1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
3CWOX 3F1QA 1ONRA 4NXSA 5CZSA 3BG3A 2ZRXA 3QYQA 3NQ6A 4CCCA 3EX6A 4DO6A 1ICPA 3LERA 5HQEA 1TRIA 5LHEA 1XM3A 3G18A 4K6AA 3P82A 3PR2A 1G6CA 1S5WA 4PL2A 4ORIA 1BEUA 4I7WA 1PVNA 3W84A 5L6UA 1Q6LA 3UZ5A 4K36A 4MLRA 3E0IA 3PVFA 1QFEA 2JGYA 4Y9AA 1NEYA 4Q32A 3GDTA 1LM1A 3LV6A 5K4ZA 4RV8A 1GYLA 4UTJA 3P5YA 1FBAA 1JJKA 4U28A 3NL6A 4XZ9A 4CNPA 1OX5A 3FA5A 4H6KA 3HOJA 4UTWA 3EKLA 3NM1A 4Z1DA 2PCQA 1RD5A 5FF3A 4O18A 4JEQA 1F6KA 1R46A 1XBVA 3HPZA 1W5MA 2ABAA 2A2IA 3EX2A 1U5JA 5DY2A 2J27A 5F1UA 1SO6A 1SR9A 2QEZA 4K37A 3W2NA 2NUYA 4JIPA 2J6XA 1K8ZA 2BZNA 4N02A 2PE4A 5J5DA 2QCNA 2VC6A 3A24A 2ZRWA 3W72A 2GVJA 5IBXA 1HFBA 4O19A 1H7RA 4JTIA 4HNTA 1LBLA 3BGGA 2DJXA 1N7KA 5D30A 4MY1A 5CGQA 3HPXA 3WK0A 3ABSA 3VCRA 3O63A 3UYCA 1VQTA 4Z1AA 1OG0A 1PHQA 2A85A 3SR7A 3VE9A 4O13A 1PE1A 4NJKA 2C3ZA 5G1YA 1H51A 2BXVA 1W5PA 3EEGA 1GPWA 2XN1A 2J9YA 4N6FA 3HMJG 1YTEA 3T7VA 1QPRA 1QO5A 1JRBA 4FNRA 4WOQA 5EPDA 1KV5A 3DXIA 3IV3A 3GNNA 2E09A 3W2LA 1A5BA 4KFNA 1DBTA 6ALDA 2QJIA 3DAQA 1RV8A 1JCXA 4MPQA 4WY0B 3MW7A 2HS8A 3BV4A 3F03K 1KLYA 1ICQA 2ZRZA 4UXDA 2GPTA 1KM1A 2PRHA 3TA6A 5KSWA 5FEPA 2CZEA 3NG3A 1VHCA 5FEZA 4Z1CA 2NXGA 4JTEA 1ZENA 2RDUA 4N4QA 2CLHA 2GQAA 1O5XA 2FJKA 3TR2A 2A6LA 1LOLA 4O17A 3W88A 1PHWA 1H7OA 1S3HA 4TR9A 4CQ8A 3LCXA 1T99A 4JXCA 3FOKA 3P8JA 1G7UA 1PIIA 2Y7EA 3LBMA 1Q6QA 2HS6A 1UBSA 3G1YA 2DZWA 1EUAA 1ME9A 1AG1O 5MHBA 5LZLA 1DL3A 1KFLA 2CZ5A 4O12A 3UWWA 2Q8LA 4MFDA 3IIVA 4HHPA 3NPVA 1IXOA 3QH2A 3LHTA 3G22A 4LC8A 1DV7A 4UTLA 3DFOA 4YLWA 3TXZA 1VYRA 5G1TA 4U4MA 2CZFA 3L5LA 3L0GA 2X1RA 5K9DA 1ICSA 1BKSA 4M6VA 1GVFA 2G96A 2QUVA 3TFXA 1VLWA 3PBUA 3FKKA 1OF8A 1X7FA 5FEXA 3O16A 3DHDA 4JTSA 2F7FA 4L4MA 1KA9F 4N2YA 5HULA 4AHOA 5TQLA 3FEMA 4BF9A 1FWRA 4M5PA 2QCGA 4MLJA 2GOUA 2QF7A 3O6CA 3NYZA 4ADTA 3C3NA 2DZSA 3B0PA 5TIMA 3S1XA 4ONVA 3JR2A 1ZAIA 1VGAA 4JTHA 3NM3A 1EWDA 1G67A 1MSSA 4E2DA 1OJXA 4FX6M 1EUNA 2EF9A 1F5ZA 3W70A 4TMBA 3O15A 1I4NA 1WOAA 3INPA 4QITA 3TJXA 3EWXA 4QAIA 3W1PA 1JCYA 5D2VA 2CLKA 1CX9A 3V1PA 3NQ8A 1H1ZA 2ZRYA 3WJZA 3WK2A 3Q2DA 4MZYA 1JUEA 2CLFA 3G3MA 3NQEA 1K03A 4Q33A 3RU6A 1KM4A 3G0XA 1GVRA 3LTPA 4QNWA 3P62A 1FWTA 2DORA 2RFGA 3ABQA 3E9AA 1YYAA 1QWGA 5K9CA 3STGA 3TCEA 1TPB1 5AFDA 1RR2A 2V82A 4PL1A 3NZ1A 2Z6IA 5DLCA 1GTHA 3PSVA 5CPMA 3P81A 4PC8A 2CLEA 5CPLA 2VEKA 3O07A 1XBYA 2EAWA 3OBKA 1MEWA 3CIWA 2QAFA 1HG3A 4OWGA 1XC4A 1EIXA 3GXTA 5KITA 4HKPA 4JY9A 2P1FA 1TV5A 4FXSA 2YYUA 3W7LA 3TQVA 3LTSA 3W7MA 1W56A 1VCFA 3TDFA 4EWND 4JIQA 1KLZA 2HTMA 3FJLA 4BK9A 2Q8ZA 3C56A 2NV2A 4YWIA 2E1DA 5I3KA 1KFBA 2ZZ2A 1L6WA 3ZS4A 4TIMA 1GG0A 3LI0A 5H2ZA 4HNNA 2G5WA 2RKXA 3GKFA 4ZQMA 4UTIA 3L65A 5U7SA 2YYTA 5D03A 2FB3A 4JX4A 4Z0JA 5HUOA 5AHEA 1KBIA 1KFCA 1B3OA 3ABOA 2HSAA 4NJGA 1FDZA 3DH7A 2KZHA 3QPZA 3M0ZA 3FIGA 5K2ZA 4GBUA 1A50A 3QPYA 1KM5A 1QR7A 4RZ4A 4N9BA 1YTDA 4KKXA 3D0CA 4IMFA 5C55A 2NUXA 4AWSA 3HGJA 1M6JA 1TJRA 1W5OA 1Z48A 4O52A 5K4XA 5G4EA 3W7GA 2ISVA 3DFSA 4NJIA 3TC7A 1G4EA 1FUYA 3SJ3A 3UXAA 2CZDA 2R14A 1F05A 4Z1BA 5CG7A 2P0OA 3P80A 4DPPA 4K39A 2WSRA 3IVSA 1PV8A 1UB3A 1X6UA 3PULA 4N9EA 3R13A 2VXNA 1VH7A 1Z42A 3BLFA 1G4SA 5A8GA 1H7NA 3C2EA 1G4PA 1XUUA 2H3BA 2ALDA 4LRSA 3M1ZA 1A5AA 3E02A 4JTJA 3PUDA 3W7DA 3ELFA 4RJEA 1IF2A 3DGRA 5DELA 3LXBA 1LLWA 3NQCA 4NUWA 4LNYA 4UNKA 4O4WA 4AH7A 3E12A 4Q4KA 1W31A 3HQ1A 3TAOA 2Y6ZA 2A4AA 2XN2A 1I45A 4BFAA 2OCZA 4RX0A 4O50A 1WOBA 3TQKA 4DF0A 3DI0A 4GUGA 3S9YA 4AVFA 5D02A 1CI1A 4LW7A 3TH6A 3QEZA 3IRDA 5F2LA 3RNDA 1FWSA 5AHNA 4WXYA 3TSBA 3EX1A 4IX0A 4QQ3A 1HTIA 2GVGA 4LY8A 1EA0A 4O0KA 4HSNA 1EP1A 3ANYA 1TV8A 1VZWA 3B06A 3N34A 1SSDA 3KRUA 4UC5A 2BWGA 1GYNA 2YDAA 3QW4B 2WPBA 4C1KA 4ADUA 4FNQA 4XWUA 3A22A 3HG3A 5HWJA 3T4CA 2WV8A 4NNCA 3NR0A 4OHQA 3N9SA 4FNPA 3QJAA 4LOCA 5D32A 5E93A 4AMAA 4FF7A 2H6RA 3S5NA 3FJ6A 3MWAA 1LBFA 5FI8A 5BNKA 3LCHA 3NZRA 1FCVA 1FDYA 2ZQ0A 3DFNA 4HN4A 1WBJA 2TYSA 4HPXA 4MY8A 3NPWA 4O53A 5C5YA 2A21A 1RZMA 3W7KA 1OFPA 1L2UA 2V8ZA 1QPQA 5DCDA 4MYXA 3GVGA 2B7PA 3DU0A 3THQA 3FKRA 3W76A 4LVGA 2CU0A 1OABA 3BW4A 3W2KA 4UIOA 1OX4B 2Y88A 3MYPA 1O60A 2FIQA 4RLIA 3C6CA 3O1NA 2W6RA 1M5WA 3MI6A 3UWVA 3HG5A 4FNUA 3UXDA 3DFQA 1HL2A 1Q3NA 3FLUA 1TMHA 3QQ1A 3A5FA 1WX0A 1RQBA 3PBYA 3C61A 3GIYA 1ZAHA 4WQ6A 3L68A 4UTKA 2VKZG 5AHFA 3R12A 3GDMA 2FPVA 3B04A 4JDYA 4WD0A 4UTUA 3T55A 3WK1A 1OK4A 2GUUA 3B03A 1T96A 1LROA 2E6FA 3G24A 3W1UA 5I3HA 1BWLA 3G1DA 3UPWA 1WYIA 4LTSA 1I2RA 3WK3A 4UUIA 3B4UA 4O54A 1ZHAA 3LX9A 2JK2A 3C2RA 3G1VA 5G4WA 4S1FA 2NLIA 2I9EA 3BGJA 4FB7A 4K7YA 1DORA 2NXIA 1JR1A 2W0UA 5HMSA 3DHFA 2X1UA 1EWEA 1SFLA 3M5XA 4P2VA 3UD6A 1BTMA 1R2RA 3HIJA 4NVTA 4JN6A 2CLLA 2GJNA 1KV8A 1SSGA 5DBUA 3GAKA 4MZ8A 4LVDA 1TQJA 3CIXA 4PH6A 1B4EA 1WXJA 3QC3A 3SGUA 2VFHA 3AO0A 1JRCA 4UR8A 3NOEA 5HR6A 1MO0A 3V75A 1G69A 3S1VA 2A1YA 3SSJA 3N19B 2YFOA 3P7YA 3PBVA 1A5CA 1K7FA 1QPOA 1L9WA 1G7VA 4B5NA 3PBWA 1N55A 1OK6A 4RCXA 4ZQPA 3O6DA 2VOMA 4BWLA 2V5LA 3S1UA 2DU2A 3KX6A 2Q3RA 1VHNA 1GZGA 3GB6A 2E6AA 2Y63A 3W2MA 1FQ0A 3P67A 