2QMKA

Human pancreatic alpha-amylase complexed with nitrite
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 166
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmkA01
1HJUA 1C8XA 1J10A 2VZTA 2BHYA 1E0XA 4HZ7A 1HKIA 3GH7A 1JXKA 4CN4A 1XGZA 2IXUA 4ZE5A 3LPGA 1QI4A 3GZAA 3VX1A 2Y8VA 2V5DA 2ZX5A 1EOKA 3WNOA 3FNDA 5HOSA 5IHRA 2G4FA 3HJEA 3BH4A 4J3XA 2J79A 3N18A 3BAWA 4GXPA 4QFUA 1UKTA 3VGBA 1GQLA 2XGIA 3A3HA 3MMDA 5A6SA 5JBEA 1TFVA 3HZ3A 3FXYA 2C0HA 1E6RA 5M3WA 3WQ5A 3WUGA 1W9XA 1R87A 4MB5A 2EPKX 5LA0A 3MI6A 4B3KA 1TCMA 3WMSA 3D4ZA 2YJQA 4RE2A 3ZT7A 1NWSA 2VX7A 1E6PA 3PHAA 4EAMA 4ZXLA 1B9ZA 3D52A 1VFFA 3AIWA 2GFTA 4KGLA 2JF7A 3BMVA 1C90A 4P7OA 1JIBA 4EKJA 1JF5A 2BHZA 6TAAA 2ZX9A 2PWEA 1VRXA 3UCQA 1JZ5A 2CPUA 1BPLB 5AY7A 3I3EA 1E5NA 1KCKA 1BVNP 5CLWA 3MUIA 4AD5A 3MMWA 4P8VA 1UD6A 4CKQA 3W53A 1OM0A 2F7OA 4D6HA 1BFNA 1W9VA 2WCSA 3ALGA 4OBRA 3BAIA 2AOSA 1PPIA 3NCOA 5IDIA 2ZUSA 3BCDA 3QHMA 1R46A 3CZNA 3WL0A 1LWHA 2XSAA 5FKYA 1QNSA 3NIYA 2WKLA 1H41A 2E40A 1QI0A 5ABGA 3SCOA 4DO6A 2J77A 1E0VA 4R5EA 3L4YA 1AQMA 1QW8A 3VTRA 4AISA 3AI0A 1QI2A 1K9EA 4PMOA 1UH3A 3L4VA 2GSJA 4KRTA 4MAVA 5C8BB 2YL6A 2QPSA 4AIEA 1ZBVA 3CHDA 4W5ZA 1OIMA 1EXPA 3CUGA 4AY1A 5AC4A 1B3ZA 4GKLA 5E9AA 1Q6DA 4PYSA 3D3AA 2BXZA 1CYGA 3NJ3A 4AZIA 2JF6A 3W27A 1IZJA 2ALWA 2WXDM 3VO0A 3DC0A 3CZSA 2WHJA 3VMPA 1KWKA 4J3TA 2YL9A 1MW2A 3SCTA 3VGHA 3SUUA 1WNOA 3LPFA 1E40A 4A3HA 2WPGA 3ZR6A 4AZCB 3TONA 2ZUTA 3RIKA 1TVNA 4JFWA 1W3JA 3L4TA 1XYZA 3AS1A 1RP9A 8CGTA 4MB1A 1ZBKA 4TOQA 1J0IA 4ML4A 4W86A 3CZKA 2VVSA 3WNPA 5I23A 2C8NA 3CPUA 3VU2A 3CZLA 5JIPA 1TG7A 3ARWA 3A24A 1KWGA 2X2JA 2VRJA 4V2XA 4U2ZA 1DWFM 3EMCA 2EBNA 3VD9A 3NDZA 5D9PA 1X1NA 1ODZA 3WD1A 4F66A 4HZ8A 1A3HA 1XV8A 1CXHA 4FNSA 2JIWA 1PS3A 1U30A 4P7LA 1LL7A 3N11A 2D22A 1GOKA 5AYBA 4Z2IA 3HG3A 4E8DA 1TMQA 5M5DA 1UR4A 4WLCA 3IANA 2BNJA 4PMYA 2W66A 5FL0A 3U5YA 1TA3B 4DWSC 4AW7A 3LMYA 2VR5A 3APGA 2CIPA 3GXTA 3VSTA 1E6ZA 1J12A 2ZUWA 3VSVA 2G3NA 5A95A 1BAGA 1V08A 4GINA 3N17A 2DT3A 4XV0A 4S3KA 3BSGA 4X9YA 1B3VA 3FW6A 3OLEA 4NZCA 1M01A 4A3YA 1WZAA 2YA1A 3WQVA 4E2OA 3TV8A 1SFSA 3UR8A 4GZEA 3EMZA 1OBAA 1W9DM 3M7SA 1MW1A 1HJVA 5DO8A 4GIAA 3PTQA 2FH8A 1OD8A 5CSUA 4CVWA 3DYPA 4FLQA 2VCBA 1V0NA 2J7BA 1GNXA 3BXWA 3UESA 2IXVA 1DHKA 1JF6A 5A8PA 1D2KA 3N12A 4F9DA 2YKKA 2Y4SA 3LXBA 4BA0A 1UD4A 4A4AA 1JZ8A 5D8ZA 4GO9A 3BLKA 1CWYA 2ZICA 2VZOA 3AFBA 4IPLA 3RPMA 4ACYA 1ZBCA 3SIMA 3VIMA 1V6XA 3CTTA 3MU7A 3NSXA 3BUDA 4XUYA 1R34A 2F7QA 4XZBA 4AYGA 3S5ZA 3RILA 3EMQA 3HMCA 2DSZA 2F18A 4IPNB 4Z2JA 3W28A 4PCTA 2W5FA 2WZIA 2OWCA 3TTOA 3EJTA 3WF3A 2V3FA 2PBGA 3GNPA 2JEQA 5F7UA 3AHXA 4UOJA 1PX8A 8A3HA 4M81A 1JDCA 1MXGA 3N9KA 4B16A 3AJ7A 2A3CA 1EHNA 2EQDA 4AXNA 1W32A 3NUKA 2J8GA 1C7SA 2W92A 3EYPA 1CXIA 2WC4A 3FHQA 2DH2A 3PZ9A 3T2QA 5EMYA 1QI3A 4HA3A 5I77A 2QMKA 3D51A 4C7DA 1JG9A 1NM9A 1VF8A 3CMGA 2D73A 2WHLA 1UH4A 3WBEA 2DIJA 1H5VA 4XX6A 5CPSA 3WUEA 3CGTA 4D72A 1HF6A 3SCPA 3BAYA 2CESA 2CKSA 1Q4NX 2PB1A 3LXCA 1G9HA 1DEDA 4M24A 2XIBA 2ZX7A 1PX4A 2ZX6A 4HTYA 2VNCA 4FNQA 1N82A 3ARVA 3SCSA 1HX0A 1W9BM 5DFAA 1UKPA 1LWJA 2O9OA 5A94A 4NZFA 1B90A 7TAAA 2WMKA 3IGUA 4AZCA 1B30A 1VIWA 2VZUA 3GXMA 1V03A 3K4AA 1QWUA 4OBSA 2PWHA 3EDKA 1L0PA 3CO4A 1XC6A 3KLLA 3ZT5A 4N0RA 4PTMA 3ZSSA 4JFTA 2WSPA 2W61A 1V02A 5IFPA 3WDHA 4B9YA 1HJSA 3VM5A 1J18A 4HMEA 2FH6A 1TQUA 4W8LA 1B2YA 1QBBA 1GHRA 5HBFA 3K8KA 1PX3A 3E1F1 1E4MM 2W62A 2XM2A 1UWUA 2YDQA 4JZ5A 5E09A 4AMXA 2VVNA 3KL5A 4KRUA 3AMGA 1KR1A 5A6KA 3WN6A 5A2CA 1UWRA 3BGAA 1E6XM 4LGXA 3RCNA 2YOCA 4W8AA 3VDHA 1ZU8A 4NX0A 4URIA 3TTYA 3W6MA 2Z1KA 1TA3A 4UTFA 2W67A 3ARXA 1HXJA 2CKRA 1CDGA 3LXAA 4JFUA 3RM4A 1HWWA 2DSVA 1V3KA 1C8QA 2WMGA 3A4WA 3MO4A 3WY2A 4CD8A 1NWRA 5I79A 1C7TA 2XVPA 3SURA 3WNMA 3W37A 4GQQA 3WF0A 4UCFA 1HKKA 1EQPA 5A3HA 1BGGA 4AZ5A 4BCEA 4HP5A 3AHYA 2FHFA 1HVQA 1S46A 4OGZA 3UG4A 3G6LA 3W25A 1R85A 4TVCA 1BG9A 3RM9A 4HOZA 1E3ZA 4N42A 3OBAA 1VENA 1VFUA 4HU0A 4MJ4A 1MXDA 4FNTA 4M29A 5ECUA 1ODUA 1YQ2A 3CUFA 3MSDA 1JAKA 2QLYA 3KLKA 1DTUA 1IT0A 2PC8A 4CU6A 1E15A 1SYTA 1K9FA 4W84A 3WIJA 1ISXA 4AYSA 5BRQA 2D0HA 2EPNA 4UQEA 1VFOA 4H8UA 3DYOA 3PBGA 2D2OA 2E9MA 3S2CA 2OWXA 2DT2A 1I1WA 2WYSA 5BYWA 4FNUA 2VUYA 3B8SA 2D23A 1UR8A 4X0VA 3QHNA 4LYRA 2WCGA 3WEMA 4P8WA 3TTQA 2JE8A 4CD7A 4PMRA 5LA1A 3WH6A 1EDTA 1W2PA 3KZSA 3BUBA 1IZKA 3CZEA 2WZEA 3N04A 3WMCA 1BF2A 4P8UA 3M07A 1SR0A 3CV5A 5ABEA 1EGZA 3AROA 1R7OA 5CLTA 4JFSA 1LLOA 3UETA 1C92A 4TX6A 3MSGA 2WWCA 3AOFA 4HU8A 1UASA 4J7RA 3DHPA 4WIWA 5ABFA 1KXQA 3VNZA 3AS0A 4J3SA 5GNZA 1FP8A 3GBEA 2CBIA 1UQYA 1GOQA 2XFFA 3UEQA 1G94A 3AZRA 3L4UA 4J3UA 1EDGA 3WNLA 3O9NA 3F5KA 2BY0A 3VUPA 4CCDA 4PMVA 1OCQA 1V6UA 1H0GA 1P6WA 2DT0A 4QCFA 4Z2KA 2VO5A 3L4XA 1XCWA 3WELA 2G41A 2V38A 1J01A 3CUJA 3VGEA 2YIHA 3BVXA 1WZKA 1GOOA 2B31A 3CBWA 2X2YA 3DX4A 4MJ2A 3L4ZA 1WO2A 3W38A 1MW0A 3BVTA 3WDIA 1PZ2A 4LQ1A 1F4AA 4FK9A 1JZ7A 3AIQA 3W0KA 3ZJKA 4CD5A 3THCA 4TVDA 2GK1B 4WKFA 2BVTA 5M03A 4QCEA 1JDDA 2NW0A 2FYVA 2MANA 2Y8KA 3VDAA 1GCYA 2VMFA 3BLPX 3WFZA 1OT2A 1QWNA 2GDVA 3AMCA 