4AD3A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-deoxymannojirimycin
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
345
Chain Sequence
TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
total genus 130
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad3A00
2WW5A 2YL6A 3GXDA 2ZX7A 4W86A 3WL1A 3AZTA 5E70A 1E71M 2EPMX 3VIJA 4D6IA 1GOWA 1C8XA 3NYDA 2ZOXA 1HKIA 4RL3A 1PIGA 3A3HA 2VVNA 1Q6EA 2O9PA 2BY0A 4AIEA 3AXXA 3EMCA 3WQ6A 2D3LA 4AIUA 1K9FA 4U3AA 1QHPA 3MUIA 1UZ4A 4QAWA 3WDIA 2GDVA 2AOSA 4D6JA 2WC3A 1AMYA 5A2CA 2DT3A 3THCA 5JIPA 3VX0A 4N42A 2NSXA 3RJXA 1UA7A 2A3BA 2HISA 5ABFB 1EQCA 2VL4A 4M29A 1FA2A 2X2YA 3VGEA 1F4AA 3CUGA 1UR0A 3WNPA 5A3HA 7CGTA 4GKLA 1J0HA 8CGTA 4D1IA 1R87A 3EDEA 2NW0A 1OBAA 1W9XA 4JFWA 5JIWA 2UWFA 1G1YA 5EBAA 1V0KA 4YHEA 1OINA 4KRTA 3UG3A 6CGTA 2FDMA 1A47A 4HP5A 4JHZA 4OKDA 3WFLA 1Y7VA 1UKPA 2PBOA 2J7DA 3NCOA 1KXVA 1UOKA 1B2YA 2J79A 4D6FA 5HPCA 1NM9A 5E9AA 3WMBA 1CWYA 5ECUA 1OWQA 3MSGA 3OG2A 4TX8A 3AS3A 2VJXA 5D4YA 4AMCA 1HL9A 1D2KA 3ARSA 4FLRA 1CZ1A 5A95A 1OIFA 4FF5A 4CVUA 3AHZA 5A6MA 1G9HA 3SCOA 5CQ1A 1EGZA 1XD0A 4OZOA 1MVYA 4W87A 5A6KA 1E6RA 3PTQA 5GNYA 1G94A 1PX8A 3AIVA 4PMRA 1BYBA 3IAPA 2VZUA 1L0PA 3AIBA 2EPLX 4NZCA 1J0KA 3L2MA 2OWCA 5A94A 1IV8A 1X6LA 5I24A 3UR8A 1QW9A 1WZMA 1LJYA 3M07A 3FAXA 2ZUSA 2CHOA 5AYBA 2F61A 1HX0A 3CLWA 1H09A 1QI0A 3APGA 1BGGA 2WKGA 3M6DA 4PCSA 3HJEA 2ZICA 3ARYA 1ZBCA 2J8FA 3WD2A 3VD7A 2UY5A 1QNRA 3AI0A 4DM2A 1QOXA 4PMZA 3WBAA 3W26A 1VEOA 4XZWA 1LL6A 1CECA 4H8UA 1RH9A 4JFVA 4W88A 1UQYA 1M01A 2V3FA 3RJYA 4PMXA 2XVLA 4CD6A 2CKRA 3BH4A 2WZIA 3D3AA 3T08A 2A3EA 4W7UA 4R5EA 3AIQA 1CEOA 2BHZA 2RGMA 4W85A 2Y4SA 4MJ4A 4XUYA 3PZGA 4DUVA 3AMKA 2IXUA 4BZYA 1GHRA 3WIJA 2VRQA 1V6XA 1IZKA 4OBRA 1BGAA 1B3VA 2Y2WA 1H11A 4AW7A 2D0HA 1I75A 2VZVA 1WPCA 1IT0A 2WYSA 2XSAA 2CYGA 4JAWA 3FW6A 1PBGA 4PMYA 1E6QM 4CD5A 5C71A 1B31A 1GQJA 3AXHA 4GZIA 3MO4A 4HA3A 1JZ4A 1AQMA 2J62A 2D3NA 3SUSA 1H2JA 3BMVA 1JAEA 3W6MA 3IANA 2V3DA 3ARVA 1CGTA 3SUVA 1CGYA 1E40A 5DT5A 3K1DA 3WNOA 1QW8A 4JFUA 4MDPA 1J12A 3OBAA 2NT0A 4F9DA 1UD4A 3CHEA 4WIWA 3GH7A 4LGXA 3WD1A 2QF8A 3T0DA 1E0WA 3D5HA 5DEZA 3RCNA 3VVGA 5I3DA 3OIHA 1CGUA 3ECQA 3ZR5A 1FP8A 1CXFA 4J3XA 5I23A 1EHAA 2EPKX 4OJYA 4J3UA 4J28A 3DHPA 5EFDA 4V28A 1KGWA 1MW3A 4QCFA 3GNRA 4ACZA 2A3AA 4H04A 4JKKA 2WMIA 3W28A 4A3HA 3BC9A 3DHUA 3T0BA 3F4VA 1R86A 2GUYA 2J74A 3FY1A 2WBKA 2D0FA 2XFYA 4V27A 4UCFA 4YN5A 3EDDA 4MADA 3OGSA 4LQ1A 1JXKA 4AWEA 1AQHA 4MDOA 4AZHA 1Q6GA 3K46A 2O9RA 3AYSA 1NOUA 3ZT5A 4L4OA 3IJ7A 4M1RA 4WKFA 4UOJA 3ARRA 3VMNA 3MMWA 2W91A 3RM8A 4L4PA 4JL2A 4DWSC 2VX5A 3SCRA 4U2ZA 1WDRA 3GBEA 3BSGA 1HJVA 3JUGA 2DT1A 3L4WA 1MQPA 4E8DA 3PTKA 4QLKA 4NF7A 2CBIA 5D9MA 4UOQA 3W24A 2VUYA 2E8ZA 4GI9A 1JIBA 4HOXA 5D8WA 2OYKA 4GI8A 2YL9A 2X1IA 5FOOA 1B3YA 3WD3A 3ZJ8A 2VC9A 5JUVA 1UQZA 2GVYA 1GHSA 1KGXA 2EEXA 4JFSA 5KZ6A 1O7AA 2UY2A 1GJUA 3IAQA 4CCCA 4HU8A 5LA0A 1CLVA 3VOCA 1W9BM 5A8PA 1HNYA 1E70M 1QI5A 5A1AA 2IUZA 2WVSA 3OGVA 4UTFA 3PTMA 1JF6A 3EYPA 2VX6A 1JI1A 1X1NA 4FMVA 2WMKA 1J11A 3AMGA 4J3SA 2JEQA 6TAAA 1GNXA 3UR7A 4DUXA 3PZQA 3F5JA 3WUBA 3GXIA 3B9AA 5M03A 5D9NA 4FK9A 1JI2A 1JF5A 1OT2A 1JZ2A 3TP4A 3FXYA 4UQ9A 4CN6A 1VFUA 1KWGA 2V5CA 2BY2A 1V6UA 3WQ4A 1LL4A 3W53A 1WKYA 4AZ5A 2XIBA 2WLZA 1C3FA 2CBUA 2J7CA 3TTSA 3FN9A 3B8SA 5A8QA 1OB0A 4DUWA 5LA1A 3F5KA 2PWFA 2DDXA 3WMCA 2WM0A 4KWUA 1CXKA 1ZBWA 1UD3A 3G6MA 3K8KA 4IPLA 2ZXBA 4MNJA 1Q6DA 1LL7A 1ZS2A 3QOKA 1WDQA 1JG9A 1KGUA 2G8ZA 1E72M 2XGIA 4PCTA 4AEEA 2JIEA 2DT2A 1CIUA 1E3ZA 2WVVA 1ISVA 1FH9A 2C0HA 3AFBA 1GW1A 3ZSSA 4WKHA 4HOWA 1G5AA 4GPNA 4TOQA 2O92A 4D71A 4W8AA 4DWSB 4PMNA 3WNNA 1HJWA 4B3LA 2XWEA 2DSKA 1GOMA 4CU8A 4PYSA 2WK2A 4CD7A 1VIWA 1B9ZA 3CZJA 3WEMA 4ZENA 3VGGA 1UR8A 3W0KA 3BAIA 4PMDA 5A6JA 2PB1A 1FP9A 1V0NA 3CZLA 1CGVA 2E3ZA 2VO5A 1XH0A 4CGTA 3NSNA 3WF1A 4CU7A 2V3GA 3SCPA 3G6LA 4TVDA 3LPPA 3VIOA 1JNDA 3ZQ9A 4H7VA 5CLTA 2VR4A 1MW0A 1V0LA 4WSKA 3N11A 3ARQA 3FHAA 1E6NA 4HA1A 4A3YA 1MXDA 1NWSA 2G3NA 1M04A 1HJXA 1M53A 3WNLA 3WQ8A 1C91A 3A4AA 5GNXA 5IHRA 1C7TA 4U31A 3KZSA 3WENA 2Z1SA 2ZE0A 1GVIA 2EJ1A 1Q6CA 1W1VA 2D23A 2C7FA 1GONA 1E1FA 4IPNB 2HVMA 1E4IA 1ODUA 4UQEA 1HXJA 4MB3A 2W92A 1WB0A 1VF8A 3PZNA 1E56A 1UR9A 3AIRA 3CZKA 4WF7A 2J7HA 5ABFA 1L8NA 1VFMA 4WSJA 4J7RA 3CMGA 1MYRA 1EDGA 3W4RA 4M56A 1BYCA 1MQQA 3RILA 3EMQA 4X0VA 2JF7A 5A69A 1TVPA 3ZOAA 4MB4A 1JZ6A 1HL8A 2JF6A 2CESA 1JZ5A 1TA3A 4IUGA 2DH3A 2PWDA 5E09A 2WCAA 3AROA 1LWJA 4NRSA 3WH9A 4HOZA 4KMQA 1JDCA 4S3KA 1H1NA 2D2OA 2J47A 4HPGA 1BTCA 2DSVA 1B3WA 1ZL1A 4UQAA 1UKSA 4M24A 3BMWA 3N17A 2J7EA 2XGBA 1B3XA 1BAGA 5FD0A 2E4TA 3MMDA 1GOIA 1PEZA 1QBAA 1HKJA 1W3HA 2W61A 3I3BA 2X09A 3OLGA 1TR1A 2WVUA 1E5JA 5F7UA 1LG1A 4GQRA 1NOFA 1OD0A 5JBFA 1E9LA 3AZRA 4XV0A 5IFTA 2YA1A 2GK1A 4E4PA 4W84A 1MFVA 3VMOA 1JFHA 1EO7A 1GJWA 1V6YA 2JE8A 3ZMRA 2VX4A 3KEHA 2BXZA 2WHKA 4JIEA 1BG4A 1TCMA 1W9DM 2EPNA 4UFLA 3K8LA 4D1JA 1VEPA 1YQ2A 3L4TA 1CBGA 2BVYA 4J3WA 2G41A 1EOMA 1H0GA 4Z2KA 2UY3A 2WZEA 3VD5A 3MMUA 3BSHA 4TVUA 3TOPA 1UD8A 1W1TA 