5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
4IIBA 1X39A 1Y65A 4ZO8A 4I8DA 3WLQA 3ABZA 5BU9A 4ZOAA 3WLNA 4IIDA 3WLLA 2X42A 3ZYZA 3TEVA 3LK6A 3BMXA 4IICA 3WLTA 4ZOEA 4GVFA 4I3GA 3NVDA 1IEWA 3USZA 3WLMA 3U4AA 1IEXA 1EX1A 4ZOBA 5G1MA 2X41A 3WLSA 4GNVA 4IIFA 3ZZ1A 3WLKX 4IIEA 4ZO7A 3WLRA 3WO8A 1TR9A 1IEVA 1IEQA 4GYJA 3WLPA 3U48A 1J8VA 3SQMA 3AC0A 3WLJA 4GYKA 5FJIA 3RRXA 4IIGA 5C0QA 3WLOA 3GS6A 3WLHA 4ZOCA 5FJJA 3SQLA 3WLIA 4ZODA 4YYFA 4MSSA 4IIHA 4GVIA 4GVHA 1X38A 4ZO6A 3UT0A 1LQ2A 3GSMA 4HZMA 2OXNA 5TF0A 5BZAA 5IOBA 4ZO9A 5JU6A 4GVGA 4G6CA 2X40A
chains in the Genus database with same CATH superfamily
5EJEA 4F2PA 3ARTA 4ONVA 4PRRA 2O4QA 4JN6A 4Q4AB 2GUGA 2IV2X 1UDCA 3MMTA 4B6FA 2HXYA 2E5WA 2WC4A 1GUYA 3AJXA 1RBLA 2YOGA 1S3TC 1QAQA 1FLAA 5A4AA 1WD7A 3L8ZA 3KEQA 5A9RA 2GL5A 3HC7A 1NAHA 2RJNA 3UO8B 3IMKA 4J0FA 1N8NA 5EQJB 1ZUIA 4WNYA 5FUXA 1O5QA 2VO1A 2MCFA 1ABEA 5AB3A 5D2YA 2V5BA 3WO0A 4KXYA 2VJMB 1Y4ZA 2ENUA 2J6XA 4OL9A 4AN0A 2UV8A 4FIDA 2X6QA 2RJ3A 3C3AA 4QT0A 3GCWA 2X16A 5F1UA 1E98A 3JVUA 1OXMA 1Q83A 4Y1RB 3C2QA 1QSGA 4D0RA 3CZKA 3MVEA 4C6SA 3VDQA 4ARUA 3UUEA 4U7FA 5LFAA 1GU7A 5JSKA 2DPXA 3IOMA 1PVNA 3EOZA 1SMAA 2QMKA 2I8CA 2K2QB 3V6MA 3BLFA 2R5WA 3OW1A 2BOVA 1IRIA 3GG2A 4EI8A 3L7RA 1XYAA 1KQ3A 3T61A 3OCYA 5JXWA 4O25A 1V9LA 4RIEA 2BMFA 3I8OA 4AHPA 1CHNA 2AQKA 4G23A 3BWCA 1ALDA 3BSGA 5K3AA 4F4DA 3T0IA 2QDGA 4EA9A 1R3UA 3N05A 3V4FA 2YRFA 1VJSA 3CLRC 1BF6A 1GRRA 1SFSA 2KB0A 4FJ1A 4FILA 1RKVA 1JR2A 3N12A 4N01A 1YKFA 4DLRA 1FNNA 2H8GA 1GUDA 4FSXA 4EKNB 5A8PA 4RANA 3AXSA 3GVRA 1JL8A 4YCJA 2IKJA 1N2VA 1XPRA 3LBAA 1EE1A 4I9NA 4RHEA 2Z1BA 4DR3B 1XEXB 2VDNB 2WUGA 1OLXA 1ZNNA 2D7DA 2J9XA 5ECUA 4GYKA 4EG1A 3KX6A 5JXHA 4LC9A 1KAEA 3BK2A 4ZYVA 3DLPX 1TVLA 4OJKA 1T4CA 4GMEA 4Y6SA 1SXJD 1XHFA 3G2GA 5IRPA 3VO0A 4CCCA 2VFEA 2X5JO 4V1XA 4YL2A 3Q12A 4B5KA 1DV2A 2PEYA 2ZE8A 3WLAA 1XKJA 1MDFA 5JNTA 3QVVA 3UBMA 3IKLA 2VJMA 3L6EA 4X9YA 5IJ9B 1UJNA 3V5OA 4JBYA 1LP6A 4GH1A 3G5LA 2V63A 4LHXA 2FDSA 1FXWF 3CW2A 1GCOA 1GV1A 4LQDA 4Q3MA 4INPA 3JWGA 4WQMA 1F8UA 1CWUA 1N6RA 4KLRA 2VKZG 3VNUA 1B2LA 3CA8A 3GDLA 4QNEA 2G88A 1C7TA 3B60A 3DOOA 3INTA 3OU6A 1IPHA 1ZSXA 1PHWA 2BMEA 2ORVA 2VVNA 5LZ9A 4A15A 3P9YA 2WKLA 1AQUA 4TWBA 2RKXA 3BOLA 1HK7A 3MKCA 4NKRA 3WYFA 1UMYA 2XH4A 1OFAA 1XTPA 4IGHA 2WVTA 2Y8UA 1IUKA 4CETA 3PNSA 1GHSA 4PLTA 4EHDA 1TJ1A 4X64B 2FSFA 4NCJA 1UR8A 2JGDB 1QASA 4ICMA 4X90A 3CX4A 3HLYA 2DBYA 4CM6A 3KQMA 1EC8A 1BDBA 2H63A 2GVEA 5JZVA 2JHCA 3EVBA 1ZLXA 4XZHA 1M7JA 3HSKA 1W1A1 4MDYA 5J5RA 4RVGA 1XLKA 3PBYA 1SJ9A 1G64A 3BPWA 2G3MA 4EPEC 3A4VA 2O54A 4XUYA 3JUGA 4X3OA 3NHYA 3HIJA 4P4GA 4TR9A 1ZM7A 4K2HA 4CQBA 4QVKA 4AJIA 4TX6A 1W9PA 4FE3A 2ZVQX 2YQZA 1I80A 3PD1A 4QVGA 3ZWCA 4S24A 1JQ3A 5LA1A 5CSYA 1JIQA 2X5KO 1NDWA 1SHJA 1B42A 2YYZA 3GPCA 1GZJA 1Z45A 2IQ5A 2HCRA 3BJRA 2JJYA 2Q3JA 1PHQA 2CDRA 2C18A 4X8LA 3RVBA 1VHWA 2J46A 4MEAA 4IP5A 1JMVA 1TYBE 1KDRA 1YZGA 3BD9A 3PGXA 3M9LA 1EKXA 4ZQCB 3FX2A 1MRQA 4Y6GA 1UDXA 1ZUWA 1WUHS 4DNOA 1TMGE 1AH0A 4IVQA 5DCEA 2RBGA 2W90A 5CFLA 3LEPA 4B3IA 3H6HA 2DZUA 2ECQA 2BLNA 1BRLA 3U7GA 1HTWA 4CLMA 3UPTA 3WQVA 1TL7C 2OA0A 2G09A 2AB0A 1UDWA 4ZP1A 3S4YA 1KMNA 3IBYA 3CXOA 2XJ7A 4AY7A 4DWDA 3RSCA 3FSUA 3HA2A 2VTFA 4CMKA 4FYVA 2ABBA 1Z35A 4EQZA 5F98A 3R76A 3IOEA 1BQGA 1ZKMA 3ZCRA 5F7JA 1EQ2A 1H2FA 1GJUA 1QBGA 2PBLA 3G3EA 3ND8A 2CYCA 3THXA 3GIQA 1DV7A 2P4UA 3D3QA 4X0EA 2NWSA 5BW5A 2A5YB 3TEFA 1DJOA 4CL2A 3RVKA 5GJMA 4FBMA 5KJ6A 3LENA 2OXTA 1VYTA 4EDHA 6PTDA 2G0AA 2XGMA 3TYUA 5FTKA 4JTUA 4ZYLA 1GVFA 2JGDA 2R11A 3IDFA 2X1VA 4A6PA 3HG2A 2VJPA 1DAFA 1Z6YA 5J2UB 3T5GA 3WIEA 1S3IA 1VP9A 2D2IA 4OV9A 1E6SM 2DMRA 1FBAA 5ABPA 3TU9A 3W2NA 5FAGA 2P35A 8ATCA 3ZDBA 2ZZ6A 4GLLA 3FTPA 1PX2A 3HJRA 1FCVA 3O21A 4ME6A 3U7QA 2DUZA 3TDFA 4QQ3A 2BSXA 3WKAA 4Y9RA 2A7XA 3QUCA 2G82A 1I1HA 1VBGA 2CVZA 1HGWA 4F06A 1NXOA 4ARAA 1B0IA 2PUVA 4LX8A 5I7RA 2GGSA 1P1RA 4E8CA 5CTAA 4OVXA 2EATA 3I2GA 2QTBA 3IVRA 3RFAA 4MKRA 2PZLA 4TWRA 3H4MA 2QTLA 3DESA 4Q4PA 4NE7A 1QI3A 2UZ1A 2F1HA 3MUZ1 4H7CA 3PEWA 4G0MA 4FGJA 4XSMA 2D23A 2SHKA 4DR6B 3BHMA 1NKSA 2W2NA 4LOLA 4G3XA 3BRWA 4IJMA 2A7NA 5CPFA 3GNLA 2DFVA 5TGDA 4J7XA 2OBYA 3HI6A 1U0SY 2AF4C 2C92A 3H2SA 4V3CA 4M1OA 3RO7A 4QX4A 2XOKD 4AXKA 3CWZA 1XG4A 4HH0A 4B3FX 5BYBA 3BRCA 1C7JA 1WXWA 2R8XA 3FMPB 3ESQA 3V34A 4B84A 2J6CA 2PX5A 4GVLA 4QG6A 3OTRA 1OYOA 1KY3A 1W34A 3MD0A 3LNPA 3NHAA 5BXQC 2I1WA 2IYAA 3ISJA 4AZ6A 2QZ9A 3E5NA 1OK6A 5FI8A 3OFNA 2IYNA 3I6BA 3JD1A 2TRSA 5JFOA 1HRDA 1ZK3A 4I8YA 2F4NA 3RRXA 5LIUX 3KWSA 3D6UA 2YJ5A 1UKEA 2QRPA 2PF0A 3UANA 2DQWA 1YCDA 1ULZA 5JAIA 3JAWA 2QLYA 3CUZA 1JN0A 4D3FA 3O8LA 3KDNA 5B58C 4H7ZA 2NLYA 3QFWA 3C6BA 2WF7A 4YRJA 4ASUD 2IBSA 3GJRA 5JFGA 3WBXA 4BNHA 3QHQA 3OTHA 4E6MA 1V0MA 2VBIA 5KS2A 3KD3A 3OLIA 1RI5A 3OECA 2JLAA 4A7PA 1CNMA 1WUYA 3D0RA 5KEZA 4H0CA 3DFTA 3L2OB 4RGQA 1JHZA 4TMTA 3GROA 1MEOA 2NZVG 5KQMA 1SJDA 6PFKA 5CDFE 4K8RB 1OXUA 3F0TA 1CIUA 1SK9A 1X2BA 2VDVE 3PQ6A 1C9EA 4KRTA 4N18A 2A1TR 4EUFA 3W7CA 3IAHA 4DV0B 3H70A 