5EL1A

Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
248
structure length
248
Chain Sequence
DLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARETLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAWGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Mechanism-based inhibition of an aldolase at high concentrations of its natural substrate acetaldehyde: structural insights and protective strategies.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 105
structure length 248
sequence length 248
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5el1A00
3NQ6A 3NQ8A 1PV8A 1K7EA 1FY6A 4BI7A 3WK3A 3CHVA 3I7RA 4AMAA 4HPJA 2CLKA 2ZQ0A 3WFAA 1G4SA 4NVTA 2E6FA 3UWYA 1W56A 5DCBA 4HKPA 3IEBA 2ABAA 4O19A 1VRDA 3FOKA 1JCXA 3HOJA 1K8XA 5D09A 3NQEA 4IOTA 3BO9A 3P62A 5AFDA 1VHNA 3Q58A 5FESA 4MVAA 2RDWA 1OHLA 3E12A 3ZR4A 4JYEA 3IGSA 3DHFA 5TIMA 1F7BA 1S5VA 3M5ZA 3PSWA 4P61A 1BTMA 1TMHA 4MY1A 3C52A 4GUHA 1NEYA 2Q3OA 2NXGA 4WOQA 1FWSA 2A1YA 3QQ1A 4Y96A 3TFXA 2DZUA 1XCFA 2DJLA 2V8ZA 1JCYA 3W7LA 5CZ0A 2CLOA 3HMJG 1L6SA 4XBKA 2YPIA 2NZLA 1ZFJA 4JYFA 2ZZ4A 4YCOA 1TREA 1EP2A 5CPNA 1ADOA 3UXDA 3GNDA 2YFNA 3LHVA 1I2RA 1IXOA 2J9ZA 4K8HA 3C3NA 3GK0A 3B04A 3W7KA 1AW5A 4O1DA 1OYBA 1LOLA 5AHLA 3W07A 3LV6A 1TPH1 1VYPX 1YADA 1KTBA 2Y7FA 3KVJA 3OVPA 2E09A 2CLEA 4K8EA 3C6CA 4DQWA 1LOQA 3P80A 4MJZA 2X30A 3OA3A 3CQ0A 3EX2A 1ZAJA 4JTHA 3S5OA 1KTNA 2J9XA 2YW3A 3W83A 4C1LA 3GX9A 1NF7A 5FF7A 1X6UA 4UTUA 3M41A 3CT7A 1FX6A 3T7VA 2BSLA 1WOBA 3W2KA 4LVAA 3AJXA 4UR8A 3QQ0A 3UD6A 1ZY9A 2E77A 2QCGA 2RHGA 3I7SA 4IGHA 1H60A 5TBOA 1DKWA 2TPSA 1VHCA 3O06A 2QDHA 2QDGA 3QW3A 3PY2A 4FXSA 1P5BA 3CIXA 4LC6A 2VFHA 4IPJA 1VGAA 1XDMA 4ONVA 2WNNA 2TRSA 5KITA 1L6WA 1SUXA 4WOZA 5F2LA 3KXQA 1O94A 5DCDA 4OU1A 3HF3A 3ZWSA 1DQXA 3THAA 1H51A 1R30A 3TH6A 1YTKA 2X1UA 3MJYA 3TV8A 4AF0A 1OYAA 1YDOA 4FNTA 4JTUA 1KV8A 1YTDA 3LHUA 4Y9AA 4DELA 3S8HA 4HPXA 2NXHA 1KFLA 4QSHA 1MZHA 3LCLA 4WUIA 3NO5A 3W2LA 1ZCOA 2DZWA 2JK2A 1H5YA 3D0CA 5HR6A 1LZOA 1G69A 3O8AA 4GC4A 3CLMA 1GVRA 1TIMA 4O52A 3W87A 1GQNA 3H54A 1W37A 1M6JA 2NV2A 3W7QA 4CCEA 1G6CA 1Z41A 1TTPA 1L2UA 3GIYA 4LY8A 3OEXA 5C54A 2XFWA 4RV8A 1QMLA 2OT1A 1PL9A 2VFDA 3W7MA 1GVOA 3SR7A 2RDTA 1TPB1 3QPYA 1H7RA 3JRKA 1OF6A 4C1KA 4O10A 4HSOA 1AW1A 2QCHA 1NSJA 1H61A 4LC8A 2V2DA 5G4WA 3QYQA 4WJEA 4WZHA 3KHJA 4XTDA 4UC5A 3W22A 2E68A 2TSYA 1MSSA 2YYUA 3TX9A 3E9AA 2C0AA 2QCMA 1HUVA 1NAL1 3F1QA 1LORA 3C2VA 5D03A 3FEMA 5CPLA 1SQ7A 3W1AA 4BF9A 4E2BA 3BV4A 3OG3A 3PBWA 3IRDA 5AB3A 3CB8A 1SZFA 3O6DA 3W9ZA 2R8WA 1RR2A 2TYSA 3MYOA 2O7QA 4GUJA 1BEUA 3M6YA 4JIPA 3W1QA 1QO5A 3LHYA 4GWEA 3TR2A 1OJXA 3S1XA 1JCNA 4ZQOA 4HNUA 4ORIA 3C2OA 4O1CA 2VXNA 1QNVA 2QR6A 4R33A 3VNDA 4DBDA 3GXNA 5FEXA 4AEOA 3B0UX 1JCMP 5SWUA 3OVQA 1KV5A 2HTMA 3BG5A 5HWMA 3RNDA 3FS2A 4TMCA 4OQVA 3F4WA 4YXGA 3G0XA 3RLUA 3UWWA 2QCCA 1G7VA 1LP6A 1OFEA 1P1XA 1GT8A 2V2HA 3PM6A 2ZYFA 1GVSA 1TTJA 3IVUA 4JY9A 4UFIA 3B0PA 2H3BA 5J5DA 2W79A 3CWOX 3KRSA 1A5AA 4NZJA 1XUZA 5FEWA 2ZRYA 3HGOA 3ABQA 3G24A 1SZNA 4OHQA 3NQ2A 3DFQA 4FNRA 4LVBA 5FF2A 4HNNA 5C6MA 2QJHA 4FX6M 3JR2A 4DO4A 4N4PA 4AAJA 4O54A 3GLCA 2ZZ7A 5LSMA 3HGJA 5U4NA 3T40A 1LYXA 3OBKA 2OMAA 5KZEA 3H55A 3NL2A 3O6CA 3GVGA 2XN2A 2ISVA 1SZGA 2YGYA 1XBVA 3L65A 4BK9A 3LXCA 1O5KA 3TMLA 4PL1A 1QWGA 3L0NA 4I7UA 3W1UA 4K7YA 3CU2A 3FFSA 2X16A 1OX6A 3TMQA 5A5WA 3CM4A 1KLYA 2RH9A 5D02A 2Y7DA 2Z0IA 4UTHA 1OX4B 3DH7A 3RLVA 1TO3A 1OFRA 4HNTA 1UJPA 1D9EA 1H7OA 4M5PA 2QEZA 4K36A 1GG1A 1C29A 2GVGA 4IQLA 4UNLA 3SZ8A 3DENA 2YFOA 1R47A 2ZTKA 2QCLA 1DL3A 4K6AA 1GPWA 4WQ6A 3S1UA 1QR7A 1EIXA 3GDKA 1T99A 1B3OA 4HHPA 2RDUA 3UWUA 1H7WA 4HNVA 3BW2A 5BMXA 5AYYA 2OZ0A 3UPWA 5FEZA 1TSIA 3L5MA 2V0TA 3W7NA 4RCXA 4O8RA 1QOQA 4ZQRA 5KTLA 1OK4A 2EF9A 2EPHA 3P61A 1TRDA 5D2YA 3TK7A 1B4EA 1RQBA 1RQHA 2VEKA 4O17A 5D2TA 4PC8A 5HNRA 2V5BA 1B9BA 3L67A 3TQKA 1EX5A 4ZQMA 1RD5A 3DBPA 4GFSA 3IGXA 1A53A 3LTSA 3QF0A 3ZS4A 3EWBX 3DHDA 4JR5A 2A4AA 3DXIA 1N7KA 3TSBA 1S5TA 1W3IA 4UNKA 4XBSA 1FCQA 1KM2A 3G8RA 1DV7A 5LNWA 4A21A 3NQFA 1AL7A 3TDFA 1VPXA 2QF7A 3LLDA 1LOSA 1JJKA 1QPRA 3LBCA 5KMYA 3L66A 1DJQA 4LUIA 3HG3A 5DY2A 1OFBA 5K3VA 2PRMA 1SW3A 1XM3A 3MBDA 1SSGA 3STGA 4QIUA 3TQVA 5LNUA 4MLRA 4TMBA 1XUUA 4RK8A 3W74A 3LHZA 3OHIA 2A7NA 2VFEA 3TFCA 1WA3A 3L68A 2QAFA 5EBUA 4FNSA 3F03K 4FIRA 5BOOA 4JX5A 1J4EA 3S6DA 1VCGA 2A21A 2B4GA 2OX1A 2YZRA 3GDLA 3LB0A 4MYXA 3TU9A 1H7PA 3LCGA 1SW7A 2BX7A 4M19A 4FNUA 1K8ZA 3FKRA 1EWDA 3NQ7A 3MP4A 3MWAA 3V1PA 1PHWA 2X1TA 1K03A 2ZA2A 2GVJA 5E1QA 1E51A 1TJPA 1V7YA 8TIMA 3WK1A 4OWGA 1DHPA 1B4KA 1HL2A 3SIZA 3TE9A 4O4VA 1LRQA 1ONRA 4FNPA 3VE9A 5E0KA 1SO4A 3O07A 4HT3A 2C15A 4HSNA 4FEZA 1TV8A 4LU0A 2E6YA 2ZA1A 4UTLA 5G2IA 4GXMA 1LM1A 3DFNA 4PTNA 4YLWA 2G97A 1GVFA 1YPIA 4X2RA 1L6YA 3P8IA 5IM51 3CEUA 3HPXA 4QISA 1X7FA 1OK6A 1ME8A 2OT0A 5AC7A 3N14A 5AHFA 2PRHA 3EX3A 4CQ9A 3P84A 4O4WA 1XBZA 3W2NA 3NQAA 3NVTA 3SECA 4DPQA 1HFBA 4AVFA 4UTTA 5LKYA 1P0KA 4GUFA 4K7VA 1FDZA 1F6PA 4XZ9A 2I9EA 3W1NA 4AH7A 5G1YA 1S3HA 3PSVA 4ZL1A 6TIMA 3NAVA 1F76A 4XKYB 2NUXA 4NZFA 5DBTA 2FB3A 3UZJA 3NPWA 