5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
b'LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GLUCOSIDASE
publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
3WLQA 4YYFA 3WLIA 3U4AA 5IOBA 3BMXA 3WLKX 4ZO6A 3WLPA 1TR9A 3NVDA 5TF0A 3LK6A 4I3GA 3RRXA 1X38A 1IEVA 4IIEA 4ZOEA 2X41A 3WO8A 4G6CA 5BU9A 4MSSA 5FJIA 3UT0A 4GVGA 3TEVA 1IEWA 4GNVA 4IIHA 4ZOAA 2OXNA 5JU6A 4ZODA 4IIGA 3U48A 3WLSA 4ZO9A 3SQLA 1J8VA 3GS6A 3WLHA 1Y65A 4IIFA 2X42A 3AC0A 4ZOBA 1LQ2A 3WLOA 1IEQA 3WLRA 4GVHA 4IIDA 4I8DA 4ZO8A 3GSMA 3WLMA 1IEXA 4GVFA 4IIBA 5C0QA 3ZZ1A 4GYJA 5BZAA 4GVIA 1X39A 3WLTA 3USZA 4ZOCA 5G1MA 3ZYZA 5FJJA 3SQMA 3WLNA 4IICA 3WLLA 3WLJA 4ZO7A 4GYKA 2X40A 3ABZA 4HZMA 1EX1A
chains in the Genus database with same CATH superfamily
4RIFA 1NFQA 4HI0E 3PUHA 1VJGA 2YW9A 5F9HA 4X85A 1K6AA 5DBIA 2K2WA 2YV2A 3L9CA 1S01A 3VAZA 1Z2PX 5B1SA 3N6RA 1DOZA 1E71M 2HDOA 4DIAA 4UTWC 4TXNA 3ABIA 4GUHA 1Q7BA 1DKQA 2ODAA 1WSDA 2YJ5A 2ZWMA 1W76A 1E70M 2Z7KA 1RJDA 3IESA 3AEUB 1RPAA 3I23A 1D09A 4KLNA 3C1UA 2KZHA 3JARA 3A47A 3GS6A 1XRTA 3ZWAA 4HQNA 1NY1A 5CGMA 1UWAA 1PT7A 2JLCA 4UR9A 1CDOA 1PDZA 3RU2A 1SVLA 4WQMA 4G41A 4W1RA 3UJ8A 4TMZA 5C7VA 1JSCA 3WFZA 1XCLA 4JTFA 4BZZA 5CPTA 2QXTA 4LIPD 5ANRB 3I09A 5CFZA 3A1UA 2IXAA 5IVDA 4UTMA 4GZLA 3JATA 1UKOA 2HHJA 1VCNA 1DWAM 3K16A 3TEJA 5IBQA 4J3SA 2R5FA 4DWWA 3LKVA 4DQVA 2QNRA 2P90A 2W6JA 4D0RA 3RYHB 5DANA 4FLMA 1SZPA 3HDVA 4AG0A 4DHEA 1UXGA 1NWTA 3PJGA 1YPXA 2QAPA 3H99A 3RRXA 3E9RA 1NYTA 4ONVA 3WJAA 3I83A 1Y9EA 2X77A 2WLYA 3F4KA 1HEUA 4CM9D 2CVPA 4RD1A 5BU9A 3FYHA 3H54A 4JR0A 4ZC1A 4D6CA 1MEHA 4D74A 4UMAA 1WDTA 2B5WA 1W94A 5FV4A 1C7QA 1WXYA 4UU0A 3W05A 4HLUA 4K7VA 3RTDA 1KZ4A 3AHYA 4LWWA 1WABA 3T1GA 2NT0A 2RKBA 1G8HA 4H41A 4F04A 3LGXA 2Y5JA 4MVYA 4E1VA 1HX0A 4JC8A 3H9QA 4KEAA 1TEZA 3VMPA 3PD0A 1M0TA 1D1PA 2W90A 4D8YA 3G1VA 1XG5A 1GL9B 3VGFA 4DJDC 3ZH9B 3HA2A 4B2IA 1BYIA 2IPGA 2GM9A 4PEVA 2W22A 2JJMA 4S1OA 3WK1A 1ORRA 4LZOA 3H9CA 3VXGA 4DHWA 3CVWA 1LUCB 4AZCA 5AHLA 1GCIA 3PCTA 4CIXA 2QLLA 4LGYA 3WFLA 3KSMA 3MVIA 4Z9YA 4OHXA 2PEVA 4HZ8A 2ZDQA 5LDGA 3ESDA 3SXPA 2D0HA 1XRVA 3W1EA 5AM5A 2D54A 3D7SA 4Q3LA 2P3SA 4NZPA 1PZ2A 2OR2A 4OX9Y 1IAVA 5DSTA 4W93A 1JQDA 2VH1A 2BF7A 3ZDQA 4D82A 5EZSA 4F8XA 4IUDS 3A4TA 3G85A 1JCJA 1XU9A 2J3MA 1XROA 3O94A 3KHDA 5EA9A 1QTQA 4WJLA 4WDUA 4YAGA 4P93A 5DI3A 3SM0A 1Q0RA 5LB4A 3TTUA 1VPWA 5FOSA 5BV0A 4IP5A 1XN4A 2CSXA 4KQFA 3I2GA 4ME6A 5FIUA 3UQZA 2DSNA 1ADBA 4Q1FA 3KTDA 3M0EA 2XMCA 3AZTA 4XQEA 1A9SA 4BKNA 2VCBA 4FIQA 1FSSA 2WUFA 4B9YA 3Q9NA 4KO4S 1IPHA 1RKVA 1E72M 1B23P 1QP4A 3RYTC 5EERA 1F61A 3MUOA 4CBVA 3S2LA 1E2JA 2W6CX 3OCUA 3HG4A 4WOJA 1JEOA 1JA9A 3UJHA 3ZR4B 4NATA 2ADAA 4G1BA 5KSWB 1YDOA 3WX0A 1CUFA 1XCOA 3FHJA 5JVDB 4DXHA 4IGHA 5EP1A 1DBSA 2QXWA 3KOUA 3DHVA 4WCFA 1DKRA 4IXHA 3QVVA 1C7TA 4PPQA 3P7MA 2GVZC 3GJ4A 4QX4A 3R9XB 2HIGA 3OVGA 2N3ZA 2ZUCA 4GGHA 3S83A 2IOFA 3A4MA 2B69A 1IWOA 1TKAA 4C89A 2NX9A 2WAOA 3AV3A 4E4PA 4R5HA 3IANA 4NVTA 2D8AA 4XUGB 5LIPA 2R7KA 2WJIA 2Z5FA 1ODUA 1AHHA 2IP4A 4I9JA 4JLNA 1I6WA 4GKVA 1T13A 1VL0A 2A30A 4ZEXA 4WFJA 2CMHA 1E6EA 2RD2A 3EVBA 1S02A 4G1KA 1B2LA 2G5TA 1PNRA 3IK4A 1J2EA 3T1QA 2DVTA 1N2JA 3F6PA 3IAUA 4S05A 4R9NA 5H8WA 3HKBB 1JPNA 2XQJA 5B4VA 1TV8A 1ZH6A 3O6DA 5FTNA 3L5OA 3B51X 3D5TA 3WQEA 1KXHA 4FGKA 3EMDA 2E1RA 4QDOA 3HFGA 1Y9JA 1QC5B 1VRCA 5EP3A 1MIOA 3AY6A 4PYIA 2BTQB 3QXXA 3IE0A 3Q0IA 1Z16A 2R1TA 2HB6A 3BG3A 4OLHA 1EWRA 4Q18A 1W36D 3RT9A 5AKQA 2RBGA 4MSSA 1YIXA 1HKMA 1E55A 4PMZA 5AJYA 1OSNA 2DPGA 2Q3BA 1ZM9A 4IIFA 4QBGB 2C7OA 1YZNA 1EK1A 4ODIA 3V35A 4EMUA 1NOIA 3KRTA 3N05A 3VDQA 3EA2A 4UBKA 3EDKA 1PZ3A 2WUEA 3AG6A 2FF5A 2WZHA 2B4YA 1DMRA 2ZK7A 2J7BA 3MOIA 1ZP6A 3H2BA 4PR4A 2MYPA 3UMMA 3MT1A 2DQKA 4YHBA 1WV2A 4EHFA 3TX2A 1JG4A 3UGTA 1JCTA 4EB3A 1K92A 2HU8A 3CUZA 1G8KA 3WWYA 1X2EA 3MP3A 3D2AA 4HHEA 3AMGA 1LGYA 4PVDA 4Q7EA 4JQZA 4HT3A 5JAUA 4RHFA 2ECOA 2IXBA 3LQKA 4B5UA 4FB4A 2B1RA 4CCWA 3VJLA 1OF8A 3N39C 1P5HA 2P5TB 3NFYA 3VVCA 1GZ1A 1NKTA 5I8PA 4WEQA 1LBFA 1CZ1A 2ODBA 2IOYA 3GU2A 5IRCD 4UVGA 3HBNA 2V7GA 1BRMA 2Q8QA 1QK2A 2EEPA 1U8CB 3CH5A 2QZ9A 1XNHA 3LT1A 2XOXA 3UW1A 5E7IA 2O8CB 2W37A 4ETNA 4XLLA 1B6SA 1NG9A 3WIUA 4D8WA 1JZSA 3AR7A 2Q45A 2ZJBA 2C7QA 2DQ4A 5EIBC 4JU9A 2P9YA 4UB9A 3TZCA 4R88A 4G56A 1ZNWA 2MMGA 3M7SA 1EQCA 3PC8C 5CBJA 2WYIA 4QDZA 2JEYA 1PYGA 4HPJA 1PVDA 2DETA 3UR5A 3LLCA 1XQLA 4O2LA 4BCBA 4P4GA 1WVGA 5E1DA 1TJ5A 4X61A 2WVUA 1I30A 1VD6A 4KN9S 1FKXA 2FN9A 3C6CA 4F9TA 2D0IA 1XMOB 1SW0A 4ZOLB 4S2CA 3DH7A 2O50A 1X38A 1ECBA 1IBRA 4EHAA 4KBYA 4ZENA 4L9WA 5BOSA 4M46A 3FOEC 3RYIB 5EIAA 3CZLA 3LPFA 3D46A 2R6CA 4FUTA 4QPZA 4OB6A 1J79A 2QPOA 1X0XA 4P5UA 2UV8A 1ZB5A 4YVVA 3KL4A 3ANNA 3P9KA 2J8TA 1OFQA 2GRUA 2D3LA 2XUKA 1HLPA 2FU5C 3U4CA 3F7JA 5ALIA 3C74A 3UWQA 1HL2A 1QLJA 1FW8A 5FFNA 2IE8A 3W22A 2OO0A 5HMSA 2CVZA 3G2PA 3SIXA 1NPYA 1ULSA 5LKAA 1WO2A 4I4TA 3DO5A 3GRYA 1ECEA 4JDBA 3KUXA 2DPLA 5AVZA 1JF6A 4X00A 3FDIA 5AVQA 4I0WB 1KBJA 1K3FA 1GT8A 2QV4A 3SOPA 1AQ6A 2X2YA 4IJQA 2IXEA 3T8QA 5JROA 3WF3A 