5EL1A

Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
248
structure length
248
Chain Sequence
DLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARETLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAWGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Deoxyribose-phosphate aldolase
publication title Mechanism-based inhibition of an aldolase at high concentrations of its natural substrate acetaldehyde: structural insights and protective strategies.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 105
structure length 248
sequence length 248
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5el1A00
3BW2A 5F2LA 4X9SA 3LLDA 2ZRUA 4XZ9A 4LNYA 3EWUA 4DBDA 1W1ZA 1WYIA 5BRBA 4GNJA 4RKAA 3VE7A 3DKJA 4JTLA 4U4MA 5KZMA 4IMFA 1NFBA 3LCXA 1SZFA 3W2NA 1IXQA 1P0NA 3PBUA 2YSWA 1XKYA 3RLUA 3LCHA 4DF2A 4BK9A 2R94A 1ZY9A 4KFPA 1SFJA 5C54A 1TPWA 3LHZA 3ABQA 2BTMA 4BF9A 4ZQOA 1GQNA 2AQWA 3BLIA 2RFGA 2J24A 4QITA 4NX0A 3W1LA 2Q8LA 2Y88A 4PH6A 3SR7A 5HWJA 2FB2A 1JQVA 1EIXA 4MOZA 1SU5A 3B03A 3DU0A 4IPJA 3LXBA 3LTPA 1UASA 5D09A 2VEIA 1W5NA 4RZ4A 3DFPA 5E0KA 1QPRA 1G6CA 2EPHA 1M6JA 1MSSA 3MBFA 5HR7A 4RXFA 3KHJA 1LDCA 4QAIA 1W5PA 4HNNA 6TIMA 4MLRA 1YADA 4N9CA 4Q33A 5IM51 3F4WA 4G1KA 3AJXA 2OJPA 3BK0A 1QOPA 4QISA 4IGHA 3SY5A 3FJLA 5G1YA 4RV8A 2QR6A 3LXAA 4ZQRA 2CLIA 1ME7A 3TSBA 2WNQA 5A5WA 1G4SA 3NO5A 2G95A 1VZWA 2PRMA 4LUJA 4CNOA 3FKKA 4HIBA 1SO4A 2V9DA 3NG3A 5CZSA 3NXFA 1Q6RA 3V75A 3IGSA 4GRSA 1GWJA 4S2CA 1NF7A 1VS1A 1GT8A 4RCXA 2PE4A 3KFTA 3GYEA 3CT7A 3FS2A 3S5YA 4LS0A 1LROA 4HNTA 3LOTA 5EY5A 1MEHA 1N55A 4ML9A 3NDOA 1ZFJA 3QEZA 3C56A 3KRZA 3FA5A 3G8RA 1R2SA 4I7UA 3UXDA 2J88A 4FXSA 3TX9A 4TMCA 4ZQNA 5K9XA 2VC6A 4XKYB 3HPZA 1KFCA 4FNSA 1O60A 3TAKA 1LZOA 1FCVA 3EXTA 2WV8A 1JRBA 1OG0A 1MEIA 1ZCOA 4BI6A 2OT0A 1LORA 3W7CA 4O1CA 3W7EA 1TIMA 5F1VA 2H8ZA 1TPDA 3INPA 1D3HA 5HULA 3HG4A 4GXMA 3OIXA 1GPWA 3TROA 2E6FA 1VC4A 1F6KA 7TIMA 3Q37A 4R33A 3M5XA 1O5KA 5F4SA 5G2IA 4EIVA 3GNNA 4FX7A 2BX7A 3GXPA 3C2VA 1P5BA 4LV9A 4UMBA 3DFTA 4O52A 2G97A 4TR9A 1VCFA 1J4EA 3B0PA 5U7SA 1NVMA 1SZGA 2CZEA 2CLLA 4HPJA 4O10A 3R5EA 2F7FA 3C2RA 1SO3A 5K4ZA 4LS2A 3NPXA 1MEWA 2BLEA 3CB8A 2YW3A 1DVJA 2FPVA 1H1YA 4CQAA 3W2JA 2DZUA 3EEGA 1KM4A 4QQ3A 1L6YA 1XBYA 4WUIA 4Z0SA 4YL2A 1H61A 4O18A 1GTEA 1FWSA 1X8FA 2A6LA 3C2OA 1ZENA 4NQ1A 1HO4A 4LRSA 4NNBA 2ALDA 4OWGA 1KBJA 1TMHA 3PUOA 1H62A 2CZDA 3O05A 5G5IA 3QSRA 3L0GA 3VKJA 1SW7A 2CU0A 3O8AA 4QJ1A 3QZEA 4WJEA 3DBPA 3L5AA 2VEPA 3LX9A 3Q58A 4LW7A 1RPXA 4ZVJA 1TTJA 5BW6A 2FDSA 4UFHA 3LCGA 4JD4A 3PBYA 3LCFA 1ZAHA 3QQ0A 3UY8A 1G69A 2GUUA 1OYCA 3E49A 1KM0A 4UMAA 3GAYA 4POCA 5HNRA 3TJXA 5KTLA 3QJAA 4JR5A 1ICQA 3NQAA 1EA0A 2WSQA 4DBEA 2ZTJA 2QCNA 4XTIA 4JXCA 2VFDA 3N14A 2CZ5A 1H5YA 1OFAA 1I2RA 4O1DA 2I9EA 3L0KA 3RMJA 1UUOA 5CPNA 3IIOA 1M7PA 3P80A 3W83A 4YXGA 1F6PA 3G1SA 4TX9A 1W56A 3MBDA 1ZALA 4DPQA 2QCFA 3BW3A 2JGYA 1E51A 4HSOA 1WOAA 3C2FA 3QH2A 3HQ1A 3FIGA 5AHLA 4FXRA 3NPVA 1KFJA 1KTBA 4JY9A 1TTQA 3HOJA 2DU2A 5KITA 4FNPA 4JEQA 2ZBTA 4Z1CA 1QMLA 4FNUA 5HUPA 3L5LA 3DZ1A 3M9YA 4M6PA 1Z48A 1WOBA 2NZLA 3A5FA 3DENA 5J5RA 1JR1A 1G67A 3HPXA 2FPTA 1QPQA 3M7WA 3U6WA 3CWOX 5TQLA 4O0KA 5EBUA 1R30A 1T0OA 2ZCGA 5LNUA 1BWKA 5EYWA 1I2NA 1LRNA 4DF1A 4NJJA 5LNWA 4WY0B 3TNOA 2ZRXA 4YCOA 2GPTA 4AHQA 1G4PA 1M7OA 3CEUA 4O13A 2G96A 3IGXA 5AYZA 3MP4A 5LNVA 1F74A 1KLYA 1ZNNA 4EWND 3NQ2A 4GUGA 1FWTA 4K36A 3TUUA 4FF7A 1H7OA 2CLOA 4O1BA 4QM1A 4O0ZA 4AF0A 2A21A 1GEQA 2VFIA 1LP6A 2NUXA 5CSSA 4IX2A 3TC7A 5BMWA 2YW4A 4TU1A 2YGYA 4JNMA 4E0CA 5AYXA 1YTKA 4MJZA 2QEZA 2FJKA 2QF7A 3P67A 3W7GA 1W3NA 2C6QA 4O57A 3PSVA 5CSRA 1BKSA 3CIWA 2QJGA 2JK2A 1XDLA 1M5WA 1TRDA 4LT9A 5L9FA 1KM3A 1VH7A 3HMJG 3TK7A 1S5VA 1J2WA 3HGOA 1L6SA 3IIZA 3THQA 3U8GA 4NU7A 4PA8A 2BZNA 4IWWA 3UQNA 5F1UA 3I6RA 4WQ6A 3TV8A 3PG9A 1F5ZA 4UC5A 4AMAA 3NM1A 3I7QA 2C14A 4JTHA 1C29A 3Q94A 3QFEA 4MY8A 1FDYA 2YZRA 1G4TA 1K02A 2PRLA 1OYAA 4MVAA 4N4QA 4IX0A 2HS6A 1O95A 4CCCA 3S8HA 3BGJA 2DZTA 2QCGA 3FOKA 1KV5A 3MYPA 1XXXA 1FBAA 1OX4A 1ADOA 1R47A 3LHWA 4N6FA 1W37A 3W71A 1CX9A 1FQ0A 5FEXA 3THAA 4I9AA 5HR6A 5AYYA 1F2JA 1HUVA 4Y90A 1YXYA 2YYTA 4RJEA 1KBIA 1DORA 1LOLA 1QR7A 4ZQCA 4DELA 2A7NA 1X1ZA 2DJXA 4JTEA 5E93A 2GJLA 3W73A 4OHQA 1YTDA 2GQAA 3VI2A 3NA8A 3UZJA 4N9DA 4AH7A 1H7PA 4LC6A 4MIMA 2WKJA 1Y0EA 1IIGA 4GUIA 4AXKA 5EKYA 1LBLA 3KAOA 2UV8G 3P8JA 3WK1A 2VENA 1GJPA 1OJXA 2QUTA 3CPRA 2Y7EA 1VQTA 3G1DA 3UWWA 1H1ZA 4IXXA 4ZL1A 2BWGA 2ZRVA 1GG1A 1QAPA 3R2GA 3W7KA 1P1XA 4IMDA 3DHFA 1GZGA 3H54A 3NL2A 3QM3A 4UIOA 1LCOA 2ZDRA 4CCDA 3DAQA 3W23A 1I45A 2DZSA 1TREA 1S5TA 4J9JA 1IGSA 3W2MA 1AW5A 2V82A 2ZZ3A 3OVPA 3PF3A 5HJLA 4W9TA 2YDAA 3PUEA 2VFGA 5A8GA 5AC8A 1PHWA 3LCIA 2A5HA 2A7PA 2Z6IA 1C8VA 3PR2A 3W3OA 3TQ0A 5K3VA 1LBMA 5MHBA 3SIZA 5FF7A 3BARA 2NV2A 1EP1A 1PE1A 2RHGA 1AL8A 3IIPA 3NR0A 5FF2A 1TTPA 2Y63A 1X6UA 3N9RA 4AHPA 3MWAA 5LKYA 2RDTA 3HGJA 1LBFA 4ZQMA 1PIIA 1G7VA 4IPIA 1KFEA 3PC0A 3UWVA 1MXSA 3N2XA 2QKFA 1EB3A 3JS3A 3W7PA 2TRSA 4K37A 1DHPA 3B0VC 4MUZA 3B05A 1B57A 4FNQA 5CZ0A 1DQWA 2VELA 3O6YX 1VJIA 3GLCA 4HT3A 3LRKA 1I4NA 