3LQGA

Human aldose reductase mutant t113a complexed with idd388
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
b'SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqgA00
2I16A 4GACA 2PDIA 3KRBA 4LB3A 3BURA 4R9OA 3CV6A 1T41A 4WGHA 4XO6A 4JTAA 3ERPA 3O3RA 1PYFA 4JTQA 2PDJA 4XAPA 4FZIA 2IKJA 2WZTA 4FALA 2PD9A 2DV0A 3NTYA 4WDTA 2HEJA 2INZA 1SM9A 2PEVA 2FZDA 3M64A 1Z89A 3BCJA 3CMFA 2IPGA 1Q13A 4IGSA 4DBSA 2F38A 4L1XA 1X96A 2J8TA 4PRRA 3R8HA 4ZFCA 5LIKX 4DBWA 3RX2A 1PZ0A 4JIRA 3UZXA 2IS7A 2IKHA 3EB3A 4QR6A 4PR4A 1Z8AA 4PUWA 2IPWA 2VDGA 4ASTA 3H4GA 1ADSA 1YNQA 3N6QA 1ZSXA 1ZQ5A 3R43A 2PDXA 3UG8A 1IHIA 2PDMA 1GVEA 4DZ5A 4ICCX 4WDWA 2PDHA 2PDQA 3UZZA 2DUZA 2PDFA 2PF8A 3LQGA 1S2CA 3U2CA 4GQGA 5JH2A 5LIYX 3UZYA 4WEVX 4JQ2A 3O0KA 1PZ1A 2IPFA 2ISFA 2I17A 1J96A 4DBUA 2R24A 3MB9A 4RPQA 3UFYA 3V0TA 4XZIA 3DN5A 3UZWA 4H7CA 3LD5A 3M4HA 1FRBA 1MRQA 3UWEA 1YNPA 4LBRA 3CASA 3V36A 1RALA 2IKIA 1EF3A 2HVNA 4WDXA 3UP8A 2PDGA 1EKOA 4GQ0A 4F40A 2ACSA 4XK2A 1R38A 2P5NA 3M0IA 1T40A 3LZ3A 2FVLA 4NKCA 4XVEA 1PWMA 2AGTA 4YVXA 5JH1A 3Q67A 2A79A 3BV7A 3C3UA 3G1RA 1AZ2A 2IKGA 4Q7BA 2FZ9A 4H8NA 4WRHA 4GCAA 3WCZA 4GA8A 3N2TA 4XZLX 4XZNX 3V0SA 1QWKA 3EAUA 4I5XA 3WBXA 1Z3NA 3ONCA 5KETA 1X98A 4L1WA 5C7HA 4FA3A 4YVVA 4QX4A 1XGDA 4MHBA 4XZMX 1UR3M 4PMJA 2PDKA 1XF0A 1AZ1A 2PZNA 3CAQA 3R58A 3FJNA 3CV7A 1LQAA 2IQDA 4LAZA 5DANA 1MZRA 5LIUX 3G5EA 4JQ3A 3R6IA 2ALRA 4LAUA 1C9WA 2ACQA 1QRQA 1ZUAX 3COTA 4HMNA 2QXWA 1X97A 4JQ4A 1S1PA 5M2FX 3VXGA 1YE6A 3GHUA 2PDPA 3QKZA 3DOPA 1MI3A 5HNTA 4XZHA 3WBYA 1RY0A 1XJBA 4YVPA 2HDJA 4XO7A 1RY8A 3LEPA 2R9RA 2C91A 2IPJA 5HNUA 4WDUA 4OTKA 1HQTA 3WBWA 1K8CA 4PRTA 4JTRA 2FZ8A 3GHSA 3H7RA 2HE8A 4JQAA 3UYIA 4G5DA 4PUUA 4EXBA 3LQLA 4LBSA 3GHRA 4LB4A 1AH0A 2PDCA 3MC5A 3LUTA 4QBXA 4Q3MA 2PDLA 2PDWA 3P2VA 3V35A 3CAVA 1HW6A 2PDUA 2BGQA 2ACRA 2DUXA 2FZBA 2PDYA 1OG6A 1AH3A 4JTDA 1LWIA 3LN3A 2ACUA 4JQ1A 3LNMA 1S2AA 1YE4A 2PDNA 2FGBA 3R94A 1AFSA 1Q5MA 2BGSA 4HBKA 3R8GA 4YU1A 3RX3A 2F2KA 1EXBA 2WZMA 1US0A 2HVOA 3F7JA 1M9HA 1PWLA 1EL3A 3T42A 3R7MA 4JTCA 3ONBA 4AUBA 3Q65A 3WG6A 4JIIX 2HE5A 1IEIA 3BUVA 5HA7A 5LIWX 3FX4A 3B3DA 1ZGDA 4GIEA 5AZ0A 1JEZA 2INEA 3H7UA 4IJCA 1VBJA 1AH4A 2PFHA 2HV5A 4EXAA 3D3FA 1A80A 1S1RA 2IQ0A 3LENA 3EB4A 5AZ1A 1Z9AA 2CLPA 4IJRA 5LIXX 3GUGA 3UGRA 3S3GA 4XVDA 4JIHA 4FAMA 3LZ5A 3V0UA 3GHTA 4QXIA 2NVDA 2BP1A 2PDBA 3RX4A 2PD5A 4YS1A 1VP5A 3LBOA 2NVCA 4GABA
chains in the Genus database with same CATH superfamily
2F6KA 1XYCA 2W6RA 3W82A 4H8VA 1TPC1 5CZKA 4KCTA 4GGHA 1QNOA 3FYYA 3QPZA 3CV6A 4CCDA 3DBPA 4O8AA 4UFKA 2ZX9A 1NQ6A 1G6CA 1PYFA 1Y65A 3CZEA 3DFNA 3XIMA 3KOXA 4HSHA 2NQJA 1US3A 3VD9A 2V63A 2H6RA 2PA6A 1ELSA 3AMDA 2YXOA 5HMSA 2REQB 1YXDA 4ZO7A 3AAMA 1XXXA 5CKSA 1Z89A 3CK5A 4O12A 2FDMA 2VL4A 2WZEA 1B3OA 3CPRA 3L21A 2TODA 3RIKA 2QJHA 1M7PA 1VHCA 3ALGA 2OO0A 5LIKX 3NPVA 4FXRA 3WIJA 5I24A 4JIRA 3EB3A 2CLOA 4FOKA 1XP3A 4PUWA 3B0VC 3WDHA 2QIWA 1UKPA 4DZIA 1YNQA 2GLKA 3BOLA 2Z2AA 1ZSXA 5CSUA 3W75A 3WJXA 4IQLA 1H62A 1KCKA 4WSKA 3WQDA 3CZ8A 2B4GA 1L9WA 5A69A 2OLSA 5AYXA 2V81A 2X0YA 4FEZA 2DY3A 2ZVRA 3LTSA 3PS7A 5LIYX 4FOUA 3WD4A 3ABRA 5HDRA 2XFRA 3MA8A 1XWYA 4LX4A 2PWDA 2ISFA 4DX3A 3TNBA 3D0CA 4RPQA 2QDHA 1O94A 1Q3NA 2B7NA 1IXPA 5CLTA 1YDVA 5I79A 4GH3A 4GVGA 1GK8A 3WNOA 3CUJA 1FRBA 3QF0A 2V2CA 3S5OA 1Q4NX 4L56A 4ZZ9A 4MY9A 2WVTA 3DG6A 3PZMA 4R85A 4AHPA 1U22A 3U57A 3TE9A 1OC7A 3H24A 3GTNA 1G4TA 2VX5A 1GNXA 2YW4A 1BPLB 2MANA 3SECA 3N4FA 1XDJA 4YNGA 2QUVA 3BG5A 1XLJA 2OQLA 3DFTA 4DF1A 3S9ZA 2FHFA 4C6JA 3LGGA 4F0LA 4NZCA 4E2BA 2R6OA 1PHWA 4M19A 5FEXA 3OBKA 2YFNA 1GOWA 4HNVA 3Q67A 2W66A 1A4MA 3WENA 3G77A 2JEQA 2Z7KA 3U5UA 1FWJC 3HGSA 4K7VA 3SO7A 4DF0A 3DC0A 1DJIA 4GZJA 5LNSA 2GJNA 3EAUA 3SCQA 3MV11 2VUNA 3W25A 4S2BA 1EJ7L 5DN1A 6PTDA 4NAFA 6XIAA 1WPCA 4OV9A 4Y9NA 5CPSA 1CCWB 1ZAIA 3P80A 1MEHA 1EZ2A 2ISWA 4X2RA 1TV8A 4PMJA 5TQLA 2FMOA 4AB4A 1UWRA 4LBUA 4AISA 2VD8A 3KOZA 5AY7A 3LXCA 4W8LA 4WQ6A 2VX4A 2HWGA 2FH6A 3MMWA 1SYTA 2J7DA 2GQAA 2J27A 1SZEA 2NT0A 1F07A 4QFUA 4UTIA 3LCIA 4QEHA 1GOXA 3UETA 3VMNA 3DH7A 4NVTA 1C91A 3NQEA 3VIPA 1HP4A 1ESWA 3QV7A 3NQ6A 5TIMA 2JE8A 4L6HA 1YADA 1S3TC 3ZR5A 4XX6A 4B9ZA 4MSSA 1J18A 9XIAA 2ZE3A 4H7ZA 4S3FA 4AY7A 6A3HA 1SJCA 3I7SA 4LU0A 4A3UA 1UUMA 3F2BA 2A3EA 3LEPA 2G95A 2V5BA 4AHOA 4QQ3A 3VIJA 1VJIA 4B16A 2A2IA 1NWTA 4HPNA 1W9UA 2HCVA 1ZY9A 4O14A 4TV5A 5XINA 1HQTA 3W6MA 3C52A 4GUJA 3T78A 4JQAA 4K2SA 4S3BA 4EWJA 1VBUA 4AWUA 1M7XA 1ISWA 4W9TA 3N9KA 3GVRA 4BJHA 3P5YA 1EP1A 1AH0A 1PIGA 2BXZA 1ISXA 1YDOA 1XYAA 3FHAA 4LF2A 2YDRA 1RJPA 3SFKA 2GSHA 2AL2A 5REQB 3MP3A 3ABXA 3L65A 4S3KA 1ZRQA 3G6MA 3E1F1 3KOYA 3GSMA 4IIBA 5CJNA 2P10A 3T6CA 3CTLA 5D2XA 2QJMA 5FESA 3K8KA 3ARYA 3G3MA 3O8AA 1R85A 2YW3A 3H12A 4PRWA 2TPSA 4D6EA 4P7NA 1DP0A 1QU4A 1S2UA 1UMLA 4LEQA 2Y5JA 1E3XA 2VTFA 1US0A 3AIUA 4B5VA 3B8TA 1M9HA 2VNCA 4ZQOA 3IGXA 2O7QA 3AALA 4GQRA 5G4EA 4GPNA 4L4OA 4AZCB 1PZ2A 3G0SA 5CSYA 3WQFA 1EOMA 3JZUA 3W85A 3KRSA 2WM1A 3C56A 3SADA 3NM3A 4M6VA 1REQA 5EKYA 3CGTA 4MY8A 2HPIA 1V6TA 