1UR4A

The structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
386
Chain Sequence
b'GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTANASE
publication title The Structure of Endo-Beta-1,4-Galactanase from Bacillus Licheniformis in Complex with Two Oligosaccharide Products
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 145
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ur4A00
3L4ZA 5LYRA 5BXRA 5IHRA 3UR8A 3ARUA 4ML4A 4XZWA 4J3VA 1GPFA 7A3HA 1TZ7A 1E72M 3B9EA 3VM5A 3VKKA 5CSYA 3T08A 1OGSA 4AIEA 2J7FA 3WFLA 1H0IA 1E56A 1ZJBA 1H11A 2WHMA 4HU0A 3AIWA 1HVQA 1GUVA 1SMDA 4UFLA 2G3JA 3W38A 3KWXA 1Q6GA 1ISYA 1QI2A 1WPCA 3WY1A 5EMYA 3TA9A 1HJVA 1W9VA 1XD1A 3WQ8A 1CWYA 2X1IA 3DECA 1QNRA 1ISXA 2ZX7A 3VILA 2WMGA 1M53A 3GH5A 1TE1A 3WQVA 3SUWA 1W1PA 3RPMA 2OYMA 4LGXA 1KFWA 2DT1A 1E3ZA 5JIWA 3WH8A 3ARRA 2VC9A 1VRXA 1R86A 3MV01 2GJRA 3W6MA 2DT0A 3RM4A 3AIBA 3PZGA 2GUYA 4B9ZA 1WP6A 2QLYA 3CPUA 2BV9A 3T2QA 2JFEX 3OB8A 3WL0A 3MV11 1EHNA 1VB9A 1JI2A 2J78A 2E8ZA 4XUYA 4IM4A 5E70A 1DHKA 3D5HA 3VVGA 4HU8A 3EDDA 6A3HA 4GKLA 3ALGA 3J7HA 4W87A 4HMCA 3AIVA 1UR0A 5EB8A 3IJ7A 1CXIA 3I3DA 1V6VA 1LLOA 4W8LA 1JAEA 3WUBA 4AWEA 1GOMA 3CLWA 3FHAA 1H2JA 4EKJA 2YDRA 4ZE5A 4H04A 1GOOA 4H41A 1TR1A 4W84A 3N9KA 2XVLA 3CZKA 5GNXA 5ABFA 4AC1X 3SCOA 4GI8A 1V6UA 4QLLA 5DFAA 2YA1A 1QI5A 1W9UA 1JDCA 3QHOA 1H3GA 1XSIA 1B3ZA 2CERA 4P7LA 5I78A 4J3TA 1FFQA 4PMOA 4CKQA 3MO4A 1I75A 5HDRA 1JNEA 3VINA 4V28A 2WCGA 1W9XA 2WB5A 1B3XA 3AROA 1OBAA 1QW8A 1E6ZA 3D3AA 1LL7A 1JD9A 1UZ4A 2W63A 4HA1A 1HT6A 2OWXA 5A2CA 4D6JA 4ACZB 2CCRA 4WJXA 4DWSC 3HJEA 1MQPA 3L4TA 4DWSD 4RL3A 4PUDA 3ARTA 4GZJA 1XCXA 2ZX6A 1U30A 2IXVA 2J75A 3KL0A 1V02A 2WCSA 4AXNA 4LYRA 3WMCA 2W62A 1E6RA 3PZUA 3KL5A 4UNIA 4U5IA 4UTFA 1UZ1A 1JL8A 1GJUA 1UH3A 1Q6DA 4NRRA 2DT3A 1HKJA 1E4LA 1B1YA 1S46A 4B15A 4TX6A 3CZLA 4TVCA 2E9LA 1JZ7A 3W6LA 5A69A 2VR4A 1UD6A 1VEPA 1US2A 4CU6A 1CGYA 1XYFA 3W24A 3VD4A 3WQ4A 2WMIA 4M81A 4HOZA 5GNZA 3AHVA 3NSXA 4DWSB 1XD0A 4JIEA 1ZBWA 2W66A 4MNJA 3WD4A 2E9MA 1CPUA 4LPCA 2WHKA 2YLAA 3BSHA 4KGJA 1UR2A 4D6DA 4LXFA 2PC8A 3WNMA 3N04A 3ZJ8A 1UR1A 4P8WA 2VZSA 1C91A 3W53A 5CZKA 3FW6A 2J8GA 4BQ3A 3WELA 3W28A 2D0GA 5AC5A 2WW5A 1QHOA 3VNYA 1W3LA 1ITXA 3PZNA 4UZUA 4ATWA 1W1TA 1XH2A 5E09A 4F9JA 3WF1A 1FP8A 2HISA 2JF6A 3K1DA 3ZJ6A 1HJWA 4MDOA 7CGTA 1IT0A 1MQRA 1A47A 3W81A 1CIUA 1MXGA 4Q22A 3VIFA 2WHJA 2Z1KA 1SFSA 1XGZA 3DYOA 2PF0A 4W8AA 1Q4NX 2CYGA 1XCWA 2F2HA 1BFNA 3VIIA 2J7CA 4D6EA 1ZL1A 2Y24A 2PWFA 4E8DA 3L4YA 3AYSA 1CBGA 4UR9A 3WQ6A 3OA5A 4QLKA 4MB4A 3POHA 3AHXA 1OCQA 5D9NA 1EDQA 3T0BA 4J3SA 3TP4A 1PIFA 1D2KA 1GQLA 1W9PA 4MNMA 3K46A 4J27A 1ISVA 4U33A 5FIPA 4UOJA 3CIVA 1V0KA 5KZ6A 3QOMA 1VBUA 1UA7A 4RE3A 2EPKX 3L2LA 1EQPA 1HJSA 3TONA 5JBDA 3WN6A 5CG0A 3SUVA 3PBGA 6CGTA 4BZYA 1QI3A 3ARXA 2ZUVA 1KCKA 3UESA 1VAHA 5GNYA 2QMKA 2CBJA 1BYCA 1W2VA 2DT2A 3AIRA 4S3KA 4WF7A 5A8OA 2WSKA 2ZXDA 2WVTA 4UOQA 3BMVA 3SIMA 1LWJA 3SCPA 4QDMA 2WLYA 2VVSA 4TUFA 1W32A 2ZXAA 1EH9A 5GPRA 3PTMA 1JD7A 3II1A 3QHNA 2VUYA 2VOTA 2XFFA 4KMQA 4P7NA 1LWHA 3IAQA 3WH6A 2GK1B 3FAXA 1OINA 1RH9A 3SCUA 3SUSA 1BYAA 3PN8A 3A4WA 3BAYA 2OSXA 4C7DA 2ZX5A 3AXXA 3CBWA 3U5UA 5I79A 1MQQA 3CGTA 3W0KA 4KWUA 2W67A 3WMBA 1DWJM 1RD6A 1HKKA 1JAKA 4S3JA 1M01A 1ODUA 3WSUA 2VNCA 3SCQA 3MUY1 5CQ1A 2D0HA 5I2UA 1J0IA 2MANA 3RMEA 3GXMA 1CLVA 4FK9A 3WBAA 2EPLX 4GZIA 1GONA 4IPNB 1WKYA 1NQ6A 4UFMA 1GJWA 1PZ3A 2ZUTA 5ABEA 1JYNA 5HOSA 4GXPA 3NIYA 2EJ1A 5BROA 1QNPA 3NCOA 2QPSA 4FF5A 1C8XA 5AC4A 4GPNA 4AZCA 1HJUA 4GQQA 3WUEA 5CGMA 1WZAA 1OIFA 5JBFA 3CH9A 2G41A 5ABGA 1HJQA 2BXZA 4P7QA 5I6SA 4M1RA 1J9YA 1V3KA 1Q6CA 1WCGA 3VNZA 3WF3A 4DUWA 1HJXA 4XX6A 5D4YA 4JL2A 2WM0A 5A8NA 3WBEA 4CCEA 1EOMA 5A1AA 2YL9A 1BGAA 1J0JA 3MUAA 2VRQA 3BAWA 1AQMA 1JYXA 1H5VA 5BXSA 3WD1A 1SR0A 3K4DA 4GIAA 4QP0A 3JUGA 1J12A 1OGBA 3MANA 1QHZA 2XWDA 2VZOA 1QVBA 2UY4A 4HA3A 3WEZA 3WL1A 4BQ5A 4Z2JA 4Z2KA 2G3IA 4A4AA 5E0CA 2X8RA 1O6IA 2J4GA 3CUGA 3FXYA 3WNOA 1SMAA 1QOXA 3DC0A 1XH0A 2V3DA 1C93A 3VIHA 1W1YA 4P8XA 1V08A 1FFRA 4GQRA 2WVVA 4HTYA 4KGLA 5DT5A 2WWCA 1QNOA 4J3UA 1XSJA 1EHAA 4CD4A 3PHAA 1UKTA 2CITA 1V0NA 1W3JA 3OZPA 4TOQA 4B3KA 1EDGA 1JI1A 1E5JA 2YBUA 5FCZA 5ABFB 2ZUSA 5BXTA 1VFFA 2W61A 4KRUA 3OLIA 3I3BA 2PB1A 2J7HA 1K6AA 3PZ9A 2WXDM 2FH8A 3AXHA 2XFRA 5C8BB 3IANA 4XB3A 2CXGA 3ZIZA 3QR3A 1US3A 3BCDA 3BXWA 2E3ZA 2VURA 3B8SA 1VJZA 2PI6A 1MW3A 2NT0A 3BAIA 2WK2A 3TTYA 1KWKA 5D9PA 1M04A 4UQEA 4HMDA 4WSJA 2PBGA 4U2YA 2BVDA 1E4IA 2CHOA 1V3LA 3VPLA 1E6NA 2WNWA 4PMYA 1HKMA 3KEHA 3L4VA 5CGTA 4CU7A 3F5LA 4D72A 1CNVA 4CVUA 2ZE0A 1WZKA 5IDIA 4ATLA 3TTSA 5A6SA 2XVKA 2YJQA 4OKDA 2WAGA 1OD8A 1UD4A 1V6WA 2CBIA 5A6JA 2CBUA 2E40A 1DTUA 1C8YA 4AD5A 1DEDA 2EXOA 5LA2A 3AQUA 1G9HA 4TVUA 1V0LA 1B0IA 3MMDA 2YL5A 3WDJA 2BY1A 3DHPA 1I1XA 2BXYA 2Y8VA 2BY2A 4D1IA 1WO2A 1XH1A 2XSBA 3W37A 1PX8A 2QF8A 3ZOAA 1H49A 4U31A 3VU2A 2XG9A 2DSZA 2CNCA 2E8YA 3PZMA 3M7SA 3T0DA 2AMGA 1HXJA 3VD7A 3EMQA 4AD0A 5CXPA 1SYTA 2A3BA 5BXPA 1A3HA 4UFHA 1GVIA 2IXUA 1K9EA 1QPKA 1NP2A 3MUZ1 3RO8A 5DF0A 3ZQ9A 1W3KA 