1PTDA

Phosphatidylinositol-specific phospholipase c
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Crystal structure of the phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with myo-inositol.
pubmed rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
total genus 106
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1995-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ptdA00
2OTDA 3QR1A 2OR2A 3QVQA 5T91A 3KS5A 1DJZA 3RLGA 2FJUB 2P76A 4QJ4B 3EA2A 4RW3A 2PLCA 4F2UA 4RV3A 1DJWA 4I90A 5PTDA 3CH0A 1QASA 4Q6XA 1AODA 3V16A 4GNKB 4F2BA 6PTDA 1DJHA 1DJYA 4RW5A 4F2TA 1QATA 2ZKMX 4I9JA 3H4XA 3L12A 3KS6A 7PTDA 1GYMA 1PTGA 5T9BG 2PTDA 4I9TA 2PZ0A 5T9CE 3QR0A 2F9RA 3RLHA 4OECA 1ZCCA 3EA3A 1T8QA 3MZ2A 2O55A 1O1ZA 1DJGA 4R7OA 1VD6A 3H4WA 1DJXA 4I8YA 3V1HA 1YDYA 1V8EA 3PTDA 1PTDA 1DJIA 3V18A 1T6MA 3EA1A 4PTDA 2OOGA 4QJ3B 4S3GA 3NO3A 4QJ5B 4I9MA 1XX1A 2ISDA 3I10A 3OHMB
chains in the Genus database with same CATH superfamily
3L5MA 2DW6A 4PMQA 4TQTA 3FVMA 2AQVA 1RBLA 1EF2A 4L65A 4M7SA 4I3GA 3HPFA 2Y61A 2B0MA 3M44A 1JRCA 3I68A 5LXXA 3MB9A 1PIFA 3WKZA 4LWWA 1QTWA 4L5ZA 5MKGA 4LV9A 1RPKA 4KMQA 4BQ4A 2G4FA 3BGAA 1QHZA 1FBAA 3T0AA 4IH3A 1XRFA 1OD0A 4FX7A 1DJNA 5JUVA 3HGSA 1FH8A 2MANA 1YE6A 1A5MC 3G22A 7TIMA 3RJYA 3W1UA 1XIDA 5FJJA 5HWNA 1GQIA 2NXGA 3LOTA 3YPIA 3M0MA 1XR2A 3DHFA 1A5SA 2GVGA 3K8LA 3LTYA 1M7PA 4H04A 1LDCA 1KV5A 2CLLA 3AOFA 1Y8BA 2X0SA 4A3QA 1TZ9A 2NQ9A 3UF9A 1CDGA 5JH1A 4LY4A 3AJ7A 4F0KA 2IPJA 4PMDA 2GJPA 3VCCA 4GQRA 3LCGA 4O1AA 4O14A 3URBA 2DJLA 2C3ZA 2GSJA 4LS2A 2PWVA 4WDWA 5EL1A 1UR3M 1KKRA 4ONVA 3BWWA 3AMKA 1FFRA 3UWUA 2YIHA 3T09A 1H49A 5H8PA 3U2EA 3WLSA 4LUIA 1BXBA 1EJTC 3BLEA 2JIWA 3WQ6A 4GO9A 2IQTA 1G0CA 4ZA0A 2D1ZA 1ISWA 4GH1A 1S1RA 3GHRA 4HP5A 4UTWC 1HW6A 4HJWA 2BY1A 5DCBA 3BW3A 3W86A 1GZGA 3C0QA 4HN8A 4MDOA 3AXKA 3P60A 2CLPA 4K7VA 1JUBA 2X1IA 3QKEA 5GNYA 1ZUAX 1DTNA 3DKJA 3U4FA 4LBUA 1UIOA 3W3OA 1DEDA 4WXYA 2OLHA 3NPXA 4BHYA 3LLXA 4XX6A 3OIXA 1J5TA 5FKYA 1GG1A 3R0KA 4XUGA 3GXPA 3AS1A 4PC8A 3GIPA 1AQMA 1VPYA 1EHAA 1F8IA 1IT0A 1QNRA 3RCYA 5FF3A 3WLHA 1VD6A 4PH6A 1FCQA 1GVEA 3O6AA 3GFYA 4KWUA 3GDMA 2YL8A 4QEEA 1Z8AA 3R1ZA 4BF5A 3EX4A 2G50A 4IGSA 2FMNA 3GTNA 2BGQA 3VOGA 4LXFA 3GX9A 2XGIA 1W3TA 4CNPA 3THQA 1FQ0A 2QMKA 4IF2A 1H7WA 5I5RA 3W81A 1JPDX 3N2CA 5AYIA 1O7AA 1OT2A 3S2MA 4H3DA 1XLKA 1E71M 3KDNA 1EIXA 4JNZA 1FWTA 4PTMA 4E3VA 1XIIA 1KBJA 1CIUA 3N2TA 2PPGA 2XDFA 5EKYA 1E55A 2TRSA 2PDIA 4AIUA 4O13A 1UZ1A 3G8EA 3SUSA 4PMYA 1VIWA 1MZRA 2WWDA 2E5DA 1ZP4A 3ZLHA 3ANYA 4OTKA 1DQUA 4KGJA 4NI3A 4AZCA 3S42A 4M56A 3WCZA 1KFBA 1S2UA 3ONCA 4S2BA 3W74A 2J79A 2VCCA 2OJPA 3DFPA 5CZ0A 4YL2A 5I3IA 1VENA 4A8RA 1DHPA 2OELA 3R12A 1ZBCA 3O9NA 4FXSA 1AZ1A 5I3FA 4JEQA 2P8CA 3OGRA 3HFTA 1H4PA 1C3FA 4ZQRA 4PA8A 2VQUA 1RP9A 3WDQA 4XBSA 1TUXA 3ZLFA 2VR2A 1CEOA 4R85A 5EB8A 3NQ2A 4M6UA 4DWSA 3KOYA 2NT1A 1W9PA 1O68A 3IK2A 1CPUA 4UFIA 2E40A 4JTLA 4JTQA 4DYKA 2HVNA 5FF4A 1RHCA 4LOCA 1VF8A 3CO8A 3VIGA 5HJYA 4PL1A 3CL7A 1EQPA 3ECQA 5HULA 3ZVHB 3GXDA 2GJXA 2QDEA 3LM7A 1DQXA 5HR7A 2W91A 3VPLA 1P0EA 3E9AA 3IVTA 4BI6A 5AYZA 3N18A 3CIWA 3PNZA 2Y24A 2YBVA 4OIFA 4HBKA 3F4VA 3W1NA 2PGWA 3BC9A 4DUXA 1XLCA 3UWYA 2ZFAA 3MV01 4LH8A 3TN3A 4HT3A 3KOZA 1PXGA 1QNPA 1YXYA 2ZUVA 3MKVA 1GOXA 3CZJA 5G2HA 1PDYA 2BVTA 3CBWA 1JD7A 1S5VA 3S5SA 3IRDA 3W7HA 5BYWA 1J2BA 3W1PA 4AG0A 1EHNA 1E4LA 2AL1A 3SECA 3MO4A 1VKFA 4AY7A 2WMJA 1WDRA 1XINA 2BLEA 3TIMA 3AZRA 3WLLA 1XBYA 1T6MA 2RFGA 1WOAA 1B90A 1XQKA 3FJ4A 1VFMA 1ICPA 4Q22A 5EPDA 3T08A 1TVPA 4OU1A 3LZ3A 1IT8A 2DORA 2BZNA 1SO3A 1V7AA 3GVRA 2CIPA 3SRFA 2PBGA 4JKMA 3ABQA 2DVTA 4PRTA 4Q7BA 5A95A 1AQFA 4HVXA 1J96A 1VZWA 2HVOA 3AIUA 1KFJA 1YE4A 3QV6A 5M5DA 2A3LA 2KAUC 5CC5A 4CD7A 3VYLA 1Q6OA 4D6HA 1LBMA 3LSBA 3CHCA 4GXPA 3HV9A 5JH2A 3LCLA 4GIRA 2TODA 1ITXA 5HWJA 4WUIA 5A6LA 1DPMA 1VJZA 4AYGA 4H9ZA 2H9AB 1ISZA 1OG0A 2VL4A 2QCGA 2CU0A 2FDSA 3UEQA 3B8UA 3OO2A 2E67A 1W5PA 1HJWA 3SCUA 1IEVA 4MLJA 5K4XA 3K8MA 2UV8G 1FCVA 3OIHA 4UFHA 2X2GA 1MSSA 2A79A 4X2RA 3ALGA 4CQAA 3QTGA 4AISA 3STEA 5KZDA 1TJ1A 2PDUA 3E0VA 3CT7A 2VC5A 2QPSA 4W93A 4LV4A 4OBTA 3RO6A 3F5LA 1TMLA 4GBDA 4UUIA 1S46A 4LTSA 1GQLA 2OZ8A 3BGGA 3WD2A 1MDLA 2J4GA 1RJPA 2NQ5A 4W88A 2ZUUA 3BLIA 1QI0A 1Q6GA 3MUAA 1SQ7A 4QIUA 3OZPA 4QJ5B 3AXIA 3O0FA 4X3ZA 3TN5A 5ABTA 1H2JA 3UQNA 1Q6LA 4H7ZA 1NF7A 1OK4A 1TTIA 4K2SA 5T91A 3OTRA 3UYCA 2HZGA 4P5UA 4IPLA 1GKQA 3EXTA 1K6AA 5D32A 1W56A 4TR9A 1ZLPA 2FJKA 1CGYA 5GJNA 3W2LA 1MYRA 4DAFA 3USZA 2WQDA 2C18A 4I8DA 3UCQA 1W3HA 1XIMA 2QZRA 3ZO9A 1QI2A 1OCBA 5BXSA 2VGFA 3ABXA 1JYVA 1UC4A 4AEOA 5G5IA 3BV4A 4GZIA 3VKDA 1OHLA 1FP9A 4L9ZA 3UNTA 3CPUA 1NOFA 3TCEA 5KITA 1OFRA 1ECQA 2QIIA 1E3ZA 2NVAA 3W7OA 3AJXA 3GFZA 4ZB2A 1QI3A 1KNWA 3L0GA 3MA8A 3VKCA 3MI3A 3M5YA 3OLIA 3GNPA 2FPVA 3IGUA 1KBKA 1B3YA 1O1ZA 1GOKA 1X1NA 3KL0A 4S1FA 2DW7A 4GKLA 2WVTA 1DJQA 3HG2A 2YKKA 2V5BA 3B4UA 1EX5A 5AHMA 4US6A 2VZUA 5D2WA 4KW2A 4V28A 4AU0A 1T7LA 1V79A 2FGZA 3CMFA 4FNPA 2RAGA 4QS5A 1OADA 3WZ0E 3KBJA 4OKDA 3M0LA 5EMUA 3W1RA 5D2VA 2D3LA 1IE7C 3NL6A 4Z42C 