5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GLUCOSIDASE
publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
4IIFA 1EX1A 3ZZ1A 4ZOAA 4GVGA 4MSSA 1TR9A 3WLJA 3WO8A 4ZO8A 1IEWA 4IIDA 3WLQA 3NVDA 3ZYZA 1J8VA 5BU9A 3RRXA 5FJIA 4IICA 3WLRA 1X38A 1IEXA 3WLSA 4I8DA 5IOBA 3GSMA 5JU6A 3WLTA 2X40A 4IIGA 4GNVA 3WLKX 4GVFA 3WLNA 3SQLA 4GYKA 5FJJA 3GS6A 2X41A 3AC0A 3WLHA 4GYJA 4ZOEA 2OXNA 3USZA 3WLLA 4IIEA 4ZO9A 5C0QA 4GVIA 3WLOA 4ZOCA 4IIHA 1IEVA 3WLIA 4IIBA 4HZMA 1Y65A 4I3GA 2X42A 3UT0A 1LQ2A 4ZOBA 5BZAA 5TF0A 3LK6A 3WLPA 3WLMA 3BMXA 3TEVA 4ZODA 3U4AA 4ZO6A 3SQMA 4YYFA 4ZO7A 1X39A 4GVHA 4G6CA 1IEQA 5G1MA 3U48A 3ABZA
chains in the Genus database with same CATH superfamily
4CD8A 3NM6B 1T8SA 4MA4A 2OZLA 4ZFNA 1YIAA 2BH9A 2OV8A 4BNXA 3M6FA 2HRQA 1NDHA 1NOJA 4C6FA 2I8CA 2OSBA 1AN0A 4W5TA 1GR0A 5A5WA 3H22A 3WK4A 4GX5A 3FFAA 2IZ7A 1JTFA 2JFEX 4M1MA 3AZTA 2HEGA 4UXIA 3P8JA 2CZGA 3V1LA 3RVNA 3LL4A 1V45E 3K1AB 1SU5A 4YA6A 1A5OC 1DBIA 3H04A 1HFKA 2JI8A 5CG2A 3LZ6A 2O2HA 2FZMA 1CXLA 4JL1A 4N4QA 1LDYA 3JD0A 2ZJOA 1E1NA 3M6VA 3MJHA 1L9XA 1BU8A 4AZWA 3UH1A 1A5NC 4HGPA 2P2NA 1ML4A 2E1RA 2EO7A 2WIGA 1QVBA 3ZWBA 1LX6A 1TTQB 3JVDA 5FCZA 3R58A 4CM8B 3C56A 5DBUA 4C4ZA 4B46A 3SNHA 2CT8A 4R2IA 1ENYA 2NVOA 4J0JA 5HKKD 1V35A 1ULHA 5DMNA 1G5HA 4HNTA 3NM4A 4R51A 1L6IA 3ONNA 1ORIA 4H8VA 2FMFA 4Z4QA 2REQB 4J16A 3WYNA 1ZZGA 1N8FA 2XODA 4PLFA 5LYRA 5DBFA 2FMTA 3GXOA 1E1CB 2O7SA 4E32A 1PSZA 3U37A 1YQ9A 2ZE8A 4Q48A 5TQLA 4US5A 1TA0A 2XLCA 3SU8A 4JGDA 1A0OA 2CLHA 4K6CA 2WPDA 5SZKB 1K3TA 4KMRA 1P6XA 2JPDA 3ORWA 4KGLA 1OFGA 4OA8A 1ZSVA 1MT3A 4WDUA 2GGJA 5KUTA 5JYEA 4GE0A 1OFRA 2VDLB 1WM1A 5CU7A 3BAXA 3OZAA 3AJ9A 5BXYA 1RHQA 3N4EA 1JZTA 1EPUA 1E98A 1C0LA 5JBQA 1ZA1A 2HO4A 4QJ4B 1JECA 4MJ3A 3FNRA 1WXIA 3IB3A 4JHXA 2RARA 3ZW9A 1ETUA 1TLFA 5AKKA 1ZIOA 1B42A 5JS2A 1V1JA 4W9TA 1Y1TA 1NONA 1NH6A 2GK1A 4UFIA 5ECDA 3HJEA 2DTEA 4O5OA 3UZ5A 1N2ZA 5A8PA 3M8KA 3BX1A 3OTGA 2YCJA 3VM5A 4B3MB 3NVAA 1XQLA 1SZEA 2PBRA 3PUGA 2HDJA 4EBFA 1H51A 3DWGA 3VA7A 4YTTA 3HEBA 5ECGC 3CTPA 1MW8X 3D0OA 4Y9UA 4J0HA 1QG6A 2V2CA 4H4IA 1Q6EA 1JFRA 1FHDA 1XD9A 1XISA 3BSMA 3D5EA 2BEVB 1E0JA 3MCVA 5LP6B 2OHIA 1WB4A 2QPXA 2VCEA 2OBNA 5I7AA 3WBYA 4YRJA 4M6UA 3AP3A 4LMBA 4HY3A 1BEUA 2C9BA 4S1WA 2PY6A 1XXXA 4CT5A 3KU4A 4AF6A 1BA3A 1YRYE 2AVDA 3JQAB 3Q2OA 3OPYA 4C6RA 1NR7A 2JBAA 1QNPA 5JXIA 2M6SA 3NI2A 2J5QA 4F8JA 2PQ6A 3TQVA 3FHJA 2DRIA 2MCFA 3C3MA 2I55A 2Y6VA 4OX9Y 4PZ9A 4P9NA 3ALGA 3EKGA 3IIKA 4RETA 2W4XA 1TUBB 4AP6A 1DNPA 3NAQA 4EX6A 5J4HA 3TJMA 3JSXA 5IHRA 3ICOA 4JN6A 4R8LA 3ZTWA 1R50A 3E81A 5G4LA 2XSXA 4X6XA 4WFJA 5H70A 4GH1A 3EOOA 4J43A 5CGTA 3L21A 2BB0A 4FYWA 4CJXA 1EFRA 4K1XA 1S1PA 1UFKA 1LQTA 2HJPA 4GMHA 2XT6A 2HE5A 5JALA 3G8RA 2XVNA 3E96A 4J28A 2Q1TA 3FRJA 1VHJA 4A8LA 2RHBA 4DUGA 4EY6A 2HLDD 3H3FA 5A06A 1SVKA 2H4WA 1TIMA 1CIUA 2QUKA 4J3JA 4HPXB 3BH4A 1C29B 1ZJZA 4BFSA 4CKCB 1V4NA 5BOEA 2X8JA 4RC9A 5BVGB 4KQWA 3QWFA 2CCJA 2E18A 4X1IB 1PFQA 1KAQA 5KX5A 4XM2A 1EJWC 3F1KA 1NRJB 3DM5A 2BOGX 2VHJA 2WMJA 1T4CB 2A9JA 5BR8B 3SKXA 4ZI5A 1DMRA 2H5LA 3V2GA 2CXUA 4WY2A 4IF4A 2CZ5A 1JLHA 4RTJA 2OGTA 5D38A 4EMTA 4ENUA 3LI2A 4M6QA 4TTGA 3ILHA 4Z54A 3FKRA 3R4VA 1R8XA 4BO7A 4JGBA 3T5MA 3E22B 4BHYA 2FR0A 4HH1A 2WTNA 1UUFA 5JNTA 4D9GA 3ROTA 2ZBQA 3W1NA 2NQTA 1HFBA 3UFXA 5BYWA 2WC3A 2D73A 4OXRA 3V1KA 4E2DA 4DWOA 3ZKAA 3GPBA 1WE2A 3O8OA 4KCGA 2QMOA 1HKWA 1WXDA 5D1HA 3EWWA 4QBIA 2PSNA 4LB4A 4V33A 1U4OA 4OM8A 4JUCA 1ORTA 1OZAA 1C7TA 3FNEA 2XIBA 2IDZA 1XAGA 3C43A 4X1OA 3HACA 1GO2A 4LSZA 4MX8A 3TGPA 8AT1A 2C1IA 3EK2A 4ZT3A 1BSIA 5J40A 3QVVA 4W9RA 5LXTF 2EARA 1HO4A 2COUA 3R40A 3HGQA 3DT8A 2IEBA 4Z1BA 3G23A 4DZZA 2VF4X 4LJRA 3CEUA 3JY6A 3VD4A 3W88A 1IBRA 4MUKA 1QQ7A 2ORIA 1U0NA 3A0RB 4UTPA 1EWRA 2BMWA 4GI1A 1XLTC 3PR3A 4I5IA 5K3AA 2O8CB 3DKJA 1WD5A 3HYTA 1DRJA 5JIBA 5RUBA 3PTKA 3BC9A 4HB0A 4AVYA 4UD6A 3BE4A 5F3DA 2J4FA 1BVZA 1AGPA 1JHPA 4IDDA 3GHRA 4M1RA 3KAKA 1NM5C 2FDSA 1TPH1 1JCXA 4K36A 4KYUA 4RU1A 3KWSA 4Z7OB 3DG7A 4NAEA 3N15A 1WW2A 3L0SA 3Q87B 1I1QB 1K8RA 2IYWA 3MB5A 2J3IA 4ATWA 2E25A 4K1LA 3W1EA 3OKAA 1KOGA 4HOXA 3AESB 5AHLA 3U3HA 2VJDA 2PZKA 4AD3A 1HRKA 2IPJA 2PDPA 2G67A 2PUVA 4M2LA 1FKXA 1JJIA 2PLKA 3POHA 1IZ9A 5DNDA 1R3SA 4TR9A 3E9RA 2FKNA 4TXLA 1NQOA 3K0AA 2JJ2D 4BNDB 3BD9A 3ZQ4A 2ISQA 2GSDA 3KTOA 5ER9A 1E7WA 2ZVDA 4KAFA 2FE1A 1ORWA 1IWBB 1DO0A 2RH5A 4PCAA 3AY7A 1AD2A 4L4YA 1WCIB 3UJHA 1DBWA 1L4GA 2J4CA 3WO1A 3QFFA 1A72A 5CB4F 3VR5A 1GVHA 3V2IA 3FSGA 5EXEA 2Y2WA 3UZYA 1GOQA 3E6EA 4NJIA 4PEVA 3RUFA 1YFZA 1P0QA 2AXQA 4HEA6 2YWJA 2AYZA 5FLKA 1J6PA 3CPJB 3EWNA 2MNRA 1NJ1A 5BSKA 1UM9A 3W2LA 3TZHA 4A8JB 1O8CA 1E2MA 4MFDA 4J7XA 3WD4A 1TPDA 1Q95A 3MN1A 1XRPA 2QR2A 3LQ2A 1QGED 4G5XA 4QL3A 2QULA 1G21B 3MWYW 4Q24A 4WZAB 3ZV5A 4BLPA 3W22A 5D5PA 3HG5A 1H63A 1UINA 4XVDA 1TJ4A 4QXOA 4LOCA 3EYWA 5F23A 3U1TA 4YNBA 3GT3A 4F8EA 2NZ8A 3WFLA 3R7NA 4GYPC 5C4MA 2BW0A 1ULBA 4O2AB 5BR1A 1WTCA 1UKVY 2UUPA 2Z4TA 1LROA 3HB9A 1RAAA 2ZE0A 3KUKA 3ZJTA 3OM0A 5CJPA 1SXJE 4A5OA 3GF4A 2V5UA 