2QMKA

Human pancreatic alpha-amylase complexed with nitrite
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 166
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmkA01
3APGA 5D8WA 4OBRA 3M7SA 1UWUA 4CN4A 4JKLA 5BRPA 3FW6A 3VO0A 1O6IA 2V5DA 1JYVA 2O9PA 3SUSA 2OWWA 3VINA 1B0IA 3G6LA 3T09A 2W62A 2GDUA 1WDSA 1JF6A 1C3FA 3CMGA 2GUYA 3THCA 2WM0A 1F4AA 1MQPA 5ECUA 1UKQA 2XM2A 3WIJA 3AYRA 4TX6A 1R75A 5I2UA 1GHRA 3NYDA 7TAAA 3W37A 2UWFA 1R7OA 2ZUTA 3CTTA 3CHFA 3CMJA 2XSBA 1KGWA 1B1YA 2GFTA 3CHEA 3WY1A 2D2OA 1HJVA 4LX4A 4AZ7A 4CU7A 1LL7A 2VZTA 4TOQA 2JF7A 4PMOA 5FKYA 1Y7VA 2PWDA 2G3MA 3WDIA 1HL8A 3VIGA 3SEPA 1KQYA 1W91A 1J10A 3BLKA 2WLYA 4OZOA 4B16A 1R85A 5E70A 3EDEA 4QCFA 1HJUA 3OB8A 1W3HA 1BLIA 1C7SA 3WDRA 2CBIA 3T0DA 5IXEA 9CGTA 5CGMA 4YN5A 1OT1A 1V02E 3PZ9A 2VR4A 3GXMA 4W5UA 5JUVA 3W24A 2NT1A 1UWRA 1CLVA 2QF8A 4JKMA 3WF0A 3ALFA 5I79A 3W25A 4L4OA 3WF1A 3AHTA 2D24A 3UESA 3PZQA 1AQHA 4HZ7A 3AYSA 3BH4A 3WD0A 2E40A 1CTNA 2DSWA 2GK1B 3POHA 3TTOA 1CGVA 3CZGA 1JD9A 3VNZA 2UY4A 4WK9A 1GHSA 2CETA 1EO5A 3WD2A 2VR5A 1JDAA 1UD2A 1UH2A 4A3YA 2D20A 4DWSD 4W86A 2W92A 3ARYA 3NDYA 1DWHM 2W67A 4MADA 4PMRA 1BF2A 1X6LA 2WXDM 2PB1A 4ACYA 1LG2A 3EJUA 2DH3A 1L0PA 3HU7A 1HN1A 5I6SA 2W4XA 4KGJA 2WVVA 1NWRA 5BXSA 1VEMA 1H41A 1G5AA 1WDQA 1V3IA 5E9AA 3KL3A 3EDJA 2QMJA 4MB5A 2VL4A 4IPNB 3VM7A 4LYRA 1U33A 4D1IA 1TCMA 2X05A 4W5ZA 2DT1A 2W5FA 2E9LA 1JYNA 4AZIA 4PTVA 2YL5A 3QHMA 3IAQA 4HA3A 5FCZA 2XHYA 2YBTA 3W29A 5JIWA 1XSIA 2YFOA 3GH7A 1DWGM 1XD0A 5CG0A 1UKTA 3GBEA 2CBUA 4HA4A 3HG5A 4H8VA 1C8XA 4AIEA 2J78A 3A21A 3D50A 3B9DA 3EJSA 2WMIA 4HA1A 1ZU8A 3ZT5A 1C7TA 1QNSA 1ISWA 4F8XA 1DHKA 4HOWA 4AWEA 4NRRA 4DUXA 1VFUA 3ARZA 2PWFA 1VJSA 2ZUWA 4PTMA 4AC1X 1B3XA 4GXPA 3A3HA 4C7FA 4QLKA 3KWXA 4E2OA 5GNYA 1X1NA 3AFBA 4K68A 3WY4A 2WVUA 2BFGA 5A3HA 1UA7A 1GOWA 4M80A 4JFTA 3WUEA 1EGZA 1G94A 1LWHA 1W1TA 4AD1A 5DEZA 5FL1A 2J7HA 2F1BA 2OWXA 3WELA 2BVDA 2XYLA 3LXCA 3ZJ6A 3CZEA 1OCQA 1XC6A 4NX0A 3ARXA 2WMFA 4Z2HA 2WCAA 2WHLA 3L4WA 1UWIA 3T2OA 2VVSA 3AIEA 4RL3A 2JF6A 2JALA 4PMVA 2J7CA 4H7VA 2YFNA 1OGBA 5HPOA 4IM4A 4XZBA 4FNSA 1B3VA 2PBOA 1H11A 1R7AA 1KGXA 3TTQA 3ALGA 1K9DA 3OLGA 2IUZA 4GKLA 3GH4A 1V3MA 1LJYA 4MDPA 3OLEA 4QFUA 3CV5A 1UKPA 4AZCB 1E3XA 4XZWA 3VD5A 1FFRA 3H54A 2XVGA 1VBUA 1R34A 1CXKA 1KWGA 3GXTA 2ZUUA 4LYQA 2X09A 2WCSA 4NXKA 1QBBA 2F7OA 2G8ZA 3ZIZA 2EACA 3WH5A 4GZIA 2WANA 1C90A 3F5JA 2F7QA 3SUUA 5HBFA 5I5RA 2UY5A 5I78A 2J7FA 3FNDA 4JCMA 4B3LA 1PX8A 3DECA 5HOSA 3AISA 1EDQA 4FMVA 2DT3A 3T2QA 3EJTA 3VU2A 3H55A 1R86A 3WH6A 5IHSA 4QDMA 3GXNA 5CZKA 4JFUA 3WBAA 1UD5A 2J7BA 1JDDA 2ZXDA 2WHMA 1W2PA 4XX6A 4F9JA 1ISVA 5TD4A 3WY3A 1JZ6A 4HMEA 3F5KA 3VGEA 4OGZA 1RP9A 1XRVA 5A69A 3BCFA 1C8YA 1DEDA 1JIBA 2ZX8A 1TQVA 1C92A 3WNNA 1ESWA 4HPHA 3A6OA 2YL6A 1E0VA 3AXXA 4P7RA 3ZR5A 4IISA 2WK2A 1GQJA 2BHZA 3LXBA 2CIPA 3J7HA 3VDAA 4EE9A 2QLYA 2QPUA 1BGAA 2F7RA 3HG3A 2UY3A 3CZ8A 5EB8A 3LPPA 1UWSA 1J0KA 2FH8A 3QHOA 3WEZA 1HJWA 4CKQA 1UOKA 3L4YA 4FNRA 3OIHA 4PUDA 1XD1A 3PZGA 3AROA 1MFUA 1O7DC 1MW1A 3MUY1 3MANA 2E8YA 1FHDA 5CSUA 4BS0A 4D6IA 4LYPA 4Z2LA 2E8ZA 4WF7A 1TQTA 4D6EA 2WC4A 5M03A 3TV8A 3WNPA 2XWDA 2QMKA 3IANA 5D8ZA 2O9OA 4E8CA 1CIUA 1EOKA 4FNQA 3EBVA 1V3HA 1GPFA 2D3LA 3AHZA 3O2LA 1PJ9A 2F1AA 3W53A 3GXDA 4AZ6A 4E4PA 4CD7A 1BPLB 1PZ2A 1LLOA 3CLWA 4JL1A 1BAGA 4S3JA 1E1EA 1E6ZA 3BVTA 3O9NA 4HP5A 1GW1A 5LA2A 3VMOA 4X9YA 1KCLA 3OLDA 1M7XA 2E3ZA 3CZNA 1JNDA 4R5EA 2GK1A 2BY3A 4MTVA 1B90A 3U7VA 1HTYA 5CQ1A 2WMGA 4R27A 4QAWA 4Z2KA 3QOKA 5BCAA 1JNEA 2XFFA 3K4AA 5D9PA 1NOUA 1UUQA 1IZJA 1KBBA 2DSVA 1ISYA 1VRXA 4WIWA 3PN8A 2D0HA 2NW0A 3I3EA 4D6JA 1HKIA 3W6LA 4C7DA 4PBGA 2ZWZA 3S2CA 1CBGA 5DFAA 4OBSA 4W87A 5BROA 4CGTA 1UASA 1FP8A 4TUFA 1JZ3A 2OWCA 1V0MA 1HP5A 1UKOA 1JF5A 2CHOA 3MSGA 5A6BD 3WDPP 3EJPA 3GNOA 4X0NA 4TXEA 3THDA 3WFZA 3A47A 3AIBA 2FH6A 2JEPA 2AAAA 4CVUA 5C70A 3PHAA 4JL2A 1UHVA 3CHCA 1D2KA 4PTWA 4H04A 1J0ZA 1PIFA 4N0RA 1BYCA 1GCYA 4FLQA 1GVIA 1VF8A 1FOBA 3POCA 2V3FA 5CPTA 4M82A 1TE1A 1TUXA 3T2PA 2VRKA 4ATLA 3TA9A 4UFLA 3SCUA 1NH6A 1GOKA 5A6AA 1W3JA 2WSKA 3O6AA 2WKGA 1QWNA 1BFNA 2WNWA 3BVXA 3TTSA 2JEQA 4NRSA 2D73A 4AMWA 4PMZA 4ZXOA 3KEHA 1BG9A 3WNOA 1E0WA 2VI0A 3GBDA 5HXMA 2D3NA 3MUAA 1V6WA 5JIPA 3RPMA 3D4ZA 3U57A 2VUYA 2Y8VA 1QHOA 1H2JA 1NP2A 3VKKA 3FN9A 1H49A 1CXFA 3ZR6A 3DX0A 1JFXA 1PX3A 1G0CA 4WLCA 1QPKA 2OW7A 2ZE0A 2VURA 3GDBA 4CCCA 3VD3A 1JGIA 1KCKA 1RD6A 3ZJ7A 2X0HA 2YOCA 1XH1A 2QHAA 1US2A 4AD4A 3CGTA 3HN3A 3ZT7A 1UQZA 3SUWA 2G3JA 4TVCA 3VDBA 2X2JA 2Q8XA 2DT0A 2BY0A 4CCEA 3II1A 1EQCA 3N11A 1BG4A 3SURA 2XVNA 3BAWA 2CKRA 3WQVA 4DWSA 1NOFA 4FLRA 3VX1A 1FH7A 3AJ7A 1O7AA 3A4WA 4V27A 1JXJA 3N9KA 2ZX9A 1HKJA 3OA5A 1B2YA 3KL0A 3VPLA 5A8QA 2NSXA 2RGMA 4J3TA 5EBAA 1QI5A 1HF6A 5BXRA 3VSVA 3AS3A 3CHDA 2PWEA 4UFMA 4UOJA 2F18A 1KXQA 2F8QA 2DSZA 2J47A 1BTCA 1K9EA 4AZ5A 3VIJA 1C8QA 2X1IA 1LQ0A 4U5IA 2X2YA 2BHYA 1H5VA 3RM8A 3IJ7A 3GH5A 3BAJA 1CXEA 3OGRA 2GJXA 2XVPA 3AMLA 4UFIA 1MWOA 1JYWA 4MAVA 4P7NA 4YPJA 8CGTA 2CNCA 2GJRA 1SFSA 1E6RA 1GUVA 2EADA 2A3AA 1HIZA 