3LQGA

Human aldose reductase mutant t113a complexed with idd388
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
310
structure length
310
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Tracing the detail: how mutations affect binding modes and thermodynamic signatures of closely related aldose reductase inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 310
sequence length 310
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lqgA00
4YVVA 2IPJA 5M2FX 4JIHA 1X98A 1ZSXA 3N2TA 3H4GA 2IKHA 1K8CA 5LIWX 5LIYX 4YVXA 1Z3NA 4L1XA 2WZTA 2DV0A 1LWIA 4XAPA 2ACSA 2PDLA 4LB3A 2INEA 4ZFCA 2PDYA 1C9WA 4R9OA 4DBSA 2FZ9A 2J8TA 3G1RA 3V0UA 3R7MA 4LBRA 4I5XA 3ERPA 1RY8A 1S2AA 1M9HA 1YNQA 2IKIA 4FA3A 2HDJA 1PZ1A 5C7HA 2ISFA 3UYIA 4DBWA 4YS1A 4RPQA 4XO6A 3B3DA 3GUGA 4XZLX 1US0A 3UZXA 3Q65A 2IPWA 1A80A 3ONCA 2HE8A 2A79A 3CAQA 1PWLA 2PF8A 3R43A 4MHBA 3LZ3A 5JH2A 4JQAA 1MZRA 2NVDA 1AH3A 4LB4A 2AGTA 4LAUA 1S1PA 1RALA 4Q3MA 2FZBA 1Q5MA 2PDXA 4WDUA 1Z89A 3COTA 2PEVA 4JTAA 2PD5A 2QXWA 1GVEA 3C3UA 1T40A 3M64A 1X96A 2ACQA 3LN3A 2ACRA 4XVDA 3UZYA 1JEZA 4JTRA 4WDWA 1X97A 2IKGA 2C91A 5HA7A 2BGSA 3G5EA 3R58A 1MI3A 1UR3M 4JQ3A 4FZIA 2I16A 2CLPA 1LQAA 1Z9AA 2BP1A 5AZ0A 3LD5A 4GIEA 4PMJA 4GQGA 3R8HA 3WBYA 3EB3A 4JQ2A 3FX4A 4FAMA 3GHUA 3M0IA 4YU1A 4LAZA 4WRHA 1PWMA 3RX2A 3UG8A 2I17A 4H7CA 3S3GA 5LIKX 2IS7A 1PZ0A 4QBXA 2PDNA 4EXAA 5LIXX 3H7UA 3O3RA 4HBKA 3EB4A 2IKJA 1ZQ5A 1YE6A 3UZWA 3BCJA 3MB9A 2PDHA 2HE5A 3R6IA 4XVEA 2PDMA 2HEJA 2IQDA 1OG6A 1VP5A 2PFHA 4QXIA 1AZ2A 1IEIA 5HNTA 3M4HA 1PYFA 3WG6A 1EF3A 3KRBA 2ALRA 1EKOA 3WBWA 3CASA 4JIIX 2ACUA 4QX4A 4WGHA 1XGDA 4XZNX 2HV5A 2F2KA 1IHIA 1EL3A 4PRTA 4F40A 1EXBA 3UWEA 3CV6A 2INZA 2PDUA 4ASTA 3WBXA 3DOPA 1HW6A 2PDBA 1YNPA 4XZHA 1S2CA 2F38A 3BURA 3CV7A 3R8GA 3LENA 3UP8A 4XZIA 3V0SA 3FJNA 3V0TA 4GCAA 4JQ4A 3T42A 4JTQA 3R94A 5DANA 4GQ0A 2P5NA 3O0KA 4G5DA 1S1RA 4IGSA 4XZMX 2PDCA 1Q13A 2DUXA 4JTCA 2PDWA 3MC5A 3BUVA 3LQGA 3LBOA 1MRQA 4JIRA 3V36A 2PDPA 4HMNA 4AUBA 3CAVA 1T41A 2HVOA 2FGBA 4PUUA 1HQTA 3LQLA 2PDFA 3D3FA 4XK2A 5JH1A 1AZ1A 2VDGA 2PDJA 2IQ0A 4GACA 4DZ5A 2IPGA 1AH4A 4OTKA 2HVNA 2WZMA 3LZ5A 2PDQA 1J96A 3CMFA 3VXGA 3WCZA 4H8NA 2FVLA 3EAUA 3P2VA 1AFSA 4EXBA 3RX3A 3UGRA 1FRBA 3LNMA 1XF0A 3QKZA 4WDXA 2NVCA 4Q7BA 4WEVX 2PD9A 1ZGDA 3DN5A 4JTDA 1VBJA 1AH0A 4DBUA 5KETA 1ADSA 4PR4A 4IJCA 4NKCA 3UZZA 5HNUA 2R9RA 1Z8AA 4WDTA 4GABA 2PDKA 3LUTA 2BGQA 2IPFA 3NTYA 4PUWA 4FALA 4PRRA 1ZUAX 4YVPA 1YE4A 1SM9A 3ONBA 2PZNA 5LIUX 1XJBA 5AZ1A 3GHTA 2PDGA 4ICCX 3UFYA 4XO7A 3U2CA 3GHRA 3V35A 2PDIA 4L1WA 4IJRA 1QWKA 3H7RA 2FZDA 3RX4A 1R38A 2R24A 4QR6A 2FZ8A 3N6QA 3Q67A 3BV7A 4JQ1A 3F7JA 4LBSA 3GHSA 1QRQA 4GA8A 3LEPA 1RY0A 2DUZA
chains in the Genus database with same CATH superfamily
5AKQA 1F6PA 1RVKA 1K8XA 4V1XA 1L6YA 5A69A 4GC4A 1IZCA 2VFFA 3H4GA 3KBJA 3H2EA 2QUTA 4IPIA 1SGJA 2VUNA 3LM3A 5CPMA 5A2AA 4IP5A 3CTLA 4FIQA 2VL4A 3W7QA 2PDLA 4MJZA 4LB3A 2D24A 3PG8A 2RGLA 3N9SA 4GFSA 3WH7A 1WKDA 4UCGA 1PIGA 3GD6A 1ZTVA 1I1WA 5F2LA 5CBJA 4KERA 2YW3A 1TV3A 3C86A 1PS9A 4UTTC 3UG4A 3PZNA 3VUPA 1O5KA 2BB0A 4C6IA 3CPGA 2YL9A 3DHPA 4EPDC 3HPSA 1UP2A 3G8EA 2J7EA 4N4QA 3KVKA 5DT5A 4MVAA 2PTYA 3FOKA 4YXGA 1W2PA 2P0OA 3ANUA 4Q8WA 4JY8A 1PB0A 2DT1A 3P82A 4JZ5A 3CPUA 3BLKA 3W1AA 2WJFA 1H4PA 3FEMA 4HCLA 4GVHA 4QM1A 2PRMA 3SGGA 2AGTA 4LAUA 1XLEA 4RPPA 2ABBA 1OCNA 3POHA 4NJJA 5A8MA 1W9PA 3COTA 1F2JA 1IF2A 5D02A 3AMGA 1QI2A 3SZ8A 4ZQCA 2YCLA 4DQWA 1TE1A 3DI1A 4FNPA 4MFDA 4C90A 4OFCA 3TMLA 5LHFA 2ACQA 4JTRA 4MPKA 1RQEA 3JRKA 2OO6A 1MZHA 4PE8A 1HJVA 3PN8A 3GW3A 3A4JA 3M47A 4JQ3A 2CPUA 3MBDA 5BRQA 4FLRA 1V51A 4AEFA 3C0SA 1HKIA 4CNPA 4IMCA 1VAHA 4C60A 1GOXA 4GY1A 2YYTA 3S9YA 4GQGA 1XYFA 1J18A 3BWWA 3ZLFA 1MYRA 1OHLA 1O12A 2D1ZA 1HJQA 1JPHA 1EZ2A 3BCDA 2VC9A 4S38A 3A3WA 4L6HA 4WSHA 4W5UA 2I1OA 3G22A 4JDYA 4QBXA 2FIQA 4AWUA 2QF7A 2Q09A 4HBKA 2RKXA 4O52A 4O53A 1B3OA 4NVTA 3OO2A 2O9TA 2HXUA 2XJ7A 1MDLA 1M3UA 1SJDA 3R4IA 4NI3A 5ABHA 2NX1A 4IMFA 1OD0A 2TODA 1A0DA 7A3HA 1ONRA 4BQ3A 1AZ2A 9CGTA 3FAXA 2W63A 3WELA 3BW2A 2W62A 2Z7GA 3MZ2A 3E2SA 1EF3A 1CXIA 5AHFA 4D6HA 1R3VA 2P0IA 3LB0A 1WXYA 4WGHA 1Q7MA 3VCCA 4OOZA 2CW6A 2OOGA 3APYA 1Q6FA 2Q6ZA 1XLMA 2WLZA 3AYTA 3GXPA 3L21A 3U2EA 3HFYA 1MXDA 4WOQA 3N3TA 1OCQA 1QHZA 4RL3A 2F38A 4KETA 5KITA 4B5VA 1RUSA 3NDYA 3FSTA 1HJXA 1EEXA 3LENA 1NFPA 3NFUA 4QAWA 2BNJA 5IDIA 1R9YA 4HCHA 4P8XA 1I1XA 4OBSA 4MFEA 1FWBC 3LRLA 1RBOB 2OKOA 3GQYA 4PTDA 3T42A 1VHNA 1ZCCA 3ZT6A 1KV8A 1T8QA 3OBAA 1ZBWA 5D33A 3MSDA 1U33A 3MP3A 1E56A 3IEBA 3LLDA 3D6NA 4Q8MA 4S3JA 3OZYA 5KZEA 3VI2A 3VILA 4JTTA 1DWJM 2ZZ1A 1OB0A 1R30A 3T2OA 3JUGA 3A4WA 3DFTA 1XBZA 2PDWA 2Y7GA 3N14A 3GTIA 3M16A 5FJPA 4J28A 4NX0A 3FDGA 2Q8XA 1X1ZA 2G8ZA 2I56A 3DERA 2BHYA 4DJFC 3W02A 1X1OA 4HMNA 4E4PA 1G6CA 4M81A 4Q4MA 3UVIA 3SGUA 1GOKA 4XKYA 3AYRA 1XL9A 3LPGA 4DAIA 1E9IA 4AZ5A 5I7GA 5BRBA 1Q63A 4LVAA 1TV4A 2QMJA 4AC1X 4O1EA 3ITXA 4LVBA 1CGUA 2ZC1A 1LQ0A 2NT1A 4HD5A 4PCSA 2Z2AA 3G6MA 4P7OA 3WEOA 1KM3A 1TMQA 2C71A 3EX6A 3FJLA 3TTOA 4LOCA 2GFTA 3SEPA 2VURA 1J01A 3M5VA 4JGDA 