1WDWA 3WK3A 3C3NA 5TIMA 1K8ZA 3WFAA 1JCMP 3UYCA 1TPC1 2CWNA 3BLFA 4UFMA 2Y62A 3SGZA 5HWMA 4R53A 3MP5A 2JGQA 3VNDA 1G4EA 3MUXA 3NZ1A 3KXQA 3N34A 4AVFA 3OG3A 1A53A 1O94A 4RZ5A 5FF4A 1IXOA 1Z44A 5HINA 3O07A 2GQ9A 3L9CA 2V81A 2VFFA 3P60A 3GXTA 3LHYA 4ZQPA 4LY8A 3GZ3A 2KZHA 4AWSA 1HO1A 3O6CA 3PG8A 1TJPA 3JR2A 5C55A 5DXXA 3EX2A 2ATSA 1DV7A 3W1TA 3LTSA 4Q4KA 4LC8A 2Z1BA 1YPIA 3ZWTA 5LNRA 1WV2A 4E2DA 2CLHA 5LGXA 4FEZA 1NAL1 5I3IA 3M5YA 3NL6A 1EPXA 5F4XA 5DN1A 3H53A 3QMTA 2VEKA 4JTJA 5IBXC 4MZ8A 2NX1A 3W1QA 3W7QA 4KKXA 2NXHA 3CHVA 1TSIA 1JUKA 2A1YA 2E5CA 3B8DA 5D03A 1VYPX 3L5MA 3PVFA 3LBCA 1OX5A 3G24A 2EKCA 5D32A 2WOQA 3HBLA 3W7DA 5KMYA 1H7NA 3SFKA 3ABRA 3G0XA 3DHDA 1RZMA 3F03K 3QYQA 4UTTC 4DEFA 5AHMA 2GVLA 5BNKA 3G1AA 4JYFA 2B4GA 1SQ7A 5AC7A 3SW6A 1IIHA 2Y61A 3EXSA 4Z1BA 5DXYA 3OEXA 4FB7A 2VKZG 3EX3A 1AW2A 3N19B 2X1RA 1W5QA 5D2XA 3NQDA 2Y85A 4WXYA 4WXZA 3DI0A 3NPWA 5U4NA 2NXGA 2WNZA 3NQ8A 3KVLA 4UFIA 1ZHAA 4OBTA 3I7RA 5FEZA 3W70A 1K03A 3CU2A 3TAOA 4LVDA 3G1HA 1JJKA 3NQEA 5IBXA 3E96A 3WJSA 1TQXA 2X1UA 1UB3A 3RFAA 3IIVA 4NUWA 3NAVA 1TB3A 5EL1A 1L6WA 1Z41A 3LTYA 3GB6A 1RQHA 4WOZA 1BWLA 1VPXA 4FHAA 2VFHA 4NXSA 2V2CA 3STGA 3W87A 1JCNA 4JTSA 4DO5A 1D3GA 3O6DA 4UTTA 4EF9A 5DCBA 1H63A 4PCFA 1SO6A 3HGSA 2XN0A 1GVOA 2QJHA 2ZTKA 3M47A 2FTPA 4QIUA 4NXKA 3W7LA 3ZFHA 2HS8A 3MYOA 1TPH1 1WBJA 1QDSA 3GR8A 1QOQA 4N2YA 3NOEA 5LHEA 2DP3A 1YDVA 1JVNA 5K7JA 1XFBA 3HG3A 3P8IA 4BWLC 3NQ7A 2QDGA 4FNRA 5D38A 1T96A 1TJRA 3GDTA 1SR9A 3O1NA 3G18A 3QPZA 1F73A 1W31A 3NM3A 4AEOA 1AK5A 2F84A 3S1XA 2PURA 2EHHA 1KM2A 3LHTA 4QSHA 5DY3A 1WA3A 2ABBA 2YCEA 5I3FA 3W85A 3B04A 3LRMA 2WNNA 3PULA 4UNKA 1TYGA 4AWUA 1TPB1 1K7XA 3PUDA 3NL5A 3SECA 2E68A 1OFEA 3BG5A 2YPIA 1TV8A 3NNTA 4LVBA 2E5DA 4ORMA 3W7OA 3GR7A 3NZRA 5LNSA 1VRDA 2B7QA 1GOXA 2QCDA 3QW4B 3RLVA 4PL2A 1R2RA 5CGQA 2Y7GA 1FWWA 1OHLA 5D05A 5AC6A 3O06A 5K9CA 3L68A 2OT1A 3HJZA 4JX6A 1DJNA 3QC3A 4UTJA 3SJ3A 2CFFA 3L65A 3FYPA 4BWLA 2Q3OA 1H7RA 4UXDA 1QNVA 1RD5A 3E02A 3G1XA 3NQGA 3W7NA 3NVTA 3MI3A 3MMTA 4Z08A 5CG7A 4EF8A 2GQ8A 3EWBX 3TA6A 2OMAA 3PSWA 3NYZA 3MHUA 4EVZA 4N9EA 4A3UA 2LLEA 4FO4A 4WY0A 3QF0A 1XUZA 2B0MA 3UD6A 2OZ0A 5C6MA 3RU6A 4XTDA 3R89A 4O54A 3BW4A 4JN6A 1W3IA 1FDJA 3ANYA 4LS1A 1Q6LA 4B5NA 6ALDA 1I2OA 4NJHA 5K4XA 3F4NA 4H4IA 1T99A 3NQCA 5I3HA 4K39A 4N6EA 4I7WA 3BVJA 3M16A 2WO5A 2XN2A 2VXNA 5FEWA 3PM6A 4MZ1A 4GJ1A 3T4CA 1B3OA 1B4EA 2DJLA 2WPBA 3NGJA 5AHFA 5I3GA 1PS9A 1OABA 1QPOA 3NQ6A 1ICPA 5K9DA 1VHNA 4JX4A 3G1VA 3OBKA 3P82A 3STEA 2DZWA 3P84A 3DI1A 3VCRA 2C3ZA 4XWUA 4MJMA 1CW2A 3IIXA 2BXVA 1KFKA 4ZZ9A 1QO5A 1PL9A 2NUYA 1SZEA 2V0TA 3BPWA 4XBSA 1TPEA 2ZYFA 4Z0JA 3T78A 1KV8A 1B4KA 1UJPA 3QW3A 5D2WA 1IXPA 3ZS4A 1YYAA 1JCXA 3UWYA 1SSGA 1GVRA 4I7VA 2OCZA 4UFLA 4JYEA 3W1RA 1OFBA 1LLWA 4XUGA 2Y89A 2YFNA 3I68A 5E1QA 4O11A 3W1AA 1IF2A 4C1LA 3EWZA 5G4WA 3TFCA 1WX0A 2H90A 3W1UA 2ZRYA 3VE9A 1FCQA 1W8SA 3ATZA 1RR2A 4L4MA 2A7RA 4GWEA 1RQEA 1JCJA 2ZZ6A 3T44A 3UWZA 2P0OA 4YLWA 5DBUA 3QMSA 1DQXA 4FX6M 1EX5A 3CIXA 3D0CA 2GJNA 2EF9A 3LERA 1AW1A 4RLIA 4GE8A 4ADUA 3DGRA 3N2MA 3EXRA 3IGUA 2QCHA 3DFQA 5HQEA 3W6YA 5DCDA 4CNNA 2RDWA 3E9AA 3P5ZA 1TPFA 1SW0A 1FX6A 2ISSA 4PL1A 1XDMA 2DZVA 4Z1DA 5LZLA 1PCWA 1XI3A 4UUIA 5D2YA 5KZDA 3SGUA 2NV1A 4PEKA 4TIMA 1HTIA 1K8XA 2ZZ1A 2JKPA 4GUHA 2ZA2A 2E6AA 1XBZA 3LCLA 5D33A 1GYNA 4H6KA 2JKEA 1KTNA 2RDUA 3G0UA 3N9SA 3NL3A 4E38A 1QFEA 3LB0A 4S2BA 4RXGA 2R91A 3TMQA 4AAJA 2QAFA 1OFPA 1TV7A 3M41A 3T55A 2NUWA 3STCA 3TQKA 2X16A 5F2IA 3SI9A 5AN7A 5LHFA 3HF3A 1A5CA 3GDLA 1QO2A 1YDNA 4JGDA 1OF6A 3FLUA 3A5VA 5HWNA 3WJXA 3CLMA 2VFEA 3C52A 5CZJA 1GTHA 2ZZ2A 2QCMA 4LRTA 2H6RA 1TRIA 4WY0F 3S42A 5FI8A 3MO7A 5F4WA 3TIMA 3H55A 1J5TA 3W7IA 3TDFA 3S6DA 5F2GA 3K30A 4Z1AA 3C4UA 3VFLA 3G0SA 3IVUA 2A4AA 4MY9A 3W22A 2ZZ7A 5BMXA 1KW1A 2EGZA 4BI7A 3DXIA 5CKSA 3QRHA 3EWYA 3KVJA 3B0UX 1K7EA 2OX1A 3C8FA 4KFNA 3KRSA 1WQ5A 2J9XA 2CZFA 2E1DA 3CEPA 3PBVA 2V5LA 3OHIA 3W1MA 3TXZA 5F2MA 3RNDA 4O4WA 3T40A 2CLEA 3LCWA 1H51A 4N4PA 1Q45A 4RK8A 3IVTA 4JDYA 1DKWA 4UFJA 4JY8A 3L66A 3SSJA 4JX5A 4O50A 5T26A 3W2UA 3M43A 3L2IA 3TXVA 4JYDA 2H3BA 3MHGA 1ICSA 1YXDA 1XM3A 4JTTA 3GVGA 2O7QA 4JTIA 5D2TA 3S5NA 4NZFA 2A6NA 3HIJA 1IXNA 2Y7DA 1V7YA 4NNCA 1A50A 1DBTA 1EEPA 2WSRA 4RZ6A 4LU0A 1OX4B 2C18A 1DJQA 3TE9A 3QQ1A 1XUUA 1PVNA 4RX0A 3TC6A 1EUAA 3O16A 4AHOA 4NX5A 3PB0A 1B9BA 4D2JA 3WK2A 3QMRA 3V1PA 3Q2DA 4KFOA 2QJIA 1S3HA 4UTIA 5HUOA 2E77A 1VCGA 3W07A 1OFRA 1OFQA 4LTSA 3UY7A 4QNEA 4O53A 4R7JA 3U2OA 3FJ6A 4WOQA 1YXCA 4LVGA 2WSYA 3LI0A 2C0AA 4NVTA 2J6XA 3CC1A 3HG5A 4JTKA 3B4UA 4UFKA 3M5ZA 3L21A 1DL3A 3MHFA 1LOQA 1VYRA 5H2ZA 4JS3A 1H7WA 2XN1A 1JCYA 2X2GA 4A2SA 3TCEA 1JUEA 4PC8A 4ORIA 3P5YA 5FF0A 3C6CA 5CZTA 3P62A 1A5AA 2Z0IA 2PCQA 2WJZA 2Y6ZA 1FUYA 1VYSX 1U5JA 4N02A 5FESA 4OQVA 4PTNA 1FXQA 1GVQA 4OT7A 1UBSA 1X7FA 3DFSA 3I7SA 3O15A 4LVFA 4WD0A 1GVFA 2NX3A 5CPOA 1FDZA 3M44A 2ISWA 4UTUA 4ICNA 3QPYA 3BG3A 1GVSA 3BO9A 4JIPA 4K7YA 5DBTA 1WXJA 1JUBA 3IV3A 1EP3A 1OK6A 3S9YA 3G22A 3YPIA 4KWVA 3NPUA 4HNVA 1LM1A 4MKNA 2YXGA 4IMEA 1XCFA 5EA9A 1ZJIA 1KA9F 2CLMA 1LRTA 1FWNA 1OFOA 4IMGA 