1K8YA

Crystal structure of the tryptophan synthase beta-ser178pro mutant complexed with d,l-alpha-glycerol-3-phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
255
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta Ser178--> Pro mutant of tryptophan synthase. A "knock-out" allosteric enzyme.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 95
structure length 255
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2001-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1k8yA00
1KFCA 1H51A 4AEOA 3EWWA 1O5KA 5DXXA 1OFDA 1ICQA 3WJWA 1YXDA 2FFCA 4CQ9A 2ZDRA 3BARA 5D04C 3T7VA 3W7CA 1UUMA 3N19B 3LXBA 3RFAA 5J5DA 4JEQA 4UFLA 3LBMA 1WOAA 3P5YA 4HSOA 3WJSA 3FIGA 3NL6A 1KTCA 5HQEA 2Y89A 2CLKA 4JTFA 1OK6A 3TSBA 3ZR4A 2WOQA 1J2WA 3CB8A 3PSVA 3W7RA 2NUWA 2VFEA 3GZ3A 1OVDA 1AW1A 4M5PA 4H4IA 3B06A 4MPQA 1FX6A 3UWZA 2J9XA 3TCEA 3E96A 4BWLC 4DF2A 4XKYB 5AC6A 3ATYA 1TPH1 2B7OA 3C2RA 3C61A 3LGEA 3TQVA 1OHLA 2VEPA 3P60A 4LVGA 4WOZA 4YLWA 4N9EA 3CPRA 1OJXA 1SPQA 3MP4A 4A21A 4NZFA 3W2JA 3W7DA 1LRNA 1GZGA 4NXKA 2DORA 3W87A 1VQTA 3QM3A 3VFLA 3W7QA 3NAVA 4AH7A 4E2DA 1K7FA 3LXCA 3NPWA 2CLIA 3NPVA 3Q94A 2OX1A 5FI8A 3PB2A 3DI0A 2X30A 4GWEA 3L0GA 2R91A 1H7RA 4KFOA 1QO5A 2VFHA 3NQMA 3NOEA 3EEGA 1GT8A 1SO5A 3NM3A 3PF3A 1ZENA 1W37A 1XKYA 4EF8A 2C1HA 3LX9A 3W7KA 3LCXA 1WQ5A 3EX1A 3S1XA 2VXNA 5CZSA 1TRDA 2QCCA 2TPSA 1KM5A 1FDYA 1G7VA 2Y6ZA 1UB3A 1R2RA 4FNRA 2CLFA 1BWLA 5HNRA 3DAQA 1O94A 4ZMGA 3MUXA 4UMBA 2E6YA 1D3GA 4BR1A 4JS3A 1VLWA 3C2OA 2QJHA 2H90A 3SZ8A 4FNSA 2QR6A 2ZYFA 3FOKA 4WXZA 4O4WA 3EXTA 2YZRA 4ZVJA 1B3OA 1VR6A 5AHEA 2I14A 5HWNA 4Z1CA 1W3NA 5AN7A 5FF2A 1SUXA 1FBAA 4M7TA 2E68A 5HUPA 3UY7A 1FDJA 4TMBA 4MLRA 3DFTA 1PE1A 3LCHA 3FYPA 4D2JA 3IIPA 4POCA 3ABSA 3MMTA 1LBMA 1XBZA 2QCHA 1JQXA 4FO4A 5TQLA 5AFDA 4OV9A 4O1CA 3E02A 3L65A 3N3MA 3LTPA 1YTDA 4XUGA 2VOMA 4K7YA 1FY6A 2BXVA 5K3VA 3FYOA 1QWGA 1JCMP 3G1SA 2QDHA 4LS2A 1C8VA 4UIOA 1JRCA 2E77A 2J88A 4RZ5A 3LHZA 3TC7A 5DY3A 4KFPA 3SSJA 1JJKA 3TJLA 1Q6OA 5D38A 4X22A 3TIMA 2DZXA 2CLHA 3KOFA 3M41A 1EP3A 4JX4A 1ME7A 5D02A 4XWUA 3SECA 2NX1A 3QW4B 2R94A 3N2XA 1IGSA 2ABAA 1SFLA 3H54A 1C29A 2ZRUA 2P0OA 1H7WA 4FEZA 2ZTJA 4RCXA 4WY0F 3LRLA 2VEIA 4K38A 1XI3A 2C16A 2VKZG 2ZRYA 3TW7A 2G95A 1G6CA 2V2HA 3M16A 1L6SA 4JTGA 1H7NA 3IIOA 2QUUA 1PVNA 4JTLA 3UYCA 1H7XA 1TJPA 2CFFA 2BX7A 4JY8A 4JTUA 3MHFA 4CLMA 3T4CA 2ATMA 3GNDA 1DJQA 1QMLA 3UZ5A 1KLYA 3NGJA 1IXPA 1FDZA 3I68A 3S9YA 3CIWA 4Z0SA 2Q8LA 4O53A 4KWVA 2JKEA 1KM0A 1Q6LA 2YDAA 2CZDA 4IX2A 4I9AA 4O1BA 4KWWA 1KTNA 1OFQA 1CX9A 3G0XA 2ZCGA 4DELA 4JX6A 1RQEA 1YTKA 3PVFA 5K9DA 2ZRWA 5C55A 4LY8A 2OT1A 1E51A 1G4TA 1SO6A 3L9CA 1BTMA 4XBKA 2X2GA 4K36A 1Y0EA 3W1UA 2NV1A 2C18A 3EXSA 5G2WA 3GAYA 4UFIA 4BI6A 1LOQA 1SW3A 5D2WA 3RK8A 5BRBA 4UTMA 3W86A 3OVPA 5EPDA 2F7FA 3M5VA 2V8ZA 1T8XA 3CWOX 1WBJA 1XXXA 1TQXA 2Y7GA 4AMAA 1L6YA 5U4NA 3CQ0A 1QPQA 1TREA 4TR9A 4PCFA 3KXQA 1KFLA 4UCGA 4X2RA 3W7MA 5D05A 3M7WA 3PAJA 2GJLA 3IV3A 1W5QA 2CLMA 1OYAA 1EUNA 1WXJA 5DCBA 4Y8FA 4IPIA 4O15A 2H6RA 1U83A 4XBSA 2V82A 3P62A 6ALDA 3WK3A 3KVKA 4GUFA 2HTMA 1C9DA 4JGDA 3W7OA 5K9CA 2TRSA 4HNUA 1UCWA 4UFKA 1BWKA 2YXGA 2QKFA 4JTKA 3A24A 2G97A 1GEQA 1NF7A 1VS1A 3DFQA 4LTSA 1H7OA 4RLIA 3Q58A 1N7KA 3NQVA 4OGZA 1OYCA 2AQWA 3L5AA 1GQNA 3U2OA 4Z0JA 4UTHA 3DENA 2I1OA 3VNDA 3EX3A 2UV8G 2ZZ5A 3PG9A 5AHMA 1I8JA 3I7RA 1KW1A 1SU5A 5CSRA 4UMCA 3KVMA 4GE8A 3ABQA 1HO4A 1PL9A 1QR7A 3B4UA 4DO5A 1EP2A 3G1FA 5DBUA 4E0CA 3NQ8A 3LHVA 3W85A 1SW7A 4ORIA 3MI3A 2A4AA 1GTEA 5CPOA 4UNLA 2BLEA 2Z2UA 4A2SA 2VFFA 3L0NA 1YDVA 3N14A 2QJIA 3PWAA 3BW2A 1X7FA 3PS7A 3QEZA 1DJNA 1KBIA 3W83A 5KSWA 1L9WA 1ZAIA 1TIMA 1XDLA 4WUIA 1HUVA 1VHNA 5K7JA 1JCYA 3HJZA 2ZZ7A 1F73A 3IIVA 1P1XA 3TX9A 3DHFA 3G0UA 1S3HA 3RU6A 3THAA 1J5TA 1FCQA 3UNDA 2VFIA 1QOQA 5DXYA 3M44A 1B57A 4K7VA 4O16A 4IJBA 2OMAA 5F2LA 4IQLA 3NO5A 3I65A 4JDYA 1H50A 1Z42A 1EA0A 4WQ6A 3WFAA 4EIVA 2J27A 5LNRA 2NXIA 4LC8A 3PR2A 5D2YA 3NZ1A 3WJZA 3CEPA 1XUZA 2X16A 2NWSA 4O18A 4TO8A 3R5EA 4WOQA 3NPUA 3M43A 1TQJA 4MYXA 3DXIA 4MLJA 3IRDA 5CZTA 1WOBA 2FTPA 4UTJA 1HTIA 3LI1A 2BSLA 5EA9A 5I3FA 3NL5A 5G2HA 3GB6A 3GKAA 4L4LA 5I3JA 2QCLA 1PCKA 3KVLA 1KFEA 2NXGA 3KRZA 5D2VA 4MZ1A 4JTIA 3HBLA 4O50A 1W56A 4QAIA 1IXOA 4UMAA 4WJEA 5GVJA 1GOXA 3P8IA 1SSGA 2QCDA 1LRQA 2X1RA 4O0ZA 1ZCOA 1XC4A 2GOUA 4IWWA 2GPTA 5G2IA 3DKLA 1G7UA 4W9TA 2Q8ZA 4YXGA 4UTTA 4A22A 1LZOA 1DL3A 4UTIA 4FHAA 4ADSA 4WX2A 1FQ0A 2R8WA 3S5OA 4AHOA 2YX0A 3IVTA 4TMCA 1HL2A 1UJPA 1VC4A 3HIJA 1EWEA 3Q2DA 1JCJA 3MI6A 2PE4A 3B0PA 1LOSA 2ZZ6A 1L2UA 3HQ1A 3P8JA 2DZPA 1EPXA 4P2VA 4L4MA 3PY2A 5D2TA 3N9SA 2WKJA 4DPQA 1G4SA 3HB9A 1VCVA 1GVRA 4XTDA 2FQIA 3L67A 1PHWA 2QCDB 2W6RA 4OHQA 4ZQPA 3KRSA 5TBOA 2Q3OA 3RLVA 1ICSA 1EX5A 4DF1A 3Q37A 1GG0A 1IIGA 7TIMA 3SW6A 3TC6A 3G1HA 4LV9A 3F03K 4I7VA 5IBXC 2DJXA 3PUDA 5LNVA 5AYYA 1KM1A 1H1ZA 2HSAA 2CLEA 3TR2A 4FX6M 4R53A 4KFNA 1KM6A 3ABRA 1QOPA 3O6CA 4XTIA 1H61A 3GNNA 4Z1AA 3W7GA 2XN2A 2RDTA 1R46A 2Y88A 1ZHAA 1VHCA 5FF0A 5LHEA 3BLIA 1PCWA 4JYEA 1JCNA 1OFAA 1M7OA 3O8AA 1SO4A 1QCWA 4TIMA 3I6RA 4IPJA 4N4PA 