4AD3A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens in complex with glucose-1,3-deoxymannojirimycin
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
345
Chain Sequence
b'TELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 130
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad3A00
2VX5A 3THDA 1VBRA 3GH4A 3T0BA 3FHAA 5A8QA 4JCMA 1CLXA 1FFQA 2WXDM 3ARZA 3MUAA 2D0FA 4P7QA 1GQIA 1ZBCA 3KE0A 1K9EA 1LL4A 3K1DA 1UG6A 4OUEA 1UR9A 5BXSA 4U3CA 1HT6A 3L2MA 3VINA 1E0WA 3I3DA 2J7CA 1XCXA 1CENA 3WQ4A 4W7UA 1H49A 1X6LA 3VX0A 1CTNA 4AZ7A 1K6AA 1WAWA 3CIVA 3WH9A 1C8XA 2VRKA 3VD7A 3WUEA 2E0PA 1V0NA 1HL9A 5IFTA 2D0GA 1C7SA 5A2BA 2YL8A 4HOZA 1G01A 1BHGA 4KH2A 3GH7A 1BVNP 1MVYA 1WZLA 3DECA 1QW9A 2WMFA 2XG9A 4QLJA 1UWUA 2J7HA 5ABHA 1V02A 3ARQA 3ZT7A 1KWGA 1W3LA 3SIMA 3AROA 1AQ0A 1KQYA 1VFFA 4HPHA 1QI2A 5A8PA 3TTQA 3L4UA 1LF1A 2W61A 3WDIA 2QF8A 1EHNA 1E6XM 2RGLA 2X1IA 1D2KA 1VJSA 3TTSA 4CU7A 1JAEA 3OLDA 1SMAA 3EDFA 4MB4A 3UERA 3N13A 2CHNA 5TD4A 3B9EA 3W28A 1EOKA 2PF0A 5A6BA 1R85A 3CBWA 2O9RA 5KEZA 1CXLA 4JFWA 3RM4A 3RIKA 1NWRA 1WZMA 5CXPA 2J8FA 4MDOA 4DM2A 1FH7A 3RILA 1YQ2A 1XHGA 4KMQA 3AMCA 2XGBA 4LXFA 4DUWA 3BAXA 3U5UA 5A6SA 3GXIA 3ARWA 1W9VA 1JL8A 2VTFA 4AZBA 3AMLA 1US3A 1BFNA 2XIBA 1MW3A 3WQ5A 2VCBA 3VGGA 5FIPA 5C70A 4JZ5A 2WVVA 1UD8A 1HKIA 5EBAA 3AIQA 2WPGA 4LYRA 4PUEA 1IZJA 1E6ZA 3ARVA 3HN3A 3KEHA 3W27A 5A3HA 2VUYA 3T2PA 1H11A 1BGGA 1ECEA 4PMQA 1EHAA 1UQYA 3CHEA 5CSUA 4R27A 2GJRA 3VILA 4OJYA 3PZGA 4HU0A 1W2PA 2F61A 3VIOA 3WELA 4HTYA 3DC0A 2BY2A 5GNYA 1GVYA 2YA0A 2XVKA 1NP0A 4PMRA 5CLWA 1UA7A 1OD8A 4IPLA 3VM7A 1W91A 2A3HA 2DSKA 3B8SA 3K46A 3N15A 1V0LA 1MFVA 1OGBA 4IM4A 1QNOA 4JKLA 1LG1A 3VGBA 3RJYA 2VX4A 1UD5A 2W92A 4CCDA 2V3FA 1C8YA 1TCMA 1U33A 6A3HA 3OZOA 4IISA 1GHRA 5ABGA 3AMGA 1UYQA 1UWQA 1US2A 4DWSD 3NCOA 4GZIA 1DWHM 4PSPA 4MAZA 5EFDA 1EQCA 4UNIA 2CETA 3HMCA 3BMWA 4UQAA 3GTNA 2VL4A 5BYWA 4Q7NA 1UH2A 3WF2A 1PX8A 2WC3A 1ITXA 1EH9A 3EDEA 2YDQA 3BLKA 3CGTA 4AEEA 3CPUA 2JIEA 1FFRA 4HU8A 4CN4A 1HJVA 4NI3A 2VZUA 2Y5EA 4NF7A 3AS2A 2WVSA 1VBUA 2ZUWA 1GOQA 1OT1A 2ZUTA 4PMDA 4C7GA 3UR7A 3SCUA 3W6MA 3OIHA 1ISXA 2VZSA 1Q4NX 3KL0A 3AS0A 1UR0A 1G94A 3F5LA 2XVLA 1PIGA 4U3AA 2CESA 3VGHA 2UWFA 3WF1A 5D9PA 1H41A 3OZPA 3QOMA 4M8UA 4L4OA 1E72M 5CJ5A 3VGEA 3AHYA 4JKKA 1WDQA 3FY1A 3THCA 3GZAA 4TVUA 2OYKA 1B1YA 2QPUA 3T2OA 2O92A 3A3HA 4J7RA 2ZUVA 3GH5A 2CITA 3DHUA 4YN5A 4X0NA 3N17A 4QCEA 3AI0A 5IHSA 1FOBA 5CPSA 3SUVA 1QHZA 3AXXA 3WNMA 2YA2A 1E6RA 4FF5A 1AVAA 1E5JA 1OWQA 3SUTA 4AZ5A 4DWSC 1BGAA 1J11A 4AZCA 4GI8A 1TE1A 1VFOA 1DEDA 2GFTA 4PTWA 3D5HA 4CVUA 1MXGA 3N04A 3RJXA 2D20A 2WAGA 1JYXA 1SR0A 4ZE5A 1HJXA 1DHKA 1J0HA 5IFPA 1JXJA 5LA2A 1E1EA 1WZKA 2V38A 4BCEA 1F4AA 2W63A 5BWFA 4CD8A 3S2CA 4CCCA 2WLYA 4D6HA 4UZUA 3OB8A 3ZOAA 1J0ZA 3VDAA 1NOFA 2G3MA 3UEQA 3CUJA 1KGXA 3MU7A 4LX4A 4GO8A 1MWOA 2FDMA 1RP9A 3VNZA 3EDJA 2XYLA 4Z2LA 5JIPA 2VCCA 1F4HA 4BQ3A 4CCEA 5GNZA 1DWIM 4BQ4A 5BXPA 4EE9A 4HMDA 4Z2GA 3SEPA 1OGGA 4AIUA 2EJ1A 2J62A 1LLOA 1UR4A 4P7RA 3SCNA 3MANA 2CBIA 3WF0A 2YLAA 1OIFA 2WVVB 4V2XA 3UG4A 3CHDA 3UG3A 2WC7A 4M29A 4GIAA 3KL3A 3BAWA 1Z32X 1CGYA 2RGMA 3PZOA 1B0IA 2Z1SA 5HOSA 1QBBA 2GUYA 2CIPA 1CPUA 1OSEA 4FLSA 1GOMA 1VENA 1TZ7A 1UD6A 2GK1A 4PTXA 6CGTA 3W81A 5D9OA 3AHTA 1E5NA 1M03A 4TOQA 3VKKA 1UR2A 3DHPA 5I24A 4FK9A 1E6NA 1O7AA 1R7OA 3VIHA 1GCYA 1E3XA 2ZX7A 1HVQA 5I77A 3AYRA 2ZUSA 1V3LA 2VT0A 2WKLA 2FHFA 4Z2HA 4LYPA 2GDVA 1W9BM 1KXQA 1PPIA 3SUWA 4JCLA 4TUFA 4HOXA 2O9TA 2PWGA 5FL0A 2WM0A 2WANA 1JDDA 1E9LA 1WO2A 2FHCA 3TOPA 5BXRA 1RH9A 1QPKA 3GYCA 2CNCA 4PMOA 4AZHA 3KWXA 1VFUA 1UD4A 3CZ8A 1UD3A 1ODUA 3W4RA 2DT3A 3U7BA 1FP9A 1J0YA 4W88A 2X0HA 3GXFA 1C92A 3WSUA 4GZJA 4ZEPA 1BYCA 3CO4A 2EPKX 2TAAA 4N42A 3M7SA 2VRJA 1E56A 2G3NA 1JYNA 1XH1A 2WHMA 3K8LA 3GM8A 4D1IA 1C90A 3WN6A 1QI0A 1MQPA 1FH9A 3WKZA 5CPQA 1KWKA 1UR1A 4GQQA 4UOQA 1BTCA 1ZBWA 3S6TA 2QLYA 4CN6A 1I1XA 4PMVA 4MTVA 3WDHA 1XH0A 4P8UA 2WVUA 2ZWYA 4D6FA 5HPCA 4CD6A 1UH4A 4WK9A 1XSJA 5KZ6A 4EANA 1W3JA 3BH4A 1LG2A 3K4DA 5BRQA 2DGAA 3SCOA 1ZL1A 2VZTA 2ZUMA 4ACYA 3VIMA 4W7VA 3PZIA 4PN2A 5GNXA 4ZE4A 1XYFA 3PHAA 3F4VA 1JZ2A 5I5RA 2EPNA 1GW1A 3TTYA 3VOCA 4UZSA 2EBNA 2DDXA 4AD0A 1WDRA 4JFUA 1W9PA 1DWGM 1PZ2A 2W4XA 2BHZA 1TA3A 5C71A 3QHNA 2VURA 2XFYA 4GINA 3PTMA 1H5VA 2VQTA 1HP5A 1I75A 4AD2A 4H8UA 2Q8XA 5JBEA 1FA2A 1LQ0A 1UUQA 1PIFA 2XSAA 1C3FA 4P7OA 1LL6A 3CHFA 3WUFA 4AZCB 3ZQ9A 3ZJ8A 2XSBA 2FH8A 3IAQA 7A3HA 4HZ8A 3T0DA 5E6YA 2D3LA 2VC9A 3FHQA 3AIBA 1EDGA 2WWDA 3SUUA 5LA0A 1B3ZA 2ZXBA 4AD5A 3WUBA 4AEFA 2ZE0A 4PMYA 5BROA 1K9DA 3EMZA 1TMQA 2DSUA 4TVCA 2XGIA 3BSGA 3OLEA 2WB5A 1CNVA 1KCLA 1K9TA 1M01A 4ZXLA 4BQ2A 4KRUA 1QNPA 1G9HA 1OM0A 4JHOA 2HVMA 4FLQA 4LQ1A 1VFMA 4XZWA 1UKOA 3UCQA 2XWEA 4W89A 2WSKA 1EDQA 1GQJA 1J9YA 4PBGA 1A47A 2E40A 5EFFA 4WLCA 2E4TA 1XSIA 3W24A 1CECA 4D71A 1M7XA 2MANA 4TVDA 3WH8A 1CIUA 5D8WA 5D9NA 3II1A 1CZ1A 1B3YA 4OZOA 1CGUA 1ITCA 2F2HA 5A2CA 4W87A 1ODZA 4XZBA 2FGZA 3FNDA 1HL8A 2EPLX 3B9DA 1CXFA 1J18A 1UZ4A 2VMFA 5HNNA 5A6KA 2DSWA 2GK1B 4MNKA 3OGRA 