5FJJA

Three-dimensional structures of two heavily n-glycosylated aspergillus sp. family gh3 beta-d-glucosidases
Total Genus 302
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
302
sequence length
839
structure length
839
Chain Sequence
LAYSPPFYPSPWADGQGEWAEVYKRAVDIVSQMTLTEKVNLTTGTGWQLERCVGQTGSVPRLNIPSLCLQDSPLGIRFSDYNSAFPAGVNVAATWDKTLAYLRGQAMGEEFSDKGIDVQLGPAAGPLGAHPDGGRNWEGFSPDPALTGVLFAETIKGIQDAGVIATAKHYIMNEQEHFRQQPEAAGYGFNVSDSLSSNVDDKTMHELYLWPFADAVRAGVGAVMCSYNQINNSYGCENSETLNKLLKAELGFQGFVMSDWTAHHSGVGAALAGLDMSMPGDVTFDSGTSFWGANLTVGVLNGTIPQWRVDDMAVRIMAAYYKVGRDTKYTPPNFSSWTRDEYGFAHNHVSEGAYERVNEFVDVQRDHADLIRRIGAQSTVLLKNKGALPLSRKEKLVALLGEDAGSNSWGANGCDDRGCDNGTLAMAWGSGTANFPYLVTPEQAIQNEVLQGRGNVFAVTDSWALDKIAAAARQASVSLVFVNSDSGEGYLSVDGNEGDRNNITLWKNGDNVVKTAANNCNNTVVIIHSVGPVLIDEWYDHPNVTGILWAGLPGQESGNSIADVLYGRVNPGAKSPFTWGKTRESYGSPLVKDANNGNGAPQSDFTQGVFIDYRHFDKFNETPIYEFGYGLSYTTFELSDLHVQPLNASRYTPTSGMTEAAKNFGEIGDASEYVYPEGLERIHEFIYPWINSTDLKASSDDSNYGWEDSKYIPEGATDGSAQPRLPASGGAGGNPGLYEDLFRVSVKVKNTGNVAGDEVPQLYVSLGGPNEPKVVLRKFERIHLAPSQEAVWTTTLTRRDLANWDVSAQDWTVTPYPKTIYVGNSSRKLPLQASLPKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-GLUCOSIDASE
publication title Three-Dimensional Structures of Two Heavily N-Glycosylated Aspergillus Sp. Family Gh3 Beta-D-Glucosidases
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 302
structure length 839
sequence length 839
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
A PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain
A PF14310 Fn3-like Fibronectin type III-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.300 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase, family 3, N-terminal domain 5fjjA01
3.40.50.1700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycoside hydrolase family 3 C-terminal domain 5fjjA02
5BU9A 4ZOEA 3BMXA 3WO8A 4GYJA 4GYKA 5G1MA 4IIGA 4ZOBA 2X42A 4HZMA 1IEWA 3U48A 3NVDA 3GSMA 5BZAA 4GVGA 4ZO6A 1IEQA 5FJJA 4I3GA 3ZZ1A 3U4AA 4ZO7A 3WLSA 3WLMA 4GVIA 1J8VA 4MSSA 3USZA 4I8DA 1LQ2A 1IEVA 3RRXA 3WLIA 4IIHA 5TF0A 3SQMA 3WLJA 4IIEA 4ZO9A 1EX1A 3AC0A 3TEVA 1TR9A 3GS6A 3WLOA 2X41A 3UT0A 1X39A 1Y65A 4IIFA 4ZODA 5IOBA 3ZYZA 1X38A 5C0QA 4GVHA 3ABZA 3WLTA 4IIBA 3WLLA 4ZO8A 4YYFA 5FJIA 2OXNA 4GNVA 3WLQA 3WLPA 3LK6A 4ZOCA 3WLRA 2X40A 4IICA 3WLHA 1IEXA 4GVFA 4G6CA 5JU6A 4IIDA 3WLKX 3WLNA 3SQLA 4ZOAA
chains in the Genus database with same CATH superfamily
1T91A 3JYOA 1JMVA 3KZXA 2F9RA 4QIHA 3AUAA 3W7DA 3VM6A 3TK7A 4C01A 1XMXA 2Z2KA 3W4JA 4PIVA 1PTKA 3AHYA 3RHGA 5BSKA 1WPXA 2VDHA 3MA0A 2QP3A 2QYGA 4Y8VA 5FJPA 4MZ1A 2VHCA 4KFPA 3WLIA 4MQMA 2INGX 3QMWA 1EJUC 4FFLA 2NX3A 4UQOA 3TQSA 3SHOA 4DCTA 5I0DA 4FGUA 2PDWA 2QPLA 4H17A 2VVTA 2OQLA 1GG5A 1IJBA 1RIFA 5FAJA 3PCRB 3L8GA 1C9YA 3PPYA 2VFGA 2A3AA 1YDGA 1ITCA 5CJMA 3LUDA 5J2UA 5CLLA 4KXWA 4NU8X 5H81A 4LJYA 4LAUA 5D2CA 2M1ZA 2DE0X 3ZCUA 5F4WA 3GV0A 2HU5A 4X90A 3QPWA 3S99A 2QPXA 1KD0A 4FR0A 3E96A 1Y7IA 5I4IA 3W07A 4QLKA 5SY9A 3VMFA 2FZBA 1CP3A 2LKCA 1GT91 1VD6A 3QWIA 1SVWA 4ECAA 1ATZA 2H2IA 2IOFK 2YVQA 2YYSA 4JTUA 4WIAA 3AO0A 4O0LA 5T4HA 4JPGA 2CLPA 2VT3A 4BNYA 2Z08A 5ALDA 3EPJA 1MJFA 2DCMA 4C0KA 4P86A 4JTCA 1SO5A 2PYIA 3I4CA 3ITNA 3COSA 1VIMA 2VWPA 4AWTA 1QOPB 2AD1A 2WLTA 3G8BA 3N0RA 1G8FA 1EB9A 1RD6A 3QVVA 2VELA 2XGSA 3FTDA 3E3AA 2IIVA 1NW4A 1DXOA 1GZHB 3ZV5A 4F4DA 2XISA 2QDEA 1FA9A 1ZD3A 4EUFA 1HTBA 4YHEA 2VCAA 2JKAA 2EZTA 4A26A 4C87A 3TRFA 3BCFA 3PBWA 3IPXA 4BV8A 2O7NA 5DMHA 3L0KA 1V8BA 1NSJA 4ISBA 3QM3A 2WSBA 3LBHA 1GU0A 4JGGA 3IAM6 1CENA 4CJXA 3L12A 4XBSA 4IPNB 4L6IA 4G4IA 1G94A 4JTTA 2YA1A 2JGJA 3COPA 4BFYA 3T07A 5JVDB 4PGLA 1IM2A 3K4PA 1MGOA 1VE9A 4JBGA 2FKAA 2AZTA 4FLQA 2JFEX 5H1WA 5K3OA 4DQ0A 3I2JA 2YS7A 1N6LA 3BXOA 5C7LO 2YWCA 1QJWA 4AZHA 4CCSA 3FNDA 2VT6A 3CPJB 4K1LA 4HAVA 1J9ZA 2PX8A 3WR5A 5M29A 2C19A 4MX8A 3O5AA 3E0LA 1EFAA 3MC1A 4BO3A 1BMDA 1AUPA 3RAEC 4JVSB 2DZTA 5IXJA 1M41A 3W6LA 3V55A 1QXSA 2PKWA 3AEQB 3LA8A 3JASB 3WL0A 1QIJA 2J1LA 4GJIA 3GU2A 2P4HX 1BU5A 3QJGA 3DFHA 1AZWA 4JITA 4YRCA 1PEDA 1OT5A 2OXFA 1N25A 2HHHB 3IRDA 3HGSA 4H7FA 1TQ8A 1DQXA 2FW9A 2ADMA 4YLYA 2YDYA 1XTTA 3LGXA 1K3UB 3WDJA 3TIIA 2FN4A 1JZ5A 3JUGA 2FPMA 2GJ4A 4CIBA 3SADA 3ZU6A 3ZD9A 3R24A 1ZMOA 1VHTA 4KAAA 2FWIA 1J10A 4YU1A 1ORVA 3CSSA 1XLWA 5EXPA 5JU6A 2CE2X 2PDXA 3FA4A 4HS9A 2H1FA 6GPBA 2WICA 1M3SA 1UPAA 5A0FA 3CZ5A 4IOLA 1Z6AA 4JYCA 5JAZA 4MPPA 5KOHA 1JR6A 2GKGA 1QRRA 2VNIA 2DM6A 4WECA 1A9OA 3ZHQA 1UQUA 1UPUA 3QHPA 5U9CA 2NN3C 3OCYA 1G5TA 3W3AA 3LQGA 1WV0A 4JQYA 1C0EA 2CEAA 4KWEA 3E0IA 2MHCA 4NT0A 2QKYA 4FHDA 4YV7A 1KYIA 1F2VA 2YNMA 2BRUA 3STXA 4A2PA 4NYIQ 3GEBA 1H94A 3HYLA 2UXDB 3KL5A 5G5IA 4Q9AA 2P10A 3VIJA 2BFEB 2R4TA 2ZT7A 1APBA 2BFPA 4LY6A 1I2OA 1QO0A 4QPZA 4RK8A 4EGSA 3QVGA 2HB6A 1Y5IA 2GPNA 1Q12A 3FEMA 1SIWA 1A2BA 4RR4A 5CDSA 1G8GA 1K3FA 3A21A 3FLMA 3PVZA 1EHAA 3R0ZA 3V00A 2R62A 1TPB1 1CQWA 3M49A 3G88A 1JQXA 2CXTA 4DA4A 3ANXA 1BSIA 4KGVA 3CEUA 1VBHA 2VDKB 4MUGA 2NTVA 3LXXA 3GX1A 4ZOAA 3GFOA 1UJ2A 4KKXB 5I9SA 1XNRB 2SECE 3GUGA 4M6WB 1VL0A 4ZMGA 3OE7D 2HMWA 3JQ6A 1M5TA 2EG7A 4GP9A 2DZWA 1QK4A 3AUUA 3FMOB 5IBCA 5F73A 1P1KA 4RADA 4PWZA 4MPDA 1US2A 2TRSB 3CO0S 2OFXA 4IJQA 2XWDA 4ZJPA 4N9EA 4YNGA 