1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
2X16A 4MKNA 1GPWA 2Y61A 3GIYA 3JRKA 4L4MA 2YGYA 3W72A 1XBYA 2H3DA 1D3HA 3TJLA 3W71A 2OZ0A 4FNTA 4ZQPA 3HPZA 1PIIA 3NQMA 3C61A 2DZWA 2ZZ7A 3LHYA 3W7NA 2Y89A 4Z1BA 1W56A 4IPJA 3SECA 1PE1A 5EY5A 3PR2A 3L5MA 5LNUA 1LOLA 5FF4A 4DBEA 3OEXA 5TQLA 2EF9A 3W1QA 4GE8A 1VQTA 3MYPA 4M6VA 4AF0A 3R8RA 1RZMA 3GXNA 5KZEA 1H62A 1N55A 5I3HA 1K7FA 3MHFA 3KOFA 4XBSA 3TAOA 3TSMA 1FY6A 3KXQA 4IGHA 1JCJA 1EP2A 5LHEA 3GR7A 4BF9A 2V5BA 5KINA 3STFA 1AG1O 3HPXA 1L2UA 3QM3A 3LI1A 1CI1A 2VFEA 1NF0A 4MYAA 5FESA 1L9WA 2E6YA 4UR7A 3GNNA 3THQA 2ZZ6A 2PRLA 4GUIA 5DLCA 1FUYA 4AVFA 1VCVA 3DFQA 3GK0A 1KLYA 2V2HA 5BMXA 1N7KA 3LCHA 3OBKA 4H4IA 2BLEA 4RZ5A 3NPVA 3LV6A 4LY8A 2RDTA 3D0CA 5BRBA 5E0KA 4OGZA 3VNDA 2PURA 2GQ9A 3FLUA 3FA5A 2V2CA 5K9DA 3M7WA 3LRKA 1KM6A 4GFSA 4N9DA 2PCQA 3DKLA 3KRZA 2TMDA 3SFKA 1K8XA 3EB2A 1O60A 2WKJA 1P5BA 1OK6A 3LCLA 4UIOA 1SPQA 4Z0SA 4AH7A 3S8HA 4TIMA 1XL9A 3C52A 4CQAA 1FDZA 3W87A 3DFPA 3QRHA 1ZENA 4EF9A 3BVJA 2ZRUA 3W2JA 3W75A 1GVRA 2HMCA 1ZJIA 1JUBA 1GZGA 3HQ1A 4N6FA 3W2LA 1I2NA 4O50A 2ZDRA 1YTKA 4O15A 1OYAA 1LM1A 1RVGA 4IUOA 2YXGA 3M47A 5HUPA 2V2DA 2E6DA 1W3IA 2QUVA 3RK8A 5EL1A 4GNJA 1SZGA 2VOMA 5KSWA 4MJMA 2DZUA 3NL5A 5G1YA 4GRSA 3N9RA 4K37A 3E96A 1LTDA 5KITA 3NXFA 2NZLA 3P67A 2FPYA 8TIMA 2WSYA 3BG9A 2G95A 3UWUA 1MO0A 1F76A 2X1TA 4S2CA 3L0NA 1I8JA 3A9IA 4BWLC 5DBUA 1Z41A 2A2IA 1OVDA 3TK7A 1ME9A 3Q58A 4EIVA 1U83A 4JTGA 1H51A 4QM1A 1KFKA 3W2NA 1LLZA 1XFBA 5F2IA 4QJ1A 1XDLA 3ABRA 4EWND 2ZTKA 2WJZA 3LCGA 2ZTJA 3NQFA 5LSMA 1W37A 3TFCA 4LC8A 4IJBA 2TPSA 1DOSA 5K9CA 1O94A 3C2VA 4PCFA 4O53A 4K7YA 4Z0JA 4TU1A 1DHPA 3S5OA 3EKLA 4IQLA 3HG3A 2GVGA 1HO4A 3BGJA 3ZWTA 3UWWA 1A50A 3FIGA 3S9YA 3W7MA 5HWMA 3NL3A 1OFOA 1JCXA 3EEGA 5CPNA 2NV1A 3PC0A 1IF2A 3G18A 4LRTA 5C2XA 3NQAA 3TE9A 3LV5A 4KWWA 3MW7A 1QCWA 3W76A 3W74A 3UYCA 3G22A 2QCHA 5AHEA 2PRHA 4A21A 4DO6A 1QOQA 4MZ8A 3THAA 5LNSA 1TPB1 4NX5A 4RR4A 1VCGA 2I9EA 3B04A 2V0TA 3CT7A 1YPFA 3ABQA 3TSDA 5DCEA 3C2EA 3TMQA 1K7XA 2NV2A 2RDWA 3OIXA 4LVFA 5IBXA 3GNDA 4WUIA 3JS3A 1CW2A 2BZNA 1NFBA 1W3TA 1JJKA 2WSRA 4LVBA 3SGUA 4JTIA 2HTMA 3QC3A 1OF8A 2EPHA 4M5PA 4O0KA 1G4EA 3SJ3A 2X30A 2H6RA 5HINA 1XKYA 3LBMA 2X1SA 4WOZA 3W1PA 2CLEA 2FPVA 1B4EA 3TROA 2ZA3A 3INPA 2C0AA 2I14A 1OX6A 4LRSA 2G97A 3NNTA 3H55A 4JTSA 3N14A 3BV4A 4MJZA 3N2MA 1BEUA 5G4EA 3W7CA 1QPQA 4GUFA 5DXXA 3SI9A 3BO9A 5F2GA 4U28A 2JGYA 1WDWA 3C2RA 3EX4A 3I7QA 5D04C 4ADTA 4FIQA 1FDJA 1RQBA 3BGGA 2C14A 3P5YA 4BI7A 4UTIA 3FKRA 3EWUA 3U6WA 3NVTA 3G0UA 3MHGA 3PBWA 1VJIA 1GVQA 3UWVA 5HULA 2R8WA 3QF0A 1HUVA 2F7FA 2DORA 2GVJA 3STEA 3MJYA 1DL3A 3W7JA 5DY3A 4MOZA 4NNBA 3FKKA 1VHCA 3KRUA 2C3ZA 3KVJA 1O5XA 2QDGA 5CZTA 4LV4A 3TXVA 3HMJG 5CG7A 2A85A 4HIBA 1E51A 2CZDA 1TB3A 3TR2A 1A5BA 4JTKA 3C0JA 2WPBA 2NX1A 1SW7A 1LBLA 3MI3A 3S1XA 1SZNA 2ISVA 3AJXA 3M5XA 1A5AA 2EHHA 3PY2A 2HSAA 2VELA 1XUUA 4LS2A 2J6XA 5BMWA 3L2IA 1K8YA 1QR7A 3IGUA 3TH6A 3EWZA 2VEKA 1I2PA 3TSBA 2ZQ0A 3TDFA 4OE7A 1UCWA 4AWSA 1IGSA 1KV8A 1I2OA 4ZQOA 1EP3A 3MO7A 3TC6A 3W1UA 4TX9A 4FNQA 4XUGA 1T96A 1UUMA 3PSWA 1W8SA 1GG1A 3LERA 4L4LA 2Z6IA 3F1QA 1B4KA 5AYZA 4O14A 1I2RA 2A6LA 3PF3A 4XBKA 1KM2A 3WFAA 3G3DA 4LS0A 4FNUA 4AXKA 4YLWA 4NXSA 5LGZA 1UB3A 1XI3A 2ZFAA 3G8EA 5CPOA 5KMYA 1VYSX 4K8EA 3WJYA 3P5ZA 1G69A 5TIMA 1AK5A 4POCA 3W07A 3ELFA 3W7DA 2ZZ5A 4QQ3A 2I1OA 3T4CA 3KVKA 1YDOA 5AOUA 3I68A 2ALDA 1TTIA 5HR6A 3GLCA 3PWAA 3LHTA 3LCIA 1EWDA 1B3OA 1H5YA 1GOXA 2O7QA 1K7EA 1PVNA 1GVFA 3W85A 1W5PA 3NL6A 4UCGA 3TV8A 3FS2A 5FF2A 3P62A 3WJZA 1OFBA 3ZS4A 2NWRA 4NNAA 3G1SA 3KVMA 4CCEA 4O18A 4AHOA 4YWIA 4ADUA 4IWWA 4ML9A 3VI2A 2QR6A 2QDHA 1DQXA 2VFHA 4LVDA 2W6RA 3IV3A 4JNMA 1G7UA 2OT0A 4HSOA 3P61A 5CSSA 3L65A 4E2BA 1C9DA 3LCFA 3NOEA 1JQVA 3C3NA 3NQ2A 3RU6A 2E5BA 3TCEA 3G1DA 3B0VC 1A5CA 4HPJA 4UFIA 3MYOA 3EKZA 4G1KA 1VLIA 5J5DA 2A21A 3GAKA 4JS3A 2DP3A 3IVTA 3IGSA 2ABBA 3QMSA 3HG4A 1MEHA 2CLMA 5G5IA 3H54A 2F84A 3EXRA 2C6QA 4FNPA 1JCMP 2HS8A 4O52A 1W54A 1ICSA 3QMRA 4K39A 1UUOA 1LZOA 3Q2DA 1T99A 4YCOA 1IIHA 1IXPA 3PM6A 2G5WA 3TC7A 3OG3A 1ADOA 2OMAA 3ZR4A 4Y96A 4MY1A 3MBFA 4MY9A 2FTPA 5AHLA 1ICQA 3W3OA 3A5VA 1F7BA 3W73A 1WX0A 4FX6M 3N3MA 1UJPA 3DFTA 3ABSA 3NAVA 2JK2A 4E2DA 1EUNA 2Y62A 1QO5A 3N19B 4NJHA 1H7NA 1YPIA 2V8ZA 3LX9A 3MMTA 3STCA 1BTMA 1FWRA 4O8RA 2E09A 3LTSA 1JCLA 3NGJA 1ONRA 4HKPA 1M6JA 4WX2A 2QKFA 4JX5A 1VZWA 3S1WA 4EF8A 5BOOA 4UTWC 4UTJA 1HFBA 5F4XA 3IIPA 3B0PA 4O19A 4TO8A 3N73A 2JKPA 1H60A 1SW0A 4MFDA 5FI8A 1LRNA 2J27A 5D03A 1ZFJA 5CZSA 3QFEA 5A5WA 5LNVA 2ZRYA 3UXDA 5AYYA 1YXCA 2YW4A 3SSJA 1TQXA 4I9AA 4ADSA 4HNNA 4RZ4A 2A7NA 3ABOA 3O15A 3LHUA 4N9EA 3ATZA 4M7SA 3LBCA 1DORA 1LRTA 2FLIA 5AN7A 3IIXA 2A7RA 1W3NA 3E0IA 3A24A 1JCNA 1M7PA 2V81A 3GR8A 1JUEA 1QFEA 1KFJA 4GXMA 5G2IA 3CQ0A 3N34A 3NR0A 4K38A 2RKXA 1X8FA 3L21A 1TPVA 3DXIA 2QJHA 4HT3A 1Q6QA 4EOUA 5C55A 2Y88A 1VCFA 4M6PA 5HMSA 4E0CA 1BWKA 3DFSA 3M16A 1OFEA 3NQGA 3R13A 1Y0EA 5D2TA 4FXSA 2FPTA 3GDKA 1YLVA 2VENA 3NPWA 4BI6A 2B7PA 3LHZA 1H50A 3RMJA 4CNNA 