2QF8A 1JYXA 4UFLA 1UHVA 5BXRA 2WC7A 1ZJAA 3KE0A 5A6MA 5HPOA 2VRQA 1GOWA 1CTNA 1V02E 4LX4A 1ECEA 2BY2A 2QV4A 4M56A 4XZWA 1UG6A 4AD0A 3WD2A 1HNYA 1EA9C 2VI0A 2PWGA 1V0MA 3VD3A 4PMNA 1JNDA 3VIKA 4D1JA 1JGIA 2J47A 3UG5A 2FE0A 3UERA 2F1BA 1ZL1A 5A8OA 4C7FA 2RGLA 1D7FA 4AMCA 5IFTA 1JFHA 2BS9A 1XCXA 1MW3A 3ECQA 4U3AA 3U7BA 5HPCA 3CHCA 4Z2HA 3VIIA 3ZM8A 4AD1A 4AZBA 3KWXA 2WHKA 1KGUA 1UH2A 2D20A 4MNJA 3D4YA 1RPKA 3EJQA 3HN3A 4CN1A 4UFIA 1ISZA 3GNOA 2CITA 2ZX8A 3PZMA 2JALA 2OYLA 3AIBA 2X0HA 3SUTA 4GQRA 3WD4A 4PRWA 5I5RA 1Q6FA 3BMWA 4F9JA 3T0BA 5A8QA 1WZLA 1H11A 4JHZA 4H7VA 4YHGA 5LA2A 4WSJA 4MDPA 4OZOA 1XD1A 1WDPA 1HJQA 3VIPA 3ARQA 4QDMA 4PMXA 3WUFA 3AXIA 3PZNA 4JIEA 2XIIA 4WJXA 3KL0A 2D3NA 2O92A 2Y2WA 2GJXB 3N1AA 4EK7A 3AIRA 2JIEA 2WMFA 1US3A 3WENA 2FDMA 4PSPA 3GYCA 2XFYA 3AISA 4W7WA 1EQCA 3CZ8A 2ZUVA 2J25A 1TQSA 2WSKA 3WDPP 2XWDA 2WANA 3OLIA 2FHCA 1CEOA 2J4GA 2NT1A 2QHAA 2TAAA 4W85A 4TXEA 4EANA 4L4PA 3LRLA 3WQ8A 3WF1A 1NH6A 1E72M 2F61A 4K68A 1ZS2A 1V0LA 1OWQA 3PN8A 3VD7A 4UQAA 4BQ2A 4F79A 3BLBA 1BTCA 4CN6A 2O9PA 2PWFA 1B3YA 3FAXA 3PTMA 3A5VA 5DEZA 3VILA 4WKHA 2V3DA 1BYBA 1HIZA 4TX8A 1CLXA 3I3DA 3ZJ6A 2OYKA 1LJYA 1E4LA 1HKMA 4DO5A 2VX6A 3WFLA 1GVIA 3U5UA 2BY1A 2E4TA 3WEOA 3T2PA 1KBKA 3B9DA 2EADA 3VOCA 1QI5A 3FAWA 1CECA 1O7DC 4H41A 1VJSA 3BAXA 4MDOA 1W3KA 2E8YA 3GXPA 4AIUA 2VQTA 1QHZA 1NP0A 3OG2A 5KZ6A 4OKDA 2ESCA 1XSJA 3VNYA 3OGRA 2D0FA 1DWJM 5CZKA 1W9PA 3SUVA 3T2OA 3B9EA 3KL3A 3WH9A 4M8UA 1VFMA 4FLOA 3WH7A 2DPEA 2CBVA 2GK1A 1KTBA 4P7NA 3UG3A 3AZTA 1LQ0A 2WLZA 3WNKA 3QOKA 3WH5A 4AD2A 2ZXQA 4OUEA 5BCAA 1U33A 3HG2A 1CBGA 3CIVA 4MNKA 3VMOA 5GQBA 3AS3A 2WW5A 3WF2A 3EJSA 3CUIA 5AYIA 4GPNA 5I3DA 3AHVA 3AHTA 2WZHA 2J7FA 2YL5A 3D50A 5I2UA 1WP6A 1GZJA 3L4WA 4PMUA 3WD0A 2G3IA 4PUEA 1DP0A 5EFDA 2WNWA 1WAWA 2VQUA 2VCAA 5D9OA 1B0IA 3A23A 2WMJA 2Y24A 1V3LA 1GONA 5GNXA 1ZJBA 3J7HA 5TD4A 2GVYA 1GJUA 3WDJA 4BQ3A 4JHOA 3EDDA 1FFRA 4UFMA 1KB3A 4GZJA 1JD7A 4HPHA 4PTVA 4YN5A 5ABFB 4AC1X 1ISVA 3ZT6A 4MADA 3I3BA 2XN2A 2YLLA 2X05A 2ZIDA 1LG1A 2Z1SA 1UWTA 4HA1A 2XVNA 4D1IA 2GUYA 1ISYA 4J3WA 4CD4A 3LRMA 1VJZA 2WMIA 5D8WA 4IUGA 5CJ5A 1E5JA 4S3JA 1TR1A 1W2VA 1JXJA 3NSMA 3VSUA 3HU7A 2W91A 3W4RA 1W91A 2CETA 4JKLA 3AMDA 3O6AA 2VURA 2VZSA 2WM0A 1UR0A 4Q22A 4TTGA 5KEZA 1O6IA 4P8XA 1WDQA 4OOUA 3WQWA 1XD0A 1FP9A 2GJXA 3ZQ9A 5DT7A 4D6JA 4W7UA 4U33A 1HJXA 3ARSA 1LF1A 5EB8A 3A22A 2CERA 4MPKA 2BV9A 4LYPA 4AWEA 1Q6GA 1E1EA 1OGGA 1W1YA 3ZJ7A 4M82A 1WDSA 4B3LA 1SZNA 1CIUA 2DSWA 3BAKA 2CNCA 1G1YA 1QHPA 1UKOA 1E71M 4CD6A 2AMGA 1WDRA 1EO7A 5E0FA 5AC5A 1E1FA 2D24A 2F2HA 1BHGA 2FGZA 3SUSA 1HL8A 4RE3A 2CBUA 1EHAA 3OIHA 1KGXA 1QNPA 4TTUA 5CSYA 3VM7A 1H2JA 5FCZA 3WQ4A 3WNNA 2YBUA 2WK2A 3BUPA 1M03A 4UQDA 3K4DA 1E0WA 2BHUA 3SUWA 4C7GA 4AZ7A 3AS2A 4W8BA 2VCCA 1ITCA 3PTKA 1E3XA 1VEOA 1LG2A 2IGTA 1AMYA 1WPCA 4NRRA 2WBGA 2ZOXA 3SCNA 1NARA 3BVWA 1V3JA 1BQCA 3WDRA 1JFXA 2DSUA 1M7XA 4DUXA 1CENA 1WB0A 1JI2A 1CPUA 2EABA 2XVGA 4RL3A 1UWSA 2YFOA 1HJWA 3GXNA 2VC9A 3THDA 3ARPA 4EE9A 4JL1A 3WH8A 3LX9A 2OW6A 1EIBA 1EH9A 1BYAA 3HG5A 3CUHA 4L4OA 4ATLA 2OLHA 4PN2A 1J0ZA 1Z32X 4LYQA 1UZ1A 5A2BA 3EJRA 1HN1A 3FY1A 3CMJA 1CGWA 3VX0A 1W1VA 3W29A 3PZGA 4Q7NA 1QHOA 1GQJA 1R75A 4CGTA 2XUCA 3VMNA 3VKKA 3QOMA 3IJ8A 2E9BA 4AEEA 3DX2A 4FMVA 1JL8A 4GI8A 3EJPA 3K8MA 5CPQA 3L2MA 1V0KA 4M1RA 3H55A 2XWEA 2X2IA 3VIFA 3POHA 2EAEA 1JI1A 1YHTA 3MV11 2J7EA 2XVLA 3D5HA 4HMDA 2X0YA 2NT0A 4JL2A 3MV01 1ESWA 3OLDA 4OJYA 2A3BA 4CCCA 2V5CA 2DT1A 3DYMA 2D3LA 1KGWA 2Q8XA 3AZSA 4GZIA 5C71A 2F7PA 3AXHA 5A6BA 3DX3A 3S5YA 1FH9A 2VZVA 4BQ5A 1QBAA 1WKYA 5EBAA 3BSHA 2RGMA 4PMZA 5FOOA 1UKQA 4Z2GA 3GH5A 2BVDA 4PTXA 4DWSD 2XVKA 4IISA 7A3HA 3OZOA 3MS8A 1UA3A 3GNRA 2XM1A 4JKKA 4HPGA 3FHAA 1KXTA 1E43A 4DUVA 1XSKA 5IXEA 4UFHA 3DDGA 1R33A 4J27A 3OZPA 1V6WA 2ZWYA 4W88A 4CUCA 1I1XA 3IJ7A 2J62A 1DWAM 1CLVA 4PSRA 5JBDA 5CPTA 4MAZA 1UR1A 2XYLA 4D6CA 1CGYA 2WVSA 1KR0A 3GXFA 1FH8A 4U5IA 4KGJA 1HXKA 5I78A 4FF5A 1J0JA 4PBGA 1GQIA 3CHFA 4PTWA 3EDEA 1QVBA 4JFVA 4BQ4A 1KQYA 1H3GA 4M80A 4UR9A 1GOIA 1K9DA 2VR4A 2EJ1A 1XHGA 4BS0A 2CYGA 5CQ1A 2G3MA 1GQKA 2ZUNA 3CHEA 1RP8A 3AYRA 1QW9A 4W87A 3BVUA 3BUQA 3TP4A 2XN1A 3PZUA 2O9RA 3T0DA 1KQZA 1OGBA 3DECA 2ZXDA 5A8MA 5A6AA 5HXMA 1PIFA 5I24A 5BRPA 1RD6A 3BAJA 3U57A 1CGUA 3HG4A 5A8NA 2X09A 1C8YA 2J75A 5A6LA 3T0AA 3ZJ8A 2ZXBA 1VEMA 2CCRA 3WY3A 3PZTA 1X6LA 4P7RA 3WUBA 2UY2A 3BCFA 1HKJA 3IAQA 4AZHA 3WY4A 2HISA 1HT6A 1UD2A 1GUVA 4V27A 1UZ4A 4CCEA 4NSBA 1CXLA 3T08A 2A3HA 1US2A 1MWOA 1XH0A 1B3XA 4DUWA 3GM8A 3SCQA 3EDFA 2EPLX 1G0CA 1J0HA 1OB0A 4QP0A 4GI9A 1CGXA 2YA0A 1J0KA 1E4IA 1JAEA 1TVPA 3WDQA 4QLKA 4ZENA 5IHSA 3QGVA 3VGDA 3RMEA 5BXSA 3S6TA 1UUQA 5E6YA 3A4XA 3DDFA 5DMYA 1BGAA 2DSKA 2VTFA 4W93A 1SMDA 5CGTA 4DWSB 1G01A 1QPKA 3WSUA 2PI6A 2XG9A 1JNEA 1Q6EA 5D9MA 4PMDA 1E6NA 2WMIB 3NYDA 3AHZA 1NOWA 2J7CA 3OA5A 1OD0A 2BVYA 3BUIA 1K6AA 1MVYA 2G3JA 3AIVA 3EBVA 1Q6CA 1X6NA 1TUXA 4F8XA 2QPUA 1WZMA 5GPRA 1MQQA 3WF4A 2UWFA 3IAPA 1C3FA 4AEFA 3VPLA 1GHSA 1JZ6A 4WF7A 4NF7A 2GJRA 9CGTA 1BG4A 1GOMA 1QNRA 