5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
b'LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GLUCOSIDASE
molecule tags Hydrolase
source organism Aspergillus oryzae
publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
4YYFA 4ZOAA 4ZO6A 3ZZ1A 5G1MA 3U48A 3WLSA 3NVDA 3ZYZA 3WLHA 4GYJA 1IEWA 4GVGA 4MSSA 4GVIA 3WLPA 1LQ2A 3AC0A 4I3GA 4IIEA 3WLMA 4ZODA 3BMXA 4ZO7A 3U4AA 3USZA 2X40A 4GVHA 4IICA 3WLNA 3GSMA 5BU9A 4IIBA 3WLQA 1TR9A 4GNVA 4GVFA 3LK6A 1J8VA 4ZO9A 3WLJA 4GYKA 3RRXA 3UT0A 5IOBA 4IIDA 3WLLA 4IIHA 5TF0A 3WLTA 3TEVA 5JU6A 3WLKX 5FJIA 1X38A 3ABZA 4I8DA 3WLOA 1IEQA 2X41A 2X42A 4ZOEA 5FJJA 4ZO8A 3GS6A 3WO8A 3WLIA 4IIGA 4ZOBA 1Y65A 1X39A 3WLRA 1IEVA 5C0QA 4G6CA 3SQMA 5BZAA 4IIFA 3SQLA 4ZOCA 1EX1A 1IEXA 2OXNA 4HZMA
chains in the Genus database with same CATH superfamily
1R3RA 2HREA 5EZ6B 2ZBGA 2HGZA 1AQIA 3ESYA 5HJXA 4KXMA 1I7QB 3PZBA 1G4AE 4UE2A 2XUJA 3ZJ7A 2VEFA 1J2WA 1DIRA 1KGUA 3QR1A 2VT7A 4INJA 1VLJA 5A8NA 3F4VA 2VBFA 5C1BA 3RFCA 3DLTA 2BZSA 4DCSA 2VP8A 1ISHA 4B4VA 2AQVA 4ZGWA 2R87A 3ZWSA 2P75A 2BBFA 2IZ0A 3IAEA 2CITA 2R2AA 4JYMA 3HCWA 2JK0A 3SC4A 3I6EA 2JDID 4JSYA 4Y3UA 4RXUA 3KBJA 3CLKA 1Q2SA 1Z08A 3IIJA 3M0JA 1XRRA 1CIJA 1GG0A 2IXGA 4B71A 2QM0A 4L61A 1VEMA 5JS7A 4QKQA 3DAPA 1O6CA 4HNTA 4LHYA 1SG6A 4HVLA 3G1DA 3MKCA 4JBGA 3GLIB 3H2IA 3N70A 1X7ZA 1YJAA 4Q15A 2PBRA 1R5BA 1OX4A 2WJJA 5J43A 1IZ9A 4PU0A 1ZCFA 2NUTA 3CX7A 3WV4A 3CO4A 3H2EA 4UNKA 4MS3A 4GAEA 5CB4A 1XCPA 2ROQA 3N8DA 3TSAA 4UQDA 1Y1RA 4MS1A 3SCSA 4B9AA 1JEDA 4PW0A 1W4RA 2Z3ZA 3Q7PA 4ZVKA 3WHIA 2WZDA 2BDQA 5DIZA 4V0LA 1IWBB 1HUVA 4L0CA 3H65A 4K2AA 3GA7A 2J24A 2A5GA 4PUWA 3ADOA 1LORA 1VI5A 3U3DA 3VILA 4QTYA 3W6MA 5HZGA 1ODZA 2YJZA 1I33A 3RTBA 4P33A 4BB6A 2WOOA 4IM4A 4LF5B 4NYMR 2H31A 1KEKA 1THZA 1QXLA 1ICIA 5K05A 4J3NA 3WBJA 2RARA 3WUBA 3K73O 5ALRA 4NX5A 3QBEA 2DGAA 4BN5A 3MKKA 5DNWA 5BRJA 1I2OA 3VI3B 1XG5A 2IBMA 3R2JA 4F1KA 5AXBA 3RX4A 4IUGA 1WJGA 3C74A 1J0CA 3HCCA 3RG6A 3PJFA 1BNCA 4JV5B 4Z0HO 5F2NA 1TMYA 4PSCA 1DJXA 4DBUA 2BHYA 5B36A 2TMDA 5C1OA 1XFAA 2BMBA 3AR2A 3L0BA 1ZKDA 3GBVA 3I6YA 3KBOA 1PVDA 3V18A 2IIBA 2CMFA 1HE4A 4OIMA 4HHPA 4GX5A 1EESA 4KGLA 1HT0A 2CHOA 3AEQA 4IJ6A 1GU0A 1IJKA 1VSTA 4QXMA 4NZ3A 4YVPA 4AJEA 2A3CA 2IYUA 3W8DA 4LSWA 1C14A 1AMUA 4ZENA 1D6MA 1QPOA 1RYEA 1VYSX 4OU4A 3OZWA 2BONA 2WYVA 2AKZA 3D2CA 1NBAA 1PLKA 3HVIA 1NBHA 3I10A 3N86A 1WKBA 1K9SA 3LPFA 2ZI6A 4P7FA 2V5KA 3GR4A 3HVHA 4LYYA 1KERA 2RUSA 1L5MA 5HNTA 1M7PA 3DGRA 4QUIA 1UINA 4JOSA 1KWGA 1KOFA 2VC2B 5LLSA 1SFJA 2VTDA 3HKCB 2O14A 2B99A 2OQVA 3ARUA 1R4AA 5HKOA 4F5YA 4F3CA 2NVUB 2RGLA 4H7ZA 4DSOA 1LS1A 2CFIA 5F2EA 1DX9A 1JCXA 5HIMA 1PX8A 5TEWA 1W5AA 4S05A 3RILA 4GRDA 1T2DA 4TSFD 1UWIA 4B82A 3BXXA 4DCJA 4Z9YA 4FLSA 4IW3B 2Z4RA 2W67A 3H8WA 5ECUA 3VKKA 3EE6A 3JR3A 4RY9A 4NOLA 3PJTA 5EMUA 1B3BA 3RGWS 4ENPA 1KRWA 2WFAA 3CLRC 3WDJA 3WBKA 4Z7NB 1SZRA 3FYHA 3SN6A 5EOVA 2C0CA 4UQPA 5ALOA 4MVJF 4AULA 3D5EA 3C5HA 5K3FA 1PJZA 1ZVMA 2CLEA 3WK5A 2XA2A 5EIXA 1EWKA 4ZEVA 1IWPA 3JYOA 1L7BA 1RZUA 3W7QA 3AERA 1KH3A 4BQRA 5GVSA 3WGOA 1C1DB 3BB4A 2BNJA 1U11A 4N12A 4PCFA 2XNDA 2OECA 3LF1A 2VC5A 1OD6A 3E7WA 3TGWA 5I9TA 1EB8A 1VFNA 2XR1A 1RPTA 1J8MF 4PUKA 2AZXA 2HJ9A 1XGDA 3E27A 4NMHA 1JECA 1KDVA 2I8LA 3VKBA 3TX2A 3WSWA 4MUYA 4UTMA 5HUOA 2G36A 4RE4A 4A8LA 1FWNA 1YJCA 2H9YA 3PBUA 4XXHA 3KXLA 4L80A 3P0EA 4Q12A 2V3VA 2GT1A 4OF4A 2FP3A 2CDCA 2FWPA 5EY5B 3K70C 1NVGA 2WG2A 4QYSA 2Y6VA 5JCJA 4OJYA 4UEQA 1YR9A 3TPFA 1IBKB 2PLNA 3WB1A 2GSHA 3R8CA 1MW0A 4GMKA 3I23A 3TVTA 4YO8A 3CZAA 1M75A 3GB6A 5BWCA 1CXLA 3ZVIA 3G3EA 4F6CA 1ZCAA 1HLGA 3GEBA 1QK2A 1KZHA 1D0IA 2DIJA 1NQWA 1K4GA 1CUSA 1N0HA 3A13A 3ESBA 2Y0FA 2V7QA 3UIEA 1D8CA 1U2DA 1FDRA 1CF2O 2H1HA 3W1VA 5DOZA 2QS8A 2Z9BA 4PC3A 2RGWA 2XLCA 4IIFA 1JE0A 2OG9A 5KZ6A 3GG9A 4ZYYA 4Z2LA 3HN6A 1N0UA 2YTZA 4M1ZA 4FCTA 1N25A 2UXBB 4NI8A 3OTGA 5DMMA 3VFLA 4Z7JA 3WGQA 3Q7TA 4B5WA 2PLAA 1YFJA 3VPSA 3INGA 2ZS7A 5FACA 3CV3A 4FBMA 2SCUA 2G7ZA 1E1DA 4PYMA 4HKPA 2FZNA 4JLMA 1EFDN 1C9MA 1FS5A 1G9HA 4EM6A 3VC1A 1Z8NA 3G2OA 1SJDA 1K8YB 1HN1A 1XDBA 2Q6OA 1DKLA 5DYTA 1GGNA 1S1RA 5HWMA 3ROGA 1XK6A 1RWOA 4QGCA 5MGBA 1KYWA 3DF7A 2CF5A 3FOKA 1MEEA 1GPKA 2FA9A 4YPFA 2A8YA 4OMDA 2PSNA 3DE2X 4K7YA 3V9AA 1TYCA 3URBA 5K3FB 2ZXQA 3T3OA 3VJLA 3VNRA 4NZZA 1H9AA 4MDPA 1Q85A 2D7CA 2GBPA 3BHNA 2P4HX 1Q1ZA 5U4XA 3N9IA 4Q3NA 1NVMB 4IDAA 3DFNA 2Z5GA 4E2XA 2C58A 5KSWB 3GDBA 5LIWX 4UBJA 3A1VA 1BDHA 3BF8A 1HP4A 1T8RA 4OXYA 1G8PA 3L5KA 2FG6C 4JQ1A 3O3CA 2JS7A 2EWWA 2QTCA 3RREA 4EGSA 3PEFA 1NV8A 4IHKA 3CH9A 5DM4A 2VFHA 3FYOA 5JJ5A 2Q9BA 5TEVA 3U4CA 5CW2A 4CLXA 4CNUA 1A49A 3FA2A 5DHAA 1V71A 3VIJA 1F4VA 3WDQA 1F5NA 2BE7A 4FMVA 2MWMA 3HMCA 2BHZA 1IQUA 4FW9A 2JVJA 5C1DA 3GGCA 4G25A 3E38A 1SHJA 4IZHA 2WJIA 2WZBA 2NV9A 4AIUA 2K7ZA 2NU6B 3OO0A 4KXLA 1E3XA 4C1NB 3ZHRA 4JT8A 3TMLA 5IBPA 4CKCB 5JG7A 3C2RA 1FX6A 2CHVA 1K27A 3QV8A 3BS4A 1QFXA 2GXSA 4P22A 4ZZIA 4V33A 1SXIA 5GAJA 5J40A 3K0CA 1M33A 2Q3LA 2LW7A 3DKVA 1ZGHA 3TL6A 2DWUA 3IH5A 3QTTA 1XC6A 2OLKA 3GLGB 4LYHA 5LBTA 