5CPTA

Disproportionating enzyme 1 from arabidopsis - beta cyclodextrin soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cptA01
4MNJA 3WMCA 1A47A 2C7FA 3NJ3A 5E9AA 3U57A 4PCSA 1V3MA 1ZJAA 2XTKA 4UOQA 2EPNA 1JZ7A 4BQ3A 4C7FA 4WSKA 1V3JA 1V0NA 4MAVA 1DWFM 1ISXA 3WDPP 4Z2LA 4WIWA 1E72M 4UQDA 3GBDA 4PMDA 1E6PA 5FD0A 3A4WA 4M8UA 5KEZA 1JZ8A 1JIBA 2X1IA 4HMEA 1CWYA 4UZUA 1ODZA 4W5ZA 4URIA 1KFWA 3WN6A 1FH8A 5LYRA 4KGJA 1V3KA 4P7NA 2ZIDA 5A2CA 4PN2A 3WUEA 2DQXA 1UA3A 1ODUA 2YIHA 1ZBCA 1WDPA 2BXYA 1QW9A 3MO4A 2E0PA 3N11A 3WQWA 1AQHA 2WMFA 4RE3A 4Z2JA 2CCRA 3G6LA 1PX4A 3T2PA 1UD3A 5CLTA 2BFGA 4J3UA 3WENA 4CCEA 3QHOA 4GXPA 5DEZA 1TUXA 3AMCA 2FHBA 1S46A 2XVLA 5FL0A 2BXZA 2VX4A 1Q6CA 1K9FA 5CPTA 2BVYA 4MDOA 3WQVA 1RPKA 1WDQA 3OGVA 1F4HA 5D9MA 8CGTA 2Z1KA 3MS8A 3PBGA 2O92A 3IJ7A 4C7DA 1FFRA 1VENA 4NRSA 4PEEA 2YLLA 4DWSA 1LG1A 1KGWA 2JFEX 4E4PA 4XX6A 2VR5A 1BPLB 1KCKA 5A6MA 3GH7A 1JAKA 3L4UA 4B3KA 2ZX5A 2VZTA 2XVPA 1E71M 2DSVA 4AZ7A 4WLCA 2CHNA 4DWSC 3DC0A 5A69A 5A6SA 3GXMA 4UFKA 3AIQA 3TTYA 1NOWA 5EFDA 3CMGA 2DSWA 4AD2A 9CGTA 4CGTA 3EMCA 3KZSA 3MV11 3CUGA 4GIAA 2DH3A 3ARPA 1GORA 2DT1A 1JXKA 4IPNB 4JZ5A 1BLIA 4TX6A 3ARUA 1QW8A 1E3ZA 1M04A 4D72A 1UKSA 2WBKA 3TOPA 1FHLA 2A3EA 5A6AA 2EPOA 1JDAA 2DDXA 1G5AA 4FF5A 2B31A 2YL9A 2J7EA 1A3HA 1QNRA 4PMNA 1H5VA 5DT5A 5DO8A 4D6IA 4W93A 1OT1A 4M29A 1ISWA 3WF4A 1C8XA 3E1F1 1OINA 1UR1A 4MPKA 1K9DA 2E8YA 5GPRA 3A3HA 1V3LA 1B3XA 4M80A 4PMOA 1EHNA 3POHA 4J3VA 3WDJA 2X0HA 1AQMA 1PJ9A 3RILA 2D3LA 5AYIA 2PI6A 4JKLA 1JZ6A 1Q6FA 1H41A 4ZXOA 1V08A 1W9UA 4BF7A 3WEOA 3WEZA 3MSDA 1GOQA 3TA9A 3N18A 1DWAM 4HA3A 2W5FA 3J7HA 2VRQA 1UKOA 2OYKA 5D9PA 2BVDA 2GSJA 1BYCA 4GINA 3QGVA 3AJ7A 5EBAA 3EBVA 1TMQA 3ARVA 5CPSA 3WEMA 1RP8A 2BY3A 2WKLA 1XH2A 2EQDA 4CUCA 5M3WA 4C7GA 3FW6A 2EXOA 3AHTA 4OZOA 4N42A 3WMSA 3QHNA 5CPQA 3AHVA 2CXGA 4XZBA 1ISZA 1W1VA 3RCNA 3AIWA 5CZKA 3B9DA 1UZ4A 4CN4A 1UD2A 3ZO9A 3NSNA 1DTUA 3UR8A 4B16A 1QI0A 1E3XA 1E5NA 4AZ6A 2J77A 3VDCA 1O6IA 3LPOA 4UCFA 2VCCA 1HX0A 1EH9A 1CXLA 3BXWA 2IXUA 3VMOA 3CO4A 2W67A 1WDSA 5A6KA 2CNCA 1ECEA 4ZXLA 3SUTA 5A8NA 3BAYA 3GYCA 4OUEA 1C7TA 1BQCA 1CIUA 4QLLA 3F4VA 1FOBA 4GPNA 1TG7A 1VFUA 3NIYA 3SCOA 4BCEA 1HL8A 3CLWA 3U7BA 3K8KA 4GQQA 2E4TA 4W7WA 1PBGA 1GZJA 1C3FA 3OLDA 4GO9A 2XFYA 1TVNA 1J10A 1OCQA 3MUY1 3IJ9A 2XM2A 1UH2A 1HKMA 3K8LA 1BG9A 2C0HA 3UR7A 4AZIA 2GJXB 1QOXA 3CHCA 3ZT5A 2G3IA 3ZJKA 1IV8A 3VDAA 5CGMA 3QHMA 1V0MA 2VZOA 1K9EA 3ALGA 5JIWA 1GOMA 2CBVA 4U31A 1NM9A 4BQ4A 4JL1A 1CDGA 3ZT7A 1K6AA 4PTXA 1HN1A 3M7SA 4DM1A 1L0PA 1GW1A 1HKKA 4H04A 5HBFA 1C8YA 3CTTA 5E0FA 2XM1A 1B3ZA 2WVSA 3PZNA 3EDEA 2VC9A 1BF2A 2VX5A 4GI9A 1MXGA 1LL4A 4GI8A 4KRTA 4MB1A 2WHMA 2J4GA 3L2LA 3ZMRA 1QNOA 3ARRA 4Z2IA 3AXIA 4Z2KA 1CXIA 3S2CA 3VDBA 3EYPA 4PCTA 1HNYA 2J47A 5E0CA 1MQQA 1AMYA 2ZWYA 3W29A 2GFTA 1B2YA 1EDTA 3FXYA 1HJWA 1HT6A 1J0JA 3CPUA 1W3LA 2WSPA 4BQ5A 4CU6A 1J0IA 2GVYA 1I1WA 4IISA 3WD4A 2IUZA 1GVYA 3CZJA 3W6LA 2JEPA 4WF7A 3TTSA 2O9TA 2VVNA 1CTNA 3TTQA 3DHPA 1L8NA 3T08A 2WVTA 3GNRA 2YKKA 3FN9A 1PAMA 2BHUA 5CXPA 3ARZA 4M1RA 3B8SA 2Y8VA 2WMJA 1UWRA 1GVIA 2EBNA 4FLOA 3MMUA 1PPIA 1J0HA 3PZVA 4AD5A 4HOXA 4UFJA 1KQZA 2VCAA 1V6VA 2X09A 3WQ4A 4HZ8A 4FLRA 1SMDA 3AXHA 4OKDA 3GNPA 3W53A 3NSMA 5KZ6A 3ARQA 1EHAA 5I2UA 2J75A 1W9PA 4KMQA 1C90A 1DHKA 1E6QM 1JNDA 2PWEA 3F5KA 1VRXA 2OYMA 3OLGA 3VO0A 3I3DA 4D6HA 1HJVA 4W8BA 1NOFA 1DWGM 2DSZA 1TR1A 3VINA 1UKTA 2CKRA 4HTYA 3HJEA 4CD7A 1JGIA 1OM0A 1XCXA 4UR9A 1KQYA 3QOKA 1Q6GA 1VFFA 4OBRA 3F5LA 1MFVA 4QP0A 2QHAA 1MW2A 1D3CA 2PWHA 1ITCA 1UOKA 3PTQA 3RJXA 2FGLA 3RPMA 1KB3A 2WB5A 2VCBA 2ZX9A 1E4IA 5AC4A 3LPFA 4X0NA 1Q6DA 3K4DA 5FOOA 3VMPA 1QBBA 2X05A 1PX3A 4UNIA 2DIJA 2VUYA 4PUEA 2WCAA 2BY2A 3MKKA 3WH6A 2CBJA 2VL4A 1E40A 1WCGA 1GQKA 1KXVA 3DYMA 2AOSA 2GJPA 3WH7A 3ZM8A 5JBEA 1E6RA 2XVKA 4UOZA 1NOUA 3VGFA 3KL3A 4QCFA 1JD7A 2ZXDA 2Y4SA 4DUWA 1V02A 3UCQA 4OIFA 1QHPA 1EIBA 3WF1A 4S3KA 4AXNA 3VIGA 1EO5A 1QI4A 1J12A 1HP5A 3WD3A 1C7SA 1B0IA 4PUDA 1GQIA 3SCRA 3AFBA 4TVDA 2UY3A 1V3IA 2XWEA 2WWCA 2QPSA 4AZBA 4M81A 1LQ0A 3AYRA 4H2CA 2W4XA 2FH6A 4U33A 4GO8A 4AZGA 3UETA 1CGUA 1E4NA 3SCSA 5IHRA 3PN8A 2W91A 3W4RA 1Y7VA 2JIWA 1JZ2A 5A8QA 2VQUA 3U5YA 4HZ7A 1D2KA 1VFOA 5ABFB 3VMNA 4TUFA 3ZJ7A 2YA1A 4WSJA 3TONA 1KGUA 3AIBA 8A3HA 2Y5EA 5DMYA 3VD7A 5FKYA 1EQCA 1NWSA 4CVWA 1M01A 3VDHA 2J7GA 4MDPA 2JE8A 1V0KA 2XFRA 1MFUA 2WCSA 3W26A 3NCOA 2VX7A 2A3HA 1UWUA 2CPUA 3AS0A 2GUYA 4TTUA 3W37A 2OYLA 4J3SA 4S3JA 1XH0A 3RM8A 5F7UA 2PBOA 3VOCA 1EQPA 1HJSA 1WB0A 3BAIA 4MNMA 2ZUWA 4LXFA 5LA0A 1I1XA 1E0WA 1OGSA 3AS3A 1KR0A 1BFNA 4MJ4A 1LF1A 3NUKA 3OLIA 2X8RA 4R27A 4ATLA 4F9DA 2X0YA 2J8GA 4AIEA 2ESCA 1XSJA 2E9BA 2O9PA 4PSRA 3ARSA 4MNKA 1FHDA 1MQRA 2WXDM 6CGTA 3BAJA 1PX8A 2ZX8A 1C8QA 1PEZA 5CGTA 5CSYA 1UWSA 1PZ3A 1J11A 2XFFA 4P8WA 4BS0A 4ML4A 3SCNA 5M03A 3AHXA 3UG5A 1WAWA 4DUXA 3MANA 3WMBA 3HN3A 1JYXA 1M7XA 5A2AA 1CGWA 1KGXA 4XUYA 1VBRA 5CSUA 1VEMA 2G3MA 2YA0A 2J78A 2CBUA 4E8CA 2ZUUA 5E70A 2W63A 1G1YA 2WMGA 3ZJ6A 3FAWA 4UQ9A 1UR8A 4PMUA 3WELA 4AW7A 