2A7PA

Crystal structure of the g81a mutant of the active chimera of (s)-mandelate dehydrogenase in complex with its substrate 3-indolelactate
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
353
structure length
353
Chain Sequence
NLFNVEDYRKLAQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNRFKIPPFLTLKNFEGIDLGKMDKANLEMQAALMSRQMDASFNWEALRWLRDLWPHKLLVKGLLSAEDADRCIAEGADGVILSNHGGRQLDCAISPMEVLAQSVAKTGKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLLKADIDRTLAQIGCPDITSLSPDYLQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the G81A mutant form of the active chimera of (S)-mandelate dehydrogenase and its complex with two of its substrates.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords (S)-Mandelate Dehydrogenase
total genus 127
structure length 353
sequence length 353
ec nomenclature ec 1.1.3.15: (S)-2-hydroxy-acid oxidase.
pdb deposition date 2005-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2a7pA00
8TIMA 3NQFA 4TU1A 5D04C 5KZDA 5CSRA 4Z0JA 4JYEA 4K36A 4XZ9A 1ZCOA 3EKLA 3HG2A 4WY0A 4MZYA 3R89A 1TJRA 2ZYFA 4CNOA 4OE7A 4YL2A 4M7TA 2OJPA 1I8JA 4JTGA 3TQKA 2VENA 2FLIA 4XKYA 1NFBA 1LROA 3BK0A 3KVJA 4Z08A 4UIOA 3UWVA 3DH7A 4NVTA 3RFAA 1QO2A 3EWWA 3FFSA 2NUXA 1SO6A 4O17A 3W70A 1LBLA 2CU0A 3CC1A 3LRLA 1YDNA 1WYIA 4GE8A 1OG0A 3CWNA 1B3OA 3B0UX 4HNTA 1QPRA 3LTSA 5FF7A 5KZEA 2DZTA 3S8HA 3NYZA 3FYPA 2ZFAA 3KRSA 2NUWA 2Z6IA 4K37A 3SZ8A 5F4SA 2Q8LA 1H7OA 1MXSA 1YXYA 3W7HA 3B06A 1OYBA 4LV9A 1MEHA 2P10A 3H54A 3LHZA 1KTNA 1GG0A 2G96A 1CW2A 3ABQA 3LCXA 1TQJA 3PSWA 3K30A 5D32A 3C61A 4GFSA 4AHOA 2LLEA 5HR6A 2PRLA 1LTDA 3EX1A 3G1AA 3G1FA 4LS1A 2H3BA 2QCNA 3ANYA 3GNNA 3W7MA 5D2YA 2R8WA 2GJLA 1WBHA 2E1DA 1EIXA 4OT7A 1FX6A 1GVFA 3T40A 1ZENA 5IBXA 1U5JA 4AH7A 4UFLA 3GK0A 3LHWA 3HOJA 2YYUA 4OBTA 1BWKA 3W1AA 4RZ4A 1Q45A 2UV8G 1XBYA 2TSYA 3OVRA 4LT9A 4O12A 4M5PA 1XDMA 3TXZA 3G1DA 4NJHA 4FX7A 3MYPA 4GUIA 3I7RA 3STEA 2WSQA 4K7YA 2R94A 4MLJA 1M7PA 1O5KA 3ABRA 3W7QA 3PBVA 2DZVA 3PBUA 1L9WA 4ADSA 2Q3RA 2E6AA 3UQNA 1IXNA 4K38A 5C55A 3VNDA 1IIHA 2R14A 3NNTA 4OV4A 2G95A 1TIMA 2QCMA 5F4XA 4K8EA 4AF0B 5K4ZA 1NF0A 5HWJA 3TSDA 4UFMA 3CHVA 1G4SA 4LVFA 4JTFA 5KINA 5AC8A 1K7EA 3DU0A 2Y7FA 3LM7A 1AW5A 4IPIA 3ATZA 3L0GA 5C54A 4LUJA 1P1XA 4L4MA 2Y88A 3FS2A 1MSSA 1Q6OA 1I2RA 1G7VA 4Y96A 3W6YA 3PVFA 2EHHA 5DCBA 3TXVA 1N7KA 3A5VA 3NPXA 5AC7A 1B4KA 3LCHA 2ZZ2A 4AF0A 2OCZA 3OBKA 1A5SA 3W7KA 4BI7A 3W2UA 4JDYA 5BMXA 1WOBA 3D0CA 5C2XA 3AJXA 3KX6A 5LHEA 3NZRA 1RV8A 2PC4A 3QRHA 1P5BA 3LTYA 4DPPA 5K9DA 3F4NA 1N8FA 5IBXC 3S5ZA 2FB3A 5DCEA 1FWTA 1XC4A 3PS7A 3PBYA 1G6CA 3OIXA 3TIMA 3HB9A 4GC4A 1LRQA 3R12A 2FPYA 5L9FA 4YCPA 1OFBA 3PG9A 3MHGA 1KM2A 3KXQA 3LXCA 2I9EA 1C9DA 3NQEA 3GR7A 2QCCA 2X1TA 3M6YA 3TSMA 1GQNA 3L67A 3W22A 1EP2A 2E5DA 2Z1BA 1RD5A 2J6XA 3G24A 3WK1A 5F1VA 4CCDA 5BRBA 1DJQA 3S5NA 4U4MA 1FWNA 1QR7A 3C2FA 2ALDA 3EWBX 2DZWA 2FPVA 5FESA 3DZ1A 3NO5A 3O63A 5I3IA 3NL3A 2V0TA 5C6MA 3OEXA 3GDTA 4UMCA 3UPBA 2WNZA 1LRNA 4UFHA 3HO8A 3W2KA 4ZMGA 3GAKA 3LHYA 3LCFA 4Y8FA 1KFJA 3P5YA 3O06A 4DO5A 3PG8A 4HNVA 5HUPA 3M47A 2BXVA 4LY8A 1W0MA 3P81A 1KW1A 3Q94A 1FDJA 2EF9A 5D37A 2Z6JA 3S0CA 2Q8ZA 1VPXA 4KWVA 4AHQA 3TDFA 5CZJA 1EPXA 1TPC1 2A7NA 3NQGA 4FNSA 1X6UA 1UB3A 4O1AA 4DELA 1DOSA 4GUHA 3L5AA 2H8XA 3R13A 2ISSA 1FWRA 2NV1A 5DXYA 4U28A 4NNAA 3TAOA 4XBKA 1W3NA 1WV2A 4BR1A 4MIMA 2JGQA 4HT3A 3S5OA 2TPSA 5G1TA 3NQCA 3STCA 6ALDA 3I6RA 1FQ0A 4HSOA 2B7QA 3LCIA 2TYSA 1A5BA 4PL2A 3DFQA 1GVOA 2A5HA 5AHEA 3W84A 3E96A 5TQLA 2ZZ7A 5F2MA 4NUWA 4IUOA 3L5MA 1TCDA 3W7PA 1FDYA 3LHTA 1OFAA 1R2RA 4M6VA 1VRDA 4RJEA 1JQVA 3KOFA 4FF7A 4LC8A 4POCA 3O16A 5L6UA 4AXKA 4BI5A 5TBOA 2ZZ4A 2VC6A 4OV9A 3HGOA 3QQ0A 2Y70A 3OG3A 3W74A 4UTUA 1B9BA 2FDSA 1RR2A 2XN2A 3I7QA 1KFCA 4UNLA 2GVLA 4NT0A 4WJEA 1DQXA 1VYPX 2DZPA 3WJSA 3L21A 3NPWA 3PUDA 3TKFA 3NZ1A 1OVDA 2QUTA 4LVGA 3W1TA 4G1KA 2C19A 3LBCA 5F2GA 4LRSA 2QUVA 2XN0A 4JX4A 4MZ8A 1LRTA 4Z1AA 3CEPA 3S5YA 4E38A 1J2WA 2G97A 3V75A 3HF3A 2ABBA 3CEUA 3LCWA 1EUNA 5I3GA 5LSMA 3BGJA 3TC6A 3SFKA 2Y61A 2QCDB 3SY5A 3UNDA 5HNRA 3EWZA 4UMBA 1IXOA 2WNNA 1TSIA 1GVRA 3BLFA 4ORMA 4QAIA 2ZA2A 3N9SA 2A21A 1EP1A 2Y7EA 2GVJA 3PWAA 3GDKA 4JDBA 1XKYA 1QAPA 3BGGA 5D02A 4O0KA 2YFNA 2XN1A 2P1FA 4OHQA 2J9ZA 5D09A 4FNTA 4ML9A 5DN1A 4JN6A 2C18A 3P82A 4S1FA 5F2IA 3FKKA 3DFOA 4JTHA 1K7FA 4RV8A 3UY8A 1AG1O 1KLZA 4OGZA 4NJJA 3TROA 5HJLA 3W2NA 1SZGA 3C56A 3VKJA 5DBTA 1QOQA 5HULA 2IQTA 5LNWA 4NU7A 4GJ1A 5D05A 4E0CA 2HS6A 3FLUA 5AHFA 2CLFA 3LV5A 1C29A 3W2MA 4A3UA 1LLWA 3LHUA 3WJZA 1WBJA 5F4WA 4MY9A 4PFMA 5FF0A 3IGSA 4A29A 4RXGA 2YCEA 3QEZA 2RKXA 4JEQA 1GTEA 4IQLA 4UFKA 3W07A 1EA0A 4Z1DA 3SW6A 4XTDA 4FXRA 3ZR4A 1ME8A 1KM3A 1ZAIA 2J24A 3MP5A 4O1CA 5E0KA 3EX4A 4LW7A 4JTTA 3CLMA 3OHIA 1K7XA 1GPWA 1RQBA 3L9CA 2I1OA 2DJXA 3IIOA 3IGXA 1Q6QA 3W72A 2VXNA 3WK3A 3F4WA 3L0KA 4WX2A 2DORA 3DI1A 3MHUA 4H3DA 4KFPA 5CG7A 5HWNA 1GYNA 3C2VA 3FA5A 4XBSA 3HPXA 2HTMA 4NZFA 3T78A 5EL1A 3B0PA 1I2QA 3CU2A 2C13A 3P67A 1I45A 2BX7A 3I65A 3LV6A 3N2XA 5FEXA 1W5PA 1EEPA 4P2VA 5EY5A 2QAPA 4O13A 3GXNA 5HUOA 3GKFA 3NOEA 3W7LA 1RQEA 4ADUA 2B4GA 5EBUA 3THAA 3NAVA 5FF2A 