1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
2A0NA 2QDGA 5FF7A 2RH9A 2KZHA 4FNTA 3HGJA 4UIOA 5AHIA 1FWTA 4PEKA 1R47A 3E9AA 3U6WA 3LXAA 2WSRA 1LTDA 4QSHA 4GUHA 4MY9A 4JEQA 5D2VA 4UTMA 3FIGA 4Q32A 4JY9A 1S5VA 4AXKA 2HSAA 1YDOA 3G1HA 3MYPA 1AW5A 1B9BA 5CSRA 3U8GA 3LXCA 3SGZA 3VI2A 1OFBA 4XWUA 3PG8A 4R33A 3PBUA 1OABA 3HPZA 6ALDA 4BF9A 3L5MA 1QPRA 3MP4A 1GVOA 1VPXA 3NGJA 3W3OA 1Z41A 5AYZA 1S5TA 4JY8A 2Z2UA 4M6PA 2P10A 1JRCA 1LBFA 1FCUA 1AL7A 2X1RA 3BK0A 5AFDA 3N3MA 3HQ1A 1XCFA 3C3NA 2I1OA 4WUIA 4CNOA 2OMAA 3R2GA 1H61A 1TB3A 2EHHA 4X2RA 1KM3A 3I6RA 1IF2A 1QMLA 4JR5A 4JTFA 2YPIA 2Y7FA 2H3DA 2Y7GA 2ZZ7A 1K7EA 1WV2A 3L0NA 1O95A 4UR8A 2Q8LA 1XXXA 3DH7A 4Z1AA 2NZLA 3OEXA 3KHJA 3OG3A 3W73A 3B8DA 4PCFA 3B4UA 4K36A 3Q37A 5K9CA 4MJZA 3IEBA 1VCGA 3EX2A 1QPQA 3IIPA 1LLWA 3G22A 1WDWA 2ISWA 5I3GA 1ADOA 1H1YA 4H6KA 1A5SA 4IMEA 3L67A 1FWRA 4FX6M 4KWVA 3UWWA 3W1LA 4NX5A 3S6DA 4HN4A 5AB3A 5CPMA 3LHYA 1Q45A 1DKWA 2Y88A 2LLEA 2C0AA 1Z44A 3W7HA 3S8HA 3LI0A 1F5ZA 1L6WA 2XN1A 1H1ZA 4H3DA 4UFKA 1VH7A 2ZRVA 3BVJA 1QOPA 3MI2A 3N9SA 1M5WA 3VFLA 4FIRA 3NPUA 4QJ1A 1GVFA 4I7UA 3VNDA 5BOOA 5DY2A 4HSOA 2WV8A 4BI7A 3QF0A 1XI3A 4C1LA 3GKFA 4HNTA 4XTIA 1W0MA 5CGQA 4NX0A 5DCEA 4HIBA 2UV8G 2PRMA 4UFHA 3LCHA 5G2WA 3S1VA 2NX1A 5ABTA 3DFOA 2AGKA 1NVMA 2CU0A 3I65A 3TMQA 1IIHA 4O10A 2X30A 5CPOA 3QM3A 3B0PA 1KFJA 3NQ2A 3LV5A 4AWUA 1FXPA 1WBHA 5LKYA 2PRLA 4KWWA 4A3UA 2FQIA 2QCNA 4YXGA 3M5VA 5HQEA 5A8GA 4JTUA 4OGZA 3LHWA 3RLUA 2Z6JA 3A22A 4JTGA 4IUOA 4O16A 1SZNA 1E51A 4O4VA 1V5XA 2P1FA 2QAFA 1SW0A 5F2LA 2ZZ4A 3I7SA 4IX2A 4K6AA 3CT7A 3A5VA 3YPIA 1L9WA 3SGUA 1O94A 3UD6A 3DKJA 2WO5A 3DU0A 3W9ZA 1DL3A 4Y8FA 5HWNA 2QJIA 2TSYA 2ZFAA 3NPWA 1KTNA 2YXGA 3M7WA 3KXQA 1SZEA 2DORA 1MSSA 1I2OA 1Z48A 2FPVA 3CM4A 1HO4A 4N4QA 1G69A 3EWYA 3KVLA 2QF7A 2BXVA 4WY0B 2PCQA 1H7XA 3AJXA 5FF0A 3O1NA 1A5CA 1TQXA 3W7DA 1W5QA 3BV4A 3JR2A 4JX5A 3W7EA 3M47A 4NJIA 2JKAA 2TPSA 5DXXA 4AF0B 4JXCA 1Y0EA 5D30A 4OU1A 1B4EA 1VCFA 2AAMA 1PE1A 1K7FA 1OVDA 3L21A 3NXFA 1SZGA 4MZYA 2GVLA 4GUGA 3WJSA 4WY0F 3W7QA 4I9AA 2FIQA 3EKZA 3MWAA 1Q6RA 1VYSX 4IWWA 4JIPA 5AYXA 1TPH1 2QCGA 1DV7A 3G24A 1TSIA 3PY2A 5DBUA 3NQCA 1OX4B 3BW3A 5I3HA 4HPJA 5D2YA 4XTDA 4GUIA 1UB3A 2CLLA 1XBZA 1SZFA 1P4CA 2ZZ2A 3ANYA 4RK8A 2R14A 4KKXA 5SWUA 1GQNA 3K30A 1G4PA 2B7QA 3NZRA 4IGHA 2ATMA 1ZCOA 1MEIA 4ALDA 4EOUA 3P84A 4IQLA 4LVAA 2GVGA 1SO4A 3PBYA 2HMCA 3LHVA 3B04A 3CPRA 3IIZA 4JTHA 5G4EA 3Q58A 1NAL1 1A5BA 1ZY9A 4PA8A 1FDYA 3ZFHA 1X1ZA 1YYAA 4DBDA 4LW7A 4LU0A 4UTWA 1M6JA 1K03A 1I2PA 2WPBA 4CQAA 2RDUA 3W1UA 1VCVA 4JICA 4HSNA 4LC6A 1O4UA 3KX6A 4LC8A 3M5ZA 1WBJA 3UZ5A 2Q8ZA 4JS3A 5KMYA 2C18A 1LRQA 2VEPA 3MI3A 2G96A 3UXAA 1M7PA 1FWWA 5GVJA 1XUUA 1X1OA 2E5CA 2R8WA 3HJZA 2Y70A 3G1XA 4FEZA 4Z1BA 2PE4A 5K9DA 1G7UA 3GZ3A 3P7YA 1BKSA 3B05A 4JYFA 1ALDA 1TPDA 3WK3A 4P61A 5K4ZA 4EVZA 4A22A 3PBVA 1YXYA 3W1XA 4Y96A 5KZMA 4OHQA 3GYEA 2Y85A 1ICSA 4CQ8A 3DKLA 2NUWA 4MY1A 3UXDA 3W23A 1JCYA 1QR7A 2BSLA 4P2VA 3O07A 2CFFA 3G8EA 4MLJA 3L66A 1F6PA 2DZPA 1ZENA 3M9YA 1PHWA 2GQ8A 3GIYA 4R7JA 3L65A 5D2XA 3S5ZA 3NDOA 4IMFA 2CLHA 1XDMA 1LYXA 1FCBA 3TX9A 2ZRUA 4GE8A 3LM7A 1QWGA 3R5EA 1K3UA 1VLWA 3W1NA 2D73A 2V81A 3QZEA 4AMAA 4TR9A 3H55A 3ABOA 4LV4A 3TH6A 2C6QA 3NL6A 4UFIA 3V75A 3NVTA 1JR1A 1JUKA 2DZVA 2FTPA 3EEGA 3UZJA 3EX1A 4NJGA 5LNVA 3UWQA 3C52A 2WNQA 4Y90A 1VC4A 3HPSA 3LLFA 4GJ1A 1VS1A 4YCPA 1FDJA 3BGJA 3TC7A 3TK7A 2VOMA 3FOKA 2EAWA 3QPYA 2B7PA 3TROA 3O6YX 4JTLA 4DF0A 4XUGA 4UTKA 3E96A 3NO5A 1LOLA 2Q3OA 3W7PA 5D03A 3G0UA 1H5YA 1PV8A 2C15A 2GJNA 3PG9A 1TRDA 2QCEA 5IBXA 2DJLA 1OK6A 3MYOA 3O63A 2X1SA 1FX6A 3ABQA 4NNBA 3OBKA 3IVSA 5HWMA 3MBFA 3CIWA 1H60A 5CZSA 2WOQA 2E77A 3DFTA 3UWZA 3W1TA 3NOEA 1TO3A 3QSTA 4HNVA 2ZZ1A 1TTPA 5D2WA 4GWEA 3LRMA 3LTSA 4IJBA 3W85A 5F1VA 2V5BA 3CTLA 5AYYA 3P60A 4YL2A 2B7NA 3GDRA 4QIUA 2X1TA 3DI1A 2VC6A 1OJXA 5DLCA 5FEXA 4E0CA 3A23A 3L0GA 1YLVA 5AC7A 5K3VA 1TMHA 3C2FA 5E0KA 4K37A 1DBTA 1KM0A 4WD0A 3DENA 2C3ZA 2ZZ5A 1K8ZA 2PC4A 4POCA 1KLYA 3L5LA 2Z1BA 4LUIA 1LBMA 1JVNA 2YYUA 2VXNA 3HG5A 1ZALA 2C19A 5I3JA 4TMCA 2GJLA 4Y9AA 3TJXA 1VGAA 1JCLA 3IGUA 5I3FA 3A24A 1DVJA 4BWLC 5D05A 1IGSA 1YPFA 4LS1A 5HNRA 4UUIA 3MHGA 4ADTA 2OCZA 1XFBA 1QNVA 3T55A 4RZ6A 1QFEA 1T0OA 1EPXA 3H54A 3W7OA 1TPVA 3GR8A 3QFEA 1GZGA 1JCXA 1GPWA 3P80A 1B4KA 4UTUA 3VKJA 5C6MA 4NZFA 5FEPA 2EF9A 3LX9A 3WK2A 4M6VA 3W07A 3GVGA 3ZWSA 2A5HA 3DHDA 2FPYA 3RU6A 2DZWA 1K8YA 3PSVA 4KFOA 1MZHA 2C13A 1OYCA 3EX4A 3PF3A 3SR7A 1AL8A 4UTLA 1TV8A 4OE7A 1SO3A 2A1YA 4K39A 4OWGA 4DBEA 4YWIA 4NXSA 1DJQA 2A7NA 3BG3A 4DO4A 1QO5A 1ONRA 1OX6A 3GDKA 3U2OA 2GPTA 4LVBA 4PODA 2J24A 3PB0A 1WOBA 5F2IA 5I3KA 1AW1A 1DJNA 1GYLA 4R53A 2YX0A 4HKPA 5T26A 1GTEA 3DFNA 4X9SA 3R89A 3M44A 3BO9A 1C9DA 1XDLA 4FIQA 2H3BA 2BLEA 3NQVA 3BG5A 5L9FA 3NQAA 3T78A 1H7WA 4XKYA 3MUXA 4EIVA 1ME8A 1P0NA 1VR6A 3BW4A 3WJWA 5CPNA 2NV2A 2VELA 2WJZA 1S5WA 3NG3A 4GRSA 3KFTA 3OVQA 1T96A 2DJXA 2CLEA 4IMGA 4QM1A 4MYAA 5DCDA 2VFIA 4YCOA 1KFCA 5HINA 2B4GA 5HULA 1WX0A 1T99A 1EWDA 4WOQA 4DELA 