1FRBA 1UD8A 2D23A 2NQ5A 1XF0A 2UWFA 4F0RA 3U4AA 1JIBA 3NQEA 1XYCA 2Z25A 1IT7A 1E6QM 4JIQA 1QTWA 1OX4A 3KLLA 1XSIA 3UCQA 3QLLA 2PGWA 1MUWA 4NXSA 2OGYA 3WF1A 3RIKA 3UWQA 1UW9A 3VVGA 1GKPA 2OX1A 3TOPA 3U57A 1ZUAX 1KFBA 4WLCA 4DUXA 2OFJA 2Y61A 1H3GA 4PB5A 4XX6A 1SM9A 5AOUA 3B8WA 3W2JA 5D32A 4NY2A 3SIZA 2CLIA 3DKJA 3H2AA 4GINA 3GFZA 5C71A 2PDGA 1CNVA 4GY7A 4LVFA 1LOLA 2Z1WA 1UKOA 2J74A 3IIPA 3CH0A 1VLIA 1PKNA 1YW1A 3LNPA 1QWKA 2PBGA 4HMCA 1Y5VA 1E6PA 2WC3A 5HXMA 2A7PA 3IGUA 1H5VA 4XSMA 3N29A 3TROA 3N6QA 3M6YA 2PCEA 3UERA 3EWDA 3PG9A 1LUCB 7TAAA 5AFDA 1KRCC 5M2FX 3MKCA 2VZVA 4HSHA 1KM0A 4Z2KA 4GGHA 1E4LA 3WKZA 1AQHA 4N4PA 3SSZA 1JZ3A 1Z3NA 5B7ZA 1LWIA 4XAPA 3O15A 5HDRA 1KRBC 1ZFJA 5FOOA 3FCPA 3SI9A 2INEA 3H2OA 3W01A 3TXVA 3G1VA 2V2CA 3FY1A 5D9NA 2ZA2A 1Z44A 3TQ0A 1C29A 2J8TA 1RAKA 3S2LA 1W17A 1AG1O 2RDXA 1KM2A 1OYCA 5G4HC 5I06A 4LBRA 2NLIA 1P0EA 4W4QA 3ERPA 3V18A 4QS6A 5GJPA 1YPXA 1KNWA 4I7UA 2R1MA 1OABA 3GC5A 1PZ1A 5KSWA 4YCPA 4KEVA 5A8GA 2PMQA 3OA5A 3GZAA 1CDGA 5G4EA 2OVLA 1XX1A 2I5QA 3SRHA 3IAPA 1UD2A 3TK7A 3FS2A 1P6CA 2WV8A 3AYSA 1S1PA 1D7KA 3QXBA 4Q3MA 3N04A 1K3UA 3VGGA 3WLOA 2BSLA 1XPGA 3CB8A 1DV7A 2ZX7A 2QS8A 1KGXA 3HZ3A 4FF7A 1QHPA 4ZO8A 4S2BA 1H7PA 1EO7A 5C9WA 1YDNA 3QHNA 3UVAA 3JW7A 1M01A 4CN4A 1MO0A 3HGOA 4IXXA 4Y8FA 4XZWA 3HOJA 5G1TA 3WLSA 3BJSA 3EKZA 2EJ1A 3IVTA 1IEVA 1S5WA 1K03A 3VD5A 2W0UA 4NAFB 4UTWA 4PBGA 4P8VA 5A6JA 1UG6A 3WDQA 3HJEA 3EWYA 4PC8A 3G2GA 1MQPA 3AAMA 3M0YA 5LKYA 3CZEA 3WK0A 4LAZA 3BAWA 4RKAA 1PAMA 1XKYA 1QOPA 1RA5A 1LQ2A 2BXZA 4RDYA 5FD0A 3SFWA 3UXKA 3TW7A 1ISWA 1JD7A 3O3RA 4GUIA 4HN8A 1J6OA 4GK8A 3E0LA 2Z0IA 4O1CA 4Q8TA 1ISVA 3MB9A 4A8IA 2DIJA 2C1GA 1XQLA 4O0QA 1WA3A 4NNAA 1Q6OA 3SRDA 1O60A 3E0FA 4AD2A 2WSQA 3GB6A 4OQVA 4L9XA 3EZ4A 1NDYA 4JNYA 3GR4A 5CLTA 3GTHA 2YCKX 4HOXA 3PUEA 1QATA 2CLKA 3FGCB 1W3NA 1XGDA 4XZNX 1EA9C 1Q8AA 2E9MA 3S1XA 1FHUA 3WEMA 4F40A 5D9MA 4M1BA 2H8ZA 3AJ7A 1N82A 5DRCA 3SUVA 3QW4B 4IT1A 1HW6A 2OKTA 2TYSA 5ECVA 4RW3A 1PYMA 4JKKA 1QW8A 2BY2A 3UP8A 2QKFA 2E25A 2OLAA 4WQ6A 3I68A 4J2MA 4CGTA 1Y7VA 2D0HA 4GZJA 2QCGA 4AAJA 1RD6A 2VR5A 1EBHA 4R34A 1EIBA 4GYKA 4LNCA 3W84A 3TA9A 4IGSA 5EBAA 1NF7A 4M51A 1CI1A 5AYZA 2H9AB 1JYXA 1YYAA 4D8AA 3MJMA 4ZQPA 1M7JA 1HNYA 1KBKA 1H0GA 1MSSA 3C2OA 1X8CA 4Q8OA 1MUCA 1TELA 4E2BA 4S1FA 1BLIA 2ZUTA 1FBAA 3AHTA 2DSWA 4F2TA 3UNTA 4CCDA 1L6SA 1SZNA 4GXWA 1AJ0A 2J9XA 4YCOA 3NM1A 3P0XA 5D2YA 4TQTA 1XLJA 4NL1A 1LCOA 3WF0A 1R47A 2VENA 3BG5A 2QUVA 2ZRXA 3B8TA 3WQVA 1X6NA 4RK8A 2EEXA 1EDQA 3CMFA 4JFSA 3K4DA 2V3DA 4X0NA 1AW5A 2AGKA 3W87A 2CERA 1E1CB 1GWJA 2NVCA 5HK4A 5C54A 4IP4A 4RX0A 1TZ7A 1G4SA 3CWOX 1J5SA 2EG7A 2WVVB 4A05A 1K4GA 1HP5A 1S5MA 4WKHA 1YXCA 4HHMA 4GVFA 2QCNA 4DXVA 3CIXA 3QPYA 4GH1A 5E70A 2D2OA 3HFTA 5IXEA 4PUWA 3E12A 3CHEA 1EPVA 4B5XA 5FEZA 4CQ8A 4NZCA 3EA3A 3ARWA 1V7YA 3TP4A 4V15A 4NQ1A 1QI4A 1Y0EA 2PU0A 2PURA 2P10A 2QJHA 1M7XA 5CJNA 4IIBA 5HQMA 1EGVA 5DCBA 4C1NA 1VJSA 2ZXDA 1UUMA 1ONEA 4PMXA 3NZ1A 1XSJA 4FNSA 4GBDA 1R2TA 3MYOA 5LZLA 1THFD 1G1YA 3KTCA 2CLEA 5D8WA 1WUEA 4YHEA 3C61A 4JYFA 4UFHA 3H7RA 3SJNA 2Y8UA 2V5JA 4WY0A 2PE4A 1BQCA 1DOSA 2Y0FA 1V0LA 1WXJA 3PBVA 1KXHA 3F7JA 4Y9NA 7XIMA 1UWRA 3LHVA 5B7YA 3UYCA 3MS8A 3PUGA 3MMUA 2YGYA 4ONVA 1KRMA 3BOXA 3T81A 5LIWX 1B57A 1W8GA 9XIMA 4GRSA 1NQKA 3L4VA 1UD3A 4ZOCA 2WMJA 2ZRVA 1DJHA 1RK5A 3TXZA 4DUVA 4LUTB 5C9RA 1PUDA 2ZZ7A 3OBEA 4QS5A 3TNOA 4R9OA 2G97A 2GSJA 3W6LA 5K9XA 1ECEA 3LGDA 1HKJA 1M41A 3G1RA 3R7MA 2QAPA 3MMTA 3ZIZA 1IXNA 4HNNA 4YHGA 3CZKA 4IJBA 3BLEA 2VX5A 3WFZA 4AIBA 1J4EA 4D71A 4C91A 2GWNA 4F2UA 5AC5A 3KZPA 1DJWA 4J40A 5CZSA 3KBMA 3QGAC 2VRKA 4GKTA 3CL8A 1UOKA 3MUXA 3B06A 3HB9A 2YOCA 3AS1A 3PTQA 2YZRA 4JPGA 2A6NA 3CHCA 4IXHA 4PCPA 2PA6A 1BKSA 1H2JA 5AYYA 3UCDA 1FKXA 1HP4A 4IL2A 4Y7EA 4UTJA 4JBRA 3WQ6A 4ATDA 3SCOA 3B04A 2FZBA 4L80A 1FDYA 4Q4RA 2ZZ3A 1DXIA 1KWKA 5LYRA 5LGXA 1UQZA 4JCMA 4AWSA 1BWVA 6TIMA 3ZJ8A 4DPPA 3ICJA 4XZBA 5DCEA 3GY1A 4OU1A 2P88A 4PTWA 4EF8A 2IKGA 1E71M 4ROQA 4CD4A 3OP2A 4ZB2A 5DF0A 3PFRA 5JVLA 1YPIA 1Z9AA 2BP1A 3WDPP 3W9ZA 2FPVA 4Z2GA 1ZBKA 4ZZ9A 4U3CA 3WBYA 3WUFA 4JTJA 4AB4A 4DELA 2AQOA 4CUCA 5JBFA 1REQB 4MDOA 3UG8A 3AMCA 3SAZA 1P0NA 1EWEA 1WBJA 4W86A 4XD6A 5LIKX 4HIBA 3TEVA 1XLKA 3B03A 4DZIA 2PCQA 3LMYA 3MDUA 1ITUA 4R53A 1V5XA 4I3GA 4Z2LA 4JX4A 2W6RA 2QCCA 3D46A 4GI4A 4CEUC 3OG2A 1RA0A 2QCEA 1KGWA 3QGKC 1NP0A 4FF5A 4DXKA 1PIFA 4XVEA 1G9HA 4DBEA 1ZU8A 1W3IA 3PJXA 3UWVA 3T2PA 2BVTA 3UJ2A 3HM7A 3C4UA 1EKOA 3WBWA 2FTWA 4M19A 3BPWA 1RZMA 3WF3A 4UQEA 2V30A 1LP6A 1WO2A 4AIUA 1RV8A 4IFKB 5EMKA 2V9DA 1VQTA 2YFNA 1L6GA 3WLJA 1OFRA 4XZHA 2W27A 4UOZA 2QCLA 1FWFC 3PBWA 4Q8PA 1FH7A 2TAAA 2HS6A 3VNKA 4UC5A 3GDTA 4M5PA 2GYIA 5DMMA 1XI3A 3ARYA 5CGTA 1OT2A 4F79A 3MP4A 4RV3A 1NARA 4IZGA 3VABA 4GG9A 1OCBA 2BV9A 5JU6A 4DJEA 4X63A 2EG8A 2ICSA 4B90A 3QVQA 2QUNA 4YIWA 4NSBA 5G2WA 1JGMA 2DEPA 2J24A 3E02A 5HUOA 4DJDD 4RDVA 1TX2A 1K7EA 5ENLA 3KDNA 3S2CA 1ISXA 3CAKA 4LH8A 2OG9A 1W3HA 4QITA 4KGJA 3DFNA 4HN4A 4XV0A 4ZODA 1AQFA 1Q2RA 3AIWA 3W7IA 5CZKA 1XW8A 4G7EA 3IIVA 3PPHA 1SFTA 5CAHA 1T41A 