5CPTA

Disproportionating enzyme 1 from arabidopsis - beta cyclodextrin soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
b'SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cptA01
4GXPA 3ZSSA 2CETA 3WFLA 4XZBA 1JXJA 4UQAA 3K8KA 2BNJA 2RGLA 1W2VA 2VT0A 5CPTA 2WHLA 4KGLA 3N15A 4C7DA 1BLIA 1SMAA 2YA1A 1UWUA 1BYCA 3ALFA 2XFYA 3U57A 2FHCA 3HU7A 2BVYA 3ZIZA 2FHFA 3OZOA 1VB9A 1C93A 4TTUA 3AZRA 5M17A 3RIKA 1QI3A 1PX4A 2WXDM 3VD5A 4MPKA 5CLWA 4KH2A 2FGLA 4YN5A 3POCA 3VIJA 5BXRA 3AZTA 2EJ1A 3MV01 3SUSA 4ACZA 4PTXA 4Z2LA 3B9AA 2W91A 5A6MA 2W4XA 4UTFA 4AD3A 1QOXA 2VUYA 1DWHM 2G3MA 1B3ZA 4U5KA 1QI4A 2XIIA 4WKFA 3GXMA 3RM4A 5JBDA 1CGWA 1ODZA 2UWFA 4JAWA 4PCSA 3CIVA 4ZXLA 3WSUA 1DEDA 2D24A 1E55A 4JCMA 4M29A 3WBAA 1J0HA 3VKKA 1V6YA 3WENA 2VVSA 1JDCA 2Z1KA 1JI2A 3T08A 4AWEA 4WLCA 5A6BD 1H3GA 3WL1A 3K4DA 1ZBVA 2WHMA 2X0YA 1K6AA 4AEFA 4BS0A 4W89A 5A2AA 4AISA 2FDMA 2WSPA 3PN8A 3PTMA 2X0HA 4PBGA 1CGVA 1B2YA 2CHNA 4EANA 1E4NA 1H5VA 1E56A 2FH6A 1J12A 3OGRA 3GH5A 1HJVA 2FGZA 5HDRA 3CZLA 3LPPA 4TVDA 3BAYA 3CBWA 1JZ2A 5KZ6A 1XH0A 3WF2A 3L4TA 1KQZA 1PZ2A 2YLAA 2YBTA 3PTKA 5FKYA 3VO0A 4NRRA 1V03A 4RE3A 1O7AA 1WO2A 3A47A 1LQ0A 2W92A 4PMDA 4K68A 3ZJ6A 1NQ6A 3A3HA 3CMGA 4UZSA 5HBFA 2EPNA 4IISA 3QOKA 1UZ1A 4AIUA 1E43A 2CEQA 2W61A 3LMYA 3ZJKA 1HJXA 1GCYA 1UD4A 4N42A 1V08A 4W7UA 1L0PA 3T2PA 3ARSA 3WD1A 2PWFA 3AJ7A 3OIHA 1GUVA 1W1VA 5BCAA 4X0VA 2VCCA 4W7WA 1UD2A 1V3MA 5EFDA 4AZHA 3BAWA 5GPRA 3WD4A 2VZUA 1MXGA 3CTTA 3ALGA 1NOUA 1CTNA 3L4UA 4QP0A 2DIEA 1F4AA 1EDTA 3ARTA 5GNXA 4D6EA 3W6MA 2BHYA 1JZ4A 3W0KA 3WF4A 1ISZA 4U33A 2MANA 4UFIA 2PC8A 1SMDA 4DWSB 3BAKA 5JIWA 3W37A 3DHPA 3W27A 1B30A 1NH6A 3QR3A 2X09A 1XH1A 1CYGA 1C90A 3GNPA 3OLIA 1EIBA 1VF8A 4ZE5A 1DHKA 4J3TA 3BSGA 4HTYA 2J7BA 1W91A 5D9OA 1C91A 3WF0A 2CERA 1UKTA 1VBRA 1EHAA 1X1NA 2EPKX 4PEEA 3AOFA 1VFUA 1KGUA 3VU2A 1UWSA 4WIWA 2VRKA 1GOMA 1MVYA 3MO4A 1KXVA 1N82A 1E6NA 1UR9A 4OIFA 4ZXOA 2X05A 2XVKA 5BXTA 2F2HA 2BXYA 1OSEA 2JEPA 3DC0A 5GNYA 1B3XA 3T09A 3MSGA 4MB4A 4P8XA 4MNLA 4DWSC 2UY3A 4QLLA 1HT6A 1HKIA 4MB3A 5DT5A 2J74A 1DTUA 3AIEA 3GTNA 4JFVA 1UD8A 2BXZA 2WZIA 4HMCA 5EB8A 3I3DA 3RM8A 4JL1A 3ARPA 1V6VA 4B3KA 2GDVA 1BYDA 3VGEA 2G3JA 2JALA 2J78A 1KXTA 4AD2A 1C8QA 2TAAA 4HOZA 4MNJA 3CUFA 1V02A 1XYZA 4Z2KA 2GDUA 5FL1A 2WNWA 4BQ5A 3HN3A 2OYLA 4ACZB 3VIKA 2VR4A 1KFWA 3RJYA 3GYCA 2WMFA 3TP4A 4Z2JA 3VD9A 5BWFA 3VNZA 1CGXA 3AMGA 3WD2A 3PZ9A 3WD3A 2A3BA 2CKRA 2WLYA 1BYBA 3VIGA 3VINA 4EK7A 4M8UA 1EH9A 1Q6DA 1R85A 4CD6A 2Y4SA 3ZSTA 3WNNA 3M46A 3A4XA 1DP0A 3WNOA 4H41A 2CYGA 1UKQA 4ZEPA 3I3EA 2ZX9A 5C70A 1WDPA 4P8WA 3GH4A 1MQPA 4UFLA 4BCEA 1FH8A 1J01A 5CQ1A 3RM9A 1QI5A 2ZUSA 3AYSA 5AY7A 1HF6A 1LL4A 1CNVA 3PZNA 2EXOA 2V3GA 3ZT7A 1ZJAA 4E8CA 3W53A 2WZEA 3N04A 1E1FA 3RILA 3S2CA 5C8BB 4UQEA 1WZKA 2ZE0A 3UETA 3CHFA 4A3YA 2NW0A 2BHUA 5TD4A 4ATLA 1W3LA 4XZWA 2D0HA 3QHNA 4NF7A 1RD6A 4W88A 5DF0A 2WMGA 1TA3A 3VDBA 1GONA 1V0MA 2XFRA 1JGIA 4Y7EA 3BAIA 4M80A 3TOPA 2WCSA 1NWRA 2V3DA 3WDQA 3GNRA 4OBRA 1JZ7A 2HVMA 1B0IA 1B3YA 2PWGA 4TOQA 4CCDA 3KZSA 1GZJA 1XSKA 1E6XM 3MANA 5KEZA 1CLXA 5M5DA 3PZQA 3THDA 5ABEA 3CPUA 5A2BA 3WN6A 1E6SM 4PUEA 4FLQA 4FLSA 1JG9A 2D1ZA 5M03A 1KWKA 2WW5A 3OLEA 1I75A 1UD3A 1VFMA 1XH2A 3N1AA 1R7OA 3THCA 2J4GA 4U2ZA 3W24A 5D9NA 1BVNP 2WB5A 5LA1A 2XUCA 3SCSA 4CKQA 5BXPA 5EFFA 2VOTA 2YBUA 3WBEA 1E70M 1E1EA 3NIYA 4LYRA 3WNMA 1V0KA 3GBDA 4AZ5A 1IZKA 4CD7A 4NZCA 1M53A 1OM0A 4GZIA 3W81A 1JYWA 2ZXBA 1C3FA 5E09A 4PCTA 5CGTA 3WEMA 1NWUA 2HISA 2O9PA 1ODUA 1B90A 1E73M 1KWGA 2VQUA 4P7OA 3VD7A 4YHGA 1VIWA 1W9UA 3W29A 4CD8A 1JF5A 1UZ4A 1EQPA 3N18A 1ZL1A 2WBGA 5EMYA 1KCKA 3CUJA 4B15A 5HNNA 3OBAA 2QV4A 1MW2A 2YL6A 3HJEA 3UG4A 1BSIA 1JZ8A 1K9TA 1ISVA 2WSKA 3VD4A 4TXEA 1OBAA 2OYMA 1D2KA 2D3LA 3HMCA 4L4OA 1W9DM 3NYDA 3VIIA 1GOQA 1LJYA 4WJXA 2ZOXA 1XD0A 4E4PA 3WMBA 3ZJ8A 3TTYA 3RMEA 1JF6A 4URIA 1R8LA 2DDXA 4YPJA 3U7VA 5GNZA 1VENA 2J7HA 2WVVA 2CESA 2JFEX 4GZJA 2X8RA 1J9YA 1PJ9A 4M81A 4BZYA 3OA5A 1CXIA 3AICA 1QVBA 1M03A 3U5YA 2ZUTA 3CZ8A 1WNOA 1I1WA 2VZTA 8A3HA 2VZVA 3AMCA 3FAWA 1CPUA 1JZ6A 4QCEA 1TCMA 3E1F1 5JIPA 3NDYA 1MFUA 2VC9A 1TFVA 5DFAA 4IPLA 3AIQA 1OD8A 4PMUA 2EPOA 1U2YA 5LA2A 4HOXA 2GK1A 3BGAA 3IANA 1WZLA 3N17A 3OG2A 2Y5EA 3OLDA 3G6MA 3GXFA 5A94A 2QHAA 1E6PA 3N11A 2NSXA 4DUVA 2GVYA 3CZEA 3LPGA 3GBEA 2QF8A 2XSAA 1NP2A 1LF1A 2ZUUA 1QI0A 1XCXA 3A4AA 4AEEA 2QMKA 3DYMA 4PUDA 3EDEA 4S3JA 1UQYA 4UZUA 3VIFA 4GI8A 1XCWA 1JYNA 3L4XA 5CPQA 1UH2A 4JKMA 4TVUA 3FY1A 4JHOA 2VX7A 2ZIDA 2GJPA 4V28A 2E0PA 1UR0A 3UERA 2J75A 5FD0A 1B3WA 1UH4A 3CH9A 1H49A 4JL2A 4U3CA 2JF7A 3AISA 1HJWA 3OGSA 1RP9A 1VEOA 1OIFA 3CZKA 1HKKA 1UOKA 2ZXQA 3W4RA 4B9YA 5FOOA 3ARYA 3CUGA 2E3ZA 1BG9A 1PIGA 5D9MA 3BMWA 2WM0A 3RDKA 4PMNA 3KE0A 3L4YA 5D9PA 2JF6A 1JDAA 2PB1A 3EDJA 2J8FA 2D22A 1UR1A 4MADA 4MJ4A 3WMSA 1TZ7A 4HPHA 2OWWA 1OWQA 4FLRA 1JL8A 4AIEA 4LXFA 2C8NA 4CCCA 1HVQA 4OZOA 1K9EA 1VFFA 1Q6FA 2ZX8A 4R5EA 3TONA 1MXDA 3ZT6A 1BGGA 4AZBA 2QLYA 1TA3B 3AHYA 5A8OA 1J11A 2PBOA 4DWSD 3ZO9A 3D3AA 1E4MM 1E6ZA 1V6WA 5ABGA 