5BRAA 1EB8A 5BT9A 3GCDA 4DDKA 1ZHFA 4OFCA 3C2VA 4OQZA 1OX4B 1U4SA 5BVHA 4PN7A 2B5WA 2X5KO 5KPJA 3PB2A 1PJ9A 4EUKA 4DQUA 1T5OA 1XDBA 2WIJA 3QLUC 3G13A 3KPWA 3MTGA 4W6QA 1JBQA 2JGJA 3KPUA 4M9UA 3EASA 3LCHA 2ZIEA 4MKIA 4G26A 2VBFA 1QZ3A 4XPIB 4ERNA 1E2BA 2GZHA 2UY4A 1NJ2A 1XPYA 2OWEA 1AS2A 1TMGE 5KZMA 1RFGE 4GICA 4GPNA 3DE0X 2FSPA 2ZRCA 3UFYA 1QP4A 3WJ7A 4WXHA 1UK6A 4I36A 3HL0A 3RS9A 4X60A 4N82A 3TVDA 1XNJA 4RDYA 1EA5A 4YUZA 5AHEA 4MNMA 4E8CA 2WLSA 3ZDRA 3EN0A 1E7QA 1RLUA 4ZOBA 3FPAA 4UCGA 4Q8WA 1JPDX 1E0XA 1GVFA 2Q3JA 4Z4HA 3OO2A 3THXB 2JGNA 3JPYA 5DHAA 4KHPB 1CECA 2Y0FA 3B9PA 1ISHA 2YCLB 3VO0A 2BRUC 2FG6C 3UMGA 3TYZA 2AE2A 3R7WB 4Q3DA 1W29A 1NOIA 3O94A 4N40A 2NUPB 3EA4A 3V8NA 1VRXA 4DSTA 1NWRA 2E9SA 2EHHA 2APJA 2PXHA 1D2NA 2B1GA 2UXDB 4ROQA 2X0SA 1UKBA 3ZDDA 2J8TA 2YZ5A 2MYTA 4JC5A 4E4YA 3UUWA 1KCLA 1I5EA 1TC2A 1G9TA 3E18A 3O90A 2GSHA 4XFDA 1HKIA 3ITXA 2XTZA 1A50B 4OH7A 3PB0A 3USCS 2D1SA 3ZQ9A 5EERA 3IK4A 1UC4B 1QIDA 2AZTA 3IKMB 3IJRA 1UA7A 3QYSA 1XUZA 5JBEA 5MHTA 5TQ2B 1VFTA 1USKA 4XM0A 1UP0A 3PSVA 1TT5B 2IS2A 3FROA 1MEIA 1N75A 1V3UA 2B8WA 1XUUA 4UUMA 4GM0A 3OSUA 3TLGA 2G04A 1JZ5A 2EQ5A 2VK4A 4GIYA 1F74A 2QVLA 3GTXA 3W2UA 4IVPA 5BQOA 3ISIX 3ADPA 1K1DA 4H08A 4S23A 1XPRA 1NZDA 3HPRA 1RMTA 2GUWA 2NVAA 2HGSA 2ZCVA 2VRKA 5HGJA 3CO0S 3VOJA 4YCJA 4GGOA 3CMMA 3AF2A 4GOLD 3V35A 2PD6A 3RHFA 5C5EA 2H8KA 5EWJA 3JZMA 2XGBA 4ENLA 3T08A 2H07A 5B7GA 2FH8A 2VK1A 2ICSA 4EFKA 3M9YA 1Z3CA 4OT7A 1E2JA 1QK3A 1UXJA 2AV6A 3EMCA 3URAA 2XYPA 5LQRA 2E5CA 1IY2A 5MN6A 1WMFA 1V3IA 3GXPA 2FH5B 4FFNA 2X3FA 3F6PA 3DB2A 3FWKA 2BHLA 3FXYA 3VX4A 3KS5A 2RONA 4JBGA 3LPOA 4YAKA 2XUHA 1PT5A 3VNUA 4C6KA 2AYXA 4TZTA 2G3IA 1K88A 2GVDC 4ML4A 1TEHA 2VHYA 3SC2B 2OM2A 1U0OC 3Q9SA 4XYMA 3HGSA 4L57A 3TZFA 4O2BF 4MDOA 3N58A 1GGNA 1QFJA 1RAIA 1OQFA 1XZ8A 4KE8A 2IYPA 1FH7A 5D87A 1FNDA 4HWPA 2QE6A 1DQSA 4LF5B 2IXEA 4IIJB 3GJ7A 3TLKA 2CUTA 1FS5A 5KTOA 3C0SA 2D3LA 2ARKA 3LENA 1I10A 3WKAA 2BFOA 1M41A 5J2TF 2MINB 4DF0A 4MV7A 5K0SA 1K6EA 3QMSA 2GHRA 5BV2P 3B04A 1BGAA 2VEPA 3E35A 4NU6A 4URXR 3H1BA 1E0VA 1XYZA 4REOA 3AMGA 3FSEA 2FPVA 5IXSA 4B4UA 3MCTA 4C6LA 4NCIA 3ZHRA 3AEKB 4FNPA 2DFTA 4ZQIA 1GG9A 3T0AA 3T40A 4TROA 1UBSA 3NQDA 4KGZA 3SJBA 5FCDA 4KPFC 4FGZA 1S1MA 5CLTA 4POAA 1CGWA 5F9MA 4GXRA 4JI7B 2BPOA 4L1XA 4LC0A 1IE7C 2F1KA 3UWYA 2GZXA 3UT6A 4EPWA 1ZU5A 4MQ5A 1BXRA 4P08A 2PURA 4RK4A 2HBRA 4PE8A 3SDZA 1N0WA 3THWA 2P35A 1DQUA 2HREA 1GTVA 5JANA 2HMCA 3WK7A 4PC3A 4ZIRA 1QDSA 1HOTA 3JTEA 2PL3A 1P5BA 4CTMA 5SYMA 1HKJA 2WJIA 2ZBUA 5DLEA 3GA5A 4BKUA 3LHZA 3PFWO 1BDHA 4UTOA 1DRKA 3EVTA 4B3DA 1GSIA 4L50A 5REQB 5FEPA 4B7XA 3F6EX 2YIJA 3I83A 2CLPA 4V0RA 5JD3A 3FOAA 4W6ZA 1TNDA 4RF4A 4HMCA 1Z32X 4MPRA 1TRHA 3HVHA 1YJ5A 3BPSA 4P7RA 4LV5B 4D1YA 3A5VA 4AQLA 2W11A 1QAQA 1YJBA 3FZYA 3UTCA 1Z4NA 4QLOA 6PFKA 1U1JA 4Y9DA 5K7JA 4C6CA 1YXCA 2C07A 1DIOB 3GVWA 3RMJA 3WLOA 4HVTA 2RKWA 1QNOA 3UCDA 4Z0JA 4KWSA 3ZU4A 1TECE 1TTIA 4E5UA 2RHGA 1KVUA 2YL5A 4JVSB 1KMIY 3CF6R 3KYIB 4GFSA 1D1SA 1SZCA 1ZXBA 4I7VA 2DFVA 1H3NA 1R7AA 4Q33A 2V4ZA 4IQJA 5BMOA 3JU3A 1TZZA 2A1UB 4JTLA 2WUFA 4OA5A 1EP1A 3AI3A 5FAKA 2O0JA 5DDIP 3CF4G 4ZAVA 2VZ0A 5K3CA 1M7BA 4PTNA 3DAGA 3PRKE 3WIJA 4A8RA 3M9LA 3OZEA 2A4MA 1K63A 2XCLA 4MI3A 3RUDA 2HZBA 4ZVNA 1IXYA 3OJGA 1MDRA 5EEHA 4IF2A 1FSSA 4RXUA 1YH3A 4FSXA 1UWCA 2VYQA 4MW5A 4UU8A 4F04A 2IS6A 2BHTA 1PAMA 1XX6A 1PV4A 1MXSA 3OGVA 7YASA 1XO1A 3K9LA 5FKJA 1ODKA 3H4WA 1EP2B 4E13A 1H4QA 1OXUA 2GESA 2X41A 2G5PA 3SR0A 5IWCA 3H83A 1MAVA 4UTIA 3H24A 3MTAA 3Q4GA 3QSYA 1RRVA 3JZDA 3IV9A 3T95A 1TVCA 3MKCA 3CAWA 5EI5A 2F3RA 2HQSA 2WE7A 1MQPA 4B3SB 3MT0A 4PBTA 3I3DA 2Q4TA 1ZGJA 4AKTA 4J03A 1WB9A 3TSOA 3NQEA 2VHZA 3W70A 2CHGA 3M0ZA 3HQ4O 2O7QA 2DQKA 4D9HA 1D2MA 2GBFA 3FHTA 3VHXA 2QN9A 4FB5A 1SC6A 3WNKA 3GH1A 2E9LA 3EIQA 2PFHA 3N2KB 2LZ0A 3GFTA 4IRMA 3HKBA 1AMOA 3QEZA 2JATA 2I76A 3S29A 3C3AA 2QD5A 2C3MA 4XIIA 1OSNA 1X87A 3M4NA 2G3NA 2P1RA 1L5YA 4BE4A 3QITA 4TT3A 5BSUA 3HADA 2P2ZA 4MQEB 2JGMA 4CTOA 1D6MA 4FNMA 1OW3B 4MV3A 3BFXA 3HUFA 4BNKA 2DT2A 3AG6A 4HS9A 2H4YA 1CZOA 3G1TA 1ORRA 1XTTA 1NXVA 2P9QA 2Y99A 3QBVA 2CMDA 4G25A 3H55A 4ECEA 5B7NA 5HIAA 5E4FA 3B8VA 4U00A 3CWZA 2QSZA 3AYTA 4OO3A 2GLTA 3RN6A 2XCIA 1KH1A 2JFNA 5HDRA 2RG1A 2GZ2A 5ESDA 4Q4MA 4ZODA 3D0QA 4C6BA 4CEIA 1O03A 1ZUAX 5AJHA 3TSYA 3UQZA 2NUAA 4NONA 3Q0TA 1U5JA 1KEPA 3FB1A 1UXHA 1C0PA 3I09A 3N39C 1T0JB 3UXKA 1WD7A 2IEZA 1ZUWA 3EAFA 2Y1GA 2PMFA 2R24A 4R81A 3SECA 3EEIA 3ICVA 2YW4A 4DQ0A 2G40A 2GB4A 2PSJA 3U56A 5EJIA 4MEJA 1ISYA 2OE2A 3G1YA 4ZALA 4MP3A 1KAMA 1QHHA 3WK1A 4K6GA 1YXDA 2JFUA 1A2QA 3W73A 4Y2XA 2JHPA 3TMLA 4XRGA 4ZMGA 3UAGA 3RC8A 4MPDA 1QORA 2Y8VA 1GITA 3IUDA 2G4FA 3K70D 1AKRA 2J46A 4Z7NB 5IBXC 1XV5A 2ZOSA 3FX4A 3AKCA 3DT6A 4RXTA 2DH3A 4NNOA 4DCPA 4Z2IA 5L3VA 3NDOA 1E9YB 2QRNA 1E8DA 3VR1A 5C1BA 5JWRA 1BYCA 1QZUA 5BNKA 2O7VA 1WUEA 3CWQA 5FF9A 1GN9A 2WKGA 2X5XA 1OROA 4EFLA 1J8MF 3AWIA 3PA8A 3GIYA 3O1IC 1PKNA 3HM2A 2P9BA 3AVUA 4FMDB 1CLEA 5JNWA 2ZBGA 5AI4A 3PFMA 5K0CA 1POXA 3WGJA 1MDFA 3VNIA 