5BCAA 1UG6A 4HPHA 4X9YA 3SIMA 4F8XA 2Q8XA 5JBFA 4NF7A 4M24A 2DT0A 1UKQA 2WZEA 3ZOAA 1KXTA 5I23A 1Z32X 1IZJA 3KL0A 3K1DA 4GKLA 5C8BB 3SUSA 1R86A 5TD4A 3JUGA 3WH5A 3WUBA 5HXMA 5IXEA 4HOZA 2J79A 1UUQA 3RDKA 3NSXA 3AS2A 1HIZA 3ZIZA 4LGXA 3WUGA 2OWWA 1RD6A 1JG9A 4WKAA 4ZENA 4U5IA 4CD8A 5BRQA 4P8UA 4TXEA 2O9RA 1V02E 1IT0A 2WANA 4U5KA 4W89A 2WW5A 1V6YA 1JYNA 2V3DA 2V3EA 3ZQ9A 1W1TA 4K68A 4RE2A 3VKKA 3ARTA 1SMAA 5A8MA 1VFMA 1XYZA 1U33A 3PZ9A 3CHEA 4EKJA 1NH6A 3K4AA 4HMDA 1MYRA 1OBAA 1H3GA 5DT7A 4HU0A 1CPUA 4MB5A 1W9VA 1U30A 2PBGA 1HVXA 2WC4A 4ACZB 3WF0A 5A6BA 1LWHA 1H4PA 3SUWA 3ECQA 1OD8A 4YHGA 3WBEA 2XYLA 3K8MA 3GH4A 1HJQA 4GZJA 1W3HA 2ZUSA 5D9OA 3NDZA 3N9KA 3WQ5A 3FHQA 3NYDA 4H8UA 3CGTA 3ZJ8A 2E40A 2DSKA 5ABGA 1KBBA 3AI0A 5CJ5A 3MUIA 4DWSB 1BGAA 5I6SA 1G0CA 3W6MA 4CN1A 5ABFA 1H49A 4HU8A 1UH3A 3EDFA 3U7VA 4P7QA 1JFXA 1H09A 3UERA 1H2JA 4UFHA 2W92A 2GK1B 3VVGA 4IUGA 3FY1A 3CHFA 4CCDA 3OA5A 1UR4A 4XV0A 2VO5A 2D0GA 1WKYA 1LJYA 3UESA 3PZOA 2BNJA 1ZBVA 3SURA 2D0FA 4AD1A 2XHYA 1JDDA 1V0LA 4N0RA 4MTVA 3CH9A 1H0IA 4AD0A 1EOKA 1D7FA 5ABEA 2D3NA 1PZ2A 1WE5A 4QCEA 2YL5A 3EMZA 5LA1A 4TVUA 1VJSA 1ZBKA 1NP2A 2ZOXA 4A3YA 3AOFA 4CD6A 5A3HA 4ZFMA 3DHUA 1RP9A 1B3VA 5E6ZA 4Z2GA 1IZKA 2J25A 1JXJA 1BG4A 5C70A 1E0VA 4LQ1A 4QLKA 2DT2A 3N15A 1UR9A 4HP5A 4AD3A 2W61A 1J18A 5CG0A 3ZR6A 1GQJA 1KWGA 4ZEPA 1UQYA 4J7RA 3B9AA 3L4TA 3WDHA 4JFSA 1E70M 5A95A 1HF6A 4LX4A 3BAXA 3W28A 4KRUA 1B30A 4XB3A 1TFVA 2AMGA 4RL3A 4AEFA 1U2YA 3SCTA 2UWFA 3K46A 1MVYA 2PF0A 1CLVA 3W82A 2A3BA 2IXVA 3GH5A 3I3BA 3RM4A 1VEPA 4Z2HA 3OGRA 2J62A 1MW3A 1BAGA 1OT2A 1XGZA 1W1PA 2W62A 2ZUMA 2YOCA 3D5HA 2WHKA 3BAKA 4CN6A 2XPKA 1GONA 4IPLA 2ZUNA 1GQLA 1WZLA 1G9HA 4CVUA 3BGAA 2A3AA 1GOWA 1JI2A 5ECUA 3AMGA 1TA3A 1H0GA 2RGLA 4UOJA 4A4AA 5A8PA 1JYVA 3PTKA 3KL5A 1J0KA 1E9LA 3L4XA 5D9NA 3F5JA 1HJUA 2D22A 3RMEA 3MSGA 1G01A 3WNPA 1C91A 1J0YA 3W38A 3LPGA 3BH4A 1JZ5A 2GDUA 3FAXA 2PB1A 4V27A 1TE1A 5EB8A 5A2BA 1J9YA 5JUVA 1CXHA 3BAWA 1V3HA 5AY7A 2YJQA 3VD5A 3CZKA 2FHFA 4AEEA 2VTFA 4PMVA 2ZUTA 1CGVA 3CUHA 1UD4A 2E9LA 3APGA 1XD1A 2XIIA 5GQBA 3OBAA 1C92A 5I77A 2WLYA 4WK9A 3WY1A 3II1A 1NQ6A 1Q6EA 1UWTA 2E8ZA 2ZX7A 2YL6A 4JAWA 3DYOA 3ARXA 4FK9A 2CYGA 3VIFA 4W7UA 4U2ZA 3BC9A 2D20A 3AZTA 1HL9A 3PZGA 4PMYA 2VVSA 1B3YA 2V38A 3RM9A 4D6CA 1CXEA 1GJWA 4KWUA 1E43A 1UKPA 2MANA 1TVPA 3WKZA 2D24A 3N13A 3ARYA 3O6AA 4LPCA 3KWXA 3WH9A 2YL8A 3VGGA 1UD5A 3PZIA 3VNZA 4MJ2A 5I79A 3KEHA 1VIWA 3W0KA 4P8VA 3VILA 1YQ2A 2V3FA 2GJXA 3BLKA 2G4FA 3U5UA 3VD9A 1GOIA 1M03A 5BYWA 4D1IA 4ZE5A 3VIMA 2JF6A 3WFZA 4W8LA 2Y24A 7A3HA 5FIPA 1DEDA 1CGXA 2C8NA 1UWIA 3WSUA 4UFLA 4D1JA 1K9TA 4J27A 2NT0A 2XVNA 3EMQA 2QMKA 1VAHA 1BVZA 1AQ0A 2WMIA 1GNXA 1XD0A 4AWEA 1W91A 5A6LA 1B1YA 5EFFA 2G8ZA 3BCFA 3PZUA 2XVGA 2QF8A 3VIJA 2OWXA 3A47A 1NWRA 1SR0A 1HKIA 1NWUA 1VF8A 1I75A 1BTCA 3GZAA 1W2PA 3AISA 5C71A 5I0DA 3SEPA 2J7HA 4UFIA 3WNOA 2D23A 4TTGA 1CLXA 2DT3A 2VOTA 4XZWA 2X2YA 3THCA 1Q4NX 5A8OA 1HKJA 4W5UA 4FLSA 4AZCB 2CEQA 1V6XA 5HPCA 5IDIA 3L4WA 4MB3A 1UA7A 5D8ZA 4AIUA 1QNQA 2PWFA 4P8XA 2ZXQA 4B9ZA 4LYPA 1V6UA 1JZ4A 3CZEA 4D6GA 3HMCA 1XH1A 3CIVA 4QLJA 1CBGA 2A3CA 3SCVA 1O7AA 1NP0A 1E6SM 1E6ZA 4H41A 1H11A 3S6TA 4B3LA 3AZRA 2XGIA 4HMCA 4UQAA 4U3CA 3TTOA 1E1EA 2YA2A 3BMWA 2VI0A 3WNMA 3RJYA 1OSEA 1XYFA 2OWCA 2BV9A 2FDMA 1E6NA 1W9DM 1BHGA 4GQRA 1MQPA 3SUVA 3AIEA 2XSAA 5LA2A 3GNOA 4W86A 1E15A 3PZQA 3CZ8A 1JDCA 4B9YA 2CETA 2NW0A 1WDRA 4RE4A 3A4XA 4D6FA 3GDBA 1UWQA 2D0HA 4HA1A 3VGDA 2YDRA 1ESWA 1E4MM 1E73M 4J3XA 4LYRA 5BXTA 3QOMA 3N04A 1TA3B 2J7DA 3WQ8A 2WAGA 4YN5A 1QHZA 1E5JA 1ZS2A 4P7LA 1BYDA 3WD2A 1GPFA 4R5EA 1CENA 2Y8KA 4OBSA 4JIEA 4PTVA 1QNPA 3BSGA 4TOQA 5AYBA 1VJZA 3OG2A 1XV8A 2XSBA 1X1NA 2JEQA 2FGZA 4DUVA 4W87A 1WZAA 3WDRA 3OZPA 4PYSA 1BYAA 2XIBA 3THDA 2WVVB 1LL6A 2V5CA 1XC6A 3VX1A 3OLEA 4CD4A 4CCCA 2F8QA 4Q7NA 3EDDA 1OIMA 4KH2A 4U2YA 4D71A 4X0VA 5BROA 4JFWA 2YDSA 3WD0A 5GNYA 1AVAA 4ATWA 3RIKA 1RH9A 3OIHA 4ATDA 2VRKA 4J3WA 1KBKA 2XUCA 1DWJM 1WZKA 4JKKA 4JCLA 2VMFA 3PZMA 3AIVA 3SCQA 3T2OA 4JFUA 4PBGA 2YDQA 4PRWA 2PWDA 4PSPA 3MUZ1 3T09A 4P7OA 1KXHA 1ISVA 2CIPA 3L2MA 4YPJA 4AZCA 3HU7A 3WH8A 2DEPA 2XG9A 5FL1A 1QI2A 4DWSD 1ISYA 2GK1A 4D6EA 3PTMA 1TCMA 4JL2A 2WK2A 4HA4A 2WCGA 4NSBA 3M46A 2GJRA 1CECA 3W27A 1V03A 2J7FA 5DF0A 5GNZA 1JF5A 4FMVA 3AQUA 1FP9A 2WWDA 4P7RA 3N1AA 3WQ6A 3T0DA 1MW0A 2BVTA 2HISA 5DFAA 2D2OA 1PIGA 1W3KA 4JHOA 3WNKA 3IJ8A 4FLQA 3I3EA 4UQBA 1E6XM 2JALA 1KCLA 3VTRA 1JYWA 3GXDA 1KWKA 1E55A 3AIRA 3ZSSA 1DWHM 1BGGA 1YHTA 4M56A 4W84A 1UR2A 3VIIA 1LLOA 5A1AA 1R7OA 4ACYA 3WNLA 1QBAA 1NARA 2J8FA 3FNDA 2VR4A 4OOZA 3WF3A 2CERA 5HDRA 4QDMA 3ALFA 2VRJA 3VUPA 1CEOA 3CHDA 1MWOA 1VBUA 1FFQA 2ZXBA 1M53A 4MAZA 1EDGA 1G94A 3WL1A 4D6DA 1ZJBA 2OSYA 3VIPA 1QNSA 4TX8A 4L4PA 1H1NA 1XHGA 3MMWA 4UFMA 2VJXA 2WZIA 2V5DA 5M17A 3AZSA 2J7BA 3ZT6A 4KGLA 2QPUA 2DPEA 1EA9C 2BY1A 1CXKA 3VIHA 2WVVA 3W24A 2WC7A 2VZUA 2VZSA 4AZHA 3DECA 4NZCA 1E0XA 1UZ1A 3TP4A 2J74A 3OB8A 2VT0A 5BXPA 5IHSA 4CU8A 3VD3A 2J7CA 1B9ZA 7TAAA 3W25A 4ZE4A 4WJXA 