1Q3HA 3UWPA 4EUHA 2JGMA 4GBJA 4J03A 3OTRA 1P4JA 3P96A 3IUMA 1RWXA 3P5BA 1TWDA 4BPRA 3BFPA 2RDXA 1CTQA 2OX4A 2XIMA 1KL7A 4GSLA 1EVKA 3B6MA 3G1XA 3W5CA 1NVTA 4ERXA 2JKVA 4J07A 4IDEA 2OQYA 2B92A 1CRPA 1LP6A 2O3RA 1UJBA 3C2FA 3AU6A 1ID1A 2PGWA 2RC6A 4LRQA 5K6AA 1W88B 3GRKA 2A2ZA 2PX2A 3BJIC 1I5RA 2VRJA 2ZBUA 4NQ1A 3TTXA 4EKJA 3MCOA 2IOFK 4C6PA 3GUZA 3CO5A 2DY1A 5D00A 1E3EA 2NACA 2JCSA 4FZ3A 2JFXA 1KW1A 2MDTA 1J8MF 4B73A 4HYTA 2VQ6A 2I1WA 4K68A 1T6MA 1PQUA 1A5SA 1EPXA 3S55A 3VABA 3IGSA 1L4YA 5AP9A 4RSGA 4JP3A 1AB5A 2EW2A 4G4JA 3A21A 2IF0A 3RFTA 3A1TA 2XWPA 4QC2A 2R00C 2AXNA 4FEZA 2QTVB 4KF1A 1ICEA 2VAWA 4O4LA 4YRLA 5A3SA 5PGMA 1C0IA 3O06A 3WGZA 2EIXA 2QM7A 2WC4A 3T55A 4QVGA 3HUDA 2GJ9A 2M9MA 4W7IA 3PTZA 3L4TA 3L4JA 4KEZA 4TZ0A 1QOPB 1JR6A 3F9RA 4NYUA 5EXTA 3M6YA 5AT1A 1NVKA 4PS1A 3PFMA 4F1WA 4GZEA 5M1TA 1W0KD 4QRDA 1XQ9A 5AWFC 4N3NA 5A8GA 3DV0A 5DNDA 4EJSB 1OFDA 3SHVA 2KBFA 2E4TA 3ITNA 1UP6A 2AI2A 1Z2EA 3N2EA 4L2IB 4QWWA 3GC2A 3U7JA 1UQYA 3TSCA 2C5EA 5AJUA 1Z41A 2E68A 3GFGA 4YPVA 2FX3A 3M9XA 1C92A 5AI0A 3NG1A 3I5XA 2IUZA 3DZGA 4NX5A 2X4DA 4XO6A 1E9CA 1RYNA 4P3KA 4V38A 1KLZA 2HCJB 2HQRA 2D2JA 4WIWA 2GJXA 1WU8A 4IDBA 4AKEA 3F3YA 4RQAA 4GPNA 5GZ3A 4R2IA 1SUCA 1NHGA 3CLSD 3NVKI 3T7VA 1D2HA 3VA7A 1DQZA 4ZO6A 2RJNA 3NAZA 1JIUA 1VIWA 4L0QA 2XZLA 5FBWB 2C98A 2QOEA 3EPKA 2VK1A 4H1HA 4KQXA 3W7BA 4OQPA 4P7OA 3H2YA 2F6UA 1IU9A 5DGCA 3SZGA 5KZMA 4R0MA 2JK0A 4IOKA 3O8DA 2BKVA 4AF7A 2FDCA 1FBNA 1VZ2A 1NQWA 1L5HA 1LORA 2F90A 5HANA 4C6LA 1UT5A 2IHNA 3L7MA 2EWMA 4ESHA 3VSCA 4EA8A 4OQVA 1YUMA 4M5PA 4ER5A 1VC4A 3JW8A 1M7HA 1G1AA 1XJBA 4HYWA 1OVGA 4GO8A 2PMEA 4RC9A 4MP6A 1T4CA 2ZVDA 1X3SA 4XB1A 4DXXA 1YTLA 4WT7A 2J7PA 4LRXA 2IEZA 2PKQP 2ZZ2A 4LXFA 2PH1A 4YX9A 3HFYA 2Q9BA 3UWWA 1UHVA 1I7PA 1QZ3A 4CCAA 4UBLA 3BMCA 2I5IA 3EGXB 1NQOA 1OGSA 1E7QA 4WVLA 5EE0A 4BF9A 4JI2B 2JK2A 2VJPA 1H1LA 2VX6A 1GZ4A 2C9MA 4C6BA 2ODPA 1IZ8A 1KZYC 4F96A 2QP3A 1V7YA 2HRCA 3SX4A 3NP7A 1XV8A 4TQTA 2WC3A 1RI5A 2MTBA 3PQEA 1ZI9A 5DLQC 1BQ3A 4PEEA 3Q8KA 2PGXA 1VKOA 3FW1A 2XNCA 1C9NA 3D0CA 3UJBA 5DBUA 1UR1A 3ARPA 2O8BB 1UDCA 4IZOA 4I99A 2YASA 5EB8A 3CEPA 3L4YA 4IHAA 2IX9A 3M0XA 3ZWQA 3UZZA 3ELBA 3JZUA 4U5XA 3W1NA 2W79A 4ZARA 1OIWA 2PTYA 1MJHA 4H04A 3ZE6A 1K4HA 4F9DA 4ZYVA 3STVA 3DF7A 1WP9A 4TL8A 2A7QA 3JR3A 1MOPA 3W83A 1UW9A 3KQQA 1RYZA 4GQQA 5I7RA 4WVFA 3DPIA 4ACZA 3UUWA 1QG2A 2DORA 4US2R 3V48A 3H1FA 3S68A 2A6PA 1V8FA 1N9ZA 1FX0B 3HPSA 1G3RA 4UMEA 4RHEA 4YT2A 1V0KA 4OP1A 4UCQA 3BCHA 1IWAA 4CUCA 4X92A 5G53C 4LJ4A 4O6VA 1NDQA 4BKPA 3OFJA 4OOUA 1G5IA 3I28A 3M0LA 4HN4B 1CG6A 2BVNA 4W4QA 2XYPA 4CL0A 1QHGA 2QQFA 3HPXA 2IV2X 3S70A 2XVLA 1HQTA 3FN9A 4JL1A 4NJGA 2PY6A 4MNTA 1WSAA 2NZXA 3OOQA 3WD2A 1TQXA 4DIKA 4JQ2A 2H7VA 4LQLA 4JBRA 3HTWA 4Q4QA 3QP9A 5FOXA 2N1BA 1FYFA 4M37A 3E05A 1IIHA 3T1YB 2MR5A 1NBOA 2I33A 2UYYA 2A1IA 4C90A 3BB3A 4LVCA 1M76A 2YOGA 1IXYA 3PNLA 1ZONA 2B7BA 3TRFA 4IKEA 3V4PB 4EHLA 4C88A 4OXYA 4X60A 2X8JB 2QCDA 2H52A 4KQ9A 1ZN8A 4D4HA 4Q6WA 3Q37A 2CCGA 4EQ6A 3U16A 3VR6A 3AKYA 2OPJA 4GUAA 4EHNA 3MB9A 2WK1A 3AM5A 3NO5A 2HPAA 4IS2A 2A14A 1DELA 1OFTA 2JKEA 4RVHA 1MLDA 4Z99A 2Q2QA 1R0MA 4X3OA 4PYRA 4G6CA 1Z35A 5GPBA 1ZBQA 3G5TA 3BZGA 1P0CA 1SO3A 5A7GA 3CAQA 4DLFA 5FTMA 2VTKA 4Q8QA 1SXPA 3SQLA 1WW2A 3N76A 3GFXA 2R9VA 1R4NA 2VHUA 3E3LA 5EWMB 4EF4A 3GF4A 1RH9A 4Q8TA 2PAAA 1Q91A 3O7MA 2ZE0A 2NN3C 3HKCA 5JFOA 2KBEA 3I4FA 5EJ9A 4EJSC 1JLMA 3UAWA 1NN1A 3ZI0A 3E1GA 5IBXC 4FXJA 4HYQA 4GC4A 5A04A 2C78A 1UPUA 4D8XA 5FBQB 2HXTA 1MX3A 2P27A 3RQSA 3HR4A 4H59A 1XZIA 1W8SA 5F2LA 1MXFA 3ANXA 5EJ5A 1M1UA 1Y1SA 4U2YA 2ALJA 1RYDA 1HQYE 2J3KA 4J2OA 1G60A 3CT7A 1LTQA 3SCVA 5AQ1A 1UMDA 1R12A 3RCBA 2XECA 2SCUA 5SZIA 3I76A 3R44A 2H9IA 2O8EB 3IE2A 2QJMA 4BVBA 3NV7A 4NI8A 4N47A 4RVGA 2CJFA 3PF8A 1TVNA 4HG2A 4DR1B 3TVAA 4A8LA 2A79A 4II2A 4AIBA 4LS2A 2LD4A 4HCLA 3PE4A 1BMDA 5EPOA 3DXZA 4H7JA 5SZJA 4B8WA 2GZSA 2G97A 4E12A 1M2OA 4C4AA 2P8JA 4A27A 1MW0A 2BG5A 4DT1B 5FI3A 3URMA 3FDZB 1XLMA 2ZULA 1QORA 1HTIA 3TE9A 4KVFA 4FGWA 1OXXK 2FEXA 2C2HA 3ONWA 3LPNA 2XXJA 4QXAA 2V0CA 3E0LA 4O25A 4GLLA 2ZB2A 4YHHB 2I03A 3M4YA 4N54A 1GNPA 3ZDYB 5FH9A 1JZ6A 2P6MA 3KJGA 3PPXA 1GR0A 5LUAA 3CWQA 1C2YA 3VOBA 1HE8B 3PC2A 3V1NA 3OQNA 1JF8A 1NXSA 2ZRZA 2W9MA 4YRPA 1Q0PA 1QYVA 4U3JB 3QBTA 4JFUA 1A9XA 3RANA 5EYPB 4JBGA 1GGHA 5B7NA 3NVMB 2I2BA 2YZKA 4IIXA 2WHXA 2VZUA 5C8BB 1HJUA 4D9NA 3ZHQA 3USBA 4GX1A 1SKMA 3GHYA 9RUBA 2Y3IA 4MR7A 1F9EA 4MS1B 1R9YA 1KR1A 1SXJB 4PC1A 5J9FA 2FJUA 1EYZA 4CPDA 1CJKC 1U5CA 1T4BA 2XMDA 1AH4A 2QW8A 1XRMA 4IVRA 5IJ0B 3HM9A 1EB3A 1NQKA 4NKCA 1NWCA 2KJQA 5HYVA 1RQBA 5HQLA 3UANA 5K0LA 1QRUA 1BE6A 2V55B 2NUYA 4UIOA 4B45A 3I9V1 2PXXA 1PZXA 5HW0A 1VG0B 1QANA 4IO1A 3KZVA 1YJCA 4KCTA 4O0MA 3B4YA 2VTEA 4GW3A 1HP5A 5REQB 2DZVA 5HR6A 2FFHA 4HEHA 4ORIA 3HJFA 2GI4A 2Q9AA 1P1CA 1ITQA 5M03A 3V4SA 1R0LA 4R9XA 3V9AA 1VYPX 4MV3A 5GGYA 4TTJA 3UKOA 2FGBA 1U4SA 4GJJA 4P38A 3WTBA 3TUJC 3HY6A 3N87A 4QGFA 4OLBA 3HXPA 1IXNA 3X1ZA 3M5XA 3LRMA 4L02A 5FTJA 4MI9A 2PRZA 4MZDA 1X70A 3OVMA 3FLEA 