4AD3A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-deoxymannojirimycin
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
345
Chain Sequence
TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
total genus 130
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad3A00
4PCSA 3WN6A 1D2KA 1UWQA 1LQ0A 1J9YA 2D0HA 1WZAA 2DGAA 3AIUA 4HMCA 3GNOA 3WELA 5DFAA 2WHKA 2ZUUA 2ZXAA 4M80A 1G9HA 1HJQA 1YQ2A 1J0KA 3OIHA 4U31A 1E1EA 3DYPA 3K4DA 1QHZA 1XV8A 2WXDM 4L4OA 3T0BA 2D20A 2WVSA 1K9DA 1HJVA 1HNYA 1KBKA 3PZIA 1SFSA 3AISA 4FLSA 1JFHA 3ARZA 1W32A 3WDRA 4BF7A 5A6BA 1XSIA 1E4IA 1CGXA 5GQBA 1UWIA 3AHVA 4U2YA 1E3XA 4AYSA 1UH3A 3ECQA 1PJ9A 4C7DA 2EO7A 4BCEA 3WF4A 2WYSA 2GUYA 5HDRA 3G6MA 1EDGA 2BV9A 4Z2HA 4UOJA 2E9LA 1ISVA 2J7FA 1GQIA 3VIFA 1HVQA 2D3LA 4AD4A 5ABEA 4FK9A 4U2ZA 4X9YA 3HMCA 4JKKA 2Y8VA 3THCA 1C7TA 2X0YA 1VBUA 1UR2A 2OYLA 4A3HA 1F4AA 3PBGA 3ARVA 4HZ7A 4MB3A 1HL9A 1H5VA 4B3LA 3ZSTA 3VIKA 3VKKA 1KFWA 3ARUA 1W9PA 2VT0A 1BSIA 1LWJA 2A3HA 3EDDA 3WL0A 2VCAA 4JL2A 2OSWA 1V0MA 4EKJA 1W91A 4CCDA 1UYQA 3LPGA 1N82A 3K1DA 3PZ9A 3L4VA 3UG3A 1EGZA 4PUDA 3I3DA 4D6GA 2JALA 4A3YA 3GDBA 3GXIA 4MNLA 2PWFA 4WLCA 3QR3A 3DHPA 1UKOA 1ZBCA 2G3NA 3EMZA 2BVDA 4W85A 4UFJA 2VJXA 1V0NA 1GOOA 1UR0A 4ZXOA 5A6KA 1JD9A 1M03A 4D1IA 4GI6A 3A47A 3GNPA 1J0IA 1VFMA 3FN9A 1JFXA 2ZICA 4TX8A 2J7CA 2OWCA 1KXVA 1LL7A 2DQXA 3VUPA 3ZQ9A 5JBEA 4FLRA 1I1WA 1JYNA 3TONA 4UQBA 3BLKA 4PN2A 4BA0A 1JF5A 1NOWA 3B9EA 1FH8A 2ZXBA 5A2AA 4QCEA 2E40A 2HVMA 5HPCA 2DT3A 2J7EA 3MUZ1 3WDPP 3RO8A 1XC6A 1OT2A 3MSGA 3T2QA 4ML4A 1R7AA 4U3AA 2YIHA 3WL1A 5HOSA 3BLPX 1VFOA 4R27A 3AZRA 1FP9A 4ATLA 4WSJA 3W81A 2JIEA 5DMYA 2VMFA 3SUWA 4AZGA 4IUGA 5IFPA 2ZUTA 3BC9A 3CUGA 1IV8A 5BYWA 3BAWA 1PAMA 3WNMA 2FGZA 4Z2IA 1M04A 1B3XA 7A3HA 3UG4A 2ZX7A 1BTCA 1GQLA 3CZKA 3O6AA 2ZWZA 5E0FA 4KGJA 1AQMA 2FHCA 4PSRA 1VBRA 4GZIA 1CXEA 4GZJA 2PC8A 2BVYA 2OLHA 3BAIA 1CNVA 3QOKA 2PBOA 5CG0A 4LGXA 4CD8A 2CBUA 4EANA 3PTKA 4KRTA 3W4RA 1BQCA 2ESCA 2BXZA 4PMVA 1DTUA 4ZE4A 3SIMA 5A2BA 4AIUA 4UQDA 3WD1A 1ZBWA 3VIMA 4N42A 2VX4A 3MMWA 3CUHA 4V2XA 2VRJA 3EDKA 9CGTA 4WKFA 1H4PA 1JZ8A 4CUCA 4DUXA 1JYWA 4HOXA 4J3SA 3OA5A 3PTMA 2ZX5A 4MB4A 4UOZA 2PWDA 1H0GA 3FY1A 3AIWA 1J0YA 2YL8A 4PTMA 1HVXA 5E9AA 4V27A 2BS9A 1E6NA 3CHEA 1JNDA 2CKSA 1S46A 5LA2A 2VRQA 4GQRA 4AC1X 1JGIA 2VC9A 3RDKA 3A4WA 1K9EA 4XB3A 1CXFA 1V6YA 2VX7A 1PIFA 1JZ4A 2VRKA 2DSVA 5JIWA 4KRUA 2WLYA 4CU7A 1J12A 3CUJA 3AXIA 2V5DA 1ISYA 3KWXA 1B3ZA 1UKPA 1I75A 4HP5A 2QHAA 3NDZA 3O9NA 3ARTA 1TR1A 2D24A 2D3NA 3ZM8A 4AZIA 4P7OA 5GNYA 2D1ZA 2YL9A 5ECUA 3CH9A 4LYRA 4PMYA 3D5HA 1E72M 1GZJA 4GI9A 2VCBA 1BGAA 1E6ZA 1V0KA 3B8SA 4HU0A 4CVUA 1AQ0A 1LG2A 1FFRA 4M82A 3ZMRA 4D6JA 1JZ7A 3NSNA 2WCSA 3PZGA 4MB1A 3VD5A 3RMEA 4TTGA 3WQ6A 2BHYA 3CHFA 4B15A 1CENA 4C7FA 1E73M 4HZ8A 4TVDA 5E0CA 4CN6A 4DWSA 4PTXA 1GNXA 3WF2A 3MMUA 3WSUA 2VTFA 3CGTA 3WMSA 1CPUA 2YDQA 4DM1A 1MFVA 3S6TA 4JIEA 3U5YA 3PZMA 2J4GA 1E6XM 3VIJA 4AZCB 4LQ1A 2XVLA 5DEZA 3ARYA 3AHXA 1ZJBA 1CZ1A 4CN4A 3L4WA 5I2UA 4TUFA 3LPFA 1DEDA 3NUKA 1RPKA 1NWRA 3AXXA 1SMDA 2VR5A 3CPUA 3W29A 5ABFA 2VI0A 1QPKA 1OT1A 1KR1A 4AEFA 4PBGA 1W1VA 3BMWA 4M8UA 4JCLA 3AHTA 2QLYA 3ZR5A 4H2CA 4J3TA 3MUY1 2VO5A 3HN3A 2D23A 5A6AA 4XV0A 3HJEA 5KZ6A 3W28A 3SCOA 3L4TA 4E8CA 3N13A 2Y2WA 4E8DA 5M03A 2XPKA 3CHCA 2WPGA 4K68A 1UQZA 5I24A 3AS1A 2DSWA 4UTFA 3ZJ6A 4WKHA 1H3GA 1GW1A 1MQQA 2X0HA 2C7FA 2X09A 1DWAM 2X2YA 3GNRA 5CSUA 1KBBA 3AQUA 4MNJA 1X1NA 3NDYA 5LYRA 1QNRA 4UQ9A 1E71M 3AS2A 3OB8A 3QHOA 1WB0A 1RH9A 2CETA 1NQ6A 4QFUA 1WO2A 4W87A 4OOZA 4UNIA 2J78A 1NOUA 3U7BA 1EO5A 2WAGA 5GPRA 1HT6A 5CZKA 4HU8A 4PMOA 2J7BA 1OD8A 5E6YA 4D6CA 3M46A 5BRQA 5BWFA 4PRWA 2WSPA 4KWUA 1HP5A 3BAYA 3ZO9A 1XH0A 3SCWA 3DECA 2E9MA 2FDMA 3APGA 3GXMA 5I0DA 3JUGA 2E8YA 1TA3A 2OSXA 5CPTA 3WH6A 1HXJA 3WUFA 3SUSA 2GVYA 4J27A 4JHOA 3VU2A 1ODZA 1HJWA 3QOMA 1VB9A 3UEQA 4TVCA 1XYFA 2DSZA 4P7QA 2UY2A 3QHNA 3BCDA 2GK1A 3MV11 5F7UA 4FLQA 1WAWA 1W9DM 2QPSA 3N1AA 1KGWA 4HTYA 2GJPA 1BYDA 5A8NA 4U5IA 2CEQA 4MTVA 2J7HA 4CN1A 5D4YA 4M29A 3F5KA 2VUYA 3POHA 3TTSA 3N9KA 1W3JA 1JYVA 1LJYA 1MW2A 4MPKA 3VO0A 5D8ZA 1ZU8A 3VMPA 2YA2A 1NWSA 1HL8A 4CU8A 5CXPA 2V38A 3IJ8A 4AXNA 1O6IA 5BCAA 4NI3A 2Y5EA 1B90A 2Z1KA 2XGIA 1JDDA 1UR8A 3FW6A 2DPEA 3TOPA 1QNOA 1FHLA 3SUUA 1E70M 2D0GA 2HISA 3BAJA 1X6LA 4U5KA 3N15A 5D8WA 3IJ7A 1CBGA 4H8VA 2B31A 2OYMA 4E4PA 2PBGA 3I3EA 4CD6A 4CD7A 4ZE5A 1Q6CA 2V3EA 1OWQA 3GXFA 3T08A 5E09A 3POCA 1H41A 3MV01 1GQJA 3VD3A 1NOFA 4HMEA 3BMVA 4JKLA 1KQYA 1W3LA 1PZ2A 5I78A 3IANA 1KQZA 3K46A 1C8YA 1ZBKA 3UETA 5I23A 1UD2A 2D2OA 4QLLA 3PTQA 2CITA 3MU7A 3RJYA 4WK9A 2EPOA 1GJWA 1H11A 1WZKA 1A47A 1GOKA 2WC3A 5C71A 1D3CA 1NP2A 1L8NA 3FNDA 3MANA 3PZQA 1V6WA 1CTNA 3AIEA 4B16A 2YOCA 4ATWA 3ARQA 4D6IA 1QHPA 2WVVA 4HA4A 1D7FA 1UD3A 2WZIA 4XZWA 2RGLA 3FAXA 1UHVA 2E9BA 2J25A 3GBEA 1G0CA 2YLAA 2YL5A 2WLZA 2CBIA 2CHNA 4QCFA 2X8RA 1LL4A 1CWYA 2Y24A 4CCCA 4WKAA 3N04A 3WFLA 1MW3A 3DYOA 4UQAA 2BY3A 3W38A 1KR0A 5EB8A 3VD9A 4DUVA 2XWDA 1E4MM 4MDOA 4B9YA 4B9ZA 4LPCA 3ZJ8A 4XX6A 3MMDA 