2QMKA

Human pancreatic alpha-amylase complexed with nitrite
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 166
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmkA01
3AIEA 2CHOA 3AICA 2CETA 4PTWA 5A8MA 4IM4A 4H41A 2YFNA 1QI5A 3WNKA 4N42A 1UKTA 2VJXA 1HKIA 4JHOA 3AXXA 1TQWA 3SIMA 3TONA 2V5CA 4PMQA 3ARXA 4IISA 4AZHA 3HN3A 4BQ2A 3U57A 3A23A 1HT6A 4FNPA 4PSPA 1ISXA 4MNLA 4HPGA 2DPEA 1O6IA 1XCWA 1V0MA 4WIWA 1UR0A 4WLCA 2VCBA 3B9DA 1EOKA 4H8VA 1J10A 2UY4A 1PZ2A 1KGWA 2D73A 3CZGA 3VGEA 2WAGA 1CENA 2CBJA 3WQ4A 2OSYA 2ALWA 4Z2GA 5M17A 2PWHA 3N9KA 4GI8A 1UUQA 1E70M 4M24A 2BVYA 3SCRA 4CD6A 3GH5A 3CTTA 3BAJA 5CSYA 1SMAA 2XGIA 1CXIA 3T0DA 3B9EA 1HP5A 5I2UA 1E3XA 1BF2A 1E4IA 4MNJA 3W38A 5BXRA 1OIFA 4J28A 1E6SM 1NOUA 1WZLA 4ACYA 4W85A 1VRXA 5LYRA 3VIKA 2YA2A 4W84A 5DT5A 2WZHA 5CJ5A 4P8XA 1PBGA 1E6QM 4ACZB 1R33A 3HG2A 4OOUA 3SUTA 2E9MA 4P7QA 5E0CA 3MO4A 1NARA 1V6VA 5DMYA 1HWWA 1OSEA 1UZ4A 3A22A 3AIVA 4PMZA 1GNXA 2X1IA 4NZFA 1PX8A 4XZWA 4NI3A 1MQQA 2XVGA 1HL9A 5HDRA 2ZOXA 2O9PA 1B0IA 1RPKA 3VTRA 1OBAA 3MV11 3MSDA 1X6NA 3UERA 1JI2A 2DSZA 1FH7A 1C8YA 3E1F1 3SUVA 1ESWA 4AZ5A 4HMDA 3PZGA 1JDCA 1HN1A 1JFHA 2PWEA 5HPOA 3T08A 5A95A 2ZUNA 2BY3A 4AD1A 5ABFA 5E1QA 1BGGA 4TVCA 1E5JA 2E9LA 1CXFA 3ZT6A 3CZKA 4AYSA 1LF1A 1LG1A 1MYRA 1TG7A 3PZNA 3TOPA 2VX4A 3OG2A 1UH4A 3ZIZA 2G8ZA 1KB3A 3KZSA 1GZJA 5I3DA 2EEXA 4J3SA 4AISA 3S5ZA 4GQQA 1ZJAA 3EMQA 5I0DA 4J3WA 4EAMA 3SCQA 4H8HA 2J77A 2C7FA 1SR0A 1VEOA 2YLLA 3S5YA 1W1PA 4RE3A 1WO2A 4MADA 2YL5A 4KWUA 3VSTA 2XSAA 3W4RA 3K1DA 4PMYA 5LA1A 2W63A 1RD6A 1DWGM 3GNOA 4FMVA 4IPLA 1CPUA 1BFNA 4LGXA 2VO5A 2W92A 2XGBA 1GVYA 1Q4NX 2GJPA 3UCQA 2D3NA 3ZO9A 3RJYA 3OGSA 5A3HA 2NT0A 1VFMA 4MDOA 3KL3A 2DSUA 3CZSA 1HIZA 3VDHA 1J18A 4HPHA 1C3FA 3SCOA 1JYWA 4W5UA 3K4AA 2WBKA 2J7DA 3UG4A 4XZBA 3SCPA 2DH2A 1HVQA 4B9YA 4MTVA 3VU2A 2PBOA 1TCMA 2AMGA 4FNSA 3II1A 1V02A 1VAHA 3TA9A 5CGTA 1W32A 2WVUA 1QPKA 3LRLA 4JAWA 4AD0A 3PZIA 4PMRA 1IZJA 4AXNA 4HA1A 1KQZA 1X1NA 1R86A 5AYIA 3BAIA 1GUVA 4B9ZA 1OD8A 4ZFMA 1OM0A 5GPRA 2BS9A 1CYGA 1TA3A 1E0XA 1N82A 1QHOA 2XJ7A 2WZEA 2JF6A 3RCNA 3EMZA 3I3BA 5IFTA 4D6JA 4W7UA 3VGHA 1Q6FA 3QOMA 4J27A 4X9YA 3BLKA 1HXJA 2V3GA 5CPQA 4A3YA 2E8ZA 4AZCB 4QLJA 4UFKA 1U30A 4GZEA 3A4AA 3HG4A 1PAMA 4QLLA 1GOQA 2VZVA 3W29A 5M5DA 4GQRA 1NWSA 2VNCA 2E0PA 3U7BA 3WY3A 2C8NA 2WVVA 3WL1A 2ZXQA 1UWSA 1UZ1A 3AZTA 3WUEA 1TVPA 2GDVA 1MW1A 4HTYA 3PZUA 3AI0A 4OUEA 1B90A 3J7HA 2YBTA 1B3ZA 2A3HA 1VIWA 1UG6A 3EDJA 1XC6A 3UETA 4RE4A 2WCAA 2EQDA 1K9TA 2XN0A 1KGXA 4NXKA 3WF1A 4AZBA 2GJXB 4KRUA 3N11A 1MW3A 3PZ9A 1H1NA 1QVBA 3S2CA 2Y8VA 1FP8A 4UQDA 4K68A 4CD4A 2OSXA 3HJEA 4BQ3A 1QW8A 3WF3A 3QHMA 4FK9A 4U2ZA 3VIPA 4HA3A 5FIPA 1OT1A 1GCYA 2Z1KA 2W5FA 4J7RA 3VMNA 2JEQA 2RGMA 4PUEA 4BS0A 4H7VA 1UWRA 1EDGA 3VMOA 3WQVA 7TAAA 1B31A 4GXPA 4IPNB 3DX0A 1SZNA 3NUKA 1V3MA 2CKSA 3AMKA 5CPTA 3BUDA 3FHQA 5ABEA 1PJ9A 2WW5A 2YIHA 5DO8A 4CKQA 4GPNA 2F8QA 3T0BA 2EJ1A 3DECA 3ZQ9A 3NIYA 1VBRA 2D0HA 3POHA 2WHKA 3AHVA 1J9YA 1UQZA 5E70A 1XH0A 3M7SA 3GXNA 1QNQA 2VX5A 1A47A 4V2XA 5E09A 1CXHA 5CGMA 1VFFA 2CNCA 2XFRA 3KLLA 3PTKA 4CN1A 1W91A 2GVYA 2VR5A 4AZ7A 2E8YA 1TQUA 3F5KA 2WBGA 5A2BA 1CGYA 1QWNA 1AMYA 2F18A 3ZOAA 3OLEA 1WCGA 4OZOA 3VD4A 1WDSA 3BAYA 1V3HA 1M53A 3LMYA 1NWRA 4MNKA 1V03A 3UR7A 1GJWA 2WWDA 3VD7A 4J3TA 2ZX6A 3L2LA 1CBGA 1E3ZA 1V6XA 3WELA 3POCA 5C71A 2E4TA 3RJXA 3CZNA 5ABGA 4KRTA 3RM8A 5FCZA 2ZUVA 3ARUA 4TUFA 3BCDA 3GTNA 2WHJA 2A3EA 3VX1A 2FHFA 2VZTA 2CHNA 3GXDA 1BG9A 1LQ0A 1O7DC 4E2OA 2WC4A 5BXSA 1DWJM 2VTFA 3L4WA 3K8KA 1NP0A 1OD0A 4WKHA 3RIKA 1R47A 2CBVA 4Q22A 5DFAA 1UR2A 1CWYA 3LPPA 2WWCA 3QHNA 2EPMX 2WPGA 3VIJA 1AQ0A 1QNPA 3WY4A 4W5ZA 1HX0A 4CU8A 1V6WA 1BVZA 3BLPX 1E5NA 1G94A 3I3DA 1PIGA 1W3LA 2BHUA 5LA2A 4DM1A 3WEOA 3BGAA 2X2YA 1UKQA 3AQUA 4WK9A 2CBIA 3EJRA 4C7GA 3VM7A 3NDZA 1O7AA 3O2LA 3CC1A 3ZJKA 3ARQA 5DT7A 4MAVA 5CXPA 4F9JA 3T2OA 2AOSA 1Q6CA 1TMQA 4HOZA 4YPJA 3WUBA 1I1WA 5I5RA 4UQ9A 2MANA 3WEZA 4EE9A 1UKPA 4TTUA 4M81A 5D9PA 3KWXA 1BSIA 9CGTA 8A3HA 2VCCA 3VUPA 1A3HA 4AD3A 1HJQA 3ZT7A 5E6YA 2PC8A 1FH9A 1EHNA 1ZB5A 1OGSA 1HF6A 2YFOA 1GQKA 2BVTA 4GO9A 4P8VA 3FN9A 2DSKA 1KCLA 3DHPA 1DHKA 2YDQA 4XX6A 2XWEA 3MS8A 1L0PA 5FL0A 2WK2A 2FGLA 3WDIA 3AJ7A 1UD5A 1UKOA 2WXDM 3CUFA 5ABFB 4AEEA 1C7SA 3MUY1 1QBBA 3H53A 4AMWA 3HZ3A 1XSKA 2EBNA 2V3DA 1WZAA 4HOXA 1KXQA 3IGUA 4BA0A 1NOFA 1B3VA 1H4PA 2WB5A 3THDA 3WUFA 2J47A 3AIQA 1R85A 1CECA 2JFEX 2YA1A 3WQ8A 3AZRA 2AAAA 2XFYA 1CGVA 1NWTA 2OWWA 1E43A 4UFMA 3WH8A 2EACA 2Y24A 3D50A 3L4UA 2DT3A 3W6MA 1EHAA 5CG0A 1JZ7A 2O9OA 1PZ3A 2NW0A 2VZOA 2G3NA 2EO7A 5M03A 4TOQA 3MUIA 4XUYA 3WF4A 3SCTA 4DO6A 1W1VA 1H2JA 1J01A 3HU7A 4NRRA 4UR9A 2WZIA 3DX1A 4CU6A 4TX8A 2XVNA 1CGWA 4PRWA 3W81A 4NRSA 3OZPA 3BUIA 4PMUA 1JYNA 1V6YA 1UR4A 1JZ8A 4D1IA 2XSBA 4AZGA 4OIFA 4EANA 1LWJA 1CGTA 5ECUA 1W1TA 3PHAA 4B3LA 2WMKA 3NJ3A 3OGVA 1MFUA 2WMHA 2XUCA 3GXTA 1JGIA 1XH2A 2VT0A 3A47A 4JL1A 2E9BA 3PTMA 5HNNA 2QMJA 3GYCA 4U5IA 3CHCA 3U7VA 3D52A 4YHEA 4E8CA 1QI2A 6TAAA 5C70A 1TA3B 5IDIA 4ZENA 3VIFA 3WQ6A 1SFSA 