5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
1TR9A 1IEQA 2OXNA 3WLOA 4ZO6A 3TEVA 1IEWA 4IIEA 1J8VA 3AC0A 4MSSA 5BU9A 3WO8A 3GSMA 3SQLA 4ZO9A 4ZO8A 4ZO7A 4GNVA 2X41A 3ZYZA 1IEXA 5IOBA 3WLQA 3LK6A 4IICA 3WLPA 5FJIA 4GVGA 4YYFA 3BMXA 4GYJA 3UT0A 2X42A 1IEVA 4IIHA 3U48A 4IIGA 3WLIA 1EX1A 3RRXA 3U4AA 5BZAA 4I8DA 1Y65A 2X40A 4GVIA 4GVFA 3NVDA 4ZOBA 4ZODA 3USZA 4GVHA 4I3GA 4ZOAA 5FJJA 3WLMA 1X39A 3WLNA 4G6CA 1X38A 3ABZA 3WLTA 3WLHA 4IIBA 3WLLA 3ZZ1A 4IIDA 4GYKA 4HZMA 4ZOCA 3WLRA 3WLKX 3GS6A 5C0QA 5G1MA 5TF0A 1LQ2A 3WLJA 3WLSA 4ZOEA 4IIFA 5JU6A 3SQMA
chains in the Genus database with same CATH superfamily
3OQEA 3DG6A 5J2UA 3KDSE 5AKHA 3VJRA 2FETA 2JGDA 4NX0A 2DF8A 3A3XA 4XX0A 3CNYA 4DZHA 4NRRA 3WO1A 3M9XA 1I94B 2NUAB 3KJZA 4ZV7A 4YAEA 3WZMA 5AW7A 3GVGA 3WGQA 5BUSA 1SELA 4Q22A 3R74A 3S9YA 1RHKA 3WRXC 1UJ2A 2Z04A 5ALHA 5FPTA 3K0FB 4WSHA 1YRQA 5AYBA 4Z2AA 2OSWA 2B1QA 3O9NA 2B69A 1CS0B 1KIAA 1G6KA 2GUGA 4RIGA 4DLTA 5I3GA 3PJTA 5L4LA 1L8QA 2TSYB 2QAIA 3ZWSA 4DPQA 1GLVA 3M1LA 3C0JA 2EPOA 1K2VN 3MLBA 2X4DA 4QRDA 3T3OA 4NE2A 5ECDA 1FP4A 4W63A 2OCAA 1RCUA 1W7AA 3BWWA 3KQOA 2QTRA 2P6UA 2O48X 4NKRA 1Y8QB 4AWEA 3M6UA 1J11A 1SXIA 2JH3A 3QV7A 4BWGA 1O54A 4PMYA 4OQ4A 2VPWA 2O2GA 2ZRFA 1Z5NA 2OZLA 3WELA 1JQEA 1F9AA 4RD2A 4H6EA 4UCXA 3T61A 1RAHA 2NUBA 4L0DA 4GOLD 1VL1A 4U2EA 3DMTC 3CNHA 5JBQA 1TQ2A 2FFQA 4KO4S 1IHYA 2IZ5A 1NW9B 1Y5MA 3OLDA 3O3CA 4R2IA 2B8EA 2QN1A 4BP1A 4JBGA 2W2XA 5IJWA 1SVUA 2PCQA 4X62B 3E1KA 1TD9A 1GK8A 3W6YA 3QV6A 1FZQA 1CY6A 2JZNA 3D4PA 3C2OA 1JI0A 4BA0A 5JZSA 4X45A 4LRYA 4E94A 1JKJA 3EZFA 1WS6A 2JK2A 2I2WA 3AIBA 3GVIA 5D2XA 1TU3A 4EKGA 3HJZA 4U63A 3CEPA 3FLUA 3VPFA 1REQB 1V39A 2X9VA 1VPDA 4L1WA 3MJVA 5A04A 4S0XA 2G70A 1HO3A 4D4IA 1SZGA 2LKCA 4OHYA 1FBAA 3ZDYB 1BX0A 1E56A 2XJ7A 4AU1A 2IY9A 3ICWA 2E48A 2VAWA 3IVGA 4TS1A 2WCSA 4IPTA 4TVUA 4EHLA 5BXQC 4G37A 4C7JA 3ZJVA 1AS3A 3R8CA 2NUAA 3TPFA 4JELA 3QR1A 4FDTA 4OHQA 3BSWA 4Q7LA 3V3TA 5HKKA 4J29A 1SN7A 2D2JA 4LHVA 3W7CA 2B7PA 3PLRA 2BUBA 2ZXBA 2Y1KA 1DBTA 3EPPA 3EIFA 5PTDA 1EFCA 2AOUB 3CH4B 1I30A 1VLHA 3B8VA 2Z6UA 3W4RA 4FXFA 3VJMA 2EPLX 1NJSA 4QJ3A 3LCHA 4BX0A 3IBGA 1PZXA 4M86A 2ZJOA 3CV7A 2HSJA 5MN5A 1V6CA 2DPGA 5JROA 4D6XA 3HGJA 3ZT7A 2KW5A 4X61A 3KPWA 5LQAA 3TKFA 3Q87B 3CVWA 3BC1A 4ZRMA 3GC4A 2X3YA 3UICA 4L9YA 3A6FA 1XLUA 1GAXA 5JEEA 4NNAA 5AVQA 2G1PA 3RX2A 3LUCA 3T7IA 2QUKA 3P27A 1JZ6A 3SOZA 5D32A 2Y76A 4MVWA 3PBUA 4KLRA 1DV2A 5E3JA 2BGTA 3RPEA 1FLNA 7TAAA 3P80A 4A16A 3QOFA 4A8IA 2ARKA 5I8ZA 3I8XA 4QCFA 4JIRA 2OECA 3SX4A 4J0IA 1PFUA 5E6SA 4FWBA 3VO9A 4W9TA 2E68A 2Q1YA 3M5YA 4UTZA 3OOYA 2Y0BA 4X3PA 4GDMA 4K05A 3VNZA 4BFSA 4KCTA 1P1FA 3WD3A 3RTEA 4TX6A 4N3CA 1E3ZA 4JODA 2J0UB 2F3RA 4PUMA 1OA0A 2REQA 4M9QA 5JANA 1WULS 2VK4A 3ACBA 1Z5OA 4I9NA 4JI8B 1K63A 2X13A 4WJ8A 2WIAA 2QEQA 1QO7A 1YS9A 5LLDA 4IM7A 4LF9B 4S2BA 4WDQA 2DTXA 3PY2A 2X23A 5A9SB 2OZ0A 3ZCPA 4TLCA 5AOCA 4QYIB 4LJLA 5AUPB 4DC1A 2NQZA 4G1VA 2A3BA 1WQ4A 2PGJA 4E11A 4NZ9A 1YDGA 1C93A 4CIBA 4F66A 3PX7A 3ZXUB 1Z33A 4IP0A 2QBYA 2QMEA 2IVFA 2B25A 1P0QA 5EFZA 2DT3A 1T0UA 1QIIA 3VC3A 3B1KA 1EWDA 3L77A 4QP0A 2NSLA 5D37A 4DMRA 1KAQA 3OCUA 5F3WB 2YR1A 3CB4A 3NO5A 5J5RA 3M44A 5FL7D 3JQPA 3RLUA 4WA8A 1V7CA 2OVBA 3I76A 3B9DA 1G59A 1WP6A 3M7IA 1TT7A 4AD2A 3TFXA 3WF4A 5LP1A 3BGVA 1XC7A 3FPFA 3N7AA 4EWLA 1XH1A 1GG1A 4Z9FA 2I9PA 4LHXA 1V2HE 5BYWA 5D5PA 2WSRA 5H81A 2VAMA 4KXLA 4RZBA 4Q4LA 1OLOA 1E0DA 4MK4A 1LBMA 1JDBC 1HSZA 2W4MA 1EGAA 4Y9NA 3VSEA 2QUHA 1G17A 3OQBA 5JI2E 2AYZA 2ZUNA 2B8NA 3U37A 3PANA 1IOWA 3ES9A 1USWA 5IDXA 3V4FA 1EJSC 4BJHB 1QPKA 3SE7A 1RKBA 2O7SA 3KEQA 3COWA 3VX0A 1Q0RA 1TCMA 2GETA 3O75A 1B8PA 3USES 3ZWMA 4H15A 3ZXSA 3UW6A 1LTQA 1JL8A 4Q93A 4FYPA 4GNVA 3XINA 2CW5A 4A91A 2M32A 1CR1A 4ZL1A 4KEAA 2ODAA 3SYNA 1ZTVA 4DO6A 4OQPA 5FJJA 2DJLA 4UQPA 4JT4A 3DEAA 4L73A 4TO8A 5B1YA 5J2TA 3JARB 4NYMQ 5JSHA 3JALA 4DV6B 5I7RA 1S1CA 2H1IA 2K87A 1H65A 2QV5A 2JI8A 4UR7A 5EVCA 5WRFA 1KO1A 1IYXA 1KXQA 2XUFA 1GQOA 4YNBA 5B6JA 5AVTA 3EQZA 2WMIB 3KHJA 4PSUA 3BAFA 4D9CA 1KU0A 3UOGA 3B03A 1JHZA 1JQKA 3HGMA 1V6WA 4H83A 4H18A 4O4HB 1I3CA 3KPJA 3FFTA 2E28A 5AM3A 5GJCA 4WLCA 1KBKA 2GN1A 3P0HA 1HDEA 1NUPA 3EHDA 2IOHA 3EIXA 3H1AA 3S99A 4HQOA 5JS1A 3VA8A 4CD7A 5JS6A 3ZQUA 1ZCCA 1G8MA 3DQZA 1W3HA 4OHRA 2V69A 1ZZMA 1KFJB 4RM2A 1MR3F 3AMGA 2FHCA 2NZUG 3R20A 3AZOA 4G01B 5IOBA 1ZK2A 1JT9A 2ON6A 1YE6A 3POCA 4I5GA 1Y9ZA 1M6YA 4ZKEA 3IQGX 3WWEA 9LDTA 1ODCA 4R88A 4YVFA 3DFZA 3B97A 4Z42C 1W1VA 3N2GB 2Q5EA 3L6UA 3GTFA 3Q0TA 3OEEA 3WL5A 4L2IB 2DBZA 5T8KA 4HJFA 4TMZA 5MHTA 1DBIA 4ASTA 1LTKA 3U44B 4MNTA 2DVUA 3PZMA 1FNBA 1H2EA 3F4NA 5ALRA 2NZYA 1ZM4A 2CDAA 3IVTA 1F3TA 3SFVA 4JI2B 2QRJA 3WL3A 2VUYA 2BTQA 1UMYA 2J77A 2VFGA 4RPIA 3OA3A 1YSCA 3ZU2A 2BR4A 1S89A 4J16A 4I1VA 3KQVA 5TB5A 2ZQ5A 4JSYA 1IN4A 2NVWA 3MGGA 2B4RO 3LSCA 4GWEA 4AMAA 1NQTA 2LTAA 4GABA 3P81A 4LW7A 2M2IA 3B8TA 2PXCA 4HADA 4AMCA 2QDXA 5FD0A 5LBUA 3SD7A 3U4GA 3HDYA 3FTFA 3MG9A 1YJAA 3CT2A 2JKAA 5BURA 3V7FA 3SYTA 1A80A 4UFHA 4BTLA 4CEJA 