3LENA

Human aldose reductase mutant t113s complexed with zopolrestat
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
SRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPSGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 314
sequence length 314
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3lenA00
1UR3M 4GQ0A 2NVDA 3RX2A 1MZRA 4H7CA 4PUWA 2PF8A 3O0KA 2P5NA 4IJCA 2IPJA 3BV7A 2AGTA 3R7MA 1MI3A 1Z89A 3R58A 5JH2A 3LQGA 3GHSA 3CMFA 3COTA 1S2AA 4GCAA 3WG6A 4DBWA 3V0TA 4QR6A 2C91A 4RPQA 3G5EA 3LEPA 3B3DA 4JQAA 2F38A 4ZFCA 4PRTA 4JQ2A 4DBSA 2PDCA 3R6IA 3UZWA 1ADSA 4QXIA 3V0SA 3U2CA 3M0IA 3UG8A 2FGBA 4WDTA 4WRHA 1RALA 4HBKA 3H4GA 1XGDA 1US0A 4JQ3A 4FAMA 4DBUA 4PRRA 1VBJA 1LQAA 2HVOA 3CV7A 4OTKA 4JQ4A 3EB4A 3FJNA 1A80A 4AUBA 3V35A 4JTAA 1EXBA 1XJBA 3VXGA 1T40A 4XZLX 1X98A 4LB4A 1LWIA 2PDGA 2F2KA 3CAQA 2IKGA 3Q65A 1Z8AA 2PDYA 3LQLA 4JQ1A 2HEJA 4Q3MA 3D3FA 1AZ1A 2PDIA 1EKOA 3RX4A 3GHUA 2PFHA 2IQ0A 4L1WA 4ICCX 2DUXA 3UZZA 1J96A 1R38A 2INZA 3LUTA 2WZMA 1K8CA 1SM9A 3KRBA 2ACSA 3ERPA 3LN3A 4PUUA 3UP8A 4ASTA 1AH0A 2VDGA 4YVXA 3DN5A 4LBRA 3WBXA 3LBOA 3QKZA 3P2VA 3LENA 4XZNX 2HVNA 2PDBA 3GHTA 4XAPA 3MB9A 1YNQA 5DANA 3F7JA 4JIRA 4PMJA 2IPFA 4EXAA 3R94A 3CAVA 4JIIX 2PDKA 1Z3NA 1YE6A 1S2CA 2PZNA 2BP1A 4H8NA 3UGRA 2HDJA 3UZYA 2ACRA 2PDQA 1S1PA 1C9WA 2ISFA 1HW6A 3G1RA 2PD9A 2PDWA 4NKCA 2FZ8A 1EF3A 3CV6A 1JEZA 1PYFA 4WEVX 5LIUX 2DV0A 3T42A 4JIHA 3BUVA 4F40A 3UFYA 5HNTA 3FX4A 3UWEA 1XF0A 2HV5A 4XVDA 2PDUA 4JTQA 1IHIA 4IJRA 3H7RA 3V0UA 5C7HA 2PDNA 1RY0A 2PDFA 4WDWA 3S3GA 2IPGA 1ZQ5A 5AZ1A 3WBWA 3H7UA 2QXWA 4MHBA 3R8GA 5LIKX 3N6QA 1S1RA 4WDUA 3BURA 2CLPA 4FZIA 2IQDA 3MC5A 4XZHA 3LZ3A 4PR4A 1ZUAX 4Q7BA 2DUZA 1X97A 3UYIA 4YS1A 5KETA 4WDXA 2INEA 4GA8A 4YU1A 4XZIA 4YVVA 1RY8A 5LIWX 1ZSXA 4FALA 1YE4A 4JTDA 3CASA 1AFSA 5LIYX 4DZ5A 1VP5A 2I16A 1HQTA 2PDMA 4JTRA 3WCZA 3LNMA 3BCJA 2IPWA 4IGSA 4FA3A 2PDPA 1T41A 1GVEA 2HE5A 3ONCA 4GQGA 2HE8A 2ALRA 4GABA 3RX3A 4GIEA 2IKIA 3LZ5A 5LIXX 4JTCA 3ONBA 1MRQA 4XK2A 3UZXA 2PDJA 1AH3A 1FRBA 2NVCA 2A79A 5AZ0A 1PWMA 2FZ9A 1IEIA 1EL3A 4XO7A 3WBYA 3M64A 1ZGDA 4LBSA 3O3RA 3NTYA 2ACUA 4XVEA 2BGSA 4I5XA 1Q5MA 2PEVA 2R9RA 1PZ1A 1QRQA 2PDXA 1QWKA 3N2TA 1YNPA 2I17A 1AZ2A 1Q13A 2IKHA 2WZTA 4WGHA 2FZBA 4LB3A 5HA7A 4HMNA 3EB3A 2FVLA 1OG6A 3LD5A 5M2FX 3V36A 4L1XA 5JH1A 3EAUA 2J8TA 1PZ0A 4XZMX 2FZDA 4LAUA 2PDHA 4LAZA 4YVPA 4EXBA 3GHRA 2PDLA 3R43A 2IS7A 3C3UA 3M4HA 4XO6A 1AH4A 3R8HA 4G5DA 2R24A 2PD5A 2BGQA 4QX4A 2ACQA 4R9OA 5HNUA 3DOPA 2IKJA 1X96A 1Z9AA 3Q67A 3GUGA 1PWLA 4GACA 1M9HA 4QBXA
chains in the Genus database with same CATH superfamily
3NR0A 3P82A 2Y88A 1XI3A 3KP1A 4IG2A 1R9XA 1QW8A 4PB5A 1XP3A 1Q6QA 3BV7A 2FMOA 4P8VA 2G50A 2W9MA 2PGEA 1KLYA 4R53A 2FYMA 2FGLA 4C6FA 1OCQA 1O94A 3TYUA 3TNOA 4HNOA 4PULA 2A1YA 1SZGA 1PKNA 3FK4A 4GC4A 4P61A 3GKAA 3H4XA 2NX1A 3NXLA 1BXCA 2WNNA 3NZPA 1FWTA 4A8IA 3CIXA 3HPFA 1EXPA 2FHCA 4AF0B 2X09A 5BRBA 4L80A 2XHYA 4D8ZA 1XLEA 3MVTA 3TC3A 2J75A 2VVNA 2G0WA 2EJAA 1QJWA 2V82A 4WJEA 4FAMA 3S1WA 4AZ7A 3ARYA 3MYPA 4N02A 2A6NA 3HQNA 3O9NA 3VNZA 1G4EA 3L0GA 1XLIA 1Q8JA 2DSZA 3GSMA 4AIBA 2WCAA 4MNKA 3VK5A 1KBKA 3V5CA 4RJEA 1D7FA 2XVLA 1EJTC 1ME8A 3FYYA 2F2KA 3FEMA 1BSIA 1DJQA 4GK8A 3RILA 3RM8A 5FEWA 2PDIA 2VEGA 1SZRA 1MYRA 4N4QA 3T55A 2ZXBA 1GJUA 5HXMA 5E0CA 5D30A 5MHBA 1PV8A 3R79A 4MWAD 1E6NA 1ALDA 3IRDA 1SJAA 3MW7A 1JRBA 4ASTA 1K03A 1P0EA 3WJZA 2GDVA 3FXGA 2QVHA 3NVTA 4PBEA 4BA0A 3A64A 1AW1A 2HQAA 3WBXA 4QS6A 3B0UX 1F3EA 1OZMA 1KTNA 3AI0A 1DQXA 4MG4A 2OYLA 3VAVA 5J5DA 2NW0A 3H2NA 4UFKA 2HXUA 3GDTA 1F5ZA 4XWUA 4HMCA 2OX4A 2ZE0A 2ZYFA 2TAAA 3A3WA 1TV4A 4GFSA 4M6VA 1E0XA 1B3VA 1KV8A 1LROA 2J27A 2YCKX 2DVUA 1OFEA 3W01A 3URQA 1HKWA 2BP1A 4ZSTA 2OFJA 4FLRA 4H6QA 1O12A 1KGUA 1PUDA 3ZS4A 1FH8A 2X1UA 4L1GA 3WQEA 2EG6A 3RR4A 3GAKA 1SZFA 5EMKA 4UBPC 3WMBA 2CLOA 5HMFA 2XIIA 4EOUA 2G95A 3DESA 2DZSA 2V3EA 3A9BA 1MUMA 2CLFA 5DRIA 4CU8A 1VRXA 2VL4A 1HGYA 2ONEA 3KZSA 4F40A 1ODZA 1AMKA 3B8IA 1QBAA 4R7WA 2DSVA 4QLKA 1WO2A 1PDZA 1XF0A 3P3BA 2ZRYA 1B9BA 2W4XA 4LAOA 1KXHA 3I7QA 5AZ1A 1GGOA 3R8GA 4Z2KA 1L8NA 5AYXA 2CLPA 4GINA 1H3GA 3QY6A 3IJ6A 3WYZA 3MC5A 5KSWA 3A4WA 4GX8A 4MKNA 4MB1A 5EY5A 1PEZA 2GWNA 4Z2HA 1YQ2A 2WNQA 3IV8A 1NFBA 1TTJA 4GY7A 3OYXA 1QPKA 2ZRWA 4HD5A 2OQYA 1J6OA 3W29A 3RCYA 1UB3A 4KETA 4PMZA 3S1UA 3ZLGA 2VD8A 1KM5A 4JTRA 3ITCA 3LNMA 4GZEA 1VGAA 3KE0A 3AUOA 1UKPA 1BXNA 3GXDA 3CMGA 3N4EA 1T41A 3MU7A 1K9EA 3MZNA 3EDKA 5FF7A 1HXJA 4DI9A 3PWGA 3IVSA 3RLVA 3TTQA 1UR4A 4U33A 3C8FA 4GXPA 5EKYA 4J27A 3L9CA 2A79A 2C6QA 3GLCA 4Q8MA 4K2SA 2JEPA 2O9PA 4G7EA 1X1NA 4OVXA 1JI2A 2WJZA 1FCBA 1Y8BA 2JEQA 5H8MA 4HPNA 4V28A 1UCWA 3AHZA 4I8YA 5U4NA 3TR9A 1SO5A 4EIVA 3C2EA 3L67A 2D3LA 2WZTA 4WGHA 1X6NA 4LB3A 4M0XA 1MW1A 2O7SA 4KIRA 2R1LA 3DG3A 1NTHA 1WB0A 4KBXA 2BXZA 8TIMA 4D1IA 3W7OA 1G1YA 3GDMA 4YTTA 3K1GA 4J5NA 1VC4A 2HNHA 3ZWTA 1XS2A 3QKEA 2XSXA 3HG5A 5I03A 2FHBA 5FL0A 4GJ1A 3LV6A 4MYXA 4GYKA 2CBUA 4ERGA 2G3FA 1JCMP 2V68A 4LV9A 1C7TA 4PH6A 4XAZA 4MYAA 1E43A 3AS1A 2BGQA 4C6DA 2YDSA 1LUCB 