2A7PA

Crystal structure of the g81a mutant of the active chimera of (s)-mandelate dehydrogenase in complex with its substrate 3-indolelactate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
353
structure length
353
Chain Sequence
NLFNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLGKMDKANLEMQAALMSRQMDASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-Mandelate Dehydrogenase
publication title Structures of the G81A mutant form of the active chimera of (S)-mandelate dehydrogenase and its complex with two of its substrates.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 127
structure length 353
sequence length 353
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2005-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7pA00
2ATSA 4RZ6A 5G1TA 5K9CA 4N9DA 3B4UA 3PSVA 3LERA 2YFNA 1YYAA 3CIXA 3EWXA 3IIOA 1NEYA 3C2RA 1Z42A 3R2GA 3C8FA 5CZSA 5HUPA 4BWLC 3EX2A 1SZFA 3S1WA 1H63A 3SGZA 2V2CA 5D02A 3LCIA 5A8GA 5G4WA 3VI2A 1F05A 2ZZ4A 3QZEA 1KV8A 3LHVA 3UWQA 2TPSA 4JDBA 2E6FA 4FIQA 5FF2A 4GXMA 1FXQA 2J24A 3C52A 1O60A 3E96A 1M7OA 1CI1A 2ZZ3A 3U6WA 1LRNA 4C1LA 4LU0A 4FIRA 2PRLA 4K8EA 3LX9A 4KWWA 4FEZA 1S5WA 1LBFA 1OYBA 2PCQA 5HNRA 3E9AA 1HFBA 2FPVA 4M7TA 4UFIA 1DQWA 2VFGA 2JK2A 4K8HA 2ABAA 3CB8A 4MZ1A 5C6MA 3O6YX 3O06A 4HSNA 3I7QA 4EF8A 2J6XA 1SUXA 1H61A 4I7VA 3TH6A 2P10A 5HINA 1UJPA 1H1YA 2BTMA 1B4KA 3OVRA 4LRSA 3UXAA 4FNTA 3BLEA 3W72A 1G4PA 1OF8A 3W7CA 4P2VA 2E1DA 3QMTA 1R30A 2E09A 5ABTA 2H90A 1AK5A 5DXXA 2JKAA 3BV4A 1ZAJA 2QCLA 5G2WA 2YCEA 3NDOA 3W6YA 1AW5A 4IMCA 3P84A 2Q8ZA 3UPBA 2CLEA 1KTNA 5AFDA 3HG4A 4NXKA 2FB3A 1QDSA 3CEPA 1YDVA 3S9YA 3HF3A 3P60A 1OG0A 1SU5A 3HG2A 3W83A 2FLIA 3IIPA 3G1XA 2Y61A 1G4EA 3L0NA 2G96A 4POCA 2QKFA 4IMFA 1L6YA 2RH9A 3QRHA 5CPLA 2A1YA 4ADTA 1GVRA 2RDTA 3LCFA 3W1XA 3S0CA 4CNPA 1W5PA 5E93A 4LV4A 3OVPA 4NUWA 1GOXA 1XBZA 4L4LA 1ADOA 4LC6A 1TPEA 3FS2A 1YXYA 3MHUA 1TPDA 2V30A 3KHJA 2Z6IA 3DU0A 4UFKA 4UTWA 5DY3A 3FFSA 2J27A 3HPXA 3OVQA 2JBMA 3INPA 1YLVA 3NPVA 3T44A 3CC1A 5F1UA 1MO0A 2ZYFA 1W5MA 1B57A 2VFHA 2GPTA 3T40A 4WOZA 3LV5A 2G5WA 4GUJA 6ALDA 4LTSA 4YCPA 4LY8A 1JVNA 1Z41A 3MI3A 5CZ0A 3W3OA 1KBJA 2CLFA 5C2XA 3NNTA 3L2IA 3BG3A 2OT0A 4K6AA 1A53A 3S1XA 5EY5A 3TMLA 1GZGA 4UTIA 4O0KA 5KTLA 4YLWA 2NX1A 4TO8A 1MZHA 4U4MA 3SZ8A 4WX2A 3TX9A 1YDOA 2V8ZA 3H53A 2QCFA 3LRMA 3MYPA 4JX5A 4AMAA 5IBXA 3M16A 3A21A 4TR9A 5DCEA 2ZRVA 4HKPA 2BLEA 2W6RA 4H3DA 1EEPA 3GR7A 1EUAA 2I1OA 4ZVJA 3SJ3A 4MFEA 3RMJA 3G8RA 1C9DA 4RR4A 1JCNA 3HIJA 2LLEA 2QDHA 4PL2A 4QNEA 2RKXA 1F6PA 1A5AA 1IXOA 2QCDB 4UUIA 1JRCA 1QPQA 3E02A 3PM6A 5I3JA 4ZQNA 1OVDA 2W0UA 5CG7A 1LDCA 3S5OA 4JYDA 3DXIA 1SO5A 1NSJA 2C13A 2DJXA 4FX8A 3WFAA 3NG3A 3Q58A 4UXDA 3GNDA 3GDLA 2HMCA 2ZTJA 2GVJA 3NL5A 4O14A 4GWEA 1LM1A 2B7OA 1BTMA 4LT9A 3BW3A 3S1UA 1OFEA 4HT3A 2FDSA 4IUOA 3CQ0A 2DZXA 2VEIA 2TYSA 3SECA 2G95A 3R13A 1XBYA 4FF7A 2VEPA 1P5BA 1VRDA 2WQPA 1HUVA 4BI5A 2JKPA 1IXNA 3L5MA 2QUUA 3TSDA 4A2SA 1R2SA 4N9CA 4NNCA 5EPDA 3BG9A 3LHZA 1PE1A 5D09A 2NX9A 3W1NA 3G18A 3A22A 3PVFA 5BMXA 3QMSA 3TIMA 5LNUA 3C61A 2IQTA 4JTGA 5GVJA 4XBSA 1DBTA 2DZPA 4Z1CA 3L21A 2XN1A 5DELA 4QSHA 3NAVA 2Q3RA 3IIVA 1IGSA 1GT8A 4K37A 4DBEA 3P81A 1JRBA 1B4EA 4FHAA 5EL1A 4JX4A 2EGZA 3LHWA 3MHGA 5AYZA 3RNDA 3MWAA 3OIXA 1GEQA 2QEZA 2ZRXA 4AWTA 2GQAA 1SSDA 1ZJIA 1U5JA 5FI8A 1SW3A 5HR6A 3IVSA 3KXQA 1QNVA 2YW4A 1QOPA 1X1ZA 3PS7A 5LGZA 4AWUA 4NJJA 4JICA 1KBIA 1B3OA 2NXIA 3EX1A 2XFWA 4G1KA 3PB2A 1J5TA 1FUYA 3CHVA 3PAJA 1W56A 2Y7EA 4FNUA 1HG3A 2C3ZA 3ZWSA 3M0ZA 3NL3A 2Y88A 2GVLA 1A5SA 3BG5A 1Z44A 1D3GA 4O8RA 2QCCA 1HTIA 1F74A 5KZMA 1YPIA 4CQAA 4ORIA 2Q8LA 1F76A 2WSQA 1KLZA 2A4AA 3W7MA 4O52A 4HNTA 4E2DA 3ABSA 3DBPA 4FNRA 2FPYA 5HJLA 3CWOX 3FIGA 1T99A 2VENA 4JNMA 1ZENA 1FBAA 5AYXA 3W7RA 3G0XA 2YZRA 3LTSA 2HSAA 3I7RA 5I3HA 5K2ZA 1P0KA 1YDNA 3LCHA 1SW0A 3IIXA 4FNQA 4LUJA 3FYOA 5I3FA 1K3UA 1LBLA 2E6DA 3CWNA 4IWWA 1XBVA 1H7OA 1ME7A 3IRDA 3IGXA 1I2NA 2CU0A 3S5ZA 2CLOA 2ZA2A 3TNOA 2FIQA 4A3UA 2YYTA 3EWZA 1ML1A 4R33A 4QNWA 1Q6OA 1DL3A 3W7GA 3MBFA 1R2TA 3GDRA 4OV9A 1SSGA 4J9JA 3MYOA 4JXCA 2C18A 4UFMA 5K9DA 3GXNA 4TX9A 2VFEA 1GYNA 2WNQA 2EF9A 3W22A 3W9ZA 3YPIA 3L68A 3M43A 3EKLA 3R8RA 4WXZA 1LYXA 2CLIA 3NPXA 3DI0A 1W1ZA 3EWYA 3MW7A 4NNAA 5HULA 3BW2A 1LLZA 1ZHAA 5L6UA 3W76A 1SQ7A 1YTKA 1FWWA 1G4TA 4BR1A 3GDKA 1ONRA 1FQ0A 2CZDA 4LC8A 2ISVA 4LRTA 4AEOA 4HNVA 4JTTA 2PC4A 3NVTA 1VZWA 5I3IA 1H51A 4MZ8A 1HL2A 4GUGA 1TQXA 2PURA 1FWNA 5D2TA 3WJXA 2NWRA 3ABRA 3G0SA 3KX6A 5DXYA 4UR8A 3WJSA 1WOBA 3LTYA 4WY0B 5FEPA 5KITA 4LVAA 5BW6A 5D03A 3NO5A 3B0PA 3HGJA 5BNKA 3ANYA 1FWTA 3KVKA 4ZQCA 1RPXA 5CPOA 3N34A 1N55A 3UYCA 1GVFA 3B0UX 3NR0A 1F5ZA 3RF9A 3WJYA 4A2RA 2XN2A 2EPHA 3CLMA 2CLHA 5I3GA 3L65A 4UMBA 3SR7A 3ZS4A 2ZZ5A 3BLFA 2ZZ1A 5K7JA 4AHPA 1E51A 3TAOA 4O18A 2DZWA 3NYZA 2WV8A 1OFDA 5K4XA 3IGUA 3PF3A 3W7LA 5AB3A 1VHCA 2X16A 3T7VA 2VOMA 5F4SA 3EX6A 3W7DA 4B5NA 4MPQA 4UTTC 4UMCA 1SZNA 2A7NA 3TQ0A 1KM5A 4UTHA 2QCDA 3C2FA 4Y90A 1SPQA 3KOFA 2Q3OA 5CKSA 4YMZA 1JQVA 3PBYA 3NXFA 5CSRA 3LDVA 4MJZA 1LTDA 1DQXA 4DXVA 3TW7A 3DKJA 3O63A 3Q37A 1IXQA 1LOQA 3GNNA 