3W7QA 4ONVA 3PB2A 3LM7A 1H61A 1GT8A 3OHIA 1F05A 1EP1A 4ORMA 1TTJA 4LTSA 2E6AA 2GJNA 5MHBA 3G1HA 2NX9A 1XC4A 4NXKA 3QEZA 2B7OA 1RQEA 3RNDA 4YXGA 4LOCA 4GJ1A 3UWZA 3C2FA 1FQ0A 3C56A 1OJXA 3NZRA 3W7LA 4FF7A 3DHFA 1SFJA 3TXZA 2VFDA 5KZDA 3CEUA 3HGOA 1S5WA 4K8HA 3UXAA 3WK3A 1P0KA 3QZEA 4JD4A 3UZ5A 3W7RA 2Y7DA 2Y85A 1GTHA 3SY5A 4XKYA 1FCVA 2QEZA 2XFWA 3M9YA 3B06A 5LZLA 2GVLA 4AF0B 3T7VA 3R5EA 3GYEA 4PFMA 3BLIA 1KM1A 3GDMA 3Q94A 5AFDA 3DH7A 1P1XA 4HPXA 1FWTA 1JCYA 3S0CA 1H7RA 3W88A 3L5AA 5CZJA 1KBIA 2W79A 3CWOX 3P8JA 1QMLA 3I65A 3TAKA 4QITA 1VYRA 2CLIA 4PA8A 3DZ1A 4RJEA 2ATSA 5FEXA 1R2TA 3GX9A 1SW3A 2R94A 2NUYA 5ABTA 4KKXA 4X2RA 4WY0F 5DELA 3E12A 1Z44A 1FBAA 1GYLA 2E5CA 3KVLA 4JYEA 2XN1A 3T40A 3IVSA 4UTMA 3W1TA 4HNTA 3O16A 4ZMGA 2VFIA 1EWEA 1K02A 3NQ6A 4RV8A 2ZBTA 4WXZA 1WXJA 3W7IA 3GKFA 1AW5A 3T55A 1RD5A 5D2VA 2H3BA 3QQ0A 1QPRA 1OABA 4IXXA 1D9EA 3AO0A 1ZAIA 3KFTA 3F4WA 4I7VA 5BW6A 4AWUA 4KWVA 1J2WA 3B0UX 2A7PA 3WJWA 4OV9A 4UC5A 3T78A 4OBTA 1JR1A 1W31A 4R34A 1KA9F 3I7RA 2ZCGA 3S5NA 2B7QA 4ZVJA 4O28A 1ML1A 1W5OA 3UPWA 3A5FA 2CZEA 1XDMA 1IXOA 3DI0A 4NJJA 2DZTA 4U4MA 5EKYA 4ZQMA 3DHDA 4MY8A 5E93A 4Z08A 4AHQA 3FJ6A 4RZ6A 2YYTA 1OYBA 3W84A 1JRBA 2J9XA 3G1XA 3L9CA 3L67A 1H7OA 2VFGA 3F03K 4A3UA 1WQ5A 4H3DA 2TRSA 5IBXC 2KZHA 2CZ5A 4AEOA 1TPWA 1YADA 2QJGA 3G1FA 1RQHA 1QO2A 2A6NA 4MLJA 1WOBA 3DFNA 2GQAA 1TREA 2YZRA 1W5NA 5D2YA 3W2UA 1LBMA 4WD0A 5FF0A 4AAJA 3GDRA 3BW2A 4ORIA 1Q3NA 3PVFA 4Z1CA 3O07A 1L6SA 2EGZA 1XCFA 5FEZA 3CIXA 1GQNA 3MUXA 4MVAA 5LNWA 4ICNA 3EXTA 4Q4KA 3NPXA 1X1ZA 1HL2A 4PC8A 1LYXA 3TQ0A 3FJLA 2ZRZA 3NQCA 3NQDA 4DF0A 1MEIA 1FX6A 4O13A 5C5YA 4O0ZA 4AMAA 5K7JA 4NNCA 3BG5A 3ANYA 5AC6A 1ICPA 4TMBA 3PS7A 4OWGA 2NWSA 1QNVA 1XBVA 4HHPA 1KTCA 1WYIA 4MIMA 1TCDA 5CZ0A 1MZHA 4KFNA 5I3FA 3EX2A 4UTTA 3CPRA 5HR7A 3IVUA 3W7HA 4UMBA 2ZZ1A 3H53A 1TV5A 2WQPA 5DY2A 1IXQA 3EWYA 2E77A 2YW3A 3HG5A 3LCXA 1G4SA 3NG3A 3SR7A 5LGXA 1PV8A 2J9ZA 4H6KA 3W1LA 2Y70A 3W1AA 3EX1A 3L5LA 4LT9A 2BSLA 5F4SA 1ZCOA 3BLEA 2BX7A 1WV2A 5DBTA 1IXNA 3FOKA 3I7SA 3GB6A 1AMKA 5D37A 2AGKA 3M5ZA 3NEVA 3MP5A 2V30A 1H7XA 2C16A 1W5QA 3VE7A 3W22A 1JRCA 1AL7A 2DJLA 2QF7A 3C8FA 3W86A 3B8DA 1QAPA 2VEPA 4UTUA 4MZ1A 4GUJA 1QWGA 4D2JA 3PAJA 1H7WA 1QPOA 4RXGA 1PHWA 2QCDA 1HTIA 4QNWA 1W5MA 4C1LA 2VFFA 2Y7FA 4O54A 1TPC1 1UBSA 3W2KA 1JUKA 2B4GA 1OX4A 4WY0A 4BI5A 3F4NA 2Q8LA 4LS1A 4DO4A 3G1VA 5AB3A 1SO6A 4UUIA 3MI6A 4JX6A 1FCUA 3DFOA 2IQTA 3B05A 5U7SA 3WK2A 4Q32A 3OA3A 4YL2A 1WA3A 1VGAA 1KM3A 3DGRA 1H7PA 1GVOA 1UASA 4UXDA 2R91A 2QAFA 2AQWA 3TIMA 3PBYA 2VEMA 3VE9A 1J4EA 1JULA 3P84A 5K4XA 3G1YA 1YXYA 1EX5A 3P74A 3NQ7A 3BPWA 3QQ1A 2ZYFA 4UFHA 3TNOA 2Y63A 1I45A 3LLDA 4IMCA 3CHVA 2JKEA 2CLLA 1KW1A 3GXPA 3ATYA 1TPH1 3FYPA 2NXHA 4LUIA 3HGRA 4NJKA 1Q45A 2YSWA 4UR8A 1DJQA 1P4CA 4RX0A 3W2MA 4NJGA 1M5WA 5HJLA 1FXPA 4UTHA 3W7EA 6ALDA 5EPDA 2DJXA 3L66A 4JY8A 2CLFA 1T0OA 5D32A 4PEKA 2Z6JA 2C18A 3BLFA 4YMZA 5F2MA 4PTNA 2YFOA 1W1ZA 3TW7A 5G4WA 1YTEA 2C1HA 1SO3A 2J24A 2P10A 4OU1A 1C8VA 1X6UA 2TYSA 4XTIA 1SO4A 3M0ZA 4EVZA 4ZQRA 4IXHA 1ZAJA 1H1ZA 1G6CA 3MWAA 4NU7A 4E38A 4DO5A 1MEWA 3W7GA 1OK4A 4JTHA 5HWJA 3PUEA 3SIZA 3HPSA 3GKAA 2V82A 4KFPA 4IX0A 2FB2A 4JR5A 3VFLA 2W0UA 2ZRVA 4JIQA 1VR6A 5D38A 3IGXA 4BFAA 3M5VA 4RXFA 3UWYA 1K03A 4WOQA 3P60A 1GVSA 1VRDA 3FFSA 5FEPA 3W23A 3IEBA 2FDSA 1H1YA 4WJEA 2HS6A 2B0MA 1OFAA 1R2SA 1WBJA 1HG3A 5D30A 1YTDA 5AHMA 3A23A 1I2QA 1TO3A 1TPFA 5I3GA 4RLIA 1ME8A 4GUGA 5G2WA 2EAWA 1B57A 3NL2A 1S5VA 4LNYA 5K9XA 3M41A 4RKAA 1EPXA 4ZL1A 3DENA 5I3IA 3S5YA 6TIMA 4HSNA 3GDTA 3HF3A 4A22A 1Q6LA 2DZPA 2FQIA 5D2WA 2CFFA 1YDVA 3UWQA 3CB8A 5BNKA 1EUAA 5LKYA 1C29A 3DI1A 3USBA 1WOAA 2YFNA 3TQKA 4OQVA 3O8AA 3BG3A 4C1KA 3CWNA 4XZ9A 1MXSA 2QUTA 5I3KA 1FDYA 4DF2A 1NF7A 2DZSA 5L6UA 4DEFA 1EB3A 1HO1A 3G24A 1KM4A 3L0KA 4LWWA 4O4WA 1B9BA 4N4QA 4FHAA 1OG0A 4LU0A 5AC8A 3O63A 3GAYA 1NEYA 4UTKA 3LDVA 1OHLA 1A5SA 3WJSA 1CX9A 2OX1A 3HBLA 1SR9A 3S1UA 4NJIA 2XN0A 4JTLA 4M7TA 4HNVA 1DV7A 3OVPA 3QPZA 4JX4A 4O4VA 3TJXA 1TTQA 4N4PA 3PSVA 1ZALA 2NX3A 3W7KA 4FEZA 4LV9A 5E1QA 5T26A 5D2XA 2ZRXA 3TUUA 1LRQA 4N02A 1KV5A 2OCZA 5KZMA 4DQWA 1R46A 2RHGA 4NUWA 2Y7GA 5SWUA 3UZJA 5H2ZA 5F2LA 2QCLA 2BTMA 1QDSA 4NZFA 2GPTA 3M1ZA 3CU2A 1G7VA 5DN1A 1OFRA 3CM4A 5C54A 1TRDA 3KX6A 3CTLA 5HUOA 2NUWA 4FXRA 3HB9A 2GJLA 4PL1A 4O1DA 4IMEA 4O17A 3DAQA 3C6CA 1A53A 3BARA 3GDLA 1KTNA 1J5TA 4CQ8A 4LUJA 3PULA 1R30A 2NXIA 4UTLA 2WNNA 3QSRA 3UY7A 3P80A 5CPLA 4DPPA 1TPDA 2TSYA 5C6MA 2E5DA 3NZ1A 3SW6A 3STGA 1K3UA 1LOSA 3NPUA 4UNKA 1AL8A 3GVGA 4BR1A 1LBFA 3O6DA 1WAUA 4UFKA 1G67A 4AB4A 2V5LA 3G0XA 2ISWA 2QCNA 3U8GA 2A5HA 3B4UA 1S3HA 1DKWA 3PBUA 5EA9A 5LNRA 4AHPA 5CSRA 2QUUA 4MPQA 1GEQA 1F73A 1G4PA 2A4AA 3M5YA 3NA8A 1TIMA 1OFQA 4WXYA 3P8IA 4CNPA 1JVNA 2Y6ZA 2J88A 3G0SA 2OJPA 4JN6A 4TMCA 2WOQA 2H8XA 2C13A 4Y9AA 3UPBA 2UV8G 4CCCA 4O12A 4Q33A 1TJRA 1Z48A 3K30A 5KTLA 5D02A 3LOTA 1DJNA 4O1CA 3O6YX 3W1NA 2ZZ2A 1FCBA 1VPXA 3R89A 4OT7A 1FWNA 3CEPA 3RFAA 2WV8A 1TV7A 1SO5A 4FIRA 3QH2A 5EBUA 4ALDA 5L9FA 