2GVNA 1XL0A 5LWQA 1SUBA 2MNRA 2FFRA 4BC1A 3ASYA 4U00A 2YDRA 2BFNA 4N82A 4EG3A 1AKNA 2WVJA 2F3TA 3T40A 2AG1A 4R1SA 2VGFA 5LU8A 3TC7A 1OX4A 1DV7A 4HSOA 4A22A 4AKSA 2E6FA 2OCLA 1XCFA 5G0UA 4BY9E 2H0AA 5KAMA 1B5TA 2RKXA 3ILHA 4POOA 2JS7A 2VDMB 3QVMA 2JFVA 1EEXB 2Y5EA 3CLVA 4QTXA 5DLEA 4YQFA 2IODA 1QE0A 3F4VA 1L6RA 3C2OA 1UKTA 3EZ7A 2PRKA 3W6UA 1DWUA 4AI6A 3IPRA 5CH3A 2OFXA 4TMFA 1UOQA 1QB8A 1W0KA 1OB2A 1HJQA 1GL7A 1FBTA 4X1IB 4ONEA 4M1YA 5F3RA 3W2HA 4QWMA 1EX1A 4IJKA 1F2JA 3CVOA 6A3HA 1DXYA 3KB2A 5SY9A 2VEOA 5CFOA 1EFVB 3WAGA 3R4IA 4QE1A 2ACQA 2C5GA 3RLVA 4P98A 3EX6A 2PZAA 2WWGA 1IRXA 1T10A 2WYWA 1PEKE 2OFWA 3MC1A 2XINA 2D2VA 3K09A 1JPUA 5IWCA 4HLQB 3GN1A 5JARA 3IAS1 2QMOA 1XKTA 2UY3A 4X66B 1OK6A 2NNWB 2OILA 3C5HA 5A6TC 4YRBA 5A9TA 1OFUA 3NT2A 3CXRA 3VD4A 4RH3A 4UHEA 5IU6A 1ZH4A 2WAYA 2XB2A 1RLOA 2O2HA 1P7WA 2I2FA 5FQOA 3QV2A 2DBRA 2OZKA 1L8NA 1V7AA 4NMMA 1AA6A 1OFUX 2C15A 4Q7BA 4OHMA 3IEIA 1Y5WA 2FOXA 2QF8A 1U31A 3AUAA 1HOXA 3F47A 4BNZA 4CFYA 4JICA 2GTIA 3ENKA 4XIGS 4Z53A 1D6MA 2PRHA 3W2FA 3DCYA 2FMIA 3KOZA 2BW0A 4D4MA 2HQSA 5CK4A 4LCSA 4BO1A 1ZMOA 2HA7A 4OUDB 1SU8A 1Q95A 3N8HA 2FGJA 1CUEA 4B6JA 1EWDA 2CC0A 3L5MA 4NAEB 1UM9A 3E8SA 4G1FA 1OOEA 4N9WA 4RCVA 4E30A 4ZZ2A 1R74A 2BLLA 1BH2A 1H2WA 3RTEA 2BKLA 3PB2A 3QPYA 1PU2A 4KUGA 4PBGA 2GSHA 4R1OA 2PZJA 1RBAA 2GEJA 1NFGA 3UPWA 1W75A 1A9PA 4MARA 3EW9A 4FSDA 5FL3A 4BB0A 1BG4A 2RMKA 3WADA 4DQDA 1DWPA 1VE1A 4FT2A 3B4UA 4X1KB 4B33A 3ZU4A 3M0HA 2O2XA 3OETA 1V4YA 3I9NA 1W1ZA 2Y7GA 3RVDA 3S28A 1IHXA 3BAJA 2WF9A 2PDXA 1NYLA 1U5BA 3NQDA 1FU4A 3C6MA 4LC9A 4X1YA 5CX1B 2WUWE 1D8WA 4RD2A 4GBUA 2CHRA 1NDUA 1UWVA 1TTIA 3NA8A 4HH4A 5LN1A 4RKFA 1U2SA 4MPPA 1GPFA 2HCBA 2XNDD 4AY6A 2QPSA 2CEKA 3STEA 2G1UA 3QQ0A 2D5CA 3PR3A 3TW8A 1WDPA 1Z07A 1POWA 1H5VA 5JIBA 1N5KA 4AFNA 2JD2A 4N5HX 2A59A 3KXLA 4ZFCA 4MW7A 3QVKA 1SM9A 4GMKA 2B25A 5G40A 3CVUA 3QQPA 4BE4A 2C5HA 3IRUA 3C3MA 3CQKA 3DFQA 1C9WA 1X80A 1J0AA 5CB8A 4GKKB 2AOWA 2VZTA 1E1RD 2Y1FA 3UT5A 3QR0A 3RNDA 1SXJC 2JW5A 4XIMA 1FFCA 3SQOA 3W7EA 5BNFA 3PAJA 5H68A 1D3GA 4ADUA 5A0FA 4F1JA 4M9QA 4TVBA 4I4TF 4NJIA 3GFQA 2FFJA 2M1ZA 1C9YA 4OQDA 3EXG1 1YB1A 4O1FA 2Q09A 3DZFA 3LBYA 5HJEA 1B4KA 3BK7A 4BI5A 1XYVA 2RHOA 3KOOA 3W9SA 2ZI5A 1IN5A 1VXOA 4G2TA 1WRBA 4KGVA 4RMJA 3Q8MA 3VMMA 4JFTA 5ABFA 1ECLA 2F4NA 2Z8YM 4G81A 5KTNA 4K1XA 4D26A 1RQ2A 2A3HA 3K4HA 3DERA 1ZGAA 1GGJA 1S3SA 1JG7A 1PXGA 1M7XA 1KDPA 2CFOA 3H4VA 2R4UA 3LFUA 3H8SA 3WO8A 3BLIA 4L07A 2IPFA 3NFRA 1T2EA 3PXXA 3AF4A 3EIUA 3G6KA 3FYYA 1PJRA 3KWFA 2PGEA 3UG6A 1BVUA 3IO3A 1Y6QA 2NPIA 3ZCTA 3OM9A 3QLVC 3P5YA 3A3KA 3DWIA 4E22A 2PE4A 1A0DA 1Z2OX 5HAOA 2H5LA 1OW3B 2LE0A 2B99A 4O4WA 2NZ2A 3HM2A 1OU4A 2P7HA 4PMYA 2GBPA 3HBLA 3WF2A 2H4HA 1JPJA 5AOBA 3VGGA 1UBOS 1MO2A 1PV4A 5LNVA 2C94A 4HAXA 2NXIA 1AVTA 4DB2A 4MMWA 4DCNA 2O20A 4L6CA 4NG5A 5ALLA 2CFFA 3BZUA 1ADYA 3M83A 2W6ID 5F1KA 2P1RA 4L3OA 3NX4A 1AJZA 1RXUA 4I1YA 2FZKA 1BWKA 4YAKA 5FUYA 1S5PA 3H8WA 4OHVA 4Q4HB 1XRRA 2ZSDA 2HLPA 2L2QA 3FJOA 3FY4A 1PW5A 3ECSA 3P74A 3ME3A 4O4LF 2JQXA 3DFYA 3QLEA 4GMHA 1VPXA 1BF6A 4IHQA 1T2CA 3G1UA 2E77A 1Q3TA 3LT0A 3AT1A 1X6NA 4V24A 5FPYA 4NU8X 3T3DA 3FNBA 2FUG1 2VHQA 4WGHA 3ZLBA 4L51A 3GTNA 1SCDA 3UJ7A 4ZR8A 4EBFA 1GPDG 4AB4A 4ZICA 4RQBA 3UVIA 3BWEA 5C9ZA 4XQ9A 1ST3A 3RCMA 4MLDA 1Z0AA 2EP5A 3IBTA 1KMHA 3R9KA 4M22A 2OGSA 1JIBA 3OG3A 3LCHA 3KVNA 4DNOA 3W53A 3HB5X 4RDZA 5FHRA 3MTEA 4BV8A 1F1BA 5TEWA 1J8YF 2C7FA 4LC8A 3MA8A 5KREA 1R87A 1IY9A 1I0LA 1EBUA 3OCVA 3FPAA 3U6WA 3IIEA 4OHOA 2PX0A 1RYYA 2GD1O 5HGXA 5AD1A 2HMTA 3M3HA 1YTEA 4WKBA 4NG4A 3NQ7A 3P93A 3GA7A 1PX2A 3C1TA 3HLYA 5FP0A 2BGSA 4YTQA 1PLKA 4D92A 4H35A 4AZ0B 4MDPA 3O2JA 3L4UA 1K6MA 5I03A 3ZW8A 1U1DA 1BS1A 5K6TA 1XC7A 4B15A 2AEFA 2V3CC 1N3BA 3L1IA 2NLOA 4W8GA 2CJWB 1EIBA 1US2A 5L7WA 4DARA 1G3MA 2GLKA 5HFJA 3QMMA 4BX8A 4LHXA 3WRWA 5KNDD 2WO5A 3LUTA 1X87A 1RA5A 1H0SA 1MNQA 3FI9A 1CXKA 4YCCA 1P1KA 2P11A 1R3VA 9XIMA 3ZC3A 5MKGA 2J79A 3CGGA 3RI3A 5LM3A 4FYYA 3T7RA 3VGDA 2YNMC 3IIMA 2Q3LA 2ZR7A 1E20A 4IM7A 1L5NA 3LFTA 3LZDA 5IAJA 4UUAA 5E4TA 4N3GA 1GTG1 1W54A 4PMVA 3UHFA 3WNVA 1ST2A 3B1KA 1BH6A 3H3XA 4QOIA 1SU5A 1XUOA 4NRRA 4KB5A 2REQA 1R5NA 4CQAA 4IHJB 1CZLA 4RHUA 1MA0A 5G5IA 4MQBA 4IPTA 4IH3A 2QROA 4I9HA 3UK2A 1FFHA 4MJ4A 3GZNA 3U7BA 4HMOA 3QVOA 1M7BA 2X8AA 1NMZA 2ZIXB 2E4XA 1OZHA 4LTMA 1OVMA 4JY7A 1TPWA 3A6ZA 3GLGB 4OBRA 1A5BB 4JX4A 3KVVA 4WR3A 1D07A 5T8KC 3EX1A 4YVPA 4XQ0A 4KQJA 3VUFA 4EPKA 4WA7A 3RFUA 1U6IA 5KQRA 2QR5A 3I42A 3U17A 1KSGA 1Y98A 5KX5B 1VHQA 3HJNA 2JPDA 5DYGA 1E5VA 4RLIA 3H13A 1E0XA 2ZUUA 4A2SA 3I64A 1DEXA 3SHTA 5CSYA 2G77B 1S2OA 3LCJA 1O5QA 2VSOA 4AH7A 4YAWA 3CH0A 3SDBA 4I90A 4M6UA 2WT8A 2XODA 2YBVA 4RV8A 1FEZA 2WHRA 3QE3A 2PUCA 1DQXA 2JEPA 3L7KA 3N0XA 4U2BA 1VLMA 3V6LA 2RG1A 4GLEA 3NQCA 3GM8A 3S2MA 4AVYA 4WGGA 4CT0A 1B74A 3AI2A 2BIFA 5B1DA 2G83A 1IR1A 2JB9A 1J07A 3LDUA 1GYPA 3ZV6A 4MR9B 5G0SA 4RF4A 1SOMA 4HTFB 1MDFA 3UB3A 3EMZA 2Q3HA 2BGRA 5CYPA 1JHUA 5A6SB 1MVYA 4JKOA 4M1QA 4IEEA 1FQJA 3DLPX 4NILA 1JZ3A 3X1JA 4Z0PA 3M4XA 1I2DA 