4JCLA 4B16A 1SFSA 4D6CA 4BA0A 2DEPA 3SUWA 3NUKA 4BQ4A 1NARA 1QI3A 3CMJA 3ZJ6A 1UWIA 3BCFA 3ZT7A 2XYLA 4ZE5A 1NP0A 2VNCA 2QHAA 1KCLA 4QFUA 1CENA 4QLLA 3EDKA 1NQ6A 1UZ1A 1V02E 3WH6A 3AIUA 1KR1A 2W5FA 3ZJKA 2D24A 1DWAM 2VMFA 4KGJA 1OGSA 3S2CA 2GJXB 5D8ZA 4UNIA 1EA9C 4MB5A 1FFQA 1E4NA 4CU6A 4GIAA 2W67A 1CYGA 3ALFA 3A4WA 3UERA 1XYZA 5HXMA 2F8QA 3AHVA 4D6HA 5BXSA 3GH4A 1KWKA 5IDIA 3AS2A 2PF0A 5CGTA 2X05A 5CZKA 3VNYA 3MS8A 1KQZA 3W6LA 2YDQA 3WUGA 4D72A 4EANA 2EO7A 4UQBA 1B1YA 2GJPA 4F79A 2G3IA 4U5KA 3CHCA 4MNMA 5FCZA 2FHFA 2J7FA 8A3HA 1LLOA 4TTUA 1J0IA 3ARZA 4ATWA 1OCQA 1JFXA 1V3MA 1PZ3A 4M80A 1C8YA 1E0VA 1EOKA 5HOSA 1KXHA 1DWIM 1FH8A 1MW1A 4UQDA 3OLIA 5EFFA 5CXPA 1QNQA 3AOFA 4JZ5A 3IJ8A 3BCDA 1WZAA 4AZIA 1V02A 3PHAA 3A47A 1UD6A 1D3CA 3N15A 3SEPA 4IISA 5A2BA 4AEFA 3U7VA 4GI6A 4HZ7A 1TMQA 2WMJA 3HU7A 5ABHA 1BHGA 2G4FA 4AZBA 3WDPP 3L4YA 2G3JA 1NOWA 2YA2A 4AZCB 1BYAA 1VBRA 3WKZA 2W63A 2BVDA 3PZ9A 5EMYA 1D7FA 3DYPA 3CIVA 4A4AA 3VUPA 1MWOA 5LA2A 4MPKA 2WXDM 1DEDA 4B9YA 3FNDA 4CKQA 1G0CA 1EO5A 2ZUWA 1UWSA 1BVNP 3TONA 4PTWA 4ZE4A 1B90A 3U7BA 3QGVA 5FL0A 1W1PA 5HDRA 1J0JA 2Y24A 4MAZA 1IZJA 3SCTA 5IXEA 2DSZA 1OGGA 1JYXA 4X9YA 4H8HA 4HMEA 4ZFMA 3WMSA 2D20A 1H49A 3VIPA 4H41A 4Q7NA 1Q6FA 2E9MA 2XPKA 2B31A 3RIKA 5A8OA 1EXPA 3IK2A 3CO4A 1O6IA 1MFUA 2AAAA 2ESCA 3WNKA 1JGIA 5C70A 4PSPA 1VBUA 4QCEA 4KGLA 1OD8A 4J3TA 4JCMA 4KRUA 4F66A 1KR0A 4F8XA 3TTYA 4PUEA 4Z2LA 3T2QA 5I5RA 3GYCA 4JL1A 4ZXLA 4DM1A 1BVZA 2GJXA 1CLXA 3HMCA 1EDQA 2OYLA 3VIHA 3AHXA 4JFTA 3AS1A 1UG6A 2IXVA 1E6PA 3W25A 3WDQA 7A3HA 3N9KA 2F2HA 4LX4A 1JD9A 4K68A 5AC4A 2WB5A 2VTFA 4CVWA 3POHA 2GSJA 1XCXA 1PPIA 2EPOA 2YJQA 1UD2A 1E4LA 3PN8A 4HPHA 3EDJA 3RMEA 9CGTA 2AMGA 1UA3A 1XCWA 5M17A 1KBBA 2J25A 3WBEA 1BF2A 3WDRA 3AS0A 1XSIA 4Z2IA 3B9EA 4MNLA 2JFEX 4CCEA 2CETA 2XM2A 3VIIA 3QHNA 3FHQA 1MXGA 3PZMA 1HJQA 2BNJA 3CZEA 1K9EA 2VR5A 3ARUA 1S46A 1NWTA 4U3CA 1ISYA 4M81A 1ZJAA 2YOCA 2XTKA 2ZXQA 4PSRA 4ACYA 1VRXA 1R7OA 2A3CA 2YKKA 2QPSA 5D9OA 5CLWA 1PIFA 3SCVA 4UFJA 1NP2A 1I1XA 3VD3A 5BWFA 3VGFA 3IJ9A 3WDJA 2Y8VA 1AQ0A 3I3EA 1UKQA 2DPEA 4W93A 2ZUNA 2ZUTA 3L4UA 1DWJM 3KL3A 5TD4A 3ZJ7A 1QBBA 3KE0A 3SCWA 4DWSD 4IM4A 2O9OA 1B0IA 2W66A 4P8UA 4C7DA 2WNWA 1WE5A 3PZIA 2ZX6A 3VO0A 2J8GA 4CD4A 5DO8A 1UH4A 4ZXOA 3BLPX 3THDA 1AVAA 2XVPA 5HBFA 3SIMA 2VRKA 3W81A 1ODZA 1UWUA 2WSKA 2ZUMA 1PX3A 2WHJA 2OWWA 3U57A 5M5DA 3NDZA 4AZGA 3WQ5A 3B9DA 4ATDA 5IHSA 1JNEA 1GORA 3MU7A 4AZ6A 1V3IA 3T2OA 5FL1A 4PUDA 1JD7A 4QDMA 2CEQA 1BFNA 1EIBA 3RPMA 3PZOA 1KQYA 2GDUA 3PZVA 1J18A 2VQUA 1H41A 1RD6A 2ZXDA 1VJZA 3K4DA 4AYSA 1H5VA 4ATLA 1J9YA 1HKMA 1HJSA 4BF7A 3T0AA 2D1ZA 4AC1X 1QPKA 2W62A 3OZPA 3ZR6A 3RO8A 4M8UA 3GXFA 1ECEA 1M03A 1UWTA 5BRQA 1MQRA 2XVNA 1J01A 4HMDA 3WH5A 3ZM8A 3SCNA 1GCYA 3AMCA 1ITXA 2WPGA 2DIJA 3AICA 3DYOA 6A3HA 1TVNA 4CN1A 3VPLA 2CPUA 2J75A 1W3KA 3WY1A 3TA9A 1ESWA 3CTTA 2OSYA 3GXMA 4TUFA 2G3MA 2EQDA 3AIWA 4M82A 1RPKA 2VCAA 5HPOA 2FGZA 3CH9A 3VNZA 4B3KA 2VT0A 4FLSA 1HP5A 1PJ9A 1UWRA 3PZTA 1KBKA 4LPCA 3QOMA 3QHMA 1W9VA 3MUZ1 1C93A 2Z1KA 3VD4A 3WDHA 5DF0A 3WD4A 4X0NA 1BLIA 4ML4A 2WVTA 2VZOA 2J4GA 3F5LA 3ARWA 4UR9A 4MAVA 2J7GA 4P8WA 3RM9A 1EH9A 1TZ7A 1JDAA 4BQ3A 3WEOA 4LYQA 4W89A 1CDGA 1W91A 3SCSA 1RP8A 1TFVA 2PI6A 1GZJA 1F4HA 3VTRA 4AIOA 2QMJA 2BY1A 5E0CA 3N18A 1Q4NX 1QI4A 3KL5A 1E4MM 4HA4A 1UH3A 3GH5A 2ZUVA 4PMOA 3QHOA 4AXNA 4PTMA 4OOUA 3MV01 3M7SA 3VD9A 1JL8A 3LPOA 3N1AA 4OOZA 2WSPA 5E0FA 1GUVA 2Q8XA 2V38A 5D9PA 3VIMA 3VDCA 2O9TA 3CBWA 2WCGA 2XHYA 7TAAA 3OB8A 1CNVA 2WC4A 4CD8A 3CZ8A 1R7AA 1UYQA 3UCQA 4QP0A 5JBEA 4U33A 2WMGA 2XM1A 1ISZA 1E43A 4HU0A 5A6LA 3ALGA 3OGRA 3SUUA 1JZ8A 1UHVA 4GQQA 4AISA 3VDHA 2WMIB 1VJSA 3GDBA 3DC0A 2DIEA 2ZX8A 4TVCA 1JZ3A 1UKOA 1VB9A 1U33A 5GNZA 4P8VA 2YL5A 5E6ZA 5KEZA 1OM0A 4CCDA 1OSEA 2X0YA 3GZAA 4PEEA 5CSYA 3WF0A 1US3A 4LYRA 3EDFA 3WUFA 3AHYA 1QVBA 1ITCA 5DT7A 2WC7A 1DHKA 1QHZA 4PBGA 3GNOA 1WAWA 1W1YA 1QNPA 3L4VA 3SCQA 4XX6A 1N82A 3WUEA 1BYDA 3VGDA 5AC5A 1KB3A 4BS0A 5A6SA 4AD0A 5A6BD 3BLKA 1V6WA 2VI0A 5FIPA 1JXJA 4RE3A 1NWRA 2BS9A 2E9BA 1X6NA 3SCUA 5BXPA 4J27A 2ZX9A 1HVXA 4HZ8A 2OSXA 5AYIA 2CITA 1TA3B 3W29A 4JKLA 4PRWA 3UETA 4UZUA 3CHDA 4UFMA 1BG9A 4D6GA 2WAGA 1WDSA 4ZEPA 2X0HA 1V3HA 1XYFA 1ZJBA 1SYTA 2BXYA 2VRJA 1LWHA 4PTVA 4BQ5A 1FHLA 4N0RA 3SUTA 3U5YA 2WLYA 4UQCA 1ISXA 4AD2A 3WL0A 3BAWA 3CUHA 3MANA 4P7NA 1PAMA 3A6OA 3VIKA 3ZIZA 4B9ZA 1HKKA 3BXWA 1DWFM 4PN2A 1WNOA 1DWHM 1OIMA 1V3JA 1ISWA 3U5UA 4EKJA 1NH6A 3AISA 4J3VA 1XD1A 2D22A 4AZ7A 1OT1A 2C8NA 4UFIA 4TX6A 2VURA 4FLQA 4PTXA 4CN4A 1LQ0A 2CHNA 4H8VA 3CGTA 3POCA 1VAHA 3OLEA 3DECA 2OWXA 4W8LA 4FLOA 3HN3A 2WBGA 4H2CA 3VDAA 2WZHA 2PBGA 4GO9A 4W5UA 1ZBKA 1CXLA 1XHGA 2WHMA 5BROA 5IFPA 3VU2A 5I0DA 1UR2A 3WFZA 2VQTA 4KH2A 4MTVA 3AMLA 1I1WA 1XH1A 2PC8A 3BAXA 2ZXAA 4P7LA 4YPJA 3TTQA 4HMCA 3WD0A 4CUCA 4Y7EA 1WP6A 3KWXA 1FFRA 3EBVA 1E1EA 3O6AA 2OYMA 5GQBA 1DWGM 1DTUA 4XZBA 1Z32X 2VOTA 2DSWA 3AMDA 1UH2A 1VEMA 5DFAA 3NJ3A 3VIFA 1E6ZA 4GZEA 2V5DA 5I79A 1U30A 3AYRA 1E6SM 5E6YA 1CXEA 1JDDA 3UEQA 2XJ7A 2YDSA 3BAKA 4LYPA 