1NH6A 2D22A 3NYDA 3WMBA 1VIWA 4UOJA 3W6LA 3W82A 2OWWA 4OKDA 2OSYA 5DT5A 1JFHA 5A6AA 3AIVA 4GZEA 1GJWA 3PZNA 3OGVA 5ECUA 5C8BB 2BFGA 4LPCA 3VIFA 4Y7EA 4H41A 5D4YA 1UQZA 1TVNA 3QGVA 2WW5A 1W3HA 1E0XA 2ZX6A 2WWCA 3ARPA 4PCTA 5M3WA 1JI2A 5LYRA 2BHUA 1V0KA 3POHA 1GQLA 3MMWA 1U2YA 3BCFA 2DQXA 1NOWA 2WMKA 3CZJA 1WPCA 1BAGA 2VR5A 4UQ9A 4HOWA 3WBEA 2BS9A 3QHMA 4PEEA 3VO0A 3SCWA 4UQCA 1B9ZA 4YHGA 1GZJA 1CGXA 3AYSA 4JKMA 5FCZA 2EEXA 3AMDA 2WYSA 1H2JA 4MAVA 3K8KA 1J10A 1Q6EA 3MMDA 2XPKA 3WEOA 2CKSA 2ZIDA 4PMZA 2PBGA 5F7UA 4IPNB 3TP4A 2YL6A 4DM1A 4DWSA 1H4PA 2PI6A 3WH6A 1GVIA 5D9MA 1CXKA 2GJXA 4YPJA 2V3EA 1SFSA 2JIWA 1WDSA 2YDRA 2J7BA 1V3HA 2XVNA 4M82A 3AFBA 3BC9A 2OSWA 1IV8A 3FN9A 4AISA 4M81A 3AIWA 2A3EA 3PZQA 3J7HA 1CXHA 3VD5A 2BHYA 3VDCA 5A6MA 1GPFA 2AAAA 3AS1A 1B31A 4RE2A 3RDKA 2G3IA 4QFUA 2XTKA 3PZTA 4MB1A 3EYPA 1UHVA 1V6XA 3L4TA 4PSRA 4CVWA 5DMYA 1WKYA 1V6VA 1YHTA 4Z2KA 4B3KA 1GNXA 1N82A 1J01A 1TA3B 2CKRA 1E70M 4AZ6A 7TAAA 3NSXA 3VDBA 1KBKA 1IT0A 2YDSA 3WMSA 3W38A 4CN1A 4HA1A 2PC8A 3UR8A 1NWUA 3ZMRA 1WNOA 3AXIA 1RP8A 4Q22A 1V3MA 3U7VA 3OA5A 2ZXDA 1W2VA 2OYMA 2PWDA 4JFVA 3VGFA 2CERA 2VZOA 3WF4A 1GQKA 5E0CA 1UR8A 2A3BA 1LL7A 1C8QA 2B31A 4ATWA 4B16A 1UWIA 3L4ZA 3AZRA 1EIBA 1JYWA 1BF2A 3AOFA 4P8VA 2WHJA 3PTKA 3W53A 1R87A 5DF0A 5FOOA 4PMUA 4BZYA 1JXKA 1Q6CA 1VEOA 2PWHA 3ARRA 4WF7A 4NRSA 2W91A 2WNWA 1G5AA 5GPRA 3VD4A 3EMCA 1BVZA 1NARA 3AXHA 3BAIA 3EDDA 3POCA 2X2YA 2WMGA 1JD7A 4W7WA 1NWTA 5DT7A 4U5KA 4ZENA 4UQDA 3VD9A 2E8YA 3CUHA 3GXDA 4P7LA 4MJ2A 2DPEA 1V3KA 1MFUA 2D3NA 3VU2A 3AISA 1KCKA 4A3HA 4ATLA 3CLWA 1JF5A 5E0FA 2ZX5A 4A3YA 4E2OA 5JBDA 2YA1A 5BRPA 2IXVA 2WZHA 4QAWA 5DEZA 1HP4A 3WL0A 1RD6A 2XVGA 1XGZA 3MUIA 3M6DA 4OOUA 3AHZA 2O9PA 1HXJA 1BPLB 1JNEA 5ABFA 2NT0A 4GXPA 1DTUA 3EDKA 3ZJ6A 3CTTA 1BYDA 4AD3A 4WJXA 1GUVA 5JIWA 3RM9A 2VVNA 1GORA 3NSNA 1QNRA 3WY1A 2CPUA 3AICA 3VGDA 1E55A 2GDUA 3AIUA 4M80A 2YJQA 5M03A 1MW2A 4AIEA 8A3HA 4D6DA 4W8AA 4MNLA 2OWCA 2Y8VA 4UFKA 3SCSA 5JUVA 1KR0A 1TG7A 4RE4A 4GI9A 3T2QA 4U31A 1TUXA 2O9OA 5E6ZA 1J0IA 1G0CA 1JZ4A 3CZEA 4HZ6A 4HPGA 4H2CA 1B3WA 1NM9A 1K9FA 1XD1A 3A6OA 1LWHA 3GBEA 3WL1A 1JGIA 1EOMA 2CBUA 3I3BA 1EGZA 1U30A 1VB9A 2UY4A 4K68A 1OCQA 3WDPP 4HA4A 5LA1A 4U33A 4AWEA 4W5UA 4MB3A 1OBAA 1E43A 4AC1X 4A4AA 2QMJA 2HISA 1XV8A 1W3KA 2PWEA 4HP5A 4OBSA 3TTOA 3CHCA 5CGTA 3PTQA 1KGUA 1Q6DA 3W26A 1B30A 1V0MA 4DWSB 1W1VA 4GPNA 1C93A 4FMVA 4OBRA 5I78A 2D23A 1OB0A 1QVBA 2GJXB 1R7AA 3LPFA 1PBGA 2VOTA 1X1NA 1OINA 1JG9A 1L8NA 3F5KA 4E8CA 1WE5A 5BXTA 4D6GA 5FKYA 1LWJA 2BY1A 1BG4A 4J3VA 3CUIA 3RPMA 4JL1A 2Y24A 3ZR6A 1J12A 1E4MM 1UD2A 1B3VA 1W1PA 4V27A 8CGTA 4P8WA 1KFWA 4AZGA 2DSZA 3ALGA 3KL5A 4B15A 3OBAA 3A4WA 4UFIA 5I6SA 2G4FA 5JBFA 1EQPA 3NDZA 1PJ9A 2YOCA 4QLKA 1EA9C 1NP2A 3SCQA 1JZ7A 4MPKA 4ACZA 4CUCA 5A8OA 4JIEA 2XM2A 2V5DA 1W9DM 2Y4SA 1EXPA 1HKJA 1V03A 3HJEA 2WMIA 2IUZA 5CQ1A 2VZVA 4J27A 3WD0A 2EQDA 1DWFM 1X6NA 5AC4A 2G41A 4HMCA 1QBAA 2WMJA 1NQ6A 1WP6A 1VEMA 1ISYA 2C8NA 1E4LA 2YBTA 4UQEA 4E8DA 3RO8A 1V02E 2GVYA 3VTRA 4GI6A 2JFEX 1CGVA 4XB3A 1W9UA 3QR3A 1GOKA 3MV11 2DSVA 1E71M 4PTMA 2UY5A 4MNMA 4NSBA 3AHVA 1ZJBA 4JFTA 3WQ6A 2J25A 3DYMA 1V3IA 4J3WA 1QHOA 3E1F1 3T09A 1E15A 3GNRA 5E9AA 2OSXA 2W66A 2YLLA 2WCSA 1GHSA 3MUY1 3WEZA 3EMQA 4W93A 3OLGA 2Z1KA 1I1WA 4WSJA 2JEQA 2VR4A 3APGA 3VMOA 3UG5A 1H0IA 4FLRA 4W5ZA 1VEPA 4U5IA 1BYAA 3L4VA 1ISZA 2J78A 1ESWA 5CLTA 1UA3A 5CGMA 1WDPA 2ZX9A 3GNOA 2DT0A 1UWSA 3UESA 1PZ3A 4AYSA 4UOZA 2VX6A 3WFZA 1J0JA 5D8ZA 1JZ5A 4AXNA 3G6LA 4J3XA 3WNKA 4BA0A 3M46A 4L4PA 4S3JA 5AY7A 1CXIA 1GOOA 1JYVA 1ZJAA 1XSKA 1UH3A 1BSIA 2DEPA 2YL5A 3O6AA 4AIOA 4UFHA 3UETA 1AMYA 4RL3A 2XJ7A 3WH5A 1JAKA 1KR1A 5ABFB 3GDBA 2BXYA 3PN8A 3HU7A 2BVDA 3OLIA 2V5CA 2EPMX 3BGAA 2IXUA 3K4AA 2WVTA 1VF8A 1D7FA 2J7EA 3BLPX 3CMJA 4TTUA 4TTGA 4EKJA 1ZBVA 4UCFA 3T08A 3ZM8A 3ARTA 3WNPA 2OYLA 4EAMA 1V6UA 2XFRA 3TA9A 4W8LA 1UKPA 2F8QA 1KXVA 2QMKA 1KBBA 3ZSSA 5DO8A 3SUSA 3PZ9A 1WCGA 3BCDA 2XM1A 4J28A 3W37A 2X8RA 4BS0A 1PAMA 5HDRA 1D3CA 2ZXQA 7CGTA 3MSDA 4IUGA 1E40A 3WNLA 3ZT6A 1NOUA 3WBAA 4M1RA 1M53A 6TAAA 5BCAA 1V6YA 3N1AA 4PMNA 4F66A 2BNJA 5M5DA 4FLOA 5A6JA 1GJUA 2VNCA 1PX4A 3ZT5A 4AZIA 2FGLA 2WLZA 4PYSA 4XUYA 4URIA 1R8LA 5GQBA 1JF6A 3F5JA 2A3CA 3WD4A 2OLHA 3IJ9A 4N0RA 3VIPA 1H0GA 4QP0A 2NT1A 3LPOA 2VX7A 2BV9A 4B3LA 2G8ZA 3VVGA 1WZAA 3MKKA 4F9DA 3NDYA 5A1AA 4OIFA 3A4AA 2DH2A 1MQQA 2D0HA 1BQCA 4J3TA 2DT1A 1O6IA 2EXOA 4CD4A 3W25A 1KXTA 1E6SM 1XCWA 1ZU8A 3QOKA 3MSGA 3WIJA 3I3EA 4J3UA 5I0DA 4W86A 3SCTA 5CG0A 2UY2A 1OD0A 2FH6A 2AMGA 1E4IA 2JEPA 3A47A 1E4NA 5A95A 4B9ZA 4M24A 2J47A 4WKAA 3NSMA 1IZKA 4GQRA 3WD3A 5HBFA 4ACZB 2ZUUA 1MW1A 3TONA 1TR1A 1JI1A 3WUGA 4X0VA 1CDGA 1HNYA 2WMIB 2PBOA 5A6BD 3AJ7A 4HZ7A 5I3DA 1B90A 3MO4A 3L4YA 3WENA 1QI5A 4QDMA 2E9BA 2Y8KA 1EDTA 1FHLA 4AMCA 4ML4A 4W8BA 2J4GA 5HXMA 3WDQA 1ZBKA 3WH7A 2VJXA 3ZIZA 2NSXA 2QHAA 2J8GA 1E0VA 4MDPA 4Z2JA 1WB0A 3OG2A 1B3XA 1HVXA 3IJ8A 2D1ZA 1FH8A 4PTVA 4WKHA 4AY1A 1ISWA 1XRVA 3WDRA 4PUDA 1XC6A 1JFXA 4MNJA 4F8XA 4UTFA 1VRXA 5HPOA 2W5FA 3ZO9A 3QHOA 