4UQCA 2DIEA 1HNYA 1C93A 3QGVA 2AMGA 2EPNA 1E15A 4JCLA 4Q22A 4W85A 3DYOA 4JFWA 1OGSA 1NWUA 4HOXA 4YHGA 4V28A 3BMWA 4AYGA 4PEEA 1J9YA 3CUGA 1TVPA 1A47A 1K9TA 5BWFA 1E4IA 1BQCA 2BNJA 2EPMX 1UH4A 3VSUA 3AIQA 3U5UA 3GNPA 1NWTA 2BXYA 3MI6A 4U3AA 3KL5A 4ZXLA 3BSHA 1OB0A 2DH2A 2ZICA 3WF3A 5FD0A 3NJ3A 1MXDA 2ZXAA 1N82A 2VCCA 2V3EA 1HXJA 4PRWA 1E6QM 3N1AA 2DDXA 3CUFA 3DHUA 3WDJA 2JFEX 2QPSA 5E6YA 3L4UA 4GIAA 2GJXB 4PYSA 1SZNA 1JAEA 4B9YA 1PX4A 1J0HA 2C7FA 4JKKA 4W7WA 4U2ZA 1SR0A 1M01A 3ZQ9A 2OSXA 4UOQA 2J8FA 3PTKA 2VOTA 3EYPA 4J28A 1EHNA 3W0KA 1OT2A 2E4TA 3BAIA 1H4PA 1DWIM 1WPCA 4DM2A 4LGXA 2ZIDA 3AHVA 2ZX7A 4Z2JA 3CZJA 1XH2A 4XUYA 1UD4A 5AC4A 3W81A 5GNXA 4AIUA 4D6CA 4S3KA 1V02A 3SCRA 1GNXA 2EPLX 4BA0A 8A3HA 3VIPA 2ZX6A 3SCSA 1ZS2A 2A3CA 2YA0A 3W26A 4KRTA 3GTNA 1VBRA 1CEOA 2YDRA 3B8SA 3GZAA 5I3DA 3TTYA 4FLSA 4UQAA 5HPCA 1NM9A 1WAWA 3FXYA 3AICA 5CXPA 4OKDA 5E09A 5A8OA 5CGTA 2OYMA 1VFFA 4MJ4A 3ZJKA 4D71A 1WDRA 4GZEA 3ZSTA 4AISA 5AC5A 3A22A 4UQDA 3MV11 4PMYA 3RILA 2Z1SA 2WVTA 2A3HA 3LMYA 4P8VA 2YDSA 3IAPA 3ARTA 1QVBA 4BQ3A 4B3KA 5A6KA 1J0YA 2CESA 1V0KA 1SMDA 1OD0A 3H53A 1B3YA 1V3LA 3W4RA 3E1F1 1XGZA 1FA2A 1UR8A 3ZJ8A 1HJSA 2BVTA 1XCXA 3LPFA 1MXGA 4HZ8A 4AD0A 1WZMA 3BMVA 4LXFA 3CC1A 2MANA 4TTUA 5D4YA 1WZLA 1WKYA 3CZKA 3VIHA 4MPKA 4MB1A 1OBAA 2D0FA 1CXHA 5CJ5A 1E43A 3OBAA 2HVMA 5A6JA 1U2YA 2EABA 3AMKA 4URIA 1Q6CA 1ZBCA 2PBGA 1AMYA 2WPGA 2CKSA 4LPCA 2WB5A 3MSDA 3CBWA 3WDHA 2ZX5A 3EJQA 3ARSA 1FH9A 1UG6A 3VDCA 2WWDA 1ITCA 3GM8A 3PTQA 3A24A 1W1PA 2ZWYA 5D9OA 4WKAA 4UQEA 1JDCA 1B9ZA 4M8UA 1QOXA 1QW9A 3BSGA 2WHKA 1HVQA 1TQWA 1TVNA 4FLOA 3IJ9A 3AHXA 1U30A 4MNKA 3CUIA 3CO4A 4TX8A 2FYVA 1UR2A 1QHPA 5E6ZA 3RIKA 1SYTA 2CPUA 3KE0A 1WE5A 4FNTA 3ARPA 2E9BA 3WEOA 3DX4A 4ATDA 2VQUA 1LL6A 4HZ6A 4DWSB 3WL0A 5A6LA 1HKMA 1ZB5A 5LYRA 1WNOA 2VX4A 3AMGA 3VM5A 1ZL1A 1DWAM 1UKSA 2VZVA 1TA3B 3VSTA 1M04A 1QI3A 1TG7A 1GOMA 5A94A 4HU8A 4AXNA 1W9UA 4AEEA 1CGUA 5I24A 1KXVA 4TVDA 4OIFA 1DWFM 1PS3A 4IUGA 4M81A 3HJEA 1TQUA 5AYIA 2G4FA 2DPEA 3MU7A 4AD5A 3W27A 2W61A 3DX2A 2BY2A 3CZSA 3VTRA 4FK9A 3OG2A 4UNIA 2EO7A 2Y5EA 4AMXA 1A3HA 2J62A 2XTKA 5BXPA 3TP4A 4JFSA 4UZSA 1UYQA 1UZ1A 2J77A 3UCQA 3UEQA 1YQ2A 1NWSA 1GONA 4PCSA 2G3IA 3U7BA 2XWEA 1JZ7A 1XCWA 3RM4A 2CHNA 3OLIA 1X6NA 2EPOA 3B9AA 2W63A 4GPNA 4AZGA 2VJXA 1TFVA 2WMIB 1MW3A 3ZMRA 1KXTA 1ZJAA 3WQ4A 3VD4A 1CLXA 3ARQA 2BVYA 4GI6A 1ODUA 1E9LA 1HP4A 1EOMA 1J0IA 2XPKA 2YA1A 1BSIA 3FHQA 1CXLA 4KWUA 2NT0A 1PIGA 1OGGA 3MO4A 3K46A 2EBNA 1UR9A 3PZTA 1E4LA 3UG5A 2O9TA 4GI8A 3L2LA 3K8KA 2FGZA 3L4XA 4QLLA 4W7VA 3DYPA 3QHNA 3BC9A 2CXGA 4PMQA 1ZBWA 2WBGA 2UY2A 1VB9A 1JFHA 5ABEA 5HDRA 4TVUA 1VEOA 4HMDA 2D0GA 5A6MA 1GVYA 2V3GA 1QWUA 4PMDA 3LRMA 1JZ4A 5D9NA 1PAMA 1VEPA 2VX7A 1KR1A 1HJQA 2GJPA 3FAWA 3RDKA 1S46A 1WZAA 4PSPA 2HISA 2EAEA 3AXHA 4CN1A 1W9PA 3S5YA 3ZO9A 1OM0A 1E55A 5A8PA 1VFMA 1JAKA 3BXWA 3TONA 1CXIA 5GQBA 3T08A 1FHLA 4JAWA 3NDZA 1GQIA 4JZ5A 3LRKA 1C91A 2PF0A 4CUCA 2BS9A 1QHZA 2V5CA 1BGGA 1L8NA 3WQ6A 4Q7NA 4A3HA 4UFHA 2EXOA 3CH9A 4E8DA 4ATWA 1Q6FA 3QOMA 5CLTA 3VIKA 2C0HA 2WCGA 1HXKA 4M1RA 4WKHA 2Y2WA 2WMKA 3G6MA 4OUEA 3D52A 1FP9A 1E6NA 3VD7A 4W88A 2VZOA 4U5KA 3JUGA 3NSXA 1E70M 1W9XA 3VIOA 2OW6A 1NOWA 3A4XA 2RGLA 1W9BM 5BRQA 3MMDA 4GI9A 3EMCA 4AZBA 3PTMA 3K8LA 5KEZA 2Y8KA 2VX6A 1CENA 3NSNA 5A6BA 2EQDA 1EHAA 3MMWA 2V38A 5ABHA 1UQYA 2J4GA 4NZJA 1EDGA 4DUWA 3BUDA 5E1QA 3D3AA 3WF2A 2V3DA 3M6DA 4UFKA 3WMCA 4D72A 2WHJA 1JYXA 5ABFB 3ARWA 3NCOA 4W8AA 3IK2A 4QCEA 1W32A 1LWJA 1YHTA 1GQKA 2A3BA 1MW0A 1E72M 1W1YA 3PZOA 5IFPA 3AQUA 1LG1A 2D22A 1LL4A 2GDVA 2WLZA 3S5ZA 4DO4A 1E5JA 3UG3A 4F66A 4PSRA 2BHUA 1OSEA 5JBFA 2WMHA 1JZ8A 4ZE5A 2D23A 2DT2A 4Z2GA 3SCPA 1UH3A 1I75A 3SCVA 1E6SM 1XSJA 2WVSA 2VCBA 3A23A 1QNQA 4J7RA 1UZ4A 3SCWA 5DT5A 3N17A 2TAAA 2WWCA 1UWTA 4D6HA 3ZM8A 2XIIA 1W1VA 2PWHA 3VUPA 1Q6DA 3SCQA 1HWWA 4GQRA 4KH2A 4W84A 2D1ZA 2WW5A 1J01A 4AD3A 5D9MA 3AS2A 4DM1A 1TA3A 1EH9A 3GXIA 1K6AA 5DF0A 1BYAA 5E0FA 1JZ2A 4AW7A 1CNVA 3ARRA 3LX9A 3M46A 4RE3A 1J0JA 2Y4SA 1JL8A 3CPUA 3N18A 3OZOA 1WP6A 2FGLA 4FNUA 5IFTA 3FAXA 4J3UA 3GNRA 2Z1KA 1JD7A 2VQTA 3IGUA 5AYBA 6A3HA 2ZUMA 1GQLA 4J3WA 3WENA 5JBEA 2DSUA 1WB0A 3OZPA 3T0AA 1KFWA 4OOUA 3AIWA 1XYFA 2WZHA 3AZTA 1H0GA 3DC0A 2VVNA 1EQPA 2VZUA 3VVGA 4B15A 3RO8A 1QI2A 2WZIA 4GINA 5BXTA 4H8HA 4NI3A 3NIYA 1I1XA 4UCFA 4W8BA 3ARVA 4IPLA 3AZSA 1W3KA 5A8NA 3WMSA 5M5DA 1EO7A 3OGVA 4X0VA 3VIIA 1E1FA 2JIEA 4J3SA 3EDDA 2VRJA 4CU6A 4J3XA 4W93A 1JI1A 3HZ3A 1V6XA 3GXPA 2DQXA 1V6UA 2CBVA 5DT7A 3VGBA 4AY1A 4NF7A 1ECEA 2J74A 4EAMA 5DMYA 1VAHA 2YJQA 1G01A 3WY2A 1XHGA 3SCNA 3VILA 1MYRA 4EKJA 1XV8A 3WQWA 1QNPA 1OD8A 1P6WA 3A5VA 3VOCA 5FIPA 1VFOA 1ODZA 4C7GA 1AQMA 3PZUA 1AQ0A 3WEMA 4GO9A 1XYZA 1PEZA 1Z32X 3L4TA 4HU0A 2ZXQA 3BUQA 2WBKA 4CD4A 1RP8A 2XJ7A 1HX0A 1CDGA 3DHPA 1B30A 4Z2IA 1MQRA 1KB3A 2IXVA 1MW2A 6TAAA 1V6YA 4WSJA 4H8UA 2VT0A 3BLBA 1KBKA 4MNLA 3BGAA 1US3A 4NSBA 3TOPA 3A4AA 3WH7A 3WFLA 3K1DA 2OLHA 1E6XM 4MJ2A 3EJRA 1M03A 3GYCA 2PI6A 4CU8A 5M3WA 1LF1A 3SUVA 4ACZA 4QLJA 4PMNA 2J79A 1TQSA 