4AD3A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-deoxymannojirimycin
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
345
Chain Sequence
TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad3A00
4P7QA 5BCAA 5BXSA 3GNRA 7A3HA 5A6MA 1GUVA 4LXFA 2JIEA 3GZAA 4WSKA 1PIGA 3D5HA 3N18A 3II1A 3KL5A 1I1XA 1WZKA 4ZFMA 2JF7A 3LPGA 2XFYA 3AMCA 4QLLA 2WHLA 2EBNA 4MJ2A 5DT7A 1GZJA 4KWUA 1Q6FA 2WCAA 1V3HA 4JHOA 1GW1A 1DTUA 4P8UA 2PBGA 3K46A 5LA2A 1VJSA 1OCQA 3FHQA 2EQDA 4Q22A 2E8YA 1NARA 4OIFA 1UQYA 4D6HA 3AFBA 1D3CA 2E8ZA 2WSKA 2ZUUA 2YDRA 1R86A 2GDUA 4YPJA 2X0HA 4UQ9A 3VMPA 1CIUA 1VBRA 5I0DA 3F5KA 2DT2A 5CLWA 4L4OA 1JYVA 3HN3A 3W6LA 3CMJA 1ZJAA 3VX0A 4XZBA 4PCTA 5CZKA 2PWHA 3GXDA 3RM8A 1US3A 3IAQA 5A3HA 3TONA 4C7FA 1E70M 3B9DA 1E3ZA 4UFLA 4X0NA 3HJEA 3AS0A 1UWQA 3AIRA 5D8ZA 2W67A 3AISA 1A3HA 1OIMA 3PHAA 1UA3A 1TA3B 1H0IA 4XUYA 4PTWA 1SMAA 4CN1A 4CD4A 3VILA 2Y24A 1E0VA 4JFWA 4PCSA 1ODUA 2BFGA 4PEEA 4CGTA 3WD4A 1CXFA 2GSJA 3WQ5A 3ARRA 2GK1B 4H2CA 1V3LA 2J7EA 5CJ5A 1M03A 1UR2A 3WH7A 2G3IA 3BAKA 4GO9A 3K8LA 4A3YA 2XG9A 1JZ5A 4AZGA 2WLZA 1VFUA 4Z2JA 2VO5A 1XYFA 4PMQA 1DWJM 2EPNA 4D6CA 2NSXA 1WDSA 2VCAA 4LYQA 4NSBA 4UZUA 4E4PA 4TUFA 2XVKA 2VVSA 3DHPA 2CEQA 3A4AA 4UCFA 3VKKA 2J75A 4HA1A 2YLLA 3FHAA 4UNIA 2VQTA 2WVVA 2E9MA 1EQPA 2CBJA 1E6QM 1UKQA 5ABFA 4M82A 2X05A 1B3ZA 4DWSC 4UQCA 2WSPA 2QMJA 3AYRA 1GJWA 1TUXA 4HMEA 1E1FA 2J47A 3IK2A 4AD4A 2YLAA 4ACZA 3UR8A 3I3EA 1R7OA 1N82A 1W9XA 1CLXA 2V38A 1V0NA 2J78A 1VENA 2EPMX 3G6MA 2A3BA 3WL1A 1BFNA 1GQJA 4K68A 1V0LA 4U33A 2XYLA 4HZ8A 5A6JA 4DWSD 1PX4A 4UR9A 4V2XA 1E4IA 1C93A 3T2QA 5A6KA 2XWEA 1KGUA 1ISZA 2CITA 5BRPA 1HIZA 1US2A 1Z32X 4CKQA 1GORA 3ARPA 1E55A 4B16A 2ZXQA 1JF5A 1TMQA 4MPKA 3ZM8A 2DDXA 3BC9A 3WUFA 2A3EA 4W87A 3SUVA 3KZSA 2WMJA 2WPGA 4JL1A 3ZQ9A 5HOSA 2V3GA 4GIAA 2UY4A 1H09A 1J0ZA 1KR1A 2WBGA 1JYWA 3WH6A 5I23A 1J11A 3VX1A 1XCWA 1K9FA 1XSIA 3UG3A 4QCFA 3GBDA 2UY5A 4B15A 3SUWA 4S3JA 1QNSA 4IUGA 3WEMA 1PAMA 4PUDA 2WMFA 1ISWA 4XX6A 5I5RA 3JUGA 3WDRA 3CZJA 3TTQA 4YHGA 5IHRA 3VGHA 3CZKA 1NWUA 4MDPA 1J0IA 2WMGA 2W66A 2WKGA 2NW0A 3OG2A 3WSUA 1V6XA 3N9KA 2Q8XA 5ABFB 2E40A 3MSDA 1E5JA 5M03A 1WDRA 2XTKA 1XRVA 2VR4A 4TX6A 2D23A 1W91A 1Q4NX 2XWDA 4GPNA 2VX6A 2D0FA 1GCYA 3GNOA 3GNPA 2OSYA 1LJYA 3CHDA 5M5DA 3B9AA 5CSUA 2XM1A 3T0BA 4ACZB 1RH9A 4AD1A 4YN5A 2CYGA 4OOZA 4W7WA 2WYSA 5EMYA 1JDCA 1HKJA 5E70A 1PJ9A 2WMKA 3WNOA 5D9OA 1FH9A 1W1VA 2VX5A 5CQ1A 1W9BM 1E6SM 3RILA 4D6DA 2CBVA 4JCMA 2J7BA 2J7CA 1KXHA 3N04A 4HOWA 4UOZA 1WZAA 1E1EA 4CD7A 3VMNA 1PPIA 1W2VA 2YL8A 2BHYA 1V6UA 1VEPA 1E4LA 1UWIA 4GO8A 3O2LA 5AC5A 3T0DA 1E6ZA 3ZO9A 4CN4A 3ARSA 4NRSA 2CERA 2VUYA 1MQRA 2VZOA 5I77A 1MW2A 5M3WA 1QW8A 3CZGA 3CUJA 2YKKA 3GTNA 4UTFA 3AICA 2X1IA 2CCRA 1VAHA 4CCCA 5A8NA 4H8HA 1V6WA 4X0VA 3VD9A 3ZR6A 3AHXA 4MNJA 4TVCA 2EXOA 3KWXA 3WNNA 2DSUA 4PN2A 1XCXA 3W82A 3BCFA 1CLVA 3L4VA 4M24A 1C7TA 5D9MA 2Z1KA 1FH7A 1I1WA 1R8LA 3A6OA 1UD5A 2EPOA 3LPPA 4IPNB 3WD1A 1JD9A 4JFTA 2VX4A 4AZ7A 2PWDA 2YL5A 1ZL1A 1HJWA 2E9BA 1HJVA 1J12A 1CXEA 4AZ5A 1QOXA 1HJXA 1L8NA 1U33A 4W5ZA 1EHAA 1UWSA 3ARXA 1JI2A 1Y7VA 4P7NA 1JFHA 1MFUA 3I3DA 4JFSA 2DGAA 2ZX7A 3THDA 4TX8A 5I79A 3DYOA 1J10A 3WMCA 3GM8A 1OGBA 1W1PA 4WLCA 4JKMA 3CPUA 2IUZA 2OYMA 1CXHA 1ITXA 2CXGA 1A47A 3SUTA 3WMBA 2D24A 3FY1A 5E9AA 4J28A 5A2BA 2VCBA 3U57A 3ZSTA 5FL0A 3T0AA 4MB3A 2BV9A 3SCTA 3VIHA 3A4WA 3GH7A 5I2UA 3SCUA 1F4HA 3ARWA 3EBVA 4JKLA 1AQ0A 3BSHA 4AIOA 3TP4A 5C8BB 1KB3A 5ABHA 6A3HA 2CHNA 4L4PA 4J3WA 2GFTA 4N42A 2VMFA 1TG7A 1NQ6A 1LLOA 2YDQA 3MS8A 4AZHA 1CECA 3OA5A 2CBIA 1UWUA 1NH6A 4F9JA 1BYAA 4TXEA 3QGVA 5EB8A 4NF7A 2IXUA 3APGA 1UZ1A 2WM0A 4ACYA 1GHSA 1GONA 5A6LA 3BXWA 4U5KA 1JYNA 2ZIDA 3K8MA 3ARUA 3WDQA 2DH3A 2G3MA 2CBUA 3A47A 3TOPA 4PTXA 1BG4A 4RL3A 3RDKA 3EMQA 3DC0A 3AZTA 4ZXLA 4ZEPA 1JFXA 3ZMRA 3ARQA 3L4UA 1FOBA 3I3BA 5DT5A 4EE9A 1J0HA 4W8BA 1CBGA 2JEQA 1W1TA 1BVZA 2WXDM 3BLPX 5AYIA 3LPOA 4J3UA 2CKRA 2JALA 4Z2HA 1WNOA 4FLRA 3PZ9A 3PZMA 1JGIA 2BY0A 4XB3A 3CZ8A 4PMVA 2FHBA 1CPUA 3ZIZA 1VJZA 4R5EA 5I6SA 4W8LA 3VO0A 1NP0A 2J7DA 3MV11 2QF8A 1R7AA 4AISA 5AC4A 5IFPA 2FGZA 1LQ0A 3GH4A 2FHFA 1NWTA 3PZQA 1M04A 1GOOA 2VZTA 3L4XA 1ZB5A 1HL9A 2EEXA 2X8RA 2O9RA 2YJQA 1NOUA 3O9NA 3TTYA 2ZX9A 3BMVA 4LYRA 3OGRA 1UG6A 1J0KA 1ODZA 1FHDA 3F4VA 4JFVA 1WPCA 1CXKA 5A6SA 4D6FA 2G4FA 4AYSA 1XGZA 5AY7A 1QNQA 4J3VA 3VIJA 4GKLA 2CETA 5ABEA 3S6TA 4AW7A 4DM2A 4MAZA 1DWFM 2WB5A 4UQAA 4CU7A 1ZBKA 2AAAA 4UOJA 5C71A 2GJXA 4PUEA 1VIWA 1BYDA 3K8KA 1HP4A 1FH8A 4N0RA 5GQBA 4M8UA 1UH2A 5CGTA 1UWTA 1H49A 2JIWA 1ZJBA 3SIMA 1TR1A 8CGTA 1TE1A 2QV4A 1K6AA 1VEOA 4HTYA 5CPSA 5IDIA 3AMGA 1VFOA 4TOQA 1HNYA 3WNKA 4F8XA 1DP0A 5HXMA 4B9YA 4PMYA 1WE5A 2XHYA 4ZXOA 3W37A 2V3DA 4GINA 3M46A 3VGDA 1JYXA 1BHGA 4TVUA 5JIPA 3EDJA 1UH3A 2X0YA 1XD1A 3G6LA 1QW9A 1AVAA 3ZJ6A 1E9LA 3L2LA 4XV0A 2YA0A 3NYDA 2BVDA 1BLIA 1UQZA 4OJYA 5HDRA 3WENA 1BGGA 4JFUA 3SUUA 1UR9A 2G8ZA 3AOFA 1JXJA 1BAGA 5M17A 4D72A 7CGTA 4MJ4A 3OZOA 5IXEA 3E1F1 4AIUA 1SMDA 3WMSA 2VNCA 2FH8A 4PYSA 3MV01 3CH9A 4HOZA 