1H1NA 2BY3A 4QCFA 3WDJA 4D6IA 5FL1A 2CHOA 1DWAM 4XX6A 4JFSA 3U5YA 3EBVA 1W9XA 4CD5A 3LPGA 3VUPA 4P7NA 1E3ZA 1PEZA 1ZB5A 3VDHA 1QOXA 2VI0A 2D2OA 2JE8A 3LMYA 4H7VA 3NIYA 1JD9A 2VQUA 2YL9A 1E73M 1NWSA 3DYOA 2VVSA 1UWTA 2ZUNA 5M17A 1FP8A 4W84A 2DH3A 3K8MA 5IXEA 3MUZ1 4YHEA 3RMEA 4CU8A 4PMXA 3DYPA 3VM5A 1KGWA 1JDCA 3CZKA 1HJQA 3AQUA 4H8VA 2XUCA 1CWYA 2JF7A 4WKFA 1UOKA 4UFMA 4S3KA 2X09A 1PX3A 4D6EA 3LPPA 2JALA 2VO5A 2NW0A 3WQ8A 2XWDA 2VCAA 5A69A 4XV0A 4LGXA 2QPSA 3NUKA 5IHRA 1AQMA 4UFLA 3IJ7A 3O9NA 3L2LA 4UFJA 2C0HA 4LYQA 4R5EA 3N9KA 3FAXA 1HN1A 4KWUA 1G1YA 3PBGA 5ABEA 1CBGA 1EO5A 2FHBA 2J75A 4HA3A 3SCVA 1MYRA 4NZCA 1VAHA 2EO7A 5A8MA 2E9LA 2DIJA 2BY0A 2E3ZA 3GNPA 4X9YA 2A3AA 1HJUA 3JUGA 1HX0A 3N12A 3CMGA 4ZXOA 1H3GA 4OOZA 3W0KA 2WZEA 1W32A 1JZ6A 5DFAA 1M04A 1C7TA 3O2LA 2WK2A 2WBGA 3WF3A 2AOSA 4U2ZA 2V3DA 1DWJM 5AYBA 4D6JA 3BXWA 5I2UA 1RPKA 3PZVA 5IDIA 5A2AA 1Y7VA 4D72A 1MQRA 5EMYA 1HJSA 2X0YA 2DIEA 3GXMA 1XH2A 1BLIA 1J0KA 5E70A 2CXGA 5AYIA 1QNQA 3KZSA 2CBVA 1R86A 3U57A 2GJPA 3MMUA 3GBDA 4CD7A 3WNNA 4GO9A 3N11A 3ZJ7A 3OGSA 2ZICA 1QW8A 3PZUA 3BAKA 4KRTA 3SCRA 4UQBA 9CGTA 1HF6A 3IAPA 1UKSA 4W85A 1B2YA 2J7FA 3T0AA 2XFFA 3WQVA 2YIHA 2DT2A 3AIRA 1KQZA 3SURA 3WEMA 3VMNA 4CKQA 1HKKA 3WNOA 2WCAA 2ZWZA 3AZSA 2CCRA 1UKTA 1Q6FA 2YBUA 4GKLA 3BSHA 1E1FA 1HJWA 1LJYA 4CU6A 2WHLA 3IK2A 1E6QM 3WQWA 1GONA 3BMVA 4H04A 2PWFA 2ZXAA 3MV01 3FXYA 4PRWA 2WZIA 4J3SA 2GSJA 3CUGA 3FW6A 2WSPA 3CUFA 5CPTA 3MS8A 3VNYA 3VD3A 2CBJA 1A3HA 4U2YA 1MW0A 3CZGA 2J79A 3B9AA 3ARXA 1UKQA 1QHPA 1L0PA 5AC5A 3AS3A 1JDAA 1QNSA 1W1TA 2E8ZA 2WC4A 3AIEA 4JL2A 3D3AA 4UR9A 3WFLA 3WMCA 1GOIA 4JAWA 4EK7A 3ALFA 2BVYA 4WSKA 1KXHA 1W1YA 5A6LA 3G6MA 3AHXA 1SMDA 3ARYA 1V08A 2XHYA 2C7FA 3CH9A 2QV4A 2UY3A 1HKMA 2G3JA 3AMKA 2EPOA 4ATDA 1H09A 1CLVA 1OIMA 4D1JA 4C7FA 5A8NA 4F79A 1TVPA 1HIZA 1ISVA 3ARUA 1EO7A 4DUXA 1TFVA 1VJZA 4D6CA 3VMPA 3FAWA 2CEQA 3ARSA 1QI3A 1KB3A 4M56A 3ZJKA 5A94A 4PCSA 1QI4A 2OWXA 4MADA 3VPLA 2X05A 1V3JA 1XYZA 5E09A 1S46A 4TX8A 2BXZA 3WD1A 3VIJA 4P8XA 1JNDA 3VIGA 4WIWA 5CSYA 3M07A 1UWRA 2J77A 1JZ3A 1SYTA 3CZLA 1AQHA 4MJ4A 2YKKA 3SCPA 1C91A 2WHKA 4KGJA 3AZTA 3L4XA 2WBKA 3BAYA 3W29A 1CGTA 1CEOA 4F9JA 2J7GA 4C7DA 4H8HA 4DUVA 1JZ8A 4BQ5A 3VX1A 4E4PA 2D24A 1UZ1A 3VIIA 4Z2IA 1CXEA 3ECQA 2VRQA 3ZR5A 3VIKA 2WCGA 1JIBA 3IANA 1BYBA 4NRRA 2CYGA 1E6PA 3L4WA 4CGTA 1CYGA 4HMEA 4RE3A 2ZX8A 2XIIA 5EB8A 3RM8A 1XD0A 4KGLA 4AD4A 3NJ3A 2ESCA 2WMHA 2WKGA 3WD2A 1OGSA 4TX6A 3BAJA 1BG9A 1P6WA 4AD1A 2Y2WA 3PZMA 5I23A 1ZS2A 2BVTA 3ZSTA 4QLLA 4B9YA 3RCNA 5FD0A 2J7DA 5I79A 3A4XA 2W62A 1V6WA 2PB1A 4ZFMA 1GOWA 2JF6A 1MXDA 1DP0A 4BF7A 1Q6GA 4JHZA 4V28A 4MB5A 1CGWA 2ZOXA 2V3GA 1OT2A 4TXEA 5CZKA 2J74A 2W67A 2E9MA 4AW7A 2XVPA 3N18A 1FHDA
chains in the Genus database with same CATH superfamily
2J6VA 3FHAA 1B54A 5A8QA 4HYWA 1EB3A 1FFQA 2P3ZA 4P7QA 2AGKA 3AAMA 1XLHA 5BOFA 1R46A 3G0SA 3RU8X 3L2MA 3WBWA 3VINA 3TWBA 3I3DA 1XCXA 1CENA 2POZA 4W7UA 1X6LA 2WPBA 1CTNA 2I16A 3VFLA 4AZ7A 2JKEA 4WY0B 5FF3A 1AW5A 4IUOA 2VDGA 5C55A 3FJ6A 3GG8A 3WLMA 1AD4A 2PLCA 3VD7A 4MWAA 5D04C 4Z42C 3H4GA 4AWSA 3FKRA 3TH6A 1C7SA 4HOZA 3TYCA 3WLQA 3W6YA 3REQB 3MA8A 1MVYA 3DECA 4EXAA 2WMFA 4UMBA 4QLJA 2PU0A 2YW4A 1V77A 4H9UA 2AL2B 4CNUA 1R38A 3ZT7A 4XKMA 4TMCA 1EPVA 4RZBA 1AQ0A 2PP3A 1VFFA 4JQ4A 4HPHA 3G8EA 4GYJA 3GW3A 1QDSA 3QGAC 5LNWA 3P8JA 2PWVA 2D73A 2Y0FA 1EHNA 1E6XM 2V8ZA 1MO0A 1X6UA 3HB9A 2ZFAA 4MKNA 3NQCA 3MKCA 3A23A 2BX7A 2CHNA 3ERPA 1UJPA 3ZLFA 1EOKA 4UTUA 5A6BA 1D7KA 2QYGA 1PB0A 1CXLA 3RM4A 1NWRA 1WZMA 5CXPA 2BWGA 4DM2A 2PFHA 3G5EA 1YQ2A 2QCFA 5CG7A 1GZ1A 1VR6A 5CPLA 3BAXA 4KFPA 2VEIA 4NAFA 4AZBA 3AMLA 1TTQA 1H7WA 1MW3A 4XUGA 3HGOA 1YEYA 4H6EA 3S2MA 2BLEA 4O4WA 3VGGA 5K4XA 3AALA 2WVVA 3SR7A 4Q6JA 3AIQA 1N7KA 3NQFA 1PV8A 3EB4A 4I5RA 3HN3A 3EXRA 4N9BA 4CCZA 3PJXA 1PVNA 4QS6A 4YVVA 4MLRA 2V5LA 1ECEA 4L9XA 1W2PA 3VIOA 2RH9A 1LQAA 1U1HA 3WQPA 3E2SA 5HQEA 3I6RA 2PZ0A 1OD8A 4MKVA 3B0YA 3VM7A 2A3HA 1VCFA 3O06A 1OGBA 1I2RA 2OCZA 3S3GA 4JKLA 1LG1A 3RJYA 3U4FA 3LCWA 2V3FA 1C8YA 1TCMA 1U33A 4H9ZA 4XD5A 3OZOA 1GHRA 3AMGA 4JQ1A 2HDJA 2QKFA 4DWSD 3NCOA 3E3HA 4HB7A 4GZIA 3AWOA 4FR6A 5EFDA 2PRMA 1EF3A 1WX0A 2CETA 3HMCA 2XGZA 2REQA 3LNMA 2VL4A 1EX1A 5BYWA 4IH3A 2YCKX 1UH2A 4LUTB 1VBGA 2NQ5A 1ITXA 2YDQA 1MXSA 4LBSA 2VGFA 3OQEA 4XZLX 1MZRA 4S3CA 4H9TA 4J2PA 1QNVA 1RBOB 4ADTA 1RJQA 5DCEA 4AFYA 2WVSA 2ZUWA 4RKAA 2ZUTA 3UR7A 3MSRA 3NQBA 1OCBA 3OIHA 3V3WA 4DNHA 3PJUA 3GNDA 1K7XA 5CCZA 2VEMA 1G94A 5HNTA 1HW6A 2XVLA 3EB3A 1SPQA 1SZFA 5C2XA 3C56A 3WF1A 4DF1A 3LENA 2YYUA 3B9NA 3ITTA 1H41A 3N4EA 2D2JA 7REQB 4M8UA 3TYZA 4G1KA 2O56A 3VGEA 1S1RA 4HQVA 1GGOA 2ZTKA 3FY1A 4KKXA 4DJFA 3GZAA 2A6LA 3UVAA 4CNPA 2OELA 3M16A 3W71A 2OYKA 3T2OA 4NYUA 3CU2A 4X0NA 3N17A 3U3HA 3V18A 4QCEA 1SJAA 1H1ZA 4US6A 5CPSA 1XIDA 1EJRC 1QHZA 1E6RA 1K4HA 4FF5A 4C1NA 1E5JA 3GG7A 3NQDA 4NX5A 3KFTA 4AZ5A 4DWSC 5LIYX 4AZCA 5LXXA 1FWFC 1YYAA 3N04A 5F1UA 3LGGA 1F9CA 4HMNA 2WAGA 3N29A 1SR0A 4ZE5A 1VCGA 4EXQA 5IFPA 1EYWA 1JXJA 5IOBA 3PP7A 4RLIA 1WZKA 4JS3A 4QG9A 4GYPA 