2YMPA 4C4XA 3MBDA 1LZLA 1SXJB 5HATA 4KMSA 5CPFA 6CGTA 2QTBA 4GQIA 4EFKA 1FTWA 4RW3A 3F7JA 2E6YA 3QV8A 4Y0NA 2AC4A 2NM0A 5EZ5A 1M1XB 1R0WA 3KZ1E 3O4JA 4QUAA 4CQAA 2RHWA 4ZYTA 2DGAA 1JI1A 4FTWA 4QGCA 4DJEC 2R91A 2IOQA 3I6BA 1SMDA 2A0FA 1GN8A 3B04A 1HNZB 3ZT7A 5H9WA 2O2IA 5ABPA 1T6XA 3LE8A 3E7DA 4OA8A 4RTMA 3GRUA 2OHXA 3KOZA 2PQMA 1E3WB 3OJLA 2FE4A 5EFDA 4C7MA 3CRMA 3WD2A 5A5DA 3GWGA 1NBOA 4HHPA 3DVAB 4X1YA 3I04M 1ISMA 1WCIA 1A8IA 2YZGA 1NA5A 1IRIA 3OJXA 3HU2A 4JHOA 1U2PA 2WAMA 3IOEA 3GBPA 1TZMA 3KG2A 2BZ0A 4H3SA 5IDWA 4HAXA 1UINA 4IXWA 4URUR 2NO1A 3Q5EA 1YB4A 4JROA 3AVXA 4YDSA 3TSAA 4BA0A 2WJHA 3VKFA 5LA6B 3VZDA 3R7MA 4JUAA 3H11B 2ZUCA 1WX0A 4ASUD 1RI3A 3W90A 3DBIA 1PR3A 1DJNA 2WC3A 4OGKA 1QPRA 5A6KA 1U30A 3TI7A 4YRFA 4S04A 1CXEA 3W9BA 1YQ2A 5IAJA 4PPQA 4ZEXA 1S8AA 2Y7EA 4NYIR 4UREA 3NH6A 2FQQA 2WCAA 2Z8YA 2LCQA 4Z17A 1DJWA 4EK9A 3KD2A 4O25A 3TW9A 3GT3A 1Y7TA 3U9SA 1L4YA 2DSNA 3IXMA 3EW7A 2H51A 3OM9A 3O63A 3UATA 5JD6A 3VU9A 4G1KA 4DF2A 1YZUA 4FUQA 4ER7A 1NRIA 4ZAZA 3MHTA 5EHZA 3PU6A 4KUEA 5JAOA 1VSTA 3ZGOA 1OWOA 2C14A 3D6JA 4MAMA 3V4ZA 1WAWA 4WY0F 4XBJA 5HF5A 4MV6A 1ONEA 1E0JA 4GC9A 5IM5A 2PRZA 4AURA 4CF4A 5I7WA 3WI7A 4F0HA 2VEKA 1MDFA 1WTCA 4R1QA 4GQ0A 2BHUA 1FRQA 5C0OE 1PDOA 1XXHA 3VKUA 3ND5A 3U4HA 3UUWA 4AZTA 3F8TA 1WZLA 1EFLA 3DV0A 3LTPA 1OCJA 4ZO7A 3CHFA 5J3JA 2QUAA 2B98A 3WK3A 3OU8A 1DJOA 1OIFA 4TV8B 1C3EA 1P72A 4FJ2A 3EASA 4A4DA 4MUHA 4P8XA 2A4MA 4CM4B 4UTPA 1A2OA 1M1BA 1OW3B 2WB5A 3DFZA 5DNCA 2DZVA 3EFEA 1KNQA 3UTDA 2H1CA 3U39A 2C1XA 4E4PA 5ITZA 3VR4D 2BMFA 4TVUA 2DZUA 4MR7A 4KYIB 5G40A 4HD8A 2Z8YM 3OIXA 3II1A 1RQRA 4V0OA 1Y7HA 2AMJA 2QT0A 2W6RA 4IMRA 2CXSA 4X3ZA 1PVVA 4RE2A 4JMPA 1NQAO 1R3DA 1G6OA 1SQFA 3W7EA 1UBJS 2RC5A 3IV8A 1X15A 3WK4A 3IQWA 3Q58A 3OBEA 1X1NA 1YRQA 1JPDX 2I1WA 3BRWD 2J9ZA 3OSZA 4F2WA 3UK0A 2XX3A 2CWWA 2HRRA 1RYEA 1SJDA 5CH5A 4O4LF 3FMGA 1EA9C 4MUXA 5BR1A 1OFUA 5ALKA 4F97A 1KBLA 4Z7JA 3PWAA 2YB1A 1G7VA 5I7VA 2V7VA 2HVMA 2OG2A 3SC2A 2OYCA 3PGXA 3I0MA 3KJGA 3GUYA 1R12A 4E32A 1OFEA 1Q20A 4TMBA 3TZLA 4QQNA 3JVDA 4P32A 4GSLA 1DO2A 2PKRA 2NVOA 4P3OA 3BWVA 1Q65A 2WI8A 2W3ZA 2XB2A 3VYUB 1PJRA 3OZWA 5AM0A 3AR9A 1ZK0A 4DG9A 5JJCA 1LPMA 3W7NA 2WJPA 3D3QA 5GWXA 2EIHA 1J1UA 4BLWA 3LU2A 1QTNA 1XDGA 3PC7A 1PWXA 1VE1A 1PR2A 1CYDA 4PO3X 3FYDA 5F7ZA 3EVNA 4NMLA 3NAGA 4RXGA 4RTKA 2EC5A 2GCNA 4ZB2A 3SDOA 3CS2A 3KBVA 1T8PA 3G13A 4PSKA 4MQ4A 1Q13A 3GG2A 1NWSA 3BOLA 3TCEA 3EZXA 1Y5MA 2ZIXA 1H05A 3PDUA 1VQTA 4GO9A 4GX5A 2CLHA 3QUAA 3N6JA 5LGZA 5DK6A 4BMYA 2VPXA 4DSAA 3BGSA 3VKHA 1JDTA 3O8LA 1YRAA 2J3QA 1ZGGA 5D4YA 4LVGA 4AX4A 1NHGA 3I42A 3WKCA 3JQ7A 2HWGA 2Y2UA 3QN3A 3IP1A 4BQRA 1M2GA 2BMEA 2J07A 2QLTA 2QTNA 1C8YA 2DZXA 2YLAA 5KINA 1SXJE 5H91A 4U2KA 5I9IA 1KYWA 2G9ZA 2GAOA 5EXSA 4X2RA 3WH6A 4INFA 1SK8A 4E2XA 5HYVA 1T4CA 2KPOA 3INNA 4UFLA 4YEDA 1LCIA 3T7TA 4QZVA 5EJ8A 4D3YA 7GPBA 1QE5A 4ZCRA 1XC4A 4P8VA 1NN1A 3D8UA 4LGYA 1GPKA 2BFMA 3V97A 1AO0A 4Z49A 3EODA 5GADl 1A7JA 2X1MA 4F3CA 5E1MA 3CQHA 5JS7A 4BL5A 2W2MA 1C41A 4BATA 2Y0PA 3W8DA 3PS9A 4TT3D 4ACAA 1TYDE 3B9NA 3DFYA 3OP1A 2VNSA 2C31A 1K9TA 3FOZA 4II2A 4PMDA 2W11A 2X8RA 4AZVA 5C9XA 2JJ1A 2HE8A 3PZUA 3DZCA 1KOLA 1NQTA 5AZ0A 3HP1A 4N47A 5ILGA 4TWAA 1H0GA 4GVXA 5J5RA 3ZLJA 2YWGA 1IEWA 3C6QA 5EIFA 4URIA 2C4TA 3QMSA 5AI5A 3UZ5A 2HTEA 1D1PA 3SXUA 2J0QA 3NQ2A 4QO8A 4H3KB 2E0PA 3CZGA 4XZIA 2FRDC 5TMDA 3N2IA 3U7HB 3A25A 4KRUA 1QOQB 4R83A 3GU1A 2PX3A 4MYDA 5FYDA 3RT7A 3LU1A 2QRMA 1J2BA 2V1XA 3HFRA 3JS5A 3IIJA 3JYNA 3TXZA 4YT5A 3AF6A 3A36A 4UATA 3CCFA 2J7EA 5EIBC 4M9SA 4RNJA 3R4IA 1CDZA 4F93B 3H53A 4UFKA 1OZMA 4YWJA 2C2XA 1V9LA 3JZAA 3LPFA 3TCKA 4FFDA 4ZQCA 1GTEA 4RMNA 5KITA 1U6IA 2DPMA 3WL5A 1XLGA 4LBSA 1YQ9A 1H5QA 1T43A 4WCVA 3NR0A 2WPDA 3N9KA 3CV1A 4QRIA 1K3TA 1L6RA 4A82A 3GZNA 1SHZA 3IUBA 3P4UA 4AD1A 3F4KA 3AONB 1MEEA 3VV2A 4ETMA 1OZGA 5IU6A 4FOKA 4NBRA 3R7LA 1LF1A 4AZ0A 3OY7A 1WABA 5DT7A 2WU4A 4WEQA 4NZOA 4QXOA 1CT5A 4K7YA 1O9GA 1YUNA 3UH0A 3A2KA 2IPMA 3F3KA 4Y9AA 1QHEA 1JB1A 3PC0A 2VWQA 1TWWA 2RH5A 4RZUA 3RDPA 4PQEA 3K8MA 2EJWA 3HE3A 1CUXA 5LP6C 4IIEA 5BRJA 2ZPUA 4UTTC 3NORA 1E5NA 1FPQA 4XVHA 3FLBA 1Z69A 2E77A 2O52A 1PYDA 3G0SA 4DMMA 1W73A 1E2DA 1H5YA 1U0OC 4J3FA 3PTAA 3IK4A 3VMOA 2CD9A 2Z8XA 2PQ2A 1Z6GA 4H60A 3KV1A 4CXMA 1JCMP 2FSGA 3LHSA 3HZZA 2R66A 3LBYA 3P61A 4WACA 3AVVA 5K0EA 5FLKA 3ISTA 1NBAA 4LCJA 1HO1A 2O3TA 3NRBA 3RJXA 1R46A 4A0RA 4B4VA 1UAYA 5FFMA 2QW5A 1XDMA 2WU8A 4R85A 2C6QA 5DZSA 1KEWA 3CZEA 3NTLA 2VRNA 1V8PA 3ID6C 4DB2A 4D6HA 4J1NA 3L0PA 4PSUA 2HSEA 5EXTA 3ZWVA 3H8WA 3TTOA 2E40A 3L65A 2C18A 2YGYA 3RS3A 3ET4A 1VBUA 2WNQA 4LTSA 4LJAA 4LCBA 4Z7OB 2DSKA 1TAUA 5CC6A 2LP4Y 3LT1A 2RAFA 3ETNA 1DKLA 5HMFA 4A16A 4ML9A 3SRKA 4YTEA 3HKBB 1BS2A 3JQAB 3P94A 1HQKA 3MTEA 2VGFA 1QDEA 4ZV4A 5BV0A 3ROMA 3AK4A 4K39A 1NI4A 4Z0NA 2P69A 3TAXA 2ZCVA 4GBDA 2QUHA 5KVSA 2I8AA 1GORA 4X71A 3EMKA 3IP8A 4XW2A 1TUBB 2WJVA 3PTLA 3OFND 1T0UA 1UQYA 3AY0A 2IX9A 4IIXA 4Q4DA 1V3UA 1P18A 2A9PA 2QDKA 3LKDA 4C6KA 5BRQA 1H5NA 1FFCA 3K0FB 3U7JA 3V7FA 2V98A 4H9UA 4MVJH 1B1CA 4M6PA 3HA3A 4KL8S 1VPVA 1WKYA 3WGLA 5D2VA 4O4IF 3NQVA 2W83A 3IKMB 2C95A 1ITXA 5DK4A 1DEAA 4JJ4A 3MTDA 1RZMA 2FSVC 2RGDA 2ZE0A 4HWGA 4OM8A 4XJVA 1Q3HA 4F4JA 2WIBA 2R6OA 2HHJA 3SYMA 3JQFA 3RR1A 