1WA3A 5EKYA 4K8HA 2ABAA 3W2MA 3NM3A 3W2NA 4BFAA 1RD5A 4GNJA 5FI8A 4UTTA 1R2SA 4O54A 1X7FA 2CZDA 1TV5A 4ML9A 3MHUA 3UPWA 1QPOA 5J5RA 3KOFA 5LNWA 3HGOA 3RFAA 1KM1A 1FUYA 5FF3A 1B3OA 5C2XA 3UWUA 3LGEA 4MVAA 2ZZ6A 3T7VA 4CQ9A 3F03K 2FLIA 3DI0A 3QC3A 3L68A 1KFLA 2V2HA 4NNCA 4X3ZA 5K7JA 3GAKA 1HFBA 3P5YA 5KZDA 1PIIA 3KRUA 3TA6A 2ZRZA 4OBTA 1K8XA 4N9CA 4H4IA 5LNSA 2J9YA 4XQ6A 1GVRA 2H90A 1EP1A 1JUBA 2JGYA 3BLFA 4ZQOA 3HO8A 1HO1A 3W75A 4N6EA 3TUUA 1TYGA 3C4UA 4LRTA 4A29A 3ELFA 1SW7A 2BWGA 4D2JA 2OT0A 3IGSA 2NXGA 5LHFA 1I2QA 4S2BA 3HOJA 2Q3RA 3TIMA 4JDYA 4XZ9A 1OFOA 4FNUA 4MLRA 1I4NA 3WJYA 5CKSA 3GXTA 3W70A 1W8SA 4YMZA 1OFEA 3H53A 1OFRA 4FX7A 4JIQA 1OYAA 2QUUA 3S1XA 1SR9A 2J9XA 3W88A 3LTPA 2GQAA 3IVUA 4NZJA 4GXMA 4LUJA 1FY6A 2B0MA 1OF8A 3CEUA 5LNRA 5F2MA 2YDAA 1L6SA 1TV7A 3OIXA 1G4SA 4AAJA 2VKZG 3LCGA 4IPIA 4NU7A 1EX5A 4PL1A 4DO5A 3P8IA 5AHEA 2QCDA 3SI9A 1LZOA 1P1XA 2CZFA 1LLZA 3TR2A 2PURA 3STFA 3LHZA 3FJLA 4NJKA 1TPB1 2ZA1A 3TDFA 4LV9A 3W2LA 3BLIA 4LS2A 2FB3A 4CCEA 1N7KA 1YXDA 1SU5A 1OFQA 3ABSA 4JTIA 1U83A 1BWKA 4QITA 3PULA 3W1RA 2E6DA 3TSBA 4DQWA 3NQFA 3TKFA 5LNUA 5HR6A 4AH7A 4LVDA 2NLIA 5DBTA 5L6UA 3EX3A 2A85A 4S2CA 3R8RA 2G95A 1TTQA 3Q94A 2BZNA 1KM5A 5LHEA 3NQDA 3P61A 3QW3A 1XM3A 4LY8A 1Q6OA 1ICQA 4FNSA 4O14A 4M6QA 4UFMA 1EEPA 3LXBA 5H2ZA 3PWAA 4LNYA 1KM2A 5D04C 1TIMA 5HMSA 1G7VA 3DFPA 3LHTA 2BX7A 3BW2A 4I7VA 4LWWA 3MW7A 2ABBA 1I2NA 5EMUA 2FJKA 1RQEA 3B06A 4MFDA 1GEQA 3RK8A 5LSMA 4ADSA 3FYPA 1GG1A 2EGZA 2QKFA 5FEWA 2QCLA 4FB7A 3M0ZA 3C8FA 4Z0SA 4K38A 3GLCA 1UUOA 1TRIA 4JTJA 2J6XA 4N6FA 3NQMA 4O28A 2JBMA 1DOSA 5DELA 1FDZA 4NT0A 4MFEA 4MKNA 2CLOA 2VEMA 2CZEA 5CG7A 2J27A 5HUPA 3MMTA 3W76A 3BPWA 1OFPA 2ZBTA 4LTSA 4FNQA 3UWYA 3RNDA 3DXIA 2YW3A 1C29A 3UPBA 1LOSA 3W74A 2CLMA 3LCIA 1IXPA 1W5NA 3GX9A 3N73A 5G2HA 1SO6A 2ISVA 3NYZA 3LCLA 4E2BA 1W54A 4O52A 1W5OA 4UC5A 4BK9A 2QCCA 4QNWA 1EIXA 1SW3A 4UFJA 1KA9F 2GVJA 2R91A 1LDCA 5D37A 3S5NA 3PVFA 3T40A 2QJHA 4UFLA 5LZLA 3C56A 1F6KA 4BI6A 1UUMA 1FQ0A 1IIGA 2E1DA 3ZS4A 3NQEA 4EF9A 4JTTA 3TXVA 3PB2A 3L5AA 1OF6A 3TSMA 2H6RA 5LGXA 3GXPA 1ML1A 5D38A 5E93A 3FFSA 1EUAA 4Z08A 5KTLA 4MZ8A 1GYNA 3M41A 3QRHA 5HR7A 3WJXA 3STEA 3C2VA 3CQ0A 4IPJA 4JNMA 4O1DA 4O17A 5DY3A 3W84A 3FKKA 4LVGA 3G0XA 4O1BA 1HL2A 3DBPA 4JDBA 1AK5A 1K7XA 5BMXA 3EKLA 4LS0A 1X6UA 1JCJA 3NQ7A 3SIZA 3F1QA 4XBSA 3G1YA 3HIJA 1TPEA 4ORIA 5AHFA 5H91A 2ATSA 2DU2A 4MOZA 1CW2A 1VYRA 3VE7A 4ZL1A 2Y7DA 1ME7A 4IX0A 1EUNA 3W7GA 4PC8A 1SO5A 3B03A 2GOUA 3E0IA 2DZSA 2EPHA 2VFFA 5MHBA 1ZFJA 4TU1A 4ZZ9A 3S0CA 3LB0A 5AHMA 1FXQA 4UMCA 1GVSA 4HNUA 4PL2A 3C2EA 2A6LA 5K2ZA 1ZAJA 3QEZA 2E5DA 1HG3A 4G1KA 1RPXA 2EKCA 1NF0A 2ZTJA 1JQVA 5C55A 5IM51 1P0KA 1RV8A 5TQLA 5KITA 1WAUA 8TIMA 3SW6A 3NQGA 1AMKA 1GG0A 1TPFA 1YTKA 2QDHA 1DHPA 1DORA 4UTHA 3VE9A 2Y7EA 2H8ZA 2QCMA 4ONVA 3CC1A 3LV6A 4O53A 2DZXA 2YYTA 3KVMA 3CWNA 3N19B 3A9IA 1A5AA 2ZTKA 4QISA 5TIMA 1XUZA 2H8XA 5KINA 2X16A 2ZA2A 5EPDA 1R30A 3WK1A 2GQ9A 2W6RA 2J88A 4O4WA 3TMLA 1H7RA 4JYEA 3MI6A 3GXNA 1TQJA 3LRLA 4FX8A 3TQKA 4LRSA 4O19A 3G1DA 3NPVA 7TIMA 4FF7A 1EP3A 1UBSA 2VENA 2ZZ3A 2QUVA 3N34A 5DN1A 4MYXA 2V2CA 4EF8A 1EA0A 3QW4B 2VEKA 2DP3A 1KBIA 4UTWC 2CLFA 1RZMA 4N4PA 2O7SA 4AHQA 2FDSA 4WQ6A 2G97A 1R46A 3T44A 2CWNA 2JKEA 4NVTA 1S3HA 3P67A 1G4TA 4FNPA 4OV9A 4R34A 4AHPA 1TCDA 2QUTA 4W9TA 3O06A 2HS6A 3OA3A 5D2TA 1IXOA 3R13A 1JQXA 4PFMA 3EWBX 2NWSA 3M5YA 3NEVA 5BRBA 1SFJA 2C16A 1LRTA 1I45A 1U5JA 4K7YA 3WJZA 5U7SA 3PSWA 1ZHAA 3E49A 1LM1A 3G1FA 3W2KA 1O5KA 1SPQA 3FKRA 3C2OA 3M5XA 3STGA 5I3IA 3KAOA 5AC6A 3S5YA 4N9DA 2E6FA 3NL5A 3JS3A 1ZAHA 2CW6A 4K8EA 3QMRA 4M5PA 4ZQMA 4A21A 3STCA 3FLUA 4GBUA 1YTDA 2RDTA 3NA8A 1FWNA 5A5WA 5U4NA 1KV8A 4JTSA 3HF3A 2PRHA 4UMBA 4DF1A 1OFAA 1W5MA 1SQ7A 1W3NA 3O05A 1EP2A 3W1AA 1B57A 1CX9A 3LCFA 2QEZA 3FS2A 4IXXA 3LLDA 5EA9A 2Y61A 2ZA3A 5BNKA 3TJLA 1D3HA 4RLIA 3TW7A 1Z42A 3IV3A 2VFEA 4TO8A 3W2JA 1KFKA 3LBMA 3P81A 1KLZA 1OK4A 4O12A 4Z1CA 5EBUA 2V30A 3FJ6A 2RDWA 3S1UA 3Q2DA 5CSSA 4QNEA 2HTMA 4AWTA 1O60A 3SECA 4ZMGA 2Y62A 4LOCA 1ZAIA 4DXVA 4HNNA 1JRBA 2E09A 3CEPA 3N2XA 3F4NA 2WSYA 3SY5A 4KFNA 3F4WA 3C2RA 1I8JA 3TQVA 3TFCA 2ZRXA 2NUXA 2V0TA 2ZCGA 3THAA 3HGRA 1BTMA 5EYWA 4WX2A 3NQ8A 3I7QA 3MP3A 1FCQA 4NUWA 4UNLA 3G1VA 1ICPA 1KV5A 2A7PA 2QCHA 3IIVA 4DEFA 3M6YA 2X2GA 4ICNA 3L9CA 4UXDA 1ZJIA 3BLEA 3KVJA 5HJLA 3D0CA 4N9EA 3P8JA 5IBXC 4CNPA 4HHPA 1OX5A 2V82A 2A4AA 2Y6ZA 1J4EA 4XKYB 1FCVA 5C54A 4BI5A 5F4XA 2ZYFA 3DAQA 4UTIA 2E5BA 1TPWA 1OHLA 1G67A 2TYSA 3CLMA 2FFCA 3OVPA 2XN0A 5D33A 5FF2A 2XN2A 3N14A 1DQWA 2V9DA 3BGGA 4UCGA 4GFSA 4TX9A 2FPTA 4NNAA 2Z6IA 4NQ1A 3PUDA 4UTJA 1YADA 1F7BA 2W0UA 3GNDA 4U28A 3W71A 3EB2A 3ATZA 2CZ5A 4JX4A 4OQVA 1AW2A 5AOUA 3O6CA 3IRDA 4WJEA 1F74A 1XBYA 5CZJA 3HPXA 1XKYA 1LORA 2RKXA 1FBAA 3CWOX 1HTIA 3SFKA 1MEHA 4LT9A 3UNDA 2VEIA 4HPXA 4UMAA 1XC4A 1CI1A 2NV1A 3MJYA 2AQWA 1C8VA 4A2RA 1L2UA 2JK2A 2NX9A 3A5FA 4GC4A 1Q6LA 1A53A 3S42A 4RXGA 1W56A 1LROA 1GJPA 2TMDA 4ZQPA 1PHQA 3M16A 4N2YA 3NPXA 3W7JA 2O7QA 3C6CA 4O11A 5K4XA 