3D5TA 2QR5A 1MGPA 4HGQA 3OVGA 4KFRA 4CQBA 1C7TA 3RC7A 3DAYA 1PR5A 1XLFA 3P96A 1B3RA 4N0MA 4ICCX 1EBHA 4BVJA 1G7SA 2R8PA 4CGTA 4YU1A 2HSDA 4WTOA 3OM0A 1W94A 2QTBA 3WQ5A 1K7EB 5DCUA 4B3ZA 3GEIA 5KYWA 3LQ2A 1NIPA 3ZE1B 4NZ1A 5ALLA 3NRCA 2QG4A 2P9ZA 1J09A 4XD4A 3XIMA 4GZIA 4LC0A 1EUZA 1TZCA 4MW2A 3QX8A 4B46A 1JLMA 3OD5A 3IP7A 4HHHA 5EGRA 1IM8A 1CULC 2JRCA 4Z7NB 4JHOA 4NMHA 1CIVA 1N92A 4KO3S 4YVVA 3QPCA 5F4WA 3TG8A 1SBCA 1W3TA 1USIA 4LE0A 3MBIA 2HRCA 3N2TA 3CS2A 1CR6A 2JGKA 4TYMA 1PSCA 3TN6A 4OAOA 2ZBPA 2QRZA 2VC9A 2DQYA 4TLDA 3RWOA 3GRKA 5A8OA 4Q4OA 1KFCB 4MVJF 4W82A 1T3GA 2MDTA 5IDVA 4Z5XA 4G4SO 4WMLA 2PDFA 3DPIA 4OXRA 3L7AA 1RWOA 4GVHA 3TKAA 1QZ3A 3CV2A 2EGGA 2OP1A 2UUBB 4LJRA 4BP8A 4OJNA 5KYTA 3M4NA 1R85A 3EGOA 4QJ4B 3OQPA 4L4RA 4QDUA 3ZE2B 4E3VA 1UMBB 1P6XA 2GJNA 1ETHA 5BOOA 1SCKA 6CHYA 1Y80A 2RAVA 3G6WA 1YBFA 4QGFA 1DOAA 2C4MA 2Q50A 4N4AA 4B2DD 3WDLA 3K70D 3IAS6 4OSEA 3L9XA 1MW9X 3AVVA 1ZXXA 2NPIA 1CXZA 4YJGB 2BLEA 4OHMA 5BQFA 4BCDA 3U7QB 1M3SA 3F3YA 5CBJA 3KLLA 3F5QA 5LUAA 2AQIA 1EP2B 2GGHA 1K7FB 3DW3X 1L4FA 4OQQA 3FOEC 2PR7A 5C5DA 2L2QA 3AK4A 3FNBA 3N70A 4GL2A 1YDYA 3QF4B 5A3HA 4AIOA 3WYZA 3UCXA 3L7OA 1F8XA 3L4SO 1TVMA 3WNMA 3ZWDA 3AS0A 3ONBA 4MJ4A 3FGCB 4TT8A 3LCIA 5LYRA 5K4XA 2FX2A 2DSVA 2GGSA 1D4ZA 3WYDA 3ZIUA 2N9UA 4G1NA 3PM6A 4ENPA 4DABA 1EKXA 1WF6A 3H9UA 4G0VA 1X7DA 1V8ZA 3KLNA 3O0TA 3BCUA 1EM8A 4ZEVA 4FSAA 1XYAA 3D4NA 1EJWC 2HBQA 2HSWA 3S2IA 2AXNA 4GUDA 1C81A 4QX6A 4HG2A 1XLDA 3LQYA 2G07A 4Z1OA 4A35A 4E8DA 1C9NA 3EG9B 3EQ9A 5JTUA 3R12A 4A2QA 2FHPA 4S3MA 3AFBA 4HXEB 1OBFO 2AGTA 1WEKA 4XAPA 2P5YA 4GHWA 4H31A 1SC4A 3JQQA 2X7JA 2XKKA 3CL8A 1ZSXA 3V5NA 3LHSA 3V0TA 1JS1X 5KMGA 1DQSA 4JS3A 5GV7A 1H4SA 4YRAA 4OHWA 3VAZA 1PJZA 2JJ2D 1D8CA 3M0EA 4WVFA 1BVWA 2X5KO 1JSCA 4GQQA 1FWHC 1T5HX 4RK6A 1Q2UA 2W93A 2IEGA 3SUWA 5D2VA 3WUEA 1W3IA 4JX5A 1B0IA 1NWUA 4B3HA 2WILA 3L8MA 4TPKA 3UJNA 2FZWA 1FUIA 3CPGA 4AZSA 3I04M 5DSXA 1YGPA 4YTQA 3UXLA 1BPLB 1U3GA 2O3RA 4QBIA 2IKSA 1VQTA 3N2IA 1MD9A 1JH8A 2NQ2C 2QLTA 3B0XA 1NHWA 4UQEA 3CVXA 1R4NA 2VAPA 3KJNA 2H3EA 1NC3A 2Z98A 4R8SA 4QPPA 3ZY2A 1MRQA 2VSYA 4D0GA 3C3CA 3OLVA 4A4AA 3FPAA 1N5IA 4KPUA 4QREA 3KRZA 5IAAA 3BCRA 4FSHA 1UOEA 2OQRA 3GP8A 1Z0KA 4C3OB 5J63A 3PSWA 3MWDA 4UTLA 4EZIA 5KTPA 1TEHA 2C2KA 3NDYA 4FIZA 1RBYA 1UMLA 4K9OA 4IG2B 3LRXA 5D3MB 1Y1TA 2VT6A 4CU7A 5TQ2B 4GPNA 1E2KA 4EX7A 2QPUA 1JLLA 2EX0A 4GVFA 4MA0A 2PZGA 1ISYA 1EM8B 1PZNA 2Y4NA 3PWSA 1VECA 2R4TA 4WA7A 4X90A 5A2CA 3A9TA 1NX9A 5FKYA 4CNTA 4LYQA 4WOJA 1XCOA 4AZCA 2YZRA 4LF2A 1E2BA 3L0NA 2BHNA 3TLYA 3LX5A 4RPQA 4MA5A 3IB6A 3CW8X 1HDRA 4Z4EA 3H2SA 2PV0A 3K9FC 1LBHA 4C0LA 4F3YA 4OTZA 4ZGWA 1Z44A 1QU3A 4JVNA 3B8HA 5AJZA 1DOHA 5CGTA 3EWZA 4R0VA 3LC2O 2ZSIA 1XNRB 1R8SA 1JJBA 2PUDA 2A6NA 1DQPA 2H8XA 4UU1A 2O9OA 5C0QA 3BLPX 4QATA 4XSHA 1UZLA 4JT2A 3SEFA 4KQIA 3P2JA 8OHMA 3TPCA 3SDOA 2LIPA 5HZKA 2UZIR 2PT5A 3M8KA 4X41A 3VVCA 5IVPA 3U6BA 2DW7A 1XRRA 4GZMA 4HT3A 5B3AA 3VHRA 1RM0A 3EDDA 1XRFA 1N3IA 4GQGA 1C0EA 4FB4A 1ZENA 1S5TA 2ZRHA 1HF6A 1A8UA 3BTNA 1JU3A 1E5TA 3GQVA 3PWTA 3L4JA 2JKYA 2HHHB 1RLIA 3R1ZA 1YHYA 3VUPA 2BZ1A 1X1CA 1E5NA 2OBLA 2XA9A 1RA5A 1A9XB 3Q4DA 1TYEB 2PLJA 5DHFA 1YR1A 4CL0A 2V5VA 1Q16A 4I4IA 2C7RA 4GIEA 2AL7A 3V16A 3HFGA 1RQLA 3EVCA 4J9UE 4UNLA 4NXKA 2X4GA 3I1YA 3M1YA 4QXAA 2CXQA 1UR5A 3LD5A 1Q1ZA 4OLAA 3QY0A 4Y18A 4DY1A 5TEWA 5LZ4A 3KAPA 2PS2A 1R6UA 1FUUA 3UO8B 2QI9C 3AB8A 2NLYA 3QRWA 1QRDA 1EB3A 1DUIA 5C55A 1GG0A 3W5CA 3FTQA 1QHNA 4G8CA 3K5PA 3Q41A 4M8NE 5LR6A 4L9AA 2R7LA 3FCEA 4C7VA 4QPZA 4MNMA 4IJKA 3CZQA 4NP7A 5ABTA 4GMHA 4HWSA 1S2LA 3KOUA 2WMNB 1ES9A 2A3RA 4MG4A 1E1DA 2EWVA 4DZTA 1KEZA 721PA 3GZTB 2CLKB 1ZMOA 1QNRA 3GZJA 1UOQA 1JUBA 1II8A 4P3OA 4MOZA 2J3HA 4BO0A 2EJVA 1QP0A 3HV2A 4HQ6A 1Z2EA 2CLLB 1NTRA 2DUAA 4ZR8A 1R9ZA 2C2BA 3OGRA 1P5BA 1DRJA 3AVYA 4ZCMA 2DH6A 3LUHA 2GK1A 2HC9A 1UOZA 3VNDA 1B26A 1A04A 5A5DA 5BWBA 1IHDA 1HM5A 4P7QA 2CXEA 2C7PA 5CM9C 4QYSA 4WNIA 4LRUA 4XZBA 5K2OA 2OAQ1 5K9CA 1BD0A 3NQAA 3DA8A 2X3UA 2EL7A 1CWYA 2UWFA 3FUTA 5AHRA 2ZQYA 4PPGA 2RHJA 3KRBA 4H3DA 3I05A 1UIPA 2ZX6A 5FTKA 1G20E 2V0TA 3USBA 3AQIA 1MTOA 2H92A 1KYZA 1KMHA 3V8VA 3I64A 2J46A 3UKJA 3ANYA 1KB3A 5KO2A 1PZ1A 1X1ZA 3HY6A 2I2AA 3ABRB 5AJXA 5AFSA 4U3JA 4AY8A 1GEQA 5TDHA 1E3SA 3BB3A 3RO6A 1C7QA 1EQCA 3AW8A 4RJJA 3COSA 4NBNA 2G63A 2ID7A 1JDZA 3DE0X 4ZOBA 4AZBA 1ITZA 1EO5A 3ENNA 2XYGA 1Y6RA 5GQBA 3O47A 2QQ5A 1QHSA 1YZVA 1FP4B 2OELA 3O63A 3HZ3A 1JTEA 1PYMA 4KE6A 4ODIA 3DCIA 2IYLD 3DYMA 3S5SA 1TVPA 3OW1A 3OJLA 4XWKA 4XZIA 5AM0A 2W58A 2I55A 4UTOA 1AK5A 3QMMA 4S0ZA 1IXZA 2ZZNA 1O3YA 5LNRA 4LECA 4DEVA 3AX6A 3L4VA 3GLQA 4YWIA 1Y5LA 2CZVA 5EHGA 1HX7A 3FYTA 4KRXA 4X9XA 2Q6TA 5JZBA 1Z89A 3T0DA 1G8JA 5AI5A 2CUTA 4CQDA 1KYWA 1GYPA 1SG9A 3PGLA 2CLKA 3QXSA 3HVKA 4CKEA 1YULA 4OB7A 1XI2A 5HTOA 1Q57A 3HFJA 3ZWVA 1VI5A 4DWSA 4YMGA 4MLCA 1D2MA 4DIDA 1U0HC 3KSDO 2ZTJA 1US8B 2NADA 1PL7A 2OZVA 2R6OA 1BIFA 1W5NA 4M88A 5CIYA 2EZ4A 5B1EA 2IHUA 4ASUD 1SG0A 2FKNA 5IBRA 1TL7C 1EIZA 3KLOA 2QBYB 5GJPA 2J75A 