2QMKA

Human pancreatic alpha-amylase complexed with nitrite
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 166
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2qmkA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2qmkA01
3EDEA 3BCDA 1W3KA 4MAZA 5D9PA 1WZMA 1X6NA 2Z1SA 3M07A 3A4XA 1I1XA 2X0HA 2W92A 4W5ZA 4UOZA 3KE0A 4DWSB 4U33A 1KGUA 1UKPA 2WBGA 5E6YA 4UR9A 3VD9A 2O9RA 2CETA 2J62A 4DWSA 2WVUA 3W4RA 3DDGA 1E5NA 3PZIA 2FGZA 3CPUA 3PZNA 3AHZA 3AQUA 1M01A 5A2CA 5ABHA 1WDSA 2EBNA 1W9PA 3N9KA 4RE4A 1EDGA 2RGLA 4WKHA 1EIBA 5GNZA 1LQ0A 2XJ7A 3RCNA 3RO8A 3VNYA 4NZCA 1ITXA 4PSPA 5GNXA 4H41A 4JKMA 1BVZA 3EBVA 3VM5A 2XN1A 2G4FA 1A3HA 3TP4A 3WUBA 3W53A 3KZSA 1UASA 1WZKA 3T09A 4JHOA 3N17A 3TA9A 4JL2A 4E8DA 3B9AA 2OWCA 3A22A 1XV8A 4UQEA 6A3HA 4XZBA 4PMRA 1PEZA 1R87A 4L4OA 2XVGA 4M24A 2OWXA 1HKKA 1AQHA 3HG4A 3ZR6A 2JEQA 1GJUA 1UWIA 4JFWA 3WUFA 2WZHA 1ESWA 1J10A 1YHTA 1GHRA 1C8QA 2WZEA 2A3AA 1E6NA 4RL3A 3D5HA 4PMDA 3LMYA 5ABGA 3VIMA 2VRQA 3WMCA 2QMJA 4RE3A 3TTQA 3VDBA 4EE9A 4M82A 3WY3A 1H5VA 1PIGA 3OLIA 1EQCA 3K8KA 2XG9A 3AI0A 5FCZA 1J0KA 3A3HA 4JCMA 4KRUA 4YPJA 3K46A 3AROA 1HF6A 5IFPA 1BAGA 1KXVA 3S2CA 1E6RA 2D23A 4DUWA 3ARYA 1J0HA 4URIA 2OSWA 3PZQA 2YDQA 4XX6A 2JIEA 1AQMA 5A8MA 4FNTA 1LWHA 3I3DA 1UKSA 2YDSA 2VZVA 3N11A 1BYCA 2J7EA 1V3JA 1UKOA 1TQUA 2VMFA 1GONA 2J7GA 2IXUA 3MKKA 2CHNA 3QOKA 1VBUA 3AHTA 2DSUA 1P6WA 2DDXA 2XFFA 2ZUWA 3IJ9A 2IXVA 1US3A 2W66A 1OBAA 3OGVA 2JF6A 3VKKA 2HISA 4Y7EA 4BQ4A 4D6EA 5A8PA 1R47A 1EOMA 1HN1A 1UR0A 5FL0A 5IHSA 2B31A 1VJZA 4IPLA 2WWCA 4BCEA 5BCAA 5E1QA 3POCA 1ZU8A 3POHA 1GPFA 1XHGA 4MB1A 4MNMA 2BV9A 1JF5A 2E9BA 3WDHA 2VQUA 3CO4A 1FH9A 3ECQA 4UFHA 4HPGA 1JF6A 3CC1A 5EFFA 2EEXA 2GDUA 2XHYA 4NXSA 5ABEA 2X2JA 2J47A 5JIWA 1GORA 2BY0A 3L2MA 3MANA 1BTCA 3S6TA 2F7OA 1B3WA 2WCAA 2D1ZA 1UYQA 1KQYA 4D6IA 1VEMA 3ARZA 1XYFA 1X6LA 2WKGA 1E15A 1JGIA 1RP8A 3AHVA 4HMDA 5ABFB 2XGIA 2CHOA 4QAWA 5HDRA 1J12A 1NWRA 1G1YA 2EPLX 3I3EA 4MPKA 4S3KA 2GDVA 2CPUA 5CGTA 2WC3A 2WSPA 1JZ6A 1JYWA 3AYRA 1IZJA 5ABFA 3TV8A 1B3XA 1C91A 2X0YA 1FP8A 2E40A 3RJXA 1K6AA 3OZOA 1L0PA 2XVKA 4PMZA 1W9DM 1Q4NX 3BAWA 4PUDA 4DM2A 2J7DA 3PBGA 1W1VA 1NOUA 1UKQA 3OLDA 2W63A 4DUXA 4W8BA 5D9MA 4R27A 3U5YA 3WN6A 3IJ8A 1QNPA 1B3YA 1UD4A 4GZEA 3SCQA 3CIVA 4AYSA 3VX0A 3VIJA 1TVNA 1QWUA 1R34A 3WNOA 1ZL1A 1UWSA 1M7XA 1BHGA 3T0DA 4QLKA 1EDTA 4CCDA 4JAWA 1QBBA 3AIVA 1G5AA 3WBAA 3SUWA 3QR3A 2ZUTA 2Y24A 4A3HA 1UH4A 1Q6DA 4AD0A 3J7HA 2CBVA 1Q6GA 1HP4A 1CXKA 3CZSA 4N0RA 1OWQA 4TX8A 4B9YA 4HU0A 2ZXAA 4AZGA 3VMOA 3UESA 4CD7A 2QLYA 4PTXA 2WHJA 2XVLA 3SCWA 2BY3A 2E8YA 1GW1A 1ZB5A 3W24A 1ZJAA 1R33A 2CIPA 4LX4A 3CGTA 3CHFA 4CD8A 1VRXA 2PC8A 3GXPA 1EA9C 4BQ5A 5BYWA 3GNOA 1JYXA 5EFDA 3BVVA 3W81A 4HU8A 4LXFA 4PEEA 2UY2A 3MI6A 1HIZA 2C0HA 3IAQA 1VJSA 2ZUSA 4CVUA 1QPKA 1UH3A 1CBGA 4PSRA 1GUVA 3F5KA 4W88A 2CBIA 2W4XA 3OZPA 3WQVA 2GFTA 5A94A 4TVUA 1CYGA 2PBGA 3B8SA 2E3ZA 4B3LA 5CPTA 4V28A 3NSMA 1JZ3A 4HZ7A 1NH6A 3H55A 1UR4A 3BUDA 2W61A 1XC6A 3CUGA 1O7DC 5FOOA 4AIUA 3UG3A 4ATWA 3WFLA 2ZX8A 1CIUA 3DX2A 4DUVA 1HKMA 2VZOA 1NM9A 4CGTA 1FH8A 1NWTA 2ZUMA 3AIWA 1QHOA 4TTUA 4BA0A 3GBEA 1B9ZA 1XYZA 2X1IA 4P8XA 4HOXA 5D9NA 3SCOA 4H8HA 1Q6FA 3B9DA 1MW3A 3DX3A 1E9LA 3ZJ7A 3ZJKA 1QX1A 3AMCA 1E4MM 4Q7NA 3AIQA 3NIYA 1TFVA 3AISA 1RPKA 5C70A 3VDHA 4TVDA 2QF8A 1BPLB 2D2OA 4CU8A 3BVUA 3ARTA 4F66A 5CG0A 5I2UA 1UKTA 5I24A 4W87A 5CJ5A 2UY4A 3O9NA 5A6SA 1W1YA 1H3GA 1MW0A 2YDRA 4ACYA 1OGGA 5LA0A 5A95A 3WD2A 5A2AA 1D3CA 4U2ZA 3ZQ9A 1L8NA 3L4WA 3WF4A 2DT1A 4P7OA 2XWDA 5I6SA 4FK9A 5HOSA 2GSJA 1FOBA 2DIJA 3BVTA 4MJ2A 4QLLA 1JDDA 1RP9A 1QVBA 3BAXA 4D1IA 3FHAA 1HX0A 4W86A 1KTBA 2EQDA 3WIJA 1EGZA 2JALA 4WSJA 3ZO9A 1EO5A 3EMQA 1DP0A 4DO6A 2FGLA 2YIHA 3QHNA 2NSXA 2VOTA 1KCKA 3E1F1 1OIMA 4QDMA 4AZIA 4MTVA 1KB3A 3W25A 1SMAA 1F4AA 3WY2A 1LG1A 3F5LA 1RH9A 5CZKA 4NF7A 2G8ZA 1UD3A 3DHUA 1MYRA 4AEFA 4AYGA 3BGAA 4D1JA 5CGMA 1GHSA 2A3EA 4C7GA 1DWGM 5E6ZA 1V6YA 4U31A 2XFYA 2OLHA 3WNPA 1VF8A 4ZE4A 2GJXB 4PMQA 3WUGA 4BQ3A 1M03A 1Y7VA 4MADA 4H7VA 1G94A 3WNNA 5EB8A 1QBAA 2ESCA 3MUAA 2FYVA 5E0FA 1KTCA 1C8XA 2GJXA 2F7RA 4EANA 1WP6A 3MSDA 4UQAA 3FHQA 2VZTA 4GI8A 3CZLA 1W32A 3NSXA 3WH8A 2WNWA 2D0GA 3ZT5A 3CZGA 2J78A 2YL8A 4WKFA 3WEMA 2ZICA 3OBAA 4TUFA 3GDBA 4OBRA 2YLLA 5A6MA 1GQLA 1JI2A 4A3YA 3CMJA 3W82A 1WO2A 3N18A 1R8LA 1UG6A 1E5JA 1E6QM 2A3BA 2VVSA 4IISA 5A69A 4Z2GA 1JYVA 4P8WA 1HKJA 1JAEA 2WAGA 2WCGA 2OYLA 1HJWA 4HP5A 1CDGA 4Z2IA 4F9JA 1QOXA 3EJSA 1CZ1A 4J3UA 4R5EA 4UZSA 1MW2A 1V0MA 1K9TA 3DECA 1ECEA 4KGJA 4MJ4A 3H53A 2VCCA 2X2YA 1GZJA 1PPIA 2O92A 2JFEX 4PMOA 2VL4A 3VGFA 4P8VA 4GO9A 1EH9A 4MNKA 2C8NA 3CMGA 4JFTA 2F1BA 2BHZA 1DWAM 3CZJA 4HZ8A 1EXPA 1CWYA 1W9BM 1CGTA 5A6BD 4NX0A 1SZNA 4FLQA 1E70M 5M3WA 2WVSA 3VIPA 3WF1A 3ZT6A 1NQ6A 3BVWA 1J01A 1ZBVA 3ARRA 1CECA 1G9HA 1UWQA 4KMQA 1H11A 4JKLA 2UY3A 1E4NA 2VRJA 3PZMA 3K4AA 1NP2A 2ZXBA 1BYAA 2YKKA 1VB9A 2BVTA 1E56A 2BVYA 4B16A 4M80A 2QPSA 1SYTA 2FDMA 3T08A 3I3BA 3ZM8A 3GBDA 1KFWA 3QHMA 2G3NA 5BWFA 2XSBA 3BLBA 2YBUA 1BSIA 2Y2WA 1V6WA 3WDJA 3M7SA 