3BWMA 5BMXA 3UR8A 3DJFA 4JDBA 3I3BA 1LQ2A 1OZAA 2JALA 3I6YA 1JCYA 4PHFA 3IUBA 4LJSA 3TBFA 4Q7QA 1EXWA 4NBVA 4OOEA 3WISA 4D8VA 3AIEA 3GU3A 3GLUA 5G0TA 4GSLA 3BURA 5I7OA 5C46F 3FRJA 1TM3E 3IPRA 2D3LA 2VNSA 1RQPA 3MLAA 4CNQA 3STPA 3B8VA 4B2LA 4RJIA 1UWTA 5BSTA 3K70D 5A0FA 3P5ZA 3PFIA 2V4ZA 2W66A 5IBXC 2G8ZA 1O5TA 4LUTB 1L5MA 8RUCA 4PGHA 5I47A 2OBNA 1NJJA 5SZHB 1DNPA 3E02A 1NNLA 4YMVA 2YB1A 3O1IC 1VFSA 1Q6GA 2WZIA 3TH6A 4UDYX 1VEOA 1MXHA 3EUEA 2PUAA 3DERA 1XZEA 4GNVA 4O16A 2EHJA 3WHPA 3UB3A 5A69A 1PEYA 5IH3A 5DXAA 4WXEA 4MI3A 4MW0A 3G1XA 2G41A 2ZBTA 1DJMA 2ACWA 1N9ZA 1XRMA 2IVFA 4PC7A 4EHBA 5DOVA 4D02A 4BMCA 3GFPA 2C0QA 1HGXA 3FVVA 4B4FA 4GYJA 2O1EA 1BD3A 2O2GA 4BQSA 1SQ7A 5BOSB 1IONA 4PCVA 1X7ZA 5C7LO 1KL7A 1N5LA 1C1HA 1MVYA 3RH0A 3DFHA 1L3CA 2QD1A 1MXFA 5C5DA 1H8HA 2G80A 2DZPA 3MB8A 1KFEB 1RZVA 2QTCA 5TV2A 2UWFA 1KFJB 2ASEA 4GRAA 4HTFB 5B4UA 3WLOA 4NU7A 2O57A 4OQNA 1D6SA 3E81A 4U7JA 5E1OA 4RE5A 1DX9A 3GV0A 2OFOA 3Q8XB 1GGOA 3OB8A 3SCPA 5DEZA 1ZMTA 2QHXA 3S1UA 1IK4A 2XNDA 2QRNA 2A5HA 4Q3BA 5E4FA 2EDCA 3G8AA 5CPQA 4L07A 4DWSA 3MJCA 5A6BD 2Q1TA 2QCMA 4GU5A 2X14A 1B15A 1ZK1A 3RTEA 1UBPC 1WVGA 3T3PB 3EPMA 3UOAB 4XIAA 2ZJFA 5FNVA 4ZTUB 5K09A 2QSYA 4HZUA 3EWXA 3TG8A 3C3NA 3ITDA 2RH9B 5A7HA 1NOWA 3EGIA 3BEDA 4NYMQ 5ICCA 4EZIA 3CWOX 1P81A 2ISFA 3OAAD 1JU3A 4U7WA 3GUGA 3V8NA 3P27A 2AOTA 4R8SA 4Q7IA 4EPKA 3LX5A 4C1KA 4CNTA 3L06A 2QJJA 2QBYB 4N12A 4A8JA 1J25A 3O05A 1FEZA 3LE8A 3C5QA 4F6RB 3DTVA 2WD9A 2WWFA 5JNLA 9ATCA 1UOZA 3U2ZA 3E84A 3IEUA 1J8VA 2ZKIA 4C14A 1FFDA 3C98A 4XOIA 4HDRB 2V45A 3PJTA 4HPNA 4RV9A 2IEIA 4IIFA 2YCEA 4CQAA 4D0SA 3DQPA 5K3OA 2OYLA 4UTIA 3HO6A 4ZK6A 1L7OA 1JNDA 4F6CA 3IGSA 1M04A 2HNAA 4E5MA 4A0FA 1US8B 3KEGA 5F1KA 4TXEA 3IHLA 3I9OA 3V18A 1SHZA 4WACA 3GTNA 5EVCA 2GO7A 3PFGA 3KKOA 4XR4A 2HA5A 1ZMXA 2XHYA 3IP5A 4UD2A 5BRJA 4F11A 1ZHHA 1X77A 5T4BA 3W6ZA 4XO7A 2WPDA 3EVGA 3ZLBA 3N2MA 1ESMA 4MS1A 2VFHA 4H01A 3PQ5A 1CB2A 2P2ZA 1TGVA 3MS2A 4RS3A 2X58A 4IG9A 1A50A 3PC3A 2WUVA 3RBVA 3NTRA 3D7KA 4UMBA 1C9DB 2NX1A 1XCLA 1HURA 4BRZA 4NV3A 3SBFA 1JTFA 3DZ8A 3VCNA 1LXCA 2O8DA 5TDHA 6XIMA 2PUZA 4R7ZA 4G7FA 2VCAA 3GGJA 1ICPA 3T9AA 2X23A 2CXNA 2VUTA 1K9DA 3PPYA 3ZIUA 5DCBA 1BE1A 4DMGA 1TZKA 1W6TA 4YO7A 3OLCX 1S3FA 1IXSB 3ZH9B 3EDRA 3RKSA 4N5MA 1Q74A 1E6XM 4L1WA 5BWAA 2VRNA 3GZNA 3B9PA 3CC8A 2ZRAA 4NH0A 5LB4A 1KRCC 1CGVA 4H7JA 3L7IA 4FEYA 5CGQB 3DFFA 1E5QA 3QPDA 4JTQA 2FMUA 1QOQA 3HFYA 3ENKA 5G1PA 1Z12A 1TCAA 5IH7A 1R5OA 1BWVA 4AF6A 3S44A 5IDWA 2V6IA 4N48A 2XUZA 4JCMA 3O1JC 3JARB 3LRXA 5TJ9A 1JHXA 1MB4A 2ATIA 3IV6A 1DWQA 3SCQA 4UB9A 4BMPB 1T8YA 1GTEA 4S1NA 5CAKA 4KUEA 1GZ6A 4JJKA 2A9QA 4FZ5A 4W99A 3RC9A 4UDXX 3QM1A 3ZX4A 3DMGA 3L1VA 3OVQA 4GZLA 3DE1X 3BD6A 4Z4IA 1U0RA 3TD6A 3ES8A 3H8VA 3UOGA 2CKDA 3T7KA 5JTUA 5DXYA 3IP3A 3K0AA 3DHVA 3OA0A 5FB3A 4CQMD 3RRZA 5DP2A 4MI9A 1XPUA 2VJCA 4YLEA 5JZBA 3IR6A 4BQIA 4OSPA 2A79A 2FWRA 1EK5A 1XCGB 3GXIA 3ITVA 1G8JA 4C2AA 1PG2A 2E5CA 4Q4AA 1HYBA 2VBFA 3LSCA 4M1QA 3TSDA 2GK4A 2VDOB 2GCOB 3Q8MA 5D5QA 3MKVA 3PEVA 1W32A 4E12A 4K87A 1EBGA 2C8LA 4Z2GA 1K7SN 3HXQA 1W88B 1OYAA 2DG2A 3UP8A 3NM5A 3A2LA 4PX5A 4TM7A 4RVCA 1TWWA 3ADCA 1J49A 1U1GA 4XPIB 3HJTA 1YIXA 1OX5A 1SO8A 2J47A 1Z06A 2V59A 3G9XA 3ZGVA 4PUKA 4QULA 1RLTA 2COEA 1RA0A 1PAUA 1NF7A 2C9ZA 1MG0A 4PZVA 4WJ8A 1HJUA 3DKLA 4M38A 1T1GA 2FW8A 4C6MA 1EUAA 3CF2A 1KOGA 4ETWA 1ENPA 2QPLA 2MWMA 2WDZA 2UYQA 4NHVA 3COJA 1JBKA 4DUZB 5M2FX 2XIIA 3DZDA 4Y1FA 5J1SB 2OO5A 1IF2A 4AVFA 4FHEA 3FMIA 1WB4A 3IRDA 3DCPA 3CF4A 3K05A 4D3YA 4J3VA 5I3GA 3EEZA 5KDOA 2ECKA 3DUFA 5TVGA 4XH9B 3MSGA 1T91A 2J5QA 3R75A 5I01A 1PD1A 4YS6A 3VIGA 4N76A 2PLKA 4IFKB 1E0SA 3NXKA 4UM8B 1L3IA 1Q1GA 2GGHA 3HR8A 4JDYA 2CV0A 1ZBCA 4L8LA 5ALXA 1OA1A 5EZYA 4HUJA 3DPUA 4IIGA 1RRVA 3WB1A 2CNKA 2Y92A 1QYWA 3OT5A 3QVWA 1NIUA 1UUMA 1OAOA 2RDTA 1VSQA 4PRKA 4MAVA 2DE0X 1GR0A 7ENLA 1T0BA 1U2TA 3M6DA 2BZSA 4C0QC 5ILQA 2QW0X 4BWYA 5L8VA 4QBGB 4DJEC 1H7XA 4X3ZA 3FZYA 3ZE8A 4NCHA 2GZSA 4N5DA 1EVKA 2VHZA 3TNOA 3T94A 4RLIA 1REQB 1XZNA 1VCVA 4PAQA 5JEEA 3BULA 2VSFA 1IBKB 4UBMA 4J0KA 2R66A 1NLZA 4QYWA 3TUIC 1T6BY 5LOVA 3NNSA 4BZZA 1N2SA 4ESEA 4F71A 4CG3A 3N59A 4MIKA 4BE9A 4LZNA 3NC0C 3Q2IA 1M2NA 1YDHA 2UBPC 2FWPA 1SKMA 4O0KA 5TMDA 2H1VA 4BV8A 3N2TA 2JASA 1T8TA 4ZMSA 1VH7A 3ZW7A 3JD0A 4EHLA 5BQXA 4JI6B 2IYSA 4D8XA 3WRWA 3COPA 5CXPA 1QNLA 1UZAA 2J87A 1UKVY 3IVUA 2OVLA 1BIFA 3W22A 4RSRA 4F0KA 3ONCA 1D8WA 3U09A 5DK6A 2XB2A 5ABGA 1XHGA 1A71A 3THUA 3OEYA 4NZJA 2QTWB 4L64A 4FGKA 1G5PA 4CODB 4L50A 2ZIXB 1UQUA 1YDYA 4H00A 1PW5A 1E7MA 1ECEA 4WCDA 1AXRA 1M5WA 3LL7A 2Q2WA 4JI2B 4AKTA 2GN1A 1NV8A 2FMXA 3TCNA 2NXWA 3LS9A 3LCLA 4AEFA 5EKXA 4MINA 4C1BA 5LIPA 1QTIA 3AM5A 1FU4A 4Z9BA 2O0KA 5HCNA 1SB8A 2GK1B 2EX1A 1X7HA 3IK4A 2AG0A 4LJ7A 3WUGA 2XXJA 3FA2A 4F3CA 1A8QA 4IDFA 3SC2A 3BT7A 3FOWA 5JJ5A 3GIYA 2D4AA 1IK6A 1D03A 2R8ZA 1JZ5A 4A6EA 2NSXA 3UCDA 1U2YA 2AKEA 1RKXA 2ZBQA 1SUCA 2OZVA 4QPZA 4YP7A 4GQ0A 5JYEA 3LXRA 3FTDA 2GCEA 3CVWA 1EDDA 4K6CA 1HKIA 5IMSA 4PICA 5ALWA 3VH1A 4ARCA 