1UWIA 2WB5A 6A3HA 3WY1A 3MMUA 1EO5A 1HL9A 1UD8A 5FL1A 3W24A 4QLLA 1K9TA 1R86A 5BROA 1MFVA 3II1A 5A6BD 4JKMA 4NXKA 2XFRA 4OIFA 3CH9A 3W26A 2IUZA 1UR2A 2CEQA 1J11A 2XHYA 5CG0A 4TUFA 5E6ZA 2UY4A 2X8RA 3CZJA 1BYCA 1E70M 5GNYA 2ZUMA 1EOMA 4D6FA 2F8QA 4D6EA 3DX1A 1KCLA 4NZJA 1JDAA 2F7RA 4UFKA 5HDRA 5LYRA 3AIUA 1GORA 3IJ9A 4UQ9A 3TA9A 1TQTA 4W5UA 1UYQA 3RM8A 3PZIA 3OGVA 1E55A 1XSIA 4NXSA 1TZ7A 1TQWA 3ZOAA 2WMHA 3BVVA 1PIGA 1H09A 1CGVA 4H8HA 2WVVA 1WCGA 4U31A 1JYWA 3AMLA 1QNQA 1W3HA 1NOFA 2BXYA 3WMBA 3ZR5A 1OINA 1Y7VA 3T09A 1B3WA 3MUY1 3RJXA 2YLAA 4H2CA 1JZ4A 3WD3A 2ZXAA 1M04A 7CGTA 2OSXA 3VIHA 1KFWA 1E73M 3WQ6A 2AAAA 1XYFA 1KTCA 2G8ZA 5HNNA 2OSWA 4ATDA 2WVTA 1V6YA 3LRKA 2VJXA 3VINA 2F1AA 3N13A 4GO8A 1LL4A 3W81A 4J3VA 1VBUA 3RO8A 1W3LA 4D71A 2D1ZA 5A1AA 2YA2A 3LPPA 1AVAA 4JCMA 3SCVA 1J9YA 1V3HA 6CGTA 3F5JA 2UY5A 4FLRA 3RJYA 4ZXOA 4U3CA 1NOUA 4UOZA 1BLIA 4W7VA 3SCRA 5M17A 2E3ZA 1OGSA 2DIEA 4UNIA 2D0GA 4QLJA 4TVUA 2DGAA 5D9NA 2X2HA 2WLYA 1PEZA 2EO7A 1R7AA 2DEPA 3F4VA 4P7QA 2A3AA 3VGFA 1D3CA 3OLGA 4E4PA 1V6VA 1ZB5A 2VRKA 5E0CA 1QNOA 1VEPA 5FIPA 1W9UA 1R47A 5JIWA 1L8NA 2E9LA 4MTVA 2J78A 3M46A 4AZ6A 4BF7A 2JFEX 2DDXA 4WK9A 4FLSA 4PEEA 2YBTA 1WE5A 1I75A 4ZE4A 1TE1A 3VD5A 1V3MA 1CGTA 1B1YA 2CHNA 4U5KA 1DWIM 5E1QA 1R8LA 3G6MA 2J8FA 5JBFA 4HMCA 3AQUA 5ABHA 4NRSA 5I6SA 5CGMA 4UQBA 3CLWA 3EDJA 1KXHA 3N15A 1UD5A 4DM1A 2XJ7A 2VOTA 5A69A 3NSNA 1SMAA 2VX4A 1IV8A 4X0NA 1C91A 4PCSA 4DWSA 1XH2A 4KWUA 2EEXA 4ACZB 3DX0A 2PWDA 1E6QM 2WKGA 1VAHA 4HZ6A 3F5LA 1H0IA 4MNMA 1CXKA 1JYNA 4D6IA 1C93A 3WEZA 1DWGM 1OIFA 4FNRA 2WBKA 3VIOA 3ZIZA 1HP4A 1NWUA 1H49A 4HA4A 2EXOA 5A6JA 1QX1A 2QMJA 4R27A 2NSXA 4WKAA 3ALFA 3ARTA 1CXFA 1W1PA 3K46A 4RE4A 2E0PA 1UR9A 1FHLA 4KH2A 3VDBA 3A47A 3VIGA 4UZUA 1MFUA 4CU8A 2J74A 4HOXA 1BSIA 3AYSA 5E70A 1U2YA 3WKZA 1FFQA 1UQZA 1BYDA 3WBAA 1MQPA 1OSEA 2FGLA 3EJUA 1MYRA 3K1DA 4CU7A 3B9AA 3LPOA 2O9TA 3GDBA 3QHOA 5D4YA 1QOXA 3OGSA 2OSYA 3VDCA 4H8VA 3MKKA 1HP5A 1PBGA 4E8CA 3K8LA 3AXXA 2DQXA 3M6DA 3GBDA 2FHBA 2Y5EA 4Z2LA 3VGGA 3ARZA 4BZYA 3A4AA 4D6GA 1W1TA 3VIJA 4FNPA 4J28A 1F4HA 4DO4A 4JCLA 1GJWA 4CVUA 2WVUA 3ARRA 5DT5A 3W6LA 3RDKA 1PZ3A 1GW1A 2WAGA 1E6SM 3MUZ1 1KXVA 2YDRA 4DM2A 4UFJA 3SEPA 3UR7A 4UOQA 1XRVA 3TTSA 4YHEA 2YDSA 5I0DA 1J0YA 1UA7A 3VVGA 3ZMRA 1H1NA 3TOPA 3H53A 1RH9A 4AZGA 1E9LA 3KEHA 3H54A 4OOZA 1CZ1A 1JZ3A 2W63A 5CXPA 3GTNA 3GXIA 1PJ9A 1NP2A 1ISWA 3L2LA 4LPCA 3BC9A 2OYMA 2CHOA 2J7HA 1UD3A 3PZQA 1CNVA 2CXGA 1A47A 3O2LA 1VBRA 1UKSA 2VX5A 2WWDA 4U2YA 2HVMA 4ZEPA 4PMQA 1G5AA 4AD4A 5JUVA 3AMKA 1NWTA 3GXDA 1HVXA 2JEPA 2DH3A 1MQRA 4UZSA 3AICA 3GH4A 2EPMX 4LXFA 1UOKA 4AD3A 4D6DA 3AIEA 1FA2A 1LL6A 5BWFA 1FHDA 4QAWA 1AQHA 2GJPA 3DHUA 2CBJA 2XTKA 2XSBA 2XPKA 1PAMA 3W82A 2XN0A 3A21A 4B9ZA 4MNLA 1KBBA 4ZFMA 2BY3A 4UQCA 1T0OA 4B15A 4NI3A 4MB3A 3PZVA 5A2AA 4YPJA 3OB8A 5C70A 4HOWA 2J7DA 3QR3A 1OT1A 1EDQA 2V3GA 2YL8A 5BXTA 1VB9A 2ZUUA 4XB3A 2X1IA 4W89A 2YFNA 4Y7EA 3SCUA 2C7FA 1FOBA 1UWQA 5BXPA 3NDYA 1JYVA 2V3EA 2BFGA 5DF0A 2UY3A 3CC1A 3FN9A 4WSKA 4JAWA 1CXEA 3ARYA 3IK2A 3ZO9A 2XGBA 3MANA 4H04A 1GVYA 4GI6A 5EFFA 2VL4A 2WHMA 3VD4A 1JD9A 4KMQA 2VT0A 1JZ2A 3POCA 4ACZA 1V3IA 4AMWA 2GDUA 4AIOA 1E4NA 1FH7A 1TQVA 1AQ0A 2WVVB 3U7VA 2PF0A 4ATWA 2WC3A 1DWHM 2PBOA 1BVZA 2ZWZA 1ITXA 1B31A 2WCAA 4IM4A 2EACA 4MB4A 3A6OA 1GPFA 1NQ6A 2EPOA 2J7GA 2ZE0A 3CZGA 2A3EA 3PZOA 1O7AA 2E8ZA 1ZBWA 1M53A 1XH1A 2OW7A 5FD0A 4PUDA 2W4XA 3ARUA 1E56A 1HTYA 3ZSTA 4V28A 1H4PA 3JUGA 2OWWA 3WL1A 3SCWA 3MUAA
chains in the Genus database with same CATH superfamily
2APVA 4X4ZA 1C8XA 5G4WA 4DZHA 1M41A 4CVXA 4ETQB 3CB3A 2H45A 2IXUA 3RNDA 3WFDL 3SPIA 4RGNE 1WWBX 2G4FA 3GBNH 3HJEA 5L0QC 1L6YA 1UKTA 4MY8A 1GA2A 3KPNA 2VP8A 5M3WA 4L9ZA 4FFWC 2VC2L 4XPFH 5JHLH 4N6EA 1LZOA 3MHZA 2DM7A 3QXWA 1ZTXH 1XCQB 4DVBA 2CBOA 3HEIB 1JIBA 1FWHC 5KZMA 4Y9NA 2VXTL 2NLJA 4N2IA 3QORA 3TL5A 2CPUA 1BPLB 3H2PA 2CRZA 3EO0B 1X7FA 4AXKA 3OSVA 4NO2A 1P7KA 3X1FA 3G1XA 4FJYA 5AAMC 3M6YA 4D6HA 4EZLA 2VDQB 3ERPA 1POJA 3ABSA 4MA3A 4JFQB 2AK4D 1TSRA 4R96A 2DQCH 3E80A 2CU0A 4G8TA 1PEWA 1OALA 1RJLA 4ZUWB 5IESL 3WIHA 3VXGA 3KW3A 3CUGA 1XIIA 5C86A 5F72S 2CR0A 3DMMA 3WHXB 5HYJA 3N91A 5E9AA 2PRMA 1MCBA 2LW3A 1FVDA 2AC0A 3LCXA 4P3DB 2HNHA 4L4TA 3APFA 3V4PB 3T0XA 3QYCA 3U25A 4P2QA 3LEYH 4JPKL 1J5CA 1L9SA 4A3HA 1JVNA 3X3GL 3BVNA 3ZHLA 5FUZH 1OSYA 4MKVA 3QJFB 2IO5A 4Y4FA 3K72B 3CZLA 1KWGA 4AX7A 1QZNA 3MW7A 2IAMC 3S8GB 4L48A 1XF4A 2ZYHA 4WWPA 1S38A 2R59A 3IVKB 3MXVH 5LHDA 4NM4L 5JIKA 2P10A 2D22A 3NSYA 1WBYB 2H26B 4E8DA 1ITBB 3NZPA 3FH7A 3BD4A 2PDFA 4PMYA 1TA3B 4ZB2A 3ZWSA 5ALCH 2X4NA 2EEDA 2CIPA 2FB4L 4C5YA 1CD0A 3GMPA 2BNQA 4N0YH 2OU4A 3N17A 5T5NF 1DQJB 3L0KA 5IVXA 4DK3A 3TVMD 2IFGA 4U1IA 5JPMC 3F58L 1WZAA 4A3YA 1VGAA 4J5NA 3EMZA 3M7SA 3RZCA 5AFAA 4QGTA 3TEXA 2FH8A 3T42A 1KBGL 2FQFA 1W8EA 2XZZA 2VLKA 4OECA 4N8UA 3SSGA 5I73C 5JZ7D 1FAKT 4EF9A 4N8VA 4E41D 2QCMA 6ALDA 1S7TB 4RK8A 3STGA 1N6VA 4HFUH 3BUDA 3ARBC 1L9MA 4AYGA 2CLZA 5B4MD 4MZIA 1T7YA 4JRYB 2Q9OA 3F6IA 3ESPA 3IFPA 2CRMA 3QUZA 3IDNB 3QJXA 