1PTDA

Phosphatidylinositol-specific phospholipase c
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with myo-inositol.
pubmed rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 106
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1995-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ptdA00
1GYMA 2PZ0A 3EA1A 3QVQA 3EA2A 3OHMB 4OECA 3RLGA 4F2UA 6PTDA 1DJIA 2OTDA 1T8QA 3L12A 3KS6A 1O1ZA 1QASA 1DJYA 4I90A 1V8EA 4S3GA 4RW3A 4I9JA 1DJWA 2FJUB 4I9MA 1DJZA 3QR0A 4QJ3B 3EA3A 1DJGA 4QJ4B 4RW5A 3I10A 2ISDA 2PLCA 1DJXA 5T9BG 3KS5A 1YDYA 5T9CE 3QR1A 4Q6XA 1PTGA 3V1HA 1VD6A 4F2TA 4QJ5B 3CH0A 3H4XA 5PTDA 4R7OA 1XX1A 4GNKB 2ZKMX 4I8YA 2O55A 2OR2A 1ZCCA 1AODA 3MZ2A 3V18A 7PTDA 1QATA 4F2BA 3RLHA 3PTDA 2F9RA 1DJHA 1PTDA 2PTDA 2P76A 4I9TA 4PTDA 2OOGA 3H4WA 4RV3A 5T91A 3V16A 3NO3A 1T6MA
chains in the Genus database with same CATH superfamily
3BLKA 2QUVA 3VMNA 1DWIM 5JU6A 1UB3A 5GPRA 2PDYA 3I3EA 2WHLA 3T08A 1VFFA 1XYAA 2E1WA 4Y9PA 1OFQA 3MO4A 4Z1DA 4UQ9A 1RY8A 4CVWA 1QI5A 4AH7A 1LWHA 4ROPA 3WQ5A 3GNPA 4K39A 4W87A 4K7YA 1G94A 2OOFA 1QI0A 1NFGA 3SCRA 3UJEA 5CCZA 2A7NA 3V1PA 4YTUA 4LVBA 1QXLA 5DXXA 1SYTA 2QJJA 1NF0A 2E68A 2GVLA 3FHAA 1EX1A 4HBKA 4L1GA 1GHRA 2OZ8A 3EMCA 1SW3A 4UBPC 2HROA 1VAHA 3SM0A 2IQTA 3O3RA 1AQFA 2Y5JA 5BOFA 3BPWA 1W2VA 4QG9A 2UBPC 1C7TA 1JF6A 2CZFA 4PMVA 3I65A 3LERA 1VD6A 1VPQA 4NRRA 1GT8A 3L4XA 3HPSA 1FTXA 3A3HA 1T6MA 2GK1A 2Y7DA 3LTYA 3CEUA 3LXCA 3ANVA 4KPLA 4OE7A 3W86A 1YHTA 5KZMA 2BG5A 5IRPA 3LYEA 4GUFA 3L4WA 4F48A 1O68A 3NFUA 4O8RA 1R30A 2BV9A 5CSUA 4NY2A 1XIFA 3OJGA 3EB2A 1PBGA 3K13A 3N4FA 3BXWA 1SJDA 4O15A 1PUDA 1J2WA 4UXDA 4GQBA 3TOPA 4NXSA 5ABHA 2CERA 3TYUA 4M5PA 3T0AA 2ISWA 4XO6A 1R2RA 5AFDA 1FH7A 4DXKA 4JDBA 1ZPTA 3U6WA 4JXCA 1WPCA 1H09A 1V3KA 1LZOA 2XYLA 1QO2A 1JUKA 1GZGA 4PYSA 2OKTA 2PUZA 5FA5A 2WZHA 3QLDA 1BVZA 1SVDA 4LVDA 4JIHA 2CNCA 1I0BA 4U2YA 3PWIA 2XWEA 3U3HA 1BSIA 2VR5A 1E0TA 4LX4A 4AD1A 4Y9OA 3NL5A 3P7YA 4JTJA 4QSHA 5DLCA 4REQA 2FZ8A 3O05A 4MZ1A 3WQVA 3A21A 3ABSA 3CV6A 4DIAA 2C79A 1Q8AA 4PB4A 1UYQA 4PCFA 4S2BA 1TUXA 1K9FA 1V02A 4JN8A 5GQBA 4C1NA 3I7RA 1UBPC 4F9JA 2GOUA 3CJPA 2P53A 3PNZA 3S47A 4C6CA 2VFIA 3NQBA 1ICQA 3PM6A 3V0UA 5MHBA 