1UR4A

The structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Endo-Beta-1,4-Galactanase from Bacillus Licheniformis in Complex with Two Oligosaccharide Products
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords GALACTANASE
total genus 145
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ur4A00
2QMKA 2X09A 3VU2A 3A4WA 1QI3A 2Y8VA 4MNKA 2EJ1A 2QPUA 3ARWA 1HJXA 3QOMA 3CUIA 5D8WA 3J7HA 4WKAA 3II1A 1ISVA 4JCLA 1CENA 3VINA 4BF7A 1IZJA 5A6BD 3POCA 4OBSA 1VEPA 1B90A 4OKDA 2XVKA 3THCA 4BQ4A 1R86A 3MMDA 4DUWA 2E4TA 3LPPA 4UZSA 2WB5A 4UFKA 4JAWA 1XC6A 1VB9A 2J7EA 1QNRA 1QNSA 2WMKA 4OIFA 1AQHA 4P8VA 5BRQA 4GI8A 5I77A 4UCFA 3S2CA 1CXFA 1JDCA 2XIBA 1E43A 2ZIDA 3NSNA 3IAQA 4Q22A 4BCEA 1UKQA 5A6SA 2EPKX 1MW3A 1GOIA 2Y8KA 2QV4A 3VIMA 3PHAA 4JIEA 4W7UA 4CKQA 3B9AA 4ZE5A 4PUEA 2J74A 3RO8A 3GH4A 2J47A 1UZ4A 3VGBA 2EPLX 1TUXA 3SCWA 3I3EA 4UFHA 5DF0A 3U5UA 2XFFA 4WKFA 2RGMA 1WAWA 4WJXA 1H0GA 3T08A 3ZT5A 4NZCA 1W3LA 4LYPA 4JL1A 4Y7EA 5ABEA 3GXDA 3RILA 3ALFA 2GSJA 1V08A 1W3JA 4N42A 3WD2A 4JHOA 4OOUA 3L4WA 4QDMA 4ML4A 1CYGA 5D9PA 4HA4A 1QI2A 2BVDA 1E4IA 3S6TA 3B8SA 1UWQA 2VRJA 1BG4A 1EHAA 2V3FA 1E6ZA 3M46A 1OB0A 2G3JA 5DFAA 3EMCA 1XYFA 1UHVA 2WW5A 1H5VA 1OT1A 1G01A 1Q6EA 1KGXA 2ZICA 5EBAA 4W93A 2JEPA 3BLPX 1NH6A 1KGWA 2X1IA 1C7SA 3QR3A 3BLKA 1PX4A 3GH5A 1HN1A 3ZJ6A 1QBAA 2HVMA 1B3VA 4TXEA 4PN2A 1VF8A 3RJXA 3TONA 4PCTA 1C93A 1V3KA 4YHGA 3OGVA 4TVUA 1MQRA 3NUKA 4CD4A 3EMZA 1E4LA 1X6NA 2EXOA 5D9MA 3SUUA 3VDHA 2PWHA 3GYCA 1W2VA 2V5CA 1FOBA 2VTFA 4B3LA 2W5FA 5FL0A 4TX8A 2YL5A 1HJVA 4QFUA 4HZ6A 3OLDA 4V27A 5ABFA 4KH2A 2V3EA 1BLIA 3RMEA 1G5AA 3RCNA 3GBEA 3VD5A 3WNOA 3ZJ7A 4J3WA 2CBJA 1UWSA 3W53A 4U5KA 3CHEA 3QHOA 1YQ2A 2FH8A 5D9OA 2Q8XA 2XWEA 2EBNA 3L4ZA 1XH0A 3ZOAA 2A3CA 4ZFMA 1EO5A 1ODUA 3ZR6A 4AZIA 1R8LA 3GBDA 3WUFA 2YBUA 3OZOA 1V0MA 2JIWA 3WD3A 4YHEA 1QNOA 2J7GA 2J62A 2O9PA 1LJYA 3ARVA 4B3KA 3K4DA 2CBUA 4UQDA 1VFOA 1JI2A 4R27A 4ZE4A 2ZUSA 5I5RA 3LPFA 1HJWA 1GVYA 1E6SM 3K1DA 5FKYA 3ZJKA 1GOMA 4CU6A 5IHSA 1GOOA 1RP9A 2X05A 2CNCA 2O92A 2XVLA 4AEEA 2YDRA 1XRVA 4HU0A 1ZBVA 1E5NA 4HOXA 1W1YA 3AROA 4UQBA 1TE1A 1FFRA 2DT0A 3AIEA 3AIRA 4TUFA 4A3YA 4AD2A 3ARPA 3WNLA 3BC9A 2DIJA 1LF1A 2XYLA 4D1IA 1JZ2A 1RD6A 2B31A 2BY0A 2XGBA 3OBAA 4HMCA 4HP5A 2FHCA 1DWAM 1C7TA 4M24A 1ZS2A 1BYCA 1E4NA 3WH7A 1JI1A 1OSEA 2XSBA 1B31A 2D20A 4A4AA 3D5HA 1UD8A 3CTTA 3AIBA 5IDIA 3SUSA 4GI9A 4GZJA 3NCOA 1PJ9A 2BNJA 4FLQA 4MADA 2XIIA 1ITXA 3WQ8A 4W88A 1W9DM 2CETA 1VFFA 3M7SA 4M29A 3UESA 1XD0A 1ZBWA 2VX5A 1QI5A 2Y4SA 2V3GA 2WWCA 1KXHA 3DYMA 3G6LA 4UOQA 2BV9A 1G9HA 1UKPA 3ZR5A 5CLWA 1KXVA 2YL9A 4HPGA 2J8FA 2PI6A 1GVIA 1UD2A 4IUGA 3EDFA 4AZCB 1XV8A 3ZM8A 2WHKA 2D3LA 5EFDA 1BYAA 4JZ5A 3WD1A 2WPGA 1ODZA 4JFSA 2X8RA 1I1WA 3SURA 3VKKA 4FLRA 1EDTA 3K8KA 4CD5A 1XSKA 3CHFA 2YOCA 1R7AA 2WKLA 4U31A 2G3MA 5I6SA 2VCBA 1CXLA 3AXXA 1P6WA 3EMQA 3WN6A 4AZGA 2WMIB 4UOJA 3WIJA 2XTKA 1LG1A 2WVVB 3CBWA 1C3FA 2F61A 1HF6A 4AIEA 2EEXA 1FHLA 4PMZA 1VFMA 1ZL1A 1JYVA 3CZLA 4D6HA 2C0HA 4FK9A 1JAEA 1JXKA 3THDA 4D6EA 3K8MA 2WZEA 2FGLA 4QLKA 1XSIA 5A95A 1O6IA 1OWQA 1UR0A 4CU7A 1CXHA 4QCEA 1QI4A 2AOSA 3AZSA 3WQWA 1E6NA 2E0PA 3WNMA 1E71M 1JZ3A 3N18A 4HA1A 4GKLA 1Q6CA 2DT3A 1QW8A 7A3HA 2VNCA 1E56A 2FDMA 3W82A 4K68A 1FHDA 1QHPA 4GXPA 4BZYA 3ZMRA 3NSXA 1CXKA 4MJ4A 4BA0A 3B9DA 3AHVA 1TCMA 4UFMA 4J27A 5D4YA 3OLEA 4JL2A 1W9VA 4S3KA 3W26A 4M81A 1JNEA 4AY1A 2VX4A 3HU7A 3AIVA 3NYDA 1WB0A 3APGA 3W25A 5DMYA 2A3HA 1QVBA 1W1VA 4CN4A 3BMVA 3WDPP 2D22A 2YL6A 3GNOA 3VIIA 2ZUMA 5CPSA 1OIMA 5FIPA 3QOKA 3AHYA 3L4TA 3EDJA 5E0FA 1VENA 5JIWA 1KGUA 1J9YA 3CZJA 3QGVA 1CEOA 2WSPA 1GOKA 3ALGA 4ACYA 4JCMA 3WY1A 1NWSA 2BXZA 3WD4A 4LYRA 5FL1A 2DT2A 1UH3A 2ZOXA 1Q6GA 3GZAA 5C70A 3WEMA 1UD6A 3ZO9A 1TFVA 5HPCA 2PWDA 1CNVA 3VO0A 5CJ5A 1UD4A 4MJ2A 1KWGA 4JKKA 2WHLA 2TAAA 2CXGA 4JKMA 5I3DA 2VVNA 4W85A 4DWSD 5IHRA 3BCDA 2BVTA 2YA2A 2YKKA 4ATLA 3SIMA 4KGJA 3N04A 2QF8A 4HZ7A 5TD4A 1K9EA 2CPUA 4E4PA 2WM0A 1F4HA 3K4AA 3MUZ1 1PPIA 3F5JA 3IK2A 5CGTA 5A8NA 1TMQA 2GJXB 4GZIA 1EDQA 1LWHA 4EKJA 1V02A 3PTKA 5JIPA 3L2MA 2JIEA 4MB4A 2ZUUA 1Q6FA 3UCQA 1V3LA 1HT6A 4MAZA 1VRXA 4OUEA 5A3HA 1UZ1A 1R7OA 1GQJA 1E15A 2YDSA 1E5JA 1BAGA 1L0PA 5JBFA 2J7DA 4W7VA 4ATDA 1ESWA 2MANA 1IV8A 1JXJA 3WSUA 4Z2GA 4W89A 5E6ZA 1J0HA 2XVGA 1FH9A 2WZIA 2YA0A 1GJUA 1E4MM 1XYZA 3RDKA 2E9MA 3PZIA 4QCFA 2VCCA 4AISA 5HXMA 1GW1A 2W66A 3POHA 1UH2A 4RE4A 2YLAA 3NDZA 1OCQA 2VOTA 5C8BB 2DSVA 3VIPA 3RM8A 4W87A 3MSGA 1XHGA 2PBOA 4W5ZA 4AZ6A 3VIFA 3WDRA 5A2AA 4CD8A 1AQ0A 1NWTA 2XM2A 1R85A 3IJ7A 4UQAA 1HXJA 2OSXA 3VGGA 5ABGA 1ITCA 4F9JA 3AMGA 3GM8A 4H8VA 4W86A 3OA5A 2ESCA 2J8GA 3RIKA 3ARTA 3FY1A 7CGTA 4CN1A 3OLIA 5GNZA 3AHZA 3MU7A 5DT7A 1HKJA 3MUY1 3VIGA 6TAAA 1C8XA 4CGTA 2BY3A 4LQ1A 3MV11 7TAAA 4CCEA 2VR4A 1MWOA 3EYPA 2D24A 2FHFA 2GJXA 4JFWA 2WVSA 3SCPA 5I24A 4W7WA 3WBAA 2VUYA 1RPKA 3WF2A 5CSUA 3CUGA 4TVDA 1UWTA 1WNOA 5AYBA 5GNXA 2CBIA 3M07A 1OGGA 1CPUA 1SYTA 1R87A 1ISYA 1GQKA 4AMCA 1MW0A 4J3UA 4LX4A 5CSYA 3SEPA 1MQPA 1MQQA 4Z2IA 1D7FA 4GO8A 4XUYA 1V3IA 1C91A 