5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GLUCOSIDASE
publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
3ZYZA 5FJJA 4HZMA 3GSMA 3WLOA 4ZOBA 3SQMA 5BU9A 4YYFA 4GYJA 1Y65A 4IIBA 1EX1A 3WLLA 4IIHA 3WLTA 4G6CA 4ZODA 4ZO6A 4I3GA 3WLKX 4ZOAA 5G1MA 4IIGA 1J8VA 3TEVA 3BMXA 3RRXA 5FJIA 3NVDA 3U48A 4ZO8A 3WLIA 3WLMA 4ZO7A 3WLNA 4ZO9A 3UT0A 1X39A 1IEWA 2X40A 3USZA 1IEXA 4ZOEA 3AC0A 5JU6A 4GVGA 3WO8A 4MSSA 4GYKA 5IOBA 1TR9A 4I8DA 4GVIA 3ABZA 3GS6A 4IIEA 3LK6A 2X41A 3WLHA 3WLRA 4IIDA 3SQLA 3WLPA 1LQ2A 4IICA 3U4AA 4ZOCA 3WLQA 3WLJA 5BZAA 2X42A 5C0QA 4GNVA 1X38A 5TF0A 4GVHA 3ZZ1A 3WLSA 2OXNA 1IEVA 4GVFA 4IIFA 1IEQA
chains in the Genus database with same CATH superfamily
1ICIA 2WWWA 2FR8A 3MS2A 4MWEA 3ZT7A 4MOWA 3BSSA 3EX1A 1SC9A 2NTVA 3W5UA 2NV2B 1B76A 4ENQA 3ND6A 4HT3B 5LMNB 4CQCA 2WU8A 2GBGA 4HDCA 2QTGA 3FMOB 2DFKB 3NZGA 1RI2A 2XF8A 1AKVA 2G4JA 3CPRA 5BWMA 3SYRA 2EBHX 5TMEA 4AZBA 1EUZA 1KERA 3H87A 4NQRA 1SN7A 2R8XA 3L6OO 2VAPA 2AI3A 3L4UA 3V80A 4MUYA 3TAKA 1SIBE 2CT8A 1IRXA 5I24A 2HISA 3W4KA 3LGGA 3WDIA 4Y0NA 5IJZA 2IYWA 1KA9H 2I6GA 3CPSA 1W91A 1WB4A 1CLVA 4HLUC 5TVKA 1FNCA 3APGA 4AJ4A 3ZR6A 2H4XA 1XRQA 3F90A 3A6KA 2OWEA 3FFWA 1J11A 1FFYA 1HLDA 3V4SA 4L7QA 4DIKA 2EJVA 4ED9A 2APJA 2NAPA 3C48A 5F78A 2AMYA 3FLEA 3R3JA 2VPZA 3ENQA 1FOBA 1BX1A 6ABPA 2BG5A 3IXLA 4BNTA 2VXBA 1K0UA 2OVFA 1OFAA 3THOA 5EFDA 2B2XA 3PXAA 3CLWA 5LP1A 3CL6A 5JS1A 3T95A 4IWNA 4L8LA 4X66B 2YN4A 3HACA 3BLIA 1TLLA 4QHYA 3LNTA 2QW5A 5JCJA 4RTRA 1FDTA 2JZOA 3AMKA 5AK5A 2Z4RA 4MCIA 3AEQA 3R2JA 3YASA 4X60A 4B35A 2ISFA 1M5TA 1IXZA 5JHGB 3MWJA 3LZ5A 4GRDA 3M4HA 2IQ5A 1MQAA 3HL4A 3B2EA 1EFTA 1QVZA 2OZTA 1CR1A 1C9MA 4GNJA 2ORVA 2PDWA 1ACLA 1SVNA 2PZGA 3ZW7A 4RV8A 4DF0A 4KXNA 3E48A 4WZAA 1DT5A 3P0RA 3AEXA 2X2GA 4UTWA 5EXEA 3A24A 1Q7BA 4ZCRA 3ICWA 3L41A 4P8WA 4NZ1A 2A5JA 1VYVA 5AI5A 4FFRA 3LSCA 2OELA 1WOMA 5JMOA 3HYLA 3BLOA 3H2KA 2PLKA 3HYCA 1QU4A 4JDYA 4R8RA 4BLQA 2F8LA 1GVHA 1HQKA 3N4FA 1M66A 4BOYA 4M0XA 3GR6A 2I9KA 1XD1A 4KE9A 4GKBA 1C9JA 4K2HA 4OBXA 3R41A 3AISA 3NUQA 1VEOA 1ZY9A 2VGGA 1P4RA 4FM9A 4UHDA 5DYNA 4R0MA 2ZJ5A 1J0DA 3CQIA 4UDNA 1Y7VA 4I46A 4MRRA 4E2XA 2JF7A 1OLUA 4HXGA 3RAOA 4YDSA 4V0LA 5DMXA 4A3HA 1Q7MA 4O4HA 2DMRA 1RVV1 2GJNA 3A1VA 3DDNA 4RCXA 1TVMA 4MAAA 5KYTA 4OXNA 5M3WA 3PXCX 5LP6C 3QU5A 3FK4A 3H9BA 3BL8A 3ZX4A 4LJ8A 3PM6A 1Z6AA 3LDGA 4TYNA 2BFMA 5BQOA 4WLEA 5AMXA 4DDTA 3HWRA 4QLLA 3MCMA 4CODB 1DAKA 3L6UA 2G8NA 1JJAA 1R3QA 4IBOA 4BMVA 1P80A 1X7HA 3DFMA 5DGXA 3L4KA 2NVUB 2QX8A 3OE5A 8TIMA 1GGVA 1KBIA 3IJ6A 4MDOA 3DZHA 3EXEA 2WBLC 4EF5A 4MUHA 3AB7A 3GWZA 2BX7A 1NLZA 1ODCA 2QPTA 1B1CA 3ES7A 1ZIDA 4PU0A 1XHEA 4OTKA 1KC3A 1GD1O 3A4XA 3MF4A 2HA3A 1X0VA 4HJRA 1OX6A 3ATYA 4QO8A 1SXIA 3TCSA 4US5A 3UU0A 3DBVO 5G4EA 1GOIA 1CRWG 4ZQCA 1FFGA 2R5FA 4AUMA 1FF9A 5K0NA 4ZK2A 5DSTA 3LGXA 2AK3A 1H11A 3RJZA 2Q9BA 2YYSA 4FYPA 2JF6A 4R3WA 1X80B 1QHHB 1ZVQA 4PG6A 4DXAA 1T0BA 3V3KA 4JR1A 4IP5A 3M0HA 3PUJA 5I5RA 2DW7A 3W1PA 2P3LA 3HHEA 2GAAA 1YHZA 4G9PA 2ZIZA 4WRRA 4LTSA 1J70A 4O25A 1QW8A 1ZJIA 3GCZA 4CTKA 2OM6A 4TSFD 2OECA 4E6MA 1RIFA 1GAQA 2R44A 1C5KA 5IDIA 1MFZA 3RHSA 2P2ZA 4RW5A 3GC6A 2QV5A 3QENA 4ZU6X 3KZPA 1P0CA 1C7QA 2AN1A 3G9QA 4MQEB 4UOEA 4OGFA 5KSWB 3DFKA 5ELMA 3VR6A 2R7KA 1I2ZA 3OUTA 1I8TA 2B6HA 1ICPA 2DUAA 3EISA 1DDIA 4JB0A 1EM8B 4L8FA 5DTQA 5BMVA 3QWFA 1KI7A 3IPLA 5K3EA 4LHSA 1GJRA 3H86A 1FKWA 3SQDA 5B2EA 1UMLA 5LIRA 5EWLA 4A2WA 2ZE5A 4IXXA 1KZ6A 3ZIAD 4C4PA 5HUQA 3HRHA 2W2MA 5MKGA 1HURA 2REXB 4BN5A 1S3GA 3SR7A 1Z17A 5FV4A 1IWBA 2FVMA 2GD0A 2F3UA 3LI1A 5I48A 1MZHA 4F56A 3RF9A 3UQZA 4J28A 1FP6A 4K38A 4AKEA 3F2CA 3MHPA 1L4BA 2EFJA 1A1VA 3UW3A 4GGHA 4HLUA 4GZIA 1E0JA 5I03A 4IFTA 4C03A 4H2CA 3ONVA 3STWA 1W1WA 2ZJFA 3CXUA 4HNGA 1LV7A 1NUUA 3ZQKA 1OBVA 3NOQA 3IMKA 3O0DA 4QXRA 4TT8A 3AU9A 1B8PA 4OHRA 3E12A 4DLLA 1ESCA 2Z8YM 4ZT6A 1XP5A 3G5MA 4X94A 1W85A 2BGTA 3ABSA 4B4UA 3VZPA 4KHZA 4BATA 1U2EA 1YJBA 4JA2A 4J75A 4RIIA 2AOTB 1DJIA 3GC4A 4HZUA 3VFCA 5JARA 2O8BA 4HQKA 5DN1A 2OO3A 3EX2A 4WXRA 1G8SA 3OX2A 5FOTA 4QQ3A 4ASUA 3KU1A 3OLZA 2VHCA 1VGRA 1E9FA 4Q39A 4JJGA 2I16A 2HW8A 3V34A 3IA2A 3L7AA 1D0IA 2ZJ3A 5EJAA 3U3DA 1HDEA 4FOLA 4A0SA 2LR0A 2OBMA 2OX1A 5A3VA 4W87A 2PWEA 1F51E 3C0QA 1AHIA 4B5TA 2XVXA 1FH8A 4NZNA 2GK4A 4C88A 3HQNA 4RJEA 3H5AA 2R8EA 3CUZA 3OMWA 3VNAA 5DCEA 3TZFA 1D2AA 1XLWA 2AMLA 1GAEO 1G6HA 5EE3A 1HBJA 2PCQA 3GDFA 4EPBC 5BNZA 1TUBA 2IGTA 3BXFA 1FFSA 4H6PA 2PT9A 1O08A 4LDAA 2QNBA 4G81A 3PBYA 3OC6A 2OD9A 1KWGA 2QZJA 4GFDA 4E0BA 3PGMA 3EC1A 2GDJA 4JX8A 4KETA 3HSYA 3A14A 4G0NA 1NBMA 4V0NA 4US0R 2FSHA 5T6MA 3PPXA 3DD1A 1PKEA 1I1WA 1Z33A 2RHJA 4FXSA 4X64B 3AH8A 5BXPA 3BFKA 1HJSA 1Z0AA 1K8ZA 4AJNA 2D7CA 3JQ7B 1AV6A 1JEQA 4JU8A 5T64A 2DQSA 4RXMA 1AA1B 5F2GA 5DHTA 3MKVA 1K5PA 2P5UA 1QH9A 4JLBA 3GUCA 1PCKA 2HK0A 3L4WA 2IS2A 1UD6A 4XBKA 3SJBA 2HDNB 1XIIA 3I04A 1QPZA 4ZVSA 2VF5X 3K94A 4NBTA 5LP6A 3FG9A 3RITA 2DU8A 5T4EA 2HDJA 3SRDA 3P9QA 4ZOAA 5KETA 2ODBA 4K9RA 4PZAA 4XWWA 2QJHA 3UB2A 1OWLA 3V5FA 3JRNA 1C3OB 5HMDA 