5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
3ABZA 3WLMA 1X38A 3WLQA 3ZYZA 4ZODA 4GVIA 3WLSA 2X40A 2OXNA 4HZMA 4IIDA 3SQMA 4GYJA 3GS6A 3SQLA 1TR9A 4GYKA 5FJJA 3WLOA 3U48A 1IEQA 1IEWA 3WLTA 4IIFA 3AC0A 1IEXA 4IIGA 4GNVA 5FJIA 1EX1A 3LK6A 3NVDA 4MSSA 3ZZ1A 4G6CA 4IIEA 3WLLA 3WLNA 5JU6A 4ZOEA 4ZOBA 3TEVA 2X41A 4ZOAA 4I8DA 4ZOCA 3WLRA 3WLPA 3WLHA 5BU9A 3WO8A 5IOBA 5C0QA 4YYFA 1X39A 4ZO7A 3RRXA 5BZAA 3UT0A 4GVHA 3BMXA 4I3GA 4ZO9A 3WLKX 1J8VA 4ZO6A 3GSMA 4GVFA 4ZO8A 3U4AA 3WLIA 5G1MA 1Y65A 4IICA 5TF0A 4GVGA 1IEVA 4IIHA 3USZA 1LQ2A 3WLJA 4IIBA 2X42A
chains in the Genus database with same CATH superfamily
3NRJA 4KWVA 4IXNA 1M7PA 3GT7A 1T5IA 3VKFA 1GTL1 3QELB 2VH5R 5IFLA 2BGWA 1GZ6A 5JDCC 5EAIA 3TZLA 2HTFA 3M5DA 5K8VA 4HNUA 2Z6IA 1Y5LA 3DV9A 4QXPA 1XAJA 5LMCA 3UXEA 4O4IF 5E09A 3O84A 2PI6A 1RAKA 2QAGC 4ZRDA 1XDUA 3G0HA 2ZZ4A 2CNNA 1MIHA 5CITA 3KRUA 2OZEA 3RFVA 4LS0A 3SHVA 2WTNA 3TNFA 3KOMA 1J12A 5KTPA 5AI0A 4E46A 2IS1A 5BUZA 3WDKA 2VTBA 3PTLA 3ADBA 4NYIR 4MTCA 1BXNA 1QUFA 4Y9MA 3L2IA 2Q4BA 1PYGA 4UARA 4GI7A 2P3EA 4O2AA 2JFOA 3ZCTA 4BCBA 1JIUA 2PO7A 2XMCA 2G67A 2Y8EA 1CEOA 3QOXA 1KO4A 1VC2A 5TT0A 1TQ8A 2OL4A 4V38A 1IQ0A 4YV1A 1SBNE 5SZKB 1I36A 1SR0A 2X1RA 3TN6A 3BHMA 1A53A 1PZHA 1E1LA 2BOFX 4K9QA 2Z1NA 3L02A 4QYTA 5EIBD 5CPTA 4G8DA 3TFCA 1GL6A 4DZTA 3H5AA 4JB0A 4AY4A 1POXA 1J6PA 3AILA 3DQQA 4D9FA 3N2XA 5A6BA 2FSSA 3ZUGA 5HOQA 4LF8B 1QIGA 4NBVA 4GIBA 2X0HA 2ZSHA 1I2OA 4JTDA 2CNWD 2LRHA 3ABQA 1P4AA 3EX2A 3BURA 1US2A 3JAKA 4OATA 2QW8A 1Y5RA 4RJTA 4A6GA 4BF7A 1VM6A 1N4DA 1TAGA 3QHAA 3H8AA 4XYEA 2X0IA 4XV0A 1I0BA 5C7OO 1M1XB 3OBAA 2QKFA 2VELA 2F8TA 4ND2A 1WSDA 3PM6A 3GVRA 3VD3A 4Y6SA 3BWYA 4UFJA 1QQ6A 2G6BA 2W4QA 4UR8A 2IF2A 4BV9A 2QP3A 1E92A 1ECJA 3RH0A 1ZNNA 3E70C 4KT2A 1Z39A 3ARYA 4C7GA 2G8NA 3NXLA 2CZGA 4MIKA 4HLQB 3LY9A 2GYUA 3DGEC 3INGA 1NF8A 1KRMA 2BP1A 1R16A 3U3KA 4HDNB 2WKLA 3KD2A 4PYJA 5M2QA 1XYZA 3NL6A 4OL0A 3KPUA 2ZI6A 1SM9A 3AR6A 2ZVIA 4WGFA 2IIBA 3PUZA 2YDSA 1GVHA 4AX7A 3RPMA 2NSXA 5HS6A 5B3JA 3MW8A 4PYMA 3B1ZA 3TC3A 5K2ZA 3RLHA 1LH0A 3ABQB 3MTGA 5ABFB 4F7WA 3AF1A 4CL3A 3I1FA 2ODNA 4YCDA 4KXYA 4ZP1A 5J3JA 5CSUA 2AWOA 2QX7A 3KR2A 3VUFA 1WXIA 1BD4A 4KPUA 2WIJA 1JHXA 3VDNB 3ZWTA 3IH5A 2PRHA 3CQJA 3A10A 2A1YA 3EXIA 1TCMA 4J2PA 1GUDA 1FQ0A 4LGVA 5IAKA 1Q7GA 3D4NA 1M72A 3SCRA 3SIXA 3UMGA 1N77A 5L51A 3W01A 1VBRA 1TA3A 3A6DA 1AUQA 4B4UA 1J97A 2OCYC 4OB8A 4BFWA 3FXAA 1Q3TA 4BNYA 3ISIX 4YAEA 5AICA 4IHJA 1EP3B 4UFMA 1GPWA 5AM4A 3B3GA 2ONCA 4IJVA 3T1GA 4DJDD 1PLLA 3E3LA 1KYQA 1TPZA 5IDVA 2FF5A 1PTDA 3LPAA 4ETWA 5FUBA 3AS3A 1YE5A 5HCNA 2I76A 1JB9A 4NOMA 1P9OA 1VGVA 2JBAA 5EE3A 1TIKA 2NADA 3K5WA 1H0RA 4CNNA 2ZRNA 4HHPA 1OV4A 4KIFA 3PWIA 3NTXA 5T9BG 2VDIA 1QXSA 1IMJA 4NV1A 1NLYA 4NZCA 1WU8A 3SVTA 2I9UA 4GXPA 1KBBA 5DYIA 1U9CA 5K0TA 3PGLA 1KR2A 2PUWA 4JJZA 3TR2A 4WZAA 3UY8A 3D6AA 4UW9A 3PX3A 2J3MA 5JLJA 3RCBA 2PF8A 3VU8A 5TQ2A 5LD2C 1UP4A 3CR3C 3NHBA 3LKBA 5D5HA 3I45A 3SJUA 4KSBA 3X1ZA 4ZVRA 3JD2A 3WJ7A 3WEMA 3QFFA 2HVMA 3AKDA 1H0HA 4E03A 3TRKA 1X98A 3CPUA 2JGMA 3L93A 1JMVA 3GFOA 3HDHA 1XGZA 2XCLA 3QWHA 1GYLA 3FFWA 1GQLA 4HWKA 1QO2A 1BFDA 3BO9A 4MB5A 2V8BA 5FTWA 3CZLA 4H7ZA 1YSCA 2MU1A 2VUUA 3CR7A 1JQBA 5C2XA 2WZQA 4WLOA 4I50A 2JA1A 4QBXA 4YQFA 2ZZMA 1XI2A 2WJEA 5KINB 4YRAA 1JR6A 4OO3A 1VI2A 2I1WA 4JYDA 2VP0A 2F43A 1VE9A 4F21A 1RWBA 5F9FA 3PDCA 1GVFA 2X5OA 2YYAA 1HDOA 1R7AA 2E87A 1WPGA 4LHSA 3IV8A 4G5XA 3RBVA 5AOAA 4P34A 1S1RA 1QLJA 2D1ZA 1M7JA 2OZLA 4PPYA 1UD8A 1FNMA 1EFPB 3CWNA 1OH8A 1OX5A 1IY9A 1B8VA 3VPAA 3THRA 4QUEA 3GQBB 2YZ5A 3LUDA 3CKLA 4IYJA 4NZ4A 1M0SA 1G1YA 1TUFA 4JEQA 4Q4DA 1RRPA 5JVDF 1PSDA 4HGNA 3BUVA 1XYVA 1E9FA 5ITZB 2CLEB 2PDGA 2QLBA 5KTSA 4BNKA 3I01M 4QOGA 4IP5A 3QSRA 5E95A 3UHAA 2FW1A 3T9AA 1YJBA 3QYFA 1KB3A 1SQ0A 1N78A 3ITNA 1SBHA 1VF8A 1I9CB 4AMUA 4EI9A 4IKPA 3IFSA 3CH4B 2BJHA 2AZMA 5ES4B 4HOXA 1YS4A 2VJYA 3AKYA 4DYHA 1B0ZA 5LNSA 5DANA 2HDWA 4P8RA 4Q18A 2VDKB 1F4LA 1RFGE 1U0JA 4RE5A 4TTAA 4R7JA 2G04A 4IQJA 4PXAA 4W6QA 3Q0IA 3DOIA 3QJYA 4KJXA 2CKDA 3HKCA 5FACA 2R1PA 3PE4A 2YV1A 3FYHA 4LQLA 1OCEA 4XIIA 4ZOEA 1E6SM 2MCFA 2PH3A 2ZRXA 1OLXA 1AQLA 3W8DA 4LRTB 1W1TA 3UENA 2Q2QA 1TX0A 3EDYA 3THXA 5JC1A 1EDOA 5EI5A 1H51A 2RJNA 2CWWA 1JHDA 3BLFA 4G5HA 5JPCA 5BMWA 2EX4A 2C59A 4LOCA 3OIFA 3SCTA 4U0JA 1KR5A 4QS6A 2C94A 4AZTA 3SXUA 4RV3A 1IPFA 2BP7B 1OGYA 2OFXA 3WWEA 2IUFA 3INRA 1OU4A 3KVLA 3U7BA 5E6ZA 3GKFA 1FBAA 1DADA 2EL7A 2D2FA 4BKRA 3WOHA 4R2LA 2CBVA 4IG2A 3ZDFA 1NHGA 1ISHA 2JLBA 5DNCA 1NR7A 4KVFA 3A9SA 1DJZA 2R6AA 4KPGA 3ZLTA 5AHMA 4L7VA 1I8JA 1J2RA 5I6SA 4OV4A 1M8GA 4JIHA 3SUTA 3WYCA 1YI0A 1DBVO 1ISGA 3QFCA 1BC5A 3AMCA 2PQ0A 1OABA 5BWBA 1XAGA 1A5SA 4WCVA 1MQAA 4POCA 4BVHA 3OCYA 1H9CA 2CDNA 3EXSA 3E3NA 3VJKA 1ZD4A 2WT8A 2F3SA 2H1RA 3WZLA 3ZZNA 1U0GA 1HYQA 4JXXA 3VSBA 4KQMA 4U7DA 1KERA 1GU0A 3REGA 4FFOA 3R94A 5LM3A 2PEZA 2VHTA 5AVYA 3ERPA 2C5GA 1AA1B 4QDOA 4UATA 2ICSA 4JKOA 1PX4A 1GFWA 4KC0A 3NM5A 4UUIA 5A3HA 4OOUA 3UR5A 3ZDEA 5BNIA 3ZJTA 4EXBA 3SPXA 4COOA 1MAVA 