3GP3A 1IZ0A 1NFQA 1D1QA 4H6EA 3LGSA 4JU9A 1F1JA 1N2ZA 2Y1OA 3AAMA 4OHFA 3EW9A 5AYYA 4LNAA 3AL2A 3GJ4A 4AYXA 2J4DA 3NR0A 1ZJJA 4BK9A 1R6DA 5B6JA 2OV2A 3CPHA 4XD3A 1TM5E 5LZ9A 5HKAA 1WU8A 2XTKA 2J7EA 3AU6A 1KO0A 1J79A 5TJ9A 3RC9A 1UPUA 4NOKA 3WL3A 2GSJA 2A0YA 4CR7A 3DLCA 4EGAA 1NYTA 1VMIA 1G4EA 2HUNA 2XM1A 2HL6A 3BL3A 2C4VA 5HW0A 3HH8A 4B6PA 3AEKB 3NEAA 4NXKA 4G1CA 5KSPA 3M0LA 1YRBA 2FX5A 1T2VA 1W49A 2NYVA 4RZIA 3LAWA 4IOTA 1QSGA 1F8GA 3TM5A 2HU5A 3DFTA 1XCGB 1NFRA 2RGYA 4P7OA 5ITSA 2JRCA 3LQ4A 4Y2RA 3MD9A 1EUDB 1CRZA 4ENTA 5IHXA 3E9MA 3RYHB 3KZMA 2UYOA 4LXUA 4ADSA 1E79D 4ZO8A 3N76A 1QIMA 5MFZA 4MAMA 1TU3A 4M1SA 2IYZA 3LKZA 2R8YA 2ID4A 4LWWA 1BMDA 1H23A 4PMNA 4ER5A 2QW1A 4B6GA 4QLBA 4C0BA 4XD7A 3BKWA 4DLKA 1XYLA 3IAS6 4DA7A 1SO6A 3CS2A 4TTVA 1OYBA 4RDVA 1QI3A 5CSRA 1J1IA 4R53A 1L4KA 3EMVA 1GWJA 3WDSA 4JUIA 4TGLA 1ZN8A 5K0ZA 3RXZA 4MUGA 4Q9DA 3GUGA 3P9ZA 3MAJA 2F8QA 3TWBA 1OHLA 3PRYA 3I01M 3L06A 2W7TA 4NNCA 4FDMA 3P5SA 2FEWB 5IJ0B 2WDZA 2O7SA 2VPQA 1R3TA 1LVHA 2XUAA 2J3HA 4JI5B 4NJMB 4ASUD 5FEPA 3ANXA 3ZIUA 2WV9A 1GADO 3K09A 3R0IA 1PNVA 2JKPA 1AH0A 4BVKA 2I2AA 4BAUA 1H65A 2VJBA 3NB0A 2O1SA 4KWUA 3SVTA 1XCMA 3UW1A 4DFDA 7MDHA 2VXOA 3WK4A 4HB3A 1A04A 1A7UA 4CEUC 2J33A 1VJSA 3UU0A 3H42B 3FB4A 4RMJA 4F84A 4OLFA 1X2EA 3VOBA 4X54A 5B3AA 2DVTA 4TS9A 2VYFA 3MYPA 2ZPAA 3DBIA 5ALXA 1JWAB 2PRKA 2P4UA 3RAOA 1E58A 2GPJA 2X0RA 4WIAA 5DM60 4TPKA 4LHZA 4EEKA 4LY9A 2O2HA 1JDUA 4CMCA 3NO1A 2NT0A 1M2OA 2RDXA 3VTZA 4EPWA 1W56A 3AY6A 4Y9MA 4WTOA 4YAFA 2YJ5A 4PSKA 4J16C 3URQA 1LF0A 3ZS8A 1YE5A 5M7EA 3L67A 3AB7A 5KZEA 2H4HA 3RFVA 2ZRBA 3FI9A 1QTQA 3H1AA 2YN4A 4CQJA 4CTKA 2CLKA 2HV9A 2QRLA 4LMBA 2DY3A 1DWQA 3LQKA 5C7VA 1T5AA 4FYJA 1G5RA 5DGTA 1ZCBA 1S46A 1MENA 1FFBA 2RBGA 2FLWA 4N9CA 1XH0A 1ORIA 2Y1DA 1JDBB 5JSFA 1A3HA 1XJBA 3NC4A 2NXIA 2PMKA 4LBSA 3LNPA 3F7TA 5HIKA 3A4IA 3KHSA 2DZDA 3R2GA 5K6RA 3L07A 1R9XA 2WKWA 4QDOA 2A9JA 1YQXA 4PIVA 4RTNA 1NSYA 4UWMA 4YP7A 4KDEA 1U28A 3D8NA 4QJ3A 1ACMA 4YRCA 1OFPA 3B9DA 4QNEA 4CCEA 4J7AA 4P3OA 4CL0A 4FCVA 4MGZR 5ESRA 4L76A 1TJ0A 4RJ2A 2R8RA 3T8QA 1Z38A 2E2WA 5KTPA 3AMDA 2ZJYA 3Q40A 4EHHA 1TU4A 1DU4A 5RUBA 1VECA 3UMCA 1FUKA 2Y2VA 2VJPA 1PGNA 1T0IA 5LNK1 3DHFA 1E4MM 2VDQB 3ZCXA 4ENUA 1PTGA 3E2PA 1O9HA 2DULA 2OB2A 3B8IA 3T94A 3BAWA 3OYXA 4ZKEA 2PT5A 4FOOA 3BLKA 4U7TB 3OLDA 4YK7A 4G0YA 1TJPB 1C7EA 1A5LC 1S7GA 1ZMBA 1K3TA 4QM7A 5HRCA 1KOJA 4WAUA 1EGVA 1V7AA 3ZLJA 1JKMA 2ZZKA 3MO4A 2YVLA 3ONWA 1W3IA 3CSDA 1H5YA 4E22A 3OM9A 4LYRA 2V5UA 3GC2A 1WAMA 3TMKA 4R05A 1RM3A 1WTCA 1W581 1HJWA 4ZQOA 5JH2A 3ITLA 3DVRX 3LHWA 4Z7QB 2W0UA 1XX1A 4AY3A 1V3UA 2XWSA 4FHGA 2QCDA 4QFUA 1JW9B 3TYDA 1EQPA 1W2GA 4WY2A 4C0SA 1IY9A 1L7MA 4JTKA 2AE2A 1IG3A 2AWOA 1KEWA 4OUDB 4NHEA 2JFBA 3PPHA 1SR8A 5BXQC 2IQ5A 1EUNA 2VTEA 2POTA 1GVEA 2PPVA 2XCRB 3ZWOA 5T9BG 1G0OA 4W63A 5EPEA 1NR5A 3G0IA 2WU8A 3KJGA 2RHCA 4H59A 3B53X 1RLUA 1NQ6A 3R8HA 4Q9JA 5L95A 3PHGA 2GK3A 2HCRA 1T0OA 1Y8CA 1H5UA 2DUNA 1Z62A 1ZPTA 3G1AA 3W5UA 3GX1A 2XZ7A 4HUTA 2WIDA 3RK0A 1KY5A 3DFHA 4PBEA 1WV0A 1YOVA 4IJMA 3UMVA 1RD6A 2R97A 4LOAA 1UKBA 4OHCA 2PFKA 4ALMA 2NZ8A 4AKHA 2HXYA 5I3CA 3AUJB 4UAJA 3VD3A 3ITXA 1EKXA 2DU2A 4R0NA 3CNOA 2XWQA 5KYGA 1AUOA 1XLKA 5K8LA 4ZB0A 3UC5A 4ZAYA 2ZXEA 2PNJA 3IMFA 3C3CA 1ONNA 1P9LA 2DMRA 5KTLA 3G5AA 1I0LA 4F9EA 3GG7A 4M1RA 3LNMA 4DYDA 3MEQA 3ABIA 2A0KA 5K8IA 4X7RA 1U0LA 2H9IA 4M1KA 2ZE8A 4HVAA 1IDOA 1DG1G 3CUXA 1NV9A 4CUCA 4Z17A 3THQA 4RHYA 4PFKA 5F51A 1B41A 2W6PA 3KJQA 3TTUA 3EX4A 4W82A 3E1KA 1Z5OA 5JW6A 3DXIA 1GOKA 2ZP1A 3RJ5A 4CF7A 4UBPC 3CC8A 1ODKA 5YASA 4FEEA 1YHTA 4RZ5A 2GR9A 2H2AA 1FCQA 4DUOA 5E1MA 2AL2B 4GBED 1M1BA 3CUEF 5AM4A 1BDIA 5I51A 3I76A 1Y7LA 1L8OA 5SZJA 2FUG6 5LSMA 3MQTA 4XYGA 3QJ5A 1Z2AA 4N6GA 1PW5A 4NMXB 4U8GA 5COQA 4BMYA 1M7XA 1F6YA 2O1EA 2BR3A 5IXSA 3PPWA 4UULA 2AQHA 3WDPP 3HPAA 1CQPA 4G1VA 5LA6F 1T4CA 4ZMSA 2WYSA 2B61A 3NLLA 1ZU4A 5LDGA 3WL1A 1CIUA 3ER9A 2X0FA 2FWNA 3INTA 1EVKA 2FW7A 4KVZA 1O5OA 4OP2A 3SSNA 3VSEA 3BOSA 4RKEA 3MWEB 4JJKA 1I3KA 1SVWA 5LP6F 3OA2A 3I65A 3UYCA 2WABA 5KDDA 3EA1A 2P9CA 2QRPA 5C5EA 4JNZA 1K7XB 5EMJA 1ZS9A 1TVEA 1QWKA 2P8JA 3H18A 3CF4G 1ECBA 3KFXA 4W5JA 4QT0A 1Z06A 4Y7DA 4HAXA 3M89A 3F3YA 1X94A 1HTTA 3F2CA 1U9JA 2R9RA 4H9YA 4Z9FA 5IP5A 4URUR 1F8UA 2B20A 3N2BA 3B48A 3FXAA 3FHTA 3NQEA 1A5BA 4BI5A 1FWIC 3QF4B 2QVBA 1BTMA 2CJPA 1ZHHA 5ARCA 5FWXA 2HXSA 4ROQA 4ED9A 2A4MA 4YHEA 1SHTX 4QGBA 3OEEA 4OYHA 1B4DA 4DBDA 3KETA 2D0PB 1Y7HA 1THFD 3IJ9A 4LANA 3DVLA 3FWKA 2RDTA 3KZ1E 2JIEA 1H7RA 3OP1A 3K1GA 3PQ6A 4UQAA 1QF6A 2J85A 4GPTA 1Z45A 1KQZA 4ZREA 3H5VA 2WM8A 2XFYA 2VR4A 2HJVA 3WNCA 2GGJA 1L0BA 5KJ6A 4GY0A 3RHSA 1FFEA 4LJ8A 2V6JA 2NAFA 3MSDA 1O2DA 3CV2A 1EDTA 2CSUA 2DUJA 2QG6A 3L6CA 4S12A 1Q7TA 1F8YA 5LZLA 1OADA 1PGPA 2XN1A 3H24A 1NSFA 1OV6A 3WYEA 2GM4A 3PHJA 3HE3A 2PRYA 1F76A 3PUGA 3RLGA 3D59A 2P62A 1GCUA 2POQX 3NTRA 4FXRA 1OA1A 4PA8A 4YTTA 2DFVA 1AKQA 1GSHA 4B2PA 3QW4B 3GAAA 1VFTA 4OXQA 5I02A 1KC7A 3SRFA 2FEXA 4I1RA 1GGVA 4WSJA 3ZE0B 2C7VA 3N6XA 3SN1A 4MZXA 5G02A 1E6NA 4P93A 1B8UA 5BQ3A 