1JDBB 2PS2A 4G5SA 5BW6A 1ORIA 1WBJB 4HX5A 2VZUA 3B3QA 1YS4A 4HJRA 1AKWA 4YTRA 4R0MA 3E5MA 5FCZA 4QPDA 1PHRA 1R9XA 1PX0A 3HQOA 5DISB 3WQWA 2G83A 4IJCA 2X15A 4ENTA 1WUTA 3VYUB 1J0HA 1Y9ZA 1IT0A 5HUQA 2ZYAA 5BUCA 1CGUA 2GO1A 2QL9A 5LMNB 2HO5A 2E4YA 5EZ5A 3VGEA 3MT1A 4MKSA 1SCBA 4B4UA 4XM1A 3T12A 3VX1A 3EWNA 1DWHM 1J33A 2YPIA 2G5TA 4DLKA 1HL9A 2UVDA 4P5UA 2K5UA 3TM5A 4JFTA 4LQLA 1SXPA 5A4IS 4RLHA 2G0NA 4TYNA 4ATDA 2I2XB 4WL0A 3E61A 4PX3A 3DH7A 1YL7A 3B1KA 1NW6A 1OQFA 2PLWA 1T96A 3VNZA 2Q09A 4NY2A 5J5VA 4K1LA 2GAOA 3B9NA 1B74A 2IS6A 2DWCA 4QAIA 3IOYA 3VKWA 2W11A 1P19A 2WAYA 1QK4A 3BFVA 2JAUA 1NXPA 4KUHA 2YZ2A 3AMCA 5LJLA 3LYLA 3PC2A 5IVHA 4IIEA 1FTGA 1GUAA 2D74A 4XW2A 3SRHA 3FZNA 2ZRXA 5C2GA 5IN5A 4GKAA 4K9LA 5F1YA 1ONNA 1KBBA 1MTZA 2A2ZA 1GFSA 2F17A 1J11A 5FP0A 4NG4A 4J3WA 2WAXA 1DE5A 4D6YA 5JZ9A 3RRAA 3GAMA 4RV3A 4WKCA 2BIFA 4LEQA 2PDNA 1WB5A 2FA9A 4M87A 3NIBA 1X6NA 4C2BA 1VCIA 2XGSA 1IY2A 3OX4A 4Q1EA 3GUWA 4RY2A 3PDCA 3WC4A 3G0UA 4P93A 2JJQA 3L6DA 2BEJA 5TPWA 1EB9A 2N9UA 3QF0A 4ZGGA 4AF0A 4YRRA 3PFHA 3FWPA 4F5EA 3ZZNA 3V9AA 5A4FS 3DF9A 5DSXA 2PGJA 1R5YA 3QPCA 1VTKA 1P2GA 3DKIA 5J1TB 5DZSA 1QH1A 1KGSA 4Q8OA 4MI1A 1TFRA 4HS9A 3GEMA 2P76A 5EKSA 4L57A 1QMGA 3RU7A 1TJPA 3SURA 2PPGA 4I4LA 4KPUB 1VLIA 4C05A 3FUXA 3UXLA 4B6QA 1ME7A 4DRSA 1JIIA 3EWCA 2XFWA 3VOBA 4MVJD 1S02A 1DCMA 5K7JA 3RSLA 2YMPA 3L4JA 4QUIA 5DVZA 1CUXA 3D8UA 2JK1A 4M8SA 4L75A 3RAJA 4RVSA 4J16A 4LRWA 4WKOA 4B3SB 1VG0B 1TU4A 1UMCA 1ISWA 1NYTA 2GZHA 3L4XA 3ZGLA 2RAPA 3HB0A 4MPPA 5FWXB 1DGQA 2O2XA 2EG6A 3M5DA 4KXXA 4FONA 1XQ1A 1SZPA 2Q8XA 3A64A 3AHVA 4ATLA 4B2IA 3WNBA 2ALJA 1J07A 1R2RA 4PC6A 4HIBA 2DW6A 3OIYA 2KMLA 2HIHA 2PBGA 3QOFA 4EYOA 3R7WB 1TRKA 4DIDA 2OHFA 2NP6A 5HMMA 1XCJA 2IXTA 3ZJ7A 5C9UA 4ZVQA 2R14A 3ABOA 2QMOA 3P9SA 1BNCA 2AF3C 3L12A 2ILTA 4RKYA 1U1HA 2D7JA 1MQPA 3IHWA 3FHJA 4JKIA 3TE6A 2IUTA 1OY1A 1J1ZA 2VP5A 2DSWA 3GR6A 4AG3A 5JSFA 1UH5A 1TIBA 2GYYA 3NWPA 4NCXA 1H4TA 3L5OA 2PV0A 3G59A 2QN6A 3G0HA 4TWZA 1X98A 1FDJA 1FXSA 1VBMA 3TQ0A 2B1RA 2JNWA 1TA0A 2VXOA 3FW1A 5H4GA 5E6SB 4DV1B 2QG6A 1ML4A 4O1HA 3SQOA 2QN2A 3KZ1E 4URHA 3R7NA 4CLEA 3EF1A 2D59A 3W07A 5BOFA 1M53A 3RNOA 4YXGA 1KE2A 4YXWA 3CTMA 3OT4A 3RWBA 2WYOA 4FX7A 4P3XA 4LHEA 2VT7A 4F0JA 2WKWA 3FTFA 3LXAA 2IH5A 3DVAA 3P62A 1V1RB 5E6RA 3BILA 2EG9A 1JGIA 2BTOA 3N70A 5AI5A 3A4TA 1RLMA 1Z6ZA 3AI1A 2ZZ3A 2IUUA 2CNWD 4DN1A 1CRLA 2EEPA 3DULA 3D6TB 3QF7A 5IW8A 1JD7A 3DUGA 3OYXA 1I5RA 3WJYA 3VOGA 3ITTA 3OPYA 3UJEA 3DBIA 4JBRA 2F9RA 2PRMA 3TTTA 3AFHA 1SVMA 1C29A 2B5VA 4N3BA 1NJ2A 1TTQA 1WS6A 3LCRA 1GG2A 1JECA 5ISMA 3OI7A 2C96A 5G0UA 4ZT3A 2KM1A 1O12A 2GJXA 1NF2A 3W7BA 3E22B 1BXKA 2QTVA 4UCXA 5HG0A 4B4DA 4XQCA 3GLVA 5BR4A 4V15A 5KNDH 1SZGA 2YBVA 2NQ5A 1RR6A 4Q9LA 2V82A 2CB0A 4R01A 4XEUA 4OHFA 4O2BA 1IBRA 3FUCA 3BDVA 5AYYA 4DBLE 4QSHA 3AR9A 4U5KA 3GPLA 2OB3A 1EGVA 4FEEA 4YLWA 4BFVA 1QF7A 2BGGA 1NW4A 4MSUA 1UBMS 1ONRA 3UFXA 1GNVA 2WWGA 3L8CA 3R3UA 1FY2A 1FDZA 1KBQA 4IJBA 3M1IA 3Q98A 4OKDA 4CEUC 1HLPA 4I5XA 2WJ6A 3FZGA 1IRXA 3VDXA 4NARA 2NUXA 5A5WA 4WOCA 4A29A 3T06B 3ECCA 3H11A 1F9EA 4R2IA 4NZ5A 5EIAA 3ZWQA 3CB2A 1D2MA 1DKUA 2IP4A 4UTNA 5CGMA 1KQPA 1RQRA 1HKUA 1YZVA 2O07A 3WLEA 4L1GA 3KC2A 2QCDB 3TNBA 2Q9AA 3B06A 4NNAA 3UWWA 2H0AA 2HWXA 2IC5A 4D1YA 2ZIAA 1LPMA 2IHUA 4DBWA 3WLJA 3MFQA 3ARSA 2CERA 3MJHA 5M1TA 3DR3A 2TECE 4W8AA 5BSMA 4C78A 4EI7A 4D3SA 5DF0A 3P9PA 1JLLA 2JJ8A 3OJLA 4M9XA 1J39A 4G5XA 3AHDA 1R3YA 2QZZA 2VHVA 1P2UA 1CECA 1KEWA 3O0KA 1CZLA 3BLLA 4O2RA 4KHPB 1IMJA 3ZHYA 1QIJA 4R34A 3GIWA 1US3A 1OXKB 2LVBA 3L3BA 4JKKA 4WGXA 1V03A 5EHQA 4A03A 4OHCA 4F9TA 5CYGA 4G9PA 5I45A 1CF4A 3MT0A 1PR4A 1EWDA 4OQQA 2C4TA 5I7UA 2HS8A 3NDIA 1J5TA 3PE6A 2I2DA 4M7OA 1E3EA 4C4OA 1OGGA 2P40A 3UCCA 3DMNA 4AY5A 3SE0A 1GZ5A 4BPBA 3QBVA 4HDRA 5KHAA 4QOSA 3NGMA 1F38A 4DS3A 1XCFA 1PE1A 4P8UA 4LIPD 3A2MA 4BPRA 4F93B 3BDKA 2D20A 4BP8A 1TMLA 4YBRA 3UFXB 2VHLA 3LERA 4QUDA 3Q3CA 3KVNA 4OUEA 3ANLA 4PPQA 4BJ6A 3V35A 1KKRA 4WXRA 4B3LA 2PH3A 2BM1A 1TD1A 1L5YA 1OLSB 4O1MA 2Q5LA 4GOAA 1US0A 1QNPA 2V4UA 1LSJA 2PDBA 2O2YA 2JIWA 4LBZA 5AVVA 4OHQA 3PFWO 3L8GA 1SD1A 1FQKA 3B8TA 3CKMA 4IEEA 3W83A 4FCVA 5T4EA 2VJLA 4UHFA 4G9GA 1N1EA 1UMBB 1PJZA 4N9WA 1UXOA 3WS7A 4EQ6A 1GGHA 1WOAA 4WF7A 1JFVA 3AEUA 3INYA 1COZA 3R25A 5I9NA 1W96A 3BZWA 3KXDA 4CJXA 4HQKA 1YZ3A 2AOVA 5AJUA 1F14A 1EHIA 2SKDA 5T64A 4FPSA 3VNAA 2Z6IA 3SR7A 5JARA 2ZM5A 1W59A 2CXTA 2RGUA 1XISA 1C9KA 1N1DA 1OE0A 5A6VA 2CJYA 7XIMA 4OBSA 2QT1A 3H1TA 2J7EA 2E3ZA 1W94A 1H4SA 4MWEA 2M6RA 2MINA 3JPWA 1K68A 1B0PA 4Q8WA 1YAJA 4S23A 2QJOA 5JR3A 3UZUA 3SGZA 3BZUA 1RTKA 1N82A 4EB6B 1L4FA 1V02E 4DNHA 4RW5A 5A3QA 1TELA 4D0GA 1I4OA 3CZLA 1GG1A 3N1UA 3NJRA 5C8XA 3H8JA 4IHCA 3HJFA 3BKWA 1UZ1A 4IMDA 2GXSA 2Q4RA 4ZA2A 5FOVA 2GM5A 1ADOA 1TPDA 2PAAA 5EMYA 3NAZA 5IAGA 4ZQBA 1KM5A 2C1GA 3TCEA 1AQ0A 4LZJA 4CG1A 1FSGA 3IX7A 3H4IA 3I9V6 4H2CA 4Z2AA 3E9DA 2GN4A 3U9LA 2J6VA 1F3XA 3I2IA 4Q12A 3S4TA 3AVOA 3EWDA 2C88A 4C01A 3TH5A 4KNWA 9LDTA 3VISA 2NW0A 2ETXA 3GRIA 4GI5A 1EA9C 