1AQMA 1XSJA 3IJ9A 2VX4A 4UR9A 3U7BA 3TTOA 4U3AA 5I23A 1C7TA 1W9BM 2E9LA 2JIEA 3II1A 1SR0A 1E3XA 2YDQA 2G4FA 2XVLA 4OOUA 2WMKA 3KEHA 4H8UA 3VGGA 4GPNA 1BG4A 4HZ6A 2VZOA 4LQ1A 4C7GA 3B9DA 2XG9A 1QHOA 2Y2WA 2XIBA 4IPNB 5DO8A 7TAAA 2VO5A 5BRQA 3SCOA 3W26A 5I6SA 5E0CA 2BV9A 3AIRA 2FH8A 4H8HA 1FP8A 4U2YA 4UFKA 3WQ6A 1NWSA 2E8ZA 3MUY1 1R87A 4RE4A 2J62A 1E0WA 2CBVA 3PZMA 3WNPA 3AXIA 2AAAA 3WQWA 3AXXA 1XYFA 3MUZ1 5JUVA 1U33A 1EDQA 2VQTA 1TUXA 1G01A 1B9ZA 4EKJA 1C8YA 3VX1A 1JNDA 1K9DA 5BROA 3VGFA 1V3LA 3B9EA 2XJ7A 1EOMA 1H41A 1O6IA 3NSNA 4MNKA 2XGIA 2WBKA 3QHOA 3VM7A 1GPFA 2J7EA 5CJ5A 3WDRA 3ZM8A 3PZOA 3ZR6A 1GQKA 5HOSA 2J7CA 1KXQA 1IV8A 2V5CA 3DYOA 4P7NA 3OLGA 4KWUA 2V3FA 4PTWA 2WVVB 4W5UA 4UQBA 2D3NA 1CGUA 4UQ9A 1PZ3A 5A8PA 2WYSA 4TUFA 2OLHA 4QLJA 4ATWA 1GORA 1W3JA 1QNOA 2W66A 5JBFA 4W87A 4LGXA 2A3EA 1ZBCA 1JFXA 1A47A 1ZBKA 3MUIA 2YL9A 2WCGA 2NT0A 1E5NA 4KGJA 1UUQA 1VJSA 3KWXA 1UKSA 3SUTA 1EOKA 3VOCA 3F5JA 1ITXA 1J0YA 3ARUA 3W6LA 1KQYA 2EPMX 3PHAA 2ZX7A 2O9OA 3S6TA 1EO5A 1J0KA 1H0IA 4J27A 4M82A 4NRSA 4D72A 4MB1A 2GK1B 1QPKA 1FHLA 1V02E 3ZQ9A 3T2OA 3ZMRA 3NUKA 1NWTA 3UCQA 1E0VA 3AIBA 3F5KA 1AQHA 2YL5A 4W7VA 4P7QA 1LWJA 4RL3A 3W82A 3ZJ7A 1RPKA 4X0NA 1V6XA 4D1IA 4D6CA 4HP5A 5LYRA 5A3HA 5A2CA 3AIUA 4OBSA 1HNYA 4HZ8A 2WCAA 1D7FA 9CGTA 1C7SA 1CWYA 2CBIA 1MQQA 1D3CA 1B1YA 3AQUA 4CVWA 3NJ3A 3L4VA 2CHOA 3FNDA 3TA9A 4AW7A 1WPCA 1UWTA 2A3HA 4JKLA 1GOWA 4HZ7A 4CD5A 3K4AA 3O9NA 1VEMA 2CCRA 3VIOA 3N13A 2NT1A 2BY2A 1QI2A 2W5FA 4MNMA 4KRTA 2YJQA 2PI6A 4S3KA 1IZJA 2J79A 4F8XA 3K8MA 3ARZA 3NCOA 4W8BA 1BTCA 2YDSA 1GVIA 4GO8A 4AXNA 3AFBA 1CXHA 5A6JA 1GNXA 1QW9A 1SYTA 3BLKA 2CITA 3L4ZA 2BY0A 1E6RA 2YL8A 1FH7A 3AS2A 1OGGA 4D6GA 1XHGA 3CHCA 1UWIA 2ZUVA 3WUBA 2DGAA 3BXWA 2WMIA 1M04A 2WZHA 3ARRA 3NSXA 4H7VA 3GNOA 3NDZA 3VILA 3ECQA 1GOIA 2WC7A 4M56A 1V3HA 4TX8A 4L4PA 3WKZA 1LL7A 2DT0A 2YA2A 3G6LA 2DH2A 2Y8KA 1W9PA 3WH8A 3IK2A 1VAHA 4AYSA 3BH4A 4TX6A 4PMYA 3GXDA 1JZ5A 1Q4NX 4PMXA 2OSWA 2ESCA 2A3AA 2XTKA 4HU8A 3SUVA 1KGWA 4BQ2A 3CGTA 3ZOAA 4AY1A 1WKYA 1SFSA 4F79A 2D0GA 2WC3A 1QNPA 4UOJA 3AYRA 2ZXAA 3VDHA 3ARVA 4D71A 1US2A 4UQDA 1PPIA 3LPOA 1UA7A 1WAWA 4UQCA 1FFRA 3FW6A 4JCLA 3W38A 3RPMA 1WDQA 1AMYA 4GKLA 1OGSA 2ZUWA 4PRWA 4FLOA 3L2MA 2GUYA 5A6KA 4D6DA 3FXYA 2PWDA 4YHEA 1B31A 1PIFA 2XGBA 4WKHA 3WFZA 2DIJA 1JD7A 1UR4A 4ZE4A 1G9HA 1TE1A 3TTQA 2BS9A 1ITCA 1H4PA 2UY4A 4WKAA 2F8QA 4UOQA 1TG7A 5I79A 3TTSA 3GZAA 2OSXA 1CXFA 2GSJA 4W93A 4AZCA 4FMVA 1GQLA 2EBNA 1HVXA 4IUGA 1JYXA 4CN6A 2E9BA 4BQ4A 1JYVA 2VX6A 4P7RA 1ZJBA 4H2CA 4PSPA 3WNKA 2VL4A 6CGTA 1WDSA 1GQIA 2WLZA 3NSMA 3AHVA 1ISWA 1UQZA 2DQXA 4OKDA 2ZX5A 3AS0A 4J3UA 4GINA 1V3JA 1R7AA 1BPLB 5D8ZA 3SIMA 4QCFA 4HOWA 3CUHA 3RJXA 2VJXA 4RE2A 4OOZA 3AMKA 1H11A 2E8YA 4EAMA 2BVTA 1B3VA 5CZKA 3WF1A 1OCQA 4J3XA 1E4LA 2XPKA 3UR7A 1MW3A 1WE5A 3PZVA 3WH5A 1UR2A 1W9VA 1XSIA 4E2OA 3PZUA 4J28A 3WDHA 2ZX6A 4BQ3A 4HA4A 3CZJA 4A3HA 1UD5A 2D2OA 1K9FA 2YIHA 3MKKA 2VVNA 5CXPA 4PMRA 3CO4A 3IJ8A 1L8NA 3M6DA 4JZ5A 3WD0A 2GJXA 3OZPA 4H8VA 3EDKA 5A8MA 5A8NA 1BAGA 4PN2A 1V3IA 4CVUA 2BY1A 2OSYA 4D6IA 4GZEA 2VRJA 4LYPA 1GOKA 1A3HA 2VCBA 1E40A 2Z1SA 4KMQA 5IDIA 4U5IA 3SCPA 2X2YA 3EDDA 2VCAA 4AD1A 2VRQA 2C7FA 2ZUNA 3LPFA 1E0XA 3PBGA 3DHUA 4GIAA 2WVSA 5FL0A 2WANA 2J77A 1W2PA 1X6NA 3GXIA 1DWFM 4D1JA 8CGTA 1GHSA 4LX4A 4MDOA 3VX0A 1UKOA 2W63A 3AMDA 1W1YA 3L2LA 4NSBA 4FK9A 2XM1A 1CEOA 4F66A 3AIVA 3F5LA 2B31A 1XGZA 1G0CA 5CLTA 2DT1A 4LPCA 1TR1A 3SUWA 4MAVA 4AC1X 5A1AA 4HU0A 4EE9A 1KR0A 3IJ7A 3VUPA 2XHYA 2EO7A 4N0RA 3AS1A 3ZT5A 5A6BA 1EGZA 1CLVA 1ZU8A 3WUFA 2DSUA 4ZENA 2XSBA 1HP5A 4PSRA 3VDAA 1QHPA 2VNCA 3GH7A 3O6AA 3VMNA 4GO9A 1PX8A 1JNEA 2PWHA 3SUUA 3MSDA 1UG6A 2J7GA 3EBVA 2WMIB 4AZ7A 1EHNA 3ARXA 3EMQA 1ZS2A 1E71M 3WUEA 3CMJA 3OB8A 3VM5A 1MW1A 3WF3A 3VIMA 1WCGA 4CCEA 1Z32X 2Q8XA 4Q22A 3CHDA 4QAWA 1RH9A 2E40A 4AZGA 3AXHA 5E9AA 1WB0A 2BY3A 5BXSA 4W86A 1PAMA 2PWEA 3PZIA 3EMCA 5I77A 3MMWA 2VR5A 3FHAA 2V5DA 3BCFA 4WSJA 3DECA 4UFMA 3WH6A 1MWOA 4LYQA 1KB3A 3MS8A 2XVNA 1WDRA 3WDIA 4F9JA 4PTMA 1OD0A 2DT2A 1FH9A 1OGBA 4V2XA 4J3SA 2FHBA 1E3ZA 1UD6A 4BF7A 2UY2A 2YLLA 4JFTA 3GDBA 1NOFA 2ZXDA 4U31A 5IFTA 1BYAA 1BVZA 1DWIM 1WP6A 1FFQA 1OT1A 1H09A 3A6OA 4ACYA 1E5JA 4DM2A 5DEZA 3F4VA 2DEPA 4ZFMA 4J3WA 1MFVA 3IAQA 4P7LA 4HMDA 2YA0A 2A3CA 5BYWA 1UWRA 3BMVA 5A8QA 4OJYA 1HL8A 4WF7A 1W3HA 1BF2A 1JFHA 4QDMA 1LG1A 4AZCB 3MV11 2WVUA 4FF5A 4AD5A 1KXHA 1VJZA 3WQ5A 2ZWYA 5I3DA 4BA0A 1UWQA 3SCWA 2BVDA 3AMLA 2AOSA 3BC9A 2G41A 4H04A 1UA3A 1KBKA 3QOMA 1J18A 2J7FA 2EPLX 1GVYA 4UCFA 2WPGA 4JKKA 2CXGA 3J7HA 5AC4A 2XVPA 3AIWA 1OT2A 1HIZA 1QNQA 2JE8A 3N9KA 4CN4A 1JDDA 1JIBA 5FCZA 1S46A 4J3VA 4JHZA 1FHDA 3B8SA 1EDGA 3K46A 5CPSA 2CKSA 2OYKA 1BHGA 1H0GA 1LWHA 3K1DA 3AZSA 2GJXB 1P6WA 5ABHA 2WKLA 2VURA 4Z2GA 3WH9A 2DSWA 3POHA 1NM9A 4CN1A 1W1TA 1CBGA 1QNRA 2XFFA 1R86A 4TVCA 5CGMA 4MTVA 4CU6A 1OIMA 1J0IA 2Y24A 3SCRA 3WQ8A 4IM4A 1MYRA 5JBEA 4CD4A 4GQQA 1HP4A 3M07A 4DUXA 1BQCA 1W1PA 3WY1A 5ECUA 3WEOA 4F9DA 4HA3A 1G94A 2ZUMA 3MMDA 3UEQA 3VGBA 2G3NA 2DT3A 