3PBWA 3S1VA 1MO0A 4ADTA 5EPDA 3HGRA 3IVSA 2Z2UA 4IOTA 1KFLA 3WK0A 4MYXA 4DPPA 4XKYA 2YYUA 3ABSA 1NSJA 3PS7A 3OVQA 1W0MA 2GOUA 4IMCA 2TSYA 2VEMA 3A24A 3F1QA 1GYLA 1OVDA 5AFDA 4BR1A 2GVGA 2RH9A 4ZMGA 1N7KA 1F05A 1JRCA 4KWWA 4TO8A 3T7VA 3W75A 4X3ZA 4A2RA 1JQXA 3HG2A 3GK0A 3S1WA 2V30A 2W6RA 4FIRA 4DXVA 4ALDA 3E0IA 3DFNA 3LV6A 3UPBA 3TR2A 3GAKA 4OV9A 3BG9A 3TKFA 5EMUA 3GX9A 1L9WA 4GBUA 4LOCA 2P1FA 3TMLA 1OFDA 4O1AA 4UR8A 4XBKA 4UTWC 1TPVA 3S5OA 5D37A 1PHQA 4OGZA 3KRUA 3G1YA 4MY1A 4XQ6A 1TO3A 2A85A 2DZXA 3BLEA 1O4UA 1I8JA 4CQ9A 4CQ8A 2ZA3A 1UCWA 2YR1A 3E12A 5G1TA 1SFLA 1QWGA 3CWNA 2GVJA 1XC4A 4DQWA 1LOSA 1VHCA 5DELA 2I14A 4UCGA 1ALDA 2IQTA 3MW7A 3EX1A 3L0NA 3M6YA 3W72A 2B7NA 4NZJA 5C2XA 3W7RA 4M5PA 4Y9AA 3C0JA 3EWXA 1LLZA 3UZ5A 1RQBA 5D30A 3ZWSA 3BV4A 1EWDA 4FX8A 1DOSA 3W1PA 2B7OA 4UTHA 2TYSA 2C19A 1SUXA 2TPSA 4O16A 1FCUA 4HPXA 1RVGA 3A23A 1XBXA 2YX0A 4C1KA 5G4EA 1K7FA 2P10A 3DKLA 1A5SA 4UTWA 1R2TA 4AB4A 3ELFA 1EP2A 3S1UA 3LHVA 1V5XA 3RF9A 1YDOA 1GG0A 4N9BA 4M19A 3W7JA 1W5OA 4OV4A 2NWSA 5FF3A 4JTUA 4A29A 3TW6A 4AWTA 1FY6A 1EUNA 1KLZA 3EB2A 3QSTA 3CTLA 3EKLA 4WZHA 3KVKA 4RR4A 4M6VA 5LSMA 4HHPA 3LRLA 1JCLA 1UUMA 5AHIA 1AG1O 1OK4A 4LUIA 5DY2A 4TMBA 2C16A 4K38A 3TH6A 2E09A 3L67A 3LBMA 1THFD 4FIQA 3RK8A 4O17A 3IEBA 2ABAA 1JULA 2DZPA 3LGEA 3GXNA 3CM4A 3STFA 3M5VA 2FB3A 2DORA 1NEYA 1Z42A 4GUJA 1ZAIA 3G3DA 5DCEA 3TW7A 2ZFAA 4PODA 2Q8ZA 3B06A 2ZRZA 4Y6GA 5KZEA 1YPFA 4O15A 3G3MA 4CLMA 4HN4A 3R12A 1BTMA 2W79A 3PY2A 4E2BA 2V2DA 2E6YA 1ML1A 2QCEA 1AMKA 1P4CA 1FCBA 3KX6A 2NWRA 3FEMA 4ONVA 3OA3A 3WJZA 2H8XA 1W5MA 2XFWA 3MP3A 3LLFA 5G2WA 4OU1A 3HO8A 3W7HA 1T8XA 3S5ZA 1Q6OA 1YTEA 3EX4A 1TTIA 4IQLA 3W2KA 2A0NA 4BFAA 4QNWA 3UWUA 5DLCA 3FFSA 1L2UA 4M7TA 1U83A 3I65A 4GFSA 2E5BA 1XBVA 3M0ZA 2CLKA 5TBOA 2ISVA 3W1XA 1HG3A 4HKPA 1SSDA 4MFDA 2B7PA 4MZYA 2H3DA 4K8EA 1SO5A 2Y7FA 1H7XA 4GC4A 4UNLA 2Q3RA 3LHUA 1ONRA 3TQVA 3TSDA 2QCDB 2D73A 4K7VA 1FWRA 5J5DA 2RKXA 2R8WA 1R46A 5D02A 3NQVA 4CNPA 2NXIA 3OVRA 1F7BA 4O14A 5KINA 4Y8FA 4HNUA 2HSAA 1F76A 1W3TA 4IXHA 4NT0A 3KOFA 1W54A 1VLIA 3GIYA 2QUVA 3WJYA 5L6UA 2CLFA 1D9EA 2A2IA 3R13A 5AHNA 3AO0A 2QDHA 2PRHA 1ME8A 3ATYA 5C5YA 5CPMA 3GDMA 3P74A 4LWWA 3W2LA 1HFBA 1TQJA 1OYBA 3ZR4A 4X2RA 3A9IA 1SW3A 4UR7A 5SWUA 2X30A 5BOOA 3FKRA 3W76A 1VLWA 2O7SA 3MI2A 2JKAA 5I3KA 1LRQA 4ADSA 1Q6QA 3PB2A 3GNDA 1I2QA 4LV4A 4JDBA 3UXAA 4L4LA 5ABTA 2V8ZA 2I1OA 3C2EA 1RV8A 4DO4A 4OE7A 1OF8A 1PV8A 3BGGA 1S5WA 4P2VA 1O5XA 4K6AA 4M7SA 2ZZ4A 2E6DA 4FNTA 4MPQA 2C1HA 4JTFA 2X1SA 5CPLA 4WX2A 5D04C 5AOUA 3TSMA 4CCEA 2VOMA 4BI5A 3P61A 1QPNA 5I3JA 2J27A 8TIMA 3W84A 3FYOA 4JICA 3GKAA 2J9YA 2EAWA 2C13A 4YMZA 2CW6A 3TJLA 3A21A 1VCVA 4LVAA 1KM1A 5H91A 2FLIA 1SPQA 4Y96A 5AB3A 3G1FA 2HTMA 4X22A 4A21A 2WQPA 1I2PA 2J9ZA 5LGZA 4DF0A 4HSNA 1PCKA 3S0CA 3MJYA 4MFEA 3UWQA 2QCLA 3W86A 1XL9A 1HL2A 2C15A 4O8RA 2YFOA 2AGKA 4AF0B 3DFOA 2ZQ0A 1NF0A 2FQIA 4O4VA 3LXCA 3W7MA 5HMSA 2NX9A 3UPWA 3HPSA 5KSWA 4YCPA 1H60A 4H3DA 3EWWA 2Y70A 2Z6JA 3N3MA 3W88A 3W74A 1EWEA 1ME9A 2ZA1A 1KTCA 1C9DA 4DO6A 2QCCA 1X1OA 1YLVA 3LI1A 4O12A 2HMCA 3EX6A 3JRKA 1A5BA 3ABOA 1H50A 1TPUA 1K8YA 3R8RA 3P81A 3W1NA 4S1FA 3HB9A 2ATMA 4PFMA 4A22A 3LV5A 2V2HA 2ZRWA 4O28A 2FFCA 1FXPA 1KM6A 4NJGA 1WBHA 3EKZA 3USBA 1N8FA 3LM7A 3O63A 4Q32A 3IRDA 4IUOA 1MZHA 2G5WA 3C61A 3W9ZA 1QCWA 2X1TA 1P0KA 1LTDA 2ZZ5A 3PAJA 4R34A 1WAUA 2W0UA 3P7YA 5D2VA 1VR6A 3NQFA 3GKFA 3GDRA 1K3UA 4IJBA 4UTKA 1G7UA 5FEPA 2AAMA 3TFXA 1SZNA 1Q3NA 1KM5A 3CQ0A 3PWAA 3UNDA 1TV5A 3DH7A 5GVJA 1BEUA 4YWIA 4MLJA 2FPYA 3WJWA 1TCDA 2R14A 1LYXA 4NJIA 5K2ZA 4K8HA 2FIQA 1AL7A 4P61A 3NEVA 1VGAA 4UTLA 3SZ8A 4M6QA 2QUUA 2JBMA 2BSLA 5G2HA 1ZAJA 3LDVA 4O19A 3N73A 3MI6A 1CI1A 4NNAA 4GUFA 4JTGA 2V5BA 3TU9A 4UMCA 3A22A 5AHEA 4UTMA 4NJKA 3M1ZA 4U28A 3NQMA 4MYAA 3KVMA 1KFBA 2TMDA 2PC4A 3G8EA 2QAPA 3GDKA 4EOUA 1OX6A 4JIQA 2NLIA
chains in the Genus database with same CATH superfamily
3BW2A 4MTVA 1GJUA 3LLDA 1XYCA 2PDIA 5BRBA 3TLLA 3VE7A 1XGEA 4XVEA 1QVBA 1O5QA 3VDAA 2Z7GA 3G6LA 5CC7A 2ZE0A 3LCXA 1WCGA 2O56A 1CDGA 4GVFA 3S6OA 1NFGA 1RH9A 3RN6A 4DNMA 5C54A 2FTYA 2BTMA 4ECLA 2WCGA 3NVDA 3W1LA 4W7WA 4GY7A 1JZ5A 4PH6A 4N42A 2CIPA 1E0UA 1EIXA 3BCFA 2NVAA 4W93A 3OP2A 3DU0A 4IPJA 2F6XA 2WM1A 4AC1X 3VM5A 3LTPA 1U30A 2VEIA 4GQQA 1VEMA 3DFPA 5E0KA 1QPRA 3RPMA 2WKGA 1R3WA 3LZ3A 2HNHA 3WDQA 3ERPA 3AAMA 4QR6A 4A3QA 4Q33A 5IM51 2G3JA 3LZ5A 1OD0A 1DTNA 3SY5A 3LXAA 4AUBA 4ZQRA 2XSXA 4FXFA 4IUGA 5GQBA 1E6ZA 1T7LA 1HJWA 2W27A 4HIBA 5C7HA 1S5NA 1SO4A 1L6GA 1OT1A 4I8YA 4ERIA 4GY0A 1GWJA 1H5VA 4LS0A 5EY5A 1MEHA 1LJYA 4L6OA 4LFYA 4XAYA 3UXDA 4ATLA 5I24A 4TMCA 5K9XA 1XRVA 4AWEA 4XKMA 4DYKA 5T9BG 4J5NA 3EXTA 4HZ6A 4WGXA 2XIBA 1JRBA 1MEIA 4WJXA 4WDWA 3W7CA 2R9RA 2UY2A 1TIMA 3K4WA 4AD5A 2ODOA 3INPA 4UTFA 2UZ9A 4HTYA 3KP0A 4DJEC 3T0AA 5HULA 3WFLA 4OECA 1GPWA 1ZJHA 4TUFA 3M5XA 1DJGA 3U5UA 1JI1A 2PWUA 3F5LA 4GVIA 3GXPA 1QNRA 1EC8A 4UMBA 3DFTA 1A47A 3VOCA 1U5VA 2G97A 2I56A 2ZUSA 4UWMA 5KZ6A 3E2QA 3R94A 2CZEA 3R5EA 1UA3A 3C2RA 2PDYA 4Q4RA 2E0PA 3WENA 4LS2A 3CB8A 4F9DA 1Z3NA 4PBGA 1BVNP 3GVVA 5A6KA 4CQAA 