4E38A 1U8IA 3LB6D 4S0HA 4MVAA 2CXEA 4UOJA 2EEAA 3EH4B 3TA6A 4EVNA 4BWWA 3PV6A 2A3CA 4H83A 1NC4D 4LTSA 3TV3L 3KXQA 4LVAA 1CXIA 2HJFA 4HJEA 5LIXX 4FI8A 4W9EC 1CFNB 4LHQB 4P5MB 2QF7A 4JMNA 3CQ0A 1DZBA 2PB1A 1RIUH 2UBPC 4E3VA 3FOMA 1WRFA 3SPCA 3WFEL 2PPGA 1MWAB 5IQ7H 2OJPA 3RX5A 1YDPB 4PTUA 3AXLA 1Z0NA 1TPVA 2E6AA 4PJIA 3OJGA 1HJSA 4R0LA 2NXZC 1ZUAX 1DVFC 1CVSC 4P5KB 3QBUA 5F2IA 1QBBA 4JM2A 3ROLB 1PX3A 4E9YA 3MDJA 1DJYA 4Q58C 4LCSA 1TZ8A 3BD5A 2CMRL 2YDQA 4FOUA 3EJYD 3SZKC 1BFVH 4TULL 2QDVA 4XNYL 4DOHB 1F3WA 1ZAIA 2H1PL 5D30A 4U1MB 3THML 4JTEA 2WXPA 2ATAA 3KWUA 4J4PA 1AGFB 3WD5L 2J1KA 5D70L 2J57A 1XGRA 3BN3B 1EB3A 4H4NA 2E6PA 1BXVA 4OGZA 2J56A 1R85A 1Z5YD 3R8HA 3NSCA 5FI8A 4FKHA 5IKCA 1QLFB 2A6DB 2QCLA 1AH3A 2D0HA 4GD0A 2C3ZA 4L56A 5IWLA 3TO4A 2EVIA 3LS4H 1NFDE 4QY8B 1LP9B 3QHNA 15C8L 4AIXA 2HWZL 1AR1D 3SOTA 1K2DA 4FQHB 3PG8A 1OARH 2J13A 3MRFA 4WK0B 1C8VA 1P48A 3SCMA 1C92A 1IC1A 4YFDB 3D2TA 1A7PL 5MKGB 1LBMA 5GRXG 1UG9A 3GBEA 3FCPA 4IIGA 1VGEH 3MZTA 1A5KC 4J3UA 1EDGA 3KZPA 4GQ9H 3S9YA 4HJ0D 4XCCH 3UYPB 5EB9A 3S1VA 3PAYA 1BVKA 1CFVH 4XE0A 5HR6A 2FSEA 3L6FA 4R7NB 2DT0A 5JYMA 3CFTA 2NZ9C 5I1EH 4XXWA 2E59A 4DTGL 3KJ4C 5I0WA 4K37A 1I1AA 2R2HA 1KNOA 2QUUA 1OX6A 3WDIA 3WO8A 3U4KA 3WLTA 3QR1A 4QNWA 1YEDA 4QE5A 3RU8X 3VJ6B 1IAOA 2FIQA 3H42L 3F4NA 3PGCA 1XH3A 1XMWA 2ENQA 3HBLA 5G4HC 2WLLA 1RAKA 5SWZB 2I60L 3EB4A 1E4KA 3F00A 7REQA 2X38A 2QV4A 4XZWA 1UG6A 3W1UA 5FLVA 5FHBL 1TWIA 2DYSB 5C0GB 3D39A 3SN0A 1R3JB 1NBZA 4BZ2L 3BG5A 2WXHA 3GW3A 3QEGL 1D7FA 2O4EA 2KHAA 4NKMA 2N7BA 2LVEA 4B4HA 4ML9A 2N7SA 4CJ0A 5C0AB 2WHKA 1JFQL 3QZ6A 1KJ2H 5I6NA 4HLZH 2JJVA 2DQUH 2QVFB 4Z1DA 1PDYA 1ISZA 1UCBH 4O14A 4MD0A 1N8ZA 3WEXA 3AIBA 5HGDB 3PHOB 4PRWA 1JF1A 4TPRL 4O4YH 4F9JA 3T0BA 2X88A 1XIGA 2R82A 3FB6A 4F7TA 4NO3A 3UO8B 3QLDA 3R8QA 3AXIA 4CRPA 3UTPE 4BWLC 2ZP8A 5FYLE 5AB1A 2KX9A 1I3GL 4FFYH 2Q5BA 3WDPP 3OF6D 3LZ3A 1KT2B 4JKNA 4PWEA 4QRTA 3VRIA 3P0YL 4HIIA 1O75A 3EYVB 3UNTA 4MMYA 3KWWA 1U91B 4GG8B 4N68A 2HRPH 3O05A 3HS9A 4GSQA 1CT5A 5DXYA 2XWJB 1KBKA 3ANYA 2FJFA 1TJIH 4WGVB 1J5OH 1CF8L 4OM0L 5KYUA 2W07B 3VZYA 1Q9LB 3PAVA 1SEQH 1D5MB 4OY9A 4P23B 2XG5B 2P26A 4NJIA 4FLOA 2W9DL 4GRWH 1CLOL 3MOAH 1HKFA 1AKJA 2RA1A 4N6QA 1Q9OB 2AMXA 1TKKA 3GU1A 2Q6WB 3UJJL 2DQDL 3VQMA 3DA0A 4GP8B 3JU2A 1HKLH 2C3XA 4YDJA 3I75A 3ITLA 4JE4B 4PMUA 4FKEA 2AVGA 1TPEA 3CPGA 2JKTM 1P4UA 1SDAB 5EBWA 1PG7H 4PJXB 3EOBA 1WBZB 4IDLA 3QS2A 1F4WL 2DP3A 4GKNB 5IHUL 5AZ2L 2NX3A 3Q2NA 4Q56A 5L6YH 1AHWC 4BFIB 2YLLA 5DUBB 3ATYA 3U30B 2PD5A 1QABA 4YWGL 2ZCGA 3X3FH 2AABH 5D7IA 1H8SA 1LEGB 4R4FL 4S3JA 1W2VA 3ZYZA 1LQSR 4QXTB 1INDL 5JLZB 2VURA 4NNPL 5HYJE 4Q22A 5CZVL 4AC2A 3VXUD 4DLFA 3GZPA 3HQOA 4L3EB 3PWPD 4GJJA 1ZWIA 3ARSA 4L4TE 2I9EA 5K39A 1E50A 4P2QE 5FX3A 1HH9A 5ICZB 1WC7B 1ERNA 4YSTA 5GGTL 3VW3L 1HWGB 2DSWA 3TZVD 3IK4A 3F7YB 1HGYA 4JN2B 4ZXBC 5ANMA 3R4DA 4HNUA 3NH7L 3S4SG 2SEBA 1KLZA 3FYYA 5AC5A 3L0GA 3HQ1A 2CBUA 1BQRA 3OIHA 1T03H 4KROC 4TTUA 2X4TA 2DW6A 1ZCOA 3K4DA 3VFWB 3UO1L 3SFWA 4W6XB 5IFHH 3SGZA 1CE6A 3FU8A 1AMYA 1WPCA 3DBXB 5HPMA 1EIXA 3QQ3A 3ETBJ 4URKA 3WDRA 4MZYA 1JFXA 2E3VA 5HDBE 3QIWC 2FYMA 5MF5A 3W07A 2JJWA 3OKEA 1SF3A 3C8DA 3F83A 5AZUA 2K6ZA 2HSIA 2WSRA 4YWIA 2GTZB 2BNQE 4ATLA 3GSVB 1B2WH 3BW9A 5IVXE 4X9HA 1CGWA 3P40A 2C7UB 3VX0A 4G82A 3F7PC 5EU3A 4Q7NA 3GD1C 5KVDE 1GQJA 2ZKXA 2Y1YA 3QOMA 2FGBA 4PZVA 1G1KA 3O6KH 3EWXA 3EJPA 2VLKE 2XFXA 3ZKNC 2Y7NA 4FG4A 1KPRB 5GJPA 1UXWA 2ATPB 5DRCA 3O2DL 2J7EA 2XVLA 3SGKA 1AKPA 2WP3O 4C90A 4LKCA 1KPUB 4F2MB 4NT6B 4EMZA 2OM5A 4GBXB 5E6ID 5IW3A 2VZVA 1VRSA 2Y07L 3A6BL 3HB3D 2EE0A 3THQA 4M6NH 1O0VA 4J1UB 1F3TA 3MJ6A 2C1HA 2F84A 1KG0B 3IEBA 4DWSD 1DCLA 4AHPA 1UA3A 2ROXA 3BUYB 1TVBB 3KR3H 5B22A 1XSKA 2J1ZA 5DN1A 3P30L 1R33A 4J27A 5MI0B 4FXLA 4R8WL 3GNMH 4E9SA 2ZYRA 4UT9A 3RU8L 5G1TA 4PBGA 2WQ8A 2J3SA 4U6VL 5ABDE 3DRQA 3C60B 3E2SA 4XMLL 3QPZA 3RVXC 4WKZA 3FV9A 2R27A 4XAFA 4NP4H 4LT7A 4KNUA 3S2MA 2A9NL 3G3DA 2J6VA 1NAMH 4ZSUA 2NYKA 4HYWA 4Y9PA 4XH2B 5BJTB 4PJFA 1CL7L 1D7DA 5AW7B 2DF3A 3JTSA 2YRLA 3TU9A 4PJIE 4OV5A 1XAUA 2ZXBA 3GS6A 3N1FC 1UP3A 4NL1A 4JO1L 3HI5H 5FJJA 1JNJA 4XP5H 3RNKB 2Z93A 5JOPD 2AL2A 5D5MB 2BX5A 5FYJL 1W3IA 4IFKB 4IFOA 3SY1A 4O57A 3WLWC 1SN2A 2LOEA 3ZYOA 2HUHA 5HY9B 5E94A 3H7LA 5D7HA 1LTXA 2XKSA 2JKSA 1QNIA 1CCWB 2ZDSA 1MPAH 4PJBA 5BOFA 4ELMB 4A05A 3D25A 1BJ1H 3B0XA 4WGKA 3MGTB 2ISSA 4BR1A 3Q58A 4YX2L 1W1IE 2PI6A 4QRAA 1E6NA 4WEMB 3ZDWA 2Z3FA 2VITA 1PFOA 1YC7A 4OZIA 1VYPX 3EAKA 4PGEA 1C3FA 3UTSA 4CNTA 3DURB 3VA6A 5DJ2A 3Q1SL 5DJYB 2KBGA 3L3OB 4OZ4A 2WB5A 1TVHB 1VD6A 1PWLA 2Q6ZA 6A3HA 4L4VB 1URZA 4N9GA 4WEEA 1UOWA 4M8QB 1YPXA 4OKVA 4JKMA 4NXKA 2W8CA 3W5MA 3CH9A 4HUUB 4RDYA 3CVIH 1J11A 4QRRD 2AW2A 4IG2A 1UZ8B 5KBDA 4M62H 5F8QC 2FTYA 1BQ5A 1ACXA 2H6PB 3R1GH 2CNZA 3OGVA 4XTIA 4OFVA 4BK9A 5BVPH 1NMAH 2Z1PA 2W60B 1UWXK 2P52A 4GNKB 1RLWA 4K8RD 4HNLA 4KFPA 3LTVA 4U31A 3H7BA 5T1DH 5EEXA 4NQUA 3FXIC 2YARA 2YLAA 1PKQB 2NZ1A 5B1JA 1JTTA 5JW5A 2AGJH 3LRKA 4NKOB 1XX1A 4XSMA 4J2MA 3A5FA 3MV9A 5D1QD 1XRSA 3KBEA 4RIRB 