3PZOA 1D2KA 3VDAA 1K9FA 1OT1A 3U7VA 1KWGA 3EMZA 1JZ5A 2E9MA 1W9UA 3FAXA 1QI0A 3AS3A 1DHKA 4CUCA 1PAMA 3VIGA 1LF1A 1R46A 1B0IA 2E8ZA 3AZTA 4LPCA 4CCCA 3VINA 2E0PA 2WXDM 3ARQA 1EQPA 2OWWA 2F61A 1C92A 3A21A 2X8RA 1D7FA 3WH7A 1WPCA 4D6HA 1BVNP 1LWJA 2OSXA 2WWDA 1MFUA 1E3XA 5A2BA 3L2LA 3PTKA 3BAJA 1PZ3A 3VM7A 4U3AA 4NZFA 1JAKA 2PF0A 3QOMA 5M5DA 3S5ZA 1UR1A 1UZ4A 2WMIB 1V03A 2D0HA 4ZEPA 1JXKA 4CN1A 3EJUA 2VC9A 3SCPA 1VEOA 1JNEA 1JI1A 3VGDA 2TAAA 1GNXA 1KBBA 1W3JA 2ZX6A 2BFGA 2WMIA 3HMCA 2VX6A 5DO8A 2DSKA 5HPOA 3OGSA 3WQWA 3TTYA 1W3HA 2VCBA 2V3FA 5D9OA 1E4IA 2V3GA 5FIPA 3IK2A 3CV5A 4RE2A 4GO8A 3K8MA 3AFBA 4FLRA 4GQQA 4MNLA 3WNLA 1TCMA 2AMGA 5D4YA 4AZ5A 1TA3B 1ZJBA 4W93A 3VILA 3W27A 4AC1X 2CKRA 4CD5A 3N15A 3DYOA 1UD6A 3RDKA 3GM8A 3W29A 1TR1A 3CHDA 5LYRA 1QHPA 1JFXA 3EDJA 3OGRA 5M03A 1TA3A 3L4VA 3BAKA 1E1FA 1WCGA 3VIKA 4DM1A 3WDQA 4AD3A 1H0GA 1B1YA 5A6LA 4F79A 4U5KA 1JXJA 3U57A 3VPLA 5I77A 2OSYA 1E0XA 4LYQA 3PZGA 1UZ1A 1GJWA 2J8FA 1CXHA 4PMNA 4KH2A 2XSAA 3CUIA 3VSVA 1E3ZA 1WE5A 3N13A 6CGTA 3F4VA 3THCA 3WH5A 3D52A 2J8GA 1OSEA 2Y8KA 4CD6A 4HOWA 7CGTA 2CBJA 3WD4A 4MB4A 3MMUA 4NI3A 5ECUA 1JL8A 3VD4A 5E70A 1Q6CA 3THDA 2OYMA 5KZ6A 1PIFA 1H41A 4MDPA 5F7UA 1IT0A 2WM0A 2YBTA 2BS9A 2F2HA 4UZUA 3ARXA 3BSGA 4CN6A 1J11A 5I3DA 2XUCA 3W37A 4M29A 3NJ3A 2OYKA 3BMVA 3WQ8A 4BF7A 4X0NA 1N82A 4LQ1A 1UOKA 2D73A 4W84A 1QNRA 2QV4A 3AZSA 3D50A 4UQCA 3ALGA 4F9DA 4AMWA 1HVQA 1EOKA 3WMSA 1TZ7A 2ZXQA 2O9OA 3WD1A 3TTSA 1HKIA 1W2PA 1GVYA 1MXGA 2D20A 2YLAA 3WD3A 2G3MA 1JD9A 2V38A 1UWTA 4AWEA 2Y4SA 4J3WA 2BXZA 4PTWA 1HJUA 3CZNA 4WLCA 4GIAA 3VO0A 1H4PA 4L4PA 1HJQA 4P8UA 2WMFA 3EDDA 1V0NA 1WZAA 5D8WA 2WYSA 3VD5A 4E8CA 5FL1A 4NXKA 3EJTA 2MANA 2JIWA 4H04A 1TE1A 3ARUA 1UR9A 2BY1A 2EJ1A 3W28A 1M04A 2RGMA 1KXTA 3EJPA 3RIKA 5GNYA 3L4TA 5DT7A 1JYNA 1KWKA 2ALWA 2FH6A 4J28A 3EJRA 1MVYA 4KWUA 3TONA 2DSWA 2CKSA 2NT1A 3WY4A 3JUGA 2XM1A 1J0IA 3WDPP 5E9AA 5DEZA 3HN3A 3NDYA 1ITCA 4QCEA 3VIIA 2BHYA 3LXBA 1PBGA 3BUPA 4MB3A 1W3LA 7A3HA 2E4TA 1PX3A 1CPUA 3CBWA 1VFFA 2WHKA 1QI2A 2EADA 5HBFA 2VX5A 2J79A 5FKYA 3AS0A 1QW8A 4UFJA 3BH4A 3WKZA 2GJPA 1E71M 4UFKA 4D6CA 4QFUA 4J3TA 5A6JA 1JDAA 3BLPX 3L4XA 4JL1A 2ZWYA 1DWHM 1OD8A 4OGZA 1C93A 2CXGA 3GH4A 1B2YA 4JKKA 4W7WA 3SUVA 2V3DA 3VSUA 4UFMA 5EBAA 1UH2A 1XCWA 2BVDA 5BXRA 1E6SM 4AZ7A 1TUXA 2VZSA 2ZWZA 2J7CA 4AMXA 3CTTA 1FH7A 2WCSA 2J77A 1C8YA 1HNYA 2YOCA 1QWNA 3VGHA 2X2HA 2WBKA 3N1AA 4PTMA 1KQZA 3EDFA 2CBUA 1BLIA 2DQXA 3W38A 4W8LA 1XH0A 3II1A 4AZCB 4DWSD 4QLJA 4Z2JA 3EMCA 4PTVA 2F1AA 1CGVA 3AXXA 3AMDA 4F8XA 1JIBA 4OIFA 4HOZA 2G3JA 4CCEA 3WEZA 3ZIZA 1CNVA 3A24A 2EPNA 4AZCA 4P7NA 4OJYA 3AIRA 1HT6A 3SCSA 3D51A 3RM4A 4D6DA 1CGYA 1XSJA 1OIFA 1S46A 1HL9A 4EKJA 3NCOA 1G01A 2XVNA 4PMUA 1V0KA 2AAAA 2E9LA 1IZKA 5IHRA 1VENA 1W1TA 3F5JA 2FHFA 1ISZA 3KWXA 1VFMA 4W85A 5GPRA 1U33A 4UNIA 2EPMX 4W8AA 1UR2A 4AD1A 1HVXA 4AZHA 1QHZA 1QI4A 5LA2A 3AHXA 3WF0A 5JIPA 1V6UA 2WVVB 3VIOA 3KEHA 1DWJM 2OW7A 1H09A 4PBGA 4LYRA 1VFUA 4PCSA 2D0FA 3ARVA 1M53A 5A3HA 6TAAA 3HZ3A 5CQ1A 1WDPA 5AYIA 2J75A 4U3CA 2IGTA 5A8QA 1O7AA 3CZ8A 1AMYA 3DX4A 3UETA 5HNNA 3AZRA 5JUVA 1J9YA 3MMDA 4M81A 1CTNA 2VNCA 3VMNA 3DHPA 4GXPA 3MU7A 3VTRA 2XN0A 2WANA 2JE8A 1UR8A 3MMWA 1KGXA 4JHZA 4M8UA 1UQZA 3ZSTA 1HJXA 3NDZA 4AD4A 2WSKA 3AXIA 3LX9A 4KRTA 3FNDA 1BGGA 4WIWA 4OBSA 3L4UA 1UHVA 1CENA 1MWOA 1JZ8A 1BFNA 4W5UA 3SUUA 2VR5A 1WNOA 5BXTA 4HA4A 5KEZA 1JG9A 1MFVA 3NYDA 2PB1A 2J7BA 3GXMA 1J18A 2AOSA 3GXFA 2DT3A 2CESA 3PZUA 1V3IA 3MV01 1MQQA 1VAHA 1VBRA 1B31A 3T2OA 4D72A 2O9PA 3GNRA 5IDIA 3UR7A 4UOJA 4BQ2A 1QI3A 5JBEA 4NRSA 3LXAA 2DPEA 2BNJA 2WLZA 1YQ2A 1GOOA 2XWEA 4J27A 2D22A 1ZBCA 4WKAA 1E40A 5C8BB 5HPCA 2WKLA 4GI9A 3ZOAA 3WQ6A 1XSKA 3OLEA 3ARWA 3WDRA 1CGUA 4V27A 4AW7A 5CLWA 1F4HA 5A8OA 3WF3A 1JFHA 3SEPA 1G0CA 2QHAA 2VVNA 4GI6A 4J3SA 3MO4A 5EMYA 1JDCA 1V3HA 4P7QA 4DO5A 1FHDA 2ZX9A 3WSUA 2XFRA 3HG5A 4YHGA 1U30A 3VU2A 1HP5A 5AY7A 3VGGA 1UD2A 2OW6A 4M56A 1R7AA 5CSUA 3ZJ6A 3VSTA 1FHLA 1HXKA 2F8QA 2F7PA 2YL9A 4NRRA 4ZENA 3N12A 2XIBA 5E0CA 4UFIA 1OB0A 2PBOA 3VIFA 2EACA 1TQWA 2V3EA 1B3ZA 3PTMA 4WF7A 1XH2A 2VCAA 5IFTA 1BGAA 1GOMA 1GQIA 3A4WA 1OGSA 4MDOA 4JFUA 3U7BA 4TX6A 1J0ZA 2W5FA 1UD5A 3LPFA 1O6IA 3CHEA 3LPPA 3O6AA 3BUBA 3GXNA 3WY1A 1B30A 1KGWA 4HZ6A 4NSBA 2VURA 4DO4A 3SCNA 3PN8A 5A6KA 3K1DA 1VFOA 5I0DA 3SCRA 4E2OA 3AYSA 5M17A 4ML4A 2ZXDA 3WFZA 5GQBA 3KLLA 3BAYA 3GTNA 4MNJA 8A3HA 3RILA 1NARA 4AIOA 3ARPA 4CKQA 2ZE0A 1KBKA 1ZS2A 3BVXA 5IXEA 1KR0A 2WMJA 1V3MA 3BUIA 3AOFA 4UTFA 3ZR5A 1E1EA 3L4ZA 1LL7A 3GYCA 2YFOA 4GZIA 3HG2A 3SCTA 4ATDA 3GNPA 4D71A 3W26A 4CN4A 1ODZA 1W2VA 2FE0A 2CNCA 2X05A 3VIHA 5AC4A 1NP0A 2D3LA 1LJYA 1UUQA 3VVGA 3LRMA 2J25A 1E0VA 3BCFA 1XGZA 1OT2A 2W62A 1CXIA 2VI0A 2WB5A 1E43A 3FN9A 2EABA 2G3IA 4DWSC 1CLVA 4PMYA 1UA3A 4PMXA 1SMDA 2Z1KA 3AMLA 3BSHA 4XZWA 4WSKA 2ZUVA 5I5RA 1ISYA 4UQBA 1GOKA 5CSYA 3LRKA 1OGBA 4Q22A 3AICA 2PI6A 1V02E 3WBEA 2UY5A 4AZBA 1TQSA 2GJRA 1QI5A 3VDCA 1PJ9A 4D6FA 1A47A 3PTQA 8CGTA 1H1NA 4FLOA 2J7FA 3TTOA 1EHNA 1IV8A 1TG7A 2WHLA 1XD1A 3LRLA 3WF2A 