1HJSA 3VM7A 2J4GA 2XGIA 2J79A 4QLLA 3PZUA 4MB5A 4P8WA 4P7OA 2WYSA 1BVNP 2XSAA 3W6LA 1KXTA 1VIWA 2OYMA 2J77A 1JFXA 1C8QA 4ACZB 4U2YA 1J0KA 2E8YA 1KCLA 4W8LA 3CMGA 4HOZA 1SMAA 5GNYA 2ZUNA 5GQBA 2JF7A 5DEZA 1NOWA 3SUVA 2GJPA 4P7NA 3W81A 2WHMA 4BQ2A 2CKRA 1LLOA 2XWDA 4AXNA 3N17A 4X9YA 2JF6A 2QLYA 1JFHA 1HX0A 2WC7A 1KWKA 4GZEA 3VD7A 1GZJA 1CGUA 4MNLA 1JF5A 1YHTA 4CD7A 4XX6A 2YJQA 1GONA 1HP5A 3I3DA 3ZSSA 5FD0A 2FGZA 2NT1A 3WBEA 2W91A 2WK2A 1J10A 3DECA 4M80A 3AS1A 2DSUA 5BXPA 1U33A 2W63A 1GUVA 2BVYA 4L4PA 4P8XA 4GI6A 5A8QA 2XFRA 1J18A 4ZXLA 3D3AA 5I79A 5E9AA 1X6LA 2OYKA 3W29A 3MKKA 4PMNA 3VIHA 1BYBA 2Z1KA 4HU8A 3CPUA 2ZXDA 2VR5A 5DT5A 1DWIM 1RH9A 3SCUA 3UEQA 1E73M 1LL6A 1JIBA 1EIBA 3E1F1 3VTRA 4D71A 4PTMA 3UERA 1G1YA 4XV0A 3VGDA 1XSJA 1FH8A 3DYOA 4AEFA 1M04A 1V3JA 3AS3A 3VGFA 1JYXA 1Q6DA 4AWEA 1JZ5A 2VZVA 3PTMA 2VO5A 4IPLA 3W24A 1XD1A 3GTNA 1VBRA 2PWFA 3AYRA 3ARZA 3W0KA 4TOQA 1NARA 3A3HA 1VJZA 3CGTA 4NRSA 2ZX9A 1WZKA 5D8ZA 3WQ5A 4Z2JA 1VBUA 4OJYA 4PTWA 4HTYA 4YN5A 3GDBA 4QLJA 3VNZA 2CERA 3DYPA 1NQ6A 4GPNA 1BHGA 4Q7NA 2XG9A 1AVAA 4UOZA 1B3ZA 1E70M 3B9EA 3FHAA 1B0IA 2DSWA 1B3YA 2EPMX 2D0HA 2XHYA 1UYQA 4CN6A 1JL8A 1MXGA 4M56A 2DSZA 4W8AA 1WZMA 1UWIA 3TTQA 2DSKA 1V0NA 4CVWA 3AIWA 5JBDA 3WH8A 4PSPA 5AYIA 3IAPA 1LL7A 1AMYA 2EPOA 4QAWA 3WDJA 1J0YA 3BCFA 1GHRA 3O9NA 2ZUWA 3VIOA 2NT0A 1US3A 4D6IA 1GJWA 3CUHA 4CD6A 3WDQA 1W1PA 1EHNA 3OZPA 1UKSA 1OINA 4AD3A 1JYWA 1NWUA 3OB8A 2F2HA 2GVYA 1W3HA 1I1XA 5A2BA 5HBFA 3BGAA 5HPOA 3AXHA 3KL3A 2DIEA 1D2KA 2WBKA 1CTNA 3WUEA 2GDUA 3AMLA 3VGHA 1PEZA 2FH6A 3AHXA 5A1AA 2V3DA 1XH1A 2WAGA 1NM9A 1UQYA 4PTVA 2WMJA 1HJUA 3PZGA 3U7VA 2XM1A 4WSKA 2PB1A 1JDAA 1EO7A 2ZX6A 5I2UA 4F79A 1KXQA 3BSGA 2Z1SA 2IXUA 3ARRA 1WKYA 2C7FA 1TA3B 3DC0A 4V28A 1EDGA 5IXEA 1PIFA 1HL8A 2EO7A 2UY2A 1CGYA 3WF1A 4M8UA 3WFZA 3MMUA 5BXRA 4U2ZA 2VVSA 1HL9A 3MUIA 3TP4A 2CEQA 3OG2A 3WELA 4ZXOA 4FLSA 3WNPA 3PN8A 1C92A 5IFTA 2UY3A 2JE8A 4FMVA 4UQEA 2PF0A 1NWRA 1V6XA 2XPKA 1VEMA 5ABFB 3IJ9A 1DWFM 4AYSA 1UWRA 3CZKA 1H49A 5LA2A 3EDDA 3UR8A 1B2YA 3GNRA 4AIUA 1MYRA 4Z2HA 1WDQA 4HZ8A 1Q4NX 4JFTA 2VZOA 3WUGA 3DHUA 4W84A 4X0NA 1HKIA 3HJEA 5A6LA 3MO4A 4UNIA 2WCAA 1JZ7A 4LYQA 1CDGA 5I78A 1DHKA 2DEPA 2VZSA 5CG0A 3WH6A 4MDPA 4TTGA 1F4AA 4RL3A 1UR4A 4PMDA 3T0BA 1W9UA 1JF6A 3N13A 1E55A 1JDDA 5CPTA 3W37A 3O2LA 2D0GA 3AXIA 4PTXA 1OGSA 3SCRA 4KRUA 3N15A 3TA9A 3LPGA 5EB8A 3AFBA 3VGEA 1W9BM 1M53A 1U2YA 5A6AA 4OOZA 2G3NA 4PMRA 1V0KA 4B15A 2CHOA 1MFUA 2WZHA 1DP0A 1S46A 3LPOA 1V3MA 3A6OA 1HNYA 3W38A 4A3HA 4P7QA 1UR2A 3AHTA 1CGWA 3WH5A 4YPJA 4C7DA 3AQUA 3VD4A 2DH3A 4MPKA 1JZ4A 4MAVA 9CGTA 2CBVA 4GQQA 1GHSA 2VCAA 3TTOA 1WP6A 4H7VA 2WBGA 3FXYA 2E9BA 3K46A 1B3WA 2GUYA 3RPMA 1UG6A 2DPEA 4RE2A 1N82A 2BXYA 3WF3A 5F7UA 3VDAA 1ZJBA 1M7XA 2ZX5A 1G94A 3PZOA 4EK7A 4P7RA 2BS9A 2PC8A 3KE0A 1DWGM 3AMCA 4CCCA 1O7AA 3OIHA 4V2XA 2WLYA 4IPNB 1CXEA 2A3BA 3WH9A 1H0IA 3WMCA 3EDEA 5LYRA 4GIAA 4JFUA 2WLZA 4DUVA 3QHMA 4D72A 1WCGA 3SCSA 1EOKA 1B9ZA 4C7GA 3EDKA 3CHDA 4UQCA 2WHJA 3G6MA 3M6DA 4M1RA 1K9FA 4DWSA 2D2OA 2E3ZA 3L4XA 1WO2A 3A47A 3VD3A 4MNMA 4EAMA 3SCNA 2W61A 4NI3A 3UETA 5A94A 4J3TA 3RJYA 5A6JA 3AIQA 3AJ7A 2WCSA 2A3AA 4H41A 3ZIZA 2G4FA 4IM4A 1ZB5A 1UKOA 8A3HA 2BHUA 1EXPA 3RM4A 4LPCA 5DO8A 1CWYA 4JHZA 1CGXA 2VZUA 1J01A 2PWGA 5CZKA 3BAIA 3WF4A 1MW2A 2DDXA 5M5DA 2XFYA 3UR7A 3T09A 1UR1A 2WMHA 3AOFA 4WIWA 3KL0A 2OSWA 2X0HA 5E09A 2OLHA 2ZX8A 2O9TA 2WC4A 3ECQA 4MB1A 1OT2A 4HMEA 3ARSA 2YDQA 1K9TA 4AD0A 1K6AA 3EBVA 5A8OA 1D3CA 2IUZA 4PMYA 2VMFA 2YLLA 4XB3A 4R5EA 1VFUA 5BRPA 2J7HA 5CQ1A 3BAJA 3O6AA 1HKMA 3PBGA 1QHOA 5A69A 1V3HA 2CITA 4W8BA 1US2A 3WEZA 2GK1B 3AIUA 1J12A 1QHZA 3SCVA 3FN9A 1NP0A 1L8NA 3HMCA 3SCQA 1V03A 4BS0A 3WNNA 1E0WA 3F5LA 2G3IA 5BWFA 4FF5A 4E8DA 1HKKA 5KZ6A 3W4RA 1OD8A 3IANA 4KRTA 5HNNA 1ECEA 3KL5A 2AMGA 1JG9A 1CGVA 1PX8A 3AI0A 1KB3A 1HIZA 3VVGA 3F5KA 2QMJA 3KZSA 3VMOA 4M82A 2CYGA 1BFNA 3AZRA 5BYWA 5A8MA 4GO9A 1V0LA 2VQTA 1UH4A 4DWSB 2OWXA 4KGLA 1W1TA 3WFLA 1GPFA 3BAKA 3LMYA 1DEDA 3FW6A 3N12A 1JNDA 2VRKA 3ZSTA 3SUTA 2YIHA 4HPHA 5CPQA 3WL1A 1BPLB 3HN3A 5D9NA 1ISWA 2UY4A 1LG2A 2WCGA 4EANA 1IT0A 2UY5A 1KFWA 1KBKA 3FNDA 5AC4A 1WE5A 1Z32X 4HMDA 1OD0A 1K9DA 1TR1A 4U3CA 1I75A 2CESA 2UWFA 3I3BA 5AC5A 4P8UA 3WNKA 4PUDA 3VD9A 2WNWA 2Y24A 1TVPA 2GK1A 3WENA 4J3VA 2WXDM 1JD7A 4C7FA 3VUPA 2BHYA 3CZEA 1JYNA 4TVCA 1UUQA 4FLOA 5BCAA 1EA9C 1SMDA 4PMQA 2JALA 2X0YA 5E70A 3OGRA 2VQUA 4DUXA 2WANA 2W62A 2WVTA 3VMNA 4URIA 1BF2A 3GXMA 3WEOA 1A3HA 1XCXA 1BGAA 3TTYA 1W91A 1E9LA 3CUJA 4ZENA 4UTFA 3JUGA 1E0XA 4AIOA 4D6CA 1E6XM 4GQRA 2ZUVA 3NSMA 1W9PA 3MV01 1WPCA 3PZQA 1KR0A 2V38A 4MB3A 3PZTA 3CMJA 1J11A 1H2JA 1OGBA 2WWDA 2EPNA 1WDPA 2WMFA 5GPRA 3BAWA 4OZOA 3A4AA 3AS2A 1NOUA 4L4OA 1GNXA 4F8XA 4NF7A 4BQ3A 4U33A 3AMKA 1ZJAA 5JUVA 1CGTA 1JZ6A 2V5DA 1A47A 3KWXA 3PZVA 5I0DA 3UG3A 4PMXA 2DQXA 3L4UA 4W5UA 1AQMA 2VZTA 1M01A 1E6QM 4QP0A 4CU8A 2VC9A 1B30A 3CZ8A 3RM9A 3ARQA 3ARXA 4ACZA 3CHCA 5EMYA 5A6BA 2FHBA 4UR9A 3VX1A 1UR9A 4F9DA 2W92A 3GXFA 3UG5A 3WMBA 1V02E 1XGZA 1MW1A 2BY1A 3L4VA 2G41A 