5DRWA 5IVXF 4LF3A 4QTIH 3BZEA 3IRDA 2PP3A 4YOKA 4PUNA 1KENL 3IKCB 1NAL1 4GIEA 1JVKA 3AREB 1ORQA 2D0GA 2VQ1B 5G55A 4P8QA 2Y7GA 3FUKA 1PEZA 3L8QA 2NY4C 2VDOL 4B3ZA 3S34H 5D2XA 5E0CA 1PQZA 3MV7A 4K0OA 2BSBA 4IHBA 3D39E 4GVIA 5DQDL 2OEKA 1NIUA 5G5DA 1V7ML 1UJ3A 2GWGA 4NU7A 3P4NA 4NRZB 1LBLA 2NTFB 5ABHA 2V0AA 2EC9U 5CJOL 3N15A 3B7RL 1E4HA 1VFBB 3U9PH 4LV9A 2XJ7A 4DZIA 2CGRL 2K70A 1AH4A 4YAQA 2QVKA 2DTSA 1UFGA 2VDNL 3QUXC 3TYCA 2QDGA 3QFJA 4WOZA 3ULUD 1H0IA 4MF4A 1DVSA 3TC7A 1G6RH 2EKSB 1OYBA 3CFCL 2FX9H 3K4WA 3OMAB 1DWGM 4FA7B 3IJQA 1UWEL 3BVJA 1CFSA 5F7LB 3HMWL 4M5SA 1JVLA 2EXOA 3BXNB 1XP3A 4HEMA 4KTGA 4WY7H 3CYJA 3VXTA 2VXSL 3I9GH 3KVJA 2PYEB 3NQKA 5DK2B 3VCLB 4J2PA 4O1EA 3QYQA 8RUCA 1Q6RA 2ZF9A 4Q9QH 4LYKA 1FFQA 3DPDA 2CDFA 4FXKC 5F1SA 1MYRA 5MP6H 3N4EA 2IPJA 3QRFM 5I8OL 5K4XA 1FYTD 2RDWA 3IVUA 4PJIF 1YEWA 4F7MA 1PMYA 3X11A 2FHBA 3C6SB 4ALDA 1SXCA 4JM2F 4UCGA 1SHXA 3G1AA 4J28A 5CAKA 2PTWA 3EYQC 3SPVA 1P5VB 3LAFA 3RDKA 2EDRA 3MUZ1 1BOGA 1YG9A 4MBRA 1XWYA 3MRJA 1CZ1A 3SE3A 4RFNB 2Y9RT 4UYQA 1TXKA 2RACA 2QHLA 1G5AA 4MKTA 1Q2SA 2IDSA 4HKBA 3ITGA 4WFGE 5DC4B 2AI0L 3RNQB 4PFEA 2DW5A 1FGVL 2HXUA 3M5VA 2QUNA 3ES8A 1JHTA 3CXFA 2HH0L 2V3GA 1H8OA 1EEYA 4L8BB 2A73A 4ALAH 1ASOA 3S5LG 5DF0A 3SR7A 1RUQL 4RNHA 5K5YA 4UTJA 4P5TA 4PBEA 3A12A 3GMMB 4Q7DA 3UR5A 4RDQF 3EO9H 1S4IA 1ZEAH 1A7NH 4AMWA 1FH7A 2PF0A 4XOBA 4MB4A 4KXZH 3A6OA 3VB9A 5D7IE 5C0JB 4K9EC 1O7AA 5F9OL 2F19L 1VC4A 2J5LB 2OW7A 3HVDA 1W8GA 4YTTA 2X3BA 2W4XA 1LWRA 2EH8H 3P1VA 1ALDA 3UWWA 1I7RB 4QLWA 1LM1A 2RQ8A 1LJMA 4WO4A 1ADQA 5K9KB 5IUSA 3SB0A 3GVVA 3UBPC 3WNOA 3DVGB 3K6NA 3NR0A 4GW5A 3CK0H 5ANME 4X6DB 2WTPA 4MZ3A 4LUSB 1OFDA 3DX6B 3P84A 3A3HA 1I8KA 5IOPA 2C34A 1D6VH 2FO4B 1W6WA 2C0HA 4QHUA 4Z3HA 2BX7A 1A4CA 4DGIH 4JPWH 4MAYA 5K69A 4BQ9A 2IH9A 5E9NA 1RUPL 2VX7A 2MNRA 1A6UH 3D0AA 3NPUA 5ERWB 2GFTA 4J12A 3T3PE 2XH7A 2KUTA 4V1DB 4RZ4A 3D3FA 1AOZA 3E6FB 5DZNA 1EPFA 4FYRA 4N0CC 2DIAA 3RZWA 1P9MA 3VWKC 3H9SA 1XDTT 4DN4L 3B0YA 4GS7B 4Z76A 1E8XA 1DBKH 2LU5A 4YHML 4QHRA 3K1GA 4PRNA 4E2DA 3R0MA 4X6EB 4NX5A 5FKYA 4M00A 3BGGA 4ZW5A 1ZENA 1AD1A 2J44A 1E0VA 4CSSA 2VFHA 4WJ5B 1HL4A 5HHVH 1KNWA 1MQKL 3QBTB 5E1HB 2UV3A 3LSOA 4CCZA 4W5ZA 1EXPA 3Q06A 1LRQA 5AC4A 5GS0D 4XVUC 4E42B 1L0XA 1VADA 1J8RA 2BXZA 4E0RB 3KWTA 4EN3C 3WNIA 2P43B 4FQXC 3N85L 2ZYSA 1KZYA 2C91A 5T1LB 4BINA 3UBFA 4IGBC 4G6CA 2XTJE 2FPYA 3R94A 4JRYD 4X4YB 1YY8A 3TONA 5LXVA 1VKXB 4LESA 3BKJL 1GZGA 1BAFH 2QSVA 4QR7A 3JWOC 2ZJSH 3VFVA 4W86A 3O6FB 3CEPA 2C8NA 3SYPA 4IIFA 3QISA 2KPNA 3A9BA 2AKRA 1RZ7H 4XBPB 3V0IA 2FIRT 3WD1A 4NZTL 1AR1C 3GSNH 1DL3A 3DGRA 5JW4N 5AHFA 3O9WB 1CD1B 1IEBA 4S3EA 4WSGA 4TL4A 2JLPA 3HZVB 1W5PA 5I02A 3ULSB 5LUMA 4HNCA 1VFLA 3QUMH 4BKLB 2BSTA 1AXTH 3LQAC 4QGYA 5T9CE 2ZE3A 2B7PA 4KK8C 5FM8A 3L3DA 4DZ8A 1H3WM 4PJFE 3LXUX 2XQBH 4MMXA 4PY8J 4NRXA 3HE7C 3MOBH 2YAEA 1OV8A 3RWGB 1GPOH 5EZJB 3ABMB 2CR6A 1T21A 4HZAA 1XBYA 1DYSA 5FYKD 2Y4SA 1M6UA 2C13A 4FERA 2YGOA 2FZNA 1XLIA 1FN4B 4ZOBA 1HKWA 4AK2A 4GYFA 1U8OA 1TQCC 3NA9H 4PJBE 1QLRA 5KBMA 3E49A 3UAAA 2UZXA 2A9BA 5KVFH 1D7CA 3MBXL 2D2JA 2OELA 1T6MA 5GGVY 4BKNA 4ZMOA 3KDNA 4A2DA 3N9KA 2V2WB 2PTTB 3UR2A 3ZZSA 1SDDA 3UTSE 4AXNA 1QO5A 2J8GA 1OLLA 3QXAA 5CC6A 4HUXB 1NM9A 3Q7JA 4R90H 1UH4A 1H5VA 3CGTA 4KK5D 3MJMA 2MNJB 5EWIL 4Z42C 4JNXA 4MFEA 3JVFC 4M24A 2XIBA 2ZX7A 1A5BA 2ZZ1A 4I18B 4X2PA 4FNQA 3E2VA 5DFAA 5MHSE 4AL8H 5KVEH 2OZ0A 5F7HA 3LD8B 1SVDA 2UZIH 1T6WA 3V0HA 1A8JH 3ZT5A 4PTMA 1US0A 4OLUH 1IGJA 1UEMA 1F00I 4YSQA 4BEUA 4DIAA 3SPHA 3T3PF 2FH6A 2C3WA 4Z78A 1RCQA 4UM8A 5AHMA 3NDZE 2XTSA 3HN8A 3BLDA 5I00A 1L2QA 4RSYA 1N5AB 2M2DA 2ROYA 3MV9E 4PGCB 4X6CB 2DFAA 3W7QA 5GZNC 4NKDB 3BWZA 3QJRB 4YPGA 2W67A 1NCAH 5I5MA 5I3JA 4NZUH 1FC2D 1A8ZA 1AI1L 3ABOA 5DY3A 1A7QH 4I77H 4OZFA 5D1XC 3VUSA 4NQTA 1C7TA 4AVJA 3D2UA 4F0MA 3ZE2E 3SURA 4J6IA 4DJMA 3QT2A 4X5XB 1EX1A 5DSCA 1DXIA 1KN2L 2D2HA 5TDNB 5SWZD 3HC3L 3QWRA 3FX4A 4I48B 4WUUA 5TQ0L 3W0WA 4FNTA 3BVDB 1ODUA 3LN5A 1YEGH 1IAMA 2QLYA 1FZOA 5D2NA 4ASTA 3FMGH 3MV7E 5E1GA 1X5AA 2P1YA 1OW0A 1J88A 2X7LB 5HI3C 1KSRA 2G4JA 4ZQKA 3PVFA 3F62A 2QCDB 3Q43A 1V55B 2KLTA 5C0AD 4UU9A 2G96A 4L9LA 3TYZA 3CU7A 3HRZC 1MI5A 4LEXL 5EO9A 4N0UA 4FIQA 1T1WA 4ENED 3AOFA 2BOBA 3S88H 1MHEB 2PCFA 1S3KL 4KX9A 2BP8B 43CAA 1GOQA 5FM4A 3T55A 5DVPA 2ZRWA 3E02A 1F11B 2VDMH 4KNSA 4ZO7A 4JKPL 1ZANL 4LASL 4C1NA 5JH2A 3WQEA 4HEME 4LUTA 4IWWA 2OZNA 4DELA 2QJJA 5HJYA 2YK1L 4UTKA 1XF3B 4BK8A 1ZT7A 2YIHA 2X4PA 1WZKA 3DX4A 3NQBA 1NDMB 3GI8L 1K4GA 1IE7C 5SWSA 4DT2A 3VE9A 4G7SB 4JQ3A 4TUOA 3EBGA 3CV7A 3V52L 4PJFF 4H19A 3WX7A 3WK1A 1KYUA 1K6WA 2DDQH 3VDAA 4HPJA 3LKSA 5A3ID 3VWJB 2OP4H 3OJVC 2QF8A 2B2XL 5EBGA 1QEWA 1JP5A 1NF0A 3DKHA 4F2FA 1GOWA 4G56A 3C2RA 2QJNA 4GUIA 2H5UA 3CTLA 2BERA 4XNAA 3S9DB 3MLSL 1KFAL 3EX6A 1R6VA 1KJ2B 4C7FA 2XY2A 1KFBA 1G43A 3KPRB 4Z2HA 5F7NC 1NEZB 3RVVC 5E23A 3MXWH 1PZUB 1LILA 2D20A 3Q5TA 4P23D 3D4YA 2L4OA 4CN1A 5GHWH 4P05A 3LQGA 2Q8LA 4PRDA 2AQ1A 3CC5B 4OZIF 4MAUL 4IRZA 3FBQA 4DERA 2DI7A 1NCCL 1I7TB 5BNKA 1FWIC 4Y2DC 3NQFA 