3G0SA 1S5WA 4OV4A 1I2NA 5KSWA 1R2RA 3E02A 2EKCA 2BTMA 1FWNA 3LDVA 1PHQA 3PS7A 4AXKA 3UZ5A 1HO1A 4Q32A 3WJSA 2V30A 3BARA 4O11A 2GUUA 3N34A 1TYGA 2G5WA 4KFNA 3CC1A 1VS1A 2ZZ2A 2FB2A 4RX0A 3EWXA 1LTDA 3EWWA 2ZCGA 4ICNA 3BK0A 3C4UA 1AW2A 3MW7A 5I3HA 1FCBA 2NUYA 1IGSA 1ME7A 2E1DA 1OG0A 4LRSA 3P8JA 2EHHA 3NL6A 1TPDA 4OV9A 3HJZA 5K2ZA 2PURA 4D2JA 5LHEA 1EUAA 1N55A 1A5BA 2FPTA 3NQMA 1C8VA 3LCWA 2CZDA 3PB2A 3P7YA 3IIVA 2GQ8A 2DU2A 5F4SA 4JDBA 5H91A 1G67A 1QO2A 3L0KA 1KW1A 3G18A 1AG1O 3ATYA 3DKJA 3C2RA 1LRTA 5L9FA 2WSQA 1I8JA 4JTJA 1I2QA 4U28A 4O1BA 2IQTA 1KM1A 1GTEA 3G8EA 4RXGA 3C8FA 3DU0A 4DF1A 4I7WA 3PR2A 4CNPA 3UY7A 3TAKA 1GEQA 3L21A 2ZRZA 4O13A 2VEIA 3ELFA 1X1ZA 3G1AA 2ZZ5A 4M6PA 5DCEA 1Q6OA 4Q4KA 4UMBA 4N6EA 1FCUA 3TNOA 3TC7A 3WJWA 4NNBA 2CFFA 3PAJA 2NWSA 1XBXA 1I2OA 3S1VA 2VFIA 5KZMA 2A6LA 2ZDRA 3M5VA 4TR9A 3W7CA 5D04C 4LVDA 4ZQCA 2NV1A 3M5YA 1YYAA 4R7JA 2QCFA 3LXBA 2WNQA 4O1AA 3B03A 2QJIA 2E5CA 3Q94A 2YYTA 1TV5A 5IBXC 5CGQA 3M16A 3WK0A 2Y61A 3W6YA 1H63A 2J6XA 1OFAA 2BLEA 2ZZ3A 3S9YA 4L4MA 3UQNA 1UCWA 1Q3NA 3LERA 3F4NA 4JNMA 4JX6A 1VJIA 4WY0A 1W1ZA 1WOAA 4JYDA 3T55A 2GVLA 4OGZA 4XQ6A 3TXZA 3UWVA 4IMCA 2WKJA 1QOPA 1XDLA 1QPNA 2Y6ZA 4Q33A 4IMEA 1F5ZA 2H6RA 3KVLA 1TV7A 4X3ZA 3LCHA 3W1LA 3EWUA 2ABBA 2A5HA 2GQ9A 1ZAHA 4GUGA 1GWJA 4UFMA 1TB3A 5F4XA 5C5YA 4O57A 5CKSA 4S2BA 5F1UA 3W76A 3MHUA 1VH7A 3TW6A 1EWEA 1KFBA 3QZEA 1IIHA 3C56A 1OFDA 3CIWA 1EPXA 4LOCA 3A21A 5EA9A 3LLFA 3W7IA 1WDWA 2FDSA 3PUDA 3MYPA 2A2IA 2VKZG 3QH2A 4ZZ9A 4MKNA 4MY8A 1KTCA 4DPPA 1FQ0A 1CW2A 3AO0A 3SW6A 5LNRA 4UUIA 4ADUA 2CLIA 2AAMA 3FKKA 3MMTA 4JTTA 1AK5A 3R2GA 2C16A 5DLCA 2WSYA 1OFPA 3N9SA 2DZVA 2EAWA 4XKYA 2ZRUA 2V2CA 5AHEA 4Y6GA 4QQ3A 4YCPA 1WV2A 3S0CA 5HULA 2F7FA 1WAUA 4CNNA 2Y7GA 2ATSA 2RKXA 3NR0A 3G22A 5H2ZA 1HTIA 1H50A 4UTWC 4JDYA 4JX4A 3DKLA 3G3DA 3TROA 2A7RA 3W70A 2E6AA 3PUOA 4FHAA 3TKFA 3IIPA 4UFKA 1J5TA 1LDCA 4GNJA 4J9JA 3LOTA 2YR1A 2WJZA 1SW0A 3BGJA 2Z2UA 2PC4A 4DBEA 3W2JA 3TXVA 1VLWA 1VQTA 4ZMGA 3SI9A 1GJPA 3EB2A 4QNEA 5FF4A 1JRBA 2G95A 1VR6A 3BLFA 3IIZA 3KOFA 4O0KA 1SO3A 4Z0JA 4NX5A 1EP3A 3W73A 2NWRA 1IIGA 3EXTA 2Z6IA 3B4UA 4NJJA 1FXQA 4AWTA 2FLIA 4NJGA 4N6FA 1MO0A 4IXHA 4JEQA 4UR7A 2Y89A 4WXZA 3O6YX 3WJYA 4UFLA 4QAIA 3GDRA 3R5EA 5T26A 5DY3A 2R94A 3NXFA 3LCIA 5FF0A 1TTIA 4NQ1A 4MLJA 2JKAA 3UWZA 1M7PA 4LS1A 1IXQA 5AHMA 4O0ZA 4DO5A 2A7PA 1V5XA 1O4UA 2Y63A 1JUKA 1OYCA 3GKAA 3PVFA 3NQVA 3NA8A 1T96A 2CLMA 1OFOA 1N8FA 4CCCA 4Z1AA 1Z48A 2QUUA 2P10A 2WQPA 3W7GA 3IVSA 1NFBA 3W75A 5K9CA 3ZFHA 4UMCA 3B0VC 4O14A 4PFMA 4JXCA 4X9SA 1SR9A 3LCXA 4ZQPA 3O1NA 1ML1A 2XN0A 3U2OA 3LI0A 4POCA 1CX9A 1P0NA 2QKFA 3HIJA 5DXYA 2H90A 2QCDB 2YCEA 3PF3A 4JD4A 1W8SA 2VELA 1HO4A 1KFJA 1M5WA 3N19B 4GRSA 4UIOA 4Z08A 3NGJA 4CLMA 1CI1A 3CEPA 1W5NA 3NL5A 3TW7A 3HGSA 3PG8A 4PCFA 1I45A 2H8ZA 1SZEA 3MI3A 5U7SA 1YTEA 1AL8A 5D38A 4BR1A 3DFOA 4HIBA 4MJMA 4XUGA 3NPUA 1SO6A 3NOEA 1W5OA 2DZPA 2NXIA 1H1ZA 1XKYA 1R2SA 3DFSA 2VEPA 1FBAA 3FIGA 4O15A 3M43A 3T44A 3W3OA 3WK2A 5AN7A 3VCRA 4A2SA 1T8XA 3STFA 2YXGA 4TU1A 3JS3A 1OF8A 3EX1A 2X1SA 4A3UA 3Q2DA 1SU5A 3P67A 2Y85A 3WJZA 2QUVA 1W31A 3G1DA 3HGRA 4BWLC 2P0OA 1KA9F 4AWSA 2NX1A 3DFTA 3S5ZA 4FIQA 3TA6A 2AQWA 5AHIA 3MP3A 5AC8A 4LW7A 4LTSA 2LLEA 4TIMA 3A23A 4JTIA 1K3UA 5D2WA 1GYNA 1OFQA 1R46A 5E93A 2X1RA 3PG9A 3HQ1A 3HPZA 1BKSA 5HINA 5D30A 3NZRA 3LM7A 1P4CA 3G1VA 4LWWA 1KM6A 2HS8A 3G0UA 3RF9A 4P2VA 4UTIA 3PUEA 4MOZA 3N9RA 1G4EA 5D2XA 3ABSA 1Z44A 3DFPA 1KFCA 2ZRXA 1TPUA 1W5QA 1GVQA 2DJXA 3M9YA 4WXYA 5K4ZA 3BW3A 1GG0A 1SFLA 3GZ3A 4OT7A 3N2XA 4Z1DA 1TPEA 3M0ZA 2Y70A 5A8GA 2EGZA 3PBVA 3SGZA 2J24A 3T78A 1YXDA 3EX4A 3EWYA 1TQXA 1LLZA 3ZWTA 3R13A 2ZZ6A 3M47A 2C14A 3R89A 3NM1A 1G4PA 2YDAA 1PCKA 2DZXA 4JGDA 3UY8A 3QMTA 2OJPA 1XI3A 1VYRA 3PWAA 3LHWA 3IV3A 1ZHAA 2J88A 2DORA 2XN1A 3STEA 4M7SA 3HG5A 3STCA 2RFGA 1SFJA 2JBMA 3M1ZA 4GUIA 2HSAA 3ATZA 3DGRA 3RMJA 5F2MA 4IX0A 2WV8A 5EKYA 1SO5A 2NX3A 2WO5A 1JQXA 3B05A 4RZ5A 3UPBA 4AHOA 1AMKA 2GJNA 1W5PA 1Q45A 2W0UA 3A24A 3NPVA 1QPQA 2QAPA 5HWNA 1XFBA 2B7PA 4N9EA 3HBLA 4O53A 4YL2A 5HQEA 4DF0A 1IXNA 3EKZA 3L5AA 1UBSA 3GDTA 1FDYA 1L9WA 2BXVA 2V5LA 2GOUA 2ISWA 3CPRA 4BI5A 4PH6A 2WPBA 5HUOA 4A22A 3NG3A 3M7WA 3G3MA 4RZ6A 2ISSA 5EMUA 1IF2A 4AF0B 1K02A 4UTJA 4K37A 4JTFA 5D2VA 3A9IA 4WY0F 2QCDA 3HG2A 2R91A 2CU0A 3QSRA 1ALDA 4FF7A 5F2IA 4NJHA 1FWTA 4LT9A 1ICSA 1T0OA 2HMCA 4LNYA 2E6DA 3GNNA 4LVFA 3I65A 4AHPA 1RQEA 1OX4A 3W1MA 2GPTA 5BNKA 3W23A 3W88A 3I68A 4QNWA 3TSMA 4EVZA 4FO4A 4FX7A 2VC6A 2G96A 1ICPA 5G5IA 4R34A 3SGUA 3K30A 5CPMA 4ALDA 3GYEA 2E5BA 1YPFA 4IUOA 3WJXA 2Q8ZA 5LGXA 1GTHA 5D33A 3NNTA 3NEVA 1JVNA 3NM3A 3E0IA 3W84A 3W7OA 3PB0A 4E2DA 3FLUA 3S5YA 3USBA 2Y88A 4NU7A 2C6QA 2ZRWA 4RZ4A 1UB3A 1PCWA 2A85A 1VCVA 3A22A 3QMSA 5EPDA 2FPYA 4NJKA 3C61A 4IXXA 4FB7A 1A50A 3ANYA 5DXXA 5BRBA 4B5NA 2V82A 1O60A 4CCDA 1JUEA 3FYPA 1EB3A 4N02A 1QAPA 3W7RA 1PS9A 3NQCA 4PEKA 3PC0A 1GOXA 3TUUA 1QDSA 4MFDA 5D37A 3G1YA 4EWND 1OABA 2CZFA 3MUXA 1A5SA 1YXYA 4MUZA 3THQA 2B0MA 2VEMA 2W6RA 1EA0A 2ATMA 3A5VA 3Q37A 4N9DA 4EOUA 2Y62A 4NNAA 1FWWA 2PE4A 2GQAA 1RZMA 4S2CA 