1U83A 1VS1A 2VFEA 6TIMA 3EWBX 2PURA 4FX8A 4RXFA 2ATSA 1NVMA 3G0SA 4PTNA 1F2JA 4DF2A 3NQGA 3IIZA 3U6WA 2G97A 3LCLA 1HO4A 1K8XA 2VEIA 4IMEA 1D9EA 3B0UX 3PC0A 5J5RA 3UY8A 5E0KA 4JX6A 5AYYA 3OVQA 1EPXA 3GAYA 4A29A 1MEIA 1PS9A 3HG2A 3RLUA 3W7IA 4PCFA 1IXPA 3ATYA 3KAOA 3QW3A 2FFCA 3W1NA 5D09A 4IMGA 3FYOA 3LHZA 4NZJA 1K3UA 2RDWA 3C8FA 1P4CA 2QDHA 5E1QA 1AK5A 1QOQA 1I2PA 1RVGA 3WJWA 3MJYA 1SO3A 4JYDA 3LHYA 1GG1A 2JKEA 2C1HA 5FF7A 1FY6A 4D2JA 3U2OA 1W5QA 3S1WA 3CWNA 3CM4A 3LCGA 3SGZA 1XKYA 1TTPA 3QSTA 1R47A 4GUHA 3NQFA 1FCBA 3CB8A 4YCPA 1GEQA 2A0NA 2YW3A 4ZMGA 5LNRA 5I3JA 2NZLA 4ZQRA 2B4GA 2QCMA 4UTWC 1XI3A 1KFKA 1G4TA 4JX5A 4LUIA 3G0UA 3GR7A 1XDLA 3RK8A 3RMJA 2OZ0A 3TQ0A 3ZR4A 4M6QA 5I3IA 3M9YA 5CPNA 1LRTA 3L67A 2JGQA 3GR8A 5D05A 3EX4A 3RF9A 3M43A 1ME8A 1W3IA 1FWNA 4JY8A 2NWSA 5EYWA 3KFTA 1TV7A 1GOXA 1H62A 3TX9A 3TXVA 3W07A 2FB2A 3EX3A 1NAL1 1O5KA 2AAMA 1K7EA 1ME7A 1PCKA 2QR6A 3W7NA 5LSMA 1K02A 3W1AA 4NZFA 3R5EA 4JTTA 2WNZA 1UASA 2DZXA 2E6DA 1VCGA 2Z6JA 1DJQA 3EKZA 4Y90A 2NX9A 4EIVA 2J9ZA 3G8EA 2E5BA 1TPUA 5AHLA 1DOSA 1EX5A 4BI7A 4NU7A 4EVZA 2ZA2A 1SZNA 4MY9A 2VFFA 3CQ0A 2C18A 3JS3A 1XDMA 4R33A 4R7JA 4JGDA 4X3ZA 3VKJA 3QFEA 4AAJA 4DXVA 5AHIA 2AGKA 3VE7A 1SQ7A 3W7HA 2LLEA 4I7UA 5FF4A 1ALDA 1TYGA 1O94A 5KTLA 1KTBA 1RQEA 4OBTA 1SUXA 3DI1A 4O14A 3GLCA 4OGZA 4DEFA 3TIMA 3QMTA 2YR1A 3W7QA 1ML1A 4Z0SA 2ZRUA 2TMDA 2W79A 4O1AA 4JTLA 1MZHA 2QUUA 4HT3A 5FF0A 2HMCA 3TC6A 3OVPA 4K7VA 2TRSA 3DENA 4AXKA 4IJBA 1OYCA 2A7PA 2DP3A 4Y96A 1YXCA 2V2HA 3TW7A 3W86A 1WAUA 2ZZ1A 3OEXA 3KVLA 1S5VA 3MP4A 1VYPX 4HIBA 3RLVA 1OF6A 3NA8A 1PCWA 4PFMA 2NXHA 5CPOA 3IIOA 1LZOA 3W2UA 3ZFHA 1X1OA 1TIMA 3MHFA 2X1TA 1VCVA 3UZJA 5I3FA 4YMZA 1SPQA 2FPYA 2D73A 3NQVA 1IIGA 2V2CA 5F4WA 1SW7A 1F6PA 1Q6OA 1R2TA 3GKAA 2CW6A 1M7OA 4LWWA 1KTCA 3SI9A 3NQDA 3NPXA 3G1SA 3S0CA 2C6QA 3L0KA 5EMUA 3HBLA 3WJXA 3CEUA 4GC4A 4AHPA 3G8RA 4MOZA 4MIMA 3W22A 4GFSA 4M7TA 4K38A 2ZZ7A 3UPBA 1P1XA 4XKYB 1LORA 1NF7A 1WQ5A 1GVSA 3GX9A 3PSWA 4BI6A 3HGRA 3A5VA 3M6YA 1JUBA 1QDSA 2ISWA 3TKFA 1D3HA 2IQTA 3PUEA 1ZJIA 4RR4A 1UJPA 2ZZ6A 5EKYA 4UFLA 3GXNA 3NAVA 4HNUA 4PODA 2PRLA 2WKJA 3A9IA 4R53A 1Q45A 4N4PA 1TO3A 3S5OA 3NQ2A 1IGSA 2GQ9A 2CFFA 5HINA 3EXRA 3EB2A 4GJ1A 4WOZA 4N9DA 4FIRA 1WV2A 5K7JA 2P10A 3IEBA 4NXKA 1XBXA 5CKSA 1YPIA 3LLDA 4A3UA 3I7RA 1GJPA 1YLVA 3C52A 3VNDA 1LYXA 2Y7GA 3A21A 3LM7A 4DO5A 5D2XA 1TPVA 1LTDA 4WY0A 4DO4A 2O7QA 2WO5A 3FS2A 2G95A 1TTIA 1P5BA 3YPIA 2B7OA 1TQXA 1AW1A 5FESA 3UWQA 1SZFA 4O1DA 4CQAA 2YSWA 3L5AA 1PL9A 5CZTA 1FCQA 3S6DA 1TJPA 5DCBA 2H8ZA 4MYAA 1GVQA 1OFEA 1FDJA 3BG5A 3W1LA 2FLIA 3GDRA 3CU2A 2ZFAA 3SW6A 4OQVA 3QSRA 4UR7A 3MP3A 2UV8G 5HUPA 1B57A 4DELA 3KVMA 3KRZA 1YXDA 2RH9A 3VFLA 3I7SA 4YCOA 4PEKA 4CNOA 1KM2A 3IGSA 2WSQA 4IXXA 5BOOA 4M7SA 4JNMA 2ZZ5A 2BX7A 4A22A 3EXTA 1A53A 2CWNA 1TPWA 5LHFA 1S5TA 4NX0A 4S2CA 4JTKA 2WNQA 2Y89A 3U8GA 2QUTA 3UQNA 3T78A 2YPIA 3W6YA 1RQHA 3SY5A 4UCGA 1JUKA 4E38A 1W3TA 5LGXA 1GTEA 2QJHA 3LGEA 1TB3A 3O06A 3QQ0A 4X9SA 3TE9A 1W1ZA 3IGXA 2QCFA 2C0AA 3LHVA 1OFRA 4AB4A 3L21A 2X1SA 3N14A 3Q94A 1VLIA 2X16A 3M16A 3MO7A 1LBMA 4DPQA 3GNDA 1I2NA 1TPFA 3E96A 2BLEA 1Z41A 1FCUA 2JBMA 4GXMA 2GVLA 4WY0F 3CLMA 2H90A 2OMAA 1JVNA 2FPTA 1D3GA 2Z0IA 4FNTA 3NEVA 5G5IA 4MJZA 4BI5A 5HWNA 3KHJA 1YADA 4HSOA 5G2HA 3M44A 3STFA 4ZVJA 1TPH1 1F74A 3W7JA 1F7BA 4GUIA 1H7XA 3BO9A 2QCDA 3C0JA 5DXYA 3EWZA 2QAPA 3NL5A 5LNSA 2EGZA 2RDTA 1W37A 1IXNA 4LS2A 1QMLA 1OYAA 3USBA 4FIQA 1J2WA 5K3VA 1GT8A 5F1VA 3ATZA 3GYEA 3NXFA 3OG3A 2O7SA 3MP5A 5LNUA 2QCCA 3MI3A 2C16A 3UNDA 1TSIA 3IVUA 4UFJA 3P61A 4NX5A 1TTQA 4Y6GA 5AC7A 3B8DA 1ZAJA 3BK0A 5DBTA 5L9FA 1RPXA 4LT9A 5BRBA 1T0OA 1C8VA 4DBDA 3KXQA 4OT7A 3EXSA 4CCDA 5F2IA 1OFQA 3Q37A 5ABTA 4OV9A 4UMBA 3K30A 1LLZA 4LVBA 3T44A 3IVTA 5DY3A 4ZQNA 1QNVA 3IIPA 4MZ1A 1KFJA 3P74A 1XL9A 4DF1A 5IBXC 4ALDA 5HR7A 4TO8A 4HPJA 3M5ZA 1GWJA 3M5YA 2ZCGA 3O8AA 2RHGA 1JCMP 3GK0A 2EPHA 2WSYA 3SECA 3QMRA 1AMKA 1TREA 3I7QA 4AF0B 3TAKA 5FEWA 1ZY9A 4K8EA 4O0ZA 4IQLA 1F76A 1KM3A 3QRHA 3LCIA 3EWYA 4NNBA 1YTKA 5EY5A 2PC4A 1VR6A 2ZA1A 1VJIA 5HJLA 3G3DA 1F73A 4AEOA 5KMYA 3FYPA 1SZEA 1DQWA 3MYOA 1H61A 1MEHA 4WXZA 3BARA 1DKWA 2R94A 3W1MA 3I6RA 4Y8FA 4QJ1A 2ZTJA 4L4LA 4H4IA 3NGJA 4UMCA 1QPNA 3W87A 3NO5A 4LU0A 3G1XA 3NPUA 2X2GA 2YGYA 4I9AA 5G2IA 5D04C 3LHUA 1OFOA 1J4EA 3H53A 3LCFA 2E68A 3MHUA 3HG4A 2Y61A 3GDLA 2C19A 3DKJA 1H5YA 4P61A 2Y62A 4Z08A 3CTLA 2I14A 2E5CA 3CC1A 1TPEA 3BVJA 4XKYA 2WJZA 4IPJA 2B0MA 2YFNA 5KZEA 4A2SA 1KTNA 2ZZ3A 1R2SA 3HF3A 2YW4A 4JTFA 2V9DA 3VI2A 3TFCA 1JCLA 1OX6A 3QF0A 4N6EA 4ADSA 5D38A 1UUMA 3PF3A 2BTMA 4MFEA 4S2BA 4AHQA 4DQWA 1NF0A 2DZVA 2YZRA 3H54A 3THAA 5H91A 1YDOA 5BW6A 4J9JA 1JULA 2V0TA 2VEMA 3ABRA 1FWWA 3GDKA 2OT1A 1VC4A 3NQ7A 2WQPA 3W71A 1OFDA 4POCA 5CSSA 3MBFA 3QMSA 2QCHA 2V2DA 3NDOA 4FXRA 1H1YA 1IXQA 4E2BA 3N2MA 5D37A 3W7OA 1I2OA 3B0VC 5CZJA 4QM1A 2CLIA 1YPFA 1K8YA 2C13A 3UWZA 3C2VA 3L5MA 4ZQCA 2BSLA 3W7CA 3PM6A 4O57A 1BWKA 4TMCA 4FNSA 3M5VA 1VPXA 2DJLA 4C1LA 5EL1A 3HJZA 1DHPA 1LP6A 4LV4A 5LNVA 