1QOXA 4CVWA 2VZTA 1OBAA 5FOOA 2CESA 4MJ2A 5BXTA 5A94A 1V0LA 1EDTA 4AD0A 1W1PA 5A69A 3L2LA 1PIGA 3WF1A 4PEEA 3WY1A 1CDGA 1J11A 5IDIA 4X0VA 4M56A 3MSDA 2WMIB 1TCMA 5A6BD 1JZ6A 1KB3A 5A95A 4P8UA 3GXDA 1U33A 2DH3A 4AISA 3GH7A 2BXYA 1HP4A 3ALGA 1KXTA 5D9MA 1FH9A 5CLTA 3SCTA 3VDHA 3GH4A 3TTQA 1UWUA 3WH9A 1TMQA 5IHSA 5A6JA 4X0NA 2YBTA 3RM9A 4XZBA 1MFUA 3CUIA 3VMOA 1V03A 4U33A 3NCOA 1V6XA 1H0IA 3KEHA 2CXGA 5C70A 1UA3A 2BHZA 2XSBA 3PZUA 5M3WA 2WC7A 2WMKA 1KXHA 4UCFA 1Y7VA 1V3JA 2O9TA 1DWJM 5BRPA 2WKGA 4PMXA 3UERA 5AY7A 4DM2A 2WHJA 2XVNA 1UR9A 2X1IA 1UH4A 4H7VA 1E6SM 4UFKA 1FH7A 1PX3A 2V3GA 4GIAA 4CKQA 2WHLA 2GJXB 1JL8A 4AW7A 4TX6A 3UR7A 1OIFA 3WNLA 3W82A 1US3A 5JUVA 1VAHA 1UR4A 4LXFA 1OSEA 3UESA 1JXJA 4D71A 3RJXA 3VINA 2JEPA 2UY4A 2BHUA 4PTVA 1KWKA 3VGHA 3WEZA 4J3XA 4MNMA 3AICA 1PEZA 4D6DA 2BY1A 3SCVA 4GO8A 1HJXA 2CNCA 2VX5A 4AIEA 4GZEA 3M7SA 4NRSA 4W89A 3SCSA 1EHAA 4CD4A 3BXWA 1VJZA 1JF6A 4YHEA 3W25A 4QLJA 1XH1A 4DUWA 2PB1A 1XSKA 4TVUA 4HPGA 5I5RA 2QMJA 1JZ2A 2TAAA 3ARRA 3T2OA 3WF3A 3RPMA 1H49A 5CSYA 3WBEA 1HKMA 3SCPA 3CMJA 6A3HA 2WCAA 2QF8A 1H2JA 1W3HA 1WE5A 1JNEA 3AYRA 3AIRA 1B30A 5GNXA 1LL6A 1EQCA 2JF6A 2J62A 1SMAA 4H41A 4W88A 4A4AA 2J47A 3SUVA 5IHRA 3MUIA 3W6LA 1YHTA 1WNOA 2ZWYA 5BROA 1UWTA 5I77A 4UFIA 2YBUA 1V3KA 4J7RA 1G1YA 1GOWA 2J7DA 4AZ7A 1WZMA 3MS8A 2IUZA 1M7XA 1KGUA 3BH4A 1BYAA 2W61A 3ZJ7A 1HIZA 1WKYA 2WMHA 5I6SA 3T09A 3L4UA 1L0PA 1CLVA 1PZ3A 1CYGA 3EMCA 3W24A 5DT5A 3TA9A 1XD0A 2CKRA 3ZJKA 2EPKX 1PX4A 3WQ4A 1BPLB 4ACZB 3VDBA 1ZB5A 3ZSSA 3CIVA 1Z32X 4J28A 1J0ZA 1XSJA 3NJ3A 3KE0A 2J74A 1IT0A 2VZUA 4BQ3A 3OLIA 4W86A 5A8MA 4MNKA 4OJYA 1RD6A 2YA0A 3WUEA 2W91A 4BZYA 2Q8XA 4OBRA 4QDMA 1JG9A 2EBNA 2CERA 1NM9A 2ZX6A 2YA1A 1W9UA 1E56A 1ZJAA 2YLLA 4U3CA 4PYSA 5A6MA 3RCNA 2F61A 3BAXA 2RGMA 3SEPA 3WUBA 2VZVA 1CXKA 4PSPA 4EAMA 2O9RA 1GVYA 1E4LA 5CQ1A 4W8LA 1C8XA 4YHGA 5BXSA 3AMDA 3CMGA 1Q6GA 4CU6A 3IJ9A 1FOBA 2WZHA 1RP8A 3AIVA 1P6WA 1JI2A 3NSXA 1UQYA 1W9BM 1CGVA 2YKKA 2OYKA 1NH6A 1HJUA 4PUEA 2DSKA 1BVZA 1UA7A 2XM1A 1TA3B 2OWXA 1FP8A 1E0XA 1LLOA 4W84A 3CZGA 3OLDA 4FLOA 4KGLA 1WDPA 1CIUA 4LX4A 1GCYA 3L4ZA 3KZSA 4OKDA 1BFNA 1ESWA 1JIBA 4Z2LA 4NF7A 2XUCA 5FIPA 4GINA 5FL0A 1JI1A 4NZCA 2WBGA 3CZEA 3VX1A 1C7SA 1E55A 2CCRA 1TUXA 2IXUA 3ARPA 1ZL1A 1QI2A 1W1YA 2O9OA 1E40A 4BS0A 4UZSA 4NSBA 4MAVA 2XIIA 4D1JA 3OG2A 3EMQA 3CTTA 5TD4A 3VGBA 3VOCA 4E2OA 3K4AA 4OBSA 1XCXA 4RE2A 3AHZA 3VIPA 1TVPA 2VQUA 1EO7A 3A3HA 2E4TA 5A6LA 2ZUVA 1E0VA 1OM0A 3N11A 3ZT5A 1CLXA 3DC0A 1O7AA 2WSKA 3M6DA 3W26A 4UQCA 1IZKA 1C91A 3W53A 3AIBA 3BSHA 1HKJA 2WW5A 1MXGA 3U7VA 4F9DA 4W5UA 5GNZA 1SR0A 2XFYA 3CZLA 4IM4A 4YN5A 1F4HA 4AD1A 4MB5A 2BY2A 3WNKA 3WD0A 4AY1A 4GI8A 2DT1A 2ZXQA 1GPFA 4BQ4A 3PHAA 3CO4A 3EDEA 2EPNA 3PN8A 1KCLA 1GORA 1UUQA 3RIKA 1GOQA 3WQWA 1Q6DA 4LYQA 1K9TA 3OGSA 1MQPA 1K9FA 4W7UA 4HOZA 2ZXDA 2GSJA 3S2CA 1QNPA 4UOQA 3AI0A 2E8ZA 3F5JA 3ARXA 2CHOA 2UY3A 3K8LA 1HJSA 1BG9A 1OINA 1CXHA 1E5NA 2FH6A 3EYPA 3NYDA 4Q7NA 3WDQA 1QHOA 1W3KA 4F79A 1OIMA 1QI5A 3ZT6A 1J0JA 1XGZA 3DYMA 1NWTA 1TG7A 4M24A 2G3JA 4AZCA 1UWRA 1JYXA 5ABGA 5EFDA 3VMNA 3OBAA 2J77A 1TFVA 1E6QM 5EFFA 3F4VA 4HMDA 4R5EA 4RL3A 2VURA 1ISWA 1Q6FA 5CJ5A 1E3ZA 3GH5A 4AWEA 4WIWA 1E6RA 4N0RA 1B1YA 1GONA 4PTWA 1C92A 2XTKA 3W6MA 5HXMA 2VZSA 1JDAA 5AC4A 1RP9A 1VEMA 1VFUA 4IPNB 2ZUMA 3G6LA 5D9NA 1BYBA 1UR1A 5DO8A 1DWHM 2V3DA 2BNJA 1M53A 5CLWA 2J8GA 2FHBA 3VD7A 3SUTA 4NRRA 2W66A 3UCQA 1VEOA 5A8PA 1UD8A 1H1NA 2FH8A 3VVGA 1QNSA 2Y4SA 3VDAA 3AMLA 1PPIA 1G01A 5KEZA 2JEQA 4HA3A 3VIHA 5CPQA 4JL1A 3VIOA 4D72A 3AZTA 3L2MA 2F8QA 1CECA 1UH2A 4W8BA 2WKLA 3RILA 2Z1SA 3WQ5A 1C90A 2ZUNA 1B3WA 1UG6A 3WMCA 1G5AA 1J0HA 1UKTA 4UR9A 1CGYA 4W93A 5M17A 3IAQA 2NW0A 4Z2GA 1PX8A 1WDQA 3AROA 1XD1A 1HKIA 3W27A 5CPSA 3FHAA 2JFEX 2PF0A 1AVAA 1MVYA 3GYCA 3GBDA 4AIOA 1BHGA 3WMBA 1OB0A 4PMZA 2ZE0A 2QMKA 2WVUA 2WK2A 2NSXA 3SURA 1BLIA 1HX0A 1KXQA 1DWFM 1V3MA 4L4PA 3THDA 2BY0A 2ZX9A 3NIYA 1JD7A 2VVSA 2EPMX 3WENA 2XYLA 3CLWA 2XSAA 3WFZA 3VD4A 3AYSA 7TAAA 1V3IA 4MJ4A 2C0HA 3B9AA 4EE9A 1XRVA 1ZS2A 3WH5A 4S3JA 3PZVA 2VVNA 1ITCA 4JFUA 1W2VA 1E4NA 3AJ7A 1EHNA 3LPOA 3LMYA 3EDJA 3VPLA 3L4XA 1FFQA 1E0WA 3OGVA 5IFTA 1GHSA 3HU7A 2CIPA 5FKYA 5EBAA 3AMKA 1W1TA 2QPUA 4PMDA 3AXHA 1R87A 5D9OA 4PMRA 5A1AA 1MXDA 3F5LA 2O9PA 2CBVA 1JAKA 1B3VA 1C8QA 3CHDA 1BG4A 2NT0A 1V6UA 1CEOA 3WF0A 2ZIDA 1ECEA 5JBFA 2DEPA 1WCGA 1UD6A 3AMGA 1TZ7A 2WC4A 3A6OA 4GPNA 4B3KA 1QBBA 1QI4A 3BCFA 3VGFA 1U2YA 2DIEA 4M1RA 3GM8A 2DT2A 1JDCA 3L4YA 2E3ZA 2J79A 1TVNA 4F9JA 2YJQA 5M5DA 2VR4A 3WQ8A 5A8OA 3WEOA 1K6AA 1J18A 2EQDA 3N12A 6CGTA 1H09A 2ZUWA 4TTUA 5E70A 2G3MA 1MWOA 2JF7A 4TOQA 1QNQA 1E9LA 1B0IA 2VOTA 3CZJA 5C8BB 3D3AA 2XWEA 4CD5A 1PBGA 2WM0A 4TXEA 1KWGA 4UFLA 4GKLA 2ZUSA 4JFWA 2PWGA 3A4AA 4MADA 3VILA 5AYIA 1EXPA 1JXKA 1DWIM 2IXVA 1UKQA 3OLEA 4QAWA 2OSYA 4P7RA 1MYRA 2G8ZA 4F66A 1ITXA 3WKZA 2A3BA 1QW8A 8A3HA 4FF5A 1V02E 1W2PA 2D0FA 2D22A 5FD0A 3FXYA 1XCWA 3WBAA 5DF0A 3RM4A 2EEXA 3N18A 3PZTA 4UFMA 4ATDA 1W9XA 3ARSA 2VZOA 3UR8A 1IZJA 3T0AA 3KL0A 5BXPA 4WJXA 3NSMA 