1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
2O7QA 3OEXA 5IBXC 1QO2A 4LS1A 5KTLA 5I3HA 1LLWA 4ZL1A 1QAPA 3SY5A 1XBXA 5D2YA 4GUGA 2A5HA 1SZFA 2E6FA 1HFBA 4LWWA 4WY0B 3IEBA 4UTJA 3R8RA 4AB4A 4C1KA 4U4MA 3NO5A 4ONVA 2X1SA 1NSJA 3GXPA 1XBYA 2PURA 2ABBA 2BLEA 1LOLA 2NXGA 3KVJA 4GC4A 1RPXA 1JCXA 2QCFA 4JX4A 1GVOA 3OVRA 1KFKA 3IIOA 2HS8A 3W7NA 2VEMA 2EF9A 4EOUA 4AVFA 1PCWA 2GUUA 4R34A 1UB3A 4O10A 4UFMA 1NF0A 5EMUA 3HG5A 4KWWA 1GWJA 3NL5A 3M9YA 3FYPA 3QMSA 3M44A 1WV2A 2QDHA 3N9RA 4JD4A 2OX1A 3SFKA 3W1TA 1KFCA 5AC8A 3KRUA 4QNEA 1ICSA 2PRHA 3W07A 3M1ZA 4K6AA 4EF8A 3FA5A 1H7PA 3N2XA 1VYPX 2ISVA 1OABA 5KINA 3FJLA 1PHWA 3M6YA 3ZR4A 5LKYA 4HKPA 3P8JA 5F1VA 4S2BA 1EP2A 3MHGA 3U8GA 5F4WA 4O52A 2A2IA 1OFQA 3L0GA 3NQ6A 2PCQA 3ANYA 3G1XA 4FEZA 4GXMA 2ZZ4A 1TPUA 3NG3A 1JR1A 3TJXA 4ZQPA 4H6KA 4MFEA 5K2ZA 4UTKA 4JTFA 2YPIA 2BTMA 2A21A 3DFOA 3LHVA 2DZXA 1TQXA 5C5YA 3GDRA 4UCGA 4L4LA 3HO8A 3W7JA 1P0KA 3IIPA 3P74A 2E6DA 2Z6JA 3KVMA 5AOUA 1RZMA 4N9DA 4ALDA 2O7SA 3DFNA 3HPZA 3NQMA 4DBEA 1K03A 1KFLA 4DO5A 4E0CA 1W0MA 1DJQA 3TQVA 5D02A 2P0OA 1IXPA 1KTBA 4YL2A 4IMFA 4LV9A 4I9AA 1G4PA 4JTJA 4BF9A 1LCOA 2OZ0A 4JYFA 2FPYA 1H60A 4K8HA 2QCDB 3G1FA 4OBTA 5EPDA 1H63A 2CZFA 3GAKA 2RDWA 2BWGA 2AAMA 3O8AA 4I7UA 2NUYA 3IGXA 3QYQA 3O15A 2NUWA 2QAPA 1IXOA 3W1MA 4CCDA 1DHPA 1LOSA 1P5BA 1Q6RA 2HTMA 3DZ1A 4DQWA 1LYXA 1N7KA 4GRSA 2Q8LA 3F4NA 2WOQA 2V5LA 3PBWA 1OHLA 1DL3A 4K7YA 1O94A 2ZCGA 4RJEA 3NGJA 5D05A 3CM4A 1FWRA 3N19B 4R33A 3CU2A 1TPB1 3G1DA 1XCFA 4Y9AA 1OVDA 4UXDA 3EB2A 5LNWA 3W75A 3P60A 2ATSA 5AYZA 1VYSX 3G1AA 3R5EA 2ZDRA 3LX9A 1TMHA 1TV7A 3TSDA 1AK5A 2V0TA 1UCWA 1LRQA 3LV5A 2YX0A 2WJZA 1ZALA 3H54A 3EKZA 2R94A 2E5BA 4LVGA 3L68A 3W74A 2CLOA 1F6PA 3KAOA 1W37A 1JULA 1FCBA 3IGUA 2Z2UA 3OHIA 4UTUA 5HQEA 1OF8A 4O14A 1XM3A 4NZFA 4O57A 4UMBA 1K8XA 4O18A 3M47A 5A8GA 4OV4A 2WQPA 2C16A 1KM4A 3FIGA 3L65A 1FWWA 3W9ZA 3TMQA 3KOFA 1X7FA 2X2GA 2WKJA 1TRIA 3ABOA 1VPXA 3QSTA 3MO7A 1KM1A 3NL6A 3PBYA 4M7TA 3LCXA 2JKPA 1H7OA 4FF7A 3GKAA 2YW3A 3VE9A 1VH7A 2WO5A 4ICNA 5DCBA 3MJYA 3G8RA 3NQVA 4U28A 4YXGA 1IXNA 3BV4A 4N4QA 5KSWA 5AHFA 3U6WA 4K7VA 3W1XA 3NOEA 3EWYA 3TAOA 1PIIA 3SGUA 3T4CA 3FFSA 3I7RA 2VEIA 3LCIA 5LNUA 4NUWA 3A24A 3STEA 4Q32A 1PV8A 4AWSA 3HQ1A 4UMAA 3EWUA 5HWMA 4TIMA 1YDVA 1JVNA 3TDFA 3VCRA 2ZA2A 3WJWA 1OFOA 3EXSA 2ZRVA 4QAIA 1JUEA 2C0AA 3C61A 2VKZG 1V7YA 3HGJA 3SZ8A 3P7YA 1B4EA 4UNKA 2X1TA 1M6JA 5D37A 2EHHA 4N4PA 4ADTA 2DORA 3MUXA 5D32A 3N73A 4MPQA 2BX7A 3O6YX 4NVTA 4HSNA 4D2JA 2J24A 1WXJA 1H1YA 3PUOA 2PRLA 4XTDA 5HINA 4XUGA 4GUJA 3JS3A 4O15A 2X1UA 3TH6A 1GVQA 2KZHA 5D33A 1JJKA 4QIUA 2QJGA 5DY2A 4ZZ9A 4NX5A 2A0NA 2X1RA 1OFRA 3QW3A 2OMAA 1AL8A 3LBMA 4GWEA 2EPHA 1L6WA 4XTIA 5LZLA 4X22A 1SW7A 5SWUA 2W0UA 1TTQA 4NU7A 3R2GA 1DQWA 4MY8A 3NQ7A 3WJSA 2QUUA 5G2WA 2WNQA 1B3OA 1P0NA 2V2CA 2QKFA 2V9DA 4O17A 2UV8G 3TQ0A 4P2VA 3K30A 2VXNA 1LTDA 4NX0A 4RR4A 5EY5A 5K4ZA 2E6AA 2J88A 1EX5A 4MLJA 1WX0A 2ZFAA 1R2SA 3NM3A 4Q4KA 2Q8ZA 2B7NA 4JEQA 5AC6A 1M7PA 1J5TA 1NF7A 1Y0EA 2ZBTA 4WQ6A 1LLZA 5DBUA 5I3IA 3ATYA 2FPVA 1HG3A 3S8HA 4QQ3A 4N9BA 5CSRA 3C56A 1LROA 1O95A 3I65A 4UTLA 4UTTC 2YYUA 3W87A 1CX9A 1XUZA 2W6RA 3JR2A 6ALDA 3BVJA 4JTUA 4PTNA 3B0PA 1D3HA 3TROA 3KFTA 1N8FA 5KITA 3MHFA 5L6UA 4N6EA 3W3OA 3TC6A 3P61A 2GVLA 1Q45A 3UWZA 2ZZ5A 3RF9A 1RVGA 1ME8A 5HWJA 3PG9A 3CB8A 1OX4A 2JGYA 4JDBA 1LRTA 1RD5A 1VJIA 2XN0A 3RFAA 3PUEA 4HT3A 1OG0A 1X6UA 3CWOX 3NQ2A 4XZ9A 1GQNA 1O60A 1KV5A 2FDSA 3S1UA 2A85A 2TRSA 5FF3A 6TIMA 3C3NA 3RLUA 1W56A 1G6CA 1LBLA 1I4NA 3W73A 3TNOA 2E5CA 2JGQA 4DELA 5HR7A 3MP5A 4WZHA 2RKXA 1QDSA 2GJLA 4FNPA 4BWLA 3TIMA 2A7PA 3LM7A 4DO4A 4ADUA 3NL3A 2CU0A 5H2ZA 3W1AA 3UYCA 2GPTA 2J6XA 2ZTKA 1KM3A 4OU1A 4GUFA 3TXVA 3G0XA 3CTLA 4WJEA 4JS3A 4IGHA 3W2KA 1QPRA 2VEKA 3LHWA 1U83A 3UWWA 1VRDA 4PEKA 1EEPA 5DXYA 1FCVA 2C18A 3TMLA 5HMSA 5AC7A 3YPIA 2FIQA 2NX3A 4NJKA 3EWXA 3B04A 3NXFA 1WBJA 3LXCA 3L21A 3UZJA 1W5NA 2QCNA 3Q37A 4A29A 3G22A 1KLYA 2I14A 3UWQA 1VQTA 4JYEA 4NJHA 2E68A 3W1LA 3TC7A 4JN6A 1A50A 3PSWA 3TW6A 1A53A 2A7RA 4DPQA 1JQXA 8TIMA 2CZ5A 3C4UA 3QMRA 3LBCA 3W1UA 3UNDA 1WQ5A 3LERA 1J4EA 2GJNA 3PWAA 3D0CA 4O4WA 1G4SA 1Q6LA 1BTMA 2DZTA 3GDLA 5FF2A 4MUZA 4AH7A 4A3UA 3HOJA 1KBIA 1T0OA 1CI1A 3O6CA 3HPXA 2BSLA 1LBFA 3UD6A 3C2RA 3W7IA 4LS0A 5IM51 3W7PA 1IGSA 2CWNA 3GZ3A 4EIVA 4NJIA 1NAL1 2B7OA 2H3DA 2QJHA 3BW4A 3W7EA 3TU9A 2BXVA 2H90A 1GVSA 2A7NA 2DP3A 4LNYA 3C52A 1X8FA 1SUXA 3CQ0A 4LRSA 1KM0A 1K02A 4LT9A 3FEMA 1KTNA 1V5XA 4DBDA 2F84A 4HIBA 2I1OA 1XDMA 3MI2A 2ABAA 4O0KA 1SPQA 5DCDA 3TQKA 3M7WA 3NQFA 3UWUA 4LY8A 3F4WA 2C19A 1H1ZA 1R30A 1OYBA 4IMDA 4JTEA 5CGQA 1Q3NA 4NXKA 3LLFA 4NT0A 3PUDA 1LP6A 4NQ1A 2VFHA 5AHNA 4YWIA 4UFJA 1VLIA 1AW1A 3VFLA 4RLIA 4ZVJA 2YSWA 4DF1A 1F76A 5F1UA 5KZMA 3P84A 1TSIA 3GAYA 4LC8A 2C13A 2QCEA 3UPBA 3RMJA 1XFBA 4O28A 3PBUA 4XKYA 4Z1BA 3LB0A 1LOQA 1DKWA 3N14A 3TV8A 5EBUA 3PB2A 3GLCA 4DXVA 4ORMA 1Z44A 1WOAA 1OFEA 2CLHA 3QZEA 4DF0A 1O5XA 1X1ZA 1P1XA 4JNMA 2NV2A 1OX4B 4XBSA 1AL7A 1W54A 3QRHA 1XBVA 1MO0A 1R2TA 