4EPBC 3FSUA 1F4AA 5BWFA 1DJIA 3OZYA 4UZUA 3OB8A 5I3IA 5DXYA 1GKPA 1VKFA 3INPA 3VDAA 3B05A 1MZHA 2G3MA 3BGJA 1KGXA 3FX4A 3MU7A 2FDMA 2ZZ6A 1F76A 4XK2A 3VNZA 2NZLA 4JEJA 3WK2A 3NG3A 4JGDA 2ZA3A 5BXPA 4HMDA 3BW4A 1ME8A 3SCNA 1AUSL 5D33A 4EACA 2YLAA 1OIFA 2AQOA 3CHDA 3UG3A 1K8XA 3S42A 3HFTA 4DO4A 5K9CA 5HNUA 1AA1B 3BAWA 4LAOA 4QJ5B 1Z32X 1AH3A 1CGYA 5HOSA 1QBBA 2GUYA 2CIPA 4G7FA 1CPUA 1OSEA 4FLSA 3PG8A 2NV1A 1UD6A 4PTXA 3W81A 4S3DA 1M03A 1U5JA 3RLUA 3LD5A 3A21A 2ON3A 3KCOA 4ERIA 1YX1A 3CNYA 4JX6A 3EX3A 3VIHA 2AKMA 1GCYA 3GRIA 3UFYA 3LXBA 1L6SA 5CSRA 2VT0A 3KBWA 2WKLA 1Q5MA 4Z2HA 4LYPA 4BEQA 3LGEA 4RCXA 4QXIA 6ALDA 5FL0A 1K6WA 2WANA 4AHPA 1P48A 2QCNA 3TOPA 4IFOA 2PAJA 4PMOA 3LI0A 3KWXA 4AZHA 4WY0F 1UD4A 3R11A 1LRTA 4HHMA 3EPMA 1UD3A 2C13A 5F2MA 4AHOA 2DT3A 2OT0A 5JQ9A 3O0KA 3U7BA 2PDQA 3K13A 3W1NA 3VOHA 4XBKA 3FEMA 1BYCA 1TO3A 5DELA 1N8WA 1Z42A 3M7SA 3H2NA 1FQ0A 2HRWA 1WBHA 1JYNA 2WHMA 4D1IA 5J8LA 3WN6A 3PPCA 3C2RA 3H2AA 1MQPA 2ABBA 3WKZA 5CSSA 1NJJA 3W02A 4GQQA 4UOQA 3W83A 3U2ZA 3S6TA 4CN6A 4MTVA 1YXCA 3WDHA 5HPCA 3C4UA 4EANA 1YMYA 3FFSA 3MYPA 4OHQA 1WBJA 3BJSA 2OEMA 3I6TA 3ORWA 3KBSA 2LLEA 3PZIA 4PN2A 3L7RA 3UD6A 2EPNA 4IFRA 1FWCC 1GW1A 3VOCA 1AL8A 4AD0A 4JFUA 3ZFHA 4ZA0A 1W9PA 4NJGA 2R1MA 2BHZA 1TA3A 3EEZA 2OG9A 2HQAA 3E2VA 5LIKX 4LAMA 5G4EA 2XFYA 2BXVA 4GINA 3PTMA 4JBRA 4X2PA 1I75A 4YYCA 3ITLA 1OZMA 4PR4A 1LQ0A 2ZRZA 4NZ5A 2XSAA 2QUUA 1UP3A 1TIWA 3CHFA 1W5NA 3W7KA 3ZJ8A 4O0KA 3T0DA 3FHQA 1VPXA 2QGYA 5FI8A 5BROA 3BLIA 1TMQA 3BSGA 1LUCA 3OLEA 3QPYA 2PPGA 3M44A 1L8PA 1CNVA 3V0UA 1KCLA 1V7AA 8XIAA 4PB5A 4ZXLA 1QNPA 1R3QA 3T9PA 4OBTA 2HVMA 4WUIA 4FLQA 4GIYA 4LQ1A 1VFMA 1UKOA 4WHBA 3FYOA 1EDQA 4NU7A 1GQJA 1J9YA 5LZLA 4EIVA 3W24A 1CECA 1OY0A 4GIEA 1LRQA 3IV8A 1NFBA 4V1YA 1Q7QA 1IIHA 1VPQA 2QNEA 4HSOA 3ATYA 3O3RA 2RJGA 3PUGA 4QIUA 1TVLA 1IEXA 2F2HA 4W87A 2VWSA 1GOXA 1RSCA 4MZ8A 1LT7A 3SBFA 2QIIA 1SU5A 1UZ4A 1R2TA 4GVIA 3FSTA 1UBSA 4CNNA 3NXFA 3UXLA 2Y5SA 3ANVA 1TV2A 4MNKA 5ENLA 2H90A 1NH6A 2D22A 4UOJA 1G4SA 1W1IE 2OSYA 4GHRA 1JFHA 4FXSA 2XIOA 3TZFA 3W70A 5C8BB 5ECUA 4IXHA 2HNEA 3FKKA 4Y7EA 3GU9A 4H41A 1UQZA 1V4YA 2G3FA 3ARPA 4PCTA 1JI2A 2Y7DA 1V0KA 3POHA 2OKTA 3W3OA 5HANA 1S2TA 1U2YA 3BCFA 1NOWA 1GW9A 3MB9A 1W0MA 3WBEA 3TVAA 3CIWA 3SCWA 4UQCA 4YHGA 5L6UA 5FCZA 2EEXA 3AMDA 3VDGA 1H2JA 1VYSX 3O07A 1Q6EA 3WLSA 1N2VA 3KBVA 4E6MA 2XPKA 4OUIA 2PBGA 5F7UA 3UWYA 4O14A 3TP4A 1BWLA 4DM1A 1W1A1 2PI6A 3N4FA 3W86A 5LIXX 4MYXA 4ZCWA 3QR1A 1EP3A 4GZ7A 4M82A 2XVNA 4M7TA 3BC9A 1P4CA 1VBJA 4JIQA 5FAGA 1Z89A 2DUAA 4NI8A 3NQ6A 1CXHA 2BHYA 4MYAA 1HGWA 3IPWA 1P0EA 3AS1A 1TCDA 3AO0A 3PZTA 3EYPA 1UHVA 1V6XA 2XFWA 3FA4A 1V6VA 4PUJA 4LEQA 1JGMA 4B3KA 2A85A 1J01A 4A2RA 3QC0A 1KBKA 1HZYA 2YDSA 3WMSA 5HATA 3W38A 4I3GA 4R85A 4HA1A 4Z1YA 3GSMA 3C5QA 1WNOA 1EP2A 2BASA 3OA5A 4B92A 3WF4A 3GG1A 4HN8A 3NPVA 3PS7A 2A3BA 4YNGA 3VK5A 4G6CA 1LL7A 4E8GA 1C8QA 1KNWA 5FEZA 1Y5VA 3AOFA 1J5TA 5HUPA 1K70A 2HK0A 1FWBC 3W7GA 1ITQA 1R87A 4UB9A 2QCMA 1VQTA 1VEOA 4BKNA 1Z41A 2PWHA 3ATZA 4NRSA 4QITA 1ICPA 2W91A 4FXFA 4YIWA 5A6TC 4O8RA 2CLEA 4GABA 4L7ZA 3VD4A 4LF1A 1OEPA 2JGYA 3RX3A 3GTHA 4K8EA 2WMGA 2CLMA 1NWTA 3C0QA 4U5KA 5JH2A 4KT2A 2ZTJA 3VD9A 2AQVA 2E8YA 3TU9A 2Q71A 4P7LA 5HR6A 2DZTA 3WCZA 3QW3A 3T55A 1KLYA 1WOAA 3EX2A 5AECA 2JKAA 1ZSXA 4XVEA 2Y62A 3VU2A 4QROA 4A3HA 3UXDA 4ATLA 5BW6A 5E0FA 2ZX5A 5JBDA 1J6PA 3R4IA 2GL5A 5BRPA 3VZYA 4ML9A 3FXGA 3L0KA 3E9AA 3URAA 1D3GA 3P82A 2R94A 3AHZA 3ZS4A 5E9XA 1HXJA 1P0BA 2NT0A 3OZMA 1AH0A 3IJIA 3CTTA 2Q01A 4DI9A 2V67A 4H9VA 5JIWA 1K8YA 3JU2A 3AICA 3IVTA 4GNKB 2GSHA 1EJTC 1PDZA 2YJQA 1QCWA 2HS6A 1MW2A 3S1GA 8A3HA 1U5HA 4UFKA 4UTHA 1KR0A 4RE4A 4QSFA 5E1QA 4A8IA 2DZUA 5E6ZA 3TMQA 1XKJA 5LGXA 1J0IA 1G0CA 1JZ4A 4HPGA 1B3WA 4IXXA 1LWHA 3GBEA 1EOMA 2CBUA 1U30A 2KX9A 3TJXA 2AMXA 4WQ6A 3KP0A 2QMJA 1XV8A 2XIJA 1KM3A 1S1PA 3CHCA 1PWLA 3NO3A 1Q6DA 3LQGA 2E5BA 3W26A 4DWSB 2ISFA 5CPMA 1C8VA 5I78A 1DPMA 2D23A 3P93A 3VZXA 1U1UA 1TV8A 1PBGA 4PUMA 2VOTA 1JG9A 2XN2A 4E8CA 1C9WA 5BXTA 1FKXA 1DIDA 1O5QA 3TQ0A 3KVJA 3K4WA 2HTMA 3ZR6A 1FHUA 1ZAIA 5LHFA 1V8EA 1TMHA 1W1PA 3RCYA 1NY1A 1DOSA 3IVUA 1WUEA 4AWTA 4XAFA 3VFCA 5I6SA 2G4FA 1EQPA 3NDZA 3NM1A 4QLKA 1JDFA 1KO0A 2A7PA 4UCGA 3SCQA 3CHVA 4MPKA 3GZ3A 5A8OA 4JIEA 3W1LA 4UIOA 2VFEA 2V5DA 1P6CA 1W9DM 1DJHA 2IUZA 1SO3A 3LHWA 2E1WA 4JD4A 5REQA 5AC4A 3L5LA 1U83A 3C3UA 3E49A 1WP6A 5U4NA 1E4LA 3RO8A 3L23A 1R3YA 2Y8UA 3VTRA 2P10A 4XISA 2JK2A 5H1WA 1A0DA 4B5WA 1CGVA 1P7TA 1W9UA 3GAKA 3QY6A 3MV11 1LT8A 2DSVA 1E71M 4PTMA 4JTEA 4MNMA 3WQCA 3E38A 2J25A 4HJWA 3CWOX 1BTMA 1TV3A 3QVQA 4RZ6A 1F07A 2YLLA 3U8GA 1TJ2A 3GXTA 4H7ZA 2FPTA 2NSOA 2A7RA 2VR4A 1JJKA 4GQ0A 4M7SA 1VEPA 4U5IA 4IIEA 1KW1A 2QCEA 7PTDA 3WJZA 2J78A 3H4XA 1PKLA 1RQBA 3L0GA 3CQHA 3NYZA 4M6UA 2BGNE 5XIMA 3OO2A 2PGFA 3W88A 3WFZA 3P7YA 3W1QA 3XISA 2VC6A 4R7OA 3E5BA 2CC0A 4E4UA 4DX3A 3HGRA 3BICA 5AY7A 1GOOA 5MF5A 1UUOA 3TFCA 2YL5A 4HCLA 1OABA 3UETA 1AMYA 3WH5A 4KCWA 1KR1A 1ALDA 1L9WA 3BGGA 3PN8A 3M41A 4JICA 4AB4A 3OLIA 3BGAA 2EPMX 3GFXA 2IXUA 