1VHCA 1JJVA 3NCTA 5E6ZA 2HSWA 5CHEA 1EX5A 1KXJA 5T8KC 2QX6A 1T2FA 3CX4A 3SECA 4I6KA 3HXOA 3HQOA 1MXFA 4NJMB 5P8WA 3AUFA 1PIGA 1UR8A 3CVVA 4J43A 4RKWA 4AD3A 2QUIA 1NKSA 4G8TA 2YBVA 1HJUA 4A0FA 1CNEA 1TJYA 2GUGA 5JNUA 1ZHAA 4YV0A 5KTNA 3KPWA 1F3LA 4MGYR 3G5AA 3BGDA 4I6JA 1WXWA 2A3EA 3BXZA 4IV0A 2IX3A 2J0SA 1VHNA 4EHFA 2VEFA 3VMMA 5ICGA 2BUCA 4XUDA 3T7VA 4E5TA 1YVUA 3N3MA 2VFFA 3T95A 2ZSKA 4HNVA 4MINA 4EY3A 3GJ6A 5TQJA 4CMIA 2C8VA 2WMOB 3W24A 1VFPA 4DLFA 3RVKA 4PO9A 1UOEA 4PRKA 2FHBA 1NLMA 3V1MA 1UZUA 1RFGE 1R6TA 1AKNA 3P4YA 4F8YA 1QO2A 3QY0A 1XTZA 4JQOA 4MDHA 1TD1A 2OYRA 3RYCA 1J7KA 1KO8A 1WCXA 2Y62A 3UD6A 3H21A 3VX4A 3PLRA 3MSYA 3W1EA 2WWRA 1FYWA 2WWFA 4Q48A 1X1RA 4AWBA 1TCUA 2JC3A 5HS4A 4BX0A 3AUJA 1IN6A 2UYYA 2ZE8A 2QVXX 3OF5A 2WJEA 1Z4LA 2DU8A 5M2QA 5F5LA 2ZTMA 5CT4A 1OC7A 4US5D 3LX9A 1COZA 4HMDA 1YWGO 2XNSA 5E3IA 1PYGA 3KS6A 3CPEA 1E6KA 4LHZA 1U4OA 3E3NA 1C3VA 2QYTA 3CMGA 1N5JA 4YCNA 4MWAA 1RY8A 2I16A 1D09A 4LE1A 1KEUA 3WQPA 3HN6A 3U7QA 2YHIB 3KUDA 4OUDB 2W22A 1XSJA 3FDKA 1B2LA 2XH4A 1RSCA 4M46A 2PUZA 4O52A 4CMHA 2JBAB 4C90A 2EZ9A 2WYIA 3QEOA 3H1GA 3FYHA 2RE8A 3DG6A 1KA9F 3PFFA 2XEDA 2QR3A 5E4JA 4M1ZA 1K06A 2ZZNA 3IEVA 8TIMA 4S1WA 1QRDA 1ZISA 5F35A 3GLCA 3QRHA 2G3JA 4UTOA 5LN1A 1ZSVA 1Y0BA 1LFDB 2NNWB 5AK5A 4K9QA 2XBLA 3KT0A 3CG4A 3AI7A 5FJJA 4B6FA 2RGBA 2C7OA 4F4UA 1MW8X 4D43A 6REQA 1HYHA 2ISQA 2O20A 3ZXIA 2WKSA 3MELA 3EMVA 1E8MA 4DUOA 2FPRA 5M3WA 4C22A 5KWSA 2WDPA 3IEPA 1EGZA 1X8LA 1YIAA 4MPKA 2GVJA 5KTRA 3UBPC 2BZNA 5D02A 2FKPA 5FR2A 1II9A 2II6A 5FUYA 1ZA2A 2PE5A 1M2EA 2HBZA 1EVZA 5L4SA 4PEVA 1P4CA 1SCUA 1XZIA 3RKRA 4LXYA 3MUZ1 2OCYC 4JXJA 3HPAA 3EXG1 3PJWA 4DQWA 4JTIA 2LV8A 1EZZA 1NLZA 1UQRA 5SWUA 2A0KA 4IFKA 2VEIA 2A9VA 3ITTA 2X5XA 4CHGA 5BSFA 5DI3A 2OG1A 5BWLA 3OPVA 3HU5A 1G5AA 4E94A 3EXEB 4Y30A 2GGHA 1T0JB 5D3MB 3LXRA 4FWIB 3WUBA 2JGMA 1SKUA 4MVYA 4BFWA 1L0PA 2QZZA 4C7JA 3DTVA 1G4EA 3EEOA 3M6DA 4YIKA 5DM1A 4Q1CA 3W38A 4DLXA 4Q7BA 1CDOA 3VR5H 3ZLBA 4NF2A 2DZBA 1EWVA 2YY6A 4MSSA 2IK8A 4CUJA 4J28A 5L3QA 3MSDA 1VPYA 4P82A 3PJRA 2DTEA 3WL3A 4GUAA 4YCPA 1RQHA 4XKYA 2WYUA 3Q6NA 2BSLA 3OX3A 4DPLA 2V3GA 1L8XA 4ZARA 1SXQA 1CZUA 1OADA 3V7NA 3LLMA 5FWAA 1GLGA 2WKPA 4G37A 5FBVB 2P3SA 3QEAZ 4DBSA 3HMJG 4F2HA 1JKFA 5TGZA 1FCVA 2GK7A 1O5OA 1OPXA 2ZUBA 2MYPA 4TLDA 3FV9A 3GGCA 3UFXA 3FDFA 4LXFA 2O2JA 4AYGA 2CLMA 1XYYA 1VYVA 4KNVA 3GM8A 1M10A 3V2HA 4ICIA 2FMTA 4JYMA 1OI2A 5CYFA 1DTNA 4ETIA 2XPCA 3G3EA 1Q3NA 4CNSA 3QHNA 1DAKA 1VLMA 2OELA 1P2FA 2XBMA 4KRYA 3QEBZ 4W8AA 1QH8A 1ZUNB 4MRSA 4KVAA 2H9AB 5KSWB 3E2RA 3PIDA 3OGSA 1P2TA 3SX2A 4CLMA 1RHJA 5LZ4A 2I3BA 1CR0A 4D9PA 1JI2A 2DFVA 1M8GA 1M03A 3MVTA 2BFDA 3W1TA 4D8YA 3TN4A 3EA2A 1Y8RB 1WQ1R 2P6PA 3WDKA 4MPJA 1H1ZA 2O0TA 2MR5A 4YYZA 3TRHA 3R3WA 3UW6A 4DY6A 2ACWA 3OEED 3TECE 2VKTA 3DZ1A 4MW0A 2ON6A 2W6OA 4OHVA 1XM3A 5EXEA 2EBUA 3FGOA 1DWGM 3P5SA 4FMCB 3EVFA 1NELA 5GJBA 2VKQA 4R54A 4U7HA 4BN0A 4OJNA 3NAMA 5EPDA 1TF5A 4R2XA 4QBHA 1FNDA 3TR2A 2JFBA 3EY4A 1S2CA 3U5YA 4URVR 3T5AA 2PDJA 2B7QA 1KM1A 5GNYA 4E08A 3R3JA 3SM3A 3T15A 2QAGC 1H61A 1K5HA 4DSZA 4S0XA 2MINA 3S40A 4C3ZA 4BKNA 4X9SA 1PFWA 4O2BF 2IV7A 5C7YA 7ABPA 4JWKA 5L7YA 3VKGA 5LL6P 1DG1G 2CLFA 1H4VB 5M34A 4WY0B 4DV2B 1V41E 4XH9B 1U6JA 1K8ZA 3LPCA 2B8NA 3AQ4A 4ORIA 4E3TA 4DMFA 4XCQA 2ZRXA 5ALUA 2FWJA 1NF0A 5KNCH 2WAOA 3VYRB 1GKQA 4FGWA 1KM2A 3MW7A 1JSXA 5AHOA 2QM8A 4KH0A 4PLPA 3IGFA 1VYSX 3LRPA 3PQ8A 3DX5A 3KALA 4PB5A 3BF8A 4COKA 2DIKA 1TEHA 2QMYA 4JYBA 1WF3A 4IDBA 1MV5A 4BFTA 1U8EA 3BHNA 1L5VA 3TLBA 5HIMA 3SHTA 2Y4NA 4L8VA 5JNLA 2JGDA 3D8SA 3TN5A 5EJ5A 1TQHA 3EZ6A 1UK6A 2CHFA 1GJRA 4HKTA 3ZLTA 1E9SA 3L2OB 4CKCB 1MF7A 3GG7A 1A7KA 1XB2A 4HYEA 1UH5A 1HFKA 5D33A 1KFJA 5ALNA 2VSQA 4CZ2A 1Z2NX 4MPTA 4W5OA 1SYTA 3H97A 3KB6A 4HDRA 3B0YA 4DJJA 2BH9A 3DT8A 3MQ2A 1XU9A 3K0SA 1IEIA 4EKEA 4RX1A 3WX0A 4FI3F 3DF7A 2WT8A 3AUSA 1JDAA 4DAFA 3VM7A 5HXMA 2ZOXA 4JQ4A 2Z1NA 3CZMA 3I10A 4XO7A 2Y77A 3CE6A 3T3MB 2V4ZA 2WMIB 3AMGA 3AY7A 5JAQA 1FWCC 1X98A 4OM7A 4S1VA 5CSRA 1A5AA 5IC5A 4FBLA 4U33A 4CNPA 3M6LA 3LCXA 1MJ5A 4DJAA 3DMHA 3HSSA 1CW2B 1M74A 4I50B 3V4VB 1EJ6A 1SQ5A 3ANUA 3BSWA 5F4BA 1PVOA 3RFXA 1WDWB 3ZYZA 3T44A 2ZJ0A 1U33A 4TZKA 1VFSA 1J0EA 2QXYA 4OXYA 4Q8NA 3GA5A 2I7CA 2X23A 4MYUA 3AX6A 5JS8A 1GGFA 3I53A 2G88A 1YB6A 3LHIA 4LJ5A 1TCDA 1MPXA 3UJ7A 4F5WA 3TUZC 1JLSA 1JHRA 1I6KA 1TVKA 3FUWA 4B3HA 5EMYA 3BFJA 3R6TA 3PAJA 4M0MA 2X09A 2IY8A 5CPNA 1G5RA 2YJ4A 1VECA 1WE5A 4GUHA 4YI5A 4P6VF 1E5XA 2NSDA 4QTYA 5B5SA 2ZBGA 3LFUA 1O6FA 1HETA 2PH1A 2XWQA 4U3JA 3T12A 3AS3A 4RMHA 1FUEA 1EVYA 3GC2A 1FH7A 4OP1A 1IY8A 3PQ7A 1CG6A 4XAFA 4K9OA 1X74A 1AS2A 1P1XA 2XBUA 3AH8A 1YZKA 4CV1A 3KQHA 3M7IA 3PZQA 4Y67A 4RNHA 4B6PA 2XE8A 1W5PA 2POQX 4J40A 1LG1A 3BCSA 1SCDA 3WBWA 3ESXA 4QJ4A 2RG1A 1EGQA 3NAQA 3PNOA 2XZOA 4NK4A 5EP1A 2VA8A 3BWDD 3H2MA 2N1MA 2W2PA 1Z2AA 3QWBA 1B54A 4GGBA 3W83A 2BYTA 1TW3A 5BSUA 3TZCA 2DFAA 4ZYYA 1R4ZA 3SCSA 2XQFA 4I5UA 1Z6QA 4IMCA 2X0KA 2BEUB 3PNSA 3RQSA 1WKVA 1M6VA 2L0XA 3ABOA 3VNRA 1K6JA 1SR8A 4AO8A 4S39A 3UYIA 1W4RA 2JZOA 2WVHA 3UESA 4G0VA 1JIUA 2NQTA 1XTJA 3M41A 4LE2A 1BE0A 4CF5A 1A5KC 1XF9A 3GDGA 1OBVA 3H8JA 2BASA 5L6MB 1Q1GA 1V79A 1SFLA 5MKGA 3CW8X 1X7YB 4JT2A 5TMPA 3OICA 2R79A 4Y9SA 2OESA 3MKVA 3REQA 5E0KB 