1GWJA 4RCXA 3SJ3A 3CIXA 5C5YA 5BW6A 4MY8A 4N9BA 1NF7A 3QYQA 3W7RA 2YW4A 3O8AA 4UNKA 2W79A 3TSDA 3B0VC 4JTEA 3S1WA 3S5OA 2NUYA 1D9EA 5TBOA 1XL9A 3NNTA 4OT7A 4RZ4A 1GOXA 3W7MA 4WZHA 4WOZA 2FB2A 1P5BA 3G8RA 4O0ZA 3EWZA 3G1SA 4FXRA 1Q3NA 1QO2A 4DPQA 4WXZA 5D32A 3GDMA 3DGRA 5G2IA 3IVTA 1W1ZA 2ZRYA 3PM6A 3TU9A 3L2IA 3IGXA 5EY5A 2QCDB 1PCKA 1BWLA 1NEYA 4RZ5A 4M7TA 4K7VA 3RLVA 3UY7A 1QAPA 5KZEA 1PS9A 4M19A 4O57A 4Q4KA 3TAOA 1J2WA 4M7SA 3T4CA 2QCFA 4EWND 3HBLA 1ME9A 3P82A 3EXSA 4WY0A 3W1MA 1W3TA 3E12A 1HUVA 3LCXA 4GUFA 2VFDA 3THQA 3NM1A 4E2DA 4PH6A 4ZQRA 3AO0A 4S1FA 2BTMA 3MBDA 1QDSA 4JX6A 1NSJA 4AF0A 4AWSA 3ABRA 4JD4A 3ZR4A 4AHOA 3NL3A 5K9XA 4XBKA 3PC0A 1TTJA 3GKAA 3EXTA 3JRKA 3EWUA 4PTNA 1UCWA 1FWSA 5FEZA 1TTIA 4UTTC 2ALDA 1PCWA 2ZQ0A 3VCRA 1R2TA 1RQHA 4FNRA 3GR7A 1KTCA 3EWWA 4L4LA 3UWVA 1H62A 3O16A 4JGDA 1OX4A 2ZDRA 1LRNA 3G3MA 3L0KA 3W7KA 1GVQA 5AHNA 3TNOA 1KFEA 1QPNA 3N9RA 3FA5A 1MXSA 1TPUA 2YR1A 2J9ZA 3INPA 1JUEA 4TMBA 3SZ8A 3RMJA 1H7OA 4AVFA 1LBLA 5D02A 4CLMA 3MHFA 2XFWA 5G1TA 3PUEA 1R2RA 4CCDA 3W72A 1JCMP 5F4SA 5LGZA 2B7OA 3UYCA 3QMSA 2RHGA 3LERA 3SSJA 3UY8A 3ATYA 3EXRA 2QJGA 3MO7A 2P0OA 1WQ5A 2QAPA 3W7CA 1PL9A 3CHVA 3QMTA 3QH2A 1RVGA 3OVRA 2JGQA 4RXFA 4Y6GA 1J5TA 3TV8A 1XBXA 5HWJA 1K02A 3I7RA 4UR7A 4LVFA 3TAKA 3NAVA 4O15A 4ZQCA 3M43A 1T8XA 2V8ZA 1EB3A 1W3IA 1W37A 4Q33A 3W7LA 2G5WA 1GTHA 3G18A 3GB6A 2DZUA 3G1AA 4MIMA 4U4MA 4B5NA 4CNNA 1UASA 2Y63A 4FO4A 3TXZA 1OG0A 3KVKA 2OJPA 1VHCA 4L4MA 1NFBA 3TC6A 2A2IA 3UQNA 3QPZA 4WXYA 3GK0A 1RQBA 4O1CA 1F05A 5AHLA 4KFPA 3NQ6A 4RV8A 1G4EA 3P74A 5CZTA 2DZTA 3W7NA 1TREA 1IXNA 1QOQA 4OV4A 2I9EA 4CCCA 1D3GA 2I14A 5G4WA 1GT8A 4NJHA 4O18A 4BWLA 1KW1A 3GDTA 1VJIA 5DXYA 3OHIA 2E6AA 2V2DA 3LI1A 1LCOA 1H7NA 1VRDA 3KRSA 5AC8A 3S9YA 2Z0IA 1THFD 4DF2A 2ISSA 4MPQA 2F7FA 3HG2A 4IOTA 4RJEA 3EX6A 1UJPA 3LCWA 4IMDA 3O15A 3LBCA 3HB9A 2OX1A 2NX3A 1VLIA 2HS8A 3TW6A 3PUOA 5AN7A 1VYPX 4MJMA 4AB4A 3NZ1A 2A21A 2OZ0A 3W1QA 1VZWA 1IXQA 4IXHA 3QJAA 3TE9A 4HT3A 3I68A 2A7RA 3MP5A 2OT1A 1W5PA 2CLKA 5D09A 1F2JA 1F76A 3V1PA 4N02A 2YGYA 3W6YA 1ZNNA 1KM4A 3EWXA 1YDVA 1N55A 4MZ1A 4O0KA 2YFNA 1H51A 4DO6A 3G3DA 1SSGA 5CPLA 3LHUA 2VFGA 2WNNA 5KSWA 1SSDA 3DHFA 4RR4A 3GAYA 4Z1DA 4ORMA 3P62A 3LRKA 2C14A 3BARA 1JULA 3QSRA 2WKJA 2YFOA 4QQ3A 1YPIA 4RX0A 5FESA 4O50A 4MUZA 4RKAA 1RR2A 3A21A 4FHAA 1KM6A 3M1ZA 3HG3A 1TPC1 4YLWA 1TJPA 1JJKA 4BR1A 3QQ1A 2NXHA 4AEOA 3W83A 3BG9A 3DFSA 3G0SA 1JCNA 3FEMA 5F2GA 1W31A 4NJJA 1WYIA 2ZRWA 1F73A 2E6YA 5G1YA 1WXJA 5F4WA 3QQ0A 2E68A 3LOTA 3WFAA 4QAIA 3W1PA 3PBWA 1PVNA 1YTEA 1H7PA 3GDLA 1OYBA 1EWEA 2IQTA 2R94A 1VQTA 1G6CA 4ZVJA 2CLIA 1X8FA 6TIMA 1QCWA 3RF9A 3GNNA 3FYOA 2WSQA 5CZ0A 5F1UA 2A6NA 2YCEA 4A2SA 1V7YA 1O5XA 4JN6A 1N8FA 3P5ZA 4I7WA 2TRSA 1A50A 2GUUA 3LTYA 1BEUA 2VFHA 5EL1A 2Y89A 3B0UX 3HMJG 2WQPA 1MO0A 1LOQA 3CU2A 5HUOA 5DCBA 2C1HA 1YDNA 3DFQA 1H50A 3IIOA 1Q6QA 4IMCA 1TJRA 3HGSA 3R12A 5E1QA 1SUXA 3KRZA 5BMWA 4E38A 1SFLA 3O6DA 4TIMA 3N2MA 2X1UA 2YSWA 4ADUA 3PS7A 5G5IA 2JKPA 1YXCA 2QR6A 1L6YA 3TFXA 3NR0A 3W87A 5J5DA 1AG1O 4O1AA 2WNZA 3NL2A 3W86A 3DZ1A 2V5LA 2YZRA 1XBVA 4DPPA 1I2RA 1MEWA 3LDVA 3C61A 3PR2A 2NWRA 3E02A 3TQ0A 4JTKA 1KBJA 4JYDA 4O8RA 3USBA 1KFBA 3W2UA 3ZWTA 3CB8A 4O13A 3IIXA 1M7OA 1VHNA 4X22A 3TCEA 1KTBA 2RFGA 1OFDA 4J9JA 3W22A 4C1KA 4GUJA 1LP6A 3C0JA 2NXIA 4NXKA 3PAJA 1WOAA 4ZQNA 3WK0A 4Z0JA 2F84A 5FF4A 1H63A 4FXSA 3W7IA 1DQXA 3HG4A
chains in the Genus database with same CATH superfamily
3GG7A 4L56A 2RH9A 2PWGA 3E6EA 2QUMA 2R24A 1J01A 4UIOA 1FWTA 3GU1A 4PEKA 1IYXA 3DIPA 3TEVA 3VIGA 2P88A 5FJRA 2XIQA 7PTDA 4DZIA 2CITA 1Z7AA 4RUBA 4MY9A 4ZE5A 3FIGA 4H2CA 2BHYA 1S5VA 4AXKA 1B9BA 3S6OA 3BLOA 5CSRA 5REQB 1KR1A 3LXCA 5BOEA 3S3GA 3B9EA 2PLKA 3A47A 3L5MA 3LA4A 2JALA 4PTMA 1PIFA 1QPRA 3KDNA 3UJRA 3QTPA 1VPXA 3VX0A 1NOFA 1S5TA 1CCWB 4M6PA 2P10A 1JRCA 3SQLA 1KCXA 4Y9NA 2GOKA 1HKWA 1XLFA 3BTNA 1RXOB 1MQQA 3U3HA 2PFHA 1UA3A 2PWUA 2EJ1A 2Z25A 4CKQA 1H61A 5C9ZA 2YCLB 4TUFA 3VD4A 1RA5A 1AQ0A 4JR5A 4K1GA 3MS8A 3RIKA 1K7EA 1GVYA 1TWIA 1H49A 1W1VA 4UR8A 4C1NA 3DH7A 2NZLA 3WFLA 1FWCC 4PCFA 3Q37A 4L1XA 2D1ZA 3WQDA 3ID7A 2WC3A 1JI2A 1WDWA 3G22A 5I3GA 3L67A 1E1EA 3I4KA 4HN4A 4S39A 2PU1A 2LLEA 1Z44A 4D6EA 1F8IA 1F5ZA 3LI0A 3WYZA 4LF1A 1G1YA 4PSRA 2ZUWA 4LF2A 3CAWA 3NPUA 4JNYA 1E9ZB 5DY2A 3FXGA 4Z17A 4RDWA 1ITXA 5M5DA 5EMKA 4NX0A 4Z2HA 4W84A 2OWWA 4PTDA 1KRAC 3BGAA 3IAPA 4UWMA 2PRMA 5C7HA 1E6NA 2DVUA 5ABTA 3Q45A 4QDMA 2PDFA 1PYMA 4O10A 5FJUA 2NQJA 3QM3A 2EPMX 1UMYA 1FXPA 1WBHA 5FCZA 4HMEA 2XSAA 4A3UA 2FQIA 3WEZA 3A3WA 2ANUA 5A8GA 3LHWA 3SN4A 3KUMA 3A22A 4JTGA 1AZ2A 4N0RA 2DUXA 2XWDA 1SZNA 1SW0A 5F2LA 4GISA 4IX2A 3A5VA 4TVDA 3UD6A 1DL3A 3H6OA 4Y8FA 5C2CA 3LY0A 1KTNA 3M7WA 4JCMA 3E2RA 1TR1A 3BMVA 2WWCA 1JDCA 3WLLA 1RJPA 1XLJA 4N4QA 3EWYA 1CLXA 2BGNE 2QF7A 2PCQA 3T8QA 1H7XA 5FF0A 3O1NA 2CERA 5E9XA 1IT8A 3TZNA 4HU8A 1OD8A 1JFHA 4H00A 2JKAA 3V0SA 2TPSA 4MSSA 1E1CB 4AF0B 1RALA 4JXCA 1U30A 2NQ9A 3ZT7A 4HTBA 1OVDA 3L21A 1R7AA 2IXUA 3UZWA 4P7NA 1U5VA 4C5ZA 3ZR5A 