4UTMA 3BLEA 3W23A 2J88A 2Y7DA 7TIMA 1VRDA 5U4NA 1C9DA 4PA8A 2XN0A 4IGHA 1QAPA 2J24A 5D33A 3W73A 1LOQA 1JQXA 4LS0A 1A5SA 4K8HA 1V5XA 2NX3A 1R30A 4M19A 3TUUA 3FFSA 5C54A 4RK8A 4X22A 5AHMA 2JKAA 3CT7A 1SO5A 1SU5A 4NNAA 3SFKA 2NUWA 4KWVA 5IM51 1KM6A 1AL8A 1Q6RA 5GVJA 5CSRA 3I68A 2QCLA 5A5WA 1W5NA 1M7PA 3C2OA 2WNNA 5DXXA 1OFAA 4RZ6A 3P84A 1MXSA 4LUJA 4WUIA 4ZQOA 5K9XA 2OX1A 3LRLA 4LVAA 1H63A 2ISSA 4KFOA 1JCJA 4CNNA 5C2XA 5AC6A 2I1OA 3W7RA 1FXQA 2ZRVA 3HPSA 3P60A 2DZPA 3M7WA 5CZ0A 5F2MA 1WDWA 4GE8A 4R34A 2B7NA 2QDGA 1UUOA 3OIXA 1NSJA 3WJSA 5HWMA 4UFKA 4ICNA 3MBDA 4AF0A 5F4SA 3W2JA 4MJMA 1UCWA 1OHLA 1FX6A 3NQMA 4OU1A 3L2IA 4O4VA 2Z1BA 3KRSA 1B4KA 4JYFA 2A7RA 1DVJA 3WFAA 1XXXA 3LV5A 2FDSA 4BR1A 2EKCA 4WX2A 3UWYA 2ZYFA 3PS7A 3EWUA 5AYXA 3LHWA 4GUJA 4CLMA 3W1RA 1LDCA 4UFMA 1SO4A 1OVDA 2F84A 4IPIA 4UMAA 4YL2A 3KOFA 1H60A 4QIUA 3OA3A 4ML9A 4LVFA 4O1CA 3BG9A 3KVKA 4IOTA 1XBZA 4JS3A 2B7QA 2Q3OA 1IIHA 1GVOA 2R91A 1OX4A 3LXAA 4XTIA 3W1QA 2DZTA 3A23A 4UFIA 3TNOA 4ZZ9A 4KFPA 3LRKA 4O1BA 2DZUA 5LGZA 2YCEA 4XBKA 3W83A 2VELA 3PG8A 1EB3A 4IXHA 1XUZA 5F2GA 2V30A 3WJYA 3W75A 3G1AA 4A21A 4IX2A 2ZDRA 5EBUA 1W54A 4RKAA 3W7PA 2ZA3A 4HNVA 4E0CA 1XFBA 2OJPA 3LCWA 4EOUA 1HUVA 4FO4A 3L9CA 4O11A 3TW6A 4G1KA 3NQAA 2ATMA 3PB0A 1YDVA 5FF2A 1LRNA 1E51A 2AQWA 3PAJA 1NFBA 2YXGA 3HGOA 5KZMA 4TX9A 1CW2A 4JICA 2QKFA 1ZNNA 3LRMA 4EF9A 3PB2A 1LRQA 4O15A 3RFAA 4DBEA 5KZDA 3N2XA 4M6PA 2TPSA 3GZ3A 3G1HA 3M47A 3N3MA 1YDNA 3Q58A 3KVJA 2OT0A 3SZ8A 2FTPA 3STEA 4XUGA 5KINA 3B05A 2Z2UA 2A5HA 3EWWA 5D2TA 3MMTA 3NL2A 3QZEA 1VYSX 4IWWA 3R2GA 2E6YA 3TROA 3MI2A 2VFGA 3M41A 3NNTA 1P0NA 4H3DA 5AB3A 3BPWA 4LRTA 3S8HA 3G1FA 1GQNA 4MUZA 4UTHA 5TBOA 8TIMA 3DFPA 3MHGA 3TV8A 4NT0A 1ZFJA 2NWRA 3LTYA 1O4UA 1AW2A 2J9XA 1TPDA 3BW3A 4XTDA 5D2WA 3L0NA 5SWUA 1FXPA 2PRMA 1QOPA 2NV1A 3L66A 3OVRA 1ADOA 2Y70A 2R8WA 4RZ5A 5EA9A 1SZGA 1N8FA 3HGSA 3N73A 4W9TA 3C2FA 2CLMA 1X1ZA 4MKNA 3W1XA 1KFEA 1TRDA 5BMXA 4MVAA 1K7XA 1TPC1 4BWLC 3IGUA 4WZHA 4UFHA 3TJLA 4JD4A 4N9CA 2E5DA 1J5TA 5DN1A 1V7YA 2JKPA 1H7PA 1I2QA 4UTTA 3DFTA 3CEPA 5C6MA 1O95A 4IUOA 4QISA 2ZTKA 1KW1A 2VEPA 2Y7FA 3LXCA 3R89A 2GQ8A 3IIXA 3QM3A 1TCDA 3T40A 5G2WA 1W8SA 2FQIA 1TTJA 3O6YX 4YXGA 2X30A 2VFIA 3R8RA 2A7NA 5LKYA 2ZZ4A 1QCWA 3TMQA 2EHHA 1I8JA 3PY2A 1WBHA 3W7EA 3S5ZA 5AC8A 4IMDA 3LDVA 3ZWTA 1B9BA 3HB9A 4KWWA 3F4NA 2GJLA 3P8IA 4X2RA 1QO2A 3DZ1A 3LLFA 4JTUA 1H50A 2CLOA 1YXYA 1EEPA 1Y0EA 4OE7A 4ORMA 4FEZA 4A2RA 3PWAA 1LOSA 4JTGA 3LB0A 2NX1A 2WOQA 3OHIA 3HO8A 2V81A 5AN7A 4UNLA 4UTTC 1AL7A 3DKLA 3CHVA 3LOTA 4OV4A 4GNJA 1H7WA 3STCA 5DCEA 1X8FA 2QJGA 4WJEA 1L6SA 1SW3A 3H55A 4JYEA 5T26A 3P5ZA 1SW0A 3GXPA 4LC6A 3UWUA 3TMLA 3TSDA 1JCNA 5AYZA 1ZCOA 4JR5A 1C29A 4O10A 3E49A 4XBSA 4LV9A 3BW2A 5F4XA 4AWUA 5HNRA 2H8XA 3TU9A 3LI1A 3UY7A 3JRKA 2E77A 2QCEA 1W0MA 2QCDB 4RXGA 3C4UA 1W3NA 1ZALA 1T8XA 4NJHA 3SIZA 1JQVA 3CPRA 2C14A 1Z44A 4QNEA 3NL3A 4I7VA 4GWEA 1EP3A 3S42A 4O8RA 3MUXA 3TK7A 2XFWA 3BLIA 3AJXA 1DQXA 1L6YA 4XQ6A 3W1TA 3NVTA 5I3GA 5BMWA 3I65A 4CCEA 3O05A 3W74A 5AOUA 5LNWA 1SFJA 4EF8A 1KBJA 4IMCA 3W9ZA 4FHAA 1LCOA 4NQ1A 2ZBTA 2V5BA 1OYBA 4CQ9A 3S5YA 1HO1A 3W85A 1DJNA 2Y85A 4ZL1A 2TSYA 2YX0A 3W3OA 2H3DA 4O28A 1EP2A 3F4WA 3LBCA 1THFD 4AWTA 4GUFA 4GRSA 4TU1A 3DBPA 4NJJA 1P0KA 2VENA 4JDBA 5D2YA 4FX7A 1AW5A 4QSHA 1XCFA 3PG9A 1OFBA 2A6NA 2ABBA 1KM0A 3ZWSA 3N9RA 3PUOA 2C15A 2VFDA 3TSMA 1WA3A 4O16A 4LS1A
chains in the Genus database with same CATH superfamily
5CZSA 2BP1A 1OCJA 2NSXA 2ZRXA 4WJXA 9XIMA 4XAFA 3QYQA 3EX6A 2PS2A 4B15A 1OG6A 1BVZA 1XM3A 2JF7A 4OOZA 2V3EA 3VTRA 4GI9A 1BEUA 4E5TA 3O0FA 1EFZA 3DHUA 1V0LA 3GVQA 5BWFA 3GH5A 3PVFA 1HVQA 3WLRA 2JGYA 1E6ZA 2O55A 3GDTA 5EMYA 1KD0A 5K4ZA 3QFWA 4UTJA 8RUCA 2Z7GA 3KOZA 1HKVA 2HVOA 1U5VA 3FA5A 4UTWA 3EKLA 4ZTXA 3GC5A 4MTVA 4O18A 1FH8A 2AMXA 2WPGA 2INZA 4FOJA 2OZ8A 1SR9A 3GBEA 3VMNA 4K37A 1IZCA 5LA2A 2OYLA 1V79A 2E7FA 2NUYA 1W1VA 1Q4WA 4DI8A 3TYDA 2BZNA 4RW3A 4JQ2A 3T1GA 1E6XM 2QCNA 3A24A 2TAAA 2PWUA 1JDFA 5I07A 1NARA 4NYUA 1LUCA 4JTIA 4QG6A 3GNXA 4WDWA 1RBAA 2DJXA 1N7KA 4MY1A 4M51A 3JZUA 3RPTA 2G3IA 2C7FA 1UD3A 3KZSA 5I03A 1PHQA 3SR7A 3SUVA 3TYEA 1X7IA 1LUCB 4KMQA 1VPQA 2VJXA 5HJYA 4NJKA 3OBAA 3GZAA 5TNVA 2DT3A 4NZ3A 2J62A 3MY9A 1GPWA 1Y5XA 3HMJG 4J3ZA 1CLXA 1EF2A 5A6LA 4W5UA 3SY8A 1FP9A 4WOQA 4HYRA 4AYGA 1KV5A 3DXIA 3GNNA 2E09A 1DBTA 1J0KA 3DAQA 4CU6A 1EZWA 4MPQA 4WY0B 1LWJA 3MW7A 3WBAA 2HS8A 3WBWA 6PTDA 3F03K 1V6TA 2PF0A 4Z2LA 5FEZA 5A3HA 2RDUA 2CLHA 1UA7A 3SDOA 4MAVA 1DJHA 4NRRA 1XRTA 3EB3A 1CLVA 4H83A 1S3HA 3LGGA 1OIFA 3P8JA 1XYLA 3ARVA 4QLJA 4M24A 5E9AA 4UQBA 1DL3A 1KFLA 4O12A 3UWWA 3PNZA 4DZ5A 4PUWA 1RY8A 1CENA 1MQQA 1IXOA 2EPMX 4B2DD 3G22A 2ONEA 2WYSA 4LC8A 1DV7A 4TV6A 3ANVA 4GY1A 3EDJA 3M0YA 1VYRA 3AMKA 3ZZ1A 2CZFA 1FOBA 3GO2A 2X1RA 1ICSA 4K1WA 2QUVA 2WZIA 4IIBA 4F0RA 4V1XA 3AWNA 1OT2A 4YS1A 4YTQA 1EJTC 2G3FA 3PBMA 1R3SA 1XIBA 2UBPC 2F7FA 3BXWA 4N2YA 5TQLA 4BF9A 1FWRA 2HCVA 2QCGA 4MLJA 1XCWA 2C1IA 2YBTA 3EB4A 2PZ0A 1E5JA 2WQDA 4S38A 5LA1A 1VGAA 