2P9HA 3RUCA 3WCZA 3GHRA 4RADA 2NTYC 4PQFA 3R25A 3CJPA 4DRSA 1A50B 4C9BA 2YH2A 4OSOA 1XJCA 4R68A 4LJ3A 3PLAE 1RXCA 1QQ5A 2QVBA 3N4FA 2ZIUB 2PNJA 1X1EA 4WIAA 3OZDA 5D01A 2ZSAA 5FP0A 3RK1A 1YBQA 4WPGA 1P7YA 1HR0B 2H08A 3DPUA 1SSDA 3IQFA 4B3LA 4V38A 2ZVPX 1NXPA 3IUJA 3DC7A 1RSCA 4CV3A 4C60A 2B2XA 4TQ9A 3VHXA 5LXTA 1M1YE 4BNGA 3Q40A 2C4TA 2PMBA 4D0NA 4JBHA 1EHYA 1YU9A 2NP6A 4A4DA 5EPUA 5I51A 2PTWA 4OIFA 1SOMA 2A8YA 4NCHA 5ISMA 1N2CE 4BWYA 1C9DB 2CL5A 5CLQA 1POXA 3MSXA 1CS4C 3PF8A 2QYTA 5JAPA 5IFLA 1Y5WA 4W8GA 5JBEA 1YOBA 2P35A 3N0XA 2UYGA 4YAJA 1T1GA 3KZMA 3ZI4A 4Q7QA 1S5VA 4XGKA 4R0MA 4XZNX 3S27A 3CISA 5JCZA 5A5FA 3LOPA 5F1KA 1UANA 1FE8A 4I4TF 4C6TB 3PTZA 4U6QA 3TTTA 4LB3A 3EZ6A 1YZGA 4CUJA 5C4IA 2I14A 4F9FA 1XCMA 3PYMA 2GD0A 1CUEA 1JWAB 4XPIA 2C0CA 4BO6A 4M1QA 1GOWA 3ND5A 2PTXA 4W6ZA 5FNZA 4Q6WA 4HO1X 5J4HA 2Z57A 4DJDA 2FH6A 2WLSA 1VJGA 2WNWA 2WWWA 1ESCA 4D8AA 4GUGA 3KEGA 1F5ZA 4L1GA 2YJ3A 3G0HA 4U7PB 5K3SA 5U4QA 5KVAA 4PMOA 1WPCA 3DERA 2CXUA 3DOJA 5KTKA 1W6TA 5DK6A 4AECA 4D8UA 2OSYA 1YAHA 2E6YA 1UXOA 3UAZA 2OWDA 2HQOA 1NQKA 6CGTA 1PLKA 5CFLA 4QFBA 1DEXA 4IR7A 2XUQA 5EJFA 5JZMA 1KR5A 4W9NA 3ESZA 2JDID 3NGMA 2WMYA 1T5OA 4RFSB 1NTHA 2VNHA 1P0DA 1S2CA 1ZESA 5FJUA 3HBMA 4FR5A 3U80A 2O3UA 3E5HA 4UHKA 1LX7A 1SFJA 1SYTA 3EZNA 1KTCA 1FJGB 2DBRA 3QG1A 1XCFA 4D97A 4XSMA 3B36A 3WB2A 3PK0A 3GCGA 5BQOA 3PSVA 4J3NA 2DWPA 4M83A 3PBKA 2P2GA 4MEBA 4FQ7A 5SZIA 2OP0A 1Q12A 1OFPA 2GGEA 2JJ8A 1ZSVA 2P53A 2W2MA 2VDWA 2CL6X 2QLBA 3P9CA 2VELA 2OV3A 3EXEB 3VKJA 2W6IA 2NUTA 4YTSA 4AY2A 1KFBB 4IX9A 2YWRA 1N2CA 2D8MA 3HFYA 4DJFA 3KCQA 3V7PA 3RTBA 3JQFA 3K2IA 3O15A 1LDGA 4D3XA 1KI7A 5KQPA 4HYVA 4WI1A 4MO2A 5HQ3A 4ZOEA 1ORTA 1T2CA 3LDHA 1VHQA 1V03A 1BKSA 4HMQA 1EHCA 1DCFA 5I6SA 4EI9A 5D3ZA 2I7VA 1MVYA 4C06A 1HJXA 4M29A 4P0TA 2V58A 1KAMA 1QRTA 1OU0A 3W0KA 1CR2A 4RQAA 4LU0A 4HVCA 5JIWA 4F9EA 1F3EA 1V11A 2WUVA 5LDGA 4LISA 1CDDA 2DCUA 4KR9A 1D2CA 4O4LB 2VZUA 3A4TA 2C71A 4ZHQF 4EF4A 1OMOA 2BMBA 3AWIA 4AX8A 5E09A 1MI3A 4CU8A 1NASA 4P4UA 3EAGA 3TJLA 3U26A 5A2GA 1H7WA 4UFJA 2EGUA 4HYTA 4EPVA 4M3PA 2NZXA 4PHHA 5B1SA 3WHLA 4ER3A 1U3UA 4LZOA 5DXAA 3K94A 1I1HA 1Y5IA 2WU1A 2DP3A 4WCFB 2LWIA 1Y63A 4Y1FA 4G26A 4DJEA 4JENA 5K0GA 4H17A 3N19B 1OKKD 1Z88A 4GMKA 4BPBA 2BGJA 1BYCA 1V7PC 2ZC1A 3DUGA 4XIAA 4FKBA 5BMVA 2EGZA 1XZBA 3U5YA 2HBYA 3M0VA 3LEPA 2GUUA 5JH1A 3S40A 5DF1A 3FHTA 4LY3A 3WLNA 3PB2A 1QUEA 4GRIA 2Z30A 3JVIA 1HYHA 4DR2B 5T9CE 2V6MA 4Q6JA 1PN3A 2R44A 4MFEA 2K5UA 1YR2A 3RK8A 1E7QA 4WZHA 2CHEA 3CEJA 3H1EA 4TLLB 1XIIA 4Z9BA 4BJ1A 1H2BA 1U7TA 4N39A 1J06A 4TXEA 3K1ZA 1KI9A 4E2DA 3TTUA 2X8JA 6YASA 1RJQA 5I8WA 2WHQA 3W2LA 3OTHA 1L5QA 2VRQA 4M1YA 3TRHA 2ZUVA 3EULA 4E5YA 2ZE0A 3WAJA 4FLSA 1T0BA 2C7GA 3VKKA 4RL3A 2XMRA 1IVNA 3DOEA 4KK3A 4I9HA 2BPOA 5AVOA 2WKLA 4FEGA 4LJKA 3AH8A 1ZUWA 4ZRNA 3TTOA 4REQB 3PQ5A 4KK4A 4JFVA 3B2NA 3TXAA 4BBZA 5B1DA 2JLQA 1Z5PA 2GKOA 5JI3E 2G77B 4XISA 2XUOA 5DN6D 4JWTA 4OH7A 1GPH1 3FSUA 1S5MA 1J5PA 3DAGA 4K46A 4ERXA 3DEYX 1BYUA 3EPNA 3RILA 2AMJA 4CG3A 4GPD1 3CYJA 4ZXPA 3IRSA 1RE0A 1T9GR 2CK3D 3RX3A 3G2GA 4Q8PA 3ZNOA 3OZSA 4CL3A 2J6BA 4L4MA 3U4FA 1VL8A 3R0ZA 1PVNA 2MR5A 3V1KA 4DPPA 4G1UC 3QU7A 2QE7D 1NELA 3HM7A 5JAUA 5FWDA 2Q5JA 3UU0A 1UBOS 1EBGA 4BMCA 1SB9A 4URYR 4XBJA 5H9WA 2P67A 1FWDC 5ABGA 2A4AA 4B45A 2PLAA 3Q10A 1Y6ZA 2JEZA 4PYJA 2ZTUA 4B81A 4F3KA 3KSUA 2IS2A 5AVUA 4G81A 2QMYA 4HS4A 1PHQA 3KJEA 1V48A 4KHPB 1BNCA 2J7BA 1QP4A 3CT7A 3K4DA 3H5AA 1FWIC 2Q4TA 3RADC 4OXYA 4DHGA 5EWLA 2B7LA 5C5IA 1OXKB 1UBRS 5LA2A 1FWSA 3VKCA 4BF7A 1EJ6A 5DT7A 2GCEA 1DLIA 1JQJC 4A5OA 1AQLA 4Y2JA 2IC5A 1RT9A 3R7WA 1GPMA 2J33A 4NI8A 3FZYA 1NJ6A 2V6IA 4MW7A 1V8PA 4Z4IA 1L6YA 4XWGA 3BICA 1RIFA 1N7KA 2FW0A 1M1BA 5A6LA 2BGSA 5TXGA 1XR3A 3MWEB 4HU4A 2O9PA 2DR3A 1NDVA 1KY4A 4D6DA 4DQVA 3EY9A 1KXTA 1K1DA 3UP8A 2F17A 4LC9A 4DXXA 1FFXA 2MSCB 4M5PA 4H19A 1A5UA 1HLGA 1U8UA 2TECE 3BVPA 4EUNA 2PSDA 4UMBA 5ALDA 3F9IA 4GEKA 1ESWA 1VE6A 1IXOA 3MTJA 3KV3O 1DIEA 1L4GA 4OHVA 5IDIA 4H9GA 2GPAA 3I10A 1G2OA 2NQHA 1WXFA 2F8LA 5F52A 3OA5A 1RV8A 2J7GA 3T8QA 1C50A 2X1VA 2P8SA 4BV3A 4WDTA 4JY9A 3BWYA 5EXPA 2QE6A 3C87A 1MB9A 3Q6IA 1I32A 3GLIE 4ZJUA 3FUWA 5IYZA 4W87A 4MR7A 5DMNA 3NUQA 1H1DA 1UJCA 3AF3A 2DT1A 4OM8A 3JWPA 4HGZA 1J33A 3QR0A 3NZ1A 1O7AA 3U0BA 2IIQA 3B70A 5MHBA 5LYYA 1NYLA 3URAA 2PAFA 3HBJA 3BIWA 4IKEA 2H90A 2EWMA 1GTVA 4JKLA 1QDSA 4IG2A 2QVZX 2VKQA 1B1CA 3W5AA 3GBEA 3CJRA 1XC4A 3HZZA 4MGEA 3PUZA 4QGAA 3HV9A 1GGJA 5BPFA 1MPTA 2G71A 3NAQA 4AEOA 1QW7A 4AN4A 3H8SA 2D54A 5B30A 4JC0A 3BTSA 3HZRA 3DKIA 1VMKA 4JKOA 2WIKA 4MV1A 5HF9A 4KLCA 3DTYA 3U31A 1OVMA 2BSAA 5FESA 5JVDF 1EFHA 1RCFA 1S2NA 2JD1A 4P5UA 3L8ZA 2JLCA 3C2VA 5H7XA 3WK0A 2E09A 3HMKA 3IH5A 4RCXA 4YCLA 2OYKA 5GADl 5KQLA 4FDMA 3ENQA 3GD7A 4S35A 4EATA 1RLTA 2Q2OA 3RV3A 2HJHA 5BRBA 4QYMA 2M6LA 4JQCA 1W5PA 2CKDA 4PV7A 1PIIA 4XXHA 3U2EA 1ZL2A 4P3XA 3PQCA 2OFXA 1BQ4A 2JHCA 3G7NA 3ORWA 3W3ZB 4FEAA 3NWBA 2R9RA 2J4DA 3CV6A 2O3SA 1DPGA 3INGA 4GO9A 2G76A 1X77A 4I7WA 2ID8A 3INNA 4ECAA 4WOZA 