1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
2RH9A 4OWGA 4NZJA 1H7NA 2AAMA 2Q3OA 4NU7A 1G4TA 3Q37A 1F5ZA 1UUMA 3G1AA 4OV4A 4UFJA 1WV2A 3W22A 3S42A 2HSAA 1ZHAA 2JKEA 2AGKA 3LBCA 1X8FA 1I2QA 3LCWA 3O6DA 2Z0IA 1KTCA 4GUFA 2DZPA 3LCIA 4MY1A 4O15A 5DY2A 3PUDA 2I1OA 1XC4A 5AC6A 3G1YA 2W79A 3HBLA 2E6YA 1EWEA 1L9WA 5CSSA 3L0KA 3HG5A 5LHEA 1ZNNA 3BVJA 1VLWA 3W84A 2WQPA 1QNVA 3RLUA 4JIPA 5EBUA 5AHLA 1KFCA 1YDNA 2ISSA 1ICQA 2HTMA 3P5ZA 4UFHA 4ZL1A 3STFA 5HQEA 3M5VA 3NQFA 2DZWA 4YLWA 4MZYA 2UV8G 1VS1A 5HNRA 1VYRA 4NXSA 4OE7A 1SFJA 3C56A 2ZTJA 5AC8A 3DBPA 5L6UA 2CLOA 3TC6A 5DBTA 5KINA 3KVMA 3T78A 3U2OA 1OABA 3MHFA 4JDBA 1OG0A 2QCMA 3W7PA 5C2XA 4ICNA 2YYTA 1YXDA 3GX9A 2Y7FA 3A22A 1X7FA 1GPWA 4LVFA 2ZZ5A 4QJ1A 3W7HA 2QCLA 4MZ1A 1A50A 3W9ZA 1K02A 3WFAA 2FJKA 2QCNA 3LV6A 1IGSA 3CT7A 1XBXA 1S5WA 2YW4A 4YCOA 1HO1A 4MYXA 3W1RA 1Z48A 3GNNA 3I7SA 1H1YA 1THFD 2ZRWA 4E2BA 5DLCA 4PFMA 1TYGA 3T55A 1UUOA 3NZRA 5FF3A 3SR7A 3TXZA 1JQVA 4AF0A 2PCQA 5D04C 3W73A 1JR1A 5G2HA 3CWNA 4NNBA 3TCEA 3S1UA 3ABSA 3P60A 4RX0A 2P1FA 5ABTA 2Q3RA 3B06A 3K30A 5FF0A 1QR7A 4H3DA 2VFGA 3P84A 5IM51 1K7FA 4PEKA 3TA6A 3GR7A 1R47A 1VYPX 1EPXA 3RFAA 2VEMA 3LHYA 3CIXA 1FCUA 4Y96A 3THAA 1JUBA 2EAWA 1I4NA 3UWWA 4BR1A 4BI5A 3ZFHA 1TTJA 4OV9A 1R30A 3HOJA 1GJPA 4XUGA 4LS1A 3INPA 2FLIA 3KVLA 3QYQA 1G7UA 3W83A 4LU0A 5AFDA 3QMRA 3CM4A 4E38A 2WSQA 5KITA 2NXIA 2DZSA 1B4EA 3FKKA 3B04A 4IGHA 4YCPA 1QFEA 1XBYA 3MO7A 3W2JA 2NWRA 1SW0A 5DCEA 5A5WA 3P80A 4NXKA 3C0JA 3W7QA 1FY6A 4I7WA 5EYWA 1T96A 2ZZ7A 4GRSA 1G69A 1JULA 4AF0B 3S6DA 1VPXA 3ATZA 3MMTA 1FBAA 1W5OA 4S2BA 2W0UA 4UNKA 2X16A 5DBUA 4AAJA 3RLVA 1B3OA 1F7BA 1FWWA 3LB0A 1L6WA 3PSWA 1PHQA 4LC8A 3WK1A 5SWUA 2JKPA 4ZQRA 3M6YA 3M9YA 2CZEA 1W0MA 4AXKA 4RV8A 4AHOA 4UTWC 5AYZA 4R7JA 4AEOA 2TRSA 3V75A 3E12A 2A5HA 2WOQA 3P7YA 2YXGA 4LWWA 1C9DA 3PBWA 3N2XA 4ZVJA 3E02A 1OK6A 2ISWA 3DFSA 3FS2A 3MI2A 5G4WA 1TV8A 1SFLA 1W3IA 3P8JA 3C2OA 4CCEA 3PBYA 3N9SA 4PODA 5BW6A 1BKSA 4WOZA 3TR2A 4O50A 2PRMA 3G24A 1R2RA 3NL6A 1XKYA 2V30A 3EWWA 1UB3A 3R12A 4CQAA 5FF7A 1Q6RA 5BNKA 1D3GA 4OBTA 4CLMA 4LVDA 4N9EA 1LORA 4O17A 4FNRA 1HG3A 4LY8A 4IMFA 3W2MA 4HN4A 1XL9A 4FB7A 4GNJA 5U7SA 1SSDA 1OFBA 1OFDA 1M7OA 4I7VA 3F1QA 4X22A 1JUEA 2J9ZA 1GOXA 1XDLA 1ZAJA 3VNDA 3EB2A 1C29A 1T0OA 4MLJA 2C3ZA 1CI1A 3A23A 5CZSA 2NX3A 1G6CA 4JTFA 4WD0A 1AL8A 1VGAA 4GWEA 3HG3A 3L66A 3G18A 3DKJA 5CGQA 3M5XA 1YADA 4IX2A 4UNLA 1X1OA 5U4NA 3U6WA 3W2NA 3HGJA 1TPFA 3E9AA 2YZRA 5HULA 1NF7A 2VEPA 3UWVA 2G5WA 1ZJIA 6ALDA 1MSSA 1K8YA 1WBHA 2GUUA 3QSRA 4O18A 2VFEA 3W3OA 3NNTA 1ZCOA 2H6RA 4JYDA 3VFLA 2E5CA 3VCRA 1A5CA 1NSJA 3SJ3A 3GLCA 1IXOA 2ZRYA 1XFBA 2NZLA 3W7EA 1RQEA 4QM1A 3C6CA 3Q94A 1BTMA 2QF7A 4FIQA 5I3IA 4QQ3A 3KOFA 4N2YA 3R89A 1SO3A 3T4CA 1GVSA 3W88A 4DF2A 1LOQA 1PHWA 1EX5A 3TSBA 1W31A 1GTHA 1W5PA 1YPFA 3LDVA 4ZQOA 3HPZA 1TPWA 5H91A 4AHQA 1FWNA 2DZTA 1H62A 4EOUA 1KA9F 4K8EA 5DN1A 2X1UA 2C13A 3QC3A 1RPXA 3LCXA 4UMAA 5AYYA 1ZAHA 4O4VA 4FXRA 2ISVA 2F84A 3SSJA 4HKPA 1DHPA 3NL3A 4XTIA 2WSYA 4FF7A 4FX8A 2ZZ6A 1LTDA 3P81A 1QWGA 1PIIA 2BZNA 4ZQNA 3W1AA 1GEQA 5FI8A 3GK0A 3BARA 1LLZA 2OZ0A 4E0CA 1JJKA 3KHJA 5C55A 3MYOA 4O14A 3LCFA 4FX7A 1V7YA 4JTUA 1TPEA 1XBZA 4C1LA 3CQ0A 4KWWA 1TQXA 3OA3A 5GVJA 4PL2A 4HNNA 1RV8A 1TQJA 1W54A 3MWAA 2ZZ4A 4MJZA 1LBFA 3KFTA 3SFKA 2RKXA 1YTDA 4HNVA 3PSVA 5D05A 5I3HA 1I45A 5G2WA 4JGDA 5FEZA 4YWIA 3GDLA 1GVFA 1TTPA 4O8RA 1G4EA 2Q8LA 3VI2A 3LRMA 3GNDA 3GDTA 4IWWA 1R2TA 3IGXA 4ZMGA 2DU2A 3CEUA 3IIZA 3B8DA 4JD4A 2VEIA 3TW6A 4H6KA 4K7VA 4O1CA 1D9EA 5HMSA 2A4AA 1TPVA 4JTGA 3KAOA 2QKFA 2H3DA 4IMGA 4EIVA 2ZRVA 4O16A 3PS7A 6TIMA 2BWGA 2PE4A 4JYEA 4POCA 5K9CA 3EWBX 1TREA 1VCVA 2FPYA 1KV8A 1TB3A 2LLEA 1M6JA 1W5QA 4O0ZA 3DHFA 4P2VA 1SW7A 1MEHA 4OHQA 3I7RA 4RCXA 4Z1CA 4NNAA 4G1KA 4UFKA 5K7JA 3DFNA 8TIMA 2A1YA 3EX4A 4PA8A 2TSYA 2RDTA 3EXRA 3TV8A 2ZFAA 4ADTA 3N14A 4O0KA 4S2CA 1LRQA 2V82A 1KM5A 1WAUA 2Z6IA 3SZ8A 1VCFA 4GUGA 3L0GA 3TKFA 4N4PA 2HS6A 3TE9A 3TX9A 4TIMA 2NLIA 2QJHA 3UZ5A 5HUPA 1XUZA 1MZHA 5F4WA 3PF3A 4CNPA 2VFDA 3L9CA 4UIOA 1VCGA 4Z1DA 2GOUA 2XN1A 3QH2A 3LHWA 2P0OA 3GYEA 4JTLA 4OU1A 2ZDRA 3W7LA 3O8AA 2CWNA 1SO6A 1EP3A 4GUIA 5FF2A 5CZTA 3NPVA 4GJ1A 2HMCA 2H8XA 1I2OA 2A6NA 1VRDA 1JQXA 4MPQA 3ZWSA 1DQXA 1SO5A 2VFFA 3UPBA 1O5XA 3NM3A 4N9CA 1TTIA 1XM3A 5I3KA 4O11A 4O57A 2X30A 4JX5A 3RNDA 3LHUA 4NZFA 3KX6A 5D03A 4A2RA 2GPTA 3H53A 1VJIA 1ALDA 1DV7A 2V5LA 4B5NA 4C1KA 3MHGA 1XUUA 2C16A 4NX0A 3HIJA 1NFBA 3R5EA 4JYFA 3SY5A 1A5SA 1OF6A 4NQ1A 1KW1A 3LRLA 3N3MA 2FB3A 4Q32A 1OK4A 3IIPA 3B03A 2NXHA 3QQ1A 1YTKA 2QDHA 4Z0SA 2A2IA 4Z08A 4KWVA 4FXSA 3JS3A 3QSTA 3WK2A 3OVPA 3LXCA 2VOMA 3H55A 3PWAA 5LNVA 5FEXA 4YXGA 2Y62A 3TMLA 2P10A 4UFMA 5DXYA 4OGZA 5EKYA 4RXGA 3NPWA 1ME9A 2NV1A 3PY2A 4JR5A 1DOSA 2OMAA 3QPZA 1H7OA 3L5LA 1OF8A 3DH7A 5EMUA 1H1ZA 1JVNA 5F1UA 2C19A 5LGZA 2NUWA 3FJ6A 3N34A 5EL1A 2B7NA 3GKAA 1OVDA 1W1ZA 1RQBA 3Q2DA 1OHLA 3OIXA 2E6DA 2CLKA 1LYXA 3A5FA 2GJLA 3LCLA 2Y7DA 4RZ4A 1GG0A 3SW6A 4WXZA 3W23A 5E1QA 5BOOA 4FEZA 1TRDA 3LI0A 