1UR4A

The structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Endo-Beta-1,4-Galactanase from Bacillus Licheniformis in Complex with Two Oligosaccharide Products
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords GALACTANASE
total genus 145
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ur4A00
1OB0A 4YHGA 3GH4A 3WNNA 1UD5A 4PTVA 2RGLA 3PTQA 3SURA 3WQ5A 2YL6A 4MNLA 4W8AA 3VDCA 2VL4A 2WZEA 5I3DA 3EDDA 2J77A 2CCRA 1DWJM 4ACZA 2JFEX 4CCDA 5A6KA 1QBAA 1UR9A 1ITXA 3GM8A 1OWQA 3W26A 1TVNA 1VJSA 3CHCA 2WCAA 1UQZA 3MANA 1PZ2A 3VGGA 1NP0A 2Q8XA 1V0MA 2CKSA 4BQ4A 1OCQA 1UA7A 1TFVA 3SUSA 5A6LA 4MAZA 1W3HA 2QMKA 4ZEPA 2VCCA 4MB3A 3ZJ6A 2VVSA 1EDQA 1PX8A 1JZ4A 3AS0A 3VIIA 1V02E 1ISYA 4ACZB 1KGUA 1R7AA 1UR1A 3U57A 3OLDA 4K68A 2Y5EA 4JCMA 3WUFA 4D6GA 1UR8A 1E3XA 1HJQA 1LLOA 3TTOA 3BAXA 3VKKA 3ALGA 2WMFA 1C93A 4AD2A 3M46A 2NT1A 3VINA 1KBBA 1H11A 1JYNA 3K8KA 1QNRA 1JI2A 1BLIA 5CPSA 3CUJA 4AXNA 4UQCA 2DPEA 5LYRA 4PRWA 3THDA 2CITA 2CKRA 5AYBA 1UD2A 1FFQA 1R8LA 7A3HA 4B3KA 5JIPA 2A3EA 1X6NA 1UHVA 1GOMA 4H7VA 5JBEA 1VEOA 1E6ZA 2EBNA 3SCPA 4BQ2A 2VURA 3VNZA 4PMRA 4ZE4A 2D20A 3OG2A 1B3WA 4CN6A 4HZ8A 2G41A 4L4OA 1ODZA 3A6OA 1B3VA 1HVXA 3AMLA 4JAWA 4PUEA 3BMWA 1CXLA 1CPUA 2BXYA 4GI6A 2XG9A 5FIPA 3SEPA 3POHA 1CZ1A 2W67A 2BY3A 1LWJA 4QLKA 3QHOA 3O2LA 4PN2A 4KGJA 1CTNA 1QW9A 1D2KA 1JAEA 4EE9A 2HISA 2GDVA 1HP5A 3WBAA 1C3FA 1J9YA 2WHKA 2DQXA 5CLTA 2J47A 2WW5A 1FOBA 5D8WA 1V6YA 3AXXA 4E4PA 1WZLA 3BSGA 1B3ZA 1ZBKA 2X0HA 2XVLA 4P8XA 3GZAA 3MU7A 1V0KA 1Q6DA 3LPPA 2WC3A 2VMFA 5IFPA 2ZUNA 3ZT5A 1CENA 2O9TA 3AIEA 3NSMA 2ZX9A 1HJVA 2WK2A 3PZTA 1W3KA 1J0IA 3O6AA 3RM9A 3VPLA 1BSIA 3F4VA 5CPQA 2WXDM 3CZGA 3A4AA 5I6SA 1PX3A 2WC4A 3MMUA 3ZJKA 2FH6A 3OBAA 1VFOA 1WAWA 3WIJA 5BYWA 4XV0A 3VVGA 2VC9A 3VD5A 4B9ZA 5A94A 4H2CA 3ECQA 1BHGA 3GYCA 3ZT7A 2DEPA 3PZNA 4YN5A 1E5JA 1EH9A 3AMKA 3EYPA 5GQBA 3RO8A 1B30A 1RPKA 1HJXA 4CCEA 2DT0A 3QGVA 1E3ZA 2IXVA 3VDBA 1DEDA 5A2CA 1CGUA 1HIZA 4W5ZA 4NSBA 5IDIA 4P8UA 1WDSA 2O9PA 3BAKA 1IZJA 3IANA 4CVUA 2ZUWA 4AZCA 2X05A 4FK9A 9CGTA 1UA3A 2VTFA 1MQQA 2A3HA 1OM0A 2O9OA 3N15A 4AC1X 3VX1A 4GQQA 1UWQA 2YLLA 4D71A 3LPGA 1E72M 2J7FA 3ZMRA 2EO7A 4PMVA 3BC9A 1AVAA 4BS0A 2YBTA 1UD6A 4UFJA 1DWGM 3IAPA 4GZIA 1EGZA 2YDSA 1C8QA 2WMJA 3OZOA 3DYOA 2XJ7A 3W4RA 3ZQ9A 2FGZA 4MB5A 4XUYA 5ECUA 4YHEA 3W6MA 6CGTA 2E8YA 5IHSA 4OJYA 1XYZA 2YJQA 1E6QM 2BHZA 2VJXA 2YA2A 4W88A 4C7DA 1KBKA 1US2A 4AISA 1R87A 1XCWA 2J79A 4MB4A 3WD3A 4RE4A 1JYWA 5E0FA 2WVUA 2Z1SA 2WM0A 1E6NA 4TX8A 4HPHA 3L4YA 3CUHA 4ZXLA 3UESA 2W61A 2CIPA 3DECA 4J3XA 3WF3A 2XUCA 3F5LA 3L2LA 4JFSA 2CXGA 2YL8A 3ZJ7A 2DDXA 4PMZA 1SR0A 2DT2A 3RMEA 2V38A 3CMGA 4IUGA 4NZCA 4PCSA 4U5IA 3MMWA 2WC7A 1V3JA 2WMIB 4OZOA 1H2JA 1KXHA 2PBOA 4DWSA 5FCZA 1V03A 3AIRA 2Y8KA 3VIPA 4AZIA 1OBAA 2Y2WA 2CBVA 3VDHA 1KXVA 1BG4A 5A2BA 1ISXA 5CJ5A 4P8WA 1UKQA 2A3AA 1LL4A 4NF7A 1VBRA 4UFLA 2X1IA 3AHXA 4HOWA 3ZR5A 4C7GA 1CECA 1GQKA 5AC4A 1FH7A 2YOCA 2WMKA 1XD1A 2OSYA 4AZCB 4TTGA 3FNDA 2VX6A 1CYGA 1R86A 3CZKA 3NSNA 4JL1A 4DWSD 2VZTA 3KL0A 3WN6A 1TZ7A 3CZEA 3WQ4A 3L4WA 4C7FA 2WMHA 2WVVA 2VOTA 4D6IA 2FH8A 4D1JA 1LL6A 2ZX5A 1CXIA 3CIVA 2XYLA 3WELA 3OGVA 1MFVA 2EQDA 3N12A 1MXGA 3L4UA 5I24A 4UOQA 1VEMA 5D9NA 3FN9A 1MW3A 1CLVA 3VX0A 4BF7A 5M5DA 4GQRA 2D1ZA 5IFTA 3AXHA 3THCA 2JF7A 1NARA 1UH4A 4HOZA 4TVUA 3NDZA 3UERA 1QHPA 2BHYA 1GVYA 3K8LA 3WDPP 1V3LA 1CXFA 2E8ZA 3BSHA 3WH9A 3ZM8A 3ARWA 4JKMA 3WDHA 3KEHA 1Q6CA 3MV01 5A6BA 1J18A 5E6ZA 5ABFA 3ARXA 3U5UA 3OLGA 2B31A 5C71A 3LPFA 2PB1A 3B8SA 1E43A 3T2OA 3TONA 5FOOA 2WKLA 4WIWA 2BXZA 1N82A 1DTUA 1GJUA 3VMNA 1HKMA 5JUVA 2Y24A 4MB1A 1KQYA 3PTMA 1R7OA 2YDRA 2AMGA 2E0PA 3CHEA 4WF7A 3DC0A 1BTCA 1UR4A 1HL8A 2BVYA 2CETA 1BG9A 1C90A 1ITCA 3ARTA 2V5DA 2ZUMA 1BVZA 2GJXA 4V2XA 1H49A 4QLJA 1KCKA 5AYIA 3VGDA 1OIMA 1IT0A 1TA3A 2J78A 3OB8A 3ZT6A 4S3JA 1KR0A 4M29A 2JE8A 2WZHA 1KCLA 4CD7A 2WWDA 3NSXA 1V3KA 2CEQA 4M80A 4TX6A 4TTUA 3FHQA 2ZUSA 4W7VA 1QHZA 2XM2A 5CZKA 1TE1A 1OT1A 4HA3A 1L8NA 1PBGA 3M7SA 1U33A 4ATDA 1JF5A 3FAWA 4WJXA 4IISA 5AC5A 2QLYA 2BY0A 3GXDA 2XTKA 1E1EA 1GVIA 1HJSA 3IK2A 2O92A 1QVBA 2E40A 1X1NA 5I23A 2J8GA 1GW1A 2V3EA 4QLLA 4TXEA 1KWGA 2ZXBA 3AIBA 1FHLA 3FW6A 4PMYA 2BY2A 1MW0A 1O6IA 2GJRA 4PUDA 1NWUA 3VD9A 1V3MA 3L2MA 3CMJA 4DWSB 1GUVA 3GNPA 4E8CA 2GK1A 3VO0A 4PMOA 1XH0A 2D0FA 2VR4A 3BCFA 3WSUA 4OIFA 4NRRA 3ZR6A 4J3UA 2E9BA 1H4PA 3WH7A 3I3EA 4CU8A 3WUEA 4MJ2A 3QR3A 2QMJA 4F66A 2OYLA 4WK9A 4B16A 4FLOA 4DUXA 1J0YA 1XRVA 2EXOA 3T2QA 4PEEA 3A4XA 2WVVB 2PWHA 3KWXA 1BVNP 1B1YA 1W3JA 3VILA 4MJ4A 4IPLA 4JHOA 1AQ0A 1BQCA 3RCNA 3W0KA 1NQ6A 2XWDA 1OGSA 2CHNA 2VZOA 5CGMA 4P7QA 1LF1A 3AMDA 4TVDA 3MMDA 2XPKA 1CXEA 3VIHA 4JKLA 1H0GA 2VQUA 3TP4A 3TTSA 2OYKA 1B9ZA 4N42A 1NWTA 3OZPA 2G4FA 4M24A 3CH9A 4UFIA 3GBEA 4W84A 1G0CA 2XFRA 3AMGA 5CSUA 1RD6A 2W4XA 3CUFA 2V3DA 2YLAA 4ZE5A 3VD3A 3MS8A 5BRPA 5HXMA 3SUUA 1HNYA 2QF8A 1CGWA 1W9VA 5C70A 3UETA 1E6RA 4DUVA 3NYDA 4AZ6A 1E40A 1WDRA 1MVYA 5LA0A 3B9EA 3ZO9A 2WCSA 2D22A 5A6MA 1M7XA 1H09A 3CPUA 1ISWA 4JZ5A 1W1YA 3FY1A 3K1DA 