3E1F1 2D22A 4OIFA 4AD4A 2ZUWA 3LPPA 4W8BA 3GXIA 4P8VA 3O9NA 3CZEA 1AVAA 1OT1A 4LX4A 3AXIA 1EOKA 4CUCA 1JZ3A 4UFKA 3WDIA 1JDAA 3SURA 1UYQA 3W26A 4AZHA 1BYBA 1B31A 3GDBA 3RCNA 2NW0A 3MSGA 2A3HA 4CCDA 1JZ4A 1UD2A 1KBBA 1DWIM 3FNDA 4UQBA 3W82A 4KRTA 4AZBA 4GI6A 3EYPA 4YHGA 1JNDA 5I23A 2FHFA 1JF6A 2DPEA 4FLOA 3N1AA 2CKRA 4V2XA 3WDQA 5EFFA 1BVZA 2FHBA 2EEXA 3WMSA 2G3NA 3VMPA 3MMUA 4R27A 2VZVA 4Z2IA 4J7RA 4AEFA 4U3AA 1ISZA 4M24A 4CVWA 1BLIA 3RM8A 3G6MA 1C7SA 3RIKA 2WANA 1PX4A 5AY7A 1KBKA 1WZLA 3LPGA 4QAWA 4AIOA 3VIPA 4C7GA 2WBKA 5BRQA 1E73M 4MAZA 5IFPA 3GH4A 1MW2A 1NARA 4W7VA 5A6MA 5A6BA 3W27A 1CGTA 4JFSA 1Q6EA 1CXFA 3BLPX 3APGA 1LJYA 2D24A 2UY3A 4B3LA 1J01A 4TVDA 3N18A 4E8CA 4D71A 4JKKA 1WZMA 1UWIA 3AS3A 1Q6FA 4HZ6A 5AYIA 3ARPA 4W5ZA 3VIOA 4F9DA 2XM2A 1QI0A 1G5AA 1E0WA 4GO8A 4PEEA 3VDAA 1JZ8A 2OYKA 4PMXA 3HMCA 3SUTA 4PRWA 3AIQA 8CGTA 3GXFA 4EANA 4OJYA 4WK9A 2DGAA 2VI0A 2YDSA 2E0PA 3QOKA 5A8MA 4PMRA 1D7FA 1J0KA 1GHRA 2XVGA 4OBSA 4PCTA 4CD7A 2NT1A 5DEZA 2YIHA 1Y7VA 3VMOA 1UWSA 1IV8A 1KXQA 2XWEA 3WD3A 3RJXA 5CPQA 1HL9A 1E6XM 1NWTA 1UUQA 2V3GA 5C71A 4NSBA 4JCMA 1C3FA 4NZCA 3VD9A 2WPGA 3DYMA 2D2OA 3W4RA 1B9ZA 1HNYA 4QLJA 2D1ZA 8A3HA 1V03A 1UWRA 2C0HA 2WYSA 1TFVA 5E9AA 1CLXA 2W91A 1B3WA 1E1FA 2A3CA 4AZCB 3SCVA 1CXLA 1UD8A 1J0YA 1VBRA 4JFTA 1B30A 3A4AA 3UCQA 2BNJA 2TAAA 1JFHA 4BCEA 3CZ8A 4JHZA 3ZMRA 3WQWA 1UKPA 2G3MA 2BVYA 2V5CA 4H8VA 1W9DM 5I0DA 4F66A 2A3EA 3ZR5A 3OBAA 1J11A 2WHLA 2X0HA 3OG2A 4LYPA 1G94A 1ZBVA 1FH7A 3TOPA 4PTXA 1EGZA 2XUCA 2GJPA 1VJSA 2WC4A 3W25A 3FAWA 1GCYA 4ZE4A 3A3HA 3VDBA 3AZTA 1YQ2A 4M8UA 5D9MA 4DUVA 2BS9A 2UY5A 1JXJA 4AZ5A 3OGVA 1EXPA 3GZAA 1E0XA 2VQTA 1XHGA 4ZXLA 5I77A 3FY1A 2NSXA 2FHCA 3O6AA 2WVVB 1PX3A 4AD1A 2XTKA 1TVPA 1FHDA 2D23A 4PMQA 4AZ7A 1LL4A 1XSKA 5I24A 4OBRA 5CPTA 4OZOA 1NWRA 2XHYA 3M6DA 4MPKA 4JZ5A 5A8QA 4MB3A 3GYCA 3VDCA 3T2OA 1PPIA 3OIHA 3BGAA 4UFJA 1MFVA 1KCLA 3VIKA 1OSEA 2V3FA 3BLKA 1UR4A 1AQHA 1GZJA 1VFUA 2C7FA 5D8ZA 1MFUA 1V6XA 4AD3A 2XFYA 3CZJA 2D0FA 3ARSA 4DM1A 3UR7A 3IJ9A 1VEMA 1CECA 3WD2A 2GDUA 3EMZA 2OSYA 3DHUA 1ZBCA 3CO4A 2X05A 3OGRA 4FLSA 3WNPA 5CSUA 1NM9A 2JIEA 3AI0A 5IXEA 4D1JA 4ACZA 3CMJA 1BF2A 3PTKA 1DWAM 2EBNA 3K4AA 1UWQA 3ARVA 2VQUA 4JKLA 3L2MA 4CD8A 4D6CA 2WVSA 4EK7A 2D3LA 3OZOA 1RP8A 3WNLA 4MTVA 1KGUA 3N13A 5CJ5A 3NJ3A 1HIZA 4CN6A 2WKGA 1MVYA 4AIUA 2J62A 2YA2A 2Y4SA 4MADA 2XJ7A 3HN3A 4JCLA 3VUPA 2PWEA 2V5DA 1UKOA 3VIMA 1BPLB 3KE0A 4R5EA 1GOQA 1R7AA 3ZT5A 1KB3A 2JALA 3F5KA 4FLQA 5CLTA 4AY1A 2VX4A 4DWSA 1UG6A 1MW1A 1UKSA 3AS0A 1G01A 3CMGA 3T0AA 2DSUA 4AZ6A 5A6LA 5A95A 1DP0A 2ZUUA 3POCA 3VTRA 3K8MA 2DSKA 4HPGA 1WNOA 1CGWA 1R85A 2RGLA 1WB0A 4LYQA 4PMDA 3UETA 1JYVA 3M07A 2V38A 3ZO9A 6TAAA 1W2PA 3VD5A 2WC7A 4PMVA 4UQ9A 2W4XA 1X6LA 5FD0A 2DH2A 1CDGA 5LA1A 1UR9A 2AOSA 3VO0A 3WF2A 4BF7A 5ECUA 4FLRA 1ZJAA 1BG4A 1V3MA 1E70M 4QCEA 4V27A 4GINA 4P7RA 2YLLA 3NSMA 4W89A 3GNOA 3SCNA 1E6SM 3M46A 1L0PA 2GSJA 3AJ7A 1LG1A 2B31A 2O9RA 3EDKA 5IHSA 1KWGA 1VFMA 1XRVA 3IAPA 4JKMA 1DWFM 4PTMA 3AIEA 3VIJA 5CLWA 3AOFA 1CGUA 3AHTA 1FHLA 3L4XA 4CGTA 1VEOA 3I3EA 4CCCA 1FH9A 4CU8A 1H09A 1HP5A 2ZICA 2O92A 1UD5A 1ODZA 1TUXA 1HF6A 1DWHM 3ZJKA 1QHPA 4BS0A 1R7OA 1WDSA 4H8UA 3DYPA 4AISA 1CXHA 3ZSSA 4MNLA 2OWWA 1E4MM 3EBVA 1HP4A 2VR5A 1JG9A 2J7GA 4H8HA 2BHYA 1E1EA 3WF4A 2XVPA 3CHDA 3AZRA 3K8KA 3CUFA 4MJ4A 3NSNA 4X0NA 3GBDA 4U2ZA 3THCA 4HA4A 3ZT6A 5LA0A 4AYSA 3AYRA 2D20A 1B2YA 4WKAA 3PZOA 3WDRA 1QW9A 2D3NA 4CN4A 4X0VA 1TG7A 3PTQA 2VZTA 3VX1A 1ESWA 5A2BA 1CZ1A 2IUZA 3AIUA 2CEQA 1VIWA 2VCBA 1MWOA 3AISA 1W1VA 1UHVA 2J7BA 1GOWA 4PYSA 4WKHA 5I3DA 4A3YA 5M17A 3UG3A 1ZU8A 2DDXA 3TTQA 1WE5A 1E3XA 5FL1A 1QI4A 1GOKA 4MB1A 3VOCA 4DUXA 3GH7A 2W5FA 3F5JA 4Y7EA 2JEQA 1K9FA 1UR8A 3GM8A 3T09A 1WDQA 2XYLA 3CHCA 1MXDA 3BC9A 4AZIA 4JL1A 2EQDA 1V6YA 1NOUA 1OIMA 4WKFA 2WMIB 3AHZA 1E6PA 3N15A 2X0YA 2CBVA 1CYGA 2WBGA 2WMHA 4UOZA 1GNXA 1V3IA 2YKKA 2FH6A 4AZGA 3MUIA 5HBFA 1CXEA 4PCSA 2JE8A 2YA0A 4A3HA 1KXVA 1PBGA 5CPSA 3NDYA 1R87A 5M5DA 1CEOA 3OLDA 1E4NA 3W29A 1J18A 3AZSA 4W85A 4D6GA 2O9OA 3SCRA 1NH6A 4RE4A 5A6KA 2DH3A 1J10A 1W91A 1CXKA 1TMQA 1EDTA 1UQYA 3SEPA 1BSIA 4PMUA 2VL4A 5M3WA 2VX5A 1BHGA 3VGEA 5TD4A 1TVNA 2Y8KA 3AMLA 5BWFA 1W9BM 3SUUA 1HVXA 3KL3A 3GXDA 1KGXA 2JEPA 1ISWA 1HL8A 2ZX8A 3BSGA 5C70A 1JDDA 1PAMA 4Z2HA 1CTNA 1V02E 1ZBKA 3ARZA 1ZS2A 2YOCA 3AICA 2GJXA 3UG5A 4JFWA 2CESA 2UWFA 4XV0A 3O2LA 3UEQA 1FP9A 3WFZA 3AS2A 1EA9C 3TTOA 1RPKA 3F4VA 1KR0A 5AYBA 1GQJA 2VCCA 3BCFA 3KZSA 1KR1A 3WDHA 3WUGA 1PJ9A 1KXTA 3ARYA 4UFIA 3U5YA 3VIGA 2ZUMA 4WIWA 2VMFA 3NUKA 5D8WA 1UH4A 4UCFA 1QBAA 4HMEA 2YDQA 1D3CA 4PTVA 1CGXA 2J79A 4W5UA 4OOZA 1GVYA 2VVNA 4M80A 3UERA 2ESCA 1U2YA 4HPHA 2E4TA 1QNQA 4MDPA 1TCMA 3CUIA 2ZX9A 4BQ2A 1KQZA 2OSWA 1XC6A 2ZWYA 1HKIA 2O9PA 1VENA 3N12A 5A94A 4H7VA 2A3AA 1FH8A 1WDPA 3BAKA 2WVUA 4IUGA 3WEMA 4JFVA 1PIGA 3EMCA 2FGZA 3PZTA 4UQDA 2XIIA 2EO7A 4W88A 1KXHA 1LG2A 2CETA 2QMJA 1UWUA 4EE9A 3WD0A 3GNPA 4TTGA 3ARWA 2DIJA 1TA3A 2F8QA 2J25A 4M29A 5HPOA 4XZBA 4BQ4A 5BYWA 1HX0A 4BA0A 5FOOA 1MW0A 5DT7A 1NWUA 3WENA 1P6WA 4Q7NA 