5ABHA 1QW9A 3VM5A 1WZLA 1E6PA 2JEQA 5EFFA 3ARUA 1HVXA 4DWSC 1EQCA 1UOKA 2DGAA 2VI0A 3CH9A 4D6FA 3U7BA 2O9OA 4NRRA 4AZ5A 1H41A 3T2OA 4WKHA 1FA2A 4IISA 1JGIA 1XH2A 1DWHM 3AYSA 1E3ZA 1MVYA 1OIFA 3IJ8A 1ZBKA 5A6KA 3WMSA 2OWWA 4J28A 1CLXA 4AD5A 2ZXBA 1B3XA 2XVNA 1FFQA 1ISXA 1ISZA 1UA3A 3GH7A 6A3HA 1GCYA 3VMPA 1EOMA 2VRQA 5A6MA 4TX6A 1QBBA 2WMGA 3VIKA 1XCWA 1UKTA 2F8QA 4N0RA 2VT0A 5HDRA 1UD3A 2J7FA 4CVUA 2DT1A 4AW7A 4U3AA 4UFIA 4MDOA 3W27A 1NP2A 3VILA 1J0JA 2EQDA 2J78A 2VX7A 5C71A 2ZE0A 2NSXA 4WF7A 1HP4A 3F4VA 5M17A 3T0DA 1H09A 2OYLA 5M03A 1CECA 3CLWA 1GQIA 1C90A 1JAKA 4ZEPA 2NW0A 1JD9A 3WL0A 1GOQA 5CGMA 4J3XA 2BY2A 3K8LA 4P7LA 5BXTA 1HVQA 1BG9A 1BTCA 4D6JA 2E8ZA 3N1AA 1G0CA 2C8NA 4ATWA 3MSDA 3MUAA 5A2CA 4HOWA 4OBRA 4DM2A 2D0FA 3WQ4A 2GDVA 1BVZA 1C8YA 1TA3A 1E1FA 2J75A 4AC1X 3MMWA 3FAXA 2WVUA 2QHAA 3PZNA 1E1EA 3VDCA 2D1ZA 1TG7A 4D1JA 2WMIA 3KEHA 2ZX7A 3ARYA 1V6WA 2J7CA 3PTQA 3PZMA 1ZU8A 4H8HA 2Y2WA 1UWUA 2WKGA 4WLCA 5E6YA 1DTUA 2ZXAA 4HA3A 6CGTA 4H8UA 1BSIA 4KMQA 1OBAA 4UFJA 2ZUTA 4GINA 4AZBA 1PZ3A 1H11A 5A8PA 2O9RA 8CGTA 3L2LA 4XZBA 5CLTA 4X0VA 4RE3A 3PZ9A 4JFVA 3CO4A 3WQ6A 4PMUA 3WDHA 2WVVA 4BQ5A 2WSKA 1E72M 3AS0A 1E40A 1HJQA 4UFLA 5FCZA 2CCRA 3ZT6A 3OLGA 4Z2LA 1VJSA 4PMVA 3VX0A 1OM0A 5IFPA 1CBGA 2ZXQA 2XUCA 1KCKA 1QNQA 2XVPA 4J7RA 5HOSA 4PSRA 3VNYA 4Z2KA 4DM1A 2YL8A 3UG4A 1H4PA 4AZ7A 4PRWA 4XZWA 3AICA 3W28A 3SCOA 4PEEA 4PYSA 4E2OA 4PBGA 4H04A 1J0ZA 3VDBA 1PX3A 2PBGA 3MS8A 1V6UA 4CUCA 3U57A 1KQZA 3FAWA 4UZUA 1QNPA 1ZBCA 1QOXA 2G8ZA 3ZQ9A 1VEOA 2IXVA 3T0AA 1CIUA 3VPLA 5BROA 1H1NA 1LWJA 5LA0A 3VIJA 3NIYA 5M3WA 1WZAA 1EQPA 1W9XA 1BYDA 1WDRA 3ZT7A 3SCTA 1TVNA 2J25A 1QPKA 3AZTA 1E3XA 2Y5EA 1NOFA 3NDYA 3ZJ8A 4D6DA 4AD1A 1BGGA 2CHNA 4NSBA 4B16A 3SUWA 3VOCA 3GXIA 1H3GA 3DHPA 3WQVA 3GNPA 3NJ3A 3OGSA 1PZ2A 3T2PA 2VURA 2HISA 1EH9A 1W3KA 1KBBA 1VAHA 2A3EA 3WDIA 2VL4A 3WUBA 2JFEX 4LXFA 1PBGA 3U5YA 1J0IA 3AISA 1MXDA 3WKZA 5E0CA 5LA1A 2OWCA 1E0VA 3WD0A 1TZ7A 5KEZA 2BHZA 1KQYA 4UQ9A 1W2PA 1UA7A 5CXPA 4CCDA 4F66A 4WK9A 1PIGA 4TTUA 1B1YA 5FOOA 1SR0A 3T2QA 1UD5A 1FP8A 4AD4A 1Y7VA 1U30A 3BXWA 3TOPA 1UQZA 2GJRA 4J3SA 1FP9A 5AY7A 1GQLA 3N11A 2X2YA 4MTVA 1GOWA 3BSHA 4H2CA 5I23A 3CZGA 3BH4A 1PAMA 1LL4A 1V6YA 1LQ0A 2J7BA 2BFGA 2CIPA 1KR1A 3CUFA 2GFTA 1V6VA 1CLVA 1W32A 2VX6A 3TTSA 3FHQA 2E40A 4S3JA 4PCSA 3CIVA 1UR8A 4AZCA 2W67A 4D6GA 2RGLA 3L4YA 3WF0A 1RP8A 2OSYA 3BAYA 3AMDA 1IZKA 4JKLA 1E6RA 4B9ZA 2PWEA 1DWJM 2QPSA 1X1NA 5BXSA 4LGXA 2WC3A 1MFVA 1M03A 4AZHA 4EE9A 4E8CA 1GORA 4U5IA 4B9YA 1EGZA 5JBEA 2E9LA 5ECUA 2ZWZA 2ZWYA 1QI0A 2XJ7A 1WDSA 1FH7A 1CZ1A 3QHNA 2YBTA 3MANA 4PMOA 2CKSA 2VJXA 2YA1A 1JZ8A 2D23A 4KWUA 2DH2A 4WSJA 1BQCA 3N9KA 4MNJA 1SFSA 3A4XA 2AAAA 1CXIA 2W4XA 2D3NA 3BAXA 3BMWA 3W6MA
chains in the Genus database with same CATH superfamily
2X09A 2A2IA 3VU2A 3A4WA 1L6SA 1BKSA 4L1GA 5FJPA 3N9SA 4LUIA 5D8WA 5HUOA 3J7HA 4CNSA 3II1A 4LCRA 1S39A 3P7YA 4KEMA 1VYSX 5XIAA 1R86A 4TX9A 4DUWA 4UZSA 3DESA 4KEVA 1DJNA 1THFD 5CAKA 2C18A 1J4EA 2PLMA 1HG3A 3LGEA 2FJUB 2WOQA 4JTDA 1JDCA 4IMEA 1EJRC 2QVNA 2XIBA 3NSNA 4BCEA 2X7VA 5A6SA 2PDFA 4AU0A 3H8AA 3VIMA 3PHAA 1LOSA 4X9SA 4CKQA 2Y61A 7TIMA 4HNNA 2Y0FA 1BD0A 5C54A 1F8IA 2OVLA 3LHTA 4DF0A 4DNMA 1L8PA 4UFHA 5FACA 3VNMA 5LIWX 2XFFA 1WAWA 5D30A 1EWEA 3CQJA 4IOTA 3URQA 3T08A 4J9JA 3ZT5A 4C6DA 4US6A 4YS1A 4FALA 4JL1A 2VM8A 3LD5A 3QFWA 4NUWA 2QUVA 3GXDA 5CH9A 3ALFA 4QNEA 2ABBA 4U10A 4L65A 4N42A 1DV7A 2JBMA 1P0BA 2I57A 4DB7A 4ML4A 1CYGA 4Z1YA 2HTMA 4YWIA 2YR1A 3KLLA 2HRWA 1T99A 3B8SA 1EEPA 3GD6A 3DFTA 4Y9AA 1RD5A 1KM3A 3NNTA 4NJJA 1K8YA 2WW5A 1K7FA 2POZA 1F3WA 1OT1A 5HINA 1G01A 5EBAA 4W93A 4D9PA 1R47A 3OP2A 4JOMA 4GGBA 5AC6A 3QR3A 3I68A 1XRSA 4HK5A 1L6WA 1VF8A 1H7WA 3RJXA 3N6JA 3TONA 1C93A 3R0DA 5T91A 4DYEA 1N8IA 3WLNA 2EG8A 4YTUA 1E9YB 1A0EA 1M5WA 1YKWA 4OUIA 8XIAA 1IEVA 3HPFA 5BNKA 2PMQA 3AALA 2J9XA 3TWBA 3VDHA 2PWHA 3BV4A 4GABA 3BLLA 2V5CA 3MDUA 2VTFA 4B3LA 2W5FA 3N2MA 2WNNA 2EPHA 1ZP3A 1ME7A 3B8UA 3TTEA 3RYSA 5F2GA 4HZ6A 3OLDA 4YTQA 2ANUA 3GNDA 4ZQPA 4V27A 4H7ZA 2PDWA 4KH2A 1BLIA 1QU4A 3L5MA 3PBYA 1VD6A 3GBEA 3VD5A 4DQWA 1F5ZA 4J3WA 3GHTA 2BGNE 2QJGA 3W53A 2ZZ1A 4U5KA 3W1PA 5D9OA 2Q8XA 2XWEA 1TQXA 4I7WA 4KF1A 3VXGA 1XH0A 3LNMA 4FIQA 1DIOA 3MMTA 1R8LA 2X41A 3W1UA 3WUFA 2JIWA 3S9IA 4GFSA 2GVLA 4S2BA 2J7GA 2FJKA 2NZLA 4O10A 2J62A 1WYIA 4M51A 2O9PA 4XZIA 4B3KA 4R53A 3VZXA 4UQDA 4I5UA 4ZE4A 2ZUSA 3P82A 3LPFA 1E6SM 1TPVA 5FKYA 1DXFA 4XAGA 4J3ZA 3ZJKA 3VNDA 1OG6A 4CU6A 3HPSA 1RP9A 3H12A 2YDRA 1ZBVA 1W1YA 3G3DA 3S1WA 3CH0A 1P7TB 3AROA 4UQBA 3AIRA 1X8FA 5CC7A 3B0UX 7ENLA 3PG9A 3GQYA 3ARPA 3JU2A 2DIJA 2XZ7A 1JZ2A 3KP0A 4DJFA 3UZJA 1VHCA 4HMCA 3URBA 5G2HA 1DWAM 5HWMA 3DHFA 1NFGA 4FX8A 1E4NA 3LXCA 2JGQA 4QDPA 2XSBA 1VIZA 3A23A 3CTTA 3M44A 1EUAA 3DGRA 5SWUA 2ATSA 3SUSA 2OFJA 2BNJA 2XIIA 1ITXA 5E9XA 3WQ8A 1X39A 2NXGA 1EKOA 1W9DM 2QJHA 1UWAA 3EOUA 3CV6A 4M29A 3UESA 6ALDA 3GDLA 3TYBA 1PHWA 2Y4SA 4Q8QA 2BV9A 2ZE3A 1UKPA 3SFWA 1M7JA 1XQKA 1VRDA 3URAA 3S1GA 3W07A 4HPGA 4IICA 2J8FA 3V3WA 3EDFA 3SDOA 3ZM8A 2WHKA 