2OGJA 2IE0A 4M89A 4CM8A 3A2NA 4AVYA 2YZ5A 3FVMA 2IZZA 2O2ZA 4N1AA 5FJUA 4TUFA 4L6IA 1YXMA 3FDZB 1YBAA 2Y7EA 4FZIA 4Q4LA 4S0XA 1ZGCA 4C6TA 2DFVA 1RQRA 4IG2B 1X7YA 2AD1A 2OLSA 4EMUA 1MUMA 3SKXA 3ZV3A 3T5TA 3B8DA 4IRXA 5H0IA 1KVSA 1HDXA 1EPUA 2EQDA 5B30A 4WJKB 2ZWMA 3UJAA 1QGOA 2RCYA 4UTMA 2J09A 3KV3O 1DOHA 1YL7A 3WNCA 5B64A 4HQVA 3ZWSA 1N92A 4G3XA 3IHWA 1RXWA 1LPSA 4LMBA 3TLGB 2R4UA 3AIMA 4UHJA 1RQHA 2UYHA 1QHYA 1A0DA 2ZZ1A 3MRXA 1PAUA 2RH8A 3ZDBA 3OVGA 3DBHA 1DORA 2AL7A 1G41A 1ZCJA 4G09A 2IH5A 2I6UA 3EWWA 4FXJA 2HA0A 3FYTA 3HFRA 2BY1A 3B06A 4J4TA 3KUDA 1JYSA 3EKZA 2NVOA 3KD3A 4MHOA 1EZ4A 1IC6A 1PV1A 4UULA 4F2TA 4TV8B 4ML9A 1QAMA 1GSOA 3VKGA 5IEJA 1E3JA 4P2BA 1R1DA 3KXDA 1NSYA 4M7TA 2I4IA 1N2ZA 4FIRA 5KQPA 3SY1A 1AN0A 1KBZA 1RZUA 2HYDA 2R6AA 2QS9A 1OFTA 5ALPA 3LB0A 3QPBA 1T4BA 4Q7JB 2EPMX 1GOMA 2XHEA 3DZDA 3GVWA 1Y6GA 1H9CA 2CXGA 1MZPA 3WR5A 4TRMA 3VNJA 1SVIA 1O95C 5AXAA 1O3YA 1OH6A 3T35A 1KDOA 1WPXA 2P6UA 3M1IA 3T6CA 4ASTA 1MUCA 4NNCA 1WQ1R 2X4IA 2R97A 4OLFA 3RIXA 1XZQA 1I4WA 4C7XA 4NCAA 3E3HA 3E05A 4EI8A 4EUHA 2Z2IA 5T6BA 3D1LA 3BH6A 4HZ7A 2DCUA 1E2JA 5CKSA 5GVRA 3A25A 5JBEA 3W2UA 4HLCA 4F2WA 1JZ5A 1JQ3A 3TQIA 1A9QA 4GR9A 2CHOA 5ALOA 3SICE 4W1RA 3JARB 3ZVHA 3K96A 3RAFC 3VPDA 3LXRA 1PZ3A 2ZR8A 2GUUA 3IQWA 4KRTA 1SFTA 1LRKA 4HNOA 1U5BB 2P50A 3FCEA 3U9TA 1J7JA 2Y93A 5M17A 1KEKA 1F6WA 2NT0A 3V32A 3OCVA 2G1PA 2P10A 5A9SB 4V0SA 3U4QA 2XNDD 4L73A 4YT4A 3KEHA 2JC3A 2Y7DA 4E3WA 5E3JA 2ZI9A 2ODNA 2BV3A 1R10A 3H5WA 2J08A 1R27A 1G8PA 2J3LA 3PWGA 3SGZA 4H15A 1EDBA 3VD5A 1A69A 1U6IA 3N8NA 2NAFA 4S24A 5DGHA 4AWBA 4MI3A 2QPSA 1DO8A 2ZSDA 1RJ9A 1AVTA 2JHFA 4OP2A 3OX4A 7TAAA 1KK2A 1FNDA 2FLIA 1PJCA 1JZ3A 2D54A 4DWDA 3IQIX 4UCFA 1GNSA 2B9EA 1ARZA 3DFQA 3LDAA 2A9JA 1EQ2A 4YP6A 4LGYA 4Z9FA 4BQNA 2NP6A 1E1DA 2RD2A 5JYEA 1KAMA 4NZOA 2XPKA 1WZCA 4DLTA 4DG9A 2HO5A 3OPNA 4V24A 2W43A 2Y1GA 4AW7A 3CNQS 1D2RA 3HP1A 1DL5A 1TZBA 2CJYA 4HAXA 1YQUA 3VBCA 2CW5A 2MU1A 3UMMA 5MN6A 2AJCA 2VCCA 1SC1A 4CJXA 4BF9A 1RE0A 1XRSA 3FAXA 1T4CA 3FNQA 1E32A 4J4KA 1NWSA 5IT0A 1V47A 1CNFA 1TK9A 4RV5A 4MMWA 4O2AA 4GZ6A 3VABA 3BSGA 5ADUS 2QMJA 1R4MB 2V5UA 4FPXA 3ZZNA 2V8BA 1LZLA 3MGAA 3OLVA 1PTGA 1SU7A 4P3NA 1V6YA 3R8FA 3LCHA 3L7MA 1Z2AA 2L19A 4QZVA 2NU8B 3UWKA 5CQ1A 3AL2A 1H69A 2OZEA 4LH8A 3R7LA 2AG1A 3S1WA 3C3DA 5CFZA 1NXVA 4QC2A 1IOLA 4DCJA 3ADBA 3ERPA 4ADTA 4IDAA 4RE6A 2I4LA 5CB4B 3IUSA 4KI0A 3ZDAA 1BA2A 3PVCA 4OI1A 2IQDA 4KYUA 3DH0A 1SHJA 2GM9A 3G2GA 1KBJA 2OV3A 2R2GA 2ISSD 2W2OA 3PZBA 2ZWZA 1TFVA 2ACQA 1QO9A 3AGPA 4HA0A 1XC4A 1WEHA 3MI3A 4LYGA 1X8CA 4BP1A 5EJIA 1L7PA 4ENSA 1Q6GA 3UYKA 3OZGA 1RJFA 2QTVB 3TQ0A 4WQ6A 1NN0A 3UG5A 4BRUA 1K06A 2Q0HA 1X7GA 4MHBA 3VZZA 4NUWA 1VKRA 4WY0F 1BG6A 4F3YA 1ZDMA 4JJKA 1LPOA 3FUCA 4BKPA 2QUAA 4XEHA 1AKYA 4JOSA 2VNIA 1KXVA 4YP7A 3V36A 3B04A 3MUCA 3NTVA 3S2CA 2DPHA 1IXOA 3PX3A 5FNVF 3HKCB 4L9ZA 5DIFA 1SO3A 1DPFA 1EFLA 2GZXA 2CHVA 3BZBA 3OLYA 4HMQA 2DJLA 1NYLA 2X3FA 3M0KA 5EP2A 1KY4A 5DYWA 3EXFB 5EZYB 1BU8A 3G0UA 2WT8A 4JLDA 3UERA 3DD5A 2YL9A 3OFKA 4ACYA 1BF2A 1CPUA 2OPHA 1JHZA 2HFJA 3DT6A 4CN6A 1BXGA 4UFOA 4L4RA 3FVVA 3SEFA 3L6DA 2WQ6A 2Q3JA 4Y8FA 1FUEA 1LS6A 1WXJA 3DQQA 2HADA 1R86A 4EZEA 3VK5A 1T8UA 1CZHA 4FN5A 5KQLA 4LX0A 4RHCA 2DU2A 3L04A 1B3OA 5AKJA 3L02A 4RK8A 1JLLA 4D81A 1UBSB 4YQFA 2HXTA 3ANLA 1UJCA 4D9FA 1HX7A 1CZRA 1QFJA 3H8AA 1Q2XA 1NNUA 4KTTE 2P0OA 1XH1A 4E70A 2WFAA 4ZO7A 4ABYA 3W00A 4A29A 2Q50A 1O95A 1R0KA 4UUBA 5IAAA 3DBRA 4H60A 3SRFA 1PJTA 3CLUD 4JFVA 1U8AA 2OGWA 5DF0A 4X7RA 1CE8B 3HVRA 3FNBA 4QWWA 1RLUA 3UTDA 3KZVA 4AUNA 1YA8A 1A80A 2IU4A 3R7MA 4Y67A 4PUWA 3G2OA 2I1QA 2QMKA 4LRQA 3WLJA 4HDSB 5SYAA 1UP0A 2JI4A 4U3CA 2R9RA 1AG1O 2WYOA 2XGJA 3L82B 5C9ZA 5EJMA 3GTXA 4KKXB 4F2GA 3AHFA 1JDEA 4HN8A 4ZOBA 1ZU5A 1FC0A 3CVYA 1KQFA 2J9FA 5DT7A 1FPQA 1KK3A 4QRIA 3UNXA 1X1BA 4Q02A 1FFAA 3PUGA 5B7PA 1OTHA 3JR7A 2BHNA 2ESRA 3G9UA 2FZ4A 1HYHA 4M4SA 5F2OA 3A6PC 3JQEA 3WBJA 5A71A 1D2EA 1XALA 2K2QB 2VFEA 1RVDA 3FJLA 4RA6A 1ACJA 1L4GA 2I91A 3K4QA 3KQQA 2OTDA 3GEMA 4UD6A 4P81A 3CIOA 1E5DA 3GUVA 1VPYA 3SQSA 4K05A 4HR7A 2JVKA 1B6TA 4FT2A 2R9VA 2XUDA 3FCUB 4KXUA 2IT1A 3AV3A 3D8UA 4KCWA 3OECA 4XIAA 3V7NA 4DXHA 4ZHQF 2A92A 2Q21A 1HP5A 4M6VA 3ND8A 3P5SA 1V6SA 2V0NA 4HWRA 2E48A 1MI3A 2Y66A 1SQ6A 1XNJA 3H9QA 1E5NA 5WRFA 1G7CA 5BR4A 1IHDA 3MS8A 3GE7A 4L4ZA 1GQQA 3W1MA 2GEUA 2OCYC 1NKTA 4IAOA 3OZUA 2GQ8A 1G8MA 4HKTA 2V97A 4II7A 2C1IA 3BARA 1FUYB 1YUMA 4PRZA 3HKEA 1Z8NA 3DERA 1T8SA 3NH6A 4ZV9A 2BOVA 4LA4A 1VKJA 5AW6A 3EGVA 3HNOA 3NMUF 3AOEC 3P1JA 1JQXA 2GK1A 5EXTA 3TLYA 4OJMX 1EE1A 3U17A 3U48A 2ZJZA 3SCSA 4M1WA 5I9BA 2O0MA 3L7LA 2H1FA 2PUFA 4LW8A 5EQTA 3WIBA 4IXWA 1BH6A 3QEJA 5HQ3A 1XYMA 2NQHA 4RY0A 4O4JB 3P20A 2XYPA 1UC8A 1GVQA 5FORA 1BG9A 2Q07A 3LQLA 4B3GA 3GDRA 1UYQA 4XIJA 3URAA 4IFKB 1W4AA 1MO2A 2XWJI 2WBGA 5C8BB 4E31A 4H2DA 4R1MA 2OP1A 5FL7A 1JFRA 3QEBZ 4KGZA 4QS5A 5HR7A 5ALWA 2A59A 2H1VA 2IELA 3P4XA 4ENWA 1J97A 5LIWX 5CYPA 4IKEA 3BTVA 2V6MA 2CZFA 2A9OA 4O2RA 3UZ5A 1ENOA 3CZEA 4YT8A 2ZUSA 4YV2A 3L1KA 