4O1BA 1KFEA 2R14A 3GZ3A 1LORA 2PC4A 1OFDA 1YXDA 3N2XA 2Z1BA 3G1AA 3LXCA 4BWLA 4CQ9A 4XTDA 2C19A 5CKSA 2ZRWA 5H91A 1QOPA 3C4UA 1EIXA 4Z1DA 2O7SA 4B5NA 4Y8FA 2GOUA 2C15A 2VEIA 5D33A 3PUOA 3TKFA 4K36A 3E9AA 1RR2A 2A0NA 2J9YA 1RV8A 3EWXA 1DQWA 2YCEA 1FXQA 1BWLA 2X1UA 3W1MA 2CLOA 3Q37A 1AW1A 4FO4A 1N8FA 3NDOA 3CLMA 3E49A 4XKYB 3JR2A 4Y90A 5G1TA 1TRIA 4GC4A 5A8GA 3UQNA 2GUUA 5AHIA 5G2HA 3V75A 4JIPA 1K8ZA 1KFCA 1U5JA 1O4UA 1VC4A 1KTBA 3U2OA 1FWWA 1SFLA 3DU0A 3HGJA 4UFLA 1LOQA 2JGQA 5HNRA 3M6YA 1KBJA 3QMTA 2FIQA 3R2GA 4M19A 4UMCA 2Z0IA 3LCWA 3ZFHA 2JKAA 2CU0A 2JBMA 2ZZ3A 3HO8A 4A2SA 3PBVA 1O5KA 1TSIA 4ZQNA 2D73A 3QJAA 4PODA 3RF9A 3MP4A 1FCQA 1ZHAA 4GBUA 5F4WA 1KLZA 2DZVA 1PL9A 4MFEA 4QNEA 3P82A 3P7YA 4HN4A 4WQ6A 1F6KA 5AHFA 1KFBA 5F1VA 4QAIA 1PS9A 4DF1A 3TMLA 4JY9A 2QCFA 4O11A 3LGEA 4P2VA 3NM1A 3SGZA 3IIVA 1TQJA 3EWWA 3TFXA 1R2RA 2YDAA 4MZYA 4IMGA 1THFD 3FYOA 1VLWA 2WO5A 4GUHA 4GWEA 3LLFA 1OF6A 1L6YA 1Z42A 3V1PA 3C2OA 1OFPA 3L68A 2Q3OA 4X9SA 2CLHA 1XM3A 1RPXA 1X7FA 4JYFA 1SSDA 1KM0A 4IPIA 2CLKA 2CW6A 5CGQA 4RCXA 4K7VA 4PH6A 5IM51 2YPIA 1TTPA 2YYUA 3L0GA 4OV4A 1LCOA 1SUXA 4JTFA 4NX0A 1V5XA 3MBDA 2Q8ZA 2X1RA 3E02A 3IRDA 4FNSA 3EXSA 2YX0A 2ZA1A 4JTEA 1M7OA 3N9SA 2WNQA 3T44A 4IMDA 2QCGA 4CLMA 3HG2A 1X1OA 2V9DA 4JTJA 1JQXA 3EX6A 1GJPA 4O10A 4O16A 3LRLA 3RLUA 4X3ZA 3LXBA 3NO5A 4A2RA 3M43A 1MSSA 4UTTC 4NQ1A 3W9ZA 3G8RA 4RK8A 4UNLA 4FNRA 3TU9A 1ALDA 4XQ6A 3S42A 4QIUA 2GQ8A 1VHNA 1F74A 3NQVA 4IMFA 4S2BA 1VS1A 2P0OA 1O95A 4NT0A 3RLVA 3O1NA 4QSHA 4X22A 1F2JA 1TPEA 1GWJA 4DELA 2AAMA 2H8ZA 4JGDA 4YCPA 3DKJA 4DPQA 1H63A 3PG8A 1PHQA 4M6QA 3LB0A 1SQ7A 1V7YA 3VKJA 3W7PA 3QYQA 2RH9A 1ZY9A 3UNDA 3FEMA 3MI2A 2Y7EA 4JXCA 5HQEA 3W70A 3NYZA 2LLEA 2ZA2A 4N6EA 1LDCA 4MLRA 1VYPX 1SSGA 1ZAHA 1KFLA 5GVJA 1F5ZA 4Z1AA 3KRSA 2H90A 3LRMA 3QSTA 2CWNA 1XBXA 3OVQA 2ABAA 4KFOA 3CIWA 1F6PA 1DBTA 3P81A 1SZFA 5DCDA 2QCMA 3LTYA 4P61A 3B03A 5EMUA 3TQVA 1SZEA 3PG9A 1S5TA 3WK0A 5D05A 4BK9A 3NQ8A 4FX7A 3S6DA 4UMAA 2OT1A 1P0NA 2QCEA 1GG0A 3UD6A 4ZQCA 4N2YA 1XBZA 3A22A 4JTTA 3S1VA 4WZHA 4XWUA 4S1FA 4JTUA 1EEPA 1GTEA 1WBHA 1QPNA 2P1FA 3OVRA 1TV8A 2Q3RA 1PCKA 3QW3A 5DXYA 1LROA 3WK1A 5TBOA 3VCRA 2E6FA 2PE4A 3NQEA 4O1AA 1L6WA 5FEWA 2ATMA 4ZZ9A 3O05A 3KAOA 2PRMA 3BW4A 4NZJA 3QPYA 3GXTA 4JICA 5FF3A 4FX8A 3O06A 4LVAA 1LLWA 1TYGA 2B7NA 4NVTA 3SZ8A 4UFMA 2QCCA 1TJPA 5LHFA 2QCDB 5AYXA 1XXXA 2NLIA 3A21A 2E68A 3KHJA 3QW4B 3I6RA 4TR9A 4JEQA 2QAPA 4N9BA 3HIJA 1R47A 1OX4B 4WY0B 3O6CA 3TA6A 3HGSA 1DVJA 5K3VA 5AC7A 2DZXA 1ZNNA 3BW3A 4R7JA 1Q6OA 3W83A 1FWSA 4HNUA 2ISSA 1SU5A 4FB7A 4I7UA 3LI0A 2RDUA 3BK0A 3MHUA 4PL2A 1VH7A 1G4TA 3LHWA 1PCWA 3HJZA 2WSQA 5HWNA 3W6YA 2VXNA 2YR1A 3W1XA 5CPMA 1NVMA 4K6AA 4LVGA 4OHQA 3ZWSA 4N9CA 4IX2A 3M44A 3PB0A 4JDYA 5F1UA 2VKZG 4J9JA 3W7OA 2VC6A 2FB3A 4O57A 3MP3A 4I7WA 2DU2A 3IIZA 5U4NA 3TX9A 2XN2A 5K4ZA 1TPUA 4CNOA 4LC6A 4JDBA 2G96A 7TIMA 4LW7A 4UFJA 5I3JA 1LP6A 2FJKA 5J5RA 2ZZ4A 4MUZA 3CC1A 4CCDA 3W1RA 4JYDA 4DXVA 1BKSA 4QISA 2RFGA 1TMHA 4W9TA 5FF7A 3YPIA 3LHVA 1I4NA 3WJXA 3IIOA 3EX3A 4DBDA 1YDNA 3LXAA 1XUZA 5K2ZA 2CZFA 3DBPA 1IIGA 1AW2A 1KM5A 3HOJA 5EYWA 1YYAA 1ME7A 1GYNA 1EA0A 1NSJA 1NAL1 5DCBA 2NUXA 4IOTA 3R12A 2NXGA 5AHNA 2FFCA 3LTPA 4R53A 3UY8A 3G3MA 2WNZA 2Z2UA 3S5ZA 3TW6A 2QJIA 2BXVA 1D3GA 2A1YA 4A29A 4UTWA 3PUDA 4R33A 1W0MA 3EWBX 4AWTA 2X2GA 2E1DA 1Q6RA 1OX5A 4Y6GA 2BWGA 4MYXA 2EKCA 1OYCA 5D09A 3NM3A 1T8XA
chains in the Genus database with same CATH superfamily
5FD0A 2BS9A 4CN4A 4MKNA 1UC4A 2Z4GA 1GPWA 5HNNA 5FL0A 1KCKA 4H9YA 3V35A 3NYDA 4C6EA 4FNTA 3I4KA 2D2JA 2DZWA 1C8YA 2FMOA 2A3AA 4Q6JA 1AZ1A 4IPJA 4OBRA 1VENA 2WCSA 1AH3A 1BKHA 2OOGA 3B97A 1XG4A 3W1QA 1V93A 4ZOBA 3MZNA 2Z2BA 4ZBCA 1N55A 4CCZA 4K3ZA 5I3HA 1K7FA 1LLOA 3FSUA 1GPFA 2J8TA 4S3JA 3KXQA 4BF9A 2V5BA 1ISYA 2R1MA 3LPFA 3LI1A 3CZ8A 1CI1A 5FESA 2D69A 2Q8XA 2ZICA 3GNNA 3THQA 1CGTA 3VX0A 1AMYA 3G77A 2O9OA 4MWAA 3DFQA 3EBVA 4LYQA 4KEMA 4JNZA 3LCHA 4CD7A 1F4HA 2BY0A 4A4AA 4LY8A 1L2QA 1E1CA 1ISXA 1CECA 4ZB0A 1IWPA 2PURA 2VGBA 2R1LA 1KM6A 3GVWA 4GFSA 1H1NA 1K8XA 3EB2A 1BWVA 1O60A 5FJIA 3BTNA 1OZMA 4UIOA 4ACYA 4AH7A 2QMKA 4WVXA 3MS8A 7TAAA 4CQAA 3QRHA 3W2JA 5A8MA 1JUBA 1UD6A 3DESA 3PPFA 4Q8PA 5HJXA 3KOYA 1R3RA 4O50A 2ZDRA 1OYAA 1RVGA 2YXGA 2V2DA 2E6DA 3RN6A 3RK8A 3GFYA 5EL1A 4GNJA 2ACUA 1Q2RA 2G8ZA 4MJMA 4H6RA 2WC4A 1IE7C 3QKZA 5G1YA 4GRSA 4REQA 4K37A 5CC5A 1NP2A 2NZLA 4B16A 1GQJA 2FPYA 2PTXA 3B0YA 3BG9A 1MO0A 3CK5A 4QRNA 2HDJA 4S2CA 2E25A 1I8JA 5REQA 1XLGA 5DBUA 2WYSA 5I07A 2CBUA 1OVDA 5HPOA 4EIVA 2CKSA 1FH7A 4JTGA 1H51A 2V63A 3LNPA 3TP4A 4DVOA 5F2IA 4S3GA 3VKCA 3I10A 4EWND 3GYCA 2PU0A 2WJZA 5C71A 4JL2A 1W37A 2WJEA 3B8WA 2WM1A 4J3VA 1MQPA 2XUCA 5J04A 4ZOAA 1PAMA 4XZLX 1VJSA 1UWUA 2XFRA 3QZAA 2GVGA 1HO4A 3BGJA 3R8GA 1A50A 3FIGA 4E8CA 4I3GA 4DJFA 3LSCA 4XSLA 2VNCA 1OFOA 3DEQA 4CU6A 2GGIA 2DIEA 2XVLA 1IF2A 1FWFC 2HRWA 3NQAA 3TE9A 3B4YA 3E2RA 5B80A 3MW7A 3W76A 1OSEA 2Y5SA 4U5KA 5BRQA 3U7BA 3G22A 2BMBA 2VRKA 3MUY1 1IR2A 4GBDA 3E0FA 4AZHA 4F2TA 2PTDA 4RR4A 