4FHAA 2E5BA 3UJFA 4QSHA 3CS2A 1J0YA 4MB4A 4L1GA 3GBDA 2VZUA 5XIAA 1C8VA 1VEPA 1B3WA 4UTIA 4CQ9A 4ZQMA 4ENLA 2Y85A 1B3XA 3TSDA 2DU2A 3AU2A 4Q7IA 2PDQA 3TLLA 1QVBA 2VEFA 1OC5A 3REQA 2EKGA 2J79A 1W9VA 4QRNA 5HQEA 4QCEA 1KTBA 3SJ3A 3GH5A 4W8AA 4IMDA 3OB8A 2IXVA 3LSBA 3F03K 1N8WA 2PF0A 1XFCA 2PD9A 2WHLA 4MKVA 1VBJA 3WEZA 4EANA 5EMLA 1AH0A 2DJLA 1B9ZA 3OHIA 2PPGA 4PR4A 5DMYA 3CQ0A 3O8AA 5JBEA 3P8IA 2ZVRA 3AMDA 2VP8A 2GUYA 4U3AA 2BGQA 1HJSA 3O2LA 2E40A 4Z1DA 1SVDA 2VI0A 2D22A 2OU4A 3WH5A 4OBTA 2F9RA 2HS8A 1OGBA 2DVXA 1R3WA 3B4YA 2QUUA 1CWYA 1ECQA 3RM8A 1AA1B 2WLYA 1B3VA 4GY0A 2WHJA 3PNZA 2WVTA 4KFOA 3QTGA 1G67A 3G77A 3HF3A 3URQA 3KRUA 2OEKA 3OGRA 1UMYA 2E4TA 2J7GA 1IIGA 2WNQA 1V6XA 3EB2A 3LCWA 3TFCA 4MB1A 3W86A 1F8MA 2YJQA 4C65A 3PSWA 4KF1A 1HFBA 1KXQA 3KRSA 3ELFA 3RMJA 5BW6A 3B97A 3I3EA 4M29A 3A22A 3M0XA 3SSJA 4JIHA 1OC6A 1UROA 1TPFA 4UFIA 1P4CA 3TYDA 3F4NA 5HMSA 2O7QA 5G2IA 1AODA 1HGWA 3T44A 2WBGA 3NXLA 1YDOA 3D0CA 3ZLHA 2MUCA 2YKKA 4N6FA 4HNUA 4ICMA 1E73M 2GVJA 4LSBA 1UHVA 3R8RA 3LCIA 3BE7A 1Q45A 4HYRA 3AC0A 5GNXA 3SCRA 4Q32A 1FTXA 2O0TA 4S3KA 4DJFA 2DQXA 4JX5A 4U2YA 1HUVA 2IQTA 2OEMA 3I6EA 3QC0A 4R5EA 3R0KA 3ZVHB 1ONWA 2YXXA 3EDJA 2PLJA 5DBUA 3S42A 1V3JA 4MF4A 3F1QA 4YTSA 1QASA 3UYIA 2OWWA 2HMCA 4GUJA 2FFCA 4C6BA 1FCQA 4DN1A 4PBEA 3T1GA 5CPOA 3VKKA 5BWAA 2YBVA 2FH6A 4O1BA 3OZPA 4ALDA 5A6BD 3AISA 2GGGA 3MWAA 1DXEA 2HJPA 2Q71A 3CUHA 3MZNA 4CLMA 4JQAA 3FXGA 2JKEA 3W75A 3DUGA 4H8VA 1UJQA 1RALA 4CNTA 3FKRA 3LHYA 4ZENA 3RPTA 1Z89A 4H8UA 2D20A 4DB7A 1E6NA 2VQTA 1AW2A 3WL1A 3DYOA 3AS3A 4PMOA 1UJPA 2ACRA 5BROA 3ARQA 3OPSA 1NP2A 1JDDA 5C9XA 3EOEA 4LGXA 1BSIA 4MYAA 4B5UA 2ZX8A 1U30A 2W3ZA 4WUIA 3OIHA 4ZMGA 3T7VA 5HBFA 1JFHA 1UD5A 2G37A 2C0HA 3W0KA 5K4XA 3L23A 1UWSA 4C6DA 2EAWA 1B90A 3EX1A 3N19B 3MY9A 1P1MA 1KWGA 3W82A 3HTWA 3AJXA 1DP0A 3UA4A 5GQBA 5DT7A 2QIIA 1PWMA 1FWJC 1A5OC 4B5SA 3WBEA 1OFBA 2DT2A 5MF5A 1JAEA 4Q4SA 1K1DA 4LAKA 4OV4A 5IRPA 3B9NA 2E1DA 4Q33A 1IXQA 3RXZA 4LRSA 5LIXX 3KTSA 3CAWA 6CGTA 1A4LA 4JNMA 3QQ0A 1K70A 2Y5EA 2CHRA 5HPOA 1CB2A 3L7RA 3QW3A 3GVQA 5TNVA 3PPCA 3ORWA 3TZFA 3QFEA 2BWGA 3RM4A 1IXOA 1WNOA 1SJCA 3NR0A 2OZTA 4AF0A 1YBQA 4YTQA 4JICA 1MNZA 1GEQA 3S1GA 4FLQA 5IFPA 3M4HA 4F0SA 3GXIA 3KRBA 1VFMA 3QMSA 6ALDA 4M1RA 5AHEA 2ZUVA 1XIFA 1LT8A 4JTIA 1L0PA 4ZQNA 4MM1A 1BWLA 4K1GA 4S2CA 3STGA 2C1IA 1ITXA 1IHIA 4GJ1A 5FIPA 2WVVA 4JD4A 4AEOA 4PRTA 3WLHA 5DY3A 3VNDA 1ME9A 1E40A 1TKKA 3WUBA 3PTMA 1M04A 1VYSX 4WD0A 2H3BA 3VMOA 3AMLA 2CLLA 2PLMA 4PB4A 1XRVA 2X1TA 3TQKA 4AD3A 1XS2A 4MIMA 2J47A 3LCXA 1T0OA 3QOMA 2WNWA 2XH2A 4R3UA 2ZTJA 3ZR6A 5LNUA 2Y4SA 1IWPA 1QO5A 2FDMA 2GVYA 2Y63A 4IPNB 3EWBX 4M56A 1UUOA 3WQCA 1Q6LA 3SN0A 2WXDM 3VMPA 3DHUA 3M07A 3O6DA 2J9YA 4AXKA 5FI8A 3H4XA 1CGVA 1TPEA 3GAYA 4O17A 3KRZA 4TO8A 2VEKA 2Z28A 2OCZA 1XICA 2NSOA 3STPA 4JTKA 5CZ0A 2RHGA 3KS6A 3TC6A 3W22A 1IXPA 3E96A 1TZZA 3GC2A 4A3QA 3W85A 4D6IA 3CAVA 4BQ4A 3SN4A 2E1WA 4Z1YA 1B9BA 2A85A 1V03A 2AAMA 3GC4A 3WLTA 4AMAA 2VX6A 2HWGA 2ZX6A 1GT8A 2WZMA 1J8VA 2NWSA 3R0DA 2AL2A 4N9BA 3TTYA 1XLDA 2QCFA 1HVQA 1P6WA 5GJNA 2W79A 1G01A 2XVKA 4LYPA 4L65A 4B9ZA 3TVAA 3G0UA 3M0JA 1R6WA 2XISA 4J3ZA 3FFSA 4LY8A 4DO5A 2OXNA 3QSRA 3VC5A 3LLFA 4NNCA 4NJHA 4TTUA 3BLPX 2R9RA 1XLGA 4GABA 4J3VA 1BEUA 2Z2UA 3FA3A 1LL4A 4PMNA 1UPPA 2XPKA 3U2OA 1HO4A 1JUKA 2IPFA 1W3TA 3B05A 3EYPA 1H11A 1PKLA 3W6YA 4FEZA 5G1MA 2V38A 4GWEA 4E2OA 3OVRA 1UBSA 3P93A 1YMYA 3CBWA 3FA4A 1YEYA 1XYMA 3BSMA 3RN6A 3WDJA 3WMSA 2XFRA 2OYMA 1E0VA 3FJ4A 5CCZA 4LWWA 4TMCA 3B40A 3I7RA 3UXLA 2PB1A 2VGGA 1FXPA 3MYPA 3GHRA 3WMBA 4WKFA 4B2DA 2DW6A 1KKRA 4FP1A 2WZEA 3ARTA 2FZDA 4GC3A 3GYCA 3BLOA 2HRWA 1IYXA 2FPYA 3WD3A 3FIGA 4L4PA 3GBEA 3CZ8A 3O63A 2Y6ZA 3AXMA 5AHNA 1BRLA 4JN7A 3H55A 1UKPA 1JVNA 1HO1A 2FYMA 1E6SM 4O19A 1REQA 3ABQA 1W1PA 1CGWA 3HPXA 4P7QA 4DJDC 3K1GA 3VYLA 1E3XA 4IQJA 1KTCA 2OZ0A 4X3ZA 3NYDA 5DRIA 5I07A 3W53A 5G4WA 3A9BA 2F84A 2GK1A 1UC4A 2W9MA 1H7RA 4LNYA 1C9WA 1RQBA 3AFBA 3T08A 1KFCA 1VH7A 1W1A1 1HKMA 3N15A 3EWZA 1T96A 3LTPA 5I0DA 1R7AA 2B7PA 3N4EA 3IRSA 1GQIA 2YX0A 1G4PA 2GDVA 1GJWA 1GZ1A 1I8JA 3UBPC 2A3BA 3B3DA 2PBOA 4X9YA 3T0BA 1FOBA 4XTDA 2ESCA 1XGZA 2FMOA 5EKYA 1QW9A 1W9UA 2A2IA 3LCHA 3TUUA 3V1PA 1DHPA 2CKSA 3AZSA 1Y5XA 4UOJA 2YXOA 1UZHA 1TYGA 2CZDA 1QU4A 1VCFA 5JQ9A 1JCYA 1IE7C 2QUMA 3RRAA 5C9ZA 3CPRA 4GO9A 4O15A 1FWDC 2F2HA 3EDKA 3W70A 2EO7A 3GNOA 4KIRA 4QDMA 4F0MA 2YBUA 4ZB0A 4US5D 3LN3A 4MUPA 3GK0A 5AC4A 3DGRA 5CG7A 1DJXA 1AQMA 4MB3A 4MDPA 3L5MA 3P7YA 2FKPA 3IRDA 1X97A 3NDZA 2VVSA 3CUJA 4H9ZA 3E2RA 2BGSA 4H9XA 1Q4NX 3ATYA 4LC6A 1ZJIA 3VIJA 5XINA 3ABOA 2CLPA 4E38A 3HPAA 3LD5A 4I5UA 4IGHA 2GDUA 2WBKA 4LALA 2OTDA 3LSCA 3EB3A 5LNRA 1TR1A 3FX4A 4QAIA 3TX9A 3JS3A 3NL3A 1EOMA 3DYMA 1ZJHA 3N2OA 3T40A 1RJPA 1R86A 1JRCA 3LI0A 4DZAA 5E5CA 4XAFA 5FJOA 4D1JA 4Q8UA 3WQ5A 4H9TA 3RILA 1V02E 4R85A 4AY7A 3DYPA 2V8ZA 5EMMA 3O0FA 3TFXA 3EA1A 1RD5A 3MU7A 2E8ZA 2VX4A 4MB5A 5MKGA 1DE5A 3RHGA 1FHLA 3TYEA 1P1XA 3W4RA 2W66A 3YPIA 3TW9A 3T4WA 5M03A 3T8QA 2QJGA 4GI6A 4PSRA 1PYFA 1XWYA 1AL7A 1EX5A 1HL9A 1XIIA 1TPVA 