2C3ZA 1KM5A 4IMFA 1W54A 4PA8A 1KFEA 3GR8A 4ADTA 3KVKA 3N73A 3B8DA 1K7XA 4N4QA 5EY5A 5C2XA 1VCFA 1VC4A 1WX0A 4IWWA 3INPA 5I3FA 5G2WA 3B06A 3GAKA 3W1XA 3W72A 4OBTA 5ABTA 2O7SA 2J9YA 3LHTA 4MZ8A 4PL2A 1YLVA 2WSRA 3UNDA 1KBIA 5CG7A 3EWZA 1A5CA 3MHFA 4H6KA 1DVJA 1TPVA 3FYOA 1O95A 5AYZA 2C13A 1ZJIA 2CLHA 5DN1A 2AGKA 2V9DA 1LROA 1JR1A 3EKLA 1ME9A 1BWLA 4IPIA 3TQ0A 3O63A 3DZ1A 1VZWA 3L0GA 2FPVA 4O50A 3FJ6A 1UUOA 3VKJA 5K9DA 1F6KA 3NPXA 3LV5A 4ZQNA 5G2HA 3E49A 1ICQA 3NZ1A 4FX8A 4UMAA 2VOMA 1FCVA 3RK8A 5I3IA 1PVNA 2E5DA 1W5MA 3QMRA 5GVJA 1DQWA 4LVGA 5HR7A 2C1HA 1YDVA 2ZA3A 2FTPA 4LS2A 2Z1BA 3BGGA 2FIQA 3BG9A 5KZDA 3KAOA 2ZFAA 3W2UA 5CZSA 2F84A 2CLFA 3TIMA 3SSJA 4PODA 3YPIA 4ZVJA 4IMGA 4U4MA 1QFEA 4YMZA 2WNZA 5LHFA 3W86A 1ZENA 2PRLA 3EX6A 3KFTA 4NUWA 5FI8A 1TQJA 4Y90A 5F4WA 3IGUA 4IMDA 1F05A 4IX2A 3R12A 5L6UA 2FQIA 2X2GA 4LV9A 4NX0A 1G4TA 2QCNA 1JRCA 3EEGA 3C2FA 3R8RA 4JTGA 4G1KA 3LX9A 3PBUA 4YWIA 1J2WA 2H3DA 3GXPA 3O05A 1RVGA 4ML9A 4RJEA 3PBYA 1TPWA 4MY9A 2JGYA 1IXPA 1LRNA 4LS0A 4BI6A 3U8GA 2NUWA 4X22A 1NF0A 4MIMA 4Z1BA 4TX9A 4EF9A 1B57A 3GXTA 4RXFA 2TMDA 5BMWA 5I3KA 3KRUA 5CZJA 4OE7A 1MEHA 3LI1A 5D05A 1DBTA 1Y0EA 3O16A 4CNOA 4S1FA 1TJRA 3M5XA 1TPC1 5IBXA 4UCGA 1OVDA 3P5ZA 4RR4A 1JCLA 3GKFA 2ZTJA 3O15A 4UTKA 3KX6A 4JY8A 2HS6A 1SSDA 2BWGA 1PE1A 4LRTA 3C0JA 3W7EA 5LNSA 5EYWA 1VYSX 3S5NA 5K9XA 3LTPA 2UV8G 4A29A 3G1HA 2ZRVA 4AB4A 4DO6A 1M7OA 1EEPA 4M7TA 4KFPA 5HWJA 4UXDA 1LLWA 1PIIA 2H8XA 2V81A 1UASA 4I9AA 5CZTA 1JQVA 5D32A 1Q6RA 1O5XA 4UTMA 3M44A 3LBMA 4TO8A 1D3HA 1JULA 4EF8A 4NNCA 3BLEA 4JS3A 2A0NA 3TAOA 1SPQA 2P1FA 1KM0A 1XBYA 3UXAA 3VE7A 4K38A 4MPQA 4DF2A 3LCFA 4LV4A 4WX2A 1W0MA 2BZNA 3CTLA 1XXXA 4W9TA 4I7VA 1JCJA 1DOSA 3HO8A 4O12A 4K39A 1F2JA 5FF3A 2FJKA 3S1WA 1YXCA 3P81A 1W3NA 4WD0A 3LRKA 1WBJA 4NXSA 1G7UA 3SJ3A 4H4IA 1JUBA 1K7FA 3TCEA 1U5JA 7TIMA 3IIXA 5HUPA 1H1YA 2CLLA 3UYCA 3KRZA 5HJLA 3MBFA 4JTEA 3QPZA 5MHBA 1X1OA 5I3GA 3BLIA 3NDOA 4UTWA 1I2PA 2JKEA 3P60A 4MZYA 3QRHA 2GJLA 3BPWA 2B7QA 5J5RA 2DP3A 1NVMA 3BVJA 3UWQA 4FNQA 4XWUA 3NYZA 3G1XA 5K4XA 1THFD 3FJLA 3V75A 1Q6QA 3GR7A 3C2EA 4JIQA 3MP5A 3QW4B 2B7NA 3NQDA 3U6WA 4JICA 4JTKA 2VENA 4MZ1A 4XTIA 1QPOA 3GB6A 3W7PA 1WQ5A 5LGZA 3RU6A 1MXSA 4O18A 2JKPA 5TQLA 4ADSA 2Z6JA 4A2RA 1LCOA 3DAQA 3I7QA 5LNVA 3H53A 4IJBA 2FFCA 4DXVA 1F73A 1FUYA 1C9DA 4JTLA 2WOQA 4UFJA 5AOUA 1ZNNA 1QCWA 3L5LA 4NT0A 1R2TA 3L2IA 1H7NA 3FA5A 5EL1A 4QITA 4UFHA 2ALDA 5CSSA 3LGEA 2C18A 3TSDA 1LBFA 2A6NA 2DZSA 1F74A 1VLIA 3W1PA 3GDMA 4Z0SA 3EXSA 3BW4A 2PCQA 5C55A 1H7XA 4E38A 2ZZ1A 4QJ1A 3SY5A 2CWNA 4JN6A 3IVTA 3T4CA 4AWUA 3DI1A 4MYAA 1KLZA 5AHNA 1DORA 2Q3RA 1U83A 2QUTA 3EXRA 4KWVA 4R53A 2CW6A 2VFGA 4GBUA 3TC6A 3N2MA 3QFEA 4FXRA 1OX5A 4M6QA 3A5FA 3VI2A 4Z1CA 2Y7EA 4MFEA 5BW6A 3IIOA 1Z42A 4N9CA 2C19A 3G1FA 5LZLA 2I14A 3MI6A 2JGQA 1YDNA 3HB9A 1H62A 1WYIA 4NJIA 3NQGA 3GAYA 1KM3A 4E0CA 5HMSA 4CQ8A 1LBMA 5F2GA 4H3DA 1KBJA 1D3GA 1WBHA 3MI2A 1Q6LA 4RLIA 3PULA 4KKXA 1FWRA 4CQAA 4UTTC 6ALDA 1HG3A 2YW4A 3I6RA 2NLIA 3W1RA 1TRIA 4AHQA 3DI0A 3KVMA 1KM4A 2DZTA 1W3TA 2Q8LA 2ZBTA 3W7JA 5DELA 1LBLA 5KINA 3SFKA 1FDJA 1BWKA 3L9CA 2VFFA 4BWLA 1TTQA 2CZ5A 3OVRA 3W2MA 3ABRA 1XL9A 5K7JA 1RPXA 4HN4A 1WXJA 3TJXA 1DJNA 3TJLA 4ORMA 4N9BA 1MEIA 1TCDA 1ZALA 4NXKA 1GYLA 4LUJA 1X8FA 2B7OA 3W85A 3P82A 5AYXA 2OCZA 4Y8FA 1ZAIA 2KZHA 3LRMA 4KWWA 3QM3A 3E96A 2YX0A 1KFKA 2D73A 2NX9A 1XC4A 5F1VA 3P74A 4JTSA 2I1OA 3N3MA 4DEFA 1EP1A 3G1SA 4WY0B 3MHGA 5CSRA 1RV8A 3QJAA 4GJ1A 1UUMA 3LRLA 2QCEA 5DBUA 3HPSA 5AC6A 3RFAA 2CZEA 2J27A 3HG4A 4O28A 3OIXA 4O16A 3W7DA 3QC3A 4KFOA 5CPOA 1FXPA 4N2YA 5FEPA 4M6VA 1I4NA 3MO7A 4L4LA 1EUNA 4BFAA 4QM1A 2R14A 3QSTA 5I3JA 2QJGA 3W7HA 5G1TA 3CWNA 3BG3A 3VFLA 1TPFA 5G4EA 1K8YA 3W71A 1MEWA 3W1TA 3P5YA 4GE8A 4EIVA 3QEZA 4RKAA 3LXAA 3NL3A 3S42A 2YSWA 3LTYA 1GZGA 3ABOA
chains in the Genus database with same CATH superfamily
1UD4A 3LQLA 3ZM8A 3NQ8A 2EEXA 4CD4A 3I7RA 4AMAA 2PDKA 2CLKA 1S39A 1G4SA 1DIDA 3VYLA 2E6FA 2O55A 4QCFA 1Y7VA 3WLOA 4D1JA 4HKPA 2ABAA 2XH0A 1ZJBA 5D4YA 3HOJA 1DP0A 3PFRA 1K8XA 4IOTA 1U1HA 3WKZA 4QGCA 4MVAA 1BRLB 3E12A 3AIRA 3DHFA 3VM7A 4I9MA 1M1BA 3QVQA 2QXWA 4P61A 1WKYA 1L8NA 4GUHA 2Q3OA 4EX4A 4WOQA 3MKKA 3OIHA 2A1YA 3OZYA 2DZUA 1KC7A 3OYXA 2V8ZA 1V03A 1JCYA 5CZ0A 2CLOA 3C0SA 3HMJG 4GX9A 2C91A 4Z2GA 2EG8A 3DYPA 3FVMA 2ZZ4A 2J78A 3UJFA 1FKXA 5CPNA 4PFHA 4P7NA 3GNDA 5E0FA 3UXDA 3WDIA 1P0BA 3C3NA 4K3ZA 3B04A 1AW5A 1OYBA 5AHLA 3AS1A 2FJUB 2BDQA 3LS9A 3LV6A 1VYPX 1YADA 3FXGA 3MJMA 1NWRA 2CLEA 3C6CA 1LOQA 3P80A 4NAEA 1LWIA 4U10A 3EX2A 3GG8A 4FAMA 1ZAJA 1KTNA 2EO7A 1NF7A 2XWEA 5FF7A 4UTUA 1QNRA 5I09A 4E2VA 3NOYA 3T7VA 4L1GA 2QPUA 3W2KA 2OKOA 1IV8A 2RAGA 7REQA 1H41A 2Z28A 2YDQA 4ZTYA 2ZXAA 3VKKA 1RLDA 5TBOA 1C9WA 1IEVA 1VHCA 1PZ1A 3PY2A 4DB7A 3WUFA 3GY1A 1TE1A 3PNUA 3HURA 5C2CA 1TJ1A 3ZJ8A 4IPJA 1XIGA 1VGAA 4ONVA 2WNNA 3WL1A 2XJ7A 1WZLA 1L6WA 3ZVHA 1FH8A 2YOCA 4A3QA 1MI3A 3ZWSA 1DQXA 4CNSA 2PWGA 1MFVA 3THAA 1R30A 1YTKA 3A9BA 1YDOA 5XIAA 3LHUA 2EPNA 3GH4A 1I0DA 3VZZA 1KFLA 4AVOA 4MNLA 3Q4DA 1FWGC 3LCLA 4Z42C 1ZCOA 3UESA 2JK2A 2FGZA 