3EWYA 1RZMA 2RHGA 5EBUA 1OK4A 1DKWA 4HT3A 3ZWTA 4GRSA 4ADUA 3CC1A 1F76A 3QQ0A 4AF0B 3OVQA 4HPXA 5HWMA 1NSJA 2D73A 1F2JA 3ATZA 3N9RA 3QSRA 2F84A 1TTPA 4EOUA 3W23A 1JUBA 1T96A 2YW3A 4OWGA 4BI5A 4ADTA 1BEUA 4Q4KA 5CZ0A 3S5ZA 2ZA2A 3CWNA 3DFNA 1X6UA 1K03A 3GAKA 5D30A 3TNOA 4O57A 4CCDA 4EVZA 3G0SA 5EL1A 3NDOA 3TDFA 3STGA 5DCEA 3HG2A 5G5IA 4IXHA 3G1XA 2Y7FA 3MHGA 3EX4A 3TH6A 3MHUA 1A5BA 1ME8A 3NL2A 3W1QA 4NJGA 4Y96A 3LCFA 3LM7A 3I7QA 4IMDA 1K3UA 4MZYA 4JTHA 1MO0A 3BK0A 1TYGA 3BLFA 2E5DA 2C6QA 3WK1A 3NQEA 4O11A 1TSIA 1Z44A 1SQ7A 2VEMA 2RH9A 3BG9A 4IOTA 3W7JA 1XCFA 4AB4A 1OX4A 4EF9A 3RLUA 1EB3A 4RJEA 1DQWA 1H5YA 3BPWA 3UPBA 1TPFA 1FWTA 1KM2A 3EB2A 4GJ1A 1TJRA 5KINA 2DJLA 5D2XA 1SSDA 2DZVA 1H62A 2GQAA 2CLOA 1QPRA 2VENA 4DO4A 3INPA 4JX5A 3LTSA 1I45A 2QUTA 3F1QA 1F6PA 3W7NA 2P10A 5I3HA 3W71A 1VJIA 2EHHA 4JIQA 1F7BA 3TJXA 5AHFA 3SR7A 5EKYA 1FUYA 2A6LA 3BGGA 4O12A 5MHBA 3DZ1A 1XFBA 1JRBA 1ALDA 2V30A 5C5YA 1TRIA 4IMGA 3NQDA 4QJ1A 1OABA 3M9YA 3IIZA 4HKPA 3UZJA 4O13A 3NQGA 1NEYA 4RKAA 4ONVA 3PB0A 3O05A 3BGJA 2DZSA 3TXVA 3W2UA 4PA8A 2C15A 1W3IA 1RPXA 1SZFA 5IM51 3QMSA 3R8RA 3ANYA 1QDSA 4JN6A 3MYOA 3OG3A 2QAFA 2H8ZA 4OE7A 2ZRXA 4FIQA 1UASA 1TPWA 4LV4A 1TTIA 1TV8A 4S1FA 5F2MA 4YCOA 3N34A 5C2XA 2JGQA 2ISWA 4ZQMA 1QPOA 4IXXA 3DHDA 1H1YA 1V7YA 4N4QA 1UUOA 3LERA 4O10A 4QIUA 2CZEA 2CWNA 1K8XA 1I2OA 2XFWA 3FKRA 1I2QA 2QF7A 3QQ1A 5FF4A 4UR7A 3PM6A 5HINA 4C1KA 3UY8A 3EXRA 4IGHA 1FWNA 3QF0A 5E93A 4FXSA 2ZQ0A 2E5BA 3TUUA 1TMHA 2NX3A 1F5ZA 2QCFA 3W7IA 3HPSA 3TROA 4RZ4A 5DBTA 4Z1BA 1TTJA 2C3ZA 5F1VA 3NL3A 2V5BA 3UXDA 5FEWA 2YSWA 4JYDA 3G3MA 3OHIA 4MJMA 5K2ZA 4R7JA 5SWUA 3LLDA 3QW3A 4LVDA 1NAL1 2TSYA 2QEZA 1GVSA 3UWVA 3G8RA 4A29A 3V1PA 1JCXA 2O7SA 1RVGA 2ZZ2A 3B05A 2FIQA 2GVJA 3UWWA 3S1UA 4QNWA 1QNVA 1P0KA 2YCEA 3HGRA 2A1YA 1FWSA 1GTHA 2WJZA 3H53A 5CPNA 1WX0A 1CW2A 4WD0A 3B03A 5L6UA 1LLZA 3LDVA 3GXTA 3TXZA 4Y90A 1Q45A 3SI9A 4M6PA 3GVGA 2GVGA 5K4ZA 3W9ZA 1XBYA 4GUHA 3EX2A 2NX9A 3TQ0A 4GC4A 4O17A 3LCLA 3BG5A 4MYAA 4PL1A 4DPPA 1JUEA 4ZQNA 3IVSA 2ZBTA 1Z41A 1LOLA 3HO8A 4XQ6A 3DI1A 3VKJA 2P1FA 2EKCA 3EWUA 2C0AA 5FEPA 4ZZ9A 1KFBA 2OZ0A 4DBDA 3LHUA 2BWGA 2BTMA 2WQPA 3W2LA 1P4CA 2YW4A 3TAKA 3P81A 2RFGA 3PG8A 3QMTA 4MVAA 1I2NA 4UFHA 4S2BA 4GFSA 5F2IA 2NWRA 4MIMA 2QUVA 4WZHA 1KFKA 1AMKA 4QITA 3S5YA 3CU2A 1GVQA 2A2IA 1KV5A 2EGZA 5D37A 1GYNA 2C13A 5BOOA 4QNEA 3VE9A 4QQ3A 1MEHA 1RV8A 4HHPA 5IBXA 4C1LA 3USBA 3NQFA 4NJJA 4YL2A 2A85A 3W3OA 2FPTA 3LCIA 4UR8A 1FWRA 3HF3A 3QMRA 3W7PA 4ZQOA 4JD4A 3W07A 2X1TA 3STCA 1VYSX 3EWXA 1YXCA 3MP3A 2B7QA 3W7LA 3CEUA 3P82A 3KHJA 3TFCA 5FEXA 3PBWA 5E0KA 3HMJG 3GDMA 3GLCA 3LHTA 1SZEA 3S6DA 3S1VA 2J6XA 4GUIA 2ZA3A 4LVAA 1XBXA 4NNCA 1TPB1 3NZRA 3QC3A 3M6YA 1ZY9A 3SJ3A 1EUAA 2PURA 1Q3NA 3PUOA 4UXDA 1FCVA 1G4EA 2Y63A 3W70A 3MP5A 3C3NA 3W88A 4XKYA 5A8GA 1R2TA 4JDBA 5HJLA 2FPVA 1DORA 3M47A 4AHPA 3W2KA 3KAOA 4JIPA 4LVFA 3LHYA 3OA3A 3R13A 3S1WA 3UWUA 1S5VA 1O60A 2AGKA 5A5WA 4QISA 4TX9A 3W2MA 3DU0A 1F6KA 3VE7A 2H3BA 5LSMA 3MBFA 1QFEA 5T26A 4LC6A 1AG1O 4FNPA 4PL2A 3EKLA 1EEPA 4R33A 1X1OA 3QZEA 1ML1A 2PRHA 1WA3A 5HR7A 1H60A 3KVJA 4UTTC 1JULA 3UQNA 1ZAJA 5I3KA 4M7SA 3DKJA 4I7WA 4CCCA 3HGOA 4O52A 4S2CA 3LCWA 4MFDA 1LLWA 3CIXA 3C4UA 1LP6A 1LBLA 3A23A 4X3ZA 3NM1A 2HMCA 3GXPA 3EKZA 4PTNA 2AAMA 2JBMA 3PUEA 1LCOA 4UFMA 3E9AA 1LDCA 3EX6A 3LOTA 4GNJA 4K37A 5HMSA 1G4PA 3P80A 4FNTA 3RNDA 1D3HA 2E6AA 2WSQA 2VFDA 3LHWA 1M5WA 5J5RA 1P5BA 2RDWA 4PEKA 4BFAA 3VI2A 4NXSA 4BI7A 1N55A 3P74A 2Z1BA 5D32A 5AYXA 2OT0A 2Y7EA 1GVFA 2FLIA 1RQHA 1G69A 4E38A 1KBJA 4ZQRA 4YMZA 3O1NA 4OBTA 3TMQA 4O1DA 3PSWA 2QDGA 4UTWC 3G18A 3DBPA 4ZQCA 4AWSA 3JR2A 4YWIA 4O54A 4AHQA 1V5XA 2J24A 3HGJA 2E6DA 1NVMA 1X8FA 1AL7A 3W75A 2ZRZA 4E2BA 1A53A 4UUIA 1OG0A 3MWAA 3WJYA 1F74A 1DVJA 1KM4A 3P7YA 4NVTA 3QSTA 3R2GA 4N6EA 4RK8A 1FCBA 4LW7A 4QM1A 3QJAA 3G1AA 1H7PA 5KITA 2ZFAA 2VEKA 4WY0A 2Z6JA 2Y61A 3MBDA 1O5XA 3NXFA 1Q6QA 3WJXA 1YTEA 5K4XA 3DFOA 3SIZA 2E6FA 3SGUA 1W8SA 2A7PA 3QPYA 1PV8A 5CSSA 1K7EA 1TPC1 4K8EA 3GIYA 5CKSA 4MZ8A 5HULA 2YGYA 2NZLA 1AL8A 5KMYA 3C8FA 1YDOA 4X9SA 5LNUA 1VGAA 4NJHA 3GDLA 3OBKA 1IXQA 3FJ6A 2C14A 5CPMA 2OJPA 1TTQA 3ABOA 4JNMA 4BK9A 4CNNA 1RD5A 2V2CA 4DBEA 3LRMA 2H3DA 3O16A 3FFSA 5ABTA 1VLIA 3E12A 3AJXA 4A3UA 4N2YA 2H8XA 1FWWA 1PIIA 4IMEA 3V75A 3GR7A 3O6DA 2QCEA 3P67A 4GUJA 3BLEA 3U6WA 3PBUA 4MJZA 5U7SA 4GBUA 2C19A 4JR5A 4MFEA 3LLFA 5AHNA 1A50A 3CHVA 4LNYA 3TMLA 3IGUA 1NF0A 2Z6IA 5LHFA 5D09A 4FX8A 4GXMA 4AVFA 5KZEA 4HIBA 5FEZA 3TSMA 1L6WA 5H2ZA 1EWDA 4FXRA 1R2SA 3W1RA 4FB7A 1W54A 1HO1A 2WV8A 2J9YA 3B0VC 3W7HA 2V2DA 1EP1A 2ZZ3A 1JR1A 4UNKA 4Q33A 5CPLA 3GR8A 3WK0A 5AC8A 2NXHA 3JS3A 5AHIA 3DGRA 1HG3A 2W79A 5G1YA 1VYPX 6TIMA 2QCGA 5C6MA 1T99A 2CW6A 1ONRA 4PC8A 3BW3A 3W1AA 2JKAA 1M7PA 3P61A 5AYZA 3B0UX 1ZALA 5LNWA 4MKNA 1YXYA 4CCEA 4OU1A 3T55A 2YPIA 5KTLA 1YLVA 1KFJA 1GVOA 1WYIA 3HG5A 2WO5A 2GQ8A 2WNNA 2FB2A 1O95A 1U5JA 3I7SA 3LV6A 3QRHA 3WK2A 3TU9A 1SO3A 3C52A 5FF7A 3STFA 2DZUA 4LUJA 3A22A 5FF3A 1Q6RA 1W3TA 1OFBA 3PBYA 4RXGA 2A6NA 2WNQA 3IGXA 3P84A 4N9CA 3NYZA 1YADA 3UXAA 4NU7A 