3B9OA 3BAJA 1W1YA 1E6NA 5JH2A 3CZLA 2A3LA 4IF2A 1EUNA 4ACYA 2VMFA 2BXZA 1WKYA 3W70A 4TMBA 2J78A 3A4JA 3LSCA 3FNDA 3PZGA 4HPGA 1CX9A 3LGDA 3V1PA 4ZBCA 3VKKA 1RVKA 4DJDC 3Q2DA 5CPTA 3N4AA 4L6DA 4IFKB 3G3MA 4C7FA 1E43A 1KM4A 2P88A 3G0XA 4QNWA 1GCYA 2GDQA 3P62A 5M17A 4QRNA 3ABQA 3E9AA 4C6CA 3ONCA 3BAXA 4RE0A 3EYPA 3B40A 2G41A 3WMCA 5AFDA 2QF8A 4EANA 4U31A 1PZ3A 4XAYA 1GTHA 2GYIA 2VEKA 7REQB 3O07A 1E4LA 4DZHA 3ZT6A 3CIWA 3UJRA 2AL1A 2REQA 3AOFA 1EIXA 3GXTA 4I9TA 2FHFA 4LAZA 3H4XA 3D5HA 4GI4A 5I7GA 2XH2A 4HOZA 3UJ2A 3ME3A 3W7LA 3BLPX 3LTSA 2GVEA 4S3DA 4EWND 2HTMA 4IHCA 5A6AA 3AU2A 3ONBA 2E1DA 5I3KA 4TX8A 3MJMA 3BSHA 2JF6A 1RALA 4AYSA 4HNNA 4W88A 3WLJA 1Z69A 1KBLA 1YBQA 1QNRA 4S23A 4G9PA 1L2QA 4BA0A 1JI2A 3DH7A 2UZ9A 5C2CA 4JNZA 3SN1A 2CXEA 3QPYA 1KM5A 3V5FA 1J9YA 5FAGA 3CV1A 4DJDA 1BHGA 2P3ZA 4IMFA 4E8GA 2VT0A 2X42A 1VFFA 3IK2A 1E1CA 4KESA 3SB0A 1T7LA 4HJFA 3R11A 3DFSA 4FF5A 4NJIA 3K8MA 4G2DA 2P0OA 3M0LA 1QW9A 1R3RA 4PTDA 4GX8A 1OC7A 4OKDA 1XGZA 4FR1A 1E0VA 3IVSA 1HKKA 1X6UA 1V77A 1G1YA 3R13A 3FJ4A 4H9UA 4EPEC 1VH7A 5CCZA 1H7NA 2ALDA 4LRSA 4K3ZA 5BXSA 3PUDA 4ATWA 1IF2A 5DELA 3M0XA 4S3FA 4I5RA 4CQCA 4YYCA 4NUWA 1TA3A 1VKFA 3L4UA 3LA4A 4O4WA 3VK5A 4Q4KA 2QJMA 3BMVA 2J7EA 3HQ1A 2ZIDA 3WDHA 2Y6ZA 4LF1A 2BY3A 2Z1XA 1T5AA 3WLMA 1I45A 1RBOB 4BFAA 3CMGA 3R8HA 4MKVA 1HKWA 4AZHA 3WUEA 4KQNA 4ZO6A 4GUGA 3UGRA 2O9PA 1K9FA 3PPFA 4AVFA 4WDTA 3WDPP 4QS6A 1UR2A 1KO0A 1VFMA 1W3HA 5AHNA 5H8MA 3EX1A 4IX0A 4BZYA 4QQ3A 1QBBA 3W4RA 1HTIA 4GX9A 4HSNA 2X09A 3ANYA 3PP7A 4MNLA 4Q8MA 1ELSA 4C91A 3EMQA 2VZUA 3VZXA 1GYNA 2YDAA 4H8VA 4FNQA 5HWJA 1XIIA 3H2EA 3T4CA 1UJQA 1M7JA 4FNPA 2FZDA 2PAJA 4ERAA 3U0HA 4GH1A 3VAVA 3UPMA 2E9LA 1KQYA 3FJ6A 3MWAA 1LBFA 2JFEX 1XIHA 1UBPC 3LCHA 4HN4A 1SFSA 4DZIA 4ZGYA 1UPPA 2FVLA 8A3HA 1JNDA 3U7VA 3LPPA 2V8ZA 4INFA 2ZWYA 4MYXA 2AL2B 3T4WA 4J5NA 3MUAA 4Q8QA 1V6UA 1J12A 1XP3A 3WQGA 3FXYA 2Y88A 5ECVA 1QJWA 4ENLA 1FWJC 3MYPA 3CK5A 1FA2A 4PEEA 4Q6XA 4RLIA 1FWCC 1XV8A 5C9WA 3VOCA 5M2FX 4S3EA 4H6EA 4FNUA 3MUIA 1MXDA 3MV11 3TN4A 1GQLA 4GMEA 1CGVA 1P0EA 1RQBA 3PBYA 1C8YA 1US0A 2AMGA 3N25A 3L68A 1Q2RA 2W66A 1FH7A 3DYMA 4WD0A 3T55A 3VOFA 2AL2A 3BSMA 1NM9A 5I3HA 1WYIA 4V15A 2GJPA 4YTUA 3G1VA 3ZVIA 5FSDC 3KS6A 4K7YA 1JR1A 4QDWA 3PZMA 3BAKA 1RA0A 2X1UA 4LAUA 3BJSA 1NTHA 4C60A 3DESA 1V03A 3KUMA 4NVTA 4OZOA 2CLLA 4D6CA 2P3EA 1Z6KA 1I60A 1SSGA 2GJXB 5AYIA 4LVDA 4PH6A 3CIXA 2JE8A 1XIFA 1XC6A 4UWMA 1KCXA 3H70A 2PTYA 4LB3A 3V75A 2ZX6A 1OZMA 5CBIA 3SSJA 5A2BA 3P7YA 1YMYA 4LUTB 5BXRA 3UNTA 1G7VA 1EGZA 1VIWA 2XFFA 3PZNA 2VOMA 1Z9AA 1HP5A 1DXFA 1R86A 4YYFA 4B4HA 2WLYA 3R94A 3KX6A 3A4AA 1DE6A 3W2MA 3MQTA 2ICSA 3WF1A 2ESCA 5EMMA 1KRCC 2EG6A 5A8MA 1AD1A 1B3YA 3F4DA 1XPYA 4OFCA 4RXFA 1HJSA 3G0SA 5GNXA 4ZA0A 3IIZA 2ACUA 3U6WA 3LCLA 1J79A 3L12A 3FW6A 4HQVA 4DXKA 4QG8A 2EXOA 4IMEA 4JX6A 1GKQA 3UR2A 3OVQA 2PWVA 2VR4A 2QUNA 1V0MA 1UD4A 1A5LC 2QVNA 5ABGA 3FY1A 3M0MA 6TAAA 4OUEA 1IXPA 3KAOA 5JMUA 4NHVA 5D4YA 3B3DA 4C6KA 3AXXA 1P4CA 2QDHA 5E1QA 3WMSA 1B2YA 1NFPA 4ROPA 4MNKA 2VC9A 1HL9A 4C5ZA 5CQ1A 3RDKA 4JYDA 2C1GA 4J28A 2C1HA 1FY6A 3U2OA 1A5UA 1TVLA 3SJNA 3LCGA 3S46A 1TTPA 1JAKA 3CO8A 4Z17A 3QSTA 3MA8A 1GEQA 2YW3A 5LNRA 3ZQ9A 4D8AA 5I3JA 4ZQRA 1SM9A 1M68A 4Q4OA 1EDGA 3RYSA 1RLCL 1H0GA 1TUXA 2GGGA 3RK8A 2HK0A 3TQ0A 2W67A 4M6QA 3BL3A 4J7RA 1U22A 1LRTA 3GR8A 1MQPA 4AVOA 4UZUA 2AAAA 3RF9A 3M43A 1ME8A 2NWSA 1M3UA 1H62A 5AZ1A 4A4AA 3VC6A 3S3GA 1NAL1 1UMYA 4ZODA 2Z1SA 4A3YA 2AAMA 1K7EA 5G4HC 5LSMA 1K02A 3VNKA 4JTTA 2PDMA 3REQB 2UWFA 3EKZA 5LXXA 3VD3A 1PYMA 4PUMA 4BI7A 4Q8NA 4ZFCA 3SEPA 2VFFA 4NY2A 3JS3A 3PJWA 5CPSA 1TCMA 2DY3A 1S1RA 4R7JA 3DCPA 3R58A 3SCQA 3LNPA 4AAJA 5AHIA 2AGKA 4DUVA 1DJZA 1TV4A 5HNTA 2Y5SA 2EJ1A 4I7UA 3ABZA 1RQEA 1SUXA 4O14A 3CASA 3GLCA 2BB0A 3DIPA 4OGZA 1V08A 1XWYA 3TIMA 3DYPA 4QE4A 3W7QA 2ZRUA 3UWEA 2TMDA 3BMWA 1E6QM 4O1AA 3MUY1 3PPHA 1TWZA 3E74A 1R3WA 1RP9A 2R1NA 4IJBA 2A7PA 4A35A 4Y96A 4D9PA 3GU9A 1WAUA 3OEXA 3KVLA 3CH0A 4HIBA 1BG9A 3S2JA 4PBEA 1C90A 3KBMA 3W2UA 3ZFHA 2CHNA 3UZJA 2OVLA 3A3WA 3BUVA 1IIGA 2V2CA 5F4WA 4DJDD 3BGAA 2DUZA 3VDGA 3F2DA 4X0VA 3RX3A 3H4GA 3SI9A 4A6GA 3VX1A 4L1XA 4PMJA 3V0UA 4DJEA 2X0SA 3OGSA 2C6QA 4TVDA 3L0KA 1F4HA 2VZOA 4DJED 3HBLA 3C2YA 3WJXA 3G8RA 8CGTA 3W22A 4FSAA 4M7TA 2ZZ7A 4G6CA 2WB5A 4Q4SA 4LF2A 2I56A 1F8MA 3PSWA 4BI6A 3HGRA 4H9VA 3M6YA 3TKFA 1UIPA 2XIBA 5IDIA 4W4QA 1D3HA 5EBAA 2IQTA 3BC9A 2PBOA 3WLPA 2Y5EA 2PRLA 4R53A 1Q45A 3H22A 3T2OA 5C71A 5HINA 4GJ1A 4O0QA 4FIRA 4AIBA 1CXEA 3M46A 1P0DA 1PTDA 3IEBA 1YPIA 1EQPA 4Y9NA 3WQOA 4A3UA 4PTMA 2G0WA 1FHLA 3QKEA 2BFGA 3R0KA 3QOKA 4F2TA 4NASA 1YLVA 5DQPA 1IEQA 5D2XA 4HNCA 2X2YA 4DO4A 2O7QA 2WO5A 3GXDA 7REQA 1HXJA 3MWCA 4DVOA 1TQXA 1WXYA 3K13A 3UWQA 2YB1A 3VABA 4CQAA 4JIIX 5CZTA 2ZUTA 3LU2A 5DCBA 2H8ZA 3PNUA 3W1LA 2FLIA 6A3HA 3EA2A 3PJUA 4XZLX 4JZ5A 1REQB 3MP3A 3KVMA 5KZ6A 3KRZA 4PULA 2ZVIA 1YXDA 4GJJA 2RH9A 3KP0A 5DT5A 3CQJA 3IGSA 4IXXA 3WNNA 3AYVA 4JNMA 3AMLA 2ZZ5A 2BX7A 5E70A 1UZ4A 4NX0A 4JTKA 3WELA 1XLHA 3NZGA 2Y89A 