1Z48A 1QFEA 1DORA 1GYLA 3BLFA 2Y7DA 3LRKA 3H2AA 3LZ5A 3MDUA 3KVLA 1PZ0A 4LJ3A 2DZSA 1OFOA 2O0TA 4MWAA 4DF0A 4W4QA 3BUVA 2RJHA 3PB2A 5G2IA 5DF0A 4PMXA 4JTEA 2GJRA 4G1KA 4FX6M 1C93A 5HBFA 1KFLA 1YTKA 1LM1A 4K7YA 1MQPA 3TQPA 1UKPA 1X8FA 4O17A 1AL7A 4HB7A 4AD3A 1YPFA 2R1KA 1GYNA 4WCJA 3W2MA 4OECA 1R2TA 2W62A 1UR0A 2BY0A 1OX5A 1QHPA 1UKSA 1RXOB 1HKKA 3HTWA 4UNIA 3LRLA 3CGTA 4R7OA 1CENA 3IWPA 1CZ1A 2D69A 4N9CA 3RFAA 3UXAA 3QQ0A 3W7JA 2ACSA 4F48A 1GUVA 3MHUA 4ATDA 2CNCA 3P14A 3GBDA 1J0YA 2E9MA 3G2GA 2FIQA 1XX1A 2VRKA 4LBSA 4FOKA 1XH1A 2XH0A 1PKNA 3BLPX 4UFKA 2J6XA 1ZENA 1O4UA 1GVIA 1MXGA 4LU0A 2V5LA 4RLIA 5CJNA 4NJJA 5AC7A 1YXCA 2PEVA 3RX4A 1EOKA 4IIHA 6TIMA 1F07A 2NUXA 2DSUA 2QUNA 5DELA 3EEGA 4KRZA 1J93A 4RW5A 1HKMA 4OUEA 2VMFA 5JQ9A 3F1QA 5G1YA 4JOMA 1C7SA 4ZQNA 3KLLA 4BFAA 1D7FA 3UESA 4WX2A 3QR0A 5D03A 4M81A 2HQAA 2PLMA 3CJPA 3WUGA 4LUYA 1WUEA 4L56A 3WQPA 1NDVA 1ZBKA 5GVJA 4Z2IA 1XLFA 3U4AA 4UR8A 3UNDA 4ZZ9A 2ZUTA 4GNJA 4C1LA 3PJUA 2YL5A 1CLXA 4I7UA 2UWFA 3V36A 4ZB5A 2OZTA 3RMJA 4ZO8A 1CXIA 5JVLA 3FW6A 3DYOA 1R85A 1XYZA 2YBUA 3RYSA 2VD9A 2X7VA 4HSNA 3M0IA 4M7TA 4YLWA 5A5WA 4H8NA 1C9DA 3SSZA 1XD0A 3CL8A 3SW6A 4B3ZA 5HAOA 2PLKA 4LC8A 3GXFA 3T81A 5HNNA 2RDUA 5D2YA 3FFSA 1SZEA 2HISA 3ARQA 3BJFA 3W7KA 1U1JA 4ZQMA 3T2QA 1ISVA 2XINA 4GH3A 2Y8KA 3SJNA 3CHFA 4ACYA 3M5XA 3VDBA 4UTIA 1TV3A 5DX7A 2GQ9A 1EEPA 4JEJA 1BSLA 1XBZA 4M51A 4PMVA 5MF5A 1RCXB 4G6CA 4IXHA 4MAVA 1AZ2A 3EPNA 3I3DA 3SIZA 2B4GA 3GIYA 1EBHA 4HTYA 3GNRA 4DNMA 2F6XA 2QT3A 4ROQA 2WLYA 4L4MA 2EPLX 3CIXA 3LPGA 2XIIA 4S3FA 3QSTA 7A3HA 5FEWA 4RNFA 4UOZA 1JR1A 3DHPA 4FK9A 3DERA 3ZR4A 2J74A 2XVKA 1Y5VA 4QNEA 1BQCA 2BVWA 3BAWA 5AHEA 1GWJA 4MKNA 1SMAA 1F3XA 5I24A 4QISA 4KPLA 5BOFA 5HJXA 1VCVA 3GH5A 3PZQA 1VCGA 2R1MA 2WM0A 2PLJA 3TAOA 4S3GA 1RK5A 3S5YA 3WF2A 2AL2A 4XG1A 2W4XA 1CGXA 4IP4A 1EB3A 1OWQA 1XYFA 1F3TA 2BTMA 1H7PA 5E1QA 1KM4A 3I4EA 1IXNA 1MEHA 4MY1A 3CWNA 2PDHA 4PMNA 5DRCA 3U2ZA 2V0TA 3HURA 4AVNA 3MVTA 1M03A 2HRWA 2F38A 3FCPA 1P5BA 1CXEA 3UA3A 1GOIA 2H3DA 4R7WA 2C91A 3QPYA 1UR4A 4J4KA 2ZE0A 4WKFA 3P81A 1TREA 3FGCB 1L6WA 4MOZA 1LQ2A 3FX4A 3ARPA 2GVJA 3HFYA 2F2HA 5I3GA 4XD3A 3W29A 5J5RA 4PUMA 3SCOA 4DXXA 2X1RA 1UH3A 4L9XA 1FWEC 3P7YA 3NSNA 3PBMA 2Z24A 1XIJA 1TPDA 4D6JA 1O1HA 2ASHA 1NH6A 3GQYA 4HIBA 1Y7VA 3TSDA 2GUBA 4PR4A 2BVYA 2I17A 2XWEA 4G7FA 5D4YA 3EXSA 3AC0A 1PTDA 4FXRA 3TJLA 5A6TC 3PSVA 5CPOA 3LN3A 5FIPA 4C7GA 1K1DA 1SU5A 3FNDA 2PODA 3OZMA 1AW2A 3BGJA 1Q4NX 4C60A 1AUSL 2A1YA 1PCKA 3WQDA 1TR1A 1FXQA 2O9PA 3EKZA 3LSCA 4YVPA 1D8WA 3BLLA 3RJXA 4MY9A 1JPKA 3GYCA 3UYIA 3VFCA 1E6SM 1ZGDA 4AVOA 2A6LA 2GOUA 2WBGA 1NDZA 1HP5A 2RDXA 2H9AA 1Q45A 1D7KA 2ZTKA 1QAPA 3CV7A 2YXOA 3GDKA 1K6WA 2D0GA 2TPSA 4IIGA 3URQA 3MP5A 2VGBA 3OP2A 3VM7A 3SN1A 1QNOA 3ISIX 3VIJA 3W72A 2EPKX 4IG2A 3UWQA 4G56A 4WOQA 4WJXA 1EKOA 4H9XA 4HJFA 1PAMA 5HOSA 2J77A 2AOSA 3MHGA 4DJED 2J66A 5IFPA 4BKNA 2FVMA 4PTNA 4JX5A 1RD5A 5E93A 1R3YA 4CD6A 2FHBA 1HUVA 1DJXA 4RDYA 5I77A 1LL7A 3LV5A 4GIAA 3TQKA 2A3AA 2XYLA 3D5HA 4O18A 4XZHA 3UWEA 3OOQA 2ODOA 1NQ6A 3BANA 2Z7KA 4IPJA 3C5QA 3AYSA 1W6TA 2FFCA 1VEMA 4WDTA 3S6OA 3WK0A 1EL3A 4LVAA 1KLYA 1S2VA 3IPWA 3PB0A 4C7DA 3TQVA 3THAA 3OZOA 5DCDA 1G4SA 2E77A 3CYJA 5CLWA 2HS8A 3TZNA 1T99A 1ZJIA 5F4SA 3EA2A 1QHOA 3WUBA 3G3MA 4KWOA 3ITYA 4P7OA 4QRNA 3H21A 2CLOA 1VJSA 4HNLA 4CEXC 3PTKA 1EA9C 3S2NA 4K8GA 3KWSA 1J4EA 4UMAA 1B1YA 1EYEA 3IIVA 1EPXA 1E1FA 3GU2A 1W2VA 3N9KA 1XIFA 2PCEA 2OX1A 5FJOA 1NELA 4OWGA 2SFPA 4RV8A 1NP0A 1ICSA 4KS0A 4WOZA 1Q65A 1SJBA 2RDWA 4XZMX 2Q8LA 3TXZA 3PJTA 4WJEA 1BYDA 2I1OA 4IHCA 4UFMA 3FHQA 3NCOA 2PDKA 4FR1A 4NNBA 1PBGA 3VD5A 1H0IA 2E28A 4UIOA 1S38A 3W2UA 2NVCA 1WBHA 1XLJA 1J8VA 1DJGA 4CEUC 4WSKA 1PO9A 3VUPA 3GO2A 4JYFA 9RUBA 1K8ZA 3TDFA 3L67A 3GDLA 4A6GA 4BQ2A 3EMZA 3O3RA 3CLMA 3PR2A 4YHEA 3GTHA 5BRQA 2Q71A 5FF0A 4HZ6A 4BEUA 3WENA 5AZ0A 4ZFCA 4BQ5A 2DH3A 3Q67A 3BW2A 3NEHA 2WMIB 2CLKA 2FZMA 4Y9MA 4F0MA 4EIVA 2XUCA 5HK4A 4MZ8A 3T2PA 2X41A 1W3IA 3EOLA 2WCSA 3PULA 1W32A 4K8EA 2CZFA 2WXDM 3PFRA 4H01A 4B2DD 3AU2A 1UR8A 3THCA 2G96A 1M9HA 5GPRA 1B4KA 5TQLA 3PUEA 3WMLA 2UY3A 1DIKA 5IDIA 4DXVA 1LWHA 3KHDA 3B0VC 1F6KA 3VGHA 4A8LA 2EJAA 4Z0JA 3ZIZA 5H8MA 2Z7GA 2Y5SA 1DXEA 3W7GA 4P7RA 3ARTA 3QKZA 2E1DA 4IX2A 4DBSA 3F4DA 2G3MA 5TD4A 5LKYA 3R2GA 4M1BA 5I03A 5EMMA 4DEFA 5EU9A 3T8LA 3AMDA 3T0BA 2EG7A 3PAJA 1MEWA 4PCSA 3CAQA 4FI4A 1EJRC 3E74A 4XK2A 3OA3A 4DJFC 3GG8A 2XM1A 3GTFA 2ISDA 4HNOA 1VFHA 1QMLA 1FWAC 1XWYA 2DVUA 1X7FA 4JTJA 4AIEA 4Q4OA 2EJ1A 1L8PA 2HBXA 4PMRA 4H6EA 1ME7A 4UFLA 2JALA 3UZYA 2VZOA 2X1TA 1P1MA 2Y63A 4LAOA 2YB4A 5HQEA 3A9IA 4RR4A 4DI9A 2CETA 3W24A 1FY6A 3EPMA 2DZTA 4JL2A 3RK8A 5BOEA 3GG0A 5HNRA 1LUCB 2G5WA 1MI3A 2PDNA 1TWSA 1UR2A 4PN2A 3LY0A 1JCNA 3H22A 5E5CA 1NDYA 2P0IA 1AODA 5AZ1A 4JIHA 4IIDA 1SW7A 4ZQCA 3P82A 2R6OA 3W1AA 3LLDA 1LP6A 3KOFA 5KZEA 2DH2A 2VEGA 5HJLA 3TP4A 2Q09A 2ZVRA 3NXFA 3IUDA 4JAWA 4QX4A 1EP2A 3W00A 5DMYA 3QOMA 5CG0A 1JULA 1VFTA 3S46A 1ZAJA 3NVTA 1E73M 4ICMA 2ZDRA 2VR5A 1J6OA 2F6KA 3CEPA 3O05A 3LTPA 4H7CA 2NV2A 4CCDA 3EYPA 1PDZA 