1ODUA 1LZOA 3WEMA 3GIPA 1E71M 4GQRA 3WQ5A 3O8AA 1GVRA 3W87A 2X2YA 4CCEA 1VJZA 1RK6A 3GIYA 3WLQA 3OEXA 5C54A 5DQPA 2VOTA 3KWXA 3RGTA 3SR7A 1F3XA 2YZ5A 3QPYA 3JRKA 2ON3A 1J6OA 4GXWA 3BC9A 2IQ0A 4H8VA 4P7LA 1X96A 4GABA 4Q8UA 1W9UA 5G4WA 1M68A 1UD2A 5HAOA 4ATWA 2E68A 1R3SA 1VFSA 2YYUA 1Q8AA 2C0AA 2IPFA 1EC7A 1Q6DA 2D24A 2ZUWA 3F1QA 1MW3A 4QEHA 1NWTA 5D9MA 3T8LA 4QAWA 3M0MA 3PBWA 1M3UA 1W1PA 1ZJHA 5AB3A 2NW0A 3CB8A 4GYPA 2YBTA 3MYOA 4GY1A 1HQTA 2O7QA 2X09A 4JIPA 1B90A 3KOXA 2PCEA 4HNUA 3QZ6A 3C2OA 4AZIA 1H0GA 2VXNA 1K9TA 2GSJA 1BYAA 4B92A 1EJRC 4DBDA 4AEOA 3OVQA 4XAPA 2HTMA 2PDLA 1FA2A 3RNDA 2C1GA 3FS2A 4OQVA 3F4WA 3ARSA 1LP6A 4TV5A 1P1XA 3PM6A 4RNIA 2GGGA 1PIFA 2H3BA 2W79A 5GNYA 3KRSA 4NZJA 3BL3A 2PDJA 1SZNA 6REQA 4FNRA 2JEPA 4EK7A 2O9TA 1R9XA 3JR2A 2INFA 1F4AA 3OBKA 4DWSB 4GZEA 1C3FA 4HN8A 5KZEA 4MMWA 4L6DA 2BVDA 3GC4A 1RXOB 1HJVA 4KRTA 4BK9A 2D3NA 2PODA 1FHDA 4S3BA 3UR5A 2PU0A 3KBWA 3TMLA 1QWGA 1MYRA 4K7YA 3FFSA 4GIRA 8XIAA 1O68A 2Z0IA 3V5OA 3VKAA 4AIEA 3FGCB 4HNTA 1E15A 2QEZA 4UNLA 1C29A 2RJGA 4FXFA 4IQLA 3SZ8A 2ZTKA 4HZ8A 2YXOA 3CHCA 4DLMA 2J4GA 1QR7A 3GDKA 1CB2A 1T99A 1MVYA 1TA3B 3IJ7A 5ABGA 4GK8A 3WMCA 1XR2A 4B15A 5FEZA 5BROA 3N29A 2PBOA 3L5MA 4CUCA 5DF0A 4JIRA 1QOQA 4ZQRA 3H26A 3N4FA 4QR6A 3TK7A 1B4EA 3KW3A 3AISA 1J0JA 3P3BA 3KCJA 1J93A 3EA3A 4HVXA 1K9DA 1HNYA 4ZQMA 1RD5A 3PP7A 3GG0A 3ICJA 2PU1A 2OTDA 1W3IA 2FYMA 3VOGA 4D8LA 4A21A 1FWEC 3ZLFA 1VPXA 4LFYA 2QF7A 2PEVA 2WNWA 2HISA 1IEXA 2IQDA 3LLDA 1JJKA 1ONWA 2ZUUA 3RHGA 5IRPA 4LYKA 1XM3A 3MBDA 1PZ2A 4TMBA 2RUSA 4W84A 4KCWA 1WA3A 4JTRA 2QAFA 4A8RA 4LEQA 2R9RA 4FNSA 5DMLA 1VB9A 3XISA 1UQZA 3S6DA 1VCGA 4IG2B 2A21A 3CO4A 3VA8A 3GDLA 1FWBC 5HK4A 3TU9A 3DG7A 3LCGA 1H5VA 2BX7A 4M19A 1K8ZA 3BQ6A 4JFSA 1TZ7A 1EWDA 3NQ7A 3MWAA 3V1PA 3ID7A 3RUBL 1PHWA 3WH5A 3W27A 2ZA2A 3SCTA 1UW9A 8TIMA 3H70A 4OWGA 3WK1A 1B4KA 3SIZA 2QIWA 1ONRA 2J7GA 3CH9A 2Y8VA 2WLZA 1UYQA 3AXIA 2E6YA 5ABFB 3KE0A 3T0AA 4D6IA 2DVTA 2G97A 4DBSA 1GVFA 2E28A 2HCVA 4R9OA 3GVQA 1L6YA 5IM51 4QISA 1ME8A 2OT0A 5C0QA 3WQCA 1QW9A 4GY7A 3EX3A 4CQ9A 3Q45A 1HGWA 3SECA 4J35A 4DPQA 3WLKX 2WHLA 4AVFA 4UTTA 2DSWA 2HK1A 1KNWA 1N2VA 5LKYA 4LCSA 1P0KA 3WQGA 5GJPA 1ISVA 2WHKA 3W1NA 3B8VA 4I5XA 3PSVA 4K2SA 4LAMA 4KCVA 4O1FA 4ZENA 1UBPC 2PLKA 4IT1A 2DY3A 3E2RA 4QDWA 3BE7A 3WMLA 1R2RA 3E02A 4QS5A 3MSDA 3GTNA 5CGTA 4F2UA 1FWHC 4S3EA 2NQ9A 1FHLA 1AQ0A 4KCUA 1G9HA 2V30A 2Y5EA 4O11A 2G5WA 4XAYA 1KR1A 4KFNA 2ZZ2A 7ENLA 3T1GA 1J0IA 4RPPA 3C4UA 1HKKA 4JTDA 4C6FA 3CUFA 1GOOA 1FCBA 1Q6CA 1SFSA 4DUWA 2NUYA 1OG0A 3RLGA 4FS9A 4OV9A 4UQDA 3HJZA 5LA2A 2PURA 1AJZA 4OOUA 1A5UA 3GDBA 1EEXA 4IQDA 5E70A 4AXNA 1N55A 2JF6A 2FPTA 3SCUA 2E0PA 3P7YA 1PEZA 3PJUA 4XX6A 3FYYA 1UZDA 3VC5A 3JZEA 1JDDA 5JH2A 2CKSA 1G67A 5EMYA 2FGLA 2F9RA 4C6QA 3ZVIA 4CD8A 3N2OA 2FKPA 5FACA 5L9FA 3T42A 3GSMA 4D6HA 1DWHM 4Q8WA 3KS6A 3G8EA 1GTEA 4CNPA 3UY7A 2QPXA 3LEPA 4CQCA 4JN8A 4HBKA 1XIMA 2HVOA 2ZZ5A 1TMQA 1Q6OA 3H4GA 4NRSA 3ZSSA 5AYBA 5DMMA 3TP4A 5A6SA 3TC7A 2Z25A 3CL6A 4NNBA 1XBXA 1I2OA 2VFIA 1OD0A 3PTKA 2A6LA 2ZDRA 3M5VA 4LVDA 3XINA 3K8KA 1D8CA 2QYGA 2QCFA 1C8QA 3UJEA 3BQ5A 4IIBA 3B03A 5M1TA 1TV5A 3L2LA 1JPHA 3WF1A 3OLDA 3LK6A 5CGQA 1UPPA 3AIBA 3W6YA 4L6HA 1OFAA 1UHVA 1WDDA 1Q3NA 1V93A 4QQUA 4OGZA 3C0LA 4RDYA 1W32A 4MWAC 3ANVA 4ILSA 4Q33A 5CLWA 1F5ZA 3KVLA 5I07A 3LCHA 4A3HA 1H4PA 5F4XA 2INZA 3H7RA 5C5YA 3W76A 5F1UA 4D6EA 2G8ZA 1P6WA 5TF0A 3TW6A 3FW6A 3ES8A 3QZEA 3NDYA 2PC8A 1WDWA 2GJPA 2VKZG 3QH2A 4ZZ9A 1TX2A 1OIMA 1NDWA 4INFA 1FQ0A 4DBUA 3ENLA 4CCZA 2CLIA 5MF5A 2AAMA 3FKKA 3MMTA 1GQJA 2WSYA 2EAWA 4KH2A 1XICA 1WV2A 2Z29A 3JUGA 5HULA 3RCMA 1V0MA 4X60A 1QHPA 1NDYA 1EJXC 5H2ZA 1HTIA 3F4VA 3VX0A 4JDYA 4PZVA 2E6AA 1BRLA 3KZPA 3H2NA 4UQ9A 4C60A 3LOTA 1ISYA 4OECA 2PAJA 4DBEA 4WKAA 1VLWA 4AEFA 5AKQA 1GJPA 3EB2A 3MSRA 4GH1A 4GJJA 4XAFA 3UJRA 5A8PA 4QNEA 5FF4A 4ROPA 1WO2A 2HEJA 1SO3A 4HK5A 3MUCA 2A3LA 5E6YA 1EP3A 3W73A 3HM7A 3B4UA 4NJJA 3EKGA 2FLIA 2JIEA 3PWGA 4IXHA 2WWCA 1BAGA 4RE0A 4V27A 3DUGA 3WF4A 4Q6JA 3CV7A 3CHEA 4J3SA 2R94A 4I9TA 3XIMA 1R85A 3MQTA 1QBAA 1XPGA 3LCIA 3KBMA 4DJDC 3RITA 1QI4A 4MLJA 1SJCA 3OJGA 4DO5A 2A7PA 7ODCA 2Y63A 2CHRA 4LYRA 3GKAA 3PVFA 1AZ2A 4FOJA 1RCQA 4JKMA 1CXFA 1MUMA 1DYSA 2NSOA 1Z48A 2QUUA 4FLQA 4RZBA 1NFBA 3LPGA 3NXLA 5K9CA 3ZFHA 3MWCA 4PMDA 1UR1A 2XIQA 4PFMA 4PMXA 3GFXA 5DX7A 3O1NA 3CV6A 3SUSA 3BAIA 3S5SA 2VJXA 1IZJA 2YCLB 3N25A 2VELA 3GUGA 4ZODA 1M5WA 4ZB5A 4CLMA 1CI1A 2AMXA 3NL5A 4JIEA 1LQAA 3PG8A 3QFWA 4PCFA 1SZEA 3CPGA 3VDBA 2DT3A 1GCYA 3CO8A 4I90A 3WQPA 2YL5A 1SO6A 1WNOA 3UG3A 3AHZA 4Q4MA 2PS2A 3GW3A 4A2SA 3GH5A 5AN7A 3VNKA 2OU4A 3SQSA 3EX1A 4ENLA 3BICA 3FK4A 3P67A 2Y85A 2FZDA 3WJZA 3L23A 2P0OA 1Y65A 3W6LA 2GWNA 3H2EA 3WH6A 4FIQA 1V79A 4AU0A 3I3DA 4Q4PA 3MP3A 5AC8A 4LW7A 5CSUA 3MTWA 4H2HA 5TAOA 1OFQA 4MKVA 3TTQA 1J0YA 3AALA 1ELSA 3UR2A 5HINA 4ZO6A 1JDAA 4AZ5A 3RYSA 2OPJA 4P8VA 1UOZA 1XIEA 1KM6A 2HS8A 3G0UA 3RF9A 2IXVA 4JTCA 2XVGA 1QUMA 1Z44A 4K1GA 4W7WA 1TPUA 1A3XA 1AODA 4KEZA 1GOMA 1KB3A 3L7RA 2GK1B 4D6GA 3M9YA 3SUTA 1SFLA 1U1UA 4JQ4A 3M0ZA 2Y8UA 2J24A 1R0MA 1R86A 