1QNRA 1ICPA 2HK0A 1L6WA 5K9XA 3GHUA 4DUXA 3OLIA 4HPXA 1OM0A 1WKYA 4F2BA 4U3AA 1DHPA 1BRLB 2PGFA 1M41A 3DENA 2Z28A 2GQ9A 4JN7A 1Q85A 4KEUA 1T41A 4EPKA 4GY1A 3KBVA 4M7SA 4XZNX 3NAVA 1VBJA 3N2OA 5DY2A 3AZRA 4IQJA 3QY6A 2Z2UA 1VZWA 2PGRA 3W9ZA 3QZAA 1UZDA 2E6YA 4ES4A 5HATA 1TRIA 1Z7AA 4KEVA 1EXPA 1F61A 1OIMA 1WDRA 2PC8A 5CLWA 2E40A 1XGDA 3PJTA 4FXSA 3EKGA 3ITXA 1XDLA 2FTYA 1J0JA 2J66A 3PG8A 1F8IA 3ZLHA 2Y63A 3GB6A 4WY0A 1G67A 3S2LA 3S6OA 4HHMA 3L5MA 3LCFA 3B9OA 1GKRA 2VEMA 2O9OA 3BARA 3CZ8A 2YDQA 1HGYA 4AD0A 5FF7A 4LCSA 4HA1A 3H4XA 4Q8OA 1EJTC 1X7FA 3WLNA 1H7XA 4MNKA 1QW8A 4GJJA 1YEYA 1K8ZA 4DF2A 4S3GA 2J77A 4GNJA 2CXGA 1BXCA 3REQA 3LTPA 2ZTKA 1OSEA 3UWYA 2YLLA 3CT2A 2NW0A 3SRDA 4LSBA 1S5TA 1WUEA 2PTYA 3GBEA 3V16A 1VBHA 2ZZ3A 3VCCA 2BWGA 1CENA 4MYXA 5LHEA 4PSPA 3QOMA 4X9YA 4IISA 3W4RA 1H1NA 1AK5A 4QXIA 3ABXA 1Z89A 4CQ9A 1E6SM 2ZUSA 2ESCA 3EYPA 4ML9A 1W5NA 3URQA 4JIRA 4QE4A 4ZQRA 3SIZA 1QWKA 2FPVA 2PDPA 1Z32X 2MUCA 1H50A 1NEYA 4KFNA 3ZSSA 4W89A 1JIBA 2B31A 3NG3A 3GAKA 1JPMA 1DXFA 1PKYA 4Q4RA 4NAFB 4YPJA 4KWUA 5F7UA 1EGZA 4UR7A 3W1UA 2E25A 4QLJA 5GJPA 1FVPA 4GH3A 2RDUA 4O53A 4EPBC 5FI8A 2Y61A 3UWZA 4NZ4A 1W8SA 1EGVA 4GO9A 1T8QA 1OF6A 1FHDA 4I9MA 1NSJA 5CZTA 3M0HA 1KR0A 2PTXA 2OJPA 1O66A 4Q8MA 5CXPA 1WXJA 3WYZA 1ZQ5A 1HKIA 3WF0A 5F4SA 5HMFA 4CQCA 2FMOA 1XUUA 4UMAA 3NIYA 2FGLA 1YNYA 2QQ6A 3AHYA 3AUJA 2ATSA 3PR2A 3AIEA 5A6LA 3T8LA 2JGYA 1F74A 1PYMA 5G1MA 2I14A 3UD6A 1JJKA 1W9PA 4O8AA 4IZGA 1Y65A 5LIKX 3H21A 3NEHA 3VGFA 1HNYA 3SCUA 3VDGA 1B3XA 4C6IA 3IEBA 3IJIA 3W7NA 1PWMA 3S1UA 1Q5MA 3ANUA 3EX1A 1JCTA 4K68A 3YPIA 3EDFA 3DESA 1ZS2A 3MPGA 2I57A 3CHCA 3D47A 3VFCA 4INFA 1UJPA 3EDJA 3H24A 1TE6A 3OW1A 2WZIA 5DQPA 4IFKB 1PE1A 4Q4QA 1LJYA 4GVIA 3PTMA 3OBKA 1ZJBA 1I1WA 4ACZB 4K36A 3WBWA 1IQ8A 1KR1A 1VPYA 4OTKA 1E6XM 1IGWA 2JIWA 3LXAA 2CKRA 4B92A 2D2GA 3CPGA 4O10A 4G8TA 4JHOA 1IXNA 3CL7A 3PBMA 4PMOA 2BOFX 2Z7GA 3U7VA 2F7FA 1CPUA 7A3HA 4UNKA 2VEGA 1OCQA 2OXNA 1I4NA 1C3FA 3V3WA 2VRQA 1QPRA 3QKZA 3GXIA 4M82A 3U2ZA 3PAJA 2XSBA 1IHIA 2PWUA 2VX5A 2QCDA 4GI6A 3CS2A 4A35A 2CLMA 2RDWA 3GZ3A 4C6BA 3T7VA 3EOOA 1ICSA 1TCDA 3RM4A 1OC5A 1Q7MA 2PPGA 1R7OA 2YYTA 3WK1A 4CEUC 3VZXA 2OSYA 3BAWA 2FTWA 1DV7A 