5SWUA 4U3AA 4IG2A 3M5XA 3JW7A 1FUYA 3DFHA 3PZNA 4WJ8A 2PODA 1I4NA 1VFHA 2FTPA 3T9PA 1PKMA 1CLXA 2FFIA 2GVJA 1BAGA 1VCGA 3POHA 2WKLA 1HFBA 2J66A 2JALA 3UA4A 1TJ0A 3UPBA 2XIJA 3EPOA 1X8FA 2ODOA 4J3TA 1XCFA 2WVSA 3WF1A 4XBJA 3UCDA 3KL3A 2QCNA 4ML9A 4K8GA 1EJSC 3SBFA 4K36A 2I16A 4F0RA 1H11A 3W74A 3CJPA 2PCEA 4PTNA 3KCJA 2BHZA 3QFWA 3OLDA 4JTQA 3VX1A 5JU6A 1VPYA 3MI6A 5J5RA 3F2DA 4FALA 3OA3A 4PULA 3CIXA 3SEPA 3L0NA 1PYMA 3ZS4A 4NHVA 3M64A 2IMRA 1D8WA 4YXGA 3W2KA 1GKRA 4W5UA 1H1ZA 1QCWA 1ISVA 1X6NA 2F9RA 2F38A 3QMSA 2J8TA 1XI3A 4N6FA 5AOUA 1OD0A 4HQVA 1LWJA 3VD4A 4JTUA 4OOZA 3JU2A 5D37A 3FA3A 4TX6A 2ON3A 3UG8A 4DJED 1VBHA 1IHIA 2YFOA 4TR9A 2PDMA 4FX6M 3GDLA 2PDHA 2XJ7A 4M82A 3MI2A 3TTQA 3M1ZA 1GJPA 5D2YA 4GQGA 2G4FA 1P0KA 1JL8A 5K9XA 4NQ1A 1XW8A 2VURA 3IK4A 3SN4A 3M0HA 4KBXA 4XKYB 1J96A 2NX9A 3BICA 1XH1A 2FLIA 4UNIA 2CPUA 1WXJA 5BCAA 2G3JA 1EQCA 1RK5A 3I10A 2XH7A 4KEVA 4U2ZA 2Q3OA 5AYBA 5FJJA 3VIFA 2WXDM 3IV8A 4KPLA 3WMBA 1O68A 4GI4A 2O4QA 1W31A 3E96A 3VDCA 2RDWA 3CYVA 1B3XA 1H7WA 1LBLA 4GC3A 3A22A 3N6HA 4ES4A 1RHCA 3TW9A 3URBA 4YTQA 3EBVA 3SIMA 2J9XA 3WMCA 1HJXA 2E4TA 4UTLA 4DBDA 4P8XA 2V3DA 5T9CE 4AMAA 3KBSA 4KEMA 3B40A 1PX4A 2WNWA 4NKCA 1QNQA 1L2UA 3CL6A 5BXPA 2V5JA 4LUSB 5H6HA 3UXLA 4JFTA 3UJ2A 2NUWA 4DAFA 4PTXA 3W84A 1LCOA 3ZJKA 1UHVA 3LBMA 5LNVA 2WNNA 4CN4A 5CPTA 3TLLA 3VILA 2CZFA 1OEPA 5C9ZA 2CKSA 3HV9A 4CN1A 4RXGA 2RKXA 3B06A 1TV2A 4PCTA 4I5XA 4XG1A 4RE4A 3VK5A 4HYWA 4NF7A 5IBXC 3Q4DA 3II1A 3W73A 4Q4MA 1FCVA 4Q8OA 4MDOA 3GXMA 3PY2A 5EU9A 3R12A 3VPLA 1ZCOA 3BZGA 3G8EA 1AJZA 2VEFA 5DMMA 2JK2A 1NOFA 1FWTA 5C54A 4GLEA 3IJLA 1XD0A 3AICA 2OZ0A 2WZHA 3S1UA 2FYMA 3N4AA 4JFUA 1AMKA 3O07A 4E4PA 1NFPA 3P62A 1F8IA 4FS9A 4JQ3A 1C9WA 4WIWA 3W38A 1NF0A 3STFA 4AW7A 1ZAJA 3BGAA 3SUSA 2VGBA 1F3EA 1FTXA 1J79A 4BY3A 2OJPA 3G24A 4ZO9A 3TC7A 3MZ2A 3GHUA 4NAEA 1WUFA 4HMDA 1GHSA 3W2JA 3M0JA 1OC6A 2INFA 4QCFA 1UJPA 2E28A 1VEOA 3MZNA 3MO7A 4HNUA 4ZQRA 3BJSA 3OVQA 2P8CA 1E1CA 1QDSA 4CNOA 2RGMA 4JKKA 3INPA 2JGQA 1W91A 3THUA 4YCPA 3GHSA 1S2WA 2Y0FA 3P14A 4L6DA 1FWFC 3PSVA 4IFKB 2WNQA 3BO9A 4RPPA 1Y8BA 5ABFA 2ZDRA 4IWWA 2ZZ4A 1JXJA 3W2UA 5EA9A 1XYMA 1Q7ZA 1DQUA 1PDYA 4NU7A 3NURA 3LUTA 1SZRA 3V1PA 5A8OA 1OT1A 4ORMA 3WK0A 1YXCA 2W0UA 1BD0A 1W9BM 3CUGA 4BQ4A 4UZUA 1VEPA 5DEZA 1DQWA 3FSUA 4LYKA 2P3EA 4EP8C 2GOKA 3DX5A 4QLJA 5EMKA 3AMKA 1GOOA 3U0HA 4AF0A 3NO5A 1MQRA 4TMCA 3G1HA 4O15A 3VIGA 4LCQA 2Y89A 1Q2SA 3W1PA 5GQBA 1TZZA 4JTCA 1YX1A 4IUGA 4L65A 4UTJA 3KXQA 3R1ZA 4AUBA 2BMBA 4DN1A 3TCEA 2YXXA 4MPKA 1F3WA 2QGYA 1K3UA 3QM3A 2VFHA 3WZ0E 2INEA 4HK6A 1GHRA 2FGZA 3UXDA 3R0UA 4QDMA 1QOPA 1FVPA 2HS6A 1VBJA 3GR7A 2HV5A 4EXAA 5TD4A 2ZX5A 3HG5A 4ADSA 1WZKA 1Y5VA 4B4HA 1HL8A 1LG2A 3HURA 2BXVA 3PANA 3QR3A 1TJ2A 4QAIA 3OVRA 2GSEA 1R9XA 1OF6A 3M07A 3EDFA 3VM5A 2OZ8A 4RV8A 4AD5A 2J78A 4UQBA 5F2GA 2OWXA 3S9IA 2PD5A 3M9YA 3N13A 4RKAA 4DZAA 4IIGA 5HUPA 2DT1A 3NL5A 1K4GA 1YKWA 4R9OA 5G5IA 4GJJA 4XO6A 4XB3A 4KS0A 1FH8A 2PDJA 2QZRA 2Y70A 3S9YA 4AH7A 2BY2A 3R0KA 4ONVA 1UD5A 5BXRA 4ZBCA 2XVLA 3W00A 3EWXA 1E0WA 1DJQA 1V8EA 3QR1A 4GUIA 3BZJA 2DZXA 2VZUA 4L5ZA 1QR7A 5IBXA 1I2OA 1MRAA 1KTNA 1H5YA 1WCGA 2J88A 3MUZ1 3IJQA 3S6DA 5DY3A 2GJLA 4LYPA 2WSQA 3T0BA 4Z2IA 2X41A 1SPQA 3DXIA 1K4HA 1WA3A 1G7VA 3H7VA 1LL7A 1J5TA 2TSYA 3APTA 1W0MA 4XZ9A 1BEUA 1BQCA 4O1EA 4ROPA 1CPUA 5T9BG 3H2EA 3ISIX 5HNRA 1EWDA 4N9EA 3UZZA 1BG4A 3ABQA 3LLXA 4DAIA 3SI9A 4D71A 3CWNA 3LQGA 3FCPA 2HK1A 1A0DA 4QJ5B 3L9CA 4L6OA 3KLKA 1TZ7A 4PEEA 5AC6A 3CQKA 2I17A 1FWDC 5JMUA 4OE7A 3V0TA 4KWUA 3ITTA 1H2JA 1G9HA 4W7VA 2WMFA 1HTIA 2R91A 4H6RA 2JKEA 1GQJA 5D38A 4D8AA 1V6YA 1AW5A 1OX4B 4GMEA 4MM1A 1XLDA 1NDVA 5L6UA 3CASA 2H90A 4JN7A 3IRSA 2XUCA 1EKOA 1EF2A 2QUNA 3W7LA 4H2CA 3WD2A 1GVFA 1HG3A 1AQHA 4E38A 4JL1A 4NG3A 4MOZA 1TRDA 4JOMA 2V69A 1KNWA 1DJZA 2JGYA 2XFYA 5KZMA 4W5ZA 3MMTA 4ADTA 4XIAA 5C9UA 3NQAA 4HHPA 1ZLPA 4JY8A 3VE7A 4C6DA 1WQ5A 3QY7A 1JZ6A 4H6KA 3LCHA 3CUIA 2C7FA 1O1HA 3HQPA 8XIMA 4IQDA 4JCMA 3M46A 4V2XA 4OWGA 4LUTA 3ITXA 1JVNA 4TUFA 2C0AA 3PBMA 3UG4A 1DWAM 4L1WA 3AXIA 3H4WA 1I9CB 1WXYA 1LOLA 1E6PA 1RCOB 4C1NB 1J11A 1QPNA 4RE2A 4JHOA 1PUDA 4PCSA 1RD5A 4PL1A 2GQ8A 5HQLA 1UIOA 4I3GA 1EEXA 4JDBA 3PWIA 3F5JA 5KTLA 2VR2A 3ZR6A 3OZPA 3FJNA 3RK8A 4LAZA 1FWSA 4W89A 1E6ZA 1W1YA 3M0ZA 5CH9A 1JCTA 3LI1A 6XIMA 3G5EA 4E2DA 2VR5A 2XGZA 3BXWA 4GZ7A 1K77A 3NDOA 1HGWA 3DFQA 2WVVA 3KWSA 4GYPC 5AHMA 4MJZA 4E3TA 1J8VA 4QG9A 4DHGA 3NO1A 4K68A 2E5CA 4PH6A 2WO5A 3REQB 5M2FX 1BYCA 1DE5A 1T8XA 3CNYA 1W3NA 4I9AA 4C6PA 1V0MA 3UF9A 4EACA 2WJDA 4MVAA 3WEOA 3EMCA 3G1YA 1MI3A 3IAQA 4ACYA 1NOWA 1XJBA 4XUYA 3PTKA 3SCSA 3TIMA 5JBDA 4AWTA 1G4PA 4G9PA 3IEBA 3U7BA 2IPJA 1EHNA 4LV9A 4RZ5A 1DIOA 3QBUA 5I3GA 3LRKA 3IGUA 1SJBA 2YZRA 1KWKA 4O11A 5FF3A 2YBUA 4EAMA 1R2SA 2EQDA 1YXYA 1TRIA 1MEWA 1RVGA 1GUVA 3WFLA 1LQ0A 2BY0A 3GTFA 3HQOA 4XD3A 4V15A 2EO7A 4QIUA 3B0XA 3QW4B 3NL6A 4W87A 3C3NA 2ZOXA 1A49A 3BLEA 5AVHA 3VOIA 1LWHA 5GJPA 4B5WA 3S4TA 3BARA 1FX6A 1VFOA 2QT3A 5E0CA 5HJYA 1N55A 3IUIA 3IGHX 1GPFA 4JX6A 3MDUA 