3CZPA 2VKZG 4L65A 5DMXA 3GQBB 1H4VB 1MABA 1EC9A 2B1IA 5EP4A 1IZ0A 3V1LA 2XWEA 4ZEPA 3PHGA 3QPUA 5JD6A 3IT2A 1MQAA 2QP9X 3ZJ5A 3I3BA 1PK7A 1E61A 1RXUA 3B6MA 1QIFA 3SU8A 1Z8HA 2R14A 1C7SA 3TXYA 5JWRA 4BEWA 4EUKA 5J58A 1K6WA 1G2QA 3D0KA 3GXBA 2X9NA 4MYUA 4J2PA 1FJHA 1WKYA 4GMXA 1MO0A 1IPEA 3MUY1 5KJEA 3BJRA 2DWQA 3UD6A 3EDOA 4D1YA 2BFOA 1ICPA 1MW1A 3N29A 1YFLA 3LJKA 2PSHA 3A4AA 4MKZA 3DF7A 5T26A 3KEMA 4LHEA 1DIGA 1YQTA 1RMYA 2N47A 2NU8A 2WYVA 3T95A 2V4MA 4F85A 3G85A 1P3JA 3K05A 4WGFA 4PQEA 2E4VA 4PC3A 4KE7A 4K7VA 5MKGA 2EFHB 1EBFA 2PBFA 1OI7A 2FCAA 1MLDA 3E3OA 4ZTZB 2CJFA 1BS1A 4AQDA 5F1UA 2V98A 4H1HA 5DF0A 5T8GA 1VJZA 1H2RS 3AKZA 5IP5A 2J4GA 1YVPA 2E89A 3RUHA 5CK5A 1K4YA 2Q1XA 2GKGA 4HLCA 1O58A 1E1QA 4DBLC 5EHIA 3GUUA 5FJRA 3GELA 1N0VC 1BWKA 3RFVA 3KQPA 5JCJD 4XBKA 4DNHA 5EA9A 4JQYA 3ZJTA 4EIWA 3BRCA 1UBSA 4ICMA 4TL8A 3ML1A 1ZKMA 3HGOA 3EF1A 1OXXK 4XEHA 3K4QA 4EFKA 3DHFA 2JH9A 4JLKA 1NT2A 2C82A 3CLUC 1EUYA 4C6NA 1O4UA 1XFCA 2J4FA 4D6IA 4E6MA 3QSTA 4KO2S 2AEFA 2ZZ2A 1YQQA 4A0HA 3BMOA 2E8YA 4MWAB 3OG9A 3TOYA 1XELA 1V0LA 2PZFA 3T44A 4PODA 1TEXA 2P1DA 3K09A 1UP2A 5A71A 3SIXA 4HAIA 4QUGA 5EGSA 3IBFA 5A7HA 1QKJA 2R0QC 4JAWA 3BZUA 4DAEA 4H7VA 1MABB 4YK7A 3DESA 2F67A 3PVFA 1PYOA 1PNOA 4R54A 3L7IA 1R5OA 2TMGA 3W25A 1WZAA 3KLMX 1TPDA 1NVDA 2ZROA 2WJ3A 2FPIA 3HE3A 3FFBA 3C2FA 1P2FA 2B6HA 2IYZA 4YI5A 4KFSA 2OGYA 3EF3A 3STGA 4R2KA 1GFSA 4CTNA 1ZJZA 4TYWA 4O4IB 1LOSA 1P60A 4PO8A 3CH6A 4LI3X 4D9MA 5LD2B 3H2JA 1L4MA 1OWLA 4ALNA 3H23A 4EY5A 1Y7HA 4Y7CA 4UXHA 4G1CA 4DQXA 1KOJA 5DYWA 5G0SA 3L6BA 2AJTA 2GJRA 3RBZA 3ZS4A 2VDJA 4EBFA 1XZDA 3LHWA 1XSJA 2C2HA 1AQMA 3T6KA 1FNNA 1A5NC 2Z2ZA 4YCCA 3JRWA 3TF5A 1PKNA 4WZAB 1H3EA 4YRDA 1QH0A 3U7GA 2ACSA 1K6XA 2AW3A 5CB0A 3CZJA 3WDMA 3L5AA 4N0PA 2VC6A 4KEUA 3BWEA 3RFCA 1E6LA 3IAFA 4KL8S 3RTDA 4RF2A 2JATA 4J27A 1ODSA 4A3RA 1FP9A 2OEPA 3R5KA 1O77A 3FKSA 2OD7A 4GPIB 1N5KA 1MHTA 5JDCA 4YO8A 3V00A 2E0PA 2JL1A 3CMGA 4QYWA 4G2DA 4FA3A 1ABEA 1FSZA 1KDYA 1QJ4A 4WY0A 1VDMA 1VYRA 1FWNA 3ZSTA 3T0IA 3CZ9A 2H8ZA 3PUWA 5CBIA 1C3LA 3OWOA 3B5IA 1A5BA 1X1BA 2Y7DA 4IQ8A 4PC6A 4HJWA 1U5CA 3GU2A 4N7JA 4ZJZA 4LVGA 5BSHA 1WB4A 2CFSA 4W85A 3QQWA 1KSGA 1TFVA 4LAOA 1QI2A 2ZR7A 1M6VB 2CLLA 3T1OA 1F48A 3T78A 3LT1A 1YDWA 1SVIA 4XIGS 3ZIAA 4NV3A 3DMFA 4IOKA 2YZNA 2HPZA 3ISVA 2GPWA 2XAUA 3N25A 2WFZA 2BH2A 3FMIA 1FCBA 4YUWA 2WJ6A 1XCWA 1F6BA 2J7CA 1SA0B 3D4BA 3NC1C 1NW6A 1VEMA 1SKBA 3HI6A 1TRIA 1OABA 2CNWA 4O4HF 2D23A 4QXRA 3TLQA 5A3QA 3VHXB 1VFMA 3FDJA 4MMZB 3RJ5A 1C91A 1T9AA 4IMCA 2ZYHA 3DAOA 3PUYA 4YXGA 3N8NA 3HRKA 5EKSA 3QC3A 3P26A 4F3RA 4JEIA 2NLIA 2H17A 2A7QA 3F7TA 4E88A 1XG3A 3CFYA 1K7YA 1OAOC 1UKQA 1W8GA 3KFXA 2MT9A 1PZGA 1PS9A 1ZBVA 4LJAA 3R5SA 5F4BA 2HPAA 3M6LA 2XTJA 3HB0A 5AUNB 1FKWA 2JD2A 5ARDA 4XGIA 2ZYAA 3O8QB 3IDZA 2WWHA 3GFYA 3LA6A 3TH6A 5BW6B 5HG0A 5I4IA 1X7XA 4KOAA 4KDRA 4YCSA 3GB9A 3VM5A 1LBTA 4BO8A 2Z6VA 4Z7OB 3PZGA 2JGQA 5DHSA 2PO5A 1Q6YA 1UBPC 4NMXB 3Q8KA 4MW5A 3C7DB 5HSGA 3MT0A 3AESB 3F4KA 3SCOA 3R09A 2BX7A 2HCFA 3E6EA 2ZUFA 4HAUA 5ALXA 1HE3A 5L3QB 3E9DA 2RCYA 4N7MA 3EMBA 5A5EA 4JUAA 1FS6A 2QP4A 2BZGA 3FYDA 5LLSA 3WADA 4FFRA 2E9LA 3QLLA 1XLMA 4GE3A 3A9RA 1HE1C 2VJQA 4A82A 3LF2A 2FFCA 2V2CA 1G3UA 5G5IA 3T0AA 2UVQA 3BBPA 2G1AA 4MW9A 4IXTA 2QTMA 4AC9A 5DCLA 2O6HA 3EPOA 2AI2A 4M60A 4KV7A 4JLVA 4CF4A 3TLCA 2HMYB 2YCLA 4PTXA 2GLTA 2VUIB 1YE8A 1K7XB 1R0YA 4E1AA 1GNPA 2ZU6A 4AYGA 5BW5A 4ZVRA 1USVA 4CGZA 4LZPA 1PX8A 4R1PA 2O50A 1MEHA 5I3JA 4FYWA 2Y89A 3NDPA 4TM7A 5CC6A 1UBHS 3N0RA 1DHRA 1GQIA 3QQ0A 5BCAA 1OZFA 2C99A 3PC8A 4LVUA 4CIVA 3F49S 1QWOA 2DZAA 5F7OA 4G5HA 1AHPA 2VDWB 4P5EA 1BVHA 4AKIA 1G94A 1GVFA 3V18A 1VD6A 1Y33E 1XEXA 5FHRA 1M7GA 3B3QA 4B3XA 3UPUA 4P7FA 2UZ1B 5I45A 2HS6A 4NASA 1SW7A 3WQ6A 5CLIA 1F1JA 4LT9A 5FV7A 2FQYA 2IPAB 3T7DA 2ZIAA 1VPYA 1ZJYA 1E0TA 3MJ4A 2CBIA 4J75A 4C7FA 2ODOA 4U5QA 3WRWA 4LEQA 1ZD1A 3T5DA 3OZVA 3X1DA 4EG5A 2JI9A 4YCMA 4UARA 2B1GA 1LA2A 4FEEA 1IEXA 5CFNA 1G4TA 4PCUA 2I03A 3VC1A 5F2MA 1BVRA 2YQ4A 3QLEA 4BNHA 3W05A 2IX9A 4RHXA 3VKFA 3MOSA 4HF7A 4DDMA 2OXEA 1ULTA 4O4LA 1PJ3A 4GXTA 1UC4B 4XQEA 3F6CA 1B4EA 1ZGCA 4PC7A 5TR9A 1RQPA 2DKFA 2BMJA 4UQAA 4BB6A 3F8TA 1J00A 1R30A 4NF7A 2YDYA 3UXAA 1M7HA 3PNMA 5J3JA 3OX3A 4RFLA 1R88A 3H4XA 3RC9A 1II9A 3SR3A 4CIDA 4ARZA 1CF4A 4RETA 1LWOA 4JYBA 4H6KA 2PWBA 1VKHA 4CFZA 3LC0A 3JYNA 3L7YA 3FDFA 4PG5A 4XB2A 4YDRA 1VYSX 3IACA 3UJ9A 5CX1A 4L16A 3SM3A 1C7ZA 3DAPA 4X1OA 3A3PA 1YTLA 3Q4GA 4DMLA 4E2FA 3QKIA 4N0DA 4ZQFA 4LVCA 3KLBA 3PNKA 5AB3A 4OOEA 1FFYA 3I28A 4C0XA 4GIBA 2YVLA 3LIIA 3FN4A 3K1AA 4B73A 2OCGA 4O28A 3AYRA 2CJWB 2B5OA 2C61A 4PZYA 2POTA 4O8RA 1YIDA 4QOHA 3AJ7A 2ZOXA 3HPFA 4C88A 2PMFA 3ETNA 2I1OA 1K97A 5B4UA 3KVRA 3J7HA 4QLKA 4UEWA 1W9PA 2OWCA 1KM4A 3WMSA 4FLMA 2Z7KA 3IAAA 1K6JA 5G3ZA 2B1JA 3VGBA 2R4QA 1PR0A 1XZQA 3RDPA 5FWYB 3M4XA 5BVHA 3CMFA 2JFZA 4E22A 3K8MA 1YVEI 2YFNA 1RYZA 3P2VA 2ZB7A 3G5MA 4FGJA 3DDWA 3ZNNA 2A1UA 1L5GB 3WDRA 3ZWAA 1ME7A 3KR0A 4LC8A 2VA8A 1ONWA 4NHVA 2QSZA 1HN1A 2IZ7A 1LQUA 3I01M 