3QM3A 1SU5A 1T7LA 3KUMA 4H04A 3TC3A 3MI6A 1V8EA 3EX2A 4UIOA 1SSGA 1CENA 2INZA 8XIMA 1AVAA 1C7TA 3UJRA 1P7TB 2E7FA 4NZFA 1O95A 4H4IA 2GQ8A 1P0BA 2VWSA 2WVUA 1SPQA 1SZGA 4QE4A 1WBHA 4ADUA 1QDSA 3F2CA 3A21A 3TJLA 3V0TA 4H8HA 2WC4A 3BICA 2ZBTA 4OE7A 3KAOA 5B80A 5LGZA 4FB7A 4I7VA 4HSNA 5EPDA 3GE7A 3V4BA 1S46A 1H50A 1S1RA 4W7UA 2WANA 2DUXA 1FWWA 3LG3A 4CNNA 3V5CA 2DSVA 5D2XA 3A3XA 1EWDA 2QT3A 2PWUA 3P61A 3PWGA 3LPOA 1WX0A 1XIJA 1JXJA 4IM4A 3TYAA 5A6AA 4JIRA 4H41A 3VOGA 2DFAA 3QYSA 5AC6A 4HNOA 3WMLA 4DNHA 4O18A 1MNSA 1QOXA 2V3FA 2J4GA 4QG8A 4GACA 3NPXA 3NSMA 1VFOA 3WK3A 2GJPA 2NXIA 1W0MA 1K8YA 2GQ9A 5DFAA 5DEZA 5CH9A 3AHXA 1EDTA 4W84A 1PO9A 2PWEA 1GQNA 4KFNA 3FHQA 2P3ZA 3GDMA 3M0ZA 4H8NA 3WCZA 4GISA 1F4AA 3NPWA 4GZ7A 3RLHA 4QLJA 2WSYA 4IG2B 3RX3A 4GO8A 3UXIA 3WQOA 1E1EA 2VNCA 2YFOA 2GUUA 2Y7DA 5D9PA 1TV7A 3GKFA 5E0CA 3QPEA 2Z1BA 1PX3A 4UNLA 1BVNP 2I5GA 5HNUA 4YPJA 2XIQA 3LUTA 1JJKA 1PKMA 2XGZA 1GHRA 2VGIA 3NQVA 4TV5A 1QW7A 4U2ZA 5IM51 1I2OA 1AD1A 3EEGA 1C90A 4JKLA 4HK7A 2GVEA 5F7UA 4UB9A 5LA1A 4QLLA 3WN6A 4LANA 2NVAA 1EJUC 5T9BG 1TV8A 2AL1A 1DL3A 4MLJA 4KGLA 2ZC8A 3O9NA 5A8PA 2MANA 4C5ZA 1MMFA 1RPXA 2BMBA 3GZ3A 4YL2A 2D3LA 1UR8A 4A3YA 1YLVA 3DX5A 2PDIA 3MP5A 1F3WA 1FWNA 3HMCA 2D0GA 2VC7A 3KXQA 1K02A 2UY3A 3KWXA 1Q6QA 3BO9A 4AHPA 2FZ8A 2WMIB 1I75A 1F05A 5HMFA 3HMJG 3F4CA 3HN3A 4LAMA 2P8CA 3LDVA 5TBOA 3ZQ9A 1NAL1 1S5TA 1P5BA 3TN5A 3T0AA 3WQFA 1I4NA 4DBDA 2NUXA 3SURA 1ZAHA 5F4SA 4DF1A 1JUEA 1E70M 1GQJA 8CGTA 1E1FA 2ZUMA 4UZUA 2QMKA 1FUYA 1ZP3A 1T99A 3MUCA 4HPHA 2V2HA 3VM7A 2DPEA 3NL6A 1G94A 4AZCB 2V5BA 1C8XA 1OD8A 1E72M 1KM1A 4PODA 1TZ9A 2PODA 2PU1A 1M53A 3ITTA 2EPMX 1S2AA 4A2RA 3T78A 3S4TA 3TYCA 3E0VA 5A5WA 3CB3A 2FLIA 3NQ7A 1UZDA 4XO6A 5BOFA 3VD9A 4BY3A 3PZ9A 3ZO9A 3DFOA 4ZSTA 4S3FA 1UB3A 3PK7A 5C7VA 4WZHA 2X0YA 3KVJA 4LCRA 2WO5A 4GYPA 1L8PA 2PF8A 4DUWA 1E6ZA 2CYGA 2RGMA 4QE5A 1TPUA 3R13A 2CXEA 1CXHA 3AICA 1CZ1A 1KFLA 3R10A 2VOTA 1AH3A 2IUZA 4GX8A 1Q5MA 2LLEA 1LOSA 4PULA 1L6FA 2FFIA 4E2VA 4WDUA 1TPWA 3LCLA 3WK1A 2WSRA 3LPPA 3P6LA 1US3A 2ZZ4A 1S5VA 4JTFA 1OX5A 4HNLA 3M64A 3DCPA 2DH2A 1IEQA 3PJUA 3HIJA 1A5MC 1MRAA 1ITCA 3SECA 4H6RA 3L2LA 1Q3NA 3TE9A 3WQ8A 1WDRA 3SQMA 1E9LA 1MUMA 4FNUA 3W73A 2DVTA 4PBFA 4J3TA 3JR2A 1B4EA 3IARA 3VC6A 1XD1A 3CV1A 3G8RA 3SUSA 1U1UA 4FAMA 4DUOA 4XD4A 4K8HA 4NZJA 2I9UA 5IDZA 1GVSA 1F3TA 1WDPA 1ML1A 1JYWA 1H0IA 3CGTA 4UNKA 3S0CA 3AIRA 4ZTYA 4RZBA 3POCA 2BTMA 3ITYA 1OBAA 2YXGA 3OBKA 2WJZA 4KEUA 3KP0A 2YDQA 4Y9PA 4GD0A 1WKEA 2HE5A 4PMDA 4HK5A 4UWMA 3WLKX 1EP2A 5T8GA 2PSNA 2B4GA 3SCTA 3P74A 1IEIA 3PBUA 4XUGA 1MW1A 2PTWA 3KZSA 3ZMRA 1PEZA 2ALRA 2PGRA 4NP7A 1Z69A 4QQ3A 1YNYA 1DBTA 1EBGA 4IIEA 1HIZA 3UY8A 3J7HA 1WDQA 2YA1A 1A0CA 3DKLA 2E77A 4EVZA 4CQDA 5HR7A 1DJZA 2PDUA 1TE6A 3S9ZA 4K37A 5AYXA 3C8FA 1V02A 3H2FA 2CWXA 3JZUA 3RYSA 1ADDA 3BMXA 4W5ZA 4ADTA 6PTDA 3NQFA 4XZIA 4CCEA 4GCAA 3FN9A 4LYKA 2G3FA 3TR2A 2FDSA 4ORMA 2A7RA 4YTUA 2GLKA 1TIMA 5T26A 1F73A 3ITOA 3N11A 5HJYA 1S2WA 3K13A 2UZ9A 2Y2WA 4U33A 2RAGA 3KCLA 1JDFA 3TA6A 2G96A 4OWGA 3PS7A 1L2UA 2XU2A 3CZLA 3PFMA 4GZEA 2CBJA 1TWIA 3II1A 2REQB 2PP3A 8RUCA 2YA0A 1W1TA 2NZLA 2J75A 5IOBA 3H12A 1CCWB 4WSJA 3THUA 3N13A 4UQCA 1MQQA 1XIHA 3ZLGA 3S8HA 5CGMA 3QY8A 2XVNA 3P3BA 2XIBA 3NUKA 3IACA 2XVPA 5H91A 3V1HA 1AH4A 1FQ0A 3MKVA 3UA3A 1E4IA 2FTYA 4C7GA 3P0WA 3CU2A 2P3EA 5HJXA 3TJ4A 2PWGA 1GYMA 1GHSA 3AHZA 3EPOA 3MQTA 3TN6A 4DYEA 4WEVX 2C14A 2OR2A 3GRIA 3B4UA 3OZOA 3F5JA 4HTBA 3EOOA 4JTDA 5K3VA 3AXIA 5KETA 3LTYA 3NZQA 3UZZA 4PL1A 1JCNA 3EPNA 3S5NA 3GM8A 2XM2A 3C2VA 4H6QA 5AHLA 5GNZA 3W1QA 1CLXA 3AROA 4PZVA 4C6QA 1FWTA 7REQA 4AH7A 2CITA 1LRQA 2W67A 3APGA 3LV5A 4I8DA 3S83A 4IMGA 1K6WA 4FALA 4P7RA 3MTWA 3V3WA 3GG8A 4R33A 4JFTA 1KGUA 2OEJA 4DLMA 5E6ZA 3GXFA 2ZA3A 3ZZ1A 4MWAA 1VPQA 2GJRA 2ABAA 4JFVA 3L0KA 3PTKA 2ZUSA 2E5DA 2JKPA 1GTEA 5KMYA 3TTSA 4M82A 3MI2A 4IP7A 3K8LA 1Q7QA 5IHSA 4QJ1A 2FPTA 2QDGA 4V2XA 4JQ1A 3CUXA 1SFJA 2ISVA 3APTA 1JPDX 2AQWA 4GA8A 3W7MA 2GPTA 3LOTA 2AMXA 4EAMA 1TFVA 3O6CA 2R1KA 1VBRA 4Q8NA 3BV4A 3WUEA 2XGIA 1MXGA 4TMBA 2NUWA 2F8QA 3QC3A 1V93A 1RJQA 2A3LA 2YDSA 3CUGA 1XSKA 4LUYA 4POCA 5CPSA 4QNWA 3G3DA 4PMVA 1JCLA 5DN1A 5KTLA 3VIIA 1MDRA 3IGHX 5F2GA 4OKDA 4UFJA 1L8NA 2BBFA 3DBNA 2DQWA 1A5BA 4ERIA 3KLKA 2GJXA 2DZAA 2I57A 2HDJA 4FX7A 1UMLA 3W28A 4A22A 3DH7A 1GGOA 4ZVJA 1D2KA 4CD8A 2X1SA 4GXPA 3UCCA 5LNVA 1G4EA 2J66A 4PMZA 1N8FA 1F4HA 3E3HA 3TLQA 2DZWA 4MY1A 1BVZA 3HV8A 4JIPA 1YXYA 4WSKA 4O4VA 1XIEA 1QR7A 2GGHA 2QDHA 3RJYA 1DYSA 3TAKA 4DF0A 1V4YA 1F7BA 3KOYA 4K1WA 3USZA 4KPLA 4J1OA 4PUMA 3CQHA 2X09A 1NOFA 3SCSA 1JNEA 1V3KA 2J13A 4B3LA 4TUFA 1UR3M 3H22A 3E2VA 5XIMA 1AJ2A 3NQBA 4KQNA 1LORA 2VJXA 3UR7A 5I77A 4TX6A 2NW0A 4O12A 1DJIA 1G5AA 1RXOB 2JBMA 2O9PA 2A3HA 1FP9A 2Y88A 3TJIA 3M41A 2X05A 1E0UA 3RX2A 3LPFA 1H63A 4UCFA 3M5YA 4L9ZA 4N9CA 4DO4A 2Y1HA 2DDXA 3L4YA 3EOSA 2EPNA 4IUOA 4RNHA 3KW3A 4E0CA 5E9XA 4K8EA 1LTDA 1RLCL 1X39A 1XLLA 4FOKA 4RXGA 5CZTA 2DZXA 3EWUA 1PX8A 3TTQA 2OX4A 1FFQA 3L4XA 3LA4A 1PBGA 4AZGA 2V81A 3VE7A 1W5MA 5FL1A 2ZXQA 3VCRA 5HAOA 4NT0A 