3CUFA 4W5ZA 5BXTA 1GQIA 1CXHA 2QPUA 4MNKA 2UY4A 3OA5A 5FKYA 3RDKA 4P8XA 5A2AA 2XUCA 2XG9A 3CZGA 3WQVA 3AHTA 2VX7A 3WQWA 1XH2A 2DGAA 1ZBVA 1EHNA 2BHUA 2CXGA 3E1F1 1LG2A 3DYMA 2J77A 5GPRA 1JYNA 3ARTA 3WF2A 3UESA 4GXPA 1RP9A 2WCSA 3VX1A 2ZUUA 2CERA 2OSWA 1C7SA 4D6EA 1GQKA 2OLHA 4D6DA 2PWGA 1HT6A 1US2A 2EXOA 2FHBA 3WSUA 5CG0A 1E3XA 4JKMA 4ACZB 3GNPA 3VM7A 3BAYA 2VCBA 4AZCA 1H4PA 5LYRA 1QHOA 2CCRA 3W38A 2NT1A 4P7RA 3VINA 1QNOA 1OGBA 3A4XA 1W3LA 4NRRA 1UKTA 3KL0A 2WMHA 5A6BA 3WF4A 4JHOA 3GM8A 4AY1A 4W8BA 1PX4A 4Z2HA 4QLJA 3AIEA 2VCCA 1BQCA 2CNCA 4F9JA 1EQPA 4PMQA 4UZSA 1QNSA 4AD5A 5I77A 2YDRA 4HZ6A 4AD3A 3BGAA 3K8MA 3LPFA 2QMKA 2XFRA 1SMDA 1E5NA 3I3DA 2RGLA 2A3HA 4B15A 4Q22A 3W27A 2FHCA 2BY3A 3BAJA 3VIGA 1GOOA 4UFKA 1HJUA 4YHGA 1JYWA 1XGZA 3CUIA 1B3ZA 3NSMA 1C90A 2BFGA 1FH7A 4E8CA 5ABEA 3WELA 1QI2A 1UR4A 1XV8A 2V3EA 4UOZA 3L2LA 5A6AA 4W7VA 3RM4A 1UUQA 1K9DA 3ZT6A 1V6VA 2PWEA 4R27A 2BVTA 1K9TA 1E73M 2XFFA 3GTNA 1W9PA 2Y5EA 1KXQA 2FGLA 4RE2A 3MKKA 3T09A 3GBDA 4TTGA 3VKKA 2QV4A 1UR1A 4Z2JA 4GINA 5BCAA 1J0ZA 1W32A 3ZSTA 5CJ5A 4S3JA 1WZLA 3AJ7A 3W82A 1H3GA 1ZU8A 3VMPA 3VM5A 1XSKA 3T2PA 1GOQA 2J78A 2ZWZA 2JIWA 2GFTA 4OIFA 4Z2GA 1SR0A 3MSDA 5CPQA 3MUAA 2FH6A 2E0PA 3UG4A 2XIIA 3EMZA 2CKSA 1CTNA 3N04A 2JEPA 2J7BA 4U5IA 4V2XA 1GVYA 4PMUA 3N12A 3ARPA 4EAMA 1JYVA 3MV11 1VFOA 3LMYA 1V0MA 2QLYA 1WDPA 3WH7A 5M3WA 4AD4A 1WO2A 1E15A 3W37A 4UFHA 3VILA 4GO8A 3VGBA 4TXEA 1SMAA 5I6SA 1KCKA 1W2VA 5CPSA 2ZX5A 3PZUA 1V3KA 3J7HA 3WNMA 1HP4A 2YLLA 3O9NA 2W4XA 2WVVB 1E6XM 3AQUA 5AY7A 1J0YA 1PZ2A 5JBDA 1E0XA 5I78A 4BCEA 5A8NA 4WKAA 2ZWYA 1VFFA 3L4ZA 2GJRA 3O2LA 3OLDA 2VZTA 1JAKA 1W3JA 4E2OA 1XRVA 1K6AA 1W2PA 5BXRA 2PWHA 3S6TA 1BSIA 2CBVA 2E9LA 1LF1A 1C8QA 2E40A 2WKLA 2YBUA 2CIPA 4PMVA 3FAWA 1CPUA 3ARXA 2VZSA 5HNNA 1HN1A 1FHDA 1VENA 1H0IA 2DH2A 1XSJA 1WZKA 1C92A 5BRPA 4WLCA 1G01A 5A8MA 2YBTA 1WCGA 1ZB5A 3SURA 3UG5A 4BQ2A 4URIA 2D0GA 2X8RA 1XC6A 2Y8KA 4EK7A 3TTOA 2CBJA 3NDYA 1YHTA 3CPUA 4RE4A 1HIZA 2EBNA 4NSBA 2DSUA 4C7FA 3VDBA 3WF3A 3WEZA 3K4AA 1V3LA 2WWCA 3L4XA 4DWSA 1TUXA 2FH8A 2WHLA 4MJ2A 2DQXA 2GK1B 2XVKA 5EB8A 2VVSA 1GQLA 1EDTA 2TAAA 2XWDA 2MANA 1MW2A 1GPFA 1KFWA 3NIYA 4OUEA 1R8LA 2YIHA 4AD1A 1TG7A 2WWDA 2ZIDA 1FOBA 1UWQA 4C7GA 5DMYA 5C8BB 1TE1A 3NSXA 1B30A 2WANA 2YLAA 4P7QA 1GOKA 1HVQA 2XSBA 4NI3A 3PBGA 1JZ7A 1CXIA 1M7XA 1P6WA 4W7WA 4GZJA 2YL8A 1CGXA 1A3HA 5BYWA 4OBSA 2YA0A 1KXTA 3MUY1 2XVGA 5CSUA 4EE9A 1R85A 1V03A 1W9UA 3LPGA 4WK9A 3WH8A 2DT0A 4HTYA 1HF6A 1UD5A 1CGWA 4XB3A 2BHYA 2WMFA 3VGHA 2E8YA 3M46A 3OZOA 2BV9A 3ZO9A 3N13A 5I2UA 1V08A 5CGMA 5CPTA 2JALA 3CHFA 3CUJA 5ABGA 3AXIA 3QR3A 1BPLB 4P7OA 3AZSA 3WN6A 4MB1A 4U2YA 1U2YA 4WJXA 1J10A 1E55A 3II1A 1DP0A 1NWUA 4LXFA
chains in the Genus database with same CATH superfamily
3W2LA 3CL6A 1Q3NA 4HNOA 1SSGA 3AZTA 4QNWA 2J27A 3ITOA 3VIJA 2NSOA 4D6IA 1GOWA 5CPNA 5BMWA 1EF3A 1HKIA 1AZ2A 3MVIA 4LV4A 4RL3A 4QBXA 1GVOA 1PIGA 2C3ZA 4RDZA 1GZGA 2XIOA 4XBSA 2O9PA 3W22A 2BY0A 3TN6A 4MUPA 1XKJA 5AYXA 2E6AA 3V5FA 1SSDA 3Q2DA 4OUIA 1A5BA 5FACA 3EEGA 4HNNA 2E09A 5A2CA 4N42A 2A3BA 2HISA 3SR7A 5G2WA 4M29A 2UZ9A 3VGEA 3IS4A 2JGYA 2ZZ7A 2NW0A 3LBCA 2DVXA 1OBAA 1W9XA 4JFWA 1F6PA 4QE4A 5EBAA 4MVAA 4YNGA 3LRLA 1OINA 2TMDA 4NVTA 4S2CA 3REQA 5XIMA 5HA7A 2PBOA 2P8BA 2NV2A 3NCOA 1SW7A 4F40A 4MY1A 5FEPA 2BMBA 3L5MA 3OZYA 3LM3A 1NM9A 5EBUA 4A8LA 2JKPA 3CUZA 1JCNA 1OWQA 4TX8A 1XP3A 1P7TA 3TN5A 1IEWA 5D4YA 3RX4A 4IG2B 3ARSA 1OIFA 2HPIA 4FF5A 4CVUA 1D3HA 1EGZA 4OZOA 1JQVA 3UPWA 5A6KA 1E6RA 3KVLA 3PTQA 1CX9A 2OOGA 3AIVA 3I10A 1BYBA 2QULA 5T8GA 1JCLA 2ACQA 1L0PA 3BZGA 2EPLX 4NZCA 3L2MA 3K4WA 1S5WA 1Q85A 2QW5A 2TODA 1IV8A 2OWCA 5A94A 1FWTA 3V3WA 1WZMA 3IUDA 4MG4A 5AYBA 4ADUA 4GYPA 1XKYA 2NWRA 1H09A 4JHMA 1QI0A 5D02A 2OZ3A 3GU1A 4I5XA 5DMLA 3HJEA 1UC4A 3GLCA 2QQ6A 2VEPA 2Q6ZA 4LVDA 3VD7A 1TPWA 3AI0A 4DM2A 2YFNA 3NEHA 2Z27A 3G1SA 5B7ZA 1LL6A 4AFYA 1RH9A 4W88A 2IKHA 3CU2A 1X7FA 4CD6A 2YCLB 2CKRA 4A8NA 3I7QA 3LQGA 2WZIA 3UJRA 2A3EA 4H00A 4WXZA 1X7IA 1ZAHA 4W85A 1TMHA 2ACSA 1PTAA 3G1AA 2Y4SA 4MJ4A 4XUYA 4DUVA 1LYXA 5DXYA 3AMKA 2IXUA 3WIJA 1KTCA 2RFGA 2XH0A 2H3BA 4OBRA 1BGAA 3G3MA 2Y2WA 2GDQA 2VZVA 1TR9A 3BV4A 4J35A 4F4RA 3QC0A 1IXOA 2CYGA 1PS9A 4JAWA 1XBXA 1PBGA 3IJ6A 5EYWA 3PUEA 3EA2A 5DCEA 3AU2A 1EF2A 4IFKB 3NR0A 4GZIA 2V2DA 2Y61A 4HA3A 3TROA 1WDDA 4LBSA 2OFJA 2V3DA 4WDXA 1CGTA 3B03A 3MVTA 2IKIA 2BOEX 3K1DA 1X8FA 3WNOA 1QW8A 2RHGA 3SIZA 2VENA 4MDPA 1J12A 3OBAA 3UA3A 3TCSA 3SRKA 3THQA 3MI2A 4MZYA 2JKAA 3PULA 2ZA3A 4ZQPA 3W1AA 2I17A 1BTMA 3WD1A 3T0DA 5CZJA 5DEZA 3VVGA 4AG0A 1IR2A 1CGUA 5AYYA 3ECQA 2FZNA 4R33A 3L12A 2I9UA 3HV8A 2EPKX 5GJNA 3CWNA 1MW3A 1NJJA 4QCFA 4ACZA 2RDXA 2Y85A 3W1UA 2WMIA 4S3GA 3T0BA 1R86A 5BRBA 2XFYA 2D0FA 2PZ0A 4V27A 4UCFA 4PGLA 3OPSA 3GD6A 4AWEA 1EJWC 3GTHA 1AQHA 4PEKA 1XLIA 2O9RA 3G1VA 2FZ9A 1WX0A 1KTNA 3SRDA 3ZT5A 1LDCA 3IJ7A 3JZUA 4ZL1A 2CFFA 1GTEA 4QG6A 3T81A 4GH3A 4LNYA 4HTBA 3P61A 3OQ8A 3QMRA 4EX4A 3CAQA 3QEZA 1PKLA 2VX5A 3SCRA 2DZXA 1REQB 4QDPA 4U2ZA 1WDRA 3GBEA 3JUGA 2DT1A 3L4WA 3IGSA 