4Q1FA 2FFIA 2AF4C 3IXQA 1CY8A 1LF5A 1VMKA 1OVGA 1ZUHA 3AFIA 5CZKA 4NPHA 3RPTA 4XD2A 3DWEX 1CR6A 1P39A 4DG8A 1YTKA 1B4KA 3BCHA 4D6YA 4O2AA 3NEYA 5U4NA 2A3RA 2WC1A 1QZXA 4URHA 5H3LA 4BP1A 2J5KA 4C4SA 1RC8A 3IHKA 1NYRA 2G8LA 2CXHA 4JEQA 1W4ZA 4BTEA 4C4AA 1EXDA 5HPOA 3NHMA 2NV1A 3VMNA 3IV6A 1E6PA 1U28A 2PEYA 1HK7A 1B42A 1GUAA 4UQ9A 4NX2A 4LJ8A 3W5VA 2PGAA 5KZEA 1EEHA 1FB5A 4W5JA 1PGPA 1L7AA 5GGYA 4PLTA 1IQ0A 3CLTD 2WIKA 3DGFC 3PEVA 5FBHA 2JH8A 1MNQA 1OC5A 2C84A 3WY9A 4XYEA 1KFEA 3K8ZA 4M55A 1BSLA 1RWPA 3AP1A 3B85A 4P80A 1F8IA 3UCQA 3M6XA 1Z0IA 1PWEA 4MVJA 3ORYA 2FQYA 1KAOA 5DN6A 1IM8A 3GKFA 1PJCA 4FMBB 3HK2A 2QI9F 3GLHB 4AJ2A 2CL7X 3FFTA 2E8YA 1N5IA 5HW0A 2XNKA 3S2YA 2VDVE 3AF4A 4R16A 1G0NA 2HRDA 1XZBA 2Q6ZA 3HQ1A 3GDWA 5FPYA 3A1EA 3NC4A 3UAYA 4DWVA 3JAWA 5JSFA 3GRKA 4AMBA 5A6SB 1WP4A 3H24A 3GBDA 4JR5A 2E55A 4ZP1A 3BL6A 5ALRA 5D9OA 3L6OO 2R1UA 4WJLA 2FDRA 3GRZA 3S44A 1P17A 3I32A 3Q0IA 1MAWA 4BMVA 2UZ1B 4BLUA 3TIMA 3DDNA 5XIMA 4A3HA 1XRPA 3H7RA 2QIWA 1L4UA 3GS6A 4JDYA 1EFPA 3WH8A 3DBLA 3L5MA 1JVBA 2OZ0A 4CNBA 3E2PA 5TT0A 4WKFA 3UAGA 2EG5A 3DM5A 1TRDA 4HU3A 2QTFA 3IBTA 4FX2A 1AF7A 2WV8A 3C2QA 1GRVA 4CM5A 4FYPA 3HZHA 2CF6A 2CCRA 3UJHA 3KSBC 1J22A 1FP7A 5IFPA 4QS5A 4OAPA 1TEXA 2XTJA 4DG5A 2DKNA 1UD8A 5I51A 2YFKA 1W85B 3P82A 1YI1A 3M5CA 2QCEA 1JDNA 5FJUA 4GK8A 2Y7FA 3DEJA 4HGOA 4M0EA 3LRXA 5BU9A 5L3RA 1RRVA 3X1ZA 1BTOA 4PTWA 3TRJA 5IUKC 3OIYA 3QZEA 1NLUA 4R01A 4HHLA 2PDQA 4D4LA 3NBUA 1YE6A 1LZOA 1BE6A 2BGLA 2PWZA 1W88A 2V7XA 1KQFA 4NZ5A 4OQVA 4JYAB 3G2GA 1EVEA 4QPNA 5JNTA 1FTSA 2VZ0A 1CVIA 5FPQA 3EVCA 2ZVJA 1KGDA 3EMBA 5LQSA 3UHJA 1P7TB 4WBNA 1ZA1A 4QQUA 4Q3BA 3VYTB 4B3BA 2WNHA 1G4PA 3Q3GE 4TQAA 5GNZA 4TO8A 3HZ3A 5CD9A 3G9UA 1EPXA 4DLZA 1YBQA 2G09A 3GTHA 4HXYA 3QYSA 4PEKA 1RALA 2CVQA 5JIWA 3L79A 3EG9B 1XLDA 2VEMA 1MQAA 4C0QC 4XWWA 1N77A 1JDBC 3ABRA 2DR3A 4IICA 5DWQA 1RJGA 3ONFA 4F3TA 1OWMA 4AZWA 4HAOA 2ZCUA 4QVKA 2ES4A 2PBZA 3WBJA 2P7HA 1XP5A 3AVUA 4C04A 4OH7A 1S8FA 4JLSA 4LKRA 3UH1A 3APGA 2ZRQA 2I65A 3N9IA 1NZFA 4Q3MA 4C4TA 3UBTA 3MCNA 1R7AA 2QD3A 1HLDA 2ZQ0A 3JQEA 5A6LA 2H9IA 4WJEA 1R0MA 2NZUG 2WAGA 1MABA 4GECA 3RBXA 4D4IA 1P0CA 2B4KA 1MC4A 2J5XA 2XDQB 5AW7A 4HZ8A 3W2JA 3U13A 3ZVLA 2ANCA 2FZVA 2QMEA 2HR1A 3TWBA 4FFBB 4AJ4A 3RVDA 1C8KA 3C0QA 3PKIA 1GG2A 2LUOA 2GZ3A 1ZOOA 4GWKA 1A3HA 3EDDA 2NO7A 1E3DA 3AYZB 1TAQA 4E3VA 4FP9A 1BQEA 4HJXA 2WU1A 3ZOKA 4ZVVA 2O4CA 2ZIGA 3NBFA 3H5NA 4CV0A 3DWGA 2HLDA 2WG2A 3EVDA 2BFNA 2ZROA 2A3CA 3FVQA 3PXUA 3NO4A 1BKSB 4FXFA 2IF0A 1G55A 4D8WA 1AV6A 4DUVA 2N42A 3MVEA 3KRBA 3W5HA 1ONNA 3C0KA 4HDNA 4JODA 5B12A 4KH2A 3WJAA 1F1BA 3W2UA 1F4LA 3AW8A 1TM2A 1XG5A 2XB9A 3WMWA 3F4NA 5AC8A 3RRBA 3OTGA 2AUMA 3RC9A 4FQ8A 3SG0A 1T9CA 3P2EA 3T4XA 2PSEA 2QU8A 2EGUA 3QVUA 3ENZA 3S1GA 2ODWA 5I8ZA 4B5SA 1E0DA 4XDYA 4UOJA 1XDWA 3U80A 2BSXA 3EMZA 3IILA 3VR5A 3UU0A 2HQAA 1E0WA 5BV1A 3MUOA 3EQ6A 3BZBA 2HDHA 4OBSA 4II3A 3VKVA 2I3DA 3PVSA 5G4KB 4ZTUB 2CYBA 4Q0MA 3A37A 1AQFA 3W7JA 2PCLA 2IPAB 5T5QA 2P0EA 2JEYA 1A27A 4LC6A 2YW4A 3LCLA 4C6TB 2J0UB 1US3A 1M5UA 5GONF 4O5OA 4XQ0A 3OO2A 4DARA 3SICE 1A9SA 1PX8A 5BV2P 3H8VA 5F3WB 4TTPA 1O1ZA 4JI6B 4B7UA 4CQLB 4LUSB 3BLEA 1W17A 4R1TA 3S8EA 1THGA 5CXQA 5JH1A 1ND6A 3FHAA 5FL1A 4C0HA 3WSTA 2W6IA 3NETA 2LR0A 1IULA 5D6NA 3VAYA 4CTMA 3EULA 2QQGA 3M5DA 3NDJA 3OLQA 5TDHA 4EKGA 2QT9A 1KEKA 1U4NA 4ZVSA 4E14A 3MRTA 2QUZA 1E5JA 4JTQA 2X3YA 2Q71A 4DN6A 1M67A 1XTRA 3RYFA 1SCKA 3UXEA 1W44A 4CKEB 1W2HA 1EDQA 3NV9A 1FE8A 5JSZA 2JCXA 3STFA 5AVZA 3S29A 1EK5A 4G1VA 1J01A 2GNAA 4HOWA 5HKAA 4KC0A 4CKYA 2XUCA 3MLBA 4P7OA 3WH7A 2RCNA 2XZTA 3INYA 1T2EA 3OGVA 3ANYB 4PN7A 2FTWA 3H2FA 1G2PA 5I3JA 1RBZA 4BV9A 1RC1A 1MNAA 3GW0A 1XUZA 2J0EA 4D9JA 2Q3FA 4JK3A 4XUEA 3RG8A 5LNRA 3MJRA 1QOZA 5AK0A 3R6IA 1U94A 4YV2A 2FFHA 1K7EA 1PKMA 2ZDHA 2VT2A 4Q37A 3O07A 3FK4A 2W6QA 5L7WA 3WLRA 3ARWA 3CEHA 2KW5A 3NHWA 2G3NA 3H84A 4MHTA 4BJHA 3WDHA 3K6SA 5T91A 1FTGA 5K3FB 4RTJA 1F60A 4P4SA 3CZCA 4ZXFA 1UR2A 3A1DA 1N33B 3GJXC 5HIJA 4A0GA 4BLTA 3TGPA 1XGDA 2FZLA 2PLNA 4MS1B 4Q01A 4Q1BA 3HXTA 4UE2A 2QZSA 2OK8A 3TONA 3ZW7A 3X2SA 4ER3A 1UBSB 5AW0A 3WZ2A 1OGYA 3TH6A 1JEQA 2J3EA 1JR3D 4LRTB 1RJRA 1THZA 3CSUA 2J13A 2IELA 3F4DA 1ZUD1 4ZT7A 4KGDA 2W2VA 1NR1A 3ZU5A 1XV8A 2IHVA 3B97A 2IYOA 1RWKA 3C97A 3T7KA 4PTNA 5CJJA 2HWXA 4UTFA 2VQSA 1NFGA 2QLNA 1NBHA 2PA0A 4IOTA 4AVFA 1U5BB 4I4TA 1XKYA 5KYYB 1QFEA 3MMNA 4GG1A 4BDTA 4N9DA 4XLTA 1MYRA 3UXIA 3LXAA 5CDFE 1ULZA 4BNXA 1PCWA 3COTA 5BN4B 2CMDA 2PWEA 2AFVA 2V6FA 4JYPA 3A11A 2F9LA 4BNMA 1EUQA 2H4HA 3OOQA 3IQGX 4I1SA 5JFGA 1P29A 2QVZX 2DH2A 4LHSA 5AC5A 1TJ5A 3PBUA 5BNWA 4RORA 4Y1RA 3BTNA 4ALDA 3A6DA 2ODPA 4OQNA 1AGPA 1C8XA 4GKJB 3LY8A 4YCSA 3EHDA 1VSVA 3M70A 4OKNA 2GVYA 2CYAA 1Q74A 4FNGA 3L6EA 4NCHA 2PD4A 1H1DA 2HW8A 2X2PA 4EWLA 5BNZA 4JX6A 1IV8A 3KX6A 4I2VA 2Q7OE 1S4QA 2WOQA 1TF2A 4C2TA 3UWSA 3OFKA 3JS3A 2CE7A 2OCBA 1G8SA 1E2BA 1D2HA 1DB3A 4GPNA 1FSSA 3FZGA 1TE2A 3T35A 3WNPA 1F8XA 2WJFA 4TTGA 3ZQ6A 3DJFA 2Z25A 3D3WB 4P8UA 3CX7A 3MWYW 5C5EA 3D4IA 1OFBA 4J29A 4NV3A 2BCGY 1QW9A 1W9DM 2RMKA 3I2FA 1U9IC 1QNPA 1B6GA 3NRCA 2YINC 2RD2A 2Z6JA 1Q6EA 4JLKA 3Q1KA 1Q6GA 3ILVA 1JFXA 1V16A 4ETNA 3EX4A 4XEHA 2V0CA 1V3KA 3QLUA 2CLEA 3GTFA 3OIDA 4BCEA 3L92A 4QDTA 3CUGA 1HGYA 1QO9A 