2WSRA 2ZX6A 2PGWA 3CHEA 2PMQA 1FWHC 1EXBA 3MANA 3CIVA 3GR8A 4CU7A 1Q85A 1KLYA 5C7VA 3ZLGA 1B0IA 3AIRA 3SUVA 1JAEA 3GG1A 5A6JA 1WE5A 3GFZA 1KXHA 2POZA 2Q8XA 1RP8A 2V3GA 2VXNA 1XBZA 4GQBA 1VB9A 1ONEA 3WD0A 2CXEA 4FF7A 3L2MA 1KFJA 2PWHA 2PTZA 3L4VA 2HPMA 1V6XA 3ZT5A 4WK9A 4AZBA 2G3MA 2J62A 4GY1A 2VHLA 3AWOA 3PJUA 2OSYA 3GFYA 3TCSA 2JKAA 1F3TA 3VINA 3R8RA 5ABEA 5AZ1A 1FQ0A 4YWIA 1N8IA 3VIIA 1RA5A 3AISA 1XBVA 3M7WA 2VMFA 3WLPA 5AYIA 5FAJA 5JBEA 2G5WA 1AVAA 2DH3A 5AYYA 2C0HA 3SRHA 1G1YA 3FJLA 1NIUA 3KOFA 2CEQA 5IDIA 1EUAA 4J4KA 3PPCA 4GABA 5FJOA 3MHGA 3SB0A 4GVIA 3G0UA 3N1AA 3GU2A 1WKDA 4WD0A 1C29A 2O7SA 1KFEA 2BSLA 2GZXA 5EL1A 4XAPA 1E4MM 4ROQA 1KFBA 3VD5A 1JDAA 1UH2A 4L61A 3POCA 4TU1A 1XBYA 4FSAA 3OZYA 1XH2A 2QIIA 3WMLA 3KWXA 4B2DD 1JPHA 2FPTA 3CMFA 4QJ3B 1IWPA 4RX0A 3I7QA 4Q22A 1SO3A 3F2CA 4PMUA 4J28A 4Q8UA 2GJRA 1P0EA 2ZRVA 1XRFA 3EDKA 1QI5A 4LS2A 3OQEA 4HYRA 2PWFA 1J93A 2JFEX 4J3WA 4MDPA 4O17A 1OF8A 2XWEA 1QOQA 2RHGA 1LRTA 2WC4A 3I68A 3I3DA 2F7FA 2PP1A 4HA4A 4GYPA 1HKVA 3P81A 3FW6A 5FAGA 1GW9A 1JJKA 1K8ZA 4UUIA 3U2CA 5FOOA 4B90A 5JH2A 4EPEC 3WJYA 3IS4A 4UNLA 2V5LA 2ZICA 3O16A 2W79A 1GQIA 2VOTA 3G8RA 1GWJA 4FIRA 2PRHA 1S46A 2WC3A 2VOMA 1J0JA 4XKYA 1JD7A 1ZPTA 4AX7A 5I3DA 1W1B1 2AMXA 3NQGA 1PKYA 4J35A 4JTLA 4H7CA 3E6EA 4O28A 5FJRA 3TYCA 3L4UA 3NSMA 1JCXA 3FEQA 2VC7A 4RE0A 4PBFA 1P48A 4RW3A 4Z42C 2F2HA 3A24A 2CZVA 2WJFA 4GD0A 5DXXA 1C92A 1X6LA 5C6MA 2O9PA 2J7EA 4BI7A 4XK2A 3EYPA 3MTWA 1NOUA 2A0NA 3RLGA 3PUOA 1VFMA 4S1FA 2FVLA 5DBUA 3K4DA 4C6CA 3CAKA 1KQZA 1VIWA 3BAJA 4O1FA 5H8PA 7XIMA 3UWUA 3WJSA 2WQPA 3V5FA 1BGGA 2FZNA 2EHHA 3RCMA 3C3UA 4D72A 4YYFA 2J7FA 3T09A 3ARTA 3O6DA 2QVHA 1GEQA 4CLMA 2PTWA 3VKCA 4UFHA 1QATA 3EWUA 5I2UA 3IIXA 5L9FA 1X98A 3GDRA 4IM4A 1KM0A 3T0CA 1GTEA 3R11A 3NA8A 1O7AA 3OBAA 4ZODA 3VDAA 3PJTA 4FNPA 3TJLA 1VC4A 4MF4A 1KTBA 2DJXA 2PLJA 4NNAA 4GYKA 3IUDA 1HKWA 4ZOAA 1XIDA 1EUNA 3T05A 2ZZ3A 4GUFA 4MNJA 4I8DA 4LAUA 1POJA 4U33A 4NI8A 4CU6A 4O16A 1OFRA 5LA1A 3OO2A 3RU6A 3ZJ7A 5A6BA 2X42A 1XC6A 1LOSA 2NWSA 1GVOA 1K02A 1C8YA 4DXVA 3QV6A 3AIBA 1LF1A 3ITVA 5C8BB 3UY7A 1RJQA 1W1IE 2XH4A 3TK7A 2QV5A 4MLJA 2X7VA 4DO4A 2Y85A 3OVGA 4YVPA 4C60A 3TSMA 5MKGA 1KM6A 2Z27A 2DSVA 4A21A 2DT2A 4HCLA 4JX5A 1K8CA 3QHMA 4L4LA 5M1TA 3RNDA 1WDRA 4M5PA 3R4IA 2PWEA 3UYIA 1FWRA 4KERA 3C6CA 1TPH1 2ZA1A 5E93A 1FH7A 3GC4A 3EX1A 3M41A 3RCYA 2OODA 4YIWA 1HJSA 1C8QA 3GDBA 2DIKA 1HKKA 2UY3A 2PBOA 1AODA 4A2SA 5D2WA 3H23A 3TYDA 1P7TA 4JTFA 3TVAA 3SW6A 2Z25A 1UC5A 3TSDA 2Y61A 5EBUA 4GWEA 1LLZA 5LZLA 2RUSA 1UW9A 1X38A 2PTDA 4JQ1A 4F4RA 2CHRA 2QV4A 3B9NA 4FOJA 4QHRA 1U5HA 1XUUA 3SSZA 3W2NA 1YPXA 4GYFA 3WF4A 2IXVA 3RG6A 3RX3A 4GK8A 2DZVA 2J24A 4AQLA 1ZP3A 3S5SA 2NT1A 1Q8JA 4J3SA 1CWYA 2G8ZA 1EA0A 1W17A 1B3ZA 2EBNA 4JICA 5K7JA 2X1UA 2CLEA 5FJPA 5LXXA 3A5VA 7ODCA 1MW3A 4GNVA 2QDGA 2XG9A 3OJGA 3MCNA 4A3RA 3WG6A 4JTHA 3MHUA 1E3ZA 1KM5A 2DSKA 3GG8A 3AMLA 3RDKA 1LJYA 4Y96A 1RAKA 4P7LA 3EMZA 3QZEA 3NQVA 3U7VA 3H2OA 1R2RA 3W2MA 2J9YA 3O05A 4MAVA 4CCCA 2ZYFA 2XIIA 1CB2A 4CKQA 3WH5A 1SW7A 2VEIA 3ALFA 3QSRA 3VAVA 1C93A 1WAWA 3PZQA 4LTSA 2VQUA 3GH7A 4QROA 2V6AA 3QQ1A 4IL2A 2Y5SA 4PTDA 4EPBC 3ATZA 2W27A 3T7VA 2QCFA 2NX3A 2ZRUA 2A7RA 3LHWA 4WGHA 2ZA2A 4NI3A 2EJAA 3W4RA 5LSMA 1XFCA 4GVHA 3OVPA 2NXGA 1QI2A 5A6KA 3VCRA 2WZTA 1QBAA 3PZ9A 1I2NA 2DV0A 3NTYA 3VGDA 2INZA 4ICMA 1VLIA 4FI4A 1W1TA 1HP5A 4J2PA 1ZFJA 2IPGA 1MZHA 4ATDA 1X96A 3CHDA 1OCQA 5BXTA 3MCMA 3NR0A 4I7WA 1TVPA 3UERA 8XIAA 4QR6A 3DYPA 4Q8MA 5CZ0A 1A5SA 3KS6A 2XIBA 4ASTA 5HR6A 3SRFA 1FCQA 2E77A 3SQLA 1VYPX 2ZZ2A 1BSLA 2VVNA 4KH2A 3E2SA 3MKKA 1A5CA 1WZAA 1B5TA 2PDFA 4JCLA 4FX8A 4D6GA 5AC8A 3F4VA 4Q6JA 1IXOA 5ABHA 1F7BA 2RH9A 4M29A 1TE6A 2XIMA 3VIOA 3PTMA 3CHVA 2OKOA 1LZOA 4ZFMA 3TJ4A 4DLFA 2GK1A 4GO8A 5IHRA 1W2VA 2BVTA 4DF2A 2D2OA 5M3WA 1XIJA 4Z1DA 2D2GA 1RP9A 3QTGA 3OBEA 4S2CA 4TOQA 4F0HA 2GDUA 3S2LA 1S3HA 5TBOA 3EKGA 3I6TA 1BVZA 1BG9A 3LHVA 4IF2A 3SY8A 5CGTA 2QF8A 2ZZ6A 4PTWA 2ACSA 3KTCA 3W23A 3WD1A 3C0SA 1M41A 4DYEA 2QCEA 1Y5WA 3PB2A 3BLKA 2Y7DA 3OYXA 3CC1A 4GUGA 1CLKA 1QMLA 1A0CA 1D3CA 1I0BA 1P1XA 1SSDA 4YLWA 3QHOA 4XVEA 5F4SA 2PWGA 2BHUA 2CNCA 1TO3A 4FPSA 3DHUA 2A79A 3C8NA 3UPMA 3B9AA 2ISDA 2PGFA 2A4AA 4H1ZA 3TFCA 2I9UA 4IPJA 3G1AA 1DBTA 4OGZA 3NEHA 3LCLA 1WP6A 4EANA 1GVRA 2ZC1A 3U4AA 5BROA 4HNCA 3ONCA 4M6UA 1TQXA 2CESA 2CIPA 3GIYA 4YVVA 4ZCWA 1X6UA 4QX4A 2QMJA 4UTWC 1GYNA 1XIBA 2VRJA 2PDKA 5GVJA 4HT3A 2GFTA 2OMAA 4N7QA 1K6AA 3SFWA 1T99A 3CT2A 3N04A 1I2QA 2WB5A 3C2FA 5DANA 4ERAA 1GVQA 3CM4A 4FK9A 2OGYA 3RU8X 3VMOA 2E67A 4HPXA 2V68A 3Q94A 2PUZA 3SY5A 1QAPA 2QXWA 4IPNB 1H50A 4LYRA 4IP4A 4GO9A 3P82A 3PUGA 2V3FA 3VX0A 2Y8KA 3AS1A 3AHZA 4MYXA 4J2MA 2O56A 3V16A 1MFUA 2QF7A 1MNSA 3RILA 6TIMA 1ITUA 3KBVA 3QGVA 1UD4A 1EOKA 3EWBX 2HDJA 3PBUA 5CC5A 2E9LA 3IIPA 3QJAA 4ZO6A 2C91A 3IJ8A 1TWSA 4JNZA 4WDUA 3RMEA 4L9ZA 1W5OA 3HG3A 3U48A 2WJZA 4JTRA 1POKA 2XDFA 1UUQA 3P8JA 4MGGA 2OKTA 2YCIX 2HE8A 1ME9A 1H61A 3KRZA 3VNKA 3CHFA 4JIPA 3N3TA 3TYAA 1MEIA 5FF0A 3HG2A 2FDSA 4LBSA 3FIGA 4AD1A 