1C8XA 1IT0A 2OLHA 2YL6A 3OGVA 3W26A 4P8VA 5DMYA 4B3LA 1UD3A 1EO5A 3KE0A 2WHMA 2EPKX 3AROA 5BXRA 2J62A 3N15A 4V27A 1OGSA 1XV8A 3GXFA 5GNXA 1CGUA 3NUKA 5FD0A 2ZXBA 2D2OA 2FDMA 5FIPA 3SCPA 4AY1A 5EFDA 1CGYA 1OIFA 2EO7A 3ECQA 3U7BA 4W93A 1WKYA 3W81A 4AEEA 3WDPP 1QVBA 1KGWA 4HZ6A 2ZUSA 4WSJA 4DWSB 3CTTA 4FK9A 2BHUA 3WELA 1E0WA 1QI3A 3BGAA 5HNNA 1B31A 4WKAA 1JZ4A 4HU8A 1MQPA 4TVDA 1MWOA 4OBSA 1BSIA 4QCEA 4D6EA 1Q6DA 3CO4A 4U2ZA 1UD6A 4MNMA 1D7FA 1EOMA 2GJXB 2BXYA 3N11A 3MUIA 1X6LA 1GQKA 3CUFA 2OWCA 2DT1A 5CPQA 3RM4A 1JG9A 2YA2A 4WKFA 1CGWA 2ZUWA 1V02A 3M6DA 4LPCA 2WHJA 2Y8VA 2JFEX 1C90A 1U2YA 4CUCA 2WKLA 2BHZA 2CPUA 4MB1A 3WD3A 1GOWA 1KWGA 4FF5A 3FW6A 2OWXA 5A6BD 1ZU8A 3GH5A 2CKSA 3RIKA 3SCVA 4CU6A 4LYPA 2O9PA 4E2OA 1UWRA 1QI2A 2FGLA 3CIVA 3N1AA 3OLEA 3OLIA 1LL7A 2VQUA 3MUAA 1EDQA 1EOKA 3KEHA 4J7RA 3WQWA 3VD4A 1W1YA 3FN9A 1GOMA 1ISVA 4AZCB 4U31A 4U5IA 1V6VA 1TFVA 1HL8A 2JEPA 4WK9A 1UA7A 3DYPA 3OLGA 1RD6A 3HU7A 4W88A 5E0CA 4PMDA 1KBKA 5FOOA 4P8WA 1K9EA 3GDBA 2BS9A 1GVYA 1BGAA 3VIOA 1EGZA 1MFVA 4DM1A 5C70A 1ITCA 1KQZA 1LWJA 2ZX6A 1MVYA 4D6GA 3AHTA 1O7AA 1KXQA 3EYPA 1V02E 5FCZA 2W4XA 4GZJA 3VDBA 1ZS2A 1ZBVA 1VFFA 3ZT5A 3WH5A 1V6YA 1KQYA 3AQUA 2ZUVA 4J27A 4YHEA 4D1IA 1KFWA 1E56A 1Q6GA 3ZR5A 5A8MA 1H3GA 4AC1X 1JF6A 1I75A 1KXVA 2RGMA 3WUEA 3BAIA 1PBGA 4EANA 3RO8A 2XPKA 3EDKA 2J74A 3PTQA 8A3HA 1XSKA 2VI0A 4U3AA 3SCNA 1UD4A 3ARVA 3VIKA 1JZ8A 1B3XA 1ZBCA 2D0GA 5DO8A 1IZKA 2ZXAA 4E8DA 3W53A 4Z2IA 5JBDA 1EO7A 4Z2LA 2W5FA 5CSYA 1MXDA 4W5UA 1UUQA 1SYTA 2EPLX 2OWWA 1UKTA 4OBRA 3LMYA 1UKSA 3RPMA 1FA2A 2J8GA 1SFSA 4AD3A 3AS2A 5A95A 4QLJA 1DWHM 2YIHA 1OT1A 3ARZA 3FAXA 5CGMA 1KXTA 1CXIA 1TCMA 1NP2A 1HJSA 4U3CA 1V3MA 1GQLA 1HKMA 4WJXA 4Z2KA 1FP8A 1UR1A 1WDQA 1B1YA 3WEOA 3PZNA 5D9NA 2DSVA 1HJQA 2AMGA 1QI5A 3AIBA 4Q7NA 2Y2WA 1ESWA 1C92A 1K9TA 2F61A 1PX3A 2GDVA 3QHNA 4UFIA 2PWFA 2E0PA 4PSPA 3GBEA 3WQ6A 3WUGA 4F9DA 1UZ4A 2J25A 3RJXA 2O9OA 5DEZA 2DH2A 4URIA 1F4AA 2HISA 1QI4A 5A94A 2XJ7A 4CD6A 1M7XA 3W4RA 2XIIA 2VJXA 1H5VA 2PC8A 3VU2A 3AXHA 3WF4A 5HBFA 1XH0A 1NOFA 1JD7A 2X2YA 3MSGA 3VIMA 3TA9A 4EK7A 4GQQA 3W25A 3AMDA 2ZWZA 1AQMA 4GZIA 4GQRA 2OYKA 5HPCA 2XGIA 2J7HA 5GPRA 3UR7A 1V3KA 3VIPA 4GI6A 3W38A 4MDOA 4Y7EA 2ZE0A 1C91A 4QDMA 5EBAA 2IXVA 3MMWA 1HVXA 1UOKA 2XSBA 2V3FA 2ZUNA 4CVWA 1E15A 3MKKA 2W61A 2DSKA 1OGGA 2ZX5A 3POCA 3WNPA 4ZE4A 3AZSA 3WY1A 1C8QA 2WWDA 4MB5A 4BZYA 5DF0A 2W91A 1VFMA 3SUSA 2ZOXA 3N13A 4ZENA 5BRQA 3UERA 1W9DM 3W27A 2Y8KA 4MB4A 2E4TA 1KCLA 4JL2A 1H41A 3OBAA 1XHGA 3W28A 3CHFA 1W9PA 1OINA 2EJ1A 4UOQA 4HA3A 2PI6A 2CESA 4IM4A 1HXJA 1E71M 2WC3A 2XFFA 2Y5EA 5E0FA 5KZ6A 1V0KA 3WDIA 2J79A 4J3TA 4KRUA 3VGEA 2J7GA 3WH9A 2ZUTA 3W0KA 3KL0A 5I3DA 3NDYA 5CLTA 2XGBA 1P6WA 2F2HA 3AHYA 1WDPA 4TTUA 3NSMA 4M1RA 5CG0A 3S2CA 4D6JA 1B2YA 5JBFA 3W29A 1PZ3A 3AZRA 3BMWA 3PTMA 3RJYA 1HVQA 1W3LA 4A4AA 4RE4A 4UFMA 5GNYA 1UYQA 2WVSA 4JAWA 2WCGA 4NRRA 1NWSA 3T09A 1OD0A 1UR0A 2GVYA 1J0YA 2TAAA 5A8OA 3CHCA 1H4PA 4B3KA 1YHTA 5ABGA 4CU8A 4HPHA 1QBAA 1NOWA 1BYBA 2VR5A 1KGXA 2XFRA 3AI0A 1FFQA 1E6RA 1UR8A 3L4ZA 3VDCA 3WQ4A 4A3HA 1FP9A 3AXIA 1XSJA 2NT0A 3CUGA 1OB0A 5E6YA 3WF0A 1GNXA 3VINA 5JUVA 3VDAA 4P7LA 2G3JA 1B30A 1VBUA 4BA0A 3UESA 4BQ5A 2FH6A 1DEDA 1MW0A 3UEQA 2WBKA 2VURA 2VVNA 3QOKA 3CZEA 1G0CA 4V28A 3MUZ1 4E8CA 5I78A 2ZX8A 3N17A 4OZOA 1G94A 2DT3A 2WAGA 4PRWA 1GOQA 1E73M 2A3CA 5FKYA 4W7UA 3SCSA 2ESCA 4BF7A 4KGJA 1J0JA 3NDZA 3AYSA 4BS0A 5TD4A 2VC9A 2D1ZA 4DWSA 5BROA 2VRKA 4BQ3A 5D9PA 1B3VA 1EH9A 1LL6A 3RM9A 3T2PA 2DSWA 4AZ6A 5FL1A 4UZSA 3BCDA 3CGTA 3CHEA 1LL4A 4WF7A 2WZHA 3VIGA 1PZ2A 1DHKA 1V3JA 1W2PA 3VGGA 1CDGA 1RPKA 3VVGA 5JBEA 3POHA 3UCQA 4PMRA 4UFKA 3NJ3A 3VD3A 3VNZA 3U5UA 2BVTA 3WFZA 1RP8A 1HN1A 4C7DA 1GVIA 2W92A 2PBOA 4H04A 2JF6A 3BAXA 1C3FA 3NCOA 2VCCA 1X6NA 3VIFA 4CN6A 4H41A 4JIEA 1G9HA 3PZOA 3WNLA 2WMIB 4D71A 2VZVA 3A3HA 4FMVA 1W3JA 2MANA 4CD8A 5DFAA 1JXKA 4GI8A 3CUIA 3U7VA 2WZEA 3AMLA 3AMKA 3MU7A 2GJRA 3ARTA 3VM7A 1GJUA 1WZLA 3FXYA 2UY2A 1JZ2A 5A6AA 3GXMA 1JDDA 2J4GA 1QHPA 4AZCA 1PIFA 3VGFA 3IJ8A 4P7RA 1UKPA 3IJ9A 2DT0A 4PMUA 2A3AA 4UQDA 4X9YA 3BLKA 4RE2A 2VTFA 1MQQA 2D20A 1UD8A 3MUY1 1ECEA 2GJPA 4W85A 3VMOA 3KL3A 1AMYA 4HMDA 2DPEA 1QNPA 2WCSA 3OB8A 1E4NA 1J9YA 4J3XA 4HOXA 1W3HA 4ML4A 2QPUA 2DIJA 3DHUA 3WF3A 4FLOA 1MYRA 3WL0A 5LA0A 4AWEA 1HP5A 5D4YA 4JCLA 3GXIA 5D8WA 1D2KA 1CWYA 4Z2GA 4H8UA 4MTVA 2CIPA 1FHLA 1VEMA 2WANA 4ATWA 3UETA 1H0GA 4DUWA 1JZ7A 3AIQA 3AHVA 1B9ZA 2QHAA 1CTNA 2D0HA 2DQXA 4EAMA 1E6NA 2WLYA 2YBUA 2FHCA 1E43A 4AXNA 1PEZA 4BCEA 1ISXA 3LPFA 5F7UA 1QPKA 4DUXA 3BH4A 3PZUA 4HU0A 1JI1A 3WN6A 1Q6EA 3SURA 4M56A 1M01A 4HZ7A 4FLSA 1E5NA 1BYCA 6CGTA 3QR3A 2A3HA 3WH8A 2C8NA 5BWFA 2XVPA 3AIVA 4XZWA 2DEPA 1B3YA 3MMUA 4KRTA 4P8XA 2VL4A 2Z1SA 3PN8A 1W3KA 2WW5A 3OLDA 1MW1A 2V5CA 2OYLA 5GNZA 4MAVA 3WDJA 1CZ1A 3J7HA 4H8VA 3BAJA 3WQVA 1JDAA 2W62A 2O9TA 1VF8A 2WC7A 1WAWA 2JE8A 4M81A 1EA9C 4HP5A 1JNDA 4CD5A 1TVNA 3AHZA 4TTGA 1EIBA 1VB9A 4GI9A 1BG9A 2YOCA 3VOCA 1RP9A 2WNWA 3O6AA 1CNVA 1K9DA 3SCOA 2V5DA 1UHVA 2WK2A 5HPOA 2GUYA 