1M72A 3MSXA 5CIYA 1AK2A 3ETJA 2A1TR 2F8TA 3GB9A 4FMBB 3GLUA 4GCXA 1KU6A 1FNCA 3PWZA 3TH6A 1W2HA 3QI7A 1ONXA 5C9RA 3KHKA 4LRSA 3NAMA 3EOUA 2FPGA 3AY6A 1VPQA 1NMEA 2IUFA 1DC8A 2R4TA 4OJQA 2NXHA 1XD2B 1EK5A 3S1AA 3CEPB 5JJIA 2W58A 4BRWA 2QY6A 1MQ8B 4EK9A 3WWYA 1KBBA 2ZRUA 1E0WA 2JJ1A 3OIGA 3LHDA 3UEQA 4DR4B 2OUKA 1U0GA 4YRAA 4WIWA 1NEYA 4TX8A 3W2TA 1MOPA 1NWUA 1Q17A 2EFJA 2YDAA 3AMDA 1G3MA 3OGSA 1FFWA 4EB6A 3S6JA 2OJPA 1R3UA 3UZJA 2WT4A 2CV1A 4JICA 2PRJA 2OKTA 3PWKA 1EJVC 4BE9A 1G8MA 3IOYA 1TPWA 4YLWA 1ZXXA 1NKVA 4KR7A 1LPNA 3JD4A 2VX7A 5FTMA 2VDKB 3O8QA 3LY0A 1KAHA 4YP9A 3PTLA 4AAYA 1OR8A 1NIJA 4N6EA 5FAXA 2JW5A 2OCKA 3EEOA 4HYWA 1XCFA 4AECA 5A8NA 2J7DA 3CKKA 1ST2A 3KVRA 4KTTE 1XNGA 2R4UA 1YQXA 2DZTA 3BS4A 3MYOA 2D2EA 3C3CA 1S7GA 3F8SA 4EJ2A 1XMSA 2CFOA 2IF2A 3E7PA 4QXRA 1TRIA 2V5DA 2W00A 3G7UA 2QVXX 1F61A 3NATA 3DXIA 2H00A 2WJWA 3MGGA 4LYQA 2RAGA 1QHEA 1SUBA 5EJMA 4E2YA 1Z2AA 4OJMX 1GTZA 1NMZA 4QUGA 3JQCA 5H8UA 3HKCA 3PCTA 8RUCA 3N7UA 4KR9A 2QW0X 5KQLA 4RANA 4AZIA 1DJZA 1PP4A 2BELA 2GJ4A 1TV3A 4QOSA 4GOJA 1KARA 4XDZA 4BWVA 1UWSA 5F2GA 4JUBA 4XIYA 1XBYA 1Q7RA 5CXSA 5M29A 2C3UA 2VQDA 3RSZA 2VO1A 1WWKA 2NZXA 1LT7A 3QFSA 3EIXA 1NU6A 4X20B 4JOBA 5BOOA 1F06A 1MV8A 2XMCA 1MHTA 4W5UA 1LUCA 4MRRA 4I1PA 4JOMA 1MQAA 2WUEA 1X6LA 4KHZA 3ZR6A 3ATZA 1X7ZB 4UVDA 3SXUB 3NXSA 1JHDA 1NXQA 1Z2CA 1T9ZA 1EFAA 2DFNA 2HHAA 3AP2A 2B4TO 5CVTA 1MAHA 5H16A 4CR6A 4G9BA 3KYDB 3B97A 3FXAA 1HO3A 5I7GA 1NW4A 4L15A 2C79A 1I3NA 2XHEA 1W4CA 1MNAA 1CS0B 4LHSA 3NL5A 4O15A 2XM1A 2ZATA 1ENPA 4TUYB 5DOZA 3UMSA 5L40A 4NS4A 4LYFA 3LZCA 1Q12A 3VOHA 3L65A 4JIPA 3KT6A 4L07A 1KLZA 5CC6A 3KZ1E 1TF2A 4Q4OA 3CBQA 1P2TA 2ZI5A 4ZMBA 1MLDA 3IO5A 1L5VA 1BNCA 2PT6A 4LHYA 1MRQA 1IK4A 1VSUA 2CVFA 4WLFA 5D9NA 1T9BA 1R9JA 4RZ2A 4FZVA 5AVZA 4G6ZA 2RJGA 1KJZA 2Q5CA 2GGEA 3J7TA 1SYTA 3OLWA 2GPBA 5K0NA 1ZRMA 4ZO8A 1VBMA 3OJOA 1CB7A 3IR7A 1I2OA 1KFJA 1TMKA 4F2PA 3QG5A 1VFHA 3CQKA 1ZM2A 3D7LA 3C97A 3URKA 4E09A 5M03A 4A3RA 3UIEA 2VUYA 3E9YA 5BOSA 5ENVA 1ZM3A 3GYBA 3UPTA 3B40A 2VJXA 3NOEA 2VA9A 4FEAA 3LS2A 5D8ZA 2UAGA 4TLEA 2Z1WA 2FPLA 4BO2A 2ZSHA 2P90A 2K5UA 1OCEA 3GT0A 5TDHA 1ZG3A 2HOQA 3UVEA 3EJWA 3IPCA 5I07A 3LT5A 2IZ0A 4KEMA 3A9VA 4L6AA 4QDZA 2GASA 3BGDA 2GEUA 1EQAA 1Y6GA 1J21A 4B35A 2QPAA 1ECLA 1L7PA 1Z39A 2VJPA 4X7MA 1GOOA 4H15A 2Q0SA 3CONA 4UHKA 2YYYA 1FDZA 2E4WA 4DLXA 5DHSA 4OKDA 3HABA 5AW9A 1CG6A 2IIQA 5C8YB 3G1HA 1IR1A 3EKLA 4MV6A 1JG3A 5J8LA 2FRDC 2VL7A 3NSMA 3VHLB 3CA8A 2YNMD 1PJ4A 4GAEA 1ZD2P 1U5BB 2DKFA 1E4EB 3MRSA 4TTAA 2BFDA 2E8YA 5B3KA 1E3SA 1Q91A 3G5LA 1POKA 2PUJA 3ST7A 2W90A 3L82B 4G2DA 1P17A 2PWAA 1E3WB 2ZBEA 5BUZA 1W85B 5G4WA 3PXBA 4CD6A 5GWXA 4YRCA 3W23A 4IPIA 3KBVA 4IGAA 5PGMA 3M0EA 1QX3A 4DYKA 2GJSA 2HCJB 1PSCA 5HBGA 1Q15A 5LZ2A 3EB4A 1OBAA 4AI6A 3NU1A 1SUSA 1PEDA 2WA1A 3IOCA 2DZPA 4RULA 1T9AA 4J2OA 4P2BA 1Q3NA 4WH0A 3GPDG 1N2OA 1A5TA 3GXMA 1HW6A 2YCBA 4PIPA 1V93A 3HDTA 1QTWA 4Z1MA 3A6EA 3QEBZ 1QHPA 5EE0A 1Q11A 3BMCA 3CZQA 5A3SA 2G97A 3M4ZA 4OBWA 4XRRA 4JQ1A 3UYLA 4L74A 3G1XA 3PQ2A 4ZBCA 2OXIA 3ZGNA 5EBAA 3H5LA 3KT0A 4OSPA 4ND7A 4OAPA 2BVTA 4ZE4A 3GEPA 4KN9S 3HGJA 4HAIA 2YA0A 5EZQA 3DTYA 2H2IA 4P8UA 4HAWA 1TQ8A 2E67A 2XTKA 4U7JA 2FW1A 4OI4A 2QMYA 5GTDA 1AT1A 4GR4A 3VPGA 1NY5A 1TPEA 4FHDA 1V1MA 2DM6A 4NSNA 5FTKA 3EXTA 4HDMB 4WW0A 1SUDA 4RDHA 4HYRA 2YY5A 4IW3B 1ONSA 3BZWA 2VH1A 2J59A 3C0JA 2QPTA 4RFSB 5AKHA 4MF4A 5KEIA 5AQ1A 3VGBA 1B3OA 1EUZA 3S2GA 4AIEA 1KM6A 4OJTA 3XISA 2QR6A 1EUCB 1JJVA 1YB2A 2VI5A 2IW0A 3LNPA 3M9XA 1U3DA 3ZNQA 3IJDA 1IG0A 1AW2A 3DVQX 3PK7A 3EGOA 4DQVA 1UIOA 1RDFA 4IV0A 2XWBF 1GJPA 4KXQA 4OTKA 2WO5A 4J1SA 4B91A 5B7PA 4EO4A 2E0PA 3W90A 3TKYA 4YRIA 4MKRA 1VA4A 4D9MA 1P0BA 1A7AA 2V7QD 1QZTA 5T6MA 1RLMA 3P27A 5D5QA 2JH8A 3M43A 2B99A 1SIBE 2PKQP 2DQZA 5A6JA 1CTNA 2BJHA 4D25A 4N9EA 2QTTA 5ALGA 5FF0A 3IARA 1NAL1 2ZIAA 5ICMA 4LSMA 4LBUA 4PUUA 2NWQA 1OCQA 2WJYA 1BH6A 4QDTA 4A0RA 2WZTA 2ZYFA 2YRWA 3VIKA 3AS3A 3HH8A 4XVQA 2TMKA 1NVWQ 4WTOA 4HXEB 1TPFA 2ON6A 4MS4B 4KV9A 1PV2A 1L6WA 3L93A 3W8RA 4BKNA 4BP8A 2VAPA 3GOQA 4ZVRA 1CQJB 1YA6A 4YN3A 4C07A 1CIJA 2QJFA 2OZPA 2EXOA 1ZOSA 3WGNA 1GPNA 1SXIA 1W3IA 2KS6A 5EJ8A 5AKLA 4JTIA 3WA7A 4LYAA 1CXZA 2X2EA 3XINA 3JYLA 4MWAA 3DE4X 5D3KA 1F0PA 1UOEA 5LXTA 4HQNA 1VIVA 4PZYA 4BQSA 1NMXA 2RMKA 3SJAA 3IPXA 5A6SA 3FJ4A 2RAPA 3TN3A 3H5AA 4C4PA 2I4LA 2FDCA 5IAEA 1XE3A 1X8LA 4NEGA 4JP8A 5MDHA 5JC1A 5B1EA 1ZY9A 1WZ2A 4JNYA 1XVUA 2KI5A 3EZYA 2VHQA 3ANNA 3PEWA 3TVYA 3G17A 3DZCA 4BBPA 1GUVA 2O8VA 3LPMA 1SQ5A 3OTOB 3ZBUA 1N7GA 3HFJA 4OU1A 2J9XB 4RL6A 4Q8PA 2PRLA 3B8DA 2OZKA 3K8OE 3OWXA 3L4ZA 3Q7IA 3H8SA 4PRYA 3SBEA 4MWEA 1GOTA 4M7WA 4QHTA 4YWJA 4TXNA 2YFQA 1GPWA 1J90A 1H5QA 3TN6A 1WOYA 3PUDA 1QLHA 4I5XA 4MRMA 1QLWA 5TS2A 3OVQA 3RFXA 4UHHA 2ICAA 2ZE3A 1XW8A 2DFAA 2BUBA 1E6RA 1JT2A 2XU2A 2WU8A 4Z4IA 1NLMA 5CZ0A 2BM1A 1TYBE 2R8WA 1G41A 4FX6M 4U1RA 3GJTA 2JKEA 1H7WA 1YS7A 4FR6A 3IS3A 3E2MA 1KEVA 2O48X 4UM8B 1KNQA 1BO6A 2Z58A 4GXTA 1I14A 4YV1A 3UMRA 3L0IB 1MKYA 3DULA 4K8GA 5FUXA 1RWQA 1HGXA 4GOOD 