2X2IA 1GCYA 2VJXA 1DWIM 2ZUNA 3M46A 2X09A 1QW9A 2O9TA 4FNUA 3U5UA 3IJ7A 1JZ7A 4TTGA 4OZOA 2PWDA 1R7OA 3TOPA 5DMYA 3AS2A 3H54A 4W7UA 1KXHA 3FAWA 5I79A 3RM9A 4E4PA 1UQYA 1CXLA 1CEOA 1BYDA 3AJ7A 4QP0A 1C90A 1GOQA 3AMGA 4N42A 1FFQA 1UWRA 2UWFA 1E72M 3LPGA 1EDQA 3T0AA 1HTYA 4AIEA 4OOZA 4Z2KA 1AQ0A 4IUGA 4P7RA 3WQ4A 4AD5A 1I1WA 3BLKA 4IM4A 3UR8A 4YHEA 2FH8A 4QCFA 3M6DA 3VOCA 4JFSA 4W7VA 1OM0A 3RMEA 3GXTA 3CUFA 1Q6EA 5DT5A 4HMEA 2WMKA 3NSNA 1JZ2A 2EXOA 1XD0A 7TAAA 3D4YA 5I78A 3AS1A 2WHMA 2WLYA 1V08A 3WEOA 3K4DA 4ATLA 3IAPA 1BQCA 5LA1A 2WZIA 2DGAA 1V3LA 5CLTA 3KLKA 5TD4A 4UQDA 1TVPA 1PX4A 1CGWA 3IANA 1NOFA 1DTUA 4UOQA 2XTKA 3UERA 3VGBA 4AD2A 1HXJA 2DEPA 3ARSA 5A6BA 4GKLA 5DFAA 3BC9A 2FHBA 1BF2A 4FNPA 2W91A 2PWFA 4FLSA 1H0IA 1CXFA 1WKYA 1CXEA 4KGLA 2XGBA 3WNMA 2XYLA 1ISXA 1MQRA 3MUIA 1J0JA 2F18A 5HXMA 4V2XA 3UG5A 1CGXA 4C7DA 2W67A 3L4YA 3KL3A 1V3KA 1E4LA 1WB0A 3B9EA 4FNSA 2EAEA 2PWEA 2WVTA 2J4GA 1LLOA 4BZYA 3WH9A 3OG2A 1XH1A 3OLGA 1HJVA 3FW6A 1CLXA 3WDIA 2PWHA 2J74A 3VD7A 1U2YA 3OIHA 2ZX7A 1OD0A 3LPOA 1W1PA 4PRWA 4HMCA 3WL0A 4AZ6A 2Y8VA 2G41A 4TXEA 1MXDA 5BRPA 4OKDA 1US2A 3RPMA 4PCTA 2XPKA 1T0OA 3GXIA 1GOIA 2WC7A 1GQKA 1ODUA 3VX1A 2ZOXA 2YA1A 2WMHA 1E6XM 2VR4A 4BS0A 3CUJA 4GZJA 4ZXOA 1MW1A 5CXPA 1ISWA 1LL6A 4IPNB 4FNQA 3CH9A 4Z2LA 1AVAA 4UFLA 3NUKA 2A3CA 4FF5A 4B3KA 3CUHA 4WJXA 4H2CA 2NT0A 1KR1A 3FY1A 3WQ5A 3S5YA 2NW0A 2FHCA 1I75A 4GINA 3CZEA 3D4ZA 3BAIA 1LL4A 4ACZB 3HU7A 3PZ9A 5CPSA 1OCQA 1R85A 2J7HA 3DYMA 2WC4A 2QMKA 1E6ZA 2JF7A 4P7LA 3GZAA 1TQTA 2HVMA 3WH6A 4ACZA 3BUQA 3IGUA 3VGEA 3SUSA 2ZX5A 1TMQA 3ZT7A 2XVPA 1E6PA 4U5IA 4HA1A 3WENA 1SFSA 2VUYA 1NWSA 3PZTA 2VO5A 4MAVA 3W6MA 3WMBA 2GVYA 3VD3A 2CYGA 2WK2A 1JD7A 4J3XA 1VIWA 2DIEA 1E0WA 5I23A 3ZSSA 1C7TA 3DC0A 1VEPA 3SCUA 4JFVA 2YL6A 4CD4A 4H8VA 1BYBA 4Z2HA 2Q8XA 2D24A 1K9DA 1R75A 2YA2A 3GH7A 3RM8A 2D3NA 1DWFM 1WZLA 3HJEA 3EDKA 1PX8A 1QNQA 2A3HA 2VQTA 3ZMRA 1ZBWA 2CERA 3EJQA 1RD6A 5BXSA 4LYPA 4M1RA 4MB5A 1GQJA 3W0KA 2YFNA 4HPHA 3CLWA 1V6VA 1PZ2A 3A23A 3LXCA 2CITA 4PUEA 4AY1A 1J0YA 3HG3A 4AEEA 3WNKA 1EHAA 1HL8A 2DT0A 2VX4A 1V6XA 1KXQA 2VZUA 1H49A 4UQ9A 1JNDA 1SR0A 4NZJA 5CPQA 2DT2A 5D8ZA 3APGA 4JIEA 1NWUA 3VNZA 1HWWA 4JCLA 3EYPA 5JBFA 1UWUA 3A6OA 1WDQA 1TQVA 3T2PA 3DX0A 3O2LA 2YJQA 3CZKA 2GK1B 2WMGA 3DX1A 1WDRA 1BG9A 3WELA 3SIMA 3CHCA 5A8NA 4B15A 5E09A 2GK1A 1E73M 5AYBA 1E55A 2WW5A 5A1AA 4J3VA 3A47A 4OOUA 4EAMA 4A4AA 1NOWA 3DDFA 2XM2A 1JZ4A 4XB3A 4AISA 5BRQA 1KCLA 2BY2A 2WVVA 4EK7A 3VMPA 1GVIA 4ZFMA 3SCVA 3KL0A 4FMVA 1XRVA 2ZUUA 3OA5A 2ZIDA 4S3JA 4XV0A 5DF0A 4GQRA 1UA7A 1FFRA 3GXDA 1LG2A 1Z32X 2V5CA 2Y5EA 3UEQA 1BG4A 4AXNA 4B9ZA 4OUEA 2DSZA 4FNRA 3OB8A 1FP9A 2VT0A 3AHYA 2DH3A 3AMKA 2VRKA 4K68A 3SUTA 2EPKX 4CU7A 4UCFA 2JEPA 2V5DA 4PN2A 4TVCA 4XUYA 3AIUA 5BXPA 1W9XA 2YA0A 1W91A 3AXHA 3MS8A 4D6GA 3BMWA 4CU6A 1B3VA 2XIIA 4JZ5A 1DEDA 3KL5A 5AC5A 5A6AA 2EPOA 1MQPA 3G6MA 2DSVA 2VTFA 1EO7A 4X0VA 3D3AA 3K8LA 2BXYA 1PS3A 1XSIA 1GOWA 1FA2A 4HTYA 2EO7A 3UCQA 3ALFA 1X1NA 4LGXA 3DYPA 1UD8A 4C7FA 4CVWA 2DH2A 4PYSA 3WD0A 4YN5A 2WPGA 2GUYA 2IUZA 1HJSA 2QPUA 4X9YA 5FD0A 4D6JA 2BHUA 2PWGA 3UG4A 2F7QA 1V0LA 1C3FA 3SURA 2CEQA 3GH5A 3QHOA 1QNOA 4U2YA 3MUY1 4H8UA 4ZXLA 2YL5A 3W6LA 3FXYA 4TOQA 3BXWA 3WL1A 1OINA 1B90A 1K9EA 3PZVA 3T0BA 3A4AA 3QGVA 3MUZ1 3T2QA 3MV11 3VUPA 1QNSA 3PHAA 4HA3A 3MSGA 1C7SA 4W89A 3ZJ8A 1ZBKA 1W9VA 3G6LA 2XN2A 3RJYA 1XCXA 3A5VA 3WUEA 2VX7A 4WK9A 1H2JA 1WAWA 9CGTA 2CCRA 4ZE5A 4AMCA 4J7RA 1R86A 4GPNA 1ISVA 2C7FA 5BROA 3N04A 4PMVA 1V02A 5JBDA 3AIEA 3AIBA 5C71A
chains in the Genus database with same CATH superfamily
2D7QA 1I8MA 5T1MB 1Y0LA 1XJBA 4HGKC 1MJ7H 5L9DH 5F7FA 2VN3A 1KGUA 2J88A 4KKNA 4PUBL 3TXVA 5AVWB 1H3XA 2F54D 3VD9A 3VUSA 2VLLB 2OMYA 2NSQA 4MNQB 3T55A 4F9PA 3R19A 2A6DA 4HWBL 1W9PA 2FR4A 4D0BB 2VFGA 4JR5A 3L8QA 4IHOA 1F07A 2XDHA 3IK4A 2GTZA 3NJHA 3GSQB 4EMZA 1JFQL 1WUZA 4P5KA 4CW1A 4MJJA 5BV7C 2CDGA 1KIRA 3KZSA 1UASA 3ZE2B 5F9OL 1UXLA 1IBDA 6TIMA 3CLEH 3CSGA 3P3SA 1A65A 3B56A 3RNQA 4MQXC 3MROA 3OEXA 1MDLA 1NAML 3QIUC 4G56A 3NMEA 4L4OA 1GOXA 4LLQB 4M24A 3K30A 3BHBB 4EF8A 5DJ8B 4K55A 1QUNB 4JB9H 3H2MA 1YYAA 3B7SA 3BDXA 5A6IA 1SJEB 3ANYA 2EGZA 2QMJA 2P1FA 4ELMB 3VDBA 3KDMB 2J72A 4JJ5B 1I3RA 4JY6B 2I17A 5ACLA 2BP0B 3QC6X 4GXMA 2Q76B 1SXNA 1EBGA 1M7DB 1F11B 1MCNA 4ZQKA 4G1EB 4BKTC 1JSYA 4G8FA 1BAGA 1P1XA 3PZQA 1W8GA 5MENB 2JIEA 5IHZA 3ILQC 5LGZA 3B4YA 1J8SA 4MNQE 7PTDA 2PURA 4KQNA 3Q6FA 3TU9A 1N8IA 4LS2A 4RAUB 3E12A 1GONA 1UZ6F 1MREL 3LM7A 1SF5A 3BI9X 1FDZA 3MZTA 4LOCA 3CFTA 5EOCH 5JDSA 1WXYA 5AKTA 4IQJA 3U9UA 3O4LD 2HXAA 3ZE2E 1ORQB 4XO7A 4BCEA 4E9LA 4DNHA 2AK4A 4XPAL 3W3BA 4UFHA 3FS2A 3CHOA 3J27A 3HPLB 3PHOA 3APMA 4OGXL 3WLNA 3U46A 3MOAL 3SJVB 4AY8A 1JVOA 3AHVA 2O55A 3R1ZA 4O10A 4MGXA 2Y5TA 2DQWA 1WAEA 1OHLA 2GDVA 3IRDA 4ELME 1Z9AA 4UAOC 1F4WL 1G9MC 3L2IA 5DTFA 1KV7A 4FALA 2VDRB 2FJFB 2MNUA 1JNLH 2CHDA 3KDPB 5EHFA 1HOEA 3V95A 3VNIA 1JXGA 2R91A 3WN6A 1JCVA 4GAAA 3IWPA 2QSCL 3PBUA 4AYSA 3ZLFA 4D8LA 1AZ1A 1NLBH 4FFTA 1DQDH 1YXCA 1QBBA 2AERT 1NBZB 3RHWK 