2A7PA

Crystal structure of the g81a mutant of the active chimera of (s)-mandelate dehydrogenase in complex with its substrate 3-indolelactate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
353
structure length
353
Chain Sequence
NLFNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLGKMDKANLEMQAALMSRQMDASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (S)-Mandelate Dehydrogenase
publication title Structures of the G81A mutant form of the active chimera of (S)-mandelate dehydrogenase and its complex with two of its substrates.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 127
structure length 353
sequence length 353
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2005-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7pA00
3UY8A 3H53A 4PL1A 5D38A 4XQ6A 3P7YA 1A5BA 3D0CA 2WNZA 3P5YA 3M5XA 3RFAA 2ZZ7A 4YCPA 1TTIA 3EXTA 3P84A 5D04C 4O50A 2YW4A 3N9RA 4O1CA 1OX4A 3M5VA 1TREA 2DZXA 3IVTA 3NEVA 5EPDA 2X2GA 4WJEA 1VCFA 2ISVA 3LRKA 4N2YA 4AF0B 1U5JA 3NQGA 2P0OA 3CB8A 4BI6A 4BI7A 2FFCA 1QFEA 3B04A 3W07A 2CLEA 1W1ZA 2KZHA 1O4UA 1CI1A 2YR1A 3LTYA 4MY9A 1TJPA 1OK4A 3W1TA 2PRLA 2Y88A 5LKYA 1U83A 1WAUA 3TMQA 3W2UA 4DO4A 4FNPA 1EP2A 4UMCA 4WXZA 3NL5A 3KVKA 3CEPA 4ZQOA 2J9YA 1YADA 3R5EA 4ORMA 2DU2A 4OE7A 5CSSA 3QF0A 3NVTA 4K36A 1KFEA 2C18A 1P4CA 2DP3A 2ZCGA 2EAWA 3BG9A 3R12A 3ZFHA 4LVGA 3LHZA 3PB2A 3TKFA 3W7QA 3YPIA 3ZWTA 1JR1A 3CIXA 1UUOA 5J5RA 5HWJA 4O53A 1FWNA 1S5VA 5CGQA 1J5TA 3UWYA 4FX6M 3WK3A 3SI9A 3P8IA 3FJ6A 4JS3A 4LY8A 3KVMA 5HWNA 3C2EA 3UY7A 1B9BA 2VELA 3C3NA 1VHNA 1LRTA 1S5WA 1IF2A 2W79A 1DQXA 3RU6A 1SW7A 3FS2A 3TQ0A 3S1XA 1ICQA 1XI3A 1AW2A 2GPTA 1OFBA 4TIMA 1GEQA 1W37A 1H1ZA 5K9CA 4AB4A 1R2RA 4NZFA 1GPWA 4HN4A 3EWWA 1DHPA 3KHJA 3W83A 4CNPA 2RKXA 4RXFA 3IRDA 5FEXA 4R7JA 5F4WA 3QW4B 4AWSA 3TSMA 3HPXA 4PL2A 4O4WA 2C6QA 1Z41A 2QJHA 4O1AA 4UFMA 1EUAA 3ABQA 3LI1A 3O63A 2E5CA 3T4CA 4WUIA 2UV8G 3USBA 5C6MA 3QPYA 1EWEA 5EMUA 2CLIA 5CSRA 2H8ZA 3INPA 4BR1A 1Y0EA 4TO8A 3N14A 3TAOA 3C2FA 4LT9A 3R2GA 3CM4A 4I7UA 4HSNA 1FWTA 1QPNA 2ZTKA 3W71A 3TW6A 2NV1A 5D33A 1PIIA 2CZFA 2C3ZA 1NVMA 3HG3A 3OVQA 3DFOA 4X2RA 2Z0IA 3KRSA 1DJNA 3NZ1A 3L0GA 1RR2A 3TA6A 1JCXA 2V2DA 5KINA 4MJMA 1LYXA 3GAYA 1F5ZA 3O6YX 5K7JA 3UYCA 2A21A 5FEWA 1L2UA 1W5PA 1T99A 2FTPA 1XBVA 3LX9A 4XWUA 4JXCA 4UTLA 4NU7A 2R91A 3VCRA 3QH2A 2TSYA 1TPVA 4Z0JA 1FCUA 4FNRA 1DOSA 4XKYB 3TCEA 2DZSA 1N55A 4TMBA 2Y7GA 3OBKA 1D9EA 1SZEA 5KITA 5DBTA 3C2VA 1DORA 4AWTA 3LCHA 3MUXA 5AB3A 3G1YA 3M7WA 3PULA 3HO8A 3KVJA 1G7VA 3TDFA 1WOBA 4IWWA 5A8GA 3MI3A 4O52A 4UFHA 5F1VA 1IIHA 1G6CA 4A22A 3TJLA 4B5NA 3BG5A 5AOUA 3WFAA 4E2BA 5FI8A 3NQDA 4BF9A 4RKAA 5H91A 5FEPA 4UTWA 1KM4A 1YTEA 3W2KA 3RLUA 2A7RA 5F4SA 1ICPA 1JCMP 2BZNA 1W31A 4JTIA 4I7WA 2VOMA 2ZA2A 2YXGA 4GUIA 3CPRA 2VFHA 5MHBA 4MLJA 2QCDA 1GOXA 1Q6RA 1LOSA 1I2RA 4FHAA 4UTKA 4UTIA 3FYOA 2YGYA 1X1OA 4MIMA 2V2CA 3TFXA 2QCCA 3LHWA 4XTDA 3O16A 1GJPA 4IQLA 3H54A 2CLOA 1XL9A 1A5AA 1PHWA 3A24A 3ATYA 3ZWSA 3G0UA 1HO1A 3C0JA 5E1QA 4UUIA 1H51A 3A21A 2DZTA 3CLMA 2ABAA 3DENA 4IPIA 3A22A 5IM51 1TPFA 3DFPA 2Y62A 5I3KA 5DY2A 1C9DA 4Q4KA 1THFD 3KX6A 1UCWA 1OABA 1FCBA 1WDWA 1EB3A 4ADTA 5D37A 1LROA 3SGUA 1H61A 3PB0A 3SW6A 3M9YA 4E0CA 4M6QA 3AO0A 5BNKA 2Q3RA 1OG0A 4IX2A 2ISSA 4XUGA 2J88A 3TJXA 3PF3A 5C55A 1X1ZA 4LC6A 1TJRA 3R8RA 2NV2A 1VLIA 5CZTA 2RH9A 2ZQ0A 4M6VA 2GVGA 4R53A 4IMDA 1Q45A 1WV2A 1M6JA 4O28A 1XDLA 3GDMA 1RVGA 4WX2A 1P1XA 3LCXA 4HNVA 1KM0A 3F03K 2FDSA 4HNNA 3CQ0A 1KV8A 3M0ZA 4JYFA 3TAKA 1O95A 1KTNA 1TSIA 1TPEA 2F7FA 1F76A 4H3DA 3C6CA 3MP5A 4RR4A 1OF6A 3QSRA 5K3VA 2PE4A 3UZJA 1KFKA 1Q3NA 4LRTA 1TIMA 3LBMA 3DXIA 4NXSA 3FYPA 3P61A 2VEPA 4N9CA 3RMJA 5TIMA 3BVJA 4FNTA 2DORA 3O06A 3TW7A 5FF3A 2FQIA 1SW0A 4GFSA 4GUJA 1FQ0A 1OFPA 3S1UA 3TFCA 3IIOA 3LB0A 3G3MA 1TRDA 3MI2A 5CPMA 5DN1A 1FWSA 2YDAA 5AHMA 3BLIA 3SR7A 2I14A 3PVFA 3W7NA 4OHQA 4YL2A 3E0IA 1K7FA 2R8WA 2JGQA 3TMLA 5LNSA 4UIOA 2FIQA 3W1PA 4PH6A 1VHCA 4LUIA 4M7TA 1JUKA 4CNOA 1MO0A 4UCGA 3W1MA 2QAFA 2CW6A 3E12A 3TSBA 1XUZA 2FJKA 4ICNA 1YTKA 3R89A 3TXZA 3G0XA 5D09A 3PG8A 1QO5A 2FPVA 5LGZA 5EBUA 1TV8A 4Z1AA 3DFSA 6ALDA 1VH7A 3W7JA 3NQEA 4L4LA 4YXGA 2HMCA 4EF8A 4BWLC 3PC0A 1G4PA 1ZAIA 2DZVA 3T44A 2GQ9A 2HSAA 4AHOA 2V82A 1TV5A 2BSLA 3GAKA 2PRMA 4K8HA 2GVLA 3W22A 5AHFA 1H7OA 3U8GA 2R94A 5D2VA 1I4NA 1TMHA 1MZHA 5H2ZA 2JGYA 2QF7A 1AK5A 3DI1A 3CC1A 3NGJA 5AC8A 2ZRZA 3G3DA 4LNYA 4S1FA 2FPYA 4N9EA 1F74A 7TIMA 1QAPA 4HIBA 2FPTA 1AMKA 3NPWA 3I65A 3WJSA 1PE1A 1UJPA 2CLHA 4NT0A 4PA8A 4K7YA 5I3HA 3FEMA 1G69A 4A2SA 4DPQA 5C2XA 4O12A 1LLZA 2I1OA 4QAIA 3E02A 1H63A 1GWJA 1L9WA 3P74A 4NX0A 1KM5A 4O1BA 3QFEA 5DY3A 2NZLA 3O1NA 1TPC1 3CWNA 2RDTA 3OVRA 2OZ0A 3A23A 4ZQPA 3O07A 1ZCOA 2Z6IA 1OYAA 4GUGA 4U28A 1LLWA 5TBOA 4UNLA 2JKEA 3NQ7A 4I9AA 3NAVA 1BKSA 2C14A 3NL2A 1O94A 4MY8A 3LRLA 4IGHA 1JQVA 1K3UA 1FCQA 1N7KA 4ZQMA 5GVJA 3M16A 2ZA3A 2WNQA 1H7RA 1BWKA 5HUOA 3G1HA 4HPXA 3F4WA 4UR8A 2C1HA 2XFWA 3DGRA 3S8HA 3DU0A 3O6DA 3I7SA 1AW5A 1JVNA 1ZJIA 4UTTA 1DV7A 1GG1A 4HNUA 4RK8A 5IBXA 1PV8A 4NJHA 3EX6A 3G1VA 1R46A 1MEIA 3E96A 3QW3A 2VFIA 4PTNA 1RQHA 