2F2TA 4QX4A 2E4ZA 4QOEA 5MFPA 4DLSA 4FNQA 4H9GA 4X3ZA 1GNXA 5HF5A 2AG0A 4R68A 1E4LA 2A57A 3HBMA 2QGYA 3TONA 3LDAA 3ME3A 5CB4A 1Y6QA 1G8PA 3NOOA 3RLIA 3WNBA 1RHUA 3I4CA 2HPAA 3GK3A 3TQKA 3R0XA 4D5GA 2IPNA 5LZ4A 5BXTA 3KSUA 2AZ4A 1QG4A 1TAHA 3SOPA 1YLVA 1B3XA 4OF4A 1KQYA 4MR7B 1SBZA 2IHJA 3I8OA 1WIWA 5BWCA 2PA3A 2EKCA 1K89A 3I3BA 4DNOA 4N5DA 3RUHA 4FDAA 3MILA 5EINA 3QTTA 1J09A 3OQ1A 2C5BA 1TZ2A 3EZ7A 2QT0A 4QJ3A 2XNDA 1XICA 2GN0A 2F84A 4IG9A 1NSTA 4PTYA 4GGBA 2BC9A 1DYSA 4CCZA 1N25A 5KYVA 3W2MA 2GJ9A 4QAJA 2VPQA 4YFYA 3A6FA 4B3ZA 3M81A 1ZALA 2ZWVA 2KAUC 2B6HA 3W7CA 1PD0A 5A9TA 1Z0AA 2E4UA 1VG9B 2CBXA 1RC1A 3QBTA 3LQFA 4BLRA 1NWTA 4MVJH 3RDKA 2C1EA 2Q5HA 2H2GA 4NRRA 2IEIA 1H6CA 4EAMA 4DLNA 1V16A 3FCAA 1EHNA 1O5QA 3H23A 3FZNA 4A6EA 2BSXA 2C14A 3VKWA 4BVAA 1VE3A 1MENA 1VBKA 1X7GA 2NAPA 1MAWA 4FM9A 1Y98A 4V2XA 3T09A 3Q1LA 4FFRA 4O14A 1A2BA 3DW3X 5SZJA 3IBFA 1T4MA 4PHCA 4MLPA 3A7EA 3GU9A 3WBKA 1U2QA 1U65A 1KMNA 4GH5A 3K0EA 1HDGO 3VUPA 2XZLA 1TVKA 1RWBA 2VP5A 1RY0A 4E5DA 3ZHSA 1EP9A 8TIMA 2OOSA 3V1TC 3NBMA 5FA5A 2GVJA 4HIBA 3TM4A 1ZM4A 2C42A 3FYCA 1K7CA 1TO2E 4D2JA 1ZQ1A 1A9ZA 3LU1A 5HRAA 1GRRA 4EP8C 2PLFA 2ZIXB 3CZ8A 5KWJA 5I9MA 1OD8A 1CEQA 3ABSA 2KM1A 3ISVA 1UW9A 3I61A 1JKJA 2YC2C 3LRXA 4JNKA 1ESCA 4FNAA 3BXXA 4IIYA 4CNQA 2FPOA 1N2HA 2W6PA 4XASA 2ERCA 3G49A 4RGBA 1JQ5A 1KO8A 3FJLA 1HYQA 3JVEA 4FFVA 1KP3A 1Y34E 3U7EB 1I1WA 3KXLA 5FOXA 1W36C 2WB2A 3O07A 4MKZA 1U04A 2RE8A 3USZA 1Y6RA 2PU5A 3OPQA 4WLEA 5KQRA 3ZC3A 2A9OA 1QH1B 2ORVA 4AD8A 4WK0B 5A4KA 4ZCLA 3H9CA 2D5LA 1SG9A 4OWGA 4MVJD 1CK4A 2Z8YA 3QKSB 2H8GA 1NWHA 1TKRA 2VTBA 2VZOA 5DXFA 4WK6A 1SNYA 3RRZA 1H2EA 2XISA 3R8RA 1UPXA 4EVIA 1D8WA 3N70A 3TA6A 3ZJ7A 3QF4A 1LPPA 1P0FA 3I2KA 2NW6A 5H3HA 2YJTD 5K45A 1RK6A 2GOKA 3EXFA 3EEYA 2QP9X 3RTCA 1SFSA 2FZWA 2Q9BA 3I7RA 3TU9A 5EGNA 6XIMA 3QXCA 3U7BA 2ZYHA 1B4EA 2CPUA 1U4NA 1HL2A 1M76A 2DSVA 3RXZA 4UDXX 3AUYA 3BD8A 3NJ3A 1E2UA 2IIVA 3SZMA 3RPMA 1GNPA 1S2MA 3SCUA 1WZMA 1XEWX 2YDRA 4LSBA 4JEQA 5CPTA 2EWWA 4QJ5A 3EX2A 3PIRA 1HE1C 2PDYA 1GDDA 2HXUA 4FINA 3QVUA 5TRTA 3LY8A 1M0EA 3H2MA 2GEKA 1YKSA 1YS2X 2NZYA 1LJYA 4Q8UA 2CLIA 2DPGA 4JAVC 1C90A 3VZDA 1J6UA 2H0AA 5BXPA 4XWTA 1H5VA 1XIJA 4CR8A 2DQWA 1ZP3A 3SCTA 2ZYTX 5B53A 4IY1A 1MW1A 4I7WA 2XCRB 4UHBA 1LSUA 3B1FA 5DCWA 3WP0A 1YRHA 3DYIA 3FRHA 1UIPA 1MR3F 4ZJPA 1LH0A 4LW8A 3SICE 4YXWD 2QG9A 2ZTLA 2W5UA 1J79A 2BGGA 1GZ4A 2IL1A 1N77A 3WJWA 3EVDA 4O2BA 3AILA 1GUBA 3GG7A 4PEKA 2VRJA 3ZDQA 5K4AA 3DO5A 4B2LA 4ASTA 2F59A 4MWTA 5CYPA 2AL1A 2HROA 2AZMA 4DBZA 3RKRA 3WK3A 1DRUA 1R9MA 3MCNA 4JI0B 1MIOA 1C1DB 4QJIA 4DQXA 1GGEA 1RRMA 3NZGA 4UTTC 3WQSB 3L4VA 2CSXA 5IDIA 5J2TA 1F7BA 1AD1A 4OXIA 4B40A 3U40A 4F9FA 3PQ3A 4HDAA 4IZGA 3C86A 3A14A 3M41A 5G0WA 4IIXA 4JKYA 3ZE9A 2WI8A 4L0QA 3QHMA 4CI9A 2A86A 5ED4A 1Z88A 1NDZA 4RKWA 5ILQA 1H11A 1I3CA 1XSKA 4MFEA 4AJ2A 2X8AA 1KSGA 3KVVA 3B1YA 4U02A 1QT1A 1GKUB 4EYSA 1ICEA 4PUMA 3NWRA 1E9DA 4M8IA 1M6NA 1TWZA 4MZ8A 3NPWA 2V69A 4DC0A 5IK2D 2QYGA 5B7ZA 4BLWA 4TMCA 2PANA 2AX3A 3LHTA 3K73O 2P8JA 3W6NA 1XA4A 3I0NA 5JCXA 1HZZA 4MHBA 1Z0SA 2C99A 1C93A 2WJ3A 4G0UA 2OVLA 1Y8RA 3FJYA 1H2ZA 2RGMA 3HZRA 3WQ6A 3QEJA 3GWZA 1M2KA 1ZD1A 4W5QA 2BXZA 1S2TA 3KKOA 4GVPA 5A7FA 1PFVA 3TTUA 5D3QA 4U7FA 5CBKA 3PEUA 3VAYA 3B6JA 4NE9A 3VOCA 3CGTA 1KEWA 1V9LA 5E9JA 5K0EA 5IKOA 2IGTA 1PR5A 1TE1A 5AI8A 4O5AA 3QKRB 1UEIA 1WDPA 2Z7GA 1VJIA 1B14A 2J6XA 3E6AA 3LOPA 4BI7A 1HVQA 5B4TA 3H53A 2IPAB 2CESA 4PYSA 1CZHA 5G4KA 3L2LA 1L4UA 3EODA 3JWHA 5HJXA 1NPYA 3MGBA 1AD4A 1IM8A 1RLCL 2Q2OA 1LV8A 5C35A 3CAQA 2I22A 4Q8TA 4DSOA 1YUMA 5A4JA 5LB2A 1E59A 1RQBA 5I24A 4YPJA 1Q8JA 1EBBA 2PYDA 4PW0A 2NVWA 4BKMA 1GORA 4RGVA 2C7GA 3S6TA 4MINA 4MUHA 3MGCA 4EW3A 4XQ6A 1XN4A 4GI5A 3NQ2A 1J9YA 3BE6A 3W1XA 2CLLA 2QJHA 3ANYB 2BLLA 1FS4A 2FDRA 2Q3BA 2PUAA 4UZEA 1L1QA 4LCRA 1I7DA 4D9FA 3SLKA 2EGUA 4YP1A 2WG0A 2FWRA 1SU7A 4DLTA 1K97A 4PMRA 2JLSA 4HNRA 5L7YA 3U7QA 3COPA 5KYNA 2ZWZA 5AMXA 3BERA 4CD7A 4AHOA 1D2EA 4HO1X 3PC2A 1KB3A 4OGLA 3KQPA 1M2OB 1M54A 2MHCA 4E1AA 4H9YA 1SG6A 2PCLA 4JYCA 5FX2A 4D02A 1WV0A 1UBPC 5LHEA 1TL7C 3ABQA 4U0JA 4PZUA 3WQQA 1WB5A 3D7SA 3NYQA 3ZBQA 2E1DA 1V0JA 3GCGA 3W86A 2V0GA 1LD3A 1AHNA 4KPEC 3WH9A 1VBUA 4JUIA 2E4YA 4E3TA 1VRCA 1IWOA 1JWAB 3T8LA 3BTOA 5JCOA 2JHFA 4EA9A 4YWSA 3UAWA 4E22A 3FIGA 4IJUA 3G2IA 3ZE7A 1MXDA 2XNHA 3WBBA 2WVGA 1T2EA 4JITA 4H6PA 3INGA 3VO2A 4GJJA 3JWGA 2QTNA 4PLWA 1VL2A 2A2IA 3IIOA 1G64A 2Q4OA 1O6IA 2HK9A 3L5KA 1MAAA 2PBZA 3L23A 4HTAA 3CXRA 3BT7A 1ZR4A 2VXNA 2MSWA 1VECA 3ZWDA 3U5TA 2X76A 2J6HA 4IGEA 4JVOA 3ADCA 1J00A 2R68A 1XTBA 3C8MA 3NQ6A 2C91A 3TLYA 1FTXA 3ITYA 2ST1A 1UAYA 2VGGA 4ER5A 1OWMA 3OIFA 2P7HA 2QIPA 2G5TA 3P62A 1LCOA 3WYFA 2ZI7A 2PRKA 1UWQA 3TEJA 4GQIA 1R4NB 2O20A 4IM7A 1PX4A 1GKPA 5HTOA 2X0EA 3VIMA 3ULKA 1EDZA 2H9AB 4BQIA 2Q3FA 1Y3HA 1TV8A 1W5NA 1Q3TA 4I08A 1HT1E 2LD4A 1ZI6A 2OZ3A 1EGQA 5LU8A 5C18A 1A4MA 1BLIA 4GVXA 5IF9A 1HL3A 1MH9A 2AC2A 4XGNA 2GYYA 1R0YA 3RS4A 2C71A 4WE3A 1XBZA 4BB6A 3SQNA 1AG9A 1YHTA 4HEJA 1VCVA 5GVJA 1Q1GA 