4AWSA 5E0FA 1X6UA 5DMNA 4JX5A 4QTGA 2A5HA 4MB3A 4JTHA 4IMFA 2GVYA 1GQIA 3HB9A 5FF2A 3AXKA 3GRIA 1OT1A 4WCJA 3I6RA 3LBOA 2BXYA 1QT1A 3GY1A 2H6RA 1M03A 2ISFA 5AZ1A 6PTDA 1O5KA 4M8UA 4W9TA 4BY3A 2D3LA 2YCJA 3H2MA 5I0DA 1EYEA 5J04A 3O07A 2AL2A 1I9CB 4EF8A 1POKA 4PTWA 3R58A 3PBVA 4MAVA 1GZJA 3CHVA 1J0YA 4LVGA 1XIIA 3W27A 3IARA 3VD3A 4AG0A 3VINA 3MKCA 1HT6A 3LB0A 2VEPA 3EOUA 3ONCA 4RKAA 4L9YA 3B05A 1HO4A 4TU1A 5D2WA 1L6FA 4FR1A 4UTMA 3M7WA 4FR6A 4XBJA 1JD9A 2Y7GA 2AQOA 2Z24A 3S2JA 3DFTA 3BSMA 1B30A 1JZ3A 4XKYB 3ARPA 4R7OA 1E1FA 1EC9A 1CB2A 3RK8A 4UTIA 3QXBA 1BG9A 1GOOA 1MFUA 1GOMA 3GDRA 4GHRA 3LMYA 2Q3OA 4TV6A 3LY0A 1Q65A 4KWWA 3UZXA 1SFLA 3WNLA 3C2YA 1R3VA 3UZJA 3VGEA 3M44A 2QLYA 2JIEA 3GM8A 1CLKA 4W84A 3E2VA 2XINA 2R1PA 2VR4A 3RLGA 4O0ZA 4M7TA 2VC5A 5MKGB 1KO0A 3N18A 2IKHA 4CCDA 3VZZA 1HX0A 2AAAA 2Z1SA 3CZLA 3W70A 3LS9A 3QHMA 3U9IA 3C2VA 3KBSA 3WBXA 1JZ6A 3W83A 4GJIA 1TA3A 4AEOA 4H7ZA 3AMDA 2X1TA 1OD0A 3NPUA 4QAWA 3R12A 2HVMA 3BWWA 1IWPA 3F1QA 4GI4A 1E0XA 2J25A 1MQPA 4PMDA 2UZ9A 1LOQA 1WA3A 3WQDA 4J3UA 3WLHA 1OGGA 3ALFA 4FXJA 4HK6A 3MTWA 3RR4A 8XIAA 2X1IA 3BAXA 2DORA 2VWSA 5CQ1A 3BVJA 1SM9A 4KESA 3WMSA 2BFGA 3M0IA 1JDEA 5CSRA 1QCWA 3H2NA 7REQB 2NQ9A 3AMKA 2CLLA 3V5FA 1QHOA 5FEZA 4E38A 4IP5A 2J7BA 5FF4A 3SRFA 4GC4A 1JZ4A 4W7UA 2DZXA 2DDXA 4B5VA 3TQ0A 3TK7A 4CD5A 5CSYA 3VIMA 2ALRA 3C2OA 2CESA 4PTVA 3NSMA 3DIPA 2WANA 1XPGA 1OK4A 2Y70A 1KFWA 3DG3A 4HU0A 2FKPA 5AVNA 1JCYA 4CQAA 1GVYA 3B8SA 3W7LA 4AZCB 1ZAJA 4B3LA 5CC3A 3EBVA 4LBRA 2QDGA 1OWQA 4TVDA 2QVNA 3W1MA 4M56A 3T05A 2ODOA 1TE1A 3WUBA 3OU8A 4GPNA 1YTKA 2W0UA 2ZUTA 4FO4A 5A5WA 4GXWA 2DSZA 4E8DA 3HOJA 1TMHA 3S6DA 3AIVA 1XLLA 1WDWA 2QAPA 2EKGA 3SY5A 1JPDX 5I79A 3NYDA 4LW7A 3BTNA 4E4PA 2HK1A 4WKHA 2EPOA 5E70A 2FHCA 3TV8A 5A6TC 1G01A 4CN6A 2HE8A 1FCVA 1JAKA 5BWFA 3V36A 1NF7A 1W5MA 3IVUA 1KQYA 4G56A 4JYDA 2Z0IA 3HMCA 2OWXA 1OBAA 3LU2A 1TRDA 3CU2A 4HNCA 1RSCA 4G6CA 1MYRA 5CPSA 1WKEA 3N29A 4PRRA 1AMKA 1ZTVA 3C86A 4L9XA 3K2GA 2W27A 4CEXC 5FJTA 1H7RA 5CEWA 3DFHA 3ZO9A 2DZAA 1LBFA 3PZTA 3SQMA 4HN8A 2NV1A 4AX6A 5HMDA 1WNOA 4Y9AA 3KDNA 1TQJA 1YBQB 3UG8A 2OT0A 4PODA 2CXEA 3W28A 3RFAA 5HNTA 3FHQA 3SCNA 4JCLA 3K46A 5CSSA 5LKYA 1IIHA 3UU0A 