2XH0A 3U8GA 3CZKA 1UWAA 1LF1A 3A12A 1C8QA 2HNHA 3AS0A 1RQHA 3SBFA 4DWSD 5CBBA 1B90A 3FX4A 3T8LA 1DWFM 2QJHA 3LGEA 7A3HA 1TB3A 3QQ0A 2CIPA 4GA8A 1W1ZA 2ZUVA 2QCFA 3LHVA 3MKKA 4XAZA 3GU1A 3ABXA 3Q94A 1RA5A 3M16A 3MO7A 3RCYA 1AQFA 1TPFA 3SCWA 2BLEA 3VD7A 3R79A 4A3RA 2PWFA 4GXMA 2FMNA 3P14A 4WY0F 3NSXA 3CLMA 4HA4A 2Z0IA 4FNTA 4DBSA 3NEVA 3KBJA 4H2HA 4B91A 1TVPA 3F2CA 1F74A 4GUIA 1JF6A 1W9UA 5I00A 2QAPA 5FL0A 1S2UA 2IUZA 2RDTA 3BURA 1IXNA 1QMLA 4FI4A 1ZSXA 3HPAA 3NXFA 2XZ7A 2O7SA 3WEZA 5LNUA 2VOTA 4WR3A 3IVUA 3TYUA 2ZADA 4MDPA 3WUGA 3ECQA 2ZUUA 1TWWA 1V6XA 4OT7A 3EXSA 1JZ5A 4ZSTA 4CCDA 3W82A 1WDQA 1MFVA 2XFRA 1VP5A 1OFQA 1BWVA 4LX4A 1EXBA 3JU2A 3RM4A 3WF4A 4PMZA 3IIPA 4MZ1A 3RN6A 1O68A 8XIAA 1T6MA 2HNEA 4HMNA 1JCMP 4HCHA 2EPHA 1AMKA 1TREA 1WZMA 3GHSA 3WNOA 1AUSL 5FEWA 5A8QA 1BXCA 3E2VA 4CN1A 3Q67A 1F76A 1IZJA 3MUZ1 1WKFA 1YTKA 2ZA1A 3CUJA 3OZOA 1OGSA 1JZ7A 4Q8WA 3MYOA 2ZC8A 3TW9A 1MEHA 5BXTA 4WXZA 3UZWA 1ZQ5A 1OQFA 3RG6A 4DIAA 2D20A 2ZTJA 3C8NA 4UMCA 4QXIA 1XLAA 3G1XA 3NPUA 1EQCA 2YGYA 5D04C 3LHUA 4UR9A 2XWDA 1B0IA 4B4FA 4YVVA 1OFOA 4FK9A 1F9CA 3Q45A 3CZGA 4P61A 3DKJA 1S1PA 2R1MA 3CTLA 1F8IA 4KRZA 3IARA 3BVJA 1FH9A 1VEPA 2B0MA 3RRAA 4IP5A 5HBFA 5KZEA 1KTNA 1TE1A 1ZS2A 2ZZ3A 4NRSA 5J04A 3IWPA 1SFTA 4WHBA 4ZENA 1JCLA 3QF0A 4IFOA 5D38A 5HANA 1KBBA 3AMGA 3PF3A 2AOSA 2QNEA 4MFEA 4S2BA 2XPKA 3EDKA 1XRFA 3THAA 3AIRA 3MSGA 3UJEA 1JULA 1M04A 3CMJA 2WVUA 3GDKA 4QCFA 1VC4A 3S4TA 1I0DA 3GIQA 3W71A 1OFDA 4YVXA 4DYKA 4A8NA 2CZVA 4TQTA 4OECA 3WN6A 2Y5JA 4R7WA 3W7OA 1B31A 1I2OA 4I5UA 3BWWA 5CZJA 3GDBA 4QM1A 3VCCA 2WWCA 3TWBA 1WDPA 1YPFA 1K8YA 3UWZA 3C2VA 3AMDA 1UWQA 2QS8A 4D6JA 2BSLA 4GD0A 4BY3A 3EMZA 4YPJA 4O57A 1BWKA 4GBDA 1ISVA 4FNSA 3M5VA 3UR5A 3P93A 5EL1A 1DHPA 5LNVA 2PSNA 4GY0A 2DFAA 2Y7DA 1VRDA 3QV8A 3NO1A 4PA8A 2W91A 4XD4A 2RJGA 1QAPA 4YJ5A 1WB0A 4TXEA 3B9EA 4R5EA 1V5XA 1GGOA 3FHQA 3N6QA 1JL8A 1YX1A 4HGXA 3B9AA 4X22A 3ITLA 1SO5A 4KWVA 2BOEX 1AL8A 1IEVA 4DZAA 5A8PA 5CSRA 3PZ9A 1W5NA 4US5D 1PKNA 2YB4A 2WNNA 9XIAA 4WRHA 3IJ9A 4WUIA 4B9ZA 3WQWA 4ZQOA 5E6YA 4Q4PA 4CEXC 1H63A 4QS5A 3URAA 2YDRA 4FOKA 4CNNA 5C2XA 4GIYA 4OBSA 2I1OA 3FAXA 1FXQA 3P60A 2DZPA 4B90A 5CZ0A 4GE8A 1MVYA 3QXBA 2B7NA 2QDGA 4DRSA 2PDCA 5JUVA 4H9TA 4UFKA 4F9JA 4AF0A 3W2JA 1UCWA 4O4VA 4JYFA 4QGCA 2Z00A 3D47A 1Q65A 2A7RA 3WBXA 1XXXA 3C5QA 3LV5A 1V02E 1R6WA 2YL9A 1I6NA 4WX2A 3UWYA 5FL1A 4QJ4B 1O1HA 1F3TA 4DBWA 4Q4MA 1WO2A 5E0CA 4D6GA 3SUWA 3VPLA 3B0XA 2CNCA 1S2CA 3FXGA 3QV9A 5HQLA 1H60A 4RE3A 4U3AA 2VGFA 2WZHA 1PKLA 4QAWA 1OX4A 1E40A 4I6VA 1OWQA 3LRKA 1AQ0A 4O1BA 4XBKA 1LJYA 3PG8A 3G6MA 4NSBA 2EEXA 1QHOA 2FH8A 4A21A 4LUSA 2ZA3A 4HNVA 2I9UA 1XFBA 3FDGA 1H4PA 5FSEC 3NQAA 1DJYA 1YDVA 1AZ2A 3MTWA 4JICA 3LRMA 1QNPA 3MS8A 4O15A 9RUBA 5KZDA 4F2UA 1DTUA 3MUCA 2BY0A 1F61A 5BOEA 1EOKA 3Q58A 3SZ8A 1MDLA 3S2NA 2PP3A 2DSUA 4JN8A 1J0YA 3OODA 3EWWA 4P7OA 3TROA 3MI2A 4MUPA 2VFGA 1XJBA 3SO7A 6REQB 4H3DA 3S8HA 3G1FA 1GQNA 2F6UA 1X6LA 3OPSA 1V3HA 1ZFJA 2GGHA 2J9XA 4DUWA 3TP4A 1FXPA 3VIHA 3W38A 5GNZA 4P7NA 1VENA 1ADOA 2Y70A 1BF6A 4WLCA 1SZGA 1N8FA 3C2FA 2NQLA 1X1ZA 4MKNA 1KFEA 4LYQA 5BMXA 1K7XA 1TPC1 4UFHA 1RPKA 4JD4A 2E5DA 4DHGA 1PKMA 2JKPA 3VD5A 4GQGA 2E8YA 3DFTA 2WNWA 5C6MA 4IUOA 3LBOA 1DHKA 2E8ZA 3BANA 3ERPA 4F66A 3ANUA 3V4BA 2I7GA 3UYIA 1YNQA 1TTJA 4L9ZA 4YXGA 2QJJA 4ZOCA 5LKYA 3A13A 1I8JA 1NU5A 4UOQA 1NY1A 1WBHA 5DF0A 1D2KA 5C2GA 3QLLA 2QHAA 3GTFA 4I9MA 4AQLA 3F4CA 4R3UA 4KWWA 3ZWTA 1HZYA 4GGBA 1RAKA 1QO2A 1S3TC 3LLFA 1H50A 4AISA 4DWDA 1LOSA 4JTGA 3LB0A 3V35A 2WOQA 2V81A 4UTTC 3RGTA 1XQKA 3LOTA 4OV4A 3TQPA 3AI0A 5DCEA 3QR1A 2Z25A 3P5ZA 3UWUA 1JCNA 4B92A 4JHZA 4RL3A 3WL0A 1BGGA 4JR5A 1C29A 2BVDA 5BYWA 5JXQA 4U33A 3JRKA 2E77A 3WL1A 2QCEA 2J7BA 1JIBA 2F38A 4Q8UA 2XUCA 4HVXA 4NZ4A 1UC5A 3DFYA 4OJYA 2FJUB 4NJHA 1Y5VA 1FWDC 3VIIA 2H9AA 1XX1A 3UCDA 2PDUA 3NL3A 4J3UA 4J3WA 4IFRA 3ZJ6A 1EP3A 1PTGA 4ZFMA 4IGNA 1SJCA 4JFWA 2W4XA 1TWDA 5I3GA 2GGEA 3I65A 3O05A 1GPFA 4JIEA 3GUGA 4IMCA 4P8UA 4NKCA 4FHAA 3MU7A 1HP4A 2EQDA 2V5BA 4GABA 1PZ2A 2TSYA 2YX0A 3W3OA 4JKKA 3LBCA 4M80A 2J6VA 2EPNA 4GUFA 4PTXA 3H2MA 1P0KA 2VYOA 4JDBA 4FX7A 3PG9A 4RZBA 1OFBA 3AQUA 1KM0A 3W53A 3ZWSA 3WCZA 1UD6A 1EGMA 3CWOX 2XGZA 4GGHA 3BG3A 1UP3A 1EC7A 4PFHA 1V6YA 4DO6A 4B5XA 3C0SA 5LHEA 4AIEA 2DT1A 3P82A 3XINA 4PL2A 5IFTA 4LFYA 3W84A 2OO0A 5L6UA 3R6IA 4O1FA 3T0CA 3E0IA 1NEYA 3QV6A 3KTCA 4GKTA 3LV6A 4WDXA 4RV8A 2QUMA 1ADSA 3P5YA 1JJKA 4P5UA 3WX7A 4XZ9A 1N2VA 4HZMA 1OX5A 4H6KA 1RD5A 4DLFA 4AD0A 3DERA 4UQDA 2ZE0A 1XBVA 1R46A 1W5MA 3WUBA 3TYBA 2PF8A 5F1UA 3EZ4A 4JL1A 4JIPA 2ON3A 3IAPA 3V7PA 1GK8A 2PE4A 2OOGA 5J5DA 4PUNA 3WH6A 3LD5A 2VC6A 4GPNA 3ZMRA 3PJTA 2GVJA 5IBXA 1HFBA 4O19A 3VVGA 4HA3A 1FRBA 1LBLA 2WMFA 3BGGA 5AYBA 5C9RA 3WK0A 4B5WA 3UYCA 2GGJA 3TA9A 1OG0A 1T40A 3VE9A 3WQ6A 1I1XA 4HU8A 4XD5A 3S83A 5A2AA 5G1YA 3IJ6A 4H6QA 4KBXA 2BXVA 1UOKA 3EEGA 4C6EA 2J9YA 4QG9A 2OXNA 3L4TA 1YTEA 1HJXA 2PGEA 4NZ1A 1IE7C 5EPDA 2INEA 2OWCA 1M1BA 4GZEA 2V5CA 1TJ2A 4I9JA 4LALA 1VIZA 2GPTA 3TA6A 3QTPA 