3TNBA 4DEFA 1OX6A 3MYOA 1KRBC 5C2XA 2EKGA 4GYFA 4O53A 4NZ3A 4Y9AA 3EEZA 3WLPA 5EGRA 1GWJA 2ABAA 4DZHA 2I14A 1Z6KA 4JTTA 2UY4A 4NJGA 3FKKA 1D2KA 3VD9A 2AKZA 4MLJA 3SY8A 5CLTA 3E1F1 4IQDA 2GGIA 5LNWA 1WAUA 4YIWA 2CWNA 3KHJA 3QF0A 1BD0A 3VDAA 5AFDA 1Q7ZA 4W9TA 1J01A 3VM7A 2R6OA 4TXEA 2O9RA 2V5LA 4HN4A 3EWZA 4QRNA 2PCQA 1C8YA 5EU9A 2AOSA 3C0SA 4AD3A 4RPQA 3GK0A 1X8FA 1TV2A 4BWLA 4UB9A 2ZWYA 4B91A 1VFSA 1EP2A 2YDAA 1WKDA 6XIMA 1G94A 1LBMA 2R1PA 4BI5A 2Y7DA 2CBVA 3UY8A 5M17A 5A2CA 4EAMA 4HYVA 1GOXA 1Q6RA 3G3MA 4J7RA 4OUEA 1D3HA 2TPSA 2PGFA 3FJ6A 3W7RA 1HKKA 4BFAA 5H91A 3T6CA 4MZ1A 4RLIA 1OY0A 4GYPC 1TJ1A 2Y70A 4QCEA 4TUFA 1OABA 1WKFA 4ZQCA 2Z1KA 4C1NB 1LCOA 4JTAA 2CLKA 1UZHA 4OGZA 4ZL1A 2C16A 2GDQA 3E0FA 1E71M 3W6YA 4CCDA 1LWIA 1QATA 5CQ1A 5T91A 1EX1A 4E3TA 4MTVA 4LVGA 5FJRA 5BWFA 1Z8AA 2QCFA 2PLKA 3LQLA 1KRMA 4QLLA 1C8QA 1E55A 3CHCA 4LUTB 5HMEA 1P0KA 1DJYA 1LTDA 3RX4A 3KL0A 4DO7A 4ZBCA 5M3WA 3TQKA 3W1MA 3DYOA 5KZMA 3LHWA 2YJQA 2OCZA 4AX6A 4LUSA 3CPGA 3QR3A 1W8SA 3BOLA 3N9RA 3S46A 1EGVA 3CQ0A 5E0KA 4D6GA 3A3XA 2D2OA 3ZFHA 2R1MA 1S5VA 3M6DA 4DJDC 3STGA 2D23A 4LX4A 4D8AA 5CAKA 3IIVA 4XZNX 4B5VA 3MMUA 4P8UA 4OIFA 3II1A 2XZ9A 4JKMA 1C91A 3SZ8A 1MXDA 4BR1A 1P43A 2H3DA 3ME3A 3GXMA 4PMJA 4I9MA 5EFFA 4LFYA 2XG9A 3ZIZA 4H01A 4Q32A 4GH1A 1XUZA 1GG1A 4ROQA 1RXOB 4MZ8A 3UWZA 3QZAA 2E4TA 1K4GA 4PEKA 3W1UA 1IWBA 3T0TA 1FWDC 4KWOA 3L0NA 3S0CA 1XC6A 2ON3A 3G1RA 3C2RA 1RK6A 3TONA 4LCQA 4KGJA 3E5PA 4ZQMA 4M6PA 5ENLA 1B3ZA 4E2OA 3FS2A 1SGJA 1TQXA 3TJXA 5JIPA 1XLMA 2BSLA 4IPPA 3CK5A 3NQAA 4H8UA 5HWMA 4BQ3A 2B7QA 2J9YA 4IFKB 2J4GA 5HNRA 1WDRA 5I24A 2Z1SA 4S3CA 4NNAA 1ZY9A 3MPGA 3WLSA 4FLSA 1RR2A 1ISZA 4AEEA 2DT3A 3NWRA 1JNEA 3NZRA 1BYAA 1K9DA 1XV8A 2VZSA 4I9AA 3WH7A 4PN2A 5CLWA 4IQJA 2BDQA 3HJZA 4KF1A 5LIKX 4TX8A 2NT1A 1UC4A 3SRKA 1HVXA 3EWYA 4JN7A 5BMXA 3AIWA 3L0KA 2WNWA 4F0MA 3CV1A 3GZAA 3FA5A 3TIMA 3RG6A 2DUZA 3GRIA 4WSJA 2GK1A 3N1AA 4FALA 7A3HA 4GIYA 1YE4A 3C2OA 1TPDA 3SUUA 4Z2GA 4R7OA 1L8PA 1HFBA 2QR6A 5CGQA 2PDMA 3UJFA 4KEVA 4AY8A 2WCSA 3MJMA 2UY2A 3KBSA 4YYFA 5CSSA 4O11A 3N34A 2OZ0A 3GU2A 3FEQA 1XR2A 3GFYA 1P5BA 3SI9A 1H7WA 3FA4A 2F6XA 1PE1A 4GIEA 2JGYA 1GVIA 3W6LA 2DZPA 1XXXA 4JTCA 3H2EA 1EIXA 2AL2A 3N3TA 4A22A 4Z2JA 1JR1A 1CWYA 4NSBA 1QDSA 2X2YA 3CEUA 3DHPA 3UZXA 4QE4A 1FRBA 3PBWA 1PBGA 3AXHA 3WQ4A 3CO8A 2J62A 4UR8A 2WMIB 5AC6A 2O56A 2IMRA 3DI0A 1JZ4A 4GIAA 2VX5A 3M64A 4JKLA 3BDKA 1XYCA 3PWIA 1S5NA 3NQVA 1GOKA 2PWEA 4XVEA 4AHPA 1Q5MA 2QIIA 3CUZA 1VPYA 4QS5A 3S5ZA 5AYYA 5FJPA 4AWSA 4NRSA 4GFIA 3QTPA 2Y61A 4XBSA 2XGBA 4W88A 4GO9A 2FZBA 5HMDA 4WKAA 1KBLA 2O9OA 3BAJA 3NO3A 3ZXWA 1Z41A 2ZZ4A 3KAOA 5A3HA 4GNVA 2A3BA 5FEPA 4QNWA 3R0DA 2J77A 2VD9A 1P0DA 3SRDA 4EXBA 1HKVA 3ATYA 2NSXA 4MY8A 1FHUA 2CZEA 3S5SA 3O16A 7REQB 1T7LA 2RGMA 3H4WA 2Q3OA 2OLSA 2PD5A 1KKOA 3APTA 4KS0A 4CLMA 2GSHA 4KESA 3KS5A 4LANA 1GHRA 3N29A 1KFCA 3BZJA 3NGJA 3QBUA 3SCRA 1T8XA 3DDMA 3C2YA 2XSAA 1H2JA 5CPOA 3SCPA 3XIMA 4G6CA 4PBGA 1E51A 3NCOA 2XFWA 2NVDA 6CGTA 1C9DA 4AZCB 1VCGA 2PF8A 1VIWA 4IJCA 3KCOA 3FFSA 3U57A 3VGHA 3AIUA 4S39A 5JXQA 3UW6A 1QI2A 5FAJA 2GWGA 5D33A 4I6KA 4CQDA 5I07A 2NWSA 1SUXA 3W7PA 1UOZA 3L5MA 2J7CA 3HGSA 2CLEA 1S2AA 3EOUA 3WG6A 4DBWA 1NSJA 3LPPA 1P6BA 3B3DA 2XPKA 3M5YA 1IIGA 3CQJA 4HK7A 2RDUA 3OIHA 4BQ2A 4JTHA 5AYIA 3UG8A 3IJ8A 1NELA 4QSHA 3WELA 3BC9A 4K36A 3VNMA 4OUIA 5D9NA 1FP8A 3H23A 1EJXC 4O28A 1A47A 1W3HA 2E6YA 1GOMA 4PMOA 3STEA 1XPYA 5BROA 1DPMA 4ATDA 1I0BA 4DXKA 2E9BA 3HURA 5LHFA 2GJXA 3VE9A 3MWAA 1X98A 4LB4A 3SCQA 3KHDA 1QK2A 4GYPA 1PZ2A 3USBA 4UWMA 1U2YA 2C19A 4ZOBA 1H7RA 3JVAA 1O1HA 4X0NA 3W75A 1ELSA 3WUFA 2JKEA 3PTKA 3QYQA 4GQRA 4EKJA 4FSAA 2WC3A 5CGMA 1P0BA 4WLCA 4G1KA 3WSUA 2QULA 3RJYA 2V69A 2YDRA 5K3VA 1PIFA 4Q4SA 1KFKA 4AD1A 3QXBA 1VENA 4J2PA 3UBPC 1G4SA 4CVWA 1C29A 4PUDA 3BW2A 2JK2A 4NXSA 2XTKA 3VPLA 2AQWA 3A47A 3WIJA 3WLIA 3P2VA 4IP5A 3WQCA 4RE4A 1JAEA 1H1YA 3NQDA 1UKQA 2ZZ6A 1M1BA 3V3WA 4TR9A 4O1CA 3N18A 2BY0A 4FX6M 4EP8C 3QJAA 4RKAA 1F76A 3KLKA 5A95A 4H7ZA 2GJRA 2Y5JA 4P7QA 4M8UA 2FJUB 3DFHA 2BVYA 2PWGA 2QJNA 1XDJA 2PDQA 3NZQA 4E2BA 3HPZA 3GDRA 4DIAA 3W1PA 3GU9A 4PFMA 2CPUA 2VQUA 4PCFA 1VBGA 3CV6A 1KFLA 2DJLA 1F8IA 2PURA 3UT0A 1CGVA 2OWWA 2YA0A 3F4WA 5IRPA 2YCLA 3MP5A 3Q45A 1V6WA 4LQ1A 5I7GA 4L64A 3GS6A 1J18A 3UWEA 4TO8A 4H9VA 3IUIA 3CWHA 3SY5A 3MI6A 5E6ZA 5CG0A 2HV5A 5HMSA 1J4EA 4LF2A 1CZ1A 1VHCA 4JTQA 1YRRA 1T8QA 3RRXA 4L4PA 4IL2A 2J24A 4TTGA 2EPLX 1KRAC 2OGJA 1KFEA 2ZRXA 4FLOA 3WK2A 1ZCCA 3WUBA 2QXWA 3MCNA 3REQB 4RZBA 1ZAJA 2TYSA 5HJLA 1J0JA 1C92A 2DU2A 4RCXA 2GVEA 2YBTA 4LRTA 3RK8A 3CYVA 1NIUA 3PWAA 2V5DA 2B31A 3G1HA 1RQHA 2VKZG 4O4VA 3KOXA 3ZMRA 5CC6A 2ZZ2A 5CXPA 4YU1A 2VCAA 3CB8A 1NFGA 4LT9A 2ZRVA 4GVFA 3LRKA 5AC5A 2OSWA 2Y4SA 1WBJA 1E1FA 4H19A 4MF4A 5HPOA 2WHKA 4UMAA 4FX7A 1JCTA 3GUWA 4CNSA 3MUIA 2VGIA 4C6MA 2JF6A 4XD6A 3OVRA 5CC7A 2HTMA 4EPDC 4C65A 3W2KA 1G4PA 1M7PA 3C86A 1UIOA 3VC6A 4S3BA 3TYCA 2IXUA 4TMBA 1L6YA 4PRWA 1K8XA 4F9JA 3NQBA 3W0KA 2FJKA 3PPHA 4OHQA 2FPTA 2WK2A 1J9YA 3ITVA 4U5IA 3WBYA 1KXQA 4PCNA 2W67A 