4M24A 1V6VA 1V3KA 1BVZA 2F7PA 3LXAA 1ISZA 1W3LA 2ESCA 3BVUA 2WYSA 2W91A 2GSJA 5M17A 3HMCA 3SIMA 2W66A 3FY1A 1WCGA 4A4AA 1H0IA 3N12A 3WD4A 1BYDA 1NQ6A 2ZUVA 1GOIA 2XGIA 7CGTA 3WUGA 3EMZA 4J27A 5BYWA 3KLLA 3SCOA 1CPUA 3BAXA 3AMDA 2YBUA 2YLLA 3N04A 4RE4A 3MMUA 2EPKX 1CGWA 2G41A 3S6TA 2YKKA 3KZSA 1ISXA 2FE0A 4CCDA 2G3NA 3AIVA 1GJWA 4HMCA 3CIVA 5JBDA 4BQ4A 4BCEA 4NZCA 4CD8A 2DGAA 4N42A 3BLPX 3AS0A 3VIMA 2B31A 1JI2A 3BVWA 2XVKA 4HOZA 3VGGA 3CUHA 4AZHA 4U33A 1GOQA 4P7QA 1CGXA 1SMAA 2J75A 3NSMA 3AI0A 1MFVA 2XN1A 1WO2A 2FHCA 4MB3A 1UR4A 4MB4A 1GOOA 4GO8A 4B9ZA 3RM9A 3HG4A 2VCAA 3DX3A 2FHFA 2VNCA 2YL9A 3AXIA 4M29A 4U31A 3LPOA 3I3BA 3WN6A 2ZOXA 1DP0A 4HPGA 2DSKA 7A3HA 1V08A 4CD6A 2VO5A 3WD1A 3L4ZA 2XIBA 3K8MA 1ZJBA 4V2XA 1E71M 2F2HA 3EDFA 3SCTA 4P8UA 1KQZA 5CPSA 4AYSA 1J18A 5ABGA 2C8NA 2BY1A 2VC9A 5A2CA 1ITXA 1PPIA 1UD8A 1JG9A 2CBJA 3AS1A 1TMQA 4JHZA 4NZFA 1VIWA 4YHEA 3VD9A 1GJUA 1DWJM 4PN2A 3CUJA 2EJ1A 3DX1A 1QNRA 2CERA 2AOSA 4ACZB 4AEFA 2IGTA 2CYGA 2DIJA 3SUTA 3UR7A 4OJYA 3ZT6A 4LQ1A 1EIBA 3BAYA 5CPQA 5EFDA 5I77A 3WF4A 1GZJA 4U3CA 5A2BA 3EMQA 2VMFA 1PBGA 3W6MA 4XB3A 3DDFA 2WC7A 5I0DA 5GPRA 1MQQA 1HKKA 4QP0A 4P7OA 1XH0A 1RPKA 2XN0A 4DWSC 4U2YA 1CYGA 1BVNP 4ZEPA 1GORA 2XFYA 2F61A 3WNLA 4WSKA 5CLWA 5I23A 1E6PA 1K9FA 1VJZA 3EDKA 3VMPA 3RJXA 4XV0A 1UR0A 4AMCA 4UTFA 2XVLA 2OYLA 1Q6GA 1R33A 3GXFA 4BQ2A 3WL1A 4JIEA 1DTUA 2VRQA 2CITA 2VX5A 1KR0A 1I1WA 3UERA 4H2CA 4P7LA 5LA1A 3UR8A 1W9DM 2OSYA 3T0BA 5A6SA 3W38A 1Q4NX 1OIFA 3LRLA 3VNYA 5A1AA 4DO5A 1V3JA 1OINA 3VIFA 3WH9A 3WSUA 2OSWA 4UQ9A 3VGDA 5A2AA 1TZ7A 2WMJA 3BCDA 3AIUA 4DO6A 4ZENA 2IXUA 5A95A 3ZSSA 5GNZA 1WDPA 4W8LA 1NP0A 2WAGA 1UA3A 4CVWA 1T0OA 3WQ5A 1D7FA 4WKFA 3U5YA 5LA0A 2J7EA 3WUFA 4F9DA 3DYMA 1OIMA 4PTXA 2OYKA 4DUVA 3PZIA 2E0PA 1R46A 3I3DA 1PZ3A 2YLAA 2O9RA 2X2IA 1H09A 3VGFA 1CGTA 3N13A 2DEPA 3DDGA 4OOZA 1UR1A 1KTBA 4UQBA 1KWKA 1B3ZA 1J12A 1Q6EA 3AZRA 3PZVA 4CD5A 3ECQA 5ABFA 2ZUNA 2BXZA 1NARA 1V03A 3MKKA 2WVVB 4D6FA 4JHOA 3KLKA 4J3VA 3QR3A 1CGYA 3BAKA 4ML4A 5FL0A 3WBEA 2XN2A 4UZUA 2PWGA 4TTGA 4PMUA 3ARUA 3NUKA 2J8GA 1G1YA 3BUBA 3PZNA 4KRUA 1D3CA 3WD3A 1IT0A 3CZLA 4ZE4A 3UETA 1V0LA 4ZFMA 4H41A 2X2HA 4HTYA 1ZBKA 2EEXA 4AIOA 1KXHA 1E56A 1V0NA 1E4NA 2VTFA 4AD2A 3MS8A 3AHYA 1EDTA 2CEQA 2XUCA 5CSYA 1BYBA 1E5NA 4M56A 3BVVA 1HVXA 5F7UA 2J7GA 3WMBA 1CZ1A 4F79A 2GVYA 1AVAA 4KGLA 2XG9A 1F4HA 3N15A 1VENA 1E0XA 1E4MM 4D1JA 1H3GA 3LPGA 1QNOA 2A3EA 4KMQA 3F4VA 3AOFA 5IHRA 1UWQA 2JIWA 3WDQA 5EMYA 1HJXA 2BV9A 4MNJA 4EANA 1W2VA 5AY7A 2XFRA 4D6DA 1B3WA 1UD3A 3PZMA 1QX1A 5C8BB 2E9MA 3WUBA 3BUIA 3WNMA 1W9VA 4PMXA 3WH8A 3VDHA 1QI0A 3HG2A 1ZBVA 1G9HA 4MDOA 2QV4A 1HL9A 1BHGA 2ZUSA 1MVYA 1JXKA 1FFQA 3VGHA 1R87A 1HT6A 3D51A 3K4DA 3RMEA 2CCRA 4JFVA 1KGUA 1OWQA 4PUEA 4BF7A 2WZEA 3WKZA 3VMNA 3FHAA 4P8WA 2X0YA 2FDMA 4UR9A 1WZKA 4PCTA 4UFJA 3M07A 4MAZA 4BQ5A 3BUPA 5A8MA 2X8RA 1H1NA 5E0CA 3MV01 4L4PA 1CWYA 4GQQA 3WQ8A 2YDQA 3WNKA 2J25A 4WJXA 1IZKA 2WKLA 1E40A 4AZCA 5C71A 6CGTA 1QI4A 3W82A 2WSPA 2Y24A 4W89A 4MNMA 2FHBA 4GZJA 2XSAA 3L2MA 3MUZ1 4W7UA 1EXPA 1KTCA 1IV8A 1QBAA 2XM1A 5HNNA 1J11A 1E73M 5IDIA 2YA2A 4RE2A 1UD6A 1XSKA 4CN6A 1B31A 5FOOA 3D4YA 3PBGA 1E3ZA 3ZOAA 4UOZA 1RH9A 2YL8A 1EA9C 1TR1A 4Y7EA 3UG4A 1FH8A 1QW8A 5EFFA 3F5LA 3AIRA 4EK7A 3IJ8A 3RCNA 3L4VA 4NXSA 1CECA 4BZYA 5DO8A 1R8LA 4FF5A 3VX0A 2VZSA 3RJYA 2XGBA 2J7DA 3MUIA 1JZ5A 3B9EA 2YIHA 3OGSA 2PC8A 2ALWA 4FNPA 4P8XA 3AMCA 3D5HA 1M53A 2WC3A 2O92A 4D6GA 2ZXBA 1R47A 2JE8A 5KZ6A 3W28A
chains in the Genus database with same CATH superfamily
5H37G 4TNFA 1P7QD 1T20A 4XWOC 3X2QB 3PWVA 1LE9B 5D8WA 1I3UA 3O8XB 1NCDL 5LDSA 4JPIB 3PJNA 4ZS6D 5IEKB 1HWHB 2Q02A 2YCJA 1JP5A 3FW6A 4PJ5A 4Z7IA 1A1MA 5GRJL 3VO0A 3BD5A 1L9QA 1GS8A 5D7LA 3O2WL 4PJ7F 4KKAC 1HFBA 4JRXD 1FV1B 5AAPA 3TJXA 1CQKA 4WJ5A 2NQHA 1E2ZA 3E0GA 4OZGA 5DQJB 1C3FA 5B80A 4ZFZB 1DO5A 3WJWA 3TZNA 3LV3B 1AIZA 1MVUA 2WM0A 3FQ1A 3CDGB 4JDZA 1A6AA 2H5UA 1M6UA 4Z7UB 3PPCA 5ECUA 4N5UA 3BOXA 1U8LB 3SSGA 2DI7A 3TV3H 4W9KC 3AYRA 2AABL 3UG8A 3BGFB 3PS6A 5DVPA 1GHRA 2PCPB 2WWKT 3VDGA 1G0YR 1BQ5A 1N70A 2MKWA 3B6SB 1R7OA 1QAPA 3TW7A 4HNNA 5K4XA 4Q8VA 3NFSL 2EIZB 5J9PA 2HRPL 3CSYA 5FYLE 3B06A 4LPUA 5FW6A 1JBJA 2VDHA 3CHEA 3CFQA 1MRDH 3O8XD 4LPVA 4DESA 1L5GA 3C61A 3EAUA 2AVGA 5JTWA 3BKJH 4FXGB 3D39B 2AQTA 2E09A 5JDSB 2R0WH 4LPXA 4W9JC 4OJEH 1KCUL 2PP1A 4G7EB 5BOEA 2NUYA 4TOQA 5I0VA 3M44A 4L1DA 3MX0A 4DIAA 2Y6TE 4L4VD 2JF7A 2NLIA 2OBGA 4PMOA 1Y7VA 1OFEA 5GNXA 1HILB 1DBJL 4ZZKA 2DLIA 2WN2A 2AP2A 2P44B 4H88L 1IGWA 1NQKA 1BLNA 3K2UL 1J8KA 2D9QB 3BPNB 1TZHA 3ULVL 4LEXL 4NG3A 2X0WA 2FIQA 1HSAA 2GBTA 1FBIH 2FWOA 1DQQA 1IQ8A 4GAGL 4WI4A 2GI7A 4NKOA 1H0DB 5DJXA 3H7VA 4WZHA 3GRWL 12E8L 1GPOL 3PCYA 2ZUQC 3QIUA 4DAGH 4GUCA 3H23A 2BCKA 3WLLA 5F1NB 3OKDB 2MOGA 3QSRA 1Q9KA 2GSGB 1W3HA 1C7SA 3DDMA 2CBIA 3T0DA 2WQRA 3FCPA 4L1SA 5ILTL 1TSIA 1RZGA 1ACCA 1NGQH 5AVVB 3VRIB 3AGWA 1UZ6E 5A40E 2XX0A 2NXYC 3MBEA 3AADB 4Y2DA 4B6ZA 3CS2A 1WT5A 5BUAA 5CSZB 1OW0C 1UWRA 4JKMA 1SUXA 1UT9A 3IDMA 3KS0J 4MD4A 4XHJC 2QF8A 