3UR8A 2GFTA 4W8AA 3UG5A 2CBUA 5IXEA 3T0DA 1C92A 3VPLA 1GOOA 2V3EA 5FIPA 1XRVA 2PBGA 2WHJA 3O2LA 3T2QA 1G1YA 5A95A 1CECA 4E8DA 2O9TA 1E72M 2VMFA 5ABFA 4AZ6A 4HMEA 3EYPA 1ZBWA 3SCNA 5HXMA 5A69A 3WL0A 1F4HA 5GQBA 1NP0A 3SCTA 1CDGA 1EXPA 4AD4A 1HL9A 4GI6A 4Z2IA 5DT7A 2OWCA 4MDPA 3VGDA 6TAAA 2XYLA 4XV0A 1PEZA 4QLKA 1M01A 1UKPA 1OINA 2QPUA 4B3LA 3W25A 5CSUA 3MMUA 2WAGA 3KL3A 2RGMA 1Y7VA 3SCVA 4KRUA 1UYQA 4PMVA 7A3HA 4PYSA 3M7SA 1HKJA 3ARQA 1UH3A 3WELA 2XWDA 4UNIA 2E4TA 4XUYA 3PZGA 1QNSA 3VMPA 1ISXA 3KL5A 4ML4A 1QW8A 3UG3A 1CZ1A 4Z2HA 4XB3A 3CLWA 2EEXA 3VD3A 4V27A 3ZR5A 2CNCA 3UESA 5EBAA 4B16A 1W9XA 2WMHA 5AC5A 3FHQA 5F7UA 2CBJA 2J7DA 1CXLA 3FAXA 3QHMA 3VIPA 3MU7A 2E9MA 1HJSA 3WUGA 3SURA 1BGAA 1YQ2A 1VFOA 3WH7A 2F61A 2WWDA 3KL0A 1FA2A 3GM8A 3MUAA 4HPGA 1C8XA 7CGTA 1E15A 1Q6CA 4P8UA 1JI1A 2IUZA 3T0AA 5E0FA 4PMZA 2AMGA 4R27A 4CUCA 1DWJM 3FN9A 1DWAM 3VTRA 3WQ4A 5E6ZA 1AQ0A 5I0DA 3BSHA 1JXKA 3EMZA 1MQRA 3D5HA 2J8GA 1CGYA 4JIEA 4B9ZA 1JD9A 1H1NA 4W84A 3CUIA 4W8LA 1QBBA 3VVGA 2CPUA 4WSKA 4X9YA 2VTFA 1XC6A 3AHZA 1FOBA 1X6LA 2XVGA 2DSKA 4DM1A 3I3BA 3W28A 1HN1A 4AMCA 5D4YA 4JFUA 1BFNA 4OUEA 4MJ2A 1US3A 3WEZA 3SEPA 3WQVA 1KCLA 2VI0A 1M7XA 4C7FA 3AS3A 1E9LA 4NI3A 1J10A 3VMOA 5DMYA 1NARA 1KGXA 1LL6A 4PMQA 2ZWZA 1GW1A 2YOCA 2G3IA 2XWEA 4CGTA 4WK9A 2W62A 4AZIA 5I24A 2YDRA 4UFJA 1FP9A 4CU8A 1CIUA 6A3HA 1E6QM 3WDPP 5AYBA 3WNLA 4DUWA 1ISYA 1ZB5A 2DSZA 1CXEA 1JZ3A 3WMCA 1GJUA 1JAEA 5IFPA 1V6UA 1OB0A 5AYIA 1MW0A 1Q6GA 3VNYA 1W3KA 1W32A 2IXVA 5IHRA 3BAJA 5E6YA 3AHXA 4D6FA 4QFUA 4UFHA 4GQRA 1EO7A 3ARWA 3BLPX 3CHEA 1QHZA 2VZSA 5IHSA 3WDJA 2DPEA 4A4AA 2JEQA 1YHTA 3BAXA 4D6HA 1HJUA 1XV8A 2GJRA 4GI9A 1RP8A 2G8ZA 1I1XA 1VEPA 1GQJA 1E4IA 1ECEA 3OGVA 5LA0A 4Q7NA 1HJQA 2QMJA 3CZGA 1V3KA 1G5AA 3AHTA 2EQDA 4UOZA 4D6JA 3IAPA 5BRPA 3U5UA 3BCDA 4XX6A 1VBUA 2WVTA 4AIOA 2QPSA 4W5ZA 5I5RA 2D0FA 3RO8A 1TVPA 4PMOA 3VGHA 2O9RA 1EQCA 1CGTA 2WKGA 1KR1A 1J0JA 3PZTA 5ABFB 4ATDA 3VIHA 4MAZA 1H2JA 1LG2A 2J25A 2W67A 5M3WA 5I2UA 4P8VA 1NOWA 1V0NA 2WMJA 1U30A 1VRXA 2UY5A 2C0HA 3QGVA 1KBBA 2OWXA 5A6LA 1XD1A 2J47A 2YKKA 1PX3A 1PBGA 4M24A 1HKMA 1CXKA 2XM2A 3PTQA 5C71A 2WC4A 1WZMA 1CENA 1GHRA 4PTVA 4M1RA 4AD0A 3L4WA 3SCUA 1DWGM 3K8LA 2BHZA 5A6AA 2D23A 5A6SA 1UR8A 4JFSA 2D20A 2Y8VA 4J7RA 4HA1A 4W85A 3T0BA 3JUGA 3AI0A 5HPCA 1Q6EA 2CIPA 2WWCA 3WIJA 2X1IA 1IT0A 3A4WA 4DWSA 2BFGA 1TMQA 3VDCA 2O92A 1TVNA 5CG0A 1V0LA 1WZAA 5D8WA 3SCQA 1HXJA 3RCNA 1J0ZA 1LLOA 2PF0A 5CSYA 3APGA 2JIWA 3DYPA 3N12A 2DH3A 1GJWA 2V38A 1QBAA 1ESWA 3AROA 1UHVA 1EA9C 2VX5A 2WK2A 1HX0A 1JAKA 4CU7A 4JFWA 5HPOA 2WHKA 4TTGA 5I78A 1AVAA 5E70A 2DSVA 4MB5A 2IXUA 3EDFA 2ZICA
chains in the Genus database with same CATH superfamily
2E77A 3QVQA 1P6BA 3U2ZA 3DG7A 4G5DA 2OX4A 3K8KA 1NF0A 2BNJA 2RGLA 2VT0A 4IT1A 4L6OA 1TPH1 2BMBA 1BLIA 1SMAA 3WBWA 3ID7A 5F2GA 4PUNA 2BDQA 3WMLA 1IEQA 2XFYA 5T9CE 1N7KA 2FHCA 1XI3A 3AU6A 2BVYA 1PE1A 1L9WA 1VB9A 3LBCA 5TNVA 6XIAA 1X1ZA 3WQFA 3BANA 4RLIA 3TJXA 4BKNA 3RIKA 1PX4A 3IV3A 4RXGA 2QDEA 2R8WA 1VH7A 3F2DA 4UTLA 4XBKA 2DJXA 3VUSA 4Z2LA 1HKVA 1XXXA 3B9AA 1XKJA 3LCGA 1QOXA 4GC3A 3EEZA 3F2CA 3LCXA 2OKTA 1F74A 1B3ZA 3BZJA 2PSNA 3SSZA 1QI4A 4WKFA 3C52A 1QFEA 3RM4A 5JBDA 1ODZA 4PCSA 1EGMA 3CIVA 4ZXLA 3C86A 2EF9A 2VVSA 3H7UA 4JN6A 4S2CA 3VABA 2HSAA 3IJDA 2O4MA 4H1ZA 1H3GA 1K3UA 2W9MA 3K4DA 3P74A 3W2JA 1ZBVA 4H7ZA 2X0YA 4BS0A 1XLHA 5G2WA 4W89A 3JVAA 2J6VA 1H7XA 1B2YA 1CGVA 4PBGA 4AG0A 1H5VA 3PVFA 1HJVA 4GY0A 3QR0A 1AL8A 2YCLA 3LPPA 4LV9A 1V93A 1JZ2A 3TLQA 3HURA 3NAVA 2CLHA 2NXIA 5HQEA 3NL3A 3SQSA 3VKJA 1R9ZA 4WY0B 2YLAA 4DBSA 1DHPA 3VAVA 4E6MA 3ZS4A 4NRRA 1V03A 1F76A 3LQLA 2PGWA 4Q7BA 5AC8A 3ZJ6A 3A3HA 3CMGA 4UZSA 2EPNA 3ENLA 3CU2A 2W61A 3PBMA 5HMSA 1GCYA 2Y61A 2OB3A 1UD4A 5BMXA 1L0PA 4TV6A 1ZALA 3OIHA 1W1VA 5A6TC 2VEGA 4X0VA 2VCCA 1UD2A 3CUZA 4JNMA 2JKAA 5EFDA 1I2RA 2FGBA 3UY7A 4JR5A 4IXXA 3LYEA 5GPRA 1SVDA 1MXGA 3ALGA 1NOUA 1PTGA 2DIEA 1ONWA 3ARTA 3W6MA 4HNNA 3WF4A 3T7VA 1ISZA 4U33A 5FEPA 4UFIA 2ZADA 1TPC1 4WJEA 1GK8A 2BOGX 4AQLA 4DWSB 2ZC1A 4HSOA 3BAKA 1M1BA 4ZR8A 4LSBA 1X7IA 3ISIX 1ZTVA 1XIGA 4C91A 3NQDA 1S5NA 3DGRA 1EA0A 5KMYA 3GNPA 4KFOA 2OGJA 4DYJA 4AHPA 3O1NA 1TTQA 1GW9A 4J3TA 4M1BA 3WF0A 1S2CA 3TOYA 3CB3A 1EHAA 1X1NA 4XO6A 2EPKX 1ITUA 1VFUA 1GJPA 4Z0SA 3VU2A 4WIWA 4HPXA 1GOMA 1MVYA 2ZQ0A 1RALA 1KXVA 1XLEA 3N6JA 2X05A 1ZNNA 3PY2A 4HNVA 5GNYA 3TZFA 1V7AA 3L7RA 4MB4A 5LIUX 3UYCA 2Q6ZA 4MIMA 5BMWA 4MNLA 1TELA 1AH0A 1FWRA 4QLLA 3LGDA 3CASA 1HKIA 2YCIX 4IQEA 5AZ0A 1RBAA 3GU9A 3AIEA 3GTNA 4JFVA 1UD8A 1PS9A 2ACQA 1OJXA 1IF2A 1WX0A 4JL1A 2ZTJA 3ARPA 1SSGA 4B3KA 4GMEA 4GNVA 2J78A 4AU0A 4AD2A 1C8QA 4HOZA 2PLJA 2PP3A 4MNJA 3CUFA 2VM8A 3PB2A 4DB7A 2GDUA 4PBEA 2OYLA 3G1FA 1KFWA 4K8EA 3GYCA 3BMXA 5BWFA 2IKJA 2QIWA 3MC5A 4W4QA 3VNZA 2QJMA 1I0DA 5CJMA 3H7VA 3AMGA 4F0KA 2Y88A 2YCJA 3V18A 3WD3A 5IBXA 4Z08A 5CJNA 3VINA 4XD6A 1ZP3A 4M8UA 5D2TA 1A80A 4GIRA 4Q4QA 3LCIA 4CNNA 3SI9A 4LBRA 1KTNA 2PURA 1EGVA 4QNWA 3WCZA 4H41A 1L2QA 1UKQA 5C7VA 5C70A 1WDPA 4UFLA 1EYWA 1PKNA 4WGXA 