2PD9A 3EX3A 2R6HA 3UMYA 3Q85A 3AV0B 1W48A 1MVOA 3GX9A 2O06A 4KX5A 4CM3A 5CFQA 1SY7A 5KU7A 3MSXA 4WKNA 4R4JA 4J29A 1S1PA 2VNCA 5FAKA 2I67A 2QY9A 3RILA 2HDHA 1EI9A 1V5FA 4NDZA 3EQZA 1TM2A 4A29A 2QUVA 4CKYA 4JUDX 5C51B 3LI1A 1LCIA 3MKKA 1IBSA 2CBVA 2XW6A 3AZPA 2NOAA 5JALA 3BB4A 3R6DA 3T3PB 4QCEA 3PKJA 2OCPA 2YW2A 3UWUA 1TT5B 5IDQA 3JQRA 1KM5A 2DUJA 2ADMA 1NSJA 4P22A 1I0DA 1YACA 4DCOA 3SJ3A 2Z2UA 2DHCA 5DIZA 2DLNA 2FW1A 3CT2A 5ISMA 1ZOIA 1GEQA 4GFIA 1IZCA 4C1NB 1J9YA 4Z42C 3G3DA 4JQOA 3OFND 1Z3IX 1X1TA 2XWEA 4C6DA 3ZGLA 2HOQA 2D2HA 1K5PA 1VPVA 5CFMA 4HS4A 2ACEA 3G5EA 3VR6H 2IXUA 1I32A 5L9AA 1C3OB 5DT2A 3I2YX 3MWYW 5JC8A 2VOJA 1WZLA 1VPQA 3WJWA 5JSKA 2CNNA 4CTNA 4H3VA 2HISA 3PTQA 1CULC 5TMPA 2C42A 3TA9A 1QO2A 1W2GA 2QY6A 2VZVA 3RS5A 3SMVA 5F77A 4OLFA 3P1JA 2ZKLA 4OHPA 2OUIA 1ZTVA 1QDEA 3VAYA 3TIXB 1J0IA 1E79A 2PDAA 4IX2A 3SZ3A 2RGAA 2AMGA 4CV2A 1G0NA 4OU1A 3BIXA 1L4EA 4G9EA 5ES3A 5CU7A 4D4IA 4UTZA 4AWSA 3QX8A 4RKWA 1FWCC 3VDRA 2WUDA 3OODA 1CWYA 1N33B 3HG3A 4IJBA 3CUVA 1UBMS 4V0RA 1X1QA 1XMSA 1SZGA 3WL5A 3V8EA 5M3BA 3M70A 4I4LA 2PKWA 2ZAIA 2G76A 4KJZA 8ABPA 1GJRA 1S89A 1VI6A 4H9GA 4U3CA 1WDKA 3DCNA 2PWUA 1RR6A 2BR3A 3V4ZA 5E95A 3PWAA 1F3XA 3D3WB 1AQ0A 3WGGA 1EUZA 2FZLA 1A2OA 1XPRA 3V97A 2EX4A 4Q8MA 5ELMA 1VQ1A 4YJGB 3D4PA 2X0JA 1OPRA 2XCRB 1G2IA 3H05A 3EIOA 3CIVA 4UOEA 4KXNA 1UP3A 4AUMA 4CMKA 2BY0A 2VP8A 1T8RA 3BTOA 2EZUA 3P9RA 5AB3A 1E1RA 3HZZA 4UQBA 3PNUA 2VELA 3MJYA 4B0OA 1RXCA 1FWDC 2QLBA 1EFPB 4OHWA 2J8FA 4GUFA 1ZJIA 1TZCA 3OLXA 2EBUA 4R05A 1OILA 3GRIA 2MSCB 2VDVE 5H9VA 1HX7A 1TD9A 2FEAA 2VYOA 5DYYA 1EINA 1KBKA 2HS8A 4JGGA 3ZNPA 5JCZA 4HWKA 3TEFA 4L8WB 4YNBA 1N7GA 1M1YA 4NENB 3UY4A 1CGUA 2RH5A 1OGIA 3PB3A 4QIUA 1IDOA 4FBMA 1GRVA 4KRZA 1C4WA 4YJ3B 3PYLA 1GVRA 2DJLA 3CF2A 5C1PA 4AUBA 1ZUIA 1R6XA 3U3HA 3GLFE 3O63A 1XYMA 3NJ4A 1OJXA 1Z4PX 3VGPA 4FFBA 5EGSA 2PDWA 1JCMP 2ZWZA 1VG1A 4QEDA 2XE8A 3DZKA 4I9MA 4CQJA 4WZAE 4EY4A 4FALA 1DIEA 2Z1MA 3WE7A 1F7VA 3WB2A 1UPFA 2DG2A 3UFBA 1DC7A 2QW0X 3H4TA 3ZUGA 3B8UA 3GDHA 3AIKA 1JDAA 1JZ7A 1B90A 2EGUA 4CIWA 3AOFA 1SC6A 1P3JA 1IXQA 3IAQA 4L4OA 4IGAA 1E1FA 3DTVB 2DZUA 4WXRA 4IRXA 1U2YA 2QPAA 1Y0BA 3UCFA 1SSGA 2IU3A 4OSPA 4MUYA 1KSFX 4H4EA 2LIVA 1E9AA 3BWBA 4LYYA 3G2IA 4HNOA 1AVAA 2HJHA 1XDLA 1E1LA 1GONA 2H4FA 4JSRA 1JG2A 4YRDA 5KVQA 1XMQB 1JVNA 2O1WA 3FTCA 3L43A 1XAJA 3N6XA 3TR2A 3F2IA 3F1LA 3B8VA 3DAOA 4Q19A 4BKOA 2AZTA 3BJZA 4IVPA 2NSDA 2W6IA 4H0CA 3EWYA 1VJRA 4UFJA 1D9EA 1IEQA 5EZ5A 3O91A 2QB5A 3L8FA 4TX1A 5J4KA 3ZVMA 3UUEA 1EE1A 2B2NA 4QREA 1ADFA 3HJHA 5FB3A 3WEZA 4J7XA 1IR2A 2IYLD 1W9VA 4RKAA 3HHEA 1FHUA 5C1OA 3OLEA 3RUHA 2IITA 4CNUA 3RFAA 4UEOA 3WGLA 4CIDA 1G8JA 1EIXA 1DFHA 4L5ZA 1Z5GA 5KINA 1DWQA 1JSRA 2GAAA 3MA0A 1DIDA 4FVTA 4MUBA 3LMKA 2J6CA 3UK6A 3KSUA 4N4AA 3VX1A 1GPLA 1ULUA 2B6NA 1W8IA 4O11A 2O7QA 4KXWA 5F2GA 4ZIRA 1Y80A 4U1RA 4DQKA 4BQ4A 2YN2A 1DEAA 4KFPA 3WUEA 2ZS7A 1XA4A 5FORA 1J12A 5LMUB 2PFGA 4NV1A 3IHWA 4EEKA 2L19A 2YC4C 3VOHA 1XHLA 3CLUC 5I7HA 4ADSA 2LKDA 2GAFA 1X15A 1CZOA 2BOEX 2D2IA 2QZPA 1MDLA 2OEPA 1IUNA 5H5JA 2A58A 5CDYA 4MQFB 4CU7A 3D5EA 2IXFA 5B57C 5GONB 1QQTA 2DBQA 2ALRA 1N6OA 1QUEA 4LA4A 3DWGA 2X0YA 1E0SA 1KEPA 2FZWA 2ZVQX 5JBFA 4CIYA 4YYCA 4MW4A 4UDNA 2WDPA 4QHYA 3NALA 1BD3A 4JIQA 4ILKA 1JDVA 2OBFA 4LBVA 2TYSA 1R3DA 2F62A 4X93A 3ELFA 3VOAA 1KK2A 1PJLA 2H59A 1GCUA 1Q74A 1XCXA 3E84A 2GXUA 4KFTA 4GYFA 3VYWA 3UGQA 1TQJA 4AY2A 3WSWA 4S04A 3T44A 3IXMA 2J7PD 3PQ4A 4IWNA 4PZEA 4J3UA 5M2QA 2O1EA 3WXBA 2C71A 1ODLA 4ENRA 4IQ0A 4Q1CA 4QVIA 2XIBA 5EZYA 5KNDA 1ZAJA 1GTMA 3LHVA 3TN7A 4WECA 4LV4A 3DOHA 5JDCC 2AMFA 1RK5A 4Y0AA 4RV3A 4BDSA 3K2BA 5I7OA 5JFGA 3OZFA 1FLVA 1QQ5A 1KY5A 4BNWA 4C0QC 2YV1A 3RS0A 4FINA 3S7ZA 4OLAA 2QDKA 5EY5B 1SQGA 4N0MA 4AG5A 2WA1A 4I14A 2AGKA 2V81A 1IWBB 1MC5A 4BGIA 3R6IA 2DZBA 4F48A 4XWYA 3B8EA 2Q4OA 1NIJA 3FA2A 1O1ZA 3IH5A 1P7YA 1FFRA 2LKCA 3DOOA 1L4LA 1LX6A 1T4GA 3WB9A 4MWAB 2ZQYA 4URZR 4RMGA 4LQCA 1UMBB 3ANTA 4NZ3A 2PYZA 3GTXA 5TT1A 3JALA 5BPHA 1I2AA 3GBSA 4RGQA 4Q9KA 3U8GA 3IJ6A 3OECA 2PL5A 5CM2Z 2AG8A 3O4GA 4D6GA 3SCZA 2FQQA 1ZNZA 2O4QA 1RBYA 5F4XA 1MABB 1TVKB 2PDHA 2Q0HA 4BTEA 3L4KA 3GY0A 1BNCA 5HCUA 4P81A 3BB1A 1VHJA 3HOJA 2FWAA 3LPOA 3K0HA 3G2QA 1H63A 1P31A 2JJ8A 3WLKX 4H9UA 3THYA 3AZQA 3LQYA 4QFCA 1TEXA 1V6TA 3D2LA 1QPRA 1CE8B 3F8TA 4N7BA 3VD9A 5TC4A 1Z7AA 1BXGB 4XEHA 1PNOA 3ARVA 2HX1A 3QUAA 2BGKA 2YIHA 2G41A 5C7HA 1Z18A 3VOFA 1CY2A 3IJDA 1KWKA 3L0YA 4YA6A 4GA8A 2IBSA 1A53A 1C41A 3G2OA 4UTJA 4OFZA 2VO5A 3I6QA 4N39A 3FOKA 3FNIA 1CHNA 4W7HA 3U4QA 2HBYA 1U9ZA 2P3QA 3I5AA 1YHYA 3N2GA 5L40A 5CZJA 4HZUA 4Q1AA 13PKA 2VJLA 3WMBA 5JE8A 4TUFA 4MOZA 1GTSA 1WE5A 1Z8HA 4BBPA 3D3EA 4S3DA 3DVAB 5FWYB 1ZDMA 1ZN9A 4BZYA 4FOPA 5ADWA 3X1KA 3W04A 2WQZA 2FZGA 1F0PA 4QDPA 1LLZA 3RT1A 5BYJA 4PNEA 3KEMA 4QDXA 1Y8BA 4WEOA 2XT0A 3H6GA 5L6UA 4CKCB 2JATA 3IO5A 5ALSA 2Q6KA 2IYFA 1MHTA 3VR6D 2QW5A 2A3AA 4JHZA 4O13A 5B3JA 3P5ZA 1IJBA 2PVCA 3T7TA 1JJBA 4KEUA 3HP1A 1C1HA 1A2QA 1CR0A 1QLHA 5GADl 4BA0A 1RM0A 4G0MA 3PQFA 1Q6RA 3TLKA 3HCFA 