3LQGA

Human aldose reductase mutant t113a complexed with idd388
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
b'SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqgA00
2PF8A 1VBJA 4YU1A 1M9HA 3U2CA 4LB3A 2DUXA 3UG8A 2BGSA 3CAQA 4G5DA 3ONCA 5JH1A 3EB4A 4JQ1A 2DV0A 2PDJA 3RX4A 4PUWA 4EXBA 3FX4A 2IKHA 4H8NA 3UWEA 2PDXA 2P5NA 1JEZA 2HV5A 3R7MA 1XF0A 4IJCA 3DOPA 5DANA 1PZ1A 2R9RA 4JIRA 2NVDA 2C91A 1MZRA 2IS7A 4JTDA 3LZ5A 1YNQA 4LAUA 5LIWX 3H4GA 4EXAA 3COTA 3Q67A 1RY0A 3UZZA 1X98A 4JIHA 2VDGA 1C9WA 4XZMX 2PFHA 1RY8A 4WGHA 4YVXA 2FZ8A 2IPWA 4WDWA 3D3FA 4JQ3A 3BURA 4JIIX 2ACUA 2IKIA 2FZBA 3GUGA 3CAVA 3R8GA 4XZLX 2HEJA 1S1RA 4Q3MA 4L1WA 1UR3M 1A80A 2PD5A 5KETA 3FJNA 4DBSA 3LQGA 3F7JA 3UZXA 1GVEA 1YNPA 5HNUA 3LBOA 2FVLA 2BGQA 4YVVA 2BP1A 4R9OA 1US0A 4XAPA 1Z9AA 2PD9A 2DUZA 2PDPA 4WDXA 4XVEA 1ZSXA 3V0TA 1Z8AA 2IPFA 1AH3A 4GACA 4PMJA 3RX3A 3R8HA 3LN3A 2HE8A 3CV6A 3QKZA 1S2AA 4MHBA 5C7HA 1J96A 3WBYA 3P2VA 4LAZA 1T41A 3H7UA 2F38A 4YS1A 1XJBA 1ZUAX 2PZNA 2PDGA 1Q5MA 3LNMA 3O3RA 1AH4A 1S1PA 3V0SA 2PDHA 1IHIA 3MC5A 4RPQA 2PDKA 1K8CA 1Z89A 4JQAA 2PDUA 1X97A 2PDMA 3UFYA 3CV7A 3R43A 3M4HA 3R6IA 4WDUA 2PEVA 4AUBA 4ICCX 4FA3A 2PDCA 3UGRA 1SM9A 1ADSA 1X96A 1EXBA 4PRRA 1AZ2A 2FGBA 1PZ0A 3WG6A 2QXWA 2F2KA 3O0KA 2IPGA 3UZWA 4IGSA 4GIEA 5LIKX 3ERPA 4GA8A 5LIUX 1AZ1A 1EF3A 2CLPA 1YE4A 3T42A 3LZ3A 4XZHA 4PRTA 5AZ0A 2PDIA 1MRQA 4Q7BA 3N6QA 3UYIA 3BV7A 1LWIA 1YE6A 2ALRA 1LQAA 3H7RA 1RALA 2A79A 2INEA 4WDTA 1AFSA 4YVPA 3KRBA 4QBXA 4OTKA 1ZQ5A 4GCAA 1Z3NA 4LBSA 4NKCA 5LIYX 3GHTA 3VXGA 4FZIA 1MI3A 4XO7A 4JQ2A 3RX2A 3M64A 1R38A 3DN5A 2I17A 4JQ4A 4XZNX 3LQLA 3S3GA 2R24A 4XZIA 4GQ0A 3GHUA 3CASA 2PDNA 4HMNA 1S2CA 4I5XA 1VP5A 2I16A 1XGDA 3LENA 3LD5A 2ACQA 3UZYA 5JH2A 4FAMA 2AGTA 3C3UA 1T40A 4QXIA 1EKOA 1HQTA 4ZFCA 4ASTA 4DBWA 2WZMA 2PDYA 3R58A 4JTQA 2ACRA 2J8TA 2HVOA 4HBKA 2NVCA 3EAUA 1AH0A 4F40A 5LIXX 1PYFA 4PR4A 4H7CA 2IPJA 3V35A 5AZ1A 2FZ9A 3WBWA 4IJRA 3N2TA 1OG6A 4PUUA 3UP8A 4QR6A 2PDBA 3Q65A 2HE5A 4LBRA 4WEVX 2ACSA 3CMFA 2PDQA 3G5EA 2FZDA 5HA7A 2WZTA 2PDWA 3BUVA 4WRHA 3ONBA 2IQDA 3G1RA 2IKGA 3GHRA 1QWKA 1IEIA 4DZ5A 3WCZA 3V0UA 4QX4A 2IQ0A 4XVDA 2PDFA 1PWMA 3R94A 3LUTA 2INZA 1PWLA 4JTCA 1Q13A 3M0IA 4FALA 4GQGA 1EL3A 1QRQA 1FRBA 2IKJA 3WBXA 4DBUA 2HVNA 4GABA 4JTRA 2HDJA 1HW6A 4LB4A 2ISFA 5M2FX 4L1XA 3GHSA 3NTYA 3B3DA 2PDLA 3EB3A 4XK2A 1ZGDA 3BCJA 4JTAA 5HNTA 3MB9A 3LEPA 3V36A 4XO6A
chains in the Genus database with same CATH superfamily
2YLLA 2XGZA 2VD8A 1JXJA 1I2RA 2XIMA 4NXKA 2RFGA 1XCWA 4OJYA 4DPQA 5I78A 5H8UA 4GE8A 3ES8A 2P76A 2B0MA 5EGRA 1Y8BA 3QZEA 1KFCA 3QY7A 4GRSA 1ZENA 1V3MA 5HBFA 3K8LA 2C0AA 3CH0A 1KNWA 2R1KA 5HJXA 4H00A 3CYJA 4UNLA 4A22A 3UESA 5DANA 1JZ6A 3VNMA 4FOKA 4JFVA 3WQWA 2BXYA 1XYAA 4V27A 4M1RA 3VGEA 4PCFA 3SQMA 5DBUA 3QRHA 4PCPA 3E74A 4REQB 1UUMA 4CLMA 2BASA 3UCDA 3COTA 4IMEA 4RKAA 3I7RA 1GOKA 4JIHA 4LVDA 4XZMX 4A4AA 3E2QA 3GYCA 3CV1A 2ZTKA 2Y85A 3SCUA 3D3FA 5FL0A 4S1FA 2YBTA 1HJSA 1Q7MA 1Q6RA 1U1HA 4CUCA 3LOTA 2G4FA 2RDWA 3N6HA 1K1DA 4M7SA 3IJIA 4L6DA 4PTWA 1AJ2A 3EWZA 1UR3M 1VFHA 3BZGA 5KITA 8XIMA 2BOGX 1SUXA 4E2DA 1GKRA 1J18A 3EWXA 3LGDA 1Y0EA 3A23A 3EDEA 3NXFA 1KGWA 4W8BA 4GBUA 2FVLA 4E2OA 3PWIA 2BP1A 4I9JA 2FJUB 1VLIA 1E9ZB 1K8ZA 3MCOA 3FDKA 2Z2AA 1FWGC 3CQKA 2E7FA 2V3FA 4GACA 3BWWA 3PFMA 4K38A 3AHYA 3G77A 2BB0A 3RCMA 1UH3A 4NZJA 3TXVA 1WXJA 4O19A 3H7UA 4PCTA 3GDLA 4YS1A 4HZMA 3UPMA 2PZNA 4IT1A 2VQTA 2GLKA 5DELA 3O3RA 4CNPA 1JYWA 3RN6A 4GXWA 3HJZA 5CZKA 3C52A 3W0KA 3FK4A 3STEA 4MM1A 3HGOA 4N6FA 3R43A 2P0IA 1T8QA 3I6RA 1FFQA 2RGMA 4CQDA 4K39A 2KX9A 4E6MA 3FYOA 1EQPA 4FA3A 2G0WA 3LM3A 1N7KA 4DAIA 3PUGA 3I68A 4GWEA 3SFKA 1VHNA 2J62A 1IZCA 1EYEA 3URBA 4KS0A 5A95A 3TR2A 3C0LA 4DQWA 2P3ZA 1KM2A 2ZKMX 3UERA 1D3CA 3CM4A 3S0CA 1E0TA 1MW3A 2O7QA 3GIPA 2X05A 3MDWA 1AVAA 4KCUA 1IT8A 1NOUA 1UIOA 4GQRA 3D5HA 5K2ZA 1A4LA 5CZJA 3IIPA 4JTGA 3AS2A 5SWUA 5AB3A 1B3WA 2VQUA 1EF2A 1H5VA 4FZIA 1KTNA 4AC1X 4LANA 4OOZA 2GGIA 3ORWA 4DM1A 5ABGA 3VNZA 2PS2A 1W1PA 1I2NA 4MYAA 3CASA 7CGTA 1KCXA 2A7RA 2WMHA 2G95A 1Z7AA 5I7GA 3HMCA 3ZVHA 1VP5A 4DYKA 5HPOA 4IGNA 1W9DM 5HK4A 1IZJA 2NV2A 3LG3A 4INFA 4C6IA 2WJEA 3GBDA 3I7QA 5BWAA 3VOJA 3SADA 1JQXA 2VGFA 1EGMA 1IXPA 2OOGA 2J6VA 1I1WA 2Z1WA 4I5RA 3TYAA 4K6AA 5HATA 4UMAA 1PB0A 4AU0A 3B0UX 4BA0A 2WVTA 1DE5A 2WZMA 1J11A 2OYLA 3CHFA 4XAFA 3V3WA 4TO8A 1HJXA 1CXEA 4GI4A 1MQQA 3AO0A 2QCGA 1L8PA 1RPXA 2QJHA 3T2QA 1I4NA 1GUVA 4U5IA 2DJXA 1E5NA 5AHNA 4RUBA 5FF4A 3GNXA 3CPRA 2O9PA 3WFZA 4HSHA 3UP8A 2BVTA 3AXHA 2WJZA 4PMOA 5DMYA 1AODA 2IXVA 1OVDA 2HE5A 1XM3A 4UFMA 1XP3A 3UJRA 1W2VA 3NCOA 4P7LA 4PBEA 1CI1A 3G5EA 2DSZA 4G9PA 3QPEA 2YL6A 2G97A 3NNTA 1JZ8A 4AD3A 2DW6A 4MB5A 4HMEA 1XIIA 1TPWA 1J0YA 4RDYA 3RO6A 7PTDA 4ZBCA 2NSXA 3ABRA 4QP0A 4UQCA 4BHYA 1XBYA 1WP6A 3WCZA 5E93A 1RHCA 4XKYB 2R91A 3N14A 2WBGA 1TO3A 5XIAA 2DUAA 1Q6OA 4GNJA 5CC7A 4ENLA 3QBUA 4UR9A 1PWLA 2VDHA 4ZOAA 4ZTYA 4FALA 4DXVA 1V0KA 4ZE4A 3GQYA 4JOMA 3AIRA 3TUUA 4K8EA 1JRBA 1QRQA 4U5KA 5D30A 5MHBA 3L2LA 4IPJA 1XLCA 4QEEA 