2PDLA 1LL4A 2F7FA 2ISSA 1CNVA 1YEYA 3P8JA 2BBFA 3ZT7A 4WVXA 4YXGA 1RJPA 4DZIA 2FZNA 4V15A 1TWSA 1MDRA 2ZE0A 3F03K 3UJ2A 2V5LA 4A3YA 2OO0A 2NW0A 2NXGA 2OLAA 1W3LA 4XZWA 3QHNA 4C5YA 4NF7A 1RD6A 1JEZA 4S3CA 3VDBA 4BFAA 1V0MA 2X1TA 4IIEA 2V0TA 3VNIA 3EKLA 3TOPA 3QPYA 2FTWA 2WCSA 1NWRA 4H8NA 2DZSA 4ADSA 2DP3A 1GTHA 2UBPC 4BK9A 4TOQA 5C2CA 2PGEA 1GZJA 1XSKA 1UIPA 3WJSA 1CLXA 4I5UA 3OZYA 4PUEA 4O1BA 4FLQA 1R3TA 3S1UA 3URQA 2WW5A 3PM6A 2H3BA 1VRDA 3A12A 1UD3A 1R7OA 1AZ1A 3N9RA 5EFFA 2G50A 1I6NA 4LYRA 3WNMA 2GQAA 4DAFA 1EJRC 3W81A 4R34A 3P8IA 3ZYZA 2IKGA 3DZ1A 4PCTA 5CGTA 2Z26A 1NWUA 2HISA 1B90A 1KWGA 4B5WA 4LS1A 4Q8PA 3PPFA 3V0TA 1JF5A 1YDYA 3N18A 3N2TA 1KCKA 3D6NA 4M0XA 2YL6A 1IEIA 2OKOA 4X22A 2Y89A 4OV4A 1JZ8A 1ISVA 3BLOA 3HO8A 1PXGA 3HMCA 1W9DM 3VIIA 1GOQA 1LJYA 1MSSA 2AL2A 3S5OA 1MRQA 4AYGA 4B3ZA 1R8LA 2FLIA 2WVVA 4GZJA 4JN7A 1OC6A 1VFLA 4M81A 1A0EA 3C5QA 1TV2A 1QVBA 3M0KA 4GX8A 4E3TA 4G56A 5I3JA 3IRDA 1RA0A 3BARA 4DO7A 4GXWA 3FAWA 4QJ1A 2ZZ6A 2G97A 4QCEA 4GUFA 3EGJA 1AJZA 5CPMA 3E1F1 3GR4A 1W1IE 3OTRA 5HULA 3KW3A 3EB2A 2VFIA 1Q3NA 1TPVA 1TFVA 5DFAA 2NWSA 2EPOA 5LA2A 4A8LA 2DZXA 1WZLA 3N17A 1PCWA 3OG2A 1J5SA 2Y5EA 1LT7A 2PTXA 2OEMA 3G6MA 3TWAA 5A94A 1XS2A 1E6PA 3S9YA 4K1GA 3CZEA 3LPGA 3UXIA 1M68A 1NP2A 2QMKA 1XLBA 3DYMA 1ITQA 5HUPA 5CZSA 1N8IA 5DY2A 4Q8WA 1ZAHA 1Q6QA 1JYNA 1QTWA 1D3GA 2DV0A 4TVUA 2ATSA 5DXXA 1HTIA 2GJPA 4V28A 1JCXA 1UBSA 1EF2A 1E51A 3HMJG 1UR0A 3V3WA 3UERA 1R2RA 1CLKA 4KEZA 1F2JA 1QNVA 4N9BA 1DOSA 2JF7A 4MGGA 2PTWA 2FMNA 3MT1A 3NPUA 1JJKA 1UOKA 3W4RA 4R3UA 2VGFA 3O6DA 4O50A 3I7QA 2R24A 3SIZA 3UWVA 2PGFA 3EWXA 3BMWA 2WM0A 5H91A 3MKCA 4G2DA 2ZZ3A 3NNTA 1JDAA 3GDRA 4HPHA 4ZO8A 3CQ0A 2OWWA 3MDUA 1O66A 4CCCA 1VHCA 1HVQA 3GFZA 4S38A 2XH2A 2QUUA 5BU6A 1VFFA 1QO5A 2ZX8A 4J9JA 2BZNA 4AZBA 4DWSD 5T8GA 1IXOA 3U6WA 3ZO9A 1E6ZA 3CPGA 5CSRA 1J6OA 5G4EA 1XSJA 2PGRA 3HFTA 1DV7A 4U3AA 5DMNA 1C7TA 2JIEA 1PSCA 1SO6A 4Q4MA 4OOUA 3STPA 4JTHA 4H8UA 3G1DA 5IRPA 5FF3A 1W8SA 1VP5A 5F4WA 3SBFA 1QHOA 1W6TA 1YLVA 2XIBA 3T40A 3O05A 4IPNB 3FJLA 3FJNA 1PZ0A 5DY3A 3MSYA 2VO5A 2HE5A 3SCOA 4UXDA 5LIWX 5I6SA 2BV9A 2VP8A 4H3DA 5G5IA 4B5XA 4L61A 4FX7A 3BW4A 4U2YA 1Z48A 4UFKA 1EYEA 2E8ZA 1S5VA 2CBVA 1LTDA 3TNBA 4QE4A 3AXIA 3WQWA 3BZGA 1XYFA 3MUZ1 3PPGA 1EDQA 2VQTA 4EKJA 1K9DA 5BROA 2PCQA 4PTNA 2XJ7A 1ML1A 3W23A 2KZHA 3KVLA 2YSWA 4PMJA 4UB9A 1P48A 4FF7A 1O94A 1LWIA 2AL2B 3ZM8A 1SZRA 3VOFA 1XLCA 3ZR6A 2J7CA 4DN1A 1IV8A 4R7JA 2QUNA 3OG3A 2PRLA 2V3FA 2WVVB 3DHDA 1CCWB 3EXSA 2WYSA 1YXYA 3ABQA 4R7OA 4HK6A 1VYRA 3H6OA 4W87A 4LGXA 3FJ4A 1A47A 1E5NA 1UUQA 3KP1A 1VJSA 1UKSA 4JTGA 2XISA 2Z1WA 2OOGA 3NQEA 2G3FA 2CZDA 5FJJA 3NQVA 3S6TA 3V5OA 4M82A 4D72A 4FI4A 1V02E 3T2OA 3ZMRA 3HJZA 2VUNA 4KIEA 5CC6A 3F5KA 5E9XA 1J93A 4W7VA 1RSCA 1XUUA 4P7QA 2QAFA 3EWDA 3ZJ7A 2GSEA 3BGGA 1V6XA 3S2JA 4D6CA 4HP5A 5LYRA 4NNBA 2PDCA 5A2CA 4IG2A 3AIUA 4OBSA 1XISA 1WA3A 2Y8UA 3EB3A 4E3VA 1D7FA 1C7SA 1CWYA 2CLIA 5LNSA 4MKVA 2VEIA 4L1GA 4ZGYA 3L4VA 2CHOA 3FNDA 3IJIA 1XF0A 2VGGA 1WPCA 2V63A 4JKLA 5PTDA 3N13A 4LB4A 2NT1A 3LTSA 4QITA 5I07A 1B3OA 4S3KA 1MMFA 2O56A 2ZRYA 3CAKA 4HSNA 1NDZA 3ARZA 4L4LA 7ODCA 1ZP4A 4GO8A 3QRHA 4K6AA 1K8ZA 2BY0A 1E6RA 1FH7A 2Z1XA 1XIDA 3AS2A 1VYPX 4D6GA 4TV5A 1PTAA 1XHGA 5DBUA 3CHCA 4IIGA 4UBPC 1WDWA 3E5PA 2HPIA 4XZLX 4DJFA 4HPNA 3U4FA 3NSXA 4H7VA 2CLMA 2PTZA 3GNOA 3NDZA 3W2LA 1LBFA 5F2LA 2WC7A 4M56A 4UNLA 3ERPA 4L4PA 4Q3MA 1KM3A 4U10A 4NILA 5FACA 4KWOA 2DFAA 4M6UA 2O4QA 5LGZA 3IK2A 4TX6A 5ABTA 3JZEA 3CJPA 1JZ5A 1Q4NX 3GIYA 3C0JA 1W3NA 4WEVX 4HU8A 3ZOAA 1AH3A 3GY1A 3SY1A 1KFKA 3M41A 1QNPA 3IPWA 4QIUA 3AYRA 1VBHA 3NEHA 3PPCA 4E0CA 3RLGA 4UQDA 1PPIA 1WAWA 3FW6A 1VKFA 2X7VA 2ZUWA 3EX1A 2YW3A 2PZNA 4PRWA 5DX7A 3TWBA 5FF2A 2XZ9A 3IJLA 1TPFA 2GUYA 2ZRVA 5H8MA 3WFZA 1XLFA 1BD0A 3BG5A 1SQ7A 2BS9A 3AXMA 1H4PA 1KRAC 4WKAA 1A0DA 4YTSA 4JTQA 4RZ4A 2A1YA 1LRQA 2A4AA 3CAQA 3V35A 4KBXA 1JYVA 4JXCA 4P7RA 3URBA 1RR2A 3EOUA 3W75A 4QS6A 1X96A 1POKA 2PP1A 3W72A 1GKPA 3IEBA 4L9ZA 1K8XA 3ITTA 3AS0A 3W3OA 1X39A 3C0SA 1BPLB 5D8ZA 1XLAA 2BVWA 4GYFA 1NEYA 1G4PA 4HOWA 4JTTA 5JVLA 4OOZA 1SO3A 1GVQA 4LV4A 3W7MA 1H11A 3GX9A 2RDUA 4G1KA 2A79A 7TIMA 5MKGA 4FXSA 3W7QA 5E0KA 2XPKA 1MW3A 3SR7A 3WK0A 3OVRA 4IQJA 3PULA 3PZUA 3W7HA 1XJBA 4KERA 2YXGA 3HPFA 1NDYA 3DKLA 1FTXA 2D2OA 1K9FA 1M65A 1E9YB 2YIHA 3GSMA 5CXPA 4DF1A 3LI1A 3WD0A 2GJXA 1JPMA 3OZPA 5A8NA 3M5ZA 9RUBA 1HKWA 2V69A 5DMMA 1LRNA 4PN2A 3TCSA 1EIXA 3GHTA 4D6IA 4AF0A 4GZEA 1GYNA 4HN8A 5M2FX 4LYPA 4WX2A 1Q5MA 2PDUA 2I57A 4MOZA 4AHOA 3SCPA 3Q2DA 4BI5A 3HIJA 3SM0A 2ZZ5A 1ZLPA 3L68A 4FNUA 5HMDA 2C7FA 1XLMA 3LLXA 3LPFA 3S6OA 4IG2B 2WOQA 2D69A 4LVGA 5FL0A 3TN6A 2J77A 3UXKA 1GHSA 4MDOA 1YRRA 2PLKA 4PCPA 3H2EA 2BB0A 1ZFJA 2OO6A 1WKEA 4NNAA 2OQHA 2QF7A 4DJDA 1XGZA 5CLTA 3SUWA 2R9RA 4HU0A 3C0QA 2DY3A 2EO7A 2QULA 3AS1A 5A6BA 1EGZA 3WUFA 1HP5A 4IMEA 4PSRA 3ZZ1A 3TTEA 3GH7A 3QZEA 3VMNA 3CAVA 2TODA 3WBYA 3E0IA 3L12A 2QT3A 4JTCA 5TAOA 5FAJA 2J7GA 5KINA 4J2PA 3EBVA 1FDZA 4JS3A 4AX6A 4FP1A 4IPIA 1Q8JA 5D2WA 4MWAE 