4POCA 3LMYA 1Z5VA 3DKIA 1AY0A 4YB8A 2R8RA 3LHWA 2H8GA 2UYHA 3W2GA 3V9PA 1TAQA 2IQIA 5CR9A 4BFZA 3ICEA 3KIPA 1JDZA 2J59A 4TTAA 5IASA 3ALFA 3RX2A 1N0VC 1DJLA 5DP1A 2A88A 2PKYX 2KLBA 1VJSA 3WYCA 1Q7MA 2VJCA 2B1IA 3OFNA 3VH3A 3PFIA 4KT2A 1TM3E 3LW8A 2I2XB 4JX9A 1VMAA 3T95A 1NASA 4TROA 4AY7A 4OUIA 1K86A 3S1AA 3L6CA 4J3NA 1WA5A 5JBIA 3DD5A 1EJ7L 3QYSA 3JQ7A 1MO5A 2QD2A 1XIMA 1TZ7A 2VRNA 1I4EB 1U8UA 4EZIA 3RJYA 1XZ8A 3NXSA 5G02A 3PHHA 5DOVA 4GNVA 1T36B 2HQAA 2QAFA 3KBVA 4EB8A 2WIDA 5EYWA 2YBTA 4ES6A 3C6QA 3K1AA 2BEVA 1VYUA 5B7ZA 2XZTA 2QRHA 1NNUA 3T42A 1Q8AA 2O2CA 4GMXA 2PUWA 2J62A 1E9ZB 4MZ8A 2JE8A 5FF7A 4XTRA 4JTRA 2G4CA 2EFGA 5HKOA 3LVBA 2HK0A 1TT7A 1RWKA 3EH2A 3PSHA 3F9IA 2R8PA 2Y93A 2ARKA 1UB3A 2I65A 3UR7A 5CDHA 1JEYA 2BB0A 4H60A 3KR0A 5BVGB 5IF9A 3T06B 2QDGA 3TJXA 2M6LA 4JLMA 1DTSA 4BEUA 2LRHA 3CHCA 4B5SA 2P6PA 1GUAA 1ALDA 4TL7A 3WUFA 2NAFA 3KZPA 2V5AA 1X77A 2PD5A 1P18A 4MAFA 3C52A 3OI7A 4NCHA 3RB8A 3DMNA 3DYBA 1V0JA 3U4DA 2HWYA 2YL8A 4UFNA 4V39A 3W86A 1Q65A 4ROQA 3F2CA 2XYGA 3OSZA 1GN9A 3BGJA 2B81A 3VILA 1Z06A 4JQCA 1O0BA 4FGSA 3WIBA 3PQ5A 3CZRA 3BH0A 4V0SA 1FFAA 1ECQA 4TRRA 5G4EA 3GG1A 1NUUA 3WV4A 4PZ0A 5JAMA 2O0KA 2CE2X 1AG9A 3AR2A 3ZQ4A 3MMWA 4N9CA 1EVJA 4AHPA 3BS4A 3QTGA 1EK5A 3DHNA 4CF4A 2XDYA 2WTAA 2NYRA 4QDJA 4C6JA 4W63A 3C70A 3NRJA 3MI2A 4IF4A 4LMAA 4LXIA 4MWAC 4FOOA 4MWCA 4DV3B 1X7WA 5EJ8A 1V3LA 3UMCA 1RXYA 4O08A 3B9BA 1M2HA 3B85A 3ANVA 4Y6GB 5G0TA 2FGZA 3KVYA 2GXSA 3MCTA 5J4LA 1QNOA 2VTBA 2HSWA 3TWOA 3EISA 1QGUB 1X1CA 5AW8A 3VR0A 2G9ZA 4BWFB 4WLNA 1MW3A 4BU1A 5CGTA 4OVXA 4MA4A 4YRQA 1QHSA 4BXOB 4WD3A 3ZPXA 3HO6A 2NVWA 4CGZA 1ML3A 3O90A 4HU4A 5EIHA 3HDHA 3OLGA 5GJMA 4OQMA 2Q0XA 3SQDA 2WVVB 3ACCA 3AETA 3HO8A 2WFLB 3VPCA 1SZDA 3OB8A 1YRYE 2A57A 3HUEA 3DNFA 2DCUA 2GZMA 1YK0A 2WKLA 1WJGA 4RKEA 1HL9A 2CHVA 1HNZB 2YIVX 3COTA 1U3VA 1OCJA 2ATXA 5B2ZA 3OGVA 4BX3A 4XIIA 4UR8A 3GIYA 2D3NA 3CPHA 1ISFA 3C0QA 3SG0A 5LQRA 4RPQA 2JEQA 4UQAA 2YHBA 1AHIA 3LM3A 3TINA 2FDMA 1J23A 5E6YA 4LXYA 3BAFA 5ITWA 2OK7A 1ZC4A 5A5GA 4OXQA 2GBLA 4XQCA 2HBVA 1XDSA 3H2JA 3KWLA 1E4NA 4LAMA 4EK9A 4AZ3A 2G6TA 2ZZKA 5KTOA 1YC2A 3ZWOA 3T3IA 1AS2A 1CEQA 3EOUA 3EQ6A 4TTVA 3R0KA 4G2DA 1WOYA 1OFEA 4MUNA 1SJDA 2O8DB 4RVOA 2CE7A 2HWWA 4Y9RA 2Z2KA 1ODZA 1JHZA 2TODA 5CC3A 2ONCA 3D6TB 2ZKIA 2PT7A 5IUKC 1AK5A 2VYND 4FDUA 3ZW7A 1H7NA 4IHCA 3F46A 5AOAA 1JNDA 3FYDA 3GLIB 2Z43A 3MGGA 1IGWA 3L0DA 4LKOA 3FWYA 5LP6B 2J5XA 3DEKA 2ZAGA 4IIJA 4GZIA 1JQXA 4U4AA 1DFGA 1F17A 3NKFA 4UTXA 1WKCA 2M2IA 1UOZA 1FX1A 2H18A 1LW7A 3BMOB 5GAJA 1AN9A 2X0IA 2RDUA 1VQTA 1IJEA 4YO7A 5EIXA 3L8MA 5FBLB 4F4UA 2ES4A 5AHIA 1KC7A 1LCOA 4M1RA 3OOEA 2ZI9A 5BXTA 1T4MA 4RK1A 1UADA 2FTYA 1N2CB 3QFHA 3RUBL 4GYWA 5EJGA 2EFEB 1V3TA 1NW7A 3WYEA 4C0HA 3IL2A 1OTHA 2PZLA 3G2KA 4CQLA 5I3DA 2XLBA 5TXGA 4X20B 3UJAA 2CLEB 5HQMA 4WXPA 3QV7A 3K72B 5AKGA 3SF8A 4S1FA 2PS3A 4RVDA 3QGVA 3PZGA 2ZIGA 1OZGA 3AILA 3MT9A 4FIZA 1R38A 4DV2B 3W7NA 4CXMA 3OPMA 3KTAB 4KC0A 5I9SA 1R6BX 5IJAA 5EWJB 1FYVA 3LX4A 3P4UA 2V7TA 3A6LA 1MAHA 4WESA 5CRIA 3NO3A 1ITUA 2WNHA 4QOSA 3GW8A 2COEA 3U61B 2XXAA 2H4ZA 3DEJA 3NEHA 3BJRA 4A15A 4Z9FA 4FXFA 4P32A 1K6XA 3NHJA 4JIEA 1EDTA 2E28A 4IQGA 2CYBA 1QPZA 2ZSUA 3KQLA 2GZHA 4JLAA 2AG5A 3VKAA 4ETMA 3UBTA 1EWQA 2VDJA 2NWRA 4O0LA 1LPAB 3PKZA 5K9CA 4NE9A 3H8JA 1L5FA 4WKAA 5HPYB 2EEZA 4TLAA 3ZVLA 1U7OA 1ZRSA 3VNKA 4H2HA 2ZBGA 4MRAA 3OOJA 1JT2A 4DF0A 3MTIA 2JBHA 3RVBA 4W5ZA 2OORC 3GXBA 1KBOA 2OQIA 4W8AA 5CG7A 1V6AA 5EFDA 3E7WA 1P1XA 4II3A 4DWSC 3VYRB 3WD3A 4XRRA 5KO2A 4ECEA 4XVDA 2QZ4A 2VAXA 2IS6A 1KVQA 5JQGA 4UAUA 1U3GA 3Q5GA 1G21B 2FWJA 2QM8A 4ZAFA 4LF8B 4NU7A 4PCAA 4J2PA 3DE6X 1AK2A 2PUZA 3ARWA 1H9AA 1EXBA 2YXOA 1F6BA 2PLKA 2FWPA 3UAYA 2GCPA 3JD2A 2PP3A 4JL6A 2WCSA 5KCMA 4AEFA 3R5HA 2QJTA 3O0TA 3NHMA 4B31A 1RALA 1ZCOA 2RC5A 1FP6A 2YBDA 5F2NA 1M1YE 3WBYA 3QHQA 2GZ2A 4NT0A 1CUGA 4YLGA 2VP6A 1JR1A 2VQSA 1PR4A 2ZBQA 3BUSA 5IFTA 4B3RB 4HMCA 1NW3A 5LMZA 1DEKA 2ZX8A 5ALPA 4CTMA 2VQUA 3SGZA 1U3FA 1ZXBA 5JO9A 3LL7A 4P4SB 1Z7EA 4CMIA 2VQ3A 4RW3A 4YAIA 1FFQA 1VCGA 3IX7A 1A5OC 2QCMA 1JDTA 4QAJA 4BECA 4DRZA 1ZSNA 1FQWA 3MMUA 1P7TA 3R0JA 5TMBA 1EQ2A 1WHTB 4ABYA 4BFYA 3DAFA 3OJEA 4MWZA 3VD7A 1Z0KA 2WHYA 5AC6A 3DE0X 3FIJA 4IO0A 4KNYA 2ORWA 5FBVB 2D5BA 3S5NA 4DIUA 5C9XA 2GXAA 5JW6A 2NO1A 2HM7A 1UCFA 2X0NA 3KQVA 2WFZA 1VP5A 1V7PC 3VPLA 3QJ5A 4TVCA 2HU2A 1H3FA 3WNQA 3B2EA 5CX4A 1GWNA 3SFTA 4YJFA 3QF4B 1S3GA 6NULA 5FPKA 1I0ZA 3LE8A 3M5VA 4INFA 2QQGA 3KXIA 3TH6A 3AIBA 2IH5A 3G8RA 2Y7DA 5C5EA 5K4HA 1RZMA 3OG9A 3WWPA 1NI3A 3IEKA 4F84A 3OUZA 4XARA 1FP9A 4FQ7A 4B92A 1GTVA 1KS2A 4DM4A 4LISA 5JANA 2C1GA 5HWJA 3P2OA 3KLLA 3N2XA 1EBFA 3FGZA 4L1WA 1LRKA 3K0EA 4FYMA 4YGYA 5GZ1A 4M9ZA 3ITTA 1W37A 1WP6A 1SHJA 1XZNA 3C3PA 3GFSA 3I92A 2AYZA 4RWEA 3FNHA 1XKYA 4H1VA 1ZJYA 3D7LA 1T40A 2GF9A 4NS1A 3LNTA 1V0NA 4ZDKA 4P84A 1U1UA 1NSYA 4JTEA 1P60A 2A5GA 1FFEA 5BMVA 1BW9B 4LNCA 2WWFA 1GRRA 3HXOA 1OI3A 1SVKA 1V3HA 1GKIA 4EKIA 5FF4A 2EPLX 4QLAA 3PEUA 3N5CA 1X8KA 5JWRA 1TA3A 1BIFA 5I6SA 4A8JA 3R8GA 4L6AA 2XAUA 