2DT1A 5SWUA 1AA1B 1GOWA 3PJXA 4XO7A 1LUCB 2OMAA 4WXYA 2X16A 3IPWA 3ZT6A 1KRBC 5LIUX 3IJ9A 3CQKA 3WH5A 2PWVA 2OELA 4DYKA 3SB0A 3RAOA 3PJWA 4F9DA 5EMLA 5BU6A 3DFSA 4GYPA 1ITQA 2GVJA 1O12A 2FVMA 1TTPA 1J2BA 3SCWA 2LLEA 4RE4A 4DWSA 4H04A 1V0NA 4DWSC 2VVNA 1H7PA 3UERA 4JIQA 3SUWA 1TX0A 3M5VA 5A69A 3NNTA 2GGHA 4J3ZA 1ZFJA 2ZXAA 2Q01A 2PURA 2BY2A 1RXOB 4C1NB 3FJNA 3E0LA 4A8IA 1H5YA 1KXQA 1A5AA 1V6VA 4PCNA 1K1DA 4GYFA 3OBEA 4WDUA 4A2RA 2EBNA 3G0UA 4K8GA 3MMWA 1GJPA 1EX5A 1YE6A 4LH8A 2BODX 4DWSD 3B0VC 3TTSA 3M64A 4FHAA 1E5JA 3NL6A 5I3DA 3GVVA 3WNKA 3MB9A 2OU4A 2NXIA 4GG9A 3JR2A 1MNZA 5KINA 5FJOA 3ZYZA 4J5NA 2XGIA 3PZGA 2Z2AA 3O2LA 3KOZA 4IIGA 2Y88A 4GMEA 4F79A 3WH8A 4AF0A 4NU7A 1TO3A 3W84A 1R6WA 2Y5SA 2BOEX 4ICCX 3T0TA 2NVAA 3MC5A 1GTHA 1XICA 2FQIA 3KHJA 1KRAC 1UWAA 3W7CA 1UCWA 3EDKA 2VZTA 4JTCA 1BFNA 3W23A 4ZO9A 4MF4A 3VNYA 3W01A 3Q37A 3QQ0A 3B0XA 2REQA 3DFQA 5EYWA 5GJMA 3IUIA 8CGTA 4G1NA 2D20A 2V0TA 1QNSA 4AYGA 4FB7A 3CQIA 3LPOA 3AZSA 1P1XA 2D24A 3HV8A 2ADAA 2HDJA 2J6VA 4H19A 2Y4SA 4WZHA 5AYBA 2ZZ5A 2XM2A 4LS1A 2OCZA 1OEPA 1JI1A 3PZIA 1OCBA 4ECLA 1G7VA 2XM1A 1RBOB 1I8JA 4ZVJA 4CUCA 3QRHA 3UG4A 2ACQA 1QHZA 3OO2A 4H4IA 3AS0A 1AH0A 4YWSA 1NDVA 3HURA 2O55A 3UG5A 3IJLA 3W07A 4H9VA 1A4MA 5C70A 3MWAA 1G1YA 5B80A 1K8YA 3TE9A 1UR0A 5DCBA 4H8UA 1V3MA 3TJLA 3QQ1A 2PA6A 2HMCA 1CGUA 5RUBA 4WJEA 5A6JA 4IIFA 4YXGA 2QMKA 1ZB5A 4JNYA 3CQ0A 2PLJA 4IPIA 2VT0A 1M9HA 1V03A 1SSGA 1RPXA 1ZLPA 2W62A 1YQ2A 3IJDA 1SMAA 2A21A 5JQ9A 4PMJA 1VIZA 3EX2A 3PK7A 4G7EA 3G2GA 3GFYA 3S4TA 1J6PA 1XYMA 2WMIA 5HBFA 2WMJA 3GHRA 3S46A 2CITA 4IH3A 3WQEA 1ISXA 3O6CA 2ZA3A 3CUZA 3VOIA 3LQLA 5CZJA 3S5YA 5CGMA 1LQ2A 3VM5A 1BVWA 1DJXA 1KA9F 1P5BA 1NFPA 3AAMA 1ITUA 3L9CA 3OLEA 1E9LA 4MG4A 1C7SA 1OK6A 4HPJA 3TC7A 4CN4A 1JUEA 1LL4A 5E09A 4KIRA 3VUPA 4JGDA 1CXEA 3NQ7A 1HKVA 1XD1A 3RILA 4GZ7A 1XINA 1I2NA 4XB3A 5IHSA 4L56A 1HF6A 4ZB0A 4UTWC 4CGTA 3E0WA 1XLEA 3SCSA 4WDWA 1R86A 2WMKA 4C6MA 4E4FA 4DRSA 4AXNA 3ZLFA 1LL6A 3KZSA 1SZGA 3M7SA 3SCQA 3LGEA 1JDCA 2A85A 2XTKA 1SW7A 3M9YA 5EMJA 3LCIA 5I09A 1WBJA 2EAWA 3QOKA 1W1A1 3TTYA 1Q2SA 3IV8A 4A3YA 3TH6A 3VD5A 3SJ3A 3UWQA 2E9LA 4GBUA 2IUZA 4C6NA 3IJ6A 3HFYA 1UH3A 3NQEA 1FXPA 4CNPA 3BLIA 