3W38A 3RPMA 4ZXOA 1H1NA 4HA1A 1I1XA 1W9UA 4BQ3A 3BAJA 5GPRA 1TMQA 1G1YA 4GI9A 1HF6A 5D4YA 5JIWA 3QHNA 3VIKA 2Z1KA 1HKJA 2WVSA 1C8YA 1SFSA 1ZJAA 3CGTA 4ATWA 3FHAA 2D0HA 3ARPA 2BV9A 3AYSA 3POCA 1QI0A 5LA1A 4IM4A 3SUWA 1ISZA 2XGBA 4J28A 4PTWA 1JNDA 3WBEA 3WDRA 3OLIA 1JDAA 3AS1A 3WF4A 5BROA 3N13A 3RM8A 3ARQA 1Q4NX 2J7HA 1ZBVA 3FAXA 1WP6A 2EPNA 4W8LA 2XSAA 4PCTA 3CBWA 2CNCA 2XIIA 1CIUA 3NJ3A 4KRUA 2EPKX 2VT0A 3PZ9A 4Z2HA 2VRJA 3GH5A 2DT3A 2Y4SA 1NOUA 1NWSA 4B3LA 4F9JA 2DH3A 3GXFA 1YQ2A 2BFGA 1V6WA 1NOWA 5A6BD 1CBGA 3VDAA 3APGA 2ZIDA 3L4TA 1W2PA 2F61A 2DGAA 3NCOA 4FMVA 4JIEA 1BYDA 3MSDA 2CHOA 1WZMA 3L4VA 4QP0A 5DFAA 1QPKA 3E1F1 3AZTA 1HKIA 4FLSA 4H04A 5A6SA 3WF1A 4CU7A 3UEQA 3WD0A 4CN4A 4HU8A 4U2ZA 4HU0A 5A6AA 3QOMA 1XH2A 6TAAA 4LPCA 3VGHA 1JYXA 4ML4A 1VF8A 4AIEA 4JFVA 2VX5A 1DWAM 4F8XA 3BLKA 4QCEA 2PWGA 5IHRA 1WZKA 3WL0A 2J7BA 4QCFA 4W89A 5HNNA 4U5KA 1EO5A 1GOWA 3U7BA 4CD8A 2FHBA 5BCAA 1NOFA 1E70M 1TCMA 4RE3A 1EDTA 3VOCA 4PTXA 5D9MA 4QFUA 1V6VA 4JHZA 3ARRA 2XSBA 2YL5A 3AIUA 3W6LA 2J7EA 4XZBA 4DWSC 1MXDA 2VQTA 1DP0A 4V28A 2CESA 4GPNA 2GSJA 1E0XA 1UH3A 1UH2A 3AROA 4GXPA 1GCYA 4KMQA 1BYCA 1H41A 3WFZA 2XFFA 3M6DA 3EMQA 1JIBA 2WZIA 4JCLA 1PIFA 2WAGA 2O9RA 1ESWA 1GHRA 2HVMA 2GVYA 2NT0A 4D6EA 5A8OA 3AHVA 5D8ZA 2OWWA 1UWIA 4UTFA 1O7AA 2WMIA 1HKKA 5E09A 1QI5A 4UOJA 1ECEA 3AYRA 2J7GA 2BVTA 4MNMA 4LYRA 1J10A 3U7VA 3CO4A 5HDRA 2TAAA 1F4AA 3AJ7A 4H8UA 3UG4A 2XHYA 4AIUA 1C91A 2AOSA 3EMCA 4UZSA 1EOMA 1HXJA 1M53A 4J3WA 4UQDA 2QPSA 2WHJA 4AZ7A 1W2VA 2QV4A 5CG0A 1QI2A 3VIGA 4MADA 3AHYA 3HMCA 4P7NA 4L4PA 4BA0A 5JBDA 1PJ9A 5EFDA 1XCXA 1FA2A 4J27A 1JFHA 1UD3A 5M17A 4M82A 1VBUA 4AEEA 1TA3B 3W24A 1C7SA 1BGAA 1V0LA 2X09A 1BFNA 3WEMA 4PMDA 2DT1A 1W9XA 3JUGA 3VM5A 2ZUTA 3T09A 2WBGA 1Q6FA 3FXYA 1UZ4A 1XHGA 1VB9A 3ZJ8A 3TOPA 1V3IA 2UY2A 1E4IA 4Z2GA 3WENA 4E8DA 2G3NA 2DSUA 3OLEA 1HJWA 4XB3A 1JZ8A 2VX4A 3N1AA 3WNMA 3PZMA 3GXMA 3G6MA 1VJZA 3AI0A 2WHMA 3WMSA 4J7RA 1JNEA 5E9AA 4D72A 4LXFA 4PMQA 2CBIA 2WB5A 2ZXDA 3GTNA 4M56A 1WO2A 3WUGA 3AQUA 3BAIA 3WNKA 2GFTA 3MSGA 2YA0A 3SCRA 1B3YA 4R5EA 5A8QA 4BCEA 4B15A 2CERA 4CU6A 1X6LA 3AIQA 1JYVA 4MDPA 1HP4A 4Q7NA 4AW7A 2YA1A 2PBGA 1C7TA 4URIA 2XM1A 5C8BB 1B0IA 2UY3A 3RJYA 4RL3A 1EOKA 5HPCA 4M1RA 2Y8VA 3WL1A 1Y7VA 3LMYA 4OOZA 3SCOA 3WMCA 3N9KA 3O9NA 1W3LA 4AZGA 1W1PA 3CHFA 4EANA 4EKJA 4S3KA 3F5JA 3MUZ1 2J4GA 1ZBCA 5HBFA 1UD4A 1B31A 3VD4A 1WB0A 3PZIA 4MTVA 3QHMA 2J74A 1RP8A 3VIFA 1C92A 2W62A 2D0GA 5DF0A 1ZU8A 4UFMA 1E5NA 3ARSA 1UWTA 4GI8A 1KGXA 5ABGA 3SCTA 4AZBA 5TD4A 5I79A 1IV8A 3SUVA 1UQYA 3WQ8A 1BYBA 3AMCA 3W53A 3WKZA 3VGEA 1PZ3A 1DWFM 1PX4A 2NSXA 1JF6A 5HOSA 1FP9A 1NWRA 4R27A 2G3IA 4HA4A 1JFXA 1U2YA 1HX0A 2F8QA 1W9DM 1UR2A 3BCDA 1EXPA 4W7WA 4UOZA 2E4TA 4ACYA 2VZVA 3GNRA 4P7OA 1KXTA 3ZOAA 1GNXA 1RH9A 1AMYA 1V08A 3B9DA 1G9HA 1J11A 5KZ6A 1LQ0A 1GPFA 4UZUA 1K6AA 3UR8A 1EQPA 3A47A 4E2OA 1UZ1A 1JD7A 2JALA 4EK7A 3OIHA 3CTTA 3WF0A 2JIEA 1QI3A 3HU7A 4H41A 1OGBA 5BXTA 1ZS2A 4UQBA 5HPOA 1I1WA 1MFUA 4PMNA 1J0JA 4WLCA 2D23A 2VVNA 1KQZA 3EMZA 3WEZA 1CGYA 2J7DA 3CLWA 1GQLA 4GIAA 1W9BM 2QHAA 4UCFA 2CPUA 1FH8A 3AHZA 1E56A 4WKFA 2ZOXA 5A69A 3AOFA 1FP8A 2DSVA 1R85A 2PF0A 3RJXA 2E3ZA 5DO8A 1E4LA 4HZ7A 1E0WA 2UY5A 2XVPA 2WLZA 3MO4A 3U5YA 4U2YA 3IJ8A 1UYQA 5EFFA 2FHCA 1JXKA 4D6DA 1GONA 1KWKA 2EPOA 1ZL1A 2YDQA 4CCCA 1NM9A 3BMVA 3WFLA 4UQEA 2D24A 1KGWA 4HTYA 3DHUA 1SYTA 1M01A 1BAGA 2YL9A 1K9TA 1UKTA 3GBDA 5FD0A 2VUYA 4JL2A 4HMDA 3RILA 4KRTA 4LYPA 4CD5A 1A47A 1NH6A 3T0DA 2XGIA 1HN1A 1V6UA 1WE5A 2WSKA 1W1VA 2FDMA 1EDGA 5FL1A 3BGAA 1BYAA 4OBSA 3TA9A 3B9AA 5BXSA 3CZJA 3N11A 4D6HA 4HMCA 3BXWA 1QNQA 4FLQA 1DHKA 5F7UA 7CGTA 4BQ5A 4W8BA 1J0HA 3WD4A 3MUIA 3TTQA 3VNYA 3WNPA 4FF5A 3K4DA 4CN1A 2WNWA 4Z2JA 1QNOA 1VRXA 1QOXA 1JL8A 2WHLA 4GKLA 2VNCA 1JXJA 2CBJA 2C0HA 3L4ZA 1MQPA 5EBAA 5BXPA 2WLYA 3I3BA 1UKSA 1W9PA 1GQIA 3K46A 2AAAA 1FHDA 3GDBA 4GZJA 3PHAA 4U33A 4LYQA 1CNVA 4AD1A 1V3HA 1OSEA 1BPLB 1V6XA 4LQ1A 5JBFA 4MNKA 3WDQA 3T2PA 5A8PA 2BVDA 2PI6A 1JGIA 4TUFA 4KWUA 1QNPA 1EHAA 1M03A 4X0NA 3A4WA 4Z2KA 3EDKA 1E15A 3PTKA 1UD8A 2RGMA 4PSPA 5M03A 1SMDA 4AMCA 3IAQA 2QPUA 2X2YA 3GXIA 3F5KA 1VEPA 5A1AA 2X0YA 1IZKA 1WDQA 3OGSA 2MANA 2D3NA 3EDEA 4A3YA 5I5RA 3N04A 3NUKA 2YIHA 3RDKA 1Q6GA 2ZE0A 3N17A 4HP5A 3ZSTA 4UQ9A 3WNLA 1ODUA 3AS2A 3WQVA 3ARYA 3KZSA 1EHNA 2ZICA 2PWEA 4WKAA 3WD1A 4LGXA 4DM1A 4F79A 4PTMA 4QAWA 4ZENA 4A3HA 3UG5A 2BHUA 2J8FA 4AD5A 3WQWA 2VO5A 4HOXA 4BZYA 5CLWA 2EJ1A 1E6SM 1E6PA 3W25A 2XWEA 2J25A 5I78A 2DSKA 3KL5A 2JF6A 1F4HA 1WKYA 2DIEA 3WEOA 5A2AA 2WSPA 5I2UA 3VGFA 4RE2A 1FFRA 4AY1A 4CKQA 1B3XA 2W91A 3ARZA 1XV8A 3ARUA 1B90A 1FH9A 2X8RA 3W27A 3WUBA 4D6CA 3W37A 3CZLA 4DM2A 4AD0A 4HMEA 2ZXAA 1BGGA 2EEXA 3ARVA 5A8NA 1GOKA 4JKKA 3AXIA 4U31A 4GO9A 4U3AA 2F2HA 2V5CA 2OWXA 4V27A 3TTYA 4ATLA 5FL0A 4PMXA 5CSYA 1EIBA 1GOOA 4MPKA 1XSIA 4KH2A 1XSJA 1OT2A 3D3AA 4PYSA 3AS3A 1UWUA 3L4XA 1UWSA 4P7LA 1TR1A 4UR9A 2IXUA 1HJUA 1XD0A 3PBGA 2YBUA 4TVCA 1ZB5A 3VMOA 5CXPA 5CPTA 1OD8A 1B2YA 5A3HA 1J0KA 3UG3A 3BAWA 4PSRA 5D9PA 1GOQA 2OSWA 2WYSA 4MNJA 