4MYXA 4JHZA 4LLYB 2LFEA 2FJGB 4PE8A 1I9EA 2YXOA 1PD1A 4POCA 5B3JF 3KL0A 3F6JA 1LOSA 2WMFA 1NFPA 5JDJA 2P80A 1TZ9A 2CLFA 2YPVA 1Q65A 4ZFGL 3NQDA 3N43B 3PB0A 1U2CA 2DEYX 2VN4A 3OLIA 5AOLA 2VFEA 2HVKB 4UB0H 1KV8A 1EC9A 1IBHA 4UTAH 1ACCA 3LRLA 2RDUA 1QTYT 2XY1A 1KBWA 5DBUA 1XB3A 3HA1A 2IW0A 3QA3A 4UQAA 1OHQA 4CN6A 1DKWA 3GQYA 4BRVA 4AOFA 3DV6A 2C3HA 3DDMA 3GC5A 2J1WA 1HKMA 2YRBA 1EJXC 1VPOL 2N59A 4OD3H 4WCYH 2PABA 4B5UA 3VOCA 3G6DH 3NSJA 4L3ED 3OBEA 3C5JA 3A4FA 3GXPA 4LPTA 4UQ2A 4GRWB 3WSQL 2ESCA 4OQVA 3AM8C 3OGRA 4HCRH 1JGUL 3BHBB 3SUVA 5CD5C 3B9EA 3GJFH 4R7VA 1QZ1A 2PWVA 4U1NB 2ZKHL 1MY5A 1M9WA 5EC2B 1YN7A 1IEIA 4DPCX 1XI3A 4U1JA 3OOQA 4P61A 2OMAA 5BV7C 4RAVB 3RG1C 1A80A 3CIVA 2WW5A 2DYPA 3CDGB 4K9JA 1KY6A 4H1LG 5AVHA 3VE0A 2ZF8A 4KKXA 4A21A 2XRAH 1A0QH 1XZWA 4FXGA 1SO6A 4WJKB 5JOFA 5DS2A 5H8MA 2BSSA 3C8FA 2KL6A 2GVGA 1WFNA 2AQ3A 4MSWA 2XIMA 4PYHA 3FUIA 3DIVA 4AC1X 5GSVB 5HYSB 3ZT6A 3AB0C 5KTEL 3NZ8B 1TJHH 5KSBB 1GOFA 2BO0A 5CFAA 3TMLA 3HLAB 4ZPTB 3S3DB 5CJ5A 2DQFA 1GGOA 4M5YH 5I07A 4PJCA 1C16B 3I02A 3L5IA 4WWKB 2GFBA 3PWLB 4NBXB 5EZLA 1LK3L 4D6JA 4KJPD 3L5LA 3RDTA 1JZEA 3QYNA 5AWNH 1AMXA 3QUYA 3RPKA 4GUQA 4GBXD 3M43A 3EF4A 3H6OA 2DD8L 1E7UA 3GVRA 4N2EA 2ASHA 2OQLA 1IGCL 2FEEL 3VU1A 2V7NB 4X63A 4D9RD 1WDRA 4BFRA 1GS7A 2FGZA 4UTMA 2XH0A 1PCXA 4KKLC 5I30H 3MODL 3PPEA 3C86A 3MBWA 3WNNA 3G0SA 4F48A 3MJ7B 2EDLA 1S7VA 3D0VB 1HE7A 3MJ8A 1E0WA 2EG8A 1Q7ZA 3F4CA 3DWTA 5CJBA 1NARA 3BUTA 1RUAL 3C60D 4L3CB 3GB7B 5CSSA 4S1DC 1XGTA 2V8MA 4KW2A 1NGQL 5J3HC 4HBCL 1RJZA 1XR8A 1QTWA 3GXNA 3UZEC 5IHLB 4JL1A 5FO7A 5L9DL 3TCLA 1T4KB 5HJLA 3VCNA 4OGAD 4DJDC 2YMXH 5KANI 3MSRA 2TRSA 1JL8A 2YC1B 3L2MA 4ODXB 1P4BL 4NQXA 4EO5A 3P3UA 3KBMA 3OGCB 1YHTA 4JDVA 3RJQB 4FZ8L 4EOUA 4OJYA 4QXUL 4DSYA 4YC2B 5F9WB 3OVQA 3S0PA 1UROA 3UJ2A 2J8HA 1XHHA 2HZGA 4FC3E 4ZTPH 5C09B 3ZTJG 2BVDA 1ONEA 4ZNEE 1N0XH 4BCYA 4HPGA 4CBZA 1IGYA 1KXTA 1JRHH 4WW2B 4NLHA 5AALA 4XN2A 1V6WA 4GO6B 1CLVA 4RMSA 2X0SA 4MAZA 2FTAA 4ONHB 3WJZA 1YN6B 3QUKA 3MTRA 1BWMA 2IPKB 1J79A 2HPOA 3AO0A 1DTNA 4BCZA 3MJ9H 4L4VD 1GQIA 5XIMA 3EDEA 1OAUL 1KQYA 1H3GA 4AJYV 1KYOK 1XTMA 2VR9A 1NAMB 4QGCA 1AZBA 4KUCF 1HCZA 4MLRA 4RNJA 3QMSA 3ES7A 2UZYA 2HMIC 4IJ3C 4HG4K 3BVUA 5EOCL 2WJ7A 1M05B 3PZUA 3Q9PA 2OT1A 3P7YA 5KINA 4U49A 1OGBA 5A6AA 2J72A 3MWAA 2BASA 1U8JB 1TZHA 4N2FA 3JV5A 3GHUA 3PZTA 5K1JA 1Q85A 2OZ4L 4AIZB 4CCEA 3S3BB 5BNXD 5DTFB 1CGXA 4KK9C 3H12A 1R0AH 3TSDA 1TVPA 4HHPA 2YBGA 3N44B 4KRPD 4HGWB 1DSYA 2CO6A 3R8BB 3FRUB 3L2IA 3TWBA 2VM8A 2W6RA 5B7MA 1JNEA 4IKKA 5D9MA 3ARED 3AIVA 2A77L 3EYFB 4WUUE 3W0WE 4QDWA 1ZP3A 1GHSA 4JTDA 3PFQA 2QBWA 2Y3AA 5AVTB 3KPLA 3FCSA 5KG9B 1EO5A 4EQ3A 1UA6H 2LQRA 5ID0B 5T33L 3RYMA 3KZ8A 4M02A 1TZZA 4CSPA 5GNYA 2F8QA 3RGVA 3OODA 2JH2A 5EPMB 4NFCA 1K3ZA 4UQ9A 5FA3B 5CGYD 5LNUA 2PD9A 1O6SB 4NXSA 1DBAL 3V0FA 4MCYB 3X14B 1QPNA 2R1MA 3MUY1 2G97A 3WD3A 1A3LH 2OSXA 4F40A 5FKAA 1YLBB 2BP1A 1ZGLP 2GSGB 1I85C 1IAKA 2PYED 2E76C 5IHZB 3GLZA 2QADC 4ENLA 2JJTC 4OCYL 2X9WA 4UQ3A 5FB8B 4KJQC 2LLNA 3BAEH 2Y7EA 4D71A 1I2NA 4EI5C 3B7UX 4B9FA 4XNUH 1TPXC 2QR0B 3SE4A 4WU7B 1RY8A 3PANA 4IIDA 3OHXC 5M17A 3OPSA 4MA8H 1TNMA 3U6XS 4QI3A 2A3AA 1ZLSH 2B9BA 4JW3A 3W86A 2DQTH 1RKRA 4FQ2H 5E0KA 2VRKA 1NF7A 2JGYA 1W9UA 1PXGA 1L8NA 4IJCA 1M7DB 4AZ6A 4F7CB 5I1DB 4FLSA 5HJ3A 3UVAA 1NC2B 3TR2A 1VLWA 4ZUTA 4U5KA 3TMQA 1KXHA 1LDPL 3W11C 1JERA 4FG6C 2YGYA 1MCHA 2QDWA 4ERSH 1G6RB 5IROD 4DYKA 1E6QM 5C92A 4ZI8A 5E51A 5I6OA 1CXKA 4KMLB 4O2FA 5BOOA 3GSXA 5F1OB 1IM3A 4A66A 3USBA 4O19A 3MGOB 3CSYA 4ZMLA 3T40A 1ZHLB 2IPTH 4HYRA 4GCAA 4KZDH 3MBEA 3P67A 4AMKL 1FJ1B 5CO1A 4XCEB 4JY6A 2BVQB 3H4GA 1T3FA 4HFWA 2XWBB 3C2AL 3VGAB 4ZUSA 2Y6ZA 2YYUA 1HP5A 2VEKA 3LNEA 2HLAA 4G80B 3SQBA 4HQQH 1TFPA 4UTTC 3VGGA 4OM1L 3PXHA 1MMFA 1M68A 3U2EA 1T89C 4S3DA 5FGCB 2NW3A 4WWOA 4YQXH 1RK7A 4NO5B 2PTXA 1E6OH 2FWOA 3F12A 3LV3A 4WDIB 2BB0A 4WDTA 3LIZH 4YHEA 5F7AA 1TQJA 3H53A 3MTWA 4CQ8A 5F3HB 4FABH 5GIRB 4M7LT 4ES8A 5LXGL 4KZ0A 4MJIB 3DK2A 3T4YA 2XXGA 3UYRH 3OG3A 1Q90A 2CXGA 4LVNC 1TPWA 2X4UB 4G83A 1DDHB 2PXYA 2X53A 4ZEPA 4PMQA 1RVKA 1RZGA 1TWWA 5EMUA 4O02L 1D9EA 2XTKA 1TRIA 2XPKA 4Q8WA 3W82A 3E5PA 2X42A 3A21A 3MRDA 4MNLA 2IIJA 2K7PA 4ZFMA 2D03H 1BX2A 4MB3A 4V1DD 5D6DA 1S2EA 2B1AL 4LH8A 1QQDB 3CH0A 1HEHC 3WO4C 3E8VA 1NUFA 4QKXB 4XN7A 2V3EA 3H1ZA 1Z9NA 2UY3A 2DU2A 1SMOA 5TAOA 1JXFA 1MHCB 3VD4A 3SY5A 1DR9A 1I1FA 1BXXA 3KPOA 4KXCA 5C9JA 3ILEA 4D0CA 1YUHB 2NLYA 1BWLA 4X4MA 3WJLC 4PJ8C 3FTVA 4PLKD 5F7YC 4PJCE 1EAPB 2CK2A 1V4YA 1INEH 5JU6A 4DBWA 1NIDA 5KANG 1F42A 1MAJA 4HEPA 4X7SL 1HKIA 4NUJB 5I76A 2V5BA 4LV4A 3F2CA 5T1LD 3VFGL 3EWDA 4PWIA 4L37B 5EMJA 3J27A 3C5ZA 1O1HA 3PNZA 2WY3B 1GQLA 1GGUA 4LOFA 2CU9A 2FFIA 3NVQA 3O6FD 1OGTA 3RIAK 4JZNA 3P4LA 1ZLPA 1SJEA 1Q72L 4O18A 1TKWA 2OJ1A 4P2YA 3A4JA 2YJQA 2Z8WC 4UAOB 1E6PA 4PB5A 5DBTA 3ITOA 1KUMA 4KGLA 4N9OB 2R8SH 2JI3A 4X80H 5AKVA 3T6CA 2UZ9A 1PTAA 2HBVA 2AEPL 4DPBX 3O9WD 3UJRA 4MKMA 3T65B 4BFNA 1BVNP 4KQ4H 3MLRL 3OGOE 3MUIA 3NGFA 2VDPH 2Q87A 4EPKA 4OBRA 1DBJH 4B27A 3HHSB 