1W3HA 3WNKA 3ZR6A 5HNNA 3QHMA 4YHEA 2O9TA 1UH2A 3AFBA 3VGDA 2EPMX 1J0HA 1GW1A 4OUEA 2GVYA 3VD3A 3WNNA 4J3WA 5FKYA 2UY2A 4UQCA 2VZUA 2QHAA 4HOXA 1CGVA 5HXMA 2ZXQA 3WF0A 3PZIA 3A6OA 1OM0A 2DIEA 1EQCA 3MKKA 1JZ2A 2WKLA 1OGGA 1UA3A 2Y2WA 4TX8A 2ZOXA 5BCAA 1F4AA 1H41A 2BY3A 1IZKA 4HZ8A 3AMCA 2XGIA 2BFGA 3A4XA 4OOUA 1NP0A 1PEZA 3N11A 2BHUA 2YBTA 4FMVA 2JIWA 4PTWA 3ARQA 1O7AA 2V3EA 4YPJA 1EO7A 5E6ZA 2EPNA 3VGBA 1IZJA 4N42A 4CD5A 5A8PA 1AQ0A 1C92A 2Q8XA 2WMKA 3EDFA 4M82A 1BYDA 1UOKA 1M03A 2YL8A 3U7BA 3S6TA 2QPUA 4ZXOA 1FA2A 1WDRA 3BAJA 1C7TA 2WMFA 3ZM8A 4HZ7A 5BRPA 1ZB5A 5JUVA 3HU7A 3IK2A 1OD0A 1XV8A 1KGWA 5GQBA 4KH2A 2F61A 2WMJA 4AEEA 4MJ2A 2WZEA 2PWGA 4QFUA 4IISA 2PBOA 2PWHA 2DSWA 2YL6A 4PUEA 3LMYA 1F4HA 2VO5A 2W92A 5EFDA 3G6LA 1DWGM 3SCSA 1MYRA 1UWTA 2OYLA 3WIJA 2CPUA 3AMDA 2J8FA 5I5RA 1E15A 1B3VA 3WH7A 2DQXA 4J28A 3ZJ7A 1BVNP 1V3JA 4MB5A 3K8LA 4W93A 1J0ZA 3THDA 1ITCA 1EIBA 3RDKA 5HPCA 3AMKA 1BGGA 4ZFMA 4IPLA 2J47A 3WH9A 9CGTA 5EBAA 3EDJA 2DEPA 3ALFA 3AS1A 4NF7A 1BAGA 1GORA 1OT2A 2XGBA 2ZUNA 3IJ8A 1BQCA 3MSDA 1E0VA 1H4PA 1V3HA 3MMWA 4JAWA 3PZVA 4CN1A 1VFOA 2FGLA 1GOIA 1KQYA 2WCAA 2DSVA 4HP5A 4PBGA 4PMNA 4Z2GA 1JFXA 4ZEPA 1YHTA 3OGSA 2BY0A 1R8LA 3GBEA 1E40A 2G8ZA 1NOFA 4K68A 5A2AA 3NYDA 4N0RA 2WZHA 2XM1A 3QGVA 3AHYA 3WKZA 4W86A 1QBBA 2J7EA 1AMYA 2ZIDA 4URIA 3BH4A 4PN2A 2VT0A 1C90A 1JYWA 1E9LA 4E2OA 3GTNA 2Y5EA 2GDVA 4UQAA 3MU7A 1QNSA 1OWQA 2PWDA 2WC3A 2ZWZA 4JHOA 4U5KA 1FOBA 3FN9A 2XIBA 1LF1A 4X9YA 3FHQA 5A6AA 2EPOA 4P7OA 1H0GA 5DMYA 3AMGA 2WLZA 4AD2A 4GI9A 3WUFA 1B90A 3L4WA 3N17A 2WSPA 1CENA 1Z32X 3PZQA 3NDZA 2X09A 1X6NA 2WZIA 3A47A 3SCWA 5E0FA 3RILA 4TTUA 4PMZA 2VRJA 2JF7A 2ZXBA 3GNRA 1E5NA 1JGIA 4B16A 3VDHA 3WDPP 4PSRA 3ZT7A 2CIPA 2E9BA 3BAXA 3VMNA 1JF5A 1UD3A 2XVNA 3CZGA 1M7XA 2BHZA 4LQ1A 4J3XA 1JIBA 1K9TA 3B9DA 3B9AA 4JFUA 4U3CA 1B3YA 2VJXA 2VX6A 1E6QM 1K9DA 2WWDA 4DM2A 2G4FA 4NI3A 2AAAA 3LPOA 3CHFA 3CHEA 4B9YA 2CKSA 3WEOA 4L4PA 1LL6A 2HVMA 1I1WA 2VCAA 1NOWA 4RE2A 1TA3B 1XYZA 3UG4A 1WAWA 2J74A 4TXEA 1NWSA 4L4OA 3RM9A 3LPFA 4AMCA 1HN1A 4QCFA 1JXKA 2FDMA 5IFTA 4W7UA 4M56A 1GHSA 2OWCA 3VX0A 5JIPA 3OLEA 4GO9A 4W7WA 1G0CA 5A3HA 5JBEA 4H2CA 2VX7A 5KEZA 4YN5A 2J7DA 1UKQA 2BVTA 4ACYA 5A6BD 3ZSTA 2RGMA 5DO8A 1V0MA 5F7UA 3L4UA 2GJXB 2OLHA 1VF8A 4WSKA 4D6HA 4ZENA 4HOWA 4F79A 3SCTA 3CTTA 1E43A 1LQ0A 4ATDA 4MNKA 1G1YA 1RP9A 3EDEA 3VGHA 2VTFA 1E71M 2Z1SA 5D9OA 1H1NA 3MS8A 3VGGA 2CHNA 1BTCA 3WQ5A 4Z2LA 1BG9A 3VM7A 4MAVA 3VGFA 4EAMA 3U57A 5FL0A 4NRSA 7TAAA 3CUJA 1OB0A 1JZ5A 3CUHA 5E6YA 2J77A 4CD6A 1JZ6A 1N82A 2GFTA 5M03A 2VRKA 4UZSA 1U33A 1EO5A 1UQZA 1PZ2A 4PSPA 4E4PA 1L8NA 3BMWA 1X1NA 3WH5A 2X2YA 3RJYA 4AW7A 1ECEA 4WLCA 2QV4A 1C8QA 1GQIA 3T2PA 1GQKA 2XSAA 2XPKA 3OLGA 2GK1A 4D6FA 4GZEA 3S2CA 4F8XA 4P8UA 1E55A 3U7VA 4D6IA 5ABHA 4C7FA 3ECQA 2C8NA
chains in the Genus database with same CATH superfamily
1O1HA 1QCWA 2PF8A 1GYLA 1E72M 4HKPA 4PCNA 4DLMA 4AIEA 3IJ6A 4IIDA 3S83A 1LQ2A 2EAWA 4QNWA 1JPMA 2F7FA 3SFWA 3KWXA 2NQZA 3W7KA 3W22A 3N2BA 5HMEA 1SU5A 2CWXA 1XX1A 2X1IA 1NELA 3DECA 1QNRA 1A0DA 2WMGA 2HPMA 2PP3A 2Y5JA 2BVWA 3GH5A 3SUWA 2R1PA 4GX9A 1L2QA 3QM3A 3O15A 4FNPA 5IM51 1Z6KA 4WSHA 3KS6A 5AOUA 1VRXA 1R86A 2AQWA 4O0QA 1GVFA 3PM6A 3AIBA 3E02A 4GIYA 2QLYA 2X1RA 1RQHA 1E0TA 3WQCA 4PUNA 4DLFA 1TTJA 4GI4A 3GVWA 2G3FA 4Z1CA 1VB9A 4ICMA 3NOYA 3AJXA 1C9WA 2OX4A 2J78A 1H1YA 1EJVC 3Q65A 2Q01A 3EDDA 3UZ5A 2HBVA 1Q7QA 3IJ7A 1CXIA 3I3DA 1LLOA 4W8LA 2H3DA 2ZCGA 4G8TA 1E9ZB 1GOMA 4JTGA 4NJGA 3VKBA 1H2JA 1IR1A 1T0OA 2PZNA 3JS3A 3EWWA 1GOOA 1P0EA 4PC8A 3PS7A 4S3GA 2YXOA 4YNGA 4W84A 4OT7A 3LCXA 3CZKA 1RZMA 3N73A 1V6UA 2YA1A 3ELFA 3TN6A 3LUTA 3QHOA 1JDCA 2VHLA 2E77A 4P7LA 5I78A 3ATZA 4J3TA 3MO4A 3LGEA 3M5XA 5HDRA 4JQAA 3SW6A 4NAFA 2WJFA 2WCGA 3IK4A 4NNBA 3DHDA 4DO4A 4OE7A 4HNOA 3BMXA 1QW8A 5LIKX 1LL7A 3QLLA 4R9XA 1HT6A 1J2BA 4D6JA 4G5DA 2DJXA 1UR3M 1I2PA 4O14A 1U30A 4FF7A 1YPFA 4A29A 3WMCA 3DBNA 4ERAA 2W62A 3PZUA 4Q8PA 4U5IA 5DQPA 1GZ1A 1FCQA 1B1YA 3H26A 1S46A 4LTSA 4TX6A 3CZLA 3PBUA 4N6EA 5A69A 1DORA 2VR4A 1UD6A 1M68A 2BSLA 3KRSA 1KFKA 1XYFA 3W24A 3VKDA 3VD4A 3WQ4A 1KRAC 4M81A 4E4UA 4HOZA 3C4UA 1XD0A 1J6OA 2QCNA 2W66A 4MNJA 3WD4A 4R53A 3O63A 4WOZA 3LV6A 4LPCA 2YLAA 3G0XA 1TCDA 1UR2A 1JQVA 4LXFA 1WBJA 1UP0A 4XZIA 3W7EA 1OFOA 2VZSA 1C91A 2G37A 4GNJA 1KNWA 4NYYA 5ABTA 2J9XA 1WKDA 3HGJA 2QCCA 3PZNA 1W1TA 5AVNA 4H83A 3VNJA 5F4SA 4W4QA 4MDOA 4HHHA 2ATSA 5AHEA 2ZRUA 3TN5A 4JBRA 1KM2A 2QCLA 1CX9A 4Q7IA 3LCIA 2Z1KA 4MMWA 3W1LA 1S5VA 3ITLA 4RZ4A 1WKFA 1OFAA 1QJWA 2GOUA 3AYSA 1CBGA 3DH7A 4FNQA 4LVAA 4BEQA 1OCJA 3AHXA 1JUBA 1EDQA 3T0BA 3AWNA 3I68A 1PIFA 3SN0A 1OFBA 1EJSC 2I56A 4J27A 1JPKA 4QITA 2P10A 3OYZA 5FIPA 3V5FA 1NVMA 1IT7A 5B80A 5SWUA 4R34A 5KZ6A 1OFRA 1VBUA 1L6WA 4DF1A 3C0JA 1XUUA 3QY6A 1JCXA 2BGSA 1GTHA 1HJSA 1T8XA 2QGHA 3WN6A 5CG0A 1LRTA 3INPA 4BZYA 2VGBA 4JIIX 4MHBA 1T7LA 4GBDA 5CZSA 2OLAA 2PDQA 1I6NA 1Y5WA 2ZXDA 3XISA 4QDMA 2VVSA 4TUFA 2ZC1A 1DIKA 1JD7A 1S1RA 1OX6A 2O4MA 1VIZA 4K37A 2GK1B 1RH9A 2VD9A 4GACA 3A4WA 3BAYA 4UCGA 3NQMA 4C7DA 2V63A 