4Q4QA 2VDNB 3K5RA 3QEQB 4B9FA 3QQ1A 1RLBA 1AGBB 4G1EB 4JKPL 3VXUA 2HTLC 2B0SH 3TEZA 1NCBL 1OGAB 2AQVA 3UYIA 4Q89A 3R4DA 2V2XB 2W6RA 2A74B 5EIIB 4YWGH 3BKML 2OELA 1CI3M 1AR1C 5EUKB 4L4OA 3AHTA 1YEEH 2D24A 3PZQA 1N8WA 3NQCA 3LAFA 1UB6B 3C5SB 5BMWA 1XYBA 2DSWA 4DBSA 1RJQA 5ACZB 2OL3H 3CZGA 1MHEB 2FZ3B 3P2TA 1JD9A 1NFDB 3VNZA 4CNPA 3IDJA 7FABH 3MW7A 3K6NA 1BW8A 3TWYA 3UPRA 2ENQA 2RCSH 2ANUA 2CETA 3LB0A 3CBKB 2VR5A 5CHNA 5AAWC 1UB3A 3GDLA 1JDAA 4JFQB 3WI9A 3UCCA 1N12A 2ZOLA 1I3VA 2P5WA 5EC1A 4N4PA 1PFCA 1KYAA 1FYTE 3ARYA 2WCPA 1CR9H 3U83A 2E9IA 2Z34A 4PJGB 2FO1A 1BF2A 4QI3A 4A35A 1GSKA 3L3OC 1YKWA 2NQ5A 3KBHE 3ZKSD 4KWSA 3W0WE 4ACYA 5E94A 3BFQG 5LB1A 3GKAA 3FB5B 2V6AA 3GU2A 3NPZB 4X6BB 4CJ0A 1AFVL 4XNYH 2PDNA 1U58B 4M4RA 2VDLL 1Q7QA 4PRPB 4NM8H 2JLPA 4YNYA 3HU7A 3VKCA 5I6SA 1L6SA 5TK2A 3VI4E 5AVNA 1PWLA 4PUKA 5E1AB 2WVVA 1YYCA 5BXSA 2NY1C 2ZUQB 4MRBA 4J6RL 4Y0GA 5MHBA 2BIPA 2FBJL 3QUMA 1T2XA 5JW4M 1WDQA 4WXZA 4ZSTA 4RR4A 4YCPA 1DQIA 5EU7C 3KL3A 5LAXB 1D5XB 1F74A 3DKHA 3W29A 3B5TA 4OCSH 4OFPA 2DEYX 4AEHH 2GITA 1T2QH 3IETA 3KPMA 3NK3A 3QJHB 3PABB 3VFMA 2DQDH 1XG3A 2R7EA 5E1GA 4HWNA 4DO7A 2XWJA 1PKQE 4F58L 3PJLA 3HQNA 4L80A 4LYRA 4D1IA 1WHOA 1H15B 3PPEA 2X05A 1A5UA 3N44B 4HZMA 2DM2A 3WLRA 5HDQL 5K9KB 1JYNA 3EB2A 4AZIA 1WWCA 2FT6A 1OSZB 1I8MA 5CN3A 1FC1A 4NVTA 3WQOA 4L9LB 2N7SA 3AQXA 2QV2A 3H6JA 5BVPL 4W9GC 4Y19D 4JKWA 2A74C 3V6BR 4MHHG 1VLWA 5JIWA 4OF8A 4HNOA 1J8HA 3WQDA 5AW1B 2NX3A 1FZOA 4ZW8A 1AODA 4L5FH 3OPZH 1AHKA 1JPEA 5CG0A 1J88A 4F15B 2VJ0A 4BH8B 3NZPA 4U6HB 3HG5A 4QGYA 4F37F 2R94A 3IU3B 4QJ5B 4J4KA 1UJ3B 4X22A 5LGHL 4HCHA 5CZ0A 4G8IA 3VWJA 4AQ8A 3JV0A 2OMTA 2VDRB 1YEDB 4E41D 5FJJA 1NCCL 2CRMA 4HA1A 3BRFA 5AVZB 1IXNA 1TE6A 3G0SA 4L3FA 1SJAA 5G1MA 3WUWG 4X5LA 5E5LA 3R8QA 2WKJA 3LXUX 3NPSB 4D3CL 4EBQH 4Q6JA 3MLYL 3PV6A 3ARDB 3M6YA 3O45B 4MFEA 5KYWA 4TO8A 1CFNA 1I9IL 2ATKA 2RTTA 4WWKA 2Z27A 4F8XA 3MO1A 3F04A 1XIGA 5ISZE 2YQBA 3QZLA 5DK0A 2XIQA 2C9AA 3HMXA 4L37B 1RQBA 1YNYA 4Y9FA 1FXPA 5LGJA 1F6LL 3NBNA 3LHYA 1YNTF 3W7DA 2HKFL 5DGRA 3QZAA 3OL2A 2DQFB 1VJSA 2AQ1A 2ZUWA 3GMPA 1DQVA 2COVD 3LNDA 3MZTA 3K74B 2IH3B 4AQEA 3RKDD 3TQ0A 1B9KA 3I50L 3TBTA 1RZQA 4AC1X 3G5VB 1MHPL 3MOBH 4OTXH 2OCZA 3A3HA 1LK2A 2CA4A 1QSEA 3WL9B 2FX9H 2PYEE 4QLKA 3VXRE 3PUDA 3TJLA 1I7TB 4IRZL 1DYZA 3KLAB 4JKPH 1X1NA 3AFBA 2IPWA 3WY4A 2GI0A 4ODHH 5EWIH 4F9PC 2BFGA 5EEYA 2BVWA 2NQLA 2BNUB 2W9DH 4N2HA 5D1XB 1Q4WA 2A1WH 3G77A 3PM6A 3A4EA 1NJ9B 1DJSA 1I1AB 3BSZA 3M0XA 4XPHH 4ZPVA 1EGZA 5IBUG 1Q6QA 3MRNB 4DH2A 4L9LC 3L1OL 2HJFB 1XR8A 2AVFA 1X8CA 3WELA 2OQLA 3LXCA 4AG4H 4ZQNA 4IPIA 3ZJ6A 3LMZA 5TE6L 1XL4A 4KNTA 3ARXA 4DAGL 1HESA 1IGCL 2YS4A 3QQ9D 4ISVA 4KK5C 1EHXA 3IAGC 4PLOB 2ZXEB 2Z4QA 4DP2X 2VEGA 3T2OA 3W0WA 3F4NA 3UTTA 1JCMP 2WXNA 1KIRA 2NY1D 4GSQA 4P23A 5I71C 1OCWH 4GBXA 3BKJL 4M3PA 5AL8A 3HN8A 2YXOA 3X12B 5FDWA 4FEIA 4G9FB 1B5TA 4R34A 3E0FA 1FNSH 2JF1A 5AHEA 1A6VL 2OR9H 4HHPA 4Q8QA 3MJ7A 1CF1A 2H9GA 3MN8A 4D2NA 4X60A 1UGNA 1O1HA 5BNXD 2A6DA 5LGHH 1E5AA 1JTOA 1UZ8B 3OLGA 2IUZA 4OB5L 1NEPA 2BDQA 4LRTA 1JZEA 1TITA 4O1EA 3GH4A 1DVSA 1V3MA 3FRPG 3NEHA 1LJYA 5G55A 4OF3A 5T3ZL 4PRDB 4N2EA 3K1GA 1AKJB 4V1YA 2APFA 2OI9B 3THQA 4E9WA 1I6NA 2FSEB 1E5CA 5D71L 1UKPA 4AZCB 1SZFA 2N7AA 5DS1A 1KJ2A 3SDXB 3H54A 1EWDA 3T1WA 4AH2A 1LNUB 25C8L 3QNXB 2J13A 4LYQA 4MSWA 4O8RA 1X3DA 5HI5C 3RDTA 5IB2B 2VKWA 4GRWB 4ZT1A 4NXKA 1YNTA 4JANB 4JZOA 4FP8L 3IE4A 3B7SA 5L9DH 5ERWA 3ZIZA 1QNVA 4ZXBB 3PREA 5D7JA 5KAQG 3ET9F 4HHWA 5BU6A 1KZYA 3PS7A 2VLLA 4PTUA 1C90A 4DHLA 4K94H 3HBLA 2JCCB 4NT6B 4Y2DB 3D39E 2FATL 4OCLC 3X14B 4JX4A 2NY2C 1YPZA 3IDMB 3DV4B 5HBFA 4IU2B 4JR9L 4F24A 2RHGA 3D33A 2UY5A 5F7FA 4GUPB 4JO8A 3IBEA 1DVYA 3FB7A 2FT7A 3K72B 1I7UB 5IVZA 3LCXA 5E6ID 4XMKL 4H4IA 3RKDC 4N28A 4M1CC 5JHDA 1PCXA 3AISA 5EY5A 4KRPD 2Y6ZA 4XZHA 1KNOB 3HE7A 1L0QA 4BBWA 6FABH 4I3SL 5F3HB 3WHXA 3MRCB 2NR6C 4ZOAA 4H1LA 3KYNB 3RJOA 3WH6A 4M6MH 4ENLA 2DV0A 4DJMA 4IDLA 1NFIA 1GOGA 2VCAA 2JFCA 5C3IA 3OAYH 1MF2L 2EJAA 4MMXC 4YHOH 3V0VA 5BZDB 4U0QB 3IMBA 4KBPA 1FNSL 2A77H 3WBAA 3R7QA 4MCZB 5DZJA 1J8VA 3T6CA 1JPSH 2YCLB 2V2CA 1AE6L 1T66D 5C0AA 3JS3A 2NY7H 1MKFA 3H7LA 5K9XA 4A6GA 2WHMA 3GK8L 2BZDA 3PWPD 3Q5TA 4XX6A 5CZSA 4LSPH 1Y18B 3WY3A 3RL1A 1T21A 4MJJA 4PV8A 5C9JB 3TVMD 2RQEA 4J2XA 1SPQA 1P5UA 3AB0B 1RKRA 3EO9H 3MFFB 4MWFA 4WEBH 1XRFA 3GU1A 4O9HL 3C09C 3WLTA 3D18A 1NEZA 1PU0A 4RFEA 2V7NB 3DBXB 1LBMA 3FU9A 4PMEA 3S5LB 5I66A 4ONHB 4UUIA 4E6MA 1DEDA 4NO5A 4HUWA 2Y70A 1MI3A 2EKSA 3OVRA 3BAEH 5KSWA 4OJFH 4RMQA 3BSZH 5EF3A 1BCIA 3AXXA 5EU3B 1E65A 2YSWA 4JXCA 3ZR5A 4MDJA 2Q6ZA 1Y5XA 3QQ4A 2WK2A 1JZIA 4RSVA 2A9MH 3QC3A 1MCSA 4XCYA 2EKJA 1TPEA 2QNEA 2BHZA 3BJTA 3LXBA 3FJ6A 1WKFA 3RHWF 5AWNH 3VDAA 1RHFA 2NUXA 3W76A 3B5HA 1WZ1L 2WSRA 3ZE0E 4EE9A 3AAZA 4NQCB 1EYEA 3BHBA 3NRFA 5FF3A 2F7RA 2J88L 3CZ8A 1G69A 3BJ91 1IL1A 3LPPA 1C5BH 1UB6A 5DJ6B 3K6FA 2FH8A 3ZTDC 3OZ9H 1RU9H 4JY6A 5FOBB 3QHOA 3WEZA 2XCMC 3EYOB 4RQQB 4O2FA 1HJWA 2GJ6B 2ZA3A 1UMYA 4GXWA 4PUDA 2NLJB 3IDJB 4UTTC 5EU4B 1HHKA 2XZ9A 