4MB4A 1CZ1A 1EO7A 4MNLA 2O9OA 3LMYA 2YBUA 3PHAA 4PMRA 1ZB5A 4E8DA 1GOOA 4F9JA 2ZX6A 1P6WA 1JAEA 2WVUA 3L4YA 5HPOA 4J3TA 4PMXA 1HXJA 4W85A 2WHJA 3L4VA 5D4YA 4V28A 1W2VA 1TZ7A 1W9XA 3VGEA 4H8HA 1QVBA 4DM2A 1LL7A 2XWDA 2CHOA 1FH9A 1R8LA 3BSHA 5CQ1A 2EPKX 2V3GA 1HJXA 2TAAA 3OGSA 1B31A 2WM0A 1QPKA 2DSUA 4OOUA 1JI1A 5A6JA 3MV01 3WD1A 3KE0A 2PC8A 3VGBA 2E9MA 4CD5A 3IK2A 4CKQA 4JFTA 5IFPA 3EDKA 2UY2A 1FH7A 3GXIA 1OIFA 3N12A 4AZ5A 3M07A 4AYSA 1BSIA 4L4OA 2UY4A 3T0BA 4W8AA 3LPPA 3MUAA 1W3JA 2NT1A 2EO7A 1R85A 3CUFA 3VIKA 1VEOA 5JBDA 2G3NA 1N82A 4H8VA 2YBTA 4BZYA 1J0ZA 1OGGA 4NI3A 3G6MA 6TAAA 3OZOA 4UQCA 2FHCA 2WKGA 2QLYA 2FH8A 2WZHA 3VPLA 2PWGA 1KXQA 2ZICA 2WMKA 4EAMA 1KR1A 1CGYA 2EJ1A 1SYTA 2BS9A 1ZBWA 5E09A 4W88A 3L4ZA 2EPMX 1EXPA 5BRPA 3SCPA 2HVMA 2WC3A 5BXSA 2F2HA 1OGBA 4ACZA 1VB9A 1WP6A 2CESA 2XGBA 5FCZA 1W1YA 3WIJA 5E6YA 1JD9A 4V2XA 4H7VA 3VGHA 1B90A 3AROA 1XCWA 5BXRA 1WO2A 4F66A 3IANA 4AMCA 4B15A 3VIOA 2W66A 2WSKA 3SUUA 4HZ6A 3CUJA 1WZMA 3ARWA 4JKMA 3T0AA 3BCDA 1XRVA 1CNVA 3AS1A 3VNYA 4MADA 2BY0A 5CLWA 3DYPA 1CXFA 1UHVA 3WF2A 4Y7EA 1E56A 4M82A 1XSKA 3CBWA 2EPLX 3CMJA 4JFVA 3VX0A 1EDQA 2VNCA 3MMDA 1OB0A 3IAQA 3A6OA 5IFTA 1GUVA 3SCWA 2ZUVA 3WUFA 2VX6A 4HPGA 4AISA 4J28A 4U3AA 4D6JA 5BWFA 2RGMA 3AMLA 5A94A 7CGTA 2WPGA 1E1FA 3BMVA 1UD8A 3UEQA 4AY1A 3CZLA 1QI5A 4A3HA 4YHEA 2WLZA 2CBIA 1X6NA 3AMKA 4HOWA 4GZEA 2Z1SA 3WDIA 4QAWA 3UG3A 3NDYA 1CGTA 3IAPA 3WBAA 4OJYA 4EANA 1ZL1A 1UYQA 3RO8A 4AIOA 3A4AA 5I3DA 2CKSA 1GJUA 2WNWA 1J01A 1US3A 5HNNA 3ZSTA 3AYSA 4CU7A 4LYQA 3AMDA 1MW1A 3GXFA 1E4LA 1FA2A 1JF6A 1X6LA 1OD0A 2BHYA 3EDJA 3WNNA 1B3WA 2E3ZA 4IM4A 2YLAA 2QMJA 2WBGA 2ZE0A 1UH4A 2DGAA 2EEXA 4F79A 1CYGA 1NWTA 3CZGA 4QFUA 2ZWZA 2QV4A 3W81A 4JCMA 5I78A 1HP4A 1W9BM 2NSXA 3VU2A 2Y2WA 3GM8A 4E2OA 5ABHA 3ZR5A 1JFHA 2OSWA 4JHZA 4GZIA 2WMHA 5HOSA 3O9NA 4WKFA 2G3JA 3N17A 4NRRA 3QR3A 1R7AA 5M5DA 1HVQA 3UG4A 1F4AA 1OWQA 3AHYA 2JIEA 1BVNP 4AC1X 2AAAA 1C93A 3POCA 4EE9A 2CITA 3AXXA 2DH2A 1ITXA 4EK7A 1EOMA 2GDVA 3M6DA 1JNEA 2VQTA 4PTWA 1QI3A 1FP8A 6A3HA 1QHOA 1UQZA 4UTFA 3MU7A 4TVCA 2JF7A 4PTMA 4BA0A 2VURA 2D1ZA 2XJ7A 3GBEA 4PMQA 3WL0A 2WHLA 5I24A 4UQEA 1XSIA 3SCUA 3WDQA 1WNOA 1R87A 5D8WA 1US2A 2OLHA 5AC5A 1JZ3A 3VM5A 1W32A 3AIUA 1UD6A 2F61A 2UY5A 1BYBA 5GNXA 1LG2A 3WFLA 1MXDA 4W7VA 2ZXAA 3CUIA 2WMIB 4WKHA 4AD4A 2VZVA 1PIFA 3VD4A 1V6WA 4UZSA 1UR0A 1JL8A 1SFSA 3VM7A 5A6BD 3D3AA 1GCYA 3AICA 2DIEA 3AHZA 1LWJA 3B9EA 4PMZA 2BHZA 3PZTA 1GOKA 4GI6A 1GHSA 3GTNA 3FHAA 3O2LA 1GHRA 5JIPA 2OSXA 4Q22A 5EMYA 1DP0A 1ZU8A 1WPCA 2WYSA 5I5RA 3T2QA 4BQ2A 1EGZA 2G41A 3BLPX 1DWIM
chains in the Genus database with same CATH superfamily
2QAFA 2A1YA 1A47A 2WNQA 4QBXA 1JCNA 3MHUA 3U4AA 2XN1A 4U28A 1VGAA 2XTKA 4WXZA 4UOQA 2EPNA 2F84A 2PODA 1AH4A 3L0GA 2HPIA 4WSKA 4MMWA 1V0NA 3TFCA 5I3HA 3BMXA 5KTLA 3WDPP 4MIMA 5LIUX 3BG9A 4DAFA 4OFCA 3B0PA 4WIWA 3ZVIA 3GBDA 3P0WA 2DU2A 1E6PA 5JXQA 3A4WA 4KFPA 2PTXA 3FCPA 2X1IA 3DG6A 4HD5A 5EYWA 4JQAA 3MKCA 1ODZA 3TC6A 1KFWA 1R3YA 4PB4A 4P7NA 2ZIDA 1BRLA 2HS6A 2DQXA 1M3UA 2YIHA 1ZBCA 2OQHA 4DO4A 2BXYA 3N14A 4H2HA 1BXBA 2E0PA 3N11A 2WMFA 1DJZA 4RE3A 3L21A 3GNDA 3VA8A 1PX4A 3UF9A 2J9YA 2JKPA 4J3UA 5D02A 3QHOA 2GGIA 3KRSA 5G2IA 1TUXA 1S46A 4A21A 2XVLA 5EBUA 2BXZA 3S1XA 1IIHA 1Q6CA 2HTMA 3GDKA 1K9FA 4DAIA 1TSIA 1QWKA 3WQVA 3IIXA 1KFCA 1RPKA 3PBGA 4C7DA 5AHFA 4NRSA 3UGRA 4PEEA 4TIMA 3WK0A 7TIMA 4H9TA 3TVAA 2VR5A 1BPLB 1Q6OA 3L4UA 3T9PA 1PO9A 2PRMA 5DELA 2ZX5A 2V30A 2OZTA 3BLOA 1E71M 4G56A 2OOFA 1ALDA 5A69A 4AVOA 4WHBA 2VEFA 3A3WA 4QRNA 1I6NA 1PDZA 4AD2A 5CZTA 1QWGA 9CGTA 3R0DA 1UIOA 4GIAA 2DH3A 4YTSA 1A4LA 4FHAA 4IPNB 3QC0A 1P0EA 1UWAA 1WQ5A 4WGXA 1QW8A 4Q7IA 3QMSA 1M04A 2EG7A 1UKSA 3L12A 2NUXA 4KPLA 3TOPA 1M68A 4Q4KA 1N8WA 3TSMA 6XIAA 1A5SA 1QNRA 1H5VA 4Q4PA 1W17A 3KOWA 3VOGA 1Q5MA 1ISWA 3WF4A 2Q02A 1WXJA 3T6CA 1UR1A 2E5CA 3A3HA 1ITQA 1Q8AA 2WJDA 5I3KA 1KC7A 3GDLA 2AQWA 4C6NA 1B3XA 3POHA 4J3VA 1JDEA 1PJ9A 3DDMA 4ZTXA 3CPGA 4ADSA 1JQVA 3KTSA 1RALA 2IMRA 1UBSA 8XIMA 3TA9A 4DELA 3N18A 2QCGA 1TB3A 1EUNA 1IR1A 4HA3A 3AO0A 1OQFA 1ZSXA 3GAYA 3LTPA 4LC8A 2OYKA 2OLSA 3KOXA 1V7AA 4RDVA 2GSJA 1BYCA 4DVOA 3H54A 3KRUA 3W7DA 3TYBA 4MLRA 2BODX 2BY3A 2QAPA 1ME8A 1ZUAX 3AYVA 4TV6A 1KNWA 2J6VA 3N4FA 5BMWA 5CPQA 2CXGA 4XZBA 1ISZA 3RCNA 3KOZA 3CK5A 4C6DA 4CN4A 4OGZA 2G50A 1QI0A 1E3XA 5KITA 2J77A 3VDCA 3A24A 1OVDA 5HANA 1EH9A 1CXLA 2E6FA 1N2VA 3VMOA 2CNCA 2PDIA 3PUOA 3SUTA 3W2KA 4MSSA 3MVTA 1C7TA 3SGGA 2ISFA 1FOBA 1TG7A 3KBWA 1J4EA 1DOSA 4BCEA 3TYCA 3CLWA 3U7BA 4B5XA 3VKJA 4L80A 4I6VA 3P84A 1R3TA 5DBTA 5HNTA 5LGXA 3RG6A 3DEQA 1PBGA 3B8IA 3MPGA 3B8WA 3DAQA 1UJQA 3OLDA 4GO9A 2XFYA 1XLMA 1J10A 3DFHA 4M19A 3KVJA 4N2YA 5K3VA 3QPYA 2XM2A 4DF0A 4O16A 1R38A 2HK1A 4Q8NA 4J40A 2NVDA 3ZJKA 4R85A 1Q63A 1DIKA 3H2AA 3T7VA 1RVGA 2PTZA 4UXDA 3CAKA 2OGJA 3LS9A 4CEXC 4O12A 3M7SA 4JX4A 4DM1A 2H9AA 1VPQA 3CTTA 3HFYA 5AB3A 1YXCA 2OKOA 2C14A 1F3XA 3S2NA 3FK4A 4N4PA 5HR6A 3PZNA 3KOYA 4HA0A 5GVJA 2VX5A 3TLLA 4ERGA 3ARRA 4Z2KA 3MBFA 1XDMA 3BCJA 