1HKVA 5U7SA 3QY8A 3AXXA 2VEFA 5C2CA 4XQ6A 4IT1A 3WLIA 5I79A 1MQQA 1IXNA 3SGGA 3CGTA 3W0KA 1KTNA 3S5YA 4IQDA 3C61A 4GQGA 1M01A 1ODUA 3JRKA 4XKMA 3MUY1 5CQ1A 3STEA 5I2UA 3GXMA 3GDRA 1HUVA 4H6QA 3CMFA 4PFHA 3L68A 2ZRWA 4I7VA 1Y5XA 4Q33A 1PHWA 1HG3A 5ABEA 4ASTA 1JPDX 2XSXA 3NIYA 2Y7DA 1QNPA 3NCOA 2QPSA 1EJWC 4KCVA 2E5CA 4L6DA 4GPNA 5A6TC 1DQUA 2YBVA 4GQQA 3RAOA 4LANA 4LY8A 5ABGA 2GDQA 1Q6CA 2Z29A 3S8HA 1EBHA 4DJDA 3FX4A 1KM6A 5A8NA 4XISA 4O19A 1FCVA 4DJEC 3N2TA 1IEQA 3WZ0E 2NV1A 2Q09A 1XLCA 3PUOA 4TR9A 1H5VA 1XINA 1KKOA 4BWLC 2QAFA 1R5YA 2FTPA 4HA3A 3WL1A 2C79A 4O10A 5E0CA 3S1VA 1O6IA 3EOOA 3CUGA 3WNOA 4IP5A 1SMAA 1QOXA 3MCOA 2V3DA 1PYFA 3QPYA 1HO1A 4JTTA 4EIVA 4KEVA 4DO5A 4GQRA 3UA3A 2PPGA 3EX2A 3QF0A 3MMTA 3GAYA 4KGLA 2PDPA 3L7RA 2YCIX 2WWCA 2GQ8A 3S2MA 1LOQA 2YPIA 1YXCA 3PHAA 2GYIA 1EJUC 5D33A 1V0NA 4JTJA 2Z7GA 4B92A 4ICCX 4F3HA 2VC5A 1VFFA 2W61A 2HEJA 3I3BA 3GIPA 1EJTC 2XFRA 1W1A1 1P4CA 3IANA 1JVNA 4XB3A 4OFCA 4Q4MA 2CXGA 1FDZA 1NIUA 4A35A 4BEUA 3QR3A 1US3A 3N6QA 1KKRA 1W1B1 2NT0A 4IL0A 3TTYA 2PBGA 4IOTA 3RCMA 2F9RA 1V3LA 1XBXA 1HKMA 3L4VA 4CVUA 2C6QA 2INZA 2YSWA 4ATLA 3NWRA 4FOUA 1RQEA 3W86A 2WZMA 8XIMA 4YVPA 1EP2A 2E40A 5F2MA 4KBXA 1DTUA 4IMGA 3CK5A 3AALA 5HMSA 4JTSA 1V0LA 1B0IA 1OYCA 3GIYA 3I4KA 3KHJA 2HPIA 4GY7A 1SZFA 3PK7A 2Y8VA 4IMEA 4Y9AA 3PSWA 4LF2A 4B5TA 4MKVA 2QR6A 3HG3A 3ZOAA 1H49A 2XG9A 2Z7KA 4LEFA 1U5JA 5G1YA 4C6BA 3KRUA 3HF3A 3VD7A 1IWAA 2OQYA 3AAMA 3PG9A 1QRQA 1H60A 1K9EA 4B91A 3MUZ1 5DF0A 3E0LA 1JULA 1W3KA 3E1F1 2Z25A 2H3BA 1ADOA 3ORWA 4JTCA 5HWNA 4IIGA 4H2HA 4XZHA 2OU4A 3MCMA 5LIUX 1H51A 1XIMA 1A5AA 3FJ6A 5KITA 1EOKA 3FK4A 3QFWA 1JZ3A 1V51A 4F2UA 1UYQA 5CC6A 1AJ2A 9RUBA 1BYBA 3GDBA 3IACA 4RNHA 2A3HA 3SSJA 1JZ4A 4WZHA 1UD2A 3BZJA 4LUJA 4N02A 4EF8A 2PUZA 3FNDA 1NFBA 4H9VA 1XGEA 3ENLA 4FR1A 3UWQA 4AZBA 4GI6A 4F40A 1JF6A 2DPEA 4R33A 3LM7A 3M43A 1GOXA 4Y90A 4FLOA 3BQ6A 2VR2A 2QJMA 3UJ2A 3T55A 3EEZA 3JVAA 3QZEA 3EOUA 1BVZA 3HJZA 4HBKA 4CEXC 2EEXA 2IKIA 2OT0A 1Q7MA 3MQTA 1FWCC 4R27A 3GVQA 4J7RA 4MWAB 3GR7A 4UTTC 1RUSA 1IXQA 1C29A 4XSLA 3EWXA 4WGHA 2GZXA 3VIPA 1W0MA 5AYXA 4MKNA 3UJEA 3ZLHA 3DU0A 1H7XA 3KDNA 1V7YA 2ZZ6A 1EBGA 1NARA 4W7VA 5A6BA 4NJHA 3W27A 4JFSA 1EWDA 1R3QA 3BLPX 1LZOA 1K4HA 2F6XA 4D71A 2QCHA 2ZVRA 2NV9A 4X61A 3AS3A 3EKLA 3LLDA 5AYIA 1VHNA 1GVEA 1K8CA 1QI0A 2G4JA 3H7RA 4LT9A 3OG3A 4IPPA 2IKGA 4GO8A 4PEEA 3TR2A 4BK9A 1JZ8A 1JCTA 6TIMA 1TWWA 4PMXA 1T41A 3B4YA 3AIQA 2VFIA 3B0UX 4KS0A 4C6CA 4RZ6A 1VCVA 3B03A 3C2RA 2Y70A 1W56A 4POCA 3QOKA 1UROA 1D7FA 1J0KA 4PMRA 1VPYA 4GUIA 5LNUA 3NR0A 4C6OA 1XLFA 2WPBA 1WOBA 3BW3A 3PPGA 1IV8A 1DIDA 1V7AA 1HL9A 2QZRA 1S3TC 4FO4A 5C71A 2ZRVA 2ACQA 3QW4B 2ISFA 1OFQA 3P5ZA 4X2RA 2INFA 8A3HA 3C3UA 4LS0A 2VC7A 2OZ8A 1WQ5A 2OZ3A 4JN8A 4D9PA 4KKXA 3RNDA 4QIUA 2W91A 1Q6RA 1B3WA 3SCVA 4I5RA 3OODA 4HYWA 1UD8A 1J0YA 3VCCA 1BWKA 5B7YA 3E96A 3BWWA 3A4AA 4L61A 1SW3A 1N8FA 2YZRA 5K3VA 2V5CA 1W9DM 4NKCA 3TCEA 2TYSA 2A3EA 4F66A 3PPHA 2B7NA 4OGZA 4O57A 3T05A 3GTHA 3OBAA 5CBIA 1M6JA 4NIRA 2X16A 2WC4A 1QW7A 2KZHA 3W83A 3W25A 2CLIA 1XLHA 3NL2A 2RKXA 5CSSA 4GJ1A 1KRMA 3H12A 3T0TA 5D37A 2OZ0A 1YQ2A 3PVFA 4XD3A 1JCLA 3ZWSA 3CQIA 5LKYA 1PTAA 3OGVA 3HV9A 1XHGA 1IGSA 4ZXLA 5I77A 2WVVB 1YE6A 2XTKA 3DBPA 4IP7A 3S1GA 1FHDA 4AZ7A 4L9XA 4PMJA 2FZBA 1XSKA 5I24A 5D02A 1NWRA 3S2JA 5FACA 3VDCA 3W76A 1PPIA 4KEMA 3BGAA 2PLMA 3VIKA 2V3FA 3QZ6A 1OX4A 3GLCA 1GZJA 5FJOA 3SB0A 4H9UA 1XRTA 1V6XA 3AU2A 4AD3A 2HVOA 1O5XA 4HA0A 4DZHA 3P82A 3ARSA 1Y0EA 3UR7A 3IJ9A 3WLNA 3WD2A 1VD6A 3G24A 2Y7GA 2GDUA 3PB2A 2TPSA 3TJ4A 3EMZA 1R0MA 2RDTA 4OWGA 4Q8NA 1ZGDA 1LBLA 3CO4A 3OGRA 1OJXA 6XIAA 5BOFA 1YTDA 1DQXA 4ZCWA 4ACZA 3C2OA 3CMJA 3KCJA 1EEPA 4E4FA 4O4WA 2VQUA 3L2MA 4CD8A 4GQ0A 4EK7A 1GEQA 4DVOA 2Z6IA 1RP8A 5G2WA 1TB3A 4GFSA 3TROA 1KBIA 3SAZA 4DBUA 4O11A 1KGUA 3N13A 5CJ5A 3NJ3A 4UUIA 1HIZA 3VKJA 3MYPA 1K7XA 3R2GA 3HBLA 5D2XA 2CLMA 5L6UA 4A2RA 1MVYA 3O0FA 1LBFA 4CCZA 2KAUC 2XJ7A 2DUXA 1JJKA 2NQ5A 3H2MA 3TJXA 5T91A 2PWEA 2MNRA 3VIMA 3P8IA 4FLQA 2VX4A 1UG6A 5E5CA 2FB3A 1B54A 1E1CA 3BLEA 1UKSA 1XFBA 3H4XA 5I09A 2PLJA 3CMGA 4HSNA 4HSOA 5KETA 1O5KA 5GJPA 3T4CA 4GUJA 1WNOA 2RHGA 1CGWA 4LYQA 3OHIA 4R88A 1JYVA 2QVNA 4XO6A 1W2PA 4Y9MA 3IGXA 2WC7A 3E5PA 4JX6A 4PMVA 2W4XA 4GISA 1A4LA 2EKCA 1IEVA 4M7TA 1PIIA 4R85A 4J2PA 4PTDA 1FWSA 1BG4A 3GU2A 4V27A 4GINA 5G5IA 2YFNA 4H1ZA 3OA3A 1UCWA 1MUCA 2PDMA 1ME7A 1L0PA 3FXGA 2B31A 2O9RA 3EDKA 4DRSA 4AVOA 2BOFX 4Q8VA 1KWGA 3B8TA 1VFMA 2VYOA 2CLPA 5CLWA 1DWFM 3AIEA 4YCOA 3L4XA 4JPGA 4IQEA 4CCCA 4QDPA 5EA9A 4J9JA 1H09A 1CB2A 4RXGA 4ZZ9A 4ZQNA 2ZICA 2C1HA 5CJMA 4C1NA 3GHTA 4ROQA 3ZJKA 2AKZA 1O1ZA 4H8UA 4L9YA 4OU1A 1OC6A 3M5ZA 3WLHA 2HXTA 1X39A 2J7GA 4NAFB 2XIOA 4KWVA 5M2FX 1XRSA 1E1EA 3WF4A 2XVPA 2RDWA 2VEPA 3NZ1A 1XJBA 4G9PA 4F2TA 2Y1HA 2ABBA 3ZT6A 4Y8FA 5LA0A 1DXIA 3WDRA 5EMJA 3V18A 2XZ7A 3EZ4A 2YCLA 2Z2BA 1ESWA 1CZ1A 3PUGA 4O0KA 3AIUA 4QG6A 1MWOA 2J7BA 1GOWA 5I3DA 2VGFA 1W5NA 2CLHA 3ABZA 3TW7A 1QI4A 7ENLA 1R47A 3F5JA 3LZ3A 4NG3A 1PE1A 2D73A 1PKYA 3E0IA 4ONVA 4ZL1A 3AHZA 4N6FA 1BQGA 3N15A 