3EDJA 1T7LA 4NAEA 3WEOA 4CQ9A 3DHPA 4JIEA 3BICA 3B3DA 4M19A 3EB3A 4WKHA 5LA1A 2ISVA 3TZFA 2IXUA 3B40A 3W00A 1LBMA 3UPWA 3ZO9A 2VC9A 2X0YA 3W2KA 3OG3A 4A8NA 4HU3A 3VIIA 2DQXA 1WUEA 4OKDA 4QE5A 2J78A 3S5OA 3BPWA 4X0NA 1DJIA 4PMUA 1QK2A 4LALA 1OFEA 3ZVIA 3HFTA 3ITVA 4S3EA 1F3TA 4DPPA 3U2OA 3WK1A 3BSHA 4PUWA 3F5JA 4Q8QA 3N6JA 1XR2A 3CAKA 5D33A 2EKCA 3LS9A 2DT2A 2J66A 4O1EA 1I0DA 3WJSA 5G4EA 3O6AA 3A64A 1JDEA 3KZPA 3BOFA 2A3AA 1EEPA 1CGXA 3D0CA 3NPUA 2ZDRA 2IS7A 3QM3A 3OJGA 1SR9A 3TYBA 2J88A 4XIMA 3LCWA 5K4XA 1RJQA 1MXGA 2H90A 3WN6A 1WKYA 2ZZ7A 4N42A 3VD5A 3L4YA 4GZ7A 1RY8A 4RCXA 4DUOA 2V2DA 1F2JA 4I9MA 3WL1A 5KMYA 3N19B 1UJQA 4FSAA 4J3XA 4BCEA 2GZXA 4WXYA 4O52A 5BRQA 2VFEA 2C6QA 4QCEA 3BMXA 2NQLA 3R0KA 4Q8MA 1MFUA 2AQOA 1QPOA 2ZUWA 4BY3A 4XQ6A 1KRAC 3NZ1A 3A4XA 1FHVA 3QYQA 1W1B1 1VKFA 2QMJA 4J35A 1OIMA 2I57A 5CLWA 3ZFHA 4YVVA 2DZPA 3SCQA 4UR7A 2AQVA 1UHVA 1GOIA 1LBFA 3P80A 1W5QA 4OV4A 4KT2A 3W6LA 4Y9MA 4PMJA 1XKYA 1DJHA 1OD8A 3B0YA 5T9CE 1G94A 2F84A 3V18A 1M1BA 3PZIA 3TTOA 3GVVA 4M6PA 4TVDA 3WBYA 1JGIA 2ZFAA 1T41A 4X2RA 1J12A 1S39A 3F5LA 2DH3A 5BOEA 1XCXA 3VDGA 4FEZA 3FSUA 3C0SA 4YJ5A 3LU2A 2FPTA 3IEBA 3BO9A 1K8CA 5EY5A 1K8XA 1X6UA 3UR2A 5A8MA 1Z48A 4MPQA 4EVZA 3VZZA 4LS1A 4JDBA 3HG5A 2GVJA 4WDUA 1F4AA 4JTLA 1XYFA 3G3DA 4TX9A 3BLPX 3NVDA 4BR1A 1SM9A 5DMNA 1I60A 3OVPA 2OYMA 1QI2A 3NG3A 1W5NA 4GIEA 3ZT5A 1XL9A 4GA8A 1ZCOA 1UKQA 2R94A 3FAXA 3GK0A 4C6BA 1EJTC 1L0PA 3P5ZA 2WKJA 4ADSA 4GI6A 3ELFA 3UYIA 3PZGA 3M0JA 6XIMA 1YE6A 1M41A 3VINA 1MDRA 4YVPA 1H49A 5BOFA 1KXHA 3EXSA 5FJPA 3HMJG 2TYSA 5HDRA 3FSTA 4BZYA 4ONVA 4JQ2A 4UTHA 2CWNA 1Q85A 1ZFJA 4MY9A 5GNXA 3U2ZA 5T91A 3UXAA 2BHUA 1UCWA 2ZRVA 4K36A 3T08A 1V3IA 3M0VA 4PC8A 1M7OA 1IEVA 3VM5A 2OFJA 4JNMA 3E38A 1NFPA 4WSJA 1UA3A 3MUXA 4AD2A 4KH2A 3SCWA 1TE1A 1GW9A 3P0WA 2AGTA 1FX6A 3GG7A 1R9ZA 4UQAA 5F1UA 2DZAA 3RJXA 3IK4A 3PG9A 4UCGA 3VO0A 3GAKA 4DBWA 4TTGA 1V6XA 1R7AA 3MWAA 1GKPA 2PDYA 3UU0A 1OWQA 3I7SA 1WV2A 3QHOA 4QS6A 3EMCA 1LWHA 4JTSA 1I2OA 3M6YA 1LL6A 1H1ZA 1HX0A 2X7VA 2QCLA 4PMVA 4F3HA 1DIDA 2YXOA 5HMEA 3V35A 3N9KA 5MKGA 4A05A 4GGHA 1F6KA 1PX8A 3N2TA 4HA3A 1NM9A 2O56A 1MW2A 3CIVA 4CD7A 4ZB5A 4UTWA 4A3RA 4IP4A 2EG7A 1A0CA 1WZLA 4M80A 1QT1A 3GDKA 2VTFA 1A50A 3OLGA 1U5VA 2XWEA 3VDAA 5LNWA 3O6DA 1CLKA 4NRSA 1SYTA 4Q4MA 2C1GA 3A6OA 4W5ZA 3FGCA 5FJOA 2GQ9A 1VENA 4TV6A 1LRNA 3ATZA 1BGAA 2CNCA 1I75A 4H04A 2VEIA 4WUIA 1KCZA 1X39A 4JNZA 2TPSA 3LA4A 2QUTA 2PDFA 4R5EA 3IJ6A 4GUFA 3PUOA 4AZCA 3VDBA 3P82A 1DVJA 4HYRA 3B8WA 1HKKA 1O60A 2WW5A 1T8XA 5T8GA 4O16A 1V03A 2GJXA 4DBUA 4ATDA 4HU0A 4FOJA 2JF7A 2VEPA 3B9DA 4HOXA 3TTQA 2NXHA 3IACA 3P84A 3CBWA 2PDLA 4MFEA 5AOUA 1OEPA 1TPH1 1QNVA 3SN0A 1V6YA 1T5AA 3QV8A 3VIGA 3GVWA 1RA5A 4YU1A 4A8RA 2EGZA 2DPEA 1M03A 3P8JA 4RNHA 4BEUA 3E0WA 3ZLFA 4PUEA 1IXNA 2ZXAA 1IIGA 1T6MA 1GORA 5CGTA 2HTMA 3WF3A 8CGTA 1DJGA 2BHYA 1DQWA 3WL0A 3WDQA 3GTHA 3QPZA 1TRDA 3ATYA 1JPMA 3WDHA 3W7KA 1WZAA 1B3VA 1SU5A 3T07A 1NF7A 3TZNA 1HUVA 1IWBA 1V08A 1NFBA 2AAMA 2VR5A 4Y9PA 3B8DA 5G4WA 3EZ4A 2C13A 1QCWA 3C2OA 7ODCA 3RFAA 3II1A 4L61A 4WLCA 3CWHA 3S6OA 4G6CA 2Z1BA 1X98A 1Q4NX 3LV6A 4QIUA 3T2PA 1V7AA 4BQ3A 4WGHA 1P4CA 4L4OA 4YTQA 1TA3B 3SRHA 3S47A 3EWDA 4PE8A 4X0VA 4HHLA 3GXFA 2HSAA 3WH9A 1LOQA 2JALA 4LBUA 2C3ZA 1P7TB 4NZ5A 2GVEA 2YFOA 2V81A 1EIBA 1R3TA 3LERA 3TK7A 4QG9A 1F5ZA 1ZL1A 3E12A 4P5UA 3SCOA 2PD5A 1JG9A 4GC4A 1RLCL 4O57A 4B90A 2GQ8A 4WJEA 5HUPA 1LDCA 1FH8A 3GAYA 3M5XA 4O13A 3P67A 1CGWA 3CHEA 2Z24A 2OYKA 1XPGA 2KAUC 2BLEA 3VIHA 1TJ0A 3HG4A 1OK6A 2QCDA 4I6KA 3VZYA 3G1DA 1UASA 1LOSA 4DX3A 4JN7A 2WMGA 1EJ7L 4L5ZA 3B9OA 5I09A 1AA1B 3U2EA 3KZSA 5AHLA 5FJUA 2QV4A 4F9DA 5GNYA 2QPUA 5F1VA 1BXCA 1EWDA 3AS3A 2D0HA 3KL3A 3UNDA 4B2DA 1CNVA 2PDGA 1JZ4A 1Q5MA 1PUDA 2CLHA 1TWDA 4RPQA 4WY0A 3T0BA 3RM9A 3THDA 4NHVA 1EJUC 3BQ6A 3T2OA 5FD0A 2D24A 2YCLA 2Q8XA 4GUJA 4GK8A 4L6OA 3TAKA 2PWVA 1A5UA 3SCSA 4NZ4A 5FSEC 2HK0A 2TSYA 1EXBA 2I56A 4M51A 4B3LA 3LSCA 4ZO7A 4AFYA 4AYGA 2J7BA 2YJQA 2PRHA 2WCSA 4C6LA 1YE4A 1EOKA 3T42A 1CGUA 2PDIA 2DDXA 3OOQA 4S3KA 3B06A 1WBJA 4FXSA 3N3TA 3NQ2A 3SCPA 1ZQ5A 3BSGA 3WUFA 1M68A 3HG3A 1E6ZA 4NKCA 2GGGA 2JKPA 4JPGA 1W9VA 3F4WA 2A1YA 2ZVRA 4AEFA 3CUHA 3ZVHB 1UOKA 3TR9A 4WD0A 1ZB5A 3T09A 1BYDA 3E0LA 1PDZA 2D20A 3QYSA 2RDTA 3MKKA 3DCPA 3LD5A 3PPHA 3O1NA 3R12A 2NX1A 4ECLA 5JH2A 2YLAA 4PMYA 5AC6A 1KFLA 1XRTA 1VEOA 4IISA 1H1NA 5CEWA 4MTVA 3N73A 4XKMA 3E0FA 1NP0A 3OGSA 3FVDA 4FLRA 3ABZA 1XCFA 5IM51 3P3BA 2O92A 2XN0A 7TIMA 4AWEA 3O06A 1QATA 4HBKA 1GPWA 2FYMA 5A2BA 4PR4A 3BW3A 1F3WA 3RXZA 1LRQA 1LWJA 1YPIA 8TIMA 5AC4A 3WBWA 2OT1A 3SRFA 3BARA 3C2YA 2NUYA 3AQUA 1UP3A 1NQKA 3JU2A 2J75A 2AKMA 2QF7A 3RR1A 4BF5A 5FCZA 2OTDA 2WCGA 2JEQA 3WLPA 3I10A 2AOSA 4GY7A 2VDIA 4PBFA 2V5JA 2VNCA 1S2UA 3IUIA 2CC0A 3W2MA 4CQCA 1G69A 4K7YA 4DI8A 4C1NA 3VUPA 1MWOA 1BTCA 3CZGA 4XKYA 4DZHA 1KRCC 1QNQA 1FWAC 2QGYA 4NVTA 1PTDA 2VD9A 2V5KA 4O15A 4DZ5A 3MZ2A 1OCBA 1E71M 1C8XA 3LRMA 4XUYA 1W9BM 3UGVA 4RX0A 2PE4A 4IP5A 4ZXOA 4CN1A 3Q37A 4S3GA 3NYZA 3VMOA 3O6CA 4IWWA 