1FDJA 4QNEA 4O54A 3G8RA 4PL1A 1Z41A 2OCZA 2CLMA 1VZWA 4O4WA 3TQVA 3KRUA 3SI9A 2C15A 3YPIA 1GZGA 4LRTA 3HGOA 4CCDA 1KV5A 2CU0A 3PB0A 1AL7A 3GXTA 4OQVA 4TU1A 3EX6A 1ME8A 1S3HA 3A24A 3VE7A 3N9RA 3ABOA 1ZY9A 1LBLA 4WJEA 3W2LA 4YMZA 1IXPA 1QDSA 5CKSA 4UFIA 1I2PA 4XKYA 1ICSA 1M5WA 2Q8ZA 2ZZ3A 4O52A 4NJKA 4UR7A 5D2VA 4HSOA 3PC0A 5AB3A 4MJMA 2QCCA 1WXJA 1G67A 1U83A 1XI3A 2H90A 5TQLA 3P74A 3NXFA 2I14A 1GVQA 4WOQA 1ZAIA 3ABQA 3LCGA 2Y70A 2ABBA 4JTJA 5LZLA 3F03K 1EA0A 3TSDA 5F2IA 4DF1A 2FPVA 4O12A 5EPDA 3CHVA 4JX4A 4BFAA 3EWXA 1SZEA 3CB8A 3UZJA 3QMTA 1GWJA 3IGUA 4WY0F 1PL9A 5G2IA 3IGSA 1FXQA 1J4EA 5DCDA 3P61A 4AWUA 5CSRA 4M7TA 3DU0A 3HMJG 2QCDA 3O1NA 3UXDA 2E6FA 4XKYB 1QCWA 5HJLA 1PV8A 3CLMA 4ADUA 4UTUA 3HO8A 5D2WA 1LRTA 2QEZA 1WOBA 2R94A 5H2ZA 2EGZA 5HWNA 1DVJA 4JNMA 1ZFJA 2X1TA 4KFOA 4Z1BA 2G95A 2ZRUA 4GC4A 4X3ZA 3DAQA 3O6CA 3MP5A 1TV7A 4MOZA 2CLLA 4O10A 4MLRA 3F4WA 3HQ1A 1A5BA 5T26A 1H60A 3M7WA 2JKAA 4JDYA 5FF4A 4M6PA 3SECA 3LERA 1TO3A 2VXNA 3F4NA 3STGA 5EA9A 2V9DA 3W76A 3MHUA 3W7MA 3EXTA 3QW3A 1Q6QA 3PB2A 3NQ8A 2YYUA 2YW3A 4M5PA 3TQKA 4MYAA 3ELFA 2ZCGA 3WJYA 4BI7A 4A29A 3TFCA 1GVRA 3W2UA 4FHAA 2V0TA 3M16A 3C8FA 4RK8A 3HJZA 3BGJA 2EF9A 1XXXA 2ALDA 1KFBA 4MVAA 2QCDB 3EWZA 4AMAA 5E93A 3OG3A 2CZ5A 2C0AA 2E68A 4ORMA 4LVBA 3G8EA 4R33A 3TJXA 3ZR4A 5D30A 4ZQMA 3G0SA 2C1HA 3TAKA 1R2SA 2WNQA 1JRCA 4JTHA 4UTLA 2NWSA 5CPMA 2OJPA 4UCGA 1O60A 1OJXA 3TXVA 3NQVA 4EF9A 4O1DA 1F73A 2EKCA 5G4EA 4HT3A 1H7PA 3W7OA 3IV3A 5C54A 3W7NA 4WUIA 3NPUA 1QO2A 3GKFA 4QITA 1W3NA 4UTTA 1Z44A 3BG9A 3OEXA 4UMBA 2X1RA 5KSWA 1KLYA 5F4SA 2VELA 2BLEA 4JIQA 2G97A 5LKYA 2A7NA 1A5AA 1SZNA 2YDAA 4ONVA 3GDMA 3CU2A 2QCHA 4JTSA 5FEWA 1SO4A 1TJPA 5K4ZA 3BW3A 2Y89A 2RDWA 1LBMA 3T7VA 4DF0A 2B4GA 4LV9A 3NQ7A 1OFOA 3BG5A 4DXVA 1J5TA 2GJNA 3CC1A 1VYSX 3EX2A 3TC7A 4FNTA 4JTTA 2WKJA 2VKZG 1EB3A 3QFEA 3W72A 2GVJA 3DKLA 1SUXA 3VKJA 2WNNA 1KBIA 1WOAA 4M7SA 2W6RA 1UBSA 1DORA 4ZZ9A 4LW7A 4JEQA 3S9YA 3EWUA 3G1HA 3L67A 1E51A 2TMDA 3G3MA 2YCEA 4IX0A 4IXXA 1QO5A 3D0CA 1P0KA 2X1SA 3AJXA 3PG9A 5D09A 1YPIA 2RDUA 2CLEA 3BV4A 4A3UA 2V81A 4N4QA 4K6AA 3WJWA 2JK2A 2GQ8A 3HB9A 4N6EA 3C2VA 2FFCA 4HNUA 4EVZA 4N02A 2E09A 3OBKA 4GFSA 1UCWA 3ANYA 1QPOA 3TMQA 1W5MA 2FIQA 2DZVA 3PG8A 3I6RA 3R13A 3G1SA 1KM1A 2FTPA 5HWJA 4Y90A 4RZ6A 2QAFA 2RFGA 1Q6OA 1QOPA 3FYPA 1P1XA 3W74A 5BMWA 4NNCA 3P62A 5AN7A 1K7EA 1LRNA 1SPQA 2CW6A 3KXQA 3FEMA 2EPHA 4MY8A 1PVNA 3KVKA 1TRIA 5G1YA 3NVTA 3B0UX 1OYAA 4RZ5A 3TJLA 2QAPA 1W5NA 3MI6A 4K37A 4IPIA 4AWSA 3S5YA 4BWLC 1Q6LA 3HPXA 1EP1A 3HF3A 3IVSA 5CZ0A 3W1MA 5AHNA 2ATSA 2ZZ2A 4YL2A 5K9XA 3NDOA 2WSRA 1K8XA 2ZQ0A 3BO9A 3BW4A 2Y88A 2J9XA 3O16A 3UY7A 1SW3A 4ZQPA 1WBJA 4LNYA 3TROA 2B7OA 1KFLA 3GDKA 3LHZA 3QZEA 4JTIA 4LVGA 5IBXA 1VQTA 2ZA3A 1F76A 3EX1A 3KVJA 1MXSA 1J2WA 3W7KA 1B9BA 4ZQCA 2IQTA 3G1DA 1LP6A 1VLIA 3LXBA 4FNSA 3VE9A 1ADOA 3UY8A 3IVTA 3TNOA 1YLVA 4LS0A 4JS3A 4CNNA 1RR2A 4A2SA 5LNRA 3SGUA 4UTIA 4O53A 1TIMA 3EWYA 4NJHA 5AC7A 3O06A 3V1PA 1RZMA 1JCNA 4WQ6A 5AOUA 3FA5A 4DPPA 2J88A 5D32A 2WJZA 2QCGA 4CCCA 1TJRA 3IIXA 1H7WA 2QUTA 1HO4A 1VHNA 4LUJA 3C2FA 1TTQA 3P67A 3IVUA 4GXMA 4DO4A 3E0IA 4DPQA 3R2GA 1FWSA 1IF2A 1JRBA 1MEWA 2CFFA 1M7PA 4R53A 2FPTA 4TX9A 1N55A 5CPNA 3C52A 4O1BA 3I7QA 4XBSA 1FDYA 3NQ2A 1KFEA 4IOTA 2ZYFA 4IPJA 2NV2A 1YYAA 5F4XA 4Z0JA 1WDWA 3UXAA 4ALDA 1B4KA 5C5YA 2QJIA 3RF9A 4DELA 3QMSA 3G1VA 1KM6A 1K03A 2Y85A 3DZ1A 2V2HA 2YR1A 1PCWA 3C4UA 1QPQA 3QF0A 4Y9AA 3N73A 3KRZA 1P5BA 3M47A 5AHEA 4XZ9A 4AVFA 4O28A 3NQGA 1EWDA 5G5IA 3PUEA 4CNOA 3B0PA 1S5VA 1ZENA 4XWUA 1FDZA 4O1AA 1FQ0A 4ADSA 1NAL1 3NAVA 4GE8A 4X2RA 4QSHA 3LV5A 2BX7A 3OHIA 1H5YA 4EWND 3EKZA 2Z1BA 3TIMA 4M6VA 1OYCA 3UYCA 1O95A 2QJGA 2CLFA 4A22A 2H3BA 2VFHA 5AHIA 4HPXA 3NQAA 1B57A 1UASA 2GQAA 3IEBA 1OX6A 5D38A 1W37A 3DENA 1G4PA 1S5TA 4DO5A 5AHFA 3M43A 4JXCA 4FNQA 2PRHA 3WJZA 4XTDA 3NG3A 5FESA 3MP4A 3C2RA 3TDFA 3EXSA 2C6QA 5MHBA 1NEYA 4WZHA 3PVFA 1LOSA 4IMCA 4JY9A 5KTLA 1GTEA 2FQIA 2GQ9A 4DQWA 3M5ZA 4XBKA 3L5MA 2QR6A 2ZA1A 5DY3A 1FUYA 3NQMA 1SZGA 1DJQA 3STCA 1O4UA 2XN2A 3NYZA 5HR6A 1ME7A 2DP3A 3NQEA 4JICA 1FWTA 4RKAA 3MBFA 4JTKA 1IXQA 1DKWA 1HTIA 3C2EA 4L4LA 4RXFA 1PE1A 4A21A 1TV5A 4AH7A 2Y61A 4LV4A 3LX9A 2BXVA 4NJJA 3KRSA 4HHPA 2NUYA 1SU5A 3BGGA 1H7XA 2DORA 1DQWA 1O94A 2WNZA 2WV8A 3NR0A 1OFRA 1GYNA 3ABRA 5KZMA 1AG1O 4NJGA 2NX1A 4FNPA 2B7PA 2A0NA 2YPIA 5J5DA 4JTEA 5LSMA 5BMXA 3NA8A 2XFWA 3B4UA 5E0KA 3W85A 3PUOA 2E6AA 3LGEA 2B0MA 4NJIA 4WXYA 3C3NA 3QQ0A 1IIHA 3PM6A 4LTSA 4N6FA 4OT7A 1MEIA 3IIVA 2R8WA 1QPNA 3LTYA 5CPOA 1DBTA 1T99A 3M1ZA 1GVOA 3S5OA 1U5JA 1VR6A 3NL2A 3TH6A 3WJSA 5LNWA 2E5BA 1K7XA 3BLEA 2JGQA 3I68A 4XQ6A 1WYIA 4WX2A 3MI3A 5HWMA 4M6QA 4E2DA 4DBDA 1OX5A 3W70A 1F2JA 2ATMA 1G4SA 4UC5A 3SIZA 3R8RA 2E77A 3O05A 1JCMP 3WK0A 3LI1A 1YDVA 1JCLA 4TMCA 1HFBA 3PULA 3GXNA 3GVGA 4MUZA 3W6YA 5D02A 3NQCA 2CLHA 4RR4A 3L65A 3CTLA 1WQ5A 1GG1A 1X6UA 5AYXA 1WA3A 4AWTA 3UWZA 3MYPA 3C61A 3W7GA 2A6LA 5L9FA 4M19A 4U28A 1H61A 2FDSA 3STEA 3O63A 3BK0A 1I2NA 3PAJA 1YDOA 1KBJA 