1WDDA 4BZWA 2IXUA 3SNHA 2BEVA 1Z45A 2VS1A 2YFNA 1M6HA 1XVAA 1TT5B 5KNCD 4NJHA 3UESA 4ND3A 4PTLA 1E5QA 2DJIA 4FOUA 3F67A 4TVBA 3PV0A 4BQRA 1U2GC 5AC7A 3LV8A 4C7OA 5FI5A 5JISA 5ITWA 4OI4A 1ADJA 2EU8A 3GHUA 4PUEA 4H18A 1MRZA 4OQEA 2UBPC 3P6LA 1X7IA 1KJZA 4XSLA 5K7SA 4QG9A 1UPTA 4ZT2A 4BKQA 1ZBKA 1LI5A 5JVDB 1L9WA 1DCFA 3K5XA 1TADA 4LJYA 4XZMX 4ZQHA 4NASA 1E3SA 4QGSA 4B73A 4C5BA 2QMYA 1VHWA 2IY7A 1KI9A 1UJNA 2CKDA 2ZQYA 3NRBA 2JAHA 1Y9EA 4DQUA 2CYBA 4P4NA 3AT1A 1D5WA 3ZDCA 4D6HA 2DUZA 1U9ZA 5CM8B 2A94A 3ACBA 3G0DA 5NULA 1HJWA 3Q3VA 4WOKA 3RF6A 1ZBDA 4Y9PA 5FJJA 1ABEA 2X8RA 4D8TA 3VM6A 2H11A 1AUQA 3UW1A 1HL3A 1CEOA 1UP2A 3RX3A 2QAIA 1OEPA 1KKMA 3IELA 3WGLA 4ZI7F 3HJBA 2VLBA 4GXNA 3UENA 4D0SA 3CH9A 1Z6KA 1RXVA 2QHXA 3T4PA 4RORA 1XB2A 3I0MA 3A4NA 1W1B1 5FJIA 1NXSA 3HCOA 2N75A 1U7DA 2AUTA 4Y18A 5JZMA 2C2XA 3S0CA 1NJ1A 1LA2A 2IVFA 3MT9A 5ALFA 1BWLA 4N5NA 2GCOB 3PQEA 3RD5A 1E0AA 4JR2A 3GYGA 1AUSL 1KQPA 1EIZA 1V6TA 2Q7DA 3WMXA 4FMVA 3DSRA 1NE7A 3ILHA 3WIDA 3P52A 4FYIA 1EJXC 1WB5A 2FUG6 3O7MA 5E2AA 1C2TA 5KJ1A 3MBFA 2ZE6A 1JBQA 1I7LA 2PP1A 5G1TA 3R8GA 1LG2A 3GZ4A 4P7KA 2CFOA 4JTKA 1E9BA 5BW6A 2XU2A 4N3NA 3VSBA 1W4CA 4PR3A 5KDLA 4UQCA 5EHXA 1XLCA 4QQUA 4MV0A 1EHAA 5BSKA 3ENKA 3A6DA 1ZNZA 3ONNA 1JR1A 3N14A 4RMJA 3F46A 2OK7A 1MQ8B 2VEKA 2AN5A 4C2BA 2NG1A 1LRNA 1WXZA 3TJ4A 4GLJA 3H5IA 2R8PA 2VQSA 4C0QC 1Q65A 2JVIA 1OCNA 1DP0A 1TVCA 1ZL1A 2ZRUA 4IL5A 3SC2A 1B6GA 4LRWA 5DYYA 3OCYA 4YYZA 4HPJB 2QTWB 1OC5A 3F3YA 2JGKA 2FHFA 2H7CA 3TLCA 2BS9A 5CEWA 4L9RA 1OYWA 3L6BA 2VX6A 1XD2B 2B9VA 4TTGA 1WA3A 4DIOA 2ECKA 4NK5A 3MHGA 1DLIA 1RALA 3QYAA 2QUTA 3WQFA 3SM0A 4JLSA 1YS2X 2HHHB 1UMBA 2O8DA 4RD0A 3GLCA 3KSBC 4EARA 3K5IA 2QCMA 3OWOA 2VZSA 1NZDA 4PLFA 3Q2IA 3UUFA 2QRVB 3CVOA 1XCBA 5KC8A 2BFEA 4BN0A 1PFKA 3WDRA 1UA3A 2WWXA 3SXUA 1LLUA 2A1TS 4GBDA 2OWXA 1PW5A 4B32A 3I4LA 2HU5A 2H2FA 5DBTA 1LLCA 3AOEA 1XLHA 4AQYB 2IJGX 3I83A 1W0KA 3KLMX 4OFXA 1V4BA 4V27A 1WCGA 1E2MA 3SNKA 2Y62A 3UZZA 4BR1A 2V59A 4X97A 1SKYB 3BCJA 3SCVA 2ZU6A 3OE4A 3NGXA 4QTGA 3IBTA 1O9BA 3PC8C 1R3DA 4G63A 5HBRA 4Z4IA 2WWGA 1EZ2A 3NJ4A 1Z89A 4D26A 1L8PA 2X5XA 3V97A 5CVUA 5FBQB 1A3CA 5H02A 3VOCA 4CQAA 3ZNPA 2YSWA 4OHUA 3TTTA 4OKIA 3VNIA 4Q1FA 1GQYA 5LYJB 5KVSA 4HDNA 4QLOA 1SJ9A 2DH6A 3T06B 2II6A 2H9AB 3QZ6A 2YHSA 2DULA 4B2IA 1LJLA 2X8WA 3HP7A 4QRDA 2OAGA 3DGRA 2UUOA 1FX0B 4N18A 3DMRA 4DJFC 1XQ1A 1BMFA 1P44A 4GJIA 5HMEA 3GDOA 1KK1A 2K6GA 3THRA 3A37A 3ARWA 2B1RA 2B7BA 4F3TA 3L0OA 1O4UA 5A8PA 4CFZA 2WEKA 4DNOA 1J23A 4L4YA 4TT3D 4WZZA 4QGCA 1UH5A 3DO6A 2V3FA 1HQCA 4P54A 1U2GA 5DKFA 2A3CA 1H22A 5HXMA 3FYYA 3QX8A 3WK0A 1Z2PX 4BFZA 1JD7A 5A5VA 1RLTA 3PWAA 3O0TA 3PSAA 1XELA 4RA9A 5K20A 3IEXA 3GVQA 4QCFA 3WC4A 4XWTA 1G7UA 1YS1X 4H6QA 2Q5CA 4QBTA 1H6DA 4B6GA 3U2QA 4K03A 4EITA 1UKPA 1DAMA 1P2DA 1U8XX 1Z74A 1JU3A 3LGAA 1HKJA 3W2IA 4JN6B 1FU7A 4KMRA 3ZK7A 4BS0A 1VRXA 3JTMA 4OUKX 3U09A 4JI5B 5I8ZA 4YAKA 1FYDA 5B4UA 1CLKA 1OF1A 1H9AA 1L7QA 3DDSA 4NEHB 5AUQA 3ZUGA 4B0OA 4PLPA 5H8UA 5G4HC 3X44A 1Y1TA 1X1TA 1QK4A 4QAQA 1XJWA 1CR0A 5A9TA 3VD7A 3QE3A 3RC3A 1CEQA 2Q5JA 5D37A 3P5ZA 1CUDA 2IS7A 4TZ6A 4CI9A 3CWHA 1IU9A 2G09A 3FTPA 4V3CA 1CQJA 2IXEA 4WDTA 1RE1A 4IQ8A 2OK8A 4B9EA 3F6RA 4MUIA 3LPLA 2WSYB 1YACA 1B43A 2GK6A 4GPIB 1NVKA 3A4WA 1W3LA 4UTKA 1RLDA 1C8LA 2FLVA 3CU5A 1S7GA 3ZOAA 3ZEAA 4NU7A 4LJ5A 2WJPA 2PJRA 2HR1A 3R1IA 3AXIA 2J74A 4KNWA 1HLGA 1JLRA 4GUIA 2BSAA 2VX5A 4AD2A 3RFXA 3W2JA 2FYMA 4B8YA 4B5NA 4CMIB 2NUPB 1KGSA 3IVCA 2BTQA 2RJOA 2C96A 5LHFA 1FNSA 2PZLA 2RMKA 3UXHA 3QYFA 1T8WA 2Q8NA 3D2AA 3SHVA 4MAZA 5HFNA 2J45A 4QM1A 5EP1A 1NXQA 3L0ZA 4C5AA 4AFNA 4ROTA 1JNEA 3L40A 2ZXQA 3K8ZA 3B0PA 1V0LA 1T13A 4LUSA 3NETA 1Z44A 2X1RA 2PRHA 3ISTA 3PJEA 5BRPA 4BEWA 2XXJA 1AH4A 4XZWA 2NQJA 5C2GA 4YJ3A 3VGBA 3ENNA 1E20A 2BH9A 1QORA 1SR0A 2Y6UA 5FBKA 4HX9A 1QG6A 3LNCA 3HG2A 1WUEA 4LY8A 3IUJA 5K1ZA 4EPYA 4UE6A 2X8JA 1H7WA 3GCDA 3WLOA 4I5RA 4MO2A 2C0HA 1O1ZA 3AVWA 1OIVA 4XUGA 2BODX 3U4MA 2NYRA 3OZPA 1H6BA 4MZ8A 2HEIA 3OPXA 4WK9A 1GLGA 4WDXA 1JQLB 3L7YA 2FTWA 4QUGA 3AHHA 3GIDA 5FAGA 1SUXA 1GZ3A 1KI6A 3GARA 4MB5A 4D9IA 2F3PA 2D69A 3H05A 3C2VA 2ZDQA 5EMJA 4YLWA 4PN7A 1HMPA 3WY9A 3GUGA 3A4TA 1OGYA 2R86A 5D2XA 4K9DA 3EZ9A 1Z63A 3N28A 4C4TA 2O3TA 2Y1WA 5JNUA 4RXFA 3UM9A 3SIPA 1Q77A 1P1CA 3IQHX 4GX8A 5AOUA 3NHZA 3T94A 3R3WA 2ZSFA 2G3MA 4HU0A 4L6OA 4Y9UA 1QHXA 1Q95A 3X1MA 3QJAA 5A6BD 5EKDA 5B6JA 3WL7A 1V8PA 1V9LA 2AR0A 1XZFA 3TVAA 4M3NA 4B3JA 3J81A 1VFOA 1H2WA 3DP9A 2KI5A 4GACA 2GO7A 4KZKA 1PDOA 2BFWA 1A53A 1GADO 3VM5A 4P7RA 1QBAA 3QVXA 3BOFA 4F79A 3F9RA 3MT0A 4F6LA 1R8JA 3PRJA 4YAIA 2CZVA 5IBXC 3ETDA 3RODA 1OWOA 4P4GA 1BTOA 4K8RB 2JLAA 4B8WA 4G0VA 2RC5A 3KYDA 3T2QA 1R66A 3UWEA 1E2EA 2Y89A 4PMXA 3UR8A 3VDHA 3KSMA 4PNZA 2FPUA 1MPTA 3PC8A 4D2JA 3CLHA 1S3IA 4KNVA 5CNJA 5DE3A 1PNOA 1Z4PX 3M4ZA 1AJZA 4PR4A 3GZAA 1MTZA 2BGJA 5HPOA 4MJLA 4BV3A 3HMJG 1ZFNA 5C5DA 3BW3A 1XZLA 4JNKA 4GE8A 2QZ4A 1K70A 4DEXA 2ZCJA 1QB7A 4JJIA 1TZ2A 4NCBA 1D2KA 1JDBC 4NMWA 4AJHA 3H7RA 1FIUA 3D6MA 1FFXA 2WPNA 2Z2AA 4DJFA 