2QMKA

Human pancreatic alpha-amylase complexed with nitrite
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 166
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmkA01
1BVNP 4TVUA 4AIUA 4MPKA 2C7FA 3UCQA 1ODZA 3HG5A 2WKLA 5E09A 2WHJA 3SCVA 4GIAA 4NZCA 3BVXA 3FAWA 4P7NA 5EFDA 2WVSA 1E0WA 4MJ2A 2CYGA 3AMDA 1W3JA 2RGLA 4KRTA 4GZEA 2FYVA 1B31A 3FXYA 4JL2A 3VD9A 2W4XA 3AS2A 4F66A 3T0DA 2Y24A 1HNYA 1BGAA 2VZTA 3WUGA 4UZUA 1VIWA 2VURA 1M03A 2EPOA 1WZMA 3FY1A 2YIHA 2AAAA 2DSWA 5CZKA 1Y7VA 3TA9A 2FGLA 3RPMA 4AD5A 2PBGA 4UFMA 1QI3A 4JAWA 4CVUA 1GJUA 2WSKA 4UFJA 3EMCA 2YL6A 2PF0A 1ODUA 3SCRA 1BVZA 7TAAA 1WE5A 1J10A 2WMIA 5GQBA 4AMWA 5I23A 2QPSA 3WEMA 1PJ9A 2VZUA 3CZGA 3SUWA 4BS0A 1KTBA 1JD9A 3VILA 4V27A 3WNMA 1H41A 2YDRA 1D3CA 5LYRA 4OIFA 2VVNA 1VFMA 1QI4A 3OB8A 5I79A 1W2VA 4EAMA 1QX1A 4E2OA 1C90A 3UG4A 2EPMX 4AEEA 1J12A 4ZEPA 2FH8A 2CIPA 3A6OA 4D6EA 2EACA 4Z2LA 1WDRA 5A6SA 1MQQA 1B3XA 2FHFA 3EYPA 4U5IA 3WD2A 1KR1A 3OIHA 4CCEA 4AIEA 4FNPA 2W66A 2HISA 1OGSA 1F4HA 1XGZA 3AQUA 3RM4A 3VOCA 1M04A 2WMHA 5HBFA 2WCSA 3AJ7A 3E1F1 1R8LA 3L4XA 4D1JA 1JFHA 1R34A 1PIFA 1J18A 1FHLA 2ESCA 3D4ZA 2VTFA 1O7AA 1GVIA 4UQ9A 1ESWA 3VM7A 2OW6A 3GBEA 4MAZA 3DX3A 3D4YA 1V6YA 2WZIA 3PTMA 1H0IA 4CU8A 3GXIA 4ZE5A 2O9PA 1E6XM 4AC1X 4PSPA 1SYTA 2FDMA 1HJQA 1E6QM 4Z2KA 2DIEA 1KR0A 1ZBKA 1EOMA 2HVMA 4D6FA 1C93A 2X2HA 4MNLA 1BQCA 2VOTA 2VR5A 1QWNA 1UQZA 3NUKA 1I1WA 1Q6EA 4AD3A 3BMWA 3EBVA 3N17A 2EO7A 4HMDA 2DIJA 1J0KA 2FHBA 3PZMA 1B9ZA 3B9EA 1UWQA 4URIA 1WCGA 3PN8A 1ZU8A 3A22A 3L2MA 1Q6FA 3AYRA 1UR4A 1ZBCA 2YL5A 4AZGA 5JBDA 3MMUA 1KWGA 4AZ6A 4MB1A 3DC0A 1MW2A 4JCMA 1JNDA 3GH4A 2Q8XA 1PEZA 3DECA 2PWGA 3EJQA 4ATWA 1UR0A 2W91A 3W25A 4U5KA 4D72A 3WDJA 1VEPA 2GDVA 1R85A 1GCYA 1WP6A 3RO8A 5ABFB 1BYCA 2DH3A 5A6LA 1NOUA 2OLHA 3CHFA 3KWXA 5KZ6A 1H11A 2WAGA 5C70A 2DQXA 1EXPA 2F7PA 1GHRA 2CKRA 2BHUA 2ZX5A 2WWDA 1FFRA 2DT3A 3SIMA 1J0JA 4DUVA 1V0NA 5ABFA 1US3A 2CETA 1K9EA 2JEPA 1VBRA 4MADA 2A3AA 1LG1A 1JIBA 5IHSA 3VIIA 5EFFA 3AIWA 2J78A 2XWEA 1E6SM 1NQ6A 3EJPA 2EABA 1VF8A 2FE0A 4PMQA 3FN9A 1K6AA 3VUPA 2ZXQA 3AXHA 3IGUA 2G3NA 4AD2A 2J7CA 1P6WA 2ZWYA 1UD8A 4CKQA 1TQSA 4B3LA 1NH6A 3WELA 4UZSA 2X2JA 5AC4A 2EEXA 4J3WA 3WNPA 1JGIA 4HPGA 4AZHA 2D23A 5A1AA 3QGVA 4LYRA 3OGRA 4D1IA 4CD4A 3AIEA 1IT0A 1H09A 5AYBA 1TA3B 2WHKA 1BSIA 1SZNA 3OG2A 4J27A 5I6SA 4NZJA 3FAXA 1E4IA 4C7DA 3LRLA 1V6VA 2VQTA 4M1RA 1E5NA 1E72M 3ZJ8A 1TA3A 2D2OA 4NI3A 3A4XA 4TTUA 4UOQA 3NDZA 4R27A 5A8MA 1E6ZA 4RE3A 5D8WA 4MAVA 5ECUA 1GOQA 3WQ8A 3JUGA 3UETA 1NWTA 3WMBA 3DYMA 1W9UA 2VI0A 2WC3A 1K9FA 2PWEA 5A6MA 3OZOA 4BQ3A 1XH1A 1CBGA 2WLZA 4WIWA 2DSUA 1U2YA 1QNPA 2DGAA 3WH7A 4P7LA 3U7VA 1MYRA 2FGZA 1TFVA 3MO4A 1QVBA 1W9VA 1E0XA 5CGMA 3NSXA 4P8WA 4W86A 1ZS2A 3VGFA 1EGZA 4AD0A 4GO9A 3UR8A 3IJ9A 4AD1A 3ARPA 3ZOAA 4TUFA 3MMDA 4B9YA 2GSJA 1B30A 5KEZA 4E8DA 3RJYA 2DEPA 2ZOXA 4C7FA 1IV8A 1VAHA 3W6MA 1TVNA 1V3MA 1WZAA 2F2HA 1XC6A 1EO7A 1HXJA 3VIMA 5FKYA 3MSGA 3M7SA 1QI5A 5CXPA 5E70A 1EDGA 2E3ZA 5CGTA 4M80A 3WF1A 3VNYA 2YLAA 1KGUA 5GNZA 1H3GA 4OKDA 1O7DC 4V2XA 1JAKA 1CWYA 4FNUA 4GZIA 1GW1A 1H2JA 4Z2GA 3CZLA 1B90A 3WEOA 5BXRA 5E9AA 2CBVA 2IUZA 4GO8A 1H5VA 4ATDA 3SCOA 3VSTA 1E56A 4MJ4A 3AMCA 3BLKA 1R7OA 4AYGA 1E4NA 3ZJ6A 4L4PA 1JZ3A 3LRKA 4JKMA 2EBNA 3AS0A 3MUZ1 1V3HA 1HJSA 2WXDM 1E73M 4DWSB 3S6TA 3WH8A 2OYLA 5HPOA 1VEOA 5BROA 4DUXA 1B1YA 3F4VA 1OT2A 2VRKA 2XIIA 8A3HA 1UKTA 3EDKA 3S2CA 3TOPA 4GQRA 4UQCA 3DX0A 2XUCA 5A6KA 2WKGA 4DWSA 3L4ZA 3WD3A 2J47A 3A5VA 3IJ7A 4WSJA 1QW8A 3WMCA 2E4TA 3U5YA 2VX6A 4QLJA 5A3HA 2ZE0A 2XVPA 3H53A 3MV01 4LX4A 3OBAA 2CBUA 3ALGA 3SCPA 3ZSTA 3AFBA 3GH7A 4BA0A 3WD0A 4PEEA 1QHOA 4YN5A 5A2AA 1ISYA 1JYVA 1G1YA 2NSXA 4AWEA 3THCA 3CMJA 5F7UA 2EPKX 4PCTA 4ZE4A 4U33A 2D22A 5JBFA 3EJSA 2JE8A 3AMLA 4LXFA 3HG2A 1CDGA 1UKPA 4MDPA 3WKZA 2D0HA 2GVYA 3KE0A 1V0MA 4J7RA 3HU7A 3PZIA 3NYDA 3WIJA 4P7OA 3G6LA 1X1NA 2VRQA 2J8GA 4OZOA 4D6HA 4GI6A 3FW6A 5DFAA 2W5FA 2BXYA 4Y7EA 4W8BA 1D2KA 2QMJA 5E0CA 3I3EA 4TVCA 1QBBA 3MI6A 2ZXAA 4ATLA 3W37A 3APGA 4YHEA 4P8UA 1CGTA 4AISA 3BAXA 4W85A 1ZJAA 1GNXA 3AOFA 3ZMRA 8CGTA 2WSPA 3WF4A 4JL1A 1RH9A 1EIBA 3W29A 2PWDA 2X0HA 3PZTA 4J3XA 4GXPA 1UWTA 3SCWA 1UH3A 3RILA 3KL5A 4AY1A 4M8UA 3TV8A 3OZPA 4EANA 2ZX9A 5E6ZA 4NZFA 1SMDA 2QV4A 1V6UA 3POCA 3WEZA 5JIWA 2BY1A 3PZOA 1SR0A 4M82A 1UG6A 3HG4A 4J3VA 1MFVA 1WPCA 1E1EA 4JHOA 3K4AA 2Y8VA 1B3YA 2WK2A 2YL9A 1CXLA 3AMKA 4WJXA 3L4YA 1HL9A 1JG9A 1YQ2A 3SCUA 3WDRA 1UD3A 1U33A 4IM4A 1HIZA 2ZX8A 2J7EA 2QHAA 1MW0A 1KBKA 3W38A 3GXPA 1ISVA 3WNLA 5LA0A 4ZENA 4W8LA 4LYPA 2ZIDA 2VR4A 3N1AA 4KH2A 4FNTA 4U31A 3WDHA 1Q6DA 3RMEA 3A4AA 1V6XA 3VD5A 2F8QA 4IISA 1GZJA 1HVXA 1UOKA 3BC9A 1OBAA 5EMYA 1QNQA 3QR3A 1I75A 4ACZA 3LXBA 1WB0A 3PZVA 1VENA 4PMVA 5HNNA 2XM1A 3BVVA 2X09A 3L4WA 3GDBA 2WHLA 3BSHA 3WQ6A 1ZJBA 2VX5A 4EK7A 3CZKA 1ISZA 3AHVA 1J0ZA 3CTTA 1S46A 4X9YA 2F7OA 1W1TA 1LLOA 3HMCA 5CG0A 2BY0A 3BAWA 4FNSA 4FLQA 1G94A 5D8ZA 2BY2A 3F5JA 1KXHA 3T2PA 2O92A 4UFHA 1XV8A 2BS9A 2XN2A 1XSKA 4TOQA 3ARQA 3ZT6A 1C8YA 3VMOA 3VMNA 2QF8A 3VGGA 