1IE7C 2IQ0A 2CBVA 4TV6A 1V3IA 3AYVA 4KF1A 2REQA 2FH6A 1A0CA 4AZGA 1M7JA 5HBFA 3YPIA 1Q8JA 2YA0A 1C9DA 2ASHA 1R46A 3NDYA 4QX4A 2I9UA 1L6FA 3AZSA 3DX5A 2DZXA 3FSTA 2PDIA 4JTEA 4LFYA 2GSHA 1S2AA 3LYEA 1NH6A 5A6KA 2DH3A 1TMQA 3CWHA 3ZLGA 3L0NA 2O0TA 2FZ8A 4PMUA 3N34A 4YWIA 3VGEA 5TD4A 1TVNA 2Y8KA 5BWFA 1W9BM 4XZMX 1HGYA 3SUUA 3WLMA 2UBPC 3GXDA 3NXLA 3D3FA 2EF9A 3DKJA 2PRHA 2FZMA 2ZX8A 3GXPA 4Z2HA 5CSRA 1CTNA 4O54A 3ARZA 1ZS2A 3AICA 3D6NA 3KOXA 1ZJIA 1F6KA 5K4XA 5FSDC 5FEWA 3UEQA 2XN1A 4E2BA 1LRQA 2A4AA 5JQ9A 2A1YA 2VCCA 4JTHA 3BCFA 4Q32A 1PJ9A 3N29A 3ARYA 1LLZA 3IEBA 3O8AA 2CFFA 4ES4A 3B40A 3M6YA 3SRHA 3W7GA 4PCFA 4UCFA 5KMYA 1XLLA 2P0IA 2J79A 1GVYA 2VVNA 4M80A 4FB7A 2ESCA 3KOFA 4HPHA 3R94A 1BVWA 3RGTA 4A6GA 2YW3A 3LQLA 1DJIA 3UBPC 1PZ1A 1QPOA 2ZX9A 1LLWA 2NVDA 1EGVA 2ZWYA 1VENA 1HTIA 3MHUA 3FGCA 2V5KA 1FH8A 3RHGA 4KFNA 1H7WA 2IPJA 3LERA 1YLVA 4IUGA 3IVTA 3LHUA 3HFYA 4JN7A 3PZTA 2F6KA 2XIIA 2OZTA 4PB3A 1KXHA 3S46A 2QW5A 4QS5A 1LG2A 2CETA 1EA0A 2PC4A 4J1OA 3WD0A 4TTGA 5HUPA 5HPOA 1FWAC 4C90A 4BA0A 1VBHA 4KCWA 2CZEA 1XCFA 4DXXA 3W1RA 1UIOA 3ZR6A 4H6EA 2B0MA 2O9TA 3VGDA 5I3HA 4KESA 3R8HA 3VD3A 4J3WA 5FKYA 2UY2A 2V5LA 4UQCA 4HOXA 4ZGYA 3ZYZA 2ZXQA 1OM0A 2NSOA 3MHGA 1EQCA 4LAMA 1EEXA 1JZ2A 2WKLA 2ACUA 1W3IA 2ZOXA 3P2VA 5BCAA 4DBWA 1VBJA 1F4AA 1H41A 4HZ8A 2XGIA 4AY8A 1PEZA 4PTWA 1KFJA 3N2MA 4HB7A 3EPMA 1DBTA 4YPJA 2QYGA 3LRMA 5BOOA 2QT3A 1IZJA 3LEPA 3U7BA 3S6TA 1W6TA 4JQ1A 3GDTA 3ZM8A 2WMFA 4O1CA 1PUDA 5GQBA 4KH2A 2WMJA 2PWGA 3WLQA 4QFUA 1TPDA 1EWEA 2YL6A 3M44A 2W92A 4HNUA 5IOBA 1DWGM 3SCSA 1TPUA 2CPUA 4WD0A 3FYYA 4IJRA 3WH7A 5G2HA 1V4YA 1S2WA 3ZJ7A 5EU9A 4ADSA 3THDA 1EIBA 1EUAA 3NZGA 4DYEA 2J8TA 1BGGA 3UWEA 1ZUAX 1KV5A 3V5CA 3BSMA 9CGTA 3N6JA 1TQJA 5CH9A 2VFDA 4MZYA 2BGNE 3IUHA 1GORA 1OT2A 1BKHA 1BQCA 1DYSA 3MSDA 3UYCA 3PZVA 4CN1A 3OBEA 1XG4A 5H91A 2PDJA 2QGYA 1IQ8A 3QV6A 5A8GA 1GTEA 4ZEPA 4OHQA 4L9ZA 4FALA 1QDSA 4XTIA 5A2AA 3NYDA 2WZHA 3PG8A 2ZIDA 3K13A 4FX8A 5H8MA 3T8QA 5G4EA 4AWTA 4DAIA 1ZFJA 2VT0A 4N4PA 1JYWA 3G1RA 3TAOA 4E2OA 3CT7A 4S3DA 3MU7A 3CQKA 2PWDA 1OWQA 2WC3A 2Y89A 4LVFA 2Z24A 1KM5A 5FJJA 1FOBA 2ZQ0A 2V8ZA 3OVQA 2OODA 4UTJA 2Z00A 3FHQA 1J5TA 1Z41A 2WLZA 5HMDA 4AD2A 4GI9A 3WUFA 1TUFA 2WSPA 3QRHA 1CENA 1A53A 2X09A 1X6NA 3SCWA 3QQ1A 3EB4A 2ZXBA 3QGAC 3VDHA 5DMMA 4ZQCA 3R6IA 1I2RA 3G0UA 3TE9A 2CIPA 3TAKA 1VCGA 2VC6A 2XVNA 3CZGA 4N7QA 2ISSA 3ABQA 3TYDA 2DZUA 1L6GA 1X97A 3TW9A 1K9DA 4DM2A 2DORA 3SR7A 3MBDA 3GRIA 3KBJA 4KPLA 3EPOA 4M1BA 5CGQA 2QDGA 3UG4A 1WAWA 2J74A 4NQ1A 2HCVA 4IIFA 3RM9A 4LAKA 1F6PA 4DX3A 1JXKA 3QBUA 2F6UA 2OEMA 4M56A 4O12A 5KTLA 2JQXA 3T6CA 1GHSA 4DJED 4W7WA 3C3NA 2BWGA 3W73A 3W7OA 5JBEA 4H2CA 3H7UA 5KEZA 1SR9A 4ACYA 3L65A 3ME3A 5D2YA 3AXMA 5C9UA 3KHDA 1BF6A 3LBOA 1VFSA 3HQOA 3IIZA 3L4UA 3UWVA 5J5DA 2DZVA 3HFTA 4AHQA 3S9YA 1LUCB 3ZVHB 3RX3A 3TYZA 1Z69A 3GU1A 1B9BA 5FESA 2Z1BA 3NQEA 2FIQA 4ATDA 1RP9A 3EDEA 3W88A 4S1FA 1Y5VA 3VAVA 3GXTA 1D8CA 4IJBA 3VGGA 1A5KC 2PDYA 3L9CA 1BTCA 2GVLA 2G96A 3FEMA 4I8YA 1BG9A 3VM7A 3GHUA 4G2DA 3BPWA 4IG2A 4O1AA 4PUMA 3TSMA 3UF9A 3KLLA 3G2GA 1OFDA 1XLGA 1JZ6A 3B4UA 3CV6A 3Q2DA 4ZR8A 3K4WA 1CW2A 3EX3A 1PZ2A 4E4PA 3VABA 3LI0A 3WH5A 2X2YA 1TIWA 3RJYA 2CLLA 4B2DD 5I3IA 4WLCA 2ATMA 2RJGA 3T2PA 2B7QA 3UVIA 2XSAA 3MT1A 5AVHA 2PE4A 4M0XA 3STCA 1YNPA 2F84A 1GK8A 2C3ZA 1DJWA 3M9YA 3HQ1A 2D2GA 3V0SA 2C8NA 3A12A 5LYRA 4C6LA 5BXRA 3ARUA 4ML4A 2CLFA 1SM9A 5C7VA 1OGSA 2V6AA 4I9MA 4GGBA 3OHMB 4JTLA 4PRRA 3WFLA 1H0IA 3IVSA 4CQDA 1H11A 1T6MA 2WHMA 4DZ5A 3AIWA 1EL3A 3DERA 5EMYA 4EXBA 1HJVA 1ZRQA 4ENLA 2O7SA 3LHWA 1K70A 1QFEA 3C86A 2ZYFA 3MVTA 4ZQOA 2VEKA 3PJXA 4CEUC 2IS7A 4O52A 1EX1A 4PB4A 3RPMA 2CWNA 4LGXA 1GWJA 1R2SA 2DT1A 3SN4A 1E3ZA 3WH8A 2E6AA 3PFRA 3MV01 4KFPA 3AUOA 3W71A 4IIBA 5JH1A 5MF5A 4HK7A 5AECA 4B9ZA 3EWZA 4JIRA 1DJNA 4JHMA 3BDKA 3T2QA 3JZEA 3NFUA 3WL0A 1K8YA 5C9ZA 1QASA 1BD0A 5LXEA 4UTWA 1ZQ5A 1JI2A 2POTA 1R9XA 4F0KA 3IPWA 4XUYA 3MO7A 4IM4A 3FYOA 5E70A 2C1GA 2BX7A 4LNYA 3D5HA 3VVGA 4GH3A 2WJEA 4GKLA 4W87A 4S23A 5EB8A 2FZNA 4D8AA 3RX2A 3EAUA 5REQA 4HT3A 1JAEA 3WUBA 4MSSA 5DMLA 3BLOA 2YDRA 4ZE5A 4H04A 4UTIA 4H41A 1TR1A 3N9KA 3O16A 5ABFA 1I8JA 3SCOA 1XLMA 4WDWA 1NU5A 3IJDA 4IICA 3ZZ1A 1QI5A 1W9UA 4PR4A 1LROA 1XSIA 2QDDA 1EP1A 1B3ZA 2CERA 5DLCA 3TVAA 4C6DA 3U9IA 3W2LA 5F2GA 1JNEA 1BKSA 1ZP3A 3OZMA 3KBNA 4NP7A 1HL2A 4O53A 1DJZA 6ENLA 1S2TA 3M1ZA 5H6HA 3W9ZA 3HM7A 3IGHX 3P74A 1E6ZA 3D3AA 3Q37A 1VRDA 1JD9A 1UZ4A 2W63A 3LXAA 4Q8OA 4UC5A 2Z26A 3MUCA 1XDMA 4WEVX 4ACZB 2BASA 2FJUB 3HJEA 1MQPA 3L4TA 4DWSD 4RL3A 2HK0A 3ARTA 4GZJA 4HTBA 1XIDA 4QHRA 1X98A 5E1QA 1V02A 2WCSA 4WDUA 2R14A 1E6RA 2EG7A 1UZ1A 1JL8A 1GJUA 1UH3A 2DT3A 1RY8A 3M5YA 2WV8A 2GWNA 2E67A 4G7EA 2Q6ZA 5D03A 4HD5A 4TVCA 5LIWX 2NXGA 2XU2A 1VEPA 3V1PA 1XLAA 5DN1A 4CU6A 1JRBA 3THQA 1SO6A 3MP5A 3Q58A 3STFA 4QJ5B 2WMIA 2JKAA 5GNZA 4WGXA 1HQTA 1ZBWA 1F05A 1XISA 4X22A 4KGJA 1H7OA 3NQDA 2PC8A 3WNMA 5XINA 2PMQA 1ZENA 5LIYX 5CZKA 3O1NA 1TJ0A 3W28A 5AC5A 3VNYA 1W3LA 3D0CA 1MRAA 1XH2A 2XH4A 2DP3A 3WF1A 5I00A 1FP8A 3F2DA 1XIFA 2JF6A 