4HPHA 3O2LA 2PDLA 2PDWA 3P2VA 1K6WA 4Q33A 2O9OA 4FNUA 2DUXA 3ELFA 3GFXA 4HCHA 1OG6A 1KKOA 2RDXA 5KEZA 1LWIA 5K3VA 1XINA 3A4JA 3PG8A 3NQDA 1TFVA 1HJVA 3VKKA 3NL3A 4XAFA 4LUJA 5E9XA 4K1WA 3BOXA 5A2BA 1IR1A 2X7WA 3HFTA 4YU1A 4KMQA 3BLFA 2WZMA 2HVOA 1IT0A 1B30A 3IK2A 1TCMA 4J3UA 1EL3A 3UJFA 5HR7A 3O15A 3R7MA 3DENA 3VC5A 2R8WA 5ECUA 6ALDA 3D5HA 4FXSA 4B5NA 1R6WA 3B9EA 1I1XA 3GU1A 4NRRA 4MNLA 1DKWA 1DHPA 3E38A 4D6CA 1G7UA 3S6TA 1DV7A 4XD4A 3UG5A 1E6SM 1Q45A 3PWAA 1UZHA 2VEKA 1G94A 1OFPA 3H7UA 4HK7A 3GW0A 5F7UA 5LHEA 1IIGA 1A80A 3Q37A 3AHTA 1Z7AA 4OFCA 2CETA 3VKAA 2XSXA 1G5AA 4YTTA 4IJRA 5LIXX 3GDKA 4NZFA 4XVDA 1V93A 3UXKA 4DXXA 4B9YA 4ZQNA 3GKAA 5D2TA 1KGUA 3L4WA 1I60A 4Y9MA 1D7KA 1E51A 5DT5A 2ZX7A 5FA5A 1NWSA 3KZPA 3S2JA 3VABA 2OSWA 5BWAA 2YX0A 2PU0A 1KCZA 3EXSA 3G22A 1HX0A 4HN4A 4B5SA 2GWGA 5FL1A 1A5MC 3PUDA 2H9AB 4ATLA 3QFEA 1F76A 1TPWA 4TVCA 3M5VA 4AIBA 4HZ7A 3AS3A 2NQLA 1WZMA 3W1MA 3WQ8A 4DI9A 3EX2A 4Q4KA 2W92A 2OZ3A 4Q7IA 1W5NA 1DJYA 1LOQA 1JGMA 2UBPC 4IGNA 3CIWA 2J47A 4UTWA 4N6EA 4L1XA 3R89A 4S3CA 3A9IA 1JFHA 3WMSA 3NFUA 1PZ0A 1M65A 3EX6A 4IT1A 2ISVA 4Z1CA 4NAFB 3W87A 5BOFA 5A6AA 3SJNA 3L4XA 3W0KA 1ZQ5A 1E5JA 1RJRA 2Z6JA 1XSIA 3CT7A 4FF5A 2YL8A 3LGEA 3JR2A 4X22A 4DZ5A 1OABA 1V7AA 2XPKA 1P0NA 1N8FA 2HMCA 1E0VA 3ZVHA 4ZQCA 3N2CA 2O9TA 2PLCA 3VGFA 1XX1A 3P6LA 5C55A 3GLCA 5A94A 4WEVX 1QI0A 2DUAA 5J8LA 3S5YA 3HMCA 1H3GA 2GYIA 4ZE4A 4HNOA 1GEHA 4B91A 7PTDA 4DBUA 2R24A 4DO7A 5BWFA 3KUMA 3GBDA 3DKJA 4IFRA 4GJIA 3BCFA 1WNOA 1EB3A 3NQCA 4RDVA 4PGLA 2XIOA 4WY0A 1A5BA 4LBRA 2O55A 2CITA 2I1OA 1XCXA 3VU2A 3WBAA 1H09A 4Y6GA 2X16A 5DMYA 2BVDA 1XDLA 2F84A 3NWRA 3OG3A 4NJKA 1V3LA 3IACA 1TIMA 3BDKA 4P8UA 4HMCA 3CXOA 4WXZA 2WCGA 3MSDA 3UR2A 1C8VA 1SU5A 3CMJA 4ZTXA 1C90A 3OODA 4A3HA 4JBRA 5IXEA 4QS6A 1EPVA 3BV7A 3C8FA 1ITCA 2RGLA 4C91A 1OGBA 5AYZA 3N3MA 1NU5A 3LCXA 1F6PA 5HWJA 3ZZ1A 2JKPA 2AL2B 2CC0A 3NDYA 3MP4A 1EJTC 1W54A 5AFDA 3UWVA 4CD4A 3VZXA 3QMRA 4HD5A 3NQMA 4PMQA 1UD8A 3QLDA 3HOJA 2V3EA 1FDYA 4ZB0A 3LTPA 3PJWA 1BWKA 1CLVA 3R2GA 4ATWA 4W8AA 1M3UA 1J0IA 1VJZA 2MNRA 4H41A 1XYLA 4D6JA 3AFBA 1P0BA 1BXBA 5C5YA 2A7NA 3SDOA 1KXVA 3WLTA 3GH4A 4C6QA 1TKKA 5D03A 3MYPA 2BFGA 2YB4A 5D9MA 1HO1A 5E1QA 1VBGA 3OG2A 2B81A 1EIBA 4K7YA 4MIMA 1REQB 2ZTJA 4RDYA 1KXQA 3T0AA 4XWUA 1B90A 1V77A 3SGUA 1J0KA 1Y5XA 5G4HC 3TOYA 3FS2A 3WH9A 1PEZA 2YGYA 4BZYA 1DWJM 4HNLA 1KKRA 4IG2B 2V5DA 3Q45A 3W6YA 4CNTA 3LTYA 3GXDA 4D8LA 3CPUA 3PUEA 3JUGA 4F0MA 2GVGA 1RY8A 3W81A 4H8UA 4LQ1A 3KDOA 1HVXA 4AVNA 4I6VA 4B92A 2VZTA 4C6KA 3S6OA 3EKZA 4OTKA 3RO8A 2CWXA 2CLIA 3ZSTA 1WYIA 4GBDA 1X1NA 3CWOX 2ZUNA 1WKEA 1LQ2A 3N34A 3GIQA 4R88A 3BMVA 4AHQA 2VGGA 4Q4SA 4FNSA 1AQMA 2IW0A 1W1VA 1GOMA 2QLYA 3LQLA 4UZSA 2ZRYA 4LB4A 1H41A 5BYWA 1R46A 2FVKA 4Q3MA 3B03A 3VKJA 2HRWA 4F9JA 1NF7A 3B04A 4IX2A 4BCEA 3SGGA 4AZ7A 2P76A 1TX0A 3THCA 1YHTA 4KIEA 3N2MA 2WLYA 2I57A 1IYXA 2QDDA 4JTDA 3CV1A 4D2JA 4HZ8A 1NVMA 1LG1A 1SO4A 3QRHA 4HU0A 5A2AA 1M03A 4KCUA 3W7DA 3R79A 1I45A 3NYDA 3MW7A 3N12A 4AZGA 4NJIA 2WMKA 4HIBA 4QGCA 2VUYA 1R5YA 4P5UA 2QJJA 5FF2A 2ZE0A 4QS5A 1FWIC 2VC9A 4DY1A 1W3TA 4A4AA 3MWAA 3LHYA 2XZ7A 1VFLA 2A21A 4Y8EA 1CGUA 3BL3A 4BK9A 3VMPA 4S3GA 4NXSA 3IIOA 3NSNA 4PB5A 4UOQA 1QHZA 3WDIA 4F8XA 3PTQA 1U33A 2YLAA 1D3HA 1GQLA 1NP0A 1NM9A 4KGLA 1OT2A 2ZUWA 2DSWA 4BQ5A 1QNPA 3LS9A 2LLEA 2P50A 4YTSA 2NSOA 3NXFA 2V82A 2PFHA 3TYBA 4Q8WA 4H19A 3GW3A 3QY6A 1XFBA 1F3XA 2PC4A 4UFIA 4XTIA 4D9PA 2X09A 4I8YA 2AMGA 4KWSA 4QCEA 4REQB 1BQGA 2A6LA 3HV8A 3DYOA 1XLAA 3LPGA 4B3ZA 1H7RA 3BOFA 4BI6A 4NILA 2ZTKA 3WQ6A 3B9OA 5JVLA 3KFTA 3I4EA 3B8IA 2TYSA 1CXLA 1CXIA 1FHDA 3QQWA 3WSUA 3HN3A 5ABTA 3OHMB 4CNUA 4B5TA 4W88A 3TTSA 3E49A 2WPBA 5EMJA 2J79A 4X3ZA 1PIIA 4DXKA 4N0RA 3BE7A 4MWAC 1BXNA 3MBDA 5AB3A 1WKYA 3FJ4A 3FGCB 3TWBA 1XIHA 4O10A 4WDTA 4MYAA 4KETA 4MB4A 2OWCA 4NJGA 3TFXA 2EPLX 1VAHA 4XSLA 4HA1A 2QCDA 3G1DA 2DVXA 3AZSA 2OYMA 3QSTA 2JBMA 4GINA 3U3HA 4DBWA 5CAHA 3KLLA 3GAYA 2A7PA 2NVAA 4D6HA 2ABBA 2Y7EA 1ADSA 1DORA 2Z2UA 3MKVA 3QVQA 1Z6KA 1UG6A 3ITYA 3W1TA 4JYDA 3RUBL 3URNA 2C1IA 1GVEA 4IXHA 3GTIA 2PDQA 3GNPA 3HU7A 3QPYA 4QE5A 4IISA 2PC8A 4Q4PA 3CB8A 1JZ2A 1UR1A 1TV7A 4W7WA 2BXYA 3NOEA 2V2DA 5BMWA 2YYUA 1WOBA 2WNZA 2EG8A 5FJIA 3CL8A 3MI3A 4OBSA 4JX4A 4GJ1A 2NZLA 4M3PA 4GKTA 1OFDA 3Q2DA 1ZJAA 5DCBA 1ISYA 2GVEA 2Z6IA 1H51A 5K4XA 1XLFA 1A3XA 4M51A 4XZIA 2QCMA 2NLYA 3KP0A 3WNNA 3BSMA 5IM51 3ZLFA 5HUOA 1JZ3A 2YOCA 3CHCA 5A8PA 1E72M 3HMJG 3G3DA 1DTUA 4NAEB 4UOJA 5HNNA 3JZEA 1DXEA 3VE9A 1UR4A 3TEVA 4PMYA 3M0YA 3PF3A 3EOEA 4AG0A 2QGHA 2Z1KA 2RAGA 1GG1A 1UA7A 4M6PA 3FFSA 1W1ZA 3GYCA 4GQ0A 4Z17A 4LS1A 1O5XA 4L4PA 3AXMA 1G4EA 1E1CB 3RJXA 4YL2A 1JPMA 5E6YA 4OT7A 1NAL1 1U1HA 3EXRA 1IT8A 3HPFA 2I5IA 2WHMA 4S38A 5ABFB 4UTUA 1UKTA 1HZYA 5CBBA 1AZ2A 1GTHA 2OU4A 3T81A 2YR1A 1RCQA 3TXZA 1YTDA 4GA8A 4RDZA 1IGSA 1SMAA 4C6FA 4JTTA 4LUYA 1U5VA 1JCMP 2VDIA 4I9TA 3WK2A 1UWIA 3NQFA 4C5YA 5GPRA 1Z3NA 3A3HA 4IMDA 2VFFA 4NNCA 4DLMA 1VGAA 4PUNA 3DHPA 1TJPA 3WQPA 1F5ZA 4DJFC 1LLWA 3KCLA 4AF0B 3AHVA 2TAAA 