1K70A 3V5OA 1CX9A 4W8BA 3IK4A 3R2GA 4D8LA 4FXJA 2QUTA 3IARA 3R58A 1LF1A 2ZQ0A 8TIMA 4NJKA 1DIDA 1R7OA 3U2EA 5LNRA 3UWYA 1UZ4A 4AEEA 3M7SA 2I9EA 1C7SA 3UR7A 2DIKA 1OZMA 4S3GA 1H1NA 2PTZA 2Z27A 4PMQA 3PNUA 3WLPA 1P0EA 1UW9A 3AWNA 3NQAA 2PDGA 3NOYA 4EF8A 2E5CA 4NG3A 1FDZA 1PZ3A 4GGHA 3EPMA 2JGYA 1PBGA 4HU3A 1PKYA 4H7VA 4HNCA 3S1XA 3DG7A 3S1GA 3WMSA 2NX3A 3C0QA 2IXVA 3KBJA 1D8CA 2JK2A 3IIPA 1UKPA 4UTHA 4NY2A 5HA7A 1S2TA 1MI3A 3KP1A 3BANA 1QI5A 1VFHA 2RAGA 4P7OA 1UD4A 4UFKA 5GNXA 5I78A 3FN9A 3QQWA 3P8JA 4RNIA 1P6WA 4LUYA 4C6LA 2J88A 3N6JA 1KR1A 4JEJA 1VYRA 2VWTA 3O1NA 1F3XA 9XIMA 3LSBA 3F5JA 3N3TA 4JYFA 1LBFA 4DNHA 3F2CA 3WJWA 5DLCA 3EWCA 3KHDA 2J13A 3NUKA 2WMHA 5CC3A 4E6MA 2FHCA 3DESA 3GG0A 3L4ZA 1NWRA 1A5BA 1H61A 1G1YA 2UZ9A 1FQ0A 2W67A 1DWHM 2VXNA 4UTUA 2FGZA 3GG1A 2PC4A 5KZDA 1VRDA 2BODX 2Z4GA 4HA3A 4AMAA 4KRZA 1NIUA 1CCWB 2Y1HA 1X8CA 5D03A 3EKGA 3UG5A 2BNJA 3WF4A 3WQGA 4LH8A 3WQOA 1UH3A 3UZ5A 2CBUA 2IKJA 3Q37A 2REQA 1ZNNA 7TAAA 3HMJG 1O60A 1JGMA 3GU1A 1V7AA 3CGTA 4DJED 4E3TA 3GC2A 1GHSA 1KGXA 4A3YA 4AUBA 3WUBA 2CERA 4BY3A 1VCFA 2PWUA 4EAMA 1CI1A 2F7FA 4F2BA 3NPUA 3SJNA 5CBBA 1KV8A 4JN7A 4YVPA 3G0SA 1NDYA 2NT0A 1TTQA 3KXQA 4LYQA 4LUJA 5BOFA 4QLJA 4TTGA 3WBEA 5I2UA 3MSRA 3LCWA 3LRKA 5D05A 5BZAA 4UTJA 1G0CA 1R2RA 2WXDM 3E2VA 3VAVA 4Q7NA 1JCXA 3GR7A 4YWSA 1GOKA 1TE6A 2YSWA 2EAWA 1RCOB 2REQB 4AQLA 3B9DA 1K03A 1O1ZA 4HNLA 2D23A 4H2HA 4UFMA 4W5ZA 3A4JA 5E0KA 5ABGA 1VJZA 2Y7EA 3DERA 3TNOA 2QJGA 3WY1A 1EBGA 4JN6A 1A5NC 5AYBA 1OM0A 3PZNA 4ZQPA 2D3LA 1I60A 1RQBA 2YL8A 3C4UA 3GM8A 4PUUA 5AYIA 2PWDA 4IGNA 2Q02A 1EH9A 5FF4A 5A6LA 4ZOEA 4NVTA 4KQNA 2XIIA 4N02A 1ZP4A 4WDTA 