3AJRA 4IF2A 1BD4A 2OQLA 1ZJZA 2G97A 3OOWA 4CWAA 3O1HB 3OYXA 5HKKD 3X3HA 4UFPA 3CINA 1NF7A 2FSFA 3GW0A 1QP4A 1LQ2A 3H2JA 4C6KA 5EGRA 2NTNA 5A7HA 5HF9A 1HORA 2W3ZA 3E61A 3EPPA 4TKZA 4C6QA 2W22A 3KVYA 1STOA 1FDVA 1PWXA 3G2PA 1L4UA 4RFSB 3DOUA 4LEQA 3MINB 3ZJKA 1T0OA 5DK6A 3PC2A 4C7KA 1XLLA 2OEMA 1HE3A 1GQIA 4UM7A 1YR3A 2P1FA 4C7GA 3AP1A 2PKXA 3P9CA 3SMVA 7PTDA 3VDMA 4RIEA 1NOJA 1RPNA 4C30A 1EQCA 1MB0A 4DMCA 1YTEA 4GI4A 4J2PA 3VSAA 4KVAA 4A2QA 3GRYA 4FC7A 5F7XA 2RKOA 4PFJA 4YJ2F 3JWIA 4ZVKA 1ZBCA 3DZ1A 3QLEA 1VI2A 4UR9A 2AR7A 1NNI1 1UA7A 5HCUA 4G86A 3ZJTA 2HWUA 5CJMA 5CX1A 1FWFC 5I7WA 1KRXA 4DYKA 3PFRA 3TLLA 6PFKA 3ZN2A 5F7JA 4A6DA 3GZNA 3RVBA 3AQUA 4OM8A 1UKVY 3QV7A 4MVWA 5CBBA 3PZIA 4RNHA 5AHKA 3RCNA 1TYAE 1PJSA 1JQAA 1K6JA 3SGGA 2IYEA 1TF7A 3W53A 2WJZA 4LAOA 3LF2A 3EZ4A 3S6JA 4BVAA 5ADVA 3TSCA 1DC3A 4MS1B 2AAAA 2TMGA 1PK8A 4M1TA 4RE2A 4AY7A 2ZYIA 3JASA 1AZSC 2Z6UA 1P7PA 3L8DA 4N54A 1U2YA 2FZNA 3BHJA 3HGTA 4JDPA 4BNDB 3QPWA 4DBLE 1P48A 3IVSA 2AQHA 4JOQA 3VSCA 4DNMA 3IA7A 3ZNNA 2AX4A 2JJ2D 3QMSA 2WIJA 3ITVA 4HA4A 3FOBA 4DBEA 3SBOA 2VUHB 4KQCA 3O1JC 2KSQA 1NMXA 3GJ7A 4BASA 4ARZA 1M2NA 1WZMA 4NMLA 3NQAA 1J2RA 2UKDA 5DMNA 1RCXB 4M8SA 1WW2A 4B5XA 3OM8A 3QELB 3O84A 1FMLA 3G0CA 3HB4X 3LLVA 4B3FX 3RSQA 3EFHA 3KFXA 3A26A 3RC7A 2ST1A 1M6VA 3OOYA 5HQJA 3SYMA 2C71A 1EX5A 2ZANA 2B99A 2RGRA 2OVBA 2V54A 5C18A 1GLVA 4ZANA 4JYPA 1W1A1 1MSSA 4JHMA 1R6XA 4OK3A 4Y9TA 3T9EA 1RJQA 3E0XA 1BNCA 2O55A 1HN1A 4FZVA 3MW8A 3PP8A 1JF6A 4PEKA 1RPXA 2Y7FA 3NR2A 4UMEA 1UIMA 4QEEA 5CSYA 3EXHC 3HUEA 5C37A 1RJEA 3EOLA 3K6JA 3AWIA 1G3QA 4XPZA 4RXGA 4I2NA 1SCUB 1S1CA 2QMUA 2NO6A 3KQNA 4BFCA 4FHEA 4R1SA 4EHFA 4TKUB 1Z2NX 4AHQA 5AJTA 1FRVA 1UZAA 1IQ8A 2QZ9A 1SVWA 3IDOA 7AT1A 3VNDA 4LCEA 4ARVA 1GLNA 5ADWA 3QPAA 3EVGA 3ZXYA 2J85A 2FW1A 3BD7A 4HWKA 4IEEA 3VO8A 4E0CA 1S8OA 1OLSA 3QW2A 4BJHA 1M1YB 2I66A 4BBZA 4Q7IA 3CJQA 1MB9A 4X3PA 3WQEA 3DMYA 3L2OB 3FAWA 3HVIA 1YJ8A 5XINA 4AZ5A 4RO0A 2QG6A 4YJFB 3UJRA 3SUSA 4I9NA 2BFBA 2NTJA 1SXJB 3KT3A 4EW6A 2WVVA 4YYEA 3OLXA 3PRYA 2EBNA 3E96A 3I4KA 5F77A 3E5MA 4TWRA 3ZKAA 2GD1O 1YR9A 2CWXA 2HWGA 3GNSA 4DCTA 3DZGA 3GB9A 5L6UA 4ENVA 4A92A 4ZJPA 2J5RA 4XPIA 5KO2A 3K0KA 4GOOD 3EXIA 3H0KA 4MKFA 2C0AA 3M9WA 3HXQA 3FMIA 4DANA 1R6TA 3R5TA 1HFJA 3SSJA 4WERA 8ADHA 1FDWA 3T99A 2AYZA 1L7OA 821PA 3IT3A 5EJ5A 3W1AA 3KHKA 4U10A 3H5VA 5ILGA 4LSGA 2VURA 5EYPB 3RQIA 2A7XA 2W2LD 3FRJA 3U5UA 3DKLA 1AIPA 3ZWPA 3D3WB 1WPQA 1W48A 2FWPA 4KPUA 2YQ4A 1QCDA 1R15A 2J25A 5LZ5A 2YXOA 4BP9A 4FVTA 3G1HA 2IBSA 1M8KA 2QXUA 5D6OA 3E5RA 4CQMA 2DY0A 2PMFA 1TV3A 1QRUA 2ZUDA 2QKFA 2D2FA 4Q7QA 4U9UA 1CYDA 3MZ2A 3OX3A 4GVGA 3LU1A 3OIHA 3GB6A 4Q6JA 3O06A 2DBYA 4MKIA 2XF2A 3KJGA 2JD1A 4H6VA 4RD3A 2F7FA 2OZPA 1A5CA 4EGQA 1ENZA 3EZ6A 4ZVNA 1PWEA 4LHYA 1F8IA 1Q1QA 1D0VA 1UUFA 1M75A 3PGXA 1QC5B 4EY7A 2CNOA 4JH0A 3NL2A 1I45A 3H2SA 4QULA 4PRWA 2ID4A 1L7NA 2GJAA 4YS6A 4R8MA 4P53A 4JOBA 1EDOA 3H99A 3QOFA 4ME6A 2CKRA 2GVLA 4B33A 8A3HA 2ZJ8A 3RRJA 5AXBA 3KEGA 5CIQA 1JIBA 1K7SN 4ONEA 2QT0A 3NDIA 2Q4RA 5E4FA 4JFRA 3O1IC 4HAOA 1Z6YA 4MGHA 4MA4A 1DJYA 4MOZA 3N7TA 3VDBA 3L49A 3ZH2A 4B5VA 2OC9A 1GY8A 4UBIA 3LCLA 1NVXQ 2IUSA 3HZHA 1VBNA 2FN4A 5IFPA 1WV0A 3ZFHA 4Q8OA 3MIIA 2VZVA 3WBFA 2XV1A 5U1PA 1BLIA 4H7DA 1VIAA 3HPFA 4MV9A 2QGNA 2WNIA 3OQ1A 2VHQA 4PYRA 4QG7A 2C2OA 4LXTA 4I5XA 1VB9A 5E38A 1AB6A 3ORRA 3CUFA 4EZIA 2XM2A 3TIMA 3WYZA 2AMJA 2F1RA 1R3SA 2YY5A 2PU7A 3UFBA 4JI1B 3N18A 3CFYA 4BP8A 1O5QA 5F2NA 2WDZA 1H60A 1T8XA 4LKOA 2L42A 1EQUA 4UAVA 5COBA 5A6AA 4X22A 3KE8A 2BFAA 1AQUA 4DLXA 3RYCB 4JS3A 3C4JA 4UNSA 3SZ8A 5K8CA 3DS8A 3LT5A 2XN0A 2V4UA 1JYFA 3QEAZ 2Y4SA 2VC9A 3QVJA 4FYKA 3BH0A 4OYHA 5GGXA 3FS2A 1ULBA 3GW3A 2B7CA 1U1DA 2PEZA 4RTPA 3JAKB 4QG3A 4L2IB 4UMCA 1QUFA 2OU4A 4J0FA 3UG7A 2I22A 5FA5A 5ALMA 3R7NA 1PZHA 1XJBA 2D3LA 4UOZA 2DBZA 1UOEA 4YI5A 1N3BA 3TXZA 5J2UB 3WGKA 3ORWA 3EXHA 3D6JA 4GFSA 1XK6A 3QU4A 3LM3A 3BKXA 4ZVLA 3EG9B 1KI4A 4DBLC 1R50A 3N6HA 1K1EA 4YLYA 4K6HA 3H17A 1L8LA 1A7JA 3L4XA 4E7OA 1MMFA 1A0CA 5CEEA 3UGTA 3RVLA 1DQSA 3JZAA 1G4EA 3KJHA 2PUBA 4TO8A 4ZVPA 2P90A 1ZB5A 1A27A 4LFCB 2H0RA 4BEBA 1Z8FA 4KBFA 3W1VA 1U5JA 4AX4A 1VC4A 3EOUA 1FP2A 4B2PA 1G9XA 5C2CA 2Z9DA 4RKWA 2NV9A 2EW2A 3JYOA 4S2UA 1AH2A 1NSFA 3LLDA 4IPPA 2PLMA 4GO9A 3RR4A 3PNQA 2JIBA 5A03A 2G0AA 3DCNA 3CZKA 4YRZA 3SJUA 5CFQA 1F8UA 3DF9A 9XIAA 5KREA 1V8OA 5E4TA 2CWDA 4PO8A 1I8JA 8RUCA 3DDHA 2GN8A 2E18A 4POAA 3FI9A 3ZU4A 3RVMA 1AMOA 3TLEA 3GK0A 4DIFA 2ALJA 2DT2A 3DR5A 4IQGA 3NNDA 2D2VA 3TLJA 1IQPA 2CLOB 5D03A 2R47A 3S8HA 3F5JA 3QMTA 5D7BA 5FL1A 3P5BA 3IIOA 4LVAA 4B91A 3ALFA 4ZTYA 1H8ED 2QRGA 5JPCA 4DLAA 2FDCA 3JWJA 5CG0A 4BNUA 1GITA 3H4VA 2G07A 4JTIA 1EQAA 1IOWA 4GIEA 5IULC 3S5JA 5HJYA 5CGZA 2ERYA 4IUGA 3GVPA 3W82A 4CR6A 5CLLA 1NYTA 3UJSA 4N7MA 5G1NA 1KEWA 4I6KA 5ALUA 2Q4OA 1NF8A 3DVQX 4QOGA 1C1HA 4KWTA 3MI6A 4B8ZA 2GYVA 1XZPA 1ZAHA 1MO5A 3D02A 3CZAA 4F0KA 1J6OA 2ZIXA 1OY0A 2TMDA 6REQB 2I54A 3GFXA 3VU1A 1DTUA 3NO5A 2AOXA 1MWOA 1KEEA 4RTJA 3ZE6A 2QIIA 4HDRB 1E61A 5BOEA 