1GVOA 4IGHA 4NX5A 5L9FA 3IVTA 4XKYB 2QAFA 2R14A 3P82A 4UR7A 1QWGA 4JTIA 3G1VA 2G97A 5LNWA 4XWUA 5D38A 3F1QA 1OX5A 1K7FA 3LM7A 1YADA 1OABA 1UASA 5FEXA 2VFFA 3EWUA 5J5RA 1TPB1 3N19B 2ZQ0A 1RV8A 3L5LA 3MO7A 4Y6GA 4DELA 4LVBA 1SW7A 1PV8A 2J9YA 3UXDA 1QPNA 3TW6A 4GC4A 4LVGA 2YSWA 2R94A 4Z1BA 4RXGA 3MP3A 4LVFA 5D05A 3GIYA 1FCUA 3HGRA 4OGZA 3O15A 1GPWA 3TFXA 3BARA 3F4NA 5MHBA 4JTSA 1UBSA 2H3DA 4AB4A 4Q4KA 3CM4A 2CLMA 4ZQOA 1SFJA 1NFBA 3G3MA 3B06A 2C16A 3W2JA 1JUEA 3QSRA 2FPTA 2YR1A 3IIZA 4N6EA 4HIBA 1QO5A 3W2UA 7TIMA 1D9EA 1OFOA 3JS3A 3TCEA 4ADSA 5HR7A 5HWJA 2OT1A 1YTEA 4QQ3A 4IJBA 3M5VA 4IPJA 4N4PA 4XBKA 1TV8A 5DCBA 5SWUA 3I6RA 4CCEA 2WSRA 1VJIA 4DEFA 1L6SA 2YPIA 1FY6A 1JUKA 4DPPA 3HBLA 3BGGA 4O53A 3RFAA 1OF6A 2E5CA 1Q6QA 3EWWA 1VS1A 4TMBA 5CZJA 5LKYA 2VEMA 4CQ9A 3UZ5A 3NQFA 3ZFHA 1TTJA 1RQEA 1DVJA 5K4ZA 1OX4B 2JGQA 1LOSA 3GXPA 3W1AA 3M41A 3LHUA 2Y7GA 3LRKA 6TIMA 3KRUA 3PB0A 2EKCA 3NEVA 2A21A 4PTNA 3HOJA 1H7XA 4NVTA 5U7SA 3UWVA 3MBDA 3W7IA 4NJIA 3DAQA 3MJYA 4WD0A 2KZHA 3TFCA 1SO3A 1GVSA 4DF0A 1OK4A 5LNVA 1UUOA 1PCWA 1TRIA 4CCCA 1SZGA 3FA5A 3KVJA 2V2HA 4MY8A 4QJ1A 5CGQA 1LORA 3HGOA 1BEUA 3PBUA 2YYUA 1GTEA 4O1DA 5AC7A 4R53A 2HS6A 1KM4A 3PSWA 4BK9A 4UTKA 1H60A 3L5AA 2ATMA 1EPXA 4EWND 3U8GA 1XC4A 4TIMA 5AC8A 4RLIA 1TPWA 3M7WA 4JTUA 1VYSX 3DFSA 4NNBA 2YGYA 3DENA 2NUWA 1MEWA 1Q45A 1SR9A 1EWEA 3QPYA 1ZCOA 4WXYA 5F4WA 4O10A 3N3MA 3PBVA 3B0VC 2YDAA 2NXHA 4JIQA 4P61A 4E38A 3KVLA 4JY9A 5FF7A 3W7KA 1MEHA 4MY1A 5CSSA 2C1HA 4O28A 4IX2A 1XL9A 4ZQRA 5AHFA 4O57A 3UQNA 1CX9A 3KRZA 4K38A 2VFDA 2Z0IA 3WK3A 1EWDA 1WYIA 4DO6A 1EA0A 4WQ6A 4PA8A 1FXPA 4OT7A 3GVGA 1W37A 1FDYA 4OE7A 4W9TA 3STFA 4IMEA 2E5BA 2ZCGA 3OA3A 4AXKA 3VFLA 1ALDA 1VCGA 3NQMA 3E49A 2ABBA 5D32A 4QAIA 1PHQA 4MLRA 1BWKA 3N9SA 4WY0A 4GUIA 1K8ZA 4JYFA 5D2XA 1OHLA 1LBMA 1LROA 1QMLA 3G8EA 3DFOA 2Y89A 4PC8A 4O54A 3GDMA 3NQAA 3LRLA 3QC3A 2V9DA 5BOOA 3P8IA 3HQ1A 1G67A 5H91A 4TMCA 4KWVA 3G1YA 3TJLA 4MVAA 1IXPA 2GUUA 1W3IA 4JEQA 5AYYA 2OMAA 1WBJA 1IIGA 3GXTA 4X3ZA 2B7PA 3PUDA 4UFHA 4CNNA 1R46A 3K30A 3LHYA 4YCOA 3P62A 3PWAA 4S2BA 3TROA 4JTHA 1ME8A 1PIIA 3WK1A 2Y7FA 2W79A 5TIMA 5F2LA 3G1HA 3MI6A 3TXZA 1VPXA 3OEXA 1DORA 5LSMA 2V81A 2OJPA 4KFOA 4DBDA 2X1RA 1T0OA 1P1XA 3QPZA 3FJLA 5AHMA 1OFRA 4X2RA 1KLYA 1AMKA 1O4UA 1I4NA 2X2GA 3FKKA 2J88A 3GB6A 3H55A 1Y0EA 1AL7A 1H62A 4K7YA 4KFPA 3ZWTA 2C14A 2DJLA 3L0GA 1XUUA 2BZNA 3BW4A 4N6FA 2NUXA 3WJZA 3L9CA 4OBTA 3BGJA 1G69A 1OYCA 5F4XA 4LS2A 3N9RA 4ZL1A 5KZEA 4KFNA 4LV9A 5EBUA 4UFJA 1FCBA 1XUZA 4TU1A 3EX3A 1Q6RA 1T96A 2CWNA 2E6AA 3MI2A 1J2WA 3GK0A 4GUFA 3A5VA 3W7QA 1GG1A 1DV7A 5C5YA 4ZQPA 5AN7A 2RDUA 3W87A 2HTMA 4ONVA 3W88A 1QPOA 4XKYA 3W2MA 3IGSA 1H5YA 4NJKA 2Y62A 4FNSA 1VCVA 3HPSA 4PH6A 2DU2A 2DZVA 1I45A 1BWLA 3W1QA 4HHPA 3W70A 3W2LA 4PODA 3M1ZA 3GR8A 3QM3A 3T55A 4DF1A 4JTLA 1KM0A 3UWZA 2C0AA 2X30A 5D30A 2A7RA 3R89A 5DBTA 4UMAA 3UWUA 3V1PA 3W1MA 4MLJA 1KTBA 1TV7A 1WXJA 4BWLA 2V82A 4O50A 3R5EA 3W84A 1O5XA 1TTPA 2A5HA 4LWWA 3LXCA 1KA9F 5E1QA 3S6DA 2X1SA 4O1AA 1EUNA 1DJQA 4UNKA 3LCWA 5D2WA 4FB7A 2FJKA 3W23A 4EF9A 1RR2A 3W85A 5HWNA 1TMHA 3FEMA 3HG5A 3TR2A 3SGUA 1O95A 3G0UA 1SO6A 3LLDA 2F7FA 1OK6A 4RKAA 5F2MA 5FF3A 2E5DA 4UTWC 4E0CA 3M44A 1X6UA 3BO9A 4HPXA 3JR2A 1W5NA 1K8YA 2QJGA 5CPMA 2QCHA 2GQ8A 2Y6ZA 3NQ8A 1C8VA 3CPRA 2ISWA 3MUXA 1ME9A 3UWYA 1NF7A 4WZHA 3VE7A 3ZR4A 2GOUA 1EP2A 3UZJA 3W1PA 3UNDA 2ZZ2A 4ZMGA 3EWBX 4NJGA 3MMTA 3F03K 2OX1A 1OFPA 3NQEA 4UFLA 2DP3A 1TPH1 3W71A 1TV5A 1GG0A 2WNNA 3C0JA 4HNNA 3DFNA 3CT7A 4FO4A 1OX4A 3LI0A 2NXGA 3NOEA 1O5KA 3LI1A 2CFFA 3LCGA 4CCDA 2R8WA 3QYQA 3IEBA 3LLFA 1KFKA 1XKYA 4HPJA 2WKJA 4WOQA 4N9BA 2CLLA 1MEIA 2VXNA 2A6NA 1Q6LA 3GKFA 1THFD 2A2IA 3QF0A 4N4QA 1TJPA 5IBXC 4BI7A 4IXHA 2X1TA 4AHOA 2V5BA 4HNUA 3MP5A 5IM51 4IQLA 3UWWA 2QR6A 4M19A 3FJ6A 1KW1A 2PRHA 4Q32A 3S42A 4PCFA 3CIWA 3W75A 3TAKA 3IVUA 4RCXA 1V5XA 3GX9A 3STEA 5LZLA 3PBWA 2TRSA 1ICQA 5EA9A 4UC5A 1KFEA 3LHTA 2QCMA 3O6CA 2VKZG 1QCWA 1W54A 4HN4A 5KMYA 1D3HA 1TYGA 1OJXA 1EIXA 3MHFA 4AAJA 3W2NA 4JTKA 4PFMA 4CLMA 1NVMA 4X22A 1FWRA 4WUIA 4Q33A 4ICNA 3RK8A 2H3BA 2C6QA 4WY0F 3N14A 3V75A 4JGDA 2ZRYA 1IIHA 1GTHA 3HB9A 5AHNA 2V2DA 1JCMP 1WX0A 4LW7A 3E12A 5FESA 3P67A 1KV5A 2QUVA 3EX4A 3P8JA 4O12A 3W1TA 3ATYA 3WJWA 1EP3A 3G1SA 4OV4A 3Q94A 4AH7A 3I65A 3HG3A 3N2MA 3NPUA 1LRQA 1XDLA 1F6KA 3GYEA 3THAA 3G1FA 2QCNA 4NZFA 4ADUA 3SI9A 4RZ5A 4MYAA 4RX0A 1W31A 3TUUA 5CZTA 2VELA 3I7SA 5H2ZA 1TQJA 4GE8A 5LNSA 1JCJA 3EB2A 4MKNA 2QJIA 3PULA 3UY8A 5U4NA 4K36A 1YTDA 4RV8A 1QFEA 1JULA 2DZSA 5LGXA 3UD6A 1I2OA 2O7QA 3IV3A 1TREA 3QW3A 4LVDA 4O17A 3BLIA 1F7BA 1X7FA 2A85A 4XQ6A 2CLKA 2JKEA 1C29A 4K39A 1JUBA 3NZ1A 4IX0A 3RLUA 3W86A 2GJLA 2UV8G 2Y85A 1K8XA 1LLWA 2E68A 2ZBTA 2WJZA 3A9IA 5DBUA 2PRMA 2WSYA 4MYXA 3W7EA 1OFAA 4I7UA 2EHHA 4XZ9A 4AVFA 4IMDA 1Z48A 4DO5A 1BKSA 2F84A 1VGAA 3MP4A 4O0ZA 2WOQA 4NJHA 3B04A 2QAPA 2Y7DA 1LOLA 2Z1BA 3L67A 4E2BA 3W1RA 4CNOA 1VQTA 3STGA 1AG1O 3EXRA 4WJEA 4O1BA 3NQ6A 3O8AA 3W7OA 3NM1A 3O07A 4MOZA 3Q2DA 3TK7A 4MUZA 5A5WA 3BK0A 3VCRA 4A29A 1TCDA 5I3KA 3DFPA 4O16A 5KZDA 4H6KA 5C54A 3A24A 2NLIA 2YFOA 3NQCA 4FNPA 