4BZYA 4D8ZA 1FFQA 4Z2KA 1UR8A 5A6SA 5HNNA 4C6OA 2Q09A 4MWAC 3W1TA 1JZ7A 1ITCA 2P53A 2V81A 3IGXA 1AVAA 1H2JA 2PLCA 1RCXB 3AMCA 5EY5A 1CGXA 3LZ5A 3UWWA 4H6QA 4YS1A 3GXDA 2UWFA 4PC8A 4S2BA 3LPFA 1Q6EA 1MMFA 3SIZA 4W7VA 3BGGA 2VX5A 5A69A 3WO8A 2ZE0A 1RBLA 2GSHA 4JFSA 1XLHA 1F76A 1OX5A 3MZ2A 4RV8A 4YTQA 2DUAA 2VFHA 3VMPA 2OODA 4QEEA 3VDGA 4QG9A 4UQBA 3WJSA 1NDVA 1V93A 4Q22A 1EGZA 2WVVA 5TNVA 1XPGA 3URNA 5CJ5A 3GY1A 2W9MA 4NKCA 4JFWA 2OYLA 3DHPA 4XD3A 4X0VA 1F07A 4FOKA 4GY7A 2PGFA 1E1FA 4HNTA 2E6FA 3BUVA 1EFZA 3T4WA 2FLIA 4ZO6A 3SCTA 1XLIA 1T8XA 2VCBA 4J3UA 5AHIA 4GH3A 1KM0A 4S3JA 1JYNA 3UJSA 3HGOA 1RZMA 3V5CA 2VURA 4O0ZA 2WVVB 3EWWA 3LK6A 2J7FA 3IJIA 2R1NA 4H9ZA 5FJPA 1B2YA 1U1HA 2Y89A 3FEMA 2CNCA 5ENLA 1W8SA 1E6NA 3P8IA 3QSTA 4NZ3A 3NURA 1TPWA 4JDYA 3WL1A 5ECVA 4KT2A 5HMFA 5ABEA 2HPIA 5C9ZA 1XC4A 2ACUA 4AMCA 1XIIA 3N04A 4IIBA 1NQ6A 3NSMA 1W1B1 3G1AA 5DX7A 5AYZA 5LXXA 3B8SA 1CLXA 4MYAA 1PHWA 4FP1A 1SO4A 5BRQA 2XFYA 2NQHA 4DO6A 3TN6A 2WZIA 1D3HA 1O6IA 1F6KA 1GVRA 1JUBA 2YW3A 1NU5A 4DJDC 4IIGA 4WZHA 1IXNA 4E4UA 2XN0A 3RCYA 4DBSA 1JDDA 3ONBA 3EDJA 5DF0A 1GYNA 4NQ1A 3WQ4A 2AQVA 1PZ2A 5C7VA 3TWAA 1CTNA 3UZZA 2KAUC 4OGZA 5G1YA 1LJYA 2PWEA 4DPQA 3YPIA 3VKCA 5EKYA 1KBBA 1M3UA 4Y9OA 3W2KA 1A53A 5CAKA 5TF0A 1WYIA 2E28A 3G1DA 2GDVA 2GGHA 2DH2A 4FNPA 3FYPA 1OYCA 1UCWA 1XCXA 2W5FA 3QGKC 4YYCA 3CPRA 3T81A 1LZOA 3ABOA 1VJSA 5G1MA 4XIAA 1JI1A 4EE9A 3TCEA 3AUJA 3CHCA 1OK6A 2GL5A 3VIGA 4JHOA 1UWQA 4RPPA 1Q7QA 2OZ0A 2UY5A 2QJJA 3QFWA 2INEA 2E68A 3S5SA 3E3HA 2WSPA 2QEZA 5AY7A 4W88A 2W63A 4HJWA 4LB3A 2OOGA 3CHEA 4UMAA 2PDJA 3QGVA 3WDPP 1KC7A 4N2YA 3HPXA 3IUDA 4KCVA 4MY1A 4GMEA 4JKKA 