4AD3A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-deoxymannojirimycin
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
345
Chain Sequence
TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad3A00
2WVUA 4AEFA 1TA3B 1UH3A 4KRUA 4DM2A 1GPFA 4TVUA 2ZUMA 4D6EA 1BGAA 5A6MA 2W67A 4HU8A 1M01A 2VRJA 3ZT6A 2DDXA 1UD4A 1JI2A 3NYDA 1XH2A 4KGJA 1JL8A 4PTVA 3WNPA 1DWFM 1LG2A 2WCGA 4YN5A 2W92A 1NH6A 2XVKA 1HJXA 4EK7A 1KR1A 4WSKA 2X2YA 2VUYA 2W62A 1NWUA 2XFFA 2ZUNA 1WDRA 3AHYA 5JBFA 1QI2A 1UZ1A 1J0IA 1HKJA 3VDCA 3KL0A 1WZMA 1ISXA 2E9MA 3WF2A 5I78A 2ZWZA 2ZX9A 1QHOA 3POHA 2PB1A 3LPFA 2J78A 3MMUA 3UG5A 4EAMA 3BSGA 1GQIA 1LWJA 4W89A 4ATLA 1E0VA 2BY3A 3F4VA 5BXRA 3WEOA 4V28A 3SCOA 3N12A 2IXUA 3WNOA 1QHPA 4D72A 1H1NA 2GFTA 3WQ4A 3N15A 3ZT7A 2WZEA 2WWDA 3AZSA 5I23A 2E8ZA 4PCTA 2EPOA 2RGLA 1E15A 3IANA 2GK1B 3VD7A 4H2CA 3AHTA 2UY3A 2WSPA 3DECA 4M56A 1EDTA 4WKFA 5FKYA 1BHGA 1EGZA 4MDOA 2XVPA 3PZTA 1R85A 2PWFA 2V3GA 5IDIA 4JFTA 4D6IA 3MS8A 1EOKA 4ACZA 4MJ4A 1CNVA 1E9LA 1UR8A 3BAYA 2YDQA 4PSRA 3U5UA 1NOFA 2NT1A 3N13A 2CBIA 5CPTA 1JFHA 1BYAA 4URIA 2X0YA 4WJXA 1EO7A 2X8RA 1OIMA 1K9EA 3AXXA 4AXNA 2WSKA 3WF0A 3N9KA 1VBRA 5LA2A 3DC0A 2G8ZA 5A6LA 1JYWA 1GNXA 3DYOA 4W8AA 3VD4A 4E8DA 1EHAA 3RJXA 1E1FA 5AYIA 3U7VA 3QOMA 3MU7A 1UH4A 2WBKA 2A3AA 1QNPA 2BS9A 1B2YA 3SUVA 2X0HA 3L4XA 3PBGA 1BG4A 1UKPA 2WKLA 5CSYA 1HIZA 1UD2A 3VINA 3GXMA 1ECEA 1R86A 3SCUA 3WQVA 3VUPA 3BAXA 3CUGA 3ZJ6A 3IK2A 4AIUA 3A4AA 1JYNA 4ZE5A 4CD7A 3VIGA 3HMCA 1JF6A 1E0WA 3SCWA 1CGVA 1JNEA 2OLHA 4AZ5A 1WZAA 3IAPA 4U33A 1E6NA 5HPCA 2OSYA 2J62A 3AFBA 1PIGA 1FA2A 5I3DA 3W6LA 2A3HA 1KCLA 1AMYA 1WPCA 3PZGA 2FHFA 2EJ1A 1JDAA 2D2OA 3A6OA 3ZJ8A 2DT3A 1GORA 1LLOA 1S46A 5A2BA 4U3CA 3VGHA 4RL3A 4IPNB 3W37A 4KWUA 2Y8VA 1V3HA 3UESA 1V03A 3IJ9A 4GI6A 2J7EA 3O9NA 5D4YA 3VIPA 3K4AA 1HJUA 2CERA 1VFUA 4PN2A 2WPGA 1R87A 1UOKA 1EOMA 4CD5A 3WELA 1CEOA 3AHVA 4ACYA 4IPLA 1BAGA 1E5NA 2WZIA 2J79A 3UERA 5JUVA 1VRXA 2JF6A 1IZKA 2J7HA 4BF7A 1W2VA 2VCCA 5HOSA 3U57A 4PMRA 1V6UA 3AMDA 3L4UA 2W5FA 4B16A 3CUHA 4WK9A 3AS2A 4W93A 3VIMA 5M03A 4WKHA 4X0VA 2EO7A 3GNOA 4S3KA 5AC4A 1P6WA 2PWEA 1H2JA 1H49A 4DUXA 3ZMRA 3WMCA 3AIRA 1XCXA 1M04A 2A3CA 1CLVA 3AS0A 5FCZA 2XVNA 3W0KA 3ARYA 3PZIA 1G94A 1CPUA 4BQ3A 1HNYA 2XVGA 1MXGA 2WVVB 4AZIA 2V3EA 3PZVA 2IXVA 4PMDA 3WD2A 1QNSA 5GQBA 2DSUA 3MSGA 2OYLA 3A4WA 1DWGM 4DWSB 3EDFA 3CZ8A 3NJ3A 2QPSA 1W1TA 2YBTA 5I6SA 2J74A 4UQCA 1UA3A 1DHKA 4W7UA 2FDMA 3CHFA 3WDIA 2YL6A 1W9PA 3NSXA 8CGTA 3J7HA 1V6VA 3KWXA 2A3BA 4MAZA 3T0AA 3MSDA 1VBUA 1J18A 2A3EA 2EPLX 1CWYA 1GJWA 4ML4A 1BYBA 2X05A 2Z1SA 4UQDA 3ZJKA 3VIKA 4UQEA 1R8LA 1BF2A 4P8UA 4UZUA 3W27A 1W9BM 5I5RA 1H0GA 3K8MA 1E56A 4JFUA 1QBAA 4N0RA 1WE5A 1CXKA 2ZUUA 3VIIA 3K8KA 5BYWA 2ZX5A 1ZS2A 4XUYA 1HL8A 1HX0A 4CD8A 4UQBA 2YL9A 4M81A 1MXDA 4ZFMA 4MPKA 2AOSA 4P7RA 3MKKA 1RP9A 1A3HA 3W82A 3LMYA 1E3ZA 1G1YA 1CBGA 2W63A 3D5HA 1JZ5A 1J11A 2JALA 1FOBA 1LWHA 4C7DA 3VGEA 3GH5A 1WO2A 2V5DA 4LXFA 2GJXA 3O2LA 2J47A 1GJUA 3THDA 2BNJA 5A3HA 2VZSA 2OWXA 5AY7A 4IM4A 2EPNA 4CUCA 4PRWA 3UG4A 4HMCA 1UKQA 3T2QA 4CN4A 4PMOA 3TTSA 3AIUA 3CHCA 3WUEA 2EQDA 4UFIA 2WK2A 1CXHA 1JAEA 2E9LA 4QLJA 1E5JA 1HN1A 1W91A 4GO8A 2Y2WA 3CZEA 2CBVA 2CHNA 4GXPA 1QW9A 1WP6A 4AIEA 3RILA 1E6SM 1HJVA 5FL1A 1FP9A 3EDDA 2WCAA 1C92A 5CGTA 4GI9A 1WZLA 1HKMA 2CCRA 5JBEA 2D20A 4MB5A 2ZXQA 2WC4A 4HOZA 2YA0A 4AW7A 1ZBKA 3WQ6A 4X9YA 4AD5A 5A2CA 3POCA 5BRPA 1B3WA 3WDQA 1YQ2A 2GDUA 3PHAA 2PWDA 3AISA 2D3NA 3RDKA 2VO5A 1V0LA 5JBDA 2AMGA 2GDVA 1HL9A 4UFKA 3GNRA 1QW8A 4W7VA 4R5EA 1UWSA 1R7OA 3MUIA 4Z2GA 3AYSA 4CKQA 1WDPA 1O7AA 2PWGA 1XD1A 4XV0A 1J0JA 1V3IA 4PMQA 1TMQA 5HXMA 3WKZA 5C70A 4TTGA 2WMJA 1DEDA 3QHOA 4JKMA 3VDAA 5C8BB 1E73M 2J75A 4LYQA 2VX6A 2VC9A 3RJYA 3OB8A 3GXIA 1AQHA 2C0HA 4U3AA 4M80A 2XSAA 3BAWA 1DWJM 2G3MA 1KXHA 1PAMA 1KWKA 3VX0A 5A8PA 1LJYA 4IISA 1XYZA 4EE9A 1VENA 1E4LA 2WMGA 3OLIA 4W86A 1WNOA 1AQ0A 3DHUA 4AZCB 1JD7A 1J0ZA 3SCSA 3PTQA 3BCFA 2W91A 4MB4A 1N82A 4AD1A 1BQCA 2XM2A 1MVYA 3SIMA 4W84A 3SCNA 2J7DA 1EQCA 2JE8A 1E6ZA 3AQUA 5I24A 3ALFA 3GBEA 4L4PA 3PZMA 3ARPA 1KB3A 1FH8A 2E4TA 2O9PA 1K9TA 2ZE0A 4V27A 2ZUTA 1GW1A 2BHYA 3UEQA 1EQPA 3GYCA 4HA1A 3PZQA 3VDBA 1KGXA 3W29A 5I77A 2JEPA 5BROA 1VFFA 1GOOA 3ZSTA 4U2ZA 3EDEA 4BCEA 1J0HA 3WENA 3ARUA 1OGGA 1BFNA 2XWDA 1UKOA 4H8HA 3U5YA 3UCQA 5M5DA 3MMWA 4AZ7A 1DP0A 3WD3A 3THCA 2ZXAA 5JIPA 2VX7A 2BHUA 5D9PA 1YHTA 2J8FA 3CIVA 2BXZA 4H8VA 4PTMA 1NQ6A 4HMEA 4W8BA 4WKAA 4P7OA 5D8ZA 1XCWA 2WC7A 1E40A 4PMNA 3WNMA 2QHAA 1HJSA 3N18A 1TE1A 4GZEA 2V5CA 2Q8XA 3GXDA 2XFRA 3SCVA 1JZ8A 2J7BA 2VI0A 3CTTA 4OBSA 5CJ5A 2VCBA 1JZ4A 4HZ7A 5A8MA 2XIIA 3T0BA 1OIFA 1PEZA 3M46A 2G3JA 3MV01 5ABGA 2YOCA 2OSXA 1VF8A 3OBAA 1HVXA 1UD8A 2QLYA 3AXHA 5IFTA 5CQ1A 9CGTA 3AS1A 4Q7NA 2D24A 4JKLA 2JIWA 3WH7A 4ACZB 2GUYA 2CITA 5JIWA 4JL2A 4UR9A 1B0IA 4D71A 1CGYA 2XJ7A 3WY1A 3KEHA 4J3WA 4W5UA 3G6LA 3TOPA 2UWFA 2DH2A 3CZJA 4MB1A 3RM8A 2E3ZA 2B31A 5CSUA 3AROA 3WMBA 3AYRA 3VMOA 3CMJA 4UQAA 1UWQA 3L4ZA 3WL0A 5D8WA 2MANA 5BXPA 4AISA 2J25A 3EMZA 