1UHVA 1BG4A 3G6MA 3AHTA 1G0CA 4TX8A 1EA9C 2TAAA 3ZR6A 2WNWA 1LL7A 2WM0A 2X1IA 1DWGM 3NIYA 3A23A 3BCDA 4BQ2A 3DYPA 1C7TA 2BVTA 1ZL1A 2O9RA 4GI9A 2X8RA 4HA4A 1L0PA 4W7VA 1E70M 1E0VA 4B9ZA 2WHMA 4D6DA 3PTKA 4W84A 1EDTA 1HP5A 1KXVA 2CBJA 2XSAA 1UUQA 1OGBA 1UZ4A 1QHZA 1ZB5A 4WKHA 3ARVA 5HPCA 1UD2A 3BMVA 4CUCA 4UFIA 1CGUA 3CZ8A 3T09A 5C71A 5M3WA 4CCCA 5CPTA 2XHYA 5ABEA 1I1XA 1WZKA 3SURA 3PZUA 4A3HA 3AS3A 1M53A 4PMOA 1E6NA 3LX9A 3MSDA 1ECEA 1E43A 1E9LA 3BSGA 4M24A 2CNCA 1GQJA 2QMKA 3CBWA 4HU8A 2XPKA 2DT1A 4S3JA 3A24A 4PMYA 3D50A 1OWQA 1HN1A 2J74A 4HU0A 4HZ7A 5HDRA 1JXJA 4UCFA 2GJXB 2G3MA 1CLVA 1OT1A 3WL1A 3KL3A 5I24A 2C8NA 3EMZA 2UY4A 5CPSA 1EO5A 1KGWA 3VD7A 5IFPA 4HOXA 2J77A 3W28A 4JHZA 3AISA 3GM8A 2GJXA 2WVTA 3K1DA 5CLWA 2WMFA 1XD0A 2W62A 3GXMA 3OLGA 3W82A 3RCNA 4Z2IA 4Z2HA 1FP9A 4MTVA 5DT7A 4ZFMA 1TQTA 3D5HA 3GNPA 1JD7A 2D24A 2F7QA 3ZT7A 2WZHA 4QCFA 2WBGA 4WKAA 2D0GA 1SMAA 3VIPA 3WFLA 4D6JA 4FMVA 3DYOA 1BFNA 3F5LA 1ITXA 4PMZA 4BCEA 1CYGA 1PX4A 4UQBA 2J7DA 2VC9A 4PTMA 3VX0A 3SUVA 1W3LA 1NOFA 3D51A 3TTYA 3D3AA 4AIOA 1FP8A 2YLLA 1V3LA 2OSYA 1W2PA 1E40A 3OLEA 5E6YA 3KLLA 2EXOA 4W7UA 3CV5A 2WBKA 5AC5A 1JYNA 1J11A 1W9PA 1HKJA 1EHAA 3CUGA 3VSVA 3OLIA 5I2UA 2XFFA 2VMFA 1UWRA 2XVNA 3VSUA 4JFTA 4GKLA 1GOKA 2EAEA 3CC1A 4B3KA 4W5UA 2IXUA 1UD6A 2J25A 3TP4A 3B9DA 2XYLA 4OBRA 5CSYA 1CGYA 3KL0A 4BQ5A 1W9DM 1HWWA 4CU7A 5BCAA 5A6BA 3IJ8A 4HMCA 2G3JA 1LG2A 1TE1A 5A6JA 3BUPA 1QNOA 1B3VA 3CPUA 2JALA 3W27A 4MNJA 1XH2A 1B3WA 5BYWA 1PPIA 2CKSA 1HX0A 3BAYA 4NXSA 1NOWA 3N12A 4JZ5A 2V3FA 2BNJA 4W7WA 2OYMA 5DEZA 3VD4A 4TXEA 1QBAA 5FL0A 3VGEA 2B31A 3T08A 3WF3A 2G4FA 3PBGA 1CLXA 3WDIA 1UASA 3ARRA 1J0IA 1XCXA 1OSEA 3WUFA 2YA0A 1UQYA 1VFFA 5FCZA 2YDQA 3EDDA 3PZNA 3FHQA 1BPLB 4W87A 1OD0A 1EH9A 2ZXDA 3ZR5A 4LQ1A 3WQVA 5E1QA 5IXEA 2WC4A 4KRUA 3II1A 4PCSA 3WUEA 3GXTA 3HN3A 4H8VA 1UWIA 3CZJA 3RJXA 1UA3A 3GXFA 4U2ZA 3A4WA 1BTCA 1UD5A 3OA5A 1E6PA 4N0RA 5D9OA 1M7XA 4GINA 1BG9A 1MWOA 2X0YA 1YHTA 4NF7A 2V38A 2BVYA 1JF5A 2DT2A 4PMRA 2E9LA 3RDKA 3AZRA 3UESA 1MXGA 2BV9A 5DMYA 1G01A 4UFLA 1PZ3A 1C8XA 4AZCB 3AROA 4AZIA 4JFWA 1DWHM 3AIBA 3W24A 3TONA 5JBEA 3RIKA 1B3ZA 4FK9A 3AXIA 4M56A 1J01A 2WCAA 5HOSA 2GJPA 3L2LA 1QI2A 2DSZA 4AZCA 1CGXA 1VJZA 3ZQ9A 4K68A 4W8AA 2EPLX 4FNRA 2WMKA 1R47A 1PIGA 4JFSA 1VEMA 4CD8A 5IDIA 1JF6A 2ZUSA 2UY2A 2YBTA 4UQDA 2WVVB 2ZXBA 2ZUWA 2ZUTA 1TQVA 1LF1A 1V03A 1HKIA 4FNQA 2XM2A 1D7FA 3WY3A 2PWFA 3GNRA 4NSBA 2GUYA 3BUDA 1JZ4A 1UH2A 1W9BM 4HZ8A 1HJXA 3VGHA 5LA2A 2CXGA 1V6WA 2VRJA 1CGWA 3WY2A 1V3IA 1VFUA 2XFRA 3VDCA 3J7HA 3HG3A 5EB8A 2CEQA 2JFEX 4PUEA 3U7BA 2V5CA 3K46A 2W67A 1TQUA 3VIOA 3WD4A 4CD6A 1Q6GA 5D9MA 4ZXLA 4JIEA 3VIJA 4FLRA 1WDSA 3GYCA 4RE4A 4ZXOA 1XCWA 4PMNA 5C8BB 3WNNA 2BXZA 2ZX7A 2BFGA 2CITA 2VCCA 4PYSA 4H2CA 4JCLA 1FFQA 2YOCA 2GFTA 5FIPA 1W1YA 1TCMA 3K8MA 3VX1A 1PX8A 3BVUA 1XHGA 1FH7A 2VX7A 4WK9A 2JEQA 1NP0A 3WH9A 2G3IA 2DPEA 2VZSA 1UYQA 5M17A 3QHMA 4DO4A 3UG3A 3U5UA 2WC7A 2VVSA 3SUSA 4OOUA 3MUIA 4DWSC 2CCRA 1HJUA 2XN1A 1EQPA 2E8YA 4X0NA 1MW3A 1CTNA 1OB0A 4U3AA 4J3TA 2A3EA 3IANA 1XD1A 4S3KA 3EDEA 3KEHA 3PHAA 4PMDA 4HOZA 3AI0A 1OD8A 4JFUA 2GK1B 2PWHA 3LXCA 3GXNA 1AMYA 1UR8A 2XSBA 3TTOA 3BGAA 1DWJM 2DH2A 3ZM8A 4UQAA 3AZTA 3ZIZA 1JDCA 3WUBA 2GK1A 2FH6A 4W88A 1NWRA 3GNOA 3L4TA 3BUBA 3QHNA 2E40A 3SCQA 5BXSA 1NWSA 3ZJ7A 3GTNA 5I3DA 3LMYA 1E6RA 1UR2A 4J3SA 1WZLA 3O9NA 4C7GA 1PX3A 2DSKA 1HJWA 4KWUA 5A8NA 3TTSA 1KTCA 3BLBA 6CGTA 4CD5A 5A2BA 3MU7A 4QDMA 3O6AA 4AMXA 4PN2A 2WLYA 1W1VA 1ZBVA 3CH9A 3NSMA 1TQWA 1RP8A 3MV11 4H7VA 3ARXA 5DO8A 5FD0A 1GQLA 4Q22A 3UEQA 2A3HA 1OIMA 3ALFA 3SCSA 2VCBA 1GOIA 4AYSA 4HPHA 4QP0A 3VNZA 3PZ9A 3NJ3A 1FOBA 4FF5A 1PS3A 1V3JA 1WKYA 3ZO9A 2ZUMA 4OJYA 3W0KA 1HVQA 1JZ8A 1CECA 1E5JA 1GOWA 3RM9A 4EKJA 5GPRA 2A3BA 3VO0A 4L4OA 1UKOA 2XTKA 5I0DA 3WMSA 3N9KA 3DX4A 2OWXA 3WF2A 5A6AA 4IPLA 5AY7A 4KGLA 4TX6A 1BYAA 3I3BA 3LPOA 1GQIA 2PBOA 2J8FA 1MW1A 3AICA 1BYBA 4UTFA 2J4GA 4R5EA 2VUYA 2X2YA 3N04A 3VINA 4AZ5A 3QOMA 2DT0A 5EBAA 3WBEA 3GH5A 1JAEA 3SEPA 3UR7A 3N13A 1UKSA 4X0VA 3IAPA 1AQ0A 4FLOA 5LA1A 1JI2A 3VGDA 2XN0A 4XZWA 4LYQA 1W3HA 1VFOA 5A94A 3N15A 1Q4NX 1R75A 4D71A 4QCEA 3CHCA 1VB9A 1LQ0A 1A47A 5A69A 4DM2A 5FL1A 4F9DA 1JZ6A 1E55A 1N82A 4JFVA 2UY3A 1G5AA 1KGXA 4NRRA 5D4YA 1DEDA 4HTYA 4XB3A 2VNCA 3MS8A 1WDQA 5CJ5A 1HKKA 2MANA 2J7HA 2A3CA 3VKKA 4PMUA 2Y8KA 3M6DA 1VJSA 3PZQA 1F4AA 1VRXA 2ZICA 1TG7A 2Y5EA 3QHOA 4W89A 2EADA 1LL4A 3W81A 4MB3A 3EDFA 5DF0A 1BHGA 3MANA 4P7QA 1QNRA 4AZ7A 4H8HA 1QWUA 3NSNA 1W3KA 1W9XA 1J0YA 2G8ZA 1OGGA 1CEOA 2PI6A 1MXDA 4U2YA 1JNEA 5BRPA 3WDPP 1W91A 1TR1A 3CUIA 5ABGA 2XFYA 4E4PA 2ZUNA 1R87A 4UFKA 3EJTA 4A3YA 2VJXA 2JF7A 1WDPA 1CXEA 2WMIB 3N11A 1GJWA 1MQRA 3A3HA 4PUDA 1CGVA 4DUWA 3BVTA 1CIUA 1XYFA 5A8PA 1J0HA 1V3KA 1LJYA 2D73A 1KCLA 1CNVA 1JDDA 3BUIA 2DSVA 1QHPA 2OSWA 2D20A 2O9TA 3CIVA 2YFOA 5HXMA 2CHOA 3FNDA 3BVWA 2JIWA 3BAKA 3UG5A 4ACYA 5CPQA 2F1BA 2XWDA 4P8VA 5A8QA 1HXKA 1KFWA 3AYSA 2EJ1A 4WKFA 2BY3A 1GQKA 4NX0A 4BQ4A 3CZSA 1KB3A 3B9AA 4GZJA 3ARUA 3CUFA 1GOMA 5AYIA 3RM8A 