1VCFA 1BQGA 1IIBA 4CV3A 3V8EA 4KESA 3GTFA 2X6TA 1US3A 2H3EA 1A0CA 3GC5A 2H4WA 2GXUA 5G41A 2AG0A 3HB5X 1TA3A 2HIGA 4LF4B 3QEKA 3KTSA 3JTEA 1ZCOA 4IQDA 4FR6A 1ZZGA 2ACWA 5FPSA 4F2WA 4KMQA 3B8HA 4G6ZA 2QZJA 1UH3A 3K1ZA 2F48A 3C3EA 9XIAA 4ZOLB 1H5QA 1Z9BA 1WZNA 1D2GA 2B36A 4R71A 4BQQA 2WSSA 4QYWA 5AW9A 1L6SA 3K4HA 2GCGA 4MQFB 4O2BF 4AWTA 1GFSA 1XOIA 2A58A 2AQOA 3OBAA 3GLGA 2DERA 4BEBA 2NQLA 1WA5A 1XPGA 2AZTA 4BEQA 1V1MA 4EPXA 4QE5A 1MLDA 3WBEA 3BXFA 3U7JA 4G8BA 4D8TA 2AFIB 4WJEA 3A1NA 2LPMA 3MB9A 3VGJA 4LHXA 4KRFA 1EWVA 1RDFA 1PP4A 4PIMA 2GA9A 3O6YX 3O7UA 3GCXA 3S2GA 2A3NA 4L6IA 2AMLA 4MV5A 2C5BA 4O17A 1C50A 4XQ6A 2ZI9A 4QOHA 2PV7A 3QV6A 2E4VA 2V38A 3NTQA 1L8LA 5T9CE 1KXTA 3I5MA 4GVGA 4O4IF 1KDOA 4UCXA 4ADSG 2OGZA 4C1NA 3GIYA 3R9KA 4FBLA 4QO8A 3QKIA 1S5PA 4FJ2A 3KT6A 4O14A 9RUBA 4PS0A 1CW2B 2P2YA 4FUQA 4HMPA 2OO3A 5XINA 1O0BA 4BFCA 2HHLA 3W7OA 3VDGA 5JSZA 3N3MA 2V4MA 2VWHA 5C5CA 4RQTA 5FULA 3DEAA 3PXAA 3N2NA 5P8WA 3OM8A 4CFSA 1F61A 1ATIA 4F0LA 4C65A 1Z0ZA 2IF2A 1UWRA 4NE2A 1HJVA 1VHWA 5LIPA 1O3YA 3B9RA 4YDSA 2C8NA 4RA6A 3NEJA 1HM5A 4G23A 1XH2A 4QDKA 3PQ8A 4C4SA 5IH7A 3JAKA 2H4FA 1YRLA 4K6HA 4YL2A 1SBQA 1NN3A 1H0HA 2J08A 2W2LD 2ZSAA 3O74A 2VRWA 4GX1A 2WB4A 5CFNA 4KAFA 1FXSA 4RV5A 2P6UA 1MO0A 1IRIA 1C9DB 7ABPA 3AL0C 4WK9A 1NSTA 5CFPA 4Q8TA 3ZT5A 4HTBA 1XL0A 4A29A 4M0MA 3RW9A 2DJ5A 4UFJA 1EWRA 4LOCA 3I04A 4JN6B 5FX2A 1V7PC 4G0ZA 1TZ9A 4HN2A 4BN4A 1ENOA 1WQ5A 3AS1A 4DWSA 3BK0A 1O96B 4PY2A 1W9DM 2DLDA 4RUBA 4O0LA 4AH7A 3PC7A 1KO1A 1HFBA 4LJAA 5JJCA 3VO0A 1UWVA 1GFIA 4YJGB 4M60A 4WLUA 4BUJA 2O8DB 3GL9A 5HBFA 2BM9A 1Z39A 3DM9B 3PV0A 1AKMA 4E5SA 3T06B 2WC4A 3UGJA 2J9GA 4CM9D 4JGGA 1YDMA 2HSEA 3P84A 1TUBA 1AZWA 2FFIA 4O4HF 4QL3A 4LQDA 4NF2A 4K1WA 1KARA 2OCBA 4KAAA 1GPNA 2MOKA 1DJIA 3RTEA 4R0VA 3UMFA 3K1AA 3F74A 2CYAA 5JVDB 4AC1X 2G0WA 2HQAA 3TC6A 1N2GA 1NOIA 2EKZA 4IAOA 2M2IA 5BYWA 4YMUA 3ZXSA 2OQRA 2E4UA 4B6JA 3FYUB 2CKSA 2OCKA 4DCMA 4YUAA 5BVHB 3M9YA 3RPEA 1PIWA 3PVZA 5FEMA 3UOWA 1TZ7A 4PLFA 3N28A 1YHYA 3JX9A 4MZDA 3VBCA 2JFYA 1L6RA 2WEKA 1IBCA 3IUSA 1MV8A 4HYEA 4B87A 4ZDKA 1UADA 3WJSA 2PRMA 4AJPA 3PUKA 2DQSA 4PUNA 4OI4A 3LRMA 2W98A 3F6RA 2VUHB 3HY6A 1QK3A 5FF4A 4GYJA 4HHLA 3NHZA 3FVRA 2CW6A 1GZ4A 4KQFA 3RSQA 3OECA 1WNOA 1XYMA 4H0FA 1XTQA 3HKEA 1M6VB 1O5XA 3RSFA 4CKWA 4XZWA 4MTVA 4XIFA 1Z5PA 2GTIA 4W4QA 1T9DA 2P5UA 3QVLA 5A9RA 4PCNA 2FVMA 4LCEA 3P5ZA 3V5NA 5AVXA 2GRUA 4F79A 2I4OA 2ZM6B 4O1FA 5DISB 1ECPA 2JGFA 4XX6A 1UKSA 3EPOA 1E2UA 2CCKA 1C7SA 1CZKA 4YMIA 3CZCA 4RW3A 4Y6SA 2QPOA 4NMLA 1G7RA 5GIPE 5ENLA 3IAXA 1V08A 2Y4SA 5ED4A 4XQ0A 3UOAB 2X40A 3THDA 5A4AA 2TECE 1CUFA 1LQTA 4M6UA 4UOZA 2KLHA 3I8XA 4DWOA 5EJ9A 4DF1A 1P0PA 2RHLA 3C8HA 4L3WA 1CUDA 4LVUA 4N7MA 3V3KA 3LYAA 5CB0A 3U7FB 1DCFA 2IKJA 3OT4A 3N1AA 3SSJA 1UKOA 2WLZA 3BW4A 4MSSA 4ZI7A 4M9QA 1TRKA 1EC9A 5LZ4A 2Q3HA 1XKTA 4MKFA 3TR6A 1J0AA 1UDXA 3EVGA 2ZWOA 4JYEA 4JIGA 3B5IA 3HYLA 1I2BA 1XICA 3VR3A 1W2HA 1P5JA 1XBTA 4C4AA 2FFAA 1X8JA 5KTNA 4RLHA 1IXOA 5IASA 3KPVA 4G5GA 1YD7A 3I6BA 1I4EB 3G82C 4HK6A 1M66A 4K6AA 1JQLB 3F1LA 4H00A 1GNQA 3MDUA 4A10A 4B5LA 2AD1A 2YRXA 3E0VA 1UUQA 1JKXA 5J63A 3L40A 1P6UA 4F0MA 1H2WA 3MA0A 5G3YA 4ETMA 4C4PA 4AG5A 5KITA 2NZUG 1NIJA 3L7OA 4MCJA 2JEQA 3IJ6A 1TW2A 1JIKA 3CB2A 5C9XA 3GBDA 1A4MA 5CVEA 1OMOA 5JARA 1T9CA 1CTQA 4CXMA 3DYVA 1IHDA 2WM9B 3ZEIA 2CHFA 1P1BA 4YNBA 4EUEA 1PYFA 1IXNA 2NW6A 3NV7A 4W7IA 4JP5A 4TT3A 2P8SA 2PI6A 3CNNA 4LISA 1YTEA 5BUQA 2PUDA 3OKFA 2WJEA 5FOTA 5ESDA 1JKJA 1O97C 2CC2A 3QKUA 5L9FA 2QF7A 4NL1A 1Z07A 4QGSA 3K4AA 4JNYA 3WJXA 4ZFCA 1OGJA 2IEZA 4FR0A 4LVGA 1MAHA 2ZUBA 4EAAA 2XQFA 3C1UA 5E6UA 4F4IA 4X0VA 3P96A 5FUBA 3HPZA 1RQNA 4XIYA 1UBEA 1T6NA 5LQKA 1BMFA 1LPBB 2CFCA 1HGYA 3ZJKA 3LQGA 5FSEC 4UVDA 1OCJA 3PJEA 4RTJA 4B45A 4R41A 1V77A 4WKNA 3SDSA 4MYHA 2OGUA 2ODWA 1DIKA 4LGVA 3MW7A 4URIA 2E9LA 3RARA 3KJNA 3K16A 3SDOA 2BSQA 5E2IA 1LSJA 2OXCA 4WADA 4QX6A 1AODA 2CLHB 4Q47A 2I22A 4Y9OA 5IHRA 2G1JA 1DIEA 4R2XA 3ZIDA 2ZUSA 1VPTA 3Q9NA 3E0IA 5E70A 4HK7A 1VJRA 4UJ3A 4OHBA 2ZE3A 1JHAA 4NC9A 4BVHA 3ER6A 3MT1A 5AOBA 4YA6A 3P0RA 2J6HA 1E9RA 3TTWA 3KBWA 1FNDA 4LDNA 2D62A 3H7VA 3FA3A 2B1RA 4E33A 1NW4A 3V1UA 1XRPA 1KIAA 3IESA 1U1IA 2X09A 4R7OA 2OCGA 1XFBA 4KP7A 1XBYA 3VX3A 4F4JA 1OH8A 4MLJA 5L6LB 2PP3A 2JF7A 4X22A 3K6KA 5FAXA 3TDNA 3L0CA 1Y5IA 1KRAC 1EC8A 4HPGA 4N9QA 1YZFA 4DLUA 1DV7A 2ZWYA 3KR2A 5FEZA 1E9IA 4B75A 3FAXA 1NBIA 4MO9A 4PZVA 3T5BA 4C6SA 1DIDA 5JUVA 2G67A 5LJIA 4XD6A 4DJFC 1KEEA 3Q3HA 4NEQA 1DRJA 4ACZB 3NQ8A 5DN6A 3TLQA 5HKKD 3SUWA 3RPMA 3ET4A 5I78A 4XBKA 3ONDA 3QW3A 4IFKB 1A8IA 5BVGB 2A6PA 1K1EA 4I2VA 1HDEA 5TBOA 1TAUA 4ICNA 5IK2D 4EB0A 4KNWA 4RNCA 4GUHA 4A3YA 3KHTA 4QT4A 5BSTA 4AWAA 1Z83A 3M4JA 2NO4A 5LD2C 4KYUA 1U99A 3OCCA 3VX4A 2QJFA 3S5JA 1A5TA 2XI4A 1Z56C 2OBLA 2IVZA 5SICE 4F40A 1KM5A 2WCSA 4YVXA 3MFQA 1FFXB 2HCBA 3I6ZA 3A9TA 1BW9A 2V03A 2GWHA 4L1GA 4FMCF 2WYHA 4LC9A 3R8GA 1V0JA 3AM4A 3G2QA 2G0NA 5TF4A 1A3XA 1B57A 3COSA 1DBTA 1IHIA 1X19A 1RZVA 2EGUA 4RL4A 4M6WB 4EJ2A 4W9NA 3QU9A 4C06A 4QTGA 1V0LA 1YE4A 