3CIXA 3E9AA 2ZRWA 5AHNA 1YLVA 4KKXA 3Q2DA 1OJXA 1W3TA 3W87A 2HS8A 3O07A 4GUJA 2NZLA 3F1QA 4QISA 4IMFA 4PODA 2J27A 4LS2A 1HG3A 1G69A 3E49A 1Y0EA 2C15A 3GX9A 3R8RA 1HO4A 1NVMA 3N19B 3NXFA 2ISVA 3PSVA 2OZ0A 4UMAA 2AGKA 2ZCGA 4EF8A 4MOZA 4S2CA 4AWTA 1ICPA 4MFEA 2B7NA 4W9TA 1F6KA 3P62A 4QQ3A 1VCVA 3TE9A 5HQEA 2E6DA 2ZZ6A 1BTMA 4S2BA 5KMYA 5E1QA 2X1UA 1KM4A 3G1HA 4TX9A 3QM3A 2YYTA 2QCHA 4MYXA 3GR8A 4JD4A 4DF0A 3QPZA 1CI1A 2PCQA 5CZSA 2X16A 3MHFA 1X8FA 4DO4A 1NAL1 3STGA 1TTJA 1HL2A 3PY2A 1N55A 3W23A 3PC0A 2ABAA 2GQAA 1JCJA 2A6NA 2A2IA 3IVUA 1U83A 3GDMA 3MW7A 1I2PA 5G2IA 3MO7A 2GQ9A 5LNUA 4LRTA 3W1RA 1JUEA 2KZHA 2V82A 4JTUA 1TPEA 3TH6A 1RZMA 3TX9A 3CPRA 5EMUA 2CFFA 1OK6A 2DJLA 4PH6A 1TO3A 3VI2A 1JCYA 3VE7A 4O15A 4K6AA 4LWWA 4N6FA 2Y6ZA 2YGYA 2O7SA 1QPOA 1XFBA 5G2WA 3IVTA 2BTMA 4PEKA 1SW7A 3W7IA 5U4NA 3GXPA 2QCDA 4A22A 3QPYA 5LKYA 2QCEA 1X1OA 2OMAA 3CTLA 4GNJA 4KFNA 3W7CA 3DKJA 1XBZA 1JVNA 2HSAA 3G8EA 4JTIA 4A2RA 5J5RA 5CKSA 4RR4A 4MY8A 3DKLA 2QJHA 3C0JA 4JY9A 3W86A 5K9CA 3L66A 2DZUA 3W73A 1GZGA 5K3VA 3M5VA 1ZAJA 4JY8A 2BZNA 2WO5A 3RK8A 3CB8A 3M5YA 3UZ5A 2NWRA 2Y89A 4XQ6A 1FWSA 5DY3A 2YSWA 4FB7A 5LGZA 4NJGA 2C6QA 1D9EA 2QDHA 5CPMA 1VYRA 1FCQA 3W9ZA 2PRMA 1TPUA 3IIZA 3MYOA 4JS3A 4MUZA 5CPLA 4Z1CA 1ML1A 1MZHA 4R34A 3S9YA 5HR7A 3W83A 1KA9F 3A24A 1LLZA 4JTEA 4QM1A 3RNDA 5TIMA 1M5WA 1KM5A 3DGRA 3R5EA 4MLRA 3GKAA 3MP3A 4JICA 4JX5A 1LBMA 4N4QA 4AMAA 1Z42A 3N73A 5FEZA 5LGXA 5KITA 3E12A 3RLUA 2NLIA 1LOLA 4R33A 3L2IA 2FPTA 1VCGA 3FKRA 2CW6A 3T55A 3GB6A 3NQDA 1KFLA 4ZQPA 3HIJA 3OA3A 3O6DA 3B4UA 4O11A 4RX0A 5D33A 3B05A 2V2DA 3TFXA 3W7OA 3P74A 2GJNA 4R53A 1UASA 3TW7A 3HPSA 5CSSA 4FIQA 4RLIA 1XDLA 4IMDA 4K8HA 4IMEA 3HG4A 1YADA 4GXMA 5T26A 4GBUA 1VS1A 2RDWA 3WJWA 4HIBA 1ZFJA 3W1LA 4ZQOA 4YXGA 5BMWA 3TCEA 3QW3A 3C52A 4EWND 1OX6A 1KBJA 1W37A 3BLIA 4O18A 5AHIA 4UTKA 4E2DA 2VEKA 3N2MA 3PUEA 4WXYA 3W75A 1TTIA 3IV3A 1JCLA 3BLEA 2BWGA 5LNVA 4IMCA 4OU1A 4N9DA 2TMDA 3BG3A 3W7JA 4EF9A 3T7VA 1ZALA 3MBDA 3VE9A 2YR1A 2W0UA 1VQTA 3LX9A 4RZ5A 2RFGA 2JKAA 3LTPA 2X1SA 5D2WA 4O4VA 3LLDA 4UFIA 1J5TA 4M6PA 3ELFA 2CZFA 1XCFA 4N4PA 2CZEA 1KV5A 1DV7A 2J9XA 3JR2A 1T99A 1XM3A 1ICSA 3CT7A 4B5NA 2NWSA 4A2SA 4D2JA 3M1ZA 3QJAA 5H2ZA 3LLFA 4NXKA 3WK0A 1DQWA 4RXFA 3TQVA 1UJPA 1YTEA 2VFGA 1G4EA 4JTJA 1SW0A 3KVLA 3C3NA 1Q3NA 5DLCA 1TPFA 2Y63A 1AK5A 3T44A 1H7NA 1ADOA 3W2LA 1W54A 4WOZA 1K03A 2Y85A 3M7WA 3N14A 4NZJA 5K2ZA 3BW3A 5BNKA 3VCRA 4HN4A 1TPWA 5LNSA 3KRZA 1KM1A 2ISWA 2I14A 3TQ0A 3W1UA 3S42A 1EUAA 4RKAA 5DXXA 3HMJG 3UWWA 4BWLA 5SWUA 4GUFA 2JKPA 1V5XA 4GRSA 4UC5A 4AAJA 3THQA 5U7SA 3P84A 2RHGA 2ZQ0A 4ORIA 1SPQA 3GIYA 1H51A 3UYCA 2CLLA 1H50A 4HNNA 2ZZ1A 3G3DA 3C2EA 2JBMA 1SW3A 1FCUA 3H53A 1G67A 3EWXA 3O8AA 2ZRXA 2OT0A 1TREA 5BW6A 2ZRZA 4MY1A 2YW3A 4IX2A 3HJZA 1GT8A 3E02A 3EXSA 1LDCA 4GUGA 2QAFA 1GOXA 4FX6M 1ZY9A 3DHFA 3NQ2A 1R2SA 4DF2A 1YPIA 3YPIA 1G4TA 3PF3A 1WDWA 4O16A 3KVKA 2TRSA 4Z0SA 5I3JA 3W1PA 2B7PA 2YW4A 2ZRVA 3ABOA 5H91A 5AHLA 3SR7A 4K7VA 3IRDA 1OK4A 5E93A 3IIVA 3HGJA 1FBAA 5CPOA 5I3KA 1L6YA 3EB2A 3USBA 4EIVA 3G1VA 3KFTA 1M7OA 2E5BA 2DZSA 4UNKA 2C3ZA 2ZDRA 4PTNA 1B4EA 3QF0A 1XUZA 3W85A 4BK9A 3P7YA 4DBDA 3C2RA 3W1XA 5KZMA 3EWYA 3W7RA 3S1XA 2C14A 3HG5A 4DBEA 1H1ZA 4TIMA 3TJXA 3NPVA 1FCBA 2A0NA 2Y62A 5KSWA 1SSDA 1HTIA 4N6EA 2QCLA 5AYXA 1M6JA 2E77A 4JTLA 1TRDA 5IM51 1PHWA 1BEUA 2YPIA 3TFCA 1R30A 5LHFA 3G1XA 2ATSA 1SO4A 1VYSX 2OX1A 2Z0IA 4X3ZA 4H4IA 2GOUA 2JKEA 3S1WA 3M5ZA 3TJLA 1JCXA 2WOQA 1L6WA 3B8DA 1JUBA 4R7JA 3KVMA 2W6RA 3QMRA 5A8GA 1R47A 1OX5A 4A21A 1WQ5A 4NNBA 3UWYA 3GDRA 3MUXA 2VOMA 2WSRA 1TRIA 2VFEA 3KHJA 2NXHA 1OFEA 1DORA 2NV2A 3BW2A 4N02A 3G1SA 4WY0F 3IIPA 1DKWA 2PURA 3NEVA 1AW1A 2FJKA 2VFIA 2H8ZA 5G4EA 4PC8A 5CGQA 4O28A 4YCOA 3MP4A 4UTLA 1O5XA 2CZ5A 1KM6A 4IPJA 3DI0A 3OVPA 2F7FA 2ZBTA 1W56A 4EOUA 2WPBA 1H7XA 1LORA 1THFD 2ZZ3A 3C2OA 2QDGA 1TPDA 1KFBA 5G5IA 5FEPA 1ME9A 3A21A 1QMLA 1LP6A 2FIQA 1VHCA 4MJMA 2X2GA 5LZLA 4FHAA 3MBFA 1P0NA 1GVQA 4IOTA 3LOTA 2VKZG 2NUYA 3A9IA 1F76A 3UPWA 3SECA 3BV4A 3MWAA 3TUUA 4O4WA 1VCFA 1WXJA 3LERA 3Q58A 4O0ZA 3LBMA 3W7EA 1SU5A 1ICQA 2WNQA 3BG9A 4QIUA 4LUIA 1DJNA 1Q6RA 4WQ6A 1SZNA 1PVNA 3W7DA 2B7OA 1VJIA 3TK7A 1S5WA 3DENA 2WKJA 1GG1A 3QH2A 1IIGA 1SUXA 5G1YA 3B0VC 2A85A 1H62A 2V2CA 5EKYA 3VFLA 3W88A 3GZ3A 5I3FA 2QJGA 1Z41A 4Q32A 1LCOA 4MVAA 4FO4A 3IGUA 3LGEA 2C0AA 4GWEA 5K7JA 4IXHA 1GJPA 3TC7A 1S5VA 1OFPA 1VLIA 3PUOA 4LVAA 1JCNA 5D2VA 3TA6A 4JYDA 4O10A 3W1NA 2Y7GA 4LC6A 2PRHA 2WJZA 4MZ1A 4ALDA 4FXSA 4KWWA 4X2RA 4IX0A 3NQAA 3NL2A 5DY2A 3LCGA 1QFEA 1F6PA 1TTPA 4Y9AA 3RU6A 3G0XA 4AWSA 3N34A 2PE4A 1PS9A 2V8ZA 4Q4KA 1EP3A 4BWLC 4BF9A 1NSJA 3HGRA 3LRMA 5G2HA 3PB2A 3NL6A 4AWUA 1A50A 1ZJIA 1TPH1 1XXXA 1C8VA 4MFDA 3IEBA 3M0ZA 3DFTA 2O7QA 3GVGA 3P80A 3BW4A 1S5TA 1YTKA 3M43A 3M5XA 2CLOA 1TTQA 2J9YA 2W79A 3DFNA 1ALDA 1YTDA 3L68A 1G7UA 3ZS4A 2F84A 1SO3A 2CLMA 4O52A 4XUGA 1R46A 1W5NA 4MPQA 1H5YA 4UTHA 1FY6A 2CLKA 2H3DA 2VFFA 1KV8A 1T0OA 3C4UA 1GEQA 4I9AA 2XFWA 1HO1A 3M44A 1Z48A 1ZAHA 2JGYA 2CWNA 2A4AA 4L4LA 1FWWA 4WOQA 3S1UA 3NM3A 3A5FA 5AB3A 2BSLA 2GUUA 5AYZA 3FIGA 4DO6A 3NPUA 3OVQA 5D38A 1KTCA 1EX5A 1O4UA 