4POCA 1T0OA 4TMCA 1ADOA 2QCMA 4FO4A 3TC7A 4AHQA 3A5FA 3OHIA 5CG7A 3PSWA 3NA8A 4X9SA 4OBTA 3LHTA 2WSRA 4ADSA 1JUEA 3EX4A 3HG5A 3QEZA 3RF9A 1TPDA 4LS1A 4TR9A 1ZHAA 3WK2A 1DL3A 1LBLA 3OA3A 2HS6A 1GYNA 4UNKA 1TQXA 3BV4A 4GRSA 3UWUA 3VFLA 3MHFA 1ZNNA 4UTTC 4RV8A 1OF8A 3L66A 1I45A 3NO5A 1KLZA 2R14A 4N6EA 2G5WA 3LLFA 2H90A 3MYPA 2ZYFA 4O13A 3Q2DA 2NX1A 1KW1A 4JY9A 4JR5A 3W7DA 4MFDA 2YFNA 5KMYA 1KM2A 1YXDA 4FNUA 4TU1A 2QDGA 4S2BA 3IV3A 3W84A 5E93A 1SO5A 4AHPA 1DJQA 4FXRA 1OK6A 5CKSA 5CPLA 4A29A 2EGZA 3C8FA 1VLWA 1Z48A 2WO5A 4K39A 3KOFA 3ELFA 4MZ1A 5F4XA 3NXFA 1JCJA 4FF7A 3UWZA 1KFLA 3BK0A 3PSVA 1VZWA 4UMAA 1KBJA 4C1KA 1RPXA 5G5IA 1VCGA 1TPWA 1T96A 3W2MA 4OWGA 2C19A 5ABTA 4LVAA 3LBCA 4N02A 3NZRA 3B0PA 3W23A 3UD6A 3GZ3A 4YMZA 3TROA 2TPSA 2B7OA 4GC4A 4BFAA 3LDVA 2Z6JA 3HGOA 1P0NA 1R2TA 3M6YA 1EX5A 4J9JA 4DBEA 5T26A 1TCDA 2ZRUA 2E6AA 1TB3A 4CQ9A 2BWGA 3G8RA 2QCEA 1H7WA 1QPRA 1UBSA 4H6KA 4P2VA 3T55A 4QITA 2ALDA 3L67A 3HGSA 1OX4B 2XN0A 1JUBA 1W0MA 3MJYA 4U4MA 4QISA 4TX9A 1FCVA 3G1XA 4IMGA 2RDUA 3TR2A 2FB2A 2QCGA 1AW1A 1A5CA 1E51A 3MWAA 3DBPA 3GXTA 3BGGA 4Z1BA 1SQ7A 3P67A 3MW7A 4IXHA 1QOPA 2A1YA 2VEMA 4IMCA 1MEWA 1WBJA 2YX0A 4JICA 4DF1A 5I3FA 4FX7A 3P80A 1KTCA 4FIRA 4PCFA 4ZQCA 3IVUA 1ZAJA 2O7SA 3L21A 1SFLA 3NM3A 1IXQA 1UASA 1O5KA 2E5BA 4WZHA 6TIMA 4HPJA 4K7VA 1OX5A 3SFKA 2OX1A 3RLVA 1A53A 3EKLA 3LM7A 3MI6A 1OFEA 3CT7A 1ME7A 1YDOA 3M5ZA 5EL1A 1FXPA 3PUEA 3PM6A 3CWOX 1OFDA 1LOLA 1EUNA 3BLEA 4ZQNA 3G1FA 5I3GA 2AQWA 3LLDA 3TU9A 4QM1A 1NAL1 1FX6A 4LS0A 1JQXA 2VKZG 2X30A 2C13A 3VKJA 5FF7A 3LHYA 5D2YA 4JD4A 1TPH1 3S42A 4DBDA 3VE7A 1TTQA 3C61A 4N9DA 3B05A 2G95A 3GXPA 1Q6LA 3QM3A 4DPPA 1HUVA 2CFFA 1ME9A 1VRDA 2FLIA 4ORIA 1YPFA 4UFJA 3GR7A 2B4GA 3W3OA 5FEZA 5LNRA 2C0AA 5D2WA 3NOEA 1CW2A 1H1YA 3P82A 5D03A 3V75A 3PAJA 1F05A 2A6NA 1EIXA 1TTPA 5CZJA 1KFJA 1W3IA 4WY0F 3W7IA 5BRBA 5C54A 1HFBA 1M7PA 4NZJA 3K30A 1VYSX 3KVLA 2J27A 5K2ZA 1JCLA 4MPQA 3LXAA 4OV9A 3W2LA 4JDBA 1LRQA 4MYXA 2A2IA 2V0TA 3UWVA 4O0ZA 1GG0A 4NX5A 3GDLA 1SU5A 4IMFA 4ALDA 3W1RA 1O60A 1KFCA 1XC4A 4K8EA 2BXVA 4N4QA 4EIVA 1JRBA 3IIZA 4JYEA 1IXNA 4UTWC 4O0KA 1VCVA 4MZ8A 5EA9A 1TV7A 3A5VA 3NQ6A 1DBTA 3STFA 3G0SA 3E9AA 3W73A 1DKWA 2WSQA 5HR6A 1F73A 2PURA 4NVTA 4CQ8A 3I7RA 4EF9A 4LRSA 2X1RA 1OJXA 4NJGA 1YXCA 4AVFA 1FY6A 1W54A 3CEUA 2PRHA 1GYLA 3DFTA 5U4NA 1PS9A 2O7QA 4UTUA 4AWUA 3QRHA 4R34A 3LXBA 1VR6A 2TRSA 3EWZA 2VC6A 3HB9A 4UFLA 3NL6A 4ZQRA 2E1DA 3SIZA 2QJGA 2YZRA 1SUXA 4OGZA 1EPXA 2HTMA 5HQEA 2A7NA 1W5NA 3TK7A 2GOUA 1W56A 2DZPA 3IGSA 2A85A 3W9ZA 4LW7A 1IIGA 3TQKA 3STEA 2QCDB 4KFOA 4Z08A 3W7EA 3CTLA 1PVNA 1TYGA 1IGSA 1KM6A 3N34A 4KKXA 3W7RA 5AC7A 2E68A 3W7LA 1L6YA 4LVBA 3ABRA 1OYCA 4QQ3A 3LHVA 2CZDA 3GKFA 1I8JA 3GNDA 1ALDA 2ZRYA 3UWWA 1EEPA 1B3OA 4I7VA 4LV9A 4O8RA 1FDYA 4DELA 4O11A 4DXVA 3IGUA 1HL2A 3VNDA 2J9XA 4MFEA 2NXGA 3HQ1A 2V5BA 1RQEA 4MOZA 4OV4A 3LV6A 3I68A 5CZ0A 3EWUA 2ZZ3A 5K9DA 1KV5A 4O10A 4DO6A 3F1QA 3VE9A 4CNNA 3S6DA 3GVGA 4UFIA 3L65A 4LU0A 3VI2A 3MMTA 2AAMA 5G4EA 3G1SA 1B57A 3W1LA 4IPJA 1A50A 1NSJA 4JTJA 1RZMA 4K37A 1HG3A 1KA9F 1W5OA 3QYQA 3W75A 3OVPA 1I2NA 5CZSA 2GQAA 1OYBA 2QUTA 3NQVA 1EP1A 4Y6GA 2YYTA 1P5BA 1OFOA 2ATSA 4UR7A 4X3ZA 2A7PA 4Y90A 1HTIA 3OEXA 3ATZA 3OIXA 1C8VA 3UPBA 1WQ5A 4M6PA 3JR2A 4O4VA 4RJEA 3W86A 1RQBA 1SO6A 4UTHA 1XUUA 5BOOA 3W7OA 3GXNA 3TXVA 4YLWA 4GBUA 3GDTA 4IXXA 4GJ1A 2CZEA 3LRMA 2NLIA 3OG3A 3NR0A 3KXQA 1K7XA 4OT7A 4AAJA 2X16A 2YCEA 2BTMA 2OT0A 2GJNA 1X6UA 2X1UA 1N8FA 4Q32A 3BGJA 2V30A 3TV8A 3LCIA 3P62A 2A5HA 2VFFA 3IEBA 3PBWA 3WJZA 3W72A 3MHUA 5HUPA 3M1ZA 2NX9A 2NXIA 4QNWA 3TUUA 1VGAA 3NQ8A 3TQVA 1BEUA 3W1XA 3NQ2A 2CZ5A 4ADUA 4LV4A 1TRIA 4CCDA 2NX3A 3PBUA 1M7OA 1JCYA 3Q37A 5HWMA 3GIYA 2QAPA 3MBDA 3LCLA 5DELA 1YXYA 2WKJA 1QR7A 2WOQA 3O15A 3THQA 3W7CA 4WOZA 3W1AA 4DEFA 1P0KA 1ONRA 1SO4A 4MJZA 3QSTA 3N73A 2A4AA 1GVOA 5KZDA 2AGKA 5G4WA 1MEHA 2YW3A 4DQWA 1KTBA 2GUUA 2PC4A 4O17A 1K7EA 1OX6A 1VYRA 1TPB1 2V81A 1EWDA 3LGEA 4S2CA 1T8XA 2GQ8A 1Z44A 1W5MA 3WJXA 3EX1A 2RDWA 5DCBA 2JKPA 3MO7A 2D73A 3W1UA 4HSOA 3PY2A 3MYOA 4JTKA 5D02A 1QOQA 4Z0SA 3LI0A 3MHGA 1L6SA 3DFQA 3B0VC 4FEZA 1SZNA 5F2GA 3UNDA 1QPQA 3FFSA 1WXJA 4UXDA 2YYUA 3P5ZA 2B7NA 4JTGA 2Y7FA 3W7KA 4ZL1A 4MKNA 1XFBA 1SR9A 4LWWA 3S5OA 1TO3A 3AJXA 1AG1O 2W6RA 3FKKA 4R33A 1F6PA 3PBYA 5KTLA 3GKAA 4HKPA 5HULA 2ZRXA 2WJZA 3BARA 1F6KA 1SSDA 4H4IA 1HO4A 3BLFA 2H6RA 3RK8A 1H5YA 3NQFA 1IXOA 5HR7A 4Q33A 2ZRVA 3LCWA 5D2TA 1IXPA 5BMXA 2WSYA 3SSJA 4IX0A 3SY5A 1H62A 2LLEA 2CLLA 1YDNA 4JTEA 2EHHA 4N9BA 1G4SA 3ZR4A 3Q58A 2V5LA 2Y61A 4BI5A 3WJYA 3M47A 1MSSA 1QNVA 5K9XA 4RLIA 5IBXC 4L4MA 1NF0A 3DFNA 4KFPA 3SECA 2NWRA 5HMSA 3UQNA 2OJPA 1QMLA 3HG2A 3GYEA 4MYAA 3MP4A 1SPQA 2X1SA 3GX9A 4G1KA 4AEOA 2ZRWA 4O15A 5FF2A 3HGJA 1YYAA 3QMTA 1VS1A 2ZA1A 1OFAA 3IIPA 3I6RA 3RNDA 3W2JA 3HPZA 3HG4A 4A3UA 2Y63A 1JRCA 1ZALA 5DBUA 3ABSA 4RXGA 3L2IA 4YWIA 3NQMA 4ML9A 1H7XA 3NPUA 1NF7A 1FWWA 2ZZ1A 3QMSA 5HNRA 3UPWA 4GUFA 1A5SA 2QJIA 5EYWA 1JCNA 3O6CA 1FXQA 3T40A 4JTLA 4JTUA 1G7UA 1J4EA 4UMBA 1Q6QA 4ZMGA 2E77A 1X8FA 3B0UX 1RV8A 3LTSA 3QJAA 5DXXA 3W74A 3STCA 2QCHA 1SFJA 2W0UA 1YDVA 