5H8WA 1HE3A 4P8UA 1ZCAA 3OO2A 1WEHA 4YT5A 3ZE9A 5HUJA 4US6A 3O2LA 2AC4A 3NG1A 3KJEA 3T8LA 1YOVB 3BAXA 3KCLA 5L53A 1TX4B 3AXXA 2RJGA 4OBXA 4O4JA 3A2KA 3E2RA 3L8GA 2Y8KA 4PL2A 3LY0A 2R4UA 2QIIA 1RUSA 5M3WA 3LECA 5C8DA 5DWVA 2EX1A 1FB5A 1HT3A 3HJZA 1GQ2A 2DHEA 3FFTA 1PR6A 3B38A 1YC5A 2WAXA 3O4JA 3NCTA 4OFBA 3TUIC 4MQUA 5A1JA 3WTBA 3WNOA 2QN2A 3HY6A 3C2RA 2FPYA 4KPFC 3D6FA 4R27A 1JEDA 1BA2A 3JWIA 1MQ8B 3SKXA 2V7GA 3JV7A 1GQNA 4RLFA 1RJRA 3UG6A 2G36A 4IDAA 2ZDSA 1OC6A 5EU9A 3KRBA 2O7RA 5TQ0B 5FJJA 3L8CA 2DWCA 3EG9B 4FLSA 1HL7A 1U8YA 2YASA 2EFCB 1ULZA 2OQYA 1FL9A 3TUUA 1AGRA 1X7XB 1D09A 4B6OA 1VLQA 4MQFB 1V0JA 5LBTA 1RJDA 3WK7A 2BHZA 3ONEA 2KE5A 5BOVA 3VTKA 5BSGA 2RG1A 3MQ4A 4CQBA 2O2GA 3CM4A 4WZ6A 3UATA 2FYTA 1SC4A 4WBNF 1OXVA 2IP4A 2GJ9A 1K8ZB 2PSHA 3M6XA 2ISSD 4B3HA 1PBTA 4MYUA 1DC3A 1JVNA 4GMHA 4Z8YA 2D3WA 3UMFA 3BSWA 1R5YA 3R1IA 3WBKA 2VC7A 3GO2A 5DBOA 4IHKA 1WPXA 2PV0A 3AR5A 4OXXA 2GVZC 2MYUA 3GPCA 3TZQA 1Z6AA 4JLAA 2P9ZA 5BN5A 3LY7A 4HDAA 3RM4A 4IMCA 1FA9A 3KL5A 1X8FA 2DTDA 2YJNA 1SM4A 1AIPA 4AIUA 1HFEL 2E8YA 2QV4A 5KYXB 1QJCA 1ZSVA 1DCMA 1J23A 4FX2A 4MVCA 3EFHA 4NHEA 1RBOB 2Q3MA 1E2NA 4NZOA 1QOPA 4RHYA 1FRFS 4ICIA 4WHMA 4B71A 3IX7A 3U7IA 1KR0A 5EJIA 3M8KA 4K8EA 1NWCA 2ZWYA 5CVTA 4O1BA 1XM3A 2JGDA 1LWJA 4JB2A 3NZRA 4HSGA 1UEXC 4L4PA 2TPSA 2XLBA 1THFD 1SHKA 2XWQA 3GDOA 3ROMA 2J78A 1P7ZA 1ZLPA 3S81A 3JQGA 1UM9A 1X8KA 1TZJA 5LQSA 5M04A 4ZI5A 1E62A 2ZVRA 2UKDA 4AP6A 2RAPA 3F96A 2P67A 3SSAA 1UW9A 5G5IA 4N0QA 2I2DA 2IUSA 3PKZA 2NXWA 1JX6A 5T4BA 4UQPA 2ATCA 2GNPA 1KAMA 2Q5JA 4PRTA 5DSXA 5J5VA 2WKGA 3Q6NA 1JAHA 4Q93A 2CWDA 1IXOA 4ISCA 1QJ4A 2EIHA 2Y99A 1YDFA 5JNLA 5F4ZA 1TZ2A 2IP2A 1OAAA 2BISA 2ZQZA 3WGKA 5DTRA 2CF6A 1U2DA 1NF2A 4WVLA 1EUYA 1IQPA 5SYNA 1TQ6A 2HADA 4DG9A 5GVRA 2HNAA 2R7NA 1KDZA 1VJSA 2EU8A 4RZ3A 4XZIA 2HA7A 1AK9A 5CJMA 1NMYA 2HHCA 3A5VA 4GPIB 1F6KA 1HZZA 2Z98A 1PSZA 4YNBA 4HZ7A 3ZLBA 3O95A 3PPXA 4YJ3F 4QYIB 2P4EA 1RHQA 1W5OA 2PX3A 1QAOA 1SYTA 4OA8A 3JQQA 2YPIA 4TKVB 1JG3A 1RAEA 3S1XA 5I77A 3NBXX 1SOAA 4Z0SA 3E4DA 4QFCA 4IGIA 5TEWA 2IY8A 1R5OA 4GS5A 1FHVA 4YT8A 4B3FX 2EP8A 3MS2A 1GNVA 1H8HA 5HQ3B 2DR3A 2PVPA 2A57A 1UD5A 2AC7A 3OZCA 4G1BA 1SCUB 2P9JA 4B6EA 3MJYA 2IU0A 3OZFA 2VRWA 2CLLB 1S2LA 2UY4A 4P4UA 5F1YA 3LHSA 1NU5A 1SKUA 2ZWMA 1LWOA 1UDRA 1Z33A 3N2ZB 3I09A 3UZ5A 5AHIA 2XUCA 1SK9A 3ITGA 2Y77A 1T9CA 5K0GA 2DT3A 2CEAA 2NQ5A 5BYAA 2WHRA 4EUKA 2O5VA 5F5LA 5FBZA 1Q20A 1T2UA 1HKHA 1AGNA 2B8WA 1XALA 2GQ0A 3REQB 1M1YA 4F6LA 4TV8F 4G5YA 4LV4A 1U11A 2NP7A 3HCNA 4KITB 1HDXA 3W2GA 4DKJA 3CUTA 2VFIA 2E4WA 3RIEA 2WMGA 2VP2A 3HXMA 3QFTA 4KOAA 2JH3A 4HG2A 4KXFB 2BOEX 1Z7AA 1RWVA 1S8OA 3PDUA 5G4EA 5JBDA 4O17A 3F2DA 2R7KA 3MG9A 1B23P 4HDMA 4PCTA 3ZHSA 3M5PA 3RSZA 1O95D 1C0PA 3W8FA 3G59A 5TXGA 1FWAC 2AHRA 3NQ7A 1XRRA 2EBFX 2R8RA 5BWAA 1W9VA 4DA7A 5CM8B 1VL0A 4E2DA 4P33A 2GN0A 4KIJA 2PUVA 3L0SA 5ALRA 2ZRJA 3VC2A 4ZE5A 1R8QA 1RPJA 1Y4SA 2BZSA 3VFDA 3WB2A 3YASA 3H2HA 5ADHA 4NZPA 4PMDA 2WWFA 3UCFA 5IT4A 3EODA 1D5WA 4J29A 5I24A 2W5UA 3LT0A 4NONA 3BDVA 5C9WA 3TXVA 2QXWA 1QRTA 4BATA 5HDRA 2OOKA 2OCBA 3VKCA 3ZBPA 2MWMA 5K09A 5CVDA 4E14A 3UWWA 3LNTA 2POQX 3WD4A 4EYEA 3PEUA 3HUTA 4UPVA 3UERA 5BSVA 3TE9A 5ED0A 3ORWA 3SBOA 4UNPA 1MIOB 3R10A 2E18A 2I3ZA 1DTNA 1Q7TA 1NXQA 2OZKA 3MSDA 3FLMA 4NBLA 3TLXA 3AF2A 2D1TA 2ZUWA 2OEPA 4ZI7F 3KKOA 3H4IA 2V0GA 4HAWA 3GXIA 2ID9A 2D1QA 2C77A 4ES6A 4DPQA 3ITVA 3MQTA 1GUVA 3K8ZA 3LCLA 4RL4A 5AVRA 2QTVB 3OZWA 2EF0A 1L4EA 4IDFA 2CHOA 1IRXA 3VH3A 2QMKA 3G2IA 1BJKA 5A69A 3IR6A 3UT5B 1P1JA 1PZMA 3E5HA 3TL2A 3NNTA 4ERIA 1JXOA 3SCWA 3B9NA 2E6KA 2W62A 3JVVA 4PODA 3SFVA 3WDQA 2WQPA 4AY8A 1BSLA 3I3EA 1RHJA 4O29A 2QWXA 5KOJA 3EGVA 4LEFA 3K20A 3N2CA 4CD7A 1PFWA 1DU4A 1J0JA 3GXDA 3MLEA 5C8YF 1GGEA 5AKZA 3OCZA 3OKAA 2XDQB 3TXAA 1G3QA 1IU9A 5LBIA 1JDVA 1PBNA 4C2AA 3LHVA 3FGPA 3I2JA 3WNNA 3NO3A 2CMFA 1TIMA 4M22A 4ZFCA 4Y2WA 4Q1AA 3KSUA 4TTPA 2IPFA 1EDGA 1ZMBA 3FSTA 5GGXA 1KC3A 1B9ZA 2V5UA 4DNQA 3CUKA 1H8HD 4XQCA 1EM8A 3G23A 3HYRA 4F2WA 2YXEA 2HRDA 2C4TA 3O9NA 2WZCA 2YBEA 4FC6A 3T38A 4XZHA 1M76A 2DT0A 5CR9A 1XZJA 3AUJA 4PR4A 2IH4A 4YV0A 1DDIA 3CWQA 3UJEA 2W2NA 3BBLA 3G0OA 5ARCA 4Q8QA 4W88A 2YHIA 1KKOA 1PZEA 2QCLA 3A2MA 2DEUA 4QBGB 5FHQA 4AXNA 1W4ZA 1HE1C 2IEBA 4YP1A 2HHHB 1OCBA 2HJWA 4KIGA 3IBCA 3SSZA 2H8GA 3U3HA 5DK6A 3MKVA 1VIDA 3V97A 3TA9A 4GUIA 4DUXA 3R58A 1H4TA 4FHCA 3L4JA 3ZVNA 1F8GA 2C29D 5A8NA 2WK2A 1UMLA 1RCTE 4EB6B 5C70A 2PWEA 1EK5A 1G4UR 3TLEA 2IK8A 2FLWA 2XB4A 1ZUNA 1FP9A 3NOQA 3I1YA 4MX8A 1LU9A 2HLDA 3OY7A 3R8FA 1SBTA 2WD9A 2B0CA 1K3FA 1QPGA 4BTEA 3M0VA 2NTEA 3IP8A 1E3WB 8MHTA 2FFHA 4PMOA 2HQBA 4Z6KA 4L7QA 3DLHA 3CASA 5HIIA 5FV4A 1MTZA 1TVMA 5F5NA 4H8UA 4FR2A 2DH2A 2XRFA 4NKRA 3Q7EA 2O2YA 4LUSB 4WZAE 2WWDA 3ZWQA 1H2JA 2A92A 4MP6A 5LP6B 1V79A 3LGAA 5FQNA 4UDOA 3AIQA 1KFEB 3O4RA 2QYHA 2OA0A 4GRDA 4YCJA 3LBCA 1TZMA 3ICJA 1WMFA 3E2MA 1UUOA 1Z7WA 1RI4A 1XMOB 3Q3EA 3IIKA 5I7SA 2QGYA 4XD2A 4S3MA 1Y1PA 2QW0X 2G4JA 3KKPA 1MJFA 1RWQA 1JDEA 4DB7A 4XEHA 1PZ1A 3DHUA 1T0HB 