2H6PA 2LABA 4BQBA 3UWEA 2GTWA 1QSEE 3IRPX 4HIQA 1XB3A 4HU0A 5DU7A 4KDWA 4FS9A 3P1VA 2WHJA 4LSVL 1SVBA 1GXEA 3QIWB 1R33A 1XH3A 4ANXA 4HK0A 2WQVA 1TPH1 3KG5A 1KRBC 2B1AL 3KBFA 3OC5A 5EL1A 2PTTB 3BVVA 1XIJA 1T1YA 5BVPH 3NEHA 4OB5L 2I9LB 1XI3A 5CEXB 1N6VA 1S7XA 5D93C 1KLYA 3SJVE 3DROB 4GW5A 3RIAF 2OXHB 3QNXB 4PSRA 5CBIA 2FO4B 4JNMA 1JTTA 3IDNA 1GPOL 4EI6B 4NZ1A 3QQ9C 3PG2A 1PXGA 4FR6A 3T65A 3H55A 3OMIB 5JO5B 1O7DC 2D3VA 5T5NF 5FOOA 1N6UA 3B8IA 1ED3B 2OJ1A 3SO3C 5IWLC 3LB6C 1FH8A 2ZUMA 3QCVL 1QHOA 5I1HH 3PUDA 4OGYL 3V4VA 1GSMA 2YCLB 1QK2A 1E9LA 5DZAA 1QX1A 4Q7NA 3AISA 1YDPA 4HIEB 3QULB 4P46C 5CG0A 4IIGA 4IIEA 3GW0A 5I24A 3GSMA 4Q4SA 5A6SA 5H1WA 1DFBL 3WF4A 4UTKA 4LNVA 3NVQA 2FZ3B 4F40A 3STZB 3BVTA 2YCJA 3MA8A 2NPLX 4X61A 2EQDA 3DOHA 3C2VA 5HDBF 1DP0A 2YD8A 3DGGB 3ZTNL 5AW2B 3IDIB 5IFJA 3OTTA 5TQ0L 2XKNB 3QUZC 4PUBH 3B7UX 1MQKL 4B5WA 3DO4A 2G75A 2QV2A 4ODXA 2CZFA 4ZE4A 2VMJA 4W9GC 2R7EB 4H7VA 1QLRA 3EYOA 4MJHA 1K8ZA 3GK0A 4HWBH 4AM0Q 3UWUA 3ERPA 1HHJB 2XJKA 4JPVL 1W32A 1ZWIB 2IALB 5DEFA 2MWCA 1TMLA 3MV9A 3US0A 1N59B 3CMJA 5F9OH 2QDEA 2Z35B 1YRRA 2A3BA 3VGAB 1PG7W 4HS3B 4P8WA 2P0IA 5CN1A 1CDGA 4KDTC 1NAMH 2DQMA 2C9UA 1QOXA 3HBZA 2Q3RA 4WWKA 2CC0A 3KVKA 3DECA 2J5LB 1AGEA 4Y16D 1T1ZA 3MREA 4RX0A 3FCPA 2D7TL 4DJFC 4K8RC 1EH9A 1XCFA 3QI9D 3LKNA 1CQKA 1YTDA 2PLMA 2PPEA 4X6CE 3KPSA 1XIWC 4X9IA 4ES4A 4JKLA 1M41A 1EUAA 4GABA 1TIWA 1VB9A 2CLRB 2PXYC 2JNZA 1S7RA 1OKEA 5ANMB 2X4TA 2AAMA 3E2VA 3LGEA 1U3HC 3U7VA 1V4YA 5DRXB 4WQ6A 4BDVA 1SO5A 2DQ6A 1SXCA 1C92A 1D7FA 3CVHL 3EO1A 3HG1D 3GLZA 4NYLA 5F0PB 1UR1A 1O94A 3D8MA 4B91A 1FLRL 1MDRA 5I6KA 3ZXWA 2PDYA 3MRNA 1QD0A 3WQWA 1E4IA 5HJYA 5EZLB 1H5BA 5E2JA 5TDPA 2EP6A 3MOAH 3TH2T 4KKZA 2OLSA 3G6JA 2CNYA 3MZ2A 3EWBX 3FCBA 1AKPA 2H0FA 1DVJA 4QHLB 1EP2A 1MFMA 3G2GA 3US1A 3V7PA 2R39A 4KITB 4U6HA 1CT8A 5M03A 1ITBB 2NSOA 2B7QA 3UCRA 4JZOA 4OZ4B 3NK3A 1O7SA 2DZXA 5AOMA 3U57A 1QO3B 3E1ZA 1KSRA 1WAUA 4PZVA 3IBOA 2XRAL 5HYSB 2QSCH 4JZNA 1BMGA 4XB7A 1MUWA 5CP3H 2VDQB 1FL5B 1D9EA 3D5OF 3O45B 3PABB 5AVZB 4F58L 2ZC1A 1HFUA 3HI5H 1H41A 2ED9A 1E7UA 4Y9GA 2OYKA 1U8NA 2XWJA 3MUJA 2J3SA 4ZZKA 2ZRUA 4LSVH 3LNDA 4PRHA 4UQCA 1X5FA 3P4MA 1VZHA 2DQUH 2ERJC 4ELDA 1M7OA 1ZTXE 4OB5H 4DZIA 4JFQA 4RCXA 4GBXB 3XISA 4KI5F 1INQB 1OSZB 3CB3A 1ZHBA 4NXKA 1KC7A 3BH8B 1GPOH 4TULH 2FWUA 2VDLB 2BP8B 3SKUD 3SO7A 5GNYA 1JYNA 2O4EA 3EJRA 2GSIB 3QDMB 4PODA 4EZLA 2E6JA 5DC0A 5J3HD 1DL7L 4BFJA 1YNTF 2WSRA 3T05A 3QCVH 4OGYH 2YXXA 2HKFL 3LCHA 3IS0X 4HH9A 3RHGA 1CB4A 2UXFA 4RDQG 1UZ8B 3FBQA 5LDSA 4MQSB 4OF6A 3MRHB 2UZYA 25C8L 1EAPB 3MJ7A 2VXSL 5AZUA 4GUQA 5IW3A 3WLHA 1EB3A 2BSTA 5JOPE 3ZTNH 4PRPB 2YXFA 2WLKA 5TQ0H 4MS8C 1G7QA 3ZHLA 3NEXA 1MQKH 5GSVB 4LDEB 2V5BA 3ZDXB 3RDTC 4PTVA 1C29A 3AO0A 1FQ0A 1HE8A 1DTNA 3ZL4L 1EPFA 4OJYA 2OQJA 1ZP4A 4JPVH 5D7LB 3TTEA 1HH6A 1KPVA 1YDYA 2OTUA 1ZSDA 4LVNC 4L9LA 3I75B 1VCAA 4XP9L 3KWXA 4WWPA 3UPRA 4UNIA 2EPMX 4XODA 2KX9A 5HJXA 5JIPA 1OHQA 2FEEL 1ILUA 4HIJA 4CJ1A 3VWKA 5JIIA 2D7TH 4XTRD 5C0QA 3N42F 5JW4N 2JFCA 4LO9A 1IEBA 1EP1A 3SGEI 4N0UE 2IMMA 5EU3A 5FUCE 4TVPL 2CHRA 3DRQB 1YNKL 1YQVL 3L4UA 4OWGA 4WW2A 2NW2A 5EUKA 2ZJSL 4Y4KB 4JRLA 4O02B 2EZ0C 3FTWA 1SPDA 3ZDXE 4BSWB 2VW6A 3DURA 1VGKB 1JPMA 5KSVA 4N0FB 2Z4QA 3HAEB 4UMAA 1Z5HA 3ZQWA 3RI5F 1R4XA 3QTGA 1HSAA 3V0GA 3D39B 5I82A 1U1HA 3ATFA 5AOJA 5K33A 2FGWL 2I07B 2D22A 1JTOA 3CVHH 4DOHB 4V27A 4AW7A 1F4HA 2VVNA 3FT4B 1HE7A 1FLRH 1YMMA 1A4BA 5I75C 1O7VA 3BPOC 3IXTA 3AAZB 4HIIA 5CJ8A 4D9QD 2OW6A 2BCKB 4O18A 5FO8B 3NQBA 3LH9A 4BFBD 3W87A 4OUUA 2I1OA 3VIFA 4BR1A 4MCMA 2V3EA 1XH2A 1UGNA 4XBSA 3IFPA 4MDOA 2GC4C 1MFBL 3LKRB 3O6ML 3KHOA 1P1VA 3VFTA 5GHWL 3NCCB 1KTLA 2OGJA 3SCNA 3HQOA 4OZHE 4QRRA 4HLJA 1UEMA 3P4OA 4X60A 2ZTBA 3GZOA 2I25N 4GXWA 4AIOA 4QRUA 4LOVA 5DK2A 2XRAH 3CXDH 4OF8A 4DEUA 5E6RB 4UBDD 1RBLA 2UVFA 4OV5A 3TVMB 3RAJL 1N3NB 2CR6A 4TIMA 3EOBA 4F58H 2I60L 3TQVA 1W2VA 3D39E 2X05A 3RCYA 3MLWL 4MMZC 1LJYA 1E0VA 2O6EA 1L6SA 2WQ8A 5D1ZI 4DWSC 3XINA 3MV8A 3BV7A 5D7HA 5ANHA 2FAUA 3R13A 4E6MA 2EUZA 1DVTA 4Y8EA 3RX4A 2NYYC 5IQNA 5FYLD 4BXVA 4XPBL 3AICA 5DMKA 3NQKA 4TQHA 3WG7B 2JKLA 4OLWL 1GYAA 2R15A 3DHMA 4F3FB 1JK8A 1RJZB 1W5NA 3QEQB 3QJAA 5JW4M 1KM6A 3M46A 4KIRA 3U6RA 5C08A 1FWNA 1AK5A 1FA4A 5DMYA 3T1FB 3H4XA 1VLXA 1MAML 2YZ1A 3PY2A 1FFQA 2IPGA 1DL7H 1NDYA 1G7IA 4MDIB 4HJSA 3NFNB 5G55A 2HKFH 5HBBA 4FQPA 5MP6L 4KQ0A 3WLQA 5HVHC 1RKRA 4YHEA 2WJDA 3F4NA 4QCFA 2DTSA 1URZA 2PETA 5E00A 2OOGA 3L3GB 3QR1A 1V08A 4P2QB 1T2QL 4DQOL 1K8IB 4HJJL 25C8H 3FCUB 3W0WD 3IANA 1BM3L 1NOFA 2XTKA 3ESUF 1R3VA 1HXJA 4N0YL 4I2XA 2C4FU 3Q8FA 4FLSA 1CXFA 4A7SA 1WJ3A 1AA1B 5FV1L 4GK8A 3L7EB 3ZKXC 2KI6A 2VEIA 3T8MA 5KVMC 4HX1A 4JANA 1O9VA 3V7AG 3R7QA 4OAWA 1WB0A 1O5KA 2QKSA 3OX8A 3XIMA 1UB5A 5CCJA 3QEQE 3F5WA 4KMTL 2VDNB 1FZOA 3ZL4H 1FWIC 4OLVL 2EUWA 3TEXA 3BP4B 1TLMA 1OK0A 4HHAB 1C12B 5C0BB 3DFQA 1IEXA 3CVHA 2WSDA 1YPFA 1QSZA 2QYGA 1AOZA 1VFAA 3SKNA 1LL6A 5EMJA 2YCKX 3E6FA 3HIJA 2EXWC 1RXOB 3GJEB 4JIQA 1S7QB 4PS7A 3KZ8A 4LARL 3TCXA 1TT6A 3C8HA 5J5DA 5EN3A 2DMKA 4P2QE 5CG7A 