2Y7DA 4DF0A 4NNCA 3W85A 1H7PA 2V8ZA 1O5XA 3P8JA 4GE8A 3LCGA 4JDYA 4NJJA 3HGRA 3L0KA 3IIVA 1YLVA 3NG3A 4ONVA 4JTHA 1LDCA 3CIWA 3P81A 5C5YA 1I2PA 3ABOA 3EB2A 3EWBX 4JX6A 2E6DA 2QUVA 3C4UA 2ZZ4A 1ZFJA 3C52A 1GVSA 4JGDA 4K38A 1GZGA 3W7HA 5J5DA 2V2HA 3GDKA 3WK1A 3TX9A 4O18A 4UTJA 4MZYA 4XZ9A 1G4EA 4P61A 3IGXA 3BPWA 1L6WA 2BX7A 3GLCA 5G1TA 2Y70A 4Y8FA 1FDZA 4Y96A 1EA0A 3ANYA 5CPOA 3LTPA 2VFEA 4YCOA 3GNNA 3G1AA 2VXNA 3LOTA 1GTEA 4XKYA 4M7SA 4CCEA 2FB3A 2DZUA 4JX4A 4KWWA 1LOQA 1OFQA 3NPVA 4ZVJA 1NEYA 3FLUA 1K02A 1BWLA 3IVSA 3H55A 4JTSA 3HIJA 3NYZA 5E0KA 1QDSA 5CPNA 3NDOA 1NFBA 2GJLA 4NQ1A 2CLKA 2OT1A 2Y7EA 3S5NA 2J6XA 4O1DA 2Q8LA 3S0CA 3QQ1A 2QKFA 2YFOA 3NM1A 3A9IA 1WA3A 3UWQA 4X22A 1W8SA 3L9CA 4XTIA 3FIGA 3EKZA 3S9YA 1X7FA 2VFGA 2Z2UA 3PUOA 3HBLA 1I2OA 1WOAA 3L0NA 3W70A 2V9DA 2ZTJA 4MUZA 5LHFA 5G2IA 1FBAA 4BK9A 1W5QA 3BW3A 1KFBA 4K6AA 1LRNA 3FA5A 4LOCA 2CLMA 1DQWA 1GTHA 4MVAA 3THAA 1PCWA 2ISWA 3E49A 4EWND 4JN6A 4W9TA 3F4NA 4O19A 1SZGA 1B4KA 1UUMA 2ATMA 4KFNA 3O05A 3DZ1A 3ZS4A 1C29A 4FNSA 1YTDA 1K8YA 3DHFA 3Q94A 4M5PA 5HINA 2X1TA 5AHEA 1XBYA 1LBFA 5FESA 4HNTA 3G22A 2E09A 4CCCA 5TQLA 2ZBTA 5AYZA 3SZ8A 4O54A 2Q8ZA 5G2WA 4IMEA 1SW3A 1Q6OA 1LP6A 1FUYA 4NNBA 3BW2A 3M44A 3WK0A 1FDJA 4MY1A 1VPXA 1TPUA 1LM1A 4WQ6A 2OMAA 1AL8A 3UXAA 5LZLA 2NUXA 3PS7A 3S1VA 3W2NA 3NPXA 3HPSA 1QWGA 2DJLA 3QZEA 2H3DA 1KM3A 3KFTA 4JYDA 3KRUA 1H60A 3N9SA 4CQAA 2A0NA 1XDMA 3CU2A 3S1WA 3BO9A 5BW6A 1KM1A 4O14A 3JS3A 4Z1CA 3C2RA 3PR2A 3B4UA 1GVRA 3DH7A 1DVJA 4JEQA 3IIXA 5D30A 1ZAHA 4DO5A 4UC5A 2NXHA 2VENA 5D05A 4O16A 2JKAA 3I7QA 1MXSA 4LVFA 4FX8A 4QJ1A 4AH7A 5DCEA 5EY5A 1XKYA 1ML1A 4PFMA 2EKCA 2Y6ZA 2XN2A 1XBZA 3WJWA 3QMRA 3SGZA 1WBHA 3TNOA 3W1NA 2EF9A 3L5AA 4LC8A 5LHEA 3EWYA 2IQTA 5SWUA 4WD0A 4Y9AA 2OCZA 4RZ5A 5LSMA 1D3HA 2QCLA 3HOJA 1V5XA 1GT8A 1OFRA 4QNEA 1SZFA 3MBFA 2TMDA 1LZOA 2E5DA 3W7GA 4QIUA 1VC4A 5KZEA 2VEIA 2EPHA 3NQAA 1FWRA 4DF2A 3QQ0A 3HF3A 2DZWA 4WXYA 1XBXA 3TIMA 2ZDRA 4GWEA 1SSGA 3FOKA 2XN1A 1W3TA 4RX0A 2NUYA 3N3MA 5EKYA 2JBMA 4XBSA 3GDRA 1K8ZA 2JK2A 5LNUA 1ZY9A 3LERA 3EWXA 4GUHA 4D2JA 4NJIA 1QCWA 2G96A 4JIQA 5AFDA 3QPZA 5AHIA 4CLMA 4NNAA 1GVQA 4UTMA 4IUOA 1QPOA 3N2XA 1UB3A 1ICSA 5KZMA 2H3BA 5FF4A 3U2OA 3NNTA 3O8AA 1GQNA 4AXKA 1W3NA 2QCNA 2A6LA 2WPBA 1H50A 1K03A 4LS2A 3NL3A 1CX9A 2RHGA 2DJXA 1R2SA 3TE9A 1XM3A 5U7SA 1VQTA 4FNQA 4EOUA 3BG3A 4JTTA 4QSHA 2QR6A 3DKLA 3LCFA 5F2MA 3M43A 4A2RA 4A21A 3STGA 1PCKA 1R47A 3HMJG 1KLYA 1V7YA 3W76A 3BW4A 3DKJA 1I2QA 3LHUA 3TSDA 2YPIA 3PUDA 3LV5A 5AHNA 3PBVA 4PC8A 4IOTA 3PWAA 2WV8A 1RD5A 2VEKA 3TC6A 2F84A 2B7QA 2VFDA 5KSWA 3PG9A 4JX5A 5D32A 1M5WA 4BWLA 3DI0A 3KAOA 5AYXA 5F2IA 3B06A 1J2WA 5FF0A 3EX2A 2NUWA 5DLCA 3G24A 1SO3A 3W1QA 5LGXA 3GB6A 2P1FA 3MP3A 4LTSA 1D3GA 4M19A 1TQJA 1R30A 3QC3A 3T7VA 5I3JA 4RZ4A 1XCFA 1ME8A 1JULA 3S5ZA 1WYIA 1GVFA 5I3IA 4IJBA 1PL9A 1OVDA 5LNVA 3EEGA 2PCQA 3P60A 1LORA 4FXSA 2B7PA 2I9EA 3EX3A 4RZ6A 4AMAA 5BMWA 3C2OA 4JNMA 5LNWA 3EXSA 4PODA 2E6FA 3LXCA 2CU0A 1H7NA 3N2MA 2HS8A 5A5WA 2ZZ6A 3L68A 3M5YA 4E38A 1TTJA 4JTFA 1LBMA 2H8XA 3W7PA 1VJIA 1G4TA 2YSWA 1LTDA 4RCXA 3G1DA 3C56A 3W7MA 1AL7A 3U6WA 3NQCA 3UZ5A 4OQVA 2J9ZA 4E2DA 4LVDA 3G18A 1B4EA 3EXRA 1XXXA 2CLFA 4WOQA 3HJZA 3TH6A 1G67A 4WY0A 3DHDA 5DXYA 2QUUA 5G2HA 3GK0A 1F7BA 1LCOA 2G97A 3M41A 5HJLA 3GR8A 3SJ3A 3FKRA 4HHPA 3N19B 2BLEA 4N6FA 2ZZ5A 5AC6A 3W87A 4NXKA 2Y85A 2Z1BA 1OHLA 4ZZ9A 2CWNA 5F1UA 1K8XA 4O57A 8TIMA 1KBIA 5AN7A 4OU1A 4C1LA 2WQPA 2C16A 3T78A 4GNJA 4GXMA 1F2JA 2ZFAA 3UXDA 2Q3OA 2GVJA 2C15A 1Z42A 2QEZA 4N4PA 5AYYA 1BTMA 1JJKA 5K4ZA 4HT3A 4AF0A 2RFGA 2Y89A 3S5YA 3JRKA 1VYPX 3B8DA 1ZENA 4UFKA 5F2LA 1QO2A 2ABBA 4NUWA 2WNNA 1S3HA 4PEKA 4FIQA 4MLRA 1PHQA 4FB7A 5G1YA 5K4XA 4JY8A 4LUJA 2QCFA 4EVZA 4KWVA 3W6YA 3CHVA 2TYSA 3KRZA 1EP3A 2P10A 4JIPA 5D2XA 3DAQA 3FJLA 4Z1DA 2QDHA 5DCDA 3L5LA 2E6YA 3R13A 5AHLA 1YPIA 3G8EA 2NWSA 2J24A 4WY0B 2B0MA 4XBKA 3W88A 2ZZ2A 1S5TA 4NJKA 3L5MA 1WX0A 5L6UA 3B03A 3V1PA 5L9FA
chains in the Genus database with same CATH superfamily
4PL1A 1ZBVA 2YCKX 3KS6A 3P7YA 1GORA 4L9XA 3AIVA 2ZZ7A 4YCPA 1TTIA 3P84A 4MMWA 1LUCA 2YW4A 3CIVA 1OX4A 4O1CA 1RAKA 4G56A 3IANA 3IVTA 2BODX 2X2GA 3LEPA 4WJEA 3N6JA 2QV5A 4HA1A 2ISVA 1V3KA 3QR1A 2J66A 3FVDA 2V67A 4N2YA 3R43A 5FSEC 1O66A 3MCMA 4AU0A 3AAMA 3TN6A 3QOMA 1QFEA 4D6DA 2FGZA 1CI1A 1JAEA 3LSCA 2Y88A 2R1PA 1WAUA 3EOLA 3N15A 2QULA 3TMQA 4FNPA 1EP2A 4UMCA 2VNCA 1FWBC 1S2CA 2DU2A 3E0VA 1YX1A 3QF0A 4M80A 3WQFA 3QV8A 3P3BA 4NF7A 4K1GA 1KFEA 3OB8A 2ZCGA 4YWSA 4FF5A 1TE1A 1YRRA 2XG9A 1M41A 1RUSA 1BXNA 1XLHA 5HWJA 3TTOA 2GQ3A 4S3CA 4YTQA 1FWNA 3MANA 2V38A 3GE7A 1J5TA 3M0IA 3WK3A 1REQB 4YIWA 3R0DA 4JL2A 3C3NA 5C2GA 1LRTA 1S5WA 3PTDA 1ICQA 1AW2A 3ITGA 1J0IA 1C3FA 4TIMA 4MUPA 3ZMRA 4H9UA 4NZFA 2G50A 1E3ZA 3GSMA 3B9OA 1EYWA 1GCYA 1A80A 5DMYA 5F4WA 1T6MA 2AGTA 1RLDA 4PL2A 2CCRA 3BLPX 2QV4A 3HN3A 5E6ZA 3IUHA 3LI1A 2PGEA 3N2CA 4EPDC 2Z26A 2O9TA 1P7TB 1DIOA 1QVBA 2GWNA 4OZOA 4P8WA 4B92A 3VD7A 1MWOA 3T0AA 4W85A 4CD4A 1LWJA 4TO8A 3N14A 3TAOA 3VGHA 3C2FA 4M6UA 2VCCA 3P14A 3WUFA 1QPNA 4LCRA 3TYDA 4DN1A 1QJWA 2AAAA 5D33A 2C3ZA 3GXFA 3DFOA 