5CPTA

Disproportionating enzyme 1 from arabidopsis - beta cyclodextrin soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cptA01
3W38A 4UFMA 4W89A 5A69A 1CXIA 1CWYA 1UKSA 3W27A 5A8OA 3G6MA 2CCRA 2ZUNA 2A3BA 2ZUSA 3T2QA 4HOWA 4U33A 3K8LA 4CD5A 3CLWA 3BAIA 3L4XA 4B9YA 4JCMA 1W32A 2AAAA 4ACYA 4Z2GA 1CGYA 4QAWA 1W2PA 3UG3A 1XGZA 3EBVA 2XYLA 3AHZA 1C93A 3WBEA 1E3ZA 4HZ7A 4LPCA 3RM8A 2NT0A 5M03A 4AIUA 3RILA 3HJEA 5BXRA 1HIZA 4IISA 4MJ2A 1QW9A 2V38A 2J47A 2W67A 4J3UA 4DWSD 3PBGA 1PEZA 1GOQA 4GZJA 4MB1A 5DEZA 3EDEA 2ZXBA 3MUZ1 4W7UA 1WO2A 3BMWA 4P7NA 2IXUA 4UQEA 5LYRA 1Q6CA 3VUPA 4KGJA 3VDAA 1IZKA 3TTOA 3UG4A 5C8BB 1QHPA 4AYSA 3NDZA 1QI4A 1J0IA 4DWSB 4EAMA 2CNCA 3WD1A 1JDAA 1EDTA 2WHMA 3WDRA 1UA3A 2VT0A 3QOMA 1QVBA 2XGIA 3WEOA 1V0NA 3N17A 3ARZA 1J10A 1DWFM 1WDRA 1XRVA 2VO5A 3CUGA 4BQ5A 3CZJA 4CU6A 4EK7A 3MS8A 4B3KA 4OBSA 1E4LA 1XSJA 1OINA 1PZ2A 2ZX6A 3W24A 1VB9A 3PTMA 2FH8A 1DWGM 1JI2A 3ARYA 1JZ5A 1ZU8A 3NSMA 1TUXA 3WUBA 2CKSA 3VIIA 5A2CA 4D6JA 4W86A 8CGTA 2DSWA 1FOBA 4PEEA 1MYRA 2DSUA 1E0WA 1W3HA 7CGTA 4IPNB 3BSHA 1US2A 1E70M 3EMCA 2C7FA 5IXEA 4WSKA 3OLIA 4JHOA 4UQCA 3GNPA 3ZR5A 2EEXA 2PWFA 1DEDA 5F7UA 1E40A 1EDQA 1NH6A 3SCUA 3MSDA 1E4IA 2BVTA 4W8AA 2VX4A 1BPLB 3M46A 3PZMA 1MQRA 4YPJA 3SCPA 5E09A 4E2OA 3VIGA 2DT0A 5DFAA 1ZBCA 2WNWA 1TZ7A 2VCBA 5JIWA 3WFLA 1DHKA 3NUKA 3W26A 4J3TA 1PIFA 4J3VA 3ZT5A 2GJXA 1WZAA 4OKDA 2YDSA 4OBRA 1U33A 4W7WA 2ZWYA 3TA9A 1XCXA 4PTVA 4UQAA 2O9OA 3VGDA 2F2HA 2WKGA 2F61A 1TE1A 2YL5A 3MMUA 2X0YA 2WW5A 2VRKA 3A4XA 3MU7A 1VJSA 3WSUA 2BVDA 3S2CA 3F4VA 4J3XA 3AS2A 4D72A 5CSUA 3WN6A 5FL1A 3WDIA 2WHLA 3SCTA 1M7XA 3SUTA 1US3A 2FH6A 1ESWA 4C7GA 4KRUA 2CXGA 2OYKA 4BCEA 4UR9A 3AIEA 1TR1A 5I5RA 4GZIA 5E9AA 4XZWA 1KXTA 5IFPA 2WMJA 1OD8A 2VZVA 4WKAA 3ZSSA 3PZOA 4Q7NA 2QLYA 3GXIA 4N0RA 1QI0A 3TTQA 3RJXA 4W7VA 3VD9A 1VFUA 2J7CA 5M5DA 2VUYA 1ODUA 3NSXA 3WL0A 4Z2LA 4RE2A 2WB5A 1JDCA 2FHCA 1CIUA 2ZX5A 5A3HA 4PMQA 3VMNA 2OSXA 3W6LA 1UH4A 1FH7A 2ZX9A 5JBEA 2YA0A 1UR0A 1Q6DA 4ACZA 2YLAA 1A47A 4GI6A 4PMNA 2XG9A 3N11A 1LQ0A 1W3KA 4JKLA 4RE4A 4QLLA 1H41A 4JFSA 3VIMA 4AZ6A 2PF0A 3NSNA 2YOCA 1K9EA 1NM9A 2JFEX 3CZLA 1AVAA 2J8GA 1UKTA 2X8RA 5E0CA 1V02E 4ATWA 1ISYA 3WEMA 1WDPA 3M6DA 4JFUA 1JYWA 4AWEA 1RP8A 3MUIA 4AXNA 2D3LA 1CXKA 4LXFA 2UWFA 2PWGA 2E4TA 1QNRA 1KWGA 3B9DA 4YHEA 2AOSA 4P7RA 2WXDM 2ZUUA 4X0NA 4B15A 2VX7A 5EFDA 3GBEA 3NYDA 3CBWA 2A3HA 5M17A 4PMZA 1B90A 1CENA 3ZOAA 4HMEA 3RMEA 3K1DA 1E6QM 3AQUA 4J27A 1HJVA 2QHAA 2CKRA 5FIPA 3WF4A 2XVKA 1BGAA 4Z2JA 1UD6A 1QBBA 1JDDA 2XFFA 1Q6EA 4AY1A 3SUSA 4JHZA 3LPOA 5A8NA 3IJ7A 2ZXDA 2WWCA 4UOQA 1R86A 1BGGA 2W4XA 3CUFA 5JUVA 4W84A 1ZJBA 2D2OA 3QGVA 1KXHA 2ZUWA 5CJ5A 1PBGA 1XH1A 4CVUA 1HKIA 2BFGA 3A47A 2GSJA 2J62A 1QI3A 1MFVA 1N82A 5LA2A 3AZSA 5CSYA 3IAQA 3PZQA 2J75A 1H5VA 4F8XA 1BSIA 2DSKA 1R8LA 2J7FA 4LYPA 1BF2A 2GJXB 3VIPA 4AD3A 1ZBKA 1VFMA 2G3MA 6CGTA 3U5UA 1J18A 4CKQA 3DECA 3PZUA 4QLJA 2PI6A 4ZENA 4W93A 2ZX7A 2XJ7A 1CGXA 1I1XA 3K4DA 1ISXA 2VC9A 4WJXA 1DWHM 1M04A 4UZUA 2D23A 4Z2KA 1PX3A 1MQPA 2WMIA 1QHOA 2VNCA 2XFRA 3ALFA 4F79A 4UZSA 4CU8A 2WMHA 2V3FA 4AD1A 4HOZA 1UWRA 2YL9A 5AYIA 2FHFA 3T2OA 2VCCA 1DWAM 5AC4A 2X05A 4AMCA 1NWSA 1AQ0A 1K6AA 5HOSA 3VGBA 3GM8A 4BA0A 1LG1A 3WDQA 5I79A 2VZTA 2WYSA 3WIJA 1B30A 1KXQA 1B31A 5CXPA 3VX1A 1J0KA 1RH9A 2ZX8A 5BCAA 3CTTA 3GTNA 1B3YA 1MW0A 1E4NA 3IJ8A 2OYMA 3WMCA 4IM4A 3GXMA 3B9EA 3PZGA 1FFQA 2OSWA 5C70A 3LMYA 1WAWA 1LWHA 4K68A 2JIEA 1E3XA 4JL2A 1E6SM 1E1FA 1UG6A 5HPOA 3SCSA 5IFTA 4GXPA 3BAWA 2JEPA 1WPCA 1L0PA 1QI2A 4AD0A 5FOOA 2BVYA 4AIOA 1J0HA 3K46A 4BF7A 4ACZB 3LPGA 2D3NA 1E4MM 4GPNA 1Q6FA 2VQUA 1JNDA 3VD5A 2PBGA 1UA7A 4UFJA 1NOFA 3GZAA 4ZEPA 2PB1A 4MPKA 2WHJA 4B16A 3EMZA 1BHGA 1OWQA 1W9UA 4QFUA 3EMQA 2XVGA 3WQ6A 3PZTA 3AIVA 2ZUVA 3MMDA 1R7AA 3RJYA 1V6XA 4MNMA 4BQ2A 2QF8A 4DM2A 2BNJA 1O6IA 1WDSA 1W1PA 3VO0A 3WH5A 1LJYA 2VMFA 3CZGA 4TX6A 2RGMA 1CXEA 1J0YA 3GH7A 1KXVA 1VFOA 1X6NA 3K4AA 1R85A 1WNOA 3VIJA 3GYCA 1UH3A 3CMJA 3MSGA 3FN9A 3AIBA 4PTWA 2WZEA 5A94A 3N13A 2VX6A 4GINA 3IANA 4HTYA 4ATLA 1L8NA 2VZOA 2Y24A 3L4VA 1JF6A 2IUZA 1X1NA 1UQYA 2CERA 4CVWA 1PZ3A 2UY4A 3AXXA 1K9FA 4TVCA 1W9BM 1JG9A 1GORA 3VGGA 3RIKA 1ZB5A 3WD4A 3NCOA 4PCTA 1E6RA 3BMVA 4HA1A 2EJ1A 3VILA 2O9RA 5A2AA 3RO8A 1LWJA 3PZVA 2PWEA 4MDOA 1CNVA 2JE8A 1B3ZA 3SUVA 1ISZA 1W2VA 4CCCA 3U7VA 4Z2HA 4V27A 4HPHA 1BYBA 4NSBA 2O9PA 1WDQA 1B2YA 2FDMA 3VD3A 4CUCA 4F66A 1ZJAA 5A2BA 2YIHA 3ALGA 4GI9A 2UY3A 3W29A 1FFRA 3VX0A 4H8VA 2CYGA 4AZCA 1HJXA 2GUYA 4MADA 4L4OA 5BWFA 4LYQA 4DUXA 4HZ6A 5D9OA 2XTKA 3O6AA 3SEPA 1MXGA 3ZSTA 2WC7A 2CESA 2EPMX 2J7GA 1H49A 1W1YA 3FHAA 1HT6A 2WMIB 2YLLA 1AMYA 2XVNA 4U2YA 3SUUA 2J7EA 4PMVA 1GJUA 1GOKA 1LF1A 2WPGA 1DTUA 1KGXA 2ZUMA 4H2CA 4CD6A 5ABEA 2WANA 1C90A 4M80A 1EHAA 1JF5A 1F4HA 2BXZA 2CBIA 3W25A 4CD4A 3AS1A 3MMWA 1U30A 3T0BA 3AZTA 1ITXA 3BLKA 3TOPA 3WENA 2ZE0A 4BZYA 2WHKA 4OJYA 3ARWA 3T09A 1JAKA 4UOZA 2CETA 1JL8A 3VMOA 4J3WA 1UD8A 2BHUA 3T0DA 1JZ6A 4MAVA 1BTCA 4IUGA 1XD0A 1G5AA 1KFWA 1VAHA 3WD2A 2G3IA 3WNPA 2YA2A 