2G95A 4RK8A 3DFSA 3O05A 1DBTA 1TPFA 4UIOA 1C8VA 5AHMA 1JCJA 2DU2A 5D38A 1I2OA 3THAA 3W72A 2RDTA 4AAJA 3P8IA 3S5NA 3ABSA 2DZPA 1BKSA 3TW7A 3W85A 2W79A 3NQGA 4JY8A 4GUIA 3PG8A 4FNSA 4N6FA 4MY9A 5F2GA 5D30A 4O1BA 5EKYA 2ZZ7A 4O1AA 1H7NA 3SR7A 2EAWA 1MSSA 3WK3A 1L9WA 2VC6A 3BG9A 4UTTA 5T26A 5AYXA 3LRLA 1LRNA 4O53A 5E1QA 3GNNA 1OX5A 2NXIA 1SQ7A 5LHEA 4UFLA 4BI7A 2F7FA 2OCZA 2R14A 1SSGA 5G4EA 3KHJA 4CQ8A 4TU1A 3G3DA 1UUMA 5U4NA 5I3JA 5CPLA 1KFJA 1VCGA 1VGAA 4O0ZA 5FEWA 3G0SA 1EP3A 5HNRA 1TO3A 1EP1A 1GYLA 3AJXA 3LTSA 4UFKA 4XQ6A 3W2MA 1H7XA 2NLIA 2CFFA 1TTIA 4L4MA 4RX0A 1GYNA 1GG0A 1QPOA 1OYCA 4NNAA 2CZDA 4AF0A 1HTIA 4BWLC 4S2CA 4X2RA 4AWTA 1U5JA 5TIMA 1TTJA 5D03A 1R46A 2ZA1A 3B4UA 2E5DA 3NPWA 4RKAA 4KFPA 3EX4A 5HWNA 3B0UX 3E02A 1JCMP 3MP4A 2Y61A 3C2FA 1H7WA 2B4GA 4HPXA 3B0VC 4UMCA 3TUUA 4O8RA 3A21A 2QDGA 3QFEA 4NNCA 3SGZA 3M16A 2VFGA 4UNLA 4YLWA 4O54A 4FX8A 2QAFA 4RZ5A 2WSQA 5DBTA 1KW1A 3STCA 4M19A 3THQA 3UXAA 4IQLA 3GVGA 1IF2A 3O1NA 1HO1A 1ZY9A 4OT7A 3MI6A 1VLWA 1ZCOA 5D2VA 4QITA 5DY3A 1OK6A 3IIXA 2RH9A 3M41A 1W5QA 3QW4B 3W7LA 4JGDA 3RK8A 5LGZA 1OK4A 3DHDA 5G2HA 3G0UA 3L0KA 1KLZA 3CT7A 5U7SA 3P5YA 1UBSA 1NFBA 2QUVA 1ME9A 3MI3A 2EGZA 3F1QA 3WJYA 2IQTA 4UTHA 3BW3A 4QISA 4UTIA 2E6YA 2TSYA 2Y70A 1I2QA 3W2JA 4ZQNA 4O1DA 1FDJA 1X1OA 4FNQA 1A5AA 4AHOA 1T96A 3ZWTA 3MYPA 3SECA 4PFMA 3W2UA 3L0NA 3MBFA 1ZNNA 4GFSA 2DZUA 2BZNA 1RQBA 2DJXA 4DF2A 2TMDA 1FCQA 1TREA 2ZYFA 3C0JA 3W83A 3T55A 2VELA 1LM1A 3L2IA 4LV4A 4FX6M 4PC8A 1ML1A 3EWWA 3UWYA 4A2SA 4HNTA 5L9FA 3G1HA 3P80A 4LS2A 1YXCA 2E1DA 3S0CA 4MFDA 2CLEA 4UTWA 5I3KA 4LVAA 5HUPA 4FNUA 4A2RA 3GDKA 1MEIA 3FKRA 3CEPA 3B06A 3HB9A 4TO8A 5CPMA 3NQ8A 1OYAA 2Y7DA 3HG4A 1IXQA 1H61A 3PB0A 1MZHA 4MLRA 1YTEA 3ZFHA 4MYXA 2YFNA 3SI9A 3MWAA 1YDNA 3DHFA 3T78A 2VFFA 5CZJA 3G18A 5DXXA 2D73A 4IOTA 3O07A 1SR9A 3TR2A 4IWWA 1YXYA 1Z41A 3HF3A 5CSSA 3OVQA 1H5YA 3UWVA 1BEUA 1T8XA 1VHCA 3EX2A 3DAQA 3QSRA 4HN4A 1GPWA 5E0KA 2QEZA 5DLCA 3G1VA 4UFHA 4FO4A 3FKKA 3TFXA 4N9CA 3T7VA 2C15A 3IVSA 5C2XA 2DJLA 3G3MA 1QMLA 3QF0A 2G96A 4R53A 5KZEA 3S42A 4TX9A 5DCEA 3M5ZA 4AF0B 3WK1A 2ZRUA 4GUHA 4ORIA 3H55A 3LHTA 4O19A 5CZ0A 1QO5A 1LORA 1S5TA 3E12A 2CZEA 1H50A 4FIQA 3STGA 1DVJA 1R47A 1ZJIA 4N2YA 4GJ1A 1KM5A 2P10A 5F2LA 3NPUA 2V5BA 2Y6ZA 3W2LA 2Q3RA 3IRDA 3W76A 3QM3A 3M5XA 4JTLA 2V30A 4H3DA 2X30A 1ZAIA 3PBVA 1W3IA 2B7QA 2HS6A 3LCHA 3M0ZA 3NQDA 1B9BA 1PCKA 1OX6A 3KVKA 4IX0A 2ALDA 3IV3A 1Z48A 3LLDA 5J5DA 3NAVA 4MJMA 4PL1A 5LNRA 4LW7A 1WBHA 1YLVA 3O16A 2CLFA 1WAUA 2YDAA 1JQVA 3DI1A 4GBUA 4Y8FA 4JIQA 3I6RA 4YMZA 1XBZA 3MW7A 3TCEA 1C29A 4NZJA 3HJZA 1OFPA 5BMXA 4MZYA 3C2VA 2DZSA 1FWNA 1PL9A 3RLVA 3O63A 5E93A 1VYRA 3EKLA 3GDMA 1EIXA 3LOTA 5C55A 3E96A 3W1PA 3N34A 4NNBA 4PL2A 1XUUA 3W7HA 1MEWA 3T44A 1W3TA 5KZDA 5HULA 1GT8A 4AWUA 3SJ3A 5C54A 1ADOA 3DKLA 4MZ8A 5CPOA 1HO4A 5I3GA 4HNVA 1IIGA 2P1FA 3IVTA 3VI2A 3BGGA 1FQ0A 1YTDA 1JCLA 3FYOA 2ZA3A 4ML9A 4K37A 4MOZA 1GG1A 3W7RA 4MIMA 3LV6A 3LCLA 1SO3A 4IXXA 1E51A 2FFCA 3G1YA 2ZZ6A 1SO4A 2AQWA 2YR1A 3A23A 2G5WA 3Q2DA 3DENA 3CIXA 3BLIA 3F03K 1SO6A 1PS9A 1EUNA 4MVAA 4N02A 1P4CA 2CLKA 2Z1BA 2ZZ1A 4HHPA 4E2BA 4O50A 3TSMA 4MZ1A 4AEOA 1OF6A 2B7PA 4BI5A 1A5CA 1J2WA 4FX7A 4Z08A 1YTKA 1QR7A 3CLMA 3W7DA 4JTIA 5AN7A 3M43A 4ZQOA 2XFWA 1K8ZA 2QCDA 1WDWA 4KFOA 3PS7A 1UASA 3U2OA 1TV8A 3C2OA 1CW2A 3INPA 3C8FA 2VFDA 2E77A 3ELFA 3W70A 3W7OA 3CPRA 1UUOA 4CNNA 1G4TA 4AXKA 3QJAA 3NPVA 4IJBA 1L6YA 4TMCA 4JR5A 4J9JA 1I2PA 3WJZA 5AYYA 4X3ZA 5BNKA 4AHQA 4BI6A 1A5SA 5TBOA 3LI1A 3EX6A 1HL2A 3W84A 4AHPA 4PH6A 2JK2A 2Y88A 5K7JA 4MY1A 5J5RA 3L9CA 3L5MA 1FX6A 3VKJA 1QWGA 4W9TA 1VR6A 2Y7GA 1TB3A 1H7RA 2X16A 4RZ6A 2V81A 2JKAA 4UTWC 1FBAA 2JBMA 4HNUA 1VZWA 3NM1A 3DXIA 2Y89A 5HR6A 3BPWA 2C14A 3GB6A 1BWLA 4HPJA 1KBJA 7TIMA 1ICQA 1YPFA 2HSAA 5F4XA 2V82A 5CZTA 3DKJA 5CPNA 5G2IA 3JRKA 1TQJA 2ZZ2A 1WA3A 5D04C 2QCCA 2NWRA 3IIVA 4N9EA 4O13A 3I7SA 3BG3A 2GQ8A 4NJJA 3T40A 2C1HA 4FB7A 2NX1A 1DORA 3L66A 4LU0A 4K38A 1S3HA 4JTGA 2QCMA 1SW3A 3S5ZA 3OVPA 4UUIA 4RCXA 4M6PA 2J9ZA 2H8XA 1EA0A 5D2TA 2FTPA 2HMCA 4FNRA 4O16A 5HJLA 4DEFA 2J9YA 2B0MA 3KVLA 4FNTA 3SW6A 4P61A 5HUOA 1L6SA 1F73A 1DQXA 3UZ5A 5D2WA 1KFBA 3O06A 3Q94A 1SU5A 4A22A 3QPYA 2ZRZA 4ADSA 2ATMA 3W1NA 4RZ4A 2WSYA 3LGEA 2WPBA 1VHNA 5EYWA 4S1FA 4OGZA 3BLEA 4K8EA 2Y85A 1JUBA 5GVJA 3V75A 4KKXA 4Z0SA 3W88A 4GE8A 3NZ1A 1FXQA 2XN2A 3OBKA 3ATZA 3BW2A 3W7KA 1B57A 1EWDA 1IIHA 3C2EA 4LVBA 1VC4A 1WOBA 4O11A 1FCUA 1OFAA 3OA3A 4DO6A 1RV8A 2YW4A 1OJXA 3GKFA 1TTPA 1G4EA 5EA9A 1G67A 4AMAA 4ZQRA 2WNZA 2DZVA 4KWVA 4FXRA 3FOKA 4PCFA 5CG7A 3S5YA 1ZENA 4H4IA 1D3GA 3QQ0A 3P81A 4EVZA 1EWEA 5K9DA 4I7VA 2QUTA 3FS2A 3PY2A 1TPEA 1TPC1 3QH2A 3ZWSA 4CLMA 3DI0A 1DJNA 1JUKA 1TJRA 2YXGA 4POCA 4C1LA 3GR8A 1BWKA 3BO9A 5FEPA 1F74A 1EUAA 2FJKA 4CQ9A 1KM6A 3S1WA 2NWSA 3B05A 4JTKA 2WV8A 5G5IA 2XN1A 2PRMA 3GYEA 3S9YA 3DFQA 3B8DA 3LTYA 5D2XA 3TJLA 2GQAA 4CNOA 1SW0A 1W31A 4E38A 1A5BA 3LCGA 3ABRA 3RNDA 3HGRA 2FB3A 4LTSA 3DFPA 3W6YA 2ISSA 1XC4A 5D09A 4XBKA 5BOOA 4FXSA 5FEZA 