3D48R 5KN5B 3CM4A 3UMNA 4RV8A 3OTTA 3V5DA 1NMCB 2XFXB 5EPMA 3GF8A 4IBYA 5FFOA 3V9FA 5C2BH 4J35A 3MANA 4U3XA 5EUOA 3RA7H 1EHLL 4FI8A 1E5YA 4MMXB 4JPVL 3WLWC 2XDHA 5IUSA 1XLLA 1I9RL 4YXHL 5JHMA 2CXKA 3KBEA 3QNFA 4RGMB 4D9LH 5C0CA 1YN6A 1G4MA 3FF7A 1W8NA 4AZ8B 1V7MH 4ZMZA 2QADD 2RFXB 4LDCA 1E27B 4KV5F 3UTQB 5PAZA 3V4LA 3WJLC 2H26A 2CCLA 5JMRA 1TV7A 5TE4L 3OKKB 3B2UC 3O45A 1EF2A 3GZOA 4QRRB 4C6MA 1CVSC 2ZP8A 5D8ZA 1J5IA 1KNWA 1WBHA 4WW2F 1XLMA 3IKCA 2DJSA 1EJWC 4X4XA 1Y65A 1W8GA 3EOLA 3SGUA 3U9PH 2XN9B 4PY8J 3CN1A 4F2EA 5C0CE 3ULUL 2ARJQ 1LE5B 5FO7A 2YAMA 3AHZA 3CVIH 5HYEA 4Z7NF 1FNEA 2RJMA 1JCJA 3PB2A 4FO4A 4GFSA 4ICCX 3DTUB 5E2VH 2HTLD 4MZ1A 3W53A 3ISWA 1BZ8A 2R56L 3DFQA 4E4PA 1J48A 4ODXA 1BQHA 1FQ9C 2EIMB 4MAUH 3MHUA 2IKIA 3MCLH 3CLWA 5CD5C 4N9GA 3MRHA 5FYKD 4GCAA 3ZE2E 1A0CA 3CVBA 1KN2L 2BNUA 4LOUD 5D1XA 1PZ5B 1PVNA 3SDCB 3SDDD 3T0XA 1E1EA 1XGEA 1XLFA 2CDFB 2WXHA 3BVTA 2JKPA 4U1MB 5BV7B 1YEJL 1GW1A 3R13A 3DERA 4PI0A 3K6SA 1F8IA 4JS7A 3A6CL 3DRTA 2X4RA 4WI3A 3FQRA 1O0VA 3R0MA 4IRSA 1SO4A 4LB3A 2LT9A 2NDFA 2EINB 3EZJB 2FGWH 4OF5A 4QUOA 1B90A 3URNA 5LHEA 4M5YL 3S3JA 4IJTA 4R27A 2FL5A 1PB0A 1FFNA 3B4NA 3HG0A 3O8XC 4PBXA 3V4PB 1O1ZA 4JFZL 1ZSXA 3COTA 4I77L 3DVNA 4BI6A 5I06A 4HUXB 3MUGB 1T6VN 1ZK9A 4K9EC 2Z8VC 4G6JL 4ZNEE 1ND0B 4XGZB 2GGJA 4NKCA 3MSYA 3QSTA 3CFEB 3HZMB 4NQTA 1KBBA 3INUH 3C8FA 2DQIH 2P0IA 4S0SD 2DDQL 4B5NA 3KYAA 3EJZC 3QPKA 4BE6A 3VNDA 4C60A 5DRCA 2D3VA 4NQEB 3F4CA 2D0HA 5REQA 4R96B 2POTA 4B7IA 1XIEA 3RPDA 4UTAA 4YFDB 4MKVA 2OMYB 5DYOA 2VEIA 2V68A 4HHHA 2HVKB 1Q1JL 5G2HA 3ATBA 4XMTA 4PBGA 2ZWZA 4O5LH 1GS7A 1Q0EA 1BEUA 4W87A 1Q0YH 3ROLA 4IMCA 3UPBA 3UGXA 4TUFA 4OLZH 1AKJA 5L4JA 2OWCA 3R89A 1TPWA 2C1OA 1B2WL 5IJDC 5LUMA 4BIKA 3Q58A 3ROOA 3PB0A 1HZLA 5DURB 3F6IA 1Y6MR 4PM1A 3U0WL 5A6BD 4XNDA 3WDPP 3EJPA 5CILL 1KLUA 4NRXB 3P3UA 3GNOA 1QBML 7PCYA 1ZCRA 4UCGA 5FJIA 4X0NA 4M5PA 2W9DL 3GINA 5DEFB 4QXVA 4IFRA 3NQ8A 3A47A 2O4QA 4PCYA 1RVFH 3C2RA 1V4YA 4XN9A 5I1GH 3ZGIA 1FCGA 3MRQA 1UCBL 4CVUA 4NJHA 1TRIA 1FKXA 3IJHA 2EDMA 1UHVA 4NCC2 3CHCA 3QGKC 3BX7C 3TF7C 4PTWA 4PD4J 4H04A 3H8AA 2ZTJA 4JG1L 1PIFA 4JFYA 3MODH 5J5RA 3SAZA 1PZCA 4M48L 2VUNA 2VN6A 4GY1A 4GUPA 4AUJA 3POCA 1VF8A 2A7BA 1IM9D 3KVPA 4IW4C 4NNCA 1U92A 2YC1B 4K3HA 1EK3A 4X5PA 5CPTA 3SODB 1EUTA 3K2KA 3O63A 1ONRA 4GIRA 1G7JA 3N55A 3SCUA 2FWSA 4PRPE 1OE1A 1FHNA 4DKDC 2WKGA 2J8UB 2XISA 3C86A 2DEXX 4KKQA 3FOLA 1N8FA 3Q43A 1BFNA 2Q09A 3BVXA 4QHLA 5AW9B 4QAMB 4M7TA 3W1UA 4DXXA 3MAWA 4LSTL 1BKSA 1JHTB 4NRSA 1NZRA 3ASWA 3HA0A 3MJ7B 4PMZA 4LVNC 4NKIH 3JWOH 4XHJD 3L5HA 3TGXA 1BG9A 3O3DB 3SPIA 1IEBB 4C83B 2HFGL 1BAFH 2GOKA 2Y7GA 2H7WA 4Z6AT 4JHMA 2GK0A 1YPZF 3L5AA 2KUTA 4HGWB 3IN0A 2D3NA 3RLVA 5DA4A 4CW1A 2YPLD 4XTDA 4J4PA 2XNAB 2VSKB 1PBYA 2TYSA 5DD5L 2V63A 3ZHFA 1SRDA 4F93B 3GMPB 4O4VA 2F6UA 4OZHB 1R17A 3C08L 2HSAA 3W7LA 1DSYA 3U57A 4NO0A 3S88L 4OZGE 2VUYA 3WG7B 5KYYB 4JW3A 4PFEA 2HVNA 3APTA 1JCXA 5DVKA 4YSAA 3CDZB 5BPPA 1YC8A 4KZCA 5G4NA 4RNFA 1LK3H 3RWJB 1JFXA 5H37A 3GO2A 4N85A 4ZSOA 3RDTB 5IB2A 5ADOL 4PVMA 4G1MA 4OT1L 3MA9L 1EGJA 2GL5A 3GDBA 3NL6A 5F8QC 1TJPA 3R79A 1UPMB 1K5WA 1QFUL 1KCKA 3ZJ7A 4E9RA 4M7JL 4K3JH 1XH1A 3T42A 4FXTA 1BVKA 5DFTA 2Y5TB 2QHAA 3OVPA 1HQRA 4GG6A 5E93A 3VNKA 3P1VA 4Q8TA 3BN3B 4OIIH 2UY6A 4LOEA 4AQAB 1KFKA 2CLEA 3CGTA 5KVDH 1KFGA 1KTJA 4WD0A 1OTUC 3ZT7A 5E7BA 1GGOA 2IFFL 3CWGA 2BP5M 2HWZH 4G8FA 4PJ8D 1NMBL 5FGSA 5FO9A 5AW2B 2WBJC 4N2OA 2Y8UA 3AY2A 1XYCA 1YDYA 4TVCA 3AAZB 4PS4H 2RAMA 3EAKA 4UTUA 3II1A 1LOLA 1BWVA 4XXWA 3ALFA 3QZPA 3G9VA 3HRPA 2EC8A 4IU3B 5JHLL 1KULA 1BG4A 4HN8A 2XVNA 4TMBA 3SURA 2GJNA 3T05A 3DGGA 1T89A 4QTFA 4BJLA 2CKRA 4FLRA 2VWTA 1OF2B 4DWSA 1RVKA 3X12A 1A0DA 1MCKA 1CD8A 3M7WA 4V27A 1B0GA 1JXJA 1SJVA 4Y9AA 1Z7JA 2ED6A 1VD6A 4CAGA 5KUMA 3FA3A 3Q8AA 4M7ZB 3DX8B 2H9GB 3QQ3B 3FN3A 3MACL 3QW9A 3P7YA 3V5OA 2TSYA 4C6JA 1BG1A 1GVQA 5EBAA 3V0VB 3VXRA 1QI5A 1ZRUA 2NXZB 1RCYA 1G7QB 1NAMB 3HI6H 3RWHA 3ULUE 3N3TA 3TX9A 1MIMH 3RI5F 5H2BB 4WUUD 3T0ED 4MGXA 3HQPA 4IRJD 3CHOA 3H3PH 1CTOA 3DROB 1E27A 2QQNL 3TBSB 3UTQA 2Y7QA 3WFBL 4MRCA 4LKXB 2FSEA 4UOJA 1S7XA 3SIKA 3MYPA 4B92A 1OAUL 4ETQB 1OXYA 1K4GA 5D2TA 4N6FA 2DSZA 4FQ1H 3QRGL 4C56A 4IICA 4K1GA 3ZHKA 3VIJA 3IKCB 5HNTA 5DJ8A 5E2UL 2VLKD 2X2YA 3NQGA 1T8QA 3EJYD 1KM6A 5FX3A 4GUHA 4Q9RH 2DKUA 3HGOA 3GH5A 4G71B 4HSNA 4OT1H 3OGRA 4E9YA 5F70A 4FFYL 2CLKA 2CHXA 2M83A 3GSMA 5C2XA 3WLNA 3AMLA 4NIYE 1EV2E 4NJ9H 1JYWA 4GAJL 4PTUB 1US0A 2R15A 2UWEA 1JXGA 4XZUA 3X11B 8CGTA 5FK9B 5F8RC 2CNCA 5AZ1A 4ZO7A 1ZVNA 4HLZH 3MXWH 2Z31B 5G5DA 4KCWA 4X4YB 3QBUA 2XTJC 1P7QA 1GGBH 3UTPD 3L7EB 2VC2H 3TC9A 3HNTH 4XP9L 1NM4A 4IK6A 2OZ3A 5CINL 4DW2H 4NQVA 3TJIA 3SDDC 4DUOA 2JSFA 2XJLA 1OE2A 4N24A 2DIEA 1I2RA 4K5LA 4LZKA 4H88H 3EYOA 1NCGA 1PTDA 1HKLH 3WQFA 4X80L 3QGVA 2EPNA 1JNHB 2R91A 3QXDB 4QE1A 4QG6A 1FRGH 3DYOA 2JJSC 4LBSA 4MD5A 2FBOJ 2ZYIA 5BW7A 5KN5A 3QK0A 4PRHB 5F7DA 3INUL 4YHGA 5D1XC 4PJHA 4AYGA 4HUXA 4PEEA 1XF5B 3CLMA 1CE6B 3COOA 4HXAH 4BCEA 6PAZA 3B40A 3G18A 1E8YA 5CINH 1FO0L 4DW2L 