2VZUA 1OC5A 3GTXA 4LSBA 1LL6A 3F2CA 2TODA 3M0KA 3M0XA 2OQLA 3N3TA 2C14A 2VR5A 3B0YA 3R89A 2E9BA 1G4PA 4GCAA 4FALA 1PJ9A 5CBIA 3QMTA 3VD3A 4D72A 2OJPA 3L4WA 2QGHA 5BXRA 4P8UA 2XN1A 1XD0A 4L7ZA 3BWWA 4AG0A 4M7SA 3STCA 3GFZA 1Z7AA 1TJ2A 4CD6A 3VIGA 1V6YA 5F2MA 3MMUA 3E3HA 4IX0A 1EL3A 2NX3A 2WO5A 2VDGA 3QV6A 2DIJA 2XFYA 1W5PA 3BCDA 5CJMA 2Q71A 1QPQA 4JFWA 1C91A 3W28A 4JQ3A 3H22A 5GJNA 3HBLA 2PP0A 1QJWA 1UWQA 3EKZA 1HJSA 2V69A 1ZP4A 2IS7A 1NDVA 1FDYA 3CT2A 4PUMA 4GOAA 2ISWA 1A5NC 2GDQA 2X40A 2J7DA 3WFLA 4A22A 4DWSA 3PFMA 3WQEA 2ISSA 2WCGA 1Q7ZA 3VKCA 3T4WA 3WY1A 4UTJA 4K37A 3A9IA 2P88A 1ALDA 4FF7A 5F2IA 3URBA 4LYQA 1FWTA 4IICA 4FLRA 1EYEA 4NAFB 1JPKA 3TNBA 2E9MA 2G3MA 4H19A 4LUSA 2HE8A 3AROA 3GNNA 3MCOA 3BTNA 4AHPA 1RQEA 4LY4A 1LF1A 1EC8A 3FGCA 3MMWA 3TSMA 2YJQA 1RBAA 2G3JA 2G96A 1NP2A 5G5IA 5CPMA 2C0HA 3GYEA 4HK7A 4IH3A 3ITVA 3WJXA 2XU2A 2J47A 4M1RA 1TA3A 1W1IE 1GTHA 3LENA 4A4AA 2C79A 4JIHA 2EKGA 2XWDA 3S5YA 3USBA 2PF0A 3MV01 2WC3A 1XGEA 4PB3A 1JYWA 2C6QA 2ZRWA 4W8AA 1UB3A 5AY7A 1EYWA 3PZOA 2ACRA 1FVPA 3A22A 5EPDA 2PZNA 1LWHA 4NJKA 1E70M 3C61A 4FB7A 1A50A 5BRBA 4AD5A 2WVVB 3GU9A 4PB5A 3QR1A 4KRUA 2XGIA 3CQKA 5A2AA 1EB3A 1PZ0A 1PS9A 2I17A 1SM9A 1GOXA 4ICMA 5IOBA 1R6WA 5D37A 1DJZA 5GQBA 3EDKA 4KIEA 1XQKA 2V67A 1LT7A 1BSLA 2PD5A 1XIDA 4NIRA 2B0MA 5GPRA 4AY7A 1CZ1A 3Q37A 4JIIX 3N12A 4GFIA 4KF1A 1K4GA 1KFEA 2QJMA 3B8DA 1K7XA 3H2CA 5EY5A 5C2XA 1VC4A 3B06A 3GAKA 1A49A 3GQYA 3W1XA 4OBTA 5ABTA 3V7PA 4OUIA 1ITUA 2WSRA 3KP1A 1KBIA 4WSKA 4EPDC 1EJWC 1ECQA 3OPSA 4H6KA 2PP3A 1O1HA 4EXAA 4YHGA 2XG9A 2VX6A 4IG2A 2CLHA 5DN1A 2AGKA 4LF2A 1JR1A 1EH9A 1E4NA 3QQWA 1OT2A 4HYVA 3TVAA 4TX8A 3TW9A 3TQ0A 1MMFA 1DE6A 3FJNA 3E5BA 3N17A 3NPXA 3LV5A 4ZQNA 5G2HA 4CEUC 2VOMA 1O5RA 5I5RA 2E5DA 4AISA 2A3CA 3RR1A 4HOWA 3R25A 2GOKA 1E9YB 1YDVA 3E0WA 3PK7A 2DVXA 4PMZA 3AXXA 4LS2A 3BGGA 3TN4A 3UG8A 3GUWA 3KAOA 1JPDX 2ZFAA 1B3XA 4QP0A 3WX7A 4M29A 1J12A 1EXBA 6A3HA 4LYPA 1V3KA 4DJEA 3W86A 3WDPP 3PTQA 4X2PA 4NUWA 4YU1A 1VFHA 4IM4A 3NSXA 4YYCA 4IX2A 5A1AA 5FKYA 2OYLA 4HPGA 2FQIA 4DM2A 1IT7A 4LV9A 4IL0A 3GG1A 4P7OA 4B3ZA 2WK2A 2WSPA 3ME3A 6XIMA 3C2FA 3R8RA 4DBWA 1TWDA 3LX9A 4YWIA 3GXPA 3H4WA 5EMLA 2E67A 3A4JA 3I4EA 1AH3A 2CNCA 2R1LA 1RVGA 4H8UA 4RJEA 2QDEA 1TPWA 4MY9A 3WNMA 3PTDA 4H6RA 4W7VA 4X22A 1NF0A 1JI1A 4MIMA 1VENA 3CMJA 4IIEA 3S6OA 5BMWA 2E25A 3LI1A 4ERGA 1Y0EA 1ITXA 4CNOA 3GYCA 1XIJA 1TPC1 4UCGA 1OVDA 2Z4GA 3AHXA 2AL2B 3ABZA 2ZTJA 1ZL1A 4ZXOA 1E6RA 4ZR8A 2QV4A 2HS6A 4B2DD 4N7QA 3E0LA 3N4AA 3RDKA 3UW6A 2BWGA 5FCZA 3T2OA 1GKPA 1VYSX 5K9XA 2REQB 2UV8G 4A29A 3LG3A 3G1HA 2ZRVA 3A12A 4AB4A 1KGUA 2QJJA 3WQ8A 1EEPA 4R7WA 1K70A 4M7TA 1KXTA 3TJ4A 2H8XA 1UASA 4I9AA 3EGJA 2YCJA 1Q6RA 3M6DA 2ZADA 1X1NA 2VRKA 1KRMA 2V5JA 3BLEA 5H1WA 2A0NA 1XBYA 1VFUA 4K38A 3RU8X 4PRTA 3MB9A 4IZGA 4PUUA 3E2QA 4C90A 2BZNA 4YJ5A 3VIPA 1JCJA 3HO8A 4K39A 4B91A 4PSRA 4BQ4A 4YN5A 4HMDA 3H2OA 1G1YA 4WD0A 2P8BA 4H4IA 3NO1A 1K7FA 5C2GA 5JH1A 1U5JA 4AD0A 7TIMA 3SADA 1M9HA 2CLLA 1MNSA 3H24A 2WC4A 3V5FA 3KRZA 3HN3A 4G1NA 2V3GA 4MSSA 4HHMA 1JD7A 3FEQA 3NDOA 5HQLA 4RDVA 2Q8XA 1ZCCA 2QNEA 4ZOCA 3ARRA 3NYZA 3WUGA 4XAZA 1BQGA 3VKBA 1YW1A 1THFD 1IWAA 3GR7A 4JCLA 1SYTA 4JNZA 5LA0A 1BVZA 3NQDA 4ZFCA 4JICA 3CBWA 2XH7A 2IPWA 4I3GA 2DEPA 1UKQA 2YB4A 2VENA 3VNMA 1NFGA 4MZ1A 3W7PA 3RU6A 3URNA 2JKPA 4GPNA 1QI3A 4S3CA 1TR9A 3IGHX 1V4YA 3IARA 3H53A 1F73A 5DANA 3SQMA 1FUYA 1C9DA 3HU7A 3Q65A 3FDGA 5AOUA 4KW2A 1CXIA 4IPNB 4RE3A 3L5LA 4NZ5A 3I3EA 3ARWA 2VM8A 4D71A 1EBHA 4UFHA 4U31A 4JQAA 4R88A 4XZMX 1QBBA 4RW3A 3TSDA 1LBFA 2A6NA 1F74A 2VZTA 2D22A 4Z0SA 1GGOA 3URAA 3EXSA 2DV0A 3APTA 4GVHA 3F2BA 1XRTA 4UQCA 3BW4A 3DERA 3VMOA 4QSFA 1CGUA 2ZZ1A 5HBFA 4DX3A 3DI1A 4MYAA 4GBDA 4R3UA 2Y5SA 2W92A 3BSGA 4HA1A 3SCNA 1K9EA 5BXSA 4N9CA 5LZLA 1I1XA 3RM8A 3MI6A 1WZMA 5CPQA 4MM1A 1WYIA 2YDRA 1KM3A 3A6OA 4CQ8A 1LBMA 4M0XA 2AKZA 3TWAA 3PULA 2Y8KA 5IHRA 3BAKA 3UZXA 1MDLA 2VP8A 2YL8A 3MA8A 4AHQA 5EMJA 2QVNA 4HB7A 3DI0A 3KVMA 1PDZA 3L4VA 2ZBTA 2ZXDA 1D3CA 1EHNA 1FDJA 3VIFA 5CC5A 3ITOA 1TTQA 3OVRA 3W2MA 8A3HA 4IFRA 1RPXA 3TJXA 3SJNA 1DJNA 2NVCA 1E4LA 4N9BA 4MADA 1Q5MA 3L4ZA 3VNZA 3VCCA 2ZXBA 2B7OA 1SR0A 3P82A 4V15A 1ZAIA 3WN6A 4H9MA 3LRMA 4CKQA 1QHOA 3RO6A 5FJUA 1F3TA 1VJSA 3P74A 2I1OA 3N3MA 4YPJA 2WJEA 3QOMA 4GJ1A 1XDJA 3SCPA 4US5D 3HG4A 3OIXA 4AEEA 3BZGA 3CB3A 3CAVA 3RPTA 1W6TA 4MDPA 3A4AA 3GHTA 3EOLA 1AJ0A 3V0UA 4L4LA 3ZT6A 1EUNA 4HU3A 3NURA 4BFAA 4JKLA 2OWXA 4GNVA 4QM1A 3S6TA 3W7HA 1IT0A 1JEZA 4HTYA 4S3JA 3BG3A 3VFLA 2J7HA 5G4EA 5KZ6A 1K8YA 4UB9A 3P5YA 4FF5A 4IISA 4W5ZA 3O0KA 4GI4A 4Z2LA 4F2BA 3ABOA 2WBKA 1V6TA 1PV8A 4G8TA 4S3FA 3CHVA 2ZXQA 4IUGA 3GVWA 2ZQ0A 4NVTA 4JL1A 1HJXA 1MQRA 4HK6A 3UWYA 3BUVA 1ZUAX 3O2LA 2DW7A 3FOKA 2BVWA 2A3EA 3P62A 5AFDA 5FESA 4KGLA 2RDWA 3ZR5A 2YA0A 1OHLA 2WM1A 4GNKB 2QJNA 3E38A 3AI0A 2J74A 1RBLA 3PSWA 2WZHA 4MWAD 4Q7BA 3W29A 2E4TA 2HV5A 3C52A 3KWSA 2NXGA 4MNKA 1RK5A 3OGSA 2PDYA 4H7ZA 1TIWA 1J9YA 2DJLA 4AZ7A 2ZKMX 5HJXA 4Q8MA 4DRSA 1XD1A 2YB1A 4B3KA 2NZLA 1ZFJA 4A3RA 3ZLHA 4HGXA 2ZE3A 2P5NA 1TREA 2BASA 2FHBA 2V6AA 3GK0A 3W7KA 