1MW1A 4CU6A 5BXSA 3OLGA 4HZ8A 1UA7A 2XUCA 3CHDA 3BLKA 1OB0A 2WLYA 1L8NA 4HPGA 4FF5A 2VRQA 2VJXA 5GNYA 2WHKA 4GZJA 2UY2A 1MW0A 3CUFA 4HA3A 4OJYA 4WIWA 1X6NA 2G3IA 3GZAA 1CXLA 2DSZA 4CU7A 2XSBA 5BCAA 5A6SA 3QHNA 5DF0A 1HKKA 2DEPA 4AZ6A 5E70A 3W4RA 4GPNA 1UD3A 4OKDA 4F9JA 4WF7A 1DWAM 1JFXA 1V6XA 1XD0A 1NWRA 1O6IA 3BMWA 5ABEA 1PJ9A 3K8LA 4JIEA 3WL1A 4FLQA 1LF1A 3L4VA 4NI3A 4AD2A 1GUVA 2OYMA 3ZJ7A 3SUWA 1PZ3A 3L2LA 3AMLA 3T0DA 3FAWA 3VTRA 1JAKA 3VMPA 5CLWA 1UD6A 4XX6A 2FGLA 4H04A 3VX1A 1A47A 5E6YA 1TUXA 1OT2A 1GCYA 1GQJA 1US3A 3RM4A 1C90A 2VVNA 3OIHA 3ZM8A 2G41A 3VU2A 2GVYA 2JEQA 4J3TA 3TONA 2OYKA 1JYVA 3VDHA 1X6LA 2WMFA 6A3HA 1VEPA 1CIUA 1VFMA 4HU0A 3G6MA 1Q4NX 3GTNA 3VIHA 2FH8A 2WYSA 3T2OA 1K6AA 2YL5A 4CGTA 3M6DA 3NIYA 1OBAA 2WZHA 4BQ5A 1ZBCA 3VKKA 1B31A 5ABHA 4F66A 8A3HA 1MQPA 1GOWA 2PBOA 3VGBA 1AVAA 1R7AA 4MB3A 4AMCA 4D6HA 1E4NA 1UR9A 2GSJA 2QMJA 3WF1A 1M7XA 2FH6A 4MNLA 6CGTA 1EHNA 3OZPA 3WDJA 4FMVA 2YA1A 2V3DA 3MUY1 4F9DA 1PBGA 2PI6A 1H41A 2XGIA 2WMHA 3ARVA 4GQQA 4MTVA 3PTMA 3WSUA 4V2XA 4D6GA 5CXPA 2QV4A 4OIFA 3ZQ9A 1XV8A 5D9OA 3WD0A 3II1A 3MANA 4PUDA 2BV9A 1QNRA 2TAAA 3AIEA 3VGFA 2Y5EA 4JKKA 3BAIA 1ZU8A 4YHGA 2FHBA 1G9HA 1WB0A 2ZX8A 4RE3A 1UKSA 4NZCA 1JNDA 5A95A 3A47A 1OSEA 3F5LA 3TTOA 2YIHA 1US2A 1RPKA 1FH7A 3CBWA 4PYSA 1VB9A 2QPUA 3UETA 3BAJA 4GO9A 1W2PA 1J12A 4XB3A 4J28A 1V3JA 1NOWA 4Z2LA 2PWHA 2PBGA 1CGXA 3CHEA 1RP8A 2CIPA 3CUIA 1NP0A 1ISWA 2VNCA 1M53A 1JYXA 1OWQA 1HVQA 1V02E 1FP8A 4TTUA 5CLTA 1BGGA 3AZRA 2DQXA 3ALGA 1EDQA 3WH9A 4QLLA 1F4AA 1BVNP 3A4XA 5EB8A 3NDYA 2JIEA 3B9AA 1C91A 4A3HA 3FHAA 3VO0A 3OGSA 2JFEX 4DM1A 3WQWA 1K9FA 4P7LA 3WBEA 1QPKA 1B3ZA 1TVPA 4Z2IA 4AC1X 1PX4A 2VZOA 2DGAA 1W9XA 1B1YA 1LL4A 2DT0A 1V3MA 2XVLA 1BLIA 4QCEA 5I2UA 1KGWA 3F5KA 5AYBA 2VZUA 2GJXB 1TR1A 1KGUA 3W38A 1H3GA 5KEZA 2CBUA 1MQQA 2D23A 3CZLA 2DPEA 3WDRA 2E40A 2J7CA 3ARSA 1I1XA 4P8XA 4MNMA 4AZBA 2ZX6A 4ATDA 3VD9A 2EBNA 2NW0A 2ZUSA 3T2PA 4XZBA 1NWTA 1TVNA 3D3AA 5LYRA 1ZL1A 3FW6A 5CZKA 2D0HA 3FAXA 2VQUA 1UR0A 5M17A 1J01A 1PX8A 4NF7A 4PCSA 4UZSA 3AHZA 1HXJA 2WLZA 1BYCA 2WWCA 5HBFA 3HN3A 3SUSA 2D22A 2XIBA 1CXEA 3VIFA 2CXGA 3DHPA 1W1VA 2E0PA 2BY2A 4HP5A 5FL0A 3EMCA 4CN6A 1EH9A 5CGMA 1E0XA 2WANA 2DT1A 4QLKA 5ABFA 4PSPA 4PMYA 1NOUA 3SUTA 4BQ4A 5E0FA 1V0KA 1V0MA 2WAGA 1JGIA 2DIJA 4M8UA 2WB5A 3KE0A 5HDRA 2Y24A 3BLPX 2YDRA 4GQRA 4AY1A 1OINA 4CVWA 4RE4A 3CH9A 4AWEA 2J8GA 4F8XA 3N1AA 4DUVA 2WHMA 3CO4A 4CVUA 4C7FA 2F2HA 1NWSA 3WD4A 3WDPP 3RO8A 3CMGA 3KZSA 1GOQA 2O9OA 4JCMA 4W87A 1WCGA 4AYSA 3TTYA 3VILA 4OOZA 1NP2A 3M07A 4Z2HA 1TG7A 1XRVA 4X0NA 3PZUA 1CYGA 1QI0A 4QFUA 2XFYA 1V3KA 4AIOA 1FH9A 2BVDA 2ZXDA 2PC8A 4P7QA 2F61A 1XSIA 1KWGA 2XPKA 4RE2A 5HPOA 3BAKA 2OWCA 2YJQA 4A4AA 3AXIA 4B15A 4B9YA 2VQTA 3SCQA 2J77A 3OA5A 4PMXA 3PZ9A 2DH3A 1Z32X 3K1DA 1CZ1A 1CENA 1CDGA 2CESA 4LPCA 1SMDA 3CGTA 4HZ6A 1C3FA 3OZOA 3WFZA 2PF0A 2J4GA 5D9NA 3WFLA 5E0CA 1ODZA 3B8SA 3OLEA 4FLRA 3U7BA 3FNDA 1H09A 1SYTA 4GKLA 1HKIA 3T08A 1EDGA 3GH4A 5A6JA 3LPGA 3TTQA 2BXYA 5HNNA 4GZIA 3MUZ1 1SMAA 4TVDA 4OUEA 1Y7VA 4QP0A 4W7WA 4LYRA 3UR7A 1B9ZA 1ZBWA 1TFVA 3UG3A 1UWTA 2WC3A 1UWRA 2ZOXA 2QF8A 3AS3A 4PUEA 4MNKA 1HJWA 3WDHA 3A3HA 2D1ZA 3OGRA 2JF7A 4JFWA 3F5JA 4UFHA 4J3VA 1I1WA 5EBAA 4U31A 2ZXBA 2ZUVA 2V38A 3ZR5A 7TAAA 2VZTA 4J7RA 2O92A 3N11A 2WHJA 5I0DA 1GQKA 2GJPA 3S6TA 4GINA 1V6YA 2J7FA 2X1IA 7CGTA 1TCMA 2J7GA 1Q6DA 3JUGA 5LA1A 4GI8A 1SFSA 1G0CA 3ARTA 3W81A 1VFOA 4B3LA 1PZ2A 1LL7A 4JCLA 2WMIA 1QOXA 3GDBA 2WHLA 3LPOA 4P7NA 4BQ2A 5DO8A 4UOQA 1FHLA 3VD5A 2BY0A 2WCSA 3EDJA 1E6RA 3WQ8A 3AMCA 1JZ2A 3T09A 4M82A 1HJQA 1HF6A 3KL5A 3BMVA 3S2CA 1VJSA 2NT0A 2OWWA 1C8XA 1XHGA 2O9TA 4MADA 3SCRA 4KRTA 4L4OA 1C93A 5BXTA 1JXJA 3FN9A 1OD8A 3DYMA 1QBBA 3SCTA 3VM5A 3PZOA 2IUZA 4HOWA 5LA0A 2G4FA 1B3XA 1U33A 2CEQA 4UFMA 4AD0A 3NSNA 4W85A 4CCEA 1Q6CA 4UOJA 1HT6A 2Z1KA 4AEEA 1VAHA 4N42A 1TA3A 1GQLA 4P8WA 3MMDA 4Z2KA 3VNYA 4OOUA 1VJZA 5CPSA 3UR8A 2RGMA 1KBBA 2YDSA 2VMFA 3WF3A 1RH9A 4LX4A 5C71A 1E71M 3L4WA 4PMUA 2FHCA 1PPIA 2VRKA 1UHVA 2WNWA 4C7GA 2X09A 3AIWA 4NRRA 3VIOA 2ZICA 1UG6A 2VURA 1CGTA 3FXYA 3NCOA 1E72M 5TD4A 1CXFA 1L0PA 2CETA 1DWHM 4FK9A 1QVBA 3OLDA 4UOZA 4NSBA 2YLAA 4AD3A 1C7SA 5GPRA 4LQ1A 3GH7A 1JI1A 1EIBA 4U5IA 1KBKA 4LGXA 3WH5A 2XM1A 1E55A 4HMDA 2XWEA 3M7SA 4H7VA 1G01A 1H5VA 1UR1A 4PMZA 1FHDA 5I79A 2E9BA 3BCDA 1KQYA 4E2OA 4H8UA 1CECA 1OCQA 1OGBA 1E3XA 3HU7A 1V0NA 3O6AA 4J3UA 3W28A 3VOCA 3WNLA 4DUWA 1JZ6A 4UNIA 4QDMA 4ZENA 4AZGA 2GK1A 3GM8A 4QCFA 2DSWA 4IUGA 4YHEA 5A69A 3MO4A 4AZHA 1EO5A 5E09A 3ECQA 2CKSA 2EPKX 3WEMA 1D7FA 3EYPA 1LG1A 1UKTA 4NRSA 1WZKA 4KMQA 1UWIA 2BFGA 2VCAA 3ARXA 4UFJA 1Q6EA 2OSWA 1RD6A 4OZOA 2HVMA 3OGVA 2UY4A 4LYPA 6TAAA 4OBRA 1J0KA 3GXFA 4D6FA 1V3LA 3SUUA 3W24A 1NM9A 1UQZA 3RCNA 4CD4A 4XZWA 2WKGA 3AICA 4J3XA 1E1EA 1J0YA 3BC9A 3NSMA 4MNJA 3AJ7A 3N04A 3WUBA 4ZE4A 3VM7A 4A3YA 2VR5A 3L2MA 4Z2JA 4DWSD 4CN1A 4E4PA 1W9VA 4MAVA 1BTCA 2YL8A 2W4XA 3ARRA 1W1PA 4BZYA 1ZBVA 1IT0A 3WH8A 4W5ZA 2XGBA 4UTFA 1JDCA 1KR0A 2ZIDA 1Q6FA 3KL3A 4JZ5A 5E9AA 1E6XM 4BA0A 