1G7UA 3CLMA 4O1CA 1H7RA 4HZMA 2FGBA 2PFHA 4EP8C 4UOQA 2PUZA 1Z41A 1EJVC 3A13A 4HK5A 4MHBA 1SO3A 4S3FA 1R3VA 2E8ZA 4GI9A 3KBWA 1G67A 3HQPA 4RE0A 2YL9A 1F74A 4FOUA 2VC9A 1UQZA 4FX6M 2GVYA 2NUYA 1GHSA 3L5LA 5KZ6A 1VYPX 1CLVA 1BXCA 1E9IA 5D30A 2WVSA 4K3ZA 3OGVA 4UTFA 5G2HA 2E6YA 3K13A 3I4KA 3VNDA 4FMVA 3NZQA 2WMKA 1SZEA 1YNYA 1IYXA 3UXIA 1UJQA 4FX8A 4J3SA 5AFDA 6TAAA 4O8AA 1GNXA 4K7YA 3WLRA 4DUXA 1UR3M 3OG3A 1QFEA 4F2TA 3F5JA 2O55A 1IEVA 1TO3A 3KBJA 1JF5A 1VH7A 3UYCA 3ITLA 4MIMA 3TP4A 4AH7A 1DQUA 4XIMA 1F8IA 1WKDA 1KWGA 2BY2A 3I7SA 3TFCA 2Q8ZA 4AZ5A 3QSRA 4BI5A 1LLWA 4IMGA 2OB3A 4Q4KA 2FTWA 3TTSA 2I16A 3B8SA 4UBPC 3ONBA 1OB0A 2J88A 5MKGA 3WMCA 2WM0A 4Q4MA 1XLEA 1TWIA 3G6MA 3K8KA 3BQ5A 3L66A 3EOSA 1WDQA 2WKJA 1JCXA 3EXRA 3P0XA 1JG9A 4JIRA 3NPWA 5CCZA 2NLIA 1CB2A 2XGIA 1R3YA 4PCTA 4AEEA 3ATZA 2R8WA 1TREA 1PZ1A 4ILSA 3PB0A 3E3HA 2WVVA 4MWAC 3TYDA 1GW1A 4QSHA 4WKHA 3BZJA 4HOWA 1U1HA 2V9DA 4ZQRA 2DUXA 3V16A 1LORA 1EB3A 1MEWA 1PCWA 1T8XA 8XIAA 4Q8VA 4W8AA 3DGBA 3B06A 1A3WA 3PR2A 1K1DA 2DSKA 1GOMA 3CIXA 1B9ZA 3CZJA 3N6JA 2OQYA 3BAIA 2ZQ0A 4I7VA 5A6JA 2XINA 1GW9A 2E3ZA 4O1DA 1XQLA 4Q7BA 5JU6A 4YTUA 1P0EA 4LALA 3SCPA 4UNLA 1VBHA 2PODA 3VIOA 1JNDA 1MW0A 5CC5A 3UXKA 4L56A 2GQ9A 4B5SA 3FHAA 3GDRA 3KVKA 1MXDA 5J5RA 3RR1A 5I06A 2R82A 3LRKA 1C91A 2JBMA 1JR1A 5AZ1A 3WENA 3KLKA 5D33A 5D04C 2PDPA 3S0CA 4J4KA 2ZE0A 1NDVA 3QRHA 3MCOA 2X42A 4DAFA 1W3NA 2V2HA 3N3TA 2EJ1A 1Q6CA 3KOYA 2C7FA 2V81A 1GONA 2YW3A 4ENLA 4Y9OA 2GQ3A 1S2UA 3EWBX 4XTIA 2ZZ3A 1OX4A 3N4EA 4WSJA 1L8NA 1J8VA 4B91A 2NWSA 4J7RA 1MYRA 5ECVA 4G7EB 2GGGA 3HG5A 1L6WA 1B3OA 4HN4A 4OV4A 2CWNA 4TU1A 1X98A 2Q8LA 1JZ6A 3IVTA 4QG8A 1O5QA 1V7YA 2PDMA 1LQ2A 5HR6A 1GZ1A 4XG1A 4WOZA 1LWJA 2C0AA 4PUWA 2OCZA 1HO1A 4HOZA 1K3UA 4QTGA 1JDCA 4S3KA 4IXHA 4GYKA 3GWQA 1TQJA 3TJIA 1BTCA 1ZL1A 3OOQA 1M65A 2A6LA 3HFYA 3BMWA 1BRLB 1DOSA 4NXKA 4K8EA 3B8DA 1B3XA 1BAGA 4AVFA 2QZRA 1HKJA 4A2RA 2AMXA 1HZYA 4ZTYA 2X09A 4IJRA 2DZWA 4GQRA 1OFBA 4H4IA 4XV0A 1YE4A 3CC1A 4GABA 2GK1A 4JTAA 2C1GA 4Q6JA 2VX4A 2ODOA 3VZYA 4D1JA 1YQ2A 1UP2A 2MNRA 2AL1A 1CBGA 2FMOA 2OGJA 3S2LA 2UY3A 4O19A 3BSHA 3MMUA 1XDLA 1W1TA 4JCLA 1W56A 2NQLA 2Z25A 3B8TA 4B16A 4BA0A 2G96A 2PDHA 4BQ4A 5DX7A 3OVQA 3UPBA 2XYLA 3U2OA 4K2SA 2E28A 5KZMA 2BXVA 1CENA 4LV9A 1V02E 1QAPA 3AIUA 2W5FA 2QPXA 2D24A 1JJKA 2GJXB 3QLDA 1XGEA 5D8ZA 3MO7A 1SUXA 1EZWA 4CNSA 3I6TA 4LAOA 4GIAA 5E1QA 3A22A 1CYGA 3NQ2A 1XYZA 5HXMA 2F8QA 3STPA 3TN3A 5BXSA 4XSMA 4PUNA 5CGTA 2X05A 1B4EA 4NQ1A 3MS8A 3W6LA 2YDQA 3W23A 4NNBA 4FALA 2A3LA 3BOLA 2EO7A 3R4IA 1GEQA 3B05A 3OW1A 5FCZA 1RLCL 4PA8A 4MLJA 3YPIA 4B5VA 4NILA 3GUWA 5DN1A 1N55A 1DHPA 4JTUA 4M80A 1LLZA 4UQDA 1SW0A 1MUWA 2E5CA 4Y96A 4AZIA 1R3SA 3SZ8A 3N15A 3RUBL 5A2BA 1OC5A 3P0WA 4GI6A 4HZ7A 4HCHA 1TMQA 4NX5A 7XIMA 5ABHA 1BHGA 3QYQA 4ERIA 3F03K 4IGSA 4NAEA 1UBSA 5MHBA 3N4AA 1SJBA 1S2AA 4JX4A 4DYKA 4AZCB 4WDUA 5FJJA 1AH3A 5K4XA 2BVDA 3SSJA 3REQB 3PZ9A 3W7JA 5E9XA 1RALA 2OG9A 4CLMA 3GVQA 4MPKA 2WXDM 3FNDA 4CKQA 1UWSA 1KFLA 1SR9A 1YDNA 4ZE4A 3H23A 2FFCA 3QPZA 3U7BA 3QGVA 5FL0A 1W1PA 1YPFA 5IXEA 3W1RA 2IPJA 4C6DA 1TJ1A 1JYXA 4X9YA 3GRIA 4H8HA 4ZFMA 3WMSA 4E2DA 1H49A 2QGHA 3VIPA 4Q7NA 3E0WA 4FSAA 4DBWA 2E9MA 3RIKA 1EXPA 3GR8A 1HKWA 3CO4A 1O6IA 4ZOEA 1L8PA 5C70A 3URQA 1Z3NA 3EB4A 4QCEA 3RLHA 4GKTA 4N9EA 4KGLA 1SFLA 4J3TA 4IJBA 1M6JA 2E5DA 4Z1YA 3GYCA 1S2CA 4JL1A 3DESA 2GJXA 3QZ6A 1UASA 1XYBA 3HMCA 2FZBA 4QHRA 1AW2A 3A9BA 3R89A 2A79A 3LBMA 3R7MA 1FBAA 3P7YA 4ADTA 5BZAA 5AC4A 3LLFA 2R14A 3GXTA 3GB6A 4MM1A 3POHA 3BG9A 1UD2A 4HPHA 3EDJA 3NM3A 1RR2A 2A5HA 3WYZA 4FR6A 4KBXA 1QT1A 3MWAA 2YCIX 1I2NA 2AMGA 1ONWA 1XCWA 4O50A 4DJEA 2YZRA 3F4CA 3WBEA 3WDRA 5LNUA 1XSIA 4Z2IA 1MRAA 3B9EA 4MNLA 2JFEX 4DJED 1NDYA 3VIIA 3FHQA 3GTXA 4K1WA 3ARUA 4I5RA 1S46A 3GDTA 1ISYA 4DJEC 1A5KC 4CQDA 4M81A 3UWVA 4ACYA 3MI3A 4PR4A 1X39A 2Q09A 1PHQA 2QPSA 5D9OA 3SCVA 1E1CA 1L2QA 4UFJA 1EC9A 3VGFA 3IJ9A 4H9VA 1KRMA 3WDJA 3I3EA 1VLWA 3R0DA 2ZUNA 2ZUTA 3L4UA 3KL3A 5G5IA 4Q4OA 4GFIA 3NPUA 2CZVA 2IQTA 1GVQA 1QBBA 3KE0A 3M1ZA 1REQA 1Y65A 3PFRA 3DUGA 2O9OA 1PL9A 4H9UA 4P8UA 3W7HA 3JZEA 1JPIA 4Q8OA 3ID7A 2POZA 2XVPA 5HBFA 3LHZA 1PCKA 2WSKA 2OWWA 1V79A 3U57A 3NDZA 1OJXA 4XO7A 4KWWA 3GC2A 1XPGA 1JEZA 3C56A 4ZVJA 1YKWA 1OX5A 4AZ6A 4RDWA 1V3IA 3T2OA 2ZRXA 4QDMA 3RPMA 1KBJA 2GDUA 3ITXA 3H12A 1VJZA 1W5NA 4FOJA 1H5VA 1OFEA 4Z1CA 1I2OA 3FK4A 2HK0A 4GMEA 5LNSA 4YCPA 3JS3A 2W62A 4NJJA 1ELSA 1ICSA 3QC3A 7REQA 1ECEA 1M03A 3COTA 1UWTA 4S38A 3C2RA 3WH5A 1A5MC 3ZM8A 1W1B1 4EPKA 5C55A 3DYOA 1XIMA 3TQPA 3QV7A 2CPUA 1T0OA 3K30A 3WY1A 2PDFA 4D8LA 4AQLA 3GXMA 1Q66A 2G3MA 1QXLA 2G5WA 4ZCWA 3GNNA 3CH9A 3EWDA 3L21A 4B3KA 1QK0A 4XAPA 4FLSA 4D8ZA 1HP5A 3MKCA 3STGA 3FYOA 1KBKA 3MBDA 3D3FA 3RGTA 3BL3A 4O1FA 3VD4A 2IW0A 5DF0A 1W0MA 4ML9A 4X0NA 2WVTA 2J4GA 2W6RA 4GUGA 2J7GA 3UP8A 2PS2A 5CH9A 4DXKA 2GWGA 1JDAA 4DJDA 4HK6A 4NIRA 3WQDA 4W89A 4DF2A 3GTFA 3RPDA 1LBFA 1GZJA 3R2GA 4BY3A 3BVJA 4WHBA 2BY1A 3P93A 1F9CA 3R5EA 2XIQA 4DUOA 5EMJA 1K7XA 1UH3A 1YE6A 4OOUA 3MV01 1IEQA 3F4WA 4TMCA 