1UR4A

The structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
386
structure length
386
Chain Sequence
GLYVEKVSGLRKDFIKGVDVSSIIALEESGVAFYNESGKKQDIFKTLKEAGVNYVRVRIWNDPYDANGNGYGGGNNDLEKAIQIGKRATANGMKLLADFHYSDFWADPAKQKAPKAWANLNFEDKKTALYQYTKQSLKAMKAAGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETDSNILVALHFTNPETSGRYAWIAETLHRHHVDYDVFASSYYPFWHGTLKNLTSVLTSVADTYGKKVMVAETSYTYTAEDGDGHGNTAPKNGQTLNNPVTVQGQANAVRDVIQAVSDVGEAGIGVFYWEPAWIPVGPAHRLEKNKALWETYGSGWATSYAAEYDPEDAGKWFGGSAVDNQALFDFKGRPLPSLHVFQYVDTGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GALACTANASE
publication title The Structure of Endo-Beta-1,4-Galactanase from Bacillus Licheniformis in Complex with Two Oligosaccharide Products
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 145
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ur4A00
2DPEA 2FHBA 1J18A 4TOQA 3AIRA 2PWGA 3K4AA 2Q8XA 1EA9C 3EDFA 1J01A 2W62A 4W87A 3ZOAA 2FHCA 3VUPA 3VIGA 2CKRA 3CH9A 5BXRA 4AW7A 2FGZA 3NJ3A 1NWTA 2CITA 3ARWA 2OSYA 4J3VA 1IZJA 1MW1A 4ZE5A 2CBJA 1QW9A 1JZ8A 4H2CA 2BHYA 8A3HA 5I78A 2A3AA 4BQ4A 1KR1A 5A2CA 2WKGA 3BAKA 4ZEPA 5I24A 3WD1A 3B9EA 3BLKA 1K9DA 3A47A 3ARRA 4KMQA 2JALA 4PTMA 3KZSA 3WUGA 1PIFA 3QHOA 3W28A 4PTWA 3VX0A 1H11A 2J74A 4WLCA 2WC4A 1NOFA 4F9DA 3ARZA 4FLOA 3U7BA 1XC6A 2O9TA 4AISA 3BSHA 1B0IA 2CIPA 4WKHA 3WD4A 1MQQA 1TG7A 1W3KA 2X0HA 5BWFA 1UA3A 1CYGA 2EJ1A 4CKQA 1W1PA 3B9AA 2VR5A 1EDTA 4TUFA 3VD4A 1AQ0A 3J7HA 3U57A 3MS8A 3SCSA 3RIKA 3ZM8A 4AZ6A 1MYRA 1DTUA 1GVYA 1PIGA 4U3CA 1H49A 1QNQA 1W1VA 2DSZA 1UKQA 2DT1A 4P7LA 3WFLA 2GUYA 2ZXAA 1UH4A 2D1ZA 3FN9A 3MUY1 2WC3A 1JI2A 3WMCA 1KCLA 2DIJA 3FNDA 1UR1A 1E15A 3CZJA 5D9OA 1E1EA 3KE0A 3ARXA 4H8VA 2J8GA 2WHJA 3OBAA 4D6EA 4PUEA 5D9PA 4LGXA 1DHKA 1FFRA 1E6ZA 4DWSA 4UFKA 1G1YA 3PHAA 4PSRA 3SUSA 2ZUWA 4UCFA 1VFUA 4Z2IA 1ESWA 1QPKA 3PZQA 5M3WA 2ZX6A 3S6TA 3K46A 1V0KA 2VX6A 1NWSA 4QP0A 3CO4A 1TA3A 1ITXA 5M5DA 4Z2HA 4W84A 2DT0A 2OWWA 3CUJA 2J25A 3WH6A 2CHOA 5A8NA 3BGAA 3QHMA 2UY3A 3IAPA 4UFHA 1E6NA 1H4PA 5A95A 4QDMA 1L0PA 3TTQA 1JGIA 2Y2WA 1TCMA 2EPMX 4AZ7A 4PMQA 1ISWA 5FCZA 4HMEA 2XSAA 2WSPA 5FD0A 5A8OA 2BV9A 4HMDA 1E4LA 2ZUTA 3T0AA 3WEZA 4B3KA 3AROA 4WSKA 2BVDA 3CMGA 4N0RA 4Y7EA 2XWDA 1KB3A 4ML4A 4GXPA 4HOZA 4ZE4A 1UKOA 2DSWA 3PTMA 4XUYA 4TVDA 3K8MA 1QI0A 1M04A 1KFWA 2Z1KA 5HBFA 3GH4A 4JCMA 4CU7A 1TR1A 2V3FA 2WWCA 3BMVA 1JDCA 3EYPA 1AQMA 3AHTA 1CLXA 2AOSA 3AZRA 2Y8VA 3BAWA 2CERA 1LLOA 3ZT5A 1R85A 4Z2JA 4OZOA 3WMSA 4HU8A 1OD8A 2J7GA 3VPLA 1JFHA 4PYSA 2X2YA 4M56A 4X9YA 3DYMA 4AZIA 1U30A 4PUDA 2NT0A 4GINA 3CLWA 2DQXA 3ZT7A 2F8QA 4AYSA 1I1XA 3BAXA 1R7AA 3WNPA 2IXUA 2VR4A 4P7NA 3ZR5A 1MW3A 3CHEA 2J7CA 4LYQA 3DYOA 2FGLA 3MSDA 2UY2A 5DEZA 1TVNA 2WVTA 1FHLA 4W7UA 5D8WA 2D3NA 2XGBA 1GJWA 4FLSA 3K1DA 4J3UA 4PCTA 3EDDA 5HPCA 1FOBA 3VILA 5CGTA 3VD3A 1G9HA 4JFTA 4JHOA 4F79A 3UR8A 5ABFA 4W8BA 3GDBA 2DSKA 2W91A 2XYLA 1UKSA 2WW5A 4NF7A 4U31A 2YA2A 3OLIA 5A6JA 3AI0A 4JL1A 1C91A 1DWJM 4U33A 1E6PA 2WSKA 5EB8A 2G3MA 1E5JA 5HXMA 3RO8A 1K9TA 1H5VA 1NP0A 5C8BB 2DIEA 1GW1A 4N42A 3VDHA 1HJUA 1MFUA 1J10A 4WKAA 5ABEA 3MUAA 3WD2A 2V5DA 1OIMA 1BF2A 1X1NA 3ZMRA 4M29A 2XFYA 1QI2A 3MMDA 1UR8A 4PBGA 4PMZA 1M53A 3LMYA 3VMOA 4IUGA 1FH7A 2WCSA 3UR7A 2JEPA 4WK9A 4AMCA 4D6CA 4BA0A 4TTUA 1V0NA 3UG3A 2E3ZA 1A3HA 3L4UA 3WSUA 3WQ8A 5A6BD 1TFVA 2CHNA 2DEPA 3SIMA 3GXDA 1B30A 3PZUA 1OB0A 2D20A 3VGFA 1KQYA 5CG0A 1GPFA 2BY1A 3AMKA 5CZKA 3BSGA 5DMYA 4B9ZA 3WNOA 4A3YA 4BZYA 2IXVA 3GXFA 3THCA 1AVAA 3MMUA 3PZIA 4UQCA 4LYPA 2OSWA 1V6UA 1ZS2A 4UZUA 3HN3A 4J27A 1AMYA 1QBAA 1GOWA 1PZ3A 4RL3A 2F61A 1CXKA 3KL5A 4WIWA 2EBNA 5A3HA 3ALFA 2OLHA 5KEZA 3PZVA 3LPOA 2O9PA 1JDDA 1E5NA 2BHZA 3SUVA 4MNMA 2PF0A 3LPPA 2YL6A 2DT2A 4UFIA 1B3YA 1HJWA 1HP5A 3E1F1 3FXYA 2YLLA 1NOUA 4AD4A 1FFQA 3VIJA 5E0CA 4EKJA 2W5FA 4WJXA 3MANA 5GPRA 3NSMA 4HMCA 5CJ5A 4KGJA 1ZJAA 2YIHA 4QCEA 1J0HA 1SMAA 5EBAA 5LA0A 3CIVA 4MDOA 5HOSA 3QOKA 3RJXA 2C0HA 2XVNA 1QNOA 1KWKA 1SR0A 3FAWA 3ARUA 3IJ7A 3SCQA 2YDRA 1RPKA 3A4AA 4P8UA 4E2OA 3CBWA 2VT0A 3W24A 2ZX5A 4UOQA 2XFFA 1GOQA 2D2OA 2WXDM 2BVYA 3N04A 6CGTA 3VTRA 4XZBA 1UH3A 1OT1A 1VJSA 4EE9A 1JI1A 2ZICA 2W61A 2ZUUA 3OG2A 1U33A 2D0FA 4GZIA 3EBVA 2WHKA 4ACZB 5JIPA 1VJZA 3CUHA 2YDQA 1C3FA 2XVKA 1HF6A 3AIWA 3HJEA 2GFTA 1W3LA 4FF5A 2WHMA 2WANA 7A3HA 4P8VA 1D3CA 3ZQ9A 2RGLA 3WNMA 1SFSA 2A3HA 1JG9A 4GI8A 3L4XA 1Q6DA 3VIIA 1VB9A 1BFNA 1E3XA 5JBFA 2GDVA 1CXLA 2GJXB 2Y8KA 1N82A 1B3XA 1OD0A 3VM5A 2YDSA 1JZ2A 1B90A 4KRTA 3DHUA 4LYRA 1NWRA 4TX8A 3OIHA 4AIOA 4M81A 4PMVA 4UTFA 1R87A 2XVPA 5IDIA 4DUWA 1OT2A 4AC1X 2WM0A 3UCQA 1UOKA 5CGMA 1OIFA 1OSEA 3N15A 2Y5EA 1MWOA 1E43A 1XRVA 2XFRA 3TONA 1YQ2A 1SMDA 3SCTA 2CNCA 3MSGA 1Q6CA 3FHQA 1BYAA 1JZ7A 4TVUA 3WQVA 3W6MA 1KGXA 2VZVA 2VZUA 3MKKA 1OGBA 4UNIA 1VEMA 1UA7A 3F5JA 3W4RA 4B15A 2MANA 4TVCA 2FH8A 1E56A 3B8SA 1C7TA 3N1AA 2ZXDA 1J9YA 2JE8A 3GNOA 3SUWA 2E9BA 5A6BA 4OBRA 3SUUA 1W9DM 4M80A 4PMDA 2FH6A 1GOMA 1B2YA 4Z2KA 4HZ8A 1LWJA 3GXIA 3FAXA 2VJXA 4W93A 1HXJA 4PTVA 3NSNA 1XH1A 4HP5A 1JYVA 2VX7A 4QLJA 2WVVB 3L4ZA 1EOMA 3GNRA 1OWQA 3GXMA 5A6AA 5KZ6A 2UY4A 2VUYA 1VENA 3VGDA 