3VCNA 2F61A 5CH9A 1OC5A 3PY2A 2A5HA 3EMCA 4DRSA 4UOQA 3QMRA 3CV2A 1K7FA 4NNBA 5BMWA 1VIZA 2XVPA 2MUCA 3N9RA 1MFUA 3LX9A 1RP9A 4TIMA 1EF3A 1TE1A 4H4IA 3WNOA 4J3TA 4V2XA 1YXYA 1O5RA 2NXGA 4E0CA 1ZU8A 3N4FA 5GNZA 4C7FA 3WQPA 4MNLA 1KRBC 5BXTA 1JPIA 1TELA 4YNGA 4EIVA 2VZUA 5IFTA 4LF2A 3VZYA 3BJSA 1QRQA 5D2WA 2Y24A 3CUZA 4C6NA 3H4GA 4FIRA 2ZTJA 3UR2A 2CYGA 4FNUA 4CQAA 3V0UA 4JTIA 4Y8FA 4R27A 1KCXA 3EDFA 1K6AA 4C6FA 3CV6A 4Z42C 2OEKA 3CWNA 2QULA 3USZA 1ISVA 3BW4A 2CXGA 1XPYA 4FO4A 4I7UA 4F40A 1XISA 1UWUA 1H62A 1VAHA 1HO4A 2OKTA 5IDZA 4ZCWA 3ALGA 4LYRA 4ZMGA 2O56A 3OGSA 1KWKA 1JZ5A 2CLLA 4CQCA 2A79A 1I2NA 2BWGA 7TIMA 2ABBA 1C29A 3MUXA 3DG6A 2V2CA 4XZHA 4P7NA 3B4YA 3DFPA 2X8RA 5DBUA 3NZGA 4WSKA 3VYLA 5CC5A 3NGFA 3SAZA 4LFYA 3MI2A 1OC7A 1BGAA 1S5WA 2D22A 3IJQA 4Q4KA 2H90A 3VD7A 3NL3A 3UPWA 4DB7A 1B3WA 4Y9MA 2PTWA 1R9ZA 1UIPA 2I57A 1SW3A 2PDWA 5D8ZA 1OF8A 3ARXA 1F3EA 5HMDA 4DVOA 2YCEA 3ID7A 2F6KA 2VR4A 1ONWA 3LUTA 4J40A 3ZSSA 1GQNA 3AXIA 3ZWTA 3KP0A 1PUDA 3M0ZA 4HZMA 4N9EA 1AW2A 3DYMA 3BLEA 4RX0A 2WCAA 1IF2A 2ZRXA 2GUYA 2EG7A 5I3DA 4IHCA 4V33A 4L56A 1TO3A 4TQTA 2Q71A 4AYGA 1K3UA 1GVSA 1EDQA 3C86A 3GFXA 1PKLA 4XUYA 4QGCA 4NJGA 3ME3A 4J3ZA 4CVWA 2ASHA 3BSGA 4CVUA 4WGHA 3W87A 1MEWA 3GX9A 1WCGA 4H04A 3N18A 3FSUA 3NZQA 1BF6A 3B4UA 2WSRA 5CCZA 3IAQA 2BOFX 1GUVA 4S3DA 2FPVA 1M6JA 5FF7A 3W7OA 2XINA 3E2SA 3LI1A 2QIWA 2FH6A 4NJJA 1FRBA 3NQ6A 3H2EA 1B9ZA 1TR1A 1HX0A 2DZBA 2QUVA 3WUFA 4IJBA 3ZT7A 3FAWA 3VE9A 3G1YA 2DT3A 3VFCA 1S2WA 1CGVA 1ZLPA 2NW0A 4CCDA 2ISWA 4Z08A 1H60A 1PYMA 1W32A 2XFFA 3ITTA 1XS2A 3HN3A 3LPGA 2GLKA 4TR9A 2VX7A 2C14A 2B0MA 3LA4A 1WNOA 3VDBA 2PDMA 3VMOA 