4B3LA 2WMFA 4P7NA 2VWTA 1BQCA 4NI8A 3CIVA 2I7GA 3M46A 5BOEA 4I7WA 1WYIA 2C15A 4QQ3A 4HP5A 4LALA 3V75A 3W1RA 1AZ2A 2A2IA 4IMCA 3GVVA 3PBYA 3WLTA 4LC8A 3SRHA 2DSKA 1WUFA 2FVLA 4NASA 5B7ZA 5D8WA 5E09A 2CESA 2Z2UA 4RUBA 2J8FA 1WXZA 4QCFA 3UYCA 2J8TA 2A6LA 1RSCA 3KTCA 3G1FA 3KOZA 4GHRA 3C52A 3NZGA 3T9PA 4IPNB 3MUCA 1UBSA 3P5YA 4K7YA 3RXZA 1X6UA 3AICA 4HPXA 4I5UA 3JU2A 3LBCA 3R8HA 4AQLA 5D04C 2FB3A 1EDTA 2BTMA 3APYA 2XM1A 5G2IA 1WXJA 1CIUA 1S3HA 2WWCA 3DC8A 3BGGA 1R30A 1H62A 3ZT6A 1ZP3A 4U5KA 3DHDA 3LGEA 3ZR5A 1R46A 1QHZA 3M0HA 4DYKA 3GIQA 3AXXA 3GBEA 2BHUA 3E6EA 4GVGA 4MUPA 3U2EA 4J3SA 3TVAA 1RA0A 4PMXA 1FWBC 5CJ5A 1K6AA 2PZ0A 4B4HA 2EEXA 4HCHA 1RBOB 4P7RA 4A3QA 1J5TA 4JTKA 3QSTA 3IV3A 3S6OA 1E9ZB 1QR7A 2QS8A 4KCVA 1UD2A 3K5XA 3EX6A 2OWCA 4JTLA 4C5YA 5BXRA 2YYUA 1WZKA 1HJVA 4RW5A 4AZ6A 1KBBA 3ITLA 2VMFA 1UWSA 1IYXA 3RR1A 1XLFA 4Z1AA 1BSLA 3KTSA 3M0IA 1VF8A 3H4GA 3K8MA 5D32A 2VVSA 1S39A 1OGGA 2C13A 3O1NA 2OOGA 3VZXA 1LZOA 4DRSA 1O7AA 1OFDA 4JQ4A 3RHGA 2ANUA 2A3AA 3FKRA 4CQAA 2BXYA 4AUBA 4NHVA 4IJBA 4XD3A 1W9PA 1VCVA 4GUGA 3EDJA 5BYWA 3ZJ6A 5K2ZA 2QGYA 1A5UA 1W1IE 4AZBA 1RJRA 3HMJG 3S5YA 1W9BM 3Q94A 3BOFA 4L9ZA 4QNEA 4WX2A 4L1WA 4UQ9A 1UUQA 1V79A 3H2MA 3UWQA 3NVDA 4CU7A 3LUTA 3C3NA 5D4YA 3G3DA 3A24A 1RVGA 4N6EA 4HNUA 1SR9A 1I2NA 1TTQA 2P50A 4R27A 5LXEA 4HOWA 2WSRA 5GQBA 3RNDA 2A3EA 1OM0A 2VFEA 2PTXA 3OO2A 4BCEA 3QR0A 4H9UA 2BV9A 3TWAA 1OFBA 3G8RA 4Q4KA 3JZUA 2WM1A 3MWCA 3I7RA 3T09A 3EKZA 4LU0A 1OCJA 2Y6ZA 1XW8A 3IJQA 3M47A 2Y5SA 2Q8LA 4ZR8A 6TIMA 1OC5A 1HP5A 1IWPA 3MHGA 2PA6A 1SU5A 5A2BA 4O50A 3UGVA 4HOZA 4LCRA 4JIIX 1NP0A 4UTLA 3G2GA 1VR6A 2WKGA 4AHQA 4O1AA 1S1PA 3NQEA 3M0JA 1HW6A 4L6DA 2YA2A 3H21A 3W76A 3K4WA 3OA5A 4RDWA 2CZVA 4PB3A 4FEZA 3B03A 4F8XA 4PE8A 1ICSA 1W5QA 2YCJA 3M9YA 4JHMA 2AMGA 4A8NA 5EBUA 3EOEA 3LCHA 1JVNA 3MUY1 4NX5A 2HRWA 4LEFA 5FF2A 3VNIA 4HHMA 1TR9A 3U48A 1BYDA 1PIIA 2VDHA 3QPYA 3DHFA 2NXIA 3M7WA 3WBWA 3DG7A 1GORA 3SUWA 2UBPC 3CPRA 4M56A 1HGWA 2V81A 1Q65A 3HZ3A 5LXXA 4FNTA 4E3VA 3QMTA 3MMDA 4PUMA 4NUWA 3QV6A 1VJIA 3MCMA 4XB3A 1EWEA 3INPA 2V5CA 1OG0A 1XYFA 3AMLA 3UYIA 3MS8A 1O5XA 4WZHA 4BK9A 3TJLA 2INEA 4NILA 1NY1A 4GGHA 4YVVA 1ZSXA 2OSXA 5CC5A 1XIFA 5LIYX 4OOZA 3NPWA 4CEXC 3KCLA 2GQ9A 2GVJA 3NUKA 4JBRA 4KMQA 3VI2A 4WQ6A 4RNFA 5CPMA 4IGSA 1R3TA 1DORA 3AHXA 1CW2A 4IIHA 4JZ5A 3BSHA 2CITA 3ANVA 4RNJA 3RPMA 2X41A 1CXFA 4O18A 4GVHA 2YCEA 3EB2A 3W2LA 3OGRA 3P8IA 1WV2A 1TIMA 1DV7A 2PP3A 1GONA 4DVOA 4PMYA 4I90A 5DQPA 4AYSA 3OBAA 4Y96A 3WLKX 4DELA 3K30A 4V1YA 1HJUA 4Q8NA 3CZJA 1VB9A 1QK0A 3GIPA 2FZ9A 4JGDA 1O5KA 1IEIA 4A3HA 1KWKA 1EJSC 2YB4A 1R5YA 4S3AA 1THFD 1X1ZA 5H6HA 1QW9A 2ACUA 4PUEA 2CWXA 4I7VA 4GI9A 2Z1VA 2ZICA 1V0NA 1QI3A 5B80A 3WZ0E 2Y7EA 1AQHA 3N2TA 4MWAA 2WQDA 3O6AA 1KGWA 2JALA 2RUSA 2QCHA 3UWYA 3WO8A 2DY3A 3VD3A 4KRZA 1TZ9A 1VD6A 3OGVA 3V36A 1SVDA 2CZFA 3TQVA 2IW0A 4JFVA 2CBIA 2PC8A 1S2VA 3N4AA 1ZJAA 1R7OA 3CO4A 1GCYA 4IPIA 1EHAA 1KFWA 2YYTA 4H9TA 1L2QA 2ZX7A 3P80A 4GD0A 2OX1A 1VFFA 3W1XA 4R88A 1ODUA 4MB3A 5AHMA 1J0KA 3PJWA 1W3TA 4LBUA 1A5CA 1Q6OA 1PX4A 1JDEA 3K4DA 2YW3A 3FGCA 3VNKA 9XIMA 2YCIX 1I2QA 3NAVA 4Y9MA 1G67A 4RZ4A 1QNQA 3CLMA 3J7HA 2BODX 3CC1A 3WLLA 1J12A 5D2VA 5HOSA 1H41A 3ZZ1A 1UD5A 4DZIA 4FXRA 4NNCA 5GJPA 3VCRA 1UWRA 1S2TA 4ONVA 1JYVA 1UR8A 3P6LA 3R7MA 3CHFA 1PX8A 3G6MA 2DZUA 3T8QA 3ARZA 5LNUA 3VGFA 3W71A 1ZRQA 4UTTA 3CPUA 2WVVA 4QR6A 2ZTJA 3DBPA 3LEPA 2BY3A 1GVQA 4I8DA 2Z7KA 4DXVA 2QLYA 3EA1A 3M16A 5DEZA 1E72M 3O6YX 3IIXA 4GIRA 3U2CA 4NT0A 2FPVA 4WDTA 2GVLA 2C79A 3STCA 1IV8A 1W2PA 4GG9A 1XGDA 1L6GA 1XLDA 2EPHA 1XISA 2ZA3A 4IICA 3A9IA 4PYSA 1DTUA 4E4UA 2NXHA 4O16A 3W9ZA 1I2PA 1L2UA 4IPLA 1TYGA 4R5EA 4YNGA 2VO5A 1RD6A 1HJXA 4DXXA 3MI2A 3CT2A 1HN1A 4M5PA 4CUCA 5D8ZA 4PTXA 5T9BG 4X9YA 2VC9A 3WLNA 3TP4A 4D6DA 1J0IA 1ESWA 4A6GA 3FDGA 5DBTA 4DYJA 2WSKA 1SFLA 5J5RA 2D69A 2WW5A 3SFKA 5KZEA 1LQ2A 4O17A 5FF4A 1TPC1 4H9YA 3UD6A 3SADA 4LY8A 4PFHA 7XIMA 3M07A 4FIRA 2A5HA 1Q6EA 4POCA 5H8UA 1P6WA 3LHVA 1PL9A 3TOPA 1H7PA 2A7NA 3T2QA 4DHGA 1Q8AA 5D2WA 3ARQA 4J4KA 1R9ZA 1KBJA 4C6OA 6TAAA 2OU4A 1MRAA 3F5KA 3HQOA 4JFSA 3PZQA 2Z2AA 1K1DA 2P8CA 4O14A 2QEZA 3LDVA 4Q4MA 2JFEX 1ZP4A 4Q4OA 5A8QA 4HNVA 4ACZA 5KMYA 2NUWA 2F6UA 1NJJA 2YDQA 3LENA 3LGGA 2HVNA 4KEUA 5CEWA 2RAGA 1UD8A 3WMCA 4OKDA 5CH9A 1Z42A 3CMJA 1WKEA 3U3HA 4IF2A 4JIRA 3TYEA 1CGTA 1QOPA 1CECA 4ZQPA 2P3EA 3KM8A 3NQ8A 4OWGA 4URIA 3R25A 3B8TA 4Q7NA 4REQB 1C8XA 3CAVA 2GYIA 2BZNA 4LYQA 4EACA 3FVDA 3PUGA 2QDGA 2ACRA 2WM0A 4MNJA 3EA2A 3HMCA 4UTWC 2PRHA 3KVMA 1CB2A 3ZLHA 2YL9A 2GJPA 6REQB 1LL6A 3BK0A 1TZZA 3F2CA 2NT0A 1WDSA 3N2OA 3WF3A 4HA1A 1W54A 1HP4A 4MFDA 2F6KA 4Z0SA 3JUGA 1MZHA 2AAMA 3B4YA 3PZTA 3NL6A 2HS6A 3VIPA 2L5HA 1DIOA 5LSMA 1RLCL 2Y8KA 1MQQA 2XJ7A 3WQ8A 5C7VA 1HIZA 4FR1A 4WDWA 1SSDA 4PUKA 1QT1A 3LM7A 2ZUVA 1UBPC 3B8DA 4GH3A 5KINA 1UZ4A 1F3TA 4GBDA 4CQ8A 4A35A 1W31A 2BVDA 3LA4A 3EEGA 1BGAA 1UOKA 4KKXA 1E1CB 3W26A 1ZBKA 1CLXA 1KW1A 2ZX6A 4Y2WA 2PWHA 4UFIA 1I1WA 1CCWB 3AOFA 2XGZA 3C0QA 3SQLA 4V1XA 2OXNA 1UWAA 4S3JA 4F4RA 1XCFA 1Q2SA 