1B31A 4IPLA 4DWSB 2DT0A 4IISA 2G4FA 1QI3A 4P8WA 5FL1A 2VX6A 3ZOAA 3SCRA 4M81A 4RE4A 1B2YA 1WDRA 3T2PA 2GFTA 3TTYA 2V3FA 3W37A 1JZ5A 5A6SA 3ALFA 1ZBVA 4OZOA 2A3EA 4JKMA 1LF1A 4C7GA 1GUVA 3K8MA 2WHMA 1WDSA 2AMGA 1B9ZA 1MW0A 2WMIA 4PMNA 5HPOA 2XM2A 1EH9A 5CGMA 3VTRA 2A3CA 1EDQA 1G94A 3TTOA 5JIPA 1LG1A 4AZBA 4KMQA 2EJ1A 3WNOA 3AMCA 1KGXA 3OGRA 5ABFB 3VNZA 3VGEA 2G41A 2VQTA 3ZT7A 4BQ5A 2JE8A 7CGTA 5A3HA 2WB5A 3AS0A 2ZX8A 3UG5A 1GVIA 4AZ5A 1JAEA 4AD2A 1C93A 1X6NA 3KL5A 4UZUA 4HPHA 5JBDA 4WF7A 4Y7EA 3VX0A 1BYCA 2WWCA 4AZHA 3WDHA 1E1FA 3BSGA 2CBJA 2WWDA 1ISZA 4P8VA 5FCZA 4S3KA 3RM8A 3U5UA 3ZIZA 4Z2JA 3WH7A 1BF2A 2DDXA 4ZEPA 3KL3A 1CGUA 2GJXA 3TP4A 3II1A 3VGDA 1U30A 5LA1A 1A3HA 1QBAA 5I3DA 4Z2KA 5ABHA 2WBKA 2XFRA 1VF8A 2X05A 4JZ5A 4CGTA 2WMFA 1EA9C 3CUFA 1V6VA 1QW9A 2XGBA 3WNPA 2GDUA 3IK2A 2AAAA 2V5CA 4JCMA 2WNWA 4HOWA 1EOMA 4AZ6A 3VIIA 3CBWA 1WZLA 1WPCA 4XUYA 4AD5A 4W8AA 2W63A 3WDIA 1WP6A 3U57A 4YPJA 1V3LA 2DH2A 3VGGA 2UY5A 3A4XA 1NP0A 2CPUA 2OWWA 1Q4NX 1DHKA 2GJRA 3AOFA 2J7GA 1DP0A 4HA1A 1UD5A 3AHYA 3LPPA 4AEEA 5EMYA 4P8XA 1UZ1A 3B9DA 2XHYA 4AD3A 3J7HA 5IXEA 1JZ3A 1C3FA 5CGTA 5AYBA 3WH8A 3WIJA 3ZR6A 4V28A 4MDPA 2VCCA 1XYZA 1GOIA 1GHRA 1W9VA 2GK1B 3AZSA 4ZXLA 2WCGA 1VRXA 3BGAA 4D6EA 4GXPA 2VL4A 5LA0A 4W7WA 1V02A 4URIA 1AQHA 1J01A 5HNNA 4DWSD 2XVKA 3AIQA 5I79A 4PMQA 4AMCA 2MANA 3MUAA 1OGBA 4GO9A 1V3HA 3SCQA 4WSKA 3WDJA 2W4XA 3VM5A 1DWGM 3WQVA 1MW1A 2O92A 3OZPA 8CGTA 3W0KA 3MKKA 2YDSA 4W7VA 1EIBA 2C8NA 3O2LA 1VJSA 1CXLA 2XVGA 1NWUA 3FAWA 1UOKA 2AOSA 4ACZA 2W92A 4H04A 4HZ6A 3T0DA 2PI6A 5D9PA 3ARWA 4ZENA 2J8FA 2DIJA 4ZFMA 1UWSA 2PWHA 2W67A 4F8XA 1UKSA 1CGTA 2WMGA 3GTNA 4MAZA 1QI0A 1AMYA 4DWSC 4RE3A 1XH2A 1VEPA 2E0PA 4FMVA 1SYTA 4ACYA 4P7LA 5AC5A 1XHGA 2W5FA 2GDVA 2W62A 2ZOXA 3MO4A 4JFTA 1EQPA 1GQKA 3PZNA 1J10A 2F2HA 3IAPA 3M07A 3WUGA 3GZAA 2BVTA 4UQEA 3FHQA 1OGGA 2EPLX 1M01A 1NARA 2EXOA 1ODUA 1UZ4A 1VFFA 1US2A 4OIFA 3WD4A 1GJUA 4PMUA 3WD3A 1BVNP 1EOKA 4KH2A 2WVVB 1BGGA 3AS3A 3EDFA 3SCNA 2VNCA 4D6FA 4QLKA 1E15A 2XFFA 1HN1A 1R8LA 2FGLA 4OOUA 1VIWA 3OLGA 5DT7A 1MQRA 1E6PA 3VDCA 4J3UA 1ISXA 3AFBA 2FHFA 4QP0A 1CGWA 1LWHA 4D6HA 5A2CA 1Q6EA 2PWEA 6TAAA 2G3IA 3WEMA 3BAKA 1HKKA 1CXIA 3WD2A 4LYPA 3SCUA 5A8QA 3I3BA 2WANA 1TE1A 4JFVA 4J3VA 4J3WA 2A3AA 1I1XA 2YL6A 3CZ8A 1E5JA 4P7NA 5BXRA 3E1F1 1GOMA 2QV4A 4JHZA 4UFHA 3QHMA 4H8UA 4W5ZA 3WNNA 1UD4A 2WZEA 1HF6A 2BFGA 1OGSA 5E6ZA 4EK7A 3K8KA 4OUEA 3VM7A 3N17A 3VIGA 3VNYA 1QVBA 2NT1A 2YDRA 2DSUA 4JAWA 1B3YA 3QGVA 1OCQA 2UWFA 2WMJA 5HBFA 1E43A 4CCEA 1OD0A 2XIBA 2CYGA 4JFSA 3EBVA 4BQ2A 3DHUA 3PZOA 2XG9A 4H8HA 2WVTA 4GQQA 1V08A 1R85A 2JIWA 1R7OA 1FA2A 1KCKA 2XVPA 4PCTA 2J75A 1R86A 4Q22A 1VENA 2XJ7A 3OZOA 1BAGA 1FHDA 2Y8KA
chains in the Genus database with same CATH superfamily
4PCSA 4NNAA 2PWVA 1LQ0A 2DGAA 4HHPA 4JOMA 3WBYA 1F73A 1IYXA 1TPB1 2E1DA 4IL2A 4GUGA 1G9HA 2BODX 2OKTA 2YXXA 3SN1A 1E1EA 3WQPA 1HGWA 2J27A 2IKIA 2V6AA 5REQA 3T0BA 5HULA 3PZIA 1PWLA 7ENLA 4Q8UA 1CCWB 3UCCA 4CQBA 3NPUA 2QEZA 1UH3A 4BCEA 2WYSA 4ZZ9A 3HQ1A 4V15A 5HDRA 1EDGA 3SQMA 3C2RA 2J7FA 1TMLA 3WG6A 2DZBA 3W2LA 4FIRA 2D3LA 4X9YA 3HV8A 4JKKA 5HINA 1ML1A 2Y8VA 2X0YA 1UR2A 2OYLA 4A3HA 4XD3A 1F4AA 3KOYA 4NL1A 1FWIC 3L12A 3ARVA 4HZ7A 4NZ4A 4MB3A 4KCWA 1HL9A 1XJBA 4B3LA 1WBHA 3CL6A 1KFWA 4PBFA 4WSHA 4UMAA 4Z17A 1ZJIA 1V0MA 2XIMA 4JQ3A 4OV9A 2YZ5A 3N9SA 3BLDA 4DJFC 2BP1A 3I3DA 4D6GA 4LCSA 3LI0A 3QMRA 2O7QA 2OEJA 3DHPA 1ZBCA 4I7WA 3EMZA 3UZXA 2BVDA 3W87A 2Z0IA 4W85A 4UFJA 2P1FA 2O55A 3NXFA 4Q32A 1FY6A 1QOPA 2F6UA 4H6KA 5A6KA 1KRAC 2XU2A 3EPMA 4GI6A 3KCLA 1YBQB 3NQMA 3FN9A 4E3TA 1JFXA 4TX8A 2J7CA 1Y0EA 2OWCA 1KM3A 2QPXA 3VUPA 3ZQ9A 4DF2A 4FLRA 4DXKA 3UWQA 4BA0A 4PFHA 2ZXBA 5A2AA 2E40A 4DI8A 1VCFA 2HVMA 1S38A 3SZ8A 3MUZ1 3T2QA 4N02A 3WL1A 1OX4A 4GE8A 5HOSA 1S2AA 1UZHA 2OELA 4O28A 1KRCC 1UR3M 4QE4A 1RXOB 1FP9A 4WSJA 4XWUA 1VHNA 3QY8A 1ICQA 3T0CA 4IUGA 1FWGC 1IV8A 1O1ZA 4Q4QA 3WNMA 1T8XA 2F38A 2FGZA 1OFAA 2ZADA 1M04A 5CBBA 7A3HA 4O17A 4XSMA 3UG4A 4H83A 3KLLA 1BTCA 3F4WA 3O6AA 2ZWZA 4JX4A 4NKCA 4KGJA 3E12A 1VBRA 2Y7EA 3DG6A 1EF2A 3T4CA 2ASHA 5H8UA 3QOKA 2PBOA 4LGXA 2CBUA 3PTKA 3KWSA 3DENA 3NPVA 1YRRA 4N42A 3I6TA 3MMWA 1UC4A 3W7DA 4Q8TA 1THFD 3C2OA 4FXSA 3PTMA 1T99A 2PFHA 2PWDA 3E49A 3B9NA 4LCQA 5HWJA 1J0YA 4PTMA 4QXIA 3VUSA 4IUOA 1E6NA 1JNDA 1EX1A 1YNPA 1SQ7A 1OC6A 1RY0A 4GQRA 4AC1X 1S5VA 1UMYA 2VC9A 3PJWA 5LGXA 4N9DA 1YTKA 4XB3A 1FWSA 1PIFA 3R13A 4E8GA 5JIWA 2Z2BA 3CUJA 1YPFA 4GG9A 1FWEC 3AXIA 5F2IA 1ISYA 3KWXA 1X38A 1EL3A 4K8HA 1B3ZA 4WDWA 1QDSA 3LDVA 1TWZA 3S1XA 3XISA 1H61A 1TR1A 2FFIA 3T55A 3SJNA 4AZIA 3ZM8A 5D2YA 4XUGA 3DFSA 5J5RA 3CV2A 4AUBA 4L7ZA 2V5KA 2QGYA 4PMYA 3W7HA 3HQNA 2DVUA 1E72M 1GZJA 2DZPA 4MWAD 4GI9A 3N25A 3B4YA 3JW7A 1EP3A 4L1XA 4ROQA 1GKPA 3GX9A 1AQ0A 1FFRA 1W54A 3B97A 4M82A 3WQDA 2PDUA 5EYWA 3W1RA 3VD5A 2F6XA 5BU9A 4TTGA 3WQ6A 3CHFA 1R47A 4TVDA 4CN6A 1M5WA 3PB0A 4ONVA 4PTXA 1F3TA 1GNXA 3WF2A 4YVPA 3WMSA 1CPUA 3LV5A 2E6FA 4S3FA 5I3KA 4PUWA 2YDQA 2R9RA 3FJNA 3PZMA 3VIJA 5G1YA 1Q2SA 2ZRWA 4PCNA 1E1CA 