1C8QA 2D0FA 4D6GA 4H41A 3DDGA 3VGBA 4XUYA 3AIUA 1QW9A 4PTVA 3CZEA 2F18A 1US2A 2J7FA 3K8KA 1PBGA 3W53A 1GUVA 3EMQA 1E4LA 3ARYA 1UR1A 1QNSA 2V5DA 3ZT5A 4WSKA 1FA2A 4HZ6A 4MB4A 2Y4SA 3AS1A 3AHXA 3CHDA 1V02E 3KLKA 4P7RA 2VO5A 4HOWA 1HF6A 3DDFA 3AHYA 1BAGA 2D3NA 1V08A 1E15A 1IZJA 2F7RA 1K9DA 3SCNA 4XZBA 3DHUA 1UWSA 3W4RA 3VMPA 2XIBA 3BLPX 2CESA 2WZEA 2V3EA 4TTGA 2J75A 4OUEA 5A95A 4E8CA 4GPNA 4YPJA 2CPUA 1KQYA 1X6LA 3PTQA 1R33A 3O2LA 3BAJA 2WANA 7A3HA 1CXIA 4DM1A 1JZ5A 1UD4A 4PMXA 3OLDA 1GOOA 1L8NA 3AIQA 1WAWA 2FHCA 3F5KA 5ABHA 3H55A 3CHEA 2NW0A 4W93A 2WYSA 1HTYA 4HMEA 4B15A 1HP4A 4OBSA 2JIEA 5M5DA 5GNXA 2VX4A 3WD1A 2X2IA 4CN4A 1XH0A 3T2QA 4BZYA 5I78A 2UWFA 4NRSA 4Q7NA 5JIPA 2XVLA 2WMJA 3WH6A 2V3DA 2VL4A 3VIGA 5FOOA 2W61A 2V3GA 2EPNA 3IK2A 3SCTA 4M29A 3W26A 4OGZA 3EJUA 2Z1KA 2G41A 2J62A 5M03A 2CERA 1ISXA 2GDUA 3VM5A 4MNMA 3GXDA 4CD7A 2OWCA 3VIFA 3VDBA 3WDQA 1CXHA 1KBBA 3NCOA 1ISWA 1UA7A 1MFUA 1U30A 1OCQA 5TD4A 4PSRA 2WVUA 1R86A 1OINA 3AXXA 3CGTA 3VTRA 4CU6A 2NT0A 3DX1A 1X6NA 3N18A 2W63A 1W1PA 4YHGA 2YFNA 5E0FA 1BYDA 5I77A 5IFTA 4GQQA 1DWFM 2WW5A 2EQDA 3T0AA 3BAIA 1JL8A 2WCGA 4HA1A 2YDSA 3ARZA 2AOSA 3BUQA 1NARA 1NWUA 2YJQA 4AMCA 2OWWA 2WPGA 4CN1A 4CN6A 3IAQA 3WENA 3LPGA 1CZ1A 1HT6A 3A21A 1JXKA 4JKKA 2F61A 3PZGA 2XVKA 2YA1A 1EOKA 1OM0A 3WH5A 3BXWA 2Z1SA 4JKLA 1B2YA 1PZ2A 3VIHA 2CHNA 1JI1A 2J7BA 1E3ZA 3K4DA 2OSXA 3SUTA 3WF0A 2J7GA 4PTXA 3MUY1 3CMGA 4AZBA 2ALWA 1B0IA 3WY4A 1RP9A 2IXVA 1XSIA 1DTUA 2XGBA 2XJ7A 4QLLA 3VDAA 4DO5A 3I3DA 2WB5A 1MQPA 1KCKA 3WL0A 2AMGA 5BRQA 3EDJA 1GORA 2E0PA 5A8OA 1M01A 1H0GA 2IGTA 3HJEA 1QOXA 3T0BA 3ARTA 1KXQA 2OW7A 1TUXA 3S5YA 3BCFA 4UR9A 4AEFA 1Z32X 1C92A 1QPKA 5BXTA 5BWFA 3UERA 4AD4A 1JFXA 1CXFA 1E71M 3FHAA 1EQCA 5A6BD 5CSUA 4H04A 4HP5A 1RPKA 4XV0A 5D9PA 1FHDA 1AQHA 3M46A 3CUJA 1JYWA 1DP0A 6TAAA 2WVVA 1FH9A 1E4MM 1AVAA 2BHYA 3WFZA 1O6IA 3H54A 3VD3A 2W92A 1TZ7A 3A47A 1UWUA 2VCAA 2VZVA 4KGJA 2ZUUA 3AZSA 1TVPA 4CCDA 7CGTA 1H49A 1H4PA 2XG9A 4F8XA 1E1FA 2NT1A 2QLYA 1XSJA 3WSUA 3L4UA 4BF7A 1K9TA 5DT5A 1JYXA 4NXKA 1FH8A 3U57A 4AW7A 4CVWA 2VQUA 2C0HA 1MVYA 1JZ2A 1GPFA 3ZJKA 3LPPA 4F79A 3AIRA 1HJVA 2UY5A 3THDA 4UOJA 4H8UA 3VU2A 3TTQA 4QAWA 5IHRA 4FLSA 1Q6CA 1HL8A 5CQ1A 2E9BA 4RL3A 1CENA 4WF7A 4TVDA 1GHSA 4EE9A 4J3UA 4V28A 2VZOA 4CGTA 1KXTA 1LWHA 4PTWA 3DHPA 1CXKA 2VT0A 3WQ5A 2F1AA 9CGTA 2WWCA 1E3XA 4UQEA 2D1ZA 3SUUA 1KQZA 4RE2A 4UOZA 3CUHA 2O9OA 3OGVA 2CBIA 3S5ZA 3MMWA 4W5ZA 3AIVA 4LPCA 3VDHA 1C91A 4F9JA 4IPNB 2GJRA 3BH4A 1SFSA 4DO6A 3NDYA 3AHZA 1CPUA 1XRVA 1W32A 1BLIA 3GZAA 2YBUA 1HKMA 3CZNA 1UR9A 4MDOA 2XVGA 3GBDA 3CO4A 3LPFA 4WLCA 3WQWA 1ZBWA 5CLTA 3QOKA 6A3HA 2E9MA 4QLKA 1TMQA 4IUGA 1JDAA 4P8XA 1UZ1A 2PC8A 3K8LA 4A4AA 5GNYA 4GI8A 1R7AA 4XX6A 3WNKA 3VPLA 1GVYA 3AMGA 3WN6A 2YKKA 4Z2JA 1IZKA 2BHZA 2BVDA 2PB1A 4M81A 5JUVA 1C7SA 1WNOA 2Y2WA 1QI0A 4KMQA 1BF2A 1XYZA 4LGXA 3ZSSA 5I5RA 4MB5A 3EJRA 1G9HA 3ARWA 4PBGA 2D3LA 1V02A 2OYKA 2XGIA 2YA2A 4UNIA 4D6IA 1H1NA 1GONA 4OOZA 3KZSA 3WY1A 1T0OA 1KWKA 3ARSA 1AQMA 1V0LA 1EHNA 2WMGA 1NM9A 1A3HA 1RD6A 1V0KA 4J28A 4PRWA 3B8SA 4AXNA 3M07A 4DWSD 1J9YA 2DDXA 4D6CA 1WO2A 4U3CA 4B16A 3HZ3A 3VIKA 4N42A 2ZUVA 5A2CA 1C3FA 3VVGA 2X05A 3POHA 2E8ZA 2QPUA 3OGSA 1PAMA 1LWJA 3WNOA 1VBUA 2ZX6A 3T2OA 4QFUA 2JF6A 1DWAM 4ML4A 1UH4A 4ACZB 1DHKA 3MKKA 2ZWZA 3D52A 1EDQA 2J79A 3WBAA 3ECQA 5BXPA 3DX2A 3L4VA 1R46A 4HA3A 1BGGA 3W6LA 1LL6A 1NP2A 3CLWA 3LXAA 1ITCA 1JZ7A 3LRMA 1OIFA 2YL8A 1DWIM 5D9NA 3WQ4A 4MNKA 3MUAA 2RGMA 1UKQA
chains in the Genus database with same CATH superfamily
2DWEA 2F58H 2VSKB 3FO0H 1N0XH 1YMME 4KX8A 4Y88A 5F70A 3IJSB 4RISH 1P1MA 1LD9B 4GZ7A 3AG2B 1I2RA 2RGLA 2V6HA 3QQ0A 1MLBB 1JPST 4O0KA 4LLYB 5EU6E 5EO9A 2CR6A 1S7WB 3HFTA 2VITB 4MJZA 4G8AC 2CLVA 3RUGE 5G55A 4APXB 3FY1A 2YIHA 2BMBA 3WJLA 3NGFA 3VA8A 2FGLA 4PRPB 2PBGA 2INZA 2HPIA 4S2SB 4QJ5B 4JAWA 5E8NA 2DQCL 4WHBA 3GC5A 3SCRA 3T3PF 3KBEA 4X0KA 2VZUA 1ZA6B 4TS6A 3N1MC 1P5UB 3P2TA 5DMKB 1NFBA 3E9UA 2VB5A 4DXKA 1NFIB 2EPMX 2HJKA 2EDTA 1KEGH 4MA8H 2EACA 4BKSC 1UWEL 4FHAA 1RJYB 2EZ0C 2R8WA 3WD2A 1ZV5A 3SZ8A 4FNPA 1F2QA 4EN3D 5E0QA 3K72B 1KLFB 1IL1A 1MCHA 3FU8A 3DBXA 2OR2A 1TPEA 1GHFH 5EN2A 3RDTD 1Y1UA 3HRZC 4ZFQA 2O9PA 3HE7C 2MCG1 4L3CB 3UP8A 1XF5A 4HG4J 4NOBA 4MJIE 3DFPA 1T66C 5EUOB 1I85C 4LAQH 4NAEB 3P40A 4WR3A 3BH9B 4AZ6A 2BP3A 4JCMA 4NN6C 4A7SA 1SFJA 3KRBA 3ANVA 1VEPA 3V6OA 4G9FD 5F72S 1QU4A 1ZALA 3ZZLA 3ZUNC 3HNTL 2L5HA 5A6LA 3GM0A 2JV6A 3KWXA 3MAWA 1CFQB 4QG9A 1M5WA 2H90A 5DSCA 3WO4B 4NSKA 3VOJA 5HWNA 1V0NA 1TJ1A 1NPJA 1CFTA 2AGJL 4HXBL 1U8JA 4F7CB 5IGXH 5GS1B 3NIDB 3N1FC 4GW1A 4IPPA 2R7EA 4ZUWB 5IK3B 3K6SA 1JV5B 5HI5C 4UV4H 4BSVA 5BW7A 2VM8A 4PJHF 2J7CA 4ODBD 3CVHH 4KWVA 4AX6A 4DGVH 5I3KA 1Q7MA 2Y6TE 3QGVA 4ZRGA 5AALA 3AIEA 2WAHA 2ZQ0A 1SZNA 4XVJH 3R1GL 3FAXA 2W0PA 1G1OA 1V6VA 4UR7A 5CD3B 5U7SA 1TA3A 4RX4D 5C0AB 2WXNA 5T1KB 1A6VL 1HZHL 2OLAA 2CLRA 4MAVA 1S7VA 3HAEG 4LLAA 1W5QA 1LEKB 3JS3A 4HA0A 2YSSB 5L6YH 4J5VA 2DD8H 3US9A 1ORQB 4S3AA 3LHPH 4JAMA 1M68A 1O5DT 4ZB2A 4AQOA 3GSNL 1N5YH 2NUPB 