4CU8A 3B9DA 4ZEPA 1PIFA 4M29A 1ZJBA 2C8NA 4WLCA 3W26A 2WVTA 4WSJA 4UFLA 4TVCA 1QI5A 1E70M 3VVGA 1QNQA 3QGVA 2VX4A 1VEOA 5A6BD 1W32A 1JDDA 1GONA 1QHZA 1E4IA 2EEXA 1XGZA 3ZSSA 1KFWA 4CD6A 1H0IA 1F4HA 1U30A 1KQZA 3TA9A 2ZX7A 3W25A 4TUFA 3W6MA 1JIBA 2VTFA 1KXVA 1W3JA 1ZB5A 1WDSA 1W3LA 3AOFA 4F79A 3WUGA 1JD9A 3ZR6A 4FLSA 3WBAA 2XYLA 1KCKA 1UZ4A 3SURA 4PEEA 1DWIM 3WEZA 4PBGA 2D0FA 1C7TA 2WVSA 3EDKA 5DMYA 3SCPA 3HJEA 4FLOA 3IJ7A 3AIVA 1ESWA 1UWUA 1EA9C 2BVTA 2XTKA 1G5AA 5IXEA 2CPUA 2VL4A 1GVIA 1VEMA 3CZKA 4TXEA 3EMQA 2WXDM 3N17A 1VIWA 5A6KA 4HTYA 2GJRA 4J27A 3I3EA 2F8QA 2VVSA 3WF4A 4TX8A 4B3KA 5BWFA 3NUKA 1HP5A 3APGA 4MDPA 1ODUA 1W3HA 3ZIZA 1ITCA 3BGAA 4GIAA 5A1AA 3VNZA 1DTUA 1M03A 1V02A 4AD4A 4D1JA 1OT1A 2DSKA 5KZ6A 1ISVA 1J10A 1PX3A 2HISA 3ARZA 4U2YA 1GOKA 3RPMA 1JZ3A 3QOKA 4PTXA 5EMYA 4UQ9A 4PMVA 3QHMA 5A2AA 3WN6A 2VZVA 1B90A 4R27A 3K4DA 5GNZA 1JF5A 1WAWA 4ATWA 1X1NA 4JFSA 1ISYA 4Y7EA 4YPJA 2BVYA 2VT0A 2WVVA 4HPHA 1BG9A 3E1F1 2CHOA 2O9RA 4JAWA 3DYPA 1WDQA 3EBVA 1D2KA 2WBGA 4ZXOA 4DWSA 1KXTA 5ECUA 2QMKA 2YKKA 3PTKA 1EXPA 1LL6A 1MW3A 4W88A 3VPLA 7A3HA 1GHSA 2BY1A 2VR4A 3W53A 5FIPA 5ABFB 1E4MM 4PTWA 4MJ2A 3AMKA 1W3KA 2XHYA 1QI3A 1SR0A 1B3YA 1BVZA 1ITXA 4BS0A 5FOOA 3L4TA 5E6ZA 2VX5A 1XH0A 3WUFA 1UQYA 3BH4A 1J9YA 3L4YA 2YLLA 5D9MA 2DT2A 1AQMA 5A6BA 3I3BA 1UH2A 1GHRA 1HP4A 3VGGA 1OD0A 4CCDA 2CKRA 2W66A 4EKJA 2VOTA 2XG9A 2NSXA 3LPPA 1OGSA 3WNNA 2WMKA 4K68A 1LQ0A 4D6CA 3RMEA 1E43A 1CGUA 1V6WA 3TP4A 3GBDA 2Y8KA 3NDZA 2WW5A 3QR3A 1MYRA 1MQRA 2CNCA 3CPUA 5A8QA 4Q22A 4JHOA 1WKYA 4B9ZA 4JFVA 3I3DA 3VIJA 3WH6A 1UYQA 1KXQA 3FY1A 1IV8A 5AC5A 5IHRA 3ZOAA 3IJ8A 5DFAA 1MW2A 5FD0A 1W9DM 1W9UA 4H41A 4S3JA 1H11A 5IHSA 1ZJAA 3VMNA 3CLWA 3IAQA 1GZJA 3RIKA 2ESCA 1GVYA 5CG0A 3B9EA 3ZO9A 2CBJA 2ZUWA 3AZTA 1MFVA 3AMGA 4E8CA 2UY5A 3MV11 3CZGA 1C8QA 4QAWA 1FFQA 5IFPA 3WQ5A 5DEZA 2D3LA 1BSIA 1BYDA 1E6PA 1QNOA 4HOXA 1CXIA 5CPQA 2YBUA 4KH2A 4M1RA 3CUJA 4D6DA 1Q6GA 5A8OA 4UCFA 5A6AA 5DT5A 2ZWYA 1JG9A 1XH1A 1V08A 5DT7A 1I75A 2DIEA 2WM0A 3MUAA 5A8NA 5F7UA 2EXOA 4M24A 1C8YA 3ARQA 1JXKA 1U2YA 4ZXLA 2D0GA 3AIBA 1UR4A 3ZT5A 1UUQA 1FFRA 2EPMX 4JL1A 1ISZA 4DWSC 5EFFA 1UD5A 4D1IA 3K46A 1CLXA 4D6JA 5A94A 3BSHA 3WNKA 4TOQA 1UR2A 1CTNA 1CGWA 5EFDA 1OM0A 1D3CA 1XSJA 3VD3A 1NARA 2DSVA 3SEPA 2E8YA 4JHZA 2Y4SA 3OG2A 4HA4A 2WMIB 1TZ7A 1XC6A 3VGDA 2YA2A 1MWOA 3BXWA 1IZJA 2CYGA 1XSKA 2V3FA 4W8LA 2C7FA 3AIQA 4CCCA 1MFUA 4P8VA 1E6QM 4J3SA 3FHQA 3AHXA 5BRQA 4U5KA 2G3NA 1QI4A 3PZNA 4TX6A 1B3VA 4EANA 2W61A 3ARWA 1BPLB 1XYFA 1B30A 1W1YA 4KGLA 2AAAA 5M3WA 1K9DA 3WIJA 3PN8A 2FGZA 3AI0A 1GOMA 1JZ7A 1GOIA 1H4PA 5GNXA 3GNPA 4AZCA 2BHZA 3RM9A 3WMSA 3WD1A
chains in the Genus database with same CATH superfamily
2WVUA 4BWLC 4DM2A 1P4CA 5EMJA 3M7WA 2YCIX 2V5BA 2P0IA 3MWAA 2GQ3A 4G7EA 1EL3A 1JI2A 1LLZA 1XH2A 4KGJA 2PDMA 2WCGA 3GS6A 2IKIA 2GQAA 2Z00A 2NVDA 1ZSXA 3PG9A 4EK7A 3F7JA 4WSKA 1IIHA 4IF2A 1RUSA 2W62A 5HK4A 1XBYA 2XH4A 5ECVA 4H3DA 1XCFA 3G0XA 3VDCA 1RQEA 3I7SA 1WZMA 3L0KA 1KCXA 4WXYA 5I78A 3POHA 1RA5A 7XIMA 3MC5A 1LWJA 4JEJA 1PSCA 3VKCA 4V28A 1PO9A 1FWIC 2Z6IA 3SIZA 3N15A 4JY9A 2AQOA 1A49A 3FX4A 3MI6A 2E8ZA 3KCOA 1FCBA 3W7NA 3S1WA 1F74A 4CNUA 3IANA 3VD7A 4H2CA 2CZVA 5D37A 3TR9A 4C1KA 3M9YA 1EDTA 1J5TA 1S1PA 1UB3A 2VFDA 3GB6A 3U2EA 3IIPA 2YZRA 3PZTA 2PWFA 4NASA 2NX9A 4JFTA 5DY2A 4J4KA 1GT8A 3N4EA 2O0TA 3SBFA 3LCGA 4DJFA 4QDPA 3N13A 3C2OA 1BYAA 3GKAA 4URIA 4WJXA 1JCXA 3QR0A 1VBRA 4XAGA 3T0TA 4LS0A 5G4WA 1FUYA 3M4HA 3DC0A 4XUGA 2TSYA 5A6LA 2X1UA 3DYOA 1OC7A 4DLMA 1EHAA 3RJXA 1E1FA 5AYIA 3FJ6A 1ONWA 4O54A 3CUZA 4GBUA 4NL1A 4JGDA 1B2YA 3SUVA 1BG4A 2WKLA 2EAWA 3WQVA 1X39A 4AIBA 3ZJ6A 3IV3A 2DQWA 2NV9A 5LSMA 3A4AA 3FYOA 4H6EA 2PDWA 3SJ3A 3NZRA 1JF6A 1EYEA 2F7FA 3TSMA 1JNEA 1RCOB 1K6WA 2VR2A 1AZ2A 2DW6A 4AAJA 3BV4A 1DJHA 4H83A 3IAPA 4FXRA 1KLYA 2P76A 1S2VA 5A5WA 2FFIA 1NDYA 2DORA 1FA2A 2A3HA 1KCLA 3CK5A 3T9PA 1WPCA 1Q6RA 1GPWA 2D2OA 1GORA 3GU1A 3JZEA 4NJKA 2Z7GA 3RU6A 3E74A 5FEPA 5IM51 2ATMA 2G3FA 4D8LA 3U2CA 2Y8VA 3UWZA 3H2CA 3UESA 3IJ9A 1XIMA 4DI8A 4C6BA 5D4YA 4UTWC 2J6VA 3DU0A 4L6OA 1QO5A 2WPGA 2ATSA 2VUNA 4A8NA 1XBVA 2QJGA 3K5XA 4IPLA 4PEKA 3RN6A 1BAGA 4Q4MA 1E5NA 1VRXA 1NF0A 4BF7A 1W2VA 2VCCA 3L9CA 3CEUA 4K38A 5M03A 4AG0A 3GNOA 4Q8TA 1K03A 3UZJA 2PWEA 5G4HC 2X30A 4RNIA 1TMHA 3PANA 1DIDA 1NDVA 3G1HA 4N4QA 1XGEA 5GJMA 4N2YA 2DZWA 3PZIA 3C2FA 2W79A 2F38A 1Z9AA 4AZIA 4KS0A 3UYIA 2PRHA 1LRTA 4X22A 5FJRA 1MDLA 3TXZA 2YFNA 5CC7A 4I9TA 1NF7A 1DWGM 2QPSA 2YBTA 2YPIA 1UA3A 4W7UA 3WDIA 2YL6A 3NEHA 4KFPA 1SQ7A 1V6VA 3AXKA 3BURA 3ITOA 4MAZA 1J18A 1FWGC 2EPLX 4MSSA 3WLLA 3O06A 3BG5A 2XIQA 5HQEA 1BF2A 5ENLA 1K3UA 4ZB0A 1X1ZA 1KW1A 4N0RA 3VIIA 3K8KA 1SZRA 1DKWA 2ZX5A 1ZS2A 1XRFA 2H9AA 3MCNA 4CD8A 3C0JA 3L68A 3BGGA 2Y6ZA 4ZFMA 1ZAHA 5C9XA 1NEYA 2Y63A 4G56A 4PUJA 4ORMA 4P7RA 4AF0B 2E6DA 3GG8A 1E9IA 4GOAA 5K4ZA 4HT3A 3D5HA 2Y8UA 4LVBA 1FOBA 3V1HA 4C7DA 3HGRA 4JX6A 1H50A 4LXFA 1JCMP 4A8IA 1JPIA 2BNJA 3GHTA 2OWXA 4IM4A 4GVGA 4PRWA 4LEFA 4HMCA 1DE6A 3GDMA 1UKQA 1P1XA 2HZGA 