4QEEA 1ESWA 3KBSA 1KJQA 1N6HA 3EWZA 1GYMA 5IC5A 4LNHA 3FLMA 3CNHA 1YKWA 1H09A 2CFIA 5BOEA 4EPDC 1VBNA 3SC6A 5LP6C 1SXGA 2FVYA 4BP9A 1BXRB 5LC1A 2CFSA 1WMAA 1K9EA 1LUAA 1HKVA 3M8KA 4AYWA 4CQNA 1HZZC 2WSMA 2PLJA 3RU6A 4L4XA 1TCMA 3AF5A 1ZA2A 1Z6YA 4YROA 4HNCA 3UR8A 4O2AA 4Q8VA 1II9A 2FRXA 4DYKA 1Y5LA 4ZT3A 4FF7A 3AFGA 2Q9UA 4TVSA 3DMTC 3JPYA 2ZRMA 3DQQA 2ZYWX 1TO3A 2ZRJA 3GLQA 3K0FB 2IEGA 2DBYA 4QAWA 2X8WA 4LAFA 3VNSA 4KTTE 2VX7A 4M99A 2VMFA 2W63A 3WNMA 3UG5A 3AR6A 4K9QA 3AS1A 4QASA 1R8LA 5E1QA 4LYRA 2UUCB 5KDLA 3G13A 3ED5A 1VFTA 1CGVA 3CAKA 2GBFA 3V36A 2PQ0A 1Y4ZA 4PYLA 4BB6A 3H7AA 3GAFA 3B6EA 3BTNA 1W1A1 2QRGA 3L07A 2Q8NA 1B2RA 3I58A 3E5BA 4QXQA 4RHXA 4V0NA 4G07A 3MJMA 2B5VA 1P1RA 4LHYA 4Q7KA 1G0OA 1DLJA 2FN8A 1NQXA 3JQAD 1IVYA 1LB1B 1LPPA 4Q6JA 4MGIR 4BBZA 4DX3A 3RR1A 4CLEA 5IVKA 4ZGWA 3PDIB 3B6JA 4JENA 1TUBA 4EELA 2OWWA 4S1VA 4EG5A 2GQ0A 3GR6A 3OHIA 3CINA 3N73A 4BNDB 221PA 4JT4A 4ZXOA 5F98A 4GC5A 4Q3OA 3MCWA 5EZYF 3Q3GE 4I9AA 5F51A 4OU5A 4NF2A 3KETA 3B8DA 1PWMA 1IT7A 1ZX1A 2Y1CA 1S2MA 5LJLA 2HJPA 1SR9A 3ELYA 3GXPA 3OQIB 3L0KA 3D8RA 4JTSA 2IHYA 2QE7A 5CH5A 4DLXA 2FMHA 4V0QA 1AXGA 2IUYA 3DOIA 2P2GA 4HUQB 2YCJA 1P62B 3R3JA 2BR5A 4RE6A 2DB3A 1OADA 3L4XA 3CW2A 1W35A 3QM1A 1A4LA 3D3JA 4GVXA 5T7BA 4FZRA 1J0DA 3TSDA 3Q3CA 3GFBA 4WN9A 5EHIA 3KE0A 2I9EA 1DEOA 3OVPA 4HEA6 4Z8YA 3M43A 2R1VB 5KNDH 4FHCA 5LHEA 4OYYA 4WDWA 3UPBA 1J8DA 4R5EA 3ESQA 3LHFA 4JYAB 2A21A 3FB1A 5LSAA 1KR2A 3AALA 2WM2A 5KITA 1MEJA 2Z2ZA 2C92A 1RRFA 4AP6A 3K8ZA 3LCVB 4FMBB 4O19A 5K4AA 3CBQA 1P5JA 3T0FA 1Y5VA 2UBPC 1XGKA 3M6WA 5G4KB 3CV7A 5BRQA 1YU6A 1XLCA 7XIMA 2EG9A 4HXGA 4M56A 1DXQA 2G28A 2XF2A 4ZA2A 2AX4A 3GLFA 2QK4A 2I1OA 1RM4A 1Y1RA 4GGPA 4EPTA 3T41A 2BSAA 4MUFA 3S27A 1VRVA 1VFOA 1FS6A 2VBCA 4NR0A 3T99A 2C4KA 1TMQA 4WZAA 1R5BA 4UU1A 2BTOA 3AP2A 1Q2XA 1KLYA 2P62A 4I7VA 1R3TA 2VUYA 4MIOA 3UR2A 1FVFA 2ANBA 1ZAIA 3MDUA 1M72A 1GORA 4LX0A 2GDUA 3CNEA 4AS3A 2XZDA 4R9UC 3BANA 2G71A 2PX6A 2QP4A 1R8XA 2XGJA 4BVAA 2A7NA 2V6BA 4MZ1A 3IMGA 3B9EA 3A37A 4MH0R 5TVKA 2XWSA 4Q9DA 3PG9A 5A05A 4GWEA 3CW8X 3HKEA 3RLIA 3N14A 4UFHA 3SUSA 2Y6ZA 4D4JA 2GK1A 3ZWTA 3K2IA 3CWOX 3ISVA 4D96A 3M0VA 2WIKA 4F06A 1HQDA 2CMKA 1FFBA 3QEMA 4P61A 5A5DA 3SE0A 2RAFA 1C1YA 2PL9A 2QVLA 5DHQA 4AQDA 4ETWA 5DI9A 3A6FA 1VA4A 2IQ5A 2VYNA 2CW6A 3HKDA 3LNPA 3REQB 1HL8A 2DQSA 4JYZA 1V08A 1BX3A 1QB7A 4QHSA 3HACA 1SCJA 3IPWA 2P2ZA 1XIEA 5H1WA 4X6YA 5KTTA 4JT2A 4U7WA 3GXDA 2GYIA 5LXTA 2A0FA 4RTLA 4TZ6A 2YDYA 5C8ZA 4N5IX 4KMSA 5JSQA 4DJFD 4ZV7A 1O5OA 2X0DA 3OM1A 4YLEA 1NVEA 3HABA 4LZNA 4BO8A 3BTUA 3MSRA 1CY1A 3NTYA 4B85A 3VX4A 1E7RA 3R8RA 1VF8A 1CHDA 5H3CA 4ERIA 3S6JA 4YV1A 3SKYA 1JRBA 3GUYA 1A8HA 4CV0A 2GD6A 2I2CA 1NY5A 2FDSA 4M82A 3LUBA 1M10A 2IHBA 2R24A 1WB6A 1ZK3A 1DTUA 1VSTA 5C52B 5D9PA 4IL2A 2VF2A 4JC4A 4BWVA 1KTIA 5GVJA 2C04A 3KS9A 3LWBA 4IH4A 1XHEA 1XTBA 2CHFA 1UEIA 3LDGA 3VZZA 4Z0TA 4TV5A 5CBPB 3P52A 2FUEA 1JE1A 3OU8A 3DBIA 3ON5A 2BFEA 3NGJA 3G2HA 2HPHA 2BJHA 4E8DA 3OU6A 2PX4A 2F1RA 4EABA 5AICA 3O9ZA 1JAYA 5FULA 1E79D 4W5JA 3W73A 5DCYA 1MSSA 1YTDA 2XMPA 4WZBB 2PSJA 3RIMA 4UVDA 4PIVA 1NDYA 4YT5A 1RS0A 4QGAA 3NTOA 2MYNA 2I4MA 4N9EA 4TYQA 2GX6A 1ESMA 1VDZA 3AHIA 1AKVA 2OZ8A 1HFJA 4D9GA 4EHKA 2QU7A 1UJ2A 5KNLA 2AAMA 4TKVB 1QT1A 2E7ZA 3MIIA 5I4IA 4LTDA 2PEYA 1KO8A 5HX7A 4ZVQA 1C8KA 1MKYA 1LI4A 2D0FA 2WMGA 2Q49A 1H2AS 4ZK2A 4HD8A 1O58A 1ZQ5A 3TSYA 2AQHA 3U7FB 3WP0A 1FH8A 3LC7O 4NEQA 5CLTA 4ALDA 3KHKA 3PJRA 1LPNA 4EMBA 4LK2A 3OBAA 1ENOA 2WJ6A 1YNSA 3P0FA 1Q7CA 1RLCL 3CHDA 1XP5A 3MUAA 4OBEA 2BFDB 2VWHA 1TXGA 1KBIA 3WUGA 4B6SA 2A1YA 4ZRNA 1O60A 4M7PA 1XT6A 4Q01A 3LA6A 1NE7A 1W46A 3M33A 1L3CA 4J43A 5DXJA 1B8NA 1WMBA 3T8YA 1HDCA 1A8UA 2GPTA 3IHKA 2FZCA 4R3UA 1XB2A 5GQSA 4B9ZA 5FF3A 2R87A 1PYDA 4R8SA 4WUVA 4A2QA 1P6BA 1TPC1 2IHTA 3U3JA 4ISBA 5JS7A 1E2IA 1KJNA 2OB1A 2PDJA 4FLEA 4IIGA 4LCQA 5LDHA 2QGZA 3KWMA 5KWJA 3W5DA 1OZAA 1C7FA 2FUNB 3IR7A 2F00A 3VU9A 3H17A 1CB7B 5WRFA 1WB0A 3H7UA 1D4ZA 2YMQA 1JGTA 3DBLA 1HGWA 3NBMA 4B74A 3CRRA 1DDGA 3T9PA 3K70D 2YA1A 2QRMA 4MQ5A 2XWQA 2W11A 4CD6A 4L73A 2W4QA 4HB4A 3AO0A 1KQNA 2Y71A 4MVJP 3P5SA 1JG9A 3BE8A 3L7YA 1FIUA 4Q93A 1VECA 2C4TA 4CT5A 1O89A 4NONA 3FZEA 2PUGA 3FA4A 2TECE 1TMKA 3UMVA 5C7LO 4IFEA 1T8PA 3IAM6 1SCUA 5BUQA 2NTEA 5GMOA 3CK5A 2VJMB 1Q6EA 3PZBA 2NUAB 4RK0A 3RO8A 1QGOA 3NQEA 3TVDA 4ZZ1A 2NSJA 1Z48A 4ADTA 3OZGA 5DBHX 3QR3A 4PZLA 2HHCA 3KFTA 3MV01 1M0WA 4M1BA 1OBOA 5I3IA 2HNHA 5TNXA 4ZDJA 1RI2A 4Q9LA 4IINA 1DKMA 3PYMA 1NTHA 1VHNA 4DE5A 4WY0B 4B16A 4EUKA 2B2CA 1YDFA 4POAA 2ZIWB 4FBLA 1N25A 3F67A 4ZT7A 3GJRA 3EOZA 1EFLA 2INEA 2QRPA 4KOEC 1FVHA 3M0JA 2RB4A 4YPOA 1N2HA 2OM2A 1YB6A 4OQZA 4Q15A 3PLAE 2O3JA 3WIDA 3NDBB 3B05A 5HJYA 1B8PA 3HM7A 3UAOA 4HPXB 5D3QA 5KVCA 1I8JA 2QT3A 3I04M 1K08A 3W1AA 1M9NA 3EE6A 2FPGB 3HNRA 1ME8A 3ESCA 1Y9ZA 4IWYA 4TT8A 1HP4A 3AHFA 5AUNB 4PG8A 3LUFA 3IVXA 4P0PB 1FWFC 2CXTA 3RSFA 2DHRA 3D4OA 4RD4A 5EL1A 4NWIA 3BJSA 4BLUA 3BD9A 3D0QA 1UMKA 3MT7A 7ODCA 2QVZX 2LCFA 4DV5B 4B8ZA 4TLDA 1I7QB 2NTNA 3TN3A 3D0KA 