3APGA 4F9JA 1Q4NX 3MV11 2E40A 2BY2A 6TAAA 4YN5A 1OSEA 2D0FA 4E4PA 5AC5A 4PMOA 1OT2A 1UWIA 2V3EA 1V0KA 1V0LA 1TVPA 4H7VA 1E6NA 5FKYA 2XIIA 2QMJA 5E0FA 3ZJ8A 3II1A 2W92A 3OLDA 1NQ6A 2ZICA 3WH8A 4UFKA 4ZXLA 4U5KA 2EPOA 5DF0A 3QR3A 2XM2A 1H3GA 2WZIA 4HA4A 2EPLX 5CPSA 1Z32X 4TTUA 4KMQA 2E8ZA 1E6ZA 3NJ3A 2XVLA 2CBUA 3L4YA 1MW2A 3ARXA 3LPPA 4WF7A 1IT0A 1EIBA 1VBRA 4NZCA 5E70A 1G9HA 2V3DA 1KB3A 4E8CA 4P7LA 1B1YA 2XWEA 3VIFA 1H0IA 3AFBA 3TP4A 2OWCA 2WCGA 3EYPA 4TXEA 4AD5A 4M82A 3SCRA 3OLEA 3WUGA 1YQ2A 2JF7A 3WEZA 4ATDA 3ZM8A 1OBAA 3S6TA 5GNYA 3VD4A 2WLZA 4AD4A 3VD7A 2D0GA 3WQVA 2BXYA 1U2YA 4J3SA 1GHSA 4GKLA 2NT1A 4PYSA 1E5NA 2A3AA 2W66A 4M8UA 2WLYA 3W28A 4AZ5A 5C71A 3L4ZA 4WIWA 2PBOA 1UD4A 1PX8A 2ZOXA 3WDJA 1C8QA 5A95A 1KR0A 2A3EA 1UHVA 1H09A 2WMGA 4C7DA 3RCNA 1KWKA 1IV8A 3OGSA 3UCQA 1K9DA 5A1AA 5JIPA 1XSKA 4NF7A 2VURA 3CHCA 2J7HA 3GH5A 4ZE4A 3BAYA 1VENA 3N18A 3WUEA 2WK2A 1E15A 3POCA 1EO7A 1SYTA 4JFVA 3AIRA 3CHDA 1MXDA 5HBFA 4Z2IA 3WNMA 2EQDA 3CZ8A 3WNOA 1HKJA 1SR0A 3T2PA 3AMKA 1FHLA 4L4PA 1MQQA 1V0MA 1UWUA 4M56A 3AHYA 4J28A 1E1EA 4Q22A 3HU7A 4D6HA 3ZJ6A 3W81A 3AIUA 2J79A 2XHYA 3VNZA 2ZXAA 4D6FA 1C8YA 1H11A 3AHXA 4MAZA 5EFFA 4H8UA 3VDBA 4KRTA 1V02A 4AZCB 1NOWA 5D9PA 1GCYA 3VVGA 5A8QA 2E9LA 3NIYA 1TA3A 4FLRA 4WLCA 3FAWA 1E56A 1BLIA 1EOMA 4A3HA 4TTGA 1W91A 1V3LA 4PUDA 2BY1A 3N04A 1BVNP 5D8ZA 4PRWA 5IHSA 4QLKA 3A4WA 2YJQA 1HX0A 2V5DA 5A6MA 1UR9A 1H2JA 1HN1A 1QOXA 2VJXA 2W61A 1GJWA 4AEFA 4J7RA 4LX4A 2DT3A 1G0CA 3M7SA 3DHUA 3UR8A 2DSZA 4D1IA 2WMFA 1UD5A 5EB8A 3ARVA 2JF6A 2GJPA 1C92A 4MDPA 2J25A 2ZUTA 1GONA 4Y7EA 1HVQA 1SFSA 3VM7A 4B3LA 3BAJA 2GDVA 1OD0A 3QOKA 4H04A 2WCSA 1UYQA 4AD2A 3WQ8A 3VM5A 1VBUA 3PZIA 3WH9A 4DUVA 4UQBA 1ISWA 1JIBA 3ARTA 2FHBA 2B31A 1UH2A 1G1YA 4U31A 4W5ZA 5GNZA 1HKMA 1XD1A 2HISA 1XV8A 1ZBVA 2NW0A 4GQRA 1EOKA 1J11A 5CPQA 1LL6A 1V3KA 3QHOA 3OGRA 5BXTA 1EH9A 4URIA 1V3MA 4UQ9A 1GQJA 1NP2A 2V5CA 3BSGA 1E6XM 2VX5A 3EDFA 5I24A 4FF5A 2GJRA 3W37A 1XH2A 5I77A 4KGLA 4U2ZA 4AZGA 3CZEA 4CN6A 3CIVA 4P8UA 1GHRA 2CBVA 1GQKA 2VI0A 5M3WA 3WF1A 3WUFA 1UWSA 1OM0A 3WDHA 2Y8VA 1EQCA 3AJ7A 3AICA 1F4AA 3OBAA 5E6ZA 2W62A 2OYLA 1C7TA 1Y7VA 2CITA 3J7HA 1CXFA 5I0DA 2RGLA 5CGMA 1HKKA 3RPMA 4MB3A 3MO4A 1CLVA 3VGEA 1XYFA 3T0AA 2E3ZA 2VVSA 3ZJKA 5KZ6A 2GK1A 1WE5A 1CXLA 5A6LA 3WH6A 1PAMA 1ODZA 3D5HA 3ZQ9A 4DWSC 4MB4A 1WCGA 2PWDA 1NWTA 2YL8A 1GQIA 1BYAA 4P7OA 1W1TA 1HP4A 3BCDA 4A3YA 1SMAA 4RE3A 4CCDA 1JZ3A 1ZS2A 1NP0A 1V3JA 1CYGA 3IK2A 5A6SA 3UETA 4JCLA 3F5KA 3AMLA 4EE9A 1GNXA 2Y8KA 4C7FA 3HMCA 1E9LA 4AZIA 1JYXA 3KZSA 3L2MA 4M81A 4CN4A 1UKQA 1V6WA 4M24A 1HJQA 4B9ZA 5CQ1A 2J4GA 4PMYA 4TUFA 3VGHA 1CTNA 1QBAA 4KH2A 1PX4A 2XVPA 3UESA 3BC9A 5GNXA 1TCMA 4UQDA 3RM4A 5BRPA 4XV0A 4HA3A 3O2LA 3AS0A 1QPKA 2EPNA 3ZMRA 1H1NA 4W5UA 4P8WA 1TA3B 2FGLA 2D1ZA 4JKMA 2Q8XA 1E73M 1J01A 5DT7A 1AQMA 1D3CA 1C7SA 3AMGA 3L4WA 5LA1A 5A8PA 2Y2WA 3EDJA 4CN1A 2X1IA 1QNQA 4HMDA 3W53A 4W88A 5A8MA 3WQ4A 2XFYA 1FH8A 2BV9A 3WBAA 3WMSA 4PMRA 5D9MA 3QHNA 3ZT6A 4OUEA 2XM1A 3CHEA 3IAPA 3OZOA 1OCQA 3THCA 1CGVA 2OSYA 1J9YA 1QHZA 1UZ4A 3B9AA 4GO8A 1QI5A 3CPUA 1HXJA 4MNJA 3T08A 3UG5A 3AROA 1HP5A 2DIEA 3ARRA 4BS0A 3ECQA 1B3WA 1V6UA 1MWOA 5A6KA 1VF8A 4EKJA 4UOJA 5A6BA 2ZWZA 2D22A 1LL4A 3M07A 3SIMA 1GPFA 1H4PA 4AZHA 4CD7A 1JD7A 5LA0A 1FP9A 2NSXA 3L4TA 2WZHA 3CO4A 5BROA 7A3HA 1I75A 1BG4A 2D20A 3AISA 5BRQA 3WNLA 1X6LA 2EPKX 4QCFA 3AHVA 5DO8A 2DT2A 2VCAA 1ZBWA 1NOUA 4RL3A 1ITCA 2Y5EA 4HZ8A 3SCWA 3VTRA 3DC0A 3VINA 5I23A 5GPRA 2PC8A 4HMCA 4M1RA 5CLTA 1UQZA 3ARSA 1UR8A 2EXOA 2VRQA 4QP0A 3I3DA 2XPKA 2YKKA 3WNNA 4AEEA 3NDYA 4A4AA 1FA2A 2J78A 1V6YA 3FW6A 2W91A 4WSJA 1DWJM 5I6SA 3WL1A 4UFLA 1WP6A 2MANA 1WZKA 1KBBA 1E5JA 1UKPA 1HJWA 1E0VA 2G3NA 3AIWA 2XSBA 1W9DM 3FNDA 1W3JA 1MVYA 3K8KA 1WZMA 4LQ1A 1CXHA 4UFIA 1C3FA 2D0HA 2W5FA 4HU0A 4MTVA 1VJZA 4D6DA 5CLWA 4DUWA 3ZT7A 4AW7A 2Y4SA 4P7QA 1OGGA 2JEQA 4PMXA 1EQPA 1S46A 3N1AA 1YHTA 3UERA 1QW8A 1FHDA 4HP5A 3SCVA 3VIHA 4GI8A 4MJ4A 2J7BA 2HVMA 3K8MA 3U5YA 4XUYA 3SCOA 4TOQA 1V03A 5TD4A 3DHPA 3AXHA 3ARQA 3AOFA 2GK1B 5JBFA 3WQWA 4GZEA 2DT1A 1NWRA 1CGUA 2WWDA 4LGXA 5ABFA 4XX6A 3N15A 5HXMA 2Z1SA 4R5EA 5A6AA 3CH9A 5HDRA 4AZBA 3GNOA 1JXKA 4JIEA 3U57A 2CBJA 2GDUA 4HU8A 2DGAA 2VTFA 3ARUA 2WKLA 3ZR6A 4DM1A 1UD3A 3DYMA 5HNNA 4AC1X 3JUGA 2F8QA 5ABHA 2DH2A 4JFTA 5ECUA 1OB0A 2DH3A 3A4AA 2AMGA 3I3EA 2CHNA 3VDHA 5I2UA 3WY1A 3MANA 2Z1KA 2GVYA 2BHZA 3VKKA 1JAEA 3PZNA 1HF6A 1HL8A 1BFNA 5EBAA 2WCAA 4HPGA 1ISVA 3HN3A 1GOWA 1JZ4A 1WZLA 3AS3A 2JIWA 3CHFA 3F5JA 2WSKA 3GXFA 3THDA 2PWHA 4FLQA 4D6EA 1MW3A 3AXIA 3E1F1 4NI3A 3WD0A 2OWXA 3SCNA 3AYSA 1VIWA 4H8HA 1GZJA 2A3CA 2WM0A 3SCQA 5FD0A 2O9TA 1B3XA 1UR2A 2QPSA 2YDRA 4JFWA 4CD8A 4D6IA 3AHTA 3TTSA 2J7DA 1PJ9A 5A6BD 4NRSA 1RP9A 5FL0A 3VPLA 1XCWA 3OLGA 3BLPX 4HOXA 2DQXA 2C0HA 1K9TA 3CUHA 1XC6A 1UKOA 1CGWA 1V3HA 3OA5A 4FK9A 1JZ7A 4MNLA 1DWIM 3W6MA 1KQYA 5CZKA 4CCEA 5BXSA 2WVSA 1I1WA 3GDBA 4CGTA 3AZRA 2DDXA 1XH0A 4PMUA 1FP8A 3BCFA 2FGZA 3WELA 3ZO9A 5D9NA 1JZ2A 2V3GA 3FY1A 4TX8A 3WFZA 1R7OA 3AI0A 