3P0WA 1JD9A 3R94A 1CXEA 4UFHA 1JPKA 3UW6A 2EHHA 3VC5A 4JQ3A 2XN1A 3N4AA 1W1YA 2HVOA 4AB4A 1JUKA 3RLUA 1UB3A 1IGSA 4QNWA 1LYXA 2V5CA 1KRCC 5EGRA 1UR2A 3EDEA 1LBMA 3MWCA 4D6DA 2OELA 3IJ6A 1Q63A 3ES7A 3WLSA 2P50A 3O7UA 4IISA 2BDQA 4UOZA 3F4WA 1B57A 4DJEA 3URAA 2W66A 1I2QA 1N82A 1A5KC 2PF8A 3E38A 4NYUA 3RCMA 3PB0A 1SZFA 1GOXA 1Z41A 2ZVRA 1HT6A 3J7HA 1SGJA 4PTVA 1B30A 1KRMA 3QLLA 4JQ2A 1BHGA 1N8WA 3KBSA 3A4WA 1OZQA 4YCOA 3VNZA 1AD1A 4TX6A 2EXOA 5RUBA 1EA0A 1QOXA 1CPUA 3BMXA 3AYVA 4Y7EA 3VKBA 1BVZA 1T0OA 3NQMA 3PZOA 4LUSA 4IQEA 4G1KA 2V63A 5H2ZA 3VIMA 4R9OA 1JAKA 4O11A 1MYRA 4XAPA 2E3ZA 1OC6A 2AOSA 5C7HA 3M6DA 1NEYA 2V6AA 4JKMA 3NQEA 1UD5A 4B92A 4N4PA 3U6WA 4JTCA 1G69A 4ONVA 3V75A 3QOKA 3ZO9A 1R9XA 2BTMA 4JTSA 1Z89A 4H9MA 1OCQA 4HHLA 1UMLA 2XIOA 4LJ3A 4GINA 3TOPA 4MDPA 3EPNA 1JCMP 2IW0A 3RN6A 3MMTA 1MW0A 1NWUA 1G9HA 4QS6A 4XZBA 3GVQA 3BAWA 4LUSB 4DWDA 5LYRA 3RU6A 1IXOA 3R8GA 3K1GA 4XO6A 3CAKA 2RDXA 2NLIA 3SECA 3GAYA 1XH0A 2DQWA 3LGEA 3SB0A 3UXLA 1ZRQA 4OUIA 3KEHA 3HQ1A 1GTHA 2I5GA 5A8OA 1MNSA 1M65A 3QHNA 1AG1O 2J4GA 3A24A 1NFGA 1HGYA 3A9BA 4PB3A 1ONRA 5SWUA 2BP1A 3G6MA 3TMLA 4FLSA 3F4NA 1M03A 3AXMA 1QFEA 2VR5A 1SMAA 1I4NA 3TLQA 1D7KA 2CFFA 4MADA 3OZOA 3KDOA 2GJLA 2QDDA 1VEMA 1GVEA 3M43A 1T8QA 2PTYA 1EOMA 4LXFA 1KBJA 2J78A 5EA9A 3B9OA 1XFBA 4KEZA 4XQ6A 3UWUA 1YNPA 1TSIA 4HN8A 3ITOA 1X96A 4EWJA 3VGGA 4KCUA 2CBVA 2TPSA 1AA1B 1W5QA 4PODA 1ECQA 1QPNA 1SZEA 3G6LA 1DTNA 4LW7A 1JFXA 1S2CA 1LM1A 2EG8A 4GGBA 4ICMA 2CKSA 4LYKA 3VOJA 4K8EA 1DPMA 3RM8A 3TX9A 3W22A 4O28A 4ICCX 1M7PA 4R34A 1XXXA 1H3GA 3HTWA 3LLDA 2WMJA 3FSTA 4L4LA 1VHCA 4Z17A 1VHNA 4CD4A 2RHGA 4IFOA 4ORMA 2HQAA 