1X97A 4WGFA 4QUGA 4MS3B 4ZT2A 4RM2A 2P3QA 4K8RB 1ETUA 4CI0B 4N0PA 3V0TA 4DIKA 3DT8A 3IKJA 2ZIDA 2LXNA 1Q2XA 4HYRA 1P4SA 1YJXA 1TAHA 1K5PA 1CUZA 2KBEA 1M34A 5TV2A 4RDWA 2GQ9A 2Y1WA 2CLMB 3VR6A 3WK8A 4KCUA 2M1XA 3CCCA 2WKRA 1TJ3A 1BWRA 1M0EA 1FFRA 2WT4A 3BTOA 4NAHA 5NLLA 5THKA 5MN4A 5K0EA 2AJDA 3MMSA 4AO6A 1JAIA 1Y6QA 1Q6DA 4W5HA 5JAIA 1GHSA 4LNHA 1BPLB 3OCUA 4JI2B 4J3ZA 2OV3A 3ZMRA 3OHIA 5I7SA 3M07A 4MKXA 2NYAA 5ICCA 1VLQA 1RTTA 1WDRA 2XCOA 2QGHA 1TMOA 1P77A 3MP4A 4DKJA 5EJMA 2EQDA 5ENDA 2XOEA 3EF3A 2RG7A 1LW7A 4TQUS 3AI2A 3O9MA 1KVUA 3FM9A 1USUA 5F7OA 2QRKA 3GNOA 4RVHA 4X1IA 2F7SA 3T9PA 3HMKA 2C2WA 1ISRA 1YR3A 1B7GO 1DO0A 1U5JA 4FU0A 3DHYA 4M8IA 5L3VA 5LM3A 1VB9A 3COPA 2B7CA 4G8TA 2FGBA 4LV9A 3DHPA 4WACA 4ZI5A 1TWWA 4WZHA 2D74A 1R0LA 2HZGA 3A4TA 4JLPA 5J4KA 3PUYA 3L8DA 4GU5A 4UFKA 3PUOA 1WZLA 1OBHA 3YPIA 1UPPA 1RM5A 1TF5A 5CK5A 2AJCA 4W8HA 4U39A 1ESDA 3KLMX 5FJOA 4JMLA 4EPYA 4AIEA 1A9YA 2Q6VA 5JNUA 1D9EA 3EARA 2PB1A 2PRSA 1V6CA 1M2GA 4KO3S 3M6IA 1BKDR 1WPGA 2J7PA 5ADHA 1MVNA 3I1FA 2FWJA 3CUHA 3AKZA 1GZ5A 3NXSA 1YC5A 1TM2A 4ZOLF 3CEAA 3T7IA 1NU8A 3AJAA 4O5OA 3A12A 2CL6X 3DGBA 2RC5A 2QYOA 2NQTA 2PSEA 4J76A 3LX4A 3U1BA 4QPCA 1VI6A 3LH5A 1PNQA 3CL7A 2F55A 3GNSA 5LNK6 2I78A 5I06A 2D0OB 3GVPA 5HIIA 4AAYA 3SFZA 4LQCA 1R87A 1V16A 1TK3A 1YQDA 2QU7A 3SEFA 3SRHA 3S2CA 1ZU5A 1KB3A 3FPHA 3WQHA 4FFDA 4JP1A 2Q3OA 1LDNA 3D4BA 3DQPA 1TVMA 1WDWA 4M9RA 4B5NA 3X1WA 5EC8A 3TTTA 4U8HA 4UNPA 3UR7A 2O2CA 3R6TA 5FL7D 5JYDA 4YPVA 2PURA 4OBTA 3ZUGA 4KLZA 3Q41A 3HHEA 2AG1A 5ITVA 7ODCA 3LGXA 1P1XA 4W84A 3RV3A 4AAJA 1C3JA 2QF8A 1A27A 1XKYA 2GDVA 3LPOA 2BUBA 4ISBA 1EX7A 2F7FA 1GUDA 2YCJA 1XLBA 4H3VA 3WBFA 1ML1A 1ZNYA 4HLUC 1G20E 1NXOA 3C4VA 4RD2A 3CR7A 1EVEA 1EWEA 3MGAA 2V68A 1MXHA 1V8DA 4KCGA 2P1FA 2Y93A 2R6HA 5HJYA 2I57A 4PZPA 2VFAA 2O2SA 1KTNA 2P8CA 2C1ZA 2XAAA 5LIYX 1NWTA 1ESCA 1RJ9B 4P32A 5JMTA 1PZFA 4ZYLA 3AM1A 1MIOA 3HS3A 1JCMP 3QWBA 3DO8A 1PR2A 4U00A 2F3SA 1HDOA 5MHBA 5L40A 4Q7JB 3MZ2A 3U4MA 4NS4A 4DLVA 4TR9A 2NV1A 4JC8A 2QNIA 1GAXA 3EA0A 3NSMA 3LD9A 1B26A 2JGDA 2XTJA 2PCLA 3W71A 1LI7A 1ZGZA 5D09A 3L0PA 1YB4A 3IHKA 3EIQA 4MDYA 4ZI7F 3OZDA 4INOA 1Q6YA 3V1KA 2ZRUA 3KB2A 3E8XA 3DI0A 4OLBA 3GK3A 1TJ5A 5EJ8A 2V63A 4GSLA 3IEMA 3ZIAA 1DKPA 3GUYA 2EFDB 3OA0A 3IC5A 2GLXA 5HMMA 1VH7A 1CLUA 2OLSA 2H63A 3OLQA 1K9FA 4GMHA 3UWWA 4HXFB 3WDRA 3HTWA 3I30X 1YIAA 1XLUA 1DUVG 3HZOA 4JOCA 2A3EA 4ALIA 1ELOA 4PV7A 1IN5A 4JWTA 2GNPA 1JKJB 1XLWA 2DBZA 1I24A 1XHEA 5CXSA 5JSKA 4CLEA 3CRZA 1BQ4A 3GN1A 1MB2A 2YKGA 2AHOA 2J78A 1QP7A 3NOOA 1BVWA 3T0BA 4DWSC 2OMEA 4XTIA 4B40A 5CDFE 3K8QA 1AH3A 3KRSA 3PM6A 4HHHA 3N3TA 5CGQB 2ZM5A 4GQBA 1YB5A 2Y8KA 2J3EA 4BNWA 1SCAA 2W93A 1UMBA 3QPAA 4EKNB 4MVJE 4PXSA 1C81A 1RP1A 2HW8A 2FF7A 4AKTA 2D6FA 2PS3A 3ARRA 2CIPA 3KQLA 2WF5A 3ANYA 3GE7A 2PE4A 2GQ0A 4TM8A 1XSEA 1U4SA 5CGZA 3UHOA 4KBXA 1NN5A 2GESA 4ZYZA 1KEEB 4QE1A 1JDNA 1JHMA 5JQWA 4ZMGA 4QEKA 1F60A 3H2KA 3ZX5A 1NP6A 5H8PA 1VHTA 3ABQA 3BSWA 3BMQB 4AJIA 2ZRHA 4G84A 1WLSA 4LB4A 5D3QA 4CF5A 4MYXA 2D0HA 4EE9A 4CNPA 5C34B 3UM9A 4ZWNA 1A8UA 1W9PA 1DQYA 1GPH1 1SEPA 3P45A 3V4LA 4RPHA 1KQGA 1ZEJA 1YBQB 2WYUA 1N6RA 3H2ZA 4YBZA 3RS0A 1QIIA 1PQ4A 2YUTA 3E53A 1MC4A 1QK5A 2QLFA 3W1LA 4XYLA 1OT3A 2GF0A 1JAEA 3MT8A 1ITUA 3IILA 3MPUA 4MI9A 2XPKA 3MOSA 4PYQA 3OD5A 2BRUC 3KKLA 2WLYA 4GNKA 1XLVA 1UXKA 3IIZA 1SOMA 2AOWA 3S7ZA 3U1VA 4XZBA 5EJGA 4XSLA 3UJ3X 1IHUA 2FPOA 4Q4JB 3W53A 1DFGA 2C9OA 2P76A 2COEA 3L65A 1F6DA 1C41A 5HMFA 2X0KA 4CTOA 1G4TA 3C5EA 4FP9A 4HJWA 5PTDA 2GCOA 4K9LA 1E5QA 3SQLA 3Q2OA 1LUAA 5I7FA 2QAIA 2YJGA 5A69A 1B3XA 2PCJA 2HPZA 1Y8QA 1M10A 3R1IA 1QI0A 3I9LA 1R66A 5A7HA 3WWZA 1WZMA 4E0CA 2B2NA 3UHFA 1BAGA 1JSZA 4XTCS 3SK0A 1B9BA 4HFMA 4RVUA 2F9FA 1AUSL 3E7DA 1ZNZA 1UR5A 1TKCA 1H6BA 2BRUA 4DQVA 4W5RA 1HKKA 3OP2A 5LQRA 2H1VA 3NIWA 4YWJA 2C83A 5JNLA 3G0GA 3BFJA 1IE7C 3UMGA 1XF0A 5HQLA 5KYXB 4GD3Q 2XNJA 4UU7A 3D1VA 3TD9A 3M0IA 1N9ZA 1C7JA 3GYCA 1X80B 2BY1A 3QR3A 4H1WA 3OVGA 4B35A 1ZH0A 3M70A 4GI1A 5L51A 1L3IA 3S2IA 3IERA 3PQ3A 4RMNA 4EG8A 3I0MA 1RAIA 2QTVA 1KZ9A 3T1HB 2QX7A 3N25A 4A16A 3INYA 3LL4A 2FX2A 1ES9A 2I9UA 3PWTA 1Q0QA 4F7DA 4E8GA 3QQ0A 2X2OA 2GSWA 2H1SA 1BCSA 3FGNA 4WCFC 5IZ4A 3WDIA 1M6JA 2Q5LA 3DZJA 5FOXA 5THQA 1Z6AA 3DZDA 1HJQA 5K8CA 1PDZA 4L6CA 1VSQA 3TR2A 1I60A 1N34B 4N3AA 3UY8A 2HT1A 1EGHA 3ERPA 2VEIA 2Z2AA 1BYIA 2MHCA 2PZ0A 3LJKA 4LJ9A 4X8OA 3O8BA 3I12A 1VQTA 5B5SA 1E1QD 4G86A 2VJCA 1RBQA 4KQEA 3ICVA 1C3LA 4GWLA 5BMVA 4N48A 4M55A 1GJPA 4YUYA 4KXQA 1JLHA 1JUKA 1A5AB 4BJ6A 1CDOA 4I8IA 4MY9A 4ZVQA 5FL1A 2YL5A 1T8YA 2X41A 3LPMA 3TD6A 2XMCA 2V45A 3S1GA 2BVNA 3EFEA 4R3UA 1CJCA 4XSGA 2HEJA 4M81A 2IHYA 4NI3A 3MERA 4M9CA 1YTUA 4ACZA 4Q1DA 2R6GA 3SAJA 4XFDA 3TQSA 3FWPA 2ZAYA 4PGHA 1U9YA 2BEVA 1QU3A 4GZMA 1SBZA 3N6RA 4MYUA 3EXRA 1EEXB 4UHDA 4ZVNA 1G4UR 3V1HA 1FJXA 1CPYA 3B85A 3WGHA 4Q66C 3AISA 2COKA 4HDRB 2FYTA 2VK8A 1ENPA 2ECOA 4CU7A 1SURA 4UQEA 5D33A 4M1QA 3GGPA 3SCQA 1BD0A 2A9VA 2JPDA 1PKMA 3TNLA 3FAZA 2CE2X 1KFCA 3M64A 4GICA 4C08A 3T3EA 3APTA 4KITB 2RGCA 