1QRQA 5C55A 1YNQA 1XWYA 2PD9A 1QR7A 1CXHA 3LENA 1IWAA 3EXRA 3I6RA 1EBHA 4QLJA 5AYYA 1HN1A 1W91A 1FXPA 1ZZMA 3NPWA 3P60A 2CBVA 4DO5A 1WP6A 4LV4A 4AUBA 1OZQA 5FL1A 3EDDA 5HAOA 2DV0A 4LBUA 2WCAA 4GI9A 2CCRA 5JBEA 2ZZ6A 4HNCA 3TTEA 4GX8A 1FWDC 2WC4A 3UCDA 2NQZA 3WQ6A 3POCA 1IYXA 5T26A 2GDUA 2PWDA 3SAZA 3RDKA 4OGZA 4B5UA 3BQ5A 4INFA 3OYXA 3GNRA 5FF2A 4R5EA 1R7OA 3AYSA 4GY7A 3VCNA 2NUWA 3C4UA 3SGGA 4S23A 4U28A 1J0JA 4BHYA 4TTGA 3W2LA 1IWPA 2WMJA 4XBSA 1YBQB 4JKMA 4R7OA 2IKHA 1XBZA 1J93A 4LYQA 3UFYA 3RJYA 3OB8A 1DQWA 2DZUA 2BODX 1E1CB 1AQHA 3Q94A 3ID7A 2RFGA 2XISA 5H91A 2V2CA 1KWKA 1LT8A 3TJLA 3VX0A 1LJYA 4TO8A 4IISA 4ZFCA 4XD4A 3LI1A 1TPUA 3TQ0A 2GGEA 1J6PA 1X8FA 4ZO7A 4WDXA 2NX1A 3FJNA 4R9XA 1JD7A 1VFHA 2POZA 3UR5A 3CQHA 4LEQA 3SCSA 2YB4A 1RK6A 4MB4A 4GWEA 2E77A 2HPMA 1WXJA 1DXIA 4WY0B 4W84A 3SCNA 2J7DA 3QRHA 1KRBC 4K6AA 1P7TB 1EBGA 1TJPA 1TPC1 1R3VA 3PZMA 3ARPA 1KB3A 1FH8A 2O9PA 2ZUTA 1AK5A 1D8CA 3URBA 4GYKA 3GQYA 3LZ5A 2VKZG 1KGXA 1B4KA 3A5FA 5I77A 2JEPA 4O4WA 1VFFA 4A3QA 5LGZA 4BCEA 2QDEA 1OGGA 3U5YA 3MMWA 3QKEA 3CL8A 1S5VA 5BU9A 5JIPA 4QHRA 4F0MA 3HO8A 6PTDA 3QQ1A 2BXZA 3EX3A 4PTMA 5C2XA 4MZ8A 4WKAA 3S2LA 4P7OA 1E40A 3WNMA 3O15A 4NHVA 3KVKA 1R30A 2V5CA 1XIFA 3R0DA 3GXDA 1VLWA 3P74A 3WLQA 5DBTA 4KIEA 5AB3A 1DIKA 4OBSA 1R2SA 2GQ8A 2KAUC 7TIMA 2VCBA 1JZ4A 4Q7BA 1W1ZA 1PEZA 2ZA1A 3GG7A 2G3JA 4MM1A 4QJ4B 1EJ7L 3AXHA 3LG3A 3TJIA 9CGTA 1S2AA 3QMRA 4Y9MA 4CNOA 4DPQA 3R13A 2JIWA 4ACZB 2CITA 1VFTA 1SFLA 3DENA 4ZVJA 4D71A 4GUGA 4W5UA 4GUFA 3A9BA 5K9CA 2DH2A 3CZJA 3WLRA 4LUSA 2E3ZA 2J24A 2REQA 1XIGA 3VMOA 4UQAA 3NWRA 3ERPA 3DFHA 5BXPA 3WQOA 4AISA 3LS9A 2PRLA 1DJWA 4L9XA 1WX0A 3NQCA 4OV9A 2WLYA 1L8NA 2VRQA 2XDFA 3UWYA 3KVJA 3UU0A 2A21A 3FOKA 5JH2A 1MW0A 3CUFA 3IVUA 1BEUA 2DIKA 4B3ZA 5BCAA 5A6SA 3QHNA 5DF0A 4F48A 3ABRA 4P5UA 4ROQA 1UJPA 2ZE3A 4KERA 3W4RA 4GPNA 4HN8A 1XDLA 1V6XA 1NWRA 4RW5A 3BMWA 3LCLA 1BXCA 1OX4B 3K8LA 4JIEA 1GUVA 1P0DA 3LRLA 3ZJ7A 4E5TA 1Z8AA 1PZ3A 3VAVA 4LNCA 3L2IA 2V30A 3PNUA 1MRAA 4ECLA 1OT2A 1GCYA 1GQJA 1US3A 2ACUA 1EGMA 3F4DA 2VVNA 3B40A 4YCPA 2G41A 3VU2A 4J3TA 3TONA 3VDHA 3S1XA 2ZRYA 3LHZA 4DZHA 1Z89A 2PSNA 1X98A 1Q4NX 1EYWA 1P6CA 3VIHA 2NV1A 3QSTA 1LROA 1K6AA 2YL5A 2VC6A 3MZNA 1OYCA 3E49A 3G77A 1JEZA 3P67A 4H8NA 2WZHA 3EEGA 1YDVA 1ZBCA 4DAIA 5LGXA 2CLIA 3WQGA 4OQVA 1E51A 1UUMA 1MQPA 1GOWA 3F4WA 3WLOA 2B81A 1AVAA 4MB3A 3NQMA 4AMCA 1E4NA 2GSJA 1YLVA 1M7XA 1L6YA 3S6DA 3H23A 3UXLA 4IH3A 3ZFHA 4JBRA 2A79A 3VNLA 4JTTA 1H41A 4QBXA 3ARVA 3HQNA 4GQQA 1KNWA 4RK8A 5KMYA 1IWBA 3NM3A 5FAJA 4D6GA 2QV4A 1XV8A 3II1A 4GGBA 1XFCA 4B5WA 3CV1A 3OTRA 4IIDA 4YHGA 3SN0A 1LT7A 2BTMA 2X0SA 2FHBA 2ZX8A 1UKSA 1V7YA 3TTOA 2YIHA 1US2A 2PODA 3P81A 2V5LA 4PYSA 1VB9A 2QPUA 2Z0IA 3BAJA 3HPXA 1W2PA 1V3JA 4D2JA 1NOWA 4C6KA 3UA3A 3I7QA 4XAFA 2X16A 1JGMA 2HTMA 4IGHA 1ISWA 2VNCA 1OWQA 1R0MA 4C1NA 1V02E 3M0KA 3ALGA 3LD5A 3BE7A 3RPDA 1BVNP 4YVXA 5HWNA 1V5XA 1KM2A 1SW3A 1Z42A 2JIEA 2G96A 1C91A 4US5D 3CJPA 1BRLA 1K9FA 1XLMA 3B8VA 1TMLA 2E6YA 4AC1X 1LDCA 3EB2A 5CZ0A 4LJ3A 3VOJA 3ZLFA 3ZXWA 3EXSA 4FHAA 4QCEA 2BSLA 4S39A 4GQ0A 2NLIA 5AYBA 3W7QA 4EX4A 3APTA 4I6VA 1XF0A 3W38A 2D23A 2IQTA 4O0QA 2RDXA 3UW6A 3QM3A 2HNHA 1P0EA 3TYEA 4IQLA 3NGJA 4MYAA 3RLUA 3BDKA 4MNMA 4H00A 3EEZA 4XZBA 4LOCA 4ZSTA 1NWTA 3D3AA 2ALDA 2V6AA 4NYUA 4Q4PA 1MMFA 3W88A 1P43A 1UR0A 3C8FA 4DBUA 5H2ZA 5MHBA 3HG4A 1QFEA 3R79A 3W1PA 4PCSA 3HGSA 1RY0A 4S3EA 3R7MA 3AHZA 2Z26A 4UR7A 3OQ8A 1F3TA 5CG7A 5HBFA 3HN3A 2XGZA 3SUSA 2XIBA 4PUUA 5CZJA 3S9IA 1VZWA 2QUMA 3BZJA 3VIFA 1ZJHA 4N9CA 4JIIX 1W1VA 4Q6XA 4HP5A 1UPMB 3E2SA 4C6NA 2ONEA 4CN6A 4I7VA 5CGMA 3EOEA 1SZEA 1E0XA 1DE5A 1XUZA 4LAUA 4UTJA 5D32A 4PMYA 3L0GA 3TWBA 3MWCA 1QMLA 3UXDA 1DL3A 1JGIA 2VEGA 2WB5A 4AHPA 5HDRA 2Y24A 3UG8A 3TUUA 4AY1A 2AL2A 3CT7A 4CVWA 3D6NA 5BRBA 4MFDA 4FF7A 4DUVA 1G4SA 3WDPP 3RF9A 4L80A 2O9OA 2QCMA 3CTLA 1WCGA 4AYSA 3TTYA 2IQ0A 2WSQA 1NP2A 3L21A 3FSUA 1CCWB 4BF5A 3N2MA 4DWDA 1KTNA 2A85A 4JS3A 1TG7A 1LBLA 4QFUA 2XFYA 2WJZA 2UBPC 1R3TA 2BVDA 4E4UA 4P7QA 4NJHA 5XINA 2XPKA 2QJMA 4RE2A 2PEVA 3EOOA 5HPOA 1UPPA 1RZMA 2J9XA 4A4AA 4EACA 2IMRA 1ZPTA 4EWND 1NAL1 3GR8A 3K1DA 1CENA 1CDGA 4J2PA 1OF8A 5D38A 3H22A 2ACSA 2CZ5A 4HZ6A 2I56A 1A5CA 1KFCA 4ZOCA 2HRWA 1ODZA 3B8SA 1KM6A 1TVLA 4O10A 3H7UA 2SFPA 1YRRA 5TIMA 5LHEA 3IRDA 1ZUAX 5HJYA 1US0A 1AD1A 1BF6A 1GKQA 4DUOA 1NJJA 4OUEA 4CCZA 4W7WA 4IFRA 2C79A 3BL3A 3WJZA 1X7IA 3LCWA 4Q3MA 1QTWA 1Q7QA 4LUYA 3B97A 2PDHA 2D1ZA 1LUCA 3PSWA 4UFHA 1I1WA 4FB7A 3PWAA 2ZXBA 4KFOA 2ZUVA 3G22A 4PGLA 4JQ4A 3V0TA 3DN5A 4J7RA 1KRAC 2GJLA 4HBKA 1XLEA 2GJPA 2GL5A 1V6YA 7CGTA 2TPSA 1HTIA 4C6EA 4IQJA 3LQLA 2PDQA 3W81A 4Z1CA 2QCDA 1SO5A 3LPOA 4JNYA 2P8BA 1YPXA 4UOQA 1FHLA 3DI1A 3VD5A 2BY0A 3KS6A 4GC3A 1JZ2A 3T09A 4KF1A 4IIFA 4M82A 3B4YA 3GG1A 1VJSA 2R1NA 3UXKA 5J5RA 2O9TA 1G6CA 4MADA 4WOQA 4JQ1A 5HATA 1CI1A 4L4OA 1C93A 2J66A 4B5TA 2V82A 1OD8A 4LT9A 4RZ5A 2WOQA 2V67A 2CW6A 1P0KA 1F5ZA 2ZZ1A 3PZOA 1XQKA 3MDWA 2CEQA 4UFMA 3W1LA 4CCEA 4O1FA 3QLDA 1VAHA 4N42A 2GGHA 2ZKMX 4YXGA 4GJIA 