4EOUA 4I6KA 2DP3A 4GLEA 4C60A 5I2UA 2QJNA 1YE4A 4TUFA 1RPKA 5DQPA 3VABA 1NWRA 1NU5A 3CPUA 4MKNA 3W29A 4AEFA 2PF8A 1IR1A 2QCNA 4OGZA 3M0MA 3AHTA 4AY7A 3OA3A 4H2CA 5LHEA 3MUY1 3RAOA 3R4IA 2VO5A 3M0VA 4XV0A 3IJLA 4E8CA 4E8DA 1LBMA 1L6GA 2WPGA 4K68A 3BLIA 3IUIA 4UTFA 3LM7A 5CC6A 4IMEA 1MQQA 5EGRA 1Y65A 3VZZA 3GNRA 3UVAA 4KETA 4EAYA 1X1NA 1QNRA 3PVFA 4DUOA 3P67A 1E71M 1ME7A 3OB8A 3G1XA 4RZBA 1WO2A 4OOZA 1VS1A 3M0KA 2I5GA 2D2HA 3R79A 3HJZA 3BQ5A 4D6CA 3M46A 3DAQA 4LSBA 1HP5A 3ZO9A 1X97A 3VNIA 1A0CA 3M1ZA 3CT2A 3SCWA 4I9TA 2IMRA 4KWWA 2A4AA 2FDMA 3GTIA 5DBUA 3GXMA 3JUGA 4ZCWA 2BASA 3FLUA 2OSXA 3M4HA 3LG3A 5AFDA 3AC0A 1DTNA 3WUFA 3U6WA 3SN0A 2GVYA 4J27A 1P4CA 1HJWA 3QR0A 4IIBA 2DSZA 1J2BA 3G1HA 3E2QA 3N1AA 1R3WA 4HTYA 2GJPA 2PDNA 3MP5A 3R6IA 2XISA 3SGUA 4MTVA 2DFAA 4DY1A 3TOYA 2E09A 3IRSA 2VUYA 3N9KA 1JYVA 1YE6A 4F0HA 1GZGA 2PTXA 3UG8A 4L9YA 3B0VC 1HL8A 2I57A 3BLFA 1XDJA 5CXPA 3TLQA 3IJ8A 3FFSA 7REQB 4AXNA 5D30A 3DFOA 1PTGA 4NI3A 3NQBA 2Z1KA 1KFJA 4I5UA 1HW6A 3YPIA 4KIRA 1NY1A 1IE7C 3NG3A 4PMJA 4JR5A 2YXGA 4DBEA 4U5KA 2MNRA 3W2NA 3TJIA 3NOYA 3E3HA 4LUYA 5BOOA 2VFEA 1RK6A 3SIZA 4CQ8A 1XL9A 1FCVA 4JN8A 4B5TA 3T08A 1FWJC 1H7NA 3MV01 3FXGA 4HMEA 3AUJA 3BMVA 2GJLA 1KQYA 5HANA 4BF9A 5C54A 1RR2A 2WJFA 4QLLA 3TKFA 4A8IA 4O1EA 2OLAA 2EPOA 2I9UA 1OF6A 1AW2A 1NP2A 1JCJA 3FNDA 3T07A 2PCQA 4IP4A 3DH7A 3AIEA 4OHQA 4TMCA 4D6IA 4HA4A 3VKDA 5E93A 3LGGA 3QPEA 4DJDD 3A3XA 3MPGA 3GHSA 1DXIA 2HEJA 5AVHA 3FAXA 1IXNA 4RZ4A 4O8AA 1S3HA 1F7BA 4K1GA 1MW3A 3O15A 3VD9A 4ZQNA 1K77A 4PL1A 4XX6A 3KW3A 5K9DA 2CESA 3DOPA 3I65A 4GKTA 3CWHA 4LS2A 3WF1A 3WY1A 1CDGA 1H51A 4M56A 4ZL1A 1TCMA 1XKJA 4XBSA 5BRBA 2NXIA 2DH3A 2A7PA 5D09A 4E5TA 1UCWA 3TQ0A 2XDFA 3TJ4A 3GH4A 3TTQA 2YX0A 4IJCA 2WJEA 1VYRA 1W1A1 1Q6LA 4CEUC 3VMOA 1V03A 4UTTA 1V6XA 1UA3A 3TW7A 1BXCA 3M0HA 1TVLA 1V3JA 2O9TA 5BRPA 2G50A 4PRRA 3VKBA 5FF7A 2QULA 4I9MA 1PKMA 3NQGA 3CASA 3MQTA 2V3GA 4GIAA 5LIUX 2WHLA 4FI4A 3S3GA 4AW7A 4TX6A 3UR7A 4LAUA 2POTA 3RUBL 3WNLA 3W82A 3UESA 4IH3A 4DQWA 1YDOA 2Y88A 3RR1A 3P8JA 2JEPA 2Q3OA 4XZ9A 4B4HA 2JBMA 1EWDA 4MNMA 3TCEA 1PEZA 3U9IA 2JGQA 2BY1A 1DIKA 2QCHA 3GHUA 5L6UA 4GO8A 4B5VA 1J8VA 1HJXA 2CNCA 2VX5A 1S1PA 2OZTA 1DJXA 3SCSA 1EPXA 1EHAA 4CD4A 2RAGA 3AU6A 5ENLA 3UWYA 3AALA 3QLDA 1JF6A 3LCIA 2BDQA 2YR1A 4LUSA 4EWND 3TYDA 1A5OC 3BCJA 1XBXA 1S3TC 4XTIA 4QX4A 3V0SA 1QK0A 4V1YA 2QMJA 2RUSA 2C79A 4X9SA 3RPMA 4QJ1A 4J5NA 1HKMA 2ZZ7A 3H2NA 5G1MA 3P14A 1XWYA 1W3HA 4NZ5A 5DCBA 3LXBA 1OFOA 3BURA 2NXGA 3IIOA 3NVDA 2JF6A 1SMAA 5LNVA 4B2DD 3SUVA 3HV9A 2GUUA 3Q4DA 4O50A 1YHTA 2JGYA 4BWLA 5T91A 1EZWA 3S5SA 5I77A 2QT3A 4UFIA 2YBUA 1Z41A 2Y89A 8RUCA 1G1YA 3IUDA 4FALA 1TRDA 4PB3A 4JGDA 5BNKA 1BYAA 1HIZA 5XIAA 5F1UA 1OZQA 4MWAA 4G8TA 5LNRA 4M6QA 1CLVA 1CYGA 4KWOA 3W24A 4HNCA 2AQWA 5DT5A 3WQ4A 3QM3A 2R14A 2POZA 3C3NA 1R9YA 1TTJA 3VDBA 3GAKA 4LUIA 1EJWC 2YZRA 2I5IA 3NYZA 1K03A 5I06A 4GOAA 3FJLA 1W3NA 1XG4A 4BQ3A 2G37A 2PP0A 3W70A 3H55A 1SJAA 5DXYA 2YA0A 4JYEA 5EU9A 3WUEA 4MLRA 4BZYA 4IZGA 4BK9A 1NM9A 3DFTA 2UV8G 1ZJAA 2YLLA 2PDQA 2P0OA 1YPXA 3B8TA 2RGMA 3MBDA 3SEPA 1CXKA 3WQCA 4PSPA 3IV3A 2O9RA 5HMEA 1VH7A 5BXSA 3AMDA 3CAKA 4Q33A 2Y63A 1G7UA 4LUTB 3AIVA 1EC9A 1P6WA 2X2GA 1EXBA 5K9XA 3BG5A 1UQYA 5K7JA 2OYKA 1TPDA 2EHHA 3W7GA 3HQPA 4LNCA 3GW0A 2XM1A 4JNMA 3GO2A 3QF0A 2OWXA 1FP8A 3MI2A 2FZBA 4LF2A 3UGVA 4HYWA 4J35A 1E0XA 3URBA 1LLOA 1TIMA 1RA5A 2YCKX 5F4WA 4JTHA 2OQYA 4LX4A 1GVSA 2YYTA 2GQ8A 3KZSA 1ZNNA 1SUXA 5FIPA 2NLYA 5FL0A 1JI1A 1UJPA 2WBGA 1LDCA 4K6AA 2HK0A 3B06A 1MZRA 4GX8A 1FWBC 1B4KA 2R24A 3BZJA 4XAGA 2VDIA 4NSBA 4MZ1A 4GNVA 3M6YA 3VFCA 1RY8A 5TD4A 3LGDA 3KS5A 3H4WA 3VGBA 5T8GA 3VOCA 4E2OA 4OBSA 4JTAA 3AHZA 3VIPA 1TVPA 3S9YA 2H90A 2E4TA 2JKAA 2ZUVA 4GK8A 1HTIA 1E0VA 1OM0A 3N11A 4OUIA 4GHRA 5FJIA 1GYLA 2CLFA 3W26A 1I60A 3QQWA 4RXGA 1G6CA 5H6HA 3W53A 3AIBA 2NQZA 1HKJA 3LTPA 1JCTA 1V5XA 1CX9A 1V51A 4ZTXA 4MB5A 3H7UA 2ZZ4A 3QRHA 2Y0FA 1U5JA 3L5MA 3WD0A 3KRUA 3BANA 2X1RA 1J5TA 1OG0A 3CO4A 4KBXA 3DKLA 3RIKA 1GOQA 4IG2B 3EOOA 4W9TA 1S2TA 3R8HA 1K9FA 4X60A 4Y2WA 2PD9A 2ZXDA 2OEKA 4MM1A 4UOQA 3BSMA 5IDZA 4IXHA 1HJSA 1UJQA 3TC6A 1BG9A 3OIXA 3OVPA 2Z1VA 1O1HA 1RCQA 2QCLA 1LORA 1XICA 3CPRA 1QI5A 4JX5A 2HE5A 1JR1A 1NWTA 1TG7A 3EPNA 4G1NA 2G3JA 3SM0A 4AZCA 3NM3A 1VFLA 2PDIA 4DF0A 2XH7A 1JYXA 5EFDA 3V5FA 4GXWA 4K8EA 3RLUA 3BW2A 5EFFA 2HPIA 1CT5A 3BJTA 2CZVA 4MUZA 2QDHA 2PLCA 5CJ5A 3R8GA 4LBSA 3W02A 3GH5A 1QAPA 4HN4A 4WIWA 1E6RA 3E74A 3V3WA 3DN5A 3N2BA 1JDAA 1VFUA 3G6LA 2I9EA 4GIRA 1UR1A 5DO8A 4L9ZA 1OCBA 4RK8A 3C2FA 3QYQA 1JUKA 5CZTA 1GPWA 1FKXA 2BX7A 4ZBCA 3SUTA 4CNSA 3MO7A 4K38A 2INFA 4NRRA 1Q7QA 1VEOA 5A8PA 3L23A 3GZ3A 4ECLA 5I7GA 1R3RA 2JEQA 4HA3A 2O4MA 4O19A 4JL1A 4DJDA 4D72A 3L2MA 1CECA 1UH2A 4WDUA 2WKLA 1SZEA 4PC8A 1B3WA 4AEOA 4IJBA 3WMCA 1CGYA 1C29A 5M17A 3EOLA 2NW0A 1PX8A 3VCNA 4UXDA 3QKZA 5CPSA 2JFEX 4TV6A 4PH6A 1J93A 2PU0A 3P84A 1VP5A 4S3EA 4I9JA 4KS0A 5AZ0A 2PE4A 3CPGA 1OB0A 3N4AA 4JDYA 2QMKA 1JQXA 2E25A 4CNOA 5LHFA 3HB9A 4IFKB 4I8YA 3THDA 2BY0A 3TYBA 1JD7A 2ISFA 