3G0OA 2LTAA 4C0HA 1FHVA 5EJ6A 3APYA 3KYDB 4FSAA 2OV3A 3HXTA 3JTEA 2ZJ7A 1OLSA 4OHXA 1ISYA 3WJAA 1NX6A 4A0SA 4AD8A 2A4MA 3PCXA 5FI3A 2WAAA 3NIDB 3ABIA 1HWYA 1O1HA 2J9ZB 2CETA 1S01A 3GBEA 4Z1CA 3IVXA 5AOUA 2Q9CA 3U2CA 4Z99A 1M0SA 2NM0A 3ABZA 3CURA 4J1TC 3FTNA 1UMBA 4JI5B 3T1TA 3DXFA 4FUTA 1IIBA 2C77A 1ZGGA 3QR0A 4FMCB 1CVRA 3I0ZA 2NADA 4AUNA 2I6UA 5FBHA 5AW6A 1M8JA 3BSSA 4D8UA 3IUHA 3H9CA 5D4YA 3TA6A 4FW8A 4E2DA 1E0KA 4TWIA 3STCA 3F71A 2FZCA 4RADA 4LFCB 4C5YA 2H11A 4DAEA 4LJ5A 3QVTA 4PMVA 3WF0A 4E88A 4D2IA 4Y1EA 5JDCC 1KO0A 4PCNA 3QOYA 4LQCA 1QOPA 4X63A 1EP3A 1NRWA 4AQLA 3TLZA 4RPCA 3BOFA 2P0YA 5C8DA 2FPMA 3DPIA 2ODWA 3BAYA 1DBWA 4FDAA 4P7QA 3M2PA 2PEZA 4PUNA 3NGJA 1XIIA 2IY8A 5E1DA 4UBLA 3GF4A 4NCAA 3ZKWB 2IQTA 3NPWA 3ZE2B 5FQOA 1H61A 1NI5A 2QW1A 3MOIA 1W2VA 2PC8A 5BSKA 3SN4A 1NV9A 1QW7A 4IUOA 2QZSA 4F12A 2I9UA 4UMAA 1D2GA 2LZ0A 3W5UA 3SZGA 1EDOA 4W1RA 1J4EA 4PG5A 3GFVA 4ZPXA 2VRKA 3K5WA 4G67A 2X8LA 2OHGA 2I9PA 1HL2A 2JA2A 3AIBA 1QCYA 1UDAA 4CF3A 1XLVA 2GJAA 4Y8VA 3IUPA 1D8AA 3WL8A 1V43A 1BXCA 1LQTA 2XH2A 5DMNA 4WBXC 3NHWA 4JICA 3WNOA 3IPAA 3PG5A 2GB4A 4M8IA 3AXIA 3OKPA 1AC5A 3RIYA 3LK6A 4CD7A 3AUFA 5ED0A 1AV6A 1JT2A 2D13A 3H6GA 3T4WA 4KRUA 1NF9A 1UKZA 1W5AA 3B6EA 4PRTA 5FI5A 4DNQA 3RYSA 3PC8A 4DJAA 3FYHA 1IY1A 5HKBA 3ZQ6A 2FGLA 1Y8AA 4JROA 1G42A 3E4DA 2WWRA 3G82C 2WM0A 3SQWA 3R0ZA 4MUPA 1WBHA 2OLHA 1EBBA 4U4AA 5FBRB 3ZHOA 3TQHA 1TA3B 2B8TA 3SHWA 2JGYA 1UMLA 1AJ0A 3RQSA 6Q21A 2H3EA 2MYNA 5BOEA 1KBOA 3IDZA 1Z48A 2P2CA 3BQNB 5I9IA 2ZRVA 2C0AA 3P9XA 4C0AC 4E03A 4IUYA 1YB7A 2E37A 2ONZA 4LRXA 2CXPA 2R9RA 1MW9X 1K03A 1N6LA 4UDOA 1CSEE 2AG1A 2VGIA 2Y7EA 1MG5A 3I1JA 1C7SA 2A30A 4RZQA 3M6MD 1JCJA 3K72B 1OI4A 2ZA2A 3H8SA 4XZIA 1KO4A 2ZIXA 3SB0A 3FN4A 2IQDA 4B7ZA 3A37A 3ZQ4A 1QI2A 4JJ4A 2FQYA 3WKEA 7ABPA 1BFKA 1NOUA 1KDOA 4ER7A 1E3IA 3RVQA 2EPHA 2WZQA 3AQ4A 2RGXA 4L5JA 1JXKA 5E7QA 4N5LA 1F06A 1X1QA 5IHXA 3GDTA 2C00A 2BGNA 3VKHA 5KCZA 2OD2A 1QIEA 3QEJA 2ZC8A 1DE0A 5A8MA 2XVGA 4AUBA 2NU8A 1UQRA 1Z5PA 4Q9NA 3KZKA 4I08A 4C1LA 1UT6A 3EKGA 5CLQA 4BWFB 1SOUA 4DPKA 2IEDA 3VC1A 2XVYA 1ADBA 2QM0A 4LBRA 3GGCA 3VQTA 2VSNA 3B9RA 4RQTA 4ENVA 2O20A 1WDLA 3EXHB 2J4FA 1SZFA 1WMBA 3T7AA 1XRLA 3UG8A 3K73O 3FXYA 1TQHA 5ERXA 3NOEA 1JQKA 1YUBA 1XGZA 2WPDD 2G96A 6XIAA 2E1PA 4ZO4A 1QLWA 1Z4LA 2H1FA 5AW7A 4IIJB 3L02A 1F5ZA 4YLYA 3GDFA 1J21A 2GDJA 4YRLA 4ILEA 1XQWA 1GT6A 3AR2A 1B14A 1BGGA 3JTMA 3SEPA 4BNWA 4RZHA 3LGGA 1WW2A 2D2HA 2OQHA 5AHXA 2FRXA 4J03A 4U4MA 3CISA 3O38A 1V6TA 4NT0A 3R0JA 1SCAA 4GI3A 1B9ZA 4TPKA 3TOXA 3GDHA 4YYFA 2VP6A 4HNUA 2B4YA 1YAHA 2F3SA 4AY3A 3L6OO 4MWCA 2X2EA 4AD0A 3BXEA 3ECSA 2YCKX 3A12A 1TX4B 2NUAA 4MICA 1M54A 3CGGA 3NUQA 4MVJG 4ASUA 4CN8A 3G0SA 4LOHA 4L6OA 3QKRA 2OCPA 2WU1A 2YZGA 1AZLA 2P79A 1T24A 4HC4A 4HWPA 3GRKA 1HXJA 2GZDA 5U4NA 3RU6A 1CUBA 2B69A 2PP1A 3G6LA 4DY1A 1JPKA 3D31A 4BVKA 3T40A 1EUZA 7TAAA 3O91A 1T2EA 2QRQA 2JRCA 1E2QA 3VIFA 4DGSA 4O11A 3HCCA 2V5AA 3CU5A 2WNSA 1UIPA 4Q1DA 4G7EB 3GGSA 3FGCA 3NZPA 1YTKA 2ZU6A 4WKHA 2NU8B 2C3UA 3W8FA 1FS5A 5AXAA 4KI0A 2AQWA 4M7SA 3Q7SA 4P3OA 3NS7A 4ORIA 3CEMA 2VNCA 4IJQA 1CNEA 4CL8A 4TTRA 4GBDA 3PPVA 2RGLA 3GDKA 5CZSA 3ZHRA 4N0MA 2ZE5A 2VYVD 3T81A 1Q16A 1AGRA 1U33A 5JT1A 3PPXA 3SZOA 4AWAA 3LHFA 2VYVA 3DHNA 5KWJA 1V3QE 5FEMA 1E9ZB 1B90A 2JI9A 1VE1A 1QRQA 2PG3A 4HY3A 3CZ9A 3P2EA 1YONA 4AL4A 4BNDA 2B8EA 1UKSA 3ZMRA 1SKBA 2IXFA 1JEYB 4M0EA 3DYBA 4H3VA 4HZ7A 3ENZA 4E6EA 1K1EA 2VHEA 4BS9A 5EESA 3FXAA 4JVNA 2P50A 1CIJA 2CFTA 4I1IA 3DMDA 3RHSA 1HE8B 3NL6A 1A69A 1SMKA 2H1OA 2IPOA 4FLFA 4L4RA 3HGRA 2XCRB 3R43A 3WL3A 4RLSA 2D2GA 1T8XA 4ZAFA 4MRPA 1ZHAA 3VR5A 3D3WA 3LPDA 5BZAA 1U1DA 3DFNA 1AT1A 2WMOB 4Q3OA 1L4EA 1KOJA 2QXWA 1YPIA 1Z7AA 4KR7A 2FN7A 4F8YA 5EMHA 3ROFA 1MJ5A 1W2PA 2BV3A 3V5FA 2YFKA 1PKXA 2NZLA 1Y9EA 1T15A 4EM6A 2JVKA 1WZCA 1C0PA 3A9SA 5FUVA 3H6OA 3DBHB 3MJ4A 4WERA 4DDUA 3TRJA 4IGAA 1R87A 5DT2A 4KMOA 3WDPP 3TZHA 4IDAA 2Y61A 2GQ0A 4AJNA 3FOAA 1TMKA 5KNBD 4TV9A 2V69A 2IPMA 2AE1A 3NO4A 5ALUA 2ZDRA 1UIMA 3IDQA 3LY5A 1K7EB 4JA2A 1G18A 3E7FA 2KLBA 1SU7A 1XYBA 1Z63A 3OVGA 2YUIA 3GJ4A 3CNHA 3IQXA 2PMCA 5AHIA 3OE7A 1ISGA 3GEBA 2J7DA 1EJXC 3HFGA 4EYSA 4WDRA 3WGLA 1E1FA 4OJQA 4TLLB 3PXBA 1KRXA 4G85A 1XBTA 3A0UA 2VJXA 1LROA 1ZA1A 5LSMA 1D2CA 3RXZA 1PB0A 4GC4A 4R1TA 1WCYA 3ZBUA 4M49A 3VD7A 1VJCA 1C9MA 3C5WP 2EX0A 1YIOA 3WYNA 2QT0A 4WBNF 5KVCA 2VEOA 1FLDA 5FQNA 3MUXA 4AW9A 4JIIX 1JEYA 2OEPA 4HFNA 1OFUA 2GJNA 3W2IA 4OAQA 1T9KA 2PMDA 3UT5A 2NPOA 3KP1A 4YP6A 4E3ZA 2II6A 3AFMA 4DBDA 2HF9A 5DT7A 1OW3B 4Q1CA 2W93A 1A4UA 1EQPA 5AUOB 2Q3FA 4NP6A 1QORA 2JS7A 3IGUA 4C6CA 1VJZA 4G1BA 2I4MA 4RPKA 1M74A 5G2IA 1E5LA 1LKZA 3W6LA 3NJ8A 2XMDA 2QR6A 4KQJA 2I54A 3ZLTA 1VIYA 3RJ5A 1T6NA 3D5HA 3O94A 2AKMA 3NHMA 1TIWA 2ET6A 3OIGA 1KJZA 4FEGA 3H4XA 3VMFA 1OFOA 3FK4A 2CBGA 2WJFA 4FNRA 3BK1A 1IZJA 2FPRA 1QG6A 3TJLA 3KBSA 1DVJA 5FTLA 4NDNE 3RPTA 3G13A 5G4WA 2ZRJA 4B0OA 4L56A 5AYBA 3THAA 1GAJA 3DVQX 4I1SA 1QHIA 4W7IA 4B4VA 3D2CA 3KL4A 2COKA 2FZ5A 2SICE 4GKKB 4AS3A 2FEXA 1QO2A 