2Z0IA 1RR2A 3UG8A 3LY0A 3TA6A 1JCXA 4MJMA 3XINA 3V5OA 2QHAA 5BOEA 3MUIA 5J04A 2NQLA 1T99A 2FTPA 2PP3A 4GQQA 1XYCA 2WM0A 2IXVA 4XWUA 1V03A 5IDIA 1G94A 4MAZA 4JCLA 4GVFA 3TCEA 2GGIA 4ZB2A 3OBKA 4IFKA 3C2VA 3KVJA 1Y65A 3E2RA 1G1YA 1WOBA 3PTQA 1TWWA 3BG5A 2VC7A 4I9MA 4BF9A 4YYFA 5IXEA 3L4UA 4UTWA 1YTEA 3VVGA 1ICPA 2CETA 3CV1A 4JTIA 3E5BA 4I7WA 2VOMA 2QT3A 3ARTA 1J0YA 3CPRA 4AZ5A 4MLJA 4DI8A 5ECUA 4X0NA 2ZE3A 1XYFA 2V2CA 2QCCA 4GHRA 4NAFA 2JF7A 3R11A 4XTDA 1QUMA 3A3HA 1PHWA 1U30A 3ATYA 3ZWSA 1V02A 4HU3A 5E1QA 4O0QA 3KLLA 3DFPA 2Y62A 3BV7A 1HQTA 2BVWA 1UCWA 2FZ9A 1OABA 1FCBA 1HP4A 3F2BA 1VPQA 4CEUC 1V0MA 3OP2A 1H61A 4X2PA 3SW6A 3M9YA 4JEJA 1AFSA 3A13A 1OG0A 4IX2A 2EPKX 4MGGA 3QKZA 3WNNA 5JIPA 3PF3A 4JZ5A 5C55A 2VL4A 3WNOA 4QLLA 3NYDA 3NJ3A 4M6VA 4R53A 4IMDA 1WV2A 4O28A 1E0UA 2Z1VA 1RVGA 2QDDA 3GC5A 3AHXA 1ONWA 1KM0A 4GYFA 3CQ0A 3EDFA 1BQGA 2VP8A 1TSIA 2PF0A 1B2YA 3P6LA 3HU7A 2TAAA 3RG6A 3UZJA 4IT1A 1E4IA 3PZNA 3IAQA 5TIMA 3BVJA 2DORA 1SFTA 2UY4A 2E40A 5FF3A 4GFSA 4P7QA 5FJIA 3GDBA 6REQB 2JEPA 1ZJAA 3IIOA 4JHMA 3MI2A 3WNMA 3K4WA 2XWDA 3H21A 1TUFA 2JGQA 4UIOA 2FIQA 1UWAA 4DNMA 4M7TA 3CL6A 1JUKA 3F2CA 3KL0A 2XSXA 3W1MA 4O8AA 1EJVC 5F7UA 4KGLA 1W3JA 3OO2A 4ICNA 1YTKA 5GNYA 3R89A 1GQKA 3NFUA 2VYOA 3WIJA 3PTMA 3PG8A 5EBUA 3W7JA 1GJUA 4KMQA 2HMCA 5HANA 3UR8A 4DWSD 4I5UA 3T44A 2GK1B 3OGSA 1IZCA 5AVNA 3CZGA 2NW0A 2AMXA 5D4YA 4U3AA 5AHFA 2F6XA 1EZ2A 8RUCA 1I4NA 1TMHA 1MFUA 2ZX9A 1AK5A 1RY0A 4F2TA 3CC1A 4FLSA 4Y9NA 2FPYA 1X96A 4L1GA 3VOHA 2FTWA 4HIBA 2ACRA 1PIFA 3BICA 1ZQ5A 3I65A 4UNIA 3UZXA 1VEPA 1LJYA 4PMJA 5C0QA 2WHMA 1I60A 3MB9A 4K7YA 3UFYA 5JBDA 4JFWA 2CC0A 3T08A 4CGTA 4B15A 4GBDA 2FYMA 4XSMA 1I1XA 1V6XA 2POZA 3GH4A 3LENA 4IG2A 4YVVA 3QFEA 1TPC1 3SCVA 3LA4A 2ZUWA 4H2CA 2RDTA 2EJ1A 3RM4A 2VTFA 2CHNA 4GUGA 1OINA 4A4AA 1V6UA 3NQ7A 4Z2IA 4XVDA 4MY8A 3GHTA 4IGHA 4E4UA 1W1A1 1FCQA 4IPLA 1IWAA 2WNQA 4GA8A 3G1HA 3OW1A 3F4WA 4HPXA 4US5D 3NQBA 1VFLA 3DGRA 2WKLA 3VIMA 3WO8A 1BQCA 1DV7A 1GG1A 4XAYA 3GG8A 1PV8A 1NWRA 3BAXA 4WKHA 1MEIA 2VFIA 2IQDA 2FHBA 3L4XA 5BYWA 3TYUA 4CN1A 1T0OA 4IJRA 1PTGA 2BFGA 1O68A 3BSHA 4FO4A 3A5FA 5HJXA 2BS9A 3DG6A 3OU8A 4OBTA 4AC1X 4DYJA 4TR9A 3WK2A 2VT0A 1LBLA 3UERA 3OA3A 1GYNA 1TQXA 3HZ3A 3VXGA 3CMJA 3L66A 3WLRA 3BWWA 1XIIA 1KLZA 5H8UA 1C92A 1LG2A 4ZSUA 4PEEA 4WJXA 2H90A 1F3WA 3B8WA 2NX1A 1LF1A 2PD5A 3W7DA 2YFNA 3WLPA 1TZ7A 1QXLA 1Q8JA 4AHPA 1DJQA 2QJNA 2WBGA 2XINA 4A29A 3I4EA 2Z4GA 3IS4A 1ODUA 2G41A 3LLXA 3T07A 1B3YA 3ELFA 3OTRA 4MZ1A 1JCJA 4C6DA 4JFUA 3ITCA 3VIJA 3G77A 4UMAA 4C1KA 3CUGA 5JXQA 5CCZA 1VIWA 1TPWA 3CUIA 4OWGA 2C19A 4XD6A 3LBCA 2BVYA 1EOKA 3N04A 5ABEA 2HZGA 3W23A 3EGJA 3EWDA 1V6VA 2V5KA 3TROA 2TPSA 4V28A 2D2GA 1UH3A 1SFSA 1P0NA 1XRVA 4CN6A 3SN0A 1JPMA 4J9JA 4DBEA 3R6IA 5T26A 1P6WA 2BWGA 4ZENA 4AD0A 1A5LC 2BDQA 3PZQA 4KRZA 1QPRA 1UBSA 4Q7NA 3T55A 3V5FA 5EMJA 3VCNA 1XWYA 3MJYA 3WEOA 2BOGX 4QISA 1FCVA 4QDMA 4INFA 4FMVA 3VDGA 2BHYA 2FB2A 3WLNA 1AW1A 1A5CA 1E51A 4C5ZA 2HBVA 3SRKA 2QDEA 3BGGA 3AWNA 1FH7A 2VEMA 4IMCA 1MEWA 1HXJA 3L21A 1KCLA 1SFLA 1EGZA 1U22A 1IXQA 3VOJA 2MNRA 5HMDA 3MJMA 4X60A 4FLOA 3SFKA 3EKLA 5IHRA 3AZSA 1OFEA 3U3HA 1M3UA 1ME7A 2HRWA 3PUEA 3AHYA 3W82A 1OFDA 3W38A 3G1FA 5I3GA 2AQWA 1A5UA 1GW9A 3IJLA 4QM1A 5AY7A 1WUEA 1UW9A 3A4XA 4FXFA 3VCCA 1JFHA 3P2VA 1JCTA 3S3GA 4OOZA 3TN5A 4DWSC 3UPMA 1EA9C 1ZS2A 3ZXWA 3U5YA 3GTNA 3C61A 4JKKA 2DW6A 2G95A 3GXPA 1Q6LA 5H8MA 2RGLA 1FTXA 1EYEA 2FLIA 4ORIA 1BSIA 4UFJA 4LFYA 3CNYA 1H1YA 4H9TA 5D03A 3IUDA 2OQLA 2NQ5A 1F05A 2A6NA 3EOEA 4D72A 1EIXA 1TTPA 5C54A 4GX8A 2ZWYA 4DY1A 4NZJA 4DZIA 1SM9A 3KVLA 5E9AA 3HV8A 5A6KA 3WLKX 1NDZA 3PZIA 3LXAA 3ZVHB 4OV9A 2AL2A 5HPCA 1VKFA 3OVGA 1XIJA 2PDJA 1TA3B 4NAEA 1Z89A 4OECA 2V0TA 5PTDA 3UWVA 1CGXA 4RV3A 2D23A 1GG0A 4NX5A 4ALDA 4M29A 2PDIA 3N9KA 4NASA 1XPYA 1JRBA 3K13A 2V5JA 2D2OA 1TV7A 4HK5A 4HPHA 3STFA 5HR6A 2F6KA 2C8NA 1OJXA 2XVNA 3G6MA 1YXCA 4HA3A 1YNQA 4UTUA 4U5IA 4HJFA 1JI2A 3OQEA 2J79A 2W66A 2VGBA 2GDQA 3NL6A 4ZQRA 3SIZA 1UWUA 2X2YA 4CEXC 2HTMA 2UBPC 1ITCA 3GVVA 3TYZA 3TK7A 3GFYA 2WQDA 3W9ZA 3AALA 5T91A 2OU4A 2ZUVA 3UR7A 4NAEB 1H0GA 4J3VA 2D0HA 2GGGA 3CTLA 4GD0A 5A6JA 2E68A 4W7WA 4B4HA 4LVBA 4FALA 4MWAE 3NIYA 4Q7BA 4D1IA 2IKGA 3CHFA 3SUWA 3RYSA 5A8PA 1EEPA 3II1A 1B3OA 3CAKA 2YA2A 4I7VA 4LV9A 3GH7A 3IPWA 1NWUA 1XD0A 3IGUA 1HL2A 1WO2A 4ZO6A 2NXGA 1Y8BA 3KBMA 3HPAA 1RQEA 4MOZA 3TTYA 4OV4A 3A4WA 3EWUA 4XUYA 4CNNA 5AYBA 3KBWA 3GVGA 4UOQA 1V0NA 2WAGA 2D0GA 3RCYA 2GLKA 4F66A 1RZMA 1W5OA 3OVPA 4CKQA 1TV3A 1EP1A 2PDQA 2ATSA 2A7PA 2C91A 3IK4A 4FI4A 4Y90A 3ZOAA 3TYAA 3W02A 1CB7B 4O4VA 3W86A 1SO6A 5BOOA 3KCJA 3W7OA 4YLWA 3LK6A 4GBUA 2FMOA 5DMMA 4WLCA 5H1WA 3OG3A 4PUEA 3CZKA 2W27A 3KXQA 5E0FA 4OT7A 1UOZA 1U33A 3BLLA 4J3ZA 4AAJA 2YCEA 3T1GA 2OT0A 3R0UA 3RX2A 2PU0A 4MDPA 5B7ZA 2XUCA 5FJRA 3P62A 1XS2A 1DIKA 3A4AA 2R1KA 2A5HA 3RJYA 1CGUA 2PODA 2VFFA 3IEBA 3NTYA 1JXJA 4FOKA 3NOYA 3EYPA 3W72A 5HUPA 4QNWA 4HB7A 3RO6A 2JIEA 4LV4A 4QE1A 1TRIA 2XIJA 4CCDA 2NX3A 3PBUA 3NZGA 1A0CA 1XX1A 3RGTA 1JCYA 5HWMA 2QAPA 3MBDA 1V7AA 4DXKA 3WNKA 2FVKA 4P5UA 4ZO8A 4AY1A 4LEFA 1SO4A 3VAVA 1YKWA 