2TPSA 1EUNA 3W2KA 3BLFA 4W9TA 1VC4A 4S1FA 3UNDA 2ZBTA 4DEFA 2OT0A 1Y0EA 1RQHA 3LHTA 1DJNA 1TPC1 5DCBA 2C14A 3DXIA 1KTBA 4LT9A 1F74A 3BW2A 4UTJA 1I8JA 3DFPA 3WJXA 4JY8A 4IJBA 4MFEA 2JGYA 2A7PA 3BPWA 2ZTKA 5F2LA 1X1ZA 1H50A 1QPRA 5D2YA 3LM7A 2C18A 1KTNA 1BEUA 3A21A 3IRDA 2NX9A 4TO8A 2TYSA 4GUJA 3NO5A 3NPXA 1P0NA 1F6PA 4HNTA 1W8SA 1KM4A 3E49A 4UTTC 1F05A 3TQ0A 3S1VA 3S0CA 4QNWA 1CX9A 4Y6GA 2J9YA 2Y63A 2DZUA 5CZJA 2DJXA 3U8GA 4Q33A 4AHPA 3BLIA 3JRKA 3NQDA 2YFNA 5D33A 5F1VA 2A85A 1RD5A 4QIUA 4IUOA 3B05A 2VFIA 2NXGA 1W3TA 3G0UA 2Y7GA 5TBOA 4ORIA 2ZRZA 2EHHA 3DI0A 2V8ZA 3FFSA 3I65A 1EEPA 2BSLA 3LLFA 1FX6A 1Z42A 4FX6M 4MKNA 3GAYA 4JN6A 1L2UA 5G1TA 4TR9A 5LGXA 1FCQA 3GZ3A 3LLDA 4CQ8A 1L6SA 3QW4B 5CG7A 2DJLA 2D73A 3NEVA 3FIGA 1TPB1 3W7IA 3W1TA 3LCHA 3W7RA 1CW2A 1TPDA 4HPJA 4X9SA 5HR7A 3M41A 1EUAA 3CPRA 4LS2A 3P5YA 4O13A 1TPUA 4LVAA 3S5NA 3QM3A 1BWLA 2ZRXA 4IXHA 3UQNA 4FNUA 1TMHA 3QRHA 4MFDA 5KZEA 2G96A 4D2JA 1C8VA 2O7QA 2PC4A 2XN0A 5K2ZA 2E1DA 3HGRA 1LDCA 4UTKA 4I9AA 5K4XA 3O6YX 1H7RA 2DZXA 1XDMA 1RVGA 3QJAA 1VHCA 3GIYA 4FO4A 2J24A 3FLUA 3GXPA 3W7JA 2CLIA 4O19A 1LM1A 4PC8A 4UMCA 1W56A 5I3GA 3UWQA 4ML9A 4QISA 3UPWA 4LOCA 4MZ8A 3THQA 1IIGA 3G22A 1R46A 3L2IA 1LZOA 3UWUA 1OYBA 2V2CA 3M0ZA 4GUHA 4BI6A 3OVRA 2BTMA 3M5YA 3CEPA 1IXNA 3NZ1A 4GBUA 3MP3A 5F2MA 2VEKA 3MUXA 2R91A 3HG4A 1F6KA 1OFPA 1JUKA 2AQWA 3RMJA 4DO6A 3NQ6A 3S5ZA 4UTHA 1TCDA 3UD6A 4UFLA 4UTMA 4LC6A 3HG2A 1HL2A 3DHDA 4UTWA 1OFQA 3O15A 5KZDA 2YFOA 3LHVA 1ZALA 4NT0A 3ZWTA 5IBXC 4AB4A 1LROA 1YXYA 5DXXA 1JCYA 3G1FA 3W1PA 5K9DA 7TIMA 3USBA 3FYOA 1FWRA 3AO0A 3TAOA 2I9EA 1ICPA 3ZS4A 4NUWA 3W75A 3A9IA 2QUUA 4P61A 2ZZ1A 3NM1A 3EKLA 1EIXA 1G7VA 3LTPA 1GYLA 2OX1A 3PBVA 2Y6ZA 1DL3A 3NGJA 4PH6A 5F2GA 5TIMA 1KFKA 3DGRA 3PR2A 1HUVA 2Z6JA 5I3FA 5D2XA 5D2TA 3B0VC 1O5KA 1H63A 1AW2A 4MIMA 1PCKA 1FXPA 4WY0A 1OFEA 1UJPA 3HPSA 4MY9A 2R14A 1I2RA 3S1XA 1A53A 3FKRA 4HIBA 4K36A 4HSNA 1AW5A 5LNSA 1FCVA 3ATYA 4U4MA 1OFAA 2PURA 3TK7A 4N9DA 3W71A 3W1XA 3TUUA 5LHFA 4KFPA 3DFQA 3NOEA 2WO5A 1SR9A 1QOQA 1FCBA 1SZFA 4NVTA 2E5DA 3MW7A 2O7SA 3T40A 4FIRA 2A7RA 3P82A 2YSWA 1LCOA 2HS8A 3W87A 5BRBA 1T8XA 3SGZA 1D3HA 5LNUA 2FB2A 3TSMA 3GR8A 3RU6A 5EY5A 3W1LA 4QAIA 4Z1AA 3FOKA 5D37A 3A5VA 3N2MA 3N19B 4TMBA 4N9BA 5HUOA 4IMDA 3W07A 3RK8A 4K7YA 2QCFA 4K39A 3QPYA 2RHGA 4WY0B 2CZDA 1YTEA 5KMYA 1AW1A 2Y7EA 2H8ZA 4NX5A 5K3VA 3W1NA 2PRLA 2Z2UA 1NF0A 3NL5A 3W1UA 1QAPA 2YX0A 1JCXA 4Q4KA 3M44A 1K8ZA 3BG3A 1V5XA 4EF8A 4Y8FA 2J27A 2A21A 4KFNA 3GDRA 1NVMA 1JCJA 4IMEA 3DFTA 3G0XA 3L5AA 3TW7A 1KLZA 3L21A 4RJEA 3DFOA 1XCFA 3W86A 1YXCA 3LRKA 4CQ9A 1XBVA 3W7CA 1AMKA 4BWLA 3T44A 1Q3NA 2NUXA 2J6XA 3L0NA 3GB6A 1PS9A 3DI1A 1KM3A 1KM0A 2F7FA 3S1WA 1Q45A 2V5BA 3G3DA 3TU9A 3G1XA 3CIWA 4JX6A 2VC6A 3L68A 3E96A 4IQLA 1GT8A 1OX4A 2QUVA 4DBEA 4LRSA 3UWYA 4UXDA 2JBMA 5FEPA 5CPLA 2OT1A 2V2DA 1ONRA 1SQ7A 3OVQA 1KM2A 4PTNA 1TSIA 1KFJA 3WK3A 3IIOA 4UR8A 1LLWA 1MO0A 2QDGA 2B7QA 2ZA2A 1N8FA 1BWKA 2ABAA 3QEZA 3Q58A 5HINA 2WPBA 4J9JA 3LXAA 1AK5A 2GVGA 4H4IA 2X2GA 2CZFA 5AHMA 3H54A 1EP2A 1TPH1 1SSGA 3LOTA 3JR2A 1WX0A 2YGYA 4I7UA 1LOLA 5C6MA 2KZHA 4K8HA 1N7KA 3LBMA 3MBDA 1P4CA 3PBUA 5DELA 3LTSA 2VENA 4K38A 3P8IA 3CWOX 3EEGA 3O07A 4BK9A 1OX4B 3MJYA 4PCFA 4RLIA 2GVLA 3HGSA 3FJLA 3TFXA 1H51A 1GQNA 3EX3A 5A8GA 3W7DA 3W1QA 1VH7A 4R34A 5I3JA 1ML1A 1QMLA 4KKXA 4UUIA 1K3UA 4LUIA 4BF9A 4L4MA 5J5RA 2QCEA 3GAKA 3S8HA 1L6YA
chains in the Genus database with same CATH superfamily
4OWGA 4NZJA 2AAMA 2Q3OA 2GZXA 4NU7A 4M80A 3KDOA 1ADDA 3AYVA 4GHRA 4UFJA 1J11A 2HSAA 2VNCA 4L1GA 4L4PA 3MO4A 1JYNA 1V3KA 2AGKA 1TV4A 1I2QA 3O6DA 3T9PA 4JAWA 5GPRA 4GUFA 4JFSA 2VCBA 3UXLA 2E9LA 3LCIA 3AYRA 1A3WA 4MY1A 4IIEA 5DY2A 3N29A 4J28A 1FWCC 1XC4A 5E0CA 3MS8A 3A47A 2W79A 3G1YA 4GI9A 3VUPA 3VIHA 2JFEX 2E1WA 5CSSA 2Z27A 2X0YA 5BYWA 1AQMA 4AXNA 3GNPA 3AXXA 2G3MA 3W84A 1QNVA 1PKMA 4PCPA 5AHLA 2J7EA 1YDNA 2ZXAA 3HU7A 3P5ZA 1LL4A 4NIRA 3NQFA 4YLWA 3EWDA 3KBVA 1VS1A 1S39A 1VYRA 3FDKA 1V6UA 5AZ0A 2CLOA 1YBQB 2XHYA 1DJIA 1OC5A 3VKCA 3S9ZA 3PUGA 4JDBA 1XIHA 3R0DA 2YYTA 4RDZA 1PIFA 3A22A 1X7FA 4LVFA 3BANA 3USZA 5A6BD 1A50A 3WD2A 4B5SA 3RHGA 1KBLA 1FTXA 1XBXA 1S5WA 5A8MA 1EQCA 2YW4A 4YCOA 1MW0A 4MYXA 1UH2A 3MVIA 3IJ6A 1Z48A 3VC5A 3KUMA 1H1YA 2V3EA 3RX4A 3A4JA 1UUOA 3TXZA 1VFFA 1EXBA 4ERGA 3W73A 1JR1A 5G2HA 4NNBA 2GGHA 3S1UA 2OSXA 1BVWA 2F8QA 1RLDA 2Q3RA 1XIJA 4H3DA 5IM51 3WF3A 1K7FA 4V1XA 1Z32X 3SQLA 1EPXA 1S2WA 2J7HA 4PMXA 2VD8A 1B1YA 1FCUA 4WHBA 4AD4A 2CPUA 2EAWA 1AD1A 3EMQA 3UWWA 4PZVA 1CXLA 4BR1A 1O5RA 3D47A 4BI5A 3N4EA 4DJEA 4DIAA 3ZFHA 2FHBA 4Y9NA 2HNHA 2P8CA 4LS1A 1UWTA 3V0TA 1QHZA 1G7UA 5AFDA 1H1NA 2BHYA 5KITA 2NXIA 3GVVA 4LCQA 1R3VA 5DCEA 1SW0A 5A5WA 4IJCA 4PMUA 2XM2A 5EYWA 3KL0A 2ZZ7A 4GRSA 2FJUB 4AF0B 5I09A 1RHCA 1FH7A 4S2BA 5IFPA 2NQHA 1NWSA 5EFDA 2VJXA 1B3OA 4P7QA 2WMKA 5SWUA 2JKPA 1O12A 2CBVA 3M6YA 5JXQA 4PMZA 2DFAA 4R7JA 4DWSB 3ZM8A 4I6KA 2W3ZA 3BAWA 3DG7A 1WDDA 1C9DA 3PBWA 1E3ZA 1JZ8A 1MNSA 2XIBA 4F66A 2DQXA 1W3IA 3C2OA 4DHGA 3ARYA 4WOZA 