3W2JA 2HQAA 2F2HA 1UD3A 5AVHA 2GK1A 3WDJA 2ZX7A 3RX4A 1MDLA 4MG4A 5LIWX 3AFBA 3D6NA 4O18A 2WANA 4LH8A 4XD5A 3ITVA 2Z24A 1XLJA 4NHVA 3WD4A 4X60A 2XGIA 2R1LA 3PUOA 5CGMA 4QROA 3LA4A 3VKJA 1SW7A 4I9TA 4WJEA 3TN3A 3L5AA 2VEPA 3PTQA 1QK2A 3MUAA 2P88A 4LW7A 2WMIB 4HPNA 4ZVJA 1V6UA 2OZ8A 1B31A 1IE7C 4A8RA 2FDSA 6XIAA 2Y5SA 2CBUA 3GW0A 3FV9A 4HMEA 3W28A 4B4FA 2QXWA 3OTRA 3AROA 3AI0A 2ICSA 4PCPA 4DBEA 3SUTA 1P0DA 4JFWA 3N14A 9XIMA 2GZXA 9XIAA 1L0PA 5BYWA 3PTMA 3L0KA 4QLKA 2YA2A 1LUCA 3RMJA 3R0UA 5CPNA 1SJCA 4P7RA 1M7PA 8RUCA 4MAVA 1PX3A 5A8MA 3T9PA 3V0TA 1ZALA 4DPQA 1E70M 4HP5A 1E51A 1BLIA 4HSOA 3C2FA 1IHIA 2W3ZA 3QH2A 4BF5A 1JNEA 4BY3A 4EPDC 3MV11 2VVSA 3H8AA 3THDA 3KP1A 3NURA 1VBJA 5HUPA 3L5LA 4FLSA 1WOBA 2AL1A 3OYZA 1G67A 3HPXA 1QPQA 3M7WA 1R30A 1T0OA 5LNWA 2PODA 3TNOA 2Y5JA 5HMDA 3FW6A 2WVTA 1M7OA 2G96A 1WE5A 1TWIA 7XIMA 5LNVA 3QZAA 4EWND 3NQ2A 1VENA 1Y5VA 3ZJ8A 4AF0A 1GEQA 5B7YA 3TC7A 3T2OA 2YW4A 4E0CA 2PBGA 2GOKA 3RO8A 1YTKA 4MJZA 1EF3A 2QF7A 4LBSA 4O57A 3VUSA 4P7LA 4C6FA 1SM9A 1RVKA 3WQGA 4DN1A 4H04A 5E0FA 3WQEA 1FTXA 1D7KA 1XW8A 1KM3A 4NILA 4XK2A 5LA2A 1WDQA 3U2ZA 1EIBA 1LL6A 2EG7A 4XISA 3IIZA 4B16A 6XIMA 3IGHX 3I6RA 1JL8A 4HK7A 1F5ZA 2IPFA 3GH4A 1Z32X 3KBNA 3BSGA 3M07A 4TVUA 1S39A 3QFEA 4IICA 3MCNA 1G4TA 1YBQB 4MVAA 1A0DA 3IJ7A 1DWAM 1GHSA 4PBEA 2QCGA 2BHYA 3KL0A 3MYPA 3LHWA 3W71A 3AYRA 5HR6A 4PMDA 1Q7QA 1QR7A 2YDQA 4A3YA 5A6SA 4ZOAA 3UG4A 5HOSA 2BOFX 2GQAA 2IXVA 3VI2A 4CD7A 4H7VA 4RDVA 3UZJA 3SY1A 1H7PA 2YZ5A 2VI0A 1Y0EA 3B9DA 4PB3A 1PDZA 3L4YA 5I3DA 3VD3A 1Y65A 3O6AA 2VENA 2QUTA 3I4EA 3RR1A 2F6KA 3G1DA 3UWWA 4IXXA 2BWGA 1EL3A 3W7KA 1M68A 1RA0A 1ISZA 4UIOA 1PYFA 4GIRA 4LQ1A 3CB3A 5TAOA 3DAQA 1NOWA 4V1XA 2DZSA 3AJ7A 1IGSA 2ZZ3A 3N2TA 3OVPA 4W9TA 3VZZA 3PUEA 4GYPC 3WG6A 3WUEA 1C8VA 3TQ0A 5AYBA 5D9OA 1EDQA 5MHBA 4L4PA 3ZXWA 2B31A 4NI3A 1A3WA 5I79A 2FH8A 3ITOA 1EP1A 2DQWA 3G6MA 3NR0A 4M1BA 1TTPA 4C6LA 4AHPA 3UGRA 2RDTA 4ZQMA 1YDYA 4N0RA 2EEXA 2PPGA 1EB3A 1CXIA 4ZTXA 3JS3A 1A3XA 1PB0A 2TRSA 4K37A 4S38A 4C60A 2OQHA 3WCZA 4YYCA 1YHTA 2Z28A 1E6XM 3ARQA 1HGWA 2H9AA 2BMBA 4HT3A 2F2KA 2YDRA 3C3NA 2PGRA 4W89A 3UYCA 1TPC1 1S2TA 2XVKA 4C6KA 5BXRA 4R53A 4IJRA 3VNDA 2VUNA 1G4EA 2DH2A 3NZ1A 2F61A 3KM8A 1GVIA 1M04A 4AVFA 3WLNA 3WDHA 1OB0A 1O94A 1QNSA 5HINA 1Z44A 3FSTA 4PUUA 4GIYA 2V81A 3DYPA 3LHYA 3GG1A 4KEVA 3FCPA 3O6CA 1PKLA 2ATSA 3GHSA 1DV7A 3LTSA 4Q4KA 5BU9A 1H2JA 3ZWTA 1WUEA 1WV2A 1QRQA 3PBGA 4E2DA 5LGXA 4FEZA 1EQPA 5JIWA 3DYOA 4I6KA 2AQOA 3KS6A 3NL6A 1EPXA 1KCKA 2R1NA 3H53A 3I3BA 2QHAA 5ABHA 2NX1A 3DCPA 3BOXA 4AIUA 3EAUA 2GFTA 3N13A 3SUWA 3B8DA 1HVQA 4MDPA 3DUGA 2PDXA 2EKCA 2WPGA 3M0IA 1UD6A 3TNBA 3CV6A 1R5YA 1R7AA 2ZADA 1H7NA 4V28A 3PJWA 1EOMA 3ABRA 3DHDA 3F03K 3RCYA 1FRBA 4GQBA 3DFHA 5BNKA 4JYFA 4JQ4A 4LEFA 2B4GA 3PN8A 1SQ7A 1GOOA 5AC7A 2Y8UA 4B9YA 2Y61A 4Z1BA 5DXYA 2Q71A 1BD0A 2VKZG 3CMGA 3N19B 5U4NA 3NPWA 4A4AA 2BVDA 4CNSA 4Y9NA 3W70A 4K1GA 1MFVA 3G1HA 2XSBA 4B3ZA 1AQ0A 1TQXA 5T8GA 4DAIA 1TB3A 2C79A 5EL1A 4Q7BA 1NDZA 3STPA 4I9MA 1CGVA 3TCSA 2P76A 2OWCA 3H7VA 1VPXA 2DZBA 2V2CA 3W87A 1KO0A 3CTTA 2BODX 3VOIA 4OIFA 1E9YB 2REQB 3T09A 5DCBA 3WMCA 1DIKA 2G8ZA 1UP2A 3N29A 2GL5A 2QJHA 3BH4A 3A6OA 3M47A 3KDOA 4QIUA 4NXKA 2WBGA 1X1NA 3ZFHA 2ZC1A 4H83A 2BGQA 3GU2A 4RL3A 4FP1A 1ONWA 2HRWA 3P8IA 4JFTA 4ZE5A 3NQ7A 2QDGA 3QPEA 5D38A 1TJRA 3GDTA 3VINA 1QXLA 4LYKA 1W31A 4PTVA 4EXBA 1AK5A 2HE8A 1MW0A 2F84A 2PURA 1REQA 2E4TA 4ML4A 4QSHA 3I6EA 1WA3A 2ABBA 3W85A 5AZ1A 1NIUA 4W84A 3B04A 2VR2A 3PULA 1V3JA 1TYGA 3WLRA 6TAAA 1K7XA 1KKOA 2YBUA 3NL5A 3SECA 4RNFA 2YPIA 3CWHA 3UXIA 2QVNA 2YKKA 1ZBCA 4ORMA 2E5DA 2YA0A 5LNSA 4D6CA 3ONBA 2PWVA 4QBXA 3RLVA 3FSUA 1C9WA 4B9ZA 2Y7GA 1FWWA 1OHLA 2YL9A 3VPLA 1CGYA 1UH3A 3QHOA 3HJZA 2HPMA 4UTJA 3SJ3A 4MB1A 2CFFA 2CLPA 3FYPA 2V3DA 3CH0A 2Q3OA 1H7RA 4DUXA 4EK7A 3E3HA 3MI3A 4L61A 3EWBX 3PNZA 2OMAA 3ZM8A 4EVZA 4N9EA 3H2EA 4FO4A 3QF0A 3WFZA 2CKSA 2B0MA 2OZ0A 2VNCA 1QATA 3RJXA 3BW4A 4JN6A 4JCMA 1IEIA 4LS1A 4NJHA 3F4NA 4GGBA 3QOKA 1R38A 3N1AA 3BVJA 1EXPA 1US3A 2VXNA 3PM6A 2J66A 3T4CA 2AGTA 1JZ7A 2DJLA 3NGJA 4ZSUA 3LPPA 1OABA 3ARUA 1ICPA 1ZBWA 4HB7A 1HGYA 3VOJA 3STEA 2OSXA 4HA0A 4BS0A 4X63A 4MJMA 2BXVA 4ZZ9A 1QO5A 4D6IA 1PL9A 5RUBA 2AOSA 3WL1A 4JTQA 1C8QA 4DBUA 4C91A 1UJPA 4QG6A 3ZS4A 1GORA 3UWYA 1SSGA 3M0JA 3IACA 3W24A 1GVRA 3MUCA 2OCZA 3T2PA 2VURA 3WH5A 1I0BA 3EOSA 2GQ3A 1LLWA 3MVTA 3CHEA 3W1AA 1IF2A 4KEMA 2C1IA 3PPFA 4AY8A 3EEZA 4L4MA 1NQ6A 1Y5XA 3T44A 3UWZA 4YLWA 1V4YA 1CBGA 4B3LA 3WNNA 3H22A 1UD2A 3KCLA 3D0CA 3QLDA 3F5JA 3IJIA 1GQIA 3WMSA 1JZ4A 4GE8A 3DGRA 2WW5A 3IGUA 3DFQA 5HQEA 5DCDA 3EPOA 3P5ZA 4PL1A 1TPFA 4A8NA 3K46A 3WL0A 1ISWA 1NP0A 4F2UA 1XI3A 4UUIA 5D2YA 2V38A 3PFRA 4PEKA 2QULA 1HTIA 1GOMA 4GUHA 2ZA2A 1CLXA 4IQJA 1AJ0A 1GYNA 1XHGA 4IH3A 4LCRA 1ADDA 3N9SA 1OQFA 2AKMA 4E38A 1QFEA 3LB0A 1VF8A 3HJEA 2R91A 1XSKA 4D1JA 3VX0A 1J96A 2QAFA 2IUZA 5DEZA 3BSMA 8XIAA 4ZE4A 5CBBA 5AN7A 3N17A 2Y0FA 4ZOEA 1ENUA 4CNUA 2XVLA 3IJ6A 2VHLA 5I03A 5GPRA 1UR8A 3A5VA 3AS2A 5HWNA 5JMUA 3WJXA 3CLMA 4B5XA 2ZZ2A 2QCMA 4GIAA 2UWFA 1R86A 3KOXA 4WY0F 3KBSA 3MO7A 