4P8VA 3NGFA 1J01A 4UUIA 5I3DA 1XICA 1XYCA 1UROA 4TQTA 4S3AA 3QOMA 2I9EA 3W6MA 5AHFA 3MSYA 2DVXA 1KRBC 5DXXA 5C55A 2OWXA 3ZR6A 4HK7A 4XD4A 4OGZA 1TREA 4M56A 4F8XA 2XIQA 2EQDA 1S5TA 3AHZA 1LF1A 2Z28A 3GXPA 9XIAA 1PCKA 2W91A 3HV8A 3H2FA 4DXXA 3HPXA 3SQLA 5D32A 2QS8A 4C6PA 2G5WA 4JTAA 4LRTA 3KTSA 1RUSA 4DVOA 5I06A 3F2CA 1E40A 2WANA 3TNBA 5HNTA 4AC7C 3TDFA 3R5EA 3WLNA 2E8YA 3V5FA 4HNNA 3E96A 4ML9A 2FTWA 5A69A 3U2CA 2E25A 3NQ7A 3HIJA 3WF4A 1PE1A 2Z6IA 3AYRA 4NXSA 2V5LA 3EX2A 3AYSA 3ARVA 4F2BA 1B0IA 4LAOA 1JD7A 1ZJBA 1OG0A 3TONA 3CL6A 4AD0A 2WWDA 1G4EA 3KLKA 2HVMA 4RE2A 3ZJ8A 2ZZ6A 1ZAHA 3GVRA 2ZUSA 1Q66A 4TMBA 1UZ1A 3W7EA 4MUPA 3WYZA 2HNHA 1DWJM 1UC4A 2PDXA 1XXXA 2REQA 4A8LA 1XLDA 1FOBA 2WSYA 2R9RA 3BZJA 4JFUA 2Y2WA 3RO8A 3MA8A 4KF1A 3E1F1 3SURA 1FXPA 3H4GA 1R85A 3H4WA 1JDCA 1O5KA 1B3ZA 2OKTA 4TV5A 3NFUA 1KKRA 3B8UA 4MNMA 2QUVA 4GMEA 5KSWA 3SN1A 1J2BA 5CSUA 3T05A 2FZNA 1UD4A 4E5TA 4IUGA 1S46A 4GYKA 2IMRA 5REQB 1WDQA 3GNRA 2DZSA 2AQWA 3CWNA 3PBWA 3RILA 3C61A 1U5JA 3WDRA 4EOUA 3WLMA 4G1KA 3FNDA 4H9ZA 3UETA 4O0QA 3GIQA 3DDMA 5HQEA 1ZCCA 2Y5EA 2G8ZA 5CKSA 4AIUA 3DYMA 2R1LA 1NQ6A 3JS3A 1VLWA 3EWWA 3GS6A 1V93A 3KOYA 3QV6A 1XIEA 1G5AA 5FACA 4GVGA 1DBTA 3MCNA 4QFUA 3INPA 4HB7A 3AMLA 1R3SA 3RK8A 1Z42A 3HBLA 1DJQA 2E5BA 3CQ0A 1YBQB 3DFSA 5BU6A 5C70A 3S2JA 4XG1A 5I03A 1ZBWA 3N17A 2J9YA 2YBUA 1ZAIA 4WXZA 2AKZA 2CLMA 5FEPA 2AGKA 1WXZA 4F48A 3MC5A 5LGXA 3SUVA 3ABOA 2OOFA 2PU0A 3CEPA 4LF2A 2W67A 3DFQA 1X97A 4A3YA 4NJIA 4IQJA 3QMTA 1IF2A 4XAZA 1BWKA 1DWIM 3AUJA 4KWOA 4ICCX 5I3HA 3L4TA 2HISA 5K7JA 3SUTA 3F1QA 1GKQA 4V15A 1Q8AA 3W7NA 3QY8A 1MQPA 2F2KA 1S2WA 4IGHA 3SZ8A 1GYLA 1E55A 3CUZA 2XH4A 4GIYA 2CLPA 2YCKX 4AYSA 3G6MA 1CDGA 5KZDA 2XH0A 3CB8A 2XFYA 3A4WA 1V79A 5DEZA 3S1GA 5DBTA 1YDNA 3W53A 4MZYA 3SGZA 2FB2A 4A2SA 3GDRA 3CS2A 3S2NA 1HG3A 3YPIA 1SO3A 4AEEA 1UBPC 3BW4A 4WOQA 2B7PA 2QDDA 4KERA 4L6HA 1R38A 4DUVA 4BQ2A 3DKJA 4O54A 1XG3A 2Q3OA 1F4HA 2VFDA 3MMWA 4AY1A 4YYFA 5A6MA 3DFPA 3G0UA 4L64A 2BY1A 3GH5A 3BG3A 2CZVA 3RRXA 1IR2A 4AXKA 1VJZA 1A5OC 1C8VA 2D23A 2PLKA 1EIXA 1KA9F 1FWSA 3W7IA 1KW1A 1QNOA 3EX3A 2Z26A 3MYOA 3KTXA 3GC4A 3NQDA 3ARWA 1FWFC 3BL3A 1GOOA 3WH5A 2XFWA 3OU8A 4MGGA 1A49A 2FGZA 3TYEA 1IT0A 3SW6A 1GG0A 1TIWA 4F40A 3WK0A 3MZNA 2W92A 4UXDA 4AWSA 3IVUA 3N34A 1GYMA 2PPGA 3M9YA 4DXKA 2QCFA 2PDBA 6ENLA 2WZHA 2FFCA 4Z17A 3KCLA 4UTTA 3PULA 4RDWA 3EX6A 3EX4A 1QVBA 2XUCA 1QPKA 3WY1A 2FZDA 5HA7A 5JQ9A 3WNKA 3A13A 5F4XA 4I7WA 3QHNA 3BAJA 4U31A 5CZTA 2J6XA 3VC6A 2YW4A 3SB0A 1GW1A 3ARRA 3MI2A 4GYPA 2A0NA 3VAVA 4AMAA 2X1UA 3UYCA 3W75A 3SJNA 3UA4A 2D2OA 4LFYA 2YCLB 2EBNA 2Z1SA 4US5D 4AF0B 1GEQA 3KHJA 1AQFA 4ZOBA 1EL3A 5C6MA 1W32A 4E4PA 5D2VA 1RZMA 1OT1A 1J0JA 2RH9A 1DJXA 4Q32A 4UNIA 3G22A 3VIJA 3BOLA 4NASA 3PF3A 4EANA 3R79A 4GOAA 4R34A 1H60A 1A53A 4I90A 4RE3A 1V6WA 2GUUA 1EO7A 4QGCA 2XH2A 1M7XA 3W1XA 1GOXA 1AD4A 3AALA 2CBIA 3UWWA 3L5MA 3VU2A 4IPLA 3USBA 3C8FA 4CQ8A 3WEMA 4CEUC 2XDFA 4CKQA 1BFNA 1EYWA 1U30A 2Y7GA 4UR8A 4GUIA 2DUXA 3UG8A 4BEQA 1H61A 1K3UA 1D7FA 3H22A 3M6DA 1OABA 4OU1A 1TWSA 2VGIA 3HGSA 2D69A 1RQBA 3VYLA 3EPOA 2Y5JA 4B92A 3DC8A 3FIGA 1HTIA 4FI4A 5FJJA 3W24A 1S2TA 1I2QA 1SMAA 2A7PA 3OBKA 3STGA 3P74A 4EXBA 3ARPA 3FX4A 1GJUA 1C8QA 4MWAC 3C2VA 4D8AA 1VFTA 3NQFA 3TTYA 5HULA 1RD5A 2W0UA 3OHMB 4DF1A 3UQNA 2POZA 3WJWA 2XSAA 3P7YA 3H26A 4AZ5A 1MZRA 4NAEB 1W9PA 3L7RA 3V4BA 4HZ7A 1S5MA 5AVHA 1OK4A 2O9OA 4EXAA 4UTIA 4N4QA 4PMZA 5BRPA 1UUQA 1YEYA 1PEZA 1LLZA 3MJMA 3QY6A 3NURA 4MOZA 1TJ2A 4F66A 1KGXA 3E0VA 3ARZA 3WMCA 2WSQA 2IKIA 4XBJA 5U4NA 3IAPA 3B0PA 1VGAA 4XSMA 1VFOA 3TYUA 5LKYA 2XH7A 1KV8A 1EUAA 3AS1A 2WB5A 4IFKA 4FIQA 4UMCA 3TCEA 3M0XA 3Q45A 4FNSA 3PPFA 2PC4A 3N12A 2X1TA 1UOZA 1RVGA 3W7PA 5DFAA 1ECQA 3H6OA 4RNFA 2QJNA 1VFMA 1JPIA 1P0KA 4KFNA 5E0FA 1WAWA 4RV8A 4WDXA 4JNYA 1KTBA 4N9BA 3W83A 2YA0A 1WZKA 4CD6A 1TPEA 4OUIA 3RX3A 1HKJA 1QUMA 1MNZA 4JL2A 1E9LA 1UD5A 3CV6A 1H4PA 2JBMA 2CLKA 1Z69A 1AL7A 5JMUA 2DSWA 3KEHA 3P61A 3GG0A 1XLIA 2VEMA 4HNTA 1W5OA 3RM4A 3DESA 5DRCA 3VDHA 3ZWSA 4B5WA 1EOMA 4PTMA 5DY2A 2PDHA 2PDKA 1XBXA 2F9RA 3WF0A 2Z0IA 4JQAA 4FK9A 4RZ5A 4ZQNA 2PDMA 1PHWA 3CPGA 5BXPA 1UR0A 4PTDA 4HNCA 3G1XA 4MF4A 4US6A 1EP3A 3V1HA 1ADSA 3W29A 1X96A 2VOMA 2V0TA 4C5YA 3ZLHA 4W7VA 4PODA 2WHKA 2DP3A 1T99A 2BDQA 1TJRA 1POKA 2IUZA 4MJZA 4D2JA 3WENA 1TZ9A 5HNRA 1E6NA 3A4AA 3KDOA 4D6JA 4LUSA 4GCXA 3WUBA 1K6WA 3A3HA 4FX7A 3CUIA 2GJXB 4ZR8A 4LF1A 4MWAB 3TV8A 2YDQA 3MV01 3NEHA 4JN8A 3B8IA 3P81A 3MO7A 4PMXA 1RCQA 4OTKA 5CZ0A 2FDSA 1CB7B 1BXBA 5CCZA 5CC3A 1JFHA 4LBSA 3EMQA 2BBFA 4H9XA 2ZTJA 4LUTB 1GPFA 4C6CA 1GQLA 2DZVA 4J5NA 1OYBA 3VX1A 3NO3A 1KFEA 1QI5A 5F7UA 2PGEA 4JS3A 1WCGA 4NJJA 3MP3A 2WQPA 5D03A 8XIAA 2HPMA 4Q6XA 4TMCA 1PHQA 3HGJA 4JEJA 1MXDA 3CB3A 2ZDSA 3MBFA 1TYGA 4NSBA 7ENLA 1AW2A 4C6OA 1POJA 2CLLA 1UKSA 3DKLA 3OQ8A 1U1JA 2YXGA 1ZBCA 3N4FA 3G8RA 6REQB 4Q6JA 1H7XA 3FA5A 4GY0A 3I4EA 3LHWA 5HWJA 4AY8A 1QMLA 3ABQA 5EB8A 1HN1A 3PJXA 3VA8A 1IV8A 1FXQA 3W1TA 3VK5A 4TXEA 4Z2LA 2W62A 2PLJA 1VIZA 1AJ0A 1Y5VA 3T6CA 2ACRA 