2V7VA 3Q0EA 4DJFD 4L6DA 121PA 1Y80A 3SS7X 1WTCA 4URUR 4AZCB 1ST3A 2B4TO 3WVNA 4LFCB 2XB6A 2GL5A 3WNDA 2I91A 5FHRA 4RNHA 3TSMA 4FSDA 5E8RA 4ID9A 5FULA 3LERA 2A7NA 2QN9A 5E0KA 3Q94A 3DEYX 1ZB5A 1AG1O 1U2SA 1V1JA 3VINA 2WD7A 1TVKA 5KU1A 3S2CA 3LDGA 2IZ5A 4JT8A 3PRKE 2ORVA 4NICA 4G2TA 2CUNA 4HMPA 3QK7A 1TG7A 4B5SA 1CUSA 1CUJA 2XMRA 3GZTB 2VSQA 1C9KA 1HGYA 3UYCA 1RAAA 4C3UA 5KNCA 1OJLA 3RS4A 3AYVA 2YQ5A 3F9IA 4EEKA 3PF8A 5BW8A 4HAZA 4WMLA 1O54A 4HJWA 1T8QA 2F48A 3ROTA 2CJFA 2PGXA 2JAWA 1L8XA 1CUWA 2WVGA 4Q9DA 3QEJA 4FONA 1QYVA 1Q92A 4ALLA 1BGGA 3HH8A 2ROQA 4ZAVA 3ZWAA 2UUCB 1N1EA 1P77A 5DU2A 1XTIA 3TR0A 3UKDA 1VL5A 1YFLA 5K51A 3LGXA 5L4LA 2J74A 3OPSA 4LYQA 2UYGA 3QKRB 1TK9A 5EJMA 1KZ7B 2H9AB 3PL1A 4O0ZA 4RVGA 3CVJA 1DPGA 1J5SA 5KTOA 4ZEVA 4QAIA 4YFVA 1BKSA 1XPOA 3EZ6A 4LJSA 4D2IA 1NQ6A 4JCLA 1Q7BA 4FP9A 4BNDA 2ZRHA 3K9CA 2GWHA 4UXHA 3NHKA 4G97A 3M49A 4H9VA 1HQDA 5KYUB 3WQRA 3ZDZB 3OOJA 3OE7A 3WLTA 3ARWA 4HS9A 1T6BY 2CMDA 2FZMA 2PEVA 3M0YA 4C30A 3S44A 4Y30A 4PLCA 2DPHA 4A4AA 2Q49A 3ROFA 3TTUA 3LQKA 2QL6A 4IF4A 3H2YA 1V3JA 4KERA 1RPAA 1RPTA 4MUHA 2F43B 4HGRA 2DT2A 2P8SA 1Z83A 2EG5A 1XP3A 1FDTA 2ZX6A 2IEDA 5A6TC 3R5TA 3PXXA 3UD6A 2P0IA 1IZZA 3RV4A 5IKMA 1OILA 4AW9A 2NX9A 2KS6A 1PIWA 5AD1A 1GSOA 5THKA 4MHBA 4H2HA 2WNZA 3EDJA 1M5WA 1R1DA 3PNYA 4AFNA 4QVKA 3THAA 1W36C 3Q8XB 4B15A 1PZNA 2XGOA 1E0AA 3N7UA 4FS9A 1V3VA 5HF9A 4P86A 1WDQA 1KSJA 2JVKA 4QQRA 4KR3A 3I6ZA 5AVWA 2AOUA 4PIVA 5LXTF 1OFGA 4FYMA 2YW9A 2QRMA 4YPJA 3EWAA 1U02A 1GUFA 3JQAA 3HVJA 2C4KA 4H8NA 2V0TA 2ZIDA 3K1GA 1KH2A 3JATB 3EUAA 2WEKA 1XYFA 2PN1A 3VC5A 5F7UA 1QR7A 3WLMA 1XLGA 1UK6A 2CDCA 2HK9A 2D8AA 1ZMOA 5HQMA 3SRFA 2QG6A 4WSOA 3IPCA 1SIOA 3GHRA 3SIZA 4Q4HA 4IGHA 2CLLA 4DBSA 4Y9DA 2FE4A 1KD0A 4YRTA 3CPHA 4PSCA 2JCVA 1Y3CE 3AV0B 2FZKA 2ZAGA 2AKAB 4A16A 3NQMA 3H4GA 2R84A 5DNUA 3LWNA 2C5SA 4MVJP 5JJ5A 5IASA 1EGVA 4WJ8A 2ZU0C 1I6WA 1RTKA 3ZX4A 5K4GA 5F9MA 5I3HA 1NC1A 2PD5A 2DQWA 4XM0A 4MCAA 3BA6A 4J16C 4CWAA 3DOCA 1D1SA 1T2EA 6AT1A 4EWLA 3RWOA 3LVFO 1QDEA 1OI2A 2OLKA 1TSIA 2PAFA 3AHJA 5DX7A 2XMDA 3PWKA 4NY2A 5DWQA 2B82A 3T7DA 3DZGA 1U04A 5B58T 3R0ZA 3ZWWA 4O1MA 3VIIA 2E2WA 4J0KA 2WV9A 2VRCA 5EE5B 2PKYX 3GFYA 3W23A 2OGWA 2W83A 1E77A 4BVEA 5CP8A 2X0SA 2RK3A 4MYSA 3DUFA 4N02A 3BJFA 3DM5A 5D33A 3BD6A 2HWXA 3DMTA 2H17A 1VPVA 3FPLA 2H6EA 1V2HE 3M9LA 3MSCA 3L9XA 2C7GA 3HZ3A 4YV2A 4C7MA 2FGJA 2IDJA 3QV6A 5EJ9A 2ZJ5A 1JIJA 1FFDA 1KEVA 1GQKA 3HC7A 3C3KA 1BG9A 3VC3A 5CNKA 3M1AA 3QF4A 4DRXB 1G4SA 4TL7A 3RRXA 1EHCA 4MUJA 4MV0A 5I79A 5EE9A 4TV9F 3T7KA 1U8AA 4UUNA 1SXGA 2IZ0A 1LI7A 2HA4A 1Z6TA 4JHXA 1KQOA 4OAOA 4K9RA 3T1NA 3VYRB 2JAQA 4ACYA 3P81A 3CZ8A 4LHVA 5CEJA 5D9MA 4WKGA 3HO6A 3E9YA 4C5AA 1UFVA 2HYIC 3IERA 3DL0A 4I9MA 4BU0A 3KR0A 1EBFA 4DSTA 1IXYA 1GDTA 4DBLC 3L2LA 4E8DA 1JYSA 5FLEX 5DGIA 3T08A 3R2GA 5M2FX 4W8AA 1WG8A 4HDSB 4KDRA 2GEDA 1RLDA 2BDUA 1LOLA 4L1GA 1R3VA 3VU9A 1HYBA 2IF0A 2AEJA 4QA9A 1N2HA 3HXTA 2F7FA 3QV2A 1Q3HA 4QJ5A 5KWSA 5AVQA 2A9JA 3AMVA 1XPJA 4N6EA 4LAMA 3WB0A 3AI2A 3F90A 1T24A 4PYLA 5AJHA 3ZR5A 3LM8A 1O03A 5IHXA 3G77A 1BA3A 5DE3A 3RV3A 3QV8A 2GUWA 4PAOA 5DXXA 1I5RA 4C9BA 3SCSA 2OSBA 4US5A 1R8YA 4HV4A 3WIOA 4L15A 1E3JA 3L4EA 3GT3A 3IDSA 4LSMA 2CZ5A 3VV3A 4KODA 3KB1A 3TXXA 2JIDA 1JJVA 3T1OA 1K5PA 2QYTA 3AZQA 2F2KA 2OQVA 1ILEA 2WVUA 4C0QC 1Q6ZA 3HU3A 1K3TA 3II6X 2AXEA 1ODSA 2R11A 1NXOA 2GD0A 3HYLA 3GUWA 3FWHA 2D73A 4MB4A 4FJ2A 3IAM6 3V1NA 1DQYA 4Y7DA 1EP2A 3QPBA 3W7GA 1PUIA 5LNUA 4UQBA 4W9RA 1RJFA 4IZ6A 2WUFA 3JZDA 1M1NA 5DT9A 4O4LB 1DE0A 3LB0A 2Q2WA 1JEEA 1E4IA 4JC4A 4IHAA 1KS9A 1AB5A 1X6NA 4N9BA 3NXKA 2WHPB 4F0SA 2QMQA 1ZR4A 3OLIA 1ECFA 1RHRA 3KPJA 3R3ZA 4UJ5A 1PU2A 4DQUA 1J2YA 3QTBA 4KFCA 4WXRA 3ZXSA 3ABRA 1KOJA 3DEIA 3VYTB 2GHRA 4OHPA 4E2BA 5CLFA 1KZHA 1GK8A 1IV8A 4PGFA 1BROA 1RP8A 1HNZB 3N12A 3K9WA 1KZ1A 3HZZA 1ISMA 2QSYA 2VZOA 2VF4X 1F5ZA 3M46A 4LAFA 3H21A 5FFFA 3NZPA 5DHAA 3WRYC 1C1XA 4P7RA 4YJFB 2IZ1A 4BJHA 1CQWA 1BAGA 2ZBFA 4QNWA 3AJXA 1UOZA 2YFYA 4PY2A 4DWWA 3VA8A 2I5IA 3ZY5A 3DX5A 1A5BA 4J2HA 4UTZA 3NW9A 1BMDA 3ROKA 3TVTA 4XTRA 1OXUA 4E7PA 3B03A 2CMKA 4NBKA 5DHQA 5SYMA 3ADDA 1TPYA 1FZQA 4KXQA 4J90A 3CHDA 3CUHA 4GBJA 4QBHA 1YDWA 1LDBA 1QQ7A 2QORA 1GOXA 3D0QA 3C52A 4XLTA 3FSEA 1JFHA 1BXRB 1YRAA 1KCXA 4WSJA 1DBIA 3GCGA 2TSYB 2XYLA 2DHQA 3OCVA 4HEHA 5JFTA 1RU3A 4IZOA 4GPAA 4XVEA 4OH7A 1JNDA 4HUJA 4NOKA 2JFEX 4IW3B 3F6SA 3VOTA 4I08A 1WKYA 3L21A 3TTYA 2NO4A 4C05A 2YNMA 1JF5A 1H6DA 3VK5A 3K70C 4A8IA 3IV6A 3O4IA 3W2UA 2YZ7A 1H4PA 3G1TA 3RF6A 3EGCA 1N7JA 5JTTA 3SVLA 5HSGA 4H01A 1NVFA 1Y3HA 1BMQA 4IXHA 3WIJA 1KO8A 1EXDA 2DH6A 3C6MA 1RLIA 4M51A 2QU7A 2XN1A 4RS4A 1YTEA 3GWGA 2FJUA 1EFRA 3DEZA 4RA6B 5G1OA 3FR8A 2QUHA 2BL4A 3HFSA 1R3WA 3GNSA 5D2VA 2NXGA 1MX5A 4K8RB 3SUSA 4EY5A 2J3KA 5J2UB 1N8TA 3LO8A 2D1SA 4UBNA 1NVAA 5HM8A 4U33A 1CUIA 5HZGA 4LRSA 1NNUA 4X8LA 4HT3B 1XLIA 3V16A 3DZKA 1NP3A 2KJQA 2YYSA 3R1ZA 4PA8A 2A1TR 3A7DA 3ICPA 2JGJA 5H4GA 3ITYA 1WMEA 1YCFA 4Q19A 2YXBA 4IJKA 2VQFB 2R68A 2A14A 3GG9A 3V3KA 1E51A 5DLYA 