4XO7A 3OOHA 1WXEA 5FWXA 2FJUB 3HLTA 3NHBA 4DHGA 4I1SA 2WSSD 3JWGA 3KEQA 1MAWA 2QTMA 1P6WA 3IBGA 1S8NA 1O5OA 5CU7A 2FOXA 3TZKA 4EVSA 4KQFA 2WM0A 1R9ZA 1TKAA 1HO3A 1JLKA 2W00A 1V7AA 2H52A 4YCAA 4MR9B 4G0XA 1G66A 5T7BA 4QXQA 3SHOA 2CHQA 1OWMA 1M0SA 2BTEA 5KCMA 2HSWA 1K0FA 1ZH6A 4O5AA 1JN0A 5TPWA 2F3QA 2X2FA 1RT9A 2XPCA 1JDCA 1U7TA 3PHBE 1OV4A 2P0EA 1EDEA 1R74A 1XLVA 1ECBA 2HHAA 2C2HA 2RFLA 4HX2A 3BOLA 1CUJA 2NXGA 3JD1A 3AZQA 4JNMA 1EEPA 3VDRA 2VJXA 4JWTA 4TVKA 1BEEA 5LNK1 4QPZA 3AFGA 4HGYA 1UZDA 1Q84A 2CUTA 4F3KA 2E67A 4Z1AA 1EVIA 3VH4A 4NFSA 1NUAA 1VLIA 1E2DA 3MUEA 1PR2A 4NU8X 2YJQA 4PGGA 2X2PA 4GISA 4KACA 4PAMA 2G0TA 1P6BA 1NNEA 3K8YA 4FYMA 3C6YA 2BP1A 2WMDA 5JD4A 4RMNA 1URPA 3MPOA 3UUGA 4HTBA 5AHNA 1NT2A 4LV8B 4G4JA 3WJ2A 4O0KA 5D1HA 3RV4A 1XNQB 2FWJA 3FDFA 1T5AA 2IYNA 2XWBF 4L8GA 1EI9A 1ZCOA 3PHJA 3PQ8A 3LD5A 4AT1A 4PCNA 1WNTA 1JT2A 1EP3B 3T1YB 1NLUA 1NW7A 4RVDA 4E2BA 1ZIOA 3A9RA 3L77A 1AKWA 1EP1B 5IN5A 2R6JA 4IXDA 5EWJA 4O16A 2AQ8A 1H2EA 4NKRA 3RRZA 1U7PA 4QFBA 2JI9A 1W4LA 4NOMA 4GD3Q 2HSEA 4HUQB 3N76A 2QCDA 4N0DA 3N0WA 4N0QA 3PS7A 4X00A 2PYZA 3HZZA 5AK3A 1JE1A 2WBKA 3VDNB 4B7AA 2AI2A 3UOWA 5EE9A 3IUIA 1CIVA 4DCVA 1L5HB 4X54A 2DV0A 5HUJA 3TW8B 1I2NA 1ZH0A 3D1JA 4EYGA 4JI7B 4B3SB 1X42A 3RM8A 2DT5A 5FOSA 3FM9A 4EX6A 4GZ5A 3CJRA 2CF6A 1NWUA 3OQHA 2WAAA 3HRIA 1JMKC 5K0SA 2WC1A 3ZI4A 1G7SA 1MU0A 3MOIA 4C1NB 4EUEA 4AISA 1KORA 3C8NA 2ODEA 3M34A 1KFLA 4RKYA 1UWUA 2VTEA 5C1OA 3C0LA 1M01A 4WOZA 1SWVA 3A2KA 2YVKA 4DM3A 4MS3A 3QUBA 4HD8A 3X1KA 4J1QA 4D6XA 4HHHA 1CQPA 1ME8A 4XVQA 3ZJ6A 3V00A 2R1PA 1UC4B 3P8JA 1UMCA 4DDMA 3RDPA 2XTNA 2XQVA 1S2LA 3B53X 2PRYA 3EUAA 1CUUA 4LKRA 1FWGC 1Z38A 5DCDA 4BQ2A 2OCGA 3QFHA 1PSZA 4TL7A 5FTMA 4D98A 2RGDA 2QUNA 2CB0A 4QFMA 3W4JA 1W34A 2ASHA 4JYBA 5ABFB 4AF0A 4YMGA 4U9HS 3NAZA 2Q6ZA 1DXEA 1T25A 2WJAA 5E9XA 1QCWA 1ZW6A 3LBOA 4EMTA 3QGMA 3MFQA 4U2GA 2UZAA 1DC6A 1EJTC 4FDAA 2B25A 3P5YA 1DXIA 3RTDA 2IQ0A 3PE3A 4CIXA 1GUDA 5IBCA 4IWXA 5EZSA 3W23A 1R3YA 1DEHA 1RQ2A 1Z16A 2KHZA 2WNQA 9XIMA 1XX6A 3GT4A 3OZYA 4H59A 2CEAA 4GMHA 3ARVA 3V5OA 5FD0A 5AOCA 5BV0A 3BK0A 2R8YA 3G79A 4MW5A 3T6KA 4X0VA 3UCQA 4N9QA 2XUHA 1MXGA 4HNAB 3T9AA 2QCEA 3KOMA 3FDJA 5J47A 1DQYA 3GXIA 4YRBA 1QYIA 4YWHA 4R2LA 4XYLA 2VHYA 1AS3A 1ODKA 3W3ZB 3TYDA 4FGLA 4ARIA 4TYYA 2G6TA 3NKVA 2WV9A 2Q3RA 2Z4GA 4CEJB 2JDID 4L5YA 5K4HA 2FFCA 3QV2A 3GRRA 5FNZA 3OODA 4BNXA 3DL0A 2NVBA 4GVPA 1P0QA 3QYJA 4PRRA 1J8FA 2R6GA 1IBRA 3WQ8A 1QNPA 4IFRA 1FWIC 1FLAA 4G0MA 3UWYA 1A5SB 1D6NA 4M1SA 2D13A 1E7QA 4FAMA 3BZUA 2TSYB 2WF5A 2E3JA 1FXWF 4D79A 1HEUA 3KUUA 3LHZA 2H06A 4QXPA 3LBHA 3EAQA 4GO8A 3VGPA 4LVNA 4QNNA 3TRHA 3U7FB 3C6XA 3E81A 3G89A 3UA3A 1XKQA 1RXSA 3K4WA 3HGSA 4NOLA 3Q1KA 1QZZA 3N0VA 1EINA 4TX9A 4QGHA 2O9OA 4B48A 3HXKA 2ZIWB 3CLRC 4PZZA 3P9ZA 2I5QA 1KBBA 1PEYA 2NQ8A 4QROA 1WSWA 4PRLA 1PBNA 4Y1RA 2IHVA 4MP8A 1TJ1A 4AYXA 4U5IA 3WNBA 4IFOA 1UR3M 4JVOA 3DV0A 3NVTA 2K7ZA 2XMBA 1JBEA 4H8HA 4TWZA 4LF4B 1JUKA 4LWQA 5HR6A 4JZYA 1M3SA 1BEUB 1ORVA 3WELA 4BMPB 3T9PA 4AZCA 3NIFB 2W4MA 5KKCA 2YX1A 4DRYA 4FXPA 4H3SA 5E6RA 3SQOA 2W6JA 1GGJA 1VBMA 4MQBA 2XNSA 4UFIA 2W6QA 1JLMA 4RDHA 2E0PA 2HIHA 1K7XB 5PTDA 2PTZA 3FHOA 5JJIA 3W6OA 3EF3A 4KMMA 4B43A 5AO9A 3BVPA 4PCVA 1IWOA 5E93A 1EP2A 2ZYWX 1WMDA 1G2PA 4M9QA 3PUHA 5L9FA 3R94A 3ZIZA 4IGSA 1E70M 3L8GA 1KFKA 1ZNYA 1S2GA 8ATCA 4C43A 5EUMA 5I3JA 1RQBA 1Z5VA 3DAHA 1G4TA 2WW8A 5E0OA 4KAAA 5CA0A 3IFSA 4FHGA 3BPSA 1SUPA 3FYCA 2DX7A 4UVDA 4ZYUA 3E02A 1ZJAA 3HBMA 2EQBA 3N29A 4JYFA 3RWBA 1RTTA 4FI3F 4DW8A 3P19A 2B30A 1JEZA 4D4IA 5BWAA 5KX5B 2DZUA 4YROA 5E7IA 1AW2A 2QI9F 4YIKA 4P5PA 4OUDB 4C7MA 1UP6A 4EL0A 3ARPA 1QHPA 4JTCA 2AL2B 5T9CE 4ORIA 2P2LA 1Z4MA 2JCSA 3HJAA 5FUXA 5HJLA 3JVVA 3OYZA 3RT1A 5J4KA 4Z51A 1UAYA 4QDMA 3PXXA 1LUCA 4WDWA 5A6KA 2WVHA 1ZHOA 3NIYA 2ZBPA 3L9XA 3MUFA 3ZHSA 3FWPA 3BF7A 3KXQA 1U9CA 4XW2A 2J7DA 3TAOA 2ZT8A 1YEYA 3R9XA 3NUKA 5JAQA 4C76A 4PB5A 3EFOA 3BMOA 3H22A 4ECLA 1Y1QA 2E4XA 1RQGA 1C8XA 4L5ZA 1M2OB 3MMUA 2NU6B 3W2EA 1E7MA 2FIQA 3EQZA 3VQTA 2NQ5A 1UC5A 4URWR 1T0UA 3PYMA 4KS0A 2W92A 2H17A 1NOFA 3K71B 1T9BA 2Y6ZA 4TL9A 3EMDA 1H9BA 5T91A 1ID1A 1RK5A 1M1ZA 5HSGA 4Z2IA 1IQUA 4F4RA 1MOPA 2XB6A 4W84A 4M22A 1TGVA 2JFYA 4C6DA 4BE7B 4TXNA 2WKLA 3TX6A 2YZNA 3AJ9A 4GY7A 2X0IA 2XOXA 2F8MA 1AQJA 2WWDA 2ON6A 3HV9A 1JQKA 4AXNA 3AETA 2YW3A 4YQYA 3BDVA 1NLYA 2D1QA 3D4IA 5BQ5A 2MSNA 2G4FA 2Q62A 1LRQA 1ODZA 3P82A 1S01A 4PIVA 1DQXA 3SCUA 3UYCA 5TT0A 1WYIA 2ATVA 4JQ4A 1DIKA 2G1UA 5K3AA 2ZSBA 3QV1A 1EESA 4LZLA 4EBBA 3M1AA 4HUJA 2R85A 3G68A 2RGLA 4LN1A 4EUSA 2IXAA 1ONRA 4BLUA 3DEYX 1L7MA 3FRIA 3WBEA 5L3QB 4RZ4A 3DEFA 4XZLX 2VQTA 1CHNA 3M0XA 2RJNA 9RUBA 3PD7A 3N2NA 2BONA 4M1RA 3Q85A 3PNLA 3O1LA 1RHUA 2NUYA 3OPYI 2Z25A 3UH0A 3CZCA 1SU8A 3N75A 3NQ41 1DJGA 2HA6A 4MR7A 4M81A 4MPKA 3IP8A 3QUSA 4ZQBA 4L9SA 1DTNA 3UO8B 2P4QA 3OZ7A 2DH2A 3VMOA 2WU3A 4H7CA 3V35A 3JQGA 1ZCZA 2F6UA 1IOVA 2YRXA 2O5EA 3WGZA 4MFDA 5LXTF 1VR6A 1K3UB 3TSAA 3WNZA 5F76A 4LI0A 1GKYA 1Q0RA 5FBLB 3B40A 1PL9A 2Q4EA 5LWQA 2CLMA 