1UKQA 4J4KA 1V3MA 4J3XA 1QNOA 2GQAA 2FJKA 3U2ZA 3TR2A 1OADA 2A6LA 4UQAA 5BRQA 3TN3A 1KXQA 4O17A 1H7OA 4H00A 3TN6A 4MAZA 3NO3A 4CQ8A 3LCXA 2B31A 4JXCA 1E6PA 1PIIA 1CT5A 3ZR6A 1Q6QA 2HS6A 3GHUA 3G1YA 2ISFA 2G3MA 1ME9A 4IFKA 5LZLA 3S6TA 3H2CA 2VRJA 3QR0A 5CBJA 2Q8LA 4MFDA 4XUYA 5F7UA 3AXKA 2R1PA 3QH2A 2V68A 1F3XA 4S39A 4DJFA 1OEPA 3PFMA 2VP8A 1JYVA 4BCEA 3UA3A 1GOKA 4GQRA 4LB4A 1JAEA 2G96A 2ZKMX 2J7HA 3PBUA 3ORWA 1KC7A 4X0NA 4HD5A 3VGDA 3O16A 4JTSA 3WQPA 3ISIX 1KA9F 3LSBA 1UD5A 4M5PA 3UXIA 2GOUA 5A1AA 3NYZA 4ADTA 3SADA 3C3NA 2DZSA 3GVRA 2FTWA 3NM3A 3OJGA 1EWDA 2YXOA 4NZ5A 1F5ZA 2AKZA 3TJXA 4QAIA 2PU1A 3GW0A 5GPRA 2IKJA 4YVPA 5KETA 5D2VA 2CLKA 3WJZA 2O9OA 2DW6A 4MZYA 1JUEA 2CLFA 1UWIA 1K03A 5I09A 3F2BA 1GVRA 3LTPA 3CMFA 4AIUA 4LH8A 2RFGA 2PGRA 2X05A 3CUIA 2XGIA 2AQVA 1EIBA 2J4GA 4PL1A 1RUSA 3NZ1A 5DLCA 2ZC1A 3LS9A 1XBYA 1ODZA 4PTWA 2QAFA 1GQKA 1S2TA 1HG3A 1XC4A 2D2HA 1NWSA 1H2JA 3K46A 4QE5A 1P0BA 2WJEA 6XIMA 1VBJA 1AJ0A 5BROA 2Q71A 1TV5A 2DIJA 2EG7A 2CPUA 2YYUA 3H8AA 1MZRA 1TJ0A 2NQZA 3DFHA 3TQVA 3KE0A 4CVWA 3TDFA 4JIQA 4BK9A 4DM2A 3GRIA 2Q8ZA 2Q02A 2WMHA 4AXNA 1TX2A 3ZS4A 4TIMA 4Y7EA 2R1KA 1E72M 3HFYA 1C93A 4ZQMA 5U7SA 4BKNA 3VIFA 2FB3A 4Z0JA 4JN7A 2HDJA 1ZUAX 4REQB 1MUWA 3ABOA 1MRQA 2A3AA 1MI3A 4HBKA 1FDZA 3MDUA 3HTWA 3OB8A 5K2ZA 4H8HA 1G94A 3UP8A 4MM1A 4H1ZA 2YKKA 4KKXA 4PMUA 4O52A 1JI1A 5A94A 1TWSA 4PMQA 3WO8A 2WKLA 3TC7A 1G4EA 1FUYA 3WEMA 3UXAA 4J40A 5CG7A 3AIUA 4PSPA 1PX4A 1J0JA 1QI3A 3F5KA 4DWSB 4K39A 4QQUA 1M65A 4NAEB 2WMIB 1PV8A 1UB3A 4ZB5A 5RUBA 2OWXA 2EJAA 4JFVA 3MT1A 1XUUA 2H3BA 4PMNA 3R43A 4E3VA 1V6WA 1R87A 4A8LA 3W7DA 2XM1A 2A79A 3NQCA 3WNPA 4LNYA 4AH7A 3EDEA 4BHYA 2ZUNA 3CAKA 2POTA 3N29A 2I57A 1DJGA 1XD1A 4IICA 3TAOA 4KWUA 4CD6A 2A4AA 5HQMA 2OCZA 3GQYA 1WOBA 4HNLA 2OO6A 4C6JA 2OR2A 3S9YA 4B16A 5D02A 3O9NA 4LW7A 4W7WA 2G3NA 4Z2HA 3N17A 2PI6A 1FWSA 3KP1A 4WXYA 4YIWA 1GOWA 1CXFA 2CCRA 2GVGA 2HE8A 2ASHA 1VZWA 3PN8A 1XLBA 3UETA 1SSDA 4LGXA 4MJ4A 2OSYA 4DN1A 4KH2A 4ZB2A 2WHJA 3OZMA 1GQIA 4LOCA 5D32A 2GVYA 3S5NA 1J96A 3AYSA 3OYZA 2GSHA 3WBEA 1M53A 1EO5A 7ODCA 2ZQ0A 3DFNA 2XH4A 4TTGA 4HPXA 4E4PA 3NPWA 4BF5A 1W8GA 1YQ2A 4O53A 1VBRA 4ZXLA 1OCQA 4OTKA 1RZMA 2FVMA 3SRFA 2HISA 1FHDA 1QPQA 3DN5A 5D9OA 1EGVA 3GVGA 2ADAA 1XSIA 3VKBA 2CBUA 2QLYA 3W2KA 1XFCA 1E6RA 2IKGA 2HVNA 1O60A 4HTYA 1KBKA 3WDRA 4B3ZA 5CH9A 2OODA 2W6RA 1K77A 3S2CA 1G01A 5JU6A 3MI6A 3HG5A 1GKPA 2BODX 1Q3NA 1ADDA 2PWHA 3QQ1A 1FP8A 3A5FA 3MMUA 1UYQA 4D71A 4JFTA 4O8AA 4JEJA 2EPOA 4WQ6A 1JD9A 1EH9A 2VKZG 2GSEA 1MQRA 3GG7A 3R12A 5AHFA 3ARWA 4UTKA 3H2FA 2R6OA 3B04A 4D1JA 3GNPA 1NQ6A 1BWLA 1Q6DA 4IIEA 3N11A 2WK2A 3B4UA 1ZHAA 3LX9A 1B3VA 4S1FA 2P8CA 3BGJA 1DJXA 2YL5A 5HMSA 2BVTA 5FJJA 4WGXA 4QP0A 4PBGA 2XVKA 1EWEA 2VD8A 2VGGA 3UD6A 1BTMA 1GNXA 1XYMA 1CGYA 1KV8A 3GAKA 1HKIA 1TQJA 3UCCA 3QC3A 1Q63A 1XGEA 2VFHA 1ONXA 1DJWA 1BAGA 3AO0A 3UCQA 1E0WA 1JXKA 4UR8A 4L80A 3NOEA 3OW1A 1MO0A 1AMYA 1R3YA 3HN3A 3UVIA 2A1YA 5HA7A 1Z89A 3WLHA 3PBVA 1JYWA 1OC6A 1L9WA 4UOJA 3PBWA 4QR6A 3UJFA 4HK6A 2PWEA 2V5LA 2FZNA 3S1UA 2Q3RA 1GZGA 2CYGA 4AVNA 2Y63A 3MVIA 2JQXA 2VR2A 3P67A 1GZ1A 3SAZA 3AMCA 3FK4A 2ATSA 4IIDA 2NT0A 3TOYA 2J8FA 3RCNA 4QHRA 2WJDA 2WKGA 3B0UX 2WVVB 5J5RA 1MW2A 2Y24A 1N8WA 2Z1VA 4WK9A 1A4MA 4A29A 1P1MA 3HG2A 3RLUA 3UZYA 4MNMA 4PCFA 3O0KA 3ATYA 4OUIA 2BHUA 3WF3A 5DFAA 2FFCA 1RCQA 3W1NA 2A3CA 5D09A 3FYOA 3LHZA 4NZJA 4KF1A 4ZOBA 3C8FA 1E0UA 1QOQA 3RR4A 3VA8A 3D3AA 3TVAA 3L4WA 1CECA 4KCTA 5FF7A 4JBRA 3EOEA 4LUYA 2IPGA 4KEZA 3CWNA 3BLDA 3SRHA 5DT7A 1POKA 5LIKX 5BZAA 1BD0A 1X39A 3EA1A 1Z7AA 2VGIA 1E1FA 2CXGA 3CZEA 2PMQA 4R9OA 3VXGA 2NZLA 1BYBA 1EDQA 2B4GA 1VBUA 1QI5A 2QCMA 1W2PA 1XR2A 1XI3A 3B0YA 4XZNX 4JX5A 2G37A 3GBDA 3GUWA 7TAAA 3EEZA 1UP0A 4LYRA 4P7LA 2W92A 5CPNA 4KETA 1TE6A 3W81A 3AICA 1K70A 4HPNA 1ZRQA 1FWNA 5EYWA 1LT8A 3VGFA 3AIQA 1TV7A 1ODUA 3UW6A 3TX9A 1BXBA 4C1NB 3KOYA 2FB2A 1H11A 3EAUA 3IS4A 4V33A 1J6PA 4X2PA 3KZPA 3W7NA 1ME7A 1FWEC 3W1AA 1LQ0A 3V0TA 1UASA 2DZXA 4J1OA 3BCDA 1HKJA 3WH7A 2NX9A 4ICMA 2J9ZA 1ZCCA 4D6EA 3G8EA 1VFOA 2E5BA 2IPFA 1TZ7A 2V67A 5AHLA 1DOSA 3QKZA 3MV01 4EVZA 2ZA2A 1SZNA 4HYVA 4MY9A 2P0IA 2C18A 3VC5A 5DRCA 1EPVA 4Y9PA 3L4ZA 4FLOA 1UKSA 2IW0A 2YCKX 1CXIA 3H26A 2DQWA 4DXVA 3WDJA 3BV7A 1SQ7A 1VFUA 3W7HA 1TYGA 2YBUA 5BU6A 1NELA 1KTBA 4ERIA 3A4WA 3B8SA 1EKOA 2ACQA 4XISA 3VOJA 4KGLA 3VIGA 2G4JA 3SSZA 4ZB0A 1XPGA 4Z0SA 1KRMA 1V3IA 2PODA 2VHLA 5HAOA 1J2BA 3U7BA 4HT3A 1PWMA 4MB5A 3TC6A 2PP0A 4JHMA 4K7VA 2TRSA 1UH2A 1Q6GA 4ATDA 2W27A 1MWOA 2VM8A 4TUFA 1HGWA 1S5VA 3KTSA 1UA3A 1OF6A 3NA8A 1PCWA 3UU0A 5CPOA 5GJPA 3TEVA 3WH9A 3MHFA 4YNGA 2FPYA 2D73A 2MANA 3NQVA 4AWEA 3CUFA 1SW7A 4DAIA 4E3TA 3M7SA 3VGGA 1PSCA 2CW6A 1M7OA 4W84A 3THDA 4LWWA 1X98A 3NQDA 2D0FA 3NPXA 3M0HA 2I5IA 3S0CA 4IQDA 1H5VA 3QVQA 5EMJA 4YHEA 1IR1A 1MW0A 4MIMA 4R7OA 2ZX8A 1P1XA 3CIVA 2PDLA 1ZP3A 1LORA 2D22A 2XYLA 3EDDA 1E4NA 3SRKA 3GH7A 1ZZMA 1TV3A 1FWFC 1K4GA 3M64A 4WDUA 3PUEA 3VD9A 1ZJIA 4PUUA 4QBXA 2ZZ6A 3VCNA 4X63A 3O2LA 3NAVA 3DHPA 4ICCX 