3AS0A 4HHLA 1QWGA 4D8ZA 1E43A 3IVTA 1KW1A 2P3ZA 3HPSA 1T5AA 4AVFA 4PTVA 2FJKA 8RUCA 5CJ5A 2IQTA 4AC7C 3M5YA 1CGWA 1W3JA 3N15A 2Y8UA 1M53A 4JQ4A 1LL6A 1E4IA 2VEGA 3PBYA 1OIFA 3TMLA 1MXSA 1CDGA 4MJ2A 3ZFHA 4RJEA 4HZMA 4YTRA 2OYKA 3VNIA 1B3WA 1Y7VA 2G3IA 1R7AA 3VFCA 5FEZA 3TTOA 1AW2A 1A5AA 3WY1A 2EPOA 3FK4A 4ALDA 3K5XA 4MWAA 1QNSA 1HN1A 4N4QA 1TV3A 1XKYA 2WC7A 2FZ8A 1A3WA 1ENUA 3N19B 3WLRA 4HK5A 2HBXA 1DXFA 1JNEA 3OLEA 1UZ4A 4WVXA 4QITA 5E70A 3UU0A 3JVAA 1G67A 3MC5A 4QBXA 3GVQA 4HOWA 1PDZA 2FQIA 1ZJHA 1JUBA 4EAYA 3UQNA 4DVOA 5JQ9A 1DJNA 4AZHA 4KF1A 1QW8A 4CD5A 1VEMA 2G50A 4R33A 1DWIM 4KRTA 2Y5EA 4GIRA 1V7YA 2XWDA 5BRPA 1OBAA 1UCWA 3IRDA 3WLLA 3VDGA 3LOTA 2POTA 3EWWA 1TB3A 3CUXA 3R13A 1GKQA 5CPQA 4AVOA 3TU9A 4PTMA 3HZ3A 4L1GA 1E0TA 3NXLA 4Z1YA 5CPLA 2OX1A 3H2MA 1W3HA 4TMBA 2WJEA 4GRSA 5A1AA 1R47A 4WKHA 3KTXA 5IOBA 3FY1A 5B7YA 4J7RA 3NVDA 5HK4A 4Y8FA 1UWAA 2QS8A 4JNMA 1N7KA 2EXOA 3PHAA 5JXQA 4A3QA 3XINA 4ZOCA 2DZSA 2Z2BA 3OW1A 3RRXA 3OP2A 1L6SA 4R7OA 1OGGA 1OWQA 5D05A 1J10A 1V6WA 1XR2A 5G2IA 1V0NA 1VPQA 3C0LA 1TJRA 5EMLA 3UR7A 3W83A 4EF8A 2DZBA 4NT0A 4HMEA 3E3HA 4DWSC 3WNKA 1VP5A 3LPOA 3D47A 3U6WA 3U4FA 3S2CA 4RE3A 2J7GA 4US5D 3VZZA 4H2HA 4JTAA 1LT8A 1NDZA 3BPWA 3V3WA 2OT1A 3CO4A 4W86A 3A9BA 4GH1A 2H9AA 1EYEA 2WQDA 2XYLA 4S3EA 5TF0A 1S2VA 4C7FA 3VC6A 1SMDA 4G2DA 2E6DA 1NFGA 3RLUA 4ZO8A 4F9DA 1Q8AA 1VCFA 2A3AA 4DBSA 3PR2A 4DJFA 4H9YA 1I75A 3ABSA 2VCAA 5J04A 1CXFA 4XBKA 3WUFA 4LUTB 1UIPA 2WCSA 3DZ1A 2ZUMA 4XAGA 1AD1A 4B4FA 4ZVJA 3TTYA 1XSJA 2YXGA 1KLZA 3S2NA 2DP3A 1BKHA 1OG0A 3SSJA 3LCWA 3S42A 4J3VA 4XISA 1V6UA 4E0CA 1DE6A 3TW6A 2XTKA 5EFFA 1XCWA 2V5CA 1VFFA 2ABAA 2PF8A 4KEZA 2E25A 1YTEA 1OFBA 3N29A 2BY1A 3VUSA 3OEXA 4DJDD 2J6XA 3QMTA 3KRUA 2IPFA 4R9XA 1L0PA 4GI6A 2WVVB 3MP5A 4FLQA 1JQXA 4MJMA 1OK4A 2XIQA 3LG3A 3NNTA 3TN3A 2DH2A 3D46A 1C9DA 1IZKA 2BBFA 4JHMA 1WV2A 3BGJA 4AY8A 5LNUA 1TWDA 2XN0A 1LM1A 3W76A 2CXGA 1PB0A 2ZADA 3BG9A 2QNEA 1XLHA 1RALA 4HPGA 3HGJA 5FIPA 3W02A 1QUMA 3OLIA 4IMGA 2ZWZA 3IIZA 4YTUA 1JFXA 2PZ0A 4UR9A 3VD7A 1G01A 2P5NA 4JFVA 1XIEA 1N82A 4AC1X 1V79A 4MNMA 5IFPA 3SM0A 1QJWA 1C7SA 4FP1A 4EXQA 2XVKA 1BSIA 1F6YA 3LCFA 3T8LA 4C5ZA 2VCBA 2BB0A 4F66A 4LAKA 3DC8A 1JZ7A 1QBBA 2BV9A 1IEXA 4U31A 3SIZA 4N9CA 3QYSA 1UKSA 5I7GA 4CQDA 4XKMA 3UZ5A 1GYLA 4GCAA 3RR4A 3N2TA 4S23A 5AVNA 5LNRA 3CS2A 4Q8NA 5JUVA 3PPHA 1EIXA 3LX9A 1OGSA 3AOFA 1YIXA 3CQ0A 1SO5A 2NWRA 4EIVA 4JNYA 1IR2A 2I5QA 2ZKMX 1Z44A 5J5DA 4J3ZA 2J13A 1CW2A 3AC0A 4S3JA 2VFIA 2PPGA 3I3BA 5BNKA 3ARUA 1EGMA 4TIMA 3W72A 2PGEA 3EOOA 1PXGA 1NEYA 4FMVA 2E7FA 4G7FA 3O7UA 3SGZA 1B9ZA 3URAA 4K8EA 1CB7B 4JXCA 3VNYA 3ITLA 5LYRA 4NP7A 2QEZA 3BAIA 1FCBA 4WXYA 2E6AA 2FPYA 2E8YA 7ENLA 1O4UA 3QQ0A 3UEQA 2BVYA 3HM7A 1QK0A 2A5HA 4H00A 4P7RA 4DWSA 3UY8A 4RNFA 3A5FA 5HNTA 4IX0A 5DMNA 2YA0A 2O0TA 3WQOA 3P93A 1K8YA 4H9VA 4FIQA 3ITCA 4XO7A 4UCFA 1X7FA 3TKFA 3H4XA 3IWPA 4ILSA 5RUBA 1OX5A 2QHAA 1WDWA 3F4NA 5FD0A 4JIEA 1KWGA 5M5DA 2ATSA 1RXOB 3WUEA 1JXKA 3SCRA 3FV9A 4KIRA 5TNVA 2WHLA 3EOUA 3QXBA 4GI8A 2B7OA 3NOYA 3AXXA 5BU6A 3LV5A 3O0FA 3LPPA 4JTIA 3BJFA 1WB0A 1KO0A 1KM1A 3RCNA 1EC7A 1GQKA 5D02A 4QG8A 2ACUA 1EDGA 1CI1A 4UTFA 3P74A 3TJXA 5CZSA 5F2LA 3NEVA 3EKLA 1WDDA 9CGTA 1X39A 5HQEA 3LHTA 3HG4A 4KRUA 3LRMA 2ZIDA 1RBOB 1VENA 3AYVA 3W28A 3S5ZA 4L9XA 1Q2RA 3VCNA 4ZENA 3A47A 1UOKA 1PWLA 1ALDA 4QE1A 4PMOA 2TMDA 4U5KA 1RSCA 3NPUA 1JF6A 4LCSA 2ASHA 5HAOA 1K1DA 3UESA 2NQZA 2HE5A 2Y88A 3S83A 3BJTA 4Y9AA 2X8RA 1KTCA 3NZRA 1DPMA 4DUWA 4EF9A 1J9YA 4MTVA 2X1RA 2RFGA 1JCLA 4V1XA 3TQ0A 1OHLA 3WLSA 3E0VA 2NV2A 1MVYA 1OCNA 2PSNA 1SQ7A 2OFJA 3EB4A 1YPFA 1A53A 5LNWA 1UQYA 4R7WA 8A3HA 4AEEA 3PULA 4REQA 3AQUA 3A12A 2W5FA 2GVYA 4URIA 2C3ZA 2FB2A 4TV6A 3SCNA 3GM8A 1KB3A 3FDKA 4M0XA 1VIZA 2NV1A 1AJ2A 1PKNA 4NASA 4QM1A 2GUUA 3ABZA 3VKBA 1OX6A 3AI0A 1CEOA 4KEUA 2Q02A 2YBTA 1E4NA 2WMHA 1SW3A 3PPFA 4JTKA 4US6A 2FB3A 1OCJA 4LRSA 1UR2A 2FJUB 4A05A 4JD4A 4NRSA 3EOSA 2PD9A 5A8MA 3FGCA 4CEXC 4QE4A 4DM2A 4XAZA 1HO4A 2E1WA 2FZDA 4DELA 3ZQ9A 1BYDA 3URQA 4ECLA 2OG9A 4EX4A 1JZ4A 3R8HA 1FHLA 3NZGA 1DJWA 4X2PA 1ONWA 2XSAA 2IKHA 3NQ2A 1V3MA 4UFMA 2XM2A 2DT3A 1VFSA 4PR4A 4HSOA 3AUOA 4K38A 2C8NA 1F4AA 1J6PA 4IP7A 1EJXC 1A5UA 1GKPA 1O66A 1IXNA 1TIWA 3GRIA 2PDXA 3RPTA 1H7PA 4PMRA 3RJYA 4IPPA 1JULA 4YHGA 3SUUA 1XPYA 3AU6A 2OR2A 3WJWA 2DUZA 5C9XA 1M04A 1K8XA 5T26A 4OVXA 2CYGA 4AFYA 4CD7A 1KFKA 2VWTA 4OQVA 3VOHA 2HXUA 4UTMA 2D0GA 3VI2A 2FH8A 4GOAA 3WLOA 3DG3A 4C1LA 4JKLA 4O13A 2OWWA 2YB1A 3BLIA 2BG5A 4HA3A 3WLNA 2J8FA 3GG0A 3MS8A 3DN5A 1CXKA 3CBWA 3UG3A 2B7QA 3L4TA 4POCA 3WX7A 4XZWA 3B8DA 1W9DM 4PSPA 4CQCA 2C16A 3SY1A 7TAAA 2G41A 3ENLA 1AL7A 4C1KA 3G1FA 4Y2WA 1G4SA 3NG3A 2X2YA 3VNZA 3RF9A 2FMNA 3EB2A 1UH4A 1DIEA 2R94A 3VNDA 5MKGB 2JIWA 4X9YA 5A6LA 1Q6DA 1F4HA 2WCAA 2WSPA 1I0DA 3H70A 2X1IA 1XPGA 3OOQA 2GJXA 4ZGYA 4HGXA 1ME7A 2GJPA 4XAYA 4TVDA 2Z1SA 3LK6A 1B3VA 2F61A 3I4KA 3T2OA 3CQIA 1WDPA 4BKNA 5JH1A 2G96A 3IIVA 5I09A 2UZ9A 5G1YA 2BASA 2X1SA 3N9SA 1EQPA 3LMYA 3KE0A 3THQA 5LGXA 2IKGA 2FZ9A 2I9EA 4CEUC 