3D47A 2PBOA 2ZX8A 3GNNA 1AFSA 4ZGYA 4WJ8A 5F1VA 1AMYA 2HXTA 3BCJA 1JFXA 3KVKA 4C6EA 3W1LA 2ZBTA 2BS9A 4W5ZA 4B5UA 2XWDA 4K8HA 4NU7A 3ZLFA 3B8UA 3BLIA 4H6EA 1A4MA 4JX5A 1W9UA 1M7JA 1HKIA 3DFSA 2X0YA 1KM2A 1XKJA 3WH5A 2AMXA 1Y7VA 3VKCA 1IR1A 1EA0A 3M5XA 2PTWA 2UZ9A 3OBEA 8XIAA 4GBUA 3DFNA 3NQFA 3G1SA 5CZKA 2XN2A 3QQ0A 3LM3A 4XO7A 3GO2A 1JG9A 2YB1A 3E2RA 4KWUA 4C91A 3DI1A 4Z1BA 1ICQA 2X1TA 1VEPA 1QRQA 2D0FA 2C14A 4O52A 1S5MA 1UC5A 2ZC1A 1UQZA 1OYAA 3SN0A 2E9MA 4WKFA 1V03A 1SQ7A 4JTEA 2ALDA 1BVZA 1M03A 4MKVA 3CZEA 2FVKA 1OFPA 4MDPA 4NZFA 1DQUA 3EGJA 2P8BA 1DWFM 1H5VA 3P62A 3V5OA 1LBFA 3A21A 2JKPA 3GG0A 2PDHA 3MVIA 4LAZA 2POTA 1MUCA 1SPQA 2DFAA 1R87A 1VJZA 3GHRA 3PTDA 4JCMA 2D2JA 3LXCA 2VR5A 4H8VA 1R3VA 3FV9A 4A29A 4ZXLA 4AVNA 1UASA 1XCWA 3IANA 1TX2A 3AMKA 2JIWA 4O0QA 1DJZA 2EF9A 3EMZA 4CKQA 4DJEC 1X39A 2WCGA 4MJ2A 3PVFA 2RDWA 3KBWA 3SY1A 3WH9A 4AH7A 3XINA 5HR6A 3NM1A 4TOQA 4IXHA 1PHWA 4HPHA 3BLDA 4US5A 4WD0A 4NY2A 1QTWA 1OIFA 1XYBA 1VH7A 4DWSC 4ZB0A 4BI6A 1Q45A 1Z89A 3R58A 4E2VA 1H51A 4M1BA 3ARVA 1VAHA 3JZEA 3OYZA 1IGWA 2ABBA 4WIWA 1EA9C 4QJ4B 7TAAA 4DF2A 3WENA 1TFVA 5ECVA 4DJFC 2ZZ5A 2X05A 2NWRA 2C91A 1SR0A 4JTUA 1YTEA 4EPBC 4UOQA 1AQ0A 4E38A 1YHTA 1TZ7A 3PG9A 4U2ZA 1KD0A 5A6SA 3PNZA 3M0YA 3AROA 1EHNA 5MKGB 4UNLA 2AQVA 3MUZ1 4KFNA 1XM3A 5CPQA 1RALA 4NI3A 4UZUA 4F9DA 1U22A 2Z1BA 3RCMA 3GVRA 3MP4A 1E4LA 4UNKA 2EAWA 4Y6GA 1GUVA 1C7SA 3FJNA 3GE7A 3BG3A 2OO0A 3C61A 3IJLA 3D0CA 3IVTA 3ZJ8A 4KT2A 4NYUA 1XJBA 3VXGA 3EOOA 3B0YA 1TPEA 3TE9A 2OWXA 1KWGA 5L9FA 4ZCWA 1ME7A 3S9ZA 3VFCA 2NSOA 5JBFA 3THAA 3KRUA 4NG3A 5EBAA 2QAPA 3MMWA 4UQBA 1HL8A 5ABEA 5LNSA 3WLMA 2DDXA 4CGTA 2HCVA 4B5SA 4HB7A 2NZLA 1KNWA 5GVJA 3NYDA 4UOZA 4FNPA 3DN5A 3LU2A 3RIKA 3TYDA 4CEUC 5F4XA 4PMNA 3FYPA 3KOWA 5EMUA 1WUEA 3TR2A 1XIJA 4UTFA 1F6PA 3LRMA 5AHLA 3APGA 4IFOA 2PS2A 3V1HA 3WY1A 3NJ3A 3VZZA 4HZMA 3LG3A 1Q4WA 4MMWA 2J25A 2VGGA 2CYGA 1K70A 1QO5A 2E77A 4OV9A 2G4FA 4GZ7A 4Z0JA 1V0KA 1ISXA 2PDKA 4ZQRA 3P74A 1OEPA 2HSAA 1TV8A 4PSRA 5LGZA 4KERA 3EA3A 3ZVHA 2GSJA 1CB7B 4AVOA 4YTUA 1JRCA 2FLIA 3MKVA 3BAYA 3SSJA 3VGDA 2FQIA 4R34A 5KZ6A 3TK7A 3OVQA 1XL9A 1PYFA 3ABOA 4F79A 4O57A 1GEQA 3LY0A 1GKPA 1KM0A 4I5RA 4OOUA 4BI7A 3H2AA 2OB3A 1PJ9A 3K46A 1EFZA 4UFMA 3AMCA 1I2RA 4UTJA 2PTDA 1TPVA 1OB0A 4CCCA 3CHDA 2GQAA 3TW6A 3OZPA 3IEBA 1O6IA 3V0UA 1GOQA 4DJDD 5AC7A 4UFHA 3WBAA 1B90A 3BTNA 1DE6A 1ECQA 1KR0A 5E0FA 1V6TA 3PC0A 3TW7A 2VFHA 4ILSA 3BURA 3RLHA 3CNYA 5A1AA 1H7OA 1E9IA 1LL7A 3AAMA 1J10A 4UC5A 2P3ZA 1JDCA 4Y9OA 1K7FA 3URAA 3CH0A 3G22A 3PBUA 3PSWA 2GFTA 3A22A 3RO6A 5I2UA 1MEIA 5AHEA 5K4ZA 2QJJA 1M01A 5BNKA 5REQA 1K9FA 4ZSUA 4JTDA 1Q2RA 2TODA 1GT8A 3CASA 2E6DA 5HDRA 1V3KA 3KDNA 3BLEA 3QFWA 4HTYA 4DZ5A 1FWIC 1KLZA 3P7YA 1RQBA 1VP5A 3TC6A 1LBLA 1BPLB 1TA3B 3AWNA 1HL9A 2XUCA 1T0OA 5A6BA 2R1NA 4L6OA 1IT7A 3WNOA 2AGKA 3DFQA 3QC3A 2E8YA 5G5IA 2Y7GA 4JEJA 5EMMA 4ORMA 1UR1A 3H12A 4NJJA 2ALRA 3R5EA 3DKJA 2E25A 1HNYA 1RBLA 5HANA 4W8LA 4B16A 3HG3A 4GGBA 3L12A 3RAOA 1REQB 1Y65A 3CZLA 2DIEA 1JI1A 3H55A 3H22A 3T05A 4QSFA 5HBFA 2BFGA 2OYKA 2QJMA 2PU1A 3THUA 1XUUA 2JKAA 4O19A 4ZO8A 1DHPA 3ORWA 1KRCC 4HCLA 4NIRA 5FF3A 2O92A 2BXVA 2GGGA 1FWEC 1PZ3A 3S5NA 4ZODA 1POJA 3RU6A 4QE5A 4FHAA 4L61A 1HKJA 4HMNA 4UCFA 3BG9A 3MA8A 1TE1A 3LD5A 4IIDA 1V7YA 1AL8A 3PZIA 4PMRA 2GUBA 1RK5A 2QAFA 3IWPA 4EPKA 4M24A 4YVPA 4AF0A 4IQEA 1LQ0A 3AU2A 2DJXA 4J40A 3HV8A 5F7UA 2HVMA 3EPNA 1V51A 1FX6A 5AKQA 2Z25A 1EZ2A 1R6WA 1E6QM 3IGHX 1OVDA 4NZ4A 1M5WA 1W5OA 1Z9AA 4KEMA 4S3GA 4OT7A 3VA8A 1XLCA 3UXKA 2OKTA 5CPSA 5BZAA 3SSZA 3TW9A 1UA3A 3U5UA 1RAKA 3N13A 3VKJA 1FA2A 1DWAM 2EO7A 1ZJBA 1J2WA 1BLIA 3HJEA 3S9YA 3AMDA 4DJEA 3CL8A 1JAKA 1V93A 4Y90A 4PZVA 2YL5A 1VEMA 2V8ZA 4NQ1A 3SGGA 3OBKA 3CMFA 3H24A 1ZJHA 1BF2A 1V6YA 1U33A 2B7PA 2DZAA 4QE1A 3MBDA 3E49A 5D2TA 4CD5A 1IE7C 3MMTA 5HWJA 1FP9A 3TEVA 2YBVA 2XH4A 3UZWA 4CNNA 3S4TA 4AY7A 2J78A 2VT0A 3M6YA 3H2OA 5F1UA 1JGMA 4QIUA 1G69A 3N25A 4HBKA 3LLFA 5DN1A 2OLHA 2Q01A 2VFIA 1MMFA 4M81A 2XU2A 3BLKA 3QMSA 5XIAA 2R91A 1KBIA 2HNEA 2BY1A 3CV7A 2CETA 3IJIA 4N7QA 5BOFA 1GPFA 2CLIA 3MKKA 3BV4A 2D2HA 1UH4A 2H6RA 2E5DA 1H4PA 3FJ4A 2V2CA 5C9WA 4DPPA 3CZ8A 4UR7A 5CSUA 3P84A 3TXZA 3HPXA 3KOYA 1TQJA 3C0LA 7PTDA 2E67A 1TTIA 2YZRA 1AZ1A 3TAKA 2V38A 1TV7A 1NWUA 2ZUTA 2ZKMX 3P61A 4OBTA 3LS9A 1P1XA 1F4AA 4MADA 1GQJA 2Y8VA 1H1NA 4ZB5A 4L9XA 3C5QA 1Z44A 4RE2A 2QCCA 1P7TB 4FI4A 3PFRA 3T0BA 1KTBA 3BZGA 5E9XA 3CL7A 3OIXA 1UIPA 4JEQA 4C6JA 4N6FA 2QCNA 2PF0A 4H1ZA 3ATZA 1XH1A 2VGFA 3OZOA 1V3HA 1JJKA 3LBOA 1O66A 3SUVA 3PZVA 1UJPA 4HZ8A 3NQCA 1M53A 3RMEA 4DF0A 3PHAA 4P2VA 3HM7A 4KRTA 5C2GA 2YZ5A 2JGQA 4HPGA 1J11A 1UW9A 3VGGA 2IPFA 1QU4A 1E6XM 5G4WA 4JIEA 1MDLA 5CZTA 2WBKA 4IH3A 2G96A 1UHVA 1LT7A 3AALA 1JNDA 3URNA 2RFGA 2J9ZA 3GC2A 3GX9A 4LYPA 3SN4A 1X38A 3LPGA 1A5LC 5EL1A 2Z1XA 2QNEA 6ALDA 1OX5A 3DBNA 1XX1A 5CSYA 3VOGA 3WNNA 3ZWSA 4ZEPA 3L4TA 3K2GA 1JD7A 3UFYA 3G6LA 4C7DA 1OC6A 5E1QA 2WC7A 1XCXA 5DCBA 1W6TA 3G1AA 3WNKA 1W1TA 3TCSA 4I3GA 5FJOA 5I79A 3SBFA 1RY0A 3S3GA 3CTLA 4ENLA 2C1IA 1H5YA 