4JL1A 1OT1A 1TG7A 1J0JA 2J8FA 3D3AA 1M53A 2TAAA 3DYOA 2XSAA 3PZ9A 2WVVA 1JYNA 2DIJA 3EDDA 1Q6GA 2VZSA 1JZ8A 2OWWA 1P6WA 3MUY1 4F9DA 1E0XA 1QNPA 1HJSA 1EHNA 3WD3A 3IJ9A 1UD2A 1MFUA 2G8ZA 2QV4A 3AMDA 1OGSA 1ECEA 1O7AA 6A3HA 2BHYA 3WH7A 1CPUA 2X0HA 1QNSA 1D2KA 1EDGA 2YDQA 3UR7A 1A3HA 4D1JA 1GOOA 1PIGA 3AMCA 4PMDA 3ZIZA 1EGZA 1NWUA 5GQBA 2WC4A 3VGFA 3CMGA 4UNIA 2G3JA 4OZOA 1RD6A 4JZ5A 2CIPA 3BAXA 3BAKA 3PN8A 1W9PA 1W9VA 4UFHA 3SURA 5CPTA 3GBDA 1UR4A 3FHQA 1KGUA 1KQZA 2WAGA 1CZ1A 1GVYA 4QCEA 3MV01 1HL9A 1JFXA 3OGVA 4PN2A 3CGTA 2IXVA 2YA1A 4NRRA 4QDMA 2JALA 1VEMA 2E0PA 4V28A 3WNKA 4MB5A 1VEPA 2WBKA 2ESCA 1CGTA 1HNYA 3B8SA 3LPFA 5CG0A 5I78A 1JXJA 3L4UA 1LL7A 1VEOA 1UR1A 2UY2A 1H0GA 4GQQA 1B3VA 2D24A 3VMPA 4E8DA 1G94A 5ABFB 2VR4A 3KL0A 4AIEA 2WSPA 3MUAA 2YBUA 1C91A 2XUCA 1TVNA 1BVZA 1BYCA 2CHOA 4ZFMA 4PTXA 1GOMA 3W0KA 1HVXA 5BXPA 3ARPA 1UOKA 3OZPA 1D7FA 5D4YA 3AIQA 1E71M 4UTFA 5JBDA 4S3JA 3WQ5A 3U7BA 3WMBA 1KR1A 3PTKA 1GQLA 3GH4A 2O92A 2DSVA 4W8BA 1IZJA 2EO7A 4OOUA 1XYZA 1UZ1A 4H41A 3UEQA 4BQ3A 1CEOA 1OGBA 2UY5A 5KEZA 3KE0A 1W1VA 1UWQA 5ABGA 1KGWA 3W82A 1J0ZA 4YHGA 3A6OA 2WC3A 3WF2A 2G41A 5FCZA 1UUQA 4TVUA 1SMDA 3WDPP 4TVDA 1BYDA 2E9BA 1QNOA 2QMKA 4X0VA 2OLHA 3OIHA 4UCFA 4AZ7A 3KWXA 3KL5A 4ZE5A 2YBTA 4OOZA 2WMKA 1JD9A 3AYRA 5IHRA 2CPUA 5IDIA 3QHMA 1LG2A 4MNKA 4D71A 5AY7A 2WBGA 4S3KA 3O9NA 1CDGA 5EMYA 1BG9A 2WVUA 5HPCA 4P8XA 1GVIA 4WKFA 1E43A 3VIOA 4PBGA 3TONA 4WKHA 1E55A 4DWSA 2DPEA 4CU7A 5BYWA 3I3BA 4IPLA 2ZXQA 3G6LA 3CZKA 3N12A 1JNEA 4EANA 1NARA 2VL4A 3PTQA 3MKKA 2VVNA 3BH4A 3POHA 2E8YA 3KL3A 3WKZA 3SUWA 4M29A 1B9ZA 1G01A 2C8NA 1JFHA 2X2YA 2ZIDA 4XZBA 1M01A 3VDCA 8A3HA 1CBGA 1XHGA 3W4RA 1EA9C 3DYPA 5E6YA 3ZJ7A 5DMYA 4XB3A 3VOCA 1R87A 3RM9A 2WVVB 3FAXA 4W8LA 9CGTA 3EDKA 5AYBA 1BAGA 3FXYA 4BQ4A 3GXDA 2YL6A 1JGIA 1C8XA 4U5IA 2EBNA 3N9KA 4PSPA 3CUJA 4OIFA 4FMVA 4WK9A 1DP0A 1KCLA 3OG2A 4JAWA 4PTMA 2QPUA 3WF3A 3RDKA 3WF0A 5I3DA 1J12A 2VR5A 1XSIA 1VFFA 5CGTA 2VQTA 4LYRA 3A3HA 4W87A 5A6JA 2BY0A 2E9MA 4V2XA 1UWTA 3L2LA 4R27A 1GOIA 3F5LA 1VRXA 3GNRA 1CLXA 4U3AA 5D8WA 1OIFA 1WB0A 4ZXOA 3VNYA 4PUEA 4U3CA 2VOTA 1GW1A 1GUVA 1V6VA 1HJUA 2XWDA 4GO9A 4N42A 1EXPA 3KEHA 1KBKA 4ML4A 1BQCA 4D6GA 1TMQA 4AISA 4P8VA 1E6PA 1AQHA 1JYVA 7TAAA 3BXWA 1RPKA 4PSRA 4JKKA 1EO5A 4X9YA 4D6CA 2J74A 1OIMA 1E72M 1WKYA 5DT5A 2WVTA 1KCKA 3CUIA 4GIAA 1FH9A 1CECA 1W9XA 3TTYA 2XIBA 2X09A 4W85A 1JI1A 1LLOA 2VRJA 3BGAA 3VIKA 1PPIA 2CEQA 3OB8A 4FLSA 1ZL1A 2J77A 2DEPA 2W63A 1B0IA 2BS9A 4KWUA 1TFVA 2G4FA 3PHAA 1W3LA 3VU2A 2XGBA 4FLOA 1V3IA 2BY3A 2GFTA 1M03A 2VZUA 1V08A 4PCSA 1MW1A
chains in the Genus database with same CATH superfamily
1TMHA 2P0OA 1CWYA 3T1GA 1GEHA 3W27A 5A8OA 4E2BA 1KLZA 1XWYA 4LJ3A 4FOKA 4TV5A 3TXVA 2TRSA 2ZUSA 3T2QA 3O3RA 2FGBA 4CD5A 2I17A 1G4SA 3VFCA 1H61A 2FJUB 4E0CA 4IMCA 1W32A 3KBWA 4Z2GA 1CGYA 2GWNA 3P61A 4QAWA 1A5UA 1EIXA 1XGZA 3EBVA 5XIAA 4LPCA 4BEUA 5M03A 2X41A 3H2OA 3E5PA 7REQA 2PZ0A 4F40A 4J3UA 1K7XA 1SJBA 2H6RA 2CLEA 4XWUA 2OG9A 4FOUA 5ENLA 4MB1A 3VC6A 3C2RA 1FXQA 1TPEA 1WO2A 4UQEA 5LYRA 4KGJA 3VDAA 4LANA 1IZKA 1H62A 1VZWA 4IP4A 5FA5A 3NXFA 3IRSA 1G4TA 1AW1A 5JMUA 4IGHA 3FVMA 1AL8A 3A22A 3TLQA 3LM3A 2FZMA 5F4WA 3UP8A 3K2GA 1EDTA 3WDRA 2QCEA 3WEOA 1V0NA 2VEIA 3R8RA 4QDPA 5L9FA 1WDRA 1XRVA 2VO5A 1S5NA 2VENA 4BQ5A 3CZJA 1XLKA 3MS8A 4OBSA 3USZA 3H8AA 3LHVA 1PZ2A 1R2TA 2ZX6A 2VFIA 4DEFA 2FH8A 1DWGM 1JI2A 1ZU8A 3NSMA 3RPTA 3VIIA 2I16A 3V0UA 5J5DA 2BOFX 8CGTA 4JTDA 2DSWA 1VBHA 3GTIA 2VHLA 3W7GA 4LAMA 2C7FA 3OPSA 2X1UA 3WQFA 1O5KA 1VJIA 4JHOA 3WQGA 3GNPA 2OLAA 2PWFA 5F7UA 3CWHA 2AKMA 1NH6A 3NQ2A 2V2HA 3MSDA 1E4IA 2BVTA 4W8AA 2PDMA 1BPLB 3H55A 3OHIA 4UR7A 3PZMA 4UTIA 4Y9OA 3NVDA 5E09A 3TQKA 1ZBCA 4RX0A 3W26A 5BOEA 2GJXA 1WZAA 3W70A 5HULA 2VWSA 1U33A 4Q8OA 3MA8A 2WKGA 1XLMA 2YL5A 2X0YA 3LSCA 1JUBA 2OXNA 3VOIA 4FAMA 2HS6A 4HU3A 4GQBA 1ZP4A 2X1TA 3TROA 1X98A 1X8FA 2BGNE 4XZHA 4GA8A 4D8AA 3VKJA 1M7XA 1PTAA 3QMRA 4FEZA 1QUMA 4C7GA 1Y8BA 4RJEA 4DZIA 3F7JA 1ZQ5A 4YVPA 2NXIA 3LLDA 2WMJA 3B0PA 3XINA 3S42A 1FWSA 3PZOA 3VUSA 3BLDA 2E1WA 2NVCA 3G1SA 4LNYA 1SO4A 3GXIA 2PMQA 1F05A 3DFTA 3V5CA 4DBUA 1RBOB 3RJXA 4W7VA 2JQXA 2WQPA 5M5DA 2NQJA 1ODUA 3NSXA 2WB5A 3TYDA 3GDMA 1LUCB 3IVSA 4DRSA 4PCPA 1ZAHA 4G1NA 3QY7A 5C54A 3WYZA 4WOQA 3O8AA 1XICA 3VMNA 3F1QA 1UH4A 1UR0A 2V67A 1EF3A 4WDUA 4RZBA 6PTDA 5DBUA 3SB0A 3U2EA 4XAYA 1A47A 4PMNA 4AY8A 2XG9A 1W3KA 4CNUA 2DZAA 7REQB 2PCQA 4QLLA 3TQ0A 2NX9A 1YXCA 3VIMA 5BNKA 5TF0A 3NSNA 4GNKB 3CIXA 2YOCA 3EGJA 5E93A 3FXGA 4WY0A 4N6FA 1UKTA 4ATWA 1RSCA 1ISYA 5I09A 3L66A 1JYWA 2PDFA 1O60A 4NI8A 3RN6A 1RP8A 3K5XA 4K7VA 4MWAA 8XIMA 4LXFA 3TJLA 4BF5A 3MBDA 4QG6A 1PYMA 1OFOA 1QW7A 4B90A 4C90A 2ACQA 3OP2A 3SAZA 4JTFA 1ADDA 3E9AA 1WOBA 4B15A 3W2MA 3GBEA 3NYDA 2A3HA 5M17A 5KSWA 4US6A 3BOLA 3LD5A 1XGEA 3K1DA 3AQUA 3T6CA 2OQHA 2QHAA 2BODX 4I6KA 4AIBA 3U2OA 1QNVA 3TTEA 1QBBA 4QSFA 3S0CA 2XFFA 3K30A 2ACSA 5HNRA 4EWJA 4JHZA 4IP5A 3LPOA 5A8NA 2ZXDA 4UOQA 3CUFA 5JUVA 5LGXA 4W84A 1ZJBA 2D2OA 3QGVA 3NL5A 