5F4WA 3HQPA 3S6DA 3K30A 3G0SA 2WVSA 2JIWA 2EGZA 2P8CA 3TTEA 4BI7A 3B9OA 3VNLA 3R0KA 3AMDA 1F3TA 4M56A 3PPHA 2ALRA 1WQ5A 1W1VA 1XYMA 4WSHA 1JNDA 2J9XA 4F0HA 2WHMA 4DLMA 3PBVA 2PWDA 5F2MA 3MZ2A 4O4WA 4YWSA 2CLEA 2AMXA 3WQ4A 3WEOA 4PMZA 4JDYA 3SSJA 2NQJA 1QW9A 1Y5WA 3TXVA 1JFXA 3L4WA 4JYDA 2ISFA 1FWHC 4FOUA 1DJZA 1OCJA 3W29A 2O7QA 5IFTA 1ZP4A 4U33A 3S5NA 2Y7DA 3K8MA 4JFVA 1A50A 1JIBA 3SCRA 2BVWA 1UR1A 3O3RA 2NW0A 4LF2A 1OX4B 4CCZA 3QQ1A 4JQ2A 3O16A 2PDCA 3CK5A 2I17A 4MNKA 3ZSSA 1OFRA 1YNYA 3UY7A 4L65A 4O53A 4JQ1A 3GNRA 4R7JA 1DE6A 4FSAA 4LVGA 1EQCA 3HG5A 4F0KA 1WZLA 1F4AA 3NDZA 1UQZA 4A2SA 2FZMA 4PCSA 4WKHA 4IFRA 4ORIA 3P5YA 4KT2A 5FF0A 2GWGA 3C6CA 2V5KA 3P62A 3CO8A 4US6A 1B3XA 3HPFA 3PNUA 2UBPC 4OQVA 3EWCA 2D2GA 3JUGA 3IUHA 1RCXB 3DFSA 3H21A 2FZNA 4WD0A 4AC7C 3LLXA 4J3ZA 2Z1KA 1J0YA 4XBJA 3XINA 4ICNA 4WDXA 3TYCA 4IQDA 1JXKA 2QPXA 4JIPA 4Y7EA 5DBTA 2QT3A 2Z1SA 1V03A 3E5PA 3KZSA 3G77A 3LYEA 4HNVA 3GHRA 1LM1A 5D9MA 4IMEA 4ROPA 1ZJIA 2PP0A 4C6BA 1KA9F 4K8GA 1VFTA 3QLLA 3BMVA 1LRTA 4JKMA 5BOEA 5DT5A 1DXIA 1R3QA 2Z29A 3HGRA 1H0GA 2DZAA 9CGTA 1UWQA 2YYUA 4EAMA 3AXKA 1NSJA 3OVQA 1XLCA 2QYGA 1HJUA 2PSNA 1E1EA 5AFDA 5EMYA 5FJTA 4V33A 4ZMGA 2DVUA 1F05A 1JRCA 2C7FA 4TO8A 4B3KA 3H4WA 4A2RA 3S1WA 2V30A 3EDFA 2W6RA 3ITYA 4KWOA 4UZSA 1DWJM 3E0IA 2V3FA 3DFNA 2ZUTA 3CV1A 3GAKA 4OV9A 1XF0A 2INZA 3USZA 1L9WA 3AU6A 4ZO6A 3UG5A 1OFDA 4O1AA 2YDSA 4QHRA 2HJPA 3S5OA 1GW9A 3KRUA 4XQ6A 5IXEA 5CLWA 4CQ9A 1WZKA 3ZR6A 1T40A 2ZA3A 1UCWA 3MUIA 4AZHA 5G1TA 1SFLA 1RCOB 3AZSA 2HZGA 3NJ3A 2GVJA 5KEZA 4DQWA 4Z2JA 1SJBA 3LNMA 1W9BM 1B2YA 4H2HA 4UCGA 1Z89A 5B7ZA 1AH4A 1QHPA 3M6YA 3PZOA 1V77A 1QI5A 2FMNA 1J5SA 2HK1A 4REQB 3UZ5A 1XS2A 1DOSA 2B7OA 3BAYA 1ADSA 5E9AA 4Y2WA 2TYSA 2O9PA 3CUGA 5XINA 4O16A 3THUA 3LY0A 3A23A 1BXNA 2YX0A 5G4EA 4C1KA 1JAEA 4L4OA 3ARYA 4AZGA 1K7FA 2ZX8A 5E9XA 4AD0A 1A80A 2WMIA 4UTWA 4RE3A 5EFFA 1T5AA 2BNJA 2XVPA 1PUDA 1EP2A 5TNVA 2BASA 1W3JA 1YDOA 5GNXA 4N9BA 3VD7A 2VZVA 3U3HA 1TX0A 5HATA 2UY4A 2ONEA 4PUKA 1YQ2A 3GTNA 3TW6A 2A3HA 1H3GA 1EUNA 3CTLA 1AA1B 3KVKA 3MKVA 2NQZA 4WKAA 3ZJ7A 3M6DA 3GR4A 3LRLA 3TZFA 1D7FA 5HNUA 3GUWA 1ZZMA 5AHIA 4LUIA 3S1GA 1EGVA 3I10A 4X2PA 5CC6A 1QBAA 3ARVA 3MSDA 1ISYA 3DEQA 3R79A 3H12A 1XINA 3UXKA 3WLIA 4JQAA 1FWCC 4O17A 2V6AA 2ABAA 1JULA 1X39A 3CM4A 4NAFB 3STFA 2VJXA 3EOEA 4P8UA 2DORA 5I0DA 1Z42A 3UZWA 4X61A 5DCEA 1VD6A 2ZRZA 4Y6GA 4V2XA 1YPFA 4HN4A 1BTMA 2I7GA 3VD5A 1VBUA 2E6YA 5BRPA 2FGLA 1P4CA 1FCBA 3KX6A 1PAMA 3LLFA 4OU1A 3W7HA 2DIJA 1ISXA 5CJ5A 4LANA 3VNMA 1TTIA 3GTHA 4IQLA 2A0NA 2CC0A 3TOYA 3FFSA 1UKQA 3V36A 4AISA 3M0ZA 1NWSA 3EDKA 2WKLA 4ICCX 5HPOA 5CSYA 3OLGA 1EFZA 4ATDA 4LALA 2VGGA 2HWGA 3LHUA 3WQ8A 4WEVX 2FJUB 3MS8A 3WH7A 2NVCA 4K7VA 1RHCA 1M7XA 2VCBA 1XGDA 2AMGA 4XAPA 4CNPA 4OOUA 5KINA 2WMKA 4MUPA 1OC6A 4NT0A 3KOFA 1W54A 1JDCA 1P48A 1JYWA 2DEPA 1E6RA 3WJYA 5AHNA 3AO0A 2D0FA 1UD5A 1ME8A 3ATYA 5C5YA 1V08A 1YBQA 3ZR4A 2ZXDA 3EB4A 4X2RA 4F9JA 1SW3A 3WLTA 3BAKA 2X30A 2VR4A 3ID7A 3MI2A 4P8XA 1Q6QA 1W3LA 3Q45A 1I2QA 5FAGA 2A3EA 1GJWA 4LV4A 2NQ5A 3VDBA 2V8ZA 2OODA 3URBA 1ZU8A 2X40A 1JEZA 3BGGA 5ECUA 4P2VA 1O5XA 2BVYA 3KBVA 2E6DA 3HURA 4JTFA 4B91A 3QVQA 2VOMA 5H1WA 4DJFC 2J27A 3FYOA 4JICA 2VX7A 2EAWA 2C13A 4YMZA 4CN1A 1VCVA 1EF2A 5AB3A 2E28A 2VC9A 3G1FA 4A21A 3K1GA 2J9ZA 1RPKA 4E5TA 3WQ6A 4DF0A 3PTKA 3TVAA 1PCKA 2QCLA 4Z2KA 3CZKA 5ABGA 5E6YA 3DFOA 4MF4A 2EPMX 1NF0A 3QN3A 1JD9A 4O4VA 4XO6A 1NELA 4AD1A 4YCPA 4JNZA 2WYSA 2Y70A 4ZXOA 1GGOA 1EWEA 1UIPA 2QCCA 3LI1A 4O12A 4GZ7A 4H6RA 2XWDA 3JRKA 3U2EA 4JPGA 4HN8A 3R8RA 3VIIA 3N2OA 3P81A 4C6EA 2EG6A 5DO8A 2KAUC 2X8RA 3B3DA 1C90A 3JZUA 1UKPA 2ZDSA 3H7RA 1EKOA 1FXPA 4IPNB 3V7PA 3WF0A 1B54A 4S3BA 2PP1A 3V18A 1W91A 4NASA 4AVNA 2BY2A 4I8DA 5BROA 1SZRA 3IRDA 3EBVA 4FS9A 3ANVA 1MZHA 2G5WA 3VD9A 3C61A 3W9ZA 1QCWA 1HKVA 3DHUA 1UH2A 1P0KA 4AEFA 1LTDA 3A9BA 4AQLA 3P0WA 4R34A 4H1ZA 3WUFA 5D2VA 4GIEA 3OYXA 1V6WA 1K3UA 1WZMA 4UTKA 2AAMA 1Q3NA 2HPIA 1TV5A 2ZWZA 4MLJA 3WJWA 1LYXA 5K2ZA 2FIQA 3ARSA 3NEVA 1CLVA 3C8NA 4EP8C 4UTLA 5GJPA 4FOKA 5G2HA 3QY8A 3QYSA 1ZAJA 1IEQA 5EFDA 3N73A 4NNAA 2PTYA 1WXZA 4JTCA 1DQUA 2CZVA 1W2VA 2D24A 4Q4OA 3TU9A 4UMCA 3A22A 2PLKA 2J7GA 3BAIA 3NQMA 2R82A 3MU7A 1KFBA 2TMDA 2Y2WA 4ZB2A 3G8EA 3GDKA 3VX1A 4HOZA 2SFPA 1XKJA 2HXUA 5EMKA 2NLIA 3SO7A 4X9SA 5M1TA 2ZRUA 4XZ9A 3MCMA 1KQYA 1W1ZA 1K70A 1IEVA 4GNJA 4RKAA 1PKNA 3UW6A 1E0VA 4U4MA 3QFWA 3BXWA 4IMFA 2Q02A 3NXLA 1POKA 2ZOXA 1TWZA 3W2NA 1E72M 3S2LA 1P0NA 3PBUA 1CXEA 4LBUA 2YSWA 1XKYA 1PZ0A 3UCCA 3LCHA 3DGBA 4DF2A 4HZMA 3H4XA 3VYLA 3VNYA 1TPWA 4Q22A 3LHZA 2INEA 3BLIA 2AQWA 3C0SA 4D72A 4R7OA 4NX0A 5CG0A 4NZ5A 3CIVA 1UP0A 5CBIA 1RBLA 3GY1A 3T0CA 5FSEC 4LGXA 1MRAA 3NZQA 2FB2A 4DUWA 1A5UA 4Q8VA 1JQVA 4MOZA 1SU5A 3B03A 1K4GA 3UESA 1M65A 3KOWA 1JGIA 4PMRA 6A3HA 2WJFA 1QW7A 5FJJA 1DJYA 4RZ4A 1GQJA 1ITCA 1E4LA 3MJMA 4QXIA 3KHJA 4Y9MA 3AHXA 1HKMA 1A5KC 4HNNA 4MLRA 1YADA 1J9YA 4G1KA 2OJPA 3ZT5A 3BK0A 4XZLX 4IGHA 4LAKA 4DM1A 5G1YA 4YPJA 3FX4A 2UY5A 5A5WA 1V79A 1HJVA 3NO5A 2PRMA 2GYIA 4UQBA 3MZNA 1IT7A 3NG3A 2XVNA 3V75A 4J2PA 5XIAA 3GYEA 3A3HA 