3DHFA 4YTRA 2C0AA 3W83A 1R9ZA 5JMUA 4MY9A 4US6A 1UBPC 1CLVA 1SMAA 3TU9A 2J78A 4UR7A 2WQPA 4O10A 3DOPA 3B0VC 3WQGA 5F4XA 1K4HA 3VTRA 1AW1A 3VM5A 3WNMA 4BWLC 1O7AA 1RR2A 3ZFHA 1X6UA 3GNXA 4ZBCA 1KR1A 3RPDA 1B31A 2RDWA 1W1IE 3S47A 5HUPA 4LAOA 4DRSA 3OVPA 1TV2A 1EYWA 5BU6A 2Y24A 4JKMA 1LYXA 3LGEA 3VIHA 3C0QA 5D2WA 2XVGA 1QNPA 3RM9A 2PDCA 3VOFA 1PTDA 1UR2A 1UWIA 1DHKA 4OOUA 5A6TC 3BJFA 1FWHC 3CZJA 4MGGA 1YPFA 2XZ9A 3GW0A 4DHGA 3TSBA 1ZHAA 1R8LA 3K1DA 2ZZ5A 3Q37A 3H54A 2FHFA 2BY1A 3LBOA 3VNMA 3VKJA 3TCSA 4MSSA 1E3ZA 1JDEA 3OA3A 4YYFA 3KCJA 1LT7A 3QSTA 2BLEA 4QJ5B 1VHCA 3RCMA 2WJEA 1B0IA 3C2YA 4AZ7A 2PRLA 3LQLA 2UV8G 1FWSA 3G24A 2GVGA 5JH1A 1UIPA 1RPKA 2IQ0A 1OSEA 3BQ6A 3ITGA 3S1WA 3HQPA 1GUVA 1KBBA 2V2DA 4DZ5A 1SSDA 1O5QA 1QNOA 3BANA 3LZ5A 5CQ1A 3RR1A 1QHOA 5TF0A 2V69A 5F1UA 1NDZA 2E5CA 3VXGA 2ISSA 2FVLA 1GQLA 3GU2A 1DWIM 4Z2JA 4P8WA 3LNMA 1QNSA 4J9JA 1M1BA 3WIJA 3BLLA 5I3KA 2CKRA 1X7FA 3IJLA 5I3FA 4UQDA 4PL2A 4OECA 1ADSA 4KRUA 1OM0A 2E09A 4B5NA 3PUOA 1DJGA 3W7CA 4Z1BA 4W8BA 4LBUA 3IAQA 2J9ZA 5HATA 4XWUA 2QR6A 4LUSB 3KDOA 3MJYA 2Q8ZA 1I2PA 2ZCGA 2ASHA 2NQJA 5AVHA 4EAYA 3IUIA 1TA3B 1S38A 1KFWA 1TJPA 4E4UA 3IGXA 5KZ6A 1D3GA 1WE5A 1CGXA 2VYOA 4FOUA 2XN2A 4ZFMA 3STFA 3Q4DA 2QCDA 1YHTA 2H3DA 3O1NA 4ICCX 3WFAA 4IL0A 3TKFA 2ZE0A 1A5CA 1SFLA 2D2HA 1V0MA 2H8XA 1WCGA 4IIFA 2A6LA 3QPZA 2DGAA 3TONA 3UR2A 5CPNA 5AYIA 5ABTA 3DZ1A 2V5CA 4RUBA 4LVGA 5CBBA 4J7RA 3VIKA 3PR2A 3BV7A 4M6QA 1AQ0A 3BSGA 3IJ8A 5FJIA 1E51A 4HOWA 3LMZA 2NUYA 3LEPA 2PRHA 1CT5A 1UWAA 4J3WA 4RZ4A 2VDIA 3MV11 3N2TA 1E9YB 1R46A 2E0PA 3EEZA 3IVSA 2ZUNA 1E5JA 1UPMB 3H8AA 5ABGA 4AC7C 4EACA 3EOUA 5HOSA 5CSSA 1JPKA 5AY7A 1MFVA 3C0LA 1W1B1 4ZSUA 3HO8A 4B91A 3L5LA 3F5LA 1RCOB 4RZ5A 1JZ8A 5GPRA 2J6VA 3V0UA 2V3GA 2RFGA 1DTNA 1EGZA 1XINA 2X2YA 1UR1A 1NWRA 1I2RA 2CETA 4LJ3A 3G3MA 5E6YA 3LXAA 3H23A 2Z1XA 3TZNA 3BGAA 2ISFA 2E67A 2ZUWA 2XVLA 4H9MA 1D3CA 4NAEA 3THAA 2Y89A 1H61A 1XH2A 2R1PA 4QG6A 2FGLA 3PP7A 1F5ZA 1TX0A 4GI9A 4Z2HA 1AK5A 1O1HA 1XG3A 3CAQA 2A7NA 3MO7A 5FKYA 4MHBA 3VOCA 2P1FA 3UPBA 5D37A 2PWHA 4DWSA 5K9DA 4AIOA 2ODOA 1IR2A 5BNKA 3MHGA 4MNLA 3S1UA 4NILA 4QQUA 4LV4A 4LXFA 1R2RA 3M5XA 4H9YA 2HSAA 1KFJA 4DF2A 3PZIA 2J7BA 1X96A 1KBIA 2V82A 4XVDA 5FL0A 3F2BA 1OG0A 4E5TA 3SADA 1JEZA 1VRDA 1TPC1 4S3GA 1FWIC 1O66A 5HA7A 5DXYA 5M1TA 1VPYA 4K39A 4ZO9A 2QEZA 3M46A 2YSWA 1Q7ZA 4MAVA 4AZBA 4BZYA 1O6IA 4HJFA 3UXDA 3R8HA 1M7OA 4K3ZA 3VD4A 1C8QA 2VZSA 1PPIA 3S5SA 2FJKA 4H7CA 1BXNA 5H8UA 3FYOA 2OQYA 3GU1A 3GXNA 3EXRA 2NXHA 3WY1A 2FVKA 3THQA 1UP0A 3OLEA 3VKBA 1QI5A 3TOYA 2CBUA 3AOFA 2IKJA 1UA3A 4Z2IA 4HP5A 3IV8A 4PSPA 3GDBA 6REQB 3EBVA 1EC7A 1K9TA 1V0KA 2PDMA 4F9JA 3H2CA 1OG6A 3AMKA 3WNLA 4QXIA 1LBFA 3OGVA 1QWGA 5HWMA 3TCEA 1U5JA 2WPBA 4HMEA 3HGJA 3UU0A 2F2KA 4ZE4A 1WKYA 1W9XA 3SM0A 4IUGA 3F4VA 4MUZA 1TTQA 2ZRZA 1UR0A 4X2PA 3VA8A 2XFFA 1GVQA 1AJZA 1K9FA 4WKAA 4WK9A 3LERA 2VGBA 4QDWA 5AHMA 1W56A 2VT0A 2WM0A 1JCXA 3B0UX 4PEKA 2XTKA 1S5NA 3LV6A 3CL6A 1EHAA 2CLFA 3AXKA 3VDCA 5DANA 1ZY9A 3KVLA 4GQ0A 3S2MA 4CU6A 4K6AA 2WMHA 2C19A 2XHYA 3JU2A 3URNA 3C5QA 3G18A 3B9DA 4DYKA 5BRPA 2J25A 3A47A 2BOFX 1QMLA 3OIXA 2Z29A 3LBCA 3W6MA 1GJPA 2XIJA 4FMVA 1S3HA 3MHFA 3TWAA 4X22A 4PEEA 3OYZA 1E0TA 3PZMA 5BCAA 1CBGA 4AD5A 2PZ0A 3RU8X 1KCLA 1GJUA 4M80A 4BI7A 1J0ZA 3R79A 3R89A 5LHEA 5ECUA 3FLUA 1VLWA 3V5FA 1QPRA 4C1LA 3D3FA 2WOQA 1JXKA 3W26A 3BMVA 1P48A 1O5RA 4J2PA 4Z17A 4ZQOA 4RE3A 3HV9A 4K7YA 5BZAA 4JFWA 4FR6A 1SZFA 4AX6A 2ISWA 2VCAA 1C7SA 3P60A 2OODA 3W7RA 4RE0A 4WDXA 4TX8A 2ZE3A 5HMDA 1SUXA 2F6XA 3NEVA 2WSPA 4GMEA 2H90A 1BTCA 1T6MA 3VNZA 1HJWA 4O4WA 5I3DA 2CZFA 3JVAA 2PDKA 3QR0A 4Z0JA 3DEQA 4XG1A 4NUWA 2XUCA 1SZRA 4TVDA 2YL5A 3VDBA 3AS0A 1XLAA 1XRSA 3FVDA 1U22A 1NFGA 3I7QA 3PB0A 4LYRA 3WDRA 2DVUA 4LPCA 4Q8VA 1YE4A 3QR1A 1V3MA 1SQ7A 2YCLB 3P5ZA 1NOUA 4LV9A 3CH9A 1OWQA 2Z6IA 4KWUA 3LI1A 5DXXA 2SFPA 3ITLA 4AVOA 2QLYA 1XR2A 3KBVA 1ZZMA 4KRZA 1UA7A 4W93A 1I9CB 5D2VA 4JIEA 1EJRC 1V7AA 2WMGA 1ZAJA 5CJMA 4HA0A 3GLCA 4JN6A 4IX2A 3W76A 1OQFA 5FESA 2G50A 2XFYA 4QG9A 1VBUA 1NOWA 4LQ1A 1XCWA 3RPMA 2XYLA 2XH7A 4OV9A 3R2GA 2FVMA 2F61A 3HG2A 2JE8A 5HQLA 3K8KA 1J2BA 3RDKA 2GL5A 3U3HA 5LIYX 4CQAA 3SCQA 1BF6A 5C8BB 3GDLA 1KD0A 3SUTA 2VR2A 2PS2A 4YWSA 3UW6A 5FF0A 1UD6A 4NRSA 1R2SA 4ACZA 1JGIA 3VUSA 3U9IA 1ELSA 2XFWA 4DJED 1F61A 3M1ZA 1BHGA 3VE9A 3LU2A 5IBXA 3IPWA 1ZRQA 1TJ0A 4AEEA 4C6MA 2QDDA 4JHOA 3EKLA 3W7EA 4C1KA 2NX3A 5BYWA 1XIBA 1GZJA 2Y8KA 3NAVA 1PV8A 2O7SA 2PLKA 1KB3A 3LXBA 4IGNA 3CT7A 3R25A 4JYEA 3MKKA 4A3UA 2VCCA 1CTNA 2FHBA 3Q65A 4EOUA 1E6RA 3UG3A 3TQPA 3T05A 2YLLA 1JD9A 2HE8A 3MWCA 1PWLA 3QH2A 4QEEA 3W29A 3WQWA 2PUZA 2POZA 1TMHA 5C2CA 1TPH1 1UKSA 4UTWC 4FK9A 3KOXA 4REQA 3BLIA 4DZHA 4GQQA 2GJLA 4NJKA 4RW5A 1YXDA 1S3TC 2VC5A 4JTAA 2GDQA 3AIBA 1S2VA 3L0GA 1QBAA 1FCUA 3LM7A 3UZYA 1SYTA 4B5WA 1Q66A 3EXSA 4LTSA 1EFZA 1Z41A 1U1JA 5H6HA 3N3MA 5DMNA 5LA0A 1DJYA 1EF2A 5A95A 5I6SA 3NQDA 3SCPA 2I16A 2RUSA 1SMDA 1GOMA 4HPNA 4F8XA 4GIEA 1W3KA 4NI8A 4RE2A 5REQA 3AIQA 1CPUA 2QJNA 4XKYB 4HMDA 3P80A 2F6UA 1H51A 1OX6A 2G0WA 4LT9A 3WH8A 