3K1DA 3TC3A 4AC7C 5I3JA 7CGTA 1I2OA 1MQRA 1XDLA 3DI0A 4IZGA 3MC5A 3G8EA 3N6HA 1MXGA 5EMLA 1XGZA 3DAQA 2HROA 4W8AA 3UGRA 1Q4NX 2CYGA 4RX0A 3LTSA 3F1QA 4MZ8A 2F2HA 6REQA 2J7CA 1ZL1A 2Y24A 2PWFA 1XYLA 3KS5A 1TJPA 3QKZA 4QLKA 3POHA 5D9NA 3W1UA 4C6JA 4INFA 4J5NA 4J3SA 2Z0IA 1D2KA 2I14A 3DG7A 2QJGA 3EWDA 2BOGX 3PNZA 4UOJA 2FPYA 2QCEA 1V0KA 3QOMA 2WNZA 4RE3A 4LUTA 2CW6A 2AGTA 4U10A 1S3HA 5JBDA 1A5MC 4GBUA 5LNVA 6CGTA 1O5QA 1J2WA 3MKVA 1QI3A 3Q67A 4K1WA 3UESA 1AL7A 2HDJA 4Z0JA 5GNYA 2CBJA 4AWUA 1DJYA 4RCXA 1AA1B 2DT2A 2E25A 4S3KA 1FDJA 4B5UA 2WSKA 2POZA 3IIXA 3TYAA 2VDGA 5T9BG 3SIMA 1P7TA 3TC7A 5H8PA 4KMQA 4P7NA 3WJXA 1LWHA 3WH6A 3H55A 3NDOA 3SUSA 1A80A 1BYAA 1R6WA 1VPQA 3TJLA 1M7PA 3CB8A 3M0VA 1FRBA 2ZX5A 5GVJA 3NGFA 1TWDA 1DJGA 3BUVA 4RZBA 4YTTA 1T96A 4QTGA 3WMBA 1KO0A 1RD6A 1HKKA 3IGSA 4HHLA 3ATYA 1QUMA 3KVMA 2D0HA 2ZZ7A 1J0IA 2MANA 2R8WA 2V9DA 3L67A 3NNTA 4XD5A 5BZAA 4RDYA 1XQLA 3ITGA 4JX4A 4GZIA 1GONA 2I9EA 5LNSA 1J79A 1MEWA 2J66A 2W6RA 1NQ6A 2A6LA 1S2UA 4IQLA 3HA1A 1XLEA 3WCZA 4H19A 1JYNA 4XKYA 3E0WA 1NDWA 5BROA 4I6KA 3A64A 4FF5A 2FDSA 1D3GA 3WQPA 4FX7A 1HJUA 2G0WA 3CNYA 1W8GA 1CLKA 4NZ3A 4LUSA 1J9YA 1TRIA 1XI3A 3VNZA 4GX8A 3WF3A 4XX6A 3PANA 3WBXA 3R1ZA 4F4RA 4MFEA 4FPSA 1XPGA 3WBEA 1EOMA 4HYVA 4QM1A 4I6VA 1AQMA 2WSYA 5EMUA 3WD1A 4M7SA 3K4DA 4QP0A 3JUGA 1J12A 4N2YA 1QHZA 2PZ0A 1PZ0A 2VZOA 1QVBA 2UY4A 3WEZA 3SBFA 4Z2KA 4R7WA 3FXYA 1TZ9A 4HNNA 3VIHA 1P1XA 3W01A 3EGJA 4K6AA 4US5A 1W1YA 4P8XA 4F0SA 5MKGB 1V08A 4A3QA 3QN3A 2Q02A 3QPEA 4AIBA 4DO7A 2A21A 5F1VA 1RA0A 2CITA 1B57A 3OZPA 4TOQA 1E5JA 1FXPA 5DELA 2DZTA 3E0FA 2YYUA 1K6AA 3VE9A 2FH8A 5F1UA 3BZGA 4DB7A 1NAL1 3IS4A 3GC5A 4DHGA 1ZAHA 4ERGA 3AC0A 3E2QA 3RPDA 3BXWA 1JCNA 2TODA 2NUYA 3RG6A 1LDCA 2Y7FA 4KERA 1RJQA 3GIQA 4FP1A 2AL2B 4NZ1A 3OYXA 4ZOBA 1A0EA 2E09A 2WNWA 2O4QA 3TX9A 1OY0A 4QSHA 2VFEA 3KEHA 5CGTA 4D72A 1A5CA 2YDAA 5IDIA 1YXYA 5A6SA 2XVKA 2R1MA 2YZ5A 1LOSA 3VFCA 1V6WA 2CBUA 5CZTA 1C8YA 2DIKA 3HZ3A 4QR6A 2PGWA 4LAZA 5C7HA 2VP8A 3MMDA 3GHRA 3WDJA 1KW1A 3DHPA 3W6YA 1Z48A 2P3EA 3W37A 3VFLA 2PLKA 5BW6A 4YLWA 2DSZA 3VOIA 4REQA 3KVJA 4DXVA 3M7SA 4GYKA 1K8ZA 3PB0A 3T0DA 4YIWA 2FVKA 2I7GA 2FGBA 5CBBA 4N9EA 2WO5A 5CXPA 3KRZA 4UFHA 1NP2A 4LAUA 3NVTA 4NAEA 1A3WA 4EPBC 3S0CA 4YVXA 2QAPA 4UBPC 4M6UA 2C16A 3FDGA 3LPPA 3GXIA 1MNZA 2VGGA 1TJRA 1TWZA 2ZZ4A 4F0RA 2NXIA 4CUCA 1J4EA 1LT7A 4UFKA 2X2GA 3W26A 3I10A 3RCNA 3MA8A 3GVGA 4GNVA 4H9MA 4IF2A 3W7JA 1KBBA 4V1YA 3DFSA 1DWIM 2Y63A 3W1XA 4I8DA 3C0SA 2H9AA 5BU9A 1YPXA 4B5WA 2GL5A 3KRBA 3W82A 3SN1A 4IGHA 3PAOA 4V2XA 3D47A 2Y61A 2RFGA 3WMSA 4H6RA 1H7NA 3MMUA 4AG0A 3E3HA 4AEFA 3WQOA 1WOAA 4RPQA 3USBA 1KLYA 4CVWA 1ZNNA 1BLIA 1OG0A 1C7SA 1FWGC 1PX4A 2PP0A 3C0QA 4AUBA 3GQYA 3EOSA 2QUTA 3SQLA 3R0KA 4I5XA 4RNJA 4AIOA 3QFEA 5BOEA 4C7GA 5BRQA 1E73M 3B06A 4EP8C 3HURA 5IFPA 3HV8A 4H01A 3GH4A 3M7WA 5DCBA 1Q45A 3RX4A 5HNRA 1CGTA 1H62A 1Q6EA 3TA6A 2BG5A 3APGA 1FX6A 1J01A 4TVDA 3N18A 5HQMA 4Q4SA 1U1JA 3VE7A 1W17A 2HQAA 3UZYA 1R30A 4FIRA 3MHFA 3VKCA 3ZLFA 1WZMA 3PJWA 3ES8A 1TMLA 4HZ6A 3ARPA 3REQA 3BICA 4F9DA 1E0WA 3CH0A 3M64A 3LGDA 1GPWA 2GGJA 4X9SA 2OYKA 3RITA 3SUTA 4RZ5A 4OJYA 3WQDA 3NZQA 2DGAA 2NV2A 2YDSA 5A8MA 4Y6GA 1GHRA 4R9OA 4DJDD 4OBSA 4CD7A 2XFWA 1DJQA 4JYDA 2YIHA 5AHFA 2ICSA 1NJJA 3WD3A 5EMMA 3R89A 5CPQA 3TTEA 1UUQA 4NSBA 3VD9A 3URAA 4NJKA 1R3TA 3W4RA 3V5OA 1B9ZA 1F61A 4IMDA 3H21A 1TPEA 1Q85A 1UWRA 2WYSA 3TWAA 2MUCA 2L5HA 5E9AA 5I3GA 1F8MA 1E1FA 2A3CA 1TV2A 4U28A 4AZCB 1CXLA 5FEPA 4Q4RA 4JFTA 2NWSA 1B30A 2I57A 4LYKA 2BNJA 4NVTA 1A5LC 1JFHA 5HK4A 3CZ8A 2G3MA 3SQMA 2X1TA 4XIMA 5U4NA 2WHLA 5HJXA 4LYPA 2DVUA 1FH7A 2GJPA 3V0TA 1YADA 3FAWA 3PFMA 1RLCL 2P8CA 3VDBA 4DBDA 4PODA 4ERIA 3G22A 2QKFA 4GGHA 4OV9A 2GUBA 1JXJA 4OV4A 3PJTA 1EXPA 3LHYA 3GZAA 2VFFA 2FHCA 3SJNA 3KLKA 3LM3A 1K6WA 2NUWA 1LL4A 2R1LA 3GK0A 2XHYA 4MPKA 4MB3A 3GYCA 2J13A 1OABA 1Z44A 4UFJA 3RLVA 1WUFA 1XF0A 1TPFA 1MFUA 4Q8MA 2XFYA 4JN6A 1NDYA 1P5BA 4DM1A 1QTWA 5LIXX 4CNTA 1VEMA 1CECA 1OQFA 1VBGA 3DHUA 1SZGA 3O6DA 2X05A 2JIEA 3AI0A 3TNOA 2ZBTA 3WQFA 5TBOA 2J6VA 4Z08A 3ARVA 3EWBX 3CUXA 5KZDA 5FF0A 1GVQA 4JKLA 4UNLA 5I7GA 1SZEA 1FKXA 3OZOA 4HU4A 1IWPA 3EA1A 3STPA 1MUWA 1FCBA 1G69A 5LGZA 2PDBA 4BI5A 3O7UA 2OMAA 3ABSA 2WKGA 3W87A 1JCJA 3S42A 2E6YA 4AIUA 1A50A 1P0KA 4MADA 5CC5A 3HN3A 4GA8A 4UTWC 4JCLA 3VUPA 1P1MA 2V5DA 1UP3A 2A7PA 3S1WA 4QJ3B 1UKOA 1CCWB 3KE0A 4XBKA 4AY1A 1GKRA 4DWSA 3SJ3A 3L23A 3R43A 3T0AA 4H9ZA 2DSUA 3U8GA 3G0SA 2IKHA 4M19A 4C5ZA 7REQA 4GK8A 5A95A 1DKWA 3POCA 2C15A 5CPOA 2BP1A 2DSKA 4L6HA 3H7VA 3UWUA 1GJPA 4IFKB 3MJMA 2V38A 1NFPA 1ZJHA 1LTDA 2OB3A 1UP2A 2J27A 1X6LA 5FD0A 4A3UA 1UR9A 2AOSA 3U2OA 2Y0FA 1ZJAA 1E70M 3CB3A 1ONRA 4LCQA 3ZR4A 3SCNA 4UMBA 1E6SM 4HPXA 5KINA 3AJ7A 3WLJA 4C6EA 2DZSA 4HNCA 1XXXA 1XRVA 4IH3A 3TV8A 3IAPA 4JKMA 4PTMA 3I65A 3TEVA 3NZPA 2VGIA 5C2XA 1NFGA 3OP2A 2NZLA 1FH9A 1M9HA 2WKJA 2HTMA 3UJSA 1HP5A 2O92A 1UD5A 3W23A 4AF0B 1ODZA 1TUXA 1QHPA 4GHRA 4XG1A 3WFAA 1F74A 3FV9A 1CXHA 2OWWA 3EBVA 1OYBA 4QE5A 4E2VA 3PWAA 4C6FA 4B90A 2QJHA 3NQAA 3CHDA 