1SQFA 1Y8BA 1RJ9A 3OPXA 2Y68A 2RHGB 4GQQA 4F2UA 3TSYA 4C5ZA 5DRCA 4AIEA 4QA9A 1KKOA 1N1MA 1AA6A 1LLCA 3HYTA 2EJAA 5KNDA 2JLXA 4LVGA 2ICAA 1PEAA 2BMDA 3RWMB 1LOQA 4ALLA 2GN9A 4CIAA 4AWTA 1B4DA 4ECLA 2OO3A 3V55A 3MDUA 5CCEA 1AJ2A 3QF4B 2Q49A 4OSOA 1FKWA 1FXWA 5IJWA 2LLEA 1UOKA 2C8KA 4DZIA 5CM2Z 2CLPA 1DBIA 1X39A 3OM8A 4K8GA 4X84A 1L5QA 4XWAA 4B6OA 1I24A 5HW0A 3ME5A 1EFRD 1XVIA 3VNQA 5ALKA 4NBLA 1QNQA 1Z6QA 1KK0A 2HK9A 3KD2A 4DUGD 1GSIA 1NHWA 3V3WA 3WZMA 3QWBA 1AB5A 3L7NA 4XB1A 3ZU3A 5G40A 4K36A 4CKZA 4URUR 4GVFA 4KIRA 3H9BA 1SUBA 5JCJA 3QWAA 5IABA 2Z58A 1OD6A 4LK2A 4O5OA 2J13A 1ABBA 2DETA 5CQ1A 1V8ZA 1OX4A 2DF8A 5C34B 4JTJA 3DH0A 2AWNA 3MWLA 4AJOA 4I4CA 4L9SA 5FJUA 1VHJA 3FPGA 2N1BA 2WEKA 4KLAA 4KNVA 3R40A 5FOSA 3FN9A 1OB2A 4NASA 1ZH4A 3HDVA 3D6HA 1EOMA 3ZZMA 4RKRA 4EZBA 3RRYA 1II8A 1GQJA 2ZZ5A 2VA9A 5JNWA 3ZEIA 2I34A 1QPRA 3PPCA 3GMIA 4G5FA 1W85B 1XTTA 3P5BA 3BAFA 3L0BA 3W6NA 2HFKA 4U2ZA 1KXTA 4F9DA 3C3JA 1XGEA 1VLVA 3JQ7B 1E6EA 3LT5A 4CCSA 2VX5A 1KY5A 3F73A 5KOJB 1JWAB 1WOMA 1GVRA 4Q8QA 3VKGA 3IULA 2W83A 2E8YA 1H1NA 3IIPA 5CDFA 5JECA 3LQKA 1PTGA 3ASVA 5FEWA 5D87A 3RPDA 3R3JA 3W1NA 3C6QA 4DO7A 1WP4A 3L0OA 4ODIA 4LYPA 2CHFA 5EPDA 1Z7EA 2D1SA 2C59A 4BRSA 4ZV7A 1LTQA 3B48A 1I33A 4BDSA 2F1JA 3CAQA 5AKKA 3KNZA 2W6JD 4D9MA 5H70A 1NQOA 3NIYA 4Q6BA 4UOJA 3KQKA 1X1SA 4QQUA 4OATA 3GNOA 2ZB3A 4O4WA 5K9CA 1EF3A 1EPUA 1EUDA 4P0TA 4JL6A 1UMKA 5H7XA 3T55A 4LXFA 2G6TA 3ZLHA 4R1OA 3O8QA 2P65A 2YWHA 3M1YA 4ZAYA 2VUNA 2GBFA 3FUVA 3H2MA 3THDA 1SJBA 4MUFA 1EM8A 4HQRA 4DOMA 3FNFA 3TJMA 1PX3A 3U4QA 1XQYA 1RVV1 2CE7A 3OWOA 5AHRA 2C2HA 2QRUA 1FYWA 3H53A 2FFRA 3E15A 3FX4A 1SCUA 5DNEA 4IDCA 1BS2A 1RXYA 4Q24A 1XLMA 3WDIA 1VPVA 1KSFX 1ZXBA 4IXMA 4EAQA 1HYEA 1VPWA 1E4EB 3B52X 4DNPA 2CLFA 3U9SA 4LFBB 2WVVA 3R1IA 3AIVA 3Q3EA 5AW8A 3D6FA 3W8RA 4IX2A 1MW3A 2J41A 1OD8A 2F38A 2I57A 4YRFA 4ADTA 3ARZA 1K63A 3EKZA 4FR6A 1PDZA 2DH2A 1P8JA 4Z7QB 1OXBB 2AFRA 3H12A 4MJZA 3RCNA 3EXHC 4XAGA 2VATA 3JQRA 3LHWA 5HUJA 6ALDA 4O15A 1XYVA 3FETA 3P9IA 4JI0B 3B5IA 1I0BA 2GGGA 3GCXA 2BFCA 3A6LA 3TZEA 2PK3A 3GYCA 2BTMA 2OEJA 1QGDA 3ZHVA 4OXRA 3IDOA 4HNAA 2LDXA 1D4ZA 4LYJA 4WOPA 5FPPA 2V96A 4IZ6A 1X1OA 5JQGA 2VPIA 4XIIA 4GPNA 3K1YA 1A5CA 3MD9A 2CFCA 3WKZA 2ZUCA 4AEEA 3LQYA 3S2EA 2PGOA 5A4MS 4XOUA 3GDOA 1XF1A 3HH8A 5CFQA 1BWKA 4BVEA 5L6LB 2LWIA 2FKPA 2WZHA 4Y2WA 2CLMB 3GT0A 4EARA 1BE0A 4MI6A 5L3QB 1OFGA 1TTTA 2DERA 5CPSA 2VS1A 2AI3A 1A8UA 4L6AA 4A6XA 3CUJA 2HZBA 5C8YF 1LS1A 1RQ2A 5BQPA 1ELOA 3BFPA 3C14C 5HNKA 1O9GA 2IOFA 4XFJA 4UNLA 5DULA 4P31A 2V6MA 4DV6B 4EA8A 4HYTA 1GVIA 2L0XA 4U2KA 3ES7A 3D7LA 4M3NA 2GAAA 2FHSA 4NC9A 2YY5A 4AQ7A 1G6CA 5LXEA 4L8VA 5ALPA 1NLFA 1H7WA 3GNTA 4UM7A 1JJIA 2RE8A 5ADUS 1R4MB 1E0XA 3MWEA 2WNHA 3U57A 3GXOA 1R15A 3ZOAA 3KKKA 1NY5A 3LGAA 4H3KB 1QCZA 2AG5A 4S3CA 4RELA 5D5PA 1H1TA 3KE9A 3H3XA 4Z1MA 1JWBB 3BH0A 3PXXA 5EHZA 2CSXA 2R1NA 1H2JA 2VD9A 3HVJA 1TO1E 3L66A 3G0GA 1LH0A 4X85A 2A4KA 3IRVA 4Y2TA 4AZSA 2WC1A 2XZ9A 3WGYA 2EL9A 3P7YA 4O52A 1G4TA 2BW0A 1QP0A 1TW2A 5KSWA 1AMNA 2GKOA 1GTZA 2RI6A 1ZR4A 4HH1A 4MS3B 3BBPA 3AB8A 3NP7A 4CMJA 1T35A 2ZIVB 1DTUA 4QGSA 5K51A 3STHA 1W36B 4PZDA 4MQLA 4CKWB 4F0RA 4M1BA 2GX6A 4D45A 3HUUA 1CY7A 1GDDA 5A6SA 3I01A 1QB7A 3KOZA 2OCIA 3PHJA 4URVR 1Z8NA 2G08A 5AVTA 4WZ6A 4D81A 1FVHA 1QTRA 3MW7A 2MMGA 1CTQA 2MSNA 2JGMA 3DCIA 2C13A 4HLNA 4MRMA 4Q32A 4D72A 4EHJA 1TA9A 1C2TA 1EFHA 4JNYA 5FBZA 3VR2A 1LK7A 1IULA 1B0ZA 4DWJA 5LM3A 3JCZA 4JLMA 2C7GA 4QE1A 2XYVA 2GXUA 3WQPA 2BMBA 4KBGA 3S6TA 5JCPA 5FF0A 2E4UA 4MO2A 3NYDA 3QY7A 1ZK2A 2OCDA 3OQMA 4ZIRB 4MR8A 3EX6A 2AZTA 4OXNA 5MFPA 4A3YA 1XLTA 2X9NA 2Y3IA 4IX0A 1FP4B 5C55A 4GA8A 1NRIA 4Y2YA 2QIPA 4Y30A 1J42A 3QUTA 4GMXA 3JSAA 2WWDA 3L2MA 2W5FA 1PLKA 2Z9DA 3VGDA 3QVKA 2W6RA 1SQGA 3DWGA 3MLBA 3WMCA 3A6PC 5IVKA 3O9VA 4GABA 4GISA 1GU1A 2HCBA 5DMMA 1N0IA 2HKIA 2R82A 1CY6A 5GJVC 1QO0D 3I6MA 2I66A 1W0CA 3E38A 4IX1A 1XIMA 1E6KA 1GYNA 5M5BA 3VH3A 5BNWA 3ZD6A 4INOA 4AROA 4RZUA 1B16A 1KFBB 3WO1A 3UK0A 4COKA 1ONWA 4TUYB 1ADDA 2ZCJA 1Q0UA 1QH1B 3OX1A 4TO8A 1OZHA 2YOFA 4IBOA 1EBUA 3ZIAA 4B3MB 2TS1A 1SVWA 2XSZD 3IB6A 2Z27A 5IF3A 1RCOB 1H60A 5GM1A 3O07A 3BO9A 1ZRQA 3DBRB 3SZRA 1WSDA 4KFTA 1KQGA 1L5OA 1DIDA 2FFQA 4MGGA 3R8RA 1C1XB 3KL0A 2BCGY 2BI8A 3M5WA 1Z89A 4TVSA 2V2HA 3RK8A 2E28A 3P14A 3FCAA 3QE0A 1TEXA 3HK2A 1QWKA 3LPNA 1YJBA 3R7LA 3TLJA 2Y7GA 1SULA 4IMEA 3VI2A 2NIPA 1QJ4A 3KBWA 4YDRA 5D86A 3ZDYB 1EJTC 1E2IA 3NO5A 2JGRA 3AERA 3B6IA 2W2TA 1VRVA 1FFHA 1JRLA 4B9ZA 1OZGA 4I4NA 5B36A 4J3ZA 2J7GA 1H6CA 4C0JA 4GHRA 4AX8A 4WEOA 2QRGA 3W7OA 3EEGA 3LDAA 3A3WA 1JPMA 4JTSA 2R00A 4EIWA 3M0ZA 2PRZA 1SU5A 1H22A 3AVYA 3EKLA 1QP4A 3UESA 3OZIA 3QE3A 3AFOA 3WQHA 3NQVA 2EKBA 1MOPA 3V4PB 4UBJA 1UWUA 4H8NA 3RAOA 3IEKA 5A71A 5G1YA 1PFVA 3H5AA 1V0LA 1U63A 5GTDA 1Y5LA 3PWZA 5B2FA 2VM8A 1ZNXA 4QYIA 4OL0A 4ZVOA 2P1FA 3TW0A 4ZFMA 1R6DA 1GYMA 1DWIM 2WHPA 4CIDA 2Q4DA 1ZOPA 4B33A 2QZ4A 5CIQA 2Q3DA 5IARA 2SNIE 3ZXUB 1V3JA 3NOQA 1KLYA 3A4MA 2UXBB 1U9IC 1YRWA 2HWYA 1IBCA 2ZE0A 