2WVTA 4XKYA 1VF8A 1J2BA 3BLPX 4EPDC 4TTGA 1ZBVA 3ZR4A 1THFD 3WNPA 2X7WA 2XFRA 2CZDA 3PPGA 2QMKA 5DO8A 4O57A 4ROPA 3M5VA 5DLCA 5EMLA 4DJED 4B4FA 1PAMA 2ZXQA 1ZNNA 3V1HA 3MSDA 4PC8A 3MQTA 3GUWA 3WNLA 3W2MA 4GFIA 3KAOA 5CZSA 1B9BA 1NOUA 3SSZA 3WBAA 3A3WA 1GVSA 2QXWA 4C6MA 5BCAA 1V6YA 1EJWC 2HZGA 1GJUA 4QAIA 3NPUA 5TQLA 2QCCA 3QTPA 1OCJA 3B03A 2ZRXA 4PYSA 1JF6A 3F5JA 4F0SA 3CWNA 4JYFA 4KEZA 4N0RA 1FXQA 4JNZA 4ROQA 3UR5A 3W1PA 2QJMA 3CT2A 1POJA 2VX7A 1UROA 3NM3A 3LRLA 3VVGA 2GWNA 1IEIA 5LHEA 2XIQA 2OMAA 3A4AA 2D0HA 1MEWA 1BQCA 2P1FA 1WDWA 4N9CA 3W25A 1XCWA 2I9EA 2GZXA 4B2DA 3H8AA 1TPH1 1UOZA 1AW2A 5KETA 4WDXA 4DIAA 1YE6A 3L2IA 1ZALA 2JEPA 2Z1BA 1VYRA 1S3HA 1V79A 1XBYA 2J47A 5DRIA 4MOZA 1B3OA 4WKAA 4X22A 2TYSA 4X61A 3T7VA 1GG0A 3TN3A 4DBUA 4K8GA 2ZUUA 1SO5A 4GY7A 4DJEC 1SGJA 1H7PA 1CDGA 2PBOA 4EF9A 2PDJA 5RUBA 4HZ7A 4ZBCA 5I3DA 2A7NA 3G1SA 4Y9MA 3S2LA 3BL3A 3WENA 1QI5A 5CGQA 2GYIA 2Y8KA 1FHLA 4AH7A 4W9TA 3SJ3A 3W07A 1ZENA 3ZIZA 4IQLA 2J8GA 3UG8A 4MDPA 4Z2JA 3TEVA 3R0KA 2D1ZA 4AY1A 1XRVA 2DZSA 2YB1A 1CB7B 3O8AA 4PUDA 5I00A 1JFXA 5D32A 4DEFA 1VRXA 4U28A 1PCWA 3ZO9A 3BG5A 4D6IA 5FL1A 2GGJA 4XAPA 3SN1A 4XX6A 4JFSA 3U5YA 4NJHA 1W9XA 4CD5A 1RBAA 3ZXWA 1WA3A 4HN4A 1V6TA 4AUBA 2VEPA 1JCYA 4F0RA 2X40A 4DZIA 4GVHA 3N6HA 2VI0A 4H01A 5G2HA 4H7VA 2YL9A 4RZ4A 2G4JA 2VVSA 4KIEA 2BSLA 1ZZMA 1KD0A 1ME7A 2OX4A 4PMXA 2OO0A 3GTFA 3P84A 1JRBA 1JDCA 2HSAA 4FX8A 4DNMA 2XUCA 3F2BA 4WKFA 1UOKA 3ZYZA 4UFMA 3DUGA 4S3KA 5F4WA 1LWIA 1A3WA 4D6EA 3I6EA 2I56A 3F4DA 4HK6A 3N2TA 3BO9A 1X8FA 3KS5A 5IHRA 1JUEA 3RLHA 1E9ZB 4LYQA 2OB3A 1HN1A 3PVFA 4KWUA 3PBGA 4A22A 1EO5A 4HA3A 2F7FA 3L68A 4HT3A 1XRFA 3USZA 5A8MA 3BJTA 4US5D 4N9DA 2J88A 3L66A 4X9YA 5CBIA 1HJUA 1TE6A 3GDRA 4BF9A 2KZHA 1H3GA 4JTGA 2YR1A 1SO4A 2GVGA 3DIPA 3W7CA 4UTIA 1XIHA 5DFAA 1D9EA 1M04A 3BZJA 3WF3A 5C54A 2V3DA 2H3BA 1DWJM 1RPKA 1RVGA 3GB6A 3BOLA 5EA9A 1YDNA 2X0YA 5CJMA 3STPA 1BLIA 3IVSA 1YTKA 5G5IA 5AYIA 1OFDA 3KZSA 2AGTA 3W7HA 1CB2A 1R86A 4NZJA 2GJPA 3GBDA 3GC4A 3N11A 2GVLA 1O68A 1K7EA 4DAFA 5HMFA 3GG0A 3BAKA 4RNIA 1EZWA 4JN6A 3M7WA 1XJBA 3H2MA 2J7FA 3FJ4A 3T0AA 2F38A 1VS1A 2XFFA 3HZ3A 3G1VA 3WEMA 4CKQA 3SURA 4WY0A 3UWVA 3WNOA 1J93A 1DHPA 3FJNA 2WCAA 2ZWZA 3TW6A 3UZJA 4C1KA 2YBUA 3BZGA 3RXZA 2NX3A 4CU6A 5C6MA 7XIMA 3REQA 3G1FA 2QUMA 1YBQB 4S3GA 4LVAA 3UPBA 4LY8A 1KBLA 4J4KA 3LNPA 2WZIA 4JNYA 2GSJA 2I17A 2EGZA 3MS8A 3VNYA 2AL2A 2CBJA 3RN6A 1XIFA 5HNRA 2J79A 3HQ1A 1OK4A 3H12A 1VRDA 1XLIA 1L0PA 3PWIA 5AC5A 3AS3A 4ZO8A 1XW8A 2X2GA 1W1TA 4IF2A 2C3ZA 3AIEA 3D3AA 4JAWA 1RA0A 3GX9A 3TIMA 1EPXA 1JPIA 3UGVA 1KXHA 1W1YA 5A6LA 3COTA 3LHVA 1ZAHA 1QK0A 4AVNA 1RALA 3ARYA 1V08A 2FJUB 2XHYA 1T41A 1H7XA 1LCOA 5LSMA 2EPOA 4ATDA 1H09A 1CLVA 1OIMA 3FEQA 1IZCA 4E2VA 3LRMA 1TVPA 1ISVA 1EO7A 2NUXA 1TFVA 3C8NA 3O1NA 1KB3A 5CAKA 3CASA 4M56A 1PWMA 4MADA 1WXJA 4F4RA 3KW3A 2X05A 5I09A 1JR1A 1XYZA 1BXNA 5CKSA 3PWGA 2FYMA 3T81A 3LGDA 4P8XA 1JNDA 3VIGA 4QR6A 1I2NA 1UWRA 2BOGX 3LLXA 2QEZA 1WKDA 4MF4A 3SCPA 3AZTA 3W29A 3FVMA 4YCOA 1CGTA 2QS8A 1TZZA 4WXZA 4AVFA 4IQDA 1FX6A 2E77A 3U6WA 3OVQA 1FWDC 2DVUA 1S39A 3ABXA 3ECQA 3ICJA 2VRQA 3UPWA 3ZR5A 3PF3A 3BW3A 1OG6A 2PSNA 2QAFA 3IANA 4IG2B 4NRRA 3LZ3A 3CV2A 4RE3A 2V6AA 1DKWA 2ZDSA 3TYUA 4Q4QA 2PA6A 5EB8A 2FVLA 2NQHA 2GQ8A 3ITCA 2WKGA 5C9UA 3CQ0A 1XCFA 1XINA 5I23A 4MSSA 2BVTA 4QLLA 3BG3A 2JKPA 1Q2SA 4C6DA 1V6WA 4LUTA 4ZFMA 3G1YA 3N2MA 3EWZA 4BF7A 1Q6GA 1OX6A 3F2DA 4MJMA 4OWGA 4MB5A 4KW2A 2ZOXA 2O4MA 4O16A 1DORA 2J74A 1EZ2A 2W67A 3F7JA 1DYSA 5FEPA 2G0WA 1FHDA 1IGSA 3THDA 5DX7A 3RNDA 1F6PA 1GKRA 4QISA 1W6TA 2XIMA 3T0BA 5CAHA 4JCMA 3ARZA 1GQIA 3KE0A 4DHGA 1K9EA 5LIUX 4ZODA 4S38A 2ZBTA 5BXSA 4U3CA 1HT6A 5MKGA 1NQKA 1XBXA 1KA9F 1H49A 1WXZA 3CEUA 4LUJA 1LP6A 1K6AA 1WAWA 4GMEA 4L61A 3EWUA 2VRKA 2IKHA 3UWZA 2HNHA 2E0PA 3SAZA 3LHTA 5EMMA 5IFTA 2D0GA 1S2CA 1A4LA 2PS2A 1G01A 1FCVA 1IT7A 4ORIA 4O4VA 1J6OA 2A6NA 1AZ2A 1QW9A 2PP0A 1ME9A 1UWUA 2DP3A 4LS1A 2J7HA 1UASA 5KMYA 1V02A 1QW7A 1TR9A 4OGZA 3VC5A 3AROA 1KQYA 3TTQA 3VNJA 1LF1A 2W61A 3WDIA 1KV8A 3MW7A 1W5MA 2G5WA 2HMCA 3B8TA 6ENLA 3U2CA 3V1PA 1SMAA 4MB4A 3KRSA 3UERA 6XIAA 1IIGA 2PF0A 3QV8A 5FJIA 1OFEA 4REQB 1SW7A 2YBVA 2QGHA 5I03A 3GXNA 1IWAA 2C14A 3HO8A 2J8FA 2YFOA 1FH7A 1K03A 3RILA 4I7WA 4KMQA 4QQUA 1DTNA 3GXIA 3ARWA 2Y7EA 1JL8A 2VTFA 3GQYA 5J04A 3WQ5A 2AAMA 2VCBA 5C70A 3B9OA 4ZTYA 4A29A 3D6NA 3HA1A 1P0KA 4LYRA 4PUEA 2F6UA 2PTDA 3ES8A 2NUWA 4K6AA 5HA7A 5AFDA 5H2ZA 3LM7A 5A3HA 5M2FX 2VUYA 4BHYA 4ZSUA 2RDWA 4FHAA 5CSUA 1TWSA 4PL2A 2GJRA 4OJYA 4YL2A 3PUEA 4HU0A 3DFOA 4NP7A 3VCRA 3WELA 5LNRA 5GNYA 3NL3A 2YA0A 5C5YA 4HNLA 2CWNA 3SRHA 4PMRA 1UA7A 1W1B1 3TK7A 3MSYA 4FS9A 4Q4MA 1W91A 3BURA 1MRAA 3N15A 3WK1A 3CB3A 1MFVA 1XDMA 2VX4A 5HQMA 4O54A 2ICSA 3BCJA 1QU4A 1R2RA 4FP1A 1GVFA 4Q8MA 1US2A 4F2TA 4PSPA 1DWHM 1KFCA 1EQCA 3BMWA 4UQAA 1T5AA 2ISWA 4RNJA 3B0XA 1T96A 4IT1A 1BRLB 3WF2A 1R9ZA 4LAKA 3A12A 1EH9A 4O8AA 4L1GA 3ABRA 4HU8A 4CN4A 3M6YA 1HJVA 3CEPA 3HOJA 2QQ6A 1VBUA 1GOQA 1LBFA 1OT1A 4PMDA 5ECVA 4X63A 2VZSA 1KM5A 3AS0A 1TB3A 4Y9OA 