2FGLA 1XC6A 4CD4A 1CGVA 5DT7A 1QW8A 2C8NA 1UG6A 4D6FA 1OINA 2EPLX 4CD6A 3S2CA 2J75A 1Z32X 2VCAA 4NI3A 3PZUA 4Y7EA 3WQ6A 1TVPA 3AICA 4JFTA 1XSKA 1ZJBA 1AQHA 2WANA 2ZX7A 2G3JA 4UQAA 1H5VA 1OGGA 1VAHA 2JIWA 2UY4A 3M07A 3UCQA 1E6XM 5KEZA 3ZIZA 2DH2A 1M04A 4H8HA 1U30A 2A3CA 4W7UA 2WPGA 3CUIA 3MV11 1RP9A 1JAKA 2GJPA 5LA2A 4AD3A 2VRKA 1LL7A 3AZSA 1HT6A 1XYFA 2D2OA 4X0VA 2ESCA 3T0BA 4CUCA 2DSZA 2J7CA 4P8VA 1QI4A 2XFYA 1CGTA 3SCWA 1CXKA 3K4AA 1CWYA 3RIKA 1XGZA 4AD4A 2PWDA 1TG7A 1E73M 2JEQA 1GHSA 1W32A 4D6JA 4F9DA 1J0ZA 1LG2A 2G3MA 4M81A 4AEFA 2XIBA 2V3GA 4AYSA 5E70A 1H0IA 2ZXQA 5BRQA 1G5AA 2DSWA 3BLPX 4W86A 2GJXB 2VI0A 3MKKA 3HN3A 8CGTA 1UWRA 2ZX6A 2VZUA 1E4NA 1VENA 3PZQA 5DEZA 3NIYA 4WSKA 3CUGA 1HVQA 5I0DA 1PEZA 1TUXA 1LG1A 5BXRA 4H8VA 1E4MM 2ZX8A 1DWIM 4OKDA 2EPMX 3EBVA 8A3HA 2E9MA 1AQMA 1JZ5A 1I75A 3AHTA 1E0VA 4DUWA 3SCUA 1CEOA 2VRQA 1P6WA 5A8MA 4B9YA 2GK1B 3BAYA 1KFWA 1GORA 2VZSA 2D3LA 3UR7A 2FHFA 2W5FA 1GOIA 3VIMA 4QDMA 4OUEA 6A3HA 3SIMA 4TOQA 4HPGA 1OIFA 5E6YA 5FKYA 3J7HA 4PBGA 1JI1A 1W91A 3IJ7A 4GZEA 3WD2A 1GQJA 1S46A 2A3BA 4AWEA 5D9OA 3AFBA 3LPOA 4D1IA 1MYRA 2XVKA 4X9YA 2UWFA 1MW2A 3PZVA 2DIJA 3GNOA 3VUPA 4UFKA 4Q22A 3EDJA 4ZFMA 3PZGA 3A3HA 2JEPA 3I3DA 3RM4A 4P7RA 1UUQA 1MQRA 5GNYA 3D5HA 5CQ1A 1L0PA 4A4AA 5BWFA 3SCSA 1CDGA 1UOKA 4EAMA 1VIWA 1JZ2A 4XZWA 1KXQA 3T0AA 3MUY1 1QHOA 2WVTA 1EA9C 1A3HA 4W5UA 1W1TA 5AY7A 3G6LA 4JFWA 4AZ5A 1QNSA 1K9EA 3VIOA 5ABHA 4J3VA 1D3CA 4IPNB 3OA5A 3SCNA 3WDJA 1SMAA 1YHTA 1J01A 1VFFA 3W82A 1MWOA 2W66A 1E71M 3SUTA 1D7FA 1PPIA 4WSJA 2OYMA 1ISVA 5M3WA 5DMYA 3WMBA 3II1A 2PWFA 2ZUVA 5EB8A 2NW0A 3ALFA 1V02A 1G94A 2V3FA 4OBRA 4W87A 1H3GA 1VFMA 2VX7A 4GO8A 3GH7A 3VD7A 4YPJA 3SCQA 3BH4A 1NP2A 5EMYA 3OGRA 5I77A 3AISA 1GZJA 1PIGA 1E9LA 2PC8A 2BNJA 3HJEA 4J3TA 2ZUUA 5A6JA 4PMUA 1QBBA 2BY1A 2YKKA 3K8MA 1WPCA 2XVGA 1EO7A 4M8UA 5ABEA 3WNOA 1WDPA 3DHPA 1UKOA 1CXHA 1US3A 3WY1A 2ZWYA 2CBUA 1HL9A 4MAVA 1BF2A 3SCVA 7TAAA 1OD0A 1JZ7A 1MW1A 3T08A 3W28A 4U3CA 2XVNA 3VTRA 2W63A 4JFUA 2IUZA 3CHDA 4UFHA 1E55A 3NDYA 4KGLA 3VU2A 3CZ8A 1PAMA 1Q6EA 3AZRA 3WH8A 1UKPA 4UNIA 1KR1A 2WCGA 4J3SA 1JZ6A 2VR5A 1E1FA 3W81A 2OLHA 3MUAA 1EQCA 1JD9A 4AIOA 3WDIA 3DYPA 4NRSA 1UR0A 2GUYA 5ABFB 4AZHA 2E9LA 5GNXA 2C7FA 1DWHM 1WCGA 4W93A 1KB3A 2WBKA 1C8XA 2WKGA 1CGXA 1V0NA 4N0RA 2OSXA 5CGTA 1ZBWA 1WNOA 4XX6A 2OWCA 3WH6A 3WF2A 3ZSSA 3VMPA 1VFUA 1GJWA 4FLRA 5DT5A 4WKHA 3S6TA 3AIWA 3KE0A 1K9DA 2VCBA 3EDFA 2W92A 1G01A 3IJ9A 4GINA 1JDDA 3W29A 5GNZA 3VM7A 2G8ZA 3N18A 5IXEA 4Z2LA 2BS9A 2CYGA 3WH5A 1LJYA 4OOUA 3KL3A 3PN8A 1JG9A 3QOKA 2ZWZA 3PZOA 4MDOA 2WWCA 2J62A 1JDCA 1J12A 4HZ6A 1JZ3A 4W85A 4CGTA 3VGBA 1K9FA 3DYMA 4LX4A 3VIJA 1CLXA 1XH1A 2WMGA 5E0CA 4CVWA 4Z2IA 1LWHA 1WZAA 2GDUA 3AIVA 5A95A
chains in the Genus database with same CATH superfamily
4KQNA 3W1TA 3MSYA 1W1A1 4PTVA 2TODA 3DFSA 3SURA 3AAMA 2R1LA 3JR2A 1K6WA 4MUZA 4DYEA 4HNTA 4EIVA 3KRBA 2VL4A 4EPDC 3S46A 3HIJA 4MVAA 5HNUA 3TYCA 1DWJM 4ACZA 3KS6A 3TN4A 4AWTA 2PDQA 3S1VA 1K4HA 1OWQA 4WCJA 3C2FA 1JGMA 3CHCA 2X1UA 1PZ2A 1Y8BA 3EOLA 1V0MA 3BLLA 4DLFA 5F2LA 3EX2A 3OQ8A 1OCQA 2PDYA 4A3QA 1Z7AA 3QFWA 1GKRA 1TE6A 4MB3A 3ZJ6A 1MZHA 3SAZA 3KTXA 4O14A 4O0KA 2R1NA 3F2CA 1O66A 3OLDA 2Y5EA 4PODA 3WUFA 1UR8A 4IFKA 4G7EB 5E9XA 3KUMA 3C0SA 4AD2A 1EP2A 3VINA 3T0CA 4YS1A 4KFPA 3K8KA 1BLIA 4ZQRA 4IH3A 3BJTA 1Z3NA 2WSRA 3MMTA 4LAKA 5KITA 4JX4A 3GC5A 5JIPA 1TV2A 1X6NA 1UHVA 1G7UA 4L1XA 1GOMA 4S23A 3N19B 1XRTA 1E6ZA 3SCPA 4K37A 3S1WA 1AJZA 4L1WA 3OG2A 2GGJA 3MUCA 4HZ8A 2VFFA 4L4OA 3A6OA 1FDZA 3VOIA 3AMLA 4JAWA 4BJHA 1CPUA 4F0KA 3FJ4A 3PNUA 4GI6A 2XG9A 4GUGA 3G1XA 3XISA 4PBEA 2BY3A 3HTWA 4LNYA 5KZMA 5I03A 1CTNA 1QW9A 1D2KA 1H7XA 3L12A 2HISA 3JW7A 1XYMA 4U10A 1J9YA 1A5SA 4MF4A 1O4UA 2HJPA 2DZBA 4ROPA 4YTTA 1V6YA 5FF2A 3AXXA 4E4PA 3BV7A 2PTZA 1OFOA 3BSGA 1ZBKA 3VZYA 2XVLA 4ZCWA 2BBFA 4P8XA 3EX1A 2DUAA 1KRMA 2NQLA 5IFPA 3ZT5A 2QNEA 4S1FA 2C91A 3GAYA 2WK2A 1W3KA 1J0IA 5AOUA 4GNKB 3RM9A 3VPLA 1SSGA 3XIMA 2PE4A 1AH0A 2HNHA 1PX3A 3A13A 4NJKA 2WC4A 5K3VA 1ZHAA 2FH6A 2Z1WA 3B97A 5EMMA 3GFZA 3UU0A 1VFOA 5BZAA 1US0A 4XV0A 3VVGA 1GZ1A 4B9ZA 4O1DA 4ORIA 6REQB 4A8IA 1BHGA 4KWOA 3KVLA 4YN5A 2RJHA 3C86A 1EH9A 3NGJA 4Q4RA 3EYPA 3N2MA 1GVSA 4GY1A 3RO8A 4YMZA 3G0SA 3O8AA 1DEDA 1DOSA 3IK4A 3C2OA 3TCSA 1LOQA 1EEPA 1CGUA 1HIZA 4O0QA 5IDIA 3R79A 2O9PA 3R11A 2ZUWA 2WPBA 4O1FA 4QDPA 2OGYA 9CGTA 3FDKA 1XI3A 1M68A 1POJA 3B40A 4GQQA 2UBPC 1E72M 2EO7A 5HWNA 3NVTA 2IS7A 4DJEC 3IAPA 5I07A 3DYOA 3ZQ9A 3OZOA 3PBVA 2FGZA 1Q65A 1W1B1 4YHEA 3IPWA 6CGTA 2E8YA 4M6QA 1E6QM 3QLLA 4W88A 1U5HA 2E25A 1KBKA 4EOUA 3B0UX 2HRWA 2X16A 4DEFA 2H3BA 4FNQA 1XCWA 1DE5A 3V3WA 4LBRA 2J79A 3W3OA 2OX4A 1RBOB 4TX8A 3LCIA 4B5NA 1E1CB 2Y61A 4ZXLA 3LCGA 3UESA 2W61A 2CIPA 3EOSA 3DECA 3UVAA 3JRKA 1FWIC 4PC8A 3G1DA 3AO0A 2QJNA 4GH3A 4X60A 4O52A 4HK6A 1VD6A 3LX9A 2DDXA 3M0VA 1AH3A 5TQLA 1K7EA 3MMWA 1V3JA 3KBMA 3LNMA 3EWDA 3R12A 4HSNA 5G1YA 1OBAA 1Q63A 2Y2WA 1BG4A 4LVAA 1ISXA 7PTDA 5HMFA 2FZBA 5CJ5A 1T0OA 3EB2A 1VBRA 4UFLA 4HK7A 3AHXA 2BLEA 4HOWA 1P7TB 4ECLA 