4M80A 4B9ZA 3VD7A 2O92A 1V08A 1OD8A 3CBWA 3L4TA 1LF1A 1C7SA 4H7VA 1HF6A 2RGLA 1LG1A 2XIBA 3U5YA 4BQ4A 3UG5A 5EFFA 4W89A 3ZJKA 3AS1A 2G41A 4PMNA 9CGTA 1KCKA 3BAWA 1JIBA 2YA1A 4W8AA 5CXPA 4J3SA 1E72M 3K4DA 1KR0A 3ZSSA 4W84A 1DWGM 4PMZA 3PZGA 6TAAA 1E6XM 4UQBA 3OZPA 3VIIA 2W63A 1YQ2A 1MW3A 1V3IA 1OM0A 4NZCA 4GZEA 1QHOA 1Q6CA 4HA4A 1QI0A 2F8QA 3WBEA 4UFJA 4HPGA 4KH2A 1CXLA 3IAPA 3AXXA 5BXPA 4BQ2A 1BTCA 1J01A 3RMEA 4JHZA 4LGXA 4MADA 4WIWA 2WMHA 3MO4A 1NM9A 4M29A 2BY3A 2WVUA 1E4MM 5A8QA 1JAKA 4AZIA 3W6MA 1OT2A 1E3XA 1B3WA 1EHNA 1JL8A 3GYCA 3MMDA 3AS3A 1H2JA 2E3ZA 4CVUA 5IFTA 1W9VA 2QPSA 2BY1A 1GHRA 3D3AA 4JKKA 3A4XA 1OWQA 5LA1A 2Y4SA 1CGTA 2YL9A 2WVVB 2YDSA 3WQ8A 3NSXA 4OOUA 3PTKA 2DSZA 4IPLA 2V3EA 5ECUA 3WF1A 3WD2A 3WF2A 5A1AA 2VRQA 4AMCA 4HMCA 4PBGA 3B9EA 3FAWA 3F5JA 4F79A 3AIUA 2VZSA 2G3NA 5LYRA 3QHOA 4U2YA 2QLYA 1NWRA 1HT6A 1JNEA 3EMZA 3M7SA 3WIJA 4CCDA 2D3LA 3CMGA 4MNLA 1HX0A 4RE3A 2D3NA 1G01A 1UKOA 3AIWA 3ZT7A 1XC6A 2J8FA 3AJ7A 1KBBA 2WVTA 1M53A 4UFHA 3BSGA 1HKIA 1CGVA 3OGSA 4NI3A 4PTMA 1BPLB 3AIEA 5A2AA 7TAAA 1XYZA 3PZTA 3ZT6A 2CNCA 1WZMA 4QP0A 5A69A 4JZ5A 1R85A 2C0HA 4KGLA 1UD2A 1JZ6A 1L0PA 1KWKA 5KEZA 1ZBWA 1XH2A 2AOSA 4FLQA 2WZIA 2XVLA 3T08A 3EDDA 4W86A 2X09A 4D1JA 1EQCA 1FFRA 4UQEA 1H1NA 3SCQA 4F66A 3CUHA 4GXPA 1R87A 3B8SA 3OIHA 2ZICA 4AD5A 1QNOA 4PSRA 1V0MA 4MNKA 2WWCA 3WNMA 4OKDA 2YBTA 4P7OA 1GPFA 2OSXA 1WO2A 1OBAA 5AYBA 5A2CA 4AIEA 2D22A 5IHSA 2VZUA 2ZWYA 4R27A 1TVPA 3IANA 3SEPA 1IV8A 1OSEA 4ATDA 2WHKA 1B90A 1BQCA 3K1DA 1CENA 2B31A 1LG2A 3QHMA 1W32A 1X1NA 1HKKA 3VGBA 3L4YA 3WBAA 1CEOA 1GQIA 3FNDA 2ZUMA 1VRXA 2NT1A 4AZBA 4OUEA 3CZLA 3QOMA 1LWHA 3WUBA 5CPTA 3THCA 3WFLA 1PX8A 3BAYA 1EXPA 3CLWA 3WKZA 1AQHA 1BF2A 2XM2A 3SCRA 1E6PA 1IZJA 2PF0A 1CGXA 2XSAA 3MANA 3WEZA 1XD0A 2ZXDA 3EMCA 4ATLA 4C7GA 5E6ZA 3HMCA 3PBGA 3VUPA 3ALGA 1DWIM 2PB1A 3L4WA 1GOIA 2WC4A 4CCEA 5BXTA 2CHOA 2WMIA 3NSNA 1XH1A 1GOKA 1O6IA 2VRJA 2UWFA 2PWGA 1QHZA 1W9UA 2BNJA 4QAWA 4QFUA 3PZIA 1BVNP 4AD2A 1B0IA 4PMXA 3ALFA 5A8PA 1E0XA 1SR0A 4D6IA 2BXZA 2J7FA 2C7FA 4IISA 1U30A 4DUVA 4EKJA 3RCNA 1WB0A 3L2MA 3ZOAA 2XUCA 2VX7A 5JIWA 1MXGA 3IJ7A 4ZE5A 3WDHA 1V03A 4WKHA 1G5AA 3UG4A 3EDEA 1TA3A 1DWAM 3K4AA 2PWEA 1TZ7A 3WD0A 3W24A 4QLKA 1J18A 4KMQA 1G1YA 2E9LA 1HJUA 2XVGA 4W7VA 2J77A 4LQ1A 2OSWA 2VOTA 2BVYA 3VDHA 2VT0A 1CYGA 1E40A 4AD0A 5E09A 2GK1A 3ZJ7A 5I24A 3N12A 1C8YA 1UR4A 3T2OA 1QBBA 2UY3A 4LX4A 3VNYA 3VD5A 1H11A 3PZVA 5BYWA 1UH4A 2DIEA 3TTOA 3EDFA 3NIYA 3SCWA 3DYMA 2XVNA 1ISYA 1WP6A 2HVMA 3DECA 1JZ3A 3VPLA 1EDTA 1JAEA 5A6BA 3TTSA 1S46A 4PMOA 4AEFA 4S3KA 3VM5A 1QNRA 4PTVA 3F5LA 2BY2A 1EDGA 3ZJ8A 2QMKA 3VTRA 1WCGA 3ARYA 3M07A
chains in the Genus database with same CATH superfamily
3RNDA 1CX9A 3E2VA 3GDTA 2HS6A 5GJPA 1KA9F 7A3HA 3GZAA 4HA0A 3H7VA 4WSKA 3S6DA 4I3GA 3D5HA 3N18A 2XFYA 3CT7A 5AYXA 3NL5A 3GG0A 2HCVA 3R0DA 5DT7A 3CAWA 4ENLA 1ZSXA 1BSLA 1GW1A 4U28A 2I9EA 4P8UA 1ZALA 4CQ9A 2ZZ6A 2PBGA 3GVVA 5FF3A 3MHUA 3GWQA 2PP0A 4BJHA 2QDGA 3FHQA 4Q22A 3HMJG 1NARA 4G8TA 5IBXA 3QW3A 3CO8A 4D6HA 1D3CA 2E8ZA 1TRDA 2ZUUA 4Q4PA 1KFEA 2YDRA 1R86A 1CIUA 4Q33A 4L4OA 3T55A 3IGUA 4LUSA 4LSBA 1ZJAA 3VX0A 1XIJA 5CZKA 1ALDA 4Y90A 5BMWA 4C7FA 3AS0A 3AIRA 3CQ0A 1FWDC 1OIMA 4KPLA 2GUUA 3KFTA 1QRQA 3CK5A 3LI0A 2IS7A 2PDYA 4LAUA 3KZPA 3EWUA 4IGHA 4M0XA 2YGYA 3VILA 1RJRA 4YTQA 1E0VA 1ODUA 4LRTA 2BFGA 3MJYA 1CXFA 4TMCA 1V3LA 2ZDRA 4EXQA 1KFKA 6ENLA 3FLUA 4JQ3A 3LRLA 4NUWA 3WH7A 3FVMA 3BAKA 3K8LA 2XG9A 3AXMA 1R47A 1WDDA 5TIMA 1TQXA 1DWJM 3L68A 2EPNA 1T6MA 2NSXA 4YWSA 4XVEA 3INPA 3V0SA 3I6TA 1XP3A 1EX5A 4UCFA 2SFPA 4QBXA 5CZSA 1GVSA 4ZO7A 1L9WA 3TC3A 2Y8UA 2E9MA 2OQYA 4KCTA 2TMDA 2XFWA 4NAEB 3UWEA 4GJJA 3WLIA 1E6QM 1QWKA 1UKQA 4O4WA 2X05A 4DHGA 3I10A 1YYAA 1TJPA 4FOUA 1VS1A 3CQIA 2GGIA 3M0KA 4Q4SA 2V5JA 4AD4A 2QPXA 3NEVA 1VBJA 1N82A 1CLXA 2J78A 1Z89A 1VYPX 5FF2A 1BFNA 5I7GA 4HCLA 1V0LA 1U5JA 4YTTA 2XYLA 3CWHA 4A8IA 1UP0A 1FWFC 2Q8ZA 3OVGA 1JRBA 3P93A 2P0IA 3DX5A 5K3VA 3EX6A 3IVTA 3ZVHA 3JS3A 1ISZA 2CITA 1ME9A 3L66A 3QMSA 5BRPA 2QXWA 3NOEA 1KKRA 1KTBA 3GXPA 3S1XA 1US2A 1FCBA 3DH7A 1Z32X 5CPNA 3UNDA 4WUIA 5CGQA 3BOFA 1E55A 3QPZA 4B16A 3HURA 2ZXQA 1KFBA 2OZ3A 3PJUA 4GVFA 4Q8OA 2DDXA 1NF7A 3BC9A 2A3EA 3P5ZA 3LEPA 2WMJA 3NZQA 2TODA 3ZQ9A 3HG4A 4QX4A 4YYCA 5CC3A 4Q4KA 1WOAA 1NDWA 3WH6A 5I23A 2YZ5A 3UG3A 2BGNE 4XZ9A 2G0WA 1IEQA 3LX9A 4B15A 5IOBA 2GLKA 1NDZA 3AWOA 4HQVA 2YW3A 3VK5A 1ZQ5A 4PUDA 2WMFA 1XYCA 5I5RA 3JUGA 1VKFA 1Q7QA 4YHGA 2KZHA 1XFCA 2NX3A 1GGOA 4NI8A 2X30A 4NX5A 3PK7A 3K5XA 3VGHA 4O18A 3BOXA 1NWUA 4MDPA 5CPMA 1Q4WA 3DFYA 1U83A 2Y1HA 3MCMA 2AQWA 2Q8XA 5ABFB 1WDRA 3H2FA 4GBUA 3W87A 1EXBA 5DXXA 3NQFA 4UIOA 4E0CA 4HK5A 1RCQA 4QROA 3A3XA 4XSLA 4XTIA 2OSYA 4JD4A 5CSUA 2ZRUA 1DE5A 3T0BA 1RH9A 4WCJA 4LV9A 4YN5A 2RDUA 1VYSX 1QASA 5HNTA 5HK4A 2IKGA 1K7XA 3DAQA 1NEYA 2WMKA 1K7FA 1XR2A 4XAZA 3W73A 4RUBA 4V33A 3DKLA 3E0FA 5CQ1A 4NAFA 4W9TA 4JNMA 4JCMA 2J7CA 1KXHA 4KWVA 3HG3A 4GVHA 4HOWA 7ENLA 4M7SA 4XSMA 2BWGA 3BW4A 2E25A 5I3HA 3F4WA 4NXSA 4O0QA 2GOUA 2YL8A 