3TR2A 2Z1XA 1R2RA 3NL6A 5BROA 5FF7A 1Q6RA 1D3GA 3GRIA 4LVDA 2VHLA 2J8GA 3EA3A 1FHUA 4FNRA 3QGVA 2J77A 3MV11 3L4TA 3FVMA 3GHTA 3UGRA 2XZ9A 4X22A 1JUEA 2J9ZA 1Y5VA 3VNDA 3CZKA 4MPKA 1CI1A 4NAEA 4WD0A 5C2GA 1WO2A 4LBUA 3L66A 4Y2WA 3CT2A 3MKKA 4IX2A 3UG8A 4JIRA 4R5EA 5JH1A 1X1OA 4PMJA 5U4NA 3V5FA 1TPFA 3E9AA 4NHVA 5HULA 1W3KA 3DHUA 4E4FA 3UWVA 2G5WA 5EB8A 4LY4A 1MSSA 1X39A 4UOJA 2INZA 2NT0A 3W3OA 1PKNA 3QY8A 2XFYA 3VFLA 2KAUC 3BUVA 2QPXA 1A5CA 1IXOA 3NO1A 1DJGA 4QM1A 3Q94A 1KWKA 4FIQA 1REQA 9RUBA 1CCWB 3KOFA 2OLHA 4N2YA 3R89A 3ARUA 3VD7A 2VURA 4DF2A 4LFYA 4NZ3A 1PHWA 1EX5A 3F4VA 2CBUA 1W5PA 3LDVA 4AHQA 1FWNA 3R94A 1KA9F 3NTYA 3MZ2A 5MF5A 3SCQA 2C13A 4UMAA 4O4VA 4NKCA 5FL0A 2A3CA 3FJNA 4DLFA 3JW7A 2VC7A 3MDWA 4FF7A 1LTDA 2INEA 2BZNA 4ZQNA 1QHOA 4LPCA 4RL3A 3BARA 3D6NA 1LWJA 5G4HC 4XISA 4DRSA 3LCFA 3TJ4A 1KR1A 4PTDA 3BICA 2YBVA 4KWWA 3WL0A 1TQXA 3N15A 3OA3A 2PBOA 4PL2A 4O1FA 3WQFA 3GG0A 4TVCA 3MWAA 4EAYA 4MJZA 1LBFA 1EXPA 1FHLA 1R0MA 3ARWA 1P7TA 2VGFA 3I3DA 3BLPX 1TTPA 4O8RA 3VI2A 2PDPA 1R2TA 3K46A 1HJQA 4MF4A 3CEUA 4JD4A 4IPPA 2DH3A 3EA1A 1IEVA 1D9EA 4C6JA 2A4AA 2QKFA 2D3LA 4GI4A 1YE6A 3OQ8A 4MMWA 4EIVA 2ZRVA 1WP6A 2QVHA 4POCA 1BKHA 3FX4A 5K9CA 1M53A 4DJFA 1CDGA 5XIMA 3K5XA 3VOHA 3ZIZA 4B4HA 4TXEA 2X42A 3NZPA 1O7AA 3RO6A 1NM9A 3SCSA 2BGNE 3ALFA 3K1GA 1MEHA 3ES7A 3GG7A 4HTBA 4G1KA 3DFNA 5I79A 2RDTA 3EXRA 3TV8A 5CLTA 2V6AA 1ZP4A 4ADTA 1CXKA 4S2CA 1A5NC 1F07A 2ZX8A 4HPHA 1JZ5A 1OCBA 3SCTA 3SZ8A 4WGHA 2NLIA 1XIDA 5HUPA 1MWOA 1GQIA 4CNPA 3QR3A 4UIOA 1W32A 3BAIA 1K9EA 1OM0A 4V28A 3QYSA 2P0OA 4EACA 1P6BA 3T42A 3QN3A 1H2JA 3CQIA 3WQ8A 2XZ7A 3NFUA 2FMOA 1R7AA 3S83A 5FF2A 5CZTA 4C6OA 4PTVA 4YYCA 4FZIA 2PLKA 1SO5A 3UPBA 3CZGA 5HNTA 1CLVA 1Y7VA 1Q6CA 2X30A 3WELA 3IRSA 4NZFA 4IIFA 3KX6A 5D03A 2BXZA 2YL9A 2WLZA 2CITA 2GPTA 2WSPA 1U33A 4Q7IA 3TYEA 2WZIA 2PGRA 1XUUA 4JEJA 2YCIX 1WDRA 1NFBA 4PBEA 3ZT5A 3CV2A 2OLAA 3ZVHA 1JI2A 3SY5A 1B90A 3LRLA 4DWSD 5HMFA 1XHGA 4BF5A 4BA0A 2NXHA 4G9PA 2IKJA 1D8WA 5HPOA 3SCOA 2XH0A 3ALGA 4ZE5A 5CG0A 1W9PA 2DUZA 2UZ9A 3TN3A 2DSVA 3LXCA 4PMRA 4LAOA 3H55A 2WC3A 1OBAA 4YXGA 2Y62A 2HE5A 1ME9A 3PY2A 4JR5A 1XIBA 1DOSA 2OMAA 3QPZA 1H7OA 3L5LA 4CGTA 3L4UA 3IJDA 1CLKA 2PFHA 1S1PA 3PZIA 3TTEA 1JVNA 4GQQA 5LGZA 2VCAA 3FJ6A 3N34A 4PUEA 2ACRA 3A6OA 4EPKA 3GKAA 3QV8A 1OVDA 1OHLA 3OIXA 2E6DA 4E3VA 1E6RA 4QG8A 1FWHC 1GG0A 3SW6A 3IK4A 3OGRA 3W23A 4I8DA 4FEZA 3PPCA 4Q4SA 5H8UA 2PUZA 3PJTA 1N8WA 2PWEA 3SI9A 1AJ0A 4XK2A 3YPIA 4LRTA 1HKMA 2CU0A 1NDWA 3PB0A 4PTXA 1AL7A 5IOBA 3MSRA 3GU9A 4P7OA 4DXKA 4L65A 4GVHA 1UQYA 2XIJA 3ABOA 1LBLA 1CEOA 4XZNX 4YMZA 2E0PA 4A8NA 1XLKA 4MKVA 4HJWA 2P3EA 2Q8ZA 3B8VA 2ZZ3A 3RCMA 2BP1A 4B5VA 3S4TA 3UNTA 1GOWA 3AJ7A 3W01A 5AC5A 4MJMA 2QCCA 3PWIA 1G67A 1Q6EA 3AU2A 3P14A 1XI3A 1RCXB 4Z42C 3GTHA 2H90A 3MMDA 3OIHA 3ME3A 3B97A 4FA3A 3NXFA 3ARRA 4RE3A 4E4PA 3BDKA 3LCGA 2DV0A 2Y70A 2WHKA 5F2IA 4DF1A 3L12A 8RUCA 5EPDA 2W61A 4JX4A 4BFAA 3GBDA 3QFWA 1E55A 4UR9A 1JFHA 3H26A 1KKRA 1PL9A 1MW3A 1MDRA 2FHCA 2PU0A 3IGSA 2XISA 4AWUA 4B2DA 3M7SA 4L5ZA 4HOZA 3UXDA 4XKYB 2NV9A 3AXHA 4ADUA 1UKSA 5D2WA 5H2ZA 1W6TA 3VKAA 4J3XA 4KFOA 1YNQA 2Z7KA 3BSMA 3QKZA 4HB7A 5CH9A 7ODCA 4JFWA 5C9ZA 2OEMA 6A3HA 5T26A 1H60A 3U5UA 4M6PA 2Z24A 3NJ3A 4LF2A 4ATWA 1CLXA 3CO4A 3R10A 3GD6A 1F3WA 1E0UA 3NQ8A 4REQA 4CEXC 3TQKA 1IEQA 4H83A 2X40A 2XU2A 1FFRA 1IHIA 1KCZA 4BI7A 2INFA 3EKGA 2GUBA 2Z00A 1EQPA 3LA4A 4QBXA 2PDXA 4GO9A 3GW3A 1XXXA 3V7PA 3N6QA 3UVAA 4MVAA 2QCDB 4PUUA 1CPUA 4AMAA 5E93A 1JL8A 1DIOA 2YDRA 2WMIA 2E68A 3ZR4A 3CHCA 4WSKA 2C1HA 2IUZA 4PUKA 1V0LA 4UTLA 2YDSA 3ARXA 2NWSA 2OJPA 2PDKA 1V3HA 3E1F1 3W7OA 5LXEA 4CN6A 3TNBA 3CV7A 2UBPC 3QHOA 3GKFA 4QITA 3VCNA 4UTTA 2AMXA 2VP8A 3OEXA 4QDPA 5F4SA 4S3DA 1BRLB 4G56A 4GZEA 2A7NA 1A5AA 2OWXA 2NW0A 4FLOA 4ONVA 3RIKA 3GYCA 1UKQA 5K4ZA 4IUGA 1WZLA 4Q8NA 3SADA 3T7VA 4DF0A 3AU6A 2DUAA 3BG5A 1J5TA 4XD4A 3TWBA 3NDZA 4CQCA 5ECUA 3TC7A 4ZO8A 4JTTA 1JYWA 4XIAA 3QFEA 3DKLA 1SUXA 3AS1A 3B8IA 3VKJA 1QI0A 2WNNA 3GR4A 3MJMA 4CD4A 3V0UA 2VR5A 1DJHA 4GG9A 3SEPA 3EWUA 1IV8A 4L1WA 1QWKA 1XS2A 1T40A 2G4FA 3PG9A 2X1SA 3AJXA 4C6EA 4HPNA 1RSCA 4G2DA 4WVXA 4K6AA 3HB9A 3GC2A 4FPSA 4EVZA 1FWAC 1KB3A 4GFSA 3ANYA 3TMQA 1W5MA 3E74A 3GM8A 4Z2JA 3PG8A 1TELA 4WF7A 1KM1A 3E2RA 3B9EA 2EG6A 4ZENA 3ZJ6A 2RFGA 1W9DM 4EKJA 2VQTA 3OZOA 1QOPA 2PTXA 3FYPA 1P1XA 3EB3A 2NQLA 3KBNA 4V33A 1BG9A 3P62A 1RAKA 3UJSA 4OZOA 4BEQA 1JYVA 4IHCA 3E0WA 3POCA 2P88A 3FEMA 1RXOB 2EPHA 4I9JA 4LB4A 4MY8A 4TTUA 3WL1A 2RDXA 3B0UX 4S23A 3TJLA 1W5NA 2W27A 3S5YA 4L6DA 4BWLC 3HPXA 3SAZA 5CBJA 3ECQA 3W1MA 3SCRA 2ATSA 3M0IA 3SB0A 5K9XA 3PNZA 1WZKA 4PR4A 2GLKA 1W3HA 1J6PA 3RXZA 4E2OA 2CXGA 2CHRA 4FXJA 3RPMA 1TWZA 3H70A 3KE0A 1FWDC 4YHGA 1NJJA 4H8UA 3MUIA 3TROA 2B7OA 3BOLA 3GDKA 3AMGA 4LVGA 3QZEA 3UT0A 3VK5A 4HA0A 1VQTA 2ZA3A 4D9PA 1O68A 3EX1A 3C0QA 4HK7A 1MXSA 2F38A 1IT7A 4ZQCA 3W27A 1VLIA 4S3CA 3LXBA 1ADOA 2E8YA 3TONA 3UY8A 3IVTA 2O0TA 1J12A 4NJHA 5AC7A 1RZMA 1MUWA 2E9MA 3FA5A 4DPPA 2J88A 3CQJA 2PSNA 1P0DA 2WJZA 