4B91A 3MHPA 2VPPA 2CLKA 1YR3A 1VBUA 2WJGA 3F03K 4XKYB 3OCVA 3VU2A 5F1VA 1FW6A 4UPEA 1G2OA 1VRXA 2PWYA 1II9A 1QVWA 3N15A 3OJCA 1YKGA 1J2JA 5JANA 1RLUA 5DMYA 4J0DA 5FI1B 1RCFA 4ALJA 1E63A 1SIUA 5LA2A 2NU7B 4LBWA 1TPUA 2I3DA 2Y9PB 3GY1A 1XQ6A 3NVMB 5KX5A 1P0IA 5EE3A 1E1EA 5DBGA 3VC5A 1GO2A 4IPJA 2NU6B 1T8UA 5K8LA 1M7PA 1XCOA 3D6NB 1ADYA 3KCNA 4JTEA 4P58A 1DUIA 3SEAA 4J3NA 3TWAA 3PEEA 5KAMA 2D5BA 1FBNA 2VOJA 1JSZA 2FQWA 3U3DA 2HMUA 1ZMOA 3LCVB 2PDLA 3N2YA 2GZMA 2NZYA 3C4QA 1C8KA 5HKLA 1IXRC 3GFYA 1WPCA 2P8CA 5EP4A 2POZA 2XVXA 4DR1B 4R7OA 3BAJA 3M6YA 3BE7A 1PX4A 2PUGA 2ZBPA 3MJMA 1WMEA 1RXUA 4U7DA 2WMIA 2WT4A 4Q22A 1NDYA 2O9RA 1K6MA 3S2UA 4CMEA 3WQFA 3PANA 4WUTA 4QG8A 4Q7JB 4K40A 1H2XA 3MAAC 2W27A 5CC5A 5KYYA 1TZ2A 3TCKA 1KJWA 4F5YA 2AMGA 2ZR9A 4W9NA 1LF1A 1KV8A 4A22A 1AW1A 2X77A 3L77A 3EEYA 4D99A 5BP7A 3TYEA 5EGSA 4RULA 4MVJH 2CBUA 2A2IA 4D3ZA 4C9BA 1NW5A 4XIMA 3DG9A 1I5EA 3KQNA 1ETHA 3A47A 2P2YA 3MQ2A 3WP0A 2HEJA 1TECE 3LUAA 2QUKA 1HDZA 4EJ0A 3FA4A 1GNPA 2MSLA 5EE9A 7YASA 4M9SA 4R8RA 3IS3A 1FPQA 1XU7A 2D00A 5L7WA 3UPWA 1AOXA 4I5EA 4XVCA 2DSTA 4XKYA 1SBIA 1PYMA 4PVCA 2MSDB 3LLCA 3DLAA 1RHMA 4TS4A 2C3MA 4NBSA 5DRYA 2GEDA 1RVGA 2PR2A 5HF5A 1Y8RA 1F20A 1E60A 3T7TA 1WPXA 2UY4A 1T2CA 2EW8A 1U6KA 2JIBA 3QIAA 4FNOA 3L0KA 1G0CA 2IYZA 4A3UA 4Y9MA 2QYOA 2FHCA 2Q3LA 1RPAA 4DV4B 3DBHA 4JJAA 1CUYA 3C7TA 1VMAA 2GJRA 2ZI4A 5DU2A 3EULA 2GEJA 4KIWA 3D02A 4LAOA 1L6FA 3HM2A 3UD6A 4LJAA 3ONFA 1G8MA 1XAHA 1W1WA 5LD2B 2QMYA 1UZLA 3OPMA 2VTEA 3QRHA 3CO8A 1M6HA 2CLLB 2XKKA 2WK2A 4TKUB 4DKJA 4O1DA 3KZNA 4W88A 1EIWA 2PDIA 4LJRA 3M4JA 3UHOA 3SR0A 3GQVA 3IQZA 4UMVA 3FNBA 3EOUA 4UUMA 3Q7QA 2ESCA 4TXLA 2RCYA 2RAGA 2ZOSA 2WUFA 1WXGA 3ZJKA 5K99A 2P69A 3PNVA 3QG1A 1E6RA 1DEAA 1GGJA 1JCTA 1A7JA 2R7AA 3HJCA 1L4MA 2WHXA 3E3NA 4LNUA 3M1LA 4MPRA 4QLAA 3JX9A 3BMCA 2MT9A 1ELSA 2MYTA 3PF3A 1KLZA 2BFDB 4IHKA 5GJWC 1T36B 2N75A 2ZG6A 3JASA 4F3TA 4C06A 2FYTA 3BMWA 2QTMA 3NVKI 1DC5A 3A1EA 4X66B 1NVTA 2NU9A 5AJZA 5XIAA 5AM0A 1Z7WA 1GFZA 4AY8A 4YDSA 4UUQA 1J2WA 3FPEA 2QCHA 4FKZA 4MVWA 4BO6A 4FXFA 3ASYA 3PAJA 2QE6A 4DNMA 3RVLA 1MIOB 3V0SA 1KSHA 4JFVA 4KGDA 3HFSA 5A03A 4HHEA 1CDGA 3C1AA 4V0NA 1HNNA 4NHEA 1FJHA 4IMJB 3TB4A 1U0OC 1OH5A 3CONA 4HCHA 2QN9A 1P2TA 2P8JA 3HKCA 3PD7A 4JU8A 4LC0A 4CQDA 1EJRC 2XN2A 5ALQA 3CCBA 3GPBA 2BASA 1VE7A 1TX0A 4I1YA 4NZMA 2F8SA 3SCRA 3DFPA 2Z0MA 4D9NA 2IGTA 2LPMA 1XNRB 5GINE 3L6RA 3LC7O 3ZGOA 3J7AC 2JJ2D 2W6MA 3L7DA 1XU9A 2AVNA 3LP8A 4PTLA 3BG9A 3HXOA 3AOGA 3S1GA 3T99A 3ANYA 1ECLA 1K7XA 2V5JA 3CEPA 4NQ1A 1GQ2A 3BOXA 4YN5A 1G8HA 3Q5DA 1X1CA 1TE2A 1ORHA 3A5FA 3L4BC 3ONDA 2VHCA 3PB2A 4O1CA 5BSFA 2QM3A 2EP5A 4LVFA 3C74A 3Q87B 3QTGA 3P80A 1FFXA 1FWWA 1DAKA 4EJMA 4BFLA 1GTSA 4FSDA 2AFVA 5JS1A 1AN0A 2DPLA 3UUGA 3H5IA 3WJ2A 5EZSA 3INPA 2GK6A 1CXZA 3GXFA 5AVOA 3SCNA 4OF4A 4U28A 1D4FA 4LF6B 3MHUA 3AROA 2NX3A 4DA4A 2W00A 2RGYA 4IQDA 1GCIA 3L05A 2JIEA 2WSSD 4G1FA 3G1VA 1BMFD 4NX2A 4WLNA 4PMDA 3IQWA 2QB5A 3FNRA 2F7SA 4LY3A 3TJIA 1R8SA 3CCFA 2R1VB 1PDOA 3K4AA 2R1PA 3ZGXA 2AJCA 2WJ3A 2O50A 1Z2CA 3BPSA 5BUQA 2HC9A 2DZVA 3WX0A 1PYGA 4ZYTA 3A7EA 4CU7A 4LYGA 1DADA 1XRRA 1T2DA 1DX4A 2BAGA 2IU4A 3WDKA 4JXXA 5LP6A 3MG9A 1E6CA 4I3FA 1E7YA 1WY5A 3QKTA 4EXBA 3BYZA 4IOMA 2CFRA 3UMRA 2J0UA 2BFFB 2QOEA 5EP1A 4PGFA 3KLOA 3PGA1 3LVBA 4AK9A 3EQ8A 1Z4MA 3C8ZA 3B12A 2B37A 4C65A 4MGEA 1P17A 3AVPA 1PFKA 3OMWA 3AR8A 1R9NA 1FMLA 1X7XB 1AH4A 3PTMA 5IVPA 5D9MA 3UC9A 3EG5A 2IUEA 1YJCA 2O9JA 4PIPA 4E46A 1ZBKA 1R18A 3N53A 1L8QA 2HSDA 2FCRA 1DKRA 1V6AA 1WVIA 2XH0A 1IIRA 4EG3A 4WSJA 1KAMA 5CFPA 1OC2A 3TLYA 1CERA 4GI1A 2YR1A 1EA0A 3ZWBA 4MZDA 1EA5A 1QATA 4M9CA 2C2YA 1G4PA 3PRKE 3ANYB 3R13A 4WX2A 1YQ2A 5BR7A 3NNDA 1S2LA 2P9JA 2G17A 1E4OA 4RA9A 2A0YA 1EI9A 3LWDA 1S5TA 4DBEA 1HUQA 4C6KA 1T5IA 3UZ5A 2ZRNA 1P9RA 5DRIA 2VUHB 1OF1A 1TM4E 3GVVA 1QNOA 3TX9A 5AW4A 2H2FA 3P2IA 2GK1A 3LKVA 4C90A 5FHRA 1TO2E 2RK3A 2WU0A 4I7UA 1AKNA 2BHTA 3M82A 1ZW1A 4GHWA 5L4LA 1YVEI 1SW7A 2QTHA 1IXOA 4AMCA 3LLXA 3H2BA 1UP7A 4XWWA 2B20A 3DUWA 4LRYA 1WZKA 3KLPX 5KOHA 4N0RA 3O8QB 2J9FB 4FZJA 1CUFA 1JPNA 5SZIA 5CB4A 4HYVA 4YCDA 2ID7A 4D71A 4RHFA 1X0XA 1U5AA 3HJHA 2NUBA 1UZUA 2QIWA 1KI4A 1JA0A 1JBEA 4CNBA 4G37A 1DRKA 3DIPA 1TVEA 5I3CA 3DDSA 4S3FA 3K15A 2XDFA 4K1GA 3EA3A 2GA9A 1XTVA 3T0TA 3X1ZA 3B78A 4QIHA 4GQRA 4KHZA 4DZ5A 4ACZA 2D5AA 3REQA 3CPUA 1MB2A 2ZRZA 4DLWA 4HDSB 5BV1A 2XVMA 1P7TA 2OUKA 4DJFC 3EEFA 1GD1O 3DV0B 4I6KA 2W6JA 3H54A 3AWOA 4F9JA 3UZWA 1F8YA 1PJCA 4KK4A 1X7XA 4B8ZA 5ALGA 1G19A 2ZVRA 1CUZA 1TQ6A 1WZ2A 1O89A 5KI6A 4WK2B 4DWSD 4GI7A 3IT1A 2J3QA 1GTRA 2PDMA 3ZWMA 3PXDA 2XNDD 4W9RA 4US5A 2G7MC 1P2DA 2E4TA 1BVYF 2OZLA 4AN4A 1RXOB 1PJ8A 5HM8A 1VE5A 5FI0B 1FH9A 2O1XA 4MWSA 1M7BA 5KNBA 4EYQA 1NBMD 3ZXYA 4LPCA 1KNWA 1ZCBA 2QMEA 1G9TA 3NQMA 1EK2A 1PWMA 3B8DA 1E59A 4P5EA 4BMDA 5BUSA 1E2EA 1V8BA 5ALNA 4IZGA 1JDPA 5AC5A 2DKFA 4HVCA 4A9AA 1BYUA 1TD9A 1VFHA 1T3SA 4LXGA 1KMHB 4XIFA 4MVJP 3M5CA 4UVIA 1RFGE 4RXGA 3RITA 1KCKA 2PZEA 4YONB 1D07A 4DTIA 1E9FA 2CDCA 2FPPA 3TQIA 