3WY1A 1TO3A 3NQ2A 2GQ9A 3T9PA 3KBVA 4WOZA 2WVTA 1WV2A 4C6NA 4PMRA 2XTKA 4ATLA 1JCTA 4PRRA 1XBXA 1W1PA 4D6HA 4KCUA 1XHGA 1GJPA 3VNDA 3HPFA 3RX2A 5I24A 5LXEA 3N04A 1LTDA 4WY0A 1WXZA 1LG1A 3FS2A 1GVYA 3RAOA 1UZDA 1TTIA 3YPIA 2B7OA 1AW1A 5LIYX 3KDNA 5I06A 2BV9A 1PL9A 3UG5A 4XK2A 1FCQA 3NDYA 3AJ7A 4HMDA 1C8XA 4DYEA 3E5BA 5LA0A 1GVQA 3V36A 1FDJA 2XZ9A 4LAMA 1E70M 2OEJA 3QSRA 4CUCA 1J18A 3LUTA 1B57A 3AWOA 3LNMA 1PJ9A 4GYFA 4GO8A 4O1EA 3I7SA 1FHUA 3I4EA 4QDMA 4Z2KA 3T08A 1VD6A 4U3CA 3AXMA 4M7SA 1J8VA 5LHFA 1S5TA 3RPDA 1S5MA 1RCXB 2QUTA 2VX4A 3WNKA 2YPIA 4MB1A 3B97A 5LYRA 1K4HA 1GTEA 2VVNA 1XLGA 4CU8A 2A3BA 1FWAC 3OO2A 3S5SA 3GFZA 4MWAC 3IGXA 3SCUA 1S46A 4MNJA 1OFRA 3HU7A 3C0LA 5AECA 3O7UA 1VLIA 8XIMA 1LBMA 1VEMA 3P2VA 3E96A 3VDBA 1Z41A 3RXZA 2OZTA 4BQ3A 3WQFA 1XD0A 2GVLA 2Z28A 3CV2A 2DZAA 1JVNA 3UERA 1D3GA 2PLJA 2H9AB 1V02A 4BI5A 3T07A 1TPH1 2DZBA 3SCOA 2QCDA 3AIBA 4GFIA 5DXYA 1R9XA 1HKMA 1UR3M 4GJIA 4RE2A 4LS2A 1UR0A 1OYAA 3W29A 2XIMA 4P8WA 5F1VA 3ATZA 3MP5A 4ERGA 4WEVX 3UNDA 2C16A 1TSIA 2PTXA 2OLAA 1LL4A 3P61A 2CBVA 2YCLA 4Y6GA 3WDIA 3B8DA 4ZE4A 1RPXA 4LT9A 5BRBA 1BRLA 1LQ2A 3WQ4A 1OD8A 3QGKC 1LWHA 3Q37A 1DXEA 7PTDA 2DVUA 3K30A 1LLZA 4LVBA 4PCSA 2DT0A 4HZ7A 4GLEA 1QNVA 1QXLA 4CNSA 4DF1A 3AAMA 4HMEA 1GWJA 5EU9A 3THUA 5A69A 1EBGA 3M5YA 2WLZA 3QMRA 1A80A 2D1ZA 3I7QA 4G56A 3WNLA 4J2PA 7XIMA 2PCEA 3CS2A 1JFXA 4LY4A 3LCIA 1POJA 4NNBA 4JTDA 4IIGA 5HJLA 3ARRA 5KMYA 3OLIA 2OYKA 4GOAA 3BLKA 3BARA 4KWOA 4NI3A 3AHYA 1A5NC 3I6RA 3NGJA 4W85A 3KBWA 1US2A 3N15A 1TWIA 2PEVA 4UQCA 4D1IA 4RDZA 4I9AA 3C86A 3EPNA 5A6TC 1IT7A 3GDLA 2C19A 3M4HA 4MMWA 2ZUWA 2O9TA 2Y62A 3RILA 4YTRA 2NQHA 1QATA 4L4PA 2WM1A 1XKJA 1GW9A 2E5CA 1L6FA 1TPEA 4QJ3B 3GHRA 4ZOEA 2YFNA 4JCLA 4L7ZA 3W6MA 3HF3A 2QPSA 4H7ZA 1JGIA 3U9IA 4ADSA 3OOQA 4ZCWA 1BVNP 3VIKA 4AHQA 4CKQA 1V51A 2O0TA 1NF0A 3WQCA 1V3KA 1XISA 5BW6A 3LZ5A 3VNIA 1W3LA 5FJIA 1ITQA 5H6HA 2ALRA 2OT1A 4GIAA 2XIQA 3NQ7A 4POCA 3MBFA 2J66A 3M0JA 2QCHA 4IPPA 3ENLA 3NDOA 1E0TA 4FXRA 1H1YA 1IEIA 3CUGA 2CLIA 1TZ9A 2C13A 3W7CA 2E40A 3U5YA 4EPKA 4IIHA 4F4RA 1VPXA 4C1LA 4EK7A 2P53A 4LV4A 3FVDA 1UWUA 3BLEA 1EL3A 3IJ7A 2J88A 4I8YA 1LOQA 1JQXA 5JBFA 2G8ZA 4PB3A 2OTDA 1BSLA 5IFPA 4RK8A 3QHOA 5AHMA 3WLSA 3CT7A 3H4WA 4I3GA 4XD6A 5IM51 2D23A 1M7XA 3I68A 3T0BA 1M7PA 4WGHA 1OFAA 1J5SA 4H7CA 4LUJA 4F0HA 2ISSA 5JQ9A 4LANA 4KFOA 1H09A 5GNYA 1M03A 2PU0A 2WHKA 3WD4A 4MWAE 1W9PA 3HPSA 3M7WA 3TNBA 5F2MA 4IM4A 4RV3A 4Q3MA 3NXLA 1R85A 3WJSA 2XDFA 3CNYA 2PDXA 1ZBKA 3AYTA 4ICNA 5AKQA 2V5DA 2EKGA 2Z1BA 1B4KA 3KRSA 3NYDA 3EWCA 1DVJA 3WFAA 4L1GA 2GUYA 2INFA 6REQA 3PS7A 5AYXA 4EWJA 3LHWA 5REQB 3AHXA 4TVUA 1LDCA 4UFMA 1D7FA 1SO4A 1C91A 2FHCA 4RDVA 3KOFA 4QIUA 3OA3A 4ML9A 3WMLA 2OQYA 4IOTA 5EFDA 2B7QA 1CXLA 3VFCA 3LXAA 4XTIA 2DZTA 4UFIA 4ZZ9A 4HYWA 4KFPA 1HF6A 2FZMA 3BH4A 2ZX9A 3A4XA 3BTNA 5LGZA 2WMJA 3V3WA 2PDFA 3VM5A 4F9DA 5BWAA 1OGBA 3WJYA 3W75A 2ZDRA 4QX4A 1HGYA 1NP0A 4F79A 3W7PA 1XICA 4E0CA 2D0HA 3LCWA 4GCAA 1HUVA 1WP6A 2VEGA 3TW6A 1KXVA 1LRNA 2AQWA 1N8IA 4FXJA 1ZBCA 2HXUA 4EF9A 1KFWA 2NV9A 2VNCA 2ZE3A 1QWKA 3RFAA 4DBEA 4S3JA 3N2XA 2IMRA 2TPSA 3GZ3A 1TG7A 2PDJA 3N1AA 3H2AA 2DIKA 1QRQA 3N3MA 4D72A 1YNYA 3ZYZA 1H49A 5HMEA 5JIWA 2L5HA 1XCXA 4CCZA 3KVJA 3STEA 1XLJA 3B8WA 4A3QA 2UY2A 2VVSA 3T0DA 4PYSA 3GM8A 4GISA 1XIJA 2WHMA 3WQ8A 1CGTA 1VBHA 1P0NA 4BQ4A 5AB3A 4MUZA 2R1LA 2VR5A 3DFPA 3TYAA 1UW9A 2NWRA 1Q13A 3KS5A 1O4UA 3DBNA 4OBRA 2CKRA 5SWUA 2J13A 3LZ3A 2XU2A 3VU2A 1TJ1A 1IGWA 3KHDA 3WLQA 4AC7C 3N73A 4W9TA 5GJNA 5IRPA 1TRDA 2V3GA 4BWLC 3IGUA 4WZHA 2VL4A 3W25A 4DB7A 1SMDA 4A05A 4UB9A 3MKCA 3HQNA 1KWKA 1J5TA 3AISA 1W9VA 1ISYA 1H7PA 1ZP4A 4PUDA 2YIHA 4UTTA 2E4TA 3H7UA 1O95A 4QISA 3DG3A 2X0HA 2W63A 1CWYA 2GQ8A 3IIXA 2FMOA 1DWAM 4XSLA 5CC3A 1JPDX 5G2WA 2WXDM 4GZ7A 3VNLA 2X7WA 3K8LA 4C7GA 1EDTA 2A7NA 1QCWA 2X0YA 3TMQA 1IEXA 3LMYA 5AC8A 1GYMA 2CESA 2Q09A 4IMDA 1HJUA 3VUPA 4X2RA 2OSWA 1UZHA 3P8IA 4E2VA 4PRWA 4JTUA 2CLOA 2PTDA 1E73M 4U5IA 3HQOA 4A2RA 4RPQA 4WSKA 1UQZA 2CEQA 2FZ9A 4QFUA 4OOUA 4UNLA 4GACA 5CLWA 3VINA 2WC7A 1XLLA 3STCA 2QJGA 4WJEA 2PGWA 5C9XA 1SW3A 2YOCA 4JYEA 5IXEA 3GXPA 3N2BA 3TMLA 3K1GA 4O10A 4M8UA 5F4XA 5HNRA 3NVDA 4MJ2A 3SCTA 2QCDB 5M3WA 5CJMA 1W3NA 1ONWA 5A6JA 5H8PA 1T8XA 2VQUA 1IWPA 1Q4NX 1JPMA 1UP2A 1Z44A 2D3LA 3PZQA 3SQMA 1CNVA 4GWEA 3S42A 2DGAA 3TK7A 2J75A 4Q7BA 3AJXA 4XQ6A 1JEZA 2PUZA 3W1TA 5BMWA 1RP8A 3W74A 4WVXA 2Y4SA 5LNWA 4EF8A 5T9BG 2HVMA 4ROQA 3APGA 3FHAA 3BQ5A 4M1BA 4RE4A 2PLCA 2W62A 3TTOA 3JZEA 4CQ9A 3S5YA 1DJNA 2Y85A 4ZL1A 1KCKA 2WCAA 1EP2A 1NOWA 1THFD 4W93A 2BHYA 3RIKA 5D9MA 1R5YA 3QYSA 4TU1A 4GRSA 4AY1A 9CGTA 2VTFA 2JIWA 3ZJ8A 1XCFA 5I02A 4B9YA 2A6NA 2FGBA 3V5CA 1B3ZA 2UY5A 4NAEA 4JKMA 1WA3A 4O16A 1W9DM 4EE9A 3F1QA 2IS7A 4PTVA 3RPMA 1ICPA 1XLKA 5HQEA 4EKJA 1TRIA 4K6AA 1NWUA 4AY8A 1G6CA 3WF2A 3ZLHA 4I7WA 1W3KA 4X9YA 1Q6LA 1TR1A 3UZ5A 2BVWA 4MLRA 4X61A 2HPIA 4Q32A 1ZL1A 2BY2A 2J25A 2I16A 2Q8XA 4L61A 4U28A 3NL6A 1WPCA 2YL8A 3HOJA 3SCRA 4Z1DA 1HJWA 4REQA 2F6XA 3D46A 4FLRA 1MDRA 