2ZRVA 3HPZA 3A9IA 2BZNA 2V81A 2Z0IA 3L66A 1OF8A 1J4EA 2GJNA 4U28A 4IUOA 3N73A 4U4MA 1IF2A 3NQ2A 5LZLA 1MXSA 1OFPA 2QJGA 2B7PA 2FB3A 4EWND 2CLLA 3GDKA 2TYSA 2WSRA 3F4NA 2Y62A 1ADOA 1W5OA 4NQ1A 2V9DA 3T44A 5HWJA 4RXFA 3O6YX 3W73A 1BKSA 3D0CA 1PS9A 1M6JA 3G24A 3A5VA 3N2MA 3M5YA 1LM1A 1K8YA 4MY8A 1OFEA 4ML9A 3ZS4A 3O07A 4OT7A 3S0CA 3GXNA 3O15A 1FCUA 1OFOA 3O06A 1ZFJA 1AW2A 2PC4A 1CI1A 2PRLA 3BV4A 3H55A 3CLMA 1VH7A 4ICNA 1MZHA 3L0KA 3UWYA 1LTDA 4ZL1A 2LLEA 2G96A 3HG4A 2PCQA 2ZTKA 2DU2A 2I9EA 2RDUA 1KLZA 5EMUA 4JTEA 4K39A 4LVBA 3IVUA 4IX0A 2DZWA 1D9EA 3KX6A 5LKYA 5F2GA 3PULA 4Y9AA 3O63A 4CNPA 3IGSA 4N6FA 3DH7A 3BW4A 1DV7A 1SZNA 1DOSA 1TPUA 4DQWA 4K8HA 4LUIA 4MOZA 4NNBA 3MYPA 3STEA 1DHPA 1W0MA 3C2EA 3G1YA 4K6AA 3NR0A 5LGXA 3NVTA 2E1DA 1XUUA 5DCDA 1IXNA 2VELA 4LT9A 3S5NA 4DEFA 2CZ5A 2Q3RA 4Y6GA 5AOUA 2EAWA 2E09A 2NV2A 2V5LA 3QH2A 3NEVA 4MY1A 2A7NA 2EF9A 2Y70A 1SZGA 4AF0A 1LROA 5D03A 3R12A 1VRDA 4I7UA 3E0IA 1VPXA 3IIXA 4UTLA 1R30A 4AAJA 1GG1A 3W1NA 1N8FA 4UFJA 5F4WA 3U8GA 4CNOA 4NJKA 3TK7A 3UD6A 1I2RA 3LXAA 2VC6A 2WNZA 4OV4A 4CQAA 3RF9A 1PHQA 1SFJA 2NLIA 3C6CA 3GDTA 2HS6A 3NPXA 3EWZA 1WDWA 1W5NA 2IQTA 3SFKA 3E49A 3YPIA 3C0JA 2R14A 3FA5A 5LGZA 4DO6A 3A5FA 5AC7A 4FNQA 3OVRA 5CGQA 1OX4B 2B4GA 3W1MA 4HNTA 1GJPA 2CZFA 3QYQA 3L68A 1Z48A 4LS0A 2G5WA 2KZHA 1YYAA 3F4WA 2B0MA 2YR1A 1H63A 4YCPA 1DBTA 3UPWA 3C2VA 1ZJIA 5LNSA 4NZJA 4FF7A 3M0ZA 1VYRA 3NQ6A 4P61A 4A2RA 1B9BA 4RX0A 4UC5A 3BVJA 1NFBA 3VCRA 3CTLA 1KM3A 4JXCA 2CU0A 3W1TA 1I4NA 3GK0A 4FX7A 4O8RA 1B4EA 1X1ZA 3C56A 5G4WA 3B8DA 1MEWA 4RZ6A 2XN0A 3QPZA 4M6VA 2WPBA 3AO0A 2YFNA 3FLUA 4LWWA 3W22A 1RQBA 3SY5A 1MEIA 4HN4A 4ALDA 1W1ZA 1JQVA 1ZNNA 3FS2A 4DF0A 3FEMA 3S8HA 3TSDA 1LORA 5BNKA 1QO2A 3TAOA 1GPWA 5C54A 4AWTA 3NA8A 1LBFA 1W5PA 1EIXA 4JY9A 3LB0A 3FKKA 4NX5A 2JKPA 1VZWA 4NX0A 5G1TA 4BF9A 5I3GA 3ZWSA 3W1XA 4MUZA 3HPXA 2Y7DA 4Q32A 2X1SA 1JVNA 5EYWA 4N02A 1JCLA 1VCGA 4O28A 1XBVA 3CT7A 2W0UA 5EY5A 3OIXA 1A5CA 2ATSA 5FESA 4GUGA 4LS1A 1KV8A 4HPJA 1TPVA 3ZFHA 5L9FA 2GVLA 4TU1A 3LCGA 2WSYA 4HSNA 5AB3A 1JUKA 1F05A 3HG3A 2J9ZA 3NQAA 2Y85A 3M5ZA 4UTWA 4LU0A 3OEXA 1LYXA 2DZTA 2ABBA 4FNUA 3SGZA 5TIMA 1A5AA 4FIRA 1SR9A 3CM4A 4H6KA 3G1VA 1THFD 5H91A 1OYBA 4N9BA 3GDRA 2V0TA 3TKFA 5HR6A 4NNAA 1TV7A 2JGYA 3JRKA 3THQA 4N9DA 1R47A 3W84A 3W1LA 4BWLA 1O4UA 2A5HA 2FJKA 4Z08A 2HS8A 1MSSA 2VFGA 5D33A 2XN1A 4LRTA 2A7RA 4O1AA 2OCZA 1B4KA 1GWJA 3G1DA 3RMJA 3T78A 5AHLA 1ICPA 3M1ZA 3L2IA 4J9JA 4PFMA 2QCMA 1IIHA 5DLCA 4ORMA 3A21A 2RKXA 3KRUA 4UTKA 4HNVA 3W74A 2ISSA 4MY9A 1OF6A 3BO9A 3NG3A 3W1PA 5BMXA 3LI0A 4LRSA 3HOJA 5CG7A 1FXQA 2ALDA 3W76A 5BW6A 3UWQA 1SW0A 2A0NA 3DFSA 3GX9A 3K30A 3QFEA 4DXVA 3W7EA 2FPYA 2ZA1A 5CZJA 3IEBA 5KZDA 3ELFA 2ZZ4A 4KKXA 1RR2A 3KFTA 4NT0A 4JTTA 3TV8A 1AW5A 3PBVA 1FXPA 3MJYA 2O7QA 1T0OA 2NUYA 3L5MA 3W2NA 3M5XA 1S5TA 1W31A 1K8ZA 3C2FA 3NQCA 4JYFA 2YFOA 4NUWA 3NNTA 3TA6A 1AK5A 1VCFA 3BG3A 2A21A 3T40A 1DQXA 1UBSA 5KZMA 4JTJA 2E5CA 3HGSA 1P0NA 3DFPA 3LV5A 3TFXA 4O14A 5DN1A 1LRTA 3B04A 1TCDA 2ZZ1A 4IMCA 1YPFA 3R89A 2TMDA 2YYUA 3LTYA 1HFBA 4PH6A 3TQKA 5DY2A 5I3IA 1ME9A 3W72A 1OX5A 5DELA 1I2PA 1GYLA 2X1UA 4AXKA 1YPIA 1TPDA 4O19A 4RR4A 4QSHA 2PRMA 3NQ7A 1S5WA 5F4XA 1OFRA 2YYTA 4B5NA 4LOCA 4WY0B 4M6QA 3G3DA 1YDNA 3L5LA 1WAUA 3LBCA 2QCNA 1QAPA 3W6YA 3TW6A 4OQVA 4G1KA 4R34A 1KTBA 4HNNA 3G22A 5G4EA 1ZAHA 3PC0A 2GQ9A 2GUUA 3EWBX 3L21A 4IMFA 8TIMA 4O4VA 5E1QA 2B7NA 1TV5A 3G8EA 1TB3A 2NUXA 1KA9F 2JK2A 2DP3A 1XDMA 3FJLA 4JICA 3TE9A 1A5SA 1QPNA 4Z1DA 1TPEA 3S42A 4NJIA 3MI2A 2QAPA 1K7XA 3MW7A 3P5ZA 5BMWA 2FDSA 4PODA 2ISVA 1XL9A 5K9XA 4JTSA 4AWUA 1TO3A 4CQ8A 1WBHA 4O0KA 3GKFA 5F4SA 4H3DA 1G67A 4M19A 3LRKA 1XM3A 4XZ9A 5HUOA 1OX6A 3GYEA 1WV2A 4RV8A 4WXYA 2EPHA 3MO7A 5F1UA 1W5MA 4UTUA 1K02A
chains in the Genus database with same CATH superfamily
4G8TA 1KFCA 1H51A 2ODOA 4PTXA 1XH2A 3S6TA 4QJ5B 2WMJA 1O5KA 1YXDA 2FFCA 4CQ9A 3BARA 4HA4A 3T7VA 5I2UA 1FWGC 5I00A 1EIBA 5TD4A 2F9RA 3LXBA 1MW3A 3P5YA 3AYTA 4S3CA 4C6LA 3VIPA 1UPMB 1F4AA 3W38A 4ZOAA 2CLKA 3TSBA 4Z2IA 1Q85A 3PSVA 4DIAA 3BCDA 1TZZA 1PZ1A 4H00A 1GOOA 1T40A 4H6QA 3VOGA 2QIIA 2ZX9A 5ABFB 1FHLA 3WBYA 2Y8VA 4PRTA 3E96A 5HBFA 4XKYB 3NURA 4TV6A 4XVEA 1PTGA 2OWWA 2QPUA 1QVBA 4LVGA 1FVPA 4YLWA 4H6EA 1FFQA 2EPKX 2VUNA 1OSEA 3CPRA 4RPPA 3G5EA 3TP4A 3GO2A 3B9OA 4E3VA 4DJDD 5I79A 1TZ9A 3PZMA 3W2JA 3W7DA 1Y5XA 2VCAA 5REQA 1GZGA 2ZX7A 5HMDA 1VQTA 1E1EA 4KCVA 1K7FA 1YBQA 2VZTA 6PTDA 3Q94A 2OX1A 3NWRA 2X30A 2BMBA 2R91A 3WNLA 1XIJA 4DO7A 1MDRA 1A4MA 3WF2A 4AQLA 3R79A 1Z32X 1HXJA 3NM3A 2OEMA 1UWAA 3I3EA 3LX9A 3LCXA 4HN8A 1OM0A 3CH0A 1EGVA 1IWAA 3EX1A 3WMSA 1Q66A 2VXNA 5CZSA 2QCCA 1BG4A 4FZIA 3P93A 1UB3A 3GH4A 3DAQA 5A2CA 2P8BA 4ZENA 2PZ0A 2Q71A 1XIFA 4JS3A 4G56A 4R27A 3SZ8A 2MNRA 3FOKA 3P14A 4TXEA 4UZUA 4WXZA 4PMNA 3R8GA 4MHBA 1ELSA 3COTA 1BYAA 3C86A 4HHHA 3KBVA 3N2OA 5E5CA 4Z1CA 4MNKA 2WC3A 4DI8A 2VO5A 4F8XA 5HUPA 3SY1A 4QS5A 3KE0A 4TMBA 2WBKA 3QY6A 4MLRA 5FJPA 3DFTA 3VM5A 4NZ4A 3MQTA 5C0QA 5LA0A 3FYPA 1A3XA 1LBMA 3CL6A 5TQLA 4OV9A 2OSYA 3E02A 3L65A 4W93A 3SCWA 4HCHA 4ICMA 4XUGA 