1TREA 2HDJA 5EFDA 1QPOA 3W1XA 4JFSA 4UNKA 3SURA 1K70A 4FLRA 3K8KA 1XSKA 1AG1O 3BDKA 2HK0A 3MA8A 4IX2A 4DO5A 2G3MA 5I6SA 2VCBA 3U3HA 1DIKA 1CXLA 3AXXA 2FPTA 3CAWA 1OADA 3EMQA 3WN6A 5D09A 4G2DA 4ZVJA 5I06A 2XTKA 1C3FA 4AIEA 1FHLA 2O4QA 1ZL1A 4P5UA 2OJPA 4CCZA 1SJDA 4M1BA 4D6HA 1OK4A 1FCUA 4RZ4A 1MRAA 4H9TA 3K8MA 1Z8AA 4QLKA 1Y5VA 5G4WA 1O6IA 4YNGA 3W83A 1OWQA 3QH2A 2A21A 2W0UA 4QCEA 3WQWA 2QCFA 3RRAA 4NAEB 3WNMA 1E71M 4JTGA 3TJLA 4IFKA 3W82A 2HS6A 4K68A 4OV4A 1RQBA 1QHPA 4GXPA 2C15A 3ZMRA 3DBPA 3GSMA 5AHEA 3SW6A 3NSXA 4LSBA 4JIRA 4XKYB 4UC5A 3NAVA 4UFMA 3HQ1A 5D4YA 2YCLB 3OLEA 5FESA 1CT5A 1FRBA 4S3KA 4Q3MA 2PGRA 1S3HA 3LMZA 3PUOA 2TYSA 2YW3A 1WB0A 3PUGA 1QPRA 1WKDA 5DMYA 2D2HA 2ZZ3A 3LDVA 3WDPP 2D22A 1UCWA 2W6RA 5CPSA 2XU2A 3NGJA 1OIMA 3W75A 2P3EA 1R2RA 1QR7A 3QGVA 1YXYA 2I5GA 3QV7A 4KWOA 4ACYA 4JCMA 3WY1A 4O1FA 2BXZA 3P84A 3LG3A 1UH3A 3GZAA 2ZRZA 5C70A 4MIMA 2R24A 3BPWA 4MJZA 4MJ2A 3AJXA 1EGMA 3QLDA 3UXIA 4JKMA 5I3DA 1EEXA 3BCDA 4UB9A 2V5JA 2YA2A 2GVJA 3H2NA 4KGJA 1XBXA 5M2FX 4QJ5B 5TD4A 4JR5A 1J79A 2WM0A 3PY2A 1F4HA 1QAPA 3K4AA 5CGTA 5A8NA 2X16A 2ACSA 2E7FA 5H6HA 1W56A 3CK5A 1SM9A 1XIFA 3M64A 4GJJA 1Q6FA 4O16A 3UZZA 4MAZA 1UZ1A 1GQJA 3ICJA 3R6IA 4PCPA 4W7VA 2BBFA 3QSRA 1ESWA 5JVLA 4WDXA 4GFIA 3WSUA 3F4WA 5A5WA 2YXOA 4P2VA 1EBGA 4LALA 2YBVA 5LIXX 4H1ZA 5E6ZA 4B5NA 2XVGA 4CQAA 2WZIA 1GJUA 1E4MM 3UBPC 4L1XA 2E9MA 4QCFA 2BOFX 4L1WA 2VCCA 4AISA 3P3BA 4E2BA 2YLAA 3NDZA 2FZ9A 2VOTA 4N9EA 3RM8A 2FZ8A 1LYXA 4JTFA 4A3RA 2ZTJA 1ONXA 1XHGA 4AZ6A 4GRSA 2C16A 3TOYA 5A2AA 3UVAA 2XM2A 1V79A 4IPJA 2Z1WA 1HXJA 1GTEA 2P50A 1ITCA 4H8VA 3W01A 3WLJA 3GX9A 4K2SA 1JCTA 3FY1A 4E6MA 2DUXA 3OLIA 1V8EA 3MU7A 4CGTA 4LQ1A 4O57A 1NSJA 4NZ1A 1BWVA 3MV11 7TAAA 2VR4A 1J93A 2OZ3A 1UP2A 2H3BA 4X22A 4GVHA 2RJGA 3SJ3A 2WVSA 2F6XA 4TVDA 4N9DA 4NL1A 1S1PA 4DYJA 1UUOA 3QZ6A 2Q71A 3VOGA 1MW0A 3M0XA 2KZHA 2NUWA 5HAOA 4GYJA 4GG9A 1HJSA 3VM7A 2XGIA 3P62A 4H6KA 3PZUA 4GX9A 2CZVA 3CQHA 2QCLA 3V5FA 3H2OA 2DJLA 4NX0A 3FSTA 1JFXA 1FCBA 5EL1A 1J0KA 4V15A 2E8YA 1MZHA 4JYDA 2HQAA 3BLEA 1SMAA 3OVGA 5AYXA 2JF7A 3IARA 3S2MA 2ZA2A 4C6CA 1TJPA 2FVKA 4P7NA 1XDJA 5CZTA 2WHMA 3N6QA 4ZZ9A 4PBEA 4JN6A 1OFBA 3N17A 4AXNA 4Q8PA 2CLFA 3S5OA 2DVUA 1F07A 4IQDA 2VFDA 2PZ0A 2HROA 3LCGA 2I5QA 1GONA 2OCZA 3DFYA 4IP4A 2YDAA 1D7KA 2NT1A 4IPIA 4JTTA 3NWRA 3ONCA 3W7IA 3GKAA 1PZ1A 4XG1A 3DECA 4M80A 3AS1A 5LHFA 1YDOA 3I7SA 1GUVA 1YNPA 5A8QA 1J18A 3RLVA 3D3AA 3HQNA 2Q3RA 2OMAA 4DXXA 3LRMA 3QR1A 1TWWA 3WBXA 4EF9A 3LBCA 1BYBA 1RJRA 3P14A 3BMXA 4NG3A 4HD5A 2QDDA 1UIOA 3M0HA 2DUZA 3TMQA 1XIDA 5MKGA 3FJNA 5J04A 3E1F1 3E38A 3UERA 3BZJA 4N7QA 4Y8FA 1DQXA 1X7FA 5D37A 3VC6A 1C8VA 4XV0A 2D69A 3VGDA 3GW0A 3AS3A 1MUCA 3OZMA 4IIGA 3NQ2A 2FMNA 2VZVA 4PUMA 1OF8A 3PTMA 3IUIA 1PIIA 3GTNA 4F2UA 4MYAA 4XZMX 2PWFA 3W0KA 1NARA 4M7SA 1VJZA 3CGTA 4NRSA 1T0OA 4Y9NA 3WJSA 4DJDC 4GKTA 4HTYA 3IRDA 2IKHA 4QLJA 3VNZA 1GVRA 3OW1A 4UUIA 1YADA 4AEOA 2XG9A 1AVAA 2PTWA 4BI6A 1B3ZA 2A85A 2DSWA 1B3YA 4JTAA 2XHYA 4M56A 3FYYA 3JVAA 3KBSA 4DI9A 1V0NA 3UWZA 1S5WA 1GKQA 3K4WA 3TFCA 3LOTA 3L68A 2V5BA 1ZTVA 1Z89A 2PD9A 1C9DA 3WDJA 5F2MA 4XBKA 1J0YA 4JTEA 3BCFA 2ZUWA 3CUHA 1EFZA 3SGZA 1S2VA 3WDQA 1UKSA 2O7QA 2A7NA 4AD3A 3MSYA 1JYWA 4MZ1A 3DU0A 1JPMA 5A2BA 5DX7A 3UJFA 3BGAA 1Q66A 4H00A 3NFUA 1QMLA 2WBKA 2Z7KA 2FH6A 1R3SA 3AHXA 3KLKA 2V3DA 1XH1A 2WAGA 1NM9A 1UQYA 4FOKA 2C79A 1R46A 2XM1A 5HUPA 1KXQA 2PDMA 2IXUA 2QF7A 2YFOA 1A5OC 2C7FA 3E3HA 2A79A 4DBSA 1T5AA 5IXEA 4TMBA 2UY2A 4Y9OA 1CGYA 3WF1A 4EWND 3GWQA 1KRMA 3OVPA 2VVSA 1HTIA 3MUIA 3TP4A 1KA9F 3LNPA 4B90A 3EOOA 2QGHA 3WELA 3LCHA 3W1RA 4H3DA 1C92A 5IFTA 3UR5A 3DAQA 1LT7A 1Q5MA 1EZ2A 4UQEA 5F4WA 1KBIA 3HIJA 1V6XA 1FXPA 3IJ9A 5J8LA 4ZO8A 2ZA3A 1T8QA 3KXQA 1H7RA 1AZ1A 4HHLA 3GNRA 4XZHA 4H9UA 3L9CA 1WDQA 4CEXC 3WUGA 3NXLA 4W84A 5EY5A 3SQMA 4DY1A 4WJEA 1HKIA 1PWMA 1UIPA 2GYIA 3P5ZA 3K5XA 4OTKA 1TV8A 2EKCA 4LYQA 1CDGA 1G4TA 1DHKA 2J9ZA 4LOCA 3WH6A 4MDPA 4ECLA 3SIZA 3GFZA 1UR4A 4KFNA 3VNKA 3T0BA 3MSRA 1W9UA 2VEMA 1WV2A 1JF6A 4JS3A 1E55A 1JDDA 1XLFA 4AMAA 4KBXA 1NFBA 3N3MA 3TA9A 3LPGA 2GUUA 4IMDA 3AFBA 1JDEA 1M53A 5A6AA 5K3VA 4OOZA 1TSIA 4ZA0A 4B15A 3ABQA 4FNPA 1TCDA 3UZWA 1HNYA 4A3HA 4P7QA 1DYSA 3STGA 1CGWA 3GVVA 1AH4A 4O4VA 3AQUA 4MPKA 3HZ3A 1JZ4A 1W8GA 1IT8A 3MHUA 5K4XA 2HE8A 1S5TA 3R8RA 2VCAA 3CUXA 1W3NA 3K46A 1UG6A 2DPEA 1AA1B 3WF3A 3KTCA 4LH8A 2ZZ2A 5LNVA 1ZJBA 4HCLA 3AU2A 4LRSA 4I5RA 3CEUA 3H4XA 4BFAA 1XIBA 4RLIA 1XYLA 3AMCA 4CCCA 4POCA 1UJQA 2WLYA 3NURA 2TMDA 3GHRA 1CXEA 2A3BA 1H0IA 4HHMA 5GJNA 3EDEA 3U2CA 1P0DA 3HM7A 4DUVA 1ZAJA 3HOJA 3V18A 3QHMA 4FXJA 4C7GA 1H7XA 3EDKA 3F4DA 3FA3A 2O0TA 3CHDA 4UQCA 4M1RA 1OYAA 1GEQA 2D2OA 4O8RA 1LLWA 4XD6A 4V1XA 4QITA 3CYVA 4PZVA 3A47A 4NIRA 2CZ5A 4MNMA 2DUAA 3MY9A 4J3TA 2Q3OA 3E2QA 3AIQA 3W7DA 3KVMA 4H9ZA 4H01A 3H2FA 3GVQA 2G4FA 5DO8A 5CZKA 3BAIA 3WF4A 1MW2A 1S38A 4LC6A 3UR7A 2WMHA 2OSWA 2V2CA 3CU2A 4LF2A 1L2UA 4I5XA 2OLHA 4Q6JA 3W7GA 2ZX8A 3NPWA 1PTDA 3GC4A 1OT2A 4GIEA 4HCDA 1K6AA 3EBVA 2YPIA 2CLEA 1XLHA 4R5EA 3TX9A 1I2QA 2ACQA 