3LENA

Human aldose reductase mutant t113s complexed with zopolrestat
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lenA00
2PDLA 4GABA 3ONCA 2PDHA 3O3RA 2PDBA 1MRQA 4XZIA 2R9RA 1PWLA 1YNPA 3CAQA 4GACA 2HVOA 1T40A 4L1WA 4WDXA 2ACQA 2WZMA 4JTQA 3LBOA 2PFHA 4XK2A 4DBWA 4ICCX 3EB4A 4MHBA 3GHUA 2HEJA 3V0SA 4HMNA 4NKCA 3NTYA 1IEIA 5DANA 3C3UA 3LUTA 4PMJA 4R9OA 3R43A 3RX4A 1X96A 3LQGA 2FVLA 4JIIX 4QR6A 2A79A 3RX3A 2PD5A 1Z9AA 3M64A 1MZRA 2IPFA 4ZFCA 3CASA 4JIRA 3QKZA 1VBJA 4LAUA 2ACUA 3GHTA 3R7MA 1EXBA 4HBKA 4F40A 5LIXX 2PDYA 3RX2A 4IJRA 3Q65A 3F7JA 2INEA 2IQ0A 4QBXA 1AZ2A 4XZNX 4XVDA 4L1XA 2ACSA 1YE4A 3B3DA 2FZ8A 2PEVA 3V35A 2PDCA 1EF3A 3LENA 5JH2A 4QX4A 1OG6A 2IKHA 1S2CA 4XAPA 4DBSA 2PDXA 3FX4A 4LBRA 4XZLX 2PDUA 2WZTA 3UFYA 1YE6A 1Q13A 4IJCA 1S1RA 2AGTA 1X98A 4WDTA 3UP8A 1JEZA 4PRRA 1J96A 2PDFA 1SM9A 2PZNA 2F38A 4H7CA 3UZZA 2PDNA 4G5DA 1AZ1A 2P5NA 1R38A 2HDJA 4Q7BA 2PDQA 4YU1A 3COTA 3MB9A 4WDUA 3BUVA 4YVXA 3CMFA 4XZHA 5HA7A 4JTCA 3V0TA 1ZGDA 1C9WA 2I17A 1HQTA 4YS1A 5LIWX 2DUZA 1PZ0A 2PDGA 1AH3A 2ACRA 2HE8A 1QWKA 1ZQ5A 3GHRA 1HW6A 3N6QA 3FJNA 2NVCA 3H4GA 4GIEA 1YNQA 4XO7A 3N2TA 1IHIA 5JH1A 4JIHA 1RY8A 4LB3A 1XJBA 1ZSXA 2HVNA 2IKIA 2PDKA 4I5XA 3ONBA 3LNMA 1PYFA 2DV0A 4OTKA 2IKGA 4XO6A 3D3FA 4YVVA 3WBWA 3LZ3A 2IPJA 1PWMA 2IKJA 3S3GA 4PR4A 3G1RA 3H7UA 4LB4A 4JTRA 4JTDA 5LIYX 2INZA 4ASTA 2HV5A 4JQ2A 1RY0A 2IPWA 2ISFA 4JQ4A 2J8TA 2IQDA 3R8GA 3M4HA 2FZDA 3UZYA 1ZUAX 3BCJA 3T42A 4QXIA 3WBXA 4YVPA 3O0KA 1ADSA 3LZ5A 3V36A 2PDPA 2VDGA 3CV7A 2PDMA 3UYIA 4LBSA 4WDWA 3H7RA 1FRBA 1Z89A 3BV7A 2FGBA 4PUWA 5AZ0A 2BGQA 1K8CA 1M9HA 4PUUA 2PF8A 3LEPA 1GVEA 1AH4A 3P2VA 4GQGA 4DZ5A 1PZ1A 1X97A 2BP1A 2PD9A 3EAUA 2IS7A 4WGHA 2FZBA 4XVEA 2R24A 3ERPA 3UZXA 4GCAA 1Q5MA 3R58A 4FALA 4DBUA 4AUBA 2F2KA 3UGRA 5C7HA 4WRHA 3GHSA 3CAVA 4JTAA 4Q3MA 2HE5A 1RALA 2NVDA 1LQAA 2FZ9A 3DOPA 5AZ1A 3CV6A 4H8NA 4PRTA 5M2FX 1UR3M 3UZWA 1A80A 1US0A 4FA3A 1EL3A 3R6IA 3VXGA 3WG6A 3G5EA 3MC5A 2PDIA 3UG8A 4LAZA 1AFSA 5KETA 4IGSA 2BGSA 4RPQA 2I16A 4EXAA 1S2AA 3LN3A 3R94A 1S1PA 1AH0A 4XZMX 1Z3NA 3KRBA 3DN5A 5LIKX 4GA8A 1QRQA 1Z8AA 5LIUX 3WCZA 1XGDA 4GQ0A 3R8HA 2ALRA 4FAMA 3EB3A 4EXBA 1MI3A 3LD5A 4JQAA 3V0UA 2CLPA 4FZIA 3UWEA 3BURA 2DUXA 2PDJA 2C91A 3WBYA 1T41A 3LQLA 2QXWA 4JQ1A 2PDWA 5HNTA 4JQ3A 3GUGA 5HNUA 1LWIA 1XF0A 2IPGA 4WEVX 3Q67A 3U2CA 1EKOA 3M0IA 1VP5A
chains in the Genus database with same CATH superfamily
2FDSA 3KL3A 2EJ1A 3EBVA 3FV9A 1UB3A 4L4PA 4P7LA 3VOJA 1ME8A 4FNPA 1W9BM 3LRLA 3BSGA 4A4AA 3H55A 2ACQA 1KRMA 1TWWA 1UUQA 3UWQA 5IXEA 4IPLA 2E09A 5EFFA 3UJFA 1GTEA 2PLKA 4S38A 1XIDA 3PBYA 3MI6A 1XM3A 5H8UA 1XYAA 5BU9A 4QG6A 1IE7C 2QEZA 3LQGA 1UJQA 3MDWA 5M5DA 2VZVA 2BY3A 2WLYA 3F5KA 3M5YA 4RR4A 4JCMA 1WQ5A 4O28A 2PD5A 4GYKA 2Y7DA 5EGRA 3SN1A 1QK2A 5EFDA 1ZCOA 3CL8A 3LCLA 2E7FA 1IT7A 5CZKA 1XG3A 1E43A 1PYMA 4NJKA 4MY1A 2QS8A 3BDKA 3GDKA 2Z00A 2ABBA 4WJEA 5BWAA 1BF2A 3A4XA 1VD6A 1VFSA 4ZTYA 1AZ2A 4MLRA 3O16A 2YBUA 1TVNA 3SGUA 5CJNA 5CSUA 4M7SA 1TCDA 4IIDA 3D47A 4AWTA 1K02A 1SJBA 1XLBA 2GGEA 3IK2A 3DG6A 3QXBA 2R14A 4CNUA 1PHWA 5KEZA 3KBVA 2YXGA 5XINA 4H8HA 3H70A 4L1GA 3S1UA 3UFYA 4DBDA 1OFDA 2D20A 4JX6A 4IJCA 1K7EA 5HQEA 3ID7A 3E2SA 4RNJA 1E0UA 2GSJA 1CXIA 4M8UA 3BMXA 3P74A 3EA2A 5J04A 3UZZA 9XIAA 4YTSA 2HDJA 4FXSA 2E3ZA 3E5PA 4CVWA 2VXNA 1K6WA 5HWJA 2CXGA 3W73A 3GNNA 4LCRA 5SWUA 5I79A 1WXJA 4PN2A 4DJFA 4C7DA 1EFZA 3UVIA 1SYTA 5C55A 5FESA 5CPLA 3T2QA 1W56A 1L6WA 4M24A 4FNSA 4WZHA 1NOFA 3MPGA 1UOZA 3UJEA 1LUCB 2YGYA 3VTRA 1HW6A 3TCSA 4ZA0A 2NVCA 1R30A 4KRTA 2ZWYA 2PRHA 1PTDA 1WCGA 1J01A 4MWAC 3WMLA 3TN3A 1NAL1 3W37A 5A8NA 2XWEA 3R89A 1XDMA 2X1TA 3DYPA 3I3BA 1PWMA 2X41A 3VGEA 2VHLA 1Y65A 1CGTA 3UYCA 4Y8EA 1NH6A 2PP0A 3QHOA 1RCOB 3LGEA 3ARZA 4WJ8A 4JQ4A 1POKA 2WNWA 4OGZA 2IQDA 4JYDA 1TA3B 1LLZA 2FQIA 3QGKC 3TR2A 2WQDA 3BJTA 4JY9A 2PBGA 2DT1A 2JALA 4US5D 2VQUA 5I3IA 3NQ6A 4TX9A 1K9FA 1T8QA 1F3TA 4W7VA 3M0HA 1GOWA 3BW3A 3T8QA 3N19B 5DCDA 1W31A 2YYTA 4NZJA 2VC7A 1AL7A 1BSIA 2E5CA 4UFMA 5ENLA 3M0XA 1TWZA 4XIMA 3K8KA 2AKZA 3KM8A 1H62A 4LCSA 3L0GA 3WJZA 2PGFA 2X2YA 1KTBA 3QYSA 2YA2A 2CLLA 5CC7A 4UOJA 4JTLA 1JRCA 1UIPA 1UKPA 2NWSA 1UC5A 3E49A 2W9MA 4ML9A 4MDOA 5M17A 1AD1A 3QV8A 3OA5A 3AYVA 3HGOA 4X22A 2PCQA 3UZXA 4C91A 7A3HA 2D24A 5EMYA 1JCTA 1X39A 1OCNA 3LGDA 2Z1KA 2XIBA 3SCWA 5C7HA 3L68A 1KFBA 3GXTA 3L2MA 4GCXA 1E4NA 1F3XA 2RGLA 3GX9A 5CSRA 1QHZA 3GU9A 3NR0A 2H6RA 4U31A 3MJYA 1BWLA 1W32A 2NX9A 2V6AA 2J9XA 4MNJA 4JY8A 4N02A 2O7SA 4O57A 3E2RA 1UR3M 4GUFA 3UZWA 1EEPA 1GQIA 5M03A 1LDCA 3G5EA 1U1UA 3UG8A 1EH9A 1GZJA 1ZP3A 3L4ZA 3WJWA 3PUOA 1UA7A 4IIBA 2FJKA 4IGSA 3GBDA 3C0JA 1EWEA 3TSBA 1FCBA 4K36A 1ZBVA 2Q01A 3SCSA 4Y9OA 4U3AA 3BLIA 4IGMA 4QEEA 1UIOA 4UR7A 4FOKA 1D8WA 4I90A 1ISVA 3SR7A 3W74A 3LB0A 1M3UA 5ABGA 5I77A 3EEGA 4TV6A 3T6CA 2CITA 1H1ZA 4FZIA 1UZDA 4H2HA 2QPSA 1R9ZA 4ROPA 5JIWA 4OUIA 2QXWA 3ISIX 3VM5A 3GUGA 3WYZA 3WK1A 4K39A 4PEKA 4UOQA 4QLLA 1FKXA 4WEVX 3AS2A 3IPWA 3LTPA 1OZQA 3NQ7A 1BD0A 3IUIA 4ZZ9A 1LROA 3A9IA 1EKOA 3GKAA 