3G3MA 1JULA 5DCDA 1NEYA 1I2OA 3LI1A 4CQAA 4ZZ9A 1VZWA 3TNOA 3NQ6A 2VELA 1X1ZA 3C8FA 3HG3A 2X1RA 1VC4A 1P0KA 2V9DA 2A1YA 2NXGA 2RDUA 2YX0A 4ZQCA 3QW4B 1PL9A 1H7PA 4O19A 1JRCA 4O1BA 3GXTA 4FEZA 3FYOA 3PULA 1QWGA 1O94A 4JIPA 1OFQA 3NM1A 3CWOX 1MO0A 1RVGA 1OX4B 2A6LA 2H6RA 2GVGA 4FX8A 4X22A 1W8SA 4P61A 3O05A 3P8JA 2V30A 1SFLA 1HFBA 3F03K 3NVTA 1ZHAA 3DXIA 4M19A 3U8GA 1VGAA 5D2XA 3MJYA 4TO8A 1GVSA 3W2JA 3WK2A 4ONVA 5D30A 1KFEA 4Q33A 3LHVA 1FXQA 4JNMA 3QYQA 2EGZA 1PE1A 3NDOA 4LVDA 4MYAA 1OX4A 3NR0A 2E09A 4NX5A 2GQ8A 2GPTA 1UBSA 1JUKA 3G0SA 4JYFA 2J88A 3TU9A 2QJIA 2P0OA 1PCWA 1UCWA 2VFHA 2FTPA 2QUUA 2V5BA 4UTJA 2WQPA 1A5CA 3R2GA 2E5CA 4HNUA 1AL7A 2NX1A 3LB0A 2BLEA 1JJKA 5I3HA 4LOCA 3QFEA 2OT1A 3P5ZA 4NJKA 3WFAA 2YDAA 1L6SA 5HMSA 3A22A 4AEOA 1H1YA 1KM0A 1TMHA 5CZ0A 1LYXA 2EPHA 3E0IA 3SI9A 5A5WA 4RCXA 4PA8A 1H61A 2C16A 1H7RA 4DQWA 1W3IA 5AOUA 2NXIA 3MMTA 5F2LA 3I68A 4HPXA 4PCFA 4UR8A 1QPNA 4CQ8A 1FCVA 1A5AA 3NA8A 5EA9A 3UY7A 3STFA 4NXSA 4WD0A 1XBVA 2CZDA 1GWJA 1YDVA 5BOOA 4HHPA 1K02A 3PM6A 4ZL1A 2QCGA 2VEMA 3KRUA 4UTTC 1VHNA 5F1UA 4O14A 3EKZA 1ZNNA 3S1VA 1OFDA 1QCWA 3LI0A 3O15A 4LVBA 1FDZA 1RQHA 3BARA 3O6CA 3QSTA 1TV8A 2FQIA 1VH7A 3U2OA 4UXDA 3G1YA 3PR2A 2QEZA 3ABSA 5HINA 4JXCA 3M41A 2ATMA 3G0UA 2WV8A 1K8ZA 4RZ6A 1KLYA 3P61A 4CQ9A 2ZRUA 1ME7A 1T8XA 1TJPA 1XL9A 2ZRYA 3DHDA 3QC3A 4WZHA 3W1QA 1A53A 3SGUA 3EWUA 1AMKA 3LCLA 3KAOA 3ATYA 2R91A 4EVZA 4CCCA 1IXQA 4QITA 1LM1A 1SZEA 1TQXA 3SSJA 2ZTJA 1FUYA 2JK2A 4QSHA 3LRKA 3O6YX 1O60A 4E2BA 2E6YA 4UTTA 3L5LA 4MKNA 4TR9A 1F73A 4JIQA 4DF1A 3EXRA 1XBXA 4LV4A 4HKPA 1QNVA 5G4WA 3HQ1A 4UUIA 1SR9A 1SZFA 1WOAA 3U6WA 2G5WA 1IXPA 3RF9A 3ZWSA 1HUVA 1ONRA 1GYLA 4ZQMA 3N9RA 3JS3A 3PB0A 3DAQA 1DL3A 3EEGA 1TV7A 1MEIA 5FF4A 4KFOA 3NGJA 4FNPA 1YPFA 1TYGA 3TV8A 4DPQA 3JRKA 4O8RA 1SSGA 3PBWA 3EX2A 2X30A 1F74A 1BKSA 2D73A 5C5YA 2CLIA 4DXVA 2CLEA 1WA3A 4ADTA 4FIRA 1IF2A 1W5MA 5D03A 3UWUA 3BG5A 3IIXA 4O54A 3TSBA 3MI6A 3L65A 2QF7A 2ZA1A 3QSRA 4O50A 3UZJA 1KFKA 5EYWA 4JGDA 4H6KA 3QMSA 2ZA3A 3W7GA 1JRBA 1WAUA 3FEMA 1E51A 4OWGA 3G8RA 1W5QA 2ZTKA 1V7YA 4ICNA 3BO9A 1DBTA 3ZWTA 4K39A 3EX6A 4AVFA 3GAYA 3NQVA 1LBFA 2EKCA 4CNNA 1D3GA 3HBLA 3LDVA 1YXDA 1AW2A 5CPNA 3QZEA 3G22A 2QCFA 3BPWA 4LNYA 1LOQA 1CX9A 4O1DA 5AN7A 1OF6A 3WJYA 1PIIA 1QDSA 1XUUA 4YMZA 2FFCA 2YFOA 1W1ZA 3QMTA 3L0NA 4NX0A 1F2JA 3UWQA 1X7FA 2AQWA 4RK8A 4WY0B 3GDLA 1H60A 3TMQA 4ZVJA 3GYEA 1P4CA 1LOSA 1LZOA 1UUMA 3UXDA 3NG3A 3H55A 3P8IA 3W71A 5AC6A 3DFPA 5AHMA 4M6QA 4MJZA 1K3UA 2RDTA 1Q6LA 4XKYB 1K8YA 1B57A 2QR6A 3FOKA 1GTHA 1F7BA 4LU0A 5GVJA 3UWZA 4LS0A 3W1MA 1JCMP 3HGSA 4UTWA 3S6DA 1OYCA 1I2NA 3EXTA 3UXAA 3LXBA 3M9YA 4TMBA 4O57A 1Z44A 2E6FA 4UFJA 2V5LA 2V81A 4CNPA 5CZTA 5K9XA 3TW6A 3W7NA 1FXPA 1MEWA 1KTBA 2VFDA 4I7WA 7TIMA 4NJIA 4C1KA 4Z1BA 1W5OA 2VEIA 4I7VA 4IWWA 4OQVA 1RPXA 4PL1A 4IGHA 1UUOA 1TPB1 4FNQA 2NX3A 4AHPA 1IGSA 4QJ1A 2DU2A 3QQ1A 4CLMA 2NX9A 1PHQA 1OFRA 1QOPA 1OF8A 1VR6A 2Z2UA 3Q37A 1AL8A 4NNCA 3HPZA 3W76A 4UTIA 2DZXA 1OFOA 1SO5A 3SGZA 1F05A 4DEFA 4CCEA 4I7UA 3FJ6A 4ZQNA 4NQ1A 4IMGA 4JTSA 4YWIA 2YXGA 1L2UA 1T96A 1W31A 1F5ZA 3P60A 5D2TA 5AFDA 5DELA 4Y90A 2QKFA 3A23A 3PAJA 4QNWA 3N3MA 1EB3A 3DBPA 5FEWA 1BWLA 4J9JA 3NQ8A 1S3HA 4ZQRA 3TMLA 4N2YA 3FJLA 1SQ7A 6TIMA 5HWMA 4FNUA 2C1HA 1O95A 1SFJA 3SIZA 3TAKA 3I7SA 4YLWA 4N9BA 1JQXA 1H63A 1YDOA 3B03A 3NQMA 1OABA 3AO0A 4HPJA 3GNDA 4BFAA 3GLCA 1H7WA 4UTWC 3B04A 5DBUA 4FNRA 5KTLA 5AYYA 4BI6A 4Y6GA 2E68A 3MI2A 5J5DA 4TMCA 1I4NA 3W3OA 2B0MA 2EAWA 3DFSA 4IXXA 1R2TA 3BVJA 1OHLA 4QNEA 4UCGA 4JX6A 1JR1A 1QO5A 3G18A 4UTMA 3INPA 4X9SA 2H90A 3CIWA 3M16A 4XWUA 3RMJA 3NQ7A 2V2HA 3IVSA 3MI3A 2ZZ5A 1PV8A 3CM4A 3WJXA 1WX0A 4LTSA 4IJBA 5ABTA 2VEPA 5K4XA 4M7SA 1KBIA 1TV5A 1OYAA 3SJ3A 2AAMA 3NL5A 4AB4A 1PCKA 3T4CA 2Q3OA 3C6CA 1EWEA 3TR2A 1K8XA 4HSNA 1DHPA 1TB3A 1VLWA 1YYAA 3UD6A 4WXZA 1D3HA 2HMCA 4O53A 5LNRA 5EPDA 2Y7DA 1NF7A 3RLVA 3V1PA 4C1LA 5MHBA 5FI8A 1QPQA 1G4PA 2DP3A 4JR5A 4N9CA 4WUIA 1YXCA 2YZRA 3LXAA 1TPVA 1DVJA 1J4EA 3O1NA 4N9EA 3EX3A 4JTKA 2A7RA 2CLHA 3ZFHA 1EWDA 5FF3A 2A7PA 4UR7A 1XI3A 2FB2A 2RH9A 4XTIA 3CQ0A 2WSYA
chains in the Genus database with same CATH superfamily
4JQ2A 3NQFA 4EWJA 4TU1A 5D04C 4ML4A 3B4YA 2BY3A 3LZ3A 3ME3A 4W86A 3HG2A 4MZYA 3BOFA 4IPPA 1CGWA 1JIBA 1PZ0A 4C6JA 2ZYFA 4GNVA 1RALA 1XLMA 2ONEA 1I8JA 3AI0A 2TODA 4JTGA 2VENA 2FLIA 1NFBA 2CXGA 3OLIA 1EJWC 4UIOA 3UETA 2ZXBA 4JTRA 2Q6ZA 3UWVA 1ZTVA 3RFAA 4ZOCA 3EBVA 1QW9A 3GUWA 4LYPA 4OFCA 1UH2A 3ZOAA 4LYRA 5EGRA 3RU8X 5A8QA 3LRLA 4Z2LA 2NT1A 3GXMA 4GE8A 1XLGA 4C6KA 2QT3A 3LTSA 1GVIA 2WW5A 4Q6JA 5KZEA 4XB3A 4DWSA 2DZTA 2VVSA 2DVUA 3NYZA 2R1KA 3FYPA 5GQBA 3RM4A 1S2UA 5F4SA 1H7OA 2HPIA 3QOKA 1MXSA 3VGEA 5AYIA 3ES7A 2P10A 3H54A 2CHOA 1GG0A 4Z42C 1CW2A 3GTFA 2WK2A 1BYAA 2GSJA 1BRLA 4GFSA 5HR6A 1LTDA 1ISWA 3M0IA 4PUKA 3MUCA 3G1FA 4F0RA 2QIWA 2R8WA 1ZJHA 3NEHA 3R11A 4KBXA 1WBHA 2CWXA 3LNMA 5CEWA 1EIXA 1VRXA 1FX6A 3T40A 2WVSA 4AH7A 4UFLA 2DVXA 1VBUA 2YYUA 3WUGA 3VNLA 1Q45A 1XBYA 4TVDA 2D24A 1RUSA 2TSYA 3JVAA 1PX3A 4O12A 1XDMA 2ZVRA 3G1DA 4NJHA 3WEZA 3I7RA 4WDXA 2CKRA 2WSQA 4K7YA 4KW2A 2DZVA 3PBUA 3GG1A 4V33A 1FWEC 1ECEA 