3IEVA 3QBUA 1WO2A 4DXXA 4AB4A 1P7YA 3NHSA 3ME3A 3NH9A 3AUAA 1GW1A 4MQUA 4J2PA 4WDWA 4AIIA 3L84A 3MHTA 2RKWA 5CPQA 3MMTA 1HTWA 2W8BA 1VPEA 1YVDA 5IBCA 2QTMA 1OFQA 3ZWMA 4UFLA 1T5SA 1ECLA 3QN3A 1GT6A 2I33A 2HCTA 3JXEA 3QYPA 3ZLUA 2YS6A 3PYLA 3F5DA 1EXMA 3ACDA 3VR5A 4JFVA 4H1UA 2QM3A 3GRCA 4XM1A 2G3NA 3HU3A 1P6CA 5HULA 4W7HA 1VIAA 3GLGE 4Q3CA 2PY6A 5G4HC 4CMAA 2V7EA 2XNDD 4JX8A 3FSUA 1ZBDA 4DR2B 2V7TA 4KK3A 1GJRA 4KO4S 1V8PA 1E9EA 1GY8A 2EPOA 2FN3A 3K1JA 3A1DA 2FW8A 3ROKA 1EFRA 1PKNA 4B2DD 1X1OA 1VA5A 4PM4A 1CUAA 1Z5GA 4I36A 4Y67A 1NXVA 2YB4A 3GFFA 2WI8A 2J3DA 1XQKA 4R9XA 1HZZC 4BFZA 2BD0A 1BXBA 3A26A 2YMQA 2C13A 5LL6P 1P0QA 3H1GA 1Z5UA 4RK8A 1PIFA 1DHKA 3N59A 1ODLA 4RDHA 3F7NA 3NFYA 1ODSA 2VFDA 5A7GA 1SU8A 4PZYA 2ZSKA 1KYIA 4ROPA 3KLLA 3GEEA 4C6RA 3PJRA 1EIZA 3AS3A 3JQFC 5CBPB 4XA8A 2XIBA 1NFFA 4HQNA 2XIQA 4E21A 4UW9A 1N77A 3SNKA 2V6MA 2YWFA 2WANA 2OLEA 1UP2A 4DDHA 3GDGA 1SSDA 1AF7A 3MJVA 4DDMA 3VI4B 4FFPA 4I1UA 4EJMA 4XYBA 3GW0A 1O89A 2IXTA 5JZBA 4AZ3B 2IXUA 4DR4B 4WHBA 2ZVQX 3UJBA 3IR5A 2ZDRA 3VO1A 5CGMA 1QCZA 1T0UA 5HMSA 3OZEA 3T1YB 5GTDA 3WC4A 2PAAA 2W27A 1KI2A 1FVOA 1BVZA 4IOLA 2DVUA 1ZAJA 4L5IA 4XWWA 3DL7A 4ZXFA 1N5RA 3FD8A 2BLLA 3JQCA 2AEEA 3RSHA 4L78A 3B5EA 3HJZA 1IN4A 4X6XA 3LTYA 3U9TA 4O15A 1Q1NA 2H2WA 4D97A 4OK6A 1AMNA 3ONEA 2XVYA 1OAOC 3ORHA 2WSSD 3DEFA 2OSXA 1NP2A 1S5VA 1X6VA 3TQOA 3NEPX 1QWSA 1LBSA 1K9VF 3QKWA 3DS8A 4H3SA 3RDKA 4UE3S 4EYQA 3THYA 1O66A 4RIIA 2J3QA 4DQKA 3WI7A 1NDHA 4OBSA 1LG2A 1TXGA 4O0MA 1ZR2A 3LA8A 2Z1XA 2J62A 2Z26A 2O9OA 1EJWC 1JJVA 2GEVA 1E6PA 2W2TA 3G9TA 3IV7A 1GKKA 4JLBA 3A3YA 3RRAA 3FOFC 3I72A 3OVPA 3HJGA 3GF4A 1UR8A 2DP3A 1XTUA 4Q48A 3S5OA 3DG9A 2ZYVX 4YJ3A 1O87A 1P72A 5E7IA 1S39A 2B30A 1A5OC 4OHRA 4AECA 4OX9B 3S6TA 2R4TA 1PKXA 3DYMA 4GZEA 2P41A 3TUZC 2FJKA 3A3HA 5E93A 4K86A 2PZKA 1EB3A 3VR4A 3A4JA 3UEOA 4WKCA 4JTUA 2DZTA 4AXXA 4IWXA 5AP9A 4TTQA 4C6TA 3NW9A 2RD2A 1NVVR 2I55A 4GP9A 2VHWA 1LVUA 2ABWA 4WSOA 1ADOA 4FQ5A 3CISA 3DVAA 3WWPA 1GQLA 5BOOA 4GLJA 4W9TA 3LKVA 2Z1BA 4GINA 3FAWA 3HA5A 1Y1LA 1IQ0A 5F3RA 2R14A 3QOYA 1O03A 3DDZX 4LVOA 2GAAA 1VPYA 5HOSA 5CBIA 1YL7A 3UMMA 3D4OA 3FTPA 4NZ4A 5C0QA 3AT1A 4M3PA 4W5UA 1UP6A 2YQ5A 1RM4A 1XH1A 4D0RA 4W5OA 2Y0DA 5EWLB 2GNAA 2VWGA 5HRUA 3GXDA 2WFLA 2Q71A 4D3SA 4F72A 4YCPA 3W3AH 4MGHA 2ZU6A 2WWGA 1J90A 4W7VA 1DJZA 2VUTA 3B8WA 1A96A 3PQ4A 3TLEA 1BGAA 4EA6A 3F9CA 1GPYA 3SCWA 4P5PA 1O5TA 4WKOA 2E82A 2E9BA 2ZRZA 1MR3F 1SXJE 2PWPA 3E9QA 4PFMA 5B1YA 1GSIA 4GMGA 4TUYB 4LXXA 1U0TA 2QNBA 3IP5A 3SR4A 3NYDA 1ZSYA 4WW0A 3NHUA 4A92A 1X0VA 5AJVB 4C0AC 1XEWY 3LCIA 1Q95A 2B8NA 5MN5A 4RK0A 1NVXQ 1PWYE 4I6GA 4JKOA 1SBTA 3CAQA 4D9BA 1Y8RB 4MW1A 5EIBC 4G5QA 2Z1WA 1MDFA 3AUFA 4HEQA 5IAOA 3D4PA 1C0IA 1ZSXA 3WLNA 2EPNA 1TPDA 1SCKA 3WIJA 1QH8B 3DECA 3UGRA 1TYEB 5BMVF 3HY3A 1W30A 3SG0A 1DB3A 4LVFA 4KGZA 4RTMA 2CVPA 1QC5B 3SM3A 5KQMA 3PWGA 5IJ9B 3TTQA 3BCRA 4Z1AA 3IO5A 4ZL1A 3B20A 1ZQ1A 1WUIS 1YQQA 5KQPA 2G3IA 5CDTA 1V5FA 3UJPA 4BNVA 2Y9MB 2ZZMA 2C6QA 3VZSA 1RUSA 5DHRA 2C16A 3EX2A 1E9VA 3UWSA 3H2OA 4URXR 1IJFA 1G98A 2GTHA 2C0AA 1OFIA 3GDLA 1CLEA 1NRIA 2Q99A 1RH9A 3IRSA 1UH4A 2ASVA 1O95D 2G8ZA 1MRQA 1NPDA 4RXGA 2BL4A 2OC4A 4EYSA 3V33A 4TYMA 3F9IA 5T7BA 1RYYA 4Q8QA 2R1LA 1GL9B 3SSAA 4GWEA 3OPNA 1WD5A 4GQGA 1M3UA 3FFWA 3R3XA 3M2TA 2BXYA 3URMA 4PYLA 4IDCA 5LIXX 3R4IA 2YRFA 1U3DA 5H68A 3CJTA 1UOOA 1RRKA 3PTAA 2QMEA 3HLYA 2G80A 5EB8A 1QNLA 2V8OA 3ZZTA 4U0KA 3FEQA 1WABA 2YASA 3TTXA 1OHHD 3H55A 2XGIA 3N7UA 3NKLA 1NC1A 2RHWA 4B4UA 1B4EA 2EWMA 5E6SB 4CMIA 2HRRA 1PYGA 4UVEA 4AXNA 3E02A 1PTJC 2XKKA 1UMLA 2LP4Y 4RGQA 1H7WA 3TE9A 4MV3A 1V37A 5LSAA 1FCVA 1DIOB 2HAEA 2OUKA 1D4ZA 4BNIA 4X6YA 4N4AA 2GZHA 3L5MA 1JJFA 3RRNA 3SICE 2QZZA 1IOLA 3CLRD 2MNRA 2XISA 1SOWA 4ZOLA 3VUPA 2JFZA 4D9NA 3B40A 4E4FA 4RIFA 1DG9A 2NYUA 3I05A 1G18A 1ZB5A 2PRZA 5JATA 4DUPA 3BAYA 1YDGA 3NA8A 1KU0A 1L5FA 3JPYA 3P2KA 5EYPB 3HM2A 5CLFA 4D9JA 1HQKA 2O0MA 3LPNA 3KCOA 3K8KA 2FG5A 4NU6A 3PX7A 3L7BA 3DO5A 3RBAA 2WYIA 1NY6A 1DWUA 4OP1A 1X1CA 2Q5QA 4L8VA 3PFGA 1K86A 2J9XA 1JJ7A 1WB9A 3NDOA 1WKEA 3AHHA 3KSRA 5A5DA 4WMLA 2F62A 3UXKA 1JDAA 1I1HA 2B4RO 4LJRA 5JISA 4X6LA 3BFXA 5DHPA 3NPUA 4HGPA 2VBCA 3G1YA 3U5TA 4DLBA 3R3JA 1G5HA 1NVDA 1V9SA 5AKYA 3RROA 3LX8A 1GQRA 7A3HA 4G4GA 1B0AA 2HPVA 3CLWA 4LPCA 1EBGA 1GA6A 3DZ1A 3GVXA 1LLUA 1QYRA 4S3FA 1MC5A 1V7ZA 3CLHA 3ZCPA 1Z13A 1IZ8A 3P9KA 1OREA 3JR2A 4Q4OA 1R3SA 5LBIA 1G7TA 2NSOA 3GAFA 3KSUA 3MS7A 1EP2B 2CLCX 2FR1A 1XIIA 1BEEA 2DYKA 4KWSA 3KKMA 3MRTA 2WAYA 2DE0X 1VYHA 3D3WA 2H8XA 2OMAA 3IDAA 1F1BA 3V8NA 3M4ZA 1AUPA 2CXGA 1TAQA 3IPCA 3ICJA 2IHZA 5A6SB 2OO5C 1OWPA 1DRVA 2R1TA 1JG6A 4GI6A 4O1BA 4X62B 1L9KA 5G1OA 2JLRA 1XBVA 3FFXA 1KQOA 4DYJA 1DC6A 3MFYA 1X1ZA 2QCNA 4FD3A 4I9HA 4ZZ0A 2QDEA 4BMNA 4JFRA 4IG2B 3B7WA 3K94A 2PD9A 3GUZA 4TV8F 5FLKA 4Q03A 4CKQA 1NT4A 1LBEA 4AD4A 4C29A 3HCPA 1E77A 2QTVB 3BGVA 3U4DA 2FFHA 4K6MA 1G4SA 4QIUA 4GBJA 4Q7KA 4CIVA 2I6FA 1FSGA 4OQMA 1SFTA 4TVSA 1MUMA 5JMPA 4BGEA 4OBBA 1JQDA 3PZRA 5KTTA 2YL2A 3Q37A 1T6BY 1VIYA 4ZQBA 3FUUA 3QTBA 