2V63A 2WSPA 1GUVA 4LY8A 4NXSA 2EGZA 2O9TA 1XRFA 5DBUA 1P6CA 3OB8A 4LEQA 3TC7A 3URAA 4F2BA 3OTRA 1H7PA 4DNMA 3V0UA 2EKGA 2QCFA 2PP3A 4U33A 2Y7GA 4RDVA 2WMGA 5A6LA 1WKFA 1U5VA 1LRTA 2OLSA 4B4FA 2LLEA 4K37A 3IARA 1VJSA 1PHWA 2R1LA 4DN1A 3HGSA 1U33A 5GNZA 3CV6A 1J4EA 3HG2A 2XN2A 2ZVRA 4NI8A 1PWLA 4PH6A 3UFYA 5LIWX 3QH2A 3GZAA 4PEEA 5D2TA 4B5TA 3CL7A 5CBBA 3W2UA 3VXGA 4Q32A 1DHKA 1XINA 3GNOA 1WAWA 1KTBA 3MCNA 3H7UA 3NQDA 1N82A 4CCZA 4KEMA 4ZQOA 1BD0A 4F0HA 3HGOA 3VGDA 5AC5A 5A6SA 1FWAC 4AD0A 5CKSA 4V1YA 2XH7A 3P5ZA 1JXJA 4E2VA 2BS9A 1X6NA 2VFDA 4J27A 3BSMA 1HVXA 1TPB1 3BW4A 1IQ8A 5AHIA 3CQHA 2A7NA 2IQ0A 3V36A 3UETA 4UZUA 3CHDA 2WJEA 1V77A 2WAGA 3RITA 2WQPA 2VRJA 1QPNA 4IG2A 3CB3A 5JH2A 2CLLA 3SUTA 4V15A 3GU9A 3KRZA 2ZRWA 5H8PA 1PAMA 1FHVA 3G0UA 3A6OA 3ZIZA 4B9ZA 4MY8A 4PL2A 1OK6A 1ISWA 1OZMA 3MTWA 2B7NA 3AISA 4JXCA 1XD1A 2D22A 2HXUA 2WNZA 4LAZA 3I65A 4UFIA 4PTXA 3UQNA 3SM0A 3OLEA 4FLOA 4WY0B 3AO0A 3E38A 5L9FA 4ZZ9A 2PBGA 4W5UA 3KRUA 1ZBKA 1CXLA 5BROA 1LQAA 2V0TA 1FWWA 3NURA 3AMLA 1I1WA 3BAXA 3E12A 4GY1A 1VCGA 3TIMA 2F9RA 3TW9A 2INEA 1WP6A 1J96A 1DWGM 1DTUA 4F0MA 4PL1A 2RKXA 3UBPC 4GLEA 3S1GA 2PDYA 5FEZA 1RCXB 3NJ3A 1E6ZA 4GZEA 1F76A 2C79A 2V5DA 1U30A 1E6SM 1CXEA 1JDDA 4W5ZA 2VD8A 3CUFA 5BXTA 1GQIA 2C18A 1CXHA 1QW7A 2HRWA 4V1XA 3RDKA 5FKYA 4P8XA 2PU1A 1DE6A 1GOXA 4IHCA 4O8RA 1LOLA 3NG3A 4DY1A 4UUIA 3AHTA 3KTXA 4DLFA 2DGAA 2BHUA 2QDHA 4KWSA 1LG2A 3DYMA 1YW1A 1NDZA 4GXPA 3BMXA 2WCSA 1S5NA 2CERA 3C2EA 2OSWA 5AVHA 4D6EA 3DHFA 2DZSA 3PJTA 4RNFA 1F6YA 3W1NA 2INFA 3LSCA 2DZPA 3H4GA 3BCJA 3GNPA 3VM7A 1Q63A 2VCBA 4N6EA 3TC3A 4REQB 1QHOA 2MUCA 1K7FA 1HW6A 4NAFB 4K7VA 2CCRA 1A53A 2NT1A 3VINA 3O07A 1OGBA 4NRRA 3EWUA 2GGEA 5KITA 4A21A 5A6BA 3PG8A 4AY7A 4O28A 4RNHA 4KCWA 1RUSA 4W8BA 4JOMA 3KCJA 4F9JA 3BJTA 2P76A 4HA0A 2X40A 2RJHA 5H8MA 4XSLA 3RAOA 4AD3A 3SY5A 3BANA 3PSVA 3BGAA 1E5NA 3W02A 3H2NA 3OO2A 2FHCA 4UFKA 1M41A 1BQGA 2CC0A 5HJLA 3SN4A 4E0CA 1JYWA 1XGZA 3NSMA 2EG6A 4S3AA 1Y5XA 4JN7A 2BFGA 4AWTA 5ABEA 4I5UA 1Z69A 3UCDA 4E8CA 3FFSA 3FJ4A 1QI2A 1SQ7A 5T26A 4UOZA 1UP0A 4BI7A 5CPLA 3CL8A 4YVVA 4NU7A 3RM4A 3QZEA 1UUQA 1R3QA 3VZZA 1V6VA 3S2JA 1NU5A 3IIOA 4LS1A 4G2DA 1E73M 4TV6A 1JGMA 1TMLA 4PC8A 1RJQA 3T09A 3GBDA 4C6FA 1WAUA 3ZSTA 3W82A 2R91A 1H3GA 1QPOA 1ZU8A 1D9EA 3VMPA 1XSKA 4PTDA 1AFSA 4OIFA 1H5YA 1SR0A 4UB9A 3MUAA 2XIIA 3EMZA 1CTNA 2JEPA 2PF8A 4U5IA 3OIXA 4PMUA 3L68A 3ARPA 4EAMA 3MV11 1XDMA 1TWZA 3DFHA 4MYAA 5L6UA 3G8EA 4HSHA 3ABQA 3IRDA 4ECLA 3R43A 3CWOX 3VILA 1KCKA 1W2VA 3KXQA 3JU2A 2ZX5A 5HQMA 5HULA 4C6MA 3AQUA 1J0YA 1EJTC 3A5VA 1XYMA 3STEA 1UC5A 3GC5A 2RDTA 2WOQA 5A8NA 1XISA 3U48A 3WQOA 1Q7MA 4FS9A 5LNRA 5C2XA 1DTNA 3L4ZA 4FB7A 3I4EA 3OLDA 4QXIA 4NYYA 4LS2A 1XBVA 1L6YA 1XRVA 3CPRA 4O1AA 3S6TA 2CBVA 4Q4RA 3FJ6A 2GOKA 3GAYA 4WY0F 2I57A 3UVIA 5DXXA 4L9ZA 3ARXA 1F8MA 4L4MA 1MNZA 1P4CA 1HN1A 2R94A 1W1IE 1XR2A 1OCBA 3ABOA 4HHLA 5BRPA 1WUEA 3W87A 3EKZA 1TRIA 1POKA 3NAVA 2D0GA 2ZRZA 2Y7EA 4O0ZA 3GX9A 4DO4A 1K8YA 1YHTA 4RE4A 2H9AA 3FA5A 3W6YA 3K4AA 1UROA 3KOWA 3MHGA 1EJRC 4DWSA 1TUXA 3DBNA 4WD0A 3DFYA 2WHLA 5EB8A 2PDWA 1BKSA 3MZNA 1GQLA 2WNNA 3KAOA 3DU0A 9XIMA 1FUYA 1GPFA 3LM7A 3NIYA 2Z7GA 4CNUA 1KNWA 5C9ZA 5H2ZA 1JCMP 3L0KA 4IPPA 3WLOA 5C8BB 2RJGA 3HA1A 1FWBC 1N7KA 3IUHA 4P7QA 3WZ0E 3PBGA 5HQEA 4H6RA 1W5OA 3KP0A 1KA9F 3ZLGA 5K7JA 2YL8A 3ICJA 1MXSA 1TJPA 4OBSA 5FI8A 4EE9A 4E5TA 1GPWA 4NAFA 4HTYA 2PSNA 1XLCA 1UD5A 3NPVA 1PO9A 2I14A 2E8YA 2Z2BA 2VFFA 2YDAA 3DEQA 2QDEA 3M46A 2WSQA 3VOHA 3VKBA 3N13A 3DI0A 3LI1A 1V08A 4HPXA 1GJPA 5CGMA 3ZZ1A 1I8JA 2JALA 3CHFA 5IBXA 2VGGA 1DIDA 1IHIA 3Q94A 3MJMA 3AZSA 1U2YA 3LA4A 1J10A 1E55A 1TPDA 3UXDA 2WW5A 4YJ5A 3GXDA 2ZX7A 5H6HA 1RXOB 1FWFC 2HROA 2EPMX 3RU6A 2ZOXA 1LZOA 3E0LA 1RD5A 4Q3MA 3LENA 4O10A 2ZRUA 4MY9A 4OT7A 5HMSA 3EMCA 4JNMA 3WQ6A 4AIUA 2E1WA 4IIHA 3PPFA 1EGMA 1QHPA 3TW6A 3MUIA 2GDVA 5M2FX 4IMEA 2AOSA 1XLDA 1S5MA 2WC3A 3KHJA 2NUWA 3VX0A 4N6FA 3RJXA 2HCVA 4X9SA 4G8TA 3S47A 3EKGA 5H91A 2XDFA 1Z48A 3CUGA 3WNPA 7CGTA 2VOMA 8CGTA 3QFWA 1R87A 3EDEA 1OADA 5C6MA 1F5ZA 5HNUA 1E9ZB 2OKOA 4A2SA 4JHZA 4OKDA 4ASTA 1UKPA 4BEQA 3ANYA 3W9ZA 4C6EA 1HKVA 3P3BA 4LWWA 2J79A 3WLSA 1HL2A 2E77A 4FOKA 4M6QA 1V51A 1ADDA 3HGRA 5E9AA 5A6TC 2O4MA 1JPKA 2P8CA 4CQBA 4UC5A 3BLDA 5ECUA 3MSGA 3PNZA 3GS6A 4GGBA 4AWUA 4AMCA 1D2KA 1WYIA 1EIXA 1XIFA 2XISA 3SCOA 5CQ1A 3FOKA 1ZENA 4W87A 2CU0A 1LM1A 1A5UA 4AU0A 3FSUA 4KETA 2AGTA 1W54A 4UMCA 2RAGA 2OKTA 1TWWA 2PLJA 3UCCA 3ABRA 4JX6A 5AC6A 6REQA 3UR8A 1QW9A 4H1ZA 3W7PA 3M07A 2ZUSA 3W2KA 3CLWA 1H50A 4XISA 3L0NA 3APGA 1BGGA 4N7QA 3G24A 5CAHA 4PCSA 3WK3A 4A3RA 3UF9A 1LBLA 3ARYA 3A9IA 2J8FA 2Z2AA 3V5OA 1TQXA 3ZYZA 2UY5A 4GE8A 1QNRA 4FXFA 5C5YA 2J6XA 3M4HA 1QOXA 1Q6LA 3DFNA 4L9YA 1NAL1 1RJRA 2OJPA 1RV8A 3E5PA 3W26A 1LWIA 1VEOA 4XZWA 4JQ1A 1CECA 1S1PA 2V8ZA 3TLLA 1ENUA 2AL2A 1XICA 2JK2A 2WPBA 4PMJA 3PJUA 4MWAD 2V3FA 3RJYA 3N9SA 4A3UA 1QWGA 2PDUA 1RA5A 3RXZA 3T08A 1PE1A 3TLQA 3DDMA 3PZGA 3BV7A 2ONEA 1V6XA 2CLKA 1XDJA 1B3VA 3W72A 4BWLC 1JCYA 2PDKA 1H11A 4AW7A 4CEXC 1WPCA 