1UWSA 3LA4A 3TZNA 3UERA 3G1SA 4D6GA 4UIOA 1OINA 4NKCA 3LHZA 3WUFA 1XRVA 4KFPA 4W5ZA 3GWQA 1QT1A 1QI2A 1XLDA 5FD0A 3VGEA 3M41A 5D02A 3SECA 3WEMA 2R94A 4GH3A 5FACA 2MANA 3FCPA 3PJUA 1SFLA 4YHEA 4NSBA 2JF6A 4RCXA 2ZTJA 3B8UA 3TWBA 4XK2A 3WUEA 2PGEA 3TW7A 1IHIA 2VGGA 4JTGA 4UCFA 3UYCA 3RO8A 2CFFA 3H8AA 2BX7A 3EWDA 4XBJA 4JY8A 3S2CA 3LM3A 2ATMA 3L2LA 1BGAA 1S1PA 2WBGA 1REQB 2WCAA 3FN9A 1KLYA 3VDBA 4PMQA 3QVQA 1UZHA 1IXPA 1W32A 1ZRQA 3ZJ7A 5D8WA 1DPMA 2D0HA 3T8LA 2OO6A 2CZDA 4BF7A 1VF8A 4Q8QA 4HA3A 3MMDA 1CGVA 2EKGA 3TYDA 2D0GA 3AS2A 2DPEA 4V1YA 3PVFA 5K9DA 5C55A 1E51A 3WDJA 2X2GA 2C18A 3W4RA 5G2WA 2WW5A 4BI6A 3XINA 3EPNA 1LOQA 3U2ZA 1OADA 5BRBA 4UTMA 1JCTA 3M5VA 1TUXA 2V8ZA 3WD1A 1T8XA 3BOFA 1WBJA 3V0UA 2J8GA 3CQ0A 1TREA 2V6AA 2HNHA 3KXQA 2GUYA 4IL0A 1OCNA 3W25A 1UG6A 5DCBA 4LUSA 1EC8A 1U83A 2BHUA 3U5YA 9RUBA 1JGIA 2PD9A 5LIYX 2HTMA 3CV6A 3W7OA 5K9CA 3PTDA 1H0IA 4HNUA 2NSOA 4JTKA 4HZ7A 4ZTYA 1GEQA 3DESA 1V93A 3UU0A 1POKA 1NF7A 5A2BA 4GMEA 1I0DA 1VS1A 3DFQA 4RE0A 2NLYA 3EPMA 4LTSA 1E6PA 3N13A 1EJTC 3B8WA 1N7KA 2J66A 4PTVA 5GNYA 1NFPA 5C7HA 1OYCA 4YVPA 2ACQA 3ZVHB 1UQZA 4XVDA 4R7OA 3DENA 4UTHA 2I1OA 4O8AA 1HJQA 3I7RA 2FVKA 3BL3A 3I10A 3U5UA 1WDSA 1OB0A 1TJ0A 3NQ8A 1SW7A 2A4AA 1DJGA 5CPOA 4UNLA 1ZBKA 2VFFA 1YKWA 2V5KA 4A05A 5HDRA 2L5HA 1S46A 2QJIA 3PWAA 1US0A 4OKDA 2AQOA 3W83A 1L9WA 1ZAIA 1GJWA 3LS9A 3K8KA 3H24A 3IIVA 3TYZA 3OA5A 1FCQA 1EA9C 3QTPA 1QOQA 3M44A 1B57A 2DUAA 2A3LA 2O92A 3WDRA 5CLWA 3T07A 5F2LA 3F4DA 2C1GA 3NO5A 5IDIA 4CQCA 4C60A 4U3AA 3CASA 1Z42A 4A3QA 2Z00A 3IK2A 4G2DA 5D2YA 2ZUMA 4JCLA 4B4HA 3CEPA 3T0DA 4REQA 4P7LA 3NPUA 4ZB5A 3AMGA 4MYXA 2GUBA 5I09A 4MLJA 4LYQA 1OD0A 3WIJA 5CZTA 4NAFB 1QBBA 1WOBA 2EQDA 1TV4A 3LI1A 3FNDA 3GB6A 3GKAA 1SMDA 4B9YA 2QCLA 1E40A 3O0KA 3D46A 3B40A 1E73M 4IGNA 3OBEA 1Z69A 1W56A 4QAIA 1IXOA 1EXPA 4UMAA 5CG0A 1ZCOA 2GOUA 2WM0A 4IWWA 5AVNA 3SURA 3PPCA 2W62A 3FX4A 1EGMA 4JL2A 4M1BA 5G2IA 4W9TA 5ABEA 5JBEA 4C7GA 8XIMA 4JTRA 1FQ0A 3ZR6A 4W87A 4AHOA 3IVTA 1UD5A 1DXEA 3HIJA 3RILA 2NSXA 3ZLHA 1L2UA 3P8JA 3ZOAA 2DZPA 3CGTA 4WGXA 4L4MA 1KR0A 3N9SA 1GVRA 3BXWA 4G6CA 3GIPA 2FZ9A 3O9NA 4BQ4A 4LFYA 4MF4A 4TQTA 4MB4A 4PMZA 3AALA 4PMJA 3RCYA 3Q37A 2PMQA 1UZ1A 3G1HA 4DZIA 1UIPA 2VX7A 4I7VA 5C9XA 5AYYA 1TJ1A 1QOXA 3BANA 4XZNX 2HSAA 4WJ8A 4JNYA 4R3UA 4R53A 2Q01A 4CN4A 3O6CA 4XTIA 3VCCA 2Y88A 1R46A 5GJNA 3VD4A 4NZCA 5FF0A 5LHEA 3BLIA 3O6AA 4JYEA 1PKLA 1ZJAA 1OFAA 2XZ7A 3U0HA 4R88A 3PJTA 1UPPA 4IPJA 4H9YA 3ANUA 3EWYA 1RZMA 4GQGA 1OK4A 4CD5A 1DKWA 5ABGA 8CGTA 4ADUA 3WQ5A 4GISA 4XZIA 1NSJA 1PX8A 2YCIX 1F2JA 2J6VA 4S3BA 3ATZA 2POZA 4F66A 3EDDA 3BC9A 1T96A 1GVEA 2YW3A 4Q4KA 1XIDA 1EOKA 1U30A 3CWNA 3WQOA 4KH2A 3TNOA 3WLTA 4DJEC 4QE5A 2PDFA 3SQSA 4F0MA 1AQHA 4CCDA 5EL1A 3STGA 4M8UA 2HPIA 3TTOA 3MHGA 3WDIA 1A5BA 3AHXA 1YIXA 1DJXA 1BGGA 3NL2A 4HNOA 3Q65A 3LCFA 3LM7A 5FIPA 1XINA 2J7DA 4FP1A 1CB2A 4HPGA 3TTEA 2QPXA 1E4MM 3R10A 1ZCCA 4W4QA 1EL3A 1TYGA 3BLFA 3F4CA 2E5DA 2IKGA 3CZLA 2C6QA 3LEPA 3NQEA 4O11A 2VEMA 1SQ7A 1XSJA 3BG9A 3W7JA 1T5AA 4GC3A 1ZBCA 3ABXA 3R1ZA 1DQWA 5CAKA 3UPBA 1TPFA 1U22A 1KM2A 1TJRA 3EB3A 2DZVA 2GQAA 1QPRA 2VENA 4HMEA 4XD6A 2QJMA 2ZXBA 2EHHA 3B9DA 4JIQA 1F7BA 4C90A 3SR7A 3KL5A 2UY5A 3GR4A 4OUIA 4O12A 2V5JA 2IPWA 1TR9A 5MHBA 1S2WA 1XCXA 4I3GA 1W9VA 2XFRA 1XFBA 4HZ6A 3SRFA 3URNA 5C5YA 1TRIA 3TZFA 4QJ1A 2E9LA 3IIZA 3UZJA 4O13A 4RKAA 1QK2A 3W2UA 2CXGA 1PSCA 4RV3A 3GUGA 3G2GA 5ECUA 3ONBA 3R8RA 4GYPC 1R87A 4UNIA 4K1GA 2PDNA 2PDUA 2ZRXA 5EMJA 4HTBA 4DN1A 4PE8A 3B8VA 1CXEA 3KBWA 2OLSA 3FHAA 4J3UA 3WH8A 2ISWA 4AZCA 1BQCA 1M3UA 4IXXA 3CHFA 1GJUA 4N4QA 1JGMA 2W91A 1UUOA 4O10A 4QIUA 4BQ3A 2ZVRA 4CNUA 3IJ7A 1G1YA 2YDQA 4ATWA 1B90A 1F6YA 5E93A 4LCRA 4AEFA 2PF8A 1DE5A 3QHMA 4ES4A 1TMHA 5LIXX 3VAVA 2JQXA 1JXJA 1TTJA 2C3ZA 4CEXC 3NL3A 3UR7A 3N4AA 3QHNA 4WHBA 2XVPA 5C8BB 1QNPA 3ITOA 5K2ZA 1GKRA 3A3HA 5SWUA 9XIAA 3RJYA 3H70A 3WQCA 3UWVA 3VDHA 1W9DM 3G8RA 1ODUA 3V1PA 2O7SA 3FYYA 4TOQA 2XTKA 3AAMA 3UWWA 3S1UA 1TKKA 3RPDA 4FOJA 2A1YA 5E9AA 1FWSA 1OCJA 1CW2A 2ZKMX 3GVQA 4WD0A 1H49A 3LDVA 4IG2A 3TXZA 4DAFA 1FWEC 1F4HA 4M6PA 4HNCA 2JF7A 3UVAA 5K4ZA 1JZ6A 3W9ZA 1NOWA 1BVZA 3IJIA 2NX9A 3WN6A 4MYAA 2FHFA 4DPPA 2E9BA 3IVSA 2NQ9A 1LOLA 1V0MA 4HHMA 2P1FA 3EWUA 5FEPA 2OZ0A 4ZSUA 4DBDA 1XLLA 3GFZA 2E1WA 1P4CA 4KCUA 3WEZA 3QV8A 3QMTA 4JTQA 1ZQ5A 1SJDA 4HBKA 4JHOA 4QEEA 2QUVA 2Z2AA 3WCZA 2EGZA 4GZ7A 5D37A 4DJED 3VE9A 1CEOA 1MEHA 3OHMB 3USBA 4NHVA 3NQFA 4H7CA 3CNYA 2PZNA 4QRNA 2GVEA 2FPTA 3EMZA 2NQZA 1FWRA 1LUCA 1LG2A 3EWXA 2VL4A 4R9OA 3P82A 2AL1A 3KHJA 1XRFA 2H9AB 3VD7A 3KOYA 3WNKA 3PBWA 1UMLA 1E9ZB 3K4AA 4NNCA 3QC3A 4WDXA 4D6FA 3KZPA 4C6DA 4C6MA 1FCVA 5AKQA 1G4EA 2Y63A 2WYSA 3W70A 2J62A 1EF2A 3W6LA 1KR1A 1L8NA 3AWOA 5HJLA 1P6WA 4AHPA 4JKMA 3KAOA 5DANA 3E2QA 3R13A 4AIOA 3EEZA 3WF4A 3N04A 3MUCA 4JHZA 1F61A 4I5RA 2AGKA 4QISA 3T9PA 4B4FA 2OSXA 3DU0A 3VE7A 2H3BA 2BXYA 2FGBA 3MBFA 1QFEA 5T9CE 1R3YA 4C6FA 1S5NA 2VD9A 5I07A 5DO8A 1X1OA 4BCEA 3JZUA 1J6OA 4I7WA 3HGOA 5HXMA 4O52A 4S2CA 4PB5A 3CIXA 2VC5A 3EKZA 2AAMA 1I0BA 3BAJA 5HMSA 3EX6A 1JEZA 