5CPTA

Disproportionating enzyme 1 from arabidopsis - beta cyclodextrin soak
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
517
structure length
514
Chain Sequence
SVGEDFPSEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGEEAFRFIDWLHSTGCSVWQVLPLVPPDEGGSPYAGQDANCGNTLLISLDELVKDGLLIKDELPQPIDADSVNYQTANKLKSPLITKAAKRLIDGNGELKSKLLDFRNDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSALEAIYESQKEFIDLFIAKQFLFQRQWQKVREYARRQGVDIMGDMPIYVGYHSADVWANKKHFLLNKKGFPLLVSGVPPSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRIDHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISKGVGKIKIIAEDLGVITKDVVELRKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDQEEKSKAMKYLSIAGEDDISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPSSTSFDNLETESDRLRDLLSLYGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
publication title Structural Dissection of the Maltodextrin Disproportionation Cycle of the Arabidopsis Plastidial Disproportionating Enzyme 1 (DPE1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 182
structure length 514
sequence length 517
chains with identical sequence B
ec nomenclature ec 2.4.1.25: 4-alpha-glucanotransferase.
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02446 Glyco_hydro_77 4-alpha-glucanotransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5cptA01
4PMRA 1HVXA 1RP9A 3ZIZA 2W5FA 2J7GA 4QCEA 1OM0A 2VCAA 1M7XA 1WO2A 2WW5A 1US3A 1WDPA 4M82A 5DEZA 3ZR6A 2DSWA 5CLWA 4WSJA 3W6LA 4HPHA 1BYCA 2VUYA 3THDA 1V6XA 1LWHA 4TX6A 3ZJ7A 1FH9A 5CJ5A 1QHOA 3KL5A 5IHSA 2VX6A 4ZENA 1KGWA 2QMJA 2ZUSA 4PTWA 1EO5A 4MJ4A 3OLEA 1CGVA 1PJ9A 4JFVA 2WWCA 3WQWA 2DDXA 3AMCA 1E6PA 1CDGA 2ZWYA 1CXEA 3BCFA 1G01A 1M53A 4UFMA 2VC9A 1ISXA 2NSXA 3RM8A 2XGBA 2BXYA 3CGTA 4J27A 1UR2A 4GO9A 5I24A 1JXJA 5EFDA 1JAEA 3AHZA 1UQZA 1V3KA 1XCWA 3ALFA 3BSGA 1W9DM 2DT1A 2XYLA 3WDPP 1MW1A 1VIWA 3WQ6A 4M56A 1AMYA 1I1XA 5HPCA 4HZ8A 2CEQA 2OSXA 1XH1A 3VIOA 1H5VA 4U3AA 1UKOA 1KGXA 3F5JA 1HNYA 3ZOAA 3T2OA 3AZRA 1JYVA 2GVYA 2Q8XA 1TVPA 3E1F1 4NF7A 2ZUUA 4JKLA 3RDKA 1M01A 1UR1A 3CZEA 2WMIA 1IZJA 3FHAA 1KWGA 2BV9A 5A6BD 2XIIA 3AJ7A 1XSJA 3WF4A 2FHBA 3ZJ6A 5BWFA 3WNMA 4KRTA 1EHAA 2VZVA 3BSHA 3IJ7A 4QAWA 3TONA 5BXPA 4PMDA 1H2JA 2XUCA 1VFMA 1QNPA 1UD2A 4CD6A 3VX0A 3OLIA 5JBDA 4HA1A 3L2LA 4RE2A 4AXNA 3HU7A 1JNEA 3KWXA 1QNRA 3EMZA 1HF6A 2PBOA 4PMZA 3NSNA 5DFAA 1J11A 3NIYA 4X0NA 5D8WA 2HVMA 5E09A 5DF0A 1VEOA 3W24A 4MB5A 5HXMA 1ESWA 3CBWA 6TAAA 1KFWA 3WQ4A 3QHNA 2CESA 1B30A 1P6WA 1V6WA 3PBGA 4OOZA 2ZE0A 5BYWA 1LG1A 1CWYA 2VZTA 1J10A 3AS2A 3POHA 3QOKA 4PTXA 4JAWA 3LPOA 4PYSA 1V0LA 1GNXA 3CUHA 3ZT6A 4C7DA 4GINA 3WQVA 5FL0A 4B16A 4EK7A 1CGYA 3UR8A 3PTMA 2DIEA 1B2YA 2Y24A 2D2OA 1E71M 2VO5A 1FHLA 2ZXQA 1PBGA 1XD1A 3AHTA 3PZGA 1E56A 1WZKA 2IUZA 4NI3A 2BHUA 2JFEX 1AVAA 1PPIA 2CCRA 2JIWA 4MB1A 1JFXA 1OSEA 3L4TA 3BLPX 1OGSA 3MV11 1HKIA 1ISVA 5DT7A 3VIKA 4HOZA 4EE9A 3FXYA 2V3EA 4D6EA 2WVVB 1NWSA 2YA2A 4ZXLA 5BROA 4URIA 1NOFA 2W4XA 2E9LA 2CNCA 3WNKA 3MUZ1 3APGA 3NSXA 4AZCA 3L4UA 3VGHA 1EQPA 3GH5A 4Z2KA 5A2AA 1JL8A 2WZHA 4S3JA 1QI3A 4TXEA 4AZ7A 1C8QA 1ZU8A 3CHFA 2E8YA 1M03A 3F5KA 3MKKA 1J0JA 3D5HA 5BRQA 2WMGA 4TVDA 3RJYA 3DYOA 1WDRA 1W3KA 4Z2JA 2WAGA 4XUYA 3W29A 1UD8A 3CHEA 2IXVA 3HJEA 3N17A 4CD8A 4EKJA 3SUUA 1UR4A 1GCYA 2NW0A 4Y7EA 4MNLA 2VNCA 4JKMA 3VGGA 2XM1A 3B9DA 5ABFB 4PMNA 2JALA 2GSJA 5E6ZA 1GW1A 1H1NA 4D6FA 3PN8A 2OLHA 2DSKA 4JZ5A 1HN1A 1O6IA 4JL2A 4MAZA 2A3HA 3WD1A 2VR4A 4PUDA 2EBNA 4PCSA 3DC0A 3NDYA 1UHVA 3PZVA 4F79A 3G6LA 3WUFA 2EXOA 1VJZA 2PB1A 2G3IA 1JZ7A 2J79A 4OZOA 1ISZA 3TTYA 1KGUA 1J9YA 4BQ3A 1W9BM 4E8CA 1TR1A 1VENA 4PMQA 1J0IA 1G0CA 1K9DA 2A3CA 3N15A 3K8MA 4N0RA 3RILA 3MUY1 3EDJA 2YBUA 4MB4A 2DEPA 2O9RA 1BYBA 3GXFA 4CCEA 3BXWA 3VNZA 1NP2A 3LPGA 1UKPA 1V3HA 3WH7A 1KQZA 3WNNA 2WLYA 5JIPA 3EMQA 3M46A 1CBGA 3BAWA 2AAAA 3EMCA 4W88A 3VDHA 1R7OA 1Z32X 1Q4NX 1OCQA 4IPNB 2VX7A 1DTUA 1UWQA 2XFFA 1QNOA 2WC4A 1K9FA 4MPKA 5GPRA 2CPUA 2EO7A 4W7WA 2DQXA 1LLOA 2OYKA 1JYNA 2OYMA 1WE5A 1WPCA 2GJXB 1QHZA 4S3KA 2Y8KA 3BAIA 3K4AA 1W3HA 4KMQA 2PI6A 4AW7A 2PF0A 4BZYA 1F4AA 4AD2A 1VFUA 3GZAA 4LQ1A 5ABHA 4IUGA 1NWRA 3VGDA 1BGGA 3K8KA 5D9MA 3A3HA 1KQYA 3W25A 1E6SM 3L4WA 1KXVA 4QLKA 1WZLA 3BLKA 1E1FA 5EMYA 1JZ2A 2ZUTA 1B90A 1CTNA 1WB0A 2X09A 3GDBA 2FHFA 4AD4A 2G3NA 4PUEA 3HN3A 1E5NA 2X8RA 3N04A 2YL9A 3PZTA 1W9VA 2ZUNA 1V03A 2UWFA 4JCLA 1K9TA 3U5UA 3UERA 3LPPA 5FCZA 4NRRA 3SCPA 1Q6DA 1W9XA 4AEFA 1UOKA 2JIEA 3L4XA 1VJSA 4AZGA 3WL0A 3AIRA 1FFRA 3WN6A 1UWIA 2VR5A 3SURA 1TG7A 4ACZA 2ZUVA 1SFSA 2VZSA 4CN4A 5I3DA 4OUEA 3MANA 4W5UA 1UA7A 1E5JA 4WK9A 5A6AA 1R86A 2BHYA 3ECQA 3IJ9A 1E0XA 4KH2A 1EQCA 2FGLA 4OJYA 4CUCA 3WF3A 4D6DA 2WK2A 3GBDA 1V3LA 1OIMA 3ARWA 4D71A 3G6MA 3MS8A 3WFLA 1EA9C 3PZIA 1E55A 1E0WA 2RGLA 1BG9A 5CXPA 3AZTA 2X0YA 1I75A 3WQ5A 4F9DA 1BF2A 1RH9A 1E6ZA 1HJWA 2VRJA 5HPOA 3WY1A 1KCLA 2Y5EA 1GVYA 1E72M 4PTMA 1XYZA 1HP5A 4ZXOA 3RIKA 2WVUA 1BVZA 1S46A 2D3LA 4FF5A 4W5ZA 3THCA 1KBBA 2V5CA 1XSKA 1DWHM 1ZB5A 3VM5A 2XVNA 2XG9A 1GZJA 2QV4A 2QMKA 4GKLA 1E43A 5M5DA 1TZ7A 4GI8A 4AZCB 4P8WA 3WELA 3WDIA 4UNIA 1LG2A 1R85A 4P7OA 3AHVA 2BVDA 3KL3A 3AIWA 4PBGA 4TTUA 1FFQA 4P8VA 