4M49A 3ALFA 4IVRA 3W53A 2IDJA 3KW3A 4XZNX 1V7YA 4ZFMA 4Z2GA 4R1NA 1KFBB 3E03A 5CK5A 8A3HA 3W4JA 1MUUA 1GV1A 4IYRA 3CG4A 1Q2SA 3QMRA 3B6IA 4W1RA 4O4JB 3QF0A 3X2FA 3W7IA 3RC7A 1Z4QA 3WLIA 2Y63A 4Z2KA 2BY1A 2WVAA 3L7JA 4UPEA 2ZRHA 4V0KA 4U6NA 3ZCVA 2X42A 3LCCA 2AMFA 1OIVA 2B30A 1Q1AA 3VJLA 2DBZA 1S0UA 4PS0A 4JX5A 3BGJA 4BV9A 4G85A 5K4XA 2EWMA 3N04A 2EJAA 1D4ZA 1PLLA 4IUDS 4MKXA 4K0KB 2JBWA 1M34B 2ZYDA 2D23A 2YJ4A 5AHWA 4KIUA 4FOSA 1Y7VA 4LUIA 2VP6A 5LYJB 2IYOA 3VPFA 4DWSC 3KVOA 3PNQA 3PVZA 2NWRA 2JHCA 3WD1A 3ERPA 3L40A 4AXKA 3U39A 3P4XA 3K94A 3P9QA 1IIRA 1V6SA 2VP2A 1LQAA 2YBTA 1WDTA 3UJFA 2MSNA 8ADHA 1RJ9B 3I7QA 1TRKA 1WAUA 3TL3A 2HO5A 3VZPA 3U3ZA 4PLPA 2Z08A 2X77A 4LVBA 2H65A 3RO7A 3R7BA 1MB3A 2BH2A 1QR2A 3R12A 2XR1A 4ZU1X 3ZT5A 2VS1A 2BMBA 1HDCA 4PRRA 2VDVE 3VJMA 1TM1E 2OGSA 1AZWA 1AHPA 4FEZA 1V03A 1UEXC 3OVMA 4L2IA 4PAQA 1U80A 2QS9A 4ZO7A 1Z0IA 4BMCA 5LSAA 5G1MA 3I5AA 1FA2A 1WP4A 5D2XA 4GF5A 4YO8A 2GN6A 1LRQA 5AVWA 1TB4A 1CT9A 4DMCA 1P6BA 4FOOA 1M03A 3CRVA 3C7KA 4DPLA 3VZSA 1WOMA 5EWLA 3NVKI 4S1NA 5CVVA 4CU7A 1TMYA 4FIZA 4NBLA 2H6EA 2FHBA 1B3ZA 1G63A 2HT1A 3TIMA 2TMDA 5JH7F 1M6YA 1AO3A 2VHUA 2GCOA 4DQLA 1RVV1 9XIAA 3AZQA 3M7WA 1DBRA 1AJEA 4EEZA 4ADTA 1N5LA 3LQKA 1O0BA 1SUAA 1OXTA 1J2EA 4XVEA 4PZVA 3L46A 4RK8A 1IUPA 2GNOA 4RXMA 3X1MA 1BEEA 4D8VA 4DA6A 3VDAA 3G8EA 3HLYA 2H4JA 5IBQA 1C8VA 1DBTA 2O59A 5FNZA 5LIRA 2QGHA 4BK9A 4Q4AA 3QYQA 1GSOA 4YEDA 3U7GA 4L56A 4QWMA 4UTKA 2RK6A 2BP7A 4CM9D 4QUBA 5H8WA 3GJRA 4ZO9A 1UYQA 2W91A 3ZVHB 1N92A 4JLPA 3GELA 3NWJA 1XTRA 4DXKA 4DCGA 1K4MA 3STWA 5A5FA 3HJAA 3KYCA 2RKXA 5AK4A 3W04A 2UVQA 3TI7A 1O6GA 3B70A 1W5FA 3A4YA 2FXVA 1J8QA 1AZ2A 2A3LA 5HDQA 1R2TA 4CM3A 5AK3A 1QMLA 5HQTA 3OESA 4B3TB 1C7IA 2ZCJA 3MQ2A 4PAOA 4JR0A 2YASA 3PDUA 4WHBA 3ZE2B 2Q28A 2QDDA 5CPOA 4X97A 4LJ5A 1BWVA 3EF3A 4F0SA 4BVLA 1QFMA 2DUZA 5JXQA 3N1UA 4J16C 4X91A 5I8WA 2DG2A 3I9LA 3TZEA 3UAVA 5DO8A 4KEAA 5CXUA 3ECSA 3UC5A 2D2HA 1EE9A 2QW8A 4HGQA 4IPTA 4NV1A 1ZL1A 2DJLA 2WCSA 4P0PB 3FOWA 3UV3A 3WJYA 1LPAB 4W8OA 3DG3A 2H1CA 3A5FA 3BB4A 1RHJA 4JC8A 3BJZA 2EPKX 1IHYA 3MT8A 4LHEA 4J3WA 2O9RA 2RGEA 5C70A 2QRKA 3D59A 5AC7A 5G3ZA 2VQEB 4JSRA 1PR1A 4ZCSA 1VPLA 3UHAA 2DKOA 3TEFA 3RJZA 1R16A 1GTEA 5TLSA 5H8MA 4AX4A 2JF7A 3K0FB 3GW3A 2W93A 2Y1WA 1S1CA 3GRYA 1HXJA 4X3PA 4N4PA 4D6XA 2YXDA 1XVLA 4CCYA 5KQGA 3U8GA 4ORMA 5FLXA 2PXAA 1E3IA 1IVSA 4EI7A 4QPNA 3LXBA 1XQXA 1WMDA 3M5PA 4M1OA 5I77A 2G83A 3HU2A 4ER3A 1FQJA 5LJLA 1ZJJA 2P79A 1AH4A 1CPUA 5FJIA 1R5OA 1GVOA 4B2DD 1DAMA 1IEXA 4U2KA 1UBHS 4EYEA 4CNNA 3DPIA 5C5DA 3UGJA 2QLLA 3EOSA 2W6ID 2OCYC 1MO5A 1G69A 1R5NA 1ZUNB 4Y98A 2RI0A 4O4HF 1OYOA 1DARA 4ZI2A 4G1KA 2YVKA 3W25A 4MYSA 4PBGA 4FXJA 3CRQA 1T1IA 3GJZA 3C6QA 2XDWA 3AKZA 3MPOA 4AZCB 1A5ZA 4Z2YA 1H9CA 4P5UA 3I6ZA 2FWBA 3EGWA 4URWR 1W36B 3R8CA 3AL2A 4BUCA 1TWDA 4YGYA 1EO7A 4LBVA 4D6YA 3G82C 1CUFA 3U1VA 3MI2A 2IQTA 2D0OB 4CQMD 5CJMA 1I6NA 5ADHA 4KRUA 4B9YA 2WNSA 1NNLA 4ZQOA 4F3HA 1Q63A 2PF0A 4P3KA 4BO0A 3RYSA 4DYVA 4F11A 4G2NA 4HN9A 2ZBRA 1DWAM 3E5NA 2JHGA 4OKNA 4JZ5A 3MUAA 1X15A 2W8BA 4I9TA 3OPYI 3PS9A 2Q62A 1X1NA 1TGYA 3V6LA 1SCDA 3SSOA 1QNLA 4AF0A 5DI3A 5JMOA 2V4UA 4TLCA 1QC5B 4G4IA 5TF4A 1CEEA 3ZU3A 3T3PB 2CLEB 2VYVA 3H1EA 2WUWE 2PMWB 3DE5X 3K4QA 3O83A 3FOEC 4BNNA 3QN3A 1JHXA 3H0KA 3DW1X 4OH1A 2XN0A 3QPYA 4I90A 5FF3A 4OOZA 2B0JA 3DN5A 3VFCA 2NV9A 1K6IA 3AMCA 3L06A 3TR2A 3T4EA 4OHRA 1DJXA 2WC7A 3QEOA 5B58T 4IPNB 4M21A 5JADA 5ESXA 4AD1A 2R00A 1GZDA 3M4HA 2FN9A 3EY9A 4E2WA 5KNLA 4HPWA 1TKKA 1JF8A 3KFXA 4MPJA 2ZTJA 2XFWA 3JQ8B 1U0RA 5LZ9A 3M0IA 2WF5A 3HPXA 4E4RA 2WK1A 5GV8A 1L8PA 1F2TA 3U81A 1KGXA 1RRPA 4YYZA 4R1PA 1YDHA 5I3GA 5C7OO 4JIQA 3GIDA 3VZYA 1SK8A 1X1DA 3MVEA 5H1WA 2NV6A 1RIIA 2ZJYA 3DUFA 3VOTA 1QOQB 1BE0A 1C3VA 3I3OA 4UNSA 1JH8A 3P93A 3L8EA 2I03A 2P3EA 2Z9CA 3HN7A 1VCMA 4HSNA 3JVIA 3K9NA 4HLNA 4D9EA 1X7YB 3S28A 2D7DA 1BU5A 4ERXA 3B5IA 4B4KA 1FLNA 4KREA 3BGAA 3CCCA 4EGQA 5I9LA 3N6RA 5JCJD 4OB8A 4FHEA 2CXSA 1G8SA 3C6KA 5B4VA 1AX9A 3A3YA 4MYTA 2GAJA 4FEEA 5HR7A 1R27A 3OHIA 4KGDA 3FKJA 3AXXA 2LLEA 1KJ9A 1Q6DA 3BRWA 4TZ6A 1A4IA 2IDMA 1WP6A 2CW6A 4I1IA 3NTQA 2WWVD 3E1KA 3DO8A 1KFCB 3SO7A 3VR6H 4G0XA 4C1BA 2V7XA 3ZDZB 3AHYA 1GL3A 1I2BA 2RGCA 1N2GA 3A9SA 2ENWA 2FFAA 1ZHOA 1P0CA 1YB7A 3PWSA 4DSZA 1RCFA 2C4TA 4KAAA 3P5SA 2QMZA 2XWSA 3UJEA 2ZZ7A 2BZ1A 2G1JA 3QUAA 3VIHA 3L7RA 2VNIA 4AIIA 3NP9A 1T8QA 3Q85A 2MYPA 4OHCA 1B9ZA 3CRNA 4X64B 3T3GA 1XLHA 4KXNA 1C7FA 2AYYA 4IS2A 3M6DA 1Q2XA 1E3QA 2A5HA 2ISDA 3C2YA 4PVCA 4XKYA 1HNXB 5EGRA 5E7QA 3GEDA 3NPXA 4L8VA 4NARA 4K1GA 1ADGA 2XMQA 1KQOA 3EXEA 4F3TA 1OTYA 1Z18A 3OZVA 3G89A 5IJ0A 5FWXA 1KRXA 5DVZA 4B5XA 4M1WA 3QFTA 4MWZA 4TS4A 2VWSA 3A3HA 4GI3A 1DFHA 3VV3A 2CDNA 5CPQA 1J24A 2WNNA 5CH3A 3QY9A 4KKXB 1FW6A 3MO4A 3CNQS 5KNBA 2WJZA 3C8NA 5CLJA 3NBUA 2HCFA 4AG0A 1RY8A 4B4OA 5JCPA 4EW6A 1GEHA 1IOZA 1GVSA 1JMVA 3LLUA 4BN4A 1M53A 3SJCA 4KQJA 1XYCA 4JBHA 3W79A 2C3ZA 1CR1A 2GBCA 3IIXA 3IUEA 3W1WA 4UPDA 1AL7A 2X3UA 3B0XA 1CY0A 1Y0BA 4NNCA 4ZVQA 4N9QA 4AUBA 1WLYA 