4H4IA 4AX7A 3FSUA 2GWNA 1WUEA 4PFMA 2C0HA 3B9AA 1TPWA 1AODA 4S3JA 2VVNA 4Q4PA 4JFUA 1W2VA 1KM2A 4L4LA 1EHNA 4OECA 1MEIA 2OX1A 1PCWA 3LPOA 3EDJA 5A8GA 1EBHA 1XISA 4H9YA 3RX2A 5IFTA 4MKSA 1JUBA 4FNTA 4Y6GA 3R94A 4X61A 4PMDA 3AXHA 2OT0A 1PVNA 4HCDA 3WBXA 4E3VA 5AECA 3QMTA 3CHDA 3FS2A 3ME3A 3IVSA 3CMFA 1YXDA 3TQKA 1CEOA 4LT9A 1G4SA 1ECEA 3T78A 3W7NA 8XIMA 1FDJA 2QVHA 1WCGA 2J9ZA 3DG3A 1TZ7A 4S3GA 4QEHA 5CC3A 5HJLA 3CUZA 2GJNA 1WX0A 3M44A 3N2TA 3GG7A 2DIEA 4M1RA 3CAVA 1V79A 4E2BA 3V18A 3W71A 4AH7A 2YCEA 5A8OA 5KITA 1TPVA 1IR2A 5HK4A 5TBOA 1H09A 3C8NA 3UY8A 2G3MA 2JF7A 4MIMA 4R3UA 3T8LA 1UP3A 4TXEA 3ONBA 3Q58A 4GUIA 4XKYB 2I16A 2FPTA 1GT8A 4UNKA 2PWGA 4Q4KA 4MADA 4R7JA 5AYIA 1SFLA 2I7GA 3HZ3A 2IXVA 4JXCA 1PXGA 1A49A 1KKOA 3NVTA 2IQ0A 3BJSA 1ITXA 2D2GA 4Q8MA 4FF5A 1V02E 3E0LA 1DXFA 4HHHA 2D0FA 2D22A 2Z4GA 5FD0A 3H4GA 2P8BA 5DF0A 1ADDA 3RM4A 4B2DA 3V35A 2D69A 3I4KA 1JCLA 1B31A 3ONCA 2RKXA 2FPVA 1R46A 2VC6A 1EP1A 4Q7IA 2G4FA 4P8WA 2VX6A 3ZOAA 5DMLA 4UTJA 2NV2A 3WCZA 4BEQA 4GYPC 4GGHA 1GVRA 2A3EA 3LY0A 4JKMA 2OZ0A 2PDWA 1GUVA 1ZFJA 1I9CB 2Y5SA 3UJSA 2XM2A 3EOEA 1Q6OA 1G94A 4JTEA 2A21A 2QCEA 1R3VA 1LG1A 2Y1HA 3CQ0A 5JIPA 4RDZA 4NYYA 3AMCA 4NYUA 4E0CA 3EB4A 3VGEA 1GWJA 1P1XA 4HTBA 1Q8JA 4UTUA 2G41A 4MYAA 2VQTA 4WGXA 3ABRA 5GVJA 1TX0A 1VBGA 2JE8A 2ZX8A 3APYA 1GVIA 3R5EA 3NZQA 1E1FA 3C2VA 2CBJA 2WWDA 3L0NA 4G7FA 4Z1BA 4S3KA 1GKRA 3U5UA 4F2UA 4ZEPA 3UZZA 1ZY9A 3L65A 1HZYA 3QTGA 2J66A 4GZ7A 2VD9A 2WPBA 4S3BA 2WZTA 2QZRA 1PE1A 1W5NA 2DZWA 1O95A 4GNJA 3OZMA 1QBAA 2F2KA 3MB9A 1U1HA 2GLKA 1J5SA 2BBFA 4A8RA 5G2IA 3CUFA 2RHGA 2XGBA 2V5CA 2WNWA 4IMGA 3KP0A 1F07A 3M0LA 3Q94A 1WZLA 1ONRA 2FVKA 3G3DA 4XUYA 1J4EA 4Y90A 3G1AA 2UY5A 1NP0A 4Q8OA 1Q4NX 3GDKA 3AOFA 2J7GA 3TTEA 3IEBA 4HA1A 1UD5A 3LPPA 4AEEA 2Z6IA 4NAEB 1UZ1A 2OQLA 2FZ8A 2IPWA 3J7HA 1JZ3A 4F0RA 1C3FA 3DI0A 3WIJA 1QUMA 1KLYA 4MDPA 3B8VA 3HPZA 3V5OA 1L9WA 1XYZA 3EKLA 4NZJA 5CZSA 1DQWA 2GK1B 2P50A 3M5YA 3RGTA 1R0MA 3LUTA 2VDGA 4D6EA 3TH6A 5LA0A 3EGJA 1S5TA 2QUVA 3E5PA 3W7QA 2BOEX 1TIWA 3T4WA 5AHIA 1SJCA 5HNNA 4DWSD 5I79A 3KP1A 2RDXA 3UWWA 3EPOA 3MUAA 5T26A 1V3HA 3KVJA 1TPH1 2W4XA 2ZE3A 3WLRA 1M7PA 3TYEA 1DWGM 3W3OA 1BXNA 2YDSA 4BJHA 1P7TA 3O0FA 3OU8A 2PDFA 4HJWA 2H9AA 4MZ8A 3BL3A 4GH3A 2GUBA 1NWUA 4ZQMA 3KTXA 4NX5A 2OOGA 3ARWA 1DE5A 2DIJA 1EIXA 1UWSA 1PUDA 1TR9A 1G4PA 4JN6A 4C5ZA 3THQA 1KA9F 2HJPA 1XIMA 2AKZA 1KRBC 1FDZA 4FMVA 4C65A 2WZMA 1R3QA 3BW4A 2I5QA 4P7LA 2W5FA 2W62A 4H9ZA 3EB3A 1M6JA 4I3GA 1EQPA 1J10A 3STPA 1X1OA 4UQEA 2NQ9A 3JR2A 1KFBA 1EP2A 1DIDA 2EXOA 3P62A 4FNRA 1VFFA 2PRLA 1US2A 3WD4A 1GJUA 4PMUA 3WD3A 2FFCA 1BVNP 4HIBA 1EOKA 2WVVB 3EDFA 3VC5A 4QLKA 3NTYA 2TODA 1HN1A 1POKA 2FGLA 3OLGA 3B9OA 2VGIA 1MQRA 3GDMA 1ISXA 3S42A 4GY0A 3B8UA 4JTUA 5MKGA 1XYLA 3PUOA 1O12A 3ZLFA 4D6HA 2W3ZA 3M0YA 2PWEA 2PD5A 4HYVA 3WD2A 2OZ8A 2VEIA 4J3VA 3LNMA 1F3WA 2J88A 5BXRA 3D6NA 2QV4A 4W5ZA 4YCPA 3WNNA 4S2BA 2WZEA 3K2GA 1HF6A 3P80A 2WJDA 3VM7A 3N17A 1RBOB 4Y9OA 1OCQA 4JYFA 2HWGA 5H8PA 2WMJA 5HBFA 2YFOA 4CCZA 4O4WA 1OD0A 2NZLA 4CQ9A 1AW1A 4JFSA 3TV8A 2Y70A 4WY0B 2DVTA 1TPC1 4QDPA 1KCKA 2FZMA 2MUCA 2XVPA 4HKPA 4Q22A 4ORIA 2CWXA 1WA3A 3UA3A 1FWTA 1HO4A 1P48A 3ES8A 4K36A 2C6QA 1TJ0A 1H60A 5K3VA 2D0HA 1Y5VA 2E1WA 1XI3A 3CJPA 3AIUA 4Y8EA 3EKZA 4HMCA 4YXGA 1H50A 4IOTA 3PBMA 2ZXAA 4M80A 4PR4A 2O4QA 2ZC8A 4TR9A 4U31A 5DBTA 2YYUA 1QHZA 2WXDM 1R6WA 3M5XA 1WDDA 3R0DA 1V93A 1PB0A 4FLSA 2HNEA 1JFHA 3W1NA 3B8DA 5C2GA 4R33A 1GYNA 3IV8A 1W32A 3WDRA 5A6BA 1UWIA 3AHVA 4UR8A 4U2YA 1E3XA 1PJ9A 3P0WA 2EO7A 1OFDA 2GUYA 3KDOA 2FTYA 1DJQA 3G6MA 4DJEA 2E9LA 1ISVA 1GQIA 4AD4A 1MMFA 4FK9A 4U2ZA 1VBUA 4NZ3A 1P5BA 3W9ZA 3UXKA 3SB0A 3PBGA 3M64A 3NL5A 1O94A 1XIGA 1EUAA 3LERA 3ARUA 3BZGA 3NDOA 3ERPA 1IXQA 4XD6A 2VT0A 1BSIA 3L0KA 1A3XA 5IBXA 1KD0A 3N4FA 2CW6A 4ZOBA 3URAA 4EKJA 1W17A 3L67A 1W91A 3STCA 5AN7A 3PZ9A 2YPIA 1EGZA 5HWMA 4BI6A 4X22A 2JALA 3EXRA 4XZHA 1S1RA 4WLCA 3W84A 3KVKA 4UWMA 4EPKA 3N6HA 3WJYA 2VJXA 1GOOA 1UR0A 2ABBA 3R1ZA 3A47A 1ICPA 2EAWA 3Q45A 3A12A 2ZICA 4M19A 1KXVA 1LL7A 5JBEA 2GQ9A 1JYNA 4UQBA 1XRTA 3CC1A 3BLKA 2TSYA 1JF5A 1NOWA 4NAFA 4H01A 2NVDA 1NFPA 5D38A 1H7XA 4GBUA 1W37A 1WDWA 4LC6A 3O05A 1OT2A 3GG1A 3GUWA 4ML4A 4H6EA 4DAFA 2EF9A 1FWWA 3BLPX 4FZIA 4X2RA 1VFOA 1M41A 3OHMB 5EMLA 3WJZA 3T81A 5IFPA 2O0TA 2CLHA 3HPAA 3BC9A 3CUGA 3M5ZA 3BAWA 4CNTA 4Z2IA 2R91A 3A64A 4RXFA 3CL8A 5AC6A 3ZVHA 1XBYA 5E0FA 2H6RA 1AQMA 4RNIA 1X7IA 2BVYA 2OLHA 5CG0A 2IS7A 4EANA 2Z7GA 2BOGX 5T9CE 4KRTA 3W4RA 3M0ZA 2CU0A 4ZE4A 5A2BA 4AMAA 3UZYA 4UQDA 3O07A 3KFTA 1U5VA 3S47A 9CGTA 1JZ8A 3CK5A 3LN3A 2A6NA 1JEZA 3IIZA 3O7UA 2R8WA 5CGQA 3OA5A 4HB7A 1RPXA 1LBLA 4UOZA 3ABXA 3VXGA 1H0GA 1ONEA 2ISWA 4N9EA 1NEYA 2AL2B 3AIWA 3H23A 3IVUA 1DIOA 1HVXA 3E2RA 3LLXA 2DW6A 2DZXA 3C2EA 2BS9A 4ZQCA 2EG8A 2CKSA 1P6BA 4UMCA 5A6TC 1AH0A 2YCIX 4V1XA 1CXFA 3S46A 3EZ4A 4I8DA 2DSVA 4H9TA 4CU7A 1J12A 1XS2A 5FEZA 5E1QA 2V5DA 3WQOA 3RN6A 2B4GA 3PSWA 4NP7A 3NQEA 3ARTA 3BUVA 3QZ6A 2D24A 3A5FA 1KM0A 4YTTA 4ZO7A 2AMXA 4HQVA 5ECVA 4LYRA 1SZRA 3D5HA 