3VMNA 1NWUA 1FP9A 3VGFA 3KE0A 4LXFA 2MANA 3UESA 1KR0A 1E73M 1GJUA 4UQ9A 3OLGA 3SCVA 4UFKA 1B3VA 1KB3A 1PEZA 4UFJA 4AIEA 4W84A 1WP6A 1B3XA 5CPSA 7A3HA 2XVGA 1VF8A 2VX5A 1J18A 4TX8A 2YKKA 4YN5A 1B0IA 2W62A 3VKKA 3NSMA 3WMBA 1KR1A 1R8LA 4V2XA 2FH6A 3AHYA 3AISA 4W89A 1C7TA 5CGMA 3ARQA 2F2HA 3WUEA 1SYTA 4AZIA 8CGTA 1HL8A 5DT5A 3FY1A 1QI5A 3WDRA 1MFVA 2C7FA 4AD5A 2VQTA 1DWJM 3PZOA 1H0IA 3NUKA 2OWWA 3L4YA 3AMDA 3WEZA 3WMCA 2D24A 1X1NA 4ZE5A 4XZWA 1AQHA 2DH2A 3UR7A 5FOOA 1TA3B 1J0YA 3MMUA 3AYSA 3VD5A 3U57A 3EYPA 4Z2LA 1BLIA 1ZBCA 1MYRA 2WKLA 3VPLA 3TA9A 3VOCA 1JD9A 3TOPA 1QW8A 3CMGA 3LMYA 1GOQA 4HA4A 5BXTA 4GXPA 7TAAA 1PX4A 2ZIDA 3POCA 1JI1A 1LF1A 3WENA 2WMJA 5A8QA 3WNOA 1KXQA 3ZJ8A 3AFBA 4BCEA 2ZUWA 1CGXA 2DT2A 3K46A 1W32A 4JHZA 2CBVA 2ZWZA 1V0MA 1CECA 4KGJA 3A4XA 3VINA 2VRQA 1C8XA 3QOMA 2PWEA 1GOKA 3AS0A 5CG0A 4L4OA 1CGTA 1V3IA 2W92A 2VT0A 4ZFMA 4CU8A 2XJ7A 2E9BA 1GORA 1CYGA 3WNPA 2VX4A 4ZEPA 3W4RA 3O2LA 2FH8A 4HMEA 4M80A 1DP0A 1BTCA 2G3JA 5IXEA 2D20A 2NT1A 2JF7A 2GDVA 2W63A 3D3AA 1J0KA 5JBEA 1W9PA 1JG9A 2A3BA 1SMDA 3M07A 4AD0A 4W7UA 3N18A 2XFYA 3GH4A 3AICA 5FKYA 1UZ1A 2GJRA 1N82A 2YL5A 1ITXA 3MMWA 3UCQA 5A95A 3B9AA 1SR0A 1ZL1A 5GNYA 4Q7NA 1ZBKA 3S2CA 1NOUA 5I0DA 2FDMA 3I3DA 6CGTA 4TVCA 2ZICA 1LL7A 3OB8A 4YHGA 1ZJAA 2CBJA 1E3XA 4DUVA 1QOXA 3VDCA 1RPKA 1HIZA 1BSIA 1TMQA 2BNJA 1UQYA 3T2QA 5BCAA 4J28A 2QF8A 3GH7A 1BVNP 4K68A 3TTOA 4CKQA 3I3EA 1TVNA 3ARSA 1UD3A 2F8QA 4JFTA 3FNDA 1MVYA 1UKQA 2VZOA 3UETA 1BAGA 3IAPA 4QCFA 2E8ZA 1CXIA 4W93A 4IM4A 2O9TA 1J0ZA 3PZMA 1JXKA 2WCSA 1C7SA 1ZBVA 1UH2A 1JGIA 2XWDA 2ZUMA 3MUAA 3ZT5A 4LGXA 2QPUA 2UY2A 2CIPA 4UQAA 1HJVA 4U31A 1MFUA 3FAXA 5A6SA 1UD4A 4UTFA 4CCDA 1U2YA 1JD7A 1OB0A 1X6NA 2ZXBA 2DIJA 2BS9A 3EDEA 5AC4A 5FL1A 4J3SA 2D3NA 3CZKA 3RCNA 4N42A 3RPMA 3SUSA 1W3JA 2XM2A 1BFNA 2PWFA 3FW6A 9CGTA 1LWJA 2BY3A 5A8PA 1B9ZA 5CLTA 1NARA 4MNMA 1HKMA 5A8NA 2VOTA 4E8DA 2DT0A 2QLYA 1E4NA 2EEXA 1QNQA 5D9NA 1WCGA 2Z1SA 5E0FA 4UR9A 4CU7A 3VD9A 1HVQA 1L0PA 1JDAA 5CZKA 1WZMA 5A8MA 5I2UA 2WM0A 2WC3A 4IPLA 2Z1KA 3BH4A 4MB3A 2X0HA 4JL1A 4UCFA 5D8ZA 4M29A 4WF7A 2X2YA 5IHRA 5A2BA 2WNWA 4JCMA 3MO4A 3F4VA 3AXIA 2D0FA 2V3FA 4BS0A 3ZQ9A 2XGIA 1JNDA 2DT3A 2ZX6A 4KRUA 4E2OA 1E6RA 3RO8A 3U5YA 4B9ZA 3CTTA 1C3FA 5IFTA 1TE1A 1HJSA 2XHYA 3SEPA 3AIQA 2V3DA 2OSYA 1C91A 1DWAM 4PSRA 4AZ6A 4UQBA 1UG6A 3SCUA 1WAWA 4J3VA 2CYGA 1ODUA 1HXJA 4UOQA 3PZ9A 1W9UA 3RMEA 4KGLA 1MW0A 3WFZA 1PAMA 1MXDA 3SUWA 4JKKA 1OGBA 3AROA 3VUPA 2EPKX 4HZ6A 3QHOA 4LPCA 4UQEA 1CXKA 1QI0A 5D9OA 1OBAA 1HKJA 4X0VA 1BG4A 5AYIA 1XGZA 4W8BA 2J7CA 2D1ZA 4AY1A 1HJXA 1CLXA 4FLOA 2IXUA 1BYDA 2D23A 5A2CA 4GZIA 2BY0A 5D9PA 8A3HA 1G1YA 1F4HA 1AQ0A 3F5LA 2O9OA 3ARUA 3GTNA 3VIGA 3K1DA 3WBAA 3VIPA 4D6GA 2DPEA 3N9KA 1VEMA 2VL4A 5A6JA 1GQKA 4TUFA 4YPJA 4CVWA 3OZOA 1JFHA 4J3XA 3VD3A 3WQ8A 4J3WA 5ABGA 2D0GA 3J7HA 1CXFA 1GOOA 2YIHA 4JHOA 3T0DA 1V6VA 2WANA 1R87A 2JEPA 1KBKA 1TUXA 1UUQA 1XH0A 4U33A 1ECEA 1DEDA 2WSKA 3L4VA 1DWIM 3TTSA 3OG2A 2EQDA 3FHQA 2WMIB 5A6KA 2XVPA 3K4DA 5D4YA 3LPFA 4MDPA 3ZMRA 4AZBA 5CPQA 1B1YA 4B15A 4XB3A 1Q6EA 2AOSA 4UFLA 2DH3A 5ABEA 2CETA 5KEZA 3MU7A 3UG4A 3TP4A 4XV0A 1NQ6A 1PX3A 2BY1A 3AIVA 4UFIA 4EANA 6A3HA 1MW2A 3FAWA 1EDGA 3PZQA 1Q6GA 1EO7A 1ZJBA 4FMVA 3VMOA 3CO4A 3GXDA 5A69A 4QP0A 3ARTA 4TVUA 4NRSA 2V38A 4C7GA 1TFVA 4OOUA 4WSKA 3AIUA 3WD0A 5I23A 1NH6A 1J01A 2BXZA 3SCSA 5FD0A 2WHMA 2XVKA 5CQ1A 4AYSA 4ZE4A 5I77A 5LA2A 4CVUA 2O92A 5IFPA 2UY5A 4DWSA 4P7NA 4UFHA 3K8LA 2VRKA 3RJXA 4AIUA 2XTKA 2WC7A 1LJYA 1ISWA 3ZSSA 4H04A 1HL9A 2BVTA 2C8NA 4V27A 3ARRA 4X9YA 3N12A 1VBUA 2GJPA 5DO8A 3KEHA 3UG5A 4W85A 3QHMA 5KZ6A 2VMFA 2J78A 3ZM8A 4L4PA 4HU0A 3WF2A 2CHOA 1EOKA 1Y7VA 4PMOA 3CZ8A 1CNVA 1VBRA 2E3ZA 1FH7A 1V6UA 3WL1A 1UWTA 2W91A 1UD6A 1VB9A 1NOWA 3OGRA 3AMGA 2VQUA 1JAKA 4RE4A 2JF6A 4BQ5A 1E0VA 3GM8A 4WIWA 4TOQA 4RE3A 3CPUA 3MV01 1H4PA 3PZNA 2J77A 1MWOA 1NM9A 2WHJA 3U7BA 2OSWA 4J7RA 2W61A 4HP5A 4AD3A 1QNSA 1H49A 1QPKA 1MXGA 4B3KA 1XV8A 3OIHA 3M6DA 4DWSC 3O9NA 3A4AA 5AC5A 2XFRA 3SCWA 1GHRA 2YL6A 3BMWA 2WMHA 1CGWA 3ZJKA 4XX6A 3A47A 3WD4A 4U2YA 2CERA 5A6MA 1Q6FA 2YA0A 3GXIA 1XHGA 3N13A 3WD2A 2JEQA 1GOIA 1KXTA 2XIBA 2WMFA 4FLSA 2EPMX 3CZJA 1WDSA 1ZBWA 5EBAA 1SMAA 5A1AA 1WZAA 5LA1A 4D6CA 1J12A 1UR0A 2ESCA 1IT0A 2J7BA 4GO8A 3A6OA 3WNLA 1GQLA 1E6QM 3CIVA 4GPNA 1EHNA 1H3GA 4GQRA 1KXHA 3TTQA 4P8XA 2Y4SA 3AS1A 1UH4A 3AOFA 1UKTA 3W28A 3A4WA 2E40A 1W3LA 2E9MA 1GQIA 5C71A 4Z2GA 1D2KA 1NP0A 1EH9A 2V3GA 2E4TA 1G5AA 2J4GA 1C8YA 2YA1A 2F61A 4PN2A 3NCOA 5GNXA 1UZ4A 3OA5A 1UWUA 2WPGA 3KL0A 1B3ZA 3SCRA 3RM9A 3W53A 3S6TA 1VFFA 3SCOA 2FGZA 2WHKA 1QBAA 3AIEA 1H0GA 2WZIA 1JZ4A 5E0CA 1UWRA 3T0BA 1IV8A 2TAAA 3O6AA 1QW9A 1KCKA 3UEQA 3DECA 3CHCA 1MQPA 1XH2A 3KZSA 1JZ3A 2CHNA 1OWQA 3RM4A 3WMSA 1FP8A 3CH9A 2XSAA 1E1EA 1JI2A 4UQCA 4D1IA 2PC8A 3PZUA 3WKZA 3T08A 2YLLA 3SIMA 1V3JA 4PMUA 2G41A 4D1JA 1LL4A 1E4IA 2O9PA 4MDOA 2J8GA 2DGAA 2CKSA 1MW3A 4CN6A 1W2PA 4PMXA 1K6AA 4DUXA 2J62A 3GNPA 3MUIA 3VIJA 2WWDA 3EDFA 3VVGA 4PMYA 2VCCA 7CGTA 1VRXA 4UOJA 4BQ2A 5E9AA 4V28A 2CBIA 4WKHA 4HOWA 4JFWA 1JDDA 3BMVA 4CCCA 3UG3A 4AZHA 3OLDA 1CLVA 1MQRA 4F9JA 2W67A 5M17A 5I6SA 2GJXA 1GHSA 3BAKA 4UZUA 2DSZA 1R7AA 4P7LA 