2BHYA 1BVWA 3PPFA 4XBKA 4DYJA 5AB3A 3QF0A 4ICMA 3RO6A 1H50A 1UWIA 4GO8A 4FHAA 3T0DA 1IEXA 4K2SA 5AHFA 3F7JA 3SM0A 3MHGA 1S2WA 1S2UA 5M3WA 2YKKA 3GTNA 3QRHA 3E2QA 1EC9A 4CCCA 5A8NA 1ZHAA 1VJIA 4X0VA 2ZE3A 3TXVA 3FXGA 3TU9A 4HNTA 4LF1A 3WNNA 3BQ6A 4LVGA 1O5KA 3MI2A 4JHMA 1XCXA 4ZB5A 3ZXWA 2GVGA 2ZC8A 1FH7A 4FZIA 3TCSA 3A6OA 5J8LA 1UD5A 1H61A 4MUZA 3WK2A 1XW8A 3PULA 3LPPA 1LBLA 2VX4A 3CH0A 4S2BA 3GW3A 3FK4A 4AZ7A 2PWDA 1O94A 2YL5A 1ZL1A 2E9BA 3BZJA 3OG3A 3W7MA 2IPWA 3HB9A 4C6CA 1U33A 1PDZA 1PCKA 1OFPA 2Z1VA 4WDWA 2DZBA 3I3DA 1LZOA 4JFSA 3THDA 5I79A 3W7JA 4B3ZA 4DF2A 4UTWC 1J10A 4WXZA 4MIMA 4BWLC 1GVEA 4IP4A 2IUZA 1CXHA 2CXGA 5DCDA 1QOPA 1XICA 3KVKA 4J28A 4R53A 2VCBA 1TTPA 3W7NA 1JPKA 2BV9A 3SCTA 1FXQA 1IIHA 3MTWA 1F4HA 1XC4A 5C8BB 4L4PA 1OF8A 1SSDA 3V5CA 2IQTA 3MQTA 2H3DA 3KBJA 5T8GA 3CV7A 2WJFA 4AH7A 1NH6A 4KIRA 2VYOA 2QUTA 3R2GA 4TXEA 1QFEA 1S2TA 4TX9A 3R10A 3GC4A 3PBMA 4RNFA 5I09A 5A6LA 3G1VA 4AXKA 2QJNA 2ZVIA 1IR2A 2ZIDA 3K8MA 3QLDA 3WDQA 5G4EA 2CBUA 3A47A 3KBVA 1BG4A 3DBNA 1S2AA 1U22A 4QS5A 3UZ5A 3CT2A 4LFYA 1KV5A 2J9XA 3UVAA 4AB4A 2JEQA 3LU2A 3LSBA 2JKEA 3ITTA 1BVZA 1TV3A 3LPOA 2JALA 4ZQOA 1MUMA 3PVFA 4Q4MA 1WNOA 4FLRA 6ALDA 4DPPA 3TROA 2BY0A 3NM3A 4XB3A 1YXCA 3M1ZA 4M6PA 3QYSA 3W3OA 1VJZA 2JBMA 5I6SA 4DZHA 2J7DA 3W1TA 2QF8A 3BLOA 5AC4A 5IFPA 1RK5A 2QULA 2FGZA 3VKBA 3B8UA 1LQ0A 3GH4A 3RLUA 3EWYA 3TYCA 3AU2A 3W2NA 3PWGA 3MWCA 1K6WA 1M04A 2VZTA 1XKYA 3A9IA 2J13A 4K7VA 3P6LA 2YJQA 2DZUA 2P3EA 4GGBA 1UG6A 2FYMA 4NQ1A 1S1RA 1WPCA 2B7QA 3FEQA 5TQLA 4C6DA 1WKFA 4HNNA 2FIQA 4YVVA 1XGZA 1E1CB 5AY7A 1QNQA 4CNOA 4JOMA 1DWFM 2WB5A 1JDFA 3UG8A 4DBEA 1XBVA 3PBYA 3HF3A 3PANA 1W5OA 1VIWA 2Y5JA 4LWWA 4YWIA 4N0RA 2CLMA 1EEXA 5CGTA 1UWTA 3OJGA 1Q5MA 4DY1A 5G2IA 3SJ3A 3S5NA 1ZJBA 3SIMA 2Y7EA 5AVNA 8CGTA 5EGRA 1FHVA 1VEOA 3KOFA 4HTYA 3H4XA 4S3DA 5F4SA 1VFOA 3K1GA 4PMYA 2XHYA 4S3BA 4ZXOA 3W37A 3M46A 4H7ZA 4LEFA 3VGDA 3REQB 1XD1A 3G6LA 4KW2A 3L5MA 1LCOA 4IWWA 1ZP3A 4XV0A 4HPNA 4YS1A 1HTIA 4CEUC 5HDRA 5FAJA 1PZ0A 2QCMA 3WENA 3SUUA 3P74A 2G8ZA 1DYSA 5M17A 7CGTA 3V0TA 4WDTA 4MJ4A 3S42A 3DDMA 3WMSA 3SN0A 4PYSA 2YL6A 2OLHA 3OGVA 2E6AA 2P8CA 1C9DA 3KE0A 2WHMA 2Y89A 3HPXA 2QJJA 2ZDSA 1UUOA 3S2MA 1OGSA 3DFPA 3GXFA 3NUKA 2DJXA 2PP1A 3TQ0A 2D2OA 3QSTA 2FDMA 5FIPA 4AY1A 3PBVA 2C79A 2ANUA 5CZ0A 1W8SA 3O8AA 3LHYA 4W93A 3W81A 1HW6A 3L21A 3G1RA 1YXDA 2RDWA 3KS6A 3SGGA 2ZCGA 1A5OC 3L9CA 4DWSB 4Q8PA 2VC7A 4MFEA 1QI3A 5HNNA 4H1ZA 1JZ4A 4HU8A 3W7HA 1MQPA 4TVDA 3LHZA 1IXQA 4EPKA 4QGCA 1O68A 1UROA 1UD6A 5BU6A 4KQNA 5FF7A 4UTHA 4N6FA 2GJXB 3W7OA 3LM3A 4RE0A 1B5TA 3MUIA 2OEJA 1X6LA 4WZHA 1XJBA 2JKAA 3RM4A 1TVLA 2YA2A 1YNQA 1SFLA 1CGWA 1FWBC 4WKFA 2PDUA 2JFEX 3CQJA 3APYA 3M43A 3N34A 4MB1A 1YE6A 3AALA 3H53A 1AZ2A 4FF5A 2Z25A 5A6BD 3SCVA 1PVNA 1UWRA 3CIVA 3M0MA 5H8UA 3OLIA 4DPQA 1EDQA 4MWAE 3HM7A 3WYZA 1KRAC 4AY7A 3O06A 4OWGA 1I9CB 1YPFA 2CLHA 2JEPA 4PBEA 1RD6A 4AWUA 5E0CA 4OUIA 5FOOA 4P8WA 3C4UA 1K9EA 1IXNA 2L5HA 1K4GA 3ITYA 1ITCA 1LWJA 2QVNA 1ZTVA 4O52A 4D6GA 4HNOA 2E5BA 3ZLHA 4UR8A 2HVOA 1UBSA 4H6RA 2DIKA 1VFFA 1FWIC 2NX1A 3WH5A 1KQYA 3NZPA 5FJRA 4D1IA 1FXPA 1EPVA 1SZEA 3MP5A 4DXKA 3ZR5A 1E9ZB 5A8MA 4K1GA 4H83A 3NQ8A 4ZO8A 2P3ZA 2EG6A 4QQ3A 1JF6A 2CLLA 2RGMA 1SSGA 2YZRA 4OGZA 4US5A 4MWAB 5FJJA 3RO8A 3PY2A 8A3HA 2PTWA 3GE7A 5JQ9A 1XIBA 5HR7A 5A5WA 3VIKA 3TSMA 4FX6M 4HTBA 4Z2IA 4JIRA 4EWJA 4E2DA 3MMTA 4IPPA 5K9CA 1MXDA 1UUQA 2EPLX 4MKVA 4CQDA 2R14A 5LGZA 4IT1A 3FYOA 2OZTA 1Z69A 2YIHA 3QR1A 5T91A 1CXIA 4UTIA 1TCMA 3G22A 4U3CA 1HO1A 3CS2A 4Y96A 4WJXA 2NUXA 3XIMA 2DW6A 1UR1A 1OADA 3WEOA 4M7TA 1JCMP 5GJNA 3OTRA 1VRDA 2NXIA 2P76A 2VEPA 3CXOA 4PEKA 1R2RA 5AHLA 3LTSA 2GDVA 2R24A 5KZDA 5L6UA 1UP3A 4I9TA 3F4NA 1KBIA 4URIA 1F4AA 5A94A 1F7BA 4H19A 2Y61A 1M7XA 2GYIA 5GVJA 3LBCA 3VU2A 1Q6LA 3WF4A 5HBFA 4XZIA 1XH0A 1EC7A 1J2BA 4JTQA 2ON3A 2HZGA 3VIMA 3MSGA 2PPGA 1V8EA 1R2TA 4EIVA 3AMDA 2WO5A 1IZCA 2OX1A 1OEPA 1AQMA 1F2JA 1XM3A 1KBLA 4GGHA 5HPCA 5GPRA 3S3GA 3NOYA 4IGSA 3L2IA 5G4HC 1KLYA 4REQA 2WQDA 4JIIX 3BGJA 4GYPC 3BQ5A 1HVXA 2ZUNA 4NJJA 4CVWA 1E15A 4X60A 2DSKA 4FNRA 1AH3A 2V9DA 4ZE4A 2VXNA 3WY1A 1C8QA 2WWDA 4MB5A 2PDBA 5DLCA 3SUSA 3W1RA 4ZENA 3UERA 1PO9A 4MB4A 2QCFA 3W28A 1QU4A 2R1PA 3OBAA 3B0YA 4CQAA 1PZ1A 4RZBA 4UOQA 4HA3A 3B8TA 1E71M 4H6QA 2Y5EA 3G8RA 5E0FA 5AZ1A 4LEQA 3TYZA 4Q8WA 1V0KA 2J79A 3CASA 4J3TA 4KRUA 2CLIA 5HQMA 3BSMA 2QKFA 4LV4A 2XGBA 1P6WA 1M1BA 2F2HA 4XZNX 1WDPA 4TTUA 3N9SA 4M1RA 1OX4B 3GU9A 1A5KC 3S2CA 4D6JA 1LOSA 5FEXA 1B2YA 1KFCA 1PZ3A 1OABA 5BMXA 2BOGX 3BMWA 2O4MA 4L6HA 1HVQA 3IEBA 1W3LA 5D2WA 3HQNA 1EA0A 4RE4A 2IPJA 1RV8A 2TYSA 3BURA 3S83A 2WVSA 4JAWA 2WCGA 2PTZA 1J2WA 2E68A 5F4WA 4UCGA 3CHCA 3ITXA 2C1GA 4KWSA 2OMAA 1OG6A 1QBAA 2QEZA 2BDQA 3COTA 1FFQA 1E6RA 1W1ZA 3GVQA 5SWUA 3S2JA 1RZMA 3WJWA 3AXIA 2X42A 4C91A 1S3TC 3H4GA 1RCOB 3H8AA 3O1NA 3W71A 5JUVA 3NZ1A 2YR1A 4FXFA 3R0UA 1VBUA 2C18A 3QFEA 1DEDA 2VURA 3DERA 4L6DA 5F1VA 4HN8A 1FWWA 1DIEA 4GY0A 4MJZA 1G0CA 4S39A 4V28A 1ZCOA 4E8CA 2ZX8A 3QYQA 3N17A 3B0UX 4XZHA 3E0VA 2FVLA 