1G4PA 3QQWA 4FNTA 1FRBA 2WSQA 1O12A 3LHWA 1R5YA 1R6WA 4H6RA 4NXSA 2GK1B 3P74A 4PGLA 3GH5A 2OT0A 3LPFA 2XZ9A 2FLIA 4ZSTA 4LBUA 3RR4A 1G69A 1NWSA 1ZZMA 4ZQRA 3O1NA 3PSWA 2QDGA 4UTWC 3G18A 1YPXA 4WKHA 4NZ5A 2BY1A 4AHQA 3GFYA 3USZA 3TYBA 1IZJA 2E6DA 1NVMA 4XUYA 1WXYA 1RPKA 3A4WA 1DVJA 2FGLA 4H2HA 4UQ9A 4J2MA 2ZUSA 2BOEX 3WQ8A 5KITA 5E0FA 3TJ4A 2ZFAA 3QZ6A 5XINA 2OPJA 1XLMA 5AC5A 3MBDA 4XISA 4NAFA 4GABA 4EP8C 1FWBC 3WJXA 3QLDA 3UCCA 1DIEA 2XIMA 3QPYA 1QHOA 1K7EA 1TPC1 3QGAC 3GIYA 3WQEA 3THCA 5KMYA 1YDOA 5LNUA 1IT7A 2J47A 3FJ6A 3BOXA 4GPNA 2OJPA 1TTQA 2VZUA 3ABOA 3AZTA 3CUZA 3LRMA 3O16A 2BY3A 4GYKA 1FWJC 4N2YA 5E09A 1FWWA 4IMEA 2DW7A 5EU9A 4ERIA 2QCEA 3U6WA 1NARA 2C19A 3KP1A 7PTDA 3LLFA 2GJXA 3CHVA 3AS1A 1KFWA 3IGUA 3WG6A 5JQ9A 1NDWA 3U48A 2INZA 1MZRA 1MNZA 1L6WA 2ZIDA 4S23A 5DMMA 4FXRA 1EBGA 2WV8A 1KGUA 3N3TA 2V2DA 3LU2A 4W5UA 1EP1A 1SVDA 3DG3A 3ZM8A 1VFMA 4PSPA 4UNKA 4Q33A 4W7WA 3QZAA 3CO8A 1HG3A 5G1YA 4JIIX 1UR8A 5ENLA 3MT1A 3P2VA 2CW6A 1ONRA 1M7PA 5LNWA 4YWSA 2P76A 3IUDA 4NP7A 1PZ2A 4HK5A 5A6KA 4R5EA 2WNNA 2WJDA 1O95A 1XISA 5HNUA 4Q8NA 3QLLA 3GTHA 3MKVA 3WK2A 6XIAA 3A4AA 3WY1A 2D69A 2PP0A 3WYZA 3MCMA 2PP1A 2FZ8A 2D22A 3PBYA 2WVVA 1EOMA 4Q7BA 4N9CA 3NYZA 2XWDA 1QK0A 4QGCA 1YADA 3UXAA 1UIOA 3RGTA 4NU7A 4NYUA 3SQMA 1J4EA 1DWJM 1WUEA 4LYKA 4L6OA 1VEOA 4IUOA 3V4BA 4U4MA 3VGFA 2J7BA 4Q4PA 5LZLA 1MXSA 2ANUA 1OFPA 1G9HA 1AVAA 3VUSA 4EWND 3UXLA 1NDZA 4NQ1A 4RXFA 3W73A 1BKSA 1IEVA 4RW3A 2NW0A 2OFJA 3BWWA 1OFEA 2NQLA 1WNOA 3WH9A 1J0IA 2CEQA 1ZFJA 1CI1A 1VBRA 4ECLA 3KDOA 1P1MA 3RLHA 3NOYA 4O0QA 1B9ZA 2ZC1A 4ICNA 3ARWA 3UWYA 1WKYA 3THUA 4ZL1A 3KP0A 2LLEA 1IEIA 2PCQA 2ZTKA 2FKPA 4AEEA 1US2A 3M0XA 2DVTA 2DZWA 1X39A 2OKTA 1TJ2A 4JIEA 3E2SA 1IEQA 3DH7A 3BW4A 1Q8JA 2J8FA 1SZNA 3W6MA 2BVWA 1Z7AA 4LUIA 3FK4A 1JIBA 4PULA 1WAWA 1DHPA 5D9PA 1KNWA 4HK6A 5LGXA 3NVTA 2Y2WA 3K2GA 1UZDA 4XAYA 5E9XA 4LT9A 4MKSA 1F3XA 5AOUA 1UBPC 4GKTA 4Y9PA 4LF1A 5FAGA 4IIEA 3HZ3A 1Q8AA 1QATA 1VRDA 4UQBA 1TVNA 2YDRA 3VYLA 4UTLA 1JXKA 4QHRA 3GBEA 1T8QA 5F4WA 3H23A 2BP1A 4NJKA 3RG6A 1TWDA 2VC6A 4MAZA 4OV4A 4CQAA 1NDYA 1M1BA 1QWKA 1SFJA 2NLIA 5TAOA 4WKFA 3VKDA 2RJHA 3EWZA 2VP8A 1W5NA 2OYMA 3OJGA 2Q02A 3E49A 5LGZA 3OVRA 4JQAA 5CGQA 1Q7MA 1XD0A 4GIAA 3PWIA 1VBJA 3DUGA 4LGXA 1PBGA 3L2MA 2WMIA 3L68A 1UMYA 3IJDA 3HV9A 1PJ9A 1TWZA 2KZHA 1MWOA 1HVXA 3F4WA 2B0MA 3J7HA 1GUVA 1H63A 3UPWA 1DTUA 1ZJIA 4H8HA 4C5ZA 4FF7A 3TYAA 3NQ6A 4P61A 3AROA 4A2RA 3OQEA 1T6MA 1RCQA 4B5UA 3A13A 2HXUA 2PDQA 3UG5A 4HVXA 1QU4A 3B4YA 3W1TA 2Z26A 1I4NA 4EXBA 1X1ZA 2WAGA 4FPSA 3GXIA 4KBXA 1W9BM 3W22A 1RQBA 2INFA 4DF0A 3SJNA 1IWBA 2OOFA 2EJAA 4IUGA 3UWEA 4U5IA 4IPLA 1LBFA 1W5PA 4NX5A 5I23A 2JKPA 4ZOBA 3HPXA 3C8NA 4FOKA 1ADSA 3T0AA 1JCLA 4AC1X 2W0UA 1IT0A 4PUJA 4GUGA 1KV8A 1TPVA 1JZ8A 4TU1A 3LCGA 2WSYA 4OECA 1JNDA 3IRSA 1OC6A 4LU0A 1OBAA 2I56A 5CJNA 3S2MA 3S3GA 3WMBA 4PUNA 3NSMA 1A5AA 4RW5A 3CM4A 2G8ZA 1THFD 5LA2A 1XJBA 1OD8A 4NAEA 2GGEA 4EPKA 1GOQA 2JGYA 3VOHA 3THQA 2EPLX 3KWXA 5IXEA 3I3DA 2E8YA 3G6MA 1R47A 3W1LA 2FJKA 5CQ1A 2HS8A 1F8IA 2DW6A 4J3SA 3WENA 4IH3A 3AJ7A 1O66A 3KCOA 3RPTA 2A7RA 3T78A 1H4PA 4DYEA 1Y5VA 2HBVA 5DMNA 1G5AA 5I7GA 3TN4A 1NJJA 1IIHA 4OIFA 5EMLA 5DLCA 3QR1A 1ZSXA 3N11A 3W74A 2ISSA 3BMWA 4MY9A 5FJJA 1QNQA 2CC0A 3DHPA 4J3VA 3G6LA 4LRSA 1SM9A 2E0PA 5C9WA 1C91A 3AMLA 2J78A 4M0XA 2F6XA 3UWQA 3RX3A 3QFEA 4DXVA 4L1WA 4QQUA 4J35A 4GO8A 2OB3A 1UOKA 2YB4A 3LSCA 1RR2A 3QBUA 3DERA 1FXPA 2CLPA 1T0OA 1E6ZA 3L5MA 1MRQA 1WUFA 1Z89A 2WSKA 3UW6A 4XIAA 3E0WA 2A21A 5JH2A 4JTDA 5JIPA 2E5CA 1P0NA 3LV5A 1LRTA 3HU7A 4IMCA 3A3XA 4AX7A 3R89A 3OP2A 2TMDA 4E6MA 4H04A 4LALA 3TQKA 1I2PA 1JI1A 4O19A 3SCPA 3SB0A 5F4XA 4WY0B 4M6QA 1GHRA 3N29A 2PC8A 4LUTB 3ALFA 3L5LA 1QHPA 2WC7A 2QCNA 1PUDA 1QAPA 1ISZA 1ZP4A 3TW6A 5FL1A 4OQVA 3QN3A 1TVPA 4HNNA 1XRSA 4KMQA 1WCGA 4YVXA 1QW7A 5BROA 2CKSA 4LAUA 4IMFA 8TIMA 1UP0A 4W8BA 2NUXA 3HA1A 4JICA 1XX1A 3SRKA 4Z1DA 4CU7A 1J11A 1K7XA 3MW7A 3H2AA 5J8LA 2FDSA 2VGBA 1XL9A 4J3TA 4AWUA 1TO3A 4CQ8A 3HTWA 4XZ9A 4P7RA 3K13A 3GC2A 3UA3A 4F2BA 5B7YA 4GA8A 3I4KA 1IZCA 4UTUA 1K02A 2J4GA 2R9RA 1GYMA 4AEOA 6TAAA 2XPKA 1BLIA 4D71A 1BXBA 4H9UA 1RA0A 4FXJA 4NILA 3TOPA 2I17A 3A6OA 5D04C 1ODZA 1V3JA 4F40A 3QKEA 2ZXDA 2OLHA 3RFAA 1GEHA 4JEQA 3LBMA 4PBGA 3MSYA 2E8ZA 1WOAA 2WZHA 4HSOA 1E9YB 3WJSA 1RHCA 2QULA 1OEPA 3FVMA 4KESA 3C5QA 2HNEA 3I3BA 1FHDA 2PDPA 2WOQA 3CB8A 4G7FA 4BEQA 3AZRA 4ML4A 1RJQA 4UWMA 2GJPA 1FOBA 1ISWA 3VNZA 1REQA 2GVYA 4BA0A 1QNOA 3UWZA 3TCEA 1M04A 3CQKA 1PIGA 3RX4A 4AZBA 2OZ3A 3C61A 2VEPA 1GKPA 3P60A 3TTSA 3KL0A 4H01A 2E7FA 4CEUC 1OJXA 2VDGA 2V5DA 3LLXA 4A21A 4QG9A 4NZFA 2VCCA 3LN3A 3WBWA 1LRNA 4NXKA 1RSCA 3QM3A 3VFLA 4E2DA 4AVNA 1EDTA 1WKDA 3AXMA 2BOGX 5FI8A 3WLLA 1QXLA 1H7RA 4KFOA 3FAXA 5HQMA 1QI4A 1T41A 3BSMA 1OT1A 4LJ3A 1XLIA 1XLFA 1GT8A 4EWJA 1UH4A 4IFRA 3RU8X 4A3RA 4GK8A 1WQ5A 4GG9A 1TRDA 4AISA 3NDZA 4PRRA 1HP5A 5CPQA 7REQB 1G0CA 1O1ZA 1R2RA 2ADAA 4YYCA 3PZGA 1W17A 5DF0A 4ZMGA 4UMBA 2E6YA 3RRXA 1D3GA 1TR1A 4ZEPA 2XVKA 3UYIA 4IIFA 4AIUA 2H90A 3RUBL 3URQA 4FNSA 3ZR5A 3S9IA 4J7RA 3ZT5A 