4AZ7A 4C1NA 3ARXA 5EL1A 3PPHA 1IQ8A 1H7RA 4Z1DA 1MW1A 4XIAA 2EAWA 3WF3A 3RO6A 4IJCA 1KM2A 1AH4A 1K8YA 4PUWA 4YTQA 3DFSA 4KFPA 4INFA 4BI6A 4PULA 1GQNA 1TWWA 3PZIA 4FEZA 1G7VA 2P0IA 1QR7A 3H2NA 4D8AA 4WSJA 3SQLA 3DECA 4UFMA 3WH6A 1L6YA 3CM4A 1O5QA 2XVNA 2F9RA 1WDRA 4TQTA 1F5ZA 1NY1A 3H2AA 3WDIA 4F9JA 4WDXA 3VE7A 3EOSA 1XX1A 1FH9A 3MTWA 4J3SA 2FHBA 4JY8A 1NOFA 1RJQA 1WP6A 1OT1A 4DF2A 3WJWA 1VPXA 3A6OA 2FJUB 4HJWA 5DEZA 3F4VA 3V4BA 4LY8A 4WHBA 4ZFMA 3EWWA 4P7LA 4N6FA 2G4JA 4HMDA 2YA0A 4TO8A 4EXBA 1MXSA 4FNQA 2OTDA 5BYWA 5C7HA 5A8QA 4FA3A 4QDMA 1LG1A 3MV11 4IFKA 4FF5A 3KRZA 1KXHA 1DXEA 3SDOA 3MJMA 3IACA 3NGFA 1OYAA 3JU2A 2ZA3A 3H4WA 1A5LC 1IR2A 4F0SA 3H53A 1OVDA 1VFTA 4RKAA 3RLVA 4EIVA 4BJHA 5LXEA 3TLLA 3UW6A 4UCFA 2WPGA 2CXGA 5AC4A 2XVPA 4PGLA 3OW1A 1KA9F 1QNQA 4ZFCA 2JE8A 2RDWA 1JIBA 4J3VA 3N14A 3PUGA 2OXNA 3SADA 4HK7A 1EDGA 1KRMA 1MNSA 3ZLGA 3KCOA 5K9CA 5CSSA 3K1DA 4K1WA 2GJXB 1XDMA 1G67A 1VLWA 3W1PA 2DSWA 1QNRA 3LSCA 2XFFA 4ILSA 1YDVA 5E5CA 3IVTA 2I14A 3NOEA 4TVCA 1XP3A 4KQNA 4RX0A 5CGMA 3W2MA 4LF1A 1OIMA 1J5TA 2Y24A 3SCRA 3TSDA 1MYRA 4Q33A 3ZWSA 4HYWA 3HG4A 4Y9OA 3DX5A 1TQJA 1HP4A 3WQOA 4FPSA 5LKYA 3M07A 5K7JA 4UTJA 4NVTA 1ZSXA 2XN0A 3MMDA 3UEQA 3VGBA 2G3NA 2YB1A 1IE7C 4Y90A 2VGBA 4IGNA 2GFTA 3VKAA 3T0DA 1GOOA 2WO5A 3L5LA 5FIPA 1XIEA 3O2LA 4B5TA 4BHYA 2ZRWA 3T2QA 1K7FA 5I7GA 1IGSA 4FNPA 4NG3A 1JCNA 1CECA 2NV9A 4E8DA 4K36A 2O9TA 1E72M 4J1OA 4KETA 4H6RA 1OFAA 4AZ6A 2OT0A 2PZ0A 3HPXA 4HMEA 1G69A 3Q58A 4LNYA 3WL0A 4GCAA 1F4HA 3L0NA 4HHPA 3SCTA 3TSMA 2BGQA 2NX9A 4AD4A 4GI6A 2E5BA 1GOXA 1XBXA 3MY9A 1FCVA 4DYKA 4O8RA 1UKPA 1DTNA 2F6UA 2JK2A 3UVAA 5CSUA 4S23A 4BI7A 2WAGA 3NZGA 2VWSA 4JTFA 3CV2A 3SCVA 4ONVA 4C5ZA 3LOTA 3QQ1A 3ARQA 4LUJA 4GBUA 5LNRA 4UNIA 2E4TA 2FZMA 3PC0A 2I5QA 3E0VA 3CYVA 3W1UA 1GVSA 3G0SA 2POTA 1V4YA 4YTUA 1GT8A 2A0NA 1VR6A 4K8GA 1ZJIA 2E6YA 2CNCA 3UESA 2WMHA 5AC5A 3FHQA 2QJNA 4MYXA 3HGRA 4KPLA 2Z27A 3TN4A 3MU7A 4LBSA 1YQ2A 1HGYA 2J9XA 1VFOA 3G3MA 2FKPA 3QTGA 3SO7A 2F61A 3SJNA 1FDJA 3COTA 2C71A 3KL0A 3CEPA 1KLZA 4NKCA 4HPGA 7CGTA 1TTPA 1E15A 4I6VA 3VOIA 1Y65A 3RX4A 3ATZA 3WLRA 2IUZA 2NXHA 4PMZA 5I3FA 4CUCA 3BV7A 3IJQA 4WDWA 1I45A 1AQ0A 4B2DA 4UTWC 1A5BA 2OZ3A 3BSHA 5J5DA 3EMZA 3PJTA 1MQRA 2WM1A 4R85A 5C2GA 4W84A 2FVMA 2CPUA 1W5OA 2NZLA 4IFKB 4DJEA 4QEHA 4IMDA 1ADOA 3G0UA 3DCPA 4KWWA 1HN1A 1S2AA 1XYAA 4H6EA 4IH3A 4JFUA 3V5FA 4I8DA 2GYIA 4O1EA 3WQVA 4Q8OA 2B7PA 2FFCA 4PTDA 3AS3A 3EWUA 4MZ8A 1KGXA 2Y5JA 2OGYA 3Q67A 1LROA 1RQHA 3CLMA 2W62A 4AZIA 3QFWA 1UASA 5HUOA 3MCOA 4NX0A 3L5MA 2RJHA 1W3TA 4MKNA 4ZO9A 4Q4PA 1R2SA 1KV5A 1VZWA 3UVIA 5FAGA 4JDYA 2CU0A 1TPUA 5AECA 1CXEA 2J9ZA 5DRIA 6ENLA 4S3DA 5IFPA 3C8FA 3GVWA 1R9YA 3LU2A 4XBSA 1EEXA 3KOXA 4D6FA 3W7RA 4UFHA 4Z17A 3ARWA 3BLPX 3MWCA 2E6AA 5GJNA 4AC7C 5IHSA 2JEQA 1Q66A 2OEJA 3W02A 1YHTA 4DBDA 3FYPA 3IGHX 3T55A 3P61A 1HJUA 2GJRA 4IPJA 4DJFD 2G8ZA 4FNRA 3NPXA 4GH3A 1VEPA 5CZTA 4AVNA 5C9WA 3KDNA 2Q3OA 1F3TA 2GUBA 1CI1A 3URAA 2QMJA 3W1MA 2CWNA 4PH6A 3N4FA 1UZDA 4D6JA 6TIMA 4XX6A 4LCSA 5K4XA 4AXKA 4W5ZA 2A2IA 4O52A 3SN0A 4JX5A 4H01A 4WDTA 2FDSA 5FA5A 5D2XA 1J0JA 1XUZA 1LG2A 4P8VA 4ROPA 4Y8EA 2UY5A 1KBBA 2XH4A 1XD1A 2E09A 2J47A 5A6LA 1PX3A 1F61A 4M24A 2HVNA 2YX0A 3K13A 3KCLA 1MO0A 5C71A 5J5RA 1XR2A 4JN8A 1T99A 4O0QA 1BXCA 1DWGM 2GGJA 1TUFA 1M9HA 3P0XA 4HA1A 4DXVA 4O1AA 4W85A 4MF4A 4C6EA 4JX6A 2CIPA 2Y6ZA 3CIXA 3WIJA 4V33A 4PR4A 1IT0A 3A4WA 4QROA 3VDCA 4F0HA 2O92A 3VC6A 4LOCA 1WZAA 3CXOA 3W1QA 3UNDA 1FWDC 3SCQA 1HXJA 3LENA 1K70A 4GKTA 4Z1BA 1YTDA 3N12A 1U5VA 3S42A 1OFQA 4WXZA 3FEQA 3LNPA 4RV8A 1AL7A 2V38A 4QDWA 2VX5A 3OP2A 4GI4A 1HX0A 4PBFA 5LHFA 1AVAA 3DN5A 3B8UA 4MB5A 3A23A 4UTWA 3C4UA 1A5KC 3W83A 2NVAA 1ZZMA 2OLSA 2QVHA 1H1ZA 4MVAA 1XFCA 4RZBA 4XZBA 3OHIA 4UQAA 1HQTA 2DUZA 3VI2A 2WHLA 4KGLA 2CFFA 2FB3A 1ZJHA 3IGSA 3H2OA 3B8DA 3U57A 3HU7A 2ZDSA 2FHFA 4B5VA 1JDEA 4NZ5A 1C93A 1PHQA 3N6HA 4DX3A 5K9XA 1NDWA 3AZRA 1QI3A 2WXDM 2BX7A 3REQA 3LZ3A 5KSWA 3GTFA 3P81A 2A6LA 2TYSA 3EWBX 2FGLA 3VIJA 2F84A 5BXRA 1K02A 3MV01 3FCPA 3AYVA 4LUIA 4G1NA 4DBUA 4UWMA 4L1WA 2VUYA 3UWWA 4Y96A 4GUJA 2VD8A 3VDGA 3LBOA 3BO9A 2G3MA 4U5KA 1H62A 2Z0IA 4HNOA 3UZYA 3GXMA 1W3IA 3LQGA 2GSHA 2UWFA 3E02A 4DJDD 1R47A 4H9TA 2VEPA 1IWAA 2P88A 3WBAA 1V6YA 3WENA 2Z1KA 1FCUA 2VGIA 3H2FA 4AWEA 5A6BD 1OK6A 2WHMA 3TKFA 1K6AA 4AEFA 3BGJA 4JIQA 1JGMA 1YDOA 3LCFA 2FDMA 2WSPA 5FF7A 3PTMA 2PWUA 3F7JA 4WGHA 3B0XA 1PTDA 2FTYA 4TVDA 4GUGA 3WO8A 3CBWA 3FA5A 3WJXA 3UPMA 3VNJA 4YTTA 2WQDA 1PZ2A 2R1MA 3LHWA 3F4CA 4GA8A 1FX6A 5FKYA 2PDHA 1JQVA 2NQ9A 1O7AA 3U48A 1WO2A 3GZ3A 3A47A 1LQ0A 1GG0A 3UZZA 3RG6A 4BF9A 3V16A 1JCLA 3QJAA 3HG3A 3RAOA 4XSLA 1HJXA 2XN1A 3TYDA 4HCDA 2XN2A 4N42A 1V08A 3WJYA 3ARSA 2UV8G 1GUVA 3L65A 4XZNX 4AZHA 2OODA 3KVMA 4HK5A 3WD4A 3KVJA 3L4UA 4EVZA 4F0MA 3W7GA 1C9DA 4UIOA 4C6DA 2MANA 1DE5A 4CQ9A 3KS6A 4L9YA 4WOQA 2ZRXA 1IXQA 1ZRQA 4XD5A 1P0EA 3EPMA 1EJUC 1PWMA 5I02A 1KFEA 4E2DA 1OFOA 3UWZA 4JIIX 2R94A 3GG1A 4BEUA 3EX4A 4Y8FA 4MY9A 3OLIA 1Z6KA 2I17A 1DHKA 3E2RA 2J7BA 4PB4A 