1ME7A 1W1ZA 1GJPA 1G69A 4O4VA 4UC5A 1TCDA 4UFIA 3LXBA 1T99A 4IX2A 3EX3A 5AHIA 3DGRA 4JIPA 1K3UA 1DV7A 1TIMA 3LRKA 1TPDA 2RHGA 5CKSA 5K9XA 1SFJA 4M6QA 2V2HA 1EPXA 5K3VA 2NV1A 3LHYA 5LSMA 3E0IA 3DBPA 2FQIA 4UR7A 4X9SA 4FHAA 4XWUA 4LOCA 2A6NA 5BMWA 4LRTA 3W7MA 4LVDA 2YGYA 4Z1DA 4HSOA 1KFEA 1QCWA 3W1QA 4CCCA 4UR8A 3IIZA 3RU6A 3LHUA 1ZAJA 4IPIA 4Z1AA 3ABQA 1THFD 3S5OA 1OFDA 1ZHAA 4PA8A 1MXSA 3KXQA 3ZS4A 3S6DA 3BGJA 3TAKA 1YADA 2Y7FA 3NL2A 1K8YA 2YCEA 3NNTA 1VS1A 2VFEA 1KTCA 5G4WA 4WD0A 1AMKA 4WXZA 3L5LA 5K4XA 3QEZA 1ALDA 1AW5A 3PVFA 5LGXA 3LI0A 5ABTA 1FUYA 2QJIA 1GOXA 3HG2A 1FWSA 1W8SA 3G8EA 3HMJG 1F5ZA 3NDOA 3W71A 2A1YA 4QJ1A 4WOQA 4BFAA 1I2RA 4YCPA 1KV8A 3LTPA 4EWND 4JYDA 1H51A 3W7CA 3CC1A 1K7FA 4XKYB 3A5FA 1QNVA 2QCLA 5KMYA 5DELA 1S5VA 1PE1A 4R7JA 3W2NA 2V8ZA 1VCFA 2CLMA 1TV5A 1G7VA 3HGSA 3QC3A 4IUOA 3S1VA 4BK9A 4B5NA 4MJZA 4Q33A 3PC0A 4CCEA 2J9XA 1ONRA 3LDVA 3UXDA 2VOMA 2YFOA 4WOZA 5F4SA 1QOQA 4KFNA 1DOSA 1XXXA 4PODA 3GIYA 2RDUA 3BG5A 1R2RA 1YYAA 3UY7A 4OQVA 1GVFA 3S1XA 1RQEA 3MBDA 4LVFA 4TR9A 5K9CA 3OIXA 1RQHA 4M6VA 1KM2A 1LBMA 1JRCA 3NPXA 1XDLA 5IBXA 2H8ZA 2QCGA 3UPWA 5TQLA 4Y90A 3GDTA 3R89A 3TFCA 3TX9A 3W7QA 1D9EA 1YDOA 4ZQCA 1B4KA 3W7GA 3E9AA 5H91A 1W5MA 4K39A 1I45A 4ZMGA 4MYAA 3CHVA 1JRBA 2ZRWA 1GTEA 3O6DA 3GNDA 4JY9A 3I68A 1FWTA 1AG1O 3HGOA 3HBLA 3M5YA 2YZRA 4WXYA 2JKEA 3NVTA 3OG3A 4Z1CA 1O5KA 4G1KA 1Q6OA 4BR1A 1C9DA 4JX6A 3L5AA 4JTTA 4OE7A 5AHEA 4UTMA 1KA9F 2OT1A 3NQCA 1PVNA 2TYSA 4O1CA 3N3MA 3LHZA 2A6LA 2Q3OA 1WYIA 5EL1A 5C6MA 3PF3A 2Y62A 3TSBA 5F2IA 3AO0A 3NQEA 2ISWA 5FF7A 2G97A 2GOUA 4TMBA 1OFBA 5FI8A 3E49A 1K7XA 4O12A 4Y6GA 2TPSA 1SZEA 4YCOA 2GQ9A 2QR6A 3H53A 4CQAA 2A4AA 3TK7A 4Y96A 4ZQMA 1Q6QA 4WY0A 3A22A 3GR7A 3NZRA 3GK0A 4WX2A 3M5VA 2OT0A 3QQ1A 5G1TA 2PC4A 1FXPA 4NXSA 5FF4A 1XKYA 1AW2A 1L2UA 3PULA 3BK0A 1YPIA 4HNNA 3EWZA 2R8WA 4MKNA 2Z0IA 1UJPA 3EEGA 4IMGA 3VNDA 3EXRA 1VCVA 3BLFA 3TXZA 4EF9A 4JXCA 3WJXA 4JX5A 4JICA 3USBA 3W86A 4Z0JA 4E2DA 3IVUA 2DZWA 1K7EA 1ZAHA 5A5WA 3FJ6A 2AGKA 4M7SA 1QOPA 2FLIA 4IMCA 3LCWA 3GXTA 3V1PA 3HPSA 2C3ZA 2QF7A 2ZTJA 4OV9A 3KRZA 3G24A 4OHQA 3A9IA 1SZNA 1TJPA 1XI3A 5AFDA 3N2MA 2QCHA 5FESA 3P62A 3P82A 3NYZA 1O4UA 1EB3A 3WFAA 3DFTA 2C6QA 3A5VA 5AB3A 2CW6A 3WK2A 1F6KA 1PHQA 4QSHA 5FF0A 4RV8A 4RXGA 2H6RA 4GNJA 1TPVA 3HIJA 5LHFA 3QMTA 1TRDA 1W5PA 3R13A 1SO5A 3MMTA 3TA6A 1LDCA 1FDYA 4OWGA 3PM6A 4DPPA 4RXFA 1QPQA 2ZRXA 1S5WA 1LZOA 2RFGA 3EX1A 1FY6A 2J27A 3KX6A 2E09A 4I7WA 1ZFJA 2ZQ0A 1GTHA 4JDYA 1TYGA 5AHLA 1TPWA 3GX9A 3STFA 4IXHA 1TPH1 1NVMA 1W5OA 1GVRA 3GXNA 2Y63A 1M5WA 3P67A 2VFIA 4FIRA 1GZGA 3FLUA 3LRMA 1H62A 2VENA 2Z6IA 4QM1A 1JCYA 3NEVA 5BW6A 2VEPA 5LNSA 2ZZ3A 3C6CA 3IGSA 3I7QA 3L67A 4K36A 4WY0F 3BARA 1SFLA 3PR2A 4QNWA 1NEYA 3SIZA 1N55A 5FEXA 2OJPA 2GVJA 2PE4A 3EXTA 1QPNA 1F7BA 3QPZA 3TKFA 1JCNA 1Z42A 2CLLA 2NUXA 2WSRA 3UQNA 3DH7A 1RR2A 4JTHA 1F05A 4CNPA 3NA8A 1G7UA 3N9SA 3PAJA 4LC6A 2LLEA 3TE9A 3W22A 3CWNA 5G1YA 4LUIA 3PSVA 3WK0A 4A21A 5DN1A 3B03A 5BRBA 1XL9A 1QFEA 3R12A 1HUVA 5I3FA 1M7OA 2V2DA 3CIWA 2H3BA 2I9EA 3NQAA 1W3NA 3W1RA 2R91A 2FPTA 2YYTA 2NX9A 3MP3A 2FB2A 1GEQA 4IPJA 3SSJA 3P5ZA 1SZGA 3VE7A 3EWBX 1I8JA 1ICPA 3CEUA 3G1SA 4NJGA 2CLIA 2NXHA 2NZLA 1MEHA 3LXAA 2WNNA 4JTSA 2EKCA 3HG3A 3MHUA 3LCFA 3W23A 4M5PA 4IMEA 3MYOA 3Q58A 1I2NA 2ZRYA 1F2JA 5F2MA 2Y7EA 3UY8A 2GVGA 4LUJA 5MHBA 3KRSA 3DU0A 5LNVA 4WUIA 5CZSA 3NR0A 1SSDA 1FDZA 1YXDA
chains in the Genus database with same CATH superfamily
1QO2A 4LS1A 5KTLA 1LLWA 3MQTA 5XIAA 1QAPA 2WPGA 3SY5A 4EXAA 2E6FA 1OCQA 4GY1A 4MAVA 4UTJA 4GVHA 3MMWA 1NSJA 5KETA 3SRHA 1XBYA 1JZ8A 3NJ3A 4NP7A 1LOLA 2NXGA 3ARTA 2UBPC 1OC6A 4H9VA 1B0IA 2HS8A 3W7NA 4KWUA 1X6LA 4EOUA 3PZNA 4KETA 2PTWA 2FHCA 3VA8A 4GMEA 1FHLA 1IT8A 3SCSA 3AIBA 3VIPA 2PBGA 3FYPA 5IDIA 4HHHA 3N9RA 4C6EA 4NKCA 3UCQA 1V93A 2OX1A 4AZCA 2VQTA 4DN1A 4HCDA 4IFOA 4QNEA 4MB1A 3CL7A 4K6AA 3I3BA 1KQYA 1P48A 5AKQA 2IUZA 1VYPX 1B30A 4ZODA 5KINA 1K6AA 3FJLA 3M6YA 3NCOA 2V5CA 4PRWA 2J7CA 1EP2A 1E4NA 1US3A 1UD4A 1VFSA 5F4WA 1CLVA 3I3DA 4Q8WA 4FEZA 3BAYA 1V3JA 3EPOA 4YS1A 3IARA 7REQB 4C6BA 4MADA 1LWIA 1V3IA 1T8QA 3VD5A 2YBUA 1XF0A 4JTFA 3GC4A 2BTMA 3DFOA 3NYDA 4JNZA 3TYBA 3EPNA 3ZLHA 4YTRA 3KM8A 4UCGA 4DM1A 1HJSA 3HO8A 2Z6JA 3KVMA 1YQ2A 5AOUA 1RZMA 4NG3A 1KR1A 2O7SA 3C8NA 1K03A 2ZX6A 1DJQA 3TQVA 5D02A 1JFXA 2P0OA 1KTBA 2PDUA 4J5NA 4OOZA 4LV9A 4B92A 2VX5A 1XPYA 3B8TA 2OZ0A 1K1DA 1A5LC 2HDJA 4JZ5A 4JYFA 4K8HA 5BU9A 5AY7A 2VC7A 4QDWA 1OGGA 3O15A 3CYVA 2PDKA 5M1TA 2BY3A 3PZUA 1XFCA 1CCWB 1Q6RA 3W6MA 3DZ1A 3BAJA 1WDRA 4GRSA 4FR1A 3F4NA 2HNEA 3VOFA 1R7AA 3XISA 4I8YA 4GYFA 4CN4A 2OLAA 3NGJA 1BVWA 5TNVA 1QW9A 2R1KA 3H2AA 3H7VA 4HHLA 1I1WA 1B2YA 2ATSA 1VYSX 2IQ0A 1TMHA 4PMYA 3BZJA 1AK5A 2W3ZA 3QY7A 1ZQ5A 2DW7A 2WJZA 1V8EA 1ZALA 4EPDC 3EKZA 2R94A 4G9PA 3N18A 1KGXA 1QI4A 3L68A 1F6PA 1FCBA 3BCDA 4H6QA 4UTUA 4GA8A 4WSHA 4JFUA 4O18A 5A8GA 2DT0A 2YA1A 4OV4A 5I09A 3C2YA 4I3GA 2C16A 1KM4A 3FIGA 1FWWA 3QY8A 4JIIX 1ZPTA 2X2GA 2W27A 2GZXA 5CBBA 3QSTA 1YW1A 3MO7A 1RY8A 