4TX9A 1AFSA 3L0NA 5I0DA 2Q8ZA 3IAPA 4K38A 2Y4SA 3IJDA 1G5AA 3VNDA 4JX4A 3KAOA 5I3HA 3NSXA 3ZOAA 1CGTA 1SO6A 2Y85A 4PMZA 1FWNA 3LG3A 4MUPA 1FH7A 3E0FA 5AC5A 3TJ4A 1SZGA 1VYRA 2OGJA 4E8GA 3B0PA 1JCTA 2QLYA 1ISYA 4Z1CA 5DT5A 2Q02A 3M5VA 4H9UA 3KCOA 2ALDA 1A5NC 3KBNA 2VCBA 3GVQA 2P5NA 2CW6A 5FOOA 3GVVA 4G7EB 3H8AA 4HNVA 2X30A 1ZBWA 2PRMA 2C79A 1T40A 1S2WA 4O4VA 1KFCA 4ZMGA 1FRBA 4H9VA 1HG3A 3WJSA 3UWZA 1I1XA 5CPLA 1ODUA 4GK8A 3TCSA 1SR0A 1XRVA 4XISA 2C1GA 4GX9A 1LZOA 3IRSA 3CM4A 4Q8MA 2X1SA 3VD7A 3S2LA 1GZ1A 1VCFA 3CS2A 2VWTA 3VIKA 2WC4A 3AXHA 4GOAA 3RM8A 1KTNA 4L9YA 4JBRA 4AAJA 2CZ5A 5DCEA 1B4EA 4JDYA 3E6EA 4RXGA 4IPPA 3OG3A 2I56A 5C8BB 1HJSA 2OQHA 4Y96A 3LBCA 4GWEA 3A21A 2WZMA 1YBQB 4M6PA 3SM0A 5E09A 3DYPA 5U7SA 1JPHA 2PS2A 1RR2A 4KRUA 4UQEA 1OCJA 1K70A 4JHOA 4XAFA 1WV2A 4FOJA 3N3MA 1U2YA 2WJZA 1KWGA 1OK6A 2ZXQA 5LA2A 3SCQA 1SZNA 1CGVA 4MB1A 1HJUA 4QSHA 2HPMA 1YDYA 1WB0A 5I6SA 2R94A 3HPSA 2OCZA 3FIGA 1KFWA 4OE7A 3VZZA 3CQIA 3LHYA 5JBDA 1JI2A 2G8ZA 3BW4A 5EBAA 4W7UA 4ZEPA 2NT0A 4ZBCA 2DUAA 4IZGA 4HCLA 1KKOA 2Y7GA 3ENLA 3ARRA 3QMTA 1HIZA 4QXIA 8CGTA 2V68A 1U22A 4FA3A 1DWIM 3NG3A 3NVDA 4AD2A 3R89A 4EXAA 1GOOA 2DQWA 3GH7A 3WQOA 5IDZA 1BYBA 1LT7A 3BAJA 2P50A 1ONEA 1TO3A 1WDSA 3LS9A 2CC0A 3DUGA 4RNIA 4GUIA 1GJPA 4MAZA 2OWCA 4DO5A 1RBAA 3PPHA 1P7TA 1BF2A 3V7PA 4A3UA 4S2CA 3HMCA 3GSMA 4W8AA 4B92A 1RQEA 4NILA 2IKGA 1EO7A 5AC8A 4MDPA 4XBJA 4DZAA 4X0NA 3HG5A 4UOQA 3T7VA 1TJ0A 3BV7A 5BMXA 1QWKA 2GGJA 1WXJA 2REQB 1UJQA 1DHKA 4AD4A 4UC5A 3WQGA 4UTMA 3IV3A 5FEXA 1CB7B 3H2EA 4E2VA 4HK7A 1H51A 1VYPX 2ZRUA 3S8HA 4KEVA 3C52A 3GC2A 5AFDA 5FEZA 2Y6ZA 3AIBA 2QUMA 4B5UA 6XIMA 3DAQA 1FTXA 1I0DA 2WNWA 4L80A 3VKJA 4Q7IA 3VTRA 4FIQA 4F40A 4RXFA 3SBFA 4DLFA 3U6WA 2PRHA 3WD0A 4HK6A 1HX0A 4QBXA 3CMJA 2BVDA 2PWFA 4INFA 3IJ7A 2GK1B 2BHZA 2QMJA 2B81A 2VFHA 5M17A 1MEIA 1SFLA 3TYAA 4RDVA 3BSMA 3ATZA 1FUYA 1JF5A 3BCDA 3V35A 1MNSA 2CFFA 3KP1A 1QATA 4PTVA 2V81A 4RDWA 3XIMA 3ANVA 3CHEA 3BSHA 4V1YA 2BFGA 5D38A 1KBBA 1SFTA 4UTFA 1TV2A 5CGTA 2YA1A 5ENLA 4R33A 2PDBA 3SRHA 2EPHA 3TYEA 3PUDA 3CV1A 1QW9A 1SMDA 1RY8A 3B8VA 5ECUA 3UXKA 3N13A 2PTYA 1LBFA 4HSOA 4KWWA 4GXWA 2YA0A 2J8GA 4QM1A 1UQYA 4TV5A 3ZT6A 4AXNA 1TE6A 1XRTA 4HMDA 2VFGA 3RR1A 1R9YA 5G1TA 5D9MA 2BOGX 4UMCA 4IISA 2QJIA 4TVDA 1TRIA 1POJA 4HPHA 4FB7A 2WJEA 1A3HA 1K9TA 1CYGA 3REQB 4O50A 3K2GA 3B0XA 4CQDA 1KRAC 1MZHA 3RHGA 1FOBA 3L4YA 1J11A 1GQJA 1JQXA 1Q13A 4Y2WA 1CGWA 1Z69A 3UXDA 5I00A 3O2LA 4GX8A 1OYBA 2WMHA 4G1NA 4O53A 2FDMA 1ODZA 3IJIA 4REQA 2VC7A 4FF5A 3S2CA 5CKSA 3L66A 5DBTA 1RSCA 4ZR8A 4DYEA 3OVPA 3UBPC 2DT1A 4IMCA 4MFEA 5D9NA 3KHJA 1R47A 1I6NA 3IK4A 4UFJA 1X8CA 2ZRWA 3JU2A 3MUY1 4HHPA 4L6HA 1ZTVA 2W9MA 3W71A 3THDA 2E8ZA 2OSXA 2Y88A 1QRQA 2WJDA 2R1PA 2ZWYA 3VI2A 1FCUA 3MU7A 3G1VA 1DJHA 1L8NA 3KTSA 3EMCA 3G24A 4U5KA 1P0DA 3H4XA 3ITXA 1JUKA 3CK5A 3EMQA 1YNYA 1JDDA 2D3NA 4AEFA 5CQ1A 1ENUA 3BZGA 1ECEA 3DGBA 4GPNA 5I78A 1XUZA 3AAMA 9XIMA 1WDWA 2E5BA 3HO8A 1XQLA 4J28A 1ZS2A 2NXIA 2C7FA 2J25A 4DZIA 2V3EA 1RA5A 4O19A 5C5YA 1US0A 5MHBA 3STFA 2E68A 1IWPA 4FNRA 4UZUA 3B04A 5I09A 2WMIA 4TX6A 1OYAA 4AMCA 3V3WA 1BG4A 1W5MA 3G1XA 3RM4A 4DJEA 4W7WA 1W9VA 1XIGA 2DP3A 4XB3A 3BOFA 2DZVA 3IV8A 1FH9A 4JTRA 2VZVA 1EP3A 2ABAA 2WZIA 1OYCA 3QZEA 3C2YA 3QV9A 1JZ8A 2BOFX 3EXRA 4UXDA 3CT2A 4AWUA 4IMEA 3NPVA 1L6GA 3NQGA 1ZALA 3LHWA 3W1XA 2BGNE 1C90A 1P6WA 1LG1A 1XPGA 1I2NA 1EQCA 4HOWA 4R9XA 1MW2A 4AZ5A 4Q6XA 1AVAA 5CXPA 4NXKA 6PTDA 4B15A 3QC3A 3M0ZA 4DX3A 4TOQA 4LB3A 4Y9OA 3MCOA 1TELA 4Q4PA 3DN5A 4W89A 1KB3A 2X0HA 1K02A 2PD9A 5AYXA 3KCJA 2PMQA 2WZTA 3N15A 4RNHA 5I3DA 2EF9A 5A6KA 1QT1A 3T0TA 3ANUA 1ZHAA 3CV6A 4MB4A 3MANA 3MCMA 1EDGA 4O1EA 1YYAA 4MYAA 4K37A 3HU7A 1GW1A 3HJZA 5C2GA 4FP1A 2AGKA 4GYPC 4GVGA 2GQAA 3EBVA 4UCGA 2OQYA 4AC7C 3ITOA 2WOQA 2C13A 3M47A 4PUKA 2R91A 5H2ZA 1UMLA 4LRSA 2CXEA 1JFXA 2ATSA 3MVIA 3WF4A 1G1YA 4QEHA 4HOXA 4IIFA 4QS6A 2RHGA 4DJDA 1ITCA 4WF7A 4Z08A 2HNEA 2VRJA 4XSLA 3HQ1A 3ATYA 3N2BA 1R6WA 2QJGA 4A3YA 2J9ZA 1W17A 2B7NA 2QEZA 5CCZA 3QC0A 3M6DA 2PDYA 1PX3A 4CKQA 2XFRA 4LBRA 3W70A 3BTNA 2BDQA 3AZSA 2BXVA 1N8IA 3VOJA 1HNYA 4EKJA 1Q8AA 2W0UA 5EY5A 4AIOA 2FZBA 3TK7A 2GQ3A 1OD8A 1BYAA 3TJXA 1UBSA 4C5YA 3R79A 4PTXA 3VGBA 1LTDA 3DFQA 1XG4A 1JNDA 4GY7A 1B3WA 3TSBA 4ACZB 1HJXA 3KOWA 2XN2A 3C2OA 2VFIA 3RRAA 3PHAA 2CBUA 1XDJA 1WOBA 4B2DA 1FFQA 2CZVA 2QVNA 3TUUA 2V67A 3ARSA 3C3NA 3ZMRA 1OM0A 3CB3A 1A5CA 3BAIA 4KEZA 3CLWA 3M64A 4ORIA 1W1ZA 3NIYA 3L23A 4OV9A 3H12A 3WLTA 2GPTA 3WO8A 3EB4A 4YTQA 2ACQA 5C55A 2V5CA 2CHRA 2GJLA 2H3BA 1WZLA 2WVUA 2QUUA 2XH4A 2JF6A 2V6AA 3U3HA 3GIQA 1LF1A 3VOIA 3GC5A 3WX7A 3AISA 2DY3A 4C6JA 3VIHA 1X7IA 4I6KA 3IVUA 1YKWA 4JYDA 2OMAA 2CBIA 3EOOA 1ZFJA 5M03A 1ISXA 3TOYA 4FZIA 4YS1A 1FHUA 1K7FA 4Z1YA 3EDJA 5E0CA 4JNYA 2DGAA 3LCHA 3OVQA 4HU8A 4YTTA 5FL1A 2HWGA 2VX5A 3PPGA 1EJVC 2FTYA 3USBA 1QBBA 2ZDSA 1IIGA 3P8JA 2V3GA 4AF0B 5CBBA 4JXCA 4WGHA 5DY2A 1U1UA 3SGUA 3GZAA 4GABA 4W8LA 4RJEA 4UR9A 4QCEA 3UPMA 4CVWA 3EPOA 2WHKA 2DUXA 3UZXA 3RG6A 5F1VA 1Y5XA 5GJPA 1QXLA 1R3VA 2VURA 5BWAA 4GJJA 2YFOA 