3T0BA 4U4MA 3N4AA 4NILA 1XCFA 1XHGA 1OFEA 1NELA 1XI3A 4H01A 6XIAA 4LVAA 2OO0A 3GW3A 3IAPA 3NQDA 1WOAA 2PLCA 1I2PA 3GQYA 3EA1A 4UFKA 2FVLA 3O6DA 5TD4A 3UXDA 3HJEA 4AD2A 4TX8A 2XIQA 2PD5A 2RJHA 2BY3A 1CWYA 4BKNA 3EDDA 4A3RA 4ADSA 2X7VA 4HHHA 4Q8PA 1R3WA 3HGRA 5CAKA 6REQA 4CCCA 1F7BA 3HGSA 3W82A 1CGXA 3IK2A 2XIIA 3PWAA 3E5BA 3GR7A 4GA8A 3CUFA 3SURA 1JDFA 1AG1O 4YHEA 5JXQA 1IWAA 2BGNE 2R9RA 2JF6A 4HP5A 5AYZA 3T44A 1KCZA 3M0JA 1RPKA 2EG6A 5A1AA 2ABBA 2YL9A 3H4GA 3GYEA 5AOUA 3CV7A 1R3RA 1YXDA 2CBUA 3RLVA 4IP7A 3K1GA 2A7RA 1U2YA 4PTMA 3UR5A 4LRSA 3UPWA 2ATMA 2FGZA 2UY3A 5HK4A 4JL1A 2FZDA 3NEVA 3RX4A 2VQTA 3VOFA 1XM3A 2P3ZA 3N9RA 3V18A 3TZNA 1Z69A 2VOMA 3ABQA 3OA3A 4PUEA 3QMRA 4Q4OA 2BHYA 2XISA 5XIMA 1C90A 2ZWZA 3BAYA 1EP1A 4MSSA 1W1PA 1KTNA 2RGMA 3LUTA 1GOXA 1KBJA 4LUYA 4HKPA 1FWEC 3FDGA 4RCXA 1X6NA 5BWAA 3QW4B 1XLJA 1GVOA 3N1AA 1ZJAA 1LRQA 2P8CA 3BSGA 3FSTA 1KXHA 4EAMA 3S5NA 3BMWA 1FHVA 3ZR6A 4RNFA 1KLYA 3E02A 4OOZA 3BOXA 4UQBA 5FJPA 3AWOA 2E9MA 1B3YA 2BXZA 3H7UA 2J8TA 2XIJA 5D02A 1W5OA 2FHBA 2J7EA 3VIHA 4K1WA 4GXPA 3RGTA 5KEZA 4MFDA 1D2KA 4AU0A 2G4FA 3TUUA 3HQNA 4IPPA 4DZIA 1E6ZA 2OR2A 2VCCA 2H8XA 4HQVA 1Q7ZA 1TCMA 4JQ1A 1GK8A 2QIWA 2OOGA 1TPWA 4R53A 1VRDA 2QGHA 3AROA 5G4HC 2DZWA 3ITYA 5U7SA 2DT3A 1GQNA 3E1F1 2E28A 3FA4A 1F05A 1ELSA 2CCRA 2WNWA 4FALA 3AYVA 3P80A 4YCPA 1VJZA 4EKJA 4AY7A 2YBUA 4H8NA 4LGXA 3MANA 3WSUA 3DYPA 4PMXA 3FEQA 3OHMB 1K6WA 5AN7A 2V2CA 1IV8A 4XVEA 3SIMA 2YSWA 1RHCA 3L68A 1Y5VA 3O06A 4L7ZA 3VC5A 4CNSA 3DGRA 2NLYA 4ZFMA 3DN5A 3VCNA 2PDUA 3PAOA 1WAUA 1YPXA 3A3XA 2WKLA 3WMLA 5D9MA 3B40A 4DJFD 3L0GA 3BK0A 3WY1A 4BEQA 2C13A 3ORWA 1BRLA 1SGJA 3L4UA 3S5OA 4B5UA 3NO5A 4NKCA 5ECVA 4XISA 5FEWA 1M04A 1A5UA 1RUSA 4NAFA 5C2GA 1SFTA 1YDYA 5CKSA 5REQA 1BGAA 1GVEA 1OABA 2ZRXA 4GINA 2TODA 4UQDA 1TV4A 1WAWA 3I68A 1UW9A 1TWIA 3M41A 2YZRA 3P6LA 3GVWA 1O5XA 2BY1A 3MP5A 4WKFA 2VO5A 3BJFA 1WE5A 4Q8UA 3B97A 1RP8A 4AZBA 5EBAA 1EO5A 3C4UA 2ZX6A 2AMXA 4WKAA 3KBJA 3VNMA 3WKZA 3MZNA 3TXVA 3VE9A 4FAMA 3TN4A 3P62A 2CZVA 3GTFA 1YDVA 4Z2KA 5BRQA 1KM1A 1IXOA 1HQTA 4QEEA 2PDXA 1M65A 3OGSA 1E6PA 3QC0A 4O1CA 3TTOA 2HZGA 4AZ7A 1UZ4A 3G1AA 4DO5A 4IPLA 1EPXA 4DN1A 4RPQA 2Z1WA 4OGZA 1KWGA 3KRBA 