4Q4PA 4XIMA 3NSMA 5M17A 2YCIX 2YW3A 4DWSB 3KBSA 3MJYA 3CZJA 3VOGA 1IXNA 3R25A 1XLDA 5AHFA 1Z9AA 4C5ZA 1XIEA 3NOEA 1BXCA 4AZCB 1EO5A 3T4CA 2VEIA 4HK6A 3LGGA 3A24A 4Q32A 4AWSA 1SR0A 3AXIA 1TKKA 4TIMA 4G2DA 4BQ2A 4CD7A 4ZOEA 1UYQA 1XHGA 3DHUA 4CU6A 2WYSA 1OFOA 2R6OA 3BJTA 2RGMA 1F4AA 4TOQA 3C61A 3W24A 4GVIA 3ZXWA 3P7YA 1B4EA 4ROQA 2X1TA 4MAZA 2EHHA 4N4PA 4MPQA 1QUMA 4GIAA 4D2JA 1WXJA 1H1YA 4KF1A 4CD5A 5HINA 6ENLA 2DY3A 4KIEA 1BRLA 4O15A 1TIWA 4GJIA 3KL3A 3WUBA 5D33A 3I4KA 4QIUA 2A0NA 3QW3A 3CUJA 2EPNA 3BCJA 4KEMA 1HKWA 3DC0A 2VUYA 2EPHA 1W8GA 5SWUA 1SGJA 2W0UA 3DEQA 5AZ1A 1KBKA 4MY8A 2OWWA 2WNQA 2EQDA 4Z42C 2V2CA 2QKFA 2V9DA 3ZT5A 1RUSA 3KUMA 2UV8G 3HQNA 4BS0A 2VXNA 1RXOB 3NVDA 3RDKA 1CT5A 4HNOA 4NX0A 4Q8QA 2E6AA 3PJXA 5FL1A 5I79A 1WX0A 4P7RA 2HBVA 4Q4KA 3VDBA 4D8ZA 5AC6A 4AD2A 2GLKA 2WC4A 1Y0EA 3N6HA 4CNSA 2ZBTA 1GOKA 4GABA 3PJTA 2VDIA 4QQ3A 3UA4A 3C56A 4UTLA 3VZXA 4J3ZA 3OGVA 2W6RA 3E2VA 3AIEA 3MTWA 4JL1A 1WP6A 1KGWA 3AS0A 5FJRA 2JFEX 3WNPA 3MHFA 5L6UA 4BZYA 1IZCA 3B8UA 3P61A 2GVLA 4XZHA 3UWZA 2F38A 2JEQA 1ME8A 5HWJA 2R1LA 1VJIA 3RFAA 5C7VA 1Q7QA 4LYQA 3S1UA 3L23A 5C71A 1W9BM 3EOOA 3PTKA 3U5YA 1I4NA 2PTXA 4REQA 5H6HA 3TNOA 2E5CA 3ZQ9A 4WZHA 3GFYA 4FNPA 2Z1SA 4BWLA 5CC6A 3LM7A 2EJAA 3NTYA 3GTXA 3SCRA 3GW3A 1KM3A 3KZPA 1F3EA 5A8NA 3WNKA 3CQJA 4PRRA 4M82A 1WDDA 1QWKA 3LHWA 4DBUA 4PEKA 5F7UA 4CVUA 2CIPA 5DXYA 4L5ZA 4RNIA 3OPSA 5HMSA 2ZIDA 5CH9A 3GH7A 2X41A 4TQTA 5HDRA 2DQWA 1YE6A 2L5HA 1KO0A 5G4HC 4CNUA 1WO2A 3KCJA 3NXFA 1WBJA 3LXCA 3L21A 2OLHA 3Q37A 3H2EA 1BGGA 2PF8A 2I14A 3UWQA 1VQTA 3R4IA 1GCYA 1DIEA 3PUGA 1FWFC 3W1LA 3VNLA 1JPKA 3SB0A 1E0UA 4ERGA 2VHLA 8TIMA 1JQXA 4UB9A 3UESA 3QMRA 3GW0A 4HBKA 1ZL1A 3W1UA 1W32A 5A6LA 1J4EA 1QHZA 1RVKA 4RZBA 3GBEA 4Q3MA 3VMPA 1Q6LA 2CBVA 5A8QA 5FF2A 4B4FA 4PN2A 4FOJA 1KBIA 3HPXA 2BSLA 2VJXA 3W7IA 1UD3A 1UQYA 5IM51 2C7FA 2I5GA 4EIVA 3OO2A 1O1ZA 2Q01A 1RJPA 2YBVA 1DJYA 1X8FA 3VGDA 4ZFCA 1E0WA 2VGFA 1UA3A 1GJWA 3FEMA 4JIHA 4Q8UA 4OBRA 1ZBVA 2I1OA 1XLLA 1SPQA 4X9YA 1OZMA 3GXFA 4HZ8A 1OY0A 2OFJA 4H7VA 1H1ZA 1HP4A 1FKXA 3LLFA 1LP6A 4NQ1A 3T08A 3UCCA 4UFJA 3VFLA 4RLIA 4ZVJA 2WWDA 1O68A 1MW0A 5KZMA 1CLKA 3P84A 4ZB5A 3ZT7A 4LC8A 3K4WA 2WCGA 1S1RA 3OHMB 3WF0A 4O28A 2VD8A 4XKYA 4Z1BA 1D3CA 1LOQA 2I7GA 1JI2A 3TV8A 4HU8A 3AXXA 1J9YA 4V1XA 5A6MA 2RUSA 3RMEA 4DF0A 4IP4A 4I6KA 3MUIA 1XPGA 2G3MA 3U48A 2WVSA 4CU8A 4L9YA 4RK8A 2VZOA 3WF2A 4JAWA 3CV7A 4I9MA 1Y5WA 1C8VA 2WCAA 3THAA 4OTKA 2RDTA 3QXBA 3WX7A 5EFFA 2PWGA 3ITTA 3TW7A 3NQGA 3PG8A 3RLGA 2FHBA 2CXGA 1J96A 2ZZ7A 1RJRA 2DIJA 4O1AA 3R1ZA 4IMAA 5ECVA 4J2MA 4KGLA 1Q7MA 4GYPA 5T26A 4C91A 3LRLA 3GNNA 3MC5A 5RUBA 3K13A 1V03A 4F0HA 3KOXA 3GY1A 4XG1A 3W28A 2F2KA 3H24A 4GQGA 4KH2A 5I3JA 1VCGA 3UZWA 1VGAA 1ZJBA 2YDSA 4AUBA 1R7OA 1M9HA 1EP1A 4H7CA 3AJXA 4HYRA 1KRBC 2INFA 2CFFA 2XIJA 4RX0A 1KD0A 1QPOA 2CZDA 4AF0A 1NWTA 4BWLC 4S2CA 2IPJA 2NQJA 4G8TA 1XQKA 1J10A 1TTJA 3A13A 4PMJA 3OZYA 4E4UA 1EJWC 3B4UA 4PMOA 3NPWA 4RKAA 3ORWA 3EX4A 3H12A 4JFSA 1JCMP 1BYAA 1TE6A 3VDHA 3KHDA 2Y61A 2B4GA 1QOXA 4HPXA 1SM9A 4UMCA 4O8RA 3A21A 3QFEA 4WF7A 4URIA 3N4AA 1KWGA 3CV1A 4I6VA 2VFGA 4OUIA 4UNLA 1V08A 4O54A 2WSQA 3CH0A 5DBTA 2IPWA 1RP8A 3BTNA 4RPQA 4JQ2A 1ZCOA 1E3XA 1GEHA 3SAZA 1W5QA 3KWXA 3W7LA 3RK8A 3TTQA 5LGZA 1R3YA 1OK4A 3AMLA 1B3WA 3VUPA 3WDHA 1UBSA 1EOMA 1TR9A 4BJHA 5LXXA 1S2VA 1CGXA 1E71M 2W66A 4UTHA 2IQTA 4IFRA 1XIHA 1I2QA 4FI4A 3RLHA 3POCA 3TW9A 4D9PA 4AHOA 1T96A 3ZWTA 3QGVA 3MYPA 3SECA 4PFMA 4F0MA 3L0NA 2O9TA 4IQJA 2WVTA 1MWOA 3IACA 4FS9A 2TMDA 1W9DM 1BLIA 3DG7A 5HK4A 3E0LA 6REQA 3AIWA 3T55A 2VELA 1LM1A 5AECA 4EE9A 3L2IA 3WLHA 1TELA 5E09A 4UR9A 1A47A 3OTRA 5CAKA 1IQ8A 1CEOA 3MPGA 2Y8UA 3LU2A 4S3DA 5L9FA 3DHPA 5BROA 1YXCA 4P7OA 3EZ4A 3FNDA 4LVAA 5HUPA 4H00A 1MEIA 3WDJA 1W1B1 4TO8A 4ZA0A 5CPMA 3MKKA 1P6WA 2Y7DA 4A8LA 1WNOA 2XYLA 3UETA 1UR2A 3E3HA 1FP8A 3RPTA 2YFNA 3DHFA 1VFHA 1UA7A 1K4HA 3LY0A 3MB9A 3M07A 3O07A 2E9LA 3WBXA 1YXYA 1Z41A 5I06A 1MMFA 4CEUC 4DBWA 3WD0A 4F0LA 5CSSA 3OVQA 1H5YA 1XC6A 1BEUA 3D3FA 1R3QA 4A4AA 4IPNB 3DAQA 1TX0A 1UIOA 1IEWA 3SY8A 1GPWA 5DLCA 5HJXA 2OQYA 4C6MA 4FO4A 4OJYA 1ZS2A 4WCJA 2C15A 1KKRA 1XSJA 3IVSA 3N4EA 3G3MA 2QT3A 4AF0B 4JN8A 2BOFX 4F8XA 4J3UA 3BH4A 3F2BA 4O19A 2Z7GA 1XRVA 2E25A 1QO5A 1Q6GA 3S2LA 3U4AA 1NARA 2CZEA 3OODA 1R47A 3OW1A 3L4WA 1YMYA 2JQXA 1KM5A 3IAQA 4AU0A 2GUBA 3C3UA 4JKKA 1REQB 4C6DA 2ZUSA 4GYPC 3UGRA 3W76A 3M5XA 4JTLA 4DZIA 1RH9A 2FYMA 4H3DA 3FSUA 1NIUA 3GU1A 4NF7A 2OR2A 3M0ZA 3NQDA 3VDGA 3TA9A 3A6OA 1PCKA 2PDLA 3IJIA 2BOGX 1Z48A 3NAVA 2MANA 4PL1A 2ESCA 3URAA 3FCPA 3O16A 1WAUA 2Z25A 1YIXA 1UD6A 4Y8FA 5B7YA 1B3ZA 3PAOA 4R5EA 1DIKA 2A3BA 4WLCA 5GJPA 3TCEA 3AS2A 2E3ZA 4NZJA 5BMXA 3C2VA 2DZSA 3B40A 1LJYA 1FWNA 3UP8A 1VYRA 2WMGA 3EKLA 3QZAA 3H4XA 2DZBA 1EIXA 2C71A 3LOTA 4IUGA 3VO0A 1UHVA 3IWPA 3UR8A 5C55A 3W1PA 4DWDA 1EC9A 1S2AA 3W7HA 3T44A 4E5TA 3R94A 5HULA 4F2TA 2WJDA 1GT8A 2WNWA 4H41A 1U5VA 2NSXA 3HFYA 4GCAA 1XH0A 3T0TA 3VNYA 4IP5A 1JDEA 3QOMA 1HO4A 2ACUA 2BGSA 4FZIA 1EGVA 4GIYA 