3ITTA 3TA9A 4GIEA 4KW2A 3ZO9A 3ECQA 3VNIA 5JXQA 1EHAA 4MNMA 5FF2A 4QCEA 1ISXA 3PZTA 4AD1A 4X9YA 3UXIA 1OWQA 1DXIA 4GXWA 3HN3A 3LCHA 3E38A 3H4XA 3FJ4A 1XBZA 4FO4A 1QBAA 2BY0A 4O1CA 3AFBA 1PTAA 3GTFA 4HSHA 2WWDA 1C3FA 3LTPA 3SO7A 4K7YA 1FY6A 5K3VA 1QWGA 3FVDA 4LS2A 5AY7A 3NYDA 3AI0A 3PNZA 2J88A 4RZ5A 4FALA 1DWIM 3UGVA 4GFIA 4A8RA 4RNJA 3SSJA 3OLIA 1E1FA 3VNYA 3NO3A 3GZAA 3VGBA 1JJKA 1Q6OA 3R0DA 4ERGA 3KOFA 4JX4A 1ME7A 5GJPA 4XWUA 3QW4B 3MMWA 3WO8A 3N2XA 1Q13A 3WL1A 3D5HA 1IGSA 3H54A 3VU2A 2P0OA 3U4FA 4FEZA 4WDTA 4WY0F 4K38A 4C1NB 3I6EA 4FOUA 1R8LA 4JN7A 1DIDA 1XG3A 2W63A 1MUWA 4PUEA 1G6CA 2V2HA 2QUUA 1K4HA 4JTUA 3QOMA 3MHFA 4TVCA 2CHOA 5ABFA 3GNDA 3VX0A 2O9TA 1DJQA 2G3JA 1BSIA 1GK8A 3BMVA 1B3VA 8RUCA 1I1XA 4U10A 2G3NA 1FDZA 1UD6A 1PKNA 1WDQA 3S9YA 3CIWA 4DJDA 1TX0A 4ICCX 5H8PA 1PIFA 1Q6LA 4BKNA 4RDYA 2DDXA 3BLLA 4KWWA 1KTNA 2PUZA 4Z42C 1CX9A 4LB4A 3G0XA 2ZCGA 3K1GA 3HQOA 1XLBA 2ZRWA 3QOKA 4LY8A 1JPHA 1BTMA 2X7WA 4HMNA 1DEDA 1KGWA 3W1UA 3VIJA 2NV1A 3EXSA 3GAYA 2BODX 4DUOA 3RK8A 4EPEC 3W86A 2A79A 3OVPA 5EPDA 3CWOX 3LGDA 2G4FA 1TQXA 1QPQA 1EX1A 4PCFA 1JPDX 4QP0A 1OYAA 3B8SA 1JD7A 3EA1A 4IPIA 2WMKA 3P0WA 3TYUA 6ALDA 4DWSA 2HK1A 3KVKA 3CYVA 1E0XA 3OYZA 1C9DA 4REQB 2TRSA 4PUMA 5H8MA 1A5MC 2GDQA 4HOZA 5CBJA 1QW8A 3W24A 4JFTA 4EPBC 2AL2B 1UR2A 3DDMA 3Q58A 4WK9A 4Q4QA 4JHMA 4J3XA 4OGZA 2AQWA 3L5AA 1PYMA 3ZT6A 3GTXA 3U2OA 4QG8A 1OG6A 4Z0JA 2PWUA 2UWFA 2ZZ5A 3PG9A 5AHMA 1I8JA 1SU5A 2VWSA 3KVMA 2FGZA 1QR7A 4QJ3B 3B8TA 3QC0A 3W85A 2YL5A 4RNFA 3GVRA 4A2SA 3BZGA 1YDVA 3N14A 1X7FA 2PDYA 3VIMA 2ZXQA 4V1XA 1XDLA 4WUIA 4GNKB 4IP5A 4CNSA 1JCYA 1PAMA 2ZZ7A 1P1XA 3DHFA 3G0UA 3RU6A 4C5YA 2UY3A 3UNDA 2IKIA 5LIWX 4IJBA 3SN4A 4M1RA 4Q8TA 1EA0A 3WFAA 2GDVA 2J27A 5EMYA 3MTWA 3PR2A 3NZ1A 1EJWC 4O18A 4TO8A 4WOQA 3OO2A 3QV6A 3LQLA 4D6CA 2X7VA 5A6AA 4K68A 3C0LA 4NZ1A 3IRDA 3PTQA 5A3HA 2FTPA 4UTJA 1HTIA 1E6RA 2PWGA 3OLGA 4L4LA 4UR9A 5DT7A 2ACUA 4GZIA 4C6OA 5D2VA 4MZ1A 4JTIA 3R6IA 4WJEA 1GOXA 2QCDA 2XH0A 5E6YA 2VNCA 1XC4A 4OFCA 4L5ZA 4U31A 2J75A 3DKLA 2HZGA 1GPFA 1TE6A 1DL3A 2FZMA 4IMAA 4NZ3A 4DBWA 2Z29A 2WB5A 3WBXA 3CUGA 1HKKA 2FH6A 4TMCA 1EWEA 3MI6A 1PYFA 3OG2A 2FMOA 4ZXLA 4YTQA 2PE4A 3B0PA 1LOSA 2ZZ6A 1W1VA 1V51A 3TN5A 5D2TA 3WL0A 3ZJKA 4TTUA 3LGGA 1X98A 4GX8A 1VCVA 3H2FA 2FQIA 1UKTA 1PHWA 2QCDB 4OHQA 4NL1A 3CUXA 3UNTA 4ZQPA 2Q3OA 1C7SA 1XP3A 3BSHA 2BGSA 3DECA 1EX5A 1EO7A 5AVHA 3DYPA 7TIMA 2V38A 3GG7A 5IBXC 3HFTA 2DJXA 3PUDA 3MO4A 1EO5A 3OGSA 4D6DA 4AX6A 2CLEA 3TR2A 4MNJA 1QOPA 4DJDC 4Z1AA 3W7GA 2RDTA 1NTHA 4L1XA 2PF0A 1H5VA 3GU2A 1GW9A 1I6NA 2GWNA 1PCWA 3AYRA 4XZBA 1M7OA 3O8AA 1SO4A 2Z27A 3I6RA 4E8CA 2QJJA 3MZ2A 5EBUA 2Y0FA 1PX3A 3IAPA 3PWGA 3APGA 2OEKA 2Q09A 2OGJA 3CC1A 1F76A 3QQ0A 3OVQA 4LSBA 4QDWA 1MFUA 2J7EA 2D73A 3CMJA 1UHVA 1HKVA 3OGRA 4KEZA 3W23A 1LL6A 4ZE5A 4ADTA 1CIUA 2ICSA 3GAKA 2VVSA 1Y7VA 1MQPA 3CUJA 3VZYA 2DT1A 1D2KA 1W1IE 5DCEA 3HG2A 3K1DA 3EX4A 3GUWA 2WXDM 2MUCA 1HJVA 3W1QA 3I7QA 4IMDA 4Q8PA 3BJTA 4MZYA 2WHMA 2PDCA 3KOXA 3WK1A 1V4YA 3WMLA 2RH9A 2GSJA 1OX4A 1A5UA 1EB3A 4E4PA 2PWFA 5D9OA 3UETA 1M7XA 4KERA 3S5SA 4PUUA 2DJLA 1ZGDA 3AMKA 1GGOA 1SSDA 3H4GA 1YNYA 1VFFA 2CLOA 3F1QA 1F6PA 2OR2A 1W9PA 3W71A 1VJIA 3UJEA 3TJXA 4K8GA 1YMYA 5EKYA 3WLNA 2AKMA 3BGGA 2VRJA 3OODA 2YLAA 2V30A 2FHBA 4HCDA 3ICJA 1BVWA 4S3JA 4HU8A 5FL0A 3QTGA 4HKPA 4XZLX 3DN5A 1MMFA 2DV0A 1J5SA 1NEYA 4ONVA 3KL3A 3O05A 4LCSA 4FLQA 2C15A 3I6TA 1RPXA 5CBBA 3CHCA 4Q8VA 2ZWYA 2P88A 3GE7A 2IXUA 1QDSA 3TR9A 3OG3A 2W5FA 3UJFA 2BASA 2QAFA 3ZIZA 4DLMA 2OX4A 1UASA 1UD4A 1XQKA 3C2YA 1RVKA 1X97A 4GQRA 4LV4A 5FJTA 3T8QA 4S1FA 5F2MA 1NQ6A 3UZWA 1VIWA 1VBGA 3O2LA 4W89A 2EO7A 4ZQMA 2E40A 4JQ4A 1V7YA 1G01A 3LERA 1XIBA 2CZEA 2ZADA 2CWNA 1CGXA 1I2OA 3FKRA 1I2QA 2QF7A 4X0VA 2Z1KA 2QV4A 4UR7A 4C1KA 5HINA 3UY8A 2C8NA 3QF0A 3W7IA 1F5ZA 3UG4A 2CKRA 1JYWA 3TROA 2PDMA 3A47A 3HMCA 3L7RA 4GZEA 3V5CA 3VUPA 3MWCA 3UXDA 5FEWA 2YSWA 1IYXA 4MJMA 3LLDA 2TSYA 1GVSA 2OZTA 4LCQA 4L61A 1JCXA 3MPGA 2ZZ2A 2FIQA 4TUFA 2GVJA 3GHUA 1QNVA 2YCEA 3R4IA 1VENA 4C6PA 3VXGA 3WNOA 5CPNA 4XD5A 3DG7A 3MCOA 4D1JA 3N6JA 1Q45A 3WDHA 1JNEA 2GVGA 4JKLA 4GUHA 5FJRA 1D7KA 2XVLA 3TQ0A 4O17A 1XKJA 1OGBA 1VFUA 1XIEA 2QQ6A 3UFYA 4XQ6A 3VKJA 1A5NC 3ZMRA 2PDGA 3CL7A 2C0AA 2J13A 1KFBA 3LHUA 2YBTA 3W2LA 4YNGA 4YJ5A 3RM8A 2CCRA 3PG8A 1XYFA 2QT3A 3MZNA 5M2FX 4HP5A 4LEFA 1FA2A 4FK9A 4M51A 2NWRA 4ZR8A 4WZHA 1A3HA 1KFKA 1AMKA 3N15A 3WMCA 1E4LA 1KC7A 3QY7A 2C13A 5CC5A 1RV8A 1KCLA 6REQA 2A85A 3AIVA 3CPUA 4PSRA 4UR8A 1V0KA 2YLLA 2Z24A 4Q8OA 4ZQOA 2D24A 4JD4A 5GNZA 1J0YA 3CEUA 4Q3MA 3R94A 2FHCA 4Q7NA 1K77A 5FEXA 3VKBA 4HJFA 4A3HA 4BQ5A 2H9AA 1XSKA 3GDMA 4LPCA 1C8YA 3S6DA 3S1VA 5CZKA 1XWYA 1TPB1 3NZRA 2PP3A 2VRQA 2E28A 1EUAA 2PURA 4UXDA 2PDHA 1NOUA 3C3NA 3W88A 5A8GA 3W2KA 6REQB 1UR0A 5BWAA 3GU9A 3SUTA 3UWUA 1S5VA 4RNIA 5A5WA 5BCAA 3RM4A 3VNLA 4PL2A 5HJYA 2Y4SA 1ML1A 2PRHA 3ZLFA 4J3ZA 1CXIA 4H9MA 3VKKA 4P8WA 1JULA 4I8YA 3DKJA 4CCCA 2NVAA 1XPYA 5MF5A 2J7FA 4MFDA 2C91A 3MUIA 3AZSA 1B54A 1LP6A 1LBLA 2HMCA 4PTNA 2VCBA 5AZ0A 4X60A 1JFXA 1XLEA 1LCOA 4UFMA 3E9AA 