3UQNA 5C55A 2XDFA 2ESCA 2R14A 5HPOA 5A8OA 2ZXQA 2XWDA 4K8EA 2PDPA 3H12A 4KEVA 1I0DA 3IJ6A 3B9EA 4LH8A 3GYCA 3H23A 4HTYA 3ITTA 4QE1A 1AW5A 4IPIA 1W1TA 1A0EA 1IZJA 3EZ4A 3NJ3A 4S3GA 2V67A 2QPSA 4PMJA 1I2RA 1XH1A 2J8TA 1JZ2A 3W6YA 3TXVA 2NSXA 3MSGA 4Z2JA 1B4KA 1LQ2A 3LCHA 2ZZ2A 2OCZA 1UIPA 1EO7A 2QULA 5I7GA 4JDYA 1WAWA 3BMXA 3KX6A 3NZRA 1RV8A 3QRHA 5D9OA 5K9DA 2D0FA 4L6OA 1GJWA 1QVBA 1GUVA 1DJHA 1RVKA 2FB3A 5DCEA 1ODUA 2IW0A 4B9YA 1XC4A 3PS7A 1E4LA 2WCGA 3LD5A 3OIXA 3ZVIA 1O1HA 2VDHA 3HB9A 5C71A 3CMGA 3WQEA 4YCPA 3HV8A 3MHGA 1KM2A 3V5CA 1EQPA 3B0YA 3LXCA 3GR7A 1B90A 4C6DA 5JQ9A 2X1TA 3W22A 1EP2A 3WK1A 3T1GA 4CCDA 5BRBA 1DJQA 2CBUA 3S5NA 4KIEA 4A3RA 3EWBX 4IP5A 4EK7A 2DZWA 5FESA 1YMYA 3DZ1A 5C0QA 3GXDA 4I9TA 5CBJA 3L4UA 2J13A 3TZFA 4ZMGA 4GKLA 3BOLA 4XZWA 4K68A 1GOIA 3CO4A 2YZ5A 1ZUAX 5HUPA 3M47A 2J8GA 4EKJA 2IQDA 3F7JA 3P81A 5D37A 3S0CA 2DUAA 4KWVA 1E6XM 3MCOA 1TPC1 1US3A 3U7VA 2A7NA 4XV0A 2WJFA 4H7CA 4GUHA 3CV7A 2GJPA 3R13A 1FWRA 5DXYA 3IPWA 1ZLPA 4BR1A 2PFHA 2J7GA 4GABA 4HT3A 3G6LA 2YBTA 3GHSA 2W3ZA 2PF0A 2TPSA 3TW9A 3CZ8A 3STCA 3ZIZA 4KRUA 1XH2A 4WSJA 1X38A 1FQ0A 4AG0A 1QHPA 1K70A 3QR0A 3LCIA 4ICMA 4PL2A 2XH2A 3W84A 5F2MA 4IUOA 1TCDA 3LHTA 1OFAA 2OOFA 4AIOA 2HXTA 4U2YA 3M4HA 1O7AA 2BDQA 2EEXA 3ARSA 2VC6A 2VEGA 2WMGA 2UY5A 2Z00A 4HOWA 4RPQA 2GVYA 1KKOA 4GXPA 3WD3A 4HA1A 1B9BA 1NARA 1RR2A 1KFCA 5CCZA 1AQ0A 3GNOA 4QJ3B 4NT0A 3ZT7A 5HMEA 5FKYA 1SVDA 3NPWA 2O56A 3PUDA 3SQSA 4UQDA 3W1TA 3PJTA 3LBCA 5F2GA 1Z8AA 3S5YA 4YJ5A 3VKAA 2G97A 3HF3A 4J3TA 2PDJA 3CEUA 3OIHA 2XG9A 2ZXAA 5LIWX 1XIEA 3UT0A 5I3GA 4PUEA 1FHUA 3BGJA 5D8ZA 3SFKA 1IEXA 2Y61A 3UNDA 5HNRA 3EWZA 1JPMA 5HMFA 2AL2A 6XIAA 4WGHA 1Q13A 2Y7EA 3PWAA 5BRQA 4YN5A 2BOEX 4JDBA 4PBGA 1QBAA 3A4XA 4HB7A 3IJ7A 5D09A 1S38A 4IG2B 4XISA 4P5UA 4CNUA 3FKKA 3WLIA 1KB3A 4JTHA 3NWRA 4RV8A 2FFIA 4NJJA 5HJXA 3VKJA 5DBTA 2MUCA 2PD9A 2IQTA 5LNWA 5HPCA 4GJ1A 3U2ZA 1H11A 1C29A 4WVXA 4QFUA 4WSKA 5DF0A 4CD8A 4LCQA 1WBJA 1N8IA 1XYCA 3K46A 1IEWA 2W92A 2YLLA 3H2NA 4A29A 4INFA 4ATWA 2PMQA 2Z1SA 2ZXDA 3BH4A 3QEZA 2RKXA 4JEQA 1GTEA 4OECA 4UFKA 1UWAA 3PZ9A 4Z1DA 3SW6A 5AECA 3BCDA 4FXRA 4W7WA 1ME8A 2WMFA 3KOZA 4DJFA 3EX4A 3M0JA 3S2NA 4W8BA 2POTA 2O0TA 1RQBA 3R4IA 3IGXA 4Q7IA 4WX2A 5HWNA 5CG7A 1GYNA 1XLLA 1W6TA 3LNPA 4C6CA 1BPLB 1CIUA 1I2QA 5BU9A 2C13A 3LV6A 9RUBA 4P2VA 5IHSA 2QAPA 1U1HA 3W7LA 1EA9C 5EBUA 1TZ9A 1V02E 2ZUSA 3E9AA 4QHRA 5FF2A 2ZRWA 3DERA 5AHNA 3VILA 4KKXA 1W3TA 1S1RA 1CXHA 3QY6A 1L2QA 4HK7A 1HG3A 4MGGA 4V2XA 1J0ZA 3V7PA 4GA8A 5B7YA 4I5UA 1HO4A 3PSVA 2Z7GA 1R3RA 3SCOA 4AWTA 1ADDA 3AYVA 2OKTA 3UJEA 2BP1A 2X05A 1F6KA 3P62A 4QQ3A 4XAPA 2V3DA 5HQEA 4I9MA 3D6NA 2ZZ6A 4TX9A 3NSNA 4IL2A 3QPZA 1CI1A 5CZSA 1QI5A 3MHFA 3JU2A 1SFTA 4XZHA 1BWVA 1TTJA 3W23A 3PC0A 2A6NA 3IVUA 1U83A 4FAMA 3O0KA 1I2PA 3AALA 1SFSA 3OO2A 1TPEA 1RZMA 3QVQA 4W7VA 5EMUA 4LBRA 4PH6A 1UZ1A 4AD3A 2NVDA 1JCYA 2E67A 3ZZ1A 1OCNA 3SSZA 1DHKA 2O7SA 2EPLX 2BTMA 4GVGA 4EXBA 1HQTA 2VRQA 4E4PA 3C8NA 1CLVA 1YNQA 4HA4A 1UWSA 5E6YA 1RCQA 3CUIA 3VIHA 2ZE0A 4D6EA 1X1OA 3W7CA 5T9BG 3ICJA 3WYZA 2HSAA 4GPNA 2XUCA 2XFYA 4GK8A 3CB3A 5J5RA 4B4HA 3SCSA 3VIPA 3UZWA 5K9CA 3L66A 1S3TC 1HXJA 4CD5A 3VGDA 4S3JA 3M0HA 3ZLGA 3EDDA 3RK8A 1XSKA 1KXVA 4NSBA 1WDDA 3M5YA 3UZ5A 3TCSA 4PUNA 2Y89A 2OVLA 3FX4A 4AWEA 4FB7A 4NJGA 5HQMA 1RH9A 1D9EA 2QDHA 1FCQA 5EB8A 3IUHA 1X1NA 1TPUA 4JS3A 4AQLA 2WBGA 1UWQA 4AZHA 4Z2HA 2VP8A 1S5NA 5A3HA 3W83A 1LLZA 4P7QA 4QM1A 1KM5A 2Y5JA 3DGRA 2OQYA 4MLRA 3MP3A 1VEOA 4JICA 1U22A 3CS2A 4LBSA 1XLEA 4CEXC 2D2HA 4DBUA 5I77A 2GQ3A 3N73A 1BKHA 5FCZA 5LGXA 3E12A 4R33A 3L2IA 2XM1A 1VCGA 4IPNB 5H8MA 4IL0A 2CW6A 4ZQPA 3B4UA 4GGBA 5D33A 3B05A 3W28A 3H7UA 3GUGA 3TFXA 3W7OA 3UJRA 1R85A 3TW7A 3HPSA 1XQLA 4DXXA 4K8HA 2QJJA 4HU0A 3EWDA 4I90A 5PTDA 1IE7C 2IPJA 1VS1A 4HIBA 1ZFJA 4YXGA 5BMWA 2AKZA 3QW3A 4V28A 1OX6A 1KBJA 1W37A 1C7SA 3CYVA 4O18A 4UTKA 3VDBA 2VEKA 3PUEA 4WXYA 3W75A 1TTIA 3IV3A 5LNVA 4IMCA 2TMDA 4LANA 4TX8A 1OD0A 5BOEA 3QLDA 1UWTA 3BJFA 1PIGA 4FR6A 3R6IA 3RM8A 5REQA 4F0KA 3LX9A 3RR4A 5D2WA 4O4VA 3LLDA 4UFIA 4M6PA 3ELFA 5CAHA 1XCFA 4N4PA 2CZEA 4DI9A 3AISA 3QV7A 1J79A 5KETA 2V5JA 3IUIA 3TTEA 4C6BA 3OA5A 3CT7A 3W81A 3K8MA 3V35A 2ZWZA 1P43A 1XIIA 3P2VA 3ZVHB 2VC5A 4IIEA 4NXKA 2VQUA 1DQWA 3VCNA 1FA2A 5FJIA 1GOKA 4JTJA 3C3NA 2GWNA 2WQDA 2C71A 1Q3NA 5DLCA 5BZAA 1TPFA 1UH4A 4GG9A 4BQ5A 1ADSA 2P76A 3OOQA 3UA3A 1BQCA 2Y85A 2JQXA 3APTA 3UW6A 3NXLA 5K2ZA 3CASA 3BW3A 5BNKA 1JPDX 4HN4A 5C70A 3MDWA 1TPWA 3ZVHA 1KM1A 1Q63A 4KGJA 2C1GA 2CPUA 1S2WA 1P7TA 3W1UA 3S42A 3QHMA 1CT5A 2JIWA 2P8BA 2XVLA 1F3TA 4AAJA 2V3FA 2A3HA 2ZQ0A 1SPQA 1H51A 4HNNA 3VUSA 3G3DA 3C2EA 4ENLA 2JBMA 1SW3A 1Y5VA 4BA0A 5BW6A 3H6OA 4XZNX 5I03A 2YW3A 1XYMA 1GT8A 3EXSA 1EJTC 2VWSA 1LDCA 1C90A 5B80A 1R2SA 3Q4DA 1WDWA 4O16A 3KVKA 2TRSA 3PJXA 3R10A 2YW4A 5H91A 2QNEA 3R0DA 4K7VA 3IRDA 4U31A 5A6BA 3IIVA 5CPOA 3WD2A 5I3KA 1L6YA 5IRPA 2QGYA 3G1VA 4EPDC 2E5BA 4Q8UA 2C3ZA 3NFUA 2ZDRA 4PTNA 3DFHA 1BTCA 3S6TA 5EMYA 1VENA 4QCFA 1K6AA 1QHOA 1KR0A 2PWDA 2YL8A 3WQOA 4RNHA 4TIMA 2RJGA 2IXVA 4M29A 3VNMA 1SSDA 3UXKA 2VVNA 1HTIA 1AFSA 2D2GA 1M6JA 5AYXA 3TYEA 5CC3A 5IM51 