1XBXA 4JY8A 1WDWA 4M6PA 5EYWA 3FYPA 1I8JA 1G7VA 1RZMA 3GAYA 3RU6A 3SFKA 3PC0A 3OHIA 1EX5A 2A7PA 1OFBA 3L66A 1ZAHA 2V0TA 5DCDA 3NL6A 3L0KA 5F1VA 1P0NA 4X9SA 1G6CA 2H6RA 2DZUA 3C2VA 3M6YA 2CW6A 1O94A 3G22A 2QDGA 3NQGA 1J4EA 1JCXA 3P7YA 3B05A 3C2OA 1FCQA 3TV8A 5HMSA 4Z1AA 1W3NA 4O19A 1HO1A 2E77A 3DFQA 1PL9A 3DHDA 4HSOA 3W07A 5DN1A 4Y8FA 1T8XA 2NV1A 1L9WA 4L4MA 4O13A 3G3DA 2DZTA 3H54A 4U28A 1W5QA 2QCEA 4BI6A 4DQWA 4MFDA 2YW3A 3HO8A 2Z2UA 2ZTKA 1KM3A 5AHEA 3NL2A 3P80A 3S5YA 3ATZA 3G1AA 2X1UA 3DKLA 4C1KA 1S3HA 3CEUA 4NX0A 1S5TA 1V7YA 4DPQA 4O4VA 8TIMA 2J9ZA 5C55A 1XCFA 1SFLA 5FF4A 2B0MA 3E0IA 4JN6A 3W7JA 1W5OA 5G2IA 4O11A 2D73A 4FXRA 3M9YA 4UTLA 3SIZA 3SSJA 4GBUA 4H4IA 4ZZ9A 3NA8A 3BVJA 2OZ0A 4UTJA 2YX0A 3AO0A 3TSBA 2CZ5A 3M5XA 3AJXA 3W7HA 4D2JA 3B8DA 4RXFA 1KM6A 1GJPA 4LNYA 1PVNA 2H8ZA 4NT0A 3TC7A 2ZZ6A 1OYAA 3FOKA 4QM1A 3HJZA 3QFEA 4BFAA 1M7PA 1H7WA 3LBMA 2R91A 2CZFA 1VC4A 5G4EA 3USBA 1TPC1 2Y70A 4K7VA 1WV2A 3SY5A 3PUOA 2XN0A 1I2RA 3DZ1A 4O1CA 4YWIA 2AAMA 1L2UA 3KRSA 1XDMA 4I9AA 4JIPA 1GQNA 5EMUA 1P4CA 3QEZA 2P1FA 3NQ2A 1AW2A 1XFBA 3NM3A 5HUOA 2FQIA 4GJ1A 2J9XA 1B9BA 2OCZA 1CW2A 2NX3A 1YPFA 3BPWA 1MXSA 1JCLA 4JX6A 3OBKA 5BRBA 3PG8A 1PHWA 2H8XA 1F73A 2RHGA 5KSWA 1WA3A 2DORA 4EVZA 3N2XA 1ZFJA 2JGYA 4ALDA 4AF0B 1ZNNA 3GZ3A 1N7KA 1W3TA 3HGSA 4I7WA 3GLCA 3W7NA 2GVGA 3A5FA 3EXTA 1TTQA 1H7PA 5K9XA 3W74A 3G24A 1I2QA 2FB2A 1YXCA 1DHPA 3S8HA 3QH2A 3C3NA 1VLIA 4EOUA 1RQBA 2RDWA 2ZA1A 2ZZ7A 5AC6A 5F2IA 3CU2A 3OG3A 3PG9A 1H50A 1K03A 5BMWA 1KFBA 2NUYA 3GDTA 3LGEA 3LV6A 4AWSA 2BSLA 1ZY9A 5DY2A 5D04C 2TSYA 1VYRA 3ELFA 4DF2A 1ICSA 3STCA 2AGKA 2TMDA 5FEWA 3TMQA 4KKXA 3TXVA 3DH7A 2BWGA 4M7SA 1MSSA 1VR6A 2PE4A 4FX7A 1LRTA 1KFJA 4MZYA 4S1FA 4QISA 1FCVA 1PS9A 2QJHA 1VH7A 4M6VA 1TJRA 2VC6A 1JJKA 3LB0A 2NV2A 1R2RA 5AHIA 5G1YA 1S5VA 3THQA 2EAWA 1G4SA 1EB3A 1M5WA 1QO2A 4XTDA 1KTCA 3M5ZA 4OWGA 4UTTA 3UPWA 3QSTA 4YXGA 1TIMA 1K7XA 2QF7A 3M47A 4MIMA 4UTUA 3A23A 4QIUA 1WOAA 4JYEA 4O4WA 1VHNA 3P5YA 4RJEA 1H7NA 3LXAA 1R47A 3CTLA 3NQ7A 4A22A 1UCWA 3LBCA 1ICPA 3TA6A 1VYPX 3EKZA 3TJXA 3NZRA 2ZDRA 2A6LA 3B03A 1QAPA 3O6DA 1K02A 1W0MA 1GYLA 4ZQMA 4N2YA 5FF0A 1TPVA 1IF2A 1DJNA 4PL1A 1I2PA 5TBOA 1WQ5A 3LXBA 4ORMA 3KVMA 2ZA3A 3NPWA 1G7UA 3LTPA 4R7JA 1GVQA 3S1VA 1EP1A 2BXVA 5K3VA 1XM3A 3W7PA 4GFSA 4JD4A 1YXDA 1DKWA 1RVGA 1TO3A 2I9EA 2C19A 4GRSA 4JS3A 3ABOA 2ZRZA 3O1NA 4UNLA 1KFCA 1LZOA 3WK0A 3P61A 1AW1A 1W8SA 3TC6A 5FEZA 3LOTA 3LCLA 1H7RA 3P74A 3PY2A 4IMGA 5F2GA 3TE9A 2WNZA 3C4UA 2QUTA 3GKAA 1Q3NA 1TPFA 2YXGA 1LCOA 4BF9A 3U2OA 5CPNA 1N8FA 3I68A 4Z0JA 5G5IA 4NZJA 1UB3A 5T26A 3S5NA 5TQLA 2E6YA 1LP6A 4IOTA 4R34A 1WBHA 5AHLA 3P5ZA 4Z08A 1A50A 3O16A 3DI1A 2NZLA 1JR1A 4RZ4A 3KFTA 3W73A 1PCKA 2CZEA 4FXSA 3JRKA 1M6JA 3QQ1A 1NF0A 5DLCA 4OHQA 2P0OA 1RD5A 1WAUA 1GWJA 3TQVA 3DFTA 4O15A 2ZRWA 2GJNA 4JTJA 3G1DA 4MJMA 4UTMA 3DGRA 2ZFAA 1TPUA 3PUEA 3VE9A 4OQVA 2A0NA 4JTEA 5D2YA 3T78A 4NXSA 3W1LA 1AL8A 1FWSA 4FX6M 1ZALA 4N9EA 5HWMA 4GUHA 1TRDA 4UIOA 3VKJA 1TSIA 4M5PA 2Z6JA 1NAL1 1UUMA 1HO4A 3DHFA 3LCXA 2WO5A 5LNRA 4LS0A 2NWSA 1JCYA 3KAOA 3PR2A 3FKRA 3TSMA 5LHFA 1KM1A 3TU9A 2RFGA 1FDJA 4YL2A 4CQ8A 1SZEA 3EXSA 3VNDA 3N73A 5E0KA 3QW4B 4XUGA 4Z0SA 5D33A 4PEKA 3QMRA 3R12A 3RLVA 1FX6A 4DO4A 1A5CA 3TDFA 4NQ1A 3UY7A 1JQXA 3QJAA 1TTIA 2QCGA 3ABQA 2Y63A 2AQWA 4Z1DA 4AHQA 4LS1A 2B7QA 5D37A 1RQHA 2ZRUA 1A5BA 2FTPA 1FDZA 1L6WA 1F2JA 1XXXA 1X1OA 1TB3A 2ALDA 1SO4A 4GNJA 3TKFA 4IXXA 3W1UA 4EIVA 5LHEA 3W2KA 1X8FA 2C15A 4RK8A 3C6CA 4MY9A 4NU7A 1VLWA 2BX7A 1U83A 5D2VA 1VCFA 3SW6A 3C56A 3T4CA 3GAKA 3F4WA 2FFCA 2I14A 4QITA 2B7NA 1K7EA 3EEGA 2O7SA 2WPBA 4LUIA 5G2HA 3NQVA 4UCGA 1ZAIA 4OU1A 3TQKA 4AF0A 3NQDA 2VFIA 3M5YA 1OFQA 2HS8A 5AOUA 4JTFA 1KM2A 3FLUA 2B4GA 4M6QA 2V5LA 4S2CA 3QQ0A 4Y96A 2ISSA 4A21A 1XI3A 1QPRA 4IPIA 3C2EA 4XTIA 1OX6A 5KINA 4Y9AA 1QR7A 2GQ9A 1QOQA 4JR5A 5EKYA 4ML9A 4JDYA 3NGJA 1DOSA 3HPZA 2VEKA 3WK2A 4LOCA 3O05A 1H1ZA 3D0CA 1KFLA 5J5DA 3HMJG 5HQEA 4N02A
chains in the Genus database with same CATH superfamily
1EGZA 4ZSUA 1L8NA 4RZ6A 3V16A 3UFYA 3LPGA 3LERA 3IIOA 3EWXA 2J8GA 5A6TC 3UU0A 2XH0A 1JYNA 4BWLC 1H63A 5D02A 2FKPA 4NAFA 3CUJA 3M46A 4NZ3A 3LHVA 1KBBA 4ACZB 2E6FA 4LCSA 3F2BA 4ZR8A 2J24A 1W9BM 3GFYA 1LRNA 4GZEA 2DEPA 2PRLA 4C6OA 4HHHA 3CT2A 4DYKA 1FWGC 1TKKA 1QNQA 2VX7A 4ZOBA 2V6AA 4D6CA 4M7TA 1DQWA 2VFGA 2Z24A 2XVLA 3WLLA 1REQA 5C9XA 3O06A 2CKSA 1BF6A 4EF8A 3SN4A 3SCTA 4CD5A 4I3GA 1UOZA 1T41A 2V63A 1OCBA 2E1DA 5GNYA 1X97A 1ZJHA 3BV4A 1CPUA 5G2WA 5HQLA 2YCEA 3GXMA 4KS0A 3URBA 4CGTA 1BAGA 3CZ8A 3WUFA 4B90A 1KTNA 1JFHA 3LPFA 1TG7A 3DG6A 5PTDA 2GUBA 3S9YA 3HF3A 1OG0A 4KH2A 1QBAA 2FLIA 5EMLA 3G1XA 2Y5JA 1G4EA 2BXYA 3FK4A 3L0NA 2IKHA 3CH9A 3VZZA 2V69A 5CPLA 4ADTA 1GVRA 1IE7C 4FALA 4DXXA 3WD0A 4LV4A 1EQPA 4NUWA 1HJWA 4Q22A 1GOXA 4L4LA 2V5KA 3FS2A 3MHUA 3NZGA 2V30A 2R82A 3AHXA 3KHJA 2Z6IA 2OQYA 3DU0A 5DY3A 3FFSA 3OVQA 2INZA 1MMFA 1YLVA 2HEJA 4LPCA 2QGHA 1W3JA 1MO0A 1IT7A 4U3AA 1HJXA 4PUEA 1LT8A 4GUJA 5A8QA 4S3JA 2HK1A 2J6VA 2OQLA 3RLHA 1KBJA 2CLFA 1YKWA 5C2XA 3NNTA 4A6GA 2OT0A 4WJXA 1SMAA 3QV6A 5EY5A 4AC7C 4LBSA 3TMLA 3K8LA 5C8BB 