1KXHA 2ZUWA 3G1VA 3MWAA 3A47A 1S2CA 5F2IA 1MFVA 5HK4A 1TR9A 4J5NA 4F8XA 3RLHA 3QM3A 2J7FA 4XBSA 2H3BA 2GJXB 1EJUC 3A64A 3VIPA 3GG8A 4UR8A 5G2WA 3P81A 1PTDA 3PVFA 2E5CA 4FP1A 1RY0A 5D03A 4CKQA 1K02A 4QLJA 2PI6A 4ZENA 3HM7A 3E12A 2ZC8A 1XYMA 2XJ7A 1O94A 1I1XA 3K4DA 1M04A 3ANVA 4GUIA 4IQDA 2QIWA 2A1YA 1XIDA 4OGZA 3GXPA 3P7YA 3TNOA 4F79A 3TKFA 2WMHA 2ZQ0A 3VAVA 2E6FA 1UWRA 5AYIA 1ITQA 2BOGX 4PFHA 2EG8A 1NWSA 3I4EA 1RBAA 3U6WA 8RUCA 5HOSA 4QJ4B 3VGBA 3I65A 4X3ZA 4H9XA 4NILA 2QIIA 3MDUA 1A5LC 1MSSA 3QC0A 1J0KA 2ZX8A 1XIMA 3BSMA 1WXZA 3CTTA 3UXLA 3GTNA 3M0KA 2GGJA 1T5AA 4O1BA 2BLEA 3EKZA 5F1VA 3P8JA 3B9EA 3WLOA 4JTKA 2ZDSA 1WAWA 4H3DA 4JNZA 3GIYA 4JL2A 1E1FA 1UG6A 4ZSTA 3GWQA 3QTGA 1CT5A 4MKSA 1BWLA 1L0PA 3T40A 4XKYA 5BMWA 3AXKA 1J0HA 1K6WA 4BF7A 4I8DA 1XKJA 3LPGA 4NAEA 4WVXA 4NJGA 1Q6FA 3UR2A 1UA7A 4F2BA 5AC6A 1MUWA 4ZEPA 4MWAD 2PB1A 1EJRC 4WXYA 3EMZA 2WJDA 1OWQA 4QFUA 4QSHA 4C5YA 4NYYA 1QCWA 1A49A 4WY0B 1RJPA 1XW8A 3DCPA 3NQ8A 3NOYA 1KV8A 3MMDA 4EX4A 2YX0A 4PGLA 4TX9A 2PU0A 2BSLA 4MWAB 3TR2A 1O6IA 1ONWA 1WDSA 3VO0A 1GPWA 2VMFA 3CZGA 1CXEA 3GH7A 1KXVA 2BXVA 1X6NA 3VIJA 3CMJA 3GTHA 4PTWA 4FR1A 5A94A 2VX6A 4GINA 4ONVA 2OEJA 3C2FA 3P6LA 1SZGA 1RCOB 3LRMA 3H2FA 2IUZA 3NQCA 1TVLA 3L5AA 1VYRA 3ICJA 4UCGA 1F7BA 1K9FA 2PDCA 4LC6A 4TVCA 4RNFA 5DRIA 4UTWC 3W76A 1ZB5A 1TIMA 1ML1A 4PCTA 5T9CE 3BMVA 4QEEA 5LIUX 3VILA 1BXCA 3THUA 4S38A 2R1LA 3V1PA 4QITA 4MDOA 3CHVA 1CNVA 1EP1A 4KFOA 9XIAA 5CSRA 1W2VA 2NXGA 2PD5A 4Z08A 4Z2HA 4V27A 2Z0IA 4HPHA 1NU5A 1BYBA 1WDQA 3LERA 2I57A 3VNMA 2V30A 1B2YA 3VD3A 3R0KA 2OKOA 3ALGA 1MZHA 2I56A 3V75A 2BB0A 3VX0A 1QJWA 4H8VA 1TPUA 4LYQA 5D9OA 2XTKA 1JCYA 2WQDA 1MXGA 3QF0A 3LB0A 1WA3A 2CESA 3N4AA 2XVNA 3DHDA 2VD9A 3RYSA 4IMEA 3ZLHA 4PMVA 5D37A 4LOCA 4LS1A 1GJUA 2QR6A 3IVTA 2WPGA 4AUBA 2RH9A 4C6JA 4H2CA 4CD6A 2WANA 3HGSA 3KVJA 3WJSA 5F2GA 1P43A 3MUXA 3SFWA 3LEPA 1EHAA 4HSNA 3BMXA 2QJHA 4CD4A 1E9ZB 4XZNX 4LS2A 3NL2A 2ZE0A 5AECA 3ARWA 3T09A 3B9OA 4N6EA 1VBGA 2WV8A 2WZTA 3ES8A 1EJTC 1UD8A 2BHUA 4MAVA 4JQ3A 3UJEA 1VAHA 3APGA 3W83A 2CLKA 2DUAA 1Q4NX 1I0DA 2BY2A 3PULA 3LI0A 3SY5A 3DFHA 4PMOA 1FWWA 1V0LA 1TVPA 4H7VA 3BO9A 3DH7A 1OC6A 3CYVA 2ZRYA 4XKYB 4O57A 2XFWA 3KOXA 4UFKA 3L5LA 4NAEB 5MKGA 4KFNA 2XM2A 3LV6A 3COTA 3GDTA 5LKYA 1VQTA 2EPLX 1XRFA 4TTUA 5CZSA 1E6ZA 4NZ1A 2FIQA 3QW3A 3KCOA 4GCAA 2YYUA 3L4YA 4GVFA 1WKFA 1MW2A 3LPPA 4WF7A 3FA4A 1UUOA 4JN8A 1G9HA 3VOGA 4YU1A 1XLJA 3AFBA 4OV4A 1U1HA 4L9ZA 3REQA 2WCGA 3EYPA 1F6YA 1DJIA 3CQ0A 3SCRA 1F76A 1YQ2A 2GJNA 3PWIA 1M6JA 5CJNA 3QYSA 1OBAA 3W7PA 3UYCA 1QU4A 2D0GA 2AKZA 3VXGA 3WQVA 2C18A 4GKLA 3HGOA 1GOXA 3UYIA 4J4KA 5HATA 1W1B1 3L4ZA 1TWZA 2PBOA 2Y88A 1XGDA 1D8CA 4TR9A 1BXNA 1P0NA 1UHVA 3LZ3A 3UCCA 2WMGA 5CGQA 3W1QA 1KWKA 4ZQCA 1NY1A 5CZTA 4NU7A 3UCQA 3W07A 4ZOCA 3P0WA 4ZE4A 3N18A 4XZLX 1GGOA 1PXGA 1SYTA 3CHDA 1IGSA 1JGMA 5HBFA 1NF0A 4FZIA 1ZCCA 3CIWA 5BOOA 3BE7A 3T2PA 1MQQA 4PUUA 4GC3A 4A3UA 3SW6A 1Z41A 3GUWA 4D6HA 5C0QA 1XLEA 2HXTA 3VNZA 2FB3A 1KM6A 3W7NA 4H8UA 3ABQA 5K4XA 4KRTA 3NPXA 4C91A 4LT9A 2EG6A 5H6HA 4Q8QA 3NIYA 2PTDA 2PLCA 2EPHA 1FBAA 3FAWA 3Q4DA 4PUDA 5D8ZA 1TV3A 2CLHA 5I7GA 5TNVA 1XRTA 2YJQA 1HX0A 4Q8UA 5IOBA 1VP5A 2OODA 5IDZA 1BXBA 1HN1A 1XLHA 2W61A 1LT8A 2EF9A 4LX4A 2DT3A 1KRCC 1T8XA 3UR8A 5H8UA 2WMFA 1UD5A 2P5NA 2GJPA 2IQTA 3SN4A 4Y7EA 3BAJA 3LCHA 2R8WA 4H04A 3A12A 3CU2A 2R1NA 2WCSA 2GSHA 4LUIA 4NT0A 2DZSA 2QXWA 3PZIA 4UQBA 3ANYA 2NUYA 1UH2A 4W5ZA 3LCGA 1XD1A 2HISA 4IIDA 4AH7A 1JPMA 4J1OA 5MKGB 4GQRA 1BF6A 3DI1A 3GKAA 3NZGA 1Q8AA 1LL6A 3CQIA 4L9XA 3QHOA 4O53A 4NP7A 1EH9A 2QJNA 1PVNA 1IE7C 1V3MA 2HBVA 1PHWA 1E6XM 1SZNA 1V8EA 5I24A 4FF5A 2GJRA 5DANA 4FXJA 3LZ5A 5I06A 4GABA 5CPOA 5K7JA 4UNKA 4U2ZA 3A4JA 4AZGA 3REQB 4CN6A 3CIVA 3G3MA 3CYJA 4JN6A 4OWGA 3AICA 1F4AA 5E6ZA 1YIXA 3PANA 4V1YA 2TODA 1XBYA 1Y7VA 2ZZ5A 3FDKA 3S2JA 3GW0A 2WNZA 1ONRA 1HKKA 3R43A 3RPMA 4JY9A 4JS3A 1CLVA 1OFPA 3VGEA 1WKEA 4Z1AA 3T0AA 2E3ZA 4OT7A 4LFYA 2QULA 2FZDA 2GK1A 5GJMA 1WE5A 1YTKA 4IJCA 4ZTYA 1ODZA 3BW3A 2YL8A 1W54A 1GQIA 3MMTA 4KPLA 1IXNA 1A4LA 4FPSA 5D2YA 4PTDA 1ZS2A 4UNLA 3PBUA 1V3JA 3OZMA 2V5KA 4HNVA 3F5KA 1N2VA 2VFDA 4Q8PA 3MPGA 4IMFA 3HMCA 4FNQA 3TJIA 3M0JA 3S6OA 1RCXB 1ME8A 2BG5A 4M81A 4JYDA 1UKQA 4M24A 3OVRA 4PUJA 4BI7A 1F3WA 4PMYA 1OCBA 1ZJHA 4TUFA 3VGHA 2W3ZA 1CTNA 2AQWA 5AHFA 1XISA 4KH2A 2XVPA 3NVTA 2F7FA 4QBXA 4QEHA 2Z28A 3SADA 4R9XA 1I0BA 1QPKA 4EPDC 2PP3A 2V2DA 4P8WA 4W5UA 3SRFA 1J01A 3MZ2A 1C7SA 3AMGA 4MUZA 4KESA 1W5QA 5A8PA 1TJRA 4CN1A 1W3TA 2X1IA 5GJNA 3W53A 4D9PA 4DO4A 2XFYA 3O0KA 3TC7A 1NDWA 1VCFA 4NIRA 1SPQA 2Z1VA 4J9JA 5FACA 3SGZA 1HQTA 1GZGA 3ZT6A 1OVDA 3IGSA 3GIPA 3BGJA 3B4YA 3MJMA 4B4FA 3IIVA 1J9YA 1QHZA 9XIMA 1UZ4A 1DE5A 1HP5A 4K8GA 1HGWA 3E02A 2I5GA 2YGYA 2ZWZA 4R33A 1LL4A 1WAUA 3KRSA 4UMAA 1GPFA 1R38A 2WJZA 4IP7A 5LA0A 5CBIA 3EWDA 4KWOA 1I75A 4GUFA 5E0KA 4JDBA 1X6LA 2EG7A 4P61A 1W1ZA 4I7WA 3QY6A 2VCAA 1VPYA 1ZBWA 1NOUA 2Y5EA 3SCWA 5HANA 4L1GA 5LNVA 4E6MA 4AHPA 3IIZA 4M1RA 1FDYA 4ALDA 1XFCA 4JGDA 1UQZA 2C14A 2QUUA 