2X05A 1FA2A 2WVSA 5BXRA 1W1TA 2CKRA 5FIPA 2WBGA 1XRVA 4PTVA 4PRWA 1O7AA 1E40A 1E6NA 3AI0A 1EOMA 1L8NA 1QBBA 2J7FA 1JZ5A 2VJXA 1QVBA 3WH5A 4Q22A 3AMLA 1BGAA 4JIEA 4CD4A 2WXDM 1C93A 2YLAA 1PZ2A 4H7VA 2G3MA 3IANA 5LYRA 4GI6A 4U2ZA 3VIHA 1H09A 4OBSA 2JE8A 3L2MA 2YDRA 3AHXA 3ZT7A 4ATDA 1BQCA 5ECUA 1X6LA 3OBAA 1V3MA 1CEOA 2UY3A 4DWSD 3GYCA 5CGTA 3NJ3A 1GQJA 1CIUA 1PZ3A 3DYMA 1TCMA 5I79A 4QDMA 5HDRA 4HOXA 2BHZA 1IZKA 2WMKA 2WVTA 4U5IA 1J0HA 1ITCA 1OT1A 4BQ4A 4DWSB 4AISA 2AMGA 4RL3A 1GOMA 2D22A 5GNZA 1W1PA 4P8UA 3VGEA 2WLZA 2E0PA 2PBGA 1KWKA 2WKGA 3WDQA 3VM7A 3BGAA 4H41A 1QI2A 3WH6A 2EJ1A 4B9YA 4ACZB 2PWDA 1JIBA 1JF5A 2A3EA 4FLRA 1G9HA 2VI0A 4M1RA 3GXMA 4WKFA 5BXSA 4F66A 3T0AA 4H2CA 3CUIA 3CZGA 4AZ5A 2G4FA 3EDDA 4F8XA 4AD1A 3WUGA 1JDCA 2WSPA 2ZXAA 3AQUA 1A3HA 3VD7A 2EPLX 1Q6CA 2QHAA 3DHUA 2Y8VA 5BRPA 3BAXA 4ML4A 1W2VA 1LL6A 4AMCA 3WUBA 1OD0A 2QPSA 3L4ZA 3N1AA 5CPTA 5A6LA 4LX4A 1WDQA 1FH8A 2FHCA 3VNYA 3VIIA 5E70A 3VX1A 3W81A 2XPKA 3AMKA 2WCAA 3CLWA 3MMDA 1EDQA 2GK1A 1LQ0A 2YL8A 4WKAA 2XSBA 3NDZA 2V5DA 1DWFM 5JBFA 1JZ8A 1XSIA 4E4PA 1B31A 1E6XM 2ZXDA 1UKSA 4A3YA 3OGVA 1D7FA 1PIFA 5LA0A 5I78A 3WEOA 1HX0A 3MSDA 2NT0A 4HMDA 4OKDA 1US2A 1XC6A 2HISA 1HKKA 1E15A 1EIBA 3EDKA 3VO0A 3DHPA 1QI4A 2J7EA 2J7HA 4H8UA 1GONA 1BPLB 3WBEA 3IJ8A 1W1VA 3T2PA 3WD3A 1OGGA 5C70A 2OWXA 3VGBA 2J75A 4J3UA 3ARPA 4U5KA 2GFTA 1D3CA 4A3HA 1OT2A 4WLCA 4HPGA 4PEEA 2J7DA 3VDBA 3B8SA 4A4AA 1GPFA 2BY2A 1E4MM 1MQQA 3SCQA 5F7UA 5A3HA 3T09A 1HJQA 1PIGA 1XCXA 3IAQA 2J25A 2PWGA 1G94A 4MTVA 5AYBA 4GQQA 3CZLA 3WH8A 4NSBA 2ZX5A 1PX8A 3W38A 2VCBA 4AWEA 4WJXA 5CSUA 3N11A 2G8ZA 3OGSA 4QLJA 1YQ2A 2VVSA 4M81A 5HOSA 1C90A 1M04A 3W26A 4B3LA 2PWHA 4HA3A 5TD4A 2J74A 1ZS2A 3AYRA 1TA3A 2UY4A 5M3WA 4HU8A 5HNNA 1U30A 4AEEA 1UR8A 2ZX9A 5EB8A 4W7VA 4QFUA 3WDHA 4PMVA 1EDTA 2BFGA 4FK9A 1CENA 2WB5A 4M8UA 2B31A 4IISA 1WNOA 4D6HA 3HMCA 3II1A 3ZSTA 4GIAA 5M03A 3BC9A 1WKYA 2W66A 4PSPA 4R5EA 2X1IA 4CD5A 4TTGA 3WH9A 1JF6A 2D0HA 4CGTA 1GOWA 3GNRA 5C8BB 1UH3A 2A3AA 3WSUA 5CSYA 3W37A 3VU2A 3W6MA 1BYAA 4R27A 2GDUA 1V02A 2YOCA 4CN1A 2BVYA 4UOZA 3CMJA 1H41A 1W91A 3VILA 1JZ6A 3SUTA 3BAYA 3PTKA 3FN9A 4OIFA 3MSGA 1CZ1A 1ODZA 3W27A 4AC1X 1B3YA 3B9EA 4MADA 3ARXA 5JUVA 1V02E 3WDJA 4MNKA 3VIFA 1GJWA 2ZOXA 4GI9A 2WCGA 5E6YA 3SUVA 5A6BA 1V6YA 5DMYA 4LYRA 4MJ2A 3BAJA 4PCTA 4UZSA 4HTYA 3U7VA 4ATWA 5IDIA 3CHDA 4D6JA 1UR9A 3DYPA 2WBKA 3WF1A 1FOBA 1EGZA 4UQDA 1RP8A 1DHKA 4D72A 3AZSA 1V0NA 2WYSA 3M7SA 3WEMA 3ZO9A 4P7RA 3ARVA 4CD7A 5HBFA 2YDSA 5A94A 1BHGA 1UA3A 1V0KA 2CITA 1K9EA 5AY7A 1JYXA 1QHPA 2C0HA 4W8LA 4DM2A 3GBEA 1EXPA 1HP4A 3AXXA 3WF0A 2EPOA 2VTFA 2VZUA 4DUWA 4W86A 4P7QA 1OIFA 1E3ZA 1YHTA 2RGMA 5EFFA 3GNOA 5GQBA 2J8FA 3W0KA 4C7FA 4HZ7A 3IK2A 4FLQA 3WIJA 2J47A 1U33A 3CUFA 1RD6A 3OZPA 1HT6A 5A8OA 1UWSA 2XVLA 4Z2HA 1VAHA 2CBUA 4OBRA 2Y2WA 1ISYA 3ZR5A 1E70M 3I3BA 3BCDA 3ARZA 4GZEA 1E4LA 4JFUA 1OD8A 1FHDA 2YDQA 1JYWA 1VFOA 3AIBA 2DSVA 4Z2IA 1AQMA 2WHLA 3QGVA 3ARYA 2WVVA 3CUGA 2ZX8A 3PTQA 4W87A 1A47A 4CU6A 1DWGM 4MNJA 1NWTA 4MAVA 3ALGA 3VMPA 3W82A 4J3TA 1H11A 4ATLA 3AXHA 3VTRA 2WZEA 1HJUA 2VVNA 4H8HA 2GK1B 3CUJA 3VD4A 1XYFA 3EBVA 2OWCA 1CGUA 2YBTA 3PHAA 4XZBA 4GZJA 4W8AA 4KWUA 4NZCA 4M24A 4HMCA 3SCNA 1VEPA 4JFSA 4YHEA 3QR3A 1CPUA 3SCTA 1GUVA 1XD0A 3AS3A 3VIMA 4BF7A 2ZX7A 2OYLA 1W1YA 3VDAA 5I5RA 4DM1A 1I1WA 3NYDA 4AIOA 1E9LA 1UYQA 4H8VA 4ACYA 1CXLA 2YJQA 2VURA 2CXGA 1B3WA 2EPNA 4U3CA 2XWEA 4LYPA 1OINA 4D6IA 5ABFA 4BA0A 1GVIA 4QLLA 5JIWA 1UD5A 2DSUA 1CXHA 2GUYA 1C92A 1V08A 4EAMA 4LYQA 3JUGA
chains in the Genus database with same CATH superfamily
1HVXA 5J8LA 3CMFA 1MNZA 1QO2A 2FFIA 1M7XA 1A5LC 3DKLA 4WSJA 1TPVA 5G2HA 3EWDA 3E6EA 2XN1A 5CZJA 4Z17A 1LWIA 1V6XA 4X2RA 2FTPA 3KL5A 4FR6A 5FF2A 5IHSA 4L65A 2OVLA 1MEHA 1FWFC 1KGWA 1XPGA 2PMQA 2ZUSA 1UCWA 2GGEA 4JFVA 2J27A 4OU1A 4TMBA 3SN0A 2R1KA 3M16A 1SVDA 1G01A 4BY3A 4H6EA 2VC9A 3U4AA 4O18A 2J6VA 5MF5A 4CNUA 2FZBA 5F4WA 2XGBA 3RMJA 1KTNA 4J27A 4FNUA 5EFDA 3B8DA 1JAEA 1UOZA 3U9IA 3EOLA 5CBBA 8XIMA 2PDHA 1XCWA 1Q65A 4LCQA 1MW1A 3UBPC 3NO1A 3MJMA 3LCIA 3C86A 4DYEA 1AMYA 2NV2A 4L6OA 3LNMA 4YYCA 1M6JA 5HPCA 1RY0A 3UZXA 2HXTA 4KWSA 2INFA 4U3AA 1TWDA 1A0CA 4IICA 4C6NA 2DZUA 2WSYA 1FKXA 3E1F1 4FNRA 2Y88A 3LMZA 4JKLA 1M01A 1TO3A 1UR1A 4OTKA 1M65A 2Z6JA 3WMLA 2F38A 2XIIA 3WNMA 1EHAA 3SY1A 3R43A 1H2JA 2X1RA 1I0DA 1EFZA 4WUIA 4AY8A 1VFMA 1QNPA 1UD2A 4GC3A 4RUBA 3E0WA 3OLIA 2VEMA 4Y8EA 4FZIA 4EPKA 1XLDA 1KLZA 2VYOA 4RE2A 4XWUA 3HU7A 3QSRA 1JNEA 3UPBA 1Q2RA 3KWXA 2PBOA 5DFAA 2BOGX 2B7OA 2BGNE 3KRUA 1VEOA 3GU2A 3W24A 1JDFA 2TSYA 1ESWA 5D2YA 3QHNA 1A0DA 1N8IA 1R3VA 1V6WA 3IRDA 3GC5A 4N9DA 5CPNA 4PE8A 2PDUA 3HURA 1LG1A 1CWYA 5BNKA 1J10A 2BLEA 1TV7A 3QOKA 4PTXA 1TWZA 4GUJA 1NDZA 2J9XA 4K3ZA 1KTBA 4C7DA 1P6CA 3S5SA 2E1WA 1WBHA 1D3GA 5LNVA 1PKYA 3PTMA 3HG5A 3L23A 1S38A 1H7NA 3URBA 4G7FA 3WLOA 4O13A 3UWWA 4GYPC 2WV8A 3FJLA 1C29A 3PZGA 3TN3A 3A13A 2NQ9A 2BHUA 2JFEX 2YCEA 1PPIA 3NYZA 4REQA 4C1NA 4MB1A 3QW3A 2IPWA 3MV11 3EKGA 3B06A 4TO8A 5B80A 1W8GA 3NQBA 3FXYA 2KAUC 3C0JA 3O8AA 3UWUA 1NWSA 2YA2A 4ZXLA 3AYTA 1VFLA 5BROA 3CYJA 1NOFA 1RJQA 3E3HA 5DQPA 3NSXA 3CQHA 1ZCCA 1EBHA 1PVNA 4KFPA 5A2AA 1XLFA 