3S1WA 1EF2A 3MUXA 4GK8A 3SUUA 3L12A 4TMBA 3FS2A 2QR6A 3CNYA 4B4HA 4GKLA 3UWUA 4AAJA 2WMHA 1OCNA 5HQMA 1A5SA 3TSDA 2ZZ1A 4US6A 2ZFAA 1D3GA 5F4XA 2VFEA 4TVCA 2FIQA 1BYBA 2GZXA 2VC9A 4J40A 1M7JA 1W9VA 1VHCA 3WELA 1Z48A 1CTNA 3H2EA 1RJQA 3CMJA 3CH0A 3W81A 2XSAA 3R4IA 3GUGA 4XAFA 1GWJA 3W2LA 3NZQA 1BKSA 2YA0A 4WDXA 5T91A 1TVLA 3BW4A 5EL1A 1E5NA 1LROA 1XJBA 5G2IA 3QTPA 3C2RA 4S3JA 2AOSA 1ZBCA 3PZ9A 4ZB5A 2CLPA 4LALA 2WZEA 4PFMA 2WSRA 4DJFC 2GJXA 2V5KA 1PKMA 4GIAA 3L2LA 2XIOA 1CXIA 1FOBA 1ZCOA 1XV8A 1X8CA 3G0XA 2PE4A 1LG1A 2Y6ZA 3K5XA 1V3IA 2PB1A 1H5VA 2VGGA 1V77A 5ECUA 5CG7A 3GTHA 5FEXA 1VFUA 3KOYA 3BH4A 1PCWA 4EF9A 3GG8A 3EWUA 3B9EA 3M0VA 4NJJA 3UY7A 3RITA 4DO6A 3BLFA 2VELA 1CX9A 5GVJA 3CB8A 4LANA 3DHUA 4A3UA 4LBUA 5FL0A 3RO8A 4AC7C 4C7FA 5EKYA 5L9FA 3ZWTA 3NXLA 2PWGA 6TAAA 3H7RA 3M16A 2DW6A 4UQAA 3S83A 2DW7A 3BCJA 3A9BA 1DHKA 1PAMA 3TJ4A 7XIMA 4CD6A 1BD0A 3GD6A 4S3AA 2PZNA 3O6AA 3POHA 1E6NA 1NVMA 2B4GA 3H7VA 4KWSA 3PTQA 1JZ7A 4B9YA 2VUYA 2ZRZA 1A3HA 5JUVA 3KLKA 1EZ2A 4LB3A 5D09A 3MJMA 1YTDA 1P0NA 1EO7A 4AF0B 2YL6A 3MUCA 3S5ZA 3DG6A 4NNCA 1LUCA 1ENUA 1F3WA 3CMFA 3NO3A 1WO2A 2QT3A 2YX0A 1RAKA 3RG6A 1W1B1 1V8EA 2EQDA 4NNBA 5LIYX 5JBFA 3W02A 1VC4A 3RJXA 1ISYA 1XLKA 3W7OA 3VMPA 2X2GA 1BXBA 1E4MM 4L1XA 3M43A 4OT7A 3Q94A 4J2PA 3E0IA 1PZ0A 3P74A 3TFXA 4D6FA 4O19A 4FX6M 1LF1A 8A3HA 3BURA 1P1MA 3MI3A 5I06A 2VZSA 2XIBA 4JX4A 1XIMA 1WXZA 1Z9AA 4HZ8A 4O11A 1TREA 1UUOA 5KZ6A 5M03A 1RLDA 3STEA 4KEMA 3KTCA 3HJZA 1EDQA 1E6RA 2Y8UA 4JFTA 4LXFA 3WD0A 3CUGA 4ZOEA 4NYUA 4AZ6A 5L6UA 1SJBA 4MIMA 3MWCA 2ZC8A 3DEQA 3KXQA 2I1OA 1DIEA 3NGJA 4DWSB 3CQJA 2WC7A 4ZQPA 5E0CA 1EA0A 3M0XA 2XIMA 5K4ZA 1UD5A 4RDYA 1IT8A 3FLUA 1A5CA 4PUDA 2XN2A 1Y8BA 3LV6A 1ZU8A 4TOQA 5DT5A 3QW3A 1MRAA 4UTLA 3LM3A 2YBTA 1SZNA 5JH2A 3SUTA 1SO5A 2CETA 1XW8A 3P82A 1R3TA 4LY8A 5HQLA 1TWSA 1FCUA 3O6YX 3T4CA 3N2XA 2VFDA 2QCNA 5HULA 2D69A 4J7RA 4TTUA 4P7OA 1DWFM 5E0KA 1B3WA 4XZLX 3M0ZA 4HMDA 4PMNA 5CH9A 3V75A 4W8AA 2DSVA 1D7KA 4JR5A 2Y7FA 4OWGA 1GVIA 1EA9C 3B8DA 1AD4A 2XDFA 3THDA 3AXXA 3VKCA 1ZAHA 2J78A 4DLMA 4FA3A 4MKVA 5CPMA 3T6CA 5AC4A 5LNRA 2QUUA 2J62A 2YA1A 1HO1A 1UQZA 3QV6A 3LNMA 5I3IA 1AQHA 4GCAA 4O16A 5EU9A 4DJEA 2OODA 4IMGA 