3VNYA 5FESA 1OC5A 2YCEA 4GUJA 4XZHA 5CPSA 5BZAA 1K1DA 1K7FA 5LIKX 4REQA 3F4NA 1XKYA 4UXDA 5FA5A 4PL1A 3WF3A 1PUDA 3GK0A 3KOFA 4MKNA 1DORA 4IHCA 5EU9A 3PBMA 2VURA 4WCJA 3FXYA 1GYMA 4UWMA 3QR1A 3O6YX 4FK9A 4LAZA 4NSBA 1C7SA 5GPRA 1EP2A 5BWAA 1UP3A 6XIAA 4S3AA 5LIXX 3CIWA 3GFZA 2GVJA 3QY8A 3OIXA 1GZGA 3BCDA 4GX9A 4E2OA 4H8UA 4XD5A 1OGBA 4EF8A 4HVXA 1XRSA 3HU7A 3K4WA 1X38A 2PMQA 3THUA 3GM8A 3V0SA 2XIJA 5A69A 3LXAA 4WXZA 4I5RA 4LUTB 2CKSA 4L64A 3WEMA 4J9JA 3TC3A 4F0HA 4PA8A 1XG4A 2P3EA 3ES7A 3B03A 2OSWA 6XIMA 2WJDA 4OZOA 4NAEB 2HVMA 3JW7A 3LHWA 3SJNA 4OBRA 1XLGA 5CPMA 2IQDA 3AYVA 5HWMA 3SUUA 4CD4A 2NWSA 1XUUA 3A9IA 3AICA 1TJRA 1E1EA 3GAYA 3BC9A 4O1AA 5EL1A 4MNJA 1TTJA 3AJ7A 4ADTA 1F3WA 3N04A 3FFSA 2VR5A 4ZODA 4Z2JA 2I7GA 1Y5XA 1N8FA 4RE0A 4MAVA 2A1YA 4PMJA 3C61A 4HYVA 4BZYA 3NVDA 2Q02A 1IT0A 1FWJC 4IJBA 4R3UA 2XGBA 2NZLA 2FZNA 1KR0A 2ZIDA 3B9DA 1VQTA 2PGFA 5FF7A 3W26A 2WVTA 4JDBA 5IRPA 4AWUA 1OFBA 2QNEA 4UFLA 1OYBA 2FTPA 1QI5A 4QNWA 1E70M 7REQA 3QGVA 3S5ZA 4QX4A 2D73A 4MJMA 4G2DA 4O1EA 1VPQA 3NOYA 2CLLA 4KW2A 2GGIA 3LMZA 1RQHA 3C2EA 5I3JA 3BJSA 3TA9A 2ZX7A 4TUFA 1JIBA 1F6KA 3HG3A 1ZB5A 1WDSA 1JUEA 1W3LA 2FQIA 4F79A 1SSGA 1T99A 2ZQ0A 4FLSA 1MI3A 4KIRA 4OE7A 3IGXA 1DWIM 3WEZA 3OYZA 2D0FA 3GVWA 3EDKA 3O8AA 3HPZA 1EA9C 2PTXA 2XTKA 3LA4A 3DC8A 2QW5A 3EMQA 2WXDM 4V1XA 1VIWA 3BG9A 2PTWA 3BZGA 5A6KA 2PDGA 1XLAA 3PFRA 4J27A 1YDOA 2FZ9A 4B3KA 1IT8A 1LQAA 3NUKA 2Z1WA 1J96A 3GNDA 4MDPA 3EOLA 2A5HA 1A5NC 1IEWA 2PF8A 1ITCA 2GWGA 2Z1BA 1XLCA 1DTUA 2RJGA 1KFEA 1GVEA 1VYPX 2UV8G 4LRTA 4O4VA 3U48A 3W7OA 1ZTVA 1RBAA 1Z6KA 2YBVA 1PX3A 1YX1A 3DGRA 4PTXA 5EMYA 5A2AA 3C2RA 1OK6A 3CAKA 2VZVA 1R38A 4R27A 1JF5A 3GW3A 2OG9A 1WAWA 2OFJA 5AN7A 3PAJA 4O1CA 2OGYA 1ISYA 4QROA 4YPJA 2Y88A 2F6XA 1Q2RA 2VT0A 2WVVA 4HPHA 1BG9A 4JAWA 1Q5MA 3F4CA 4IMFA 1WDQA 3EBVA 1JCYA 3P0XA 1FWHC 3NQAA 3WLMA 5ECUA 4DZ5A 2CZDA 1YKWA 2C1GA 2WM1A 7A3HA 3S42A 3M5VA 1EF3A 3HA1A 5HMEA 5ABFB 1E4MM 1SGJA 1QW7A 4BI7A 1QI3A 3QV6A 1B3YA 3WLNA 5FOOA 1L6GA 1FWNA 2QUNA 4DF2A 1SJAA 3WK1A 2R82A 2VX5A 4ZBCA 4HNVA 1Q2SA 2C6QA 3PPFA 2DT2A 1AQMA 1VFSA 4GQBA 5A6BA 3W01A 2V2DA 3VGGA 3L5MA 1RJPA 1KC7A 5F4SA 2CKRA 3R0KA 2PGWA 2XG9A 3W83A 1I2RA 4WQ6A 3ZVIA 3LPPA 1OGSA 3WNNA 2WMKA 5U7SA 4K68A 3G1VA 3FEMA 1E43A 4ALDA 4FXJA 3VK5A 1T6MA 2YGYA 4BWLA 3TP4A 3OODA 3W7MA 2WW5A 3UZZA 3W86A 4H9ZA 1YW1A 3MW7A 3QY7A 5A8QA 3FIGA 3KAOA 4Q22A 4QE5A 5KSWA 2IPFA 2B7PA 1KXQA 3MP5A 3TYCA 3V5OA 5AC5A 2NQLA 3O16A 4IX2A 5IHRA 1MW2A 5FD0A 2DUXA 5CSRA 1YTKA 2QGHA 4QQ3A 1ZJAA 2PWVA 3SDOA 3H26A 2ESCA 4JTQA 4B5VA 5CG0A 1DJYA 4IIEA 2OT1A 3AZTA 3MJMA 1AG1O 4GGHA 5JXQA 4YJ5A 4E8CA 2BOGX 3VCCA 2UY5A 3CT2A 3MV11 4N9EA 3WLKX 3RR4A 4EIVA 3GIPA 2W9MA 1C8QA 3HQPA 1FFQA 5I03A 5HJLA 5AKQA 1BSIA 4GVIA 1RCXB 3KBMA 1X97A 4LY8A 1E6PA 2DZAA 4RDWA 2VELA 1CXIA 3KRZA 3UGVA 2VOMA 1J6OA 3KW3A 5PTDA 4KH2A 3BW4A 3CUJA 2VDGA 5HINA 3IGHX 4E38A 4AH7A 1VCGA 1V08A 2HQAA 2WM0A 2FPTA 2AMXA 3EWYA 4M24A 3BLDA 3S1UA 1XLFA 3NO1A 1XG3A 3ARQA 2A0NA 3HG2A 4ZXLA 3WLHA 2D0GA 3AIBA 3CH0A 4JTAA 3NTYA 1TSIA 2EPMX 2RAGA 5EFFA 2ZA3A 4D6JA 5HMSA 4TOQA 1W5OA 1UR2A 4IMGA 3SRFA 3GX9A 1D3CA 3FJLA 1LORA 3VD3A 2DSVA 2V5KA 3SEPA 4HNLA 4O1DA 2XIMA 1VYRA 2Y4SA 3NPXA 3LLDA 4W9TA 1RPXA 2WSRA 3NR0A 2TMDA 1XC6A 4QM1A 2C7FA 1MFUA 5HR6A 1H5YA 4U5KA 2O7SA 1XC4A 3F1QA 3ABZA 2TYSA 5EMLA 4UTMA 1MNSA 3BLLA 3DFTA 1P48A 5M3WA 3NQ8A 3IVSA 1OX5A 2FGZA 1EJVC 5C9UA 1ZGDA 1JZ7A 5FEWA 1J2WA 1V79A 2ZTKA 4PRRA 1RD5A 3S3GA 4AZCA 3RM9A 3E12A 3W7GA 3ZWSA 2PDUA 3QTPA 3A24A 1UH3A 3CIXA 1FCUA 3TU9A 4G8TA 5LIUX 3TJ4A 3BCJA 3ZT6A 4O8AA 1ZAIA 3NYDA 1JL8A 2BZNA 3MY9A 3WX7A 2W92A 1X6UA 4JTFA 2I9EA 2XVKA 1HJXA 4TMBA 2OO0A 3NQ6A 3L5LA 2X2YA 3W7CA 3TN6A 4L61A 1NWUA 2ZUNA 3AHYA 3CEPA 1MSSA 3TCSA 5JBFA 2ACQA 1JCLA 4L1WA 2BP1A 2ZWZA 1K70A 2PB1A 2J78A 3MMUA 2Y7GA 1EPXA 5LNWA 3BSGA 4W89A 4LCQA 5BXRA 3C8NA 3SCOA 3KRBA 1S5MA 1SFTA 2IXUA 3WNOA 3R8HA 4D72A 3LTSA 1IXNA 5EKYA 4UTWA 3WQ4A 2P10A 3DG7A 1W1IE 2WWDA 3AZSA 4XTIA 5I23A 4UTUA 4PCTA 2EPOA 3QVQA 2RGLA 4O50A 3UR2A 3OG3A 1IF2A 4QQUA 2GK1B 5EYWA 3FVMA 2UY3A 5AOUA 4B92A 5KZMA 2CHRA 1BHGA 2R1PA 1EGZA 2XVPA 2V3GA 5IDIA 3W1AA 2BVWA 1PS9A 3VI2A 4TV6A 2QCHA 1QT1A 3U5UA 4ZGYA 2NT1A 1DBTA 4IP7A 1NIUA 3Q2DA 3L7RA 4LF2A 5GJPA 4M6QA 2EG7A 1EO7A 5FJJA 1K9EA 3CPRA 3B0PA 2YFOA 5LA2A 1QO2A 3P5YA 1ICQA 4XKYA 4DO6A 5JU6A 1GNXA 4RXFA 1H7XA 2Q8LA 4W8AA 3VD4A 4J3ZA 4I7WA 2YX0A 3H7RA 3MU7A 4KKXA 1UH4A 3PFMA 1QNPA 3OPSA 2X0HA 3L4XA 3PBGA 5HANA 4NXSA 1R6WA 4BFAA 2C91A 5CSYA 5DXYA 3VINA 5C9WA 3OZMA 1M1BA 2R14A 3W71A 1BKSA 4DYKA 3W23A 3BAXA 3CUGA 3S47A 3GZ3A 1J79A 1HL2A 1GGOA 4ZE5A 2Z28A 2NQ5A 3KP0A 1PZ1A 2V81A 2CLHA 1WZAA 2R9RA 1E6NA 2OSYA 2J62A 1PIGA 5I3FA 4IFKA 4LS2A 1AMYA 3C6CA 5FI8A 3FDKA 3C52A 2FHFA 3W7RA 3A6OA 2DT3A 3FGCB 1U22A 1SU5A 3LRKA 4RL3A 3KBSA 5HMFA 3WMLA 1V51A 3DI0A 3CL7A 1F9CA 3IIVA 2DFAA 3B9NA 1H61A 1X96A 3FYYA 1V03A 1W3NA 3G3DA 6ENLA 2OB3A 2AGTA 4XK2A 3VIPA 2CERA 4AB4A 1UOKA 3HJZA 1C9DA 1XJBA 1EOMA 4CD5A 3P0WA 1CEOA 1WUFA 3W7HA 2WKJA 4JXCA 2J9ZA 