1AW2A 3BG9A 1DJQA 1KM1A 1UKTA 2Z2AA 2NLYA 1D8WA 4GX9A 3P93A 2VRKA 2EKGA 1UC5A 1N82A 1NVMA 1UR9A 4ZXOA 3SGZA 3O07A 3WBXA 2BXYA 1SZFA 1OSEA 4HB7A 2P1FA 4Z1YA 3VXGA 3MSGA 4PODA 3ABXA 3B97A 3S1WA 4I7WA 1VQTA 5LIKX 1LBLA 1HT6A 4OU1A 4ZOEA 2J74A 3CQJA 3JW7A 2ISVA 1RY0A 4DAIA 4FNSA 2WZIA 4HMCA 3RM8A 4I7VA 1DJIA 4IGSA 3REQB 4GVGA 4GJIA 3UJFA 1V02A 4Z2KA 2WNWA 3HN3A 4GLEA 2WMFA 2YB4A 1MI3A 3TP4A 2NQ5A 3TYEA 1CGXA 4Z42C 3PZ9A 4JQAA 1KFCA 3XIMA 3RITA 2CKRA 2W3ZA 2WLYA 1BYBA 4EK7A 2PA6A 1EH9A 1Q6DA 3HV9A 1I2PA 2Y4SA 3NL2A 3V75A 4HKPA 6REQA 1KBJA 3KBWA 4ZEPA 4EPKA 1VLIA 4P8WA 3GH4A 5CH9A 1FH8A 4Q8UA 5CQ1A 4GOAA 4JTAA 4DXXA 2V3GA 5EMUA 1ZJAA 1GYMA 4AVFA 2HS8A 5MF5A 2WZEA 4AWUA 3S2CA 5C8BB 1YTKA 2X40A 3BK0A 3GIQA 4MZ1A 2Q8LA 1YMYA 3UJSA 5TD4A 3G2GA 1I60A 3QSTA 4W88A 5DF0A 3UZ5A 1DBTA 4ZSUA 1GONA 4ORIA 2ZA2A 2BG5A 4NQ1A 4REQA 2FPTA 3GNRA 4OBRA 1JZ7A 5FF4A 2CZEA 2HVMA 3KVKA 2EKCA 1O4UA 2PWGA 4CCDA 1W5NA 2RDTA 4NXSA 1H5YA 3KZSA 4IMCA 3CPUA 4MWAC 3WN6A 3PBWA 4C6LA 2J9YA 1JG9A 4M7SA 1A4MA 4J3ZA 4Z0JA 1VFMA 2J4GA 1O1ZA 1XRTA 4JTDA 2CLEA 3W24A 2WB5A 3SCSA 2VYOA 4CKQA 2VOTA 1VCFA 3H7RA 1KTBA 3WBEA 1V0KA 4AZ5A 1L8PA 3H4XA 4Q6XA 4GZIA 5CGQA 4IL0A 1JYWA 1C3FA 3GTIA 3CUXA 1E73M 3KTSA 4HT3A 3UY8A 5AYXA 3L67A 4B2DD 2VQUA 3VD7A 4AH7A 4JTJA 3KCJA 1FKWA 3CT7A 4B15A 5HNNA 2QV4A 1K7XA 4DJED 3QGKC 1BSIA 3E74A 2WSKA 2PP0A 4XZHA 2OYMA 3KXQA 3UWEA 3T9PA 1D2KA 3IWPA 4IJRA 4D8LA 1FBAA 3WMBA 2XH0A 4L1XA 3TTYA 1OX6A 4YPJA 3U7VA 5GNZA 4ADUA 2J7HA 2CESA 4US5A 1S1PA 4BZYA 4HNTA 1CXIA 1DYSA 3HQPA 3LV6A 4IP7A 2ZUTA 3PUOA 1I1WA 8A3HA 2VZVA 1KM6A 1W0MA 4NI8A 1S5MA 1EFZA 1JZ6A 4GYKA 2PU0A 5BU9A 2A7RA 4GVHA 4LBUA 4A29A 3B9NA 3WLMA 4IPLA 3AIQA 1WYIA 2HTMA 1OD8A 3ZVHA 8XIMA 4HIBA 1VFSA 4HOXA 2IPGA 4US6A 3N73A 1R3VA 3MW7A 4ES4A 3HB9A 2QHAA 3ONBA 1Q6OA 1FXPA 1QWGA 4NUWA 1XCXA 5G4WA 3M0ZA 2Z25A 1P0BA 4QG9A 2BP1A 4S3JA 4JBRA 1UQYA 2HJPA 4UZUA 3VNMA 1XCWA 4FXFA 1P0KA 3Q4DA 3L4XA 1UH2A 1RCXB 3FY1A 1YIXA 2XFWA 2ZIDA 1LP6A 3IIPA 1G6CA 1HO1A 1RUSA 3BJTA 1DXIA 4XZ9A 5CZ0A 2OELA 3AISA 2F38A 1OIFA 2ZE3A 1MUMA 5FOOA 4NT0A 3TXVA 2E3ZA 3MHUA 4Y9NA 4C6FA 3U0HA 3CT2A 1BG9A 2PLMA 2PDGA 5HNRA 2E5CA 4RW3A 3Q45A 4M7TA 4HHMA 3RDKA 4PMNA 3URNA 2ABBA 3KE0A 3L4YA 5D9PA 9XIAA 2BODX 4HQVA 2PB1A 3EXRA 1UR1A 2X41A 4X61A 4MADA 3C2OA 4MJ4A 4L6HA 3H26A 1D8CA 3I6TA 4O0ZA 3DFHA 4OZOA 3HQOA 3R1ZA 2YYUA 3AHYA 3VCNA 5A8OA 3PANA 5D30A 3TAOA 2PBOA 3D3AA 1AQMA 4REQB 3G0XA 3KUMA 3PSWA 4EXQA 3U7BA 5LSMA 3TTOA 4CNOA 1TJPA 5I23A 1WOBA 1SR0A 2YDQA 4FOUA 1GEQA 4ZA0A 4ZTYA 3BDKA 4GPNA 2VZOA 4C7GA 3B9DA 5F1UA 4RK8A 5DO8A 5I3KA 5AHEA 3O8AA 1IHIA 2R14A 2F6XA 3W26A 5E0CA 4HYVA 5RUBA 3WLIA 5LNVA 3W9ZA 1F3EA 1KLYA 1Y5VA 1IIHA 1NWSA 1OABA 1XM3A 3PZMA 2INZA 2PE4A 3WNPA 2UZ9A 3PTDA 1BRLB 4GUIA 5JUVA 5A5WA 1OZMA 1G01A 1B9ZA 4CQDA 3FSTA 1JPKA 1ZCOA 3N4EA 3GG8A 4ZOAA 4M6VA 3VGFA 4ZVJA 3E2QA 3LK6A 1V3LA 3B9EA 4H9MA 4F40A 4MJMA 3HGJA 3UCDA 3N2BA 3NSNA 4LNCA 4MNKA 1WUEA 2XGIA 5EMMA 2J7EA 5FJRA 1XGEA 3GC2A 3WDRA 1DJNA 4RW5A 4JTEA 2XDFA 3LERA 4DZ5A 1SW3A 1KXQA 4KWUA 3VCCA 4QX4A 1EP3A 4UQ9A 2I5IA 5H8PA 5A8PA 1BEUA 1F07A 3TN3A 4O10A 1Y5WA 2VFEA 4LC6A 1W3JA 1TWDA 2W66A 1YKWA 5JBFA 1JFXA 1ZBKA 4KKXA 2WCGA 3S5ZA 3W1NA 4EWND 3SUTA 1GYLA 4OECA 3ARUA 2QQ6A 1KQYA 3BSMA 4RUBA 3DFTA 4NRSA 4O0KA 2H3DA 5CPOA 9XIMA 2R91A 3NUKA 1O68A 3GNNA 3M5YA 3K30A 2ZRZA 3W2KA 5H2ZA 1BKHA 3LEPA 3LG3A 4QE5A 3N2XA 3U3HA 2ISDA 3LXBA 4QSHA 2ONEA 3T44A 3LB0A 3S83A 3H21A 5FJPA 2CBIA 3S6DA 1EPXA 1B1YA 4EOUA 3ABZA 1WV2A 4GC4A 3JR2A 3SAZA 3TA9A 4AW7A 3ITLA 1QPRA 4CD5A 3O9NA 5C54A 4QDPA 2BY2A 1QI2A 2ZKMX 2W5FA 4KRTA 3BJFA 3ABOA 1IZJA 3DAQA 1KTCA 1XG4A 1YE6A 2FYMA 1YBQA 2G5WA 3K8MA 4HA0A 4NU7A 4W8BA 1BTCA 1GVIA 3BLLA 3GNDA 2VFFA 4I9MA 4XAYA 3AFBA 1CXHA 2RJGA 1GNXA 1QW9A 3B4UA 3L4ZA 1K7EA 3WLTA 1ICSA 3M16A 3W84A 3FDGA 4YIWA 5FSDC 1MUWA 3ARRA 4ECLA 3ECQA 3SN1A 1V3HA 4TX8A 5AZ1A 4P2VA 3G6LA 1N55A 2DH2A 3WH8A 1VAHA 3IIVA 3PG9A 4AYSA 4FOJA 3CL6A 1KRCC 4YU1A 2HV5A 2XTKA 4FHAA 1V51A 3AU2A 1SJBA 1IWBA 3SUVA 4AY1A 4F79A 3APTA 4CNUA 1Q6LA 1PV8A 5DMLA 1UP0A 3RGTA 1FFRA 4JCLA 3W38A 1DIEA 1WDQA 1AMYA 3IUDA 1OGSA 3B8WA 4F48A 4FLOA 4RDVA 3C8NA 4QTGA 1LDCA 1IEVA 4IIFA 4EXAA 3FXYA 4YHEA 3USBA 2B4GA 1PIFA 2PS2A 2C0AA 1P43A 1JD7A 1TE1A 3OODA 3W7DA 4LU0A 4EPBC 4UOQA 1U83A 3IUIA 3ELFA 5I79A 4JPGA 3GVRA 4W93A 1D7KA 4KEMA 3B9OA 3OIXA 1X38A 1EPVA 1HVXA 5HNUA 1JYXA 3IIZA 2VX6A 3T1GA 4ZL1A 4PSPA 2NSOA 5XIAA 4IX0A 1JR1A 5TQLA 1AG1O 4IJBA 1GQIA 2HDJA 3OEXA 3AHVA 1ISWA 2DQXA 3FYOA 2ZX5A 3TQ0A 1FWIC 4RPPA 3HM7A 4PB5A 4QCFA 4R53A 3AMKA 2E8YA 1IR1A 2BVTA 5GJPA 4PZVA 3W7CA 2ISFA 2OEKA 3UR7A 3QZ6A 3PZVA 5JMUA 1W9VA 1P1MA 4E2OA 4K39A 4ZQCA 5AHNA 3NL5A 3VNDA 2ZZ7A 4O1FA 1TIMA 1J96A 3S5YA 2ANUA 1XRSA 2VVNA 4PMRA 3IJ8A 1L8NA 3FFSA 1I2QA 4H9YA 1O5RA 4DEFA 2BY1A 2OSYA 2AGTA 4Z1AA 3MBFA 3S1XA 1RV8A 2VCBA 3DFQA 4QJ3B 4RR4A 3CQIA 3MYOA 2A7NA 3FKRA 3KBNA 2VCAA 3BWWA 1YPXA 2Q8ZA 5DRCA 2ZUNA 5EMLA 3AXKA 4OGZA 2EPHA 2W0UA 3GDKA 3PBGA 3DHUA 1XBZA 1TB3A 2WANA 3WLHA 2PPGA 4LX4A 3VX0A 2W63A 