1ME8A 1U1HA 3QGVA 5HANA 2V5LA 5IFTA 4O14A 1DWAM 2Y8VA 3AI0A 1E9ZB 3VNYA 3BZJA 3VFLA 1A49A 1GEHA 2DZSA 4LEQA 5EMJA 3T4CA 5D05A 4B92A 1FHVA 1LDCA 2X0HA 2XIIA 3FYYA 4R9XA 4M3PA 2W4XA 1OC7A 3IJ7A 3MUY1 1W54A 3R6IA 2BY3A 1A3XA 2CFFA 2IQDA 3LK6A 4IH3A 1W32A 3MDWA 1Y8BA 2Z1KA 1F8IA 2PFHA 3OG3A 1W37A 3W1RA 5HNTA 1F6KA 2J77A 3CIVA 3NEHA 3M9YA 1OX4B 1Q6DA 2ACUA 1PZ3A 1GONA 1KM4A 4QX4A 1EB3A 1C93A 2J62A 2HV5A 2ZZ6A 4H83A 1IQ8A 3ZT7A 2PWFA 1UOZA 3V16A 2BHUA 1US2A 1GOQA 4ASTA 2HISA 2X7VA 2BASA 4WJ8A 3QYQA 5CAKA 3BGJA 4B5TA 1HF6A 4QTGA 3PZVA 1F9CA 3UR5A 2QULA 3U48A 2JFEX 3XIMA 1RBLA 5D38A 5M17A 1MQRA 2B31A 2C1HA 1XRTA 3FDKA 3UNDA 3HQOA 3QMRA 4AHQA 4N42A 2VZTA 4UR9A 5EFDA 3W7OA 3CHFA 1QXLA 4RCXA 1WYIA 1CECA 2ZWZA 1NH6A 1TWSA 3ARPA 4LCQA 4N7QA 2DSKA 2ZWYA 1DJQA 3LHTA 4IF2A 3WL0A 3CQKA 1A3WA 1YDVA 2FTPA 3FW6A 3PBMA 1XLFA 2VC6A 1KBJA 4Q4KA 4UMCA 3B8DA 4DXXA 3OVGA 4QHRA 2DIKA 1EJVC 2BY0A 3W00A 1U5VA 1V77A 1SR9A 5LNSA 3FK4A 2PWDA 4O1DA 3WJXA 1PDYA 2A3AA 2PLCA 3TH6A 3AXXA 4U31A 2B81A 3OW1A 4RJEA 1D8CA 3ZJ6A 1O5XA 4XK2A 2EKCA 1FHDA 1RLDA 4FPSA 4QLKA 3WLNA 3I4KA 4XBJA 1XH1A 3WNOA 1EIXA 4FLSA 4XAGA 4I9TA 1V6TA 3HPFA 1H60A 3QLDA 1J96A 1LWHA 3UZ5A 3GTNA 3NQGA 4TU1A 3L12A 2P8BA 4LYQA 1QO2A 3RU6A 1VFTA 2OZ3A 3QKZA 2GZXA 5E0FA 7CGTA 4ICNA 3MA8A 1JFXA 4KH2A 4DBUA 3QZEA 2FGZA 1GW9A 2OELA 1VENA 2QAFA 2ISDA 1L2QA 1F6YA 2WNZA 4UMAA 1J5TA 5CZJA 1CXLA 2NWRA 3A24A 2ZZ2A 4B4HA 1JYNA 1JF5A 3H6OA 1VPXA 2W91A 2VMFA 3E5PA 3P84A 4DO7A 4NX5A 2X1UA 4OJYA 3PJWA 4KCUA 3VGBA 1B4KA 4PRWA 2V0TA 3DHDA 3RMEA 1LWJA 1UP3A 3F4WA 3N12A 1HL2A 5D2TA 3NG3A 4QE1A 3RX4A 1J11A 2VEMA 2PAJA 3OEXA 3D47A 4QR6A 2RJHA 1W5OA 3E38A 3TQVA 3UY7A 2J27A 1OYAA 4C6NA 1ZB5A 2VEGA 3DIPA 2O55A 4YN5A 2X40A 4LBSA 1XQKA 4M8UA 4R88A 3SRFA 3C6CA 1J10A 5FEWA 3QBUA 1J79A 5BU9A 2A3CA 4G6CA 4HU4A 2BG5A 3CIWA 4KCVA 5FF4A 3SUUA 1RCXB 2CZVA 4D1IA 1V3IA 2OGJA 4MJMA 1VB9A 1SW7A 3BOFA 5FF7A 5EA9A 2EPOA 3NPVA 4S39A 4NNBA 1NFBA 3U2ZA 2PDYA 4PMYA 2NQZA 4PH6A 1Z42A 1I2QA 4XD3A 1P6BA 1TTJA 6XIAA 3U5UA 1FA2A 4A29A 3WYZA 1H7NA 1I60A 3O07A 4L4MA 4MJ4A 1YADA 3VNLA 5BMWA 2PTXA 3BDKA 1G7VA 4RPQA 3PAJA 1GG0A 3W23A 1VEOA 3GAKA 1F76A 2A5HA 4MZ8A 2DY3A 1US0A 4DWDA 3KBNA 1A80A 3UPMA 1GVRA 4O57A 3BZGA 2C6QA 4L4LA 1IR1A 4H3DA 1MEWA 2Z00A 4IPJA 5HMEA 1MZRA 3WLMA 1PSCA 2HXTA 4UTTA 4I9AA 2DZUA 4UTKA 1S39A 2PDXA 4V27A 4YYCA 2OLSA 1A50A 2PEVA 3NURA 3NVDA 1UH3A 1GVEA 3B8UA 1IWBA 3FAWA 1FWAC 4G8TA 2CC0A 4JN8A 4WJXA 1QAPA 4NZ4A 1QJWA 1GYNA 3G1DA 3BARA 4TV6A 1W1VA 5KZMA 2QGHA 1T5AA 4ML4A 1FWCC 1YIXA 2AKZA 3CMGA 2DZVA 5D8ZA 5DY2A 4DY1A 3TIMA 1QNRA 4ZO7A 4MPQA 4MNJA 4O50A 3Q94A 1VR6A 3B0XA 4JQ2A 2OWCA 2YZ5A 3M0IA 1BAGA 4I8YA 4V1YA 4H2CA 4AZ6A 3CO8A 1LUCA 5TAOA 3NQ2A 4KBXA 2UY5A 2GSEA 1E4MM 4LF1A 1G4TA 4Y9AA 2X41A 4CEXC 1TWZA 3IANA 4KWOA 5CSRA 1K7XA 3UZWA 4Q6JA 1TWWA 3G0XA 4KCTA 3WK2A 2BFGA 3BSHA 1V0NA 4J3XA 3PZOA 4B2DD 1N8IA 2WW5A 3EGJA 5U7SA 3NOEA 4RLIA 1OZMA 3VIPA 3QR3A 4IFRA 4DI9A 1OYBA 4JIIX 2TRSA 2YR1A 4V28A 1H7XA 4DJEC 5DCDA 1TTPA 2ADAA 1EL3A 2VKZG 1EQCA 4L5ZA 1TG7A 4JHMA 1YNPA 3OJGA 1ICSA 4M6PA 1AMYA 5HR6A 4IMAA 3BURA 2D2GA 1FX6A 2WKGA 4IICA 1JDCA 4C1NB 3HPZA 5F1VA 3SRKA 3VKCA 1ADOA 1KM5A 1VF8A 4LUIA 4GJIA 4DVOA 2P50A 2CZ5A 2V3EA 3WZ0E 1QK2A 3IIOA 4RDWA 2AOSA 2BZNA 4JTQA 3VOIA 3ARZA 4WY0B 3R94A 2WZIA 4UUIA 4UTLA 1O68A 4CD7A 4HA1A 5I24A 3O0KA 4TTGA 4G5DA 3FSUA 1CLKA 3TYBA 1C3FA 5FSEC 4BF7A 3CYJA 3QV8A 4JTCA 1E0XA 3TN4A 3AQUA 3GNRA 4C6JA 1TMLA 4PTNA 4TIMA 2ZRYA 1CEOA 2BODX 1UKTA 4QJ3B 4HZ8A 4ILSA 2QHAA 5I3GA 3LYEA 5ABFB 1T8XA 2CEQA 4NAFA 4CNOA 3SUWA 3URAA 3U5YA 4HNTA 2ALDA 3NDOA 3N34A 2EJAA 5FJRA 4YLWA 3S6OA 2E6YA 5EB8A 2VDGA 3RGTA 2WM1A 4ZB5A 2GOUA 2O4QA 1HTIA 4K7VA 3W74A 3UESA 3QOKA 4XD5A 4Q8QA 3NYZA 5A3HA 5AYBA 4AFYA 3UD6A 1KFKA 3FEQA 3UR8A 4HA3A 1JCTA 1OIMA 1W5QA 1LG2A 3DN5A 4XISA 1IZKA 3NXFA 5FJUA 4IJCA 3L4WA 4N6EA 3N6JA 3KFTA 6ENLA 4D6GA 4U5IA 4H01A 3FGCA 4OGZA 2QJMA 1Y65A 5FEPA 1GPFA 2GQ3A 2DSUA 3LHZA 1W3LA 3GVGA 1DWFM 2XN0A 1J0HA 4D9PA 3N25A 5I3IA 4NIRA 3I4EA 4HHHA 3HURA 1JR1A 1CXFA 1JNDA 3A5FA 4BKNA 1WAWA 4I9MA 2Z7KA 1EUNA 5M3WA 2E9LA 4AY1A 4N9EA 3AWNA 1XJBA 1XGEA 3T8LA 2O9OA 4HKPA 4A4AA 3GHTA 5FACA 4QNEA 1XLCA 3U2CA 3G1SA 3ZR4A 1VD6A 2FQIA 4WR3A 1KLZA 4Y6GA 5A6SA 1ONXA 1FH8A 5CPTA 5I2UA 2G3MA 3SCUA 3RNDA 3MVIA 3CLWA 1KCKA 2GJNA 2R24A 2WVSA 3L2IA 1JAKA 3SBFA 2W5FA 4HZ7A 2ZFAA 1ZJAA 1QRQA 2H9AA 4D8LA 4YVVA 2VFDA 3M0MA 2J8FA 3KTXA 3NOYA 1K8CA 1TQXA 2JGYA 3HQNA 4HZMA 2BX7A 1AUSL 3GVWA 5SWUA 3B0YA 1JZ7A 4HGXA 4PYSA 2ONEA 2EG6A 4ZFCA 5EBUA 2OYLA 3NVTA 4JEQA 2DH3A 4GUFA 2HQAA 3IWPA 3RLGA 4UQ9A 5LXXA 3PPGA 4OUEA 1CB7B 4AWEA 3BL3A 4MTVA 2QDEA 5BWFA 2VZOA 1RY8A 3IUDA 3ZWSA 3VGDA 1CXEA 1R0MA 4PUKA 1VYRA 5C7HA 5C70A 4ZQRA 4UMBA 1E1CA 3MSYA 4MJ2A 3RRXA 3HG3A 3NZRA 2OB3A 1NY1A 2Y5JA 5F2MA 4YMZA 3GO2A 2OQHA 5HWNA 3CEPA 1BQGA 1K9EA 5LA2A 4GFIA 4XBSA 3DBPA 4NJGA 1VFHA 3SB0A 1G0CA 3DAQA 2VD8A 4GGBA 1B1YA 3SGZA 3ABRA 4UR8A 4K38A 3P14A 3DI0A 1D8WA 1RCQA 1T40A 1OFEA 4HNCA 2Q3OA 1WV2A 7PTDA 3UF9A 3EDFA 3E49A 3DESA 1XRFA 5KZDA 4JTGA 2CLMA 3H70A 