1R46A 1UCTA 3BTNA 1AQFA 5DD6B 4X9BA 2IANE 2YPIA 4JFPA 3KOFA 3VTRA 3AI0A 3CFBA 5F88B 3ML9A 3ROOB 2JIXA 3HR5A 4I7VA 2V2CA 5T5FH 3RVTC 4JTHA 4XWUA 3I85A 4H4IA 3DI2B 3C5XA 1MREL 3D3AA 3PBWA 1SXNA 3ILQD 4YXLH 4FXSA 2ALWA 5C0CA 3CIAA 3VFLA 2ZZ5A 5T26A 4PC8A 1WNOA 2N3JA 4DK6A 4RGOL 1W72A 2QDDA 4Z7NF 1J1PL 4Y1AA 4GFSA 4TOQA 4CSZA 1JNHB 3JVGA 2QKIC 4K7YA 4TV5A 1B3JA 4X6FB 3GSNB 1NLDL 1PKMA 2OGYA 5C0QA 7XIMA 1AQDB 4N2HA 4D9PA 4S1SL 2XV2A 5H37A 5E00A 1N4XL 3CWOX 3TM6A 1PS3A 4XP4L 4LFHG 1EVUA 5HQMA 1WG3A 3W22A 3ARFC 3QUMB 1AD9A 4DKAA 5IIEA 1HYSD 3IXTB 5FL0A 3SRHA 1IWBA 4DEPB 1R3YA 3IDXH 2IF7A 3IGAB 4C58B 5C2UB 2G3NA 2B7QA 3S3SA 4J40A 5DFVC 1GY2A 3RLSA 1UUNA 1XYLA 1YY9C 1OX4A 3S96B 1DQLL 4GZEA 1RZKH 1MW1A 2YDAA 3QDMA 5DFWH 1JGDB 1U3HB 3UESA 5I6MA 4R4BA 1RY7B 4PH8A 2BOCB 2HT2C 3LXBA 3VKCA 2E5EA 2VZOA 2DZXA 4F15C 3OKNB 2DWTA 3D33A 2YKLH 2Z25A 1CDYA 3BW2A 3CTTA 3NO5A 5CN1A 2VLMD 4PJ7A 3RILA 2R51A 4YSRA 1EVTC 1LUCA 2VGGA 1A65A 3MFFA 3N1QC 4AJVA 1KPVB 4WUIA 4PJCF 3LHYA 5DHDA 1BFOB 4TOYH 3OO2A 1JDCA 1ELSA 4DQWA 3LERA 3WYRA 2P50A 5TE4H 3BCJA 3O1NA 3C0QA 2VN6A 4LNRB 1WQVT 5C0BA 5DZAA 2Q7NA 5LGHH 4KHXH 3NCCB 1MHPH 3ZTEA 5DMGC 4EUPA 3PFUA 5A16A 4B9JA 3GXMA 3AU2A 3WBXA 1FI8C 1SYVB 5IB5A 3PLYA 1U42A 4JDEA 3S98A 1G87A 4D9LH 1A7RH 3O8XB 3U6XA 4WI0A 4B5VA 3U4EB 1KIUB 3JZEA 4HGKC 2YN3A 1E9IA 4P3CH 3MRHB 4LSUH 3O11B 1H8NA 3BGAA 3JTTB 3RCNA 2R69A 4BE5A 3TNMB 1Q63A 2XZQL 4YHIA 4WHYG 1HXJA 1RZIB 2DVTA 1HWWA 2NY2B 4DF1A 4M3PA 1LL1A 1EUNA 4ZUVB 1OGPA 4CC1A 1LO0H 3TBSB 4Y90A 4UYPA 3ELFA 1EQPA 1KULA 4E9VA 3VWJD 4PUKA 3IMWA 4FP1A 3ZZLA 2XQYA 1MFEL 4Y4HB 1U95B 4ZODA 3LBOA 4C6DA 4E3TA 2ANUA 2EPNA 3Q37A 1QMLA 4H8UA 2WO5A 5CHNA 3S2CA 4RLIA 1QOPA 1BQLL 2E6QA 3FTZA 1QTPA 3BZFB 3EKLA 3GDKA 1KEML 4X0VA 3KPRD 3MA9L 4P8WA 2CLMA 5LA1A 2VSMB 2IJ0C 4FDWA 2Y61A 3BWUC 5E2JA 4MFHA 1XCTB 4AY0A 5ABEA 4EIZC 2DQJL 1XGYL 1Q94A 1K8XA 4HWEL 5LGYA 3K2MC 2A5UA 4PS4H 2JKIS 3MSGA 1LE5B 2VDMB 3KLDA 2HTLC 1AFVH 4M7TA 2UVFA 4J3SA 5E8PA 3WI9A 4HV8B 4HIQA 2FBJL 1F58L 1NFAA 5D71L 2NY7L 4NCDA 5FSEC 2QYGA 3VUPA 4GE8A 3PWJA 4YHZH 2DI9A 4G3YL 5H6HA 2V82A 3H0TB 2YSSB 3QO1A 4QJ3B 1KC5H 2WUBH 4AH2A 5BOPA 3O15A 4L4JA 3WL9A 4HS8L 2UY6B 2IGFL 2WNKA 1X9QA 3ZVHB 2VLJA 1KIPA 3MRCA 4JFYB 2ZRZA 4WFEE 1JPMA 4RWHA 3D85B 4PCPA 4PRBB 3MRBA 3TN5A 3VB8A 5AC8A 1LYXA 1XIDA 2OT0A 3CUXA 2D3JA 2AGKA 1Q8AA 1W6LA 4M5ZL 2BY2A 4L5FE 2WINA 4DJFC 4GBXC 4LK4A 3MA7B 3B05A 2VI0A 2PWGA 3N6JA 1JGIA 3QYSA 4IQDA 4G43A 4IQLA 1ZL1A 3DGDA 3BWAB 3MRGA 2RGLA 4NQVB 1JFHA 1MEWA 3T6XA 5T8GA 3JWDH 4RGMB 2ZCLH 3TVAA 5HDOA 3GHEL 2P8LA 2YX0A 3NJGA 1WBHA 3NA8A 1SLVA 4JKWA 2R1WB 2R4RH 3ISYA 2FEJA 2WIIB 2FIKB 3GQFA 3EZ8A 2QQLH 1MFNA 5AB0A 3ZDYB 4RMQA 3BDKA 3RX4A 3LYRA 1HHHB 3V6ZB 4ELDA 2BSRA 1HHJB 2OTWB 1I4FA 2IC2A 4HKJA 4QHNA 5ESQA 4OBTA 2WQWA 4LMQE 4O1FA 3KBVA 3W84A 3RDJA 2GJXB 1OAYL 3U2SA 2K45A 4W7WA 1F4YL 4Q4QA 1L8PA 4TNWF 3S37H 1I8LC 1IE5A 3NFSL 4H9MA 5LG1A 4IQJA 4AWSA 1Z42A 4OU1A 2R8WA 5TQ2H 2O9PA 4K9EL 4F7PA 2ON3A 3JW7A 3PTMA 2JCWA 4OTXH 5DT1L 3VILA 4PI0A 4X4ME 5HGHB 1RY0A 4YLQT 5DJ0B 3VFMA 1CC3A 1FWNA 4PG9A 4WWKD 1LVEA 4O0QA 2DWXA 1AQKH 1SHMA 4OD1H 3GJFB 4Z8FL 3BW4A 4F3FB 4ZTOL 1XSJA 5CZKA 3GBML 3NJXA 5C3TA 5BZDA 1MLBA 3KL3A 2DLHA 4F2BA 4KRPB 3MGAA 3PB2A 3BFOA 3TYBA 2YXVA 3GD6A 4XTRD 4GB9A 3EPNA 3EJZD 3HG1B 2E6YA 2F74B 2ZXQA 4R7WA 4YZWA 1YBQA 1JZHA 4JEQA 3ECVA 4DYEA 5EU6B 1RPXA 4Y8AA 2XC8A 4GG6B 3PL6A 1TTUA 5GRVL 3OSKA 1FCQA 2LE9A 3UJTL 3ZDXF 3RIFF 1JGMA 1X5HA 5D9OA 1KCSH 4JG0H 2ICES 4DW2H 1LE9A 4XB8A 5D96B 4N25A 1ES0A 2AV1B 4LCVA 1FFRA 1VZIA 4N2DA 5D1ZA 3MZNA 5FYJU 3Q94A 5F3BB 1AP2A 5EDXA 4JQ4A 3L5WB 2WLHA 2OQJB 2W91A 3RTLA 2V67A 4LUJA 3D12B 4IIBA 5AL0A 5KEZA 3INUL 3MBFA 4H0GA 1XD0A 5FAGA 1FP9A 3AG3B 3H24A 2NR6D 1E1CA 1RHCA 1LF1A 5C0CE 4OUUA 3UGXA 4XPAH 2CERA 2VR8A 2CHDA 1OGGA 2YGPA 5C09D 4YHPA 2CLOA 4FTDA 3P9MB 4LS1A 1QHPA 3JWOL 4Y1AE 1Z0MA 2YXMA 4HIHB 4KQNA 3C8KA 5D2VA 3FPXA 5J0BA 3PJXA 2A0NA 1U58A 3UDWA 4HWNA 2I7SA 1JWSB 3C6LA 4IOFD 4ELKA 2V5KA 1GEHA 2YBUA 1EFXA 3H4HA 2QV2A 4CLMA 4UNLA 2DQGH 4M7KL 1THFD 4EXKA 2ADYA 3RWHA 3THUA 4Z7VA 1VH7A 2MSPA 3NPVA 4B92A 4XGZB 2DSUA 2XWRA 3IJSA 3CXDL 4XAPA 1GC1C 4HX1A 1QTSA 3PU7A 1WQ5A 3I2CH 4OV4A 1X8CA 3ATZA 1NCNA 1E6JH 3CUHA 3QULA 1W8SA 1W1VA 3PS6A 5DYOB 5IGXH 2MCPH 2A74A 3IJ8A 2PPEA 3OZ9L 3QDME 4I9TA 4L6DA 1JZDC 1SXBA 1TYRA 1ZSHA 1T1ZB 1RZFH 2EAEA 4EEEA 3MV11 1BRLA 4JL2A 3G2GA 3LKOA 3UIYA 2A3BA 1AGBB 4HIEA 4OB5L 2Q8XA 4AUJA 1XQLA 5C71A 3AXHA 1OVDA 4PJEB 5AG8A 1L6WA 3VH8A 2OMZA 4PJ7E 4PVBA 3F2LA 3TVMC 2QUVA 2W0KA 4AQZA 2DQHL 4NRYB 2PP9A 3PF3A 2R23B 4NBZB 3C5SB 1FWBC 4G70B 1S1RA 2PPAA 4YFLF 2A38A 2VR7A 5JZ7C 3CYVA 2FD6L 4BQCA 5KSUB 3RX8A 2W0UA 1PD0A 4HJ1A 4NNYB 3C6CA 5HMEA 4G72B 4U1HA 1E4JA 3P73B 4M80A 4JFHD 1GOIA 1A9EB 4XHQA 5B4MC 4FX7A 3VXSB 5BQ7A 2FMOA 3Q8AA 3LB6C 3NQMA 1NIBA 4K3ZA 2FZ9A 1Y18A 2VENA 1EANA 5CM1A 1PDKB 3W1ZA 3FVDA 1FWTA 1PIFA 2GUBA 3MRMB 4Y9BA 3PHQA 3TN4A 3L21A 3MLZH 1C8YA 5A43C 3BKCH 4JGUA 1VEMA 1U93A 2JTDA 4JZJC 3FFDA 4JFOA 3G18A 4KKBD 4ABUA 4GEIA 