3LQGA

Human aldose reductase mutant t113a complexed with idd388
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqgA00
3DN5A 1Z9AA 3V36A 3CAQA 2WZTA 3LNMA 2FGBA 4YS1A 1QWKA 4YVPA 3R43A 3BV7A 4JTQA 5KETA 3WBYA 1C9WA 2PDXA 1IEIA 4WGHA 1Q13A 2R24A 3UZYA 1X97A 2BGQA 2I16A 4XK2A 3UZZA 3R94A 3Q67A 4PRTA 3G5EA 4GCAA 2IPGA 1T41A 5AZ0A 5HNUA 1OG6A 2WZMA 3CASA 4Q3MA 2C91A 3GHRA 2PFHA 4IJCA 2PDPA 3Q65A 5JH1A 3V35A 5LIWX 4R9OA 4H8NA 4XZMX 3M4HA 4MHBA 4QR6A 1RALA 4XZHA 3O3RA 3R8HA 2AGTA 1AH0A 2PDCA 2PDUA 2PZNA 1PZ1A 2DUXA 2HVOA 4ASTA 2ISFA 1MZRA 4WDUA 5HNTA 3MB9A 3LN3A 5JH2A 2PDQA 1PWLA 1EL3A 4YVXA 3H7UA 3LEPA 1IHIA 2PDBA 3EAUA 1S1RA 3ONCA 3QKZA 4AUBA 4GQ0A 4LAZA 3LQLA 4JQ1A 4XAPA 4Q7BA 2HV5A 3LZ5A 4DZ5A 2ACUA 1Z89A 4LBRA 4WDWA 2HEJA 1HW6A 2NVDA 4GABA 3CAVA 2PEVA 4EXAA 2R9RA 1VBJA 3R8GA 4JIRA 4JQ3A 4GIEA 4H7CA 1XF0A 4PMJA 2VDGA 3ERPA 3R58A 1ZGDA 4XZNX 3UGRA 3V0TA 3R7MA 3B3DA 3LZ3A 2IPFA 4XO7A 2IKJA 4GQGA 2IPJA 3S3GA 1RY0A 4JQ2A 4JTRA 2PDWA 4QXIA 1K8CA 3WBXA 3GHTA 1SM9A 4QX4A 1PWMA 2IS7A 1A80A 4ICCX 2FZ8A 1UR3M 3D3FA 2PF8A 3DOPA 2IKGA 4HBKA 2PDYA 3M64A 2FVLA 2FZ9A 3LQGA 3LUTA 5HA7A 2BP1A 1PZ0A 2NVCA 3RX2A 1X98A 5AZ1A 1US0A 2DV0A 3MC5A 2HE8A 3GHSA 3WCZA 3V0SA 2F38A 1X96A 4L1XA 1LQAA 1VP5A 4IGSA 3UZWA 2BGSA 4FALA 1AFSA 2PDIA 1XJBA 5LIXX 3CMFA 4QBXA 1T40A 1ZSXA 4XZLX 3CV7A 4DBWA 1MI3A 1YE6A 2ACSA 2PDMA 1JEZA 2INZA 3RX4A 3UYIA 3WG6A 3P2VA 1EKOA 1AZ1A 3U2CA 1LWIA 2J8TA 3COTA 4WDTA 3FX4A 4YVVA 4IJRA 3O0KA 3GHUA 2PDNA 5LIUX 3CV6A 2PDFA 2IKIA 4I5XA 1S2CA 2PDLA 1YNPA 5LIYX 4GA8A 2FZDA 4PUUA 2ACRA 2ACQA 2PDHA 3H7RA 4JQ4A 3ONBA 1RY8A 3UZXA 3UFYA 1J96A 5M2FX 2A79A 4G5DA 4JIHA 2PDKA 4WDXA 1HQTA 3EB4A 4XVEA 3V0UA 3N6QA 2ALRA 4LB4A 2FZBA 2HVNA 4NKCA 1Z3NA 4F40A 2DUZA 4WRHA 1QRQA 1ADSA 5C7HA 2QXWA 3UWEA 5DANA 3BUVA 4PR4A 3UP8A 1GVEA 3F7JA 1YNQA 4FZIA 2PD5A 1R38A 4LBSA 2CLPA 1AH4A 3BURA 1FRBA 3R6IA 2HDJA 3FJNA 4RPQA 1Q5MA 4FAMA 3EB3A 1M9HA 4DBUA 4L1WA 4HMNA 3GUGA 4PRRA 1ZUAX 1PYFA 1S1PA 1YE4A 2HE5A 3G1RA 4JQAA 1XGDA 3H4GA 2IQDA 1S2AA 4GACA 4JTCA 3M0IA 2P5NA 4XO6A 3RX3A 2PDJA 4FA3A 5LIKX 1MRQA 2I17A 3BCJA 4JTDA 4LB3A 4JTAA 3NTYA 1Z8AA 3LBOA 1AH3A 2IKHA 4EXBA 2PD9A 2PDGA 4ZFCA 3LENA 4DBSA 3C3UA 4PUWA 1EXBA 4WEVX 4YU1A 3N2TA 4OTKA 3LD5A 3UG8A 2IQ0A 3WBWA 2F2KA 1AZ2A 3KRBA 4XZIA 1EF3A 4LAUA 2INEA 1ZQ5A 4XVDA 4JIIX 3T42A 2IPWA 3VXGA
chains in the Genus database with same CATH superfamily
3T4WA 1B2YA 4W8LA 2A6LA 1B3WA 1XL9A 1UKSA 4OBTA 3MSRA 4RNHA 1SGJA 2JGYA 3BSGA 1IZCA 3VOCA 3BL3A 1XBXA 3BV7A 3SIMA 2E9MA 3A23A 5C6MA 3WJYA 3AU2A 4Y2WA 4JS3A 1IEIA 3GD6A 4M8UA 1EQPA 4L4PA 4QCFA 2G3MA 5FAGA 1XFBA 3UZYA 4CGTA 1TR9A 4EKJA 4A3HA 2DJLA 4RKAA 3EB2A 3EX4A 4DJFA 1IXPA 4ROPA 3Q67A 3ZT6A 1XI3A 1JDEA 2QDHA 2G4FA 4L5ZA 1HL9A 1JYNA 3BTNA 3K4DA 2WCSA 3ATYA 4U3AA 4CNOA 3W7DA 4Z0SA 3QY8A 4OU1A 3NSMA 3H6OA 3EEGA 4ZQPA 1M04A 3EDEA 1W9DM 1G7UA 3GC4A 4MZYA 2VUYA 4EOUA 3F5KA 1GNXA 4HMDA 4TX8A 5I6SA 2VZTA 1OCQA 3KUMA 1XUZA 3WH9A 5HUOA 3S5YA 4NI8A 4U5IA 2G41A 2TODA 4M24A 1FWNA 1H1NA 1M7JA 1NDWA 2QT3A 5EU9A 5AKQA 1BF2A 4Q7BA 1QK0A 3B4YA 3G6LA 3MUZ1 3EOSA 5CKSA 4EXQA 1NF0A 4DLFA 5KTLA 3LXBA 3ZZ1A 2OGYA 2WWDA 5FJJA 1PUDA 2CFFA 4FXJA 4DO4A 1KC7A 4BF7A 1VENA 3L23A 3UWUA 3WKZA 3VKDA 1EFZA 4B9YA 3GDKA 1BYCA 5E9AA 3A4JA 4QNEA 5HK4A 3ABOA 3RR1A 3SGGA 2JALA 2YX0A 5MF5A 2VO5A 1NEYA 3GSMA 3GFYA 5I3HA 3LHTA 1DIEA 2Z25A 1XYZA 2IPFA 5MKGA 1HJSA 2MANA 1JPHA 3VKBA 5E1QA 4C60A 3OVPA 1UWUA 2ZRYA 1OYCA 3VMOA 4LWWA 1YRRA 1A80A 2H8ZA 1HJXA 1Q45A 5AC8A 4ZO8A 1E70M 4DJDC 4Q6XA 3H4XA 2Y70A 4E3TA 1B3OA 2YL8A 2XIMA 4WGXA 4AEEA 2F9RA 1J0JA 3PBGA 3VI2A 2E6DA 5H6HA 1Q63A 2INFA 3WLLA 3SR7A 1KM6A 1JCNA 1AD1A 3A4AA 5EFDA 4QRNA 3W1QA 1VAHA 1PZ0A 1YPXA 3MO7A 1Q6FA 3SCQA 3QV9A 1XBVA 3MC5A 2YOCA 4Y7EA 4HNTA 2HE8A 2Q3RA 1DOSA 4H8UA 3NEVA 1PKMA 3WD2A 4UTLA 4L9ZA 3QGKC 4UNKA 1PE1A 1VCFA 1ZCCA 5CC5A 3ZLGA 3EMZA 3VILA 3MYPA 1UKOA 4L9YA 1W5QA 3D0CA 1GZGA 5A8PA 1OX6A 1E6QM 5AYIA 1EX5A 1TX2A 2YBTA 4O11A 2V67A 4GCXA 4LAOA 4PMZA 5BRBA 4ZR8A 1ONXA 3ENLA 4WCJA 2GDVA 3PBVA 3T0TA 3CB3A 3TK7A 3U2CA 1EDTA 6REQA 1V3IA 4J3XA 2UZ9A 3U6WA 3SCVA 1ZAHA 2Y8UA 2OSXA 2XFFA 2J7HA 4CUCA 1W9UA 2VC7A 3E12A 3CV6A 1RPKA 4JY9A 2NV9A 4IM4A 1W5OA 3K30A 4Q6JA 4QDWA 5I3DA 2G97A 1KCLA 1EYWA 2I5QA 5AYZA 1S5WA 3KHDA 5C9WA 3W85A 4IMDA 5M2FX 4ZE5A 5D2YA 1U2YA 2D2JA 2BVTA 2BHZA 2PC4A 1FDZA 3A64A 2R6OA 1OY0A 4C5ZA 5B7YA 1ZJHA 4NSBA 5D37A 4HMCA 2CLOA 4M80A 3N2CA 2OO6A 1O12A 1WUEA 1UPPA 4H83A 1RK5A 4GNJA 1GG0A 8TIMA 3SY5A 4HA1A 1XLAA 1MNSA 2DZSA 1CEOA 1M1BA 3LGGA 4MNJA 1GVEA 4OJYA 1ZP3A 2OLAA 4CQ9A 2DZPA 3VPLA 3RO8A 4GXWA 1Q2SA 1JULA 2I9UA 4WY0F 1WBHA 3AS1A 1DJGA 4Z1CA 1U30A 2PUZA 3EB3A 3N2MA 3TH6A 1TCMA 5G4EA 2WPBA 3D6NA 2ISWA 4G8TA 4H4IA 3L68A 1TB3A 3KBNA 3D5HA 3CHEA 3RUBL 1OD8A 1WO2A 1XX1A 3N18A 3W37A 1V03A 4ONVA 4XWUA 2P5NA 2JQXA 3UQNA 5D2TA 5LIKX 1UWSA 3P6LA 2HQAA 5FKYA 1AMYA 3OTRA 4C6LA 4LB3A 4O0ZA 4QHRA 1OYAA 2HXUA 4HK5A 5BW6A 2BY0A 4MPQA 1C29A 1OX5A 3TYBA 3PULA 3GXPA 2ATSA 3OIXA 4BHYA 1TJ1A 2PDGA 5DMYA 