3L7RA 2A3CA 2ESCA 4OECA 3GFXA 3NPUA 4XZMX 1R3YA 4BQ3A 4GQBA 4AY8A 4YJ5A 2X1TA 3T9PA 3TJLA 5FL1A 4C1LA 1PUDA 1LL4A 5C9UA 1L6WA 1F3XA 1P0KA 3BV7A 3R89A 4I8YA 3UU0A 1V3JA 2CWXA 4W4QA 2Z00A 1V5XA 1XGEA 3KS5A 1VP5A 4UFKA 4UTLA 1G4PA 2VEGA 4RPPA 3AXKA 3TSBA 3U5UA 3WFZA 4C7DA 2JF6A 4JX5A 5LGXA 2OOGA 2VCCA 3LBMA 1W54A 2XH7A 4CN6A 5HA7A 4JIEA 1G9HA 3PZOA 3PM6A 2C15A 4UXDA 3N4EA 5HATA 4CD8A 3V0UA 2BXVA 1TV2A 4Q6JA 4QSFA 3CWNA 3AAMA 3W7GA 5A6AA 4J40A 3OEXA 1JDDA 1YX1A 2ZZ4A 3PJXA 1OJXA 1QHPA 4AWTA 4AZCA 3WLRA 4PMUA 1F07A 1SZNA 1CT5A 2CC0A 4X9YA 1YADA 3BZGA 4RE2A 3S1UA 1LORA 3THQA 1UD8A 4NJHA 2CLKA 1ECEA 3U3HA 3S9ZA 2X1UA 3VMOA 3DI0A 4HMDA 2DPEA 3UR2A 4ROPA 2NLIA 4YU1A 6XIAA 4HOXA 2I16A 4YVPA 3IACA 3N2CA 1PSCA 4FLOA 3MKCA 1MYRA 2YCLA 1TJRA 1HP5A 5D4YA 4R7JA 3TSDA 3WLKX 3ZZ1A 2CIPA 4ATWA 4DUWA 1H0GA 1B9ZA 4RXGA 1E6NA 2E09A 2WLYA 3ES7A 2FZMA 4AHPA 4KS0A 3WQDA 1R38A 5F7UA 4DUXA 4HU0A 4TIMA 2BX7A 2GVLA 3V75A 1Q6EA 3CNYA 5DX7A 1M01A 2DZPA 1BYCA 2OU4A 6CGTA 5F2MA 1M68A 5BWFA 3RYSA 1B3YA 3P60A 4N7QA 4S3EA 2ZC1A 1Z9AA 4XUGA 1AA1B 4G5DA 4JDYA 3WDJA 1CZ1A 4IGMA 5KTLA 5CAHA 2O9TA 3ONCA 2EPHA 2WC7A 4L65A 4FF7A 3ONBA 3GW0A 3C5QA 2Q6ZA 3U0HA 4HP5A 4S23A 1ADDA 2R1NA 4CD5A 2ZKMX 2DFAA 2GVJA 4TTGA 2YOCA 3QZ6A 3HPAA 3FJ6A 4FPSA 1NSJA 1K9DA 2V5DA 2WK2A 7TIMA 2GUYA 2G37A 5HWJA 4B9ZA 2TRSA 4MUPA 3EB4A 4GBDA 1LF1A 4NG3A 1C7SA 2H9AA 3STPA 1H62A 3JVAA 2PDNA 4LRSA 4W89A 4QDWA 3AS1A 3PUEA 2IPFA 2PDQA 3LGEA 9CGTA 1KCKA 5MKGA 4O8RA 4A2RA 4ALDA 1TWIA 4QEEA 4J3SA 2A7NA 2IQ0A 2Z24A 2PDWA 4LNYA 3BK0A 3K4DA 3O6YX 1KR0A 3ZSSA 6TAAA 4EXAA 3VIIA 3FCPA 4AIBA 1MW3A 4HCDA 1A5MC 1OM0A 1TQJA 1Q6CA 1K8XA 3UZXA 3OBEA 2INFA 5TBOA 4H2HA 1UZHA 2JQXA 3MHFA 4UTWA 4BQ2A 3QLLA 5EL1A 4BWLA 4NYYA 2J24A 3LLXA 4OQVA 1RBAA 3O07A 1N2VA 3BTNA 4GYKA 3V5OA 4YTSA 1CB2A 3QR0A 3WJSA 3W6MA 1E3XA 1B3WA 4MYAA 1EHNA 1JL8A 1EJTC 2QCLA 2FKPA 3GYCA 3U2OA 5AN7A 2QPSA 3NQVA 2BY1A 4JKKA 5LA1A 2Y4SA 4R34A 2YL9A 3KP0A 4OOUA 1IXOA 3PTKA 2DSZA 1NAL1 5ECUA 3QJAA 2O55A 5A1AA 1KTCA 3EOOA 2I1OA 4PBGA 3FAWA 5LYRA 2G97A 4U2YA 1UJQA 5AECA 1ITQA 1JNEA 3WIJA 4CCDA 2D3LA 4DXVA 4I8DA 4MNLA 3ZT7A 1XC6A 3P0WA 1I0BA 2J8FA 3LHTA 1KBBA 4F48A 2GL5A 1KW1A 3BICA 1KO0A 3CPRA 1IF2A 4NI3A 3C2FA 3QBUA 5A2AA 1MRQA 1WZMA 3WBYA 4HPXA 2BASA 5EMMA 4KGLA 1S2VA 1KBJA 4ZODA 1XLAA 3VXGA 1GQNA 1TTQA 3UZJA 1WXJA 1FKXA 1GEHA 1L0PA 1KWKA 4KEMA 1ZAIA 3IJ6A 1JEZA 2WZIA 2XVLA 3T08A 5D2YA 3LSCA 1KRBC 4GIYA 1PIIA 4GIEA 1GEQA 4AX6A 1A0EA 4YIWA 2EJAA 2ODOA 3CUHA 3GIQA 2V5KA 1FCVA 2XINA 4AD5A 4G7FA 4MNKA 3IVSA 2FVMA 4OKDA 3VFCA 1FQ0A 5AYBA 5A2CA 4LOCA 4NASA 2ZWYA 1AODA 3H55A 4UTKA 4MMWA 3HO8A 1PE1A 3NPWA 2ZRVA 3LTYA 4Y9MA 4S3AA 2B7OA 2WHKA 1B90A 1MDRA 4IMCA 5DN1A 4FNSA 3QHMA 3NURA 1VBHA 3L4YA 1CEOA 4DN1A 3GKFA 2ZUMA 3I65A 1VRXA 2NT1A 2VUNA 3S2NA 3WFAA 2W3ZA 3CL6A 3THCA 1I2RA 1EXPA 3UWVA 4MKNA 3N6QA 1IZJA 1F61A 1AUSL 3H7UA 2RFGA 1O12A 3FIGA 2A2IA 3WEZA 5E6ZA 3PBGA 4O1CA 3VUPA 3TQPA 3ALGA 1OFEA 4PCPA 1ICQA 1DXIA 4RDZA 2C13A 3NSNA 4O19A 1AZ1A 2UWFA 2XN1A 1QHZA 1W9UA 3H6OA 4JTTA 1JR1A 4V1YA 3I4EA 3LCWA 4QFUA 2PDCA 2YB1A 3ALFA 2QNEA 5C2XA 5A8PA 4CLMA 1E0XA 1SR0A 3S5YA 4LBUA 4D6IA 1TIWA 3RR4A 2C7FA 3NVTA 3EPNA 1WB0A 3NZGA 4JPGA 3L2MA 3ZOAA 1EBHA 2VX7A 4FXRA 5JIWA 1MXGA 3IJ7A 4A3UA 4PRTA 2ZADA 3GDMA 3URBA 1TA3A 3C0SA 5KZEA 4KMQA 5HJLA 1K8YA 3MO7A 4B5SA 2XVGA 3GHRA 4KRZA 1BRLB 3IPWA 3K4WA 5E09A 2GK1A 3ZJ7A 5I24A 3N12A 4F0HA 4IJCA 3SFKA 2A6NA 1H60A 4PE8A 5LIKX 3FFSA 1QBBA 2UY3A 4LX4A 1QK2A 3AYTA 1H11A 4IUOA 5KINA 4RK8A 1YMYA 3TTOA 3STGA 4NNAA 1ADOA 4QIUA 1ISYA 2FZNA 3N2OA 1OC5A 4GJIA 3KVJA 1JAEA 1S46A 2OZ0A 1DOSA 3W07A 4EACA 1DORA 3F5LA 4PTVA 3ZJ8A 3VTRA 3ARYA 4XBJA 1XLCA 4P7QA 4KWOA 3DOPA 5EMUA 4LVDA 1JQXA 4LXFA 2JIEA 3MY9A 3F4CA 4S3CA 3A5FA 3IIPA 4ZFMA 2JF7A 3LPGA 3WO8A 4H01A 4MJ2A 2QAPA 5DY3A 4MY8A 1V3HA 1HKVA 1DTUA 3OPSA 1M9HA 4CQBA 1GK8A 1TX0A 3K46A 1AFSA 1VYRA 3OQ8A 1OCQA 1UJPA 2E8YA 3M64A 4FR1A 4M5PA 3AFBA 2WSKA 1H7XA 2INEA 4YPJA 2PLJA 3UPBA 3VMPA 1VBRA 5I0DA 1T8QA 2GGEA 3F5KA 4EF9A 1JYVA 3HN3A 2WSYA 3LV6A 3KCJA 4XZBA 1FDZA 3GXDA 3NNTA 2YBVA 2HS8A 4LC8A 4H00A 4NX0A 5KMYA 4DNMA 4X0NA 1PV8A 3HJEA 3TW6A 1VCVA 3AISA 3QSRA 3PHAA 3S4TA 1EIXA 3JR2A 2PTXA 4NNCA 6XIMA 2PZNA 2QCDB 1CLKA 2QIWA 4CN1A 4DJDC 5K4XA 3EWXA 2BTMA 3F2CA 2Y24A 2DZWA 1YDYA 4LJ3A 4LS1A 1DIDA 4AUBA 2VC5A 3ABRA 2GSJA 4DBSA 4H2CA 4IHCA 3NR0A 3MDWA 1M03A 3QEZA 1OY0A 4B5TA 4N9BA 3NM1A 2OPJA 2G3IA 3P5YA 3H54A 1A5NC 4GO9A 3GHUA 4R9OA 1DPMA 3B0PA 4O1FA 4JICA 5AC6A 2J6XA 2WLZA 1VFUA 3UWYA 3HGOA 4OHQA 3M0XA 4Z0JA 1XYFA 4ZQNA 3UJEA 3EKZA 4D6CA 2VR2A 3ABXA 3EA3A 4LYQA 1H7WA 4UZUA 4TUFA 1UZDA 3MT1A 4CCZA 2HE5A 3DHPA 4PL2A 3M5VA 1RUSA 2WVVA 4PL1A 1VC4A 5BOEA 4M82A 3M47A 3Q45A 7REQA 5IM51 1XIDA 4F3HA 1B3ZA 5LIXX 4DWSC 3BJFA 3A9BA 2V69A 4E2VA 2DZXA 5LNUA 3MYOA 1GJWA 2GWGA 2R82A 3UVIA 1YDNA 4IQDA 3T0CA 4O10A 1I60A 4S2CA 3GR4A 4GXWA 3HG5A 3ITCA 2V38A 3CB8A 3G6MA 4QRNA 2J88A 3RR1A 1DQXA 1LTDA 3C8FA 3UW6A 2RH9A 1PX4A 2PGFA 1E4IA 3GTHA 4LUSB 4O13A 1DHPA 4O8AA 1B54A 1YTKA 3N19B 