3ITCA 1JCXA 4QG9A 4A21A 5LIXX 2OSYA 1R86A 2V0TA 3NSNA 2Q01A 4GJ1A 2REQA 4XAGA 1DJNA 1XRFA 5T9CE 1Q6LA 3GFXA 4R88A 3A5FA 3L4WA 4C7FA 2WMHA 2G37A 2WVVA 3CNYA 4NUWA 4ZA0A 1FWBC 3LG3A 4D1JA 1LL6A 2ACQA 2ZX5A 4QQ3A 4MG4A 3GO2A 4BWLA 3H26A 3RX3A 3L4UA 1WKFA 3FN9A 1MW3A 5IFTA 2D1ZA 1NARA 2Z4GA 4HOZA 3CEPA 1EGVA 3L68A 4M51A 1QHPA 1LROA 3LV6A 3WDPP 4WX2A 3BSHA 3CQIA 1RAKA 2VFHA 5FEWA 2ACSA 2YCIX 4GUFA 3NA8A 2PURA 3SFKA 3U5UA 3SSZA 3S2JA 3LPFA 2PB1A 3B8SA 1J96A 2ZZ6A 1AMKA 3TONA 2WKLA 3MO7A 3DH7A 1YTKA 2A3LA 2YFOA 1GJUA 1P0EA 1HKMA 3CYVA 4L4MA 4IFOA 4C60A 2GVEA 4UTJA 3MUXA 5BWAA 4C1NA 2PU0A 4WF7A 2QDDA 3O63A 4C5YA 1BTCA 2BVYA 3S5NA 3H7VA 1FUYA 1A3XA 3FJNA 2GJXA 1KCKA 3LN3A 4IG2B 1TA3A 4S3JA 4M29A 4E38A 2JE8A 1XL9A 2WJDA 3DKLA 2WZHA 3W87A 1Q2SA 1KCLA 4CD7A 2WWDA 3W2MA 1DVJA 4DAFA 4L9XA 3U48A 4M80A 3IUHA 4TX6A 2V6AA 3CV6A 3FHQA 2ZUSA 1QHZA 2ZC8A 4LW7A 3T81A 3N4EA 1TE1A 1ZTVA 5XINA 1XLAA 1FCBA 1L8NA 1YPFA 4KEUA 3M7SA 1RQEA 4L5ZA 1JF5A 3WQGA 3LXAA 2VFGA 4WJXA 4IISA 3KVJA 1R38A 4LY8A 2FZ9A 2RDTA 4K2SA 1GVIA 1YDYA 2ZZ1A 3CL6A 3R13A 2J8GA 1GW1A 1WDDA 2V3EA 4QLLA 4TXEA 4YCOA 1KLYA 1FHLA 2RAGA 3FW6A 2ZVRA 1O6IA 4KEVA 3SI9A 2ZADA 1V3MA 2Y5JA 3CMJA 3MZ2A 2PDKA 2ZC1A 3VO0A 1XH0A 3BCFA 3WSUA 1IGWA 1F3WA 1PB0A 1S5WA 4AHOA 2E9BA 1D8CA 1KRCC 3TOYA 1UBPC 2F6KA 3GDLA 1AL8A 2C3ZA 5FSDC 3EB3A 3NL2A 3NFUA 1XRVA 2EXOA 1F6PA 3L7RA 4S3CA 1T5AA 3R7MA 2PDBA 5HJLA 4MJ4A 4JHOA 1AQ0A 3EWCA 4RNIA 3RCNA 3W0KA 1NQ6A 3FYYA 2V8ZA 4M0XA 3FIGA 4M6UA 5CGMA 5CBIA 3W6YA 3FS2A 4Q8MA 4YTQA 3MHFA 3H54A 4JKLA 4Y8EA 3DG6A 1B9ZA 4J3ZA 4N42A 2FDSA 1NWTA 3TNBA 3CH9A 3STCA 3W22A 2PRHA 3GBEA 3E74A 2XFRA 4HKPA 4GVGA 4FB7A 3PBYA 3LHYA 3P0XA 3CWNA 2E6AA 2BOEX 4LNCA 1HNYA 4AQLA 4QQUA 4PFMA 3R5EA 2OOGA 4IP7A 1OFPA 2P0IA 4BWLC 3EKLA 3UETA 1E6RA 3LTSA 1KA9F 1MVYA 4DO6A 4DN1A 5CJMA 3GSMA 1TWWA 5A6MA 3ANVA 1M7XA 2QJJA 3CPUA 4LOCA 4O4VA 5CZSA 4D8AA 3Q67A 2VDHA 3BOXA 3FY1A 4WEVX 2VFEA 4IGNA 1I1XA 3BAJA 1TMQA 1HF6A 1HKWA 1NIUA 3UYCA 2YCJA 3VIKA 2Z1KA 1HKJA 1C8YA 1ZJAA 3URNA 4ERAA 4KEZA 3CGTA 4ATWA 1A5KC 3FHAA 3KRSA 1MEIA 2ATMA 3P84A 4BKNA 2CHRA 4XD5A 3POCA 2QUMA 1QI0A 5KMYA 3L67A 3SUWA 1A53A 2Z29A 2XGBA 4J28A 3WDRA 1JDAA 3WF4A 3EOOA 4I9JA 4LUJA 2V82A 3ARQA 4TIMA 1DXIA 3D0CA 3LHVA 2XSAA 1P1MA 4HBKA 1PIIA 1CIUA 1KM1A 3PF3A 3T4CA 2DT3A 2QUVA 3BG9A 3P6LA 3VCNA 4DI9A 5J5RA 4D8ZA 3G1HA 3GVRA 1O1ZA 2DH3A 3GXFA 4Q3MA 3OEXA 3APGA 2ZIDA 2G0WA 1W2PA 4QHRA 1K03A 3NCOA 4FI4A 4JIEA 2V67A 5BNKA 1M5WA 6XIAA 3MSDA 3L4VA 4WGXA 5DFAA 3MDUA 4DBWA 5CC3A 1QPKA 3AZTA 1HKIA 1KKOA 4H04A 5C2XA 2Z2BA 2JKAA 1PSCA 1PV8A 1TTJA 1S5VA 4LS1A 3H6OA 4LPCA 4FA3A 4YVPA 1JYXA 3C56A 1VF8A 4NQ1A 2FPYA 2VX5A 4XAYA 1DWAM 2NV9A 1ZLPA 1W37A 4UMCA 4QCFA 5HNNA 3FGCB 5BCAA 1NOFA 1E70M 2V2HA 1V6VA 4JHZA 3APTA 4BR1A 5CAKA 4FOKA 2YL5A 2YCEA 2Y5SA 4ES4A 4MY9A 1Y0EA 1MXDA 3UWEA 4DWSC 3UPMA 2VQTA 2EG8A 1XPYA 3R8GA 3K4WA 5C7HA 4GPNA 2OEJA 1XGDA 4GH1A 4GXPA 1BYCA 4G7FA 3WFZA 1KM0A 1UBSA 2XFFA 5DXXA 2BP1A 1RD5A 3LY0A 4RXGA 1JIBA 1W0MA 3ZVHA 4O57A 4Q6JA 1NF7A 2VC7A 5FAJA 1ESWA 2GVYA 3AHVA 2EJAA 1A5OC 3S47A 3NQ8A 1QI5A 3VCCA 4J2MA 1FWFC 3GE7A 1A5BA 4XTDA 5HWMA 4MNMA 1FWAC 1QUMA 3CO4A 3S1GA 4NASA 4H8UA 5JXQA 3PANA 3UG4A 1KBLA 3QPEA 1C91A 2AOSA 4C6QA 1EOMA 1M53A 4ZOBA 3QQ1A 2ISVA 1P7TA 4AZ7A 1W2VA 2NX1A 4BI5A 5CG0A 4TO8A 1R2RA 4EXAA 4NHVA 3UXDA 4E3TA 4BA0A 3GHTA 1TJRA 5LHFA 1S1RA 1XLGA 4LVBA 4IWWA 1C8VA 1SSDA 4M82A 1VBUA 1TA3B 3VFCA 2H3DA 4C6PA 4BY3A 1W9XA 2BSLA 2Y85A 5E0KA 4UC5A 5IM51 1XIDA 1E4IA 1FBAA 4E8DA 2DSUA 4N9BA 1HJWA 1RCXB 1TV5A 3NZGA 5HQMA 3GXNA 3QGKC 2W0UA 3MBDA 5LNSA 4LXFA 4PMQA 1VGAA 3GNXA 3V75A 2F7FA 4H3DA 5CPOA 1WO2A 3UA4A 3AQUA 4WY0A 2W79A 3RLGA 2GFTA 5DX7A 1TTIA 1QTWA 4L9ZA 2QDGA 1AW2A 5EY5A 4R5EA 3DOPA 1A5CA 4MDPA 3QC0A 3UJEA 1FQ0A 4HB7A 3RJYA 3OVRA 1DXEA 3P62A 1EOKA 2ZA3A 3RCMA 5HPCA 2FZ8A 4F2TA 1KFJA 3WMCA 1TTQA 1IEWA 3GDMA 1W3LA 4S3GA 5XIMA 3NTYA 4AZGA 3BANA 4HK5A 3CHFA 4O12A 4LB4A 1ZPTA 5G2WA 3F5JA 3FXGA 1EC8A 3MUZ1 3DZ1A 1FX6A 1B31A 2P5NA 3UZZA 1Q8AA 1WB0A 4A8NA 2ZFAA 3PZIA 4MTVA 5FJRA 3MC5A 1QT1A 2NX3A 5DF0A 1WBHA 4F4RA 3WFAA 1ZU8A 1E5NA 4XWUA 3ARSA 4NZFA 4FPSA 1UWTA 4OVXA 1POKA 1S2WA 4KEMA 3PTDA 1DJQA 3SUVA 3BURA 3WLSA 5DMMA 1BYBA 3CB8A 1EP3A 3VGEA 3IVTA 1MEWA 1JF6A 2WNQA 4XUGA 4R27A 2IQDA 4UIOA 1U2YA 2R8WA 3CL7A 1HX0A 3R94A 3W2LA 3HG2A 1W9DM 3O7UA 4A35A 4W4QA 1XIFA 4UOZA 4K3ZA 2CLHA 4ACYA 1TV7A 1KXTA 1EUNA 1KFLA 1FKXA 1GNXA 3A4JA 4A2SA 1G9HA 1J11A 3GR4A 4RR4A 1GPFA 2O7SA 4Q8NA 3UR8A 3C5QA 1QDSA 1UZ1A 3BCJA 3LLDA 2V68A 5C5YA 4EK7A 3OIHA 3CTTA 3WBYA 2JIEA 3USBA 4EF8A 1J0JA 1XQLA 3TEVA 2V2DA 5XIAA 1K70A 1HGYA 2OELA 1XLCA 2J7DA 3RPTA 4GIAA 1SZEA 4X22A 4TMBA 5REQB 3CUZA 4IP4A 1V51A 4ZTYA 1R30A 3EKZA 3WLLA 2CPUA 2CLMA 2TPSA 3AHZA 4WKFA 2ZOXA 4YLWA 5A69A 1KD0A 3KVMA 4MHBA 1FP8A 1R85A 2DZAA 1RCQA 3FGCA 4IX0A 2R82A 3RJXA 5ECVA 3V1HA 1F2JA 4RPPA 2QCDA 1OFQA 3QY7A 1XC4A 2Z2AA 1VPXA 3ELFA 4U2YA 5LIWX 2A7NA 5EFFA 4QEEA 4D6DA 3I65A 3E5PA 1GVQA 4LALA 2XH7A 4HTYA 3BARA 1SYTA 2C0AA 3GVQA 1BAGA 2UV8G 3NEHA 3LS9A 