3GG1A 4H6QA 2OFJA 4H2HA 4D9PA 3U48A 3EA1A 3UG3A 1I45A 1EGMA 2Z27A 3N11A 3THUA 1N82A 3Q37A 3Q2DA 3EKLA 2PDGA 1AH0A 4XKMA 3IARA 4DO6A 3RU8X 3HGRA 3A4WA 5EYWA 2W27A 3R0DA 3KRSA 3APYA 3IJ8A 3WQ5A 2VCAA 1E1CA 1SR9A 3W7EA 3L0KA 3VKAA 4E2DA 3VVGA 1LRNA 2TMDA 2YA2A 1ZP3A 1JDFA 1F74A 1H5VA 5KETA 2AAAA 1POKA 1HN1A 3KTXA 3UZWA 3E2VA 4YIWA 1V5XA 3CUXA 2DIKA 3PFMA 4ZTYA 4P7NA 1IF2A 2J27A 4JY9A 3TN6A 2G37A 2WMFA 4HK5A 1UC5A 4OV4A 3RO8A 4D8AA 4FOUA 2ZZ1A 1T8XA 1T96A 1J0KA 3T05A 2C6QA 3AICA 2X42A 4YTSA 3R58A 3EB2A 1MXDA 1MWOA 2ISWA 4JQ1A 3NR0A 3MZ2A 5T8GA 3VE7A 4F0LA 2FB3A 4LPCA 1J79A 1R9XA 1UWTA 1QW7A 1KM3A 2D2HA 2XVGA 4G9PA 2GVYA 3DBNA 1ZBVA 1XLDA 1S2TA 4R88A 3MSRA 3N34A 4L64A 2E5CA 4GJ1A 4NZ3A 1W3NA 1SSGA 1ZRQA 2XSXA 1KTCA 3E5PA 3GTXA 1XFCA 5HMFA 1EDQA 4WKAA 3TNBA 5BCAA 3NO3A 1JCXA 2WB5A 5JBEA 1JG9A 1R3SA 3K1DA 5M3WA 3CWHA 1TTQA 3UJFA 5HR6A 1KO0A 4C91A 2EPMX 3BLOA 4BWLC 3AMLA 1E9LA 1JCMP 1H0GA 3NSMA 3H7RA 1OB0A 2ESCA 4J7RA 5I23A 4U33A 4LF1A 3KFTA 3ARVA 4JTTA 1R87A 2O7SA 3H2NA 5PTDA 3F03K 3STPA 4UCFA 1KM6A 4HGXA 3MPGA 3DKLA 3K8KA 1I8JA 1FWWA 3NM1A 4W86A 4ATLA 3CASA 2PB1A 1XYLA 4GO8A 2WV8A 4E8CA 1TE1A 3VE9A 1WBJA 4EAMA 1V02E 2PBOA 4QE5A 3QHOA 2NWRA 3REQA 2B7PA 2VQTA 3W7RA 5M2FX 2H6RA 3N29A 4IXXA 3R5EA 3EOSA 3FHAA 4DF1A 3LXCA 4J3VA 4CD8A 3WYZA 4NJIA 3G3DA 1H09A 3H4WA 1V6VA 3B0UX 2D22A 1PWMA 4JR5A 4R3UA 3WJZA 1JDEA 2A7NA 2EQDA 3EWCA 1F6PA 1YTEA 1VC4A 5EA9A 3BCJA 1TPH1 4JYEA 5DMMA 4J35A 5D8WA 4OOZA 4CNUA 1XKJA 3E3HA 4HU3A 4GI4A 4F3HA 4FNQA 2ZIDA 4XD6A 2OGYA 1W1PA 2VEIA 5FACA 4KERA 1VRDA 1K7XA 3S9IA 2Y7EA 2VT0A 5JIPA 3GTIA 2QJMA 3FEMA 1LLZA 1UUOA 3LHZA 5DANA 4MHBA 1P1XA 4JN8A 5I3KA 1OC7A 4NX5A 5HPOA 3FAWA 1TSIA 3B8DA 3V1PA 3MI6A 3C8NA 4ZOCA 5CBIA 4LSBA 1UH4A 1PX4A 5DMLA 4Y9AA 1HT6A 1ZZMA 2QJJA 4CD4A 4JHMA 4MKVA 2RGLA 4KWVA 4L61A 1S39A 2ALRA 1NDWA 1SJAA 3OGVA 1P0BA 2P0OA 2WHJA 1QI5A 2W61A 3UVAA 3W37A 5AHNA 3W27A 1F73A 3ZXWA 3QMSA 1JZ6A 1JFHA 1XDMA 2ZVIA 3VNYA 4Q6JA 2R1LA 3LX9A 2QF8A 1SYTA 3KBSA 4YHGA 3AWNA 4PSPA 3QZ6A 2G41A 1TG7A 4KEUA 3PNUA 3F4CA 4M0XA 1EZWA 1ZL1A 2Q3OA 1DL3A 3WBAA 4CU6A 1OQFA 3TW7A 2VYOA 4O0QA 1DJZA 4QDWA 4Z2LA 4QQ3A 4CQBA 2YCLA 2I16A 3RF9A 3OYXA 2GDVA 4PUWA 4XTDA 1TA3B 5E6YA 2J24A 4RV3A 3NQEA 1BYCA 5C71A 3KZPA 3CIVA 3V0TA 2OO6A 1NVMA 4H8HA 1U83A 7PTDA 2QCDB 4DY1A 1NWTA 4JD4A 8XIAA 1EXBA 5AYBA 3OBKA 2XM2A 2PFHA 3N4AA 3MSGA 5BROA 3KL5A 5DQPA 2WM1A 4IX0A 5CZKA 4WZHA 1D8CA 4H83A 4J2PA 3P5ZA 1TUFA 2FKPA 2YGYA 1JD9A 3GXTA 1NAL1 3WQ8A 4GGHA 4RE2A 3M41A 3VO0A 4CNNA 5G4HC 3D3AA 1QOXA 3H53A 4W5ZA 3TH6A 1CTNA 2PTXA 2PGEA 3CUIA 1BWLA 3SQLA 1R7OA 1H41A 1CECA 1RQBA 1KCXA 3GHSA 1C8VA 1E70M 1PWLA 2XSAA 2RH9A 1L9WA 2PP0A 2ZXBA 1V4YA 3PPFA 1SFJA 4M5PA 4WDUA 1NSJA 4JTFA 3G1HA 4QG9A 4EXBA 1E6XM 1UPPA 3T9PA 3NFUA 4TIMA 3GW0A 1LT8A 4HHLA 3LV6A 4NASA 1Q7QA 4ZQPA 4RX0A 2IPFA 4ILSA 5G1MA 4XSMA 3M43A 3VNIA 3U9IA 1IXQA 5XIAA 1BF6A 2Q8XA 5CJMA 3GVWA 1TVNA 4IP7A 1J01A 2QCLA 4HMCA 3H23A 1SVDA 4UTKA 3BSGA 4U5IA 1WP6A 5K4ZA 4NQ1A 4KQNA 3EDDA 2V5KA 2J9YA 2VVSA 1IGSA 3O1NA 1I75A 1W1TA 4UTLA 3WEZA 1Z3NA 1QW8A 2ZRXA 1R86A 4MWAD 1R2SA 1KTBA 4M29A 3A47A 2Y5JA 3ITCA 4HZMA 3B03A 5I2UA 1UA3A 2ZWZA 3ARXA 3IS4A 1GVYA 4GD0A 4DF2A 5A6MA 4ALDA 3AMCA 2X2YA 3MW7A 4N4PA 1XDLA 2ZUSA 4FLSA 4FIRA 4OOUA 1JZ2A 5AECA 2KX9A 4IFOA 3ZYZA 3QW4B 3GDRA 2CHOA 5XINA 4CN1A 2GVLA 3NQMA 1J6PA 3RLVA 5CSSA 3TWBA 4NVTA 2ZZ4A 4EP8C 4J1OA 4ZENA 2JKEA 5TBOA 1PYFA 1K03A 3M6YA 2FB2A 2GFTA 3KP0A 3N6JA 3WNMA 4AF0A 4CVUA 1NOWA 4W8BA 1CCWB 4GE8A 3WLNA 4LUSB 2DU2A 3PUOA 1V6XA 5FAGA 4DWSC 3MCNA 1FHLA 2C14A 3AROA 3TEVA 3V5OA 3F5JA 1KCZA 2OWWA 1MUWA 1GYMA 2QAFA 4DO7A 1KXTA 1PSCA 5I3JA 1TFVA 4TTUA 4OBRA 3P84A 3GVGA 4O0KA 1TX2A 3VILA 1ADOA 3I6TA 4Q8VA 4O4WA 3RIKA 4WY0F 2Q01A 4P8UA 1TPEA 1XIEA 2YL9A 3W22A 4HNUA 4IL2A 1GKPA 1J12A 4I7VA 3U5UA 3VUSA 4XZBA 3WNKA 3C6CA 1E6PA 1Q6DA 4AY8A 1V3KA 5LIWX 5AN7A 3WDRA 3KW3A 1VPXA 1A5KC 4L4PA 2GGHA 5G4WA 3GNNA 4E2BA 2A3HA 4C7FA 5DMNA 3DBPA 2NQJA 2VNCA 3IIPA 1H5YA 2Y62A 3KDOA 5GNZA 4RUBA 1NM9A 2VDHA 2R82A 4UWMA 2NLYA 1HL2A 2EKCA 1D9EA 4UZSA 5C0QA 1DIDA 1M1BA 2POZA 1L2UA 2ZX9A 4EAYA 4EXQA 3W7QA 1DBTA 5AKQA 3KXQA 2YOCA 1XICA 4LFYA 1WDQA 3A5FA 3STGA 1H60A 3OODA 3P2VA 1Z42A 2E4TA 4XZLX 4DBDA 2OODA 3DENA 4DM1A 3TYUA 5CC7A 1Q4WA 1ZU8A 2GGGA 1M7JA 3B40A 4B16A 3N19B 1JCJA 3IJ9A 3QXBA 2Y70A 3RX3A 3VC5A 2GUYA 3UA4A 3CXOA 4JFUA 5D2TA 3SCVA 1T8QA 4Q7NA 3HGJA 3WQ4A 1VEPA 1CXFA 3T40A 1C8YA 4PUEA 1NEYA 1SM9A 2J78A 4I8YA 3PZOA 4PCTA 3OLDA 2Y89A 3W38A 2ISVA 1CB2A 2PDFA 1YADA 2PWGA 3I7SA 5DXYA 3PK7A 3BAXA 2F2KA 3XINA 4C6MA 3K4AA 2PDQA 3FVDA 4Z0SA 3MP4A 2VHLA 1FP8A 2ICSA 3VGGA 2YB1A 4GCAA 2HCVA 4GQQA 3AMGA 2OEKA 2V3FA 2Z2UA 4PL2A 1IZKA 1GPFA 1HJVA 1E4MM 2GOKA 3WK3A 3NQ8A 3VOFA 3LBOA 3DU0A 4OFCA 3CAWA 3SN0A 3TKFA 4US5A 7ODCA 2FGLA 2NUWA 3II1A 3SAZA 2VGIA 3GS6A 6XIAA 1RK6A 4KH2A 4NY2A 3ZQ9A 4PMJA 3ITLA 1U5JA 1IR1A 1BKSA 2O7QA 4D72A 2HROA 4GA8A 3AIEA 2WSPA 1BHGA 1AMKA 3R11A 4A8IA 3EOEA 1GTHA 4DXKA 4O10A 3NPWA 4KCUA 1VGAA 3NNTA 1R46A 3S2JA 4X9SA 3BLKA 4CQ9A 2V3DA 4Y7EA 3KBWA 1CX9A 