4FYJA 4C4TA 2FP4A 2QRVB 1A3XA 1N7HA 3W2FA 1TRDA 2BM9A 3OJLA 3U4MA 5CFLA 3ZNPA 1A3CA 1BE0A 3KOOA 3NEVA 3ADKA 1LRKA 3A4YA 2ISCA 1YRYE 4L80A 4ZC8A 1VSUA 5H7XA 3CEAA 2PDHA 1L2QA 2VAPA 2HS6A 1I0IA 3RX3A 3S2GA 1FP4A 5EGRA 2WKRA 3G8EA 1XF9A 3KAOA 1TKBA 5BROA 4D4GA 4W7WA 2WU1A 1GT6A 3KHSA 1AL8A 4S35A 2ZJ2A 5EUMA 4JR1A 2WKWA 1ZY9A 2D13A 1PV4A 1FQKA 2JNWA 2VURA 3ASVA 4AJ9A 1U90A 4D5EA 5JD4A 4OHBA 4BWGA 1SZGA 1K8RA 3B8SA 3ZOZA 3TYZA 1NFRA 1LPPA 2PKRA 2BY3A 5IM4A 1TQHA 4Z3KA 1DC7A 1ZUNB 2HZ7A 3L92A 3N87A 4BKQA 4O1CA 1ZUHA 4YMZA 3DDMA 1JHQA 2PGLA 1E5TA 4Z9AA 3GFBA 2A7RA 3WK3A 4XVUA 2C82A 4BNLA 2V63A 1R74A 1S0UA 3ZY3A 1QCYA 2XWPA 1EDEA 1PR1A 3STTA 1JAEA 3KHDA 2E85A 1II8B 1KVRA 3GUUA 4NXNB 2HT6A 3DBHA 4IOJA 4A2QA 1KU6A 1PKXA 1RI1A 4MP3A 4NNJA 1XLLA 7REQB 2ZJFA 1ENZA 4DBLE 4IZHA 2XZTA 2H08A 3E2SA 2QTTA 3U7QB 4TTVA 2GHQA 3ZGYA 4AU0A 4OU4A 3AJ9A 3HXKA 5JSZB 2EEZA 1IR2A 3BMNB 2RH8A 3R89A 1SXHA 3N53A 1G0NA 4OLHA 3CMGA 4F0MA 4FX6M 3E49A 5DT2A 1OG6A 3QTTA 3AR7A 4YMVA 4XASA 1KLZA 4TTTS 1G64A 3R20A 3HBJA 1V1RB 2HTMA 4PVDA 4I9GA 3G9QA 1VPYA 5CFNA 1R0ZA 2VJMB 2ONYA 2Q3JA 3FY4A 4M56A 1ITCA 1W85A 1MMFA 2PRSA 4DQKA 1JNYA 1GQSA 2X7WA 1WUHS 2C5EA 3O9MA 1OWOA 1UQYA 1QLWA 5L3QB 1H1YA 3B8DA 1YFKA 2VA8A 2H7CA 3UHFA 1C9WA 2FGBA 4FN4A 2FSVC 3WRXA 2QTBA 4C7JA 3Q58A 3AO0A 1U0RA 2GTPA 3LUCA 1TAHA 1ZJ6A 2C54A 4EBFA 2OLAA 1I2NA 4M80A 5B1HA 1NMEA 1T96A 2OWXA 4LZPA 1T0IA 2GKOA 2OILA 4RJEA 8ABPA 4CN4A 1KWKA 1SVLA 3GIPA 1Y9EA 2PSDA 1MX1A 1ITQA 4EFMA 4XDZA 1F0PA 4GR5A 4G1KA 4M1ZA 1CLKA 4GUFA 3KL4A 3LT1A 3R0QA 4G0WA 2QZ4A 3QWIA 4FDMA 3FZQA 1FP8A 2ZC8A 3HWWA 3DFTA 4O14A 5GJBA 5KOIA 4H7PA 4E0BA 2E9MA 3Q5EA 5FWAA 5KQRA 1UBLS 3M1YA 3SMQA 3SDBA 1KQPA 2X41A 3C0JA 1DVRA 4NK5A 3VTAA 2NWRA 2PX6A 3OVPA 3CX8A 3P94A 4FR6A 4PC2A 3GJXC 4RMJA 1SKYE 1UZ4A 3KQTA 3LMYA 3LHDA 2O2IA 3DKRA 3FHQA 3ZXYA 2BXZA 4B4FA 3WLEA 2ZETA 4FB7A 2FR0A 4PMJA 1XRTA 3QNMA 4J1QA 3O2SB 5BT9A 1Z2AA 3ZH9B 2QUMA 4YIWA 2A35A 1QH1A 2ONJA 5BSEA 4Q47A 1OH6A 5EJ7A 3F2CA 2XXAA 3DZ8A 1ZQ1A 5JZ9A 4LGYA 3WBBA 1MVNA 4PRKA 2OWWA 4P92A 5AVVA 1O77A 8CGTA 3WH8A 1XJ0A 3T1HB 3MBDA 5INTA 5JQWA 1MOQA 4PEKA 2IOHA 3L12A 1JT2A 2HUPA 3DW1X 3SU8A 3FOEC 1UP3A 4QPNA 2QMOA 4EHAA 3LCGA 2WDPA 4ABTA 2HCJB 5BSRA 1C41A 1X1NA 1U3VA 4EACA 2DERA 5DLQC 5IZ4A 1QIIA 3USBA 5GJPA 2OCKA 4MRNA 2GH1A 1M7XA 2Q2VA 3HHPA 2YA0A 1OLSA 3PUGA 2MDTA 3K6SA 4Y6RA 4JQ2A 1KXZA 4IPJA 3D8UA 1MA3A 3CG0A 3MDWA 3W25A 1YMQA 4FFBA 3OJOA 3FZYA 4HEA6 5FKYA 3F3YA 1PG0A 4CDRA 4P3NA 1T5HX 1ONWA 3JW7A 3PCXA 3BGVA 2GXQA 3W7KA 4WGGA 1V51A 2GCIA 1QI2A 4D3FA 1KI8A 1OVMA 5JOQA 1P8AA 4OVXA 1J93A 4PSUA 3I52A 3UAXA 2IOFA 1V25A 2W00A 1O94A 1UBMS 2CNBA 2IPOA 3A4VA 2HL6A 2I1OA 3VPSA 2J62A 4HDKB 5B2FA 4PYOA 1MZPA 3HBNA 5LNVA 3O7UA 2ZLBA 1ULUA 2FK8A 1VKZA 4JNZA 1MXFA 4CCSA 2GMWA 4S3BA 1N6IA 2REQA 3SFWA 2Q62A 1KQYA 1DJHA 4W8BA 5AQ1A 4U63A 3DBLA 1DTWB 3QU2A 4H0CA 4Z4QA 3BMOA 3UPBA 1R3SA 2IGBA 4RNIA 2G4VA 5BMVF 1KAGA 2RGEA 3NMUF 3I64A 3NIWA 3QEOA 4P9NA 4CN6A 3E05A 1QG2A 3M6VA 1UJ6A 4RV9A 2JJMA 4F46A 1V02E 4D81A 1ZRNA 1WUFA 1XLBA 1M0TA 3WS7A 2VC9A 3KQPA 1EM8B 1L5ZA 4MTLA 1UPAA 1X77A 3DFNA 4AVFA 2RBEA 2FJPA 1G0CA 5C7VA 4P7NA 3RNDA 5BWOA 3QPCA 5J4HA 3VPXA 5DTMA 4L1WA 4A3QA 4GSLA 3HJEA 5I7AA 3R0VA 3L4YA 1R9GA 3ENLA 1MR3F 3ZU4A 2KBEA 1JPVA 3NAVA 4OKSA 4XJSA 4DLSA 2Q09A 2CV0A 5F23A 1NXWA 2ZSKA 1F3XA 6LDHA 3SCZA 4RQAA 1FFRA 3KOFA 1S5NA 3GZ3A 4KXWA 3LQGA 2AMFA 3H2ZA 3JQ8B 3BJZA 1XF1A 1S1CA 3W0KA 4JYZA 4Y8FA 4TLCA 1CT9A 4B7ZA 1J1ZA 2ZAYA 4JVOA 1KK3A 2SCUA 5IAJA 5CYFA 1XCJA 3BAWA 3FR7A 3G2QA 5B58C 1AB6A 1G7VA 1EIBA 1OIWA 3DXFA 3JVIA 4O5AA 3N74A 4EJ6A 3ZVLA 4IQEA 1UWQA 3CF2A 5IKOA 1WVMA 2VJNA 1Z6QA 3ZM8A 4ZALA 1W3TA 2I03A 3OD5A 4PX9A 2GFTA 3VKKA 1U3FA 4KQIA 1ZLXA 4W82A 1O7JA 2WG1A 4M9SA 5FWXA 4BRZA 5MN6A 3H8VA 3KL2A 2Z2AA 1UJQA 3PE6A 1OX6A 4URIA 3LZDA 3L0DA 1ZGDA 2IU3A 4F9JA 2ZIUB 1K6MA 1PL0A 2NO6A 1MIOA 3QJ5A 1P61B 3GZJA 2R8OA 4AKTA 4MYTA 4BQNA 4KJZA 2BKVA 3VVLA 2DUUA 3ATZA 1NURA 2WZMA 1ZI6A 3RYHA 5JNWA 1BGXT 4BKOA 1DXIA 5K99A 1G7SA 3N28A 1NQ5A 1IHXA 1U1DA 2BKUA 4EW1A 3GR7A 1S3GA 3QVGA 2VUNA 3T4XA 1KSHA 1R3QA 2O7QA 1XIIA 3OU8A 1U7ZA 1XXHE 3J7AC 4XX0A 1FHUA 1M2WA 4C4ZA 3NXFA 2CJYA 3IGSA 4FGUA 4UXDA 3MAGA 2QN6A 4TS3A 2F3PA 1IY0A 2UZ1A 3TTOA 3T2OA 3Q7TA 3V2UA 1CW2B 4J6FA 3B53X 2XG9A 1NJFA 2H1IA 2WB5A 3LUTA 2MJLA 2H5LA 3KDAA 2OBLA 1IWBA 2RG7A 3KQWA 4FEYA 3AISA 1NP2A 1OLSB 3HR8A 2E3ZA 3BL3A 1K7XB 2DECA 2OBBA 2JATA 2ACVA 5BN3B 4GM0A 2WI8A 3DL2A 3TYCA 2WZDA 3I1IA 3JS3A 3BIOA 4X8MA 4S12A 4B3MB 2IPGA 3AEQA 4BVLA 2FPIA 3F1LA 4DVJA 4GG9A 3TSAA 4DZIA 3FETA 1OYOA 3M47A 3OEED 4ZT7A 1XCWA 1LI5A 4QCEA 4K40A 5FLYA 1QW9A 3ZK7A 1WY5A 1X8JA 4QE5A 2FXIA 4AC9A 3IP7A 4TXHA 5HWSA 5FI8A 5AC4A 1NJGA 1A9QA 5CK4A 3VKJA 3JYOA 1QTQA 5DN6D 3ZT6A 5L3QA 4RE0A 3H9QA 3F5LA 1G59A 2WHYA 2GETA 4F4FA 1FTWA 1ZRQA 2VD8A 3ND7A 5IG2A 4Y96A 4C4RA 2QLJA 4J4HA 3X2EA 2B31A 5DSTA 4YDQA 4RKQA 1P0CA 4U4AA 1T3ZA 5KNBD 4JOCA 3FVMA 3VYSB 5IMBA 1QO0A 3B12A 2Y4SA 1ULTA 2QMEA 3JQDA 3WHPA 3KAPA 2FKPA 5M17A 