4X54A 4MPTA 5DNAA 4EUEA 1TF5A 1RSCA 2VTBB 3C7KA 2O9OA 1XRTA 4GBMA 3Q4GA 3MLEA 2VX6A 2AV6A 2F4VB 4IOTA 1MQQA 1RWXA 4MQBA 4UD6A 1CP3A 1SVDA 4YJFA 3LXBA 1I1NA 5FR1A 1XL1A 3LP6A 2H00A 4YHGA 1VLQA 3ZD7A 1KVUA 4NWIA 5JFTA 5IX8A 3HR7A 5TPWB 2YHSA 2OAQ1 1JZ2A 1EJ0A 3RLHA 1EYEA 2FZNA 3FFBA 1VB5A 1U9YA 3N6RA 1FYDA 2GI4A 2ISCA 3V5NA 2Q5OA 3SHTA 3LUJA 4NU6A 4LF5B 2AEJA 4OMCA 1DP0A 4FFOA 5L53A 3TEVA 1Z5OA 1JKIA 3KVRA 4A73A 2ASVA 2CEKA 4YT2A 4ACZB 1SVLA 4XSGA 2G4CA 4N65A 4C21A 4ER6A 3T7SA 2DYKA 1R12A 1KWGA 1C3FA 3ESZA 3W7AA 1XU4A 2VQFB 2C16A 1USIA 3V4VB 2PDPA 5CFRA 1PR3A 4L2IA 1WEHA 3TFWA 4M37A 5LSAA 5A7FA 1G0OA 4DMLA 5EQDA 1L6IA 2GPTA 2VT6A 1XZCA 4EG0A 1VXRA 3CO5A 5KQGA 2FUNB 2I22A 1CZ1A 3A9VA 3S1LA 3B0VC 2AFHB 5KYWA 4RY8A 3S6JA 3B3DA 1LPOA 1JUDA 1ZP3A 4IQEA 5EHGA 5JUWA 1S2VA 2DHQA 1VJTA 1BXBA 5C1DA 4TXMA 1W5BA 4W7WA 1R9GA 4LF8B 4RA6B 2EFDB 2WMGA 3ICVA 2D2XA 2YDYA 2LRHA 4XQ0A 5CDYA 3QLTA 4PLVA 2GYUA 1JJ7A 1TKRA 2V9DA 3PXCX 1M2WA 3RVDA 4S3MA 4MR8B 1SBZA 4E5TA 1MZHA 2FZMA 4KYTA 3LGEA 4B5NA 4B90A 5JLAA 1GZ1A 1XD8A 1XZPA 2CVQA 3QTTA 2I16A 4PFKA 1EVQA 4QPJC 4OXXA 1XLTC 3DHDA 1V4VA 3VYLA 2JQXA 4LMAA 1OWQA 4RNFA 1I75A 1UR2A 2BDTA 5SYNA 2XLBA 4D4KA 2CLOB 4Z9YA 4XAZA 2BS9A 1GUFA 2AJBA 5JCJD 2Q45A 2RDXA 3DVAB 3FPBA 4UUAA 5DYGA 1IOLA 2Z43A 3MT9A 2BM9A 4OAPA 4HYQA 3MP5A 3MM4A 3PVFA 2RHLA 5IDQA 1SR9A 2PXXA 1LJ8A 4N3AA 4F92B 3KZXA 4DA7A 3LY0A 4FMBB 3K71B 5EMJA 2EPMX 5HBRA 1KF0A 3O8AA 1UJQA 5HKOA 4JP2A 3BGGA 4I4TB 1Z0IA 4QISA 3TDNA 4JIHA 5A6MA 1DLIA 3OCCA 2ATXA 4MKFA 5AMXA 4HGZA 4OI4A 2CIPA 3ST7A 5J2UA 1JJVA 2QTVB 4BB9A 2R8WA 4GMDA 3WH7A 4GPBA 1TREA 1W46A 2P75A 3VSAA 2YVUA 5M03A 3LA6A 4MCJA 2XIOA 2ZZ1A 2ORYA 4KGZA 2OXEA 1ADJA 2BFBB 2ODBA 2A3BA 3LKBA 5CA1B 2DZWA 1JAEA 1QNFA 3K9BA 4BQPA 3TKLA 1RXEA 3HB1A 3LL4A 5BSVA 4YWSA 1YB5A 4TV9B 3I68A 4BI6A 1ODJA 5THKA 2QNRA 3W7MA 3BE6A 1NOFA 3U0HA 1I30A 1WZNA 1WTCA 2ZX5A 2MTBA 3L6UA 2PWZA 1CZHA 2FU5C 3CUXA 4NYMR 4HXYA 3OJXA 5D00A 3UICA 3GNNA 5DHFA 5MN6A 4JBGA 3QHPA 4KQEA 4Q37A 3ITYA 5EUQB 5ALVA 4H9VA 1WXIA 1YRRA 5K8JB 3SVLA 1Y5XA 5FXMA 2PVCA 3SSJA 1IHUA 4PTMA 3GRRA 1GKPA 3PBGA 4HKPA 3NGLA 2GJPA 1M6VA 4DJDD 1GCGA 4B6GA 4LF1A 5DY3A 5K3VA 1JQBA 2Y76A 5K1ZA 2C20A 5C81A 3B20A 1SJAA 2VFDA 4J0IA 4HSHA 4WLEA 1DXEA 2YIHA 2WAOA 4OMFG 2DQ4A 4E08A 1M2FA 1XKQA 4A8HA 2Y7FA 1IOZA 1Y7LA 1GOMA 3BWBA 1OLUA 5F2LA 5F4BA 3HP4A 2F2KA 4MEJA 3MYPA 5JVDF 4V0LA 1YXDA 1CW2A 3GDBA 3A9UA 3G1AA 4M81A 2DKOA 2EGGA 3KUUA 4DC1A 1EPVA 1OILA 2WMJA 1ACLA 2CXUA 4I55A 1GTL1 1G94A 3MCUA 4HOYA 2AQIA 4PF1A 2YJ3A 2Z1XA 4ND4A 3P32A 4P7LA 2PS0A 4WUVA 3WFLA 3HMCA 1UFVA 3ML1A 1QK3A 1B3YA 4D9GA 4CXMA 4MVJF 4ZCIA 1CUGA 4EKGA 1QI0A 4XAFA 4DB7A 1QGOA 1PR5A 1QGED 1NJ5A 3T9BA 2IYQA 2DQKA 1KS2A 1WV1A 5EHXA 4MV1A 2H1HA 5D2XA 1G7CA 3SQXA 1C2YA 1L5GB 4GMFA 3OBEA 4D6IA 4D3XA 1XCXA 4EF4A 2PDQA 3F8SA 1A80A 1DG3A 4L3VA 3CLWA 2UVQA 1EP2B 3S8MA 1RYBA 5CAEB 1FYVA 1NXVA 3I04A 3G5AA 4FA3A 3H6KA 4AKGA 2WA2A 1V5GA 4JXKA 3WF3A 1ZINA 3KU1A 2RHWA 3SOZA 3T1VA 3WQCA 4JLKA 4GE3A 4K39A 1CY0A 5KNDD 4BMNA 4M0KA 1H7OA 4C03A 3GLHA 3PQCA 3E0XA 4S35A 2W2XA 4BC0A 4DLPA 2YCLA 3UT6A 3AIWA 3FYDA 3ZH2A 4RTPA 3WL7A 4OQPA 1YA8A 4GWLA 2HDJA 1LI7A 3PNMA 3VZYA 1K8CA 1NYQA 3QMSA 3CMMA 4B80A 4EW1A 3LY9A 2AC4A 2PJDA 3HN6A 3D2AA 3GQBB 4A0GA 2GTPA 3GZ4A 2ZBUA 5IKXA 3NONA 1OCBA 4KX5A 3RARA 4J3XA 3M4YA 3N3MA 3UWQA 3OLDA 4RH3A 2FN9A 2FW1A 3L1HA 1ST2A 1Y3FE 3USBA 2Q6VA 1ZZGA 5HJ7A 3RJ9A 2OBLA 2XTAA 4HOZA 2E6YA 1OBVA 4R05A 2HMYB 1WKFA 3LZ5A 2GBPA 4P3YA 4FX5A 1E3QA 1YRAA 4BQFA 1QIDA 2O7QA 4EG6A 2OZ0A 3UWEA 5DEOA 5FULA 3DOFA 4YN3A 3TNYA 4QC2A 5FD8A 2H48A 4P6VF 3FAKA 4M9ZA 2ZB4A 1N4DA 3KJXA 5BPFA 1AUOA 1RYHA 4HHPA 4ZI7A 3IAPA 4RFVA 4PUEA 3A36A 1A95A 4ND2A 3W7NA 3G0XA 2V7EA 2ERXA 2AJLI 4HPWA 3K6JA 3HPRA 2WTBA 3GQYA 4HZUB 3SM3A 2Y1GA 5CLWA 5A5VA 5F23A 3LRTA 4N54A 4MM1A 1EFDN 5HNNA 3T15A 1TYCA 3VC3A 2ANCA 5FACA 3U17A 4IFBA 1ZOSA 2WHQA 1X1AA 4RPLA 4C5BA 2YFNA 3TKFA 4D79A 3WRVA 2VEFA 3TR6A 1V0NA 4MVCA 1K5PA 3F4CA 4F6RA 2H3BA 1YIAA 4MQFA 4KX3A 5J04A 4BJHB 4YCBA 9GPBA 4HBZA 2FV8A 4D9BA 5KYGA 4YWHA 1PF7E 3VOFA 1H5NA 1J97A 4DCNA 3KFLA 1H6BA 2ZUSA 4HOWA 4YCOA 4NBUA 3TQFA 4D26A 3K2IA 4BV3A 3AI7A 1WHSA 3P74A 5ELXA 4FGWA 4DCTA 4C0BA 4L5IA 1QHXA 2ZSKA 2A3RA 5EJGA 421PA 2JW5A 3IBFA 4QDZA 4QHTA 3PB3A 2R97A 3EVEA 3FDIA 4FFSA 1T0UA 3FEMA 1CR0A 3CGWA 4XAYA 4HJWA 1UKBA 1ZDMA 3VVGA 1U9ZA 1JVSA 2OP0A 3DXIA 3UYKA 1HE5A 1QO0A 3IP6A 4OX9B 1NT4A 4R1MA 2WF5A 3O3OB 2HA0A 5HDRA 3E5HA 4IO1A 1ZU5A 4X6YA 2YZ7A 1XCWA 4EKDA 4OKSA 1GUBA 4EUKA 4J75A 2EVWX 3B05A 5FEUA 3EFHA 3ZZ0A 3EARA 3F49S 2X41A 2FIQA 5DTQA 2PA0A 1Q19A 4UTKA 5AC7A 2R47A 3H5RA 2ZI9A 1ORWA 4TT3D 1NRJB 5DM1A 3WA6A 3FYUC 4Q4HA 1U0FA 1Y9DA 4QFUA 3R0UA 3W8DA 2R8PA 3V8RA 3IP7A 5IAJA 3KETA 3PK7A 1CR4A 1OVDA 1JIXA 4LDQA 3MMPA 3IO5A 1KFJA 1G3IA 1XX6A 1Y6QA 3VIOA 3SY8A 2OV1A 5COBA 5AO9A 1MGPA 4H7FA 2R1VA 1W31A 1K8XB 1ADFA 1TJ5A 1OSNA 5D3ZA 4CR7A 3CVXA 2DVXA 4CF4A 1IDOA 4DT1B 4GUJA 1XS2A 1OBFO 1GORA 4BFYA 1W7AA 2Z1SA 4HN9A 4H8VA 4YYZA 2BVDA 