3HO8A 1MSSA 1JZ4A 3POHA 3QN3A 1JZ2A 2QUUA 4YXGA 3SECA 1JQVA 3GYCA 1UD3A 3B8VA 2Z24A 4GZIA 3WF0A 1RQBA 4Q33A 2HWGA 1L2QA 3NM1A 1RH9A 2TODA 5D9NA 1HVXA 2E0PA 3E38A 3H12A 4DJFC 3BAXA 3CC1A 1LF1A 3LBOA 2HJPA 3G8EA 4Z2GA 2W63A 1UASA 3EX3A 3GHUA 4Q8TA 2J78A 1JJKA 2QR6A 3SCVA 4NKCA 2W0UA 3LUTA 3RO6A 3WF1A 2CKSA 3ZFHA 2Y63A 3QY7A 5FJTA 1B2YA 1TPDA 2DZUA 4IMEA 2GFTA 2DZPA 5C2CA 4CD8A 4EK7A 3L12A 3QKZA 2XFRA 1EJWC 1QNQA 1QOXA 2BHUA 4HU4A 5CC6A 3RILA 2E9LA 3ZSTA 4JTHA 3C6CA 5DMMA 2B81A 5D32A 4QM1A 2Z27A 1JF6A 4QDWA 5HJYA 5FF0A 3NEHA 5AVNA 3BICA 2FFIA 1M65A 1ZTVA 1P0EA 1JIBA 5A2BA 4MJZA 1CBGA 4TQTA 3OG2A 1POJA 5C70A 2VZOA 1RAKA 2DIEA 2OGYA 4XBKA 1FWDC 4LNYA 3SQLA 4E4UA 3DC0A 4DJEA 3LMZA 4HMCA 3RNDA 3S1XA 5GPRA 3OYXA 3TWBA 1EO7A 2OYLA 2W79A 2DVUA 1H7WA 5PTDA 3G22A 3LHWA 2ZXAA 1OM0A 3RFAA 4NP7A 3SFWA 3H22A 3UT0A 3WQOA 4DY1A 5LNSA 3VD9A 4UMCA 1RJPA 1SO3A 4N4PA 3R8RA 4NI3A 3N9SA 1V93A 4IH3A 2GYIA 3IUHA 3G3MA 3SCQA 2FIQA 2XWDA 3UF9A 3GFXA 4B3KA 3QFWA 1G94A 4O10A 4GYPA 3VUSA 4C1KA 3PTKA 4Q6XA 3T0CA 1SW3A 2GK1B 5D2VA 3KS6A 3GR7A 1RV8A 1JCNA 1UH3A 3AICA 4Z1AA 4DLFA 3O6YX 1VYPX 2V5CA 4K37A 4A8LA 3SGZA 4YTQA 5MKGA 4FR1A 2KZHA 1GZGA 4AYSA 3N2TA 1IHIA 3LK6A 4AF0B 1YQ2A 2H8XA 4HA4A 1A5OC 2E5BA 4I5UA 1ECEA 3B0XA 4JDBA 1VFMA 3AJ7A 1W1B1 5DT7A 3ZOAA 2DV0A 4CQ9A 4PMXA 1E1CB 2V3GA 3D3AA 3E5BA 3STGA 2FHFA 4M80A 1XGZA 2WAGA 2PWHA 2V5DA 3OBAA 1LYXA 4INFA 3DH7A 1BVWA 3MSRA 3UWVA 2WVVA 1PX8A 3G1RA 4MY8A 3TSDA 3VKCA 1RVKA 2J88A 4QHRA 3MKCA 4CGTA 3WLNA 2HMCA 2J8TA 1QK0A 4XB3A 4MWAE 1GJPA 4HK6A 3S6DA 4ATLA 1UR0A 4IX0A 2WMJA 4JFVA 4K8HA 3WNOA 2Z2UA 5A6MA 2VUNA 5GQBA 4QXIA 4B3LA 3B8TA 1TWDA 1A3XA 4LVGA 3ABOA 5CLTA 4GY7A 4IHCA 4FXJA 5I6SA 2NQLA 4NJIA 4UBPC 3CV7A 5L6UA 2C19A 1BG9A 3IJQA 1H11A 2XUCA 2B7QA 3ZQ9A 3IWPA 2WVUA 2V9DA 2IUZA 1OT2A 3KDOA 4U5KA 1UD4A 1JI2A 4JN6A 4KWWA 3WLIA 4LAKA 1SU5A 2QULA 4L6DA 3THQA 4Q8PA 4K1WA 1GVEA 3LLXA 3EWUA 1TTIA 3N73A 2VQTA 1QW8A 4D1JA 1YMYA 2ZZ4A 4IOTA 3GW3A 4WSKA 4M6QA 4HMDA 2W92A 1I1WA 1K03A 2QLYA 1KTNA 1QNOA 3FOKA 3U7VA 2X0SA 3QZEA 4HPXA 1XRVA 2UY4A 1EOKA 1H0IA 4RZ5A 1VYSX 4XAYA 1E70M 1TVPA 2NT1A 1IXPA 1VFHA 1SZNA 3W7NA 3G1YA 3AYTA 3VILA 4MKVA 4DJDA 4Q8OA 4X63A 5GVJA 2ZE0A 4NSBA 1W5OA 4CU8A 1XV8A 3S6TA 2WCAA 1EX5A 1EL3A 1H4PA 1R7AA 1LOLA 2XFFA 1QUMA 3MC5A 1FHVA 3KAOA 4UTKA 1MW2A 1EA9C 2X7VA 3V16A 4LRTA 5KETA 1NSJA 2JGYA 3NJ3A 4PMRA 3CQHA 3WNKA 4AEFA 3H53A 2EG6A 3WJXA 3WD3A 1FDYA 4GXWA 1OC6A 2A85A 2PB1A 3AS3A 4GA8A 2BDQA 3ZZ1A 2ADAA 3ABXA 2ZXBA 1RZMA 3WEMA 4J35A 3H21A 3EYPA 5FJPA 3V18A 2J47A 1BG4A 1P5BA 3LD5A 1G7VA 1SJAA 3TLQA 1V0LA 4POCA 1ZL1A 3VD5A 1DL3A 3I6RA 4O15A 1UWIA 4TVDA 1YKWA 1DXFA 4MG4A 5CZJA 2BLEA 4EF8A 1LQ2A 1KR1A 1QPRA 4QAIA 4HP5A 3LA4A 2F6KA 1K9EA 3H4XA 4GLEA 2VVSA 2DIJA 1QJWA 4O14A 4C90A 1EC9A 1JFHA 4GABA 1XQLA 1I8JA 2AOSA 4CKQA 3TTYA 1QTWA 4WXZA 3PR2A 5AC4A 1P7TA 2NQZA 1XHGA 5TD4A 1MWOA 5AY7A 5DELA 4RE4A 4JTQA 1BXBA 2HQAA 2PFHA 4M5PA 1CXEA 3EMZA 4GYPC 4H8VA 3FS2A 4H9TA 6A3HA 1A5CA 3HPXA 1F3WA 2R1KA 1F8MA 4HN4A 1HO4A 2GDVA 1EQPA 3HTWA 5GNXA 1KCZA 4PTNA 2JEQA 4EF9A 2HRWA 1N2VA 3L65A 3TV8A 1XLGA 3VGBA 3W71A 3H2NA 1BXNA 4HZ6A 1Z42A 4EOUA 5FEWA 5A6SA 2J66A 3WLPA 3NQFA 3RLVA 1GZ1A 4UTTA 4XIAA 2R94A 1YXYA 1W1ZA 1IR2A 7PTDA 2OLAA 4UFJA 2ZRYA 1RCQA 3CPRA 2BXYA 1UW9A 1TMQA 1R3SA 3WLLA 3B0UX 1YE4A 2PEVA 2D3NA 4LW7A 1SFTA 3CAWA 1WO2A 2XINA 2GUBA 1EO5A 1J93A 1HL9A 3L66A 4XAPA 5CPTA 1CGVA 3G3DA 1NDWA 3W7MA 2Z28A 1R6WA 1Y5VA 4NIRA 4QSHA 1J2BA 2D2OA 1R85A 1GOQA 3HFYA 1NP0A 4OHQA 3GC4A 2ZVIA 1JRBA 1RUSA 3KVLA 1QCWA 2QCEA 1GKPA 4Z2HA 3PK7A 1UD6A 3M6YA 1R38A 1I45A 1KLZA 1QT1A 5GNYA 3TZFA 3LHUA 4HTYA 4FOUA 4LVFA 1H0GA 4DZHA 3P7YA 5CPMA 1DE6A 3CQIA 3MI2A 1KW1A 3NFUA 4ZXLA 3AMGA 3FFSA 3MU7A 1TQXA 4MUPA 3GH4A 1N8WA 1TSIA 2WJDA 3WQ8A 1XKYA 1XLEA 2W5FA 3ZVHB 1C91A 4FHAA 1G7UA 3OLIA 1DORA 3VOCA 3E9AA 2AMXA 5A5WA 1HUVA 1E1EA 1BWKA 1JDAA 1K8YA 4JFTA 5K3VA 4NNBA 4B4HA 1IGWA 4PUMA 3U0HA 4XKYA 1QI5A 1Z6KA 1ZSXA 3S2LA 4C6QA 2ZX5A 3GDBA 2J6XA 4GJJA 5CEWA 6CGTA 3GXFA 3TJXA 3R11A 3QZAA 3FW6A 2OVLA 1H60A 1ZENA 2UV8G 4UMBA 1O66A 1NARA 1HKWA 2XPKA 3BXWA 1RCXB 5LIYX 1EYWA 2BNJA 3QPEA 1RY0A 3AISA 2CZEA 4KFOA 3TC3A 3M4HA 4LQ1A 4DWSD 4JDYA 3A3WA 3LTYA 3C2FA 4IZGA 4NT0A 3MW7A 3V4BA 2W66A 2FTWA 4CEUC 1I1XA 3W53A 4RW5A 2E5DA 1A5BA 1LCOA 2IW0A 1JUEA 3CUIA 3NQCA 3W2LA 4UTUA 3SQMA 1O4UA 4TU1A 4A21A 5BXRA 1MEWA 2QVNA 4MY9A 3ANYA 1HJWA 4HSHA 1DQUA 4AHPA 4C7GA 3H7RA 2WJEA 4F0SA 2Q71A 4CN4A 4W84A 3PSWA 1V4YA 5ECVA 1A4MA 4O50A 2ATSA 2PF0A 3DFYA 3AALA 4I7WA 5CBIA 1G4SA 3MA8A 4L6OA 3P60A 1HKIA 2Z1WA 1OG0A 1RK6A 4IMCA 4A35A 1HKKA 1EJSC 1OBAA 5CPQA 1REQA 2HPIA 1XUUA 2RDTA 3VZXA 3TYBA 7REQA 3OJGA 3MMWA 1GVRA 3VOIA 1DKWA 5BXSA 4MFEA 2E4TA 1ADDA 3BZGA 4J1OA 4LX4A 1JNDA 4HT3A 3O07A 4F66A 1FOBA 4O1CA 2NQ5A 1EBGA 3EWBX 1IT0A 1HJXA 3T05A 1V3MA 4DLMA 1V02E 3W76A 3QR3A 1US0A 2YCJA 2EJAA 4W88A 4AISA 1XFBA 1A4LA 4WK9A 2J75A 1CI1A 1W9VA 4BF7A 5BMWA 4J3XA 2FTPA 2PP3A 3UJ2A 4IP5A 4MNMA 4D71A 1P0KA 4ZSTA 4US5A 3OU8A 1TZZA 3DZ1A 4K8EA 5U7SA 