4IXHA 1O4WA 1MG0A 4JWKA 1VIMA 3VOGA 3W00A 3VTRA 5C5YA 1QGAA 4LCQA 1BJTA 3GJ0A 1Z0DA 2HM7A 1A5MC 1SHTX 1P0NA 2OTDA 1UT5A 4RGQA 4IO1A 3OPXA 3TMQA 3R3JA 4IMEA 1H62A 2VCHA 3CLTD 4J76A 2QENA 3MT9A 4B82A 3UG3A 1RKVA 5JBDA 3SVZA 2IQDA 1AH0A 4IIVA 4Z9FA 3WMLA 1ZAIA 2YJ5A 3VCCA 3O8NA 5EMLA 2CBJA 2ZUNA 4Q47A 1UWUA 7REQB 3DDUA 3AEQB 4O33A 1GRCA 2UDPA 5EJFA 5KOJA 3R3WA 5HBRA 3GJSA 2OLJA 4B6SA 1O66A 4W87A 1DAOA 1J0XO 1Q7GA 1QGDA 3NAZA 4EO7A 5F2LA 3CR8A 2BOEX 4D43A 4QA9A 3L1JA 1CDEA 3S1UA 5KTPA 2QXWA 5CJ5A 1PNVA 2GVZC 3D8RA 3L7NA 2R97A 1EVLA 2CZQA 3CJRA 1FYWA 1SO5A 5LA2A 4C4YA 3LBHA 3KHSA 4GXNA 4B75A 3WELA 3LKDA 3S1SA 4BUZA 3RTGA 1J5PA 4KCUA 3JSAA 3V1PA 2UZAA 2PCJA 2WY2D 3H2JA 3P32A 4FK8A 2FMKA 1MTOA 1Z7YA 3L8FA 4CCEA 1H4TA 3FYHA 4RHYA 1TCDA 2VUTA 3V8EA 1I36A 4KXMA 2ADFA 2B4QA 4CQDA 1WX1A 3HU7A 1GNQA 2ENUA 2OM6A 3LGSA 4LAUA 1V6XA 4DN1A 1VG8A 4FJ0A 3LZ5A 2E0IA 1UKQA 1CJKC 3HNPA 1XTVA 3OODA 4C6EA 3BARA 3MCMA 4YBRA 2QUVA 2J13A 3R0UA 4JBNA 4A03A 1IEVA 4B6QA 2ZX6A 1QAMA 3LXMA 4F7WA 2R6CA 5A03A 2IY7A 1E0TA 2HHJA 5TGTA 3GVIA 3BMXA 1A9RA 2IOHA 1DX4A 5L7TA 4F9JA 4M0MA 3V7YA 1YQQA 1DKNA 2JLAA 1INLA 1SW3A 4PZ0A 1Y7IA 2FUNB 4EZIA 4BX9A 2Z24A 3IO3A 3PDIB 3I30X 2F3TA 3WF3A 1WXYA 1V3MA 2X7WA 2P0EA 2B0CA 2V45A 4A4DA 4U2YA 1J8VA 4G84A 1Z0FA 1FPQA 4LY8A 4AJLA 4G7FA 3HJGA 5GM1A 3C2RA 1LOQA 3LHKA 2QZZA 4R8SA 3DLHA 2EJTA 4Q0MA 4MTCA 1R5BA 2YA2A 2BF7A 4L02A 1MMFA 4GNRA 2WWXA 2X8RA 2JFPA 1HUVA 1ORDA 1EF2A 1D8AA 3WENA 3WIEA 2C15A 1DAEA 4NJMA 4UAUA 4EKEA 1KI9A 3OY2A 4WA8A 3EIHA 4Q7JB 4LQLA 3STGA 1R2RA 3UGKA 1LWNA 1M0SA 3UKDA 4V38A 4OQPA 5ALNA 5F78A 3MGKA 2Y85A 3THYB 4TQAA 1ZOOA 1CUWA 4HU3A 1JQEA 3DZ8A 4DDWA 4S1FA 3W74A 2G0WA 2F8SA 3LCLA 4REMA 1VPWA 1OAAA 2PODA 4WDQA 3KXDA 1IULA 4C6JA 2OYRA 3UJSA 4Q39A 4DN6A 1UC5A 5IJ9A 1OB2A 3W78A 2OOKA 3TB4A 3VKCA 3MUNA 3W7QA 4JLNA 2LE0A 4TXMA 4LC9A 4N47A 1SKMA 3N6HA 3AERA 3WNDA 4DWSB 1K7YA 2CLKA 2OLKA 1SOAA 4PHGA 3PD1A 4IHKA 2O8BA 3TKAA 5GNXA 3COZA 4XB1A 2ZT7A 3GQVA 4DCOA 1ZI8A 1XRFA 5ITZB 2ZBPA 3LBNA 4OAOA 4RPQA 4PGAA 2NO0A 4DYJA 1PJ3A 2W67A 5HHTA 1WUYA 1TM7E 4PZLA 1GYQA 3F0TA 5A6LA 2EL9A 3STCA 4BRZA 1FCUA 1NM9A 3AFHA 3IDFA 3UJDA 3AYZB 1KM4A 4NH0A 5I7HA 3FCYA 3CW2A 1KZ4A 4AL4A 3N3AC 3K2BA 4C0KA 5HR5A 3CPSA 3U7HB 1WCGA 4L7QA 2DUWA 4N18A 2QT1A 4P53A 2P1DA 1JE0A 1FVFA 1KSHA 2F00A 5ANRB 4IJRA 3UWWA 4C9BA 5KYYB 2Q09A 4DLYA 2ONZA 2B9EA 2WJDA 4W89A 2E6DA 4ZTXA 3L67A 1VKFA 3MMUA 5JY1A 5DHUA 3N2GA 2PDXA 3HA1A 3N0RA 3HO6A 3ZDEA 3E8SA 1AQMA 4ZA0A 5JJBA 1AL8A 3ZCXA 4MKHA 2ZBVA 4KW2A 3I05A 3G2KA 5FUVA 4Y9AA 3H4MA 4W7SA 2FPXA 5BSMA 5IARA 3U31A 1TCAA 4MLRA 4G0WA 5LKYA 3PF3A 4CCSA 1PVOA 1XAIA 1IQ8A 3SY5A 3QV2A 2OZLB 2HWGA 4EW1A 2D5IA 3CRMA 3WKZA 5FI0B 2NP7A 3E61A 2DJIA 1Z8DA 3U19A 2HFKA 3AP1A 3NQGA 2QNIA 3TDMA 4K6AA 1PXGA 3BGOS 3K4DA 1V39A 2ZIGA 2J4GA 1PAUA 4BQNA 3VGFA 3VSAA 5BORA 1W76A 1ZGCA 1MC4A 3HV0A 4MDHA 3C1AA 1P74A 1WUTA 4BJ3A 3MSGA 4UUBA 1FFRA 3DLIA 2HFJA 2XUCA 3N14A 3VFLA 2HRCA 3FJNA 1NVVQ 1ULAA 5D4YA 3A21A 1XWYA 4HDSA 4I6VA 3L4XA 2I5IA 2RKBA 3OCUA 2FSSA 1T6ZA 4LISA 4AO7A 1BWSA 2H2HA 5IOBA 3CLMA 1O68A 4WACA 1V1RA 5A1TA 2XDQA 2Q6VA 3RV3A 4D8XA 3ZJ6A 1ECQA 1UFVA 1N5IA 3RU2A 2IUSA 2INEA 1ZEMA 4MNKA 4UFLA 1KGUA 4QNWA 3I01A 1KY2A 4CXMA 3MK31 3NIDB 4DNMA 2VPZA 4UTXA 4P7GA 2FB9A 4OI1A 3GRZA 3GAMA 3R6IA 3R0DA 3QKIA 1YOVA 5AH0A 4Q3CA 3K5XA 3OZDA 1JALA 3MFQA 2KX7A 3LPFA 4R9RA 4A7PA 1YCGA 2C61A 1J06A 3SK0A 2R1MA 3TQFA 2WUDA 3D3EA 3TL2A 1Y8CA 1C8QA 1K77A 3TNBA 5BRNA 4L1KA 3IKLA 2CLHB 1DUVG 4LA4A 3T7VA 4GPBA 4NBVA 4XUGA 3JD1A 4RXFA 2H7VA 4CMKA 3S2YA 5C1PA 4DUWA 4IUGA 4CUJA 1E92A 1F3EA 2A9KA 3PFCA 3EWUA 4KDRA 3E5BA 3MPUA 1OFBA 1VIAA 4R88A 5KSPA 5KPDA 3TYBA 2O5EA 4Y3UA 3REOA 2I6TA 4JIRA 4LXFA 1XIGA 4ZAYA 1KTCA 3PBUA 3H97A 5HJLA 4F7DA 1N8KA 1ATZA 2GK1B 2EJBA 4KIRA 4UU7A 3LSCA 2QJJA 3PJXA 1RWOA 3OE7D 4ZEWA 1W1WA 2JBHA 1ZRQA 1LY1A 2A0WA 4DBLE 5LIWX 1JQ3A 1JEEA 1W8SA 4NL4H 1SXJA 1GQOA 3DDOA 3SB0A 1N1MA 4IDBA 4B2PA 1RQ2A 2NM0A 3WSVA 4P0TA 2AG6A 2FUEA 3AU6A 2ZRKA 2EQAA 3WQ5A 1FSFA 4NX2A 4R8VA 1MDLA 1S7CA 2OD9A 3KQVA 2PDUA 2IHZA 1QW8A 1P5FA 1SVIA 3JZIA 1RQNA 2X1HA 2P75A 2Y7FA 1BEUB 3L7KA 3H1TA 4S04A 3OPYB 4CBVA 1AKWA 5BPFA 1S2AA 4F84A 1T43A 3FMFA 2JBAB 4QUJA 4ZYXA 4AMVA 1JHOA 2XSZD 2HXGA 1H1ZA 4B45A 1M2HA 4YO7A 3OCVA 3IDQA 3AIUA 4PINA 1U3UA 2JLYA 4XOIA 4B6PA 2R1TA 1Y8BA 2V9CA 1U2RA 2F61A 3NQ7A 1W1B1 1Z0ZA 3TW0A 4LAKA 2VHXA 4HMNA 3GI1A 2NYRA 4JN6B 2BGJA 5C2JB 5B64A 3D6HA 2QAGA 3HG2A 3WLQA 4PSUA 4RA9A 2VEOA 3KLBA 1CXEA 4YMIA 1NC3A 1ZBDA 3VGJA 1QIFA 2V7GA 2HUPA 4I55B 2ZXDA 1XNQB 1KVQA 3BZBA 3U5YA 3AVYA 1KTBA 3PC6A 1MZPA 4Q4QA 4FFOA 4JPGA 1ML3A 2VHEA 3H2KA 2O3QA 2X8JB 4KQMA 2WDPA 4MDFA 2IVZA 4TWIA 1GK8A 4F6RA 5KX5B 3KZVA 2DF8A 1EZ2A 1CXKA 1N6OA 4U2DA 3T12A 2C5SA 1MX9A 1JDTA 3QY0A 4Z3KA 1FUUA 4GL4A 2NTYC 5EPDA 1G3IA 1NZJA 2YS7A 1LK5A 1NAHA 1W52X 3SUTA 3LM8A 1STOA 2BGMA 2IDKA 1RRKA 3FPBA 4P0QB 3MHFA 4OMDA 1JD9A 2JEOA 1VLHA 1MAUA 1Z68A 4QT0A 2QKYA 1DSSG 3QUBA 4YCCA 2PKWA 3CUVA 1V9SA 5FD0A 1GYLA 5J1SB 4LF2A 2QM3A 