4UC5A 4C60A 4A2EA 3ZUCA 2PTZA 1XPYA 4HA1A 3GG0A 3KBMA 3EYSL 3Q3GA 4DPAX 3GLDA 2J2ZA 3BUVA 1MI5E 1SJMA 2PCQA 5D7KE 1TEFA 4TVPH 4W6YB 1VEPA 3DC0A 4GG8A 4POYA 4A7QA 4Z2HA 1YNKH 3QHTC 3QWNA 1ENUA 1PZBA 1EJSC 4LAOA 4WGVB 1GYUA 2CITA 1J9TA 3R8QA 2FK9A 1ZPTA 5JOEA 3NQ7A 1NGXA 1H0DB 3T4YB 3VNZA 3EYPA 1T6MA 4YBQC 2YC1B 4B50A 3QLDA 3BESR 2IWGA 2MPVA 5EIQA 4AK2A 5DLCA 1FL6A 4GKZA 4OU3A 2FGWH 2SEBA 2XV3A 3RPTA 4O8RA 2X40A 2FJUB 4FFYA 4NIYE 3IDJA 4GS7B 2ZAGA 3N2OA 4WI5A 5HD8D 3HEIB 4R97B 3SCMA 1B4KA 2F8VA 4US5D 4HB7A 3KOYA 3VXSE 4F8NA 2AKZA 4QXWA 4WDTA 4GT7A 4LUTB 1KCWA 3GTVA 2CR0A 3FZUC 2X6AA 1W9XA 1W91A 3ABLB 2Q86B 4BQ6A 3O6MH 4F7KA 1JHTA 3S1WA 1UWEL 2IO5A 4ZMTA 5GHWH 1Q6LA 1H15A 1GG1A 3GG1A 2YD3A 4E9WA 4FQXB 3QV6A 1FVDA 4KY1L 4Q32A 4XAPA 3NIGF 1MCBA 3NA9L 2L3BA 4N87A 4NKQB 4JFFA 4GRLA 3H2PA 3AGVA 3FYOA 3RA7L 4GQPH 3VXUB 3RAJH 1ZA6B 3WL1A 3NP4A 3Q67A 1B90A 2I60H 3QGVA 5IVOA 2EE0A 3B9KC 2E6DA 3T2QA 3MLWH 4ZRGA 4AL8L 1QU4A 4HA3A 1C7SA 3PPGA 1VBGA 1JUFB 3OXSB 1BD2B 1OPOA 2B2XL 1E8YA 4NQED 3EDEA 4YDJA 2BG5A 1TQCB 3QG7L 2GY5A 4XPBH 3CH0A 4UYQA 2QULA 4W5ZA 1AO7D 3QO1A 1UKPA 4OLWH 5EEZA 2FEDD 3DAQA 3RY6A 4ZAKA 3RYMA 3V0FA 3QO0B 4MJZA 12E8L 4A3QA 3QJUB 1DBAL 5A2CA 2ALAA 2WTRB 1PUDA 2F58H 4IHCA 1BMWA 1K6QL 1SJXA 2Z7ZA 1AHWA 2Z91A 4IK6A 4XO9A 3C2SA 2ENQA 3DGCR 4JM2C 1RBAA 2JQXA 3RX3A 1J5HA 1N0LA 4X6DA 3UFIA 5MP6H 4UQEA 2B81A 4IIFA 2Q6WA 3NN8B 3QPEA 4BFIA 1ZSXA 3NH7H 5TF1L 1GMEA 3M0IA 4PRNB 1F2XK 1NL0L 2IPTL 4ETYA 1RK6A 2WZHA 4DQOH 4HJJH 3TH6A 5C0EA 1JE6A 1BM3H 1SY6H 4HJEA 4N0YH 2J55A 1N12A 4NKMB 2P1YA 1BVWA 1BD2E 3Q37A 3OA3A 5HI4D 2PW1A 5C0IA 5GGUB 3MRQA 3IJEB 4YTRA 4IU3A 5GZOD 1B88A 1M1XB 5IFPA 4Z7UB 1O6VA 2D23A 4HEPG 1F5ZA 4BFNA 1JCTA 2IF7A 4KMTH 3RX8A 1RK1A 4XWUA 5DUML 5B38A 1WDWA 3ORWA 3AXLB 2A83A 4NDMA 4GUFA 4JHAH 5D33A 4OLVH 4XCFH 2FYMA 1J5DA 4WDUA 2Z2UA 3FRPB 5CHNB 1GOHA 4LKXB 1XWVA 3B2UD 2DKUA 3FVMA 4AENB 5DJ0A 2IANB 4HISA 2JXMB 2BNQA 4ECNA 1KBGL 3ECQA 1F6KA 3CC1A 5HQLA 3VTAA 1OSPL 3WI9A 1MCLA 5DFWH 3M7FB 3RWGA 3NDOA 1IILE 2F7OA 3VKDA 5EULV 4F15B 1I0BA 3CD4A 3KPPB 1B54A 1RP8A 2LU5A 3EYSH 4NBZB 3EUUA 4PJXB 1TX0A 2UYLA 4LVEA 2PP8A 3I9PA 4L2YA 5INCB 2P8PA 4WU7B 4NGHL 3NPSC 2Z6IA 2BOCB 4Q7DA 2RTTA 4QNPE 2Z8VC 5DYFA 1YRKA 2QPDB 2KKQA 1SDDA 2CGZA 5BQ7A 3LNMA 4RNIA 3PBYA 1PKLA 3MBEA 3MKCA 5IM7B 2I16A 4C6QA 4NAEB 4WGWB 4DB7A 4PL2A 2R69A 3UBXG 1AH3A 1K4CB 2CZNA 1M7XA 5HJ3A 4RV8A 4CMMB 1NBVL 2ZCKH 2O72A 1G5AA 1Y6NR 1WVZA 2D4FA 4K5OA 5MHSE 4P5TC 2IANE 1MJUL 4ISVA 5T1JA 2Q9OA 1KDJA 3DX9B 1WFNA 3QEUA 1OTUD 4LU0A 5LWYL 3E80A 2B7NA 3S9YA 1L6WA 4PTUA 3UJ2A 1K77A 6FABL 4RZ5A 3AQDA 2YOAA 2Y61A 3E9UA 2E3VA 3TZVD 4PJXE 2NXZC 2IPUK 1HS6A 5BVJA 1Q8MA 4LB8A 4JDVB 3CUGA 1U8CB 5B7FA 3OJMB 4C58B 1MRAA 4KY1H 4WDIA 3WZ0E 2F53A 4K37A 3GU1A 4HOXA 3NA9H 4Q2ZB 1E4HA 5EPMA 4J3ZA 4CU8A 4WZ9A 3GC4A 4NRXB 3MRMB 5A16B 5TF0A 1O9ZA 1H3GA 4ADJA 1IXNA 1P6FA 5A2AA 4O58L 3TMQA 4AL8H 1WCQA 4HJ0C 3STLB 2YRLA 3C60B 2OGYA 4FEZA 4XPHL 2DPKA 2GCYA 8FABB 5E8DL 1NKRA 3O2WL 2VOTA 4FF9A 4PJHF 3QG7H 4FADA 2MFNA 2ATPA 5AWNL 2Y63A 1DQIA 1ZTXL 3WS6C 1QBML 4H88H 3DKHA 3WTWA 3HLAB 2CIKB 4U31A 2BSEA 1VZGA 4LUSA 2A6KA 1Y7VA 3SY5A 4UNTA 3WNNA 1QBAA 12E8H 4N28A 4NQDA 4KZ0A 4FI8A 1J5OL 1NFKA 4PJEA 2C4FT 2CJSA 2HT3D 1K6QH 3KHDA 3FHQA 4OFYD 2VDRH 4F48A 4Y6GA 5D9SB 3OR6A 4Z7WF 1I2RA 3GDBA 1GQLA 1WO2A 1JGEB 3N2BA 4XXDA 4NZRL 4WGXA 1BYNA 1IGFL 1NC4D 1RUQL 5EF0A 5TF1H 3JZYA 1PZ0A 1HNGA 5I3KA 4BGDA 2WOBA 1NL0H 2IPTH 4M6NL 1PPIA 1CFQB 2V0TA 5F9AC 5LKYA 2NUPA 1BV8A 4IUOA 4GUIA 4XCNB 2F74A 2P5ED 3FU7B 1G6RL 2WVSA 3EYQC 5EO1B 1Q6QA 1JPSL 3S5SA 3K2KA 2VGGA 2VUOA 3TLLA 4JN2B 4O0KA 3UC2A 3LS9A 3ML9A 5EDXA 4YCOA 3AWNA 3GHUA 3KVDD 3I3BA 2QXWA 2WAQA 2VELA 1N6QL 3CFUA 1ZVYA 2ZRYA 4NUJA 2JVUA 5F7WC 3M7SA 1LUCB 3DUUB 4YVUA 4PRIB 5KSAC 3IU3B 4F7PA 2VDLL 4AB4A 5BW7C 3LEPA 2R56H 5F70A 3T6CA 4Y1SA 2BODX 4JFXB 4MMXB 3M45A 4D9RD 5EO0B 3WKML 3E96A 3PWLB 4G9FB 2Q71A 1H8LA 2G9KA 4FS0A 1PZ3A 4U3AA 1JAKA 3NOIA 4QE4A 3SSZA 4K5MA 4AX3A 4HWZB 4MA1C 4MKNA 1KBGH 2Y69B 4LLQA 3UAJD 5LAPA 1D9KC 4PCYA 3BW4A 3D18A 2KDGA 3VGDA 3HMWL 3SZ8A 1OSPH 3FQWB 4HSOA 2JKAA 3HMCA 5DO8A 3TTYA 1ZT7A 2YGOA 1BPVA 1A6TA 3QUYA 3UTQB 2NR6D 4XHJD 4A63A 1MLCA 2HBXA 2PDWA 1G9NC 4JJ5A 1MJ7L 2AMGA 5F1OB 4ZTEA 3DYOA 5HK4A 4NGHH 4UM9D 4G1EA 1TA3A 5U4NA 4OIBA 5FUZL 5JW4Q 5L2KB 3VIKA 4KXAA 4PR5A 1I7TA 4NNYA 1AIFB 3WO4B 4DETA 3KRBA 3OQRA 1E8ZA 4PMNA 4RLIA 3GTXA 1CI1A 5DJ2B 5AVTB 1WE5A 3N13A 4XAFA 6CGTA 4MLIA 3F4VA 3PB2A 4PRIE 1SLUA 3LH8A 2Q7YB 4ZW5A 1DN0B 4GT0A 3TX4A 3IMTA 1NBVH 1QSEA 2HSIA 1I1FB 2IGFL 3L7FB 3THDA 1TZZA 2IOOA 1ORQA 1MLBB 1X6UA 1JV5B 1E2WA 4G9FE 2AL2B 4PAZA 3NJ3A 1KG0B 3QT2A 1HI6B 7ENLA 4BF7A 2QVIA 1MJUH 4LQ1A 1OCJA 2NY5C 3NIFB 1W8OA 3MJYA 4JB9L 1D2PA 1IBBA 5DZPA 3VW3H 3EFFB 1HVQA 2ZXQA 2W95A 1KPRA 2OMBA 5I7GA 2D20A 4MXQD 1ZTMA 5HYJB 5LWYH 3SJVA 1GJIA 5ICXB 6FABH 1X5MA 3HMXL 3ZTJG 4K8HA 3B03A 3CDZA 4L4PA 4W9CC 1H1YA 1AH4A 2GUOA 2ATAA 4OSUL 3EDDA 1WZAA 2WYSA 2EC9U 1MRQA 5T1KB 1NMBL 1VHNA 4R4ND 1SLXA 4EWJA 3X2QB 2FB2A 3GM0A 