2PDIA 3H2MA 2WZIA 2NWRA 5JUVA 2HK1A 2JF6A 3V5FA 1IZKA 1F7BA 3KUMA 5KINA 1MEWA 3L4UA 4FX8A 3HOJA 1TJ0A 2W5FA 3ENLA 5FJTA 3M43A 3W2MA 1P6WA 4O16A 1EP3A 1H2JA 1UWAA 3ZMRA 2FVKA 1S3HA 2VFIA 1XCXA 4NVTA 5AC7A 3B8WA 3GAKA 1TTQA 1UMLA 2A3CA 1GKPA 3W0KA 3QV8A 1EP1A 3PB0A 2XVGA 1ITUA 3VNDA 3IJIA 4EPBC 3PZVA 3SN4A 4PMDA 3GVGA 3WD2A 3C0SA 3CB3A 2OYLA 3W7PA 1UC5A 4DWSB 5AFDA 3EDFA 3BARA 3CZ8A 5HQMA 5I6SA 4HK6A 4UQCA 2OZ3A 3NFUA 3NSXA 2QAPA 3TN4A 2V8ZA 3MZ2A 2A3BA 5AECA 3T0AA 1KV8A 4F0KA 2B7NA 5KZDA 2R8WA 3EWXA 4MMWA 3B9OA 4UQEA 1R8LA 2ADAA 2PA6A 4P8UA 4UZUA 1W9BM 3AU2A 3K8MA 3KTCA 4LVDA 4JFUA 2P53A 3KBWA 1WE5A 3M47A 3IGSA 5DRCA 4XUYA 2VEPA 3E38A 1HX0A 4GFSA 1RVGA 3DKLA 1RP9A 1A3HA 4UTTC 1G1YA 4ZTYA 2Z2UA 2YSWA 3LGEA 3FYPA 1JZ5A 2OX4A 4FS9A 1V7AA 1Q6OA 4J40A 3A13A 3GIQA 4FEZA 1IQ8A 3VGEA 3ZS4A 2V5DA 3CLMA 4LSBA 4WD0A 3RU8X 4ZQRA 2GJXA 4QJ3B 2EGZA 3THDA 1VCVA 2G5WA 3ITTA 2VZSA 3B3DA 3NOEA 3LEPA 4QISA 7PTDA 4CUCA 1WDWA 4Q4KA 3V36A 3TTSA 2IPWA 2CU0A 3HFYA 3WUEA 1TV5A 3C2YA 2EQDA 1DJZA 2WK2A 1P0NA 3XINA 3N29A 1T96A 3EOSA 4GO8A 1DIOA 3CZEA 2WSYA 1GK8A 3KBJA 3HF3A 1QWKA 3IUIA 4GXPA 2ACRA 1DTNA 2GQ9A 3KTSA 1FP9A 1Z7AA 3DX5A 5F2IA 1K02A 3MPGA 1HKMA 3EX6A 5TNVA 1GEHA 2BOEX 2WPBA 3PC0A 1KBLA 1ZBKA 4AD5A 5BRPA 1B3WA 1YQ2A 4YCOA 4E3TA 3H2FA 2YYTA 4HNOA 3PY2A 2OEKA 1HL9A 4UFKA 4AWTA 1QW8A 2PPGA 2HE8A 1TJ2A 1UWSA 1Q66A 3MUIA 4HNNA 4Z2GA 4JTEA 2HMCA 1WDPA 3MYPA 4MWAD 1IGSA 2PWGA 2HXTA 4XV0A 4PMQA 1TMQA 5HXMA 4K8EA 2CZEA 1DEDA 4A22A 3MCMA 3VDAA 4EAYA 2J75A 2OOFA 2EKCA 1HGWA 3CV6A 3GXIA 3UPWA 1IT7A 1TKKA 4QSHA 2GJNA 1KBJA 2Z24A 5AVHA 4LAKA 3WQDA 1XYZA 3RG6A 1I2OA 3MBDA 1WNOA 3GLCA 1A5LC 1TPFA 3QN3A 1C8VA 2X7VA 4H9XA 2CC0A 1N82A 3C2VA 1U5JA 3W00A 4R7WA 4KWWA 4HCHA 1J8VA 1JDEA 2HJPA 1QCWA 3GSMA 4XTDA 3SIMA 3G0UA 1EQCA 2FMOA 4G7EB 1KLZA 3W1RA 3AQUA 1F05A 3ALFA 1UC4A 1XIEA 1D9EA 4AHQA 4V27A 1TQXA 2QUTA 3OEXA 4QDWA 2BHYA 1TX0A 3M1ZA 3UEQA 3IJDA 3GYCA 4HA1A 1XINA 3PS7A 5BROA 4IFOA 1OCNA 5HNTA 1GOOA 2Y7FA 3TFCA 3ZSTA 4U2ZA 1OFDA 3EDEA 1OFOA 3L23A 3WENA 2F2KA 4H8HA 1UKOA 3IGUA 4XZNX 3UZWA 3IPWA 4GG9A 1DP0A 4TR9A 1M65A 1W17A 3WLIA 1LOSA 1BXNA 4XIAA 3VFLA 4CNSA 3Q58A 1VBHA 1KM3A 2AAMA 1NQ6A 1ICPA 4WEVX 2I17A 4W8BA 3EOUA 4PMNA 1ECQA 4S2CA 3W9ZA 3TQVA 1TE1A 4GYPC 4B5NA 2Q8XA 2KZHA 2OLSA 3AYTA 3SCVA 3LCFA 2J7BA 3CTTA 5CJ5A 1EUNA 4JTIA 3H4WA 1EJUC 2OGJA 3E6EA 3V3WA 3GUWA 2QDHA 1XIDA 1KFKA 3M46A 3INPA 3MV01 1YYAA 2YOCA 1QOQA 4M7SA 3IIOA 1VF8A 3OBAA 2QLYA 3LGGA 5CQ1A 2EHHA 3B8TA 1A5AA 3T05A 2ZYFA 2QCCA 4Z42C 1CGYA 3WY1A 1G4TA 3G6LA 1QPNA 2UWFA 4OVXA 3RM8A 4Y6GA 1JUBA 3GU9A 2B31A 5CSUA 3AROA 3WMBA 3AYRA 5LHFA 1FWAC 1SM9A 3ITYA 3CMJA 1NU5A 4WRHA 4LWWA 1UWQA 2MANA 2YXXA 3ITVA 4CU6A 2ZZ4A 5BXSA 4XSLA 1UA7A 3CHDA 4V15A 3BLKA 4KBXA 3QV9A 4RNFA 4QRNA 5KTLA 3R12A 4YVVA 4HPGA 3BLEA 4HN4A 5GNYA 1HKWA 1WKFA 3WLTA 3R5EA 4HA3A 3SZ8A 1X6NA 2G3IA 3GZAA 3O1NA 4PL2A 1IXPA 2DSZA 2Q01A 3EPMA 5D2VA 4C1LA 3U3HA 1HKKA 3GTFA 4AZ6A 3BW3A 4F9JA 4OKDA 4O18A 1GKRA 3KDNA 1XD0A 4A05A 3E2QA 2J88A 3WL1A 4NI3A 1W37A 2OYMA 3IWPA 4IMCA 3T0DA 3S83A 3VTRA 3VMPA 1Z41A 5CLWA 4K36A 2FGLA 5E1QA 5E6YA 3IIXA 1TUXA 1OX6A 4NKCA 3RM4A 1C90A 3OIHA 5I3HA 3S46A 2WMFA 3N34A 1VEPA 3G1YA 4GNJA 1CIUA 3W1XA 1VFMA 1EGVA 2FIQA 3BJTA 3G6MA 4MIMA 1SSDA 4FZIA 3GTNA 3MYOA 4XZMX 2BGQA 2GGJA 3CAWA 3GTHA 4L56A 3QFWA 5T9BG 1Z44A 4Q8PA 1EZWA 4C6OA 2VDIA 4GY0A 1Y0EA 1OBAA 1CB7B 4IICA 4L1GA 5XIMA 1UR3M 2PS2A 5ABHA 3ABXA 1YXDA 1R9YA 4F66A 8A3HA 4RPPA 2ZADA 1AZ1A 4F0LA 1R7AA 3URAA 2QMJA 3WF1A 2FH6A 6CGTA 4MWAC 3MUXA 1EHNA 4FMVA 2V3DA 4O14A 4QJ5B 3GR7A 3MUY1 3DUGA 4F9DA 1PBGA 3IUHA 1DPMA 4NQ1A 2NXHA 2ZCGA 3UCCA 1SJDA 3G1XA 5CBJA 3T78A 4OIFA 3WD0A 4AX6A 5CC3A 5HULA 1QNRA 2HVNA 1EPVA 3AIEA 1XX1A 5K7JA 2GSEA 2PCQA 2H8XA 4YWSA 4JIRA 1TTIA 2I9UA 1WB0A 4RE3A 4NZCA 4S3DA 5A95A 3F5LA 1QDSA 4IXHA 3U9IA 2C19A 1RPKA 3U2OA 4ADUA 3UETA 2PZNA 3CYJA 3PR2A 2NUYA 4GO9A 5C5YA 4S38A 4J28A 1TQJA 1T40A 4Z2LA 1GG0A 2PBGA 1CGXA 3KVLA 3CHEA 3UNTA 2FZ8A 4X9SA 3RMJA 3PP7A 3N9SA 4HNTA 2FGBA 2XN2A 4Z08A 4XBKA 3WH9A 1KFLA 2PTZA 1F4AA 3R6IA 2H9AB 2ABAA 3PUOA 4PB5A 4B4FA 4O19A 1HQTA 3QPYA 1MXSA 2Q3OA 4O53A 3CMFA 3OGSA 2O56A 2JFEX 4JNMA 4YTQA 3WQWA 4RCXA 1POKA 4PH6A 2WNQA 1PX4A 4J35A 2DGAA 3EGJA 1LL4A 5AVNA 1AH0A 3T4WA 3O6DA 1KGWA 3T1GA 3F5KA 2X41A 2DJLA 4IG2A 1TR1A 5CZTA 1JR1A 4E2BA 4WVXA 2G95A 5KETA 1MQQA 1M6JA 1UIPA 2LLEA 1XYAA 3CL6A 3GTIA 1I1XA 3LTYA 4B91A 4ATDA 3T4CA 2EBNA 2NW0A 2ZUSA 4LRSA 5H6HA 3T2PA 3B4UA 4M3PA 3EPOA 4S3CA 4HHPA 1TVNA 2D0HA 1PIIA 4TV5A 2VQUA 2C13A 2E1DA 5CC5A 4IZGA 4BR1A 1F6PA 1OC6A 3G8RA 3CV7A 4F0SA 3CU2A 3C0QA 5EY5A 1EB3A 2WLZA 3WK3A 1BYCA 4NX0A 4GIYA 1D3GA 5AHIA 2ASHA 2ZRWA 1OCJA 2UZ9A 1TWZA 2ZZ3A 3IS4A 3DHPA 4LUJA 4HD5A 1R9ZA 3AUOA 3EMCA 4PULA 2OZ8A 4PSPA 1OFAA 3PPHA 1IEVA 4MUZA 4BQ4A 5C7VA 3ATYA 5E0FA 1V0KA 3TN3A 1KRMA 1V0MA 2WAGA 1PHQA 3FJ4A 4M8UA 3BG3A 5EMKA 1LLWA 4NAFA 1RSCA 1M68A 2YDRA 4GQRA 2HBVA 3K1GA 1NSJA 3CH9A 4AWEA 4OT7A 4F8XA 2X1RA 2G97A 2NV2A 2R94A 2A6NA 3RO8A 3MVIA 5E93A 3WQEA 3BO9A 