2ZR8A 5K3VA 4HMQA 3CZJA 4WJXA 3WO8A 5ERGB 3WGIA 4FN5A 3GEIA 5EEGA 3DHEA 3T55A 3UFXB 2C29D 3V4BA 2CMGA 2JI9A 2XIMA 1EFVA 5CC5A 3JW7A 1RQ7A 1VG0B 2B82A 4K9DA 4KWUA 3GZNA 3L3BA 3O8OB 3UHJA 3S2MA 2YJ3A 4DIUA 4QU0A 5DN6A 1ZC3A 3IXQA 3K4AA 3ENVA 4HNCA 5JUVA 4D4GA 3M6MD 1HBJA 1FXUA 3DFMA 4RSGA 3DFSA 4PANA 4EBBA 2A7QA 2QD1A 1OIFA 3PZOA 1H0GA 1T0BA 4P5PA 2IUTA 4X94A 4JKIA 3GGCA 4WSJA 3S5SA 5KCMA 2ZT8A 2OGZA 4QEEA 4YRZA 1NLFA 3HSKA 3R6TA 5TVKA 2QRGA 4RCZA 4Z0TA 5KVCA 4QNEA 1PIFA 3M1AA 4YHGA 1K03A 1JDUA 4Y2UA 2YY7A 2GI4A 1L3CA 3FKSA 3R0IA 4GBMA 5TB5A 1NTHA 1T8UA 4QYWA 2IHKA 5EG5A 2WXDM 3EDQA 3PQ5A 3OFNA 2H3DA 3D1JA 3L4EA 2I3DA 4GUHA 3ZCPA 4Y9TA 3E0VA 1Q0UA 4JQSA 2QVYX 1UZAA 4HCHA 4UMFA 2LGJA 4X41A 3W9UA 2ZM6B 2O3JA 1BHO1 4LZPA 3L02A 4PGFA 3E05A 4RW5A 1CQXA 3EOAI 4I5FA 5B30A 1SC4A 3TA9A 2MDTA 3K20A 2XQGA 3AONB 4JX9A 2ZB7A 4RA6A 3LRKA 4IX2A 1AGXA 2Y7GA 4IP4A 4BNJA 1U7UA 3VVLA 2HBVA 2JD0A 1RLTA 3KB6A 3NYRA 2VF8A 5AKQA 1JCJA 4B6FA 1NUTA 1QFEA 1B15A 3T7JA 2ZUDA 1HC7A 4GACA 2HWWA 2X5JO 3QFWA 3GDMA 2MOKA 1DHKA 1KMMA 3LYAA 4N49A 4RZ3A 2EV9A 1QO9A 4KL8S 3QKUA 4G65A 1GHSA 4NAEB 2Y4NA 2ORWA 3HA3A 5DCUA 4BEWA 1JPNA 4XD3A 3BDAA 2V6IA 5CTJA 1IWAA 1KV5A 3CYJA 4F6LA 4Y6QA 5DRIA 2F1JA 1FF9A 4WOBA 1E6MA 4MIMA 1XA3A 1D0VA 4LJ4A 3V1NA 1WLSA 5KNDH 1WSAA 1Z89A 1ABFA 1V71A 5IM4A 1YDMA 3Q3JB 1CLXA 1UDAA 3WLPA 4E1VA 2FVYA 4GRAA 3K0AB 2WMIA 4LZLA 1R0LA 5E9QA 1SEVA 1M6VA 2BE7A 1S2IA 4P7JA 3RVBA 4XA8A 1PKXA 2Z6QA 2ID8A 2GCPA 2VDUE 3QMPA 4GG1A 4QKQA 3SCNA 3SRHA 3TDKA 3RHTA 4KKVA 3MWAA 1W35A 1R10A 3B3DA 4MPTA 2ZZ6A 3V7WA 3CLHA 1NFGA 1M6EX 3F74A 1ODZA 2OCPA 1AJ2A 4RNCA 3OD1A 2JA1A 3BTNA 3GLQA 1MABA 2G36A 4WR3A 3AUKA 4DZTA 5JSUA 3C0LA 1E4MM 3OFKA 2PF8A 3R25A 1A4XA 3UTDA 1X8CA 1YVDA 8MHTA 4H0CA 3W5VA 1HKKA 3L2IA 1P9RA 4PICA 3VH4A 1UM9B 2YDQA 2YBVA 4YDHB 3M0HA 1T91A 4BQRA 2OXRA 5IKEA 5FV4A 3M5ZA 1JFHA 4K46A 3ANUA 2QJOA 2GTHA 3IT3A 1W9VA 2B3TA 3D2BA 3DFKA 1E6CA 3CZ9A 3RS8A 2FW8A 3S68A 1AZTA 2R8OA 4E46A 2EEXA 4DBUA 5GIOE 3M5CA 4UFPA 4TWAA 3O93A 3ITLA 3U2ZA 5I4CA 4N42A 1G20B 4QQNA 2J66A 4CCWA 3IP8A 4JJGA 4GI4A 1FDUA 4OAQA 4N0EA 5CGZA 3GLFE 4OGFA 2A85A 1RA5A 2DIKA 1RAHA 4WJ8A 1YC2A 4WDTA 5AJWA 3T1YB 1R8QA 3N25A 3WDSA 4FNGA 2GZSA 1Z4OA 5G3YA 2HIHA 1E1YA 4D81A 3DV9A 3LYHA 5ALPA 5DLPA 3PUHA 4EG3A 4Q4PA 1Q7EA 1NIUA 2J3EA 5IANA 2ZX5A 3W5IA 3WQWA 1ZUIA 2FEPA 4HQLA 4KJXA 2RBKA 3F49S 4R6WA 3I73A 4K3ZA 2HMVA 5BVHB 3QVGA 3QVKA 4C0HA 4G4SO 1K3UA 4C20A 3O26A 2AE1A 4B8ZA 3OX4A 3VMPA 2GYUA 1XKXA 5JH7A 3SCZA 4AF8A 1DXYA 1U2YA 1BYBA 3AKEA 3M2TA 3TCXB 1GQQA 2QY9A 4MCAA 4LAFA 2B61A 3B03A 2ZZ4A 2AFIE 3NJ4A 4GH3A 4EF9A 3O1HB 1BYAA 2AUTA 4ZAXA 5KZMB 3I6QA 4AMGA 1M04A 2E3JA 3C8FA 1LC3A 2G4VA 1PL7A 4WKOA 1C9MA 1JW9B 1H50A 1WY5A 2GZDA 1O5RA 4F5EA 4X24A 3VYUB 5B4UA 3SYTA 3DDZX 3UHPA 4YMHA 4RENA 1ZRNA 4QUEA 4EHDA 4L75A 5K2OA 3C3NA 4PMYA 1KXTA 3FNHA 4M7SA 1IQ0A 3HVRA 2N46A 4AWUA 2INZA 3D54D 1R6UA 1RCQA 2WHYA 1OIMA 2PDLA 5EKYA 2VYCA 2OT1A 5DLCA 1M68A 2BSAA 1PUJA 1X86B 3EDMA 3VOSA 2Z1BA 2YYTA 3MDWA 2F9LA 1WXJA 5AHFA 1BROA 4OKSA 3I8XA 4OG2A 3BCRA 1OFDA 1J5TA 3RVDA 3KL4A 1JUBA 3LQGA 5HMFA 3WDJA 3HQ1A 5LQSA 3ZVNA 1T6YA 3PZMA 1GSAA 2O3SA 1KBQA 1QRTA 4MM1A 2O54A 1JWBB 1SKYE 3IE0A 2I7CA 2VC9A 1CPYA 3UG7A 4OYYA 1UC8A 4R7WA 3SIMA 2FZKA 2Y05A 1C1XA 3L8MA 2JAXA 1X3SA 1PS9A 2ASEA 2OMEA 1FYEA 3HK2A 1SXGA 4KI0A 1SKQA 4B6EA 2IP2A 4D98A 3KR9A 3TIXB 5BYBA 4RHTA 1NTOA 4C04A 1N8WA 2W27A 3OOEA 3ELBA 4PSPA 3GMTA 5EJ9A 1T41A 2R1ZA 4RZQA 3RX2A 2IT1A 4PX9A 1MW0A 3C3YA 4R1UA 3AOGA 1P2VA 1RBQA 2IX3A 3QFRA 1OVMA 1U3FA 4MGGA 4QNMA 3GEGA 5J2UF 1OGYA 2V8OA 4YTUA 3WNPA 3SM0A 2VP8A 1UROA 2XE6A 1JDDA 2RGGA 5KWSA 4CMGA 2V68A 1GCGA 5CKSA 1QASA 3SLRA 1E4YA 3EAGA 1PKEA 3EQ2A 3ESRA 2QAGC 1BXZA 4KPLA 5BNFA 4B0OA 4A3UA 3WWOA 1UIMA 5EWJB 5KOHA 1B0IA 3DHYA 2VR2A 4LZOA 1VYHA 3V48A 4NOLA 2R8ZA 3K0HA 4O4HA 1GPJA 3IYLW 2YW9A 1FH9A 4DI8A 3W5UA 3BSWA 3NR2A 3FNFA 4TRRA 2BHUA 1QP0A 5F1YA 1UH3A 2QUJA 4DNXA 2Y1XA 1BCRA 3M0XA 2QGFA 3OOSA 1G3UA 3KOYA 1GPDG 1V96A 1ZKDA 1V37A 1GNRA 3LZ3A 5CFQA 2BMAA 1O5TA 5LCXA 1GZGA 3G8DA 3RQIA 1CZNA 3HGOA 1HEUA 3B9BA 3LCJA 3PQFA 3WD0A 2Q7OE 5K1ZA 2JEYA 1URPA 1XIVA 3ZJYA 2FZDA 4GC5A 1LFAA 4CQBA 5LNK1 1O3YA 2Y7EA 1DAGA 3A2LA 2FZ4A 1S3HA 3KHUA 2MSEB 4XVHA 3LRMA 1DJNA 2CNWA 3EIWA 3V9PA 1NVTA 5H80A 4I6KA 3AWDA 4BEBA 4J7RA 1B3YA 4D6GA 4C88A 1X1ZA 1KXZA 2I9UA 5I3IA 1OI3A 2BISA 3TXVA 2CWXA 4HJRA 1HJUA 4URFA 1SQ6A 1M2VA 4D44A 4QRHA 1Q45A 3A27A 4C0SA 2HA6A 2CFFA 2NQJA 2FGJA 1NVBA 3ZV6A 3HJRA 3W7GA 3OZSA 2PSSA 2RHLA 2XQIA 4PEEA 2WMHA 1TC1A 1OFQA 4Z1YA 2QAFA 1J0HA 2VPTA 4Q3NA 1WAMA 2AW3A 1FY6A 1GAEO 1WW8A 1ZK2A 3DYMA 1SMDA 5IRCD 3GAYA 1DL5A 3HCNA 1UBSB 2EHDA 4D3SA 5LLDA 2NNLD 5K9XA 1TKAA 3SG0A 1AUXA 3WYBA 3MOGA 3BMNA 1YHYA 4FNRA 4IFKA 5LQNA 1OZ0A 2EC5A 3DQZA 3WYZA 3OPSA 1BXRB 1Y1RA 3OKFA 1FMCA 3KQSA 2V3EA 4WLNA 4UE2A 2DWOA 3SLGA 3L2OB 4RM2A 3THWB 2WTMA 4MOWA 4QTGA 4C43A 3FTQA 5CCZA 3BL6A 4BVJA 1L7EA 2GEDA 1I01A 4F79A 4ZIRB 4C0XA 1VBJA 2G1AA 2AQOA 3OQMA 3NQVA 3LUCA 4IR7A 4UNRA 4IQGA 4JCCA 