3EWCA 3BAIA 1OF6A 1UWTA 1E5JA 3TTEA 2EBNA 3MTWA 1EJVC 1FH7A 1E4NA 1KTCA 3G1YA 3F2BA 1TUFA 3BGAA 2WJFA 1IGSA 5TD4A 1X97A 3F03K 4F0SA 5JUVA 4ZB2A 2P88A 3B97A 3STFA 4JYFA 4E5TA 4GY0A 5C0QA 5J8LA 4Z1DA 1MEWA 3QRHA 4XZWA 2WXDM 3H6OA 2Z0IA 1EBHA 4UTUA 1EJRC 2V2HA 3UXIA 1B3XA 1QVBA 4DB7A 2HE5A 4DUVA 3M7SA 1JFHA 1NOWA 3ZT5A 3POCA 2IKIA 1QNSA 4F2UA 1NDWA 4DBEA 5LIXX 5CPNA 4QLJA 1TPB1 4HIBA 4L56A 4IOTA 4YWIA 1LUCA 4R9XA 3GIYA 3B40A 4HU0A 1E1EA 3GYEA 4WJXA 1YXCA 2Z24A 1DKWA 5A8GA 1BF6A 1PWMA 4GE8A 2VRQA 4YPJA 3ARRA 3PS7A 3CUFA 3BQ6A 1UKOA 1RZMA 1ZGDA 2VC5A 3TYZA 3O3RA 4ADSA 3E2QA 1PPIA 2CZDA 4LV4A 1AK5A 2NV9A 2OZTA 3U9IA 1ISVA 3F5LA 2I17A 4S2CA 3FHQA 4QEHA 3E9AA 3DC0A 3MZ2A 3E0LA 2VFFA 1K8YA 2NLYA 5TQLA 2VP8A 2Z00A 4GC3A 2QUUA 4IMDA 3UWVA 5M2FX 4RXFA 3LV5A 4LGXA 1SYTA 2VEIA 5JMUA 1YTDA 2A7PA 3KS6A 2FZDA 5I3JA 3BG5A 3BPWA 3OHIA 1EIBA 3MO7A 3H2CA 4H04A 4CNPA 5ABTA 3CWOX 3L2IA 2DZWA 1LORA 1SO3A 4CNTA 3BOXA 3QMRA 3EOLA 4D6FA 4ROPA 3V16A 4K38A 4Z42C 1LJYA 3RPTA 1UA7A 4R33A 3AYTA 3Q67A 1V6UA 2XH7A 1IIHA 4Q33A 3TFXA 1TELA 3OZMA 2YX0A 1W5MA 3U2OA 4C1NA 1V3MA 5BW6A 1K77A 4H83A 4TIMA 4DWSB 4HPJA 4O4WA 5DCDA 1W3LA 3ABXA 4GZJA 4S3FA 3AXMA 4HYRA 2PP1A 3PZMA 1VHNA 3M5ZA 3M0LA 1PCKA 1FFRA 3KCJA 3EBVA 3KLLA 5GNXA 5AVHA 1VFLA 4LUTA 1TJRA 4LAKA 2D1ZA 2HWGA 1OGSA 1TPUA 2WANA 1G9HA 4H7VA 4WY0A 3L4UA 5JH2A 3RGTA 4GNKB 2C1GA 1VYPX 2RJGA 4FS9A 2QW5A 5HPCA 2CLLA 3W53A 1F73A 2JBMA 4FXFA 3B8SA 3HBLA 1SW3A 3S1VA 3USZA 3VOFA 4PGLA 2ZIDA 3G5EA 3FSTA 4PCTA 3FY1A 3LHUA 2PC4A 1T99A 1J0YA 2F8QA 3QQWA 5C9ZA 4WRHA 3NQ6A 2A85A 4HYWA 1N8WA 1RPKA 1T5AA 4AFYA 5GJMA 4G1NA 1JZ8A 3PULA 1OCBA 2HVOA 3TXVA 5DT5A 2PWUA 4J1OA 4RX0A 1A80A 2BVWA 3U7VA 3AXIA 2CBJA 3GAYA 3RUBL 3SRFA 2QKFA 1JPKA 1RH9A 4XZLX 2NQHA 4BEQA 1NF0A 1XLJA 2BOGX 4G9PA 4B3ZA 4MVAA 3M0XA 2WC4A 3EXSA 3IAQA 3LRLA 5J04A 1QI5A 1H63A 4UFJA 1IXNA 5IM51 3AIEA 3T8LA 2ZTKA 1D3GA 4H6RA 1BG9A 3GR7A 7ODCA 1TVLA 2INZA 2NUYA 4N4PA 1DQWA 3SCWA 4U3CA 4XKMA 3SECA 2ZA2A 1TMQA 5CZSA 4IFKA 1MSSA 1I4NA 3WJYA 3ES7A 2QCMA 2FB2A 4IMGA 1XRFA 2FFIA 1OYBA 3GG7A 2OMAA 3WK3A 2QUMA 3UA3A 3LCIA 2F84A 1JYWA 3GXIA 2C8NA 4LCSA 2UY3A 4BS0A 1DTNA 1I45A 4RW3A 1BWLA 4GQBA 1JPIA 1KR1A 4JIQA 1S2CA 2G37A 2CC0A 3LK6A 2YBUA 1ZU8A 3HA1A 4TTUA 2ZWZA 4XUYA 4HHLA 3W7QA 3OLIA 4HCDA 2PAJA 1QUMA 4YYCA 4X0VA 5FA5A 4AISA 3G0UA 3FSUA 1PX3A 3VGEA 3TTSA 5LIUX 3S42A 4G56A 3TSMA 3WUGA 2WSPA 1A0EA 1XLAA 4QROA 4CN1A 3C56A 1B0IA 4DI8A 1SO6A 4H9ZA 2DH2A 1I1XA 3FW6A 1HO4A 4EF9A 2PSNA 1V0MA 2D24A 4WY0F 3C4UA 1EDQA 4F0HA 1G7VA 1X7IA 4HMEA 1OINA 1XRTA 1X8CA 5M1TA 2A7RA 1CGUA 3PJTA 2WMIA 2X0HA 4WDUA 3N6HA 3B9EA 3VDGA 3UXLA 3TH6A 1NDVA 4PR4A 3TMQA 2DZTA 3N9KA 4HA4A 2QQ6A 3VD4A 3UZJA 1R3YA 2FHFA 1IZKA 4WDXA 3NURA 1DE5A 1KB3A 3QLLA 3TUUA 1E9LA 1NOUA 3NL2A 2HK1A 4AIOA 3M0ZA 2E6FA 2DW6A 2MNRA 3WQVA 4TVDA 3W27A 1QMLA 3DGBA 1HTIA 2I1OA 4NZCA 2CLMA 3P81A 3CZGA 4PTDA 2JE8A 3TSDA 4OE7A 1VFOA 7REQA 5CAHA 3GG8A 8A3HA 2WPGA 2DSWA 2GSEA 3NOEA 1QHOA 3GC5A 1NM9A 1MRQA 2YL6A 2R14A 1LM1A 2XFFA 4QP0A 3L21A 4ZTXA 1VLIA 4PL2A 4IWWA 3PZ9A 4XD5A 3PN8A 2XVGA 4AWEA 3LCGA 4WHBA 1RCOB 2ZOXA 4LBSA 4QISA 3VIKA 4GUFA 4AZCA 4GWEA 5LNVA 5LA2A 3U4AA 3U7BA 5T8GA 5A69A 3OPSA 1E6SM 1RJPA 2NX3A 2EKCA 5G4EA 1Z69A 3LI1A 4LYKA 3MUXA 1GNXA 5XINA 1TO3A 5HULA 4BF9A 3TAOA 3F4NA 4Y8FA 3EX4A 2XGIA 3R12A 3GFZA 4S23A 1OG6A 1A5MC 4HA0A 3SQMA 1GPWA 4UTIA 4JTJA 4ERAA 4L4LA 5JH1A 3IK2A 3A4AA 3O05A 3RMJA 4WSKA 3ITTA 1DJGA 4DAFA 1VPQA 4RV8A 3C3UA 3H54A 3UERA 3PF3A 1Y5XA 4NYYA 3QTGA 2VFGA 1JUEA 3QC0A 4WY0B 3E74A 1QAPA 4WGXA 4AHOA 3O6CA 1RP9A 3UG5A 3PNUA 1Z7AA 4Q6JA 1JF6A 2J7DA 1M7XA 1TE6A 1XH0A 2HMCA 3RITA 2R8WA 2OZ8A 1ICPA 4KH2A 1JUBA 2QPUA 1NFPA 3ANUA 1LRTA 4H7CA 5A6TC 1OWQA 1Y0EA 2CERA 4Z08A 2IPJA 1E73M 3W7HA 4CQCA 4BF7A 3R10A 2PLCA 1DJNA 2XZ7A 4BZYA 1K7EA 2QUVA 3HGJA 2C1HA 1I60A 3FA3A 3GNDA 3BJSA 1EGMA 2WLYA 3V1PA 3NM3A 1UZ1A 3LQGA 3VGBA 2A3LA 2WV8A 4JPGA 2OYMA 3QH2A 4BEUA 4LWWA 4QG6A 5AOUA 4B5WA 1W0MA 1EO7A 3WJSA 1P1MA 3WF1A 4ZOAA 3AIQA 3BCDA 3MKCA 1SZNA 1IWAA 1JDAA 4LJ3A 5K9DA 2E28A 3MSDA 3EOSA 1WDQA 3BAKA 3NO5A 2RJHA 1FWAC 2OEJA 3AIBA 4IMFA 3VIOA 3CUJA 2OODA 4JCLA 4DBUA 2HPMA 3PTMA 4TVUA 4MGGA 3EMCA 4US5D 4C7GA 2YSWA 3DFPA 3P60A 3V5FA 4K1GA 1A49A 4F0LA 2FKPA 3O15A 5C54A 4GLEA 1W3KA 2VUYA 1ZTVA 4RDZA 5CSRA 4F0RA 4PMQA 3VIFA 3PPGA 8RUCA 3CAQA 4NNBA 2OR2A 1OX4B 3HPAA 3SCOA 2PB1A 6A3HA 1OFQA 4XSLA 2INFA 1W3IA 4LNCA 1YYAA 3BJTA 4X2RA 3DKLA 4W8AA 1RCQA 3IACA 5G1MA 4A8RA 2X8RA 3QV8A 4IGMA 1GJPA 4IHCA 4Y7EA 4YHGA 4JTGA 3HG4A 2Z28A 1VCFA 3TYBA 3EWXA 5I3HA 3UP8A 2OSYA 2J9XA 1CGWA 1E40A 4U31A 5A8PA 3QQ1A 4E6MA 4S38A 1TR1A 2SFPA 5A2AA 4N9EA 4MB5A 4C60A 5LHEA 2PGRA 2FDMA 3GHTA 3GWQA 1FDZA 1V08A 3REQA 2DP3A 3HO8A 4S3KA 4HZ7A 5CPTA 3GTFA 4XZ9A 5TBOA 3VMNA 1UROA 4AD0A 1V6VA 1F61A 2QJGA 2X7WA 1F74A 5ECUA 4N2YA 3LERA 3W02A 2R1KA 4EVZA 1OD8A 1EF2A 1XIEA 1C9WA 3NL5A 2ISFA 4D6IA 2PD9A 4E4FA 2GGEA 5G2HA 1UKSA 2FZ8A 1Q63A 1V6XA 1WX0A 3UXDA 1QFEA 2W6RA 5D37A 2ATMA 2BWGA 1I0DA 3UA4A 4W5UA 3OZYA 5BRPA 1ISWA 1TTPA 3RDKA 5AVNA 2Y8UA 