4GH1A 3QTGA 3QSTA 1PBGA 4QG8A 2A4AA 1GVOA 4ZXLA 1V3HA 2PWFA 1MEHA 4DQWA 1KTBA 1FWCC 3WQWA 3CGTA 4NI8A 4Q8QA 4XZHA 1T8XA 3VO0A 4LALA 3PBMA 3ARQA 3N4AA 3U4AA 3SJNA 3EX1A 1XW8A 2RDWA 4RE2A 2JKPA 4L1XA 2O0TA 3MYOA 3E3HA 2VWTA 3D6NA 4B3LA 1G01A 3B0VC 1JD7A 3KEHA 4AZGA 4HU8A 4P7LA 3FFSA 3P5ZA 2Y7FA 1LQ0A 4MKNA 2P50A 4J3WA 1TO3A 1XKJA 2W6RA 3PBYA 3GKAA 5HULA 2WJZA 3BARA 1F6KA 5DX7A 2XH0A 1A5MC 1HO4A 1Q6EA 4DWDA 2DSKA 1H5YA 1FA2A 4AWEA 5JH1A 2WSPA 2Y0FA 4IX0A 4IGNA 3SY5A 4PE8A 3CYJA 1IQ8A 1JFXA 4LF2A 4BI5A 5IBXC 4L4MA 3DGBA 5A8OA 3GD6A 3DFNA 1GQIA 1QTWA 2NLYA 1VBGA 2PLKA 3HG2A 4MYAA 3MP4A 1SPQA 3VZZA 3GX9A 4O15A 2X7WA 5FL0A 1XYMA 2BXZA 3AXMA 4J27A 3CUFA 2WANA 3F5JA 1OG6A 4WSHA 5DBUA 3ABSA 1XF0A 2QLYA 3L2IA 4ML9A 1H7XA 1NF7A 2GDVA 1MVYA 1UH2A 2VGGA 3EOOA 2QJIA 3HJEA 4JQ1A 2VEGA 4DLMA 1Q2SA 2KAUC 4UMBA 1G7UA 3RLGA 3GTIA 1Q6QA 4N7QA 1UR2A 1TFVA 3NDZA 3ITYA 5C9WA 4IFOA 1PKLA 4AIEA 4C6CA 5ABFA 1C8YA 4NNCA 1AJZA 2R6OA 3LGGA 4GE8A 4AYSA 3PFMA 5BU9A 3HGRA 3IIVA 3N3TA 4ONVA 4GI4A 7TAAA 2PWEA 3CIWA 5C5YA 4YHGA 2DPEA 3VUSA 3EWBX 2V3DA 3F7JA 2PBGA 3QFWA 4HP5A 3SUVA 4HU0A 1ZFJA 4PRWA 4DYKA 4YS1A 4JGDA 3W7HA 3KS5A 2V2HA 1QNSA 3WK1A 1CLKA 4MZYA 4C6EA 3BLOA 1G4EA 3IJ7A 3BPWA 3BZGA 3GLCA 1QI2A 3MSDA 1FDZA 3ANYA 5CPOA 1OD8A 3AHTA 3LTPA 2VFEA 3GNNA 4JIRA 4H9MA 3LOTA 2CBIA 1GTEA 3H4WA 2FB3A 5A6SA 3NPVA 4ZVJA 1NEYA 1KRCC 4HSHA 2YXXA 4EACA 3UF9A 1OBAA 1P1MA 3BAIA 2O9RA 4IM4A 2BASA 3DN5A 3NDOA 1NFBA 4U3CA 1KCKA 1HJUA 2CLKA 2J6XA 4O1DA 1NOUA 4ACZB 3K4DA 4ATDA 2UWFA 1QATA 1DE5A 2BOFX 2Q6ZA 2EO7A 2V63A 4XTIA 3FIGA 1UG6A 3CO8A 3EKZA 3N25A 3OQ8A 2ZUNA 3B8SA 3S9YA 1QW7A 3DC0A 1U1UA 1Q63A 3PUOA 2GJXA 1WOAA 5HATA 2P8CA 4U2YA 1ZBCA 2J77A 3GHRA 3MUY1 4MUZA 3BQ5A 4BK9A 1J6PA 3ID7A 3BW3A 2YLLA 3ZT5A 1X1NA 2VDIA 1DQWA 3ANUA 3I3BA 2INFA 1O1HA 2WZIA 3BC9A 1B3XA 1UUMA 1B4KA 2ATMA 2BMBA 3M0XA 5LXEA 4FNSA 1YTDA 4JCMA 2F2HA 3Q94A 4KWUA 4M5PA 3VGBA 1UD3A 3G22A 4I90A 5XINA 5H6HA 1XG4A 3SZ8A 4LAKA 4O54A 2Q8ZA 1Q6OA 3KZPA 5A6AA 1FDJA 1VPXA 1Z3NA 2OMAA 1AL8A 3UCDA 5LZLA 3JZUA 3W2NA 3S1VA 1IEVA 3CHEA 4S3KA 3HPSA 1JD9A 1V3IA 2DJLA 2H3DA 3K4AA 1CNVA 5I02A 3KFTA 3EPOA 1GJWA 4GI9A 5LYRA 1LG1A 3N9SA 4CQAA 3O0FA 4XZBA 3CU2A 2INEA 1C8XA 4O14A 4Z1CA 3WLJA 3PR2A 4DJED 4P8UA 3N29A 4JEQA 1XRSA 3B9AA 1KR0A 3H4GA 2DGAA 3GYCA 2NXHA 5TD4A 3AFBA 5D05A 3WYZA 5H8PA 2WVVA 2JKAA 1VJZA 1HKIA 5CAKA 3QHOA 3W0KA 2X09A 5DCEA 1KRBC 4KCVA 1ML1A 3QBUA 3T9PA 2XN2A 4IZGA 3WJWA 3QMRA 3M0YA 2EF9A 4LC8A 5SWUA 2DSUA 1D3HA 3HOJA 1XCXA 4E8CA 5ECVA 1SZFA 1UPPA 3MBFA 5BXTA 3K1GA 1VC4A 5KZEA 1K70A 2EPHA 1YBQB 1OEPA 3QQ0A 3HF3A 4WXYA 1YNYA 2Z1WA 1KWGA 1SSGA 1W3TA 1CPUA 4JL1A 1H1NA 4RW3A 5EKYA 2JBMA 1PTDA 3GDRA 4REQA 1R8LA 2YDSA 4D2JA 4H04A 1OIMA 1UKOA 4TOQA 2WHKA 3UG4A 4HU4A 5AHIA 4NNAA 3WN6A 2BY1A 5LIWX 1CIUA 1OT1A 3KOWA 3GIPA 3GVQA 1D2KA 3TZFA 1W1IE 4B5UA 4QJ4B 3O8AA 1XD1A 1GQNA 2YL5A 3H26A 4L6HA 4RPPA 4KW2A 2WPBA 4V1XA 1K03A 2E25A 4KH2A 1CX9A 2VX7A 1XM3A 5U7SA 3VNLA 1VQTA 1C90A 4DAIA 2QR6A 5XIMA 5F2MA 3LCFA 3M43A 3BZJA 4HD5A 1EDTA 3BW4A 4FLQA 4GVIA 2J75A 3TSDA 2YPIA 5DMNA 3TC6A 1DHKA 2VEKA 1U2YA 3TYCA 3BMXA 4OBSA 3AOFA 4M1RA 1IE7C 1J2WA 5FF0A 3EX2A 3CV2A 3G24A 2P1FA 3WEZA 1D3GA 4D8ZA 1UUQA 4JAWA 4GGHA 4YN5A 5I3JA 4RZ4A 3SRDA 5BWAA 1J9YA 1ME8A 5C7HA 4S3FA 2J8GA 2CLPA 1A5OC 4H7ZA 3S5ZA 3VIKA 1EF2A 1OVDA 1XIHA 3RRXA 4MJ4A 3UXLA 3P60A 1AQ0A 2I5IA 1CGTA 4L1WA 2B7PA 3A6OA 1WB0A 3EX3A 4ZFMA 3VIIA 5GJPA 4PODA 1NP0A 3DUGA 2VQUA 3ITTA 1VD6A 2OKOA 1E0TA 1J0KA 1H7NA 1UPMB 1QRQA 1XFCA 3IGHX 3KL3A 2VR4A 3L68A 1TTJA 4O1FA 1G4TA 1LTDA 1E5NA 3W7MA 2JIWA 3OIHA 3U6WA 3UZ5A 4HYWA 2DUZA 2WM1A 2J9ZA 1C7SA 6XIAA 3AISA 5A1AA 2VZOA 3G18A 3CO4A 3UW6A 4LAZA 1G67A 4WY0A 2GGHA 2FZDA 1GW1A 3M41A 2G97A 3CAQA 2GJPA 3GQYA 4IQEA 3RO8A 5I24A 5HJLA 3GR8A 3SJ3A 4HHPA 2XYLA 3VM5A 1JPKA 1B90A 1M53A 2BLEA 2ZZ5A 5AC6A 3L4ZA 2Z24A 3SSZA 5E09A 5FJPA 2Z1BA 3LGDA 5FJJA 2VX6A 1JGIA 4IF2A 4O57A 1AODA 8TIMA 3BOXA 2YB4A 3T09A 3MKCA 5JBFA 1BRLB 1HKKA 1B0IA 5D8WA 5AYYA 1O6IA 1DWGM 1JJKA 4WDTA 4AF0A 2QIIA 3S5YA 2HISA 1ZENA 2ABBA 1PHQA 1O5QA 1XLAA 4NG3A 4LUJA 1GZ1A 2Z25A 4KWVA 1R9XA 3KOZA 3WELA 4HN8A 3R94A 3M7SA 2FHCA 1PIGA 3SBFA 3L2MA 3DAQA 4R7OA 3EDJA 3IJIA 3ZO9A 3XIMA 1V3JA 4WY0B 4KETA 2RAGA 1F3XA 4IP7A 1S5TA 1GOKA 3B03A 3B8TA 3N11A 2W4XA 3OLEA 1OGSA 3GRIA 4BS0A 4HHHA 3UY8A 5JBEA 3H53A 5D38A 4XQ6A 1A5BA 3PK7A 3D0CA 2JFEX 2WNZA 3RFAA 4DJEC 1B1YA 1V51A 3GTXA 2DY3A 3N9RA 2KX9A 4L9ZA 3M5VA 1BVWA 3DDMA 1MNSA 5I79A 3WUGA 4AZCA 4CNTA 3GXMA 2ZDSA 4AF0B 4HMCA 3NQGA 4BI7A 3MY9A 2I5GA 2FFCA 2CLEA 2QJJA 4QXIA 1O4UA 3LTYA 3D46A 1S2WA 4MY9A 4MB3A 1OK4A 2PRLA 1U83A 3DYPA 3W2UA 3WLMA 4ZQOA 1FWHC 2J9YA 1BGAA 1EJWC 4ORMA 1NWTA 2XPKA 2ZXQA 1VF8A 4BHYA 1R85A 4OTKA 1UR1A 3BG9A 3R12A 4NI3A 1J5SA 3TKFA 1W9PA 1E6QM 3ISIX 3YPIA 5E5CA 3ZWTA 2Q71A 4UOJA 5J5RA 1NOWA 1Z8AA 5M3WA 4O53A 2HPIA 3OBEA 4EKJA 1IEQA 3RCNA 3SI9A 4HOXA 3P8IA 3FJ6A 4DIAA 4GO8A 4W8LA 1B9BA 3LUTA 2IKJA 1VHNA 3LZ5A 4FP1A 1IF2A 1QHZA 4PCSA 2W79A 1DQXA 3RU6A 3SURA 3AXXA 3FS2A 4HNLA 4C1NA 1EHAA 5K9CA 1R2RA 4D71A 4LUTA 3EWWA 5REQA 4GYPC 1DHPA 1RY8A 3ONCA 3W83A 