4O57A 4KCVA 4YS1A 4H7CA 1S5TA 3M07A 3TAKA 3QFEA 4O15A 1NVMA 3R89A 1CYGA 1V3KA 2ZDSA 1KCZA 4PCPA 3Q45A 4JTGA 2ZXDA 1XFBA 1ADOA 1FRBA 5D30A 2F61A 4Z17A 2PDLA 1XSIA 3N6HA 1R5YA 3DEQA 4US5A 4JQAA 2OWCA 2YJQA 3TK7A 3T7VA 1RJQA 3KS5A 4PUNA 1WYIA 3HG5A 4B15A 2VQTA 3SCQA 2BMBA 2J77A 3A3WA 2CESA 1EEPA 4L1XA 4LFYA 4Z1BA 1M3UA 3WFZA 2J4GA 4OV4A 3TQPA 5B7YA 2V68A 1A5SA 3TNBA 4FLRA 3ZR4A 3FNDA 3TA6A 5DANA 1DQXA 1XW8A 1EDGA 2GOUA 1YXYA 3GH4A 5A6JA 1R3WA 1OFQA 5MF5A 4A8LA 1XLIA 4DJEC 2FTWA 3I7RA 1R9XA 1OVDA 1TIMA 1H7PA 1B9ZA 1ZBWA 1TFVA 3UG3A 5LZLA 2J9YA 1S2TA 3DFPA 3H24A 2ZOXA 2DZBA 3NO3A 3E2RA 3NZ1A 4PUEA 1V8EA 1S3TC 3WDHA 3H2AA 3QQ0A 5LNSA 2VFGA 4J3VA 5BNKA 3W2KA 5AHEA 3N11A 2WHJA 3S6TA 2A7PA 3JUGA 2OT0A 3LSCA 1G0CA 1IR2A 3S9ZA 3ARTA 5DCDA 4B3LA 4M5PA 2WMIA 3DFYA 4BQ2A 3KOYA 1H51A 1YEYA 2WCSA 4I9JA 3WQ8A 3AMCA 1O95A 1HF6A 3KL5A 3BOXA 2OWWA 1C8XA 1XHGA 4O11A 4LUSB 1TIWA 1ELSA 2REQB 3P8IA 4KRTA 3GWQA 3USBA 3FN9A 1GTHA 3DYMA 3BVJA 3LZ3A 4MGGA 3UQNA 1TELA 4GFIA 1N7KA 3SW6A 3NSNA 3DKJA 3U2ZA 3ITGA 4J5NA 3RYSA 2Z1KA 4AEEA 1TA3A 5C0QA 1AW2A 1BKHA 4Q8OA 3MMDA 1AH3A 3B0VC 1GVSA 4OOUA 5REQA 2D2HA 4G9PA 4MJZA 1GJPA 2RGMA 1FHVA 2VMFA 3CQKA 1RH9A 1E71M 3L4WA 4PMUA 2Z1XA 2VRKA 1UHVA 3TLLA 1GTEA 3QZ6A 1VPXA 3AIWA 4NRRA 3VIOA 3HIJA 3WBXA 2Z27A 1DYSA 3M0ZA 3AWNA 1L0PA 2R1LA 4M19A 2V2HA 3M5ZA 4K7VA 1EUAA 4UTHA 2GPTA 4LQ1A 3GH7A 4HSOA 5LNVA 1TPVA 1Q8AA 4CNPA 3WK2A 3U4FA 1FWSA 4N02A 1K4GA 1WXYA 3WH5A 3M44A 3LY0A 5K9DA 4HMDA 4JQ3A 4I3GA 5CJMA 2XWEA 3R8RA 2NLYA 5CZSA 1XPGA 4MYXA 3MKVA 4CQDA 3I6TA 4H7VA 4OUIA 3TEVA 4DNMA 4LVGA 4JTSA 4HSHA 4RDZA 3S2JA 1CECA 2XFWA 4J3UA 1XLHA 2ZBTA 3WNLA 4DUWA 1JZ6A 3MHUA 4ZENA 4QDMA 3OHIA 2C15A 2DSWA 4YHEA 4AZHA 3ECQA 2NVCA 4JN8A 2EPKX 3EXTA 3EYPA 4NRSA 1YDYA 1WZKA 4KMQA 2VCAA 3ARXA 4UFJA 1Q6EA 4PBFA 1QPRA 4N7QA 3CV2A 1RD6A 4DJDD 3OGVA 2UY4A 2V69A 4YTRA 6TAAA 2BASA 3EAUA 4W4QA 4AYGA 3M41A 1FKWA 4FIRA 4D6FA 4AVFA 1Y5VA 3RCNA 3TCEA 2FYMA 1J2BA 4XZWA 2WKGA 3BLFA 3NSMA 1J0YA 3SY5A 3TIMA 3WUBA 4ZE4A 4HMNA 5DX7A 2V9DA 3GHUA 1RY8A 4S3GA 2YL8A 3B06A 5EA9A 3ARRA 1W1PA 5AZ0A 5BMWA 3R94A 1ZBVA 2C0AA 4UTFA 2YR1A 1Q6FA 4JZ5A 4WZHA 5DN1A 4BA0A 4IX0A 5DXXA 2VC7A 2QULA 4WSJA 5I3KA 4UMBA 3VVGA 3LBOA 3JS3A 1OYAA 4R53A 1VEOA 1W32A 1JDDA 1GONA 3H7VA 1E4IA 3E3HA 4C1NB 4CD6A 1HZYA 4LH8A 3BLIA 1F4HA 1IXQA 3PB2A 3R43A 3TV8A 1JPMA 1EA0A 1EXBA 2VTFA 1W3JA 1KBIA 3W7LA 4B5XA 1NTHA 4M1BA 4R34A 3WUGA 2INEA 1JD9A 4NXKA 1SZGA 3WBAA 1KCKA 3VOGA 2Z2AA 4PBGA 1BRLB 2WVSA 4ML9A 5HUOA 5DMYA 3SCPA 1KFJA 4FLOA 3SY1A 2VXNA 4FNUA 3OBEA 1NY1A 5IXEA 3KXQA 2CPUA 2ODOA 5HNRA 1KM5A 4IIGA 1TZ9A 1CB2A 2O4MA 4HTYA 2GJRA 3I3EA 4XZIA 1UBPC 2G4JA 1SZNA 3QPZA 1HP5A 1IR1A 2HROA 1W3TA 1W3HA 3QEZA 3BGAA 4RNJA 1M7OA 3W7IA 4CQ9A 5JVLA 4H01A 5A1AA 1A0EA 1EJXC 3RK8A 1VGAA 3WYZA 5GJNA 3CWHA 2CXEA 3DXIA 1M03A 1V02A 1UZHA 3EX2A 4ONVA 5KZ6A 2PTYA 1ISVA 2ON3A 1J10A 4MFEA 3ARZA 1GOKA 5EPDA 1UMYA 4MY1A 2YW3A 2QCGA 4PMVA 1IXOA 2Z25A 3ITXA 3MT1A 6REQA 3LHYA 2VFEA 3OVRA 4JFSA 3TYUA 3P3BA 3GHRA 3E1F1 2O9RA 4C60A 3FA5A 3TNOA 3M0VA 2A4AA 5K4XA 2X2GA 4K1WA 2WBGA 4MZ1A 4ZXOA 2WJEA 3G24A 1KXTA 4NX5A 3VPLA 5JH1A 1GHSA 3W53A 1F61A 1WXZA 4PTWA 3SFKA 4FSAA 5CCZA 2YCLA 4LC6A 4BS0A 1TWIA 3M6YA 3ICJA 5H8UA 3EWUA 1SR9A 1XH0A 1TTPA 2AL2B 3TC7A 3UY7A 2G50A 1PKNA 1UQYA 3BH4A 4QJ1A 2YLLA 5FF4A 4HHHA 5FF0A 2AQWA 2VYOA 1ADDA 4FOJA 1UH2A 4PRTA 4EKJA 1LOQA 3BUVA 3VKDA 2EPHA 3VC5A 1NQKA 2H6RA 4WGXA 1LQ0A 2B4GA 4D6CA 3HURA 3D3FA 3LV6A 2Y61A 3NDOA 3KFTA 1CGUA 1XLKA 2VGIA 1V6WA 5DLCA 3GXTA 3MO7A 3GBDA 2Y8KA 3EB3A 3TW6A 4Q4OA 1MYRA 2CNCA 4LAOA 3MHFA 4M6UA 1KFBA 5MKGA 3PM6A 3L66A 2HSAA 3QYSA 4WY0F 4Q8MA 1W5PA 1XP3A 4RDVA 1SO6A 5HR7A 3S2MA 1W9DM 4S3JA 1H11A 3CLWA 1EF2A 1GZJA 2CLPA 1V77A 4HU4A 4ZA0A 3LTPA 3UPMA 4JTCA 3ZO9A 2CBJA 2ZUWA 1FWWA 2E5BA 3MDUA 1MFVA 1ZNNA 2CLFA 3CZGA 1XLJA 4EF9A 4RPQA 4QAWA 5IFPA 3PJUA 5DY3A 5H8MA 2IPGA 2P3ZA 4AMAA 4DJDC 4HOXA 4LBSA 4XBJA 4EPEC 4M1RA 1ME7A 1JRCA 4O12A 3UD6A 4GA8A 5DT5A 2ZWYA 1XH1A 1LUCB 2RKXA 5FAGA 2ISWA 1I75A 4QG6A 2PLKA 4S2BA 3WCZA 1PCKA 1H7NA 2BOFX 1IHIA 1UR4A 3NXLA 3ZT5A 2TODA 1UUQA 1FFRA 4PE8A 4JL1A 3QMTA 4P61A 1UD5A 5K3VA 3K46A 3R0UA 5A94A 2HE5A 3W7EA 1QWGA 1RR2A 1CTNA 1CGWA 3JR2A 1OM0A 5DELA 3P7YA 4KT2A 4JHZA 2EKGA 3DG3A 2QCDB 1O5KA 4JTUA 4C6MA 1AJZA 1WQ5A 4N9DA 1KTCA 3KZPA 3T0CA 2YA2A 1PE1A 2J27A 3G1FA 1C29A 3LERA 4B5SA 5C2CA 4W8LA 4CCCA 1W8GA 4F0RA 4J3SA 3FHQA 3NG3A 3AHXA 1A4MA 2A2IA 1QI4A 4Q8NA 3PZNA 1L2UA 2W6RA 4EANA 3ARWA 4KCTA 4CQ8A 1XYFA 4E2VA 2AAAA 3N6QA 1TZZA 1DHPA 3PN8A 3B0UX 4RR4A 1GOMA 1XR2A 1RCQA 3B04A 4C6PA 1H4PA 3E0FA 1IEQA 4XISA 4GY1A 3PVFA 4AEFA 1PL9A 4TVUA 4D6EA 1BGAA 5A6MA 4HU8A 1M01A 4LCRA 4JTLA 3OA3A 1M9HA 2DDXA 1UD4A 5CKSA 3TSDA 4PTVA 4L4MA 1DWFM 1LG2A 3GDKA 4REQB 4YTTA 1R2RA 3UWWA 3SECA 3REQA 3ZYZA 2BGSA 4CQAA 1FY6A 1WDDA 1KR1A 4HZMA 3B0XA 1WDRA 4RX0A 3EA1A 5FSEC 3QTGA 1UROA 4GUHA 3T8QA 3SI9A 1ISXA 3WF2A 5A6TC 3H6OA 2ZX9A 1QHOA 3LPFA 3SB0A 4NUWA 4EAMA 4H6RA 1E0VA 2BY3A 3AU6A 2PDJA 3OVGA 3WEOA 2PDXA 4N4PA 1MEHA 3N12A 