3PBYA 3M0IA 1W1YA 3KHDA 4F66A 4GNKB 2E7FA 2PD9A 1Z69A 4O28A 1TR1A 1NQKA 4AC1X 2HBXA 3MJYA 3GD6A 1KR0A 3W7OA 1FRBA 1VC4A 4N0RA 3WFAA 2DSUA 2XSBA 4N4PA 4RV3A 1AMKA 1QHPA 2OVLA 3CO8A 4S3AA 1PX8A 5G2HA 4YS1A 3A4JA 3RX2A 1KW1A 3S47A 1QDSA 4WRHA 3NG3A 5LIXX 2KAUC 3L0KA 5HA7A 1GKQA 1EHNA 2CZ5A 3EMQA 3FIGA 1KM5A 1ZS2A 3F4DA 3WUEA 3OB8A 3UXAA 3N6QA 3E0FA 3VIMA 1WCGA 2GZXA 4CCEA 2DU2A 2Q8XA 3CHDA 2GQ9A 1RH9A 4QAWA 4AZGA 3AXHA 1WB0A 2BY3A 2C14A 2IQTA 1PAMA 2PWEA 4F2UA 1HG3A 3W7KA 1XQKA 2V5DA 5HR7A 1MWOA 3MS8A 3T0CA 5FJIA 1OX5A 4PTMA 2DT2A 3TCEA 1ALDA 1OGBA 3GW3A 4US5D 3OZMA 4PL2A 2W27A 3DERA 1UIOA 3WJZA 4O16A 4BF7A 4JFTA 4U31A 4S3BA 3G22A 1S2TA 3GYEA 2YBVA 3IVUA 1FFQA 3G8EA 4A21A 2PFHA 1H09A 2A3LA 3GAYA 2X1SA 4HYRA 1E5JA 4DM2A 3KTXA 3NPVA 1TRIA 4JTIA 5L6UA 3DUGA 1UWRA 3EKGA 1EX1A 4OJYA 3UXLA 4WF7A 2BOFX 1SSDA 3B3DA 4S3FA 1XWYA 3QXBA 1XL9A 5TIMA 4AD5A 4JYDA 5CBIA 4NAEA 1GTEA 1VJZA 3B05A 3LM3A 2DZTA 2F6KA 1UWQA 1OX4A 2BVDA 4CQ8A 1L6WA 2V81A 4YL2A 2G41A 4BWLA 4Q7IA 1T8XA 3B8VA 4OE7A 1KBKA 1PYFA 2NLIA 1J18A 1NFPA 2YR1A 3AIWA 3UWQA 3VC5A 1HIZA 3TR9A 3N9KA 5FCZA 1S46A 3I65A 1DPMA 1ECQA 3VOHA 2CKSA 1B54A 4MFEA 3VZZA 2VENA 1BHGA 1LWHA 3U2CA 3I4EA 1IYXA 3CEUA 4X2PA 3NQ2A 3WH9A 2WJFA 3R10A 2PDQA 4CN1A 3VKCA 1CBGA 3S2NA 2NQJA 1R86A 1VGAA 3HPAA 3K5XA 4BY3A 1QK0A 4MTVA 4I5RA 4CU6A 1G4SA 1L6SA 3SFKA 1O5XA 3R2GA 3WQ8A 4IM4A 4FIQA 5JBEA 2HNHA 4IQDA 2OQYA 3CQHA 2DZPA 1BKSA 1VCGA 1A3WA 3BOXA 3WLOA 1EZ2A 3KOZA 4F9DA 1XIHA 2ZUMA 4S3GA 2D2JA 5F4SA 5CG7A 4MSSA 5FEWA 3G77A 1TKKA 2NV1A 3UG5A 4LFYA 3SQMA 4OFCA 1HZYA 2PBGA 3OA3A 5BRBA 1RQEA 5EYWA 5ABFA 2R1LA 2Y7DA 3SCNA 4G7EA 2D2GA 1QOPA 5GQBA 3LX9A 1EXPA 4IP4A 5DT7A 1F3XA 2OWCA 5D33A 1WAUA 5D05A 4FX8A 2XYLA 4QLKA 4L6DA 1UWAA 4B3LA 3MP3A 2HXUA 1F7BA 1Y0EA 1ONXA 2AKZA 4GFIA 2RGMA 1YXCA 4CCZA 4KRUA 2HS6A 3ONCA 7A3HA 4PC8A 2H8ZA 4QSFA 4UTTC 2XWDA 4XUYA 3PZGA 3VMPA 1ISXA 3KL5A 1R9XA 4U4MA 1RLDA 1QW8A 2PWVA 3U8GA 4XB3A 2WPBA 4RNIA 3W88A 5F7UA 3FV9A 2NQHA 2J7DA 3QHMA 1IGWA 2E9MA 3UJEA 1HJSA 3SURA 3TR2A 1NFBA 2YXXA 2QCNA 1A49A 1P7TA 1Q2SA 3LTYA 5AOUA 1FCQA 4DI8A 4NYUA 1FKXA 3GHRA 4QS5A 3MUAA 3ZLFA 1F05A 1Q6CA 4P8UA 3R89A 1Q8AA 1M41A 1DWJM 2P5NA 3W76A 2QDDA 5GJMA 4YNGA 3TW7A 4JIEA 3LHYA 4I8YA 1QBBA 4W8LA 3VVGA 4FALA 3MZ2A 3S2MA 3L66A 3STCA 2VTFA 2VC5A 1X6LA 2VC6A 4DM1A 1T5AA 4O11A 2VELA 4NAEB 3NURA 3TQPA 3FLUA 3UYIA 1BFNA 3CTLA 4MJ2A 1OX4B 1KCLA 3UXDA 4KCVA 2P8CA 7PTDA 4RPQA 1XBVA 1QATA 3LZ5A 3VMOA 1LL6A 3PP7A 2ZWZA 1LOLA 2YOCA 2XWEA 4CGTA 2O0TA 1XBYA 3TDFA 3L2IA 4CU8A 2YCLB 3NO1A 3WDPP 3W2UA 3G5EA 3T4CA 3P3BA 2C1GA 3NQ8A 5KETA 2X2GA 1ZB5A 2DSZA 1XIBA 1VYSX 1JZ3A 3KM8A 3T07A 4B5SA 2WQPA 1OB0A 4O1DA 1MW0A 1Q6GA 3BG3A 1SJAA 1WUFA 5C6MA 3R79A 2IXVA 1TX0A 4RNFA 4OUIA 1Z44A 3FX4A 1EJ7L 4QFUA 1S1RA 4NX5A 3QKZA 3GO2A 3CHEA 4AX7A 1JULA 1QHZA 4QHRA 3WDJA 2DPEA 3QY7A 3GE7A 3GDTA 3QQWA 4D6HA 1XV8A 3TU9A 3R7MA 1I1XA 4CQCA 1KM4A 1ECEA 3YPIA 3C2FA 3OGVA 3M0LA 4ZO6A 3H22A 2HPMA 3QQ0A 3CZGA 5I3GA 4ADTA 4H2HA 3H2MA 1VS1A 4UOZA 3IAPA 5BRPA 1GVRA 3CPRA 4AIOA 2QPSA 4DZAA 3LXAA 2D0FA 3LHUA 2P8BA 1EQCA 2WKGA 2X42A 5HWMA 2XIOA 1X8CA 5ABFB 4ATDA 3VIHA 4MAZA 3TNOA 5I2UA 4G7EB 1KNWA 1V0NA 4OTKA 2WMJA 5FF0A 2C0HA 1RXOB 3LUTA 4JYFA 4L4MA 2PDWA 1YNPA 3EB4A 2GOKA 3R5EA 4XVDA 3PTQA 1CENA 3R8HA 4AD0A 4WY0F 5C9UA 2Q3RA 4UTTA 3OO2A 2BHZA 3A3WA 3VKBA 3T0BA 1QUMA 3VCRA 3IARA 2E1DA 3CIWA 1XIJA 2CW6A 4F2BA 3G18A 2VXNA 4F2TA 1GPWA 2VWTA 4O19A 3MCMA 4UTHA 3LBMA 3RCNA 1J0ZA 4QRNA 1E1CA 2JIWA 3DYPA 1H7NA 3W07A 2Z4GA 1TQXA 4NYYA 3QPZA 3TYBA 1XC4A 1QBAA 1IXNA 1RCQA 3AROA 1P7TB 3MQTA 1EA9C 3HZ3A 2WK2A 1JAKA 4CU7A 1T0OA 4IPPA 2FTPA 4TTGA 5I78A 4HN4A 2DSVA 3EWCA 5KTLA 3TYZA 3E49A 3ZSSA 4GQGA 4U28A 2FZ9A 1BVWA 1W2VA 5CPTA 4H19A 3G8RA 5HWNA 4S3EA 3N15A 1XLLA 4C7DA 2HNEA 2JBMA 2YA1A 3W86A 1UWUA 4DO4A 1BYCA 1TV4A 5M1TA 4LH8A 3WK1A 2W6RA 3ITCA 2GWNA 3KRBA 1OG0A 2AMXA 3BICA 3OZOA 3N9SA 4FAMA 4TTUA 3GDLA 2DQWA 2VFDA 2ZRUA 3V1HA 5CLWA 3L23A 4IL2A 3O16A 4KH2A 3OVGA 3M0JA 3VZXA 3POCA 2CLFA 5L9FA 2TPSA 4AMAA 4UTUA 2W91A 4C6OA 5A6MA 2I1OA 2W4XA 4AD3A 5IM51 2QUTA 1DWHM 3C6CA 1ZUAX 3VOJA 3FGCA 3SFWA 3ITOA 5K2ZA 4CNSA 1DEDA 1DJGA 4IQLA 1J0HA 3VKKA 2ON3A 5I3IA 3NZQA 1H61A 5DCBA 1JDCA 1JI2A 5D2VA 5TBOA 2R6OA 3D3FA 4WLCA 3OQEA 5JQ9A 1TTIA 1DVJA 3TJ4A 2GLKA 4DXKA 4HMNA 4GYJA 5A2AA 5FJUA 4AISA 4Y2WA 1NTHA 3N25A 3I6RA 2X0HA 1M6JA 4LC8A 3AJXA 1UOZA 1E4NA 1E56A 4LRSA 4Q8NA 4V1XA 2FGZA 2AKMA 3F2BA 4EF8A 2FPVA 3CZLA 4KCUA 2NUXA 4L80A 3JRKA 3BAYA 4NASA 4ERGA 5KZ6A 3QM3A 1XH0A 5LXXA 4PL1A 1Q7MA 4NY2A 3WF2A 3S1GA 3L4TA 2GDQA 3N2OA 4H6KA 2JGYA 3KFTA 4MUPA 4PE8A 4ZSTA 3QC0A 1LQ2A 4RE3A 3UGVA 3B0YA 3PFRA 2W92A 5HBFA 4IISA 5HATA 3EX2A 1UZ1A 1E43A 2CEQA 1TPEA 2DZAA 3KDOA 3HQNA 1A5MC 4ICNA 5C9XA 2I16A 5AYZA 5C2XA 4W7UA 3T2PA 3EA2A 2PRHA 3AJ7A 2Z24A 4W7WA 1V3MA 4DLFA 2PDKA 3BAWA 2HROA 5K4ZA 3CTTA 4QP0A 4J4KA 5I03A 1F4AA 1EDTA 3DGBA 4D6EA 5CKSA 1GWJA 2ZZ4A 3M6YA 3PFMA 3NXFA 1JZ4A 5EBUA 1UUOA 4P5UA 1NF7A 4ZZ9A 4UTMA 1VPYA 1DORA 3W27A 1B30A 1NH6A 1LUCA 2DW6A 