4H7CA 1QI3A 2G3FA 3I6TA 5DY3A 1ZU8A 3CHFA 3WLMA 1KKOA 1J0JA 3D5HA 1N8WA 5GJPA 5H1WA 4TVDA 1WDRA 1UJQA 3LGGA 1W3KA 1EGVA 5T8GA 3ABQA 4C91A 2I1OA 4TV6A 1FTXA 3VC5A 2IXVA 4NJHA 2W27A 1UR4A 1SJCA 3O6CA 3URAA 4Y7EA 3M0VA 4MNLA 3DKJA 3HGSA 4GVHA 2CZEA 2Z7KA 3VGGA 4RNFA 3PBUA 3CEUA 3GG7A 5E6ZA 4RK8A 3PN8A 2DSKA 2QCMA 4JL2A 4LVFA 4PUKA 3JRKA 4ZO8A 2JGYA 3CQKA 1VCVA 2GZXA 1O4UA 1S39A 2NXIA 2ZKMX 1YRRA 3AALA 2GGHA 1O5KA 5J5RA 3MP3A 1YEYA 1VENA 2PRMA 1XLEA 3N15A 2GJNA 4JQ4A 3RILA 3EDJA 1AW1A 4MB4A 2DEPA 2O9RA 3GXFA 4CCEA 1M5WA 3BXWA 3S2LA 1NP2A 3LPGA 4U28A 1V3HA 3WH7A 1KQZA 4F48A 3WO8A 1EYWA 4PCNA 4XSMA 4D9PA 2PZ0A 5ENLA 3EMCA 4IQDA 1R38A 1Z32X 1SZGA 1Q4NX 1OCQA 3IV8A 3ABOA 3QR1A 2VX7A 5CG7A 2DW6A 2HBVA 4HKPA 3S2MA 5GPRA 2EO7A 2DQXA 2G96A 1LLOA 2OYKA 1WE5A 1VH7A 1UC4A 1XUZA 1QU4A 2PI6A 4AW7A 4BZYA 1W8SA 5E9XA 3KVLA 1Y8BA 4LQ1A 4Y2WA 4J9JA 4K8GA 1GGOA 4QR6A 3BUVA 3W25A 4QLKA 3IVUA 5C2GA 4ZCWA 2E77A 4B3ZA 4TMCA 3SAZA 1JZ2A 2Q3OA 1AW5A 3OTRA 1WB0A 4KESA 4A3RA 3T40A 3QGKC 4GRSA 3TLQA 3H21A 2UWFA 3M44A 4UTHA 3ENLA 1DXFA 3UERA 3LPPA 3O1NA 1L6WA 2A5HA 1Q5MA 4FXFA 1VCGA 3DCPA 4AEFA 3IJIA 5BZAA 1FWGC 2JIEA 4GWEA 1VJSA 3TYUA 1DVJA 1TG7A 4M3PA 3WQFA 3QLDA 2O0TA 2TYSA 3H4WA 1I2RA 3UCCA 2NQLA 3HPXA 4UR8A 4IIGA 4W5UA 1TELA 1E5JA 3IJ9A 1EQCA 4JIPA 4OJYA 1S5MA 2E67A 1W5MA 5FJIA 5DCBA 3GBDA 4GFSA 4AUBA 3W7RA 4C6DA 4ZQPA 3TZNA 3E0VA 3LBOA 4IX2A 1ECQA 1OFEA 3FSUA 2G0WA 3Q67A 4LU0A 2V68A 5CXPA 2P10A 3WQ5A 4DEFA 3BLOA 2VRJA 4PUMA 1KCLA 2Y5EA 1GVYA 1E72M 1TPDA 4PTMA 1XYZA 4B5TA 4O0QA 2WVUA 1POJA 3N3TA 4W5ZA 5HA7A 3THCA 2V5CA 2D69A 3R4IA 1O1ZA 2H90A 2P5NA 4GKLA 4UNKA 4MOZA 5M5DA 1NDYA 1TZ7A 3A22A 2IKIA 4HCDA 2Y6ZA 1FY6A 1LG2A 1R85A 2R1MA 2OT1A 4TTUA 4P8VA 2NVDA 3M0MA 4LRTA 2Q02A 1NWUA 3GTFA 3A3WA 1P1MA 3VGFA 4LXFA 2MANA 1QPOA 1E73M 2DUZA 4LC8A 1ZP3A 4GBDA 4LVAA 3GC2A 4UFJA 4M5PA 3M41A 4AIEA 2NVAA 4S3GA 2QW5A 4E38A 3W1LA 1UPPA 1FWNA 1J18A 4TX8A 3SIZA 2ZQ0A 1FWEC 2PWUA 1B0IA 2W62A 1XDMA 1ONEA 3FEQA 3H54A 1RK6A 3CV6A 2NX9A 4L7ZA 2FH6A 2P8CA 4W89A 5M1TA 4Z1BA 2J9ZA 4AHOA 2F2HA 8CGTA 4GE8A 2JQXA 5DT5A 2C7FA 4QBXA 4JTDA 1H0IA 3NUKA 2OX4A 3AMDA 4ILSA 1S1RA 9RUBA 1Q13A 1PSCA 4HPNA 1QMLA 5TBOA 4S23A 3U57A 4XO7A 1Q7ZA 1BLIA 3L66A 3VOGA 3BV7A 5HJYA 3BLLA 2WKLA 3VPLA 2Y1HA 3GNNA 3PJWA 1YBQB 3CIWA 1QW8A 3IS4A 3POCA 4FIQA 4BCEA 3MMTA 4E3TA 1CGXA 1K4GA 1OF6A 4JHZA 1E9YB 2F7FA 1FCQA 2ZWZA 2E5BA 1QOQA 4NZ4A 2C0AA 1OFRA 3BK0A 3S1WA 1XFBA 3QOMA 3LTYA 2J8TA 5CG0A 1Z44A 1GVEA 1V3IA 4ZVJA 4PMJA 1FUYA 4BI7A 1TJPA 1MXSA 4CU8A 1A5NC 1CYGA 3JW7A 4BHYA 2SFPA 2VX4A 2VP8A 2ZCGA 3O2LA 5HR6A 1GVFA 3KOXA 2WKJA 1WUFA 2G3JA 3BLIA 3TA6A 3UYIA 1J6OA 1WUEA 4LB4A 1ONWA 3GWQA 1VD6A 2VM8A 3WFAA 4AWSA 1K8CA 1W9PA 1SMDA 3M07A 3P84A 3IGHX 3N18A 4AIBA 2EGZA 3GH4A 3PANA 7TIMA 1AW2A 1LP6A 2GJRA 1N82A 2YL5A 5LIWX 1ITXA 4IQEA 5A95A 2XDFA 1ZL1A 1POKA 3DUGA 5GNYA 3W9ZA 3PWAA 1NOUA 4Q4MA 6CGTA 2ZICA 4FO4A 4ZA0A 3R11A 3W7DA 3UT0A 1BSIA 1V51A 2BNJA 5BCAA 4J28A 3UPMA 1BVNP 4WQ6A 3G1DA 3T78A 1RJPA 3TTOA 4R7OA 4NAEA 1TVNA 3C52A 1UD3A 3QFWA 3DC8A 3NQGA 3OW1A 3I4EA 1F8MA 4IM4A 4H9XA 1F6YA 2O9TA 2Z4GA 3WBXA 3TQ0A 2PDBA 4KBXA 3KS6A 1UH2A 4UTWC 3TAOA 1JGIA 4JN6A 4AF0B 2V69A 4DN1A 4PUWA 3FAXA 4UTFA 3RGTA 4CCDA 2P0IA 3WLQA 1X6NA 2ZXBA 2DIJA 3EDEA 2Q8LA 3WK1A 1XISA 1XFCA 4DJDA 3RPMA 2VR2A 4M7SA 2XIQA 2PWFA 1EB3A 3F2BA 1YDNA 2YB4A 5H8UA 4GKTA 1OVDA 1X97A 3MHGA 2PLKA 3UWVA 3R8GA 1E4NA 4I8YA 2EEXA 3M0LA 5E0FA 3TR2A 4LAKA 1L0PA 5CZKA 1G4SA 4X22A 5I7GA 5I03A 4JHMA 4LUSB 4HSNA 1KBJA 3QGAC 3O16A 5AVHA 4JL1A 3LBMA 4JIRA 5IHRA 2BXVA 5F2MA 1I9CB 1JCXA 1K3UA 4ENLA 5JU6A 2CLIA 2ZX6A 1XYAA 4A29A 2YXGA 3UQNA 4OBTA 3GRIA 4B9ZA 1K70A 4L5ZA 1TQXA 1TE1A 1HJSA 2XHYA 1C91A 4UQBA 3FSTA 4Q33A 1UG6A 1PWMA 1WAWA 3IACA 4ML9A 1UUMA 2ZA3A 1Y5XA 2V63A 3TYEA 3D47A 1FKWA 3BWWA 3VUPA 3FYYA 3QHOA 4Z08A 4IIDA 4LB3A 4NP7A 3WLHA 4O11A 4W8BA 4A05A 2PODA 3V3WA 3KBSA 1XRSA 2I16A 1HUVA 5HMDA 5CZ0A 4KPLA 1BYDA 1XR2A 5A2CA 3NPUA 5HQLA 5D9PA 3EWUA 2NQHA 7ODCA 3GTNA 3H4GA 3WBAA 3P62A 1JGMA 3N9KA 3E96A 3IGSA 2VL4A 1B4KA 3YPIA 3C4UA 3I4KA 1TTIA 4JHOA 4QEEA 4G2DA 2JEPA 3M5YA 1H7RA 3MZNA 4U33A 5FF7A 4NYUA 2HROA 3FKRA 2PDGA 2A79A 2HK0A 5A6KA 3OJGA 3VKJA 3LPFA 4MDPA 3ZMRA 1B1YA 2AOSA 2DH3A 3MU7A 1NQ6A 2Z24A 3AIVA 2HMCA 3MDWA 1MW2A 3FAWA 2FB3A 1P48A 1M7PA 3STPA 1O12A 4FXRA 4IL0A 4C7GA 3LZ3A 4WSKA 4EOUA 1OJXA 3WD0A 2VGFA 4G9PA 2WHMA 4H9UA 6TIMA 1ITUA 1G69A 1TWSA 4AYSA 4ZE4A 1EP3A 3P0XA 2UY5A 2FQIA 4GJJA 4L1XA 4M19A 4ZOAA 1F3XA 2VRKA 3Q58A 1HKVA 4AIUA 1TPC1 3V36A 3KBWA 4Q8PA 4H04A 4S2BA 4QG6A 4X2PA 1TMLA 2TMDA 4GK8A 5I3FA 3EB2A 3RFAA 2DJXA 3GDKA 2FDSA 1FHUA 5KZ6A 1Y7VA 3T42A 1R3WA 1A3WA 1W17A 3R94A 3DH7A 1NOWA 3AMGA 1E0VA 4JQAA 1W1ZA 5HNTA 3STEA 2NXGA 3HV9A 4S1FA 3PZNA 2J77A 1WYIA 1NM9A 4YJ5A 4DJDD 5JXQA 4NZ1A 2DUAA 2DVTA 1OFDA 4HP5A 1QNSA 4Q4QA 1MXGA 4B3KA 2EKGA 1CCWB 3H8AA 3RO6A 1XV8A 2QCDB 4DWSC 3S6OA 3W7JA 1DXEA 4Z42C 2QCFA 2GPTA 1GK8A 2G4JA 1ITQA 3BMWA 2WMHA 4XISA 5XINA 3E5PA 1GOIA 1RAKA 3NAVA 1KXTA 4FLSA 2EPMX 2O55A 1WDSA 2WJFA 4YTTA 5EBAA 1XJBA 1SMAA 1PIIA 4RKAA 3E74A 5F4SA 1UR0A 3WNLA 4CQAA 5D09A 1SW0A 1QFEA 4XK2A 5KINA 1H3GA 3UXIA 3VAVA 4MG4A 1O95A 3TIMA 