3CT7A 1EJXC 1J12A 3HQNA 1N55A 4ML9A 3WQCA 3QEZA 2WVVB 4H8UA 1HQTA 3S4TA 4HBKA 3E6EA 3TX9A 1TVPA 4XKYB 3HPZA 1KFCA 4KGJA 1LZOA 5IDIA 3KOYA 4HJWA 5BCAA 1E55A 1ZCOA 2OT0A 3AYTA 3RPDA 5F1VA 5JVLA 4L7ZA 1E40A 4H9TA 3AISA 1F9CA 3HG4A 1HW6A 2E6FA 2YXXA 3TN5A 3BLPX 1O5KA 4FX7A 3GU9A 1LG2A 3GVRA 4TVDA 2CITA 3WNKA 1XIBA 4LV9A 2IKJA 4TR9A 1A4MA 2JF6A 3VIPA 3RILA 3IV8A 4HPJA 4HU8A 4XB3A 2F7FA 1EX1A 3WLSA 2XVGA 1HKKA 5K4ZA 3IJQA 2VQUA 3MPGA 2BLEA 3NPXA 3QR1A 4CVUA 1S5MA 3EEGA 2C1GA 1LQ2A 4WUIA 4Z0SA 2XGZA 1LT8A 3UP8A 2A6LA 1X8FA 2GJXA 3SBFA 5M03A 2XPKA 4NQ1A 2PDQA 4FR1A 1TMHA 1H62A 4S3EA 4ZR8A 2X41A 3O05A 3T0TA 3QSRA 3L0GA 2VDGA 4WSKA 2CU0A 4H6EA 3QZEA 4NYUA 3VKKA 1TELA 2A79A 5BW6A 1EHAA 3FAWA 3VDGA 5A94A 4MB5A 3LCGA 2R6OA 4LB4A 4C65A 4AZBA 3UY8A 1G69A 4U2ZA 2FVLA 1SMAA 4YIWA 2GUUA 1OYCA 3TYDA 3E49A 4UMAA 4GY1A 2D69A 4PSRA 4QP0A 4HMNA 3NQAA 2WSQA 2ZTJA 2QCNA 1OFAA 2I9EA 4MWAB 2VZTA 3UT0A 4NZCA 4I5XA 3W83A 4TX9A 3MBDA 2JGYA 1OBAA 3UEQA 3AZTA 2BP1A 2X0HA 1MQQA 1VPQA 4FXRA 4C6NA 1BGAA 1KTBA 1K9TA 3HOJA 4D6EA 5KITA 2FH6A 2ZBTA 4FNUA 1HNYA 3RM9A 3CQIA 4C6PA 2X42A 3A5FA 5CPQA 3DENA 3ZQ9A 1JR1A 3BCDA 3SQLA 2A3AA 3E5BA 3CWOX 3MKCA 5EBUA 1J8VA 2YXOA 4AD3A 3CL6A 1BWKA 3WBYA 1KWKA 1I2NA 3D46A 5A95A 1XLGA 4GQ0A 4WY0B 3SRDA 4AHQA 3APYA 3WD0A 3AWNA 3RLHA 4O13A 3WDIA 4RNHA 3MP4A 2RDXA 3P0XA 1F74A 1ZNNA 3MDUA 4K36A 3AXMA 4O0ZA 4DLFA 4DJDA 4QG9A 3GXFA 2NUXA 5CSSA 1XYBA 4DZIA 4IX2A 4KRZA 3BQ5A 4R5EA 2FJKA 1EJ7L 4AZIA 1VEPA 4IGSA 4RE4A 3PSVA 1BKSA 1XLHA 2E40A 1QUMA 3WBWA 1TRDA 1KXHA 5L9FA 4OBSA 4LYRA 1VH7A 2X09A 4LYPA 3GFYA 4HZ7A 1JDDA 4C5YA 1EJWC 5C9UA 3REQB 1B3WA 5ABFB 4W7UA 4NU7A 1IR2A 3UZZA 4HOXA 5CC5A 1XLEA 4U5IA 4GYJA 4J7RA 3PG9A 4R88A 4AX6A 1OT2A 4UC5A 4ASTA 1UOKA 3TR9A 3RPTA 3QR3A 3UCDA 2C14A 3Q94A 1FWEC 3BZJA 1LQ0A 4C6JA 3VUPA 4O1EA 2YZRA 7PTDA 1TMQA 1K02A 1YNPA 2PZ0A 2PRLA 4N4QA 2DY3A 1A49A 1O95A 1ZRQA 2CERA 4PUJA 1J11A 4C1NA 2P8BA 3VMOA 3OZMA 1OX4A 1ADOA 1R47A 4CQBA 4GPNA 3FEQA 4FR6A 3THAA 4I9AA 5AYYA 1XG4A 1HUVA 1E0WA 2O0TA 4Y90A 4RJEA 2W92A 4G9PA 1DORA 1Q4WA 1KKRA 2Z25A 2FKPA 1X1ZA 2WBKA 2VYOA 2DJXA 3E2RA 4JTEA 1B3VA 1XQKA 1OD8A 4N7QA 1O68A 4MADA 3NA8A 2WXDM 4LC6A 4C7GA 1E15A 5I09A 2WKJA 3W38A 3CYJA 1MW1A 3BOFA 1XFCA 2OO6A 1G1YA 2HVMA 4GUIA 4AXKA 3ZVHB 3KLLA 1LBLA 3KAOA 2UV8G 4FZIA 3PWGA 1OJXA 3WMBA 3V16A 1WPCA 2QGYA 1RY0A 1GG1A 1QAPA 3QOMA 1GZGA 3H54A 1UR2A 3NL2A 3GZAA 4YNGA 2ZDRA 4L9ZA 3AXHA 4CCDA 1XIMA 1LL7A 4Q7NA 1U5HA 1L8NA 3W2MA 3U7VA 1AW5A 5HJLA 1NU5A 3SEPA 2YDAA 4U3CA 1HJSA 5A8GA 3CZJA 4HHLA 1PHWA 3LCIA 1KQZA 4Q8UA 3PR2A 3W3OA 2G37A 1LBMA 3F2CA 3SIZA 5FF7A 2NV9A 4IM4A 1PE1A 4I9JA 3WQVA 1LQAA 1UZHA 5FF2A 2CXEA 3D5HA 1SVDA 3AC0A 3D3AA 4TOQA 1LBFA 1PIIA 2D23A 1KFEA 4C7DA 3V0SA 1K9EA 3DC0A 2YA1A 4OFCA 1Z69A 1V6TA 3W7PA 4IQEA 2WZMA 1C91A 3B0VC 2Z2AA 1B57A 4EXAA 3KRBA 4EKJA 4AY7A 4GKTA 3ME3A 1POJA 2POZA 1Q2SA 1EJSC 2OWXA 1Q6GA 2P3ZA 3LRKA 3OGRA 1I4NA 3OZPA 1WDWA 1ZGDA 5FAJA 2P5NA 2CWNA 3BLFA 4QRNA 3OLEA 4R85A 2QPSA 3SGZA 1DEDA 5D9PA 4FLOA 4US5A 2JGQA 1DP0A 3RX2A 3BJSA 3AWOA 3N34A 9RUBA 4UZUA 4RZ5A 5FF4A 1IXOA 4BF7A 1JPHA 4X0VA 1UWAA 4JNYA 2GQ9A 3L9CA 2VFFA 4D9PA 4Q4MA 4AWSA 1VFMA 1VRXA 1Q6CA 4QJ5B 3JR2A 2QIWA 5DXXA 3W1TA 4L5ZA 4LC8A 2Z1BA 5H8MA 3QQWA 3GNOA 3A4WA 4HOWA 3BV7A 3B4YA 1NAL1 1AZ2A 3M5YA 4CUCA 5F4XA 5A69A 3QMTA 4HA4A 4JTJA 3AU2A 4REQA 5A1AA 3LG3A 3W7QA 2NXHA 3CHVA 1JUKA 3HFYA 1VYPX 1DJWA 4P5UA 3LBCA 4NKCA 2J7CA 1GZJA 1BGGA 1M41A 2ZX5A 5D32A 2OO0A 1PDYA 1Q85A 3G0XA 1RZMA 3QYQA 3THCA 3BAJA 3ISIX 4DEFA 3OO2A 3M46A 1FP8A 3GG7A 1L8PA 4QDMA 1R85A 3SRFA 1B0IA 4FB7A 2UY3A 4CGTA 2Z1WA 1WNOA 1IR1A 4H9VA 4AU0A 1W1B1 3TP4A 5D2XA 5CZKA 3NQDA 4WXYA 4WF7A 4WXZA 3NQ8A 4UFIA 1ZHAA 3TAOA 4IIHA 3R6IA 4ZCWA 5IBXA 4EPBC 1WKYA 1GCYA 1PPIA 2VC7A 1QW8A 3LU2A 3RCMA 3NAVA 1E73M 1Z41A 4MWAC 1W9VA 1RQHA 3LQLA 3UF9A 1BWLA 4FHAA 2WSKA 4NXSA 2VCCA 4WK9A 1NM9A 1XRFA 1C92A 1JGMA 1D3GA 4UTTA 3GTIA 3SRHA 4PCFA 1SO6A 2XN0A 1GVOA 2FTPA 2JEQA 3W7LA 4H8NA 4CVWA 4WSJA 3MYOA 1TPH1 1WBJA 3IANA 5KETA 4N2YA 2O9TA 1JVNA 1ZSXA 5HDRA 3S2CA 3HG3A 4BWLC 1NWRA 1PIFA 4LEQA 1F73A 1M03A 2A3BA 4GXPA 1LLOA 3NM3A 3S1XA 1CGXA 3NUKA 3LPFA 1YPXA 1OY0A 3DG6A 5DY3A 1E1CB 3SCVA 4IG2B 1Q8AA 1FFRA 3PUDA 3POCA 3AXXA 3EOOA 4QJ3B 2FYMA 3GG8A 3LN3A 2VEGA 4HMCA 3BG5A 4L64A 7A3HA 5C9XA 4LVBA 3SN4A 3VTRA 3NZRA 1S2AA 2XIQA 6PTDA 1GOXA 3QW4B 1R2RA 3H6OA 4Y8EA 4QE1A 5D05A 5AC6A 3LMYA 5K9CA 3L68A 3CZ8A 4JX6A 5E6ZA 2Q09A 2BY3A 5AC5A 3L65A 4H7ZA 3N25A 4XAFA 5A6TC 1Q7ZA 3B0YA 4UXDA 3U48A 1RD5A 3G1XA 4ACYA 3NVTA 1GHRA 4MB4A 4Z08A 3MMTA 5FSDC 4EF8A 3NYZA 2J8GA 4A3UA 1OSEA 3CUFA 3SRKA 4MAZA 1XUZA 5A6AA 3RU6A 1GNXA 1TFVA 4XTDA 2E7FA 4QEHA 3ANYA 5C2CA 1RAKA 4B5NA 5K4XA 1RP9A 1Q7MA 1T99A 3NQCA 4NAEB 4K39A 4I7WA 4I3GA 1NOFA 3M16A 5FEWA 4MZ1A 5D4YA 5I3GA 1QPOA 3NQ6A 1OGSA 3N6QA 1VHNA 4JX4A 3G1VA 4C6IA 3P84A 2C3ZA 2OGJA 3M0KA 1C93A 4XWUA 3KHDA 4PMYA 5MKGB 3VNIA 3BPWA 4XBSA 2VM8A 2HVOA 4E2VA 1VFHA 1O66A 4O8AA 6ENLA 1RBOB 3QW3A 2Y24A 5D2WA 1QU4A 1K4HA 3H2MA 2VVNA 1KBBA 3B8IA 1OGGA 2G41A 4JYEA 2Z00A 5HANA 5CLTA 3BOLA 1XH1A 4IP5A 