1GKYA 1R3QA 2ILVA 1KETA 3OLZA 2A33A 5B3JC 4PMJA 2W4XA 2G8LA 2J59A 3GUYA 3UPDA 4RD4A 4FTWA 3TW6A 3NTQA 4IPIA 1QKIA 4MV8A 4Q18A 4QYXA 4QEEA 1VI6A 1VFNA 3F7MA 1H22A 1OFDA 3VH3A 4Q8NA 1JDJA 1BKSB 2GILA 3KJXA 3NEPX 2BM8A 3FA5A 3LT2A 3RFXA 1VKNA 3DHVA 4ITRC 2QHAA 1LBLA 3IBSA 4A92A 1OD0A 4LZZA 1XIMA 3KUUA 4JP2A 4IZOA 1NP0A 3H2OA 4ENQA 4OQZA 3J7AC 2V7XA 2JJ1D 3NFYA 4HPGA 1Z83A 5LDDC 5K3EA 4LTSA 2HCVA 3L7JA 5EJ7A 5CG0A 4EVQA 4RJLA 1MRAA 5D84A 2XN2A 3ZD9A 5AR1A 1W5EA 1XIBA 1FNDA 3LUKA 4PWZA 3SCSA 4MB0A 3SB0A 3ADBA 3W70A 1Y6FA 1YR3A 4LJ8A 3U0VA 1X2BA 4GH5A 4I4LA 3RS4A 1NVVQ 1N2JA 4PSCA 1I01A 1EQ2A 2ZXDA 1E0XA 1ZP6A 3A22A 5EI5A 1M8GA 2WBKA 4J35A 1F6WA 1I3MA 3BZWA 2JAUA 4BLTA 3THYB 3EYAA 1JSRA 3PC6A 5FI8A 1Y1PA 3VU8A 5JRZA 1F2UB 5BYBA 1L7NA 4KQ6A 4UHJA 3D46A 1FXWA 3MCUA 4OBEA 3NHPA 5IDWA 4BZQA 4DYJA 1GDDA 3GRYA 1SJDA 2Y93A 3EQ6A 4Q1BA 4O2BA 3SEQA 1RACA 3SOPA 2XY4A 1XEWY 1WHTB 2O3JA 1PR4A 3TLGB 2OXCA 3V5OA 5JFGA 3ZD8A 4Q6XA 3TSOA 1JXAA 3RU2A 2B7NA 3W5SA 2XB9A 4YHGA 4QU9A 4S04A 2W6RA 1U33A 5HJ2A 1X1SA 3MCTA 3UMRA 1IQ8A 4ZAGA 4WR3A 4ABTA 3W2MA 3KQQA 2F48A 1EI9A 1IPHA 3EMDA 3ZKWA 4XTDA 3U16A 4GZ7A 3PQ8A 2ZRQA 4XTRA 3NURA 3UMFA 3VVLA 1TQ6A 3WQ8A 2XM2A 4U6SA 2H3HA 4JLPA 1P7TA 3OUTA 4POOA 2HT1A 4QLAA 3LQ4A 4RY9A 1YR8A 1JCXA 3OQIB 4LZWA 1B6RA 3IARA 1E8DA 4ZVMA 1AZ1A 1PTGA 3FIGA 2VR4A 4QPJC 4WOPA 2OKCA 2TMKA 3ZDZB 4GX1A 1TVLA 1Q6LA 2HCTA 3H1FA 1VKZA 1GTRA 1U0SY 3L4ZA 1ULUA 3MGKA 3B3DA 1OILA 3OA0A 3L9WA 3F67A 1N3LA 1Q7BA 1T36B 4W4QA 2PL5A 2AG5A 3C1AA 3EOUA 4U3CA 4A2WA 1UWKA 5J2UF 4R2JA 4ZT4A 1QYIA 1HNZB 1DMSA 3LDVA 4GBED 2QCMA 4BATA 3A64A 3O1IC 4RPHA 2JIZD 4EGSA 3S2UA 2GPJA 1WKVA 4Z1BA 5JJ5A 1N2OA 4HNHA 1CQIA 4BEJA 4OF4A 1ZI9A 1HNWB 4UMVA 1KKMA 1OT5A 3P2YA 3DVSX 3HA3A 4YGYA 1U0OC 4XD7A 1PWMA 3ED1A 1P9RA 3WQHA 5EJ9A 5ENVA 4GZ3A 1H2YA 4BZWA 3WKDA 2YXEA 5DCWA 5JH7B 1WP4A 4DCSA 3DXIA 4BCBA 2W6ID 2OCZA 4BMXA 4MLPA 2WVVB 1WV2A 1EEXB 4IX1A 2A9VA 4JC5A 3NWEA 2QMOA 1FJXA 2XE4A 3DEJA 4JQSA 1G8AA 3MWKA 3FGZA 3CZ5A 3FETA 2JAHA 4MVJD 4ATNA 3F46A 4UEOA 1QYDA 3STWA 3UMCA 5BR1A 3CUHA 1YC2A 3I23A 1IRXA 2QTHA 3H0CA 2JLXA 2Q5LA 3PC4A 3L40A 3OP4A 1MQRA 3NBMA 4D57A 2C3UA 2YVQA 3SBEA 4GXQA 4FQ5A 4RTRA 3GARA 3V8BA 2HSGA 3CWOX 3HKEB 4L6CA 2ECKA 2Q1WA 4KI0A 1L5LA 3QZUA 1AV7A 4L08A 3OZPA 1XTSA 4ZIRB 4DUGA 1LDYA 5DDIP 3PKZA 4EDFA 3A2MA 3D0OA 3UQZA 3VOHA 3BVJA 3HZHA 1VE1A 3HJBA 2LD4A 1DQUA 3R11A 3SMVA 1WOAA 3IR5A 3U9LA 3DBHB 2V6GA 4DJTA 1F0PA 4R2LA 3RGWS 2E5BA 4G25A 3WL7A 1J24A 3AW9A 4BGDA 5D9PA 2GF2A 3EBVA 4R9UC 4RTJA 1VFHA 1EIWA 2QL7A 3RF9A 3EEQA 3CAQA 3LX4A 5A4AA 1V93A 4GYJA 4TV6A 3H13A 3VZRA 3TVTA 1E0UA 3LQQA 4G85A 4YLEA 4IF6A 1KBQA 4PLVA 4OJKA 4XDZA 3KL0A 2W0MA 5BROA 3N5KA 5ARCA 2RDXA 2IKGA 3DYPA 4AY5A 1U94A 1GG5A 3PPCA 3HUUA 4B3CA 3MDWA 1ZM9A 2VCBA 4YAFA 1HY3A 3EFHA 3O2QB 5JAQA 3G23A 2BGNE 1YDVA 1U0GA 3HCNA 4CTOA 1GTSA 3C98A 3S68A 3VU9A 3PJXA 3CAVA 4KYIB 1XL9A 2W62A 1F20A 1ZH4A 3LHFA 4JB0A 2CBJA 1SVLA 2A0XA 3DTVA 3RPMA 2C5BA 5AY7A 3T7EA 5JARA 2NIPA 2W98A 3QBJA 1PR9A 5AVXA 3IVAA 2RH4A 3R9WA 2V1XA 3ZY3A 1PZEA 5LD2C 1XSIA 1AKQA 1V3TA 3G2JA 3M70A 5CCBA 3T7VA 1Z7AA 1N55A 2RBEA 2ZVDA 2RI1A 5J8LA 4PLGA 1R6WA 1ULSA 3I9NA 5LWQA 3OFSA 3BSYA 4LFBB 1EGVA 5ERXA 2VJNA 2H1VA 3FX2A 4D9PA 3WQ4A 1X9IA 2PHZA 1RI5A 5KEIA 1HJUA 3HO6A 4JL6A 2VEGA 3HKBB 4X95A 3RNDA 3BG3A 4ARSA 1S1RA 1DC3A 2EPHA 1NU6A 3NDJA 3B9RA 2IHKA 3OZUA 4PMZA 1BDBA 1E1RA 1ONRA 2QCDB 4HFNA 2JZOA 2IXAA 2W48A 5B1IA 3WS7A 1CYEA 5DPMA 3G3DA 2BMWA 4JBWA 1ADJA 1R2TA 1EJVC 4MEJA 3AUJA 3WNBA 3OM8A 2XH0A 4QS6A 3R5FA 1RWVA 1PJAA 7ABPA 1X8XA 3QKUA 2W8ZA 1BN6A 3OO1A 3H21A 4LYJA 1XDZA 1XA0A 4HJXA 3NYDA 2W6JD 4YPJA 5E3IA 3TZLA 2GCOA 1JG2A 4YDSA 3NQFA 3R6TA 4BHTA 5DHQA 1XNGA 4HZMA 4B3MB 4QDXA 5HUHA 4FM9A 2A6PA 4Q5IA 4ZYYA 4RVCA 1L1QA 4JTGA 1T5BA 1OB5A 2CBGA 1N1DA 1D4FA 3Q2IA 1OBVA 1JYVA 5K8LA 4K2HA 3P9SA 4GD3Q 2MINA 3AF0A 2HMVA 3KU4A 1UJ5A 3POHA 3MM4A 4UTKA 5DXXA 3ROEA 3GXDA 1DP0A 4OECA 1US8A 1M9NA 3C6XA 3MCVA 3RG6A 2IRWA 2JGMA 3MMXA 1PDOA 3JV7A 1JA9A 4B3DA 3CSDA 1DX4A 1JKXA 1A5AA 4KW2A 5B4TA 4RPCA 2ZRKA 5I9MA 2QTAA 3R24A 1OYCA 2PBGA 4LRSB 4KE9A 2O0MA 1OVGA 4MZ8A 5AHLA 4KC0A 3A0RB 4CNOA 3TYEA 4WRHA 4PR0A 1EYWA 5G4KB 3E22B 3ARVA 3VNIA 4YRRA 1M34A 2IYFA 1W56A 1WUHS 3RVRA 4P53A 4IH3A 3UMSA 1O1HA 4DARA 3ZT6A 1FXQA 4RE4A 5FF2A 4DW8A 2PC8A 1XLWA 1OBAA 4EJSC 3K9CA 1QGUA 1QBAA 5SV2A 3BMNB 1TV2A 1CZRA 3DEZA 5C2GA 1AIPA 2O3QA 3G2OA 4HWTA 4JQOA 5EJMA 1JQXA 2ZE3A 4AXNA 3EH1A 4V1CB 4PRYA 5LOVF 4RE2A 5AN7A 3VMPA 4MYAA 5LQJA 4FXJA 4I1PA 2LNDA 2DH5A 4ZVOA 3K9HA 1RZRD 2OV6A 3OBBA 1WA3A 1U0JA 2O2DA 4F0SA 4L95C 5M5DA 4YPVA 2GT1A 3MUCA 3KP1A 4JY7A 5DYTA 1UXJA 1DBRA 4B15A 5FV4A 4QXIA 3VC6A 3AIWA 2VF7A 1YB6A 1IZZA 4J49A 3AXMA 1XMVA 1GP2A 4JROA 3QHAA 1MX9A 3BHJA 4DYDA 3U3HA 4R2HA 1YK1A 3QWIA 4IGSA 2HDHA 2DW6A 4QM1A 4DEYA 3BTVA 1BWSA 4HC4A 2CVQA 2ZDQA 4PSVA 5AI0A 2QYHA 1CHNA 4CR8A 4MUIA 2NVOA 5DQPA 3O95A 4IFRA 4WX2A 3GDFA 1AXGA 3D0QA 2OK8A 1QFJA 4ND2A 1L4UA 4F86A 3GZ3A 3V4RA 2OAEA 1K3UA 1BE0A 3ILVA 