5F2GA 3CV6A 3QY7A 4YVXA 2PTYA 1GORA 2WJDA 3ARPA 3WQEA 4N4PA 4LB4A 2ZRYA 4GYPA 3DG7A 4MPKA 3SUVA 4S38A 2Z29A 3NQCA 3CL7A 2WPGA 1XINA 5HOSA 1THFD 4NZ5A 3SRHA 2NUWA 1V7AA 1FUYA 3AJXA 1H09A 4GE8A 1J0ZA 7XIMA 4OBTA 1KR1A 2WBGA 4YL2A 4GISA 3TUUA 1F8MA 9RUBA 2QAFA 4LAKA 4AFYA 3VX1A 4NNBA 1X1OA 3DFOA 4QCFA 4UMBA 4AX7A 2QUVA 1ZPTA 3G1HA 1FRBA 2GPTA 4S3JA 2PCQA 1UIOA 3WEMA 1ELSA 1ISWA 3EWDA 2FPTA 3WDRA 4LBRA 3CZJA 4IF2A 3TTQA 3ABQA 2FZBA 4DZIA 2Z1BA 1FCUA 1Q13A 4FAMA 2ZRWA 2Y7GA 3V4BA 2WKGA 2NW0A 3C3UA 1WX0A 4K39A 3ZFHA 2E40A 3H23A 2CZEA 3OVRA 5M03A 2XTKA 1XRVA 2WZMA 2D23A 1W91A 3G77A 3C0LA 3OVPA 2F6KA 1GCYA 3GNPA 3B40A 4LAMA 5M5DA 2PGEA 1C29A 2XM1A 2CYGA 5EA9A 4OOZA 3KXQA 4HT3A 5EPDA 3HQOA 3WNOA 5D9OA 1FH9A 1W1VA 2OEKA 3I7RA 4GUJA 3P80A 4RNIA 5D03A 3ZVHB 1QO5A 2J7BA 2R94A 4I5UA 3T8LA 1X96A 3TA6A 4RNJA 4JN8A 5D2VA 3TMLA 1LT7A 5I3FA 1W2VA 1TPB1 4H7CA 1GPWA 1GOXA 3M0VA 1VEPA 3KOXA 5AC5A 1E6ZA 4CN4A 2CERA 2O56A 2QV5A 2VZOA 1MW2A 5I77A 4H9ZA 1QW8A 2HRWA 2G4JA 4QITA 4UTFA 3AICA 1VAHA 1SQ7A 1LBFA 4Y8EA 3V3WA 2I57A 1EBGA 4NZFA 1NELA 5K4ZA 4TVCA 4H9XA 3LY0A 1P7TA 4PN2A 1UCWA 1GJPA 2ICSA 1A5CA 4AG0A 4CQCA 1C7TA 5D9MA 4GCAA 2BB0A 1R8LA 1I1WA 3TN3A 3W23A 2OFJA 1UPMB 5G1MA 3VOJA 4PCNA 3UCDA 5T26A 4JFTA 3OYXA 3PWIA 3KOYA 3ENLA 1HJWA 1HJVA 1J12A 5FF0A 1CXEA 3PR2A 1KNWA 1UWSA 1OC6A 1OCNA 4NVTA 5JMUA 1JFHA 1MFUA 2ZX7A 4TX8A 4XG1A 3UA4A 1LM1A 3WLTA 1OGBA 3OHMB 3B0VC 1Q6OA 2B4GA 3CPUA 1TCDA 2DV0A 3RCYA 3WMBA 4C1KA 3V1HA 1TUFA 3TJIA 3FY1A 5E9AA 5A2BA 5I00A 1DIKA 4UTJA 3U57A 2OXNA 5FL0A 3T0AA 3M5YA 3VIHA 3DENA 4HJFA 3SCUA 4JKLA 2NX9A 3UGRA 1YBQA 3E0WA 1GYNA 2GFTA 4N42A 1Q85A 3U4AA 4K3ZA 1NQ6A 2YDQA 2YPIA 2CBIA 4F9JA 2PMQA 4Z42C 4PUKA 3QGVA 1EJUC 2IXUA 3RGTA 3UJRA 4KESA 4DJFC 2PFHA 4NAFB 3O7UA 3KRUA 1GT8A 4F40A 1GONA 4G6CA 4GXMA 4Q4RA 2OO6A 3BXWA 3Q65A 1ZENA 5AHEA 2V8ZA 4C60A 1KM1A 2DH3A 1W5PA 3RF9A 3BO9A 3RDKA 3IGXA 2CLPA 3EMQA 4XD6A 1W5QA 5I07A 4ZEPA 1PWLA 1R3WA 1Y5WA 4W8BA 3QQ1A 2FFCA 3D6NA 1GVFA 3R13A 5AYIA 4PMJA 1Z42A 2CKRA 3KVMA 4J4KA 3PZMA 1F6YA 3CZ8A 2Q09A 4HPJA 4QE4A 4PMVA 3QC0A 3FJ4A 1CPUA 2R6OA 4LUTA 1NP0A 3MV11 2Q3RA 4AISA 4V1XA 1A5AA 1X38A 1VFSA 5HUPA 3LV5A 1T8XA 3FKRA 1GOOA 4XO6A 4EX4A 3O9NA 2FLIA 4LYRA 4QNEA 4Q32A 3PPGA 1ODZA 1FHDA 3LGGA 4LCSA 1CXKA 3UWUA 4GKLA 5ABEA 4AW7A 3CU2A 1DL3A 1RQHA 4UQAA 2Q8LA 1LQAA 4QE5A 5C71A 4H8NA 4PUEA 1BYDA 4YXGA 3W7RA 4ZGYA 3LQGA 5DXYA 1U5VA 1MUCA 2ZZ5A 3LDVA 4EF8A 3K30A 4PH6A 3B03A 1K6AA 3LS9A 2H8ZA 3LCGA 1HKWA 4TOQA 2C1IA 1Y65A 1FY6A 3DC8A 4GINA 1SW7A 3EDJA 5KETA 1UH3A 3OQEA 1OC7A 4HU3A 1QW9A 2HXUA 4Q7BA 3NYDA 2BVDA 1HL2A 4IQJA 1UQZA 3EOEA 2NXHA 4JFUA 3VI2A 2PSNA 1EC8A 1IIGA 4HGXA 3UXIA 1JXJA 5H8MA 4B5UA 5IXEA 2CZVA 5XINA 4J2MA 2FH8A 5JH2A 1SUXA 1C8XA 3NZRA 3W26A 5DMYA 4B3LA 1EO5A 1Z3NA 1WXZA 1NF0A 5EMKA 5DMNA 5BXRA 1SR9A 3N15A 3LTPA 1XV8A 5HMFA 1FWRA 1CGUA 1TPDA 3U6WA 3IUIA 3MI6A 1EGMA 1CGYA 1SM9A 5U4NA 1M7PA 3SQSA 1TREA 5HQEA 4WY0B 3TV8A 3WDPP 3SJNA 3RLVA 1PYMA 3BWWA 1MEWA 3G0XA 1R30A 1E0WA 4PZVA 4HK7A 5G4WA 4HSOA 4WKAA 1LOLA 4G1KA 1IXPA 4IX0A 2A79A 4M1BA 4QHRA 1MWOA 3GLCA 3DFSA 4QCEA 3TR9A 3PBUA 3H2OA 1RAKA 3CO4A 4CNSA 1M41A 4ZTXA 3R58A 4L1WA 2GGGA 3N3TA 1GQKA 4XIMA 4QAIA 3KLLA 5CPQA 4E3TA 3G2GA 5GJMA 4PTDA 4G56A 2AAMA 1YXYA 2E1WA 1VIZA 1C90A 1U2YA 4IMDA 3P8IA 2XU2A 1M3UA 4RJEA 3WD3A 1FWCC 1RBOB 2BSLA 1V4YA 3LM7A 4HCHA 2OWXA 4WX2A 2PDKA 4CU6A 2YDAA 4JBRA 2O9PA 4E2OA 3A5VA 3E0LA 4PBFA 3N1AA 1O1HA 2DQWA 3MUAA 1XLFA 3WQWA 3VD4A 1OZQA 2VFGA 5C9RA 3C8NA 4DI9A 3GDLA 1V6VA 1TFVA 1HL8A 3UXKA 5BNKA 1ICPA 4WK9A 1UA7A 3DYPA 3STFA 4JQAA 4W88A 1VCFA 1IQ8A 4BFAA 1NU5A 1YNYA 1REQA 4ZA0A 5ENLA 2QGYA 4MOZA 1PYFA 1X8CA 1MFVA 5C70A 3LI1A 4O50A 4WJ8A 3UXDA 1P43A 3WLHA 3EYPA 2W4XA 4UTMA 5AHIA 4H4IA 4M3PA 3M44A 2LLEA 3AQUA 1TTJA 1KFWA 5I03A 1IWBA 1XRFA 3UYCA 1XUUA 3H21A 4AC1X 2OG9A 4IX2A 4DB7A 2PWUA 2J74A 3PTQA 1GVQA 1RALA 2O7SA 3RPDA 1EJVC 3SCNA 2VEIA 2QVHA 4IIBA 3VYLA 1JZ8A 5DO8A 2I14A 1AG1O 4GX8A 2ZXAA 3O15A 4I7UA 5DY2A 2PE4A 2W5FA 5CSYA 2F7FA 3IJQA 3QMTA 2OWWA 4JN6A 4OBRA 1UKSA 3GDKA 2Y7FA 1FA2A 2J8GA 1SFSA 4UMCA 4AD3A 2YYUA 4JEQA 4UWMA 3ARZA 4DI8A 3TEVA 3B06A 1NP2A 1HJSA 1TJ1A 3M5XA 4IMAA 5D9NA 2DSVA 1HJQA 3GIYA 1QI5A 3SSZA 2AGTA 3AIBA 4Q7NA 4AC7C 4ZVJA 1ESWA 1WXYA 4IIGA 2F61A 1PX3A 3THUA 2D69A 3LRMA 4PSPA 4F9DA 4HYRA 1DIOA 4YYFA 3ZWSA 2J25A 3T4CA 2HISA 1KM3A 1QMLA 1QI4A 2XJ7A 4ZOCA 5FACA 4CD6A 4IPJA 2XIIA 2VJXA 5J5DA 4GWEA 4IP7A 1POJA 1UW9A 4GQGA 3B8DA 5DCBA 1JD7A 3ZLGA 2QCHA 2C16A 4GQQA 3W25A 5G2HA 4GMEA 3LBOA 2V63A 3M0YA 4GH3A 5FA5A 1U1UA 1R3TA 6PTDA 1XLKA 1QPRA 3P14A 2J7HA 3UR7A 4GI6A 4G2DA 2IPGA 3V16A 2HBVA 1FWHC 4XAYA 3TN5A 3GHTA 5EBAA 2IQDA 1N8IA 3MMWA 4DRSA 1YDOA 2V3FA 4G7EB 3KVLA 4LAOA 3TCEA 4LS2A 3OA3A 1OGGA 3GVWA 4XD4A 1TO3A 1Z8AA 4Q8UA 4N9DA 5AYZA 3FS2A 1QT1A 2E4TA 4JL2A 1KCLA 1XHGA 1FDJA 2NQZA 1OINA 4ORMA 1EF2A 2BMBA 3E96A 1IWAA 1NFGA 2CESA 4IM4A 8TIMA 2X16A 3C52A 2F84A 2XFFA 3RLGA 1I2NA 4LANA 1QAPA 3WDIA 1SPQA 3GU1A 1LUCB 3VNIA 3VGEA 4JIPA 1U1JA 3KL0A 4DO4A 4AEOA 