4ERGA 4NAEB 4NZ1A 1BLIA 3MHFA 4ZCWA 2WHLA 3BLDA 3O63A 3OQ8A 5HXMA 2HDJA 4LYQA 2PC4A 1EP1A 3Q4DA 1C91A 4BF7A 4HZ7A 4C6FA 1VFFA 3T0CA 2J62A 3DFHA 1RAKA 2G3NA 4IMAA 2VI0A 1AH4A 4HPXA 5EMYA 4WDXA 3G0XA 4JTHA 4WQ6A 2CLMA 2CESA 5D37A 2G3JA 2GUUA 3P5YA 3H55A 4ROPA 1ZY9A 3LBMA 1UW9A 4X22A 3LPFA 4WIWA 2CCRA 3R0UA 3UGVA 4B4HA 2ADAA 4IT1A 4LNCA 3PM6A 4N2YA 1P0NA 4J9JA 6REQA 3XISA 4TV6A 1OZQA 2XVLA 2P3EA 3LGGA 1VHCA 4E8DA 1NWRA 3ORWA 1ME8A 3QM3A 1NF0A 4IIBA 3PY2A 4IICA 2RJGA 1RVGA 2FH8A 4NT0A 1LOLA 5G2WA 5D30A 2HVMA 4CGTA 4B3KA 3LGDA 2J47A 1IQ8A 1P48A 3TFXA 1F3EA 1W31A 4GCXA 2O4QA 3SCTA 3G0SA 1EJWC 1MQRA 1WKYA 4U28A 3R7MA 4MWAC 5CAHA 3DFNA 4E38A 1F3WA 4RCXA 3ZS4A 3P80A 5K7JA 1KD0A 3T2OA 3WUEA 5I06A 4MJ2A 3CC1A 4PULA 1MFUA 2ZUMA 4JHZA 3W9ZA 3NGJA 1UD2A 3ZSSA 1Y5WA 1F4HA 3JR2A 1VHNA 3IJ6A 3PAOA 4C6PA 1K4GA 1LG2A 3P3BA 3GG7A 3PBWA 3DG7A 1H11A 4NIRA 2BV9A 3B97A 4P7LA 9XIAA 3AIQA 4AIBA 3W75A 3VIPA 1BEUA 4J3WA 1F8MA 3QV8A 3PG9A 4MWAE 4C6KA 4HPNA 2DFAA 2HXUA 4D6EA 3F7JA 5C9WA 3CH0A 3FOKA 1DKWA 1FA2A 4LALA 2D2OA 4LS0A 3M7WA 4V33A 2XPKA 1OX4B 3BOXA 4PCFA 3FA3A 4XWUA 4JTDA 4ERIA 1KRBC 4TXEA 3H2OA 1EH9A 2QVHA 1SO4A 2AMXA 3QEZA 1U5VA 2G97A 4BQ3A 2XN1A 3N2MA 2B31A 1P43A 2BY2A 1XLLA 3APTA 3CQJA 3WLKX 3T4WA 1HFBA 4Y9PA 2FVLA 3GZ3A 2XFWA 3GW3A 1EC8A 1MW3A 3NO5A 4F9JA 4WR3A 1O5KA 3H2MA 4CNOA 3ITTA 4ZOBA 1AD1A 4GJIA 2Z6JA 3QR3A 4QGCA 3KTCA 1O12A 1BWVA 2GDUA 2WCAA 1QO2A 3GHUA 4RNJA 3AHYA 1ZB5A 1UIPA 4UQCA 1S2CA 3FYPA 3G6MA 2QCFA 3LPPA 3WQFA 3MO7A 3S1VA 1B0IA 3EX6A 4QG8A 4JDBA 4H4IA 1GZJA 3ELFA 1E0UA 3RLGA 2X40A 5HA7A 1XH0A 1QPQA 2WW5A 2O9TA 3AS2A 3NQFA 2XIBA 3KL3A 5AC4A 2GSEA 4Y9NA 5HQMA 2VFEA 5JU6A 3SCWA 4XAZA 2R9RA 4E6MA 3NWRA 1QK0A 2QHAA 3SO7A 4JIQA 2XIOA 4YMZA 5FJUA 3WBWA 4KF1A 3T55A 5C70A 1M5WA 3M7SA 1X98A 3HPZA 4IL0A 3TR9A 5G4EA 1N55A 1KGUA 2CLHA 3ME3A 2D23A 4KCWA 2VUYA 3GK0A 2JFEX 2WJFA 1ZJHA 1AL8A 3WEMA 5DN1A 2YDQA 3MY9A 4IGMA 3PTQA 2RGMA 2YCKX 3AWOA 3NOEA 3BMXA 3N73A 2YYTA 1GVOA 4BS0A 3AUJA 3M16A 4ZO9A 2UY5A 3QFEA 5LNWA 1FKWA 1XSKA 3A4AA 4L4OA 5LIUX 3SGGA 2NX9A 4GUHA 5ABHA 1REQA 1NU5A 3NA8A 3PWGA 3VD3A 1EYWA 4OBSA 1MMFA 1VLWA 2JGYA 2H8ZA 3NURA 2VTFA 1W8GA 2IKJA 3WBEA 5BXRA 3VDGA 4NSBA 4HPJA 1X39A 3UG4A 5CJ5A 1V7YA 1M01A 4RZ5A 1BKHA 2I5QA 2WNNA 3WMBA 4AD5A 1XHGA 3GXNA 1OF8A 1H7XA 3PSWA 1F2JA 3WFLA 5AVHA 4CLMA 3DESA 4H9TA 2E7FA 2XIJA 2NWSA 5C9RA 2INFA 1O5RA 3EB3A 2JQXA 5RUBA 1JI1A 1ZAIA 1TTJA 3N4EA 3TYZA 1E5NA 4H9MA 3W88A 3TC7A 5LNRA 3BMWA 2WHMA 3JUGA 4P8XA 1ALDA 4QITA 2L5HA 2V9DA 4ZFMA 3F4WA 1GT8A 2POTA 4DUWA 4FEZA 1L0PA 1NY1A 2A7RA 4I9TA 2NX3A 2CEQA 4PBGA 3UR5A 3EOUA 4LYRA 3VKKA 4H6KA 4EPDC 2F84A 3QY6A 2PF0A 1E9YB 1V0LA 2A7PA 2OG9A 3VM5A 4JN7A 1JPMA 4MPKA 3AFBA 5F2LA 1EBGA 3M0HA 4JTGA 4NNCA 4P7QA 4QE4A 3VDCA 3PZVA 3MYPA 1Y65A 1YDOA 3BQ6A 2I7GA 1OFDA 5DXXA 1ME9A 2CERA 3RMEA 1N7KA 2BODX 4IIEA 1C8XA 2EPOA 1KR0A 3IAQA 3VNMA 3GLCA 3RN6A 1XLAA 1GORA 3ZR6A 1MW1A 2GSHA 3PBUA 4LNYA 3WLIA 2PDCA 3FLUA 2UBPC 2VDIA 3WLPA 4O57A 2ZQ0A 4MSSA 4AVFA 4NZJA 1OGBA 2V5JA 4QR6A 5DRIA 3UXLA 3HZ3A 1C7TA 4O1CA 1W3LA 3QVQA 2ZZ6A 1JJKA 1SGJA 3D6NA 1UUMA 3WMSA 1UPMB 1VBJA 4NZ5A 3PANA 4GYKA 3A9BA 1TPFA 2ZYFA 3POCA 4QROA 1JCYA 3UJRA 4UOJA 1LL4A 4GFSA 2J8TA 4GI8A 3GR8A 2A6NA 4L1WA 2OO0A 2VFDA 1XF0A 2QUTA 1Q6QA 4AHQA 2FHFA 1XJBA 1EOMA 2WNQA 1M41A 2CZEA 4FAMA 3C61A 4IGNA 1JF6A 1IYXA 1MVYA 3NQBA 2GYIA 1YQ2A 4P8VA 3IIXA 1PHQA 2W63A 4JS3A 1HL9A 3VGDA 1SZRA 1SW3A 3ZJ7A 1UD6A 1Z41A 1DWJM 4J3TA 2YXXA 5BNKA 1G01A 2XIQA 5LHFA 1ESWA 1J0ZA 3QW3A 3V18A 3KRBA 5KSWA 4QHRA 3P61A 3O07A 3B3DA 2YLAA 5AHFA 1SSDA 4DPPA 4PRWA 2VX4A 2Q3RA 4YYCA 4IUOA 1EWEA 2WVVB 1V51A 2GQ8A 1KM1A 3HB9A 4HHMA 2QKFA 1M53A 1TRDA 4FX8A 2QDGA 4QG6A 2QS8A 4B9ZA 2OXNA 2QQ6A 4ZVJA 4YPJA 4BI5A 1OY0A 3JVAA 1K7EA 3A3XA 3AHVA 3TW6A 3P8IA 4MJ4A 4IPNB 7CGTA 1NFBA 1UCWA 1FKXA 4RZ6A 3L12A 2OYLA 1EA0A 4DWSB 3PUGA 3WFAA 4NAEA 1US3A 4IQDA 3QBUA 1NFPA 2PGRA 4BZYA 5FA5A 2J9XA 2ZADA 3FEQA 3S4TA 7XIMA 4F8XA 1VFSA 4K3ZA 1OBAA 3OBAA 1XXXA 3DH7A 1QI4A 3FA4A 4KGLA 3E0WA 4E0CA 4WD0A 2QPUA 1XIBA 1UZ4A 3CB8A 3JW7A 4N4QA 4W87A 2DT3A 1H7NA 1FWHC 4KFPA 1WDPA 1E0TA 1EWDA 5D8ZA 3ZT7A 3WQVA 4IPIA 4LYKA 5C9ZA 1EJSC 4D1JA 2QGYA 3AI0A 4C6NA 2CYGA 5A6BA 5E70A 1IEIA 2E1WA 2NX1A 3O16A 2QJNA 4GY1A 2FHCA 3M0YA 3E0IA 1H63A 4GGBA 4F4RA 1LORA 3BAKA 4TVUA 3LQGA 2GWGA 3A24A 3GUGA 2G3IA 1J2WA 1L6SA 2YDAA 4NUWA 3TXVA 3TMQA 3KM8A 4XV0A 1J5SA 1VQTA 2BHYA 3SUWA 4HQVA 3LNPA 3CQKA 1XBXA 5LHEA 1BTMA 1EJXC 1K8XA 2VC6A 3E1F1 3W6MA 1OZMA 4ZB0A 3NL2A 5CC6A 5CPTA 4AWTA 4YNGA 7ENLA 5LIXX 5LGZA 4U31A 3BVJA 3ITGA 1FWGC 3BG9A 3BK0A 3G1RA 3QQWA 3NUKA 4ZE4A 1O60A 4MNKA 1KGWA 3B8IA 4MNMA 3FYYA 2V2DA 2QGHA 4UTTA 1WDDA 4GLEA 2VDGA 3URAA 1WUFA 5BXTA 2YR1A 1HJQA 3W2NA 4JTIA 3DZ1A 8A3HA 1ZCCA 1XGEA 3ZVHA 1BVNP 3CO4A 1VIZA 4POCA 3L5LA 2Z1VA 3KOXA 3MJYA 5FAJA 5F7UA 2F6UA 2PWEA 4CU7A 3KCLA 1TQJA 1Y0EA 2GGIA 1IWAA 3RILA 4NF7A 5AY7A 2ON3A 4TVCA 4Q32A 3TYDA 3I3BA 3DX5A 1A5UA 2HV5A 3UCCA 1JUEA 4J40A 4XTIA 4PTWA 1I2OA 4D6CA 1I0BA 1VAHA 3VMPA 1FDJA 2PDWA 1UB3A 1MUCA 1YXDA 2ZXAA 3KBMA 