3O4LE 4JREB 5D1QB 4XO4A 4QROA 4L1DA 3HHSA 4HPNA 1PZAA 2A6DB 2ZZUT 3SQOH 2DRUA 2CC0A 3BESR 2ZOXA 3T65A 2AXHA 1V3MA 3VABA 2ROXA 3AWEA 1HXJA 3L9RB 3IDJB 4NJ9L 5E70A 3THML 1P53A 3C2OA 4LWWA 3D3VD 4KHXL 2P5EE 4KKBC 4GKNA 3C60D 3B7TA 4HF5H 2FYYA 1OW0A 2Q7YA 3BLKA 1R7OA 4AYGA 3VD1A 2JKEA 4N0CD 2YS4A 4MWAA 1NPUA 2QCGA 4Q6KA 1AZVA 2X44D 1RK0A 3I84A 3S42A 3LLDA 1OD9A 3NQ7A 4PJ7F 1FO0A 4GQRA 4Y2DB 35C8H 4LVHB 4UQCA 2B7PA 3T7VA 2XUCA 2QDGA 2XWTB 5IF0A 1MRDH 4G6AC 4CAGA 1PJWA 2J47A 5AG8A 3ZDXF 3O8XD 2YCKX 4MA7L 5CEZE 3M1OA 4M7LH 4JRXB 4LMQI 3UAJD 3Q37A 3TZVC 3SCPA 1TOXA 1F1AA 4BA0A 3L0KA 3RR4A 3IU3A 4AQ1B 2WKOA 2YRLA 4M48L 2QJDA 4ERAA 3P4OB 1KRCC 4YAQA 5JBFA 4HPJA 3C8NA 4I9JA 4O2CB 1NFDB 5K3VA 4QKTA 1VPQA 1XGPB 3PZIA 3MRJA 3OG6B 1JRHL 1GVFA 2PEVA 4C1LA 3DV4B 3FW6A 2J44A 2X1PA 3OMAB 3X17A 1HGYA 3ETSA 3R2GA 1JHLL 4AISA 1BREA 2Y7OA 4L3ED 4O57A 5FOBB 2HVKA 1U5HA 3FA5A 4LIQH 3G0XA 1ZT1A 1XF3A 3AO0A 5JPMB 1SMDA 5G4WA 3WEZA 4CDHA 4GKOA 5K69A 1MFVA 1QRNA 4PWFA 2WMPA 4FKHA 1HL2A 4MZIA 3WDRA 1U33A 3AITA 1KBKA 4F27A 2FLIA 4XX1E 4P9ML 4XP4H 1XR9B 3F5WA 3V0HA 3V1HA 2WGXA 2IQ9H 5MENB 3MA7B 3GFXA 4TMPA 3RCMA 3DO4A 4UTMA 3WUWB 2OJPA 1M3JA 3WQCA 2Q3OA 5CWSB 3TBWA 2C3ZA 3C86A 5ESAA 3KXFE 2KZWA 4HK6A 2WBJD 2OL3A 1OX4B 2Y7LA 2Q8BL 3QQDA 3BAWA 4RAHA 1G94A 4XNDA 2FTWA 1I1RA 3IJSA 3GRWA 5E6RB 1LD9A 1NGWB 2OK0L 2BS9A 4FPSA 1MLBA 4DF1A 1J9TA 4LLYA 3FUJA 1ZTVA 3E6FB 3VMNA 5HHQB 3STFA 1EWEA 2I9TA 2VITA 3AHTA 4N2OA 4DW2H 5C2XA 3EOYG 2JELL 1DWGM 4F8NA 1OQXA 4IL2A 5JHLH 2ZJSH 5J0BA 4IKIA 5I1GH 4PVNA 2MNUA 4BKTC 4G9FA 4L7ZA 5I0ZA 2PDIA 1ZB5A 2NQ9A 1XKJA 3VWKB 1ZA6A 3C87A 5I5IA 1NEPA 1D6EA 4GYPC 4N2GA 1DBAH 1F9CA 4KERA 4M24A 3CQIA 3CL6A 1OLZA 2ADJB 5KVDH 4TYUA 3RHWF 4XSLA 3LMJL 1OT1A 1XLJA 4KWWA 3IFNH 3AY4A 4MZ8A 4JHZA 3HZKB 1KCSL 3GMNA 1N64H 3RPDA 3GS6A 2XV3A 3UGXA 1LO5B 3N3TA 2WBGA 5KAQG 3M1BB 2KLRA 3FCUB 3MT1A 3PY2A 1U22A 4Z7UB 4MG4A 4I3GA 3GUWA 5EUOA 4RX4A 2VC9A 2R1YB 3VX0A 4P2OD 3HPAA 1FZMA 3L5MA 5F2MA 2F08A 5DS1A 1ZSXA 3MXVH 4A55A 3T8XB 3BH9A 1KKRA 3G5XB 3O6DA 2PWVA 2HK0A 3D0LB 1XM3A 3MKGA 1EHAA 3VSVA 5IBUG 4P4KB 4RW3A 3CAWA 1LQAA 2GJ6E 4W81A 3ARBD 3TMLA 4GXVL 2GT9B 3TQPA 3KL0A 3LQAL 4F7CA 1R3WA 3DLQR 5GS1A 1DBTA 4ZUWA 1FWJC 4PR5B 4UM9B 5DHYA 5AC6A 1JV5A 1F1GA 3JVGA 3HVDA 3AZUA 3SJVD 1JPGB 1AO7E 5GVJA 5FF3A 5AZ0A 2QJGA 4TPRH 3ARRA 4XOEA 1L6ZA 3CLMA 4HWEH 4F15B 3QQ9D 4EF8A 1BIHA 5KZMA 4XN5A 5CD3A 3HI5H 3FB8B 5C0AA 1Z6KA 3NABH 4GINA 1JWSB 4A2LA 3C3UA 2VE6B 1HAUA 1LEKA 1D8CA 3QBUA 8XIAA 3KLHC 3EF4A 4GJJA 1TJIL 1ORQA 1B5TA 4LKXA 4CSZA 2HWGA 5M95B 1CUOA 3DBSA 5CAYB 2YAEA 4LUSA 4AC2A 3VYPA 2NUPA 4MYXA 2ENQA 5XIMA 5KSAD 3I85A 3DJ9A 2EPLX 4KK5D 4JFSA 2ZUSA 5AW9B 3DKJA 2J12B 3HOGA 3BUDA 1W9BM 2X1WL 2CXGA 2BXVA 3QIWB 4QRFA 3K6NA 3EJYD 4DK5A 2K7PA 2Z8VC 4KDWA 3EZ8A 1FRGL 5C07E 4PS4H 2EIBA 3VIOA 2GSGA 5C3IA 2DLTA 1WLHA 3NWRA 2BXZA 4YHLH 5LBSH 4H2CA 1V5JA 2IDTA 2A77H 3CYVA 1O6TA 4F37K 2WYIA 1FH7A 5E08H 1NL0L 3WH9A 4XCFL 4H8WC 3UJTH 1PSKL 4G6JL 2WTOA 4NENB 2XN1A 4G6KH 5I3JA 2XWTA 3OKNB 3EDEA 2VDHA 4J3BA 1LORA 5MF5A 1IQDA 3RTQD 2VC2H 3CG8A 4NERA 1G6RL 5DC2A 1UFUA 3Q67A 4Z78B 2GK1A 4WFHD 4AQ1A 1RIUL 2UY7B 4JQAA 2Q8ZA 3GTNA 5I3DA 1WZLA 4NBYB 3VA6A 4O2CA 2IDQA 3DIDA 2WBJA 1XGPA 3PBWA 3DMMB 5SX5H 1QBLL 3GEWB 4Q22A 3SE8H 3GJFK 4Q9QH 3VFGL 4XWGH 4UINH 5H37A 3OKDA 1RXOB 3KBFA 3CFTA 2PDUA 2CO7A 3N9KA 1XGYL 1Y6NR 4P23C 4Y7MA 3FGCB 4AXWB 3Q9QA 1CDJA 5JPMA 4ZZFA 3SDDD 3EFDH 2NXYC 3MRLA 1TFPA 3VINA 4ZO8A 4JDZB 4TQPA 2H8PA 4G11A 4BY3A 3PWVA 2RAMA 1WUEA 2XN0A 4I3SL 1LTDA 1D5IH 1GSKA 5G5DB 4AH2A 2ZPKL 3W84A 3V18A 3DO7A 1FXQA 3EWXA 4MKMA 4DGIL 2OX1A 2NR6D 4HTYA 3NO3A 4L05A 4XNBA 1ROCA 4HIEB 3MA7A 2J7HA 2UX7A 4HLEA 4GXWA 4GRLC 2VLKB 3VFRB 3WUWA 1KNOA 2NX5A 3JUYA 3TJEL 5TQ0L 4BGDA 2ARWA 1YXYA 5C7HA 3AWFA 5L6UA 3S0CA 3HE6D 4J3ZA 1IBHA 3GVVA 3RX4A 1JPHA 3BWWA 4PODA 1PY0A 2D3JA 3FQTA 2I32A 4PB4A 4GQBA 2H3XC 4QYAA 1UQSB 4WFGE 3K2MC 1J7VR 3F7VB 3E6FA 1QATA 1LMIA 2CLKA 3DPBB 1OAZL 1J5HA 1MQRA 5SX4I 1VD6A 1MCPL 4LLVA 5C0IB 4DUWA 3MI2A 5E5LA 3QDMB 4OECA 1XCTB 4N20A 2ACRA 2VDGA 1QHPA 2IGFH 3FNDA 4XPBH 4ACYA 4D0CA 1VPXA 4DJEC 3VXSB 4F2EA 2ZXGA 5IESH 4U7KA 3JV0A 1KFWA 3LIZL 4RGMB 4WKFA 2BY3A 3VWKA 3MVIA 3D85B 4K07A 3CUFA 4PY7B 4C4BA 3H56A 4XUYA 1A5UA 3CZEA 5KYYA 3K74B 3CFJB 4XMXA 2XUWA 4KJYB 4F9LC 3BO9A 4BXSV 4JFDD 3STZB 2Y4SA 3MV7E 3AS1A 1MDRA 3BKJL 4GAYB 3CHDA 1ALDA 1A3ZA 2FO1A 3U82B 3ILEA 3VRIB 3GWJA 4GUGA 4DP5X 3HZKA 2AMUA 2PYEB 1EEPA 3CPLA 3UY8A 2WZEA 2YCJA 2QCNA 5A2FA 4YPJA 5I3GA 3P9MB 1XX9C 3M1BA 4PMXA 4MXWL 4Z7UA 1WHOA 4AEHL 1MI5B 4YXLL 1AD0B 1FDLH 4YNGA 3SE6A 2C3HA 1OSPH 3QSTA 1VFLA 1NICA 4FERA 3G5XA 4DJDD 1R0AL 3VJ6A 3CXFA 2VXTL 1FFOB 4PJCE 2BERA 2W61A 2H9GB 2EPNA 5EEZA 4P4KA 2OM5A 1HNFA 2Z2BA 4JFPB 4RFOH 3AG3B 1MLCB 8XIMA 3HC0B 3I7SA 4CD7A 2AANA 2VDKB 4NC2B 1KBBA 2GT9A 1GC1C 25C8L 3KPPB 4G7VL 5CZXC 4YSOA 2VZ1A 5D2TA 2DMHA 4UM9A 4HJSA 1V93A 1LDPH 1AR1B 4KKRA 3S36H 3X13A 2VDRB 5E0FA 1JPGA 3LS5H 1AH1A 4AWJC 3JT2A 5BOEA 2X4SA 8RUCA 3MRQB 3UTQA 2CA3A 5EU7C 1HHKA 