1AQHA 4RXFA 1LW7A 3WF3A 4Y6OA 2FMFA 5BMWA 1L7PA 4KN8A 4G5GA 1QHOA 2ZUUA 3U37A 4O2BB 1NJ1A 2WMFA 3VTRA 3A1FA 1TMYA 1I7DA 3LEPA 1UKZA 2HHLA 3DW3X 4KBFA 5AKKA 5ALWA 5AVJA 4Y6GA 1X7FA 1M66A 4MV7A 3MTAA 3T3HA 1XLKA 3PULA 1Y9AA 3NIYA 4D9BA 1AGYA 2EGGA 3ZD8A 2JIOA 1YQTA 2TMDA 3FM9A 4U1RA 4QL3A 3AYVA 3KQKA 2IS4A 4JQAA 3FPJA 4B6SA 3DDOA 1ME7A 2QTGA 2RHCA 5CCEA 2Q5HA 4K7VA 1N6IA 1OTHA 1FMLA 1NW3A 3W9UA 4TL9A 4MDPA 1CX9B 1G5PA 4RZHA 1GPAA 2JPDA 2YZ5A 3R5TA 3PHIA 4EOGA 2BY4A 1YPXA 2XF8A 5CDHA 3GG0A 1QT1A 2P2NA 3AOEC 2AGTA 3WGOA 1GVEA 1WZAA 1B30A 2CLSA 2CL0X 3EXHB 3CUWA 4DQVA 4CR6A 4FLRA 3AUOA 5JD5A 4D99A 2DEPA 2HLHA 3W7PA 4LPKA 4GOKA 3NALA 1KJ9A 5KMGB 4P36A 1HP4A 4XQ6A 3VU3A 4FFOA 3HA1A 1FNNA 2VBGA 2JD2A 3NWEA 4JIEA 5DBTA 1ATIA 1I4OA 5ALOA 5JFTA 1FWWA 1HTIA 1C9WA 1GYLA 1NASA 2D1RA 2QF7A 4HXGA 1IZYA 3FAKA 1Z08A 4Q3AA 1LWJA 4JLVA 4EF5A 2Z6AA 4JI4B 4U7FA 5KYTA 5FQOA 1X77A 1JHDA 1TJPA 3R9KA 4LN1A 2I0FA 1CHDA 4FEGA 1DARA 2XCIA 1LDEA 2BMVA 1GFIA 2OP1A 3MMZA 3OX1A 3WNDA 4JSRA 4V1YA 4TZ6A 3EF3A 5I3KA 3L40A 3UAWA 1ZXLA 3OIVA 1ZHHA 2ZWMA 2Y99A 2CZFA 5D2YA 5CLWA 3LRMA 1DJIA 3WCZA 4XWOA 3HEBA 1NSTA 3P14A 2YKGA 3HCBA 1IJEA 1JZ2A 2H1IA 3MGCA 4TMWA 3E9NA 3TE7A 2M6LA 1D4AA 4JJAA 1Z45A 2E4XA 2DFLA 2WA2A 1FW6A 3B1YA 5BYJA 2V67A 3C0JA 2BI4A 4FM9A 2WZIA 3QKRA 2J7GA 3LT2A 3BANA 1NWCA 4TLCA 2NV0A 3JWGA 3SDZA 3KOMA 2QG9A 5KYGA 2P2YA 4D3ZA 3PDCA 5LQJA 2OX4A 3A3WA 4HRAA 3KEGA 5H8WA 1VJ0A 5GQBA 4LXHA 4EZIA 3WLJA 5C5YA 3I04A 4L56A 1I4NA 3W5UA 4ILKA 1CETA 5FI0B 4DMRA 1LK7A 3A13A 2I6GA 2RI1A 2H4XA 5ANRB 2SKCA 3R6WA 3AIIA 1THTA 1AL8A 4RKAA 1YTUA 4JY8A 4W63A 4S3MA 2CVOA 4BVFA 3P26A 3LRTA 5E6RB 2JFFA 5BRAA 1I7PA 4MYXA 1XDUA 2R00C 3UAZA 3NKVA 1YRBA 2VJOA 2HK7A 4ARUA 1CDGA 2VOJA 4G67A 2NG1A 3W7IA 4HN2A 3X1DA 2V30A 5D3KA 3AEQA 1BRLA 1YJBA 3HWSA 2Y1OA 3VDAA 1KXZA 1W6TA 1MRSA 1NMSA 3OG3A 1UDBA 4IFEA 4RHCA 2EF1A 4O4HA 3ZZMA 2RHGB 3RABA 1VYTA 4GPD1 1E7YA 1JDEA 3PY2A 1P4JA 5TJHA 3IE0A 5KQPA 2EG9A 4KYUA 5A9TA 1K3UA 1VZ3A 3DO5A 4V27A 4CFYA 3F2BA 2IYRA 4MUPA 4KYTA 3CISA 5DHUA 2QBYB 4DYEA 4XD7D 3G2QA 5CPQA 3CWCA 4QYMA 4YP6A 3BGOS 4IG4A 1CUIA 1AA1B 1XWFA 5K4XA 4LGVA 3THCA 1JDJA 1KO5A 3EGEA 3HKEB 1O54A 4IQJA 1PJQA 2C1EA 3DAPA 3A22A 3IERA 4IQLA 3VNQA 4YRIA 4WCDA 3DEZA 5F1VA 3KQMA 1MOZA 2QQFA 3DBRA 4ZEWA 5JYBA 4Q3LA 1QHPA 1W94A 4F5YA 1TPFA 3NTRA 3AHZA 3OQOA 2VH1A 1ZVJA 2HO5A 1FY6A 2HCFA 3QKSB 1UL1X 3BB3A 3K4QA 4MR8B 4OREX 3T7IA 1C9EA 4XSLA 5A9SB 4PPGA 1PT8A 2WXDM 5FCDA 1XPUA 5CSYA 1UXIA 4FT2A 4J0DA 1PD1A 4D6IA 4LJ6A 3GIWA 5DRTA 1NIJA 4LYGA 1W3JA 1LRJA 2G83A 3HBMA 3MB9A 4FONA 1QNRA 2J27A 4AZSA 2BFEA 1QI3A 3VH1A 1DUVG 3R0VA 4HU4A 1DFHA 4A2QA 4DMHA 1KLYA 2QEQA 2Z56A 2ZYDA 3OW1A 1RD5A 1RWWA 1OV4A 3SC6A 4BP8A 3UG4A 1DYSA 5TPZD 4RQAA 1E69A 3TKLA 5C8ZA 2PG3A 3ZE2B 1WPGA 4BE7B 2HA4A 1XA0A 2I22A 2J3DA 2GL5A 2Y0BA 4KXMA 1LX7A 1OY1A 3QTBA 3IAM1 3RTGA 4LF2A 3P8JA 2ZRLA 1Z41A 4MMYB 1XGZA 3O94A 1R2TA 4ER0A 2C4NA 4J7CA 1OIVA 1XD9A 4KKXA 2VZUA 1LEHA 4M6WA 3LECA 2H63A 1QHSA 4MW9A 4L2IB 1W0KD 1DWHM 1E55A 3JRWA 2YFQA 3Q98A 2YWDA 2ZC1A 4OIMA 1LLWA 4ZRDA 1GVYA 1W1IA 4QWMA 1VHDA 1R9MA 1XWIA 3O9NA 2W62A 3WGMA 3I39X 4GLLA 2H54A 4PG7A 4ZI2A 1N5OX 2IYFA 3R41A 1Q14A 5DT2A 3U19A 3O8DA 1IR1A 1BQ4A 3G1FA 4YQYA 3CO4A 5HTOA 2Z7KA 3W1RA 4YCMA 3SHQA 3WJ1A 2PC4A 3PJXA 4V33A 2P67A 4JS3A 4IMIB 5AVXA 4H59A 3SI9A 5EGNA 3HCFA 4QJ5B 2QUUA 3TBKA 1DZIA 2JFYA 1WDSA 1DXFA 3DFNA 1UPFA 1P6WA 2HBYA 5LHEA 4LVNA 1E7MA 4UVGA 3PJDA 1CT9A 3BTVA 3EYPA 4ZE5A 2EKLA 4D0RA 4P1ZA 1H8HA 4TS1A 2FV8A 2I9PA 3D6AA 1SUWA 4O50A 3HDGA 3N05A 3KVNA 1JGIA 1ZL1A 4EJSB 3FA5A 2VSFA 5HINA 1GCYA 3HQ4O 2WWVD 1HZYA 2HJWA 5IPFA 2FPOA 3W3ZB 3HDVA 1WSWA 3NNDA 4AWXA 3LQYA 3GFTA 2PMCA 2H48A 1E3ZA 4E2FA 1EXBA 2PT6A 2JLCA 1JI3A 3GT4A 1CUEA 3H3XA 3UCEA 1PR5A 1CJBA 1VEPA 4BI6A 5AHXA 3LGGA 3SSNA 3U3KA 1R6DA 1QGUB 4B3JA 4E2OA 2ZT8A 1C30A 4R8LA 5JI3E 2HCJB 3V4FA 2W2LD 3IKJA 4YMVA 4JQZA 1ZVMA 3OFJA 1HEUA 2Q8LA 1OF1A 4P8RA 4BLOA 4UFMA 3I0NA 4CU7A 1OR8A 1SUDA 1FFBA 2NXHA 3T61A 2PVSA 1BWRA 3E9ZA 4HP5A 4RZIA 3LDAA 4IUOA 1JGTA 3DAHA 2J6BA 2PHZA 2VJMA 4HNAB 3AR2A 2O7SA 5D85A 3BMWA 1KH1A 4PUMA 2RHJA 3GNNA 2LGJA 3ANTA 5I8WA 4NUWA 2FK8A 3LC0A 4K8RB 1XJ0A 2IFTA 4CM9A 4KCGA 1NJ6A 2V0GA 4LUTB 1KYXA 4RHYA 4X97A 2O50A 5BW8A 3CZKA 1LL7A 1UBLS 1S2LA 4QGHA 2QU7A 4ZQPA 4BASA 3R89A 2AKZA 1V8DA 3UEOA 3LOQA 4GH1A 5KHLB 5E6UB 1A3XA 1JG9A 3CGTA 3NZEA 1KZ6A 1XTPA 1E5DA 2BXZA 1J5SA 1UIPA 2ZYUX 3WQCA 3GDRA 4INAA 2XB4A 4C6FA 2XVXA 2C96A 2GPSA 2FSSA 3DOHA 1JG1A 4YHBA 3DERA 3G77A 3CPGA 2ZQYA 1O6IA 1I3CA 1YS7A 4BK9A 1X7ZA 1Q1AA 2DVUA 1CJCA 1P4AA 1FNBA 1RXCA 5KNLA 3WNKA 4M7TA 3GW3A 4AQ7A 4C7XA 3MCMA 2WYWA 3I7QA 3N2MA 3KVOA 1AKMA 3RSHA 1EVJA 1BN6A 2IP1A 5CGQB 4EQ6A 3NQEA 4Q7QA 4MGHA 2HM7A 3W5BA 3VKBA 1GZJA 3VDCA 4F84A 4RACA 3W8RA 2D2HA 2AR9A 2CLKA 2GTIA 1MV8A 1EQUA 2J9GA 4OSOA 5KO2A 3RADC 4YY3B 5ECUA 2YXPX 4LFBB 4M1MA 4PC7A 1TKKA 2WK2A 1K7SN 4QREA 3OVPA 5GONB 1FDYA 4OI0A 3B7GA 2XGOA 1UP3A 3PTDA 5HJXA 3DM9B 4DYHA 3S8YA 4FXSA 4HQ0A 1JQ5A 2VJAA 3M0LA 1JXJA 3R8GA 1R5OA 1GG1A 4V0RA 4Y9UA 2CEQA 4LZAA 2FPTA 2CZDA 1A04A 2RC6A 3PXDA 1R0SA 5BVHB 2IL1A 4M8IA 1WBHA 4LXXA 1KBQA 2UZAA 2QLYA 5EPOA 3WWZA 1WDQA 1T4DA 1K9FA 3SWWA 2GARA 1OZHA 5AHWA 1KERA 2FH5B 2B83A 1EG7A 3WF0A 