3U5YA 2NX1A 1L6FA 1POJA 4H8NA 4NF7A 3WFLA 2POTA 1YIXA 3MCMA 5HJXA 3SCSA 3P2VA 1OCQA 4HOXA 2IXVA 2DW6A 3BAIA 2DUXA 3VKCA 4AMAA 3VU2A 1TWSA 4XD6A 3A21A 4KGJA 4LAKA 3GU2A 2ZRVA 4W8AA 1NWTA 4AVNA 1AH3A 3RMJA 2XIBA 1TA3A 3HIJA 2LLEA 4PL2A 4QNEA 2CBUA 1A5AA 1IR2A 1TWWA 1IXOA 4MWAE 1JRCA 3PM6A 3E02A 4N42A 4HNOA 4ZQNA 3AHVA 1OVDA 2YL8A 2WC7A 3VX0A 2OYMA 2CLPA 3MV01 1EFZA 3S5OA 3DXIA 1L0PA 3TTEA 1PDYA 4ZOAA 1C3FA 3EDDA 4UXDA 4RUBA 4O8AA 5CBJA 4O14A 3M0YA 2X0SA 3KP0A 3S1UA 3GBEA 1VEPA 3BJTA 2G95A 4JQAA 4GO9A 4AIUA 3B0YA 3WLRA 4BI5A 1GJUA 4MM1A 5FJTA 5TAOA 3L5MA 3KS6A 1W91A 3UCDA 2PDYA 3LHZA 4IFKA 3A22A 3PVFA 3QMSA 3T07A 3EOOA 5GVJA 4G7EB 4XBSA 1DBTA 4PYSA 4PN2A 5EB8A 4Z1CA 3L21A 3BCDA 4Q4PA 4S3BA 2Q3RA 3EZ4A 3IIVA 3IAQA 4ZTYA 4D8AA 3OP2A 3ARYA 2C7FA 5BU9A 3LHWA 3XINA 3RNDA 1XYLA 3OIXA 2NSOA 1O5QA 4B2DD 3H6OA 5JIWA 4A05A 4OBSA 1SSDA 4JZ5A 2FDMA 5C7HA 3IVSA 4ZO9A 3OGRA 1X1ZA 3PS7A 1K4HA 4EPDC 4JICA 1E6NA 3MA8A 4H1ZA 1KBIA 5LIXX 3LGDA 2XFWA 2VWSA 3WLHA 3PB2A 4HTBA 1OBAA 1EXBA 1E6XM 1W56A 2Y88A 3BG5A 4O8RA 1F74A 3KOYA 3OW1A 5HA7A 3OLEA 1F76A 3AAMA 1KLZA 1Q13A 4HK6A 4J5NA 4O52A 4E2DA 3CWOX 1XISA 4IPNB 4JNMA 2FZNA 3ARVA 3RPTA 1RA0A 1ZENA 1FBAA 4XD3A 3RJXA 1ISXA 4NZCA 3NO1A 1NJJA 3GHSA 3I7RA 4AX6A 4FNQA 1WUEA 3GG1A 2E6DA 3N25A 1V77A 3G1RA 4IWWA 1XBVA 1H7OA 4MJ2A 3VCCA 1ME7A 3IRDA 3IGXA 3KBSA 3S5ZA 2PLJA 4XVDA 4A3UA 2NV9A 4IG2B 4IICA 3UCCA 1U22A 2G8ZA 1SSGA 2PTXA 4JXCA 1OC6A 1EDTA 4TX6A 4WXZA 3MW7A 3TNBA 4NNAA 4ZO7A 5HULA 1ZHAA 2PTYA 1XPYA 3DHPA 2VUYA 1VEOA 3IS4A 3ALGA 4HNVA 1R3YA 3C86A 4L4PA 3CHEA 1AZ2A 1H51A 4MZ8A 3SUVA 1HL2A 2DT0A 2XIIA 3ITTA 3E2RA 4DLMA 2PURA 2CXGA 3WJXA 3V4BA 4UR8A 3V0UA 2KAUC 4CU7A 4P8VA 1EC9A 4B4FA 2WMKA 1KCLA 4WY0B 3A3WA 3H4WA 1DYSA 5D03A 1NWRA 2ICSA 3HGJA 3BLLA 4ZQCA 5CPOA 3N34A 3GHTA 1N55A 3UVAA 3BOFA 3AXKA 4GMEA 1GVFA 3R0KA 1BQGA 4ZODA 5C9UA 2V68A 3SUSA 3GC5A 3NR0A 1Y5VA 2V38A 3T2OA 3RF9A 4EPEC 2X2YA 2XN2A 3CLMA 2IKJA 1NOWA 4UMBA 2DUZA 2ZZ5A 4JQ1A 2V3EA 3IK2A 2ZZ1A 2QULA 3TAOA 2DZWA 5K4XA 3IGUA 3TN6A 2J62A 1R7AA 2VOMA 5F4SA 3LPOA 4CN6A 4B5NA 4S3KA 1PX8A 4NZ5A 5E0CA 1QASA 1DE5A 2QF8A 4UMCA 4F0SA 1MI3A 3W82A 1JFXA 4EX4A 4Y90A 2DSUA 3KOFA 4YMZA 1JQVA 4PB5A 3NXFA 5M17A 3BMWA 5H6HA 1LTDA 1DQXA 1DEDA 4DXVA 2BGSA 2D0HA 3AMGA 1IXQA 3KUMA 2CHNA 3U57A 4DWSD 4XKYB 2OWWA 2J7HA 3XISA 3GH4A 1UWAA 2EPKX 4PTWA 3BXWA 1OB0A 2ACRA 1OX5A 4GIAA 2J8TA 1IZCA 1K7FA 2NW0A 4EK7A 2OZ3A 3RM8A 3SURA 5CSUA 1CENA 1YX1A 4DBUA 3L2MA 1RBOB 4C6FA 3EWUA 1ZJAA 4UCFA 3MO7A 4XKMA 4DELA 4ZTXA 1GUVA 3WLKX 1QPNA 3MP3A 2P8BA 1PZ0A 1FHLA 3GIYA 2E40A 5D9NA 4OGZA 1XIIA 1GPWA 3BARA 3F4NA 4WGXA 3T81A 3AS1A 1VBRA 1FH9A 4HQVA 2Y5EA 1OZMA 2CLMA 5EFDA 3CWHA 3II1A 1SFJA 1UHVA 1DWJM 1NFBA 4S3DA 3DYPA 1JGMA 1XINA 1XLLA 4C60A 3APTA 2YR1A 3W2UA 4PZVA 4DJFC 4ADSA 1WZKA 3ES8A 3QY7A 5HWJA 2OT1A 1F3XA 3U48A 2GGEA 2CIPA 4IJBA 4N4PA 4XBKA 3I6RA 4MWAB 1W3HA 2WSRA 1VJIA 1O6IA 2YPIA 3FXYA 1FY6A 4DPPA 4EP8C 1FWDC 3HBLA 2PDXA 4O53A 4QLKA 3UERA 5I77A 1UIPA 3GTHA 5LKYA 1JNEA 3RRXA 1RHCA 3CL7A 5I02A 4BZYA 1RK5A 3W38A 5EMMA 3GXPA 4DWSA 4W5UA 1S5MA 3VKKA 3FX4A 3SB0A 3PB0A 1Q2SA 3VIGA 1NDWA 1XIDA 3EPMA 3VGEA 1RVKA 2G3JA 4DF0A 5LNVA 4GYPC 4YNGA 4KWOA 1HKVA 1UUOA 4UTFA 4US5A 4G2DA 1TRIA 1XGEA 1TZZA 2IPJA 3ZLHA 1SZGA 2V2HA 3U7BA 3HGOA 2VGGA 1BEUA 1W8GA 1C8QA 1OY0A 1KM4A 1D8CA 3U3HA 2UY5A 1H60A 3I6EA 1EPXA 3U8GA 4JIHA 4JTUA 1PXGA 3ZT6A 3DENA 3A9BA 2NUWA 4H19A 1ZCOA 4OKDA 1VKFA 4WXYA 5B7YA 4FS9A 1DWIM 2PODA 3N3MA 2OO0A 4KF1A 1W1VA 1HJQA 4GX8A 2NXHA 3FVDA 4P61A 3ZVIA 4GIEA 1EJTC 2XH7A 1A0EA 4KPLA 1XL9A 4O57A 1R9XA 1TIWA 3SEPA 5AC4A 3AXIA 4E8GA 3SSZA 1RCQA 2VFDA 5HATA 3V5OA 2ACUA 3WK3A 6PTDA 4DO6A 2PDJA 4BEUA 4PA8A 1S1PA 4CQDA 3GVGA 3VD5A 1FDYA 2PD9A 1HKMA 4OE7A 4W9TA 1I9CB 1QOXA 3OA3A 1N8IA 3W81A 2PDNA 1ALDA 1VCGA 3K2GA 5CPSA 1I0DA 1J96A 3S6TA 1W9VA 4GUIA 1EL3A 1XWYA 1E6ZA 1LROA 3G8EA 3NQAA 3USZA 3KL3A 2VI0A 3ABXA 2V9DA 3P8IA 4WR3A 1G67A 5H91A 4KWVA 3N29A 3TJLA 4WGHA 2GUUA 1W3IA 5AYYA 4L1GA 2OMAA 1WBJA 4NI8A 4J3XA 4X3ZA 5F7UA 3PUDA 5GJPA 5EGRA 3IRSA 3P62A 1R5YA 1VFOA 1WDSA 1EHNA 4XISA 1XC6A 3WK1A 3G1HA 1RALA 4C6IA 2V81A 4DBDA 1A5UA 1P1XA 3QPZA 2GGGA 3FJLA 5AHMA 1OFRA 4A8IA 3TYCA 3KTSA 2X2GA 5GQBA 2QVHA 2AGTA 2C14A 3UJFA 2DJLA 3TN3A 3BW4A 1H49A 3WJZA 1WDDA 2XG9A 5F4XA 4LS2A 5EBUA 4UFJA 1UOKA 1W3LA 3EX3A 2C8NA 2CWNA 2MANA 2WC4A 3GTXA 1MQQA 3MI2A 3A5VA 3FAWA 1GG1A 1UPPA 1XRVA 2ZXDA 4RDVA 3P0XA 2MUCA 3VUSA 1ODUA 4IMAA 3ITLA 5JH1A 3MO4A 4CQCA 4PH6A 2DZVA 3IK4A 1BWLA 1MZRA 4HHPA 4I9JA 4NAEA 4R5EA 5A6BD 1GCYA 4TQTA 1K9TA 3QM3A 4Z2GA 4D6FA 1KM0A 3UWZA 4MADA 3U5UA 3N6JA 1BYAA 2WK2A 3PTDA 5DBTA 3E1F1 1P48A 4MLJA 4BWLA 8XIMA 2VD9A 4O50A 1HKKA 4PMYA 1TTPA 5FD0A 4GY0A 4XK2A 3D3FA 2PCEA 4ZB2A 4K2SA 2AL2B 2YCKX 3F5KA 4WVXA 2F38A 2I5IA 5ECUA 5I23A 3W85A 1QU4A 5BROA 5HWNA 3WF0A 3PWGA 3NURA 1TMLA 3SGUA 1BWVA 4B5VA 4TXEA 3WH9A 5FF3A 4UTWC 3M44A 1IEVA 5A3HA 2GQ8A 3CPRA 2ISWA 2GWGA 3ZR4A 4CD4A 2Z7GA 4I8YA 3IJ6A 3UYIA 5LA0A 4E8DA 4Q4QA 1V51A 1TPH1 1TV5A 1GG0A 4LAZA 2WZTA 4IT1A 1XPGA 3FNDA 1OX4A 3LI0A 1UWUA 3NOEA 2O0TA 4E2OA 2WVVB 3OZPA 2R8WA 3QYQA 