3AZRA 3E5BA 3CIXA 2PEVA 4MJ4A 4TU1A 3KBMA 4X0NA 3A13A 4FXJA 3GHSA 4A8IA 1BRLA 2D20A 3APYA 4WKAA 1A49A 4ML9A 4US6A 3C52A 4CN4A 4JEJA 4DPQA 2YB4A 3PTDA 5A2BA 2PTWA 3W1TA 1VIWA 1A5OC 3XINA 2ZRXA 3VNIA 3ABXA 1SO3A 3RPTA 1FCUA 1GVOA 1ZU8A 4YTSA 5LGXA 5FL1A 1EKOA 4MB1A 1W1IE 3CL6A 4DUXA 4FXFA 3BCJA 3GH7A 4Y7EA 4CQCA 3GM8A 2W3ZA 1WDQA 2PDXA 3CHCA 4ZB0A 3BC9A 3E38A 4AZIA 4JDYA 4JL1A 3BGGA 3W7PA 3BQ5A 4OBTA 4GJIA 1IIHA 2WMIB 1I2NA 1XUZA 3DHFA 3UZWA 1F3WA 2DUAA 2WMHA 5FJUA 3EA3A 5MHBA 2XH2A 2DZWA 4UIOA 2VEIA 5XIMA 1PCWA 3T7VA 1CXEA 3A5VA 4PCSA 4A3HA 1DJXA 1YE4A 5CPSA 3UXAA 1VFHA 1AG1O 1R87A 2FTWA 5M5DA 1GVSA 3VZXA 3B0XA 5DXYA 3TH6A 2BOEX 1BXNA 4W85A 4AY7A 2OKOA 2O9OA 1S38A 5DCDA 3KVKA 4HGXA 2A6NA 4WHBA 3KCOA 1EDTA 4E3TA 1R9YA 5TAOA 1TIMA 3URBA 3EXRA 2J24A 1BSIA 2VX5A 4LC6A 4NZ4A 5DY2A 4LW7A 2ALRA 3BJTA 3DN5A 4HHPA 3UPMA 2TMDA 3IV8A 1HVXA 5KZMA 1KGXA 3LHTA 3E49A 3TXZA 2QVHA 4P5UA 1HL8A 3BSGA 3QV9A 3N2OA 1PAMA 1ZBKA 3ITCA 1MO0A 5AC8A 1WV2A 3GTIA 3UG5A 3DFNA 2CESA 4XTDA 4XV0A 3GG8A 3F4VA 1XLDA 4LOCA 2R82A 1V6TA 1TPVA 3KP0A 3KZSA 3LA4A 3LCFA 2QCDB 3WDHA 1PDYA 2I5QA 2ZUMA 4WIWA 3MUXA 2H8ZA 3NUKA 1UH4A 1SFJA 1D3CA 4IFRA 4W5UA 4OOZA 2IQTA 4O1BA 3PF3A 3VUSA 3GSMA 2E4TA 3TSDA 4DUOA 3HOJA 4MDPA 1YBQB 3CUIA 1EZWA 4NJJA 1TPC1 3B04A 5D30A 1KQZA 1JDEA 2WQDA 5C9XA 3M0HA 1AW5A 1TX2A 4HJFA 5A94A 2A3AA 3HGSA 1XM3A 4L1GA 2P5NA 4IJCA 1XFCA 1OYAA 1QPRA 2WVUA 3KTXA 1SJCA 2FFIA 3EMCA 3EWYA 4M6VA 5C2GA 4UQDA 4RXFA 4K1GA 1XIGA 4Q6JA 3WMLA 5CCZA 2QMJA 1MZHA 4EE9A 3ARWA 2F8QA 3MDWA 3UZXA 4XZBA 4BQ4A 5BYWA 1TPWA 5E0KA 5EMKA 1P6WA 4NZJA 1MEIA 1T99A 4YHEA 3W7HA 1Z42A 2X1SA 1GW1A 4OUEA 2GVYA 2KX9A 3WNNA 1KFLA 1YDVA 1AL8A 2P53A 3WF0A 4ZSTA 2DIEA 3W2KA 3P81A 3MKKA 4JIPA 1GKQA 1YNQA 2ZVIA 4ZO6A 1UA3A 3DCPA 2FLIA 1UBSA 3AMCA 2BFGA 2RDUA 4JTKA 3H23A 1NEYA 1JR1A 4N9CA 5I3FA 3W7QA 1O7AA 1EO7A 3G1AA 3RUBL 2EPNA 3TDFA 5BU6A 3DG6A 2E5DA 4K8HA 2TRSA 2Q8XA 4M82A 2PP1A 1UOKA 2VDHA 2QPUA 2VM8A 4ZXOA 1WDRA 2NLYA 3N2CA 5BRPA 3CQHA 1W1ZA 4DPPA 5H1WA 3G77A 4NILA 1TR9A 1JDFA 4PUEA 8RUCA 2VO5A 2HE5A 2OYLA 5D2VA 1PS9A 4IIEA 1TPB1 3GDMA 3AO0A 1X7FA 1ZY9A 1X8FA 1F07A 2DQXA 1DE6A 1EF2A 1BVNP 4MB5A 1EGMA 1J0ZA 3AWOA 3DOPA 3WK3A 2DVXA 3RFAA 3S9ZA 2CC0A 5HPCA 2RAGA 1IT8A 3T8LA 2XISA 1AW2A 3AMKA 2XN2A 4GABA 4XZLX 3WH9A 2Z27A 1MI3A 4NZFA 3EDJA 4IGMA 5DBTA 2SFPA 3G3MA 2FTYA 3MVIA 2PWVA 1F2JA 2HS6A 4DEFA 4BJHA 2ZC8A 2XGBA 2ZUNA 3OIXA 1ADSA 4TIMA 3CJPA 1E0VA 2EJAA 4H9YA 4O1FA 4JAWA 1PO9A 1UJQA 4D8ZA 3HB9A 1VFOA 4O16A 4Z17A 4GNKB 1KQYA 3QV7A 4LRSA 1W5PA 5EY5A 2PDUA 3A23A 1JFXA 3OGSA 5KZEA 1R8LA 4DZIA 1NOFA 4H3DA 4N0RA 3IJQA 4RPPA 3WKZA 1AMYA 1SO5A 3GY1A 4HQVA 4OECA 3L0KA 4M51A 3LB0A 2Y5EA 3N25A 3QYSA 2QF7A 2ZWZA 4U5KA 3C0LA 3H70A 3FN9A 3TLLA 2PGFA 4Q7BA 4GMEA 2E5BA 1EYWA 3T4WA 2EPOA 4P7OA 5DMYA 3TZNA 3O3RA 1QK0A 1N8WA 3NDZA 4B5NA 5EL1A 5GJMA 2VUNA 2WZIA 3A47A 2AAMA 3LLXA 4XO7A 3RILA 1KA9F 4TTUA 2XN0A 2EG6A 4HK6A 3SRFA 3SO7A 1E5NA 1NTHA 4B16A 1MDLA 1I0BA 4REQB 1E9IA 4C6QA 1XBZA 1ONXA 1EJRC 2E9BA 3HGOA 2ZKMX 2PD5A 3BO9A 2FZDA 5CKSA 1K9TA 3NL6A 4JFUA 4M6QA 4U3CA 3WQEA 1UZDA 3SDOA 3E0VA 2VJXA 1UW9A 5CPMA 2VX6A 4OUIA 3UZZA 4XAGA 3CHFA 4B9YA 3WEOA 1I1WA 1VS1A 2VCAA 3M16A 1XYZA 4JYEA 3F2CA 1S2CA 4AMCA 1HN1A 1KM1A 1EPVA 3LOTA 5M1TA 1HZYA 4P61A 4QE4A 5JIPA 1FXQA 3WLTA 3WX7A 3LNMA 1B4EA 5RUBA 1DXFA 4L1XA 5FJRA 1Y65A 3W00A 2BVTA 4LU0A 4F2BA 2H9AB 1K4GA 1RV8A 4L7ZA 4O8RA 1NDZA 4H8NA 2GJXB 2OLHA 4FA3A 1VF8A 2YB1A 3VCRA 3VK5A 1DJHA 1ONWA 3CEPA 3L5MA 4HOWA 4F79A 3SCTA 3OO2A 3M0KA 1E43A 1LQ0A 2PU1A 1G1YA 3H2NA 2VTFA 4YXGA 1RXOB 1H1NA 3H2CA 1Q3NA 7PTDA 3WQ5A 3TN4A 3BK0A 4MAVA 4TQTA 3UZJA 1EB3A 3BG5A 4ZTYA 3LX9A 4C1KA 4NRSA 7TAAA 1TJ1A 2GGGA 3RLHA 3CUJA 3A5FA 1IXPA 2J77A 4CD6A 2Z2UA 5M03A 3NGJA 2VRKA 4UZSA 4JTAA 4GVGA 1OZQA 2OVLA 1VZWA 1L8NA 1WKEA 1X1NA 4EOUA 3P5YA 4AW7A 3GB6A 4RV8A 1C8QA 4U4MA 2V68A 4DI9A 4UTLA 1GQKA 2XPKA 2GK1A 1RPXA 9XIAA 3PBYA 4F8XA 4D6IA 4AXKA 1TA3B 2PTXA 3UR8A 4XZWA 4J3VA 1GPFA 1MXSA 3IRDA 7A3HA 2H90A 2FPTA 2PDWA 5AFDA 3B9EA 4HZMA 3WJWA 2IW0A 3PWGA 5CSYA 4Z0SA 3TW6A 1M41A 2J7FA 1VYPX 2DZAA 1ZJBA 3W7IA 3DGRA 4O50A 4HU0A 3FVMA 1GUVA 1E0UA 2HNEA 1SMDA 4UFLA 2G3JA 3USZA 3W38A 1ISYA 1QI2A 3GG0A 2GGIA 3RYSA 2ZZ1A 3BJFA 1PDZA 1H5YA 5AN7A 1CWYA 2CLOA 1YDYA 1OCNA 2ZX7A 3S5ZA 9XIMA 2B4GA 3VILA 3W1PA 4HNVA 2ABAA 4ZQPA 4ZTXA 1M53A 4FHAA 1TE1A 3U6WA 2A7NA 5G1MA 1W1PA 7XIMA 3BG3A 4Q4QA 1ZTVA 3VOJA 1KFWA 4LVDA 4QRNA 4OTKA 4GWEA 2VC9A 3T40A 2GJRA 1THFD 3W6MA 3CQ0A 2PU0A 3VYLA 2BGQA 3CPUA 3M0XA 5C0QA 4GYFA 4NASA 3OB8A 3MV11 5D32A 4S2BA 1SJDA 3DFHA 1DHKA 4AWSA 6A3HA 4MPQA 4IX2A 2FJKA 3J7HA 4JY8A 8TIMA 3S5NA 4BKNA 4CQ8A 1BXBA 1FHUA 1UR0A 1NY1A 2HXUA 4V1XA 2FZ9A 5AKQA 1RK5A 1V6VA 1Z7AA 2R1KA 1UWAA 2YX0A 3H2FA 1XR2A 1KBLA 1IEIA 4HCHA 3FHAA 4H7CA 3SQSA 4EKJA 3KTSA 4G7FA 2NLIA 1AJ0A 3CAQA 1V93A 1GT8A 1S39A 4S3EA 4BWLA 4AC1X 4DF0A 3W7MA 5DFAA 3A24A 2C71A 2Z2AA 4PB5A 1K77A 2XINA 4CKQA 4L5ZA 4QAIA 3M41A 4E38A 4H9XA 1L9WA 4MFDA 3CYJA 4B4FA 1W9XA 3V75A 1BEUA 3NQVA 2WB5A 3GNXA 3NQ7A 2JKPA 4J4KA 2QJNA 4GE8A 