3KBWA 1JCLA 4MOZA 5JVLA 4MIMA 3LV6A 3LCLA 5E6ZA 1SO4A 2YR1A 3A23A 3DENA 4TV5A 1GKQA 3BLIA 3K1GA 4DAIA 3UPMA 4N02A 1P4CA 4KERA 2ZZ1A 4MHBA 3GH4A 4E2BA 2F6UA 2D0HA 1OF6A 2B7PA 3AYRA 4FX7A 4Z08A 1HGYA 2MUCA 3M0IA 3PS7A 1GYMA 1TV8A 2ZX9A 3UJ2A 8CGTA 2R9RA 1CW2A 4GNKB 3QTGA 2IPGA 1Q8AA 2E77A 4E4PA 2YXXA 3STPA 3NPVA 5CEWA 3SN4A 1L6YA 1ZTVA 3CZKA 1I2PA 1NH6A 4YJ5A 1VBJA 4FA3A 5FJUA 1LWHA 1ITQA 4AHQA 2PD9A 5TBOA 3A4XA 4RW3A 2QPUA 4AHPA 3SRFA 1X7IA 2QJJA 4MY1A 1MW2A 3MUCA 1US2A 4KQNA 4KRTA 1VR6A 1G5AA 1H7RA 3T0CA 2V81A 1MDRA 4JIRA 2F9RA 5HR6A 2OQHA 3TOYA 3H22A 1OT2A 1BWLA 1N2VA 1YPFA 1A5NC 1A5MC 4QG8A 3O6AA 4ZTXA 4D8AA 4B5UA 1TQJA 3U2CA 4IH3A 2ZICA 1R3SA 4O13A 1DJGA 3FYYA 5MF5A 1WB0A 1DORA 3L66A 3TN4A 1EH9A 3S5ZA 1LLOA 3OZOA 3P14A 4O16A 2J9YA 2B0MA 3KVLA 4M24A 4P61A 4HZ7A 4GX8A 4XD5A 2VWTA 4S3KA 3SIMA 1DWHM 1KFBA 4D72A 2R1PA 3VILA 4A22A 4AX7A 4LAUA 4D1IA 3RCNA 2J7DA 1E9IA 2ATMA 1E6NA 1R9XA 3W81A 1DP0A 1P1MA 3XINA 2Q8XA 4H9TA 4ICMA 5LIUX 4K8EA 1TVLA 2Y85A 3S9IA 1JUBA 3V75A 1XISA 2D0FA 4GE8A 2XN2A 3OBKA 4L6DA 1XIFA 1EWDA 3C2EA 4LVBA 1IZKA 2PDGA 1UH4A 3OA3A 3GVQA 1PZ1A 4DO6A 1M41A 1TTPA 1TG7A 3K8KA 5EA9A 1G67A 4TVCA 1Z7AA 4FXRA 4MNMA 1ZENA 3RPDA 3CZLA 5CQ1A 8A3HA 1GQIA 1EWEA 1UPMB 4DJFD 3E5BA 3RILA 2QUTA 3FS2A 1GOMA 1TPEA 1TPC1 3ZWSA 3OZPA 3DI0A 1JUKA 1IT0A 7CGTA 5FJOA 1POKA 3EOEA 3NZPA 1BWKA 3BO9A 2PU0A 1EUAA 2FJKA 3JW7A 1B9ZA 4CQ9A 3S1WA 4ASTA 4H6EA 3EDFA 2XN1A 4KBXA 2GSHA 2NQ5A 7XIMA 3S9YA 3DFQA 5TD4A 4W85A 1UD8A 3CL8A 3TNBA 2OTDA 3B8DA 3LTYA 4JNYA 5D2XA 4EAMA 3TJLA 2GQAA 3L2MA 3N2TA 3BLDA 1A5BA 3LCGA 3ABRA 4XAFA 4IP7A 3BCFA 4LTSA 3QOKA 3K4DA 5D09A 4W7WA 1NOUA 2XVGA 3G6LA 3L4TA 5BOOA 1W1ZA 4UC5A 1MRAA 4KRZA 1AA1B 2J4GA 4WKHA 2AAAA 3TOPA 3EX3A 5AHIA 2EPLX 1K3UA 1HKMA 5BXSA 4XBJA 3EA3A 3LRKA 2FJUB 2RHGA 5HNNA 5GNXA 5K9XA 1SFJA 4M6QA 3TN3A 3VIKA 4IG2A 1UR9A 1QRQA 1JDFA 1W1IE 4PB5A 1VENA 4S3JA 2X05A 1WE5A 3DBPA 4C60A 3E2QA 4XWUA 4QHRA 3QYSA 3W7MA 4HYVA 3ZOAA 3W1QA 3SGGA 3A3XA 3RU6A 1XLJA 2PWUA 3WLIA 4Z1AA 3TCSA 4UOJA 3RUBL 5A6SA 3ABQA 1V0KA 4A3YA 1ZHAA 1MXSA 5E5CA 3ZS4A 1MUWA 4IISA 3FHAA 4ATLA 3MKVA 3NL2A 1K8YA 1VS1A 4A3RA 1NQ6A 4WD0A 1Z89A 2CWXA 4AZBA 1ALDA 1AW5A 3LI0A 1GOXA 3M0JA 1F5ZA 3GNRA 4BFAA 4YCPA 4EWND 3WO8A 4JYDA 2J47A 3V5FA 3WLKX 2DDXA 1ZBCA 2VI0A 1FH8A 1UBPC 1PE1A 3AMKA 4R7JA 3DDMA 4YYCA 3E74A 2CLMA 1KNWA 1TV5A 1RAKA 3BC9A 1KC7A 3EDKA 3Q67A 3H7UA 4IUOA 4BK9A 1VFTA 3VM5A 3GUGA 1U2YA 1JDDA 1SFTA 2CBJA 5LIXX 5FA5A 1D8CA 3LDVA 2REQA 3UXDA 1X1NA 5LIKX 2OEMA 4WOZA 1QOQA 1DOSA 3LZ5A 3GIYA 3OBAA 1NFPA 2RDUA 1YYAA 2Y8KA 5EB8A 3L4VA 3SSZA 4L6HA 3SDOA 3OIXA 4Y9MA 1XLBA 3VC6A 2WZTA 4TVUA 4ZFMA 3NPXA 2OELA 5IBXA 1AH0A 3BAIA 5TQLA 1M04A 3R89A 3VKAA 2G0WA 4DZAA 1D9EA 3WQ8A 3W82A 2RAGA 4YHEA 1QNOA 4ZMGA 3CHVA 3F5JA 2WMFA 2ZRWA 2GDVA 3O6DA 1V6TA 4GK8A 1ZP3A 1NDVA 3QGKC 3LENA 2DSWA 2JKEA 1O5KA 1EF2A 1J0YA 4BR1A 3IJ8A 2ZVRA 4JX6A 4JTTA 2W61A 4UTMA 2OT1A 1E1CB 1ITCA 1O12A 4AX6A 2TYSA 2Q6ZA 4YN5A 1CECA 3Q45A 1UWRA 2Q3OA 1UP2A 1IEQA 1UWSA 3N04A 3NZQA 3TSBA 1DWJM 2OYMA 3NQEA 4J3VA 4B3ZA 2PUZA 3DYPA 2A4AA 2YKKA 3QGAC 4Y96A 1Q6QA 4WY0A 3A22A 5E6YA 3A47A 3NZRA 3V18A 2BODX 1NWUA 4NXSA 2PDBA 5FF4A 1YPXA 1TUXA 2PGWA 3ITVA 3D3AA 4GQ0A 1YPIA 1UD5A 2VC9A 1CGWA 2DT2A 2R8WA 3EWZA 4MKNA 4HOWA 5DMMA 4IG2B 1UJPA 3EEGA 1MQRA 3MDWA 5EMKA 4PSRA 1JNEA 3VNDA 1NDWA 5FJIA 3QLLA 3W86A 5FOOA 4GH1A 4F66A 1ZAHA 4M7SA 5ENLA 1B3VA 2XIBA 3FW6A 3HPSA 2C1IA 1OB0A 1TJPA 1XI3A 1YEYA 3AALA 1EB3A 4B16A 5AB3A 3WDRA 2UWFA 3BWWA 3QHNA 1S5NA 2RJGA 3MO4A 5FF0A 2PDFA 3CUFA 2PD5A 4PSPA 1DWGM 2GUYA 1J11A 3VD4A 3BOXA 2J7BA 1IHIA 4HP5A 4Q7BA 1LDCA 4JTAA 1LZOA 1AZ2A 2E09A 3KX6A 1ZFJA 2ZQ0A 1GTHA 4JDYA 1EGMA 1Q2RA 1TWIA 3CZEA 5M5DA 3B97A 4R85A 4ZOAA 2BXYA 1GVRA 2Y63A 3FAXA 3P67A 1GZGA 4D6IA 1OD8A 3FLUA 2AOSA 4PTDA 5JBEA 2VENA 4QM1A 4CVWA 3BSGA 2BFGA 3OIHA 4DJFA 4GZIA 4QNWA 5A6JA 3W53A 2HISA 3CHDA 4JTQA 1H09A 1Z42A 4A05A 2NUXA 3V1HA 2GYIA 4JTHA 1AFSA 2ZUMA 4CNPA 3NA8A 1TA3B 2BGNE 2LLEA 3FDGA 4CD4A 3W22A 3IK4A 4ACYA 3WK0A 1EBGA 4J35A 1QFEA 1B1YA 1HUVA 2FKPA 3TTSA 2V2DA 3M0YA 4U3CA 4L9ZA 1E70M 3IUHA 1B90A 1J12A 2WMIA 2H3BA 2I9EA 3NQAA 4EACA 1V4YA 5I24A 1W3NA 3GC5A 2FPTA 3TTOA 2QPSA 4CD8A 3MP3A 2FB2A 3O2LA 3P0XA 3SSJA 4FR6A 3EWBX 3OVGA 1ICPA 4C7FA 2VQUA 3CAWA 4Z2IA 3LXAA 2WZHA 4X2PA 2WNNA 2EKCA 3MHUA 2Z1XA 2INZA 5I2UA 1SMAA 4IMEA 4LF1A 3Q58A 3UG4A 2ZRYA 1F2JA 3B8WA 5F2MA 3CO4A 3VNJA 1PB0A 2UZ9A 4DZHA 5MHBA 5LNVA 1OIMA 3T2OA 1FDZA 2PODA 2O7QA 3ITLA 2IKHA 5IBXC 3ANUA 3S3GA 3SJNA 1E15A 4LWWA 4WY0B 5T91A 2X8RA 4U4MA 3IRSA 2X1SA 3GXPA 1RALA 2PURA 4XAZA 1JG9A 2BLEA 3M0HA 3WLOA 3DG3A 2QCFA 4MNKA 1E56A 1RCQA 1V02E 4AVFA 4PZVA 2WVUA 3ZSTA 4RNJA 1VRXA 1OG6A 4JQ3A 3RGTA 1DJIA 2OWCA 4KWWA 2I5QA 3PK7A 1TJ2A 3PZVA 3M44A 2QDHA 3GFZA 4Q8OA 3KRUA 3I10A 2PLKA 4CNTA 1R3WA 2AKZA 1MFVA 2ISVA 4Z2HA 1PHWA 2ALRA 5LKYA 4HKPA 4GGBA 3P8JA 5F1VA 2PDXA 3CO8A 3L0GA 3NQ6A 2PCQA 3ANYA 4S39A 3G1XA 5E0FA 3EB4A 1JR1A 1IR2A 3T8LA 1E3ZA 4H6KA 4MFEA 4UTKA 3ZO9A 2YPIA 1V3LA 