2QDEA 2H9AA 3GYEA 2QLTA 1JPHA 1IUOA 3AI1A 4WK6A 2WYSA 3QLLA 1T8TA 1U8XX 4S39A 4LNUB 4WBSA 4D9KA 2OFWA 2XNJA 5E2AA 3QH4A 4GOND 5BQ5A 4YPFA 5U4NA 2FW6A 4ZYTA 2IZZA 2I16A 2ICAA 4MR8A 1HXJA 4C6KA 2G1UA 1G5IA 4CTKA 3VR1A 4AMGA 4C1BA 3BQNB 5G0VA 1W54A 1J8VA 1NSTA 2PWBA 4Z9XA 3IEIA 2XKAA 2DR2A 4Q7IA 1KC7A 1ZAKA 5BVHA 1TUEA 3SADA 1EZ2A 1A4IA 3Q15C 1K8ZA 3CXOA 2ZI4A 5B3AA 1Y8BA 2VPPA 3LHFA 2P2GA 1MGOA 4A6PA 4P4GA 5A2QA 2FWJA 1NFGA 2NUXA 5IBXA 2C4NA 3O38A 3N9RA 4WESB 1F05A 3HA5A 5E5CA 1DE5A 3LTPA 3NOVA 2TECE 1E6ZA 3RGGA 2DHCA 2UUPA 3AIIA 3QLTA 3U6BA 2BOGX 2PUTA 3IP6A 5LQNA 4HPHA 2CL0X 5JRDS 3V1MA 5IDQA 1NH6A 2LGJA 5I0DA 4Z2LA 2PBRA 3KU4A 1GA1A 1JXMA 4U2KA 5L9AA 1IVSA 3M9XA 4E08A 2TAAA 3TZEA 4GMGA 4DLXA 2FMFA 1BRLB 3PWGA 1LFAA 1LJ8A 3SUWA 4DADA 2PE4A 3ILHA 3FTDA 1BE8A 2IUEA 3QE9Y 4QX4A 2O55A 1P4CA 2PBGA 3ITEA 4FKZA 4GG1A 5D4YA 1LF0A 5CLWA 4GUJA 3SFKA 1COWD 4E4PA 5IBXC 2Z6AA 2H00A 3D2AA 1DIAA 4FOTA 4MJZA 3DS8A 4BK9A 2FSGA 2GM4A 4BTVA 1XROA 2C9YA 3AM4A 4QOSA 4DDMA 5IDZA 3MMXA 3GAZA 2WMIB 2JBMA 5I6DA 2FW9A 1AKMA 1LLFA 2CVHA 1M2EA 1WQ1R 3V1TC 3LX9A 2WNNA 2G8ZA 5DISB 2PVSA 1O08A 3W7DA 3NHMA 2FTWA 1NSFA 3TAUA 2DX7A 5TDHA 4A73A 3BK0A 5IHPA 3PTKA 1OLXB 5E9XA 3GOHA 2XYHA 3DYIA 5K3BA 2XJ9A 4D96A 2NT3A 1T4CB 3VABA 3O0DA 1OFEA 1UG6A 3CEJA 4BMCA 4LVGA 4BBJA 4YCPA 4S2EA 2A1IA 4MR9B 1R9YA 5JVLA 4EG5A 4YROA 5JNRA 3N0XA 2F90A 3RFFA 5EIEA 1U0FA 3WSUA 2NU7B 4WQ6A 2Y0FA 3EWDA 3G2NA 4UU8A 2RDWA 2BM8A 5ALKA 3DEFA 1P91A 3BH6A 2DY1A 4B4HA 4AJEA 5LKAA 1LWHA 6A3HA 5JC8A 1W9PA 1H5QA 4H83A 2YX1A 1K6IA 2IXUA 1Z0DA 4MB1A 3UJ8A 1NJ8A 3WBWA 1ZO8A 3CYFA 1DJLA 3CT6A 1NN0A 1KOGA 4EG6A 4GL2A 3C43A 4Q8VA 2HM7A 1XZMA 5KBYA 1H23A 2CY0A 3OEWA 2YC4C 3DWGA 3O8OB 4RXGA 4B45A 3NC1C 4NAUA 1LS1A 2NU8A 4ND1A 4JUIA 4HSHA 2E40A 3A4XA 3K0FB 1V0LA 2J7HA 2JZCA 3D4IA 1D6MA 4DA4A 2FYMA 2DZPA 2BY0A 2PP1A 5CAEB 4A2PA 3AEXA 3A21A 2JGRA 2QTRA 5GTDA 1KRXA 3V8RA 1VR6A 3KLKA 1EQ2A 1E0VA 4G1CA 5ABEA 4NARA 4WE3A 3CUXA 4OQQA 2YQZA 5IARA 1FWCC 1NF9A 2BFBA 2WR8A 2RGGA 4YH1A 4ZT3A 3BWWA 4RK0A 3SR0A 3OHPA 2OR3A 1SB9A 3HDTA 2Q3LA 3PQ5A 3LV6A 5AHFA 1GFIA 3PQ3A 1XJCA 4RW5A 4QLJA 3EXRA 4DOMA 1RAHA 5ALPA 3GVWA 1P8JA 3UUGA 4OT7A 3IP5A 2DZSA 4G23A 4NNBA 5FF9A 4PEVA 2DUAA 3RYIB 3TONA 1O6ZA 4O53A 1XLWA 1ZDMA 4B8ZA 2AG0A 1DUSA 4WOPA 3DB1A 3MTIA 3RS7A 2DVUA 2H1SA 4M7RA 1XZNA 3R13A 1NI5A 1XXXA 1ZL2A 4DPLA 4TSRA 2PXAA 1O0SA 4LDZA 2XSZD 4GQBA 3RSQA 3E0LA 1ZJJA 5LP6F 3N05A 2BYTA 4INAA 1UKAA 1Y1KE 1GDHA 5DNVA 5KYNA 2XVMA 3AZPA 3PIIA 1CKEA 3F9RA 5ESRA 4PHCA 4MJ3A 1F8UA 4MUNA 2W2OA 3UGJA 2BFMA 5SY4A 4G8JA 1V3HA 5B4UA 1G8HA 1ZNQO 5LZ2A 1ZXBA 3G7NA 4N7QA 4N8DA 3HFTA 3W1VA 4AJ2A 3S0CA 5FESA 2UXCB 4G5QA 1NAIA 2CXOA 2EHJA 1OCJA 4HLCA 3NGFA 1S7CA 2WUWE 4KXUA 4KRZA 2CIPA 3T8QA 1DUIA 3QW3A 4ZV4A 3OTIA 4PHHA 4KMOA 3QWAA 3HV2A 4ADUA 4L0DA 1I6KA 2W6JD 1WP4A 4DAEA 4CGYA 3HMCA 1O8BA 5KQGA 3R3VA 4D1YA 4LMPA 3DOHA 3RO6A 2GAFA 1Q0HA 2WPNA 3PR3A 1R86A 4E5DA 2VDMB 5AI6A 3M7SA 1ZIDA 1K3UB 4EVZA 4CKWB 1FFYA 4O4HA 1YQQA 3QBUA 4HPJA 2NM0A 1ZJ5A 3KJHA 3MC5A 2ODQA 1J6UA 3COZA 5KEZA 3LPOA 1PJBA 1EEPA 3MCUA 2II6A 4OQLA 1YR1A 2J85A 3MI2A 4KBGA 3U9SA 4EP8C 3F3MA 5ETJA 1XRSA 3TQIA 4JLOA 4DA6A 2ZDQA 3L0OA 1G8JA 2AJDA 4IEIA 4MR7A 5MGNA 4HMNA 4C0JA 2DJIA 4IRXA 2HK8A 4PUDA 4NI5A 1WIWA 4ZPXA 2Z1KA 2V65A 4EUFA 6ALDA 3EGDB 1H69A 3FFBA 3W1QA 4KWTA 2QT3A 2WWVD 2UZAA 4H41A 4QLKA 4M8LA 2ZFAA 5CPOA 2ZWVA 1EHIA 4CEIA 2OHGA 4ZQNA 1OJXA 1KAOA 3EAUA 4TLEA 4K2AA 2UUAB 1J11A 2R60A 2A5GA 4A0GA 4AHPA 3A0RB 4U9IS 4HXFB 1E18A 2F67A 4I6KA 4OAPA 2P2DA 5FV7A 3EK2A 4F4CA 1N9KA 1DAFA 1KZ6A 1ITZA 4JY8A 2W8BB 1XWIA 3BULA 4EB0A 3NBUA 3U19A 3TP4A 1F9AA 5D37A 5HX7A 3A3PA 3U3MA 4UOEA 3I53A 1PFYA 1ODTC 1L0BA 2DFKB 3L1IA 3TB4A 4KUHA 1CUYA 3IBTA 5A4DA 2Z2BA 1SVWA 1LJLA 2Q5CA 4HYTA 1ADGA 4BO0A 2HLHA 4I99A 2OFOA 4D8AA 3IURA 1ESZA 1UWUA 5LFAA 3J80A 4KB5A 2C3YA 2ZJ7A 4ICNA 3I92A 3SHTA 4AXXA 2QPTA 5DV9A 3PNVA 1Z34A 3UBMA 3KZXA 2QTWB 4AZGA 3I76A 3MJTA 4ALNA 4F40A 2RGNC 1FC0A 4LTSA 4RETA 3I6QA 2GVJA 3H0EA 3GGGA 1WF3A 4AQLA 2WFAA 4ML3A 2BZ1A 4WESA 3HZOA 4Q9IA 4GX1A 1TU3A 3LTNC 2FEPA 3NQ6A 3DL4A 4E2FA 1QNOA 4K9LA 1EDBA 3WDPP 3RYSA 3B36A 3T7JA 4D7AA 4PGHA 3UWOA 4GQ0A 4MW2A 2FQWA 3UG7A 1NIUA 1SCBA 3A4IA 1RHCA 2BSQA 2FN4A 4CCCA 1NF3A 1HX7A 1N2JA 4TRNA 4G1NA 1CZUA 5EVCA 3GD7A 5BSTA 3PQ7A 2C7BA 1C9EA 1ETHA 4GPD1 2D2HA 4EM6A 3VDCA 2FF7A 1R38A 4CF5A 4M1SA 4Z7OB 3BMVA 3LQRA 1WPCA 2C71A 1FWRA 2BGNE 3L2OB 3WNZA 1JFXA 4A9AA 4WEVX 5EERA 4P7OA 2I22A 2JD2A 1KE1A 4W93A 1RBYA 2W6JA 4CKBA 2VR4A 4B73A 3R0IA 2BNJA 4H3VA 4BU1A 4CQMB 2ODOA 5LYRA 3P9RA 1ISWA 3HNOA 1VSTA 2X4IA 4W8OA 4C7DA 4UTPA 3L0NA 2H1LA 3PTAA 5DM70 4JV5B 1IEXA 3MUCA 1PIIA 1GTMA 4G0NA 3CLWA 2VHYA 5L45A 3B3JA 1DCKA 1UR3M 1G5TA 2O05A 4H1WA 1H50A 1S2MA 3ZJUA 1RRGA 4AZCA 4Z2KA 1RYHA 3CJRA 2GN1A 4U6SA 3EPLA 4KGZA 3TYDA 5BW6A 4PSVA 4YLWA 1YVDA 1Z9BA 2WOJA 2P0EA 4Q4KA 4L5JA 2Z95A 3ZXIA 4ER3A 4R83A 4QQKA 3ONNA 2OPBA 2NT1A 1MRZA 1A0DA 1ESWA 1XDMA 3NC4A 2AG8A 4GHWA 1Q83A 1FP2A 5K20A 3LM7A 3FMIA 