4QP0A 2VRQA 4HSOA 2XPKA 2YKKA 1RV8A 3WNNA 3NDYA 3N6QA 3FJ6A 4QM1A 3OQEA 4PRTA 3C61A 4IQLA 3B0UX 2W91A 4MJMA 1WZKA 4Q8WA 1E5JA 1W8SA 1DHPA 1K70A 1XQKA 3KVKA 1CXHA 4UFIA 2D0HA 4Y9PA 1Q6LA 4Z42C 1VJZA 4D6DA 2O7SA 5CLWA 1EF2A 5H91A 3SQSA 2JEQA 4PMXA 3UERA 1YHTA 1FHDA 3SCVA 4NHVA 1IWPA 1V03A 2HNHA 4LB4A 3DHPA 3ZLFA 3ARQA 2GK1B 5JBFA 3QRHA 3WQWA 4GZEA 4NNBA 2PRMA 3I7RA 5CPNA 3B8TA 1IHIA 1Q7ZA 3N34A 2WNNA 3DU0A 3EAUA 5CPMA 1GVRA 1ONEA 1J2BA 1XLBA 3U57A 3QXBA 2CBJA 2GDUA 5HMDA 2DGAA 3V7PA 4A3RA 4GE8A 4GG9A 3ZR6A 4GQGA 3DUGA 1P0EA 1UP3A 5ABHA 4XD5A 4JFTA 5ECUA 1OB0A 3W7DA 2DH3A 3I3EA 5D33A 3E96A 1FY6A 3MANA 1I9CB 3C52A 3UCDA 2BHZA 4LTSA 4DF0A 3KOZA 4FIRA 4XAGA 2W9MA 5K9DA 2JIWA 1TJPA 3GXFA 4D6EA 2PWHA 4FLQA 4LEFA 1S2TA 4NI3A 3WJXA 4XVDA 3ID7A 1WOAA 3AYSA 2XU2A 4H8HA 3V5FA 4XKMA 2YDRA 3TYEA 4DWDA 4D6IA 4M6PA 4EPKA 1W1A1 3GUGA 3AHTA 4O16A 3WBYA 1PJ9A 4I3GA 3H23A 3NFUA 2J9ZA 1A80A 2C0HA 4F0MA 2ZVRA 4FIQA 2XIJA 4XK2A 3OA5A 4B4HA 1JZ7A 1DWIM 3W6MA 4K36A 1J5SA 4OE7A 2PS2A 2AL2A 5FESA 1X38A 3S1VA 3AZRA 3R8HA 3KHJA 3ERPA 3WELA 4M19A 4X22A 3VABA 2WNQA 4IZGA 1O1HA 1J0JA 4WEVX 4HYRA 3G3DA 1TWWA 1Q4WA 3B97A 4LU0A 2Z25A 4HQVA 1AW5A 3EZ4A 5DELA 5AHNA 2Y62A 2DIJA 4J3ZA 3ME3A 4IMAA 4C6QA 4H01A 4QE5A 2WJFA 4MY8A 3B0VC 1QNPA 1UD2A 2YYTA 3PP7A 1TPB1 5B7YA 2G8ZA 3AMDA 4FNPA 4UTTC 3G0UA 1F2JA 2L5HA 3BV7A 1ECEA 3IUHA 1CPUA 2VEFA 3B0YA 3G22A 4F3HA 2WSRA 2YDQA 4Y6GA 4LBSA 3H4GA 1GOOA 4PMDA 1NWUA 5GQBA 2XZ9A 3CMGA 4WRHA 1EFZA 2G3JA 3CAWA 4OZOA 1RD6A 3HPXA 4JZ5A 2CIPA 4AQLA 3BAKA 3PN8A 4JTHA 2C1GA 1FWGC 1XUUA 1VLWA 1GVYA 3DKLA 3OGVA 4TIMA 4IFRA 3RLUA 1VEMA 5C9RA 3I68A 3WNKA 4MB5A 4D8ZA 1QO5A 1CGTA 3LPFA 5I78A 1JXJA 5FJJA 1NVMA 4PBEA 1RAKA 1B3VA 1VRDA 4E8DA 1KM5A 1UPMB 2IKJA 4O13A 4BHYA 3I6TA 1U5JA 2PTWA 2WSPA 3QZAA 1ADSA 4LAZA 3MUAA 2VC7A 1C91A 2QPXA 2XUCA 1TVNA 5I3IA 1XC4A 4ZFMA 1GYNA 1EBHA 1D7FA 5D4YA 2QUNA 3Q65A 3TMLA 4HB7A 5JBDA 2BBFA 4S3JA 3U7BA 2O7QA 5DN1A 1GQLA 2C91A 1JULA 3MZNA 1XS2A 3GVWA 3UNDA 4IIFA 1EYEA 1XYZA 3B40A 2HTMA 2Z6IA 1UZ1A 3VFLA 4XIAA 4B5XA 4BQ3A 1AUSL 2UY5A 1X7FA 5KEZA 3CPGA 3KE0A 4CNTA 2PDYA 3R11A 1X39A 3INPA 4AY7A 2NVAA 3W82A 2WC3A 3WF2A 5FCZA 5I3JA 1P4CA 2WSQA 2QCHA 3R13A 2DZPA 3KLKA 2PEVA 1IXPA 4HHHA 1Q2RA 2AQOA 5FEXA 3NL3A 5IHRA 1R3QA 3EKLA 1AQFA 2Z00A 5HINA 3LS9A 3WJYA 4F4RA 5EMYA 3S5OA 1GVIA 2VP8A 2A6LA 4PBGA 1E55A 1YDOA 2DFAA 4IPLA 1VFHA 3ABSA 5EY5A 1JNEA 2AL2B 3LSBA 1MUMA 3KUMA 1NARA 4PB3A 2VL4A 3NYZA 3OBEA 4FB7A 3BH4A 1YMYA 1YPIA 2Y7GA 4A2SA 4PB5A 2ZIDA 2VEGA 3LLXA 4CQDA 3W4RA 4EXAA 1OHLA 1JQVA 3LM7A 1HG3A 3Q45A 3VOCA 3IV8A 3CT2A 4AHQA 4IJRA 2VGIA 3GNXA 2FJKA 1TREA 3GU1A 3WFAA 3FXYA 4BQ4A 4YNGA 1MZRA 3QY8A 1QOQA 3TYZA 4QTGA 3GU9A 2PPGA 1L6SA 3LCIA 5EMJA 2QAFA 4I6VA 1KBLA 3BQ6A 5EYWA 3TIMA 3TFXA 2P50A 3RDKA 3DBPA 1R3RA 3PNUA 2VR5A 1DJZA 1TX2A 5CGTA 2VQTA 1EX5A 2Y5JA 1XYCA 5A6JA 2BY0A 3EX3A 4HHPA 4R27A 1RK5A 3VNIA 2X2GA 5D8WA 2FB2A 4RNHA 3VNYA 5H8MA 2VOTA 1GW1A 3R79A 1SZRA 2A21A 4MY1A 2VKZG 3KEHA 4GHRA 4PZVA 1KBKA 4IPIA 3LCFA 1BQCA 4HNLA 4DQWA 2OX1A 4WR3A 1JYVA 7TAAA 5D05A 4PSRA 3IV3A 3VYLA 3SSZA 2V2CA 5DT5A 1OCJA 2WVTA 1CECA 4DZAA 1KCXA 1EJWC 2X09A 2VDIA 1S2WA 4J35A 1KCZA 5I07A 1ZGDA 2CEQA 4HZMA 4L5ZA 2J77A 2W63A 4XIMA 3W7HA 4GLEA 3DFSA 2DUZA 3P62A 3JZUA 2G4FA 3EB4A 3P8IA 3UY7A 3PHAA 4XD6A 2C71A 2XGBA 4FLOA 5REQA 1SSDA 1M03A 3S5NA 4TO8A 3PBVA 1B54A 1V08A 1MW1A 4GYFA 1P1MA 1F6PA 1UKSA 3PWGA 3IPWA 1K4HA 3CNYA 1YDNA 1F07A 2YFNA 1SJAA 1JPKA 2ZKMX 5A5WA 1F3XA 4I9AA 2AAAA 3EKGA 2VFGA 3O07A 1AODA 3W1MA 1A5OC 3UG3A 4CEXC 2QDHA 3IUDA 2FMOA 4AIUA 3RILA 3HJEA 4IISA 4MJ2A 3FEQA 1DJQA 2J47A 1XQLA 1T96A 1TPWA 1PEZA 1GOQA 5FF7A 2ZXBA 3MUZ1 1XPGA 3TSBA 2YXOA 3BMWA 2IXUA 1PHQA 4A6GA 3C2EA 4GQ0A 3UVIA 3RHGA 3TTOA 5C8BB 3W3OA 2NXHA 2QCGA 3LX9A 4AYSA 3IACA 3T0TA 4NNCA 1NFBA 1OX6A 3S1GA 2Y63A 3LRLA 2WHMA 1EC9A 2VT0A 3QOMA 2XGIA 5AVNA 3W6YA 3WQPA 4JYEA 4YTRA 1FWDC 3CUGA 4AF0A 2E68A 4CU6A 4EK7A 4B3KA 1E4LA 1XSJA 3UZYA 2HXUA 1EA0A 1MEIA 3L7RA 4JTLA 1JZ5A 1IF2A 1TUXA 5A2CA 4IF2A 1BQGA 2FVMA 1UP0A 1MYRA 1E0WA 1W3HA 3E0IA 7CGTA 2CZFA 3OLIA 3KRUA 5EMUA 4H00A 1GKPA 1POKA 4S23A 4PUKA 3H53A 3TJ4A 3FA3A 2POZA 4IL0A 1KM2A 4EAYA 3TZNA 3M46A 3AYVA 1POJA 4YPJA 4L7ZA 3VIGA 2DT0A 2DVUA 3SJNA 3MCNA 4BI6A 1TZ7A 2VCBA 4E38A 2IPGA 3E2VA 4JTAA 3NUKA 1OYAA 4F0HA 3LCWA 1JEZA 2YDSA 4ZZ9A 4OBRA 1JRCA 3TA9A 2DVTA 4MKNA 2F6XA 2H8XA 5C55A 1XCXA 4PTVA 2O9OA 4G8TA 3VGDA 5DMNA 4QQ3A 3G1YA 2F61A 3LTSA 4IG2A 3MMUA 2YCEA 3W7QA 4Y8EA 4H9VA 5AC8A 3O1NA 5FAJA 1QK0A 3WN6A 5FL1A 1NDVA 3SN1A 2WHLA 3SCTA 5IRPA 3H6OA 5TQLA 3W2LA 5FJTA 2FH6A 4KRUA 4DUOA 3U48A 5CZJA 3M1ZA 5F4SA 2E6AA 3AIEA 3H2CA 3LK6A 4GZIA 5E9AA 3MP3A 2E1DA 5FF2A 2I7GA 4XZWA 4YVXA 1X8CA 1V5XA 2VZVA 1KLYA 2W0UA 3ZSSA 1DV7A 4RKAA 4Q7NA 4GY1A 5REQB 3AC0A 4N0RA 2V69A 3ONBA 4ADTA 4QS6A 3ZZ1A 2J7CA 3C3NA 3KTCA 3WL0A 4Z2LA 5C9WA 2GYIA 3LDVA 3GC5A 1CIUA 4HYVA 4A8IA 3BDKA 2ZZ4A 1LOQA 4I9TA 4HCLA 3URQA 4HPNA 5LSMA 3I6EA 3A9IA 4C6CA 4NZJA 1FH7A 3NAVA 3GIQA 4HT3A 5JBEA 4RE0A 1XF0A 3VC5A 