3U4AA 1MW3A 3QKZA 3CHEA 2CXEA 2FIQA 2J7CA 3DYOA 3RPTA 1Q6RA 5HNTA 1TVNA 2WVTA 3RR1A 5D8WA 3VNIA 2Q02A 2XGBA 3K1DA 3BW3A 3UJFA 1AZ1A 4HPJA 5D2YA 5HPCA 4NAFA 4WEVX 5PTDA 1XBZA 1G9HA 4V33A 3IV8A 3UR8A 3QZAA 2DSKA 3EPNA 2XYLA 4U31A 4NF7A 2WW5A 3SRKA 1G4PA 5CCZA 2AL2A 2E67A 3OLIA 2B7QA 4IGHA 5A6JA 1PB0A 2L5HA 4EOUA 4L9XA 4PUMA 4JL1A 3PAOA 1DWJM 3B04A 3CPRA 3NOYA 2WSKA 1NAL1 1ZY9A 3UFYA 4PA8A 4XVEA 5EB8A 1X1ZA 4YTRA 1K1DA 2HPMA 4LU0A 4G6CA 1H5VA 1I2PA 4IFOA 2OGJA 4JICA 1HJUA 3IUHA 3UZ5A 3MUAA 5CBJA 3WD2A 1BF2A 3T9PA 5KMYA 3TN3A 3A13A 1M7PA 1AA1B 3EWCA 4PBGA 4PMZA 3VMOA 2ASHA 1GGOA 1OC7A 1BQGA 2R8WA 3PNUA 2JEPA 3G1XA 1TWSA 4BA0A 3GZ3A 4Q8WA 1A3HA 4X61A 5A6BD 2XGZA 1TFVA 2CHNA 4A22A 3BICA 2DEPA 3W1XA 4Y96A 5KZMA 4OHQA 3GYEA 3ES8A 3AAMA 2D20A 3WLIA 1NDVA 1KQYA 3P6LA 2BY1A 4AFYA 3HA1A 4BJHA 2BSLA 3BSGA 5DMYA 4P2VA 2FMNA 5H8MA 3O07A 3GXFA 3THCA 3WLQA 1AVAA 1F3XA 4MLJA 2OSWA 1F6PA 3UP8A 2XZ9A 1XGDA 1M41A 2Z27A 2BMBA 3REQA 4Q7IA 1AMYA 1GOWA 4R88A 3LM7A 1GYMA 4RL3A 2F61A 4WIWA 4QJ4B 3ALFA 4DB7A 1R3VA 3LPOA 2BHZA 3NGFA 3QZEA 4PUUA 3SUVA 4DAFA 3H55A 2IPWA 2Q71A 2DT2A 4LV4A 4C90A 4UFIA 1JUKA 1B3YA 1HJWA 3EEGA 3FXYA 3EOEA 2ZE3A 1NOUA 3VIJA 5LNVA 1Y5XA 4EKJA 4GH1A 2W5FA 4WJXA 3MANA 5GPRA 3NSMA 2BVWA 1ZJAA 2WNQA 3HPSA 4GJ1A 3PFRA 4YCPA 2E28A 3TC7A 4QTGA 1K4HA 3CIVA 3QOKA 3H7RA 3RJXA 2C0HA 2B7PA 2XVNA 4M51A 4ECLA 3SCQA 3IJ7A 4LJ3A 2EG8A 3A4AA 2Q3OA 4P8UA 1TX2A 3W7PA 4DVOA 3CBWA 2VT0A 3W24A 4XKMA 3S9IA 2XFFA 1GOQA 1PV8A 2BVYA 2C15A 3H2OA 1J8VA 6CGTA 3VTRA 4GABA 4Q7BA 3FYYA 1UH3A 1VJSA 1U33A 3CQHA 1YKWA 2WHKA 5JIPA 1VJZA 3GG1A 1FX6A 2YDQA 5FJIA 4KIEA 3C0LA 3AIWA 4QROA 2IPJA 3DFTA 4JHMA 3GIQA 3NOEA 3QSTA 3VCCA 2HVOA 4IJBA 3WLSA 1XRTA 3L4XA 4O1FA 2WJDA 4C6NA 3UXKA 1E3XA 3VZXA 2GJXB 5HJYA 3ZLFA 1MNSA 1OD0A 2TODA 4RNHA 1TMHA 1JZ2A 3C2FA 1B90A 4K37A 3RRAA 4DJDD 4WD0A 5JQ9A 2C79A 2C3ZA 4M81A 1PKLA 1YE6A 4POCA 4UTFA 1KLYA 3L5LA 1FWAC 1S2CA 3ANUA 4DUWA 3MSRA 2YYUA 2VXNA 1ZALA 2C19A 5I3JA 4TMCA 4Y9AA 3TJXA 1KBLA 4GMEA 1XRVA 1UP2A 4JEJA 5I3FA 1SMDA 1Q6CA 4V1XA 1BYAA 3GVVA 4XZHA 5D05A 1YW1A 1KGXA 2VZVA 4LS1A 5HNRA 3M0LA 1UA7A 1Z89A 1QNVA 3T55A 3SQSA 1T0OA 3B8SA 3N1AA 2ZXDA 2HK1A 4O0QA 2JE8A 1GZGA 2E9BA 1JCXA 3UNTA 3KLLA 2EF9A 3WK2A 2QPXA 1LWJA 3V7PA 5I7GA 4ZSTA 3CK5A 3FAXA 2C13A 3SR7A 4HP5A 1YBQB 2VX7A 2WVVB 3GW0A 1EOMA 3GNRA 4K39A 4DBEA 2V6AA 2VUYA 1VENA 4NXSA 3VGDA 1RD6A 3CASA 3WX7A 3BG3A 1ONRA 2J7FA 7TAAA 4ZODA 5C9WA 4AYGA 2OOFA 3AXHA 1WOBA 4U5IA 1HN1A 4R53A 5T26A 1GTEA 3DFNA 4J3XA 3R89A 2SFPA 5A8QA 2DUAA 4J3TA 5L9FA 1WKDA 4S3BA 1JZ3A 2VELA 2WJZA 1XR2A 4GX9A 3NG3A 1R38A 5JBEA 2HCVA 4C6CA 1QNRA 5CC3A 2HEJA 4JQ3A 2ZOXA 4GVFA 5CPSA 1RD5A 4U10A 5A6KA 4HPGA 1QPOA 3BL3A 3RFAA 3VM7A 2WBKA 2VMFA 5D9NA 4W5ZA 1WE5A 4MVAA 5GNYA 4TQTA 4H6RA 3GBEA 1FWGC 2FLIA 4DI9A 3VKBA 3DI0A 4U2YA 3PZTA 3QC3A 2J66A 2IQDA 4L6HA 2JQXA 4XO6A 4NNCA 2I7GA 4RNIA 1HFBA 4PMNA 3GUGA 2GJRA 3KRUA 4I3GA 4MJ4A 1LG2A 2ZRZA 2V3GA 4N9CA 4H4IA 2PWEA 4F48A 2XH2A 4C1NB 2J9YA 1D2KA 5CLTA 2JGYA 2J47A 3U9IA 3RHGA 4S3CA 4A29A 2RAGA 1XRFA 1A49A 1IT0A 2PBOA 4E4PA 4H9UA 5CAKA 4JDYA 1FH8A 1DWHM 1TWZA 4JIIX 3H2CA 4FNUA 1P6BA 4CD7A 4GNVA 1OFEA 1OYAA 3S1XA 1SR9A 2J9XA 3S83A 3V36A 3LTPA 1VIWA 2PDCA 4NZJA 3URNA 3CEUA 1OF8A 1CENA 5F2MA 1L6SA 2VKZG 3LCGA 4IPIA 4NU7A 1WPCA 5C7VA 3I6EA 3BCJA 4NZ1A 4C5YA 4S3DA 3WKZA 1EO7A 3LHZA 4B2DD 3O3RA 3WBXA 1GCYA 1PDYA 3H2EA 3FSUA 3VOCA 1HL8A 2ZUSA 4IJRA 3BLIA 2FB3A 1NQ6A 4CCEA 1IR1A 1N7KA 4U2ZA 4B5TA 1U83A 5HA7A 3PULA 5M2FX 4BKNA 1GVIA 4IIFA 2RGMA 4J40A 1FWBC 4AH7A 4LVDA 3SB0A 5CH9A 2A85A 4F0HA 1GOKA 3R8RA 4L65A 3Q94A 1VKFA 5AYIA 2PGEA 3U2EA 3CGTA 3SCRA 2XIJA 4HZMA 1ZCCA 2NVAA 4FOKA 4FNSA 4FMVA 1XQKA 3UXIA 4A35A 4V1YA 1Z9AA 3W53A 3PWAA 3UVAA 1HKVA 1KM2A 3KBNA 5D04C 3DFPA 3LHTA 4MAVA 5IFPA 4YVXA 2XTKA 1VBGA 3MW7A 1I2NA 3HU7A 4MFDA 4J1OA 1GEQA 5LSMA 1CLVA 2I16A 4ADSA 4LFYA 4M0XA 1A5KC 3GNPA 1XS2A 2F2KA 2G4FA 2EGZA 4LAMA 1ZB5A 2E8ZA 2QCLA 4H04A 1EBGA 3SGGA 1UUOA 1TRIA 3VNJA 4DX3A 2OG9A 4CVUA 1KR0A 2JBMA 4EPEC 6XIMA 1FDZA 2EPLX 2DVTA 4WHBA 2ZWYA 3ARYA 3MMTA 3GM8A 5M1TA 2ZBTA 3QV6A 3VD9A 3WBYA 3UPBA 3GC2A 4NAFB 2DSUA 2CLMA 1IXPA 2W63A 4DWSC 3ZLGA 4HHHA 5LIYX 2AL2B 2QCCA 2PA6A 1EIXA 4URIA 1F9CA 1KA9F 4HA0A 2GVJA 4W7VA 5D37A 4H9TA 5E9AA 3S5NA 2IS7A 3UR2A 1F6KA 1K8CA 3D46A 4JHZA 3IK4A 4BI6A 4LYKA 1FQ0A 1F4AA 2I5QA 1XSJA 4O8AA 3U0HA 2UY5A 3PB2A 3ZT6A 4PUKA 4H83A 3WDJA 3VDCA 1UW9A 4CVWA 3F5KA 1ML1A 5D38A 4F0KA 1T7LA 3FFSA 1Q6FA 4Q8TA 3DCPA 3M41A 1GKQA 3WJXA 3T2QA 1VFSA 3V3WA 4JNMA 1XYBA 4O1DA 4C6IA 4CD8A 1DJZA 2QNEA 4KBXA 3FKKA 4LVGA 1V6TA 4JDBA 4PMXA 4AQLA 2NSXA 3NQ7A 3SIZA 1J0ZA 3F1QA 4W8AA 1KGWA 1C8YA 5AHFA 3WEMA 3GTXA 1VYRA 4ZL1A 2Y7DA 4IX0A 3BXWA 1GQKA 4TV5A 3W7GA 4PC8A 1XX1A 3E0IA 4D71A 3L4VA 3RU8X 4S3AA 1HJXA 3T8LA 1R7OA 3UETA 3REQB 2C91A 3C2EA 4J35A 2I5GA 4YTSA 4AY1A 3WFZA 3WQ6A 4YTUA 5C55A 5IM51 3EEZA 3P2VA 4JTRA 4W8LA 1I0BA 4LAOA 3NQGA 3VINA 1YTKA 3WH9A 3QLDA 1UR4A 1DHPA 3A64A 3VE9A 2IW0A 3LV6A 4O53A 3CWNA 5LA1A 3LEPA 3MVIA 