4Q33A 1UJPA 3E2QA 5A8OA 2VC9A 1B9ZA 3GYEA 3EDFA 3MTWA 1G9HA 3DFSA 3S3GA 3I10A 3VKBA 3OHMB 1WKDA 1KQZA 3NL5A 1JAEA 5FL0A 3INPA 4LAUA 3VNKA 4XBKA 1DTUA 4Z1AA 2EBNA 2WAGA 3QZAA 1QU4A 1WAWA 4C6IA 4LEQA 1QPOA 2YXGA 1SFSA 5DBUA 4ZQOA 2IXVA 3K4WA 2Z28A 3C2VA 3C0LA 5CEWA 1DVJA 3LD5A 3UVIA 4BCEA 1JYNA 3W73A 1GG0A 1XLHA 1YNPA 1ZSXA 2AQOA 2WC3A 4O15A 2D20A 1OEPA 1CBGA 3E2SA 3LNMA 4OGZA 4S3CA 1L2QA 4MB3A 4DM2A 4M8UA 4V2XA 4HA3A 2HE8A 1FWFC 1E72M 2J7DA 3NQVA 2R8WA 2DT0A 4CNTA 2X09A 2QIWA 6ALDA 2EEXA 1E43A 3WNNA 4KIRA 2VX6A 1PZ3A 3A23A 3AIWA 2DZUA 2XU2A 2BWGA 2EXOA 1BXCA 1O66A 2O55A 1K9EA 3A22A 5E9AA 3FKRA 3NQ7A 4OHQA 1DWHM 4PZVA 2AGTA 4MY8A 3GKAA 2VEMA 3QGAC 3TWAA 1V0KA 2HNHA 3VNZA 1EC9A 1XGZA 3PF3A 3RGTA 3MUIA 2VWSA 3RRXA 3WQCA 3VZXA 4DB7A 1Z32X 4Z1BA 4HNNA 2ZC1A 4L1GA 5DEZA 1D3CA 4E4UA 5BZAA 4J3XA 1EUNA 5D02A 5ABEA 5CZTA 3N6QA 2GLKA 4NJKA 2CLFA 1DJWA 3UW6A 3A6OA 5A8QA 1V0NA 1IV8A 3WBXA 4UQBA 1YW1A 3NEVA 4ZTXA 2OU4A 3T8QA 3T0DA 1OFPA 3B8WA 1TWDA 4RDZA 4D6FA 3EDKA 1RALA 1J10A 1Z6KA 3W7PA 1P6BA 2TYSA 3QMRA 3TU9A 1W5OA 2ZICA 4UMBA 3SZ8A 1GPWA 3L4WA 1G4TA 5LXEA 3RLHA 1K9FA 2P53A 3I3EA 4MF4A 3SQMA 3WSUA 4GI9A 2VEFA 4GYJA 5A69A 3WMCA 3GHTA 3RU6A 1V6YA 4MMWA 4MWAB 5CBJA 4JKLA 3MYOA 1W9UA 1GVRA 3A5VA 4LANA 3IUHA 4J3SA 1JAKA 4ZXOA 2Z2AA 3TC3A 2IPWA 5A8MA 4MADA 4NJHA 3NYDA 1UP3A 4XO6A 3SUVA 1PKLA 3W26A 4HCHA 4LY8A 3IGHX 3EWUA 3M1ZA 4AHPA 4GIEA 3PZ9A 3DIPA 4FS9A 2DZXA 2B7QA 1E0VA 4H00A 3VD9A 3CZ8A 4U10A 3SY1A 3UY8A 3QQ1A 1MXSA 1WA3A 1HZYA 4U2YA 4G5DA 3JRKA 3U2CA 4IMDA 3NZ1A 3W02A 3R4IA 5IFTA 4YYFA 4JN6A 5EGRA 1FWIC 3SY5A 4JTCA 3SSJA 4NYYA 1XLIA 4Q8OA 3SEPA 2I57A 3L4XA 1HKIA 2C19A 4DJDD 3UZJA 1BWKA 3CTLA 3TV8A 4IM4A 8TIMA 4FF7A 3B8TA 1JXJA 1HVQA 1TB3A 2FYMA 3W1TA 1W1YA 3POHA 4ZGYA 3MP3A 3E12A 2PE4A 1RLCL 3O7UA 1AD4A 3QY8A 4KIEA 1GTEA 3H70A 2ZUWA 5A2CA 3WH7A 1C29A 4O8AA 3LYEA 3ABRA 3GB6A 2Y7FA 3N25A 2CKSA 2OT0A 2ZA1A 4S38A 4FSAA 4HOZA 3LCXA 4Q4SA 1TJ2A 2WK2A 2ZRVA 4C5ZA 5AHLA 4K1WA 3MMUA 3DYMA 2Q6ZA 4D6DA 1XYMA 1LROA 5FEPA 1W1A1 2PCQA 4Q3MA 1U5HA 2QPXA 3DFYA 1ADSA 2VFFA 3MUCA 3A4JA 1TV5A 1O94A 4AYSA 3N12A 3OW1A 1CXKA 1FXPA 2PLCA 1GVFA 3L68A 3DC0A 1QPKA 4QAWA 4D8LA 4BY3A 5BRPA 5TNVA 1EJUC 4OUIA 4DNHA 4WK9A 1AMYA 4JICA 2AKMA 3AUOA 3CAVA 4JCMA 4DELA 4JQ2A 3V75A 3ID7A 3N4FA 4AC1X 1AW1A 2ZRZA 3S1GA 4LEFA 2PTZA 3QRHA 3O15A 3CYVA 4M1RA 1F7BA 4AZGA 1C8QA 3W1MA 4C6LA 4MJMA 3BJTA 4B5XA 2DDXA 3TTEA 3VNJA 2YX0A 1T5AA 4JFVA 2O9OA 2OPJA 2WVVA 1TJRA 1SW0A 2DVXA 3WDHA 2Z26A 4GC3A 4GUFA 5HMSA 3BPWA 1KM2A 3WIJA 1I2RA 3R8HA 3MC5A 3UR2A 3CZKA 3VC6A 1I1WA 2NQZA 3CUFA 4JCLA 4RE0A 4GQGA 2BX7A 3N9SA 7REQB 3QV7A 4XAGA 3DECA 3QF0A 1UROA 2P88A 3B05A 1PKMA 2V82A 4S3DA 4AZIA 1ZQ5A 3T6CA 3P67A 3H6OA 1E56A 1IZJA 8RUCA 1BPLB 5C7HA 3LPOA 5D33A 2TAAA 3OPSA 2O92A 3I4KA 4A21A 5C7VA 4E4PA 2HS6A 3NGFA 1FWCC 3AXXA 4FR6A 3MJMA 4PUDA 3VAVA 1VEOA 1Q2SA 1NOUA 1ADDA 3UCDA 5J04A 2QYGA 3NDZA 2DZPA 4LRTA 4I9JA 4AY1A 1UR1A 3MS8A 4ICCX 1JIBA 2PTDA 2PDLA 5L9FA 1EPVA 3A12A 4BK9A 1DIOA 3S9ZA 3VFLA 2A3CA 4PB4A 3C86A 2AL2B 5FCZA 4YCOA 3M0XA 4RPPA 4F9DA 6ENLA 4C65A 3BICA 3S1WA 4ORMA 4AZ7A 2XFFA 1XV8A 4LCRA 3TMLA 2ISFA 2QNEA 4XAPA 4O1FA 5I7GA 1VJIA 1XP3A 1Q6RA 3TN4A 3WH5A 1JDAA 3QLLA 5CZSA 2UY2A 2OEMA 2CBJA 2YBTA 3WD4A 1WAUA 3C2FA 1V3MA 2IS7A 3TNOA 3MDWA 2J7FA 1K4HA 3R8RA 1UR9A 2PGFA 3QPZA 2OOFA 1UOKA 4OT7A 4XIMA 3W01A 1GNXA 2G0WA 3EWZA 4ZODA 1OFAA 4O11A 4HA1A 3ZLGA 1XPYA 4FPSA 4Z1DA 3BJSA 5K3VA 4PCNA 1EXPA 3QYSA 1XC4A 4TX8A 5CG7A 2J8FA 2CLEA 4UQDA 2FLIA 4DJEC 2E9BA 4LAKA 1B3OA 4L4LA 1V93A 4AZ6A 3N3TA 4LT9A 3H2CA 2FVKA 1OFBA 4YTRA 3WF1A 4LVBA 1AJ0A 4BEQA 3UGRA 5K2ZA 5BU6A 5B80A 2DT2A 1XCWA 1WZMA 3I6RA 2JEPA 3AIVA 4GRSA 3V4BA 2Z2BA 5TF0A 4LVDA 1IZCA 4IUGA 2QCCA 2ZTJA 4HMEA 3KVJA 1KFEA 1BVWA 5HNTA 3N2OA 4UTWA 1IWBA 1B57A 3SR7A 1AJZA 2V2HA 4PFHA 1E6QM 1S5MA 1LRQA 1JXKA 3FGCA 4IG2B 2YCJA 4EPBC 2WWCA 3GFXA 3PBYA 3KRZA 2I9EA 3GU1A 3G5EA 4MUZA 3I6EA 5FJTA 3W7DA 1GHRA 2OWXA 1LOQA 3A64A 3W6LA 3VIMA 1RA0A 3K5XA 5JMUA 3S1UA 2WKGA 1WNOA 1OCNA 3UWVA 1K9DA 3VX1A 3VOCA 1JGMA 4JTSA 3VXGA 4TO8A 1NARA 3FAXA 4UTJA 3MV11 5CPQA 4WLCA 2JBMA 4Q8PA 4Q4KA 2QCHA 1LWIA 4PBFA 3ARWA 2V5DA 2BB0A 3WD3A 1QDSA 2E25A 1Q5MA 2NZLA 1EO5A 1RP8A 4A22A 4DJDC 2JKPA 1EDTA 2J7BA 1RQHA 2HPIA 3RPMA 3S5NA 4ML4A 1EUAA 4DZHA 4P2VA 5A2AA 1TTPA 4A05A 4LUJA 3N04A 3M0JA 4J3UA 2V2CA 3AYRA 3HN3A 4JFSA 4I7WA 2G95A 2HSAA 3GDTA 4XUYA 4B91A 2YFNA 4Q8TA 1UP2A 2WLZA 1AW5A 1MRAA 3DXIA 2INEA 3PZMA 3IJLA 2WSYA 2JE8A 1C92A 1XSIA 4DIAA 3OB8A 1W91A 4ADUA 1TZZA 4W85A 3RM9A 2YCIX 1PVNA 4YXGA 3APGA 1OGGA 1TIMA 5FI8A 1KLZA 3SB0A 3FSTA 3AYTA 5FSDC 4Y8FA 4EVZA 4URIA 4JNMA 2V63A 1G69A 4LUTB 3H7UA 2DZAA 1GW9A 4H1ZA 4DHGA 2WBKA 3RXZA 1LRTA 1PE1A 1QVBA 3EWYA 5E6ZA 1ZPTA 1KA9F 2XJ7A 1VBGA 1P6CA 4AWSA 1ELSA 5F2GA 3V16A 1OX6A 1A5OC 1I60A 3Q45A 3DFOA 4M19A 3CEUA 3MWCA 3WLRA 4PGLA 1KM5A 5A1AA 5C6MA 4CQ8A 1GVQA 4IP5A 4JFTA 3HMJG 1P4CA 4IOTA 1UZHA 3EEZA 2F9RA 1B3XA 1XCFA 1DWGM 3LU2A 4K8HA 2XG9A 1PX8A 5C2XA 1JDCA 4GXMA 5EMKA 3TTYA 3FN9A 5IHSA 2I14A 2CZDA 1A53A 3NM3A 5E0KA 4K1GA 