2OO6A 1BGGA 1Z9AA 2XU2A 5LA1A 1PYMA 4ASTA 3BURA 4AWSA 4O4WA 1E1EA 1Z41A 4UFMA 1ITUA 1ZSXA 2OTDA 1MW2A 3QPYA 1EWEA 5CSRA 4DWSA 5AC5A 3E0WA 4EAYA 3INPA 4Q6JA 1Y0EA 3BSGA 1HT6A 3U57A 2CYGA 3HM7A 4F0KA 4LYKA 4I7UA 1FWTA 2ZTKA 2HPMA 1K8CA 3TW6A 4MAVA 2CZFA 1GONA 2HVOA 3HG3A 3KRSA 3MZ2A 3S1GA 1XYBA 1JPHA 3L0GA 3GAYA 1F5ZA 2PDMA 4ATLA 5K7JA 3UYCA 9XIAA 3AMDA 4ATWA 3ARRA 3AS1A 3LX9A 4Z2KA 3VCRA 3C3UA 3IJ8A 4Z0JA 4WVXA 2XIQA 4FOUA 1Q4WA 1SMDA 1NARA 4J2PA 1N55A 3TOPA 4TMBA 5FL1A 1D9EA 1SZEA 3WBYA 3LCHA 2FKPA 3M7WA 3HO8A 3FW6A 3MI3A 1PKNA 3WBXA 3TJLA 4NRSA 2IMRA 5H91A 4HZMA 3B4YA 1W3KA 2A7RA 5XIAA 4US5A 4M81A 4H6RA 3THCA 1W31A 2YXGA 1UC5A 4ZO9A 1K9TA 4XX6A 1GOIA 9RUBA 3R25A 2PWDA 2WSKA 6TAAA 4UTIA 3FYOA 1A0DA 1X1OA 4MIMA 2EPOA 4LAMA 1JI1A 1AD4A 3LHWA 3JW7A 3G0UA 4CU6A 3C0JA 3A21A 1GKQA 3DENA 5IM51 3OGVA 1D7FA 2FZNA 1RBOB 1C9DA 4Q4KA 4A3RA 1BG9A 2CHRA 3TZNA 2NVCA 3NURA 1EB3A 1F07A 4WCJA 1LROA 5M1TA 3SGUA 3L2LA 2E7FA 2NSOA 2YCJA 4E0CA 5BNKA 4B3KA 1UA3A 2ZVIA 2E0PA 1MUCA 2ISSA 2J74A 4LGXA 1AQFA 3TJXA 3RU8X 1X1ZA 1XLBA 3UG5A 4D8AA 1UBPC 1TJ2A 2GSJA 4D6IA 3EEZA 3R8RA 3T2PA 2NV2A 3IK2A 2RH9A 1AH0A 1YE4A 3FAWA 4RDYA 3H22A 4D6FA 3VKAA 1UHVA 4NIRA 4XAFA 3H7VA 5J8LA 3H23A 2FDSA 4RW5A 4HNNA 5CC5A 2OLSA 3C5QA 4JYFA 2P76A 3VDHA 2F7FA 3T6CA 2V5DA 4H3DA 4HTYA 1OF6A 3QSRA 5K3VA 4Q4SA 3FDKA 1KFKA 1Q3NA 4L6DA 4C6QA 1TIMA 1V79A 4NXSA 3FYPA 4WDWA 2Z1XA 4FNTA 3O06A 2BOEX 1V0KA 1BG4A 4IL0A 3AS3A 3GHSA 3OZPA 3H2AA 1OFPA 3TFCA 2Y2WA 2VI0A 3LD5A 4F3HA 2YDAA 5AHMA 1Y5VA 1ZP3A 1J18A 2I14A 3LN3A 3BAWA 3UWEA 2G8ZA 4OVXA 2I16A 2R8WA 2I9UA 1VHCA 4LUIA 2A3AA 4L56A 2GGEA 2ZADA 2QAFA 4BZYA 1PAMA 2CW6A 1FHUA 1XUZA 3S5SA 3RN6A 1Q6CA 1XH1A 3QVQA 4C6BA 1E9LA 1QO5A 3V18A 5LGZA 2XIMA 3PJXA 2I56A 1Q5MA 2BGSA 5A6BD 4JFTA 1HN1A 3PC0A 3UXIA 1XLGA 1ZAIA 2DZVA 2CERA 3WF4A 2HSAA 4AHOA 2V82A 4HNOA 1TV5A 2GVLA 5MKGB 3U8GA 2AMGA 4LX4A 2R94A 1IR2A 5DO8A 1I1WA 2RGMA 2JGYA 1H11A 1DEDA 3DI1A 3RRAA 4KS0A 3G3DA 1PX4A 1QAPA 1R86A 3GUGA 3TN4A 3RM9A 3AS0A 1UJPA 3WQ8A 4NT0A 4PA8A 2QUMA 1S5MA 3FEMA 2RUSA 1EH9A 1IGWA 4AZ7A 4BA0A 4O12A 3R1ZA 1LLZA 4BF7A 1LLOA 1WKDA 3P74A 2YXOA 4NP7A 5CPSA 4NX0A 3SCOA 1O7AA 1QW9A 4OUIA 4TVUA 1GVEA 3S6TA 2NZLA 2FGLA 3O1NA 1M03A 4GMEA 2OZ0A 1F8MA 4PBFA 1OYAA 4ZE5A 4EPEC 4L65A 3W37A 3NAVA 1K6WA 1BKSA 2C14A 3NL2A 1O94A 3LRLA 1US2A 4ZO7A 1N7KA 5GVJA 4BQ2A 1XICA 1VBHA 4MHBA 3WDPP 4IL2A 4A05A 2C1HA 3VOIA 3DU0A 3O3RA 3O6DA 3I7SA 1AW5A 3KWSA 1ZJIA 4CD5A 5IBXA 4NJHA 1TE6A 3EX6A 3G1VA 1RJRA 4PTNA 5ABHA 3UGVA 2PI6A 4C6LA 1K6AA 2ZX5A 4TMCA 1ADOA 2QCMA 2WZTA 4UZUA 3VOFA 3OHIA 5CG7A 3WH7A 2ACQA 3PSWA 2NVAA 2YLAA 2E3ZA 3RHGA 3LHTA 3VIGA 2WSRA 3DESA 3QEZA 3RF9A 1TPDA 3A3WA 3TWBA 1ZHAA 1DL3A 1J93A 3DHUA 2HS6A 4UNKA 3QHNA 2PWUA 1OM0A 1XIGA 4MJ2A 3AUJA 1Q6DA 1V02E 3PZOA 3MHFA 4RV8A 3MU7A 1I45A 4H6EA 1H3GA 1QT1A 2J7DA 4N6EA 2G5WA 1GKPA 1QNQA 2VDGA 1PXGA 4XIMA 4O13A 3WH6A 3Q2DA 1KW1A 1VFMA 4L4OA 4JY9A 4JR5A 4LAUA 4CD6A 5KMYA 1KM2A 2R1NA 4RUBA 2NT0A 4FXRA 3GBDA 2EGZA 1EBHA 4J7RA 5A8NA 3KOFA 5F4XA 3WMBA 2XFYA 3NXFA 5DQPA 3A12A 4TTGA 1KFLA 1VZWA 4AVNA 1XQKA 3N12A 5G5IA 4DBSA 1C9WA 3WUEA 3W2MA 2X05A 1V3LA 4IMAA 4M0XA 1S2TA 1C7TA 1L0PA 4PRRA 4DJDD 3NZRA 3W4RA 2DQXA 3TLLA 3ZR5A 1EGVA 1HJWA 2Z2BA 3GZ3A 3TJ4A 3LDVA 2Z6JA 4JNYA 4RDWA 1R2TA 1HL8A 4LPCA 3BCFA 3WEMA 3USZA 2E6AA 3PPCA 3SO7A 4GI8A 3T8QA 4BF5A 1UR9A 1PKMA 4N42A 4P7RA 3FHAA 2ALDA 1WDRA 3REQB 4GQRA 1W0MA 4AEEA 2BGQA 1IR1A 1E0VA 4QDPA 2J25A 4U4MA 2ZIDA 1JZ7A 1WE5A 4IMGA 1E71M 2QGYA 2FMNA 2RDUA 1BF6A 2QCGA 4C65A 3MWAA 4FOJA 3DBPA 1XR2A 1XCWA 1SQ7A 2D0FA 1MDRA 3MW7A 2A1YA 1NTHA 3WQCA 2YX0A 4F0RA 2W3ZA 3P80A 1KTCA 4FIRA 4ZQCA 1ZAJA 2O7SA 1R7AA 1UASA 3KW3A 3UVAA 4D8LA 4G7FA 1BKHA 1A53A 3LM7A 2WMIA 2DUXA 3V16A 3CT7A 4MM1A 3QV7A 1C93A 4D6GA 5EL1A 1H2JA 1BAGA 2VD8A 3NGFA 5FAJA 1AH4A 1I9CB 1TV4A 3VKCA 2IPFA 3LLDA 3CAVA 2OELA 1Z7AA 1NAL1 3KZSA 4PTVA 3WNPA 1JQXA 3SCTA 2VKZG 4GPNA 5FF7A 2VCAA 2YZ5A 1C8QA 2DUAA 1ZLPA 8XIAA 3NDYA 4WK9A 4DBDA 4W7VA 1BSLA 3ZLHA 1TTQA 3DC8A 1XINA 4N9DA 5JQ9A 5A2BA 3I6EA 2G4FA 4IFRA 1UR4A 1P6BA 3QM3A 1J0ZA 3EAUA 1XQLA 1TWSA 2CFFA 1ME9A 2DH3A 1EDQA 2HXUA 2VZVA 3KHDA 4JIEA 3W3OA 5I77A 5FEZA 6A3HA 2C0AA 5LNRA 3K8MA 3NOEA 3VM7A 1KGWA 4J2MA 3P82A 3W6LA 3VZXA 5CZJA 1EEXA 1KFJA 3BAJA 1W3IA 3EOUA 4WY0F 3W7IA 1GPFA 3N4EA 3BCJA 1M7PA 1UD8A 1HIZA 3WNLA 2OG9A 5K2ZA 2D2HA 1JCLA 2WBKA 1U1JA 2X0HA 2Q02A 4YVXA 4MB4A 4G8TA 4JDBA 3WDJA 2A2IA 2AOSA 1ADSA 1HKWA 3UT0A 3WQ6A 3GDLA 3VKBA 3HA1A 3GWQA 4IMFA 3G5EA 2EXOA 4PUJA 6ENLA 3IIZA 3VZYA 4O0KA 4MZ8A 5EA9A 2JALA 4L64A 4E5TA 3TTQA 1DBTA 2UY3A 3WG6A 5CPTA 1OSEA 2PURA 1Y5XA 1BF2A 5FJOA 4PULA 3A3XA 4NJGA 4K3ZA 4OJYA 1FY6A 1W54A 1GYLA 1P6CA 5U4NA 1PS9A 1RHCA 4E2VA 1NELA 4Z2LA 3E5PA 3QRHA 4R34A 4MB5A 2BY2A 3B0YA 3PTKA 1JG9A 4HYRA 3HB9A 1VFOA 3QZAA 3BUVA 2YZRA 5HQEA 4TV6A 1MRAA 1W56A 3T2QA 3COTA 4LW7A 1EC7A 1W3HA 5LIUX 1MW3A 2CXEA 1DE6A 3STEA 2QCDB 4HHLA 4Z08A 2ZVRA 2FJUB 1PVNA 1IGSA 4IJCA 5AC7A 3GG1A 3W7LA 3QPEA 2O9PA 4HYVA 1CZ1A 3FEQA 2PFHA 1UC4A 3M0MA 2CZDA 3GKFA 2XIOA 5JUVA 3CUHA 4ECLA 2WC3A 2QNEA 3KUMA 2BY0A 4O11A 4TQTA 4PUWA 