1IT0A 1TE6A 3NWRA 5DY3A 1LUCA 1PTGA 3EWXA 1UMYA 2NUXA 5C71A 5GVJA 5LXXA 1GQJA 2IMRA 3AXHA 4K1GA 3MO4A 1XX1A 2O7QA 3IIVA 1Y5WA 3HG3A 3KRBA 3GY1A 3BLOA 2J62A 2C6QA 1HUVA 3BMVA 3OVPA 1JAEA 3R58A 2CLPA 5DT5A 4WGHA 1EFZA 4JFUA 1P48A 2NT0A 2YBVA 2VEKA 4F9DA 3NTYA 4O13A 3CHEA 3DKLA 1TPC1 3GH7A 3W7EA 3S2NA 2P88A 2ACRA 2QF8A 2QCEA 1P0KA 3D5HA 3RCNA 4FX7A 1K4HA 4UXDA 4MF4A 3F7JA 5AB3A 1CXFA 4TX9A 4H7ZA 4F2UA 4IMCA 2BASA 1V7AA 1EEXA 1RQHA 3DHPA 1KGWA 2A3AA 4A3HA 4KPLA 4NJHA 4D9PA 3IWPA 2GUYA 3FY1A 3EDDA 2OOFA 4RW3A 1YNPA 3U9IA 1P5BA 2NQHA 4DAIA 1Q6GA 3GTIA 2QV5A 1NOUA 3LXBA 3TYBA 1Z8AA 4L4OA 3PS7A 3M0ZA 3ARRA 3VMNA 4NJKA 3T8LA 5AN7A 4NNAA 1IE7C 2V30A 3IGXA 4FIRA 3H7RA 3SQSA 4XKYA 1YDYA 3PUOA 4UTWA 2YYUA 1A5AA 3W24A 2Z1BA 2VUYA 4J40A 1ZRQA 2QJNA 4GRSA 1CCWB 4LVBA 2YCKX 5D8WA 2Z6IA 4GI8A 2OEJA 3VC5A 5FOOA 3WD3A 1KGXA 2EEXA 4KWOA 3ZVIA 2CZEA 3IAQA 4CCCA 5LA0A 3VOCA 1W9BM 5A8PA 5CSRA 3WO8A 5DMNA 1AL7A 3R1ZA 3PTMA 3ZWTA 2QCLA 1JI1A 3GG8A 3GUGA 3KS5A 3PM6A 5D37A 3AMGA 4HSOA 4QQUA 3CWHA 2JEQA 1J2WA 1QO5A 1X38A 3FYPA 4C6CA 1ZUAX 5M03A 1ONXA 5D9NA 3BPWA 2FQIA 1AD1A 5F4XA 4F48A 1JZ2A 2B7OA 4O18A 4L1XA 1A0EA 4AF0A 2V5KA 4AMAA 4OFCA 4CN6A 1TKKA 2V5CA 5EY5A 1V6UA 5HATA 1VGAA 1VPXA 3QFEA 3TYEA 3NQEA 2YW4A 1D8CA 3FDKA 5FEXA 2J7CA 4MYXA 3E0FA 3FN9A 4GYPC 1CXKA 1ZBWA 4LB3A 4IPLA 4MNJA 2ABBA 2G8ZA 3DFPA 4GC3A 3EA3A 2Q3OA 3B9OA 2R1MA 3QGAC 4IP5A 1E3ZA 1ISVA 3AFBA 3ZSSA 3WLNA 4ZB2A 2OQHA 3GDMA 3MHUA 4D71A 1XPYA 1Y8BA 1NTHA 3MQTA 2FYMA 4Y2WA 1HJWA 2HVNA 4CU8A 1VPYA 5KETA 4CD7A 4N02A 3WEMA 4ZENA 3W0KA 4F0KA 2OLAA 4I6KA 2TPSA 1U1UA 4H83A 3CZLA 1IGSA 2VO5A 2ASHA 3WF1A 4ZB0A 3RCYA 4YS1A 3W83A 2J9XA 4KF1A 1A5CA 2E25A 5HNRA 4TVDA 3LPPA 1JULA 2VDGA 1ICPA 5CLTA 2VR4A 1AUSL 4HA1A 4A3YA 3V35A 1NWSA 2G3NA 1U1JA 4Q4SA 4CNTA 3WNLA 3WQ8A 3BURA 4IIDA 1RLDA 3IGHX 5GNXA 1HGYA 4Q7IA 2C1IA 1N8IA 5HWNA 2Z1SA 2QIWA 4YYFA 1GVIA 1MEHA 2VWTA 5BW6A 2NXIA 1E1FA 1HXJA 1VF8A 3PZNA 1T6MA 1E56A 3AIRA 3OBKA 5AYZA 4WF7A 5DLCA 2X0SA 5ABFA 2PRHA 1VFMA 1W5MA 3CMGA 2OR2A 1EDGA 3UWYA 3W4RA 4M56A 4L6HA 3V0TA 4JDBA 3NL2A 1TVPA 3ZOAA 3M43A 4MB4A 4DJFC 2JF6A 4C5ZA 2CESA 1JZ5A 3NQVA 1ZZMA 3LCGA 5E09A 2V5JA 1QTWA 2WCAA 4DZAA 2J9ZA 4BEUA 2QJGA 4KMQA 1K8XA 4I9JA 4H8NA 1I0DA 2DSVA 4UQAA 4M24A 2J7EA 4DWDA 2E4TA 3FEQA 3MMDA 1QBAA 2DVUA 5F2GA 1FX6A 1W3HA 2YSWA 2W61A 4S1FA 3I3BA 1C9WA 1E5JA 5JBFA 1YLVA 5IFTA 3SSZA 5DANA 3C86A 1F61A 4PCPA 1MFVA 3BOFA 3VMOA 1JFHA 1EO7A 1GJWA 1V6YA 3KEHA 2NXGA 1BG4A 1A3XA 1S2VA 5SWUA 1UIOA 1VEPA 1WXZA 2OZ8A 3T05A 4Y9PA 1AL8A 1EOMA 4Z2KA 3SGUA 2WZEA 3LHWA 4Z1DA 2RUSA 3KP1A 3SUWA 3PBMA 1QI3A 2HJPA 1PV8A 3UR2A 3TR2A 2ZA1A 4L6OA 3ZT7A 1S38A 1GVRA 2VNCA 1OQFA 1KCLA 2FJUB 4QFUA 4C6BA 4QLLA 2PEVA 1NQ6A 4JTRA 2CW6A 4L6DA 2NLYA 4LUTB 2PGFA 4DPQA 1BWKA 3MUXA 3F4NA 4KGJA 4GVFA 3S2CA 3UJ2A 3O06A 4MB5A 1FFQA 3IJDA 4JNZA 3B9NA 2W67A 1FWDC 3P84A 2ZTKA 3ALFA 5BOOA 3TQKA 4D6HA 1IZCA 2XIJA 2GPTA 2PF0A 2C13A 1M68A 3C0SA 5CZKA 3HPAA 4QITA 1KQZA 4GACA 2QUTA 4KT2A 4G7EA 2GL5A 4N9BA 4R53A 3S83A 4NT0A 4L1WA 4RNIA 4U5KA 4MNMA 4D8AA 3I68A 4Q8UA 2B7QA 8A3HA 1LLOA 1J0IA 4ATWA 4IGNA 1OCQA 1R2TA 4KEUA 3UVAA 3VKDA 2D73A 3R25A 2UV8G 1FH8A 2V68A 2ZCGA 1H60A 2A2IA 1L6GA 3R94A 3BCDA 1WZAA 1R9ZA 3PHAA 3BW3A 1SFTA 5AZ0A 4XZMX 3EOEA 4DHGA 1R9YA 3HU7A 4MUZA 2G4FA 2DJXA 3P80A 3L4YA 2G3JA 4RJEA 5T9BG 1NOWA 3MMTA 1DV7A 2YA2A 3C5QA 3HV9A 3TU9A 1K70A 1N2VA 1BYAA 1VBRA 3WLQA 1P1XA 4G56A 1VFHA 2VC6A 2A4AA 1D7FA 5FESA 4RZ4A 3CIVA 1MWOA 3TX9A 1OABA 3V75A 1DEDA 2VFGA 4YTRA 3GR7A 1G0CA 1MDRA 3DFOA 3TH6A 3TONA 4GI4A 3I6RA 3VYLA 3U6WA 3H2AA 1X97A 1J0JA 1IZJA 4KCVA 4EPEC 4EIVA 2G50A 5CBJA 3OVGA 1OC7A 1EJXC 4H41A 1EXBA 3LY0A 4GJJA 1Q6FA 1IT8A 4Z0JA 2PD9A 3IK2A 4NUWA 1BSLA 3M5ZA 3GIYA 3TR9A 4LBUA 5JVLA 3T44A 1KM4A 3PTDA 1OD8A 2VC7A 2FKPA 4OHQA 4JCMA 4KRUA 3VKJA 1KR0A 4F8XA 3TTYA 4PUEA 5EU9A 1H7XA 3F1QA 4Z1BA 5HJYA 3M16A 4H9MA 3L5AA 3VIHA 3F2BA 3AHXA 4JFTA 1A49A 1UG6A 5D2VA 2IXVA 3W25A 4GQGA 3N9KA 3L2IA 3UPMA 4LX4A 1JD9A 4K68A 3F2DA 4I90A 2WB5A 3EX4A 1PPIA 4KESA 1KM2A 1YXDA 4LB4A 2QXWA 2V67A 4GVIA 4JTKA 2Y70A 1BXNA 2REQA 2QAFA 2GJNA 4W9TA 2J25A 1NFBA 1P7TB 1BF2A 1DL3A 1K02A 4CCEA 2VD9A 3EEZA 3LCWA 1FCBA 3LCLA 1K9EA 4US6A 3E6EA 1JRBA 4TO8A 5IM51 1PXGA 2XTKA 1DE5A 4ZQNA 2A3CA 1R2RA 2YKKA 3SFKA 3LHVA 5K2ZA 3TJLA 3WQFA 4B5UA 1OZQA 3TTEA 4JQAA 4FR1A 3WJYA 4JN6A 1DWJM 5TD4A 4C6QA 3TN4A 1Z89A 4HQVA 4MGGA 5AHLA 1TV8A 3E9AA 3GZ3A 3HB9A 4IM4A 1LROA 3NZPA 5AOUA 2XFWA 2E6DA 3PZIA 2ZX6A 3W71A 4CD4A 5DO8A 5FJUA 3BLPX 3W7QA 3IRSA 4A35A 3SIMA 5G1TA 2VRKA 2PA6A 4Z42C 4KEZA 3EGJA 1TV3A 2P5NA 1PX3A 5M5DA 1KKOA 4LANA 1YADA 3GIQA 4M0XA 2OX1A 3S5SA 2I5QA 2I1OA 2WM1A 3S1VA 1FCUA 4PUDA 3WCZA 2YCLA 3A3WA 3PZOA 3PZVA 2VQUA 3LGEA 2ZXDA 3K4DA 1XIHA 4ATLA 3MYOA 1VPQA 1HKMA 5F4WA 1YEYA 2P0IA 5LKYA 1F3WA 2WJFA 1UOZA 3BOXA 2D1ZA 1QPKA 1Q8JA 3VABA 4RKAA 3ZR6A 1J93A 3CTLA 5C54A 3L0GA 2PMQA 1MQRA 4DJDD 3LZ3A 3TAOA 2ZZ1A 1UCWA 1GCYA 3LCFA 2P3EA 3AMCA 3RK8A 6A3HA 5MF5A 1YX1A 1PVNA 4AIBA 4RZBA 4CN1A 4IUOA 4UTJA 3O15A 3LV5A 2EG7A 4TUFA 