5FJOA 3ITOA 1YW1A 2YX0A 2CESA 1TV4A 1AJ0A 3VGHA 5E93A 4YWIA 3TR9A 4UMCA 3MI6A 2YFNA 4FALA 2FZBA 3IV3A 1E72M 3DKLA 3TJLA 3V5CA 1SZEA 1WDQA 3THCA 2FPVA 3IK4A 3W1MA 2PU1A 3KHJA 4DN1A 2Z2AA 1B1YA 1XYAA 3BLFA 1TPDA 4J7RA 3W7EA 2DZVA 2O4QA 4WGXA 3H2FA 4XBJA 3OPSA 3MP5A 3URNA 1XLJA 2YCIX 1P43A 3CO8A 1DE5A 5GJMA 2EJAA 3WNMA 5DMNA 1AVAA 3B8DA 1OWQA 4A35A 1NVMA 1KBJA 1F7BA 3TQVA 1RCQA 2OZ3A 1D3HA 4L56A 5C7VA 2GFTA 4DJFD 3D5HA 2D20A 4IGSA 1RY0A 4NNCA 4HNUA 1SSDA 3GNNA 5LA2A 4B5NA 3EOSA 3HV9A 4AHQA 3UXAA 2W3ZA 1GVRA 4BCEA 3SN4A 2W9MA 4K1GA 1W3NA 1XLKA 4MLJA 2G95A 3KDOA 1NOFA 5JMUA 1S2WA 4LU0A 3C2EA 3FGCB 4N6EA 3EDJA 4CNTA 2G96A 2VCCA 3M1ZA 4IMFA 4ZO9A 5D03A 4L6HA 5F2LA 4BQ3A 3CL7A 1DWIM 2HWGA 1OHLA 3TMLA 1H5YA 1OX4B 2CZEA 4CQAA 2EJ1A 3W7DA 2FGBA 4P7RA 3MANA 5HMEA 4V2XA 3TE9A 4S23A 6PTDA 4CNSA 1A0EA 4K38A 3KL3A 3PBWA 3PZOA 3WK3A 4LS0A 2V2DA 2QF7A 6CGTA 1A50A 1A5MC 3KOXA 1EP1A 2Z0IA 4IFKB 2DZAA 2I14A 4Q6XA 5CPOA 1UR2A 3W7OA 4JQ2A 2CU0A 1EEPA 1X1ZA 4FK9A 2YZ5A 5AVHA 4HA0A 4LALA 2CZFA 3TJIA 1IXNA 4N7QA 2ZX7A 1H7NA 3W2UA 3QLLA 2EG7A 2ZUSA 1V3LA 2OT1A 4H6KA 2FHFA 4QNEA 2GDVA 1W9BM 3SUWA 5CBBA 4HOXA 4K8HA 2WM0A 3PNZA 3VI2A 2J27A 1JDDA 3ONCA 4K1WA 1E9LA 2XDFA 1ONRA 3FYPA 3TLLA 4WXYA 2L5HA 3NQGA 1RH9A 3R94A 3HBLA 3DFYA 1VFUA 3VC6A 3QF0A 4G56A 3S2NA 4J35A 4Z17A 4F0MA 3SRFA 3TX9A 2HPIA 1RJRA 5AOUA 3DKJA 4LJ3A 1XIMA 2HBXA 3VUSA 4N42A 1E56A 2G3NA 1EJSC 1E0UA 2WJFA 1ZUAX 4GKTA 1XBZA 3Q2DA 3DXIA 1XYBA 3C2YA 4Q8NA 1BTCA 2QLYA 1L2UA 4PMVA 3VAVA 2WVUA 5FJRA 2ZWYA 2R1KA 4D6FA 2J9XA 1KRMA 4CD6A 1R30A 3JZEA 4KETA 3USBA 5AC7A 4DVOA 2X1RA 1W3JA 3BH4A 1EL3A 5AKQA 5BRQA 1G69A 2VZTA 4ACYA 4ZE4A 1XYFA 5GVJA 2NQ9A 3F4VA 1JZ2A 5I5RA 1OC6A 4UZSA 3GY1A 1DWGM 3MY9A 5C71A 3QHNA 5IBXC 2VDIA 2VFDA 2VURA 2W79A 4Y90A 2ZKMX 3CAKA 4H8UA 2Q8XA 1FA2A 1UUQA 3B8VA 4AG0A 2A2IA 3UZZA 4QGCA 1LL6A 3WUFA 1G6CA 3RPTA 3GC5A 3R43A 5E6YA 1V93A 3T40A 4IL2A 4WJ8A 4XG1A 5FF4A 3W00A 2Z7GA 4NVTA 1TTPA 3CH0A 1B3ZA 4AD5A 4AF0B 4AEFA 4Q8QA 4I9AA 4M6VA 4PMYA 2VFGA 3GYEA 1QT1A 2NXIA 4H6QA 3EMZA 3W73A 4DF2A 2ZC1A 2PDWA 3P0WA 3BDKA 3WYZA 2VC7A 4XD4A 1IXQA 4GNVA 1WDDA 3WLKX 5E5CA 3K2GA 5EU9A 1G9HA 4O50A 3S9ZA 4JHOA 4RE0A 1UPMB 2G37A 2XWEA 2WSKA 4QDPA 3QRHA 2BG5A 3UNDA 3M64A 4QBXA 5EFFA 2E4TA 1XSIA 1CLKA 4WOZA 4D71A 1A5UA 1A5OC 1M7XA 2MANA 1K3UA 2XN0A 1MI3A 4PH6A 3ENLA 5D9NA 3RYSA 3II1A 1SZGA 1SO6A 3LMZA 4IMCA 4OZOA 3EKGA 1CGUA 4JYEA 3TDFA 3S5OA 4E4FA 3T6CA 2YYTA 5HWNA 1HL8A 4M5PA 4F2UA 3B3DA 5A6KA 1I60A 2GGHA 2ABAA 3MKVA 4DXKA 4GX8A 1XS2A 1W37A 3WMBA 3DHDA 5AYXA 1VIWA 1K7FA 2CLLA 1OADA 2Y70A 4FO4A 4GZEA 1GJWA 2A5HA 1TPWA 3ZWTA 4GUFA 4I8DA 3GIPA 4LNCA 1JCLA 4YJ5A 1A53A 3QFEA 3VABA 1LLWA 3JRKA 4ZVJA 2C1GA 1ADDA 3CZJA 1WPCA 4UQ9A 3QHMA 1IEQA 3VO0A 3LERA 1B9ZA 1GZJA 1CGXA 2ANUA 3AYSA 4XQ6A 4C91A 1M9HA 2BP1A 5XIAA 3K8KA 2VC5A 3EOLA 2PDMA 3VYLA 1J10A 3N34A 3UA4A 4K7VA 2ZIDA 1IWPA 5C2CA 4R9OA 3W2NA 3PB2A 1Q6RA 4DWSA 3QJAA 1GVIA 1Q6OA 2NV2A 4GRSA 2YCLB 1X8CA 4C5YA 1XLBA 3P3BA 3A9BA 2V3EA 1GEQA 1PTAA 2PDHA 1A5LC 3PAOA 3P60A 2FFCA 1XG3A 1M68A 3MO7A 1FCQA 2V2CA 5FF7A 3AIWA 1PUDA 3PZQA 4GUIA 8XIMA 4Z1DA 2QCDB 4ADSA 3T4CA 3C61A 3RDKA 2G3IA 4EPEC 4MB1A 1WKYA 1DL3A 1DJZA 1GNXA 1N82A 1V5XA 3A22A 3LRKA 3OODA 2WZMA 4JTQA 4QRNA 2OVLA 4K39A 3WO8A 3UR8A 2PODA 2HV5A 1NWUA 1JDEA 3U7VA 1NFGA 5H8MA 3OW1A 2ZXDA 1W2VA 3VGFA 2CERA 2J9ZA 5E0CA 2OODA 3NOEA 2YCJA 1RVKA 4ICCX 4FOJA 3SRKA 3PY2A 3S8HA 1M7JA 1UWIA 4KCVA 1EIBA 4OECA 5AN7A 1ZP4A 3H2CA 3QKZA 5DF0A 2V5JA 4BZYA 1JXKA 4MVAA 3LZ5A 2OZTA 3LCXA 3QKEA 3MDUA 1G5AA 1IEWA 1AODA 4JN7A 3H7VA 4EWND 3EMCA 3CAWA 3BAIA 3EDDA 4H9YA 4UR7A 2WZTA 2C15A 3G1RA 1JD7A 5DT7A 1UBPC 3TN6A 4ZENA 2V69A 1XYLA 4LB4A 1AW1A 2A0NA 4FNQA 5LNSA 1LRNA 3F2CA 1Y8BA 4DJDD 1WXYA 3WJWA 4A8LA 2GVEA 2OKOA 2DPEA 1XIEA 3C86A 3GHRA 3P0XA 2CLPA 3CLWA 3B8IA 3GUGA 4LYKA 4LC6A 2IXVA 1IT8A 5DEZA 4GLEA 2QT3A 1RD6A 1XGZA 3DGBA 3THQA 4AX6A 1BD0A 4QX4A 1EBHA 1BPLB 2FVMA 1IXPA 1LYXA 2CLIA 3EDKA 1IEVA 1YADA 2Z1WA 3RM9A 3UBPC 1QNRA 3VGDA 3NZRA 4RDWA 2WKJA 2WNQA 2GDUA 3AIUA 3CUXA 4L9YA 5M1TA 4W8AA 5JXQA 1MUCA 4MNLA 3EKLA 3AU2A 3SCSA 5JUVA 1TG7A 5AHLA 5EY5A 1Z48A 4GYKA 4U31A 3H7RA 2V0TA 3Q94A 3SW6A 5D37A 4MKSA 4ZMGA 5BMXA 1JGIA 3GHSA 1TIMA 3QN3A 1LTDA 3QV9A 1VB9A 2UY4A 2OX1A 4K68A 1OCQA 4MZYA 3WDPP 3EXSA 1OBAA 4A4AA 1IE7C 3HPAA 1W3KA 2PWEA 3IJLA 3OQ8A 1UB3A 1YPIA 4OBSA 5HJYA 1MSSA 4L4MA 3UP8A 5T26A 1TWIA 1MUMA 1SFLA 3ANYA 2HJPA 1C93A 4OBRA 4DJDC 1Q4WA 4S3BA 1OB0A 1R7AA 3LPFA 1JVNA 1RJPA 3F5KA 3UZXA 1TPB1 3LG3A 4D6GA 4R34A 5C9RA 2RDTA 5FKYA 1LWJA 4ZQCA 4LVBA 4L80A 1SW0A 3B06A 3HGJA 3TYBA 4V27A 8CGTA 2R9RA 1KFWA 3WLTA 2DSZA 3ALGA 3KL5A 4XSMA 4AQLA 4S2CA 1XYMA 1Q63A 3R7MA 2VOMA 1XLGA 4P61A 5CZ0A 3EWYA 1FWEC 1EWDA 1PJ9A 2YOCA 4DRSA 3ZWSA 4MY1A 1EA9C 5DRCA 4ZGYA 2GGIA 3VNMA 2B7OA 4S3FA 4E3TA 4CUCA 2DUZA 3F03K 1I2PA 3T0CA 3TKFA 3NGJA 3DU0A 1EXPA 3CQIA 1G4PA 1FY6A 4J27A 3WD0A 2EQDA 1DWFM 4FPSA 1X6NA 3RG6A 4AC7C 3CB8A 1QBAA 3CLMA 1A80A 2WJZA 1W5PA 1ISYA 1FCUA 3VOFA 2PRHA 2PTWA 1ZPTA 1Q85A 1Z7AA 1WQ5A 4NILA 2UY5A 