1WKYA 2OFJA 4MFEA 5I23A 3RAOA 3MZNA 2R1MA 3I68A 1F3TA 5CZ0A 3OA5A 4GQGA 4O10A 4RE4A 1EXPA 4DO6A 5HXMA 3VE9A 4MKVA 3GC2A 4Q8OA 4LXFA 1NIUA 4IPJA 4W88A 1GK8A 1JNEA 1H41A 4S39A 1KA9F 4ZFCA 1KXHA 5CZSA 4DJDC 3NQVA 4Y6GA 2YYTA 1P5BA 4QEEA 3MKVA 1FWIC 4D6JA 3OEXA 3K8KA 1IZKA 3UPBA 3I10A 1W17A 2ZXDA 1RQBA 1XUUA 3CV6A 4IXXA 1US3A 2WMHA 4GJ1A 1LL6A 3LRMA 1MQRA 1E6SM 4H9VA 3NR0A 4WEVX 2PDCA 5E6YA 2X16A 5CGTA 1X6UA 3BGJA 4DUVA 3QQWA 4AISA 4AQLA 3WJZA 2PUZA 5BXPA 1A49A 1EO7A 2NX9A 1CDGA 1GHRA 1DJWA 2OR2A 1ITQA 1R9YA 4XZMX 5DELA 2Z00A 3O15A 1UKSA 2CKRA 4WOZA 3AHVA 1TR1A 3CPGA 2OLAA 4S38A 5BXSA 1ITXA 3ONBA 4J40A 4GJIA 3N73A 1AA1B 1J96A 2AGKA 2XGZA 4X61A 3ARXA 4LUSA 4WGHA 1AH3A 4J5NA 1OX6A 1TPB1 1P0BA 3UZYA 7ODCA 3LGEA 4NHVA 3LM3A 3N1AA 2GQ8A 1Z44A 1YEYA 4M56A 3MO7A 3PFRA 3W1UA 7A3HA 3PY2A 1E1FA 4AZIA 3WFZA 5D02A 1QOQA 3BJTA 3VIHA 3TA9A 3FSTA 3APYA 2QPUA 3SCQA 3AYTA 2YYUA 4S3GA 4ZL1A 1XFBA 3S5OA 3CAWA 3FKKA 4HK6A 1F6PA 4R33A 1IWBA 5I09A 3TP4A 4H4IA 3ES7A 2EG8A 5CLTA 2JEQA 4L61A 3AROA 2ZWZA 3OGRA 4QLKA 1CECA 4Q33A 4ZOCA 4DJEA 2OQHA 4JN8A 5A2AA 1T7LA 4JIIX 5BMXA 4PMRA 1JZ3A 3ZR6A 3C0LA 3FA3A 3VIPA 4YTTA 5BROA 4XVEA 1YDNA 4JTEA 2YDRA 3RITA 1CLVA 3Q58A 2V5LA 2PDLA 3CT2A 3TCSA 1Q66A 1MSSA 1QNVA 5K9XA 4RLIA 4LUSB 8XIMA 4NZCA 5CGMA 4XZNX 1UWRA 1UP0A 3SECA 1L6GA 1Q8AA 3MCOA 3UQNA 2OJPA 1QMLA 3GYEA 4G1KA 4AEOA 5FF2A 3U4FA 3UJ2A 3QMTA 4KIRA 1E56A 1X97A 2ZA1A 1OFAA 4X0VA 2G0WA 1REQA 3RPMA 4NZ4A 3H4XA 3RNDA 3W2JA 4EX4A 2HVMA 2WLZA 1KKOA 1GQJA 1ZUAX 1KBKA 1Q65A 3S2JA 4Z2JA 2D2JA 3PZ9A 5EMKA 3LQGA 3QMSA 2CBUA 4W4QA 3QY7A 5EYWA 3I4KA 1FXQA 4HOZA 4JTUA 1UWSA 1R3QA 3VABA 3P0XA 4ZXOA 5CJ5A 3LTSA 5DXXA 1KXTA 3STCA 2QCHA 1SFJA 1ZPTA 2W0UA 4S3BA 4TUFA 3VMPA 4A8NA 1YDVA 1P7TA 7ENLA 4XK2A 3FGCB 1H7PA 3AZTA 3OBAA 2V8ZA 3CL7A 1O5XA 3P8JA 4NZ5A 4DZ5A 4YTSA 1YLVA 3ZSSA 1EGMA 2HE8A 4GYPA 3D3AA 3O6AA 1Q13A 3AIQA 3UVIA 1RH9A 1UP3A 1RK5A 4JX6A 2E6DA 5A8MA 3C4UA 2ZZ4A 1GVSA 4K38A 2PDHA 1DJZA 2DIKA 1WDPA 3KOYA 4V27A 3IGXA 2WCSA 5G1TA 1W3LA 4MWAB 2Y70A 5CC6A 4GO9A 3G1AA 3R8HA 4IQJA 1W9VA 4M7SA 4JX4A 3W29A 4KWWA 3ECQA 3K2GA 3H55A 1H5VA 4JTSA 4PR4A 3HIJA 3NYZA 4KCWA 5C70A 2D69A 3OODA 1CXKA 2GJLA 1UZ1A 4NQ1A 2OT1A 4KRTA 3RR4A 2Q8LA 3S0CA 5EMMA 3QQ1A 3OLGA 1A5NC 3SDOA 1DJGA 1YMYA 3NM1A 5AYIA 3SM0A 4X22A 3L9CA 2FGBA 3KTCA 1XLFA 1X7FA 1MNZA 2OQYA 2HK0A 3L0NA 3HQPA 2G3MA 5G2IA 4IGMA 1FBAA 4PGLA 1KWKA 1LRNA 3URAA 2BVDA 4DXXA 3MVIA 2OEMA 4MVAA 4CU8A 1FKXA 3THAA 2ISDA 1PCWA 2ISWA 4EWND 1RLCL 3F4NA 4ZSTA 3EDKA 4O19A 4S3EA 1CGYA 4KFNA 3O05A 3DZ1A 3EDEA 4KT2A 5GQBA 3TN3A 1RJQA 3VNZA 3DBNA 3UA3A 3SAZA 2ZC8A 2FZBA 4HNTA 3SCWA 4AIOA 5KZ6A 2IPJA 2VVNA 5G2WA 1LP6A 1IT0A 4GKTA 4NNBA 3M44A 5FOOA 1LM1A 1RXOB 3UXAA 3PS7A 2VR5A 4GY0A 5HNUA 4S23A 4JQ2A 1KM3A 3KRUA 1H60A 1TZZA 4A35A 3FCPA 3VINA 3S1WA 5BW6A 1XRTA 1KM1A 1OCJA 4Q4MA 3S4TA 1GVRA 4FS9A 3OLIA 3BE7A 1ZAHA 3WMCA 1S46A 1M1BA 1GZJA 5A3HA 4O16A 4PZVA 1SZRA 4H6QA 2Y5SA 3WDQA 1GUVA 3Q65A 5EY5A 4AH7A 3UJRA 1XKYA 4PFMA 2PB1A 1Z32X 4TVDA 1ECQA 4GKLA 1RSCA 3EWYA 3M07A 3N4FA 4QHRA 4IP4A 4RZ5A 4QNEA 1S2UA 5B80A 6REQA 3QLDA 3AU6A 4QIUA 4C60A 4P7OA 1FWRA 4DF2A 4TTUA 3CH0A 4HZ7A 2PDXA 4JQAA 2ZDRA 3KE0A 3ZT7A 3FK4A 3RM8A 3JUGA 2OWCA 3FOKA 3ME3A 1Q2RA 1KRMA 3C0SA 3N3MA 2DVUA 3HQOA 4GG9A 4Q4PA 1K8ZA 2JK2A 3M46A 1ZB5A 4AX7A 4GUHA 2QPSA 2B81A 2G96A 2JE8A 2WVSA 1GVQA 1HJQA 4F0MA 1UB3A 7REQB 5KZMA 1GVYA 5FF4A 2HE5A 2FVMA 1W3NA 4HMDA 4H83A 2A6LA 3A64A 2VOTA 3AIRA 3VMOA 3H7UA 2DJXA 2O9OA 3TE9A 2GK1A 2MANA 2OWWA 4HK7A 4PTDA 2NSXA 4A2RA 4KWSA 2PTZA 3WFLA 3GVRA 1PCKA 4XISA 1V7YA 3W76A 3DKJA 3LHUA 1XIDA 1XIMA 3UYIA 3AYVA 4ZTYA 3VC5A 2WV8A 1RD5A 1JDFA 5CAHA 4H8UA 4AZHA 3ARVA 4GX9A 4LYRA 1HJVA 3LSBA 1IEXA 1OC7A 3WH8A 5KSWA 1ZTVA 1JZ6A 2RJGA 4GY7A 4JX5A 5D32A 1M5WA 2PZ0A 1QI4A 2NUWA 3VYLA 4GABA 1SO3A 4LEQA 3GB6A 3M0HA 3MP3A 2UZ9A 1E9IA 1R3TA 1WYIA 1E15A 4Q8UA 5LNVA 2XFFA 2PCQA 3TVAA 1LORA 4C7GA 4JTDA 2ICSA 4H00A 3HQNA 1TVNA 3W6MA 3WD1A 4BEUA 4RZ6A 2PP1A 5DMLA 3C2OA 5LNWA 5FJTA 3ITLA 2AKMA 2WJEA 2OZTA 4DO7A 3M5YA 3E2QA 1LBMA 2J78A 2CXGA 2YSWA 3M0KA 3NQCA 4WGXA 4OQVA 1IV8A 2OYLA 1RCXB 2OKTA 1XXXA 1SJDA 1E3XA 3DX5A 3O2LA 4FPSA 3GK0A 1F7BA 3GNOA 3N19B 1QU4A 4N6FA 2V5CA 3W87A 4NXKA 1FHLA 1ISZA 1OHLA 5GJMA 1VBJA 2O56A 4ES4A 4ZZ9A 3DECA 1UZ4A 2BV9A 1E6PA 3SN4A 4CUCA 3M4HA 2A3HA 4H8HA 4OU1A 2C16A 3T78A 4XV0A 4GXMA 4Y7EA 5GNZA 3UXDA 3NZQA 3WY1A 1DP0A 1Z42A 4JKLA 3WLSA 4N4PA 1BTMA 4ZBCA 5K4ZA 1YQ2A 2RFGA 4HGXA 4OOUA 1NJJA 3U7VA 3H8AA 3GXIA 1S3HA 4FIQA 4PMXA 1XLJA 4MLRA 5G1YA 1W6TA 4JY8A 3M64A 3IUIA 3HURA 2E1WA 3W6YA 3WMLA 4V1YA 4B5WA 3CPUA 4ZE4A 1PB0A 3QGVA 2BBFA 2XGIA 1EXBA 3ZLGA 3H6OA 2QDHA 1D7KA 3NO1A 5HPOA 2E6YA 1YPIA 2NWSA 3TC3A 2BVTA 1B5TA 3W88A 3B97A 4NJKA 1XGZA 3BOLA 3L5MA 3ZVIA 5HQMA 3V36A 1XIEA 3GU9A 4G6CA 4GXPA 2C0HA 1TJ1A 1VPYA 3L12A 4I5RA 5DF0A 3KBNA 2QJMA 2HXTA 3M5XA 3CHDA 1E6ZA 2PF8A 5D04C 4O50A 1EHNA 4WDXA 3B9DA 2ZUTA 1TREA 3ERPA 2VEFA 2QQ6A 4CCZA 3AC0A 2WVTA 2E67A 2DZXA 3LBOA 7CGTA 2DSWA 4B3ZA 1E4NA 1C91A 3LRKA 4QS6A 4AX6A 3P93A 4ZOBA 3WSUA 1U5JA 3W53A 1QI5A 2E8ZA 3S83A 2YDQA 4WKAA 4Q8VA 1W1ZA 