1LORA 2ZX5A 2W79A 3HN3A 3VNMA 4AISA 4NXKA 3TA9A 4HJFA 4XQ6A 3UZJA 1E3ZA 1GVIA 3XINA 2Y24A 1Q4WA 2W91A 3MKVA 5HWMA 3B97A 3AMCA 3EA3A 1GJPA 3WLQA 2QJJA 3A24A 2Y7GA 4DWSD 4DM2A 5IBXA 3VC5A 1Y65A 2C0HA 2DVTA 1XIHA 4XZIA 3MJYA 3R0DA 3V4BA 1V7YA 5DCEA 1E3XA 4F3HA 3LHWA 2BTMA 1M68A 1GOMA 1JAKA 2AGKA 2YYTA 3CV1A 1RPXA 2R14A 3DYMA 5F2GA 5BXTA 4HPGA 1CT5A 4C90A 3GTXA 1GZ1A 5D05A 2PU1A 1OABA 3RG6A 5J04A 3UD6A 2JFEX 3PBWA 1XPGA 4OV4A 3BAIA 1ZU8A 4FLRA 3TW9A 2QV4A 3VCCA 3AS0A 3SUTA 2GJXA 2DT0A 3LS9A 4GBDA 3GB6A 3VD9A 4W87A 1PTAA 5AYYA 2QUMA 1CWYA 3VFLA 5AZ0A 2FB2A 4QDPA 3CPGA 3E2QA 2C91A 3BPWA 4W5ZA 3T0DA 1S5TA 1WZKA 3IPWA 2UY2A 5D9MA 1NWUA 1TMQA 1O95A 4H8NA 2ZC8A 3ARSA 1QW7A 2OOGA 2PDCA 2R82A 1GKRA 3G2GA 5IDIA 4TTUA 5EMUA 3BSMA 4L4OA 4PEKA 4G7FA 2VKZG 4Q4RA 4HOWA 4J4KA 1B0IA 1E4IA 3GIYA 3SN1A 2OR2A 5JVLA 1J79A 4P7QA 1R3QA 1P6CA 2J25A 4GQ0A 2WV8A 3E3HA 3P3BA 2PLJA 4C91A 4M6PA 4MDOA 1FWBC 2OEJA 3CM4A 4WLCA 1CXEA 1IZKA 1GHRA 4P8WA 3DENA 1FX6A 3AU6A 2VWTA 3TYZA 3AICA 3MO4A 1ISZA 5DXYA 3P8IA 3ZQ9A 2GDUA 3PJUA 4NQ1A 4LUTA 4XAGA 3CZEA 3U48A 3TJLA 4P8XA 4FK9A 5EMLA 4A8IA 1VYRA 1PX8A 4BR1A 4H01A 3TR9A 4ERIA 4L80A 2PZ0A 4S3CA 4R85A 3AMGA 2OXNA 4V27A 4XSMA 2XM1A 2WXDM 3FCPA 3JR2A 1HXJA 1T96A 3XIMA 3LZ3A 1UJQA 1TUXA 3LV5A 2GSJA 2WB5A 4MSSA 7REQB 2Z7KA 4JY8A 1FHDA 1OSEA 3OBAA 4ZCWA 4G9PA 2V9DA 2DJXA 3M0LA 2V5LA 3VDGA 1RV8A 4UFLA 4UTWC 1XYBA 3YPIA 4OKDA 3N73A 2DIJA 4ICCX 4O18A 1FCQA 1NVMA 3QGVA 4O50A 4K1WA 1HKWA 3G1DA 2GUBA 5C5YA 3W6YA 5I78A 1Q8AA 1XLDA 3BAKA 1RP8A 3AFBA 2OSYA 2PTZA 5BMXA 1SR0A 4RE0A 3CO8A 4PYSA 3L5LA 1E73M 5FF4A 4FX8A 3B9NA 1UKQA 3MBDA 3PB2A 3K8LA 1I2PA 4JX6A 1S39A 4P7LA 2DV0A 5F2LA 4GUJA 3WH6A 4XD5A 1KR0A 4AX6A 2I1OA 4NI3A 3R2GA 4UQBA 1VJIA 3OZMA 4R27A 3UZWA 1TKKA 1VLIA 3CB8A 4FXFA 4C6NA 4JFSA 1XJBA 4PMDA 1J9YA 4R7OA 1A53A 1OM0A 4XBKA 1QOPA 1W9BM 1V0LA 4O1FA 3EWCA 1LP6A 3CQKA 2C8NA 2ESCA 4CNNA 3P93A 1ZALA 1UBSA 3CLMA 3D47A 4GGHA 4N4PA 3WG6A 4HU8A 2P50A 1UG6A 4NX0A 4LGXA 4NAFB 1ZAIA 1WV2A 4YVVA 3APGA 3ISIX 1LF1A 5JBEA 3H2NA 3CAWA 3DGRA 2HK1A 3GNXA 1DIKA 2PLKA 2PDNA 3OVRA 1PEZA 4J5NA 1HX0A 1QT1A 4M6UA 2XIQA 3RJXA 5DF0A 2OQLA 1IEXA 1EPXA 5BZAA 2CXGA 2QZRA 3FJ6A 3PSVA 3TZFA 2FDMA 4OZOA 1PS9A 3HIJA 1C9DA 1J01A 4EK7A 3S6TA 2NV1A 2QNEA 3UWVA 2CZ5A 5LNVA 2PWEA 3REQA 3E0IA 1AW5A 3HMCA 2ISVA 1EJUC 4YHEA 4F0LA 3EB4A 4TUFA 1OC5A 2QPSA 2QLYA 1EJVC 3B8IA 1JFXA 4E5TA 4FEZA 1LJYA 4LYPA 1F05A 4WRHA 1G4SA 3FXYA 2Y1HA 2XIOA 4D8AA 2PTXA 1P0EA 5DANA 3VAVA 1GQIA 2Y5EA 3GH7A 3F7JA 3VKJA 4B16A 1VPQA 3RHGA 1MUWA 5BNKA 1TTIA 1F3TA 3NQFA 1FRBA 2ZKMX 2YXXA 5I09A 1LT7A 2OELA 2NQ5A 1AG1O 2HVMA 3CWHA 4XV0A 5C9UA 1QPOA 1XC4A 3C0JA 1N7KA 3PPGA 1IR1A 3C2EA 4JTCA 4MWAC 3VGDA 3T40A 4MM1A 1WDQA 2YL9A 5IM51 2WJZA 2VELA 2ZIDA 4NILA 3MP4A 3GNPA 5D8WA 2CEQA 3R89A 5FSDC 1QW9A 5HDRA 1J6PA 3NG3A 3HPZA 1VFUA 4AVOA 3RF9A 4PULA 3AOFA 3NQMA 4YLWA 1B4KA 5AVHA 5CBJA 3GZ3A 3B9DA 5HMSA 1VIZA 3NJ3A 4B5UA 4LALA 1NP0A 1OGSA 3NL6A 4BS0A 3AALA 4QFUA 2EJ1A 1ML1A 1W9VA 2YFOA 1FXPA 3HGRA 1CZ1A 2V2HA 2A3AA 3KOWA 3Q37A 4HU0A 2WC4A 1FCUA 1PCWA 3V36A 3UETA 2BGNE 2DSZA 3LNMA 5EFFA 1KFJA 4HSHA 1AJ2A 1P6WA 2J24A 4CLMA 1TJRA 2AL2A 1D7FA 1KB3A 2CLLA 4AZ7A 3FHAA 1OGGA 1TWZA 1V51A 4I7WA 2VYOA 2VEFA 3WEMA 4H41A 3HMJG 5F1UA 1FWIC 4C6QA 1L9WA 1UD5A 4WXYA 3B0YA 4Z2GA 4JEQA 4MKVA 4XK2A 3T7VA 3W26A 1TWSA 5LNSA 1YHTA 1B57A 1XLMA 3NDYA 4NU7A 4JDBA 4QIUA 3W1XA 4B2DA 2DIKA 5AOUA 2HNHA 4CQBA 3PZVA 4F0SA 2A3BA 5AHIA 4KRZA 4CNPA 3W1NA 3M4HA 5C9RA 4NY2A 3R79A 3PVFA 4QLKA 3GG7A 4PCFA 3TTEA 2J27A 1FWTA 3BV4A 4HYRA 2ZUSA 3BLKA 2CLIA 4NNBA 4IISA 5E70A 4HTYA 3VIPA 1ZPTA 4YCPA 1LOLA 1V6VA 1KRAC 4K7VA 2VXNA 2I5IA 3S42A 3VDAA 3TQVA 2G0WA 3AYRA 1H61A 1X7IA 1QI5A 1G67A 1ZB5A 4ZFMA 2I7GA 2Z28A 1YNYA 1Z89A 3E0FA 1H3GA 5CPOA 1A49A 1UBPC 4IQEA 2G96A 2QMKA 2VR4A 3RCMA 4YCOA 3IRSA 3THQA 2ZWZA 4KEVA 3AO0A 1BGAA 4JHZA 4UR8A 3CQ0A 2R9RA 2CW6A 1DWHM 1CXLA 4M82A 4AZ6A 3R8GA 3CC1A 4D2JA 1D2KA 3UZ5A 4I5RA 3VOGA 8CGTA 1F74A 2F7FA 1EPVA 2Y88A 5CAHA 1EHAA 2DUAA 1CENA 1FTXA 3WL0A 4DYEA 1MW1A 1NY1A 3PTDA 1SMAA 4FNSA 3DI0A 3IEBA 1S2WA 1KQYA 1W1IE 1QBAA 4UCGA 1ADDA 2TSYA 3WLRA 1E9LA 1R2TA 2R8WA 3ES8A 4FNTA 2IPJA 4O19A 1O5KA 5HMDA 3SBFA 1AA1B 4JX4A 2BY1A 5HWNA 1C7TA 3QY6A 4NAEA 3N3MA 2VGFA 2ON3A 2VURA 1CGXA 2QCEA 3SQLA 3LGEA 3L9CA 2ZTKA 1V6TA 1PXGA 3NQGA 3KBVA 5E0CA 3VOJA 3W2UA 2JIEA 3FK4A 1PL9A 2QAPA 4NZ5A 3IIZA 1XDJA 3PN8A 1XCXA 2R1PA 3F4VA 3UA3A 3K4WA 1ZRQA 1TMLA 1XBZA 3L12A 3T8QA 3ZVHA 3N17A 2ZRZA 3AYSA 3IAQA 3QZEA 4WJXA 5CG0A 1ICPA 4O14A 4DHGA 1S5NA 3NQAA 5HATA 3OBEA 1XQKA 1WKDA 4RCXA 3BAWA 1J2WA 1R9YA 1UR1A 4B91A 1VPYA 2ZBTA 6XIAA 2TAAA 3VM5A 5G2HA 3GVGA 1JYVA 2REQB 3GG0A 2PBGA 4JCLA 4HA3A 4IXHA 2INZA 4HNCA 3ME3A 1UR0A 1C93A 1TYGA 1OX4A 1I1WA 2FMOA 4TVCA 2J8TA 5IDZA 2XFRA 5EYWA 1ZLPA 4GRSA 1TZ9A 4DJDD 3QTPA 4PODA 2P76A 2VFEA 4LBUA 3IUHA 1U5VA 3KE0A 2Z4GA 5C55A 2PDFA 2Z6JA 2WW5A 1W3HA 2FPVA 1X1NA 4RUBA 2BY3A 1K9EA 3EA2A 3UYCA 2NXGA 4CD4A 1H1ZA 1LBLA 2WC7A 3UZXA 1W1YA 2A6NA 5HQLA 2ZE3A 5IHSA 