1JZIA 4LCUA 2Z0IA 5C7VA 3ERXA 3MN8A 2LFGA 3QGVA 4G5ZH 3N2MA 1UUQA 2QGCA 4GEJA 3UBHA 2VDLH 3WXWH 4NO0A 3S1WA 4N24A 1EEQA 1ZK9A 4JYFA 1K4DB 3G5VB 1Q6CA 3EJYC 4KK6D 2AS5M 3X13A 2Z8SA 3QDGB 3V7MA 3B56A 2ZUQB 4IUOA 4RW3A 1WTGT 3KXFB 2E27L 1NC2D 4XBEH 1MFVA 4J8QA 4KFZC 1AH1A 1HEJC 1BEUA 5T3ZL 3W26A 1GZQA 3VAEA 1WKFA 1VPXA 1IGWA 1BYCA 4K15A 1KRMA 4ISVA 5CC3A 2BGNE 4PRPB 2EIJB 4WTQA 3B2VL 2C0AA 1T5XA 2VXQH 3BVVA 4K3HA 2X1TA 1JE6A 4L8SA 3GLAA 3L3HB 3GMRB 1B3WA 3L67A 1PYWA 1K03A 4OR1A 3B6SA 3IDMA 1M04A 7CGTA 3CEUA 3QJUB 4PRHB 3VFTB 1NJJA 4R85A 3H23A 3K2KA 5A2KH 4L9YA 1IJNA 3DO7A 4E9WA 2PLTA 4XD5A 1WXYA 4J3VA 4F2UA 3BP7B 4ONFH 2AJZB 4NNXA 4YHYB 2A21A 3QIUB 5AHEA 1ZLUH 3KBFA 3KVQA 3PGDB 1EJ8A 4N5ED 1O60A 1RULL 1SXAA 1FWEC 5CP3A 1G5GA 2NX5A 4OLZH 4UNIA 4A2FA 2AAMA 1E27B 2HJKA 4HJ0C 3L7RA 2PW2A 3STZA 4JFFA 3FT9A 1D3CA 2NNFA 5B3SB 3H6AA 3LRSA 1QU4A 1R5IA 3BMXA 3W9DB 2C4FU 4M19A 3FXGA 2C1OB 4MTVA 1KFLA 4NQSA 1BBDL 4XZUA 2PW1B 4E9QA 2PP7A 4HYTB 4JQXC 4PJ7F 4IEFB 2FWUA 3VNMA 1HEZA 1OB1B 2FT8A 1TZIA 2EYTB 4IBVA 4MJID 1DQDH 1EEPA 2JB5H 1XF5B 1XF1A 3VI3B 3V35A 2EEXA 1U8CB 3SDAB 5GGUB 1KA9F 4H25A 1NBCA 4C5ZA 1TV3A 1F0LA 1Z9AA 5EZOH 4MVBD 4OZIE 4HA4A 5I8KL 1DQTA 1FFTB 3ALFA 1D2OA 2XWTB 1E9PA 1V27A 4DESA 1I9CB 3VDBA 4H9ZA 3ZL2A 2KZKA 2UV8G 5I17B 1OTUD 1J8HD 3FFCA 1PCWA 1GGBL 4EWJA 5B3JE 2K4AA 5AB2A 3GMNB 1KDIA 2QS8A 4LHUA 4NUWA 4HS3B 4ODHL 4WHDA 5D4YA 5GGRA 3D4CA 3MKKA 1BKSA 4TUKH 4HHWA 3P4OA 3K8LA 1FVPA 2CZVA 5HYFA 4JY4B 4ZMVA 3CASA 4MQXD 1W0VA 3N40F 1EFQA 5DHYA 1W1TA 5K1NA 4OI7A 4JCLA 3K6SB 2A2QT 2IPUK 3L9RB 1KXVA 3FT1A 4DM2A 3UWQA 3V9CA 3NK4A 4U0RB 2Z1VA 4A6YH 5C0DB 5E7BA 1YEHL 4A37A 2VWEC 1ORSB 3IVSA 1A4JB 2XISA 4A04A 1IWAA 1UD3A 2ICEA 1CQKA 2HJLB 5HMFA 1A4LA 1G7UA 2NRDA 3NQGA 1S7UA 1BZ9B 1K6QL 4K8HA 1FHDA 4QAWA 1PHWA 3DHUA 5HNUA 3AU1B 2R4SH 4GQPH 4B9ZA 2OJEB 1OFOA 3BIAX 5T3XL 4HC1A 5DD1L 4XC3H 1EGJL 3O07A 1A4AA 5DO2D 1ZAGA 3V0TA 3OR7B 3SCUA 1FOBA 1KJ3L 3V4VL 4QXGH 1RMFL 3EBHA 4LVFA 1QA9A 4NUMA 4WSKA 3PRZA 4XODA 4I6VA 3U46B 4LCQA 5F1NA 3TN3A 4KMQA 5E1AB 2CHRA 4X0KA 3IUDA 4HWUA 3B97A 2B0SL 4ZFCA 3FUNA 2YLHA 1BZ8A 1DVYA 1FFPB 4OCSL 4BK5C 3VNJA 3QFJE 2L0DA 4M5TA 2J7GA 5ILTL 1XH1A 4TF4A 4OW6A 5LGKA 1G0DA 1X44A 1WHPA 1J10A 4AV5A 1IBZA 1L6SA 5LSMA 3GZAA 2Y8VA 3BFWA 2IKJA 2AXFB 1WUFA 3QY8A 1ZA6A 4HH8A 3KOXA 3EYUH 3K5RA 2DWEA 1T20A 5TTRA 3T07A 1IVLA 2EXWD 1U22A 5JBEA 3WJMB 4D94A 3BZDA 4WK2B 4MB5A 5DD5H 5CZRA 1KLFB 1VF5C 5DQ9A 1NWSA 3B3DA 5T1MA 1YIXA 1KY7A 3UFYA 2KI6A 2XNAB 2O5ZH 4XCNB 3DOPA 1T6BX 3RWJB 4BWTA 3TBYA 5GRUH 2VDPB 2IBZY 4DF2A 2JQAA 3PIQA 1A3RL 5H4ZA 1A1MB 1SOKA 5CLWA 3TZVC 4OIAA 4CNUA 3MMWA 5EZIH 4IU2A 4CAGA 2G9KA 5LIKX 4K2UL 4KO6A 5GS1B 3CSGA 4TVPH 3NRQA 5F2LA 4AYMC 2X16A 1F90L 3G5YA 3KYOA 5ESAA 2ZNWA 4IBYA 4WV1C 1YECL 1K9EA 1U3HD 4S3CA 4R7LA 1ZBVA 1H62A 1IBFA 3BKYL 2YAMA 3ABKB 4GKLA 3LA4A 5DCDA 4D0BB 1T7VA 3V6OA 4PRTA 4PYSA 4WJ8A 4RMWA 4AZIA 2YCLB 4JVPA 5TQLA 4FFZA 3SKNA 1GTNA 1W80A 3DXAB 4PS7A 4WTZA 4AZ8B 1ZHAA 1KWKA 3VG9C 3NESA 2CLVB 3UWYA 3G9AB 3MNWB 1RP9A 4NZ5A 3LBMA 1H7WA 4G1EB 3EOTH 4KEVA 2Q76B 4ML4A 1OC6A 3QK0A 5I23A 5A7EA 4YE0A 2OMUA 4LSRH 5FJOA 3M64A 2WBJA 2FL5B 3WIIL 4F66A 1F1AA 1IT9L 3M1BA 4JR5A 3DO4A 1BF6A 5E6IC 3TJHD 3NIFE 5AYBA 3HB3C 4G7EB 2PO6A 3FONA 4DWSC 3DIFA 5AUMB 4K3EH 2VR5A 3O45B 3T0EB 2BFVL 3QNYA 3P3BA 4OQTH 1OCWH 3FTXA 5FEPA 3S1XA 4AYFB 4LBEA 3FW6A 3EX4A 4ZMAT 3TV8A 3QPXH 3KNBB 2ZWKA 3TWAA 4FFTA 4LGPB 4IS6B 3O8XD 4LCCB 1XG3A 4FKKA 2IXVA 4PTNA 1DHKA 2IH8A 5C3IA 4HSNA 3B2DC 1VBJA 5EZPA 4BA0A 1JDEA 3DAQA 2O61B 3VIMA 4RVBA 1QASA 3LZQA 4PJ9D 4XXDB 4LNCA 3H9SE 2NY2D 5D93B 1CZ8L 5J56B 4EACA 1X5JA 2GGIA 3JQOB 5DHMC 1OCNA 1VHCA 2PBGA 4QRPB 3LM3A 3MWCA 3SO5A 4Q6XA 3AJ7A 5IW1B 4PP2B 4Y4HD 1MUMA 1S3HA 3TA3D 3T2LA 1DE4B 3GKFA 2W92A 2DH2A 4LSPL 4S0SD 1FZMB 3C8NA 1WT5A 1OFBA 4XX1G 3RL1B 1G7HB 5TFSH 2IH3A 4XX6A 5FPIA 1UB5A 1Q4NX 4MJZA 5K9XA 1G9HA 1A0EA 4MFDA 4IXHA 2OMTA 5FAAA 1HX0A 3QPYA 1NJ9B 2XV6B 3GAYA 4GJIA 4UR7A 3TC9A 3EKGA 3GZ3A 4YBHA 4C56B 3TBTB 3KLLA 3ZSSA 3W9EB 3F04A 4S2SB 4UZGA 1GHRA 3DFYA 3SFKA 4Z7VF 4L64A 2YN5A 3PAOA 1GYVA 5CBEB 4YDKH 3GRWA 4I4WA 1HOCB 3WN6A 1Q6OA 1GVFA 4LSSL 4ODWA 2O30A 3TTYA 4OJFL 3BARA 1TR7A 3O63A 4XKMA 2B5IB 4QT5B 4TRPH 2I5QA 3A4WA 2CO7B 2RGSA 4M93B 4PFMA 3QZNA 3D85D 3WF0A 4K8RC 5LNSA 3DPBA 1FAIH 4C8XA 4PHZA 1KTDB 2FHFA 3PHSA 1BG9A 4IBSA 1KTRL 3O2WL 4RCAA 2Z91A 4P5RA 2UXTA 3OVGA 4PIRF 2NUPB 5KVGE 1RPQA 5AAPA 4KOBA 5TIMA 5DEGA 5D1QC 1JNNL 2VUYA 5G4MA 5EV7A 4BUGA 2EIMB 4LYRA 2OEJA 1YMMB 1CU4H 2ENPA 2O6EA 3II2A 3CZEA 1C29A 4B9GA 3UBXA 3CV5A 3NA4A 4LC6A 4JFSA 3LJ3A 3GG0A 4LBSA 3GK0A 3SDXA 4PIBA 2VMEA 2HRGA 5MEPB 2X28A 2KZHA 5GNZA 3IU4H 2OZTA 3ZYIA 1W1A1 3AZRA 5SX4H 1QO3B 4PRRA 4UINH 3BQVA 1ZLVH 2GJZB 5C9RA 4FXTA 3NIFF 1MUWA 2P8BA 4RZCA 1A0CA 4IBTA 3FCBA 3K1KC 1FH5L 2QUTA 2NQCA 4HF5H 4IBQA 3FFCE 3H2OA 2YXFA 1F3EA 4BHYA 4CD5A 1KACB 2H47C 4KVNH 4XN1A 3ULUC 3BUVA 5KWYC 4WAFA 4LCIL 5E9DB 2P44B 3RAOA 1YJDC 2R1YB 4HLZG 5ECJE 2BBFA 2VDRH 2CDEB 2D4FA 5D38A 1SY6L 1NEZG 4OFYA