2Y7MA 4OCYH 4X7EC 1NFPA 5CSZA 1EOKA 3KOWA 1MNSA 4M03A 5I9QC 3VIHA 5AOLA 3FEMA 1F4XH 4WFFD 3FB8A 3ORWA 2TRYA 4YLBA 2DLGA 1JPKA 2IXVA 4IBWA 1DTUA 4XN9A 4A7GA 3IS1X 4AX3A 1GORA 1COBA 4FZEL 4EZKA 1BJMA 3E6HA 3MKVA 4PMEA 4WK4B 5HAOA 2ZOWA 5CLZA 1QPKA 1EA0A 1M41A 4DBWA 4P0DA 1EQCA 1DQVA 3BP6B 2WPBA 4KRPD 4LVOC 3HR6A 3L5WB 4H88H 4HCHA 1T5KA 6TAAA 1K6QH 1AVAA 2BHYA 4EAYA 3D48R 4L8SC 1WX0A 4P2VA 1Q2RA 5DGQA 3QIWA 1UZ6E 4QTIH 5J8LA 5CD5C 3V7AE 2D7MA 2NT1A 2ZONA 5KAQF 5JU6A 2A3TA 5HHMB 1GPFA 4V15A 2X7VA 3BRDA 5HK4A 4YK4C 1REIA 1P1VA 3UAFA 4B5XA 4G8GE 3STCA 4IRJC 1DSFL 1HL8A 2DYPD 4MAYD 5EEWA 1TMCB 5DLML 3OKNA 3D7PA 3VFNB 1I1FA 4UOZA 3QIUA 4P99A 3B34A 2ZRWA 3E80A 3AIVA 4LEFA 4DF0A 4IIQC 1QDSA 3OVQA 1T5XA 1AC6A 1UCTA 4AGPA 3CO4A 5CGQA 2HKHL 2EKSB 4XP5L 5AVTB 1XRSA 1UZ1A 4LSSL 5AOUA 3CVDA 1FWBC 4EZLA 4XIAA 4HT1L 3DMMA 3LZ5A 3MA9L 5CBIA 2B7DT 3T77A 2FWLB 4NLHA 1SDDA 1UWGL 1MH5A 5IRPA 3DEQA 3TXZA 4IOSD 3K80A 3O0RL 1OM3L 3MJ9A 4RAUA 3T78A 1UB5A 3T0TA 1KA9F 3I6KB 1A3HA 2CZ5A 3ZKND 3FU3A 1C5DB 4JRYD 3G6AB 1NCAH 2DDXA 4S39A 2F53E 3HZ3A 2ATKA 3I75B 4TMCA 4J3OD 4JFOB 1WBXB 4DQOH 4LCCC 3CFKA 4R33A 4TQIA 1ZCCA 4MMZB 3EO9L 4WRHA 4U05A 4YLCA 1TZGH 3WBAA 5G5DA 4WW2A 3DG7A 2BJMH 5JUEL 4FABH 4XB8A 4HBQA 2QCDB 1DCEA 4WIQA 1F2JA 2DYRB 4CLMA 1NCGA 1O9WA 4NO2B 4GOSA 3LZRA 1DN0B 2VLKA 3FAWA 2V37A 3TW6A 2PU0A 3GNXA 3QRFM 3BQUC 2W4XA 2BNUA 4P49A 3ECBB 4J3OG 4M9PA 4A3QA 1AGBB 1Y7VA 3ZYOA 5JW5B 4AD5A 3IDYC 5FUOH 4HWBH 5I0VA 4NILA 4X4ME 3L68A 5I19H 1GJUA 3CX5K 5AW3B 5EUKA 2ICEB 4MCYB 3Q8CA 4GUPB 2XA8H 1KXVC 2E1WA 3DPBA 4EPBC 3DTDA 2I5YL 3MA8A 1R3RA 5ILTH 3DVGB 3QDMA 4NQUA 4X2UA 1A1MB 3WNMA 2C71A 5HDQH 4F8PA 3CL7A 1AD4A 2F19L 1KRMA 4QO1B 2ZAHA 1MZZA 4GK8A 3JV4A 1Q9WA 4R9HA 2Y7SA 2VENA 1B3XA 2EDYA 1OFBA 4N2LA 1KC5H 3T8LA 1XGZA 3WNIA 5I8EB 2PS2A 1EAQA 4D1JA 1A5AA 1F3WA 3OAYH 5C0BD 3TU6A 1QCWA 2HXAA 5E8PB 3VM7A 2WYHA 2QQKH 2WZIA 4AHQA 4ODXB 3CFJA 3P0VL 1SEQH 5DXWA 4KJYA 3AYVA 5I6XB 1EXUB 4JDTL 4KKCD 4KMLB 1MHCB 5DHDA 4NM8L 2DY2A 4AZUA 5I30L 2VR5A 1AQFA 1IQWL 5C0JB 3VRIA 5FGRA 2DJUA 1EX0A 2IKIA 2PYEA 4A7GF 1I1AD 1PFOA 3A22A 2HK1A 2HS6A 1KJVB 1MW2A 4XP1H 2Z93B 1TJPA 4NQXB 1HCYA 3P9MA 3U9PH 3WHE1 2W91A 5DFVC 2QXWA 4V1DD 1AH3A 1P6BA 1MI5A 1WP6A 2B0SL 1AD0A 2CALA 4LEEA 4JQIL 1YEFH 4BZ2A 2TODA 5DS2A 3HS9A 4XTRC 4DBSA 3ALXA 3WTSA 1QZ1A 1XL6A 3N42F 5AW5B 5BOPA 3VIIA 2H9GA 1WFNA 4P4RA 4XPGL 4JFPA 2AMXA 1AFVL 2FSEB 2ZWYA 4RLDA 4ZL1A 3WEXB 3D12B 2PRHA 1OSZA 4OGQC 2B7NA 4NZ5A 4HPOH 1BAWA 1LQBC 1F86A 1CLYL 1L6YA 3P7YA 4RDYA 5IM7A 3SGEI 3ME0B 2IIJA 4P9HC 3HOJA 2Q3AA 3MRQA 4TTUA 3W3BA 2JIXA 5ENWB 3CH1B 3DGRA 4RE3A 5ECUA 4HQVA 1J1XL 1MRFH 4KIEA 2VC5A 3PM6A 1WUZA 3TA3C 5L2JB 2WLZA 2Y5QA 4NT0A 4XCCL 4NRYA 1I60A 3QDHA 1DVQA 1HJCA 1Y0LA 2H45A 3IPBA 3TYUA 1M71A 4MDJA 2R23B 5CGMA 5KVFL 3GSUA 2C1IA 2CO6A 5GJNA 2OT0A 3RCYA 5DZOA 3INUL 4ZS6C 4YE4H 5DELA 1N6QL 4BQBA 3G6JE 2X87A 3JWOC 2ZKHH 1IGJA 1KJ3H 1L2QA 1GZHA 1T80A 3L5WA 3CVCA 4OKDA 3KRSA 1Z1WA 3VB8A 3MMEB 1H2JA 2FO8A 4TUJB 4ATDA 4UBDC 3ZY7A 1IEWA 3GVRA 2FMOA 3LD8C 3BARA 4IOSA 4KFPA 3Q3GB 5HVWA 5HHOE 1VRSA 3FHEA 2OYLA 1OWWA 3Q6GH 4WW2F 5DVLA 1K4HA 2IFGA 1SJHB 4Y16C 3MWCA 1OFPA 4L56A 2BS8A 2V2CA 2X5PA 3FUEA 1ZVNA 2FTAA 4BR1A 2PXYB 2KQNA 3ALGA 4GRSA 2APFA 4UTUA 1ISYA 3KP1A 5D2YA 1TITA 4PUMA 5MI0C 4NQDD 1V10A 1BBDL 3VFNA 1DJNA 4RRPG 1BD0A 5CU5A 4TNEA 2OXHA 3H8AA 2Z0BA 1CICC 2C1PB 3LZOA 4UT9H 2CU9A 4M1BA 3CV7A 2X4QB 4P8UA 4RCXA 1GTFA 2GC7C 1LK2B 3DJRA 4X99B 5E5MB 4HHLA 2B7QA 1UWTA 2PDQA 5E6IC 4KI5E 4AY1A 4M8UA 4MHHG 3EOAB 3QQXA 3ROOB 4NZFA 4XXWC 5D32A 3TPKA 4CVZB 5EPDA 5ANME 4DTGL 4HS8L 5BRZE 1MJJA 1P4LA 3K4AA 4R53A 2Q1EA 3GIYA 4WJXA 3BYTA 1T2JA 2QQLH 2ZA1A 4QT5B 1B4KA 1WS7A 1E42A 3VD5A 3FUIA 4A7UA 4JFOA 1WBXA 1HVXA 3FFCE 4MMZA 3LXBA 1JVKA 2O4EA 2BNRD 4TL4A 3L4WA 2CNYA 3BP7B 4EK7A 5FYLD 3EBAA 5FV2A 2EO1A 4JGMA 5C0BA 1WFTA 2H6PB 3GRGA 1R9XA 4M6OH 4FLQA 4NO2A 4UT7L 3OVGA 1FG2B 4NO0D 5B21A 3LPWA 4GQ0A 2ID5A 4FHBD 3QEGH 1KXHA 3H2OA 1IM3D 1DVSA 2KKQA 5ABAA 3TA4D 1UHVA 1BRLB 3VK5A 5DR5L 3G6MA 1TRDA 1DQWA 3ECBA 3S3GA 1RHFA 2ARJQ 4XMKH 2LAAA 4N0FB 1EA9C 3LHYA 3WS6C 4IGHA 1YTDA 5JW5A 4IOFC 1CI1A 2CBQA 2CDEB 4EIUA 4HA4A 1OAXL 3BI9X 3P73B 4YSQA 6PTDA 3SPJA 2CBJA 1OQFA 3WUZA 1SO6A 4UFIA 3SE9H 3DVGA 1A1MA 1G7JA 1RUQH 4CCCA 2VKZG 3X14B 2BRRL 3SCMB 4ABVA 5FV1L 4Z0JA 4QO1A 2Y25A 1HO1A 2CQVA 4NUJB 1NEUA 5EG6C 2QMKA 2D31A 3I2CL 1NIDA 1NF7A 3HNVH 3KEDA 1KCZA 3WD5H 3PYCA 2ZZ1A 5I1KH 5I8EA 4JFQB 4HU0A 5HDRA 4HZ7A 1JXJA 3C8HA 3ZIYA 4NUMA 1I7UA 3M64A 3CJJA 1XS2A 4LRNH 5E8PA 4C1NB 2J77A 3W28A 4G9DA 4Z3GA 3AISA 3GM8A 2WOQA 3MLUL 4RQQB 3OLGA 4ZSUA 3WFBL 5ALBL 5FC9A 3G24A 1MHCA 5HYIA 5DT7A 2VM3A 1KGIA 3ATEA 5H1WA 3FT2B 3G7TA 2DUXA 5FKPB 5C0JA 1GVOA 2Y7GA 1U8IB 4Q9CA 1IT8A 1T96A 1WFJA 5D6DA 5H8PA 5I1EL 4U1JA 1LM8V 1KJVA 1AY1H 2Z93A 1E40A 4OZHE 5FJIA 4HN8A 1UOLA 2LAGB 1EO8H 4JPVL 3JWDH 4HGXA 4DN4H 1QWGA 3RGHA 2O5ZL 4UR8A 1FWHC 1LO4H 1MCRA 3P4MA 3UTSE 3BLIA 1LWRA 3O41A 3N2TA 3FSWA 4Y4KC 4NS0A 3GB7A 1QNVA 4RZCB 3OVRA 1F02I 1HUVA 2EO9A 