2H00A 3LD9A 3IGXA 2ZE3A 3IJPA 4FZ5A 4JKLA 5BCAA 1U0JA 2RB5A 3W06A 1NRIA 1KE2A 4AO7A 1GQFA 3EASA 5IXSA 1ZH8A 1KRXA 4S39A 2I1QA 3KR2A 1YVRA 1BOOA 4CMEC 1V6YA 2QD4A 1YR6A 3P80A 1UBNA 5HNUA 5P21A 2PVPA 3JR2A 1CZNA 3KKOA 2W92A 4IUYA 4EP8C 1BEZA 1YZVA 6REQB 2IYRA 2WWTA 2A5YB 1XFBA 3F73A 3N6VA 2W7TA 1C8VA 1LQ2A 5IZ4A 1OA0A 5H8MA 4ZI2A 5BNZA 3VTAA 3E1F1 4IIJF 3EA5A 3L8YA 1NXQA 2UDPA 1KGUA 1YI0A 2EGZA 5HMDA 1KO0A 3T4EA 4LZPA 1S1RA 1JZ5A 2AFHB 1C30A 3IULA 3BPSA 3FYOA 3T3OA 3SCNA 2YS6A 1ELSA 2JFBA 1I2RA 3CZAA 1H11A 1RVGA 4H1ZA 3EWXA 3F3KA 1Q11A 1QASA 2IE0A 5P8WA 3TTWA 4LJSA 1Q7ZA 2C2WA 1E9VA 4ZQGA 3GH4A 4PXYA 4ZEOA 3URAA 1FFYA 2ZRVA 4GQGA 1SVNA 4XD7A 2WOJA 2R1KA 4GNJA 1I4LD 4ZMSA 1DQRA 3GDTA 3G8CA 4AF8A 3ZJVA 1E2LA 5A6MA 1V3JA 4M4SA 4OU4A 2FRDA 1J8QA 3GR7A 1JKIA 3OGRA 4LOIA 1XO1A 5HS6A 4U9IS 2IZ0A 3GFTA 2FMFA 4G0WA 3MQ4A 4RMIA 4NP7A 4L5IA 5IWAB 1OU0A 4B71A 2QRLA 2J3EA 4HOYA 5DCUA 2EDAA 4XK2A 3JQAA 5G2HA 4YRTA 2OZVA 3HVIA 2AK3A 1KJZA 5CLLA 2O2IA 1WB9A 3Q98A 2AL7A 3DEFA 2OOSA 4L80A 4MVJD 4ANFA 4O0ZA 4E2DA 4MINA 4AM8A 3LV6A 1UEJA 3Q5EA 1A7UA 1NXWA 3SVTA 4WNCA 1RAKA 1Z33A 2GOYA 3U40A 3E6EA 5K0TA 2QYHA 3BWYA 1FTNA 4TVUA 4GIYA 1KPIA 3FPHA 3MS7A 4RE3A 3CVXA 1SURA 2FZ9A 3VYVA 4F9FA 3GUHA 4OK3A 3AOEA 3E74A 5CC7A 5DCWA 1ZGJA 4XWTA 4U8HA 4CDRA 1GQNA 3IUDA 4B6OA 4ZQEA 1EJXC 2F3QA 2AN3A 1Z8FA 3U39A 1SVSA 2DFNA 1GZHB 2B0MA 1OAOA 2XSBA 4GYYA 4PC6A 3RNLA 2G7MC 1TMHA 2EKBA 2NT3A 2QTHA 4KDEA 4Q82A 3VPSA 1QLWA 1B42A 2C9BA 3RIXA 2O9TA 3U19A 5CVTA 1AZ1A 3ONFA 5JQGF 3UT0A 1XKLA 2DFDA 3O5AA 1N6LA 5I7WA 4MVXA 2O3QA 2R4TA 1VPTA 2WD8A 5H8UA 2RHRA 3BBLA 4TLBA 1TTQA 4PPGA 1X6LA 1QNRA 5BRBA 2UUAB 1FP8A 2B7NA 1SKYE 4X9XA 3ZI7A 1Q0LA 4EGCB 1YDGA 1RLMA 5ENVA 2FEMA 2ZRLA 4G25A 3GVGA 3UP8A 2R1PA 2OU4A 1IPEA 4ZRMA 3SCTA 5E0KA 4NBTA 2PXCA 4OREX 4JDUA 4HAOA 1Z6AA 1SUWA 4MQEB 4FNMA 1I14A 2VHJA 4BMZA 3WF4A 1OABA 1ZG3A 3EZXA 2E5WA 2VD9A 3SBXA 1M74A 5DX1A 2YZNA 3LPMA 4KREA 3HCWA 3SURA 5H02A 4KMMA 4QBXA 4F0LA 1TMOA 4B34A 5IOBA 4Y2SA 1CRLA 1CEYA 2NQHA 1U0NA 3KR9A 1LI5A 3S1LA 1XYBA 3ORHA 1ZS9A 2WJFA 2LTAA 3FWHA 4IP0A 2NV1A 4M6QA 1W2PA 3W75A 3F5DA 1RRVA 4DXKA 1LSSA 4NULA 1H4QA 5HZHA 4RCXA 1UR9A 2R1MA 4DQXA 2HF2A 1JLKA 3O1IC 2PRMA 3KZNA 1PFUA 3KJIA 1U2EA 4LY9A 2C19A 2A6LA 3IV9A 5A7FA 1SSDA 2JH3A 5DNUA 4AF0A 3TZBA 3QVJA 1JIVA 2AC2A 3ISTA 4HJRA 2Z56A 2Q4DA 4ER7A 3LRLA 1WUHS 3EX7C 3BPWA 4QEKA 4D6YA 1T9KA 4ER6A 5JSZA 2FK7A 2VHLA 1JIQA 2AN5A 4MHOA 2NVUB 4DJFA 1JG6A 4F3NA 1XQWA 4WUIA 1JBEA 3UXAA 3LC2O 5J58A 2WZBA 1NFRA 1ZWLA 4G0NA 1E3IA 2AEJA 4HU3A 4UFOA 4Q3AA 4GP6A 1UASA 4Q4CA 4W7UA 2EPOA 2QUTA 1UWCA 4EA9A 2Y1HA 3OLWA 3QVWA 2PIDA 5JATA 2NQ9A 4QQFA 5CH9A 1NWHA 4XB6B 3QIAA 3I4EA 2G8ZA 1KC1A 2VDLB 3WD1A 4WX2A 3I9OA 3N1AA 1E2GA 3W7KA 3TEVA 1ZOPA 3H2NA 2ACWA 4DMKA 1M6JA 4O15A 4OQXA 1POKA 2I4RA 2VHCA 2BDEA 3PFCA 2P78A 1Z0FA 2YXPX 3URQA 1K6JA 4FHDA 1NXTA 2YXEA 5CT6A 1US8A 3TUZC 3NXKA 3H8VA 2W4XA 4MB5A 1V2GA 4TXHA 2UY2A 1U30A 3SGGA 2XQGA 1E5QA 1HYBA 2NXCA 5CG0A 3JRKA 1OX5A 3THWB 3IIKA 1AJEA 2WJEA 1FZQA 3VI3B 4A36A 4D1IA 1SXQA 4UTUA 3AHZA 2C61A 1MC4A 3IUSA 4XXHA 3VI2A 5I9BA 1FU7A 3R7WB 4R1PA 3ZGVA 2WVHA 1YXDA 1F3LA 1U65A 4LRYA 4QSFA 1VAHA 4AICA 3MS2A 1EF3A 3IMCA 5J40A 1ZD1A 4O2AF 4JOQA 1RQHA 1ZL2A 2YJ3A 3LQ4A 2H4XA 1DQYA 2YJTD 5M5BA 3PUDA 3S8EA 4PUEA 4NHVA 3UFXA 4FC6A 3FNQA 3ELDA 1K75A 2D0PB 1CYGA 2RDWA 2B7PA 4BBJA 1T5HX 5AFDA 2O5CA 1JFTA 3I6IA 3PWZA 3S5ZA 6Q21A 1FLDA 2RGNC 2ZE6A 1WL8A 1G8SA 1G6HA 1I33A 4RW0A 1U99A 3IAXA 3DOCA 4IOJA 1Y65A 2JH9A 1X8XA 3Q7QA 2VO1A 1VE3A 4O4HB 1DPFA 3PZOA 3SI7A 4EHHA 2Z9DA 3TOCA 1FFDA 4M86A 3E0WA 2WJZA 4NY1A 3ATZA 1YCDA 1VGAA 5JNRA 1IZKA 3A1WA 3U5UA 2GEKA 1VCVA 2FB9A 4N40A 4KDCA 4ZKEA 3BSHA 3VE7A 1BG9A 2HA5A 1Z34A 2J0UA 1U80A 4K3VA 2R1UA 2PD3A 3H7VA 3M0MA 2V54A 1TB4A 2QXYA 4MDEA 3CH4B 3QXBA 3VM5A 3HURA 1CEXA 1UMCA 1HT3A 3PZRA 5C5DA 4XKMA 1GNLA 4GKAA 3OTWA 4RXTA 4BNUA 3MUIA 3EZYA 1MX1A 4XZLX 3PPHA 3B7PA 1W1VA 3ESAA 3KU1A 2ZUNA 1IN8A 1MW2A 3BXEA 4KKXA 3IKMB 3W74A 2ZJ4A 1M7PA 3A23A 1TTHA 4IX0A 3W8DA 2EC5A 1BROA 3QKRA 2IZ6A 2QN2A 3RRYA 5SYAA 4DVGA 4ARSA 1YMYA 4D41A 5EESA 2VP3A 4CCYA 1KZHA 2OLHA 2G3FA 2WP8J 3UH0A 4N2YA 3G5MA 3R8HA 3RJZA 3FVWA 3DTYA 4HA1A 1DRJA 4HKPA 2PAJA 1ZITA 3HB0A 4RZQA 4MFEA 4HAUA 4LJRA 4YALA 1QU2A 3ZD7A 3SICE 4RGBA 1GFZA 3NB0A 3MPOA 3MSYA 4PMDA 4OA5A 4EO9A 4QXRA 2X14A 5CCBA 1QO5A 2PFSA 5AI5A 1HFEL 3D0OA 4R68A 2O56A 2ZA1A 3DAGA 4N7MA 1TCVA 4L78A 5FOQA 4M98A 2HI0A 2JL1A 1KV8A 4AUKA 3BSYA 3HN6A 4M0PA 3ZWPA 2D13A 3KLKA 5HOQA 1HVQA 1YFKA 5E2IA 2Z4GA 4DJAA 1W3LA 3W23A 4LJAA 1OMOA 1HMYA 4IUOA 1HDGO 3G8DA 1EZZA 5KOIA 4M9XA 3SM3A 4PH6A 3PVFA 1GZ3A 2XYVA 2P4UA 1IIRA 2XKAA 2RGWA 1P1BA 1I01A 1ONBA 5B30A 3V1TC 1O4VA 3TDFA 1FWAC 1PYMA 4DJED 2QVBA 4REOA 3MANA 4DM1A 3OGSA 3S2JA 3P2YA 3KYDB 1JZ4A 1M1NB 1YS6A 3HN3A 2QCEA 1TM7E 1XRSB 3NPMA 1KBLA 3UTDA 2ZTSA 3NMUF 2G50A 5A9SA 1MD9A 1GZDA 2VFEA 3MBIA 1AD4A 2JCXA 3N2ZB 2ZRUA 4QOHA 2CNCA 5MGNA 3N13A 3TDMA 4FJ0A 2BFGA 1DCTA 2FWMX 5FBRB 5JZSA 4LGXA 2JHFA 3B97A 1J0BA 1SO8A 4JBYA 