1AQFA 1W1YA 3CL7A 2ZTKA 1XUZA 4WDTA 5KINA 1PEZA 3AWNA 1R30A 1UUQA 3NWRA 3GH5A 3QY7A 2TAAA 2FMOA 4S38A 3WF3A 3AS1A 1TQJA 4QLKA 4W7WA 3TQKA 2R6OA 4LRSA 4HNLA 4LXFA 3W27A 1G0CA 4BQ3A 3NPVA 4GKLA 2PD5A 2OODA 1UWUA 2WWDA 5AC5A 4M1BA 3VGGA 5BRPA 4EF8A 1PWMA 1RCOB 3VA8A 1VBRA 2VEKA 4UTWC 2CLFA 4QG6A 4FLQA 2WMHA 4NG3A 4GK8A 4H7VA 2JKEA 2XVLA 3N2OA 2WVUA 3RAOA 3W81A 4R34A 4W9TA 3O06A 4GD0A 3R13A 3GFXA 3S2CA 1K6AA 4HQVA 2ZXBA 4E6MA 3BJTA 1SFJA 4MWAE 1PWLA 3GC4A 1I45A 2YA1A 5AKQA 2PDPA 2GGHA 4JN8A 1SPQA 3MKCA 4YHEA 4D1IA 1SYTA 3CB3A 3C2OA 3H7UA 4AZ5A 1DWGM 3S5YA 1LJYA 4WRHA 4N9DA 3WD3A 3JS3A 3H12A 4M5PA 1O68A 3SEPA 2PPGA 2F6KA 5I2UA 5U4NA 3QC0A 1IEQA 4JTSA 4GY7A 3WUFA 3VX1A 1Q7ZA 1AJ0A 1HJVA 2PRHA 4OUEA 1ZZMA 1W3NA 1I60A 1EP2A 3N2CA 3VUSA 3WUEA 3W29A 3H8AA 4C7GA 3LCFA 2QEZA 3SN0A 2P3EA 3WELA 2Y61A 5DT5A 4RLIA 3TW7A 1UZ1A 2OXNA 4TO8A 2PS2A 5I77A 1KLZA 3VABA 2Z26A 3RCYA 2V30A 3H2FA 4W86A 1XG3A 5HNUA 1GONA 2GSHA 1PXGA 3IK2A 1KRBC 4AWTA 3ZVIA 1ZQ5A 1XQLA 4XG1A 4HNNA 3VIHA 2E09A 3KBVA 3ANVA 3FHAA 3VU2A 3U5UA 2WSYA 3SY5A 2P8CA 3AMGA 1I8JA 3T4WA 2NUXA 1OQFA 5DT7A 2V0TA 4HOWA 1U1HA 1V03A 3FGCA 2DDXA 3CHCA 1FCQA 4DXXA 3G1VA 1ICPA 1KV5A 1KGUA 1D7KA 3FDKA 3ZSTA 1GKRA 1ZJIA 1OZMA 3BLEA 3QKEA 5HJLA 3D0CA 5I23A 4N9EA 3P8JA 4ZFMA 3BH4A 4S3JA 4DM1A 5HDRA 4C6QA 4WKFA 1FCVA 2GWGA 1TIWA 3OO2A 4CNTA 4UTIA 4NI8A 1GHSA 4X0NA 3OVPA 6REQA 5FF2A 5J8LA 5I3DA 2DQWA 3T42A 1DQWA 3BGGA 1BYCA 2AAAA 3W71A 4EAMA 3VOFA 4LCQA 2ZX8A 5AOUA 3R7MA 1XBYA 3DUGA 1JGMA 1XKYA 2WZTA 2RKXA 3CWOX 4B92A 1SJBA 3NO3A 3VGEA 3ZSSA 2DFAA 3UNDA 2VEIA 3DYPA 1XC4A 1AFSA 1CI1A 2F38A 1C8VA 1FHDA 1A53A 1F3TA 3KEHA 1XYLA 2DUZA 3SCPA 4N2YA 1B3WA 2IKIA 3EMZA 2PF8A 5HQMA 1EJSC 4O11A 5BXPA 3TR9A 1MXDA 4RCXA 3SJ3A 3VD7A 5C5YA 1NF7A 1FWDC 2ZVIA 3V1HA 3OW1A 4L4OA 5H8UA 1OCQA 1P0DA 1ZBCA 1BHGA 1UKTA 1XL9A 2RJGA 1UD8A 4GCAA 3SCUA 3EWZA 4UB9A 1XD1A 1AH0A 2QDDA 4KCVA 1CNVA 1XP3A 3H21A 3GDMA 2Y4SA 2WYSA 5XINA 4LBSA 3BAIA 1Q4NX 3LENA 2BY3A 4QAWA 2PI6A 1PTGA 2PDIA 4US5D 4RZ5A 3RLVA 5KZEA 1V79A 1CZ1A 4D6FA 4MB1A 4M7SA 3HBLA 2GWNA 4B3ZA 2D2GA 3MWCA 2WC7A 1CGYA 3MB9A 5I07A 2VD8A 3B97A 1E6SM 1HUVA 4LPCA 4GUFA 4D6IA 4E2DA 2PD9A 3PZMA 4QEEA 3OZOA 4P7OA 4GVGA 1NSJA 4JD4A 4AD1A 4AHOA 3CUXA 3WDQA 1J79A 4E8CA 1I6NA 1TTJA 2OYKA 3JRKA 4HD5A 4PTNA 3AZTA 1OBAA 1UCWA 1FWSA 5FEZA 2ZQ0A 4FNRA 1KTCA 4FAMA 4Q4RA 3EWWA 1E73M 1ZUAX 1FVPA 4L6DA 3PWGA 1A5LC 2Z1WA 1XYZA 2XH0A 3DX5A 3L0KA 1DEDA 4PGLA 3PZ9A 1HKIA 2YR1A 5IRPA 4KCUA 4WF7A 1PBGA 2EG7A 3RMJA 1ISZA 2XUCA 3L4YA 3UF9A 1LBLA 4CLMA 1JZ5A 4D6DA 3PUEA 4PCPA 1R2RA 4AWEA 4KH2A 3XISA 5FKYA 4DZAA 3UY8A 4K8GA 3E5PA 1Q7MA 2QJJA 2QAPA 5CSUA 4DI8A 2OFJA 3QMTA 4JL2A 3SCVA 2HNEA 1FKWA 4RXFA 3TV8A 1XGZA 1XBXA 4J3WA 1KQZA 5HWJA 3I7RA 4LVFA 4LAKA 2OQHA 1LG1A 4PRWA 2ODOA 3OVGA 3AHVA 3T09A 1UP0A 4F40A 2VZOA 3W7LA 5IHRA 3KS5A 3G18A 3GB6A 1KWGA 4B5NA 4ZA0A 3UT0A 2OJPA 3R1ZA 5I02A 2HNHA 4GBDA 1VHCA 4C65A 3CTTA 2Y5SA 2GGJA 4UQEA 4KEZA 4O1CA 1F05A 2QGYA 4XD4A 3W7NA 2QF8A 1YDYA 1IXNA 3MUZ1 3RRXA 1D3GA 2AQVA 1GT8A 1A5OC 3B0YA 4CGTA 3VKDA 3MJMA 4CN4A 1VJIA 2E6AA 2BB0A 3LI1A 3KRSA 5AC8A 2E7FA 3VC6A 1XV8A 5A94A 1VFHA 1ZBVA 2BDQA 3O15A 2NX3A 2HS8A 5AN7A 4GC3A 1AH4A 4HSHA 3ZVHA 1ITQA 2VYOA 3W1QA 2E1WA 1Q4WA 1VFOA 1VZWA 3WQFA 4DBWA 4HT3A 1DQUA 1BAGA 1ISYA 4HTYA 3VIKA 1C8QA 2ADAA 2HBXA 1W5PA 1F2JA 3BAJA 1WDQA 4N02A 4DUVA 3W6YA 1QI5A 1QRQA 1IWPA 4G8TA 4AX6A 4A8IA 3B8IA 1H51A 2GLKA 4H7ZA 1SSGA 3LHUA 1VRXA 1YMYA 2A3EA 2WNNA 3DHFA 3M0MA 3M0YA 4NRSA 1MQRA 6PTDA 3CAQA 3ME3A 2W4XA 4LEFA 5A2BA 2WKJA 3VMPA 2E25A 2XINA 1BWVA 4MF4A 4FHAA 2G3NA 4FK9A 1EJRC 3T08A 3WBEA 4Y9MA 4IQDA 1X6NA 1EXPA 1NOWA 4IFKB 2NXHA 2P3ZA 2XSXA 3DFSA 4LANA 3WF0A 5F2GA 4QCFA 4NJJA 1V77A 3N11A 5G1YA 4GXWA 1WXJA 2ZUNA 5F4WA 4NY2A 4YVVA 3S47A 3WFAA 1H7PA 4DYJA 1PZ1A 4H2HA 3CUGA 4JNZA 1OYBA 2IQTA 3V5OA 1VQTA 4GKTA 4ZVJA 1ADSA 2YB1A 3K8LA 6TIMA 1QCWA 3FSTA 1V0MA 2B31A 1NIUA 1JFXA 5T91A 2WLYA 3P5ZA 3R25A 2VFHA 3M7SA 3U7VA 2Y89A 3HMJG 5HUOA 2FZMA 3CU2A 2G4JA 3D47A 1Q6QA 1SJCA 3VZYA 1TJRA 1US3A 3HGSA 3T07A 4O1EA 1ONWA 1QNPA 4E38A 1QHPA 1CTNA 2IKJA 2VGFA 2X1UA 3TWBA 3VNMA 4IIGA 1YIXA 2WMGA 5AYBA 3T0DA 5CPTA 4DBSA 5G5IA 1W1A1 2JKPA 2QR6A 1L6YA 1VBUA 3TFXA 3DDMA 3NR0A 3WH7A 3C8NA 1JD9A 2ZC1A 2I9UA 3W86A 1J0YA 1XBVA 4DPPA 3TQ0A 1L8PA 4JTKA 3USBA 4JIEA 2XIMA 2ZWZA 3ZWTA 3CB8A 4O13A 4I9TA 5A8MA 3GH7A 1OZQA 4GVHA 1NU5A 2FZBA 1KTBA 5I09A 2CCRA 3W22A 3R0KA 1WUEA 1F61A 3C0JA 3UU0A 4ZQNA 4HCHA 1H63A 2VI0A 3W7IA 2QDGA 1ZTVA 1J18A 4LEQA 4FNTA 3EDFA 3TCSA 2QVHA 2W62A 3I4EA 5G4HC 4HYWA 1R47A 3E9AA 3U6WA 2FHCA 1Q2SA 1JDEA 3UW6A 5BXRA 4JEQA 5D2VA 1MW1A 4UTMA 2CBJA 3F4CA 5I78A 1A4LA 5FSDC 5A2CA 3SGZA 3LLXA 5AVHA 2REQA 3WD1A 1OFBA 4HJFA 2NSOA 5I24A 4XWUA 4R33A 1XLMA 6ALDA 3CQJA 3FGCB 4KMQA 3MP4A 3TOYA 1ECQA 3W28A 1RHCA 3NGJA 4WLCA 4ZGYA 1MUMA 3P0WA 4F9DA 2W3ZA 4FLOA 1LBFA 1FCUA 3U7BA 2XIOA 5AFDA 1B0IA 4XZMX 4PE8A 2CIPA 1TJ1A 4WKHA 3IJLA 3HPAA 4E4UA 1W3KA 2B81A 1CYGA 4CNOA 2OMAA 3R2GA 3USZA 3B9AA 4L9YA 1TB3A 1EDTA 