3OZVA 2JJ1D 4L64A 3BURA 1VBFA 2PQ2A 4UBKA 3I42A 4PNEA 2C5FA 4HEA1 1EGHA 3DJYA 5C8DA 3QPVA 2SICE 5EJ4A 3DLCA 3O03A 2ZWAA 4NAEB 3R3ZA 3J81k 3BD8A 4DRXB 4PNPA 5LPNA 3PD1A 4LRSA 4MRMA 4GQRA 3BRCA 2A57A 1DQWA 3H5RA 5IOBA 3ECSA 1K2WA 3ML1A 3R4IA 1GDHA 4HDAA 2VJOA 2NX1A 1I3LA 4EVIA 4GR4A 4UMBA 4YUVA 1ZJJA 1BYAA 1PR4A 2VI0A 1WCXA 4L5IA 2QZPA 2X6QA 2D73A 3VNLA 2XQGA 4Y2TA 1W88B 1C3EA 3ID6C 3QOKA 1T2FA 3LSBA 3NA8A 1ISXA 5C7IO 4JJ6A 2WHYA 1XXHB 4NESA 1Q2SA 3OE7A 3RFAA 1UR1A 2ONYA 3QXBA 4HZMA 5IF3A 3GLGE 3B70A 3CUYA 3F9CA 4N9EA 1M1XB 2V3DA 4RFLA 1Z4IA 5GONB 3UJ9A 5EKXA 2WD7A 1U31A 3FE2A 3QMWA 1QOXA 1B42A 3KNZA 4NXSA 3UYIA 1NJGA 4LEFA 3MWEA 2NZWA 4F1WA 3KV1A 3OURA 2GJXB 2P0YA 4Q8PA 3HDHA 4Y96A 3ZZ0A 1BSLA 4J29A 3HUDA 3PNBA 1V39A 2R1NA 1COWA 2PGIA 2W48A 1ONOA 3LIPA 4DM1A 1W8GA 3EKGA 3TEJA 4DF1A 3TK1A 2DQZA 4OA8A 3AR6A 3FPHA 2GAIA 4I9GA 4W7IA 4XIYA 4XFJA 1GKQA 4L9YA 4EHNA 1NASA 3WGNA 2NU7B 1P9LA 4EJ0A 5ALRA 1UEIA 3OPSA 3RUCA 1N2CE 3GOHA 2PZ0A 4L4SA 4HAYA 3WX7A 1O1YA 1Y7TA 4CM6A 4HMOA 4M19A 5HQEA 1GZ6A 2G3NA 3PG9A 2I34A 1ZQ1A 1KF0A 4K6OA 3CEJA 2AA3A 3ZDQA 10MHA 5AKLA 2JIWA 5K05A 1Y3DE 5AI8A 1W5BA 1T2AA 3GLSA 1O6FA 5AM2A 2QRZA 4PPYA 5FTJA 4CR7A 4BDTA 2DSUA 3I1YA 4ZEOA 4JDBA 2YTZA 1JZ2A 1REQB 1W46A 2ALDA 1P2FA 5ALTA 3NQ7A 2QQ5A 2AJLI 4CLDA 5E6YA 1NWTA 4RHTA 1VJSA 5A6MA 1J90A 2CBZA 2WZCA 1QQTA 4QLBA 4RETA 4HFMA 4I14A 5DLEA 5E0KB 3S6OA 3OTGA 3ITOA 3S5YA 2OLHA 4PB3A 2QJRA 1L7VC 4KVFA 3KB2A 1JX6A 4I4TA 1PLKA 4O59O 3OJFA 1BPLB 1ZQ9A 4F45A 1B3YA 5EWMA 3TPCA 1EJBA 1SXJD 1ZM2A 4G1EB 1IBSA 3NJRA 4I50A 3DU0A 1JPVA 3TXAA 1RBYA 1UADA 1I0BA 2I6SA 4UQOA 1RMTA 4H17A 3UMCA 3HC7A 3WLEA 4IP0A 2BH2A 3O3CA 1WXXA 4RULA 1G8HA 1XYZA 1E3TA 3VIGA 2JLCA 5ALHA 1YI0A 1B73A 4YA6A 2M6LA 1MEJA 2H7XA 1JVBA 5HK9A 5I7GA 5DLQC 4YCMA 2LIVA 1S3SA 5CCDA 4TVUA 3W7JA 2CXNA 3Q8KA 1XO1A 1E9IA 4C1LA 3U7VA 5KYXA 4M88A 3S44A 3NDYA 2QPOA 4PZ0A 2QQ6A 4P5DA 5AK0A 4AZ3B 1KTIA 3VZYA 5K9XA 3AR3A 4FFMA 3T9FA 3GFOA 5AUOB 4OP3A 2F43A 2YHIB 4O2BA 3P9PA 4PQRA 3G1AA 2D5CA 4F2UA 5K3SA 3N8KA 3G13A 3I2JA 5HAOA 1E2NA 4PXSA 5AVZA 2JFGA 2PZEA 5AOBA 3GEHA 1XAHA 4FDLA 4C4AA 3OPYB 5ABGA 3LZ6A 5HX7A 3NL3A 4N2YA 2ZRIA 3WLHA 1BOFA 5KSOA 5B80A 3QWIA 3EWAA 4R3NA 3E3AA 3O4RA 5BZAA 3GOQA 1SM4A 3KKMA 1XAJA 2B4GA 4H7HA 2CIPA 1DKMA 1ZAYA 4CM5A 4TRNA 3UOAB 3L66A 4BXOA 2YCKX 1B2YA 3I7RA 4W5JA 1GZ1A 3TA9A 1KYYA 3KVMA 4I1PA 3PAOA 1IZYA 3CBGA 4BMXA 4Z2HA 2ABAA 1RLCL 4G0ZA 1TTQB 2P9HA 4R34A 4BU1A 4GPBA 4LYFA 4DM2A 2OYKA 3SCNA 2PWUA 4ZI3A 4HFNA 2PUHA 5FSEC 2QYSA 1QPBA 2Q5FA 4EB0A 4MNMA 1P3JA 1V3HA 4DJ5X 3E38A 2C5BA 4PH6A 3MHTA 1DWPA 4N9CA 4Y2SA 3EX3A 2PDMA 3EIUA 4ZE4A 5FAXA 4TTJA 4MLZA 1M53A 1PKXA 2YV4A 4E2ZA 3O93A 1Q1NA 2PUWA 1XRPA 3U0VA 3WL5A 2R1VB 3KBOA 2WVAA 3HJCA 3Q45A 1X96A 4E4FA 4K9PA 5ALDA 5LR6A 3LLCA 1Y5WA 3R8HA 4NJOA 3WGQA 1OFBA 3UCDA 1E9CA 3D31A 2HROA 3VPHA 4ZVOA 4ZQOA 2I67A 2DZVA 3O3OB 1FK8A 1ZO8A 5AM0A 1KARA 4JTFA 2PX0A 1Z42A 4NDAA 3NZQA 3GGSA 3B8UA 3PNSA 3RCBA 3NXKA 5CYFA 5AYZA 5FPPA 1RD6A 1PE1A 4X9SA 3CQ9A 4M8IA 4URVR 2J7FA 3QK7A 4K3UA 4X84A 4JKOA 4LF2A 4IXMA 3KAKA 3W88A 5AKHA 1ITQA 3FSEA 1C3LA 3ZZTA 1DZ3A 1KO8A 3OEWA 3PBMA 5K3VA 2RI6A 5JS7A 4MLJA 1AQHA 1OJXA 4CDMA 4HP5A 2XDQB 2W8BA 4HFJA 2ISVA 3OX1A 1TA0A 1FE8A 1ILEA 2HSAA 1M0EA 3L9WA 2XHYA 1JWAB 1C3VA 4KH0A 4F2PA 1UD3A 2ZRHA 3UGRA 4KGLA 1N4DA 3ORYA 4BFXA 4NHVA 2Q71A 4EUFA 4O4LB 2LDXA 4XLLA 4FR0A 2WWRA 1FOEB 3KPVA 1CKEA 2I71A 2QTFA 5K45A 3TQFA 3HFJA 1YRRA 3BJSA 3BA1A 1OFEA 5LC1A 4JIEA 3FAKA 1B4EA 4B44A 4MGZR 3LBAA 3M5YA 2EW1A 3ADOA 1Q5PA 4NV1A 2VCAA 4JN7A 3JAWB 3G2HA 3PUYA 4I3HA 4ZMSA 3TNLA 2G3IA 1UUOA 4LUJA 3TAUA 1BGAA 3B8VA 1YR6A 1FW6A 1TO3A 1LXCA 1W3NA 3BULA 3TN7A 4QAIA 4L9XA 4A6EA 3N2ZB 4JFWA 2DQYA 5IU6A 2QMEA 4N82A 2V7GA 1UWLA 1UXOA 3ARSA 3VO0A 3N12A 5GJCA 4I9MA 2JIRA 4JLKA 2YYYA 1RC1A 1IAVA 5KZDA 3UG6A 2H1CA 4RANA 3GRAA 3IBYA 1E1RD 5FJRA 3K8OE 2PX6A 3SQNA 4RVNA 1I75A 4JGBA 3DLAA 4DJJA 4QU5A 3L2IA 2ZJ6A 2PJDA 4J2MA 3EMBA 4L4XA 4F60A 4WOJA 4CKEB 4BB5A 3W7CA 4U8HA 1ZD3A 1W3TA 3JY6A 2NO5A 3PXEA 2CVHA 1EFPB 4U63A 4DGQA 2AEJA 2C00A 3IE1A 3TD9A 2AUMA 3MMZA 2Y2UA 4RPQA 2W0SA 5ABHA 1BE6A 5A0FA 1TFRA 2VLIA 3M0IA 3ADKA 1F48A 4X45A 3HJEA 1U6JA 2GJLA 1YNPA 3Q2KA 3CAKA 4YYFA 3QFCA 1G4SA 1LOSA 3K6SB 1DC5A 3ONCA 4K68A 3D7SA 3TC6A 4GZ7A 4D6JA 1C91A 3PZNA 4J0QA 1GOTA 5G0TA 1PR3A 2OQYA 4OJTA 4G5XA 1KXJA 3NI2A 4O0QA 4G41A 2G7ZA 1LJUA 3CZLA 3R43A 1TTPA 1TTJA 5D8ZA 4KEMA 3VGJA 3CYVA 1CB7B 3KYJB 3G5UA 1FZQA 1OB2A 1F2DA 4JKIA 2VHUA 4IIUA 2EPLX 3P97A 1K4HA 1SCKA 2NO1A 3D0OA 1NPTO 2AKMA 2ZS9A 3LUPA 1RPKA 5LU8A 3CG4A 2O59A 4NENB 1C8VB 3W87A 3ARRA 3FFAA 1JPUA 1ESDA 2C98A 3ZXSA 4HXFB 3K4AA 3GTHA 3IPCA 5U7SA 2EJTA 3BGWA 2NVWA 2G95A 1ZCFA 3OKAA 1C7FA 2OZ3A 3BORA 1PK7A 2E5CA 4FC6A 1CJSA 4EP1A 2VDWB 2C83A 3RJMA 2I2AA 1Y9ZA 2QNIA 4EXAA 2IHNA 2QJGA 5A5WA 4HEHA 3MWFA 3DCPA 3EEZA 3AS2A 4L0QA 1W5OA 2QL6A 1LJ8A 1V26A 3TI7A 4KHPB 2JGIA 1RAFA 2ADOA 4MUKA 1QATA 3EFBA 3FKQA 5AQEA 2PDKA 2Z3VA 2CFFA 4IFEA 5HFJA 2ANCA 3TTUA 4DT1A 3CK5A 1BYBA 1KJ9A 