2YL9A 5FJOA 1VHNA 1UKTA 5FD0A 5K2ZA 3RILA 2V30A 5CEWA 1V6UA 1W1VA 2NUXA 5CPLA 4QJ4B 1NJJA 4I7WA 4WD0A 4D6HA 5LXXA 3UPBA 1I45A 4C65A 4KCUA 4BQ5A 4W8BA 3U2ZA 4UTMA 4CLMA 5GJMA 3LCXA 4FF5A 1QNOA 3UVIA 3M4HA 3LHUA 2DW6A 2VNCA 1JXJA 2A79A 4H00A 4C91A 3WJSA 4INFA 5BXPA 2PGRA 4MWAC 3I3BA 1TQXA 2OXNA 4IT1A 2AAAA 4E5TA 1Q6RA 1FY6A 5MF5A 1D3HA 1OCNA 1OSEA 1BPLB 1V6XA 2QUTA 1UZHA 3RRAA 3WDQA 3UZJA 2BVDA 5FJTA 3CHVA 3GYEA 3GD6A 1GVFA 2NQHA 4D8LA 2WKJA 3GS6A 4DPQA 1P0NA 2FVLA 3H7UA 2ZE3A 1RLDA 4GKTA 3HFYA 4HT3A 2IPGA 1W3NA 2I17A 2QPUA 1XBVA 3GXIA 1XP3A 1VEPA 4OUIA 5J5DA 2X0YA 2J9YA 3T44A 2BMBA 3ABOA 4OFCA 1WDQA 4L65A 3OGSA 2MANA 2D3NA 1SVDA 3GNNA 4HP5A 1ZENA 1LP6A 3LQLA 3QC3A 1EHNA 1VFSA 4WKAA 3OJGA 3GQYA 4HHHA 4H9TA 2FB2A 4I6VA 1IEQA 2VENA 2BHUA 4JR5A 3NQ7A 2WQDA 2Y7DA 3PP7A 1S5MA 4E8GA 2V63A 2FB3A 4A2RA 1NFPA 4HOXA 4HTBA 5JU6A 1IXQA 2EJ1A 4ZQMA 3W25A 2D2JA 1QATA 1AD1A 4AHPA 2YGYA 3QV8A 5HJYA 2Q3RA 4XBSA 1F4HA 3CK5A 4EXBA 2DIEA 3TJ4A 3RU8X 1QK2A 3UGVA 2OKOA 1OEPA 4LAMA 1J6OA 1FH9A 2X8RA 4D6CA 2CLIA 2D69A 5AVNA 4AD0A 4ROQA 2C13A 3SFWA 1AUSL 4XAZA 2PDUA 5A8NA 3E0WA 3LQGA 2OT0A 3AXIA 4FF7A 3R6IA 4U3AA 5IBXA 3NQCA 3T9PA 3HMJG 5CJNA 3DUGA 4AX7A 4ATLA 5FL0A 4CNSA 2QAFA 1XSIA 1XSJA 1OT2A 3D3AA 3DHDA 4H9UA 1UWUA 4GXWA 3KOWA 2C18A 2IXUA 4UR9A 3GDTA 1XD0A 3MW7A 1N8IA 1KLZA 3HA1A 3PWAA 3LBCA 2QIIA 3NQMA 3T6CA 5CPTA 1DQWA 1B2YA 5A3HA 1J0KA 1RY0A 1CT5A 1PO9A 4X61A 1YE6A 4MNJA 3TSMA 1TPVA 3NO1A 5DT7A 4IMEA 4HD5A 3SIZA 1TSIA 1MI3A 2C8NA 2PODA 4CD6A 3IJDA 1Z32X 3WQPA 4AUBA 5AFDA 4NI3A 1LBFA 2CFFA 3PZUA 4IF2A 2YFNA 1TVPA 1ZJBA 2G96A 1ZY9A 3O15A 5D2WA 4CCZA 2G3JA 4UQAA 1H5VA 1G69A 2PUZA 3W7DA 4RUBA 1UP2A 3KOYA 1WYIA 3UBPC 4H9YA 2ISWA 1QPQA 3BQ6A 4HU4A 2WPGA 3MV11 1JAKA 4AD3A 2HE5A 4ZO6A 3PULA 1N2VA 2W6RA 1H7NA 1XYFA 2ESCA 3T0BA 4FOUA 4AYGA 3M0IA 2DSZA 2E6YA 3N4FA 2XFYA 3WX7A 3SCWA 1R3SA 3VNJA 3W02A 1E73M 1GHSA 1W32A 4D6JA 1LG2A 4UCGA 3UW6A 1JEZA 3GHRA 2Y7FA 2V3GA 4AYSA 3L0GA 4FEZA 5BRQA 1G5AA 3G3DA 5HATA 4W86A 4IIHA 4AWSA 3HN3A 5LNVA 8CGTA 2BOGX 3QPYA 2ZX6A 1E4NA 3PZQA 4FOJA 1T41A 1U5VA 3RG6A 1HVQA 2YW4A 1LG1A 1BXNA 2ZX8A 4O53A 1LCOA 3RLUA 5FEZA 3OYZA 1I75A 1XYLA 3N6JA 1CEOA 3OW1A 5A8MA 2MNRA 3E2VA 4B9YA 1KFWA 5F4XA 1GORA 1J8VA 3P81A 3B06A 3WG6A 5BRBA 4XZHA 4OUEA 2J24A 4B4FA 4ADSA 3HG3A 3QZAA 4HPGA 1OIFA 2HNEA 3UG8A 3N6HA 2Z0IA 2V2CA 4MLJA 1L6WA 1VP5A 4PBGA 4TV5A 3WD2A 2ZA2A 2ATSA 2GUUA 1MYRA 3VE9A 3GNOA 3PZGA 3A3HA 3G1YA 2JEPA 3R8RA 1UUQA 2Y8UA 2YXGA 1OVDA 5CBJA 5CQ1A 3UFYA 1NTHA 2FTWA 2NUWA 1VIWA 4E4UA 5CZTA 1B9BA 3MUY1 3NZRA 3QXBA 1A3HA 1RXOB 5K4XA 4J3VA 1D3CA 3SCNA 3OA5A 1UC5A 3PUDA 3UY7A 1YHTA 3SUTA 1D7FA 5AC6A 1CB2A 2QJGA 3SQMA 2OYMA 1WA3A 1V7AA 3BW3A 3PAOA 3NO5A 3WMBA 1QRQA 3II1A 3WCZA 2NW0A 2ZUVA 4H6QA 2AL1A 2V3FA 1W5OA 4ONVA 4W87A 1O12A 4YPJA 3MYPA 1GZJA 3OIXA 4H7CA 3U6WA 1E9LA 1SM9A 2PC8A 3HJEA 5JMUA 3LDVA 2NWSA 2BY1A 4DXKA 4AMAA 4QROA 4DO7A 3WLKX 3NL5A 1WPCA 3P61A 1J6PA 3S42A 5CGQA 4BF5A 4YWIA 1HQTA 4DZAA 1D3GA 3DHPA 5KINA 4RZBA 1CXHA 2Z26A 4ZO7A 3WY1A 4LEQA 3LTPA 1A5UA 1KCXA 1BF2A 5B7ZA 1FWSA 3T08A 3NVDA 4JFUA 3WO8A 1E55A 1DJHA 1DPMA 3VU2A 5IOBA 2BXVA 5DCDA 3CZ8A 4F0HA 3S0CA 2HSAA 3WH8A 1UKPA 3N29A 1ONRA 1KR1A 5C0QA 4N6FA 3S5SA 5H8MA 2X1SA 3MUAA 1JD9A 4LUTB 3WDIA 1H63A 4NRSA 2NUYA 2E9LA 1DWHM 1KB3A 2WKGA 1CGXA 1Q13A 3TH6A 3R43A 5G5IA 5I06A 4XX6A 2OWCA 2ICSA 4IIEA 4ZQPA 3VMPA 1ICSA 3L66A 4MKSA 4F48A 3SBFA 2QJIA 3S6TA 4S3EA 2P3EA 4O8RA 4DPPA 3IVSA 2VCBA 3M5YA 3EDFA 3IJ9A 3TIMA 1JDDA 3F1QA 5BMWA 3W29A 3IV3A 3H2CA 3KHDA 1LJYA 1XF0A 3KL3A 4QISA 3CLMA 1IGSA 4HYRA 2J62A 1JDCA 1JZ3A 5BOEA 4N6EA 5BW6A 4W85A 3B0PA 3UD6A 4JTKA 1K9FA 3DYMA 4LX4A 4MY8A 1XH1A 2WMGA 4PTDA 1EBHA 2PP1A 1EZ2A 4CVWA 1RBAA 1DJIA 4GUJA 3KBVA 1XUUA 4CQ9A 3LD5A 4DNHA 3W7HA 1P48A 1QU4A 3NAVA 1TB3A 4ERGA 4FXSA 4UTLA 3G8EA 3PTQA 4FNSA 2P50A 2FFIA 4NZ5A 1A0DA 2DJLA 3CM4A 3VDCA 4WDWA 3TE9A 5I3DA 4RV3A 4I9TA 2H6RA 2E5DA 1XLIA 1O5QA 2C1GA 3NYZA 2JFEX 1YXDA 2YYTA 1VH7A 4DY1A 4REQB 4IHCA 2AGTA 3TYBA 1AJ2A 3G3MA 3W26A 2C1HA 1VJSA 2WCAA 4S3FA 1NP0A 3HURA 4MAZA 3HPZA 4ZEPA 5AYZA 1R7AA 1UR1A 3WJYA 1DXFA 3U57A 1PYFA 3ABZA 2QUNA 3M1ZA 3BTNA 1E3XA 1LLOA 4O16A 1KM4A 5H2ZA 2OVLA 1P5BA 3HB9A 1PTDA 1EC7A 1KBBA 2NVDA 4B91A 3M64A 1JI2A 2PLCA 1MUMA 4NZJA 3CUJA 4MJMA 5DMLA 4UQCA 4CQBA 3OTRA 1YBQA 5LYRA 4PRWA 3PUOA 4FIRA 3THDA 3UXLA 4R7OA 4GYKA 3CU2A 3TZNA 1UD2A 1W56A 5HMSA 3H4XA 1CLKA 4NXSA 4B3KA 1GJPA 3STPA 3UPWA 1FWTA 3BE7A 1VEOA 1V79A 4XBKA 2EBNA 4F2UA 1OYCA 2VURA 3RUBL 2VWSA 1RUSA 3L5MA 1B3WA 4CN6A 3ZVHB 2G41A 3GWQA 3TWBA 2VEIA 1ODZA 2OU4A 1MNSA 1VLWA 5D38A 2BX7A 1HVXA 3E5BA 4LH8A 1ZGDA 5EMKA 1BTMA 1CXLA 3IGHX 2A2IA 3SEPA 3POHA 2W67A 2BZNA 1DIKA 4LVDA 4QLKA 3VI2A 4O1BA 4BEQA 4KGJA 3QEZA 2LLEA 3F2DA 1JAEA 2GDVA 5J8LA 3VNKA 3WBAA 2ONEA 1OHLA 2EPHA 3NQEA 3UJRA 5CLTA 4H9ZA 2PD5A 9XIAA 1OF6A 2B7PA 5L6UA 3TN5A 1SW0A 3UR5A 3VKDA 4NYUA 3MU7A 1V0KA 5LIUX 1R2SA 7TIMA 2I56A 2WC3A 2VMFA 1JUKA 3GTHA 4P2VA 4JYEA 4R3UA 3URQA 4ZO9A 9XIMA 2ZTKA 2QF7A 1CENA 2Y7GA 2AL2B 1HJVA 3PZTA 3O6AA 4EWND 