1W0MA 1QHOA 3OA3A 1W31A 1OFAA 4LB3A 3G1YA 2CITA 4DXKA 2GK1B 4UTTC 3G1AA 3WQFA 2BVWA 4C6FA 3F4NA 3FN9A 3SCVA 1YX1A 3FKKA 3HMCA 1A5NC 1TWIA 3WNNA 3IEBA 1E0WA 4DNHA 1FCVA 3KW3A 3LX9A 2Q6ZA 3PJXA 1DHPA 3W4RA 1OD8A 1B54A 3IANA 5HNNA 4LF1A 1XUZA 4M7TA 1ECEA 2VWSA 3QJAA 2IMRA 4AY7A 1JG9A 4FNQA 2OXNA 1KM5A 1UPPA 3QMRA 1HIZA 3K30A 2QMJA 3K1GA 3KZSA 4RDVA 3S6OA 3AZRA 3E0IA 3DG7A 4GO9A 1V0LA 2VQTA 1UH4A 2OWXA 2EGZA 1W1TA 3WFLA 4LC8A 2B0MA 3LMYA 5AHIA 1JNDA 4HN4A 4ZOEA 4Q4MA 4HPHA 5CPQA 3RRXA 4HYWA 3KRBA 3HN3A 4JTLA 1ISWA 2UY5A 1KFWA 1WE5A 2F6KA 4HMDA 3O6YX 5AZ1A 3QF0A 1I75A 4WDUA 3I3BA 3VD9A 2HMCA 1XKYA 1XLLA 2GK1A 3O07A 4J3VA 1FWSA 4WSHA 4QJ3B 3TXVA 3VUPA 1OCNA 4TVCA 4Q8WA 1XKJA 5BCAA 3QKZA 1DJQA 3GG1A 2JALA 2X0YA 3A5FA 5E70A 3OGRA 2VQUA 4DUXA 2W62A 3PTDA 2PDJA 5G4HC 3UWUA 1KFCA 4WUIA 4S3BA 1XCXA 1W91A 4HPXA 4AIOA 1CLKA 3O1NA 1W9PA 3KM8A 3PZQA 1I2NA 3PZTA 3CMJA 3H23A 1H2JA 5D04C 2VP8A 3B40A 5HR7A 4NJHA 3HGJA 1WDPA 1RK5A 2WMFA 1JUBA 3A4AA 4L4OA 1GNXA 4F8XA 4U33A 2PDBA 3UR2A 3AMKA 5AB3A 3TV8A 1CGTA 1SO6A 1A47A 4LY4A 1ZHAA 3MUXA 3UG3A 2DQXA 3L4UA 4BF9A 4YVXA 1AQMA 1K7EA 2DW6A 1VCVA 2Y8UA 4GA8A 4JQ3A 1J6PA 3SQSA 6XIMA 1B30A 1X1OA 3CZ8A 1SZNA 3RM9A 4F48A 1RY8A 2FHBA 2MUCA 5HANA 4KESA 4Q4OA 5T8GA 1MW1A 3M0IA 3OHIA 1QW9A 4FAMA 5TF0A 1W1A1 1SO4A 5I03A 3GXNA 5EFFA 2QCGA 4A8LA 1HVXA 4DWSC 2QZRA 3JZEA 2ALRA 4UNLA 4HGXA 1ZPTA 1J8VA 4DJED 4RDZA 3QN3A 3HGRA 2O9OA 2G5WA 4RE0A 4O11A 2WV8A 4A21A 3T2OA 7XIMA 1FA2A 3T42A 3WLKX 4BWLA 1AD1A 1JGIA 4GWEA 1E3ZA 1G67A 2EJAA 1OIFA 1S5NA 2OWWA 4J28A 1FVPA 5AOUA 4AD5A 3UJSA 1BRLA 1ISXA 6A3HA 3U4FA 4NHVA 5CG7A 1XCWA 4H6RA 2F6UA 2F8QA 5HDRA 4XD5A 1UD3A 2J7FA 3CQIA 4U3AA 3DHDA 4XTDA 3USZA 1J0JA 2FLIA 3UFYA 2VX7A 1ELSA 2ZE0A 3EX2A 1AUSL 4IGMA 2OGJA 3F4VA 5M17A 3WJWA 4GXMA 3GK0A 5I3KA 4CQBA 5M03A 1CECA 2OT0A 3CLWA 1O1ZA 5DLCA 1XLEA 3F7JA 3KOFA 4L4MA 1SW7A 4ZEPA 4MGGA 1K3UA 2BY2A 3K8LA 4P7LA 3V36A 1UPMB 5CSSA 1FWWA 1IT7A 4FNSA 4HIBA 3N1AA 1G0CA 4X3ZA 2C8NA 4GX8A 5A2CA 1IE7C 3MYPA 2H9AA 3L5AA 3P93A 3R1ZA 1EJXC 4REQB 4HZMA 4D1JA 5JQ9A 3W74A 2NQJA 3KEHA 3DX5A 4HA0A 2F38A 3QFEA 3TYEA 2WKGA 3ZVHB 1DTUA 1K8XA 3KAOA 3DDMA 4KMQA 2V69A 1S2WA 3CASA 5D38A 2O9RA 1R3RA 3L2LA 1XLGA 1GVFA 1M41A 1VPXA 2NVCA 4JDBA 1WKEA 2WVVA 4BQ5A 2WSKA 3B4YA 2Q8ZA 3W1TA 1YPXA 1HJQA 3SRDA 2IW0A 4LS2A 1NDWA 2QEZA 3MWAA 3VX0A 1P0NA 1YNYA 1OM0A 5IFPA 2ZXQA 4IHCA 5BZAA 5CSRA 3G24A 3HFTA 3AYTA 4DM1A 4L7ZA 4MM1A 3B8TA 1TPEA 5DBTA 4H04A 1IWAA 4A8NA 4CNNA 3VDBA 2PBGA 4KETA 2H6RA 1V6UA 3CC1A 4CUCA 3U57A 1EJSC 3EA1A 3FAWA 1FWGC 4XZ9A 4LB4A 1BEUA 5I00A 5K7JA 2E5DA 4WXYA 4UZUA 3V0SA 1KM4A 1ZBCA 3NQVA 4XZNX 3ZWSA 4DZIA 3ZQ9A 1VEOA 2IXVA 3PUEA 4MFDA 1JCYA 1H1NA 4XD3A 4X60A 2C1IA 2B7QA 4ES4A 4J35A 1W5PA 1WDRA 4K6AA 3ZT7A 3ITXA 2J25A 5AHFA 3O06A 1E3XA 2Y63A 1BGGA 2NWSA 4NSBA 1ZENA 4F0LA 2PWVA 1YYAA 3UWEA 3B8WA 4Z0SA 3WQVA 3GNPA 4HU4A 2Y7GA 2FQIA 3T2PA 4I3GA 4M19A 4YTTA 1B9BA 1HZYA 3ISIX 3SRFA 3WUBA 4ENLA 4XK2A 3AISA 2IKGA 2OWCA 1KQYA 2I17A 1W2PA 3JR2A 4CCDA 3BJFA 4WK9A 4XKMA 1PIGA 4TTUA 1B1YA 2V5LA 3GAYA 2AGKA 2ICSA 3WJXA 4IFOA 3UPBA 4DIAA 3ANUA 1TRIA 3TOPA 1UQZA 2DW7A 2OU4A 4H7CA 2J24A 3M5ZA 2AL1A 5LKYA 5G1MA 3N11A 3GC5A 1GOWA 3BSHA 4GC3A 3N4AA 3EPNA 2YCJA 1V6YA 2KX9A 4IIDA 4C6QA 3C2OA 3NM1A 4UTHA 2OEKA 1MEHA 4L5ZA 1HO4A 2E6DA 1EX5A 1UR8A 1FHUA 5EBUA 1R3WA 6PTDA 1WUFA 1IEWA 4D6GA 2RGLA 3EWZA 3BAYA 3L21A 3ABOA 3BL3A 2SFPA 2HPIA 3W1AA 1DWJM 4PH6A 5BXSA 1LP6A 3VOJA 1MFVA 2FZMA 4ZO9A 3W2MA 3W71A 3QV6A 4AZHA 4DPPA 4U5IA 2OLAA 4BEQA 5ECUA 2ZWYA 4R9XA 1FH7A 1CZ1A 3QHNA 1FKWA 2YBTA 3G1HA 2VJXA 3BO9A 1KV8A 3USBA 2AAAA 1CXIA 3GUWA 2D3NA 3EKLA 2V82A 3EB2A 3W02A 1NVMA 1FDZA 1QI3A 3B05A 4R34A 1BQGA 4MNKA 3V5CA 3ARWA 4LVBA 4Q8TA 1D9EA 3QOMA 4JCLA 1CENA 2E5CA 2ZZ4A 4BF7A 5A6BD 3EAUA 1YPIA 3ITCA 4A35A 3THCA 1W1IE 2E4TA 1X97A 1OCJA 3LPPA 4HNCA 4LNYA 4UFKA 1ITQA 1VB9A 2WMKA 1QNRA 5BRQA 3LCLA 1Q6RA 5AN7A 2QGYA 4GI8A 1ONRA 1CXFA 4A05A 1ZQ5A 5AFDA 4Q22A 2VFFA 3FEQA 3MT1A 4LV9A 3E9AA 1PV8A 4IFRA 3LXBA 3M0JA 4W7UA 4QIUA 3B9AA 3QYSA 3EKGA 5BOEA 4PUEA 2J74A 3GH4A 2OOFA 4ZL1A 2CZEA 1TUXA 4Z08A 1H62A 1RPXA 4GUHA 5CZ0A 4RUBA 3MP3A 3GNXA 4WJXA 2FPVA 4MVAA 2V81A 1EUNA 3B06A 1MSSA 1FY6A 4LYPA 1U1UA 4Y7EA 5ABEA 4AWTA 3W2NA 1XICA 3R94A 3GDKA 4JHOA 4S1FA 4F40A 2J13A 2QCCA 4FNRA 3DFPA 4LYKA 5D9PA 3UY7A 2XH7A 3PS7A 1MUMA 1QI2A 3WLOA 1E4IA 2VRJA 5LSMA 1BG4A 1EHAA 2V3FA 4DZHA 4PGLA 1OB0A 1QOQA 1TX0A 3MKVA 1Q6EA 3O6DA 4B2DA 4GMEA 4ZCWA 4JYEA 2OX1A 4JYFA 3CO8A 2NQZA 5IRPA 1NH6A 2F2KA 1C7SA 2ZVRA 1PX4A 4FA3A 3PUDA 1B3VA 4MF4A 1ZFJA 4DELA 1ZZMA 1ENUA 2BSLA 2YXGA 1V3KA 2GLKA 3IIXA 3OGVA 3M41A 1UP0A 1MQRA 4HCHA 3KUMA 3APYA 3PBWA 1E4LA 2HBXA 4G7EA 1E51A 3W85A 5D9MA 3SUUA 1O68A 5CJMA 1NU5A 1T41A 3DI0A 4HTBA 4TX8A 2J6VA 3RMJA 1RSCA 1EPVA 4LY8A 3O0FA 4QFUA 5REQA 4CLMA 3B0VC 5ABFA 3RX4A 1MXSA 4C1NA 2BTMA 4JTIA 3O8AA 3ZJ7A 2OT1A 5FF3A 4GVIA 1XBVA 1UWSA 1EJTC 1EP1A 2FH8A 3MBDA 2CWXA 5DY3A 3ZOAA 3UPMA 1EO5A 3LN3A 4MOZA 3ZR6A 4FPSA 4C5ZA 2JK2A 3OTRA 3U2ZA 3OZOA 3NVTA 1V0MA 1QNOA 2ASHA 3EXRA 