1K70A 1DIRA 1YMYA 1X3SA 5DP2A 2JJ2A 5EL1A 4KGDA 2SECE 2BP7B 5L40A 5I9LA 4MIMA 2B31A 5NLLA 4Q3NA 3CW2A 1YL7A 4TVKA 3WH7A 3G9TA 1L6FA 4PHTA 3IEUA 3FCSB 2GZMA 3HVJA 4N65A 1UBLS 2P5UA 1SCJA 3U4IA 2FMIA 3HWRA 1T2EA 2FN4A 2CXTA 2IEIA 3V32A 1OG6A 4TM8A 1H5NA 1JJKA 3TFOA 3I3DA 3VH1A 1FUYB 1FWRA 5BN4B 5KZ6A 2GZ2A 2BEUB 3BIFA 3ZLTA 4O14A 5G1TA 2GSDA 2Y0CA 4JEQA 5HQMA 1B30A 2IHBA 1KGWA 2IHYA 2GYIA 1IY9A 3NVTA 4LCSA 2VRCA 3DWGA 4BNLA 2GDQA 2WJJA 2I54A 3Q8LA 3TQTA 1YIOA 4TTVA 2I1LA 2J30A 2JFVA 3GYEA 2QSYA 1RLMA 1B8UA 5KSYA 1C0KA 1IRIA 2ADOA 3IAM6 3IOEA 3KU1A 1LUCA 4FD3A 3PZQA 3WG6A 5ECYA 2HS8A 5DFAA 4RLIA 2C58A 1HNYA 2QUZA 3EDEA 5FAKA 1EVEA 5J4YA 1T5IA 4KFOA 4UREA 3AHIA 4OLJA 2ALRA 3VILA 4RD6A 1W1YA 4DO4A 2L17A 4D72A 1TJ4A 1EQPA 4OKSA 1CUUA 3CX6A 2Q8QA 3EXSA 4NX2A 1JEYB 2B4GA 2ZTKA 3LYLA 4PUJA 4NARA 5TGDA 1ESNA 2Z2JA 3X44A 8LDHA 1QBKC 3W3AA 3PIDA 5DNYB 5DNEA 3SC6A 4M8LA 3WGUA 2BL4A 5IJ9A 1PZ0A 3QLTA 4J0JA 3T81A 1QFSA 2J07A 3GYBA 2V9ZA 1YZUA 3OO0A 4UTWC 2JS7A 4RK0A 2JLSA 3W2TA 5CTJA 2HF7A 1KORA 1X8CA 4JIPA 3LF1A 4FNMA 4JOCA 1CUZA 2NTJA 1NV9A 1Y4AE 2BS9A 2DMRA 5CVVA 3SI9A 1T96A 5KJ6A 3PX2A 1K3FA 1QGDA 4WW0A 3SEAA 5K4AA 1SVKA 4O0LA 2WTBA 4MIOA 1RM4A 1G9XA 4NI3A 5K8IA 4AO7A 3P9XA 4US5A 4NFSA 1C2YA 1G1YA 4ZVNA 1KR2A 4MAFA 2CFFA 2BV3A 3BSSA 3N0WA 4LS1A 4PY2A 4XR9A 4HRAA 1TUEA 2C5FA 5CC7A 1VBNA 1ULZA 1AU9A 4QRNA 3C5VA 5DX7A 1Z4IA 1ZMXA 4ZI7B 3K1AB 3N9SA 2WSYB 4Y96A 1UR9A 1NY6A 1GLGA 3JD4A 2I3BA 4AWUA 4F4UA 3RFUA 5JLAA 2E3ZA 4LCRA 4Z2HA 4EKEA 5F98A 2VYVA 1CUDA 1NKVA 2GZ3A 1HGYA 4PZ9A 5EY5A 3LLUA 1TV8A 3BE6A 1CPYA 1IE7C 3F5MA 1A3WA 5EWMB 2R25B 1Z3IX 1Y5NA 4G7FA 1KDPA 1Y8RA 5DMLA 2IIVA 3IGFA 2W9MA 4JNYA 2EG6A 5U4XA 2Q3HA 5FUMA 3N6RA 3X3HA 2GEUA 2QLJA 3AFIA 1TF7A 3A6ZA 3EKZA 2QX8A 4UVIA 2VDRB 3HYRA 3U0HA 3KEOA 4AYSA 3JUGA 3WYNA 4EPYA 5I47A 4PO9A 3LMZA 1OVDA 1XVTA 3E6AA 4OFCA 1R0MA 4RMGA 4G7EA 2E6DA 3W71A 3THQA 1L6SA 5T67A 3HR7A 3AR7A 2QZSA 2AOSA 2HIGA 2QS8A 1Q11A 3ESCA 1GGNA 4Y1EA 2CWDA 4QASA 4MKFA 3QFFA 2D69A 1E2NA 2REXB 4XD6A 2XUDA 4C7OA 4WIWA 4CMKA 5F3DA 1VE5A 5B1HA 2PLMA 1NY1A 2C5AA 2XUJA 4EMBA 4NBWA 5G02A 3BE8A 2I4RA 2A88A 4DQLA 3BJIC 3BD8A 1AS0A 1WD7A 4H9UA 2O4UX 3QLJA 4F4CA 3BILA 1KLYA 3CO4A 1SU4A 1WXDA 5J2TF 4DNPA 3KL2A 2VDNB 4BY3A 3IVXA 3HM2A 2WWGA 3Q45A 1PR3A 5EXXA 4JSRA 3A6LA 1JZ5A 2EXXA 4I6VA 4Z2JA 2XYHA 1Z37A 4YT4A 5IF9A 1XYCA 1BXRB 3KS5A 4XEUA 4L78A 4NAEB 5AJWA 1RNLA 2FPXA 1I6LA 3DOPA 5ALZA 3Q7QA 3NNTA 1G18A 2YMPA 1WKCA 3W86A 1XNQB 2QUTA 3GUVA 1XLJA 1OAOA 2ZDRA 4KB5A 3RFFA 2PXXA 4YHEA 1BCRB 1QF9A 1TF5A 1XX6A 4MIKA 5LQKA 2A3NA 2JB9A 3EBLA 1CCWA 4O0KA 2R6CA 1BKYA 3UVEA 2XITA 2ECOA 3DE5X 3OEHD 3OTRA 5FSDC 1LYXA 2VURA 3NTUA 1C9EA 1NWCA 2RJ3A 2WF5A 7ADHA 3LCUA 3R7LA 4X54A 1SHTX 1Q14A 1EFVB 5C52B 1NWSA 4X5OA 2AOWA 1O95A 3GVHA 2IEAA 4NKCA 3WMFA 4F1JA 5I5GA 4B3KA 1FSSA 2HKIA 1AKVA 3UNDA 2YV5A 5FNVF 4BN5A 4HOWA 3OFND 1JHPA 1P18A 1XLKA 4QG3A 3QPDA 1AG9A 3REOA 1ZUNB 2GGIA 2CVHA 1P1CA 2WOJA 2SBTA 4DTCA 5JSQA 2SNIE 3BIJA 3V2HA 3ZO9A 2ASVA 2OXRA 3AXTA 3P9IA 4ECEA 4WESA 2Q99A 1J6PA 5I24A 1FC0A 1JR4A 4DV4B 2A4KA 1GW9A 4B35A 1TZBA 3QITA 2BFPA 1Q6DA 3E23A 2A7XA 3UWDA 2FZMA 3SCNA 5IZCC 3N86A 2C0AA 1D2HA 2ZUBA 2C8JA 1J9GA 3R8RA 4XJXA 1PV2A 4LANA 5GGYA 1BHGA 3MYRA 3IHKA 4BKUA 1WUKS 3GDOA 3NM3A 2HK0A 5TQLA 1R9MA 1GUBA 1PUDA 1W29A 2VPIA 3DMRA 3ZQ4A 4IV5A 4F0JA 1Z6KA 1ENUA 1G8GA 2FSVC 4N3NA 1U65A 1RYFA 2CVZA 1EIXA 2Z4RA 5KBYA 4XB1A 2O8BA 1OWQA 4RE0A 4EUFA 3U3XA 4HA3A 3OJOA 4ZZIA 3CBQA 1VPLA 3IK2A 4QQFA 4PVCA 3HQNA 3TV8A 1I7PA 2V9DA 4CI9A 1P8JA 3UUEA 1I7LA 1PIFA 1DDGA 1NRJB 4EPTA 2EBHX 2F64A 4OQEA 6XIMA 3L1HA 1IJEA 4GRDA 1KRCC 2A0YA 1ECQA 3A3NA 3I65A 1N6LA 3E70C 2CL0X 5SYNA 1JI3A 2GJKA 4QARA 2GASA 4D9HA 2ZSJA 2CD7A 1VIMA 2IW1A 4YP7A 2V7GA 3AJDA 1TLLA 5B7QA 1Y7LA 2PT6A 3VYSB 4GI5A 4IEIA 4XIJA 2YWXA 4YN5A 4IL2A 4YRCA 1A7AA 4BVBA 4OO3A 4OV9A 1VMIA 3QHPA 3O5AA 3W26A 3W85A 3L0ZA 3GNDA 2EBWA 1KS9A 1TTQB 4GXWA 1YFJA 3EWAA 1EFVA 5CB8A 1W1B1 4MUJA 5FEUA 2NQ9A 1YRWA 2WSPA 3LC1O 4L85A 3STFA 3H4MA 4AY6A 3BFKA 2YOCA 1SULA 3FNRA 3NBAA 1GJRA 4IZHA 1ADYA 3HV0A 3C1OA 4K28A 4C01A 2PUHA 3L0DA 1VLZA 2DE0X 5LM3A 3N28A 4CQLA 3RCBA 1ZYUA 2ZX7A 4TWBA 3KR2A 1NOWA 5A02A 4C2BA 3QOMA 4RNIA 1EX7A 5IWCA 3B9OA 2QL6A 1SM4A 1YRHA 3RIKA 5AC5A 1X13A 1NJFA 2ZZMA 1P7PA 3INTA 2ZFAA 2DSZA 2VYND 3V6MA 1ICSA 3K9LA 1VJRA 4BVGA 4RDWA 1CQXA 4F38A 4DLXA 4NJGA 4ICIA 2OXIA 4FR0A 3S3GA 2G5PA 2GLXA 4Q39A 2DWOA 1U0EA 4RGYA 4FI3F 4TYQA 4I5XA 5A9RA 2HE8A 3WDHA 4M7SA 1SHZA 4DN1A 4F3CA 5CLHA 3W8EA 2IELA 5FBZA 4BE4A 2BEWA 1RJEA 3O1NA 4FR2A 1FWCC 1M6HA 3A1EA 3O84A 4XIMA 2PBZA 2NU6B 3WGGA 2NUXA 2EJBA 2Q27A 1GZHB 2GA8A 2CWWA 2I4IA 3LXUX 1QTQA 3P71T 4GE0A 1T0JB 3SZ8A 1Z2NX 1PGPA 2YCEA 1W36C 4MY1A 2QWXA 1S3GA 1WVGA 4V0SA 4EG8A 1UFKA 2VIIA 1OV4A 1TZ7A 1KLZA 3AP1A 1FH9A 4A3YA 1PB0A 1HTWA 3LQRA 3Q7EA 1FXSA 4RZQA 1ISPA 4JP5A 3KL4A 4EPXA 3SLKA 3KVKA 4K9NA 3IO5A 4WWHA 4OHUA 5HK8A 4OIMA 2DZTA 2I9KA 1KJ8A 5HQJA 2JGYA 3TVDA 1L5YA 1I1WA 5BNTA 3BF7A 3VPBA 4CKYA 3AKCA 4S12A 