3GNDA 4I3GA 3AIWA 2OX4A 1VJIA 3TA6A 1RPKA 2VCAA 5HPOA 3WLKX 1OFOA 1VFTA 1PJ9A 4LJ3A 3PZTA 1H1ZA 4H01A 4I8DA 1W9VA 5KSWA 3MUZ1 3WBYA 1TPVA 4IGHA 2Z1KA 3QPYA 4PBEA 5KZDA 4L61A 3E96A 3MP4A 3MZ2A 2NVAA 3F5LA 5MKGB 5CC3A 4MAVA 4P8WA 4DJFA 3WEOA 2NV1A 3LRMA 3SCSA 1TSIA 1IXNA 2PI6A 4KEVA 5EMUA 4UMBA 1EJSC 2XIMA 3IUIA 4AIOA 3QY7A 5E0CA 1Q4NX 3KL5A 2GVEA 4E3VA 3VNIA 4AX7A 1MZRA 2ZUVA 4ZSUA 1FWGC 4RW5A 3RX2A 4AXNA 4JIPA 3M7SA 3VD9A 1JL8A 2BP1A 2QVNA 3W7LA 5D9PA 2NXHA 2E68A 3RLGA 7TAAA 1TTQA 1I0BA 3CZ8A 1QOPA 1UYQA 4JTCA 4QP0A 4NNCA 1IXQA 3DERA 3GXNA 3A4JA 4IQEA 1Q5MA 1E43A 1QUMA 2HWGA 3ALGA 3G1RA 5I07A 4WQ6A 3SUUA 1JZ8A 3M0JA 1OF8A 4S3EA 2BODX 2DIEA 2ZX8A 4HT3A 4Y9NA 1NDWA 5E6ZA 4LF1A 4K38A 1EC8A 2NVCA 4OECA 4XKYB 3EDFA 1K77A 1QVBA 3AHYA 1JDFA 2AKMA 2WC7A 2WNQA 3M0IA 4IIEA 1YBQB 1W1YA 3L4VA 1OFAA 4XX6A 4O1BA 4R7JA 4FXJA 1EUAA 3E74A 1LCOA 1OG0A 4JTQA 1BYDA 1EX5A 3P62A 3H2EA 5TIMA 4H9XA 5LHEA 3UYIA 2P3ZA 3RLUA 3GW3A 4HB7A 2VI0A 5FIPA 1BEUA 1FWCC 4PCFA 4L65A 2E9BA 3SCUA 5BXPA 2X7VA 1FCVA 2ZX9A 4IP7A 4GNVA 2OSXA 3BLEA 4N9DA 2V69A 3AUJA 3HM7A 5J04A 4PRWA 1OK4A 4JEQA 4G1KA 2G3FA 3L65A 1FY6A 3UNDA 1TPFA 1WDSA 1Q4WA 1M5WA 4L5ZA 1ZJBA 2ZYFA 4ZSTA 3QBUA 2OXNA 4XUGA 1KV8A 1RK6A 1FHLA 3LYEA 4QROA 4N0RA 1X8CA 3LXCA 4PBFA 3WK1A 4OV9A 4P7NA 4AWSA 2BB0A 2VXNA 4LH8A 4LUTA 2DW7A 3SI9A 1XIBA 3QQWA 5LNWA 3UZ5A 2ZKMX 1V3JA 2NV9A 5BWAA 4J3VA 4AZ7A 1VFSA 4HHMA 2CLEA 1KRBC 3GVWA 1VAHA 1ZCCA 3DECA 1PWMA 2WBGA 1ME8A 2BX7A 4Q8NA 3RFAA 2WZHA 3PJWA 3H2FA 3VCCA 4L9XA 3T4CA 3VU2A 2VEFA 2VQTA 4S2BA 4RK8A 4KH2A 4OWGA 4EWND 3PY2A 2PC8A 2ZXAA 4P7LA 4HMCA 3WD0A 4CUCA 1OFPA 1T7LA 2G37A 3KVMA 4S23A 3DKJA 4FXRA 1AG1O 4AC7C 2IKGA 3O6AA 8XIMA 3T6CA 4S3CA 3O16A 3OP2A 1VEMA 3QR1A 3QSTA 4GWEA 1VC4A 2PGRA 2PTYA 2V2CA 1XIDA 5K3VA 3JRKA 3AYRA 2FTYA 3UEQA 2YDSA 4HMNA 3H21A 1E9YB 3HPXA 1RQEA 4AAJA 1A4LA 3FCPA 4MNKA 2UY4A 3OA5A 1O60A 3LTYA 1G4EA 2Z00A 5A2AA 2XUCA 4CQ9A 5JXQA 1WDWA 5H1WA 5D2WA 1E1CB 2Y7FA 4X2RA 2ACUA 3PPGA 4BWLA 5GPRA 4D2JA 2Y7DA 4QQ3A 3VE9A 4UTWC 4DELA 4DI9A 2X7WA 4UNKA 2V5LA 4D6DA 1XLMA 2PWGA 5JH1A 1HT6A 1LBMA 2FHBA 1LP6A 1K8CA 3ANUA 3DENA 4JKMA 3JR2A 4ACZB 3W7CA 4HK7A 4MZ1A 1H4PA 3FS2A 3LX9A 4RXGA 1UBPC 1OYCA 2HMCA 4F0LA 3TYAA 3W38A 1W5PA 1QNOA 3A4XA 2ICSA 3RPTA 1W3LA 2FDSA 4KRZA 1QPRA 1UKTA 4UTTA 2WMHA 4JHOA 3GM8A 4AY1A 2BOFX 3R13A 4R34A 3LQLA 4QLJA 3AIEA 1A5LC 2VCCA 4UZSA 5BU9A 1KRAC 3LD5A 2YDRA 4LCRA 4HZ6A 3TC6A 4G7FA 3ITVA 2QMKA 3LPFA 4LBRA 5KTLA 4UTMA 2NQ9A 4LUSB 4XD3A 4GG9A 3DX5A 5FF4A 2BY3A 2QUNA 5J8LA 5DRCA 1I6NA 4LRSA 1G69A 4NX0A 4GZ7A 3QY8A 5G1MA 4I9TA 1NF7A 4YL2A 1KC7A 6XIMA 3WLMA 1FH7A 5LSMA 5A5WA 2DQWA 3K2GA 1Z42A 3R10A 1OCNA 3S5YA 4W7VA 1SGJA 2OO6A 3WJZA 1K9DA 4GGHA 4DBEA 2BVTA 1UP3A 3GTNA 1W9PA 3HQOA 2Y5EA 1KXQA 2EG8A 1M1BA 4XO6A 3RHGA 3PP7A 4JICA 1UR1A 1FWIC 2XZ7A 4GINA 4O16A 1J0ZA 5CJ5A 1SJAA 1WZLA 3B04A 3WBXA 1KW1A 2J78A 2GLKA 2ZWZA 2VP8A 4GC4A 3LS9A 3VE7A 5CPQA 4YLWA 3LMZA 2FH6A 1XC4A 3LBOA 6PTDA 2Q3RA 3DXIA 2J7BA 3LGGA 1GVYA 2PGWA 1VFOA 1V0MA 4LTSA 4L4LA 2QDDA 3WH7A 1E15A 3NYZA 3OZMA 3S9ZA 1XLKA 2VEMA 4X22A 1F3TA 3KZPA 3W37A 2HQAA 4UFHA 3UY8A 3PZUA 3P2VA 1V3KA 4OU1A 1VIZA 1ZHAA 3J7HA 1BF6A 2WVVB 4FXSA 1E6XM 3S5OA 1FDZA 2GVJA 2ZE3A 3KS6A 1F73A 4WOQA 3C0QA 2NX3A 3FJLA 3TV8A 1R3WA 3NZ1A 3D46A 3UJEA 1JAKA 1VBGA 3WMLA 3FLUA 4DEFA 3OJGA 5BXRA 1JCJA 3UGVA 2A85A 4TQTA 1ZGDA 2E9LA 3W73A 2E40A 2WKLA 5HK4A 2HPMA 1IR1A 1CPUA 5I3IA 1VENA 2DH2A 5D03A 1XSJA 5C2CA 1WV2A 1KFKA 1PZ0A 1C92A 3ELFA 1G01A 3CEUA 1DJNA 3QF0A 3ATYA 1NFGA 1JRCA 4JTDA 3A5FA 1W8GA 2X8RA 4C6IA 2ABAA 4H6QA 5REQA 2PRLA 3RR4A 4ERGA 3LNMA 3R79A 5TAOA 3QPEA 4GYFA 4NSBA 2DSUA 4C1NB 2OT1A 3VDBA 1C29A 4L64A 3WEZA 3Q37A 3G1YA 2QF7A 4LC8A 3MSYA 4UTLA 2FH8A 3TSBA 4U28A 4MKNA 1OX6A 2PP1A 5KINA 2Y6ZA 4H9TA 5XINA 4LVFA 3UR5A 4ZOCA 3W2NA 2E6FA 1B4KA 4HHPA 1KFWA 1YBQA 1R8LA 5EMLA 2WZTA 4X61A 1UUOA 1OCJA 3GYEA 1TG7A 1EP1A 4C7GA 1UWQA 2QJHA 5DMYA 4GH1A 1B30A 2YLAA 1HQTA 1TPUA 2YCEA 3ANVA 1JZ7A 2Q02A 1P6WA 4W7WA 2G4JA 2E5BA 4GZJA 1A3HA 1RY0A 2A6NA 5BYWA 1DPMA 1KXTA 2GGHA 1AJ2A 2PDGA 2GUUA 4Q8TA 4AF0B 1W9UA 3PC0A 3T55A 3C52A 4WK9A 4WUIA 2DT0A 3PWIA 4WZHA 2HK1A 4GJIA 2BHYA 2WQDA 2WMFA 3VGHA 4DNHA 1YTDA 3KWSA 4AB4A 3KTCA 2Z7KA 3H53A 3ERPA 5CPTA 3WLLA 1YDVA 3CUJA 3IJIA 2W0UA 5FSDC 3KOXA 1ZALA 4WJXA 3II1A 4GBDA 5CGQA 1W8SA 2YL6A 3AUOA 4W86A 3WL1A 3VNJA 2ISFA 1C8XA 3NYDA 1OYBA 1XM3A 5FAGA 4R9OA 3HZ3A 1SPQA 4HCDA 3GE7A 4AIEA 3BQ6A 4GX8A 3HBLA 4QAWA 3WDIA 1YDOA 1O95A 3P14A 3S1XA 3TVAA 4LFYA 1O4UA 1AMYA 2EKCA 3THCA 5JIPA 1UA7A 1VQTA 5ABFB 9XIAA 3BK0A 2VL4A 1PKNA 2CLOA 2QT3A 1FA2A 1F3XA 1DJGA 2X2YA 3GU2A 1UR0A 1PKMA 5CC6A 1VP5A 1PKYA 4O15A 5JIWA 4ZQMA 2WJZA 3AC0A 2UWFA 4YHEA 4KRTA 3UG3A 2FDMA 1A47A 4HP5A 3WFLA 1Y7VA 1IIGA 3FDGA 1CW2A 3AWOA 4V33A 3GKFA 1UOKA 1R9XA 4D6FA 4TR9A 5HPCA 1V4YA 4JTLA 3WMBA 1CWYA 3EOOA 5FEWA 4Y9AA 1JQXA 3OG2A 4XKMA 2Q01A 3KOFA 5CJMA 4FNSA 1HL9A 3NGFA 4FLRA 3KBSA 3AHZA 5A6MA 1G9HA 4R85A 2KAUC 4QRNA 2ZRVA 3KLLA 1MVYA 4LVGA 1G94A 2YPIA 4M6VA 4ZOBA 4PMRA 3CASA 4FNRA 3IAPA 