1QK0A 1P6CA 2I5IA 2L5HA 3ARVA 2CBUA 2P0OA 3L65A 2OODA 5B7ZA 5CBJA 3AWOA 4HSNA 3K1DA 5T26A 2WZTA 2J9YA 5FEXA 1J6OA 3SGGA 1TE1A 2V2HA 2XIQA 2DT0A 4S3EA 3EX4A 4QQ3A 2BP1A 4TUFA 4J2PA 1UROA 2Q01A 3OU8A 5L9FA 4DAFA 3A13A 3TSBA 5KZEA 1LF1A 3K13A 1RD6A 3RU8X 5HJLA 4NXSA 4LANA 1GEHA 2XGBA 3KTSA 2FHCA 6TIMA 3IJLA 1BYCA 3WH7A 5E1QA 1JI1A 1OSEA 3KZPA 1TR9A 1SFJA 3MI2A 4MWAE 4ZB0A 1KD0A 5K9DA 1RHCA 1UD8A 2B4GA 4BI7A 1ZY9A 2PPGA 3CNYA 3C2RA 3S47A 4GZJA 3NCOA 4MADA 4ML9A 2A4AA 3BG5A 4GH3A 4AAJA 2CETA 1VFFA 3BLDA 4MHBA 4ZQRA 3G5EA 4PRRA 1RV8A 2RDWA 2Z1XA 3LB0A 4UWMA 5HJXA 1Y5XA 3NL3A 1GWJA 3G6LA 3BOFA 4JTCA 3NPXA 2PI6A 5HMSA 3SSZA 4IUGA 3WBYA 2Y7EA 4W9TA 2D3LA 2FMOA 3NQDA 3WD1A 1EPXA 1MEWA 1LWIA 1OX5A 2RDXA 5HNUA 1EDTA 3GG7A 4CD5A 1B5TA 1R7AA 2PDCA 3EB4A 1RY0A 2FVLA 4AZGA 2YYTA 4UOJA 5EU9A 1LG1A 3RF9A 4S23A 1EYEA 1VFMA 1JYVA 3CZLA 2ISFA 1NELA 5EMMA 2OTDA 1JAEA 1JXKA 3OZYA 4L9ZA 3RR1A 1KW1A 4DLFA 2I56A 3W1NA 3G8EA 3DFHA 3GAKA 3AZSA 1A80A 3L0NA 1E6NA 4IZGA 5K9CA 2E0PA 3VK5A 2DJXA 4GGHA 1LOQA 4KIEA 3C3UA 2VNCA 1E56A 3EEGA 2FDMA 3NO3A 3KDNA 5EMUA 3NL6A 3QMTA 1FHDA 4BZYA 5C9WA 1IHIA 4L64A 1CXKA 4MJ4A 4M6UA 1P4CA 3FA4A 4JL2A 3W26A 3P61A 1VPYA 1JNEA 4M81A 4AY1A 2VX4A 3RG6A 4E8GA 4DBEA 4O53A 4CN4A 1LBLA 2D2JA 3BMVA 2ZUMA 4FXRA 3QQ0A 4NJIA 1V4YA 1AODA 5FIPA 3QOKA 5PTDA 1OF6A 3L4TA 5E0FA 3P8JA 4ORMA 4W4QA 3CZJA 4GQBA 3ATZA 3M0LA 3W3OA 4L6DA 3ALGA 1XM3A 3L0KA 4XO6A 3TW6A 1YE6A 3MW7A 2DORA 4LYRA 2YB4A 1IZCA 2PWDA 4YCPA 1MEIA 5CJ5A 3TROA 1VCFA 3UW6A 2WHLA 3SB0A 3FA5A 4DWSD 5IHRA 2BVTA 2YKKA 4DO4A 2BXVA 4RK8A 2H8XA 3E49A 4YL2A 1PL9A 1V7YA 3GVGA 3RUBL 2CPUA 4DBUA 5T9BG 3PNZA 5HR6A 3F5JA 3IK2A 2I9EA 3M4HA 1TMQA 4MPQA 3KDOA 3KVLA 5GVJA 3A4JA 2WNZA 4ORIA 1EDQA 1FWTA 3GFXA 2A6LA 3Q58A 1LWHA 5JIPA 3N3TA 2JIEA 3I6TA 3A9BA 1RQHA 1HT6A 4AXKA 1SUXA 1VRXA 4OUEA 4V33A 2C13A 1FWFC 1BAGA 1L0PA 2DVTA 5JBFA 1VBJA 1LTDA 3UF9A 1EJ7L 5HK4A 1IV8A 1JXJA 2YCIX 3BWWA 1ECQA 2PDNA 3LS9A 3KVJA 3TC6A 1J0HA 1XUUA 1REQB 4KEZA 3RDKA 2CLMA 3PZIA 4KRZA 5XIMA 1GW1A 2DP3A 4GY1A 4IUOA 1OFQA 2X1RA 3POHA 4RE4A 1OCQA 3QLLA 3VIPA 1A53A 4W87A 2P8CA 1XWYA 1HGYA 2V5KA 5AHLA 2PBOA 3VIFA 3KOXA 1IXQA 8RUCA 1QPNA 3NYZA 2GOUA 1TIMA 3VGGA 2W9MA 5HMFA 3C61A 4PC8A 3GM8A 3TU9A 4W86A 2WSYA 2QV5A 3OA5A 2J8GA 3RIKA 3VFLA 2ZZ5A 1SR9A 1XPYA 2ONEA 4CN1A 3IGUA 3HF3A 5GNZA 2AL2A 3GS6A 1C8XA 3SM0A 6TAAA 4CCEA 3KCLA 3OBEA 1EYWA 1MWOA 1XI3A 2YFNA 3N34A 4Z42C 2ODOA 2ACUA 4W7WA 3WBAA 3VCNA 1RPKA 4RR4A 1PKNA 4JX5A 3WF2A 5CSUA 3MJMA 4YXGA 3E96A 3T6CA 9XIAA 2GGEA 5GNXA 5RUBA 4YCOA 1CPUA 4Z1CA 3V0UA 1SYTA 1R87A 3OYXA 1GQKA 4AMCA 3SEPA 1H61A 3P0WA 1MQQA 2DZUA 1NQKA 4HNTA 1LLZA 4S39A 1V3IA 2XN0A 5D2YA 1TKKA 2GSEA 4QLLA 4MB5A 4P8WA 2VC5A 3W7HA 4ZB5A 3W6LA 3M5XA 3S1UA 3VOFA 4RJEA 4NZ5A 3ME3A 3V1PA 3MVIA 2P1FA 2PDQA 4ICMA 3OIXA 4M5PA 3SO7A 5ABTA 4HOZA 3T0TA 5GNYA 4QGCA 1SJCA 3SUVA 2ADAA 1XG4A 2GJPA 1JGMA 2VUNA 1K4GA 4KS0A 1F74A 3R0KA 5B7YA 5FF2A 2PP3A 3CL8A 4ADSA 3E12A 1XJBA 2RAGA 1H1YA 4INFA 3C5QA 4ZR8A 1KWKA 1UC4A 3SN4A 3UZXA 1CCWB 1JR1A 2EG6A 2DIKA 2ZRVA 4EXBA 1UMLA 1AW5A 4MWAB 3N9RA 2PTYA 2DSUA 3VE9A 2BVYA 2PFHA 4GI6A 4PTDA 4ZXLA 1I8JA 1NFPA 5I79A 4AWUA 2OYKA 3W29A 4PMNA 2Z1KA 4HU8A 4RXGA 3A21A 3D6NA 5J5DA 2O7SA 4BHYA 5DT5A 1DWIM 1RH9A 4IT1A 3SCUA 4A2SA 4MKSA 3DH7A 1EIBA 1SJAA 3CLMA 3VTRA 3N6HA 4D71A 3EWWA 3VOHA 3EPMA 3GB6A 1EL3A 1EJWC 3C2VA 4MY8A 1SPQA 1XSJA 1FH8A 3DYOA 1M04A 3UZYA 1JYXA 2QAFA 1R2SA 5BOOA 1OFEA 2VO5A 4FIRA 1Q8AA 1Z48A 1RLCL 1RK6A 3C0SA 2OQLA 4AC7C 3A3HA 4JD4A 5D8ZA 1R2TA 1XBZA 1EB3A 4WD0A 1OQFA 1TIWA 1R38A 2CERA 4ADUA 2PP1A 3B9EA 1MDRA 4O17A 3QC3A 4GH1A 3UNTA 1F05A 1UYQA 1C9WA 1YLVA 1WZMA 1UWIA 4MWAA 4IF2A 1TELA 4WHBA 2OKOA 1A3WA 4F2BA 2X40A 1VQTA 3WH8A 5AYIA 3VKDA 4ZOBA 3OQ8A 4NYUA 1LL7A 4LUTA 1AMYA 3PBVA 4US5D 1K02A 1BRLB 1F6PA 2EPOA 1Q4WA 1YBQA 2HEJA 4C6IA 1GG0A 4RCXA 1R0MA 2DFAA 4CD6A 3S2LA 1I45A 1NWUA 3NO5A 3VZZA 5D2TA 4XKYA 1W3HA 1I1XA 3G3MA 5HPOA 2QDHA 4AX6A 2DIEA 1CTNA 3WUEA 1TJ0A 1F6YA 2QCDB 3SJNA 5A1AA 4L9YA 1O60A 4LNCA 3PZGA 1HJUA 2MNRA 3U7VA 2XH2A 2PB1A 1XDLA 1QO2A 1Z7AA 5A8GA 4C6OA 4F79A 5C6MA 5DANA 2Z1SA 4DAIA 3W7KA 3CHVA 1U1HA 3MHGA 3UCCA 4H6QA 1WKYA 3NA8A 3RLUA 3DC0A 4H9YA 1XL9A 3H6OA 1EDGA 5TAOA 2H9AB 1PIFA 1HL8A 1GKRA 4DHGA 1W17A 5CJNA 1TTJA 3H7UA 2J8TA 2XH0A 3LCIA 1HL9A 2CEQA 3M0YA 3OG2A 3ABXA 1E9IA 1B4KA 3WG6A 3NPUA 4KQNA 2JE8A 3CPGA 2PF0A 3AU6A 2XPKA 1VEMA 3NZ1A 2R14A 1S1RA 3CZKA 1F7BA 3SSJA 3PJTA 3UR8A 1Q4NX 1TJ2A 4JFTA 4CNUA 1XLKA 1GK8A 4X0NA 3LERA 3HJEA 3UZ5A 4WEVX 4RX0A 3L23A 1KM0A 7ODCA 2DEPA 3P80A 2VZSA 1ME9A 4U4MA 1M68A 1S2AA 4TTGA 1F4AA 3I6EA 1CI1A 1I2RA 2YGYA 5FEWA 1DJHA 2UBPC 4QISA 5CPTA 3LHYA 5HULA 2D0GA 2XDFA 2O4MA 3O2LA 3P5YA 4PTXA 4GUGA 2YYUA 2OGYA 4L61A 2FTPA 1Z69A 4X63A 3VGEA 1KRBC 1W9BM 4LCQA 4S38A 1U2YA 3NZGA 3U0HA 4NI8A 1XYMA 3MZNA 3TSDA 3PULA 4C60A 1A5MC 4DZ5A 3UWQA 1V3MA 2OEJA 3E02A 1KCZA 3N25A 4OHQA 4DJFC 3WH5A 2QJNA 4G8TA 2BX7A 3R0UA 1ZCOA 4L56A 3LA4A 1AD4A 2CBVA 4GQQA 1OYBA 3NTYA 4IMAA 5K4ZA 3TTOA 1Y8BA 1S5MA 2PS2A 2X30A 1GYNA 3FXYA 