4I6VA 2EGZA 3O0KA 2IKIA 2BP1A 1J18A 2NXHA 4WVXA 1Q6EA 4GINA 3KUMA 4LF2A 4QSFA 1LWJA 3CPGA 3V5FA 1EJ7L 3W28A 1V3HA 2HBVA 3IIOA 1TWWA 2XIMA 1I2PA 3PWIA 1E9ZB 4JQ3A 4AB4A 1R30A 3WUFA 1W3JA 3H24A 2NSOA 1OF6A 4WRHA 1V6TA 3QOKA 2FGBA 3GNOA 5AOUA 3KRUA 3P6LA 3SCRA 1TX0A 1AJ2A 1E9IA 4DPQA 2OLSA 3GNDA 3VABA 4BA0A 3V5CA 2W66A 4UR7A 1HTIA 4NI8A 3LHTA 3RCMA 4HNCA 4RE3A 2YPIA 2BNJA 1R5YA 3W23A 1IHIA 4Q8WA 4O1BA 2P10A 2R24A 2W79A 1GQKA 2J7CA 3OJGA 2Z25A 5BU9A 5BMWA 3SY8A 4PYSA 3LI0A 2D2GA 3HOJA 3JZEA 4LS1A 3H7VA 3MMWA 4JIEA 5IHRA 2CHNA 3WDJA 1AQHA 3BO9A 3G18A 4DYJA 1EC7A 3AXMA 3QLDA 4NX0A 2DV0A 3HG3A 5A6JA 5FESA 4JL1A 1QPNA 3L2MA 4JGDA 4X0VA 3UJEA 2JF7A 3CHDA 1AG1O 2VUNA 1SPQA 2XSBA 4JX6A 1VYSX 1YMYA 2ZZ2A 2ZA2A 3ERPA 4PB3A 2I5IA 4MZ1A 3MI2A 4BF9A 3SRKA 3T07A 1XM3A 2WO5A 3SDOA 4JFWA 3NJ3A 1XL9A 4I9AA 1Q2RA 3HQNA 1K77A 1R38A 3AHXA 3TTQA 2IXUA 3UD6A 3CAKA 3GXIA 4PSRA 2YW4A 4PEKA 1KQYA 2FZDA 2FZ8A 4HHHA 1RH9A 1XD1A 4PRRA 1CXHA 1V3LA 3O8AA 4LW7A 1NWSA 1UQZA 3PS7A 1IIHA 5CZJA 4IMFA 1QASA 1OG6A 4ADTA 3WL1A 2ONEA 1WCGA 1Z9AA 3RLUA 1QNSA 3OA5A 1A4MA 1TCDA 3OG2A 3OVRA 1YIXA 3CUHA 3B9AA 1M3UA 1RCQA 1DXFA 1X1OA 2DSVA 2ZE3A 3M07A 5B7YA 3IGXA 3LCWA 1BXNA 4KCVA 4LAMA 1SO5A 3ZFHA 4ZO6A 4W9TA 4XO7A 2I5GA 4ZE5A 1EGVA 3W0KA 1LUCA 2X7WA 3W07A 3BG5A 3WLMA 4UQAA 3QGKC 1TWZA 3DI0A 1F9CA 3PZGA 7REQA 5ABFB 2JIEA 2PUZA 3LDVA 4XD4A 3WNOA 3L4VA 3NTYA 3NZQA 5KTLA 2ZXDA 1UD5A 5IM51 3BG3A 1KRCC 1TKKA 4HTBA 1OABA 1WZAA 5H8UA 1F61A 1YRRA 5IBXC 5B7ZA 3GM8A 3RR4A 4FMVA 3C3UA 3OZYA 3OQEA 1FWRA 2WSQA 4JIRA 1JGIA 2FJUB 1IEXA 3CPRA 4JIIX 3EWXA 4NRSA 1FWJC 1ZJBA 4DJFD 4LCQA 4GIYA 4S3KA 3STCA 3HJEA 3UY7A 3LRMA 2AAMA 3M9YA 4I90A 4O12A 3NOYA 2EG8A 3FV9A 2DZBA 1GGOA 4GNKB 4AFYA 1GK8A 2Y1HA 4Y6GA 1E4IA 3G1YA 3G6LA 9CGTA 3RX2A 4D6IA 5JXQA 1DE5A 1TCMA 3BAYA 1YHTA 4XAYA 4U3AA 3W6YA 1TJPA 4F0HA 2CWXA 3ZZ1A 2BMBA 3BURA 2UZ9A 4G7EA 5A6SA 3VIOA 5HWMA 3GRIA 3A3HA 4YTUA 1QOQA 3U7VA 2C0HA 3ICJA 2EG6A 3BH4A 4LYPA 4OVXA 3FDGA 1PEZA 3UT0A 1OIFA 5SWUA 3S83A 3SFKA 4FNTA 3OBEA 2ZX6A 1VR6A 4K36A 5KZMA 4ATWA 1GJWA 1TMQA 2ABBA 1DJIA 1PPIA 1HKVA 2CLIA 1I4NA 4N0RA 2W6RA 3M46A 1Q7MA 1XI3A 1XW8A 3FKKA 4DUVA 3CV2A 1KXVA 4IFRA 1A80A 3P0WA 4JIPA 5A6AA 1P7TB 1UWQA 2C8NA 3UZZA 1YBQA 2X16A 3SGZA 3WLOA 3T42A 3TE9A 1BFNA 4B5SA 5A8PA 2D73A 2IW0A 3LMYA 4ZO7A 3E49A 2PA6A 1OJXA 3KLKA 3ZR5A 3DG3A 2O9RA 1GCYA 2AKZA 3WH8A 5A8NA 2QV4A 1G7VA 1QK2A 2ZX7A 5GQBA 3W7LA 5CLTA 3GH4A 1HKWA 2YW3A 3LEPA 1JCLA 4E2OA 3C0SA 4GI6A 5H91A 3W84A 4LVFA 5HMDA 5AHIA 1KC7A 4O16A 1JNEA 4PUJA 4D8ZA 2JGQA 1NWUA 2Z4GA 3KEHA 4HNTA 2XZ7A 2VVNA 3TYCA 2ZZ5A 4PEEA 4US5D 1X1ZA 2J7EA 3GAYA 3BDKA 3R94A 2BBFA 1TWIA 3OVGA 2E6DA 2W3ZA 1YPXA 1RV8A 1SJCA 1F76A 3PTDA 4ZOEA 4MFDA 3EZ4A 1S3HA 4X61A 5DFAA 5FJPA 5DT7A 1RY0A 1HQTA 4H41A 1UASA 2HK1A 4GUJA 4J3ZA 4CN6A 4CCCA 3B06A 1J0IA 2DEPA 3QJAA 4O54A 4LC6A 4MB5A 4LVGA 2ISSA 4RW3A 3ABZA 4V27A 3UG5A 3UJ2A 3UG8A 3SADA 4EF9A 2REQA 3ZM8A 5CSRA 2BGSA 5HNUA 5REQB 3W2KA 1H50A 1D3HA 3GU9A 3ALFA 4EPKA 3HGOA 1EFZA 1XRSA 3IJQA 1UMYA 1FHDA 4IJCA 5AC6A 4JQAA 3D46A 4H2CA 3QY7A 1UWUA 4A8NA 1HKJA 3E5BA 1WXZA 3L2IA 5CC3A 4QE1A 3ARYA 4RZBA 2GWNA 1KCLA 1GQNA 4REQB 1MDRA 2CPUA 1T41A 4I5UA 2GK1A 4KT2A 1VPQA 4Q4QA 3PPCA 4AEEA 4AZHA 1KW1A 4W5UA 3GR4A 2WNZA 3SCNA 2DSWA 3OGSA 4OQVA 1BSIA 4Q4MA 1K3UA 3EAUA 4RE4A 1X97A 4A29A 3WH6A 2PWUA 4LUTA 3G1AA 5J8LA 1Z7AA 1SJDA 2BG5A 6A3HA 4AUBA 4YVXA 1O5XA 3BMVA 3BXWA 3J7HA 2FZNA 1TR9A 3AIRA 2EO7A 4NZFA 3CQHA 3R10A 4AX7A 4S3EA 3FK4A 5LYRA 5JBFA 1ONRA 5KZ6A 4HKPA 2YDRA 1IEWA 2GL5A 4N6EA 4Z2JA 3UXIA 3L21A 1NFGA 2HJPA 3RITA 3Q58A 3W1LA 2FPTA 4DRSA 3B9OA 1A4LA 2CXGA 4XVEA 2XGZA 4N7QA 3UR8A 4QCFA 3W82A 4WSHA 4KRTA 1TV4A 1XFBA 5LNUA 1B31A 1U33A 2H8XA 5DY3A 1Q63A 3DHUA 2OLAA 2VOTA 2PURA 4GG9A 3DI1A 1JEZA 4ECLA 2Y8UA 3AO0A 2YZ5A 3G0UA 3OLEA 4GKTA 4C6DA 1XSJA 3WELA 4S3JA 5ABGA 1G6CA 4A2RA 1CNVA 5AYYA 1W9DM 4NP7A 1KGXA 4NNAA 1EIBA 4FXFA 4IFKB 3WNPA 1OINA 4LAZA 5CPNA 5L6UA 4Z17A 2YYUA 1CLVA 2W67A 1E15A 4KEMA 3QHMA 4NXSA 3DGRA 2NW0A 5I02A 2VENA 3GUWA 4TMBA 4AWEA 3BOLA 3D0CA 2OR2A 3LM3A 4EX4A 4GBUA 5HATA 1UWSA 2X8RA 3AS3A 2X1UA 3R6IA 1DOSA 1HGYA 3VMOA 1KCKA 2A21A 4A4AA 5F2IA 2EHHA 4ICNA 2BHUA 1XH2A 4WHBA 2PI6A 3UPWA 1VFOA 4FNUA 1V03A 1V0MA 2VD8A 3PVFA 2Z1BA 3SJ3A 2Y8VA 1VH7A 3AZTA 1S5TA 2D2JA 4PB5A 6TAAA 3AALA 4H19A 1BTCA 3DC8A 1A50A 4PMUA 1Q8JA 1EZ2A 3HIJA 2A4AA 2NUYA 3GKFA 1GOMA 3TONA 8XIMA 1CGUA 1JYWA 1M6JA 1CT5A 4FALA 1D2KA 3VX0A 4I5RA 3HG4A 1A5BA 3SIMA 1H1YA 2E6AA 4ES4A 1JPIA 3WQWA 4QP0A 3B4YA 3MMTA 1IXPA 1CW2A 4R5EA 1PUDA 2NQHA 3NZRA 3K13A 2LLEA 1QO5A 1KBLA 3WLQA 3DFTA 1IT7A 1WO2A 2W92A 2WPGA 3PN8A 3CMGA 1XS2A 4N6FA 1FWDC 3LTSA 2CITA 7TAAA 2PP1A 1X6LA 3K1GA 3ABSA 2ZBTA 4AZBA 4HMNA 2FMOA 3LA4A 2RUSA 4L6DA 3PZIA 1PS9A 3E02A 3VCNA 4JTUA 4AHOA 2QUVA 4LCSA 1BVZA 3KS5A 2IKHA 4TUFA 4GISA 1YDNA 4XD5A 2E09A 1H1ZA 4HA0A 3WQEA 4QJ1A 3NQDA 1G94A 2ZUNA 2KZHA 5FF2A 4MLRA 5BOOA 1PHWA 4QNWA 4Q8UA 5AVNA 3SN4A 1YTDA 1VBHA 3SQSA 5I07A 1AQ0A 3P62A 4ZOAA 3WJXA 1QUMA 2QW5A 3W7CA 3GR7A 5LIKX 2ZA3A 5ABFA 1VLIA 1J0JA 