3R8GA 2YB1A 3M0JA 2BGQA 1E4LA 1H7WA 1R9ZA 2QUTA 2OPJA 3IVUA 4GXMA 3SUUA 3R2GA 2CFFA 3N4FA 1MEWA 3N11A 2FPTA 3P0WA 3C52A 4O1BA 4D6DA 1YNYA 3I7QA 4WLCA 2XPKA 1CXIA 5BXRA 1XSJA 1V0MA 2OODA 2UWFA 2XINA 4O0QA 1YYAA 4GGBA 3I6EA 3CIVA 4QDWA 4ALDA 1B4KA 5C5YA 4H19A 3DOPA 1UPPA 4JIEA 3CUJA 3F7JA 2ZUMA 5A2CA 2Y5EA 3MC5A 4IZGA 1BFNA 3P6LA 1QPQA 3QF0A 4Y9AA 3N73A 4XD3A 4AVFA 5AHEA 3MPGA 2HE8A 1QPKA 3IK2A 3PUEA 4CNOA 3WLJA 2YIHA 1GHSA 1S5VA 2QJNA 1GONA 4O1AA 4S3AA 2J7FA 2VVSA 4GE8A 3QHNA 3LGGA 1AH0A 4EWND 3EKZA 1C8QA 2QXWA 1Q13A 3WBWA 4GIRA 4M6VA 4H9MA 4A22A 2CLFA 1B57A 2OTDA 4QXIA 3WG6A 1CB7B 3OLDA 1JZ6A 1KRAC 4FNQA 2PRHA 3VM7A 4FR1A 2L5HA 3LSBA 3WJZA 3NG3A 1ZJBA 1LQAA 4WZHA 4KT2A 3PVFA 4JY9A 5KTLA 4ML4A 4XBKA 3W37A 2V63A 2ZA1A 2G0WA 4GZIA 3M0MA 2VI0A 4CKQA 3VFCA 3KW3A 2R1NA 4OOUA 5HR6A 3HQPA 1OD8A 1F61A 3MBFA 4JTKA 5HMEA 4A21A 2Y61A 1QI2A 1WXYA 4JHZA 4HHPA 1H7XA 3M0LA 3NR0A 3VA8A 1GYNA 3K13A 5DF0A 1JNEA 3W00A 3BCDA 2A0NA 1IZCA 1KNWA 5J5DA 3PUOA 1EGVA 4NJIA 3ZSSA 3AMDA 2VCCA 4W8AA 4DJDA 4JL2A 2HCVA 1R85A 1MEIA 3IIVA 3UESA 1JZ4A 3POHA 3QHMA 4DWSC 3S5OA 1IR1A 3WNPA 3NL2A 3WJSA 1N82A 3U5YA 1E3XA 3EMZA 4XQ6A 3MI3A 4DYEA 5CC5A 3W29A 1UBPC 1OX5A 4HPGA 1HJUA 2W92A 3PJUA 5HK4A 1QI3A 2HVMA 1M7JA 4DYKA 1XG3A 7A3HA 1ODUA 4HU3A 4INFA 4A3QA 2F9RA 1V03A 1VFHA 1KXQA 4TMCA 1ZBKA 3TOYA 3P3BA 3GXNA 1U1HA 3GVGA 4B92A 2FMNA 1S38A 4C1NB 5C70A 5D02A 1DJWA 4CN4A 1CGYA 2IKHA 4RR4A 5BU6A 3PHAA 5REQB 3IANA 1UMYA 1WQ5A 1X6UA 2GSHA 2XWDA 5ABFA 1TR9A 1H61A 3UZYA 3RITA 3MKVA 3O63A 3E2QA 1I2NA 1YDOA 2ZDSA 1ZLPA 1FWIC 3W2KA 2PDUA 4S1FA 3UNDA 3U9IA 4GYJA 1E71M 1EL3A 3O0KA 3BW2A 4UTJA 1ESWA 3GTNA 3DFPA 3HURA 1VBUA 4MFEA 2V67A 3E38A 3WKZA 4C5YA 3WEOA 4Q6XA 4TO8A 2TYSA 2DT2A 4GUJA 1P0NA 1F6PA 4GKTA 3R8HA 4GVIA 1JG9A 5EGRA 1NDYA 3JUGA 2I5QA 4FLQA 3TQ0A 3PPFA 4UQ9A 1OWQA 1CX9A 4Y6GA 2Y63A 3LMZA 1JDFA 4HZ7A 2GVYA 2DZUA 2CYGA 3FGCB 3G77A 3BLIA 3JRKA 1VFTA 2YFNA 1Q7QA 1XLGA 1RD5A 4F3HA 3ZSTA 4IUOA 3B05A 2VFIA 3UG3A 1W3TA 3LD5A 1XR2A 1RD6A 2BSLA 4J3SA 3LLFA 3N17A 2A3HA 2BDQA 3EA2A 3MCMA 1HKJA 4ZOBA 5D9PA 4YVXA 3GZ3A 3LLDA 1EOMA 3SRFA 1X38A 2OO0A 3LGDA 3W7IA 1BXCA 1J2BA 4HA4A 4IP7A 3ZR5A 3W7RA 3W6LA 1YNPA 3S5NA 2ZRXA 1TMHA 4GBDA 1DPMA 4L56A 2PC4A 4C90A 3RGTA 5K2ZA 3HGRA 4QE1A 1XRSA 3O6YX 4XBJA 4ICCX 5CJ5A 4NF7A 3I3EA 2W63A 1YHTA 4BQ3A 3L4VA 1VHCA 3GIYA 2OKTA 4XSMA 3NIYA 3W7JA 2CLIA 1A5OC 3SRDA 4EXBA 4ML9A 4LOCA 3HPAA 4GYPC 3THQA 3ZJKA 2C91A 3VNIA 3BURA 3TCSA 2HRWA 3WBAA 3SQSA 3M0ZA 2WZMA 1KQYA 4GUHA 4BI6A 2BTMA 4D6FA 3FJ4A 4F4RA 2V5KA 3BLDA 2VEKA 4BS0A 5C7VA 3TYCA 2PMQA 4JOMA 2AQWA 4NYUA 4C6PA 4DO6A 3D3AA 3NQ6A 2F61A 4UTHA 2OZ8A 2WM1A 4L6OA 3DHDA 1OFQA 3O15A 1SMDA 4PTWA 3LHVA 1ZALA 4NT0A 3GC5A 3LPGA 5K9DA 2EBNA 3EPOA 1OG6A 1X97A 5CJMA 5HOSA 3W75A 1GVYA 4X9YA 3WF4A 3EKLA 2GOKA 1GVEA 5E6YA 3U4FA 2Y6ZA 1DL3A 1DEDA 3NGJA 2YB4A 1SJAA 4J3ZA 2PDMA 3A3HA 1LG1A 1S2TA 3V5CA 4RDWA 1H63A 1TJ1A 3P2VA 3HZ3A 3II1A 4URIA 4ENLA 3GY1A 4ZFMA 1D7FA 3HN3A 4PCTA 3HPSA 4MY9A 1OINA 3S1XA 1I2RA 5C71A 2X1IA 1ONWA 1BYCA 3ATYA 4AZIA 4D6JA 3SQMA 2PURA 1GEHA 4WSJA 4U5IA 1V0NA 3NOEA 4RNIA 4Q8UA 2WO5A 1SR9A 2H9AB 4NVTA 4DZIA 3T40A 2ZE3A 3WUBA 2J7BA 4IFOA 3N12A 1I0BA 2ASHA 5DFAA 3CV6A 5XIAA 3ICJA 3TSMA 5A6KA 4H04A 4XD6A 4H6RA 3VINA 4WKHA 3KL3A 4AZCB 1X7IA 2EO7A 1E15A 5FJJA 1XIGA 3GC4A 4K7YA 5CSUA 1RY8A 4IFKB 5HQMA 3U48A 1YTEA 1AW1A 1UWRA 2Y7EA 2H8ZA 4JN8A 5K3VA 2OYLA 2PRLA 4C7DA 1E56A 1L8PA 4UQDA 3ZXWA 3F4DA 5E5CA 1JPDX 1CZ1A 4S39A 1JZ2A 3GDRA 3SUSA 1JCJA 1UA3A 3WH8A 4J2PA 5AKQA 4IMEA 3O9NA 1NDZA 3DFOA 3SGGA 1YXCA 1W1IE 1PJ9A 1MW1A 2DW6A 4LYRA 3T44A 4YTRA 1WZAA 4H6EA 4KEVA 1Q3NA 2XIOA 1GQJA 2J6XA 2YL6A 3QLLA 3GB6A 3C0SA 1XLBA 2F7FA 3L68A 3E96A 4IQLA 1GT8A 3AMCA 1OZMA 1E6SM 2BVYA 4NI3A 1M01A 3ARZA 4HNLA 5CPLA 3VNMA 4K8GA 3KP0A 3DYMA 3J7HA 3W02A 4I90A 1BWKA 1H0IA 3CASA 1EJRC 3MVTA 4LEFA 4H4IA 2PF0A 4M81A 1A5MC 3CYJA 3IJ9A 2KX9A 4ZA0A 4YVPA 3LOTA 4S3JA 4JZ5A 4OUEA 1NWUA 3AZRA 4I7UA 2WWCA 2D22A 3NCOA 2YBUA 4K8HA 3BMXA 3FXGA 3LBMA 1TWDA 3MBDA 3PBUA 5DELA 4K38A 3P8IA 3EEGA 4BK9A 4PCFA 1R87A 4RLIA 3MANA 3FJLA 3TFXA 2A3EA 2XVPA 5A8GA 3W7DA 2ACQA 3W1QA 1VH7A 4R34A 1QMLA 1W9XA 4KKXA 1F6YA 4GCXA 2VR2A 3EDFA 4LUIA 4BF9A 4J5NA 2QCEA 4IP4A 3GAKA 3S8HA 1MVYA 1XPYA 1H7NA 4LF1A 2VRQA 3A3WA 2Q09A 3GXMA 3MDUA 2J8TA 4LUYA 1UUMA 4QROA 4H41A 3S42A 1TWIA 3HV8A 4KCWA 3VOFA 4QGCA 1ZHAA 4BQ4A 1L2QA 3LQLA 1X8FA 7ENLA 3BXWA 3PTDA 1A5KC 2HQAA 1E6XM 3SCNA 3O0FA 1GW1A 3C3UA 3BE7A 3GNRA 5I06A 1XLEA 3PZUA 3PUDA 3O3RA 2RGLA 5CAHA 4JFVA 4ERIA 2E6YA 3QLDA 1EWEA 3L0KA 2QGYA 3HG5A 2O55A 1B3XA 3RLUA 4DM2A 5EBUA 1JGMA 2ISSA 4J3UA 2HTMA 4UFHA 5HQEA 3M5VA 4MZYA 3TYDA 5HNRA 4NXSA 1QATA 1VIZA 1ECQA 3DBPA 3CUXA 5KINA 1LG2A 4IGMA 3KVMA 1PB0A 1J10A 5C2XA 1MFVA 2WPGA 4GQRA 1ITUA 2P53A 2PGWA 3TA9A 4MB4A 1EBHA 4QJ1A 3GH4A 3W9ZA 4NSBA 2R82A 1BF6A 2QCNA 3VZZA 3LV6A 1IGSA 3CT7A 1L8NA 3KRBA 3WDHA 1J96A 4L6HA 2VD9A 1PX3A 4J4KA 3KBWA 6XIAA 2ZRWA 4E2BA 5DLCA 1TYGA 3NZRA 5FF3A 4HMNA 2O4MA 1JQVA 1MXDA 3S2NA 