3ME3A 3N2CA 4UMBA 3H7RA 3M16A 4ASTA 2WXDM 2JK2A 2EHHA 4Y90A 1QASA 4JTCA 5I6SA 5IRPA 4GZ7A 4R9OA 4PZVA 1X97A 3ZYZA 2TYSA 3ZJKA 2HWGA 2WZTA 1B54A 3MP5A 4HIBA 1WQ5A 6REQA 3VD5A 4JPGA 4C6OA 2PDLA 4GYPC 4LVFA 2E28A 3P93A 1PZ1A 1JPMA 1RJRA 1SZRA 1ZSXA 4LEFA 3UWUA 1QO5A 3EPNA 4F40A 4B5VA 4E3VA 1KV5A 1XLDA 1RPKA 4WY0B 1HJXA 4CCEA 3QGVA 1BQGA 2IXVA 1WBJA 3VDBA 1EB3A 3MTWA 2WOQA 3KRZA 4QR6A 3BAKA 3IANA 1IE7C 2NV1A 2I14A 5C7VA 2X05A 4FK9A 3PC0A 4LB3A 1UP3A 4B5SA 4FP1A 4QRNA 1UA3A 2YYUA 2VTFA 3TCEA 2A3HA 1ZZMA 1OM0A 5F4WA 4S2BA 4QSHA 4AC1X 1IQ8A 4MJZA 3QGAC 4I5XA 3WLTA 4WHBA 3RX2A 3B0YA 3LPGA 5GVJA 4H01A 3SY1A 3V1PA 2PCEA 3ZMRA 4ADUA 3BC9A 1L2QA 3EEZA 1I9CB 5C9RA 1XLEA 2YBTA 1DWGM 3ZZ1A 3T1GA 3P7YA 1EGZA 1C8QA 3THQA 4I8YA 2XJ7A 1ZP4A 4G1NA 3HOJA 1RZMA 4KERA 4OHQA 2YJQA 1F76A 1GKQA 2VJXA 2YA2A 1XFCA 2PU1A 1VC4A 4C7DA 4C90A 1US2A 5TIMA 1KW1A 1R87A 4WXZA 5C2GA 1IIGA 1PKMA 4RE4A 4O1AA 4WY0F 4JY9A 1F3EA 1E1CA 2A7RA 2WM0A 1E6NA 2ZYFA 4HPHA 3L4YA 3P0WA 4J4KA 1A49A 2YL8A 4H2HA 3UA3A 4Z1YA 4IMGA 4K8HA 3CMGA 1K8YA 4U5IA 6ENLA 2FVKA 4OZOA 4JHMA 1J2WA 1KXHA 3LUTA 2XINA 1R2TA 5FCZA 2E77A 1TPFA 4Y6GA 3VIPA 4AZIA 1Z8AA 4I7UA 5D09A 3K1GA 3MCOA 1AG1O 2CBVA 3VDHA 1KXVA 5A2BA 2ZVIA 4O17A 1XFBA 4JQ3A 1CX9A 1GVEA 3LXCA 4P8WA 1UKQA 2A3AA 1FWEC 3M7WA 2VEGA 4GJJA 3GG8A 5EL1A 2X1IA 1IXPA 1C9WA 3P2VA 3ZR5A 4KFOA 3GFYA 5AC4A 1FH7A 2YOCA 1I2RA 1XD1A 4AZCB 4TTGA 4ZQCA 3CPRA 2HPIA 1IZCA 3CZKA 3MP3A 3T42A 2VZTA 3LLXA 1HTIA 3BV4A 2JBMA 2QYGA 3C8FA 4V1XA 1CXIA 3OGVA 5C54A 1MFVA 4A8LA 1GW9A 5LNRA 3NOYA 1VIZA 5CSRA 1UJPA 3AXHA 3THCA 1LT7A 4TVUA 3NDZA 3CC1A 5AZ1A 3W2KA 1LQ2A 4NYYA 1O5XA 1V3LA 1CXFA 2E8ZA 4N02A 3WH9A 3ZM8A 3KEHA 3VZZA 5A6BA 2Q09A 1J18A 4Y9MA 1TQJA 5TNVA 2PDFA 3U0HA 2GQAA 4OV9A 1LUCA 1YNYA 2R1KA 2POTA 5FOOA 3VDGA 1AL7A 4WIWA 2UZ9A 5JUVA 3SRHA 4ILSA 4MB1A 4EPEC 1R7OA 3A21A 2E0PA 1GPWA 3CHEA 3DC0A 1UR4A 1HL8A 2CETA 1DL3A 1KNWA 1BG9A 1ZNNA 1ITCA 4LU0A 5BMXA 3I6RA 1F07A 3NR0A 5AYIA 5FF0A 1XJBA 3ZT6A 4XD3A 3JZEA 4IFRA 2JQXA 3W1AA 3C2RA 1KV8A 3CQHA 1DHPA 2WV8A 2HV5A 1J79A 3VNLA 3V4BA 2Z24A 1Q7ZA 3QZ6A 4AXKA 4MYAA 3KLLA 1XM3A 4QBXA 1OT1A 4QNEA 4ZOCA 4FX8A 4K1WA 1ZCCA 3PBMA 3FAWA 3FJ6A 2HDJA 2QLYA 3OZYA 3E0FA 4GHRA 1A4LA 2DZVA 2O92A 1QVBA 3LRMA 4XKYA 1K77A 2OJPA 2ZXBA 3VNIA 3T8LA 4H1ZA 4PMYA 1H7PA 1K8CA 1ZUAX 2GJRA 3VD9A 3L2MA 2QCHA 3O0FA 1Z9AA 1ME7A 2CZDA 3W86A 4E8CA 4X3ZA 2GK1A 2X1RA 4PMOA 2VR4A 1QJWA 1D9EA 3ZR6A 3RLHA 3I3EA 1P4CA 1F61A 4FR6A 4OBTA 2OZ8A 4QNWA 3QR3A 4GQGA 4QX4A 4LAOA 1D7KA 4B16A 3AUOA 1UR3M 4HNLA 3RRXA 1J0YA 3WK3A 4IL0A 3A4XA 2WVVB 4NX5A 1YW1A 4IQDA 5HUPA 1BVNP 2Y7EA 4KFNA 1B1YA 1W3JA 3VILA 4QE1A 2B0MA 4IPLA 1BQCA 2XWDA 2ISDA 3MPGA 3P8IA 1XBXA 1LF1A 2PP0A 4GCXA 5LZLA 3FK4A 1VS1A 1CXEA 4NAFB 4K8GA 3H4GA 4F0RA 4XO6A 1H0GA 3CMFA 3Q65A 5AB3A 3TTSA 2OYKA 5CSSA 4M24A 3GK0A 2Z6IA 3TYUA 2W4XA 4RPQA 3T8QA 2R1PA 2GPTA 3SUUA 3PSVA 5C70A 1IYXA 3EAUA 3SO7A 1IWPA 4AZ6A 3BG3A 5LA0A 4US6A 4XIMA 2WCSA 2D22A 4OQVA 3BLIA 3EX4A 1EJUC 1EBGA 5DMNA 5PTDA 1W1YA 3N14A 1J5SA 1C29A 1SPQA 4ZXOA 3GW3A 4H6KA 1W9UA 3RMJA 3ZS4A 4BQ3A 1W6TA 2HBVA 2H8XA 4IIGA 2Z27A 3DEQA 3QHNA 1RBLA 2HVNA 4XZ9A 1EYWA 2BV9A 1YKWA 5TBOA 4IM4A 2ZRXA 2KZHA 4GACA 4PUJA 3OLIA 1M6JA 5K9DA 2J7HA 1R3QA 2P3ZA 2PDJA 1XGEA 3CBWA 2VGBA 2CNCA 4JY8A 1YPXA 3P5YA 3DI0A 4KRUA 2VT0A 2VRJA 4NZ4A 5HJXA 4E0CA 2B7QA 2G5WA 4F9JA 1NOWA 3FVDA 4DHGA 3VDAA 3Q58A 2W27A 2F61A 4FS9A 5I3GA 2AQVA 4UTUA 3VKCA 1YRRA 3VNMA 2KAUC 2J13A 3E1F1 1FWNA 5T91A 3LLFA 4Z08A 3UEQA 4O15A 3FLUA 4HU8A 4HU0A 3QOMA 3M41A 1EX5A 3FA4A 1U1UA 3S2LA 1IHIA 2O4QA 3VGHA 3D3FA 1QXLA 1C9DA 1V4YA 4GIYA 1GOXA 2PP3A 3W7CA 3C8NA 4F8XA 3BLKA 1R46A 1F73A 4NVTA 2PWGA 4B90A 5IHRA 1LM1A 4W89A 4IXXA 3SY8A 3A24A 3FEMA 1RK5A 4OE7A 4CD8A 5EYWA 3U7BA 5I09A 1TCMA 3KLKA 4HNUA 3NQGA 3IV8A 3UWQA 5FAGA 3HG4A 3W6LA 2J7EA 3P82A 5G1TA 2CESA 2GL5A 3BLEA 1GCYA 3K13A 3LSBA 5EKYA 2D73A 3V7PA 1GEHA 1IIHA 4JYFA 3THAA 4JCLA 4D6EA 5D8ZA 3QPZA 5E1QA 4UTFA 2WMIA 3M9YA 1HKKA 5E09A 4UOJA 3R4IA 1ECEA 2IQTA 3G2GA 3AYRA 3PS7A 3QH2A 1TCDA 2BVTA 5HNTA 1J10A 3UT0A 3A9IA 4DBSA 1BWKA 3CUXA 1HXJA 4RDZA 5F4SA 4AFYA 3QBUA 4UBPC 2WHJA 1ZQ5A 3B8IA 4AY8A 1ENUA 3S83A 3V35A 4CNUA 3QMSA 3KFTA 3VOHA 4XAPA 1XCXA 1FA2A 4J27A 1ELSA 1VFLA 5M17A 3NZPA 1JRBA 1WOAA 3QSTA 3NXLA 3QMTA 1BFNA 2D2HA 2CLFA 1UIPA 4RNFA 3R8HA 3BW4A 2ZUTA 5ABTA 4QEHA 5D2VA 1M7OA 3AYVA 1QR7A 1Q6FA 2OQHA 3O06A 2A0NA 2OR2A 3ZJ8A 4Z1DA 4Z2GA 1H5YA 3ICJA 4AH7A 1DIDA 2XZ7A 3DX5A 4XB3A 1Q3NA 5F1VA 2XN2A 1E0UA 3PZMA 1PE1A 1OC6A 2ZDRA 3G6MA 3AI0A 1EF2A 1YTDA 3PUEA 4HHMA 4J7RA 2OKTA 4D72A 1EP1A 3U4FA 2TMDA 4M56A 3WUGA 3H21A 1NDZA 1H60A 1RSCA 4I6KA 4M3PA 3WNKA 1ZJIA 4C6KA 5EGRA 3MSGA 1NF0A 3KBNA 3S3GA 3SCRA 3CAKA 5A8QA 3TNOA 4B15A 3C3UA 4CU6A 4L6DA 3F4DA 4Q7NA 4AW7A 2E1DA 4XG1A 2XM1A 5C8BB 1VFTA 2ZZ4A 3WK0A 4MFEA 1RCOB 1FWWA 4BFAA 4JTAA 3LM3A 3O9NA 4G2DA 1JQVA 1E9YB 3IRDA 4XVEA 1RVGA 4N4PA 5D33A 3TMQA 1FCVA 3E2QA 4S3KA 1KM2A 1ML1A 4H9VA 2VWTA 5D37A 1UD4A 3N6QA 3QY6A 3MWAA 3I7RA 3QHMA 1XRSA 4KWWA 3VIFA 2BOFX 2W62A 3BK0A 3QMRA 