3U9SA 3MVTA 2QGZA 4MR8B 1G94A 4TLLB 3UK6A 4M0KA 4MMXB 2OWDA 1ECFA 4FN4A 2HU8A 2DERA 1JDJA 2WHEA 5GWXA 3T7KA 5H80A 3B7WA 1IL0A 3FCXA 2OQVA 3KXLA 1XQKA 3H5LA 2NQTA 1U2TA 2WSLA 1MKYA 4EX4A 3DZIA 4LOJA 4ZOCA 3EEBA 1Z69A 1KTBA 3OG9A 1VHJA 1V7PC 5BSGA 1FL9A 3T34A 1O77A 4JSYA 2R6OA 2GA8A 3H9UA 1QFYA 4NH4A 2VYND 1IPEA 1PB0A 2PANA 3DUFA 3G5EA 4REQB 1CS0A 2G4VA 3AVUA 1KDTA 4IP7A 2ATEA 4C0JA 3AR2A 2ZZ4A 4RY9A 2ECFA 2W90A 4YVVA 1E4NA 3N5CA 2GJ4A 5DEIA 2IEDA 1E56A 4QQFA 2XE7A 2GN2A 3QPZA 3B1WA 1BSVA 1RCUA 3M1LA 2A2IA 5T5QA 4LXGA 1TDJA 2RHOA 2XVPA 2FZKA 2NUAA 3QKUA 3MJSA 1Q0SA 2WJEA 5I02A 3L23A 4YMUA 5CA1B 3ZWKA 2GX6A 2P7IA 3QSTA 4CNUA 1SXPA 4WGHA 1IZ7A 3UZUA 3GLGA 1N3LA 4NY1A 3NTYA 1T35A 4M1EA 2FTPA 1XCXA 4XK2A 4D8VA 4PQEA 3P27A 3KZXA 3RMEA 1VLWA 4B6PA 4UTHA 3DDZX 1A3HA 3WIUA 3WDQA 4U7PB 5T41A 3ZY2A 4ZE5A 5SICE 1XWIA 2CBVA 8CGTA 5HM8A 3OLIA 3TOPA 1UMKA 4BAUA 4Y0AA 3QE0A 4IJRA 5H9VA 3H11A 1Q91A 2ODQA 5EBAA 1GOKA 3U6BA 1P1MA 1PZ0A 2X9GA 3X2SA 4JFAA 2H4ZA 4XDGA 2FH5B 2PPLA 3BBPA 1C93A 1K9EA 1D4OA 4L7VA 4FI4A 2DUWA 3VJMA 5HNRA 3GEEA 1ZA2A 3QFSA 5C71A 1XGDA 3HU2A 1NQAO 2VPPA 5TJHA 3GUWA 1JHMA 3CVJA 1GQLA 4D8LA 3TSWA 3I32A 3NNTA 4RVCA 1N2CA 2GESA 5KYKA 1T1EA 2HMSA 3F78A 4TXMA 4C1KA 4UFHA 2R79A 4JK3A 1LI4A 1JJ7A 3ZJVA 4Z9XA 4EM6A 3PF3A 3F4LA 3OA0A 1I4EB 5G2OA 4ZYVA 3VDCA 2V0CA 4MGKR 2VUTA 4HPWA 3HVHA 2Y0BA 621PA 4LAUA 3N05A 1EGVB 5EHZA 4GQBA 3NBMA 1KKOA 3GQBB 3W9UA 2D8MA 2UY2A 1QMGA 3MT1A 1G8KA 1ONBA 4NZPA 1UXHA 1HKUA 4L7ZA 1JDNA 3T1GA 2DH5A 3DAFA 4QIHA 3LV5A 3TZHA 4IMCA 3BGJA 3V9PA 2H63A 3KVNA 3BREA 2A14A 4BVEA 3GV0A 1QP8A 4MEJA 4PG8A 4WN9B 3NNNA 1EDDA 1KM0A 4IFBA 4OGZA 4YUYA 2IGBA 1M73E 3SXJA 1FSSA 3QUTA 5HW0A 1PO9A 4QG6A 4BFAA 1TCAA 3DYBA 1XZNA 4HMNA 1AL7A 3TRIA 3G2QA 4ZCTA 3XISA 3HV8A 4FMBB 1OINA 4X5OA 3S8EA 4WR3A 3NHRA 5L7YA 2I87A 1LK5A 3TTXA 3O75A 1BF6A 4KPFC 5IKOA 3AIUA 4GKJB 3T05A 3Q3HA 5B1EA 3WD4A 4QDUA 3RGGA 1PDZA 3WKBA 1B93A 4U28A 2AFHB 1AM4D 1QU3A 2GWNA 5DWVA 3GDGA 4TUYF 1R6VA 3F4BA 3K70C 2XE4A 1I10A 3IDFA 2HE5A 1SGJA 3NVDA 2Z7KA 1M7XA 1YE4A 3AHYA 2KPOA 1JTFA 4GLOA 2PGOA 4G8JA 5AIAA 1NGSA 1F8YA 2N46A 1E9VA 3IVMA 4A23A 4HH0A 3O9MA 2ZJYA 5BR8B 3VHLB 1TR9A 3GBDA 3S6TA 3HB1A 3G1XA 5IXYA 3WYNA 3PRHA 3A27A 4R5MA 3RASA 1N7JA 1ZU4A 2HA7A 2YUIA 2J0EA 4XGKA 1N5DA 1YSCA 2Q9UA 3V1HA 4J9UE 4O8CA 4LG1A 1R4NA 3JR2A 3A3HA 2QMQA 4H6RA 1NFGA 1P0BA 3O2LA 1W35A 5DYIA 1Y63A 3WSUA 2GYUA 4RAQA 1SU4A 2X14A 3QHQA 4CIAA 1XU4A 5F7OA 3NRJA 1KV8A 1HETA 1FQKA 1YVEI 5CYGA 4NOJA 5AVXA 2WHPB 2A4KA 3KZOA 1TJYA 1HTIA 1E9LA 1O4VA 1KFJA 3CT4A 4V3BA 4YPOA 2O2EA 2OWWA 2VDUE 5BWBA 4AG0A 2AH5A 2MWMA 3ARZA 2SKCA 2ZRQA 1XTUA 1WLYA 4EWLA 5KDDA 4BRSA 1XEXB 3P2JA 4LDZA 5AW0A 1NQWA 3DE6X 3W86A 4DV0B 3IJ7A 4L5CA 1PSWA 3ISIX 2JKYA 6GPBA 1OKKA 2A3BA 1N0UA 1W5SA 2IV2X 4TOQA 3PHIA 3VNRA 1P0MA 4NI8A 2XSZD 3FAZA 3JQRA 4DVGA 5BSEA 2ZC1A 4BU0A 2CXSA 3D0KA 3HCWA 4MVJI 4JEIA 1ENYA 4Z7JA 3AEKA 4C21A 4JKMA 3WK1A 4JI4B 1BC5A 2QJOA 1U5CA 2FGZA 1GR1A 1GFIA 2F6XA 2XOKA 8AT1A 1KMHA 3GLTA 3MBKA 3NYIA 2ZI7A 2PDPA 4E3TA 1N75A 1I3NA 5IVIA 4WXHA 3ONWA 2C31A 3ZW9A 3RN6A 4NZ3A 3JATA 1QPRA 3PGLA 2CHEA 2YS7A 1P33A 1QHZA 5F5NA 1CECA 1EDQA 2C9ZA 1MXHA 1QCYA 3RREA 4D9GA 2AW5A 2ZIUB 3FJ6A 2TYSB 3W84A 2G71A 1AMKA 2CVOA 1O60A 2J3EA 4DUOA 5I3KA 4IOJA 5AYBA 1L6YA 1V5XA 1HWYA 2BGNA 3SF8B 1KVRA 2XUAA 2RBEA 3O9NA 3EW7A 3ANMA 3CB4A 4F6CA 1VE9A 2AGTA 1YOVA 1RWWA 3VBEA 4FR1A 3AKZA 4LY6A 1N1GA 1DJLA 2NXJA 2WW5A 4NZ5A 1SHKA 5AT1A 3MSGA 1V6AA 4Q4JB 3VDGA 4YAGA 4IX9A 2PAAA 3UNDA 2WHMA 1H3FA 2Y05A 5IJ0A 2E5DA 4IGIA 1DQPA 4LEIA 3U26A 3GCWA 2GNOA 1CR6A 4ANFA 3DOIA 5TPZA 4C89A 2NZVG 3QEMB 1RCTE 5I9IA 2E9MA 3LHSA 4YACA 1NUHA 1V3UA 3WQCA 1RNLA 2IV3A 1WPCA 4ZTXA 2H92A 3STEA 4J07A 4RNJA 1TV2A 4TN1A 4DIBA 4ZL1A 4DMMA 3MT8A 3VPSA 1NV9A 2R94A 1P4JA 2QUKA 3HGOA 4NI5A 1UBGA 4G7EA 3OWHA 2GVJA 1M7BA 4HNQA 2F1JA 3BB3A 3JVIA 1QK2A 4MUNA 4RQUA 3R7BA 2OB2A 2V7TA 1QE5A 2E4YA 1Z8AA 4QVIA 2NZJA 4TTIA 4LHZA 3L4VA 5IBXA 1JHOA 1U8EA 2A78A 3Q6MA 2B83A 3WNDA 3E0FA 1CUYA 1JCXA 2ZSHA 3LKBA 4LNYA 4RY8A 2NXCA 5FTNA 4HSEA 2FYTA 4OY3A 3OEHD 1DJWA 4B2YA 3WJYA 3LQGA 4Z8YA 4ZAZA 4DI9A 1ULZA 1VIDA 3R25A 4E30A 1I4TD 2QAJA 5DM0A 3WQOA 2JFQA 1T4DA 1DBVO 1B4KA 1Y48E 1C4KA 4Q4CA 4IL2A 2EJCA 5I3DA 3KEMA 2BI7A 1AV7A 3TUZC 1O0SA 3O8DA 1MA0A 3GIWA 3E82A 4HVCA 4DPMA 2XUGA 4KITB 2XFFA 4QJ3A 5JALA 2LBPA 1IY2A 4CLHA 7MHTA 4BNJA 1RWMA 5DRIA 2VKTA 2VJMA 3DX5A 2J0UA 1ZHAA 1UQUA 2XGSA 4A5OA 2YCBA 2CFIA 3RB8A 2PVPA 1NKVA 3PQCA 2J9GA 3AU2A 1NJSA 4U7GA 3TZBA 3I61A 1Q45A 5H16A 1K9FA 2ILTA 4G97A 3KCQA 1KMNA 3KD2A 3TUJC 2VUIB 4IJQA 1W76A 3SPXA 4MXDA 5BXTA 2AFVA 2GEFA 2DZDA 1IEWA 2PF8A 2NP7A 3LMYA 1GPJA 2YB1A 3OJEA 5JJBA 2F61A 1AS0A 1WABA 2ZUEA 2CLPA 2D0DA 1MXFA 3FMGA 3JD2A 3OMXA 4QASA 4DX3A 1RJRA 2B4QA 3ECQA 5M3BA 1GR0A 1LQUA 4FR2A 4OHQA 1R8LA 3IS4A 3HZRA 3T0IA 4GFIA 5LB2A 2IXDA 3IIZA 3A4LA 3UXDA 1R2QA 5C35A 4GVFA 2JCVA 3ZGNA 3K31A 3H55A 1YZLA 1KZGB 3L5MA 1VFSA 1SWWA 1YDHA 1M2FA 1P1KA 5GOZA 3EGXB 3NHFA 4YRJA 3HBAA 3MD0A 5KZ6A 1PLLA 2UV8A 