1IEXA 1RHCA 2E7FA 5CPMA 2VCBA 3S1WA 4CVUA 1ZGDA 1XDMA 3E9AA 4D6JA 4R7OA 2GL5A 1K1DA 1XLGA 3NSNA 4OTKA 2WCSA 1XINA 3PZGA 4MB1A 3W7EA 3RMEA 3XIMA 3FA5A 1QFEA 1LTDA 1TV4A 2BHYA 1E73M 5E0CA 4DWSA 2BXVA 4QJ5B 3SRFA 2OGJA 1ZRQA 1U22A 3BGGA 3V1HA 1AA1B 3KZPA 3USBA 3S6TA 5AC7A 1TX2A 4FX7A 5T9BG 3EWWA 5DEZA 2PA6A 3ARYA 1RJQA 4A6GA 4MWAC 3I7SA 4CN4A 3L4WA 4M6PA 4GX9A 3LPFA 1DEDA 2HPMA 2V5BA 3AXXA 5KTLA 1SMDA 1I2OA 5ABFA 3ZXWA 2VI0A 4DPPA 1KR1A 3PUGA 3S2JA 1V7YA 4L1GA 3V0UA 3BOLA 3BMWA 2QW5A 3TR2A 1NJJA 4GD0A 2AKMA 2PAJA 4JX6A 2E5BA 4JTKA 1XLFA 4J3TA 3HN3A 2D23A 5A6AA 5KZ6A 3W28A 3B0XA 5D03A 3N13A 2Y2WA 4POCA 4JNYA 5M03A 3TK7A 2INEA 5CBIA 2VYOA 4UB9A 5I24A 2DSWA 1FWRA 2BGSA 3ZJ6A 2X0HA 2C7FA 2X09A 1WBJA 2X2YA 3QV8A 2QIWA 4MNJA 2XZ7A 3K30A 7PTDA 2HXTA 4ML9A 4UQ9A 4NNBA 3AS2A 4C6LA 3NQAA 4JIRA 3BG3A 3QHOA 1RH9A 2X1SA 2CETA 1WV2A 3SGGA 1OFBA 2CLOA 3G1YA 3VZYA 1MEWA 3VA8A 4UNIA 2J78A 4LVAA 5U7SA 1MEHA 4HJFA 4LANA 1RUSA 4HU8A 4H6RA 2J7BA 1RAKA 4PMOA 1JDEA 5E6YA 5C7HA 2PDPA 3R43A 1F5ZA 3CIXA 3P8IA 3GDLA 4KWUA 1BKHA 1FWAC 1XW8A 1L8PA 1BVWA 1M9HA 3DECA 3PAJA 4YNGA 2E9MA 1JJKA 5I0DA 3GIYA 1EKOA 2GVLA 5AOUA 1Q45A 1Z48A 3SUSA 3UJFA 4X3ZA 1SO3A 2REQB 4JHOA 3OTRA 3VU2A 2OZ3A 1VB9A 1SU5A 1XYFA 3QHNA 2NUWA 3BCDA 3HFTA 4IQEA 2WQPA 4J4KA 5DY2A 1A5CA 2QPSA 4K7YA 3CB8A 1A5BA 1KGWA 4RUBA 1J79A 1YX1A 5A8NA 3LSCA 1MDRA 2J7HA 4CN1A 5D4YA 3RYSA 3KOXA 1JUEA 3EWDA 1LJYA 4FPSA 4WUIA 4WQ6A 2YA2A 4R53A 1XQKA 3FYPA 4US6A 4OVXA 1O6IA 5BCAA 1EEPA 4MGGA 2OODA 4XO7A 4YVVA 1B90A 1JDDA 4EP8C 1T6MA 1QRQA 3U4FA 1QNOA 3VOHA 1VKFA 4S38A 3ZZ1A 4MFEA 1WXZA 1XP3A 3NQ7A 3P5YA 4LNYA 3VZXA 3PS7A 1X6LA 3N15A 5D8WA 2HMCA 4H8VA 2B31A 4PUJA 1XKYA 3BW3A 4CD7A 4ZE5A 2VFDA 4LY8A 2VEMA 3CYVA 3KOZA 3S5YA 4O57A 1OWQA 1KO0A 4WJ8A 1SJDA 1NOFA 1SSDA 3W72A 4JKLA 3SGZA 1PZ2A 1S2WA 3TJLA 1C8YA 1ZBKA 4KW2A 2D2OA 1ZP3A 1KM5A 2XN2A 1W1ZA 3RJYA 3W7LA 3MSYA 1H11A 1A47A 1GOKA 2XZ9A 5XINA 8TIMA 2EGZA 1D3CA 4JTLA 2ACSA 1L8NA 1V6WA 4DJFD 3DFPA 3U0HA 1UD3A 4DNMA 3HGJA 2WZIA 4R7WA 2IKGA 4FAMA 5GJNA 1L2QA 4M51A 5HMSA 3SQSA 1TV8A 3GBEA 1G0CA 4YYFA 3GG0A 4QCFA 2X8RA 1X6UA 1LL4A 1CWYA 4AHPA 3N04A 2J6VA 3GS6A 2BY3A 3TX9A 3W38A 3AYTA 1KR0A 5EB8A 3OYXA 4LAOA 3RLHA 1E4MM 4MDOA 3G1SA 3RXZA 4B9YA 1LYXA 1YNYA 5DY3A 4K2SA 1OBAA 5BXTA 1V0LA 2Z25A 2CXEA 1RZMA 5A69A 1U1JA 4HCLA 5HUOA 1J11A 3MSDA 2WMIB 1UB3A 1JZ6A 2YFNA 2V69A 3GXDA 4DJDC 3GH7A 1HP4A 2QDDA 4HGXA 1FH9A 3M41A 3S6DA 3UNTA 1FTXA 3RG6A 1Z9AA 1AD4A 4X0NA 4E4UA 2YBTA 2RJGA 5C0QA 4U33A 1UUMA 3NCOA 4JBRA 2XINA 1H0IA 5C70A 2BHZA 4AHQA 5CJMA 1KXHA 3TCSA 4UCFA 4LVGA 4PULA 2JKEA 3GFZA 2WKGA 4ALDA 3G18A 4DM2A 2BZNA 3P2VA 3KVMA 4AWSA 1B54A 1UR9A 9XIAA 3ZWTA 1IWBA 1YADA 4RNHA 3C6CA 3BG9A 2CWNA 1W1IE 2GJXB 1JL8A 4R34A 1A5MC 3PPCA 5JUVA 4G7EA 2VFFA 2V5JA 3OOQA 2KAUC 3IRDA 3R7MA 4H3DA 4D71A 3RJXA 5FJJA 4QGCA 3GFXA 3VINA 3MZ2A 2GPTA 1KWKA 3G3MA 1I2QA 4QRNA 5G2WA 3AICA 1XYAA 3FVMA 3NFUA 1YEYA 3HIJA 4C6FA 4LY4A 3H2MA 4AIEA 3W85A 1A5LC 3M7SA 4W89A 1WXYA 3OVQA 3BXWA 4PEKA 1VJZA 1PL9A 4GFSA 1OG6A 4YHEA 4LBUA 3H2FA 4ERAA 3QSTA 5BOEA 4G2DA 2R1MA 3CV7A 2Q02A 4MLJA 5I5RA 3M0XA 1JZ2A 2TAAA 3ARRA 3EA2A 4IGMA 5CBJA 4DX3A 5LXXA 5CSYA 4JTIA 3WBEA 3W00A 3CMJA 3DDMA 1H2JA 3B40A 3QY6A 3W2JA 4AF0A 1JNEA 3U2EA 1VFSA 4GABA 4S23A 3NGJA 1B30A 4ZVJA 5GNXA 3TFCA 3SSJA 4LWWA 3UP8A 5IHRA 1WNOA 2ZWYA 3IGSA 1O60A 1UWTA 1EGVA 4HNUA 1XLCA 1VLWA 1V3KA 2PODA 4J7RA 2J7DA 1GOWA 2FMOA 4AIBA 4AZ7A 3MP3A 1W56A 4G9PA 2OOFA 4ZODA 2Z6JA 1ZCOA 5F2LA 3GIQA 3L4UA 3VE9A 1L0PA 1PZ3A 3Q65A 2QYGA 2OKOA 4O14A 3TA9A 4O8RA 3CIWA 5G4HC 2NWSA 4Q4OA 2CLLA 1F74A 1Z42A 3QV7A 3GHTA 1Z32X 3DX5A 1XSJA 3R10A 2J74A 3P60A 2VFHA 3A23A 2OQHA 5A8MA 4MNKA 1RD6A 4JTGA 2Q8XA 2EBNA 5CEWA 4O18A 2YA1A 2A7NA 2A1YA 4LVBA 1W9UA 3W1TA 3LXCA 1IXPA 3LCGA 4G1KA 4M0XA 5IM51 3C2YA 4IMFA 3SY5A 3GXTA 2BGQA 2X0SA 4XO6A 4FNQA 3RCNA 3V5CA 4K37A 9XIMA 1ZCCA 2I17A 4RR4A 1GQNA 1PV8A 3WUBA 2B7QA 4EAMA 1GVYA 3KBVA 4YWIA 4W8LA 1C8XA 1D3GA 3CMGA 3OP2A 3S0CA 4CU6A 3IJ9A 1JPHA 1FOBA 1UOZA 1TTPA 2P88A 3NSXA 1CGVA 2VKZG 2YKKA 4GUHA 1MNSA 1SSGA 1UA7A 1TA3B 4XIMA 4GGBA 1JRCA 3EWZA 3DBNA 5CCZA 4FLOA 3B03A 1GCYA 3L4ZA 2D2JA 5SWUA 1ESWA 3T42A 4Z2LA 1L6WA 4NZCA 1DPMA 1C7SA 3LU2A 2CCRA 1TUXA 3CM4A 3PF3A 2IXUA 4KFOA 1PWMA 1XC4A 3GD6A 1MI3A 4BS0A 4MY1A 1PIIA 3OG2A 4KEZA 4LFYA 2F7FA 4LVFA 3M16A 4S39A 4UTMA 5A6LA 4ZO9A 3B04A 3GY1A 3GLCA 4DXVA 2Y62A 1CLXA 1Z44A 1PYMA 3DC0A 5FF0A 2CLPA 3G0UA 4ILSA 2VP8A 5AYXA 4UQCA 3DFQA 2J6XA 9RUBA 1C91A 1T41A 3BSHA 3GVGA 2WW5A 1MXGA 3UXIA 3W1XA 3CZLA 3M5VA 1BWKA 4AD1A 3WNKA 1JCMP 2RDUA 3UW6A 5CPLA 5CC5A 3ID7A 2CHRA 5JH1A 3EDEA 2EPNA 1P6CA 1KCLA 4HHLA 1GORA 1UUQA 2HVNA 3MUCA 5DXXA 1K9TA 1T8QA 4WGHA 2EG6A 3OGSA 1A50A 5FAJA 4HOZA 4M6UA 2R82A 3F4CA 4HHMA 5REQB 3S2CA 1QNPA 3BE7A 3PSVA 2E8ZA 5CJNA 4RX0A 5CAHA 4EF8A 1RA0A 1G4EA 3UCDA 2UBPC 1AFSA 1F2JA 2FH6A 3EYPA 1BEUA 3CWNA 1W3KA 3FGCA 4MOZA 1OIMA 5DLCA 1E0TA 3LA4A 5HNTA 1XGZA 2SFPA 1EJSC 1ZQ5A 3B05A 3Q2DA 2J77A 2F84A 1TFVA 3WO8A 3MI3A 2ONEA 2DZAA 4HMDA 4IQDA 1EB3A 3EAUA 