3G8RA 2FPVA 1CEOA 1W3HA 3EGJA 3W7DA 4A3QA 4J5NA 2XGZA 3EOUA 3QMSA 4D6IA 2ALRA 4JTUA 3CIXA 4B9ZA 3UGVA 2BFGA 4QJ1A 1NQKA 1KFJA 1CLKA 1YLVA 4EXBA 2OSWA 5DXXA 4FPSA 7TAAA 3G0XA 9XIMA 3W1NA 3A4AA 3RU6A 1TV3A 2Y0FA 1DHPA 2XVGA 1MZHA 2QCDB 3LSBA 1OZMA 4UIOA 4KEUA 1KFCA 5A6LA 1W9UA 2CLIA 2OYMA 2I7GA 1V03A 3VNIA 3B04A 3WIJA 2PDWA 4LUSA 2Z1SA 3URBA 3PZNA 4MYXA 5HNUA 5HAOA 2FH8A 1LWIA 4FSAA 4B5TA 5CBBA 3VGHA 4KEVA 3SUVA 2PCEA 4GBUA 3W7QA 5CGQA 1LORA 3GNDA 4M0XA 4V1XA 4L61A 4NX5A 2O9RA 4KGLA 1UWQA 3FSUA 2PC4A 4OJYA 3RCMA 3QMTA 1RJQA 1XW8A 2R91A 4L1WA 2Y8UA 5KZDA 1T5AA 3BOXA 4DAIA 4FNRA 3W23A 1IEIA 2GGJA 5DANA 5DY3A 4PBGA 1X96A 5LA0A 4PL2A 2VP8A 4S1FA 5HATA 1U5JA 3EWYA 4FLRA 5C5YA 3P5YA 1KQYA 3K1DA 4M1BA 1K6AA 4MPQA 3I4KA 3MBDA 1DWHM 2FB2A 4EPDC 3WQDA 4HNOA 1UWRA 5I03A 2NV2A 3N4FA 3CO8A 4AYGA 3GHTA 4TR9A 3R7MA 5IDZA 5DCEA 5EMUA 2VC5A 4F40A 1E9IA 2OB3A 2V0TA 4IICA 4GIYA 2GJNA 1FDJA 4LPCA 3VOFA 3LCWA 2G3MA 4MNKA 4G6CA 3CO4A 3FA3A 4KRZA 1WAWA 4DUWA 2ZRVA 2QUNA 2PDCA 3R0KA 2AAAA 3TQ0A 1S2WA 3S0CA 1S2CA 2CERA 4LALA 1J0JA 1IR1A 3VC6A 4L9ZA 5C2XA 4O12A 1W3NA 2YFNA 4M6UA 1DJZA 4CQ8A 1D8CA 2WBKA 1W3JA 2BXZA 2W67A 1H7OA 4HPGA 3NA8A 1XS2A 4PRRA 2GJXB 2A3LA 3UQNA 4ES4A 7ENLA 2P5NA 2DDXA 5FJUA 4AD5A 1K4GA 1PUDA 1VBUA 1YX1A 3B9AA 1KRCC 3AZTA 3P61A 2E67A 1CPUA 3A47A 3MB9A 3HMJG 4CNPA 5G4HC 2VNCA 2XN0A 3IIVA 1WDRA 5M1TA 3RGTA 1UOKA 1XUZA 4EPKA 1B0IA 3WLSA 1HQTA 3SRHA 2XIOA 1KTCA 3CYVA 5HR6A 4MM1A 2VEKA 1T99A 3FHQA 3FY1A 2XVPA 3M07A 4QGCA 3BL3A 3JZUA 3AWOA 4WJXA 3VMOA 2J7GA 1RK5A 4LEFA 2QCMA 1XLJA 4JTSA 4PCSA 1V6XA 2QDHA 4C6BA 1RY8A 1GVQA 5A95A 2XJ7A 2ZICA 4JHOA 2OX4A 5TF0A 3ZR5A 1LQ0A 5BRPA 5I2UA 1W5PA 1JXKA 2G96A 1U22A 4X2RA 1OX5A 2I9UA 3UETA 2E1DA 3UA3A 5REQA 5G1MA 3VFCA 1WV2A 3WL0A 3H7UA 4E3VA 1G4TA 3WLHA 1ZCCA 3NL3A 5HPCA 3KX6A 3QGVA 4C5ZA 4YTRA 1FBAA 5BWFA 3NOYA 5DF0A 5E0CA 3R8GA 3ATZA 3N34A 1KNWA 3W2MA 3IIXA 1F8IA 3PWIA 2FZDA 4IG2A 2ISDA 4GFSA 5LA2A 3O8AA 4IWWA 1XIMA 2AL2A 2WMIB 4J4KA 4F0MA 1TMHA 4I9JA 1OF8A 2WPGA 1F73A 3SRDA 3NQEA 3NL5A 2PDPA 2GSEA 3A24A 2VT0A 3PZ9A 3F2CA 2CNCA 3KFTA 1W5NA 4LUTB 1BKSA 1GTHA 2QMKA 3ME3A 1EUNA 5A69A 2OT0A 1FWAC 3E6EA 3LHVA 4D9PA 4DX3A 2FPTA 2EPNA 1QMLA 1GHRA 1H51A 4NJJA 5AYIA 3IJ9A 1TR1A 1S39A 4R33A 1UG6A 4WCJA 3TX9A 5G4WA 5BOEA 5GJNA 4QQ3A 1FWRA 1DV7A 3H2MA 3PM6A 2ZZ1A 3WLOA 3ES7A 3L23A 2DVXA 4MIMA 2OGJA 4I7VA 5HOSA 4LH8A 1DWGM 3R58A 4Z42C 2RKXA 4FALA 4H3DA 3GIYA 1IZJA 3L9CA 4AIOA 2ZUWA 4JTAA 4AEEA 4A29A 2Y8VA 1OYBA 4L56A 4Q3MA 5LYRA 4GC4A 1V3LA 1TV5A 2W62A 3DECA 3LCHA 1MXDA 2XVLA 4RXGA 2BOEX 1CX9A 4NYYA 2ZRWA 3P3BA 1K4HA 4FA3A 3ORWA 1A0EA 4LCQA 1OINA 4CQCA 5CZ0A 1Y8BA 4ZQPA 3VGGA 3M5XA 3O9NA 4FO4A 1B54A 1E1FA 3CTLA 3G1HA 1XC4A 4WSHA 3LCIA 2I16A 1B3VA 1S38A 3G6MA 1KLYA 4RV3A 1GWJA 2J79A 3WQFA 3ZT6A 4GUHA 3O06A 4F0KA 1IWBA 3LBCA 1LRQA 3NO1A 1JDDA 1ZPTA 2BXVA 2F9RA 5EBAA 3FXYA 5DLCA 3JZEA 1J5SA 2CU0A 1KKOA 1PCKA 4O1FA 3U9IA 2HXTA 2VGBA 2C91A 4NZCA 3ABRA 3LQLA 3PPHA 4JQ3A 1AJZA 3NURA 2VFIA 4GX9A 2YDRA 2P88A 5A8PA 1GOOA 2OSYA 3ALGA 1OGBA 4R88A 3W25A 4BF5A 4QP0A 4ZL1A 2ZX9A 2HCVA 3PY2A 4LWWA 3VNZA 4YNGA 1PPIA 3POCA 1HT6A 1KM6A 1J8VA 1VGAA 3B8DA 3IIZA 2R9RA 4C5YA 3QV9A 1IT8A 3T4WA 2VX4A 3MKKA 4UQ9A 3ANVA 1KRBC 1EQCA 2GSHA 3LPPA 3MHUA 2PGWA 3BLFA 3A22A 4KWSA 1PJ9A 2C13A 3DBNA 2RUSA 4RE0A 2FJUB 2J25A 1BGAA 1HXJA 3ALFA 4UR9A 1NM9A 3C2RA 4GI8A 5I3FA 2XSXA 3HFTA 4K7VA 4KQNA 3WY1A 1U83A 4OECA 3W75A 6XIMA 3BQ6A 3S5NA 3GU1A 4W86A 3S42A 2J74A 4IFKA 3RX3A 2IPFA 1FH8A 3AHZA 4GI4A 1R2SA 2MUCA 3NZRA 2CC0A 2E28A 1LG1A 1XIJA 4GKLA 3F7JA 1RP8A 3BSMA 5DX7A 4ZQOA 4EAYA 2NXIA 1LUCA 3QSRA 4HNLA 2O7QA 5F1UA 3D5HA 3KL0A 1W9XA 1XYLA 3V35A 3E12A 4N9BA 5K4XA 3I65A 4W5UA 1ZFJA 3GO2A 2MANA 1U33A 3DCPA 4DYJA 5G2WA 2GDQA 2PE4A 1NVMA 2PS2A 3GQYA 3UCCA 2ZDRA 2E8ZA 3VIIA 8RUCA 1XLCA 2XIIA 3TEVA 4PC8A 3BAYA 4JKMA 3K4WA 1GYMA 2OFJA 1MUMA 1KWGA 4CCCA 1US2A 2PDFA 3SAZA 2AQOA 5J5DA 3QM3A 2AL1A 1G5AA 3CZJA 4WIWA 2VWSA 3CHVA 4NHVA 3N2XA 4RPPA 2F61A 2R6OA 1A5LC 4Y9AA 4Q6JA 3GAYA 4E6MA 4H41A 2DZXA 1C8XA 1DJGA 3W07A 4HNCA 4XZHA 5HA7A 4JTCA 3RITA 1TIMA 4X61A 4DEFA 1YDOA 1JPMA 1GW1A 3DHFA 4N9EA 1MW1A 2E68A 3NNTA 3A5FA 4DI8A 4B5SA 3S2CA 3LM7A 3V1PA 2XH7A 4LJ3A 5HBFA 1I6NA 4P5UA 4NZ4A 1YNQA 2ZC1A 3LV5A 1P6CA 2GGGA 3MUAA 4S3FA 1XCXA 2RDUA 3SY8A 5JH1A 4HHLA 1QFEA 3KUMA 3EOEA 2C0HA 4F2BA 2AMGA 3VDCA 3K4AA 3GW0A 4E2OA 3LNMA 3MI3A 4E8DA 1PZ2A 1E0XA 2IKGA 4FNTA 4QS5A 3M16A 4JD4A 2B7PA 3LNPA 4PMNA 1JCMP 4WY0A 1DQWA 4Y96A 3L2IA 5D8WA 1PB0A 3MUIA 4AD3A 3C0LA 4UFHA 5EA9A 1OGSA 3NPWA 2G41A 1VPYA 4LY4A 4ECLA 1FP8A 1DXIA 1TR9A 1VENA 3A3XA 4NZ3A 3PB0A 4MAVA 4LNCA 5FL1A 2AQVA 2Z4GA 3MQTA 4AU0A 1C93A 4RUBA 2OLSA 5AHLA 2PRMA 3MSYA 3A9BA 5DRIA 2QV4A 4BR1A 3O0KA 2VENA 3GM8A 1KRAC 3NXLA 4D6CA 1VJZA 3UG3A 3EWCA 3IANA 3V36A 1WZAA 3RM4A 3P14A 4O1EA 4J28A 4YYCA 2BVTA 1M01A 1E6RA 2RJHA 4K68A 5I3DA 1Z89A 1UD8A 2JKEA 2IXUA 2VFEA 3S8HA 3LEPA 3RMJA 2WKJA 3AMDA 3FVDA 4FLOA 1A0DA 2GQ3A 1OCJA 2Y5EA 2D22A 2PLMA 3WLQA 4XVEA 2R24A 1S2UA 3F5LA 4U2ZA 