3JAMA 2BCEA 2CNBA 4GI5A 1XLAA 3WLMA 2QLBA 4F3YA 2UZ3A 3TW6A 3ES8A 2HPZA 3RVOA 4I9NA 2BUBA 4YS6A 4DBLE 1Y65A 1IZ8A 5EY5A 4XGRA 1G63A 5H4GA 3ZU4A 3OPMA 4H08A 1RCFA 2BF4A 1G7SA 3OSUA 2ZVDA 2QPTA 5DCLA 2VD9A 4HK7A 4PMZA 2R87A 3WRXA 1M04A 1KY5A 4JNYA 4IS3A 3RCYA 4JOCA 4CI0B 1VE3A 5EEHA 1UDAA 5CEWA 1T34A 2VDRB 1PO9A 4PCAA 1PIFA 4FUTA 3G2OA 3LLCA 2QV4A 4UD2A 3CHVA 1BEEA 4BDSA 3KDSE 1SO4A 4K68A 3RI3A 3TA9A 1D1QA 2W5UA 1QHGA 1D7OA 1O5TA 1K4KA 3O1NA 1EC8A 2Y89A 3S0JA 4HUJA 5CTAA 2LDBA 2I5IA 4D4JA 1G59A 1GAXA 4G63A 1WSAA 2HVNA 5EJEA 1E18A 2J6CA 4A6XA 4CKWB 1IXPA 1CRWG 2UVQA 2EFGA 1PTDA 3F5LA 4Q6BA 3VPLA 4HNQA 1GPUA 2WVAA 3I4LA 5I02A 1ZK4A 2VP8A 2A85A 4M0DA 5I9NA 4P4NA 3C2RA 1BSVA 5CH9A 2C9ZA 1AGRA 4HAZA 2Q9BA 4QHYA 3ER9A 3GJSA 1G9XA 1UMDB 1HDXA 3VI4B 1J2YA 3AV0B 1CUGA 3GXBA 1D2CA 1Z4QA 3FPKA 4AUKA 2I4TA 2ID8A 1PCXA 2H7CA 4DWSD 3K8QA 1TK2A 3BZJA 1NVAA 2JHGA 2YOCA 3QEJA 4EO9A 2IYUA 3DLAA 4XD3A 3UGKA 4WXYB 1YRRA 4M1RA 4MB0A 4GLOA 1SUCA 4NZMA 2EEPA 3KX2A 1U2DC 2DT2A 1LJ8A 3FZQA 3G1XA 4WLEA 4ZQEA 2WMNB 1L5ZA 4J2HA 3DCIA 1Q7GA 1XNHA 4LYDA 1AF4A 4Q7IA 3W29A 4PONA 1LC0A 2IIPA 3FHJA 3KSZO 3C85A 5EWJB 1YR6A 3S1AB 2NQHA 1E1MA 3MSGA 1EBFA 3COYA 5CW1A 1I2MA 3P9YA 4B5UA 4PTMA 4ZIRA 1W0JA 1HEIA 5C2GA 4TMTA 4OLHA 3ZT6A 1M72A 4UTNA 3FXYA 5JSQA 4JQ2A 4UTVA 1U8XX 3PGVA 4DRZA 4AXKA 3MW8A 4N65A 4GP6A 4QDUA 2XUHA 5KI6A 2H16A 3ARZA 3FGCB 2C83A 3IRVA 4DS3A 4W5RA 4NTZA 4MVXA 4ZB0A 2X5OA 5JD3A 3EOOA 3WJSA 2OSXA 1A80A 3F5FA 3MCTA 2YIHA 3E02A 4KEZA 2FI1A 2NVUA 3CLSD 4ESOA 4EANA 1DHTA 4OFBA 1YXYA 2YSWA 1SVSA 4QBTA 3DE2X 3PC8A 4Y9MA 1QOXA 4HTAA 1PTJC 4AQLA 2DSWA 4RZ2A 3FF4A 2JAHA 3RFCA 2OB3A 1R86A 1VENA 2XSAA 5I6SA 3ZHCA 3KEQA 1RQPA 2VPTA 3QW3A 4FYIA 4GBMA 1M7BA 5E3HA 1BC5A 1JNDA 1OT1A 2SICE 1TFVA 3CX3A 4TQ9A 4OKSA 3GRCA 2NZXA 4JFUA 2BPOA 2DHDA 4Z1MD 1GZGA 3S1LA 3T81A 1P2BA 5C0QA 1SKMA 4HWKA 1WULS 4PFKA 3S5UA 2J8GA 2WJWA 1O4UA 1WXXA 4K37A 1DIBA 1DBPA 1KBBA 2EKPA 1YT5A 5HJ2A 3A24A 1I2BA 4NY1A 3HI4A 1EHCA 2GT1A 1JIQA 3S8MA 3MQ4A 3PF8A 5JEEA 4K1WA 2G70A 3FROA 1ADFA 3UHOA 4MLRA 2OAP1 4PX9A 1KQZA 4MY8A 1P5ZB 4IINA 2FRXA 1IY9A 2R8BA 5LZLA 1U7OA 3HI6A 4YRMA 1RHQA 2XVKA 2JLSA 3UGJA 2R68A 4W6QA 2FA9A 2FPIB 4RJTA 4GJ1A 3T3IA 5FOQA 5LUAA 1CWUA 1XLTA 3R94A 1IZKA 2B31A 3S7TA 3L18A 3WBFA 2BVDA 2ZJ4A 2A9RA 3A1UA 3L4WA 4P4GA 4B1FA 4F1WA 1L5SA 3H18A 1XROA 4OA5A 2HSGA 5D5HA 4RVHA 3RM3A 3RU8X 1OYBA 1R50A 1ENYA 4KO8A 2OC4A 4MWZA 2VBCA 3DE3X 4KE9A 3AJ7A 3DEAA 1QHIA 4S0ZA 4DPMA 2GHRA 3B1JA 3QSYA 3T5GA 4OB6A 2I6TA 3LUPA 4QNWA 2ID9A 1XRFA 2ZTHA 5C4MA 4UC0A 4NFLA 2Q4TA 3PWTA 4NJMA 2J6IA 4QC2A 5HKOA 4F7WA 2XYQA 2PLAA 2Z1DA 1BXKA 4PX3A 1UK7A 5AHMA 4N5LA 2G41A 3ZY4A 4C0JA 3IT3A 4YRSA 1KZHA 5EFZA 2HA5A 1UM8A 3O3RA 4XA8A 5FF2A 1WF6A 4A3QA 4M9XA 3CIWA 3K9GA 2BKVA 1R5YA 5EJ9A 2RGAA 3UMJA 1OC4A 3HDJA 4NJOA 3LUHA 1RWVA 5EGRA 3CLRD 4DCOA 4W93A 3O3CA 4AJ1A 3ZGZA 3S1UA 5I45A 3H5AA 3HPSA 3MSXA 1U1IA 3ASZA 4Z7NB 2HMAA 3QYFA 4JLBA 1P0MA 1UOPA 4B3GA 1I7SB 3WQGA 4TMVA 4RS3A 2JLYA 3O7UA 3LZ5A 4TKVB 4RENA 4NATA 4WSKA 5K3VA 2Z5LA 4ZTZB 3ZWDA 5BWAA 1E6NA 4GZ7A 3OJ0A 5HFJA 3E27A 3UJAA 5LMNB 1ZK2A 4BR1A 4PGAA 3DE4X 5FF3A 3MP3A 1EBGA 1QK5A 4A3RA 1IQRA 3V3TA 4POOA 3L7BA 3ITEA 4UR9A 4TL6A 1QFMA 1NH6A 4Z1YA 1Z0KA 1ECLA 2R44A 3VBEA 5B7PA 1Y1PA 5CR9A 4OMCA 1GKLA 4EXQA 2VT7A 1ZU5A 4AY3A 2NOAA 3ZVIA 2YC4C 5C9WA 4FCTA 2QZRA 3M44A 1B2YA 1QKKA 4MA0A 3BW4A 4QVIA 3IIPA 3CAQA 4CLOA 2EW8A 4KR6A 4MS4A 4AJHA 4P2VA 3HJNA 4DAEA 3FPEA 1PQPA 3S1XA 4X0NA 2JBAA 4NOLA 3U7BA 1QATA 4BRWA 4ILSA 3TJLA 5AI8A 1CQZA 3WYDA 4MZYA 4RJJA 2B8EA 1RHKA 4YWHA 2C94A 2I7DA 3IVXA 5JSKA 4G0UA 2BTEA 5F4XA 3QFHA 3FDGA 2Q2VA 4YR7A 1R0BA 3O3NB 3QUCA 1G8PA 2FJPA 1NNSA 4ZOLF 1Z44A 1SBHA 5H68A 2V74B 2VGIA 5F9FA 2PODA 4EFNA 3QM1A 1S5TA 4R40A 2BOGX 5D9MA 1GWNA 3QR3A 1I0IA 3BQ5A 1WA3A 4KKVA 1FP6A 1HYEA 2BFCB 4ATLA 3GDFA 4GZ3A 3QXGA 4FS3A 1MIOB 4ROPA 4N3CA 3OA0A 5JXGA 1ZJ5A 2PA3A 3MHFA 4Z4FA 2Q5JA 4AY8A 2HQRA 4KR0A 4D44A 3W3AD 3MQFA 4RNIA 1UQZA 2CJFA 2O2YA 4HAUA 2DCUA 4O02B 4CN8A 3L01A 2YNMD 3CVYA 1AH2A 3K2EA 3O2JA 1W5EA 3AHGA 1QPZA 3BA1A 2HQSA 4TOIA 4IQ0A 1XP3A 3MKKA 5D3MA 1XA3A 1V93A 2O5EA 2H08A 3LUAA 2MYNA 1QO0D 4HX9A 1KQOA 4Z4HA 2CMHA 1KS9A 4LGXA 1RPZA 5E9WA 4LNUB 5FJIA 1X1OA 4N6FA 3ELYA 5J63A 2GM4A 3CUZA 2GXAA 1FH8A 1Z0DA 3KAJA 1CUDA 5ICFA 4I4NA 2CUZA 3GP8A 1E4EB 1JPJA 1Y3HA 3K0BA 3O4GA 3T4PA 2PQ0A 1W9PA 3NOEA 1A98A 3OPNA 3WHKA 1U0SY 2MNRA 2QVYX 4JXKA 2C2MA 1PZEA 2YQ4A 1NAL1 2FZMA 4CEHA 1GZUA 2PUCA 4D3FA 1WW8A 4J94A 2E9MA 2UBPC 2BGJA 2D3LA 5DHFA 3VZXA 3GH4A 1R10A 2OYSA 2FHCA 3GKAA 2QPSA 3EEBA 2R9RA 4F0KA 1EX1A 1XZPA 1MLDA 3DXXA 5HNUA 4FX7A 4GZ6A 5HOQA 3K70B 4WSOA 3EFBA 2JBHA 1GVSA 2YASA 4UNPA 4NZYA 5LQUA 1MEIA 4LJ9A 2B4AA 1ODUA 4AO6A 1N8SA 5KSWA 1EC7A 1N1GA 4R41A 4FF5A 5EBAA 4MH0R 3WBBA 2Q5CA 2G5TA 3KUMA 1YIOA 3IPCA 1XDJA 4ICMA 2OBBA 1U7UA 2QTVB 1DPFA 4H04A 4KSYA 5CB0A 5JZSA 3BMNB 4PODA 4DAIA 2YDRA 1ADCA 3RK8A 2Y27A 3FGNA 3RVPA 2ZZ6A 2QIOA 4BQIA 3B1FA 3QC3A 5ABTA 1TFUA 4O4LB 3ZI7A 2CMFA 1QASA 1EQPA 3F6BX 4CE6A 4DNFA 1GONA 2BHRA 3NCOA 4OGZA 3JYPA 1K8QA 2JHPA 3OAAA 1DQNA 3PQCA 3D6VA 3CWNA 1A5BA 4BBJA 1NU5A 2WNNA 3T09A 2FZEA 4V1CA 1P33A 3QIVA 4B73A 4LPCA 2GCGA 3OQHA 4WCFC 2XVMA 2IUUA 4IOMA 3EIOA 1BJKA 4ECLA 4X1IB 3G7NA 