2HVOA 1ZS2A 2PTWA 2NVCA 3WBEA 2PTYA 1PYFA 4IIFA 3OVGA 2GL5A 3RLGA 4AEOA 4S3JA 4HTBA 2NLIA 4HPNA 4O1FA 5HOSA 3WQ4A 1Y5XA 1H7NA 4S2CA 1GGOA 1EDGA 3S1UA 5IOBA 2W5FA 2J7DA 3NO5A 3WLTA 3P14A 3N25A 1UKPA 1W9UA 5I00A 4EE9A 3QC0A 5D8WA 3C0JA 2Z2BA 4GNVA 1JYXA 3NWRA 3RG6A 1RH9A 4PZVA 1CCWB 3MMDA 1ECEA 1YADA 1J0KA 4PBGA 4NI8A 5I23A 5T26A 2W6RA 2E6DA 1WUFA 2JGQA 4QX4A 2FZMA 1TTPA 2XISA 4DO6A 4UIOA 4PMQA 3UJFA 1SJBA 1AW5A 4QM1A 4Y6GA 1V8EA 3R94A 1F8IA 3HPFA 4PEEA 2E4TA 4JY8A 3M7SA 1NWTA 1VBRA 4GPNA 3HZ3A 1JDDA 1RK6A 3PY2A 4L7ZA 3UZ5A 3DH7A 1B9ZA 1CGYA 5TNVA 1D3HA 2DSKA 3PP7A 4S3DA 4G1NA 2WXDM 1VPQA 3EKZA 4OIFA 2X0SA 2PC8A 6A3HA 1XFCA 4D6FA 4HU8A 6TIMA 3TQ0A 1OCQA 3BAIA 3BCJA 1X6LA 4AVNA 3RLHA 1TTQA 2WC3A 1XIHA 4WY0B 3WQEA 4W87A 3L0KA 4XWUA 3VKJA 3RU6A 4LB3A 1CZ1A 4DJDC 2XZ7A 3DAQA 3S4TA 2XU2A 4JKMA 2VX5A 4MVAA 4CN4A 2WVUA 1L8NA 3QV9A 1UD6A 3H2EA 4CCEA 2DV0A 2CEQA 3LPPA 4KGJA 4MWAA 4RK8A 3GC2A 1H7RA 3LRKA 3M0YA 5C5YA 3BGJA 4XAGA 2TMDA 1C91A 1FWCC 4AH7A 3G2GA 1TJPA 3WLHA 1YXCA 1H62A 4D6GA 1Q4WA 1SFJA 2ZUUA 5A8OA 1CBGA 1FFRA 3L9CA 4DAFA 2I5QA 1NFGA 1TQJA 2JEPA 2WC7A 3B97A 2V2CA 4HMCA 3MWCA 4LAUA 3WLQA 3L4ZA 3NZRA 3OYZA 1TVPA 2WVVA 2ZUMA 4LU0A 3EWCA 4LS2A 4DZAA 4XIAA 4D1JA 2ZRUA 1RP9A 1CGVA 3N18A 3MCMA 2YR1A 1O4UA 1L6FA 3IGHX 4DLMA 4YVXA 2IPWA 8A3HA 1BG9A 3EX1A 4I9AA 3TLLA 1FP9A 1RJRA 3L4UA 3S6DA 2ACUA 2ZOXA 4OHQA 3RUBL 3GUGA 4AVFA 3CAVA 3W7OA 1GWJA 4FP1A 3FXGA 3U8GA 4K8HA 1KV5A 3ZJKA 3WK3A 1F76A 2V30A 3GXMA 5FAJA 3SQSA 1XSIA 1ICQA 4P8WA 1CECA 5CG0A 2FMOA 3UZXA 2Q71A 4I7UA 4MKSA 4QG6A 5I0DA 1BQGA 3VGBA 3GRIA 4AZBA 1WA3A 3GDTA 2DW7A 2Q8LA 1VEMA 2WMKA 3AZTA 4O18A 1TV2A 3C5QA 4W8AA 1ZSXA 2FGLA 1Z8AA 1TV5A 4YLWA 1W5PA 1CLXA 1PTGA 1AK5A 4YTUA 1HF6A 2D3LA 3P2VA 1YBQA 4D6IA 6XIAA 2VZSA 4JZ5A 4Q8UA 1I6NA 3W6YA 4AZCB 3PBGA 2RAGA 3IK2A 4XTIA 3SI9A 1BHGA 1V0MA 2Y24A 3LLDA 1CT5A 3L67A 3K8KA 1GK8A 3ID7A 4EIVA 1R47A 3WLLA 3ALGA 4GFIA 1XLHA 2OQHA 2Z6JA 1OM0A 2PEVA 4LSBA 3CAWA 3PTKA 2OX4A 1E0WA 2E09A 5BWFA 5AHEA 3UGRA 2XFRA 4FLSA 1JCNA 2OZ0A 1AZ2A 4AZHA 4BQ4A 2FFIA 4H9UA 3SCTA 2EPLX 2PA6A 3UZWA 4H9YA 4WJ8A 4FXJA 1UR9A 1W3NA 3LRLA 4XX6A 2A3HA 2QULA 1R86A 2Y62A 2V69A 1F73A 2WVSA 1DJYA 4O8RA 3BV4A 1TWIA 1Y7VA 2ALRA 3O9NA 1DV7A 2XVKA 3W1LA 1EJSC 3GR7A 3QC3A 2CXGA 2PSNA 4QBXA 3TC3A 2X2YA 4E2VA 4MB3A 4DEFA 3HG2A 4RZ4A 3DENA 4LUJA 3W73A 2VFIA 2QCMA 1PKLA 2JKEA 5D38A 1Q6FA 3GHTA 3G1FA 1GVFA 4ACYA 2R82A 4G8TA 1XYMA 3RX2A 3WQVA 4JAWA 3W22A 1GHRA 1XD0A 5L6UA 3GHUA 1E51A 5ABEA 4ZEPA 4CU7A 3FAWA 1XGDA 4QAWA 4V1XA 4GXMA 3MHUA 3MTWA 3TN5A 1C93A 3KBSA 4H9VA 1ZZMA 3PZVA 3CUFA 3KOXA 1IEQA 4TUFA 4EPEC 5E5CA 4N9DA 4IG2A 3W70A 1T40A 3R0DA 3WKZA 1WKFA 1LCOA 3W23A 2YPIA 5CJNA 2Q02A 4MLJA 3NJ3A 1KLZA 1P0BA 4DNHA 4PSRA 2ZA1A 2Y8UA 2V67A 3WFAA 3ZM8A 1PIIA 3TTSA 4FO4A 5HXMA 3C6CA 1XRFA 4D6DA 3CT2A 2QCCA 1F9CA 1AH0A 1E0XA 1BVNP 3AXKA 4D8ZA 4UTJA 2IPJA 1UWSA 5J8LA 4MFDA 4AXNA 4DWDA 1OZQA 3HN3A 3IUHA 3PSVA 3NSMA 3RGTA 1H63A 4ZA0A 4UOQA 4NZ1A 3IGXA 1PIFA 1GQIA 4JTTA 1HO1A 3ZYZA 3GC5A 2PRMA 1H0IA 3AXXA 2J7CA 2Y1HA 3TOPA 3GBEA 2FJKA 4QEHA 3DFOA 1S3TC 2OQYA 1XQKA 4GINA 3MYPA 3WQ8A 3A12A 3WLIA 4KWSA 1XSJA 2Y7FA 2IKGA 4XTDA 4RNJA 4GJJA 2NXGA 2V3DA 3AZSA 4HZ6A 2HCVA 4YYCA 3TA9A 5G4HC 4KRTA 1OC5A 1AQ0A 4LV4A 1NWRA 1W31A 4OBSA 5DF0A 3AI0A 1DXEA 1V3LA 1VPXA 3WQGA 4M81A 5JU6A 4JKKA 1IXQA 4XZBA 1OJXA 1H1YA 3ITTA 4HNVA 3EXTA 2NV9A 4Y9AA 4HHPA 4CVUA 3AIUA 2VRKA 1DQUA 1NOWA 2I5GA 3MS8A 3GNOA 2NQ5A 4W84A 3KE0A 5CPLA 2BV9A 3VKBA 4M6UA 3GXDA 2YDRA 3WK2A 2BWGA 4KIEA 3AIEA 4A2RA 1LG1A 2HROA 3WZ0E 1YW1A 4MWAD 2GPTA 2ZRYA 3N2OA 4C1NB 4DB7A 2YXXA 3VZXA 2PTZA 2PGWA 4OT7A 4GZIA 3HOJA 3URQA 4UFHA 3TFXA 1UG6A 5H8PA 4JIPA 1KQZA 4GKLA 3TW9A 1XYLA 4AIOA 2BY2A 1G01A 4HN4A 3M16A 3PTQA 1H5YA 2DT0A 1UYQA 4KWVA 1W1A1 1PDYA 2O9RA 1R5YA 4ZQPA 3KBNA 3AUOA 3CHDA 3R7MA 4H8UA 1TMQA 3VDCA 1R3WA 2XM1A 4HJFA 3UEQA 2YZ5A 4KEMA 3LNPA 2NVDA 3N11A 1LT8A 4X9SA 3QPYA 3IJ9A 3C8NA 1XRSA 1E6SM 4Y7EA 2QNEA 1DHPA 5LHFA 1D9EA 5DT7A 1XD1A 4RR4A 1UB3A 4HZ8A 1E1FA 2PZ0A 1V7YA 3HB9A 4WDWA 5JIWA 5GJNA 1ODUA 1THFD 2OEMA 2VFFA 4JIIX 4G56A 3RHGA 3SEPA 3AZRA 3LBCA 2GUBA 3TN3A 1MO0A 3VMNA 4C90A 3VX0A 2BOEX 2W27A 2HEJA 4YHGA 2HBXA 1KWKA 2RKXA 4HNLA 1HKVA 1MYRA 1Q6GA 5KETA 1GZ1A 1C92A 3GH4A 2XIOA 3F7JA 2PWUA 4JL1A 3GU9A 4MG4A 1GVEA 4UTWC 2FKPA 2H8XA 4E2BA 3LBOA 4DRSA 3W38A 5DXYA 5A6LA 3LM7A 1RAKA 1US0A 5CPQA 1ZP3A 3NAVA 3RLUA 3WD2A 3B9EA 1HVQA 4IFOA 1EA9C 2EJAA 1LORA 5RUBA 2ATSA 1VZWA 3NXLA 3CMGA 3PWGA 4AZGA 4Q4RA 2ISDA 1E1CA 1R2RA 4CNOA 3W7DA 4MJ4A 1S2AA 3OA5A 4PCNA 4J40A 3P8IA 3GWQA 3UWYA 1FWNA 5AC8A 4IX0A 2DZUA 1QW7A 4PFHA 1ZUAX 1RR2A 1PJ9A 1SVDA 5G1TA 2VZVA 4PUNA 3E49A 2DIEA 2GK1A 1YDVA 1RQEA 2VR2A 2CKSA 4J27A 1QO5A 5AC5A 2PU1A 2NT1A 1YXYA 3BTNA 1W1VA 4S3FA 4O1DA 1A5BA 3MUY1 1OIFA 1PAMA 3HQNA 1EC7A 5EMYA 4IX2A 4DN1A 2G3IA 2IW0A 4MZ8A 5DCEA 3QLDA 5M5DA 4LOCA 1CB2A 1NARA 2IPGA 3D46A 4CU6A 4FNRA 3F03K 1DL3A 3PHAA 5LIUX 4GJ1A 4NAFA 3BLDA 1G4TA 5I3FA 1FWDC 3CZJA 3E02A 3BLIA 4KCTA 3W1NA 4PRTA 3GXIA 2A21A 2AAAA 