3IEBA 4G1NA 1FWCC 1NOFA 1UWTA 1WKDA 1V6XA 2ZC1A 1Q6LA 2F9RA 2A2IA 5A6BA 3VMNA 3WNOA 5M1TA 4OZOA 5IBXC 4BI7A 4IXHA 6REQB 5CCZA 3IWPA 1ITUA 3V7PA 5HPCA 3OIHA 5E6YA 4M19A 4R27A 2GUYA 4Q32A 1PEZA 3S42A 2NQZA 3UG4A 4PCFA 4GY7A 3W75A 3TAKA 2J78A 2P3EA 4KERA 3GNPA 1RBLA 2ZUMA 1ICQA 2QCMA 4BF7A 4F0RA 3AS3A 2CEQA 4H8HA 4E4PA 2ZX8A 3RM9A 1FWRA 4OIFA 3LMZA 3RK8A 3UXKA 4WY0F 5HPOA 4JGDA 2ZRYA 1IIHA 1GTHA 1S2UA 1WX0A 4JBRA 2C71A 4ZEPA 4PUWA 3I4EA 4JQ4A 3P8JA 3ATYA 1F3TA 2CESA 2QLYA 3G1SA 4L64A 3Q94A 3I65A 3HG3A 5HK4A 1W9PA 3W29A 3NPUA 4MF4A 5BXTA 3M0JA 3G1FA 4NZFA 1VIZA 4RZ5A 4MYAA 2GVYA 3SCQA 1BSLA 1TQJA 1JCJA 1KRCC 4UZUA 3PULA 4I90A 4UB9A 3UY8A 4HGXA 4FR1A 5LIWX 1HJSA 1QFEA 1UMLA 2DZSA 2O7QA 2OWXA 3BCFA 3IV3A 1SVDA 2A85A 1MDLA 1UP3A 3EA1A 4IX0A 4I6VA 4K8GA 2Y85A 1T40A 2C1GA 1LLWA 3WLSA 3A9IA 1R7OA 3QC0A 3LZ5A 3GRIA 4MYXA 2PA6A 4B9YA 4J28A 7REQA 2EHHA 4AVFA 1BKSA 2F84A 3WZ0E 1WPCA 3N18A 4INFA 3FGCB 3H2AA 3ZVHB 1P7TB 4B5UA 3MP4A 2WOQA 2QAPA 3ID7A 2Z1BA 3L67A 2JQXA 4E2BA 4CNOA 4ICCX 2DQXA 4GC3A 2XWDA 1W32A 1XLIA 4WJEA 4O1BA 4EWJA 1V93A 4B5WA 2PLKA 3NM1A 3NTYA 1POKA 4S23A 3TK7A 3F4CA 4HP5A 3BK0A 3VCRA 4A29A 1GOMA 1NDYA 2VVNA 4H6KA 4LAOA 5C54A 3ZIZA 2NLIA 4EANA 4FNPA 1XBXA 3SQSA 3OVGA 1G7VA 3VMPA 4MG4A 3GAYA 3RU6A 3PC0A 4GI9A 1EX5A 1OFBA 3OBEA 5CC6A 4HK5A 1HQTA 2P53A 1IZJA 4PRRA 3WX7A 3C2VA 3HU7A 2QDGA 3NQGA 1J4EA 1JCXA 1JZ5A 1UKPA 1QHPA 4GQ0A 5AYBA 4E4UA 3DFQA 1F6YA 4OUEA 4S3CA 4L4MA 1KRBC 4C5YA 4MKVA 1W5QA 2VZSA 2WM1A 3AMDA 2WHMA 2PDCA 3PZIA 2OTDA 2Z2UA 2X09A 2ZTKA 4JTDA 3S5YA 3G1AA 2PAJA 4C1KA 1S3HA 4IIEA 3CEUA 1S5TA 1OT1A 8TIMA 1K6WA 4IPLA 1LQ2A 2DFAA 1U1JA 4U5KA 1PPIA 3LK6A 3E0IA 4UQBA 1W5OA 2XPKA 3AOFA 4G6CA 3QTGA 4GH3A 4GBUA 2CXEA 3URAA 2XSBA 3AO0A 3BLDA 3TSBA 1DQUA 4JTRA 3H4XA 3AJXA 4E3TA 2HNHA 4KRUA 1EDQA 1KM6A 1HZYA 1PVNA 4GBDA 2ZZ6A 3ANUA 4CNSA 2OGJA 4GQRA 1GKRA 4B5TA 3VIFA 3LMYA 3LBMA 4JFSA 2CZFA 1GQLA 3BDKA 2XFRA 3ENLA 5JXQA 1TPC1 3VDAA 2FMNA 1WV2A 1J0JA 2VR5A 3GXFA 1JPIA 3PUOA 1LUCA 2XN0A 2R24A 1I2RA 3RX3A 3KL0A 2AAMA 2PZNA 2VX6A 3KWSA 1XDMA 4OTKA 4GCXA 4AQLA 1Y8BA 2VYOA 3RILA 1HJVA 2VC7A 1P4CA 3UZYA 2FQIA 4GZIA 2J9XA 2FGZA 3QHMA 1A4LA 1KKOA 1YPFA 1MXSA 5BRBA 2H8XA 1H3GA 3PUGA 3VNZA 3SADA 4DNMA 3WF2A 3ZLGA 4YVVA 1XRTA 4Q8PA 2WM0A 3DGBA 4L5ZA 2PDIA 1PTAA 1A5LC 1XCWA 4B15A 2J7EA 2ADAA 2GVGA 2QIIA 4NYYA 1VFSA 1I2QA 2FB2A 1YXCA 1DP0A 5AVHA 1ZU8A 3MB9A 4XZIA 2JF7A 5M5DA 1IV8A 1RQBA 2RDWA 2ZA1A 2ZZ7A 3WG6A 3OG3A 4R7OA 3EAUA 5BMWA 5A8NA 3LGEA 2BSLA 2CWXA 3WEZA 3NCOA 2GSJA 4DF2A 2TMDA 4LNCA 4TVCA 4ATWA 3CV2A 3GG0A 1OC5A 3KW3A 1J0HA 4JAWA 1ZBCA 3N2CA 1VR6A 1UP0A 1VFFA 3WQWA 4FX7A 4HN8A 3R7MA 4MZYA 3IJLA 2P76A 4QISA 1FCVA 4OOZA 1FP9A 2FH8A 2NV2A 4S39A 1R2RA 3PN8A 4NAFB 5MKGA 1S5VA 4HU8A 2EAWA 3MKCA 1G4SA 3WF4A 1M5WA 2QQ6A 4IHCA 2XGIA 3WLMA 1QO2A 1KC7A 4W7WA 4DIAA 1ONXA 2BY3A 4CD7A 4XO6A 3QSTA 2CKRA 1K7XA 2IQ0A 4RDZA 1PZ2A 3A23A 3FAXA 2VJXA 2IKIA 4QIUA 1WOAA 4JYEA 3P5YA 5CZKA 1M9HA 3W53A 1REQB 4RNJA 2CBJA 3G5EA 3PPFA 2DPEA 5IDZA 1ICPA 1DWAM 3EKZA 4FSAA 2BS9A 3B03A 5CBBA 2F6XA 4V33A 3I3DA 3K13A 1K77A 3N13A 3A6OA 3OBAA 4PL1A 1EEXA 1I2PA 1XW8A 3LXBA 4WRHA 3UNTA 3KBWA 3LTPA 1GVQA 5C71A 1EP1A 1RY0A 3WBXA 4NIRA 1XM3A 4TVUA 3VIJA 3VNKA 1DKWA 1TJ0A 3BURA 2X05A 1TUXA 4HPHA 5E70A 2W62A 3ABOA 4IQEA 4MSSA 1JAEA 3O1NA 1KFCA 2ZOXA 3WQCA 3PJXA 4QE4A 1UQZA 2R1MA 5FEZA 3LLXA 4C6JA 1KRAC 1MFUA 3D3AA 2FH6A 3P74A 4M3PA 3APYA 3TE9A 1H11A 3FA4A 3RU8X 1A5NC 3DECA 3JZUA 2WZHA 4J1OA 3I68A 4Z0JA 1S38A 4XV0A 5DRIA 3G77A 1EKOA 4DJFA 4MB3A 1UKTA 1UB3A 4MKSA 1BGGA 1LP6A 1WBHA 2J79A 1C9WA 1A50A 3UGRA 1X6NA 3STPA 3GG8A 4HJFA 1IEWA 3IJDA 4WF7A 4IL2A 1ZTVA 3GD6A 1PCKA 4FXSA 3VIOA 3AWOA 2J25A 1LWIA 3BUVA 2CHOA 1F9CA 3DFTA 4W93A 1QNPA 2XUCA 4MJMA 2YBTA 6XIAA 4ES4A 2O4QA 2WMIA 3VE9A 1ZRQA 2PDBA 2A0NA 4NXSA 1IWAA 1Q66A 4JFVA 4NZ4A 4UIOA 4M5PA 3VZYA 4QJ5B 1A0CA 2IW0A 4GYPA 3EKGA 2QDDA 4H00A 2GK1B 3N9KA 5ECVA 3MU7A 3TSMA 3WCZA 3V0SA 1KM1A 3TU9A 4YL2A 1TA3B 2CERA 3N73A 3CGTA 3QW4B 5E0KA 4XUGA 4Z0SA 5D33A 2ANUA 3QMRA 3RLVA 1FX6A 3SY8A 3TDFA 3QKZA 1E6SM 3FV9A 4X9YA 3QJAA 4LYKA 1TTIA 3KS5A 2WMFA 2JF6A 4AHQA 3QY6A 2B7QA 1Q7MA 2ZVRA 3TQPA 2ZRUA 3ONBA 5AKQA 2Y0FA 3P14A 2DT3A 4GNJA 1SO4A 4IXXA 4KW2A 3BAKA 2C15A 4V1YA 2DSVA 3WQ4A 1O5RA 3EB3A 3C6CA 1CXLA 4GISA 5D2VA 3GO2A 2ACSA 5DFAA 1GJWA 1EJWC 2YCJA 3C56A 3T4CA 3F4WA 1US0A 1AJZA 3V35A 4JIEA 2AOSA 4LUIA 4L6OA 3KCJA 2HXTA 3M5YA 1DXFA 2AKZA 2HS8A 1AMYA 1JF5A 3FLUA 4M6QA 4Y7EA 1W1TA 4A21A 4H41A 1QPRA 4ERGA 1WZAA 3C2EA 4ROPA 1JZ6A 1OIMA 1ZBKA 4GQGA 3M0MA 1S2TA 1EQCA 2GQ9A 4AZHA 8RUCA 4KEMA 1Z32X 2AKMA 2WMJA 4UBPC 3WK2A 3KP1A 4TTUA 2E67A 3HMJG 3WH8A 3SBFA 4C6LA 3PFMA 2PSNA 1V6WA 1TZ7A 3B4UA 3PSVA 1H41A 3LSBA 1E55A 3CIXA 1YYAA 3EDJA 3C2RA 3PP7A 1EX1A 1Z42A 2XH4A 3R2GA 2DSWA 2OGYA 3EX2A 3LUTA 1SZFA 3S1WA 1BHGA 2V2CA 3MUIA 3LCIA 5EMJA 3VI2A 1F05A 3B97A 3A4WA 2ZZ4A 1LQ0A 1OC7A 3QZEA 1FXQA 4D72A 1SJAA 1CB2A 3B8IA 1O60A 3E96A 1ECQA 3PTMA 4MNJA 3S9IA 4LU0A 4FIRA 3LX9A 3S9ZA 1S5WA 3SN1A 4LUSA 5C9WA 1OGGA 3E9AA 1PDZA 3IANA 2FPVA 3MZ2A 4UFIA 2WCSA 2HBVA 2ABAA 2R6OA 3CB8A 2Y4SA 1CYGA 