3WEXA 4JEJA 2Z7KA 2JJSA 3MVSA 3JWNC 1AZ2A 5INCB 3U9UB 3OPUA 3WUFA 4J3OF 5C2UB 3SY8A 1FSKC 3UYPB 3CN4A 3N9GL 3KM1A 2WC4A 4US6A 4HXAL 1EJSC 4OZIE 3ME0A 2VLJE 1NELA 3F7QA 2G60H 5ENWA 3CH1A 2V68A 3BFOA 5C09E 2PYFB 4H20L 2RQEA 1GYAA 5HYSA 1NOLA 3KCJA 5H8MA 3CHVA 1ULVA 1GGIL 3ATBA 5L2JA 5JBEA 4XPTH 2HN7B 4NHCL 1P0BA 3ABOA 1WK0A 5D72L 3MWAA 2R4SH 4NQDA 4TSAL 2R23A 2Q87A 5J7CC 1HKVA 2ZUTA 3RVWD 3VI3B 1LF1A 5B8CC 5T3XL 3WY3A 2J8OA 4FX7A 4NSBA 3VGHA 3GR8A 4ZBCA 4FQLH 4XPHH 1J8HE 2A1YA 4OQ1A 2PLMA 3DXAB 3C08H 2MCAA 3K2GA 5JIIA 2HMIC 1YTKA 4TUJA 3S6CA 3KJ6H 5C8BB 2BFGA 4QJ1A 2POTA 1TMHA 2YZ1A 1TCMA 3VX1A 4N6QA 4DEFA 2D7NA 4NI6A 4LCSA 3Q3GA 5AHFA 4RKAA 4HIBA 1NMBH 4OAWA 1KCRL 1CTNA 1DJQA 4KK6D 3NTYA 2QYGA 5LXGH 3EYVA 1HHJB 3FSOA 3TSBA 2DH2A 1HEZB 1WC7B 4PH8A 2V4LA 2PXYA 3MRNA 2BNRA 2FH6A 4QM1A 4OF5A 2NOYA 1NWSA 2WWKT 2HG5B 2GTQA 4GMSL 3BLBA 4CQBA 2YR1A 3P9WB 3L3JB 2C9PA 1U1HA 5A3IC 4H7VA 4WTZA 3PBVA 2BVUA 4V33A 4ZX5A 3CFIC 1GOIA 2VCBA 4NO0A 2C1PA 3RBSA 1EXBA 4YHML 5FYKE 1IEBB 4FFVC 4HSOA 1D9KD 2GQAA 1A5SA 1F5ZA 1YDOA 2NYYD 1H8LA 3VO0A 1QMLA 3V0GA 2R1XB 1FKXA 4L9ZA 4LDEB 3C2AL 3SOTA 2C0AA 4BI6A 4I3RH 1W1B1 4MWAD 3EOAA 4YPGB 5IHUL 4YXKL 3GTHA 2ZG2A 1F8MA 2WBWB 1GQIA 3FO1B 2IANE 1JNHA 1J9RA 3BH8B 4YUEL 1A4KB 1YEGL 4O2FB 3HF3A 2B3RA 4YWGL 2HVJB 4K55A 3KBVA 4X0VA 1FV1B 5CJXC 2VQ4A 1AG6A 1FORH 1NLBL 1WYJA 4QT5A 2H8ZA 1AQKH 1ETA1 1WSST 1MUJA 2PAJA 2OTWA 1R3LA 1QVOA 1RY8A 3CFBB 3R8GA 1UM5L 3ZMEA 1I1YB 5FO2A 4LB3A 2ZICA 3UZQA 1BZ7B 2Y5EA 2EADA 3ITYA 1GZPB 1AP2B 3B56A 1J5CA 2H6PA 4H01A 3LLXA 1QWUA 1W3KA 1TRIA 3QSRA 4NJHA 5D1ZC 2A9DA 2G8ZA 1IAOB 2CLPA 1S5MA 3E9AA 1BGXH 4ERSL 3RVVD 4YHOH 4EPKA 4Y9NA 2A74C 3TSMA 5JHDA 4CEUC 3PWNB 1BZQK 3VXRE 3IARA 4NWTL 1U8CB 1W1ZA 1A3WA 4XAFA 1M7IB 4FF7A 1P7TA 3T1WA 1GW0A 1QRND 4A66A 1V6TA 5HDLA 1FNFA 2CDEA 3KBWA 3GHUA 3W9ZA 3RA7L 3BUIA 4ZFOB 4ELMA 5J57B 4DETA 1USQA 3UABA 2WZPD 5D2LB 5A8QA 1IFHL 5D96C 2FB2A 2OCJA 1A7OH 5IVZB 2Z34A 4IRZH 5TDPB 3VXUE 3SCMA 3PWPD 2AJZA 1WDAA 4I4WB 3B9VA 1KPRB 2J6WA 1R3YA 4NUJA 3VFPB 3ZYZA 1JZEA 1WXYA 3WCYA 1QFEA 2P45B 3TV3H 4JFQA 5F96H 2PTTB 4GQGA 1PKMA 2VO5A 3AHYA 1BAGA 3NA9H 1RURL 4J8RB 2KZ1B 2YPVA 3DHUA 2WO5A 2OXNA 4RQQA 4JDVA 4I1PA 2IS7A 2OMVB 2WANA 2BSTA 3SGJA 7A3HA 4LTSA 1SRDA 2CZVA 5LXEA 3S48A 1L8NA 1PDZA 1ID2A 6FABL 2AK1L 5ABHA 3NGJA 2E7DA 1T03L 3FTWA 3W83A 3ZE0B 2GBVA 1XICA 4Z7IA 2JIEA 4GSXA 3WLOA 1I9RH 4CN4A 4KVCL 2PE4A 4TNWF 2GDQA 2AGTA 5IM51 4ZS7L 5BS0B 3PHOB 3WN5A 1HC1A 3FQ1A 1SUJA 5EC2B 1OWRM 4ZXBA 2BZCA 1RV8A 1GC1H 4GY1A 4XUGA 1X9UA 2J62A 1W16A 3SN1A 4U1SB 3OZMA 1T04B 3B06A 5B1JC 3US1A 5CGBA 5E4EC 3VTRA 4FG4A 1O9ZA 4HCRH 4TQHA 1WCBB 1CCWB 2OJZL 5L8KB 3X3FH 4Q74A 4RZCA 3CBRA 4GQQA 3PWLA 1SZGA 3ESOA 2YJQA 3WENA 3U9UA 4ADJA 1PEWA 4WK0B 4UB9A 2XWZA 4DQWA 3VRLE 1DBMH 3ZDZF 4D9LL 5K7JA 3K2KA 4OUOA 2J7BA 3V9CA 3II2A 2VLRA 3WJMA 1DJZA 3VDAA 2PYFA 2QUMA 1D2OA 1Z9MA 5AAWA 4S3FA 1PB0A 2DQJL 4FI7A 2FUTA 3FK3A 1KTRL 1HSAB 3Q5YA 4LY8A 3BWSA 4FFZA 3VGAB 3FNKA 2VIRB 5HPMB 4I7VA 4KRMB 1DSYA 5CP3A 4AD4A 2HN7A 1CXFA 4ILDA 1L5GB 5CSUA 1FNSL 4HP5A 2VR6A 1RPKA 2VDNL 3MLYH 4YHKL 3CUJA 3WGUB 1FG9C 4LV4A 4FOJA 1JGEB 4GAGL 1LGVA 2W9LA 1N5AB 3BT2H 4LSQL 5DBUA 3EFFA 4A21A 3R25A 1YA5A 5IJKA 4JX6A 1D9KA 1KCBA 2O5XH 3V4VL 4K8RH 4YC2C 5DT5A 3ABGA 3ULUE 4NZTH 5D2NB 4WUKL 3U57A 1JCNA 4OGAD 4ZTYA 1UOZA 2UY5A 3ZDYF 2XBDA 5C0AD 3FQXA 1X5JA 3EWYA 2UZPA 5CCHE 5T1KD 2W0KA 5JTWA 3IE4A 1Q6CA 1M9HA 4TXVB 3ZMNA 4W9TA 3IMWA 4JM0A 4J3UA 3H0TA 3H9SB 1EUAA 2UXFA 4H25A 2D03H 3TDFA 5I8OL 1NDMB 4R7JA 1QT1A 2D1ZA 3QHZH 1TE6A 3CHRA 2AHIA 1HHJA 2PTUA 5D71H 1HEZA 2WXQA 1WC7A 5T3ZE 1E7VA 5D1QD 2AQSA 1OAQH 4JGUA 2YD9A 4RW5A 1THAA 3QOKA 3VKBA 1TMQA 4IQHA 4OFYD 1V7MH 4Z7OB 5HHXH 1LDSA 4O00A 3AW5A 3M5VA 5CGYC 1IBGL 3VWJB 4J5NA 4ZUVA 2BOBB 4MY8A 3X11B 3S2AA 1ET5A 4ELMF 4MY9A 4E9XA 4E9LA 2PW2A 1IEBA 2JCCE 2BSDA 4JTEA 2BCKB 4HCIA 4P2QB 4OTKA 4H9MA 4LSDA 1IGMH 1V77A 4XAWL 2R1XA 4Q33A 5HI3C 4YPGA 2AEQH 4QLRA 1IBBA 2OZ4H 5HHPA 3FO1A 3ZJAA 5TK4A 4JKNA 1LP9B 4O2FA 2AQOA 4Y2DD 4X61A 1KG0B 3P69A 1FV1A 2WZPA 1GYMA 4NZ4A 5DUBA 4UTLA 4UXDA 4DGUA 1MAKA 3ZHKA 4N26A 2W6RA 5BXPA 1ET7A 4JRXD 1OP3K 4DKFL 1UMYA 4PJGB 1CURA 5LNRA 3PWPA 3WQ4A 4MNKA 3MUAA 3QCTL 3CFBA 1ODZA 1ILUA 2WHJA 3PIQB 3PWUB 3VOIA 1QFHA 1I1YA 3AMDA 1BZ7A 5CC3A 1GZPA 3DPDA 3BG5A 2F5AL 1OCBA 3WUGA 1LCOA 2DDQL 2DZTA 3RGBA 1KIPB 1IAOA 2J88L 4LCYB 3PB2A 4P07A 5IB4B 1S7WA 2L7QA 4JTLA 4Z7QE 4APXA 4PJ5B 4HIHB 2PF0A 1U0QA 3GHEL 3PWNA 4U1GC 3AUJA 1RMFH 1U8CA 5GQBA 4PRPA 3CZGA 4S2SA 2FSDA 1E6JL 4Q6YA 5LYRA 2VVNA 1ZY9A 3C5QA 1V5XA 3UG4A 1NCHA 1TJHL 4TF4A 2DLHA 1IEXA 3GC4A 3PCYA 2GQ3A 2XRAL 2XN9E 4ODWB 4BZ1H 3UH8A 4OT1H 5D2LA 1P5UA 5IB1B 4UAOB 3BVNB 5DMKA 2JNZA 1NFIA 4Y9PA 5H37G 4OTXL 1OLLA 3UC0L 5MEND 4DFHA 3D4ZA 2ATMA 2JMRA 1RJYA 4I4WA 4O14A 3GBEA 2NX5D 4H6KA 2ZOTA 3C8FA 3GXIA 2Y1YA 3VFPA 3QZNA 4Y2WA 5TFSL 1KN2L 3K72A 1KLFA 4I0PC 8FABB 2PTTA 2Q71A 1IGCH 3QZWB 1XGQB 5TJWK 2QADC 1A7BA 4L3CA 4J8RA 4JZJC 3BMWA 4LT9A 3MLPA 3PY9A 1P0KA 4D8PB 1ZBCA 1OF0A 3SDXB 