3CRRA 3RIYA 5JLAA 1SULA 1WSAA 3WL1A 1NZDA 2FB2A 3W5JA 3B82A 1A2KC 2GRJA 4YN3A 4Z7JA 1U3WA 2H7XA 2XRYA 5I3DA 2CUTA 1H6BA 1NUAA 1QKIA 3CZQA 1V8OA 1PGPA 3EZLA 3CTTA 3WWZA 2IE0A 3DDWA 5EEGA 4G7FA 1TV3A 2UZ1B 2H29A 4WDRA 3DR5A 3DC0A 1LBTA 2RHOA 4HHMA 1AU9A 4DLPA 3D7NA 3LPGA 4CD5A 4CUZA 1AHHA 1VYRA 2X1MA 1M67A 5EP4A 2COEA 3B5EA 1Z15A 2EERA 1BIFA 3LCJA 1W47A 4XSMA 3RYCA 2YFKA 1SUWA 4BLRA 2ZI3A 3QFSA 1JSCA 4TYQA 4LJAA 3TCKA 3JD1A 3ETLA 5FJIA 3RFUA 4YJ5A 4I6GA 1VHQA 2D2VA 4CCAA 4IJBA 1OW3B 3PZRA 2FY8A 4Q8TA 2IOQA 1U7OA 3EC1A 3IQWA 4MGEA 2X1IA 3ZZMA 3MTAA 4Z53A 5MKGB 4RCZA 1G8PA 1VKNA 5ALSA 4F9TA 1PDOA 4WXPA 5FUXA 4DRSA 3T9BA 1AO0A 5A2AA 4HSNA 4YTUA 4QKQA 1ZCZA 5EMLA 2EZUA 1QP4A 1K4YA 4UHBA 1HQYE 5A2CA 1HC7A 2KZHA 1QX3A 4QRIA 3R4VA 1BEZA 4AYWA 2W7TA 1GN9A 4PUJA 3QU4A 2GOYA 3VIMA 4JJ8A 4O63O 3JD4A 3BHJA 5FAGA 4ZDKA 4GMFA 3NEYA 1ZK2A 1RNLA 4MXDA 4ZT6A 2AEMA 4AX6A 3VKVA 5BQ3A 3PY2A 3R24A 2GVDC 4DAIA 1FCBA 4QREA 5J5CA 2AYYA 3DNPA 1QGUA 2OD2A 2EYQA 2DCMA 1NQKA 1X19A 2JVJA 1EZWA 2JGIA 1TF2A 4LRWA 3H6KA 1NZFA 1R6XA 2CCRA 5BN4B 2WHMA 3IKLA 4OP3A 4XA8A 1KWGA 2XE4A 1NBHA 3TI9A 2VNSA 2FSIA 3VIJA 3DV0B 1E3ZA 1R0RE 3NX4A 3IPLA 1BGAA 4BYMA 1R9XA 4DLTA 2Y2WA 2MMGA 1K9DA 1XZAA 2YXDA 1JA0A 2ZBRA 3QVQA 3KOWA 1KGUA 3UU0A 3IA2A 4DLLA 3NDRA 1EK1A 5A3JA 3FOZA 1Z0SA 3FAXA 5DBFA 3EA3A 3IOMA 4GCAA 2VJLA 3OA5A 5COAA 3W7BA 5FX2A 1LYXA 3K0BA 2I56A 1UBGA 2YHBA 1JSZA 1AW2A 3NHYA 2J4FA 3UQNA 3BOFA 1ENUA 4B3SB 2J66A 1W3IA 3N17A 2I7CA 4HU4A 1JV2B 3U13A 1JAKA 2V55B 1LRQA 4ZZ1A 4JP8A 2VZEA 1OV6A 5BXTA 3VU0A 1D3GA 3SCQA 4CI9A 5DP1A 3T95A 3ZQKA 5LP1A 2X4LA 4TN1A 3B9QA 1QHHA 1QPOA 3WQFA 1CSEE 4QUAA 1K1EA 4YRNA 3RJ9A 2HXTA 1G1MA 4NEHB 1FP7A 4FLOA 3U37A 4H17A 1ZXLA 1RXVA 4C78A 4ZVPA 2ZSJA 3OZTA 1U31A 4RV5A 1JYFA 1WOMA 2E6YA 2BWJA 4D6PA 5JS1A 4LB3A 2X3FA 1KGDA 2MNRA 1UFOA 1G17A 1A5NC 4YI3A 3T3MB 3MINA 3PU6A 3H4TA 1R3TA 3S4TA 3HJFA 1E79A 4KHPB 1C5KA 2WD8A 5BN3A 3THYA 4MA5A 5BO5A 2LR0A 1PCXA 5FBQB 3EXG1 2GWRA 2ZJ8A 3G0GA 3CX7A 3BJRA 4YVXA 2PH1A 1BGVA 1EF2A 1AFSA 2XV1A 4U4MA 3AYZB 3E5MA 4B3RB 2X8LA 2GM5A 1RP1A 3FIJA 5DBIA 4OBWA 4QUDA 1IHOA 3JY6A 4P32A 2JLYA 3J81A 3C3AA 1P1FA 1P9NA 2DFAA 2VYFA 3FDFA 1OZHA 4A8HA 3ZYZA 2CB9A 3VR6D 1D0VA 1I2MA 1JHYA 4BR1A 4X71A 2VNAA 3VX4A 3KYDA 3R41A 5HIJA 3VZRA 5F2OA 2A88A 1XWFA 2HXUA 4J7RA 1TKCA 2DP4E 3DEQA 1QYIA 1AK1A 3DQZA 3UAWA 2GGEA 4QROA 4TUFA 5IAAA 1PBGA 4YWHA 1VHTA 2I3BA 3TEFA 3HZRA 1W6UA 4QUGA 3AHEA 2OZ3A 4PRRA 4PCFA 3QSYA 2R8YA 1ONRA 1PX2A 1ZOLA 1EBHA 2RARA 2JLXA 1ESNA 5BRBA 4AFYA 3ER8A 1K9TA 4CD4A 2Z8ZA 1Q3NA 1DB3A 1H42A 1LSOA 3TFQA 1O1YA 2O8FB 4D97A 3HBMA 2ZG6A 5FWYB 1Z7BA 3FTEA 2IUTA 4MFDA 5AKJA 3SZUA 1R6BX 1H8EA 3BZUA 2JIOA 3OFNA 3R6LA 1M6VA 3QR0A 3ZU6A 4TTIA 1ZMXA 1E9RA 1CUHA 1YRQA 1UAGA 2PCQA 4KYIB 4E32A 3BLEA 4YQZA 3AYSA 3HPXA 3HN3A 1S2OA 4PINA 3QITA 1PR9A 2P65A 4HTAA 3ISJA 5LCXA 3E5PA 1AJZA 3EXFA 4WX2A 1DZIA 1QHFA 1EQPA 3LNMA 4X0VA 2C1XA 5FF7A 1EIWA 1JEQA 1SXJA 5KHOC 1QG0A 3TCEA 3AR2A 2F00A 3DA8A 2MSDB 1XIFA 1AGYA 2VTBB 1J8DA 4FYWA 1VFNA 4NG5A 2HU5A 3O6AA 2H54A 2NT0A 1KFKB 2F61A 2WBGA 2PL9A 4QGFA 3QI2A 1WV2A 4RF2A 1G9HA 2P9TA 2A5LA 3G2OA 5KMYA 3Q72A 3SQSA 4Z2GA 5TGZA 2Y4NA 2ZRZA 4HN8A 3UR7A 4KWUA 3PT9A 3N19B 3PYXA 5B7ZA 4JIQA 4Q15A 1WR8A 3NKFA 2IQIA 2Q9UA 3NHJA 4HOZA 4D99A 2V6JA 1LLUA 5BWLA 1NXPA 3TBFA 5THXA 5FLXA 1MU0A 5F3RA 4YJ3B 4RY0A 1CTQA 4RVHA 3OZYA 1EJWC 2P78A 4ZB5A 3GW0A 4BN5A 4A21A 2BE7A 4RPCA 2R751 4G4IA 1PZGA 2H9YA 1P39A 3JAKB 4LRQA 3V8VA 1PLKA 3A9TA 2IXVA 1P2BA 3FMOB 1ZX1A 5LIUX 2XCOA 4C14A 1U0EA 1TL7C 3U09A 1KIAA 1YH3A 3P2MA 5L6MB 5DGTA 3NKLA 4QGGA 1J0IA 2JE8A 4L3WA 2IUZA 5ALGA 2CNWA 4HLUC 5EZYF 2HHJA 1D8WA 1HNNA 2FPOA 3V7YA 3TNDA 2NV0A 2VXBA 5D2TA 5D6OA 2QE6A 3EDQA 2V7XA 4JBYA 1I33A 1JQ3A 3DM9B 2Q5LA 3ID6C 1CB7B 4NIRA 1QU2A 5TJ9A 3UV7A 3LBIA 3GF4A 3FAWA 4D79A 3CB2A 5K01A 5CDGA 3P9XA 3JWHA 4RX1A 4D6FA 4BBZA 5CB6A 1PIFA 2AE2A 1D2NA 4L27A 3XISA 1WZLA 4AVOA 3PZIA 3OQIB 1L2UA 4M8IA 2XBLA 2OAP1 5EE1A 4B0OA 2WJFA 4DO4A 1JMYA 1TT7A 3REQA 1TJ0A 1CXFA 1QONA 3B5JA 5CA0F 2XNDD 3ARUA 3NO4A 3VMNA 4L6OA 4LTDA 4JYCA 3O3NB 4Q9KA 3X1MA 4NLLA 4DQVA 2VCCA 1MT3A 1XC4A 3VM5A 4HK7A 5IDYA 1KXJA 2AFVA 1A96A 4OUKX 2AQKA 2YY6A 4XISA 3KNZA 3R09A 2HT1A 4YACA 4EJMA 1XIEA 3IIPA 5KJ6A 4LFAB 1JNEA 2ORIA 4L56A 1OFAA 2PGWA 4MA0A 2BSAA 2VSFA 3RX4A 1T8RA 1TO6A 5T3YA 1OVDA 1E6EA 3G7SA 4KR2A 4E30A 3KZ1E 3DE7X 1K86A 4BQFA 5E93A 2A86A 1JR3E 3C6QA 3UG8A 3HB7A 3QLVC 3E8XA 1J5EB 5G1MA 3E82A 2WNWA 4JTCA 4X6YA 4ZMSA 4BWVA 4IDPA 1YIOA 3CZRA 2YCLB 3STGA 3WIDA 3ZIAD 4EMBA 3GD5A 3EVAA 1VLMA 2ADFA 4MUEA 5LXTB 1NMSA 3IAPA 2CNOA 3VZZA 1K70A 1F6WA 4CLHA 2AFRA 5AKEA 5ALMA 5JSUA 4G0XA 2GBGA 5HK8A 4HDCA 4LCJA 3FGCA 4U2FA 4DRXA 2GPBA 1C1DA 4TKLA 2G50A 3OP4A 3DE3X 1Z8DA 4DT1B 1WHSB 1B2LA 4G6ZA 1ZH4A 1ZD8A 4Y2SA 3WYBA 1GRQA 2OLEA 2Q3HA 2EXOA 3S6DA 4X64B 3BZBA 3P52A 3BCFA 2NUAB 4EP1A 2C9MA 2FSUA 5T64A 1KO1A 1UEJA 1SZNA 3PUIA 2HA3A 5D5PA 3N75A 1YBMA 2WHJA 5E9WA 1LTDA 3E0FA 1BVUA 1CR1A 3VNAA 3P45A 4OB6A 2RUSA 1Q21A 1LV7A 