2WHJA 3O6YX 3BLPX 3I7QA 4HSNA 3WFZA 4QS6A 1SUXA 1H61A 4LX4A 4B92A 2HVNA 2ZUNA 5HINA 1TVLA 3T8LA 3WQ8A 1B4KA 3OVRA 4LRSA 4W86A 3BLEA 4QTGA 1G4PA 1OF8A 4PMXA 3W7CA 2E4TA 4P2VA 3G2GA 4QCFA 3NSXA 4KCVA 3B9DA 3OYXA 1AK5A 2OSXA 1GORA 1Z7AA 3W6YA 3MWCA 4QP0A 4IMCA 3P84A 5E09A 3UPBA 2D22A 3CO8A 1O68A 2V5JA 3HG2A 2Y61A 3TVAA 4C6NA 3R79A 5BXPA 2DGAA 2RH9A 1SR0A 3QRHA 3LCFA 3REQA 4GJJA 1JZ2A 3ZOAA 1E6QM 1R3QA 1TPEA 3VO0A 1YXYA 4D8LA 1TPDA 3R1ZA 4UTWA 4UFKA 1J6OA 2XVPA 1ZP3A 4XAGA 3ITYA 3INPA 4P7RA 4YPJA 3E0VA 1VP5A 1MYRA 3CYVA 1J9YA 1VPYA 5AZ0A 2VFHA 3T40A 2G5WA 3PZOA 1BRLB 3QTPA 1UJQA 1MDRA 4LY8A 3CHFA 3OLDA 5FJIA 3L2IA 3SCVA 1A53A 3LQGA 1SFSA 3S1XA 4OFCA 4PCSA 1CLVA 4LBUA 3WIJA 4UTIA 3VD7A 5D8WA 4YLWA 3T0DA 1CGTA 3TX9A 2V8ZA 3S2NA 3MYPA 1NU5A 3URQA 4QG9A 5IBXA 4QG8A 3AICA 4DZIA 5I0DA 3FHAA 2P5NA 4TR9A 1ZQ5A 2E9BA 1TVPA 4KWSA 3SY1A 4E3VA 4FF5A 4H3DA 5KEZA 3SJ3A 4DI9A 1JCNA 2ZX5A 2QDHA 4YN5A 3WH7A 2VGFA 3OLIA 1A4MA 2W0UA 1LDCA 4AW7A 2FJUB 1NELA 3CAQA 1B30A 4X0NA 1NSJA 2C13A 2DJXA 3WFAA 2ON3A 3NG3A 2PDHA 2ZTJA 2GVJA 3N17A 4FLRA 4GWEA 4LJ3A 1LM1A 1BTMA 4QEEA 4YTRA 3S2MA 3BW3A 2Z26A 3KBNA 3CQ0A 4PGLA 2VEIA 3SECA 3L4YA 1HKWA 4YTTA 2VEPA 3TYUA 2WQPA 1HUVA 5GPRA 2QUUA 1RJPA 4EE9A 1M41A 3BG9A 5G4HC 3WD3A 1PE1A 4BF5A 3DERA 2VDHA 1C8XA 3C61A 1UR0A 2IQTA 4JTGA 5FKYA 2DZPA 2XN1A 5DELA 3NAVA 1B4EA 5EL1A 4JX4A 4UQ9A 2EGZA 2WLYA 5AYZA 2EBNA 3ZXWA 2ZWYA 2ZX6A 1A49A 4L9XA 4ROQA 4QAWA 3CZJA 1FH7A 1U5JA 1VBHA 5DEZA 3SRHA 4DO7A 3PPCA 2W61A 4IGMA 3FDGA 5CPQA 1QOPA 1CGYA 1HVXA 2WMHA 2WKLA 5LGZA 4AWUA 4NJJA 2WSKA 3KOXA 5DMNA 4LUYA 3EX1A 1EJVC 1I0BA 2GGIA 3KHDA 2YKKA 3WMBA 2GFTA 3PAJA 5GJMA 1HG3A 1Z9AA 3M0ZA 3NL3A 5IDIA 3HPFA 3N12A 5HMFA 5KZMA 1YPIA 2ONEA 3MSGA 4ORIA 1ITCA 2SFPA 1XLKA 3TP4A 1PWMA 3W7MA 2P8CA 3OLGA 5CJMA 5C2CA 3WLTA 4HNTA 3TZFA 1HIZA 4FNRA 3R0UA 2FPYA 4A3YA 4J3UA 2VENA 2WAGA 3VGHA 2NQJA 1E4LA 3W7RA 1O1ZA 3CK5A 2G3MA 5I3HA 1B5TA 5K2ZA 3L4XA 2HISA 3LCHA 3P93A 5ABFA 1IEQA 3FYOA 4UOZA 1GQKA 3CWNA 3MPGA 1BD0A 3CMJA 1ZSXA 3TNOA 2FIQA 3TR9A 3AYRA 3EWZA 1ML1A 2ZUSA 1Q6OA 1SFTA 3MBFA 3L7RA 4PMRA 2C18A 3GXNA 2VFEA 1GYNA 1Q63A 1W1IE 1OCNA 3YPIA 3L68A 3EKLA 3CS2A 1E5JA 4D6JA 4YWSA 3NZPA 4NRRA 3R8HA 1Y65A 3O0FA 3R0DA 3E2SA 3BW2A 1LLZA 1NFGA 3AALA 5L6UA 3W76A 3R4IA 1O1HA 1FWWA 3ARQA 1G4TA 4JNZA 4XZBA 2CZDA 3ONCA 4WHBA 2OKOA 4MAZA 4Q4SA 4JTTA 2PC4A 3NVTA 3FEQA 1K70A 1X39A 5I3IA 1W3KA 1KNWA 2Z27A 4NKCA 1TWIA 4L6DA 1XLMA 1XD1A 4PR4A 2NWRA 3ABRA 3G0SA 5EBAA 4R88A 2VDGA 4ZB0A 3WJSA 3ERPA 4HHMA 4GYJA 5FEPA 1UZHA 3V3WA 3ZT7A 5KITA 4MB1A 5BW6A 4QFUA 1DJYA 1FWTA 4HBKA 4DJDD 3CYJA 1RPXA 2ZX9A 2J13A 1XYBA 1QRQA 1E6PA 3UYCA 5XIAA 3O7UA 4IF2A 1E9YB 3GHUA 3WJYA 4A2RA 2EPHA 5I3GA 5JU6A 3UCQA 3I3EA 3PZNA 4XSMA 1W2VA 1CZ1A 2WV8A 4RNHA 1OFDA 3VABA 2X16A 4QXIA 4U3CA 4EAYA 1RSCA 1JPMA 1U5VA 3PNUA 4Y9NA 5BRQA 4XZHA 3UZZA 4D1JA 1SZNA 1S2VA 5LA1A 3TQ0A 2NVAA 4IQDA 4Z2LA 3H2MA 2OLHA 5CKSA 4FP1A 3MSYA 2X7VA 3ZT5A 4MJZA 3TW7A 1WZLA 3DKJA 3O63A 6A3HA 4ZFCA 2Z1KA 2XIMA 2NQHA 1GVOA 4NX5A 3CQKA 2R14A 3P82A 2R9RA 4UR7A 1JI2A 1QWGA 3A4XA 1EDGA 3BCJA 4I6KA 7ODCA 1R87A 3ARTA 4XIAA 5T9CE 1E40A 3C2YA 1JZ3A 4NAEB 1YADA 1OABA 2Z1VA 1OEPA 2XFFA 3C0LA 2VFFA 1TPB1 4Y6GA 1X7IA 4LVBA 4GINA 2UY4A 2X1IA 3UXDA 3GSMA 1ISYA 2R94A 5CSYA 4Z1BA 4M56A 4WLCA 3CZGA 3ZMRA 1KCXA 1FCUA 3OU8A 3TFXA 2IPFA 4C91A 4JTSA 1KKRA 2H3DA 1HNYA 3CUXA 4Q4KA 1DJGA 4PFHA 4ZQOA 4MWAC 3WQVA 3G3MA 2CBIA 4LGXA 1JUEA 1TJ2A 1K9EA 4HSHA 3RUBL 7TIMA 1D9EA 3LNMA 3AIEA 4JTCA 1TV8A 5SWUA 1HKIA 4DY1A 4PRTA 1CEOA 4D8ZA 4R9XA 1L6SA 5M3WA 4FOKA 3JVAA 3SDOA 2JIEA 4AISA 3RFAA 2E5CA 4CD8A 3CH0A 3SIMA 2VCBA 1ITXA 5BZAA 3EWWA 2VZTA 1E9IA 4EPKA 3NQFA 2WVTA 4ZE4A 4MDPA 1HP5A 1EXPA 1MW3A 1DVJA 1OX4B 2QGYA 2JGQA 1LOSA 3RO8A 1BSIA 4ZXOA 2EJ1A 2F6UA 3NEVA 3HOJA 4NVTA 5I06A 4HK7A 1JDDA 1IWBA 3MJYA 1XLAA 1PYFA 1PSCA 3TFCA 1GVSA 3N2TA 2VT0A 3UJSA 1PCWA 1CT5A 3W26A 3TC3A 3FA5A 3KVJA 2DDXA 3RCNA 4MUPA 4NG3A 1CGWA 4Y9OA 3B8SA 2YYUA 2OEJA 1I6NA 4G7FA 4JQ2A 1RJRA 3NVDA 3TTSA 1PZ1A 4BK9A 4UTKA 3EMZA 2VD8A 3L5AA 4DNHA 4EWND 1ZS2A 3AIVA 1AFSA 3TTOA 1TPWA 1UMYA 5A6MA 3TZNA 2YGYA 3H7VA 3QPYA 3GTFA 1ZUAX 2YA0A 3EYPA 5F4WA 4O10A 3PBVA 3B0VC 3SQLA 3WBWA 3VXGA 4JIQA 2B31A 3BZGA 3W02A 3W7KA 3WDIA 4MY1A 1MEHA 3CV6A 1AH0A 3CQIA 1A47A 3KRZA 4FA3A 2DQWA 1EA0A 3EDFA 4DUXA 4M1RA 4OT7A 1FXPA 5C9RA 1IQ8A 1XLHA 4IMEA 2PF0A 1Q8JA 3VFLA 3W6LA 1BVWA 4C90A 4HMEA 2BY2A 3LD5A 4IJCA 3ZR5A 2ABBA 3VDGA 3JUGA 1UD8A 1CDGA 1JPHA 4HMNA 3N9SA 4JYFA 3E2VA 1OHLA 3HQPA 3DFOA 1R6WA 3MMUA 4PC8A 3GDMA 4GKTA 3QC3A 1VFUA 1J01A 1VD6A 5ABEA 4TMCA 1IXPA 4L6HA 3GIPA 1IIGA 2B7PA 3A47A 4HMDA 1W1A1 4I8DA 4YCOA 4QQUA 4EXQA 3TROA 2OB3A 2W79A 5F2LA 5A6SA 3VOCA 7REQB 3CASA 3NIYA 2V67A 4AD0A 1DWFM 4JTAA 3WNLA 1V03A 1JZ4A 4X2RA 1KLYA 1C92A 2J47A 1O4UA 4UNIA 3FKKA 1H62A 4QLLA 3GY1A 2PFHA 3BGJA 1FWFC 1I60A 2ASHA 3N9RA 4KFNA 2INFA 4WEVX 1E15A 4UOJA 1XUZA 2C79A 1K6AA 1T96A 1YDYA 4H83A 4I9TA 1J2WA 5CQ1A 3W7QA 2Z28A 3WQ5A 1DV7A 5C5YA 1QK0A 2RDUA 3URNA 3W37A 1KQZA 2HTMA 5CGTA 4ONVA 2PGEA 4KEUA 4CVWA 1H5YA 3EDKA 5DRCA 2Y62A 4FNSA 3AMCA 5FJJA 1I45A 1M01A 