1N7KA 5EU9A 5C2XA 4GMEA 1H41A 1UOZA 4JFSA 4AZ6A 2PF0A 2OZTA 4DJDC 4DO5A 4XUGA 3GFYA 3LN3A 2VC6A 1NM9A 2JFEX 3P0XA 2XZ7A 3WCZA 2PDNA 4AX6A 1AVAA 3TUUA 2X8RA 1EJ7L 4DAFA 3WBXA 1I45A 4JFUA 2OGYA 1TKKA 3MDWA 1TTJA 3VOJA 2V9DA 4AXNA 1G7VA 2D3LA 1BSLA 1CXKA 1UB3A 2DJXA 3MO7A 1IXQA 3CAKA 5KINA 4O14A 3CASA 1KWGA 3ZS4A 1F3EA 4P7RA 5I3FA 2ATSA 2PTZA 1LOSA 1UZHA 4AF0B 2VX7A 5EFDA 2PA6A 4RZ6A 1N55A 3GC2A 4PMZA 4U28A 1MUCA 4H9YA 3ZOAA 3W23A 1EWEA 4MFEA 2VXNA 1DVJA 2C19A 4UWMA 3WF4A 3WLHA 1EPVA 4DBEA 5D2TA 5AZ1A 3S1XA 3DX5A 1YXYA 4WGHA 1R46A 3E6EA 1QDSA 1V7AA 1M7JA 3LMZA 3TAKA 1R86A 2W4XA 4I9MA 1A5AA 3BGGA 4AXKA 4ZFCA 4HCDA 3DAQA 4B2DA 1HKIA 2GSJA 1TB3A 2J62A 1N82A 5LA2A 3AZSA 2HJPA 1NFGA 5CSYA 4JIPA 3IAQA 4Z1YA 4Z17A 4P5UA 2X1RA 2G0WA 3T0CA 1BSIA 4MIMA 1R8LA 1BF2A 4KF1A 1KFLA 5B80A 3STCA 2G3MA 6CGTA 2OKTA 3U5UA 4ORMA 1A0EA 5CSSA 4IG2B 1CGXA 2VC9A 1DWHM 1WQ5A 4UZUA 4Z2KA 2WMIA 2XFRA 3W85A 2P10A 4LBUA 2NUWA 2QDGA 3S9ZA 5K2ZA 1CB7B 3BURA 2GQAA 2V3FA 2YL9A 5AC4A 1DWAM 2RDXA 4AMCA 3BWWA 3NEHA 1K6AA 3N73A 1G69A 3HMJG 3T44A 2B0MA 1LG1A 2WYSA 1B31A 3VX1A 3KWSA 1S5MA 4NZ4A 1B3YA 4DJFC 1B3OA 1QPQA 1US0A 3HPZA 4RPPA 2OYMA 4IM4A 3GXMA 3PZGA 2OSWA 1SW0A 3RF9A 1OYBA 2J13A 4DX3A 3EXRA 1E6SM 2IQDA 4JIIX 4GYKA 1ZFJA 4LBRA 1VPQA 2ZBTA 2GGHA 1TPH1 1QI2A 3PC0A 5FOOA 4AIOA 4F0KA 4FF7A 3QR0A 2CXEA 2D3NA 4QAIA 3VD5A 3A24A 1N8IA 1NOFA 2GQ8A 3GZAA 1EUAA 1ADOA 4MPKA 1XCFA 1SU5A 1BHGA 1JUEA 2G37A 3EMQA 3TYCA 3R12A 3R1ZA 3CQHA 3TVAA 4LB3A 2FMNA 3AIVA 2ZUVA 4GYPC 3GYEA 1R7AA 3VNKA 1JDFA 1V6XA 4MNMA 4BQ2A 1HZYA 4M7SA 4S3BA 3SM0A 5HWNA 3JS3A 2X7WA 3QQ0A 4ICMA 4DM2A 4C6MA 3W74A 4FI4A 1J0YA 4Q4PA 1DIOA 2INFA 1FWAC 3AXMA 1WNOA 3HURA 3NXLA 1XDJA 1IR1A 3IWPA 3CXOA 7PTDA 2ZTJA 2ZZ1A 1IIHA 4AFYA 1L8NA 2BDQA 2VZOA 2Y24A 4GD0A 1JF6A 1OFAA 4EIVA 4B2DD 2XN1A 3N2MA 1SJCA 2QCDA 1PCKA 4LF1A 3AO0A 3LQLA 5CG7A 1GORA 2YSWA 1W5MA 3RIKA 2VYOA 1VS1A 4IWWA 2ATMA 3NCOA 4MOZA 3T7VA 2EJ1A 4ZCWA 4CQCA 3E74A 5A2AA 2Y7EA 1O66A 4IGNA 2PWEA 3QZ6A 2JE8A 1B3ZA 1ISZA 3PAJA 3RX3A 2BX7A 4ZQPA 4ZBCA 3N9SA 1FCUA 2D73A 4P2VA 1K7FA 4HVXA 6ENLA 3KAOA 2FDMA 4CUCA 4GI9A 2LLEA 4AZCA 5HMEA 4MADA 2GLKA 4L4OA 1X1ZA 4HZ6A 3O6AA 4H6EA 4ZQRA 1XLIA 3ZSTA 5FJPA 2J6XA 2DZUA 5HNUA 2WMIB 2YLLA 1AMYA 4JTGA 1YEYA 2R24A 4KIRA 2J7EA 3LGGA 1GOKA 4FXSA 1KGXA 3W7IA 1JVNA 1SVDA 4PCFA 3GQYA 1JF5A 2IQ0A 2CW6A 2CBIA 4WCJA 4DYEA 3JW7A 3T0BA 3AZTA 3WENA 1XYAA 2WHKA 1NEYA 3MQTA 3EWWA 5EGRA 4UOZA 1JL8A 3VMOA 4J3WA 1TPFA 4CEUC 1JZ6A 4IUGA 4RNIA 3NZRA 2G3IA 2YA2A 3UWEA 1SW7A 3GSMA 1S39A 1W8GA 6TAAA 4YN5A 4S2BA 3S9IA 2WJEA 1OSEA 3MWCA 4C1NA 3N19B 3NQBA 3B8DA 4IIBA 2HSAA 2I5QA 3O15A 5FKYA 2QJIA 4I5UA 2XIIA 3G77A 2QMJA 2JK2A 3II1A 3OLDA 2ZFAA 3RU8X 3DOPA 3WH8A 2OO0A 5DF0A 3PFMA 1H3GA 3BG3A 2QJJA 1RXOB 1TCDA 1Z32X 2NLYA 3CS2A 2DQWA 4J40A 3IIPA 3ARXA 1VBRA 2X1SA 4KEUA 2VWTA 5E70A 2V3DA 3SJ3A 1KB3A 4E8CA 4P7LA 1B1YA 2XWEA 5B7ZA 3VIFA 1P7TA 4ML9A 1H0IA 1RD5A 3CUXA 1IZCA 4A8NA 3L21A 2FPTA 3LENA 1P48A 4TXEA 3G1RA 2D2GA 2Z2AA 5BU9A 1S3HA 3CMFA 4GBDA 2JF7A 5XINA 3S6TA 1NQKA 2QUVA 5GNYA 3F03K 2ZRZA 3VD7A 1PIIA 5HQMA 3IUIA 2X40A 3RR1A 1TX0A 4J3SA 2NT1A 2DZWA 1V6TA 4LYKA 2WLYA 3CAQA 4AZ5A 2ISVA 1R3WA 2ZOXA 4HHMA 5DXYA 1H09A 4H4IA 3RCNA 5LIWX 3NA8A 1IV8A 1W5OA 3OGSA 3RMJA 5A1AA 2HS8A 2QCDB 4JYFA 3ITXA 3GH5A 5LGZA 1VENA 3VCRA 3QKEA 2WK2A 4JFVA 1EO7A 1S5TA 3WLLA 3AIRA 4E3VA 5JQ9A 2P8CA 2EQDA 2PFHA 3WNOA 3FGCA 4FS9A 1HKJA 1SR0A 3GU2A 3AMKA 1DIEA 3RGTA 4FSAA 5AVHA 1F6KA 1LTDA 1RR2A 3VNDA 3IGXA 2V0TA 4Q22A 3W84A 4OVXA 3GY1A 3GXTA 2JGQA 4DJDA 4YVVA 3ZJ6A 3R0UA 2QCLA 3MW7A 3EWCA 1EJSC 4N9BA 4XAFA 2ZA1A 3QPYA 4DAIA 4AZCB 4EF9A 2ZCGA 3M0MA 4IGMA 7XIMA 4OUIA 2E9LA 1MXSA 1TA3A 4WLCA 4LRSA 1W91A 1IT8A 1N8WA 3N04A 2OQLA 4PRWA 1TV4A 4M7TA 2P3EA 5A6MA 1UR9A 4UTKA 4O54A 3G24A 1V93A 1RJRA 3G0XA 4KEMA 1GJWA 5C5YA 4KEVA 1P0BA 1FWRA 1BVWA 4ZB0A 1EZ2A 1G0CA 3DHUA 3EOLA 1H50A 5EB8A 3ARVA 2JF6A 5RUBA 1C92A 2O56A 4JTJA 1J79A 2ZUTA 1GONA 3UT0A 3TW6A 1SFSA 4NXSA 3VM7A 1VD6A 2GDVA 5CBJA 1OD0A 2GOUA 1UYQA 3LHZA 4R34A 5H1WA 2OEKA 4DYKA 1O5XA 4JQ2A 4C1NB 1NFPA 3LNPA 1ISWA 2EJAA 3QGKC 4WDXA 2F38A 4NNAA 5LHEA 3NZ1A 4IIGA 1ZBVA 3IJDA 2NW0A 4JTEA 4EPEC 1EOKA 3GVQA 2VR2A 2YZ5A 5CPQA 3EX4A 1LQ2A 4GY0A 4GISA 2C1HA 6REQA 5LNWA 4KWSA 1W31A 1CLKA 3P80A 4UQ9A 5EKYA 1G4PA 4KS0A 1NP2A 3RR4A 1GEQA 3W37A 4RDYA 1P7TB 2IPFA 3CZEA 4P8UA 4B5SA 2VI0A 1FHUA 1OM0A 5F2MA 4R7OA 1B9BA 4IQJA 3RLGA 1SO3A 3KZPA 1YRRA 3UG8A 3J7HA 2JGYA 4IPPA 3TC3A 1Q6RA 4DJFA 4MB3A 1KRAC 1TIWA 1WV2A 4IFOA 4AC7C 1XYFA 2VVSA 1RCQA 2Z1BA 3ZWSA 5KZ6A 4YTUA 5A6LA 1PAMA 1L9WA 4MB4A 4PH6A 4LV4A 5K9XA 4DJDD 1HP4A 3BCDA 4CCDA 3HQ1A 1XPYA 1CYGA 3G8EA 2FVLA 2PDGA 1S1RA 4JCLA 3AMLA 3FGCB 1GNXA 3TZFA 2E6YA 3M6YA 2QQ6A 3H2AA 2OTDA 1E9LA 3HGRA 1HJQA 4QGCA 4ICCX 5CQ1A 2J4GA 1QBAA 2R91A 3P5ZA 1PX4A 3VNJA 3TCSA 4K38A 4BK9A 1TCMA 3P2VA 1O1ZA 3RM4A 2BOEX 5BRPA 6XIMA 1MRQA 4Q4MA 1H7XA 2PC4A 2EPNA 4J2PA 1CI1A 3ZMRA 1LRTA 1FKXA 4EACA 2RHGA 1TA3B 1AK5A 4QG8A 2FGLA 1E73M 1OQFA 1RZMA 4NL1A 3STPA 2F9RA 