1OINA 4FF5A 4AD2A 4WSJA 5HBFA 1WB0A 2OLHA 4URIA 1R87A 4UOQA 3A6OA 2YDSA 3TTOA 4NZCA 4CCCA 1QW9A 3MKKA 3VPLA 1OWQA 1M04A 1KXTA 1H41A 5JBFA 4GZJA 5D8ZA 2UWFA 3IAPA 2WVVB 4MB5A 1KTBA 4RE2A 3VM5A 2FDMA 4E8DA 1CXLA 5FOOA 1JXJA 3M46A 1B9ZA 1IZKA 4FLRA 4F66A 3BAXA 5CZKA 1QNSA 3M6DA 1KFWA 2WCSA 3PZMA 4GINA 3T0AA 2YA0A 3UG5A 1HJVA 2J8GA 2BHYA 2B31A 4XB3A 3TV8A 4PMXA 4MB1A 1ZBKA 2OW7A 1VFOA 1ODZA 4PTXA 2YL6A 4MPKA 3BUPA 2QV4A 3BMVA 3NDYA 2QPSA 4AZIA 3ALFA 3GNRA 3WD4A 4E4PA 3WFZA 4HA4A 3CBWA 2JALA 1EXPA 1EOMA 2VUYA 1E4LA 3BMWA 3WUGA 1Q6GA 3GXPA 3DC0A 1MFVA 1LJYA 3BVUA 3PBGA 1T0OA 3GM8A 3T09A 3OLIA 4BQ5A 2X2HA 1WPCA 3VOCA 1HJSA 4U5KA 2WHMA 2ZUTA 1BQCA 3AHZA 1PS3A 4H04A 1V0LA 1QX1A 4MB4A 1W3KA 1JNDA 1VENA 2DIJA 4PMOA 3AS0A 3D51A 3ARYA 3VMPA 1CLVA 4DO5A 4LYRA 4YN5A 3W37A 3N04A 3T2PA 3WEMA 4ZE4A 5CQ1A 1DEDA 4D6DA 3W25A 6A3HA 2GK1A 2W61A 5A6MA 2O9TA 2DEPA 3DX3A 3ZJ7A 4OKDA 4KGLA 4L4OA 1HTYA 1ZBWA 4CD7A 6CGTA 3BAWA 5AYBA 3WMBA 1ISZA 3OIHA 3TTYA 1J0HA 2PBGA 2FYVA 4KH2A 3VD5A 4Z2LA 3UR8A 1WNOA 1VF8A 1YHTA 1RP9A 2NSXA 3B9AA 2EPNA 4P7OA 4AC1X 2XWDA 2VQUA 3D5HA 3CV5A 3BH4A 4MDPA 5A69A 2DDXA 5D4YA 3LPGA 1WE5A 4P8UA 1E71M 1BGAA 1GORA 3VNYA 2D2OA 2PWDA 1V3JA 4TVUA 5A8PA 1OIMA 4ZXLA 4AWEA 2OWCA 5KEZA 2A3BA 2J62A 3MMUA 5CLWA 3VIHA 3VIIA 3I3EA 3DYOA 1US3A 2CBUA 2E3ZA 3A21A 1H0IA 5E6ZA 5FL1A 2J75A 2V3EA 5BWFA 4N0RA 1W2PA 3AISA 1V3IA 4P7NA 1PIFA 3FY1A 3EDFA 4QAWA 1IT0A 2RGLA 5C8BB 2VOTA 1E0WA 1KR0A 2GFTA 2J78A 3A5VA 8CGTA 4J3UA 1BHGA 4S3JA 1CLXA 3B8SA 1WZMA 4D71A 3RM4A 5AC5A 1UKSA 3FAXA 1E73M 3G6MA 3W53A 4HU0A 3F5LA 1KXHA 2J7CA 3OB8A 1WAWA 1K9FA 1MQRA 2J7GA 2Y4SA 4C7DA 4W88A 3T2QA 4UQAA 1ITCA 3AIBA 3WDPP 2XYLA 3WH6A 1GJUA 3F5JA 3CO4A 1JAEA 3WY2A 5HPCA 2GSJA 4PYSA 1JZ4A 4WKFA 1JZ2A 3FNDA 3WDQA 3LX9A 3SUUA 5A6KA 4W87A 1D7FA 4WF7A 3WSUA 2FGZA 1E1EA 2PI6A 2XVKA 2YOCA 1FA2A 3BUBA 3MI6A 3AYRA 3CUIA 3CUGA 2QPUA 3SEPA 3OGRA 3BVTA 3TTQA 4ACZA 1UD3A 2BY0A 1KCKA 2X09A 3QOKA 4UFHA 5D9MA 3W24A 4JIEA 2ZXDA 1EDTA 3VDCA 1TR1A 3AMCA 4KMQA 3FW6A 2JEPA 3U5YA 2F7QA 1WDPA 4JKLA 3PZOA 2WLZA 1B3XA 1OGGA 3VVGA 1TE1A 3WD3A 3BXWA 3AIWA 1GQIA 2ZX8A 3SUWA 1VEPA 2ZWZA 3W28A 1XRVA 4D1JA 2DGAA 2Y2WA 1RH9A 3LPOA 3PTQA 5E9AA 1W9VA 1XHGA 2BY1A 1J12A 3AIRA 4U2YA 3ZT5A 4GI9A 2A3AA 1W9UA 1E6RA 3BUQA 4HZ7A 1FH8A 5E0FA 2IXUA 2W66A 3MUZ1 3L4ZA 3U5UA 3UESA 5DEZA 1V0KA 1H09A 4QCFA 4YHGA 1JFXA 3WBAA 4DM2A 4AIUA 1JDDA 2FH8A 3CZLA 1MXDA 1MQPA 2BFGA 3QGVA 4EK7A 3VIGA 1AQHA 2WC7A 1H0GA 1JG9A 2TAAA 4AY1A 1QI3A 4JKKA 1OGBA 3DHUA 4ATDA 4UCFA 4TXEA 2JE8A 1L8NA 2YL9A 1DWAM 4PMNA 4TX6A 4M56A 3VIOA 4W8BA 1KTCA 1J0IA 3A24A 3KE0A 2CPUA 1J11A 1B1YA 1XD1A 3KL5A 3WH9A 1AVAA 1WZKA 3GBEA 4UTFA 1C93A 1GVIA 3GNPA 3QR3A 3WBEA 1QNRA 2VURA 4PCTA 4MJ2A 5CLTA 3WD2A 3EMCA 2ZX7A 3VSVA 4MJ4A 1V0NA 1E1FA 4W7VA 3S6TA 1Z32X 2WKGA 3WNPA 3BAKA 3CLWA 1KBKA 1RP8A 3RO8A 4PSRA 4CUCA 1UH3A 4FNUA 1HJUA 2WNWA 2X8RA 1VJSA 3LXBA 2PWGA 4ZEPA 3H54A 3H55A 1CXKA 2BVDA 4P7LA 4PUDA 1JD7A 1NOWA 5A6JA 1F4HA 4D6FA 1LWHA 1JZ6A 2ZUSA 4UQBA 1KQYA 3CH9A 4PMDA 3THCA 2D1ZA 3CIVA 1GONA 4MNMA 5ABHA 2WLYA 2XHYA 2WANA 4R5EA 3ZJ8A 2FE0A 4LQ1A 2BXYA 1XYZA 1BYBA 2ESCA 5DF0A 2O9RA 4BF7A 2X0HA 1E6XM 4UFLA 4UOJA 4KGJA 4Z2JA 2J8FA 2V5DA 4JFSA 3QHOA 3ZSSA 1E72M 4C7FA 3MMDA 1J0YA 1M03A 3AHXA 1GOMA 5A6BA 1TQVA 3GXMA 2IXVA 2FHBA 5BYWA 5A2CA 1WKYA 3OLGA 1HVXA 1C90A 1QNOA 4RL3A 1W3JA 5CPSA 1C91A 3ZR5A 2WMIA 2CIPA 4LYQA 4UFJA 3K8LA 5EFDA 4H8UA 1YQ2A 3AMGA 3ARWA 5D8WA 1W9DM 3CUJA 3GH7A 1V08A 4ZE5A 1B30A 1GOOA 3EDKA 1E40A 4BQ4A 4EKJA 3VINA 4U3CA 4LX4A 2J25A 1R46A 1KXVA 3EBVA 5HXMA 1U33A 3GDBA 3VGFA 1E55A 4PMVA 3KEHA 1HKMA 4WKAA 4FLSA 1GOIA 4PCSA 2C0HA 2Y8KA 3WFLA 2OYLA 1PX4A 3EJQA 3OBAA 4W8AA 4V27A 1Y7VA 3KL0A 4D6CA 1US2A 2QMKA 3OZOA 1EA9C 3NSNA 3CZ8A 1P6WA 1S46A 3CMJA 5A6AA 2F7OA 4DUVA 1DWFM 2WM0A 1UQYA 1PEZA 2FHCA 4U33A 3UEQA 5GNXA 3CZEA 5HOSA 3K46A 2X2JA 1HP4A 4BZYA 2GK1B 1G0CA 2D24A 3AS2A 4MB3A 4TVDA 1GQJA 2O92A 2YBUA 3K8MA 5GNZA 3W27A 2IGTA 4OBRA 4HZ6A 3VKKA 3L4XA 3RMEA 3NCOA 1XYFA 4OJYA 5EBAA 1UA7A 2XN1A 2CESA 1TQTA 5A8OA 2Z1SA 3WDJA 2OSWA 1W9XA 3NSXA 1NWUA 4D6HA 2XVPA 1C92A 4HOWA 3VSUA 1QHPA 1MW0A 4Z2HA 2D0GA 1EIBA 3MMWA 4Z2KA 2ZUMA 1XD0A 4NF7A 3F4VA 2X0YA 2ZX9A 3IJ9A 1H11A 5BXPA 1E0VA 4JHZA 1BG4A 4M29A 1BAGA 3AS3A 1G01A 4GO8A 1MWOA 2XPKA 3AROA 5D9NA 3WMSA 1ZJBA 2ZXAA 2G3IA 1TFVA 3DYMA 4CN4A 1CTNA 2OYMA 2F61A 3RM9A 1UR9A 4BCEA 1HKJA 1R75A 1G1YA 4U31A 4CU7A 1EH9A 1ISYA 1R8LA 1V3KA 1BPLB 3WQWA 1G5AA 2EXOA 3D4YA 5EFFA 4F8XA 4UZUA 4W8LA 2GJRA 2VRKA 1R7OA 3ARTA 3VGGA 3AMLA 1QI0A 4PBGA 2ZICA 4P7RA 1QI4A 2BXZA 5FKYA 1UASA 1EDQA 1FHDA 5A6LA 3VGBA 3EJTA 3OA5A 5FD0A 2IUZA 3ARPA 2J7EA 3VD3A 3W0KA 2BY2A 1CZ1A 1VJZA 1E6ZA 5I23A 3WL0A 3LRMA 4FNRA 2UY3A 1ITXA 4HU8A 1E6PA 1UWTA 2G4FA 1WP6A 5BRQA 3VX0A 3CHDA 4DWSA 4UOZA 2WMFA 2WCGA 4B3KA 3ZR6A 3GH4A 1CXEA 4M82A 5A2AA 3EJSA 1Q6DA 1LL6A 2CEQA 1E4NA 1E56A 2FH6A 4UQCA 2W62A 4Z2IA 4JL2A 2PB1A 4UNIA 2G3JA 2ZIDA 2J4GA 5A94A 4CD5A 3L4YA 1XSJA 1KR1A 3HG5A 1LLOA 3NYDA 3ALGA 5I77A 2ZUUA 3L4TA 2YLAA 1UHVA 