4LVAA 3RJYA 1ME7A 4EX4A 1CW2A 1Q6LA 2PBOA 1NELA 4Y8EA 4F2TA 2E8ZA 3ANUA 2HNEA 4WK9A 5IDIA 1VCVA 1DIOA 4KCVA 5JXQA 5CPMA 2X2GA 2A3EA 2GWGA 1XISA 4UOZA 3CXOA 1XRVA 3RITA 2OWCA 3LQLA 3VFLA 3S2LA 2C18A 4TX6A 3PBUA 3F4NA 2VYOA 3T0TA 3T40A 1GVSA 4OOUA 1W3IA 2KZHA 2I16A 1KR0A 5M17A 3UCCA 2SFPA 3L66A 1FKWA 4L9XA 3A4JA 1P1MA 1HT6A 1H51A 1VAHA 3H2CA 4J3SA 1V3KA 3SCRA 3U4FA 3U6WA 2DEPA 2ODOA 4KWWA 3T81A 4UTKA 4N4PA 4RE4A 4NF7A 3A3WA 1NDWA 1TPB1 3DYPA 3UVAA 4TOQA 4V1YA 2F7FA 2OQLA 1IQ8A 3UZJA 3WLRA 1VFLA 4P61A 3KRUA 2O9TA 5AVNA 1IZKA 1OGBA 4HCLA 1ADOA 3NL5A 2CCRA 1J0HA 2YCJA 3KM8A 3N2XA 3DI0A 3TTEA 2W9MA 3TSBA 2CLIA 1TWZA 3OZPA 3BJFA 1M3UA 5ABTA 4CNNA 2XVNA 2BOFX 4ZQOA 4MB1A 2J7HA 4J2PA 3M43A 3DYOA 1DPMA 4LNYA 2YOCA 4J3VA 2VEFA 4LY4A 5IBXC 5ECUA 2JK2A 2VCBA 3B03A 3W07A 1NSJA 1QHOA 3GZ3A 5ABHA 4DJFA 4F9JA 4IFKB 4GH3A 7TAAA 3QTPA 1BWLA 1EQCA 3CK5A 1QPNA 1RCXB 1Z44A 3STPA 1IEIA 2RDXA 3UXKA 2ZE0A 3EWBX 4QJ5B 3BJTA 4GYJA 5CSYA 4W4QA 3VIPA 1PWMA 1EDQA 2XSXA 3WLOA 4AAJA 3LUTA 2FVMA 4UOJA 1TELA 5CJMA 4IFRA 2NQZA 5CAHA 1ZAJA 4I9TA 1K9TA 3ZMRA 4GQGA 1OT2A 5D2TA 1R9XA 4OBRA 1KKOA 1H41A 4UBPC 2IKJA 3LPFA 4L9ZA 4G7EA 3U0HA 4Q4SA 2BZNA 4NNCA 2HDJA 1HW6A 3RRAA 1J0IA 3GG8A 4PMDA 1FCUA 4XK2A 4UQ9A 1W3TA 3MB9A 4QS5A 5D9PA 1GTHA 5E6YA 4CEXC 1PIGA 3THUA 1K8YA 4E38A 2HPIA 2HS8A 7XIMA 3QQ1A 3MP4A 1JF6A 3MPGA 7REQA 3WQFA 5CBIA 3VGDA 1DP0A 1BKSA 3VILA 2HRWA 3FYYA 4LW7A 2WPBA 2IKHA 2HS6A 2PWEA 1RA0A 3APTA 3NZPA 3PM6A 3E0IA 1XF0A 5DO8A 2GOUA 3H54A 2PWFA 1XLBA 1E15A 1PZ1A 4J3ZA 3SSZA 4ZGYA 1E6PA 1OC6A 1P6WA 1TE6A 3ITOA 3FDGA 4RPPA 3KOZA 5I79A 3N9RA 4H1ZA 3FV9A 1O12A 4LGXA 5KINA 2OGYA 1M6JA 4LUYA 2F61A 2VCAA 5GQBA 6ALDA 4LUTA 5CH9A 5KZMA 4FPSA 1RD6A 3EOEA 1XSKA 4J3WA 2UV8G 3M5ZA 1EZ2A 2F6UA 3L5AA 4J2MA 4GUGA 3TN4A 3UR7A 3RPTA 5BRBA 5CQ1A 3SR7A 4UTUA 3OW1A 1W8GA 4LTSA 4ZB2A 1UMLA 5ENLA 5FJTA 4L1WA 4FMVA 2C0HA 1A80A 1TKKA 3TC7A 4DBSA 3C2FA 5FF3A 2X8RA 4ICNA 2ZXDA 1HVXA 3S5YA 1YNPA 4ADUA 3SUUA 3G1HA 1JZ2A 2V5CA 4OZOA 1TZZA 5D2XA 3CQHA 2RHGA 3THQA 4X22A 4QLKA 5D04C 4R9OA 1KFKA 2VI0A 4KW2A 1ML1A 1AQHA 3UD6A 1HO4A 2VL4A 5D9NA 1VJIA 2NW0A 5A6AA 1EJXC 1E5JA 5LYRA 3BOXA 1E6QM 1EBHA 1Q6QA 5CPSA 3RPDA 5MF5A 4IIGA 2JF6A 4O12A 4A35A 3HM7A 2R1NA 4KGLA 2PBGA 4IG2B 3Q94A 3FKRA 3LTPA 2FTYA 2J24A 1XJBA 1RJPA 4IIDA 3V16A 1OFPA 3LTSA 4NY2A 5EBAA 1AH4A 1BG4A 2PP1A 3G0SA 4GVIA 3O0FA 4M3PA 4KIRA 1VQTA 1ZU8A 3LHYA 3XISA 3USZA 1LL7A 3QLLA 4IXHA 3UFYA 3CV7A 2H3BA 3DFHA 4K37A 2CBJA 4AUBA 4YCOA 4LUSB 3O8AA 3R13A 2Y89A 2GJNA 3W01A 1Q7QA 1WPCA 1BKHA 4P8XA 1E43A 3LX9A 4UFIA 1OC7A 2NZLA 3BH4A 3RMEA 3HFYA 5LIKX 4EKJA 1JRCA 4B2DD 5HWNA 4V33A 4PB4A 1IYXA 1QW9A 3D3AA 3POHA 1ZALA 5CBBA 3ZSSA 3ITXA 4QJ1A 4XZHA 2VWSA 2P88A 3SY8A 3N6QA 1FVPA 1RVKA 2X0HA 1LQAA 1RALA 4Z1DA 1LJYA 4LCQA 1SJCA 4NILA 2XPKA 1SMDA 3IJQA 1JDFA 1PKMA 5BROA 3DFTA 1B57A 1FWWA 4MPKA 5M1TA 3M64A 2Y7DA 4K8GA 2RJHA 3CIWA 4MSSA 1KWGA 3B0VC 3S3GA 3T4CA 2CERA 2PWGA 3DC0A 4ZE5A 1NDVA 3MMTA 5G2IA 1LG2A 4FB7A 4ZOEA 2YB4A 2WJDA 4QISA 2Z25A 1O5QA 3PR2A 1LL4A 5JBFA 1Q7ZA 3SECA 4JCMA 4UB9A 3EKGA 5HAOA 1FUYA 4QXIA 4JR5A 1GVQA 1EKOA 2TRSA 4EWJA 1HQTA 4ASTA 1I2PA 2WLZA 1G7UA 4LCRA 1KM0A 3CUXA 4C6KA 5EMUA 1TV7A 3QV7A 3W76A 1UWIA 5ABFA 1TPC1 1SW0A 4PUDA 1FH9A 3GR4A 3JRKA 4WJXA 3NQGA 1K6AA 4WSKA 4I8DA 1K77A 4Z0SA 4QE4A 4ZENA 1HFBA 3GX9A 4N0RA 3BLKA 1A5CA 3ZOAA 2ABAA 3VOHA 2ONEA 3K30A 3TQVA 3H23A 2OSXA 1H3GA 3AHVA 4LJ3A 4AISA 3PPCA 1MEIA 1FDYA 3TWAA 3FHAA 1BQCA 4J28A 3FEQA 4JTUA 5HUOA 4XBKA 3K4WA 4B5VA 3KBJA 2XJ7A 3G1RA 5FEXA 3O2LA 4C6NA 1N8IA 1W91A 1FTXA 3WQDA 4JEQA 1NH6A 1TSIA 3ECQA 4K1GA 2ZWYA 1UR1A 2ZZ5A 2ZRWA 3KX6A 3NGJA 3WJZA 4AWUA 2VEKA 4GYFA 3W71A 5JBEA 1EEXA 2DT1A 3LHUA 3ZJ6A 1WKDA 1J0ZA 2WSPA 3M47A 3ZR5A 4BJHA 1OFQA 3KBWA 1ZLPA 3WBXA 5EMMA 3RMJA 4K3ZA 4PN2A 2WNWA 3PWAA 4KBXA 3KFTA 3AU6A 2WM1A 2ISFA 5HWMA 5E6ZA 2D2HA 4ZMGA 1ZGDA 4GYPC 1CLVA 1OX4A 3ABSA 4N7QA 1XIMA 1R30A 1A3XA 4FLQA 4LEFA 4PH6A 2FPVA 3ITLA 1UMYA 3VKCA 3IIXA 1SZFA 1HL2A 1VCGA 1US2A 3ME3A 2GDQA 4ZQCA 1LYXA 4Y9OA 3THAA 2BG5A 2FLIA 4UC5A 5GPRA 3VGHA 4JQ1A 1UQYA 4C1LA 4NL1A 3MU7A 2E40A 4JN6A 3QGVA 1RV8A 3VOCA 2NQ9A 1P48A 1NAL1 3GNDA 1FHLA 2I1OA 3TYCA 3AMKA 3TOYA 3GO2A 2H9AB 3LHTA 5BOOA 1YPXA 1OGSA 4ZO9A 1KB3A 1H11A 3BC9A 4JYDA 3RU8X 4JIRA 5DQPA 2V3GA 1SO4A 1E6RA 4AWTA 2NWSA 1WZMA 3PB0A 1ONEA 1XLMA 3HPAA 4LYPA 1LZOA 4TU1A 3ENLA 2DSVA 1PS9A 1RY0A 2I9UA 3OGRA 2OB3A 4JTJA 2E6AA 3NDZA 5HJLA 2HK1A 3L68A 3CIXA 4UTLA 2V68A 4LAMA 4C5ZA 5D05A 1QHPA 3VNYA 1ZY9A 5A2AA 4GIRA 4J1OA 4S2BA 3EDFA 4H41A 4JQ3A 2AMGA 1XFBA 3B8SA 5G1YA 4QROA 3GU1A 2OELA 1TB3A 2YYTA 4G2DA 1QR7A 2J47A 3WF1A 1B3OA 2GVLA 3PUEA 3BLFA 3R8GA 1F07A 1ZBKA 3OTRA 1JCXA 3PBVA 4Q3MA 3LCIA 5I3IA 1H7OA 1EPXA 1E4IA 2G3MA 1IGWA 3WQPA 1OYAA 4GQBA 2DORA 4K68A 1S38A 4JDYA 4YNGA 1OF8A 2E9BA 3AIWA 1BRLB 2PTDA 4QG8A 4FR1A 3UVIA 2D2JA 1W0MA 4Q22A 4LVBA 1RXOB 1TV8A 1AG1O 1HNYA 4S3CA 1DWHM 8RUCA 3LN3A 3L5LA 4XD5A 4XZ9A 1KQYA 3N4EA 3QEZA 3OEXA 1VR6A 1ICSA 1E3XA 2VELA 4FX8A 4C7DA 2CLOA 4DJEC 4EPBC 2BFGA 4D6CA 