4C5ZA 4IM4A 2NQ5A 3KTSA 4AX6A 3IACA 3ABSA 3TYBA 4W7VA 2IPWA 3B06A 3K30A 5FF0A 1QR7A 2Y2WA 2PWUA 3PNUA 3GR7A 1EIBA 1QTWA 3OJGA 3LENA 4V2XA 4W7UA 2VEMA 3LHYA 3R25A 1XF0A 3CIXA 4Y96A 3R6IA 1JUBA 3DECA 1GJPA 4D8AA 4XUGA 1NARA 3GXIA 3QYQA 5CBBA 4S3GA 4E38A 3CM4A 4UQCA 3FKKA 3B04A 3UZWA 2NWRA 1H0GA 1ODZA 1JF5A 2ANUA 2BY1A 3M0VA 1FY6A 3RR4A 5E70A 4I7WA 2Z4GA 3S6DA 4I9MA 3ZLGA 1FBAA 1TZZA 5DBUA 3UCQA 1V3MA 2NVAA 3VDAA 3HQOA 1HXJA 3LB0A 3MTWA 2FKPA 4GH3A 1R3TA 4YPJA 1F3TA 2Y4SA 4AXKA 1K77A 4UTWC 2A3AA 3UJEA 4AEOA 1SZRA 2FZDA 4AZBA 5B7YA 2ESCA 3P7YA 3BC9A 4LWWA 3PZNA 1JDCA 1XH0A 4OIFA 3BMVA 2G3IA 5D9OA 5I5RA 4ZVJA 4QP0A 3E02A 1OK6A 3ZLFA 4HCDA 1UMLA 2E9BA 3BJFA 1TV8A 1HJVA 5DT7A 1R5YA 3P93A 1XWYA 2PRMA 1PYFA 3G24A 2V30A 3R12A 3UP8A 4DUWA 1LORA 3O7UA 3PJWA 1HG3A 3ITGA 5A6BA 4Y8EA 4IQDA 3VNKA 3ANUA 3BZGA 5U7SA 1SSDA 1OFBA 3F1QA 2YLAA 2FTWA 4PB5A 1ZAJA 4HGXA 1KCXA 1C29A 1Q7MA 3W82A 4MLJA 2E3ZA 3A23A 4Z2LA 2NX3A 1G6CA 4JTFA 4EPBC 1E9LA 5FOOA 1BAGA 1M9HA 3WNOA 5CGQA 4AY8A 4H9XA 1TUXA 1YADA 3U6WA 3SCVA 1XLHA 4J40A 1CXHA 1NF7A 3GNOA 6ALDA 5E0FA 4O18A 4EAMA 2OVLA 1ZCOA 4JYDA 2E5CA 1HX0A 3VCRA 1NSJA 3AICA 4PB3A 1FHDA 1XYCA 2NZLA 3WMCA 4B3KA 2QF7A 5I3IA 1K6WA 4QQ3A 4F40A 4C6IA 3BZJA 3T4CA 2HK0A 3LYEA 1JGIA 4NAEB 3UG5A 1W31A 4ZQOA 3HPZA 5H91A 2DZTA 1W9VA 4S3BA 5DN1A 1C7SA 1GK8A 3QC3A 4EPDC 4RW5A 4XO7A 2F84A 4HKPA 1DHPA 4CUCA 4XTIA 2WSYA 5JH2A 3P81A 5C9RA 4G7EA 1GW9A 1JD7A 3WMSA 4WKFA 5FAGA 2FDMA 2PWDA 2OZ0A 4E0CA 5CJNA 1JJKA 3KHJA 3MYOA 2XFRA 4JTUA 2HV5A 4PMVA 1REQB 4MHBA 1U1JA 2WMFA 4LCRA 3PK7A 1YQ2A 5A8PA 1FVPA 2ZXDA 1RV8A 3UR8A 1TQJA 1W54A 1M7XA 3VM5A 1MW2A 1VJSA 1H49A 3KFTA 3GUWA 1YTDA 1IEXA 2ZUVA 4HNVA 1XPGA 3PSVA 5D05A 1K9DA 5G2WA 4JGDA 1Q6FA 4ES4A 1MQPA 4YWIA 4GMEA 3QPEA 3B3DA 4YJ5A 3LRMA 4HMDA 5JU6A 2DSKA 4ZMGA 3T6CA 1GJUA 2E8ZA 2VEIA 4C6KA 1UC4A 2XH2A 3UR2A 3UR7A 1MI3A 1TMLA 1ZL1A 1M1BA 2H3DA 4IMGA 3LPFA 2VL4A 5HPCA 1TREA 4KESA 4AUBA 4WDXA 3SBFA 2FPYA 1TB3A 2BV9A 1LQ2A 4RCXA 2W91A 4Z1CA 4RZBA 4UFKA 4C6LA 8TIMA 1PZ1A 1NWRA 2ZFAA 1MFUA 1P7TB 2FH8A 1S2AA 4A8IA 2Y8VA 1UUQA 4AC7C 4JCLA 1DWHM 2BY0A 3NSNA 2X8RA 3QV6A 1PSCA 4GUGA 5B80A 2IS7A 3TX9A 3OW1A 3PPGA 4TIMA 3PP7A 4F9JA 5F4WA 1E0TA 1VCGA 2GOUA 2XN1A 4EE9A 3LHWA 3GYEA 4OU1A 2ZDRA 3W7LA 2IQDA 5BOEA 1EF2A 4O1EA 1EP3A 1EFZA 3NPVA 2O56A 3KP1A 1VEPA 1VRDA 1JQXA 3ZWSA 5D4YA 5JUVA 4N9CA 4J3VA 5I3KA 2WW5A 3GH7A 1UKOA 4XIMA 1EBGA 4A2RA 4C6QA 3T07A 1WB0A 1VJIA 7XIMA 3GVWA 4LB3A 2V5LA 4ZB0A 4B4FA 4E8GA 2XVKA 3DFYA 3B9DA 4JYFA 2V5JA 1HF6A 1GOMA 2DT3A 1E40A 2Y8UA 3OG2A 2GGEA 1UR2A 3CB3A 3IIPA 2V38A 2QZRA 4DJED 4OVXA 1RALA 3WQEA 4DXXA 4Z0SA 3N13A 2BS9A 4FXSA 3JS3A 3QSTA 2MNRA 3OTRA 3WK2A 4Q8OA 4FOKA 3K4DA 1ZGDA 4WDUA 5FAJA 2VOMA 3PWAA 5LNVA 5FEXA 4OGZA 4RXGA 1YDYA 1EDTA 3B8UA 3STPA 2CWXA 4ZE4A 1BGAA 5F1UA 1M68A 2NUWA 3GE7A 3XISA 2B7NA 2Q71A 4ZODA 3VCCA 3H4WA 2POZA 3OPSA 3ZVHB 2ZX6A 1LYXA 3LCLA 4RDVA 4NYYA 3LI0A 4ZO9A 1NU5A 2PLJA 4MNMA 1WXZA 1Z41A 2OCZA 2CLMA 3M46A 3H7RA 4Q8TA 1YMYA 3W0KA 3PJXA 1H5VA 2I57A 4DZAA 1UWSA 4TU1A 1E72M 4HU0A 3VE7A 3VGBA 2ZKMX 2PCEA 1QDSA 4UFIA 1KKOA 2HXTA 1XGZA 1RUSA 1R86A 2DVTA 2OGYA 3KS6A 3PC0A 1HL8A 1Z3NA 1WXJA 4ZB2A 1XV8A 5FJRA 3P74A 2ZUSA 3N25A 1E9YB 2RAGA 3ABQA 4Q4RA 1LL6A 5LZLA 4JTJA 1EA0A 1A5UA 1HKWA 5I02A 3ES8A 3ARPA 4LH8A 4DB7A 2PDLA 3CHVA 4GQBA 4IG2A 2DH2A 3EWXA 5CC7A 4KCUA 2O9OA 1OSEA 2OZTA 1WKEA 4WY0F 5G2IA 4JNYA 1FXQA 1F8MA 3P61A 5CSRA 3VOGA 1F4HA 1YPXA 4M7TA 3DU0A 1DXEA 4YIWA 3CLMA 4M24A 1A3XA 1LRTA 3L4YA 3QY6A 4W93A 4NZ5A 5HWNA 4MDPA 1DVJA 4JNMA 4Z1BA 4A4AA 2G95A 2ZRUA 2YOCA 4ZB5A 4YVVA 1JXJA 1DJZA 4JQ2A 3M7WA 3AS2A 4JDYA 1JPMA 5BWFA 2W9MA 2QUNA 1QNPA 1HGWA 4QE4A 3W76A 3OBAA 3EXTA 3QW3A 3PB2A 3DEQA 1UKPA 2YW3A 4LAUA 4MYAA 3ELFA 3WY1A 1XIFA 3WJYA 2FHFA 3TFCA 3VX1A 1GVRA 3W2UA 1N2VA 2V0TA 3GS6A 1XLLA 1ISYA 4RK8A 1YIXA 1KFBA 4W8BA 3G6LA 3PZVA 1B30A 1XICA 4YN5A 4F9DA 3MWCA 3QTPA 2CZ5A 2GK1A 3ZJ7A 3TJXA 4R33A 3G8EA 1D3CA 1E0XA 4PSRA 5GNYA 3GHSA 3G0SA 3QC0A 2PWFA 3GTIA 1R2SA 3N2OA 4OTKA 4I8YA 4AW7A 4UCGA 3RR1A 3LG3A 3NQVA 4EF9A 4LBRA 3ABZA 5G4EA 4HT3A 3IV3A 4MM1A 5C54A 2XWEA 3PZ9A 4WUIA 3NPUA 3ITCA 3VKDA 1HKVA 4GA8A 4F0KA 3BG9A 4UMBA 2X1RA 4NZCA 2BLEA 3OO2A 2G97A 4REQB 4JTSA 4IIBA 2QCHA 4QDMA 1GZJA 1SO4A 2Y89A 4M8UA 3T2OA 3CUGA 4CD6A 2B4GA 3EX2A 5CGTA 3DX5A 1BLIA 1V93A 2GVJA 3VGDA 4Q4QA 3R0UA 2W6RA 3EDDA 4GO8A 4ZZ9A 4LW7A 2WMIB 3S9YA 3G1HA 2D0HA 2V3DA 1KGUA 1QO5A 1VB9A 1ZSXA 5D09A 3V0SA 2CLEA 3F2CA 2V81A 4QEEA 4QG9A 2JK2A 3C2VA 4HNUA 4ZOCA 4N02A 2XSXA 2YXOA 4KQNA 4D72A 1QPOA 2EKGA 2DZVA 3H7UA 4X0NA 5TAOA 5HWJA 2PAJA 2P0IA 1R3RA 1SMAA 4WCJA 2PA6A 3KWXA 2PEVA 2CCRA 4Q8VA 4HZ8A 4KETA 5BMWA 4D71A 1K7EA 3SUTA 1OGBA 3E5PA 3CTTA 2J62A 2HVNA 3TTYA 4RE2A 5A6TC 3KVKA 4N7QA 4GYPA 1OYAA 4US6A 9CGTA 2QAPA 1DWFM 3R11A 4ROQA 4AWSA 4OBRA 1EP1A 4IMAA 3FDGA 1F3XA 1VFMA 3E6EA 4YL2A 3WX7A 2WBKA 2VC9A 1EF3A 3BW4A 3VMOA 3O16A 3OLGA 3UY7A 1DIEA 3QOMA 1SW3A 3SRKA 1GOIA 4AZ5A 3BGAA 3VGGA 3T2QA 3MCNA 4GKLA 1B5TA 4MKSA 4QSFA 1X1NA 3W7KA 