3SCVA 1W3HA 3BSHA 4CCEA 2EPOA 1VFUA 3IJ8A 2F1BA 3VNZA 3WNNA 3AHYA 5KZ6A 4W86A 4AW7A 1BVNP 1QHZA 3ARSA 4HZ8A 1JL8A 3D3AA 2CCRA 1Q6EA 1UD6A 2BHZA 3AOFA 3LXCA 4UQEA 3W6LA 3IJ7A 4PN2A 4M8UA 3WY1A 1NP2A 2WSPA 1LG2A 3MV01 1C8XA 1OCQA 1JNEA 2XM2A 3MUAA 1W2VA 5JUVA 1GQLA 1VEMA 1R34A 1JIBA 1JD9A 2ZX5A 2VCAA 3DX2A 4V28A 2GUYA 4QFUA 3TP4A 4WSKA 4FNTA 4UFIA 3N1AA 2VX7A 5A6BD 1MXGA 3AFBA 1VB9A 3KLKA 1SMDA 2VZSA 2G41A 1KWKA 4F9DA 1FFQA 3WF0A 4PEEA 4ATLA 3WIJA 1SYTA 1CIUA 3N15A 2V3FA 3GXIA 2D22A 5AY7A 3BVVA 4NXSA 3AIUA 1ZL1A 1LL7A 5A8QA 3WN6A 2J7FA 5JBDA 4Q7NA 2UY2A 1H49A 2EABA 3WNLA 3CHFA 1X6LA 4NZJA 2CITA 2DT2A 1WDRA 2PWFA 3BCFA 4D6IA 4MAZA 4LYPA 3CUHA 2X2IA 1JZ5A 5IHRA 4ML4A 4WJXA 2W4XA 4HMCA 3DDFA 1MVYA 1V6UA 4JZ5A 3EDEA 1JF6A 2EPKX 3EYPA 3SCNA 1ODUA 1C8QA 1UWIA 3FAWA 4M80A 1R7AA 3WD1A 4FLOA 1GPFA 4D6GA 1F4AA 5I79A 4HMEA 1BLIA 3CMGA 1JZ3A 4JFVA 3FHAA 1D3CA 1DWIM 2D0FA 4U3AA 3NSMA 3IK2A 4W89A 1TQSA 3K4DA 1JDAA 1B3WA 3PN8A 2DT1A 2JIWA 2EAEA 4P8WA 1K9DA 2WVSA 2J7HA 3DX4A 2E40A 2X05A 1EQCA 4XV0A 1IV8A 2DSWA 4QP0A 3WMCA 1LL4A 1NH6A 3MSGA 3CGTA 4QLKA 1CGUA 2QLYA 2XVLA 1M01A 2A3CA 2Y5EA 1EGZA 3IANA 3N13A 3ZJ6A 4JCMA 2DSVA 4IUGA 2DT0A 2CXGA 1NM9A 5TD4A 5I24A 1OT2A 5BXTA 3A3HA 2EADA 1HJXA 1UWQA 2WMIB 3WH7A 1PPIA 4X0VA 1FFRA 1K6AA 3ZM8A 1EO5A 4FLQA 1W1YA 1WDQA 1XGZA 2XIBA 3LXAA 3MANA 2F7RA 2QF8A 4AD5A 3AS1A 3D4ZA 4W7WA 1FOBA 3VIMA 3WH5A 5JIPA 2WMGA 3N12A 3EDDA 2VVSA 1UR1A 1UOKA 2YL8A 4DUWA 4JFWA 1XV8A 2HVMA 1UD8A 3WF2A 4HP5A 3SCSA 1E15A 2XM1A 3BSGA 2VR4A 5IFPA 2QHAA 2DQXA 3VDAA 4CGTA 4OGZA 2VRJA 5I78A 4H2CA 2VX6A 4QDMA 2W91A 2BNJA 1B2YA 1B3YA 2VC9A 2WSKA 2YDRA 3WQ5A 1UR8A 4DWSD 4M1RA 1TVNA 2V38A 1UA3A 2OWXA 2VQTA 3LPFA 5D9OA 2YKKA 1FHLA 3L2MA 1H3GA 4A3HA 4X0NA 4AMXA 3SCUA 1ZS2A 3CZJA 1D2KA 2DIEA 1HXKA 2OW6A 3O9NA 2WVTA 1CEOA 1EQPA 5BRPA 2W67A 1U2YA 3W26A 1BYAA 4JFTA 3PZQA 4TTGA 1GHRA 2GDUA 2G3MA 2WC3A 2XG9A 3GZAA 4AMCA 3A4WA 1I1XA 3VILA 3SUSA 3AXHA 2VRQA 4LXFA 2CKRA 1XSIA 3ARVA 3RPMA 1E9LA 5A6SA 2PF0A 1V3LA 5IXEA 2VL4A 3VO0A 5I6SA 1HNYA 4S3KA 5F7UA 4LPCA 3HMCA 5AC4A 4PTMA 1CDGA 4CVWA 4L4PA 3UG3A 1UWUA 4CVUA 1UH2A 1ZU8A 3SCWA 1E4MM 1G9HA 1GOWA 5JIWA 1TZ7A 2F2HA 2XIIA 2HISA 5BROA 3VDBA 1M7XA 4AYGA 1JXKA 1VBUA 1J0KA 1V02E 1JYXA 3LRKA 3AYSA 2F7PA 1J0ZA 4GZIA 4AD4A 1XCXA 1HL8A 1W9BM 1XH1A 1GOKA 5A1AA 3OLDA 3BLBA 3SURA 3MU7A 1ZBCA 1UD2A 4A4AA 5GNYA 2F1AA 1CNVA 1TUXA 3W82A 1E6NA 1UD4A 5BCAA 2VZUA 4GI6A 4AZCA 4DWSB 4F79A 4J3XA 4NSBA 2OYKA 2WHLA 3ARRA 3VD9A 2ZE0A 4Y7EA 4UZSA 5A8NA 2VVNA 2XTKA 1I75A 3AXIA 3AHTA 2EPLX 4B16A 3PZTA 1K9EA 3N18A 4GKLA 1HJWA 4R27A 3ARZA 4D6EA 3TTSA 3PZVA 1JAKA 2Q8XA 1BYDA 3O6AA 1FP9A 3WD0A 2ZXBA 3EJPA 1ECEA 3N17A 3WDRA 2ZWYA 3CPUA 2GJXA 5JBEA 3DYPA 4AIEA 7CGTA 3WENA 1ISVA 3AMDA 3RILA 4CD8A 4FNQA 4NX0A 4AEFA 4J3VA 1GHSA 4OOZA 3WDHA 1AQMA 4QCEA 1GW1A 3L4VA 4ZXOA 2D23A 4DUXA 2UY5A 1HKKA 1BYCA 7A3HA 3AZSA 3VGDA 1DWHM 4JFUA 4JKMA 1J0JA 3WNOA 4GIAA 1CGXA 3FXYA 3RDKA 2WYSA 3JUGA 3WNMA 3IAQA 2BV9A 2J79A 3GBDA 4PTVA 1JF5A 4DWSC 1MW2A 2D20A 4CCDA 2JIEA 1JYVA 3ECQA 1DP0A 4B15A 1H5VA 2XFFA 2WKLA 1UYQA 4OBSA 2VI0A 5EB8A 3BC9A 5CSUA 2YJQA 5LA0A 3APGA 2DH3A 1NQ6A 3A4XA 2CERA 3CHEA 4DO4A 3BVWA 4W93A 3BVXA 2WMJA 2ZUWA 5M3WA 3WKZA 3EJUA 3GXFA 5GQBA 2NT1A 1W9PA 5IHSA 1ISWA 1QOXA 3HG3A 3DDGA 1C7TA 5EMYA 1QBAA 2XN2A 2VMFA 1DTUA 4JCLA 1JI1A 2CYGA 4CN6A 4AZ6A 1OB0A 1KGUA 1ZBVA 1QWUA 4D72A 1KWGA 2D3LA 1PX3A 1KBBA 3M07A 3ZSTA 1EO7A 2J7BA 3ZMRA 3G6LA 2J74A 4ATWA 1BTCA 2JF7A 4AIOA
chains in the Genus database with same CATH superfamily
5A8MA 1OEPA 3CU7A 2Z31C 4G7FA 4H8WL 3PE9A 2Z0UA 2V5CA 5TH2A 1HOCA 3SQSA 3LLFA 2AJVL 4KJPC 3VFNA 1JTTA 5C0GA 3NBNA 1ALDA 4H6RA 4LOUC 1BGXL 4XVTL 1QPOA 2VCOA 3BAJA 4BUQA 5HDBB 5I5IA 3QAQA 5C9UA 3WHXA 3P9LB 4ODWA 3O2WH 3DOSB 3S2MA 2GPZA 2XWCA 3UJTL 4GVIA 3X17A 5AHMA 3U36A 5D2LB 5G4WA 4YBLC 2A5UA 2P8PB 1UACH 4OOUA 4JQVA 3E0FA 2VKWA 1IT9H 3RI5F 3A4JA 1R3TA 4WI8A 1SHSA 1SSGA 4EQ2A 4LKCA 3SUVA 3ES8A 3HQ1A 2QFPA 1I53A 1LF1A 5K9CA 4PHXA 4OZHB 4GQQA 1ZJAA 3OR6B 5D37A 1QT1A 2NSMA 4XBGA 2R15A 1NTHA 2WBXA 3RYSA 4JEQA 1FAKT 4KS0A 1V7NL 5HJYA 1QXLA 4IPLA 4OCWL 3DCPA 2V2WA 2AHIA 4PGDA 4R83A 4MDOA 5JHLA 1QQDB 4UYQA 1JWSB 2VMDA 4Y9CA 4X6FA 2YBRA 4J5VA 2XKSA 3VXRB 5H2BA 4PULA 3HUJA 4D8OA 4WW2F 1XJBA 4BINA 2P5ED 1AZBA 2QQKL 1R86A 1TVHB 5GPRA 2AJXL 4GABA 3ZZLA 1AY1H 2F8VA 2HNHA 1LCOA 2E3VA 1XLDA 4FFZA 1WOBA 4X9YA 1JN6B 4J9JA 1KSRA 2V3GA 2ZZ5A 4GQGA 4A3YA 5HWMA 4QLJA 1NAKL 1T99A 3ZVHB 4AUBA 2VNCA 4LRNL 3GDLA 4C56D 4RETB 4Y16A 2JV6A 3P60A 1UZ1A 1TOXA 3ERPA 3GSVB 5IJCC 3J7HA 4QTHB 1RLDA 3EOBA 4TU1A 2IANA 2OI9C 5DZNA 1JHKL 1M71B 1AZUA 5KBNC 4NXKA 3IDYC 2PDCA 4A2LA 1IZCA 4QAMB 5DYOB 3MYJB 2EXYC 1WT5A 4IG2A 1B2WL 4WENB 7FABL 4WGXA 5JXQA 2OMNA 2FSEB 4GAGL 2RGMA 4BS0A 3UPBA 3KRUA 2FBOJ 2PPEA 4ROPA 1YN7A 1V3MA 5CPTA 3FHQA 1H7XA 2CKBH 3C9NA 4HCLA 3EOAB 3O9WD 2EJ1A 1U9KA 1E5ZA 1EMTH 3M7SA 3HKFA 3QDGE 3HTLX 3K74B 4Y4HD 1TPWA 5FYLL 2VEPA 5GGRB 3OXSA 1VESA 5FA5A 2PGFA 5C0CB 1OTSC 4Y89A 3PUOA 2DUAA 3HC0B 3QIUD 5FYLE 1H7NA 