5KZMA 2OWCA 1X8FA 3GR8A 2PSNA 3THUA 1F5ZA 1EJUC 4IMFA 4PCNA 1XSJA 3E02A 1DJQA 1JDFA 4BY3A 2OEMA 2F8QA 3RK8A 2ODOA 4CQAA 4AFYA 3USBA 3FDGA 1B3YA 4AXNA 3W1QA 3B9NA 2HBVA 4ALDA 2DJXA 2VX5A 3EPMA 3A5VA 3F2DA 4XAFA 4O8RA 1A80A 2ISVA 4K7YA 1NOUA 4O4VA 2A0NA 3MP3A 2C8NA 5HANA 4DWSA 3W02A 4DF1A 3AUOA 3VIOA 3VO0A 3WQGA 4MVAA 2G95A 5KMYA 3E2QA 4GNVA 1TPB1 1W1IE 4RPQA 1GOKA 1JYVA 2A7NA 4GISA 4XUYA 4JCLA 2GVEA 5AC5A 1XYZA 7XIMA 4M6VA 2CLOA 5A6BD 2ESCA 3WDRA 2Q6ZA 2CIPA 3SDOA 4E0CA 1WXZA 1JZ8A 3RLHA 4EP8C 3NDZA 2VCBA 3G6LA 4HGXA 4LGXA 4F9DA 3QFEA 4KCVA 1SR9A 4JTKA 3DYOA 3EB3A 4E8GA 2P10A 4GINA 4KWVA 3NEVA 2QJIA 1XISA 2J9YA 4QIUA 5EB8A 3RM9A 3BURA 3HPSA 1DJXA 2XZ9A 1QHPA 1B30A 3LOTA 4Q32A 3RPTA 4I5RA 4AVNA 1XLKA 5HNTA 1S2VA 3WDPP 2YW3A 3CU2A 4B4FA 4EWND 2QV5A 3DG3A 4P7QA 3ELFA 4AVOA 1V6VA 3HV9A 1UR4A 3CK5A 4AY8A 3MO7A 3MY9A 4B5UA 2HS6A 4IQJA 3IRSA 5LNUA 3VA8A 3CWHA 2BOFX 1NWTA 1QU4A 3MZ2A 2WVTA 4CU6A 3OQ8A 2AQWA 3B0VC 1Q2SA 4S3CA 3WUEA 1QR7A 3SZ8A 4NUWA 4DIAA 5E6ZA 3MV11 2CCRA 4JTTA 4GACA 3QBUA 2WHKA 3AMKA 1OC5A 1DYSA 1X6LA 1JYWA 5I02A 5K9XA 2X16A 1JCLA 3TMLA 3W7HA 1H2JA 3C8FA 3BMVA 1VEMA 1W1PA 4Y6GA 3SQSA 3EA1A 1BGGA 1JAEA 2OX1A 2GWGA 2QVHA 5DT5A 3HG3A 3FJ4A 4H2CA 4EX4A 1DTUA 4US6A 3M64A 2PPGA 2SFPA 5D2XA 3CASA 4BQ2A 4KIEA 1P4CA 4Q4RA 2NQ9A 1Q6OA 1A0CA 4O8AA 4LUYA 1EHAA 2VRQA 4LBUA 1LLWA 3LU2A 1MMFA 1P1MA 2WHJA 4C1NB 2INEA 2DUAA 2GK1A 3IIOA 4V27A 5EMKA 3H2OA 3WZ0E 4O4WA 4GZ7A 3CUGA 3QZ6A 3PBGA 1Q7QA 2XU2A 5AYYA 3OQEA 5JH2A 4QX4A 4A3YA 4W8AA 1OG6A 3APYA 4AF0A 4CNOA 1IEVA 4TMBA 1Z41A 4NRSA 4L4OA 3GG8A 2CETA 1E1CA 3FVMA 2Y1HA 2O92A 3P0XA 3MHGA 1VEPA 3PAOA 1DBTA 1LBMA 3TC6A 5K9CA 1SSDA 1JYNA 1SM9A 4IJBA 4D6DA 3CV2A 3MKVA 4JXCA 1D2KA 4S3GA 3VD7A 3R13A 3U57A 1EJTC 5LNVA 1MRAA 1TJRA 1ALDA 3GTFA 1OJXA 5FIPA 5F2GA 4RV8A 2DW7A 2YCEA 1UROA 1ZJHA 2YCLB 3WLJA 3GTHA 2GZXA 5BW6A 3XINA 4C6EA 5T91A 3BGJA 5AOUA 4RK8A 1UR2A 2EAWA 5FD0A 3LDVA 1TELA 4IL0A 3NYDA 3VUPA 4UTWA 4WKAA 2QF7A 4LFYA 1F4HA 4CVUA 3AXHA 3PJWA 4HA1A 3H4GA 1WZMA 3GY1A 5HXMA 3OGVA 3BVJA 4JIHA 4P7OA 2BHZA 5EYWA 1MW0A 3B4YA 1J4EA 4H9MA 2YLLA 3N25A 4LVBA 4O11A 3TQPA 1PYFA 3T0TA 3W6LA 1DTNA 1AW2A 4XO6A 2ZCGA 4WKFA 2DFAA 4PMOA 1KM5A 3IAPA 2IKJA 3PUEA 1B9ZA 1UH4A 1TQJA 3CL6A 1SMAA 1O12A 4ZB0A 2GDUA 8TIMA 3OZYA 4FF5A 1EJXC 2BY0A 3TNBA 5FF3A 4ATWA 4W8BA 4YCPA 1NIUA 2X1IA 2QJJA 2QJNA 5FI8A 4UTMA 2A1YA 2QHAA 4X60A 3W1TA 4RKAA 2V30A 3WFZA 3TNOA 3PUDA 1AW5A 2BMBA 3O15A 1TIWA 2NWRA 2VDGA 3W3OA 2F84A 1SO6A 3UPMA 3M0VA 3G1VA 1SGJA 4LBSA 3UXLA 1FWHC 4PBFA 2DVTA 4W7UA 3SB0A 1GW9A 4XKMA 1K8CA 1S5MA 1U5HA 4JGDA 4NJGA 1YEYA 1ONEA 1L9WA 4GFIA 1XLAA 2QCLA 1VBHA 4J3WA 3BG3A 1OK4A 2WOQA 1GYNA 3ITYA 3QYQA 4GCAA 4AX6A 4H8UA 3DKJA 4AMCA 1CXHA 3P0WA 5D9PA 1PX4A 1PDZA 4ZOEA 1ZJIA 4ZCWA 1HGYA 3THDA 5ABTA 5CKSA 4S3KA 2V3DA 1EDGA 1DHKA 2OCZA 3FGCA 1SQ7A 5CJ5A 3UPBA 3DOPA 3I10A 4NG3A 3VU2A 2YR1A 5MHBA 3ITCA 4V28A 1N55A 3THAA 2YPIA 4FS9A 5C2GA 1J0HA 5A8GA 3K46A 1UWAA 1BVNP 3T4CA 1JD7A 1X1NA 3PWAA 2NX3A 2JBMA 4HPNA 1EIXA 1JPKA 5DQPA 1JAKA 2C1GA 2CBUA 2VI0A 1MQRA 2XH4A 1UKQA 1VBGA 1UPPA 4EXAA 1GNXA 1S2AA 3LN3A 3PFRA 5I07A 2ATMA 4GH3A 3FDKA 3EWXA 2XIJA 1R3TA 1CIUA 4JN8A 1HFBA 1NTHA 4QCEA 2PI6A 3CUJA 1EF2A 4AXKA 2W4XA 4KEMA 3NZQA 3R8HA 3WBAA 3MSDA 3OGRA 4R9XA 8CGTA 3T55A 4KT2A 3RAOA 2NW0A 2WWCA 2G4JA 3V5CA 4BI5A 4KESA 1XSIA 4Q7IA 2PWGA 5EL1A 4NZ1A 3ZYZA 4IPNB 1EUAA 4H1ZA 3TJLA 1OCQA 3UERA 2FMNA 3QTGA 3TYZA 1MUCA 3PBMA 3BLDA 3W85A 3VE7A 2JKAA 2J6VA 1KCXA 4UOZA 1MUWA 2C0AA 4BKNA 1G01A 5JQ9A 4U3CA 1DXEA 3FEMA 2X40A 3HB9A 2A7RA 4ZB2A 2EKGA 1K8ZA 2PDHA 4HOZA 3G2GA 3H54A 3STCA 1DP0A 1W3KA 2ZC8A 4HHMA 3CAQA 4H7ZA 4AD4A 1J9YA 1IXQA 4LTSA 4PEEA 4X0NA 1EGZA 4DVOA 1XG4A 4AX7A 1OGGA 3EB4A 5T9CE 3GC5A 1XDJA 3IVTA 1WXYA 4PMJA 1Q6GA 3W2KA 1J79A 1KCKA 1W3LA 4OOUA 3TTQA 4IPIA 2CHNA 4PMVA 2VDIA 3WD2A 1M1BA 4Q8VA 5D4YA 2E6DA 3M0MA 3TYEA 3W87A 3EX1A 5FEPA 3A12A 4W87A 1UQYA 1T7LA 4PMUA 1H7PA 3ECQA 1OFOA 4U33A 2ACUA 1VPXA 4GNJA 3M0JA 4AZIA 2PDYA 3RX2A 1IYXA 2IMRA 1H7RA 4F2TA 2DH2A 3VMNA 3VVGA 3PB2A 1JFXA 4X3ZA 5BZAA 1ITUA 3D0CA 2O4MA 5E93A 3PZVA 1V6TA 1BKHA 1S3TC 3L7RA 4BWLA 3CT2A 4DBSA 3KVKA 4LXFA 2R1NA 4UZUA 1HTIA 2AGTA 4XSMA 2EPLX 3VAVA 4DF0A 2CEQA 2OODA 4PSRA 1HP5A 4MLJA 4BQ3A 1V6UA 2XYLA 3DIPA 1J96A 4R5EA 1Q6DA 2P8BA 4IIHA 2PDNA 1AZ1A 1TTJA 2WMKA 1AJ0A 1IWPA 3PZTA 2H90A 2Z6IA 3AFBA 4RDVA 3G18A 3IARA 4FXFA 3O7UA 1BYDA 3EDFA 1RA0A 3N2OA 2VEGA 3BUVA 4YPJA 5JXQA 4G8TA 3QW3A 3NDYA 2HROA 3NYZA 3AHXA 3GVRA 1VFFA 3DYMA 1CGWA 4XQ6A 3WH5A 1IEQA 1X6UA 2I17A 2CBVA 1BAGA 3VM7A 4YS1A 5A6JA 3BCDA 3MSGA 4KEZA 3SFKA 5H2ZA 2J7CA 1PV8A 4DAFA 1TB3A 5D2WA 3LXBA 4I6KA 3UD6A 3EOOA 4DYKA 4HU0A 3UPWA 2JE8A 1VFLA 3W7PA 1HX0A 1P0BA 4UQEA 4MSSA 3V5OA 1HKMA 3OHIA 4M6PA 2FGLA 1TMLA 4G7FA 4N9DA 4TMCA 4YVVA 1HKJA 3H2FA 3GXDA 4MADA 5HINA 1QWGA 4LV4A 3OIXA 5E6YA 3S3GA 3SJ3A 2VGGA 3Q37A 2JF7A 4OVXA 6REQA 1P0NA 3TIMA 4JQ2A 4I8DA 4O54A 3HMCA 2CZDA 5C6MA 8XIAA 4GI9A 4A8IA 4KFPA 3B4UA 3CPGA 3TFCA 3GXIA 2Q09A 5B7YA 1OD8A 1ZB5A 2WHMA 