4O52A 2AQOA 3WCZA 4XZNX 3V5CA 4E6MA 1QO2A 4UTHA 2D0FA 1P7TB 4PA8A 3GB6A 2DQXA 3MSGA 3DGRA 4N02A 3OU8A 2PF0A 4MFDA 3T1GA 1ZJBA 1QK2A 3PSWA 1LLOA 3PVFA 1XGDA 3MSYA 2YZ5A 2A1YA 1ZBWA 3S1XA 3FA5A 4S3AA 4TTGA 1EP3A 4DJEC 1SUXA 1J0HA 1ZNNA 2WMIA 3T0DA 4UFLA 1F74A 4FB7A 5XIMA 3KBWA 3RM4A 2JEPA 1T0OA 4L7ZA 2A85A 2A3LA 3R6IA 1FWBC 3MY9A 1QRQA 5A5WA 4DO6A 4NZ1A 4GQQA 1S5TA 2OO6A 4FO4A 4LC6A 3AWNA 3E2VA 4WOQA 3MYOA 3A21A 2Q8LA 2BDQA 1YE6A 3H2FA 1KM2A 4KQNA 3EA3A 3SCOA 2VCCA 4YN5A 4K6AA 1RUSA 3F5LA 4JEQA 2DIJA 5M17A 3DFYA 5AECA 3TLQA 3V4BA 2UY2A 1ADDA 4WKAA 1JGIA 3STEA 3TR2A 1TA3A 2R9RA 4MJ4A 1E40A 1W3KA 4HTYA 4RXFA 1WAUA 2VRQA 2NX1A 4N9DA 4UMBA 4HHHA 3BW3A 4AU0A 4KFOA 3H7RA 3RN6A 5AHIA 3WQWA 4A8RA 4HYVA 4G5DA 3TNOA 3MUIA 1VH7A 4K39A 3DI1A 2VT0A 4LGXA 2VJXA 3QY8A 4LJ3A 3L4YA 3P7YA 1HW6A 2ACRA 4P8VA 1UR9A 2VC6A 4KESA 2PTXA 1M68A 3FKRA 1HGYA 4PYSA 1UA3A 2D0HA 1M01A 1MW1A 1HKJA 4HB7A 3GXFA 2NQHA 3MUCA 2CW6A 2XINA 2RDUA 4F3HA 1VHNA 2W4XA 4MKNA 4LW7A 2YBVA 3WQGA 1E9IA 5B7ZA 2WK2A 3C2YA 4U2YA 3T42A 5FJTA 3R5EA 4ZMGA 4XSMA 3L2LA 3OPSA 1UPPA 4KWOA 3W26A 4S39A 3A23A 3M44A 4O0QA 1E55A 5E0KA 3WLHA 3AMGA 4GIEA 4A6GA 4F0SA 5HJLA 1WKFA 4PMXA 3DFPA 4DEFA 3HF3A 2PP0A 1H7OA 3L5LA 3VZYA 2GK1B 3GVVA 2A3BA 5LGZA 3IVUA 4RK8A 9RUBA 3OB8A 4JIHA 4FAMA 2DEPA 4GKLA 3GHTA 4JPGA 4QXIA 1QFEA 3EMQA 2OX4A 1BRLA 1TX2A 4UC5A 3KOWA 1E56A 2PDBA 3B4UA 4Q7NA 3DHFA 4YS1A 4BQ2A 3ARVA 4BHYA 3C4UA 1W5QA 1XLBA 2NSXA 3GS6A 4A8LA 4NXKA 3UNTA 4J27A 5FKYA 2QVNA 3L66A 3ARSA 5DCEA 2Z00A 5DLCA 1M7JA 5C71A 2EG7A 2YL5A 2VYOA 3EDJA 1V6VA 1F61A 4XD6A 1O6IA 4IPIA 1E1FA 2J7BA 3DFSA 3DBNA 4OIFA 1OZQA 2CLLA 2FGLA 2Y7FA 1B2YA 1K9DA 3SCPA 1AG1O 3SQSA 4DUVA 2BTMA 4HHMA 4NX5A 7CGTA 3BCJA 3AHXA 4I9JA 1Q13A 1Q4WA 1DIDA 2C14A 5E6ZA 3ZVIA 5MHBA 3CZLA 5EBAA 4HA0A 3P67A 1BWLA 3T2QA 4C6EA 1RCXB 2E68A 4AWSA 2O92A 3HA1A 4DJEA 3D6NA 2B0MA 4QJ1A 4ZA0A 3M43A 4RW5A 4Q4QA 1CZ1A 3M0VA 2Y24A 3IJIA 5DRIA 3ECQA 1L8NA 1RZMA 3E5PA 3FVDA 3WO8A 3AYSA 1UKQA 4WDWA 3WD3A 3QZ6A 3T0TA 5A8QA 2OTDA 2QPUA 2VRKA 4XUGA 2CLKA 4PCNA 1BVNP 3QW3A 1SJDA 2I14A 3KZSA 5MF5A 3LYEA 4JN6A 1FHVA 1Q6RA 2B31A 4PUDA 3P84A 3C2OA 3MSRA 2UY5A 5F4XA 3ZR4A 1F9CA 1H5VA 1Q63A 1SO6A 2ONEA 2R1LA 1KRMA 1GYMA 4PUEA 4JR5A 4IIFA 3BLOA 3LSCA 5ABGA 4A8IA 1K7EA 4O8RA 3EZ4A 3TDFA 3C0JA 2E8ZA 3UWEA 2MUCA 4MNKA 1I2RA 2ZRZA 3GXIA 3RFAA 3V36A 4ACZA 4GVFA 3TONA 4WDXA 2FVMA 5BZAA 3S1GA 3EWCA 3EWZA 1VFTA 4H83A 1ZCCA 2J8GA 3UJEA 3BTNA 3M0IA 3ARWA 1P6WA 2VFEA 1XS2A 2W9MA 1VCVA 3PAOA 3BSHA 1H1YA 1TMHA 2X2GA 4LVBA 2WM0A 3MPGA 4DO5A 6REQA 1FH9A 4A35A 3GIPA 2VVSA 1EWEA 1TELA 2DZTA 4H8NA 3HGOA 1TTIA 1XGZA 4YJ5A 4WRHA 3LPFA 3KEHA 3P0XA 4X0NA 1MQPA 3KHDA 2DPEA 1QWKA 2QJGA 2RDTA 3LCGA 5CJMA 3DFOA 3APGA 2D20A 2Z24A 1UASA 3W3OA 4FLOA 3T4WA 1U83A 4INFA 1LL4A 1K03A 4HPJA 2XGIA 4MKVA 3TA9A 2JF6A 1QXLA 1X7IA 5EY5A 3W1AA 4UQ9A 3VDBA 3NJ3A 3AYRA 2H3BA 4U4MA 5D8ZA 1JDCA 3GG7A 3NQBA 3PFRA 1EC8A 5FF4A 5FJUA 4ZOBA 3R58A 1HXJA 1E70M 3TN5A 1LQAA 1MZRA 1JNDA 4I9MA 3FJ6A 3TAOA 1DWFM 1FBAA 1LBMA 2ACQA 3NPWA 2IXUA 2QQ6A 1J4EA 3HFYA 1W9PA 1XC4A 4N9BA 1MUCA 3C2RA 1JRBA 5BMXA 3VVGA 5KMYA 5AHEA 3TOPA 4V27A 1KBLA 2PE4A 1ICQA 2Y62A 1XLCA 4B5XA 1IEVA 3K4AA 1K7FA 1GJWA 5FF7A 3STGA 4J9JA 3QKZA 4EPKA 4XZHA 5GNXA 3B0UX 3W24A 3VA8A 4KWVA 4HNNA 3WLJA 1CGVA 3BMWA 4WX2A 5BRBA 4E3VA 1TPVA 4Q4RA 4D6FA 3G0XA 3GNOA 3EWYA 3FKKA 2W91A 4PE8A 3VOCA 4IMAA 2V30A 1TREA 2EKCA 1H4PA 1YYAA 4JZ5A 4RNIA 4TX8A 4JIQA 2Y4SA 3NGJA 4RV3A 1MUWA 3WLQA 2ALDA 3GHRA 2FTWA 3VD3A 1IXQA 4BQ3A 2OEKA 4JAWA 5FACA 1MDRA 4DUOA 3O6CA 2NLIA 1XIGA 4N2YA 3AXKA 1P1MA 1TPB1 4CGTA 1XICA 2PDYA 2XGBA 2PRMA 1ZB5A 3CLWA 1W56A 2PCQA 3GXTA 1K7XA 2P0OA 4H9UA 5I3FA 2YL6A 2C18A 1TQJA 2Q71A 1PKLA 5D2VA 3EEGA 1EEPA 1UWSA 1Z48A 2BGSA 1OFEA 3AJ7A 3R8GA 1RBAA 2F2KA 3S46A 2DT0A 1BXCA 3U9IA 1ODZA 4UIOA 3QV9A 4H3DA 4OUEA 2PP3A 4J1OA 4WKFA 3L68A 3ONBA 5F4WA 2BVWA 2YYTA 2Z4GA 4LV4A 4PCFA 2VGIA 4HSNA 4CVUA 1BLIA 5CLWA 3ZVHB 4JIIX 3NCOA 3BUVA 4BWLC 1RA0A 1EC9A 4JTGA 3M16A 1XRVA 3HPXA 3DDMA 1CT5A 4PMDA 4JTSA 5H8MA 4IJCA 2Y2WA 1E5NA 1ZU8A 2QJIA 5IHSA 2FZMA 4FNQA 3D3FA 4G7EA 5HWMA 4BI5A 2EKGA 4K37A 1KD0A 3E74A 2OLAA 3G1SA 5KINA 3IJ7A 3LENA 4K8HA 1YNYA 2ZUUA 1WOAA 3MJMA 1OADA 3TW7A 2CLPA 3ORWA 1RK6A 2X1TA 2UWFA 5I03A 4WCJA 4WY0B 4QTGA 1AW1A 2YLLA 4DB7A 4EVZA 2ICSA 1KFCA 6CGTA 3PNZA 2DORA 3OYZA 1U2YA 5HATA 4P8WA 1R30A 3SCUA 3FHQA 2OCZA 3S0CA 4JFWA 2YCLA 5E09A 1UKOA 3L0KA 2E0PA 2EPHA 3W86A 3O3RA 1JDEA 4FZIA 5C2GA 2IKJA 4CCEA 5I3HA 3QOMA 3J7HA 3W7IA 1KV8A 3WN6A 1TTQA 5EYWA 4H6QA 1R8LA 1R3TA 3IJDA 1ZL1A 3VM7A 2NQ9A 4NYYA 3QEZA 3I3EA 4AXNA 1LYXA 3TXVA 4LRTA 1PHQA 3AROA 3FN9A 1V0KA 1NH6A 2V5KA 3NZPA 3DGBA 1JD9A 1K9TA 4PZVA 4KW2A 1IZJA 3O9NA 3GVWA 4Y9PA 1QPKA 1K9FA 2QCCA 1YBQB 3UWWA 3RX2A 3MVTA 4GZEA 2Q8ZA 3VCCA 1KBJA 5AKQA 3GC2A 3UW6A 3L4ZA 1TUFA 2C79A 1EBHA 4B3KA 4LXFA 3LGDA 2PRLA 2AKMA 4E8DA 4EPDC 3L23A 4WHBA 5A6SA 2BGNE 3VIMA 2WYSA 4JQ2A 4Y90A 2YSWA 2E09A 2Z1WA 1I1WA 1SJAA 4V33A 3WLKX 4R27A 1VS1A 3NDZA 1DQXA 1JI2A 2W63A 4FHAA 5LA2A 