4Y2WA 2XH4A 3KW3A 2W0UA 4MVAA 2OJPA 5JBFA 3W29A 1E0UA 1XIEA 3UZYA 5CZTA 3KRZA 2HBXA 3PTMA 1ZLPA 2QJIA 4UFMA 5F4XA 1NWSA 4RDWA 3O3RA 2YFOA 5A8OA 4B3KA 4JS3A 3FKKA 4DJDA 3WQFA 3R8GA 4LF2A 4HPHA 3QZAA 3Q37A 2PDGA 5C54A 1NOWA 3B4UA 2VR5A 4Z1YA 2XFRA 3GAKA 1J6OA 1RR2A 3H26A 3L4ZA 1A49A 3BGGA 3NQ2A 3PUGA 4A3HA 3QTPA 3SB0A 1AL7A 2YCEA 2V5BA 5IDZA 1GNXA 2R1MA 4K36A 1AMKA 3CWOX 4IG2A 3QY8A 1B30A 3CJPA 4BQ5A 3T40A 4PA8A 3RX3A 2WBKA 1G69A 4CEXC 3CZEA 1UUMA 2C71A 4GNJA 4REQB 2O7QA 1G94A 2DT3A 3OZYA 3FDGA 4PRWA 3V36A 1GOQA 4C1NA 5FKYA 1PS9A 4WQ6A 1TPC1 4UMAA 4BF7A 4KGJA 3UBPC 1XX1A 4BS0A 1B4KA 2OLAA 2D1ZA 3LG3A 4DWSA 2VRKA 2INZA 1B3VA 1TV4A 4HNUA 2KAUC 4MLRA 3RM9A 1PKMA 3B3DA 2DSWA 4JTGA 3MPGA 4N02A 4WF7A 4Y9NA 3L65A 2WZHA 3VIGA 3G24A 5DBTA 1DHKA 4PTNA 1W2PA 4NIRA 1BXCA 1LQ2A 3VVGA 3POHA 3RMJA 3S1VA 1ADSA 1JCYA 2ZZ7A 1RSCA 3NJ3A 1XLHA 3VD3A 1LT8A 4BEUA 1WQ5A 1HG3A 2BVTA 1Q45A 1RP8A 4FNUA 2W92A 2QQ6A 4IIEA 3SN4A 4H04A 4JQ4A 1GG1A 2HK1A 1QK0A 2VEKA 1J5TA 1X6NA 3CLMA 3W1AA 4D71A 4FMVA 2VZVA 4Q7IA 4DLFA 1W3JA 2UZ9A 3NG3A 4XAFA 2ZFAA 4L1XA 1EPXA 2GJRA 3VM7A 1WZLA 2UY2A 1JZ2A 4B92A 3WMLA 3NQDA 1D7KA 3GG7A 4O57A 3FYYA 4P7RA 3IJ9A 2HVNA 3MZ2A 4LUIA 1R3QA 2ZZ1A 2EHHA 1Q7MA 4QQUA 1EGVA 2D20A 1JCNA 3MUY1 5K9DA 2GJPA 4ZO9A 5B7ZA 5DANA 3E2RA 5FSDC 1LLWA 3OB8A 2WSQA 1ZAHA 4ADSA 4J3XA 2HWGA 5CG7A 3TDFA 1JGMA 4ML4A 3GR7A 4O1BA 3VC5A 3WF3A 4HYWA 3WL0A 4UBPC 4J3ZA 2HV5A 1SJAA 4Y9AA 4GOAA 1CWYA 3B9NA 2DORA 1G6CA 4Z2GA 4AU0A 4FOJA 4MTVA 4LAZA 3RUBL 3GSMA 2I7GA 3JRKA 3AHVA 3SY8A 1UP2A 1OX6A 3LOTA 2QUUA 2QHAA 1CTNA 3EAUA 4BCEA 1ISXA 3LPFA 2REQA 3A21A 3PZUA 1VCGA 2C1HA 4M56A 4GLEA 3SI9A 1ML1A 1E5NA 1SW0A 4MFDA 2C8NA 2XVPA 3AIVA 3NL6A 2DEPA 3MMUA 4OV4A 3HGRA 2Z1SA 3PN8A 1W3KA 1LP6A 2GGHA 5M2FX 2V5CA 4HNLA 3BVJA 1K03A 4MAVA 3QMRA 4RW3A 3L0KA 3LCFA 4PFMA 3C2YA 4L56A 3WQVA 3S9IA 4D8LA 1XIMA 1VF8A 2CLOA 1PB0A 4KIEA 4BF9A 2OGJA 1WAWA 4MM1A 1EKOA 1EA9C 1I0DA 1XDJA 1JNDA 3W70A 4C5YA 3UNTA 1VB9A 1W31A 3VOCA 2WNWA 2GDQA 2NV9A 3WLOA 4MHBA 3FA4A 3NVDA 3O6AA 3V1PA 3ZLFA 3SCOA 1UHVA 2XIMA 1KCXA 5E5CA 3VD7A 2O92A 1V08A 2I5IA 3L4TA 1OF6A 4NZ3A 4DF0A 1HF6A 2Y0FA 1S2CA 3UG5A 3UYIA 3NQGA 4L80A 2VGIA 2XZ9A 3GUGA 2G41A 4PMNA 2YA1A 5CXPA 1SJDA 3AU6A 4DO6A 2IKHA 3MP3A 4HJWA 4W84A 3PZGA 3B8VA 4DELA 3OZPA 5BRBA 1YQ2A 2E67A 2YCLB 3GIPA 4ERGA 3SADA 1AL8A 2CXEA 3WBEA 5CC5A 4UFJA 3KM8A 4RKAA 3IARA 4KH2A 3LCXA 1CXLA 3GR8A 2BLEA 1BTCA 3RMEA 2XIOA 4A21A 4GY7A 2OVLA 3NDOA 4LGXA 4WIWA 2WMHA 4F0MA 3MO4A 1NM9A 4M29A 4J5NA 3ABZA 3CQKA 4AZIA 3M0LA 2BVWA 3LCIA 4QS6A 4E8GA 4JY9A 3NAVA 3AS3A 1H2JA 1W9VA 1MO0A 4K37A 4RV8A 3MJMA 1CGTA 5F1UA 4UB9A 3WQ8A 3TTEA 3NSXA 2I5QA 2FQIA 4Z17A 1E0TA 5AVHA 1FWJC 3A3WA 1HFBA 3RXZA 3WF2A 1F3TA 4DJFA 3FV9A 1MZHA 1OX4A 3B9EA 5FEPA 5CBBA 3F5JA 3DIPA 4QTGA 2QLYA 2DW7A 1XRTA 4FB7A 1WAUA 1HT6A 4NY2A 2QDDA 5E93A 4RE3A 1G01A 2QT3A 1PXGA 3AJ7A 3UPWA 2WVTA 4KBXA 1FWNA 3LRKA 4UFHA 3ID7A 3KBWA 2VOMA 4C5ZA 2F6XA 1AK5A 3AIEA 1OFQA 3KTSA 4ZZ9A 4QJ4B 1XYZA 2H9AB 4JZ5A 3FYPA 1R85A 2C0HA 3HOJA 1JZ6A 4LU0A 3FEMA 2YCIX 5MKGB 4MZYA 4L5ZA 3NL3A 2AQVA 4ZO6A 5KEZA 3TZFA 3LB0A 1WDWA 2F9RA 2VDGA 3EDDA 4W86A 3CM4A 2ONEA 2ACUA 5JVLA 1P6BA 4WJEA 3ANUA 4I9JA 4G1NA 3W84A 4F66A 2Y7DA 1R87A 1DJQA 2Q01A 4IJBA 1QNOA 2WWCA 3FJLA 2QJHA 4P7OA 3GKAA 2D22A 4JY8A 4L9XA 4XVDA 3HBLA 1O1ZA 2PWVA 1EX1A 4MKSA 2YYTA 5HUOA 2A3LA 4ZR8A 1H7PA 3SEPA 3QV6A 4ATDA 3GFYA 3K1DA 3LCHA 1CENA 1LG2A 5HJYA 2HSAA 1W32A 3VC6A 4GVIA 4XQ6A 3WBAA 3SBFA 3EWWA 3FNDA 1XS2A 1Z41A 4F2BA 4Q4OA 1VBGA 4OUEA 3VE9A 5KZMA 3N4FA 1L6GA 1WOBA 3CLWA 5FAGA 4NHVA 4AAJA 3HTWA 3GB6A 3SCRA 1UASA 2PF0A 1CGXA 2XSAA 3EMCA 4O17A 4RCXA 2C14A 4B5WA 1DWIM 3UT0A 3QKEA 2PCEA 3KDOA 1XXXA 2HNEA 3FJNA 3GK0A 3WK1A 4CCEA 5BXTA 2CHOA 1Q7ZA 1XH1A 1GOKA 2AKZA 4CNTA 2VRJA 4GQ0A 3UJSA 1OK6A 3WLPA 3W2JA 3W74A 3WLSA 3VCCA 3PZIA 1BVNP 4H3DA 1OFBA 5FJOA 4IISA 4DUVA 1DVJA 2FPVA 2HDJA 3WBXA 1P0BA 4LC6A 2XUCA 2QJGA 3G5EA 3SSJA 2A5HA 4YNGA 3YPIA 1TE6A 3T05A 3WDHA 1V03A 4MZ1A 1SJBA 3EDEA 1DWAM 3K4AA 4FOKA 3ABOA 3N6HA 3WD0A 2W27A 3W24A 5FSEC 1J18A 1C9WA 3SECA 3PJTA 3C56A 4GFIA 2BVYA 3EX1A 2DUAA 1CYGA 4AD0A 3G18A 3EX2A 2V2DA 3EX3A 3VD5A 4X2PA 5BYWA 1JPHA 4O54A 4LUJA 1MUWA 2XVNA 1WP6A 3DECA 5LHFA 4HHHA 4XKYB 1I6NA 3TTSA 3BV4A 2W9MA 4AEFA 3U2ZA 4S3KA 3VM5A 1X98A 1R6WA 3L0NA 4O1AA 1TB3A 3T4WA 2BY2A 2PURA 3RHGA 3VKDA 3H2NA 3BMXA 3VE7A 4MGGA 3D3FA 4AMAA 5BCAA 3W7IA 3GNRA 5A6MA 2ACRA 1GUVA 2VHLA 1XIHA 1VGAA 4P61A 1W8GA 1WBHA 1PIGA 4PULA 2CU0A 1F05A 4ZMGA 3KL5A 2BG5A 1I1XA 3V7PA 1NDYA 1UMLA 1NDVA 3AMCA 4QLLA 1XIGA 4RPQA 1MI3A 2XSXA 1Q6FA 1FWEC 1BKSA 4JHOA 3TYAA 4LY8A 2Z1WA 1W3TA 5CC7A 3T0TA 1YKWA 4JTEA 4K8HA 3CV2A 1JCTA 2VGGA 1VPYA 3N2TA 3XINA 3CIXA 3T42A 1VFHA 2GDUA 4B5NA 4Q4QA 3URAA 2DT2A 5CLWA 5LNWA 3CMJA 3O63A 1OFRA 4JTSA 4PCTA 1US3A 3IAQA 1R46A 5A3HA 3TONA 3RRXA 1E70M 2VGBA 1E3ZA 2FTPA 3QC3A 4UFLA 1UWQA 5D8ZA 2PDJA 3PP7A 4RDYA 3F2BA 1UA3A 2OQHA 4BI7A 1TA3B 3IRDA 4IOTA 1AJ2A 2G5WA 5D38A 1B57A 4PCSA 1BEUA 2PF8A 4IJRA 3WD4A 4XO7A 3WQ5A 3ARRA 2GK1B 