1KCXA 1ZJBA 4JFTA 3WQ6A 3W7LA 4J3WA 3E1F1 3T09A 2NWRA 3RFAA 5FJJA 3V36A 1E15A 3GNRA 4C6OA 5L9FA 2OSXA 4JIHA 2WCSA 3IGHX 3MUY1 3WEZA 3CV1A 4W93A 3FDGA 1HKVA 3OLGA 1A3XA 2DZBA 2PDFA 1UC5A 3W72A 3PBYA 1S5NA 3H24A 3TNOA 4OT7A 2JEQA 3DHFA 3VMOA 2PP1A 4FLRA 3ES7A 3WLNA 4H8NA 4MPQA 3S1VA 3L4VA 4O10A 4Q4PA 4RJEA 1B57A 1ISZA 1POKA 1ESWA 4KWSA 1UA3A 4Z0SA 2ZZ3A 5BMWA 1QPNA 1UWSA 1PZ3A 1MEHA 2SFPA 1FWNA 4PUNA 4EX4A 2VX6A 1J0JA 1REQB 5D8ZA 3G6LA 4QEHA 4J3XA 2P8CA 2F6XA 4ICNA 3WNKA 3M46A 1XSKA 3GVRA 3O6AA 2DEPA 4AIOA 4UFHA 3G22A 3TW9A 4DO6A 1JAKA 1GVQA 3TN5A 3KOFA 1UP2A 3N73A 3I7SA 5ABFB 1JCXA 2BVDA 1I0DA 2GUBA 3IRSA 1BXBA 2HE8A 2FB2A 2J7EA 2H3DA 3WJYA 4UCFA 4KF1A 3T08A 3ZM8A 1RHCA 4HYVA 4N4QA 1QOPA 4EAMA 4QJ1A 2IW0A 1KBBA 2XM1A 2VYOA 1AJZA 4ZO7A 5HDRA 1D3CA 3N2BA 3BPWA 4BJHA 1E40A 3V16A 4LEFA 3N1AA 4PRTA 5A6JA 4YXGA 2OLAA 2P76A 1Z69A 3CUZA 3ZT5A 4PB3A 4AZIA 4I9JA 1R8LA 4ZL1A 3NAVA 2H8ZA 3DGRA 2GQ3A 3W7PA 3VIPA 4C6QA 1H0GA 1VYPX 1YXDA 2NT1A 3LPOA 4Y6GA 1XRSA 2BV9A 2HVNA 3PPHA 3MKKA 1XX1A 4FNSA 2DH2A 4S2BA 5LNUA 3TYDA 4LWWA 1QK2A 1O6IA 2EXOA 1KXTA 3WIJA 3FA3A 4LANA 4W86A 3EAUA 1JRCA 2E68A 3EPNA 4GVGA 1ZJIA 3LUTA 1OD0A 2FH6A 2AMGA 3A47A 3M0XA 1E4NA 1XP3A 2HXTA 4GC4A 2QJJA 1S2VA 4BK9A 1FHVA 1YBQA 4HTBA 3AWNA 3WD3A 3MZNA 2OR2A 3HURA 4ACZB 4QSHA 5F4SA 1FWAC 3M0KA 5BNKA 1AFSA 1T0OA 1TR1A 2WMIB 3GS6A 3B0UX 3G3MA 3B0VC 1B90A 3MMTA 4B2DD 3DCPA 2ACSA 4GXWA 2E6AA 4QDMA 5HJLA 1EDTA 5HK4A 4EXBA 1TX2A 3A5VA 1YLVA 3W2LA 4CQBA 5K9XA 2NSXA 1E0VA 3OG2A 4N02A 3DG3A 4J40A 4L1XA 3TC7A 3IRDA 4ZQNA 2OOGA 2OPJA 3AYTA 2PCEA 3M9YA 3QH2A 2PDCA 2W5FA 3SQLA 4GJ1A 1DWAM 3OBKA 4RPQA 3EBVA 3LTSA 3SB0A 2TSYA 1E3ZA 5JVLA 2PTXA 1ZB5A 3STGA 2D2OA 3LMYA 3TN4A 2YXOA 3TCEA 1E73M 1NWSA 1FP8A 2J9YA 1MDLA 2VM8A 3SJNA 4EP8C 1KFJA 4NZ3A 1VBHA 4XAGA 4Q7IA 4D8AA 2BDQA 3M0VA 4HCDA 3GIYA 3FOKA 4LV9A 2X16A 1FWHC 2X09A 3WQ8A 2VO5A 4XZHA 5A69A 1EC9A 3KVKA 4XV0A 4R53A 4IG2A 2QPSA 3VE7A 1K4GA 5F2IA 2QJNA 3NL5A 3O9NA 1J79A 4UFJA 2Z6JA 3B8UA 1HTIA 3TSBA 3N9KA 2PUZA 1CBGA 5EYWA 2Q3RA 4H7CA 4GD0A 4NZCA 5IRPA 2ZADA 2EO7A 4MFDA 2YDAA 2C1IA 2DIJA 2Z1XA 4FA3A 3AXKA 3GNPA 4JHMA 3SFWA 3N12A 2I5QA 4ZXOA 4OOZA 2Q8ZA 2Q8LA 3CJPA 1C7TA 4LRSA 2AOSA 1A49A 4U2ZA 2VGIA 4N4PA 3ISIX 3W1AA 3HQNA 4B91A 3BXWA 1Y7VA 1Q2RA 5HR7A 4C6EA 3GLCA 1KFEA 3EA1A 4O0ZA 3OVRA 1FDYA 5FJTA 1S2AA 2DIEA 1J0KA 5E70A 1TPEA 2CXGA 1QNQA 4PTDA 3U57A 4PBEA 3MMUA 3FLUA 4CD7A 4FF7A 3OP2A 2NQJA 3H7UA 4JTDA 4J3ZA 3M5XA 3SCRA 4UQBA 1Q7MA 2PTZA 2VGGA 4M3PA 4L6OA 1UKSA 3DN5A 1WUFA 4IPPA 1B2YA 4XO7A 3WQVA 2YIHA 1JPDX 1HKKA 1G4TA 2CCRA 4L6DA 4RW3A 2DJLA 4P5UA 5J5DA 2V81A 1HJWA 4O17A 1VGAA 1NDWA 3WQWA 5C9XA 2BOEX 2ZXAA 4HIBA 4FIRA 4MIMA 5G1TA 1WYIA 1P5BA 2UV8G 1XLMA 4J3SA 3UZYA 2WSPA 3CUFA 3D3FA 1O66A 1PSCA 3R1ZA 1SM9A 1AQFA 3CZGA 3QSRA 1Y65A 3CPRA 1F6KA 2WQDA 1P1XA 4AY7A 1E51A 3BV4A 1W8GA 3K1GA 2WC4A 1R5YA 1GG1A 4LAZA 1GOIA 2DFAA 2ACQA 2YXXA 3ALFA 4EK7A 3B97A 1OFAA 1AL7A 4GY1A 1U22A 1KLZA 2FMOA 4LBUA 2QV4A 3TROA 2UY3A 4REQA 1HKMA 4DQWA 4XWUA 3UQNA 2G3JA 4HSNA 4C6JA 3AMKA 2E6YA 1P0DA 1AD1A 1PO9A 4D1JA 3WLIA 4X60A 5A8NA 3PJWA 4F79A 4F48A 1HIZA 3GFZA 4LVGA 1UUMA 1VJZA 2FDSA 4JTUA 3VMPA 2CEQA 3G0UA 3RU6A 3ZJKA 5A94A 4D9PA 4GIRA 3VPLA 2NWSA 3TW7A 5I7GA 1S46A 1TWDA 2BXZA 1QO5A 1SJBA 2CZVA 2R24A 1RCOB 4M19A 3WLOA 3MJMA 2GGEA 5JU6A 3A24A 1SYTA 1JUKA 2INZA 5HINA 1C91A 4KGJA 4IP7A 4OTKA 1CEOA 1TREA 3WBXA 2H8XA 3T8QA 2RDXA 1O12A 3EWCA 4A3QA 4E4PA 1OYCA 2VEKA 3VIIA 1CXEA 1GK8A 3SY5A 3UJFA 3OU8A 1XGDA 3V35A 4CNOA 1JIBA 2ADAA 4PB4A 1E6PA 3H6OA 4NT0A 3TAKA 7ODCA 4ZQOA 4HMEA 4WCJA 2VFFA 2ZX8A 2CHRA 1XIBA 3RM8A 3G1AA 1T40A 1Y5WA 4AD4A 1TZ9A 1X97A 3RGTA 1OGSA 2QW5A 1P6WA 2WJEA 2Y2WA 3PZMA 3KOZA 7TIMA 3SY8A 2QPXA 3C8FA 1TUFA 4NX0A 1O4UA 2J7DA 3A4XA 1BRLA 1SFTA 3NFUA 2I5IA 3S6OA 2CLHA 2R8WA 1CI1A 1MXDA 3AXMA 1TPC1 4H3DA 1CGWA 2VHLA 1OT2A 2GPTA 3GTXA 1LDCA 4YWSA 5A8GA 1OQFA 2E9MA 3NQMA 2MNRA 2Y6ZA 3EWBX 3PR2A 1TV5A 3O6DA 1Y5XA 3GH4A 2PDYA 3KOYA 4LUIA 2OZ0A 3S5NA 2B7PA 2J6XA 1CLXA 2WXDM 3TFXA 2WV8A 2D0FA 1ZBCA 1NAL1 2A21A 4EOUA 1LL4A 3K1DA 4OUEA 1F6YA 4Z08A 3PFRA 5I3HA 3W74A 1UR9A 4R7JA 2J7CA 5B7YA 3WQ4A 4BI5A 1NU5A 3GD6A 3BARA 3VX0A 3DOPA 3W9ZA 1C29A 3CIVA 1C8XA 2E5CA 3SGUA 1NDYA 2HCVA 1MDRA 3WUEA 4NXSA 1YDOA 5DCDA 1KRCC 2DIKA 5A2BA 5K4ZA 3SGZA 1BHGA 3RX4A 3GH7A 4Q33A 5HJXA 4HBKA 4IX0A 2XG9A 1R2SA 3HIJA 2ZA1A 5ABHA 3UW6A 1I45A 4BI7A 3GDMA 3KVMA 1KWGA 3E12A 3SIMA 2ZQ0A 2FMNA 5A8PA 3RMJA 4N9EA 4A2SA 2QF8A 1JEZA 1W1ZA 4RR4A 4Y9AA 1IF2A 2RGLA 3W7IA 3S2JA 4KEVA 1VJSA 3TTSA 3O6YX 3OLDA 3LLFA 2DZXA 2OJPA 4NL1A 3N13A 3KX6A 1YE4A 3W28A 1R85A 2ZRYA 3CBWA 4Z1CA 2O9RA 5KEZA 1F8MA 3RIKA 2PGEA 4MDOA 1TX0A 4OV4A 1P6BA 3H23A 4ENLA 2VGBA 1QTWA 1VP5A 3AMCA 3QR0A 4DUWA 3U5UA 1FWGC 3R8RA 4V15A 3AU6A 4F3HA 1OX4A 3IIOA 1E9YB 1FWSA 1X7IA 2V9DA 3L67A 2WSRA 2XIBA 3DFSA 2QDDA 3Q37A 5FIPA 3APTA 3G77A 3TQKA 2GOUA 3SO7A 1HKIA 3EOOA 4L64A 3M4HA 2WPGA 4S3AA 1A4MA 2PDIA 3ARVA 2R1LA 3KEHA 1KFBA 4DXXA 3O16A 3T2PA 1H11A 1BGGA 4WZHA 4PMQA 1EHAA 4IFKA 4R27A 1DBTA 3VILA 