4KERA 2EHHA 3I6RA 3U57A 2Y7FA 1EXBA 1XW8A 2Y7GA 2QW5A 6REQB 1PIGA 4U3CA 1WV2A 1KCZA 2DSZA 2Q8LA 1P43A 2DT1A 4P7LA 3KHJA 3OG3A 5K9CA 1UH4A 3E2VA 3FN9A 3IIPA 1LLWA 3FNDA 2GVEA 1ADOA 2QGHA 3CZJA 4FX6M 4MM1A 3SN1A 5CPMA 3LHYA 3KE0A 2WHJA 2C0AA 3OBAA 4LNCA 4PUEA 3E2QA 2XN1A 5D9PA 4LGXA 4H3DA 1ZRQA 1DHKA 3EZ4A 4DWSA 4UFKA 1VH7A 3MPGA 3LSBA 1MRQA 1QOPA 4WDWA 3VFLA 4DHGA 8XIAA 4Z2IA 1ESWA 2ZX6A 5H1WA 4HSOA 2WV8A 4BI7A 4HU3A 3GKFA 3CO4A 2PSNA 4YVPA 5CGQA 3QR1A 2OEKA 4NILA 3CAVA 2J25A 2UY3A 3EPMA 2NQ5A 4UFHA 4H9VA 1H4PA 3S1VA 5A95A 3AU6A 3DFOA 3I65A 3TMQA 1V4YA 1IIHA 2HRWA 1JGIA 4L61A 2X30A 4J2PA 3B0PA 3E5BA 3NQ2A 3HV9A 5HJXA 1ISWA 1IHIA 1TMLA 2PDXA 4YXGA 4B3KA 5HQEA 4JTUA 3AROA 3BOLA 4WSKA 2BVDA 1O5RA 4EPDC 4MUPA 1V5XA 3JW7A 3I7SA 1UKOA 4K6AA 3H4XA 3PTMA 3EWDA 3NO1A 3ONCA 3YPIA 1L9WA 3SGUA 1O94A 3K8MA 2ISDA 1QI0A 1KFWA 4ZB5A 2TSYA 3NPWA 3KXQA 1SZEA 1XJBA 1UZDA 4R7OA 4C6PA 3EYPA 2FPVA 3CM4A 1HO4A 2Y8VA 3BAWA 1TQXA 3W7DA 3ZT5A 1R85A 4OZOA 1UPMB 2J7GA 4NAEA 4PYSA 2X2YA 5DXXA 4Q6JA 1Q65A 5AZ1A 5D30A 4OU1A 1VCFA 1PE1A 4S23A 3BAXA 2OGYA 4GUGA 3WJSA 3MWAA 4LYQA 3MSDA 1B54A 2UY2A 3OU8A 3N2BA 4IWWA 4OVXA 3G24A 2D3NA 4D9PA 3NQCA 1GJWA 4J3UA 1TJ0A 4S3EA 4XBJA 2PDUA 1FOBA 2CLLA 3VILA 5CGTA 4F79A 4W8BA 1P4CA 2ZZ2A 4LB4A 4RK8A 3C3UA 1FTXA 3NZRA 2ATMA 1ZCOA 1MEIA 4ALDA 5TNVA 3MT1A 3P84A 4LVAA 3AI0A 4DJDC 3R79A 5G4EA 3Q58A 3ZFHA 4LW7A 4LY4A 1K9TA 4UTWA 1M6JA 1K03A 2DIEA 1GW1A 1VCVA 1AH3A 3VDHA 2Z1VA 4XVDA 4Y2WA 1O4UA 1J10A 3M5ZA 5ABEA 2CWXA 4QG9A 1X1NA 5DMMA 2C18A 1LRQA 2VEPA 2PTWA 3ITXA 2G96A 2ZKMX 3FX4A 3H2NA 5GVJA 3JVAA 1XUUA 1UPPA 1X1OA 4R7WA 1FH7A 3HJZA 4AMCA 3UR7A 4WK9A 1G7UA 3P7YA 3B05A 3UG3A 4P61A 3L4UA 4E2VA 4EPKA 1B30A 3PZUA 2Y85A 5CG0A 1JCYA 4GH3A 3GWQA 3AMKA 3CV6A 2IXVA 5CJNA 4QEHA 3PZIA 3L66A 4I5UA 1OADA 1PHWA 2GQ8A 4R7JA 5D2XA 4DYKA 3NDOA 4IMFA 4IL2A 4ZOCA 1XDMA 1LYXA 1FCBA 3TX9A 2P53A 1SVDA 5DRIA 2BP1A 4GE8A 1EC7A 1QWGA 3N4EA 1K3UA 1VLWA 1JDDA 3PPHA 3XIMA 4TR9A 3HV8A 2PF0A 3ABOA 3WLKX 2C6QA 4FXFA 1JR1A 2FTPA 1XPGA 3E1F1 3UZJA 3ZVHB 3ISIX 2YLLA 3EX1A 1FFQA 4NJGA 4L80A 3Q65A 5B80A 1DIEA 1POJA 4HMCA 1VC4A 3LLFA 4QCEA 5EBAA 1Y65A 3VOHA 2VOMA 1PUDA 3GQYA 1M65A 4NP7A 3QPYA 1QNOA 4L1WA 4MWAD 2HE8A 2YDRA 4XUGA 1GEHA 4LALA 3ITCA 4XZLX 3NO5A 4B5VA 1MUWA 5D03A 3G0UA 2ZX5A 4UOQA 1OT1A 3MCNA 3UZYA 2ZICA 4OUIA 2W61A 3GG0A 3OG2A 4XO7A 2PMQA 3O63A 1XIBA 3CUHA 3H24A 1C3FA 3IVSA 1MMFA 3CIWA 1H60A 4RDVA 2X0SA 3W1TA 4FF5A 2WHMA 1GVEA 4P8VA 2ZZ1A 3SJNA 3ZQ9A 4GWEA 3LRMA 5F1VA 2NV9A 5AYYA 4YL2A 3GRIA 2B7NA 3GDRA 3DI1A 1N82A 5FEXA 1OJXA 5DLCA 3TLLA 5AC7A 3VDGA 5K3VA 4A8RA 4PMVA 3UCCA 1LBMA 4IIBA 4GNKB 3IGHX 3HG5A 1T8QA 3UCQA 2PDKA 5CGMA 1MWOA 1JCLA 1AD1A 3IGUA 3A24A 2CNCA 3FHQA 1JZ7A 2INEA 3MKKA 1YPFA 1OGBA 4UUIA 4B15A 4ERIA 2OCZA 4TVCA 2FH8A 2PTXA 3G2GA 3UBPC 3GR8A 1TV4A 2CC0A 1TELA 4OBRA 3P80A 1B4KA 3VKJA 2FH6A 2VWSA 5FEPA 4JTAA 3LX9A 1TZ9A 3GVGA 2PODA 1FKXA 3ZWSA 2A5HA 1US0A 5GJPA 5XIAA 2FPYA 2DZWA 1K8YA 3PSVA 1MZHA 4PTVA 3PF3A 4QLJA 1TV8A 4OWGA 4KEUA 5A6AA 5LYRA 1F8MA 4DO4A 2CKSA 2R9RA 2OZTA 3QOMA 1OX6A 3U2OA 2J24A 3AICA 1O1HA 5DMNA 1AW1A 1HW6A 2R1LA 4XD3A 3BO9A 3NYDA 1HGWA 1US2A 3IJQA 1WXZA 1XLDA 3NQVA 3BG5A 5IXEA 1ZP4A 4FI4A 1H7WA 4XKYA 3KTXA 3MUXA 5M03A 1XWYA 2NV2A 2YJQA 3KFTA 3OVQA 1T96A 1P6CA 4YN5A 2CLEA 4QM1A 2WVSA 2VFIA 4YCOA 3SSZA 2J13A 5HINA 2REQB 3QR3A 1QI4A 4WOQA 2DVXA 1WDPA 4K8HA 4NZCA 2ABAA 3W2NA 5FI8A 3KL0A 1R2SA 1GHRA 1X7FA 2CZDA 4Q4SA 3MHUA 3THDA 3UPWA 2HWGA 3KOFA 4X2PA 3HGOA 1TR9A 1EJUC 4LAUA 4RZBA 3O6AA 1KM1A 4AVOA 1S2UA 4TX6A 1B3OA 3AXKA 1H1NA 4R85A 2ZZ6A 3T7VA 4S3GA 5D9MA 3P5YA 5KZDA 1TKKA 1OY0A 5E5CA 3WO8A 1G94A 1K8XA 5A6SA 4MPKA 3ABXA 1UR2A 2CYGA 3PBGA 1GVRA 1IT7A 3VGBA 3W75A 2Z7KA 4R27A 3U5YA 1WZKA 2HBVA 2BWGA 2XIBA 3DHPA 4R9XA 1F4HA 1I2QA 3O0FA 2AKZA 2YLAA 3L2MA 4JTDA 2J4GA 1L6GA 3WJYA 3CHFA 3W70A 1H0GA 4UZSA 1EFZA 4QJ5B 7ENLA 3VZZA 1UWSA 4DWSB 3M0JA 1TVPA 1UR0A 2WZEA 3POCA 4GZEA 2JF7A 4ROPA 1TV7A 3AXXA 4AAJA 4P8WA 3SCNA 1XH2A 5AHEA 4Q8PA 3SI9A 1LZOA 1P1XA 5FL1A 4ERGA 2FKPA 3RCNA 3WDHA 2ZA1A 3TDFA 1NH6A 2KX9A 1QVBA 4LS2A 4QDWA 2QV4A 1QJWA 3N4AA 3RCMA 2PCEA 4JTIA 4KS0A 1EKOA 1BWKA 2E6DA 5CEWA 4ROQA 5LNUA 4UQBA 2O0TA 4MB4A 4F4RA 5DBTA 2QPSA 3EX3A 3GTFA 1V3MA 4EP8C 2BZNA 1W3HA 1JNEA 1XM3A 4LY8A 1Q6OA 2JIEA 4DY1A 4O14A 2BOEX 2V5JA 3BAYA 1EEPA 3EA3A 3LXBA 1XHGA 3FW6A 2BX7A 3BW2A 2ABBA 3AMLA 4BF5A 2GVYA 3RK8A 1EJVC 1FWIC 2QULA 4NAEB 4IFRA 1BVWA 4Z0SA 2OLAA 3GLCA 2J6VA 4U3AA 1ZJBA 4O28A 4MTVA 1DOSA 1K9EA 5C0QA 4L1GA 4AEFA 2CLOA 2VEMA 1PAMA 5CG7A 1DIDA 5HUPA 4DJED 3BPWA 3R11A 1RK6A 4HN8A 1VD6A 3RX4A 3L4WA 4PTXA 4FNQA 4FR1A 3R10A 4GJIA 3RNDA 2I56A 1LOSA 4KCTA 1IGWA 1SO6A 4PUNA 4E2BA 2W66A 2QLYA 1DJHA 4O52A 1EYWA 1W5OA 4UC5A 4BHYA 3DG7A 4MNLA 1BGGA 2F6XA 1ZPTA 4W5UA 4PB5A 2R91A 1LDCA 5LZLA 3G1RA 3WH5A 1IIGA 3ZS4A 4C6MA 2OO0A 4EF9A 4JTTA 3UERA 5JH2A 5BXSA 2EEXA 2X40A 4HNOA 5LGXA 3F2BA 3JUGA 4I5XA 3H2MA 3LU2A 5E93A 1S46A 3DEQA 4MZ8A 3QRHA 2QJNA 1L8NA 1NARA 1GW9A 1UD2A 4O17A 2BOFX 