1HW6A 3B04A 1ONXA 1QW8A 4UBPC 1U22A 1WDQA 2XJ7A 4JN8A 4ZE4A 1EDTA 3ARPA 2YCIX 4TXEA 1CGWA 4XZHA 4YJ5A 1JJKA 1JXJA 4LVBA 3SGUA 1JZ3A 3CASA 2WZMA 2R1NA 3EDDA 1EBHA 1NJJA 1G4EA 4E8GA 3SJ3A 4UQBA 1SR0A 5HINA 3VA8A 1XKYA 1GOIA 4ZO6A 2WVTA 3CZEA 1ODUA 3DBNA 1KBLA 2CLEA 1B4EA 3INPA 1Q7ZA 2ZXAA 1OX6A 1PTAA 2ZUVA 4JTDA 3WNOA 3H55A 1QI2A 1KWKA 2OU4A 1WNOA 1MMFA 4JFSA 3SI9A 5GJNA 1FWCC 4U28A 1WKYA 4KBXA 2JGYA 1WDWA 3VIJA 3EX4A 1F4AA 4FIQA 4PMUA 2HZGA 3BGGA 3MDUA 2C14A 1BYCA 3VIHA 1RLCL 4WKFA 1NFPA 3PBWA 1IZCA 3APTA 2F7FA 2GVJA 1P7TB 1V3IA 3CQHA 1RJQA 1O1HA 3KDNA 3W7JA 4MNLA 4LCSA 3ZOAA 3N17A 3KVJA 4HCHA 1K9EA 2QDGA 4H8VA 3HMJG 2J79A 4HIBA 2CZDA 3LPOA 3DUGA 3L4ZA 3CYVA 4Q6XA 3C0JA 1SW7A 1E5NA 3C0QA 1SZNA 1I1WA 3PY2A 1AJ2A 4LS2A 5BMWA 1QR7A 1XGDA 3FSTA 3PNUA 1TWDA 2O56A 3VCCA 1A49A 4OE7A 1XLIA 4AWSA 1IGSA 1RVKA 4DZHA 1H41A 1W2VA 3ZVIA 3T0DA 3CMFA 1FWEC 5D9OA 3BICA 1OT2A 4XUGA 1UUMA 3LERA 3CYJA 3F1QA 2PGFA 4O14A 3UG8A 2A6LA 4E4FA 4AXKA 1HGYA 1TKKA 3W37A 5LGZA 1UB3A 4I6KA 3VVGA 1VYSX 3GNOA 4U2ZA 1WB0A 1RSCA 1OD0A 4AD0A 3W7DA 2A79A 4QQ3A 1K8CA 3IK2A 2F61A 1AZ2A 5HR6A 4F0HA 5FJJA 4ASTA 3BDKA 3LCIA 2VZSA 1EKOA 1H5YA 1OY0A 2O7QA 4B9YA 1KXTA 3VOCA 1K7EA 3WN6A 3TV8A 3IAPA 3FS2A 2WB5A 3DHPA 1X38A 4JKKA 4EPBC 4Y9MA 2O55A 4RDZA 3EPOA 3KVMA 4JBRA 2QR6A 3NOYA 4DWSC 4E2OA 2W6RA 3IV3A 4JNMA 4LH8A 1ISVA 2OT0A 4AEEA 1PBGA 3U2EA 4CVUA 3L65A 1C9DA 2G3FA 1UH3A 2W67A 1R3WA 4HPJA 4JFTA 3H2CA 4EK7A 4B9ZA 3L4WA 4JS3A 4WGHA 3IGSA 1OIMA 4G7EB 3L23A 2ABBA 1MEHA 4Q8QA 2F84A 1V3MA 3FGCB 1HVXA 6CGTA 2OGYA 4GLEA 3Q2DA 3ARVA 2VCBA 2SFPA 1IXPA 1UW9A 2FKPA 3WQGA 1BYBA 2VVSA 1ITUA 3E5PA 1P0BA 3VMOA 3MBFA 2J77A 5AHLA 5I7GA 1ICQA 4LY4A 3A5VA 3RR1A 4LUYA 1XICA 1WX0A 3PZVA 4FX6M 3VILA 3GC4A 2Y62A 3B8SA 5MKGB 8A3HA 1BPLB 4O8RA 2O9PA 4GZ7A 1GVEA 2YL8A 1M6JA 4WX2A 4IGNA 4M24A 1P0DA 4UTWC 4Q7BA 1Q6EA 4QE4A 1TMQA 4TO8A 3N73A 1H60A 1SW0A 3BSMA 5FI8A 5D03A 1ZFJA 3QFEA 4S39A 5A5WA 2ZRYA 3HQNA 3N15A 1YXCA 3GXFA 1JD9A 3CUXA 1J01A 1NDVA 3O15A 2EJAA 4M7SA 3EMZA 4GC3A 1GJUA 2FLIA 5AZ0A 3HPFA 4KIEA 1IEIA 2YDRA 2A7RA 1W3NA 3E0IA 4H19A 1MYRA 3A24A 3NUKA 5BROA 4YU1A 1JDFA 2HK0A 1J96A 4AZ5A 1JI1A 3N34A 3V36A 2OXNA 3WUBA 3QQWA 3ZR5A 1BXCA 3DXIA 1MRQA 3PBGA 1B3VA 2I57A 5HMSA 3AWOA 1T40A 3MSGA 1RPKA 3DFSA 3MCMA 3ZVHB 1Y0EA 5D2TA 5MF5A 3UNTA 1FWAC 3GDKA 4UQDA 1YLVA 3NPWA 1A5MC 3L7RA 3WENA 2B7PA 3VYLA 2CNCA 1UWSA 4PE8A 4L80A 4TV6A 4LYKA 1F05A 4LTSA 1KWGA 2E6AA 2C7FA 4P7RA 2GL5A 3WQVA 4HA1A 1NDZA 7PTDA 3IJIA 3LPPA 2NX9A 4H9ZA 1HKKA 4H9MA 2XSBA 3T2QA 4NXKA 4QP0A 4ZO8A 4GXWA 3W28A 3TLQA 2WKGA 3CPUA 3VNZA 1A47A 3GFXA 1JZ7A 7REQA 3VKKA 3W29A 2J6VA 4AZGA 1QUMA 1XRFA 2W5FA 1G01A 1E9ZB 3HGOA 3CL6A 1UHVA 2DH2A 1GOQA 1DJZA 4LB4A 4XKYA 2QEZA 3BXWA 5LZLA 3T7VA 3R5EA 4PFMA 1KM1A 4QDWA 4AC1X 3AYVA 3VDGA 2O0TA 4HHHA 1VBRA 2PDLA 3N2OA 1R86A 5BRPA 3S2LA 2I5QA 3I65A 4QITA 1ENUA 3GTNA 2PDQA 1ITCA 4F0MA 1R2TA 4MWAB 1SW3A 2R94A 1EH9A 3GH7A 2NUYA 4Q8MA 5AYBA 5ABTA 1HX0A 3RCYA 1I1XA 2EO7A 4AG0A 1QVBA 2EG8A 2X41A 4CN1A 1GYLA 1I9CB 1E1CB 1V02A 3T40A 2QVHA 2VFIA 3RCMA 3W7IA 2NSOA 3G6MA 2BDQA 4HOZA 4HMDA 3WEMA 1D9EA 3AO0A 3ZJKA 4US6A 2XINA 2QPSA 1IHIA 3CV7A 2EG7A 3WLLA 4AWUA 4KWVA 1W1VA 4ICMA 3B0UX 3WX7A 4OBTA 3J7HA 2OSXA 3I7RA 4PTMA 3KL0A 3S5NA 5DT5A 4D8LA 4F4RA 2QULA 3TOPA 1RCOB 5T91A 4HTYA 2CZEA 1IXOA 1KFWA 2JF7A 4U4MA 4REQB 4MY8A 1JF5A 4Z08A 2WWCA 1UD4A 4GPNA 1R85A 4KETA 3M0XA 1ECEA 5REQB 3U4FA 2VFGA 3LS9A 4A3UA 1E6PA 2CPUA 1KRBC 5IBXC 5HMEA 1YADA 2A6NA 4MLJA 1KC7A 1SFTA 3W02A 4AAJA 5BXRA 1WO2A 3BQ6A 3F7JA 3PVFA 3O07A 3DYPA 5IRPA 3VGHA 2DH3A 3UZWA 2WHLA 4MVAA 2F9RA 4H7ZA 3NPXA 4F0KA 3W26A 3GS6A 1MEIA 4NZ3A 1FX6A 4DUVA 3OODA 5C5YA 2ZWZA 3WD1A 2VGFA 4GYPA 3M0YA 2F6XA 4NNCA 4QJ4B 5LXEA 3ANYA 4M6UA 3IJ7A 1JPIA 4DJED 4QDMA 1KXQA 2HEJA 2C71A 3DFYA 2PDGA 4UTTA 1IXQA 3EWYA 3LCXA 3NG3A 1M68A 1V0NA 2FTYA 2Y70A 4XZNX 4PMQA 3BLEA 2BX7A 3FOKA 3GBEA 4Q8OA 2YDSA 4C6FA 1GYMA 5D37A 2AGKA 3AS1A 3NEVA 3ANVA 2C16A 3JVAA 3SCQA 1B5TA 3DGBA 1JRCA 1AL7A 2DJLA 2QF7A 5C9RA 3WL0A 1UKTA 1YIXA 3QY8A 4WDUA 4MZ1A 4D6IA 5LA2A 1QWGA 4S3BA 3PAJA 1JZ2A 3AHVA 4NZ1A 1E71M 3BAYA 3NIYA 2QCDA 1HTIA 4XZWA 4QCEA 2VFFA 1E55A 4K1GA 1R38A 4ZB2A 1R9ZA 4Q4RA 3W2KA 3NFUA 1IT0A 1E6XM 2VDGA 3KCJA 3ZJ6A 1QT1A 5AB3A 4P8WA 1R6WA 1SO6A 2QDEA 2Z28A 3EOOA 1ITQA 2IQTA 4NYYA 2O92A 3M0MA 1WA3A 1J9YA 4XVDA 3EB3A 1XIMA 4V2XA 1W3JA 2WHJA 2AQWA 2WNWA 4OECA 1XRSA 3P74A 1CXEA 3BAIA 4QQUA 3QQ1A 4UFHA 4KWOA 3LLDA 3GXPA 2EKGA 4D71A 3ATYA 2ON3A 1TPH1 3A6OA 3K4WA 4EAMA 3FYPA 4PMYA 3QHNA 3S5SA 5ECVA 1Q45A 2DSZA 1E0WA 1RCXB 2CBJA 1DJQA 3SADA 1P4CA 3VNKA 3NWRA 4Q22A 1S2AA 1XGEA 5I3DA 3PTMA 4AZBA 3W7EA 6ALDA 5EPDA 3H8AA 3RJYA 1NU5A 4D6JA 2PDBA 1T0OA 3VZZA 1W1YA 4IIBA 1MNSA 3GU2A 1AH0A 2J75A 1P0EA 1M7JA 1IR1A 5G4WA 5TNVA 3WQWA 4E5TA 2HXUA 3WIJA 4EVZA 4XTIA 1SO4A 1ZAJA 1H1ZA 4A3QA 2IKGA 3GHSA 4H2HA 4E38A 3UERA 4DO5A 1MEWA 3W7GA 4P8XA 5HWJA 3SIZA 3HPSA 2WC7A 4KFPA 1VR6A 3IGXA 1VD6A 4M8UA 1K03A 1V8EA 4WOQA 3R0DA 4DRSA 1UWAA 5HJYA 4AD5A 3DG7A 