4JFWA 1UP3A 3W0KA 1DIDA 4BEUA 2BZNA 4JZ5A 1XRTA 3U5UA 1UHVA 2DSZA 3C8NA 3LHZA 2RJGA 3BGAA 3HOJA 3GNXA 4Q4QA 3S47A 5LGXA 1E51A 2CLEA 4QE5A 1JYXA 3VKKA 2OQHA 2PDMA 1OFPA 3NQGA 3SSJA 1F6KA 3SUUA 2A3HA 1TUXA 2ZX6A 2FHBA 3W2JA 5C9RA 1B3XA 2Q3OA 1VFTA 3M1ZA 3AAMA 4O0ZA 4TUFA 3WFLA 1SZFA 1BRLA 3BG5A 3F03K 1SR0A 4UTIA 1D7FA 2F6XA 2Z1XA 6TIMA 3P2VA 3AXMA 4MZ1A 1EJVC 1H1NA 1P6WA 3BLKA 1LL6A 2IS7A 4DF2A 1ODZA 2EPHA 1QNVA 1FWNA 1VFOA 1ELSA 1WBHA 2WM0A 3AS0A 4JNMA 4MGGA 5EU9A 4PB3A 3IJ6A 1VEOA 3BTNA 3RJXA 3OVQA 2QCDA 3N18A 4F0RA 1P43A 4AWEA 3CB8A 3A23A 4N6EA 1TPVA 4ERGA 2HE5A 4PYSA 1V3IA 3ATYA 1J0ZA 3C0SA 5EY5A 1G69A 1NQ6A 3DFHA 3CV6A 1GPWA 5T8GA 4PRTA 1MQQA 5D02A 2WANA 3GDTA 3UY7A 4ADSA 5BU6A 3NQMA 1PCWA 2BASA 2YYUA 2H8ZA 3E3HA 4LAOA 1PDYA 3IV3A 4DRSA 1W5QA 3OODA 1QASA 3CPUA 4J3SA 2ZA2A 1CLVA 1V3JA 1FVPA 1WPCA 3RG6A 1L0PA 3NQAA 1GQJA 1NWRA 3LY0A 1GYLA 3CZKA 1XDLA 2PWEA 4B5NA 3I3EA 1X1ZA 5HMDA 4JIPA 1M41A 1JGIA 2FTYA 2DQWA 3F4NA 3HJZA 3DN5A 3GE7A 2VEIA 1Q6CA 2Z1VA 3WQPA 4Y7EA 3CM4A 3QLDA 4GUIA 4ZTXA 4GXPA 3EKGA 4XAGA 3AQUA 5BOFA 4G56A 2YX0A 3L0NA 3N9RA 3VKBA 3URNA 5C9XA 1MI3A 4AMAA 4IQEA 4YIWA 1PTAA 1XRSA 3V0UA 4P61A 4PUNA 1P48A 4C60A 3R25A 4BWLC 5MKGB 5JBEA 4Y90A 4JQ1A 1Y7VA 4Q4OA 4PL1A 2EF9A 5BXPA 2XDFA 4PMQA 3RR1A 3FJLA 4PZVA 4J7RA 4Z1CA 3Q67A 3O1NA 2I9EA 1N8FA 3M0IA 1VP5A 2OZ3A 1FTXA 3WK3A 3PG8A 3CBWA 4XG1A 3F4VA 2WVVB 1TZ7A 2XGBA 1DJYA 1FUYA 4WHBA 3N2CA 1OCBA 3IK4A 2HTMA 4LYQA 1PBGA 2FDMA 1UQZA 1E4IA 1T40A 4WDXA 4DHGA 4WY0F 1TV4A 1OX4A 3MVIA 3WQ5A 3ARYA 4HNUA 4PUJA 2E9MA 3AI0A 2GJXA 3TP4A 1IIGA 3M5VA 4UUIA 2OZ0A 1HIZA 2WO5A 2VEMA 2NVAA 2TMDA 3CH9A 4QR6A 3TTOA 1MVYA 2O56A 3HQ1A 5A6BA 4NNCA 3TAKA 2FB3A 3NSXA 3ZMRA 4E8CA 3AIQA 4D72A 2D69A 1KD0A 4LAUA 1JUKA 1TYGA 4TVUA 1R3YA 4HBKA 3OW1A 1XYFA 4AZGA 2VC6A 3DG7A 4YYFA 3S2NA 4OUEA 4M1RA 4M29A 4TIMA 4PCFA 3TK7A 4LS2A 1FHUA 4QCFA 1W8SA 3B9EA 2A3EA 1W6TA 4LSBA 1EP2A 6ALDA 1O1ZA 5BXTA 2X0HA 4H7VA 1B31A 1R9XA 1W54A 1WP6A 5K2ZA 1E4MM 4HCDA 2J7EA 4LBRA 3C0QA 2ZUTA 1RXOB 3AZRA 4ERIA 3QPYA 4ZVJA 2G8ZA 5CZSA 1CNVA 4WDTA 1TJ0A 4F2UA 4D6FA 5A8OA 1IZKA 1V3KA 5DFAA 1QI2A 4AZBA 4I3GA 2XVNA 1EEXA 4GD0A 5CH9A 2OKOA 4UZSA 4R27A 4ZODA 3U6WA 3CB3A 3SRFA 3K30A 3IVSA 3N9KA 1A47A 3W38A 2D2JA 3JS3A 3VIGA 2GLKA 4YVXA 5AC8A 3UNTA 3W7RA 2GOKA 3M7SA 4HYRA 2WMIA 5LHEA 4GGBA 3S5YA 4AWSA 2X1RA 3NPXA 4NVTA 1BQGA 1XR2A 1H7NA 3P62A 1DWAM 1YTKA 4AIBA 4CCEA 4LUTA 1FWGC 2OSXA 3QGAC 4GVHA 5AHIA 2VRJA 4PTDA 3GVQA 3CIVA 1OK6A 4XZBA 2Y8KA 2P0IA 4U10A 1O5QA 2HVNA 1H7XA 3ONBA 1ZJAA 4AC7C 1ICQA 2BVYA 4ZE4A 1UYQA 1KXHA 4NAEA 2VFHA 3CMGA 5EMMA 5XIAA 1WUEA 3AO0A 4HYVA 3PF3A 2W27A 4X9YA 3NPVA 4BHYA 5A6KA 3IV8A 1HNYA 4GPNA 4NX0A 1H63A 3SSZA 1C90A 2JKPA 2OZTA 5B80A 4A3HA 3O0FA 1YBQA 1O6IA 1Q45A 3M6DA 2Y85A 3RRXA 5HR7A 3TTSA 3AU2A 1PL9A 3BW4A 1TE6A 1HG3A 1O1HA 2OG9A 4WXYA 1TFVA 4ZO9A 3VOHA 3W1AA 3VK5A 2YCIX 4R34A 4MB3A 5I5RA 1P7TB 1SJCA 3KS5A 1FXQA 5DXYA 3UA4A 3SBFA 3KZPA 4WSJA 2VFGA 1TWIA 2X09A 1KXQA 4UNLA 1KQZA 3LCGA 2WCSA 2ZOXA 3NGFA 2YBTA 1S3HA 3QKEA 1R3VA 4AH7A 4H6RA 4QNEA 7TIMA 3UYIA 1DQXA 2DSWA 5JBDA 2F6UA 1QW9A 2W6RA 1VRXA 3BV7A 5E9AA 3ZS4A 1WDSA 4PUWA 2B4GA 4Z2IA 4J3VA 3P81A 3U8GA 3WH8A 3SN0A 3B05A 1K3UA 4CCZA 3ZVIA 5AECA 4GQGA 1DOSA 2YFOA 1J2WA 1V02A 4W5ZA 1GUVA 3PFMA 4OWGA 3MCNA 4TO8A 2GJRA 3TONA 1AVAA 1BLIA 1J0YA 4C6PA 4HPJA 3ITOA 2ZUUA 3IJDA 1T8XA 4PUDA 5ABFB 1FP9A 2ZA1A 1CB7B 5AHEA 1ZAIA 2F7FA 2BBFA 1IEWA 3WF4A 4QS6A 1C3FA 4JFUA 4AD2A 2F2HA 2WMGA 3LLFA 4DXVA 3KEHA 4H8NA 3RJYA 3AHYA 2ANUA 1QATA 1J10A 4GC3A 2YA0A 1I0BA 1ZS2A 3FA4A 3FLUA 4KH2A 1OX6A 4LAZA 3ARUA 2WQPA 3W72A 3SN4A 4GKTA 1Q6RA 5D37A 3H26A 3PTMA 4XZMX 2Z6JA 1Z3NA 3GZAA 2VGFA 4C6KA 2GGIA 4Y9MA 1DJHA 1IV8A 3DU0A 1VLIA 3O63A 1XPYA 1Q6EA 3ABSA 2YKKA 4ACZA 4P7NA 4EACA 1M7PA 4JTJA 4GNKB 3K13A 3GKFA 3U4AA 3WK2A 3QV6A 4GHRA 2DUXA 2NQJA 4O19A 5JU6A 3GBEA 3B9DA 3WBYA 3OP2A 3OBEA 4XKYB 1GEQA 2D73A 1PKMA 3OZOA 2OXNA 1THFD 5GNZA 5E70A 1TE1A 1TKKA 1DJNA 4P8WA 4JOMA 3V1HA 5LXXA 3S4TA 4YN5A 3WSUA 4BA0A 2PDBA 3R0DA 3J7HA 5HWNA 3BLOA 1JNEA 5F4SA 3EWDA 5F1VA 3T2PA 3TN4A 4G7EA 2FMOA 2NXGA 2WZMA 3ITVA 5LNWA 3UBPC 1FWFC 1XIBA 4KCWA 4A05A 1XWYA 3ZLHA 3R43A 5FEXA 4IUGA 3RX4A 3OEXA 3N2BA 5DCBA 3U7BA 2VX7A 5IHRA 1PEZA 3SCTA 6ENLA 5FA5A 4AY7A 2XISA 1GOIA 4AAJA 3QOKA 3TROA 4F4RA 4CD7A 1Z9AA 2OQLA 1XIFA 3AUJA 4ZFCA 1J18A 3EMQA 2TSYA 1R3RA 3WD4A 5BOOA 3ITTA 4GWEA 3PS7A 3W27A 3OG3A 2BGNE 1OD0A 2DT3A 2V8ZA 2VVNA 3B0PA 4PBEA 3C2EA 2JGQA 3BE7A 1AMYA 3GNRA 3A4JA 1KM0A 4QBXA 4AC1X 1OABA 4GY0A 3MZNA 1U30A 3OOQA 4Y9NA 1REQB 3TN6A 4GOAA 5FCZA 2CXEA 3HV8A 7REQB 3EDDA 1S46A 2E1WA 2G4FA 2XSBA 1V08A 2DT2A 2XM2A 3QQ0A 1B57A 1VCGA 3FN9A 3E74A 1AA1B 3I7RA 1E6NA 2PDUA 1RVGA 1UZ1A 3RO8A 4PCPA 2ZZ2A 3ZT7A 1S1RA 4N0RA 1X6NA 4HVXA 4FF7A 2NLYA 3B9OA 1TV7A 1XIHA 3OLDA 3VNJA 3SCNA 1BYBA 3WDHA 3W7EA 1LL4A 3DI0A 3IGXA 4K8GA 2R1MA 2QCCA 5IM51 2V2CA 3IJ7A 3HPFA 4CLMA 4GH1A 1SVDA 2P3ZA 2BWGA 1ONRA 4H9VA 1AJ2A 3PNUA 1AD4A 4ZQCA 4YJ5A 2OO6A 1BQCA 1J11A 3MWCA 4Z1DA 1QI4A 3STEA 3V0TA 