5LYRA 1RD6A 2WMKA 3W82A 2CKSA 1TMQA 1QW8A 3QOMA 2J7FA 7TAAA 1WAWA 2E9LA 3AXHA 3AICA 4U5IA 4RE4A 1HN1A 3A4WA 2AMGA 3ZIZA 4J3XA 3NYDA 4P7QA 1UD6A 1US2A 2VCCA 5A8QA 2WB5A 2UWFA 1FH9A 4J3TA 5ABGA 5IXEA 2HISA 4HU0A 1QHOA 5M03A 2OWCA 1PPIA 3OZPA 1JZ3A 2YJQA 5JBEA 1V6VA 2G3IA 4YN5A 2BXYA 2WVSA 1XSIA 1QNRA 2VVNA 1DWAM 3QR3A 3VMNA 1QI4A 1VEOA 2ZOXA 5E09A 2ZE0A 1WDPA 4NZCA 5CPSA 5BRQA 2E0PA 3WNLA 3KL0A 4KRUA 2BHUA 1GHRA 5A6KA 3THDA 4HPGA 1W9PA 1MFVA 1E0WA 1QHZA 1E0VA 2WKLA 3VM7A 3O6AA 2WBKA 3AS3A 2VMFA 4TX6A 4GZJA 5D9NA 1E72M 1JD7A 4W5ZA 3WNNA 1H1NA 1WE5A 5GNYA 3TP4A 3GBEA 3AYSA 1J12A 4L4PA 4U2YA 3PZTA 3WIJA 5D9MA 4F9JA 1BYDA 2CXGA 4PMNA 1JF5A 2V5CA 3MMWA 4BS0A 2GJRA 4MJ4A 4CU6A 3N17A 1LG2A 2XGIA 2WMIA 1G94A 2V3GA 5A6SA 3RILA 4MPKA 1KXTA 2PWEA 1TE1A 1UR2A 3RM4A 2CYGA 2D23A 3PBGA 5CLTA 1D2KA 1IV8A 2J47A 1EHAA 3K8KA 3VGBA 3WF2A 1JZ6A 4R27A 3U5YA 1WZKA 2CETA 2WAGA 2XIBA 3DHPA 1F4HA 1IT0A 2PBOA 4E4PA 8CGTA 2YLAA 1FH8A 1DWHM 3L2MA 2J4GA 4MNJA 1QNSA 3CHFA 1H0GA 1UKPA 4CD7A 4UZSA 3AHZA 4MADA 4AIEA 1E40A 1UWSA 4DWSB 3WL1A 2F2HA 1TVPA 1VIWA 1UR0A 2WZEA 3POCA 1CENA 4GZEA 2JF7A 4AZGA 3AXXA 4P8WA 3SCNA 1XH2A 1TA3B 1WPCA 4B9YA 5FL1A 3WKZA 3W38A 3AHYA 1NP2A 1EO7A 5D4YA 3VO0A 1XCWA 4IPNB 1KXVA 2J7DA 1GCYA 4PMYA 3WQ4A 3RCNA 3WDHA 3M07A 1NH6A 3VOCA 1V6WA 1HL8A 2ZUSA 1QVBA 2QV4A 2VQTA 2OYMA 1NQ6A 4CCEA 6TAAA 4U2ZA 4MB5A 4JZ5A 5FIPA 4UQBA 5A69A 3WF1A 1V3JA 1BSIA 4MB4A 1GVIA 2RGMA 2QPSA 1GOKA 4AZHA 1V3MA 2WMJA 1BTCA 5AYIA 2ZIDA 3WF4A 1ZBKA 1W3HA 3CGTA 1ISVA 3SCRA 1JNEA 3RM9A 1EIBA 2EPNA 2WBGA 3RDKA 2JIEA 4FMVA 3BAYA 4W85A 1W1TA 2YL5A 4UFMA 4UQDA 1O7AA 1CWYA 3W53A 3CZGA 1UZ4A 1XHGA 3FW6A 2OWXA 4HPHA 4MAVA 5IFPA 2XTKA 3RPMA 3HU7A 3AMLA 1GQIA 2GVYA 1CLVA 2OSXA 3AMDA 1WZLA 3GNPA 1HNYA 2G4FA 2CESA 1ZB5A 1JL8A 2E8ZA 1CDGA 4OJYA 4H04A 4M24A 2QHAA 1ISXA 3AQUA 1B1YA 4U3AA 1ZJBA 3T2PA 4CVUA 1KR0A 4MTVA 3A3HA 1K9EA 2X8RA 4AEFA 2EPLX 1PAMA 4GI9A 1VF8A 1PX4A 2EPOA 2D3LA 2ZWYA 3ARYA 4JFWA 1OGGA 3ARSA 3GM8A 3WD0A 4AIUA 3L4WA 4PTXA 3AIBA 3VD9A 1LWHA 4ZENA 2DSUA 4M82A 2W63A 4DWSC 5ABFB 1UH2A 2W66A 2QLYA 2YA0A 2GJPA 3WL0A 2VQUA 5E0FA 4MNLA 3VIPA 1BGGA 4URIA 3WQ5A 4W5UA 4UFJA 4X0VA 2D0HA 4W7VA 1J0JA 3APGA 4H41A 1HJSA 5E9AA 3NUKA 1CGTA 3A6OA 4UFLA 4EK7A 3NDZA 1PX8A 4JHZA 1V0LA 5M17A 3WH5A 4D6HA 1F4AA 4AD2A 1XSJA 3UERA 4M1RA 2UY5A 5BXSA 2EEXA 3ZT6A 2ESCA 3WDJA 3VDCA 5ABHA 3W26A 2YKKA 4CVWA 3PZGA 1W2PA 1E4NA 3GZAA 3F5KA 3JUGA 4UOZA 1S46A 5E6YA 2XG9A 1LL4A 4OBSA 1Q6FA 1P6WA 4JAWA 1L8NA 4NI3A 2NT1A 3T2QA 1NARA 1UD2A 4AD3A 4CD8A 4XZWA 5DFAA 2CPUA 3SCOA 1B9ZA 2BNJA 2PBGA 1E70M 4PMXA 2E40A 3ARQA 3WDRA 3ZR6A 2NSXA 3B9DA 1WNOA 4YHGA 1J0ZA 2WHLA 3RMEA 4W8AA 2HVMA 3K4DA 1KGWA 1C8YA 3D5HA 3WEMA 4BQ2A 1B3VA 3BXWA 1GQKA 1EHNA 1E71M 4D71A 3OLEA 3L4VA 1HJXA 1XSKA 3IANA 3OLDA 5GNXA 1DWFM 3QHNA 2FDMA 5CSYA 1R7OA 1GQJA 1QI3A 1H3GA 1LL6A 3G6LA 3QGVA 1ODUA 3UETA 4AY1A 3WFZA 1UD5A 1CXEA 3WQ6A 2VCAA 1XYFA 2EO7A 1EQCA 3WBAA 2VVSA 2WMFA 3DC0A 4W8LA 1MW2A 3I3EA 4YPJA 3VINA 1W3JA 1EGZA 3ZJ8A 4AZCA 1MXGA 3WH9A 1UR4A 1YHTA 1JXJA 3ZJKA 1JNDA 1HKJA 4BQ5A 4F66A 5DO8A 4PMOA 2VOTA 1CECA 5LA1A 3BC9A 2O9OA 1UD4A 1E6RA 1W1YA 2EPKX 2XWEA 1PEZA 3I3DA 1GOIA 1UUQA 6A3HA 3GH5A 4PMRA 1ZU8A 2TAAA 3CZEA 3W0KA 3TTOA 3WF3A 3AS1A 4UR9A 4HA3A 4QLKA 4W7WA 1CIUA 3BLPX 4JFSA 4LXFA 3W27A 1G0CA 4BQ3A 4GKLA 3SCWA 4RE3A 1UWUA 2WWDA 5AC5A 3W37A 1I1WA 5EFDA 1MQPA 3VGGA 3ZJ6A 5BRPA 1JZ4A 1G01A 1VBRA 2J7HA 5HNNA 2XJ7A 1CXIA 3WDIA 3PN8A 1GOOA 2VO5A 4FLQA 1H09A 2WMHA 2XVGA 4H7VA 2XVLA 2WVUA 3W81A 1V02E 1V6XA 2J62A 4RE2A 5BYWA 4PEEA 4JKMA 3S2CA 1K6AA 4HA4A 4C7FA 4WSJA 2ZXBA 5A6LA 2VURA 4HZ7A 1GUVA 2CBUA 1JYWA 4DWSD 2YA1A 3WNKA 3VVGA 1UWIA 5D8ZA 2CBVA 2VCBA 2CEQA 4YHEA 2VTFA 4D1IA 1BGAA 1SYTA 3M46A 1MVYA 1BG9A 3ARTA 4AZ5A 1DWGM 1WO2A 4EANA 1LJYA 5BXTA 3WD3A 1HKKA 2XIIA 1V3IA 2EXOA 5FOOA 1BLIA 3ALGA 3SEPA 2EQDA 1CBGA 1CXHA 3AOFA 5I2UA 1C93A 4UOJA 3WUFA 3VX1A 3MO4A 1HJVA 2VX4A 3EMQA 1V6YA 2ZX7A 4OUEA 2XHYA 3BMWA 2WK2A 1KCKA 3WUEA 3W29A 1OGSA 1TUXA 4C7GA 4ZXLA 3EDEA 3AHXA 3WELA 3VIFA 3AFBA 4W88A 2C8NA 3PTKA 5DT5A 1BVNP 2PB1A 2O92A 1UZ1A 2E9MA 4UQ9A 5I77A 5TD4A 5JBDA 3D3AA 1X6LA 1R86A 5DF0A 4W86A 5E6ZA 1GONA 2A3CA 1LF1A 3I3BA 3IK2A 2J77A 4XV0A 2GDUA 1HJQA 3VIHA 3HMCA 3FHAA 4GQRA 3VU2A 1XD0A 3U5UA 1EO5A 3AMGA 1KXHA 3RJYA 3W25A 3UG4A 2VRJA 5DT7A 1C8XA 4HOWA 4GO9A 2BY2A 5I5RA 1V03A 2DDXA 3UEQA 3WDPP 1HL9A 3CHCA 2CBIA 1EH9A 1R8LA 5E70A 5C71A 2DSVA 1RP9A 1KGUA 4MDPA 3ZSTA 4PN2A 1V02A 3NSXA 3DECA 3VIMA 3POHA 2DH2A 3NIYA 2VZTA 5I23A 5LA2A 1J0KA 4ZFMA 5A1AA 1LQ0A 3BH4A 3OA5A 4U5KA 5I0DA 1VEPA 4XX6A 4S3JA 1UYQA 5HDRA 4DM1A 4PCSA 4WKFA 3MU7A 2OYLA 1WP6A 2XSBA 2QMKA 2WNWA 4W89A 4TTGA 2Y24A 1JDAA 1GHSA 4X0NA 1PZ2A 2GK1A 5I3DA 1JF6A 2V3EA 3OGVA 4AD0A 1UD3A 4H8UA 1BYCA 1BVZA 4CU8A 2AAAA 4OIFA 4EAMA 1BPLB 2BS9A 2ZX8A 3UESA 2IUZA 4IPLA 2GK1B 5BROA 3BCDA 4A4AA 4V27A 1E6XM 5EMYA 3VGEA 3ZSSA 1M7XA 2V3DA 2VNCA 4M8UA 4K68A 1WB0A 3WEOA 3DYPA 1UQYA 3ARPA 4MAZA 1WKYA 4D6JA 5F7UA 1C92A 1E4MM 4Q22A 1FHDA 2YL9A 4ACYA 3KEHA 1HP4A 3SCPA 4GO8A 1B3WA 2X1IA 3EMZA 2WMIB 3A4XA 7CGTA 3ZO9A 3PZNA 3VGHA 1OINA 5BXPA 