1LCOA 3UPWA 3KCJA 4HNNA 1AJ2A 1ISWA 1JRBA 2QGHA 2ZRYA 1Q6FA 2VELA 4IQLA 3S4TA 4AWEA 4MF4A 3MKCA 4ZSTA 1GGOA 1HUVA 4JTJA 1B1YA 2VR2A 5HXMA 4I9AA 1VEMA 4PGLA 3LOTA 3QMSA 3GB6A 3VI2A 2ZUMA 1D9EA 2V3DA 1YDNA 2INZA 4Q7BA 1M53A 2ZRVA 4YLWA 1ELSA 5CLWA 1PYFA 4NZFA 3C0SA 3VD7A 4Q8PA 4LRTA 4US5D 4CEXC 2W66A 1LT8A 1UD8A 3NO3A 1X39A 4DJFA 5FJUA 3GU2A 1PPIA 2NX9A 4GCAA 1F3XA 5CPQA 4EPBC 2NVAA 3FA4A 4W8BA 3RILA 1EPVA 3SADA 1M68A 2Z1SA 3WQ5A 2ZUNA 4HNVA 3N29A 1UG6A 1GVQA 1WOBA 3H53A 1UKTA 1PTAA 4W93A 5C6MA 1SO5A 1EJUC 3K5XA 3GE7A 2WSQA 1SO4A 3AROA 1R2SA 3W27A 3FHAA 4I5XA 4DLMA 1AVAA 4HD5A 4O1CA 3GYCA 3ELFA 2HCVA 3WMBA 4ADUA 2ALDA 4PMZA 5DANA 1BWVA 2P10A 2WK2A 5U4NA 2HV5A 4BHYA 1DWFM 2CC0A 1K02A 2Y85A 2OPJA 1LRQA 1OX4B 4ZB5A 1EJXC 2TYSA 4GUFA 3G8RA 2UZ9A 3WENA 1CLKA 3CLWA 2EJAA 4QAIA 2ON3A 3KUMA 4EF9A 3CXOA 7TAAA 3W88A 4MJ4A 4EE9A 3RNDA 1XRVA 3WH5A 4W4QA 1BRLA 4KIEA 4DYKA 4IIEA 3AJ7A 3LMYA 3VPLA 3UJRA 1FFQA 2XN0A 4GH1A 1R3SA 3AMKA 1XIJA 3VE7A 2QPUA 3STGA 4PCFA 1R87A 5D9OA 4PMRA 3QFEA 3F5LA 4L65A 4XZMX 1JAKA 3CEUA 4E6MA 3A9IA 4BI7A 1V6UA 3NQCA 2PEVA 2QS8A 1K8ZA 5JBFA 3N14A 2PZ0A 1UD6A 4AU0A 2HVOA 3TC7A 2WC4A 3A6OA 2VD8A 4B3KA 1QBBA 2FPYA 1QI4A 3BCFA 1ZAJA 4MPQA 3W1LA 4O12A 2QDGA 1JDCA 3L4YA 3T0TA 3URQA 2E3ZA 2J79A 2E5DA 2FDSA 3G5EA 4C6DA 4F9JA 3WEOA 1J18A 6CGTA 2QR6A 2ZUWA 4OU1A 1MWOA 1BKSA 4GC3A 1QNQA 2NX1A 4C90A 1B0IA 4RZ5A 3G22A 4IICA 1RLCL 3S5ZA 4CD5A 1KWGA 4UFLA 2ZUSA 4GKLA 3PBWA 3W7CA 1XLAA 5FESA 1SFTA 4Z1AA 1JXKA 5EL1A 4HU4A 4LUJA 1PKNA 2OLSA 1IGSA 3OLEA 4IPIA 4UR7A 2PGRA 2A3BA 3HOJA 3WJXA 3AU2A 1ADSA 2G4JA 4ZO6A 3BV4A 5ABTA 4IFOA 3VCCA 3WBAA 4WDXA 2EEXA 2PDGA 3N18A 4UFMA 3GNXA 1EEXA 4QSHA 3FDKA 1W9XA 2VZOA 3LQGA 1QWKA 3UR2A 3CL7A 4IPLA 4HPXA 4IISA 2C1IA 1XQLA 3WZ0E 2HTMA 4M81A 1WDRA 1XXXA 3D47A 4KEMA 1LQ2A 4HNOA 4OZOA 1ZBVA 4FXJA 3UT0A 1LF1A 4C7GA 5HNUA 3Q37A 2QCDA 1MW0A 2GVEA 1E1CB 3OG3A 4A8LA 1J6OA 2A3CA 3PWAA 3TTOA 4QSFA 4WZHA 1KGXA 1BTMA 3KVLA 3OGRA 3GR4A 2YW4A 1R2RA 3AWNA 3C0LA 4EXQA 1FWFC 3IUHA 7CGTA 3JU2A 3L5AA 4AZ5A 1JAEA 5DMMA 2PDJA 1TJ1A 3KL5A 3F1QA 5JBDA 1TYGA 3HPSA 4GYKA 4U28A 2WWCA 2WJZA 4AZHA 4MKVA 3BSGA 4O10A 2CFFA 1Z89A 4YMZA 4C6EA 5I09A 3TSDA 1FRBA 3WLSA 3W07A 3SBFA 1X96A 2QCMA 1F05A 3LM3A 1LP6A 4O1FA 3VGDA 4YWSA 2JQXA 3MCNA 1U30A 1H7PA 3KX6A 3EOUA 4A35A 2PGWA 4OFCA 2WBKA 2X1UA 1VF8A 2X05A 4FB7A 4CGTA 3N6JA 1EA9C 3R58A 1WAUA 5CSRA 1PHWA 3S8HA 1QW9A 1QASA 1WUFA 2C0AA 2GDUA 3IK2A 3SR7A 4HOWA 4AZ6A 1K4HA 5MHBA 4BY3A 1XLLA 1OCJA 3WLTA 1WPCA 3E0VA 1VD6A 1F6KA 1Z69A 3IJ6A 3OVRA 5AYYA 2DH2A 3SY8A 1DJWA 3B4UA 2CPUA 5HQEA 1UIOA 3TNBA 1V4YA 3E5BA 2PDMA 4RCXA 2ZCGA 4P8XA 2YGYA 3LBMA 4FEZA 3I68A 2HDJA 5AYBA 2Q01A 5HAOA 3C86A 3H2OA 1LRTA 2VCCA 3GIPA 1OYBA 1RBAA 3AWOA 1EUNA 2IPJA 2XN1A 3IPWA 3AZSA 1GKQA 1RVGA 1VRXA 3BGAA 3VNDA 4IIGA 4K8GA 2ZTKA 3I7RA 4GXPA 4C6JA 1OK4A 4I5RA 4W7WA 2OFJA 1O66A 2NQLA 4HPNA 4URIA 3O0KA 3KXQA 3QPZA 4NJJA 2XVKA 3AIQA 2VXNA 3DHDA 4AMCA 5CG7A 1AJ0A 3P5ZA 3SCQA 2ODOA 3WDJA 3ZLHA 3VM5A 3PP7A 3UBPC 4DO6A 1W1B1 2C3ZA 5DX7A 4KF1A 3T1GA 3HQOA 4QIUA 5GJMA 3OZPA 3W0KA 1D7KA 3MKKA 1A80A 4Z0SA 4W7VA 1OC5A 2C8NA 5D2VA 3O2LA 4N6FA 1MDLA 1VJSA 4LU0A 1CXLA 2E5CA 3FAWA 4ACZA 1DVJA 3DFHA 4AHOA 4H04A 3LHUA 1R5YA 4HZ6A 1W5MA 2PI6A 2AQOA 4DF1A 4PRTA 4ZENA 3REQA 2J8FA 2OJPA 3I6RA 4ZFMA 1LZOA 2PWHA 4WJEA 1R30A 3NQ2A 3LHVA 3QH2A 1CGTA 4G5DA 3CWOX 4MAZA 1AMYA 5K2ZA 4HSOA 4DWSC 4O54A 1R3YA 5IOBA 1ZHAA 1KFEA 1TRIA 1XHGA 2QV5A 4FNPA 4JFTA 2GDVA 2ZOXA 2QCCA 5EMMA 3IAPA 2BVTA 3FHQA 3HF3A 1A53A 2EPLX 2YXOA 1IEVA 1NARA 1W8SA 1ODUA 3IVTA 1P0NA 4N4QA 3MHFA 3R0UA 4M7TA 4HNLA 2VNCA 3TMLA 2FQIA 5K4ZA 3FX4A 1RD5A 3L0GA 3IGXA 1U1UA 1R8LA 4OOUA 2R1KA 5DT7A 3VDCA 4J3UA 3MCMA 1K8XA 1Z7AA 4K7VA 3VNJA 1IWPA 4QP0A 3M0JA 1LWHA 1SW3A 2TPSA 3QYSA 3EXSA 5A2CA 4US5A 3WEMA 4L61A 3BAKA 1CXIA 2BSLA 3TVAA 4QBXA 5A8QA 4IPJA 1TE1A 1VCGA 2FGBA 1ZSXA 5BW6A 1M7OA 3E1F1 4K39A 2PMQA 3W7RA 1IT7A 4H8UA 3KTCA 1XYMA 2V8ZA 1UD4A 1OGSA 1S5WA 2WV8A 5E6ZA 4EK7A 3K8KA 2FVMA 3VIGA 4MYXA 5F1VA 5CH9A 4WR3A 1QVBA 1KTCA 2DSUA 1SM9A 1TELA 4JAWA 6TIMA 3DC8A 1SJBA 3TWAA 4N6EA 1A0EA 3SY1A 3EBVA 4BQ2A 3MI6A 3G1RA 1IEQA 1JGMA 3K4WA 2YDAA 3TR9A 1JPDX 3FV9A 4DXXA 4PCTA 1HQTA 2J75A 3W1MA 2R1PA 3WLHA 2DJXA 5C5YA 2Z26A 1FHDA 2V9DA 3LLFA 3S83A 4NNCA 4AX6A 3WLOA 3V75A 2WSRA 1POJA 1D2KA 1UWQA 1J9YA 4JY8A 2V63A 5HWNA 3WELA 5KZDA 1WKFA 1HJQA 3O63A 1YQ2A 4KFNA 4QQUA 3PY2A 3DYPA 3K4DA 1FCUA 2IQDA 1XV8A 3RR4A 1GOXA 4L4OA 2WVSA 1K9DA 1HNYA 1LLZA 1KBKA 4XZNX 2HK1A 6REQA 1SFSA 1XF0A 4DBUA 5B7YA 4GVGA 3ARZA 5D2WA 1CB7B 1XSIA 2DUXA 4AYSA 3ECQA 3TZFA 2YW3A 3WF4A 4LH8A 2VFIA 3MMTA 2BV9A 1EA0A 4UOJA 4ADTA 5M2FX 3D46A 3RLVA 3VIFA 2WNZA 2Z1WA 3LENA 2OG9A 1PSCA 4LUSB 3ZR4A 3THCA 1C7TA 1PZ0A 3IJDA 4N7QA 3ABSA 3OPSA 1Q4WA 1KTBA 5EMUA 4MFDA 3ZSTA 3VIKA 2ATMA 3VKKA 4AQLA 1W9PA 1XCFA 1UW9A 3DFNA 3EDDA 2A3HA 3WL0A 2VCAA 4JL2A 1JCNA 3O8AA 5KETA 2QVNA 4B5UA 1A5NC 3LS9A 3VCRA 3T8QA 1UYQA 3LPGA 1N82A 5BMXA 3K1DA 1O4UA 5RUBA 3L4VA 3W1AA 3UG3A 2OXNA 1ITUA 1PHQA 3R12A 3GDBA 3GXIA 4MNLA 4QHRA 