1UP2A 4JTIA 3AOFA 1UKTA 3MBFA 4GY1A 4C6JA 3BJTA 1S2WA 3G1FA 4DPQA 3S0CA 3BSMA 5HK4A 1S2VA 2CXEA 3D3FA 3LI1A 1CT5A 2F61A 4PN2A 4F2TA 4Z0JA 5GNXA 3VCNA 3OA5A 3ZWSA 3KL0A 4ZOBA 5K7JA 3DGRA 4MWAE 4PGLA 1B3ZA 3SCRA 3PTDA 3UCDA 5F2LA 1UB3A 1JZ4A 2VFHA 3G2GA 2ZDRA 4QAIA 4B91A 3U2CA 2PLMA 1SJBA 2QVNA 1JZ3A 5CC5A 3ONCA 2CHNA 3RM4A 1XLGA 3R0UA 3W2KA 3VNMA 2ISDA 2XSAA 4FF7A 3G0XA 1JI2A 4Y9OA 2PC8A 3PZUA 4F3HA 5G2IA 4GABA 3SM0A 4IFRA 3T08A 2YLLA 4FNQA 2IQ0A 2ACRA 1T40A 1JCYA 2ZTKA 4D1JA 3ORWA 1LL4A 2O9PA 4N9EA 3MP4A 2DGAA 3RYSA 1XYBA 4MWAC 5AB3A 2CKSA 3KS5A 4I9TA 3L67A 3WCZA 4DBSA 3L65A 4FX6M 1JPDX 3EDFA 1VPXA 3GSMA 4UOJA 3ID7A 2EG8A 5D37A 4HOWA 4UTTA 1GZGA 1QWKA 3I7RA 4DY1A 2FMNA 2W67A 2X30A 1R7AA 2WVSA 1P1XA 1XRVA 4DLMA 3OOQA 1SZEA 5EMKA 1JQVA 1QBBA 2J7FA 5FSDC 1Q66A 4K37A 1ZUAX 3EOUA 1QVBA 3LCWA 1P7TB 4JIEA 1IE7C 2WXDM 2YDAA 4KEZA 1C93A 4G1NA 1PZ2A 3NXFA 4KETA 3VIHA 4Q8QA 4OBSA 4A2SA 3VNLA 3B03A 3WLNA 4ATDA 1DJQA 4HNOA 1V3MA 5CGTA 4LVDA 1TYGA 4BI6A 1IXNA 3VZXA 4B5XA 5I79A 1IQ8A 4QDMA 5EA9A 4A22A 2CLMA 3THUA 7REQB 4AWUA 3OQ8A 4DZAA 1OT1A 3AO0A 5AECA 4BQ4A 1T96A 3QKZA 2NWRA 1SFLA 1EP2A 1XIEA 2E28A 3WX7A 2NQZA 1P0BA 3BGAA 2O4MA 5LGXA 4QQ3A 1QI2A 3NO5A 2EJ1A 3MYPA 1Q6OA 3NM3A 2PWDA 1YLVA 1JIBA 2A3EA 1TPEA 1SM9A 2C71A 4XD4A 2VI0A 3IVSA 2VC7A 4MY8A 4KF1A 4F66A 3L5AA 1JRBA 1SZFA 4ERAA 1XBZA 3F2CA 1V77A 1LORA 2OTDA 2WSPA 1Q6CA 5BRPA 1ZAJA 1LL6A 3WUBA 2CLHA 3CPGA 5CPTA 1F2JA 5A6LA 3ITGA 2E6YA 1W5QA 1KM4A 2HK1A 2AGKA 2YB1A 5TF0A 4C6OA 1P43A 1XBVA 5E93A 4ROQA 3BJSA 1VR6A 2MNRA 3VKAA 3TDFA 2GK1A 3B40A 5L6UA 1LQ0A 3W2UA 1XIHA 3STFA 4A2RA 4O1AA 3QTPA 4GIRA 1BWKA 1DWFM 1LQ2A 1XSIA 4E4PA 3G1VA 1UKSA 4A3YA 4DJEA 1NVMA 1F6PA 4X3ZA 4YYFA 2PCEA 4CNPA 2A6NA 4PR4A 2HISA 5FEPA 5G5IA 3FJ4A 3DBPA 2J7HA 3IJ8A 1RCQA 1W1VA 3N73A 4S38A 3WD3A 3C2RA 2J75A 1Q8JA 2ISSA 2RDWA 3ARPA 2GFTA 2X40A 1OT2A 1P0EA 4GMEA 4AQLA 3CAKA 3LS9A 3B8SA 4QNWA 4Q7BA 2WJDA 3GIYA 4EP8C 2OPJA 1HJQA 1KM2A 2WNQA 1LTDA 2BZNA 4H9TA 3CZLA 2ZX5A 1H50A 1O68A 2X0SA 4WJXA 5CSUA 3N3MA 3L5MA 3KZPA 1XM3A 2ZRVA 4X60A 4LH8A 3NA8A 2PU1A 4L1WA 5CZSA 1SFTA 4GJIA 1HG3A 3UXAA 4HA3A 4UNLA 1MUMA 4O0KA 2V5KA 1U30A 2BGQA 1UR8A 1H51A 2ZX9A 3U3HA 4I3GA 1SQ7A 3MVIA 4QFUA 4HNCA 4AX6A 1H7WA 4M8UA 3EA3A 3SW6A 2QUTA 3HMCA 1FHVA 3W00A 5TQLA 3ZSTA 2PDYA 6REQA 1Y65A 4PSPA 4NILA 5BOOA 2D0HA 3GNRA 1O60A 3BVJA 2A3AA 3MWAA 3WSUA 4ASTA 1LUCB 3GR8A 4UR7A 3VU2A 3DENA 3T0TA 1YTEA 3GDTA 3UYCA 4CN1A 5DCDA 3CMJA 1H41A 5CSRA 3GVGA 3HM7A 3VILA 3ISIX 3N2CA 4YWSA 1JZ6A 2OO0A 3PTKA 4R33A 3ARXA 3P2VA 1V02E 3WDJA 1FCUA 2I56A 4MNKA 3W86A 1RSCA 4GX9A 4QNEA 1GJWA 2EG7A 1RR2A 5CBJA 5DMYA 4RDYA 2YCJA 4LYRA 3HG4A 2BASA 4MJ2A 4PCTA 5HWMA 4H7ZA 4HTYA 4WGHA 3TJIA 2WQPA 1IYXA 2VKZG 5IDIA 5LIYX 1GW9A 2RKXA 3CHDA 3E02A 1RHCA 2IKHA 3K13A 1EGZA 4UQDA 4KCTA 2PDMA 1KCXA 3AZSA 2BTMA 3B05A 3KOZA 3LV5A 1DJZA 2PDKA 3TU9A 4DAFA 2Z29A 1V0KA 1QHPA 4W8LA 3GBEA 1EXPA 4GCXA 2GDQA 3W7HA 1FDZA 4KEVA 3BDKA 2EPOA 1F07A 5E5CA 2FTWA 2RGMA 3ERPA 2J8FA 3O05A 4HZ7A 2Z6IA 2XIOA 3WIJA 3FS2A 3W7CA 1RCOB 4OQVA 1TPWA 2C16A 3O06A 4YTRA 1S3TC 1W31A 5A8OA 1AL7A 1X8CA 1VAHA 2PPGA 4Q8NA 3TYCA 1AL8A 1ISYA 3LRMA 1FDYA 2VUNA 3I3BA 2FMOA 4QJ1A 4Z1DA 1K03A 1EJUC 2WSQA 2YDQA 1VFOA 3TOYA 2PURA 5FJOA 3DFYA 2GSHA 3EX3A 3EOOA 3ZLGA 2VD9A 1A4MA 3BGJA 3QGVA 1BWLA 1OY0A 3UWZA 1XICA 2WNNA 2ZX8A 3PTQA 4W87A 1A47A 1IWBA 4GY7A 1H11A 4HTBA 4KT2A 4DJED 3AXHA 1EJRC 3H7UA 4GISA 1HJUA 3QPZA 3VD4A 2OWCA 3EBVA 2YBTA 3B8UA 4XZBA 4GZJA 4W8AA 3USBA 2JKEA 1GG1A 1X1ZA 3P80A 3R25A 1I8JA 1C9DA 4JFSA 4YHEA 1CPUA 3OHIA 3KTSA 3UVAA 4BF7A 3KHDA 1FCBA 5EPDA 2OYLA 4Y9NA 2A0NA 3I7SA 3NL6A 1JPHA 5ABTA 3KLKA 3RPDA 1AZ2A 2CXGA 2PCQA 2VOMA 5I02A 3MW7A 2PFHA 4WGXA 4D6IA 3ES8A 4IGSA 4QLLA 2DSUA 1IXOA 3LK6A 4P5UA 4KIRA 3BLFA 4F0LA 4JIIX 4EAMA 1EUNA 1MEIA 1F3WA 1RP9A 5HATA 1OM0A 2WW5A 4O57A 3PPCA 5CLWA 4DJFA 3W6LA 3F2DA 1LWHA 4TX6A 1OK6A 4B2DA 3V16A 4XKYB 4XQ6A 5CJ5A 4WY0A 1V6TA 3WLRA 2WQDA 2ZYFA 3VOJA 3PJUA 4XVEA 3QZAA 4HHPA 4PTWA 5K4XA 5LXEA 1CGVA 2YFOA 1KTCA 2WWCA 3FLUA 3IWPA 1E6PA 1CDGA 1FWCC 1CXEA 2ZWYA 4G6CA 3QFEA 3EA2A 4LS1A 1AZ1A 4AYGA 3PJTA 4UTKA 3RM8A 1D8WA 1KW1A 3E2RA 3VE7A 4G7EB 2OX1A 5DN1A 5I24A 3AHZA 1IHIA 4XZLX 1UQZA 4DUOA 1V3KA 1JCTA 3BSGA 3UFYA 2DT1A 2XYLA 1K8YA 5EMJA 1VIWA 4FXSA 3FJNA 4M56A 3W7MA 2V8ZA 3P74A 1G4PA 2CEQA 2I9UA 1XH1A 5REQB 5C9XA 4ZQOA 4X63A 3ZOAA 3N6HA 1Z6KA 1IXPA 4NF7A 4I7UA 3RDKA 1P4CA 4C60A 5HQMA 1XSJA 3WF4A 1UZDA 5BWFA 3T8LA 4KRTA 2VZVA 4GNVA 1XF0A 5AHFA 1HO4A 2XUCA 1TV5A 3URQA 1S5VA 2INZA 3JU2A 1UBPC 5G1MA 5I3GA 3BICA 4H6RA 3DERA 3SI9A 3UJ2A 3NSNA 3QM3A 3NIYA 3RNDA 4GFIA 3GLCA 5D8WA 2HVMA 3H2OA 5E09A 1R0MA 1OFPA 1O5RA 3DI1A 3N4AA 4MFDA 1KRAC 3TLLA 3G77A 2E6DA 5HXMA 1UMLA 5CBIA 6TAAA 3WQ4A 2HTMA 4HJFA 5LIKX 3PBGA 1A5SA 1OX6A 2YZ5A 2H8ZA 4OOZA 2ZE0A 3AS2A 3POHA 1TKKA 1W0MA 4HB7A 3LPOA 4PYSA 4A21A 2HJPA 1ICPA 3L0GA 4LCSA 3WQVA 3USZA 1WKEA 4L9YA 4PULA 1DBTA 1DJXA 3TNOA 2HS8A 2D2OA 2VO5A 2TODA 1XD1A 5BMWA 1E56A 2ZTJA 1KV8A 1IT7A 3DX5A 1R6WA 1WZKA 2QV5A 1AVAA 2C1GA 1EA0A 1JFXA 1OSEA 2HEJA 4AVFA 4ZL1A 3QY6A 1MSSA 4NXKA 1WKDA 4M1BA 2W4XA 1JJKA 3KOWA 3SB0A 3MVTA 1DJHA 1EQPA 4Z2KA 5F1VA 4MIMA 3V5CA 