2C0AA 4N6FA 1AODA 3DN5A 5DANA 4YTTA 4Z1AA 4JTAA 1B2YA 3PSWA 1HT6A 3LX9A 5CZSA 4F0LA 1H7WA 3UJEA 1I1WA 2QCFA 4IISA 4WF7A 2JEPA 3S5NA 3TTSA 2O9TA 3OQ8A 4NZFA 1S38A 3T08A 3AWOA 2NX1A 1KTCA 3TN6A 3FN9A 1V7YA 4RNJA 1NDVA 3SRDA 4M1RA 3LCXA 2WMJA 1UWRA 3O06A 1TJPA 3WLLA 3ZXWA 4FEZA 3P3BA 3JZUA 1PPIA 1OYCA 2HNEA 2QVHA 3KLKA 4AD5A 4HOXA 1KQZA 4LVFA 3VNMA 1R9ZA 1V6VA 2X09A 3AXHA 3MC5A 3GNPA 2BGNE 3W53A 2ZTKA 3SGUA 5KZ6A 4X9SA 3KFTA 3H21A 2J75A 4KMQA 1DHKA 1JNDA 3UYCA 3T0TA 3F5KA 2OYMA 3EZ4A 2YFOA 3F4CA 3M41A 1R30A 4D6HA 1HJVA 2HS8A 3ISIX 1UKTA 4W4QA 4CQ8A 5HMSA 2IS7A 4LUSA 1GOXA 4GCAA 4YCOA 4NY2A 4IGHA 2CLEA 2XN2A 3M0MA 3EWBX 3QOKA 1VFFA 1MFVA 3HGOA 4I7UA 3GNNA 4E38A 1ITCA 1XDLA 3RPMA 3NEHA 2FGLA 3IVTA 2ZTJA 3O6YX 1KTNA 3RITA 3MDUA 1QBBA 2H3BA 1PX3A 3RGTA 2WCAA 3W1QA 2BY2A 3MKKA 3PWAA 4Z42C 3CIXA 1DJGA 1B5TA 4MUPA 2GJPA 3CO8A 4E3TA 5JBEA 1NOUA 1B3OA 3R0KA 3M16A 1TX0A 4OIFA 3WO8A 3LRKA 4NZ3A 3RRAA 4TO8A 4DXVA 3VIGA 1A5NC 1QI4A 1DYSA 1SM9A 3UJ2A 4ORIA 1GQIA 3SCRA 4O10A 1TPC1 3V16A 5HQLA 2QPSA 3L5LA 1XBZA 4M81A 3AYRA 3MO7A 4BY3A 4DBEA 4TMCA 4H2CA 1KFLA 4G5DA 4U33A 1JPKA 3LLDA 4LJ3A 1E4NA 1F3WA 2JIWA 1T0OA 2PD9A 4JQ1A 3THQA 3WQFA 2X7VA 1D2KA 4JYDA 2J6XA 2QKFA 1Y5XA 4WSJA 3VXGA 1QOQA 1OCBA 3M0JA 4BK9A 1XLHA 8A3HA 2Y5EA 5FKYA 1EQCA 4CVWA 4Q8PA 4FNQA 2J7GA 3H4XA 4MDPA 2ABAA 1QT1A 1MFUA 2WCSA 3W26A 5K4XA 3EWXA 5LHFA 1UWUA 3TIMA 4IIBA 1LOLA 4ZB5A 3HZ3A 2OX4A 4TTUA 2BOFX 4J3SA 3D6NA 1XH0A 2ZZ6A 3T4WA 4RZ6A 1G67A 4EOUA 1HJSA 2Y88A 1A0CA 1WB0A 3KP0A 4LF1A 2XH4A 2TODA 1GK8A 4GUGA 2B4GA 2NXGA 3AS3A 1TVLA 3LHVA 1BFNA 4MJ4A 1AD1A 1V77A 2Z1WA 3BWWA 4ATLA 2W9MA 1XPGA 2FZMA 3FS2A 2QUTA 4F9DA 3B03A 1OFDA 2W27A 5FF0A 1X8CA 1KFEA 2O9PA 3W7RA 1FHDA 3P67A 4AC7C 4NAFA 3Q45A 2GJLA 3EOOA 2ZA3A 4DRSA 1PEZA 3LLXA 4NJIA 5CSYA 4C6IA 2FB2A 2XFFA 3ELFA 2PDPA 3CWHA 3EWWA 3UG5A 5B7ZA 1WAWA 3WMBA 5JQ9A 2GQ3A 4H9ZA 3TSBA 4XUYA 3ABSA 1A5LC 4QJ4B 2YA0A 2ATSA 4YLWA 3I6RA 4LOCA 1EL3A 2WMGA 3WELA 4LANA 3UPMA 5BCAA 1OK4A 3UA3A 3NZRA 4INFA 4HPHA 3OVPA 4X9YA 2DT0A 1UKQA 1C8VA 3LSCA 3ZOAA 4O17A 1Y65A 3ZWSA 4GKLA 4CQ9A 1TZZA 5AZ0A 3W88A 4HPXA 1GQNA 1R86A 4Y9MA 4DXXA 1I60A 4GK8A 3AS2A 3MUCA 2DZWA 1HIZA 3NL2A 3ZIZA 2QDDA 4LGXA 4WDUA 1RD6A 3C2YA 2B0MA 4WKAA 4QGCA 1XQKA 1OX4A 3IGXA 4TXEA 1IT0A 1FWIC 4U5KA 4W89A 4A29A 2RDWA 3CV7A 3NQAA 3STGA 1JYNA 3VOHA 3MYPA 1VHNA 3C3NA 1ZAIA 1W1TA 4M1BA 3VKKA 4LALA 1SMAA 3RLGA 5HAOA 3MSRA 3FYPA 2NZLA 1PDYA 1MYRA 4X63A 1H3GA 1H7OA 5H8UA 3UP8A 1MO0A 4PH6A 1CPUA 3ANVA 1HVXA 2WC4A 3ANUA 1H4PA 3WBEA 1BXNA 1EKOA 4IWWA 4J3ZA 2OKTA 3W1LA 2Z00A 2V2HA 1I0DA 4DWDA 2ZUSA 1LQAA 3G1YA 4MLJA 5G4HC 3OYXA 2IKIA 2PURA 1Q8JA 3LRLA 4WRHA 2DSKA 4XZHA 5CJ5A 4I5UA 4RDWA 1BGAA 3A22A 3REQB 4YYCA 3W6MA 4CN1A 3TUUA 3IUIA 3B4YA 1YPIA 1QTWA 4MKVA 4NNBA 5CJNA 3DIPA 3U7VA 1S5MA 3PBYA 4GWEA 3BGJA 3NO1A 1JFXA 1TPDA 1H09A 2Q3RA 4QDPA 3VVGA 4IX0A 3FY1A 3VZYA 3S1UA 3OA5A 3TK7A 1POKA 1LJYA 1FTXA 5LIXX 1PKYA 1JPIA 1ZBVA 3SURA 4AD1A 4LFYA 4N0RA 5E9XA 3CH9A 1V79A 4AD0A 1Z48A 1EOKA 3RRXA 1D7FA 1BEUA 1J2BA 4QCEA 2YL5A 3HURA 1K6WA 3PR2A 3H2FA 1JR1A 4A3YA 3DHUA 1XR2A 2VWTA 1B3VA 5E6ZA 3S42A 4UC5A 4XO6A 4LU0A 3B8VA 4LQ1A 4S23A 3TYUA 5I02A 1UR9A 4IT1A 1J18A 4JTRA 4ZEPA 3VNIA 4QIUA 2I9EA 3D3FA 1E70M 1QMLA 4DJDA 5A95A 3DFYA 4PUKA 3RO6A 3RX3A 1B30A 2OQYA 6REQA 3GFXA 2AMGA 4RL3A 3SCTA 2UWFA 3K46A 1S2UA 5FJIA 1CLVA 1C9DA 1XIIA 3NXFA 4S2BA 2IXVA 4KT2A 3LHWA 5EY5A 1MW3A 1XGZA 1ZAJA 3PSVA 2FPVA 4JGDA 3WQPA 1HTIA 4GJ1A 4DF2A 3WLOA 5HNUA 2ZUNA 1GQLA 2V9DA 2INEA 2A3AA 1GOWA 4ZMGA 4EXQA 4JN7A 1RV8A 1P0DA 2OODA 5A8PA 3L4XA 1VCVA 3F5JA 4E0CA 3UNDA 2A79A 3B4UA 3MSGA 4Z1YA 3R58A 1G01A 1VPYA 3WNPA 3W38A 3LPGA 3BH4A 4DBDA 2ZZ4A 1FWHC 1S3TC 4YYFA 2Y63A 2PB1A 1ZGDA 4V27A 1A50A 2I5IA 5EB8A 2Y85A 1IE7C 4XVEA 3GVQA 5JUVA 4YTUA 4DJEC 5AY7A 3VD5A 2FHFA 1XUUA 3O16A 4S3CA 3TKFA 3CUHA 4M3PA 2XIIA 2OJPA 3OBAA 5I77A 2WLYA 4WK9A 2Z24A 2E5BA 2YYTA 1U1HA 2ZX7A 4GY7A 3UW6A 1MEWA 2CYGA 3VIFA 3BC9A 3CIWA 3T55A 2JKAA 2VVSA 1BQGA 2V38A 3RM9A 4QJ5B 2VEGA 1SQ7A 2J24A 1UKPA 3V18A 2D24A 3ARYA 4RZ5A 1O66A 3O6AA 3TAKA 3VNZA 3OVGA 3KEHA 3OHIA 2QNEA 4P8VA 3A5VA 2NLIA 3PFMA 1G69A 1TV5A 4FX8A 4PRTA 4GYPA 1YYAA 3F1QA 4GRSA 3MVIA 2GJXA 1K8CA 2G4FA 3VD9A 1M03A 4WDWA 1J93A 4W8LA 3VK5A 1FDZA 2C8NA 3EA1A 4DJED 3DFTA 4KEVA 3RR4A 3UZJA 4D8ZA 5HJYA 2EG8A 2QMKA 3DHDA 1BVZA 1DXFA 3S4TA 3CC1A 1B1YA 2G8ZA 4NILA 4C1LA 3VIJA 4F0MA 1VRDA 1HKIA 3DFQA 5J5DA 1TQXA 1ZENA 3GZAA 2Y8UA 2PUZA 1CLXA 2VOTA 5D2XA 3THCA 1EFZA 4Q4QA 2QGYA 1Q4NX 2CEQA 1V6XA 1DKWA 4GY1A 2DUZA 5IDIA 2A7NA 3C4UA 3IJDA 4ZO8A 5D2TA 2PWFA 2ZXQA 4AUBA 4LYPA 3S6DA 1JZ4A 1TIMA 3E38A 3HMCA 3PJUA 4F2TA 3CIVA 4QLJA 4QITA 3CQ0A 1XIMA 4X2PA 1RQBA 1H11A 2PU1A 2VENA 4B3LA 4HMCA 4U3CA 1V51A 6TIMA 4N9EA 3IIVA 4L65A 3WG6A 1OSEA 3UWEA 5AVHA 2BV9A 3PFRA 2A7PA 4GQRA 5G2HA 3AIEA 3HPFA 3GVGA 5AHLA 3PZQA 1RLDA 4O1FA 3UJSA 4B9YA 4KFNA 3U48A 1S5TA 2DY3A 4RE4A 4GQGA 2YB1A 3W7OA 3AXKA 3DUGA 1E4MM 4R9OA 5C0QA 1E73M 4YVPA 5IRPA 4LYRA 3DI0A 3N04A 5AHMA 5KMYA 1EUAA 3KDOA 