2D0GA 3SRDA 4M7SA 1LRQA 3P8JA 1OJXA 1SZFA 2E67A 3W1RA 3GVWA 2R6OA 3URBA 1L9WA 4G56A 2R94A 3F03K 3M47A 3W88A 1ME8A 1UQYA 4GOAA 1WXJA 1DIOA 2QCEA 4PCPA 3WQ8A 3W53A 2DJXA 3LZ3A 3A3XA 5C9UA 1DWFM 2NSXA 5HOSA 3GIPA 1JPDX 4BF9A 4Y96A 2GVLA 5T8GA 4A05A 3I6TA 3TW7A 4US5A 5I3JA 3BCDA 2E4TA 4D2JA 1AZ1A 3GNRA 5HQEA 3ZOAA 3CEUA 4PFHA 3UZYA 2OODA 5KZ6A 1VQTA 4J2PA 3A47A 3TJXA 4E2OA 1JD7A 4KBXA 3VOJA 2IPFA 4HJFA 1H62A 4JNZA 1OGBA 5BXTA 2ADAA 1P43A 1I1WA 4PMNA 3O6YX 4B5WA 3A22A 3WQFA 1H7OA 1I6NA 1MUWA 2VVNA 2PSNA 3PWIA 3CLWA 4CQ8A 4XZIA 2A21A 2BDQA 1S2CA 4K6AA 1GT8A 4DF1A 1W9BM 4HJWA 4IQJA 4UCFA 2AL2A 4LS2A 4I5RA 3AOFA 2Z7GA 1TO3A 3BOLA 1ZJHA 5DO8A 2UY5A 2HROA 3E9AA 1UYQA 3IACA 3KOFA 1JXKA 3T78A 1X1ZA 3S9ZA 1JR1A 5AHIA 2X40A 3MJMA 3BMVA 3WFLA 3EWXA 1KC7A 4RZ6A 2D24A 1UC4A 1EJWC 2MUCA 2QDEA 3BMXA 3HGOA 4GA8A 3SQSA 3GBDA 4JL2A 2GJLA 3QR0A 1A47A 1NH6A 4L1GA 2OLSA 3T0DA 5CC5A 3SGZA 3ZFHA 1W54A 3WYZA 4EX4A 1EDGA 1BYAA 3SRFA 3PPCA 2ZZ3A 4LTSA 3BXWA 3O6DA 4FLQA 4PRRA 5AECA 1DHKA 2YDAA 3N2BA 3ITXA 3MUIA 3WNPA 4CN1A 4Z2JA 1VRXA 2Y62A 2WHLA 1LOLA 1YE4A 4NL1A 4N9DA 2F6XA 3CQKA 3R89A 1UUMA 4XQ6A 2XN0A 1W9PA 3H2FA 3K46A 2Q8LA 3W7QA 4QE4A 4OTKA 4U33A 2DU2A 1CNVA 1TWDA 4QITA 3UJFA 3G18A 4LQ1A 1I0BA 3TSBA 3FDGA 4GY7A 1K3UA 3B3DA 5HQLA 4KWUA 3ATYA 1TMHA 3SN4A 1EHAA 1M03A 3NM1A 4X0NA 3A4WA 4NU7A 4GJIA 2PMQA 3PTKA 4GVIA 5H6HA 3KTCA 4AMCA 3M0MA 1M7JA 1YPIA 4J1OA 2VXNA 4A3RA 1IZKA 3U2CA 2XIJA 3S5ZA 1QK0A 4GNJA 3EDEA 3PPGA 2DW7A 2AQOA 5I5RA 3W76A 2YIHA 3UZ5A 2QW5A 3RDKA 1ITUA 3N17A 5D05A 3H2OA 2ZRVA 2PRMA 3ZWTA 3DFOA 4LUSB 4H7ZA 4DZHA 3WD1A 4RDYA 1QMLA 3SZ8A 4F79A 3LM7A 4QAWA 4ZENA 5I3KA 3UG5A 2J8FA 4YNGA 1G4EA 4HQVA 3Q94A 4AD5A 3WQWA 1X98A 3TA6A 3TSDA 4QXIA 3QN3A 2HMCA 4MWAA 4KKXA 1R0MA 4WQ6A 1PTAA 2DSKA 3KL5A 2QVHA 1TUFA 4XO7A 4RE2A 1FFRA 4AY1A 4CKQA 3TYEA 2FIQA 4KESA 1RHCA 4EPBC 3ARZA 3WUBA 4LCRA 4KCTA 4RKAA 4DM2A 3TQKA 4HMEA 4JN7A 2VOMA 2ZXAA 1GOKA 4JKKA 3H70A 4N7QA 4GO9A 3TYDA 5CC6A 2V5KA 5H1WA 4PMXA 3NQAA 1EIBA 1GOOA 1X1OA 4MPKA 3VYLA 1SO5A 4PYSA 3AS3A 1UWSA 1GYMA 1TR1A 1HJUA 2VR2A 3PBGA 5F2IA 3G8RA 1PDZA 1OD8A 3MCNA 3C6CA 5I3HA 4Q4PA 4DF2A 4WXYA 1TWSA 2WYSA 4C6BA 4KIRA 4DNMA 1SJDA 4HYWA 4FXFA 3ERPA 4ERIA 2FGLA 3WLJA 1XC6A 4CD4A 3WJZA 1QW8A 3HGRA 1TRDA 1OINA 2EPLX 5FJUA 3S2CA 2J75A 2XFWA 4KRZA 3MI2A 3WQEA 4PCFA 2ANUA 4Y7EA 4IGMA 1OG6A 3WQ6A 1OX4A 3TFCA 1W17A 1XSKA 4C6EA 2E6FA 4A8RA 2Z6JA 1RV8A 1OGGA 5DELA 3M07A 3UCQA 1U1JA 4I8DA 4DO4A 3S6DA 1VCVA 2BGQA 4DBEA 5LA2A 3TW9A 2VRKA 4HN8A 3FYOA 4LF1A 3ABXA 4B2DA 3W01A 5HA7A 3A5VA 1CGTA 1CXKA 2QPXA 5FEPA 1XGZA 2HQAA 1TG7A 1WUEA 4I9AA 1J0ZA 2H9AB 2QJMA 3TJIA 4M81A 3S8HA 2XIBA 4HPNA 4PA8A 2QCMA 3W7GA 5E70A 4FHAA 1TV4A 1H0IA 2ZXQA 1HUVA 2VI0A 3MKKA 3W1MA 5BOFA 1J2BA 4O28A 1KTBA 1U1HA 3KRUA 1PEZA 3TXZA 2CU0A 5C6MA 4OKDA 1E4MM 1ONWA 2EPMX 4MKNA 4IPPA 8A3HA 5DQPA 5BU6A 3M0JA 4ADTA 2E9MA 3S1UA 1AH4A 2YB1A 4IOTA 3AHTA 4DUWA 2IMRA 2VRQA 1YDVA 1P6WA 3W00A 1FHUA 3DGRA 3HV8A 3BAYA 5LHEA 2O4MA 4DJFA 2ISFA 2VELA 3W7IA 1GOIA 3PFMA 3ENLA 6A3HA 1XLBA 3OHMB 2ZRZA 3CS2A 4IMCA 5FKYA 3ITLA 3IJ7A 1TJ1A 2A3BA 4ML9A 4D1IA 4IIFA 3TR9A 2DIJA 3ZLFA 4Q22A 4ZFMA 3WZ0E 3I3DA 4GK8A 2IW0A 1MQRA 2JKEA 5GNYA 5DRIA 5CPMA 3B04A 3PR2A 3FJLA 3HM7A 5CAHA 1JZ2A 1KXQA 2ZQ0A 4RK8A 3T0AA 3FCPA 4PEKA 1F5ZA 1YYAA 1W1TA 5AY7A 1IWBA 4AZ5A 1TPEA 4FXJA 4IL2A 3G77A 3PUGA 3KWSA 5ABHA 3MI6A 4Z0SA 3ZVIA 3QV6A 3W82A 3V18A 1EIXA 3ZLGA 1PPIA 3GX9A 2A6LA 1GEQA 1QPNA 1ADDA 1Z41A 4WOZA 2FKPA 3GDRA 1FWHC 4YCPA 1ISVA 4PMJA 2PWFA 1O5RA 1MMFA 1G94A 1JCJA 2PGEA 4UR8A 1H3GA 1T96A 2ZZ5A 3SCQA 1OQFA 5EMYA 5I77A 4OU1A 5ENLA 3GG0A 3LHWA 1HKVA 3IIOA 2BNJA 3ONCA 1F9CA 3TC7A 1QBBA 3W71A 3B8UA 2YKKA 3KOZA 4D9PA 1UCWA 1XDLA 4HGXA 4DRSA 1GG0A 1QW7A 2GGHA 3S9YA 2NLIA 5I7GA 2CBUA 2POZA 4AX6A 3SCVA 4C6FA 1WAUA 2QCCA 3B4UA 3C4UA 2PCQA 2W63A 4LF2A 3CHDA 1RVKA 3NDYA 4KGLA 4JTQA 4G9PA 1P0BA 4YL2A 1SGJA 3MDWA 4H4IA 3DG7A 5EMLA 4LUYA 4HVXA 1E1FA 2BG5A 3W81A 2WSQA 1BRLB 4ZFCA 3KVKA 1TX2A 3DYPA 3EWWA 1UR0A 2GUYA 5ABFB 2A5HA 5GNXA 2YR1A 3F2BA 3MKVA 1Y5WA 1WCGA 4W93A 2WBKA 4DYJA 4GXMA 1C8XA 1ITQA 4REQA 2BWGA 2PEVA 2HS6A 4N0RA 2OSXA 5AKQA 2PPGA 5CGTA 1WNOA 8XIAA 3WH6A 3RHGA 3I68A 5A6TC 3N9RA 3C61A 1GJWA 3ANYA 6ALDA 5H8PA 2X30A 2W92A 4NZ1A 3PK7A 5GNZA 2H9AA 4JTEA 3LTYA 1YEYA 3N18A 3T0TA 3R0DA 3F7JA 2OOFA 2BS9A 1I4NA 4GABA 4OOUA 3GB6A 3H55A 3PN8A 3OA3A 2ZWZA 4GFIA 3PZOA 2CW6A 3W7RA 4MPQA 3FEQA 4CGTA 3UXKA 5JH1A 3H53A 1EL3A 2GSEA 5E0CA 3RR1A 1LWHA 3EOUA 2R24A 3EWYA 5A95A 3GH4A 3WNNA 1UD5A 2RGLA 1CI1A 3HPSA 1XIBA 1GTEA 4ZB2A 4RDWA 3F4WA 3GHSA 2HXTA 4CCDA 5A8GA 1L6SA 1L8PA 2Q3OA 5A6KA 5AHFA 5HWJA 1UR9A 1ZFJA 4K7YA 1ITXA 1F3XA 1R9ZA 3GM8A 4DXVA 3IJ6A 1TVNA 3W1LA 1V7YA 1R6WA 3MANA 3R0UA 3VGGA 3BOFA 4O4WA 2CKSA 4UTTA 5AC8A 1EGMA 3AUJA 3SUSA 1UA7A 4GBDA 1IWAA 4GLEA 2DZUA 3CJPA 1X6UA 3GKFA 2V81A 3RXZA 4GIEA 4LWWA 5D2YA 1ISYA 4ACZB 1GVOA 4D6GA 4LFYA 3H2AA 1W3TA 3S6OA 4GYPA 3P3BA 3BAXA 3NEVA 3VKKA 5LIYX 4N2YA 3ALGA 1C93A 4LCQA 2ODOA 2R91A 3HF3A 3V5CA 1OFAA 4QJ1A 2B7OA 1W3IA 4IUOA 1QNRA 