3R58A 1E6XM 2V5DA 3NL2A 1XDJA 4IQEA 5HNRA 4WIWA 3DGBA 4C7DA 5J5DA 4JS3A 2YA2A 4PMJA 1XYLA 4XKMA 2QCMA 1C91A 4G7EB 4O11A 3C0JA 3T09A 3M44A 3GHUA 1YX1A 4WRHA 3CO4A 2WKJA 4JEJA 1TUXA 3WF2A 1GVFA 5BXPA 2IS7A 2D73A 3NCOA 4Y8EA 4KCWA 1LRNA 1J2WA 4INFA 3VCNA 2YDRA 3IJ6A 2XSBA 1V6VA 3REQB 1Q65A 1W5NA 1ZQ5A 6A3HA 2QVNA 3MUZ1 1HG3A 2PDHA 1B54A 1PJ9A 4LUTA 1QPKA 1VCGA 4NYYA 2R8WA 1EOKA 1VP5A 1LROA 4BCEA 3KBSA 1C9DA 2YCJA 2R91A 3M0LA 3M5ZA 3ZM8A 2QQ6A 3PNUA 3OLIA 1A5AA 1R3QA 1HT6A 3K30A 4X2RA 2QPSA 4UTHA 1UWQA 5KEZA 5HINA 4XIMA 2ATSA 1SO3A 1EJ7L 4H19A 2BOEX 3CV6A 3GR7A 3NA8A 3GXDA 4ZEPA 4ZE5A 3GWQA 3PM6A 3G6LA 2QZRA 3VAVA 3M7SA 1PHQA 3IIZA 3SCWA 4RNFA 2NQ9A 4UQBA 3MT1A 4MZ1A 5C2XA 2JK2A 3FJNA 2PGEA 2G5WA 3L66A 5AHIA 5CKSA 2OSWA 3PTDA 3FXYA 2ZVIA 1JQVA 1V08A 3W71A 1LLZA 1C92A 2HK0A 3OOQA 4FNQA 3AUJA 1W1ZA 3PBGA 1RJRA 1GOOA 1QT1A 4E4FA 2R14A 1BYCA 4J3UA 3VZXA 3CC1A 1H1YA 1MRQA 3RLVA 3I3DA 3V36A 2JALA 2PDPA 4HA4A 1X8FA 4Q7NA 3QZAA 2X42A 5AC7A 4UOQA 1VBGA 4KEZA 3KL5A 3LGGA 3WQDA 3H2NA 5H8PA 1M6JA 3GS6A 5K4ZA 5J5RA 4PN2A 3QQWA 1EO5A 5CC5A 3BH4A 1SR0A 5RUBA 4RDZA 1NIUA 5GVJA 2QJJA 1B2YA 2WMKA 1OF6A 4HT3A 2RDTA 4FOJA 1GQKA 4NXKA 4C6PA 4YTTA 2J88A 1R85A 2P76A 3AWOA 3F5KA 5FAJA 4PGLA 1XLIA 1R3SA 4U5KA 3MCOA 1XC6A 2GOKA 1QUMA 4LW7A 4DLFA 2A0NA 1UZ4A 3CJPA 4WXYA 3HQ1A 3NSNA 4FX8A 5C2GA 3QRHA 4D2JA 3OLGA 4H00A 3M43A 4IX0A 4LY4A 2Z1SA 4IFKA 2POTA 3QTPA 2G95A 3W27A 2OOFA 5AVNA 5HULA 2NQHA 3NNTA 2NX9A 1N55A 3VGFA 1AD4A 5D30A 2C7FA 1ITQA 5D9OA 1ISZA 1KKOA 1DQWA 1O4UA 3VNJA 2PZNA 4U10A 2JGQA 4FR1A 1TWDA 3NO5A 5LIUX 4CQBA 3GNDA 5AZ1A 5BOEA 1EEPA 4BF5A 4H7VA 3SW6A 2Y7FA 4WF7A 4P2VA 4GUGA 4WX2A 2NSXA 3ZYZA 4CU8A 4S3CA 1NVMA 2VD9A 3ZS4A 3W2KA 2QCHA 1WPCA 1R38A 3WJWA 2HZGA 4QFUA 1J6PA 1WXZA 4AWTA 2X1RA 3THCA 3VINA 1A3HA 3IJIA 1R9XA 3C2EA 4U4MA 2QF8A 5I23A 3CLMA 5C0QA 2PC8A 2R6OA 1X98A 1XM3A 3CUFA 4HSOA 3SCNA 1ZLPA 3WD4A 4L1XA 8XIAA 4ZTXA 1UC5A 1EA0A 1FDZA 2VOMA 3I3BA 4AF0B 1M03A 2VM8A 1YBQB 2A1YA 5A8OA 4XAYA 3ARUA 4GPNA 4UFKA 4TVUA 3PZGA 1EZWA 3I65A 3ALFA 3NQCA 4BK9A 2OLHA 4FS9A 4PUNA 4I5XA 1IIHA 1QPNA 4KRTA 4W89A 3ALGA 1M9HA 1YNQA 3C3NA 1KO0A 1XH0A 1Q6GA 4EP8C 4DBWA 1TV5A 4YS1A 5EY5A 3CZGA 3T6CA 2EHHA 3V75A 3A13A 3G1XA 3C2FA 1ME7A 3U4FA 2G4JA 3P81A 3PWAA 3ZXWA 2JF7A 3TWBA 1V6YA 2NVDA 1ZAIA 3NZGA 2V6AA 2YYUA 3SDOA 1A53A 4EPBC 1XHGA 1JQXA 3ATZA 4IISA 3OQEA 2Q01A 3W37A 1A0EA 1TPB1 4GI8A 1JCMP 3A6OA 1YQ2A 3KL0A 4AU0A 1TIWA 3A23A 1A5SA 1PXGA 2C91A 2NT0A 1K9DA 2QV4A 3GFYA 1Z32X 4O13A 3W1PA 4A3HA 3VDHA 1K6AA 4AW7A 4DIAA 4AVFA 3HGSA 3P67A 2J7FA 2VTFA 4PUJA 4W9TA 3ID7A 1N7KA 3N2XA 1EJXC 5H2ZA 4EKJA 1BTMA 2HVMA 5ABFA 1F3EA 3OQ8A 4MNKA 3I6RA 1NEYA 3GDRA 2J6XA 3VO0A 3IV3A 4EXQA 1XBVA 5LSMA 2AL2B 3ZWTA 3DFSA 4ZCWA 1BD0A 1FCBA 3EB4A 2QPUA 1EX1A 4MWAD 4GXMA 1J0KA 4F3HA 3ARVA 1M68A 5GNYA 1BKHA 4BQ5A 3BCJA 3Q45A 3E74A 3WENA 1ZCOA 3R12A 3TC7A 1MXSA 2HEJA 2DT0A 4QIUA 3L67A 3WLPA 3OU8A 1UZ1A 2L5HA 1TRDA 3G1FA 3B9AA 4I90A 4MWAE 1MEHA 2QW5A 3BAXA 3NSXA 4CQCA 4LS1A 8A3HA 3ZVHA 2BVWA 1AL8A 5I3HA 2QVHA 3BK0A 5CC6A 1OCJA 2VGFA 4IIHA 3ES7A 3SY1A 1KCXA 4EPEC 1SFSA 3BG3A 4F48A 1GOWA 4B4FA 2F6KA 2IXUA 1OIFA 1S2CA 1XISA 1X1NA 5C9UA 5CJ5A 4F0LA 3DFQA 4GZIA 3CV7A 3ITVA 1NELA 3PC0A 2OQLA 3V0SA 1CX9A 2DUAA 1NF0A 3PSVA 4JQ4A 5LXEA 2KX9A 1P0DA 2Z2BA 1LLOA 4W7WA 3HG5A 2WWCA 4AX7A 2HBVA 2ZDRA 1VFUA 3BAJA 3WQ4A 1VFFA 5A2BA 3W88A 1IT0A 3BLDA 1BRLB 4D6CA 1PZ2A 2WNNA 3KOZA 4Y2WA 3UT0A 4DI8A 1QI0A 4MG4A 2O4MA 4IIGA 3MCNA 3UXAA 9XIAA 1EJTC 3I10A 3TJXA 2YLAA 3RJXA 3MVTA 4QGCA 4GQRA 3UGVA 4PUUA 1BGAA 2CESA 1OFQA 2GK1B 1HQTA 1N2VA 1GORA 4GJJA 2PDJA 1XP3A 1BWKA 2E68A 2WPGA 3HJZA 4OHQA 1DEDA 3C2RA 2G3JA 4XB3A 1JPIA 1R7OA 4ZA0A 4ZOAA 3W38A 3A3HA 3ANVA 2QYGA 3UGRA 1KRAC 4UFMA 5T9CE 4FXRA 2EPHA 4LRTA 4M7TA 2HBXA 3N2CA 4M0XA 1VEMA 2BS9A 1HXJA 2QNEA 4IOTA 3TN3A 3L68A 2WYSA 3W1NA 2DORA 2GVLA 1VRXA 2E8YA 4JHZA 4S3BA 3KL3A 3QQ1A 2VX7A 3WUGA 3KOFA 3GNPA 1OK6A 2CCRA 4H6EA 2PP1A 3STEA 3AU6A 1LLWA 3UJSA 2DP3A 4OZOA 4D6EA 1EH9A 3Q2DA 3WNNA 2X2GA 4PFHA 4WHBA 3AIUA 3UWWA 3DG3A 4G1KA 5A8QA 2PTDA 1WP6A 4JR5A 2VRJA 4H9UA 3MUAA 4JTUA 1GKRA 4B3ZA 3CXOA 3F4DA 2XWEA 4P61A 3V35A 1KM6A 3TNBA 4L1WA 1JZ6A 2FH8A 3EA2A 3VFCA 4W8LA 2JIEA 3H4WA 2OT1A 2I5IA 4JFUA 4RNIA 1XBYA 3NQAA 5EL1A 3BAIA 4GNVA 3H26A 1BXCA 4BJHA 2DUZA 4HPXA 3B9OA 1HX0A 2IPJA 4FSAA 1DKWA 4PMRA 1SW3A 3G1AA 1O1ZA 2A21A 3TYUA 1ZSXA 4HVXA 1VIWA 3SN1A 4GYJA 1VS1A 2E6DA 3IJ9A 4HU8A 3CM4A 1I0BA 4DO6A 1Z48A 5CC3A 5EMUA 4JTLA 3TYZA 5MKGB 2BGNE 3AZRA 3GIYA 3QV6A 5BOOA 2XN1A 4GYPC 3MCMA 2OMAA 4U28A 1F74A 1NM9A 1XD0A 4JTSA 5I00A 4XZ9A 3KHDA 1D3HA 4I7WA 1OFOA 1M65A 3VZZA 1EHNA 1J0JA 1HKKA 4N2YA 1VCVA 2OSXA 1K7FA 3ANYA 3RO6A 2IKIA 3QY6A 3IVUA 2B0MA 1L6WA 5KINA 5EGRA 1XC4A 5C6MA 1E43A 1EC9A 1W6TA 4XZLX 3UZXA 1NTHA 2YL6A 4KESA 5DLCA 2QGYA 3S2NA 5HWJA 5FF2A 1HGYA 1JUBA 4K8GA 3R43A 4MYXA 5TD4A 2EQDA 3GIPA 3G1HA 1QPQA 4KMQA 1TPDA 3H24A 2C3ZA 4HHPA 2CHNA 3D5HA 1J9YA 4LFYA 1ZPTA 1UH4A 1XIMA 4F9DA 4GNJA 1M5WA 1E55A 1W9BM 4LS2A 1WZMA 4DM1A 1UD4A 1TVLA 3NQMA 1IZJA 4F0HA 2OZ8A 5BXRA 2ZXBA 