4H6QA 5JH2A 3G8RA 2WAGA 3UJFA 1QHZA 4P7LA 4S3BA 3WD2A 4HGXA 2YSWA 5IOBA 1XIFA 3G8EA 4R5EA 3UXKA 1CENA 1F07A 1VKFA 3TYAA 3BSGA 4AWSA 3ES8A 1I2OA 3IIPA 2Y70A 3SFKA 4DUVA 4FALA 3S83A 4PYSA 4H00A 1EJVC 3P82A 3THDA 3RXZA 1LBMA 3LY0A 1OHLA 3OYZA 2ACUA 3VX1A 1SW3A 1SR9A 2FQIA 3P0XA 1DJHA 3NQ7A 4U2YA 4D71A 4JFWA 5GJPA 1MUMA 5GNYA 5MF5A 4A35A 1RH9A 2X1TA 4J3WA 2XUCA 2F6KA 4HB7A 2Q71A 4AB4A 2VMFA 1EWDA 4KCTA 1SO3A 3GB6A 3WK1A 3WBXA 2PZNA 3T2OA 4JFUA 2ZRWA 2YDQA 2PWDA 3MUZ1 4P7OA 2G4JA 1ISVA 3L2MA 3R12A 1P1MA 4QSHA 4L6OA 3VCRA 1XXXA 7ENLA 2C13A 3W6YA 2HBXA 1ISYA 5KZDA 4DY1A 3JVAA 3PTMA 1TCMA 4JL2A 3W87A 2QW5A 4NX5A 1V03A 5GNZA 1JF5A 4FMVA 2VGBA 3AQUA 4O0KA 4A8RA 4DJDD 3WQ6A 2WJFA 2I56A 2DV0A 3MP4A 1G4SA 1MW0A 3Q58A 2BVTA 5KINA 1S5VA 2D2OA 3MCMA 3WNKA 3S9YA 2J13A 3H26A 3I3EA 1E6XM 1TTQA 2IKHA 2BGQA 3T8LA 1YPXA 3BARA 4HNLA 1DWHM 4I8DA 1O68A 2HWGA 4LEFA 1FWJC 3B3DA 3KTXA 1D9EA 5DCBA 3VIIA 1LLOA 3C5QA 5CSSA 3WNLA 1RQEA 5C7HA 4GG9A 2VR4A 4WEVX 3E0IA 3GZ3A 2CERA 2E25A 4WD0A 3TN3A 5REQA 5BOFA 4LS2A 1OFBA 4GYJA 4R7JA 4GIEA 4MAZA 5C54A 1G94A 4YTQA 3VC5A 3VIPA 1K1DA 1QPOA 1QNSA 3Q94A 4ZZ9A 4I5XA 2I16A 1WXYA 5F4WA 1VC4A 3BK0A 3AZSA 2E7FA 4YJ5A 4UIOA 1B4EA 1YTKA 2ZVIA 4GIRA 3A23A 3CAWA 4ADUA 5FJPA 2R1NA 3VIHA 4V1YA 2BASA 2PLJA 1XUZA 2VZSA 2QR6A 1B57A 5F1UA 1M1BA 4NZCA 1YPFA 1E0XA 3TP4A 2J7CA 1T8XA 2DZUA 3W25A 1W3TA 1XG4A 1NDWA 1ICSA 4QEEA 4L7ZA 3PHAA 1ZB5A 1Z41A 4N9CA 1XKYA 1IIGA 3QF0A 4PMXA 1BD0A 3NDOA 5G5IA 1FWRA 3LHYA 4ROQA 1L6FA 3EKGA 3VYLA 2XWDA 1PL9A 3QTGA 2P3ZA 3SQSA 4DBUA 1KLZA 2IKJA 4QROA 2V3GA 4AQLA 1B31A 1FHUA 2WM0A 4JYEA 1QPKA 4H83A 3NZQA 5A6JA 4H6EA 3PJTA 2PC8A 2ZKMX 3VGBA 3HQ1A 3IK2A 4CKQA 1ZRQA 2GZXA 3LV5A 3GDRA 1FH7A 3FEQA 1ENUA 3N12A 1NJJA 3M07A 2C18A 4JTJA 4L4OA 1DORA 4E2DA 1OADA 3T0BA 1W3JA 4IG2B 2EO7A 3CUFA 1VCGA 3QQ0A 1XIHA 2G3NA 6TAAA 1KRAC 3OZOA 1Q7QA 4FNTA 4UQCA 1I2PA 2PP3A 4UWMA 3VPLA 2QLYA 4KWWA 1PWLA 1H1ZA 5T8GA 4KBXA 2IQTA 4KWSA 2QULA 1SYTA 3FYOA 3L4ZA 4K1GA 2EPMX 1EXPA 1EB3A 2KX9A 5BRPA 4NJKA 4QQUA 2HVMA 2WC3A 3FVDA 1QFEA 5BXSA 1I8JA 4ACZA 4ZODA 1VB9A 2CESA 1AZ2A 2XGBA 2R82A 3LYEA 1LRNA 3TQKA 1J8VA 3MP3A 3O8AA 4C6CA 4WJEA 1JUKA 4GNJA 1OF6A 3SUUA 4HU3A 3CUJA 3TMQA 3O05A 3BCDA 3K1GA 1FWGC 2IPGA 4TU1A 2AQVA 1SJDA 4GUHA 2WKJA 3CMJA 4JFVA 2VNCA 3M64A 2QQ6A 1FWDC 4KEMA 4LNYA 3IGUA 1GUVA 2F2KA 3SCWA 5BU6A 3WUFA 3IS4A 3OQEA 4L5ZA 4WCJA 4U3AA 5A94A 7CGTA 1F6YA 1E1FA 3BMVA 4AY1A 4J1OA 1LYXA 5H8PA 5MHBA 1R5YA 4GZEA 3G1FA 3BLDA 4QAWA 3W1AA 3WDIA 5ABTA 4XQ6A 1DJIA 2NXHA 4IIGA 3IV8A 3LTYA 5DY2A 3SDOA 3WBAA 4EANA 4LUSB 2CKSA 3UD6A 3MI2A 1EJTC 3ZSTA 3KBJA 1AMKA 4J2MA 2Z1BA 5D38A 4EWJA 1JF6A 3TQVA 5JU6A 4LAZA 4MYXA 4O54A 2BMBA 2BHYA 4OT7A 2R8WA 4PUMA 4C5ZA 3UXIA 4WY0A 2DGAA 1W37A 2EEXA 1NWTA 2I5QA 1WXZA 2ZWZA 3EAUA 4L6HA 3W1UA 5I78A 1HP4A 4IUOA 3VU2A 2E5DA 2OSWA 4GZIA 3O9NA 3DU0A 2YBVA 4UTHA 4NRRA 1R7AA 5M5DA 3UQNA 3H7UA 1OWQA 5CJMA 3AHYA 1J6OA 1KM5A 1DVJA 1UJPA 2X30A 4EE9A 3VCCA 4ZQRA 2G0WA 3OJGA 3TYZA 2GDVA 1I9CB 4UTMA 2VQTA 4C6JA 3SFWA 1UQZA 3NQEA 1ADSA 2X16A 5I09A 5EA9A 4F0SA 2QEZA 2F7FA 4QAIA 1A5MC 3SCUA 2C79A 1US2A 1JZ3A 3UVIA 3DG3A 1OFQA 1GPWA 3ZLGA 1IGWA 3NPXA 2UY5A 3CASA 5GNXA 3GE7A 3CUIA 4AD4A 1X8FA 3E2RA 1UR0A 1T8QA 1TWSA 4K8HA 3K5XA 4GH1A 3NOEA 1TKKA 3B9EA 2YYUA 3NR0A 2V6AA 3PZTA 4UR8A 3NO5A 3G5EA 3QV6A 6ENLA 4Y6GA 4R53A 1SW7A 2WYSA 1F6KA 4JIQA 2VDGA 1XYAA 1EIXA 3HTWA 4MNJA 3FX4A 2QJHA 2C7FA 3KXQA 3STPA 3HB9A 1HKVA 3GU2A 3LLFA 1JZ7A 1V3JA 1UUOA 4MAVA 4C6BA 4HHPA 1E72M 3FLUA 1SFJA 3TMLA 5FD0A 4UNKA 1Q6LA 2D73A 1PWMA 3PPHA 4JXCA 3I7SA 4HMEA 3M5ZA 3CH0A 1BSLA 1OX4B 3HPAA 2QS8A 4KGJA 1CX9A 4A8IA 4PN2A 2AAMA 4A2SA 1ODUA 2RDTA 3IRDA 1WDPA 2G95A 2EPHA 1XF0A 1DQXA 1QPQA 3MO4A 4QISA 1ME9A 3GY1A 3HA1A 2CCRA 1XYBA 4ZSUA 1UD3A 1E9YB 1HZYA 6REQB 2BGSA 4PCFA 5FL0A 1IEWA 2POZA 4MDOA 4QJ1A 1Z6KA 2DW6A 3SSJA 4B92A 3TW9A 4Y8FA 3HQOA 2Z1KA 2GLKA 2O92A 3IJ7A 1FFRA 1VENA 4S2CA 3GHSA 2YLLA 4H7CA 3QQ1A 2PLMA 1JAKA 3MCOA 3P8JA 4B3KA 3T4CA 3W2JA 2QGHA 4G2DA 2XVPA 2DSVA 4AZ7A 4GUJA 4DWSC 3QLLA 1LBLA 4KIRA 4REQA 1EJSC 3TTYA 1SU5A 2VD9A 1SZEA 1XLFA 2A85A 3EMCA 3O1NA 3BVJA 1JRCA 5G1MA 4DNMA 5H2ZA 2XIQA 2YW4A 3U9IA 1GORA 2PDLA 3FJLA 2FTPA 3WJWA 1BLIA 5C9XA 3LU2A 5CPOA 4B5WA 1J2WA 2OQLA 4K7YA 2PDBA 4F0HA 5A6AA 2IQDA 4IFKA 1JDAA 4EXAA 4FAMA 1CT5A 2B31A 2YL9A 4KWVA 2J7EA 3OVQA 2WM1A 2ALDA 4IF2A 3REQA 2QIWA 9XIAA 4N7QA 4PMNA 3JZEA 2FZ9A 1ONXA 3H4GA 5DO8A 1BWVA 3PWIA 1C8XA 3E1F1 1OINA 1K9DA 1O5KA 2E8YA 4G7EB 4UTIA 4Y2WA 3RU8X 3EX6A 4IH3A 4DI9A 3WFAA 2XSXA 4JOMA 3W7KA 3VFLA 2X0HA 2B7OA 3DGRA 1IEVA 2D3LA 3G0XA 3B8TA 2PI6A 1XBYA 4JKLA 4S1FA 5MKGB 2ZCGA 2Q8LA 4ZXOA 4A6GA 4BF7A 3WEZA 2GQAA 3MSDA 1GOQA 1VJIA 2ISVA 3W7CA 4MOZA 1E1CA 3J7HA 1U5JA 2VRQA 3W7NA 5EMMA 1PKLA 1DQWA 4QE4A 5G1TA 3U2ZA 1H7NA 1J5SA 4X22A 3KZPA 3ARVA 4KCUA 4WSHA 5CPSA 1SO5A 4GMEA 4GIYA 5I06A 3PJWA 3NQBA 4Y9OA 3QHNA 1FX6A 4M7SA 2HVOA 3CWNA 2PE4A 3N2TA 2RHGA 1DTUA 3UR8A 3LHTA 2PDJA 4AZ6A 5FJUA 1O6IA 3LPOA 4LCQA 2VCCA 1FKWA 4C6KA 1HX0A 1UP0A 3BXWA 