5DN1A 1AMYA 1YJDL 2VMJA 4CNPA 4LSRH 4A05A 3T7VA 2ESVD 3PWNA 4OZOA 2ZZ3A 3LMYA 1R9ZA 2VLRB 4E5XB 2ZX6A 1QJWA 1H6UA 3B3DA 2E4TA 4E0CA 1DZ0A 4ZSTA 3VNDA 2VZTA 4IQDA 4M6ML 2V68A 5AUMA 3QEQA 4F9LA 4PJXF 1DJIA 2ENPA 1T5WB 3VH8B 3RQ3A 4RFNB 4H7CA 4NZ8A 4HPXA 1R47A 4OGYH 3PIQB 4B5XA 1N64L 1PFOA 4MFDA 5RUBA 1XTMA 3VVVA 2WO2B 2IOMA 5DZOA 4X0KA 5K9DA 4AM0B 1IEHA 3I3DA 5LA2A 5E03A 2O5YH 5D71H 1MJUH 1N0XL 3L5WA 5AKRA 5C2UB 5HVWA 4KK9D 4ODVH 1AK5A 1N7KA 3ARBB 5AAPA 1EC8A 4F9JA 4A3RA 1AGCA 4J3OF 3UMNA 2H8XA 2NQ3A 2DJSA 2Y7QA 4B5VA 3BK0A 4GKSA 9PCYA 4JLRA 1OGAB 2O6FA 3W83A 1CFTB 1WYIA 2VCCA 4K73A 4DJFC 1FCCA 2AGJH 5INCA 1H6EA 2KQMA 4AVOA 4Z3IA 2C7UB 4KKLC 4UNUA 1NCCL 2NSQA 4YXKH 5I71B 4V1DD 1Q9WA 2TRYA 4F2EA 5ABFB 3ZRFC 4IMCA 5EG6C 1C7SA 3TT1L 3N2TA 4AMWA 1ACZA 2AABH 3ZDXE 4ZJ9A 1U91A 5EO0B 1XVSA 4MXVF 2FDSA 5FCSH 4N4YB 3ZKMC 1P6BA 5CSSA 4O51B 3WH8A 3L4UA 1SF5A 2IGFL 1TCRA 4A39A 5ALCH 2V9RA 4BZ2L 4N0CC 3N1GC 4NJKA 4B90A 2DQ6A 3D39A 1YW1A 2X1RA 4CU6A 4TX8A 1ND0B 4FTVE 3OZPA 2GW5A 4AVJA 2UXGA 4N0FA 4JZOA 1K5NA 4D1IA 4B4HA 2ZYIA 4MCNA 1PKLA 3TJHD 3E6EA 4FZ8H 1E9QA 3U30C 5HYJA 3GXTA 1MCHA 4LPUA 3QQNA 1RK7A 1ZTVA 2YAMA 3EW3B 2QMJA 4ETQB 5JHMA 3CHCA 2PP1A 4GC4A 1L6SA 5FEWA 3OKKA 4ZENA 1XLAA 2QTEA 2ATPB 2OQJA 2FT6A 2K78A 4Y7OC 1II4E 3MKCA 1GJIA 4A6YL 1EGJA 3PNWA 3UIYA 3EH4B 1BYNA 5CSBA 5ECGA 1HILB 3SN4A 4NNYB 2WVVB 4GI4A 2VITA 1A4JB 3D3FA 3LRSB 3EOUA 1EUUA 2GY5A 3O0FA 2FL5A 2WUCH 4NP7A 1O0VA 2BHYA 4F2BA 1QFWL 5CZ0A 5IVXA 2R1MA 3UTZB 3W0WB 4MVBC 1G7MB 1E4XL 1QSFB 3HZYA 4NNXA 1E4LA 5C0IA 1Q6GA 3GXPA 3S0CA 2HUHA 3SDOA 1YNKH 3OZ9L 4W9EC 4L8CA 5AZUA 3LD8C 3D51A 5JPNB 1MFDH 2AEPL 3LN9A 3LZQA 4BWUA 4NNCA 5F7DA 1Z0NA 1C5CL 3FOKA 1U6AH 2N01B 4Z0XA 2W61A 2VLKB 3BFWA 1QWKA 3EUDA 4YEEA 4HCRL 2HE5A 3BKMH 1TJGL 2IDQA 2E27H 3O4OB 1ISZA 2CO3A 4GYPC 2VRAA 3E8UL 4AQ1B 4NN5C 3MBEA 5I73B 3FQUB 3PFMA 1JBJA 4RGNE 2F6XA 3EZ4A 4WO4B 4AG4L 4ZXLA 1XGPA 5ELIA 4DP4X 4LNRA 5E51A 3VIIA 3LHVA 3H42L 4MXQC 3KVPA 2VXQH 4ZODA 1IGCL 2AANA 2H6UA 2ARJA 2NX5E 1I9JH 3IIVA 4HU4A 2XZ7A 2DV0A 3V6ZB 5C0RL 2HT3C 1UKSA 4FNLL 1DXIA 4UTTA 5DUMH 5DD3H 3WS6C 5EIIB 4N5ED 4C6FA 4M6PA 4G82A 3UTPE 2AK4E 1G84A 3ZLFA 2DM2A 5I1EL 3ARDC 3RY6A 3GLAA 3WDQA 4BI6A 1TITA 4IKKA 4L4TB 4GJTB 3G08A 4LT9A 5TK2A 3QG7L 4QGCA 5HGBA 3OJVC 1TWZA 2NVCA 3IETA 1Q13A 3FSOA 4UFHA 2F84A 3JZUA 5E1AB 3GO1H 3U5YA 1AFVH 4K8RH 5GRXG 4L8SA 4Y1AB 2R0LL 5IV2A 4I9XA 3NQEA 1GQIA 4F4RA 3L8QA 2DGAA 4IBYA 1A6VH 2JCCE 5JLZA 4MRBA 3EO1A 1XHGA 3OF6A 2E6JA 1P7TB 1UGNA 3L7EA 1QFHA 1J9SA 3HS8A 3OZYA 3VFTA 5HDBF 3DG3A 1Y8BA 3V7PA 3X12B 1MCDA 1AMKA 1ORSB 1WITA 3VRJB 1RZFH 1GEQA 1PSCA 3PCYA 5C3TA 5D2LF 4NZTL 3KHDA 5FEPA 4DP2X 3M0VA 2EYRB 5HJ3B 4TRPL 1DSYA 1AHMA 4INFA 2R94A 3MBXL 4Z3TA 1PJWA 4QO1A 4IXHA 3N6QA 3KYAA 1VHCA 4PRRA 1GHFL 5EF3A 2IAMA 3V4VB 1NCWL 2GFBA 3R0NA 2X8RA 2Y1HA 3FN0L 4H9MA 1HWHB 2VLJD 2DRUA 4PUDA 2BVDA 1JD7A 4TQPA 3REQA 3QPEA 3GINA 4JXCA 4OZHF 1JZ6A 5MENE 2CE6A 1MFNA 4X9FA 4AVIA 3GSQA 2QUUA 4KXBA 1RUQH 2VDGA 1BYBA 4Z2JA 5CJBA 5BS0E 2WSDA 4AITA 3TZVB 1P4BH 2XN9D 1W3JA 2NWRA 5BJTB 1XQKA 1FWBC 4N26A 3PPFA 1GOOA 3KS6A 3GJFK 2BSTB 4O53A 3HKZA 2IWGA 3T4AB 5FUZH 4G80B 1MRDL 3DGBA 2J25A 5HXMA 4QYOB 3SSJA 4PCSA 1R3LB 2Y8KA 1EAQA 1PSKH 3UBXA 1T6WA 3CSTA 4XVSL 4FQQA 2F7OA 1ZV5A 2J9XA 2Z65C 3WFDL 4HNTA 3O4LE 3KW7A 4HK7A 1OD9A 1HP4A 3QQDB 3IPFA 2D24A 1BMGA 1J5OL 5H6HA 3DK2A 2IGTA 4CSPA 3S8WA 4N90D 1YEEH 4OJYA 3ZY7A 5TDOA 5JXAL 5A8OA 3IDUA 4YWGH 4WGKA 4JANA 3K5SA 4Q6IC 4LCCA 4QIUA 4HBCL 3CV7A 1MW0A 1J88A 1DN0A 2VFGA 2FZ3A 1NIUA 3MMWA 5GZNC 1AGFB 2H8PB 3N85H 1DFXA 4P5SA 1AKJA 5C08A 4JHZA 4P46A 2W38A 2RGSA 2XTSA 2X30A 3U2EA 5DJAA 3OJGA 4RA0C 2F2KA 3SE8L 1PKOA 5JW5B 2OMTB 3BT0A 3UTQA 1PFCA 3KZ8A 3EB3A 4NEHB 2D2GA 3APYA 3DERA 3TBYA 3AMLA 1LQBC 1A5FH 4KF1A 4UTHA 2ZUQB 5DRIA 2YPLE 3VGBA 5DK0B 4OZIE 3OXRA 1FLTX 2A7BA 2P0IA 3LCFA 4PN6A 2XG4A 2KUTA 2R1NA 4WZ9A 1MCOL 2BK8A 3RZCD 3FSWA 2B0MA 5TIMA 2I7OA 2AGTA 1HL5A 3L9RA 3KHQA 1R9FA 3F7QA 3FVMA 3SE4C 3TN0C 2W62A 4JL2A 4Z6AT 4XC1L 5D9SA 2J4GA 2QZQA 5D1XE 1L6XA 3C6LD 1CC3A 4QYAA 4BFNA 4AMAA 3NYDA 4P06A 3PJSB 5L8KB 5J8OA 3SCVA 4WIQA 5D1QB 1R3HB 3RIAK 1O5KA 4I0CC 4PZVA 5KZ6A 1JCJA 3HGOA 1QHZA 4QWWD 32C2A 1MJJB 3RB5A 3P80A 1RUSA 2W65A 1L3NA 2IC2A 3N9GH 3DJRA 2FJSA 3CQJA 1KCUH 2PCFB 4GRLB 4L4JA 3TO4B 3SQOH 3NOIA 4HALA 4I3RH 4QITA 1JD9A 2B4CH 2ZX5A 4EDXB 2VCAA 6TIMA 4NN7B 2NQZA 5EMLA 4AAJA 1TCDA 2VX7A 2C9QA 1NKRA 5F7BA 1TWIA 3GR8A 2P5EE 5TE6H 2VUKA 3WF0A 1MZYA 1CIUA 3KBVA 4P3WA 3M41A 1AG1O 4ZUUB 4JG1L 4BFBD 1L0QA 2B8OT 2ICEB 1PZCA 3I7SA 1RMFL 5CNHA 1S7TA 3T0XA 3GMLB 3P11H 4POZD 3A4FA 4FG2A 2GTWB 1JZ5A 5HHMD 1XR2A 2HUEA 4PGJA 1XWVA 3SCNA 4HGKC 1UZ6F 1ZVYA 1HO4A 1MEXL 4P48A 2FVKA 4GP5B 5GS1A 3MOBH 3HBGA 3QIBA 4Q8NA 5FYJE 2P1YA 4A6YB 4ZQPA 3XIMA 5E8EA 3VXTB 4P8WA 1BCIA 4PRIE 3K2KA 2BP8B 2J20A 4LU5L 3QGKC 5JIDA 3WX7A 1NCOA 4P61A 1P7QB 4YE4L 3WMCA 3MLVH 1D2OA 2EDDA 3XISA 1WV7T 2QLYA 1UGKA 4IBWA 1MRCH 1XIWB 4B5TA 2DSVA 2CXGA 3PL6B 2XDFA 4NSKA 4G8GA 1L6YA 4GIOA 5EEZA 1PKQA 4NKCA 