1YBQB 2FMOA 3BQ5A 3S4TA 5CPSA 4AXNA 5M1TA 2PD9A 2CITA 4ICMA 2CKRA 7A3HA 1OADA 3A23A 2A3EA 3O07A 4R7WA 1FRBA 5FF3A 4H7VA 5JBEA 3VC6A 3VNZA 4PMRA 4GWEA 1AFSA 3WQOA 2E68A 1T7LA 1NDYA 1B3VA 1UROA 1MEHA 5FIPA 4Q8TA 3L23A 5KETA 3S9IA 3O2LA 1CW2A 3KHJA 5AC7A 1UPMB 2VEKA 2HEJA 4EE9A 2J66A 4Y9AA 1HP5A 3PFRA 3NL3A 2WHKA 4ZO8A 5D8WA 1A0CA 2XN1A 1HGWA 3APYA 2DUZA 3RGTA 1TRIA 1WZLA 1B3ZA 1OYAA 3QW3A 1TWZA 1Q6DA 2DORA 4JNMA 1PCWA 2CZ5A 2GQ9A 3LPPA 1M9HA 4HNCA 1SJCA 3HG5A 1ZAJA 3NSMA 4JQ2A 5JQ9A 1OCBA 3ABQA 1W1IE 1LYXA 3F4VA 5CPQA 4MOZA 2BGNE 2CWXA 4X9SA 1N7KA 3D46A 1AD4A 3A4AA 4Q33A 3M5XA 1YADA 2WJFA 3MMUA 1G4PA 2PDGA 3OBAA 4GGBA 2PTXA 3IS4A 1I60A 1WAWA 3QY8A 1TTPA 1XS2A 1A5NC 1WKEA 1EF3A 3ECQA 2O7QA 3HQPA 4S2CA 3GYCA 3G1RA 4X63A 3W7OA 3PZNA 1O60A 4XSMA 3HGJA 2ZRWA 4FO4A 4ZOAA 1NQKA 3WK1A 5GQBA 4KPLA 1IT7A 3N3TA 3T07A 1E3ZA 3AWOA 5LXEA 5A2CA 1RA5A 4HCDA 4W5ZA 1TR9A 3E96A 4NSBA 3H23A 4P8UA 1WDSA 1K02A 4MM1A 3TN6A 3W7JA 4CVUA 4LVGA 1I2OA 4AZCA 3CB3A 2HTMA 3GNDA 1MQQA 2O9OA 4CQAA 2YLLA 4D71A 5HMDA 3CH0A 2J7FA 1AVAA 1AQFA 1P0DA 3H8AA 1CB7B 4WDTA 2ZA1A 3RFAA 1UD6A 4GZIA 2WMJA 5HINA 3PY2A 3M0HA 4MB5A 4XUYA 5ECUA 3TFXA 4JBRA 3M6YA 3WK2A 4LV4A 4LS0A 5IHSA 5I02A 4X2PA 1OFRA 4KS0A 2PDIA 4FNRA 4GRSA 3DN5A 3LGDA 3UWYA 1MRAA 4CNNA 1JYWA 1UPPA 4HN4A 2GOKA 3CQ0A 4HZMA 5E0FA 4O1CA 2Z1SA 5I3IA 3LCWA 5C55A 2ALDA 5IDZA 3OOQA 3W1XA 3KDOA 3KAOA 3F5LA 3L2LA 2CXGA 3DGBA 3WLPA 3ZJ7A 4PMZA 1SR0A 2DT2A 3OVQA 3EX6A 1WKDA 3M43A 2V38A 4IUGA 4PCSA 4Q8WA 4I3GA 4LUSA 5F2MA 1V03A 3AIRA 2Y8KA 3LGGA 1YLVA 4C6DA 2OZ3A 3H4WA 4FIQA 1Q85A 1VPYA 4XKYB 3EA1A 4IQEA 3LCLA 3W83A 1LL4A 4KT2A 4NF7A 3VXGA 4DUOA 2DZPA 4YYCA 5HNRA 1QOQA 4EVZA 4JTJA 1CECA 4FZIA 4IIDA 5FJPA 3GTFA 2WMKA 2XIOA 3OU8A 3IUIA 1CYGA 4JL1A 1X39A 4DWSD 3BLOA 3KL0A 4MGGA 1TZ7A 1F6KA 3ISIX 4FNUA 2PGFA 3UJSA 4D6IA 1EYEA 2FH8A 3CIVA 4JDBA 3NGFA 4MWAB 1SW3A 4Q8QA 2EQDA 3P5ZA 3DCPA 5D9NA 4PL1A 5M5DA 1CLVA 4HCLA 3VX0A 4BF7A 3GU9A 4P5UA 1TPB1 1UH4A 3PG8A 3Q45A 2OO0A 3B8VA 3K8LA 2PDXA 3LERA 4JKMA 3O05A 3DFQA 3MV01 3SN0A 1V6TA 1W5NA 1Q6QA 5ABFA 4DELA 3ARXA 3MYOA 1VLIA 3T2OA 2DIKA 3TAOA 1DTUA 1KM6A 3BZGA 1DE6A 3EZ4A 1ADOA 4MWAE 1UW9A 1FCQA 5LIKX 2YDRA 2EKGA 5LNWA 2OEMA 4ICNA 4JTLA 4XKMA 3R10A 1E0TA 5MKGA 3ARTA 3MY9A 2C71A 3C2VA 1H49A 4QLJA 5AHMA 3M0LA 3VGDA 1OIMA 1QOPA 2WNZA 1WXZA 3OB8A 4DBUA 1JPHA 2R9RA 3S5OA 3B8TA 3KTSA 3NSXA 4PL2A 3Q4DA 3G0XA 4KCVA 4PUNA 3U2OA 2FZMA 3JS3A 4HA0A 3C0QA 4NI8A 2XM2A 2PTDA 1XR2A 4GISA 5AVHA 1PDYA 4EWJA 1KBIA 4ATDA 4QSFA 1VBJA 1WV2A 2BY0A 2O55A 2QGYA 2XTKA 1OCJA 4WSHA 1HJSA 3IK2A 1XUZA 4Z0JA 2E40A 2YX0A 2YZRA 1R9XA 3FFSA 3AIBA 3QQWA 1MW0A 1JDFA 2CZEA 1PTGA 2V5JA 2DQWA 3C2YA 4NKCA 2FYMA 3GNPA 2J27A 3UP8A 3NPWA 3EB4A 1GYNA 2ZZ2A 3RLVA 2D0FA 3CO8A 4X2RA 1BKSA 4NRRA 3WH7A 1KTNA 2F2KA 3WUEA 5G1MA 4IZGA 2OEKA 4L56A 4WK9A 4Q6XA 4GC3A 2ABAA 2PFHA 3IIPA 4DJFC 1VCFA 4DUXA 5FI8A 5CC7A 2PWUA 1P6CA 4PEEA 2G4JA 2PWHA 1NDVA 2AQWA 4FNPA 4E6MA 4L64A 5M2FX 1WOBA 1OGSA 2VZOA 3V5OA 3IRSA 1AW1A 1GVRA 3AMDA 4TVDA 4JIRA 2IKGA 2XPKA 8RUCA 2OG9A 2WNNA 3VIHA 3TP4A 1JCLA 2XH2A 3OZPA 4POCA 4DZIA 2G4FA 3E02A 3NPVA 1KTCA 4W84A 4RJEA 1G0CA 1TJPA 2FJKA 3REQA 3RITA 3CUFA 2V3DA 2YLAA 5G2HA 1UOZA 3TLLA 4PULA 4S39A 2JKPA 2NLYA 1CGWA 1ONEA 2Z1XA 4YU1A 3ITGA 4YIWA 3SGGA 3SB0A 4DUVA 3NYDA 4H6EA 1E40A 4Q4MA 1DYSA 5RUBA 3T40A 1DJWA 5DBUA 3ZO9A 3QYQA 4DAIA 4GUHA 4R33A 4ZSTA 4HNOA 3E38A 1H09A 1BSLA 4Q8VA 1IEXA 3SADA 1ISWA 4JZ5A 5BU9A 3W38A 3LV5A 1I2NA 2NZLA 4IJRA 3B0XA 3NO3A 2X1TA 5CG7A 1G1YA 2CZVA 2OT1A 1VBHA 2W3ZA 1XQKA 5D4YA 3A3WA 3C52A 1SFSA 3PG9A 2D0HA 3ARPA 1BXBA 3CWHA 1V77A 3LGEA 5L9FA 1FTXA 4GYFA 3U4AA 1X7IA 4PTWA 2I16A 1JNDA 3FYPA 3AS1A 1XIMA 4AVOA 4IJBA 3RM8A 3L0KA 1Q4NX 1WP6A 2EPNA 4W8LA 3PB2A 2OPJA 2XIIA 2WJEA 1PWMA 2R1MA 3PZ9A 4CEUC 4Z2HA 3GH5A 3U2EA 2Y4SA 1NOUA 4WOQA 1IXOA 2YCLB 1YQ2A 2BFGA 3GY1A 3BSMA 2PTYA 2FZDA 4ICCX 2DGAA 4FMVA 3HQOA 3S5YA 1BYDA 1VJIA 9RUBA 1F7BA 4GVFA 2ZKMX 4RNHA 1P0KA 4FLSA 1EZWA 3TQVA 1JRCA 3WD0A 4U2ZA 2I5IA 2G3FA 5A6AA 2P0OA 1O95A 4LC8A 3NNTA 4YTRA 1P1XA 4ML4A 2AKZA 3K30A 4AIEA 4ZZ9A 1YNPA 3KDNA 3PB0A 4QCEA 1WZKA 2J8TA 3C2EA 2A85A 2J7BA 4ENLA 3W1PA 1XISA 3THUA 4U5KA 2R14A 1EO5A 1GOWA 2CLEA 2FHBA 4ZSUA 4QDWA 4RE3A 2PLKA 4PTXA 5BOOA 4BEUA 3ARRA 3LCFA 1XYBA 3E0VA 1O94A 1DP0A 4V28A 2GSJA 1UH3A 1DIEA 3I7SA 4KMQA 2OX1A 1H41A 4F3HA 5CPNA 3O6CA 3M6DA 1WDWA 7ENLA 3YPIA 2FJUB 1A80A 2WZIA 2O9RA 3HFTA 1GHRA 2HVMA 3DHFA 4K36A 2NT0A 1BVWA 1FKWA 2ZRYA 2P1FA 1O7AA 3H2NA 5REQA 2GWNA 2ABBA 3E0LA 4GC4A 1IXNA 3NPUA 2J7GA 3B4YA 4H83A 4JS3A 4HU3A 4LYRA 5HDRA 1F4AA 2Q02A 3AJ7A 2QDHA 3ITOA 3ZXWA 4PH6A 2XHYA 4AIUA 1NEYA 3EMCA 1QO2A 4J3WA 4UMAA 3FA5A 4UQDA 2HE8A 4UTKA 3UJ2A 2QV4A 1QI2A 4CNOA 4M1BA 3AHYA 1IR1A 3HMCA 3UXAA 5JBDA 5EFDA 3WLRA 5FEXA 1JFHA 2Q71A 1UD3A 4AEEA 3W24A 1C7SA 4Z17A 1BGAA 1V0LA 2X09A 3WEMA 4PMDA 1JPIA 2DT1A 3VM5A 2CZFA 2DZSA 3T09A 2WBGA 3DFYA 2PDCA 4GNVA 4L6HA 4JTIA 1SFTA 4UTWC 1XHGA 3GAKA 1VB9A 3N73A 5JVLA 3WENA 1NDWA 2DV0A 2G3NA 3EPMA 1A5MC 3R58A 1QPOA 5CKSA 1JZ8A 2VX4A 3L9CA