3WBYA 5LHFA 4I8DA 1PIFA 1VYSX 4UOZA 1E9ZB 3S1WA 3CIVA 3M5ZA 1C3FA 2EPKX 3B8DA 1JUBA 4R7JA 3QMRA 5A8GA 3W37A 4IP7A 3C0SA 1F9CA 1R47A 1E3XA 3R94A 1WQ5A 3WO8A 4ZO8A 3P3BA 2IPGA 1GEHA 1ITUA 2VOMA 1X39A 2WSRA 5JU6A 1OFEA 3SBFA 1DORA 3QLLA 4N02A 4HSHA 2A3CA 3VGHA 4XUYA 1AVAA 3GC2A 3FAWA 4HU4A 2WLZA 3CL6A 4YCOA 1A5OC 1WUFA 1O5XA 2CZ5A 3IGHX 3OVPA 1H0IA 1QI3A 4CKQA 3KOWA 5G5IA 1WNOA 1BXCA 5FEPA 4OVXA 3M64A 1NOUA 1VHCA 5FAJA 3FW6A 1GVQA 3LOTA 2XIBA 1BVNP 2P0IA 4GI4A 3UPWA 3N12A 2CHNA 1R5YA 3BV4A 3W00A 4XD3A 3WLOA 1TV3A 2YB1A 1WXJA 2DT1A 1V6VA 3SAZA 1BVZA 3W7EA 1SU5A 4PRWA 1YW1A 2HROA 5FA5A 4GQ0A 2YCLA 1MVYA 3N6HA 3I3BA 2GL5A 1VFMA 3MSDA 1S5WA 1E0XA 2A3EA 2QPXA 1F07A 1SUXA 1FHDA 2HPMA 4OBRA 3VFLA 2BFGA 1TWSA 3GZ3A 1UG6A 4KMQA 4DHGA 1Z41A 3WDQA 2Z26A 1UD4A 2FTWA 3LGEA 1FH8A 3VKCA 1E70M 2PAJA 1GJPA 3KWXA 3TC7A 5ABEA 1OFPA 2YCLB 4LVAA 1CZ1A 4M0XA 9XIMA 4MZ1A 3DC0A 2DSKA 1TUXA 4IX0A 3NQAA 1VFHA 3N6JA 3RU6A 4FF5A 3N34A 1EJ7L 1EJVC 3SRHA 3ZLHA 1IQ8A 3N18A 1NELA 4CUCA 4BWLC 3A4WA 1KBKA 3PB2A 3S46A 3RO6A 4TXEA 3VIKA 2VCAA 3OGVA 4CU7A 4KESA 4XIMA 4AEEA 4ERGA 1KGWA 2O7QA 3P80A 4WKAA 2VCCA 3BMWA 3MO4A 5GJMA 4AIEA 1YTDA 1I0BA 3ZS4A 2CLMA 1VBRA 3UR2A 4XUGA 3ARVA 1KR1A 4TTGA 1H5YA 2KAUC 2H3DA 1U33A 2VFFA 4UZUA 1YHTA 1F61A 1GEQA 3VVGA 2XFWA 3M44A 2JGYA 4C6IA 4G2DA 4YTTA 4AW7A 2Y8KA 4WOQA 2BSLA 2GUUA 1DWGM 1FWJC 2DSZA 2PP1A 4DO6A 3NPUA 3OVQA 4BHYA 3G3MA 3CBWA 3B97A 3AFBA 2WMIB 4ROQA 2X1RA 2YL9A 4RZBA 2A1YA 4BQ4A 3KL3A 2YX0A 3VC6A 4J2MA 4ZQCA 1BD0A 4O19A 1JRCA 4QGCA 4TQTA 2OO0A 4A3QA 1J6PA 4FEZA 3FYOA 1QWGA 1GQIA 4E2OA 1O94A 4JIPA 5I24A 1GGOA 3H2FA 3VIOA 1OFQA 3NM1A 3CWOX 2JEQA 1RVGA 1OX4B 2V68A 4IFOA 2H6RA 3M46A 4FX8A 1AQFA 3BQ6A 1W8SA 4BEUA 3VOFA 1SFLA 3F03K 1QNPA 3AWOA 2PBGA 3UG4A 5I3DA 3VCCA 1NQKA 4M19A 1GZJA 1F6YA 1VGAA 2VGGA 4I6VA 3GVQA 1JNDA 3MTWA 3W2JA 3IUDA 4JAWA 1CBGA 5D30A 4DUOA 3EPNA 3B9AA 4Q33A 1UD5A 3LHVA 1FXQA 3WQ5A 3POHA 1I9CB 3VU2A 1U5VA 2PF8A 5XINA 1OX4A 2E09A 1JAKA 3L12A 1UBSA 2PB1A 3U4AA 4Q8VA 4U10A 1PCWA 3UWEA 2VFHA 2QUUA 4M3PA 2G41A 4D6IA 1A5CA 2E5CA 1AL7A 3MS8A 3LB0A 5I23A 4GX8A 2CNCA 3KWSA 4MF4A 3QFEA 3OVGA 3OZPA 2WMHA 3A22A 1H1YA 3GFZA 3SCRA 3SI9A 5A5WA 4RCXA 4MKSA 1CXEA 4JTAA 5HOSA 2I5IA 1H7RA 1W3IA 5AOUA 3DOPA 1W1IE 3I68A 2Z25A 3CHDA 3WQGA 4WEVX 3CQIA 3CYJA 1CENA 4CQ8A 1FCVA 2VL4A 4MNKA 5EA9A 1HKMA 4FS9A 3KDNA 3L4XA 1OC5A 3V0TA 4Q4QA 5BOOA 4HHPA 1K02A 2BHZA 5HAOA 4R5EA 2QCGA 2VEMA 3HZ3A 3KRUA 3CZKA 2Q02A 1US0A 1OFDA 4GQRA 5HNTA 4BQ2A 1YNYA 3O6CA 3QSTA 4GY1A 3FXYA 5A6TC 3AYRA 1CGXA 4R27A 5FAGA 4JXCA 3M41A 3E38A 2E25A 4EP8C 4IGMA 5A8PA 3RJYA 4RE3A 2ZRUA 4RUBA 3EYPA 3RYSA 3FXGA 5EFFA 1A47A 3QC3A 5C7VA 3H2AA 3SCQA 4PUDA 1OQFA 2RGLA 3AIRA 3TYBA 4J7RA 3O0FA 1XQKA 3AAMA 1AQMA 5FJTA 1XJBA 1TQXA 3LPPA 1FUYA 1NDYA 1O60A 4PEEA 2ACQA 2E6YA 5E5CA 4GQQA 4JIQA 4DNHA 3EXRA 2WHJA 3KW3A 1YKWA 4NILA 5G4WA 3URNA 3THUA 1TWZA 4PUMA 4JNYA 4UUIA 1ONEA 2RAGA 2YB4A 1R9YA 5CJ5A 5GNXA 1HUVA 1ONRA 3LGDA 2GK1B 4PE8A 3GQYA 3PB0A 4NAEB 4WJXA 3LBOA 3IWPA 1RA5A 4KFOA 1D8CA 2PTZA 3NGJA 4FNPA 1YPFA 1JD7A 2ZDSA 2X30A 1XIJA 4B4FA 1BKSA 1B31A 1DJGA 2BMBA 2I5GA 3TLLA 1XYLA 1IF2A 3GU1A 3BG5A 4NAEA 4FPSA 2YL5A 3U9IA 2CETA 2INZA 2V3GA 2FZDA 3QSRA 4O50A 3UZJA 1KFKA 3KCLA 2ZA3A 4BF5A 2BBFA 3QYSA 1V7YA 2WYSA 1T41A 1HIZA 4C6QA 4K39A 3BAIA 4GKTA 4AVFA 3NQVA 4CNNA 4MB4A 1J5SA 3HBLA 2G8ZA 1GHRA 1YXDA 2XM2A 2IKGA 2ANUA 4LNYA 2YA0A 1LOQA 1XLFA 3HM7A 4ACYA 2Y0FA 4Q4RA 1E1EA 2PDHA 4GIEA 4D6FA 1K9EA 4IJRA 3T42A 3QMTA 4HHMA 1F2JA 4NX0A 1X7FA 3H8AA 3M6DA 5HJYA 3TYUA 3E5PA 1EHAA 3GYEA 2VWTA 1P4CA 3PZIA 1ESWA 3RX2A 5BXTA 4NYYA 1UP0A 1JL8A 2NV9A 6CGTA 4XKMA 3FJ4A 3VK5A 1CDGA 3CAVA 4MJZA 1NQ6A 4B5UA 5MKGB 5BYWA 3CO8A 4E5TA 4PZVA 1EPVA 1YEYA 3UWZA 2J47A 2PDFA 3HGSA 4UTWA 2D20A 3BAYA 3T08A 3EXTA 4KEZA 1HX0A 1DIDA 4UFJA 4KETA 4XSMA 3N4EA 1FXPA 1MEWA 1EC7A 1S2CA 2VR4A 3UVIA 2DT3A 3IARA 4Z1BA 1W5OA 4I7VA 4IIHA 1RPXA 1OD8A 2J7HA 1TPB1 3AMKA 1MW2A 4L56A 4ZGYA 3VAVA 4AHPA 3OLEA 3HQPA 4CLMA 3BANA 3QQ1A 5GNZA 3HTWA 1GOMA 3U2CA 4RDWA 3A4AA 3Q37A 4JIIX 2BNJA 3GNPA 1GVYA 3W76A 4UTIA 4E3VA 1OFOA 4YTQA 4L7ZA 4DX3A 3I6TA 1W9VA 4IMGA 1FH9A 3WFZA 5JVLA 3VKBA 3CZGA 4XZMX 4E3TA 2OSYA 2QKFA 3UR5A 2E0PA 1EB3A 1P0DA 2BXYA 1ODZA 3WNNA 3DBPA 3C5QA 4G7EA 4J9JA 5H8UA 5M1TA 1E6NA 4N2YA 2VC7A 3VIMA 1CLXA 3RLGA 3T81A 1D2KA 4FNUA 1SFJA 4AY7A 4AZ6A 3BICA 3PHAA 4N9BA 5JH2A 4IISA 1OABA 1E9YB 3REQA 3AO0A 4GD0A 4Q6XA 1FWIC 3GNDA 4BFAA 1CGUA 2VT0A 3T05A 5KTLA 4DAFA 4BI6A 4ZR8A 2YA2A 2E68A 2OG9A 5J5DA 3VOGA 4TMCA 1U1JA 1IYXA 2B0MA 3RILA 3ZM8A 4IXXA 4ILSA 1EFZA 1JR1A 3WF4A 1HL8A 3ABZA 3CIWA 2D1ZA 3REQB 2FTYA 3M16A 3RMJA 2F6KA 2EJAA 2V2HA 9XIAA 3OPSA 1IWBA 1RAKA 4NI3A 2ZZ5A 3O6AA 2CIPA 1W2PA 1CXKA 2RUSA 5A6SA 4IJBA 3LUTA 1KBIA 1TV5A 4KF1A 1OYAA 2WAGA 4GOAA 3SJ3A 2HE5A 1EWEA 1TMQA 4HSNA 1TB3A 2XU2A 2IKJA 3DCPA 2XINA 4R3UA 1JF5A 3GG7A 1IEVA 5EPDA 1E4MM 4LCSA 4C1LA 1QPQA 2ZX5A 4IGSA 1SYTA 4DUWA 1EO5A 4F4RA 2ACUA 3UESA 4QEHA 1IR1A 3IANA 2A7PA 5FF3A 2FB2A 3CQ0A 2OYKA 5KEZA 4Z0JA 5CPSA 1Z32X 3RIKA 4U3AA 1GHSA 3EKLA 4WY0A 4LQ1A 4A35A 4LFYA 1TJRA 2J74A 1IEQA 4PTXA 4L80A 4YL2A 2J77A 4YPJA 