1BG4A 1JYXA 5F4SA 4DYEA 4MNLA 5AECA 1NAL1 1PXGA 5C7HA 3L5LA 5AYBA 3OODA 3R1ZA 4IIEA 1BYCA 1UH2A 2J7EA 2BHYA 1JYNA 2IPGA 1B3WA 4MSSA 2I9UA 4ADTA 1L6WA 4K37A 4MHBA 4MZYA 4IISA 2Y24A 3WQWA 3MJYA 1F6KA 4WKHA 3WL0A 3UU0A 2ZDRA 3TA6A 4HSOA 3VUPA 3LZ3A 1A3XA 3ZSTA 3KZPA 1MUWA 5XIMA 5CJMA 3VILA 3BWWA 1FH9A 4QAIA 2CKSA 3NL3A 1C8VA 4GA8A 3GTXA 3W84A 4C6IA 1NQ6A 5FJJA 1ADOA 1O5QA 2E5CA 5SWUA 4K7VA 4D9PA 3KL5A 3RRAA 5TF0A 4KCWA 1CNVA 1YEYA 3W7NA 5A94A 1WOBA 1HKMA 2VC7A 1CT5A 1PO9A 2ATSA 2DGAA 4HNCA 4MY9A 1FFQA 2OELA 1DIDA 3WH8A 3PPCA 4P7OA 2J7GA 1JQVA 1W9XA 1JULA 4JIPA 3H8AA 5CPLA 1S5WA 1YIXA 3BO9A 1W2VA 2QJHA 3LXBA 2AL1A 4NJIA 1GTEA 4PB4A 2A21A 3UWWA 3TN5A 4A8LA 3WDRA 2NV2A 3TDFA 2NQ5A 4JR5A 3RCNA 2O55A 3GDLA 3W2JA 4DNHA 4LPCA 3L66A 2PWVA 3S83A 1GVFA 4FNSA 3PPFA 3I4EA 4PEEA 1VYSX 2P0OA 2DVTA 3NTYA 5CJNA 1QNPA 4PBFA 1H1ZA 1R2RA 2RKXA 1SZEA 3WFAA 2BG5A 3CB3A 5JQ9A 4J3TA 5D38A 2YR1A 1FBAA 4AY1A 5A6BD 4FOKA 4DX3A 2V67A 4Z17A 3NZ1A 2VX7A 3SM0A 1YMYA 5HA7A 3KXQA 3V18A 1XQLA 2FDSA 3WDPP 2HROA 1L6FA 2G8ZA 3WEOA 4A05A 1UZDA 3AYSA 3V4BA 1CBGA 2WYSA 1UP2A 4L1XA 3CT7A 4PTVA 4XKYB 3DHUA 2BVTA 1RV8A 2GVYA 4F3HA 1A3HA 1CDGA 1ZZMA 2ISDA 1EGZA 3GNPA 4GVIA 4HVXA 1UR9A 4NF7A 1QI0A 3R4IA 4QQUA 3WKZA 3E3HA 4K8GA 4IX2A 2WO5A 4AWUA 4R9OA 1I9CB 1NEYA 3DOPA 3LPFA 1X96A 4PA8A 1Q85A 4TMCA 4YJ5A 2QPXA 1K02A 1SFJA 2CIPA 3ARXA 1AL7A 1R2SA 3ABRA 3SQSA 1VEOA 3AYRA 3P0XA 4KEZA 1UR3M 4IGNA 4XV0A 3KTXA 5FL1A 1DVJA 4MJ4A 1YXDA 3NXFA 2P53A 1N55A 3VOIA 4YWSA 4NVTA 4BQ4A 3GNXA 3KP0A 4AEFA 4PCSA 2V63A 1MI3A 1FKXA 5PTDA 1K9TA 1HVQA 3G24A 1MQRA 1TIWA 1XWYA 3HB9A 3OVPA 3SCSA 2QYGA 3AS0A 4KCUA 5D2XA 1EBGA 1M68A 3WX7A 4GCAA 1FWFC 5I6SA 4DJDA 2VC6A 4AAJA 2ISSA 1MXSA 4AWTA 1CI1A 3NQ2A 1GVRA 3WDIA 3SB0A 2DSUA 3C2VA 4AX7A 1ZBCA 2EHHA 3EWUA 3WLOA 4JQ3A 3A23A 1WA3A 4PRRA 4UOJA 3VZYA 1EZWA 3AJ7A 3WQPA 1H0GA 1Y5WA 5KZDA 2VTFA 3WK1A 3NO1A 4FNQA 3OLDA 4S3EA 3B04A 4DJED 1W3JA 1JXJA 2C0HA 4QAWA 3G18A 4QGCA 3E0IA 2GQ3A 3FN9A 2OJPA 4O8RA 1R85A 3W00A 4ICNA 5I5RA 2PWDA 3Q65A 4CCEA 1UWUA 5M5DA 2H9AB 1XSKA 1IF2A 1ISYA 1FXQA 2OEMA 1TX0A 4HSNA 3L23A 5H2ZA 2D20A 4C6PA 1ITUA 1R3SA 1TB3A 2D0HA 1JCXA 3H26A 1LG1A 1J96A 3QGAC 2WZMA 1JCJA 1ITXA 1J5SA 2QGHA 1KQZA 3CAKA 3BSGA 3CU2A 3QPEA 4PMDA 4XX6A 4RL3A 1W5NA 2XYLA 4AW7A 5C9XA 2VDGA 2WHMA 4IM4A 4TX9A 3AS3A 1W1VA 2C3ZA 3O0FA 5AHNA 4HTBA 4LBRA 4PTMA 1XIBA 1BTMA 2DZXA 3N6JA 8CGTA 1NWTA 4BWLC 5E9AA 5HINA 3B06A 2J66A 3CLWA 5CBIA 4H8HA 1UWIA 3PUDA 3VOHA 2VR4A 1SFSA 4BQ5A 2EQDA 1F6YA 3G0SA 1DJWA 1YDNA 4TV5A 3PSVA 3CV2A 3TJ4A 4DN1A 3LPOA 3OQEA 1W1A1 4QJ5B 1UPMB 4Q8VA 2BOEX 3JR2A 1MFUA 2GUYA 4GCXA 5EMLA 1TWZA 2Q09A 4MAVA 2QCDB 3UZYA 3W7IA 4GYJA 2V9DA 2WJEA 1SMAA 4Q4QA 4QDMA 4NKCA 2ZVRA 2ZXQA 4ZE4A 3IUDA 4WEVX 2QMKA 4HK5A 3LLDA 5DMYA 3IIPA 4TQTA 1AJZA 1WPCA 3WDQA 1YX1A 3WUEA 1PKLA 1ONXA 4D72A 3E2VA 1JPDX 4MNMA 3QGVA 1Z48A 1NQKA 3WF0A 3B05A 1BFNA 2WSQA 4BJHA 5C9UA 4ZVJA 2R94A 3N2BA 4Y9NA 4NAEB 2Z2BA 4H4IA 2XM2A 3VNLA 3E12A 3KWXA 5CZ0A 1O5RA 5FAGA 3UR5A 1UJQA 9CGTA 4AG0A 2IQDA 2O9TA 2JIEA 3ELFA 3L5AA 2O0TA 1VPXA 2D73A 4CD4A 1GVYA 3HN3A 3ARUA 1IZJA 1GQNA 4Q7IA 1TV3A 1DJIA 1A4LA 2WZEA 5G1TA 4XZIA 5LIWX 1AODA 1TMLA 2W92A 3DFOA 5HATA 3DFYA 4B90A 4D71A 4DO6A 2J79A 2NQLA 4Q22A 3OTRA 5D9MA 2PU0A 3W7MA 3EPMA 4N42A 2QCLA 1ME9A 3LHYA 3RYSA 1XQKA 3AFBA 1AJ2A 3BMXA 1B1YA 1WZLA 1L9WA 2G3NA 1E5NA 1FCQA 3VUSA 2YPIA 3UETA 4IUGA 1MO0A 4LUJA 3TYAA 1EUNA 4IQLA 3T08A 1CXEA 4JL1A 3UJRA 4AXNA 4JX6A 2A0NA 2FTWA 2ZRUA 1EC8A 2YGYA 3VCCA 1CEOA 5FI8A 4QTGA 4FNUA 2J7HA 1EL3A 1WOAA 4L6HA 2PGWA 4GJJA 1CPUA 5AB3A 4GJIA 3W86A 3L4WA 1GZGA 1RQEA 3ZT7A 1ZLPA 2P10A 1W17A 2WNZA 2GOUA 4WOZA 3DCPA 5FESA 5JBEA 5IBXC 3KDOA 3W28A 1H61A 3R13A 4ZQOA 3BL3A 4XBJA 5D03A 1JZ7A 2XIBA 4JFTA 3W07A 3H53A 3DAQA 1R3QA 2X2GA 1CGXA 3AZTA 4DQWA 4D6JA 5B7YA 5HAOA 1B54A 3QHOA 5EMJA 3IIOA 3F5JA 2YIHA 1RUSA 5DY3A 2PODA 1VFMA 1AH4A 3AZSA 2R24A 1TWWA 4Y9PA 1KFJA 5HNUA 3C8NA 4JDBA 1GQIA 2IKJA 1KCLA 5I0DA 3FIGA 3W82A 1XC4A 5AHIA 1KCXA 1XIGA 3QHNA 3ZR4A 3H2FA 4UQCA 2RDXA 3ARSA 2O7QA 1QWGA 4GQ0A 2YFNA 3S2MA 5KITA 3PAOA 2CHNA 3WLRA 4F2BA 3PJXA 4PUWA 3W38A 2GDUA 2RHGA 5A6MA 1ONEA 1TUXA 4FF5A 4H9XA 2ISWA 4YHEA 4UNIA 3TKFA 5HJXA 2PPGA 2KAUC 1A53A 4CQBA 1IEVA 3S1GA 3T0CA 3AIRA 2X1IA 5CCZA 2QV4A 3V0TA 1MNZA 2QDHA 5U7SA 2DIJA 4UTHA 1FDJA 3T07A 3PZUA 4JQAA 2Y7FA 2GVGA 4JFUA 1BKSA 4C1KA 4DBSA 1A3WA 1POKA 2X16A 3HGOA 2H3BA 1RJQA 1R86A 1LLWA 2OO6A 4KRUA 4CCZA 3M43A 1ITQA 1IR2A 1EDGA 2ZX5A 2WPBA 5K9XA 4WF7A 1QPNA 1AD1A 2PI6A 2Q8ZA 3GH7A 2OLAA 4MKSA 1SFTA 1UP0A 4HU3A 3N9SA 4UMBA 3PB0A 5HK4A 3WBEA 1GEHA 5C9RA 1W3NA 2FIQA 1MFVA 2HZGA 3W2NA 4B9ZA 1EEPA 4U28A 1RBAA 4Y8EA 3T4WA 3IS4A 4M3PA 3PBVA 2X30A 3FDKA 4REQA 3SIZA 2GPTA 2RDTA 2BNJA 1X1OA 3LNPA 4IG2B 1FTXA 1ZHAA 1H09A 2IKGA 5A5WA 4ZMGA 2J13A 2YXOA 4E2DA 5BWAA 5D02A 2BASA 1EKOA 4NP7A 2O4MA 4K1WA 2AQOA 2X7VA 6REQA 3SCTA 3MHUA 1RPXA 3W81A 2JQXA 4FMVA 4ICCX 3R11A 3WJXA 4M7SA 1R38A 3F1QA 4HSHA 4GUJA 4MJMA 1OD0A 1LLOA 4NRRA 1OT2A 4MJZA 4DLMA 2ACSA 2EGZA 3LN3A 4PUUA 3TA9A 1AH0A 