1JL8A 2WZHA 4O1DA 4TXEA 1LBFA 2FGBA 3OZYA 3E2SA 2CU0A 2E8YA 2AL2A 4IXHA 1M03A 1ZZMA 4RZBA 2WMGA 3UVIA 4EPBC 3DYOA 1W6TA 2AQOA 2R91A 3H26A 4QISA 3T7VA 3HJEA 4EKJA 5H8PA 3SUUA 4KFOA 1I45A 1GCYA 2NW0A 5K4ZA 4IP4A 3GYEA 2VNCA 4DJFD 4HU3A 1LT7A 3KXQA 1GJPA 4MZYA 3QV7A 2Z28A 4B2DD 1LLZA 2JALA 1Q7QA 1GEQA 1GW1A 3FDGA 4JZ5A 5F2GA 3MP5A 4DBEA 2E6FA 3CYVA 4ZODA 1J2BA 1IEWA 2EPHA 4NJKA 1UROA 3DC0A 3NDYA 4F79A 3G6LA 2OQLA 2PB1A 3BURA 1ISZA 3SBFA 3HJZA 1NELA 1J9YA 1KGUA 3LM7A 1RXOB 1J0IA 1GKQA 5JMUA 4JTFA 4MHBA 2W0UA 1OCJA 4CQCA 4LRSA 1YBQA 1BXNA 1LCOA 2YBUA 4LVGA 3TXZA 1MMFA 3BE7A 3SSZA 3VNZA 1PWLA 3UGRA 2WLYA 5C9ZA 2QGHA 3M46A 4W88A 1VHCA 2RHGA 2VFEA 4C6PA 1NAL1 3VDHA 5BMXA 1UP0A 2LLEA 1M3UA 4FOKA 4HNNA 4K8EA 4KRZA 4MPKA 3G1XA 4W7WA 3C2OA 4GVGA 3FCPA 2VGGA 4YVVA 2GJXB 4ADSA 2Y8KA 4J1OA 3KLLA 3TC7A 3OHMB 1XW8A 2P53A 3P81A 3C3UA 3CLMA 2OQHA 4BEQA 4ORIA 2C79A 2Y7DA 5C9UA 3A3HA 3L4WA 4A35A 1OHLA 2GL5A 1AH0A 4O8RA 2X41A 5EMYA 1G67A 3UPWA 1CTNA 4DX3A 3GS6A 2I7GA 1E5NA 3V0SA 3GUWA 3QQ1A 2YL9A 4I9JA 1V03A 3R79A 3U5UA 3LYEA 3ABXA 1PV8A 5DXXA 1ZRQA 2C3ZA 3LCLA 4MYAA 1JCJA 3PFRA 1Q6DA 1W9XA 1TCDA 1UOKA 1K7EA 2IKJA 3L4XA 1PUDA 1U1UA 3ELFA 4GH3A 1FFRA 2G95A 4GYJA 4JTJA 1HW6A 1UWIA 3SURA 4ACZA 3ITOA 4GVIA 1SFSA 3HTWA 4JTRA 5I3DA 3KP1A 2ODOA 1XQKA 2YXXA 4LS0A 2GUUA 1UA7A 2GWGA 4WK9A 1R86A 4JTKA 3N14A 1V3LA 5EMMA 4S3CA 3VOIA 3ARWA 2Z1WA 1EA9C 4PUNA 3PZIA 1R3RA 4S3FA 4FXJA 1E55A 1IR1A 2RGLA 4NAFB 4MZ8A 1MI3A 1I75A 2X0YA 1BF2A 1E6ZA 5HPOA 4YWIA 3MA8A 3RIKA 4ZXOA 5L9FA 4N6FA 5DMNA 1S46A 2D3LA 5HJXA 1KBBA 1XSKA 4HJWA 1ZB5A 3VM5A 2Q71A 3TR9A 2XG9A 2IPFA 2Z25A 4KWWA 3G1RA 4GY0A 1E43A 4AZCB 1A5BA 4ZB5A 2OKTA 4ZSUA 4UNIA 1OZQA 1A0EA 3B4YA 3AHVA 3TN4A 4LVBA 4Q8OA 1W1A1 4E3VA 1FFQA 4LEQA 3W2NA 3RX2A 2DW7A 1FP9A 1OC7A 4IPIA 3DHFA 3TYBA 3TE9A 1XPYA 1QK0A 4UFKA 4XIAA 1B3VA 1KB3A 1PEZA 2ZZ2A 4W84A 4HN8A 1L6GA 4OECA 2HBXA 2XVGA 1VHNA 3NQFA 1QDSA 3WJXA 2VX5A 3E0FA 4LNYA 3W22A 3NSMA 1KR1A 1DYSA 1XLLA 4GI4A 1QXLA 3ARQA 4ICMA 2GGJA 3UWEA 1RQBA 1IF2A 4JX6A 1SYTA 3TWAA 4MKSA 1QT1A 1QI5A 5SWUA 3LCXA 3QPEA 4JTLA 4AD5A 4F0SA 2OWWA 1WA3A 2NQJA 1DE5A 1X1NA 4XZWA 5F2IA 1AQHA 3BZJA 1TA3B 5B7ZA 2PC4A 7PTDA 1ZJHA 5C2XA 2HRWA 2HZGA 4H9MA 1XBXA 1PE1A 9XIMA 2Y5JA 4IP7A 3TN5A 5BXTA 3H2EA 7TAAA 5HNUA 1JI1A 3IJLA 1F05A 4R85A 1PYFA 5A8QA 4PRRA 3FVMA 3CTLA 3AFBA 2C15A 1K02A 2OO6A 2DVUA 2HDJA 3A4XA 1PTAA 3ITVA 3NEVA 5AOUA 2HXUA 4ZQMA 1RALA 4HU4A 1ZTVA 2PTZA 2VT0A 4ZFMA 1JPKA 1QPNA 4C6IA 3WNPA 4ZEPA 2A1YA 3W4RA 3I65A 1KM5A 4QJ5B 5IBXC 1JEZA 1BKSA 4IIFA 2YCLA 4IT1A 4PB3A 4KIEA 5LIXX 3O6YX 3D3AA 1R3YA 3HG3A 5JBEA 3GIQA 3R89A 2I57A 3BQ6A 3V0TA 3R6IA 3UCQA 1SR0A 3PF3A 3RHGA 1Q3NA 1VFTA 2ATMA 3S2CA 5I0DA 4V15A 2AGTA 2ISWA 4YHGA 1JQXA 1ZJAA 3EXTA 3VDCA 1RPKA 3WBWA 2Y5SA 4DNMA 1HIZA 5D05A 1TMQA 4AX7A 1UQYA 3T2QA 3GH7A 4K68A 1A53A 4CKQA 4QS5A 2J6XA 4O0ZA 2F8QA 4MZ1A 3FNDA 1MVYA 1UKQA 2VZOA 1KM1A 3DFOA 3UETA 1BAGA 3IAPA 3A9IA 5D2TA 1IEXA 1H1YA 1X7FA 1C7SA 1I4NA 4ZO9A 3NFUA 2ZUMA 3ZT5A 2X1TA 2HPIA 2UY2A 4HMNA 2ZRWA 4UQAA 2ZRUA 4B5VA 2YZRA 1MFUA 2Q01A 3IK4A 5C7VA 3AXMA 4KCVA 2H9AA 1JD7A 3N6JA 1OB0A 1SO3A 2BS9A 4RDVA 2VDGA 2D3NA 3RCNA 4N42A 3PG9A 3SUSA 3EXSA 1RJRA 4OVXA 2UBPC 3EKZA 2QJMA 3NGFA 9CGTA 2BY3A 1B9ZA 1NARA 4MNMA 1HKMA 3H70A 2VOTA 4E8DA 4FB7A 2DT0A 1YE4A 3CB3A 2ZBTA 5D9NA 1WCGA 1ZFJA 3F03K 5FF4A 4UR9A 3S1XA 3ZS4A 3VD9A 3CWHA 1HVQA 4M6UA 1DIOA 1WZMA 2OELA 4JTCA 5A8MA 3UW6A 5I2UA 2WM0A 4ALDA 4IPLA 3BZGA 2Z1KA 4MB3A 2X0HA 5D8ZA 3WLKX 3PM6A 2PP3A 2NSOA 4WF7A 1LDCA 2WNWA 3P14A 4JCMA 3F4VA 1VP5A 2D0FA 3FJ6A 4WDTA 3PP7A 5H6HA 4BS0A 2XGIA 4IMDA 3UR2A 3W7KA 3HMJG 4GIYA 4LV9A 3U5YA 2ISVA 3CTTA 4NNCA 1C3FA 2ASHA 1XS2A 4ZTXA 4AZ6A 2QDDA 4F0MA 2EG6A 2FLIA 1FWHC 2CYGA 3GDMA 1ODUA 3FFSA 3PZ9A 2WM1A 5D03A 3JVAA 2WZMA 4HNLA 3W1PA 1TPUA 3AROA 3XISA 4DXKA 1JCLA 4LPCA 6ALDA 3W88A 3S4TA 4PL2A 1V8EA 4BF9A 2YBVA 4IL2A 2R24A 3V1HA 1N55A 1BG4A 1XGZA 4QJ3B 1XBYA 1HJXA 2ATSA 3KUMA 2ZE3A 4JNZA 3EX2A 2Y61A 1ICQA 2D23A 4UTLA 3KAOA 4BKNA 3UZZA 8A3HA 1G1YA 1AQ0A 3XIMA 3VIGA 4JEQA 4D6GA 1H7XA 2C14A 2FJKA 2DPEA 1VEMA 3STCA 2PGEA 4TUFA 4YPJA 4RJEA 4CVWA 1JFHA 1IXQA 3R58A 3C61A 3WQ8A 4J5NA 1YX1A 1H7PA 4QROA 1RA5A 2YIHA 1GOOA 3IUHA 3T0DA 1V6VA 2WANA 2ISFA 1KBKA 4F2BA 1S2TA 3ZLHA 1XH0A 5HMFA 1ECEA 2C19A 4C90A 1DWIM 3PULA 2EQDA 1P7TA 4KWOA 5D4YA 2YXOA 4AZBA 4B15A 4XB3A 5ABEA 2CETA 4L80A 3FGCB 3UG4A 3TP4A 3WK0A 6A3HA 3ME3A 1VLIA 4G1KA 2XH7A 3N4EA 1Q6GA 1ZJBA 3VMOA 3CO4A 4CNSA 4ZSTA 4QP0A 3PSWA 3AIUA 4YVXA 2IQDA 1OF8A 3G3DA 4BR1A 1NH6A 2Y8UA 2BXZA 1K8ZA 3SCSA 3SJ3A 5HWNA 1H5YA 4IMFA 4DXXA 2HVNA 2PS2A 5I77A 5LA2A 4CVUA 3ANUA 2ZZ5A 4P7NA 4UFHA 2XU2A 3QSTA 5EBUA 1XWYA 1EJWC 3ZZ1A 1R2SA 2WC7A 2AAMA 3ZSSA 1AD1A 3M0ZA 1KRBC 1VBHA 3EAUA 3RN6A 2GJPA 3RCYA 3LLDA 1XKYA 3C56A 2VMFA 4C65A 1HKWA 3ZM8A 4HU0A 4P61A 1EOKA 4PMOA 3CZ8A 5KSWA 1CNVA 1VBRA 2FVMA 5CPMA 1FH7A 1UWTA 1VB9A 4JIQA 5CAHA 3SRKA 4J35A 2VQUA 4HIBA 4IXXA 2JF6A 3TW9A 4LUTA 3TSDA 4TOQA 3CPUA 1H4PA 2J66A 1IR2A 3VI2A 1MWOA 2A7RA 3ZLFA 2OSWA 4BJHA 4KEMA 2W61A 3TC6A 1QPKA 3E9AA 4S3EA 3IIVA 3M6DA 1O5QA 3O9NA 5AC5A 2NQ5A 2YL6A 3PBMA 2DFAA 1CGWA 2FPVA 3ZJKA 1MNSA 5G4EA 3WD4A 5A6MA 