5A6BA 2PDKA 2XVGA 4A8RA 3CT2A 5DBTA 1PKLA 1E4NA 3OLEA 4D6JA 1AJZA 2Y7DA 4KWUA 1XP3A 2CLFA 3UESA 3WD1A 1TRDA 3IJIA 2V82A 4YTUA 2NLIA 1RXOB 3OBKA 4IPLA 3EBVA 4F0KA 3RLGA 1UQYA 2RDTA 2ZUUA 1QASA 1RR2A 1J93A 3CK5A 1QNRA 4K6AA 3PPCA 3ZR5A 2ZC1A 3IK2A 4YHGA 6A3HA 3J7HA 3GS6A 1UCWA 4JTIA 3UWQA 4H3DA 1HGYA 4S3FA 3PAJA 3AS2A 1G01A 2XDFA 4C1NB 3PWIA 3NR0A 2XN1A 3BLDA 4IIBA 1MXDA 4CCEA 2E5DA 1BG9A 4FS9A 2HBXA 3VOHA 2JIWA 1LQ0A 1LLZA 4O15A 2PWUA 2R1MA 2I17A 5CC7A 4D8LA 1CBGA 2W27A 1P0DA 2GGGA 3TN3A 2XH4A 4MWAE 3TXVA 3LLXA 1DWGM 3A4XA 3GO2A 5KZ6A 3LBOA 3O6YX 1CX9A 4GY0A 4GO9A 4PUEA 4GJJA 1EC9A 4IP5A 4DJED 4XUGA 4GPNA 2GJRA 1P43A 4L6HA 2I5GA 3C3UA 4TX9A 5FJUA 4GK8A 1XYMA 1YTEA 3THUA 3FAXA 5FEZA 4M1RA 4YU1A 2VDIA 2NVAA 3WQDA 1A5CA 2PU0A 4R88A 3U4AA 1SSGA 1P4CA 2WVVB 2X1RA 2TMDA 4HMEA 4I90A 4XAYA 3R11A 4EPKA 1BFNA 4DM1A 3UWYA 2Y2WA 4G1NA 5IFPA 3I4KA 1GYMA 2OU4A 1ZENA 1V0NA 3EX6A 1CYGA 4AHPA 4GG9A 1I0DA 2PPGA 1ZQ5A 4O52A 4JIIX 3CUIA 5HAOA 2ONEA 2OVLA 1IE7C 3PUGA 3GG1A 3CBWA 2WZTA 2Z2AA 1I8JA 4GY1A 5HQMA 3KLKA 1JZ6A 3K1GA 4Z1AA 3GX9A 2AL1A 4WQ6A 5AYXA 3NPVA 2WVTA 4N4QA 4X0VA 4PN2A 4CCZA 3VD7A 3CJPA 4FXSA 4HYWA 1D7KA 3V16A 4O4VA 4ICNA 2BFGA 1QHPA 4H1ZA 1CGWA 4HNUA 3M1ZA 2QIIA 3EOUA 3GK0A 1T41A 4A35A 1OG6A 1FWRA 1JL8A 3GHRA 2PFHA 2PBOA 3BJSA 3BZGA 4I9MA 4R9OA 4S38A 2VEKA 4JCMA 4NZJA 5D03A 1R9ZA 4IQJA 5ABEA 3WY1A 1K4HA 5CZTA 4Y96A 1NARA 2V63A 4S2BA 2XIBA 3SN0A 1XYCA 1E6RA 1YBQA 2VOMA 2CXEA 4F66A 5LA1A 1DV7A 1UP2A 1H41A 4J35A 3GXDA 1QMLA 3ARWA 2BXVA 2TYSA 3NZRA 1X1OA 1WE5A 1X38A 2VM8A 3LN3A 1PTGA 3O7UA 1W17A 1V7AA 4H2HA 3PTMA 3DAQA 1DWAM 2DGAA 3EAUA 2CU0A 1K7EA 4LAZA 3LQLA 3VZXA 5XINA 1AVAA 1UKPA 4UCFA 3RU8X 4LC6A 7ODCA 2D23A 1QPRA 2ZQ0A 2V5KA 1GK8A 1HJUA 3W7GA 5TAOA 1GVFA 1E0TA 2WSYA 4DPPA 5FOOA 1BYAA 3PZIA 1WZMA 5C54A 1HW6A 5A95A 4TTGA 1XYFA 4S3BA 1B3YA 4HJWA 4JIRA 3SAZA 3UXDA 1XLGA 3UR8A 4H6KA 1W1ZA 1GQJA 2EEXA 2J9XA 3L4YA 4C1KA 3VNKA 3W88A 4IGMA 3QMSA 3VE7A 5D9NA 4LNCA 2Y5JA 4GQGA 3MVIA 3CQHA 1SW7A 3KCOA 1R2SA 4UMAA 3WBXA 3GHTA 3Q94A 2MUCA 2W61A 4LYRA 1DXFA 3H2AA 1H49A 4AG0A 2FZ8A 3HQNA 1UR3M 4F0MA 4EF9A 4HCDA 1JPDX 3DOPA 4BWLA 4Q22A 4XX6A 1XICA 3ZS4A 3AXMA 1ESWA 1C8YA 1SFLA 1VEMA 3GXMA 4AD5A 1WDDA 1W37A 3EKZA 2OYKA 1VYPX 1RLCL 3QHOA 4IJBA 4PMYA 2OZ3A 2DSUA 1NTHA 1NU5A 2F38A 2X7VA 1X96A 3U9IA 4JIPA 3RCNA 1VP5A 1H5VA 2G3NA 3URAA 4Y9PA 3CGTA 1T40A 1O66A 3DFHA 1FWWA 2DVUA 4CU7A 2PLMA 1MI3A 3SEPA 3VA8A 2XSBA 3T2PA 3RX4A 2XINA 1EJWC 1FKWA 4C6FA 4BY3A 2WMKA 4WDTA 1MEWA 2G4JA 4AF0A 4DYKA 1O4UA 1TPDA 1PJ9A 2ZA1A 3VKKA 1RCOB 3UBPC 5CLWA 1QI0A 2BNJA 4TVUA 1K6WA 3VDBA 3LYEA 1XM3A 2OX4A 4BFAA 3U7VA 4CU6A 3W00A 2VX6A 5E93A 1L6FA 2JKEA 2BS9A 1R3WA 1P6BA 3R4IA 5I3FA 3NXFA 4M81A 3RR4A 1G4TA 1NSJA 1OIFA 2VEIA 3GDBA 3PBYA 2BHYA 5FACA 2ZUWA 5DT5A 4JIHA 2Q8ZA 4EX4A 4JYFA 1FWGC 5BOOA 2YL6A 2B7OA 1KFEA 2OTDA 3CIXA 1RJRA 3LPPA 4JFTA 1E40A 4K37A 1H7RA 2DFAA 3MI2A 3KBJA 2HVNA 1TFVA 2FPTA 1RBLA 1C3FA 1E9ZB 1V08A 2QCMA 3M7SA 4NKCA 1TQJA 1OFPA 5H1WA 1X6LA 3ZVIA 3PZMA 4QITA 2XIIA 3C0QA 2G8ZA 4GYPC 4FOKA 3DH7A 1DHPA 2XWDA 3UP8A 4MB1A 1W54A 1X7FA 2XYLA 1TV8A 5AB3A 1S3TC 1HNYA 3LPFA 2IW0A 4UQDA 1BHGA 1V02A 3U2OA 3NM3A 4LCRA 1YE4A 3HBLA 5DQPA 3NVDA 4L7ZA 4L6OA 5E0FA 3BQ6A 4DUOA 4GQBA 3L0KA 2FMNA 5CPNA 1XGDA 5D9OA 5HNNA 2O4MA 2ISSA 5HQEA 4XTIA 3RITA 1CB7B 1EEPA 1XISA 3H8AA 3F2BA 1ME7A 4KH2A 3GTHA 3PFRA 3E49A 1FFQA 2RUSA 4EPBC 3KOZA 3R13A 2VDHA 4AIBA 3LOTA 1Z48A 4REQB 2JKPA 4K38A 2PP1A 2J88A 4DF0A 3HPAA 1KFKA 2CBUA 2F84A 3VNJA 2Q71A 4XD3A 3O1NA 4OTKA 3FDKA 2OT1A 3TNBA 3KS6A 3BLPX 1VBHA 1TREA 1AQFA 3PUOA 3PZUA 1H7XA 4DNHA 4QGCA 1J6OA 4QQ3A 4AC1X 1CLVA 4AIUA 3S5OA 3QY7A 4QROA 3UEQA 4DEFA 4LU0A 5FJIA 1XBYA 4KERA 4B4FA 1TJ2A 3H2EA 1YDNA 4MWAD 3KL0A 4ACZB 2IUZA 2XTKA 4WGHA 4LFYA 4Y8EA 7ENLA 3G6MA 4B9ZA 1WDWA 2GK1A 3MI6A 5CXPA 5TQLA 3NQ7A 4DO6A 1BAGA 1O5RA 3UZZA 2H9AB 3OGRA 4ADTA 3GC5A 3JRKA 1QDSA 4C6EA 1E71M 1MDLA 3UWWA 1VFOA 1RK6A 4ZO7A 1WPCA 1MEHA 3SZ8A 1A5BA 2DQWA 4I7VA 1O1ZA 1UC5A 1MVYA 2NV2A 2O56A 4GOAA 5DCDA 4H9ZA 3R8HA 3MWAA 2GGEA 3C2YA 3B8WA 3GNDA 1M53A 1E0VA 2DP3A 4QAIA 4MYAA 4ADSA 3SUUA 3BOFA 2OO0A 4QG6A 2ADAA 4DX3A 1T8QA 2PGFA 4BEQA 2LLEA 5G1MA 4PE8A 5HNTA 2GVJA 1UWRA 3GM8A 3HB9A 2WZHA 1UB3A 1BWKA 4AUBA 2VZSA 2ATMA 1JXKA 1EP1A 4DZHA 5BMWA 5E6YA 4HCHA 3WMLA 3R0UA 2GUUA 3MMDA 1UD2A 2YA0A 1LRTA 3W81A 4JICA 5DMNA 3MUCA 4GABA 3LK6A 4A3QA 1XC6A 3B0VC 1OFRA 3UG3A 5GNYA 1B31A 5AC6A 2WM0A 2GGIA 3HG4A 3ARPA 1UJPA 3KTXA 4Z1BA 3TYCA 1WAUA 3RRXA 2PGEA 1KXTA 3E02A 5H8UA 2CBIA 3B8SA 5TNVA 1DHKA 5F2MA 3S1XA 2VCAA 2VR2A 3WMSA 2OSWA 1WUFA 5EKYA 4DI8A 4DUVA 4ZTXA 2RJGA 3URQA 1TPFA 3INPA 3STFA 2A7PA 2QCDB 1K8CA 3TZNA 4S3JA 4AD3A 3T07A 3IJ7A 1LTDA 3IGSA 3P7YA 1THFD 3TOYA 5A8GA 4RXFA 3BOXA 5GVJA 2PC8A 4HHPA 3BW4A 1VBUA 1W9XA 4PBFA 2YCLB 3QW3A 3W2JA 4IMEA 2CZFA 1TPUA 1LM1A 1XSKA 2IXVA 5F4XA 1VH7A 3KCJA 3MUY1 2IXUA 4F2TA 1Q85A 2Y0FA 4PTMA 3EDJA 1GOKA 4R53A 1UD8A 1PV8A 3LUTA 4WXZA 2WVSA 4QG8A 3W38A 4GI8A 4IMGA 3VVGA 5CZKA 1BXCA 3WYZA 1LQ2A 3WJWA 4UNIA 