5CPLA 3M0IA 3WD2A 1BG9A 1TRDA 5BROA 1T6MA 3EGJA 3QHOA 3EDKA 1VCVA 1X1OA 2YDRA 1DIKA 4ZA0A 1XC6A 5CC7A 3PWIA 2ALDA 2IUZA 3WELA 5HDRA 1UR3M 4IX0A 5FESA 3KHJA 3FK4A 1J0KA 3BZGA 4GUIA 1O1HA 4MPQA 3LB0A 1GJPA 2G95A 4QQUA 3T55A 5E6YA 1Q6CA 8XIAA 3W83A 3UESA 2VHLA 5DMMA 3S2NA 4IGHA 1FHLA 3VE7A 2X7VA 4XG1A 3L5LA 1ZJHA 1IR1A 2BY0A 3ARWA 2X40A 1G6CA 2Y61A 4Z1DA 3PC0A 3M41A 4KPLA 2BY3A 3GNRA 2BZNA 2Z6JA 1KTCA 4J28A 5CAHA 1YIXA 3HG4A 1HIZA 2WVSA 1V7YA 3E0LA 3H6OA 4E8CA 3FKKA 3AFBA 3OLDA 3O6YX 4JBRA 1WKEA 2R6OA 1D9EA 1FX6A 3C8FA 1OVDA 1S3HA 3TLLA 5A8GA 4DYJA 1MEHA 4XD6A 2DH3A 4UTTC 4CCZA 3VOFA 4GZIA 3LPPA 3SCVA 2Q8XA 4RJEA 2C3ZA 4DJFD 4ZBCA 1FHVA 4HA1A 5IBXA 4DJDD 4D1IA 1C9WA 3T07A 2QCGA 1EB3A 2C19A 3DGBA 3SW6A 1D3GA 2XG9A 3ZJ6A 4O54A 3HGRA 3EOUA 3WQ8A 2J66A 4B15A 3BOXA 3U2CA 2Q3OA 2JFEX 4P8XA 1ZENA 1YTKA 1JUEA 4JIEA 1SFTA 3NSNA 1LQAA 5EMJA 2X1UA 3LHZA 5IFPA 3T8LA 2E6DA 1XCWA 4MDOA 1EPVA 1VRXA 4PUWA 4O50A 1FY6A 1UUMA 1WKFA 1A5LC 3AJXA 1QI3A 1XF0A 2PLKA 4PZVA 2W62A 3AIEA 2C13A 4IIDA 1GVOA 2YZ5A 4WEVX 5TD4A 3N11A 3VO0A 4H8VA 4KH2A 5AOUA 2YA2A 3REQA 3CNYA 5CC6A 4JDBA 3GYEA 3B0YA 1F4HA 2D69A 5D2XA 3FDGA 1VLWA 4A35A 3SN0A 4XK2A 1E6QM 1M04A 1BD0A 4GO9A 3SCSA 3GE7A 2OQYA 3GH7A 2WOQA 1AL7A 1R47A 2Y2WA 4JGDA 1P1MA 3WNKA 2OG9A 2G3NA 1LP6A 4M19A 1NOUA 4QDMA 3KOWA 3BLLA 4UTLA 2FKPA 3PK7A 5FF2A 3QHMA 3REQB 5F2LA 4CGTA 1XIFA 5I5RA 4MHBA 1R3QA 1HL9A 3A3XA 3RHGA 4IJCA 3K5XA 5HANA 1TR9A 3G3MA 4IG2A 2PZ0A 3RITA 4FK9A 4FHAA 4H6RA 1DJZA 2XIJA 1OIFA 1ZJAA 4P61A 1GONA 1VFTA 2CZDA 4W8AA 1QAPA 1XQKA 2ONEA 5HBFA 3GQYA 3OA5A 1J96A 1UBPC 1US0A 3SR7A 1X6UA 5HR7A 2OLAA 5L9FA 5BXPA 2PTXA 5E09A 4C1KA