2CPUA 5DY3A 1HZYA 3SCOA 3BE7A 2BNJA 3G0XA 3IUDA 1HL2A 3VFCA 2GL5A 3WDRA 3ZR6A 4LS0A 3FVMA 2HXTA 3D5HA 2DU2A 3VE7A 1M7JA 3OLEA 2DZSA 1XSKA 3TN5A 2V5KA 3UZXA 3QHNA 5CAHA 4TU1A 3CAKA 3S0CA 5CSYA 1GQJA 1QI3A 3LB0A 5AHMA 1UJQA 1FXQA 1ODUA 2IPGA 4PL2A 4GY0A 3OP2A 3RR4A 3TYEA 1RPXA 2EKCA 1T40A 2ZTJA 2P5NA 1P0KA 1RV8A 2VVSA 3DC0A 5TQLA 8TIMA 4YPJA 4HK6A 3MZ2A 1EGZA 2FYMA 1DORA 1JXJA 1FWJC 3VOJA 1EF2A 4IT1A 1HKJA 4F66A 4GOAA 1XLCA 4HK7A 4PMOA 3N19B 3BC9A 2O9OA 1A5AA 2EPKX 4GG9A 1W8GA 3GG8A 6A3HA 3PPFA 3TMLA 1JPIA 4UR9A 4FX8A 1DPMA 3GU2A 5IDZA 4IZGA 3URQA 4EXBA 4FF7A 4XIAA 3HTWA 2QUVA 5DN1A 4MYXA 5EFDA 1EA0A 3QW4B 2J7HA 1NDYA 1KBIA 2XJ7A 4AHQA 1K77A 1R6WA 2FDSA 2VO5A 3LZ5A 4HMNA 2CWNA 1S3HA 4Y9PA 4FNPA 2J62A 4RE2A 2QUTA 3DERA 5BYWA 5D2TA 4JKMA 1U22A 4HA4A 2FGBA 3EWBX 4AVNA 3MC5A 3NEVA 4IP5A 2VURA 3FEQA 3MDWA 2ACSA 4K7YA 3VVGA 3WJZA 1UWIA 3PSWA 6XIAA 2CBVA 2VCBA 2CEQA 1O5KA 4IP7A 4OECA 3M46A 1MVYA 1K6WA 1BG9A 4H6QA 5I3IA 2I5IA 1HKKA 3QMRA 1BLIA 2RDTA 3AOFA 4IG2A 3HF3A 4F0LA 3MO4A 4UMBA 2XHYA 3BMWA 1SQ7A 4ZB2A 1PKYA 2WK2A 3V16A 4XISA 1B57A 1L6FA 2PDGA 3RUBL 4LSBA 1DE5A 3VIFA 3AFBA 2A79A 3IV3A 3W2JA 5TD4A 5JBDA 4KCWA 1R86A 5EBUA 2RDWA 3I3BA 1VBHA 3QXBA 3Q2DA 4XAGA 2VDIA 2Y62A 4XV0A 2W9MA 4DXVA 4Z42C 1XF0A 4GQRA 4GFIA 1EO5A 2PGFA 3H7VA 4LCSA 3RJYA 3W25A 3TFCA 2VRJA 3UEQA 1S1PA 3WDPP 1XDJA 4WX2A 2CBIA 1EH9A 1R8LA 5E70A 3IACA 3MP3A 4UNLA 1RP9A 3IIVA 4DEFA 4ICNA 4MDPA 4PN2A 1V02A 2Z28A 3NSXA 3DECA 3F2CA 3R58A 3VIMA 1RBOB 1J0KA 2DW6A 1LQ0A 3OA5A 1A3WA 2Y6ZA 1J4EA 3GO2A 4XKYB 3GE7A 3HFTA 2QMKA 4TTGA 2E5BA 4R3UA 2V69A 2WQDA 1OHLA 3PJTA 3CLMA 1JF6A 2V3EA 4KEMA 4AD0A 4DNMA 1UD3A 2V9DA 4H8UA 4KQNA 3GTIA 4C6DA 4TX9A 2FPTA 4UTJA 4OIFA 2W0UA 3QV9A 4JX4A 1BPLB 2BS9A 1R5YA 3WLHA 3O6CA 3QVQA 1F74A 2GK1B 3BCDA 1LORA 4V27A 1E6XM 1JEZA 3UPMA 2RUSA 1M7XA 1MEHA 2VNCA 4LT9A 4K68A 2VWTA 4HPXA 3ARPA 2GZXA 3MJYA 4DRSA 4A2RA 3OQEA 2NX9A 4F2UA 1ITUA 1E4MM 1Q6LA 2YL9A 2X7VA 3LGDA 1W56A 3A12A 2TMDA 3CNYA 4DJDA 5DX7A 3R8GA 3NPXA 3ZO9A 3AU2A 3CIXA 1H0IA 4B4FA 5BW6A 4MY8A 1W1B1 4UNKA 4G9PA 2VEGA 3CPUA 3B0VC 1HQTA 1Z3NA 4JTEA 3S5OA 3IRSA 1D9EA 3O2LA 5TBOA 3AJ7A 4OT7A 4WZHA 4WOZA 1DP0A 2VGIA 4YTQA 3VIOA 4UQAA 1Q3NA 2P76A 2C1GA 3COTA 1QO2A 4G5DA 5D32A 5G2IA 1JPHA 1Y8BA 2E8YA 2OQYA 2W92A 1XLHA 3D3FA 3TU9A 3BDKA 3L2IA 5EY5A 4MB3A 1PCKA 3QLLA 4M7TA 1QAPA 3KW3A 4CD5A 5JUVA 3C2YA 3WMBA 3KLKA 1EDQA 3T4CA 3URAA 1W9XA 4EWND 3N6QA 4QX4A 4D1JA 3W1MA 3WN6A 4BF7A 3NM1A 1REQB 3B8UA 4ZQRA 2EJAA 1W32A 3VNYA 2BTMA 1QDSA 4JX6A 2YBTA 4GQQA 4XD5A 4HA1A 5A8PA 3GHUA 4XBKA 4ZO9A 2QIWA 2YCJA 3IAQA 1Q6EA 3EXTA 1PJ9A 3BQ5A 3EWUA 1CXFA 2FZ9A 1L2QA 3VCRA 1UQZA 5B7ZA 2ZXQA 1RQHA 2O56A 3GVRA 1X8CA 3CHDA 3BSMA 5ECUA 1UG6A 5HK4A 2ZDRA 3G3MA 4C91A 2J75A 1GVQA 1NELA 2YXOA 2X05A 3BJSA 1MXSA 1RVKA 1TPUA 2WZMA 4F0RA 4HJWA 4NZ3A 1PX3A 2Z1XA 1IQ8A 3PTQA 3SZ8A 2C71A 4KEVA 4B5UA 2PUZA 4AVFA 4NIRA 1CEOA 3MHFA 1XLIA 2XFWA 4GPNA 3RXZA 4CCDA 3N2TA 1JCMP 3S2LA 4ATDA 4PSPA 1XIGA 3SSJA 2J78A 3EXRA 5T9CE 2QJGA 2ZUVA 4RW5A 4ATLA 1WQ5A 3W7CA 3G6MA 3H4GA 9CGTA 3KCLA 1R9ZA 1CGWA 3NURA 3S4TA 2PP0A 2O4MA 4Y6GA 1W9VA 4JQAA 3VKKA 1K02A 4J3SA 4ERAA 4DUXA 4AXNA 1P0EA 4O15A 4ZQCA 1EJTC 2V8ZA 5T9BG 4EXQA 4Q33A 3GHSA 2PLMA 1GTHA 1A47A 3HQNA 2DZUA 1UIOA 4FO4A 1AQHA 5IHSA 1E55A 4DO7A 3KVKA 4OFCA 1H41A 1XIJA 4L4MA 1NFBA 2A2IA 3VDAA 1UBPC 1E9IA 3UQNA 3F4DA 1QOXA 2WLZA 3GYCA 1KBBA 1JYNA 4RV8A 2BXZA 1W91A 1KC7A 2WZHA 4AD5A 4CCCA 2V67A 4NJHA 1LUCA 4DZHA 3PFMA 3VXGA 5DXYA 3WUBA 3OHIA 2V2DA 3Q67A 3CMJA 3DG3A 1VRDA 4HB7A 3EDKA 4QDPA 4B2DA 3WLJA 4MPQA 4P7RA 4HOXA 3HG2A 4IOTA 3SURA 4V15A 3KWSA 3LCWA 3LPFA 1XYCA 3LBCA 2OX1A 2WZIA 1VYPX 3FK4A 3CH0A 1RJRA 1H2JA 3WLTA 3WBWA 3NZ1A 2OZ0A 4A3QA 1TZ7A 2XZ7A 3TE9A 1K4GA 1X98A 3I68A 5HPOA 3BLDA 2OT1A 4QBXA 3LPGA 3HPFA 3CZ8A 3PTDA 3II1A 1KM4A 3EKGA 1GORA 4G2DA 2X09A 1J96A 3EWXA 1YDVA 1HIZA 3RM8A 2YFNA 2FTYA 4DO6A 1LL7A 3RN6A 1SSDA 3AYTA 4AEEA 4C6KA 3BUVA 4IPPA 4Z1DA 1BSLA 4KWUA 4ORMA 4XSLA 2I57A 2BY0A 3NZQA 4JBRA 2C14A 4BCEA 1WDRA 5CQ1A 1U5HA 1JULA 4ACZA 3QSRA 1X96A 1B31A 4CN6A 2YFOA 1YPIA 4RX0A 4O50A 4MUZA 3EDJA 4RKAA 4KGLA 3A21A 1Y7VA 1NM9A 3IJ9A 3HG3A 4J28A 1K9FA 3SUTA 3TOPA 1JJKA 3ONBA 4LUTA 4ZB0A 4KWOA 3AXIA 2VDGA 1UHVA 1BQCA 3FEMA 1OM0A 2ACRA 4AZBA 3B8TA 4Q7NA 4XAPA 2E6YA 1GJUA 2PLCA 1G5AA 2E68A 2PGWA 4QAIA 4BEUA 3UVIA 3W1PA 3PBWA 3BOXA 4GYFA 1D7FA 2YL8A 1YTEA 1PKMA 5LIXX 1YNYA 2XM1A 1CB7B 4B16A 1WZAA 1UWQA 1X8FA 3RF9A 3WLRA 3FYOA 5F1UA 2A6NA 3WLMA 2YCEA 1Q8AA 1N8FA 2JEQA 2W67A 3B0UX 1EX1A 4I90A 5DCBA 1YDNA 4IMCA 5CLWA 4QSFA 1GQLA 5E1QA 1SUXA 1WCGA 3WQCA 3O6DA 4TIMA 4C7DA 1TWWA 1JXKA 3W00A 4Z2LA 5I00A 5J5DA 1AG1O 2DH3A 1EPVA 2WNZA 3DZ1A 2YZRA 5HANA 2G3JA 1E0XA 1O6IA 2NWRA 4NHVA 3GHTA 4O8RA 5FJOA 3KS6A 3PZOA 4IG2B 4LQ1A 2GGEA 3HURA 1J93A 3DBNA 1C90A 1TZZA 4J9JA 4XAFA 4C1KA 5BCAA 4GUJA 1LP6A 5HMFA 1J0IA 1WOAA 3B9OA 3ICJA 1X39A 5FF7A 2DPEA 4TOQA 2KZHA 3K4AA 2Q8XA 5FAGA 3RGTA 3FA4A 1AD4A 2CKRA 3LXAA 2FGZA 3NJ3A 4GUHA 4J3VA 1IZJA 3DG6A 3PJXA 2HSAA 