1EPVA 2J7GA 1BYCA 1QASA 3EA3A 3W02A 1ZRQA 2Q09A 3EWYA 2XTKA 4FIRA 2WM0A 3PVFA 4CU8A 1REQB 2WHLA 4QCFA 1A5SA 3QZ6A 2PDUA 5I07A 3MSRA 3R6IA 3OA3A 4WSHA 4LRSA 3WJYA 1OZMA 3SY1A 4JYFA 4XUGA 4CCDA 2XWDA 3AIBA 2OLHA 2EG6A 1EWEA 4R88A 3CL7A 1V3HA 4IMDA 1PKNA 1XGEA 3CQJA 4S39A 1UR8A 1L2UA 1AMKA 3EEGA 1A5NC 4E3VA 3ANYA 4HTYA 3Q58A 4ZZ9A 3W27A 1WKEA 1BSLA 4LPCA 1KFJA 2AL2B 3BSMA 4EK7A 2VVNA 1UD2A 3TIMA 4E8DA 3UJSA 3NQ6A 2QDEA 4QSHA 3VXGA 1VHCA 2NX3A 2GGHA 1R46A 2G37A 5CJ5A 1H7PA 2B4GA 4HNOA 3B8VA 1A5MC 1OCJA 3IVSA 3CUGA 3LCLA 3WQ5A 4M29A 3KTCA 3VIKA 1S2CA 1GOMA 4Q8TA 2J7EA 2ZC8A 3R2GA 2PODA 4DUXA 2R1MA 3W2UA 2XVLA 3AIQA 4O8AA 2C19A 1B9BA 3GYEA 3N2MA 4HHHA 3FY1A 4HPXA 4UFKA 2XINA 4DO5A 5AYXA 4DBEA 2FHFA 3OG2A 5F4SA 1TVLA 4ZFCA 3GUWA 3WNLA 4ERIA 4PMNA 3M0HA 1KLYA 1A0EA 3G8EA 3T8QA 3KDNA 5BCAA 4FLOA 4E8CA 2UY2A 3SIMA 2ZUTA 2CZDA 4OECA 1VYRA 3GTIA 2E1WA 3E2SA 3A3XA 1NDZA 2FZ9A 4I6VA 1MVYA 3LV5A 1R6WA 2ALDA 2HMCA 1LT7A 4PUUA 4JYEA 1J8VA 3WMLA 1YPFA 4FX6M 1I0BA 4E4UA 3S5SA 3P60A 1W3KA 2ZVIA 1BEUA 4GVFA 4JBRA 3W7QA 1LUCB 3GB6A 2E9MA 3TSDA 1BRLA 3BE7A 4HA0A 2BTMA 2IQDA 2BX7A 3EOSA 5C8BB 3T1GA 4ZQMA 4DJEA 4P2VA 2UY3A 3TH6A 1EBGA 1R87A 3CTLA 3T8LA 1J6OA 1OGGA 3NR0A 1FH7A 3HGRA 3H2MA 4RJEA 5G2WA 4PTXA 4FOUA 4DNMA 1VCFA 2NX9A 1XBVA 2J7FA 2WBKA 2DT3A 4NRRA 5DY3A 2QCDB 4GXPA 1Q13A 2I5IA 2VC7A 4JX4A 4CQAA 2O4MA 4HCHA 1DIEA 3PNZA 2Q01A 3CZLA 5DT5A 3AWOA 4F0RA 4Q4OA 2GVYA 2A3CA 1JNEA 1WQ5A 1XIBA 3BCDA 2FH6A 3T55A 2VCCA 3NDYA 3QH2A 4UZUA 1ISXA 3RAOA 1V6VA 2QLYA 1B31A 4AZIA 4D9PA 2FVKA 4AMCA 2E67A 2WZEA 4BWLC 1KXTA 1M9HA 4MYXA 4GX9A 3R25A 3QKEA 3VMPA 2MANA 3W1AA 2BGSA 1RBLA 3O16A 1EDTA 4TVUA 5JH1A 4DJFD 3CLWA 1NJJA 2Q8ZA 2A5HA 4M6VA 4FF7A 4GBDA 1CX9A 1JI2A 3GW3A 2C7FA 2OSWA 5C2XA 1PL9A 4ZL1A 3FKKA 2DQWA 2EPMX 3WDPP 1DTUA 4GQQA 4NAFB 1XIFA 3UWEA 1TV3A 3IARA 1GG1A 1PZ3A 3S46A 1JEZA 3KCOA 3UXDA 5A8QA 4GX8A 3KWXA 1UKTA 3DOPA 3ARSA 2J9XA 1TTIA 1X7FA 5E09A 1PV8A 3A9BA 2OGJA 1N2VA 4J4KA 1MDLA 4YN5A 2NUWA 2PURA 2YW3A 3UJ2A 2W79A 4AHOA 4WZHA 1BF6A 1KC7A 2ZADA 2DZTA 1EHNA 2QAPA 5TQLA 2QQ6A 1KM6A 4PEKA 4S3BA 3U9IA 3URAA 1RPKA 3HQ1A 4DHGA 1JCYA 2J4GA 1XDMA 3PN8A 1CPUA 1G4SA 3DERA 1OHLA 2Z1KA 3NVTA 4GVHA 4GY1A 4LQ1A 3W1UA 4JFTA 3PB2A 4Z2GA 1HL8A 4KEVA 4MWAE 3V5CA 4AIEA 2WVVB 3JZUA 4JY9A 2YBVA 4H19A 3RPMA 1NWSA 4QDPA 3LXCA 2V5BA 2BS9A 2VRQA 4F4RA 2EPNA 2ZCGA 1F7BA 2VR4A 2JFEX 1X7IA 4I7VA 2VP8A 4XAPA 3W26A 2BY3A 1J79A 4I8YA 3VKAA 3KHDA 3O6YX 4EPKA 3PC0A 4XVEA 4WKFA 2IPFA 1AH3A 5D2YA 4FNUA 3SM0A 5HMSA 5B7ZA 1MMFA 3RNDA 2NUXA 4O4VA 4NZCA 5IDZA 2DIKA 1DTNA 1IE7C 2XHYA 5H1WA 3U57A 4GZEA 3TN6A 2WMIA 4H2CA 1EJRC 4IUOA 5E0CA 2PGFA 4BWLA 4J7RA 1V6UA 3LNMA 4S23A 3QMRA 4Q7IA 3V0SA 3K2GA 3KVJA 4AX7A 1SJDA 1VH7A 1FWHC 1B2YA 2QIWA 3PS7A 3W25A 1F3EA 5LA2A 5EA9A 5CG7A 1JUKA 4R7JA 3MMUA 5EPDA 4AY7A 4D71A 3SBFA 1ISWA 1W54A 3PK7A 3EEZA 3N1AA 2OWWA 1VBHA 3A21A 2DFAA 1QBAA 1Q3NA 3HQOA 3PBYA 4PA8A 3N9SA 2OODA 4P7OA 2QJMA 3QMSA 3GD6A 2HBVA 5AHMA 3LZ3A 3EA1A 4ILSA 2WHMA 5M03A 4UCFA 3BV7A 1LWIA 4EF8A 4AIBA 5HNNA 3MUCA 1QNPA 3OO2A 1SO6A 1OD0A 2X7WA 4HIBA 5IFTA 3PZQA 3VCRA 4HKPA 1S5VA 3QHMA 4AD1A 1RLDA 4W93A 4KFPA 4Z2KA 3S5ZA 1P0DA 3UG4A 1V5XA 4XZNX 4ZOCA 2XFFA 4BF9A 4TVCA 2OMAA 4GQ0A 1UD8A 4NX0A 5H2ZA 5D02A 3H12A 1L6WA 3HU7A 5JIPA 1TG7A 5EMKA 4W9TA 3MVTA 3PG8A 3A5VA 3LENA 2C15A 3L4VA 5AYBA 1VC4A 2YCIX 4EF9A 3W7CA 1MXSA 4MLRA 4LWWA 3KVLA 1DXFA 3C3UA 5I5RA 4YWIA 3B0XA 1WXYA 3DX5A 5BMWA 4MMWA 1W2PA 2Y63A 3U4AA 3OPSA 5ABFB 4JTQA 4TR9A 3VIOA 5H6HA 4MNJA 4BQ5A 2FQIA 3CUJA 1ISYA 5K9XA 1L9WA 3W2NA 3LCGA 3AJXA 3KP1A 4MADA 4H7CA 1KTCA 3OB8A 4N9EA 3PZNA 3F4CA 3SUWA 4J3UA 4X63A 1UKOA 1SZEA 3S83A 1E4MM 2YB1A 2XM2A 4LBRA 4WGXA 1XI3A 4O53A 5CAKA 4NUWA 3BGGA 1QHZA 4IPPA 1JL8A 4ERAA 2PDWA 1R7OA 1EC9A 4BS0A 1BD0A 2CLFA 3SGGA 1QNRA 5DLCA 1PSCA 4L4PA 2PP3A 2A6LA 4O1AA 5GVJA 4HU4A 4US5A 2W61A 4WF7A 4Y96A 5AECA 2WO5A 5DCDA 5L9FA 2GK1B 2QGHA 3RR4A 4DI9A 2INZA 5A6SA 5FF2A 4JTCA 1QOPA 4GGBA 3IJ7A 1JYNA 4L65A 4C7FA 2A7NA 2V63A 1EH9A 2B7OA 3L4XA 1UWTA 4PUMA 2CW6A 1KBLA 1P43A 2PCQA 1MEHA 1Q2SA 4WKAA 1VIWA 1OSEA 3W1PA 3FS2A 5M2FX 3LXBA 3NTYA 2ZC1A 3ALFA 4FR6A 3WD1A 1EX5A 2B7NA 3E5PA 1WDSA 3LEPA 5FF0A 4O4WA 5BXRA 1VD6A 4Z1AA 2P53A 3MJYA 1D2KA 3K1DA 4GISA 3EB4A 5A6KA 4NYUA 3RCNA 2QF8A 4H8VA 2YL9A 1JGMA 2OO6A 3CZEA 5EFFA 3UT0A 4QSFA 1TV4A 1UWAA 4LXFA 2CFFA 4GI8A 3MI6A 5I2UA 1XC6A 4H8NA 2BGNE 4Y9NA 1MSSA 2P5NA 2E28A 1G6CA 2XGBA 2WKGA 4XSLA 3TFCA 2ZX7A 2CHOA 1CTNA 4FHAA 3VGFA 2ZZ1A 2ZA2A 2CIPA 1X6NA 2QUMA 5A6BD 5D09A 3W9ZA 1XIGA 5REQA 4IL2A 1B3YA 2Z7GA 3GTXA 4I3GA 4G7FA 1OX5A 1Q2RA 2TODA 2QCEA 3ZJ7A 3L0NA 4JTDA 1YNQA 1YQ2A 3NM1A 4CVWA 3OQEA 3GXTA 2P0OA 1B5TA 3AHXA 1UR2A 2VDGA 1XLFA 3WQCA 4Z42C 4K1WA 1ZHAA 3EWUA 1J4EA 3SSJA 3WNPA 3MUIA 1JULA 4V28A 3NQ8A 1BF2A 4HHMA 3T0CA 1C90A 1RP8A 3K4AA 2XVGA 3PNUA 5A2CA 2VZUA 1B1YA 2Y0FA 5BW6A 2FMNA 1QI3A 2FIQA 5FSDC 1TX2A 1TMHA 4L4MA 3K5XA 5FEWA 1K4HA 4H7VA 4ORIA 1OBAA 5FJRA 4YHEA 1UH2A 3H55A 2O0TA 2R14A 1QFEA 3BAWA 3VD3A 3H21A 4OE7A 1JPDX 4WQ6A 