2FX8L 2EDFA 5BWFA 2H8PB 1A3RH 4JFZH 5JW3L 1JF1A 4L3EA 4LLYA 3O2DL 1AO7E 4Y5VB 5IGXL 4KC3B 3VSUA 3Q2VA 1BQCA 1YX1A 4GIYA 2O5XH 2NQZA 1T96A 3H26A 5FA5A 3OHXC 3HHSB 3GQYA 4LDLB 2QJDA 3TCXA 5DJAB 4ERIA 5J3HD 4LSUH 3MJGX 3HI5H 1ZT7A 2Q6WB 3IGHX 3BSHA 4TR9A 4X4XB 3S47A 1KF9B 3V0TA 2GT9A 2VXQA 3LH8A 4Y9PA 3S5LA 5M7QA 2QDDA 3MVTA 2CRZA 1A9BA 2ZXAA 2Q8AH 5D70L 3C8KB 3W39B 1IMHC 5B39G 5D5MA 1BOYA 1BD2E 5HHNB 1NCHA 2P4AB 3OA5A 1E6QM 2XT1B 2RDTA 4O1BA 1E4XI 1PY4A 4N8UA 2DDXA 2CK0H 3MCLL 1KLUB 1D6EA 1A3LL 2KDGA 3DHUA 4HS8H 3WDJA 4AJ0A 3CUFA 2JFEX 3UYRH 5IKCB 1W72H 5E6YA 4GIAA 4PYSA 3OKNA 1SZNA 1IEAA 2WW8A 5A7BA 1K3ZA 2DTMH 2Q10A 3H4WA 2F7IA 4PW3A 3SRDA 1N64H 2ODHA 4U2ZA 2IJ0C 4XCNA 3AGVA 3V5FA 1A6TA 4RK8A 3U4AA 2QSVA 5A3IC 3HNSL 4ELDA 3K6SB 2X7VA 1M01A 2BIQA 2OMZB 2OSXA 1DQMH 1KBJA 2JH2A 4XP5H 1S39A 4B5TA 3TFXA 1SM9A 2QHLA 4TNVF 3EYPA 4O13A 4G8AC 3ZKMC 2E4TA 1CE1H 2ZWNA 3PGDB 1WPCA 2XA8L 4X7SL 4B0MB 4N2BA 3UCRA 4BHUA 2ERJB 1IHIA 3IXTB 2EYSA 1A5FH 1HGWA 2DQGH 2ZX7A 3W71A 1XX9C 3HE6D 3CFKB 3BZEA 1EJFA 2NYYC 3V4UL 1Q1PA 2FX7H 3L16A 5IJKA 1VPYA 1CWVA 4LOCA 4CVXA 4D6CA 4G6JH 3MUJA 3MRIB 2HT3D 3GU9A 4ZQCA 1ILSA 3FOLB 1TJGL 2BSED 4E4FA 1H9VA 4M6UA 2YSSB 3SCSA 1ZS2A 1XGQB 4TMPA 4YLQT 5JIMA 3MOQA 3QORA 4WNQA 5I0WA 9XIAA 2Y7LA 3N44F 3QUYB 2P3ZA 3B8SA 1HIMH 3MOAH 3OHXA 2GK0B 4EZMA 3T44A 4A8LA 4EOUA 3FFDB 5KITA 1T66C 1OZUA 3MNZA 1EQWA 4NJIA 5HPCA 2BVOA 3FXYA 2R9HD 2Q2LA 3EYUL 4KZDL 1FDZA 1H1YA 1LCOA 4RPPA 2ISSA 5A8OA 43C9A 2F9BT 3KPPA 3LQZB 5CGTA 3VWKA 3SOTA 3W11D 4AENA 1LXMA 4QSHA 2WKOF 5HYSB 2PDYA 4M8RA 5F2LA 3ZJKA 1U3HA 3DSNB 2I24N 3RRQA 1NOAA 4Y19A 3VXSB 1VERA 5BV7H 2PLKA 3NZQA 4GZEA 3EXJA 1VLXA 3CQPA 3KLHC 3FCSA 3ABZA 5DQJA 1OCBA 3E3QC 4Z7UF 3G7TA 4U05A 3RILA 2HT2D 3KWTA 2BNRB 2FB4H 2QBWA 3QMSA 4ZAKD 2DYSB 4OZFA 3FULA 5F96H 2LABA 2A3HA 5D70H 1KW1A 3CVIL 2QCGA 2X16A 2EYTA 2OTWA 4L3CA 1PNDA 2YDSA 3CLFL 2LFEA 3GIPA 4CJ1A 3UFYA 3NPWA 1JWMA 4PRAA 4HS6A 2NY0D 2I56A 1QVBA 1T7XA 1ME7A 3DX9A 4M7LL 2C9XA 1OZTG 3CT7A 3GRWA 3OU8A 4IRSB 3MBFA 1BX2B 2K8QA 2QSTA 2UY6B 2CESA 5D09A 1CF8L 4HUCA 1OD0A 3FUDA 4M6QA 3ZS4A 1V3LA 3QCTH 1BD0A 1NC2A 3E1F1 1WIUA 4BSWB 4KRLB 3FJ4A 3ZJ8A 3A9IA 4RDBA 2NSMA 4Q4PA 5AZ0A 4AD0A 4KTEH 1BZ9A 2ITCB 5JHLA 2HE5A 4OLUL 1WK0A 2VDMH 4F8PA 5FSEC 3BWUC 1YN7B 2MANA 3R6IA 4KOBA 3GEWB 3WIHH 3NEXA 1FWFC 1OSPH 4MNQE 1NLDH 2NNFA 1WZLA 4NFDA 1YBQA 4BZ2A 3OKEB 5C0RH 1FO0A 1X5FA 2X6UA 3LERA 2F53A 3CZKA 4LY8A 3UR5A 1DZBA 2ZOTA 4IOSA 3LGDA 1NIUA 1OBAA 3MCKA 1CXHA 3QARA 4LMQI 1E43A 1K77A 4JZNA 4I3SH 3HNVL 1P53A 1NCUA 2HVMA 3STFA 3KGUA 3C8DA 4ZMAT 3GJFK 3TEWA 3LS9A 5A6JA 1W0MA 3LQAL 4URIA 4OZIF 1Z2KA 1WZ1H 2AJ3B 4JO2H 3DZ1A 4YTRA 4JPIA 4LPCA 1GEQA 2WB5A 3MSDA 4HKBA 4FQLH 2F53E 3GKWL 3UDWA 4UTBA 1QOQA 3CBWA 3NQ7A 5D96C 4JYFA 3ZWTA 2ZX5A 4PA8A 3N1PC 3CU2A 1O9ZA 1M05A 4R7NA 3CFDA 3AT8A 5SWZD 5IW6B 3GMQB 1W5PA 5MERB 2QCHA 4LW7A 3RWJA 1FZMA 1H6UA 1NBQA 3VRIA 1XW8A 4PB9L 4G80B 2XIJA 4ZFZA 2CBTA 3W11C 4APQD 1W1PA 2ZWYA 4WHYH 5D9OA 2YQGA 3IXAB 4UZGA 4PUJA 5LHFA 4ANWA 2VERA 7PTDA 1JDCA 1W1IE 3T3PE 4LV9A 2XY1A 4DJED 2Y3AA 3X1GA 4R7XA 1QW9A 2HA1A 2HXAA 3CQKA 1HVQA 4JRXE 1IE7C 5CILH 4XPBH 1I8LC 2P8PA 4FTDA 4IRSC 1GW9A 2F74A 1OB1A 4YBQC 3IJ9A 5DRZA 1D7KA 1GGIL 4Z1CA 3ZDZF 2HPOA 3QPXL 4E68A 1GAFH 4C54A 2QHRH 3CO4A 4P3WA 3NQVA 1R9ZA 4EIZC 5KTEH 5IB1A 1L5GB 1UR2A 2Y61A 4TX8A 1PUDA 3KE0A 5C08D 3F7VA 4FNTA 3W2UA 3UBXA 5F6IB 1NPUA 4FQJL 5E4IA 2EVJA 4ATDA 3PWAA 4XP4H 3EUDA 4HU0A 1FRGL 3WL0A 4DWSB 2Z7ZA 5J1TC 2YN3A 4P46D 5A6LA 1LD9B 3V75A 4BGDA 3LHPH 3STLB 1YTKA 2VX4A 3AMGA 2F8IA 4DYJA 2UZYA 1RJLA 2VZVA 1TA3B 1FSKB 1J1PH 1MH5B 2QVMA 3VSTA 1F58H 4N6RB 4NB7A 3WO4C 4LHUG 4WIQA 4GS7C 2UV8G 4NO3B 3NSYA 4QWWC 5KBDA 2BVPB 1T0MA 1TR9A 4PRPA 2AQRA 3WS6C 5SWQB 6TIMA 3QIUB 4DERA 5C0FA 4OI9A 1XF0A 5I5MA 5J06A 1CGUA 1NCAH 4LKXA 3IJSB 3QH3B 2VXQL 3QUMB 4H9TA 1NC4D 3IFPA 3FO2B 1CLOL 3H4FA 2VAAA 2R51A 5EU5A 3PUUA 4UC5A 3FTGB 3S37L 4TVDA 1ETB1 3NCFB 4C56B 5AHMA 4Q8OA 1JWUB 1PS3A 1G7PB 1Y5VA 2CK2A 3QQXA 4PYGA 5AYIA 2DPEA 4A2HA 3VXUD 1LYQA 1U1UA 3MU7A 2VSDA 1RJPA 3NEOA 5IESH 4MQXC 4J6IA 1Q6RA 2W61A 3OBKA 1WAAE 4YU1A 2Q8BL 3NJKA 4Z42C 4NI6A 4FK9A 3RHGA 1XPYA 4UNIA 4ZUWA 5IFHL 4C8XA 3CN4A 1EGMA 3ASOB 3CHXA 2NOYA 1F05A 1ZFJA 3NOEA 2XTKA 1CQYA 2V2XA 4Q8BA 1DUZA 1N9PA 2B59A 2VDMB 3QUYD 3TP4A 2XYCA 5AVQB 4IMEA 1WAUA 1UFGA 1UYQA 3ZXWA 4XVJH 4PJBE 4OAWA 4XG1A 3BWSA 2C9UA 3UCQA 3UEQA 4NQ1A 1RZIB 4QBXA 5FO9B 4AOFA 4R8WL 3WJJC 5I8KH 4IG2A 4UIKL 2G3IA 2H1PH 2NYKA 4GG8B 1EAOA 2XWEA 4YR6B 1JZ7A 3RM4A 4TMCA 2P7TA 3OLIA 3PGFH 4WO0A 2NSOA 2EPOA 5F6IC 1L7IL 3O6FC 4KK9D 2A6IA 2WTPA 1TU2B 5CBJA 1B0GB 2Y2YA 4HNLA 4LHJB 1WS8A 5LG1A 3L3IA 1QSFA 5IR1A 2WAQA 4O51B 3KCPB 2BCMA 5FF6A 1PDYA 1RALA 2PU0A 4LC8A 3WQEA 3WQ4A 5FGBC 1SJEA 3VD4A 1CLXA 4TQIA 3IDXH 1QNZL 1WDAA 3VXQA 3WO4B 4RCXA 3V4VL 2BOCA 5MENE 4LVEA 1M3JA 3RAJL 4N5EC 1ODUA 5K9OA 1HP4A 3HV8A 1IFHL 4LSRH 4PD4K 4PTTA 4KK8C 4L3EB 3DHFA 3U7YH 4BQ9A 1NDMB 1INQB 2GABA 4MA8L 4R0LB 3N1FC 4ETQA 1MFEL 2OJEB 1JPFB 3HHSA 3KVLA 4AQEB 