2OJPA 4DVOA 5IXEA 1VF8A 3DHPA 3TQKA 4WGXA 1H41A 1Z69A 1LROA 2C8NA 2FVKA 3EWWA 3EA3A 1R87A 1SO6A 3W70A 1R9XA 2CU0A 4XD4A 3CC1A 3IJIA 3SN0A 5LA0A 2Q8XA 2ON3A 1HZYA 5CC5A 4G5DA 3G6MA 5LIXX 1UJQA 4LAKA 4GISA 3JUGA 3D3FA 1P7TB 3VIJA 1YXYA 4HNOA 4QS6A 2R82A 4NZ1A 3PSWA 2LLEA 2PRLA 4UOQA 1TZ7A 1NWTA 4L9XA 5D2YA 2INEA 4WSHA 2PP0A 3CHFA 4HHHA 1GVFA 1ZENA 1U5JA 1VFOA 4GZJA 3LHWA 1ELSA 4B3LA 1A80A 4O8AA 3PJUA 2BY2A 4DZAA 2UV8G 3SM0A 1S39A 1OINA 3P0XA 1PEZA 4LT9A 3C3UA 5DRCA 4FX7A 3IJQA 4GUIA 2CERA 1EGMA 4MLJA 1XP3A 2OELA 4V15A 1UD6A 3MUAA 1JZ5A 2Y5SA 3OTRA 1KRBC 3BSGA 3NNTA 3ITOA 1BGGA 3UXIA 2G95A 1TIMA 3VDAA 2C7FA 1G4SA 3HU7A 4R9XA 4TV6A 5AC8A 3WNKA 3LM7A 1V93A 2G4FA 3ZJKA 3L0GA 5C54A 3JZEA 2JIEA 1P1XA 3WLKX 3FS2A 4CN6A 3QGVA 3BAKA 1G7VA 2NQJA 4ZB5A 2PC8A 5DCBA 1W1B1 1BHGA 1Q85A 7XIMA 1MW1A 5AC7A 1XLHA 2Z1WA 1HP4A 4BEQA 5C9WA 1A5SA 4MAVA 4NZ5A 4YNGA 3ZJ6A 5BMXA 1WOBA 5CC7A 1BSLA 7A3HA 5C2XA 3AJXA 1P5BA 3LTYA 1B1YA 4H6EA 3QV9A 3APGA 3KTSA 1FWTA 3PBYA 3WQVA 3WQFA 3TIMA 3VXGA 2FPYA 1OFBA 1LT7A 2HXUA 2F2KA 3GFYA 4P7NA 3W27A 1P48A 4FMVA 4AVOA 2I9EA 1UP2A 4PTMA 3RG6A 1EJSC 3TLQA 2E5DA 2Z1BA 1RD5A 2J6XA 3V0SA 3MUIA 1A5LC 3GIPA 4L61A 1Z89A 1DIKA 1QR7A 1EC8A 1TIWA 5I3IA 1KFWA 1H09A 3NL3A 1RK5A 1JFXA 1XLKA 3PJWA 3OEXA 4AC7C 4F0SA 3WLHA 2BASA 2WNZA 2GLKA 3TR9A 4M81A 4Y8FA 2VGBA 2E9LA 3O06A 1XIBA 1XGDA 2R1MA 4HNVA 1MFVA 2BXVA 2OOGA 1KW1A 4L4PA 2I17A 1VPXA 4Z2KA 4AHQA 5CZJA 4ATDA 3NQGA 4PTDA 1X6UA 1UB3A 4BY3A 4O1AA 1L6GA 1DOSA 3PPFA 3L5AA 2ISSA 4H7VA 4U28A 3DX5A 4XBKA 1W3NA 3S9ZA 1KKRA 4H6QA 4O0QA 2JGQA 4KQNA 3W24A 3KLLA 3JZUA 3MSRA 5G1TA 2G4JA 4GIAA 1UBPC 2BOFX 4UNIA 2B7QA 2TYSA 4MNJA 1U5HA 2XSXA 2B31A 3P0WA 4DUVA 3D3AA 5AHEA 4NUWA 5CH9A 3L5MA 3W7PA 4M6VA 3WNOA 4LC8A 4AXKA 4IIDA 3IAQA 3GNXA 4M1BA 2ZZ4A 4PRTA 3ECQA 4ZFCA 3QQ0A 3OG3A 3QFWA 2PGWA 3ZR6A 3AXXA 1WPCA 1BG9A 3ARZA 2XN2A 2FDSA 2RDXA 5A8MA 4QJ4B 5LXXA 3WH9A 1V3HA 1YBQA 6PTDA 3TKFA 1LG2A 2YIHA 1OVDA 2QUTA 2QUVA 2XWEA 3E2SA 4Z1AA 2IKIA 4E4FA 3E2QA 4H04A 4E38A 3VM7A 3GW3A 2ABBA 3LCWA 4IFRA 1REQA 4MB5A 1EUNA 4GY7A 4CU6A 3E0VA 3TC6A 1T8QA 2QCDB 3ORWA 3SY5A 4W4QA 3GVWA 3LPGA 1R0MA 2WNNA 2WWDA 1TSIA 2BVYA 1GVRA 2HWGA 1DE6A 5M03A 2ZIDA 1H2JA 1VFUA 1QAPA 1UOKA 2PDXA 5D02A 4O0KA 1LJYA 3R43A 2VZUA 2YFNA 2P1FA 2J9ZA 4ML9A 2VHLA 1W3LA 3A3XA 3FV9A 1KC7A 2C18A 3P82A 4S1FA 1V0NA 3DFOA 1AG1O 2YKKA 3VOCA 4NU7A 1P0EA 2HS6A 3T2QA 3VGBA 5AHFA 4GNKB 3LV5A 3W2MA 3VZXA 2OU4A 4MY9A 3SQMA 4PFMA 4ASTA 3IGSA 2OGYA 5FL0A 4Y2WA 5HATA 2EKGA 2PWEA 3OW1A 3B8SA 1QTWA 4XTDA 1KM3A 5M2FX 2J24A 4M1RA 4O1CA 4MWAA 4NZ4A 3CLMA 3L9CA 2I1OA 3F2CA 3PAOA 2DJXA 1HJUA 4GMEA 1Q6QA 2AOSA 1X6NA 2VXNA 3WK3A 7ODCA 2DORA 1EL3A 4XO7A 3HPXA 4N0RA 4GZIA 2HTMA 1MXGA 4XK2A 5FEXA 2BX7A 1OT2A 1Q8JA 1RD6A 1EEPA 3SRDA 5EY5A 3GKFA 1O6IA 3NOEA 2B4GA 3EDFA 1ONWA 3CIXA 1AA1B 3AIWA 4QLLA 3BTNA 3W87A 1WKDA 4IMFA 4PODA 4UQBA 1JYNA 4LS2A 2WWCA 1G69A 1F8IA 4B91A 5AY7A 2PTDA 2QV5A 1XV8A 2C15A 2DH3A 2GVEA 4ZBCA 4UMAA 4MWAD 2AGKA 3CL7A 4EF8A 3K4AA 3DFYA 4MFEA 1ITQA 4HGXA 2E28A 2PGRA 1VFLA 3T8LA 5CXPA 3NZPA 1TE6A 3TE9A 3GSMA 5KMYA 1ZGDA 4KRZA 3G1HA 3TA9A 3QM3A 2YYTA 4DJEA 3R25A 1QBBA 4P8XA 1LL6A 5DFAA 4DF0A 3AHZA 2PCQA 2X16A 4DLMA 2PWUA 3PZVA 4DO4A 1NAL1 2O9OA 2ACSA 4GJJA 3VD5A 4GZEA 1Q6EA 1JCJA 2A2IA 1S2TA 1GYMA 1DJYA 1GKQA 1J93A 1E71M 3TH6A 2W4XA 3EMQA 3S83A 3LSBA 4HU3A 3CPRA 3KUMA 4I9JA 1PX4A 3VI2A 2VX5A 2VCBA 4E8DA 4LWWA 3ZR5A 4IQEA 2WVUA 4UBPC 1PTAA 2Q71A 1H5VA 2OEKA 3W7IA 3GXPA 2HCVA 2D2JA 3QPYA 1W2VA 4PCPA 3CTLA 4GNJA 4RE2A 3SO7A 1JVNA 5BXSA 2DPEA 1YPXA 5CKSA 1DE5A 2NVCA 3OQ8A 2PODA 3WF1A 3DKLA 2ZICA 3C0JA 1CB7B 4F3HA 4XVDA 2FZBA 4JY8A 1GQLA 2P3EA 2WO5A 2QXWA 1J0KA 2BGSA 1FWSA 2YSWA 5C2CA 5LGZA 4YWSA 1RLDA 3FNDA 3W9ZA 2WJDA 2PRMA 2REQB 4KCVA 3S3GA 3MYOA 5CPLA 1ML1A 4R34A 1HKVA 2ZUUA 1KA9F 2W62A 1IEIA 3A24A 4JTEA 3RNDA 1M5WA 2VZTA 4A3HA 4JX5A 1LBMA 1B2YA 4N4QA 1JZ7A 1C9WA 3EMZA 3FCPA 4AMAA 3QOMA 1UR8A 3GC4A 1Z42A 3NUKA 2REQA 4WIWA 5A1AA 3PBGA 2X0HA 3RLUA 2NLIA 4JPGA 3VYLA 3UCCA 3SEPA 3GB6A 1FWHC 3NQDA 1KFLA 1M65A 4LX4A 4D1JA 5CPQA 4ZB2A 3KDOA 3P74A 4W89A 1EZWA 3GU2A 1UASA 5CSSA 4FIQA 4RLIA 1XDLA 4IMDA 3DYOA 4IMEA 4HA0A 3HG4A 1YADA 4GXMA 1XR2A 2NQLA 3WJWA 1R8LA 1OEPA 4ZQOA 1UWUA 3RUBL 4I5RA 4X0VA 2O9RA 3C52A 4EWND 4E2DA 3N2MA 1EZ2A 1JCLA 2J8FA 1V02A 4H8HA 1TG7A 1J9YA 4MHBA 4N9DA 5A6JA 3RN6A 4H8UA 4DWSC 4QG6A 3MBDA 4Z2IA 1OCBA 4KWOA 2WXDM 1VQTA 3N2TA 1JD9A 3GBEA 4PRRA 5T9CE 3ZSTA 2CZFA 4N42A 1KV5A 4QJ5B 2OWXA 2J9XA 1NTHA 4QLKA 1XM3A 4OIFA 3B8IA 2YCJA 3TTSA 4AZGA 7CGTA 3VOJA 1R9ZA 2NWSA 3FK4A 1VIWA 4D2JA 3M1ZA 3WQWA 4F40A 2PI6A 4U5KA 3BDKA 4V1XA 2VDIA 3DUGA 5I07A 2ALRA 2HNHA 1UJPA 2NQHA 1YTEA 3MV11 4ZSUA 1CCWB 3KVLA 4URIA 2BG5A 4YHEA 2HBXA 1AMYA 1QT1A 3FSTA 3W2LA 3FVMA 4WOZA 1JZ4A 2VNCA 2X7VA 4CD7A 4JIHA 3VIGA 1KO0A 2ISWA 1PB0A 1QPKA 1I1WA 3GG8A 4AYGA 5DXXA 3ARYA 1UA3A 3QHOA 5BWFA 5SWUA 4GUFA 1V5XA 3FA4A 6ENLA 1EJUC 1S5MA 4ORIA 5H8PA 3Q67A 2CLLA 2EO7A 2O55A 2ZZ1A 4H9XA 1SMAA 4B16A 1FCUA 3EB4A 1G67A 3O8AA 3T0AA 3BCJA 4MY1A 3HJZA 4DO7A 4JKKA 3M07A 3PNZA 4LB4A 2J6VA 2QAFA 3UG3A 1X7IA 3J7HA 4FX6M 1QASA 3DHFA 4IFKA 1YPIA 