1XGEA 3FYPA 3QQ0A 1CNVA 1A0CA 1X39A 3QHMA 3NYDA 4AXNA 1BVWA 1EOMA 1ZSXA 1KWGA 1IEWA 2WQDA 4DBWA 3M6DA 1EC7A 1E1CA 2NUXA 3HPXA 3A3WA 2W3ZA 1IWBA 4Q4OA 3GTIA 4AY8A 2J7GA 2X7WA 4Q8QA 2CHNA 2ABAA 4DF2A 4AYSA 5LA2A 5HWJA 4LJ3A 4QE4A 4XG1A 4Z1DA 3H54A 3T2OA 1VRDA 1M65A 1DJHA 3WFLA 1H51A 4YTSA 5BOFA 1K9FA 3M0JA 1HTIA 3O15A 1H0GA 4PUUA 1XPYA 2ACRA 1R0MA 2FPYA 4W7WA 1RY8A 4O12A 1QI3A 2BVYA 4HVXA 3S4TA 3VKCA 3WLNA 3M43A 1MUCA 3HM7A 3DX5A 4N02A 4KFNA 1TPVA 4QM1A 3AXXA 2GJLA 4ZSTA 1XIFA 3PPFA 3N6QA 4LB4A 3W70A 1HUVA 1POKA 5L6UA 1K9TA 3G0UA 5LXEA 2J13A 3TCEA 4PTWA 5C7HA 2WSKA 4IPPA 3ABZA 3OLGA 1LUCB 8XIMA 4O1AA 3MHUA 4DI9A 3DBPA 3SFWA 2DY3A 2HMCA 4PFHA 4H9VA 3ZJ7A 1QATA 1JF6A 2XZ9A 3LNPA 5I3KA 5T91A 3ZFHA 3VIIA 5IHRA 4H9YA 3ARTA 4Y9NA 2VC5A 2D3NA 2Q8XA 1M9HA 1FWSA 6TAAA 2HE5A 3TKFA 5DY3A 1S5MA 1G94A 1XLEA 4XIAA 2ZA3A 3IIXA 1XLIA 1PVNA 5I5RA 2RAGA 2IQDA 3AXKA 2FH6A 1HZYA 2UY3A 3OEXA 4M6VA 5EMMA 4ATDA 2XGZA 3TYUA 3BCJA 4IXXA 3SN4A 1NFBA 4JTDA 3KZSA 3SCNA 2G5WA 3AAMA 1OCBA 2EPHA 9XIAA 1FA2A 3NO3A 4JGDA 1IGSA 2NQZA 2IKHA 2VVNA 3E0WA 4CEUC 3I7RA 1Q6CA 2QJGA 2Z1KA 2D2HA 2Z1VA 5ABHA 2O55A 1KM2A 1E43A 1TV2A 1TA3A 4WOZA 3RJYA 2Z27A 4U3CA 2A3CA 2ZRWA 4KETA 2AQVA 1IEVA 1E1EA 3UPMA 2X42A 3V5CA 5A69A 3KDNA 3AZRA 4QE1A 5A2BA 2WSQA 5AC4A 2FHBA 2FYMA 3GQYA 4LAUA 1GJWA 2Y6ZA 4US5A 2YDRA 2GQ8A 1GYLA 1JGMA 2P0IA 2TRSA 2PTYA 3WBYA 2PDXA 3GWQA 4C7GA 4XBSA 1QPNA 2REQA 4MNKA 5FEPA 3M07A 5EMJA 3B9OA 4C5YA 1GQKA 2BGQA 2ANUA 1GKQA 2FZMA 1F6YA 4DZAA 3DBNA 3W72A 4GYJA 2D22A 2QCFA 3R94A 3DHUA 5D04C 3EOEA 3QLDA 3IACA 2VENA 1EOKA 2WZMA 5ABFA 3MMWA 1BWLA 4UR7A 2P0OA 5A6JA 1E5JA 4JN8A 1RLDA 2E3ZA 1EBGA 4D1IA 2YLAA 2G3JA 2J7EA 1VJSA 3EKGA 5HNRA 4QR6A 4XZHA 4RZBA 4GQQA 2DZXA 3QR3A 1VFMA 2FTYA 4MJMA 4U5KA 4QAWA 4F0RA 5G2IA 4IP4A 4DWSA 4KEMA 3M46A 1ZY9A 4ATWA 4MZ8A 3O16A 1E6SM 5BROA 4LVFA 3S83A 3BMWA 4FSAA 4DJFD 1PSCA 3QJAA 3LCHA 2PDQA 1YYAA 2HS6A 3LBCA 1I2OA 3LEPA 4UQ9A 4HA4A 2UBPC 3HV9A 1HN1A 1FWCC 4DXXA 4GISA 3MW7A 4A3UA 1OK4A 2VFGA 5FF3A 2XSXA 4NNAA 4FNUA 2Q02A 3BSHA 2PEVA 1LROA 2XVPA 1VGAA 3PZTA 1G7VA 4PUNA 4HU3A 1SZEA 3H2OA 1ENUA 3W7MA 3AHXA 2QJNA 4L4LA 1KXQA 2V68A 3CWOX 1W3LA 1CGYA 2PS2A 4TIMA 4AD2A 2VX4A 1JZ5A 5EGRA 4IQDA 3WQ4A 1S46A 3NEHA 2VD9A 5D02A 3MZ2A 1L8PA 4C6CA 4AVFA 1DJWA 2IKJA 3DYOA 2BXYA 1JQVA 1ZBKA 4QQUA 2Z2UA 2POZA 1NH6A 4JTRA 3CUHA 1EP2A 5CQ1A 1DKWA 5FCZA 3SRKA 1J0HA 1KFLA 1KQZA 4UTTC 4N9BA 3U2EA 3B40A 5CSSA 1JI1A 4KGLA 2A3EA 1GHSA 1EJRC 5G4WA 4AAJA 3H21A 3V3WA 4FO4A 3IJQA 3NQVA 5DLCA 3BCDA 1SYTA 1SR9A 3ARYA 1HKVA 5CPMA 1C91A 4ERAA 4IICA 1R3RA 3WLIA 4I9JA 3LLFA 2J77A 2HROA 1FWJC 1N8WA 3TP4A 8RUCA 1LQAA 5FD0A 4IGSA 2J6VA 1EEXA 4Q33A 1HVXA 4PRWA 1RA5A 4CNTA 3CMFA 3FHQA 1JUBA 3CV7A 1S2TA 4DXKA 3ZSSA 2FGZA 1OCJA 3KL3A 1KKRA 3TTOA 1JEZA 1VQTA 2V3GA 2X0YA 3CT7A 1KBKA 4WZHA 2D69A 3AZTA 4X60A 2RFGA 4FNQA 1WCGA 3DFSA 4WSHA 3W86A 2CESA 1E5NA 4AH7A 1KM1A 3DG7A 3L4WA 1KBBA 3ABRA 1W5MA 2J74A 3BLLA 4DRSA 2ZOXA 5BXPA 1EO7A 1F07A 4HPNA 4H2CA 1OHLA 3K8KA 4RL3A 3ARZA 4CQDA 1E51A 3KBSA 2R1KA 3HZ3A 5H8MA 3EEZA 2AAAA 2O4QA 1XIGA 3CXOA 3LLDA 3EX1A 1AW2A 4YXGA 3G1HA 4DO5A 2Q09A 2WBKA 3VD5A 3LHVA 2CLMA 4DUWA 1A3WA 3QR0A 1U1JA 3L2IA 4MWAB 5CC3A 3BLEA 1ADSA 1G1YA 5GNZA 5B80A 3UWEA 3N9SA 3QZAA 1L6WA 1A5LC 2G95A 1DJZA 2ICSA 3GBEA 4W93A 4K8HA 1REQB 3AQUA 4KW2A 4Q8UA 5TBOA 4H04A 1LBMA 4PTVA 2V38A 1O5XA 3A21A 3NPXA 1V77A 3HFYA 1H09A 3LERA 4Z1YA 4P2VA 2NX9A 1PYFA 3MMTA 4GGBA 1IR2A 1Q3NA 1OEPA 1KGXA 3CTLA 5F7UA 1GYNA 3PJXA 3VD4A 2HPIA 3GW3A 1QHZA 1FDJA 1KV8A 1GVSA 5K2ZA 3A47A 3FV9A 2B31A 3N9KA 3QV6A 3S2JA 3SY8A 4NXSA 3BJTA 4ZTYA 1SFTA 5AYBA 1JF5A 4X3ZA 1ZTVA 2ZCGA 4WUIA 2GWGA 4MJ2A 4EXBA 3QKEA 2ZZ3A 3NQ8A 4CQCA 1JNDA 2EG7A 4O10A 3M7WA 3QC3A 4LRSA 1PPIA 2VMFA 4LPCA 3RLVA 3M0XA 1ZJIA 1SSDA 1W3IA 3UG8A 1AD4A 2P8BA 2WNZA 4KIRA 4AX7A 1ZHAA 3QMRA 4CN6A 2Y8KA 1XKYA 3RPMA 3WMCA 4IMCA 3GDLA 4ZMGA 3EX2A 3OVGA 1EX1A 4IMAA 4NP7A 3QV7A 3GH5A 1DXEA 1TTJA 2HXTA 2VCBA 1YTKA 3W23A 3ZLHA 2FVMA 2FGBA 1RJPA 3WUBA 3M5ZA 1YLVA 1E6XM 5I2UA 1J18A 1BTCA 3R43A 1OZQA 4IFRA 4DXVA 4GVHA 3W7EA 9RUBA 4UZSA 3ITXA 4LSBA 3S9IA 4J3ZA 5CJNA 1W91A 3MUXA 1UMYA 1ZAJA 1BKSA 2VI0A 3G5EA 2QCCA 4U4MA 2NUWA 3WJSA 3BAXA 4C1LA 1KCKA 1DWFM 1EUAA 1XS2A 1ZZMA 2W63A 2BASA 2NLYA 4GQRA 1W0MA 3AJ7A 1CXFA 5MHBA 1PAMA 2CITA 4A29A 2FDSA 3WNKA 5JIWA 4U2ZA 3MMUA 2NUYA 2OFJA 3RCYA 3LM3A 1BVZA 3ITVA 3TQKA 4AZHA 1C8VA 4W86A 3U0HA 3LPGA 4RW5A 2E9LA 3CUFA 4WY0A 3NCOA 1MZHA 1B54A 1NFGA 3MB9A 4J3VA 1HIZA 2IQTA 4S3DA 1EL3A 3ZYZA 2JE8A 1DBTA 3C2FA 3VU2A 1UR8A 3QKZA 1PBGA 2EQDA 2FJKA 1E1FA 4EP8C 3ARVA 2C1IA 4GHRA 1C8QA 2X2YA 2DIEA 2HEJA 1TVLA 4LCQA 3WQWA 1KR1A 2NXHA 3EMQA 3CAVA 1B9ZA 2Z1BA 4JTLA 2X05A 3QC0A 3QH2A 3TAKA 1J0IA 4G6CA 1ECQA 1PX4A 1FHUA 3NPWA 4KESA 5FA5A 1EDQA 2GQ9A 4KEUA 2VEPA 1PB0A 3TYDA 2BB0A 3SCTA 3WH7A 1FUYA 4MLJA 1P1XA 1UWTA 2XFYA 1YW1A 2V5BA 3W27A 5CJ5A 3R7MA 1V3JA 3AHTA 1OG0A 2YW4A 1UWAA 2C14A 2ZXBA 2VX5A 1DE5A 1WAWA 4K36A 1EP3A 1TVNA 4MVAA 1E6NA 2C71A 3BCFA 4ZGYA 4UNLA 4O57A 1RY0A 