3VIGA 1I75A 3IEBA 3WBYA 4MAVA 1UKSA 4FR6A 1R2SA 5BU6A 2Q6ZA 1YTDA 2VCCA 1F61A 1TO3A 4IICA 5CZKA 4KGLA 3TN4A 4QFUA 4YHEA 3H6OA 4GUGA 1S5VA 4LNYA 5K9XA 3M41A 4RKAA 3BAJA 2PS2A 3DENA 4ZL1A 1YBQB 1BSLA 5I79A 6TIMA 1A5LC 3HF3A 5D2WA 2FQIA 2P3ZA 3L12A 3UZZA 5FJTA 1S2CA 4U5IA 4D1JA 1YDVA 2J66A 5BNKA 5LIXX 1AJZA 2YLLA 1UQZA 3DI1A 1MFVA 3ABZA 1WOAA 2YFNA 4OQVA 1D2KA 3N9KA 1S38A 2QUTA 4RE4A 1V51A 1CXFA 4DXXA 1NF7A 2DZSA 4GA8A 3LSBA 4J3WA 1EO7A 1EB3A 4LWWA 4N4QA 1OG0A 5AC8A 4KEUA 4KGJA 3UXIA 1JZ4A 4GIAA 1Y5XA 6REQA 3PNZA 1XLBA 5I00A 3HBLA 3TOYA 3S1UA 3EOUA 2PI6A 1V79A 3OVPA 3QPZA 1X7IA 4NILA 4PUEA 1A3WA 4EKJA 4GGHA 3PSVA 2NX3A 3U3HA 4LV9A 3NZQA 1GZJA 5E1QA 5T26A 1MRAA 3QTGA 1EL3A 2PWDA 4QG6A 1LRQA 1KV5A 3GSMA 3SQMA 5KZMA 1R46A 3QN3A 5SWUA 1XIEA 1AA1B 3LMZA 4B5VA 5F2LA 3ZT5A 3EPMA 3M1ZA 4NI8A 1OFRA 3VM5A 1TRDA 4HU8A 2NUWA 4B2DA 1DQUA 3C6CA 1KTNA 3VDCA 3ISIX 3QPEA 3T05A 3EMCA 5C6MA 2WSPA 1S46A 4JTCA 1Q4WA 1RBLA 1OIFA 4BR1A 3O6DA 2CLPA 2VX6A 4HN8A 3VO0A 1G67A 1PIFA 2V5LA 3WQ5A 1S3HA 1DKWA 4ECLA 3PBUA 3GRIA 5EA9A 3VM7A 2G3MA 3DYOA 4LANA 3QV6A 3EA3A 4XD5A 2QUNA 2A4AA 2RDXA 1TIMA 2OWWA 1QNPA 3N3TA 3W4RA 2OJPA 4JN6A 3I3EA 3S9IA 2UV8G 1GNXA 4KT2A 5D02A 1BQCA 2GSJA 3S83A 2XHYA 3W1NA 3TTYA 1FCBA 3QOMA 3CUGA 5DFAA 2WV8A 1SO5A 4ALDA 2ZWYA 4H04A 5E70A 3VDAA 3N2XA 5IXEA 3G1AA 3LXCA 4JCLA 4BWLA 4XTDA 2C19A 4QEEA 2VX4A 1OC7A 4B5NA 2GOUA 2C15A 3TKFA 7REQB 1UKPA 4K36A 2O9RA 4DLFA 4LAZA 5HDRA 1DQWA 1BWLA 3H21A 4U3CA 3HN3A 2BG5A 3AWNA 1CLXA 1AW1A 2BFGA 4XKYB 3JR2A 7ODCA 3T2PA 3WQEA 3AIBA 1CLKA 2GUUA 4RDVA 3V75A 1W9XA 1P6BA 4LBRA 1O4UA 1EPVA 2PDMA 1K77A 1XYAA 3N2TA 4MDPA 3FDKA 3REQA 4HA3A 3TN6A 2POZA 4QE1A 4DN1A 2JGQA 3OZYA 3VTRA 1KBJA 2FIQA 3AZSA 3R2GA 4M19A 1YRRA 1KKOA 4B15A 1D7FA 4DNHA 3HO8A 3I3BA 3ZLGA 2CESA 4A2SA 4J1OA 1O5KA 3GHTA 1XLEA 3VNYA 1FCQA 3TYUA 5F4WA 2DZVA 1JI2A 5I23A 1XDJA 4MFEA 4I9TA 2WM0A 4W86A 4HN4A 1F6KA 3ARRA 1BG9A 5F1VA 5BWFA 1TV4A 2PP1A 4QAIA 3RAOA 4UQEA 2ISDA 2ZOXA 2B81A 3CHEA 4MUPA 1C92A 4AW7A 3G2GA 3NM1A 1TQJA 3EWWA 1LWIA 1XD0A 2VZVA 1UPPA 3LNMA 1TWIA 4GWEA 4W5UA 5LIKX 1U1HA 2Q3OA 4X9SA 1X7FA 4PB5A 4IPIA 4LUSA 4JQ1A 4RCXA 2YPIA 2YA1A 3BQ5A 4BY3A 4S3KA 4Z1YA 4UOQA 3APGA 4JTFA 4NX0A 2WQDA 4AZCA 1TE1A 3N2CA 3BUVA 4LAKA 2X1RA 1KBBA 3IRDA 1XLHA 1WDRA 2QGYA 2ZA1A 4JTEA 4PULA 1XRTA 3HTWA 3UVIA 2VUYA 4JN7A 3T44A 2QCGA 1UZDA 2V9DA 1XGZA 2OO0A 2BGQA 3D46A 4O16A 3LRLA 6PTDA 3WF3A 2FMNA 3M43A 1BYAA 1V6UA 3G8RA 4UNLA 3TU9A 3S42A 2F2KA 3PANA 1DWAM 4KPLA 3ARTA 1VHNA 4ZENA 4IMFA 2YKKA 1O95A 1XSIA 2IKIA 3O1NA 4X22A 3R8HA 4MWAD 4KCUA 4QX4A 5DO8A 3GHRA 3Q45A 4RPQA 3DKJA 4TVUA 4DPQA 4ZEPA 1MQRA 3L4XA 4HSHA 3LB0A 1UBPC 1V7YA 2X0YA 1Z8AA 4IP5A 3AC0A 3VKJA 3TTSA 1C8XA 2QDDA 2RH9A 1XISA 4LPCA 3MI2A 4JXCA 5HQEA 3RU8X 3PTKA 5A2BA 2LLEA 1VYPX 1S2TA 1Z89A 4I5XA 1F5ZA 2R6OA 3KRSA 3LRMA 4B92A 1OG6A 3IJLA 1XBXA 3AXKA 4IIEA 1ZP3A 2QCMA 4P61A 4FK9A 4D1IA 3TQVA 1BSIA 1SZEA 1UR2A 3PG9A 3LENA 3NQ8A 1RLDA 3RHGA 1Q65A 3S6DA 3UBPC 3VGBA 1Z7AA 1P0NA 2OYMA 1XBZA 3ZIZA 2BOGX 4UWMA 1MZRA 4WZHA 4JTUA 1KQYA 1W91A 3QW3A 1LROA 3OGRA 3V5CA 3WK1A 2E40A 2PE4A 2YBVA 1UMLA 3FXGA 4ZCWA 4O1AA 2Z1VA 4MSSA 3BSHA 2FVMA 3R43A 2HV5A 3O05A 3QPYA 4KIRA 4W7WA 3ZSTA 4LVAA 2FTWA 5LA1A 4BQ5A 3VD4A 3SCPA 3EOSA 2Z2AA 2QCDB 1XH1A 2E68A 3KHJA 2QHAA 1EJXC 3QW4B 3I6RA 4C6DA 4N9BA 3HIJA 5GJPA 1IQ8A 3O6CA 3TA6A 1XV8A 2A3HA 4JHZA 5AC7A 3BW3A 1BFNA 4YTTA 1FWSA 2PA6A 4I7UA 3LI0A 4J4KA 4PBEA 4DJFD 5A6MA 3BK0A 3MHUA 1JZ8A 1VH7A 3AUJA 3QTPA 3LHWA 5ABHA 2WSQA 5HWNA 2VXNA 3MPGA 5CPMA 4QROA 2UY4A 4NZ4A 3GIQA 2G4FA 4PBFA 3TTEA 5F1UA 4EACA 3OLEA 1LL4A 1BXNA 4PRTA 4J9JA 3W7OA 1Q6DA 4O57A 3IIZA 2XN2A 1TPUA 5GNXA 2GK1A 4XD3A 4MAZA 2QIIA 5CH9A 5I3JA 1LP6A 2ZZ4A 3N25A 4HZ6A 3U48A 3W1RA 2XVPA 1XIGA 4QISA 3CAVA 3LHVA 1TVNA 3EX3A 1XUZA 2CZFA 3DBPA 1IIGA 2ACRA 5FJRA 1KM5A 3HZ3A 4HGXA 4FALA 1QW9A 1NSJA 1CYGA 1TZ9A 4IOTA 3QC0A 2NXGA 5AHNA 3W6MA 1UOKA 4R53A 2Z2UA 2ZC8A 3VDHA 2YA2A 3R7MA 2TAAA 2QVNA 1D7KA 5M17A 4GJIA 2Z29A 3PFRA 3O0KA 2Y2WA 1Q63A 2QNEA 4JKMA 2MUCA 4KEVA 3AJ7A 1RJRA 4MYXA 1OYCA 1TA3A 4WKAA 1FKXA 1EEPA 2XH0A 1Q5MA 4AISA 3UZYA 3AXMA 1Q6FA 1UH2A 4YTRA 4L4MA 2YGYA 3W72A 3FN9A 4HCDA 1FWHC 2H3DA 3TJLA 1UIPA 3B40A 3PAOA 2CERA 2D0GA 4D6HA 1JFHA 3HPZA 2P8CA 4MF4A 2GDVA 1OZQA 3LHYA 2AQVA 4DWDA 3COTA 1W56A 3ENLA 2ZUNA 4XAZA 3L5MA 3OEXA 5TQLA 4MDOA 2EF9A 1LT7A 4DJEC 4KERA 1RJPA 3B9OA 4GY0A 4NYUA 3R8RA 1NIUA 5ABGA 1H62A 2VX7A 4W7VA 4ZSTA 4TQTA 5DANA 4XBSA 3TSMA 1VPYA 4Z2KA 2EPMX 4FS9A 1JCJA 2FH6A 3GR7A 3GWQA 4F2UA 3BLOA 3BOXA 5KINA 1AG1O 1L2UA 3QM3A 4O0QA 4YTSA 4K68A 1L9WA 2E6YA 4UR7A 1KCZA 2OEKA 2PRLA 4AIEA 3GG1A 3V5OA 4XUYA 3H24A 1FUYA 1VCVA 3KP0A 4GI9A 3LYEA 4LEQA 1RP8A 2V2HA 2UY5A 1YMYA 3OBKA 2PWHA 4JQ4A 2BXZA 3P93A 5BRBA 2VJXA 3FA5A 3M7WA 1CXIA 3LRKA 1G94A 3DKLA 1P5BA 2UWFA 1OK6A 3AICA 1SPQA 2EPOA 1IZKA 3DFPA 3MMDA 1ZENA 2WLZA 3OJGA 4Q4QA 2ZRUA 3W75A 1GVRA 2X40A 2HMCA 1GZGA 4B4FA 4N6FA 3W2LA 1ODZA 4ERGA 1I2NA 4MKSA 3P0WA 4HU3A 3TYAA 3UJEA 5HUPA 1X98A 5HQMA 