3RN6A 1EGVA 5LZLA 3AIBA 4R7OA 3CV1A 1WA3A 1DIOA 4FAMA 1LJYA 1RJPA 2PD5A 2CHOA 1HX0A 3C0JA 3NQ6A 1UMLA 1XIJA 3W76A 4DIAA 3WQCA 1SJCA 2WKGA 3M6DA 5FF7A 2CLMA 3LB0A 4DB7A 2JKEA 2ZICA 3AU6A 3BUVA 4IQJA 4UMAA 3WBAA 4AXKA 3S3GA 4PB4A 5HWMA 1A0CA 1V5XA 4JFVA 3O1NA 1UQYA 1M01A 3IIPA 4PMXA 5XIAA 3LEPA 1OC6A 3EA1A 3BH4A 4GYJA 1J79A 2PZNA 3IGUA 5LXEA 3SGZA 5FF3A 4R5EA 3AIQA 1CEOA 3FXGA 4DBUA 4BZYA 7TIMA 4UTHA 3ITCA 1I2QA 1IZKA 1XCFA 4IPJA 5T91A 1EEPA 2WYSA 1GWJA 1OFDA 2OT0A 2XSAA 1D3GA 2P10A 2D2HA 1A80A 2D69A 4XAZA 1RBAA 3VC6A 1NY1A 1E6QM 3H6OA 4CD5A 3UZJA 3DN5A 1B31A 2CZ5A 1JZ4A 1R3RA 1AQMA 2D3NA 3SUSA 1H2JA 4G5DA 1VS1A 4PUMA 2OQLA 4ORIA 3SUVA 4GOAA 3K5XA 3UZWA 1E40A 3KHDA 2ZFAA 3MB9A 1YMYA 1R3TA 1LT7A 3OYXA 1UD4A 3SQMA 1MSSA 1ZP4A 3FV9A 5TBOA 1E0WA 5I3DA 3OIHA 3ZR5A 1FP8A 3E0IA 4BHYA 4JYEA 5I23A 4OJYA 5HR7A 4J3UA 4Z1AA 5EFDA 4V28A 1IWPA 3SBFA 1OX4B 5E0KA 3GNRA 3NXFA 1RZMA 4H04A 4JKKA 3DCPA 2J74A 3VK5A 4YN5A 1EPXA 2OEKA 4EWJA 5C9UA 3OGSA 4CQCA 2D2GA 4AZHA 5CPOA 3K46A 3AYSA 4FIQA 4PRRA 1VCFA 1J5TA 3MMWA 2W91A 3RM8A 5CSSA 2POTA 4QS5A 3MY9A 1XFCA 2VFEA 2PDLA 1ZJHA 1DXIA 2J66A 4E8DA 1OYAA 4QLKA 4BKNA 1MNSA 2CBIA 4IMAA 4A6GA 4NY2A 1GVSA 3WQGA 2V82A 4IQLA 1JIBA 1FKWA 3ZS4A 4ZO9A 2OYKA 3ZJ8A 2PCQA 4PODA 4J2PA 4IF2A 3G22A 1TIMA 1O7AA 2UY2A 1GJUA 4MSSA 1IGWA 4HU8A 1H63A 1W3IA 3W88A 5FJOA 3GQYA 5I7GA 2QCNA 2F7FA 3V0SA 3EYPA 3WJXA 2VX6A 4C5YA 1X1NA 3THAA 4AYGA 2Z2UA 4E38A 1J11A 1RK5A 2ALDA 2VUNA 1CLKA 1SZGA 3NQGA 3OHIA 3GXIA 2YB4A 1JI2A 1OT2A 3ITGA 4XD4A 3FXYA 4HJFA 4BK9A 1BVWA 1VFUA 3NOYA 2YXXA 4DI8A 1WKYA 1ZSXA 3PBWA 4O0KA 4DRSA 3G1DA 2WLZA 1C3FA 2FPTA 4W4QA 5HUOA 4C90A 4NZJA 4QJ5B 4DUWA 5LA1A 3F5KA 4KWUA 1ICQA 3IPWA 4Q4QA 2HNHA 1Q6DA 1EYEA 1LL7A 3LUTA 3QOKA 1FCQA 2F38A 1F6KA 2PDNA 1TTIA 4X60A 1KGUA 1FVPA 3B0UX 3S9YA 1E72M 4PUUA 3TZNA 3CYVA 5G2IA 5F1UA 4O52A 3AXKA 3BO9A 3KDNA 2JGQA 4RV8A 4IIBA 1FH9A 4JDYA 1L2UA 1SFJA 3OU8A 2JQXA 4NZ5A 4TOQA 3W84A 1RCOB 5D05A 4ICNA 4DWSB 3WJSA 1IWAA 3G0SA 4B3LA 3VOJA 2XWEA 4PYSA 4MKVA 4YMZA 2WK2A 1VIWA 5C9WA 1MUMA 4O0QA 3VGGA 4PMDA 3LV6A 1FP9A 3EX3A 1XLFA 1EWDA 3W7OA 4JQ2A 1XH0A 3PG9A 4CGTA 3NSNA 3EX2A 3G6LA 3SFWA 4RUBA 1QJWA 5BMXA 4EXQA 2ZZ4A 3NDOA 2L5HA 3ARQA 1E6NA 1BWLA 4YU1A 1H51A 3QY6A 3M0XA 3OQEA 1C7TA 4U31A 3QXBA 3KZSA 3DIPA 5BNKA 1R38A 4HBKA 3SJNA 5CC7A 4XK2A 1XRTA 5CZ0A 3GVGA 3MW7A 1ADOA 4IPNB 1KKRA 1E4IA 4MB3A 4C91A 2W92A 2QEZA 1UR9A 4BR1A 1W31A 2H3DA 1PDZA 4ZA0A 5LIYX 4ZO8A 3RILA 1MQQA 3T0CA 3EMQA 4X0VA 4JYDA 5A69A 3RO6A 3W7KA 3GXPA 3USZA 2FPVA 1HL8A 4Q4PA 2A1YA 5KMYA 1ZNNA 4PE8A 3EB2A 2EAWA 4HU3A 5BU6A 1XBYA 4P5UA 4ROPA 4DLMA 3IIZA 3E02A 1KFJA 1H1NA 2D2OA 4KIRA 2J47A 4HPGA 2A0NA 1UKSA 4C6KA 1J6PA 4GIRA 4NASA 3VFLA 4BF9A 1ZTVA 1R46A 1PIIA 2RDUA 4ZFCA 1W17A 3W1MA 1AD4A 4I7UA 3OLGA 1TR1A 3TYUA 4GVGA 1LG1A 1NOFA 1Q2SA 1OD0A 1E9LA 1T99A 2QUMA 4GUJA 1KRCC 3NQAA 1QO2A 4E4PA 3TW7A 1RQBA 2H6RA 1LT8A 3FKKA 3NL6A 4JIEA 1W9DM 1I9CB 4A29A 3ZVHA 3KFTA 4MOZA 1ZPTA 4J3WA 2G41A 1H0GA 1ALDA 3GHSA 4BI6A 3VD5A 2ZC8A 3TOPA 1GKRA 1IXPA 1SFSA 4D6CA 3B0PA 4XQ6A 1KBLA 4QEEA 2DEPA 1O66A 2G0WA 3EAUA 1FDJA 2Z4GA 4EVZA 1UWIA 3W7GA 4ZE5A 1H1YA 2QHAA 4A3QA 1XGDA 2GZXA 1KCXA 3EDKA 3NOEA 4DF0A 1QR7A 1UZ1A 3WH6A 4KCTA 2Y62A 5HMEA 3ZJKA 1DWAM 2VMFA 3DG3A 1OGSA 1PDYA 5HMDA 2C71A 3NFUA 4UNIA 5HUPA 3SECA 2PAJA 3O05A 1E4NA 1SU5A 1OFQA 2DZAA 2BSLA 3UERA 1XRSA 3B8IA 1AW5A 4AHOA 3D47A 1KWKA 4WCJA 3AS2A 1I60A 3C2VA 4PB3A 3SQLA 1O1HA 3TOYA 4C6PA 4Q8PA 3V4BA 1K6WA 4UQBA 1ITUA 1V8EA 1B1YA 2DV0A 1EL3A 3CQIA 4F79A 3G1HA 3UNTA 4HNVA 3DZ1A 2G3IA 3GFYA 1WKEA 3GDLA 3CHCA 2G95A 4ORMA 3VA8A 4NP7A 3WK2A 2FHFA 2VFIA 3KCLA 2J7FA 3CJPA 2QCDB 5F2IA 3H4XA 3GK0A 4G9PA 1V3MA 3VOGA 3QGKC 5HOSA 1KXHA 3CQJA 1MW1A 3P8IA 5EFFA 5CXPA 1QNQA 2O7SA 3IVUA 2QJMA 4GY7A 3P82A 4QM1A 2TYSA 1V02A 6ALDA 3ORWA 3SEPA 4IISA 1QCWA 5LIKX 3U7VA 3EX6A 4ZBCA 2QCCA 3QN3A 2YZ5A 2QCDA 1R0MA 3TKFA 2DZTA 4DYEA 1ITQA 3NZGA 4O14A 3LNPA 3R0KA 2W63A 5C9XA 6TIMA 5CZSA 4BFAA 4POCA 2Z28A 4A4AA 5LA2A 3LGDA 2I5GA 1GK8A 3M0LA 1TCDA 1ZP3A 1TV5A 2QUVA 1TWSA 3G1XA 1EO5A 1XXXA 4YWIA 1TYGA 1B90A 3AWNA 4CQAA 1PYFA 5HDRA 4MAZA 3FX4A 2DSZA 1OGGA 1GEHA 1K4GA 4HMEA 3B4UA 3CAKA 3S4TA 3ZWSA 2OODA 3PBYA 2XPKA 2B31A 3BLFA 4LYKA 2AAAA 2ESCA 3WNKA 1JGIA 4PSPA 2ZBTA 1K03A 1W1ZA 4NG3A 4QE1A 3VAVA 4F66A 4RV3A 5DCBA 3SY1A 4J5NA 4DM1A 1EBHA 1P0DA 1BVZA 4EACA 2YR1A 1CLXA 4I8YA 1EDQA 5EA9A 3CV7A 2X16A 3AS1A 1E6PA 7A3HA 3W3OA 4EXAA 4IFRA 3ZVHB 2VTFA 3M0HA 4QGCA 2ATSA 2CHRA 2EPOA 4GD0A 1E4LA 1GT8A 3RMEA 2NX1A 9CGTA 3NQFA 4HHHA 3R0UA 3C4UA 1UA3A 4AVOA 1SW3A 4GNKB 1KBBA 2VEIA 5M17A 1E0UA 1UZHA 4K8GA 3ZFHA 4HNCA 2HBXA 2TRSA 1W3TA 1SJDA 4M6UA 3LI0A 1HJQA 2BNJA 2J9YA 3N6QA 1EWEA 1NWTA 1KBIA 5HQLA 2P50A 1DIKA 2ZXQA 4IXXA 3CHVA 3AALA 1VRXA 3WLJA 1R7OA 1TTJA 3CH0A 1EKOA 3S5ZA 5CLWA 2VWSA 1F2JA 2H8ZA 1E0TA 2IS7A 3GVVA 3VD3A 3WQEA 2Y8VA 1AQ0A 2YXOA 4W93A 1EBGA 3ZJ7A 2HS6A 5G1YA 3RG6A 3T9PA 3SCWA 4DWSD 2W9MA 4HGXA 4CNPA 2W66A 4C7DA 2WNWA 1WE5A 2AQWA 4DJFD 4I9AA 4WGXA 4DZ5A 2J8GA 3B0VC 1O5RA 2GUBA 4JTFA