2Q02A 3W9ZA 4CQ8A 3C5QA 3DN5A 3DENA 4LNCA 1QNQA 1PL9A 2P88A 1C9DA 1IYXA 4IX2A 5A8MA 1JPHA 2Y61A 3QR1A 1XR2A 4M5PA 5GVJA 1JJKA 1OY0A 1GVFA 3FYYA 2BV9A 3KRZA 2HPMA 4XZIA 2RFGA 1WUFA 4K37A 4M0XA 2EHHA 3SR7A 3WMSA 4A35A 2XM1A 1L6YA 2B7OA 3OZOA 1ICPA 5T91A 1OCQA 3CWOX 3D0CA 3ABRA 4GO8A 3CPUA 2ZDRA 1R5YA 1K8XA 4NZ5A 3APTA 4BS0A 3U8GA 5C9XA 1SGJA 1VF8A 5U4NA 4EKJA 2R94A 4UOJA 2VD8A 2DIKA 3TK7A 3SIMA 1X96A 3LXBA 1FP9A 3PUEA 1EEXA 1FVPA 5FF3A 2X42A 4PEKA 5BROA 3CO4A 3EOOA 7A3HA 3LHWA 2Z26A 2B4GA 1BG4A 2P3ZA 2D20A 2IPJA 1TYGA 3AISA 5BRQA 5CC3A 5FAGA 4QCFA 2V5JA 4M1BA 2DT2A 2JBMA 1ZY9A 4H83A 3L9CA 5HUPA 4RL3A 1ITCA 4HZ8A 1I60A 3QW4B 1H7PA 6REQB 2CLOA 1P5BA 4S2CA 2HE8A 3M64A 3ARSA 1H5YA 4EXQA 4A4AA 1YPFA 1LBMA 1KTCA 3FX4A 5LNRA 2ZYFA 3K1GA 5AHEA 3WLTA 4WSJA 2FPYA 4Y9AA 2Z27A 2MANA 2YDAA 1KBBA 1HJWA 4DJFD 2XSBA 3AIWA 3UZJA 3FNDA 1OFQA 1W3JA 1C3FA 2QV5A 4O28A 4MTVA 3QKZA 3ZT7A 3WK1A 1WKDA 2Y4SA 2QYGA 4O52A 4UIOA 2ZRWA 1EQPA 4XBKA 1FUYA 3VIHA 4GI8A 4MJ4A 2HVMA 3DFYA 1NJJA 1EGMA 1HKWA 1PE1A 1EL3A 3AXHA 2OO6A 3AOFA 2G4JA 1FKWA 3GK0A 2QW5A 2DT1A 3MSRA 5ABFA 4QDWA 1D3HA 2AGKA 4Q7IA 4R5EA 1R3TA 5A6AA 3HGJA 2OJPA 1W6TA 2HK1A 4JIEA 1A5CA 2Y1HA 3LBMA 3FSUA 3C56A 5CJMA 3IJ6A 3F2DA 4HNUA 4HU8A 2CZDA 3ARUA 2G3FA 1VKFA 4DM1A 3DG6A 3DYMA 4AC1X 2F8QA 3M47A 2W27A 3NOEA 3A4AA 3NDOA 2CHNA 3WLKX 1F3TA 2Z1KA 3MC5A 4O11A 4JEQA 2ZRUA 3PZNA 1XLAA 3BZJA 2HBXA 1HF6A 2WCAA 1GVQA 4FO4A 3QQ1A 3CHFA 4H9MA 2WSKA 3AXIA 1QOPA 2YCJA 1K8YA 1L6WA 1XFBA 1Q8JA 2NQHA 2A3CA 3SCQA 5FD0A 4M6UA 3AAMA 2QPSA 5D2VA 3W1TA 4L6HA 4LC8A 2I1OA 2Y8UA 4JD4A 2JKPA 4HPJA 4WJ8A 1JCTA 2H3DA 2DQXA 3QV7A 3VK5A 4RZ5A 1GVOA 1XC6A 1V3HA 1DL3A 4FNUA 3S5YA 1KQYA 3FYOA 1I8JA 2OFJA 5EMMA 2VEPA 4Z1BA 3OVPA 1I1WA 2DDXA 3G1AA 3QV6A 2Y5SA 1FCBA 2FGZA 3T07A 4US5A 5D9NA 3G1XA 3NPUA 4TX8A 3AI0A 3UR5A 4N9DA 4XD3A 3BLEA 1M53A 5FF0A 5HMFA 1BRLA 5EL1A 4QISA 3EWBX 5CPLA 2XSAA 5FJOA 2O4QA 3PR2A 3MVTA 3M9YA 1JZ8A 1O5QA 3KOYA 3O7UA 4F9DA 1TPDA 1NDZA 4WDWA 1EHNA 4NX0A 4PUWA 3RG6A 3T42A 1MFUA 3ABZA 1QMLA 2RJHA 2Y70A 1LBLA 1A5SA 4RZ4A 1PCWA 4HK5A 4QXIA 3WH7A 2J24A 3SO7A 1Y0EA 2X0HA 2OOGA 1EB3A 1K77A 3OBKA 2PTYA 3EB2A 1D2KA 1H60A 2PDJA 4L80A 3ZIZA 1RA5A 2WC4A 4KWWA 3M5ZA 1SW3A 5M2FX 3BAXA 1W9VA 1TPVA 2C15A 3GBDA 5C6MA 1KQZA 4KW2A 2WAGA 3PPHA 1OK4A 1YXDA 1JFXA 3UU0A 2RDUA 3ENLA 1YTEA 3VDGA 2YA1A 1UBSA 4YLWA 4NRRA 2YFOA 4YL2A 3W1UA 5DX7A 2E25A 4JTTA 1OCNA 4EP8C 2INEA 2VUNA 1EX1A 2FZBA 2FKPA 3B8SA 3ZWTA 4G56A 1LORA 3L4UA 1VEOA 1W37A 3VMPA 2D24A 4GX8A 5ABFB 1D7KA 1T99A 1UWAA 1BVZA 1KA9F 3N3TA 4O12A 1D9EA 3ARPA 1B5TA 3N4FA 2AQVA 3W22A 4JBRA 3M0VA 4UTFA 3WMBA 4AB4A 3U2CA 2DVXA 2NV9A 1Z7AA 3N9RA 5T9BG 3GE7A 4QQUA 2DSVA 1ZNNA 4W8BA 1YDYA 2ODOA 4KBXA 1HL2A 5LNSA 4R7WA 4G5DA 3GC4A 3W72A 2D2JA 3QEZA 2PDKA 1CEOA 1GJPA 4XSMA 1W1VA 4E2VA 5ABGA 1KGWA 3W7RA 1UUQA 2P1FA 4TVDA 2ONEA 4X0VA 2OLHA 1EPXA 3HG2A 3GRIA 3OIHA 2VFHA 2YBTA 2WMKA 2XN2A 4DBDA 1EYWA 5IDIA 2QUTA 2EKGA 1A0DA 2F6UA 3V16A 1I4NA 4S3KA 4US5D 3DZ1A 2XH2A 3R4IA 2WVUA 1RVKA 1DKWA 3DERA 4WKFA 3VIOA 4PRRA 1O12A 3TONA 3HA1A 2DPEA 4CU7A 2ZXQA 5HAOA 1OEPA 3CZKA 3EWXA 3W2UA 4HCHA 4EANA 1WXJA 1FHVA 3MKKA 3UVAA 4IJBA 3KL3A 4M29A 1G01A 2C8NA 4LW7A 2X2YA 1O95A 2PGFA 4XZBA 3VDCA 3EX6A 3NZPA 2V8ZA 4K6AA 1BRLB 3JVAA 2Z7GA 1Z69A 5PTDA 3PUOA 5AYBA 3GXDA 4JTIA 2YL6A 3LHUA 3CLMA 4U5IA 3TNBA 2EBNA 1E0UA 4PSPA 3UPWA 3UWZA 5XIMA 3GDLA 1Q45A 1KCLA 3WF3A 4QNWA 1AJ2A 2PURA 3LCLA 2O55A 3W1RA 4HGXA 1XSIA 1VFFA 4LYRA 3NO5A 1OFRA 3F4WA 4UC5A 3DGRA 3HPAA 2RDWA 2E9MA 3L2LA 4E4UA 3IRDA 3MKVA 4MF4A 1LDCA 3GNRA 2BMBA 1OIFA 1WB0A 3BUVA 4PUEA 1MEHA 4PL1A 1L8PA 3B03A 1E51A 1GUVA 1V6VA 3TEVA 4L4MA 4GO9A 3HFYA 3E0LA 4GOAA 4KQNA 4ML4A 4H7ZA 1TMQA 3TYBA 4AISA 4R85A 2DORA 4LALA 2PGEA 1SM9A 3NQFA 4MYXA 1VBJA 2PAJA 1OIMA 1YBQA 3S83A 4GIAA 1FH9A 4I8YA 2QVHA 3VE7A 1W9XA 3TTYA 1XIJA 2XIBA 1SQ7A 3APYA 1ELSA 1JI1A 3KDNA 3W00A 1JPIA 2VRJA 3M0XA 2YW3A 1DORA 1GYLA 4UTMA 4KKXA 3VIKA 3BVJA 1XJBA 4FNTA 2X16A 1ZL1A 1RHCA 5D09A 3CT7A 1M65A 2ZA3A 3HPSA 5AYYA 4NVTA 1OF8A 3B04A 1V3IA 2BY3A 2KX9A 4PCSA 1GW9A 4UFMA 5E5CA 4W89A 2PU1A 1CXIA 4GJIA 1KKRA 3G6MA 4X2RA 2CCRA 2A3BA 3GS6A 4OECA 3TN3A 1XG3A 2QCCA 1DQUA 3CLWA 5I03A 3BQ5A 3BAIA 1GTEA 2WPBA 4B9YA 4ACYA 1SFTA 3CQJA 2XYLA 3GLCA 1C93A 4EXBA 1JCXA 4HZ7A 3RM8A 2GQ9A 1HIZA 4YTSA 1QW9A 4AU0A 1M7PA 5DCDA 1A53A 2PDLA 5DEZA 3EDEA 1AMKA 4W7UA 1OF6A 4M51A 1Q6CA 3H4WA 3VUPA 3MYOA 5DCEA 1OYCA 4WX2A 5AHIA 1QHPA 1R6WA 2Q01A 3U3HA 2XH7A 4LCRA 4EAMA 3XISA 1R2RA 2CNCA 3WD1A 4UUIA 2A79A 1UA3A 4I5XA 1PKNA 3W1XA 1QVBA 3URNA 1TWIA 1J10A 3R2GA 3SZ8A 1GG1A 1T0OA 3N2TA 4L4LA 2VEKA 5DLCA 4A22A 3E5BA 1OINA 3ZLGA 1VB9A 3PTMA 4XG1A 3AWOA 4MYAA 2WKJA 3ARYA 5E9XA 1TE6A 3HZ3A 2FQIA 3ZFHA 5U7SA 3WUBA 4W86A 1FOBA 1KTBA 2OMAA 4PEEA 2DSUA 3S2LA 4A8RA 3H4XA 3EMCA 4WSKA 3KP1A 3MB9A 3W7LA 4UQCA 3NTYA 3ZR5A 3TXZA 2EEXA 4JIQA 5MF5A 1XDMA 1KBIA 1DEDA 1E40A 1MI3A 3M0HA 1Y65A 1EDQA 1P0KA 3SCUA 4NZ3A 4W9TA 2A5HA 1U1UA 3M44A 3SCPA 5DFAA 2Z2BA 1ZCOA 3WFLA 3V35A 1DHKA 3MTWA 4J3TA 