2WXHA 3KAOA 4LVHC 1T0MB 4AD5A 3VIMA 4UR7A 2Y1ZA 4BI7A 1RZKH 3KOYA 3QEUA 1Q85A 2A6IA 1JPFB 5CCGE 2FLBT 2OSLB 1SQ2N 1A1MB 3L45A 4Z8FL 5KSVB 4JFFE 5H37A 2DQXA 2VSDA 1PS9A 2VX6A 1IGIL 3DKJA 2QR6A 5C07D 4FABH 3VYPA 4HIJB 2WKOA 3NFUA 1UR8A 2QCCA 1IHIA 3MV8E 4DPBX 4PJDB 2G96A 1AHKA 1ZS2A 4JTFA 4M5PA 2HKFL 1EQPA 3W26A 1GVRA 2G3MA 4AMCA 5F4SA 5FF6B 2WXGA 4Q0XH 5F6IC 1T3FA 1PZ0A 2PF0A 4FZEH 1OFQA 3PB0A 2G4EA 4RDQG 3BANA 4OIAA 1A9EB 3U9UB 3FO1B 3DIFA 2DZAA 5LO7A 1TXKA 1MREH 2LT9A 4GSQA 4TSCL 1UWUA 1KM3A 5B3NA 3T3PB 4X63A 3CU2A 4FLHA 2JNZA 2HBXA 2FTWA 4WEEA 5ICXB 1LNUA 4XVJH 2B1AL 4RSYA 3IGKA 1U8MA 3CB8A 3DRTB 2WJDA 5LAXA 5K93A 2F1AA 3FU0A 1E6NA 3PQYA 5AHIA 1PAZA 2XBTA 1S9YA 1VADA 4AL8L 4CDGC 3R4RA 4IL0A 4C54A 3QUYA 4KVCL 5KSBA 3F7VB 1HZKA 1GZPA 5FF0A 1HJWA 2IF7A 3VWJB 2OYPA 2PR4L 3EYQC 2EHHA 2YXWA 2Q8XA 5H8PA 3O6AA 2DWXA 1LO2H 3QCTH 3W7KA 5JBEA 4XN9A 4HMNA 3LZNA 5C9KA 3VE9A 3MXVL 4UTIA 3O3BB 4AX6A 3QH3A 1GW1A 1GZHC 3UTSB 3PHQA 2P52A 4BJLA 4AEIL 4LF3A 4AZ8B 4GKZA 4MMYB 3NM1A 1CLOL 1QKZH 5B8CC 3EYOB 3MKGA 4X7EC 2W94A 4ZS7L 3LAFA 3THAA 1EC7A 2BSBA 2VJ0A 4FSAA 1OW0C 1OAKH 4DTGH 2B5IB 3OGCB 3SN1A 4MNQA 2ZFAA 4PJXE 2FX8H 3CT2A 4H20L 1QOXA 4HLEA 1AW2A 2I5GA 2A6DA 1RL1A 2ICWI 4R26L 1R3IH 3IT8D 1KCRL 1M6OB 1EJ8A 3WYRA 2XJKA 1CDHA 5CR8A 3EHBB 3D6NA 5FR3A 4H41A 3W1XA 1UKTA 2PYFB 1FLRH 2QPEB 1BM7A 3BFQG 1M7PA 3AC0A 4L4VB 3VXUD 1B0GA 3UPAA 1A0QL 1KPRB 3D85D 2DLEA 3JV4A 1UR0A 2R9HD 1J10A 1QABA 3L3HA 3BH8A 1W72B 4LC6A 4JB9H 4NNBA 4I85A 2J73A 3P30H 1H8SA 1M2VB 1E70M 3ARFA 4YVNA 4JM0A 1DQLH 3UH8A 4IRJD 4MNJA 5HVHC 1LOSA 1VCGA 1E1CB 3F3HA 1O5XA 4ORZC 2O5ZL 4UM9D 4I1PA 3LQAC 3GC5A 3TBSA 4LBSA 2OZNA 5GGVH 3I7RA 4Y2DC 4ACZB 4IRZA 4W9DC 1AD9B 1GOFA 1EP1A 2OMXB 2F6UA 2BNQE 4LEQA 5ILTH 4M7KL 1BD2E 1HWWA 3QNYB 5MEQB 3CDZA 4G8EB 5I3KA 4MXVE 4HBQA 5T3XD 1MQQA 1FCGA 3MJ9H 1EO8L 4DKEL 4LQFL 1KLGA 4NN6C 3MSDA 4TLKA 5KETA 1N8IA 3UERA 1F6AA 1MEIA 5EDSA 2INFA 2I14A 5AVHA 3DFNA 4B3ZA 3T08A 2XKNA 2F8IA 4AWUA 1W1ZA 5MHBA 2X0VA 1FWAC 1VS1A 5D6CB 3M0MA 5BUGA 2XVBA 5DUPH 2B08A 5CJQL 5FEXA 4DOHE 3NO1A 3UZQB 3W4RA 5K4XA 1K3UA 2XZ9A 3LS5H 3LU2A 2WLLB 2Z8RA 2W92A 4L4TD 3QI9D 1Q4NX 2D3NA 2Y7FA 1GYLA 3URAA 1U93B 2J5WA 4XP6H 2NT0A 3FUFA 4KDVA 4O13A 3Q6FB 1DQXA 1YE4A 5HGDB 1TVDA 5DJYB 2Z26A 5FLUA 3CM4A 1XG4A 4LL1A 2BASA 3ZMEA 1E28B 1V27A 4NZ5A 4BK4A 2BS9A 5F96L 1AH4A 4FXGC 4HA0A 1YEGH 4JY4A 1Q6FA 3EIFA 5FA3A 4UTAA 3LY0A 1UM5L 3FJLA 2OL3A 4NZUH 5C0AD 2N0MA 5EU3B 1GIGH 1MFEL 1RV6X 3ABZA 4ZW5A 2EDTA 3HZKA 1NCIA 3GMNB 1CDIA 4M1GL 4I9JA 3DPBA 1THCA 2PDLA 3UWQA 2YBTA 3SO5A 2A3HA 1QTWA 2WCAA 3SE9H 1OCWH 2EQDA 2XN0A 4BR1A 4S1DD 4E5TA 3L95A 4OKVA 4B9JA 1S5IH 4EVNB 1Z7AA 4YL4A 1TKWA 2KC0A 3KYMB 3HLAA 4CD4A 2OSXA 3INUH 4K71C 4TXVB 4QJ1A 1UOVA 1VC4A 2ZJSH 1Q7QA 4UT6H 5D02A 5LAPA 1U2HA 3MJ8A 4K7FB 3UTTD 2D4DA 3RDTB 3FT4A 7TAAA 1B31A 1ZDSA 1JPEA 4WDUA 4IPNB 2CKSA 3CJPA 4AQLA 4LU0A 2WW5A 3MUHL 2DWDA 3MBFA 4TIMA 3C0JA 3L1EA 2Y5TA 3ZTDC 3VZZA 3GTVA 4BXVA 1TB3A 3RFAA 4H8QA 3VXQB 4HKBB 1X96A 3AJXA 3KLLA 3LKNB 1UUOA 4LIQH 4B50A 1KFAL 1KM2A 4C56B 1OP5H 1OGPA 3UGVA 3V0TA 4MSWB 3NK4A 2D9CA 1WCGA 1N6QH 3S96A 3ZDXF 5EUKB 1BIIA 3M17B 4KJYB 2WWDA 2QIIA 3LDVA 1RAKA 5CINH 4TUFA 1NEZB 4I0PD 2FHFA 6REQA 2XU2A 1P5UC 5DRXB 4IQLA 3E74A 4JTQA 1JZDC 3L4WA 4M7LT 1OD0A 3CC5A 2C3HA 3CASA 3M1BA 5FSEC 3JVAA 3EH5B 1LYQA 4RGNC 3C5ZA 5BZWA 3UC0H 4XIAA 2VC2H 3H56A 1E5NA 3O9WB 4HEME 3WN5A 4DM1A 4D9QD 3WEOA 1BLNA 1WHOA 1LE9B 5FXCH 3T0EC 3LENA 4NAEB 4Y4HB 1H6FA 5DT7A 1NGYA 4QTGA 2PTTB 1NMCC 3LBOA 2YXXA 5IOPA 3SBWA 5ADPL 2EXWC 1DJXA 4M81A 4MAUL 1BKHA 5CC5A 4M7ZB 4N90E 4K4KA 5HDBE 2ESVB 5CEXB 5FCUH 3TIDA 4IOIA 3F58L 2H32A 4NJAL 1MWAH 3O6KL 4XN2A 4N9GA 3IIPA 4IEFA 5LIWX 1Q45A 1JR1A 3PBUA 1CL7H 3UZZA 5D2LE 2K1MA 2H1XA 1PCWA 2AQVA 4WWNA 4ETYA 3DXAE 3GG7A 4BGLA 2DM3A 3N2JA 2X0SA 1X8CA 1KJVA 3LSOA 3O1NA 5AW8B 1A3RL 1A1OB 3MREA 4KHXL 1OM3H 2Q8LA 1ZAJA 4PS3A 3RLUA 4ERGA 3EFOA 1FDLH 2JJSC 2G3NA 4XOBA 3QRHA 3FQXA 1HIML 1B4TA 2O6CA 1CDCA 1W2KT 2C1IA 2PLJA 2I57A 3DX1A 5KBMA 2ISDA 4OZHE 2JKJA 3W81A 3OOQA 1T1XB 2V8ZA 2XA3A 2AJYH 3DMMA 5EZLB 4GG6A 5LLIC 3SSGA 1H5YA 3HIJA 3PHAA 3RNQA 3CIQA 3ICJA 2X38A 5HHXH 3MCKA 5IM7A 4WDIB 4HWBA 1HI6A 1WFOA 3DUUB 2ZSVA 4WK0B 4GKOA 3KYOB 3AB0C 3SAZA 3TO4D 3E9AA 4V1DB 4ZQMA 3GYEA 4Q58C 3D2UA 2Y06H 2Y36L 2IH1B 4XNYL 4NZCA 3VXRE 1QW9A 2HJLA 1IC5H 1GPOH 4QXWA 4W9ZA 1FHGA 2ARWA 1A14H 5LGYA 2UWFA 2XH0A 2Z8VC 1I1RA 4LHUD 1SFLA 4FQHB 4E3TA 2UV3A 2Z4GA 4APQC 4H88L 1LWRA 5CZXD 3B8VA 1F1AA 4RMBA 2Z92B 4EIBA 5AOUA 1K4GA 1LBLA 2X70B 2YL6A 4MPKA 4RGOH 2I25N 1OL0A 4QM1A 3WFZA 1HGYA 4AQAA 4HA4A 4UWMA 1PQZA 2EE2A 1X5FA 5CD3A 1DQVA 2CM5A 3TEWA 1LJYA 3T3PF 2RJHA 3LIZL 2FR4B 4NQSA 3F7RA 1IM9A 1V0LA 4NI8A 4X61A 4WO0A 3EJZC 2XU9A 1TWSA 3UFIA 2QCNA 3SY1A 3WEMA 3EO0B 1P4CA 3W25A 1UCTA 3S48A 4WTQA 4S3EA 4IH3A 5DEJA 4IX2A 3FU9A 3Q44A 4X50A 2P8MA 4JN1L 4X4ME 2PBGA 4Q2ZA 5C09D 4L6OA 4L3CB 2XRAH 2BOCB 2A1WL 4Z2LA 2YKLL 2ZNWA 1U4FA 3FPYA 2EXTA 2J66A 3IVKB 3ITVA 2YN3A 3HB3C 3IJHA 1ONRA 3QJSB 3L6FB 5D4YA 