1TQXA 3SUWA 5C5YA 2IKIA 3W7JA 3IIPA 3DFHA 3P74A 3KOYA 2W62A 1QNRA 4D6EA 2YZ5A 1R3VA 4N9DA 4LAOA 3S1GA 1OC5A 5ABFA 3OLDA 4WJ8A 1W0MA 4EPEC 4YL2A 4I9AA 4BF9A 3LQGA 2NQHA 1LCOA 1IT7A 4XAYA 4AC1X 1M68A 3G1FA 5EPDA 1D2KA 2CZFA 3GAKA 2RDWA 4I7UA 3VABA 3W1MA 2VCAA 1XCXA 5FCZA 1J0IA 1JXKA 1LOSA 4J3SA 4AZIA 2HTMA 2F6XA 2E0PA 4MB3A 3AHZA 2WOQA 4ECLA 2WANA 1Q5MA 4K7YA 1O94A 2OEJA 2ZDSA 1V79A 1R86A 5D9NA 3G1DA 3VINA 4GISA 3WKZA 1S39A 1WZKA 5LNWA 3UA3A 4DJEA 5I23A 3R5EA 4DJFC 4Q7NA 1TV7A 3TSDA 4O1EA 2V0TA 4LH8A 3CTTA 2Y0FA 3IPWA 1DXEA 2E5BA 4X0NA 4TX8A 1KB3A 3VDCA 3IGUA 2CKRA 5HQEA 1O7AA 3HPAA 1A0DA 4UMBA 4P7LA 2WLYA 1XH2A 1B5TA 1XRSA 3W9ZA 4PCTA 3KOFA 2HZGA 2WHMA 3ARXA 3V4BA 1C9WA 3ABOA 2E7FA 3NL6A 4HB7A 2V6AA 4M3PA 4JQ1A 4M7TA 4MM1A 3LCXA 4AFYA 2PLJA 3VE9A 1GVYA 1XIIA 2B31A 4ICNA 4ATDA 4IQEA 5BOFA 1LG2A 3N4FA 4HN8A 3AUOA 2YCLA 4GNVA 2QJNA 2BOEX 3W1XA 5XINA 2V3GA 4GI9A 5C9ZA 3FFSA 3LCIA 4LBUA 1XG4A 5FAJA 2O9PA 3CT2A 3F5LA 4ROPA 3H7RA 1JVNA 2ZA2A 3PBGA 4EANA 3EXSA 1M53A 4D71A 3OLEA 1O6IA 3H2MA 3AZRA 4FF5A 3ME3A 4UNKA 4PBGA 2PSNA 1M6JA 5D37A 4S3AA 4ADTA 3MUXA 3N73A 1AUSL 1SVDA 2BX7A 2YXOA 3MZNA 3GIPA 4HJWA 3W27A 2PRLA 3R58A 4XTDA 4GUJA 2ZKMX 1ISYA 3TH6A 4V28A 2KZHA 3SCQA 2PLMA 4FLRA 2ADAA 4V27A 3D47A 2HVMA 1E9YB 4ZZ9A 2YL9A 1W2VA 1GKRA 2OMAA 2QXWA 3HZ3A 4DLFA 1AL8A 4HSHA 4XTIA 4X22A 3ITGA 3P93A 5EMJA 1WDQA 4NU7A 2ICSA 1DQWA 4XSLA 5G2WA 4HK7A 1P0NA 3MS8A 4P2VA 2GL5A 3K30A 3B9NA 3RYSA 1LTDA 3KBNA 3NURA 5I78A 4RR4A 4KCTA 4QQUA 3URNA 1KBBA 4MLJA 5D8WA 3QV8A 2ZFAA 3NM3A 2Q8ZA 5DEZA 2B7NA 3EDDA 4JEQA 2XINA 2XVPA 3CMGA 1M7PA 1A3WA 1EJUC 1J0KA 3GG8A 3ARRA 2CHOA 4NZ5A 4QROA 4WQ6A 1LLZA 5I3IA 3WLTA 2VR4A 3TZFA 2Z1KA 2PCEA 1G01A 5CSRA 1XINA 3I65A 4C6OA 4UTTC 2YYUA 3W87A 5FL0A 1D3HA 5KITA 1HNYA 4ZCWA 1GUVA 3TC6A 3WLJA 1Z3NA 2ZZ5A 3RF9A 4PGLA 3WCZA 3IV8A 1A80A 2A3CA 2XN0A 4EP8C 1UQZA 1X6UA 2Z24A 5FJJA 1DPMA 1GQNA 1Q13A 1KV5A 3B8SA 2VDHA 5FF3A 6TIMA 3QKZA 1EYEA 1VEPA 2QF8A 3C3NA 3RLUA 1G6CA 2Y8VA 3WFZA 4DELA 2XG9A 3MP5A 1QDSA 2GJLA 2A7PA 4BCEA 3N6JA 3EB3A 3A3HA 1XRTA 5KZ6A 3BMWA 1UWUA 1FOBA 5HATA 3G0XA 3CTLA 2CEQA 4JS3A 4WJEA 3ZVHA 4LJ3A 1EDGA 3UWWA 1EEPA 3MSYA 1FCVA 1Y5XA 2C18A 3TMLA 1FH7A 5AC7A 3VD3A 3YPIA 2FIQA 4NJKA 3DIPA 2YCLB 3B04A 4OKDA 2JIEA 3W4RA 3A3WA 2PP0A 1LQ0A 3N2CA 4HK5A 3M0VA 2HE8A 2QCNA 4NASA 2EBNA 9CGTA 1Y8BA 3S6OA 3G22A 2NVAA 4JHMA 1KWKA 3FY1A 4RNHA 4JYEA 4NJHA 2E68A 3TC7A 4JN6A 1A50A 3PSWA 1FKWA 3AXHA 1A53A 5LA0A 4DPQA 2KX9A 2CZ5A 3AYTA 2EG7A 4A6GA 1WQ5A 5BRQA 4DO7A 4ZB2A 3D0CA 4W4QA 1QW8A 1CGVA 1BTMA 2DZTA 4Y9OA 3KW3A 1JZ6A 4A3UA 3HOJA 3WEMA 4QJ4B 4PR4A 3GG1A 3PZMA 3OGRA 3PPGA 1EXBA 2VRKA 1FH9A 3WH6A 1IGSA 2CWNA 3AZSA 3GZ3A 4YU1A 1IWPA 4NJIA 3E0FA 4E8DA 1BXNA 4G5DA 3BW4A 3W7EA 3TU9A 2H90A 4GXWA 2FH6A 3E1F1 4US5D 2A7NA 2DP3A 1Y7VA 3CQ0A 1KM0A 1HKJA 3AIQA 4DRSA 4R9OA 2NSOA 4D6GA 2PDPA 4IIFA 2WVVB 5DCDA 3TQKA 3M7WA 3NQFA 3ONBA 1XX1A 4LCRA 3MY9A 4AZGA 3F4WA 3H2CA 4LUTB 4AZHA 1R30A 1BPLB 1BF2A 4NXKA 4NT0A 3PUDA 2VFHA 4PUWA 1ZUAX 4HOZA 5B80A 5EBAA 4Q7IA 2YSWA 4EKJA 3V7PA 5HBFA 2VGGA 3WQ5A 2PC8A 3FGCB 1X98A 2FGLA 2C13A 3MV11 3PBUA 4BF5A 3LB0A 3FJ4A 1DKWA 3N14A 1U22A 5EBUA 2GK1A 3WNOA 5A6KA 4C6CA 1ZB5A 2OOGA 4DXVA 1KBLA 1OFEA 2UY3A 3EA2A 4XB3A 4YTUA 3AS3A 4JNMA 2NV2A 1W54A 3QBUA 3DFSA 3PWGA 6TAAA 1S3TC 1EDTA 1TPFA 4UIOA 7ENLA 4F0SA 1SZRA 1JCJA 2DU2A 3V35A 3W72A 4AAJA 3S5NA 3ABSA 2DZPA 4W89A 3KL5A 5A6BA 3W85A 2ZE0A 4FNSA 4MY9A 4O1BA 5EKYA 1ITUA 1H7NA 3OQ8A 4CUCA 3MA8A 3WK3A 1S5MA 1L9WA 1A4LA 5I07A 4E3VA 4MDPA 4H8UA 5AYXA 1NELA 1OX5A 1NDYA 5LHEA 4UFLA 1C8QA 4BI7A 2F7FA 3GTHA 4GPNA 1TJ0A 2OCZA 1W3KA 3ALGA 1DTNA 5G4EA 2OYLA 4TV6A 1UUMA 1XR2A 2BASA 3BLPX 5CPLA 3DECA 1XG3A 1U30A 2Q09A 4QX4A 1GZ1A 4KPLA 1E1FA 3MV01 1WZMA 1TCMA 1GYLA 2P88A 3LTSA 4UFKA 2IXVA 3W2MA 1FHVA 4HJFA 5D4YA 4L4MA 1VF8A 1GG0A 4X2RA 4MF4A 5TIMA 1R46A 4PEEA 1TZ7A 1NWSA 4M51A 4F3HA 2NQ9A 1XYFA 2VZVA 4XZIA 3VCNA 4QG6A 4O0QA 1OADA 4PRTA 3TUUA 3UFYA 4PMVA 1KW1A 3F2CA 3THQA 1IF2A 2XSAA 1HO1A 4KW2A 4OT7A 1VLWA 5D2VA 2OQLA 3GNPA 1GHRA 1GQKA 3T2PA 4PB4A 3EOSA 1Q6FA 3IIXA 2RH9A 3QW4B 4UCFA 3CHEA 4JGDA 3L7RA 2V3DA 3BLOA 4AYSA 4JHZA 5G2HA 2OYKA 3U0HA 1OBAA 3R6IA 3P5YA 2OKTA 1NFBA 1A5OC 4WDTA 3WJYA 3ARVA 3BW3A 3BL3A 3A9BA 4QISA 4UTIA 2WZEA 4XZLX 2GSEA 4MNJA 4ZQNA 2FGZA 3WBWA 1FDJA 1QI5A 3HQOA 4FNQA 4QJ3B 3MBFA 1PKYA 1ZNNA 3FA4A 4B3LA 1DE5A 1RQBA 2TODA 5HANA 4RW5A 2I9UA 1XH1A 1G0CA 4GG9A 1VFOA 1TFVA 1FCQA 1PKNA 3W83A 1DJXA 2GK1B 2GGHA 1WUEA 4PC8A 3EWWA 3WBYA 4A2SA 4G7EB 3KS6A 4LS2A 4J2PA 1MFUA 1S38A 3Q4DA 2CLEA 4UTWA 4GYJA 5I3KA 3LNPA 4FNUA 4A2RA 1PYFA 4XO6A 1ODZA 3CEPA 3N2BA 3ES8A 3B06A 3HB9A 3NO1A 3DCPA 3WMSA 1H61A 3PB0A 4MLRA 1QHOA 2VX4A 3ZFHA 1PO9A 1Q4NX 1SYTA 5FSDC 3T0AA 3RX3A 4OUEA 3QN3A 4P8XA 3ZM8A 1NDZA 2OO6A 1SJAA 2AGTA 4DYEA 1PZ3A 2QVNA 2PGEA 4DM2A 4AC7C 2QJMA 2XWDA 3OZMA 1H3GA 4H9ZA 3L4YA 3WIJA 3AI0A 1XRFA 2PS2A 4HN4A 3JVAA 3OG2A 1JCTA 1GQJA 4UFHA 1E5JA 3TFXA 4MNLA 1PX8A 1EL3A 1OCJA 2G96A 4R53A 4U5KA 2NQZA 1E6SM 3WK1A 2OZTA 