3TR6A 1GU1A 3HJHA 4AECA 5FI5A 3TWOA 3VNBA 5C32A 3R3XA 3WB9A 3GC6A 2VH5R 4DR7B 5TLSA 3WL4A 3NOXA 2F9MA 3LM8A 2RI0A 3MIIA 4RY8A 2G3YA 3A4VA 4CL8A 4F8EA 3NP9A 1X8JA 1N5RA 1AQMA 3N8NA 1E96A 1WZEA 4R0MA 2IXBA 3HBJA 1KB3A 1YJ5A 4DW8A 4QARA 1TW2A 3BFPA 4ITRC 3KVJA 1IDN1 4GNVA 3RROA 1ZRNA 2PS1A 1F6PA 2FSPA 3T7EA 4KEVA 1V11B 3VGHA 4PYMA 2CW6A 1AY0A 5KIAA 3PWZA 1OG6A 4XJSA 3DEQA 3IV7A 4YBZA 4NLLA 1UMCA 2E1WA 3L4UA 4J8PA 4Q3EA 1WNTA 5FACA 3UJSA 1N2XA 3O2SB 4Y0VA 3CZPA 3LD9A 2BTQA 1DQYA 3DL2A 5DGDA 4OLAA 4I3GA 3URAA 2J9RA 3DFUA 1CQIA 4HAIA 3K2GA 4HDSA 3BJTA 3PG9A 2JK1A 2Z8ZA 3MJFA 3ZK7A 1VKOA 3KYBA 3L4ZA 1ISRA 1RWQA 4EBFA 2OGUA 4OH1A 3PC4A 4UM5A 3WG9A 4IMDA 1OD8A 4BV2A 3TA6A 4EF9A 4Y8FA 2EPKX 1XRSB 3PT5A 4ARZA 1UQTA 2OE2A 3FMVA 3RU7A 2GAIA 3T2PA 2DW6A 4ACYA 3QVXA 2JFOA 2IYZA 5B3JC 4CR8A 1OBOA 2A5DA 5SICE 4TYWA 4KZKA 3ATYA 3ZC3A 3CRW1 4JHLA 4LXIA 1I2RA 1GCIA 2A1YA 3GNOA 3FMFA 4EMBA 1AUQA 2I6QA 4NZ3A 2WMIA 1UD2A 3KEOA 4MQ6A 3DHNA 1V6TA 2IMRA 3H83A 3PEEA 2ZRUA 2PDGA 4TR9A 1QPOA 1HKMA 3OG2A 2GILA 1RIIA 4ALKA 1N2HA 3GNTA 2FG7C 1KR1A 3LUBA 3PJGA 5BMVF 3P9IA 3KSMA 1JBKA 5ABGA 2IUEA 3ZSTA 2HPVA 3C5CA 4YRZA 3TM4A 4MEBA 2FGBA 4JIRA 3TXAA 1ECEA 1N5LA 2D6FA 2B0CA 3VO0A 4E21A 2A79A 3E5BA 1UKAA 3BDIA 1K92A 1RE0A 1OFAA 4R3UA 2F90A 4X44A 2B92A 3MRSA 3CONA 3MO7A 4W5TA 3S2JA 2IH2A 2CBVA 4HV4A 1NN3A 4Q21A 5AKYA 2C0HA 4MFDA 4DV4B 2YZNA 4G25A 2Q8QA 4YN3A 4KK3A 2NT4A 4PPNA 4MV5A 3FOAA 3RPDA 2PANA 4BVBA 4G5XA 2K2WA 3EARA 1NWUA 1AXGA 3VGDA 2V38A 3T06B 4N6GA 4HSNA 3NEAA 2FPUA 3XISA 2YX0A 3PA6A 4RF2A 3ULKA 3PF9A 2VDPB 5E95A 2O2XA 4F4HA 4BUCA 3IVUA 5ECWA 5C37A 1DC5A 3RJ9A 3B9OA 4DLLA 4QTTB 3OO1A 3ZXXA 3NS7A 3N7AA 4DR5B 2INZA 2RONA 5ALSA 3AISA 1V0MA 1Q6ZA 3STCA 5BURA 2WTAA 4IG9A 4BAUA 4MXDA 4YJ3F 3EIXA 4J3JA 1T8UA 4F66A 1NW8A 4XZ3A 3LTYA 1OAOA 2HRCA 5H6HA 2OHOA 4KWHA 4EY7A 3QE2A 4YVXA 3LX6A 4XZWA 1G5IA 1XTIA 2YY5A 4MJ7A 4M22A 2O2HA 4PMUA 4WE3A 1JDPA 5F51A 4KOAA 1NTOA 1XPOA 3HS3A 3HCOA 4RFLA 2CNNA 3W1WA 3OCVA 1D2AA 2G50A 1M6EX 3PDJA 3HRHA 5IG2A 1R6BX 3BE5A 2GN2A 4RHEA 2AA3A 3OBKA 1E2KA 2FFJA 4NAUA 2X1LA 1CZKA 3AILA 4FJ1A 3UY8A 2V58A 3MXTA 1DBTA 4TVCA 4JV5B 3E4DA 5KDDA 4M8NE 1A5OC 3GCXA 5D8WA 1X7YA 1N2GA 4DIEA 1L6IA 5J2TF 2QPOA 2A9QA 4ZC1A 5E0KA 4F2GA 3RSQA 1O7JA 2IVZA 1V5GA 5C1IA 4FB4A 2I91A 2WVVB 1KBZA 3TSOA 3RUPA 1UKQA 1DQSA 2CBXA 3AEKB 5JCJA 2DX7A 2JJ1D 4QTGA 4C89A 2A7PA 2ZXBA 4MP3A 2C5FA 4E5UA 3TW7A 4HNHA 2HIMA 2OQRA 3C3BA 1Z0ZA 4JL5A 2PDPA 4OLJA 5K3DA 1VDMA 5FUXA 1Q8JA 1QVBA 2O19A 1EFTA 1KS2A 4YVVA 4CEUC 3GT7A 3BKXA 5JG7A 4K6CA 2JJMA 4OHXA 4UHKA 4S23A 2JEPA 4BQ5A 3A14A 5H9VA 5FULA 4ZU1X 2N47A 1RWMA 4UBLA 3RJ5A 3FYUA 4MGZR 5D7BA 3CNQS 4CF6A 2A2IA 1MUUA 4UFNA 5BOVA 3E3OA 3H65A 4N8EA 1N1DA 1Z0SA 3LCGA 3GEEA 3OQ8A 3IBCA 4JTDA 2GXSA 3ONEA 4H9GA 2NLOA 5EIAA 3E12A 1S5VA 3PB3A 3D1LA 3GLHA 2AMXA 3SJNA 1K75A 2JVKA 4PYNA 5DELA 1YB7A 3LD5A 1XAJA 5C8BB 4Y18A 5JIBA 3M5WA 3WK8A 4O4IB 4NZ1A 5DHPA 2KE5A 2ZUVA 1VKJA 3G8AA 3TQRA 2GD1O 2WPDD 3KM8A 3TNJA 4PWYA 4TLMB 1MAVA 1GL9B 2G0AA 4ZVPA 4XOIA 2IW3A 5B6IA 3A3OA 5CYPA 5C54A 1KO1A 1W8GA 1GU7A 3EDKA 3ESAA 3T9DA 3IRSA 3VPFA 4MKHA 3F7MA 4C6IA 3T1GA 2I2DA 1EWYA 3UAOA 4G5QA 1RMTA 3R43A 4AULA 4XPIB 8OHMA 4JTAA 3VABA 5IJWA 5DOZA 2AYYA 4R2LA 2G95A 2VKZG 3CRQA 2EEZA 1ZN9A 1KMQA 4UUNA 1QX3A 4JLMA 4Y90A 1A8UA 4P3PA 5DM0A 2P9QA 1JRBA 1ZNQO 1NC1A 1MO0A 3V7PA 5HSGA 3KBJA 1GAWA 1HNXB 4YAFA 1LVUA 3S2ZA 4PVDA 2O1XA 2QM0A 5JQGF 4DB4A 4BV3A 1IGSA 3KHSA 3WOVA 1KMHB 5DSTA 2IZOA 2GN0A 1R9ZA 4E3WA 2OQ2A 5CBBA 1IXKA 1P6BA 3IAAA 2PB1A 5IT4A 3H55A 4JFWA 1FXQA 3ZJ7A 4QEDA 3TINA 3BARA 3VZBA 4L64A 4GXPA 4K6FA 4B76A 5JQ9A 5DHTA 2NQLA 3E7XA 3IODA 4TTUA 1H1TA 1KXQA 2E4VA 1X8XA 3LS2A 3URKA 3KFTA 1FMFA 5K9XA 3M6VA 4HN4B 3VHXB 1AURA 1F4AA 4PU0A 3CMCO 3A3KA 3F5QA 5AJYA 1V25A 4N18A 3BXFA 3JRKA 3PGKA 1VA5A 5I6DA 2IH4A 2X2EA 1E66A 4GYKA 1XG4A 1XVAA 3TW8B 2HSAA 1CUJA 5F2MA 4ZCWA 4XUCA 5IVPA 4B3KA 4A03A 1ISHA 2DUNA 3BIWA 3QSTA 3EG9A 2J7KA 3ZQ4A 5EN4A 1U04A 5B7NA 4LYFA 1W5NA 4D46A 3EGCA 4LBZA 1J9EA 2GPAA 2FQWA 2F3PA 2AI3A 4J76A 3GAYA 1QR2A 3QA9A 3RR2A 4FLEA 4G84A 2PPGA 2B1QA 4WWHA 1Q6DA 1DLJA 4JKKA 4PUEA 1KDOA 3KT3A 1QH9A 5IAEA 1DWPA 4QLAA 4MNTA 2ZULA 3N39C 1LDYA 2E4UA 2CC0A 4MHSA 1BMFA 2VZ9A 2VAXA 3UT5A 3LK6A 1C80A 1CNFA 1W0JD 3WLHA 2X0IA 3JQDA 3T6CA 4B5WA 2GWGA 2D1YA 4FNUA 1DKRA 1YAJA 3ZR4A 2VZLA 2H4WA 1DV2A 1CRLA 3GIDA 4J9JA 3CGWA 1SZPA 1BD0A 4P58A 3BGWA 3GMTA 1ISPA 2O8FB 3WIUA 2OORA 4KQ9A 2WCGA 3BW3A 5DP1A 4V0ME 2DY0A 4WKNA 3P9RA 1NLFA 4GZEA 4CG0A 2I7XA 3VU1A 2AH5A 1OOEA 5AVUA 4E8GA 4HH0A 5DLCA 5E0CA 5DNAA 3ZHXA 4AXNA 2D2FA 2PU1A 2AEFA 5DN1A 4BQ3A 1I1WA 3WC4A 4PZCA 3TDMA 1GNVA 1DGQA 1UDCA 4BMPB 5CT6A 1DCFA 3QNUA 2FZNA 2BONA 3QBJA 2IHNA 3HP7A 2DPGA 1C7ZA 2Q2QA 1JHOA 2PD6A 2JA2A 4XJXA 3RRFA 3L4BA 2FR1A 4ZVUA 1YVEI 4M76B 1KRWA 1PUDA 1ZY9A 5F2KA 4BX2A 2ZBFA 4O57A 4CUZA 5EC8A 4BCCA 2IS1A 3V9AA 2REQA 4LSZA 2PSNA 5J43A 1BTCA 3N53A 2NO9A 4HPXB 4PSAA 1GUVA 4LCQA 3UZUA 4L9XA 4BVEA 1ODIA 5C8DA 2VSYA 3PB0A 1CPUA 3I62A 1FVOA 5TRTA 1T6YA 3PFBA 4DZTA 2FEAA 4L7QA 3DTYA 1CSEE 2PZFA 5AICA 5DT9A 5CITA 5KNCA 3QPYA 2CKRA 4DBEA 4KQIA 2AL2A 4CDMA 2J9YB 4BLSA 1PL9A 1C9KA 1USVA 3R7SA 4ZXLA 1O95C 1SRRA 2QN7A 5IS2A 5FD8A 3AJ8A 3WYCA 4BGUA 5HILA 1M34B 