2J7EA 1UPPA 3NXLA 5I3GA 5CJ5A 3Q2DA 4PUNA 4UNLA 1UR2A 1D3HA 2ISVA 8RUCA 4A3YA 4DJDD 4AZGA 1LOQA 4R3UA 1EJXC 2B7NA 4Z2JA 2VO5A 1G4SA 1WDSA 3QFWA 3R1ZA 4QE1A 4ZSUA 1R5YA 4GK8A 4NSBA 4E4PA 2XVKA 2VVSA 1IWPA 3OU8A 4AHQA 3A4AA 3VKKA 2J75A 2YLLA 1X1ZA 2VQTA 4ZFCA 3E74A 5I02A 3S5OA 3DHFA 2VEMA 1GVOA 3BLLA 1XDMA 4R7WA 4X2RA 3TQKA 4DZAA 2QMJA 3AYRA 1TUXA 3B9OA 2NQ5A 3GU2A 3PPHA 4LBSA 1KKOA 2J47A 3BLEA 3IK2A 4AF0A 2YLAA 1Y5XA 1EP1A 4RZ4A 4ACZA 1XQLA 1EL3A 3UR8A 1W3IA 2J6VA 1W9XA 3HV8A 1V0NA 1VENA 2QF7A 3ME3A 2VEFA 2RDXA 1GQJA 4JTJA 4NJGA 1VH7A 3RPTA 1JRCA 1TKKA 4U33A 3MUXA 4JIHA 4XD5A 2V0TA 4HZ8A 4DWSD 3HPZA 1DJGA 5D04C 1C93A 5A6KA 4DNHA 5I06A 3OVQA 3QV7A 1KGUA 2X40A 1ENUA 5DMLA 2Z7KA 5AZ0A 5HNUA 1EUAA 3SR7A 2X1RA 4IQLA 3LN3A 3DG6A 1FDYA 4TQTA 1ME7A 4I90A 4KFOA 4TU1A 4MY9A 4R33A 3ZM8A 5I3IA 5HMDA 3KZSA 4BY3A 3R94A 1EJRC 2YXXA 2QUNA 4JL1A 1TSIA 2NWRA 5XIMA 3EXRA 5E1QA 1T5AA 3TOYA 3W1UA 3IJIA 4L61A 2NLYA 4FNTA 5TF0A 2CW6A 1JYWA 1F3WA 2ZTJA 1FVPA 4LH8A 1J11A 5HWNA 1XCWA 1YTDA 4AQLA 5HMEA 4H9MA 4HSNA 2XGZA 1UBPC 2UY5A 3GXNA 3AC0A 4GD0A 4A3QA 5E9XA 2R9RA 5IHRA 1TMLA 1KLZA 3W1LA 3RU8X 1WUFA 1J0IA 1QW7A 3R8RA 3KWSA 1UC4A 1MRAA 4GYFA 3WSUA 1V6XA 4CNNA 7REQB 5E0KA 1QATA 4TX6A 1DV7A 3VKJA 2XWDA 2E5CA 4GPNA 4NL1A 2VX6A 4HHPA 1LJYA 1FTXA 1DQUA 1AH0A 5EMYA 1JDCA 1HKJA 5E70A 1PJ9A 1UR3M 3UXAA 4LT9A 1MDLA 2FB3A 3WK3A 3ITLA 3U4FA 9XIAA 1RY0A 1W9BM 5C2CA 3CQHA 3RILA 4MY1A 3N04A 3TN4A 4UOZA 2ZTKA 4ZQMA 3ATZA 5HANA 2I5GA 4RV3A 1WZAA 1E1EA 2X0SA 4CD7A 4GC4A 2HQAA 4B5XA 1RA5A 1XPGA 3W22A 2VFIA 5FEWA 1JUBA 2OOFA 3LXBA 4K6AA 2ZA2A 3JU2A 3GNNA 3E3HA 3O2LA 3ZO9A 3ARSA 4NRSA 4KCWA 2A7PA 1MQRA 1PKLA 3USZA 3CZGA 3EA2A 1PHWA 1Z48A 1TR9A 3LERA 1IGWA 2CCRA 1I2PA 2PDXA 1BRLA 4H8HA 1V6WA 3BDKA 3P82A 5HINA 3WLJA 3AHXA 4MNJA 2EXOA 3KWXA 2DSUA 2XH2A 3BCFA 1CLVA 3L4VA 5LKYA 4M24A 4LALA 1ZGDA 4O12A 2EPOA 4IPNB 5BOFA 1RY8A 3WD1A 3Q94A 4ICNA 1MSSA 4ZQPA 4LVAA 2EKGA 3WQGA 1XL9A 2XIQA 5JU6A 3ZR4A 4W5ZA 1EHAA 5CJMA 1Y7VA 2VP8A 4IMGA 3WG6A 5CH9A 2G50A 3DYOA 4PGLA 4YCPA 3WMCA 3GM8A 4FR6A 1W1PA 4WLCA 4ES4A 4YLWA 4DZ5A 3SUTA 2D24A 5HQLA 3QKZA 3U9IA 3ZSTA 4MB3A 3R8HA 3A4WA 3GH7A 5CCZA 4K8EA 1VHNA 3EBVA 1AQ0A 3BSHA 3LNPA 2Z0IA 1KB3A 3TW7A 3JZUA 3EEZA 2CHNA 2Y85A 4A3RA 1OG0A 2VMFA 1SZGA 3TJ4A 2NQ9A 4AZHA 3OA5A 1UWUA 2WPBA 3DEQA 3ITGA 4GJ1A 1K70A 4LW7A 3BPWA 4O0KA 4U4MA 4QNWA 4KFPA 1M7JA 4ACYA 3LLDA 3UWWA 3CIWA 1JYNA 1LYXA 1TV7A 2G3MA 1US0A 1EWDA 4JTAA 5DBUA 1EUNA 2FPYA 1B9BA 4PCFA 1PKYA 5KITA 3BCJA 1VQTA 6REQA 1SO4A 4H6KA 2OO0A 3DC0A 4ZXLA 4DJFD 4XZLX 1FOBA 2V67A 1Z6KA 1NFPA 4QG9A 5DT5A 4EE9A 2GSHA 4IICA 1T40A 2WXDM 3BLPX 3H70A 4J3UA 4Z2HA 2H6RA 3GYEA 3WZ0E 4NILA 2UBPC 1J96A 1L6YA 4I9AA 4O16A 2FHBA 1KM2A 1W0MA 2YB4A 3MKVA 4JTIA 3A23A 3VDGA 3EXSA 3S2LA 2Y62A 1OFAA 1F6PA 1NWTA 2PGRA 1CW2A 4S1FA 2OZ8A 3OOQA 5ABTA 1HUVA 1ZB5A 2EEXA 1JQVA 2O9RA 3W7KA 3T81A 3TTYA 1SJCA 1I2QA 1J0KA 1K02A 3R6IA 3F4VA 3U2CA 5U7SA 2G4FA 4J3VA 3VIJA 2RKXA 1JPDX 3S6TA 4MAZA 1LDCA 1ME8A 1D8CA 3KLKA 1Q8AA 2HK0A 1RXOB 4UOJA 4RNHA 3JW7A 1ZFJA 1HP4A 1FH8A 4R7OA 3H2AA 3VNDA 3R25A 3VUSA 3W7PA 1ITUA 2DZTA 2P5NA 1YBQB 3N9RA 1KD0A 3W2MA 1H49A 5RUBA 2NVAA 2Z26A 4HIBA 1XLEA 2AQOA 3W6YA 2ISWA 1TR1A 1A0CA 1Q2SA 2PD5A 1XKJA 5CPSA 3L23A 5IDIA 5HXMA 4F8XA 1MNSA 2PAJA 2QW5A 4B9YA 2V3DA 1M5WA 1BHGA 3TE9A 5JIPA 1DXFA 2X0YA 3F4DA 3PF3A 3ZJ6A 2YA0A 1QOQA 3TNOA 1IGSA 2Y88A 4OJYA 5K9XA 2CZ5A 3EPOA 1BGGA 3KOWA 1W17A 1GKPA 3AOFA 5LHEA 3G3DA 1BAGA 4B4HA 3QH2A 1QPNA 1A3WA 1BQGA 3VNKA 3HG2A 3OZOA 4DX3A 3E1F1 1C8VA 2VNCA 4NJKA 3MV01 3H4WA 4HOZA 3SO7A 3P0XA 1IT0A 1OCBA 1UD3A 5HNRA 3AROA 1Q2RA 1S5MA 2OTDA 2J62A 3G1SA 4V27A 1ZY9A 3DFQA 1S39A 4NP7A 3GG1A 4EVZA 2P10A 2ASHA 2ZXBA 4LUTB 2WNNA 4JYFA 3OZMA 4ADTA 5EFDA 3WJZA 1OIFA 3ECQA 5C7VA 3U7BA 1WKYA 4AEEA 4FS9A 3TAOA 4WXYA 1QVBA 1KGWA 1ZZMA 2ZUSA 2VD9A 4GA8A 3K2GA 3MW7A 1IEVA 3CTTA 2BHUA 4JNYA 3SAZA 4C6IA 2F38A 1KM4A 4ZOAA 1O60A 4NU7A 4ERAA 2XZ7A 1SVDA 4OBSA 1BSIA 5D09A 3RRAA 4WDXA 2BGSA 4D6EA 1UIPA 1B3OA 4UR7A 3G1YA 1AW1A 4YCOA 1EP3A 4U2ZA 3W86A 1D7FA 1K4HA 2YXGA 2BXYA 1AJZA 3MVTA 4CQ8A 3CUFA 1R2SA 2OWCA 5REQB 1JG9A 2ZUWA 1V02A 3M6DA 4TMBA 1FBAA 3BL3A 4H6EA 3U48A 3GG8A 2WHJA 2Y8VA 5FESA 4QJ1A 5ECVA 3NPVA 3MI3A 2WKLA 2BHZA 2PLCA 4V15A 2ZRXA 1KWGA 4LY4A 2KX9A 3A22A 1ZU8A 2CKSA 5FJTA 3W7LA 4LYPA 2FGLA 5H8PA 1P4CA 4A29A 3OLEA 1NTHA 1LL7A 2VQUA 3VAVA 2DUZA 4O53A 2E7FA 3FN9A 1GOMA 2V81A 1ISVA 3L5AA 3ORWA 4Q3MA 2AGKA 3DKJA 4R85A 3HU7A 4BI5A 1B4EA 2ATMA 2Z28A 1KBKA 1XQKA 2VM8A 3KAOA 3S8HA 1GVYA 2ADAA 1BGAA 1KQZA 2ZX6A 5LIWX 2FTWA 3KRBA 1LRQA 1TWWA 4LCRA 3AHTA 3OO2A 1KXQA 3SY5A 2WJZA 5FCZA 1YE4A 3FGCA 4WD0A 3VDBA 2ZA1A 2PC4A 4K1WA 4LTSA 3NQAA 2GZXA 3BG9A 8XIAA 3HZ3A 1XLGA 5T9BG 1Q6GA 5J04A 1EZWA 1JVNA 1KXVA 3WUEA 4YTRA 3BAIA 4EAYA 4EANA 3PC0A 4AVOA 3GUWA 6TIMA 4U3AA 2X2GA 1SW3A 3BJTA 1B3XA 2D0GA 2A1YA 4A8RA 1IZKA 3NQ6A 3WK0A 4E8DA 5JBDA 2PEVA 1EO7A 3W88A 1QPQA 1NIUA 3NEHA 2PDLA 4W5UA 1SYTA 1ZUAX 3R12A 1UKTA 4DYKA 1R9ZA 1OYAA 3RPMA 2Q3OA 5M1TA 3AS2A 4IFKA 5A95A 3S0CA