5DXYA 1YRRA 4IP5A 4YP9A 3ABOA 4KR0A 1W1TA 1CNEA 1VPDA 2GM5A 1FWSA 3K46A 4GQAA 5FBZA 4FB5A 1WDWB 4HLUA 4KW2A 1YFZA 5FXMA 3WB9A 1PX2A 3ZTWA 1NDVA 4B73A 2G63A 4IRUB 2DKOA 2ZFAA 4KQ1A 4FCWA 1RK6A 5CA0F 1Z32X 1EUAA 3ETNA 4KIJA 1NF0A 2NUWA 1MAVA 3Q3CA 5KIAA 2X5JO 4P2VA 1TJPA 4J1SA 1E70M 1W3KA 1SVSA 4IPLA 1OLXA 3I92A 5H4GA 3GLVA 2H0RA 2V65A 2AKMA 5LNWA 2W2KA 2NO6A 5AVRA 4WBNB 2W2PA 2P0YA 3EAFA 3PBKA 1HO4A 2W00A 1YRWA 3AV3A 3AETB 3ANVA 2FPGB 3S28A 1WHTB 2WIKA 2H6RA 1ZGBA 1V1MB 1ZUNB 3QFHA 4EF8A 2EJAA 1G8GA 1XWWA 4AROA 1A8PA 4G0QA 4ZU1X 1JR6A 4CD8A 4D8UA 3AF6A 1E1EA 2C95A 3U09A 1G60A 2VDGA 3EZFA 1JAXA 3KKOA 4NV1A 5H91A 3GQYA 3RRFA 1OFUX 5B4TA 1XUZA 5REQB 4Q4CA 4WCJA 3UHAA 3S1UA 4RELA 1OBFO 3GJSA 1HQTA 1VPXA 4J16A 2RI1A 1XQXA 3DMHA 5T5QA 3OIWA 2VUYA 4HA1A 1V39A 3JYHA 2JL1A 3OHPA 1LH0A 2Q5OA 2EJCA 1VC2A 3L9CA 3TRDA 3FJOA 1NUHA 3RB8A 4EB6B 4B4DA 2H17A 4II2A 1QAPA 1MJ5A 3QXBA 2GOKA 2WAXA 2WTXA 4HTYA 3W7HA 6A3HA 2OCDA 1Z3CA 1KM6A 4D92A 1PFWA 4GXPA 2E77A 4ZXOA 2IYSA 3ZT6A 2YFYA 2YZNA 3G2LA 1XQVA 1PQUA 1X8XA 1I3LA 2GVEA 4DTIA 3TDMA 2XDQB 1Q12A 4DLRA 1LBLA 5AVZA 3M5VA 2WU0A 4FSHA 2OWWA 2PKYX 2XT6A 4TLBA 1H3FA 3S2NA 3L1UA 1XISA 1EQAA 3FDFA 1IUOA 3KKQA 4H0NA 2E40A 1XLTC 3Q88A 3UCXA 1LOSA 4QCEA 2XWDA 2BHSA 4C6TB 3B1WA 2V1UA 1UWUA 4HRAA 1C1XA 4Q8PA 4GLFA 2GN2A 2C2GA 3E9EA 1EP1A 3V48A 4MUEA 1LBHA 2MIIA 1V8OA 1VOTA 4WUTA 4ZAGA 3A36A 1SM4A 2ERCA 2QT1A 2H92A 3DKKA 3TI9A 3ZGXA 1CTNA 2XB9A 3CTTA 2QT0A 2OGSA 3LNTA 2GYIA 3C3BA 3PNSA 1GHRA 3R9XA 1AKTA 2D73A 4OMCA 5LDDC 1CVLA 1NBMD 1FRBA 5AO9A 5E2AA 3QPBA 1OX5A 5KCZA 3B9BA 4LQ4A 1JL3A 5HQ3A 3VHRA 4ZSUA 5BPFA 2O7RA 3SBXA 1G3UA 4BFWA 2I7VA 2VSYA 3ORYA 5KAMA 4B1FA 4EY8A 1CEXA 3O9VA 1C29A 3SKVA 3ZVRA 1XZFA 4KE7A 4BKNA 3U5YA 1URPA 5FJTA 5KHLB 3H1FA 5AVUA 3BD8A 2AAAA 5A1TA 1J06A 3E15A 2B7LA 4BI7A 5JSZB 4RVGA 1TCBA 4FR5A 4WXZA 3P3BA 4UU1A 3VAYA 2WF9A 1K9DA 1KETA 4L2IA 3ZWXA 1DKUA 5AVSA 1CUJA 2HOQA 3WBBA 4EGJA 1CERA 2BI8A 3Q7EA 3IIEA 1L5YA 2BG5A 4P8VA 2EBFX 1T36A 4EYEA 3O8AA 3HFTA 2WJZA 2A4KA 3T52A 2H2FA 2Q28A 4UPEA 1XAHA 1B93A 4NJIA 2C4TA 3ENQA 1HI9A 4CVNA 4U6NA 1LEHA 1QIFA 3IBYA 3WGTA 2CZDA 5HBGA 2DHDA 1B31A 2QT3A 2Q7OE 1UIOA 1LUCB 4GRIA 2W58A 3WSTA 2WVAA 4UZFA 4KBYA 3ZU4A 4UHJA 1CS4C 3COWA 4N8SA 1XP5A 3M41A 4IDEA 1C3XA 1DDIA 2HIAA 3ZHYA 1WMFA 5FV7A 1V43A 4E5UA 1I6NA 1JIIA 2JC3A 3H21A 3OWOA 4RYLA 4JEMA 1QB8A 3AFNA 3PUEA 3H53A 1TIKA 3BWCA 3C3NA 4Z42C 3IQXA 4KH1A 4XZHA 2JKVA 3OO1A 1HT6A 2NUXA 2GUYA 4S3MA 2WQ7A 1FDTA 1XQWA 5A3SA 4E1VA 1OF1A 5F2IA 3THCA 2P2NA 4XARA 3TKYA 4BNMA 1NUSA 4JN8A 2RH9A 3P9SA 4XZ3A 2DBYA 1RBZA 2PT6A 5JO9A 4K68A 2ZWPA 1JFFA 4JTFA 2B1QA 3JARA 2B7PA 2SKEA 1VS1A 1FQJA 3VK5A 3W5JA 2BZ1A 1OEPA 4DDVA 4QQFA 3N14A 1IMJA 1N8FA 2PTDA 4G2TA 1T2EA 3PWZA 4X3PA 3LX9A 3NJ3A 5CZKA 3OCWA 2QRMA 4MM1A 4BLVA 3GBSA 1JGMA 2CSXA 3G59A 2CERA 2G9NA 3VD7A 4L4XA 1DAPA 4A5OA 4QBFA 2JIBA 1XD2B 4XPZA 4BNXA 5KI6A 2O2ZA 3TIXB 3WQ4A 3RAFC 3KKZA 3LM8A 4YAUA 4IGHA 2DH5A 1FW6A 5FDFA 1OF8A 1H60A 1BDMA 5FHQA 5CT8A 4O2BB 1P1IA 4NBNA 1GKYA 1R7OA 3AXSA 4TLLB 2H59A 5IC4A 1JYXA 4BDSA 1P17A 4OV9A 1BYDA 2GCOB 4FWTA 2P88A 4LVNA 2RGDA 5DYYA 1GPLA 2TMYA 1R50A 2OCPA 3S5NA 1MQAA 1HNZB 1TYAE 5C55A 4IBOA 2WK1A 2WDPA 4IJUA 3RDPA 5BRPA 5CVJA 4F3RA 1BG4A 2EPKX 2QGZA 1YXYA 3SD7A 1VJZA 1XEXB 4OWGA 3AVWA 1R9MA 2AN1A 2IYWA 1OSEA 5EMMA 2KPOA 3H9BA 4CL3A 1ILWA 4AZ5A 4KKVA 4GQ0A 2VJDA 4PCTA 2FB3A 5CJJA 2D20A 3M1AA 1EUYA 3CNYA 4YNGA 3L18A 4ZIRB 3S5UA 1WUTA 2G76A 2GVDC 2NU8A 4RV8A 1XXLA 1G01A 4WNCA 2QN7A 3V2GA 3BH4A 2G1UA 1K7CA 1XRNA 1HL8A 4ZICA 1TA4A 1XI3A 3HZZA 4JTSA 1UC4A 1KFBB 3W01A 5J58A 1P4GA 5G1MA 3WENA 3KL4A 3OKCA 4WXEA 2YWCA 3FGZA 3LHKA 3MOGA 5AHEA 4U33A 4O3MA 3RS3A 2FB2A 1TJ4A 3UY4A 1UQUA 2ETXA 4K37A 1MA3A 4GBGA 4RHXA 3VDXA 2V0CA 5AW5A 4FKMA 1XK7A 4JD5A 1G5FA 2V5VA 1FFCA 5F5XA 4W93A 2BDTA 1NW7A 3IPAA 5BXYA 4JKYA 3A4LA 3ORFA 1JSRA 2WA2A 4C2AA 3MC1A 3OU2A 1H1LA 2BEUA 2B4TO 1AQFA 4GP6A 4RPCA 3TVAA 1T9BA 4DEFA 5ALZA 4RHTA 2L82A 4Y0VA 3EX6A 1IBLB 1MN6A 5HQTA 3TNJA 2FUCA 5IBXC 2W2KB 1DMSA 4Z2YA 3RUEA 3ZJ5A 2X1IA 3DR5A 1BVYF 5AI5A 1T24A 2A3AA 1G1AA 4MYAA 4L51A 2QCHA 3OPYB 3SYKA 4QGAA 3I2FA 5FBHA 4RF4A 3CN7A 3DUFA 1XYFA 3TEFA 2LDBA 4Q4QA 3O1HB 2ACVA 4YR7A 1CXKA 4MYTA 4UHHA 2IY9A 1EUCB 3CMFA 1FXQA 1VDMA 4J2MA 2Z7GA 1F6WA 4H04A 1OFVA 4UPVA 4K6CA 1SHUX 1IRXA 1QCDA 1F4AA 4IUBS 1EVYA 2PXXA 3WRYA 4GS5A 1ONOA 1Y6ZA 4X3CA 2Z29A 1M2OB 4KE6A 4PMZA 4QAQA 1CV2A 1YKSA 5CDSA 2RIRA 3SF8A 2PA0A 4RIEA 1WOMA 4B3KA 4DWSB 5ALHA 3DFOA 3R3SA 4ZEWA 4ER6A 1LJUA 3N3BC 1FP4A 3ARYA 3GJYA 1VM6A 4GXMA 5ERXA 1PSCA 4S2CA 1QQAA 5DGHA 3WNNA 1W1ZA 1AFSA 5H5JA 1TCUA 3KPWA 4ZQRA 3T34A 2P67A 3PDIA 5LUBA 1M7JA 5EQFA 3UCEA 1KMIY 4RHFA 5CFLA 4XGIA 2V2CA 1ISFA 3PLAE 2JGKA 4Y2UA 2DT2A 3IUMA 5FNVB 3OZ7A 3ECAA 2PAFA 4DLTA 4O52A 1RJ9A 2GBGA 2CBZA 5EXPA 3KWFA 3K4PA 2D0IA 1ZI9A 5JADA 3MHPA 3DTNA 1WEKA 4UNRA 3TAKA 1C3FA 1OCNA 1JNXX 4PMXA 1R16A 3Q0EA 2C2XA 4W5QA 1ZUHA 2MSWA 1GO2A 3NAZA 2J9ZA 1DCKA 1N2SA 3HF3A 1F4PA 1QAMA 4DBVO 2D2OA 2NO0A 2Q5CA 3BFVA 2CNNA 1AGNA 3RVSA 