1MQQA 2PGWA 1OFEA 1SM9A 3MQTA 3M47A 8A3HA 5HPOA 3WFAA 4OOZA 1M5WA 3ELFA 4AMAA 4UXDA 4TV5A 3AS3A 3OB8A 1JR1A 4DF1A 3B05A 4GIYA 2GGHA 4CCCA 2PDYA 2EJAA 1C8XA 1LG1A 4PCSA 3VIGA 2YB4A 3CPRA 1F5ZA 5EL1A 2NVCA 4ORIA 3PG9A 4IIHA 1HT6A 3ARXA 4A2SA 2OZ0A 2VNCA 4PBGA 4HU4A 3VGGA 2X41A 1B1YA 4FLQA 5U7SA 3OYZA 3TC3A 3VDHA 3N25A 4S3KA 2OJPA 4R33A 1J5TA 4WIWA 3UG4A 1DXIA 4ACZA 3DKLA 3WF1A 1GWJA 4U33A 1UH2A 1O7AA 2X1UA 4LUSB 1DTNA 1XIBA 2E9BA 3M44A 3SI9A 4QSHA 4IGHA 4AHQA 4N0RA 4D6EA 4TQTA 1OB0A 5ABGA 5LGXA 5FJRA 2V5JA 3W74A 3TN5A 4M7TA 2PDLA 1BLIA 3KVMA 3SCRA 1RBOB 4S3GA 3W6LA 4Q4KA 1BXNA 4BJHA 3IVUA 3IJDA 4FIRA 1F8IA 5D4YA 2CNCA 3I6RA 4BQ4A 2NW0A 3QYQA 1V6WA 3V5FA 4C6BA 4P8VA 1V8EA 2OMAA 4QP0A 3MCOA 3FXGA 4IF2A 1VCGA 1SJBA 4KWWA 1OGBA 1V3KA 3PS7A 3W6MA 2E8YA 1VEPA 2CKSA 4LV4A 3GVWA 1Q4NX 4BK9A 3ITCA 4IZGA 3L4VA 1KW1A 2D2GA 1HFBA 4ZOEA 1XD0A 1V3MA 4NF7A 2HJPA 4Z2IA 1ITCA 2PRHA 3CZKA 3FW6A 3F4CA 1ZJBA 4NRRA 1XDLA 3TIMA 3MUAA 4GI9A 3VMNA 2Y7FA 4L1WA 4HK6A 3WF4A 4HPJA 4DJDA 5HXMA 3RAOA 2W9MA 3W87A 5L9FA 4XSLA 1Y7VA 3PWAA 4X9YA 4PBEA 3QHNA 3G1XA 4HHLA 4KPLA 1EJTC 3T09A 2DSWA 3PTQA 2PDJA 1IT8A 3TUUA 5ABTA 2JEPA 3IANA 2NSOA 3DI1A 2VFDA 1RVGA 4GUFA 4X22A 2QCDA 3NTYA 4C6OA 2FQIA 3AISA 4JR5A 4RW3A 3CHFA 1VBGA 1NDYA 4CN1A 1RCQA 3FS2A 4KCWA 1K1DA 3LHYA 4PUWA 3H55A 1EXBA 5D2XA 1J10A 3P67A 1YQ2A 4Y8FA 2NQLA 3LD5A 2OWXA 2OCZA 3WUEA 1BRLA 2CERA 3RFAA 3UPBA 4D6HA 1PDZA 1GOXA 3FJ4A 2CBVA 4JHMA 3UXKA 1EF3A 3VNZA 4B5SA 2PF0A 1C7SA 4ACYA 1H5YA 1J2BA 3KTSA 1Z9AA 1IZJA 3TN4A 1TPB1 1U1HA 2GGJA 3SSJA 4ML9A 1U33A 4K8GA 1XWYA 1TE1A 4YNGA 4Q4MA 2R24A 1XCFA 3O8AA 1EIXA 4DAFA 3GDMA 5DRCA 4H9XA 1A5KC 2VD8A 4H7ZA 1UROA 3CV2A 4HIBA 3C2VA 1EGVA 3WDRA 4DJEA 2Y62A 5BU6A 3I7QA 4U10A 4J3TA 3PFMA 3R10A 2E6YA 1W5PA 2HK0A 1SU5A 3V5OA 1L8NA 7TIMA 2HBVA 4XZ9A 2DT1A 3C0SA 4O8AA 4UMBA 3QYSA 4ZB2A 3MDUA 1HKMA 4AZBA 1J11A 1PZ1A 3EKLA 3PR2A 1P7TA 4NUWA 3M5YA 2PE4A 2ZADA 3G3DA 1KRCC 5MKGB 4XBJA 1FWAC 4XD6A 5AY7A 2ISFA 3N29A 3ID7A 5D33A 1UD6A 3TLQA 4BI7A 1IGWA 3SGZA 2QHAA 3CHDA 3I4EA 3BGJA 3I6TA 4ZOBA 3NXLA 1PWLA 3H7UA 3UJFA 1JZ3A 3ONCA 4JNMA 3DFQA 3MP3A 4HB7A 4W8AA 4JQ1A 4MIMA 2GPTA 5F1VA 3DKJA 2ACUA 1OJXA 1RHCA 3GAKA 1K4GA 3HQPA 2WVUA 3H2CA 4QEHA 5A8QA 2D0FA 2O9TA 4YN5A 4AZCA 1JCYA 1BPLB 1TTQA 4L65A 2QYGA 3S5SA 4EXAA 3QFWA 2DZAA 3FKRA 3WSUA 5C8BB 1XYAA 2HPMA 1J5SA 2NX3A 2XH2A 1XF0A 4CQ8A 4LW7A 4LRTA 3C2RA 3DC0A 1HP5A 4KFPA 3V7PA 4IIGA 2C79A 5A6MA 4IFOA 1QJWA 2ZX7A 1V6XA 4AWEA 4HZ6A 2RGMA 1OZMA 1ZNNA 1R46A 3OHIA 2BLEA 3QVQA 3TJ4A 2QJIA 1EJ7L 1PX3A 3CEPA 1E9IA 4QX4A 4DJEC 4F9DA 3ECQA 5FI8A 5A6SA 4D6FA 1A3HA 2PWGA 2VFIA 3EYPA 3WLTA 3VIMA 4HBKA 5JQ9A 3USBA 1WXZA 1XLKA 4NRSA 5AC5A 3E2SA 1YPFA 1CGUA 3LB0A 2E4TA 4G1KA 1SFJA 3STEA 3P8JA 2UWFA 4Q8TA 6ENLA 1US0A 3UCCA 1ZP4A 4G2DA 1QU4A 3AJXA 1NOWA 2W4XA 4AEOA 3AHVA 4UFHA 2XVKA 3H2FA 1V6UA 4NT0A 3S1WA 3WJXA 5K4XA 1TVPA 1E9YB 1PZ3A 1EGZA 2HRWA 1ITQA 2DVXA 3WLJA 2ACSA 2CHOA 1X6UA 3GLCA 4C6MA 3C52A 3PUDA 1VB9A 2PP3A 1D8WA 3EWYA 4L61A 2OLHA 4LVBA 3S2CA 1T8XA 1A0EA 3LMZA 1QW8A 1SJAA 3NA8A 4V1XA 3LRMA 3E96A 3B06A 3FA4A 3CIWA 5LIYX 4F8XA 2J7FA 4OUIA 4MGGA 2PDHA 4GVGA 3W1PA 3IARA 2QF7A 4AW7A 5T26A 1R8LA 5CSYA 5DO8A 1A5UA 4K39A 1GKPA 3EWUA 1P1MA 3II1A 2HS8A 4OHQA 1KFBA 1MFUA 1EQCA 2J7CA 1UZDA 4P7NA 4B5VA 3FN9A 2Z24A 2H3DA 1NWTA 3RM8A 3V0UA 1R3YA 4ALDA 7PTDA 1XGZA 2E7FA 3QLLA 1QPQA 3SUSA 4E8DA 2EBNA 4JFWA 4PMQA 5FIPA 5D32A 4PCPA 3ORWA 3LCIA 4RDWA 3N19B 2X09A 2FFCA 1A5AA 3D3AA 3QFEA 3OQ8A 2X2GA 3SDOA 3P82A 4UTWA 1AH4A 3R6IA 3R12A 1Q5MA 4FAMA 2BDQA 4DBUA 2PTDA 3TXZA 3SADA 3GUGA 4PRRA 4Y9AA 1OFDA 1K02A 4Q8PA 3MP5A 1WA3A 2YIHA 3GTNA 2AKMA 1UZ1A 3BMXA 3FAWA 4NYYA 2QKFA 3WQ8A 4O1BA 1MRQA 3P84A 2Y7EA 4MY9A 1LLOA 3VK5A 3L4TA 3QGAC 4IWWA 4W8BA 2GJXB 4LH8A 3GBDA 1QXLA 3HFTA 4O16A 1F61A 5G1YA 4KS0A 3LENA 3FVMA 3GFZA 4X9SA 3WIJA 1DWJM 5KINA 2OWWA 3OU8A 2GDQA 3S47A 4QSFA 1GUVA 3WLKX 5EBUA 2GQ3A 3CQJA 1XINA 3VYLA 3HV8A 1XCWA 1MNZA 3OPSA 2A3HA 2E25A 1TWWA 5LXXA 3ITTA 5C2CA 4XVDA 3PJTA 2YYUA 3GU1A 2IPWA 1ISYA 1LDCA 3CAQA 1Y5WA 4M7SA 3NZ1A 3BC9A 1IT0A 3EA1A 4WF7A 5T9BG 3QOMA 4YS1A 2PRLA 1XUUA 1UH3A 3MANA 1HG3A 2YA2A 1C9WA 2PGRA 2WSPA 3GDTA 3IGUA 3CZ8A 1X97A 3U4FA 3DFTA 5FJTA 4A21A 4PMXA 4ATLA 4DZIA 4GCAA 4LUTB 3G77A 3DFPA 3EWXA 4BF9A 1E6PA 1UD4A 3H53A 3IRDA 2ZDRA 1R30A 4DUXA 2CWNA 3RMEA 5JH1A 2GOUA 3G22A 5BWFA 4UOJA 3DFOA 3NZQA 3TSBA 3LDVA 3UJEA 2XN0A 3QRHA 4MHBA 4KKXA 3W2NA 3F4NA 2AGTA 4Q8OA 2DH3A 4B5TA 2PDUA 5I3JA 4YYCA 1MW3A 3OG2A 1R3VA 4PEEA 1MW2A 1UUQA 5J5RA 1VR6A 4ZQOA 4FOJA 4MY1A 1GOIA 2YJQA 2ZRUA 1MZRA 1A47A 5D09A 2WANA 4WDUA 1JCLA 4JN7A 4EWND 1XRSA 1N2VA 4ZENA 1D8CA 4WSJA 1SMDA 1BVNP 1Y5XA 4FIQA 3EDKA 4LBRA 3A3HA 3WLPA 5AECA 4RDVA 4MWAA 3OJGA 1GG1A 3QN3A 5EA9A 3CUJA 1ODUA 3HG5A 2NVDA 4ZQCA 1XHGA 4B90A 3LXAA 2FKPA 4PUDA 3FYYA 4QS6A 3IGHX 4RNJA 1IWAA 4MMWA 4LNYA 2CZVA 3H24A 3GH4A 4U2YA 3Q4DA 3THDA 3ERPA 3PAOA 4KCVA 6ALDA 3L21A 3A3XA 2QGHA 3AI0A 1I9CB 1RUSA 1XH1A 4Z08A 3E6EA 3ANYA 4HNVA 3NZGA 1ZS2A 4W85A 1P5BA 3WLOA 