3AROA 4I9TA 4I90A 1QK2A 5F4XA 3W75A 4FXRA 4HA1A 4AMAA 2OWXA 1PTGA 3KOZA 2CCRA 4WJXA 4DWSC 3BLDA 4YWSA 4PUDA 2ZX6A 5G1TA 2IXVA 2J75A 4AXNA 4LYRA 2ZTJA 1EXBA 4XAFA 3CLMA 2Y6ZA 3TYBA 2IMRA 4UNIA 3ISIX 5HQLA 1ICPA 1Q6DA 3W2UA 1HKJA 1E4LA 1MZRA 5FJTA 2E9LA 2X0SA 1JZ7A 3W6LA 3O6CA 1ZLPA 1US2A 3U0HA 4DXKA 3PULA 1EFZA 3RU8X 3GFZA 1HFBA 2FYMA 4FOKA 4NX5A 3AHVA 3NSXA 3NPUA 4DWSB 4JIEA 1QWGA 3BSHA 4D6DA 3PR2A 3GX9A 2OFJA 3N04A 3B8IA 1UR1A 1PKNA 4FNRA 1EX5A 1QPQA 1MDRA 4JXCA 3FW6A 2J8GA 3WELA 2D0GA 2WW5A 3QVQA 1KM0A 2BLEA 2GWGA 1ITXA 4HIBA 4JICA 3C8FA 4UZUA 3NYZA 3R12A 4FNSA 4F9JA 1IIGA 5FJPA 3LN3A 2HISA 1EF3A 3BL3A 3ZJ6A 1HJWA 1A47A 3CEUA 4PH6A 2A5HA 2ALDA 1CIUA 1XRFA 3VIFA 1SFSA 4LY4A 3R11A 1XQKA 2OQHA 1BFNA 5LNWA 4D6EA 3EOLA 1IEWA 4E8DA 5HQEA 1LWIA 1R3VA 3WQ6A 2Q3RA 1UMLA 1NF7A 4MB4A 4WCJA 1DL3A 1G4SA 1OCQA 1SFTA 1GG1A 3MZNA 1W9PA 4QEEA 3P7YA 4MNMA 3K46A 1ICSA 4MWAA 4U33A 4HVXA 3RRAA 3WYZA 3OPSA 4HJWA 3UY8A 1REQB 5ENLA 3L2LA 1EQPA 1SSGA 2VFHA 3TONA 3W7NA 3SUVA 1GYNA 1OVDA 1U1UA 1KCKA 2E28A 3VI2A 3ITXA 3KUMA 3N4EA 2QMKA 4ROPA 1BYCA 3LXBA 4JX5A 4PL1A 3AIRA 3FS2A 3PJUA 1B4KA 3G1XA 4WF7A 1M3UA 2WVTA 1LWJA 3SCPA 2CZ5A 3H2EA 3NPXA 4LBRA 4W9TA 1W32A 2ZXAA 3TUUA 3PTMA 4LH8A 4UMAA 1RK6A 3QHNA 3APTA 2VOTA 2XFFA 3VNKA 3IAQA 4J35A 3HPFA 3LDVA 3P3BA 3PN8A 2VWSA 4LRTA 4CNUA 3L21A 4ADTA 3S5SA 3TYCA 4LB4A 1X96A 3BVJA 3U5UA 3HPSA 3BG9A 5AHNA 3ITOA 1TSIA 4Q8QA 1VFTA 2W67A 3G1VA 1DWJM 1OC7A 2BXVA 1JAKA 4XD6A 4S3JA 2VNCA 1AUSL 2BZNA 3SCQA 3RMEA 3ABRA 4O1DA 3GTFA 1WKYA 1GJWA 2E1DA 3KFTA 5LHEA 1DHPA 4IWWA 3SY8A 2ZA1A 4GVFA 1C8XA 2HNHA 5AZ1A 4AHOA 2O56A 1NDVA 3WUEA 1WZAA 3T1GA 2G5WA 3CH9A 1WXJA 4P7QA 5I6SA 4M1RA 3ZS4A 2A0NA 4DUWA 1HJXA 5D4YA 4IMCA 5E93A 2WM0A 4BF9A 2HSAA 2J9YA 1J0JA 1ZAIA 4YL2A 3BAWA 4LF1A 1SR0A 1IZCA 4GIAA 2CZDA 5G4WA 1OGBA 3MANA 2XWDA 1RLDA 4BQ5A 2G3IA 5HATA 4A4AA 1F6YA 3OQ8A 4TV5A 3EOEA 1XH0A 5D2TA 1A5SA 3UW6A 2GQ3A 4ZB2A 1SZRA 1VLWA 3E9AA 2WVVA 3WK1A 4HTYA 3ZXWA 3LQGA 1K7FA 4MLRA 4QROA 4TX9A 1QNOA 4J3UA 1RCQA 3WO8A 3GG7A 1EHAA 3LBMA 4CD4A 1Y8BA 4K3ZA 2ZDRA 3KOWA 2FKPA 1W3JA 4B3KA 1XL9A 1EDGA 1JI1A 2YBUA 3W85A 3CV7A 4IL2A 3OLIA 2QULA 1GEHA 2J7HA 4DNMA 3PZ9A 2WXDM 4X3ZA 3SADA 4QNEA 3SIZA 1WAUA 3A3XA 4JQ4A 2P8BA 3H6OA 1H63A 1F7BA 3V3WA 3STGA 3NG3A 2E3ZA 4EF9A 1VJZA 4JOMA 2PI6A 2WK2A 2CZFA 3IUDA 3C2FA 4UQEA 4HMDA 1P43A 5EPDA 4U2YA 2BVDA 1R3SA 1LP6A 3FKKA 3C8NA 3VPLA 4EX4A 1J93A 4IHCA 1RVGA 3CWOX 4CU7A 4RE0A 3F5LA 1CNVA 3O07A 2ZE0A 1WZKA 3TLQA 4XSMA 3KXQA 4OKDA 1AQFA 1OD8A 2WAGA 1W37A 2CBIA 5A6JA 3VOFA 1IHIA 2EXOA 2V69A 1CT5A 2OGYA 2YCJA 4XZNX 1XIHA 1XYAA 3QPZA 1I1XA 1BWLA 4MF4A 2BY2A 4D1IA 3TK7A 1VJIA 4ZODA 4S3AA 2YW4A 1XH1A 4AAJA 2UV8G 1PX8A 2XH7A 4U31A 3VU2A 4HCLA 3BARA 4L65A 3L66A 2CNCA 1ME9A 3PZMA 3W7RA 4O4VA 3W02A 1HXJA 5HANA 3EMQA 3R0DA 3BLLA 2ZA3A 3UNDA 3F4CA 3W1NA 1SYTA 5BXPA 1GVIA 2IXUA 4L6OA 2XIMA 1QPKA 1TYGA 3RO8A 1FDYA 4JIHA 1JUKA 3ZQ9A 1KM4A 4GKTA 2CXEA 2D22A 1V77A 4WY0F 2ZUWA 3QTPA 4W8BA 5C5YA 1Q4WA 5FF7A 3CZEA 3VDGA 3AXIA 1FTXA 1EC9A 3TWBA 3AXKA 3WDIA 1JDAA 3IIVA 3SURA 4AZHA 3EPNA 2NW0A 3MSGA 2OKTA 1UIPA 4LALA 4E5TA 5HJLA 1TREA 4F0MA 4KRTA 3E2VA 3NVDA 3OW1A 1ALDA 5I23A 2CZVA 1JUEA 2CKRA 2GJLA 3WDQA 1XDJA 3M0IA 5EFFA 2FHBA 2G3NA 4LEQA 4XAZA 2VZVA 2GGHA 3B0VC 5K7JA 2R9RA 1ISZA 3G6MA 3HMJG 2LLEA 2WANA 1QPNA 4MY8A 1KD0A 1KBKA 3EX6A 5AY7A 3CWNA 1WZLA 1ENUA 3GYEA 4QAWA 1FBAA 2C14A 2WBKA 1XLJA 4NNCA 4MAZA 2ZRZA 1W3TA 4KW2A 3KOYA 3UY7A 5A6MA 2Y5SA 3KCLA 2HK1A 2D24A 3DKLA 1KLZA 1P0NA 1HGWA 1WBHA 3TFCA 3QZAA 3NL5A 4E8CA 4KEUA 4JKKA 4QGCA 4FX6M 4B3ZA 4RR4A 1DIOA 3QW3A 5C9WA 2ANUA 4JS3A 3PPCA 1Q6FA 1K02A 4J40A 4W5ZA 2P3ZA 3VIOA 1H50A 1IF2A 1L2UA 3VCNA 1G5AA 3E2RA 5TF0A 4PRWA 8CGTA 3QQWA 2NQ9A 2V81A 1UPMB 3F4WA 4N9DA 4C6IA 4G6CA 2QCGA 2I5GA 2E0PA 3G1YA 4DJDC 4DO6A 2XVGA 2W79A 4H9TA 4PCTA 2NT1A 3THUA 3DUGA 3B9NA 1Y7VA 4MGGA 3IRSA 1KXQA 1DV7A 1NWTA 2V3GA 4JCMA 2PCEA 3DYMA 4QLJA 1HNYA 2D2HA 4A21A 3B0PA 2A79A 2D1ZA 1V03A 2C0HA 2PGRA 3H22A 4RUBA 1TFVA 1CLXA 4NZ5A 3FVDA 3RO6A 3NQ2A 4LVGA 2C19A 4RV3A 1VBRA 3FYPA 4US5D 3UCQA 4DYKA 5CZJA 5HINA 4BF5A 3EKZA 1WYIA 3GU9A 4BCEA 4JHZA 3WQWA 1UKPA 1GVRA 4PRTA 4S39A 2PAJA 3NURA 4WQ6A 3H2AA 4WR3A 7TIMA 1G94A 1ZBVA 1BSLA 4D8LA 4PTXA 3WJSA 1GCYA 2OO0A 5JH2A 2YGYA 2X42A 4M8UA 5D9MA 5BRBA 2Q8LA 3PBVA 3QQ0A 4DJFD 4AZ5A 1NSJA 1XBYA 4KEZA 4GLEA 2EPHA 3DFYA 4EXAA 3EKGA 4AX7A 2GGEA 2NSXA 2JGYA 3O6AA 3WLSA 2IKJA 3HPAA 3OTRA 4G1KA 1J6PA 4AD1A 1FWWA 5I02A 4PMQA 7ODCA 1HO4A 2P88A 2PDFA 4CNNA 3AUJA 1XC4A 4OBRA 5CPTA 5D04C 2QCFA 1R3RA 3M6DA 4JZ5A 1Q13A 3WJZA 3P93A 3UGVA 3HTWA 2H8XA 2ISWA 1S2VA 3P8JA 1EYEA 1MFVA 1KCLA 1OSEA 4RNIA 2C7FA 3KM8A 5D8ZA 5FAGA 4GQBA 1OC5A 3P14A 4XD4A 2F38A 5LSMA 1EC7A 3V35A 3P0XA 2WM1A 5FA5A 4GIEA 3S6DA 2OSYA 1ZBCA 3GC4A 3M0LA 2JGQA 3GS6A 4FLSA 3WNPA 2FPVA 5CSUA 2WNQA 1NM9A 3FFSA 2AGKA 5IXEA 2OLSA 2NQHA 3G1SA 3FA4A 3K4AA 1UWQA 3T81A 4K39A 1TWIA 3G8RA 2QIIA 3I7RA 2BTMA 1MUMA 4O1EA 1FQ0A 2D3LA 3WNLA 3WLOA 1R2RA 3T78A 4GXWA 4JEQA 2PD9A 5IBXA 1AODA 3L0GA 3NL3A 3BLIA 2J62A 1PWLA 2WSR<