1HN1A 3IRSA 4DYEA 3D47A 3PF3A 4Z0SA 3W1PA 1RP8A 1X96A 1Y7VA 2QIIA 3SR7A 1OK4A 4WF7A 3HGJA 3UR8A 5BCAA 1M7OA 1ZJAA 1J12A 2JFEX 3ID7A 1B0IA 3SDOA 3C2RA 3W1XA 5KZMA 4J3VA 3EWYA 3WQDA 5F7UA 3S1XA 2C14A 3FN9A 3HG5A 4DBEA 4IJCA 4L9ZA 4HU8A 2BVWA 9CGTA 3ITVA 4J4KA 3P6LA 4ZE4A 4JHMA 1BEUA 2HNEA 1J96A 1RBAA 3TFCA 2ATSA 3F4DA 2ACRA 1HP5A 3V36A 4Q4OA 3TJLA 3BCFA 4H19A 3UG5A 1HGYA 3LQGA 3T6CA 4ZXLA 3KVMA 2V63A 4QDWA 3CAQA 2OEJA 2XZ9A 4ZSTA 2OR2A 1EXBA 4HK5A 2BGNE 4W5ZA 6A3HA 4C65A 1F8MA 3TN3A 3UWYA 3GDRA 3KL5A 2PDBA 1TRIA 3KHJA 3NGFA 1ZJBA 4OOZA 5JIPA 3G1SA 2VRJA 4JQ4A 1Y8BA 1DKWA 2PURA 4HP5A 1BYDA 2VFIA 2EG8A 5G4EA 4PC8A 3B9DA 4IPJA 3DI0A 2F7FA 1AZ1A 1W56A 4EOUA 2WPBA 4D71A 3H7VA 2ZZ3A 3C2OA 3ALFA 2FH8A 2QDGA 1TPDA 2DT0A 4NYUA 2GDUA 3VKKA 4LCRA 2Q09A 1LP6A 5LZLA 4FLQA 3MBFA 1P0NA 3M0XA 3IK2A 2NUYA 2WC3A 4WKHA 4DM2A 3DIPA 5C9XA 5E0CA 4DAIA 3E3HA 1EX1A 3CUZA 4QBXA 4PUWA 1VCFA 4GLEA 3Q58A 3GTIA 4O0ZA 3LBMA 4HA3A 3BG9A 2JALA 4QIUA 4LUIA 7REQA 1DJNA 3MDUA 3U7BA 2B7OA 1VJIA 4I6KA 3S2LA 3DENA 2E9BA 4H01A 3ZT5A 2X2YA 3GTNA 5CSYA 4YTUA 2A85A 1H62A 2PDCA 2V2CA 4PB4A 4C6OA 3NSXA 3S5SA 1MYRA 4GVIA 2XGZA 1PAMA 4FALA 1RBLA 3A4JA 3IGUA 5D9PA 5K7JA 4IXHA 5AZ1A 1XCWA 1Q5MA 1VLIA 3TA6A 3ARTA 1WDQA 2Y7GA 3KCOA 1A4LA 1PTDA 2GOKA 1QNRA 2WJZA 3GHTA 3HV9A 5DY2A 3L4YA 4Y9AA 3NDYA 4JTQA 4K1GA 5BXPA 1NWSA 3CAKA 4Q4KA 3H2MA 3ITCA 1KRMA 4BF9A 3LRMA 4HQVA 4QX4A 5G2HA 4PCSA 1MMFA 2PLCA 1HKKA 3TJ4A 2PD5A 4EXQA 4F9JA 4PULA 2PDLA 4MFDA 3WMSA 3M0ZA 4KERA 2NSOA 1JI1A 1YTKA 4WLCA 3M5XA 4XX6A 5CBBA 2CLOA 4F48A 3RAOA 1TVLA 2J9YA 2W79A 3N4AA 3IS4A 3GR4A 3L68A 1G7UA 3VNJA 2F84A 1PDYA 1I75A 3AYTA 4C7DA 4MPQA 4UTHA 1FY6A 1DEDA 2CLKA 1POJA 1HNYA 4GI9A 2C91A 1HO1A 1IT0A 1B3XA 1ZAHA 2CWNA 2W66A 1DWAM 4GVFA 2V5KA 2QUNA 1ZBVA 1HJQA 1Z6KA 3HQNA 1Q66A 5AYZA 3FIGA 3A3WA 3KCJA 1E40A 2EG6A 2OEMA 1JULA 2QLYA 5DCDA 3UR7A 1LG1A 1XYFA 4CQAA 1F4HA 3RX4A 3NZGA 3FHQA 4AISA 3NQ6A 2O9PA 1WUEA 6REQB 1P0KA 2V9DA 2HE8A 2RDUA 4ERIA 1H7PA 4LUTA 4MTVA 1EBHA 3PULA 1DXFA 3BL3A 4IQDA 3ZJ7A 3AXIA 4PMYA 2MNRA 3WEMA 2X1IA 1JG9A 1V6WA 2GVGA 4P61A 3O05A 1ZHAA 2PTXA 3DXIA 3U8GA 4HNCA 2XVPA 5G4HC 1AJ0A 5LA2A 1GVSA 4LF1A 3WIJA 4LUTB 3HN3A 1Z3NA 1KFEA 4H2HA 5C9UA 2D69A 1MNSA 1PE1A 3NDOA 4LVDA 4MYAA 3NR0A 1GK8A 4YS1A 1JUKA 2J88A 2XSBA 2NVAA 3HQOA 4UTJA 2WQPA 2GSHA 5E6ZA 1AJZA 2W9MA 3BAJA 3R2GA 4X63A 4PYSA 2ZUVA 4G56A 2J7BA 2VX7A 3URBA 2YBUA 4LOCA 2P53A 2CYGA 5AVHA 1XIDA 3T8QA 4NJKA 3WFAA 3ARUA 1TMHA 3AXMA 1J0IA 1LYXA 2EPHA 2GWGA 1H61A 4RW5A 3UGVA 2C16A 3KZPA 1JYWA 2NXIA 2BB0A 3SCNA 3WG6A 1M9HA 2G3JA 4NI8A 3LM3A 4W87A 2YBVA 1PUDA 1PSCA 3LLXA 6TAAA 2A79A 4WD0A 1UH3A 3MUY1 2WKLA 3PN8A 1GWJA 4TX6A 4UTTC 1VHNA 4O14A 1WKEA 1UROA 1KCZA 1PXGA 4J3SA 3GNRA 1QCWA 3LI0A 3WQ4A 3ISIX 5HDRA 5A94A 5AVNA 2FQIA 3MB9A 5HA7A 4CCZA 2QEZA 3II1A 4Q8OA 5HINA 1LQAA 4BF7A 1IV8A 4JFSA 1KLYA 3P61A 4P8VA 4N7QA 3RPDA 3EOUA 3VOHA 3SRFA 3DHDA 4P7LA 1WDRA 5FJJA 1A53A 1K9TA 3EPOA 3UEQA 3JW7A 2VTFA 2XSAA 3SCTA 2QS8A 4EVZA 4H8VA 2P50A 1LM1A 2ZUTA 2GZXA 4GACA 2I7GA 1UMLA 1XH0A 1K9FA 3O6YX 4A8RA 3MU7A 4DF1A 4AYSA 3R8GA 4HKPA 4Q4PA 4ZB0A 3HQ1A 1SR9A 2G5WA 4JQ3A 1V77A 2FVLA 1GONA 3N9RA 4JN8A 3AIVA 3DAQA 3ITLA 3W82A 4QR6A 3OHMB 2WZMA 4M24A 2VX6A 3E1F1 3TV8A 1UW9A 4DPQA 1Z7AA 3RJXA 1HJXA 1UA7A 3HMCA 1SSGA 3PBWA 3EX2A 4MPKA 4DLFA 1V6XA 2EPOA 4J40A 3V16A 5C5YA 2CLIA 4IUGA 4DXVA 1WA3A 1W5MA 3HJEA 3H24A 3W01A 3WMLA 1C8XA 1JFHA 2CHRA 3GHRA 3TSBA 1OG6A 5LIUX 2XJ7A 1TE1A 1A3XA 2Z27A 2HBVA 4JGDA 2FMOA 3MC5A 3QMSA 2QDEA 3QR3A 3W7GA 1WAUA 1E51A 3G8RA 3BO9A 1DBTA 1K6WA 1XG3A 4RE4A 4KGLA 5IFPA 4PB5A 4E8CA 1YX1A 1D3GA 3LDVA 1AW2A 3R0UA 4BQ3A 2ISDA 3L2MA 3OYXA 1KWGA 3L4ZA 1QDSA 4ZE5A 2XIIA 4M6UA 1ZB5A 3GH4A 1BFNA 2F6XA 3BGAA 1S46A 2YFOA 1AH4A 1TZZA 4FLRA 2AQWA 3OB8A 1QW8A 4XAYA 5IDZA 3GDLA 1H60A 2PS2A 4QDPA 4HBKA 4D6JA 4K8GA 1LOSA 2XVGA 1MI3A 3UXDA 3SN4A 3NG3A 4UCFA 3H55A 5AC6A 3NYDA 2PDNA 5AHMA 3VC5A 4XKYB 4HVXA 1QRQA 4RE0A 2QR6A 4HCLA 3VNZA 1F7BA 4LU0A 5GVJA 4AMCA 1K1DA 4HZ7A 4LS0A 1TX2A 3S6DA 1IT8A 4OOUA 1D8WA 3M9YA 4O57A 2O4QA 1TR1A 3OZMA 3W25A 1DP0A 1XPYA 2V81A 4CNPA 5CZTA 3CAWA 3TW6A 1DWIM 2VQTA 5DT7A 1KTBA 4I7WA 4XD5A 4NJIA 3N2CA 1QXLA 4OBSA 2VEIA 1AUSL 4IWWA 4OQVA 1WCGA 3AHYA 4IGHA 2NX3A 5CJMA 3SURA 4J2PA 1UD3A 4QJ1A 2OFJA 3WKZA 1BYBA 4MM1A 1OF8A 4L1GA 1QUMA 1A5KC 4NNCA 2DZXA 2DDXA 1SO5A 1C92A 2ADAA 1Q7MA 1F05A 4DEFA 1JZ6A 4I7UA 3FJ6A 4NQ1A 2NLYA 2YXGA 3V5FA 3B8VA 3FSUA 1F5ZA 3S47A 3GC5A 5D8WA 4Y90A 3A23A 3PAJA 3LA4A 4JFUA 5FJRA 4O1FA 1J10A 3UU0A 1UD2A 2G3IA 3FJLA 3T2OA 3OU8A 1SQ7A 1XYAA 5HWMA 4DB7A 2C1HA 1O95A 3SIZA 3TAKA 3I7SA 4RL3A 4PCNA 4KPLA 1R86A 1JQXA 1H63A 2JF7A 4C1NA 3B03A 1FWCC 1BAGA 4HPJA 1SGJA 2PUZA 3GLCA 1ZBKA 2QQ6A 4UTWC 5DBUA 2PWVA 4MJ2A 1JGMA 2GK1A 3MI2A 1O5QA 5EMKA 3W3OA 4D6GA 2EAWA 3DFSA 1QWKA 4HYRA 1R2TA 4QNEA 1P6CA 4UCGA 1W3KA 2H90A 2CITA 4CQCA 4YTRA 3NQ7A 4YU1A 3OYZA 1E73M 1SJAA 2VEFA 3MKVA 4DIAA 4H9YA 1UHVA 1PV8A 3CM4A 1NP2A 4MSSA 2VEPA 3HURA 1QW7A 2VD9A 4YVPA 1Q8AA 3OBEA 2AAMA 4H41A 3NL5A 3AROA 2PGFA 2Q3OA 3AIUA 3C6CA 4ZO7A 1WKFA 4TTUA 1NWRA 1VLWA 1U30A 4IZGA 2G50A 1EC9A 2Y7DA 3MKCA 1FWAC 1G4PA 