3PZGA 1P7TB 4GG9A 1M3UA 3DC0A 2BY2A 3E0VA 1GVYA 1NP0A 3VE9A 8TIMA 5MHBA 2PDLA 4JOMA 3UXIA 1SSGA 4ZB2A 2DSKA 3B8SA 3L5AA 4I90A 4CQDA 3K46A 1TJRA 4PFHA 4LV4A 1JCMP 2PWUA 2DVTA 4NZ1A 1YPXA 1ZCCA 3VGBA 5LXEA 4HZMA 4NZ4A 1TPUA 2W92A 4FB7A 1VJIA 4IIHA 4CCDA 5G1YA 1X1OA 3MVTA 3M0HA 6A3HA 2NVAA 1DJWA 4IISA 4YTTA 1DXEA 4PUKA 2C18A 3LBOA 1W5OA 3HG5A 3MJYA 3GTNA 4Q7NA 3CV6A 5F4XA 4ZQRA 2HPMA 4D8ZA 2P0IA 3BLKA 5BWAA 2X0SA 3CPUA 1P0NA 2CLFA 2JIEA 4NI3A 2VZUA 2Y5EA 3I4EA 4MUZA 3S6DA 5C9ZA 5CC7A 3E0LA 1UR3M 4C7GA 3LEPA 4US5A 2CLKA 2ZC8A 3NZQA 1ISXA 1Q4NX 3KL0A 1UR0A 4ERGA 4IMGA 3W1XA 3F5LA 3BQ6A 1PIGA 1TV7A 5KZMA 4KWWA 4U3AA 1DV7A 2UWFA 4TU1A 3XIMA 3OZPA 2PE4A 3G18A 3QOMA 4JTAA 3IUDA 4PA8A 3HQPA 4L4OA 1T6MA 4Y96A 4JIPA 3AHYA 3BOXA 3WLRA 1VCVA 3WFAA 4E5TA 4EAYA 3UR2A 2XZ7A 1KRAC 3N2CA 3N9SA 5DBTA 3IACA 4F0HA 4AAJA 3A3HA 3V7PA 3STFA 3KBNA 3DHUA 1RA5A 4U10A 3LCLA 3H21A 3AXXA 3LB0A 5AHMA 1ZTVA 1KCZA 1RBLA 3SUTA 1BGAA 4AMAA 4GI8A 2FTYA 1Q66A 3RJXA 3WBYA 3KRUA 3L65A 4EF8A 3T05A 3URQA 2YGYA 1ONEA 3WQFA 1HJXA 5SWUA 4KFNA 4TIMA 4AF0A 1E1EA 3NDOA 2ZYFA 5DCBA 9RUBA 4NJJA 4CD8A 4KESA 3S2CA 4CCCA 4LT9A 2WLYA 4D6HA 4C90A 4C60A 5HUOA 2QDEA 3M47A 1XISA 4LX4A 1RP9A 5JIPA 4KCTA 3VKCA 3R13A 1F4HA 4CCEA 5GNZA 3NZPA 1XGEA 1OGGA 3PBVA 2J62A 1UR4A 4ZSTA 4AEOA 3WF0A 2ACUA 3UG4A 1CW2A 2WC7A 2QJGA 3KHDA 2GQ9A 4DO7A 1R3WA 4FXJA 4IP5A 5E0KA 5KITA 4HYRA 2RGMA 1VD6A 1FUYA 5B7ZA 1GOMA 1TZ7A 1WOBA 3AHTA 1E5NA 1EF2A 3NWRA 3S9IA 1H1YA 3F4NA 3DHPA 4UR8A 5I24A 4O28A 3NPWA 1E6NA 1R3VA 3THUA 1O7AA 1R7OA 3A4JA 3UF9A 2VUNA 1T7LA 3ZVHB 1E3XA 3MP3A 1F8IA 4MM1A 4LNYA 3T78A 2E5DA 1KXQA 1SUXA 4TUFA 3PFMA 4UTWC 2PWGA 2OXNA 4Q8VA 2FHCA 3PBMA 5BXRA 3KCLA 3GYCA 3H26A 4O12A 1ODUA 3W4RA 1R9XA 1J0YA 2QDHA 2Z4GA 3UT0A 3GXFA 4ZB0A 2ATMA 3WSUA 3IARA 3R0UA 4NAEB 3P74A 3PUDA 2Z25A 2EPKX 3QXBA 2O7SA 3W76A 2VRJA 3KRBA 1GTHA 1Z8AA 1XH1A 3GM8A 3QMTA 1C90A 3W7RA 1QI0A 1K1DA 2Z7KA 5CPQA 1KWKA 2ISSA 1US0A 2QZRA 3UVIA 1I1XA 5K9DA 5CC6A 2O0TA 1B5TA 3DBPA 1E0TA 2PDBA 2I5GA 4XIAA 2F84A 1UH4A 4WK9A 1XSJA 3IJDA 1NIUA 5KZ6A 2X7VA 1L6FA 2QCDA 3HG3A 4GGBA 3EB2A 3K4DA 1ZL1A 3V5OA 4WX2A 4W7VA 5GNXA 4TQTA 3PHAA 4O1FA 3M0MA 3AYVA 5FACA 4JIIX 4ERAA 2DDXA 3RR1A 1WDRA 5D2YA 1LM1A 3W1TA 3DFHA 4HK7A 4QQ3A 4GI4A 3AUJA 3LCGA 1O1HA 3FA5A 2EPHA 3PM6A 1AZ1A 1H5VA 4LBRA 1HP5A 3URBA 4AD2A 2Q3OA 1YKWA 3I65A 1R47A 3E0IA 3GC2A 4GACA 1PIFA 3CQKA 4JYDA 1C3FA 1OVDA 3DH7A 3ZQ9A 3ID7A 2FH8A 3IAQA 4A6GA 7A3HA 4HZ8A 1S38A 4Q4SA 2VC9A 1ZY9A 3TA6A 1BKHA 3AIBA 1EDGA 4IX2A 3NVTA 2HROA 2ZXBA 3DEQA 4QHRA 3WUBA 2ZE0A 1TKKA 1QMLA 4TVCA 1VFLA 2XGIA 3VCNA 4NQ1A 3I4KA 3ZVIA 1M01A 3NQ8A 2Z27A 3OJGA 2FB3A 2F6KA 2WSQA 4MY8A 4XZWA 1IR2A 3UCQA 4RNFA 4MFEA 3CAVA 2INEA 1A5NC 3GU2A 4O1DA 4QJ4B 4A3UA 4RX0A 1E1CB 3UJEA 1CZ1A 1B3YA 4IIDA 4PBFA 1S5MA 1HGYA 4JTJA 4BF5A 1ODZA 1OF6A 1QWGA 3FNDA 2VR2A 4CEUC 2E09A 1CXFA 3B9DA 1J18A 3HQOA 5HNNA 1KTCA 1OF8A 3FCPA 1PS9A 2Z28A 3NGFA 4DO5A 4HPJA 3EKZA 2GK1B 3OGRA 3OHIA 3QZ6A 3NYDA 3W82A 2PC4A 4GE8A 4I7UA 4OKDA 5A6AA 3AIVA 1KM0A 4NNBA 1HO4A 4WR3A 1O1ZA 3DX5A 2BFGA 3VIFA 4R3UA 1BSLA 4IJBA 3SRDA 4IGHA 1TVNA 3QGVA 5C9WA 1W3HA 5M3WA 2WWCA 4GX9A 3GXPA 3H70A 1L6YA 4X2RA 1GQLA 3MMWA 2PMQA 2WMKA 4XZMX 1BAGA 2VR5A 4HOWA 3BV7A 3O6CA 5BRBA 2Y89A 4PEEA 4UUIA 3P2VA 3VNKA 3EA2A 3OEXA 4JKMA 3L5MA 2OU4A 2VD8A 3OVPA 3HGSA 2WYSA 4MAVA 3ABSA 3C2OA 2RJHA 3A3XA 4LCSA 5GJPA 4LCRA 3WEOA 4ICMA 4PMZA 4IPNB 2PGWA 4YTUA 3BLLA 1H51A 2YL6A 5AHIA 2H9AB 4ZZ9A 3QBUA 3EX1A 1CXKA 5G4WA 1WV2A 2CW6A 3QM3A 4K37A 2Q6ZA 1YNQA 2YDRA 4JEQA 4PTNA 4C6FA 2OSWA 1IV8A 3FN9A 1BF6A 4M81A 2G50A 4IL0A 2A3EA 3QPZA 3HFYA 1FBAA 1XDLA 1EXBA 3WLHA 4MG4A 3IJQA 2A3LA 1B31A 3MCNA 4RE2A 3V0SA 4O1BA 4QFUA 2IKIA 1UP0A 3L4TA 4PSRA 1YHTA 4Z2KA 1E70M 4AZ6A 7TAAA 3QFWA 1IT0A 3HM7A 2FZDA 2PC8A 3V4BA 3TTEA 1RP8A 4HPXA 3LX9A 4JFVA 2EG8A 3GE7A 5T8GA 1EEXA 4C6BA 3N14A 2I1OA 3VOIA 4ATWA 4B16A 3L4ZA 2JBMA 3AZRA 1JYWA 3RLVA 4GH1A 4P8VA 3PTKA 4GQGA 3GR8A 3W53A 2MUCA 3TYEA 3TXZA 4CLMA 1Q6CA 4MHBA 4WF7A 5MKGB 4GA8A 5DN1A 4NKCA 3T07A 4Y2WA 3UU0A 4GBUA 2WNWA 3LK6A 4IWWA 3NQ7A 1KC7A 3LHUA 1NARA 3POCA 2R14A 4WD0A 3FK4A 2Y7GA 3VNIA 3KXQA 1H61A 1DIKA 4UQDA 2W6RA 2A79A 4E38A 3CUHA 4H9XA 2P50A 3W7NA 3GDTA 1SJDA 3RRXA 1PHWA 5U7SA 1SW3A 1REQA 3IWPA 4G7EB 2E7FA 1MFUA 3AISA 2AQWA 3MHGA 1JF5A 1NF7A 4AU0A 1PCKA 3RUBL 4A3YA 5CC5A 2YA1A 2G97A 1NSJA 3GHUA 1RPXA 3WL0A 3O05A 2OQLA 4PULA 2HE5A 2XVGA 3O63A 3M6DA 2O9PA 2ZZ4A 5ABFA 4GXPA 4Q4OA 3ZJ6A 1BYDA 1EJVC 4DAIA 4NJKA 4WJXA 3NSNA 3WY1A 2CPUA 4FNUA 4UC5A 5EMJA 2IMRA 2Z24A 3DFPA 4M80A 4RDVA 1IQ8A 2PD9A 1O5XA 3HF3A 1ZFJA 4UTTC 3PBUA 3DFTA 5FEXA 5I3JA 5C2GA 3NO5A 4GI9A 3LOTA 2O9OA 2WJDA 4A8RA 4QTGA 3HV8A 2WSYA 4L4LA 4H2CA 4P2VA 2NQZA 1K9FA 1XD1A 5IBXA 3F4CA 3H2OA 5EL1A 1M7PA 4HA4A 4IMDA 5LA1A 4U33A 4AWEA 4W5UA 3XINA 4DYKA 4NY2A 4GFSA 4HP5A 3GKFA 3G1DA 4IHCA 4TX9A 2VEFA 3AUOA 1OFRA 2HBVA 3TTOA 4TMBA 4DLFA 1H63A 5EGRA 1B30A 1V0MA 2FVKA 1W1VA 2P5NA 5AYYA 1YNPA 3HG2A 3VNLA 2NLYA 1QVBA 2GJXB 3E02A 5D02A 1UMYA 4NZFA 1A5AA 4HK5A 1X1NA 1SR9A 2IKJA