1LDCA 3LOTA 4GNJA 1GQJA 2Z4GA 2V3EA 2P53A 3NFUA 2E6AA 1B1YA 1M5WA 4E4UA 4PEKA 4CD8A 3VI2A 2CPUA 2POTA 3ZVIA 2Z1BA 3VK5A 2INEA 1GVFA 1IEXA 1QRQA 1RQHA 4E38A 2CHRA 4ZFCA 1B31A 5H8UA 3AIWA 3B0YA 4YMZA 3AIUA 1I1WA 2QIWA 1PEZA 4KIRA 1X38A 4ZQCA 3JR2A 4YWIA 4O54A 4XSMA 1MNSA 5TF0A 3UESA 4ENLA 4DNMA 3W75A 2ZRZA 4E2BA 4UUIA 3MWAA 3WJYA 4C1NA 2IW0A 2OXNA 5GPRA 1KM4A 2X0HA 3P7YA 2BG5A 1FKWA 1Q4WA 1JDAA 3CAWA 1CENA 3TCSA 3G1AA 1W1TA 4NF7A 5REQB 4AFYA 2G3FA 3PJXA 4JNZA 4ACYA 3GG1A 2Y61A 3VNKA 4MADA 3M07A 3NXFA 3AS0A 1ZU8A 5K4XA 3NXLA 1W8SA 3ZSSA 3PBGA 5CSSA 5A6BD 4K8EA 5CKSA 5DT5A 1DJZA 1AL8A 4X9SA 1PPIA 1VGAA 4W84A 3VD3A 3CV2A 4PN2A 4JNMA 3WDQA 3WLPA 1RD5A 2V2CA 4DBEA 4F0HA 1YQ2A 4PCSA 3R7MA 5ABTA 3AJXA 1R7AA 3CPGA 4OOZA 4YPJA 1ECQA 1PIIA 3OZPA 1J0JA 3V75A 3PFRA 1UR3M 1TA3A 3JUGA 4GUJA 5FSEC 3TN6A 1J0HA 2G0WA 5U7SA 4UQEA 3T2OA 4H2CA 2HWGA 1HZYA 4MFEA 1CXKA 1J0KA 1A50A 3IJQA 4LNYA 4DUWA 2Z6IA 5LHFA 1HL8A 3N2CA 2EJ1A 4XD3A 1Q6DA 4GXMA 3LY0A 5FOOA 2A3EA 4ZO9A 1LWHA 3AUOA 5FEZA 1EHNA 2PDJA 1OZMA 4RL3A 1EWDA 4JEJA 4PMOA 3W53A 1U2YA 3E2VA 1MQRA 1W54A 1QI5A 1V03A 3B0VC 3LK6A 2KAUC 4CN6A 3W7HA 3MSRA 1JR1A 1A4LA 1ITUA 5AC8A 2NXHA 3CZEA 4Y9NA 5AHIA 3B9NA 3V3WA 2W79A 3FV9A 6TIMA 4B9ZA 2PDWA 2QCGA 2EPOA 3WLMA 3P61A 1QTWA 3B0UX 1YXYA 3T55A 1U5VA 2YPIA 4B92A 1PZ3A 1KFJA 1D3CA 1GVOA 3ORWA 4JTAA 1SJBA 1MI3A 4NRSA 4DYJA 3M0YA 2UY4A 1FP9A 5H1WA 4PCTA 1UKPA 3CYJA 3EKGA 3PAOA 4GOAA 1OC7A 2QNEA 3U9IA 3C52A 3STFA 4LUJA 4QX4A 3A22A 3WQGA 1MW1A 3CZKA 3WQDA 3VMPA 4RXGA 2WNQA 3B9AA 5GJMA 1CTNA 3MV01 3VTRA 2CNCA 2ZRVA 3AUJA 3PNUA 4WDWA 2Z0IA 1EJVC 4U28A 3B0XA 3OZYA 2X40A 1O5QA 2QJGA 3IJ8A 2B7PA 2GSEA 2FB3A 2V3FA 2P50A 1WXZA 2ZX6A 2DSVA 4E2OA 5HWJA 3O6YX 1NU5A 3GXMA 3D0CA 3IJLA 2GZXA 1PS9A 4NYYA 3U2CA 3GXFA 1ZBVA 7CGTA 1M6JA 3G24A 3A5VA 3GU1A 3AHVA 2C0HA 4HPHA 1K8YA 5IOBA 4ML9A 3ZS4A 3CXOA 2JEQA 3S0CA 3O15A 3PPFA 1FCUA 3O06A 1AW2A 2A3CA 4W86A 3BV4A 4LNCA 3CLMA 1VH7A 5CPSA 1BQGA 1Z6KA 3BJFA 3U57A 6ENLA 3F5LA 3DHUA 1NWTA 3SQLA 4CGTA 2OTDA 4MJ2A 4EXAA 2DU2A 4U2YA 4MB1A 1JD9A 2CWXA 4LVBA 1F07A 3OPSA 3S4TA 4HYRA 5F2GA 2JIWA 3PULA 2VT0A 3O63A 4Y9AA 3UJ2A 4HGXA 1DV7A 2WMIB 4NNBA 5CAHA 3VKAA 3AISA 1W0MA 3UA4A 1UWQA 3NR0A 5EMKA 4PR4A 3BTNA 4KEMA 3P6LA 4D6JA 1AFSA 1DWGM 3S5NA 1UH2A 2A3BA 2CZ5A 5EFDA 1KCZA 2EAWA 2E09A 1GZ1A 3NEVA 4MY1A 2A7NA 3ES8A 2Y70A 1SZGA 3GHTA 3R12A 2X1IA 1GG1A 3W1NA 3BAIA 3LD5A 1R9ZA 3TK7A 1JPKA 1XW8A 1RK5A 2V67A 1PHQA 2ACSA 4KRZA 3C6CA 3WQFA 2QXWA 2A3AA 2IQTA 3SFKA 4DBSA 3YPIA 2R14A 1E9IA 4GYFA 4FNQA 3ZJ8A 4N42A 2EPNA 3S83A 4GH1A 3W1MA 1PKYA 3NUKA 4HNTA 4J1OA 4PMXA 3CQHA 3L23A 1KD0A 2ZUNA 3CHEA 4LS0A 1NFGA 3VX1A 2YR1A 4YCPA 4QDMA 1DWAM 1HT6A 1WE5A 2D2OA 4HZMA 5JU6A 4UC5A 4MKVA 1BYCA 1TG7A 1KQZA 4JXCA 1E4NA 2CU0A 1A49A 1MVYA 2RUSA 1Q7QA 4O8RA 3C56A 5I77A 3EMCA 1XGZA 4RZ6A 2WVVB 2BFGA 1MEIA 2WK2A 2PSNA 4NIRA 3TSDA 1LORA 1Q2RA 1FP8A 4JL1A 1QO2A 1CYGA 4GJIA 3VD5A 2HXTA 4MMWA 5IDZA 3RDKA 4AY1A 4CNTA 1EZWA 4BF9A 4NX0A 2WZTA 3ZWSA 4MWAA 4MUZA 4QR6A 4DI9A 4YS1A 4O28A 1UP2A 5EY5A 2VGFA 2AAAA 4LS1A 4HPJA 1J93A 2GVLA 1RLCL 4HSNA 1JUKA 3C3UA 2J9ZA 1F3TA 4B91A 4UTWA 2REQB 1V02E 1AD4A 3S1GA 2PLKA 3SGZA 3WLJA 1EQPA 2YL9A 4QAWA 4IF2A 3IK4A 2B81A 3UF9A 5HAOA 4N9BA 3GDRA 2F38A 2Y8KA 5CPTA 3TKFA 1E72M 1X6NA 2E25A 4Q4OA 1CBGA 3W84A 5E70A 2BVTA 4IP7A 4Z08A 2VFGA 1S2TA 2XN1A 3BLKA 2J25A 3HQNA 4LY4A 4LRTA 3WH5A 3G1DA 3M46A 4FI4A 3RMJA 5A6LA 3UR2A 1LUCB 4JFSA 1XLKA 1H3GA 3L2IA 4J9JA 3KRBA 2X09A 1W1B1 3TOYA 1KBLA 5CGTA 2QJNA 4DYKA 2ACRA 1JF6A 2PWVA 1A0EA 1KXQA 4LUYA 3D47A 4EE9A 2D3NA 3BO9A 3NG3A 5BMXA 3LI0A 3IACA 1K9EA 5BZAA 4Q6XA 3W76A 1FXQA 2ALDA 1NH6A 3VFCA 3VOFA 3EYPA 3GX9A 3K30A 2WJEA 3N12A 2PTWA 2FPYA 2ZA1A 2XVNA 3ELFA 4JQ1A 3VOJA 1J2BA 4PUKA 4KKXA 2BVDA 1NP0A 3KFTA 1FWIC 3TV8A 3PBVA 1AW5A 1NWUA 3ARQA 1V77A 2XFFA 3UJSA 2FFIA 2DSZA 1S5TA 3C2FA 3NQCA 2YFOA 2PAJA 1BG9A 5BOFA 3L4XA 1AK5A 2ZVIA 1ISVA 3BG3A 3LQGA 3T40A 1EYEA 3QGVA 5G4HC 2PS2A 2XYLA 3B04A 1TCDA 1DHKA 4F9JA 1EXBA 5MKGA 2WCGA 1VIZA 3LTYA 5DY2A 5I3IA 1RBOB 1UYQA 4EACA 1XFCA 2EXOA 3GNPA 1YPIA 1HJUA 1K70A 4AU0A 6A3HA 4S3EA 2PRMA 1K6WA 3EGJA 1S5WA 1OFRA 4B5NA 1FTXA 3NSXA 1GW1A 2E9MA 5A6JA 2CBVA 5JVLA 3T0TA 3G1RA 3V16A 4KWSA 3KBNA 3W6YA 4YTRA 1XPGA 4G1KA 1KTBA 4PFHA 3SRHA 4L9ZA 3PC0A 5DX7A 3LNMA 4XIMA 3W27A 2FZBA 3EWBX 3VNJA 3G8EA 1W3KA 1KA9F 2QLYA 4Y2WA 1QPNA 1S2VA 5DMYA 3MI2A 1RALA 7XIMA 2O4MA 2GDUA 3P5ZA 5BMWA 4OTKA 4PODA 4JTSA 5ABHA 1WBHA 4O0KA 4M19A 4P8VA 1OC5A 5C9RA 3MO7A 4G7EA 5FKYA 5HMEA 5F1UA 5ECVA 4KF1A 4JCMA 2FZDA 3EWWA 1VKFA 1YRRA 2EPMX 3AWNA 2ZDRA 2GL5A 4H8NA 3W7CA 1EC7A 3PZUA 4PMRA 4JFWA 1FWFC 2P8CA 3NL6A 2G37A 3ARZA 1ZL1A 3P3BA 4ZOCA 4W8AA 5HQEA 1WKFA 1UKQA 2Y89A 3C0SA 2VVNA 1OK6A 3ZR4A 5M3WA 1J2WA 1XIIA 3W7RA 3EOLA 3IGHX 1UKOA 4IICA 4QTGA 1P48A 3IANA 3HPFA 2VFEA 2GFTA 1OVDA 1AW1A 4M5PA 3F4VA 4H4IA 3VOCA 3B06A 2WC4A 3H21A 3FHQA 4WIWA 3U2EA 2J9XA 1BPLB 2FTWA 4DF2A 4BWLC 4KT2A 3IAQA 1CCWB 1UR9A 3C2RA 1TPH1 3LGEA 4QFUA 2IKJA 1UP3A 3XIMA 1WPCA 1SPQA 3MKKA 4DZAA 4GGBA 3WFZA 3LZ3A 3B3DA 4FLRA 4JPGA 2J7HA 3NAVA 