1LOLA 3PPFA 3W07A 4C6KA 1TPH1 5B80A 1KTBA 3KVJA 1UKTA 4HJWA 1NWUA 2X30A 3OA3A 4QXIA 1WUFA 1ISWA 4C1LA 5I2UA 3GX9A 2Z2AA 2W67A 3KDNA 1PX3A 1HX0A 3VCNA 1WOBA 1VFOA 4LVAA 4C91A 1J2BA 3QQ0A 3UD6A 1ZY9A 2E77A 4Z1YA 2QCGA 1UZHA 4Q7IA 4HHLA 3BGAA 3HFTA 3UEQA 4G2DA 1W3LA 1ZLPA 4Q8NA 4UOQA 3O06A 1XKJA 2QDGA 4HMNA 4NZ4A 4LJ3A 4GLEA 4ZOAA 5H8UA 3V5CA 5FJOA 2OLHA 4V28A 1YE4A 1JGMA 4X63A 2WJFA 4RW5A 2TRSA 5KITA 4QG9A 1QK0A 4WOZA 4QRNA 2FTWA 3WDQA 5DCDA 4OU1A 3HF3A 1ZU8A 1H51A 3EPMA 3MJYA 2X1UA 4EWJA 1KV8A 3S8HA 4DELA 1ZRQA 1C93A 3T9PA 4NILA 5A6JA 3NO5A 3W2LA 1M01A 3GTIA 4ZO7A 3D0CA 2D20A 1TX0A 3UXKA 1TIMA 5A6KA 1GQNA 3TN3A 4C6CA 3M0YA 1W37A 4GI9A 3IJ9A 2NV2A 4XO7A 3RCNA 3W7QA 1L2UA 3V0TA 3GWQA 2C7FA 3KTSA 2VFDA 3W7MA 5EMMA 5HA7A 5HPOA 3ZLGA 4X0VA 3GU1A 3MPGA 4QG8A 3IRSA 3RLHA 1JAEA 1QNSA 1HL9A 1QI0A 3E0FA 1NSJA 3UPMA 1H61A 2OGYA 2PDHA 1H0IA 2V2DA 4G7FA 1H49A 3IAPA 4EACA 4XTDA 4UC5A 4LPCA 4C6NA 3S9IA 4Y8EA 2TSYA 3M64A 2EPKX 3A4XA 3E9AA 5FOOA 4CQBA 3GS6A 3PZUA 5D03A 3FEMA 3FX4A 4BF9A 3BV4A 3CAQA 1JF5A 2ANUA 3W9ZA 2R8WA 2TYSA 3BXWA 4HZ6A 1QATA 3S2CA 1TZ9A 1LL7A 4GWEA 3TR2A 4TQTA 3PZVA 3H2FA 4B5XA 4DI8A 4O1CA 1T40A 3U4AA 2QR6A 3ZJKA 2XVLA 1AQHA 2PA6A 3GNPA 2Y1HA 6CGTA 4ZE4A 1KV5A 3WYZA 3FAWA 4I5RA 4S38A 3UWWA 2QCCA 1OFEA 1E56A 4XG1A 1GT8A 4IP4A 2ZYFA 2VUYA 1HVXA 3SAZA 4BEUA 4JY9A 5J5DA 1MQQA 1CWYA 1NARA 3BJFA 5CBBA 1XUZA 5FEWA 2DPEA 4OHQA 4IPLA 3DFQA 4LVBA 5FJJA 3NSNA 4XIAA 2QJHA 1FHUA 4N4PA 2AL1A 1T8QA 3CGTA 1EC9A 1SGJA 3T40A 4U2YA 2OMAA 3ITGA 5FJIA 3NL2A 4DLFA 3O6CA 2ZVRA 1SZGA 2YGYA 1DTNA 4PMRA 4LB3A 1O5KA 1XPYA 3UERA 2O0TA 3M0HA 3L0NA 4IFKA 2J75A 3CU2A 2X16A 1OX6A 2JQXA 3KDOA 2P8CA 3N04A 5D02A 2Y7DA 1OSEA 4WIWA 1X6NA 4UTHA 1BFNA 1N8WA 1UJPA 3VOHA 1D9EA 4K36A 2GVGA 1X39A 2YFOA 3MU7A 3IJQA 4U2ZA 4K6AA 3WBXA 1B3WA 1Z32X 4WQ6A 3RRAA 5A6MA 4DJFC 2CBIA 5IHSA 3UWUA 3SB0A 3BW2A 4TXEA 2R1NA 3S83A 3TONA 2V3EA 4AZGA 4D8AA 2XISA 2UY4A 1TSIA 2Q01A 2J7BA 3B8TA 3WFZA 2V0TA 3FJ4A 4O8RA 1AA1B 3P61A 1GJUA 4GIAA 1UH3A 1RQHA 1KXQA 2VEKA 2XH2A 5HNRA 4W5UA 1B9BA 1RHCA 3PJXA 4AFYA 3TQKA 1K6WA 5CC7A 1ONXA 4GFSA 4HJFA 1R3TA 3IGXA 1UR8A 2P76A 1XJBA 3AHVA 3MMDA 4JR5A 3DXIA 5BCAA 3WQDA 1S5TA 4GD0A 3CZKA 4XBSA 4HP5A 1FCQA 1KM2A 1DV7A 3STPA 2FZMA 5HNNA 3VIHA 3LZ3A 3NQFA 1AL7A 2MANA 1BQCA 1GHSA 4BF7A 2AL2A 3A3HA 3LUTA 2PSNA 1LOSA 4DZAA 1CBGA 1YNQA 5I00A 2ZC8A 2BY0A 4FK9A 2PRMA 1OWQA 2REQA 1UD8A 2PDCA 3STGA 4QIUA 3TQVA 5LNUA 3H21A 1XUUA 2DZBA 4RK8A 5DT7A 2EJAA 3LHZA 2HJPA 4N42A 2NQHA 4WLCA 3GVRA 3ITCA 4RNFA 1XSIA 4DO7A 2QF8A 4AIBA 4KEVA 3F03K 2BVYA 1LJYA 4FIRA 2ESCA 3QR0A 3CH0A 4JX5A 4PBGA 2D0GA 4BQ5A 4PRRA 3EOOA 2W5FA 3N4EA 4C6PA 2YZRA 4HZ7A 2NT1A 5FA5A 1H7PA 1GORA 5DMYA 1DWJM 2FH6A 2A3BA 2GUYA 3DDMA 3FKRA 1JG9A 1K03A 1CXEA 4AD3A 4DI9A 1QHZA 1DJXA 1KXHA 2JIWA 3FA4A 1HL2A 3TE9A 2BHUA 4DYJA 4H41A 3LMZA 1PO9A 3O07A 4J5NA 4HSNA 2BOEX 1X7IA 4LU0A 1VRXA 2BXZA 4I6KA 1G5AA 1YBQB 4GXMA 4PTNA 1G01A 4XV0A 1ZGDA 3H7UA 1WXYA 1XYCA 3W82A 1XINA 4C5ZA 3TYUA 2BGQA 1YPIA 3PZGA 2R1PA 2OO0A 1WP6A 1OK6A 4P8XA 3N14A 3CJPA 5A6BD 5CXPA 3QYSA 1UOKA 1XBZA 1S3TC 4GYKA 4F3HA 2XZ7A 3GHRA 1CGVA 2J7FA 4GUFA 1FDZA 1TCMA 3DHPA 1WDSA 5G1YA 4AYGA 3N2BA 3VK5A 6TIMA 3EZ4A 3R94A 1L0PA 2FB3A 3WQ4A 3WLLA 3K4AA 4L4PA 4OV4A 1I2NA 3GTFA 3DEQA 1E0VA 3LDVA 5JIWA 4PEEA 1B54A 4B5UA 5CC3A 4Q32A 4PYSA 1IEIA 2GUUA 3N34A 1XYMA 3IJIA 3UG4A 1IHIA 2VO5A 1VS1A 4TUFA 3EWXA 2W61A 3VIKA 2GLKA 3BK0A 5C8BB 3MW7A 4TX6A 3KL0A 4DN1A 4E4PA 1E1FA 2NSXA 4OIFA 4LRSA 5A69A 1TFVA 1WAWA 2EHHA 4QEEA 4EP8C 3NL6A 5K2ZA 3N6QA 5HJYA 5FL1A 1EUAA 3AXKA 3NQMA 1C8VA 2CZDA 3PB2A 5E6ZA 3IIVA 2DU2A 4YTUA 5F4SA 4JDBA 1BXNA 2W91A 4XZBA 1QO2A 2JEQA 3W4RA 4GIYA 1I2QA 3SEPA 3HJEA 2BGNE 1Q7MA 3DU0A 1L6FA 1XSJA 1DXIA 3F7JA 3RM9A 3TAKA 3L21A 3LLXA 2ZRZA 4O13A 2VEIA 3ELFA 4XISA 4M6PA 5M3WA 4F0RA 2PDGA 1FCUA 2WZIA 2XYLA 2ISFA 3W24A 3ERPA 4GKLA 4NRRA 1O7AA 1FWAC 5KZMA 4PMUA 1XIFA 4TR9A 5D04C 1UMYA 3VM5A 4ZQCA 1YYAA 3H6OA 3FCPA 4IMAA 3I10A 1YHTA 2WZEA 3M16A 3WK0A 2Y61A 3IANA 4I6VA 3B9NA 1H63A 2J6XA 2ZZ3A 3LPPA 4L4MA 1UCWA 3VNIA 2TAAA 4JX6A 1E0TA 1W9XA 1MQPA 1H1NA 2GVLA 4XQ6A 3UWVA 4HCHA 4HD5A 4IMCA 1O1ZA 3TR9A 4J4KA 2Y6ZA 4FZIA 5FAGA 1TV7A 1NP0A 1NELA 2ABBA 2OX4A 1GWJA 1TB3A 4ZXLA 3OBAA 1TWZA 1VH7A 5AC5A 3SY8A 2ZX5A 1IIHA 3C56A 1OFDA 3CIWA 2XSXA 5EA9A 3SN0A 3MVTA 2Z27A 3W00A 3MYPA 4LBRA 4MKNA 5REQA 4MY8A 1QTWA 1CW2A 4GISA 3SW6A 2YA2A 2B31A 2VYOA 4JTTA 5DLCA 1OFPA 2Z2BA 2O9OA 4XKYA 2IXUA 1HJUA 3V35A 5AHEA 2J6VA 4QQ3A 3ARPA 2AMGA 3S0CA 3U57A 4ZA0A 2XVPA 5CJ5A 4CNNA 1W1VA 2ATSA 1R9YA 3MSYA 3G22A 1GEHA 1EIBA 1TWIA 3DKLA 5DFAA 3GH7A 5AC4A 3PUOA 4FHAA 4J3ZA 4UFKA 1J5TA 4HU0A 4QLKA 1RSCA 1F8IA 2XINA 1HW6A 5H8MA 2PC4A 4V2XA 1AQMA 3FY1A 1RAKA 4ZMGA 3SI9A 1A0DA 2X05A 3B8WA 2ALRA 1EA9C 1KGXA 4NHVA 1VR6A 3KOFA 4O0KA 1OCJA 4Z0JA 4EPEC 5CAKA 5C9XA 4NX5A 2NWRA 3H23A 3EXTA 2Z6IA 1ZTVA 1NOWA 4NJGA 5ECVA 4AYSA 1US3A 2WMKA 3G2GA 1GNXA 3QY7A 4UR7A 3SY1A 2Y89A 3WJYA 2BY3A 4B5TA 2EQDA 3RPMA 3K4DA 1WZAA 2DGAA 1LQ0A 4NQ1A 2WM0A 3K4WA 3V0SA 2PTZA 2CZVA 1M7PA 3EA2A 4LS1A 1IXQA 3EB4A 4GJIA 