3KTAB 5I2UA 3KTFA 1CVRA 2L69A 2FTYA 5JH7F 2AN4A 2CLSA 4DRYA 3M0ZA 3HQOA 4IS2A 3W79A 4QRDA 3JZEA 5JCZA 3WJYA 2NO5A 3ANMA 3I28A 4IL0A 3HFSA 4QS6A 1R3YA 4PSDA 4O4JA 4MNMA 3M44A 4EGFA 4TTSA 3LCXA 3U61B 4WPGA 1CGUA 3ZD7A 2PSHA 3QBJA 1PFYA 3KLOA 1IEVA 1RRCA 3OY7A 5DMHA 4WXPA 1QPKA 1RR6A 4QUDA 3HMQA 4XFJA 3O8QA 1R2QA 1HT3A 4YP5A 1RK5A 3BQ9A 3WKDA 1ZIOA 5L3RA 2I4LA 2UYQA 1EYZA 3N6JA 1O5QA 1GRCA 4GKBA 5HFAA 4R1MA 5KYVA 5FV4A 4W7SA 3EOEA 1Q13A 4DDTA 2QY9A 3L8HA 3O6AA 1JHXA 3ZHBA 1LUCA 5JHGB 5DI9A 3A6LA 4QFBA 3PG5A 3OZYA 4QGFA 2SKDA 1MEJA 2Q3BA 5H8WA 4B5VA 1CGYA 1ONPA 1G3MA 4UM8B 2AG5A 1K89A 4C21A 2AFVA 4UE6A 5JY1A 1KO5A 3ZJUA 4N0MA 4TWZA 4K6FA 3D81A 1QV6A 4B84A 3UF0A 4ZCLA 1QLWA 2YA0A 3EBPA 1CWYA 1AVAA 1CXZA 4CMEC 1NXWA 3U19A 1PIIA 2PGEA 3ARSA 4LHEA 2UZ3A 5DRIA 2B81A 2JI7A 4JTLA 3HM9A 4OH7A 1WWKA 2O0JA 2DY1A 4OAPA 3HRHA 3RU9A 1JJBA 3EGJA 3RS7A 5LIUX 3R20A 1IJEA 5EP3A 3PG8A 4F6LA 4DR5B 4B5KA 3EPKA 4E14A 3BZWA 3BJSA 4AVYA 4OUKX 4JP3A 2ZUNA 3W29A 2YZ5A 3PUHA 3PC4A 1K4KA 4ARVA 2H5EA 2LD4A 1UKAA 3IBSA 2FPIB 2ZJ8A 3COZA 2FPGA 3FGPA 1IQPA 3QYQA 3S70A 2KMLA 2Y1KA 1GFWA 1SC6A 3MJMA 1J9ZA 3UG7A 1ODUA 4Z08A 3G0SA 3EXHA 3FWNA 4J4TA 4C5AA 1QE5A 2IDKA 1NJ8A 4C4ZA 2X5KO 3VX0A 5DVZA 1XZ8A 1FMLA 2V6BA 1BXGB 3EY9A 1MORA 2WMIA 1RADA 1KKRA 3PWIA 2VDLB 5DEOA 3CZ5A 1IXPA 1BVHA 1OQAA 2ZJ1A 4O54A 1VCHA 4ARBA 3NUKA 3HZHA 4M0FA 3FXGA 3C6BA 1NFPA 3GH5A 1CNFA 4F38A 3N0XA 2Y62A 3R44A 3HR8A 1VJIA 1TR9A 3A6EA 5LMNB 1S89A 3W86A 4R34A 2CGEA 4EI9A 4FFVA 4BBJA 4CEIB 1JJAA 2C04A 4HZUB 5AHRA 2VNIA 2M1ZA 2OENG 4DPQA 3RWMB 4AVOA 5KNBA 4MP8A 2WW8A 3AO0B 1TM1E 1UFQA 1OYVA 1P1CA 2JIZA 1A76A 1VG9B 2YHBA 3QXCA 3P9NA 2V3CC 4FDLA 3RVRA 2HI0A 5IJ0A 4O2AA 2QI9F 4Z4EA 3CM4A 1XZCA 4YMZA 5I8WA 4CR8A 3KKPA 3EGEA 3GH3A 2YYTA 1XP8A 3SJNA 3WNBA 4GKJB 3B60A 3A22A 1F14A 1UZ1A 3W9ZA 2D5LA 2YX1A 3MTBA 2IUFA 4WKBA 1MJGA 2PD4A 1VCOA 1A2BA 1EX6A 3OBKA 3ZLHA 1O95C 3NRJA 4CWAA 1ZRMA 1OG0A 3W2MA 6TAAA 1E5TA 3QLDA 4HLDA 1DWPA 4LKRA 2DR0A 4WDRA 1F0KA 4X1YA 1RHRA 1USGA 3TO5A 3A1EA 3NBYC 4HTFB 2AFRA 2CY0A 1ZN2A 3LFTA 1LBFA 3DMGA 1UMCB 7CGTA 3WFZA 4WESA 3D7RA 3N4AA 3B3FA 3FVTA 3W7EA 4COOA 1FEZA 2O9PA 2G40A 1RI5A 4DZ5A 4RJJA 3WL5A 3AR4A 2BT4A 1MZHA 3DXXA 3A4VA 1E9LA 3UJ9A 1GEQA 3RVQA 5DCWA 4IZIA 2QJGA 3OYZA 4KO8A 1V6UA 2QROA 1S2IA 3NBUA 2HMTA 2H3HA 1F2UB 1P1HA 1XRVA 3W7PA 3E22B 1XNHA 2FHFA 1SWWA 1XPYA 2QJWA 1KFBA 1HYQA 3GNPA 2FFCA 1SB9A 3AR3A 1HTBA 1IWAA 1H9CA 3GRZA 1HLPA 1H1DA 3C24A 2H7CA 3HQNA 1C30B 2OKGA 3O9NA 3KX6A 2MUCA 1AL7A 4JFUA 3H4IA 5DXAA 2RK3A 3DOCA 5DF1A 3BAKA 4TV9A 4IQFA 5AC5A 3MA8A 1I7DA 4YIKA 3Q65A 2Z4TA 5H3HA 5J59A 4FB7A 3L5AA 3GAMA 4IZGA 4OZOA 2DFKB 1O60A 1GG1A 2BEKA 3QOFA 3ROEA 1Y6RA 3A6KA 1YQGA 3AIVA 3ZKWA 1XW8A 3PDHA 1D6NA 2PCEA 3NGMA 1AURA 4DIEA 4C6EA 2L2QA 1GTJ1 1PT9A 2W6NA 4C1LA 1J0IA 4F3YA 4N5NA 4OV6B 3EXFB 4QBKA 2J9YA 4TOIA 3IDQA 5L53A 1MB9A 3DT9A 1KM0A 1VRCA 5DHSA 2A33A 3U40A 4Q7NA 1N82A 4XIJA 4F2GA 4XUGB 3L1IA 4DB7A 2BOEX 4A0GA 4ESEA 3ROXA 5HPYB 3RF9A 4OFWA 1QGDA 3GMTA 1E18A 1UQZA 4XWGA 4CYMA 2AIRA 1VJTA 4MV6A 4URYR 1X8LA 1BOOA 1R47A 3Q3VA 1MXGA 3VZDA 1Z89A 4QUBA 4IQEA 2GWGA 3G7UA 4UDOA 3R3HA 1JMKC 1R4MB 1N6PA 3L8FA 1J0JA 3IJDA 4Q8UA 1GGOA 1UKCA 4X24A 3MVTA 5KYYB 1YWGO 3I3SR 4L4MA 5FSDC 2CE7A 4JYPA 3T9CA 1TA0A 1J2UA 4WESB 3HWWA 1S4MA 4WXRA 3N2OA 2JLZA 5DN1A 1ZLYA 1E20A 4KMMA 3A6JA 1VBMA 2I3ZA 4PZUA 1KVTA 4BIMA 1W36B 1SO4A 3FZNA 4MQEB 2EWVA 1WP9A 3B3QA 4FFNA 3LUPA 1SC1A 1SW7A 1YEYA 4C7KA 5ECVA 2BVTA 1P6QA 2BZ0A 2WR8A 4D6FA 4ZDIA 1UZMA 5HQMA 1SUEA 1BKSB 2AC7A 4FO4A 4LU0A 3PT5A 5G1YA 3SZMA 4WY8A 3F6CA 3CRRA 1NA5A 3HFYA 4R51A 1K70A 1WHSB 1GVYA 1NPYA 3C0QA 4NZ1A 1P73A 1XIVA 2QLJA 3F4CA 5JWHA 3SLKA 2F4VB 1FS4A 5T4HA 4AQLA 5K4XA 2RHHA 5TLSA 2PMBA 4RC9A 2RGNC 3KBBA 3IAM1 1XIFA 3W2NA 1C9WA 3F6SA 3NVMB 3WLIA 1Q6OA 3TBHA 2BFDB 3SBEA 5KJ1A 1HXHA 5F1OA 1BA3A 4P7GA 1SFRA 3WNKA 5F3DA 3Q8XB 1RWKA 4WH0A 3IV6A 3DEIA 1QQBA 3KFTA 3W6YA 5CB4B 1N9GA 4CLDA 3SFVA 5AVVA 4F71A 2VUNA 1HDZA 2CC0A 4Z0PA 4MIYA 1VA4A 1WZEA 3IDFA 3Q98A 2A0FA 1SCUB 2VEPA 2P11A 1P62B 4Z49A 3FNQA 4YRGA 1EVLA 4EX7A 1JZ2A 3GDKA 2GN6A 3H70A 4RUKA 4MLRA 3WKCA 3D3AA 3RT1A 1QCYA 2BGTA 3RO6A 2HRQA 1XRJA 3IMEA 4PNHA 3AB8A 4R85A 3X2EA 3FKSD 3HB4X 1N1MA 3ITKA 4QEDA 1VMAA 4X84A 3ZE1B 1DJNA 3RIHA 1KRCC 1JYVA 1RJFA 4OMFG 5I9BA 4YJ2B 2NV0A 4OL9A 4E3WA 2ZB4A 1QAOA 4J1NA 4JT4A 3KK0A 4P82A 4KRXA 3P9PA 4MHTA 2ZVRA 1C7IA 5BR8B 1AE1A 3UA3A 1ORRA 3HG7A 4NABA 5JJKA 1Z6ZA 4HWRA 1D3CA 2ODOA 4IZOA 3LSYA 3FVVA 2HQBA 1DOHA 2GHQA 2X77A 2UUBB 3F5JA 4DXVA 3FYCA 4KFRA 3AVQA 3RU3A 1S4QA 2ZTLA 5AIAA 5FO1A 3LU1A 4D0GA 2POCA 1R9JA 2NTEA 4OYYA 1OH6A 5KEIA 2GZAA 3Q4GA 4CIXA 1MO4A 4R16A 1FYVA 1RQGA 2I76A 5J5VA 5KZMA 1MW1A 3ZD9A 1J24A 1XLIA 2QN6A 1AK5A 1KVQA 4E4TA 2FRDC 4HAZA 2HK8A 1TUEA 3VVBA 1Z5NA 4WX2A 2II6A 2XTMA 4NU0A 3E1GA 3LQ1A 2I56A 3STYA 3JALA 3KXPA 1E96A 3F8TA 4YT5A 4ORIA 4I9NA 4HGYA 4KFUA 1EM8B 2HXTA 2BF7A 2XUQA 1XAIA 4RKAA 2IYAA 3LPLA 1QDEA 3JQAD 1QBKC 4BBAA 2ATIA 4QECA 3WJAA 2HC9A 3FYTA 3HU1A 3FNFA 3FHCB 1NPTO 1G9TA 