2FH6A 1DWFM 1XUUA 3PP7A 3VMNA 3CU2A 2R14A 1M65A 2ANUA 4BR1A 3FDKA 1H7RA 4IQLA 3AHZA 1Q85A 4NJGA 4GZ7A 1A0CA 3S0CA 4PODA 1B9BA 4D6GA 2CKRA 3C8FA 4M82A 3WD1A 4DVOA 1F05A 1PZ2A 2DJXA 3VA8A 2WZHA 4JY8A 3P93A 1YLVA 3WDIA 3WDPP 3PZUA 1THFD 3W7NA 3TLQA 1DV7A 1XLGA 3TZFA 1V8EA 5KINA 2W5FA 3N2XA 3VOHA 1F5ZA 2VM8A 1OVDA 1PZ1A 1EX1A 3G1FA 5F1UA 4QQUA 1Q6CA 1QJWA 2FPYA 2J13A 4ACZA 1HF6A 2BY3A 2PWHA 3LHVA 1AK5A 3CUZA 1UYQA 3VNLA 3M0KA 3W4RA 2J6VA 1KRMA 2VGGA 1VBUA 2BXZA 3TLLA 3IIZA 1W54A 2WSRA 3MT1A 4UBPC 2XWDA 3C0JA 4WGXA 3VGFA 1B5TA 3S1XA 3F2BA 4GC4A 2HXTA 5E0FA 1JYXA 3EX1A 5K9DA 1TZ7A 4UTUA 4ASTA 3SCSA 3F4NA 1TPB1 4F79A 1WYIA 3OYZA 5CPMA 3L9CA 1MO0A 2FTWA 3LXAA 4Z2HA 1A5LC 3N17A 2XN0A 2FQIA 2ZOXA 4ADSA 2PU1A 2C1IA 2XVPA 1JL8A 2E6FA 4NAFB 1B54A 4Y8EA 3PJWA 5C54A 4GVIA 2PSNA 3ITVA 4HN4A 5HPCA 2UY4A 3B9DA 4Q4RA 1CXLA 3G8RA 1E1CB 5A8GA 4CCZA 4XQ6A 1MQQA 2DIEA 4R27A 3N14A 4YJ5A 3MQTA 2IMRA 4CN4A 5D2XA 3NAVA 1EEXA 2NQLA 4EWND 1GVSA 5K9CA 4C1NB 3VIFA 2HMCA 4RPQA 3MKCA 2VRQA 1ONWA 5CSYA 2PP3A 4DZ5A 5HINA 4RK8A 3QR1A 3LCIA 2FFIA 3I7RA 3W7IA 1RLDA 1A3XA 3UJSA 1M68A 3W1QA 3GBEA 4C6OA 2PTWA 3OU8A 1IEQA 4LB4A 4JTAA 3TQ0A 3TAKA 4F2BA 4CD5A 4HCDA 3FJ6A 1R7AA 1Q3NA 2MNRA 3GD6A 3LLFA 3NDOA 2E6YA 3MSDA 4FO4A 4Z2KA 5K9XA 1W0MA 1HO1A 2Y0FA 3E38A 3QN3A 4KFOA 3URNA 1E5JA 3LXBA 4DJFA 3HQOA 4CU8A 4P61A 2DZWA 5E9XA 1RJQA 1W37A 1A47A 1IGWA 1N8FA 1R0MA 3MBFA 4B3LA 1X38A 1NQKA 4EK7A 1X96A 2VJXA 5F4WA 2PRLA 1E0XA 1B3VA 4AD0A 3KX6A 3NPUA 3IANA 3U7BA 4K6AA 5C2CA 1XGDA 3BCFA 1DE6A 2D0FA 5LZLA 4N9EA 1YX1A 4AMAA 3MBDA 5FF7A 2C15A 3FSUA 1KV8A 4F0SA 3CWOX 3R43A 5TIMA 1FHVA 1Z89A 3U5YA 1X6NA 4HZ8A 5LNVA 3WF3A 2X0YA 4AW7A 5REQA 2P3ZA 1CI1A 3IEBA 3D3FA 3F2DA 4B5VA 1R9ZA 1ZCOA 4RKAA 2ZX8A 4GHRA 3KBVA 3UP8A 4DI8A 3CQ0A 2WKLA 3W25A 5EBUA 1A3WA 1UWAA 1TPWA 5LIYX 3WF0A 3TW9A 4X2PA 4MYXA 5A6BD 1HGWA 1LLOA 1W5NA 2VR4A 5BRBA 3HF3A 1H62A 3ES7A 1DWAM 4XZ9A 1S2AA 2BOEX 4FLOA 4S39A 1FVPA 4TMCA 1VB9A 3T4CA 3CZEA 3PBGA 3TR2A 3IGSA 4L7ZA 1LQAA 4MIMA 5CGMA 4B4FA 3Q94A 1O5QA 3DHDA 4DN1A 1LYXA 2A2IA 3TC6A 5D9OA 3HPAA 1XC6A 3FA5A 4H7VA 2Y5EA 2WVSA 4PUUA 3WK2A 4ZSUA 3OEXA 3JS3A 1AA1B 1UH2A 5KMYA 1GOWA 3ZVIA 4KBXA 4D1IA 3G1SA 1XG3A 2GDQA 3KE0A 5DO8A 3C2RA 2WPBA 1US2A 1UHVA 4J5NA 4HA4A 1S5NA 1OCQA 2XISA 3VCRA 2QV5A 1XLEA 1XYBA 2C1HA 4YU1A 3R25A 3W7MA 2P76A 4YCPA 2ZRYA 1R3WA 3B9NA 4DLMA 1PL9A 1VFUA 4WXZA 5HUOA 3ZWSA 1AH3A 4HU0A 2QDDA 3ARZA 1BG9A 3TA6A 4S3AA 3VD4A 2D0HA 1V77A 3NQAA 3S6DA 4DAIA 4HD5A 3N1AA 4F2TA 2R1NA 2ZKMX 3IUIA 2VELA 1UD3A 1TQXA 5U4NA 4CUCA 3UWWA 3MKKA 1PJ9A 4IFKA 4GFIA 4MG4A 2PD5A 1W5QA 2AMGA 4E4FA 3COTA 3ABOA 1LL6A 3F5KA 1R2RA 4AD1A 1PKYA 5C9XA 4W7VA 1HP4A 3MUZ1 4IQEA 2YCLB 1PCWA 1DYSA 4R34A 5FSEC 1TIWA 2IUZA 4EPEC 4XKYB 1KXHA 1TPVA 2F61A 5D9PA 3TYBA 1QBAA 3HV8A 1IXOA 2ACRA 2V38A 3DOPA 5EMLA 3SRDA 1UKQA 2WQPA 5H6HA 3CNYA 3OHIA 1XLMA 3R13A 2OSYA 1WQ5A 3PBVA 2FTPA 3UERA 3TFCA 1R8LA 4HYRA 5D05A 1HO4A 3D47A 1QCWA 1LQ0A 1M04A 3W83A 5M1TA 4AXKA 3W85A 4HSHA 5F4XA 1XIHA 1ICQA 1H7OA 2ZCGA 1G67A 2J7GA 1V6UA 1A5AA 4MNJA 1LCOA 4WY0B 4GMEA 3WH9A 1U1HA 1E6ZA 4MPQA 1N8WA 2WYSA 2MUCA 1RD6A 3LB0A 3FJNA 1I9CB 4BJHA 4MZYA 2NLIA 1E51A 4KKXA 4C6BA 3NZPA 2VEPA 1F6YA 1DP0A 4OJYA 4C6QA 3WJYA 1H3GA 3B8SA 3VINA 3VZYA 3TVAA 5LA0A 1KBIA 4U2ZA 3WN6A 1BD0A 1B3ZA 1WX0A 4IWWA 1TPC1 1FX6A 2E0PA 1FCBA 1FWSA 1XBVA 2OB3A 4B9YA 1VS1A 2G3FA 5A94A 1E0WA 1TA3A 3A3WA 2NSXA 1V3IA 4AX6A 1RCOB 1RPXA 3U0HA 4MTVA 4XZWA 4B90A 1UD4A 2XHYA 3SFWA 1S1PA 2QCEA 4GUGA 2DSKA 4B5NA 1LOSA 2NV9A 3JZUA 2QCDA 4HYVA 1W9XA 2Y2WA 3GNXA 4DUOA 4JKKA 4QFUA 1UWRA 5A2BA 4A35A 3K30A 1OC6A 2XH2A 3UR7A 1G7UA 1GEHA 1WXYA 1V08A 3I7QA 2H90A 1UBPC 4E5TA 4TTGA 4GQ0A 4ZXLA 5BXPA 1HVXA 3NO1A 3L7RA 2WCGA 1YNQA 1GJUA 3W76A 4PMOA 4AQLA 4A2SA 4C6CA 3ZJ6A 4ERAA 4Z2GA 1DJYA 2YDSA 3W87A 1KWKA 4IMGA 4IGHA 3ONBA 3HBLA 1K8YA 1ITQA 1UG6A 4O1DA 4UB9A 3AYVA 3RAOA 3M5ZA 1BRLB 1PYMA 5F2MA 4FLRA 4OZOA 4AH7A 3B0YA 5T9CE 4H6RA 4B5WA 4DO4A 3NL3A 2CBVA 3UZ5A 2HTMA 3WFZA 1KFKA 4EACA 1XLBA 4NYUA 3T78A 3TTOA 1JRBA 4RZ4A 1S3TC 2INZA 4XIAA 4QLLA 1OFQA 1F4AA 2QDHA 3K4DA 1A0DA 3EWDA 1C9WA 1E40A 4HU4A 4ML9A 1W1B1 1R3TA 3FS2A 3TTSA 3WY1A 3EGJA 4QDPA 3MMDA 2QXWA 3BE7A 3BZJA 2WMGA 3Q65A 3SUUA 3O6DA 4FXJA 2QAPA 4DBWA 3L65A 4EE9A 2OVLA 3DDMA 2X05A 5FJRA 3AU6A 1DQWA 5BWFA 3CH9A 2PDPA 2YCEA 3AHTA 5TAOA 4DQWA 4ZSTA 3B9EA 3CUGA 3E0LA 4JPGA 4X63A 1UA7A 1E3XA 1LLWA 4CQCA 2HK0A 3T1GA 3PZTA 2VP8A 1UUQA 4NAFA 4YN5A 1JZ3A 1Q6FA 2ACUA 3BARA 1YDVA 4N02A 4EANA 2OQLA 1B2YA 3GE7A 5IOBA 2Z1KA 5DLCA 2A3EA 2PF8A 1PV8A 4F66A 2WC7A 1WE5A 1W8SA 5CH9A 3PWAA 3TOPA 1JQVA 3QGVA 4YWIA 4IJRA 3PG8A 5MKGB 3GDBA 2QR6A 4HPGA 3S6TA 2XZ9A 5EFDA 2NV1A 3KZSA 5CPSA 4LGXA 4NG3A 1X6UA 1FDYA 1Q7ZA 2OZ0A 4H8UA 4F0RA 2O4MA 1MRQA 4C1NA 2EKGA 1K8CA 5J5DA 4R9OA 3LCFA 4LUSA 4U3CA 5FD0A 1TV7A 1TPUA 2VOMA 3DEQA 1VRXA 3WNLA 4M24A 1LJYA 2OZ3A 1WKEA 1NIUA 5GJMA 1UKTA 4Y90A 3DCPA 1KR1A 1UZDA 1YPIA 2ZZ7A 3H2FA 2EPNA 5EMJA 1OSEA 3LERA 1CLKA 4NKCA 4KETA 2Z29A 2EAWA 1L6YA 3GWQA 4UTTC 2Z1WA 2PAJA 3GAKA 2JK2A 1E1EA 1M7XA 1BAGA