1P8AA 3O8RA 1J0KA 1QTWA 4R81A 2WW8A 3PPIA 3W1RA 4EB3A 3D64A 3WK4A 1L7BA 5G3YA 1U5JA 4BCEA 4UU8A 3DL2A 5BUZA 1MPXA 1EGMA 1NYRA 2JBWA 3NYRA 4UVHA 2O3TA 3IRUA 3W2GA 5DB4A 1QDLB 3WH6A 1SJCA 3HOJA 3ZXSA 1SCDA 1RWBA 2EQAA 2CZDA 3SJAA 3A1FA 3AKCA 4UASA 2JLWA 3W8NA 2W5UA 3LCCA 1F4VA 3MN1A 2W71A 1DAGA 3IUYA 1N5DA 4BDTA 2JI6A 3VFLA 4YMGA 2YZMA 2J3DA 2Z29A 4BFTA 1GN9A 4AAYA 1VBKA 3LZ6A 4S04A 3QQ1A 4Q9DA 2QRZA 4RDXA 3A31A 3DTVB 4O8AA 3TE9A 5G1TA 4L9WA 2XCLA 1A8HA 5SYAA 4R41A 4CG2A 3AHCA 2V3WA 3ZLUA 1H0SA 1FUEA 1P29A 2XMBA 4CFYA 4UNIA 2ZJ0A 2VJYA 5AI9A 4G56A 4EHAA 1QAPA 4BNGA 4WSHA 1OYBA 5F78A 1IEQA 4GXMA 4BNFA 5HJLA 3Q2DA 3LRPA 1KBKA 2Z8ZA 3LVRE 1Y6FA 3GU9A 1RNLA 1A8PA 3SK0A 4BNUA 1AQ6A 2O8BB 2VDGA 3O0FA 3CW8X 3A4YA 1SFRA 4CKWA 4GICA 4OXQA 4YIKA 1CJUC 3W70A 1Y0EA 1HE1C 4ERGA 3P19A 3SXUB 3N6QA 3RE1A 1EXPA 4PS0A 4HN2A 5J5AA 5K3CA 3BHIA 4LBVA 2V98A 1U3VA 3PZNA 1UMDB 2DP3A 3NCTA 3S28A 3LPOA 1YJAA 1JA9A 2X4LA 3ZCQA 4XWOA 1PL0A 2ZRHA 1OI2A 4XE5A 1FLVA 1W1TA 6LDHA 4RTKA 1I6LA 4BEBA 1W30A 3COWA 4C4PA 5F3RA 1T7LA 4EAMA 4RS4A 4JC4A 4QO7A 4UHCA 4C7KA 5CFMA 4QGCA 2FR8A 2ZXEA 1OWMA 5ABHA 2OAEA 1M68A 3MDWA 4BA0A 4GY1A 3OTQA 3P6LA 1E3JA 2ZWOA 1V16B 3I3OA 3VKJA 5CXSA 3AHTA 1KZ4A 4MNMA 1HYGA 5AD1A 3EXFB 2OSXA 4Z4QA 3L4KA 1N2JA 5AT1A 4FLMA 1PCXA 4CR6A 2WG0A 3H9UA 3ZIAD 1A0CA 3HVKA 1IXNA 2ROQA 4MAFA 3DHUA 4DM2A 1ONPA 3UPUA 4UQEA 2JFVA 1YQXA 2QJWA 1Z32X 2B8WA 1OKKA 1H3GA 4UUNA 4ZCTA 4JKOA 1BRTA 1K98A 3LLMA 1IV8A 1B3VA 1MQAA 3B0PA 3NT4A 4FN5A 4DO6A 1G16A 2XG9A 1O96B 2D5IA 3VDNB 2VAXA 4D1JA 3M8KA 1ICQA 1KAGA 1QRUA 1H09A 1Z88A 3H42B 1JEZA 1IZCA 1P6WA 4H3DA 3G1DA 4U6SA 5FWDA 1NP6A 4IJUA 4Q00A 5JH7A 1F61A 1HZZA 4JWTA 4QU8A 4OFXA 1HJQA 2VJBA 4N0EA 1UBJS 3SHFA 3RK1A 4WXMA 3OSUA 3GG9A 3GLFA 2PXHA 3KVMA 1MC8A 3EZ9A 1NVMB 4ERIA 4WDXA 3VZQA 3GC5A 4YPFA 4KW7A 2AXEA 2Z9BA 1Z2EA 5L45A 1KO5A 3H9GA 1FZTA 1DIBA 1P0QA 3DBOB 3GRPA 5I4IA 4U8HA 1I2MA 1UK9A 1PSZA 1YKWA 2WAMA 1NJ6A 3B0UX 3DT8A 2GILA 4GO8A 1TQXA 3WMBA 3FVQA 2GZ1A 3ZLVA 1RBQA 1XZQA 4C4AA 4I55F 2C2ZA 1CF2O 2EJVA 2D0HA 5AK6A 2R6JA 2YL8A 3IA7A 1O0BA 3SJUA 2QGHA 3KCLA 2JH9A 2EAWA 1J12A 3TNFA 2B31A 3PQFA 1UKTA 2GJ8A 2Q3HA 4GQIA 2JFNA 1PJRA 4WR3A 1QHYA 1L9XA 2GVDC 3MIZA 4XDZA 1XMOB 1APBA 3N19B 1KEEB 2QLMA 3LNCA 4Q15A 5CR9A 1TVKB 5CP8A 4TZKA 1JDUA 2WD7A 3C87A 5I7AA 3IFSA 2LBPA 4MF4A 3R0XA 2IWRA 3FFSA 4HSOA 2WWXA 2V5LA 1XC4A 3EXFA 1CR6A 3UJCA 2PGIA 4Y90A 3ONBA 1W8GA 2BEWB 1ENZA 4AXXA 1G5QA 2X4DA 4R9RA 3RSFA 1JQAA 3U31A 4IXNA 3R09A 3LBNA 1EZ2A 3LXXA 3TW6A 3ZTWA 4KXWA 1JTEA 1B5TA 5AICA 3N2EA 4JT8A 2PUCA 2PLNA 3HYNA 4Y1GA 1AJZA 5CDHA 2J79A 3AR5A 2X13A 3BA6A 3HN7A 4JL2A 4UHJA 3OFKA 5FTWA 4HN8A 4DZZA 4DLFA 2FR8C 2GLUA 4QROA 4UVEA 2JKZA 2OFWA 3CL7A 1DCFA 5THXA 2ZGVA 4FK8A 1YDEA 4HGQA 1QWSA 5A3VA 3Q40A 3BKXA 1SURA 2VH5R 2CUKA 4W6ZA 5BVHB 4CM8A 2AN3A 1K89A 1CRWG 5EHNA 1BJTA 4BU0A 1Z0AA 3LWNA 4GD3Q 2FDRA 5EXEA 1PGPA 1NWCA 2YXBA 1LF0A 4P54A 1TMQA 2WV9A 1I2QA 3HPFA 1JZ4A 4A23A 1I1WA 2NTNA 5A0TA 1CJVC 3ISVA 5I8WA 1DC3A 2AE2A 1TI7A 4G0UA 1UPBA 4LS2A 1RRKA 2XT9A 4DXVA 2HBZA 5EJ7A 2OCGA 5JROA 2QG4A 1KMIY 3VHXB 1O0CA 2BXVA 2FPKA 2NUTA 1HQDA 1I4NA 5JBDA 5I3JA 4O8CA 3CUHA 4PZPA 4H18A 2Z04A 4M22A 2WYSA 1V47A 3QLEA 3U5ZB 3R0KA 2RGNA 1TK9A 1C3EA 1F3OA 3P4XA 1R9MA 1NKVA 1JLMA 4DY4A 2QVNA 3FOCA 5A8OA 3G2MA 3UF9A 2NG1A 4ML9A 1NE2A 4EL0A 2FEWB 1AXEA 4TX1A 1FWGC 3PY2A 3J7TA 1GADO 3DDMA 4HDAA 2B0JA 4XGKA 1HLFA 1KZ7B 4TQTA 4QDUA 2JDIA 2Z6VA 3C45A 4E1BA 2QUHA 3CSUA 3VBEA 4ORMA 5TIMA 3WNVA 4NOLA 5I4CA 4J2MA 1EEXB 2HRRA 1KAHA 1CS4C 1PL7A 1BGWA 1PIIA 2WSBA 3MB9A 1VRDA 3W90A 1XH2A 2VHTA 1FPMA 4YS1A 2E87A 3IXMA 1P5ZB 1SO4A 4MAMA 4N8DA 3WGQA 1T8RA 2P91A 1G0NA 3A6OA 2W42A 4K03A 2ZVPX 4NJIA 3IEMA 3NCHA 4MIEA 2C4MA 1QV7A 3ZNPA 1LUCB 2F1IA 3ZCUA 4KLZA 5CPMA 3I5XA 3LNTA 1J1IA 1QF9A 4YJ3B 3DI0A 4EF6A 3W53A 4ROTA 3DM9B 5IAKA 4XWUA 2V7QD 1P5JA 3PJRA 4JJZA 4GX1A 4RNDB 1EWYA 3ZGZA 4CMIB 3OIHA 1NVEA 3LOTA 2ZSBA 4G5RA 2X2PA 4EELA 4IFTA 2YVLA 4CM8B 4MY9A 2Q5CA 2DTDA 2ZAOA 2ORWA 1GOQA 4JI3B 1TVNA 4KBFA 3LHKA 2CZCA 1IQ8A 2HBVA 1BXZA 1Y3IA 3WNMA 4J0GA 2J9GA 4GPEA 3RIKA 1BHO1 4M88A 2VZ0A 2QYHA 3R1ZA 1KFKB 5FWXA 4EPXA 3VKBA 3NM6B 4KNYA 2GSWA 4IQ0A 2XYQA 3QF4A 3RM8A 1DC7A 5K8IA 4BQ5A 1IN7A 4AP6A 4ZVPA 4Z54A 5K3FA 4RDWA 3G8EA 3F6EX 4BO9A 2H4ZA 3CLKA 3QYAA 4UXDA 1AE1A 3WLHA 5K0LA 1YRLA 4C4TA 2P68A 1CG6A 4PMZA 4DPLA 4FEZA 5DI3A 3K35A 3L4BA 3TLCA 3NNTA 1R0BA 3A9TA 5IT9A 2D22A 2YL9A 2HQSA 4TRJA 3UXDA 3QFFA 4Y2RA 1NUAA 4BZYA 3A3NA 5DLPA 1I6KA 3DAOA 2XN0A 1A9PA 2E9LA 3SQNA 5I7WA 3Q58A 5H8PA 4G5GA 4EW6A 2B9EA 4EK9A 3HXKA 2JG3A 3RM9A 4Y9UA 4ZCSA 3I1FA 4JQSA 2EC5A 1P44A 2X0NA 5LKRA 4DIEA 4FHDA 5G4EA 3H99A 2PE5A 4CLOB 2AKAB 1C0IA 1DQUA 5A6BA 2JLZA 2BP1A 3NAGA 4TGLA 2FLKA 4D4GA 4UEJA 4QXPA 2PFGA 3RUDA 3VR4A 1SM4A 4IJVA 2C14A 4LJ6A 1CXKA 3KTAA 4JYEA 5HHTA 1ZBWA 3DFYA 4A0HA 1GPH1 3M4XA 1GTMA 2QUMA 1NI4B 1U9JA 7ADHA 1LNZA 2C3OA 3GRZA 3A9IA 1E94E 4WLOA 3N2CA 2NX9A 3RJYA 3QVGB 2VAWA 2ZC1A 3PKZA 3GLGB 5FPHA 1L4NA 5FO0A 1KJQA 4DXKA 3PBKA