2UY5A 2VTFA 4FNSA 5GJPA 3GDBA 4PMQA 4JKKA 3URAA 4ZFCA 5HQLA 4LS0A 4JS3A 4UTIA 1HIZA 2PWVA 4A6GA 1UR1A 3JZEA 5BXTA 4HK6A 3AUOA 3QY7A 2DIJA 4OUIA 1JCNA 2G8ZA 5D32A 4LCSA 2VYOA 4E8CA 1RBOB 2QCGA 1A0EA 1UOKA 3ITYA 4U5KA 1HO4A 4DZ5A 3W81A 3P67A 4M6UA 3E0IA 4DPQA 1IF2A 4TX9A 3UA4A 2VVNA 1FWJC 1RP9A 4CU7A 2OFJA 4MADA 3VDCA 4MJ4A 3NQ2A 3DYPA 5ENLA 4IOTA 4FOUA 3T0BA 3QGKC 5BXPA 4I3GA 3K2GA 3U7VA 1A4MA 5CXPA 1O6IA 2WXDM 2CEQA 3UXAA 2DIKA 4LNCA 3FEQA 4QAWA 1A4LA 1RBAA 2WMHA 3QMSA 3G1VA 1KM6A 3DZ1A 2YR1A 2QMJA 4UBPC 2PODA 4C7FA 4GFIA 4O28A 3NQGA 1EWDA 1SVDA 3B0PA 2J7CA 1K4HA 2BOEX 1VRXA 1ZENA 1V6XA 1FDZA 1VBGA 3WYZA 1S2VA 3WQWA 4ADSA 1NAL1 1W91A 3WDRA 1PKLA 4QRNA 4IIHA 4M56A 2O9RA 4JQ1A 2XIQA 2GGJA 3LV5A 3M6DA 3OHIA 1H5YA 4EXAA 3LY0A 5LIWX 4MWAC 2YDQA 4F0SA 3UYCA 2QJGA 4HPXA 4G6CA 1UASA 4F0HA 4X63A 2OQLA 3DENA 2X7WA 3BH4A 3UF9A 1V6TA 3VIPA 1C93A 3M43A 3N1AA 2PDBA 3V5OA 1A47A 3M64A 3VOCA 1RJRA 5FESA 3MP4A 2YCLA 4YTTA 4H9YA 3EXSA 6REQA 2C6QA 5MHBA 3L5MA 3WZ0E 4IGSA 2QV4A 1FUYA 3NQMA 1SZGA 1KCKA 3STCA 1XX1A 3HFTA 2XN2A 1ME7A 3NQEA 4JICA 2C1IA 1DKWA 1HTIA 3C2EA 4ZCWA 3PTQA 1TV5A 1OC7A 4H9VA 3KCOA 3BGGA 5KEZA 1DQWA 2WNZA 3T08A 3KWSA 2WV8A 4XVDA 3CLWA 3BSHA 1AG1O 2GWNA 1XIMA 2NX1A 2B7PA 4FNPA 2D2JA 4JTEA 1O1ZA 5BMXA 2GJXA 3NA8A 2XFWA 4XZIA 1SFSA 2XVGA 4WXYA 4ECLA 3VOIA 5GQBA 2B81A 3LK6A 5DMNA 3QR1A 1IZKA 4OT7A 2R8WA 1R9XA 3LTYA 5CPOA 1DBTA 4JHMA 2EG7A 1CBGA 4DJEC 4Q8WA 1K7XA 4WX2A 5HWMA 1HN1A 4M6QA 4E2DA 1K4GA 4DBDA 2AQOA 5A1AA 4R88A 4OOZA 2AQVA 5M1TA 5A6MA 1P6WA 4Q7NA 2D69A 4JQ4A 4UC5A 2BFGA 3O05A 3WK0A 1YDVA 5CPSA 1EO5A 1ZRQA 5JIPA 4LUSA 1VFOA 1HFBA 2PD9A 2I5GA 1E1FA 4MUZA 4QJ5B 4LALA 3RX2A 3L65A 3GUGA 1PDZA 1GG1A 1R9YA 5FD0A 4XAGA 3MYPA 2CIPA 3C61A 3W7GA 1XD1A 4J3WA 4M19A 4WJ8A 3BCJA 3CUZA 3TYUA 1EJTC 2TPSA 4D6CA 4PRRA 4MDOA 2OT0A 3CHFA 2Z25A 5E9XA 5C7HA 1Y0EA 3BAKA 4PMYA 2PDIA 3FN9A 5FJUA 1TPC1 1VEMA 5DCBA 3BAXA 1GHRA 2OYMA 1F74A 3PBMA 4JY8A 4HSHA 4JIIX 2A7PA 1Q85A 1VKFA 3FCPA 1KO0A 3TYAA 3A21A 1XINA 2NX9A 4HYVA 4JTAA 1GGOA 3UZZA 2VWSA 4HNTA 1KM4A 3E49A 2CESA 3S1VA 5BRPA 4DUXA 3S0CA 2OEJA 3RO8A 2J9YA 2RUSA 5ABFB 3A64A 4DBWA 5HMDA 3RM8A 3G6MA 4AHPA 2XM1A 1E0WA 1CGVA 4QIUA 5LYRA 3G0UA 2Y7GA 2EHHA 3DI0A 4H8HA 3I65A 1EEPA 3TW9A 2PTYA 1GNXA 4GK8A 3HFYA 1I75A 4FX6M 4MKNA 3GAYA 2DZBA 4GPNA 1B3VA 3PANA 5LGXA 1FCQA 2OR2A 4QTGA 1X6LA 3NEVA 1DP0A 4GIEA 1QNSA 1UC5A 1CW2A 1VEOA 3AMKA 4X9SA 5HR7A 3M41A 4LS2A 4EX4A 2D0GA 1ZCCA 1TPUA 1TE1A 3UQNA 4FNUA 4B9ZA 3QRHA 1JPIA 4MFDA 2PZNA 4D2JA 3UGVA 1ELSA 2XN0A 3GG8A 1LDCA 1H7RA 4XAPA 3QJAA 1JDDA 1TZ7A 1UZHA 2GSEA 3RJYA 5FJIA 3LBOA 3Q4DA 4AYGA 2VX4A 3VPLA 4KERA 4PC8A 4UMCA 1W56A 5I3GA 5JMUA 2D3NA 4F2BA 4IIDA 4JKLA 1AQFA 3FVDA 1CECA 1IIGA 4MNLA 3L2IA 1FP9A 3OYXA 1TVNA 3UWUA 3FW6A 2V2CA 3OVRA 4FR6A 2FTYA 2J13A 2W62A 1FHVA 3MQTA 3NSMA 3CQHA 1HL9A 3MUXA 3HG4A 1F6KA 2F6KA 1OFPA 4GXWA 3RMJA 1C92A 2NVCA 3UD6A 3KCLA 4UFLA 3BSGA 3DGBA 1HL2A 1Q65A 4UTWA 4GC3A 5KZDA 5IBXC 1LROA 2OYKA 5DXXA 3W1PA 3QVQA 2J75A 3USBA 3EPNA 3T8QA 2WC4A 3A9IA 3WLOA 3HV9A 5IHRA 2I16A 4P61A 2OWCA 1OEPA 1G7VA 1GKPA 1G5AA 3QV7A 4GY0A 1Q2SA 4NRRA 4YWSA 4PFHA 5TIMA 1KFKA 1P48A 3PR2A 4ACZA 4XD5A 1VJZA 3PPHA 3WLKX 4AU0A 2BGSA 5I3FA 4WSHA 1T41A 3ONCA 3DG3A 1W1TA 1O5KA 2XGZA 3PBGA 4WY0A 3VD3A 1KWGA 3OYZA 1UJPA 4CQBA 3KCJA 3B40A 4U4MA 4CNSA 4HTYA 4N9DA 4Q3MA 4KFPA 3UA3A 3DFQA 2OSWA 1FCBA 1XSKA 1EOKA 2E5DA 3WQ4A 3MW7A 1JPKA 3I6TA 4FIRA 2A7RA 1LCOA 3UJ2A 3W87A 1T8XA 2OXNA 3VKBA 4O8AA 1D3HA 2E67A 2QUMA 3CZ8A 3N4AA 2V5DA 5EY5A 3FOKA 1H09A 3CZJA 3I3BA 3N19B 3W07A 4N9BA 4IMDA 4K39A 4GXPA 5JQ9A 4Y9PA 3VMNA 4HVXA 3ZYZA 5KMYA 4EK7A 1DYSA 3T1GA 4ZR8A 1MRQA 3PN8A 2Z2UA 1X98A 2XIIA 5FJPA 4H01A 1NQKA 3VNZA 4PBFA 3WH9A 2BASA 2YXXA 2OSYA 2QQ6A 4Y8FA 2J27A 5I07A 1NVMA 1R38A 2WMJA 3DFTA 3L5AA 3TW7A 3F2BA 1KLZA 3MSYA 3W86A 4M1BA 1NFGA 1SJDA 3LRKA 5DO8A 3DHPA 1JIBA 1W1VA 4LBSA 4MB5A 1KM3A 1KM0A 3S1WA 5J8LA 3G3DA 3TU9A 4AFYA 3G1XA 4JX6A 2VC6A 1FH8A 1S3TC 2O9PA 3FK4A 1Y65A 7REQA 2FVMA 4KS0A 1UWAA 5E9AA 2OT1A 1OB0A 1DXFA 2Q8XA 4I9TA 3SY1A 2V2DA 4NAFA 4QLKA 3V1HA 4W86A 2MANA 1SQ7A 4PTNA 3L4XA 3LPPA 4PN2A 4J1OA 3CAVA 3IIOA 1Q4NX 3OVGA 3CPUA 2QDGA 2ABAA 3QEZA 2AKMA 2JALA 4J9JA 4W5UA 3LXAA 3W25A 5D8WA 2X2GA 4S3EA 5AHMA 3AIQA 4Y7EA 1MUCA 1SSGA 3JR2A 2YGYA 2VDIA 2ZX9A 4PSPA 1LOLA 1W3JA 1F8IA 1P4CA 1ZZMA 3MUY1 3FA3A 3LTSA 2ZVIA 4S3KA 1KRCC 3CWOX 3CK5A 2XTKA 4PMNA 1KD0A 3WLQA 2GVLA 1K1DA 2VUYA 3EX3A 1MNZA 2WHLA 4HK5A 3JU2A 1PKYA 3EOOA 2VX6A 2I7GA 4HOWA 1GUVA 1YEYA 1QRQA 2RH9A 1CGUA 5C9XA 1R3SA 3RAOA 5I03A 1UIOA 4OV4A 4KGLA 1WV2A 1UR3M 5AECA 1M41A 2JKEA 4C6DA 4N0RA 1GOOA 5AC4A 1O5QA 3SURA 4W89A 2I1OA 5AC6A 1EH9A 1RCOB 4ASTA 2VO5A 4JIHA 1UHVA 1L9WA 3FAXA 2D2HA 1EZWA 3S46A 3APTA 1A0CA 3BVJA 4PUWA 1VLWA 2WQPA 3F5JA 4JIPA 2J4GA 1PIGA 2I56A 3L23A 1QUMA 2PBGA 1ICQA 3MB9A 4IL2A 4PBGA 2DZWA 4WEVX 2UV8G 1BVZA 2DT1A 2XH4A 2C7FA 4OE7A 3C56A 4FK9A 2O92A 3GWQA 5AC8A 2WZHA 2VZTA 2WCSA 1DXIA 5DBTA 4AZ7A 5CEWA 3AXMA 1OABA 3AC0A 3MHFA 5GJNA 3W7PA 