1R87A 3K8MA 1ZL1A 4R7JA 1RSCA 4AQLA 1JULA 1FY6A 4M24A 4FZIA 3INPA 3WSUA 1PVNA 4CKQA 3OZMA 1GVOA 4N9DA 3WLRA 1S2UA 3A4XA 1GKQA 1WOAA 3N2BA 3VMNA 1VZWA 3WMCA 4ZR8A 4ZGYA 4NZ5A 3DG6A 3HG4A 1DWHM 5BXTA 3XISA 4PB3A 4HU3A 2XDFA 4PUDA 3E0IA 2YCIX 1QNQA 3LS9A 2C8NA 3GH7A 5ABEA 1HZYA 4S3DA 3RCNA 5PTDA 3K4AA 4OIFA 5AC8A 2R1LA 5CG0A 3NO1A 3GVVA 5M5DA 3GSMA 3QV7A 1FWRA 2GSHA 1H49A 3OGSA 3R0UA 4GYFA 2CU0A 3GNNA 3R1ZA 4A35A 3VNIA 2BXVA 1OADA 4CNUA 2DZBA 3RR4A 1KQYA 4AYGA 1ZENA 1YTEA 2YPIA 3GDKA 3PBYA 3W7LA 1EXBA 4ECLA 3MMWA 1BG4A 3VKDA 3M6DA 1EXPA 3WNKA 1Q6RA 4IHCA 3WBXA 4A3RA 4E2DA 3N4AA 4WJEA 1Q6EA 2GGIA 4MZYA 2UBPC 3ABSA 4HU0A 4Y9OA 2VDHA 1W5PA 3S2JA 3KCOA 3DXIA 1PL9A 3WLLA 1MW2A 1AMKA 3PJTA 3BCFA 5AN7A 3AIVA 3VKAA 4XSLA 5I02A 1OGGA 3BW3A 3BGGA 2R1NA 3GH4A 1FWEC 3EMQA 7ENLA 1A5NC 1CIUA 1ISYA 4K36A 1O94A 2V5KA 5J8LA 1XYBA 1R5YA 3SCVA 4H9VA 4UXDA 4O28A 3CMJA 2HPMA 3P62A 3BUVA 1XUZA 1FVPA 3AIEA 2DW7A 2ZX5A 2HK1A 1GTHA 1C8YA 1OK4A 1ZBCA 2GQAA 1FFRA 2H6RA 4DWSD 2Q8LA 4I9JA 2HVOA 1NU5A 2FGBA 2QPXA 5FJTA 1XBXA 3VIFA 1A5UA 1SO5A 4BQ2A 1NWTA 2E9BA 2INFA 4DX3A 3EX3A 4GQBA 3N9RA 3H2MA 3U6WA 3NWRA 2HVNA 4OTKA 4DAFA 2JEQA 3UWUA 3VX0A 1BGGA 1LL7A 2J7CA 3ZSSA 1POKA 5G1YA 2PC4A 2V68A 3AUOA 1E15A 1UUQA 4EWND 3NQ6A 1GW1A 1EUAA 4MNMA 4M6VA 3S46A 2I14A 4H6KA 2BDQA 1A5LC 1FP8A 4MWAC 4AISA 1WUFA 4UTFA 3CHDA 4IQLA 3UETA 3WO8A 1Z8AA 4NZ3A 4ERAA 3VIMA 4ROPA 4EWJA 5K2ZA 4FI4A 4L61A 2O92A 2VR4A 4JYDA 4BEQA 3IIXA 3NTYA 4TX9A 2CBVA 1A4MA 2XZ7A 8TIMA 2MNRA 1V3LA 4GCXA 1W3JA 4G9PA 3S6DA 4KWVA 4FIRA 2VFIA 4NJIA 3PHAA 3W7NA 1MWOA 1LL6A 3VDAA 4AD1A 3CWHA 3ONBA 1CGYA 4RXFA 1P7TA 1WZAA 4MADA 2CNCA 4WVXA 1XIDA 1IV8A 5I5RA 5U4NA 2I7GA 2VO5A 3W7JA 3W24A 1ODUA 3O6YX 1BG9A 3DU0A 4NHVA 4XO7A 1U83A 3MPGA 3QY7A 1HL8A 1EPXA 3LX9A 4Y96A 1Q4WA 2OPJA 3W7PA 1EDGA 1V3HA 5EYWA 3E5BA 2XSAA 4AXNA 3BJTA 3BVJA 4MLRA 3BAYA 1H5YA 4XIAA 5G5IA 1QCWA 2WAGA 4MKNA 3MHUA 3CTTA 1MW3A 2C18A 1H62A 3EWCA 4WY0F 5I09A 2E28A 4RV8A 1XDLA 1BPLB 3TAOA 4G1NA 1LRTA 1CXKA 3B8IA 5CEWA 2WK2A 3GG0A 1GNXA 4Q6XA 4Y90A 2Z1VA 1PKYA 2WZTA 3BMWA 2DV0A 3B8VA 1W91A 1WAUA 2VVNA 2C79A 3WDHA 3RF9A 3VOJA 5DBTA 4ZOEA 3OTRA 5D09A 2XM1A 4RZ6A 3M7WA 3AHYA 3STCA 3V7PA 3EPMA 4KWSA 3UWYA 3BLFA 2A4AA 3ES8A 4ZO6A 4M6UA 2Z26A 3NM3A 2JQXA 4GIAA 4A8NA 4FA3A 1V6UA 5A2CA 1YTKA 2B7OA 1BYAA 3EMCA 4DJDA 3B0PA 4QP0A 4IG2A 4BI5A 3WH9A 4ZL1A 2EPKX 4NG3A 3W07A 4EX4A 3GUGA 1JF6A 1ZBVA 3QHOA 4I5RA 4E8CA 3WNPA 3BTNA 2NV9A 3W7GA 4JDBA 1VC4A 3ONCA 1OFDA 2D0FA 2JIWA 2AAAA 3T9PA 1KC7A 1UH2A 1KR0A 4P7NA 5JH2A 2PP0A 2WCGA 4AIEA 3NGJA 4J4KA 2BVYA 1Q2SA 4A8LA 3AZTA 2D69A 4PCFA 1IEXA 1Q8JA 3CQIA 5A1AA 3WJZA 1RP8A 4DM2A 3AHVA 4KT2A 4EE9A 3CUZA 1KFEA 3LRMA 4WDWA 1K77A 1RHCA 1TQJA 5E1QA 2XIMA 1KA9F 3G5EA 4UTMA 3MANA 1GG1A 5E9AA 5CSUA 1EGMA 3THDA 1K8ZA 2AMGA 3GG7A 1PX4A 4Q4PA 4JY9A 4QCFA 2C15A 3L4UA 4IIDA 1ZS2A 4KWWA 5I78A 3LCFA 3MSGA 3L4TA 1IT8A 1GK8A 3RITA 1J93A 4FNRA 1UYQA 4PTMA 4YU1A 4O1AA 2WMIA 3MMDA 5AB3A 3ARXA 1WQ5A 1CYGA 3FVMA 2I17A 3IGSA 1GVIA 2CIPA 2WJDA 1MFUA 3S3GA 4PMUA 2YDAA 4NRRA 3AYVA 1PZ0A 1JCJA 1MW0A 1H7WA 2HROA 4HZ6A 3DECA 3EKGA 1TREA 3HA1A 4XBKA 2OYKA 4CNSA 4O54A 1YE6A 4L4OA 4Z0SA 2C13A 3W1TA 1KBLA 3GFXA 3FHAA 1GOIA 1QPOA 1TB3A 1TO3A 4ZXLA 3RO8A 5EFFA 1Y5WA 4L6DA 4Q4QA 5FAGA 4EK7A 4AZCA 4OUIA 2CZEA 3N1AA 1BXBA 4KIEA 5A6KA 4GE8A 1TCDA 4WCJA 3ARSA 1H1ZA 2ZOXA 7REQB 2NLYA 3NL5A 1F07A 4ERGA 5E09A 1B3YA 3VD7A 1RVGA 1HJUA 2DSZA 1FWGC 3KM8A 4QROA 4UTUA 2NV1A 4TXEA 3WJSA 2X7WA 3L0NA 3PANA 4X0VA 3WQEA 1BYBA 2RH9A 4MWAB 3QMTA 1Q85A 4HJWA 3R8GA 2WMFA 3EDDA 4HYWA 4CN6A 4NU7A 4F4RA 4E3TA 2V67A 1BF2A 3EX4A 4NYUA 1P0KA 3ABXA 3QJAA 4YWIA 2FJUB 1ENUA 4Z42C 4YNGA 3IS4A 4GOAA 1IWAA 3GVRA 3RLUA 3A5VA 2XGBA 1SJBA 3H53A 3WQPA 3ISIX 4D8ZA 4BA0A 4LVDA 3A4AA 1JZ4A 5BMXA 4QISA 4J27A 4RNJA 5A6MA 3PWIA 3SR7A 1OT1A 1WZKA 3MC5A 3ZR5A 3WD0A 1W8SA 4HTYA 3LQGA 3N2MA 3VPLA 4GKLA 3WD1A 4XQ6A 1EJWC 4WGXA 5A6BA 1SZEA 1DE6A 4AUBA 3WLQA 4AD0A 3A9IA 3E2QA 6XIMA 1LF1A 1J0IA 1A47A 4QDPA 3IUHA 1DXFA 1DQUA 3W1MA 2PDFA 3RK8A 4GNKB 2QIWA 3DFYA 4NF7A 2IPGA 4HPJA 4N02A 5HJLA 2NV2A 3L5AA 3P5YA 4KKXA 4LF2A 3R11A 4G56A 5FSDC 4IGMA 2ZKMX 1HVXA 1OFAA 3HBLA 4C5YA 4IPPA 2Z6JA 1JI2A 4F0KA 2GJXB 1BSLA 4CCCA 3EAUA 4KEMA 1GCYA 1PCKA 5K7JA 2WCSA 4EXBA 4BR1A 3LXCA 3KOWA 5C55A 4O8RA 2DZTA 3T0DA 1TCMA 3VGEA 4Q7BA 4UFLA 2XWDA 2OJPA 3DC0A 1ZGDA 1IGSA 2VWTA 3BW4A 1KLYA 3Q58A 4ADSA 1SW0A 1WOBA 3SO7A 2OSYA 7TIMA 4LUJA 4NKCA 3NGFA 1LZOA 2EF9A 4WDTA 1W2VA 3WBAA 4Z1CA 3MUIA 2BHZA 3PPFA 4S23A 1OEPA 4FXJA 5T91A 1U5HA 2C16A 4JOMA 1MEIA 4J3SA 3GUWA 4BEUA 3GXTA 4BS0A 3PY2A 3SIMA 2ZTKA 1VFSA 3CT2A 3I7SA 1VYPX 2RJGA 2X30A 4IPLA 1DIOA 3CK5A 4LS0A 3UG5A 3TTEA 3SY8A 4X60A 1XDMA 4FXFA 3E1F1 1NWUA 1NJJA 1B3ZA 3ARRA 3QN3A 1QNVA 1RQHA 2XINA 4E8DA 1W1YA 5DX7A 1HKWA 3LLXA 3LRKA 5CC7A 1BFNA 4IJRA 4AZIA 1WZLA 1KXTA 2NXGA 4YJ5A 4Z08A 4DYJA 2Z4GA 1LG1A 2G4FA 1OINA 3Q67A 1POJA 4GH3A 4O0KA 1ZP4A 3GHSA 2EGZA 5E0KA 3GKAA 1OFPA 3KHJA 1U2YA 3W2MA 1RY0A 1YRRA 3L9CA 1KTNA 3OODA 3EXTA 4B15A 2CHOA 4FLOA 3PULA 5FA5A 1XCXA 2TPSA 2REQA