5FKYA 3TTOA 4IPJA 2PRLA 1AG1O 1BHGA 4JL2A 1EYWA 3WQ5A 2OT0A 1GOWA 1AVAA 4HJFA 1J6PA 1YNQA 4A4AA 3PR2A 2CXGA 3GY1A 3F7JA 1G01A 3VDBA 3O2LA 3NYZA 4A3RA 1PS9A 1VYRA 3WD0A 3GW3A 4NJHA 1E1CA 5MF5A 3DGRA 3SJNA 2FGZA 3GR8A 3BE7A 4DM1A 4AYGA 2WKJA 3TU9A 1SMDA 1YE6A 4M51A 2FH6A 4D6HA 2HDJA 3BLFA 4Q8UA 3WMLA 3FYOA 1V02A 1BVWA 1CENA 3CHEA 1I75A 3W7JA 4O8AA 1LP6A 3QLDA 3LTPA 1JEZA 4Q6XA 4RR4A 4W7WA 4L5ZA 4J28A 4JIHA 1DYSA 2OQLA 2W3ZA 1ZBWA 4CN4A 2C71A 4ZQNA 3BUVA 4X61A 3LX9A 3MP3A 5HNTA 5C5YA 1EUAA 4C6QA 5BU9A 3H7RA 3WEMA 1VBUA 3ICJA 3RU8X 5FJIA 3W23A 3DIPA 1IT0A 3CL6A 2PUZA 3WLQA 2YA1A 2BMBA 1VLWA 1RP8A 2VZVA 3VVGA 4QJ3B 5AC8A 3WD4A 1EQCA 3RN6A 4CNUA 1ZUAX 4Q7BA 3TN6A 1UR2A 4H9MA 3BGJA 4YS1A 1OIMA 1RVKA 3BXWA 5CBBA 1JQXA 1CTNA 2QCEA 1UUOA 5HJYA 3S6DA 3W70A 3WD2A 1CGYA 1PTAA 3FOKA 4V15A 2IUZA 3UQNA 3PM6A 2QUTA 1UD3A 3WCZA 4QFUA 5CC3A 3WK0A 4JHOA 4M29A 2F2HA 4ICMA 2E09A 3NDYA 4UIOA 1B5TA 1FHVA 3SUTA 1AW5A 4YCOA 3DERA 4GY1A 3H70A 3QEZA 3GW0A 3A4XA 1XLKA 5D2YA 3N12A 2DQWA 3CGTA 3TC7A 3EDEA 3EX1A 4XTIA 3AWOA 3UPWA 5LNRA 1OSEA 1JPMA 1MNSA 3W7GA 3AQUA 5JIWA 4RE3A 4KGLA 3EWDA 2Y89A 1JD9A 1LOQA 1Q6FA 2ZRZA 4JTIA 1RLDA 5ABFA 5GPRA 5D9PA 1Q4NX 3LOTA 3NDZA 3M1ZA 4FIQA 3PUEA 5HQMA 2XIJA 2XH0A 2CU0A 2TRSA 3MSRA 1P4CA 2G41A 4PMUA 2FVMA 4O12A 3P8JA 3OLGA 2QVNA 1BXBA 1OGBA 3Q58A 3CHVA 4EWND 1ONWA 2IQTA 4AEOA 2HBXA 3LXAA 1XIIA 1QHPA 4WXZA 1JDDA 4PODA 5EPDA 3URBA 5IBXA 2WVTA 2ZUWA 3C6CA 1BRLA 1V5XA 1HJSA 3UESA 3CWNA 3AHVA 1SJCA 2WHJA 1OC7A 1G7UA 5MKGA 2IS7A 4AZHA 2Q71A 4W4QA 1ENUA 1V3LA 1V77A 3TFCA 1XH2A 1ZALA 2DZBA 3AHYA 4QX4A 2CW6A 3LCXA 3MV01 4D2JA 1W37A 4AMAA 1E4IA 2I5QA 3WQOA 3W24A 2WQPA 3HQ1A 3L65A 1XDMA 3GNOA 4X3ZA 3CJPA 4TX6A 1XIHA 1NWRA 4K8EA 3PUOA 1E6PA 4G7EB 5HQEA 3I3DA 4J3XA 4QHRA 1YLVA 4J35A 4M80A 3R0UA 3AZRA 4N9CA 1TPFA 3IIZA 3A3HA 3B9OA 1KM3A 1S2WA 2KZHA 3AISA 4QITA 3L68A 4F0KA 2V5JA 2WHLA 2EXOA 3P67A 3RLGA 1GW9A 2PTZA 1XHGA 5DLCA 3AXKA 3F4CA 5A8NA 3VD5A 1XSIA 1ZENA 1A0CA 1KO0A 1JIBA 1XICA 3RJXA 3MSYA 4HK6A 5DCEA 1TWIA 2VZUA 4D1JA 1LG2A 4ZFCA 4UR9A 4LS1A 3KVJA 2QPSA 2J7BA 3R6IA 1R8LA 2W0UA 1ADSA 3I3BA 3CUHA 4QXIA 5TIMA 4IFRA 2DIKA 1Q6GA 4Z2IA 4IP7A 4K3ZA 3RF9A 2XVPA 1R3RA 1TCMA 1LRQA 1OFRA 1U30A 5BOOA 1K7XA 4W86A 1QASA 1V7AA 3GH5A 2YFOA 3QV9A 1P0NA 4UCGA 4FB7A 3VIIA 1B3OA 3EB4A 3LCWA 3ZOAA 2DUAA 1E6ZA 4F48A 4M82A 1JZ3A 3A6OA 3HTWA 1OYCA 3GKFA 4CQ9A 1HO1A 2E6AA 1WP6A 2D2GA 2ZUSA 2Y0FA 4IMEA 4JOMA 3BAXA 3UJ2A 1UQYA 3W25A 3D3FA 2UWFA 3WD1A 2TSYA 2PFHA 1TMHA 1W32A 3PFMA 2IQ0A 2XIOA 3G8EA 3UZZA 4YTRA 4RZ6A 4DM2A 1KCZA 1M04A 2P0IA 1R3WA 3P93A 3GG1A 4DUOA 3I10A 1XD1A 1Y5VA 3ERPA 5HNNA 3K8LA 2PCEA 4XTDA 3LCFA 3WLJA 1XBYA 3FAWA 2X1RA 5DXYA 3IK4A 2P76A 3GYCA 1J79A 3L2MA 3UR8A 4FOJA 3D6NA 1VFUA 2ZVIA 2PDBA 1UG6A 1KGXA 1NH6A 4B15A 4A2SA 3CIWA 2B7NA 2G97A 3UPBA 1J8VA 1JL8A 1O4UA 4JTFA 4FNRA 4C7FA 5DANA 4DBDA 3AYVA 4V33A 3R8RA 5CG7A 3CUIA 1WBHA 1TKKA 2ZC8A 4QG9A 3G77A 2YXXA 3VTRA 2POZA 1FWCC 2OT1A 4W7VA 3M5VA 2WMJA 1US3A 1Z3NA 3OG3A 3UGRA 4O13A 1S2UA 5HWNA 2J74A 3S2LA 5I00A 3EX2A 2V5BA 2CHRA 3OA3A 4RE0A 1JCNA 1UR0A 1EF3A 1TA3A 2OZ3A 4IGHA 4M6QA 2DV0A 5H8PA 3ALGA 2EPKX 4TV6A 4LUSB 4QDWA 3ARPA 3GDKA 1SW0A 4F66A 4ZO9A 2XINA 5DMMA 1QNOA 4HU4A 3N2CA 3L2LA 4TVCA 3FX4A 3T2OA 1M65A 4C1LA 1IHIA 1NOFA 2D22A 2PDNA 2X42A 4B2DA 1REQA 3PZNA 2ZADA 3B8VA 2RGLA 3LSCA 3N15A 1NDZA 3TQPA 5A8OA 9RUBA 2EG7A 4FZIA 1LLZA 4IIGA 3U2ZA 4XZHA 3TROA 1NF7A 5HQLA 3W74A 1KM6A 2VX4A 2YL8A 4GXWA 3Q4DA 1CYGA 4HGXA 4N9DA 3HFYA 5FD0A 3HFTA 2YOCA 5DMNA 1HL2A 5C55A 3MO4A 4DUWA 4HQVA 2PLJA 4KFPA 3DEQA 1WZAA 1R9YA 1UMLA 3FNDA 4BKNA 3DYMA 1H49A 1HQTA 1UWQA 3LCLA 1D8WA 3OOQA 4FA3A 5H1WA 4JNYA 3W7LA 4GPNA 1H7NA 2YLAA 5ABFB 5BU6A 4MPQA 2VJXA 3WD3A 1FCUA 4J3ZA 2VELA 4RK8A 4FLQA 4O10A 3QW3A 3K8KA 1V02E 1N2VA 1WDDA 3ONBA 1HF6A 5IHRA 3D3AA 3TZNA 1GVOA 1AH3A 2VUNA 1O68A 2QIWA 2ZZ7A 2X1SA 3B9DA 4AZ5A 3MHFA 3O63A 1IT8A 3HIJA 3PZGA 5CBJA 4CU6A 2QUNA 4OECA 3W37A 3BAWA 1BRLB 3EYPA 1Q7QA 2VRKA 3T40A 3RO8A 4LYRA 4L9YA 2PDXA 2V5KA 1QOXA 1GHSA 3I68A 2WKLA 1XG4A 3ITXA 1YKWA 3TTYA 5BXTA 1MXGA 1B31A 2GK1B 1JXKA 5I3KA 3W7CA 3M0MA 4PCPA 3P5ZA 5F4WA 3ARWA 1H50A 2XH2A 1NWSA 3EAUA 1FKWA 1V8EA 1LYXA 2QDEA 3B9AA 1GTHA 1XIDA 2F61A 2VI0A 3EX3A 2VYOA 4ZZ9A 2HPIA 2ADAA 3R2GA 2PDLA 1P48A 3GXNA 3E5BA 4KQNA 4OBSA 2NV1A 4XO6A 1GW1A 1U5VA 5D9OA 3KFTA 2AL2B 3O06A 3NA8A 1CXIA 3VDCA 3SGZA 2ACQA 2WB5A 3XISA 1W8GA 2E8ZA 4HKPA 1A5SA 3SJ3A 4G2DA 2WMKA 4UUIA 3MV11 1HUVA 5DY2A 1LF1A 3GTHA 4UMCA 1ML1A 2PLMA 2WBGA 4ALDA 1FCVA 1OZQA 1AQMA 1MZRA 3UNDA 3ENLA 4XAFA 4AD5A 3O07A 3TJIA 4UZSA 4ZE5A 1KC7A 1JPHA 1Q3NA 3IRSA 2DQXA 3QW4B 3UEQA 4ADUA 3WQFA 5D05A 2OEKA 4HHPA 1S38A 4Q8WA 1R47A 4MWAC 1BAGA 1P7TA 3Q2DA 3EKGA 4BY3A 2WMGA 1JZ2A 3H7VA 4JQ2A 4AU0A 1PDYA 4GKTA 4ZFMA 4JHZA 1CX9A 5EB8A 3KL3A 3WMSA 1RCXB 4LSBA 5DFAA 3WNPA 1RHCA 2WMHA 2HISA 1DHKA 1J2BA 1J93A 1FDYA 3OP2A 1IQ8A 3ECQA 4WR3A 3CTTA 3WFLA 4GXMA 4Q4PA 2XFRA 5JVLA 2BY2A 5I77A 4NJKA 4YN5A 2ICSA 2ZXDA 4YMZA 3UVIA 1GKQA 4U4MA 4UTWA 5TNVA 1EXBA 3NPUA 4LS0A 4FK9A 4GI6A 