2ZRUA 3TYEA 3PTDA 3H55A 4DNHA 1UROA 5CZ0A 3NO3A 1S5TA 2IMRA 2NQLA 4HPNA 2VOTA 5GJMA 1JI1A 3ZJ7A 1Q7ZA 1HP5A 5DRIA 2NVCA 6A3HA 3CUIA 4X60A 3NPUA 2GSJA 4TX6A 2DVXA 3W2LA 2E9MA 2Q3RA 3WMBA 3ISIX 4MJ2A 1QI0A 3WNMA 4O1FA 1VFLA 4AXNA 3NDYA 3QR0A 1W3IA 3VYLA 1V3KA 2EPOA 2B7QA 2HS6A 3FXYA 5CLTA 4MPKA 3EDEA 4DLMA 3LSBA 1QNQA 3KVKA 4IX0A 2DZAA 4B3KA 3VZYA 4AZ6A 5J5DA 1ZSXA 1WBHA 4CQBA 4WDUA 1YLVA 5ABHA 2CLFA 4TTGA 2YDAA 2XVLA 3WFLA 4GBUA 2VZUA 1JF6A 3I6RA 3U9IA 2G4FA 4UZSA 3WH5A 1IR1A 3C0LA 3GG0A 1KCZA 1C29A 4YWSA 3HJZA 1QK2A 2J25A 3DERA 4MZYA 4B5SA 1H4PA 4BQ5A 2X0HA 3EMCA 1OEPA 1S1PA 3BJSA 5E93A 4RDWA 3UT0A 2ODOA 3CHCA 3GDMA 4ZOBA 4D6JA 4C6IA 4DI8A 1SMDA 2W91A 4H7ZA 3RRAA 4PL2A 1XUUA 1J6OA 1MEWA 7REQA 2XFFA 2EXOA 1W3TA 2J7FA 4AWUA 3GNOA 4HA4A 4MZ8A 2HK0A 2VO5A 2PMQA 2PDWA 1Q2SA 4HNVA 1IIGA 3IVTA 3VI2A 1YTDA 3FYOA 4AEFA 1JYNA 4AZ5A 3P2VA 3I6EA 2FFCA 6XIAA 3G1YA 4CN1A 4A8IA 2ZWYA 2G5WA 3PHAA 3F03K 4AD4A 1WDSA 1PS9A 5FJPA 3VU2A 1NU5A 1MUCA 4JIEA 1QK0A 5E9AA 3SN1A 3R8HA 1L6GA 3UJFA 1OINA 1YTKA 1JZ4A 3W7DA 4JTIA 4Y9NA 4ZQOA 4RNFA 4Q8NA 3W02A 2A3AA 2FMNA 2V5KA 2VD9A 3ENLA 3W7OA 3NUKA 1EHAA 3CPRA 1UUOA 4CNNA 3TC3A 3QJAA 4IJBA 4TMCA 3UR7A 2BY2A 4V15A 2J6VA 1DYSA 1C93A 1KKOA 1A0CA 3EX6A 4C6KA 1HL2A 3W84A 1BG4A 1ZBKA 5J5RA 3L5MA 4ZTYA 4W9TA 1H0IA 4RZ6A 4W87A 1E43A 1OZQA 4UTWC 4W5ZA 3WQGA 2JBMA 4HNUA 2J8GA 3V16A 3W38A 1ICQA 1KRAC 4LB4A 2V82A 5CZTA 5CPNA 4JQ4A 4W93A 5G2IA 1B54A 3TN5A 1QPKA 2GJPA 2EO7A 2QCCA 4JFWA 4N9EA 1RPKA 3BG3A 1PX4A 3L4XA 2WM1A 1T7LA 3PTMA 2GGJA 2QCMA 4IGNA 4HMDA 2J9ZA 2H8XA 2PDQA 2FTPA 4FNRA 2D1ZA 2G3FA 2R24A 1KCXA 3FSTA 3GUWA 3PFMA 3UZ5A 4F9JA 5D2WA 3O06A 2XH7A 4CD6A 3NIYA 3OBEA 1SU5A 3SO7A 3QPYA 4ADSA 1UW9A 3W1NA 2WHLA 3OA5A 2WPBA 4DWSA 3ERPA 1VHNA 4HGXA 4S1FA 1XGEA 2J7GA 3VDAA 3T6CA 4US6A 2XGBA 3VOJA 3FV9A 3NZ1A 2QPXA 3CPUA 5HA7A 1DHKA 3ATZA 5LIWX 3PZTA 2CC0A 7TAAA 1VC4A 1WOBA 2GVEA 4O11A 1FCUA 1OFAA 1FVPA 3WD4A 2ISFA 3CJPA 2J74A 1S2WA 3SEPA 1EJRC 3P81A 3B0XA 5K9DA 3ARQA 2DSZA 2EEXA 4DBSA 4PB3A 1J6PA 5FIPA 2WLZA 1TWZA 2BHYA 3WQWA 3IJDA 3GR8A 1Q65A 1F74A 1W9XA 2HNHA 3CBWA 4Y8EA 1ISZA 1E4IA 5TAOA 4LAZA 3B8VA 2NT1A 3UXLA 1J18A 2VC5A 2VMFA 1VBRA 2QIWA 1HJVA 1XLAA 1HZYA 1A5KC 4LAMA 4B2DD 3RNDA 3HGRA 2FB3A 3S2MA 3DUGA 4LCQA 1ME7A 4Q4QA 5D8ZA 2VWSA 4ENLA 1TCDA 3DBNA 4UFIA 3LXBA 5JBFA 1WKDA 2VZTA 1FWEC 1TIMA 5JU6A 1Z69A 2ONEA 2VT0A 3DX5A 1H11A 1Q66A 1B3XA 3SCWA 1FWCC 1G9HA 4GH3A 1EPXA 4NAEB 3D6NA 1HKVA 5K3VA 2NV1A 5LSMA 3E0IA 2FQIA 3QR3A 1V3MA 2FZMA 4UR7A 2HRWA 4X9SA 1WZLA 5BMWA 4LRTA 3T09A 4LVDA 4DB7A 1QNSA 4R9XA 2HEJA 4HSOA 4E2VA 1KFEA 3NGFA 4CCCA 4UR8A 3IIZA 1TJ1A 3LK6A 1AD4A 3LHUA 3SRKA 4IPIA 2G3IA 4FLQA 1V6XA 1OFDA 4FAMA 1T40A 2YCEA 4ACZB 2VFEA 3CMFA 5G4WA 2YL5A 1W2PA 3GHUA 3WQFA 3QEZA 3M6DA 3PVFA 1BVNP 2CBUA 1FUYA 3HG2A 2F2HA 1FWSA 4FLSA 2IPFA 2A1YA 4NYYA 3N6QA 1X8CA 3BAXA 3AISA 3W25A 4JBRA 3A5FA 2QCLA 3L2LA 4HMEA 3QQWA 4GI6A 1VCFA 1QU4A 2P3EA 2Y5JA 4PULA 3S1VA 3GWQA 4B5NA 3GXMA 4LCSA 5A95A 3VKKA 2FVLA 4DUOA 1E55A 4BHYA 4S38A 1ONRA 3ITCA 3AFBA 2VOMA 2YFOA 5JIWA 5M2FX 1TMQA 4LPCA 3BG5A 1R2RA 3UY7A 3EPMA 4TTUA 2J79A 3QV9A 3MBDA 3AIRA 4LVFA 3WQOA 5K9CA 4KWSA 1RQHA 2ANUA 1KM2A 1O5RA 1LBMA 1KQZA 3UXKA 1JFHA 4Z17A 1Q6DA 1VJSA 2XHYA 3K46A 1VBUA 3VK5A 4UZUA 2BB0A 4Y90A 1DWIM 5GNZA 1LG1A 4ZQCA 1QTWA 3W7GA 4B5XA 4GFIA 3GH5A 4QG9A 1W5MA 1FFQA 1PWMA 2VURA 4FSAA 1JRBA 1F8IA 1P6BA 2HCVA 3AHTA 3PZQA 3W37A 1XYMA 2FVKA 4DWSC 3HGOA 2WJEA 3M5YA 3LPOA 2OGJA 3NVTA 3OG3A 4Z1CA 4G1KA 3T9PA 4Q8TA 1C9DA 5HPCA 3CUGA 5C70A 1PTDA 1UKTA 3NQCA 4M29A 4O1CA 3N3MA 5A8OA 5AC5A 3UWEA 1BYCA 5EL1A 1BF6A 4MWAA 1UR8A 4NI8A 5F2IA 7ODCA 5FF7A 2GOUA 1YDYA 4TMBA 3E49A 4JFVA 4Y6GA 2XDFA 4FK9A 1W1TA 1SZEA 2P76A 4CQAA 5CGMA 4IJCA 3TK7A 1EFZA 2X42A 4XD4A 3M5VA 2OT0A 1J8VA 5CSUA 5BOEA 1QT1A 3TWAA 4AYGA 1XKYA 1L2UA 3C86A 2BGQA 4KIRA 2Z0IA 2QW5A 1MW1A 4Y2WA 3TXZA 2Y2WA 4W84A 4NZ4A 4JICA 3WN6A 4AEEA 4Z0JA 3EWCA 1BXBA 4E2DA 2WWCA 3BV7A 1W6TA 2Y5EA 2FLIA 4AD3A 3T05A 3HA1A 3CWHA 3V1PA 1XICA 2C3ZA 4G56A 3KRZA 2GGEA 3A9IA 4E2OA 5AFDA 3N2MA 3BQ5A 3UYIA 5FESA 1GOWA 1ZBWA 4GJJA 1O4UA 4MB4A 4PMXA 3A5VA 2PPGA 3UJSA 3VCCA 3WK2A 1GW9A 1PHQA 4KT2A 4RV8A 1GZJA 4RXGA 2H6RA 4C90A 1CDGA 2G41A 1TPVA 3HIJA 2DW6A 3VPLA 1C92A 1CXKA 3PM6A 4NZ1A 1S5WA 3EX1A 1FY6A 2CETA 4OOUA 1QI3A 2D2OA 1TYGA 4D6HA 2Q02A 1ISXA 3GX9A 5AHLA 3STFA 1NP2A 3FDKA 1ADSA 1TPH1 1XLFA 4AD5A 1W1YA 1W5OA 3CMJA 2BNJA 2VFIA 2WKLA 2XSBA 4QE4A 3WQPA 1S2UA 3NEVA 4UQCA 1TUFA 3C6CA 2GVYA 4WY0F 3BARA 3PR2A 3UG5A 3CS2A 2XH2A 1PBGA 2OJPA 2PE4A 3N1AA 1KRMA 1VFMA 1F7BA 5CC5A 3CNYA 1JCNA 3IJ7A 2Z29A 3SFWA 2J78A 1RR2A 3WLMA 3QKEA 3GQYA 1G7UA 2FZDA 3PAJA 2OZ3A 2DPEA 3N9SA 2BDQA 3AMDA 1DWFM 4JKLA 4KMQA 2HXTA 3FN9A 1E73M 4A21A 1KCLA 5DN1A 1XL9A 5IRPA 1PIFA 4H2HA 2OSYA 1A3XA 4B2DA 1RY0A 4HZMA 1K9EA 4L1XA 4P8WA 3DYOA 1ONXA 3W1RA 2R91A 3T0BA 2PLCA 2YYTA 4UNIA 4IPJA 4L56A 4M1BA 1F3WA 1I8JA 3G1SA 2CLIA 2ZC1A 2NZLA 1EBHA 3KEHA 1MEHA 1IV8A 2GFTA 3HG3A 4E6MA 3LCFA 3W26A 1MUMA 3MYOA 4H01A 4ZO9A 