3U7RA 1MW0A 1BX0A 2C4KA 3KLPX 2HXGA 1I7QB 3V2UA 2QZZA 4KK3A 2C4TA 3DBNA 1WB9A 1OIFA 1ZRSA 4ESEA 1UP3A 1YQTA 2ZA3A 3GGPA 2BE9A 1T2DA 3P9YA 1UL1X 1C1DB 1KGWA 2A4MA 3H3FA 1H2ZA 4P93A 2CY0A 4LFAB 4JT4A 4AHOA 4ZVUA 3EY9A 5H1WA 1ZXXA 3E2MA 5K2ZA 2Q02A 1ISGA 3I12A 4PHGA 2H2WA 3R3HA 3FJYA 1O6IA 3T7VA 1YUNA 2R1MA 1UINA 3W1XA 3WNOA 5CPFA 2FPMA 3IRUA 2E7FA 3U4AA 2FX2A 2EJ1A 4WXMA 1BDBA 2PZFA 4WFIA 3OAAD 4CU6A 5JPDA 1GZJA 1Z8HA 4XZHA 1DOSA 4Y6LA 5B53A 1R9NA 2CETA 1J20A 2BY3A 4E12A 3T4WA 1YADA 4NHEA 1X77A 5A0TA 3W75A 3MHUA 5CZKA 3JZIA 4GA8A 1H7XA 2RSLA 4ZGYA 4AICA 1LWJA 4WUIA 2FPWA 1NI5A 2OG9A 3G7UA 1H3NA 2BDTA 5CD1A 4BQ3A 2UXBB 1EBUA 4JY9A 4LVDA 1B15A 4AL4A 2NLIA 1U2PA 1EUCA 2H5IA 5PGMA 5CBKA 4A0QA 5L6MB 3LENA 4XLZA 4PLHA 2YC4C 2A33A 4PF1A 2GNPA 3KE9A 2FPLA 5DOVA 1WO2A 2A9RA 2PU1A 2PL1A 4H9VA 1OXKB 1TW2A 4DHEA 1C14A 1GNRA 4BNMA 4AMGA 2ZAMA 1YL5A 5KWEA 3W9YA 1DRJA 1R0WA 4RHUA 1OE0A 2VPTA 3W4IA 5HHTA 3AR8A 1C0LA 4FP9A 3TFOA 2IHBA 4BFTA 3QA9A 4H27A 2QBYB 2ZRFA 4GOJA 3H7IA 1VC2A 4LSZA 1OBFO 2AQOA 3NM6B 2JH8A 1EUNA 1IM8A 2P6RA 3F2BA 2MNRA 4IIBA 1EJWC 3DEHA 4XH9B 4M82A 2OUIA 4EO7A 3ZCTA 1HSZA 3C0JA 4W7WA 3TGLA 2ZXEA 1JDUA 4RVGA 1YA4A 3ANYB 3QTGA 5REQB 4A2RA 1V7ZA 4YCOA 4FDUA 4B76A 3TR6A 5KU7A 5GZ1A 1OVDA 3W3OA 3K8MA 1QH0A 3SZ3A 1VLVA 4ECEA 5KOYA 4W5ZA 4YP1A 5J3JA 4XX0A 2ERCA 5J59A 3VR4H 1Z0FA 1QS0B 5AVTA 5SY4A 3UQYS 4PLYA 4X20B 4AP5A 3GM8A 4QJ1A 3U61B 1AJ2A 1H1TA 2HU2A 2XT0A 1L1EA 5RUBA 4PHHA 4XARA 4I1YA 4L0DA 2XUCA 3PENA 1M04A 1TZMA 3CHYA 1FDOA 2ODPA 2INFA 1ZOPA 1AQ0A 4AO7A 4IHJA 3QBUA 2NXWA 2CK3A 4EOUA 3S2UA 1DRUA 1U9IC 2OFPA 3EJ6A 2FFAA 3HJGA 3C2FA 1GQFA 2AXPA 3D6TB 1D0SA 4R9OA 1ADBA 4PSVA 1F06A 4RM3A 3FA3A 1E3WB 1Z48A 3ER9A 4LUTB 3EDKA 4M76B 2VJNA 4EO9A 4FUTA 1C1XA 3B8SA 3INTA 1R38A 1MABB 2OGYA 4LBYA 2ACSA 3IB6A 1LOQA 4PVCA 4BAGA 3PQ6A 1SD1A 2XQKA 4NAFB 4CVNA 4OE7A 5IM4A 3UFXA 3LRPA 3BYZA 2BDQA 3BSFA 1A9TA 1ISIA 2D0OB 3LDHA 5I09A 2BVWA 1XDLA 1I0ZA 2IYQA 4LZOA 3E6AA 2FCAA 5SY6A 3WFLA 4PZLA 2K7FA 2ZIDA 3QBEA 1CGYA 1F05A 2YWXA 2I1LA 3UJEA 3WH6A 4GLEA 3SOPA 2WVJA 4Z7QB 3K0AA 4F9JA 3E7XA 1R88A 2JH9A 4YECA 4F8EA 3IE0A 3CF2A 5KCZA 1CJBA 3M5XA 1SO6A 1L5KA 1J6PA 1OCEA 4ZAGA 1I7DA 3BQ9A 3TQPA 3BJZA 2FA9A 3P74A 3TUUA 3N7UA 1EUDA 4OV6B 2I17A 1EM6A 4TZ0A 5TMDA 1O66A 1R4AA 1GPDG 5E7QA 4ZXFA 1ZIYA 4QX6A 1KFBB 1Q66A 3W8NA 4AJOA 4OQVA 5CURA 1IN6A 1UDCA 2XRFA 1RLIA 4C6HA 5K0BA 2EGGA 3EZXA 1S5MA 1PYDA 2PDQA 2ZA1A 3KSZO 1LTHR 4FHDA 5C80A 3KR9A 3S1LA 3ANXA 5E1QA 3KCLA 2WIFA 1K7FB 4PMUA 3EVNA 3NVAA 3OSUA 4BLOA 2V82A 3ZWBA 5NLLA 4D7AA 1M1UA 4NBSA 1OHHD 1I2DA 5DXJA 4O57A 1EPVA 2VUNA 4BX8A 4D9CA 3RWMB 5HOQA 2I1OA 3OVPA 2QN1A 1BWKA 1OROA 4K88A 3K9CA 4NEQA 1OCQA 1N1DA 4TVOA 3ABQA 1W0MA 1AKUA 1X1SA 3PD0A 4MB2A 1VCNA 3W1LA 1KSHA 3NM3A 2A79A 3UHJA 1DJPA 3NB0A 3AEZA 5D5QA 4LXUA 1U1IA 4CT4B 4RTNA 1JILA 4LAKA 4YMZA 1LF0A 1E7SA 2C4WA 2J6VA 3LVRE 3KK0A 2R60A 1H0SA 1K4GA 1CFJA 3CV6A 3KXIA 1TC1A 5BN4A 3NM1A 2JGYA 2Q3FA 1A49A 4D5EA 4AJIA 4KGJA 2RGWA 2A3NA 4CM4B 4RK6A 1B1AA 5E4YA 3M47A 4JT2A 5CP8A 2YXXA 2BP7A 4RU1A 5EJFA 1F3TA 3U7IA 1P7TB 1TKBA 2CD7A 3CUSA 2YFKA 5FYDA 2FK7A 2QENA 4FMDB 2RHCA 4OHZA 2QTNA 4O08A 2I3AA 4WD3A 4D92A 4NNBA 1Q22A 5D9MA 1EEHA 2JCYA 1W25A 4M0EA 1UKTA 5SZKB 2X15A 4IJUA 2W6ZA 4RZXA 1EGMA 4G25A 2CJWB 2WYIA 5F4WA 4DXKA 3HKDB 3FMVA 4RFVA 3NL6A 1SBNE 4L8YA 4INOA 5TAOA 5I9TA 1K89A 2X8AA 3L0PA 5EGSA 1M74A 1QP7A 1A2OA 1YZYA 3EGDA 4AMZA 5JNWA 4LBWA 3U13A 3BMNA 3CPJB 2WO5A 1LKZA 1UBEA 4EQZA 5HP4A 2I4TA 3LHDA 3HCAA 4DBZA 4QISA 5HA7A 2A4AA 4HN9A 5HM6A 4LBSA 4MSUA 4F9FA 3L1JA 2FF5A 2E87A 3VR2A 1MQ9A 3SJZA 5ED0A 3L92A 3DAPA 2W91A 1JQEA 2AE2A 3EIFA 3SN6A 2ZUUA 1PG0A 5ER6A 1PGPA 2MYTA 4DXXA 3I8XA 4N5DA 4L3VA 2O23A 2PWDA 4L9AA 3ZVKA 3T3NA 4LCQA 4DQWA 4YH1A 1RP9A 4R6WA 1IJEA 1QR7A 1KY2A 4AWUA 1W29A 4XAFA 2Z1NA 4P08A 1ZCAA 1AZ2A 1RRVA 4C91A 1K9VF 4KO4S 1N6NA 4E2WA 4BO3A 4H83A 4Y1GA 1P1RA 3VO9A 5MHBA 3W7GA 1E6WA 2IUEA 4Z2GA 3HUFA 5K6RA 2CLFB 4LVGA 5KAPA 4WJ8A 1NZJA 3KVLA 2VHWA 4AEOA 1VE3A 3NTRA 1OADA 3W2TA 1KDPA 3BAFA 2RH9B 3N04A 2MJLA 3U7EB 4TYMA 1GUFA 2VYVA 2DEPA 2R1LA 4Q1BA 4CIYA 4O4IB 2Y61A 4QE1A 3PQ4A 2WWHA 1OI2A 2WSMA 1U9IA 4EKIA 1FQJA 2H29A 5COQA 2V9DA 2TRSB 2PZAA 4PSDA 3WGUA 4Q8UA 4WA8A 5JNSA 8LDHA 1FVPA 2J13A 1SVKA 1NQVA 4K9KA 1G21B 1PJZA 4E4RA 1I2MA 4MHTA 1GRRA 4WACA 4QNRA 3CPGA 5K4GA 1Q1EA 3QM3A 1R0ZA 3CGGA 4EHHA 5FUMA 1E69A 3H65A 4HIBA 3S9YA 4UCXA 4FDMA 3N0TA 4FKZA 1ZUAX 3PPWA 1XCWA 2ALRA 4EACA 5ANRB 1I3MA 4A21A 1BXZA 2R8ZA 2WABA 3SUTA 3UB3A 5IKXA 1KI2A 2ANBA 1MVOA 1NXPA 1B3VA 1E1QD 2WLZA 2D4HA 1D2GA 4M5PA 1K6AA 1OBHA 2X5NA 1A4UA 1E79D 3TMQA 2FB2A 2OL4A 3CPHA 1W3HA 3O16A 4R2KA 4IH9A 2B1JA 2WZTA 4M46A 4IIJA 3TS1A 4IGNA 4K81B 5JMPA 3IEBA 1E0KA 5HRCA 3VPGA 5L3SA 2IWRA 1IPHA 1XKYA 1KQZA 1KPHA 1MEIA 2I7VA 3PUDA 3QSRA 2H1SA 5D85A 2ZITA 5I9NA 1UKCA 2ENUA 4MADA 5CZSA 4JIHA 2BGUA 4WQMA 3FJOA 4HS4A 1H2BA 3JQBC 3ZLVA 3DOJA 3D3KA 1YJ5A 3LPFA 1JPHA 2WICA 2ZATA 3RLGA 3NHMA 2Q2NA 4G7FA 2DQKA 4PICA 5AQ1A 4EB6B 3RVSA 4D8UA 2HIGA