3DENA 5DMJB 3SCMC 3BLDA 2H6PB 5CHNA 5E7FA 2X1SA 2Q76B 4U6YA 2DMCA 1S7RB 4LJ3A 2QPDB 5C0CE 2V3EA 3DX6B 2ZVRA 3FY1A 2RGLA 3MLYH 3F2DA 2W9EH 4FP8L 2BWQA 4WCJA 4AWJC 2VLRE 3T8VA 5SWSD 1KXHA 2XG5A 3VB9A 1N5AA 4K23H 3VD1A 2NUPA 3KYNA 3IGAA 3UROR 3WDPP 3N1MC 4PW4A 5E6IC 1JAEA 5KBDA 3PY9A 3NJHA 1AP2B 1NFPA 4DGIL 2ABBA 4W87A 1NAMH 4NP4L 2YOCA 1CVRA 3HI6L 3ZE1B 4DI9A 4B2DD 2HMIC 3L5IA 5IR1A 3M5VA 1LK2A 5M1TA 3KR3H 3PZOA 1OGGA 1G6RA 3BXWA 4QQUA 2YB4A 1ZEAL 2B7OA 4E41D 2KT6A 3CDGB 1F3TA 1XRVA 1KJ3H 5AW3B 1OGAE 2PCEA 3IVTA 4NVTA 4O4YH 1D6VL 3CO8A 4U1LA 5D1XC 2I9UA 2IMRA 3M16A 2IXUA 2E47A 2FQEA 5T1DL 5CWSA 1X3DA 3TSDA 3WD5L 4IHBA 1XX1A 1ZV2A 1U3HC 1R9YA 4GXFA 1HK6A 5J5EA 5AVNA 1OTUC 4FFYL 4BUGA 4ZMNA 4PMJA 1X44A 4JMXA 4HSCX 2VDHA 1VFAB 5DJ2B 3KS5A 2FQDA 3VWJD 2FB4L 2IFFH 3V6OE 5MERB 4RBPH 1T66D 2BLFA 3KE0A 2GEQA 3H2MA 1TO3A 1AGBA 3WE6A 3WH9A 4FMFA 4NHUB 1IARB 1AVAA 4BUHA 1TG8A 1L7TL 1U42A 2LU3A 4Z5RB 3GNPA 2ORBL 5C0JA 1N2RA 3RUGB 1I8AA 1ITQA 2C91A 1TRIA 2R1YB 4OFVA 2HPTA 5EA0H 5ITBL 4IMLA 2ED9A 3PRZA 4M5SA 3UJ2A 5I1JH 2C9AA 1IKFH 3MWCA 4D6FA 4LCYB 1PDKB 4PMDA 3BZ4B 3QZWG 4DP1X 5GRUL 1KY6A 4D0DA 4G7YL 4X4YB 3B8DA 4P2QD 4UM8A 4PJIB 3NSJA 4NKMA 3G5XB 2HX9A 1C90A 4GRWH 4LYQA 4JDYA 2ACRA 4IQEA 4IMKA 5B3JF 5CAHA 1V08A 2OK0H 1MFCH 4QHLA 8FABB 3CXFA 3N4FA 1TPVA 4QTIL 4JX0A 4OLEA 3BZFB 5JOFB 1YYML 5CP3H 3CHOA 3GR4A 3GW3A 4L4VD 3MODL 1ZTMA 3U6WA 2F53A 1RJPA 4DUVA 1UQYA 4TMPA 3W0WE 1S78D 4B3VA 4YNYB 3JWDL 5GNXA 3RR4A 2VLJB 1DKWA 1QSFE 3EGSB 1GKQA 4LMQI 3M0LA 1YTEA 5AOIA 2MKLC 2B16A 1MIEH 4G7VL 1CT5A 4UBDD 3W2LA 3S3CB 3L7FA 2NXIA 3E38A 3ZXWA 4AGPA 4LV4A 1N5YH 2J9YA 2DWEA 5J57B 4NZ1A 4GXUM 5FW7A 2BP5M 5CFAA 4Z2HA 2TMDA 1G6CA 3L1FA 4PJGB 4XPGL 5FSDC 4C57C 4LOCA 5HGHA 2MHAB 3CFEA 2VLKE 2ACSA 2XN9B 3ARGC 2JQMA 1ZTXH 2XPKA 1CLZL 1YNTB 1FO0L 1WKFA 3OKNB 3B5GA 3Q0HA 1S4IA 1E42A 3CU1A 3OB0K 4HJ0D 2PTUA 1UR9A 3GHEL 5FJTA 4N9EA 2FJFA 4G2AA 4NC0B 4PJ9A 3RWCA 3I10A 1A0DA 1G5AA 2Q0ZX 2HTKC 1MVUB 3WJZA 4LARL 1TZZA 5T3XL 3RAJL 2QLVB 4H3DA 1I8MA 2Y2YA 3ARPA 5IZ7A 3RPBA 1VJZA 1E6ZA 1BVNT 1QLEL 2UY3A 2YX0A 2Y5JA 1DQML 2INEA 2FLIA 2EICA 1GA2A 4EE2A 3HFTA 4RMWA 3ILPB 4FP1A 3BW2A 5ID0B 4LUSB 4BFIB 1F4YH 5DI8B 3KP1A 1VRSA 4G56A 1CXEA 3QC0A 2YC1A 3UVIA 5GHWH 1ZLUH 4Z2IA 1IKOP 3MSRA 4JPGA 4U28A 2G3JA 3R94A 1PLGH 1Q8AA 3X14A 3QJQB 2BG5A 1DL3A 1K4CA 3LXUX 4WW2A 4NJJA 3IGLA 1HCVA 5J1AA 2Z31A 3LUTA 4PN2A 4FTDA 2R8SL 4M8UA 1TPUA 4O57A 4JVUA 4EUPG 4JFEA 2OMWB 1I4FA 1S7QA 3NO3A 3PHOA 1R34A 1P7KA 4TS6A 1GAFL 5DT1H 3PWGA 4J4PD 4HKJB 4H6EA 4CVXB 4Y1AE 5L8JB 1NTDA 1WAPA 3DIPA 3RZCB 2EDHA 2XZCH 4GW1B 4HIEB 3SR7A 4PBXA 3T07A 3IWUA 3DFOA 3RURA 4D2NA 4UMSA 5AYXA 4ILSA 5DD6B 2DKMA 1IQDB 2EIMB 2PD9A 2IDCA 3CFBA 4RUBA 4OD1H 3C6LB 3D6GA 5CLXA 1CI5A 3NPSB 3W9EA 3X1EA 3MJGX 1U41A 3V9FA 5DMNA 3QQ4B 3FAWA 1PNCA 4M80A 1GY1A 2O6PA 3RDTD 4C5ZA 3NVDA 1KTLA 3FB6B 4JFVA 3AALA 5BRZD 3WKMH 1WD8A 3IK2A 3V4VL 3P5ZA 5LKYA 5IBLC 5IHUL 43CAA 1KENH 3W02A 5D2YA 1NCGA 2Y6SC 4O0ZA 4JHVA 5F0PB 2XVLA 3EWCA 1IGYB 3TUUA 1KJMB 5H8MA 1CICD 4P9ML 5E6UB 5HWJA 3N13A 1GTFA 3D47A 1GGBL 3VXSA 4BRVA 3TJPA 4F8PA 4RXFA 1OT2A 4Y19B 4J3OC 1FFOB 1Q3NA 1HNGA 1FFRA 2A77H 1D5ZB 4ZTOL 5C8JA 3CLFH 3NTCL 3VGAC 3ME3A 4C4UA 3N2BA 4ZK8A 1XMWA 2DQTH 2JB6B 3OJDA 3WLTA 4TUOB 3GZKA 3O07A 2X7VA 3WH5A 4K9EL 4MLSA 3V1PA 4PGEA 3TO2B 2VVSA 3QORC 5HI5D 1FNGB 5HHMB 1A3ZA 4M6OH 2AQOA 5MKGB 1JDEA 1R3JA 3LN5B 2GPTA 2B3IA 4ZZKA 2P49B 1BQUA 3LQGA 2YXFA 5D5MB 4K3JL 4FQIL 1L9WA 3HG0A 4JFYA 2HA1A 2GT9A 4JG5A 4DWSD 4LAZA 1RAMA 1UA3A 4R88A 3IXAA 1A8JH 2AV7A 2EUVA 5FW6A 4F37K 4LLDB 1RD5A 3IJYB 4QGYA 1DBML 4V33A 5ENWB 2V5SA 4L37A 1KB5H 1JWUB 1TTCA 4GW4A 4NO5A 5FYKD 3SUSA 1JK9B 1BXVA 1UJTA 4R9XA 3WG6A 1E9LA 1HH6B 3P0WA 3VO0A 2Z4TA 2VR2A 2X1UA 5IWLC 4QROA 4PY8J 1UB5B 2ZG3A 1FE8H 4TULL 5ISZD 4I9AA 3F04A 1MAMH 4LL4A 3OW1A 1KCVL 1KFCA 5KBKA 2IG2H 5J3HD 3W2JA 3GKZA 3GW0A 3H7BA 4A3QA 2IDFA 5G2WA 2ZAHA 2PPDA 1UZ8B 2R1WA 4AD4A 2J4WH 5D7EA 4AQZA 2ITDA 3UXFA 4LVEA 3EOOA 4K8HA 4JQAA 3M8OH 5C07B 2FBJL 5DD0L 3PBYA 2PFHA 4AZCA 2R1XA 4Y7EA 2DY3A 2I32A 1H1ZA 4M7LH 4IFKA 1G7QA 1A5LC 2DKUA 2D7TH 2Z34A 1MIMH 1BMWA 4LSDA 3IAGC 4XNAA 4P2CG 3PZVA 3D09A 3DFHA 2DL2A 4OD3H 5HDQL 2GVEA 4RZCB 4YE0A 3LB6C 1I82A 2ZXBA 3EJPA 2WXPA 2X4PB 4R0LC 4YHLL 3HAEB 2Y88A 1OYCA 5HYIA 3ULUD 4AIEA 3MUXA 4GUGA 4DQWA 3LRGA 3SPJA 4NX0A 2E6FA 2OS7A 5K9QG 1GHSA 4DUXA 4YDMA 5FC9A 7A3HA 4QOKD 1NBVH 1SDAB 4UT9H 5DK2B 3WNOA 1KFEA 3WTSA 5D1QE 1VA9A 5J11B 1ZS8A 1G4SA 2CLOA 4QNEA 1OPOA 1QVOB 2A7RA 3BKCL 1FFTB 4LSQH 5DHMC 3T78A 2OR9L 5FKPA 1HHHB 2E6DA 3QFEA 3KYKH 3BC9A 5LA0A 1UCWA 1IL1A 3GU9A 3CHEA 4WNQA 3MCLL 4W93A 4LRIC 5J5DA 4U3HA 2PMZA 1ZPTA 4JRXD 2NT1A 1UWAA 3ZE1F 5TDPA 5KG9A 4JZJC 2JELL 2VMFA 1CTMA 15C8H 1MDAA 3M07A 5CGBA 2H2PD 4BFEA 3WI9A 3SODB 1K3ZA 5IW6A 2ADFL 4DJFA 2ZCLL 2ZKXA 4AHPA 4MHBA 3R12A 1W31A 4DEPB 3ONBA 2I69A 3VKJA 5ABTA 4FNPA 1A1NA 2O0TA 4HPGA 4HGMA 3BJFA 1BQGA 1UWYA 4Z7UB 2VERN 2EH8L 5I76A 4U1KA 4RMQA 3S1VA 3ZLGA 3JT0A 4H40A 4MY9A 2OXGA 4Q97A 5EO9A 2Z1BA 4PTDA 