3FVDA 3QR3A 2G3NA 1OVDA 4FX6M 2AGKA 2Z2UA 2X40A 4JTDA 2AAMA 1ZPTA 3CHVA 4L4MA 1YPIA 4MWAB 2VWSA 4ZXOA 3TJXA 3NPXA 3MWAA 1JD9A 1M03A 5AZ1A 4C6OA 1E0UA 1DQUA 3GNPA 4FOJA 3F2DA 2PLMA 2X16A 1QCWA 1EC8A 4AVOA 1FCQA 2FKPA 1KM1A 2PGFA 3TONA 1EJTC 3B9EA 4GXMA 4H6QA 3TMQA 4RV3A 4Q8NA 2J7EA 3RO8A 1XC6A 5FJTA 3MSGA 1OFPA 4U3AA 3E38A 1FCBA 2YIHA 1H1YA 4R27A 3AZRA 4ATLA 3W81A 2ZRXA 3O6YX 5CKSA 3SUWA 3BJFA 5TIMA 1RCOB 1DJZA 2D73A 4GMEA 1W5QA 1B3XA 4WEVX 4DIAA 1TV7A 2FJUB 1GQLA 3CZKA 1KV8A 3PPHA 4EXAA 4LJ3A 1R3TA 1CXEA 4HBKA 3QN3A 4RKAA 3BAIA 3FDGA 2AGTA 1P0EA 3H7RA 2Q09A 3U8GA 1BQCA 2ESCA 4QR6A 2BXZA 3VOJA 4QE5A 1R38A 1AZ1A 4NJGA 5LIWX 5CZ0A 3PBYA 2PLJA 3WD1A 1ZBWA 3GKFA 3GG8A 3CUHA 2VRJA 2PC4A 4WKFA 1H4PA 4LAKA 4CUCA 4C6KA 3HFYA 4DUXA 2XSXA 4HOXA 3OZYA 1I0BA 4J3SA 4UTWC 1V7AA 4RDVA 3HBLA 4MB4A 2PLKA 1ME9A 3N4EA 4P61A 3FY1A 5TQLA 3ATZA 5E9AA 4V27A 3CHEA 3EX2A 3O16A 2QCGA 3GWQA 3R25A 3MC5A 4ZB0A 5LA2A 2BOFX 1JGIA 2KX9A 3LRLA 1TPUA 4LC8A 1XM3A 2VX7A 1SGJA 1VGAA 1R9ZA 4O15A 2VRKA 3S1GA 2HSAA 4KRUA 2WLYA 2X7WA 2OR2A 1XDLA 2PTWA 3E0FA 3WLPA 2NX3A 4UIOA 1NVMA 4HP5A 2QHAA 3NDZA 1CI1A 4AWTA 3KCOA 1VC4A 3O6CA 4MZYA 2HRWA 5ECUA 1Q85A 5D37A 5JQ9A 4Z1DA 2ACUA 3ZLGA 1BGAA 1E6ZA 3PUDA 1V0KA 3B8SA 4HU0A 1S39A 4FR6A 2X42A 4BF5A 1LG2A 1ZALA 1JZ7A 3QFWA 1V8EA 4C1NA 4DO7A 3S9IA 2FMNA 4V33A 3GC2A 3LGEA 4HZ8A 2ZKMX 4J2MA 3WSUA 3LBCA 3P81A 4F0KA 3G1FA 3H7VA 3KBMA 5I3FA 4YVXA 3IWPA 3N6QA 4GQ0A 1JQVA 3NNTA 1G69A 4CNUA 3BTNA 2E28A 1TJ2A 1GK8A 2J4GA 1REQA 2IQTA 5AKQA 1E6XM 4AZCB 4LTSA 3U2OA 3PNZA 3BV7A 4S3AA 3TN4A 3AHXA 1LM1A 3NO1A 5CZJA 3AXKA 1ZJBA 4Q8WA 1C8VA 3E0WA 3NUKA 1VYPX 2VR5A 1QPKA 4GVHA 4GY7A 4PBGA 1W1VA 3QBUA 4QNWA 4FA3A 4JTCA 3MCOA 1TKKA 4JCLA 3LLDA 2OTDA 3ZR5A 1DORA 5JXQA 3SCOA 3L4TA 2PDCA 3CHCA 3IS4A 3GK0A 3HM7A 2E6YA 4WKHA 3VKAA 1DWAM 5EMKA 2IKHA 3AQUA 3W2MA 3NDYA 3DKJA 1KFCA 4HMNA 4Y9MA 4GI4A 4XD4A 4DI9A 2Z1XA 4DYEA 2GQ3A 4PUUA 1EC7A 3MJMA 1WB0A 1TTIA 4QFUA 4IMAA 1F61A 4WVXA 4DLFA 1HT6A 4PE8A 4HSNA 1OD8A 5HQLA 1FXQA 5BRQA 5BWFA 1EYEA 4LV4A 4MSSA 4FNUA 1JVNA 1LROA 4IL0A 3W7KA 5FJPA 3ITYA 5G5IA 3FOKA 7ODCA 1BD0A 4UTIA 2NVCA 1TA3A 5CPTA 3C52A 3RRAA 1JPIA 4QISA 3WH6A 1C9DA 3P61A 3EX3A 5FJRA 2VHLA 3QOMA 3A22A 3R8RA 4P7QA 3DBPA 2VFGA 2QJHA 5CAKA 5F7UA 2NLIA 3CO8A 3FKRA 3ITCA 2YB1A 1W9DM 3OQ8A 2PURA 2V2CA 2RH9A 3F4DA 1BYDA 2X30A 4U5IA 3TDFA 1QNVA 2CEQA 1K7FA 4FXFA 4RDWA 4C6QA 1XLMA 3NZRA 3D3FA 3F5KA 3POHA 1MW2A 3ATYA 4MPKA 3H8AA 3TU9A 3VO0A 5D8ZA 1ZU8A 2BGNE 1MUWA 3VMPA 3LCXA 1HG3A 1NWSA 3E0IA 4CU8A 4BI5A 1TE6A 1TJRA 3CV6A 4JN7A 2Y5EA 2H8ZA 1PZ1A 1Q6QA 1UR8A 1LUCB 3FW6A 2DPEA 4J1OA 4DBSA 1K70A 1FHLA 2L5HA 3W74A 2W6RA 2D0GA 4JTQA 1B3OA 2DZTA 1TQXA 2IPFA 4NG3A 3BAJA 3MKVA 3FJ4A 1W3TA 3L68A 1CBGA 2OYMA 5LIKX 2PBGA 3VNKA 2J8TA 3I3EA 4CD6A 5AHMA 3DIPA 3PB2A 3BO9A 2OCZA 1QOQA 3FYYA 1UBPC 3GXFA 2PU1A 3BDKA 3POCA 4KCVA 4QJ3B 3MUXA 1GQJA 4L6HA 3VD3A 3TEVA 3FEMA 3GR7A 4LCRA 2QUTA 4YTUA 1KQZA 3RPTA 5I23A 4G56A 1ZJHA 4DVOA 3BMXA 3PTQA 4O13A 3WK2A 5EPDA 3IJIA 3RITA 1WZKA 2ZDRA 2V0TA 3VNLA 3WK0A 3I7QA 2WC3A 5C71A 3A3WA 4LB3A 2V82A 2ZTJA 1CTNA 3DGRA 2A2IA 1XUUA 4B16A 2ZZ6A 1QHPA 1D7FA 3L7RA 3KBJA 1IQ8A 4PTNA 2ACQA 3NL6A 3T9PA 4DHGA 2RGLA 1O5QA 2J25A 2WNQA 1X98A 5H2ZA 2YL5A 2CBIA 4JQ2A 1GEQA 4RV8A 3NWRA 2Y24A 4MWAE 2ISDA 4WKAA 1AJZA 3LNPA 3ZFHA 3NQFA 4ZFCA 3DYOA 2ZVIA 4UQAA 1IEIA 2B7PA 2XWDA 3PWIA 4HVXA 4XD5A 4B9ZA 4LPCA 3ZJ8A 3MMDA 2OU4A 1QOXA 5AYZA 3DEQA 2P8CA 5FACA 4REQA 4XVEA 5GJPA 5FOOA 5A94A 1FBAA 4OQVA 4KEVA 3L2LA 5HMFA 1PIGA 4ICCX 2PRMA 4PEEA 5IDIA 2ATSA 1UP2A 2A3LA 2YCLA 3B8WA 1UIPA 5A6BD 1E9ZB 5A95A 1JPMA 1U33A 4GYPA 1KXTA 1TB3A 2DY3A 5CLTA 3SCTA 3VDHA 3TW9A 1KBLA 3KTSA 1UWUA 4DJED 2FZNA 4RNJA 2Q3RA 3RM9A 4PB4A 4XZBA 1MFUA 3CEPA 3NZPA 3HO8A 3KEHA 2CXGA 2XSBA 3PZUA 4XIAA 1VR6A 2ZA1A 3ITVA 2WC7A 2WMKA 4X63A 3N9RA 4UC5A 1DWJM 1WYIA 5AY7A 1VHCA 4ES4A 1EYWA 2WHJA 4HYRA 3BOXA 4UBPC 4GFIA 3EX1A 4H2HA 2R6OA 2X1IA 4O0KA 4AFYA 4EXBA 4UFKA 3KM8A 4KFPA 4NXKA 4KKXA 3EA3A 1OIFA 1A5UA 4A22A 1UR4A 2Y7DA 1OSEA 1HKWA 1JXJA 4A3UA 3DU0A 4RZ6A 1XIDA 2UY4A 1TPFA 5HQMA 2FLIA 3PC0A 4F0MA 1KRMA 1SO6A 1O5XA 3VGHA 4PZVA 4J3XA 3AUOA 1IF2A 2ZQ0A 4D6DA 4F40A 3EWUA 3RLGA 4B91A 4GZEA 2VEKA 4FHAA 3AO0A 1X7FA 4A8NA 2PDKA 2ZRUA 2TRSA 5J04A 1EJ7L 1KM6A 5HR7A 3NEHA 4G6CA 2AL1A 3PJTA 4DUWA 2PB1A 5HR6A 1FWHC 2F9RA 4H00A 1RJRA 1YYAA 1MRQA 3SCPA 1MUCA 6A3HA 4GJIA 2WCAA 2QF8A 3UD6A 4C1KA 2TMDA 4F0LA 3AYRA 4H9XA 1EQCA 3QV9A 1PTDA 3MUIA 3H24A 4IHCA 3T6CA 5BROA 3NAVA 5KINA 1LQAA 4IT1A 5DELA 5KZEA 2IUZA 1J2WA 1KGUA 4LBRA 2W61A 3HPXA 3ZJ7A 3ANVA 3U3HA 3W01A 1WKYA 4UTKA 3T09A 4Y8FA 4M7SA 4FIQA 3T40A 3EMCA 4FS9A 5M1TA 4XZLX 5JH2A 1XD0A 1P7TB 1YBQA 2CKRA 3ZJKA 4A3QA 2H9AB 2GYIA 2DU2A 1ZB5A 4HU3A 3ZSSA 1OC7A 3NJ3A 4ZOCA 4TX9A 1IT0A 3E96A 1DJYA 4E4FA 4OJYA 3V7PA 2W91A 3TN5A 1MXSA 2PSNA 4RW5A 3NGFA 5EY5A 1JG9A 4XAPA 3GSMA 3LV6A 4U3CA 1OJXA 5A6MA 1VBHA 2CZFA 1KC7A 5KSWA 3WMLA 4B5NA 2VZVA 3WFAA 4YIWA 1E4LA 1Q8AA 4H19A 4YHGA 2GGJA 3CH0A 2Q6ZA 4WRHA 1TTQA 1GG0A 3LK6A 1VQTA 1RP8A 3BLOA