1TO3A 5LQJA 4BATA 4QGAA 3OHPA 1W87A 2IZ6A 1VHDA 1R87A 2W9XA 1L5OA 1G18A 1Y82A 4PA8A 1KQ3A 4ZT7A 1PCKA 5JWOA 1D6SA 4PIVA 4BAGA 1GG2A 4MJ7A 2OFFA 4LDQA 1SWWA 3MNFA 2CHQA 4DR3B 3BYZA 3ANVA 2CD7A 5I7UA 3H3XA 2AFVA 4MWAC 5DX0A 5IP5A 1Z82A 3LS9A 1BE8A 5CC3A 1E6EA 3ZY4A 1BW9A 1IY1A 2OVFA 2Q7XA 2GRAA 5CYFA 4AEEA 3OBEA 2PUBA 2R7KA 3RRFA 1QH8A 3F4BA 3WLJA 1GVRA 2NTJA 1NWSA 1L4HA 1CY8A 2RHGB 3B12A 2R6ZA 3K2EA 4OJNA 1MUCA 3CV6A 1VP9A 4FYPA 3CKMA 4YMVA 2VNKA 5IRPA 2DBRA 3AM3A 3LX9A 4LJAA 4POCA 4Q3MA 3MB9A 2BY0A 1KKUA 1EP1B 3QR3A 3ZJVA 2WSBA 3DBRA 5K3FB 3KLPX 5DLDA 3ZD8A 3WV4A 3W9BA 1B2RA 4DZ5A 1VCGA 4FFLA 1BMFA 1BA2A 4MYCA 1U1IA 3CT6A 4EHLA 1ISFA 5AESA 3WWEA 4C7JA 1UKYA 4NSBA 2O1SA 3EPNA 7MDHA 1UDBA 3UUEA 2PUZA 4Y30A 5TNXA 4YQFA 4KFSA 4JIHA 3R3SA 1FY2A 2CC0A 4CQAA 1X7WA 3HRKA 3WGMA 4IUBS 1JQLB 3CVJA 2QMJA 1TIWA 3AFNA 4CGYA 1WMSA 6LDHA 3BHMA 2FETA 1OK6A 3MAJA 4AKSA 4LY4A 4F5WA 4NPCA 1PYMA 4ZMSA 1WPGA 1E2EA 3WK2A 3LN3A 3C2QA 2WSSD 3N9SA 3KUUA 3K8KA 1VCFA 4R2LA 5AM2A 2YSWA 1NQ6A 5IU6A 3A28A 1KXVA 3DE1X 1JFSA 1US3A 5I7OA 3VKHA 2FQXA 3I5XA 5EIWA 2PBFA 4JA2A 2HNHA 4H77A 1H0HA 1UCWA 4HYTA 2C4HA 1P9WA 1FSZA 3Q8KA 4UBNA 4XW2A 5CPFA 3FGCA 2X23A 2HD4A 1PZGA 1T9CA 3V36A 4GNKA 2EF9A 3VHXB 4I8YA 4J49A 3KKNA 3HKBB 4ARAA 3K1GA 3LQLA 3EFHA 4KQXA 3BILA 3GT4A 3CTTA 2XCSB 3N2ZB 1ZUD1 3VCNA 3QFCA 5FOTA 2DX7A 2VOTA 2NNWB 5BSWA 4WIAA 3P9IA 1JP7A 2I4NA 4LEQA 1IOLA 2AOVA 2EERA 4N7RA 2MTBA 4KMMA 2AX4A 5E6RA 2H0QA 3ZWYA 1XLGA 5FO0A 4HCLA 2OODA 4PSRA 1I6LA 1FBAA 1BCSA 4ZTYA 1MOQA 1P19A 4Z53A 4CETA 1X9HA 4ILEA 4I5DA 2Y0EA 1L2QA 3PUZA 2M6RA 2IUUA 3QX7A 3MGAA 1D8TA 3GBDA 4XGRA 3HB0A 2H4HA 2JH3A 2WU4A 4GWGA 5DLQC 3QY8A 4YWIA 3O6YX 1WHTA 5E8RA 1XTZA 2PA6A 1Y80A 3HP4A 4LRXA 5DNVA 2BX7A 2C2MA 1W9MA 2IITA 4CEIB 2AUNA 4HVCA 2C8JA 1P7VA 4PE5B 3AKDA 1BGWA 5JBFA 5JOQA 1AV7A 3IEUA 4J4BA 5LWQA 2NUAB 4WKCA 3OMLA 4N0MA 3S7ZA 4CT0A 3DHNA 3H1AA 1KMCA 1YL6A 3X1XA 1GQLA 4XO6A 1LK0A 1V5XA 4XYLA 3RTBA 4H7IA 4HKTA 3M1ZA 3FPCA 3H1GA 2UZ9A 4WVLA 1NYLA 1QS0A 3UV7A 1H6DA 4UHEA 1ICIA 3QIVA 3SS7X 1QHHB 3ZHUA 4MO9A 1SR8A 4TTRA 1W8IA 2VPIA 1TYEB 3BWWA 3E9AA 1ZH4A 2XFRA 2JJMA 3G0DA 5KTMA 4NATA 4YYFA 2BCJQ 3S70A 1V25A 3MSRA 2V63A 3BGIA 1XDSA 4HWOA 2WZEA 4HA1A 1YR7A 1MNZA 3U48A 4YP7A 2OHVA 1W59A 3P1JA 5DBHX 2O3RA 2DBVO 5HVNA 2HJSA 3DMYA 4U2ZA 3OTWA 1B7GO 1N78A 1O89A 3H6OA 4EL0A 4DSUA 1AU9A 2UYYA 4O57A 2WJHA 1UBRS 2ZKLA 2JD2A 4EY7A 5IM4F 3QPWA 2OCLA 2QX8A 5BSVA 5J47A 4S0ZA 3PUYA 5A6KA 4JJZA 2GDQA 1K4KA 3TRKA 4OY3A 2IXBA 1R1DA 3GUWA 4XVCA 2P10A 2IPLA 3VZRA 3I6BA 4WEOA 1JLMA 3NC4A 1ZZMA 2C88A 3BJIC 3LCGA 4IDNA 1ZLYA 1O77A 2DWQA 5DRYA 4MJMA 3HR8A 2Z8YM 4N7MA 3OAAA 4EYQA 1Z6GA 4GYJA 4OV6B 5THXA 3LCWA 3FE2A 5AVJA 5F2KA 3OJCA 4EKGA 2V97A 1TM3E 2PGEA 1UUMA 3RUPA 2R8EA 1YJCA 3MUOA 4LRSB 1HURA 3ITOA 2R7AA 3JALA 2Y6ZA 3RROA 2FPGB 3G1WA 3CE9A 2PTGA 1LVHA 4ML9A 1QHZA 1N2VA 3S1AB 3LY9A 2EG9A 4GU5A 2ONCA 1J5XA 1IHIA 3ZI4A 4RQUA 5CHYA 3WB2A 3M3HA 3SCQA 4NBSA 4ND8A 5E0OA 1VZ3A 4E31A 3W1LA 1P2DA 4EB6B 1C3EA 3MCUA 3COJA 2RHWA 3W1AA 2BAGA 2YVAA 3KB8A 1G01A 4ZZ2A 4F5YA 3RNDA 5F35A 5CCEA 3O8QB 5EP3A 4YCMA 4QPCA 5DGHA 4ATDA 3MUY1 1SMAA 3DP9A 4FNUA 1K0UA 5I06A 1CYGA 5FJJA 2ZGVA 3ZQUA 1Q0SA 4HDNA 4S2BA 1UZHA 3A12A 3W8EA 4FOTA 3F73A 1ECJA 1YDYA 4Q3KA 3LC0A 1BRTA 1Y4SA 1W1YA 1IOWA 1B9BA 3PNLA 1B93A 1OB5A 2A78A 1XRQA 3DDNA 5NULA 2VAWA 2CNLA 1EZ4A 4RSRA 3WY9A 1TZKA 4FBGA 4G0OA 2WJFA 5DP2A 1Y5MA 3QLEA 4S3BA 3ED1A 5DCBA 2ZWYA 2J32A 3HKCB 4M9SA 1T4DA 3UW1A 2J0SA 4Y2JA 2BKXA 2PAFA 4U2FA 2HCVA 2YCKX 1ZVKA 3O7MA 5LB4A 5JFTA 1F0YA 3R89A 5ALVA 5HRCA 1KHHA 2NT1A 3KSAC 3S5NA 4MQUA 3F9RA 1BXGA 9ABPA 3ME5A 4TQUS 1NQUA 5LQAA 4G2TA 3OZ7A 4QVGA 1TUGA 1QGYA 4DO6A 4BI5A 2CZEA 4AU0A 3X1ZA 2A9RA 1OC6A 4ER7A 2O8EA 4W63A 1T10A 4WKNA 1AMKA 1UH5A 2XKAA 3EBLA 3I6IA 1KO1A 4X9SA 6TAAA 5M3WA 1LK7A 2WT9A 2ISSA 5LZ7A 1P9OA 1LUCB 5B36A 1K0FA 3ZV7A 3W6MA 2CHFA 4ACZA 4KO8A 5L3QA 4L80A 2OWWA 1IN5A 2B78A 3KDPA 2P62A 5CW1A 1R6AA 1D9XA 4Q03A 3RYCA 5AK5A 3IHTA 3AJRA 2BKAA 2ZDHA 4HMPA 5AM3A 3O16A 1U99A 3VMMA 1BZYA 3G79A 4C29A 4ZAFA 2DV0A 3ONWA 5D2TA 4G6CA 2WWWA 4QTUB 4DARA 1N0UA 2FOLA 4G97A 3OTIA 1Z6QA 1XYGA 4BX3A 5BURA 1XYBA 2VWHA 1E1KA 3ZLHA 1BVWA 4BL5A 4X92A 3CINA 5JATA 1T5TA 1CVIA 2AQKA 2QQ6A 3K13A 5BUQA 4P80A 1ZHHA 1NVGA 3C8HA 2BONA 3BD6A 3IV6A 1TVEA 1UD8A 1ZGAA 1YDNA 5JMUA 1EZWA 1WULS 4YPOA 2IS1A 3L9XA 4MPKA 2WMOB 2IKHA 2FEOA 4OK5A 2NWSA 3OSZA 5IAGA 3NDJA 2O4QA 5C71A 4B5VA 1NR5A 2ZIFA 2IKJA 1HZZC 1LBTA 5A8OA 4F40A 3S2IA 3N3TA 1KFJB 3L4YA 5DGIA 3W02A 2Y1OA 1XI3A 4QLKA 4PWZA 1XJCA 1VLIA 2YV2A 1M10A 5BOSB 3R1ZA 3CNEA 3ZTYA 4ZVLA 4E2FA 3G8YA 1W73A 3SYKA 4OGKA 4TTQA 3W4RA 1ZW6A 3W7RA 5EXXA 3T41A 3NEHA 1UP3A 3F03K 4DV1B 3WAJA 1XRLA 1UPUA 3EEZA 1L7DA 3ML1A 2JLCA 2J67A 5JEDA 4E2BA 4LYGA 3LLXA 3NHWA 2XM2A 5EESA 5M5BA 5IM5A 3BCUA 1EJUC 1ZJHA 4H8UA 5DMXA 3GDTA 2BWGA 1IEIA 5KEZA 1VKNA 3MWKA 4JV5B 4NYYA 4B4HA 4W7HA 3DAFA 3M64A 4TZ0A 2IW1A 1NF7A 2LW7A 1W581 3BWXA 1PNOA 4K8EA 1I0DA 1K8QA 1NLYA 3OYZA 4NJGA 5DBTA 2Q1XA 2VOJA