1WXJA 3GC4A 3GXIA 3WQDA 3WD2A 2JEQA 2EKCA 3BW3A 2WMFA 5A1AA 5LA1A 4D6CA 5K2ZA 1IT0A 2J7BA 1Q63A 1GQLA 4BWLC 3N34A 4DELA 4UIOA 3GFZA 3CIVA 1EHNA 4GQRA 2P0OA 3AS1A 1LOQA 5I06A 1W3LA 2E9MA 1ELSA 4GUHA 2QUUA 5IOBA 4ICCX 4NJIA 2PAJA 1F7BA 3RAOA 1XKJA 4MPQA 2YW3A 2ZVIA 6ENLA 3MYOA 5LNUA 3EWWA 1UWUA 4XSLA 4FR1A 4NQ1A 5PTDA 3EPMA 3TJXA 1RPXA 3S6TA 1VFFA 4JQ2A 3GAKA 3T0BA 3O6AA 1KCKA 3N9SA 3PPFA 4S2CA 3UEQA 1HGWA 3DECA 3GHSA 3WQCA 3CHCA 1RQHA 1XH2A 4Q4RA 3TZFA 4E2DA 3H2FA 3U2ZA 1US0A 4C5ZA 1XIBA 1QPRA 3EX4A 2V81A 3CH9A 5DANA 2I5QA 3NVTA 1E1EA 4M6VA 1T0OA 3P67A 3UXLA 3P3BA 3WLSA 4PMUA 1T7LA 3DFTA 1Z69A 5F4XA 1IZCA 1F73A 3OU8A 1MW3A 4PMXA 3MUIA 4MY9A 1DJGA 4PMYA 1NEYA 1J2WA 2Z0IA 4F0KA 4GUGA 3OYXA 1DQWA 2CBIA 4Q3MA 3M0IA 1Y5WA 2E6AA 1PTDA 3BMVA 3C8FA 3HPAA 3I6RA 1MQRA 2AKZA 4FIRA 4UZUA 4P7LA 2X05A 5BWAA 5FIPA 4XKMA 4PRWA 2BP1A 3AAMA 3MSYA 3RLUA 2EF9A 3DAQA 3KWSA 4HPJA 3WH5A 4Q22A 3AMLA 4BEUA 4PBEA 2YLAA 4Z0SA 4K39A 3IANA 3SDOA 3N25A 4GI6A 3S5NA 1WBJA 2YDRA 3THAA 3ZT7A 3S3GA 3C2VA 3TNBA 3TROA 3UWYA 1XLBA 3OBAA 4DI9A 3P5YA 1XG4A 1V79A 1CB7B 1REQB 3VNJA 1GQJA 4PTDA 1WAUA 3FEMA 4O28A 4AHPA 1PZ3A 3CU2A 3DYMA 1FDJA 1TCMA 2OOGA 3VFCA 1FWRA 1NDWA 4XBSA 3RR4A 2BHZA 1GWJA 4U5IA 1ALDA 3GR7A 1WKFA 2GYIA 2QCLA 4G5DA 4DWSB 4AISA 3H2CA 2PSNA 4RL3A 1RBLA 5GNZA 2Z00A 5BU9A 4JGDA 3D46A 2PBGA 2R1PA 1KWKA 3B0YA 5JQ9A 2CWXA 3TCSA 1I0BA 3N9RA 1OQFA 1TJ1A 3CASA 2FZDA 3H24A 4WKFA 2JGQA 1KKRA 5BXSA 4NZ5A 4K2SA 1TIMA 3CUIA 3CZGA 4AZ5A 5HQEA 1NU5A 2ZXAA 1A3HA 1UP3A 4JY8A 2XN2A 2QHAA 4XTIA 1IWAA 4ML4A 4AMCA 5D38A 4LUJA 3TWBA 3N1AA 5I3JA 2PRLA 3T0CA 3IRSA 2FHCA 3M1ZA 4KWVA 5EL1A 5A5WA 3LCFA 1KM3A 2WCAA 1FRBA 3CLWA 3KVKA 3MMDA 4MKVA 4V1XA 3QZ6A 4MJMA 4FPSA 2QDEA 2V5DA 1D7KA 2VGBA 1UPMB 4UXDA 2ZXDA 2TRSA 3W1UA 4I9MA 3TEVA 3VCRA 1S2CA 1PIFA 1OYAA 5I78A 4QE5A 1HX0A 3MKVA 3OVPA 3VUSA 4HMDA 5B7YA 1XC6A 4US6A 3VO0A 3DHPA 4RZ6A 3WBEA 2QF7A 5K9CA 4J3UA 4U5KA 3CQ0A 1D3CA 1EGMA 2DQWA 1W37A 1YXDA 2FZ8A 1GEHA 1YKWA 3VDBA 1PKNA 2PU0A 1ZQ5A 1XCFA 4NNBA 4MWAB 2XH2A 2HNHA 1NJJA 1E4MM 1SW7A 1MQQA 3SCQA 5M2FX 2J24A 1YADA 5D04C 3T09A 1YTDA 2ZC1A 4X61A 3U48A 1XCXA 1ZLPA 2B4GA 2J25A 4XKYA 5AYBA 4YU1A 2WOQA 4GQQA 4IQLA 3UY8A 1NTHA 3W38A 3GXPA 2DZAA 2ANUA 2OODA 2HE5A 5LKYA 2D2GA 4N9CA 4IX0A 4QLJA 1RD5A 3MI2A 3IIZA 5DXYA 3VZYA 3FA4A 1CLKA 4JTUA 3QXBA 1UASA 2PWHA 4ZQRA 1KM6A 1DJYA 5TD4A 5C0QA 1DE6A 3O15A 1YNQA 4Q8MA 2ZC8A 4EX4A 1UW9A 2VWSA 4G7EA 1BSLA 4HU8A 2DZBA 2JBMA 5EB8A 3DOPA 2GGGA 3TJLA 4PMVA 4AB4A 3QV9A 1FXPA 3I10A 3CWOX 5HUOA 3TN6A 4IISA 5A8GA 2PDQA 3II1A 3EOSA 4GIAA 3K2GA 2QDHA 4R5EA 4CD5A 2CLEA 4TTGA 4H2HA 1JF6A 1EF2A 1J5TA 1UH3A 1SW3A 5H2ZA 3AWNA 3G18A 2C1HA 4TQTA 4MM1A 1IT8A 2DZPA 3P0WA 5BU6A 2GOUA 5C54A 3M43A 1IGWA 1TV3A 3GFYA 3SUTA 3MSGA 1F3EA 1B3YA 3B9EA 4MADA 5JUVA 2VHLA 3VNIA 1VYRA 3W7IA 4K7VA 4IMAA 1ME9A 3U4FA 5AZ1A 3H2AA 1LBLA 3GXTA 2ZOXA 4IIHA 3KCOA 4GI9A 3SUVA 5A6BA 1R9YA 1XDLA 2VGIA 3OVGA 3KTXA 3T1GA 4UZSA 5TAOA 4V33A 4PA8A 4ATWA 3DFPA 4UTIA 1UR9A 3ZFHA 3UZYA 1MUCA 1R5YA 5C9RA 1X8FA 4QE4A 3GX9A 4H01A 4C6KA 4D72A 3BARA 2PDIA 2WYSA 4EWJA 3ZO9A 4P7RA 3ARVA 4CD7A 2V6AA 1BHGA 3V4BA 2CITA 1K9EA 1JYXA 3AXXA 3WF0A 2AL1A 3BG9A 4DUWA 1OIFA 3CV1A 3GDLA 4RCXA 4POCA 1SUXA 3W0KA 4C7FA 4RZ5A 2E7FA 3TK7A 4FLQA 4E5TA 1VLWA 3S5OA 3M9YA 3P8JA 3R8RA 3UZJA 1E9IA 3HIJA 4Z2HA 1TIWA 3CH0A 4OBRA 4NU7A 2Y2WA 4K1GA 2X7WA 3VC6A 3ZR5A 2ZA1A 4GZEA 1UBSA 5FF3A 5I00A 1FHDA 2F6XA 3B8IA 5ECVA 4Z2IA 5AHLA 5FF0A 3H22A 2PDNA 5LSMA 3C0QA 4L61A 5FEWA 3CL8A 3B3DA 3ARYA 1WOAA 3CUGA 4GA8A 4N02A 4MAVA 3W82A 3B0VC 4J3TA 2OG9A 2D2HA 3GE7A 4ATLA 3WZ0E 5G2WA 2WZEA 4S3BA 4H8HA 2CC0A 1BXCA 1R9XA 1PKMA 2NUYA 3PHAA 2QJHA 2PDPA 4JR5A 4NZCA 4M24A 3JS3A 3L0KA 4HMCA 4J40A 3WBYA 3SCNA 1VEPA 5EU9A 3QR3A 3TUUA 1XD0A 3VIMA 4RV8A 3WQOA 2ZX7A 2NV1A 1W1YA 1BWVA 3HPSA 2IPGA 1I1WA 1E9LA 3RU6A 3CHVA 4H8VA 1TRIA 1CXLA 2YJQA 5LNSA 5CZTA 1B3WA 2EPNA 3GHTA 4DZ5A 1V7YA 4HCHA 3NQ2A 1JUBA 1Q6QA 3IVTA 3D6NA 3FDKA 3HB9A 3VKCA 4PCPA 2W5FA 3O0FA 4QCEA 5LGZA 2P88A 1FWSA 4U4MA 1QATA 1WO2A 5DEZA 4M82A 1PHWA 3S5YA 1N8FA 4OGZA 1YPXA 4HPHA 2AQWA 4IOTA 1BYCA 3UZWA 2VUYA 3THDA 3C2YA 4L4LA 1FH9A 1O1HA 1R3QA 1TQJA 5F1UA 3UD6A 4ZENA 3PR2A 1XX1A 5AVNA 1M9HA 1A5OC 3QF0A 3VE9A 1EO5A 4MJ4A 2HSAA 3LCGA 1CB2A 2O4QA 5TIMA 1OX5A 2VFIA 3W1MA 5DY2A 4IG2B 1XLAA 2G37A 4GD0A 4UFMA 2NSXA 3JZUA 1UR2A 3ONBA 1JXJA 3CNYA 2CZ5A 4PBFA 1FBAA 3CB8A 3B0PA 1W9DM 2O7QA 1UC5A 1TTQA 3QYSA 4PODA 2WJEA 1I1XA 4J4KA 4R34A 2OSXA 2VD8A 3VIOA 4B4HA 4QXIA 3F5JA 1HNYA 4GUIA 2GVYA 5KETA 2OXNA 1TVPA 2RDXA 2WMIA 3FHAA 1KWGA 1J8VA 3LI0A 5A6BD 3AJ7A 3ZJ6A 3BOLA 4JEJA 1W54A 3BSHA 1N2VA 4JS3A 4MSSA 4QAWA 3S47A 5FA5A 2G97A 3S8HA 3KOFA 1X38A 1FWBC 1TTPA 4GJ1A 3V0UA 1C8VA 4CD6A 3F1QA 3TYDA 5JBDA 4RNIA 3W2JA 1RV8A 4GYPA 3R1ZA 4HA1A 1V7AA 4IJRA 1R30A 4H9YA 1BEUA 4QDWA 1PXGA 1J11A 3L21A 3BLEA 5DF0A 3ZWTA 4IPPA 1VZWA 4MB5A 4Y8FA 4NHVA 4NNAA 1XIDA 3ITCA 3NTYA 3CBWA 3GU9A 1KFWA 3CT7A 2CESA 1GVRA 4QDPA 3MCOA 5BYWA 3R7MA 2JK2A 3KHJA 5J5DA 1H61A 2BODX 2VZTA 4K6AA 4IGMA 4LTSA 1K6WA 1V0LA 1TX2A 2PDCA 3PUGA 1MRAA 3TV8A 3KDNA 3L2IA 4GINA 3T07A 2NLYA 5GVJA 3V35A 3BGGA 1J5SA 3ICJA 4LT9A 3QC3A 1B2YA 1L2UA 