3W2MA 3NM1A 1FHVA 2ZZ6A 2NZLA 1FP9A 2E0PA 1NDVA 4HT3A 5BOEA 2PWFA 3ALFA 3GIPA 4S1FA 2IS7A 1EB3A 1JCXA 1IV8A 1MDRA 2VT0A 4UTKA 3TROA 1Q6RA 1CDGA 2CLEA 1T7LA 3RXZA 3LU2A 3SM0A 2E40A 1P48A 4CN4A 3LTSA 4MPKA 1CLXA 1I2QA 2F6UA 5D9PA 1OF8A 3EOOA 2FVLA 3A4WA 4AD4A 5LGZA 1WXYA 1ICQA 2BP1A 3BK0A 4WKAA 1B30A 2C0AA 3VFCA 1X98A 3LTPA 1XLCA 3UWZA 3RMJA 2GZXA 3LA4A 1VFHA 3CL6A 1DPMA 4H6QA 2ZUNA 4LUIA 3REQB 3BG5A 3VO0A 3DHPA 3EOLA 1MUMA 1E55A 1V79A 1JUKA 3SO7A 3VCNA 3ITGA 2C16A 1QUMA 5D2VA 3POCA 3ZR4A 4GFSA 1BWVA 1NOUA 1TPEA 1YXCA 3UPWA 5B7ZA 1GEHA 1LWIA 2OLSA 2FTWA 2WKJA 3HO8A 1W8SA 1SO4A 2P3EA 2JBMA 3O9NA 5JU6A 1K7XA 2ISDA 2CCRA 2AMGA 4O8RA 5D8ZA 2G3FA 3I6EA 1SFSA 4IFKA 5I3GA 4Q7NA 4HKPA 1VEOA 1Q6OA 4H8VA 3N2BA 3JZEA 2VFHA 2A79A 3K8MA 2QVHA 4ZXLA 4Q8WA 4CD7A 1JGIA 4KRTA 5A2CA 4A05A 1W1A1 4AY1A 4XVEA 4AYGA 2ALRA 3MTWA 4BQ3A 4N7QA 3EZ4A 1S3HA 1LG2A 1JZ4A 1JZ8A 5CGMA 5BCAA 3WLMA 5T8GA 5KZEA 1M03A 4PB4A 1OFQA 4UQEA 3PM6A 5GQBA 5ENLA 1FFRA 4IL2A 3H70A 3ZM8A 1T0OA 4AC7C 4JPGA 3MHFA 5D38A 2HDJA 3VOIA 1QCWA 3FDGA 2YDAA 1F3XA 3HGSA 4HMNA 3K46A 4IHCA 3WF2A 4MAZA 5IFTA 3NQ6A 3BO9A 2VGGA 4F4RA 2OWCA 3TTYA 1GQNA 3CUXA 3I3DA 3IV3A 3SRFA 1MWOA 1BSIA 2BHUA 2ZTJA 5I02A 1CXIA 3I3BA 2AL2B 4EF8A 1AUSL 2BVWA 2POTA 1PIFA 3I10A 2QJMA 4IPJA 3PNZA 1EHNA 2L5HA 4HQVA 3VUSA 3O6DA 1IXOA 1A0DA 3N4FA 4Q4PA 2EPNA 4YMZA 3CL7A 4BCEA 5GJNA 1MXSA 3N2TA 3QMTA 3ZJKA 1AQMA 4U31A 1XSIA 2DSKA 3RDKA 1XIIA 2GYIA 2FVKA 1Y8BA 1US3A 2WNQA 3W7JA 1CTNA 4Y6GA 5M17A 2F2KA 4LAKA 1AZ2A 1XIEA 3NQ2A 1FP8A 2A5HA 4GBUA 3TR2A 4G7EA 2V3DA 4EWJA 4K1GA 1GONA 2QUTA 3E0VA 2VGIA 3WQVA 4D71A 3GC2A 3W1TA 1GVQA 1QWKA 3T8LA 5BRQA 2J78A 4GKTA 4YYFA 1JDCA 2XWEA 4BI5A 1JD7A 1Z41A 4MZ1A 5DX7A 4LT9A 2VP8A 2X1TA 2OQHA 1D3HA 2WZIA 3GDRA 3N6HA 5GNXA 1YDYA 5I03A 3B4UA 1Q7QA 1WKYA 1M41A 2GVEA 5REQB 2J7BA 4IJCA 4X2RA 5PTDA 3VD3A 3WDHA 4GZJA 3EDDA 3MKKA 1TZZA 4H6EA 3S2NA 4Q8VA 3F1QA 3GTFA 1ZBCA 1BYDA 4PH6A 5HULA 1UQZA 4TV6A 4HHMA 1YXYA 1CGTA 3RPTA 3KRZA 3EXRA 4IPNB 5K9XA 2OKTA 3WQOA 2YBUA 1XDMA 2YLLA 3ICJA 1SZGA 4E0CA 5TD4A 1OK6A 2QF8A 1AODA 4YVXA 3KS5A 2PDBA 1S1RA 5KMYA 5KSWA 4I5UA 3N3TA 5LNUA 2Y8VA 4Q4SA 2WKGA 3USZA 4NZ3A 2P3ZA 4AXKA 1B5TA 4PB3A 4YPJA 1UHVA 3SJNA 4HPXA 1YKWA 1NAL1 4LVAA 4NZFA 2D24A 3AC0A 1UPMB 2FIQA 1F4AA 3LCXA 3B03A 2PSNA 4HGXA 3EPNA 5ECVA 3VGBA 4MKNA 1K8YA 1XR2A 4GZIA 4LXFA 4D6CA 3GR8A 1MW0A 4H7VA 4V2XA 3HG2A 3B0XA 4PL1A 1TJ0A 1Q6EA 2I56A 3S5ZA 2OZTA 4XZWA 3ZVHB 2WCGA 4O53A 1FWEC 1Q6QA 3IVSA 1VS1A 3W2KA 2J8FA 4WHBA 1TIWA 3CHVA 4ZVJA 1EUNA 3N15A 3NZPA 3EWBX 2A85A 4JQ2A 4IH3A 4O28A 1KV5A 2V30A 3EWZA 4UTJA 2XG9A 1EWDA 1NOFA 1OX4B 4Z2JA 3G0XA 4PMNA 1TWIA 5FJOA 1Q7MA 3W2LA 3SCSA 3WNLA 1O6IA 2VUNA 2PF8A 1EO5A 1DJYA 2A7NA 4N9CA 3F03K 2QMJA 4DBDA 4D6GA 8XIAA 3C56A 1W3JA 4JTUA 1H7WA 2Z2BA 2QIWA 2RHGA 3OA3A 4K7YA 4JDYA 2QCGA 3VINA 5JBDA 4QISA 1VCVA 3G8EA 2Z1XA 4C6PA 3O2LA 4FLSA 4LVGA 4M0XA 3BMVA 3ARRA 5FL1A 2WHMA 3DZ1A 3ZT7A 4IPIA 3WEZA 1G6CA 5G1TA 3GHSA 3WCZA 1A5MC 4Q4QA 4RLIA 4IMFA 2I9EA 1U1UA 3BLIA 4L9XA 3DYPA 2NT0A 1FH9A 3HA1A 4L1XA 3WF3A 4O1CA 3BAJA 4PB5A 3L4ZA 2BGSA 1AFSA 3HPSA 1CXKA 3WH5A 2Y4SA 3VTRA 1E0WA 3FLUA 3LCLA 3N34A 3NURA 4OBRA 3KRSA 4GO8A 1JRCA 3JU2A 2ZUTA 1TELA 4ZSUA 4QNWA 1TG7A 3U5YA 1F3WA 3P2VA 2J79A 1AZ1A 4DYJA 2OX1A 3CMJA 1X8CA 4FP1A 1GORA 3CWNA 1HL8A 4KIEA 5C2GA 3O0KA 3C8FA 3E1F1 3HPFA 1XYLA 4FOUA 1QPKA 2Z6IA 1JQXA 4NZ1A 2WHKA 1CPUA 1K6AA 3U7BA 1Q6LA 1DYSA 1JXJA 4LYKA 5HANA 3BQ5A 3DFNA 1QI4A 2YFNA 3KVKA 3UXLA 3ONBA 4JTFA 2QAFA 1TR1A 1LWHA 3NDZA 4EPDC 1XIDA 4DJFC 1H0IA 2Y89A 1SW0A 2ZZ1A 3VMPA 3VKAA 1G4PA 3SCOA 2Q3OA 4AMCA 4FB7A 3FYOA 2C19A 3W0KA 4XUYA 1W1PA 3SB0A 3A12A 2DUZA 1M7PA 3UXIA 4GVFA 3DHFA 4C6IA 3GXIA 3S0CA 4TO8A 1SQ7A 4R9XA 4K3ZA 1KCXA 4O1DA 3OHMB 4J28A 3W9ZA 4W88A 1R38A 3BURA 4GX9A 4ZL1A 4E2BA 1NQ6A 3EMCA 4NJIA 4R7WA 3HTWA 1I1XA 2F8QA 4JZ5A 3W53A 2W92A 3PC0A 4LF1A 4V15A 3R8RA 4O13A 3KOFA 4I8DA 1HVQA 3MUIA 1DQWA 4E8CA 3WQEA 4TOQA 2P8CA 4X2PA 3GRIA 4M29A 5C9XA 2FHFA 3GXTA 4ROQA 3GY1A 3L2MA 4UR9A 2G3IA 1EA9C 5DEZA 1XLLA 3G18A 3UW6A 1A3XA 2ODOA 3BE7A 3VIHA 3LI1A 3P14A 2GOKA 3TDFA 3P5ZA 4NYUA 1XLHA 4TXEA 2CETA 2PI6A 3SCWA 3UCQA 3D46A 4JIEA 4KWOA 2PRMA 3TWAA 3UERA 2VCCA 2IMRA 2QGYA 3OOQA 4GVIA 7A3HA 5A6AA 4HD5A 3W7LA 2PCEA 1KLYA 4BZYA 3N13A 3OP2A 4D8ZA 2QVNA 3WLHA 5HOSA 3NSNA 4AZ5A 3WBWA 3VX0A 4R34A 1CI1A 3O63A 2E6AA 1JRBA 3KRBA 1A5OC 2HCVA 5CZJA 1MFVA 1YBQB 2INEA 3E5BA 3CZJA 1R85A 3UU0A 3WFZA 3GFXA 2ZX6A 3DN5A 1AMKA 1SO5A 1WXJA 1OFBA 3AIUA 4XAFA 2E1WA 4IOTA 2ASHA 3RLHA 1R2RA 4ZQNA 1XIJA 4C7DA 3PWGA 3APTA 5AHEA 1W3TA 2WPGA 3ZSTA 1Q6DA 4K8EA 3KEHA 1YDOA 3LPOA 4HTBA 2WMJA 4GE8A 4GH1A 4J1OA 4A2RA 4OWGA 1ISVA 4ES4A 2YCJA 2BSLA 4PMRA 2YL5A 4H9UA 1Z42A 4Q3MA 4UTIA 4US5D 4WD0A 1VF8A 3P0XA 3WQCA 1JCJA 4MY8A 5F2IA 2WOQA 1TX0A 3C3NA 1WNOA 2WO5A 1AQHA 2MNRA 4UBPC 4GYPA 1LL4A 1F6KA 2GVLA 2OYLA 2DU2A 1FCVA 3TAOA 3S1UA 3WDPP 3MDWA 2Z7GA 4MB4A 3PUEA 3M0HA 2JKAA 3W4RA 2EG6A 2V0TA 4CKQA 2G50A 4ASTA 1KRBC 2QDEA 1QOQA 1I60A 4C7FA 3WQ5A 4A8LA 5A1AA 