5HQEA 2VXSL 4PJ9B 4NAEA 2QCHA 3PTDA 1TO4A 3NCYS 5DWPA 3RO8A 2A9NL 2R0KL 4UIKH 3WUWG 2NNRA 4JN6A 2WAGA 3Q1SH 3Q2LA 1FBAA 3BW9B 3SIMA 1XRTA 5BVPH 3VWKD 1CFQA 2JEPA 4N2KA 3QKEA 1DDTA 5BS0A 1JCJA 3FH7A 2XU2A 1VBHA 4XBKA 3MZNA 1T2XA 5EC2A 3MQTA 3FN9A 1CF8H 3MRMB 3LY0A 1T04A 5IK3A 1ADDA 2I7SA 3S5SA 3LNPA 4LYRA 3A5FA 1WCBA 1LT7A 3MV9B 1E4IA 3BUTA 4G6ML 2DN7A 1IVLA 1E5NA 3T55A 2D2OA 1Y5XA 4ZZKA 2RHEA 3ABQA 5AOJA 5B38B 2MOVA 1IKOP 4TULH 2CLOA 5LNUA 3KDNA 2WKOF 3GHBL 2F6AA 3UETA 1K9FA 4C83B 4Z1YA 5T1KA 1DV7A 2VCOA 4XX5A 1CBGA 1G4TA 4RMQA 4FR6A 1IARB 4YEEA 3MX0B 4G8FB 2R4RL 4WHDA 2YSSA 4YHZL 2NZ9C 1W9VA 4MLSA 1J96A 3PQYE 1K3ZA 5T8GA 4GABA 4AD0A 3O2WH 4P4KD 5EIIB 3P67A 3JWOH 2QSTA 1MCWW 1HSAA 5D1QA 4ZD3L 5ACMA 5HPMA 4A2GA 1AZ1A 2A6DA 1D8WA 3MSGA 3PS6A 1DZ0A 1HH6B 4OFYA 2CBTA 4UM9D 5IT2L 1G1KA 3L9RA 2YGYA 3F65A 3IDJA 1B90A 5BV7L 1JGEA 3UNDA 3B9KB 3VSTA 1ZKAA 1GOHA 3SQLA 1N5AA 3SPVB 4AX7A 1NBQA 1XUZA 3MVTA 2EEBA 4UOW1 3W86A 2A1WH 1VEOA 5HPOA 2EH7H 3JQOB 3P1VA 4AB4A 4FOKA 2IFFH 5GGTH 2XWBB 2EYRB 2K0RA 1U8MB 2X9WA 3N2XA 3WD3A 4JYEA 4ANUA 5I1IL 2H1PH 2ASHA 4A3RA 1G87A 4Y2DA 2MWCA 4BSWB 1GAFL 4XC1H 4JDBA 5IBLC 3WTUA 3AFBA 4RMUA 3QUXB 3H9SA 4AWEA 4O28A 3NQEA 4KKQA 4JRXA 2EPKX 4YTQA 1NDMA 4DY1A 2FT7A 4L8BB 3LZFL 5E93A 4J7RA 4M7ZB 3WIJA 3P4OA 4C6LA 1JULA 2RFGA 2W5FA 1PHWA 4RMTA 1NFDA 3O6CA 1L9RA 3MI6A 3SAZA 3GZOA 4MQXC 2FX7H 2HH0H 3DV4A 1QSFE 3FJNA 3W29A 3QIWD 2O5YH 4DHGA 1X7IA 2JWYA 3X11A 5FOBA 1EMTL 4IH3A 2X1XR 2R29H 3HG4A 1RULH 1SEBB 2BCKA 3EKZA 5ESQB 1YLVA 3M0JA 3N55A 1F76A 3VU1A 1LBMA 3N40F 2ARJB 5BUAA 3GPEA 2AKMA 2AKZA 3M0KA 4ZENA 3J2PA 2CGRL 4FNTA 4DN3H 5TPWL 1Q6DA 1LQ2A 1U3HC 4S2CA 4HD5A 1KG0A 5HA7A 4WCJA 5LGHL 1XR9A 2X09A 3GZQA 3QIUD 2WHLA 2VDOL 3BSHA 3WQ6A 3FCSB 3BZEB 5MENA 2Y72A 4H40A 4CNPA 5CPOA 5HUPA 2ITCB 5CWSA 3EWDA 4A2EA 4B50A 5EUOF 1VERA 2H26B 1OX4A 4MA3B 3CPRA 3DMMD 3G3MA 1OC5A 1CZ8L 4XVTH 4DZ5A 3LGEA 1MEIA 5AW2B 1NGWA 2WNWA 3HBLA 2J13A 3ILDA 4TVSa 1QR1B 5HHQA 2VXUL 5DU7A 2BVTA 1QFWH 5IB4A 1X7TA 2O9RA 1E0VA 3KYOB 4PJ5A 3B05A 3PB0A 4LU0A 2CIIB 4GUQA 5J56B 3ARVA 2OULB 1CE6B 3NIDF 1H1ZA 3S9IA 5JIQA 3W7QA 2YGNA 1UOVA 2AJYH 4JG1H 2DM7A 4PTUB 3IUHA 3P3TA 5LQBL 5D1XB 5L2KE 1Q1PA 4P2CG 4WU5B 3BVNA 4ZMQA 1SM3H 2DT1A 1QFPA 4CQ9A 1AYRA 4ANXA 1CLVA 3NP3A 2VLKD 3VD7A 4YDIH 1DE4B 1S6NA 1CLKA 4A6YB 4U6TA 2ADJA 4ONGL 1XEDA 4IHOB 1BEUA 1XD0A 3FULA 2EF9A 4WO4C 4BK5A 3UX9B 4XTIA 1CE1L 1JD7A 1JUKA 3SDYL 2C9AA 3QZWA 1XGQA 3B2UC 3DBPA 1BFNA 1TTJA 4MMXB 4ZQNA 2OR8A 1LO5A 2ERJC 4JPQA 1W3LA 3GK8H 4NYLB 4X7DC 3TTYA 1TF4A 3FF7A 4K3DH 3SDXA 3W6YA 1ZLSH 4PJ9A 2WP3T 2R1YA 1F00I 3QDMD 4Z0SA 5EYWA 1BEYH 2H0PA 1XRFA 2X9YA 1HKJA 3T8XA 3FBQA 3QJFB 2NY3C 4F8TA 1NAKH 3VXSD 3D0LA 2ADFH 4JJ5B 1IT7A 3BW9A 3FT1A 1UD6A 4FCHA 2G0LA 4KJPD 1AL7A 3D85D 1XIGA 1HWWA 4R2GC 2J9ZA 4JX4A 2IWEA 1ASQA 4B0MM 2FBJL 2FX9L 3JWNH 2JALA 1UM6L 4RFNB 3C0JA 3OKEB 5BYWA 3Q8BA 2OYMA 5DEZA 3AREC 4PR5A 1QBAA 4YZWA 4FFYH 3PBGA 3UY7A 4YX2L 1BYPA 1BD2B 1P5BA 1QOKA 3NL2A 2GKIA 1AS8A 4GNJA 3MV9A 3I68A 4M7KH 4Z17A 2PYED 4LQ1A 3JBG7 3HN3A 4MNQE 2XTJB 3G9AB 1UA3A 4WUIA 3NJMA 4Y9GA 4GKTA 3Q2DA 1KFLA 1MI5D 2I1OA 5JIHA 3RDKA 5C2BL 1A3QA 1G01A 4AZCB 1PZ3A 1XO8A 5LWYH 4REQB 2Y07L 4JFWA 5L0QC 1NFDF 1JWSA 4DI9A 5DJYB 1P1ZB 2VE6A 1FWXA 4FK9A 1R3IL 2NCMA 2OCFD 3U4BH 2Y06L 1A21A 4XMPL 5A2KH 4FNRA 5CSRA 5HYJE 5EIIA 3FUNA 5EEUA 1IT9H 5GRJH 4M5ZL 1V03A 5CR8A 4E4UA 4QRRE 1NUNB 1V6WA 1CGWA 5DJ0B 4S1DC 2ZF8A 1HH6A 4JTJA 3KW3A 2JFEX 4PUEA 3C6CA 3NRFA 4MNHB 1AR1D 5KTEH 1UUNA 2F2KA 4RZKA 5I0WA 4K8GA 1P2CB 1YW1A 4KO9A 4KF1A 2NQHA 5ISZB 2JIXD 5ES4B 3SKJL 3MUIA 4AYFB 2EYRA 2HRWA 1HJUA 3CB8A 2E27H 3WIAA 4X0NA 3X1GA 4AT6B 1XD1A 1U8MA 3U0WL 3KEHA 1I82A 5CM1A 3PHSA 2PWHA 5TQ2L 4Q6IC 4ANKA 3EAKA 4NENA 1Z2KA 3ABKB 2A9MH 4BSWA 4C65A 4E42B 3MSYA 3QUXA 1EAJA 3BFQG 2VEKA 1M7JA 2ZCZA 4W6WB 4Z78A 4KXBA 2VXQL 1KZQA 2CKBH 5PCYA 3O6AA 1TQCB 4KK9C 2UY7A 2UZIL 1XLEA 1OIMA 3VCNA 4UC5A 4KK8D 1S2EA 4FS0A 2AI0L 4OU3A 1PS3A 5J6HB 3WXVH 3HZMB 3PG2A 4L61A 4EACA 1VGEH 3HC4H 3WF2A 3U46B 3NEHA 3T44A 3RHWK 1BYAA 3UTTE 3W0WE 4TR9A 2CGYA 3PFRA 4HS3B 5HHMD 2P0IA 3TC6A 3FGCA 4AXWA 4JTHA 2P50A 4ZW7A 3L1FA 2ED7A 4WQ6A 4X8JB 2RCSH 1AIFB 4CCZA 2ARJA 3OX8B 2XX0A 1Q4NX 2CH8A 4JDZA 3DV6B 1URLA 2GQ9A 4D71A 5AB9A 5A69A 2OPCA 2DL9A 1VFAB 1BQRA 4NRRA 1DEDA 4XB3A 1PKQB 4EXKA 3PSVA 2BP5M 1MY7A 5HMEA 1ONEA 3PZQA 3H6OA 3PPGA 4HIEA 1G4MA 1DO5A 3EDFA 3L5XL 3BZEA 4ICWA 4JKWA 4Z9KB 5C9JB 4KU1A 3VFRA 4AZ7A 4H8HA 4Z7UF 1F42A 4J4PC 2ZG1A 4A22A 1N6VA 2H26A 3KHQA 2DB8A 3F1QA 3KGTA 3CAKA 1ET8A 3HPLB 2NY4B 5EU9A 1UQSA 3KVQA 1YN6B 3F7VA 1QR1A 4TVPH 2PGFA 2VDLH 3QEQB 4O9HL 1B0WA 2DSVA 4OM1H 2DQHH 5C0IA 2CHOA 3UG5A 4YVNA 2CIIA 3FN3A 3BD5A 2HT3C 1XCTA 3TBTB 1LDCA 4GFIA 4N2IA 4Q8WA 3AM8A 1CE6A 3IJHB 1KB3A 4F0HA 3VXSA 1OYCA 4IQEA 4WEMB 4DN1A 2XV2A 4XHJC 3D85A 4Y4FC 4U1HB 3TEUA 4PY7A 1E4LA 4W9KC 2XFXB 4J4KA 1UR1A 5CUSH 4FF9A 4PJ8B 5CJOL 1O4UA 2NWSA 3AHXA 1P4CA 3KLKA 2L7JA 1ES0B 1OE2A 3STZA 1DE4A 4A6YA 2V63A 3Q2VA 1EEZB 4GAYA 2QFPA 4L4VE 4IHOA 5EOQH 2IKHA 