4Y5XB 2GJZB 4XAYA 3Q6GH 3RL2A 1T0NB 1WZLA 4TLSA 2WP3O 5HR7A 1I9IH 4O2EA 5EOCJ 3N42B 1O95A 2Y07H 2E9MA 3P77A 4Z3HA 2ZCKL 4QRSA 3MP4A 4YZWA 5GGUA 3AIVA 3VYOA 1V55B 3RUGF 3VAVA 3VE0A 2K9UA 3JYCA 1E9PB 5AG9A 1U1UA 3CFDA 4NZDA 2BVQA 4FXSA 4L9ZA 4YXHH 3TQPA 1H3XA 4MG4A 1KJ2A 2GBTA 5I1HH 1HXYA 1LG1A 4ZFGH 2QHLA 3QYSA 3VXUB 3TOPA 3IMUA 3L4CA 4PH8A 5C55A 1WA1X 1E4KC 1E7UA 3D85B 4LOFA 5IB1A 4JJOA 3S5ZA 4IRSD 1TWWA 4PMYA 4BH8B 1RD6A 1DWGM 5JH2A 1FRGH 2XGBA 4UB0H 3UZWA 1NMBL 5A3HA 4IRJB 4HZ1A 1FO0B 3KL3A 3I75B 4UM9B 1JYWA 4W5UA 3HGJA 1QO2A 3MN8A 4MQSB 3W1LA 4CVZA 3V0JA 4PJDE 4B9YA 1GWJA 2A5HA 2I5QA 2DZPA 4WUUB 4EBQH 5EWIL 4U1GB 1BV8A 3UMTA 5FIEA 3Q2DA 3C2SA 1NCNA 4NUGL 3RHWF 5DTFA 1X1NA 3BAIA 4LKXA 5I1IH 3FMGH 1R5WA 2WN3A 3TNMB 1WJ3A 2ZKHL 4UQ3A 1QLEB 3ILQD 2WZEA 1QOKA 1T22B 4JS7A 1KIRA 2J6EA 1OAYH 4JTJA 2NX1A 1NIAA 2KYIA 4ZTPL 1UJ3B 4EF8A 2DTSA 3HG4A 1DO5A 4GQRA 4LVBA 3R11A 3WMLA 5AAMC 1OFRA 3T3PE 3WL1A 2ZXQA 1ANUA 1RIUL 3MNVB 1H1YA 2XH7A 4ZQCA 4PJGF 5EZPA 5E2WH 4GYPA 5EO1B 1FDZA 3B2VL 1CQKA 1BKSA 5I19H 1YNTF 3QI9B 5E9DD 4RE4A 2DTMH 3Q2VA 1N6UA 4Q9BA 1HEZA 1MW3A 3ISYA 3B9VA 3S37L 1BWKA 4UIMA 1OOAA 1WDWA 1QW8A 1QLRA 1FH5H 4I3SH 3A3YB 1YDYA 3HG1A 1EUNA 1LO3H 1FIEA 4HJFA 1ASOA 2X4OB 3I84A 5DQ9B 2WO5A 1W8SA 2HRPL 3UT0A 2QIWA 1WIPA 3M0HA 4GJJA 4JNZA 1ADQA 3PP7A 1PO9A 4P9HL 3JXAA 1DANT 1NPJA 5E70A 1GZQB 3WS6A 4DBEA 4M7JL 4QHMB 3NJNA 3PAJA 4MBRA 5GS3A 1ZPUA 3UTSE 3D30A 5EMJA 3F65A 3CQIA 5C0AB 2YGQA 3ARDA 1P4IH 2CM6A 1NGZA 5LBSL 3DBPA 3E49A 3LNPA 1LP9B 3VCRA 5MF5A 4OFPA 4OJFH 5BMFH 1V3HA 5CEZD 3U0WL 1VCVA 3SYOA 2WTRA 2YCKX 3RM8A 3STZB 1DPMA 1MI5D 1S7UB 1H7PA 3B0PA 4AJVA 1MCIA 1MCNA 3F7KA 4N86A 3LZFL 5K2ZA 3Q3GB 2PDWA 1GC1H 1RHFA 2B7DT 2E1WA 1ELSA 5ETUA 4ICCX 5GGQH 3WBWA 3FCGA 3RIKA 3P61A 4JD4A 1SDDB 3DEQA 4Q22A 5DD1H 3UTTB 5AOJA 5LIYX 2XA8H 4HFWB 4D9LH 1AQ0A 5F1IB 1ZKAA 3VFOA 3OKLB 1G9ML 3U46B 1WEJL 1PIGA 5IQOA 4G8FB 4A2FA 3HO8A 4I8DA 3VYNA 1EUAA 4YYFA 4AT6B 5DHYB 2CUAA 1W72L 3FQNA 1TLKA 2EXSA 4OSUH 3O2LA 3ARQA 1ORQA 3N5AA 2B20A 4HOZA 4DSYA 4YDVB 3WUBA 1XLBA 4G6ML 2FQGA 5KINA 2F5AL 1QNZH 4EE9A 2QVTA 2PDIA 4HG4K 4LSUL 1YNLH 1V10A 2W79A 2ZONA 5AG8A 3KCPB 3DHJA 2CHRA 1XL9A 4GO9A 2QAPA 2DSKA 4DPCX 1A4KA 2OMAA 4RFNC 3S4SA 1FBIL 2UYLA 4N8VA 3UBXI 4I0PB 4I1RA 1UC4A 3H53A 2OTDA 2DI9A 1MEHA 4PJCA 3VFUA 1VJIA 1A6ZB 3FUIA 3IGUA 5LNRA 1CECA 4XP4L 4S1SH 3LKOA 2A73B 2R0WL 3W6MA 3ARBC 2NW0A 5E5RB 5FF2A 4TL4A 3WF4A 4GPVA 4ZPVA 1H2JA 2GZXA 1XF5B 4FJYA 2BSSB 5D09A 1B9KA 4PRWA 1FNSH 4DKAA 1MJ7L 4DYKA 3MLSL 1UR4A 4HETA 1FWCC 4AZGA 4GW5A 1RZGA 2QVNA 3EKGA 5XINA 3TURA 2Y62A 3RVVC 5I71C 3IGFA 2P24B 4MA1B 5HNNA 2FGWH 5T33L 3SYCA 2UZXB 1XF2A 4HK0B 4B9KC 1YY8B 3WQ6A 3MJ7B 3NFSH 2JKNA 1V79A 4HUWB 1T21A 5B3JE 1AJZA 5GGTL 3TXVA 2KLRA 1OANA 4FQXD 2D7QA 2BOEX 4X8XA 3OKYA 1KXTA 4BKNA 1VKFA 4OGAD 4M8QA 4AIZB 1K8DB 3I9PA 1T89C 3BPNB 5JW4N 2FNWA 2IIJA 2XXMB 4Q6IA 3UG5A 2E7MA 4XB3A 3MRRA 1DJNA 5GZNA 5L9DL 4DWHA 1ZP4A 3ORWA 3NDYA 4Z0SA 3KWTA 4GCXA 1EXPA 1FWWA 4GNKB 3PANA 1ECQA 2J1XA 3GJFB 1K5WA 3CV1A 5ABZA 1X1OA 5ACLA 4YAQB 1X5XA 2MNUA 1VENA 2DIJA 3AS0A 3MRJB 3O2DL 4JVPA 1XGRB 4EUPH 2VXVL 5DBTA 4H5SB 3I4KA 3SKJL 4B7IA 4NASA 5CN3A 3GJEA 3ULAB 5TE4L 3REWA 2YEQA 4EPEC 3U2IA 5I8EA 1LTXA 3UYIA 3LKSB 3ECBB 1SM9A 3GDCA 3QDJA 4H26B 1J0HA 1GSKA 1Z5YD 4QG9A 5DR5H 3G1HA 5FGRA 4Y19D 5D7IB 1VF8A 3RWIB 5FB8B 4FS0A 3VWKC 4G3YL 4OVUA 4P7OA 5HHQA 4LHUB 4ZQNA 3IV8A 3CV5A 5A69A 1GL4B 3UBGA 3WEBA 3VNYA 4LESA 2D2OA 3BP4A 2H3XC 3MX0A 4FGMA 3SE4A 3TN0A 5ICZB 2BODX 3GVQA 3V3WA 4XMLH 3NFPA 3URBA 4C60A 5CLWA 1K4DA 3CNKA 3DYOA 1OG0A 3DARA 1US3A 1A9BA 1EEPA 1HYSC 4PJ5A 1DFBH 5F9OL 3AISA 4C56E 5KOMC 4JFOB 5C8BB 3FO9B 1UCBH 3U2SA 3VYLA 1JUFA 4YBHA 4JO8A 3QEHA 4JIPA 5IQ7H 2H5UA 1NELA 2DQDH 2Y4SA 3MRMA 3O4OC 4UQAA 4AQ1C 2HT2C 5C0EB 1JULA 2GSJA 4CQBA 4FQJL 5I73C 5D32A 5EA9A 2NY6B 5C09B 4WO4C 1SY6A 2XQ0A 1X39A 1J5HA 4H8WC 3QMTA 3ZTJH 2R2CA 4R5VA 2D2HA 3I85A 5FYKL 4WNJA 4PLNC 5AKQA 4JKLA 5KJ7E 1FWIC 3LN3A 1KPVB 1NCJA 3QIWD 4Z7UF 2A0LD 4NLHA 1J12A 4GI9A 4KQ4H 4BFAA 1W9UA 2GI7A 3WBXA 2ESVE 4RFOL 1BZ9A 5E0FA 3DO7A 3G3LA 1MSPA 2AQSA 4NYLB 5SWSB 3FGCA 2R9RA 4AIUA 5F3BB 4ANUA 4I4WB 5IF0A 4JY5H 2BFGA 3AWNA 4XWUA 3ULVD 1QLFA 4KU1A 4K7PH 5HI3D 3N42F 4LVDA 2YL9A 1GW9A 1HXMB 4A7GA 3FO0L 3F4DA 4M56A 3VIOA 2ZSWB 5AVZB 5T1KA 2FJGB 1SMOA 4FX6M 1O5QA 3SHSA 3B2PA 5B21A 1JNHA 4UTFA 2XIQA 3NGJA 1JEZA 3OAWA 4J3BA 1ZA3A 3OVQA 2VEKA 5F7KC 1TYJA 5JYLA 3FRPA 5K3VA 3UPRA 3LCHA 3RO8A 4A35A 2Z0IA 4PV9A 4YC2B 3ULUL 1CXKA 3DVFA 4LBAA 3HURA 4E41B 1I0BA 3UWEA 2DB8A 3CIVA 2X6UA 4KNSA 4MNMA 2WANA 4JGDA 4LEOB 4DJED 2O9RA 4BF7A 3W7NA 3O6DA 2SEBA 3QVAA 4JFSA 4NUJA 3QFWA 4KHTL 4XOCA 3BUYA 3GBNH 1CCZA 1IGTB 4PPTA 1TELA 4YDKL 4V1DE 2KHAA 4JHWL 4JKPL 3KOXA 5EF2A 4K39A 1UC6A 1MG2C 2E1DA 4LLYA 5DMKA 4B0MM 2Y7EA 4QJ4B 1U33A 1X7QA 5AYQA 1JZJA 1P7HL 3WFLA 4W8AA 1OD7A 1R5IA 3FQRB 4IK6A 3NP3A 2FWSA 4PGCA 3FYPA 1EB3A 5CF3A 1GYMA 2H0PA 4IOTA 1K6QH 1THFD 2W3ZA 2BWDA 4G70B 1J05B 1WBXB 5E2UH 3TK7A 4MFHA 3P73A 3K8MA 3RTQD 1Y18B 3C8KB 