1EDGA 2QPUA 1MXDA 3NDYA 1H0IA 3VD7A 1XCXA 2JFEX 3CUFA 3CPUA 4L4OA 1OCQA 1HT6A 1ZBCA 1BHGA 1UKTA 3O2LA 3AJ7A 2J7BA 1UD8A 1DP0A 3SCUA 3VIOA 4PMUA 1XD1A 2VX5A 4UQAA 3AIUA 4JFVA 1CNVA 4V2XA 3L2LA 2A3BA 2YBUA 2ZX9A 5GQBA 2E8YA 2Y4SA 2WYSA 2W92A 1HVQA 1ITCA 1RH9A 3BAIA 1Q4NX 3GTNA 2BY3A 1I75A 2VRQA 4QAWA 4P8XA 1M03A 2PI6A 4MB3A 1WZMA 2X0YA 5CXPA 2DGAA 5JUVA 4CD5A 3WMBA 1CZ1A 4D6FA 5EFFA 1EDQA 4MB1A 1W9XA 3AZSA 2WC7A 1DWIM 3WQWA 1CGYA 5AC4A 2WCAA 4R5EA 4D1JA 3WN6A 2J79A 1CGXA 1E6SM 1FA2A 4LPCA 4BF7A 4D6IA 1FP8A 3L4TA 1C7SA 3PZMA 1W32A 3MUIA 3VNYA 3OGSA 3OZOA 4P7OA 2YBTA 4GQQA 4AD1A 3F5LA 4HA1A 5A8PA 5A6MA 3WDQA 1UWRA 4E8CA 3GBDA 1Q6EA 3IAQA 2OYKA 1PJ9A 3AZTA 1OBAA 4TXEA 3CUIA 2VZSA 1CXFA 4CD6A 3T2OA 4HZ6A 1UQZA 3ARVA 2ZXQA 1E73M 2D24A 3CHDA 4OKDA 3UG5A 1XYZA 5ECUA 1UG6A 2J75A 2VL4A 1DEDA 2X05A 3PZ9A 2DT3A 1HKIA 1PX3A 4WF7A 1PBGA 1W9BM 2O9RA 3PTQA 4OOUA 1ISZA 2FHFA 2XUCA 3L4YA 1CEOA 1CPUA 1JZ5A 4D6DA 3AISA 4GPNA 1W2VA 3NCOA 4AWEA 4CCDA 1ODZA 1Z32X 4KH2A 5FKYA 4ATDA 2PC8A 4DM2A 3EMCA 4PSPA 2J78A 4A3HA 2ZUVA 4QLLA 4ATLA 5CSUA 3G6MA 4JL2A 3TTSA 2WCGA 3WENA 3SCVA 9CGTA 1CGWA 1WDSA 2V38A 1W9VA 1XGZA 3VKKA 2JF6A 4J3WA 1KQZA 4J3SA 4DUXA 4AXNA 3N18A 1LG1A 4PRWA 3AHVA 3T09A 4MJ2A 2VZOA 1E9LA 5IHRA 2BVTA 1A47A 2PWHA 1B3ZA 1KWGA 1AQHA 5IHSA 1V08A 1E55A 4IISA 2VC9A 4CN1A 1H41A 1MW0A 2JIWA 3KWXA 3VDAA 3CTTA 1VAHA 1E4IA 1V3KA 3AMCA 4UQEA 1QOXA 2WLZA 3FY1A 1KBBA 3GYCA 1JYNA 2J7EA 5I6SA 2BXZA 3AIEA 1W91A 2QF8A 2WZHA 2ZUMA 4AD5A 3MUZ1 1CGUA 3F4VA 4CCCA 4CGTA 1JYXA 1FP9A 4CN4A 3BCFA 3WUBA 3OGRA 3CMJA 1UR9A 3EDKA 1BYBA 1XV8A 4P7RA 5A94A 4HOXA 1JAEA 1RP8A 4D6GA 3SURA 2E4TA 3W6LA 1ZBVA 4V28A 3LPFA 2XPKA 1V3LA 2WZIA 3N9KA 4E8DA 1H2JA 2GSJA 1KXQA 3TA9A 1TZ7A 4NSBA 1VFOA 1NWUA 1M01A 1BAGA 1ISYA 4HTYA 3VIKA 1C8QA 5HPOA 3LPGA 4JKLA 2D0GA 3BAJA 5IFTA 3CZ8A 1WDQA 1JIBA 4DUVA 3MV01 4NRRA 1QI5A 2J8FA 3II1A 3ECQA 1GORA 5C70A 1ECEA 1ZL1A 2X09A 2VRKA 3M6DA 4B3LA 4JFUA 1HIZA 3RM8A 1LL7A 1VRXA 2A3EA 3IJ8A 4AEEA 3AIQA 3N13A 4NRSA 1MQRA 2PWDA 4KWUA 2BY0A 4BCEA 1WDRA 5CQ1A 2W4XA 3AS2A 4ACZA 4OOZA 3WH8A 5A2BA 5JIWA 1B31A 4CN6A 3VDBA 4LX4A 3VMPA 4AZCB 4ZXOA 5CPQA 4ATWA 3EDJA 4KGLA 1W9UA 2G3NA 4FK9A 1Y7VA 3T08A 3WBEA 1NM9A 1X6NA 3IJ9A 4J28A 1K9FA 1EXPA 1NOWA 4CD4A 3SUTA 3TOPA 3O9NA 1KBKA 1BG4A 3AXIA 1E3ZA 1UHVA 1BQCA 2G8ZA 1OM0A 1QBBA 1HKMA 1VFMA 3WF0A 4QCFA 4Q7NA 4AZBA 2GJXA 1JAKA 1U2YA 2Z1SA 3N11A 2NW0A 3TTYA 1GJUA 2ZUNA 1G5AA 4JKKA 3VD5A 4F8XA 1D7FA 2YL8A 3CZKA 1HX0A 3MV11 3ZJ7A 2XM1A 3KL3A 1J11A 3CUGA 4B16A 1WZAA 3WY1A 1UWQA 1V3HA 3K8LA 4D72A 3N12A 1V0MA 2B31A 3CZLA 1E6QM 2XM2A 1JFXA 2WLYA 2JEQA 1GZJA 4IM4A 2W67A 5I79A 3VNZA 3M7SA 3U7VA 1ZBWA 4Z2GA 5CLWA 3T0BA 1US3A 2YOCA 1GNXA 5A2AA 4CUCA 1GQLA 1CGVA 1UWTA 1VFFA 1WCGA 1QNPA 4GI6A 1QHPA 1CTNA 4C7DA 3AYRA 1JXKA 5FL0A 2WMGA 5AYBA 4S3KA 3T0DA 5CPTA 3OB8A 5AY7A 2WPGA 1Q6GA 4Z2LA 1VBUA 3OLGA 3WH7A 2D22A 2DH3A 4QFUA 1JD9A 4GIAA 1XH0A 1J0YA 3AS0A 2G3JA 1E0XA 1O6IA 2C7FA 4MNKA 2PWFA 2G41A 1HVXA 4JIEA 2ZWZA 5GNZA 4J7RA 2WVVA 3PZOA 4LQ1A 1EOKA 5A8MA 3GH7A 1E1FA 4FLRA 2BFGA 1C90A 2CCRA 5BCAA 1J0IA 3AIVA 2QMJA 4XB3A 4JCLA 4H8HA 1IZKA 1EQPA 2VI0A
chains in the Genus database with same CATH superfamily
3GG7A 4L56A 2RH9A 2PWGA 3E6EA 2QUMA 2R24A 1J01A 4UIOA 1FWTA 3GU1A 4PEKA 1IYXA 3DIPA 3TEVA 3VIGA 2P88A 5FJRA 2XIQA 7PTDA 4DZIA 2CITA 1Z7AA 4RUBA 4MY9A 4ZE5A 3FIGA 4H2CA 2BHYA 1S5VA 4AXKA 1B9BA 3S6OA 3BLOA 5CSRA 5REQB 1KR1A 3LXCA 5BOEA 3S3GA 3B9EA 2PLKA 3A47A 3L5MA 3LA4A 2JALA 4PTMA 1PIFA 1QPRA 3KDNA 3UJRA 3QTPA 1VPXA 3VX0A 1NOFA 1S5TA 1CCWB 4M6PA 2P10A 1JRCA 3SQLA 1KCXA 4Y9NA 2GOKA 1HKWA 1XLFA 3BTNA 1RXOB 1MQQA 3U3HA 2PFHA 1UA3A 2PWUA 2EJ1A 2Z25A 4CKQA 1H61A 5C9ZA 2YCLB 4TUFA 3VD4A 1RA5A 1AQ0A 4JR5A 4K1GA 3MS8A 3RIKA 1K7EA 1GVYA 1TWIA 1H49A 1W1VA 4UR8A 4C1NA 3DH7A 2NZLA 3WFLA 1FWCC 4PCFA 3Q37A 4L1XA 2D1ZA 3WQDA 3ID7A 2WC3A 1JI2A 1WDWA 3G22A 5I3GA 3L67A 1E1EA 3I4KA 4HN4A 4S39A 2PU1A 2LLEA 1Z44A 4D6EA 1F8IA 1F5ZA 3LI0A 3WYZA 4LF1A 1G1YA 4PSRA 2ZUWA 4LF2A 3CAWA 3NPUA 4JNYA 1E9ZB 5DY2A 3FXGA 4Z17A 4RDWA 1ITXA 5M5DA 5EMKA 4NX0A 4Z2HA 4W84A 2OWWA 4PTDA 1KRAC 3BGAA 3IAPA 4UWMA 2PRMA 5C7HA 1E6NA 2DVUA 5ABTA 3Q45A 4QDMA 2PDFA 1PYMA 4O10A 5FJUA 2NQJA 3QM3A 2EPMX 1UMYA 1FXPA 1WBHA 5FCZA 4HMEA 2XSAA 4A3UA 2FQIA 3WEZA 3A3WA 2ANUA 5A8GA 3LHWA 3SN4A 3KUMA 3A22A 4JTGA 1AZ2A 4N0RA 2DUXA 2XWDA 1SZNA 1SW0A 5F2LA 4GISA 4IX2A 3A5VA 4TVDA 3UD6A 1DL3A 3H6OA 4Y8FA 5C2CA 3LY0A 1KTNA 3M7WA 4JCMA 3E2RA 1TR1A 3BMVA 2WWCA 1JDCA 3WLLA 1RJPA 1XLJA 4N4QA 3EWYA 1CLXA 2BGNE 2QF7A 2PCQA 3T8QA 1H7XA 5FF0A 3O1NA 2CERA 5E9XA 1IT8A 3TZNA 4HU8A 1OD8A 1JFHA 4H00A 2JKAA 3V0SA 2TPSA 4MSSA 1E1CB 4AF0B 1RALA 4JXCA 1U30A 2NQ9A 3ZT7A 4HTBA 1OVDA 3L21A 1R7AA 2IXUA 3UZWA 4P7NA 1U5VA 4C5ZA 3ZR5A 3U4AA 1MW3A 3QKZA 3CHEA 2CXEA 2FIQA 2J7CA 3DYOA 3RPTA 1Q6RA 5HNTA 1TVNA 2WVTA 3RR1A 5D8WA 3VNIA 2Q02A 2XGBA 3K1DA 3BW3A 3UJFA 1AZ1A 4HPJA 5D2YA 5HPCA 4NAFA 4WEVX 5PTDA 1XBZA 1G9HA 4V33A 3IV8A 3UR8A 3QZAA 2DSKA 3EPNA 2XYLA 4U31A 4NF7A 2WW5A 3SRKA 1G4PA 5CCZA 2AL2A 2E67A 3OLIA 2B7QA 4IGHA 5A6JA 1PB0A 2L5HA 4EOUA 4L9XA 4PUMA 4JL1A 