4W8BA 1P0BA 2XGZA 4PODA 1Q65A 1MQRA 2GGHA 1GYMA 1UH3A 4DF1A 4JTLA 4XAZA 3QBUA 2C0AA 2A7RA 2YIHA 3KOZA 4U2ZA 3UWUA 3V1PA 5I3DA 3DYOA 1TV7A 1M53A 1WXJA 2V82A 3R5EA 3VA8A 1O5XA 2A5HA 4LWWA 4KEZA 4C6QA 4O1AA 2DVTA 1EUNA 2IXUA 3LCWA 4FB7A 2FJKA 4EF9A 1RR2A 3H4GA 3WENA 3B8WA 3HG5A 3TR2A 3S5SA 1KGWA 3LLDA 3WH6A 1OK6A 1XLDA 4FI4A 5C7VA 3A13A 4H2HA 5JBFA 1X6UA 3BO9A 2YJQA 5AYIA 3JR2A 4MNLA 5CPMA 2QCHA 4LYPA 3NSMA 1ME9A 4WZHA 2BY1A 1EP2A 2GJRA 4ZO6A 3UNDA 2ZZ2A 4ZMGA 1XIJA 4GYKA 4NJGA 4O1EA 1UWSA 2OX1A 3A4AA 4UFLA 2E9LA 2WNNA 4A3HA 2YLAA 3QZAA 4M29A 1V3JA 4HNNA 3DFNA 5FL0A 3ITVA 1CCWB 3KRBA 4CCDA 1BYBA 3LGGA 1KFKA 4HPJA 2WKJA 4N9BA 1MEIA 2A6NA 3K8KA 1THFD 3MCNA 3W4RA 1XYZA 3H2FA 3VDCA 1JDFA 2V5BA 4HNUA 1EJRC 5IM51 2J7GA 1RH9A 3VGDA 5IOBA 1WCGA 4F2BA 3FJ6A 1F61A 2PRHA 3VFCA 1X98A 3WBYA 3CIWA 4ICMA 3RRAA 1XICA 4GH1A 2XWEA 3GX9A 3Q4DA 3PBWA 2TRSA 2JIWA 2OOGA 4HN4A 5KMYA 1OJXA 5IHRA 1MRQA 1R38A 4BQ5A 4JTKA 3NQBA 4PFMA 4QS5A 1NVMA 4HNLA 3HQOA 4DX3A 4ICNA 2CNCA 2C6QA 1DXEA 3V75A 3K1GA 4AD5A 2XHYA 1O7AA 5AHNA 3PPHA 2V2DA 1AH4A 1EP3A 4DB7A 2F2KA 1LRQA 2H9AA 1OCJA 1F6KA 7CGTA 3THAA 4AZ7A 3ICJA 3V0TA 4GLEA 1XP3A 3SI9A 1W31A 3L12A 4PRWA 2BBFA 4OUIA 2VELA 2Z29A 3VC6A 5MKGB 2J8FA 3EB2A 4MKNA 2QJIA 1VBJA 1XJBA 1R86A 5XINA 1OZQA 5U4NA 2YXOA 1YTDA 3GG7A 2VR2A 4RV8A 4B3ZA 3R43A 3UD6A 1I2OA 1NDZA 4O17A 4I5XA 1E9ZB 3GYCA 2JKEA 4RW5A 1JUBA 3NZ1A 3RLUA 3BV7A 2GJLA 3B40A 3IV8A 2QJNA 3QR0A 3BSGA 4YJ5A 5A2BA 4URIA 3WSUA 2WJZA 5A6JA 4K1GA 3CHDA 4YS1A 4QEHA 5CJ5A 1OFAA 4I7UA 1JPKA 4XZ9A 2UZ9A 1TV2A 4IMDA 3AIWA 4CEUC 4HA1A 5FAGA 1VGAA 3EGJA 4O0ZA 1S1RA 3B04A 2Y7DA 1TCMA 3VM7A 3HQNA 4GGHA 2X7WA 1AG1O 2YL5A 4PSRA 2VQTA 3O8AA 2G37A 1UD5A 4MOZA 3GXIA 3DYMA 1G1YA 5I3KA 4WK9A 4AZ5A 4HA3A 2PGWA 1PJ9A 1IT8A 1T7LA 4JY8A 3L4WA 1Z89A 4BQ3A 3IGHX 3WDPP 1T5AA 1RZMA 3N1AA 4B5SA 1U1UA 2A7PA 1LL7A 4MMWA 3L66A 1ZAHA 2V0TA 4F8XA 1N8WA 4AMCA 1PTGA 1G6CA 2H6RA 1HW6A 1AZ1A 4LB4A 1U1HA 3M6YA 2CW6A 3G22A 3LENA 3QV8A 2ZXAA 3P7YA 3B05A 5AECA 1J0KA 1AVAA 4Z1AA 5J8LA 1E4NA 1W3NA 4O19A 1HO1A 2E77A 3OGSA 4KBXA 3B8VA 1PL9A 4PTVA 3VPLA 1WDQA 1IYXA 1LG1A 4HU4A 3QPEA 1L2QA 1MNZA 3BSHA 3T8QA 2RDXA 1DPMA 3G3DA 2DZTA 2ACQA 2OYLA 2X40A 2QPSA 1PBGA 4BI6A 1FWAC 4EXAA 3OOQA 4ZOCA 2WWCA 1H2JA 2WMIB 3FA3A 3NL2A 3P80A 2X1UA 1RLCL 3DKLA 1V3LA 2ZWZA 4NX0A 4ENLA 4DPQA 4O4VA 1XCFA 5FF4A 3PHAA 2PS2A 5G2IA 1B2YA 4M81A 3B9AA 4H4IA 1E4MM 3N4AA 4ZZ9A 1M7JA 4L56A 1FWBC 2FGLA 3N04A 2W9MA 4UQEA 1GJPA 4D1IA 2JEPA 4OECA 3TC7A 1W9UA 1OYAA 4QM1A 3QFEA 2PI6A 3GNOA 1PYMA 5C70A 5IRPA 1CWYA 3E0FA 4U31A 4FOUA 1VC4A 1XGZA 4R85A 4DAIA 3LG3A 4K7VA 3WBEA 1E4IA 3NDYA 1GHRA 1KBLA 4OJYA 1L2UA 1RLDA 2BGNE 1J79A 1QI0A 3EMQA 4AYSA 1EJXC 2HPIA 1XFBA 5H8MA 1UKSA 2VTFA 3PWIA 4GJ1A 1OADA 4LYQA 4XAFA 2GL5A 5AC5A 2RHGA 5KSWA 1CXIA 5DT5A 1XRFA 3IJ8A 3UWEA 3WLNA 1YE6A 1N7KA 1V0NA 1BG9A 1W3TA 1Q6EA 3EDEA 1R0MA 3DX5A 4NHVA 3ARPA 4FXFA 5G1MA 1H7PA 5K9XA 2XSAA 3W74A 3PZGA 2UY2A 2WYSA 4HTYA 5A8PA 2ZVIA 1VLIA 4GPNA 3R6IA 5AC6A 3CU2A 1JXJA 4UWMA 3UP8A 3GDTA 1ZY9A 1R8LA 5LA2A 2FMOA 5D04C 1XLCA 2TSYA 3DUGA 3ELFA 4CU6A 2NT0A 4JFUA 4NRSA 4M7SA 2VMFA 4O0QA 2C0HA 4MWAD 2QJHA 3VILA 2VC6A 1JJKA 3LB0A 3PBMA 1DTNA 2DT1A 1HGYA 1VEMA 3AMLA 1IT0A 2PDWA 3POHA 4NILA 3VC5A 3UPWA 3UETA 4W4QA 3GC4A 4IP5A 1R3VA 3GE7A 2FTWA 4LUSB 4QDWA 1VHNA 3S2LA 2GYIA 4RZBA 3NQ7A 3CTLA 1US3A 2AQOA 3DC8A 4H9ZA 3BMVA 3RDKA 1VYPX 3TJXA 3K4WA 2A6LA 3QVQA 5FF0A 1P0EA 2OWCA 4WCJA 3ZM8A 2RJHA 3CMFA 3AZSA 3GVWA 4GIRA 2PD5A 1XQKA 1XSKA 2Y5SA 1UD6A 4ORMA 1A0DA 3H7UA 2ZA3A 1IEXA 4LH8A 1A3HA 3HZ3A 3W7PA 4GFSA 4WKHA 1YXDA 1HVQA 1RVGA 1OM0A 3RIKA 5RUBA 2C19A 3KE0A 2ZRZA 4UNLA 5HQMA 3WK0A 3P61A 1IR1A 1VFTA 4Q4MA 1UQYA 3PY2A 4C7FA 4RDYA 3C4UA 3ARWA 4MWAA 2D2GA 1TPFA 3AQUA 3REQB 4BF9A 3VNIA 1PKMA 4KEVA 1JNDA 1N8FA 2Z00A 5G5IA 1WKEA 2FZ8A 1TE6A 4Y9PA 2WWDA 4P8UA 1R85A 3O16A 1W17A 2OQHA 4RZ4A 1FFRA 2E1WA 5GJNA 3SFWA 4Q7IA 3JRKA 4H9VA 1NF0A 3F4VA 1KWKA 1MVYA 1RUSA 3H23A 3TQVA 4DRSA 2J66A 2ZRWA 4JTJA 3L4ZA 1UD4A 4UTMA 2ZFAA 4B2DA 3ARRA 4E2VA 4RPQA 1WXYA 3H2OA 4OQVA 2AMGA 5LXEA 1KD0A 5D2YA 1YW1A 3T78A 3W1LA 3B9NA 3AYVA 1MW2A 4XIMA 3CV7A 1OD8A 3KCOA 2Y8VA 2PWGA 2G4JA 4PCNA 3DHFA 4Q6JA 2WO5A 4HCLA 1MXGA 1V4YA 3KAOA 3PR2A 3SRKA 3FKRA 4ILSA 4ZSTA 1E0XA 1FDJA 3IAPA 2O9OA 1MUMA 5GNZA 4DO4A 3HMCA 4NQ1A 3UY7A 1JQXA 3G6MA 2QCGA 1E6RA 4GOAA 4NZ1A 4LS1A 1JDAA 5D37A 4MAVA 2O9PA 1P6BA 1A5BA 2VRKA 5E6ZA 3WLOA 1X1OA 1TB3A 2WKGA 2QHAA 3SCUA 4CU8A 2Q8XA 3W1UA 5LHEA 2VUNA 3MANA 1X8FA 2P3ZA 3UR2A 1LL4A 1XDJA 5REQB 2IPGA 4LUTA 4FXJA 3N2BA 1GW9A 1VLWA 1U83A 1UH4A 1SGJA 3WEMA 1MRAA 1KGUA 2B7NA 1K7EA 2WPBA 3NQVA 4UCGA 1ZAIA 3V1HA 4Z17A 4F3HA 1IWPA 3QLDA 3QQ0A 5E0FA 4Y96A 5DX7A 4WJ8A 1NQ6A 4IPIA 2ZICA 3V5FA 4Q7BA 5FIPA 2ESCA 3BTNA 3GBDA 4ML9A 3NGJA 1DOSA 2J7CA 1RJQA 2EPOA 4GO8A 4S3GA 2HJPA 3H70A 4UR9A 3DBNA 3D0CA 2FZMA 1OSEA 4UOQA 4F79A 2Z2AA 5HQEA 1RY8A 4N02A 2ATSA 4AY7A 2PLMA 4L9YA 5G1TA 3H2EA 3BLOA 4QE1A 2YL9A 1NEYA 4XAYA 3C8FA 3VD9A 5CZSA 2D3LA 5A8GA 1KB3A 3QV9A 4GK8A 4YIWA 4F4RA 4JDBA 4FIQA 4R3UA 1V02A 3T1GA 1J2BA 1AJ0A 3POCA 1V3KA 2VOTA 4IH3A 4C1NA 4B9ZA 