4JEQA 3HPZA 5I2UA 3QTGA 2ABAA 2A2IA 3DYOA 3EX2A 3B9NA 5DY2A 1K1DA 2QEZA 3RCMA 3W2NA 3WD0A 2KAUC 5HATA 3B8IA 2J6XA 2QGYA 4TV5A 5C7HA 3W72A 5HK4A 1H7RA 2OQHA 1BSIA 5D30A 1D3CA 3KLKA 1ECEA 3V16A 2XIJA 3ZVHB 3ABSA 3VCRA 3O63A 3W28A 2A85A 1OC5A 2VZTA 1PE1A 1UMLA 5B7YA 2HV5A 4JKLA 4GXWA 4HHHA 3CQKA 1W5PA 4G8TA 2BASA 1EF3A 3W01A 2Z29A 2W61A 4FNRA 2YZ5A 1X96A 4TTUA 4B3LA 1A5BA 6ALDA 1RV8A 1PPIA 4PCTA 1JCXA 4EXQA 2C0HA 2CERA 2REQB 2DSVA 1ICQA 4AZBA 2PRHA 2C8NA 1VHCA 4M29A 4IGMA 4S3BA 2NXGA 3TZFA 4JTEA 3CL6A 2FH6A 1TR9A 4JIRA 2PFHA 4TR9A 1UPMB 4FS9A 3FOKA 3VGBA 2Y7EA 3QC0A 3LBMA 1DQUA 3CYVA 1EUAA 1JPHA 1AG1O 2BVYA 5MHBA 1YE4A 1J0IA 4HHPA 3CPGA 3QV7A 3LHTA 4H8UA 4UTLA 3SY1A 3DFOA 3TXZA 4C6PA 2Z4GA 5G1TA 4U4MA 4ILSA 2W3ZA 3K8KA 1V6VA 3KBSA 1PKYA 4E8CA 1BKSA 1GVFA 3CAVA 2FTYA 1VLWA 1O66A 2DDXA 3KL3A 4NAFB 1U5HA 1XIGA 4FLQA 1CLKA 1X7FA 1EEXA 3DHDA 1WKDA 3BZGA 4L4MA 3TCSA 2I17A 3O6CA 3DOPA 3CGTA 1PEZA 2XVLA 5CZKA 4GI6A 5TIMA 4RW5A 4ONVA 3S1XA 4H2CA 2PTWA 1J0ZA 3UR7A 1SMAA 3JR2A 4H7VA 3VNJA 2E9BA 5IDZA 1OJXA 2OKTA 1WAWA 2QPXA 3O15A 1I4NA 1AJ2A 3CL7A 3W1PA 4CVUA 1TZZA 3TWAA 1KR1A 3GVWA 3NQ8A 2ZRYA 3WK2A 3TJ4A 2PDQA 2GDVA 4HMCA 3NQEA 3OZPA 4J3TA 1YKWA 3PPCA 4YU1A 2IXVA 1RCOB 4CQDA 5K9CA 1ZB5A 3STGA 4QROA 1TPB1 1U1JA 1RR2A 5CPMA 2YL6A 3P81A 1GQJA 1EHNA 1Y8BA 2EAWA 4I90A 2F9RA 1MEWA 3TOPA 1Q85A 2BNJA 3SURA 3UG4A 3SRDA 3CAWA 1WDRA 3WSUA 3JUGA 3E1F1 1E0XA 2WVSA 3AS2A 1QI4A 4JPGA 4FXSA 5MKGB 3E2SA 3VOIA 1J6OA 1VCFA 2PBGA 1KLZA 2HBXA 3G6LA 2ZZ2A 2D2JA 4P7RA 4P8VA 5ABEA 1GG0A 5H2ZA 2J74A 2VDHA 2RKXA 4QE1A 1XRSA 3L65A 4UTIA 1GZJA 1KFCA 3TN5A 2HSAA 1EC9A 3FV9A 3AYRA 1RJRA 1A3XA 2KZHA 3QPZA 3IV8A 1TVNA 3M0ZA 4A8RA 1ZBWA 2D69A 3MDWA 3N3TA 1ISWA 2BMBA 1A50A 3Q65A 4GBUA 2UY3A 4Y2WA 4N9BA 3NSMA 3QY7A 1YTDA 5C55A 2NUXA 1M6JA 4ZO7A 4IUGA 1E4MM 1DIKA 1TJRA 3ITTA 1QU4A 1YW1A 5G4EA 3W7GA 1C7SA 3SJ3A 2CZDA 2R14A 1SGJA 4YWSA 3PTQA 5CC6A 3RMEA 2WSRA 3U4AA 4IZGA 2POZA 4N9EA 3BLFA 1Z42A 2VX6A 1G4SA 5A8GA 2YJQA 2IPWA 3M1ZA 1UWSA 4JTJA 3ELFA 4GKLA 4RJEA 3S6OA 1J93A 3VOGA 3E12A 4IP7A 2EPKX 3KWSA 1Q6CA 1PO9A 1H3GA 5TF0A 2XN2A 1LWIA 2V6AA 3UA4A 3NUKA 1Q7MA 2OX4A 4HA1A 4O50A 1OSEA 3TQKA 4DF0A 4W89A 3IK4A 3DI0A 4HZ6A 4U2ZA 1DTNA 4AZGA 5AC5A 1KKOA 4F40A 3IRDA 5F2LA 2XG9A 3RNDA 2PPGA 1PYFA 3TSBA 2A3HA 5D9NA 3W26A 3VIJA 4LY8A 1UIOA 1NDVA 3B06A 3O3RA 3GNRA 4NIRA 4PR4A 4UC5A 2WZTA 4GNVA 3T2QA 4C1KA 3GWQA 1Y65A 4XWUA 3A22A 3HG3A 4US6A 3I10A 4NNCA 3NR0A 1BTCA 4AZCA 4XX6A 5E93A 3MSYA 4AMAA 4FF7A 2BGSA 1NWRA 2H6RA 4C6DA 3A3XA 5PTDA 4PUEA 3NZRA 4GH3A 2DVTA 2TYSA 4RPPA 3D6NA 5HJXA 1RLDA 3BAIA 2A21A 4QEEA 1QW8A 3IANA 3UT0A 5KEZA 4JQ1A 3DU0A 4FLSA 3FKRA 3W76A 4LVGA 3H7VA 3TLQA 3SFWA 2WCSA 4L1WA 3S47A 3R7MA 3K5XA 4AD5A 2YCJA 2FIQA 4DAFA 2CKSA 2NQ5A 2HRWA 1NP2A 4W8LA 1L8NA 2MUCA 1R7AA 3DFQA 1HL2A 3K2GA 1EJRC 2PA6A 1P6BA 1WX0A 3KDOA 3URBA 2OEMA 1MYRA 1MUCA 1RJPA 3P6LA 3ARPA 4JDYA 3L2MA 3WK1A 3OGRA 1OK4A 2DT2A 5FCZA 2GUUA 3B03A 1T96A 3VZYA 3G24A 4AW7A 4DNMA 3XISA 5E6ZA 3EOSA 3W1UA 5D9PA 4AEEA 3MMDA 3G1DA 3UPWA 1CXHA 3CB3A 4LTSA 5C7VA 4UUIA 1UR9A 3C2RA 2DVXA 5G4WA 2GWNA 3AHTA 3CT2A 3EWDA 5FKYA 3BOXA 3NQBA 3WLOA 1SFLA 2V5JA 3UZXA 1TA3B 3F5JA 3MB9A 3WNMA 2WANA 4CD8A 4MZ8A 1B4EA 1WXJA 1EZ2A 3SGUA 3WYZA 1EXPA 5CGMA 3VMPA 1JF5A 2R24A 1G69A 3S1VA 2D0GA 5ECUA 1HW6A 3N19B 2YFOA 2E0PA 3NDZA 1PAMA 1QPOA 4B5NA 3OYXA 1N55A 1OK6A 4P7QA 3WMBA 4FAMA 2BS9A 3O6DA 2GQ3A 5ABHA 1A0CA 1RJQA 1VHNA 4ZR8A 3GB6A 2E6AA 1BVWA 3QPEA 1C3FA 1US3A 3M0VA 1FQ0A 3QZAA 1U83A 1VS1A 5FJUA 3NZQA 4CD7A 5E5CA 2PURA 3A64A 3BMXA 3GS6A 1NVMA 2DV0A 4LCQA 1F2JA 2QV4A 5DANA 4E8DA 4JFSA 1TMLA 4HNOA 3FDKA 1HO4A 3OQ8A 4F48A 2VEIA 1D9EA 3UY8A 1QHPA 3S9IA 2GLKA 2X7VA 1GUVA 4Z1YA 1EPXA 1JDAA 1EJUC 3PAOA 1CGUA 3W7IA 1CGWA 4KEMA 4JQ3A 1BQCA 1MRAA 4QLKA 4UOZA 2VX7A 1K3UA 4CGTA 3STPA 1AK5A 4Q8VA 4PMVA 1GVEA 2IKHA 1RVGA 2RUSA 3GIPA 3WJWA 3UVAA 2O9RA 2QDEA 3LHYA 2G4FA 1UC4A 3S1WA 3CM4A 1JZ4A 3WQEA 1V93A 3QGAC 3SGZA 4PCNA 3OLGA 5EB8A 1DJIA 2AKMA 3WKZA 4FALA 1R47A 2QYGA 1FCBA 3CB8A 1A5MC 4YCPA 3ZJ7A 2A0NA 2D2OA 4Q22A 2QMKA 4S3AA 1G4TA 3KRBA 4LUIA 3G0UA 3GR7A 2PWGA 4GI8A 2OZ0A 3H2NA 5C9UA 1S2AA 3UXLA 3L67A 2JGQA 5D05A 3LEPA 1JD7A 1S2VA 1EYWA 1KR0A 2ODOA 1W3IA 4US5A 3APYA 2YA0A 5FJRA 1GOXA 3TXVA 5MKGA 1DIEA 2OLHA 3W07A 2ZX7A 3PZUA 3EX3A 4MF4A 1JDDA 1O5KA 1PX8A 2QR6A 4IJCA 3R5EA 4DNHA 1UQYA 4AZIA 5LIXX 5HNNA 4HP5A 1DJQA 4Q7IA 3EOUA 3G77A 4EIVA 2E9MA 3MMWA 5JBEA 2J7FA 1TPUA 2OFJA 1EX5A 5DMMA 1Q66A 4L56A 3FJNA 7ENLA 1XDMA 2GDUA 1XLEA 2ZXDA 2PDPA 2XINA 4W87A 3CQIA 3VDHA 4X3ZA 3VKJA 3QFEA 4CNTA 1CCWB 2HQAA 2LLEA 1W9XA 1ALDA 5KTLA 1O94A 2DH3A 4J2MA 4DEFA 2YR1A 1RXOB 1ML1A 3E3HA 1B3XA 5BXPA 2QUUA 2GFTA 1UR8A 5FF0A 2HMCA 3OVPA 4PMXA 1Z3NA 2DP3A 2FZ8A 2V2HA 3TW7A 3W86A 2ZZ1A 3MP4A 3RLVA 4PFMA 2NXHA 1RD6A 3IIOA 1RBLA 1X1OA 1TIMA 2X1TA 2ZWZA 1SPQA 5DMYA 4G7EA 2F8QA 2Z2BA 1ZBVA 4E4UA 1UZ1A 2EG8A 3G1SA 1UD8A 2W5FA 5EMUA 1R9YA 3DECA 4K38A 3UPBA 5CEWA 4XKYB 2CC0A 4PRTA 1AH0A 4GIRA 1WQ5A 2R82A 1GVSA 1QNQA 2PD5A