1YDOA 3MYPA 1UP3A 8A3HA 1R3YA 2A3AA 4Q8NA 1KO0A 3BAKA 3VI2A 3BLKA 2BBFA 5GJNA 1OABA 4YU1A 1K70A 1GVOA 3EOUA 1H11A 1F6YA 2J74A 5AYZA 3PK7A 4JY8A 2Z2UA 3ARZA 1BXCA 4ES4A 1XC6A 2X1RA 3BK0A 3BSHA 1EF3A 2DY3A 3HQ1A 3V5FA 3C3NA 1TG7A 4WUIA 5BWFA 3R0UA 3KBMA 4DLMA 1W1PA 3QTGA 1KM3A 1XGEA 4JTFA 2X42A 3E0WA 3SCSA 1GK8A 3RYSA 2ZZ7A 1MYRA 1DTUA 4WSHA 3L0NA 1QNQA 1O95A 1UKQA 3OEXA 5BU9A 2GUYA 3B8DA 3B4UA 4K36A 3AALA 4NKCA 3IEBA 1VCGA 1QPQA 1KCLA 2ISWA 4C6OA 1H1YA 4H6KA 1A5SA 4IMEA 5D9OA 3UWWA 3W1LA 4NX5A 3S6DA 5AB3A 3ARXA 1PTAA 1Q45A 1DKWA 3W7HA 4IQJA 3S8HA 1L6WA 2OEMA 1H1ZA 4G7EA 2ZRVA 3BVJA 3BURA 5TAOA 4FIRA 4UCFA 3SADA 2G0WA 5M3WA 4QJ1A 2HVNA 3K46A 4I7UA 5BOOA 2VX6A 3QF0A 4QP0A 1TA3A 1W0MA 1DJGA 3OHMB 3RLGA 2DT0A 5T8GA 1IEWA 3WH6A 3QHMA 4HIBA 2UV8G 4E5TA 1LQ2A 2NX1A 1L0PA 4CQCA 2CU0A 3TTQA 3MY9A 5CBIA 5CPOA 1JCTA 1TCMA 2OQLA 1KFJA 4PMQA 3LV5A 5LKYA 4CEXC 2BV9A 4KWWA 4E3TA 4HMDA 3M5VA 4Y7EA 4QG8A 1KB3A 4O16A 4ML4A 2P1FA 4HOZA 2ZZ4A 4ZE4A 2DSWA 2OKTA 3DKJA 4I8YA 2ZFAA 4LBRA 2DORA 1MSSA 1Z48A 1AQMA 1G69A 3AHTA 3O0KA 1UZHA 4F3HA 3AZRA 4MWAC 1QU4A 2I17A 2OPJA 4EACA 1W5QA 4L64A 3BV4A 3JR2A 4JX5A 3W7EA 4NJIA 4GY1A 4M56A 5DMLA 1VP5A 1Q85A 3DYMA 4PUDA 3CJPA 2NT0A 1B4EA 2J8TA 4GINA 3CLWA 4QE5A 2AAMA 3VNKA 2F8QA 4AYSA 1K7FA 1SZGA 2GVLA 2FGLA 4FA3A 1VPYA 2INZA 1VYSX 1DIOA 4JIPA 2QCGA 4W7UA 3PY2A 1TSIA 5DBUA 2OTDA 3GHRA 4FLSA 3UJSA 5I3HA 3EDDA 1W17A 4GUIA 1SZFA 3HFYA 5JH1A 5ABFA 2VGBA 3MCOA 2W91A 3UWEA 1UKSA 2R1PA 4IQLA 2GVGA 1SO4A 3PBYA 1C91A 1A5BA 3TTEA 1FDYA 4DBDA 1NP0A 3ZXWA 5C8BB 1NY1A 2RDUA 3K13A 3W1UA 1M9HA 4N42A 4HSNA 2QIIA 1MFUA 4LC8A 4WKAA 4GIYA 1OIMA 1XLLA 2GGGA 3G5EA 1QI2A 3MMDA 1IZCA 1FWWA 1EJ7L 1M53A 4YS1A 4IUGA 2Z29A 2E5CA 1Z6KA 2WCSA 5K9DA 4TTUA 1V0NA 1BKSA 1ALDA 1TPDA 2E3ZA 3WSUA 3WQ8A 1ENUA 1YXYA 3IUIA 3SIMA 3GXDA 3VKAA 2HXUA 3DKLA 4MY1A 3W23A 1GPFA 5CZKA 4D8LA 4A3YA 4ZTYA 4UQCA 4LYPA 1V6UA 2DZPA 1POKA 1ZS2A 3M9YA 3GIYA 2CLHA 1KRCC 4HPNA 1LUCB 1F3WA 4J27A 4X60A 1QBAA 4US5A 1CXKA 2O4QA 1T6MA 2EBNA 4REQA 5J04A 4GYKA 5KEZA 3PZVA 3SO7A 2O9PA 3T0TA 4WCJA 1SJDA 4MHBA 3V75A 3NVTA 5I03A 3T0CA 1UMLA 1HP5A 4S3FA 1I0DA 2OKOA 4AD4A 1P1MA 4CNSA 5CJ5A 3C52A 4Y90A 1J0HA 1VS1A 1FDJA 1SMAA 5LA0A 1UC5A 5HOSA 4ICCX 3FOKA 2EAWA 1KWKA 4JTLA 4DF0A 4Q4MA 4HGXA 3E96A 1LOLA 1IEVA 2D2OA 4RPQA 3F2DA 2WXDM 3VKCA 4P5UA 4YTTA 3N04A 4AY8A 3PG9A 1QT1A 1XIIA 1JI1A 3THUA 3WQEA 1KD0A 4C6LA 2D0FA 4IP4A 4ACZB 3ABQA 4NNBA 2XVKA 3OBKA 1HF6A 5HWMA 2E77A 4AU0A 9XIAA 4CQDA 7A3HA 3NFUA 5HQLA 5D2WA 2AKMA 4Q4OA 3W85A 1SFSA 2A3HA 2V5BA 3CTLA 4IL0A 4GI8A 3L12A 3VIIA 1VB9A 1BFNA 3E2SA 2GDVA 1CXLA 3M0IA 2PDLA 1B3XA 3VM5A 2VC6A 4E0CA 1YRRA 4QR6A 2YDSA 1YLVA 4LH8A 3B4YA 4LYRA 1NWRA 3AUOA 5AECA 4TX8A 3SRFA 3TJIA 3GU9A 4AIOA 2ZZ5A 4JQ1A 4B5SA 2OELA 4JIHA 1NTHA 2PC4A 4LUIA 2XVPA 4AC1X 4JN7A 2WM0A 1OIFA 2GJLA 1OSEA 1YQ2A 1S39A 1XIFA 3MSGA 4G7FA 3WQVA 3W6MA 2VZUA 1IGSA 3SBFA 4UNIA 3MHGA 2MANA 4RZ6A 1T5AA 3H54A 3W7OA 1J9YA 1D8WA 3GNOA 3QFEA 3SUWA 4G1NA 3N3TA 4UTUA 1R3SA 3CV7A 1GOMA 1B2YA 4Z2KA 4GQBA 4HZ8A 4M6VA 5AZ0A 3MA8A 3QV7A 3DHDA 4Q6XA 2VJXA 3RU6A 1N2VA 1HXJA 3EX4A 3EOLA 4UTLA 2HV5A 4OE7A 1SO3A 2A1YA 3GXMA 5KZ6A 4YWIA 2PGRA 1DJQA 2A7NA 1QO5A 4DNHA 1QW8A 1WAWA 2OVLA 2GPTA 3CV1A 4PODA 5F2IA 4RE4A 4A8NA 1DJNA 4DUOA 1GYLA 4HKPA 3M44A 1XDLA 4P7QA 4FIQA 1UD6A 2H3BA 3T05A 2VCCA 2BLEA 2UWFA 1FH9A 5ABGA 2AGTA 3CO8A 4H9ZA 3T78A 4GZ7A 2HISA 1QHOA 4HCDA 1ME8A 1O5QA 1P0NA 1VR6A 2OWCA 1PPIA 3BW4A 1A0DA 1RA0A 5CPNA 3WJWA 2XH4A 5HATA 4GRSA 4IMGA 4MYAA 1XSIA 5DCDA 2VVNA 4MGGA 1DWAM 3VMNA 4DELA 1WA3A 5E09A 5EKYA 1BXBA 3CMFA 5BRQA 3W2MA 3NM3A 4BFAA 4BY3A 4KRUA 4O54A 5LIWX 2PDMA 4ML9A 3V5CA 1MFVA 2IKGA 1E0WA 1QHZA 4DJEC 1E0VA 3KP1A 3AS3A 1FUYA 5FF3A 4GYJA 1E72M 1JD7A 3WNNA 3UWUA 4IGSA 3LGEA 4D8ZA 1DIKA 3BLLA 4L4PA 3WIJA 3L68A 4X3ZA 4F9JA 2V5CA 1PIIA 3MMWA 4CU6A 3TA6A 3N17A 2XGIA 4OBTA 2WMIA 3OZYA 4XAYA 3ITLA 1TE1A 1DXEA 2D23A 4XQ6A 1IV8A 1EP1A 3BLFA 4FS9A 4ZQOA 3K8KA 1HO1A 3WF2A 1JZ6A 3TUUA 1TYGA 4LRTA 1SW7A 2OT0A 3WQGA 3IGSA 2NXGA 8CGTA 3WLPA 4C6JA 4S2BA 3HOJA 4I8DA 1OFOA 3OYZA 2XH7A 4JQ2A 4MNJA 1QNSA 4GGBA 4YMZA 3AHZA 4JIQA 4FX7A 4MADA 4AIEA 1E40A 4G7EB 3WL1A 2F2HA 2GQAA 2OLSA 4LUJA 2B0MA 5LNRA 4AZGA 3OIXA 3A3XA 1EX5A 4DO5A 3P8IA 1Y5WA 2QCDA 1TA3B 4B9YA 3E38A 1LLZA 3TR2A 1GZ1A 1ZSXA 3STFA 3AHYA 1NP2A 2EG6A 5D4YA 3DN5A 3UGRA 4NJKA 3VO0A 4IPNB 2A3LA 4PMYA 2YCIX 3KBSA 1UWAA 3LM3A 1V6WA 3W2LA 2VQTA 2OYMA 4IIEA 6TAAA 4FPSA 4BEQA 4YIWA 1SU5A 1OFQA 4JZ5A 4QITA 3EB3A 3TSBA 4DQWA 5DRCA 3TKFA 5A69A 1WUFA 3WF1A 1V3JA 1QATA 5HAOA 1XIEA 4S2CA 5JXQA 2G95A 2WMJA 3RO6A 1BTCA 1TTQA 3IS4A 2ZIDA 3WF4A 1ZBKA 5EMLA 2OZ8A 2ONEA 2PP1A 2ICSA 2QV5A 1YPXA 3P61A 1XIHA 1EIBA 2EPNA 1ICQA 4M6QA 2ISFA 2Y0FA 2YL5A 1CWYA 1UZ4A 5HMSA 4N7QA 4HPHA 1Y5VA 5GJMA 3QPEA 4LWWA 1KKRA 1RQEA 3B06A 1GQIA 2OSXA 2KAUC 2QKFA 1JL8A 5FEWA 4FB7A 3C8FA 4M24A 2OB3A 2BGQA 2QHAA 1ISXA 1EJXC 3NQMA 3T2PA 3A3HA 3PJUA 4MFEA 4MKNA 4GI9A 2EPOA 3OODA 3ARSA 3W76A 3QFWA 4AIUA 5FJTA 4LTSA 4AIBA 3AIBA 3DXIA <