4L4OA 3U8GA 3QLLA 2GSJA 4OOUA 1EWEA 5EY5A 4FF5A 5HDRA 2WM1A 3T4WA 4A4AA 2DT0A 5D30A 2ZUMA 4TTGA 1BYDA 3W2NA 1EJUC 1E1CB 1IGSA 4DB7A 4ORMA 3K8KA 5BXSA 3OVGA 3ZVHB 4XTIA 2YW4A 3M1ZA 2NSXA 4UTHA 5ABGA 3K30A 3WL1A 1GNXA 3SN4A 4HZ7A 4X0NA 2XG9A 1MQQA 3W7QA 2YL8A 3PF3A 4O1BA 4X22A 3BQ5A 1TTQA 3LPPA 1NOFA 4MPQA 5XIAA 3V0SA 3KWXA 3L67A 3DYOA 4UCGA 4HHLA 4RE3A 4IMEA 4G9PA 3GG1A 4GE8A 4LOCA 3ZVHA 2D2HA 4O1AA 1X96A 2VZOA 1ML1A 5BMXA 4X2PA 5D2TA 1NWSA 1FHUA 2V82A 4ADTA 3F4NA 3NXFA 3W7KA 3C5QA 1GOKA 1DJZA 3MP3A 5HA7A 4I7UA 3VX0A 5E5CA 3H26A 2PDNA 5LIXX 2YXXA 4IPJA 1F9CA 5A94A 1XF0A 2W67A 3U4FA 3TCEA 1E72M 3FJLA 4EPDC 4BI6A 4GZIA 4V28A 4KMQA 3RCYA 1Q6EA 1Z6KA 5AY7A 4IJCA 3TU9A 3E74A 3BSHA 2B81A 3KZPA 1TTIA 2VHLA 1Y5XA 5EMYA 1I0DA 1PYFA 1I2QA 5D38A 3N34A 1T5AA 4GIRA 1HW6A 2G50A 5C2XA 4TO8A 2PGEA 4C90A 5XINA 5PTDA 1XIHA 1PWLA 4RLIA 1XR2A 3TONA 3ARXA 3MU7A 4J3VA 2RDTA 3RX3A 3O16A 4DHGA 1FWNA 3CUXA 6A3HA 1PO9A 1JRCA 2BX7A 1ONXA 2YZ5A 1XX1A 2A4AA 2BSLA 5TF0A 1S2WA 1XLFA 4K8EA 2QCHA 4XAYA 4G1KA 2A3EA 2G41A 1NOWA 1TPC1 3GUWA 5CC7A 1Z42A 1BVNP 3PB0A 1KM4A 4DBDA 2ICSA 4DZAA 2O9RA 3G1SA 3P5ZA 1YXCA 3NL2A 1ZP3A 1EF3A 3WF3A 2POZA 4MDPA 3MA8A 3DX5A 1V0KA 2O7SA 4MJZA 4DBWA 4PL1A 1NARA 1O1HA 1Y7VA 2G3MA 3AMLA 2DQWA 2Y24A 1BF6A 3B3DA 4P8VA 4Q4MA 3W26A 4MMWA 1NH6A 4GIEA 3W7EA 2FH8A 2GGGA 2CPUA 1X1OA 2INZA 3AHXA 2DSUA 3MO7A 1KRCC 3QBUA 4RW5A 3N73A 4URIA 3WLOA 4D6IA 1MI3A 2D2JA 3G6MA 3HPZA 4BEUA 3LDVA 2X09A 1XKJA 4N0RA 1QUMA 2EPNA 3MP4A 5TNVA 1CT5A 3NZRA 3N9KA 5AHNA 3DCPA 4B4FA 5DCEA 2NT0A 3OLGA 3LPFA 4Z1CA 5BRBA 2VRKA 1WDDA 2NQJA 2GJXB 4HMCA 1A0EA 4O54A 3RR1A 2AQWA 4GUHA 1JYWA 5BMWA 3RCNA 3ZR4A 2QDEA 4PB5A 2WO5A 4ZQCA 2Z00A 2R14A 2WZMA 3KCLA 3PPGA 3B8TA 4LCRA 4YTRA 3C2FA 5I00A 3CIXA 2DQXA 2VMFA 3LLDA 3C61A 1A5BA 3B0UX 4PL2A 1CNVA 1UR3M 1ZUAX 4JOMA 3CAKA 3N6JA 1I6NA 2QJHA 3ZJ7A 3A23A 5H8PA 4D6CA 5I07A 3AS3A 3LSCA 3W87A 3T2QA 3HPXA 3KS5A 3IIPA 4ZENA 3M0KA 2GDUA 1VJIA 3IUDA 3IWPA 3OGRA 3WK0A 2Z6IA 3GFXA 3IGHX 4F8XA 4CVUA 1EOMA 1OX6A 3EB4A 3TR9A 3TQVA 4H6RA 3QSTA 4CNUA 1H51A 2O9TA 4O50A 3USBA 4KFOA 1WDPA 1UKOA 1FWWA 2FZMA 1HKKA 1E43A 4UFHA 4L4PA 4ZO6A 2OLSA 4L80A 4LPCA 4DZHA 3C52A 1EOKA 4I9AA 3MT1A 4UCFA 