1IGSA 1V5XA 3PP7A 1I9CB 3SY5A 3WN6A 4XD4A 5LKYA 2ZUMA 1K9DA 2DSUA 1TTQA 3LGGA 2WHLA 3D46A 2X2GA 1TRIA 1ENUA 1OC7A 4BJHA 2D2HA 3L2LA 1ITCA 1PHQA 4QQUA 1VAHA 1US3A 2JK2A 5G1YA 4HZMA 3VMPA 4U5IA 3OHMB 5HULA 3A6OA 3DEQA 4GBDA 3KOZA 1KM2A 3VDHA 1V0MA 3WKZA 2GWNA 4FR6A 4PR4A 1AQHA 3W7KA 4HSOA 4JTDA 2INZA 4YHGA 4FNQA 3SCPA 1N8IA 2PTWA 1Q65A 5CC3A 4BI6A 5AVHA 1G0CA 2NLIA 3DFSA 2C1IA 3SADA 4JR5A 4B3ZA 4P8VA 1D3CA 2G37A 1H09A 1KGXA 3FAXA 1RJRA 3TC7A 1EA0A 5A8QA 2PZ0A 3KBMA 2QDDA 2J13A 4R3UA 3HURA 5FSEC 3H4WA 3FK4A 1GORA 3HGSA 5E9XA 4D6EA 3UWWA 1FWCC 4WD0A 3IACA 3Q45A 2PF8A 1X38A 3TH6A 1AH4A 2E6YA 4ADTA 2R8WA 2G5WA 2VCCA 1PZ1A 2JIWA 4W85A 3AIEA 2DU2A 2E77A 2AKMA 3KOXA 1QXLA 3PULA 3ERPA 1P6BA 1TVLA 4O52A 4YLWA 3V7PA 1XGEA 2OELA 2DEPA 3AIVA 4WR3A 3QRHA 4TX8A 3B97A 1EPXA 3WD1A 1XLIA 1B4KA 4ICMA 2VTFA 3SI9A 3TW7A 4V15A 4AIEA 4KRUA 1C8VA 1RALA 2QYGA 3UXKA 3W7OA 1I75A 3SO7A 3VC5A 4ZENA 4C6IA 3HG4A 3SJNA 1W17A 1YDNA 2QNEA 4HOWA 4C6LA 4GO8A 3S2JA 1R3QA 4D6JA 3ARXA 4DJDD 3KWSA 5C54A 2I1OA 1ZZMA 3KHJA 5DMLA 4ERAA 2BVWA 4NAFB 2ZWZA 3QY6A 2BTMA 3LCXA 3WMCA 1L2UA 2XH0A 1GT8A 3L4UA 1ME9A 3R94A 1AH0A 5FF7A 4CD5A 3VPLA 3STFA 3LV6A 4UTLA 3LS9A 4XSLA 1XCFA 1XGDA 2ZFAA 4ADUA 3EXTA 4PUEA 4UTHA 1EHNA 2FZNA 2V81A 2OJPA 1KFLA 2CLMA 4I8YA 3A64A 1ZJBA 4M19A 4FLSA 1WE5A 3NL2A 1QPNA 2CLPA 2QUMA 4GMEA 4DUVA 1GJUA 4MKNA 3QQ1A 3TE9A 2PDJA 3URAA 1Q7MA 3NQDA 1DWFM 2VD9A 5HJLA 1PIFA 3B8WA 2O4QA 4L65A 3R10A 2PU1A 5C8BB 3SUTA 3CLMA 4QE4A 2X42A 3BGGA 5F7UA 3U2CA 3N6JA 1Y0EA 1FWEC 1B1YA 5REQB 1LBFA 3LPOA 4Z0JA 1O5RA 2RGMA 3ONCA 2OWXA 3DFOA 3KTSA 1PO9A 3O3RA 2P53A 5FF2A 1XICA 1SZGA 1OT1A 2Y24A 1F4AA 4K2SA 5EMLA 3UWZA 1FWJC 3AHTA 2PTYA 1YIXA 2V3EA 3ICJA 3BC9A 3OLEA 4XK2A 4CN6A 4ICCX 1I0DA 1MDRA 1A5UA 1FX6A 3S9IA 2C79A 2HEJA 4BI7A 3C3UA 1QPOA 3QR1A 2J8FA 4J3ZA 2UY2A 2B7NA 3L5AA 3ARSA 1HVQA 3KVMA 4PMDA 4ZO7A 1A5KC 1TX2A 1XL9A 3GDRA 3GAKA 4GVIA 4C6JA 4YTTA 8A3HA 3MTWA 5C7VA 2YCLA 4L4MA 1UCWA 2ZXQA 3HG5A 4HJWA 1GOXA 3RR4A 3DC8A 5KZEA 3CUZA 3UVAA 2YL5A 1LJYA 3AIBA 1UA3A 5K9DA 2G3IA 3R5EA 1KBLA 3BAWA 3CWNA 4DELA 4J3UA 3GVGA 5FSDC 2DIKA 4EWJA 4HU3A 2VWTA 1E56A 4D1IA 4XZNX 3I3DA 4IQLA 4R85A 3B3DA 3ABQA 5IRPA 1R8LA 3GFYA 2BY1A 1LRNA 1NOWA 1EF3A 3MMUA 4HMEA 4ZO8A 3OVRA 2EGZA 4UNKA 3WQCA 2VL4A 3EB2A 1XH0A 4EKJA 3BOFA 3MUZ1 1V8EA 3TXZA 2CBJA 2WJFA 2OU4A 3QR0A 4IISA 1M7OA 1VPQA 4ICNA 4O1AA 1X98A 2GUUA 1R86A 1B3ZA 2OZ8A 4Q4SA 3XIMA 2F38A 2RH9A 1A5SA 3M0YA 4H9XA 3WNLA 1KXVA 3TFXA 3U2EA 2D3LA 3VKAA 1S2TA 2CZVA 3UESA 1C29A 1TPC1 5TNVA 3W2NA 3LXAA 2O9PA 3VIFA 1WZKA 2GJPA 3ABZA 1CCWB 1P0DA 3WQWA 4E4PA 3E0WA 1ISZA 5E09A 3LERA 4H6EA 3P8JA 3C3NA 2OEJA 3DX5A 1R7OA 3H8AA 5A94A 4XBSA 1CECA 1OY0A 2CHOA 4BF9A 2Y2WA 3K5XA 1J6OA 4E2BA 4IGHA 2VJXA 4UXDA 4QJ4B 4B16A 1O7AA 3SRKA 5I23A 3CXOA 1D3GA 3NO5A 1IZCA 1UZHA 1XJBA 2NUXA 4DN1A 4L5ZA 1B3OA 3NOEA 4KMQA 3M43A 4QAWA 4S23A 2XFYA 3E1F1 3VKDA 1XP3A 2IPJA 2YIHA 3RCYA 3W00A 2QUTA 3PZMA 1A5AA 4P7RA 1XRFA 4ASTA 1M5WA 3VNMA 2IPWA 5CSSA 3OO2A 3MUY1 1E40A 1VB9A 4MZ8A 2VUYA 5BCAA 3VNDA 1H50A 2PLJA 4OIFA 1RBOB 3UZYA 4ENLA 2YXXA 3PBWA 3WBXA 2I56A 4YVPA 3BLLA 1YPIA 2WWDA 2CYGA 2ZTJA 3KWXA 3BQ5A 3PC0A 3PVFA 3KRUA 4BS0A 2QGHA 4JTFA 1H41A 5BYWA 1ITXA 1OB0A 1NU5A 5CPOA 3MUCA 3QPZA 3S1WA 1L6SA 1X1OA 3N4AA 1T96A 5GJPA 3IGUA 2J8GA 4YMZA 3G0SA 1QNSA 3OIHA 4GVFA 1KCLA 4WF7A 4IFKB 1QVBA 4KERA 3O6DA 3S2MA 3FHAA 3ITLA 4O18A 3VGFA 4DBEA 4C7FA 4S2CA 4D8LA 3IRDA 1H49A 3R2GA 1Q2RA 4LVDA 3VINA 3B8UA 3DFPA 4JTIA 4N7QA 2A7PA 2E6AA 1KA9F 2X1UA 3WLTA 4IP4A 3LLDA 5G2HA 3GH5A 4DM2A 1GVOA 2Z2AA 3P5ZA 3B8SA 2QW5A 4FK9A 5AZ1A 1BVZA 4U4MA 3ANUA 3BOLA 3KBJA 5B7ZA 3HPZA 1TO3A 3GIPA 3AXXA 3KP0A 3W6MA 4M56A 3KRSA 2PDIA 4XUGA 4Q4PA 1R2TA 3WNNA 1H61A 3N14A 1ZNNA 4GJIA 3FSTA 2YL9A 2EKCA 2VOMA 2BGSA 1PAMA 1XLFA 5TIMA 1FXPA 3IEBA 5F2MA 2VM8A 1QI3A 3NM3A 2GPTA 2YL6A 4BZYA 5I00A 3CHCA 2X7WA 4I9AA 2V68A 3KLLA 2QJGA 4GQBA 2Z0IA 5CGTA 3T40A 4MOZA 5CC5A 1ZP4A 3CV1A 1C8YA 3VZYA 4M82A 5HQLA 1UD2A 2HXUA 2UY5A 3NZ1A 5D2YA 1OFQA 3ZJ8A 4JQAA 4F8XA 4IPJA 1MXSA 1QI0A 2ZE3A 1EC8A 1EOMA 2V82A 1R46A 4AZCA 1T41A 1E73M 3LCFA 4H6QA 4AD1A 3Q4DA 1W0MA 4RDWA 1XH1A 2PTDA 4LRSA 2A21A 1TPFA 2X0YA 4ZQMA 5A6TC 4WX2A 4WY0B 1OHLA 4FEZA 5FAJA 3CT7A 3I6EA 2V2DA 2A3CA 1JZ5A 1LRTA 1H3GA 3S5ZA 5FJIA 1TJ1A 4W9TA 3GXNA 1EZWA 3ZJ7A 2A4AA 3VZZA 1YW1A 4TVCA 4MB1A 3VCRA 5HPOA 1RQHA 2XN1A 5C71A 2AAMA 2DSVA 3WLMA 4DBWA 2FH6A 4TX6A 1JPIA 4S3DA 4KCTA 4ZOAA 3SM0A 2CLFA 2I57A 3G1SA 2FPYA 4JIIX 2PMQA 1NY1A 1X8CA 4PTXA 3NZGA 2HK0A 2NUYA 4H01A 2V3FA 2WBGA 2RAGA 4TV5A 1CGYA 5I24A 4JKLA 1R2RA 2JQXA 2BX7A 2EEXA 3FNDA 1VBJA 3W70A 4IXXA 3NPUA 1OFAA 1LZOA 2A6LA 3PJTA 5JBFA 2J24A 1OF6A 4J9JA 2E9BA 2IQ0A 1JG9A 4K3ZA 3W7LA 3QMRA 3LPGA 2ZBTA 2YJQA 1R5YA 4QROA 1KBKA 5IFPA 1GK8A 2DZVA 1HJSA 3ARRA 6PTDA 4ZMGA 3GLCA 3VABA 3WLKX 4J27A 3BLEA 3VE9A 3SW6A 1WZLA 4PFMA 4WKHA 1UC4A 2PDXA 3CMJA 3KCLA 1UP2A 1YE6A 3UG5A 2Y70A 3HGJA 3UEQA 1EDTA 2C6QA 1MDLA 1E0WA 3PAJA 3EX4A 2VYOA 4RDYA 4UB9A 3FYYA 2ZZ6A 3GSMA 1O5XA 2PGEA 3TMQA 