4AH7A 3WF3A 3L4ZA 3ZJ6A 2IQ0A 3LXCA 3NPWA 2CLIA 3SCSA 1BXCA 2OLAA 2VR5A 3DI0A 3PB2A 4GWEA 3L0GA 3GY1A 1T7LA 2VR2A 1IT8A 4LAOA 3NQMA 5HNTA 1SR0A 1ZP3A 3WKZA 4ERAA 3PF3A 1ZENA 3S2JA 3VZXA 1W37A 4XAGA 3WD3A 2C1HA 1PZ0A 3W7KA 4F0RA 1LT7A 2VC9A 1FH9A 4DWSB 2O55A 4I6KA 7ENLA 4I6VA 4OOUA 3MCNA 1FDYA 1Q63A 2XIQA 5HNRA 3BAYA 1CDGA 4M29A 1O94A 3PTKA 3CMGA 3MUXA 1ITCA 4J3WA 3IS4A 4DX3A 1VLWA 1VB9A 1XF0A 1OCQA 1CWYA 2QR6A 1OZQA 3ME3A 4O4WA 4GI9A 3EXTA 1MW0A 4XZMX 5A95A 2YZRA 3BICA 2YCJA 1HX0A 2ESCA 5M1TA 3SFWA 1W3NA 1FKXA 5AN7A 1IR1A 1FBAA 3HURA 4GCAA 4M7TA 1ZLPA 2E68A 3UY7A 5DFAA 1FDJA 4HYWA 3AU6A 2DSKA 3L4WA 3LPGA 4L6HA 1PE1A 3FDKA 2WLZA 2VTFA 3MMTA 3R0KA 4PUWA 4W85A 1JQXA 4QBXA 4ROPA 3N3MA 2ZOXA 2VZSA 4AZ6A 2VOMA 3CWHA 4FMVA 3S47A 3RITA 4IIGA 2ON3A 4UBPC 2QDHA 1C8VA 1BSLA 1JRCA 2E77A 1SJCA 1V3LA 2GGJA 3KTSA 3PZ9A 2VYOA 1DIOA 4E8DA 3MB9A 3N1AA 3TIMA 2CLHA 3S2LA 2XM1A 1EP3A 2EG6A 1UROA 4BHYA 5EBAA 4HMDA 2ABAA 2OU4A 5BWFA 2ZRUA 3EDEA 1JF5A 3LRLA 2VEIA 1S39A 5I6SA 4FXFA 2C16A 2VKZG 1JL8A 1KWGA 1C93A 1HKWA 1W3JA 3M16A 1L6SA 4AYGA 2V3GA 1H7NA 2D2HA 3IIOA 1PVNA 1H7XA 1TJPA 3TTQA 3A64A 5EMMA 4BF5A 1XHGA 4MM1A 1AJZA 3T4CA 1PWLA 4UTFA 3VD9A 3H12A 3URAA 1NM9A 4IQEA 4Q22A 3VIHA 5BOEA 3UZ5A 5DEZA 4HQVA 4DUXA 2XDFA 3GTIA 3AXIA 3NGJA 2WZIA 4ACZB 5BU6A 3I68A 2PDXA 1D8CA 5DMLA 4WDUA 3WLKX 4HNLA 5D8ZA 4KWVA 2JKEA 3MJMA 1KM0A 2YDAA 3CUHA 1Q6CA 4IX2A 1CZ1A 2FVMA 4I9AA 4O1BA 3ITXA 4MB3A 4DLFA 5FJIA 4JX6A 3JU2A 4TX6A 2OT1A 1G4TA 4XAPA 4K36A 5EFFA 4IFKA 1Y0EA 1KGXA 1BRLB 4IPNB 4UFIA 2HISA 1SW3A 3PN8A 4D6EA 2SFPA 4PCNA 2WMHA 2F7FA 2Y7GA 1P0EA 1L6YA 5U4NA 2WANA 4Q4RA 4WF7A 4X2RA 3W7MA 1W5QA 4F2TA 4P7QA 2H6RA 4V15A 3P62A 3VCNA 7A3HA 3WK3A 5EB8A 2XH2A 4GUFA 4TX8A 4ZO6A 3UT0A 1E0UA 3NJ3A 4GLEA 1XGDA 2YXGA 2QKFA 4B15A 4ZB2A 5CCZA 2D3LA 1I60A 4D72A 1BRLA 4I9TA 1V7AA 4RLIA 4CD6A 2PPGA 3NQVA 3GHSA 4JQ2A 5AZ1A 1DP0A 1V6UA 3CUFA 4L56A 1GQNA 1JZ7A 3T09A 2WQDA 3VNDA 4HMCA 2V5CA 3EX3A 2UV8G 1M41A 1XSIA 2PDIA 1E9LA 5CSRA 3GYCA 1VPYA 4UMCA 4GE8A 1HO4A 1HIZA 1EP2A 3G1FA 4C7FA 4E0CA 3LHVA 4ORIA 4N0RA 2PODA 1V6VA 1KB3A 4IQJA 4L7ZA 1AJ0A 3QEZA 1DJNA 1KBIA 4RE2A 5KSWA 1TIMA 3WNMA 1HUVA 3SEPA 5K7JA 3HJZA 3TX9A 3E0LA 1J5TA 4IIBA 4PZVA 1D7FA 4GIRA 3STPA 2VFIA 5DXYA 4O16A 4AYSA 3GM8A 4IQLA 3FW6A 4H9TA 3I65A 4JDYA 1H50A 3WLOA 4EIVA 5LNRA 2NXIA 2VEFA 2PLJA 4PMUA 2X16A 2NWSA 4QLLA 1XH0A 2DFAA 5A6SA 4S3DA 3L4TA 3PPGA 4RE4A 5EA9A 1L6GA 5I3FA 1XC6A 3AS3A 3AC0A 3MUY1 4L9XA 3DC0A 1PCKA 1A0DA 1W2VA 3KVLA 1KFEA 1WKEA 5LA1A 3KRZA 4PRWA 5CSYA 1JDFA 3A12A 5GNXA 4O50A 5GVJA 3P8IA 3RX2A 3LPPA 2VDIA 4O0ZA 3SCVA 1JFHA 4V28A 1TWWA 5I0DA 3FXYA 1S2CA 2GPTA 3SDOA 2Y5SA 2WKLA 2FH8A 3BDKA 4S3AA 2XFYA 4FHAA 1IR2A 3S5OA 2YX0A 5HA7A 4AIBA 4HA0A 1VC4A 3O7UA 4AD2A 3TW9A 2DH2A 3W81A 2PWHA 3HQ1A 4LAZA 3FSTA 1KXTA 4P2VA 2Y8UA 3PY2A 1PDYA 1W8GA 2WKJA 4DPQA 1CB7B 1ONEA 4XTDA 3AMDA 3AHTA 3L67A 4ZTXA 2W6RA 3M6DA 4NAEB 1B30A 3KRSA 3TYEA 3SCUA 3RXZA 4I9JA 2NVDA 5C9UA 4L1GA 1C8XA 3UVIA 1ICSA 4DF1A 3CJPA 1GG0A 3SW6A 4J5NA 3RJXA 5I06A 3F03K 3IV8A 2REQA 5LNVA 4DRSA 1KM1A 4FX6M 4KFNA 1KM6A 2NV9A 1UWUA 2XN2A 1TIWA 3MANA 2I9UA 2VHLA 3EMQA 1B2YA 3RCNA 3ZYZA 1GONA 4OJYA 3EB4A 3ZLGA 2AKZA 1YBQB 4TIMA 3CTTA 1P43A 2ZXAA 2JEPA 2RHGA 4E4FA 3WNPA 3K4WA 4HT3A 2BY2A 3ZWTA 2P5NA 3PZNA 3SCQA 4AF0B 4GGHA 1D8WA 2DVXA 1AMYA 4C6KA 1TTPA 4QEHA 4EOUA 4YN5A 5CC7A 1YE6A 4XO6A 1KO0A 1M03A 4OWGA 4BI5A 1BEUA 4D1IA 1R3TA 3WLSA 1VAHA 1WZAA 4I90A 3Q45A 1EF3A 3NVDA 5D30A 2HE5A 3FGCB 3AICA 3SCTA 4EVZA 2R24A 3G0SA 4EK7A 4K3ZA 5G5IA 4HU4A 4IXHA 4A8NA 2Y7FA 1E6XM 4C6QA 4A6GA 5B80A 3MHUA 4US5D 4HZ8A 4NJGA 4Y96A 4PCPA 1J8VA 1EH9A 1JYNA 2ISFA 4JTHA 1MO0A 1RCOB 3BK0A 1R3SA 3BV7A 4I8DA 1W6TA 2IS7A 1TUFA 3T42A 2PDBA 2ZUVA 1TSIA 1Z44A 4CVWA 5CEWA 1HKJA 1XCFA 4AB4A 4EF9A 3RLUA 4RJEA 2JIEA 3WLIA 1FWTA 3ID7A 3OZMA 4B5VA 5F7UA 4XB3A 3DOPA 4E8GA 4DJFD 1N82A 4JX5A 5IHRA 1I45A 2QUTA 4UZSA 3W7NA 5I3HA 1MW2A 2WLYA 2GJRA 1QW9A 5AHFA 4CUCA 2DZBA 3KWSA 2BHZA 5AYBA 1EC9A 2O9PA 3V35A 2QW5A 1TZ7A 2DT0A 3L4VA 1DYSA 4IMGA 3NQDA 3W82A 1E5JA 2IQDA 4BZYA 4ZGYA 1XCWA 2XSXA 3NQGA 3KHDA 2G41A 2DT3A 4PA8A 1KXHA 1W3IA 4D8ZA 1HF6A 3LMZA 4NY2A 4JIRA 1QHZA 3NZQA 2I16A 3FSUA 2XJ7A 2CBIA 3ANYA 4JZ5A 4JN6A 3MYOA 4OE7A 3BAWA 2BXZA 4FIQA 2VJXA 4GO9A 4PYSA 1TTIA 2VD8A 1J9YA 4YCOA 3N34A 2JGQA 3REQB 4RNHA 3R8HA 2FYMA 1XRTA 1XLJA 4JQ3A 1E6QM 3S9ZA 4F0SA 3DHDA 4GKLA 4AUBA 1EJXC 3MA8A 2HBXA 3ZQ9A 3EA2A 3VIKA 3AIQA 2O9RA 3ITYA 3OGVA 3PM6A 3EXRA 4IGHA 4FXSA 2E5BA 4DAIA 1XYAA 4HD5A 3TUUA 4KQNA 2NX3A 2D2GA 2QCFA 3NTYA 1GKQA 4Z1BA 2IPJA 4WRHA 4AIEA 3H7UA 5BXSA 3OHIA 4US6A 4R7JA 5GQBA 3QW3A 4DY1A 4LVDA 1WP6A 2QEZA 2HVMA 5JBDA 3EOEA 4IIHA 1RVGA 3B05A 1PXGA 1FH7A 1RP8A 2OG9A 3M0LA 1KRAC 1GTHA 2J7GA 2WJZA 3N17A 2V63A 3BURA 3B03A 5L6UA 1LLZA 2ZE3A 3GXTA 3T0BA 3W02A 3SI9A 3BAXA 3GW0A 2XGIA 1XBYA 5CLTA 3EX2A 2RAGA 4GC4A 1FWDC 2XGZA 1R38A 3LCLA 3BG5A 5A1AA 1KXVA 4IT1A 5G1MA 4ZQNA 5M5DA 5CXPA 2ZBTA 1Z41A 4DJEA 4WGHA 1L8PA 1TWSA 1SZRA 3DI1A 4Z2GA 4ZZ9A 4FLSA 4IP4A 8XIAA 2BWGA 2BTMA 1RK6A 1GVYA 2YW4A 3H7RA 2RFGA