3PAOA 1DWJM 3B04A 3CPRA 3NOYA 2WSKA 1NAL1 1ZY9A 3UFYA 4PA8A 4XVEA 5EB8A 1X1ZA 4YTRA 1K1DA 2HPMA 4LU0A 4G6CA 1H5VA 1I2PA 4IFOA 2OGJA 4JICA 1HJUA 3IUHA 3UZ5A 3MUAA 5CBJA 3WD2A 1BF2A 3T9PA 5KMYA 3TN3A 3A13A 1M7PA 1AA1B 3EWCA 4PBGA 4PMZA 3VMOA 2ASHA 1GGOA 1OC7A 1BQGA 2R8WA 3PNUA 2JEPA 3G1XA 1TWSA 4BA0A 3GZ3A 4Q8WA 1A3HA 4X61A 5A6BD 2XGZA 1TFVA 2CHNA 4A22A 3BICA 2DEPA 3W1XA 4Y96A 5KZMA 4OHQA 3GYEA 3ES8A 3AAMA 2D20A 3WLIA 1NDVA 1KQYA 3P6LA 2BY1A 4AFYA 3HA1A 4BJHA 2BSLA 3BSGA 5DMYA 4P2VA 2FMNA 5H8MA 3O07A 3GXFA 3THCA 3WLQA 1AVAA 1F3XA 4MLJA 2OSWA 1F6PA 3UP8A 2XZ9A 1XGDA 1M41A 2Z27A 2BMBA 3REQA 4Q7IA 1AMYA 1GOWA 4R88A 3LM7A 1GYMA 4RL3A 2F61A 4WIWA 4QJ4B 3ALFA 4DB7A 1R3VA 3LPOA 2BHZA 3NGFA 3QZEA 4PUUA 3SUVA 4DAFA 3H55A 2IPWA 2Q71A 2DT2A 4LV4A 4C90A 4UFIA 1JUKA 1B3YA 1HJWA 3EEGA 3FXYA 3EOEA 2ZE3A 1NOUA 3VIJA 5LNVA 1Y5XA 4EKJA 4GH1A 2W5FA 4WJXA 3MANA 5GPRA 3NSMA 2BVWA 1ZJAA 2WNQA 3HPSA 4GJ1A 3PFRA 4YCPA 2E28A 3TC7A 4QTGA 1K4HA 3CIVA 3QOKA 3H7RA 3RJXA 2C0HA 2B7PA 2XVNA 4M51A 4ECLA 3SCQA 3IJ7A 4LJ3A 2EG8A 3A4AA 2Q3OA 4P8UA 1TX2A 3W7PA 4DVOA 3CBWA 2VT0A 3W24A 4XKMA 3S9IA 2XFFA 1GOQA 1PV8A 2BVYA 2C15A 3H2OA 1J8VA 6CGTA 3VTRA 4GABA 4Q7BA 3FYYA 1UH3A 1VJSA 1U33A 3CQHA 1YKWA 2WHKA 5JIPA 1VJZA 3GG1A 1FX6A 2YDQA 5FJIA 4KIEA 3C0LA 3AIWA 4QROA 2IPJA 3DFTA 4JHMA 3GIQA 3NOEA 3QSTA 3VCCA 2HVOA 4IJBA 3WLSA 1XRTA 3L4XA 4O1FA 2WJDA 4C6NA 3UXKA 1E3XA 3VZXA 2GJXB 5HJYA 3ZLFA 1MNSA 1OD0A 2TODA 4RNHA 1TMHA 1JZ2A 3C2FA 1B90A 4K37A 3RRAA 4DJDD 4WD0A 5JQ9A 2C79A 2C3ZA 4M81A 1PKLA 1YE6A 4POCA 4UTFA 1KLYA 3L5LA 1FWAC 1S2CA 3ANUA 4DUWA 3MSRA 2YYUA 2VXNA 1ZALA 2C19A 5I3JA 4TMCA 4Y9AA 3TJXA 1KBLA 4GMEA 1XRVA 1UP2A 4JEJA 5I3FA 1SMDA 1Q6CA 4V1XA 1BYAA 3GVVA 4XZHA 5D05A 1YW1A 1KGXA 2VZVA 4LS1A 5HNRA 3M0LA 1UA7A 1Z89A 1QNVA 3T55A 3SQSA 1T0OA 3B8SA 3N1AA 2ZXDA 2HK1A 4O0QA 2JE8A 1GZGA 2E9BA 1JCXA 3UNTA 3KLLA 2EF9A 3WK2A 2QPXA 1LWJA 3V7PA 5I7GA 4ZSTA 3CK5A 3FAXA 2C13A 3SR7A 4HP5A 1YBQB 2VX7A 2WVVB 3GW0A 1EOMA 3GNRA 4K39A 4DBEA 2V6AA 2VUYA 1VENA 4NXSA 3VGDA 1RD6A 3CASA 3WX7A 3BG3A 1ONRA 2J7FA 7TAAA 4ZODA 5C9WA 4AYGA 2OOFA 3AXHA 1WOBA 4U5IA 1HN1A 4R53A 5T26A 1GTEA 3DFNA 4J3XA 3R89A 2SFPA 5A8QA 2DUAA 4J3TA 5L9FA 1WKDA 4S3BA 1JZ3A 2VELA 2WJZA 1XR2A 4GX9A 3NG3A 1R38A 5JBEA 2HCVA 4C6CA 1QNRA 5CC3A 2HEJA 4JQ3A 2ZOXA 4GVFA 5CPSA 1RD5A 4U10A 5A6KA 4HPGA 1QPOA 3BL3A 3RFAA 3VM7A 2WBKA 2VMFA 5D9NA 4W5ZA 1WE5A 4MVAA 5GNYA 4TQTA 4H6RA 3GBEA 1FWGC 2FLIA 4DI9A 3VKBA 3DI0A 4U2YA 3PZTA 3QC3A 2J66A 2IQDA 4L6HA 2JQXA 4XO6A 4NNCA 2I7GA 4RNIA 1HFBA 4PMNA 3GUGA 2GJRA 3KRUA 4I3GA 4MJ4A 1LG2A 2ZRZA 2V3GA 4N9CA 4H4IA 2PWEA 4F48A 2XH2A 4C1NB 2J9YA 1D2KA 5CLTA 2JGYA 2J47A 3U9IA 3RHGA 4S3CA 4A29A 2RAGA 1XRFA 1A49A 1IT0A 2PBOA 4E4PA 4H9UA 5CAKA 4JDYA 1FH8A 1DWHM 1TWZA 4JIIX 3H2CA 4FNUA 1P6BA 4CD7A 4GNVA 1OFEA 1OYAA 3S1XA 1SR9A 2J9XA 3S83A 3V36A 3LTPA 1VIWA 2PDCA 4NZJA 3URNA 3CEUA 1OF8A 1CENA 5F2MA 1L6SA 2VKZG 3LCGA 4IPIA 4NU7A 1WPCA 5C7VA 3I6EA 3BCJA 4NZ1A 4C5YA 4S3DA 3WKZA 1EO7A 3LHZA 4B2DD 3O3RA 3WBXA 1GCYA 1PDYA 3H2EA 3FSUA 3VOCA 1HL8A 2ZUSA 4IJRA 3BLIA 2FB3A 1NQ6A 4CCEA 1IR1A 1N7KA 4U2ZA 4B5TA 1U83A 5HA7A 3PULA 5M2FX 4BKNA 1GVIA 4IIFA 2RGMA 4J40A 1FWBC 4AH7A 4LVDA 3SB0A 5CH9A 2A85A 4F0HA 1GOKA 3R8RA 4L65A 3Q94A 1VKFA 5AYIA 2PGEA 3U2EA 3CGTA 3SCRA 2XIJA 4HZMA 1ZCCA 2NVAA 4FOKA 4FNSA 4FMVA 1XQKA 3UXIA 4A35A 4V1YA 1Z9AA 3W53A 3PWAA 3UVAA 1HKVA 1KM2A 3KBNA 5D04C 3DFPA 3LHTA 4MAVA 5IFPA 4YVXA 2XTKA 1VBGA 3MW7A 1I2NA 3HU7A 4MFDA 4J1OA 1GEQA 5LSMA 1CLVA 2I16A 4ADSA 4LFYA 4M0XA 1A5KC 3GNPA 1XS2A 2F2KA 2G4FA 2EGZA 4LAMA 1ZB5A 2E8ZA 2QCLA 4H04A 1EBGA 3SGGA 1UUOA 1TRIA 3VNJA 4DX3A 2OG9A 4CVUA 1KR0A 2JBMA 4EPEC 6XIMA 1FDZA 2EPLX 2DVTA 4WHBA 2ZWYA 3ARYA 3MMTA 3GM8A 5M1TA 2ZBTA 3QV6A 3VD9A 3WBYA 3UPBA 3GC2A 4NAFB 2DSUA 2CLMA 1IXPA 2W63A 4DWSC 3ZLGA 4HHHA 5LIYX 2AL2B 2QCCA 2PA6A 1EIXA 4URIA 1F9CA 1KA9F 4HA0A 2GVJA 4W7VA 5D37A 4H9TA 5E9AA 3S5NA 2IS7A 3UR2A 1F6KA 1K8CA 3D46A 4JHZA 3IK4A 4BI6A 4LYKA 1FQ0A 1F4AA 2I5QA 1XSJA 4O8AA 3U0HA 2UY5A 3PB2A 3ZT6A 4PUKA 4H83A 3WDJA 3VDCA 1UW9A 4CVWA 3F5KA 1ML1A 5D38A 4F0KA 1T7LA 3FFSA 1Q6FA 4Q8TA 3DCPA 3M41A 1GKQA 3WJXA 3T2QA 1VFSA 3V3WA 4JNMA 1XYBA 4O1DA 4C6IA 4CD8A 1DJZA 2QNEA 4KBXA 3FKKA 4LVGA 1V6TA 4JDBA 4PMXA 4AQLA 2NSXA 3NQ7A 3SIZA 1J0ZA 3F1QA 4W8AA 1KGWA 1C8YA 5AHFA 3WEMA 3GTXA 1VYRA 4ZL1A 2Y7DA 4IX0A 3BXWA 1GQKA 4TV5A 3W7GA 4PC8A 1XX1A 3E0IA 4D71A 3L4VA 3RU8X 4S3AA 1HJXA 3T8LA 1R7OA 3UETA 3REQB 2C91A 3C2EA 4J35A 2I5GA 4YTSA 4AY1A 3WFZA 3WQ6A 4YTUA 5C55A 5IM51 3EEZA 3P2VA 4JTRA 4W8LA 1I0BA 4LAOA 3NQGA 3VINA 1YTKA 3WH9A 3QLDA 1UR4A 1DHPA 3A64A 3VE9A 2IW0A 3LV6A 4O53A 3CWNA 5LA1A 3LEPA 3MVIA 1AQFA 1W1YA 3CL7A 2ZTKA 1XUZA 4WDTA 5KINA 1PEZA 3AWNA 1R30A 1UUQA 3NWRA 3GH5A 3QY7A 2TAAA 2FMOA 4S38A 3WF3A 3AS1A 1TQJA 4QLKA 4W7WA 3TQKA 2R6OA 4LRSA 4HNLA 4LXFA 3W27A 1G0CA 4BQ3A 3NPVA 4GKLA 2PD5A 2OODA 1UWUA 2WWDA 5AC5A 4M1BA 3VGGA 5BRPA 4EF8A 1PWMA 1RCOB 3VA8A 1VBRA 2VEKA 4UTWC 2CLFA 4QG6A 4FLQA 2WMHA 4NG3A 4GK8A 4H7VA 2JKEA 2XVLA 3N2OA 2WVUA 3RAOA 3W81A 4R34A 4W9TA 3O06A 4GD0A 3R13A 3GFXA 3S2CA 1K6AA 4HQVA 2ZXBA 