5AHMA 3DG6A 1VEPA 3OGVA 1JUKA 3NA8A 1T96A 4FR6A 3WCZA 4GXPA 1N8FA 3ABXA 2P10A 2WQPA 3W7GA 3W75A 4GINA 4UMCA 3B0VC 3LCXA 4ZQPA 1GKQA 1ML1A 2QKFA 2QCDB 4GHRA 3L4YA 1Q8JA 4JD4A 4XZWA 1OM0A 1HO4A 1CB7B 1WUEA 2WMIA 1DJIA 4UIOA 4Z08A 2VI0A 1I75A 1W5NA 3CEPA 3TW7A 2H8ZA 3MI3A 1AL8A 5D38A 3UVAA 3UXIA 1S2WA 3DFOA 4HIBA 2O92A 4E2OA 2DZPA 2VEPA 3FIGA 4O15A 3T44A 3M43A 3W3OA 4FOKA 3VCRA 1T8XA 2I16A 3PZNA 2WMFA 2BBFA 2X1SA 2O4MA 4L65A 2HE5A 1SU5A 3RAOA 1G94A 3G1DA 4BWLC 7PTDA 1KA9F 1L2QA 2NX1A 4LGXA 3BLDA 3S5ZA 5HATA 2R6OA 1K3UA 1GYNA 4TOQA 2X1IA 2X1RA 3MDUA 4RL3A 4KETA 4LQ1A 3PPHA 1P4CA 1ZZMA 2GQ3A 3ZO9A 2G3IA 2D23A 4MOZA 4MB4A 4S3DA 1G4EA 1XYLA 3ABSA 4KERA 1QT1A 3WEOA 1KFCA 1XGDA 3KOZA 4IJCA 1GG0A 3GZ3A 4OT7A 3P2VA 3FSUA 1TPEA 1R7AA 2DUXA 2OOGA 3VD9A 3AUOA 2EGZA 3PBVA 1J0KA 3FA3A 4ASTA 3T78A 1IYXA 1AD4A 3EWYA 1TQXA 4TVUA 3QN3A 3M47A 3NM1A 1VD6A 2YL9A 1S2AA 2VEFA 4JGDA 5CPTA 1Y8BA 1VYRA 3PWAA 3LHWA 3RXZA 2J88A 2GVYA 3HG5A 4TTGA 1V3HA 1SFJA 2JBMA 3M1ZA 3PZIA 4GUIA 5I79A 3DGRA 5AVNA 1RJRA 3QXBA 3QHMA 3AYTA 1QK2A 2G3NA 1SO5A 3JZUA 3B05A 3NFUA 4AHOA 2GJNA 1Q45A 2W0UA 3UJ2A 1XFBA 2XDFA 1LG2A 1DWGM 3KEHA 3PJTA 1JNDA 4DAIA 5EU9A 3L5AA 1I6NA 1IT8A 4EXBA 1GVEA 5B7ZA 3ISIX 4DYKA 2GOUA 4PH6A 2R82A 2WPBA 2OOFA 2AQVA 5EMUA 4Y7EA 2UY5A 4GGHA 1HKJA 3O9NA 1HT6A 4JTFA 4WY0F 3HG2A 2R91A 2F38A 3QSRA 2Q09A 4F40A 3TZNA 1VKFA 1WB0A 5BXPA 2E6DA 3I65A 4L9ZA 4ZBCA 3N15A 4CD7A 3DIPA 3NZGA 1V6WA 5BNKA 4QNWA 4EVZA 3L4UA 4L1WA 4O8AA 1GOWA 1E1CB 4R34A 3SGUA 1NWSA 2VGFA 3M0IA 3EB3A 2E5BA 4IUOA 2Q8ZA 3TOPA 5LGXA 4JPGA 3NNTA 3R0KA 3VXGA 1JVNA 3E0IA 3W7OA 2EJ1A 4FOUA 2PDIA 4E2DA 3G6LA 1XW8A 2Y88A 3IJLA 1LUCB 1ADDA 1RP9A 3SCRA 4CNTA 4JL2A 4B5VA 3UBPC 3KOYA 5BYWA 1POJA 2FPYA 5AECA 4IXXA 1V6UA 3BAWA 4C65A 5MKGB 4B5NA 2Y5JA 2NQ5A 2VGGA 2D69A 1KKOA 1O60A 2PBGA 3C2YA 4BY3A 1EBGA 4FI4A 1QAPA 3LMYA 3W7RA 4PEKA 3WH9A 3PC0A 3TUUA 3WNNA 1QDSA 4MFDA 2HRWA 3TJIA 1UR4A 2CZFA 3RM4A 4MUZA 2VEMA 1EA0A 3A5VA 4E4UA 3B9AA 4N9DA 2VX4A 1MFUA 1FWWA 2PD9A 2GQAA 2PE4A 1LL4A 1RZMA 1UZ4A 1AH0A 2OVLA 3WNOA 2C3ZA 4PA8A 2F6KA 4FSAA 2D0FA 2QQ6A 5A2BA 1VCFA 1WX0A 3INPA 5G2WA 4AZCA 1OC6A 4CQDA 4BJHA 2CESA 4HOZA 4MZ8A 1YQ2A 1ZPTA 4PL2A 3WLRA 2CHOA 1DWIM 3AIWA 5CG7A 2XSAA 1WDPA 5LXXA 1JD9A 1O95A 1ZJIA 4AZ6A 1Q2RA 4MAZA 1LROA 3CLWA 3EKLA 2BP1A 4QX4A 2QDDA 4DZ5A 3O63A 3DZ1A 1VZWA 2GUBA 4O50A 2YA1A 4URIA 4RV3A 3E49A 3NZ1A 3VGFA 4BCEA 1FCVA 1EQCA 2JF7A 1PVNA 3VPLA 1Q85A 1JYVA 5GVJA 1Q13A 3UU0A 1EF3A 2ZA3A 5A6TC 4PE8A 4HHHA 3HFYA 1R7OA 4UQBA 4GYPC 4JHMA 2VEGA 4PODA 3B40A 2PF8A 4ZVJA 1QFEA 3AZTA 4H9YA 2RGLA 2W66A 2PRLA 1KRCC 4H01A 3EX6A 3ALFA 2DW6A 1KO0A 2UY2A 5G4HC 3D47A 4IMDA 1F05A 3SCSA 1CENA 5L6UA 4DXKA 3AWNA 1I9CB 4G1KA 1J2WA 2PB1A 5GJMA 1WKFA 4IQEA 2EPOA 3K8MA 5E09A 3O05A 2XVNA 1T5AA 3KLKA 1PAMA 5A3HA 2JGYA 1IXPA 1JPMA 1LRNA 3VIOA 4GKTA 3U8GA 4BI6A 2NUWA 3FAXA 4C7DA 4U3CA 4TX9A 3B4YA 1JZ7A 4WR3A 5I3KA 3T8QA 1ZBWA 1E6SM 2XIBA 1XLHA 3O16A 3M5XA 4XAGA 5A6LA 2XZ9A 5IBXA 2VZVA 3P5ZA 1OZQA 3O15A 3OOQA 3KX6A 4J3XA 4JY8A 1EX1A 1FWDC 3AUJA 1J6PA 4PUKA 1TJ0A 3C0JA 4Q8TA 1XSKA 3UXLA 3S5NA 3BCFA 4WRHA 1J96A 4GVIA 3UGRA 4DJFD 2ZUSA 4KFPA 1PIIA 1M7XA 5CZTA 3QGAC 3TN6A 2F2HA 3AYVA 4IHCA 4ZE5A 3F4DA 3TYZA 4V33A 1MUWA 3OTRA 3WH8A 4EF8A 1RLCL 4JS3A 1OEPA 1REQB 1VFTA 1KM0A 1E6PA 3VE7A 3N2CA 4DF2A 2XHYA 3EOUA 2ZUTA 3RO8A 3PAOA 2ZWYA 4W9TA 4CU7A 1B30A 1DOSA 5C9UA 1NQ6A 4PUNA 1EDGA 1YXCA 1W3NA 3VTRA 3LRKA 4NXSA 4L9YA 2CBVA 2BY1A 5HMFA 3TCEA 4I9JA 4EXQA 2G3FA 2YIHA 1QNOA 1W3KA 4L4OA 3MBFA 4C6BA 2OZTA 1AFSA 4Q22A 1X1OA 1EGVA 3BLIA 4UTWA 1A0EA 1UH2A 3ECQA 3O3RA 2GJLA 1TG7A 5J5RA 2DP3A 3BVJA 1DTUA 4FNQA 3E6EA 4PSPA 1W1A1 1WPCA 4YTRA 1ZBVA 3V75A 1Q6QA 1QOXA 4W86A 3C2EA 3OYZA 1XHGA 3VAVA 2Z7KA 2WB5A 4R5EA 4JTKA 3CXOA 1M65A 3GXDA 4YYFA 4JN7A 3LM3A 2XGZA 4GG9A 4JZ5A 4AX6A 3H8AA 1WQ5A 5LGZA 4O18A 3PPGA 1LCOA 2BHYA 5E9XA 2J13A 5CGMA 2I5QA 4V1YA 3I6TA 2FFCA 3WIJA 8XIMA 2CBUA 1K4HA 4UFJA 1C92A 1QCWA 1R2TA 3L2IA 3I6EA 9CGTA 3FA5A 5EL1A 3R0UA 1M53A 4J7RA 3EPNA 3ZMRA 4A35A 1AQFA 2DZSA 4F9JA 3ARQA 1E9IA 1KFWA 2ZX8A 4YIWA 6TAAA 5JBDA 3ZOAA 2PCQA 1E0UA 1H7XA 4Z17A 3RPDA 2OSXA 4E38A 4JN6A 4M6UA 3IVTA 3A47A 4AWUA 3QPEA 5BU9A 2WXDM 4F48A 1KLZA 5AHNA 3BH4A 2QUTA 4R53A 3NUKA 2VFGA 4A8IA 1BTCA 3QFEA 3VGGA 2OEMA 4Z1CA 4KRZA 2Y7EA 5BW6A 4MWAE 1P48A 3IIOA 1D8WA 4EAMA 1Z42A 2QT3A 1TV4A 1JPIA 4JFUA 2C19A 3WBAA 3G1FA 3UR7A 2I14A 1H2JA 3PANA 2OO6A 5BXTA 4QJ3B 1CYGA 4J3WA 3NQGA 3GAYA 4E0CA 3THUA 5F2GA 2VZOA 1BSIA 1UIOA 2NLYA 3O6AA 3CMGA 4KESA 1FWRA 1PIGA 1CLXA 4UTTC 2VX7A 6ALDA 2PLMA 1HG3A 2YW4A 4XB3A 1TWSA 4PN2A 2NLIA 3EBVA 4GQ0A 1TRIA 2BG5A 1XWYA 4RPQA 3V18A 2Z1WA 3SFKA 4H04A 3L9CA 3OP2A 2A79A 4D6JA 4LH8A 2V38A 3ABRA 1MZRA 3TJLA 1JDFA 1UIPA 3NYDA 1TCDA 4Z2KA 1KGWA 4LUJA 1MRAA 1A47A 1FWFC 2QV5A 3N9KA 3V3WA 4PCPA 2KZHA 4ATDA 2ICSA 3E96A 2POZA 2F61A 3LSBA 2YX0A 1B9ZA 1ITQA 3M0JA 3BSMA 3U2ZA 2NX9A 4JTSA 3K8LA 3ZVHB 4DEFA 2OEKA 4G7EB 3OVGA 4CEXC 1CIUA 1RV8A 3DYOA 1UUMA 2QCEA 5XINA 2IPGA 2Z24A 2J27A 4O28A 4O16A 3VGHA 2AKMA 3QC3A 3AMCA 4ZOEA 3CNYA 5CPOA 5CSYA 5FEPA 4PUDA 