1QHPA 2E6FA 2GFTA 3P6LA 3C5QA 5TQLA 4BY3A 3QZEA 3ZT7A 1PWLA 2WZEA 4AU0A 2XIOA 1S38A 4X60A 1E15A 1ZY9A 4NZFA 1K8YA 3DECA 4M56A 5E9XA 5M2FX 4XVEA 4WKFA 5FKYA 4NNCA 3VNJA 2JBMA 5TF0A 4BK9A 3EB4A 1YDNA 1TCDA 1R85A 4GZ7A 1EOKA 4MJ4A 1K8XA 1UR8A 4UMCA 3N2OA 1FDJA 4PSRA 4HYWA 1FCQA 1NOFA 2CBIA 5CPTA 3UJ2A 4QITA 2POTA 4AVOA 1T7LA 1OIMA 4AXNA 4EP8C 3WF0A 2PFHA 3GFXA 2HDJA 5JQ9A 4LALA 2Y85A 1OHLA 4H2HA 4E8DA 4FX7A 1RHCA 1V4YA 2WBKA 2BS9A 1QAPA 3T44A 1J5SA 1F07A 3UA4A 1MUCA 4ZR8A 1UKPA 4KFNA 3E0IA 3LM3A 1K4HA 4Q4SA 1Q45A 4O1BA 1ECEA 4Y8EA 3SCUA 3TJXA 3O0KA 4I90A 4GHRA 4GACA 4AIUA 3CWOX 1JYNA 7REQB 3VIGA 3AWOA 3HMCA 3GHSA 2FB3A 1CGVA 2DW7A 2OLHA 3G2GA 4AZ5A 1A3XA 3M0XA 5I3DA 3W6LA 4Q32A 3N2CA 4LUIA 1TPWA 1I2QA 4FALA 4IPPA 3ZJ8A 4AWSA 5A2BA 3V75A 3I4KA 4UTTA 4GE8A 3VGHA 4I6KA 3NQ2A 3T81A 1P1MA 4IPNB 4KWUA 3E0WA 1I0BA 1V3HA 2PDKA 2H8ZA 2J7EA 3KWSA 2OJPA 3O9NA 1VFUA 1R87A 1ME9A 3WELA 3AHVA 4RXGA 1FCVA 4GABA 2F6KA 4ACYA 2BBFA 3MCOA 4I8DA 2EF9A 3UERA 1TJ1A 1XXXA 2J7HA 4ZQPA 4C6QA 4PMRA 3AMDA 2INFA 3CUHA 4WK9A 3AS2A 3VIMA 3NO5A 4WKHA 2EO7A 5AC4A 2YB1A 1H49A 2A7RA 3OOQA 3WMCA 2JGYA 3GNNA 1ZAJA 1CLVA 3AS0A 3U0HA 1IEIA 4KPLA 4D8ZA 1MXGA 2WVVB 3RPTA 1N8IA 1QNSA 5GQBA 2D69A 2DSUA 3KCLA 1W5NA 4A35A 3STFA 3DERA 4A29A 2ANUA 1W1TA 3QV7A 4EXBA 3W87A 2J74A 2ZZ2A 1FX6A 1DHKA 2PP3A 3QW4B 8CGTA 3J7HA 3V16A 3KWXA 3U6WA 3UJEA 4FOUA 3MSDA 4H9UA 3W2UA 4JTDA 1GYNA 1CWYA 1GJWA 1WAUA 4ML4A 3P14A 1BYBA 3K30A 4ICCX 2IW0A 4UQDA 3ZJKA 3CPGA 3VIKA 2ZZ5A 3W27A 5I5RA 2DP3A 4IJCA 1L6SA 1E56A 1FXQA 3JZUA 1CXKA 2ZUUA 3VA8A 3MUCA 4MZYA 5BYWA 1ML1A 1PXGA 3BICA 4UQBA 4DN1A 1T0OA 4JTRA 1MXDA 5RUBA 2Q6ZA 4DZAA 3GVRA 4O52A 3W82A 3LMYA 4XKMA 2W63A 1OJXA 4JYEA 1J11A 2JALA 1LWHA 3TN5A 5FSDC 3GH5A 1DXFA 3F2BA 2ZFAA 1FWBC 3QC0A 4GIRA 2J47A 3TW7A 4JTJA 4D9PA 1ZCOA 1RLCL 5AY7A 4HKPA 3E0VA 3UG4A 1XDJA 1TPH1 2HCVA 3ELFA 3CHCA 1H7WA 4LS1A 3BV7A 2R91A 1R3SA 4UFIA 5FJUA 4BI5A 1H1YA 4JD4A 4Y90A 1JAEA 3PTDA 2E9LA 3KRUA 3KX6A 1E5JA 3URQA 3VKAA 2CHNA 4Y8FA 3NL6A 2Z7KA 3HV9A 4YTUA 3M0LA 1E6SM 1HJVA 4JTKA 4XO7A 1UBSA 1C92A 5CGTA 1PDZA 4GH3A 4DVOA 1WZLA 1YNYA 2QPXA 2D20A 1K8CA 3E5PA 2YA0A 1TREA 4X9YA 3LB0A 1DJNA 4GLEA 4GYPA 5DRIA 3WDQA 3AISA 2D3NA 3CQ0A 4H4IA 4A3UA 5DMLA 3M16A 1JULA 2AMGA 1AD4A 1VHNA 2E5CA 1REQA 4CKQA 1VP5A 3F03K 3LNPA 1N55A 2C1HA 3KP1A 1UCWA 2IKGA 3UWEA 3WKZA 3UNDA 3GW0A 2AKMA 2ISFA 3TC6A 4IPJA 1E73M 2VX6A 4BJHA 3EX1A 2RDUA 4F2TA 2FB2A 3HGJA 2PDNA 4U3AA 2XSAA 3MJYA 3BAWA 3BLOA 1PAMA 5AC6A 4Y2WA 2HVOA 3O6CA 5A8PA 4QR6A 3TWAA 1Y8BA 3PUGA 4CEXC 3VYLA 1E4LA 3OLIA 4AZCB 4UTIA 5FF3A 3PTQA 3BCFA 2W91A 3N2XA 3DESA 4AD1A 1GYLA 1MVYA 2Y62A 2JE8A 4FI4A 1E6ZA 3TQKA 3GBEA 4L4PA 5DMMA 5G2IA 2H3BA 4ADSA 2C16A 2VFFA 5FACA 4U4MA 1EQPA 1VKFA 2QAFA 3VDBA 3PUEA 1GVFA 3V35A 4WHBA 2NXIA 1TPEA 1RLDA 1FKXA 1PWMA 1SVDA 1FVPA 1J0HA 3MP3A 5LNRA 2JKEA 3UCQA 3PBUA 3DCPA 4K7YA 3WD3A 2ZXAA 1QK0A 1FBAA 2BHUA 1WOAA 1KTBA 2J8FA 3CIVA 4GRSA 4HMEA 2FZMA 4V1YA 5D8ZA 1A5OC 2WC7A 2QHAA 1DIEA 3N18A 2CLOA 4GZEA 3VE7A 2DUZA 2OEJA 5EBUA 1JZ8A 4HCLA 1SPQA 1XM3A 2O4QA 4HZ7A 1H62A 5A8MA 3SO7A 4I7UA 1OIFA 3ZVHA 3TZNA 3PUDA 4J1OA 2OSXA 4I8YA 1HVXA 1XLLA 5IFTA 4ZQMA 5G1YA 4I9AA 4Q33A 4H9VA 1A0DA 3AS1A 1ZCCA 4MWAA 1BWVA 3WH7A 5LKYA 2GUYA 4DXKA 4JL2A 1TWSA 2FVMA 2GWNA 3QQWA 2XJ7A 4DBWA 1SO4A 4JIQA 4DXXA 3ZZ1A 1Q8JA 3LCHA 1QASA 3BOLA 1K7XA 3A3XA 4XKYB 3CM4A 3KOXA 3SRKA 9XIMA 1MW1A 1W56A 4MG4A 3OLGA 4HZ8A 1HG3A 2VC5A 4P2VA 4XQ6A 1OB0A 2VEKA 1ZP3A 2BDQA 3CXOA 5G2WA 4FF5A 2WHKA 1JRBA 1SJCA 4EVZA 2UY2A 4GVHA 4OJYA 3KDOA 3NXFA 3A21A 3EWBX 1CXLA 4CU7A 2XSBA 1QUMA 2CLKA 4QG8A 2XN0A 1OF6A 3KBVA 3LUTA 1JQXA 4A8RA 3AAMA 5E70A 2Q8ZA 1UD3A 4WF7A 1JFXA 3RXZA 1WBJA 1O6IA 5ABEA 1PJ9A 4FLQA 1O5XA 4XD3A 4IFKB 3PPCA 3AMLA 3B8IA 3FAWA 1JAKA 3LBMA 1SFJA 1UD6A 4XX6A 1E9ZB 4H04A 4Z1YA 3ZM8A 2GVYA 2JEQA 3S0CA 4H6QA 1X6LA 3HTWA 3E2VA 4UIOA 5DQPA 2VGGA 4HU0A 1F8IA 3C86A 3MVTA 2VDHA 3CAVA 4FR6A 4GI4A 1PYFA 3T2OA 2WYSA 3G0SA 2CLMA 3HPFA 4CGTA 4LNYA 1TV3A 3HQ1A 3O3RA 1ZRQA 1U1JA 5AYZA 4BQ5A 1LRQA 2H90A 4KESA 2RH9A 3THAA 4O28A 2PBOA 1UR9A 2O7QA 3OZPA 3WDJA 2YA1A 3S1VA 1M7JA 4ZTXA 4ERGA 2PI6A 5G1TA 2XGIA 5CBBA 4TU1A 5BU6A 3W74A 1RJRA 3ZQ9A 1O4UA 2BV9A 2TAAA 1HKVA 4RZ6A 3V7PA 1ZU8A 5D2TA 1NDWA 1G9HA 5HWJA 1JNDA 2MNRA 3WQPA 3CBWA 3SR7A 1F2JA 1J12A 1TRIA 4RNHA 2GUBA 4DBEA 2PWHA 1EFZA 3MI2A 3N4FA 1OY0A 2AL1A 2CWXA 2CIPA 3NPVA 1RXOB 1PZ0A 3CASA 4EXQA 3CUIA 3PBWA 1VYSX 1M53A 1I8JA 3TOYA 5ABTA 3W22A 1R2TA 4PODA 3S2NA 4H9YA 2CZFA 1OK4A 1IEXA 1HVQA 3IJ6A 1FP8A 4TTUA 2QGYA 2WZMA 3MTWA 3NQ7A 1BGGA 3AZRA 4JDYA 1TRDA 2QJJA 2DQXA 5C7HA 1T8QA 2XZ9A 1EDQA 1VBJA 4QLLA 3KTXA 4YYCA 2OU4A 5EB8A 1BWLA 2VEIA 3QJAA 3NDYA 4I9MA 3B9AA 4ICMA 4ORIA 4P7LA 4HA0A 2HEJA 3KHDA 4Z2IA 3GFYA 1I2PA 1W9XA 1SO3A 2DT0A 2XVLA 4IP5A 2GJXB 3RHGA 1XYCA 3SM0A 3RCMA 1X8CA 5KEZA 3CZLA 3WJSA 3WDRA 1VLIA 2E40A 1EC9A 1EX1A 5G4EA 2A7NA 3WQCA 4AZBA 2ZX6A 3VD9A 2R1KA 1FQ0A 3OU8A 3KOWA 1QPOA 4AHOA 1TV8A 4DJEA 1M5WA 2H3DA 4UNKA 5LYRA 3FW6A 5CZKA 4BI6A 2OOGA 3FAXA 3OVPA 4H9TA