4E6MA 3BJTA 1SFJA 4MWAE 1PWLA 3GC4A 1I45A 2YA1A 5AKQA 2PDPA 2GGHA 4JN8A 1SPQA 3MKCA 4YHEA 4D1IA 1SYTA 3CB3A 3C2OA 3H7UA 4AZ5A 1DWGM 3S5YA 1LJYA 4WRHA 4N9DA 3WD3A 3JS3A 3H12A 4M5PA 1O68A 3SEPA 2PPGA 2F6KA 5I2UA 5U4NA 3QC0A 1IEQA 4JTSA 4GY7A 3WUFA 3VX1A 1Q7ZA 1AJ0A 1HJVA 2PRHA 4OUEA 1ZZMA 1W3NA 1I60A 1EP2A 3N2CA 3VUSA 3WUEA 3W29A 3H8AA 4C7GA 3LCFA 2QEZA 3SN0A 2P3EA 3WELA 2Y61A 5DT5A 4RLIA 3TW7A 1UZ1A 2OXNA 4TO8A 2PS2A 5I77A 1KLZA 3VABA 2Z26A 3RCYA 2V30A 3H2FA 4W86A 1XG3A 5HNUA 1GONA 2GSHA 1PXGA 3IK2A 1KRBC 4AWTA 3ZVIA 1ZQ5A 1XQLA 4XG1A 4HNNA 3VIHA 2E09A 3KBVA 3ANVA 3FHAA 3VU2A 3U5UA 2WSYA 3SY5A 2P8CA 3AMGA 1I8JA 3T4WA 2NUXA 1OQFA 5DT7A 2V0TA 4HOWA 1U1HA 1V03A 3FGCA 2DDXA 3CHCA 1FCQA 4DXXA 3G1VA 1ICPA 1KV5A 1KGUA 1D7KA 3FDKA 3ZSTA 1GKRA 1ZJIA 1OZMA 3BLEA 3QKEA 5HJLA 3D0CA 5I23A 4N9EA 3P8JA 4ZFMA 3BH4A 4S3JA 4DM1A 5HDRA 4C6QA 4WKFA 1FCVA 2GWGA 1TIWA 3OO2A 4CNTA 4UTIA 4NI8A 1GHSA 4X0NA 3OVPA 6REQA 5FF2A 5J8LA 5I3DA 2DQWA 3T42A 1DQWA 3BGGA 1BYCA 2AAAA 3W71A 4EAMA 3VOFA 4LCQA 2ZX8A 5AOUA 3R7MA 1XBYA 3DUGA 1JGMA 1XKYA 2WZTA 2RKXA 3CWOX 4B92A 1SJBA 3NO3A 3VGEA 3ZSSA 2DFAA 3UNDA 2VEIA 3DYPA 1XC4A 1AFSA 1CI1A 2F38A 1C8VA 1FHDA 1A53A 1F3TA 3KEHA 1XYLA 2DUZA 3SCPA 4N2YA 1B3WA 2IKIA 3EMZA 2PF8A 5HQMA 1EJSC 4O11A 5BXPA 3TR9A 1MXDA 4RCXA 3SJ3A 3VD7A 5C5YA 1NF7A 1FWDC 2ZVIA 3V1HA 3OW1A 4L4OA 5H8UA 1OCQA 1P0DA 1ZBCA 1BHGA 1UKTA 1XL9A 2RJGA 1UD8A 4GCAA 3SCUA 3EWZA 4UB9A 1XD1A 1AH0A 2QDDA 4KCVA 1CNVA 1XP3A 3H21A 3GDMA 2Y4SA 2WYSA 5XINA 4LBSA 3BAIA 1Q4NX 3LENA 2BY3A 4QAWA 2PI6A 1PTGA 2PDIA 4US5D 4RZ5A 3RLVA 5KZEA 1V79A 1CZ1A 4D6FA 4MB1A 4M7SA 3HBLA 2GWNA 4B3ZA 2D2GA 3MWCA 2WC7A 1CGYA 3MB9A 5I07A 2VD8A 3B97A 1E6SM 1HUVA 4LPCA 4GUFA 4D6IA 4E2DA 2PD9A 3PZMA 4QEEA 3OZOA 4P7OA 4GVGA 1NSJA 4JD4A 4AD1A 4AHOA 3CUXA 3WDQA 1J79A 4E8CA 1I6NA 1TTJA 2OYKA 3JRKA 4HD5A 4PTNA 3AZTA 1OBAA 1UCWA 1FWSA 5FEZA 2ZQ0A 4FNRA 1KTCA 4FAMA 4Q4RA 3EWWA 1E73M 1ZUAX 1FVPA 4L6DA 3PWGA 1A5LC 2Z1WA 1XYZA 2XH0A 3DX5A 3L0KA 1DEDA 4PGLA 3PZ9A 1HKIA 2YR1A 5IRPA 4KCUA 4WF7A 1PBGA 2EG7A 3RMJA 1ISZA 2XUCA 3L4YA 3UF9A 1LBLA 4CLMA 1JZ5A 4D6DA 3PUEA 4PCPA 1R2RA 4AWEA 4KH2A 3XISA 5FKYA 4DZAA 3UY8A 4K8GA 3E5PA 1Q7MA 2QJJA 2QAPA 5CSUA 4DI8A 2OFJA 3QMTA 4JL2A 3SCVA 2HNEA 1FKWA 4RXFA 3TV8A 1XGZA 1XBXA 4J3WA 1KQZA 5HWJA 3I7RA 4LVFA 4LAKA 2OQHA 1LG1A 4PRWA 2ODOA 3OVGA 3AHVA 3T09A 1UP0A 4F40A 2VZOA 3W7LA 5IHRA 3KS5A 3G18A 3GB6A 1KWGA 4B5NA 4ZA0A 3UT0A 2OJPA 3R1ZA 5I02A 2HNHA 4GBDA 1VHCA 4C65A 3CTTA 2Y5SA 2GGJA 4UQEA 4KEZA 4O1CA 1F05A 2QGYA 4XD4A 3W7NA 2QF8A 1YDYA 1IXNA 3MUZ1 3RRXA 1D3GA 2AQVA 1GT8A 1A5OC 3B0YA 4CGTA 3VKDA 3MJMA 4CN4A 1VJIA 2E6AA 2BB0A 3LI1A 3KRSA 5AC8A 2E7FA 3VC6A 1XV8A 5A94A 1VFHA 1ZBVA 2BDQA 3O15A 2NX3A 2HS8A 5AN7A 4GC3A 1AH4A 4HSHA 3ZVHA 1ITQA 2VYOA 3W1QA 2E1WA 1Q4WA 1VFOA 1VZWA 3WQFA 4DBWA 4HT3A 1DQUA 1BAGA 1ISYA 4HTYA 3VIKA 1C8QA 2ADAA 2HBXA 1W5PA 1F2JA 3BAJA 1WDQA 4N02A 4DUVA 3W6YA 1QI5A 1QRQA 1IWPA 4G8TA 4AX6A 4A8IA 3B8IA 1H51A 2GLKA 4H7ZA 1SSGA 3LHUA 1VRXA 1YMYA 2A3EA 2WNNA 3DHFA 3M0MA 3M0YA 4NRSA 1MQRA 6PTDA 3CAQA 3ME3A 2W4XA 4LEFA 5A2BA 2WKJA 3VMPA 2E25A 2XINA 1BWVA 4MF4A 4FHAA 2G3NA 4FK9A 1EJRC 3T08A 3WBEA 4Y9MA 4IQDA 1X6NA 1EXPA 1NOWA 4IFKB 2NXHA 2P3ZA 2XSXA 3DFSA 4LANA 3WF0A 5F2GA 4QCFA 4NJJA 1V77A 3N11A 5G1YA 4GXWA 1WXJA 2ZUNA 5F4WA 4NY2A 4YVVA 3S47A 3WFAA 1H7PA 4DYJA 1PZ1A 4H2HA 3CUGA 4JNZA 1OYBA 2IQTA 3V5OA 1VQTA 4GKTA 4ZVJA 1ADSA 2YB1A 3K8LA 6TIMA 1QCWA 3FSTA 1V0MA 2B31A 1NIUA 1JFXA 5T91A 2WLYA 3P5ZA 3R25A 2VFHA 3M7SA 3U7VA 2Y89A 3HMJG 5HUOA 2FZMA 3CU2A 2G4JA 3D47A 1Q6QA 1SJCA 3VZYA 1TJRA 1US3A 3HGSA 3T07A 4O1EA 1ONWA 1QNPA 4E38A 1QHPA 1CTNA 2IKJA 2VGFA 2X1UA 3TWBA 3VNMA 4IIGA 1YIXA 2WMGA 5AYBA 3T0DA 5CPTA 4DBSA 5G5IA 1W1A1 2JKPA 2QR6A 1L6YA 1VBUA 3TFXA 3DDMA 3NR0A 3WH7A 3C8NA 1JD9A 2ZC1A 2I9UA 3W86A 1J0YA 1XBVA 4DPPA 3TQ0A 1L8PA 4JTKA 3USBA 4JIEA 2XIMA 2ZWZA 3ZWTA 3CB8A 4O13A 4I9TA 5A8MA 3GH7A 1OZQA 4GVHA 1NU5A 2FZBA 1KTBA 5I09A 2CCRA 3W22A 3R0KA 1WUEA 1F61A 3C0JA 3UU0A 4ZQNA 4HCHA 1H63A 2VI0A 3W7IA 2QDGA 1ZTVA 1J18A 4LEQA 4FNTA 3EDFA 3TCSA 2QVHA 2W62A 3I4EA 5G4HC 4HYWA 1R47A 3E9AA 3U6WA 2FHCA 1Q2SA 1JDEA 3UW6A 5BXRA 4JEQA 5D2VA 1MW1A 4UTMA 2CBJA 3F4CA 5I78A 1A4LA 5FSDC 5A2CA 3SGZA 3LLXA 5AVHA 2REQA 3WD1A 1OFBA 4HJFA 2NSOA 5I24A 4XWUA 4R33A 1XLMA 6ALDA 3CQJA 3FGCB 4KMQA 3MP4A 3TOYA 1ECQA 3W28A 1RHCA 3NGJA 4WLCA 4ZGYA 1MUMA 3P0WA 4F9DA 2W3ZA 4FLOA 1LBFA 1FCUA 3U7BA 2XIOA 5AFDA 1B0IA 4XZMX 4PE8A 2CIPA 1TJ1A 4WKHA 3IJLA 3HPAA 4E4UA 1W3KA 2B81A 1CYGA 4CNOA 2OMAA 3R2GA 3USZA 3B9AA 4L9YA 1TB3A 1EDTA 4KERA 2EHHA 3I6RA 3U57A 2Y7FA 1EXBA 1XW8A 2Y7GA 2QW5A 6REQB 1PIGA 4U3CA 1WV2A 1KCZA 2DSZA 2Q8LA 1P43A 2DT1A 4P7LA 3KHJA 3OG3A 5K9CA 1UH4A 3E2VA 3FN9A 3IIPA 1LLWA 3FNDA 2GVEA 1ADOA 2QGHA 3CZJA 4FX6M 4MM1A 3SN1A 5CPMA 3LHYA 3KE0A 2WHJA 2C0AA 3OBAA 4LNCA 4PUEA 3E2QA 2XN1A 5D9PA 4LGXA 4H3DA 1ZRQA 1DHKA 3EZ4A 4DWSA 4UFKA 1VH7A 3MPGA 3LSBA 1MRQA 1QOPA 4WDWA 3VFLA 4DHGA 8XIAA 4Z2IA 1ESWA 2ZX6A 5H1WA 4HSOA 2WV8A 4BI7A 4HU3A 3GKFA 3CO4A 2PSNA 4YVPA 5CGQA 3QR1A 2OEKA 4NILA 3CAVA 2J25A 2UY3A 3EPMA 2NQ5A 4UFHA 4H9VA 1H4PA 