3C0LA 3G1YA 2GUYA 4N6EA 1FCBA 5HJXA 1AL8A 1P0NA 3PBMA 3TSDA 2HV5A 3GIQA 5I77A 3ATZA 1B3ZA 2W67A 3PZQA 1WKEA 4PMUA 2I14A 4RDZA 5TIMA 3QBUA 3AZSA 4IP7A 3TOPA 4KRUA 4CQAA 2H6RA 4P7OA 3E74A 1XG4A 3Q45A 3BANA 4KEZA 3VIFA 5AC7A 3SRHA 3BXWA 2PODA 2W0UA 1K3UA 3TJIA 2ZRXA 2BZNA 4YTTA 4BEUA 3G24A 1FOBA 4GIEA 5G2WA 1CB2A 3OZYA 4L56A 3H12A 4AIOA 1MRAA 2O7SA 4PMJA 4B5NA 4GZ7A 1HGWA 4GIRA 4G56A 5FSEC 1PKYA 1RH9A 3OIHA 3A5VA 4NASA 4LVDA 3S3GA 1XLFA 4R7JA 2DZWA 5TF0A 4E2VA 1RQHA 2E8ZA 1QWGA 2YA1A 3VGHA 4DY1A 1FY6A 4NHVA 5D30A 3LM7A 4WK9A 4UFMA 3L2LA 1KCZA 4AF0B 1Z69A 2EKCA 5AVNA 4V28A 2ZZ2A 2D73A 3KAOA 4RNFA 3E9AA 1A50A 2FZ9A 2CZEA 2EPLX 3VZZA 3IJ6A 2GFTA 2PTWA 5E9XA 4A3RA 4PTNA 5HA7A 3ZWSA 4YIWA 4H00A 1V3LA 5HPCA 5LKYA 3WUFA 3GKFA 3SGUA 3UVAA 4QLJA 3VGEA 4J7RA 3W73A 2YZ5A 3JUGA 4FXRA 1R7OA 1PDYA 2QR6A 1WB0A 2J9YA 2OODA 3DU0A 3MCMA 3NGFA 5LZLA 5LIXX 3CL8A 3S5NA 2J6XA 1E4LA 4QBXA 4EACA 2GLKA 2QQ6A 3FA5A 7REQA 3W07A 3C61A 4MYXA 4OV9A 2V81A 1J8VA 3HQ1A 3OQEA 1EDGA 2PDMA 3WNOA 1K70A 2P1FA 4X63A 2E28A 2W62A 1LBFA 5IBXC 4AFYA 1XD1A 3FKKA 5EBAA 2YDSA 1EKOA 1D3CA 2RDXA 1UC4A 2NQHA 3P60A 4EIVA 3LTYA 1O60A 3BVJA 3EGJA 3AXIA 5A5WA 3DHDA 1XIMA 3BAYA 2WSRA 4I5XA 2A3LA 2BV9A 3I65A 5FAJA 2XH0A 2ALDA 2PAJA 3QXBA 1TRIA 1FH8A 4A4AA 4B15A 1VKFA 3QPZA 4I3GA 4ILSA 1XFCA 1IYXA 5E6ZA 4NZCA 1QI2A 3NOEA 1JZ7A 2J7DA 2XM2A 4AHOA 1OINA 5I7GA 1BEUA 1IQ8A 1HL2A 5RUBA 2RKXA 5I00A 4DAIA 1GOWA 3NOYA 3IK4A 3HG3A 1RD6A 2J62A 4LUJA 3ITLA 1NQKA 1G69A 2C7FA 5LHEA 4LY8A 2CZDA 4XIMA 1SUXA 3TNOA 4AWSA 2XN2A 3LHZA 4R3UA 3HURA 1OD0A 4A22A 4FPSA 2VRQA 4LBSA 4NAFA 5CG7A 2DZVA 3S6DA 3KOYA 4B3ZA 3E2VA 3MV01 2OZ8A 1LRNA 2XH7A 3BGAA 1J4EA 3T05A 1PZ2A 4ZA0A 2FZNA 4IGNA 3NFUA 3MYOA 4POCA 3H4GA 4Q7IA 3K13A 1KO0A 3ZIZA 3KHJA 1ITXA 3RK8A 4GC3A 4XISA 3WENA 4EPEC 4A8NA 3PF3A 1RAKA 1BG4A 1HP4A 2GK1B 2WHLA 2DT3A 1UIOA 3CQIA 1S2VA 2EXOA 1DWIM 3OG3A 1DJIA 3BW2A 2PD9A 2QUNA 5H91A 1D9EA 1AW1A 4ZFCA 4B3LA 4JIQA 1GW9A 4RE3A 3WQPA 2ZWYA 3SIZA 5A6TC 3I68A 3FEQA 4S39A 4KMQA 3RM4A 3W1LA 4IQLA 3TC7A 1EH9A 3ZR6A 2QV5A 3QQWA 1UD3A 3LGDA 3QTGA 1RQBA 2IQ0A 3EPOA 3WQ6A 1U22A 2QS8A 3TYEA 2Z00A 5K7JA 1E0XA 3ITOA 4TR9A 4HPHA 3IV8A 3RU6A 1U5JA 1HKKA 4R5EA 3AROA 3KXQA 4RK8A 3ALGA 2YCEA 4DWDA 4YVPA 4UFKA 2VOTA 1BGGA 1E4MM 3QW4B 2WNWA 3WN6A 2BMBA 1DORA 2FTPA 3KCLA 1WDPA 2F6KA 2XISA 1A4LA 7CGTA 2XSAA 3GXFA 3U8GA 2O7QA 1GZJA 2I16A 2D20A 1UUMA 4OIFA 3HGJA 1I0BA 1WQ5A 2IPGA 4XTDA 1MXGA 4JL2A 1JDDA 2HNEA 2BOEX 2PDPA 4UFIA 1QNVA 3V35A 4PA8A 5LIWX 2UY5A 1LT8A 1T6MA 3UCDA 4DLMA 2DDXA 3S1GA 3AMKA 2Z26A 2Z1WA 1PO9A 3ZMRA 3H4WA 3TQPA 2AKZA 2HVOA 3AYTA 3T0AA 4J27A 4JNYA 4MJZA 1PKNA 1DIDA 1XRFA 2EO7A 1JYXA 2WMIB 2I57A 4GJ1A 5LSMA 2VL4A 4ML4A 5H8PA 3W84A 4QLLA 2CPUA 4XAPA 2DZUA 4GX8A 5DT7A 3DGBA 4OQVA 4NJHA 4XKYB 3THCA 5CJMA 1HJQA 2F6XA 3STGA 1QTWA 4YTQA 3O06A 4ZXOA 4OUEA 1FKXA 1VBJA 3MVTA 4GFIA 2F61A 3W71A 1OC7A 4CEXC 2WWCA 3TLLA 1SJCA 5CSRA 1FH7A 3NQCA 5CAKA 3JS3A 3GR7A 3LSCA 5HUPA 3SQMA 4C65A 1N82A 4UFJA 1JG9A 1QOXA 3V0TA 4OOUA 3B3DA 4I6KA 3AHYA 1GVRA 4GUHA 2G37A 2JGQA 4PGLA 1E1CB 3GG8A 3RPDA 3IIPA 3SCPA 2OPJA 3LCGA 1IT7A 1LOSA 4FR1A 2RJHA 1QHOA 5CGQA 1UH4A 4KT2A 2ZX9A 5A2AA 3KP0A 4ZZ9A 2J9ZA 3TJXA 1BXBA 3E5PA 4D9PA 3QSTA 5LNWA 4KWSA 2NQ9A 4V1YA 3I7SA 5EMYA 5J5DA 1YXDA 4H6RA 5EY5A 4BQ2A 3CU2A 5AZ1A 1GPFA 5FJPA 1LLWA 1K77A 1FWFC 3QPYA 1KXVA 5I06A 4IG2B 2V6AA 1W2VA 4UWMA 1IWPA 3PK7A 4N9DA 2E09A 3IJLA 4IIDA 3VNIA 3TVAA 1HO1A 3T4CA 2X16A 3K1DA 3LHUA 4XZLX 5G4HC 3PG8A 2GVGA 2ZA2A 3TW7A 1A5SA 3NQDA 3GUWA 3T81A 3MCNA 4KGJA 4IIEA 5CPLA 3K4AA 2GQAA 1LZOA 4QJ3B 4WJEA 3E2RA 1JAEA 4ADUA 3C5QA 1I2NA 4D72A 5REQA 3WZ0E 4F0HA 3EX3A 4AY7A 5K4ZA 3DG6A 5C2XA 4QTGA 3VNLA 2FZDA 4DQWA 3TSMA 4RZ4A 3L65A 3H7RA 2HSAA 3A6OA 4JQ4A 3VNYA 4PMOA 2ZE0A 1O1HA 2QUVA 4LS1A 2C6QA 3A9BA 1JCMP 2X0HA 3ZWTA 4PSPA 4UQAA 4HZ8A 2E77A 2ZXQA 4JN6A 1JPKA 3NGJA 3NPUA 4QJ5B 1HQTA 3MSDA 4HA0A 1R87A 4OECA 3KBWA 3TV8A 3GKAA 3LG3A 3UGVA 2GL5A 2UV8G 1BTMA 3N14A 1MYRA 4F40A 3QEZA 5BRPA 5I79A 4ZBCA 1TA3B 3E0LA 1ZCOA 1H60A 3BUVA 1UR2A 2JF6A 3W7RA 3EXSA 1KNWA 4FZIA 3STPA 2OYMA 3B8VA 4RR4A 3TCSA 2DW7A 4UTTA 4J3WA 1I4NA 4DVOA 4LUYA 4QS5A 3WNNA 3NYZA 1XRTA 5CC6A 1DP0A 1KBIA 3RM9A 1U83A 3KWSA 3FGCB 5LA0A 1WZLA 4YTRA 4QCEA 1S2AA 2WLYA 3BH4A 3LRKA 3N2XA 4XO6A 3QQ1A 4Z2KA 2DZTA 2PWVA 1LCOA 3GR4A 3B9EA 4GD0A 3IJ9A 1Z8AA 2V69A 3KVLA 3GYCA 3VABA 3EWDA 3W24A 3IWPA 4HZ7A 2OG9A 3ZJ8A 3S9YA 3TFCA 1RBAA 1W3KA 2O0TA 1V3HA 4UTHA 3QF0A 4H8HA 5ABFB 1LOQA 4W7UA 4WSKA 3C4UA 4DELA 3EWWA 1YADA 2XVNA 1XKJA 3QV8A 3K2GA 3WK3A 1E72M 5BU9A 2CLHA 3PBUA 1QNSA 3R5EA 3CIVA 1R3SA 1R47A 4GC4A 1K9DA 4DWSB 2KX9A 3HU7A 3PTKA 4GXPA 2FHCA 1G4EA 3HGOA 3LMYA 4IL0A 4C1NA 4LS0A 3VXGA 5A6KA 1TMHA 3K5XA 4AZGA 4HN4A 3VX1A 9XIMA 1YDVA 4JAWA 1R86A 3NSXA 2ZUMA 2WJEA 1EZ2A 1UASA 1ONEA 1G9HA 3RILA 1TE6A 1VFLA 1DJNA 3W82A 2WJDA 3W1MA 2DT2A 4GNVA 3CNYA 4GI6A 4RZ5A 2P88A 2BG5A 4MLRA 4JOMA 1WDSA 3CZLA 4PUKA 3MKCA 1M01A 4PL2A 2C1HA 4N2YA 1N8IA 3WX7A 5CEWA 3PZOA 1OFOA 1EWEA 1I6NA 4OT7A 1Q66A 5DRIA 