4FX6M 5JU6A 4RE2A 2QCMA 2YZ5A 4H2HA 1B57A 1G94A 1ME8A 1YNQA 4P7RA 3QPZA 3L0GA 1DWGM 3IVUA 3OIHA 4IX0A 5FAJA 4IPNB 4UIOA 1ZAIA 1G4SA 1S2TA 2Y5JA 1A50A 3KCOA 2FTWA 1C29A 3ABRA 2ZDSA 2WHJA 3G6MA 3M6DA 3P8IA 2GQ3A 2EF9A 4EAMA 3YPIA 2PDGA 3UETA 3MC5A 4QDWA 3W6YA 3FGCB 1FDJA 2WCSA 2EHHA 2A3AA 3VNIA 3IJQA 1EZWA 2VFGA 8A3HA 1EXPA 4HHHA 1CGXA 2VZUA 1J01A 1RQEA 1T7LA 2KAUC 4TQTA 4LFYA 2Y85A 5JH2A 1GVSA 3SZ8A 1UR1A 3KL0A 4L80A 5CKSA 1TMHA 1Q7QA 4HPJA 2WC4A 3MTWA 4NASA 4B5XA 2PEVA 3Q45A 3HMJG 4LS1A 2DZBA 3DGBA 4QAIA 5DN1A 2IUZA 4PMYA 2YLLA 3DEQA 2VXNA 5CQ1A 3OG3A 3HFYA 3BAJA 1HKMA 1SVDA 5I3IA 3GHUA 5CGQA 2YW4A 4MUPA 3B03A 1O4UA 1I4NA 1P1MA 3AIUA 2Z25A 3W86A 1J12A 3CT7A 1G7UA 3Q37A 4FNTA 1L8NA 2O55A 3WZ0E 1MUWA 1UMYA 2GQ9A 4BF5A 2VEKA 5BMXA 4ROQA 2X0SA 3F5LA 5BWFA 4FF5A 4E8DA 2C1HA 1Q6LA 5KZ6A 1GG1A 4GUJA 4HKPA 4LEQA 2NLIA 3H54A 1KCXA 4K1WA 1TWSA 4KCUA 3PBUA 3UJEA 5H1WA 3OPSA 1XINA 4GXWA 3HJZA 2AMGA 1L2QA 3W22A 1M3UA 4NZJA 1QATA 3UT0A 3VMOA 1BFNA 2G50A 3B0YA 2QVHA 2A7RA 1Q7ZA 2BGSA 4DWSB 4KGLA 2Z2BA 3FW6A 4AWSA 3BQ6A 3LCFA 4RDYA 5FAGA 4IFKB 3ZSTA 8XIMA 2DZTA 4O1CA 3WL1A 5DRCA 4IQJA 3RCMA 4JY9A 3D3FA 4Q8VA 5LNRA 2Y70A 4U28A 3GR4A 1KBKA 3PFRA 1OD0A 4U3CA 1FXQA 3HPZA 4JQAA 4P8UA 3WQDA 2Y24A 2DVXA 3DUGA 1TVPA 3ITLA 2NUXA 3WENA 5CZSA 4HNVA 3BTNA 4C1KA 2BHYA 3GFYA 2FKPA 1JYNA 4FLOA 3EZ4A 1SMDA 4PMQA 4B3ZA 1RXOB 2WANA 3VMNA 2OQYA 4URIA 1JQVA 4EACA 3JW7A 3DENA 3TTYA 4FNUA 3CUJA 4ZENA 3G2GA 2QUUA 1E0XA 5LNWA 2DQWA 2ZADA 4D6CA 1E6XM 4GQRA 3NSMA 2ON3A 6ENLA 2V38A 4DVOA 2ZBTA 4DYKA 4CQ9A 3R8GA 2EPNA 5EKYA 3SR7A 2XH4A 3OEXA 4HYRA 5DCEA 3ZR4A 4GYPA 3M5VA 1JRCA 4BQ3A 3GDTA 1W37A 1TQJA 5I7GA 2V5DA 3KWXA 1W3TA 3PZVA 3IIZA 5I0DA 4L4LA 5FF4A 2ZKMX 1BWKA 2QIWA 4PTNA 1GVEA 3W2JA 4W5UA 2EKGA 1E6QM 1OVDA 4QP0A 2VC9A 4GLEA 5A6BA 3CHCA 3NXFA 2W92A 3UG5A 3WMBA 1V02E 1FWEC 1QWGA 3F1QA 2QJJA 2GOKA 3L4VA 4UTWA 3W76A 1AJZA 5KZMA 3VM5A 1DJYA 1WZLA 2DZXA 4OECA 3T05A 4JEQA 1OHLA 1K7XA 3PVFA 1EQCA 1UOKA 5F2LA 3WLIA 2VI0A 1XLAA 4Q7IA 2I1OA 5H8UA 1TV3A 4LWWA 4D6FA 4NRRA 4P61A 2A3LA 3VAVA 2IKIA 1H41A 2VC7A 4IISA 1POJA 1XH2A 3AYSA 2HBVA 4PODA 3KRSA 5CC6A 1ZBKA 2E67A 5LIYX 3WMSA 1CLXA 2BG5A 1X7IA 2XVNA 1FFQA 1F3TA 4N4QA 3WQEA 5D05A 1GCYA 4FOUA 1EOMA 2PC4A 5A6MA 2QULA 5KSWA 2V30A 3TEVA 1IWPA 2VT0A 4CVUA 2QUTA 4AY8A 1NDZA 4DO7A 5AYYA 1NP2A 2VELA 2J78A 2FGBA 4O13A 3UCDA 3FS2A 4LUTB 3GO2A 4OFCA 1R3YA 4R88A 2OYLA 1EC8A 1SO5A 1JAKA 2NW0A 3WL0A 1J2WA 4UMCA 3GDRA 4J3XA 4AQLA 4O52A 3ABSA 1HVQA 3ERPA 3LRLA 1RVGA 4Y90A 2WJZA 3L5LA 4EIVA 3B8VA 4DUOA 4HOWA 1P43A 3PWAA 4OBRA 3LHVA 2GDVA 1M9HA 3O15A 3SRKA 1TA3A 5FF7A 2WVUA 4JICA 2D1ZA 1TG7A 3HQPA 2GGJA 3GW3A 3VKCA 3PZMA 4AH7A 2G95A 5GJPA 1UWUA 5HQEA 1ICPA 1IIHA 4OBTA 3G0SA 1Q13A 5LIKX 1F2JA 1Q3NA 4N02A 3G1DA 1B3OA 4WRHA 1TZZA 1KRCC 1KBJA 1PZ3A 1XYAA 5AHNA 4UTUA 4XZBA 5CLTA 4RE3A 3PZ9A 3WLQA 5BU9A 3CO4A 3CUZA 3WQCA 3WDHA 2QCHA 4UFLA 4ZQMA 2ZCGA 3DFNA 4IL0A 1AH3A 5TIMA 2R1KA 1QNQA 1PHQA 2XVPA 4J7RA 3VNYA 4Z2KA 4HT3A 2IPWA 4AZ7A 4PRWA 4LJ3A 4XZWA 5KITA 3W28A 4MYXA 4E2OA 1YTEA 4ZSTA 3MS8A 1HKWA 4IJCA 1PS9A 4FHAA 1QFEA 2FYMA 1QOXA 1FBAA 2G8ZA 3T0AA 3ABZA 3QSTA 4EXQA 5LA0A 3EOEA 1EC7A 4EP8C 3NIYA 2ABAA 1W9XA 1J96A 3DFOA 3UGRA 3EX1A 3RGTA 3MJYA 3NDYA 3HG5A 1Q45A 2OEMA 4AD1A 2PTZA 2WJEA 2X1UA 3TQVA 1W1B1 3GXIA 1H3GA 3TJ4A 3STFA 3I7QA 2QCEA 4LAMA 1SW0A 2IQDA 3UU0A 1EH9A 1W3KA 4XAZA 1WXZA 2A3EA 3M7WA 2VL4A 3LM3A 5ENLA 2PP0A 2DZAA 1J0IA 2BWGA 3WKZA 1MXDA 3HTWA 3PJWA 3DIPA 1LM1A 5LA1A 2PUZA 2QNEA 4EOUA 1EC9A 1EBHA 4IMGA 5CXPA 1LRTA 5HNTA 1L6FA 4QS6A 4V1YA 5FOOA 3PJUA 4AD4A 3BXWA 3T0CA 1FP9A 4RZ6A 1GQLA 4MTVA 3TYZA 3IGXA 1QUMA 2WPBA 1PAMA 5CPNA 1LL4A 1U1JA 4I6VA 4GIRA 2BFGA 1KR1A 3H2EA 1M65A 2VX6A 2E40A 4IIBA 4MMWA 2B7NA 5CPOA 2PGEA 2ZFAA 4AZCA 1A5AA 4ILSA 1YPFA 3WF0A 1RP8A 2OSYA 3T81A 1ZRQA 2P10A 4YTSA 2XN1A 2QPSA 2WC3A 1ADSA 4Y2WA 1GORA 4MKVA 4B9YA 3IJ6A 4GCAA 1EGZA 5JBEA 4N2YA 2E9LA 1P0EA 5KETA 3M16A 4CQCA 3C52A 1A0DA 2CLKA 5CPMA 1QOPA 4REQA 1QO5A 1JZ8A 1AZ2A 1AK5A 1DXIA 4MNJA 3A4XA 5AHMA 2W4XA 1YW1A 2C91A 1XFCA 3CQKA 3LGDA 2NV2A 3FVDA 1RA0A 3LXAA 3ES8A 3BGGA 3W1MA 1TWDA 2Y8VA 3N19B 3TAOA 2EJ1A 2QPUA 1OCBA 1TPWA 3P67A 1YE4A 4HSHA 4QHRA 2V67A 1TV5A 3CUIA 1TB3A 3A64A 4MY9A 1ISVA 3A3WA 3VINA 2J88A 4UMBA 1WBJA 4OKDA 3O63A 3RCYA 1E1CB 3FGCA 3EOSA 3MMDA 2P8BA 3LEPA 1D8WA 5CBBA 2WB5A 4Y96A 1JULA 4FP1A 4JAWA 3MI3A 4Z0JA 2J7EA 4OIFA 1QNSA 1XXXA 3ANVA 2ZQ0A 3FIGA 4HVXA 2FFIA 4BEUA 4UCFA 2Y7DA 3S2CA 4HJFA 3DXIA 1E43A 2EAWA 3IAQA 4RDWA 2JKAA 1KM6A 1VHNA 3LBMA 1TVLA 1UKQA 3RU6A 2EPKX 3AO0A 2CLPA 1GOIA 2ZTKA 4JIEA 2GDQA 2BOGX 2Z2AA 3MKCA 4ZE5A 2Q02A 2J47A 2E6FA 1UZ4A 3VGBA 1UJPA 2EPLX 3ONBA 2PDUA 4ROPA 3I3EA 1IXOA 5DF0A 3U5UA 3CWNA 4UTJA 1A4MA 4LUSA 4QS5A 2RGMA 4LV4A 2V63A 1H0GA 3S5NA 5FJIA 3ITOA 4C6NA 1W3LA 3FYPA 3TCEA 1VLWA 2QYGA 3S3GA 1LQAA 1JUKA 2VKZG 3TC7A 3TVAA 4ZTYA 1W3JA 1GOXA 4GIYA 2QDEA 3WD2A 4OOUA 3L4WA 3CIXA 3PC0A 4RNFA 4O12A 3S6TA 3A24A 3PK7A 3THAA 4MFEA 4NQ1A 1A3XA 1E6ZA 1R5YA 3SQLA 1RA5A 1U5HA 2G3JA 1WX0A 1UHVA 5BWAA 1H5VA 