1AODA 2ZZ7A 2ZQ0A 1L8PA 3MP4A 4I9MA 4YL2A 4EIVA 3DHUA 2REQB 4DWSB 1Q63A 3YPIA 1AW1A 3GXMA 4IMAA 2J7DA 3EA3A 2V5KA 3N3MA 2QAFA 3WJSA 4CNTA 3EOLA 4XWUA 5KSWA 1Z32X 1YTEA 2YB1A 2DPEA 1VR6A 3BAJA 1DPMA 4HQVA 3UR8A 4LC8A 4GZJA 5D38A 3I7SA 3S1GA 3BAIA 2PDGA 1YNYA 1VYRA 4ML4A 3TSMA 5IOBA 3T0DA 4UR8A 3GHRA 2VDHA 3QVQA 1ZRQA 3DHDA 3IJIA 3KVJA 3UJSA 3AYRA 6XIAA 1ECQA 1BEUA 2QPXA 1G4EA 3LSCA 1H5YA 2X05A 3RDKA 2ZVRA 2O9TA 3LZ3A 3NSMA 1YDYA 2YW4A 3UU0A 2CESA 1XLHA 2YDQA 4NZ5A 2RDWA 4FMVA 3LI1A 3T1GA 1JL8A 3UXAA 1FWWA 2PURA 4PFHA 6TAAA 3VDBA 2Y4SA 4B2DD 3LPFA 4A3RA 2WYSA 4LUJA 5E0FA 1JCXA 3OVGA 1P1XA 3BARA 1O60A 2QF8A 2QDEA 5H6HA 1ODUA 1K70A 1B3WA 2WSYA 3PJXA 1U1JA 4EE9A 1ML1A 2QAPA 3CH0A 1JDEA 3N04A 2B31A 1PVNA 4UNIA 1KR0A 2DZTA 1WNOA 3WO8A 1OFBA 3VD3A 3LZ5A 1WKYA 9CGTA 2PWUA 2D0GA 4CQBA 3VOGA 3T07A 4B90A 4FI4A 1XBXA 1XH2A 4O16A 4QEHA 4Q8NA 3BMWA 4QDPA 3WMBA 1PKLA 3L4WA 1EP1A 2Z2BA 4IIGA 2NZLA 3F4CA 3G24A 5AZ0A 4AZHA 2BGQA 5I78A 4ONVA 2Y7FA 1Q6QA 1ICPA 3WENA 3UJRA 3XISA 4PE8A 2YL8A 4Y9PA 2ZA3A 2BP1A 1XD1A 1KKRA 3UY8A 3SUSA 4TXEA 1E6XM 4ROQA 4W93A 2BV9A 1A5MC 5AHNA 2E25A 1IXOA 2ISSA 1IWAA 1R3WA 4PCTA 5E1QA 3GHSA 2MNRA 5FJOA 1I2OA 4FIRA 1TCMA 5FF4A 2QMJA 3NVDA 5RUBA 2YB4A 2WCGA 4OBTA 1PSCA 2GOUA 5A1AA 2I5QA 2WV8A 4XBJA 3K4DA 1WAUA 4NY2A 4AG0A 5M2FX 1UJPA 2WMFA 3H23A 3E2VA 3C4UA 4YHEA 3TN5A 3R6IA 4GVGA 3VFLA 1W3TA 1VCFA 4UQDA 1TJPA 4I9TA 3MVTA 1A5NC 2C18A 1AFSA 3QV7A 2DW6A 4K1GA 3A21A 2JEPA 4ATDA 4XTIA 4FX6M 4NI8A 1ZLPA 4H04A 5FAGA 1NJJA 3OLGA 1XX1A 1PZ3A 5AKQA 1J12A 3RLUA 2XM1A 3W1XA 1A50A 1DIKA 2I5GA 3WUGA 1J0KA 5I3HA 3LRKA 3S9YA 3K1GA 3HF3A 3G1DA 3I7QA 4J40A 3M47A 1W1VA 3W24A 4ILSA 1UWSA 4JL2A 4AD0A 3M5ZA 2CW6A 2X1SA 3UWEA 2UWFA 1EGVA 3FYOA 1Q8JA 1NFPA 2ZRZA 3PPFA 4YTUA 3GDMA 1JCYA 1EXPA 2JFEX 4ZXOA 1YXCA 3GXPA 1TRDA 2CLKA 3LYEA 3R4IA 4ZB5A 4CU7A 2WKLA 2VFFA 3N11A 4QRNA 3VDGA 4HCLA 2KX9A 4U2YA 4LUIA 5D8ZA 4JX4A 1VBRA 4RX0A 4LAMA 1TA3A 3M7WA 5KITA 3ITXA 1UUOA 4IP7A 1EZ2A 2ZUNA 1TWSA 4UFKA 4Z08A 1XBZA 1FH9A 1PIIA 3CWOX 3NQ8A 4LT9A 3ZSSA 3DKLA 1OFRA 4LEQA 2POTA 1LOQA 4KW2A 2PRLA 3LHYA 3MV01 1LTDA 4MB5A 3NXFA 2Q8XA 3O2LA 3UR2A 5HMSA 4E2VA 3AZSA 4IT1A 1XC6A 4MFDA 2WLZA 1DVJA 2FVMA 2VKZG 3UWYA 4U28A 3ARPA 3ARTA 4ZQNA 3TOPA 3CGTA 3OBKA 1WA3A 1EXBA 2X8RA 3QLLA 1GVIA 2CWNA 5LIXX 2PA6A 4AZ5A 4JFSA 1E5NA 4IGNA 4MZYA 5KTLA 3EXSA 3ARQA 3URQA 2Y7EA 3HQOA 1QO5A 3UXDA 2QJHA 3WDJA 3S9ZA 3EX2A 4PTMA 2BY2A 4IMGA 3N29A 3W83A 3W01A 3BCFA 2OO0A 4XZWA 1QBAA 2QIIA 4PODA 4PH6A 4ZSUA 3PZIA 3RN6A 4XZLX 5CQ1A 2WZTA 4BK9A 1W5MA 1OIMA 4JYFA 1O68A 4HYWA 3FGCB 4DJEC 3NAVA 3VIJA 3F4DA 1QAPA 3VCNA 2W61A 3EEZA 4L6HA 4GY1A 4QFUA 3M44A 2G3JA 1TUFA 2OWWA 1O5KA 3PZUA 3EMCA 1RLCL 1JR1A 5G5IA 3CUHA 1VF8A 4OBRA 1HL8A 2FGZA 1SJDA 3AHVA 1ZY9A 4O17A 1C9WA 5LIWX 1XLMA 1ISXA 3W7CA 1M6JA 2PWVA 4GXMA 1SMDA 3WD0A 2ZADA 4G1KA 2XZ7A 3B8IA 1R47A 3UNDA 1HF6A 1YDVA 1I2RA 3NSNA 3QF0A 5E5CA 4FB7A 2GVJA 1UUMA 3W86A 4I6VA 4G2DA 4UTJA 3DESA 2QCNA 2DH3A 1FWBC 4OTKA 3D3FA 3W1MA 2WZHA 4HIBA 3LXCA 3IIPA 3EPOA 4OKDA 1JGMA 2V5JA 2FHCA 3AXIA 3UZJA 4MYAA 2G3NA 3EZ4A 2DGAA 3T0BA 3PHAA 3H2CA 3WQVA 2XFWA 1ITQA 3VDAA 5ABFA 1FHDA 1CYGA 1Z69A 3NVTA 2EPOA 2VR4A 1JQXA 1AL8A 1CWYA 1VKFA 3KL5A 1T6MA 5CXPA 5D05A 5D9MA 3M0KA 2DORA 3FKRA 2FFCA 3C2VA 4NRRA 3GNOA 3DHPA 4LANA 5M3WA 1XQKA 2PWFA 1JDCA 3VNYA 5H8MA 1OVDA 3L4YA 3AWNA 1DIEA 3GWQA 3UWUA 1Q3NA 4R53A 4C6DA 3F1QA 3CZ8A 2ZIDA 2J9ZA 1F6YA 4RZ4A 4CD4A 5I3JA 1V3HA 3GU2A 4D6GA 3V75A 1M9HA 4MJ2A 2EG7A 3N13A 1Y5WA 3VNLA 3C52A 3W7IA 4M3PA 1E6QM 4DZ5A 3TZNA 2V67A 4C6NA 1X97A 2CLHA 2Z26A 3AIWA 4QJ5B 2H3DA 5HDRA 3ZIZA 1JZ7A 1TPUA 3WL1A 3MMDA 2LLEA 5IBXA 1NWSA 2PAJA 3GG7A 4EVZA 3MHFA 3RRAA 3WNPA 2D2GA 3OB8A 4CQDA 4D8AA 3F5JA 1XBVA 3GB6A 4C6MA 5CAKA 3AU6A 1A53A 4A6GA 2P0OA 2TRSA 1K8XA 2O9OA 1EBHA 4GUGA 3RYSA 2EPMX 3RIKA 5LXEA 1YHTA 5C9UA 4MJMA 4JS3A 4E38A 4IIEA 5FL0A 3C2OA 4DJDC 4P8UA 2PU0A 5JIPA 4M81A 3VXGA 5DN1A 1S5VA 2O55A 4KGJA 4HKPA 3GTXA 1PXGA 4GX8A 3WNMA 3BWWA 2NUWA 4R7WA 3EXRA 2VEFA 1LOSA 5I0DA 2V69A 4MAZA 3BO9A 1E3ZA 3SIZA 2P50A 3WCZA 1OSEA 4OFCA 4WGXA 4A8RA 5FACA 2D0HA 4B15A 4FIQA 1AMKA 5HMFA 1SFSA 5GJMA 4B5XA 1QO2A 4JAWA 5HK4A 4KETA 4Q4KA 2C14A 3OYZA 3MANA 4HTBA 2Q8LA 1OFEA 4PMZA 1MQPA 2G97A 3KTCA 4REQB 3AIUA 1F9CA 3KTXA 1FWSA 2GVYA 4MWAB 2CHRA 1NEYA 3M46A 4C6FA 1JZ6A 2P3EA 1BXCA 1W2VA 4QLKA 3BPWA 1YYAA 1E9ZB 3WH9A 1UMYA 5KZ6A 4AB4A 4F79A 1XPGA 2WNZA 1WKDA 2A5HA 3L5LA 2OLHA 4S3JA 5CJMA 3CUXA 3QC3A 3M0ZA 1KO0A 4JNYA 1QHOA 4HHHA 2WSRA 4JIQA 5KINA 6REQB 4N42A 1JD9A 2ZYFA 1F61A 1PWLA 3WDIA 2WM1A 2E8YA 3VX0A 1PKYA 3M41A 3IGSA 2WSPA 1L6GA 2HPMA 3ENLA 1GJWA 3W2UA 4XX6A 1XCWA 4MHBA 1YADA 3REQB 4HK5A 4WQ6A 2OQYA 4GE8A 4HMNA 2AGKA 2JIEA 1WX0A 4G9PA 3FKKA 4Y8FA 4GJ1A 3TA9A 4H6KA 3HN3A 4MJ4A 3ZR6A 3BV4A 1CENA 3CZEA 3RCNA 2CZFA 4J2MA 7ODCA 1UKOA 4RZBA 3F4WA 3I6TA 4GO9A 1XXXA 2QIWA 2B7OA 1BRLB 1W8GA 1UH2A 2DQXA 3GDLA 2G50A 4UTTC 2G3FA 3KCJA 3GTNA 3VX1A 3CHFA 5LNRA 1UR9A 2H9AB 1K77A 3W82A 2ZDSA 1RHCA 1J6PA 2Q8ZA 1BFNA 2ALDA 1OEPA 