5HMDA 4Y7EA 2DP3A 4N9CA 3ENLA 4NKCA 2YXOA 4PMXA 1B3WA 1QATA 3MZ2A 3VOIA 1F4AA 3EX3A 4JTKA 2A7RA 3ZFHA 1TMLA 4A6GA 5J04A 4NY2A 5KZDA 5CSRA 2YDRA 1RP9A 3V18A 1O1ZA 2I57A 1ZCOA 1XCXA 3VDGA 2QMJA 2W61A 3N3TA 1EYWA 2HZGA 1DJZA 4CNOA 4OE7A 3ZMRA 4KEMA 4WK9A 3D46A 2BVTA 1VAHA 2CCRA 3GG0A 4Z08A 3W0KA 1J2BA 1JF6A 4REQB 2WZIA 3FFSA 4DJFD 3FEQA 3C2YA 1DTUA 4O17A 2WSKA 5AC5A 1LBLA 1YDNA 4AIUA 4IPLA 3CWNA 4DYJA 3ZXWA 1B3OA 1KXQA 4W85A 4HNTA 4EPKA 1ZBWA 5FF7A 3OQEA 1DQUA 4CU8A 4RNIA 3S8HA 5I0DA 4NZ3A 4K37A 4WRHA 4ZTXA 2Q8LA 1BLIA 1LWIA 4IGNA 1E0VA 5EU9A 4ACZB 4ZCWA 5DX7A 3S2CA 3B06A 1OYBA 2WPGA 1MEHA 4C60A 2Y24A 3LHZA 2F61A 1KTNA 1FOBA 3ABQA 4IIFA 2DIKA 1FHVA 3K30A 5D32A 3C61A 3QBUA 4ES4A 4F0LA 1KRCC 4JQ1A 3UNTA 3GU9A 4Q4SA 2OTDA 3G1AA 3WLSA 4LS1A 2H3BA 2QCNA 3WEOA 3ANYA 3BV7A 3F5JA 3GNNA 3W7MA 5DMYA 3HPFA 4O1EA 1OBAA 4OT7A 4Q22A 3C86A 1V6UA 4NL1A 3GK0A 1XINA 1RLCL 5A6BD 2TAAA 3LPFA 5M3WA 1BWKA 2J75A 4RZ4A 4MMWA 1XF0A 3WLMA 3N1AA 2ZX9A 3OVRA 3TXZA 2HDJA 3MYPA 5A6AA 1TR9A 3STEA 2R94A 3WN6A 5IFTA 1M7PA 2XH7A 3PBVA 4GXWA 4DBWA 4ADSA 2Q3RA 4BZYA 1N8WA 2E6AA 1UC4A 1KCKA 3PNUA 4K38A 3B9NA 2Z29A 3BQ5A 1IIHA 2QF8A 2WANA 1E56A 4OV4A 3NTYA 4HZMA 4Y9OA 3TSDA 4UFMA 4HN8A 1V3IA 3CHVA 3NZQA 4X0NA 1S1PA 1PBGA 3LMZA 3OZYA 5KINA 1CTNA 2X09A 1K7EA 2J78A 2Y7FA 1XSJA 3ATZA 1V3LA 4LUJA 2Y88A 3OBAA 1MSSA 1ISYA 3CUGA 4Y96A 3IJDA 3PVFA 2ICSA 3A5VA 2E9MA 3VDCA 3NPXA 3W7KA 4BI7A 1R3TA 1NWUA 3PP7A 1CLKA 1A49A 5LHEA 7ENLA 3WH7A 1XLCA 1DWHM 4D9PA 3GH5A 2VRKA 1GKRA 3LGGA 2PDIA 1G6CA 4QCEA 1B30A 4GC4A 1LRQA 4M82A 5CLTA 3R12A 5L9FA 1XRFA 2J66A 1UKPA 3KXQA 2FDMA 4IHCA 5XIMA 2FH6A 1BXNA 5I00A 2QCCA 3SUTA 3M6YA 1GQNA 2IKHA 5JXQA 4F0MA 3G24A 3N2OA 5F1VA 3KP0A 4NF7A 1OGBA 1FWNA 4TUFA 2DSWA 2Q01A 2V0TA 1U2YA 5C6MA 3UPBA 4K1WA 1SMDA 1LRNA 4UFHA 3W2KA 3LCFA 3SUUA 2PLJA 3P5YA 1CNVA 4DO5A 3R79A 3CZJA 5GJPA 1W0MA 3L23A 1FDJA 2DH2A 1PZ1A 1DIOA 2Z6JA 3ABXA 4NAFB 2Q8ZA 3N2BA 4JL1A 1YE6A 7REQB 3TDFA 4B3ZA 4PR4A 1EPXA 2WB5A 4OZOA 4US6A 2D22A 1XLDA 3KTCA 4DELA 1GQJA 1GZ1A 4PMNA 1Q4WA 2H8XA 2NV1A 3WDJA 3TAOA 4W88A 4A8LA 3C0LA 4E2VA 3DYPA 5A6KA 4S3BA 1BF2A 4H7ZA 6ALDA 3CL8A 3I6RA 4HSOA 1M1BA 1ZSXA 5FJOA 4J5NA 3DFQA 1GVOA 4AZ7A 4NIRA 2XGIA 2A5HA 3KBJA 3E96A 5TQLA 4HZ8A 2MANA 1MRQA 1FDYA 2W63A 4EACA 4FF7A 3KOFA 4ZENA 4POCA 1PWMA 2EQDA 1E1CA 1J0JA 3RPMA 2Y70A 4H9VA 4Q8NA 2V38A 4Q3MA 3W74A 4UZSA 4UTUA 1L0PA 5T8GA 4UNLA 1A5NC 4WJEA 1DQXA 2IQ0A 1VYPX 2DZPA 3ZJ8A 1EJXC 4LVGA 1M7XA 4LRSA 2XN0A 2FVMA 1NFGA 4GIRA 3CEPA 2RJHA 2BOGX 4NZCA 2OODA 5LSMA 4QXIA 3K8KA 2D0GA 1T7LA 1IXOA 1I6NA 1Q65A 4AU0A 3BLFA 3GTXA 4ORMA 1PPIA 4QAIA 2ZA2A 2A21A 1EP1A 1ZL1A 2GVJA 1TJ1A 1H3GA 3B8WA 4M51A 3BGGA 2BS9A 2X8RA 2WBKA 2XN1A 4DWDA 4KIRA 2IMRA 5F2IA 3EOLA 1KLZA 4M8UA 3TROA 5HJLA 2PBOA 4QE4A 3TTYA 2W27A 5D05A 4E0CA 3FLUA 4DJDC 3SCUA 2CLFA 3H70A 3AMDA 4A3UA 3TTQA 3T0TA 1V8EA 3VNIA 3MANA 3LHUA 3WJZA 2NQ9A 5F4WA 8XIAA 4P8WA 1BGAA 4RXGA 3MCNA 1V79A 5JBEA 2P5NA 2XIQA 3LQLA 2VZVA 1HJWA 3LY0A 2Z1KA 4PMZA 1NDZA 3MP5A 3WSUA 2DY3A 5E0KA 2ZVIA 1G5AA 2Z1XA 4GZ7A 4JTTA 3OHIA 1K7XA 3CHCA 1PKNA 1GPWA 5CGMA 4F66A 2QV4A 3BLPX 1V3KA 2FGBA 3VMNA 2OPJA 4US5A 2SFPA 2WVVB 3GY1A 3L0KA 4KFPA 3DI1A 3MHUA 4H3DA 3C2VA 3FA5A 2WLYA 4IH3A 2IPFA 3AZSA 3P67A 3N2XA 1W5PA 3COTA 5M17A 1WB0A 1NDVA 2EBNA 5G1MA 3DBNA 5HUOA 1HJVA 4C7FA 3THAA 3NAVA 3QV8A 1IR2A 1MNZA 1CXFA 3Q2DA 1OJXA 1EDTA 3GD6A 3O07A 3F1QA 1R38A 4GO8A 4S23A 4WJ8A 2PTWA 3Q65A 3E49A 3WLJA 1Y0EA 3GX9A 2OZ0A 1J0YA 4F9DA 2ZCGA 4S2CA 5D4YA 4MUPA 1D3CA 2HVOA 3ERPA 3VPLA 4H9TA 3H2EA 3WUEA 1BTMA 2AMXA 4U3CA 1KM4A 3BLKA 1B54A 4HYVA 4MYXA 3H4XA 4JD4A 1A3WA 2FYMA 4DJEC 4LSBA 3PY2A 1N55A 1V03A 2GQAA 1OY0A 5D9MA 1J8VA 1V51A 2PDKA 3MW7A 5G2IA 1YQ2A 1CWYA 2HVNA 4B5VA 4LRTA 1MW0A 3N29A 3W1RA 1JUEA 3F2DA 2KZHA 5XIAA 4S3FA 4C6FA 4FK9A 3TX9A 1FFRA 1OK6A 3USZA 4HCHA 3STPA 4TVUA 3WQPA 2PWHA 1X8CA 4O15A 4K6AA 2PZNA 3VE7A 3PTMA 4MB3A 1VFTA 4N6FA 1EF3A 4EX4A 1Q2RA 2YGYA 5G2WA 3IVTA 3KBMA 5FJPA 3L4WA 3UXLA 1SW7A 3VABA 1UR9A 3BC9A 1FWGC 2DZBA 2QCDA 1QI4A 3EOSA 3AC0A 2PU0A 1XLBA 3S9IA 1RSCA 4XSLA 4J3ZA 4KFNA 3PZQA 2VYOA 3D5HA 3RLHA 4JTIA 1FP8A 1S2AA 4FOJA 1QU4A 4LF2A 3A47A 2QJHA 3W86A 4LUSB 2DZUA 5K3VA 3QKZA 3M5VA 1ZAJA 2BZNA 3G5EA 2AMGA 3CB8A 1E1FA 2VD8A 4HPHA 3AICA 2NWRA 1MQQA 5HANA 3W53A 3UG8A 5CPMA 2GJXB 5TNVA 3QQWA 3C0QA 4JN7A 3IIZA 3ZT6A 3S9YA 5I09A 2WMIA 4E8GA 4IICA 4HJWA 2INFA 3QTGA 3ZYZA 3WELA 1E55A 3GKAA 3QKEA 3V0UA 3CZEA 2I5QA 3TYZA 4DN1A 1JPKA 4GBDA 2GJXA 3TYDA 2H9AB 5FEZA 5KITA 1VKFA 2OSWA 1D7FA 1LOLA 2FPTA 4HMCA 3PZMA 3N17A 3FKRA 2QYGA 5BOFA 3T55A 3AXHA 3AZRA 3HIJA 5DRIA 1HKWA 4O11A 4RX0A 5C2GA 1B3VA 4Q8WA 1XX1A 1X97A 3L4VA 3K13A 2PZ0A 4R53A 4X2PA 4ROPA 2VGFA 2CC0A 2H9AA 1UP3A 2WM1A 4A3YA 2IUZA 3BLOA 4U2ZA 2WJEA 2J4GA 4GBUA 2RDWA 3QN3A 2UY3A 2FHFA 3BLIA 4FOUA 1KCXA 4FI4A 5AHIA 3U48A 1QNSA 3BLEA 5CSUA 2BWGA 4IP4A 3GIQA 1XGEA 3W7JA 4EF9A 3T7VA 1VPQA 1L8NA 1XRTA 3VE9A 2YR1A 1FWBC 5AKQA 4FLOA 4RZ5A 3V3WA 1IZCA 2JKAA 3LTPA 1S2VA 1J5TA 4Z1YA 1MUMA 2WZEA 4HPGA 1VBHA 3H2CA 1DV7A 3JR2A 1ISXA 1DIEA 1T99A 1XHGA 4FA3A 3SADA 3QJAA 5H2ZA 1JDDA 4MKVA 3E6EA 3WK0A 1RCOB 4RXFA