1UR9A 2FECL 4NJIA 5D6DC 1AD4A 3LS5L 3S36L 2WLLB 4BH8A 3G9AB 4D0DB 2JJSC 4Q3MA 2PU1A 3TEWA 4N8VG 5EOCL 4QCIB 1BW8A 2HVKB 2JTDA 4V1DD 4Y9OA 1KJ3H 2J79A 1NBZA 3BH4A 5AW8B 1P7QD 2G0LA 2ATKA 4D6CA 3BICA 1W0VB 2IAMA 5GGRB 2DMCA 4H9VA 4XPHH 1C93A 5GZNC 2HLFD 4QBXA 3CZUB 3PPFA 3F8UB 1N2RA 4U4MA 3SDDD 3NIFE 4FX6M 1RURL 3WV0A 3IRZA 1EC7A 1XL4A 1XLLA 2ZUXA 3DMMA 3O2WH 4BCXA 2PTTA 1ZRUA 5AWNH 3BN3B 1ZTXH 5HA7A 1QBMH 1C8YA 3OKDB 5HYJE 1X1OA 4AF0A 4KXCA 4W8LA 3EMCA 1CGVA 3MN8A 3RGVA 1V5JA 1NGZA 3WXVL 3AT8A 1J5OH 3AIRA 3RUGB 4U1NB 4Q4QA 1XSJA 1XEUA 1T6WA 1ED3A 5EFIA 3VWJD 2XVNA 4OGAD 4PMUA 5FJRA 3NDYE 4BFAA 2AAAA 2Z34A 4PW3A 4PBVC 3IKCA 5ERWA 1XF3A 2FTPA 4WRLA 3FSAA 3Q9QA 1DYZA 2PAJA 4QO1B 1FL3B 1HVXA 4NZRH 3VFOB 4U7SA 5HGHB 1IGFH 1TRDA 2MEJB 1RUQH 2VDQH 3VIOA 4HIPA 3SDAB 3KRUA 2YD5A 3ME0B 2KBGA 5CQ1A 4QITA 4M6NH 4A7GA 3A5FA 3S88L 2FZ3A 3LZRA 3UZEA 1KV3A 4GI4A 2F1EA 3IDYC 5DRNA 3L66A 2Y36L 4PC8A 4X6CA 2IH3B 2DVXA 4ONOA 3GSNB 1ADQL 4M6PA 1G6RH 5BS0E 2X2GA 4DKEL 3F4CA 4UI2A 4WHTB 2NV1A 2TPSA 3W23A 2WSKA 1JPSH 4WU5A 3DBSA 2XKNA 1GS8A 4JQ4A 2BWGA 4FHKA 5BXTA 5KEZA 2H2PD 4RSVA 5LIUX 3ID7A 1TITA 1N6QH 2CBTA 3MBWA 1PNCA 3MV01 2D7MA 3PM6A 1AC6A 1U8LA 3N73A 4JAMA 2J44A 2VDLH 3JWDC 3BDYL 3LXAA 4AXWB 3NYZA 1M05B 2IALA 3EX4A 4N2YA 3KBSA 2Z35A 3WKMH 2ZCGA 4TYUA 4HS3A 3CXFA 4R6UA 1X44A 1XYMA 7TIMA 4JPSA 1EXUB 3RZCD 1IZCA 2Y6SD 4GI6A 3IJSA 4P23C 1WOBA 4REQA 4ILSA 4P7QA 4DO5A 3WSUA 5DBTA 3VRJA 4XNQB 3D0VB 3HMWH 1T04A 5K9KA 3VSTA 1AZZC 3BAEL 4Y9NA 2OL3A 2P5WD 2F7PA 2XA3A 1BM7A 3P82A 2XIBA 3W07A 2CZEA 1BGAA 3HOGA 4PP1C 5HR6A 4AQ1B 2VYOA 5FI8A 4I8YA 3ESOA 5HHOB 5I1DA 3WY1A 4N22A 1BQKA 1IO4C 5FUZH 3PN8A 1NCGA 3CEPA 2H9AB 2VAJA 1PTZA 1GHFL 4C54A 3IIPA 4XMWA 1RZ8A 1V27A 5IHHA 3WFDL 2VDNL 4ES9A 4RVBA 3FDWA 4AW4A 1I8KA 1J05B 3KEDA 3OAZK 2R83A 3BQUD 1EX5A 4NAMA 5DRXA 3SGJC 5JPMC 1EJ6A 1L0YA 4PR4A 4RDYA 2IGFH 4HKJB 1NDMB 3LY0A 5AC4A 4GKTA 2J25A 4PWGA 3BCFA 4R5TA 5D5MB 4FKKA 4PMYA 8XIMA 2CHZA 3B8TA 3LIZL 2UY5A 5M7QA 2E7BA 2GJRA 4D6FA 3KPLB 1KM3A 3HMXH 4A6GA 2WV3A 1GCYA 4KKLC 4QHLA 1OP9A 4OSUH 4FG4A 1P6BA 1NMBH 1SPQA 3B2XA 3WJJA 1KTKE 3MLVH 4KX8A 1E4XH 1BYDA 5EF3A 3G6AB 5B8CB 3ESMA 4UTTC 1NSJA 3LS5H 3S36H 1QWGA 4UTBA 4N90D 2AQNA 1I1WA 4N2FA 3GXUB 4YCPA 1MOEA 5GS0D 5HYSA 2OXGB 3KP1A 4QXUH 3OHXC 3M6DA 1FL5A 3HAEH 4LASL 3SN4A 2IDUA 4HF5L 2EXOA 1XCQB 1SVZA 3QZNA 2ZKMX 3FT0A 5FYKU 3KXQA 5TD4A 3S8GB 3T5WA 4S0SD 1OCOB 1G6RA 3QARA 5EZIL 4M61A 1RURH 2PW2A 3QQ4A 2NVDA 2W0PA 5GGVH 1X4ZA 2P47B 3WNMA 2G4JA 5E1HB 2ZTKA 1FG9C 3FQYA 2MOQA 1G7HB 1FAIL 4CC4C 3N9GL 2VABB 2CUHA 2X42A 1DEEA 3OIHA 5J6GB 5AVUB 1MXDA 3WXVH 4ODWA 4FI7A 3GXIA 2GSIA 3AU1B 5MENE 4EUPB 3GMPB 1FWDC 3DI0A 2CKBB 3B1UA 3ULUF 2CLOA 4N2MA 4G59C 5BMFL 4FJZA 3DLQR 5LJYH 1VYPX 1NANI 4FF5A 1A8JH 3NGBC 4LAZA 3HI5L 3GPSA 3D4ZA 1LL4A 3WFBL 5C54A 2I5IA 3H4HA 2E28A 3LY6A 5AN7A 3S88H 3BUQA 3WH6A 3HA0A 1CI5A 5AB9A 3IRCA 4N0UA 4K1WA 1XB6A 3HFYA 2Y36H 3H7UA 2DQUL 3EWYA 4YTUA 1IAIM 1ADQH 4RRPM 1JD7A 3RX5A 4DKEH 1X4YA 4XMVA 3SCUA 4JFVA 2CD0A 3BIKB 4K73A 4IOSD 4F24A 4YR6B 5KW9L 4MCZA 2CERA 4NUWA 4JLRB 5GSVA 3L08A 3CLWA 4P8QA 4TULL 5CO1A 4BQCA 2IQ9L 3QM3A 4TSAL 4A3RA 5EU7C 1FDLL 4F2BA 4G6FD 1QPPA 5JBFA 3D69A 4ZUWB 4EI5D 4M8VA 3BDYH 5I0YA 3ZLHA 5DUBB 5DD0L 3EKGA 5E09A 7REQB 5SWQB 1E55A 1U36A 4FG0A 3AREC 1ZLSL 2BIQA 2BY2A 3OMAB 4GVGA 3TQKA 3VRIB 4FMVA 1SYVA 3K5XA 4FFVD 4E36A 4GQRA 5ICZB 2V5CA 1FKWA 5EU6A 4AXNA 2HG5B 5F3BB 1LORA 4MAYD 1V7YA 4DCQB 2XQYG 4EOWL 3BAEH 4QLWA 2DQTL 4W81A 3HMXA 3TROA 2VO8A 4TLUA 3VFRA 3K72B 3EKCA 1DBKL 1Z6JT 2Q8LA 1KMGA 3NPZB 1QTYT 4C57C 4OZHA 3MCNA 1EO7A 1XRTA 3IDGA 2X4RA 3RG6A 3WLBA 5K9OB 2M8XA 3ALFA 4JQIL 4C7FA 3PV6A 4Y19D 1RSYA 1A9EA 1PZ5A 1GHFH 3IETB 1HHKB 3WFDH 2PODA 2VDNH 1XBYA 4LIQE 2EC9T 5JW3L 3BH9A 5IQLA 5B1CA 3RPBA 3FXYA 4AAJA 3BUTA 2QDVA 4JNXA 1MEWA 4HT3A 2B7DT 4MA3A 2IDCA 3MJ8A 2EVIA 4KNTA 2XINA 1WZ1L 3EX3A 5CJNA 2R9RA 1P48A 3AAZA 3LIZH 4HCGA 4Q4RA 2V2CA 2B14A 4Z17A 2Z24A 3CK0L 2CETA 1P7HL 4J4PC 1ECYA 3NJFA 3CPUA 1I9IH 3L12A 5CINL 5DHXB 5HDOA 5FB8A 2X4QA 1UMYA 1FVCA 3RVTC 4QXIA 1HWHB 3S36X 1KZYA 3X13A 1I2OA 3G08B 3ETSA 1A3HA 5F72S 2AMUA 1RJYA 4GMEA 1FCQA 5ESVB 3M47A 3TA9A 1G0XA 4E8DA 4V15A 1SJHB 3TVMA 4LASH 4IMLA 4ADGA 3W7GA 4O19A 3EBGA 4G7QB 3GKFA 3ZKMD 4HF5H 1KNWA 5D71L 4E3TA 1HHIB 1QASA 1V93A 1F3RB 4Y4HD 1FI8C 3DXAD 4X5LA 3QJSB 3QIBD 3QORB 2B4GA 5ABGA 2NZIA 4QRBA 5F1KC 1KGCD 1VFBB 5EZIH 3OLIA 1EQCA 2XG9A 4PWIA 4IT1A 4YPJA 1FAIH 4MWAC 4PMJA 4ZSTA 3LHYA 3N9GH 1RJZA 2RHEA 3MRIA 3QEQA 4AUUA 4UQ3B 1AQMA 3OTRA 3FQ2A 4Z0BH 1IEAB 4NQSB 4GYKA 4FAAB 1IWPA 1GZPA 5DSCA 3ENEA 1M5WA 2FD6L 4YE4L 4P2OC 3GSWA 3CXDL 1OBAA 4ELKA 2BO0A 5ANME 15C8L 4MDIA 4Q8OA 3NFNA 3HTLX 1UR0A 5BMFH 4JFEB 1M3IA 1SZGA 3V0WL 3A9IA 1XHGA 4PU2A 4YNYA 2AF2A 1FH9A 4YSAA 4RFNB 2VXUL 4P2QA 1OYCA 3MLUL 5H35A 4HPOL 3WFBH 3DFHA 5C0NC 1GORA 3GHPA 1FWWA 2YSTA 3WGVB 4W9LC 2A7RA 3S0CA 5T9BG 4OLZH 1MI5A 1E15A 2VLJA 4QAWA 1JZFA 4MPKA 1J12A 3I3EA 2ADJB 5PCYA 1CFNA 3DBXB 4X80H 1I7ZB 3QNFA 2J1WA 1PD1A 1HCZA 5KW9H 4HWBA 2OB3A 