3S1VA 5A95A 3AU6A 3DFOA 3I65A 3TMQA 1V4YA 1IIHA 2HRWA 1JGIA 4L61A 2X30A 4J2PA 3B0PA 3E5BA 3NQ2A 3HV9A 5HJXA 1ISWA 1IHIA 1TMLA 2PDXA 4YXGA 4B3KA 5HQEA 4JTUA 3AROA 3BOLA 4WSKA 2BVDA 1O5RA 4EPDC 4MUPA 1V5XA 3JW7A 3I7SA 1UKOA 4K6AA 3H4XA 3PTMA 3EWDA 3NO1A 3ONCA 3YPIA 1L9WA 3SGUA 1O94A 3K8MA 2ISDA 1QI0A 1KFWA 4ZB5A 2TSYA 3NPWA 3KXQA 1SZEA 1XJBA 1UZDA 4R7OA 4C6PA 3EYPA 2FPVA 3CM4A 1HO4A 2Y8VA 3BAWA 1TQXA 3W7DA 3ZT5A 1R85A 4OZOA 1UPMB 2J7GA 4NAEA 4PYSA 2X2YA 5DXXA 4Q6JA 1Q65A 5AZ1A 5D30A 4OU1A 1VCFA 1PE1A 4S23A 3BAXA 2OGYA 4GUGA 3WJSA 3MWAA 4LYQA 3MSDA 1B54A 2UY2A 3OU8A 3N2BA 4IWWA 4OVXA 3G24A 2D3NA 4D9PA 3NQCA 1GJWA 4J3UA 1TJ0A 4S3EA 4XBJA 2PDUA 1FOBA 2CLLA 3VILA 5CGTA 4F79A 4W8BA 1P4CA 2ZZ2A 4LB4A 4RK8A 3C3UA 1FTXA 3NZRA 2ATMA 1ZCOA 1MEIA 4ALDA 5TNVA 3MT1A 3P84A 4LVAA 3AI0A 4DJDC 3R79A 5G4EA 3Q58A 3ZFHA 4LW7A 4LY4A 1K9TA 4UTWA 1M6JA 1K03A 2DIEA 1GW1A 1VCVA 1AH3A 3VDHA 2Z1VA 4XVDA 4Y2WA 1O4UA 1J10A 3M5ZA 5ABEA 2CWXA 4QG9A 1X1NA 5DMMA 2C18A 1LRQA 2VEPA 2PTWA 3ITXA 2G96A 2ZKMX 3FX4A 3H2NA 5GVJA 3JVAA 1XUUA 1UPPA 1X1OA 4R7WA 1FH7A 3HJZA 4AMCA 3UR7A 4WK9A 1G7UA 3P7YA 3B05A 3UG3A 4P61A 3L4UA 4E2VA 4EPKA 1B30A 3PZUA 2Y85A 5CG0A 1JCYA 4GH3A 3GWQA 3AMKA 3CV6A 2IXVA 5CJNA 4QEHA 3PZIA 3L66A 4I5UA 1OADA 1PHWA 2GQ8A 4R7JA 5D2XA 4DYKA 3NDOA 4IMFA 4IL2A 4ZOCA 1XDMA 1LYXA 1FCBA 3TX9A 2P53A 1SVDA 5DRIA 2BP1A 4GE8A 1EC7A 1QWGA 3N4EA 1K3UA 1VLWA 1JDDA 3PPHA 3XIMA 4TR9A 3HV8A 2PF0A 3ABOA 3WLKX 2C6QA 4FXFA 1JR1A 2FTPA 1XPGA 3E1F1 3UZJA 3ZVHB 3ISIX 2YLLA 3EX1A 1FFQA 4NJGA 4L80A 3Q65A 5B80A 1DIEA 1POJA 4HMCA 1VC4A 3LLFA 4QCEA 5EBAA 1Y65A 3VOHA 2VOMA 1PUDA 3GQYA 1M65A 4NP7A 3QPYA 1QNOA 4L1WA 4MWAD 2HE8A 2YDRA 4XUGA 1GEHA 4LALA 3ITCA 4XZLX 3NO5A 4B5VA 1MUWA 5D03A 3G0UA 2ZX5A 4UOQA 1OT1A 3MCNA 3UZYA 2ZICA 4OUIA 2W61A 3GG0A 3OG2A 4XO7A 2PMQA 3O63A 1XIBA 3CUHA 3H24A 1C3FA 3IVSA 1MMFA 3CIWA 1H60A 4RDVA 2X0SA 3W1TA 4FF5A 2WHMA 1GVEA 4P8VA 2ZZ1A 3SJNA 3ZQ9A 4GWEA 3LRMA 5F1VA 2NV9A 5AYYA 4YL2A 3GRIA 2B7NA 3GDRA 3DI1A 1N82A 5FEXA 1OJXA 5DLCA 3TLLA 5AC7A 3VDGA 5K3VA 4A8RA 4PMVA 3UCCA 1LBMA 4IIBA 4GNKB 3IGHX 3HG5A 1T8QA 3UCQA 2PDKA 5CGMA 1MWOA 1JCLA 1AD1A 3IGUA 3A24A 2CNCA 3FHQA 1JZ7A 2INEA 3MKKA 1YPFA 1OGBA 4UUIA 4B15A 4ERIA 2OCZA 4TVCA 2FH8A 2PTXA 3G2GA 3UBPC 3GR8A 1TV4A 2CC0A 1TELA 4OBRA 3P80A 1B4KA 3VKJA 2FH6A 2VWSA 5FEPA 4JTAA 3LX9A 1TZ9A 3GVGA 2PODA 1FKXA 3ZWSA 2A5HA 1US0A 5GJPA 5XIAA 2FPYA 2DZWA 1K8YA 3PSVA 1MZHA 4PTVA 3PF3A 4QLJA 1TV8A 4OWGA 4KEUA 5A6AA 5LYRA 1F8MA 4DO4A 2CKSA 2R9RA 2OZTA 3QOMA 1OX6A 3U2OA 2J24A 3AICA 1O1HA 5DMNA 1AW1A 1HW6A 2R1LA 4XD3A 3BO9A 3NYDA 1HGWA 1US2A 3IJQA 1WXZA 1XLDA 3NQVA 3BG5A 5IXEA 1ZP4A 4FI4A 1H7WA 4XKYA 3KTXA 3MUXA 5M03A 1XWYA 2NV2A 2YJQA 3KFTA 3OVQA 1T96A 1P6CA 4YN5A 2CLEA 4QM1A 2WVSA 2VFIA 4YCOA 3SSZA 2J13A 5HINA 2REQB 3QR3A 1QI4A 4WOQA 2DVXA 1WDPA 4K8HA 4NZCA 2ABAA 3W2NA 5FI8A 3KL0A 1R2SA 1GHRA 1X7FA 2CZDA 4Q4SA 3MHUA 3THDA 3UPWA 2HWGA 3KOFA 4X2PA 3HGOA 1TR9A 1EJUC 4LAUA 4RZBA 3O6AA 1KM1A 4AVOA 1S2UA 4TX6A 1B3OA 3AXKA 1H1NA 4R85A 2ZZ6A 3T7VA 4S3GA 5D9MA 3P5YA 5KZDA 1TKKA 1OY0A 5E5CA 3WO8A 1G94A 1K8XA 5A6SA 4MPKA 3ABXA 1UR2A 2CYGA 3PBGA 1GVRA 1IT7A 3VGBA 3W75A 2Z7KA 4R27A 3U5YA 1WZKA 2HBVA 2BWGA 2XIBA 3DHPA 4R9XA 1F4HA 1I2QA 3O0FA 2AKZA 2YLAA 3L2MA 4JTDA 2J4GA 1L6GA 3WJYA 3CHFA 3W70A 1H0GA 4UZSA 1EFZA 4QJ5B 7ENLA 3VZZA 1UWSA 4DWSB 3M0JA 1TVPA 1UR0A 2WZEA 3POCA 4GZEA 2JF7A 4ROPA 1TV7A 3AXXA 4AAJA 4P8WA 3SCNA 1XH2A 5AHEA 4Q8PA 3SI9A 1LZOA 1P1XA 5FL1A 4ERGA 2FKPA 3RCNA 3WDHA 2ZA1A 3TDFA 1NH6A 2KX9A 1QVBA 4LS2A 4QDWA 2QV4A 1QJWA 3N4AA 3RCMA 2PCEA 4JTIA 4KS0A 1EKOA 1BWKA 2E6DA 5CEWA 4ROQA 5LNUA 4UQBA 2O0TA 4MB4A 4F4RA 5DBTA 2QPSA 3EX3A 3GTFA 1V3MA 4EP8C 2BZNA 1W3HA 1JNEA 1XM3A 4LY8A 1Q6OA 2JIEA 4DY1A 4O14A 2BOEX 2V5JA 3BAYA 1EEPA 3EA3A 3LXBA 1XHGA 3FW6A 2BX7A 3BW2A 2ABBA 3AMLA 4BF5A 2GVYA 3RK8A 1EJVC 1FWIC 2QULA 4NAEB 4IFRA 1BVWA 4Z0SA 2OLAA 3GLCA 2J6VA 4U3AA 1ZJBA 4O28A 4MTVA 1DOSA 1K9EA 5C0QA 4L1GA 4AEFA 2CLOA 2VEMA 1PAMA 5CG7A 1DIDA 5HUPA 4DJED 3BPWA 3R11A 1RK6A 4HN8A 1VD6A 3RX4A 3L4WA 4PTXA 4FNQA 4FR1A 3R10A 4GJIA 3RNDA 2I56A 1LOSA 4KCTA 1IGWA 1SO6A 4PUNA 4E2BA 2W66A 2QLYA 1DJHA 4O52A 1EYWA 1W5OA 4UC5A 4BHYA 3DG7A 4MNLA 1BGGA 2F6XA 1ZPTA 4W5UA 4PB5A 2R91A 1LDCA 5LZLA 3G1RA 3WH5A 1IIGA 3ZS4A 4C6MA 2OO0A 4EF9A 4JTTA 3UERA 5JH2A 5BXSA 2EEXA 2X40A 4HNOA 5LGXA 3F2BA 3JUGA 4I5XA 3H2MA 3LU2A 5E93A 1S46A 3DEQA 4MZ8A 3QRHA 2QJNA 1L8NA 1NARA 1GW9A 1UD2A 4O17A 2BOFX 2CPUA 5DY3A 1HZYA 3SCOA 3BE7A 2BNJA 3G0XA 3IUDA 1HL2A 3VFCA 2GL5A 3WDRA 3ZR6A 4LS0A 3FVMA 2HXTA 3D5HA 2DU2A 3VE7A 1M7JA 3OLEA 2DZSA 1XSKA 3TN5A 2V5KA 3UZXA 3QHNA 5CAHA 4TU1A 3CAKA 3S0CA 5CSYA 1GQJA 1QI3A 3LB0A 5AHMA 1UJQA 1FXQA 1ODUA 2IPGA 4PL2A 4GY0A 3OP2A 3RR4A 3TYEA 1RPXA 2EKCA 1T40A 2ZTJA 2P5NA 1P0KA 1RV8A 2VVSA 3DC0A 5TQLA 8TIMA 4YPJA 4HK6A 3MZ2A 1EGZA 2FYMA 1DORA 1JXJA 1FWJC 3VOJA 1EF2A 4IT1A 1HKJA 4F66A 4GOAA 1XLCA 4HK7A 4PMOA 3N19B 3BC9A 2O9OA 1A5AA 2EPKX 4GG9A 1W8GA 3GG8A 6A3HA 3PPFA 3TMLA 1JPIA 4UR9A 4FX8A 1DPMA 3GU2A 5IDZA 4IZGA 3URQA 4EXBA 4FF7A 4XIAA 3HTWA 2QUVA 5DN1A 4MYXA 5EFDA 1EA0A 3QW4B 