4PY7A 1K7EA 4J12A 3ISIX 2YXGA 2XN1A 1FUYA 3WDJA 3OHMB 4FAMA 3X3FL 4K6AA 3G04B 4D6HA 3DI1A 3TZVC 1M7DA 3HI1B 4P2QB 4WFGD 4Z2KA 1JGVH 5INDB 4S0SD 3F4VA 3IJ9A 1JMZA 1OCCB 2WSYA 2XLLA 2BSLA 3KS0J 3NK3A 2ICCA 4IKNA 1T04A 2Q8AH 1KG0A 1CD9B 2ZXEB 1G1YA 1ISYA 5JMOC 2VMCA 3MMTA 3WLOA 4F8XA 4MJ6A 3D4YA 3TWCH 2GITA 4N9OB 4QR7A 1GZHA 4D0CB 5HHVH 5C6TH 5I8KH 1FDYA 2BY2A 4N6RA 5I23A 3IRPX 3WL0A 2NYYC 3WUWB 2VXUL 5B8CA 1Q1JL 3I6LD 3U9WA 3GPEA 1YJDC 4YHZL 3ZE2B 4HXAH 1PYWB 4HYRA 4A8IA 1OW0A 4MPQA 1LP9F 1JPST 2HLFC 2N3JA 1AJ7H 4DK3A 1TPFA 4O1AA 1JGDA 1UZHA 1XSJA 1XHHA 3PWJB 3AG2B 4WUUD 2BNUA 5GJNA 3LA4A 3AHYA 3BJSA 3GUTB 4W86A 2PMQA 4ONFL 1OX4B 2BRQA 3ITCA 3FJ4A 4PWFA 1Y1UA 3QDGA 2YEVB 3BVJA 1JL8A 2ZUQC 5I66A 4LCRA 3UACA 3ZE1E 4WCYH 5IT2H 2OOGA 5EB9A 2WSPA 3P1VA 2K4AA 3S88H 2ZXGA 5IB5A 2XM2A 1ZHLA 2EPHA 3FFCD 1JIBA 1DQJA 3N6HA 1JRCA 7XIMA 3IXTB 2OVLA 4R4FH 4ECLA 4ONHA 4N8CH 3N55A 2PWVA 5EC2B 4NENA 5DZVA 3RNDA 4UWQB 4N1HB 1J5TA 5HSFA 3B34A 4DYJA 3KRSA 4GXMA 3TTEA 2LTQB 4IMFA 1WV2A 3AIUA 4NHVA 3IU4L 1A21A 5D03A 3PS7A 1OCRB 2HXUA 1CWVA 3CX5K 1YY9C 5D1QC 3WIIL 2V2HA 5FO8B 4Y2DA 4YBQD 4MX7B 3MV7D 5CBAB 1DUYA 2Z7KA 4HMCA 4D8PB 1IM3A 1AI1H 1JK8B 1A7BA 4CA4A 1CU4L 5JDSA 3OJ2C 1KN2L 4D6GA 1MJ8H 5LZLA 3HMXH 4GRLC 3NSMA 4H9YA 1A4AA 1TQSA 3TWAA 1NDZA 1CDUA 5I6XB 5KWYC 4NN7C 5A2FA 2WVSA 4M8VA 4QY8A 3RUGE 3T2NL 5TDNA 3NEXA 4HPNA 4PS7A 4Q3MA 4UIKL 4CNSA 1UEYA 3P2DA 1Z8AA 2VKZG 2CBQA 1RJYA 1XIBA 2VAJA 2ICEC 4O16A 5F9AC 4JDEA 3FTGA 5SX5K 4XPBH 5AOLA 2K0RA 1U36A 1W5NA 4BJHA 3N12A 1RUAL 3GG0A 4E38A 4APXA 3IJSA 4PJIE 2VM8A 2YSSA 6PTDA 4K8GA 1QNIA 2FLRT 4C6JA 2BVPB 2JVUA 2Q8ZA 3JYBA 4IOSD 3VQMA 1QPNA 3N6JA 5FF4A 3BDKA 5CEZL 4KK6C 3LS4H 5IFPA 2AQ3A 4DKDC 4CGTA 3TU6A 4QDMA 3AY4C 4MJJA 2FEEI 5BRZB 4MXWH 2WSKA 3QP3A 4QXGL 1HHIB 3JTBA 4FXGA 2K7QA 2OWXA 4FTVA 4HW6A 1NC2A 2YKKA 4XCYB 2I1OA 1XIWC 4U1JB 6ALDA 4OCSH 1OAUH 3O9NA 4PV8A 3PL6C 3D05A 3MACH 4S2SA 2FBRA 1X5IA 4NS0A 3QFJD 4HT1H 2EYSB 1CICB 3AXHA 2VRQA 2VLJE 2WINA 4YSOA 1XSIA 3I2CL 5IXEA 3S36H 1WXZA 3AYTA 1XR9B 4S0TD 3CFJB 4K36A 4EZJA 3T8XB 4UV4H 1S2WA 3HCVB 4QT5B 4IP4A 4K94H 4ACTA 1G67A 1XG3A 2DI7A 1WXJA 4GEJA 4TL5A 4PJGE 2IWEA 2PW2A 3MO7A 3GQFA 2XN9E 2A6JA 4HN8A 2QSCH 2BIMA 5KYUB 4F20A 3FUNA 2X4QA 3A9IA 5J13B 2J43A 2QADD 4JICA 4ODUB 2VZUA 2LAGB 2NDGA 4DWSB 3BZEA 3L13A 4UZSA 4K3HA 5D7IF 4Z7OB 1WCQA 1ID2A 3CHRA 2EPLX 1XYLA 3ARZA 4ISVB 2LV4A 4JY9A 3TYFA 2W88A 4BM7A 3ESUF 3GMMA 5DZJA 1ECEA 1W56A 3VZYA 5J0BA 3QE5A 3W39B 3GTTA 4HHMA 1W3NA 1S38A 1KA9F 3EWZA 4RAUB 4Q6JA 4N2OA 3LM7A 1A66A 1JV5B 3ZYOA 5CPNA 2RR3A 1X9RA 5ISZB 1PLAA 4XE5B 5F9JB 2D2CC 3MGOA 1BYCA 2OT1A 4JKMA 4EXPX 3J2PA 3TNNA 1P5UA 1FV1B 5HJGA 1G7LB 3LHPH 5A16B 2ZCHH 3IJEA 5KUMA 1BRLA 2WGNB 3GWQA 2CRZA 3PC0A 4KRMB 3B0YA 3HF3A 1KLUA 4X2RA 3E02A 2WLIB 4GXUN 1T7XA 4FR1A 3B40A 2JXMB 4S2CA 4LEXH 1GGCH 3IUHA 3R58A 4CDHA 3F7JA 2E56A 5I1LA 3WFEH 2ZUWA 2OTUA 5GQBA 4XX1E 3T0EA 2NX5A 1LHZA 2ZDSA 2CBMA 4AWTA 3FA4A 2FECI 4JJHA 1ZBVA 1C12B 2FATH 2CLVA 1TJIL 2XZQL 2J74A 4TMBA 1DQQA 4CJ1A 4HCGA 4DZBA 3RIAF 1QI5A 2VJXA 2ZRYA 2RAGA 5C86A 3O6LH 4XI5D 3G6AA 5FA4A 1RQBA 3BGJA 4LBEB 1E5CA 3SADA 4GUPB 5FM4A 2GKIA 4WY0B 4YVUA 2YHGA 4WI9A 4QOKB 4XPFH 5JA9A 3BQ5A 3BHBB 2V5YA 4GI8A 4PJDF 5HY9A 4QHUA 2B5IC 3TH4T 1CB2A 4O02L 1U1HA 3E0LA 1F74A 1S1RA 4HXBH 2R29A 1DVSA 4KVNH 1TSHA 3OKDA 3DO4A 4R5TA 4N2CA 4JTRA 1CVSC 2FX7H 5CZRA 2JJSA 1GOGA 4JRXB 2JCCA 2JK5B 3MO4A 1JCKA 4P57B 3CPGA 4JTSA 2AXGB 3GNXA 3EHBC 1F42A 1FCBA 5HDRA 2ZOXA 1MHEB 1EVTC 1ZD6A 2VDMB 1H3PL 3N1FC 1OCJA 2V69A 1EXUA 4Y19E 4C1LA 2DSZA 2E6AA 4BEUA 1JCNA 1JFHA 4YO0B 1KBWA 4AYSA 3DTXB 2APFA 3NQBA 1V8EA 1F8TH 1UXWA 3LH2L 4ZX6A 3T04D 4LLUB 4AWSA 2XC8A 5HHME 1SR0A 3S2AA 3O8XB 3NR0A 2W9DH 2PGEA 2OMZA 4JR9H 4F0HA 1CPUA 2CO6A 3STLA 2Q3ZA 3W56A 2NY6D 3EF4A 3PGCA 2KZWA 1JHLH 1J5IA 4OFIA 3SSZA 4APQA 1YQVL 2DSUA 1IMHC 1HIZA 1JVLA 4XNXH 2WV8A 5G1MA 3UU0A 3K4AA 2O5XL 1Z9SA 1LUCB 5DJXA 3PXHA 5MENA 3KLAB 4NIRA 3II1A 3P0YL 3MUCA 3TBTA 2W1NA 5E23A 4AKPA 4WI7A 3GUFA 5LDSA 1GUVA 3K6SB 3GI9H 5BS0A 1N82A 4O0KA 3FDWA 4HUVB 2XJ7A 5BW6A 1ET5A 2X4SA 2EAWA 4YLBA 3UXLA 1G7PB 3KDMB 4IP5A 3C2AL 3V5OA 3N91A 2BB0A 3MUGB 5EGRA 4KZDH 3V0UA 3R8BB 3P4MB 3H3PL 4QLLA 2CZDA 5FECA 3D07A 4IRSB 3KM1A 2WUBL 4HJSA 1IAIH 1YDPB 2AJ3B 4KCVA 1UG6A 3FTWA 8TIMA 5D6DC 3CG8A 1VYPX 4G8TA 3FQ4A 5C07E 1MFAL 2QHRH 5KZCD 5AOKA 5F2GA 4UOW0 4MDIB 3B05A 3ULVL 1JNJA 2Q09A 3O4LA 3ENLA 2AXWA 3SCMA 1KFKA 2RTTA 3W84A 4KK8C 2NTFA 4YXLL 3QHMA 4FK9A 3I7QA 3OKOB 3EB2A 5I17B 4IU2A 1D5XA 3QUXD 2AXHA 3DX0A 4GMSH 1R6VA 1GTNA 4CKQA 4PG9B 2V63A 3DECA 4GUCA 3BLFA 1HZLA 3NZPA 1I7ZB 5AL8A 4ZUVB 3IFLL 3RX3A 3EXTA 3DHDA 4OLWH 4ZDHA 4CNIB 1KM5A 2XFRA 1WAAA 3KCWA 4AEOA 1P0DA 3OAUH 1HQRA 3QPKA 5E6IA 4U6XA 2YK1H 2VH5H 3ATAA 1LO4L 1REQB 4DAFA 4XG1A 4JO3L 6XIAA 2YPLA 5A40E 4OZIA 3HZMA 4MASA 3V5DB 5E9DB 3V0AC 4ZQKB 1SGJA 3SDCD 1HTIA 1GXEA 4E9LA 1LROA 4WEBH 4KTEL 3VX1A 2Q10A 2CHNA 1A6AB 4LAQH 1X6UA 1DWJM 1A02N 3UR2A 1TENA 4BSWA 4GHRA 3H2OA 1RY0A 2UV8G 3WTTA 3VG0H 3MBWB 5D1XA