4Z2LA 2Y89A 3I68A 5E1QA 3UJFA 1JPKA 2FVMA 4C1LA 3UVAA 1UWSA 4NZ1A 5G4WA 5PTDA 1WX0A 3TFCA 3W1UA 3VE9A 1FCQA 1W8SA 1OADA 1RR2A 1TV4A 1JCJA 2P0OA 4GK8A 1BQCA 1VFLA 1DQXA 4FX6M 1N8WA 1EX5A 1V51A 2R1MA 2GJNA 3CHDA 3LPGA 2EF9A 1XLMA 2JFEX 3VKBA 3OGVA 3BJTA 2CETA 3N4AA 3W6YA 2IPWA 2RDWA 2ISSA 3EOLA 4LX4A 3H24A 3OPSA 4S3CA 4Z1DA 4PGLA 3W6LA 1PCWA 1RJQA 5KZDA 2E67A 5E5CA 4TIMA 3TOPA 3C0QA 3VIMA 2ZZ1A 2BVTA 3OBEA 5D33A 1E5NA 2JKEA 3CH9A 1KTNA 3OLDA 1Z8AA 2E9BA 4JN8A 4RXGA 1UKSA 3TMQA 2WM0A 3VC5A 1TV7A 4D6FA 4J2MA 3BANA 3T55A 4BJHA 4HMDA 4ZENA 3PPCA 4JGDA 1KRBC 3C52A 4U2YA 1GTHA 2E9LA 1VFOA 2H6RA 1TRIA 3IAPA 3S42A 1J5TA 4A35A 3TDFA 3VFLA 1TWDA 2A4AA 1BYCA 4MY9A 3S2MA 2VDHA 4PMOA 3W22A 1KW1A 5JUVA 3CXOA 2EPLX 1F3EA 2Z26A 5HA7A 2OX1A 5TD4A 1ZBVA 5JH1A 2DQXA 2E1DA 4ERAA 3OHIA 1HP4A 3W1MA 1AMYA 3T40A 3LCWA 3GC5A 1Q45A 2NT0A 1DWHM 4UFJA 1PKMA 3AHZA 3APTA 3W2UA 3M43A 1O1ZA 1XRSA 4EXQA 3L2IA 1NFPA 1W8GA 2WZTA 1TIWA 1LT7A 1TA3A 1RD6A 3ITLA 1YXDA 1EGMA 2OR2A 3BURA 2BOGX 3NO1A 3HIJA 5BXSA 5CCZA 2YL5A 4PSPA 4LU0A 3RM4A 1IZJA 2RJHA 5A2BA 1XUUA 1HKJA 3W6MA 4R9XA 1OCQA 1EUAA 3L2LA 2ZXQA 4AHOA 1QT1A 3RDKA 1B9BA 3WK2A 3V1PA 1FHVA 1S3HA 5HUOA 2E77A 1VCGA 3T07A 3BUVA 3ITCA 3IS4A 4IFKA 2YB4A 4PMQA 1OM0A 4LCSA 1WDRA 3FJ6A 1UC4A 1CECA 4RUBA 3LI0A 1B5TA 3F4CA 1ZUAX 4JTKA 3B4UA 2CBJA 1IT0A 1LOQA 5IRPA 1VYRA 1XIJA 7REQA 2MNRA 2XN1A 5AECA 1JCYA 2FHCA 2X2GA 3T4WA 1MRQA 5LIXX 2QJNA 4Q6XA 1QWKA 3ONCA 2Z0IA 2WJZA 1PZ3A 1VYSX 2PGWA 4N02A 2V3EA 4NY2A 3IJDA 3WEZA 1PZ2A 1FXQA 1VEOA 3O15A 4LVFA 1MXDA 4E8CA 1XYLA 2Y8KA 3CHFA 2PB1A 1ONEA 4AVOA 3UR7A 5CSUA 4PUWA 1T6MA 4X0NA 4UTUA 1JPIA 3BG3A 3EA1A 4ZOCA 2O4QA 4HNCA 3BO9A 2MANA 4P8VA 4K7YA 2AL2A 1EP3A 1OK6A 1V02A 2V3GA 3G22A 3YPIA 3NPUA 4RW3A 2XIIA 4HCLA 3LD5A 2WNWA 3UG8A 1FWNA 3MWCA 1UW9A 3S1VA 5EPDA 4DJDD 3COTA 4KF1A 1KFLA 4DPPA 3VIKA 3KBJA 4W85A 4XKYA 2F8QA 2D0GA 3PHAA 4BKNA 3ABSA 2GOUA 2TSYA 1MUCA 2WC3A 3QHMA 3FXYA 5FJRA 3SADA 4PMNA 1FWDC 1N7KA 4KWWA 3SY8A 4QLLA 3W75A 4X3ZA 1BPLB 4BQ3A 3WF1A 3GTFA 4ACZB 3VGHA 3UPBA 3TR2A 3BG9A 3BC9A 3POHA 5EMUA 4GX9A 4GBUA 4LOCA 2P1FA 2TAAA 5D37A 3AHVA 5LA1A 1PHQA 1X8CA 4J1OA 1KBKA 4U5KA 2EJ1A 1O4UA 4GISA 4CQ8A 2AAAA 3E12A 2ZIDA 2ACUA 2PP3A 1XC4A 1LOSA 1VHCA 2QUNA 3OVGA 1H49A 4FMVA 2A3CA 4XZIA 4BQ4A 4G56A 1HXJA 4RDYA 1OINA 4JQ3A 1DXFA 1W1A1 2IQTA 3MW7A 3PPGA 4G7EA 4GI9A 3I6TA 4CQDA 4Y9AA 1QASA 4DJFD 1K1DA 2DGAA 3EWXA 2B81A 3ZWSA 2QVHA 3BV4A 4FX8A 1XICA 4UTHA 1ZB5A 5HMFA 1XWYA 4JCLA 2TPSA 3OA5A 1PKYA 1RVGA 1XBXA 4RW5A 1AZ1A 3LSBA 2XJ7A 4TTGA 3DKLA 5XIMA 4FPSA 1R2TA 4LAMA 2WHKA 3ELFA 4AB4A 3WIJA 1F8MA 3FGCA 3S1UA 3LHVA 3CQKA 3OQ8A 1GG0A 1TJ2A 4H9UA 2Z7KA 1AFSA 1CB7B 1R87A 4Q8QA 4OV4A 2EPOA 5FF3A 4AY1A 3IWPA 3IRSA 4A29A 4IJCA 3TN4A 4IGMA 4AWTA 1FY6A 1KLZA 1I9CB 2JEPA 4M6VA 1VFUA 1ZTVA 1ELSA 3GHTA 1TE6A 2WQDA 3CASA 3ZVIA 1S1PA 2XIOA 4M0XA 1DJXA 3VOGA 2WZIA 4GJIA 3E1F1 1R3VA 5A6MA 4J3SA 3LBMA 3EPMA 4HHMA 1RXOB 2VRJA 4IIEA 4Z2IA 3O7UA 4MPKA 1E6NA 1DPMA 4GUJA 4Q6JA 1R0MA 3KWXA 4PYSA 5KZEA 4O15A 2W79A 2IXUA 3GWQA 4E2BA 4GQRA 1ML1A 2QCEA 3P2VA 1AMKA 3M0MA 1QNQA 1W5MA 1KGXA 5BU6A 3H7UA 3MP3A 1J6OA 3WQDA 2OKTA 1YKWA 1T8XA 3S5ZA 3KW3A 1Q6OA 1YTEA 3BAWA 7ENLA 1EO7A 4UOZA 1VBHA 1XH0A 3EX4A 3W2KA 1PYMA 3FXGA 4QNWA 3WNLA 2ISDA 2GK1B 4GFSA 2E5BA 2QNEA 2JIEA 4S39A 3SFWA 4US5D 3WQFA 3W1XA 4KS0A 2HXTA 3CUZA 2HV5A 3QKEA 2VX5A 3XIMA 1XLAA 1MMFA 2ZICA 4JEJA 4XD6A 1KXTA 4GC4A 1EZ2A 4WGHA 1XCWA 1TVNA 4OUIA 2D73A 5FJUA 2WAGA 5FOOA 1A3HA 2QIIA 1EBHA 5ABFA 4NG3A 4O14A 1WKEA 4YN5A 4Y8FA 1E5JA 2ZVRA 2YCKX 1W3TA 5DRIA 3BTNA 4PEEA 2GWNA 1TV3A 4HJFA 1FWFC 5I7GA 5BXTA 5L6UA 2CLFA 1D9EA 2A2IA 3O0FA 2WVUA 3F4VA 2OLAA 1K6WA 1MNSA 2RAGA 3O0KA 5CPMA 3GDMA 4B5VA 4LWWA 2VX6A 2PLCA 3A4AA 3EMQA 4WR3A 4AIOA 3A9IA 3VZYA 1ZLPA 4H00A 3QR0A 1VLWA 3BL3A 3L4ZA 4H8VA 2CHRA 3NSMA 4ADSA 2CBIA 3R8GA 3UXAA 4ERGA 1BHGA 1UIOA 2I1OA 2RJGA 2ZKMX 3C2EA 4DO4A 3MKKA 1VBRA 1HN1A 1OZQA 1S5WA 4K6AA 4M7SA 2FTWA 4FNTA 3WF2A 3PJTA 2QMJA 4F8XA 5D04C 5AOUA 3QTGA 3TTYA 3W84A 1M3UA 3VMPA 4ZO8A 3GKAA 1UZ4A 2I16A 4TV5A 1SR0A 2J9YA 2CW6A 1Z6KA 4D71A 2QV4A 1D2KA 3CQJA 4LVAA 4P7NA 1KM1A 4HA3A 2FLIA 3C0LA 3R10A 3QC0A 3CL8A 2HTMA 4X22A 3M0YA 1ITUA 2WQPA 1I2PA 4W88A 4WKFA 4S3AA 4S3DA 1U2YA 4FLRA 3VIOA 5JBEA 4B2DA 3S0CA 4MFEA 3UWQA 1FWBC 8XIMA 2VGBA 2YFOA 4AF0B 3E38A 2EJAA 2JQXA 1X97A 2XSAA 1BAGA 4J27A 1H60A 4ROQA 1AQFA 2Z6JA 1E4IA 3W88A 4QS5A 1VBGA 4DO6A 4C6QA 5JH2A 1XR2A 2HMCA 1U33A 4J3XA 1ECQA 2GSEA 1A5BA 1H50A 1TPUA 3VD4A 1L6FA 1J79A 3K2GA 1Q6EA 4S1FA 1UMYA 4PFMA 4DYEA 2WLZA 3LV5A 2J77A 4O28A 4XAGA 2DIKA 3DC8A 1S2CA 2F6UA 4GXWA 3EKZA 1N8FA 1UR4A 1AQHA 2YLLA 3RLGA 4IUOA 1MDRA 3PZVA 3MSYA 3ZZ1A 2Y4SA 6CGTA 3BWWA 4JFUA 3PJXA 3PAJA 2W0UA 3WQWA 3R8HA 4F48A 2GSHA 4LAOA 3TYBA 1M53A 4HSHA 1ZCCA 2W91A 5EGRA 4E4PA 5FEPA 1SZNA 3PWAA 2VP8A 1U1UA 5GVJA 4L1WA 1XD0A 2BHUA 3JVAA 5CPSA 5HNNA 2FPYA 1TCDA 3LS9A 4WDUA 4OOZA 2PMQA 2DT0A 5FCZA 2X05A 1W9DM 4M6QA 2VC5A 2JBMA 2YCIX 3H70A 4RNIA 1EO5A 2GVYA 3LDVA 4QLJA 3GIPA 3KVMA 1DWGM 2Z27A 4DYJA 2QAPA 2XH7A 1F4HA 3ALFA 3AIBA 2CESA 1BRLA 3OODA 3BGAA 