2ZICA 2JEPA 5AKQA 3BLPX 2ZRYA 2X1IA 4NU7A 1VCGA 1FHVA 1QBAA 2HVMA 4TXEA 4PCTA 4OE7A 3BOXA 4YHGA 1V7AA 4TVUA 5FSDC 4WY0B 3M1ZA 3LENA 1X6NA 2PDKA 1OEPA 3GYCA 3MHFA 3UWVA 1W2VA 5DELA 3IIPA 4JTQA 3TW9A 5FL0A 2YL5A 2VGGA 3BANA 1RUSA 4UTLA 4LS0A 1WQ5A 3PR2A 4H83A 4NILA 4XD4A 3UQNA 2V3EA 2VFHA 3SFKA 2CBJA 4FEZA 4Q7BA 3M0ZA 3QHOA 1PSCA 4IXHA 4KIRA 2A3CA 4JQ1A 4XAFA 4ZFMA 1ODUA 4MWAD 2E25A 4JNMA 3EWCA 2DZWA 4D8LA 3V0TA 2GJNA 1R9YA 3GBDA 1BKHA 4NNBA 1Q85A 4MLRA 3WD3A 1XIJA 4YVPA 1MRQA 4AIBA 5C0QA 2OPJA 3K4DA 1VFOA 4R27A 3SN1A 4EVZA 1GOMA 2ZYFA 4QE1A 4R7WA 1VFHA 2CNCA 2XVLA 4UXDA 4HNOA 1FWNA 3S1XA 4HU0A 3RO6A 4HOXA 1F3XA 1P1XA 2PLCA 2HE5A 1JCNA 4HMNA 4A3YA 3EA2A 3QC0A 1RAKA 2ATMA 9XIMA 1DXEA 1IF2A 4GBDA 4MUZA 3SY1A 2R8WA 1C7TA 4PUJA 1ZS2A 4Q8NA 4GHRA 3W7NA 3IJDA 3C86A 1FUYA 1K8ZA 3QY7A 2OR2A 4FOJA 3TQPA 1X96A 3AIBA 5IDIA 4JBRA 2P5NA 4YYFA 1LRQA 4FLQA 4JPGA 2HNHA 3CAQA 5FJRA 4ZO7A 2RHGA 4I8YA 4Q8OA 4NZFA 4YJ5A 3RLGA 3M7SA 3GDMA 4QSFA 2ISDA 5FI8A 2PDLA 4D2JA 5C7HA 1TPC1 1ZBWA 2VX5A 3T40A 4JY8A 1QI5A 5XINA 1G6CA 1TJRA 1KXHA 3DYMA 3LZ5A 5IBXA 3WLRA 3NEVA 4TV6A 1ITUA 2YL9A 1GKPA 2C6QA 4A6GA 3SY8A 1VYPX 1GVIA 4HN8A 4AZCB 4QJ1A 2AL2B 1ODZA 1W5NA 1KV5A 1I1WA 3BVJA 1I2OA 1M7PA 3NR0A 3O3RA 3UJRA 2WKLA 2FFCA 3GG0A 1VJIA 5KINA 4J40A 1E9ZB 4KFOA 3CWOX 3P81A 5EMJA 4BKNA 2WVVB 4LRTA 1KLYA 1HF6A 1BXBA 4PMZA 1UBSA 4XBJA 3E2VA 3A5VA 4JGDA 4C6PA 4FR1A 3M0VA 3THDA 2VDGA 4D6EA 2FGLA 3F2CA 1RBOB 4DX3A 1IEXA 3FDGA 3TJXA 1TJ1A 1CXHA 4CU7A 3U9IA 1QI4A 1LBMA 1HGWA 1OJXA 2E6YA 3GNNA 1XPGA 3FLUA 4GKLA 2DT3A 1QW8A 1OFDA 4KW2A 7A3HA 1KM1A 2QAPA 3GG8A 3QXBA 3BUVA 2CZDA 3D46A 4WVXA 4ERIA 3KOYA 4RV3A 3B9DA 2WSQA 3AHVA 1FWBC 4MG4A 1TPH1 4M6QA 3REQB 3DN5A 3BSMA 3APGA 1QVBA 1W1VA 3MP5A 3OO2A 2TODA 3S9YA 4F4RA 1G7VA 3AHYA 4O15A 4CNOA 3EDJA 1VENA 4F0HA 3VKAA 5JIWA 4C6JA 1KGUA 4QE4A 1EXBA 4OWGA 3N29A 1DVJA 5LNSA 3UJ2A 3LV5A 5FL1A 2DT2A 3R12A 4G1KA 2ZOXA 3THQA 2IKJA 3W87A 4B4FA 3VKJA 2QIIA 1UD6A 2Z27A 1TFVA 5HPCA 3EXTA 4R9OA 1QTWA 4XIMA 1UD4A 1U5JA 1KWGA 9RUBA 4JKKA 1W5OA 4W85A 3AYVA 3N14A 2RH9A 4ATLA 1ICQA 3SIMA 1OC5A 1TO3A 3N04A 3GXTA 3NOYA 2QF8A 3NL5A 4KWSA 3UXKA 2QJIA 2ZVIA 3MUZ1 1PPIA 2CLLA 3U4AA 1KTBA 4Q32A 5LZLA 4EKJA 1V02A 3PTKA 2P76A 3L2MA 5CPLA 3RHGA 4PULA 1KNWA 2ZUUA 3UCQA 3TR2A 4EPEC 2FDSA 3W70A 5M1TA 4KT2A 1R7OA 3HO8A 5C5YA 1R3QA 1IXNA 3KS6A 4PRTA 1E5JA 3BG3A 1EGVA 4IIFA 1B4EA 1UASA 4ATDA 4JN7A 2PDIA 2MANA 3C0JA 4DJEA 3NQCA 1KFEA 4M6PA 3PF3A 3BJTA 4Z2GA 3VE7A 4W89A 3CAVA 5FJJA 3HV9A 1FH9A 2YA0A 1V77A 3OVRA 1XYZA 1LQ2A 4PUNA 2YSWA 3U8GA 5HXMA 2W66A 5D03A 5D2WA 4WCJA 4LAKA 4DJDA 3MSGA 2A0NA 4AHQA 3CS2A 1XF0A 4W5ZA 1YBQB 1DOSA 4JIPA 4K38A 4CD8A 2VHLA 4UR8A 3I6RA 3IJ7A 3WLHA 1XIIA 2VDIA 2OSXA 3LBOA 3UGVA 4JTKA 3N2TA 2POTA 4K3ZA 3D0CA 4Y9PA 4R7JA 5K2ZA 3ARTA 3NQ6A 7CGTA 1W5QA 4XQ6A 4K8GA 5BRBA 3E5BA 2PCQA 3H70A 5DT7A 1HKJA 4ZODA 3VIGA 4TMCA 2BY3A 2R82A 1X1ZA 3EYPA 2D24A 2FHFA 1AJ2A 3UYCA 4JFWA 4IWWA 2X2GA 3E5PA 3SCPA 3RPDA 3B0XA 2OELA 5I24A 3CUGA 3B04A 3M07A 1OGGA 1K77A 1BTMA 2PU0A 3SADA 4O0ZA 1F8MA 5B80A 3DZ1A 3TSMA 4J3UA 4LX4A 5CSYA 2VFEA 4ZTXA 4Z2IA 1D7FA 4GO8A 3N2BA 3NQ8A 5F1VA 4E5TA 3GTHA 4AVOA 2VDHA 2E68A 4R7OA 2J79A 3G0XA 2YB1A 1A4LA 3MCOA 2J77A 1C8QA 3F2DA 3AAMA 3BZGA 1TTIA 2ZUNA 2BZNA 5GQBA 3TWAA 5DEZA 3MZ2A 1BSLA 4FSAA 1F61A 3LTPA 5F4XA 4BQ2A 1LLOA 1RVKA 2XWDA 5H8PA 1X38A 4M0XA 3TNBA 3WYZA 4X9YA 1RBLA 2JF6A 1I60A 2QLYA 1JFHA 1HX0A 2W3ZA 1E1CA 1OX4B 4GZEA 1GZJA 1CGUA 4MNLA 4NYYA 1YHTA 2PLKA 4QJ4B 1W1ZA 1AQFA 3OVQA 4HU3A 4XAYA 2FGZA 3T9PA 3EX3A 3ORWA 3WBEA 2W91A 4ZQCA 3PBMA 3JRKA 2ISVA 2WK2A 1MMFA 3NQMA 1J10A 4NNAA 1U33A 4Q4RA 3LI1A 4JN8A 2W63A 2Y62A 2PTXA 4L4PA 1T6MA 4P8XA 1XC4A 3H2AA 4E3VA 3R7MA 3MUCA 3N4FA 5E9AA 3GZ3A 4TR9A 2IPGA 1AFSA 1GPWA 3VIHA 3WLMA 3IV3A 1TV2A 5I3GA 5E5CA 4FX7A 3I65A 2VEIA 1H50A 4LT9A 1E73M 3PFMA 1JIBA 3A22A 3B4UA 4PTMA 1A0CA 1NIUA 4QSHA 1LOLA 4C6LA 4G7FA 3ZS4A 1QPQA 2I9UA 3QQWA 3VGFA 4O4WA 1N8WA 4AWEA 1JZ5A 3QM3A 1L6GA 1VC4A 2BASA 5I3FA 2GQAA 4FI4A 2JQXA 4X2PA 3LHZA 4F0MA 2ALDA 1EJUC 1PKYA 3PPGA 3ARZA 2PLJA 4GY0A 2HWGA 3KBMA 4TOQA 1YDYA 2R94A 2ZX9A 3UXDA 4Z2JA 4J5NA 4OJYA 4PTWA 2Y88A 5DCBA 3RR4A 4NNCA 4MKNA 3W23A 3W7OA 2V9DA 2OKTA 2ZDRA 1NQ6A 2DZSA 2H90A 4GPNA 1E70M 3FHAA 4RZBA 3WJYA 3NEHA 3N2CA 4ZSUA 1Y5WA 2RJHA 1MXGA 1GYLA 1TMLA 3G1FA 4W8AA 5CBIA 4MWAC 2DSKA 5DY2A 4Y8EA 3AIWA 5JBDA 2ZA1A 3IIOA 3IAPA 3PPHA 3C3NA 3BV7A 2E1DA 4QQUA 1PVNA 1GHRA 2NT0A 5AECA 1XX1A 1W1PA 1EHNA 3OZPA 1QK2A 2ZRUA 3OB8A 5D02A 4RPPA 1EWDA 3P2VA 2GVYA 1SJBA 1D2KA 2GGIA 2G4JA 3GTIA 3VGHA 3TQ0A 4PTVA 2E5BA 3GE7A 4WSKA 1D8CA 5CEWA 5CAHA 5I2UA 4NP7A 2HNEA 2NQHA 3NGFA 1KKRA 1UR3M 4BWLC 4KWVA 3ARRA 3GHSA 5F2IA 4BJHA 4XTIA 2ACRA 4UTKA 2EO7A 3OJGA 3GY1A 4A3QA 2VR2A 3WFZA 3MMUA 3FKRA 5BXRA 1DJGA 3W7CA 1BF6A 4GE8A 4IQLA 4ZXOA 1BXCA 3PN8A 2UY3A 4US5A 2EG7A 4FMVA 3OODA 1NWRA 3GTXA 5ABFB 3P74A 1DWFM 3B9OA 4AYSA 1UWRA 1LDCA 1H49A 5TQLA 1JDFA 2C0AA 4OT7A 5LA2A 4DRSA 1B2YA 3NQEA 4AIUA 2X7WA 1IEQA 2VZOA 3DHUA 2HVOA 2RUSA 4S3AA 2CLOA 5A6LA 4UNIA 2YXXA