3EJJX 2X4TB 4XZ9A 3X13B 2XZCL 2D7NA 1KCSL 5CSSA 1PIGA 4M7JH 3C0QA 1T1YA 5E9NA 1ZAHA 2XV3A 4QRNA 4OH2A 1FWWA 1I7TA 2A1YA 3KCOA 4XPHL 3B37A 4GW4B 1EHKB 1HHIB 1BOGB 3LDBC 3LZFH 1M9HA 2PW2A 1X8FA 2JI2A 1UM5L 1NCNA 1XCQA 3RTQD 4X9BA 5KBLA 3AYVA 1NJ9A 1COBA 4W7VA 3RU8H 3SQOL 3DYPA 4G6KL 4GRLD 2ATAA 3X1EA 4PC8A 4LP5A 2XETA 2XWBB 3QO1A 4ENZA 3QYQA 1KKOA 3LLDA 2QJJA 5T1DH 2QKIB 2QCLA 3MJ8A 2E86A 1KGYE 2WOYA 3KJ4B 3P4OA 3P9LB 4ZZFA 1PVHA 3LD8C 4Q4KA 3ULVD 3RCYA 5ABEA 1HU8A 4ONFH 4A63A 5KETA 5KYUB 1A02N 3HHMA 2D0GA 3B0UX 1GVYA 3DVGA 2O30A 3QIWA 5EZOH 4M6OL 4KCVA 4CEXC 1NLBL 3JTTB 5DRWB 1PAMA 3KTXA 2JJTC 3UJJL 3DIFB 1WICA 3V95A 3N6YA 5AD0B 3V7AE 2PE4A 1TJHL 4RFNC 3QDME 4UAOB 1NC2B 1KR1A 1A8ZA 1GL4B 4XB7A 3HVNA 1BIIA 1KCWA 2SODB 4K7FB 4QE5A 3PG8A 3RDTC 3EGJA 1BZ9B 1S46A 2ITCA 4P49A 5CZXD 2E25A 2QSQA 4DJFC 2HISA 2XBDA 4K9EL 2EAEA 4DPCX 3AXHA 3ZO9A 2OO0A 3B2VL 1LJMA 5DA0B 4BFJA 1KGCE 5HPMA 3D05A 3F6JA 3RVTC 1JAKA 4LCSA 1XIDA 5KVFH 1V51A 1VPXA 1WA3A 3SADA 1U2HA 4TLKA 5C3LD 4JZJB 3QORB 3IU4L 3CSFA 4XPGH 1S2AA 3W00A 4JHUA 4OIIL 1OTUD 4JZ5A 1Q2SA 4NM4H 3LRKA 4O2EA 5FUOL 5T3XH 4CUCA 5HHPB 1LK2B 3MDUA 1QHZA 2AXFB 4QT5A 5D7IF 3UJFA 5DMGC 3II3A 4JPQA 2WNNA 3UNTA 4I8YA 1CCWB 2EXOA 4UFHA 4E8DA 3ES7A 3QOMA 3LN9A 5KJ7E 4MZ2A 4IMGA 4MKNA 5D33A 2IADA 4M5SA 1WAPA 2ZG2A 3GI9L 4HKZB 4WKHA 2PAJA 2NW2A 2Y2WA 4TULL 4AWUA 4NASA 4M7ZC 3UP1A 5MERA 3D52A 1M7IA 1RK1A 1CLZH 1NGZB 2N59A 4WTXA 1E6NA 3QUXB 4O4YL 4HJIA 2JCCA 4NT6A 3VD7A 3X14A 4S1SL 5HVHC 2E59A 2PWUA 4W88A 1YEGL 4OZFG 4QTGA 4U5KA 5KZEA 2L8AA 1OKEA 3LZNA 3E3HA 4FCAA 3W5MA 3SGJA 3C3NA 1KIPB 3LCWA 1WA2X 3VIOA 2QVFB 4Q97A 5INCB 3B3BA 1W9BM 1UZ6F 3CB3A 3QDGD 3WN5C 3EMCA 1A7PL 2ZKWA 4QHKI 4PJFB 4WWKD 3PTMA 4RDWA 2ZDRA 3FA4A 4LARH 1BBJB 3KPQB 3KDPB 3B83A 3TIDA 4RFNB 2XWXA 1L0YA 5IB4B 3C4UA 4BSWA 2VX6A 2XV0A 1CENA 2PP0A 2EQDA 3R0UA 1RZPA 3P3RA 3PP4H 1MF2H 3QUKB 1XM3A 2V38A 5TGBB 4P61A 1UQYA 3W9ZA 1YN7A 2G60H 4DUWA 2G2NA 4NYLA 1FAKT 5JOFA 1KEGL 1E55A 4J3ZA 1IGCH 4DGYH 2VQ4A 2GQ9A 4D94A 1A6VH 2B5IC 1P7TB 4LBEA 4ONGL 1FWJC 2QCMA 3P2DA 4O53A 2OL3L 1E9QA 4R7DA 1F07A 5D2XA 4S2BA 4UFKA 5IROD 4D72A 5ICXA 1JYXA 2WHJA 3KBWA 4TTDD 1DBBL 4L4LA 4XCFH 3RL1B 5I6OA 3GUWA 4UILL 2EIEA 1W32A 3MNZB 4NC1C 2XH7A 2YCIX 4Q8WA 4QXGH 2P80D 4WQOA 1GQKA 3TWBA 2EE6A 5C0ND 2EUWA 3GSNH 43C9B 2CZVA 4FERA 3GRIA 3ZBMA 2DYRB 5C3TA 3CEPA 4Y96A 1JERA 1GOHA 2GG1A 4HUWB 2QEZA 3P2VA 3AQUA 1U95A 4JGUA 1KTKE 3IFOA 3QYMA 4JIHA 1FGNL 5M94B 1XB8A 5E8EB 1LL4A 4U4MA 1DDHA 1R2RA 1OCOB 3QJXA 2WLZA 4DO4A 2O55A 3EX2A 2EILB 4ZK8A 5KVGH 3S9ZA 1TKWA 5IROA 3T0WA 1RK0B 1TLMA 3W28A 3FKRA 3RGVC 4GRWE 5AFDA 3IXAA 1OSEA 4XCYB 2XN9D 3RGBA 2WMHA 4GQ9L 1JZ8A 4JK0D 1TJRA 4ZE5A 1OVZA 3AT0A 4XC3L 4HNTA 2FBRA 3O11A 2BSDA 3HCVB 3ZZSA 4DPAX 1UH3A 1LP9B 4JQVC 3VUAA 3GNDA 3ECBB 2MSPA 2VDLB 1E6SM 2DORA 2P43B 1LVEA 4I4WA 1J9RA 2VCBA 4G6FD 3DFPA 1UZ4A 2RJGA 2VDOL 3EKCA 3PUOA 5F72S 4NUWA 2TAAA 2WWCA 1QEXA 2R9RA 2OKOA 4Q8NA 5GHWH 1EEZB 1WS7A 1JGLL 3GVGA 3ZM8A 3GLZA 2VP8A 2P5PA 4UM8B 4EWND 2EDXA 1VF5C 2R0KL 3UBXG 4YS4A 5LG6A 3T0CA 1Z9LA 2IXQA 4RMUA 4U1JB 3TT3H 3SCQA 5L2JA 4FHKA 3G1HA 5AYZA 2WW5A 4BH7A 1J01A 2GGEA 5GJPA 4UR8A 5F21B 3LLFA 3AS2A 3ZTNL 2FUQA 1H50A 3WTUA 3LZPA 1TA3A 3GXIA 5JW5B 1H5BB 4IBWA 3CU1A 1BYAA 2ZZ1A 3LK6A 1HSBA 2ID5A 4Z0XB 3EB4A 1T21B 4PV8B 4DPBX 1DVZA 4JY4A 4QHMB 4AW7A 3ZGHA 1KB5B 5C9JA 2PTDA 1XCFA 3KWWA 2E9GA 3GC3A 3MCYA 5AWNL 5SWQA 3ESNA 2AV7A 5C5YA 3ARRA 3BPWA 4POZC 3MRKA 2YRZA 5D72H 3GG8A 3PUEA 1B6DA 2OKTA 2WSQA 1BECA 3V0IA 1HK6A 2P80A 5JUEH 3C3UA 3G24A 3TC7A 3U0HA 3RFZC 2XQYG 5F89B 2Y4SA 1JL8A 3RX9A 3SFWA 5CD3A 1RIHH 3PG2A 2EKSB 1FGVH 2FATH 3U4KA 3OZOA 3ORJA 4UT9A 5JH2A 4Z3FA 2HLAA 1BQHB 5K33A 2BP3A 4IIZA 4PJDE 1OPGH 3FAXA 2R8SH 2NMSA 4JNXA 4J3UA 4MDJB 1EGJH 2YD1A 3STEA 1NDGB 3GNRA 2L4OA 5D1XE 5FF0A 1JGDA 1CK0H 3QEZA 4E36A 4MNQB 4ODUA 5CLYA 4J3OD 3CYJA 1UCTA 3BLFA 1KRBC 2PSNA 1GQLA 2MQCA 3GD1C 4J3WA 4JRYA 1S78C 3H2CA 4WUKL 3RY6C 4NM8L 2VKXA 4UQ2A 5SWSB 1JNJA 2Z29A 1MFBL 2NY0B 1KFWA 3L66A 5D7SH 3RTQC 1K03A 1XYFA 1X4XA 5BMFL 2WZHA 3E8UH 4PP2B 2X4NA 4PREB 3B9KB 4N86A 4PUBH 5FWRA 4HJGA 4X6FB 5KBMA 1XI3A 2ALRA 3KZ8A 1UURA 1BQGA 1QYGL 2FZ9A 5CJXC 2FECI 3TCSA 4LRIA 3N0PB 2IDQA 2VZUA 1R30A 2XFXA 5EPMB 4YWSA 3VVGA 1QI2A 2WZIA 3R10A 5BXTA 4NI3A 1L6ZA 5DJ0A 1A3QA 3O3AA 3E9UA 4A7TA 2UX6A 5KANI 4FJZA 2VC5A 2Y5SA 2W0FA 3KBJA 3NIYA 4FXGC 4IEFA 3P4MA 4IBZA 1XKYA 4G5DA 4ODBD 4DEWA 2GJ6E 1RZMA 4JTGA 1A80A 4M19A 4LFHG 1W3KA 4XMUA 2Y1AA 3SBQA 2BRRH 5M5DA 1EO7A 4N8CH 2D2JA 4ABWA 1L2UA 4YJ5A 5ID1A 5K9OB 4GRLA 5TQ2L 2A99A 3G1YA 5FEZA 1HINL 2AMXA 1UC4A 1G5GA 2F5AH 2OJZH 3C60C 3QXVA 2JKRM 3VIIA 2V8LA 5AZEL 2UWEF 2JIEA 3LHTA 1CFVH 1H7XA 4JN1L 4XVOA 3OR6A 2FO4A 4BFIB 4CU6A 4ZMVA 1EPFA 3DUSA 2VAAB 1D7BA 4LEEA 1YRRA 1IJNA 5DXWA 2QDVA 3MHZA 4YDJB 2B14A 5JDJA 1QK0A 2BMBA 2I5GA 2X1RA 4XD6A 2CBVA 3E9AA 5I00A 2FPVA 2NLYA 2YQ2A 3BPLB 3IGLA 3BTNA 4DJDD 3VGBA 4X6CB 3MRHB 1SY6A 3MV9E 3O6LH 4JJ5B 3OGCB 1DJWA 5DMYA 4YL4A 4IJCA 2MPAH 3FUMA 1VAHA 3TESA 3MA8A 1MUMA 4NRYB 