2DZAA 5FSDC 1W9XA 1SW0A 1FKXA 1PTDA 1TTJA 3LD5A 2VZOA 4WOZA 3OA5A 3KL5A 3WNLA 4MUZA 2YKKA 3PP7A 1MRQA 4L9YA 3DECA 3CV2A 1XLGA 4P2VA 5T91A 1YTKA 1ZBCA 2SFPA 5FEPA 3LXBA 2ZUTA 1WX0A 1A5OC 2OGJA 4DQWA 4DRSA 1TUXA 4CNPA 5A95A 2HZGA 2WLZA 4Z1BA 1TCDA 2GUBA 3SQMA 1DJHA 4IL0A 1TPUA 3LV6A 3W7JA 4K3ZA 1HF6A 1DL3A 1QHPA 1PWMA 1M7OA 3PZOA 1CXHA 2Y63A 3E12A 3KVMA 1UPMB 1NWRA 5CPOA 5GJMA 3AMCA 3F1QA 1FXPA 3OIXA 3TZFA 4UMAA 1H7NA 1BTCA 1LTDA 4JDYA 1V0LA 1KV5A 1L8PA 3FA4A 3GX9A 3RXZA 1PIFA 1JYVA 3L5AA 4M7SA 4TTUA 2BLEA 5HMEA 2UY4A 3ZOAA 2HS8A 1W1A1 3LHZA 2J7CA 2EPKX 1LUCA 3S1VA 4PB4A 4GGBA 1OJXA 2J25A 1EDQA 3WELA 3E2QA 3NM1A 5F1UA 4HU8A 3CLMA 1YDYA 4P7OA 4EKJA 4BWLA 1BF6A 5FCZA 1JUKA 1P6CA 3OQ8A 3RGTA 1QVBA 5I3IA 2X0SA 1LRNA 4XD5A 5LIUX 3W7PA 3A3XA 1E15A 3PNUA 3QKEA 3PAJA 3EX3A 2CLMA 2V38A 4Z2HA 1JPIA 3MBFA 3STPA 4WUIA 4G6CA 3LY0A 3WL1A 4RNHA 3VXGA 4IH3A 1W5MA 5E0FA 4EOUA 4DM1A 2XHYA 3F5KA 4Q32A 3DOPA 1XRSA 5G2WA 3WBYA 1RY0A 3TC3A 4FX7A 2E9BA 3GY1A 3TQKA 2DDXA 2B7PA 1PV8A 3RAOA 3MHFA 4CVWA 1OINA 3PB0A 4Q8PA 5HINA 4A22A 5M03A 4A29A 3V18A 2BY3A 4X0VA 2QR6A 4C6NA 2G0WA 4XV0A 1GZJA 4EXBA 4CQAA 4TXEA 3UZJA 3EX4A 3K8LA 1E6XM 2ZZ1A 4R3UA 4LAOA 2WHKA 1S5MA 1CGTA 2GL5A 2L5HA 2CHNA 3GNRA 2FZBA 1TV4A 1PJ9A 2QCDB 1KR1A 2F6UA 1GPWA 4YCOA 3T55A 4DPPA 2VWSA 4Y9OA 2H8ZA 2XH0A 3PZUA 1BYAA 4CQ8A 5D09A 4UBPC 5DY2A 1ZHAA 2KX9A 2J77A 3VYLA 3BW4A 2VFDA 1V03A 2WSKA 3BV4A 1Z41A 3PZTA 1SZFA 3W37A 2NV9A 3GO2A 3TQVA 4HU4A 3C2EA 4NZ5A 2BOFX 1IE7C 3UPWA 2BS9A 4IZGA 4ZE5A 1RH9A 1FHUA 1EJUC 2Q6ZA 2YPIA 5LIWX 3IGSA 2VGFA 5JIWA 1PZ3A 1JCNA 3A3WA 3VGEA 1JEZA 4Q4OA 3LBCA 1KRBC 4ADUA 3C86A 3BK0A 4RZ6A 3MMDA 5CG7A 4O1BA 2ZC8A 3EDDA 4QP0A 3NVTA 1VJSA 3ZXWA 1FA2A 4BA0A 4NJJA 3GU9A 2ZRWA 4JYEA 2DIEA 4GIAA 1KBIA 2AKZA 2PLKA 1CBGA 3O6AA 4WJEA 3VO0A 1CIUA 3GXNA 5EFDA 4V28A 5D9NA 2BP1A 2YJQA 3VIKA 3B97A 2AOSA 5K4ZA 3QC3A 2HISA 3G1XA 5DRCA 1DJXA 4O0KA 3I6RA 3V75A 1NQKA 1T41A 1VRXA 4B2DA 3A13A 3H6OA 2VI0A 1VPXA 4AY1A 4ERGA 4OU1A 1WUEA 1CX9A 1JG9A 3AXHA 4JN8A 2HEJA 4GZIA 4DYKA 3MWCA 3LHUA 3WUBA 3MT1A 3OHIA 1EGZA 4X60A 3MVIA 4QISA 4E8CA 4IGSA 1V02A 2AL1A 4RZ4A 5FI8A 5KSWA 2J75A 3C5QA 2OB3A 1BKSA 4IXXA 4H9MA 1U1UA 1W6TA 4YYCA 4Q8QA 1XLIA 4PUKA 3E5BA 3BMXA 1AD4A 3KBNA 4FLRA 1FY6A 3UT0A 4UNKA 5CPMA 4JY9A 4LVAA 1DOSA 1DXIA 1W9VA 1R3RA 5DMLA 3PM6A 2I7GA 4ICCX 3NQ8A 3GD6A 1UUOA 2ZZ5A 4EE9A 5D8WA 2EPNA 3NL2A 4O53A 1IV8A 4IJBA 6TAAA 5U4NA 2VC5A 3LRLA 5CZJA 3K8MA 2QAFA 3UZYA 1TG7A 2CCRA 3TAKA 3O0KA 3G18A 4AZIA 3F4DA 5JBFA 2OELA 3MB9A 4AZ5A 5C70A 3NIYA 3KAOA 4MPQA 4GE8A 4LF1A 2EJ1A 1L6YA 1H63A 2XN2A 3B05A 3MQTA 2QMKA 4LT9A 1J6OA 5I0DA 2WHJA 3LA4A 4PB3A 1XLLA 3CMGA 4F48A 2KZHA 3H54A 3QYQA 2XFFA 4MZYA 3FOKA 4PMVA 1G69A 3HPZA 4JGDA 3CH0A 4JYFA 3UP8A 1KM4A 1M6JA 1Q6CA 4WSJA 1J01A 2PDGA 2D73A 3ITOA 2WMGA 3MV01 4UQAA 4UFJA 3S1WA 4MWAE 4MWAB 3QTPA 4R7JA 3F03K 5AC7A 4LEFA 1UBPC 3GBEA 1EP2A 3ANVA 1MW0A 3N2OA 4HVXA 1NJJA 2HROA 2AGTA 2REQA 3GKFA 4OHQA 2V0TA 2GWNA 2XFWA 3S2MA 1UH3A 1XDMA 4D6DA 5CC7A 3W7NA 2XISA 1SR0A 3SUTA 1UP3A 1CENA 5I6SA 1MSSA 1XV8A 5C2XA 3EPMA 1TMQA 4ICNA 3WNMA 3GWQA 1LORA 2PLMA 4PMZA 1XQLA 3B9DA 1QW7A 4Z08A 1FWGC 5I23A 1VD6A 4I6KA 3VNMA 5CSRA 2D23A 4FR1A 1CECA 1TTPA 5D9PA 1XLMA 4ZQMA 4BF7A 4WZHA 1F6KA 2YDSA 1JCYA 1JPDX 3H21A 5E9AA 4AMCA 1SFJA 3S5NA 1A5LC 3H22A 4W4QA 4NY2A 4NJHA 3LM3A 1NY1A 2YL9A 3V7PA 8TIMA 4A3YA 3CAQA 4LOCA 1V3HA 1J2WA 1MFVA 3TYEA 4NZ3A 4C6MA 4P7QA 3W7HA 5HPOA 3HTWA 3H2CA 2O9RA 3B8VA 3N73A 1OM0A 3ZWTA 2CU0A 1XD1A 5CZTA 3RRAA 3MUY1 4U28A 4HMNA 1SVDA 5KZEA 3W22A 5H8UA 4QDWA 1X97A 2QUTA 1R7OA 2R1PA 3TN4A 1JR1A 2FIQA 4JEJA 3CL7A 2GVLA 4NYUA 2ZXAA 1MYRA 1PCWA 2C19A 3WEMA 1XYBA 2ZFAA 3MO4A 4ENLA 1XM3A 1EJRC 5A6BD 4X61A 4I5UA 3W7OA 4LNYA 1DEDA 1TE1A 3GXPA 2V8ZA 3RM9A 3ARZA 3H2NA 3RM8A 3M7SA 4LNCA 1E9LA 1H49A 1D9EA 4DYJA 4IICA 4ZSUA 2VZSA 4DIAA 1IQ8A 1Q6GA 1FXQA 3W9ZA 3UR8A 2TRSA 1FWEC 4X63A 3E2RA 1JYXA 3WK1A 3NSXA 4TO8A 2HNHA 4PUJA 5CQ1A 3CAVA 1T8QA 2BGQA 3GUWA 1R3WA 1TJ1A 1AH3A 3LN3A 4PODA 3W7GA 3LNMA 1Z32X 3D3AA 1IT7A 2PDNA 3EXTA 3TH6A 4UTKA 2GQ9A 1UZ1A 5A6TC 4BS0A 1B57A 3M47A 3FSTA 4PFHA 3PZIA 5I3KA 1DTNA 1RR2A 3KX6A 1D2KA 5IDZA 1CTNA 1HL9A 3B0PA 1GGOA 3VFLA 1THFD 1D7FA 1QO5A 1Q6OA 5D30A 3BC9A 1HT6A 3I7RA 1UBSA 3Q65A 2A3HA 3TV8A 2UV8G 2VEMA 1ODUA 3NO3A 1V5XA 5AZ0A 1FDJA 4QJ4B 1KCLA 1LROA 1PSCA 3R10A 2YCKX 4JKMA 3GVGA 3BG3A 4KT2A 5K2ZA 3ABOA 1E6QM 1GJUA 4BF9A 1ZAHA 5HPCA 3WH8A 2CLFA 2EAWA 4DUXA 1O5KA 2D22A 4QQUA 1J5SA 3UCCA 3VTRA 1QI3A 3RX4A 3AUJA 2XVNA 5F2IA 3T07A 4B5UA 3ARPA 2PDIA 2D69A 4IMEA 3HGRA 1GT8A 3O06A 2C13A 3TSBA 2R82A 3M0XA 3L7RA 1O1ZA 1BTMA 3RMJA 3WF2A 1H7XA 3GTXA 3P61A 1XG3A 1OZMA 2YIHA 1QASA 2BHYA 3CTTA 4CNSA 1E73M 3W7RA 3DIPA 4IIDA 2R1KA 5REQA 4BEUA 2PEVA 2X05A 1EJWC 1FP8A 1QI4A 3TQPA 5D33A 4AYGA 2V67A 1UWUA 4IMCA 1W3LA 3AU2A 1RQBA 1JUEA 3FLUA 2GPTA 4HJWA 5LXEA 1VYRA 1YBQA 3UZXA 2IS7A 3FVMA 4FLSA 1FWCC 1Z8AA 1KRCC 3N2BA 2DZPA 4OV4A 1AK5A 1KGXA 1PBGA 1SR9A 3GK0A 4CN6A 5I00A 3WL0A 4AZCA 1T6MA 3DG7A 1LRQA 4E2VA 2VZVA 