3MJEA 1SVKA 4UQCA 1QDLB 2HWKA 3GZNA 3PYMA 1H7XA 4GIAA 2JI9A 1OFBA 5FIPA 4RZ3A 1PR0A 4ITRC 4XGKA 3GG1A 4A4DA 2ZC1A 1TX4B 1CZRA 1T96A 4MF4A 1KI6A 1RIIA 1QHEA 1PJBA 1TO6A 1QE3A 3OHMA 3G5UA 1HG3A 4G0UA 1M54A 4FTWA 5KINB 2CEQA 3BAXA 4ORMA 1J07A 4GOND 1EPXA 3QKSB 7TAAA 3TNOA 2YWEA 1W8DA 4OQPA 1M34B 1GZDA 4JC4A 5KNCD 2VDOB 3WNQA 1G8SA 5DBHX 2OSBA 3FA5A 4EHIA 4BFSA 3NL3A 2OFWA 4RSHA 4R8KA 4ZALA 3DV2A 5FR1A 1O6IA 3PEYA 5JDCA 5BW8A 4BJHA 2GVGA 4PO3X 1J39A 3TUIC 2BFNA 9LDBA 2DVMA 4H18A 1STOA 3S5SA 5AKJA 3L4VA 1W75A 1TO1E 1Q5MA 3P60A 1D6JA 5AM2A 4S35A 5CSSA 4DLAA 3RR1A 3DLIA 4AJKA 5IAAA 4E3ZA 4CUJA 4R7JA 1UQTA 1SAYA 1ZUD1 2FLKA 3ZY2A 3BB3A 2PX2A 3WYNA 3KKNA 3NHWA 1Q6GA 5EQJB 5CFOA 3MM4A 1KSGA 3ZWVA 1QJ4A 1GAWA 4J40A 1XVVA 4PZAA 3LB0A 4QJ5B 4JXCA 4HPXB 1TIMA 1NZDA 1V5IA 4JJFA 1J2YA 1M8KA 4ZCRA 1WE5A 3D9QX 5KVVA 3QY8A 2WHPA 2OBYA 2CBGA 4HQ0A 3PEVA 4HWPA 2RAGA 2I6TA 1C0EA 4Z0NA 4LUIA 1EDZA 1PTAA 4JY7A 2ICSA 4BUCA 3AX6A 2UZ9A 1M9HA 1KYQA 1M1ZA 1W5FA 5F4SA 3LSTA 4HPJB 5JTUA 4GOLD 2PL5A 1T40A 4BJ5A 4HTAA 1JLKA 5U7SA 3P8JA 2YXBA 1RACA 1LSSA 1FMJA 5L4NA 4MRPA 4R6XA 4F11A 1ULHA 5BW4A 2OHXA 2ZKMX 4JYDA 5JEDA 2GA8A 1B3OA 1FL9A 1MAUA 4UEWA 5JFTA 2VJNA 2C20A 1UIRA 5EJFA 4DLPA 1C7TA 1U3VA 2QL6A 3BGJA 1FLVA 5FA5A 3BJEA 3KVRA 2ZIGA 4EGCB 2WJFA 3MTAA 1X87A 3JAWA 4CI9A 3PD0A 5AKQA 1SELA 4Y2XA 3RU7A 3CBWA 3DWFA 2IYQA 1RRVA 2ZIFA 3I5YA 4B46A 1OSNA 3NBXX 1RLMA 1YNOA 4CQCA 2VHYA 1PX4A 4CG3A 4D6XA 2CXSA 2JRLA 3ZWDA 5LR6A 1C7ZA 3NPWA 2VCAA 2F00A 3JWHA 4GH1A 1HRDA 1H4VB 5DYWA 4ACYA 2XBLA 3ZWQA 1GXSB 1N8TA 3OQBA 3DOPA 3T1GA 5ABFA 3PA6A 3GLRA 4J9UE 1QWOA 2I4RA 5C5YA 2XDWA 2VHQA 3TQHA 3RYFA 1N3YA 2Z2IA 4ZT5A 2LZ0A 4CD5A 7ENLA 5MGNA 5F5LA 1OZQA 2WV7A 3UICA 2WPNA 3SQWA 1CEEA 3A9IA 3CNHA 1AL8A 4J29A 3OOSA 2GEFA 4NZJA 3VA7A 4DLFA 3SGLA 2PMQA 1BZYA 2VDWB 5DU2A 1RHUA 1YPIA 3R7WB 4DIAA 4HMQA 3R5HA 4S1TA 2PGIA 4FLMA 3TP4A 5BXPA 3P14A 2BR4A 3JUGA 5CDFA 1A5SB 1P5RA 2DZSA 1NBOA 3GS6A 1EFRD 4WUVA 5TQ2B 1EK2A 2HN9A 4L9RA 4BWFB 3LX5A 2DTEA 5I4CA 5TVGA 1SIOA 3HC7A 1V4YA 4C0QC 2C8LA 3SEAA 5L6UA 1RYZA 4LZNA 3B0XA 3FGOA 3UNTA 3R5SA 4PEVA 2YXEA 2CVFA 3BWEA 2DQYA 4ZP1A 3F2BA 3U57A 4LCBA 1ND6A 4GLOA 3H2AA 3OZRA 2GVNA 4AYWA 2C0PA 2W2VA 2JHPA 3AGPA 2FQYA 3STHA 3U7RA 2VDHA 2FJUA 3ACBA 2PO7A 4HADA 2V9CA 2WKQA 5CCXA 4FX5A 4V0NA 5I3KA 2XUZA 3TK1A 1ZD1A 3EAQA 1XHGA 1V6VA 1R64A 3EIFA 5KYUB 2Y0BA 1FFXA 3G49A 5CVUA 2ATVA 4BC1A 4NSBA 5IRCD 1EJ7L 1UH5A 1OAOA 1I2PA 4IXDA 3OPMA 3OLWA 2QKFA 3L0ZA 1X14A 4OQXA 4WOZA 4JBXA 3ZJTA 2CJWB 2XFWA 4HVCA 1V3QE 4FS8A 2FZBA 4CT0A 4OSEA 2QUNA 3DE0X 1FP6A 1QO2A 1F20A 1ZSNA 5EZYB 2GFHA 2JGRA 3CZEA 4H60A 2QPUA 1HYBA 4NVTA 4CEHB 1YDHA 3H7UA 4IL5A 5PGMA 2JCVA 2E8ZA 2E9SA 3FW6A 4CFYA 3VGDA 3B51X 2Q3MA 2E5BA 4DQWA 1VIDA 3LDGA 2O4CA 1JZ3A 1AIPA 4O16A 4BLSA 1KXHA 3DBHB 1XDMA 2CLPA 4DX3A 1TJRA 2AG8A 4FGLA 4M86A 1A97A 1LLQA 2XU2A 1JJIA 1XLGA 2B94A 3W1RA 3HU5A 3OFNA 1AA6A 2FWIA 4Q8VA 1F8MA 3PZTA 1U9IA 5CFZA 4JJGA 1FX0B 1FJGB 5C7YA 2NUYA 1RYNA 4DY1A 4O2AF 1L8QA 5EUBA 3S1XA 4NICA 2FPLA 3CXRA 1BHGA 1NT2A 3N18A 4GDMA 3RR4A 1M2WA 1BVRA 3HCOA 3U2EA 2UDPA 3LHFA 4H7JA 3O82A 1QP4A 1XNQB 1AJEA 4NLLA 1PB0A 3IUDA 3G13A 4POAA 1YMYA 1H2HA 3ZVLA 3DVAB 3N8KA 4RD4A 5IAGA 3TW0A 4CEJA 4V1CB 2XAUA 3PF9A 4X65B 2XUPA 1PV8A 4Z2GA 1C8QA 3MJTA 3WQ8A 4AEFA 2DWQA 2VRKA 2YDYA 2WC7A 3N9RA 3PR1A 5T57A 1IM5A 3PX3A 2Q5JA 4QG3A 4W87A 4WL0A 4CKXA 4Y1FA 4DF3A 1I51A 5TT0A 4GMFA 5C8BB 5EBAA 3C7KA 4IUDS 3UWVA 2GBIA 1WV1A 2NZWA 1F2DA 5D32A 3UJCA 5CYGA 3N7TA 4WZAE 1ZA2A 4TXHA 1VCVA 4NK5A 4X90A 4HA4A 4X3ZA 4LCJA 5BR1A 2X0NA 3TBFA 4U28A 3AIIA 3GDTA 1HURA 3EDDA 4WERA 2BGNE 4MUHA 3J7AC 1EGMA 2YX0A 2JKZA 1YRYE 1RAGA 3NKVA 3WFLA 1VP3A 3HYSA 2HS6A 2JA1A 5BWFA 3U16A 2GGGA 5C4IA 2OHJA 3HU7A 2Y8UA 4MTCA 2R85A 2FFRA 3QOMA 1W8GA 2IZ1A 3L02A 3H75A 3AEXA 4ZJUA 4FT4A 3OIHA 1XZLA 5H9VA 2GOUA 3EDQA 1KJNA 2VS1A 1TKAA 3VJKA 3IMKA 3L12A 1GKRA 1C9JA 4G1NA 2F61A 1K68A 1V16B 2XOKA 1ZRSA 3BMVA 1FQWA 4TX6A 3S1WA 2EFHB 3X1KA 4JIRA 1ACLA 3VA8A 4EMSA 1PU2A 2I4MA 3OFSA 1MCZA 3IP3A 4IWYA 2RGMA 2BAGA 3AKEA 1I7PA 5FOQA 4JTHA 1K5GA 1TVKA 4Y9PA 2ZS8A 1S01A 2BFCB 4C7MA 3LT2A 3NZPA 4A5SA 4E09A 3HVUA 1F8IA 2CK3A 5JBFA 3VE9A 2E55A 4E2BA 3P9QA 4YJDA 4R5EA 4BLQA 3E81A 3AR6A 5HYVA 3L4BC 3AY7A 4JLUA 4D5GA 5E6YA 1MO5A 3HV9A 1SCUA 3E48A 4C07A 5BRQA 4ROSA 2ABBA 4H6QA 1JRCA 3HG4A 2IEIA 3W27A 3K30A 3BH0A 1QRQA 2ZYIA 2NQZA 2C5LA 3LWZA 5CIYA 4QD3A 5HS6A 1RKVA 2G9ZA 4FYXA 3A5VA 2BGUA 2NTYC 2ZADA 2A5JA 1CR6A 3RHTA 2WICA 1G6CA 2V7PA 3DAGA 4HWKA 1U33A 2VUIB 1TIPA 4ZYVA 4XSHA 1EHIA 2CLFB 1E2JA 1P7WA 5CR9A 3KEOA 3BWVA 2QD2A 4H3HB 1KPHA 1XF1A 2FG7C 5CLWA 4UHCA 3D6UA 2NV6A 2JKYA 3AVYA 1ZMTA 3K9WA 3ZQ9A 1IEQA 1FWGC 2IYVA 3BTVA 3TVYA 4B79A 5AHKA 1JCNA 2BKEA 3PB3A 2R1UA 5CB6A 3QG5A 3EF0A 1FWTA 5CB8A 2JFNA 5FWYA 2OCLA 4HRXA 5CG7A 4M38A 5JS8A 4FK8A 3WJZA 3MUXA 3BXZA 1G8AA 4KL8S 2AF3C 4HF7A 3VR4H 4AUEA 2ATMA 3DDMA 4K26A 3EKZA 3QGVA 2Q5HA 3NTXA 3ARQA 4AU0A 5AK5A 1K88A 1P9RA 1QRSA 3ABOB 4YRIA 3UWQA 1ECGA 4ZVOA 4HDMA 2H1CA 3L8GA 2NX9A 2EL9A 3DEHA