3EOEA 3DDMA 1GPFA 3GHRA 2IMRA 1V8EA 1GPWA 1KRBC 2ZZ5A 2PDYA 3GFYA 3W7HA 4DVOA 2QCLA 4MZ1A 1XCWA 1JEZA 2J25A 2BOGX 5BWAA 3MUCA 1US0A 5FL1A 1QVBA 1UG6A 3GNNA 4RV3A 2FZNA 2VMFA 3T55A 4AD2A 4B16A 4AZ6A 1DWIM 3F4CA 3H8AA 3IUDA 3CWNA 3H4GA 3TCEA 5CC6A 5EMJA 2BY3A 3VIKA 4RX0A 2P1FA 5ABTA 1SR0A 3V36A 1GZ1A 2VFGA 3VKKA 2XVLA 3G2GA 3TA6A 4MAZA 2ZIDA 1VYPX 3WDJA 3URBA 4GD0A 3UJFA 5FJOA 3GU1A 1FKXA 4LJ3A 3THAA 4LYPA 1I4NA 1VAHA 1ITXA 2WVSA 4ZTYA 4DZHA 1ONXA 1TTJA 5C8BB 1NFPA 2AL2A 3WEZA 4GGHA 5JBDA 1R30A 3HOJA 1K70A 1M04A 3INPA 2OEKA 2IW0A 3FSUA 2WSQA 1UOZA 2DZSA 4YCPA 4IGHA 2FYMA 1XBYA 3P80A 4NXKA 1EDGA 3W7QA 3LLXA 4AMCA 2GGGA 1JULA 3DC8A 1EYWA 3MMTA 4GJJA 4US5D 1W5OA 2ODOA 2AGTA 2X16A 4HYWA 3RLVA 4GABA 2BY2A 1F7BA 1FWWA 3BV7A 1L6WA 1PHQA 4LC8A 3WK1A 3T8LA 3B4YA 1S5NA 2PDNA 1TUFA 3REQA 4HQVA 4UOQA 1CIUA 2AKZA 2TRSA 3V75A 3E12A 2Y8KA 2WOQA 3WF1A 2YXGA 1WDPA 4HHLA 2Z1VA 3N2XA 3ITVA 4AVNA 4B9YA 2ISWA 5IDIA 4G5DA 2P50A 3QOKA 4GOAA 3MI2A 1R3YA 3AMLA 3N9SA 4PODA 5BW6A 1XG4A 1QT1A 1U5VA 5ABHA 3SCPA 4O50A 1BSLA 2X0HA 2D1ZA 2XGBA 1XKYA 4LUTA 1PDYA 1Q6GA 4A8RA 1UH4A 4O17A 1J9YA 4RE4A 4ERAA 4GQ0A 2CC0A 4LY8A 4BF7A 3W2MA 1FA2A 5MKGA 1LJYA 1XL9A 4MWAE 1OFDA 5LA0A 1XD0A 2C1GA 1XLFA 2C3ZA 1Z89A 4EPEC 2WCGA 2F6XA 3AFBA 1AL8A 1VGAA 4GWEA 3HG3A 5A6JA 3DKJA 4NI8A 3M5XA 5LXXA 4UNLA 3WFLA 3W2NA 3HGJA 2VZVA 2YZRA 1UR0A 2VEFA 2VEPA 3OP2A 3RN6A 1ZJIA 2ZVRA 3R4IA 1B9ZA 4ZO7A 1O1HA 2GUUA 4D8LA 2VFEA 3HM7A 2CBIA 2H6RA 3VNLA 1J0YA 4H8VA 3WQDA 3QR0A 3CL6A 1AVAA 3IV8A 1A49A 2J7GA 3RUBL 3W7EA 1RQEA 4KWSA 4MG4A 1VPQA 3C6CA 5BCAA 3MY9A 1LT7A 1SO3A 3W88A 3AIWA 1LOQA 1T5AA 2PP0A 1DWGM 1UWQA 3TSBA 3O2LA 3LQGA 2YBTA 3VUSA 1YPFA 3NO3A 4GVGA 4EOUA 4GX8A 1JPHA 4K8EA 2XSBA 4EXQA 1UD2A 5AYYA 4JPGA 3N9KA 1K8CA 4FXRA 1XKJA 4NILA 3NL3A 6XIMA 1WPCA 3KOYA 1QWGA 5HXMA 1PIIA 4CD5A 5I7GA 1RVKA 1GEQA 3CHDA 1W1A1 3GK0A 5C2CA 4DWDA 1W8GA 2OU4A 3WBEA 5C55A 3M0HA 3PZMA 4O14A 4FX7A 1V7YA 2YL8A 1TPEA 3B9NA 3UR5A 6ENLA 3CQ0A 2GDVA 4DN1A 2CETA 1TV3A 2D2OA 4HNNA 1H11A 1Z6KA 1HZYA 3SFKA 1KCLA 2RKXA 4BKNA 1AQHA 1XQLA 2CBJA 3WLIA 3AIBA 5FEZA 3GDLA 1C9WA 4Q4OA 1HVQA 4IT1A 2X0SA 1I9CB 1F3EA 3EOLA 3IIZA 1LLOA 3MT1A 3B8DA 1DWJM 3TW6A 4H6KA 4K7VA 4O1CA 1JNDA 1MDLA 5HMSA 1TPVA 3KAOA 4G7EB 4P8UA 3QQWA 1Q5MA 1J18A 3H7VA 3PS7A 6TIMA 2BWGA 2PE4A 4JYEA 3EDEA 3CUIA 3SDOA 5KETA 3VD4A 3WMLA 4UQBA 4KEUA 1W5QA 4O0ZA 3DHFA 4P2VA 7PTDA 5AVHA 4DNMA 4B5XA 5K7JA 2D20A 2OQHA 2UY2A 5IHSA 2OGJA 4E6MA 4L4OA 4O0KA 2I5IA 3ZOAA 1JAKA 1XYZA 1LRQA 2V82A 1KM5A 1WAUA 2Z6IA 2EPNA 3DC0A 3TKFA 4N4PA 1I6NA 2HS6A 3TE9A 1IWAA 4NASA 3EBVA 3FHAA 1MZHA 3PF3A 1QU4A 2VDHA 3L9CA 3M07A 2CNCA 4Z1DA 3QH2A 5CBIA 1OCJA 4JTLA 2OOFA 3ZJ8A 1SO6A 4GUIA 2HMCA 2B31A 4PCNA 2H8XA 2A6NA 4MPQA 1DQXA 2VFFA 1UR9A 2JF7A 3AWNA 3GQYA 1O5XA 3NM3A 3UWEA 1XM3A 4O11A 4O57A 4NZ4A 4JX5A 2OOGA 3RNDA 3LHUA 2WZEA 2PDQA 2RJHA 3A4XA 1K6AA 3O6AA 1ALDA 1DV7A 4C1KA 5M17A 2C16A 3GXFA 4NX0A 4S38A 3R5EA 3ONBA 3AROA 2WVTA 5I23A 1A5SA 5AYBA 4NQ1A 1R8LA 3N3MA 2FB3A 1OGGA 4M3PA 4Q32A 1OK4A 1TX2A 3B03A 2OKOA 2GQ3A 4X61A 4LAMA 2WAGA 4L1XA 3EDKA 3A12A 2A2IA 4Z08A 4KWVA 1HQTA 5B7ZA 2FH6A 1M3UA 1V0KA 3TC3A 1QW8A 1VD6A 1J01A 3VOJA 1BGGA 1TMQA 3KL5A 5DXYA 5EKYA 3NPWA 5HBFA 4PULA 4J27A 4HD5A 1OF8A 3DH7A 3LM3A 5EMUA 1AFSA 2XG9A 3HPFA 3TN6A 2C19A 5EL1A 4GZJA 3WF2A 1LWIA 1OADA 2FGZA 3DBNA 2BHZA 2NVDA 4MWAA 2DGAA 3WUEA 4XUYA 1KGXA 2CLKA 3L2MA 2EJ1A 3A5FA 3LNMA 2Y7DA 3AWOA 1J93A 3VIGA 4G7FA 5C0QA 1ECEA 2ZOXA 1FDJA 1TIWA 1ZBCA 4HHHA 4PL1A 3I4KA 4BQ2A 4W84A 1UP3A 1JCTA 2HXUA 2R9RA 4O4WA 1C90A 3TQVA 1UD4A 4H9UA 1VPYA 3HGOA 1VFLA 4CCDA 1KV5A 3GXTA 4OQVA 3VNJA 4ZO6A 3H2EA 2Y0FA 1DIDA 3EX6A 1S3HA 2PI6A 4ZSTA 3A24A 3W2LA 2VGGA 1IXPA 4R9XA 5CKSA 2AMGA 1MQRA 2ZWYA 3M0XA 4NJKA 5D2VA 2DY3A 1JF6A 4HSOA 5AB3A 3SSZA 3K4AA 1KXHA 4J3TA 3T0DA 4IH3A 4M82A 2ZUNA 4A05A 2HISA 3BWWA 3KZSA 5FACA 1ZAIA 2V3GA 1XYMA 2HZGA 3NZGA 3TR9A 2Z2BA 3TSDA 1EJSC 2VRKA 3COTA 2FPVA 4O12A 1RJQA 1LL7A 4LGXA 4X2PA 3Q65A 2DIEA 4U33A 1SZEA 3SN4A 3QMTA 1DTUA 4TOQA 4F79A 2ADAA 3S3GA 1GWJA 1H41A 3IGUA 3LN3A 4L9XA 1J4EA 1KFWA 2E6FA 2GGIA 5HJLA 3R1ZA 3HO8A 2O9TA 2QEZA 2R94A 1Y5WA 2EGZA 1FWEC 3D3FA 3T0AA 1ZFJA 2X1TA 4CCZA 3NEHA 2VT0A 4GC4A 2C79A 3DAQA 4X3ZA 4R7WA 3MP5A 1TV7A 2WJEA 4MOZA 4MLRA 1ISWA 3F4WA 4LQ1A 2WC7A 2JKAA 3W53A 3GFZA 3CO8A 1S2UA 1TO3A 1E1CA 3LERA 3STGA 3MHUA 1AODA 4KBXA 2CKRA 4WRHA 3N6HA 3U2EA 2YYUA 3EB4A 2O4QA 4IG2B 1V08A 2NQJA 3OZMA 4A29A 3S47A 1VFSA 3M16A 1MYRA 4AEFA 2BODX 2YZ5A 3BGJA 2ALDA 2PS2A 3EWZA 1NOUA 1KGWA 3ZQ9A 2GJRA 3OG3A 3OLIA 1PBGA 5T91A 3IJLA 4LVBA 4U2YA 3MSGA 3D46A 2DT0A 3OZPA 5CQ1A 3UG4A 1GORA 3W24A 1KQZA 3WQ5A 2WNQA 1JRCA 1LUCA 4JTHA 1V6WA 1OJXA 3H24A 1KXVA 4O1DA 1EKOA 4HNCA 1H7PA 1QO2A 4LYQA 1W3NA 4MAVA 5KSWA 4ILSA 1Q66A 2PLMA 2Y24A 2PGFA 1TZ9A 2YDAA 1KRMA 3GDMA 3CU2A 1B0IA 1QNRA 1TJPA 2RDWA 1LBMA 4LV9A 3NQ7A 2GJNA 3CC1A 1VYSX 2WQDA 4YNGA 2VKZG 2YKKA 2PTDA 5IFTA 4F0RA 3BTNA 1KBIA 4M7SA 1UBSA 2PC8A 1DORA 2GK1B 2QS8A 3FY1A 4D8ZA 3U57A 3L67A 1E51A 2TMDA