2XU2A 1KBKA 3KL0A 4NL1A 3HQNA 4MADA 2GOUA 1JDFA 3EDEA 3QN3A 1AQFA 4HNTA 1S2CA 2QPSA 1XH0A 2Y1HA 2WVUA 5CBJA 1PZ1A 1WBJA 3STCA 4JS3A 1HL2A 1PS9A 3CUFA 1KM3A 7TIMA 3DYMA 1ZTVA 3QV8A 3AJXA 3W7MA 4MUPA 3G6LA 3USBA 2FTYA 3W7QA 3ANYA 4O1CA 2QKFA 1L6FA 1VZWA 2YDAA 4DWSB 1QNVA 3H55A 4P61A 2CZEA 2EGZA 1ONXA 4ZR8A 3OIHA 2DSZA 4CNNA 1MXGA 3OZMA 4H04A 2C15A 2PURA 4FXFA 1YDNA 3UCQA 3CH9A 2E6FA 4J40A 3TMQA 3UNDA 1TWZA 1S5WA 3W53A 3LZ3A 3ARRA 3H53A 5T8GA 1B1YA 1A50A 3TROA 3KBMA 3AZRA 3SURA 1K70A 1WDQA 3ARXA 5DT7A 3WFZA 1NELA 2BOGX 2Q09A 3NQ7A 4OKDA 3RITA 3FXYA 1H0IA 4XBSA 4K1GA 2ZUVA 3T08A 1Q66A 1FDZA 2Z1XA 1XYFA 1OCBA 1Q65A 3NAVA 4OUIA 2X40A 1HJUA 1JI1A 2E5BA 5JIPA 4HJFA 2W61A 1C3FA 1PX8A 1PPIA 4H4IA 5DFAA 4XQ6A 2WBGA 4XZMX 1SFLA 1P5BA 3THDA 2YA2A 4H6EA 1E6RA 3TYZA 1W32A 1NTHA 2OEJA 4IUOA 1KA9F 2EEXA 4IGHA 2IQDA 4W85A 4ZXLA 4LS0A 2OEMA 3ES8A 1OD8A 1QPOA 4I5RA 3G2GA 1ZZMA 4C7GA 1ZUAX 3L12A 2Y7GA 2WKJA 3N4EA 1AL8A 1KXTA 3QGAC 2NXHA 2E1DA 3NZ1A 4MY1A 1QT1A 2XH2A 4QSHA 2C1GA 2VX7A 3BLLA 3P0WA 1A4LA 1SGJA 3K46A 4S3DA 1MUMA 3W7CA 4NZ4A 1UQZA 4AIEA 1ADOA 2PDPA 1RVKA 3OZOA 2VFGA 2FHCA 4CU8A 1Q7MA 5K9CA 4OECA 3HQ1A 3FDGA 1KFLA 2J7HA 3VNLA 1EYWA 3ZJ8A 4WLCA 3RR1A 2NXIA 1GVSA 1GOKA 3WBWA 3GH5A 3BAKA 3GZ3A 1ZALA 3SRDA 4C6LA 1FCUA 3V5OA 3B8WA 2CZ5A 3SZ8A 4LUSA 3ME3A 4ZOEA 1HKMA 2WKGA 1OFAA 1OC5A 4IPLA 3ZYZA 4UQDA 3MUAA 3K2GA 3N14A 1S39A 3M6YA 4ZSTA 4L80A 4GYJA 4H9ZA 2C6QA 3SN1A 1T96A 1OK6A 3V35A 3HJZA 2WANA 5KZ6A 5CC6A 1IIHA 3TWAA 1GQNA 4HKPA 3GYEA 3UWQA 4O18A 3T8QA 1U5JA 3IV3A 4CD6A 4AX6A 1SSGA 5BXSA 1XSKA 1OB0A 4R34A 3UWZA 1YE4A 5AC5A 3R94A 4ZEPA 3M0MA 3PWGA 4M1BA 3KVJA 1RD6A 4QSFA 4WGXA 2AAAA 2HSAA 3A64A 5AHLA 3TTEA 3TZNA 2WW5A 1EFZA 1DWHM 2CFFA 3KM8A 3CZJA 3VOFA 3H2AA 3APYA 1XL9A 3S47A 4C6OA 3FEMA 3ZJ6A 3LM7A 4QRNA 4AWEA 5CPNA 3AHYA 3LSBA 7REQB 2ISSA 2CBJA 4H7VA 4UB9A 2QDEA 2AGKA 5CGMA 3PK7A 3EA2A 1N2VA 1ITQA 2IQ0A 5EGRA 1BYBA 2CBVA 4LSBA 4IHCA 2XVPA 1Z9AA 5HANA 4AEOA 1Q6EA 2WPGA 2GGGA 3S3GA 1O60A 2VEPA 1KR0A 3LU2A 3V0UA 3WNPA 5K9DA 3GR4A 2NVDA 2OQHA 2PTYA 3QLLA 2XN1A 4RNJA 2QCGA 3NPXA 3LBOA 1R0MA 3ARQA 2AQWA 3TA6A 3PBGA 5EB8A 2GGJA 4LVGA 1JCJA 2ZXQA 2DW6A 1A5KC 1ECEA 2EPMX 4IFKA 4ZTYA 4YPJA 4M7TA 2PI6A 1YMYA 3W88A 3ERPA 4MKSA 1FOBA 2GJXB 4HP5A 4CCZA 3K1GA 4MAZA 1ZJIA 3LERA 5G4WA 3SN0A 1W2PA 4HOXA 1TPEA 1A3HA 5D9OA 2WZIA 4HN8A 4IP5A 4IQEA 4M81A 3EA1A 3WQEA 2CERA 1GONA 4ZFCA 3WKZA 3BQ5A 1NDYA 3ID7A 4C6IA 4GC4A 4FR6A 4YWSA 1L2QA 2DFAA 2IPWA 2VDGA 5AHNA 5E5CA 1RQHA 1E0XA 3H4GA 1R9ZA 3WJZA 3L67A 4D6IA 2C1HA 3A4XA 3QZAA 3VKDA 3WLMA 2QULA 2EG6A 1R87A 3Q58A 1E9YB 3CUHA 4GIYA 5BW6A 2WMIB 3AYTA 1YPIA 5C9WA 4C90A 4GX8A 3BCDA 2VKZG 2PGRA 5C9RA 3IJ6A 2HK0A 3GAKA 3UXIA 4O57A 2F6XA 3BLDA 3UFYA 4O50A 3BAXA 3BH4A 4ERIA 4KFPA 4O4VA 3UZWA 1UZDA 3KHJA 4OBRA 3SUWA 4GX9A 5DXYA 4V1YA 3M4HA 4IQJA 1TYGA 1D3GA 1V3IA 3FYPA 1E1EA 1Z42A 3IARA 4IMFA 4JL2A 2ZRXA 4Z0SA 3EGJA 2QPXA 3L0GA 2IKIA 1EF3A 3WFAA 2OVLA 2JQXA 1EDTA 1A0EA 2G97A 2ANUA 1TA3B 4WSHA 1H0GA 2GUYA 4LVDA 4C65A 2KAUC 2OT0A 4I7UA 3E0FA 5PTDA 2FFCA 3S8HA 5D4YA 4O54A 3K1DA 3RO6A 4RCXA 3GNDA 1V3KA 3CEPA 2F8QA 2ZXDA 1FP9A 3ZSSA 1C7TA 3VGGA 3G1RA 1QW9A 4IIHA 5HQMA 3R25A 2Z1VA 2G3FA 3GZAA 2RJHA 1IWAA 1NSJA 1SZGA 5B80A 3TR9A 4GXMA 3V0SA 4Z1AA 1U1JA 2X0HA 3KBJA 3TUUA 3K13A 1RBLA 3AIEA 1GORA 3BSGA 3ES7A 5C7HA 3W1QA 2R1NA 1B54A 4WJXA 1VYSX 4F2BA 1S5NA 4LYQA 2XZ9A 1HKIA 4LY8A 1GVYA 3MKCA 1UR3M 2Q01A 5ECVA 1GG0A 1KCXA 4AD0A 1OQFA 3YPIA 1ZBKA 3U8GA 3W1LA 4A2RA 4QEEA 1P43A 4GY0A 4XTDA 3CV7A 1G0CA 4KKXA 5DX7A 4I7VA 4UR8A 5ENLA 3KDNA 1UC4A 1K9EA 4Z2GA 5C0QA 2HBVA 1V4YA 2AQVA 4C6BA 2DVTA 2CBIA 1IF2A 5AN7A 2VP8A 4NNBA 2WBKA 4KCWA 4MLRA 1YQ2A 2OLHA 5DELA 1KQYA 1S1PA 3BANA 3CQHA 1JF5A 1JZ5A 3BWWA 2VENA 3THAA 1R3QA 2YDQA 1OX4A 3T40A 5KZDA 2G4JA 3UR5A 3XISA 1M1BA 3FNDA 3TP4A 4E2OA 4IGMA 1VLWA 2QW5A 1OFOA 3EOLA 4O0ZA 3W1RA 1ZENA 4Z2KA 1W5PA 3MUXA 3LB0A 4GXPA 1OYCA 5GNYA 4EK7A 4NUWA 2OSXA 4M56A 1BRLB 1IEQA 1MWOA 4PRTA 3DUGA 4B3LA 1TVNA 5CXPA 3NGFA 3G1VA 3ZO9A 5D32A 4MMWA 3WQ4A 3W2LA 3W01A 3H8AA 4RLIA 4TX9A 1KGWA 1KC7A 3AIVA 3P60A 3EWDA 4HZ6A 4B15A 5BOOA 2EF9A 1ICSA 1L6WA 1YRRA 2VX6A 3ATYA 3KVLA 1GZ1A 3WF3A 1XGEA 1TR9A 3HO8A 4PCPA 4F2UA 2XM1A 4LALA 3PPGA 4IOTA 1DWGM 4NSBA 2ZCGA 2PDUA 2QYGA 4G8TA 3AZTA 2P0IA 1US2A 4RL3A 3UD6A 2H3DA 3VUPA 5LHFA 3O1NA 2D3NA 4UTTC 3RPMA 4C1NA 5HXMA 3PC0A 2NW0A 2GGHA 3GNXA 2D3LA 1A47A 3JRKA 2VELA 1BHGA 2ZA3A 1VKFA 1F8MA 4PMNA 4GFSA 4I90A 1QNRA 3PG9A 1UYQA 4PUMA 4MG4A 3CAWA 5I3JA 1UD3A 1SFSA 4N42A 2FKPA 1XG4A 3GDTA 4BR1A 4E4UA 4TQTA 3MCOA 1IZCA 3WLIA 1XUZA 1IEIA 2Z28A 1EX5A 2W3ZA 3C2VA 1P6BA 2CHOA 3B3DA 3AIQA 5U7SA 4CD8A 3REQA 1PAMA 2WSYA 5GJNA 5CSSA 2BNJA 3EEZA 4QNEA 4DI8A 1V51A 5HMDA 3ZT6A 1HNYA 5TAOA 4QG6A 2D2HA 3B8SA 3DI0A 1MQQA 4KFNA 1QPRA 2V9DA 2ZQ0A 4QDPA 2R1MA 3GUGA 1FWWA 3LZ5A 3CU2A 2ZDSA 3NZQA 4W93A 3B0YA 1J12A 3HIJA 3B8UA 4O4WA 2FPVA 4ACZB 4LAMA 3WYZA 1D8CA 1X1OA 5CAKA 3PTDA 1JYWA 4W7UA 5F2MA 1EX1A 3C0QA 1SZNA 2OQYA 3CPGA 1XHGA 1F2JA 5LKYA 3BAWA 5CG0A 3UA3A 4R53A