1Z12A 3H4IA 3RSSA 4V39A 4CQCA 1XL1A 2J8GA 5LNK1 4B7CA 2FPMA 4M4SA 4Y9OA 1GCOA 3R3XA 3WJ2A 1B43A 3HCCA 3SZUA 2RB5A 5DV9A 3UPWA 3IDFA 4GXMA 4AZ7A 2WMDA 1JWLA 2WWIA 3A1VA 5JHHB 3QTGA 2W6PA 1YNSA 3SR7A 4WDXA 3TN3A 1SVMA 2ZCVA 3RAEC 5T4FA 1NFFA 1XZKA 1QNPA 2BG5A 3WB0A 2C4UA 3AHGA 2Z08A 2YCBA 4IJMA 4INZA 2ERCA 3AICA 1K4GA 5HIMA 5DO9A 1V35A 1VENA 2CSXA 1AMYA 2TYSB 3QUSA 2YY7A 4GFIA 2VEMA 4GNRA 2ZWYA 3KKQA 2CUZA 5AI6A 2A4MA 3DBVO 1VJDA 3SR0A 2BGMA 1HDXA 4B4KA 1FFCA 3GK3A 1A76A 3K0FA 1SJ9A 4V27A 2QR2A 2J85A 3UTDA 2RHRA 3FYYA 1KJJA 1CS0A 1PJRA 1KV5A 1J8VA 1NMEA 5LP6F 4I4TA 5A7GA 1PV8A 3LPLA 5FUQA 3V1TC 3Q3JB 3NQGA 2YSWA 1J0IA 1QHZA 1OQAA 4IMJB 2X6RA 1PFVA 2H5JA 2ACUA 3A7DA 3S0CA 4P0QB 2FJ0A 4D6FA 3HXOA 3BV4A 3QKEA 1TJ1A 2QUIA 1AQIA 3TOZA 3DFUA 1M6EX 3OVMA 5GPRA 1FRVA 4ZIRA 5HATA 3ZLHA 1X7YB 1U1EA 4MUGA 4AAYA 2C7VA 4HSEA 4MUAA 3SHOA 3IP1A 5EIHA 4YROA 4X91A 2PL9A 1KXZA 1CZKA 4GXRA 1Q8JA 3GIQA 4XSVA 4JFTA 4BYMA 5LL6P 3EMKA 4MCAA 2G9VA 1TJPB 3DBHA 4DV0B 3OHIA 4X6YA 2YRFA 2GJAA 5U7SA 1GCIA 3AI1A 2X7HA 3B7WA 4MVJG 1SXJE 3HR8A 3LBNA 4F21A 5DNDA 1S3HA 3LNCA 2UU9B 1Q7QA 1XCGB 4JP8A 4RNCA 4KMQA 2BKXA 1U98A 1JHXA 2XB6A 4MADA 4OI1A 1NF0A 1WL8A 3QWAA 3BAJA 4LV5B 3LX9A 3TW8B 2PU7A 1Q6ZA 3ZCQA 3W6MA 1E5DA 2E4WA 4GX5A 3ZJ7A 1U8ZA 3IQEA 3EUWA 2FQQA 3LWZA 3B1ZA 5BT9A 3BQ6A 4BO5A 5FFMA 1OY1A 4YWJA 4WSOA 3OJCA 2OC4A 3QXHA 3GRCA 1KC7A 3S2FA 2AW5A 2XD9A 1M6VA 1UR4A 5BWOA 3T7RA 3U4HA 2J27A 1RQGA 4U7FA 1ZFJA 2JG3A 3DTVB 4E0BA 1VCMA 4CMHA 4JI4B 4K86A 1SSGA 4NZPA 1C1DA 2MIIA 2FSIA 3M81A 5D7BA 4E70A 4IMEA 2VF5X 4AUEA 3WICA 5JQGB 1Y7VA 1X6LA 3T4CA 4Q7IA 3I72A 4OH1A 5D09A 2OQLA 5A6SA 3I1JA 1HO4A 3PGXA 1Y7TA 3D7MA 4V2IA 3BOFA 3KS6A 5KSWA 3VTKA 3G2KA 4DV1B 5T4HA 3M9LA 2ZREA 2J0SA 4EPBC 4JD5A 1A1VA 2A35A 4X1YB 3HSYA 3DMHA 4A8PA 4NESA 1UH5A 1Z6GA 3SZRA 2ZE8A 2X3FA 2NVDA 1H7OA 3EKLA 1K8ZB 3WO0A 3K9WA 4IH9A 5LQUA 4BVHA 1J79A 1CNMA 2QTCA 1E7SA 1VCGA 4WECA 4FNRA 3Q2OA 2ZEJA 3H8VA 3DR5A 1DRWA 3QXBA 1X7YA 5IC5A 3HN7A 1MFVA 3TC3A 3IV8A 3TN4A 1ZMRA 4L5IA 3TQHA 4FOUA 3U3MA 2X0JA 5G4HC 3IFSA 3JZMA 2QCHA 3WNCA 2DJIA 2MJLA 1L4HA 2XUIA 2P0OA 1VFPA 5A6KA 1H94A 4HH3C 5BU6A 4LYYA 5K51A 1SPQA 2ZIEA 1LWIA 2VNSA 2RGCA 2CJYA 5E6SB 4EW6A 5D2WA 3M1AA 3I8SA 3P4UA 4J4KA 4PYIA 5LJLA 2PA3A 4Q16A 3BGGA 3QM3A 2UVPA 1I4LD 1QMLA 3M6FA 3PPVA 2J7EA 3IOBA 2HWKA 2Y0PA 1GYNA 5B4VA 5CAEB 4N3GA 1BVNP 4IMPA 4QXPA 4OBTA 1U83A 1Z47A 4J7CA 4C1NB 3IIMA 2XNCA 1IAVA 4H59A 3CRMA 4EG6A 1NDHA 4AWTA 4RA9B 1HX0A 1KYXA 3U7EB 2Y1FA 3LVRE 5A9SA 2AVNA 3GGCA 4O1IA 3U3KA 1CWUA 4XA8A 3HI4A 1C1DB 3T42A 3JQ8B 3SSMA 2HAEA 5FDFA 1R0WA 1TU0A 2JDIA 1TZJA 3Q58A 3PRKE 1RE1A 3RJYA 1D7OA 5AMXA 1C9KA 4NU8X 3IKLA 3CPHA 5D87A 2J3JA 2NPFA 2CHRA 3WQWA 3CU2A 4MV4A 1WR8A 1WAUA 2KX9A 1WOMA 3S29A 1WDWA 4Y0AA 4BXOB 1X92A 3CXUA 2PUTA 3HJRA 3ZCRA 4DVJA 4JWKA 5U9CA 3U7BA 1CQJB 1CUBA 3I0ZA 2VOMA 1L5HA 4J0EA 4KGXA 2J9YA 2NT1A 2BKLA 4CLMA 1E5QA 2C19A 5C1DA 1X9HA 5IHPA 1Z0JA 1RYDA 2W6ZA 1LRTA 1P43A 5FF0A 5FO1A 1JDTA 4N40A 2C88A 3S7ZA 5E9XA 1BE6A 4ZPJA 2RIRA 1YR6A 1J0DA 1EH5A 3DUFB 5IKEA 3WJWA 4JUDX 2C00A 2J3QA 3CAWA 3T35A 5HUOA 3VZXA 1TKRA 4CMEA 1MAUA 2OMEA 2QW1A 3DOHA 3C0QA 3UWSA 3CEAA 3LVQE 1P6CA 1WDPA 5MFPA 2PX6A 2BE9A 4K03A 2EWWA 1PWZA 1B74A 1HTBA 2C59A 1FFBA 1RJ9B 2VDVE 5AICA 1XMSA 4PWYA 3BSHA 4FFOA 5GJMA 1P19A 3TDMA 2RHOA 1ADCA 1UJMA 4Z3OA 4Q9KA 3BLLA 1V3QE 2JAQA 3INRA 2ZGVA 2BGNA 3BLIA 1OIMA 4IGIA 2SKCA 2O54A 2OCPA 3KQLA 4HEJA 3R0JA 2G7ZA 4HLUC 2OODA 1SC6A 3MBOA 1T8XA 4QPCA 4EQ6B 3ROXA 3LCMA 1E2PA 2VQEB 4EHHA 2EJUA 1ZC4A 3EE6A 8ADHA 4KWCA 1W1UA 5DGTA 4E5PA 2BFEB 1PAMA 1VGVA 1DP4A 3AIVA 3A26A 5IJAA 4L9XA 3UCDA 2J9FB 1BN7A 3MI6A 4GHRA 3G5LA 1BGXT 1RPKA 3QG5A 2Y8KA 4U31A 1EWVA 3GDGA 5ALWA 2ZT7A 2VTBA 4C4YA 1VE7A 2VRNA 5TS3A 1V0JA 1ZGHA 3GJYA 1XI3A 2EEZA 4AY4A 4KQWA 1XLAA 3AC0A 2J67A 5LA1A 2ZI7A 5L3SA 4BS0A 2JGFA 3M49A 1M7XA 3QMSA 5C9RA 4IWXA 1S1PA 1GKQA 4XDYA 2ZPAA 4JA0A 1FF9A 2Z28A 1UFRA 2CCGA 1XKQA 4DRXA 2JA1A 2HGZA 4MEAA 5EC8A 4JZKA 5CLLA 3IXLA 3R75A 1V8EA 1IWOA 2JEYA 1KFJA 1M5TA 3WQCA 2CF6A 1ZD3A 1TCBA 2NZWA 2VP6A 2PA6A 2WHEA 4YBZA 4YMTA 4ND3A 3IIEA 4B34A 2PDIA 2WMFA 4DM7A 4F46A 1QYWA 5A7FA 4GKBA 1ZAKA 1KMCA 2NXHA 3BJSA 2WNSA 4KR2A 2GPBA 3T5BA 4HTYA 3ZLGA 4C7OB 4C2AA 2WZIA 4JD4A 1G63A 3TSWA 4RC9A 2XH2A 1HG1A 3PNVA 4EANA 1XHFA 4B2LA 3HC7A 4E12A 1MDFA 3V4OA 2OZPA 4EL0A 4FX5A 3OVQA 1CUXA 2GWRA 4EPWA 1P33A 1W31A 5B7PA 1X98A 4ED9A 4F4HA 3P84A 3PWAA 3FHCB 1WB0A 1Z74A 2BXZA 1C3VA 2OLAA 2EU8A 3EYWA 3NWJA 5IYZF 2I8AA 4JCOA 4NXSA 4IIGA 1JVBA 3M5XA 1PJTA 2Z9CA 3T5AA 2Q7XA 1RZ3A 3HG4A 4CQMA 1FMLA 3L7KA 1UPMB 3MUZ1 3SHWA 4IJ6A 3LKZA 3I68A 3F47A 2YIMA 1LL6A 4X7PA 1X8FA 1HK7A 4F1KA 3I9OA 1QH8B 1DKPA 3IUHA 1XCBA 3DW1X 3OMWA 4IP5A 3AM1A 3K4WA 5HGXA 5DTEA 3IIJA 4Z9XA 2DFTA 5BOVA 1LDNA 6AT1A 4ZVLA 1EEHA 4X20A 4EMSA 1D3AA 3RIMA 3IYLW 4XGRA 2HSAA 4MUMA 2XN1A 3WLLA 1U8TA 3T4UA 2HMCA 2WSYA 2G36A 5AK6A 3GFFA 4FHFA 2QIOA 3LP8A 1FFGA 5JRJA 4JDPA 3PHIA 2GQ9A 2IFTA 3GH3A 2IJGX 3A70A 4HP5A 4LVDA 1K88A 2Y6UA 3IIOA 