1J96A 1E51A 4JYDA 2DZXA 3S2JA 5LHFA 3AHTA 4NAFA 4O14A 4Q8VA 2IUZA 4Y90A 3GD6A 1PDYA 3W1NA 2Z1BA 2PA6A 1OGSA 4PL1A 3ITXA 1NFBA 2NX1A 1NF0A 2FZNA 3QQ0A 1HKIA 3VIKA 2Y7EA 4EE9A 2V3EA 3H4XA 4D6EA 4F2UA 4URIA 1R9ZA 3DFNA 4EIVA 4AVOA 3MUZ1 3APGA 4AZCA 4WCJA 2GVEA 3PWIA 4H6KA 3KVJA 3VGHA 2OZ0A 3HQNA 3GH5A 3SQMA 2B81A 1DOSA 2Z2AA 3UJSA 4AZ7A 3NZPA 1TPB1 2DZTA 3F5KA 2BB0A 3A9BA 2P76A 1EX5A 5GJNA 1KFBA 4L4MA 4RE0A 5FAGA 2NVCA 1A50A 2WAGA 4XUYA 1PS9A 1UD8A 3CHEA 4PTNA 4CD8A 3SQSA 3GB6A 4PRTA 4PH6A 4KCUA 5K9DA 1SO6A 3EKLA 4OE7A 3R0DA 4H1ZA 3VYLA 1J6PA 4C6CA 3LD5A 4FS9A 4YXGA 3N2MA 3B9DA 1HO1A 3RCMA 4PMNA 4RR4A 4I6VA 1NFGA 4EAYA 3EXRA 1H1NA 4AEOA 4D6FA 2MUCA 4ERIA 2A3HA 5T91A 2PTDA 5EY5A 2QPXA 2ZA2A 3ZVHB 4F0RA 2VR4A 2EBNA 1XDJA 4PCSA 3U2OA 1UHVA 3PZVA 5DELA 1LOLA 1YDVA 2EXOA 2OU4A 1VJZA 3CM4A 3CUXA 4ZGYA 1JZ7A 3E12A 3TTYA 2V82A 4DF1A 2E09A 1EJXC 1TR1A 4PMQA 1IGSA 1XC4A 1K9DA 1Z9AA 3K8MA 4LUYA 1VBGA 1LLWA 4JXCA 4FAMA 3RUBL 1AA1B 1BYBA 2QIWA 1BRLB 2XINA 3ZYZA 3RLVA 2R82A 1UKPA 3WNNA 1B3OA 3UWQA 1X98A 3EMQA 5LIUX 3BAWA 1OADA 2OQYA 5CEWA 3I7QA 4IPNB 4RPPA 3QQWA 1T5AA 1UWQA 1QNOA 3SECA 3PK7A 1K9FA 1R2TA 1LRNA 5EKYA 3UNTA 3V18A 3TXVA 3WLIA 1JYNA 2OYMA 3WK3A 1WPCA 3HFTA 1QHZA 3KRBA 4S3KA 3BAIA 3K4AA 1W3HA 2PF0A 4DO7A 4AD2A 3GZAA 3LERA 4IUGA 2DZWA 2ACQA 3MTWA 5MKGA 5D9MA 2H3DA 4P2VA 1E6SM 1KXVA 1WZLA 1E1FA 4ES4A 1JVNA 2ZUTA 4I5UA 1B90A 1DHPA 2V2DA 2A7NA 4PUEA 5U4NA 1L2QA 4I7VA 2X8RA 2L5HA 3PZTA 1W9VA 3GNDA 3EZ4A 3UXDA 4MMWA 4XZHA 1PCKA 3DIPA 3GG0A 4NRRA 5HJLA 2OT0A 3VA8A 4O4VA 4NI8A 1Q45A 3WL0A 5HMSA 1NF7A 2CW6A 3G22A 4Y9MA 4CN4A 3QTGA 3QMSA 4M6PA 3O7UA 1SFJA 1OYCA 1NY1A 4JQ1A 3A3XA 4LEFA 4WOQA 1KFJA 3IEBA 2DY3A 5A6AA 5D02A 1E0XA 3HG2A 4KH2A 4AHQA 2DP3A 2WK2A 1X39A 4GUFA 3SR7A 3GNXA 3UP8A 1OIMA 4JICA 4QG9A 3G1AA 1OYBA 3MUCA 2EHHA 2PGRA 3WFLA 3GTXA 4DVOA 2YSWA 5C2CA 3DG7A 3GU1A 4GG9A 2J13A 2D73A 4CEXC 4NG3A 3NQVA 1HJWA 3WY1A 1HP5A 3C6CA 1XYCA 2PTWA 4J2MA 1EJ7L 1BVZA 2FB2A 3LHUA 4HNTA 4IFOA 2REQB 2A21A 1DWHM 1AFSA 4H9VA 2XVNA 5FJTA 3THQA 1TE6A 2QV4A 3QMRA 3AUJA 1ME8A 3LZ5A 1R2RA 4NX0A 5DRIA 5I09A 4P8WA 1D9EA 2VWTA 1KCZA 2BVDA 4DXVA 1EC9A 2OFJA 3KL3A 1KRMA 1Q85A 3VMNA 4M6QA 3W73A 1YW1A 1A3XA 3EWXA 5K9XA 3KE0A 1A80A 4RW5A 2BBFA 3UESA 1KR0A 1GJUA 2HS6A 5CJMA 3OQEA 4OV9A 4LNCA 3TQVA 1B3XA 5CPSA 1XIIA 3H23A 5AHMA 4PC8A 2YKKA 4YN5A 5LZLA 2HPMA 3LRLA 3WMBA 1VKFA 1W5NA 3DGBA 3AHYA 2QYGA 3AISA 3T9PA 3T44A 3G24A 3HPZA 5EMLA 3FYPA 1O94A 1PDZA 3FY1A 2F6KA 3CQIA 4JBRA 3WDRA 5FAJA 2FKPA 3IARA 2VQTA 1DWJM 4GH1A 1M7JA 2CLKA 3PBWA 1H63A 4GZ7A 3WMCA 2D24A 1XG3A 4ZE5A 2DH2A 3P7YA 5FOOA 1TJ0A 3C2EA 3GTIA 1J0YA 1RLDA 3MMUA 3IGXA 1SJDA 2P3ZA 4I5RA 3AYSA 2W9MA 4NYYA 3VD5A 4WR3A 4Z2LA 1ZBCA 1MYRA 3K4WA 1JD9A 1TV2A 3TOPA 1GOQA 2VEKA 4GXPA 2TPSA 1LF1A 3UA3A 6REQB 1KXQA 3ZJ8A 2CLFA 3L68A 1TVLA 2DT2A 2PDWA 1V0MA 3PG8A 4DIAA 3LN3A 3SFKA 2VRQA 1SO4A 2X16A 2PWEA 3AS0A 2W92A 2OOFA 2GJLA 2E9BA 2XIJA 3FGCA 3GZ3A 1EP1A 3PC0A 3M7WA 2QCEA 2IKGA 1AH4A 2FH8A 3NZGA 1DP0A 3W85A 4GNJA 2D20A 2NT1A 1V4YA 2JF7A 4UTWA 2GDVA 3TFCA 3PNUA 2ZADA 4FOJA 2A3BA 4DRSA 1EBGA 4LJ3A 4RX0A 4AD0A 9XIAA 2XFYA 5FKYA 4E2VA 3MBDA 4QRNA 4UTJA 3MMWA 3B9AA 3CWNA 2HWGA 4K38A 4A8NA 1DJIA 5U7SA 2XIMA 4UWMA 1LL7A 1HFBA 1E3XA 4MFEA 4WZHA 2X7VA 4YLWA 2OZ8A 3KRZA 3E0LA 3M4HA 4UCGA 1Q2SA 2CZFA 1OFQA 1FWDC 1MUWA 4JFTA 3M5XA 3MCNA 3RLHA 2J9YA 3RR1A 5XIAA 4HCLA 4W93A 2GVGA 4GQGA 1DJNA 1XIFA 2CHRA 1JXKA 2WCSA 3A21A 3O3RA 4ZQNA 4GYFA 4Q4OA 1ADOA 3LNPA 3U8GA 2QPUA 1UMYA 4WDWA 5CGQA 4U31A 3N19B 3UXKA 2YCIX 1DTNA 1TWWA 4O8AA 2BG5A 4MYXA 5FL1A 1W3JA 2XM2A 1BFNA 3W71A 2B7QA 2DUXA 4C1KA 5I3IA 4QE1A 5A8PA 4LOCA 4UBPC 3SRDA 3R8HA 5IM51 5A8NA 4IFKA 1RUSA 4PUJA 2Z1SA 1IEQA 3QKEA 4FNTA 3OYZA 1QOPA 3G3MA 4ZBCA 4ZQCA 1JDAA 4ZZ9A 3PAJA 3FVDA 3SQLA 3PBYA 3BH4A 3WQGA 2X2YA 4K7YA 5C9WA 3AXIA 4QS6A 2CZDA 1XGDA 3KFTA 1JNDA 3TYZA 4CQBA 4WJ8A 2HV5A 1E6RA 3ABSA 1LYXA 5IFTA 3SEPA 3F4CA 4MUPA 4C6EA 1LZOA 2OSYA 1EIXA 1DWAM 1O66A 4PB4A 3EB3A 1N7KA 1OX4B 2V67A 1QK2A 1CI1A 4DJDC 1HXJA 2BWGA 3P5ZA 3DU0A 3APYA 1TMHA 2VXNA 4KGLA 1A5KC 5HULA 2YFNA 1S5TA 1PAMA 3SUWA 1OGBA 2EJAA 1TX0A 4WY0B 4HZ6A 4UQEA 4RXFA 1QI0A 5D9OA 5AHNA 1U5HA 1OBAA 1HKJA 3OODA 4X0VA 1DXIA 5AYIA 2J7CA 2D1ZA 3VKDA 2GQ3A 3RLGA 4DPPA 3M0KA 3A23A 2BSLA 3NO3A 8XIAA 3S9YA 1XLCA 5T9BG 3ARUA 4LW7A 1ADDA 2GQAA 3K1DA 1TR9A 1TJ2A 4JY9A 3TCEA 1BXBA 5A6JA 1GYMA 2FVLA 3DG6A 4J3XA 3VD3A 4GGBA 4O1CA 4J3WA 5ABGA 1FVPA 2IS7A 4IQJA 3FK4A 1H7OA 1UUOA 2XH0A 4DF2A 1YMYA 2PLJA 3I6EA 1GKRA 3FA3A 3F4WA 1UUQA 3A4JA 1DEDA 2Q09A 2Y62A 3OG2A 3FHQA 5AZ0A 4R7JA 3K4DA 2HQAA 3W84A 3W01A 2PD5A 5CPQA 3S9IA 4R9OA 1KFCA 3DEQA 1PX3A 2BY1A 4UFIA 3N2TA 3PZQA 3ARTA 4EVZA 4TVUA 3GG1A 1KO0A 1IIHA 1REQA 2V38A 1TFVA 3IGUA 4Z1AA 3NWRA 2NXHA 4FNSA 5FD0A 3W72A 2XVKA 5C7HA 4YCPA 3PSVA 2YPIA 2AMXA 3GHUA 3GG8A 1VC4A 4DWSA 4E0CA 3A12A 4GHRA 3GHRA 1LT8A 1VFHA 1ISWA 1JPIA 2OZ3A 3LGEA 5IRPA 3QZEA 1OZMA 4XZNX 3S9ZA 1BTMA 4X9YA 2B0MA 2E5CA 1VBUA 5DO8A 5KZDA 3UG5A 4AMAA 3M0YA 3BJFA 3QHMA 2YYUA 3W2MA 2J78A 4L4PA 2Y63A 2CHOA 4WEVX 3LEPA 2GVLA 1AH3A 4DBUA 1V6UA 3EPOA 3TFXA 3WL1A 2W91A 4M51A 3OGRA 2ACSA 4LUIA 2E68A 4RE4A 3H2MA 4BQ5A 4JYFA 4HNVA