2XVKA 2BBFA 4ORIA 1GQKA 2I5GA 2OOFA 4C6KA 3WQGA 4Q3MA 5LYRA 1TV5A 3ARTA 1V0LA 5FCZA 2W27A 3WN6A 1FY6A 1YBQA 2GGJA 1GZ1A 4EXQA 3WFZA 1E70M 3UR2A 1SM9A 1DOSA 3T78A 1E0VA 2X40A 3UCQA 2H90A 4UFLA 3DECA 2C7FA 4H6KA 3KUMA 1SJBA 1YTKA 4YVXA 3QVQA 4UTTC 1DJXA 3BW4A 1XYLA 1U5HA 4HNLA 3R89A 4XAPA 1WZMA 1V3IA 2C18A 4G8TA 3QOMA 4PTWA 4UQAA 4WSHA 3RPDA 4LVDA 1QNRA 3CH9A 3GB6A 2DVXA 3NFUA 2E3ZA 4RZ5A 2VZTA 3PTQA 3N19B 1F07A 5CGTA 1K8ZA 4EXAA 2GJXB 1EB3A 3OHMB 1PKYA 2V6AA 2V3GA 5EMYA 2PZNA 1LWHA 2QMJA 2CNCA 1NP2A 4JYDA 4LVBA 4W84A 3W7KA 3QOKA 4JS3A 3T81A 2GLKA 3W2MA 5IFPA 5C6MA 2R82A 2Y85A 2W62A 2GOKA 3BH4A 4ML9A 1WQ5A 3VMPA 5DX7A 3CEPA 1TVPA 2QF7A 3GBDA 2DZVA 3UVAA 2NQJA 2PWFA 1VQTA 1I8JA 2E68A 5GNZA 1FUYA 4AIUA 3C0JA 3N3MA 4OZOA 4XVDA 4I6VA 1S46A 1I2OA 1YNYA 3SEPA 4AD2A 1TRIA 3BW3A 3W73A 3OB8A 2A3CA 4OFCA 4ZXOA 3H7UA 3GNRA 1C93A 2REQA 2CCRA 1S1RA 6ENLA 5LA0A 1IXPA 4C6BA 3IPWA 4EPEC 3VX0A 3W72A 1BKHA 2B7OA 5L6UA 1L0PA 4CD8A 3M44A 3ABQA 1U1JA 1TCDA 2ZFAA 3GXFA 4RXGA 2KX9A 3NEVA 4XZBA 2VCCA 2E1WA 1PIGA 4PC8A 1MVYA 3VDHA 4ZO7A 4Z1YA 3VMOA 4MM1A 1QW7A 3GR4A 3LBMA 1B4KA 3SAZA 2I57A 1U5JA 2ODOA 3BICA 2G3JA 4J2MA 3MANA 1FWNA 2HE8A 2WZHA 1F7BA 4FP1A 4MFEA 2YCLB 5BXPA 5IDZA 4JNZA 2WAGA 2WOQA 3BVJA 2VURA 5F2LA 3NNTA 1A5AA 1EJWC 3LTYA 5HUPA 3VD7A 1GOIA 3BJFA 5A6LA 3QY7A 4CNOA 1IEWA 2EG8A 2Z27A 4GUIA 4Q8OA 4Q8TA 1LOSA 4DWSA 4DZAA 1J0HA 4KW2A 3TLLA 3HG2A 1XLBA 3ISIX 3BLLA 2BGSA 4I5XA 3OJGA 2PEVA 2VOMA 2R9RA 1JGIA 1EO5A 1VFTA 4FX8A 4DJFA 3N2MA 2VOTA 1QPRA 3TCEA 1BVNP 1L6SA 2QF8A 1G5AA 1ECEA 3EB3A 1D7KA 3WL1A 2GZXA 2DEPA 1GVSA 3Q37A 1DEDA 1W1B1 3W87A 4CN6A 1Q66A 4LAUA 3JS3A 3CS2A 1UKTA 2TMDA 1IZCA 1WKYA 3NSMA 3I3EA 2NX9A 1WDPA 1BQGA 3DYPA 3R43A 1GG0A 5DXXA 2XN1A 3D46A 3EDFA 4LOCA 2NVAA 1Q6CA 5G4HC 3VFLA 2VXNA 5DBUA 2Y62A 2C0AA 5I78A 4MIMA 3ZJKA 4GACA 2DT0A 1HJWA 3FAXA 5E70A 2J6VA 3WDHA 4WXYA 4LTSA 3GDBA 6XIAA 1FWWA 2P5NA 1DXIA 3A5VA 1XIMA 4S1FA 1NARA 8XIMA 2Z29A 1Z32X 4LUYA 1G6CA 4Q4RA 4DY1A 4RDYA 4BHYA 4YL2A 5T9CE 4JNMA 1DWIM 3GHSA 4KIEA 5DT7A 3SO7A 3VO0A 3T0DA 1OFOA 2PP0A 2H8XA 2EPMX 1TJ2A 4GISA 1YPXA 5I3DA 4LVAA 4KWWA 3F2DA 3QR1A 3T4CA 3S2CA 4MDOA 1RA5A 3BCFA 3KW3A 2FGBA 5CKSA 1R0MA 4JX4A 3ZYZA 3QZ6A 4NX0A 5LA1A 2YXGA 1US0A 4Q8PA 3W83A 4HOXA 3LMYA 3IJ9A 1YBQB 4C6NA 3KX6A 2VX6A 4ATLA 4AMCA 1ZPTA 5BXSA 5C8BB 1SSGA 4MOZA 4CD6A 1VJSA 2VR2A 3IGXA 4FO4A 2NLIA 4X22A 4I9JA 1T40A 4EE9A 1XG3A 1CXLA 1SJDA 1N8FA 4S2BA 3GM8A 4LNYA 5A8MA 3S47A 3STPA 2F9RA 3LMZA 5A6AA 1EOMA 4FF7A 1PCWA 3BARA 2J8GA 5C70A 5FSEC 3S5OA 3N73A 1VBHA 1S5TA 2WSYA 4UTKA 1TSIA 4A21A 2W61A 2DUXA 2XN0A 4NL1A 3MSGA 3BMWA 1WCGA 1K8CA 2F7FA 3G0XA 3T7VA 1UYQA 4NZJA 4ZO6A 4GO8A 4JYEA 3VNJA 4QM1A 4HN8A 3OEXA 3E38A 3MY9A 3QKZA 1G4TA 4HT3A 4J9JA 5IFTA 3VC5A 1IEXA 1TVNA 1DIEA 1HX0A 3NEHA 1JF5A 2ZDSA 3VIMA 1VKFA 2D3NA 4NXKA 5EFDA 4FPSA 4CD7A 1AJ0A 1XFBA 5AY7A 2E0PA 3VYLA 3CAWA 1DWJM 4A3YA 2FH8A 3UNTA 1XLLA 2ZUMA 2QHAA 5LZLA 5RUBA 1E4MM 5K9CA 2VNCA 3ITYA 4V27A 2P1FA 5FF0A 2QDDA 1LRNA 1FQ0A 4RPPA 1VBRA 1CLVA 1U1UA 2REQB 1EPVA 2PDWA 3W6MA 4AC7C 1TREA 1XLGA 4L7ZA 4GZIA 1EX5A 1GJWA 4J3WA 3T42A 3LYEA 4HZ6A 1XYZA 1BWKA 3JW7A 1V3JA 5TAOA 1WDWA 3M41A 4JD4A 2PBGA 3RM4A 4W93A 3U8GA 3W85A 1BGGA 4QDPA 3PBGA 3TN4A 1AD4A 3VABA 1F4HA 3DENA 3W88A 2W66A 4B5TA 1PSCA 3TSBA 2I5IA 2BX7A 4B3KA 2PDFA 3TWBA 4QEEA 4UQEA 1VIZA 3B9NA 4C6LA 1GQLA 3N6QA 4DNMA 1EH9A 4K39A 5FSDC 4D6CA 4HJWA 1JUKA 1MWOA 4KFOA 1TRDA 4LW7A 1QBBA 1N7KA 5EA9A 4L65A 2EJ1A 4F2TA 1K6WA 4U10A 1EEXA 1PVNA 4IZGA 4IX0A 5I02A 4S3DA 6PTDA 3D5HA 2I16A 3GXTA 5F2IA 2VEFA 4JN6A 4NZ5A 3IAPA 1FWGC 1ZNNA 3WNMA 4H41A 2PDPA 2DH3A 4U2YA 1YDOA 3DU0A 1CLKA 3ONCA 3JRKA 4X9SA 3TN3A 1XYMA 4GQGA 3ABZA 3KOFA 2CXEA 2G4JA 3P14A 5GJNA 3S6TA 5G2WA 1JCYA 4Z2LA 1H60A 3KBJA 2GL5A 2OG9A 1MDRA 4HNTA 1M3UA 4P5UA 4XK2A 5ABHA 4DF1A 5F2MA 2NVCA 5K7JA 5ABGA 4MLRA 4OBRA 4HHHA 3UPMA 3WF2A 3A5FA 2NQZA 1MEHA 3NQMA 3EDDA 3W1QA 4JKKA 1FXPA 3U5YA 4XIAA 3TV8A 3UG4A 3THDA 1JCLA 4W85A 1XGEA 3AHTA 2A3HA 1GK8A 1B9ZA 1F05A 1D8CA 3QN3A 3I65A 3WH6A 4YCPA 2WWDA 4B4FA 1HG3A 2W79A 4H00A 4CVUA 1DIKA 2IKHA 3U4FA 3TOYA 3CQHA 3UCDA 1XD0A 2XFYA 3PB2A 4OJYA 2EPNA 1EOKA 4UXDA 5DELA 3SGUA 4O15A 2YLLA 3BLOA 4HMDA 5AYZA 3UG3A 2ZE3A 3P0WA 4GKLA 4YXGA 4NAFA 3N04A 4GI4A 3QGKC 3WEZA 1PTGA 4H2HA 4R3UA 3CQIA 5DMLA 1FWJC 2PE4A 1BEUA 1LOLA 1MW0A 4G5DA 5IOBA 1R2TA 3QZEA 1ZJIA 1OCNA 3QV7A 1NDYA 2E40A 1X7FA 2VHLA 2WJDA 4PTNA 3S2NA 2Z6IA 4O54A 1WXYA 1US2A 3HU7A 1M9HA 1XINA 1OHLA 2GJNA 4AIEA 3U6WA 1A5BA 3ALFA 3EXTA 3PZOA 2W63A 3I7SA 2BOFX 3UZ5A 3RX2A 1YDVA 1H0IA 2J7FA 4AB4A 3ZSSA 1F3WA 1YDYA 3K13A 4GNJA 4MWAB 7ENLA 1OX4A 3M0VA 5IDIA 1K4HA 2Q02A 3CBWA 1W56A 1ZB5A 4ERIA 4QJ1A 3GH4A 3PAJA 3T44A 4DO5A 1WNOA 2XIMA 3COTA 4EANA 2ISVA 4LS2A 4MY1A 5AC4A 3FJLA 3AO0A 1WE5A 4RNIA 4TU1A 2XISA 2ZUNA 3IJDA 3BSMA 3THCA 4WCJA 5I09A 2B81A 1O1ZA 2XWEA 3PANA 1XBZA 2F38A 1TPWA 2DT2A 2PDCA 1M41A 2HJPA 3OLEA 4GMEA 2BB0A 1EPXA 4X63A 4YTSA 2Z1WA 4JAWA 3SIMA 3SCUA 4E8DA 4YTQA 1A50A 4E4PA 1QI4A 1KCKA 2UV8G 4D6EA 4AXKA 4R85A 3NGFA 1SO4A 2OPJA