1VFTA 3B05A 5A6KA 4CNTA 4ZXLA 1P1XA 1XLKA 5A8NA 1TJ2A 3GYCA 1BQCA 4IXHA 3F4VA 4ZCWA 4MM1A 4O4VA 3NIYA 5C2GA 1MXSA 3KBMA 1HL8A 4JY9A 4MJMA 3ZFHA 4DX3A 4N4QA 1T6MA 2E4TA 3H7VA 5TNVA 3U0HA 1L6GA 7XIMA 3UXDA 1GZJA 3GIYA 3NZGA 2OLAA 1C3FA 3MP5A 2ASHA 2G97A 3MUY1 3S2MA 1LZOA 2HDJA 4GABA 4LYKA 3K8LA 5CPMA 4E2BA 2C0HA 5F4XA 2IQ0A 3CT7A 3CHCA 4MFEA 1LM1A 1Q7MA 3NQCA 1DXEA 1ICPA 1GOMA 1NM9A 3IARA 3P5ZA 3TXZA 1H61A 4JL1A 1CDGA 3W86A 4PTXA 3DENA 3S5SA 1L0PA 1GW1A 2J9ZA 3DHFA 3U2EA 5HBFA 3LQLA 1DIDA 4ML9A 2XM1A 3CL8A 3NA8A 4I9JA 1XRFA 3WLMA 3K30A 2WVSA 1UP2A 2PD5A 3EDEA 4GOAA 4OU1A 3AALA 2Y7EA 3N6HA 1MXGA 3NEVA 3UWVA 4PR4A 3L2LA 1ELSA 1VYPX 1XINA 4F2UA 1OG6A 3S2CA 3EYPA 4PCTA 1HNYA 3PPCA 3OW1A 4XIMA 1MQQA 4HNVA 2GFTA 2C16A 1EDTA 1HJWA 1I2RA 1H1YA 5AYXA 4DBSA 3FA3A 2GVYA 3WD4A 2D2HA 3W6LA 4ZFCA 2VVNA 1D3GA 3DHPA 2P0OA 4IOTA 1L8NA 3QN3A 2WVTA 1CCWB 4IFOA 4Y96A 5H8MA 3GVVA 1DE6A 3AUJA 1PAMA 2BHUA 3ARZA 4Q8UA 1GVIA 1JGMA 2EBNA 1VPXA 4FLOA 4OECA 3PZVA 3W1PA 3L66A 4UFJA 2VCAA 4X60A 2GWNA 4HZ8A 1A5UA 3QJAA 4OKDA 2O7SA 4JTLA 1EHAA 5I2UA 1W9PA 1C90A 2PWEA 4BHYA 1MRQA 1FWAC 3WZ0E 4KETA 4HKPA 1WBJA 1OFAA 1DWGM 4GQBA 1ZQ5A 4HT3A 2HROA 3HJEA 2P1FA 1DJNA 2E28A 5F2GA 3QFWA 2QV5A 4OBRA 4C90A 3W07A 1MW2A 1D3CA 1X1OA 4HCDA 4Q8VA 2F38A 4Q8MA 5I03A 1GVOA 2VCBA 1ZLPA 1E4IA 5AC4A 4IGSA 2PRLA 1P43A 1SO6A 1Q6DA 3ATYA 3VMPA 2X05A 4B91A 5D04C 2RH9A 2VUYA 4PUEA 4PCNA 1CB7B 1IR2A 2CBJA 2VL4A 1E40A 1EA0A 5DMMA 2OELA 2I5GA 3DBPA 2FMOA 3SADA 3P74A 4NZ4A 4QCFA 2ZXDA 4J35A 3TOYA 1FVPA 3AWNA 1QK0A 1IWPA 1POJA 2PDHA 1XS2A 1EIBA 3JRKA 4S3KA 1EO5A 3GG1A 1HP5A 4A3UA 3LBOA 4RXFA 3AFBA 4TVDA 3PP7A 3LBMA 1V3IA 2GQ9A 2WJEA 3BUVA 5DN1A 3W3OA 2HE8A 1A0DA 2W4XA 2ADAA 4GO8A 3R6IA 1OX6A 5JVLA 3W4RA 2Z1VA 1Y7VA 2HQAA 1MDRA 3QSRA 1TCDA 3B97A 2PDFA 1Y5WA 2VQUA 3TE9A 1AJ0A 1VFOA 2P76A 2CZVA 4IMDA 1PYMA 1QXLA 4FXRA 2YA1A 2ZC1A 2ZVRA 3GX9A 1X38A 3F2BA 4M7TA 3M7WA 5CZJA 1KGUA 5DMYA 5F2MA 3VDHA 4Q8OA 2GPTA 2DZXA 2J9XA 5EPDA 2YPIA 2QJIA 1VLIA 3GS6A 2XFRA 3USBA 1S2VA 4JQ2A 4GVFA 2CPUA 4BEQA 1F6PA 4AAJA 1FWCC 4UTUA 3RYSA 1AH0A 3KCOA 4H4IA 4M51A 4P61A 4S3JA 3S9IA 2PBOA 2FZDA 3VOCA 3GG8A 1N55A 3MSYA 3C3UA 2HXTA 3L0KA 3HG5A 3DGBA 4LXFA 1I1XA 1ME7A 3PPFA 4BFAA 4ILSA 4QHRA 4LRSA 3KHJA 1KR0A 5TQLA 3ABRA 3OLIA 5E0KA 4R27A 4JX6A 3S3GA 2Q01A 2X0YA 1UCWA 3T1GA 3U2OA 4IHCA 1YLVA 3L68A 1XPYA 3ABXA 4AWTA 4MNKA 3T05A 4PTDA 1TPVA 2P8BA 1MQRA 2IKGA 6CGTA 3BAJA 4LS0A 1WUEA 2J66A 1C8QA 5CGTA 3UWWA 3QKEA 1PTDA 1J11A 3SCNA 3AHXA 1WDDA 1YDOA 1OC7A 4DUXA 1SJAA 3IEBA 3IUHA 2UV8G 3HN3A 3QGAC 3SY8A 2ON3A 1M7XA 4QG6A 1CGWA 1KGXA 3PK7A 4FP1A 3JR2A 3UWQA 1TWDA 1IWAA 3KBNA 2J78A 4MWAA 4E8CA 4XBKA 5EU9A 1G1YA 1NFPA 3ZJ6A 3TXVA 4UQ9A 3FFSA 1A5KC 1SW0A 3SIMA 4B3ZA 5FJJA 4NF7A 3U2CA 4S38A 4LAMA 3S5YA 5I3JA 1IZJA 3L2IA 1UUMA 1DQUA 4PUWA 4ZTYA 3JUGA 3WH5A 5IXEA 3RHGA 2I57A 3D46A 5F2IA 1D8WA 4MWAB 4Q8QA 1G4EA 1A80A 1S2CA 2OWWA 4ZENA 5DY3A 3H7RA 2O9RA 3CMFA 2WW5A 1V6YA 1XJBA 5I07A 2V3EA 1HL2A 3ZQ9A 4ZR8A 3M5YA 4HU4A 2PDCA 4C6QA 3B40A 1XYZA 3WMLA 1U33A 1UPMB 1J79A 1WOAA 2C1HA 1GTHA 4HMDA 3OA3A 5DT7A 4ZA0A 4RNHA 1W9VA 1U30A 5T26A 3QMRA 3WF0A 2P53A 4O53A 4LVBA 4IIDA 5EMKA 4YHGA 3RX4A 1IHIA 4GYFA 3GH4A 1QAPA 3C86A 2HVNA 3LB0A 5D9OA 4UTTC 5TBOA 4NVTA 3NYDA 3FHQA 2E40A 1W3IA 3NQDA 4GACA 1KBBA 3AI0A 4HNTA 1Q13A 1W5NA 1U1UA 2O56A 2P5NA 3BTNA 1A0EA 3A5FA 2OEJA 1H49A 3DC8A 1UH3A 3IVUA 4P7QA 4UFHA 2W92A 4EF8A 4O11A 4GNKB 1TPUA 3NWRA 5C9WA 4IUGA 5GJNA 1NU5A 2BOGX 3ZVHB 4XV0A 2VO5A 3HM7A 2GVEA 1AJ2A 3PZOA 4NNCA 5T91A 2PPGA 1V0LA 1H0IA 1TJ0A 1BTMA 2FJKA 5ABEA 4RPQA 2AGKA 3G3DA 3EMZA 3H70A 3MA8A 1NP2A 5A3HA 4GBDA 3O3RA 1BG4A 2ACQA 4QLKA 3T44A 3N15A 3ZR6A 1GQJA 1KWGA 4OE7A 3HV8A 5TIMA 4Q4RA 2PDKA 1H50A 4FB7A 2Q6ZA 4XB3A 3MWCA 1DHPA 4AEFA 4A2RA 2QUMA 3I6TA 3RMJA 1FXPA 4ALDA 4IP7A 3H24A 3C8FA 3I3BA 1MDLA 3GTFA 1VEPA 3APTA 2J62A 1W1PA 4S3GA 3ITCA 2YOCA 2WHKA 4CN6A 2ZYFA 5E5CA 4IPLA 3PBUA 1WZLA 2Z2BA 4R7OA 1LORA 3HFTA 3WBYA 4UOJA 4JHMA 2Y7GA 3KL5A 5D9NA 4FOJA 1SJCA 3EPNA 1SO4A 3WLRA 3E96A 1C91A 3M0LA 3OZYA 3UJRA 1Z9AA 1B54A 3CV1A 2PWUA 2O4QA 2GDUA 4ZO6A 4X61A 2V81A 1J9YA 2GDQA 3VZXA 1OK6A 4FZIA 1V3HA 3QM3A 5CC3A 2ZRYA 2A7RA 2VTFA 4TX9A 1XLCA 3BL3A 4H7ZA 1SZFA 2ZRZA 5GQBA 1C92A 4QQ3A 4FX6M 1NQ6A 4KFOA 1FXQA 1GZGA 1Q6EA 1UWTA 3B8UA 4DJEA 3IIZA 4M6VA 2D20A 1HL9A 4HHMA 4PMYA 3C56A 1SPQA 2Z6JA 1CXEA 4DLFA 2Z7GA 4KWUA 3VFCA 1X98A 3URNA 3RLUA 2CU0A 3KWXA 2YL8A 5BRBA 2GSEA 2G3FA 4MJ2A 3M0HA 3W7HA 1RY8A 4PEKA 3W0KA 2GVLA 2BTMA 3VILA 3BANA 3CWOX 3PJXA 2V3FA 1M9HA 4WX2A 5CG7A 1EJXC 3U5UA 1GOIA 2VEMA 5BYWA 4ZE5A 1YADA 3WFZA 1W5MA 4BI7A 2Y24A 3KBSA 7A3HA 1L6YA 1G4TA 1CGXA 3W70A 3WSUA 3OPSA 2OO6A 3TYEA 4J27A 2XVNA 3EMQA 1VAHA 1AQ0A 3EX2A 5GJMA 2I14A 4FNPA 4GISA 4LUTB 4Q4OA 3LGEA 1F3TA 3RNDA 4DQWA 2XVGA 4CLMA 2OWXA 1NWRA 3GQYA 3F4DA 2Y7DA 3GO2A 4GC4A 1DJXA 2ZC8A 5C71A 3SEPA 2J7HA 3WNOA 1XIBA 4GD0A 4FSAA 3RK8A 3G0SA 1OZMA 4W5UA 2FFCA 4FLSA 1J6PA 4AZCB 2GGEA 4G7EA 1RBOB 1UA7A 5LIWX 3QQWA 4HJFA 2ISDA 4P8XA 4R3UA 4B9ZA 