5AVHA 4AD2A 2Y5JA 4PN2A 4L9YA 4EAMA 1TIWA 4MNMA 4DO4A 4MKSA 3NL5A 3IRSA 1YADA 3R5EA 5TF0A 3AIUA 4OE7A 1MUMA 5C9UA 4MNLA 4K36A 2F2KA 2C18A 1P4CA 2DP3A 3TEVA 4CU7A 3ZFHA 4LVGA 3W00A 4C6MA 3PB2A 3W7QA 1JF6A 1KGUA 2NT1A 3LNPA 1JR1A 3CIXA 1UUOA 4C7DA 2C79A 2GSHA 5CGQA 3UWYA 4FX6M 1PDYA 4LY8A 5HWNA 3GNXA 3C2EA 1CYGA 1SW7A 2X8RA 3WDRA 3WLHA 3S1XA 4Z42C 4H41A 3E2VA 3MDWA 1H1ZA 2WMFA 3MCNA 4AB4A 1EQPA 1XLKA 4HN4A 2X40A 1WDDA 3VNYA 4RXFA 3IRDA 3N6HA 5FEXA 3QW4B 3TSMA 3GNRA 2EG7A 2C6QA 2OYMA 4O1AA 3VGFA 1EUAA 3ABQA 4ERAA 3AICA 2E5CA 3T4CA 2UV8G 3UXKA 3USBA 9XIMA 1KBLA 1MRQA 4Q8TA 5C6MA 1R5YA 4HPGA 5A6BA 4W89A 2CLIA 5EMUA 1NFPA 4GYKA 4I3GA 1JZ8A 3H2CA 3ZVHA 2E9LA 2IW0A 4QLJA 4NRRA 2J8FA 3SGGA 1TA3A 4HSNA 1YE6A 5FAGA 3W71A 1S39A 3QV9A 5TAOA 3AIBA 1PIIA 1DYSA 4ICMA 4YTRA 1NVMA 1W1VA 3OVQA 4XIAA 4X2RA 1X38A 3S2NA 1WPCA 2X7VA 3QXBA 1UQZA 2Y1HA 5FEWA 3GG0A 3S9IA 1W5PA 3G6LA 4LSBA 9CGTA 1XBVA 4W8BA 4JXCA 4UTLA 1HJXA 2R91A 3QH2A 1JZ4A 1TPVA 3CQJA 1FCUA 4FNRA 1DOSA 4XKYB 5I5RA 2DZSA 4ZOEA 4Z2GA 2Y7GA 1US0A 2WYSA 4DAFA 4LQ1A 5KITA 3UESA 5AB3A 4E2OA 3G1YA 2CIPA 4IWWA 5A8GA 4B5XA 2H9AA 4O52A 4UFHA 5F1VA 1G6CA 4HTBA 4B5NA 3WFAA 4E2BA 1MW0A 1DWJM 4IH3A 2Z1KA 1PZ1A 1V0LA 3SCUA 4IPNB 5F4SA 4CQCA 3P0WA 1JCMP 4NZ1A 2BZNA 1X6NA 2GYIA 4ROPA 2VFHA 1GOXA 1LOSA 1JGMA 4JKMA 2YGYA 2V6AA 2AL1A 3POCA 1GJPA 2EEXA 3H54A 1XL9A 5BRPA 5CJMA 3G2GA 5A6MA 3RDKA 3T0TA 1ZCCA 4WHBA 3WDIA 3CLMA 2ABAA 5EMLA 4IPIA 3A22A 1TPFA 1OGGA 2HDJA 1YW1A 3KX6A 3EPMA 4ENLA 1GQLA 1WDWA 4ADTA 1ZL1A 4TX6A 3GXDA 4HHMA 1KNWA 4IIDA 3ARSA 4TXEA 1E40A 4JNZA 4XBJA 3PB0A 3U48A 1OD0A 4M6QA 4GCAA 2Q3RA 2F8QA 3ENLA 5IDZA 2H9AB 4XUGA 4KPLA 5C7VA 3URNA 3Q45A 1BXCA 1N82A 4LC6A 1TJRA 3RIKA 4IIGA 4PTMA 1FHDA 2J4GA 5I0DA 2GVGA 3M0JA 1M6JA 4FR6A 3GDMA 2Q09A 4HNVA 2OZ3A 3F03K 3WD0A 1POKA 1KV8A 3TAKA 3TJIA 3ICJA 2F61A 3H2FA 3MP5A 4RR4A 4QX4A 3PZGA 4B90A 4ZA0A 4DJDA 2Y5EA 2BNJA 4N9CA 1QASA 4Q8MA 3ZJ8A 2BGNE 2O92A 1GNXA 1FQ0A 3FYYA 3WQGA 1S2AA 2G4JA 4AY7A 5CPMA 4PMVA 3R0KA 4JIHA 3SR7A 1E5JA 3E0IA 2IPGA 1K7FA 3UETA 3TMLA 5LNSA 2CZVA 4QEHA 1FH8A 4PH6A 3BMVA 4CNOA 3NWRA 1BYBA 1JAKA 3FXGA 3MDUA 3E12A 1NQKA 3TSBA 3SB0A 3T0BA 3APGA 5EFDA 1XSJA 3G0XA 1EX1A 2X0SA 4GJJA 2FPVA 4XD5A 3IARA 3PP7A 1TV8A 3MO4A 1KGXA 4Z1AA 1VH7A 4KERA 3A4JA 3NQEA 3OHMB 4L4LA 4YXGA 4QS5A 4EF8A 2Q01A 2I57A 1E4LA 1MZRA 2EJAA 2GQ9A 1BYDA 2BSLA 4I6KA 3GAKA 3PUGA 2PRMA 3FJ4A 4Q4OA 2OEJA 2GL5A 3VPLA 4GZEA 3SUSA 5H2ZA 2QF7A 1WKEA 2BY3A 2CBJA 2DT0A 4M51A 3VDAA 3Q67A 5AC8A 2ZRZA 4S1FA 3JZEA 1JDDA 3K5XA 2DT3A 4N9EA 4E4PA 1F74A 2VX4A 1UWIA 1AMKA 3NPWA 4P8VA 4B5VA 4F48A 3WJSA 1IT8A 1GOWA 2CLHA 1SJCA 1B9ZA 1G69A 3QKEA 4A2SA 4DPQA 3VNIA 1WDQA 1A47A 3LMYA 4QAIA 3WDHA 1L9WA 3J7HA 2E8YA 4S3JA 4EE9A 1VFTA 3RILA 5DY3A 3IJDA 5A8QA 1MUWA 3BJFA 4Q4QA 3OVRA 5AZ0A 3NXLA 3A23A 4ZQPA 2DDXA 1LLWA 4UNLA 2JKEA 1J6OA 1J2BA 4I9AA 3NVDA 4XAZA 1HZYA 1K3UA 1H7RA 5HUOA 2ZC1A 1DPMA 2OOGA 3S8HA 2PDYA 4UBPC 3VDBA 4QG9A 1JVNA 4AZ6A 4UTTA 4HNUA 1WKFA 4H01A 1B3ZA 3ARUA 2CPUA 2OGJA 1YPXA 2PAJA 3WLLA 2A79A 1LT7A 4POCA 1UKQA 1CLXA 3TC7A 2JF6A 3UJEA 4B5SA 1BLIA 6PTDA 5FACA 3NA8A 3U2CA 2AQOA 3N18A 4ADSA 3EX4A 3HG5A 1DXFA 2V3FA 4GH3A 4AVOA 3BMWA 1FWEC 4EXBA 4GRSA 3UWUA 3B3DA 1K4HA 3T0CA 3VFLA 4J3XA 3KL5A 3NO5A 1WXZA 4DBUA 1BD0A 5DANA 3WQ5A 4ZB0A 2W5FA 4C6FA 2FHFA 3IJ6A 2ZYFA 4JTCA 4OUEA 1N8WA 4KBXA 1R3YA 2J7GA 4MFDA 4WKFA 1XYZA 2W62A 1HF6A 1YXDA 4FNUA 4LYQA 2ZKMX 5E93A 3W84A 2E4TA 3KOXA 5CPLA 3C8FA 4NYYA 4C6NA 5CJNA 3VA8A 1NWSA 4D9PA 2VO5A 1NDYA 5B7YA 3VILA 1VIZA 5FD0A 5HNNA 3UWZA 1RPXA 4YTUA 3TLQA 4R7WA 1T96A 5ABTA 4LVAA 3E0FA 3LMZA 3B0PA 4J3UA 3AU2A 3VD9A 4YMZA 4ACZA 3AJ7A 2B7OA 2WWDA 3SUTA 3CQIA 3M6YA 2W63A 2J47A 3URBA 5IHSA 1TCDA 2ZRUA 3H7RA 4ILSA 3S9ZA 3C0QA 1TB3A 2XVPA 3PHAA 3TYEA 4AZBA 3TWAA 1QI0A 4H6KA 1AUSL 1ISWA 5DT5A 1VFUA 4QITA 1LUCB 1KD0A 2VURA 5CBIA 1OX4B 4PSRA 1Q7QA 3FX4A 1JUBA 2Q8XA 2PDNA 4ZGYA 4TX9A 3G1XA 1CWYA 2D3NA 1MFVA 2ACSA 4LNCA 3GR4A 4MADA 4W5ZA 4B16A 4WR3A 3WF3A 3GXTA 4Z1BA 1K77A 1EJUC 3P67A 1QOPA 1O1ZA 4BEQA 4CNSA 1WBJA 3O9NA 4JICA 4FX7A 4PCFA 3IVUA 1T41A 1O12A 3KLKA 3NM3A 3VNMA 4F4RA 1O5KA 6TIMA 1F4AA 4Y2WA 1OX5A 1FOBA 2OX1A 3MI6A 3C8NA 3KDOA 2PBOA 5DRCA 3WL1A 1VJSA 1YDOA 4DNHA 3F5LA 1FXPA 3MS8A 5HMFA 4DVOA 3CWOX 1RP8A 2QXWA 1LOLA 3E0LA 3BLEA 1UWQA 4PSPA 1D8CA 4ZQNA 3MWCA 3S47A 1RA5A 4KEUA 3MA8A 1U5HA 4Q4RA 1UP2A 3VKJA 3LNMA 4K1WA 2GZXA 3LHYA 1HKVA 4JD4A 2YL6A 4QAWA 1TPH1 3S42A 3VE7A 4UQCA 3KP1A 5D9PA 4I8DA 2PS2A 4HCLA 1XSKA 1CEOA 4DPPA 4GGBA 2XIIA 1LQ2A 1CXEA 3QHMA 1VRDA 2W91A 4C91A 4EP8C 3VK5A 1Q7ZA 3V75A 2VJXA 4P8XA 3Q4DA 5BRBA 1YBQA 3EOSA 4XAGA 3K30A 3R4IA 2WB5A 2J27A 2EQDA 2X1IA 1WCGA 1MI3A 5FKYA 1MQQA 3MQTA 3JVAA 3W2LA 1ZBKA 1TCMA 3QR3A 4QP0A 1I0DA 1PUDA 4O0ZA 4PCTA 3U2EA 2W92A 1SU5A 4U10A 1DWHM 3WMSA 3LS9A 3W1RA 1PEZA 4K8EA 3PAOA 4KEZA 4N4QA 4EIVA 2J7HA 4JBRA 4G5DA 3OG2A 3UBPC 1IXNA 1VCVA 1E6RA 3EMCA 4IIEA 3BSMA 3NQ6A 2R24A 3WQOA 3W73A 1DKWA 2WSQA 4F0HA 1YIXA 1FP8A 5C8BB 4NVTA 4CQ8A 1AZ1A 4EF9A 1J0JA 4WDUA 4IFKB 3ZIZA 4C7FA 2X1RA 3S46A 5JIWA 1KQYA 1GEHA 4AVFA 2PU1A 2WHLA 2PRHA 3DFTA 5HK4A