3KNBA 3LNGA 1JGMA 3HFTA 4I0KA 4DM2A 3OVPA 2ABAA 3DX8A 3U9WA 2IQ9H 4TSAH 5BRZD 2OJZL 4BF5A 1IC1A 3SCQA 1FDLH 1SJCA 5E95B 3H9SB 1XLEA 2OSLA 2XDFA 4QRPB 5H8DA 1NAMA 5DD0H 4IWWA 3BT0A 5KYWA 3OZYA 1UH4A 5IVZB 5KUKA 4AD0A 5MI0B 3CQ0A 1ZLSH 1UOLA 5AQ0A 1DR9A 4CD7A 3VMOA 3HPZA 1BIIA 3W24A 3OHMB 2VSMB 2R1XA 9XIAA 4C83A 3CGTA 1W8SA 4H1ZA 3VXSA 5I00A 3OJ2C 1AW5A 1JYXA 5EPDA 4EOWH 1L6PA 2DQTH 2NXIA 5HQEA 4N6EA 4GUCA 3MA7B 4IRJA 1NU5A 5FAJA 3W1UA 1M1BA 1KYUA 2CBIA 4L05A 1DBKH 3OZ9L 5D4IA 4N25A 3UABA 4B3LA 5MERB 5F7MC 4I7ZC 5JHAA 4DUVA 1L3NA 1VJIA 1I45A 1VRSA 1YJDC 3M5YA 3NQIA 4JQIH 4HOMA 3GBEA 1XGTA 2GZXA 4P8XA 5IBXA 3TF7C 5IB3B 1IC5L 3DX3A 3VA6A 1SSDA 3H7BA 4GG6B 3QDME 5JW3H 3IIZA 3H9SE 1O5QA 3AIQA 2JWYA 1UWAA 4NNPL 4QRPE 1I8LC 4QF1A 5F44A 3FUKA 4LDCA 2CO1A 3IWVA 4WXYA 4FK9A 4GBUA 4OT7A 1WZ1H 4Y5VB 3WAJA 3QEZA 3O4OB 5EUOF 3ZO9A 2DQFB 5LB1A 3M43A 2EC8A 4OT1H 4QDMA 1KCKA 1PBYA 5HTSA 4ZBCA 2VZ1A 1NMAL 4G9DB 4IQLA 2O61A 3W83A 4LUTA 1ORSA 2FIKB 5E8OA 4PG9B 1DWGM 3CK0H 2OLHA 2WBJD 1K3IA 4JIPA 4ZFZA 2K6WA 1KCRL 4PRPE 3LSCA 1DN2A 5AC6A 8RUCA 3P62A 5CINH 2GJXA 1NDVA 2Q3XA 4EANA 5BOJA 3LV5A 4ICMA 3NSXA 5CZRA 3PWIA 2CDEA 1JN6A 5CP3A 2XPGB 1S5HB 1E5AA 3ZL2A 1JAEA 2EEDA 3QQWA 5D7LE 1XLAA 4OM1L 4DPPA 5DHMC 4GG6E 1WFIA 1TIUA 5ADPL 5D71H 3JZEA 3TXAA 3SIZA 1MCQA 3VGFA 5FKPB 5A40E 1TTGA 4XAZA 1F8MA 4YGVA 4XOEA 2G5UA 1MZZA 1E4JA 5C7XH 4XP6H 3GS7A 3DVFA 1SN2A 3KPOB 2OJEA 4PTNA 5I3HA 4FXRA 4DK6A 2TRSA 5E93A 1BOYA 1PCSA 3CCHA 2NVCA 5FYJE 1KFWA 5D05A 3AFLA 4IKLA 3SQLA 4G6AD 3O7UA 4TLSA 1ROWA 1KPUA 1K9FA 1M6OB 1KWGA 4KT2A 2FD6H 4JG5A 4YE4H 5EOCJ 3B3DA 4F80A 15C8H 3ARQA 1AZBA 3BEVA 3WH7A 5HDBB 3UL4A 2F2KA 3L2LA 4HIBA 3V0WH 1GK8A 4AQEB 4AQ8A 2DLFH 5MKGB 1T5KA 2R2CA 3EJUA 2VC9A 4LCYA 3SCPA 2VXUH 3RP1A 3MLUH 4HPOH 2ICSA 1CD1A 4DOHE 3W7MA 1AIZA 4ZTPL 1W3HA 2BX7A 2PGRA 2BP5M 4NVTA 1S1RA 4U6YA 1NIAA 3ZZQA 2VFHA 1D6EA 2C7UA 2VKWA 2IMNA 4HD5A 4Y7MA 3KLAA 1DHPA 1INDL 1I31A 4XXWA 3KPNB 4N24A 2EIDA 1Z7JA 2WQUA 4YBLC 2GQAA 3RDKA 4HYWA 3EDJA 4ERSL 4AD3A 3ECUA 3WFHB 1X8CA 3B4NA 4U5KA 2F58L 1A21A 2OBGA 2VRAA 5E8EB 2OJZH 1MVUA 1YECL 4C6FA 1HXMA 5HHVL 4MAYC 3A64A 1RJLB 1FWRA 3E0GA 4CD6A 5J8LA 3SDCA 1P9MC 2O30A 2HPTA 2IQDA 3OZMA 1PIFA 2OMUA 3NH7L 3NO3A 1J11A 3BMVA 2DOCA 4KFNA 3GSVB 4H83A 1TV2A 2HB0A 1FXPA 4FXKB 1RBOB 4OD3L 1Q38A 1SY6L 3G18A 5E4AA 3MQTA 1A2YB 4NERA 4C56A 5IHBA 3KPPA 1GTFA 3DSNB 4IMGA 4J3WA 3TW9A 2JLPA 1VPYA 3L5AA 3GSNL 3VO0A 4N6FA 4OJCA 3S2NA 3VFMB 5LGHH 1YEDA 2Y70A 3OZ9H 4RMBA 4QEHA 3WTVA 1NCUA 4XN2A 4ERIA 5J4MA 1JZDC 3TC6A 1OTTD 2WNZA 3SDYL 2JJWA 3K0YA 1E1CB 3TJHD 3ZIMA 4XO8A 3LPWA 4Y16C 1TO5A 5E9AA 4BZ1L 4QYAA 4JHAL 4JY9A 4L9ZA 4XCFL 4L65A 3W71A 3QI9C 3II3A 1W3LA 5T9CE 1IC5H 3LHVA 1CPUA 4WO4B 2DY2A 2A6LA 4NNPH 1LRQA 2C3VB 4KK9D 3TUUA 2R24A 4E5XA 4XKYB 2APXA 4UFKA 1U8PA 3PANA 1QPOA 4QFUA 2WY3B 2Y7LA 4CAGA 3LNFA 4PJ8B 2H1XA 4ADIA 3OBKA 2VWTA 2JMRA 4W7WA 4P3WA 2PE4A 2ALDA 2V8MA 1EJRC 2A7NA 3QYSA 2UY7B 1A3LH 4B9PA 2ZWZA 4OVUA 5I17A 1F6FB 1NMAH 4I48A 5FJUA 3KPRD 1IL1A 4N4QA 4MMYA 1YTEA 2CBUA 1AGFB 4ML9A 4LCCA 4AZCB 3DA0A 3IN0A 1VFHA 1A7QH 5DZNA 1KCRH 2YMXH 4PUKA 2HQAA 4LHUA 5JH2A 3FH5A 2XWBB 4QRTA 2QKIC 4UDUB 3FU6A 4JDVA 1U8CA 1DV7A 5HPMA 1ZCRA 5GJTL 3IBEA 3UMNA 5I3IA 4L4MA 4G7EA 5CFAA 2A3TA 2MCPL 1CFMA 3F5JA 2FHFA 4Q2ZA 2AAVA 3INOA 2ZCKL 2ZPKL 2FTAA 4CNNA 5LA2A 5C0BE 4OM1H 3LZOA 3QJRB 2GGHA 5A16A 1MCJA 5AYQA 2YAMA 5ADPH 3HHSA 4PCSA 1SFTA 1S9VB 3QFJD 4UOW0 1RZGB 2H8PA 3BVJA 3STLA 1T0PB 3C60A 1SJBA 4ZOEA 5DHEA 1J9YA 2NLYA 4TLTA 4CC0A 3THQA 8FABA 4WI3A 3L5WA 4YUEL 1KKOA 3OKMA 1DJHA 4W4QA 1BZ7B 3SKOB 5J13B 3RMJA 4OBSA 2V2TA 5E08L 4GC3A 5U7SA 3SUUA 2HXUA 3LV6A 2RD0A 5T91A 3OKOA 1T4WA 3P3TA 4D9LL 3AWFA 3S35L 2BOGX 1TSRA 2PABA 5IHUL 2NXGA 3PZUA 4H9YA 5C0AB 3WJLA 1BVKB 3BLDA 4IS6B 3UR7A 3NEVA 4E41B 4TPRL 3P5YA 3BT2H 3A3YB 3IDMB 1WWCA 2GJZB 4PPTA 1LEGA 1VZIA 1OEPA 5I3GA 2A9BA 3E8UH 1KV8A 3DOSA 3N5AA 1G0CA 4QX4A 2CDFA 2IC2A 4IYKA 1DIEA 1J88A 3EOYG 2XXMB 3HG5A 1E27B 1Z9SA 1LD9A 3V4LA 3EGXA 2YGNA 1GVQA 4MAUH 5CSUA 1GVOA 1UP2A 4KI5E 4ZTPH 4TUOA 4PRAB 3MDUA 4K71B 3T81A 2VW4A 3O3EB 3SPJA 5J3HC 1T21A 3ZX1A 3MV7B 4LMQE 4JFUA 1HILA 4TX6A 3EG9A 1INDH 1UD5A 4H88L 3O6AA 1T03L 5TFSL 4ERSH 3MC0A 2VURA 1BZ9B 2V5SA 4GP8B 5FECB 3G1FA 4HZMA 3TQPA 1VFOA 2AEOA 1HL2A 4AMKL 1EYWA 4WD0A 2VDRL 4JY4B 1LUCA 1YECH 1LE5A 4AJWA 1LO3L 5C0AE 5HHVH 3BUIA 5I16B 1JHKL 5C7HA 3FSZA 3W70A 1IAKA 4CVXB 3GYCA 3CC5B 3L3JB 4JFXA 5AHLA 3N42B 4AIZB 4E41E 5F6HI 4I18B 4X83A 2CKBL 2X70A 4WFFD 5B3NA 1ONEA 3VIHA 1LRTA 3URNA 2PF8A 1NDZA 1GYMA 4IIDA 4C6KA 3LRMA 4KRNA 5FSDC 3VXUE 5E4IA 3IFOB 1PDZA 1OT2A 4MJ6B 2X9WA 4OD3H 3IGXA 5I5RA 4WK0B 3VDCA 1M7UA 4JIHA 8CGTA 2WHLA 5G4MA 3HE7A 3GSNH 3MV7E 3VG9B 2C9QA 4TTGA 4OZOA 2PWDA 4XP4L 4EVZA 1OZUA 4QJ5B 4KZCA 3P69A 2RFXA 1UJ3C 1WHOA 5D38A 3SDYH 2COVD 2F38A 4FZ8L 4L1SA 1GOQA 5FOBB 1E72M 4JKWA 3VJ6A 3L5XL 4BZ1H 3QYMA 1LRNA 1HZLA 1IAOB 4P7RA 3KBNA 4XTRC 2R56L 3LM3A 4CDHA 1PDKB 2VXQL 4LIQL 2Q7YA 2FH8A 5BJTB 4JFSA 1XRSA 4XAKE 2HPIA 3NPWA 3RMEA 4CMHC 4BFKA 