2J7FA 3NOYA 3SB0A 1G0CA 4M3PA 5F2LA 2G50A 2HK0A 1X6NA 3WELA 4K3ZA 4C90A 3ARTA 1XJBA 1UYQA 3QZ6A 3CUXA 2WK2A 5FACA 3VDHA 5EB8A 1AH3A 4L1XA 1VPYA 1NFBA 2P50A 2DUZA 4HGXA 1SZFA 1IXQA 4JZ5A 1BXBA 5AC4A 3N2BA 1KXQA 1ZY9A 4KFPA 1SFJA 4KW2A 1SJDA 5HJXA 3SCWA 3CUHA 2ZXAA 4J3UA 3L7RA 3T05A 2VQTA 1XH2A 2J24A 4QITA 3W01A 1H41A 5BRQA 1UD8A 3SR7A 4XZBA 5HWJA 3RGTA 1RBAA 3GXMA 1BSIA 5EMJA 1AQMA 3LXBA 3KCOA 5D09A 3FJ4A 4UQAA 1W5NA 2D3NA 1G6CA 2EPHA 5BWAA 1ODZA 1M6JA 1MSSA 3MBFA 4RXFA 1W5PA 2V67A 2R1PA 2WCSA 2YCJA 3F4WA 3C5QA 1QOPA 4QISA 1DWIM 4JHMA 3FJLA 4RV8A 4QFUA 1TUXA 4UB9A 3TSBA 2WNQA 3T1GA 3S2NA 3A64A 4Q4QA 1Q8JA 1BXCA 2JF7A 1VZWA 3WD2A 4LUJA 3NCOA 4CNOA 1AD4A 3FKKA 2V9DA 4MGGA 3NXFA 1Q6RA 1BVWA 4AZ5A 3IGSA 4S2CA 1VS1A 2GUBA 2V63A 1ZP3A 2GJPA 3FS2A 2WC7A 3S5YA 1LROA 2XH2A 1ZFJA 2OEJA 1CGWA 4PTMA 3FA5A 3G8RA 4I7UA 4GINA 2J88A 4FXSA 4Y9OA 4IG2A 2GVEA 2PF8A 4YHGA 4FNSA 2P3EA 1UD4A 3TAKA 3EA2A 3D3FA 2PBOA 5J04A 1E56A 4YTRA 1W9XA 1BYDA 2OSWA 1LORA 3CV7A 4AZCA 1NARA 1E0TA 4H8HA 1TPDA 1YMYA 4JIIX 1YX1A 1BYBA 2CCRA 3UETA 4GXMA 4DIAA 1H0IA 1IT8A 5G4HC 3GRIA 4B15A 4DZHA 4QE5A 1VC4A 1RUSA 2CBVA 1F6KA 3Q37A 3LGGA 2XZ9A 4EIVA 1JZ3A 1J0HA 2PU1A 2BX7A 4PTXA 4QAWA 1AODA 5AYIA 3MSGA 4ZODA 1CEOA 3SDOA 3R11A 1P5BA 4PMUA 3LNPA 4O52A 4E8GA 1J4EA 4AYSA 4URIA 1Y8BA 3B0PA 1NVMA 1V6XA 2WLYA 3MVIA 2CLLA 3CAVA 2OLHA 1P6CA 3ZYZA 4Y9PA 1MEWA 1FKWA 2YW3A 2DW7A 2FPVA 1KM4A 3UA4A 4ES4A 1L6YA 2XH0A 1EGZA 4J3TA 1E9IA 1GTEA 3C2OA 4OBRA 4DJEA 4S3GA 4LRSA 4BHYA 4HQVA 3UU0A 2ALDA 3VGEA 2I5GA 4TQTA 3WLOA 1KBJA 4TX6A 4IGNA 1WDDA 2CZDA 5G5IA 3PZMA 4I5UA 3EB3A 4QJ1A 1DXEA 3Q58A 1RPXA 4MM1A 4Q8NA 1TTJA 4DZ5A 2OGYA 4JD4A 3ITTA 3PBYA 2YJQA 3LCFA 1ZAHA 3QQ0A 1CXHA 3GAYA 4POCA 5HNRA 3TJXA 3AS1A 5KTLA 4OKDA 3QJAA 1ICQA 1EA0A 3AS0A 4H19A 4UCFA 1EJRC 4XTIA 4JXCA 4QE4A 1OCNA 2VFDA 1V3IA 1I2RA 3GVQA 4W7VA 4GVHA 3IIOA 5H8PA 4YXGA 1F6PA 3CAQA 3G1SA 3TZNA 3VCNA 3BW3A 1MW3A 1I6NA 2V68A 4GC3A 1HP5A 3SCSA 3KTSA 4MNMA 3WF4A 1Q66A 4S3KA 1WP6A 3HQ1A 3FIGA 5AHLA 3V5CA 1SFTA 3NPVA 2VRQA 2PD9A 1TTQA 5B80A 4FNPA 2V5JA 2MUCA 3K8KA 1J18A 3AIWA 3GW3A 3M9YA 4M6PA 2ZX9A 4CD4A 4IL0A 4UQ9A 2PDHA 4ZFCA 4AZ6A 1OIFA 4O0KA 4EAYA 2ZCGA 5LNUA 4DX3A 3VIHA 3RITA 2GGGA 2DT1A 4RPPA 3VK5A 4DF1A 3OB8A 2ZRXA 4ZGYA 3TA9A 3NWRA 3CEUA 3IGXA 4P7OA 1MQRA 4HZ8A 4B5UA 1BWVA 1WB0A 1FWTA 3GE7A 3S5SA 5H6HA 2CLOA 2EXOA 4O1BA 4QM1A 3RRAA 2KX9A 2VDIA 4TU1A 4JNMA 1W17A 3UR8A 3A3WA 1A5OC 5AYXA 4HNOA 2DSZA 3P67A 3W7GA 1US0A 3SUUA 5CSRA 1ZPTA 3UR2A 3CIWA 3FVMA 2QJGA 4V27A 2JK2A 1XDLA 1M5WA 3K13A 2NSXA 3OG2A 2HBXA 3KCJA 2DT3A 4KETA 1R3SA 4S23A 1I75A 1S5VA 3LENA 1IYXA 4H01A 2BY1A 3THQA 3ZO9A 3ZLFA 4PA8A 7TAAA 2YL8A 1E4NA 3UQNA 1V0MA 5F1UA 2ZX6A 3PTDA 1IWPA 3TV8A 4KBXA 3M0LA 2VRKA 3VDCA 1YRRA 3GH5A 3M0VA 1FWAC 4JTHA 2GGHA 3GO2A 3IJLA 3MA8A 1FDYA 1OYAA 1Q6DA 4IX0A 2PDWA 3S8HA 3BGJA 3FOKA 1MFUA 1FBAA 2BBFA 4DWSB 4N6FA 3PJUA 4ZFMA 1CX9A 1FQ0A 2YOCA 5FEXA 1IGWA 3DESA 2XWEA 3JU2A 4JIEA 1QI0A 1YXYA 2YYTA 4XO7A 4YTSA 3AMKA 4PUDA 1LOLA 4DELA 1QI4A 3W73A 4C6MA 1YTDA 4N9DA 4MNLA 5HJYA 3GU1A 4CD5A 1V3MA 4D6HA 2QPUA 3N4FA 3S9ZA 5BWFA 2PTWA 1IIGA 3FDGA 1BSLA 1DIDA 3MUZ1 4JHOA 3WK1A 2BGSA 3N15A 4GZEA 1GJPA 3CPRA 2Y7EA 1VQTA 1H1ZA 4ZL1A 5IHSA 1XV8A 1E9LA 2E8ZA 1KRAC 4IMDA 5C9WA 3BLKA 5T9CE 1YE4A 1SJAA 1TE1A 2WWCA 4KERA 1I45A 2DUXA 1S5TA 2POTA 3AIUA 1O7AA 1GKQA 2VFGA 4CN4A 2A5HA 2A7PA 2Z6IA 4DRSA 5JQ9A 3SCNA 5K3VA 1TWWA 3UPMA 2Y1HA 1QPKA 4M1RA 3BARA 2Z1XA 4LBRA 3IIPA 5DMLA 1C7SA 1S2UA 2Y63A 1X6UA 3N9RA 4F3HA 5HBFA 4XIAA 1IZCA 5LKYA 3HGJA 2CHNA 3WLPA 2BXYA 1G7VA 4IPIA 1FH7A 2ZUMA 3UWVA 4HYWA 4M8UA 4W5ZA 1K8CA 2G3IA 2PWHA 2DW6A 1DHPA 1UBPC 3QY6A 3GC2A 3WKZA 3B05A 3N04A 1UH4A 5DFAA 1HIZA 5CZ0A 2VELA 4YVVA 1V3KA 3O6YX 5E0CA 2J75A 3KE0A 2BS9A 4GYPA 3IPWA 1JCMP 4ACZA 3H2CA 4UFMA 2Y62A 2EO7A 5HWMA 3LQGA 3A4XA 5C2GA 3GNXA 1RA5A 4BQ2A 1A53A 3MV01 3NDYA 3O07A 2WCAA 3BMXA 2QS8A 4ZQPA 2KZHA 3AZRA 3PZTA 3UXLA 2DH3A 2Q01A 2PLJA 3PG8A 4Z42C 3EX2A 3QGAC 2Q6ZA 3KTCA 5JBFA 4LPCA 1YPIA 5LNRA 2GGJA 5HMEA 3SCUA 5DN1A 2VEKA 2Y8VA 3B97A 4MZ8A 5I6SA 4MWAE 4Q8TA 4KKXA 4YS1A 2AKZA 4OJYA 3GG0A 5D03A 3WLMA 2INFA 1UWTA 2J7HA 1H1NA 3HBLA 5KMYA 3U4FA 3SFKA 1UPPA 2GUYA 1RK5A 3DDMA 1R9XA 4I6VA 3AMLA 5HPCA 2GVLA 1MVYA 1T41A 3CYVA 1QHOA 4XSLA 2Z1VA 3EXSA 3WUGA 3GIQA 4KH2A 3AUOA 4WRHA 1AW2A 1W2PA 3P6LA 1J0JA 1NDWA 4B2DD 3FHAA 4GACA 4M82A 1DE5A 3DI0A 2NXGA 1JZ8A 2WNZA 3I7RA 3WD1A 5FEZA 1LWHA 4JN7A 5DX7A 4LVDA 1JJKA 3NQEA 3WJSA 2ACSA 3IIVA 3EMZA 4NUWA 5M17A 1W1IE 1L6WA 2PTZA 2V5DA 2PGEA 3ORWA 1EZWA 2J4GA 4WOZA 1XLLA 3KUMA 4TVCA 1QI2A 2VFHA 1VFFA 2BHZA 2IS7A 2NQ9A 4JL1A 4NF7A 3BE7A 2ZC8A 1TR1A 1JCNA 1W3KA 4DO5A 2WHLA 3O6DA 1EYEA 2IPJA 1X96A 1EC7A 2IKHA 4GNKB 1H63A 4A8IA 2ZTKA 4Z17A 4ZSTA 4ZO7A 1XIGA 1UG6A 5FKYA 1I1XA 4CN6A 1TZ9A 3CAKA 3G2GA 3R7MA 2PA6A 3RXZA 3NFUA 4U3AA 4JTDA 3GBDA 2WSPA 1SR9A 3O1NA 4NZ4A 3G18A 5D8ZA 3QPZA 4HYVA 1KM2A 3LHTA 3VOFA 2J8FA 2WNNA 3LRMA 4AWUA 5CJNA 1OFEA 4JIHA 4PULA 4H9MA 3N11A 3K5XA 3GR7A 1PWMA 2B7QA 4GO8A 4PL2A 1HZYA 5CGQA 2W62A 2QV5A 3MB9A 4IIBA 5E70A 4XSMA 3MCOA 3R43A 2W4XA