4AHPA 3MW7A 2ON3A 1DQXA 4A3HA 3ES7A 2BGQA 5TAOA 3PTDA 3V1PA 4GO8A 2PD9A 1VFFA 2ZQ0A 4ROPA 1DWFM 4HMDA 1EJWC 1Q63A 2RJGA 4Y8FA 1LLWA 2BMBA 4PUKA 5EBUA 1C7SA 3UXLA 2HE8A 1K7EA 3NPWA 1MUCA 3BAXA 4PB3A 4UFLA 1GJPA 1VBUA 3NSNA 1LM1A 1LLOA 2YZRA 3O05A 3VKKA 1LRTA 1JCLA 2QCNA 3WDJA 1W1ZA 3WLJA 1S1PA 3GXNA 4JTIA 1Z89A 3U48A 3NQAA 1IIHA 1FY6A 2Y4SA 5I24A 2PGRA 4B5NA 3ICJA 2X1SA 4X2PA 4FNTA 3M4HA 1RCOB 4MAVA 2NLYA 2DVTA 4DF0A 1FWIC 3QR0A 3EDDA 1YDOA 3DG6A 3ZXWA 3LGEA 2QUNA 3IAQA 1YXDA 4Y90A 2WCAA 5C54A 3GDBA 3M7WA 2ISSA 3O0KA 5GJMA 1FBAA 2GVGA 1R3VA 4IGSA 2EKGA 1EXPA 5K9CA 4F0SA 2GYIA 5HR6A 3SUSA 1RBAA 3GSMA 1G1YA 4M8UA 3TEVA 2D73A 4IPIA 2FTPA 1KD0A 3NZGA 3EPMA 3H7RA 4WDTA 2GOKA 1BTMA 2VX6A 1ADDA 2UZ9A 3E2VA 5C9WA 3CMJA 1ODZA 1HJUA 1L6GA 2O55A 1Z3NA 3S9IA 2DH2A 4IQDA 3K4DA 3DHDA 1JIBA 4CD8A 1WDPA 2I14A 4B4FA 5A8NA 4RDVA 4LX4A 5D2WA 2ZXQA 5LGZA 2VX7A 3WQ6A 3KVKA 2OU4A 4R85A 3VD4A 3RLVA 3IIOA 1F74A 2D1ZA 4C7GA 2HJPA 3REQA 3EPNA 2Z4GA 4HPJA 3ZWTA 1C29A 2ZZ3A 3SN4A 4HQVA 1XUUA 1BVWA 4HGXA 1OFOA 4EPDC 1LP6A 5A5WA 2PUZA 3MHFA 3F2BA 4B4HA 3MQTA 1JD9A 4W8LA 3R11A 4UNKA 4DIAA 1ZNNA 3C3NA 4IIBA 1HP4A 2V3EA 1WYIA 4YPJA 2Q6ZA 1PX4A 1RSCA 3C86A 3UXIA 3UWUA 3LB0A 1V3JA 3E3HA 3QXBA 1ME8A 4KESA 4WR3A 7A3HA 1FCBA 4LCSA 3G1AA 1ZBVA 3CL8A 4LT9A 2HQAA 1FCVA 3STFA 5F2GA 4LC6A 1HL9A 3GG1A 2XSBA 3TQPA 3S8HA 4WEVX 2WMIB 1XHGA 2DZBA 5I3GA 3CMFA 2QIIA 5A1AA 1W1IE 4UQEA 2XZ9A 1SR0A 5DMMA 3AXIA 1JF5A 3FOKA 1EA0A 1GVYA 4LY8A 3WSUA 3N2BA 4TTUA 1YMYA 3BXWA 4DF2A 3QR3A 3G1VA 1UJPA 1XH1A 4GKTA 2CKRA 1E9IA 3GW0A 2IQ0A 4DUWA 3EOUA 1Q6EA 1Q65A 2ATMA 2BVWA 3F5KA 3XINA 1SGJA 2D22A 2QHAA 1R3YA 3IJLA 1V0LA 2UY4A 1TUFA 2YYUA 1VF8A 2L5HA 3P5YA 2YDSA 3LMYA 4H9MA 1WDWA 3BJSA 3M1ZA 4MDPA 3QOKA 4XISA 3H53A 5BNKA 1JCJA 2P8CA 1PZ2A 3GLCA 4Q8NA 1UUOA 4YTTA 1RK5A 4GABA 1N82A 4JTRA 4LB4A 1TVNA 4M82A 3TCSA 1FP8A 3HJEA 1TPVA 2JQXA 2ASHA 3CT7A 1KXQA 1K7XA 2OX1A 3UG5A 4JXCA 3EMZA 1IGSA 4NNBA 4ZTXA 3DBNA 3MI3A 2BNJA 5HPCA 2ZRZA 3TYDA 3B8TA 2Y88A 5LNRA 2PF8A 1HKIA 4ZO8A 2ZYFA 1UWRA 2GSJA 4BI5A 3K13A 3PTMA 3UF9A 5C71A 1BWVA 4H01A 1OADA 4MDOA 2ZXBA 3GE7A 1R3RA 3VM7A 4HN8A 3IPWA 1ISVA 2ZBTA 4RZBA 4WY0F 1PX3A 2CETA 5CSSA 1JJKA 3LI1A 1SW3A 4DJED 5BMXA 1XINA 3RX4A 5A6TC 1O66A 3I4KA 4IF2A 3TW7A 4DJDD 5AY7A 3IWPA 1YTDA 4MY8A 3QN3A 3S2CA 1VBGA 3UG3A 5XINA 4ERGA 4FNPA 5AYIA 2PB1A 2VFGA 3N04A 3ITYA 1NOFA 5LIWX 1MRAA 4NJKA 1F05A 3EBVA 1WDRA 3R8RA 1BVZA 3UZZA 3OLEA 4RNIA 1EHAA 2XN1A 2Z2UA 2REQB 3OP2A 2EPOA 1G9HA 2GQ3A 3AIVA 3EGJA 2YL5A 5C2CA 1ICPA 3GZAA 3WX7A 2GFTA 5FAGA 3WMSA 3NSXA 2BY0A 1ZTVA 1UD3A 3W4RA 4F0HA 5A3HA 1FDJA 4FXRA 3PPGA 3BCFA 4IM4A 4PTNA 3TYZA 4AHQA 1AQMA 4Q7NA 1EUNA 3B4UA 1UWUA 3PANA 2J8FA 3W7MA 4XD6A 4GG9A 1QOQA 3VNIA 1W37A 1ISZA 1TPDA 3GTFA 1KBKA 4OQVA 1VB9A 1AMYA 2G3FA 1B4KA 2XG9A 4FXFA 4UWMA 4LYQA 1LOLA 1XV8A 1SFSA 1X1OA 4GNKB 3LLXA 1X1NA 2V8ZA 3TWBA 1M53A 2G96A 3NQBA 1BLIA 3S42A 1VYSX 3HA1A 2VZTA 2VOTA 4KEZA 3O15A 1OX6A 3FHQA 3KL0A 1T0OA 1CXKA 3D47A 5CBJA 2QPSA 3AS0A 1OY0A 2YFNA 4LYRA 1MUMA 3BDKA 3MDUA 4F0MA 4N6EA 1SQ7A 3EYPA 4H6RA 2DZXA 2VRJA 2P50A 4IICA 1NP2A 3G18A 1R2TA 2DY3A 4C65A 1KBBA 1UA7A 3CTTA 2PDCA 4O50A 1NVMA 3LI0A 2AL2A 4HSNA 4Q4KA 4OFCA 4JHMA 3TMQA 1DJZA 1PZ0A 3OYXA 1XW8A 1YYAA 1TCDA 1TWWA 1EJVC 4HPHA 4KQNA 4Q33A 2VFHA 3LYEA 2NQJA 2R8WA 3IVTA 3W7GA 4YTSA 2BHZA 5AZ0A 4O17A 2CITA 2WYSA 2G3JA 1GVIA 3EKLA 3KBMA 5LNUA 3KOFA 1KFWA 4QDMA 5TF0A 4IH3A 3KRBA 3CO8A 3PFRA 4R33A 4IMGA 1TCMA 1J93A 5C9UA 2G4JA 1IWPA 3PZMA 2H9AA 3G24A 3CHVA 2A6NA 1CWYA 3NQMA 4U3CA 1O95A 1GT8A 2WKLA 2I17A 2ABBA 3GY1A 5F4WA 3VCNA 1B90A 2BVDA 4QAIA 4XZIA 1GTEA 1IEWA 1D8WA 4HMNA 3N29A 3STCA 2Y7EA 3KVMA 1XWYA 4O14A 3VD9A 2QJJA 4MNLA 5IRPA 1A0DA 4AD5A 2BXZA 2B31A 4JFSA 5C9RA 3UCQA 1ZPTA 2HXTA 4KWUA 4CNTA 2C1HA 3L0GA 2C16A 1QJWA 2PI6A 3W87A 1E56A 3K1GA 3E2RA 1X1ZA 2XVPA 4JX6A 3ANVA 1PTAA 1US3A 3R58A 1W5MA 4YCPA 4LVGA 4CNSA 3FXYA 3CQIA 3U7VA 1X38A 1HKMA 3OZOA 4PFMA 1VFUA 5FOOA 2CU0A 4E0CA 5HANA 4K7VA 3QQWA 1UPPA 2GDVA 3VPLA 2C79A 1CYGA 2Z1VA 4W86A 5CSRA 3ZS4A 4NJGA 5A6JA 3EB2A 3RCYA 1TQXA 3WLSA 1YX1A 1MZHA 1S2VA 1EP1A 2QKFA 1BPLB 3AXMA 1FCQA 2CWXA 3AYTA 4UQBA 3TU9A 1KGUA 1V4YA 3LLFA 3TX9A 3VABA 3DBPA 2UBPC 1I45A 3QSRA 3WF2A 2P1FA 1QDSA 3C0QA 2WZTA 4M5PA 3IIZA 3MHGA 4W7UA 3WO8A 4IQLA 3WLKX 4ATLA 3W88A 4Z1BA 4IIEA 1U83A 3GHRA 3TC6A 3PBMA 1FQ0A 1PKYA 3I3BA 4DYJA 1O94A 3R4IA 4IZGA 3T7VA 3ZLGA 1KFBA 4IGMA 2CZEA 1OFRA 3O7UA 2ZA3A 1CXLA 5I02A 4IL0A 4ML4A 4N02A 1TPUA 5C9ZA 3HTWA 1DWAM 2WPGA 3JUGA 4GFSA 4DBDA 4R3UA 3ZQ9A 2OO0A 3W1RA 2ESCA 4W88A 1FKXA 4KKXA 1A3HA 1SO5A 4OWGA 2GWNA 3WELA 3VVGA 1ITQA 2VMFA 3M44A 1OINA 3SO7A 3S1VA 4DWSD 2NT0A 4NZ3A 3ARUA 4L1XA 1D7KA 4M1BA 2GJLA 3OVRA 4C6QA 1FA2A 4RV3A 4WIWA 3CJPA 2JIWA 1X8FA 3VOFA 3NA8A 3DEQA 1J6PA 3FEMA 3UY7A 2WV8A 5CPTA 1KR1A 3PZOA 1GHSA 4F0LA 3NUKA 1W1TA 3QR1A 3PAJA 4YTRA 3KBVA 4R27A 5EL1A 4B5SA 1OFAA 1YRRA 4ZVJA 3ONCA 4DJFC 1N55A 2A3BA 2QCHA 3NPVA 4WOZA 3JZEA 4DJDA 2YCEA 2J27A 3L2IA 4E8GA 3V7PA 2QT3A 5D37A 1JZ7A 3SCNA 3S9YA 