2GQ3A 1PWMA 1PIFA 4UMCA 3ZT5A 3VNLA 4AAJA 5MHBA 3E0VA 4JY8A 4OKDA 3KCLA 1X1OA 3SQLA 1LRQA 3B3DA 4UQAA 3T4WA 2IS7A 4N2YA 4R3UA 1A3WA 1ZZMA 1TE1A 1SUXA 1IR2A 3LYEA 3O06A 4OHQA 1XKYA 2BVDA 3S2CA 1YBQB 3F4VA 3N2XA 3QMTA 4J3XA 2FZ8A 3AS2A 2QCMA 3N3MA 4HTBA 4ILSA 4D72A 4QX4A 3N2BA 5CSUA 2YBVA 4GWEA 2E5DA 3SUTA 3L0KA 3M0YA 2REQA 2OYKA 3O6YX 4UR9A 2R1MA 1TR1A 5I5RA 1BEUA 1XIGA 1KXTA 4PUMA 4MFDA 1XYBA 1TJ0A 1F8IA 4ZTXA 4MG4A 1YNYA 2ZRXA 2QLYA 3N29A 1TPC1 2X7VA 1C9WA 1QI0A 1VFUA 4JHMA 4BWLA 1JPDX 1W5NA 2XIOA 4DJEC 4MLJA 3PBMA 4JN7A 4RE2A 3VI2A 1JDCA 2FHCA 1THFD 2ZX5A 1M1BA 3T4CA 5A3HA 2PDUA 2OSXA 1SZEA 5AFDA 3W6LA 3HB9A 4GYJA 4G2DA 4ACZA 1Q7QA 4GI6A 3MCOA 3N11A 1LQ0A 4RE4A 4GXMA 3E2RA 1SZFA 2J8GA 5E0CA 1D3GA 3UY8A 3WEMA 3AU6A 1WDPA 3M6DA 4ZQMA 4AWEA 2BTMA 4UTLA 1Q6QA 1K1DA 2XIMA 5G1MA 3GFZA 3T9PA 1EZWA 1QNRA 4YHEA 2AOSA 4MWAE 3H2MA 5A8GA 2WXDM 4DI9A 3LI1A 4DO7A 2ZUUA 1M5WA 4X0NA 4DB7A 1R9YA 2GUBA 1R2SA 4H6QA 2VDGA 3CBWA 3GTXA 4UXDA 1S1PA 1CENA 3DGBA 1E6QM 3KXQA 3T8QA 1R9ZA 2CKRA 5FIPA 3CO8A 3OYZA 4Z2JA 4GH1A 4HBKA 5HA7A 3H22A 4IH3A 3LU2A 4HNOA 4JNMA 1Q6EA 4KCTA 4JICA 3ZVIA 3KRBA 1I2OA 3TE9A 2HROA 3IJ7A 5D2WA 1TV2A 3MI6A 3RNDA 1ONXA 3UA4A 3RRXA 3G1HA 1PTGA 1WDWA 5CJ5A 1XH1A 2C79A 4CVUA 4GVIA 1Q6OA 4OV9A 1H5VA 3O63A 2AAMA 1AD4A 3H26A 3B0XA 2DSKA 1K8CA 3P67A 2PGWA 3EEGA 3W2KA 3GVGA 2I5IA 4I5RA 2FTYA 1KBJA 3W86A 3FOKA 4NYUA 4W93A 2Z7KA 2ZX7A 5FJUA 1ISXA 4WJXA 3PPCA 3RXZA 2D2HA 2FTPA 2PGRA 3LBOA 3KX6A 2F2KA 3ES7A 4KCWA 2R6OA 4H8NA 3K13A 4QHRA 4UZSA 2B7PA 4CU8A 3R7MA 4PA8A 4HOZA 1VGAA 1LBFA 2FHFA 3ELFA 2X05A 2REQB 3W2NA 5HUOA 1OADA 1AQ0A 3I7QA 4B91A 5I79A 1YE6A 2VZTA 3WIJA 1KXQA 5CXPA 1RH9A 5D2XA 5BCAA 3KP0A 4C6LA 3VCCA 4FXFA 3TWAA 3U9IA 3GHRA 1PKLA 5AC7A 3WG6A 3IJ8A 2HK0A 3LBCA 3GNDA 1FFQA 3H21A 3LMYA 4L61A 1E3XA 3G1DA 3U4FA 3GVRA 3C0SA 4XISA 3SCSA 4GXPA 2CLPA 4CQ9A 4ACZB 1E4MM 4GPNA 2A7RA 3UZWA 1H1ZA 2VQUA 1JNDA 1ICSA 4G1KA 4UFJA 1XL9A 1RLDA 3VKDA 3BICA 4GVGA 3ITOA 2RJGA 3URBA 3TAOA 4C5ZA 3LTPA 1VCVA 1IEIA 3PZTA 4JIRA 1DXFA 3MHUA 3RJYA 2PZNA 3F2BA 3TDFA 5CKSA 1TQXA 3F4DA 3DFPA 2QF8A 3BARA 3GFXA 4AVOA 3O6DA 3WH5A 4TX6A 1KFBA 1VFOA 4LY4A 4DVOA 2DY3A 3KVLA 2GUUA 3GYCA 3MSGA 3RX4A 4ORIA 1I2RA 1LT7A 2WZEA 1AJZA 4ECLA 3N13A 1VFTA 1I2QA 3P82A 1A5NC 3QBUA 3G0SA 5G2IA 4ATLA 4ERIA 3R58A 1UROA 3CWNA 3L4VA 2GPTA 2QJMA 4KETA 5LXEA 5HQLA 3NG3A 1UQYA 4CVWA 1PZ3A 4LUJA 3B05A 4LH8A 4N4QA 4RPQA 5F1UA 3PAOA 3SI9A 3ZYZA 1JG9A 3THAA 4S39A 4UMBA 5HJYA 3KBSA 1LUCA 4RCXA 3I4KA 1IEQA 2O9RA 3BPWA 3RO8A 1LWJA 3P5YA 2FLIA 3PZVA 1S2VA 4NG3A 1B57A 3SUVA 4CCCA 5KTLA 3V3WA 1YW1A 3W1NA 1GTHA 4HU4A 3RUBL 4F66A 2HE5A 1ZJAA 2UZ9A 5A2BA 4WZHA 2UY3A 3TWBA 3OA3A 1FFRA 3B8IA 2CYGA 2PDQA 5BZAA 3UZZA 3TV8A 3W7CA 2GUYA 4Q3MA 2QJGA 1G67A 5BWFA 4DUXA 3SGUA 4NX5A 3SEPA 2EPMX 2J7GA 3GG7A 1HT6A 1FWNA 1S3TC 4U2YA 1RQHA 3SUUA 2KAUC 4RK8A 2G96A 3CV1A 3HQPA 4LVGA 3HO8A 3MSYA 2BASA 2ZUMA 4C6NA 4DBSA 4XVEA 5J5RA 4HHLA 1TZ9A 1DE6A 4M80A 4JTSA 1F4HA 3QV8A 3KBJA 1ZSXA 2BXZA 2MNRA 3EA1A 3FJNA 4U4MA 3UZXA 1UP2A 2OU4A 4LUYA 4MZ1A 1DIKA 1YNPA 1QT1A 6XIAA 2OZ0A 3T0DA 1LROA 4IICA 1BTCA 3CV2A 4L6OA 5HQEA 1XD0A 1KFWA 3WNPA 3NM3A 1DYSA 3A5FA 3LUTA 2Y0FA 1ZLPA 2E40A 3RCYA 3M41A 4KCVA 3NR0A 4E4PA 5AC5A 1OT2A 5AN7A 1UWIA 2V3EA 1TV8A 3GR8A 1VYSX 2DZXA 3NNTA 4I90A 3GAKA 5IM51 3E38A 2E7FA 2Q6ZA 3BLIA 5CBBA 4HNCA 3ZJ8A 2W92A 4YCPA 1L2QA 3GX9A 4MMWA 1OG6A 3IIXA 2EPOA 3EXSA 3L23A 4GJJA 2OQYA 4LRTA 3QR3A 1S38A 1BKSA 2WZIA 4HA4A 3HF3A 1IXOA 5CPSA 5G4HC 4KMQA 3TR9A 3NJ3A 4HMNA 4QIUA 3OVGA 5HWJA 1XIIA 1OG0A 2XVLA 4YWIA 4Q32A 1IT0A 1EIBA 5JH1A 4NZCA 5BWAA 3W87A 3EWUA 2TPSA 4BF9A 3VE9A 3SRHA 4GIEA 3TP4A 3WUGA 1GT8A 3WEZA 4MLRA 3ZM8A 3MJYA 1OX4A 1H7OA 2WLZA 4AD4A 5D30A 1MO0A 1RY8A 1U2YA 4PYSA 1E5NA 2WOQA 3S4TA 2W66A 1UD4A 3W7MA 1PX8A 3WDJA 3RO6A 1C8QA 3CL7A 5A95A 4DJEA 1DXEA 2A3EA 3E2SA 3BJTA 3VKCA 4W4QA 4F2UA 1K9DA 3WMLA 2G50A 4NF7A 2VURA 3C2OA 2DJLA 2DZBA 2J7HA 2RDTA 3BAYA 1YDVA 3POCA 1ECQA 3BK0A 2ISSA 2X30A 1MXDA 2BWGA 1XLFA 3WNMA 1BTMA 5D32A 2NX1A 4REQA 1R47A 2DW6A 2BP1A 4GH3A 1R3VA 1FHLA 4L4PA 1QWGA 4R88A 4M56A 3AHYA 4J28A 6ALDA 1E1EA 2XINA 3QV9A 3LXAA 1A5KC 1DJGA 4DZHA 4N02A 1PZ0A 2J79A 2ZXAA 4D6FA 4NY2A 5EFFA 4DIAA 3C4UA 2XSXA 4DHGA 1Z89A 4ROPA 1RALA 3RITA 3OYXA 5D9PA 1GCYA 2PRHA 4CNNA 3VVGA 4HSHA 1ME9A 4NKCA 4FLRA 1EOMA 2VFFA 3NPWA 2BY1A 4C6FA 1BVNP 4AWSA 5IHSA 3A4WA 1F73A 5FSDC 2V5DA 3BOFA 1H2JA 3ITVA 1QOXA 4IPJA 1LYXA 2VJXA 2Q09A 5L6UA 1MMFA 3BV4A 3M7SA 1WUEA 3QPZA 1U83A 5LNUA 2DSZA 4D1IA 1FDZA 4JQ4A 3WLJA 3PM6A 1P0DA 1HVQA 1VFSA 1TQJA 1SR9A 2VFEA 3QOKA 2PSNA 3M5VA 4I7UA 3TW7A 3JZEA 5FEPA 1VBUA 4UTHA 4DUVA 1JIBA 4GNVA 3ARTA 5JVLA 2B31A 1J2WA 1G1YA 3UFYA 4YXGA 5K9CA 4EF8A 3UA3A 3TN5A 1PS9A 3PUGA 4NXKA 2QKFA 3G18A 1J11A 3ITGA 4A05A 1V3KA 3CL6A 3DG7A 1YKWA 3CM4A 3EWYA 4KWVA 2DU2A 2B81A 1U22A 4JDYA 4Y8FA 4WOZA 4HN8A 2VX5A 2GVLA 3TSMA 2ZZ6A 1UIOA 5I77A 3QH2A 4LCSA 1VYPX 1GHRA 2CBVA 4NJHA 5M3WA 3P93A 3WUFA 4DJED 4CNOA 2Y8VA 3PPGA 4INFA 4DNMA 1EQCA 2P0IA 3AJ7A 4YCOA <