4E15A 3WP1B 6YASA 8TIMA 1XZCA 2CXHA 2SICE 3K8MA 3H4XA 1AH0A 4W87A 2FFIA 2GZRA 5LXTF 5GIPE 1KWGA 3BGOS 4URWR 2J9XA 1XQYA 2EKDA 4NBRA 5KUTA 3NTLA 4ND8A 3VRHA 1QPQA 1K63A 1DAHA 1F5ZA 2F43A 3P8ZA 4RZXA 2GN8A 5FX2A 2WMNB 4F93B 1MVLA 3HF3A 3LO5A 1JUEA 4WH0A 3AIIA 4UNSA 2BM1A 3KQHA 4B3MB 4Q8PA 4ZPXA 1QK0A 2WK2A 1V0LA 1QRSA 4ZBCA 1IT0A 3HR7A 4BWLA 3T6CA 1HGXA 2YHIB 3EWUA 4TQ9A 4MADA 1N6RA 5B55A 1D8CA 1K8XA 2R751 2WA2A 5SZKB 2R8EA 1VP3A 3S1WA 3I6RA 2G63A 5FWAA 1GU7A 4GOXA 4BMSA 2CLHB 5K0GA 3QELB 1XRJA 1X2BA 3FPGA 3SX2A 2Z1VA 1WCV1 5C9RA 1SOUA 1ZAHA 1DAOA 2ZAMA 3UPDA 2XJ9A 1Y5XA 2YLLA 1J09A 3PWSA 4DW8A 2WU4A 5L3QA 5CDUA 3DCJA 3GJ6A 4IMEA 3R20A 2ZTMA 1FX6A 3KOWA 2HT1A 3HRIA 4C4RA 2JA2A 4MVJA 3I8OA 1GQJA 2D4AA 1ODCA 4C6FA 4JJEA 3F5FA 1JWBB 1R4MA 2ODTX 2G3IA 3G0XA 4QUAA 5A3QA 4KEVA 4LZLA 4BVEA 2VD8A 4OJKA 2AZMA 5L3RA 4R1TA 5BXPA 2H1SA 3D64A 1EC8A 4LS1A 4ZYTA 2GDQA 1EQUA 4PUJA 2ATIA 3ROEA 4PN2A 1K88A 3AYZB 3ZBUA 2EKGA 4LJYA 4L0MA 3MSGA 1ZD4A 3G1AA 3MT8A 1WDLA 3F5MA 3GT4A 5G1TA 1QVRA 3LXUX 1VSUA 4YRMA 4JKKA 3TL6A 3QPUA 3MYOA 1TO1E 3L4SO 4IQ8A 4GM0A 1NOKA 3PNZA 4M8NE 3O8NA 4LYGA 1MXHA 1H66A 2QQ6A 4ASUD 1FDIA 1EFRA 4F3HA 3MTBA 3WB0A 2BEJA 2XUDA 3QLLA 4BGVA 5KVSA 4ZZ0A 1ZH2A 5FADA 4GG9A 4M7TA 5G3ZA 1MF7A 1GEGA 2AMJA 5DXFA 2QCGA 2ZTJA 4RK8A 5EJ6A 3B52X 3T5PA 4FHAA 1XV5A 4DMUB 2HW8A 4J3FA 3A04A 4BBAA 1OIXA 4JR2A 2JHCA 3BF7A 3D54D 3HS3A 4KR2A 2XTJA 3ANYB 3WZ2A 4JUFA 4ESVA 4XYLA 1VXRA 3N75A 1DRKA 2NYUA 5GTDA 4K81B 4E70A 3BAZA 4XYBA 4G85A 2AUNA 2GK3A 3BWVA 4LFYA 1D03A 3PF3A 1BPLB 3X1DA 3NOQA 1M8GA 3GAAA 1XD8A 4GU5A 1POJA 1HL3A 3Q9LA 3IPLA 1A9QA 4A0FA 2CUZA 2PODA 1IZ7A 1OGYA 3ZWYA 5E9QA 5I06A 5CPFA 2O0LA 4A1OA 1AV7A 2ZSBA 3D5HA 1M2GA 2ZSAA 3ZI4A 2WIBA 3OSUA 1LL7A 3WKDA 3FUCA 3T12A 1E4IA 4DCSA 1FRBA 4PG7A 1FVPA 2JALA 3WF0A 5EMUA 2C79A 3OFVA 4QGSA 1PDVA 1XEAA 5BN3A 3CIXA 1O03A 4DWJA 2WNNA 1B73A 2BFOA 1CVLA 3MUY1 2VPTA 1BTOA 3OHMA 1NYRA 1IIGA 3JZDA 2NV9A 3QXHA 4EGSA 3T4WA 1GGNA 1E0UA 3BGIA 3EIHA 4CLOB 5HP4A 4KW2A 1OQFA 1NR5A 4IS3A 3NONA 1KQ3A 5E3HA 2B20A 1EP1A 2YTZA 3TWBA 3WMFA 2D1YA 1FYEA 3UY7A 5CJ2A 5JJIA 4DLWA 2J07A 1VYRA 3ZS9A 2OTCA 2ZBFA 3L8ZA 4J3ZA 3ZV5A 4OQYA 3WNDA 4C6QA 4KK3A 4AZIA 1JXJA 4CCSA 5KWSA 1CEOA 4PWZA 4W7WA 1SFTA 2J27A 4TLLB 3HL4A 4X91A 5F4ZA 4LALA 4UM5A 2HA4A 2Z2AA 4BMYA 3MTGA 4L16A 2A5DA 3S1VA 3LM8A 1K3UB 1UQUA 4H0NA 4RF3A 2VJKA 4CQ8A 3QPDA 2BHYA 1SVOA 1I4WA 5EIWA 1MRZA 2WWWA 3JWPA 2H4JA 3W1QA 3OKFA 3QXCA 5EQJB 2HH9A 2EGGA 4KFCA 4CI0B 4EYOA 1QNFA 4RVCA 4H1WA 4Q4JA 1QG4A 3AF1A 3L6RA 2OYKA 3JQBA 3QOWA 2LWIA 4NRDA 2GB4A 3O2QB 3AUOA 4RO0A 3DO6A 2PIAA 4X62B 2UU9B 3HDQA 3K6SB 1UDAA 5BUCA 1OD8A 3ETDA 1PK9A 2BCJQ 5B58T 3LERA 1Q1ZA 1U1CA 2JGFA 3MTAA 3RADC 2VCEA 3SCOA 3B9DA 4BNLA 3XINA 1VBRA 3HGOA 2D6FA 4DG8A 5M04A 3EDMA 4BCDA 1U9JA 1WD7A 3WQPA 1ML1A 5A0TA 2HEIA 3W77A 4OSEA 5CPLA 2B9VA 1CQIB 3CX4A 1UPBA 1APBA 3EVCA 5EWLB 5D5PA 3EH1A 5CQ1A 4EXBA 1K8ZA 5BRAA 1QP8A 1HOTA 4IF6A 1R4ZA 1U2PA 1RDFA 1W6TA 3I6ZA 3ENVA 2PSHA 2BGWA 4P7GA 4A1FA 2DGDA 4QCFA 3R23A 2NV2A 5CC5A 1EA7A 3HXTA 1SIBE 4MB1A 3ZXIA 2KI5A 4Y2HA 1XLTA 3I2IA 1KDZA 5LZ7A 3RV4A 1PKXA 2Z30A 1RPNA 4UVHA 3H83A 1L7VC 4DWSB 5U4QA 1VJIA 1AKQA 4XR9A 5T9BG 3WB1A 4O8RA 3CYFA 4QSMA 4NSBA 4KLZA 1FJXA 4UCWA 4UW9A 2J5QA 2GETA 3GDLA 1CLXA 4R33A 4G0VA 1KIMA 2DCMA 3VDBA 1DRVA 3ITDA 1E92A 3LUGA 1G1YA 1WHSB 1X7YB 1DBQA 4MA5A 1XJCA 3IIZA 2XITA 4WHMA 3WMSA 1YPIA 5EE3A 3VYTB 1RCTE 5DLCA 2MWMA 3RC7A 4TXMA 1Y8AA 1X8CA 3CEAA 3OA0A 1V1MB 5DF1A 3DG3A 2I3GA 4P4UA 4DNMA 2D74A 5E6UA 3UETA 2A92A 4XX1A 5L9FA 4CD8A 1ZU8A 2QE7D 4PTXA 3TZEA 3H2MA 3DEHA 3GFOA 1ICQA 1O66A 4LVGA 1BU5A 3K9CA 2W5UA 2OAGA 2ZJ0A 2J85A 2ZRDA 3NW9A 4OYLA 2XGOA 3K2QA 3LY8A 3LQRA 2HTMA 3P2JA 1LS6A 2OCZA 5I07A 5F1YA 5KJEA 1O8BA 3POCA 4U63A 2VUSA 5DO8A 5HRUA 2XH8A 2ZYUX 4RL3A 4J76A 3OO2A 5LHFA 3HJGA 4F6RA 3Q2IA 3W72A 1YS9A 2LUOA 2QGFA 2GSDA 4S3FA 2VRQA 3RYFA 1GNSA 2JF7A 1UDXA 3ICPA 4FR6A 3TL3A 4B3GA 4E33A 4QT0A 3W6ZA 5EJIA 2JZCA 3JU3A 4HUJA 5JAOA 3A9RA 3H24A 5LZ8A 2PLFA 3Q0TA 2A0NA 4J0KA 1GCYA 4FSHA 5F7JA 1P75A 3QQWA 1WOMA 4JT9A 4S24A 3Q10A 4I5GA 1NV9A 1NQTA 1ADSA 4IKPA 3WWZA 5KQPA 1W3TA 3A10A 3CONA 4XSVA 2BBTA 1H0HA 2V5LA 3KSDO 4WOZA 1FWSA 1H05A 1X7FA 3UPTA 2IFTA 4BNNA 3O26A 1OYOA 1FY6A 2Q99A 2YZ7A 3WGOA 1WUKS 4QLJA 1IV8A 3GKAA 4BHTA 5LBUA 4Y9AA 1NIPA 1AW1A 3S1UA 1FF9A 4AJ2A 2IS1A 5AW4A 3HY4A 4N48A 3MQTA 2IJGX 3RFFA 1U1IA 5AUOB 3Q87B 2OP1A 4PYNA 1LWIA 4ZQOA 2BL4A 5KYXA 4EENA 4RIHA 3TUUA 3E9YA 1EK0A 4Y1FA 5A4AA 5EUMA 3RUFA 3TBHA 2VDNB 5D5QA 4JH0A 2F3UA 1DRWA 1VP9A 2XNJA 5BW6A 1HT0A 2V6MA 3T0DA 4MKFA 1ULBA 1G5FA 3DUWA 3FVQA 3EC2A 2XN1A 4QYIB 3FDFA 4ZAVA 2MINB 3GGDA 4EEXA 1R0YA 2GUYA 1WXDA 2Z7GA 5D38A 2E9MA 4WY2A 4F12A 4YUAA 4TQAA 1E4EB 2ABAA 3AW8A 4HSNA 4NNOA 3C4UA 3M6DA 4DJEA 1F9AA 1NMSA 4IFKB 3QTTA 4MO9A 4ACYA 3EFBA 4C5CA 4RTMA 5B3LA 1ECJA 4A8TA 1XTVA 1KHHA 4RDXA 1JPVA 3E9NA 5JO0A 2PWAA 4W88A 5BOOA 1NXVA 1J1ZA 3NC1C 1CUZA 3PC3A 4GZ7A 3K94A 2C9ZA 4HQOA 4KIEA 2N1MA 2C0HA 3T8LA 3R5XA 3AFIA 4LUTB 3K7EA 3TW9A 1QOQB