2CYGA 5H91A 3EXRA 4GLEA 1LTDA 2V6AA 2HV5A 3DIPA 5JUVA 3UR8A 5CXPA 1SZGA 3GNPA 1Q45A 3NL3A 2D2GA 2J79A 2C71A 4NT0A 3CGTA 3TXZA 3JR2A 3ARYA 3MY9A 1JPHA 4U28A 2RUSA 5HINA 1MNSA 1PXGA 5E1QA 5FF7A 1GZJA 3N4AA 1XG4A 3LDVA 3H4XA 5CGQA 3A24A 2G50A 4JTFA 3HURA 1Z41A 2ZWZA 2PFHA 1K4GA 4RXFA 3PJUA 3W28A 4L56A 2X09A 1XDLA 3BURA 1TIMA 2OT0A 5AHIA 1J9YA 1DJNA 1JUBA 1UP2A 1ZP4A 5AC7A 3DHUA 4PULA 3OLDA 4UZSA 4Y2WA 4D8LA 1ITCA 2VZOA 4M6QA 3KOWA 3SRKA 3F4DA 3FJNA 3VOGA 1DEDA 4U10A 5TD4A 4D6HA 3I6EA 4XV0A 3LPOA 1GOWA 4EAYA 1R2SA 3M5VA 2ZZ4A 3GH7A 2J74A 4HPGA 4L80A 5G1MA 3IGSA 2DUZA 2PDPA 2ZX9A 2WJFA 1QK0A 4PMRA 1JFXA 3W2LA 2FHBA 1KXVA 3QTGA 4A3QA 1ELSA 5A6BA 4DWSC 1E4LA 1WAUA 3QKZA 2OEJA 5AYZA 3WBAA 2BODX 4GO9A 3VNDA 3GVQA 3NYDA 4KMQA 2P3EA 4LAKA 4KEUA 2WLYA 3ZZ1A 4P7RA 3T44A 4F79A 3WH7A 4DY1A 1GCYA 5KTLA 3TSMA 3NQVA 2J8GA 5CLTA 3M0KA 1MFVA 4C91A 3VD7A 1VFSA 2V9DA 6CGTA 2PRLA 4HYVA 3TW6A 1Q6CA 1YHTA 1FWJC 1UW9A 3TJ4A 3VGGA 3LCHA 4MZ1A 1JR1A 3AFBA 3APYA 9CGTA 1Q6DA 4U2YA 3WG6A 4QQUA 7REQB 1Y65A 2NXIA 3ERPA 4CCCA 2NQHA 1JVNA 1K02A 4IPNB 3QW3A 4RW5A 1UWQA 4JIQA 4OBTA 1XQLA 3AAMA 1MRQA 3JVAA 3RIKA 4GH1A 3TJXA 1DYSA 3PSWA 3POCA 4GIAA 5LHEA 3OZMA 3LXAA 2GSEA 2FPYA 4H6QA 3DUGA 1V6TA 2VJXA 4JTEA 3W7HA 3OIHA 9XIMA 3CNYA 3P0XA 5LIYX 2QDGA 5LA0A 4Z0JA 2VX4A 1ITUA 3CU2A 3U3HA 1E9YB 1XIDA 1XBZA 3GM8A 3IJ8A 2R24A 1XGZA 2OLAA 3D6NA 3BW2A 3M41A 3LBMA 5A8GA 4PRWA 3ZT7A 1P5BA 1AUSL 3FJLA 4GJIA 5FA5A 2FDMA 4CN6A 3H70A 3W84A 2YA1A 3FJ4A 3A5FA 3FCPA 1OF6A 3DFYA 1I9CB 3PZ9A 1SSDA 4AW7A 1UZ4A 3TJIA 5EMLA 5I77A 2ZICA 4O0ZA 1M7JA 1W56A 3ZR4A 2WOQA 4AZ7A 3B05A 4W7WA 2VM8A 3EAUA 3N13A 5LIXX 1K9EA 3Q4DA 3KXQA 3LY0A 3IUDA 5CGMA 3G1SA 3OVQA 4LNCA 3BGAA 5GNZA 1K70A 2C1IA 3W72A 1OG6A 5TBOA 4Q4PA 3DHFA 2WQDA 4GHRA 4ZSUA 4B15A 3PJTA 5B7YA 4CD4A 1DE6A 2R6OA 1W3HA 1N8WA 2X40A 1H09A 3T0AA 1PBGA 3CV2A 1UC5A 3KS5A 3BUVA 1C8YA 3ONBA 5EFDA 3QZAA 3IGUA 1GVRA 1TX0A 4PUJA 4WHBA 4QE1A 1MW0A 5IBXA 4ZODA 1EGVA 3V0UA 2H6RA 4NZFA 3G1YA 4LYKA 4LUIA 3DFNA 3BANA 4B3KA 4ZO6A 3IS4A 1NY1A 3WD4A 1OFBA 1E0VA 3M0IA 2OPJA 4HNUA 3H2OA 4YXGA 1KM5A 1RBOB 1SZRA 3MP5A 2PTXA 4H7ZA 3WIJA 4AZ6A 2OSYA 2NV1A 3AICA 2W3ZA 4HP5A 5HMFA 4M7TA 4KCWA 1QWGA 4QJ3B 3ABXA 2V5DA 4A3UA 1P0EA 6TAAA 4YL2A 3OIXA 1G4PA 1A5KC 3R10A 3GTNA 4OV9A 3MBDA 1HKWA 2ADAA 1VEPA 3BG9A 4NU7A 1D8CA 2FHCA 5DX7A 2HZGA 2EEXA 3ITGA 2QMKA 1FWTA 4ZXLA 2INFA 3I65A 4PYSA 4MY1A 4DO4A 2W66A 2WWCA 2CPUA 3VI2A 4U3AA 2PWDA 5F2LA 2HXUA 2QVHA 3NOYA 4V2XA 5A8PA 4HSOA 2FH8A 5BU9A 1QTWA 4B9YA 2VGGA 1NDYA 1JAKA 5FL1A 5GJPA 3EDKA 1IR1A 4XD3A 1JUEA 3AMDA 3W1QA 3KRZA 1WOAA 2GQAA 4IP7A 2DU2A 3I6TA 2C91A 1XLAA 4NG3A 3MVIA 4AG0A 3EOOA 1BAGA 2Y8KA 1ITXA 1W3JA 5D9MA 4CGTA 4C60A 2Q3RA 3PJWA 2VVSA 4L4LA 4O1BA 3VE7A 1PCWA 4NIRA 3UY8A 3A47A 2Y8VA 2E3ZA 1XS2A 1B4EA 2YSWA 3DECA 2YL8A 4XAYA 1Z32X 3W74A 4YIWA 1W1YA 1QAPA 3VOIA 2FZBA 1AJZA 4IMAA 3BAKA 4WX2A 1BYBA 1MW1A 3PUDA 2VURA 2WHJA 3TVAA 3L4WA 5TIMA 1HZYA 2EPKX 2EO7A 1V51A 4LS0A 3BMVA 2W4XA 3RM8A 3NOEA 1MQRA 3VE9A 3K8MA 1X8CA 4CQBA 3HPSA 3G6LA 2UWFA 3DI1A 3KCJA 1SFLA 4JICA 4HD5A 3IJDA 1JI1A 3T9PA 2DIJA 2X30A 1XLKA 1YKWA 3AWNA 5G5IA 3GU2A 1H7WA 1JYVA 1M01A 3R8HA 1O5XA 2C8NA 1ALDA 2PCEA 3S2MA 4EACA 1O1ZA 5IFPA 2WNZA 4RDZA 3WDIA 1TPFA 3FFSA 4LAZA 4LH8A 3TA6A 4R7OA 5EU9A 1CIUA 2GJRA 3F2DA 4JHZA 4B5UA 5C2GA 2ZUNA 2PAJA 3VIMA 3GNNA 4C6DA 4CCZA 5BZAA 1LBLA 4IXXA 1HJWA 2QUUA 2R1PA 4YMZA 2HWGA 1J5SA 5D4YA 1HJVA 1GQJA 4B3ZA 2E6YA 5F2MA 3WUEA 1VRDA 2YKKA 3WQOA 1HIZA 3VNLA 4P7QA 4GI9A 3VNKA 1AL8A 5A94A 2QXWA 1A5LC 4H9TA 1JCMP 4OVXA 3W86A 1EX1A 2UY5A 4BF7A 1WX0A 3AMGA 3W7LA 1TRIA 1TUXA 3ZT6A 2EAWA 4ES4A 4H4IA 5CPNA 2JE8A 1WO2A 3VUSA 4Z2IA 2VGBA 2A79A 4H3DA 1TFVA 1FHUA 2E5DA 5K3VA 2ZX5A 1C3FA 3IIVA 3LK6A 3M0LA 4RW3A 3BLEA 4I5UA 5FESA 4KPLA 3DGRA 1DWGM 1OFDA 2O4QA 3NZQA 1OCNA 4A6GA 3IV8A 4PL2A 3OLIA 3SGUA 2POTA 3VC5A 4HT3A 3QFEA 1DXIA 1ONRA 1E72M 1VRXA 3LGGA 4UQDA 4JD4A 2VUYA 1N8FA 3UZYA 4MIMA 1P6BA 4NI3A 1GJWA 3CEUA 3EA2A 4NNAA 2GGJA 4FAMA 3W85A 2OZ3A 1HGWA 2D0FA 5LXEA 1QBBA 3TROA 1H0GA 5EKYA 1KM4A 1I8JA 2VWTA 5ECVA 3BLLA 2VENA 2O7SA 3TQKA 3BQ5A 2QEZA 1EP2A 2BSLA 3GDMA 1F6PA 3K46A 3UW6A 3M0MA 4DELA 1XLEA 1UZDA 3BAYA 5DCBA 4JHOA 3S5NA 5CZSA 4Z1CA 2IQTA 3Q65A 1U22A 3NL2A 3CHCA 1SJAA 2QZRA 3H2NA 3M46A 1S5WA 2GDUA 1IWAA 1YDYA 2CZFA 2XYLA 1C9DA 4DYEA 3LCXA 4PL1A 2WZIA 3IRSA 2Z00A 1REQA 4B16A 1OYCA 1QWKA 1GONA 1KBIA 4IJBA 2Y61A 3OODA 3NIYA 2DGAA 4WVXA 4DM2A 3N3MA 2VUNA 4F2UA 1UP0A 1VS1A 4ACZB 3P6LA 3R89A 2EPHA 5JBDA 4J9JA 3LMZA 1FRBA 1UIPA 3SJ3A 3FJ6A 1U1UA 2VXNA 1E0UA 1E3ZA 2B7QA 4Q8WA 3Q2DA 4AVOA 1XKJA 2DJLA 2QDHA 2X16A 2WK2A 4KFOA 2JIEA 1CEOA 1JCTA 3KAOA 2B81A 4O1CA 3FLUA 1K9FA 3W7RA 4F0KA 1FWRA 5T9BG 3KP0A 5J5DA 4PSPA 2VO5A 3VFCA 2G3NA 5C0QA 2JGYA 2QPXA 3UWQA 4G5DA 3GFXA 5I3JA 3PZUA 1QXLA 4IMFA 1Q8JA 3QQ0A 1XC4A 2YDAA 5PTDA 1V02E 2DSUA 2JKAA 4XZWA 2Y70A 1GNXA 2OKOA 4XBSA 6REQA 4KRZA 2YX0A 2LLEA 3S9ZA 1PVNA 4QNEA 3NPXA 4JFWA 2AMXA 1BXNA 4TX8A 2Y5SA 3LHVA 1QW8A 5EYWA 3L65A 3UPBA 4IJCA 1KCLA 3REQB 3GVGA