4K3ZA 4MHSA 1RC0A 5KYXB 1E3JA 4IV8A 1CNVA 3DD1A 3TVYA 3UY4A 4B1FA 5EPOA 3I30X 4R81A 4ZEWA 4ZXFA 3C5HA 2XOKA 3PEVA 2JAPA 4XGQA 2B61A 3LW7A 4B6RA 3AERB 1YB2A 2YOGA 5P8WA 1QRUA 2VYNA 1RI3A 1OX4B 1YJQA 4EYQA 3GXFA 4WF7A 4PNPA 2HVMA 3KYIB 3LHZA 4ML9A 4FFMA 4GOKA 4CG2A 4HXFB 4TZTA 4F4FA 3ITXA 4FXRA 5BRQA 1AGPA 2JFPA 1IUNA 3DR3A 4QFDA 4GD0A 1YV9A 2VENA 3NEVA 3GLFE 4NZ3A 3NQVA 3OCJA 3C7KA 4WL0A 2PGAA 1WXQA 4ESOA 3GZ4A 4NRDA 4LYKA 2QDHA 1O1ZA 5A03A 4P3PA 1VP3A 2W9XA 4JUBA 3OJFA 5DGXA 1AC5A 1I2MA 1OSEA 4DF1A 5K3DA 5ABPA 5KHAA 3P9KA 4ACBA 1T10A 1ZK4A 2B7BA 2AKAB 3NL5A 4LHZA 1KCZA 1EGMA 2DH3A 1R2SA 1ZGJA 3FN9A 4J0HA 4B6OA 3QBEA 4QNRA 5A5VA 4LF8B 2ZBQA 6ENLA 5C5EA 5B7ZA 1QHPA 3AOEA 4CG1A 2HGSA 3LXBA 821PA 2QS9A 3DFPA 1FXWF 5FPKA 3AEKB 1MJHA 5A2BA 1H2HA 5BW8A 4I2NA 3KVJA 4PM4A 5COAA 4RD1A 5JU6A 1VF8A 5EQDA 1KIMA 1YOVB 4IS3A 1HEUA 5ALKA 3GMIA 4BVAA 1BXRA 1QLHA 4DLFA 1JHUA 2Z2YA 3PDHA 4BI6A 1LW7A 3I1FA 4K1LA 2PDUA 3TXVA 2XDYA 4WQMA 2CLIA 3CPJB 3ZHUA 1XIJA 4PEEA 3ITTA 1XIEA 1GTHA 2Z9DA 2NSDA 5HDRA 1BCRA 3WA7A 3NKVA 3LP5A 1KRXA 3ELUA 3TS1A 4D3YA 3S55A 4Y67A 3GJZA 1IAQA 4EFDA 4GI7A 4P98A 3R0UA 1PSWA 4OQYA 2VFFA 1UCFA 3FAXA 1QNLA 2JIRA 1HE5A 2WIDA 2DX7A 2BZSA 4FDAA 4ILSA 1BQGA 3U49A 4WZBA 3X2SA 4UCFA 1C9WA 5JPCA 4GP6A 1QZXA 5HR6A 3VCNA 2IT1A 1KNWA 1W88B 1CZ1A 1YX1A 4XVHA 1SOAA 1YPIA 3WBXA 2QCEA 2P4EA 1EA0A 3SXPA 5FHQA 3RYIB 2H4FA 2O8EA 2BY1A 1OZQA 1J12A 2YZ5A 1HDZA 5DXJA 4W8BA 2I4MA 3UXHA 5CDHA 3QFCA 3JQ7A 3F2VA 4IM4A 4RL4A 4MB4A 1N1GA 3C41J 3TL6A 1I13A 5D5HA 1ZU8A 4H8VA 3OKCA 2PH3A 4L1XA 4DEFA 5LSMA 1V7YA 1WUYA 3WAGA 4PUUA 4ZVPA 5ITSA 1S2UA 2FGLA 2RGEA 4H0CA 3CU5A 4IOMA 2QZ9A 2ZSKA 2NQ8A 4F6RA 3B51X 3TAHA 2YB1A 4JDYA 4DZIA 4JTTA 2R1VA 1GG2A 4S2CA 5SYAA 4HPHA 1KKRA 4LSBA 4TMKA 1XYGA 4I5EA 4L74A 3F6SA 3HCAA 2FKPA 1QFMA 4WK0B 5BP7A 2W4IA 4GG1A 1K8RA 5A0VA 2XGSA 1M53A 3KOOA 2D20A 2P3OA 4EWND 4Q3LA 5ALOA 4F97A 4ZQHA 1YS2X 1USKA 4NMWA 3R4IA 4B3GA 1YE3A 3PQDA 2FX5A 3E2RA 1E3WA 1E71M 4FLRA 1E60A 2BW0A 4CEIB 1W5BA 1BYIA 1I3KA 1UBKS 1PTDA 1PWEA 3N76A 3PQ7A 4CNUA 4S1OA 2VF4X 3GA7A 4NJKA 3JQCA 4ALDA 3LRTA 2IPGA 3AL2A 3IQZA 3IUPA 4WXYA 3E8MA 3UWQA 2Q02A 4RK8A 1CJSA 3Q7SA 3R3YA 4YCJA 3WMRA 2WNQA 1V71A 2YV1A 4WZZA 4U3AA 2QRLA 3CUYA 2BEJA 1XRTA 3SAZA 1P4SA 3ZIZA 1QO0A 1EJ0A 1XE3A 4LRQA 3ICJA 1OBHA 5LWHA 4N4PA 1E1NA 1P4AA 2X5OA 2AQKA 3EF0A 1RPXA 1V1MA 1QX3A 3TQCA 1DAHA 4Y2XA 1O6GA 5C0OE 1LSJA 4WLEA 1PNQA 5GGXA 1S1MA 1WXIA 2UYOA 1DBPA 1GQNA 3U40A 2DQKA 4DTIA 4BFCA 4YAGA 4IW3B 1XJBA 5J2TB 4MROA 2YY6A 3B8UA 4GBMA 2OESA 1B41A 1QNOA 2NUWA 5JIPA 5IMSA 2AH5A 3BRWD 3FVQA 1Y8CA 1EP1A 1ELOA 4JI6B 2EFEB 3WGZA 3JQGB 5HMDA 1G7RA 4ZXLA 4MS3A 4LMPA 3K73O 3Q1LA 5M3WA 4IDQA 4AP9A 3DZIA 3AKEA 1CLEA 3RPTA 1S3FA 1F3LA 4MRRA 2B30A 3ETEA 1Y65A 4QIUA 4AG5A 2E18A 3GHHA 1PCXA 4UZEA 4FIDA 1UQTA 3HA5A 1KO7A 1EE2A 1OWOA 4ZB2A 4TMYA 1CERA 1JI2A 3PFBA 4A21A 4D8WA 1IIBA 3RS0A 1JKMA 4M53A 5E4TA 1E2JA 2CVPA 5JSUA 1UMDA 2E82A 1H2ZA 1ATIA 4PZUA 2QULA 2F9FA 1NF9A 5A05A 3N1AA 3F4CA 6REQA 3C97A 1PEAA 4TV5A 4HNGA 2GYUA 5CDTA 2QMKA 4LW8A 4YL2A 5EZSA 4ID9A 3TR5A 3EZ4A 3VZYA 2BGKA 4LDZA 1QAPA 2QUAA 4TZ0A 2FZVA 4LUTB 1QK3A 4HYEA 4BE7B 4R1MA 3IT0A 2AN5A 4KO8A 3BW2A 3A27A 4P83A 3WYCA 5ADUS 1EDGA 3GG1A 1CJBA 1KQZA 4YUAA 3ZW7A 1EP3A 1P45A 4URIA 3DBIA 4MITA 4RAQA 3SUTA 4PINA 1KP3A 4PCLA 3EHEA 4DMHA 2XGJA 1VSTA 3LZ5A 1ZHAA 5K4ZA 1OXUA 3CWCA 4FZJA 1NA5A 3NTXA 4ZO4A 3D3JA 3FCOA 3BO9A 1A88A 1P72A 3U7VA 3N53A 1E89A 3SRDA 1FHUA 1YXDA 2ISWA 2B83A 5KWEA 4G07A 2QA5A 1OLXB 1V41E 4JL2A 4JMPA 4A29A 1KH1A 3PICA 1DJOA 1ZHHA 2PE4A 4HB3A 3H84A 3ZW9A 3S6TA 2F43A 4XFKA 5FEMA 2YGYA 1SY7A 4EUHA 4MTCA 2DQXA 2GCIA 2XBMA 1EA9C 3WLHA 1FQKA 1GSHA 4MYDA 4BLOA 3PBWA 2G5WA 3ONDA 3DEIA 5JVDB 1CG6A 1KO4A 2H1CA 3AOFA 4JTUA 5IAOA 4B5TA 2VRCD 2AUNA 1MQSA 9XIAA 4KXWA 3CQHA 3KBSA 2GI4A 4QUJA 4I4TB 2GF9A 2YHIA 1P9LA 2UUOA 4FEZA 5JALA 4WOKA 1XNHA 2R24A 1UASA 1DTWA 1ZI6A 3D5QA 3SPXA 3S8YA 3ELYA 1HKJA 4XFDA 2AKZA 2C9YA 4V1XA 4PCFA 5GWXA 3AR4A 4JGBA 5SY6A 2CLFA 1OFGA 1A98A 4KCGA 3BFXA 2PA0A 4NBUA 3ZR4B 3HCRA 1GDHA 3KOYA 2OG1A 3HDGA 1E7MA 4JS0A 3PZVA 5FBKA 5LKRA 2VS1A 2XDWA 4OI2A 5C9XA 3GO4A 3ZHYA 4G5GA 4DJDC 1EQAA 2P0EA 3BK0A 3BLDA 3N6QA 4JXZA 2PDKA 3RARA 4FB7A 3DT9A 1U2ZA 4DO7A 4IYJA 3BWDD 3F6EX 1XZJA 2J08A 3QFSA 5EKTA 1HKVA 3MHGA 3CM0A 3D6TB 2V7TA 1SR0A 3UJEA 1LRQA 2QYSA 4CTJA 4XZ9A 3KZVA 1YRAA 4E08A 4O1AA 2IPMA 2D62A 5KU7A 4ZP1A 1F0KA 1S4QA 4RE3A 3UY7A 3KVOA 4ARUA 4QWMA 5BOSA 5LIKX 3PS9A 3N0TA 1CJMA 1G1AA 5LA0A 1ECBA 4DLYA 2XNDD 1PKMA 3BZBA 1TC2A 4KREA 1Z8FA 1UEJA 2DBVO 1XYMA 3LSYA 4RXGA 3GUGA 1TVKA 1E9EA 3GFQA 4CU2A 3AHXA 4N6OA 3DB1A 3OG2A 2JGNA 2PTYA 4JGIA 5KCZA 2VUNA 4X3ZA 1H66A 1ZO8A 3HFRA 3I2GA 3ANLA 4RTNA 1ADGA 1QV9A 3TNYA 4AUMA 3C8HA 4PLCA 4ZAXA 1JZ7A 4ZFNA 2C4VA 2E1PA 4NYJQ 1J0JA 1YQUA 1W73A 3OTIA 2NXIA 3AVPA 3T8YA 4OFWA 4C6DA 2VI0A 2UXBB 2J9YB 5JUWA 3JR2A 4JEMA 2GBGA 2PTHA 4Q48A 3LUTA 3VX3A 2HWUA 1VSQA 4QITA 1QVWA 4MV0A 2CHOA 3KTXA 1R74A 3E8SA 4KAAA 4OK3A 4EPRA 2OWXA 3D8NA 1GPWB