2Z25A 2ESCA 3B9NA 1EGVA 4D8ZA 3E96A 4MADA 2OQHA 4WCJA 4IIDA 2WSYA 2G95A 1WAWA 1T5AA 4GZEA 4H7CA 4G7FA 2X1TA 1H09A 3L0NA 3A9IA 2OG9A 2A2IA 5E09A 1BAGA 4GD0A 3Q58A 3G5EA 4QM1A 3AU6A 4GKLA 3E6EA 2IXVA 4QJ1A 4F0RA 3Q65A 3LCGA 3NQFA 4V28A 5LSMA 2AL2A 4LC8A 3BOFA 1LQ2A 4DIAA 2Z27A 2TPSA 1BHGA 1Q8AA 1O94A 4O53A 1K70A 1WZKA 1DHPA 4IP7A 4XZIA 1O1ZA 4IQLA 4B4HA 3ZWTA 1WKFA 4N42A 1T8QA 2ZUMA 4NL1A 1BG4A 2J4GA 2E1WA 4LRTA 5C2XA 3K8MA 4RV3A 4S3DA 4DJDA 5HMFA 2OQYA 2WWDA 4PTWA 1QCWA 3W74A 1ZBVA 2X05A 3L4VA 3CHDA 3WLQA 4GO9A 1X8CA 2PRHA 3WZ0E 5JH1A 1VBUA 1TPB1 2I16A 1E0TA 1VCGA 2I9EA 3CT7A 3QVQA 3ABQA 4DZAA 3C2EA 1K7XA 3ITXA 3APYA 3SUUA 2RDWA 3OIXA 4LVFA 3SCRA 3AZRA 1W1PA 2XWDA 1W3TA 1OM0A 2WSRA 3K4DA 1WZLA 4M5PA 3W0KA 1OADA 2X30A 4WIWA 3UA4A 4EP8C 2CITA 3LBMA 4WOZA 3W1PA 2HCVA 3TZFA 2VTFA 5CGMA 1NFGA 1TFVA 2I14A 2G3NA 1Z6KA 5BXTA 4X0VA 3QR1A 2QZRA 4LBSA 1PZ3A 3IACA 3BV4A 4MJZA 1FWDC 5G4EA 1BEUA 2PD9A 2VZTA 5LXXA 2IQDA 5F2GA 2PDCA 3I7QA 5D04C 3QV8A 3UJSA 1XHGA 1FDJA 3SQLA 1UD3A 1RQBA 1K9TA 3P5YA 4BI7A 3N6JA 4UTIA 3V1HA 4L5ZA 3VIMA 1E0XA 2PDWA 2DORA 1AQFA 1W8GA 2PC8A 2PDYA 4KMQA 1DL3A 4KS0A 5DY3A 3AYRA 4NNBA 3VNLA 3KRUA 3M4HA 1UUQA 1J11A 3TXVA 3HMCA 2A85A 1TB3A 2OODA 4JTKA 2WPBA 1CZ1A 3SQSA 3S4TA 3V7PA 1LBLA 1VFTA 2OKTA 3MI3A 3S1XA 1Y7VA 1D8CA 3M5XA 3WEOA 1EO5A 2HQAA 4A6GA 3WQPA 5HAOA 1JD7A 4JIIX 2GWGA 4LUSB 2VEKA 1UH4A 2VQTA 2P3EA 3BV7A 2IPGA 3TDFA 3WYZA 4AZCB 1NH6A 2PGWA 1UCWA 1JNEA 4LYPA 1EP3A 3SURA 3MO7A 3W1UA 2GSEA 3PSWA 3TYEA 2PBGA 2EEXA 1W8SA 1F3TA 1Q4NX 2Z6IA 4DB7A 5AYZA 1I2RA 3OLGA 2FH8A 1ZU8A 1KM2A 2Y5JA 3AHXA 1ZL1A 1XI3A 1B30A 5LA0A 1UR8A 1AQMA 3M0JA 4HMNA 3RG6A 5TIMA 3Q4DA 2BVYA 3LD5A 2J7EA 1DIEA 1VFUA 1J0HA 3S2NA 1YDOA 3AAMA 4HHMA 5AOUA 2ALDA 3I68A 1XRVA 3GLCA 1K4GA 1OC5A 3LHTA 1B54A 1EWDA 1GOXA 3GU9A 3F2BA 3NL6A 4GFIA 5FF2A 4JCMA 1NWRA 2J7GA 3OBEA 5C70A 3ARSA 2OSYA 4O18A 2QLYA 2PLCA 3AXHA 3FJ4A 4ML9A 4TOQA 1F8MA 4QLKA 1VEOA 2WMKA 4LVDA 1ZJAA 3DYMA 1HL8A 4JQAA 2BVWA 4HSOA 4S3FA 3WF1A 4GYKA 3P61A 1REQA 3N6HA 3NOEA 3NQ2A 3SSZA 4UFIA 3D47A 3M0LA 6TAAA 4G1KA 1VLIA 3QXBA 4JTRA 3ARXA 2HK1A 2DV0A 1JYVA 1XIHA 1V6VA 3A4AA 1MW0A 3QBUA 2CLMA 4E3TA 3H54A 1Q7MA 1VFHA 2ZE0A 1BRLA 1JCMP 3QMRA 2W92A 4K39A 4QLJA 4Z2HA 3EOEA 4W88A 5CJ5A 3BURA 1WUFA 1EJVC 4LNCA 2NQJA 2WK2A 1VPQA 1ADOA 1EIBA 2OMAA 2EBNA 4J3ZA 3VNJA 3ORWA 1S39A 3VIOA 1U1JA 3S9ZA 1VFSA 2GGEA 1X39A 2D20A 4CU7A 2VGGA 2PZ0A 1S1RA 3TA9A 1SM9A 2OFJA 3PWIA 4MMWA 2G41A 3LX9A 2CHNA 3RILA 3NGJA 3BSGA 5LYRA 1C93A 2VC7A 2ZX7A 5BOOA 2J7HA 4UTJA 4W8AA 4MJ2A 3IIPA 4QLLA 4O19A 2JKPA 1XP3A 3E1F1 1LL7A 2J27A 2X09A 1GOKA 2PDHA 3KBJA 3ZLHA 2P53A 4HCLA 1MNZA 4AFYA 2RGLA 1BF6A 5AYYA 3UXDA 4CEUC 2YW4A 4I9AA 4ADSA 1K9FA 4HNNA 1JDCA 2A7NA 3TN5A 4AWEA 2XZ9A 4INFA 3U0HA 2F2HA 4JIRA 1AQ0A 1IEVA 3IIXA 3KBSA 1R0MA 2QXWA 4ZFCA 1XX1A 2GK1B 5A6BA 3KEHA 3UXKA 1KRAC 4H9XA 1RY8A 1XYLA 1JUEA 1QFEA 1QHZA 4PCPA 1U2YA 3RRXA 4CNSA 1TCMA 4JFWA 3L21A 1R3VA 5GNZA 4R85A 1Q6CA 2E67A 5C55A 1B3XA 2QGHA 1BWKA 4L65A 4C5YA 3H2AA 3I3DA 3WD3A 3R13A 1FHUA 2PDIA 4FXSA 2RAGA 3MA8A 4BI6A 2ZDSA 3RMEA 3LHZA 1H50A 3RMJA 4CNNA 2D3NA 3W7QA 1PKYA 4DYJA 4H9UA 1VBJA 3NDZA 1A5NC 3OHIA 1YE4A 1EP1A 2C1IA 4BA0A 1B9ZA 1TA3B 5MHBA 1PWLA 3BLDA 3IWPA 1RY0A 1FHVA 3N11A 4MWAC 3WLJA 5C2GA 3EZ4A 1HT6A 1BVWA 1UWTA 4GJ1A 2WLYA 3GZAA 4XK2A 1V3HA 3UP8A 3T07A 3DHFA 1ZCCA 5KZDA 3ONBA 1S5WA 4K8HA 4J2MA 5C7VA 4YVVA 2WZHA 3MB9A 1Q2SA 1P0KA 4JD4A 5AKQA 2Y7DA 1FCVA 3M9YA 1PWMA 2GVLA 2G3JA 3BLIA 3OZMA 3GDMA 3Q94A 5FOOA 1P1XA 1P6WA 3WLNA 4HPXA 3K46A 1FWTA 3S0CA 3KTSA 1EQPA 1BGAA 3PZOA 2PWEA 2YZ5A 1WXZA 3AISA 3T0CA 1KBIA 2W79A 3MT1A 3CWOX 1AODA 3HV8A 3TAKA 5D9MA 4PA8A 2XFFA 3DZ1A 2AMGA 1SVDA 4RJEA 3RM4A 4YIWA 4KKXA 4WY0F 5DELA 3WBWA 1G5AA 2VD8A 2WVSA 3BAKA 3QY6A 3IJDA 1RBOB 1FBAA 3KVLA 3IVSA 2JF6A 4ZMGA 3R10A 3WLIA 1EWEA 1K02A 4XX6A 2KX9A 1BVNP 3UR7A 1EC8A 2WMJA 1AW5A 3QQ0A 3AQUA 4GZIA 3WLTA 4RUBA 4MNJA 3T2OA 4D6EA 3KFTA 2XGBA 2QF8A 2NV9A 4QTGA 2A7PA 3WJWA 3BJFA 3WL1A 2UY3A 2XTKA 2X7VA 4KESA 4R34A 1KA9F 1O68A 4DJFC 3GTFA 4ZFMA 1ML1A 3UPWA 3MTWA 1XDMA 5JVLA 3DG6A 4JNYA 3S2MA 5EMKA 5E93A 3LY0A 7ENLA 3FJ6A 2FYMA 3AMDA 4RZ6A 1OYBA 1JXKA 1XLLA 3BAWA 2J9XA 2V5DA 3MSDA 1H7OA 1PX8A 2O9TA 4MHBA 3VGEA 4H3DA 2J47A 2TRSA 4PUUA 4DM2A 2IXUA 4AEOA 2WBGA 2P8BA 4IJRA 2QJGA 3T8QA 1QO2A 4F9DA 1PIGA 3FEQA 1WOBA 2R1KA 1TX2A 1TREA 4HZMA 3W01A 3BW2A 3RLHA 3GVVA 3CIXA 2PDPA 5LNWA 2GYIA 2HNEA 2QPXA 1OGGA 4Q4KA 5H1WA 1EJ7L 1HL2A 1LYXA 3FJLA 4EAYA 3NQDA 4DF0A 3ZLFA 3CO4A 5IHSA 4U33A 5JBEA 2BY3A 3QLDA 2Q01A 5FSDC 4O0ZA 4AMAA 3FVDA 5K7JA 1BYDA 5FJOA 3NZPA 5AC6A 1FWGC 4PMRA 4RNJA 4TMBA 4WJ8A 4FOJA 1XBVA 5C9ZA 5BYWA 5A2CA 4FF5A 2GGGA 5CZ0A 3SAZA 4GX9A 5EU9A 4KFNA 3WH5A 1RK5A 4U10A 5I3FA 4JPGA 1G1YA 4X63A 2ZZ1A 5DY2A 3CUZA 1NWTA 3AU2A 2FVKA 2YW3A 4EANA 4Q8WA 5LGXA 1PV8A 3G6LA 2J9ZA 2PF0A 4H6KA 1HGWA 1W9UA 4PMVA 3L5LA 2Y8KA 4BF7A 4LT9A 2BSLA 5F4SA 4DUWA 4TVCA 4B2DD 2A3CA 2PAJA 3SO7A 3I7SA 4L64A 3NVDA 3S6TA 3B8VA 3GO2A 4OFCA 3MP5A 1H7XA 4W7UA 3MDWA 