1A7PL 3W02A 2BLEA 2CPUA 2R0WL 3ENLA 3OAZH 1GKEA 2GWNA 3G0UA 4KTEL 5FOJA 1HTIA 3TFKC 3TJIA 4HAKA 1X9LA 1AJ0A 2PMZA 3WKML 1P48A 5DD3H 5FXCH 2CXEA 4HMEA 1P1XA 1EHXA 4R6UA 3QPKA 4PCFA 5D9SB 3NCEB 1M3IA 1A0QL 5CEZH 4AV5A 4QTHB 2AK4E 4JQVC 5K9KB 4X7SL 3QJFA 2B15A 4RGOL 3B03A 3GHTA 5ADOL 3E49A 1AH4A 1FFOA 1GGBH 1Z42A 5FJRA 5CEYB 5GIRB 1UA7A 1F73A 5TD4A 1AG1O 4F1ZA 1VS1A 3PUEA 1MLCA 4Z7NE 3HC0A 3CSGA 3B4NA 2EG6A 4RCAA 1W1PA 4O02H 4YHGA 1J1PL 3SYCA 1HEJC 1GTEA 3KPPA 3OKEA 3QI9B 4DHLA 5IFTA 1YNLH 3QC0A 1NARA 1BD2A 5JXEC 5CCKL 3QARA 1ACYL 3NDOA 5G5IA 3LUTA 2FVLA 5F71A 4KI5C 2IOOA 3CWNA 2OVLA 1S38A 1E3ZA 3PGFH 3ZX1A 4JO1H 1AA1B 3GDRA 1PCKA 3VRJB 3WL0A 1H19A 3GX9A 1OCJA 3M88A 2WINB 3RY5A 1W5PA 4REQA 5GS2D 2W79A 3JR2A 3UPMA 3UD6A 4KC3B 5DJYA 3FXGA 3LXUX 1Q0XH 2INFA 3QYQA 2D7TL 1HJBC 4DKEL 2J6EL 4H04A 4IL0A 4NQTA 4OLZH 5D9PA 2ISSA 2DQGH 3MLXL 4PJ6A 1X3DA 3TYEA 4J1OA 4DVBB 3QRGH 1XIWB 4ZMVA 3BP6A 2ZKMX 3QFWA 1JUFB 3KJ4B 5BZXA 3LYEA 1DJIA 5DJ0A 5E0KA 2VZVA 4R4FL 1BFVH 4FIRA 2I60H 1AOHA 3ML9A 3B7RL 4YDKH 4KESA 1Q63A 3IUDA 1SXSA 1P2CA 2HKFL 4LHQB 4HHAB 3IDXL 3LPPA 3OC5A 5ISZA 2V2HA 1V55B 1O6SB 2X28A 3QJZA 4M0XA 5CEXB 2FJHB 3GQFA 4AYFA 3DHPA 5CINH 5K9JL 3HQ1A 2F8OA 2ALRA 3TWBA 3VYNA 4CNTA 2GJNA 4AQEB 3LH8A 1BJ1J 1FHGA 2CBIA 3S5ZA 1ZRUA 3MMWA 1ZLWK 4UTJA 3V52H 1OTTC 2QJIA 3BP5B 4E42A 5AAMC 1QFWI 4NUPA 1F8TH 3DDMA 4BUQA 4N9EA 2EKSA 2BHZA 5B1KA 2IPTH 4OY9A 1KIUB 1MRCL 2R8SH 4GC3A 5HYSG 43C9B 3DTXB 1GONA 2XISA 3CXHK 1EP3A 4PW4A 2AAMA 2XIQA 2WNXA 3EYQC 3NACL 3NPWA 4Q4MA 2XJLA 1B4RA 3TC9A 1KBGL 3HC2A 1M42A 3I6KA 5JH1A 3N2JA 4HS3A 1C5DA 4QFUA 1DWAM 3G6AA 4KUZH 3BGGA 1CR9L 3VYOA 3I75A 1AIFA 3D52A 4K5MA 1J86A 2J79A 4P59H 3NA4A 3DV6A 3VYLA 4WHTB 3FYOA 2PXYD 3DETD 3UTPD 3DESA 5D9NA 1H1YA 2ZT9C 1BVNP 5HMSA 2MHAB 2C7FA 4O5LH 3V3WA 1PKQA 1FIGH 3CYJA 4Y5XC 4G8IB 1DL3A 3BJTA 1S2UA 2RFXB 4P7NA 4OWGA 2WVSA 2QCDA 4GZEA 4YTSA 3W1LA 2HRPL 4D8AA 3OZLA 1DN0A 2Y24A 1HNYA 1A1NB 2HSAA 5DVKA 1DVUA 5M7QA 2MCPH 5F7YC 5KJ7E 2SEBB 4UFMA 2E7FA 2GGHA 3S2MA 5G4NA 2I69A 3HPLA 4JO3H 4DAGH 1W2KT 3ETBJ 1AGBA 4HUKB 4O4YH 1WE5A 4AMWA 4HEPA 1PJ9A 1PFCA 2KLSA 3BW3A 1YN6A 3OPZL 2ICEA 4MCYA 4GUPA 3KHDA 5FLVA 3FTGB 4NP4L 4EO5A 1S7SB 4WCYH 2VFFA 2WHVA 4JQ3A 3LVEA 4WTZG 4CJ1A 3PP7A 1YY9C 3MOBL 3RM4A 4WFED 3H9ZA 3MO1B 2WMHA 2CBOA 3W1RA 3EO1B 2AC0A 1RUML 2I25N 3EA2A 4C56E 1TZIB 2VGLM 3FF8A 4G7FA 4BWTA 5CLYA 3CV2A 2GYSA 5AEAA 1EF2A 1FY6A 4WUUE 3BYYA 2DIEA 4ODXA 4D6FA 2F7IA 4PJEB 1RZJL 1RVFL 1EXUA 3BGFC 1C16B 2AV7B 3LDBB 4DRSA 3B9EA 3UEZA 3UYRL 5JHDD 3UDWC 3AYRA 4G7YL 3QUML 1J48A 2GGGA 2GI0A 1M05B 2YKLL 3L5AA 1MNUH 2DWTA 3UAEA 2OLHA 3QJOA 4NQXA 1JPSL 5C70A 3GS7A 2XIMA 1BVLB 1OAKL 2H2PC 3WQDA 2E9WA 2WLMA 4Y1AB 5D9SA 5AC8A 3P0YH 5JPNC 1K9EA 5FYLL 5AD0B 4FSAA 5HVGB 1B4JL 3SCMD 5K9KA 1VF8A 4PMQA 4QS5A 3RAOA 5CN2A 4CKQA 1TQSA 2VEPA 4IGBC 3WELA 3FUKA 5CEYA 3VSQA 1ZEAH 5T5FA 3K6IA 2FSEA 3KLAB 2HFTA 1KYOK 5C7ZA 1BSIA 4HBCL 3C56A 1VFTA 4FRWA 3JVFC 3RBGA 2OLSA 2LU4A 3O2VL 2VQTA 2G3FA 4KZEH 2WZMA 3SB0A 4JPWL 3MGAA 1E6ZA 1A5BA 1IC0A 4NN5B 1L0QA 4LSUL 4AQLA 3Q45A 2YMXH 2XZAL 4F7KA 4FNLH 1C29A 2RB8A 4HNVA 4FULA 4BHYA 4ENED 4MWFB 4W86A 4ZXBD 3IJ9A 4FLHA 4M7TA 4KHTL 2XH7A 1KACB 1GVEA 4YSDA 3W6MA 4OQTA 1QR4A 4A8NA 3FQ2A 2Q10A 3OTRA 4F57L 3NCCB 4N2FA 3U2JA 1KGUA 2PDGA 3BO8B 4LU5H 4F0MA 1YNPA 1YHPA 3LTSA 4MAUH 5BXRA 2C18A 1UT2A 3IWVA 1JUFA 3D46A 3GDKA 4Q7BA 2QEJA 2G2PA 1YN7B 3MMEA 4H8WH 3RWJB 4JTGA 1E73M 3S6TA 3WH8A 4N85A 2WLIB 1XYMA 2XIIA 4AC4A 1Z41A 4KPHL 4HCGA 4JXCA 4KROC 2WKGA 1H63A 1S5IH 2VLRD 1CL7L 4E2VA 2AQ2A 2E4TA 1NDYA 5H2ZA 1O6SA 4D94A 2MH4A 1SJHA 4MOZA 2GZXA 3ZSTA 2TYSA 2ZYIA 5KZCB 4JEGB 1RZFH 1RUAH 4PAZA 3QO0B 2D22A 3G0SA 5FYJU 3H26A 4JS3A 4DYEA 1MDLA 2GVYA 3PNUA 2HLFC 3DXIA 3FKUS 4OLVH 4YCPA 1OAUH 3RJQB 1W72H 4GI6A 3BP5A 4Y7EA 3O3BB 1JWMB 4WEBH 3WFDL 4BKNA 4YHEA 1FHVA 5J3HD 4ODTL 5JR1L 1HZYA 1RZGB 2X0HA 2GBTA 4EI5C 4DBDA 3RL2B 3SCWA 2X4QA 2NV2A 2Y89A 3NZUA 1KIUA 4RWYL 3DXAD 3FO2B 1LK2A 4X99A 5E5MA 3DTXA 2QHLA 1NKOA 1K7EA 3OJDB 3DX8B 3ROOA 1DJYA 3AMKA 3JTSB 4CVZA 1UD3A 3WLBB 1OZQA 4FI4A 2DU2A 1UJ3B 2B9BA 5KINA 3DUSB 3CFMA 4KXDA 4O1AA 1JFQL 3RY6A 3RMJA 5DC4B 3LKRB 3AABA 5E2UL 1K70A 2ZOLB 3C6SB 3IRPX 1V51A 4ZQRA 1XCFA 1ZJBA 1AAJA 1ISZA 2C1OB 3ZUCA 3SY5A 5FB8B 3LMZA 1QBML 5DQ9B 3HMCA 4FNSA 2JK2A 1IGWA 1NSNL 3BP7A 4G8IA 1IXNA 3LS9A 4KO6A 2LABA 1X5KA 4LASH 3PL6B 1FG2A 5GRZA 2X89A 3ARGB 5F9OL 3MODL 4RDZA 4MS8C 3D0VB 3QAZC 2FZMA 4H7ZA 3OMZA 3T0VA 1A5OC 3A23A 4WGHA 1BRLA 2NQJA 1ZL1A 1ADQH 2SEBA 2BGSA 5HDBE 2EXTA 5CZSA 4TLTA 4N0FA 2WHMA 3QGKC 2ZF9A 1J9CT 2R1KA 1R6WA 1NDVA 2DQDL 4QJ3B 1NAMH 3S47A 1TELA 3P73A 3DSNB 3RPIB 2AQVA 2V7NB 3LSOB 2H9AB 3MSDA 4BFRA 4WQOA 4AVFA 3SSGA 3X14A 3QNXB 3DUHA 5FHBL 3E6EA 1UXLA 2Y5SA 3MO1A 5GJPA 1KDIA 3W1UA 4UCFA 4X9SA 3KL3A 3SO3B 2UY4A 4JPKL 3CHQA 4Q7IA 5HGDB 3PWGA 4ZAKB 2V69A 4HQQH 2P7TB 4GUIA 1DQML 4UTTA 3QW3A 4JTQA 4C1NA 1TQTA 2D24A 3ZT7A 4RDBA 3NQKA 4B5WA 5JZ7D 1PX4A 3BWUF 4UQBA 1FO0L 2WIIB 1TCRB 1ZMYA 3FT2A 1HU8A 5FKPA 2JQMA 3ZTNL 2XQBL