1M7OA 5CXPA 2WW5A 2OFJA 3BAYA 1JYVA 1XRSA 2D23A 3ZLFA 1LBFA 1OYBA 4H7CA 5HNRA 1KFWA 3TWAA 2DV0A 1HFBA 2JK2A 4I5RA 5T8GA 2J7DA 4H04A 4MZ1A 5C6MA 3SM0A 3MUCA 2FGBA 3GM8A 2X8RA 1ADSA 3MC5A 1N2VA 3EEZA 4JCMA 4I7VA 3TH6A 3ZSSA 3AI0A 3NWRA 2BTMA 5ABFB 3R94A 4L80A 5I2UA 3MJMA 3RR1A 3AYSA 1R30A 2BODX 5ABTA 1PKLA 2H90A 5A6KA 5A6AA 3CBWA 1ZAJA 4GFIA 4IIGA 1JD9A 2AL2A 2W3ZA 4AZGA 1IZKA 1UH2A 3ABZA 3B8UA 1C7SA 2J74A 3MT1A 3RX2A 2CETA 3CEPA 4AD3A 1YDVA 1P43A 2DH3A 3W83A 3TYEA 1M03A 4POCA 3MCOA 1L6YA 3AC0A 5BWAA 2RDTA 3W1XA 1J8VA 4CNPA 1W5PA 5E93A 1HGWA 3OVPA 1L6GA 3BL3A 5DQPA 3OZMA 1K9FA 1DJIA 5BWFA 3GQYA 4LC6A 2VC9A 2VVSA 3K4AA 2J27A 1BXBA 1CB7B 3NPVA 5XIMA 3T44A 2Q71A 3MMWA 3CC1A 2YCLA 4PUNA 1W5MA 2PP1A 1B57A 5C0QA 3CJPA 2GPTA 3ZQ9A 3LV5A 5JH2A 5FOOA 6ALDA 2BVTA 4YCPA 4F0MA 4D6IA 1JVNA 1Z41A 4J3ZA 4GIYA 3W3OA 2EG8A 1TVNA 4K6AA 3KZPA 2BNJA 3E0LA 1GZGA 4KETA 4IPPA 5KTLA 1V6VA 3PZ9A 2XISA 4WX2A 2QCFA 3BAXA 3LRMA 1PKYA 3HFYA 1DWHM 5FL1A 3CUFA 3CV1A 1XIHA 1ZL1A 4X60A 3EMCA 4D6EA 1GOKA 1CLXA 4EXBA 1EEPA 3GR7A 3QGVA 3CNYA 3ZJ8A 2I1OA 4ZVJA 4MFEA 3G8RA 1C9DA 2POZA 4RR4A 1QHZA 2VGIA 3KLKA 2RKXA 1F6PA 2YLLA 1EPVA 4M0XA 4UUIA 3UF9A 1DE6A 2J7BA 1GOWA 4PUMA 4JYDA 2WJFA 3OA5A 4W5ZA 2TODA 3Q58A 2J75A 2PDMA 3GNDA 2W63A 4P5UA 2HMCA 1F4AA 3NL5A 1UBPC 1AA1B 2DH2A 3OQEA 3WDHA 1QTWA 4H8UA 1OFEA 1B3YA 1XYFA 1QI5A 2TYSA 3R13A 2BVYA 1PO9A 1XBYA 3GTIA 1P5BA 1VRDA 3UG5A 1IXNA 1R2SA 1E3XA 5EPDA 5D09A 3G18A 4Q8WA 3UXLA 2Z4GA 1PX4A 5LNUA 5H8PA 5HOSA 3T4WA 4W8LA 2PPGA 3TTQA 1UKQA 4IFOA 3V36A 3LU2A 4QSHA 1GT8A 4K37A 4M8UA 4DBEA 3U2CA 5JBDA 4JIIX 1V08A 1R9YA 1PZ3A 2QEZA 2J7FA 3R11A 2V5DA 2DSZA 3FHQA 1MW1A 2YZ5A 1X38A 4J4KA 5FI8A 1SW3A 3KXQA 1YBQA 1QNVA 2YW4A 3PTKA 1X96A 2VO5A 3AXXA 3U2EA 3W28A 3CIVA 3V18A 3R25A 5EMKA 1C91A 4YYFA 3AROA 3E3HA 3NEHA 4YU1A 2QUNA 1J5TA 3DESA 3CHVA 5HANA 2Y7EA 4MHBA 3M07A 4GI4A 2ZDSA 5A8OA 3EA2A 2Z2BA 4Z42C 2Q02A 3TOYA 2MNRA 2EG6A 4GG9A 4CNUA 3UJEA 1S3TC 2IUZA 1O12A 2VURA 3ABSA 4NI3A 9XIAA 5HJLA 3FIGA 3SCNA 4YTQA 1T99A 1H0GA 4DWDA 1FKXA 4IIFA 1YDNA 1MQPA 1JGIA 1JCTA 1SW0A 3IIXA 5A95A 4B5XA 1V0LA 5I3FA 1YRRA 1LBLA 4MGGA 1S2CA 1EJUC 3CUZA 4BEQA 2ZA2A 5CJNA 1CLKA 2G0WA 5FJOA 3DHUA 1NWSA 3GS6A 2Y2WA 4QNWA 5DMMA 1NIUA 2OYKA 5DT7A 1KGXA 3GDRA 4OV9A 1JL8A 4XZWA 3RHGA 4J9JA 2HNEA 2OPJA 5HAOA 4TX9A 3RG6A 4FLSA 3LSCA 3R8RA 2DIEA 4QX4A 1WO2A 1LYXA 2CLIA 3NPXA 1W1ZA 3TJ4A 1EYEA 1EJ7L 1SQ7A 2XM2A 4PUKA 1F3WA 1YTKA 3GDKA 1ONRA 1FQ0A 1FH8A 3DN5A 2ISVA 4LRTA 4AEOA 3HFTA 2PF8A 4GXPA 1U5HA 2WHLA 2VZVA 3SUUA 1TQXA 5GNXA 4DXKA 3AUJA 5D2TA 5JMUA 5DXYA 1P6WA 3O0KA 1D3CA 1TWZA 3LTYA 3LBOA 4QR6A 4AZCA 3PK7A 4TV6A 3B0PA 5BNKA 4KIEA 1WDRA 4US6A 3TOPA 1Z69A 5E5CA 1AJ2A 3VMOA 1F5ZA 4A8LA 2P88A 1QATA 3W27A 4S3FA 4A4AA 3SR7A 3ZS4A 3GIQA 3BLFA 5K7JA 4AHPA 4CN1A 2UY3A 5AB3A 4NP7A 4FK9A 3LYEA 4A3RA 3E2QA 3W7DA 2W5FA 4P8XA 1UG6A 3AU2A 4DM1A 2A7NA 4PMUA 4WIWA 4UTHA 5I07A 2QCDA 3C2FA 1HP4A 3J7HA 3PZMA 1SPQA 4U33A 3PBYA 3CUIA 4W87A 1LL6A 2R1NA 3LDVA 3UJ2A 1F3EA 3VZXA 4PBGA 3IUHA 1LOQA 3R58A 3ZO9A 3GNNA 4KGLA 3RO6A 5L9FA 2QAFA 2PEVA 4JPGA 2NVCA 4JTIA 1JI1A 3SRDA 1VBUA 1H09A 4CEXC 3LM7A 1SJDA 3IPWA 1UASA 1GOIA 3VOIA 1VF8A 2WJEA 1KXVA 4RE2A 1P1MA 2V5CA 1VFHA 2YDQA 1RV8A 2YBUA 4C6DA 1SW7A 1UWQA 4LVGA 5HNTA 5BXSA 1I75A 3CAKA 1VJSA 2ZXBA 1GVIA 5D05A 2OG9A 3HGRA 1E71M 4KCWA 2E0PA 2EQDA 1XKJA 5MHBA 1LT7A 1EOKA 2DT2A 4AB4A 8XIAA 1OGSA 3AISA 4GCAA 1F8IA 2OEKA 1AODA 1Z8AA 2C16A 3AS0A 3QSRA 3P3BA 4N6EA 4XSLA 3IIZA 4HIBA 4AY8A 2X41A 1OFOA 1ONWA 5H1WA 1FHDA 1T8QA 2Z1WA 2QJMA 4MDOA 4QQ3A 3M5VA 5DCBA 3CQJA 1UYQA 3WQGA 2WXDM 1JUKA 4QBXA 1MUCA 3BGGA 1OF6A 2PDLA 1EHAA 2OOFA 1VS1A 4J2MA 4TMBA 5CZJA 2VEMA 2WSPA 4HU3A 1UZ4A 2KX9A 1UC5A 1G0CA 1TTJA 3ZJ7A 4JQ3A 1YPXA 2F8QA 3W1AA 3IACA 3M41A 2YA2A 3LHUA 2Y7GA 4GABA 5H8UA 3KRUA 2BVDA 7A3HA 2EKCA 2A21A 1TWDA 1H7XA 4XD4A 5U7SA 3UWVA 4NJIA 3DAQA 4PB4A 4WD0A 1A80A 1J11A 4DBSA 1OK4A 1S39A 3OB8A 1GVYA 3M0IA 2CYGA 4MY8A 4HZ6A 4QJ1A 1UIOA 4PMNA 4UQAA 2XVGA 1LORA 1UD2A 2REQA 2WZMA 3OTRA 1GTEA 4O1DA 3RAOA 3KZSA 2HS6A 3PSWA 1FWHC 1ODZA 2ATMA 2PUZA 3AZTA 3WEOA 5HJYA 1XC4A 3KBVA 3M7WA 4JNYA 1S2WA 3GH7A 3VKDA 1MEWA 3UG3A 2EJAA 1Q45A 4S3EA 4MNKA 1EWEA 3F5LA 2VX5A 3LS9A 2CCRA 1TMQA 3MKVA 2YDAA 5B7ZA 1M1BA 1WP6A 4E38A 4GVGA 1XCXA 2C1HA 4J3VA 3DOPA 5AHFA 2G3NA 3WDRA 3UQNA 2GVEA 4K38A 2Z0IA 4WDUA 3M0VA 1ZP4A 1EWDA 1E56A 3SCOA 1MXDA 4WQ6A 3M0HA 2GK1A 3AMKA 1CNVA 3ARXA 2H9AB 2JFEX 4OVXA 1W37A 1QVBA 3THDA 2E5BA 4AXKA 3E49A 4CD6A 1B54A 4QAIA 1UP2A 3B3DA 1PIGA 4MLRA 1E5NA 2GSEA 1LJYA 5D2XA 3QGAC 3QQWA 2Y89A 2WJDA 1XLFA 4O54A 2Y8UA 1JDCA 1B1YA 3HQ1A 3G1YA 4MVAA 2GJPA 5TNVA 1DIEA 1F07A 4JEQA 1CXEA 3C3UA 1R46A 3K30A 3LHYA 1RCXB 1BTCA 4QLJA 3D6NA 4JEJA 4S2BA 2FFIA 4PMZA 1ME8A 1PIIA 1Q6DA 1RP9A 2TAAA 2Y7FA 3QZ6A 3VNYA 3LY0A 3TXZA 1VPXA 3OEXA 1DORA 5LSMA 2OJPA 2X1RA 4M80A 1C7TA 1MW0A 4QJ4B 3AZRA 3BWWA 2J88A 1Y0EA 1AL7A 4KFPA 3ZWTA 1XUUA 2BZNA 4N6FA 2NUXA 2RUSA 2WZEA 4OBTA 1G69A 4DJDC 1OYCA 5E9XA 3UZWA 2JEQA 3OYZA 4LV9A 2W92A 4D6HA 1D7KA 3P6LA 1FCBA 4TU1A 5I09A 1NP2A 3CUHA 1KXTA 2E6AA 4P7OA 3GK0A 4GUFA 1QI4A 1J0IA