2J7HA 1NDYA 1KBIA 2XJ7A 4AHQA 1K77A 1R6WA 2FDSA 2VO5A 3LZ5A 4HMNA 2CWNA 1S3HA 4Y9PA 4FNPA 2J62A 4RE2A 2QUTA 3DERA 5BYWA 5D2TA 4JKMA 1U22A 4HA4A 2FGBA 3EWBX 4AVNA 3MC5A 3NEVA 4IP5A 2VURA 3FEQA 3MDWA 2ACSA 4K7YA 3VVGA 3WJZA 1UWIA 3PSWA 6XIAA 2CBVA 2VCBA 2CEQA 1O5KA 4IP7A 4OECA 3M46A 1MVYA 1K6WA 1BG9A 4H6QA 5I3IA 2I5IA 1HKKA 3QMRA 1BLIA 2RDTA 3AOFA 4IG2A 3HF3A 4F0LA 3MO4A 4UMBA 2XHYA 3BMWA 1SQ7A 4ZB2A 1PKYA 2WK2A 3V16A 4XISA 1B57A 1L6FA 2PDGA 3RUBL 4LSBA 1DE5A 3VIFA 3AFBA 2A79A 3IV3A 3W2JA 5TD4A 5JBDA 4KCWA 1R86A 5EBUA 2RDWA 3I3BA 1VBHA 3QXBA 3Q2DA 4XAGA 2VDIA 2Y62A 4XV0A 2W9MA 4DXVA 4Z42C 1XF0A 4GQRA 4GFIA 1EO5A 2PGFA 3H7VA 4LCSA 3RJYA 3W25A 3TFCA 2VRJA 3UEQA 1S1PA 3WDPP 1XDJA 4WX2A 2CBIA 1EH9A 1R8LA 5E70A 3IACA 3MP3A 4UNLA 1RP9A 3IIVA 4DEFA 4ICNA 4MDPA 4PN2A 1V02A 2Z28A 3NSXA 3DECA 3F2CA 3R58A 3VIMA 1RBOB 1J0KA 2DW6A 1LQ0A 3OA5A 1A3WA 2Y6ZA 1J4EA 3GO2A 4XKYB 3GE7A 3HFTA 2QMKA 4TTGA 2E5BA 4R3UA 2V69A 2WQDA 1OHLA 3PJTA 3CLMA 1JF6A 2V3EA 4KEMA 4AD0A 4DNMA 1UD3A 2V9DA 4H8UA 4KQNA 3GTIA 4C6DA 4TX9A 2FPTA 4UTJA 4OIFA 2W0UA 3QV9A 4JX4A 1BPLB 2BS9A 1R5YA 3WLHA 3O6CA 3QVQA 1F74A 2GK1B 3BCDA 1LORA 4V27A 1E6XM 1JEZA 3UPMA 2RUSA 1M7XA 1MEHA 2VNCA 4LT9A 4K68A 2VWTA 4HPXA 3ARPA 2GZXA 3MJYA 4DRSA 4A2RA 3OQEA 2NX9A 4F2UA 1ITUA 1E4MM 1Q6LA 2YL9A 2X7VA 3LGDA 1W56A 3A12A 2TMDA 3CNYA 4DJDA 5DX7A 3R8GA 3NPXA 3ZO9A 3AU2A 3CIXA 1H0IA 4B4FA 5BW6A 4MY8A 1W1B1 4UNKA 4G9PA 2VEGA 3CPUA 3B0VC 1HQTA 1Z3NA 4JTEA 3S5OA 3IRSA 1D9EA 3O2LA 5TBOA 3AJ7A 4OT7A 4WZHA 4WOZA 1DP0A 2VGIA 4YTQA 3VIOA 4UQAA 1Q3NA 2P76A 2C1GA 3COTA 1QO2A 4G5DA 5D32A 5G2IA 1JPHA 1Y8BA 2E8YA 2OQYA 2W92A 1XLHA 3D3FA 3TU9A 3BDKA 3L2IA 5EY5A 4MB3A 1PCKA 3QLLA 4M7TA 1QAPA 3KW3A 4CD5A 5JUVA 3C2YA 3WMBA 3KLKA 1EDQA 3T4CA 3URAA 1W9XA 4EWND 3N6QA 4QX4A 4D1JA 3W1MA 3WN6A 4BF7A 3NM1A 1REQB 3B8UA 4ZQRA 2EJAA 1W32A 3VNYA 2BTMA 1QDSA 4JX6A 2YBTA 4GQQA 4XD5A 4HA1A 5A8PA 3GHUA 4XBKA 4ZO9A 2QIWA 2YCJA 3IAQA 1Q6EA 3EXTA 1PJ9A 3BQ5A 3EWUA 1CXFA 2FZ9A 1L2QA 3VCRA 1UQZA 5B7ZA 2ZXQA 1RQHA 2O56A 3GVRA 1X8CA 3CHDA 3BSMA 5ECUA 1UG6A 5HK4A 2ZDRA 3G3MA 4C91A 2J75A 1GVQA 1NELA 2YXOA 2X05A 3BJSA 1MXSA 1RVKA 1TPUA 2WZMA 4F0RA 4HJWA 4NZ3A 1PX3A 2Z1XA 1IQ8A 3PTQA 3SZ8A 2C71A 4KEVA 4B5UA 2PUZA 4AVFA 4NIRA 1CEOA 3MHFA 1XLIA 2XFWA 4GPNA 3RXZA 4CCDA 3N2TA 1JCMP 3S2LA 4ATDA 4PSPA 1XIGA 3SSJA 2J78A 3EXRA 5T9CE 2QJGA 2ZUVA 4RW5A 4ATLA 1WQ5A 3W7CA 3G6MA 3H4GA 9CGTA 3KCLA 1R9ZA 1CGWA 3NURA 3S4TA 2PP0A 2O4MA 4Y6GA 1W9VA 4JQAA 3VKKA 1K02A 4J3SA 4ERAA 4DUXA 4AXNA 1P0EA 4O15A 4ZQCA 1EJTC 2V8ZA 5T9BG 4EXQA 4Q33A 3GHSA 2PLMA 1GTHA 1A47A 3HQNA 2DZUA 1UIOA 4FO4A 1AQHA 5IHSA 1E55A 4DO7A 3KVKA 4OFCA 1H41A 1XIJA 4L4MA 1NFBA 2A2IA 3VDAA 1UBPC 1E9IA 3UQNA 3F4DA 1QOXA 2WLZA 3GYCA 1KBBA 1JYNA 4RV8A 2BXZA 1W91A 1KC7A 2WZHA 4AD5A 4CCCA 2V67A 4NJHA 1LUCA 4DZHA 3PFMA 3VXGA 5DXYA 3WUBA 3OHIA 2V2DA 3Q67A 3CMJA 3DG3A 1VRDA 4HB7A 3EDKA 4QDPA 4B2DA 3WLJA 4MPQA 4P7RA 4HOXA 3HG2A 4IOTA 3SURA 4V15A 3KWSA 3LCWA 3LPFA 1XYCA 3LBCA 2OX1A 2WZIA 1VYPX 3FK4A 3CH0A 1RJRA 1H2JA 3WLTA 3WBWA 3NZ1A 2OZ0A 4A3QA 1TZ7A 2XZ7A 3TE9A 1K4GA 1X98A 3I68A 5HPOA 3BLDA 2OT1A 4QBXA 3LPGA 3HPFA 3CZ8A 3PTDA 3II1A 1KM4A 3EKGA 1GORA 4G2DA 2X09A 1J96A 3EWXA 1YDVA 1HIZA 3RM8A 2YFNA 2FTYA 4DO6A 1LL7A 3RN6A 1SSDA 3AYTA 4AEEA 4C6KA 3BUVA 4IPPA 4Z1DA 1BSLA 4KWUA 4ORMA 4XSLA 2I57A 2BY0A 3NZQA 4JBRA 2C14A 4BCEA 1WDRA 5CQ1A 1U5HA 1JULA 4ACZA 3QSRA 1X96A 1B31A 4CN6A 2YFOA 1YPIA 4RX0A 4O50A 4MUZA 3EDJA 4RKAA 4KGLA 3A21A 1Y7VA 1NM9A 3IJ9A 3HG3A 4J28A 1K9FA 3SUTA 3TOPA 1JJKA 3ONBA 4LUTA 4ZB0A 4KWOA 3AXIA 2VDGA 1UHVA 1BQCA 3FEMA 1OM0A 2ACRA 4AZBA 3B8TA 4Q7NA 4XAPA 2E6YA 1GJUA 2PLCA 1G5AA 2E68A 2PGWA 4QAIA 4BEUA 3UVIA 3W1PA 3PBWA 3BOXA 4GYFA 1D7FA 2YL8A 1YTEA 1PKMA 5LIXX 1YNYA 2XM1A 1CB7B 4B16A 1WZAA 1UWQA 1X8FA 3RF9A 3WLRA 3FYOA 5F1UA 2A6NA 3WLMA 2YCEA 1Q8AA 1N8FA 2JEQA 2W67A 3B0UX 1EX1A 4I90A 5DCBA 1YDNA 4IMCA 5CLWA 4QSFA 1GQLA 5E1QA 1SUXA 1WCGA 3WQCA 3O6DA 4TIMA 4C7DA 1TWWA 1JXKA 3W00A 4Z2LA 5I00A 5J5DA 1AG1O 2DH3A 1EPVA 2WNZA 3DZ1A 2YZRA 5HANA 2G3JA 1E0XA 1O6IA 2NWRA 4NHVA 3GHTA 4O8RA 5FJOA 3KS6A 3PZOA 4IG2B 4LQ1A 2GGEA 3HURA 1J93A 3DBNA 1C90A 1TZZA 4J9JA 4XAFA 4C1KA 5BCAA 4GUJA 1LP6A 5HMFA 1J0IA 1WOAA 3B9OA 3ICJA 1X39A 5FF7A 2DPEA 4TOQA 2KZHA 3K4AA 2Q8XA 5FAGA 3RGTA 3FA4A 1AD4A 2CKRA 3LXAA 2FGZA 3NJ3A 4GUHA 4J3VA 1IZJA 3DG6A 3PJXA 2HSAA 1YDOA 3MYPA 1UP3A 8A3HA 1R3YA 2A3AA 4Q8NA 1KO0A 3BAKA 3VI2A 3BLKA 2BBFA 5GJNA 1OABA 4YU1A 1K70A 1GVOA 3EOUA 1H11A 1F6YA 2J74A 5AYZA 3PK7A 4JY8A 2Z2UA 3ARZA 1BXCA 4ES4A 1XC6A 2X1RA 3BK0A 3BSHA 1EF3A 2DY3A 3HQ1A 3V5FA 3C3NA 1TG7A 4WUIA 5BWFA 3R0UA 3KBMA 4DLMA 1W1PA 3QTGA 1KM3A 1XGEA 4JTFA 2X42A 3E0WA 3SCSA 1GK8A 3RYSA 2ZZ7A 1MYRA 1DTUA 4WSHA 3L0NA 1QNQA 1O95A 1UKQA 3OEXA 5BU9A 2GUYA 3B8DA 3B4UA 4K36A 3AALA 4NKCA 3IEBA 1VCGA 1QPQA 1KCLA 2ISWA 4C6OA 1H1YA 4H6KA 1A5SA 4IMEA 5D9OA 3UWWA 3W1LA 4NX5A 3S6DA 5AB3A 3ARXA 1PTAA 1Q45A 1DKWA 3W7HA 4IQJA 3S8HA 1L6WA 2OEMA 1H1ZA 4G7EA 2ZRVA 3BVJA 3BURA 5TAOA 4FIRA 4UCFA 3SADA 2G0WA 5M3WA 4QJ1A 2HVNA 3K46A 4I7UA 5BOOA 2VX6A 3QF0A 4QP0A 1TA3A 1W0MA 1DJGA 3OHMB 