4EHJA 5HMDA 2UVPB 2VR5A 1TA3B 1ZIXA 4JLDA 2BHTA 2WVTA 5C1DA 3VA7A 3UK2A 3B9RA 4CQLA 3KZOA 1FXWF 5ELLA 4UU7A 2NZ8A 3G1RA 2JE8A 2YQ5A 3PUHA 3F6RA 3VOHA 2BR5A 1W91A 1FHLA 4OWGA 4RVFA 3BX1A 2OHVA 3PFIA 1Z88A 4ERXA 2LD4A 1U2YA 4FD3A 4CMBA 3AJEA 4MWAD 4K86A 4P3YA 2JIPA 4DO7A 1T2DA 4LS1A 4KYVA 3FPHA 2IZZA 3R3HA 4JT9A 2NTJA 4LHVA 2DT8A 3VIGA 1CC1S 1HDCA 5FPPA 2R47A 2HYDA 1F3EA 3BE6A 2DQ4A 1XPYA 3Q7TA 4PN3A 1ZD1A 1P7YA 4BMSA 2O8BA 2AL1A 2HU8A 2ZIAA 3ASUA 1KO4A 4RTSA 4WBSA 1TJ4A 4BKOA 2AFIB 3AIMA 1BF2A 5CCZA 3ANYA 3G1WA 1C9MA 3PDIB 2XTAA 3L5AA 2JRCA 3WKAA 3C2VA 3W73A 3CT6A 2QTZA 4HWOA 1Q66A 1W4BA 4QBXA 5H02A 2CFRA 5CZSA 5AFDA 3WIBA 3LSYA 1LBEA 1MD9A 3FIGA 5LXTF 1YEYA 3FGZA 2WD9A 2PP3A 3EDEA 2XVNA 4GKVA 2E5BA 3ZHBA 5F7UA 5DCUA 5FV7A 5JDIC 5TARA 2FWNA 3L7NA 3HJCA 4HTBA 1USIA 1XYZA 1G6KA 2DV0A 1ETUA 4WINA 4U6NA 1WZKA 4OUKX 5K3FA 1MEHA 1VZWA 1XMSA 3NGXA 1Z28A 1JP7A 5EJAA 5CEJA 2VCBA 1YMQA 2HAEA 1R4NB 2Y1XA 1E9FA 2ZXFA 1HORA 2G9NA 1U2RA 5KTPA 1UR3M 4XSHA 3WFJA 3GK0A 4WMLA 2ZYHA 3RT1A 3BIOA 5CTJA 3WYNA 3PUGA 3KZVA 3OBIA 4DLBA 1KWKA 3V4PB 4OQPA 4LRTA 3O74A 4DELA 3JXEA 2QMZA 1IK4A 3ENKA 4GI3A 3T99A 1EE9A 3HV9A 3O0FA 5G1OA 2P1FA 5I07A 1JZ6A 5T3UA 3WK1A 4CVUA 1A2QA 4B3CA 4IF4A 3BGGA 2WABA 3DTVD 1M1NB 2ROQA 2G1KA 5ETJA 1YNPA 1UWLA 2R97A 3VSDA 1E6SM 4J3NA 2BV9A 3ZVHB 5EQJB 3L0DA 2H9YA 3AMCA 2JI6A 3SCPA 2DQZA 4PA8A 1ZZMA 1ORHA 3ES9A 3GR7A 1VBNA 2R7AA 4D72A 1XAHA 3SFZA 1WOMA 1TR9A 1N3YA 1GQRA 2AE1A 4MJXA 3NXKA 2DETA 1QTRA 1XCXA 4HWSA 2I6FA 4YRDA 5F9HA 3PPFA 4PBRA 3E0FA 3GFRA 1O97C 2ATCA 2O3RA 1G64A 4J35A 2EL9A 4M86A 3WN6A 1A1VA 1FKXA 3ZJKA 3IHWA 3W1AA 1CCWB 5BWMA 1H50A 3K09A 4GKKB 3M07A 3OQPA 1KGSA 3B3QA 2W8BB 1TRHA 1ZFNA 1G18A 2YWHA 3O26A 4MPRA 5EZ6B 4D2JA 1W36C 2PUBA 1K77A 4DCGA 5ESRA 2YJNA 3N6QA 3UV6A 3ND8A 3QLDA 2W42A 4TS3A 4BE4A 1PB0A 3IVRA 3A70A 3RMJA 3LERA 4N49A 1CB2A 2JH3A 2XXJA 2ZJ3A 2PSFA 4FWTA 3TIGA 3N04A 3GGPA 4WOCA 1T1JA 3LRLA 1ZLPA 3AEXA 1XCFA 4CG1A 4B4OA 1RP8A 2PTDA 1TTQB 3WMGA 3ONWA 2VENA 3ENQA 1IWBB 1QOPA 1FRBA 4W7HA 2XB6A 2WINI 3OVMA 1RBYA 1Y4SA 3PHAA 5G0WA 3BWYA 1T2AA 1U5VA 2EX4A 1ZD4A 1GQKA 2C2ZA 1ZOSA 4OJYA 2Z9DA 2W0MA 4IP0A 5ER6A 3ZWBA 4L1KA 1WY5A 4F4IA 1Q6RA 4NASA 2OJPA 4HPGA 2ZIZA 1H8EA 4UTUA 3COVA 3O05A 1UB3A 3L0OA 3AEUB 4AD5A 1Q1NA 2IU6A 1Q8AA 4JKYA 3HYSA 4QQKA 2HRQA 3QUQA 1TX0A 3F74A 2OOKA 1GKRA 1M1UA 2FAXA 2GF0A 3HHPA 1T99A 2FF7A 4ABTA 4BLRA 3M5VA 3STVA 3WBYA 2VGBA 1CX9A 3BWMA 1G66A 2EGZA 1YX1A 2EIXA 1XEFA 5JXWA 5JVDA 2PX5A 1XMJA 3SM0A 4LTMA 3AV3A 3A7DA 3CHYA 3D47A 1W3HA 4XLLA 3UJBA 2WWWA 3FTCA 1S5NA 3M0EA 4RDVA 2IPXA 3X2FA 4Z4EA 1EUDB 1I14A 3NGJA 2GLTA 5AVYA 3V1KA 1M34E 5C80A 3SZLA 4RDIA 2HLPA 3LL4A 2VUYA 4DLUA 2DQXA 4CG3A 3GGOA 3KEHA 4Y6QA 5KMGA 2DSUA 3UCDA 2OEJA 3JASA 1P1CA 5FA6A 3H1FA 4OBRA 2JIWA 3A9IA 1IVYA 2G96A 5EUBA 4QEZA 4UDXX 2RJGA 4KAXA 1RJWA 2V65A 3U1TA 3HFYA 1YDNA 4HVAA 4MARA 4MVJI 1AMNA 3EIWA 5AW5A 4U7PB 3L05A 1MG0A 4P7NA 2P9JA 1HE3A 3ZE0B 2C5LA 1RAKA 3BGAA 4RW5A 1KHHA 5ADUS 5TX7A 2E87A 1GGHA 4CKBB 1V7PC 2O1WA 4LF9B 4P3XA 2I4OA 4KFCA 4Q6WA 4C0LA 5F12A 3M33A 2JK2A 2XMDA 2D2EA 5JDCC 2NQ9A 2AFIE 5C2JB 4F2BA 3N0WA 1HM5A 4AX8A 3JTMA 4HY3A 3LWBA 5A6AA 3RV3A 1JSZA 3NLLA 1BLIA 4KX5A 5CNIA 3MWEB 3T1OA 2GBLC 4NCBA 1LK5A 3GNXA 1XN4A 2GEKA 4BVJA 4D57A 3HDQA 4EPRA 3Q3VA 2CNCA 2IHKA 2NWRA 4TMFA 2C4HA 4EMTA 4W7UA 3N6VA 5DEZA 4LYPA 2C0AA 1G2OA 4OXXA 4RF5A 4TPKA 3P81A 1TPC1 1ADYA 3M82A 3U1BA 2VX7A 3NBXX 1DIGA 2EOAA 1T7LA 2JI4A 2CHEA 2D0IA 1GJWA 3E0VA 1XVUA 3IUYA 2XMCA 1SC6A 1G2QA 4DR3B 4BVHA 5K2MA 4ZQOA 4UTJA 3PUOA 2VUUA 1Z7BA 3R5JA 3ZJYA 2P53A 1ZK1A 3VNKA 2XT0A 2PSHA 5GZ1A 1GUYA 4DXXA 2C2KA 5JO9A 1CP2A 4MLPA 1U0JA 2PRIA 3TVAA 1TMKA 4E33A 1SCIA 5KTMA 5AI0A 1XNQB 5D86A 4GGHA 2B8JA 3BAJA 2BH2A 1J18A 4UDNA 4R68A 2VPWA 4YGYA 1S3TC 1UWCA 1MVLA 4Z2IA 4Q32A 4ML4A 3SY1A 5B80A 4D02A 3RUHA 2PT9A 5T4BA 2GS9A 5BQ3A 1Z3NA 2GGIA 4XIAA 2Y93A 2OGJA 3NTUA 4ZCIA 4XKMA 4LNAA 2GWNA 1FDWA 3AXKA 1YXCA 3GIPA 4YCCA 1LDGA 4IM7A 4PLHA 2HJRA 3LDGA 1RLDA 1W3NA 1T9ZA 5K3EA 1T41A 2AEJA 1E0AA 2TRSA 1O08A 5EMHA 1BXNA 1I0LA 1G0CA 4DLWA 2JFHA 1AUXA 1OGJA 2PWBA 1SXJA 1RWXA 5HS6A 4CMKA 4KI0A 1WB9A 1HURA 4NAFB 1NN0A 3AHJA 2YWRA 3ZJTA 1XJBA 2QJFA 3MPGA 2IYNA 1ID1A 5AR1A 3J80A 1A88A 4PCVA 5KEZA 3I9OA 1VJTA 4IZ6A 4YMHA 1XVVA 3WQWA 1YJXA 1IOVA 5DLEA 2PRLA 4MV3A 4XM2A 4ZE4A 1G4UR 3AHXA 3SZOA 2QUKA 3N19B 4GS5A 3WO8A 4R2HA 4LJ3A 3EZ9A 1E3WA 3WMCA 3PANA 2EJ1A 4HUQB 4IGAA 3DVAA 5B7QA 1EDDA 3GVXA 3VPBA 2XCTB 1SHKA 4K2AA 3VR2A 2LRHA 1QUEA 4LQ4A 1S1CA 4DVJA 1JFVA 3LUTA 1XMIA 5JRJA 5TR9A 2GJXB 3QKSA 1ZOLA 3VNYA 3CV7A 2F1OA 5CYOA 5FL3A 1XH1A 4RCXA 4C7FA 4MV8A 3WISA 4FALA 5DQPA 4JY9A 5LA6A 3H11A 1YE5A 2QIPA 1OH8A 4A8LA 3OJGA 3DBVO 1KAGA 1N3BA 2REBA 1SM4A 2QN9A 2A59A 3DBHB 4L8YA 1VE6A 3I52A 3F1QA 4M98A 4HNSA 3A3XA 2BE7A 4F45A 3PWGA 1UXOA 2KQUA 3IEXA 4OK6A 4M8LA 4ZMSA 3JYLA 5JNSA 2JIZA 3SQDA 3HWX1 1ZEMA 1XIDA 1KCKA 3NQ41 4XARA 1DZ3A 1TEVA 3MI3A 3CZQA 1FS6A 3FSTA 1LRTA 2WFZA 4MVJD 5IM4A 2RGEA 5DN6D 3CL8A 2HLNA 4C4YA 3DBNA 1TO6A 4KQ1A 1MU0A 3NJ8A 1J8MF 1MWOA 2IHYA 1H0SA 4ADSA 4YAWA 4PFQA 3URQA 4B84A 2Q5OA 4MP6A 1CY4A 2WNSA 3PX2A 3MUXA 3ETHA 1I5EA 3CWZA 4S12A 1XC7A 3K32A 3KPVA 2ZYTX 1RDFA 4GVIA 1P7VA 3O8CA 4X7BA 2WMDA 1BN7A 3W05A 4A0HA