2HE5A 3D4YA 3L7FA 3P11H 1VFLA 3ZWTA 2K8MA 4ZO9A 4UQDA 1HI6A 3FL7A 1XLCA 1XGQA 2PLCA 1PZSA 3IGFA 3ZLGA 4FNPA 4AVIA 1IRAY 4H6KA 5SV3A 1F6AA 1WKYA 5A8GA 4P2AA 2VCOA 3EGSA 3TQ0A 1HQRA 5HYJA 4MPQA 5IGXL 4AUYA 4ETQA 2J8UF 2J27A 5FGSA 3Q2NA 1KCVL 1NJ9B 1UB3A 3QZWG 3OG2A 4M5ZL 4U49A 1GSKA 2AEWA 1BVLB 4MWFA 2VR6A 3U2ZA 1W2KT 2VM4A 4Z7UE 3CJJA 4NFDA 1R5WB 3MYJB 3QA3B 2QPEB 3V6OE 1XVSA 2WC7A 1GQKA 4L4TD 5GJTH 3ZHDA 4PBFA 3FGCA 4D0DA 5CXPA 3WKYA 2MCPH 3OAYH 1LBMA 4KNQA 5EZJB 1ACZA 2HK1A 1NSNL 2HVKA 4YAQB 2ZPKH 1E65A 3R06B 4RWYL 1XP3A 4XPFL 4IBQA 1W1IE 1K4DB 2P76A 2JF7A 2NQZA 3WUWG 4P7LA 2YAEA 1F97A 5DEGA 4R5XA 1P5BA 4O2FB 3VTMA 3VW3L 3ALWA 4KOCA 5BS0A 2F7FA 1N18A 3MRLB 1PCWA 1GH7A 4EKXA 4YUEH 4QE1A 1I1CA 5FJTA 1E6OL 3MRFB 4UBDC 3W39A 4H8VA 5JIDA 3N29A 3TJPA 5C2UB 1A4JA 1P5UB 1QNQA 1R17A 4NENA 5E08H 2EICA 2D4DA 3S8WA 4H6QA 4HC1L 2YPKA 5BRBA 4D9LH 1IGCL 3S35H 5IHUH 4JN7A 1H49A 1P7BA 1TLKA 5FAGA 4LB3A 4D8OA 2AKMA 1HW6A 2PPFA 3MX0B 3DH7A 3TBCA 4TPRH 2BVPB 2WNGA 2QGCA 3TNOA 1WFMA 4IQEA 1A4KA 1U8IB 3BZJA 3UTTB 1VYSX 2NQHA 1KJ3L 3A47A 2X3CA 4XB3A 3GDKA 4PD4J 4OFDA 1GVIA 3L3IB 1SY6A 4Q52A 4DIAA 3VB9A 2Z9TA 4H9MA 1XYAA 3JWNE 3AWEA 3TF4A 2ODOA 4XD3A 1R0MA 2H1LM 4AT6B 2DH3A 2IH3A 3GSNA 1B9KA 4I7VA 2DEXX 5H37G 2NY3D 4W4OC 1A5MC 1ND0A 5IFAH 1FPTL 2G0WA 4UQ2B 3T0EB 3MS8A 3T8LA 3BMWA 1AG0A 1T03H 5TFSH 2EPOA 4Z1YA 1AS8A 3PWJB 5C55A 1O66A 2X4NB 5CZXD 1XSIA 4BZ1A 3WHE0 4HTYA 4RGNB 5F7NC 4OIIH 4AMKH 1UP0A 3W7IA 1ONXA 4ZDHB 1I3VA 5FD0A 3QJVB 1LO3H 3E74A 1JHKH 1XYBA 3QHOA 2HKAA 2X1SA 5LBVA 4N2DA 4EUPH 5I74B 5I09A 4DN4H 3LH2L 2CKBH 1AGCB 4KXDA 2GQ9A 2YUZA 3A4AA 1KEMH 2IBBA 2R8SL 3V0TA 2VDQL 3UTTE 1KFGA 3KM2A 4XNQA 1OEZW 3AIBA 2P80A 1H3PL 3IDUA 4MAZA 3GIZH 3GR8A 1Z5LA 2X6VA 1TVLA 1GY1A 5I71C 1FIGL 3BP6B 3T8QA 1ZE3H 3PVFA 5T1MA 3ZYJA 1K85A 3PWNB 1KY7A 1UWXH 4PLKD 1W17A 4MA7L 4CQBA 4HETA 4YNGA 1BBDL 1THCA 4NHUB 2EBNA 3T0EE 4XP4H 2VLLA 4MNQA 1BQHB 1FHGA 4NZCA 3FH8A 5GNXA 4D0BA 2XYCA 4FZ8H 3BZFB 5IBUB 1J1OL 3F7YB 3GSQA 3L5XH 5D2XA 5J1AB 3CE1A 2JELL 3BO9A 4JL2A 3ATBA 2VXQH 4LIQH 2C79A 7XIMA 3TN6A 3N19B 1N9PA 1U9KA 3UXIA 5HAOA 3PPHA 2DMHA 5DMJB 2BS8A 2OWXA 1IIKA 4I9AA 4ABQA 3AWOA 3HR5B 2WZEA 4O9HL 2AQ1A 1XYLA 4AV0A 3BHBA 1DVZA 4G7FA 4OIAA 3UBXI 5DJ8A 3C5ZB 1QUNA 5HI5D 5F2MA 2QVTA 2AQTA 4Y5YC 5TK4A 2QS8A 1SJEA 4X2RA 4Q97A 2YQBA 3IGLA 1PZ1A 3NPVA 4ELMA 3KDMA 3NIGB 1G67A 4KRUA 4APQB 5AAMC 5IGXH 4JY6A 1FHVA 2BP0A 4XAGA 3B3IB 1M7IB 4KCUA 3S2CA 2Q76A 3CYVA 1LEIB 1KCVH 1M7DA 1F11A 4M5ZH 3QUXD 2PSNA 2LQRA 1XLDA 5MENA 1XR9B 1V3JA 5KJ4A 3VQMA 1H7RA 3SR7A 4XWGL 4JXCA 5HD8C 1EERB 1HESA 4QRNA 2XFFA 4HNNA 2YXVA 4RAUA 3O6FB 3CSPA 4E9TA 3ZYOA 4Y4FB 1WIOA 4LH8A 1X96A 3IB4A 5CMAB 3V6BR 1NSNH 4GRMB 2PZNA 4K3EL 3QQDB 4RWYH 1CDIA 4XPFH 2W6RA 1TQBB 2X2JA 5JIWA 2MCAA 3LKPB 2VDHA 4GQ9L 3B2PA 2GL5A 2PGWA 5TQ2L 2D9CA 1XYFA 2A9AA 3HPLA 3S1VA 1RA5A 3GFUA 3S4TA 3N1MC 2EPLX 3BJSA 4CSPA 1E6OH 1LYQA 4G71B 4EIGB 4L8CB 3JV0A 1G7HA 3H9YA 1KN4H 3HE6B 3RUBL 2E40A 3NIGE 3S35X 1L0PA 1USQA 3D3VB 5FYJL 3KZPA 4G43B 2J7DA 1WEJL 4HC1H 2Z64C 1IVTA 1IGCH 3RRQA 1E4WL 1G5GA 3MLVL 2FJFA 4BWLA 1E4XL 1Q3NA 3LLXA 5HGDB 1QNPA 4CQ8A 1UD4A 5L2KE 4O02L 3AU1A 3PE9A 3MODL 5IROD 3PS6A 2CKBA 2PP1A 4JCWA 3PHQB 4GUJA 4QXUL 3WBAA 1NFIB 2OR8A 1CDYA 1S2VA 2GDQA 3U2CA 5KYUB 3TN0B 1F2QA 4FG6D 3BOVA 1M2OA 2FEDC 4O1CA 2QVKA 4NP9A 4NUPA 5HMFA 1X9LA 4JRXB 4LL1A 1GW1A 1GTHA 1ZJAA 4PG2C 2CIPA 4EO5A 3D0CA 5K9QG 3UTPD 4FIQA 1PIIA 1VRXA 1SEBB 3AQXA 3QIWA 2XY1A 3VH8G 1PHQA 2KS0A 1U3JA 5GGVL 1Q9LB 3MI6A 1FC2D 1T7WA 2J12B 4UYPA 4PWFA 1GUVA 1FPTH 2I9LA 4PREB 3ZK0A 5CEXA 3ULVF 4KERA 1JGUL 5A3ID 2E3ZA 3DROA 4YR6A 3FONB 2OXHA 4V28A 3QNXA 4RNRB 4J4KA 3KBHE 1MFNA 2QJNA 2FO4A 4EI6A 1R2SA 3D3VE 4KV5E 5JO5A 1OPGL 5E8PB 1CB7B 2VXQA 2WJEA 2CLZB 3K80A 3SCOA 3Q01A 4ZUWA 4XE5B 1NC2D 4KHTL 2YCLA 5HI4C 3V52H 3LH2H 4GYFA 3PLYA 3GQYA 5CJ5A 2ZT9C 5LGXA 1RCYA 4HIEA 3QULA 5GZOC 2R8SH 3WO3B 3QB7C 1QTSA 1QLEB 2L8AA 3SE3C 1HX0A 2ESVD 4UF7C 1E67A 1I4NA 1DFXA 4DIXA 3MSRA 4JRXE 2R4RH 1JXFA 2B77A 3STZA 4HQQL 2NSXA 3RNKB 1H3PH 5EIVA 4JYDA 1IX2A 2ARJB 4FGMA 1LG1A 1FIGH 1J6PA 1WBYB 4NF7A 4AYGA 3DGGA 3IDIA 4QWWD 2V8LA 2VKXA 4MA7H 3B2UC 1S3TC 2HJLB 5FJJA 2ZXGA 4RUBA 3MUAA 1BBDH 4MDJB 4HJGB 1TPC1 2R7EA 4H0LC 3MNVB 5GS1C 4GI8A 1XFPA 2ZQ0A 3CLMA 2J78A 3WEMA 3CHPA 2NW3B 1J1OH 1HHJA 2G3FA 1HHKA 2JELH 1UG9A 1ZWIA 3RUGE 1HKJA 4XBEH 3KBJA 1N59A 3HGJA 3JBG7 1A5SA 2V2HA 1A6AB 5IDZA 1UXSB 1R9ZA 1FYTD 2JFEX 1YXYA 4O9HH 1QPRA 2E47A 3CMGA 4JG9A 3WLLA 2HA1A 4LY4A 2X0SA 1V7ML 1SZNA 2VDMB 3HBGA 1CYXA 3WF1A 4ZUUB 4GLRI 1YEFL 4BELD 3K4AA 3CWGA 4M19A 4HC1A 5D2LB 2BVTA 2BVYA 3ZM8A 2XSBA 3BWSA 3W1MA 3V0AC 5DK0B 1MDTA 2CLRA 1D2KA 4Y1AB 4CSTA 3P73B 2YD1A 1XGRB 2VLKB 4XWGH 2DYSB 5ANMA 1ZGLB 1S2WA 4YL4A 4E4UA 4GYPA 1OTUC 4TSBH 1ZAIA 3ONCA 4E42B 1X7IA 5HULA 1P7TB 4ORGB 4LC8A 4PJHB 3GIYA 4K3EH 4IBWA 1CZ8L 3MWAA 3TZVC 1VEOA 1W3JA 3U0WL 4E9SA 2MOVA 5FF2A 4GQ9H 2PPGA 5TQ2H 2WUCL 3QORA 3IK2A 1Z9MA 2LU7A 3LZQA 4F7CB 4YXLH 3AFBA 2X4OB 2EHHA 5EZLA 1TCMA 5D7JD 4CD5A 1XLKA 1TR1A 2X44D