3RLGA 2DT0A 5T8GA 1IEWA 3WH6A 3QHMA 4HIBA 2UV8G 4E5TA 1LQ2A 2NX1A 1L0PA 4CQCA 2CU0A 3TTQA 3MY9A 5CBIA 5CPOA 1JCTA 1TCMA 2OQLA 1KFJA 4PMQA 3LV5A 5LKYA 4CEXC 2BV9A 4KWWA 4E3TA 4HMDA 3M5VA 4Y7EA 4QG8A 1KB3A 4O16A 4ML4A 2P1FA 4HOZA 2ZZ4A 4ZE4A 2DSWA 2OKTA 3DKJA 4I8YA 2ZFAA 4LBRA 2DORA 1MSSA 1Z48A 1AQMA 1G69A 3AHTA 3O0KA 1UZHA 4F3HA 3AZRA 4MWAC 1QU4A 2I17A 2OPJA 4EACA 1W5QA 4L64A 3BV4A 3JR2A 4JX5A 3W7EA 4NJIA 4GY1A 4M56A 5DMLA 1VP5A 1Q85A 3DYMA 4PUDA 3CJPA 2NT0A 1B4EA 2J8TA 4GINA 3CLWA 4QE5A 2AAMA 3VNKA 2F8QA 4AYSA 1K7FA 1SZGA 2GVLA 2FGLA 4FA3A 1VPYA 2INZA 1VYSX 1DIOA 4JIPA 2QCGA 4W7UA 3PY2A 1TSIA 5DBUA 2OTDA 3GHRA 4FLSA 3UJSA 5I3HA 3EDDA 1W17A 4GUIA 1SZFA 3HFYA 5JH1A 5ABFA 2VGBA 3MCOA 2W91A 3UWEA 1UKSA 2R1PA 4IQLA 2GVGA 1SO4A 3PBYA 1C91A 1A5BA 3TTEA 1FDYA 4DBDA 1NP0A 3ZXWA 5C8BB 1NY1A 2RDUA 3K13A 3W1UA 1M9HA 4N42A 4HSNA 2QIIA 1MFUA 4LC8A 4WKAA 4GIYA 1OIMA 1XLLA 2GGGA 3G5EA 1QI2A 3MMDA 1IZCA 1FWWA 1EJ7L 1M53A 4YS1A 4IUGA 2Z29A 2E5CA 1Z6KA 2WCSA 5K9DA 4TTUA 1V0NA 1BKSA 1ALDA 1TPDA 2E3ZA 3WSUA 3WQ8A 1ENUA 1YXYA 3IUIA 3SIMA 3GXDA 3VKAA 2HXUA 3DKLA 4MY1A 3W23A 1GPFA 5CZKA 4D8LA 4A3YA 4ZTYA 4UQCA 4LYPA 1V6UA 2DZPA 1POKA 1ZS2A 3M9YA 3GIYA 2CLHA 1KRCC 4HPNA 1LUCB 1F3WA 4J27A 4X60A 1QBAA 4US5A 1CXKA 2O4QA 1T6MA 2EBNA 4REQA 5J04A 4GYKA 5KEZA 3PZVA 3SO7A 2O9PA 3T0TA 4WCJA 1SJDA 4MHBA 3V75A 3NVTA 5I03A 3T0CA 1UMLA 1HP5A 4S3FA 1I0DA 2OKOA 4AD4A 1P1MA 4CNSA 5CJ5A 3C52A 4Y90A 1J0HA 1VS1A 1FDJA 1SMAA 5LA0A 1UC5A 5HOSA 4ICCX 3FOKA 2EAWA 1KWKA 4JTLA 4DF0A 4Q4MA 4HGXA 3E96A 1LOLA 1IEVA 2D2OA 4RPQA 3F2DA 2WXDM 3VKCA 4P5UA 4YTTA 3N04A 4AY8A 3PG9A 1QT1A 1XIIA 1JI1A 3THUA 3WQEA 1KD0A 4C6LA 2D0FA 4IP4A 4ACZB 3ABQA 4NNBA 2XVKA 3OBKA 1HF6A 5HWMA 2E77A 4AU0A 9XIAA 4CQDA 7A3HA 3NFUA 5HQLA 5D2WA 2AKMA 4Q4OA 3W85A 1SFSA 2A3HA 2V5BA 3CTLA 4IL0A 4GI8A 3L12A 3VIIA 1VB9A 1BFNA 3E2SA 2GDVA 1CXLA 3M0IA 2PDLA 1B3XA 3VM5A 2VC6A 4E0CA 1YRRA 4QR6A 2YDSA 1YLVA 4LH8A 3B4YA 4LYRA 1NWRA 3AUOA 5AECA 4TX8A 3SRFA 3TJIA 3GU9A 4AIOA 2ZZ5A 4JQ1A 4B5SA 2OELA 4JIHA 1NTHA 2PC4A 4LUIA 2XVPA 4AC1X 4JN7A 2WM0A 1OIFA 2GJLA 1OSEA 1YQ2A 1S39A 1XIFA 3MSGA 4G7FA 3WQVA 3W6MA 2VZUA 1IGSA 3SBFA 4UNIA 3MHGA 2MANA 4RZ6A 1T5AA 3H54A 3W7OA 1J9YA 1D8WA 3GNOA 3QFEA 3SUWA 4G1NA 3N3TA 4UTUA 1R3SA 3CV7A 1GOMA 1B2YA 4Z2KA 4GQBA 4HZ8A 4M6VA 5AZ0A 3MA8A 3QV7A 3DHDA 4Q6XA 2VJXA 3RU6A 1N2VA 1HXJA 3EX4A 3EOLA 4UTLA 2HV5A 4OE7A 1SO3A 2A1YA 3GXMA 5KZ6A 4YWIA 2PGRA 1DJQA 2A7NA 1QO5A 4DNHA 1QW8A 1WAWA 2OVLA 2GPTA 3CV1A 4PODA 5F2IA 4RE4A 4A8NA 1DJNA 4DUOA 1GYLA 4HKPA 3M44A 1XDLA 4P7QA 4FIQA 1UD6A 2H3BA 3T05A 2VCCA 2BLEA 2UWFA 1FH9A 5ABGA 2AGTA 3CO8A 4H9ZA 3T78A 4GZ7A 2HISA 1QHOA 4HCDA 1ME8A 1O5QA 1P0NA 1VR6A 2OWCA 1PPIA 3BW4A 1A0DA 1RA0A 5CPNA 3WJWA 2XH4A 5HATA 4GRSA 4IMGA 4MYAA 1XSIA 5DCDA 2VVNA 4MGGA 1DWAM 3VMNA 4DELA 1WA3A 5E09A 5EKYA 1BXBA 3CMFA 5BRQA 3W2MA 3NM3A 4BFAA 4BY3A 4KRUA 4O54A 5LIWX 2PDMA 4ML9A 3V5CA 1MFVA 2IKGA 1E0WA 1QHZA 4DJEC 1E0VA 3KP1A 3AS3A 1FUYA 5FF3A 4GYJA 1E72M 1JD7A 3WNNA 3UWUA 4IGSA 3LGEA 4D8ZA 1DIKA 3BLLA 4L4PA 3WIJA 3L68A 4X3ZA 4F9JA 2V5CA 1PIIA 3MMWA 4CU6A 3TA6A 3N17A 2XGIA 4OBTA 2WMIA 3OZYA 4XAYA 3ITLA 1TE1A 1DXEA 2D23A 4XQ6A 1IV8A 1EP1A 3BLFA 4FS9A 4ZQOA 3K8KA 1HO1A 3WF2A 1JZ6A 3TUUA 1TYGA 4LRTA 1SW7A 2OT0A 3WQGA 3IGSA 2NXGA 8CGTA 3WLPA 4C6JA 4S2BA 3HOJA 4I8DA 1OFOA 3OYZA 2XH7A 4JQ2A 4MNJA 1QNSA 4GGBA 4YMZA 3AHZA 4JIQA 4FX7A 4MADA 4AIEA 1E40A 4G7EB 3WL1A 2F2HA 2GQAA 2OLSA 4LUJA 2B0MA 5LNRA 4AZGA 3OIXA 3A3XA 1EX5A 4DO5A 3P8IA 1Y5WA 2QCDA 1TA3B 4B9YA 3E38A 1LLZA 3TR2A 1GZ1A 1ZSXA 3STFA 3AHYA 1NP2A 2EG6A 5D4YA 3DN5A 3UGRA 4NJKA 3VO0A 4IPNB 2A3LA 4PMYA 2YCIX 3KBSA 1UWAA 3LM3A 1V6WA 3W2LA 2VQTA 2OYMA 4IIEA 6TAAA 4FPSA 4BEQA 4YIWA 1SU5A 1OFQA 4JZ5A 4QITA 3EB3A 3TSBA 4DQWA 5DRCA 3TKFA 5A69A 1WUFA 3WF1A 1V3JA 1QATA 5HAOA 1XIEA 4S2CA 5JXQA 2G95A 2WMJA 3RO6A 1BTCA 1TTQA 3IS4A 2ZIDA 3WF4A 1ZBKA 5EMLA 2OZ8A 2ONEA 2PP1A 2ICSA 2QV5A 1YPXA 3P61A 1XIHA 1EIBA 2EPNA 1ICQA 4M6QA 2ISFA 2Y0FA 2YL5A 1CWYA 1UZ4A 5HMSA 4N7QA 4HPHA 1Y5VA 5GJMA 3QPEA 4LWWA 1KKRA 1RQEA 3B06A 1GQIA 2OSXA 2KAUC 2QKFA 1JL8A 5FEWA 4FB7A 3C8FA 4M24A 2OB3A 2BGQA 2QHAA 1ISXA 1EJXC 3NQMA 3T2PA 3A3HA 3PJUA 4MFEA 4MKNA 4GI9A 2EPOA 3OODA 3ARSA 3W76A 3QFWA 4AIUA 5FJTA 4LTSA 4AIBA 3AIBA 3DXIA 1LWHA 2YW3A 1C29A 4GI4A 4ZENA 3W74A 4M82A 3LCIA 5ABFB 2ISVA 3NYZA 1A4MA 1W54A 2YA0A 1BF6A 4BK9A 4QNWA 3BZGA 1SW3A 3WQ5A 2D0HA 4IGMA 4C6FA 1J0JA 3APGA 5FA5A 3GY1A 1CGTA 4IICA 3K1GA 4EK7A 1PX8A 3C56A 4I6VA 5M17A 5FJPA 4FALA 3R94A 4D6HA 1UUMA 4PB4A 4AD2A 3TXVA 4M1RA 2QZRA 3R6IA 1UIPA 4J2MA 5HMEA 2ESCA 4AC7C 1OF6A 3W26A 5ABHA 5JU6A 2YKKA 3PZGA 2BGSA 3KM8A 2AQOA 3Q4DA 2P8BA 3NTYA 1GYNA 5HR7A 3M0KA 3BWWA 4JAWA 1EL3A 3CQ0A 4F2TA 1MI3A 4AD3A 5DFAA 3R8HA 3W84A 1B9ZA 4O1BA 3DBPA 1EGVA 1E70M 1K7XA 5BMXA 3EKLA 1X6UA 1JCJA 4YHGA 4DJFD 2WHLA 2HVMA 3HIJA 1TPEA 4ORIA 2ATSA 3PWIA 1ME7A 1B3VA 1ONXA 1EUNA 1SO5A 3B03A 2GOUA 3IANA 3OLDA 1QUMA 5GNXA 1H3GA 1LL6A 1GVSA 3QGVA 4HNUA 2A6LA 1ZAJA 1UD5A 2E5DA 3TN6A 4G1KA 3KOWA 4REQB 4WDXA 3E0VA 3XINA 1NF0A 2VCAA 1JQVA 3GFZA 1XYFA 2WMFA 1MW2A 4QE4A 4Y9OA 3I3EA 1AMKA