1YIXA 3V5OA 4ES4A 3IVSA 1Y5VA 1TV4A 4IMAA 4KCVA 4DIAA 2R9RA 3I7RA 4DXKA 3SCVA 1NP0A 2O0TA 2PTWA 4XAFA 3S6TA 3IK4A 4MFDA 3AZRA 4UTJA 4UQAA 1GZ1A 2YA2A 2VI0A 2GVJA 2ZADA 3P93A 4GGHA 2OWCA 1MMFA 1OC6A 4DJFA 2CLLA 4UMAA 3SUVA 4BF5A 4JD4A 4W86A 3BLFA 3KCJA 1WDRA 3SZ8A 4DYEA 4E2VA 4D6FA 2DIKA 1EPVA 4IPPA 4UNLA 5DQPA 2D0HA 3BQ5A 4HA1A 2YDRA 1GG1A 2YDAA 2YR1A 3SECA 3E2SA 4L9XA 4X3ZA 1R3SA 5EMLA 1K4HA 3M47A 3IUDA 2PEVA 2TSYA 4F40A 4GYPC 2BBFA 4OBSA 4JIEA 1OCJA 1ZPTA 4PTVA 1QNPA 2INZA 1DJQA 2V5JA 5AYBA 1VJZA 3B0XA 2JEQA 4CNOA 4JTKA 4FI4A 3C0QA 3B04A 3OZPA 4JIRA 2PCQA 1RCOB 3N3TA 1XC6A 3R8HA 1QASA 4CCCA 3C8NA 3EDDA 2QF7A 2XINA 1YDNA 3WCZA 4JEQA 2FZ8A 3TYDA 1YXYA 2R1KA 1VS1A 5K2ZA 4E4FA 2YDSA 3WD0A 4LUTA 1XISA 3EOUA 1AVAA 3RIKA 1EP1A 1OY0A 5EGRA 4ATDA 4YL2A 3BE7A 1DWJM 4Z1BA 4JKKA 4JCLA 4F3HA 5LHEA 1H62A 4LC6A 4PFHA 3SCQA 1FUYA 4PBGA 1BKSA 1KXHA 2XN0A 2CIPA 3KVLA 5CBJA 3W7LA 5CGQA 4RNFA 2UZ9A 1JPHA 2XG9A 1PVNA 1WDWA 1RK6A 1EC8A 4UTWC 4DWSD 1A3XA 2VYOA 1J96A 3EPMA 4OQVA 3TNBA 4HA4A 2GJRA 1XBVA 2PRHA 1FP9A 2WWDA 1HUVA 1FWEC 5JH1A 3R2GA 4NX0A 1G7VA 1GWJA 4NU7A 5I3IA 1AL8A 1PIGA 2RJGA 3GC5A 1W3KA 5CKSA 3IJ8A 4FLQA 4MHBA 4DI8A 3VTRA 3LD5A 3GXDA 1E55A 3ZSSA 1IXOA 3SJ3A 1BGGA 3GK0A 2Y6ZA 1NELA 1RJPA 3GW3A 4IQEA 4AY8A 4AHOA 1O94A 3LZ5A 3P80A 4W84A 2GWGA 4QE1A 1UR2A 1TV8A 5A1AA 3TQPA 3LCWA 4IIFA 2J8FA 1T99A 4YVVA 4K36A 3WYZA 4QDMA 3FGCA 2VRJA 1OYAA 3CHDA 1MWOA 3V36A 1KFKA 1N8IA 1AL7A 1GVFA 3K4WA 2QUVA 2ACRA 3EXTA 4W9TA 4X2RA 3WL1A 2PDQA 4D6DA 1ZJBA 3U4FA 4TX8A 3PAJA 4L4PA 4J4KA 1Q2RA 1XHGA 3WLIA 3MMWA 1M7JA 3LCLA 2VJXA 2J7BA 3ZT6A 1NFGA 2QPUA 2C91A 2DPEA 2CWNA 3MHGA 2OOGA 2WVVA 2WNNA 1VIZA 3W24A 1M6JA 4LS1A 2VZUA 3OBKA 2VT0A 1MZRA 5IHSA 3VD3A 2JK2A 2Y5SA 4ZE4A 2DQWA 1MUCA 2O9OA 3VOIA 1US0A 1BWLA 2YB4A 3LMYA 4GVIA 4S39A 1JAEA 1P6CA 3L4YA 4Z08A 1HXJA 1X39A 3KWSA 1QATA 1TZ7A 5HMDA 3VGEA 1RBLA 3LCIA 3QFEA 4DM2A 3NPVA 1FH9A 3W7GA 2CLFA 1HJXA 3URQA 4DPPA 2TAAA 3OGSA 2DSUA 1JI1A 3JW7A 1KV8A 2E9MA 2FPTA 3LRMA 3LCFA 3ITXA 5CC6A 4KESA 4AYSA 1S5NA 4W8AA 3LBCA 3LPPA 4AF0A 2NT1A 3KS5A 2R6OA 1N82A 3PG8A 4PMJA 1OGGA 2JGQA 3G6MA 3FV9A 4UMBA 1KBLA 2ZBTA 1QO2A 2WZHA 2HK0A 2PWGA 1KXQA 3TCSA 3NZ1A 1KR1A 4UBPC 3A9BA 3S2JA 1NF7A 1ZBWA 1ZY9A 1SFLA 2BS9A 3ATZA 1X97A 3DFNA 3GXNA 1QRQA 1M65A 1OGBA 1ADOA 2TRSA 1WP6A 1W5QA 1GT8A 3KRZA 1W1YA 4QDWA 3VGHA 3I10A 5F2LA 6PTDA 3DKLA 3AROA 2J27A 2RAGA 4AMCA 3M0KA 2W66A 1AW5A 3GIPA 1D8CA 4AU0A 1JJKA 2B7NA 1AG1O 1WZMA 3EB4A 5ENLA 3ARWA 4O8AA 3T0AA 3LENA 3SO7A 5CAHA 2WQPA 3VNYA 2BY0A 2DP3A 3R5EA 3G1DA 3GU9A 3EX1A 3N6JA 4ERAA 1XSKA 2EPLX 4WDXA 3VX0A 3S46A 4Y90A 3TV8A 5IFTA 3AUOA 2PTDA 2E1DA 3N2CA 3WLJA 4AISA 2FYMA 3T42A 2NV1A 4A3HA 5HJXA 3E49A 1EZ2A 4F48A 2Z27A 2IPFA 3BJFA 3NTYA 2WPBA 3QEZA 1WKDA 5CBIA 2Z1SA 1VHCA 1XM3A 2NVAA 3NDYA 4HSNA 5L9FA 1CGTA 1CW2A 1UMLA 3IAPA 2GOKA 4AG0A 4OJYA 1ZL1A 1G7UA 3A4AA 4KF1A 5A5WA 2X1SA 2F6XA 5HNNA 3CUZA 3A21A 3AYSA 4CU7A 3W2LA 4QSFA 1YBQA 2VELA 5CPLA 1RA0A 4HMNA 3N6QA 1X6LA 1FCVA 1B3WA 2E3ZA 4HYRA 2WBGA 3RPTA 1CYGA 4NQ1A 3EPOA 3CYVA 3MY9A 1PCKA 1OG0A 4AF0B 2NSXA 3IJQA 4PZVA 3GM8A 1VBJA 1AH3A 3LNPA 1YW1A 2VFFA 3KX6A 1IYXA 4DUOA 1Q4WA 3W1NA 3LOTA 3MW7A 5LNRA 3CXOA 1F4AA 5AFDA 5HUOA 4IPJA 2NLYA 2CITA 3N9SA 4J9JA 4LF2A 3MT1A 4FS9A 3GYEA 4Z1DA 4K6AA 1IEQA 2B7PA 1FP8A 3COTA 3NAVA 4TVCA 2JF7A 4QX4A 4PTMA 4BA0A 3EA2A 3VCNA 1EC7A 3S6OA 4Q3MA 3GUGA 4NYUA 2HEJA 5LKYA 3GKAA 4GA8A 3CHVA 4XZMX 5I24A 5AHIA 1ONEA 2QCEA 2V68A 3CB3A 1RXOB 2BLEA 1XSIA 2VFIA 4K38A 2BG5A 4LVAA 2AKZA 4E5TA 4JN8A 5D8WA 3G1VA 4LEQA 1W32A 3I7QA 2F61A 2QDHA 5HULA 1NDYA 3GVRA 3S5OA 1TX2A 3VD4A 1V6WA 3BURA 4UZSA 4QJ3B 4I9AA 2P0IA 2OGYA 4FIRA 1IQ8A 3AICA 3A3XA 3EWZA 1V4YA 1JCYA 1QU4A 4HSHA 2BHZA 4WDTA 1P48A 5D2VA 3L67A 5JIPA 3VNLA 3SBFA 2QCLA 4NAEA 1VFSA 4ADTA 1P4CA 3HPSA 4BWLC 3THAA 4MY9A 5I5RA 3BLPX 2GL5A 1WUFA 1DWIM 1KA9F 4UMCA 3WMCA 3LHUA 1XI3A 3HGRA 3FDGA 1DIOA 5AOUA 5E9AA 3UY7A 4M0XA 1RR2A 3TQ0A 3U57A 4UCGA 2XIJA 1YNPA 4NXSA 3ERPA 5CAKA 4BQ3A 5A6TC 4C7FA 3L23A 1ISXA 1OFOA 4M8UA 1Q45A 1JZ8A 4JTGA 3B8DA 4MPQA 1CWYA 4FNUA 4FX7A 2VC5A 1LOSA 1FH8A 4RKAA 5LYRA 2CFFA 4EPDC 5A2CA 3WUEA 1KO0A 5D32A 3A9IA 1QW9A 4GZ7A 3WQWA 1Z3NA 4Z2JA 3ZLFA 3G6LA 3T2PA 2BFGA 1FWBC 3WENA 1IXPA 3NQFA 4GCXA 4GVHA 4XTIA 4GXPA 2QT3A 4I6KA 2OX1A 4K7VA 3AMCA 2FHBA 3IGHX 3TFXA 3WQGA 2PDMA 3B9OA 5CPTA 5KZMA 4NZJA 2BVYA 1Z69A 3RLVA 4C6LA 3OGVA 8CGTA 3MS8A 1GTEA 2CHRA 1IWBA 1LCOA 1MZHA 4WY0B 3GHTA 2E1WA 4B5UA 2X41A 3STCA 1KGWA 4E4PA 4XX6A 5A6MA 2Z4GA 4KW2A 3PNZA 4PTNA 4ZBCA 5FEZA 1K7EA 4WLCA 1EC9A 2CHNA 3DC0A 3W7EA 1SSDA 3CB8A 3GXMA 4UFKA 3AIQA 4XWUA 1NOWA 2VC7A 3R13A 4G8TA 4IMFA 2AGTA 1H60A 5J8LA 3CMGA 2DSWA 4CGTA 2OT0A 3ARPA 3HGSA 3HQNA 5HWJA 3W00A 3UR5A 1MI3A 1O4UA 4N9BA 1I45A 3QYSA 3DCPA 1OABA 2EPOA 2QJNA 4XZ9A 3STEA 4FF5A 2J88A 3GD6A 4JDBA 1QDSA 1H63A 1QR7A 1NF0A 1MEIA 3DKJA 5DRCA 4W93A 1OT1A 2QUNA 4M29A 3S9ZA 1R46A 4MPKA 3GDTA 5GPRA 1OX5A 1V3LA 3GU1A 3W2UA 4IP4A 1KKRA 3W9ZA 2H9AB 2CLMA 3WLSA 4HYVA 5BU9A 4AIBA 1AQMA 3CL7A 