1YDGA 4Y6GB 4TMTA 1JPKA 4H77A 3QM3A 4HQRA 4KEUA 2QRQA 3NUGA 3KXIA 3OBEA 4QDTA 4KEMA 4YP5A 3MKKA 3AHIA 4IMJB 5CTAA 4BZZA 421PA 3OZAA 4A0HA 4M53A 4RXUA 3NJ3A 4XB2A 4MS3B 5E1DA 2BCGY 1GHSA 2QYOA 1E2PA 1Q44A 3KSRA 3WZ2A 4XUGA 2VYVA 3O7MA 1FWWA 2GILA 1IB0A 1UHVA 3F6PA 2BDQA 1R4ZA 2JIWA 3ETNA 5CRIA 3NHZA 3HGMA 1ZENA 1P7CA 1U0TA 2J48A 3WELA 1VJGA 1E55A 4FIRA 1SJ9A 3VVMA 3VNLA 5JQGA 4HQLA 3ETDA 1P0MA 4JI3B 3ZZ0A 2QNIA 1Q6DA 5TEVA 4FOSA 3WGQA 2IPJA 1TREA 1NOUA 4BFXA 2Q2OA 4EL5A 3UBPC 1AJ0A 3D6JA 3CWZA 5JHHB 4HDKA 3A31A 4LXIA 2FH6A 4BBPA 5A7GA 3HSSA 4RCXA 3WDIA 4DLVA 1K8CA 1DXQA 5C4GB 2CB0A 1NYTA 2G95A 4DY4A 4Q16A 2WB4A 5C7LO 1XRMA 1YKFA 1GVRA 3PGKA 3TLQA 4PS1A 3WYFA 1D6JA 2X0JA 5K3VA 3WLIA 1NAHA 4ENVA 4C7BA 3ZCVA 1A5OC 4HVXA 1PVOA 1XJBA 3NWBA 1PV1A 2G4FA 3TFWA 1RCUA 3SN4A 2Z1VA 1S1PA 3CW9A 3ZUPA 1IR1A 4EB6A 1J25A 2B99A 5HWJA 5C9RA 4ZVVA 1H6CA 5SWUA 2XUIA 4G25A 6REQA 2DULA 4LC9A 4F2DA 3MJFA 4PBGA 3HY3A 4CD6A 2PQ2A 5JADA 2IWHA 1YNYA 2CNDA 2OTDA 4W4QA 2GPJA 2L42A 4XD7A 3UY4A 1JPDX 1KI1A 5HTKA 4QT4A 2PLAA 4HAUA 4EPKA 3QVOA 1XZGA 4FTWA 5M1TA 2VFDA 2DZDA 2X0RA 4UCQA 3ZZTA 2EGGA 1KL7A 3RBAA 3KUCA 2ZI9A 5DM4A 4TMKA 1DFHA 5HRCA 3UAGA 4DIKA 5K9CA 1VA4A 3TTTA 3QV1A 1QPRA 3LCFA 4N3BA 3PJDA 1TW2A 4DR2B 3MJVA 3HQ4O 1F9EA 1CWYA 2EFHB 1DAPA 5CDSA 4BX2A 1RVGA 1A4LA 1QGYA 3V2IA 3WQDA 2AKEA 4P5PA 5FUWA 1HL2A 4N4AA 4TKUB 1K8XA 3F7JA 1VRWA 4K8OA 1Y1RA 3SURA 2JKVA 2QRPA 1E8NA 3DPSA 1TE2A 4ARBA 1I3MA 1ORDA 1J8MF 2A85A 3SZ3A 1W0CA 4MMYB 1JZTA 1N6PA 2OLJA 3UYLA 1O9HA 2W70A 3MCNA 4KCUA 1DJOA 3GMIA 1UPXA 3DAPA 2GQ8A 3RVBA 3BOSA 3U9LA 2BV3A 5IH7A 4Y9NA 5DW0A 3OO1A 1U1CA 1RY0A 2QE7A 1NVMA 2CBXA 3UXAA 1WPQA 4JC0A 2ERYA 3KOZA 1XIVA 3AEZA 3BT7A 4R9XA 1HE8B 1HP5A 2V30A 1YMVA 4GGBA 3E5NA 2EG8A 4WSHA 2P7IA 1K6JA 2GM3A 4M1WA 1YZUA 3GGJA 3G6LA 4OKDA 3G6MA 1TZBA 1J2JA 1VSQA 3L84A 3R7FA 3GI1A 2CKRA 4QOFA 4ZKEA 2G88A 5KVAA 3HG4A 2WIGA 3R9KA 2OGJA 4EEZA 4F85A 5ICSA 1TM4E 4ATWA 1RQLA 3SOPA 2O2ZA 3KSMA 1J4AA 3PBMA 1FIUA 3JU2A 4QT0A 4IUCS 2E9LA 4UTMA 2EPMX 3AG6A 1QDSA 2XOXA 1M75A 4YK7A 5GGYA 3CLRD 1AD1A 3FE2A 3S9IA 1T8PA 3UFXB 2DM6A 4MS4A 4KHZA 2OXFA 4ECLA 1XTPA 2IPWA 1JRBA 5DMHA 1FY2A 2D74A 4YAWA 1RQNA 4C1LA 3P32A 2K5UA 4OOZA 3H18A 4TIMA 3VGBA 2OV2A 1Y9AA 3FYUA 4RLHA 1U9YA 3IV7A 3ONCA 4M4SA 4I3GA 1CF4A 2Y1OA 4DR5B 4HH3C 4AEOA 3P4XA 1HFWA 2GJRA 3UF0A 2Q3FA 2CE2X 2D2JA 3ESRA 4A27A 2NO0A 4L4MA 2EARA 2FGZA 5A2BA 4RHTA 1NAL1 4TRMA 4YTSA 2OCGA 1UXHA 2A6LA 1ZRHA 3AL0C 1EC7A 2E25A 3V4ZA 3T7RA 3ECQA 3DXZA 1GDDA 5IWCA 3C39A 4Q1EA 2RH9B 3PHIA 2UU9B 2OCZA 5ESXA 2AQVA 3LI1A 2HJRA 3A13A 3VISA 2DSKA 3H0CA 2QRNA 2GUUA 4R98A 3QXSA 5IEBA 4ER6A 5T4FA 1P7WA 1SKAA 4ZQMA 1WXDA 3CBQA 2V4UA 1C9JA 2ZRVA 3BMWA 1EVLA 3DCNA 1I1XA 3EDEA 5JJLA 3VR4H 1OA1A 3AJDA 1CCWA 2PMKA 5ARDA 5GONF 1AF7A 2AQHA 3VR5A 3NWEA 5IHSA 1T5BA 4QOHA 3STXA 4AKEA 3AUKA 3ZDAA 3CZEA 3SJBA 3TD2A 1OI7A 3BZJA 1IE7C 3C7AA 4XWOA 2YIJA 5FA5A 5JAUA 4K9PA 1BF6A 1EPXA 4EAQA 4FSXA 1MJHA 2XGGA 4RZXA 4IJUA 3JD3A 1ZUD1 2X9VA 2TYSA 3CW2A 1LQTA 5KTMA 1NULA 1YC2A 4XX6A 4FNTA 1FFEA 4M38A 2QJOA 2AD1A 3EPMA 4BKNA 3W7CA 4ZI7B 2VSNA 3CV6A 1E0JA 1P0BA 1N5JA 2J47A 4CMHA 5XINA 1LW7A 1QGUB 3QX7A 3T7SA 3U9IA 5JSKA 5ALLA 1J2EA 3LP6A 1PK8A 4UFPA 4PLGA 5CC3A 1ZJHA 1R18A 3IBYA 4DILA 3DBNA 4RZBA 3BG3A 3W4RA 1G4TA 1J22A 1FYXA 5JUVA 2JFZA 5T67A 3RCMA 4B7XA 1JJKA 1ECBA 2OXEA 1Z47A 1CY8A 2ZRIA 3Q10A 5HCUA 4UNQA 1T3SA 3BCDA 1IG0A 1ZSXA 2O3SA 2WIDA 2WKJA 2ZIZA 2B5WA 1HEYA 4G1MB 5M03A 3WWDA 2RKOA 1VKFA 1JZ8A 3M6WA 1DOAA 1S7GA 3GEBA 3TSOA 3OG2A 3AYXB 2VYVD 2Q8XA 4D92A 4Q37A 2FEAA 5ENLA 1H93A 5BUSA 1ZI9A 1XHFA 1Y65A 3ERCA 1J9YA 2FGLA 3L7YA 5CTJA 2HJPA 4ZSTA 2OZ8A 5HG0A 2INFA 2C8VA 2ZJAA 3O93A 4Q34A 3O3RA 3MBOA 1YLVA 3HEBA 1S2AA 1GILA 4B5NA 1KEPA 2H4ZA 4L4XA 3DFIA 1I4OA 2OAGA 2NX2A 1RXUA 5K9DA 3VR5H 1OPXA 1EL3A 3HB0A 5AJUA 1XRLA 1LLCA 4RH1A 1IGWA 1XTKA 1P6WA 4M0MA 4H7VA 1PV8A 4DEXA 3OJXA 2I0FA 3OBIA 1PUXA 4MQ6A 1L3BA 5EGSA 1BTOA 1M34A 2VEMA 4PZLA 2VFHA 3UB3A 1IVYA 1WCIB 4DW8A 1T1GA 1RQRA 3KU1A 4W5QA 4F93B 1SG0A 2PGDA 2QRUA 4IMGA 4NUWA 4UHKA 3QR1A 3OIGA 5IRCD 4GFSA 2J4DA 3RG6A 1PQYA 3PA6A 4JLPA 4HYYA 3CH7A 1ECPA 4PO3X 1GTVA 1G4EA 5ALUA 1E43A 4XOIA 3DVSX 2R65A 3WWYA 4AY6A 1K77A 1GM5A 1VXRA 4QGSA 2WZBA 5CJ5A 3ML1A 4QNRA 4DUVA 1US3A 3PVCA 1N6HA 3IIJA 5EJ2A 3AI3A 5B7QA 1L4NA 2JAHA 4KH1A 2A3LA 2A3BA 3PJUA 4J27A 1S8AA 3EAGA 4MLDA 4KOEC 3H53A 2R1TA 1UR9A 7A3HA 2I6XA 3A6FA 4P7KA 1QF6A 2VIIA 4GLLA 4NYMR 5IAOA 3UJCA 3N8DA 3L0YA 4DQDA 1A50B 1FS4A 4F56A 1HDZA 5EYPA 3QC3A 5ER6A 4O18A 3KKNA 1RWKA 4J91A 1IWOA 3F5SA 1DXYA 2CV2A 4OX9B 3SJCA 3CPGA 4AO7A 3W1PA 2K7FA 5GJCA 2NSDA 4IKEA 4FAMA 3NU1A 3RUFA 3R7AA 2PWDA 3R43A 5FQOA 3DE1X 3RAJA 3QMTA 1JLKA 5FBVB 2B69A 1E60A 4E4FA 1XIJA 4I50F 2BN4A 2DTEA 4A92A 2PLCA 4L4LA 1UWSA 3ZV3A 3BK2A 1RYNA 4M1KA 5DOVA 2V3VA 1JZQA 2X8WA 3NDPA 1FJGB 1W46A 4JITA 1TVEA 1O7AA 1T8XA 3ELYA 4EHJA 2HRQA 2XD9A 3QZEA 1VCHA 4HGYA 4IXWA 4NDAA 1GTHA 1KPIA 2IU6A 1C90A 4FR0A 4ZO7A 4I5FA 4JT2A 4QEEA 3RVPA 5K0NA 2GGGA 1H0KA 