1XLGA 2X09A 1XH1A 1SO5A 3H4GA 2EG7A 2LLEA 4AY8A 3PWIA 2Q71A 4JIRA 1EIBA 5D09A 1VF8A 2ZC8A 3LD5A 1E1CB 4DNMA 3DEQA 3CAWA 4PUMA 3BSGA 4HTYA 3THQA 3GIPA 1W91A 3GVVA 4IIHA 4S1FA 4DPQA 1XW8A 2CERA 1YADA 4PEEA 3AOFA 1KGUA 1KO0A 3MHFA 3RF9A 3P2VA 1FWTA 5AVNA 4QJ5B 1EJVC 1RQBA 1E6NA 3B03A 1KRBC 1J2WA 5BXTA 2JEPA 1R3SA 3DC0A 3TUUA 4G7FA 3T09A 3DIPA 1F6KA 4RDYA 2Z7GA 1DJWA 1K4HA 5AB3A 4DWSC 2UY3A 3CQKA 1U1HA 4WR3A 1NU5A 1W56A 1DL3A 4A2SA 2BXZA 5EB8A 3NEVA 3WLSA 3I3DA 1HGWA 3PK7A 2YZRA 2ZZ1A 1V6VA 2GDVA 2G3JA 2EG8A 2JALA 3OQ8A 2EG6A 3PBVA 4UTIA 2TAAA 1LRTA 3TMLA 5FL1A 1FWGC 1TWIA 3VIKA 2GOUA 3MWAA 4Z2JA 3VD9A 1C29A 1EJSC 4O12A 3WD2A 4NJGA 3W74A 1K4GA 2YDAA 2A3BA 5CPLA 5LHEA 1REQA 3FGCB 3W01A 4OQVA 1XIIA 2VFGA 1R85A 4CD6A 3QMTA 2QAPA 4GACA 3ZSTA 3M46A 3A4XA 3KBVA 4IX2A 3EOLA 1FWNA 3UA4A 3WNOA 5T9BG 1MZRA 2I5GA 1Z42A 4TIMA 3DFNA 4DVOA 3W6YA 1MQPA 1YNYA 4K2SA 3RM9A 3TC7A 1QI5A 3AYSA 5AY7A 1HF6A 1WOAA 5G1TA 2I7GA 4E8CA 3W53A 3N04A 1CW2A 1W5QA 4L7ZA 4UQEA 1UP2A 1MNZA 3ES8A 3AUOA 2O7QA 4KWSA 1WZKA 3OYXA 3UETA 3VZYA 4ATLA 2D0HA 4KEVA 1OCJA 4EAYA 3V0SA 3AYTA 2CWXA 2WMGA 3M5VA 1TA3A 5EGRA 4DBWA 1N8WA 1W37A 5DXYA 1JGIA 4UNKA 2J6XA 4LEQA 1AD1A 4M80A 4LAOA 1UP3A 3WDQA 2WSYA 4YCPA 3QMRA 1B0IA 1B3YA 2C15A 1E6XM 4IGMA 3OBEA 3EOOA 3PZQA 3THDA 5ABEA 4O18A 2PEVA 5A2BA 1E6SM 2JQXA 2QKFA 3P14A 2D1ZA 5K3VA 1KWKA 2WKJA 1D9EA 1I75A 2WZMA 5AC7A 3N1AA 3THCA 1Z89A 4U2ZA 5BXPA 2FZDA 2ISWA 1E1EA 3NIYA 4POCA 3GBDA 4CD7A 4NZCA 1RVKA 1OM0A 3IK4A 3P5ZA 4GG9A 2ZXBA 5E09A 3STFA 3TAKA 4P7OA 1A5SA 3W29A 1WKFA 4CD8A 1UZ4A 4N9EA 1EQPA 2Q01A 1S39A 1EC9A 1ZL1A 2WBGA 5EMYA 3ZR4A 1W31A 1R0MA 5SWUA 1LUCB 2WNZA 3LCLA 2DJLA 1MW2A 3UG4A 3QLLA 2E5DA 1OFRA 3VD4A 3O0KA 1FWSA 2D3LA 4I9JA 4L4OA 3NYDA 3HTWA 3O15A 2AQWA 4PRRA 4O15A 4WJXA 2ZOXA 1XD0A 4E4PA 3ZJ8A 1IIGA 3RMEA 1XIFA 2DDXA 4LALA 3PNZA 2O55A 4IMAA 4N4QA 1VENA 1KD0A 1QAPA 4GQ0A 3SECA 4CNPA 2B7NA 1PJ9A 4NZ4A 1POJA 3CS2A 1M03A 4BR1A 4LW7A 1QPNA 1WNOA 1PL9A 4R33A 3AMCA 1LCOA 1GGOA 1CPUA 4XUGA 1TCMA 3UP8A 1PKMA 2DVTA 3MP4A 1MFUA 1FCBA 3C3UA 2VKZG 4ZB2A 3A64A 2ZBTA 4GHRA 2HE8A 3NZ1A 4JQ1A 3DG6A 4Q4RA 4WUIA 1O12A 2GK1A 1TJ2A 3BGAA 5G4HC 2Z6JA 2JGQA 1XLJA 1TV8A 3GXFA 1H63A 3N11A 2GVYA 3GBEA 4GISA 1LF1A 2ZUUA 5C55A 3S46A 4A8NA 1N8FA 4IOTA 2E25A 3SRDA 4AY7A 2DUAA 3VIFA 4GI8A 3UZJA 5CPQA 4QBXA 1VBJA 4JHOA 4EACA 4XWUA 2VX7A 1EZWA 1ME9A 1REQB 2EGZA 3W7LA 4A35A 1B3WA 1UH4A 3CH9A 3M0MA 4LAMA 1FWWA 4B91A 1H49A 3QPEA 4HU3A 5IDZA 2QPXA 4RZ6A 1HJWA 4UR8A 3OGSA 4MYAA 3O06A 3HBLA 1TZ9A 3CZKA 1J8VA 1B57A 3ARYA 3CUGA 5ENLA 1RK6A 3MA8A 2JF6A 4RE0A 3EDJA 2J8FA 4QGCA 2D22A 3ZVIA 3HGSA 3WMSA 3RR4A 1A53A 1TZ7A 2VEKA 1OWQA 4FLRA 1JL8A 2GL5A 2C8NA 1SW7A 1V8EA 3LS9A 1K9EA 1MDLA 2GVGA 1Q6FA 2PDFA 3EPOA 3WQCA 1TPDA 3ZT6A 1GVOA 1BGGA 4DELA 2QLYA 1TA3B 4BF5A 1UCWA 3DKJA 1L6GA 4R9XA 5IBXC 1E4MM 1V6WA 5ABGA 3QY8A 1HUVA 2RFGA 3IJ9A 3UR2A 1RCOB 1R3RA 4UR9A 4CLMA 4DUOA 4AFYA 1W9BM 2E9LA 3II1A 1E3XA 2XVLA 2WMKA 3VGGA 2PU1A 3PJXA 3C2YA 4LQ1A 4C1KA 4XIMA 3E2VA 5F2MA 3QTPA 3R4IA 3W7EA 4HCLA 3UNTA 1A5OC 1Z3NA 4DO5A 5B80A 1TJ0A 5HANA 4C90A 5BRQA 1EP1A 1FWAC 3H8AA 2NV2A 4H8HA 1FP8A 3WQ6A 3VNKA 4FXJA 3MUY1 4JTKA 1AFSA 4RE4A 1E0WA 2AAAA 3P0WA 3AXXA 5MKGB 3H12A 4PUUA 3KWSA 3PBUA 1F9CA 1T96A 4JEJA 1C8YA 3M0VA 4D8ZA 3DH7A 3GKFA 1XLKA 3SZ8A 3STGA 1NAL1 1AJ0A 1WXYA 5CPNA 3W71A 3VM7A 3QHOA 1US0A 3AALA 4A3UA 1PKYA 3NO5A 1HFBA 5F1VA 5GVJA 3PZOA 2GGIA 3OBKA 2QR6A 1TPWA 1A5CA 1SUXA 5HOSA 1RJRA 1Z7AA 3H55A 4AF0B 1K03A 4N02A 4NJIA 3DYOA 4P7NA 3OLGA 4W5UA 1CGUA 3SW6A 1PZ3A 3N19B 4DIAA 2GPTA 4TUFA 2OLHA 4QLJA 3RMJA 1GORA 2PD5A 3GR8A 1SFTA 3O7UA 4YWSA 4A22A 1V77A 3N2MA 1YXDA 2GJLA 1GVEA 1QNOA 2A3EA 3GHUA 2NT0A 3W00A 4AEOA 4OBTA 3PG8A 2BGNE 4X9SA 3KWXA 1EOKA 3LDVA 3VOCA 1ITXA 2QVNA 3RLHA 1J0YA 3W6LA 3HPZA 1SR9A 2ZX7A 1EO5A 1TYGA 4J27A 1TO3A 2JKEA 2GK1B 1FHLA 5LNUA 4C60A 1PVNA 3O63A 1W5MA 3BCJA 3UCQA 1E0VA 1WDDA 1IEWA 2YL5A 1AQHA 2F2KA 1LWJA 2GGEA 2Z00A 2ZCGA 1AW5A 1S2WA 3W82A 3CNYA 3W1LA 4X0NA 2Z7KA 4D1IA 4WDUA 5DLCA 4B90A 2C18A 1U5JA 4HZ8A 1T6MA 4O54A 2WCAA 9CGTA 3L0GA 1V7YA 3ZXWA 1MQQA 3TQVA 3AQUA 5AHLA 4C1NB 4CVWA 2POZA 2A3HA 2NWRA 3K4AA 3A22A 3VIOA 3KX6A 2QZRA 2WV8A 1YX1A 2P10A 2YJQA 5AFDA 1ELSA 2J79A 4JGDA 1UBPC 3A5FA 4KCWA 8XIAA 4M5PA 3CWHA 3XISA 4H9ZA 4NJJA 2VD9A 4Q4KA 3NO3A 2E67A 1SYTA 3M0XA 3GTXA 1OGGA 1PO9A 4GRSA 2ZUVA 4C6MA 2DGAA 1QK2A 3BXWA 4DQWA 1M04A 4WSHA 3V1PA 3ZLHA 4GK8A 3QN3A 1W1B1 3B04A 4FS9A 1GOIA 3VYLA 1XGDA 3RCMA 3WKZA 4GFSA 4OWGA 2GGHA 3LN3A 4PUJA 3BH4A 2AGKA 2IPFA 4PMYA 3HG2A 2OSWA 1TV7A 2A3AA 4F0LA 1XQLA 1KGWA 4A8RA 2OZ0A 1LYXA 3DXIA 3U9IA 4ZTXA 2ZXAA 3TJIA 3ARVA 4D71A 1UA7A 3LHVA 4UQCA 3RPMA 3BLIA 4GKLA 3A3XA 3MCNA 4EF9A 3CH0A 4HBKA 1B5TA 3M0HA 5A6KA 3D46A 4D6DA 2PWDA 2VOMA 2DIJA 1UR4A 4ZE4A 5FSEC 1G9HA 1QT1A 1ITCA 3S3GA 3MMTA 2F8QA 3PNUA 3TTSA 3GZAA 1CXFA 2GSJA 2V67A 3A24A 3SGUA 1RD5A 3GK0A 3RCYA 4AZCA 3BPWA 3NQ7A 4IUGA 2E1WA 4CN6A 3TMQA 3SB0A 4BQ4A 2FJKA 1ZJBA 4H2CA 3WNKA 2GVJA 2VL4A 6CGTA 3ZFHA 1WDSA 4RJEA 3NSMA 4CEUC