3RILA 4D8LA 5AYIA 3NQ8A 4C1KA 2HJPA 3ZVHA 5J5RA 3A64A 1JZ6A 4IJBA 1V08A 1W9UA 1NFBA 3WEOA 4MG4A 3MDWA 3UR2A 4JS3A 1JUEA 1UOZA 1JEZA 2W5FA 4NASA 3P8IA 2HE5A 4PB5A 5D9PA 4RDZA 2C19A 4KCWA 2BVDA 3C2EA 2FIQA 4MVAA 3ZYZA 1VQTA 5EBAA 3PWGA 3EBVA 1TMQA 4KEZA 3WEMA 3RLHA 1RP8A 4WOZA 3CV6A 2L5HA 2QJGA 2WKLA 2EQDA 4JX5A 4QE5A 4CUCA 4C7GA 1MUWA 4NP7A 4ZGYA 2EXOA 4QTGA 1FCUA 5FAGA 3AHVA 4BKNA 4N9DA 4S3FA 1R0MA 3AIWA 4EPEC 3ZO9A 3TR9A 3NSNA 2ZA2A 1RJQA 2YCKX 5FJOA 4UCFA 1ITUA 1SJBA 1V6TA 5CPNA 2W67A 3BAYA 3FVMA 4DYJA 1WKEA 4GPNA 1VFUA 1M5WA 2PZ0A 4ZOCA 3SCOA 4CCZA 3K8KA 4GQQA 4CNSA 4O28A 5KETA 3V1PA 1Y0EA 2JGYA 4H9YA 3WLNA 1P6BA 5T9CE 4IGNA 3H8AA 4EWND 4YCPA 1F74A 1XICA 3IJ9A 2DZPA 2WJZA 3WLQA 1F9CA 1HKMA 4L1WA 4AZIA 2BP1A 3Q65A 3HMJG 3QR0A 2QCDB 3WBWA 2G3IA 4HCHA 1PHQA 5CGMA 4XUGA 1NIUA 3ALGA 1L2QA 2PS2A 3KBVA 2PLCA 4Q32A 1EJRC 4BQ4A 2DJXA 3ZT7A 1K6AA 4O18A 3BLLA 2G37A 3S0CA 4Q4SA 3VOFA 2EF9A 1TPH1 2A21A 5E0FA 4R88A 1B3ZA 3GR8A 3W22A 2FZBA 4B5NA 1QOPA 4OV4A 2VC9A 1AUSL 3LM3A 1LL4A 3ZMRA 3EKZA 3SB0A 1F61A 4Z2IA 2DZAA 2AKMA 2OZ8A 1XP3A 3I4KA 3KUMA 3W29A 2YX0A 4UB9A 4EXBA 4FPSA 1J0JA 3CPUA 3F2DA 1IEXA 2PFHA 4BQ5A 3KOFA 4XD6A 3GKFA 4GJIA 4DF1A 2YW3A 3CZJA 1YXDA 1CTNA 3TTQA 3V35A 3CTLA 2V0TA 3GNRA 2YKKA 1TTIA 1FWNA 2PC4A 1TWWA 3M0ZA 2NUWA 3BSMA 3TJLA 2C1IA 4RNIA 5CXPA 3B8SA 3MMUA 4H9MA 5FF3A 3GNXA 1AZ1A 1K77A 2GUBA 3WQ4A 4FLRA 1SMDA 1JRBA 3TWBA 2FVKA 1TPB1 1U83A 2NQ5A 3W1XA 3TN5A 2CC0A 2X2GA 4M6UA 3NSMA 3O0KA 5C9RA 2E77A 2BDQA 4JBRA 2Q3OA 1E1CB 2DW7A 3GC4A 3OLGA 2QCCA 1X7FA 4G7FA 1MSSA 4DZIA 4W8BA 1NOFA 2DSZA 1ICQA 1KM0A 1A49A 5BW6A 3VINA 1S1RA 4IQDA 1JGIA 3N2MA 2JKEA 4MUZA 1Q6RA 1XCXA 5XIMA 4DJFD 1KQYA 3P61A 1TTJA 1Q6GA 2CWXA 3F2CA 3F5LA 2QHAA 3CT2A 1KBJA 1UOKA 1EF2A 4PUUA 4ICNA 1RJRA 3E2VA 1KB3A 5C55A 2WB5A 2ZX9A 1K8XA 3LPFA 5C9ZA 4PUJA 2OXNA 1VCFA 5HUPA 4D2JA 4UNIA 1XC4A 2DIJA 1PUDA 1JQXA 1WCGA 1GQKA 3DYMA 2AOSA 3W74A 5HQMA 1Q85A 4FR6A 4AYGA 2PP1A 2XVKA 4JIPA 3KL3A 4WJ8A 1JD7A 2PDUA 2Y4SA 4AWUA 4DUWA 1V02A 2CLOA 2PGEA 1TV2A 1UB3A 4R33A 1F76A 3WF1A 4FF7A 4ZQOA 1J12A 3WD3A 4IGMA 4LW7A 4C1NB 3KM8A 1G4PA 4AZBA 3P5YA 4Q8WA 5D33A 2QUUA 4JY8A 1KKOA 1W1B1 2NSOA 5AKQA 2FH6A 1RLCL 3DFSA 3FKRA 3AAMA 3UETA 4HPJA 1CGUA 3G22A 4UTKA 5IHRA 3QYQA 2W91A 4HBKA 4WY0F 1JZ2A 3FXGA 5DBUA 4YS1A 5CEWA 3QZAA 5A8QA 4TQTA 4HZ7A 2PP0A 5G2WA 5AECA 1LT8A 3UBPC 5ABFB 1VZWA 4Q8TA 4TUFA 3W1TA 4OUIA 5FEXA 2MUCA 3WK2A 4OBTA 1VH7A 1ML1A 2YXOA 3AIBA 4K3ZA 3VD7A 4XZIA 1TO3A 1R3QA 1M01A 2AQOA 1UPPA 4AXKA 1RY0A 2QCNA 3ICJA 3H2EA 3GWQA 3R79A 2E68A 3TR2A 5HWMA 1V0KA 1TIWA 3PUGA 2X7WA 2A3HA 1LRQA 3R8GA 1XG3A 3HQPA 5JMUA 4TV5A 3LXCA 3TCEA 3MJYA 2OR2A 2V5KA 3W37A 2OYLA 1IGSA 1LROA 1EP3A 3UNTA 3H12A 2A6NA 3NO3A 2PDWA 2NXIA 3HBLA 4NZ1A 3RM8A 2Y0FA 3KP1A 3NL3A 3W2NA 3E0FA 2PGFA 1J5TA 5K4ZA 3WLPA 3LXBA 3W2MA 1Y8BA 2ZUWA 5LA0A 1GVRA 4JQ3A 4LV9A 2A6LA 2DUXA 2Z29A 1R2SA 4C65A 3NUKA 4HPNA 3GXPA 1LDCA 3OBEA 4GQ0A 1MNZA 1RHCA 2J8GA 4N6EA 1E9ZB 2ESCA 1JUBA 1AJZA 4QNEA 4YWIA 1TJRA 3EA3A 4PSRA 3ARSA 3RPDA 2ZZ5A 2WXDM 4O1AA 1PX8A 2ZX8A 3UGVA 5FSEC 1PZ3A 5M03A 1UZDA 4GJJA 2Y62A 3OEXA 1R3VA 1JYXA 3TJXA 5A2AA 2PU0A 1VBRA 5CSUA 1VEMA 2G3MA 3UFYA 4OHQA 3IWPA 2KAUC 2CBUA 2ZUUA 5E70A 1UR8A 1V93A 4NI8A 3VE9A 3OU8A 4HTBA 1UG6A 4JDYA 3N4AA 2Q8XA 4DO5A 3FJ4A 4XBJA 3GXTA 5HINA 2WZEA 1KXTA 4MWAC 3K1DA 3LM7A 3SUSA 2VGGA 1KM2A 3W83A 1W1IE 4HOZA 2J79A 3NSXA 1XLGA 2AMXA 3WUGA 1JG9A 4U5IA 4HHLA 4CD8A 4P8UA 4YNGA 1V02E 1GEHA 2WANA 2EJAA 2V3DA 2YCLA 3DFOA 4LBUA 4K68A 4REQB 3ARTA 4HHHA 1VFMA 3EEGA 1N8FA 3U6WA 3M1ZA 4EKJA 2JQXA 2Y89A 1OBAA 3PNUA 1PCWA 1XGDA 4EP8C 4HU0A 2FZNA 2DUAA 3D0CA 4US6A 3TROA 3UG8A 3QVQA 5A6BA 3ITYA 1OD8A 5C5YA 2TPSA 2XYLA 2JBMA 4O14A 1P0NA 1EPXA 1O95A 2TMDA 2ZRUA 4GZJA 2Z1XA 2R1MA 3EEZA 4FIQA 3WQ5A 1WAUA 2GGJA 3CGTA 3ZJ8A 2H90A 2YGYA 1K8YA 4JNZA 4DWSB 3BPWA 1G0CA 2XGZA 3L7RA 3GSMA 3ZWTA 1ZP4A 4MYAA 3ITOA 3NQ2A 4KKXA 1F05A 3EDFA 2GQ8A 1KV5A 3UERA 1H2JA 1R9XA 3HOJA 4GI4A 4F0KA 4CEUC 3SM0A 1Z8AA 1T7LA 4XK2A 1QUMA 3UA4A 4CCDA 1UR4A 3UESA 2IPJA 3V0UA 4XKYA 2BNJA 4IL2A 4DZ5A 1JDDA 4MTVA 5HQEA 3HV9A 1YKWA 3QW4B 2NQ9A 2D69A 2V2DA 5D03A 3FEMA 3L5MA 2D3NA 3AU2A 1TRIA 1PZ2A 4L9YA 4TVUA 5LIYX 2G96A 4RXGA 3G24A 5FJTA 3NG3A 4TR9A 4I90A 4IPIA 1KM6A 2ZOXA 1L6SA 3AOFA 4Q4MA 1RP9A 1JCLA 2J25A 3UZXA 3QRHA 1E0VA 3E12A 5BWAA 1CB2A 1DJYA 2DT2A 4ZO7A 4AD3A 1FCBA 3V75A 3ZS4A 1UQYA 4J7RA 3B9AA 3L4TA 2XZ7A 3FA4A 4JFSA 1M7OA 2WZTA 3PBVA 1HF6A 1KCZA 3W28A 2XZ9A 2P50A 1R9YA 4KRUA 3S1WA 1TFVA 3BOXA 1QJWA 2PTYA 4WUIA 1MVYA 3O15A 1ZP3A 3W82A 1XKJA 2A3BA 5LNUA 4S3DA 3RM4A 5HJLA 4Z2HA 4A05A 1BAGA 1OT2A 2PLKA 4ZB2A 3UZZA 3FSUA 3ITGA 3D5HA 5CZ0A 3BAKA 3M0VA 2XPKA 4ECLA 3EKLA 5AC8A 3EX4A 1G9HA 5BOEA 3EOLA 1YDVA 4R34A 4CVUA 3BGAA 5SWUA 3BGGA 4I9MA 5ECUA 1TA3A 4GHRA 4A4AA 5LNVA 3PTKA 1E9LA 1OC5A 2D22A 3MMTA 1RD5A 1XYLA 3GDMA 4LT9A 4BR1A 3PBWA 1J0YA 4XG1A 4FO4A 2GSHA 4US5A 3E2QA 5A2BA 3NPUA 3BAWA 4HNCA 1JCMP 3SRKA 3QY6A 4B2DA 2VKZG 4PMVA 4H9VA 4GYKA 2ZUTA 1A53A 2E9LA 4I3GA 5AZ1A 1XD1A