2G37A 3O0FA 2PDFA 5I3JA 1IGWA 2D2GA 2VGIA 1V0NA 3ZQ9A 3THDA 1TPFA 3W71A 4U5IA 5C7HA 1UUQA 2OSWA 4UZUA 2YLLA 4EIVA 3L4TA 3QEZA 1GZJA 2YSWA 3LTYA 3OQ8A 2B81A 2WBGA 3W25A 2PLCA 1FY6A 4BI7A 3WK3A 2GDUA 5ABHA 4US6A 2GVEA 4YVVA 5LIYX 2QLYA 1KWGA 1CXKA 1E5JA 1W56A 1DIOA 2H9AB 3NWRA 5HQMA 3IEBA 2HNHA 1VRDA 2OQYA 1FFQA 1JCXA 7TAAA 4O0QA 4IP5A 3NQEA 4R85A 1ZQ5A 1H3GA 1KRAC 3BO9A 1VHNA 3Q58A 4FR1A 3TTYA 5HPCA 1DQUA 4JYEA 4BZYA 4BEQA 2UBPC 1S5VA 2WMGA 2VD9A 3ARYA 2PDWA 4XUYA 1BTMA 4MY1A 3QHOA 1NEYA 1XLJA 2INEA 1FWSA 3APYA 3QQ1A 4E8DA 2XVKA 2FZNA 2XFRA 1XCFA 3GXFA 1EKOA 1XRSA 4UBPC 4ES4A 4XBKA 3F5KA 3QTGA 4JYFA 3R43A 3EDJA 1PWMA 3MZNA 4CVUA 3W01A 4L5ZA 1PTGA 3QV9A 2YDSA 4MUPA 1EF2A 5FSEC 1JCTA 1I2RA 1GKRA 2J9ZA 4K8HA 1E6XM 1VAHA 3CYVA 3QLDA 1MWOA 3WNPA 1SJDA 1WE5A 3OVPA 2O9RA 4K8EA 4CD5A 4DQWA 3B97A 4WDWA 4REQB 3CQ0A 4L9XA 3S5OA 2J9XA 2YW3A 3K5XA 5I23A 1X6UA 1PDYA 3MO4A 1EOMA 2VZSA 2YBVA 1UC5A 2OEJA 2YCKX 2RHGA 4M81A 1OD8A 1RALA 1BXCA 3PTMA 4IGHA 1H60A 1ONEA 4XD4A 3WDHA 1ZS2A 4YVPA 2TPSA 3UZZA 3COTA 1DIKA 4FXSA 1P5BA 2RGMA 1S46A 4LC6A 1E6ZA 1UWIA 2VFHA 5BU6A 4IF2A 3GE7A 2QS8A 1DJHA 2WANA 3A3XA 4PTMA 3PPCA 5CG0A 3TV8A 1XISA 4BKNA 4FNTA 3TC3A 4Y9AA 4HPXA 1I60A 1H5YA 3ITTA 5HR6A 3GG7A 3IS4A 3CLMA 3QR3A 1NJJA 2PDNA 4LANA 3JU2A 3QHNA 3WMSA 1G6CA 4LY8A 3S1GA 2XFWA 3NGFA 4RV8A 4HNCA 1E1CA 2RDTA 1H7RA 1W2PA 1BG4A 1O66A 3OODA 4C1KA 3S9ZA 4HSOA 1AW1A 2QCHA 4LC8A 1XX1A 3QYQA 5A94A 5D8WA 4WJEA 1LUCA 4E5TA 4ZO8A 1MSSA 2XIIA 3TX9A 5KETA 2QCMA 1HUVA 3AS0A 4J40A 3AJ7A 2VC5A 3FHQA 3C2VA 3U2EA 5CPLA 1SQ7A 3GU2A 3OG3A 1PB0A 3IUDA 2Z7GA 3VIMA 4FLSA 3O6DA 2CERA 1F07A 3W38A 3Q67A 1RR2A 4XO6A 4X61A 1K77A 1S38A 2CXEA 1BEUA 3M6YA 3W1QA 3LHYA 3KBVA 1AUSL 1OJXA 3AXMA 4QLJA 1JCNA 3S1XA 4ORIA 4FLOA 1QNVA 4R33A 3E0VA 2V63A 3HQNA 5FEXA 4WSHA 1XH2A 1JCMP 2DUZA 4GA8A 1MRQA 3MKCA 5SWUA 4ERAA 3BG5A 4PB4A 3MSGA 4B3LA 5HWMA 1UWTA 4YXGA 3WD2A 3AMGA 3G0XA 2JALA 2V2HA 2ZUNA 3VKDA 1GVSA 5HMEA 1TTJA 4PMOA 3IVUA 4UFIA 3B0PA 4U5KA 3S2JA 1A5AA 3EDEA 3G24A 5C6MA 4HNNA 1GYMA 1EGMA 4FX6M 4D9PA 3E2VA 4R7OA 4AAJA 3LN3A 4O54A 1BD0A 4HU8A 2CITA 4QDMA 3HGJA 4KEUA 5U4NA 1DWFM 1LYXA 3HZ3A 3WF2A 2ISVA 4E4FA 3L65A 1C7TA 3GHUA 3LXCA 3OGRA 1PXGA 4M1BA 5BOEA 1KD0A 2DUAA 1TVLA 1GK8A 3WQ6A 2QUNA 5LA1A 3W1UA 4AD4A 2OQHA 3TTEA 5BRQA 4EE9A 4KQNA 5A5WA 3LZ5A 3CM4A 2RH9A 3WLPA 4J27A 2HPIA 1OX4B 3BLLA 3DH7A 4WDUA 1OFRA 1H7OA 3J7HA 4M5PA 1GG1A 3DENA 1OZMA 3TYCA 2QCLA 1IE7C 3WEZA 2P50A 3CAWA 3KTXA 1UPMB 2Z1XA 1RBOB 1CCWB 3SUUA 3WELA 4GZ7A 1H7WA 4HNVA 2X7WA 1JZ5A 3C0QA 4PMVA 2PDPA 2OZ0A 4P7QA 4XVEA 3AMLA 4JEJA 3DYMA 4HMCA 3AMKA 2WKGA 4WK9A 2EG6A 4L1XA 1KBLA 5D2YA 3BURA 4E6MA 1RQBA 3TTOA 1S5MA 4O17A 5D2TA 4PC8A 2V5BA 2G0WA 1EX5A 2POTA 3DBPA 1A53A 3QF0A 3ZS4A 3EWBX 1OIFA 2A4AA 3TSBA 3K1GA 4CN4A 4I8DA 7A3HA 4L56A 1TUXA 3DC0A 5LNWA 2G50A 4Q7NA 3SBFA 3N11A 1EJUC 3U0HA 4DWSC 5A6AA 2XIMA 3THCA 4LF1A 4J3UA 2O56A 4TTUA 1QPRA 5KMYA 3L66A 4N0RA 1DJQA 3HG3A 5DY2A 1OFBA 1ISXA 4LUTB 5EGRA 5I24A 1UP3A 1BF2A 3C86A 3W74A 3OHIA 3UR8A 3B0XA 3L68A 3RMEA 1VFLA 4LAUA 5EBUA 5HDRA 1TV3A 5BOOA 3WBWA 1J4EA 1XC6A 2VD8A 2A3AA 2B4GA 3H2AA 3LB0A 1REQA 4MYXA 5HXMA 1SW7A 3VMPA 1UH4A 1B5TA 3MP4A 1RPKA 2C71A 2X1TA 4ZGYA 1XRVA 5E1QA 1E51A 4NYUA 4H7VA 4OUEA 1PZ3A 5H8PA 3POHA 1LRQA 2ZX6A 3VE9A 5E0KA 1QNQA 1SO4A 1P43A 1S2VA 3B8SA 1U30A 2BNJA 1WKEA 1SFTA 3BMVA 1YX1A 4UTLA 1O5QA 1TVNA 2R24A 3WF3A 5G2IA 1U33A 1ZJAA 1FWIC 4NSBA 3DFNA 4DUOA 4YLWA 4AZBA 2ZVIA 3CHDA 6PTDA 4ATLA 4X2RA 4YHEA 1B2YA 1HJWA 3EWCA 4MB1A 1BWVA 3HPXA 3K46A 3EOEA 4W93A 1X7FA 3JVAA 1P0DA 5AC7A 4F0SA 5AHFA 4NKCA 2PRHA 3P84A 2VCCA 1XH0A 1V77A 4XZ9A 2I9EA 1KBBA 4AH7A 5GNZA 1S3HA 1JYNA 4JNYA 1YNYA 3NAVA 4Y9MA 4NZFA 1WCGA 1L8PA 5DBTA 4JAWA 3KL3A 1W3JA 3UZJA 5D9OA 3MANA 3VILA 3G0SA 1S5WA 2EKCA 4GX8A 1PHQA 3PS7A 4AXKA 2NQJA 5IFPA 3WJSA 4GH3A 3BARA 2GFTA 1EZWA 4NZ3A 3T09A 3CC1A 4GACA 5I02A 2FB2A 1EDQA 3CMFA 3D3AA 1VEMA 4ICNA 4D6CA 1AW2A 1YDYA 1XLBA 2OB3A 3KTCA 5I3HA 4NY2A 4HA3A 1XG3A 2V3DA 1IGSA 2KAUC 3F5LA 3P8JA 4MWAB 1PKLA 3WZ0E 1FH7A 4X9YA 1A5BA 3S2LA 2ZE0A 1YIXA 4DJEC 3ES7A 4GVGA 2GQ8A 2D2JA 2W27A 4YWSA 1GW1A 3IK2A 2Z1SA 1FTXA 4H1ZA 3QY8A 3CAKA 5H91A 1Q6FA 1Z3NA 4QDPA 1KW1A 3G18A 2HDJA 4M80A 2OZ3A 3DKJA 1LRTA 1I8JA 4JTJA 4U28A 3USZA 1KM1A 4RXGA 3C8FA 3ZT5A 3ZYZA 9RUBA 1X1ZA 5DCEA 4N6EA 2CFFA 3PAJA 2NWSA 1XLLA 3DN5A 1VBRA 1X97A 2HVNA 3GVVA 3W7CA 3LQGA 4ZSUA 2NV1A 3SCOA 5CC6A 3LXBA 1K6AA 3GC5A 2WNQA 3QZAA 2QJIA 2E5CA 3WLSA 2YYTA 3WLNA 3BMWA 1S2CA 1TV2A 3WO8A 3S9YA 2OELA 4C6DA 4G7EA 1W1ZA 4JYDA 1J18A 5D9PA 3T55A 1WDRA 3P0WA 4WHBA 4XZHA 3SUWA 3EYPA 4Y9OA 3VU2A 2OFJA 4NP7A 1QOPA 1XDLA 4IQJA 1V3MA 2H6RA 5ABFA 1GOKA 4EANA 1BG9A 3BLOA 4J28A 2VMFA 3W1LA 3EWUA 2A5HA 4GUGA 1ZAHA 2D3LA 2XGBA 5CKSA 4GZJA 1A4LA 3MUZ1 3M4HA 1UR0A 3MHUA 1KFBA 2NQLA 1EPXA 4LOCA 3A21A 5A8NA 1F61A 3W7IA 2G41A 1EO7A 3CV2A 1XIHA 3PUDA 1HKVA 1KTCA 2VQTA 2VDIA 2DDXA 3AO0A 5LNRA 4UUIA 5JUVA 4ADUA 1HXJA 1AK5A 1LT8A 3R2GA 2PWHA 2C16A 1J11A 3N9SA 1HKWA 2DZVA 3T0BA 1HJQA 1TUFA 4BS0A 2V2CA 4YCPA 3U3HA 2E1WA 4AD2A 5BRPA 1TMLA 4PTVA 2H9AA