4W84A 4HNLA 3VE7A 4AUBA 4DM1A 4JL1A 3B8DA 2VEPA 4L4PA 3VMNA 1S5NA 5LIWX 4C1LA 1DE5A 2Y7FA 4PTDA 4O54A 1UBSA 4R27A 1JPDX 1OC6A 3SJNA 1OX4A 4WY0A 1YNQA 4E6MA 3F4NA 3FW6A 2Q8LA 3EDEA 4DO4A 1EYEA 3MV11 4FP1A 3FVMA 4A8NA 4PMXA 1FCUA 3B05A 3WK2A 5A8NA 4YL2A 1KM3A 2BNJA 4IQEA 2W4XA 2WAGA 2E3ZA 2QAFA 2OZ3A 4IL2A 1SFSA 3SBFA 3TIMA 3H23A 2VEMA 2X0HA 3TONA 3E2QA 4FXFA 1J4EA 1JULA 3G1YA 1QHOA 1YXYA 3MY9A 1EQCA 4QG9A 1GUVA 3SCWA 2ZYFA 3DOPA 3EDKA 3TNOA 2VZOA 1M04A 1SJBA 4IMCA 3CHVA 3IGHX 3ZMRA 4CEXC 4EPDC 2NXHA 4LUIA 4MB5A 5A6AA 4NJKA 2MNRA 2IUZA 2JE8A 2VCAA 2YSWA 1KGUA 1X97A 4Z2JA 1M5WA 1A4LA 2R1PA 4UTHA 2A3EA 4NAEA 3AIWA 4JY8A 5D32A 1MDRA 3KW3A 1UKQA 5F2MA 3N4EA 2YFOA 1W1B1 1SO3A 4OU1A 2NQ9A 1RD6A 3WBEA 4P8UA 2TYSA 3CQIA 4GGBA 1GKRA 4NHVA 4NU7A 5FIPA 4HJFA 4R7WA 1OK4A 3VABA 5HK4A 1DIOA 4FSAA 1CDGA 2FZBA 3D3FA 4LF2A 1XQLA 1G9HA 1GQIA 2W0UA 5IDIA 3LGGA 4BFAA 1XLAA 3M5VA 3ZR6A 2JFEX 1VRDA 1HP5A 3E38A 5FEPA 1RALA 1G0CA 1XLFA 2B0MA 1OFAA 4Q8VA 2XM2A 4Z2LA 3ITOA 1TE6A 4RLIA 2EAWA 3NL2A 4QR6A 2VEFA 4GX8A 2G4JA 3B8IA 3CH9A 3S5YA 3CTTA 4HSNA 3GDTA 3L4YA 3WO8A 2VWTA 4B5UA 3UWQA 3WDQA 5LKYA 2F6KA 2OELA 4M82A 1C29A 1REQB 4NG3A 5A3HA 1XIIA 4C1KA 2DSUA 1B1YA 5I3KA 3U2CA 1ECQA 4GMEA 3TN3A 5L6UA 5CGTA 2OQLA 1OT1A 4O1FA 1R5YA 3G24A 2FDMA 4FLRA 4O4WA 4FHAA 4LU0A 3UJRA 3CV2A 4QXIA 3TNBA 1BRLB 3O63A 3FXYA 3GAYA 1NEYA 4I5UA 3LDVA 1TX0A 1OHLA 1A5SA 4FLOA 3WJSA 1PZ0A 1CX9A 9CGTA 4I9MA 2OX4A 4GOAA 3WBXA 1QHPA 2WZIA 4NJIA 4AZ6A 4PMZA 2GFTA 5ABEA 5IFPA 2BP1A 5PTDA 4JTLA 4M7TA 3BCFA 4HNVA 4JX4A 4O4VA 5JXQA 2V5JA 5CJMA 1TMLA 1Z3NA 4LFYA 3RYSA 3TUUA 1XINA 1EJRC 3FJNA 4Y9NA 3SIMA 3S1GA 3KTCA 3E3HA 1JGIA 5A1AA 1QDSA 2GPTA 3CU2A 5DN1A 3ZQ9A 1EZWA 1VRXA 3KX6A 4TTUA 1GORA 4J3TA 4KCWA 5CC6A 3ZT7A 4DBWA 1R30A 2NXIA 2IPFA 1PKNA 3OOQA 4WSKA 2HVOA 2ALRA 2FHCA 2WNNA 3QSRA 5CAHA 3P80A 4DPPA 4XG1A 1TPDA 4IGSA 2E5DA 3NZ1A 3SW6A 4OBSA 1LOSA 4G9PA 2C8NA 1AFSA 3HQPA 4H8UA 3LLXA 3R11A 1IGWA 4UFKA 4OIFA 1VJZA 3PWGA 2EXOA 2Z7GA 4H2CA 2J74A 4GCXA 3BANA 1CCWB 2GZXA 2QYGA 5LIYX 3LA4A 4GZJA 2QPUA 1F73A 4DAIA 3WQ8A 3S2JA 5BWAA 3SRHA 1CT5A 3JU2A 4CNPA 2Y6ZA 1GZ1A 4JHOA 2C13A 4R9OA 3UPBA 4O12A 1TJRA 1EDQA 5KTLA 3KOWA 1U33A 2HISA 1VPXA 2VGIA 2YDQA 4XIAA 3FHQA 3SCOA 1PZ2A 4FIRA 3QH2A 1W3KA 5L9FA 5CPSA 1QASA 4O1BA 2G50A 4KW2A 1M3UA 1KFEA 2R14A 3SCNA 1ELSA 1VIZA 2PC4A 3SFWA 2Z1BA 2PP0A 4S23A 3K1DA 6A3HA 2E0PA 2ZRWA 1U5VA 5H91A 3C4UA 1EIXA 2O7SA 2DSKA 4KWSA 1JZ5A 2VC9A 3PUOA 1CTNA 3WUEA 4GI4A 1DWHM 5FAJA 3MANA 2YCEA 1E15A 2CLOA 4DUXA 3NDOA 5G1TA 4OJYA 4GC4A 2HNHA 5A8GA 3WQ6A 3AS0A 3RDKA 3TYZA 1FWWA 4E3VA 3KBNA 3STPA 1MXDA 1EOKA 1E6RA 1OBAA 4GYFA 1E73M 1P1MA 4UMCA 3ECQA 3LCWA 3CGTA 2JKAA 4C7GA 4WDTA 4GQ0A 3WFLA 1JCTA 1TJ0A 3KWXA 3RF9A 1ZHAA 1KLZA 3PPHA 4HNCA 1A80A 3AIEA 4QNEA 4PTXA 4WQ6A 3DFHA 1KFBA 1Y65A 4DI8A 3ARUA 1KCXA 3TMLA 4JY9A 4KH2A 2QCFA 3IJ8A 3TJIA 3LGEA 2DFAA 3PJTA 3FA3A 3SGZA 5C9WA 3NSXA 4RDYA 3NJ3A 4MZYA 5ECUA 4IQDA 1OF6A 1OFPA 1HKJA 3L68A 4YNGA 2WHMA 1XM3A 4M80A 1RPXA 4JYFA 2VUNA 2DT1A 2CLKA 3L4TA 4PH6A 5IM51 1UIOA 4R88A 3W81A 5H8MA 1WDDA 1I0DA 2REQA 1UP0A 1Y5WA 1HN1A 4H1ZA 4GYPC 2A3BA 5E5CA 3E02A 1JG9A 1DJWA 3N9SA 4HBKA 3SUVA 5M1TA 3F2CA 4CLMA 1X1OA 2OTDA 4TX8A 1JQXA 3EX6A 3QOKA 5D9PA 1CEOA 3ITCA 4O10A 3RLUA 4X3ZA 3WMCA 3CUHA 2WANA 1MSSA 4UTTC 3WQDA 3ES8A 3XISA 2E8ZA 2Y5EA 3IPWA 3MJMA 5RUBA 4MB1A 3SGGA 1ALDA 4XQ6A 4KEZA 1F74A 4IHCA 1GQKA 3NQVA 5CC7A 4E4PA 3RLVA 3VIIA 3LN3A 3VOIA 1TPEA 1GWJA 4DELA 2NT0A 5B7ZA 2FHBA 4CNTA 4M6QA 3RLGA 1SQ7A 1LWJA 4EXBA 3M64A 2PBOA 5DRIA 1ZY9A 2POTA 2Y7EA 1ZP4A 2VDIA 3NYZA 4N6EA 2JIWA 4LUTA 1XLKA 1N2VA 1ZAHA 1KFLA 5GVJA 4Z1AA 3W38A 1VAHA 2AKZA 1DTNA 2XVKA 4GNKB 4F48A 1VIWA 2WCAA 1DBTA 4GINA 4IIHA 1SZFA 4MM1A 2GQ3A 5EMUA 2NW0A 4M0XA 3PP7A 2ZX8A 4BK9A 5D05A 1YX1A 4FX7A 3WQFA 4UMAA 2QCEA 4ZQCA 1ADSA 1DXEA 1Z32X 2WVUA 4G1NA 4YHGA 3ZT6A 3GM8A 2PWUA 2XIIA 1EC7A 1GTEA 1WBHA 1CB2A 3OVRA 2WZEA 3KL3A 3PZUA 3QFWA 4H9VA 1O5RA 2ZX5A 4HMCA 2OZTA 2BGSA 5FEWA 2ATMA 4ZZ9A 2PDKA 2PRMA 3BW4A 2DW6A 2CWXA 4JICA 1KKRA 2Z1KA 1LLWA 1BXBA 4GH1A 2ZUTA 5T9BG 3AZTA 2QCCA 4F2BA 1TJPA 3Q67A 5LHFA 5T9CE 5AYXA 2NLIA 1VEMA 1V6XA 1E72M 2XVNA 1BD0A 1XIFA 3N4FA 2ZX6A 3V18A 4DY1A 1OX4B 4WY0B 3FCPA 4RW3A 4HZ7A 1FTXA 5FSEC 3OPSA 3H7UA 3VU2A 1SU5A 3ANUA 3AROA 2RDUA 4AVNA 4LX4A 1EOMA 1ISWA 1MUCA 3DN5A 4DJDD 1M65A 4AD4A 5DEZA 1NVMA 4K6AA 4LVGA 3DC8A 1QW7A 4ROQA 4Q4MA 3VINA 1QOXA 4W85A 1R3SA 2VC6A 2FB3A 2W91A 4EXAA 3GH4A 4IMAA 5U4NA 3TX9A 5CBBA 5K4ZA 3AIUA 3WLRA 1DHKA 4JDBA 2UY2A 2GDUA 3LG3A 1LQ0A 4QSFA 4JYDA 2RFGA 4P7LA 2DUXA 1I4NA 4NAEB 3OTRA 3VOGA 1PO9A 1AW2A 3HOJA 2YOCA 1ME7A 3MV01 3KHDA 1NAL1 4H7VA 2YJQA 3WQ4A 3VZXA 2R24A 3G3MA 3OG2A 3ARQA 1PUDA 2D22A 4V1YA 1D3GA 2A1YA 1E56A 3K13A 4BZYA 4A29A 5JBFA 4R33A 5F7UA 4WR3A 2X2GA 2E1DA 4Y6GA 5HOSA 2OKOA 1ZGDA 3F4DA 4PUJA 3BGAA 2X16A 4F8XA 3GIYA 3JRKA 1O12A 1XBYA 2GUYA 5A6LA 1D3HA 3W71A 2OZ0A 1XIJA 2X1IA 4PMJA 1PIIA 3NQMA 3W7NA 3SCUA 2TODA 3T0AA 2Y89A 3MVTA 1EX1A 3KBMA 3PR2A 1AUSL 5LNUA 1LOLA 