3GTFA 3NT0A 1FDJA 2XLLA 5D7LB 3HGJA 1GG1A 2X0VA 1XV8A 1PKNA 2NXYB 3A5VA 3BQUC 4KHXH 2X4RB 4EWJA 2J6EL 2PR4H 5FIPA 3SPVA 1DBBH 1AQMA 1I7RB 2WD0A 3K3QA 4ZUTA 4FTVE 4LEXH 1KENL 3ZZQA 4F7KA 2H9AB 3D06A 1AQ0A 1OTSC 4LIQH 3RFZA 2Y7OA 3VA2C 1QLFB 1PEZA 5DUBA 4J5NA 3F7KA 4M8VA 1T6WA 4QXGL 4BM7A 2GWGA 3FQYA 1OCRB 5B4MD 1SXCA 1W31A 4X8JB 5DLLA 1F6AA 4EAYA 1CLCA 2AJVL 3BQ6A 3QCVH 2A6IB 1VYPX 2DJLA 2R1NA 4IX0A 3LKNB 5GRZA 2DZUA 2DQIL 4YMPA 1M42A 2BSBA 3L3JA 4X99A 1P4LA 2NR6D 3WIFB 2VM9A 1H3TA 4INFA 4L8CA 9XIMA 5CKSA 1ECYA 4C56E 3OA3A 1B30A 3CO8A 3KVDD 3N2JA 2IO5A 3UZWA 2OCJA 2DYPD 2Y07L 1YNQA 4Z1DA 1OSYA 2IWFA 2ZCLL 4P2CG 1DCLA 4WSJA 2UVEA 3H2PA 1LGVA 2CO1A 3C60B 4H8UA 2BX7A 3U30B 4P2AA 4KKBC 5HYJB 4JR5A 4EDXB 5I18H 1J5OL 2YSTA 1US3A 5JU6A 1P4UA 4X7EC 1JULA 3WH7A 2BWQA 3BDYL 2MQ3A 4IJ3B 1RIVL 3CDZA 4PJCA 1XLEA 4K3EL 4L56A 3T9PA 1E6XM 3GYCA 1HHIA 1M03A 1EEQA 4OCRL 4P59L 3RUGE 3FONB 1CD0A 3ZXAC 4DGVL 3P2BA 1I8KB 4ACZA 4TVPL 3L23A 3D4CA 2J79A 3OB0K 3VXMD 3RGVA 1T3FA 1U8HA 1WAEA 1OCZB 2C5DC 1E4KA 1V55B 3ELFA 2ODIA 4FIRA 4P2RE 1W5QA 5GRXG 4Z1BA 1TTFA 3A6BH 1LO5B 1FSKC 1JMXA 2QGYA 1NFDE 2F7PA 3G0XA 4L8BB 4IP5A 4QO1B 1ZE3C 2IKJA 1XGUA 3RURA 4URTB 4GMTL 1MJ8H 3HMCA 1GPOH 1U8LA 1HCFX 4P46A 3SIMA 2W66A 1U92B 1USQA 2UXTA 3F7PC 1H0IA 3GMRB 3JZYA 1UCWA 3UZEC 1S9XB 1T2JA 1XTMA 2K7QA 2WQWA 3C5JA 4KZ0A 3RI5K 5EV7A 3N85H 4KJWD 5IT2H 4NT0A 3CUXA 4Q7DA 4KHTH 3AM8C 3EMZA 3OKLB 3ZMEA 1NF0A 2HRGA 4AM0A 3ISIX 5E2JA 4G9FE 3KLLA 1GVSA 1OX5A 4GJJA 3SCOA 1UJ3C 3RR1A 5B39B 3MMTA 4LUTA 3HR5A 3HM7A 2YBUA 2YLLA 3N04A 1EBHA 2CHRA 4KKRA 1EUNA 1KXTB 2B39A 3MMUA 4NYLB 2WO4A 1HZYA 4GVHA 4RGND 3S6TA 3HGSA 3DBNA 1FNHA 3QQ9C 4KK5D 5DI8B 1KRCC 4BH7B 1Z0MA 3DOPA 3OV6A 4CCDA 2QF7A 3NJJA 2XNAA 5AW3B 3SCMD 4BQ4A 3TLRA 1FG9C 3U30C 4E2DA 1H5BA 4NZCA 4K71B 1TKKA 4S3CA 2WJDA 4XNZC 1A9VA 2WQSA 2PRMA 3O06A 1WV2A 4W81A 4XC1L 2I9EA 2CIKB 2XVKA 4HOZA 1KACB 1HCZA 3AWNA 5HDBF 5AB2A 4Y90A 1D9EA 3RBSA 5FHAH 4GBXC 2NUPB 4H1LG 4HA0A 2EE9A 3DJTA 3LNEA 1W0VB 1T5AA 3HS0B 1EZ2A 1L8PA 2C1HA 3EKLA 3VKJA 2VH5H 3GHEH 2VENA 2FTAA 3BISA 2K6ZA 1EC9A 1VQTA 35C8H 2ZCKH 1MFVA 3UACA 5DHVH 2IVFC 3MLWH 3O9WA 4L65A 1W6LA 3G6DL 3X11A 4OKVB 1GOOA 3RM9A 5D2NA 1SLXA 2HT2C 1IAII 2W0PA 3GHPA 3TH3T 3WFHB 5DT1H 2Y36H 4F33A 5IHWA 4G8GD 1SN0A 1NBVH 1P7QB 5KMYA 4E9SA 1V7NH 3H9SB 2B4GA 1DJGA 3LPOA 1XDJA 3MHGA 3LH2H 3SJNA 5DZAA 2AJUL 5EUKA 4X7FC 1A7OL 3GIYA 3I3BA 4GAGH 8TIMA 4L3AA 1F5WA 1QNZH 1BBJA 3KPQA 2Z4GA 4G8TA 3PULA 3UT0A 3GSRB 2DMKA 3HPLB 4GRMB 1BYNA 1WWBX 4R7OA 4E5TA 5HI3D 4S0TD 3NVDA 1ZT1A 2DSKA 4QJ3B 3STBA 5EN2A 3QQ3A 5I71B 2Z3FA 3R18A 4JDVB 4P2RB 5EC2B 4CD6A 5FEBA 3RPBA 3UX9B 5GJNA 4PCPA 1E71M 4MNGA 2BW4A 4I5BB 2JLLA 3HC4L 5J1SC 2G4EA 2PKDA 4UOW0 4JTRA 4P8UA 4IIQB 5CPSA 4QR7A 4BKSC 4GKSA 3Q6GH 1LROA 1TQJA 4QDWA 5ICXB 6FABL 1UWAA 3DENA 1S7XB 3WLHA 3CFJB 3I7RA 4DN4L 2W0UA 1I8UA 4XNZB 5A2CA 5ID1B 2EH8L 2X6AA 3TS8A 2ADYA 5C0DA 1ITXA 2AL2A 3UXIA 2HXUA 1N8OE 2BWIA 1BBDH 4YHPA 2ZG3A 3QWRD 2AV7B 5B3NA 1SDDB 3LG3A 2JI1A 4NZFA 3KYKH 5CZJA 2GK2A 3BW9B 3FF8A 4HYWA 1YYLH 3VD9A 4V15A 1ZLUH 4WHBA 1ES0B 2NCEA 4OCYH 5DQDL 4PN2A 1VFHA 2Q71A 4F4RA 1BVNT 4IGBC 2PDKA 2ZZ4A 2CERA 1RZGB 4WCYL 4GQZA 5JOPD 3BLDA 2VD8A 4ILDA 2AEQH 2IGTA 4QOKA 2DIJA 3V52H 3O16A 2IH8A 2EDHA 3EJCA 3BXNB 1FIEA 4P48A 5HI4D 3LN5B 5DD0H 4LB8A 5ACMA 1XMEB 3ZT6A 3RPTA 4PJ9D 1ZGLM 3NFPB 2UZ9A 1U8MA 5HGDB 3GI8H 1FAIL 1A6AB 1OGPA 2E3VA 2Z31D 3AWOA 4YBHA 2UZIL 3UO1L 4YQXL 1XQKA 1P0NA 3G1SA 1KEML 2J8UE 1AGBA 4G1EA 1OSZA 1IE5A 1S3TC 2W27A 3DXAE 1FBIL 2KS0A 1FGNH 3P5ZA 4ODSL 4YHYB 2KH2B 4HK3J 3MDJA 4PJHF 5KVEE 3ULVH 1YECH 2Z4TA 2QJIA 1P6BA 1PBGA 4O1CA 2J2ZA 3CSYB 5AVWB 2XX1A 1VRDA 1CC3A 3DDFA 4DCQA 1FNGB 4KDTC 2J9XA 2NY3D 3FUEA 2H0EA 5D2LB 1IM3A 3UAAA 4WI9A 1P1ZB 3CV1A 1CDBA 3N14A 5H4YA 1H63A 3UZVA 1DQJA 2VLKB 1ZA3B 4WTZG 4XPTL 1DQTA 3BUTA 4PV9B 3R0KA 3GTIA 2EDTA 4O12A 4HXAL 4F8TA 5I6KA 1TWZA 1SEQL 1YYMH 2XC8A 3Q9QA 1C5DB 1UUOA 2WYIA 3LKNA 1BVNP 1EEXA 3S1XA 1GORA 3WNLA 5I23A 3EDKA 4UV4L 4RZCA 3SKNB 5HMEA 4LCVA 1V93A 4GYPA 3T07A 3HAEG 4CQ9A 4WNQB 3M0HA 1HCYA 3KD4A 1NGPL 3ATDA 1BZ7B 1E4HA 1TJHH 2XVLA 1R33A 4X6BA 4XNMB 5KYWB 4RIRA 5L6YL 1F1DA 2W0LA 3MC0A 3WL1A 3MO1B 3QJUB 4XP1L 5CH9A 2PTUA 5FW7A 2Q3AA 3P60A 3U79A 3EH2A 4CC4A 5EZIH 3NIGF 3KDOA 4LHUD 4K8RC 2JK2A 2FNWA 3WN5B 4IP4A 2VM8A 5LVEA 1RBAA 4OLWL 3WJJA 2KQMA 4F15C 4UIOA 4P7LA 1NUFA 2OQJA 2XKSA 2Z64C 2C79A 4EPDC 4LASH 5LA1A 7ODCA 2X1PA 5AYYA 1Q4NX 4LESA 4P2QA 1P7HL 4Y9EA 2Y1ZA 1ULVA 5LWYL 1ZTMA 2DI9A 3VNYA 1ZHLB 2GITB 1BVLA 1QHQA 3IETB 2DQHH 3PWLA 4POZD 1J9TA 2PCYA 3VFMB 5A1AA 5F7KC 4KX9A 1V3JA 4XCCL 4YDLC 1FCQA 1KYOK 4MSWB 2FTYA 4DP6X 3O1NA 3DETD 3ITCA 4TQ8A 4XBPA 4D0BB 3VGDA 4IMFA 3BCDA 4PTNA 4DO6A 3CQQA 4OV4A 4ZENA 2FPYA 4ZXBA 1RUPH 1PHWA 1F4WH 1R4XA 1INDH 5IOKA 5TDPA 4HS6B 1X9QA 4ZO6A 3ZSSA 4JUTA 2CO2A 1WDPA 3KWSA 5GNZA 1MI5B 5H2ZA 1AI1H 4WI7A 4OV5A 4XVUC 1T0OA 4JPWL 1CFVL 1FZOB 2HLEB 3B9KA 4TNGA 1O75A 3R7RA 3WIIH 3R0NA 2FT8A 1D7FA 4WKFA 5FAJA 3K72A 3I02A 2A3TA 1IXQA 2JV6A 4YXLL