4YCBA 4BMXA 3VRHA 1K1DA 1K98A 3AF0A 4YI5A 4CW7A 3WK6A 4HEA1 1DJXA 1ZMTA 2HWYA 3COWA 2CXXA 3VNKA 3I62A 2QL5A 3DTVD 1F4VA 2PR7A 4YP6A 4M3NA 5IXEA 3L77A 4CKXA 2Y1KA 2DUWA 4HFJA 1QAMA 4B2IA 1N75A 4JX6A 3UMSA 3M4NA 4UNNA 4CLEA 1G67A 2GK1B 1DWUA 2ISSA 1JTVA 4ZICA 1ZW6A 4DY6A 2O1SA 1EF3A 2ZJ6A 3NP7A 1M2GA 4JS0A 1DIDA 4XKJA 1NDVA 2XVXA 1F8XA 5EPUA 1QH0A 3IP3A 5DY3A 2PWAA 2XYRA 3DTNA 3KZMA 1EJ0A 3GDFA 4KRXA 5EKTA 4MR9A 1JHAA 4NX2A 3ANXA 4WXYA 2HF8A 4LJ8A 2E5WA 5BXQC 4WN3A 4HHLA 2DGDA 1OT2A 1GGVA 3CM0A 3EIHA 2BFWA 2VCHA 1ZRMA 3F2VA 2MYNA 2WD7B 4K1XA 3PB3A 2HBYA 4I5IA 1W75A 4IIJB 4E13A 3GUYA 1EU1A 1QVZA 4WKPA 2YCJA 5F4BA 1W25A 4X8HA 4C91A 3MYPA 3C3MA 4AWEA 2V9CA 2B7CA 2XM2A 4FNGA 1LC0A 1XWWA 1QP8A 4NMWA 3SX4A 4QAQA 2XUHA 2ACRA 3PHCA 4QELA 3NBQA 3NQGA 5K8LA 4E8GA 5F1OA 2RGXA 1DUVG 3N5KA 4R9UC 4UHCA 1M6JA 2Z5GA 2JCSA 3CUZA 1Q57A 4G65A 2GK6A 2ZAIA 1YK0A 2QD3A 1PFGA 1SUSA 3QV7A 3K53A 4FOLA 2HNEA 5L4NA 3RTEA 2XRZA 1SZEA 4OPMA 3R0XA 4EUEA 1F1JA 2O2EA 4HYEA 2A30A 4F3HA 2QHAA 3SN0A 1F2TB 1SC3A 3DHFA 1MNQA 1XI3A 4J7CA 1FQOA 3EMBA 1F2DA 1KJ9A 1F3WA 2XCQA 3UMBA 3KS9A 2XOKD 5FB3A 5G4KB 3E22A 3OOEA 3SXPA 1KXQA 5E3IA 1QGOA 4DM7A 4EZIA 3RUIA 3CVUA 1GTEA 1Z6PA 1JLHA 3WD2A 3IJ9A 3N3TA 1DWIM 4B16A 2E68A 4TVDA 2I6QA 3HPAA 1T4MA 5I9TA 5CSRA 1QKKA 2GQ3A 2ZDRA 10MHA 1S2TA 1SKQA 5AM1A 3XIMA 1FLDA 1QCDA 2ZIXB 3AQUA 5BCAA 4XYLA 5EUQB 3STPA 3SD7A 4WJXA 1FK8A 5KOHB 2Q6ZA 4HYVA 3FI9A 2V5AA 1CR0A 4R1QA 3RTCA 2Y8VA 5H91A 4Q8WA 1EUAA 1ZGBA 4NBNA 5IS2A 2V0NA 5TS2A 1OWQA 3PZ9A 4M8KA 2ZWAA 1ZESA 3U4IA 1LSUA 4ESOA 2XH4A 2D3TA 4DBEA 2P4SA 1Q3KA 1RC1A 3OZDA 1E6NA 3WLKX 1IPEA 1TJYA 1XLDA 1R8XA 2EX0A 2W66A 1XU7A 2XVAA 3AFIA 2GQ9A 1GCUA 2JGKA 3E0XA 1ZCBA 1BHSA 1GPNA 2Q5EA 4A8RA 4FLQA 3B9RA 2W6IA 4NT0A 3PQCA 4UCXA 2QDXA 3WO0A 1FFXB 4C2BA 3R40A 4FFNA 3QW2A 1YMUA 1Z4OA 1BW9B 3UF9A 2G1AA 5LDHA 2GPSA 4FIDA 3SHOA 2Y76A 1G20B 2XH7A 1GR0A 1G8AA 4JTGA 2OYLA 1VFHA 4JASB 4D45A 2EYUA 1U1UA 2JVIA 3FZNA 3E22B 5DRTA 1G18A 5FAKA 4EYSA 4RNDB 3LE8A 3QNWA 1YJ5A 2XU2A 3LZ5A 3KRZA 1GZUA 4P0PB 3GX9A 3G8YA 3HSKA 5A4MS 1G63A 5K2MA 4C6CA 1E4LA 4BWLA 3F6YA 3LYUA 3U4QA 1BCRA 4Q4PA 1T2VA 2Z2KA 3T5GA 1CD5A 3W85A 2VZTA 2YICA 2O20A 1A5ZA 3HURA 3MILA 4F4HA 1UDWA 4NYMQ 3H2BA 3FJ6A 5JT1A 3HFRA 4MVJE 5CGMA 4HA3A 3GJ3A 1SWWA 3GFTA 3K4PA 1UBSB 2AI3A 2FUG6 5ALJA 3LCHA 1SR8A 1T1IA 2XIIA 3C7KA 4BO6A 3D5EA 4EARA 4HNOA 4KRYA 721PA 1HI9A 1E20A 2WTUA 3WLHA 3X1YA 1UQRA 4KV7A 4DN6A 1LQ0A 4OHMA 4H6QA 2ZYFA 1SU8A 2COKA 3CCCA 4R1OA 4LYJA 2VEPA 3I7RA 3FVDA 4PANA 3H04A 1E7WA 1R4MB 1IQ8A 4L6IA 1G6OA 3OPYI 1IONA 4JCOA 2TODA 2K87A 3MVTA 3BQMB 5K3FA 3DULA 3WJZA 5J58A 3MW7A 5SICE 4AD1A 1V1MB 1XBZA 5NULA 4TX6A 4D9BA 2YKKA 4RK7A 1MC1A 3EIFA 4PYKA 3VI3B 4IHCA 4X6LA 3HADA 3C97A 2JLCA 3DHYA 3L01A 1B0PA 2H3BA 2J6HA 2C04A 4ZYLA 4NAEB 3F67A 1SBQA 4MZDA 2DPGA 4EAAA 3W7VA 3TN5A 3EQZA 2E82A 3P20A 2D69A 4ZI7A 2X7VA 3E9QA 1ZWLA 1N5IA 4RIHA 5LBUA 2VXNA 3CZJA 5FJPA 3ESDA 4QQ8A 4JTJA 1FW8A 2JALA 1WCWA 4ZD6A 1V6TA 5IYZF 3P5ZA 4OHKA 2PFKA 1M9NA 2L5HA 2C2HA 2E4XA 4YR7A 3EX1A 4Q3NA 2C2WA 3USZA 3VR2D 2Q5FA 4KRGA 2XCRB 4EKJA 2VJXA 3BD9A 3LC0A 2ZRUA 2RIPA 3EPJA 1SIBE 3UWQA 1H41A 3NEJA 3OM9A 3BL5A 1P33A 4E5NA 4J9UE 1IZ9A 1YS6A 2XM1A 2LUOA 1H0IA 4UKDA 1E2GA 3W87A 2DZBA 3N6JA 4DJED 3GPBA 1EJRC 3GUCA 1P0FA 4RL3A 1E8DA 5C4IA 2Z5VA 4F2TA 3QHQA 4AECA 4DREA 2XT9A 3CN9A 3ONVA 1Y89A 2VDUE 1TC1A 2OKTA 4HWPA 1XDZA 4CLDA 1S8NA 4G86A 4HD5A 2IS7A 4JYAB 3OLYA 4DG8A 4BZXA 2ECKA 1E3EA 3FSJX 1Z32X 4AY2A 3AB3A 3E7PA 3N8NA 3VPCA 4WLVA 3OLCX 4YQEA 3QOFA 1RE1A 4W1RA 3COTA 4TKUA 2YJQA 3EZ4A 3EDMA 3JRKA 2C5LA 2F9FA 3HBFA 1CU1A 1O5OA 1KYIA 2CLCX 3EPPA 3AGQA 3QUTA 3L1HA 4QEHA 1XRSB 1NQTA 2IE8A 2E7FA 2PXCA 1UAAA 3HUUA 4AZ7A 2QULA 5GY7A 1E69A 4TX8A 3QVJA 3O92A 3DESA 3DHWC 1UWAA 3H9CA 4F11A 1V7ZA 1RKVA 1MEJA 1U9IC 2Z2JA 5JV5A 7CGTA 3TZFA 4AVNA 1XVIA 4YMHA 2I87A 4F4JA 5IXYA 1E3MA 5CH8A 1T6YA 1SC9A 1FRNA 3BGGA 4NJIA 1A9ZA 3EVBA 3SZRA 1DJGA 2YXGA 2CYGA 1DWAM 2H4HA 1G01A 3HQNA 1D3CA 4GLBA 3PC3A 2HMVA 1N6OA 2E1DA 2GCGA 4GABA 1T1EA 4AEFA 4D0GA 1WDRA 1AC5A 4NE2A 2ZTKA 2O9RA 2CXNA 2LE0A 3UOGA 2OCPA 5KWIA 3HABA 2NZLA 4GICA 1KH3A 3HTXA 2AFHE 3C3NA 1EC8A 1A5UA 3VD5A 3OEHA 2UUOA 1C3OB 1JIXA 2F1KA 4IV5A 3H97A 3E3HA 3PSVA 4M7SA 3P27A 5T57A 3MWAA 2PX4A 5K6AA 3BGDA 1X97A 4FNSA 3MSRA 3IPYA 1E98A 2OO5A 1LFDB 4AU1A 4JQSA 1UQZA 6ABPA 1MV5A 2BD0A 3F4DA 1VECA 1XBVA 3N4AA 3E2QA 1SZDA 2JJ8A 3MT9A 2PWYA 3MQFA 3OC0A 3W7OA 1EP9A 3W05A 5F2MA 1SIUA 4PONA 4MRPA 4L3VA 2OGUA 1C7IA 2QRLA 4NBUA 2X0FA 2ZIAA 1G0OA 1VG1A 4CKCA 5GWXA 3QKWA 1GORA 3WIBA 3AOEA 2KW5A 1NELA 4E2ZA 4MVJG 1W30A 4DMMA 1I60A 2HB6A 2GLUA 2IHZA 3ZWPA 3V0SA 2VPYA 3LTYA 4KX3A 3DVAA 3O1JC 1EUCA 4BX0A 1OOEA 3FPEA 2B3TA 4O12A 4TL6A 3ND8A 2ON3A 1FBNA 1N1MA 4Q02A 5AFDA 2PYZA 1N2OA 3M44A 4NNCA 1XPGA 2WSKA 3PGXA 3NEHA 3DG3A 1D8TA 2K2WA 2C2YA 1LM1A 3RARA 4NJEA 1H7OA 4UUQA 3LZCA 4HF7A 3SM3A 3G9ZA 2GUBA 4RTLA 2FFQA 4UM5A 3AHDA 1KI4A 4XUEA 4PN2A 3NGJA 3KUKA 3WGTA 1MQ9A 1W9XA 4UTWA 1CDGA 2VT6A 3R5SA 3B3AA