4B5SA 4LCRA 4W89A 3CB3A 4GE8A 4ROPA 1VQTA 3C8NA 1IYXA 1NWSA 2P88A 3GXNA 5KZEA 3GC2A 2Y0FA 5E6YA 3KOFA 4H8HA 3TAOA 1FY6A 4CQBA 4IGHA 5A8QA 1EP2A 3MU7A 5LHEA 3NXLA 3IARA 4UB9A 3STFA 3HPXA 4BF5A 1FRBA 1NF0A 2ZZ6A 4QS5A 1QTWA 4GUIA 5DLCA 3CAWA 4GJJA 3IRSA 1EF2A 5AVHA 1ITXA 4L9ZA 5FKYA 1J0IA 5E0FA 5BMXA 4GO8A 1N7KA 2YCLA 3V0UA 1MQQA 1RHCA 4H4IA 2BLEA 1H11A 2DT3A 3PZNA 3LV6A 3WUFA 2RDTA 3D0CA 4OGZA 2ZUSA 1MFUA 3FLUA 5K9DA 1S3TC 2PCQA 2I5IA 3KRZA 2ZX9A 4Z0SA 3WD0A 3WLPA 3S8HA 2DZAA 1YKWA 1E43A 1A5OC 1FDZA 3BC9A 3W87A 2OLAA 3WDPP 2AQOA 2PZNA 3BVJA 5J8LA 4HD5A 1EJTC 2NLYA 1ZJIA 3HQ1A 4OZOA 4ERIA 3RRAA 4U3AA 1LM1A 1W3IA 2VOMA 5CC3A 2FJUB 5KSWA 4U31A 5M2FX 2DZUA 3LU2A 2FVLA 3DX5A 1UD2A 2PGEA 3M0VA 3LK6A 1JYNA 1C8QA 3DDMA 3L2MA 2W66A 1E1EA 2CC0A 4EPKA 4BWLC 3GHUA 3TK7A 4PRWA 1ME9A 5JU6A 4IZGA 1E6NA 1K1DA 1PPIA 1PKLA 3R0UA 3VCNA 1V3KA 4HK7A 1XDLA 3ABRA 3GC5A 2ZTKA 4L56A 5CSYA 2ZTJA 2ONEA 4C6CA 3WD4A 3TFCA 4K8GA 1XR2A 3B9AA 1WDSA 1DOSA 4PCFA 7A3HA 4A8RA 4ICCX 3ARYA 4TU1A 3QHMA 1NDWA 5C8BB 3S5OA 3EKLA 3UWWA 4GY7A 5DF0A 1JCXA 1LUCA 5CPNA 2RJGA 2D3LA 1LT8A 4KWWA 3VKBA 1UR3M 1V3LA 3UYCA 1TR9A 2QCHA 4AYSA 1QOQA 1I6NA 1E4LA 4MZ8A 3TWAA 3POCA 4AD3A 4NX5A 2V0TA 4NZCA 1PZ1A 3TSDA 3ITLA 3WG6A 5DCEA 3RM8A 2NV2A 4JOMA 4V15A 3WMLA 2OEJA 3HA1A 3JS3A 1CW2A 2BZNA 1NFBA 3GXDA 3VX1A 3VXGA 1E1FA 1F9CA 2HTMA 2WCGA 2EPHA 1MUMA 3ARZA 2H6RA 2WVVA 2BBFA 1JDEA 5A8PA 2VZUA 2C0AA 5A6BD 4GACA 1KGXA 1NOWA 2V3FA 4LF1A 3CO8A 3N2MA 3W7CA 4GUFA 4HPNA 5DXXA 3L2LA 3BO9A 4MTVA 1J93A 1UD8A 4DXKA 4FI4A 3M6DA 4L1WA 1F8IA 5DX7A 4BS0A 4XAGA 1TWWA 2NQZA 4X61A 1QI0A 1YE6A 1BF2A 3U6WA 3BLKA 2INZA 5FL1A 5HULA 3ONCA 3QF0A 3E2VA 3V0TA 3STEA 3MJYA 5D8WA 2GLKA 3QLLA 3D5HA 2EPKX 4MOZA 3FKKA 2Z00A 2C3ZA 3PZTA 5CZTA 3BE7A 4LV4A 5CG7A 2X42A 3TR2A 1A5BA 2NX1A 4A8LA 4ZO9A 3WD2A 2ISVA 1VKFA 3AJXA 1A5AA 2EHHA 4YYFA 1B90A 1UQYA 2HSAA 1DJGA 2VELA 4UCFA 2Z1WA 2Q09A 2YXXA 1CXHA 3IGUA 5IHRA 4GIRA 3EWZA 3E0LA 3TSBA 1I2PA 6ENLA 2REQB 4H83A 1K9DA 3PTQA 5KEZA 4HYRA 1E4MM 1Z9AA 1I2OA 1PX4A 1W9PA 3BCJA 4M3PA 4FNQA 4HMEA 1T96A 1XS2A 4PTVA 4YN5A 3ME3A 1EXPA 4L4LA 1B4KA 1GOMA 4XBKA 3G3DA 4LS0A 1QK0A 2Y8UA 4NXSA 5D9NA 1FHLA 1N8WA 3EPNA 3G8EA 1H4PA 4JHMA 5KMYA 4YWSA 3WJYA 3ALGA 1QRQA 3UJ2A 1J6OA 1OCQA 4QCFA 3RJXA 2WW5A 4EE9A 4B91A 1EGMA 2V3EA 3GUWA 3VOFA 4DAFA 2O4QA 3GXIA 1QK2A 2ZZ5A 3VD3A 1TELA 3T4CA 2J7DA 1XLCA 4FLSA 4JTQA 3BZGA 1TTIA 4K2SA 3VMPA 2OZ8A 3U5UA 4M81A 1HJSA 2W3ZA 1B3OA 2WBKA 4S3AA 5I0DA 4ZOEA 2XIBA 1E0UA 5I6SA 4LUTB 1LQAA 2D24A 1GVFA 3TTOA 4R9XA 3OVGA 1W5PA 3P62A 3WJZA 3V16A 1QNQA 1OGBA 3ZS4A 4QS6A 3TYDA 2NWRA 4NNAA 3G1SA 4CCEA 4GY1A 1M01A 1YW1A 4YWIA 3MWCA 4ADUA 1SYTA 3VI2A 4JQ2A 1DQXA 3PFMA 1XYMA 1G7UA 3ZXWA 1LWHA 2OYLA 5CSSA 2DY3A 3LEPA 4XISA 2P0IA 3CS2A 2JIEA 3LCFA 2CCRA 1JQVA 1ZJBA 3WFZA 2E5BA 3G1DA 4XAFA 3B0VC 1A5CA 2G37A 3MYOA 5H8PA 1X6LA 5HBFA 3GAKA 2DP3A 1KBKA 1T6MA 2YLAA 3WH9A 3QMSA 4AXNA 3K4AA 4JFUA 4AY7A 4HK6A 2C6QA 1HJUA 1W54A 3IK4A 1UUOA 1LZOA 5G4HC 2GSHA 1T99A 4S3CA 4EPEC 3TC7A 3OG3A 1XCXA 1B0IA 3ZR4A 2W27A 2FZDA 1OWQA 3W3OA 1F7BA 1XLJA 2BHZA 3N29A 3DFTA 4E2DA 2JALA 4LAMA 1QO5A 3FHAA 3N19B 2PDJA 4AX7A 9XIAA 4GQGA 4NJHA 4PZVA 1H7NA 1YPIA 1DEDA 2BV9A 1V3JA 2V8ZA 1NM9A 4PYSA 3MMTA 1FWRA 2E09A 3LTSA 1P6CA 4HKPA 2QKFA 1VZWA 3GIPA 1PTGA 1FHDA 1JYWA 4IG2A 1HJVA 1R3QA 3WDIA 3QR3A 3B0PA 3II1A 4MFDA 4F0LA 4I8YA 1LRNA 3KDOA 3O3RA 2BVTA 3QGKC 5CZSA 4WJXA 5LNVA 1GJWA 3IUIA 3GU1A 4CD8A 4RZ4A 4J5NA 4XV0A 3PZIA 3ATZA 4P5UA 3LQGA 1DORA 3M0HA 3W6LA 4N7QA 3H4WA 3RITA 3BL3A 3QGAC 3H26A 4O8AA 5G2IA 1JAKA 2IPWA 2BY1A 4PMNA 1K6WA 4PR4A 4CUCA 4K38A 3NQBA 2RKXA 1FA2A 4J7RA 1X8FA 3KP1A 5JIWA 4HT3A 3EOLA 4IFKA 1Q6QA 4EOUA 3A4XA 1VCFA 4B5TA 4E0CA 2IPJA 1Y5VA 2FPTA 3E0VA 4F40A 3A13A 3FAXA 3PB2A 1H61A 2VDHA 3W25A 4ORMA 3KL5A 2C0HA 1V6YA 1V7AA 2GJNA 4PB4A 2YB1A 1DE6A 2Z7KA 3G1HA 5TD4A 4PEEA 4AIUA 1C9WA 1XC4A 2BHUA 4HA0A 2B7OA 1RQEA 2CXGA 3RNDA 2E4TA 4YXGA 1PXGA 1UR9A 4J40A 4F9JA 1EC9A 3UWZA 3C2FA 1FQ0A 1H0IA 1OJXA 1O6IA 2BOFX 3W7LA 1RCQA 1X96A 4FF7A 1SFJA 4HYVA 3U7VA 3TXZA 2VFDA 2FHFA 1DWFM 4UOZA 3UXAA 3WK3A 3QZEA 3UZ5A 4RE0A 3BCDA 5DMNA 2Y85A 1GTHA 3SY5A 2VQUA 3A47A 2XFWA 3B06A 3MMUA 3SRFA 4W5ZA 2E28A 2V68A 1EJUC 3DH7A 4H01A 2PWFA 4AC7C 1QU4A 1TJ2A 4CQDA 1HKIA 1JCYA 4LXFA 1IZJA 1LG2A 4V33A 3W88A 3C2YA 2J8GA 1HL9A 4IISA 4B5XA 1AH4A 2GJPA 3O7UA 3PZGA 1L8PA 3GX9A 4PB3A 1EZ2A 4X2RA 4JFVA 2YCLB 1UJQA 4H6EA 1W3HA 1ONEA 2XN1A 4Z2IA 4UTMA 2PDFA 3W1TA 3O16A 4C6IA 4B5WA 3NQ6A 4RV8A 3WKZA 3QGVA 2QIWA 4WXZA 4LGXA 3V0SA 2YL5A 4HYWA 4GH3A 1V03A 2DPEA 1NDYA 4IXXA 4NRSA 1ZAIA 3SN1A 4LYRA 3F4WA 4RNFA 4I7VA 5BW6A 4WLCA 4OV9A 3T78A 1W31A 7XIMA 2Z1SA 2ZCGA 1Q85A 1E4NA 4ZVJA 4C91A 2GVEA 3QV7A 2YXOA 3VUSA 3F2DA 4DJDC 3A5FA 2D1ZA 5I24A 4NJJA 5EKYA 4AHQA 1L8NA 3BMWA 3W84A 5JMUA 2PODA 1C3FA 2XIQA 1JRBA 1F6YA 3G1XA 2PWGA 3TCSA 3L67A 2PU1A 3F03K 2QW5A 1J10A 1TPWA 4Q3MA 3G1FA 5I03A 1RQHA 3HU7A 3DFNA 3MUCA 4MB3A 3GW0A 2YZRA 3RO8A 1W5NA 5AZ1A 4WD0A 5FF0A 3GDRA 4ORIA 3H7RA 4DUOA 5BOFA