3F4VA 3WLRA 1PWLA 2GVGA 4WRHA 1R9YA 1M03A 1ECEA 4LUJA 2WMHA 4EPBC 4MWAB 4WUIA 1AJZA 2YCKX 4PCPA 5DT7A 3NR0A 4QP0A 3VFCA 4WJXA 6CGTA 1YXDA 1Q8JA 1XBXA 5D2YA 1PTGA 4E4FA 4IIBA 1E0TA 1HFBA 1UG6A 3IEBA 4CQCA 3R8RA 1FWIC 4AB4A 5CJMA 4C1KA 3NO5A 3S46A 1RJQA 2ABBA 5H8MA 3VIMA 3KVJA 4GC4A 1RPXA 4V33A 4JX4A 3NEHA 2XISA 3LM3A 3VNMA 1OSEA 1QBAA 1PX3A 4PTWA 1XIMA 2VEMA 2EF9A 4K2SA 2GUUA 4R34A 4Z2KA 1UB3A 3MUZ1 1BQGA 1NF0A 5EMUA 2VDGA 2DSUA 3HG5A 1GWJA 3M9YA 4Y9PA 3QMSA 4XX6A 3VNIA 4AY8A 4JD4A 3IJQA 3SCTA 1KFCA 3M0XA 1ICSA 2PRHA 3M1ZA 1VEMA 1H7PA 4HMNA 1OABA 3HFTA 1N82A 2HVOA 2JF6A 3AHVA 2DT1A 1XIJA 4D6DA 1ZZMA 4MSSA 2A2IA 1OFQA 3RITA 3CQKA 4A3HA 4KEZA 2OVLA 3ARYA 2QDEA 3NG3A 4ZQPA 3CV6A 4WGHA 5K2ZA 2V5JA 2D2JA 2HK1A 1JZ3A 2V67A 3GDRA 1U33A 1P0KA 1UIPA 1OC7A 2E6DA 3SUTA 2JALA 3KDOA 5BYWA 3DFNA 3HPZA 4DBEA 4DO5A 3P6LA 1TWDA 2VCBA 5T9BG 4E0CA 3MSGA 4HD5A 4RE0A 3NXLA 1IEXA 1VAHA 5A3HA 4IMFA 3TYZA 1CB2A 1G4PA 2XVNA 4M81A 1R87A 1GK8A 2C1GA 4B91A 2H9AB 2PDYA 3WUEA 2FPYA 1H60A 2QCDB 1RK6A 4OBTA 1H63A 5DT5A 2AAMA 5FACA 3BICA 2ZC8A 3WLSA 1FWGC 3SQSA 3HPFA 1IXOA 1ISVA 4CCDA 3AYSA 3CHFA 1X6NA 1LL7A 1LYXA 1M3UA 3MCMA 2XM1A 5EMLA 1BG9A 3G1RA 2V5LA 1REQA 2Y5SA 4J28A 3C5QA 2ZCGA 3USZA 2VX6A 5D05A 1FWRA 5DMLA 4EK7A 4R33A 1Z6KA 3CU2A 2PDNA 1TPB1 2F8QA 1XCFA 3GE7A 1OVDA 4UXDA 1HKKA 1BHGA 3P60A 2J66A 2ZDRA 3M7SA 4GGHA 1EIBA 2FHFA 3H2NA 1JGMA 3LV5A 3VD9A 2V38A 2ZVIA 4LVGA 3W74A 2IS7A 3K1DA 2CLOA 2RDXA 1JULA 5GJNA 2PZ0A 4ZXLA 5C9UA 1OF8A 4K8GA 3LEPA 4H2CA 1PSCA 4RE3A 1BWVA 3RAOA 3CAQA 2OWXA 1JGIA 1D7FA 2E9BA 1X7FA 1CENA 2WKJA 1TRIA 5E0CA 1VPXA 3NQBA 1KM1A 3HTWA 3PBYA 4UQAA 1FWJC 1NOWA 2Y4SA 1I60A 3LUTA 4GO8A 2JKPA 2P50A 4FF7A 3BUVA 3WH7A 2WO5A 4YXGA 4I8DA 8RUCA 3BV4A 4N4QA 3SURA 5KSWA 3U6WA 1E9ZB 2YJQA 3EWYA 1MXGA 2WBGA 3PZGA 4QDPA 2QV4A 3TAOA 1WXYA 3I7RA 3NSXA 4KWOA 1E0XA 1UC5A 1HJQA 5MKGA 4AVOA 3HQ1A 3UF9A 4UMAA 3EWUA 3E2RA 3WJWA 4S3FA 2GGGA 1AQ0A 1JUEA 4PTMA 2C0AA 2VKZG 3O0KA 1B31A 2DORA 4C1NA 4BQ3A 5D32A 1GQLA 1LL4A 1FWDC 1FP9A 4HSNA 3H4GA 1OCBA 3PUOA 4U31A 4LSBA 2X1UA 2PWFA 4J3TA 4EXBA 1GVQA 4RUBA 2QJGA 4HTBA 4TUFA 4F48A 2X1RA 4ZO6A 1OFRA 1CB7B 1U1HA 3PNZA 2D22A 3GXDA 3LBMA 4GWEA 3RPMA 4W8BA 1L6WA 1SW7A 5T8GA 1YKWA 4M8UA 3NQ7A 3S47A 2BMBA 3L4UA 3UNTA 2WB5A 5IXEA 1ELSA 3U57A 3RJYA 2R1NA 1ENUA 1EX5A 2BV9A 4B5TA 4H9YA 1J5TA 5CCZA 3ATYA 2FPVA 5CAHA 1HG3A 4N9BA 3OOQA 4L61A 1UR0A 4LUSA 3MJMA 1VKFA 4WK9A 3PJUA 4YIWA 1CX9A 1XUZA 3JR2A 3BVJA 4JTUA 4PTNA 3TROA 4DY1A 1HJWA 4U2ZA 1N8FA 3NWRA 5CSYA 3GHSA 3A12A 4ZR8A 2YB1A 3CB8A 3PG9A 3T2QA 1OX4A 1LRTA 3UG8A 1RD5A 4HT3A 2Z2AA 3CWOX 3WDPP 4XZ9A 1O60A 2FDSA 1F07A 1TX2A 3D5HA 2XJ7A 1AODA 5CPQA 1LBLA 4WIWA 1K9DA 4U2YA 4NI3A 2JGQA 2RKXA 4B5WA 3TIMA 5AC4A 4ADUA 3NL3A 4NRRA 5H2ZA 3W1AA 4DNMA 2ZTKA 4OU1A 1Z8AA 4GY0A 5C2CA 4GUFA 2QYGA 1UKPA 3TXVA 3W2KA 4CEXC 1XP3A 2VEKA 2VYOA 5BZAA 2HJPA 1XJBA 1VRDA 2DFAA 3U2ZA 4LGXA 3ZSSA 1W91A 1JXJA 1GOIA 4PUEA 2OX4A 4U3AA 2E8YA 4XZWA 1WKFA 2NX3A 4S3GA 1RK5A 3EWXA 5CBIA 1VIZA 4JN7A 4D8LA 1UZ1A 3HV8A 4WEVX 3UZJA 1W5NA 2VVSA 1XGZA 4A29A 3B0YA 1KLYA 4D6CA 5MKGB 4R7WA 3UR5A 2JF7A 1OD0A 4WDXA 1M01A 2E67A 4AIEA 2YDRA 3WD1A 3GVWA 1AQMA 2A7RA 4A35A 3BDKA 4QE5A 3G6MA 4IF2A 2PP1A 3UNDA 3LERA 3MMDA 4GVGA 1ZP4A 1G4SA 3E6EA 3OP2A 4O4WA 1JIBA 4C1NB 3GDLA 3M46A 2IW0A 1XWYA 1XIDA 1T0OA 1CI1A 2OODA 3O6CA 3WH9A 1LBFA 4BQ4A 4LS0A 1PEZA 1H41A 5H8PA 3O3RA 4CU7A 4NY2A 1NAL1 2B7OA 3DN5A 2BXVA 4OZOA 4F2UA 3C52A 1SUXA 3LPFA 3E5PA 4LRSA 3RX2A 4LAKA 4LT9A 3LSCA 1MDLA 1V5XA 1NQKA 4A8NA 2EJ1A 4HIBA 3FA3A 3VKBA 2AKMA 4O0KA 4GVFA 4M6UA 2BXZA 4NRSA 3KL0A 3VIFA 3REQA 3CLWA 3UWUA 2IXUA 4LY8A 3ES7A 3KZSA 4IMDA 4JTEA 1L8NA 4RDYA 1Q3NA 3UZZA 2CESA 1J0ZA 2GJRA 4DI9A 1AW1A 2D69A 4MKSA 3WBAA 4Q4MA 3KTCA 4DF1A 1K6WA 3T81A 5D9PA 4YVPA 5EFDA 2GJXB 1H49A 2D3NA 4KEVA 1TSIA 3UJEA 1V0LA 1BYDA 4JCLA 4Q8MA 4KCUA 2HPMA 4LUSB 4F2BA 4JTRA 4WDWA 4HU4A 3FX4A 3PB2A 3R7MA 1EXPA 3GLCA 4Z2GA 3OGSA 3UGVA 1NOFA 2CNCA 1OX4B 5I02A 4XBSA 3LMZA 1DTUA 1XBVA 1MO0A 5DFAA 3KE0A 1R2TA 2G95A 3O05A 1P0EA 3V5CA 1HW6A 5AHMA 5D38A 2J8TA 3P8IA 3W01A 1XCWA 1MYRA 2E4TA 1BKSA 2X40A 2W79A 1SJCA 2RJHA 3WH8A 1J5SA 1PYMA 3EKGA 3SR7A 2EAWA 4HA3A 4WVXA 3ITOA 3ZJ6A 3UG3A 3FVMA 5I5RA 1T41A 2NXIA 4GACA 2QV5A 2J62A 2R14A 4YNGA 2C0HA 3KHJA 4CQ8A 3G3DA 4QAWA 1KFJA 3EMQA 3WL0A 1A49A 3SCNA 4K68A 4PUKA 5FEWA 1E9LA 4QLKA 5FJTA 3KBVA 4AQLA 4M56A 4IGSA 4XQ6A 3PPHA 1E1CA 1H7XA 2NLIA 4L65A 1P7TA 1TTIA 1GYNA 1UMYA 2QMKA 1OYCA 2CHRA 1HTIA 3IAPA 1U5JA 3RX4A 4J7RA 4V2XA 4MGGA 5C7HA 5JH2A 1X39A 1W9VA 4XZNX 3CZ8A 4KFPA 1ZJHA 3B8IA 3E02A 1EA9C 3ECQA 1H7WA 1X97A 4P8UA 2QDGA 3R43A 3GZAA 4YLWA 2HE5A 2QAFA 2XPKA 1YX1A 3CUZA 3M4HA 4YVVA 4M19A 2PWHA 3ITXA 2XWEA 3CAKA 4AIUA 4HPHA 5TF0A 1ZY9A 1UWAA 3MI6A 4GLEA 1JF5A 3AWOA 4QITA 5DY3A 1OK6A 4C6FA 4XKMA 3NSNA 1W9PA 3PANA 3MVIA 3QHMA 4ZSUA 3GXIA 4H04A 3DHDA 3VM7A 3G0UA 2Z2BA 4UQDA 3L0KA 2DH3A 2WKGA 3MSDA 3REQB 1Q63A 1GHSA 1M65A 3E0WA 3TONA 4LNCA 2QUVA 3R10A 1CYGA 3MI3A 2EGZA 1EQPA 1S2TA 2Y70A 5A94A