4QJ1A 4D6DA 4LQ1A 1DJXA 4Z2LA 2QEZA 2WVVA 2VZVA 4HSOA 5AHNA 1W9PA 1ZJAA 1NWRA 1GGOA 5HMFA 3F4DA 3FVDA 4KCUA 2X1SA 3DECA 1TTPA 2CIPA 3CUGA 3SUVA 2GVYA 2YGYA 3ABXA 3KZPA 3ZLFA 4JD4A 4RXGA 4OBSA 2A0NA 3OZPA 3W28A 2JK2A 2O9RA 1XW8A 2E67A 4JTEA 1CXHA 1B90A 4DZ5A 3UT0A 4GMEA 4HHHA 1W3NA 3N11A 4DB7A 3PZNA 4JNZA 1JIBA 2XZ7A 3SECA 4FX7A 2RH9A 3S46A 1UUOA 3GZAA 3URBA 2VTFA 3RLUA 2WK2A 1EYEA 4UC5A 3CS2A 2XJ7A 5HBFA 3CUZA 3M0ZA 5C7VA 1VZWA 4RX0A 1EGMA 3W7OA 4MNMA 2JEQA 1QNQA 3R58A 5E5CA 1ZGDA 2VJXA 3P61A 1H2JA 4NNCA 4LX4A 4MDPA 3W7PA 3P5YA 5DFAA 2V5CA 1KM5A 4QEEA 1TPC1 1YEYA 4F2UA 4OE7A 5FF7A 4XO7A 3ZOAA 1LWJA 2FJUB 3H2MA 4EANA 3F5LA 3A5FA 3KDOA 3VDCA 3P0WA 3CPUA 4UB9A 5FEWA 2FLIA 4HCLA 4ZQRA 1Z44A 4CD5A 2A21A 4YWSA 3GYEA 4AVNA 1PIGA 1X8FA 1OT2A 4TU1A 2OT0A 4DN1A 4AEFA 3W7HA 4W84A 3UG5A 2JF7A 3CYJA 3D3FA 3H22A 4AU0A 1ISXA 3OLDA 3SUWA 1ADOA 1IXNA 3M64A 4J40A 4LY4A 1ONRA 1JI2A 3GVRA 4PTXA 2QW5A 3E38A 3LQGA 4JTTA 5A8OA 4N9EA 1XQLA 3N6JA 3WMBA 3CO4A 4JTSA 1W1TA 5AHFA 3APYA 4P8UA 3WELA 4ZQMA 5EPDA 1FXQA 1E0UA 1QFEA 5CPQA 1UIPA 3U57A 2PDIA 2PURA 4Y90A 3FOKA 2PWDA 2OB3A 4JTHA 5CLTA 5LYRA 3B8DA 1SO3A 4Q32A 1OCNA 1W1B1 1UP3A 1Y0EA 5CPSA 4MUPA 4OFCA 4HNNA 4UTFA 3GAYA 5EB8A 1DVJA 1VFSA 3QSRA 1OQFA 1VYSX 2H3BA 3LY0A 2GWNA 1HO4A 1KTCA 3T55A 3BARA 3FX4A 4IJRA 3ARUA 2NWSA 3UY8A 2O92A 3GHUA 3WNPA 4IUGA 1W6TA 4Y9MA 2XHYA 5LIUX 1TO3A 5ECUA 3DERA 5DN1A 1S2CA 4NL1A 5A8MA 1KKOA 1O5QA 4F2BA 1PYMA 3GU9A 1WKFA 3O6AA 3KW3A 4AZIA 4E6MA 3IS4A 1F76A 4LAMA 4C6DA 3TYAA 2V2DA 3O6CA 4JBRA 3WD3A 3UFYA 1J96A 1XH0A 4PMVA 3L67A 3G8RA 3AIWA 4P5UA 4U28A 3JZUA 1JPIA 4V33A 5CH9A 1RQEA 1KM4A 1TIMA 4AWTA 1ZFJA 5K9DA 1Z3NA 1OADA 2H8XA 2UY4A 3FJLA 1ODZA 2QXWA 3VM7A 2WC3A 2VEGA 3OYXA 2E6FA 1WZAA 2YXGA 2WCAA 5A6LA 3TQ0A 2YDQA 4HNLA 3RGTA 4HNOA 1WBJA 2R91A 3NDOA 1FHLA 3UR7A 1KM3A 3PJWA 1W5NA 1RJQA 1B3VA 3MWCA 1F9CA 3DCPA 3L0NA 4AD1A 2VR5A 1IF2A 1F3EA 2ZXDA 1BD0A 5AHLA 2WAGA 4FA3A 2ZICA 1UOKA 4B92A 1JNEA 3S8HA 1F6PA 4FF5A 4EAMA 1TZ7A 3W83A 4JTAA 3WBEA 5A94A 2P53A 2TPSA 4W89A 3W29A 1OT1A 5CGTA 2R1LA 3RIKA 3RNDA 1SPQA 5JIPA 2CKRA 1JVNA 3FNDA 3QR1A 3L4XA 4WJ8A 1TUFA 2OGJA 1H7PA 4MFEA 4QDMA 3TN6A 2AOSA 4LV9A 2NWRA 3SQSA 4E4UA 4UIOA 1HJVA 3IUIA 3MU7A 4NVTA 5D2WA 5BXSA 3IGXA 4DPQA 2ZZ5A 4E4PA 3OLIA 4JEJA 1KTNA 3GVQA 3IVTA 3TONA 1W56A 1CGVA 1GTEA 4B3KA 5XIMA 4GUIA 1W31A 2PLCA 3GU2A 1UR4A 1H7NA 3PSWA 4WY0B 1EA0A 3BZJA 4GUGA 1TSIA 2Q01A 2X0SA 1DJQA 2VVSA 3B8TA 1SVDA 2RDWA 4BWLC 2Z29A 3PZ9A 4US6A 2ZZ7A 3L5AA 5KETA 1JYWA 1US2A 1HJWA 1L6GA 4O54A 1H4PA 4CVWA 4JTJA 1Q13A 1H11A 4ICMA 3XISA 5FESA 3T78A 2HWGA 3FIGA 5HR6A 4IX0A 4ZO9A 3NNTA 3PP7A 2OQYA 1CIUA 4REQA 2QUUA 4NJGA 3W02A 4GIAA 3BLFA 5HNUA 3GW0A 3CASA 1SZFA 3VC6A 4NJJA 2DH2A 3VGFA 1NIUA 1Q65A 2A1YA 2XIJA 3M5VA 4CNSA 4O1EA 2V8ZA 1AH0A 4RE2A 3OO2A 4MG4A 4FHAA 1R5YA 2PZNA 3DXIA 1L6SA 2OEMA 3QOKA 3WUGA 3VE9A 1T5AA 1R9XA 5KZDA 5CBIA 2O9OA 4AQLA 3MJMA 4J9JA 1JD9A 2D0GA 3S9ZA 4S2CA 5JH2A 3SRDA 3ZT5A 4EE9A 2CLKA 3WH8A 5I3IA 1UZHA 4LC8A 3NWRA 3S6OA 2GJPA 1O68A 3S2MA 1HKIA 1W32A 3AIRA 5C9ZA 1ICSA 5U4NA 4MTVA 3O07A 3G1VA 1I2RA 4D6IA 3NL3A 1TV3A 2B7NA 2D3LA 4QJ4B 4UOQA 1EBHA 2H9AA 2XVLA 4B5XA 1Q7ZA 4GKLA 3AMLA 2X30A 2WJFA 1UA7A 1DL3A 4X61A 2SFPA 4JQ3A 3A9IA 5I0DA 1TJPA 2ZYFA 5XIAA 3CAKA 5HMEA 4L4MA 2W66A 2Y5SA 3LCWA 4M1BA 5HINA 3O0FA 1N55A 2GSHA 3CYVA 3R25A 3TMLA 1KXHA 3ITYA 4A3YA 1JPMA 1AJ0A 2DZBA 2FFIA 1FBAA 1V0MA 4AB4A 4O17A 3UJSA 2VGBA 4P61A 3U5UA 5LNRA 1JUEA 3M6YA 1WYIA 3FEMA 1VHNA 2NT1A 2Q6ZA 3SY1A 4IUOA 3LI0A 4BF5A 3C6CA 2EPKX 3AUOA 2X40A 3MS8A 1VPXA 3AWOA 3O05A 4DBEA 1BSLA 3RN6A 5M1TA 1QNOA 1NWSA 2XFWA 3T0BA 2YPIA 3I3EA 2QCLA 3STCA 3UNDA 4EVZA 3NVTA 2WZEA 3PPHA 4GWEA 4WVXA 5BWAA 1DQUA 3WEOA 2EF9A 3VZYA 3KLLA 4CVUA 1JDFA 3OODA 3S1VA 3A22A 5F4WA 3TC6A 3MHGA 1B4EA 3M16A 2C3ZA 1LYXA 9CGTA 2C13A 2E68A 4MB3A 4MNLA 1KFCA 4YL2A 3CZGA 4P7RA 1S2UA 2BXZA 2W5FA 2VZOA 3DEQA 1KRMA 1KWKA 2VZUA 2H90A 3PZGA 4LTSA 1TPH1 4GJIA 3B0UX 1B9BA 2YCLA 1KGUA 3MV11 1DTUA 1JCTA 5DCBA 1R7AA 1F7BA 1UYQA 3M0MA 4RZ6A 1T99A 4TMBA 4F79A 1SO6A 3P81A 1F8MA 2QULA 1B3XA 1UP0A 3WL1A 2EPOA 3KVJA 3IAPA 1K8ZA 3B0PA 5GJMA 4CD8A 5DELA 3VIJA 5KITA 4D1JA 3BW3A 1QO2A 2RGLA 3PB0A 3FFSA 2GSEA 2J4GA 4GYKA 3WDQA 2Z0IA 1A4MA 1BQCA 2WMIA 3H26A 3V1PA 1W8GA 4I7UA 4KQNA 4I6VA 3T1GA 2QDGA 3LRLA 2FZBA 2GJNA 3AYVA 4JKLA 2ZXAA 1V0KA 4O0QA 4HN8A 4NX5A 7XIMA 1QRQA 2ZVRA 4ZOCA 3W7KA 4LS2A 4XKYA 3NQEA 3G1SA 1JZ2A 1ZBWA 2B0MA 1YMYA 2E1DA 3FSTA 1V5XA 3B9AA 3TW6A 1BRLB 3PHAA 3CEUA 3AHZA 3LBMA 4PUMA 2V3EA 1EJXC 3TEVA 2WNNA 4O0KA 2DQXA 1EJSC 4F9JA 1I45A 2YKKA 1FVPA 1S1PA 1Z32X 3WD4A 2E5CA 1Z7AA 3KP1A 4DIAA 4IX2A 4Q8MA 4XD4A 1QBBA 2ZDSA 4M56A 4RV3A 3BWWA 1UWIA 3BICA 3KTCA 4UUIA 2HISA 4PTDA 3AIEA 6CGTA 4XB3A 4MKSA 1J0ZA 1MO0A 4HYVA 1AH3A 3HQOA 4IIFA 3V75A 1M6JA 3BGGA 1V93A 4JKKA 2ZVIA 2RDUA 3T08A 1QO5A 4I9AA 1UZ4A 3CMGA 4B2DD 4GY7A 2R1NA 4DBSA 3BOLA 4UTMA 2OOFA 1R3TA 2PMQA 3PNUA 1BF6A 1ZL1A 4HP5A 3GVVA 1LUCA 1F4HA 2WM1A 2BBFA 4M6QA 3T2QA 5A8NA 4FNPA 4NIRA 3R0KA 1JDAA