1I2PA 2IKHA 3GVWA 1TPH1 2V63A 3PANA 1E15A 1AQFA 4P8XA 4JKKA 2HZGA 3SURA 4WOQA 3P67A 3CQ0A 3VIKA 2RFGA 1Q13A 3G1AA 3KXQA 3DFNA 5EBUA 1WDDA 5AN7A 3QTPA 5FKYA 3MDUA 1K9TA 2Y61A 4B92A 3QQWA 4DM1A 1YRRA 3MYPA 4YU1A 3TAOA 4EXQA 5F4XA 5IHSA 3U2ZA 4RJEA 2HNEA 4UWMA 3ZR4A 4JEQA 3L0KA 2PBOA 3D6NA 3CMFA 3PPGA 3V3WA 2IXVA 5D30A 4AZ6A 4ZFMA 2O0TA 4BQ4A 3HGRA 1I2QA 4LY8A 1CDGA 4IF2A 1ZALA 5CZTA 1E6ZA 3NZPA 4IXHA 4DZIA 2NSOA 4QDMA 3CLWA 1PE1A 5IBXC 2POZA 3AJXA 4DXKA 2HE8A 5EPDA 3G77A 4L80A 1HN1A 1RR2A 4GIEA 3IVUA 3UCQA 3HZ3A 3W26A 1WKFA 3HG2A 4JTGA 1HO1A 1NDVA 1IF2A 5D9OA 5L9FA 3QH2A 1QPQA 1UR1A 3CHDA 3L4XA 2L5HA 5ABHA 3FA5A 1EGMA 3W1RA 3FCPA 4CN1A 3WBWA 3PZGA 4R7JA 2GQAA 4GIAA 3MWAA 1QBBA 3DENA 1KM3A 5CSYA 4BQ5A 1IQ8A 4LF1A 1GCYA 3OZMA 3E0LA 1RLDA 5HMEA 2GVLA 3AOFA 4B91A 2HBXA 2GL5A 4GUJA 2WSKA 2XSAA 4S3AA 4UC5A 1RPKA 1CGXA 3R79A 3QY8A 1RQEA 3CIWA 2GVGA 1PIGA 2QUVA 1FCVA 1OYAA 2DZBA 3TWAA 2OT1A 4MF4A 5BRBA 1ADSA 4CNNA 1OX4B 1EB3A 3T08A 3TA6A 1C7TA 2VO5A 1YTDA 1NDYA 4L4LA 4I7UA 5CG7A 3LRMA 1CTNA 4NAFA 2TAAA 3WUFA 2VR5A 3NL6A 3P6LA 4NL1A 4WDWA 4IFOA 1MO0A 2QPUA 2VEPA 3GR4A 4ACYA 5ECUA 5TBOA 3QOMA 2VMFA 3ZJ6A 3JU2A 2QGYA 3ZT5A 1RBLA 3SEPA 4GQQA 3QC0A 2RHGA 5HQMA 4WGHA 4CNSA 2FZBA 4GRSA 2ZX8A 3PUGA 2I5IA 4EAMA 2NX1A 3HJEA 1LLOA 1VCVA 5FEZA 4BEQA 4G1NA 4O0KA 5H1WA 4DXXA 3U48A 3KDNA 2PUZA 3F2BA 3TOYA 4A22A 4PTVA 5AHFA 4B9YA 2Y7GA 4RZ6A 2XHYA 4IX2A 1MFVA 2ISWA 4RW3A 1V6YA 1TV8A 3ES8A 4DNMA 2FZ9A 5A8MA 2RDXA 4CEXC 3WF3A 3II1A 3EX6A 3VIPA 4A3UA 1XBYA 2TPSA 4P2VA 3RM8A 2NT0A 1SFLA 1BSLA 4LYRA 4B2DA 3DUGA 3GS6A 4OV9A 3W88A 1ADOA 1FCQA 2VOTA 3Q94A 3HM7A 4V2XA 1NF0A 1V77A 3HBLA 2BVDA 1XINA 3IJLA 1UBPC 1S1PA 5JVLA 4HZ8A 3ZVHA 5LIKX 3PJUA 1ME7A 1Z8AA 2ZUSA 3BSHA 1DE5A 4PSPA 3I68A 1MYRA 4MNLA 2J7HA 3TKFA 4XISA 4KWOA 2FLIA 1SO4A 3PZOA 1QOQA 4AWUA 3W4RA 4JBRA 4WLCA 4FOJA 2ABAA 3B06A 4JYEA 4QISA 4Z0SA 1MXGA 1OYCA 1XYBA 4HNNA 2BHYA 5XIMA 1R9YA 3KRZA 2J7FA 3VGDA 2EBNA 1M03A 3P93A 3PBVA 4LVAA 4ZEPA 2OPJA 4N6FA 2VCAA 5D03A 3ZLGA 3W7GA 3LG3A 5HUPA 4NAEB 2DSKA 3NUKA 3FIGA 3KP1A 1OIFA 1JI1A 1YPXA 1UPMB 2J77A 3UW6A 2WNQA 1XD0A 2YOCA 3TYAA 1ZHAA 2FYMA 3NGJA 4NQ1A 3ITGA 3Q58A 1YBQB 4V1YA 3M9YA 4OZOA 1XIEA 3CEPA 2PWDA 4AW7A 1KXTA 1TG7A 3NDOA 2ZZ5A 5HUOA 3C5QA 3ZWSA 4OE7A 3HU7A 1M68A 2FVLA 2EHHA 4EPBC 4NNAA 4H19A 3TDFA 1VC4A 3O6CA 3TYDA 2A6NA 3DERA 1F07A 3BLPX 5F2IA 3ZJKA 1ONWA 2UBPC 2YA1A 2Y5JA 3RF9A 1R87A 1SUXA 5K4ZA 1PKNA 3TYCA 2WNNA 4OQVA 2TYSA 4OOZA 4URIA 5F2LA 2GQ9A 3DDMA 1LWJA 3E0IA 1XFCA 3ZWTA 3MP5A 4NXSA 1Q7ZA 2Z29A 3W81A 2BB0A 3AYSA 4L1XA 1W91A 3DGRA 1U1HA 4LC6A 2Y5SA 4JEJA 3GRIA 4GI6A 3T2OA 1GQLA 1GOMA 2ZX7A 3W28A 2A3BA 3C61A 3FX4A 2J4GA 2C3ZA 3EKZA 4KBXA 5TQLA 1JCJA 3K8MA 1BHGA 3IUDA 3OVPA 4J2PA 1F74A 1GVFA 3PNZA 4W4QA 4F9JA 1MNSA 1KM4A 3VCCA 2VRKA 1N82A 5I3GA 1VH7A 1TV2A 4ZOBA 5EMJA 3CS2A 4G5DA 2QCGA 4Q7BA 2PDQA 5E0KA 3T44A 1C8QA 3BW2A 1GVYA 4IUOA 4O0QA 4WVXA 5AYZA 2BOGX 2EXOA 3KE0A 3NWRA 3L5MA 1E9YB 1QW7A 2D0FA 1LBLA 4IQDA 1LM1A 2HS8A 4GG9A 3KBWA 4C6CA 1GGOA 1E0TA 1KV5A 3QHNA 4QJ3B 1SSGA 4JL1A 2YLAA 3RPMA 4OT7A 5BNKA 3OGSA 1XYMA 1AH3A 3EDJA 2V5BA 5CG0A 3MCMA 2VR2A 4A2RA 1ZQ5A 3PSVA 4FNUA 2ONEA 2X30A 1WYIA 1UZ4A 4ACZB 3U2OA 4XO7A 2Z25A 3FJ6A 1LG2A 1G4PA 1YXDA 2Q3RA 1W1YA 5LHFA 4X9SA 4PUKA 2IKIA 2PDKA 1YPFA 4X0VA 1MNZA 2WPBA 2FKPA 1HKVA 3FAWA 1SW7A 1V0KA 4KWUA 1RSCA 1KM1A 4MWAD 1W9PA 5C9WA 4QITA 1KBJA 3JRKA 2J7BA 3APGA 4UFLA 4EANA 3SCUA 4JTRA 1O94A 1RD6A 1PS9A 2XH2A 3TJ4A 2GJLA 4GZEA 2XIMA 4ORIA 2DZAA 2ISFA 3LX9A 3T0AA 2H3BA 1KV8A 4FXRA 3N3TA 2ZRXA 3VIMA 3W6YA 4AQLA 1B4EA 1CZ1A 3CL7A 1TTPA 1WUFA 3T42A 3BJFA 4A2SA 4KIRA 3CEUA 4L64A 3EPNA 1MW3A 2OEKA 4G7EB 5D2TA 4RNIA 4XD6A 1SO5A 5CGMA 3A3HA 3KBNA 3B40A 1M7XA 3ARWA 3QJAA 1C92A 3W9ZA 2P76A 1XLDA 5I3KA 3IAQA 3KHDA 4BCEA 9RUBA 3E0VA 1FRBA 1I4NA 1Q8AA 3U3HA 2Y62A 4PUUA 5AHMA 2NV9A 3VNKA 2B0MA 3SCOA 2WZIA 5TAOA 3OA3A 4PMYA 4FP1A 1E3XA 4YWIA 1SW0A 4Z2KA 3UG4A 1K1DA 1SZRA 3S1VA 1U5VA 1IIHA 2HSAA 4MMWA 3UGRA 4DPQA 1RBAA 5CAHA 1WOBA 4XTDA 3TLLA 1IXNA 2E40A 4HB7A 1TPEA 2Y89A 2Y6ZA 4AVFA 3W84A 3GG1A 4TTGA 4S39A 1GG1A 1GKQA 1WKEA 4O1BA 2ZXDA 1GKRA 4CD6A 3H2EA 3UR7A 1Q4WA 3T9PA 2A2IA 5IFTA 1TPWA 3HQNA 1SZEA 2YDSA 3PN8A 1M7JA 1U2YA 4OV4A 4UFIA 2FVKA 5G2IA 1VJSA 3TCEA 1G9HA 3SGGA 5CCZA 1I2NA 1VZWA 4F0HA 1VRDA 1BYAA 4DUOA 1D7KA 3GUWA 1HL2A 3VI2A 3LI0A 3TJIA 2QT3A 1LL7A 4NYUA 1F3EA 2HK1A 5LSMA 1QRQA 2NQHA 3CUFA 4JTEA 1KFKA 3V5FA 2ZZ3A 3VD4A 5BROA 1F6PA 3PZQA 4O53A 1Q6FA 3SIMA 5D33A 1A3HA 5FOOA 1KGWA 3EWZA 3ZM8A 3VIHA 4Z17A 1L6FA 4M51A 3STPA 2QKFA 3BJSA 4GQRA 3GK0A 5G4EA 3DAQA 1UR8A 2DJLA 1W2PA 1EX1A 3N17A 3IGHX 5D09A 2WXDM 4HOXA 4L9YA 1E5JA 2DZWA 4DI9A 4JX5A 3WX7A 2WC7A 5I7GA 2CWXA 3HPAA 2C1HA 3H2AA 4HD5A 1DJWA 1CXFA 2OOFA 1FHLA 4S3BA 5CLWA 1CB2A 2IQTA 3WEZA 3THCA 1KBBA 4DZAA 1MRQA 4XZIA 3GIQA 3W1PA 4IM4A 4Z2JA 2QDGA 4DB7A 3WF2A 4XV0A 3MO4A 2ICSA 4L7ZA 4WUIA 3TVAA 2XGIA 4MTVA 4DJFD 3V0SA 1W3IA 2WJZA 3C56A 3UR5A 1B5TA 5AYXA 1BPLB 3CYJA 3IJ8A 3RLGA 3HA1A 4Q22A 2REQA 1UWUA 4E2DA 3N15A