3N15A 4ACZA 1W31A 4DAIA 3SSJA 3GKFA 4QCEA 2E5CA 1F76A 2B0MA 3OHIA 4I9JA 1MRQA 3MJYA 3UBPC 4V2XA 1JXKA 1IZKA 4QRNA 4RXGA 2OZTA 3NPXA 5KMYA 4RJEA 3UXAA 4EXBA 3W7PA 3MKVA 2XZ9A 5HNUA 3WNMA 2GUUA 4MY1A 2ISVA 1PZ1A 1DOSA 1VR6A 3CHEA 1LBLA 3N6HA 4DPQA 2VEFA 3I7QA 2E8YA 3TA6A 1CXFA 1SSDA 2GLKA 1NY1A 3VFLA 2QF7A 5A8NA 3BG3A 4XSMA 4NVTA 1T0OA 2QJNA 1TVNA 2FPYA 2GJPA 3W29A 3F7JA 4P61A 1JULA 5E93A 2ISSA 4UTJA 3L66A 4LB4A 1KQZA 3VIFA 1C9DA 5M17A 2A3HA 2OQYA 5I23A 3TR2A 1W54A 3BANA 3MQTA 3C6CA 3EGJA 4G5DA 3VKBA 1UH2A 4JQ4A 3CC1A 3CASA 5E9XA 1V5XA 5CJNA 2HXTA 2QPXA 1G5AA 4QLKA 2A3BA 4BR1A 4NT0A 1ISZA 1CGVA 1OHLA 4O17A 5C5YA 4BF5A 3ES8A 1S5NA 1SJCA 1Q6CA 3W2KA 3PFMA 3GDBA 4HPHA 2XFRA 2VVSA 4CU6A 2JK2A 2Q8XA 1C9WA 2X2YA 1TIWA 4U3CA 4GI8A 3NOYA 4XG1A 4GACA 2FZNA 5JMUA 3SDOA 4BQ3A 3I3DA 4I5XA 3W72A 3TZFA 5BRPA 3EB3A 2R1KA 3DHDA 2Y0FA 3HQ1A 1VB9A 1A53A 5EMMA 3T8QA 4MAZA 1QTWA 3CIWA 1K9EA 1VYRA 2OYLA 2RDXA 3LZ5A 3GC4A 1DBTA 3EA3A 1S46A 1MW1A 1KB3A 4TXEA 3NOEA 2UY5A 2ZXQA 3VGDA 4TUFA 4BCEA 4JTKA 4C91A 5AYXA 2WNNA 4V27A 1XIEA 1H1YA 4PCTA 4IFKA 4GQ0A 1QMLA 3PBWA 1TYGA 3J7HA 2E6DA 3NO1A 4Z2IA 5I78A 2XVKA 5EMUA 2PLMA 3BUVA 3V4BA 3VOJA 1NP2A 3BAJA 4XIAA 4A21A 3MMUA 4X63A 4UMCA 4F0KA 3KE0A 3G77A 4D6GA 3K4AA 4WRHA 4OKDA 3B9NA 3RXZA 4B9ZA 2CZDA 1WCGA 4EIVA 5EMKA 1S3HA 2CBVA 1V6XA 3WDHA 1RCXB 2DGAA 3N13A 4HGXA 4GYKA 3G8RA 5GJNA 3G1YA 4BHYA 3QHNA 2INFA 2WVSA 4PMQA 3SGUA 3BG9A 1AJ2A 3VOGA 4U2ZA 1VIWA 2PS2A 4N42A 4AD5A 4AD3A 4C65A 1TMLA 4GH1A 4C7GA 3B8UA 3MUAA 1O95A 1DJHA 2F8QA 5ENLA 1K70A 1US3A 2J13A 4UTWA 4REQB 1RVGA 4UOJA 4AIUA 5HMEA 3PVFA 4M81A 3TC3A 1BAGA 1EL3A 3BGGA 1XBVA 1PTAA 3GLCA 3CZJA 3NDOA 4JTEA 3RF9A 3H4WA 2UV8G 3TAOA 1P0BA 4JQ3A 1MFVA 4CKQA 1G4TA 2E4TA 4GQQA 2ZZ7A 2DUAA 1BYCA 3DXIA 4UTKA 4QITA 7ODCA 2WW5A 3R79A 3P8JA 5LSMA 1R5YA 2Z6JA 1KGWA 1FBAA 1W9XA 3NTYA 1BQGA 3L23A 3R8RA 2HS8A 1EJXC 3FIGA 4IL2A 3WQGA 1GQLA 3BLPX 3UR7A 3FAWA 1X8FA 2CHRA 4U5IA 4DUWA 1US0A 3R8HA 1TJPA 3HZ3A 1GOQA 2ACRA 3XISA 4CNOA 9RUBA 2F6XA 1V3JA 1XYLA 5LA0A 4FXFA 4DBSA 3A22A 4I6VA 4P7QA 4QNWA 3VDBA 4ZQOA 4DO4A 1XG4A 4I5UA 1ONRA 4J1OA 3AZTA 3T55A 3BQ6A 1DQUA 2YYUA 3NVDA 4N9EA 4S23A 3PG9A 3VXGA 4TVUA 2W79A 1XPYA 5BOEA 3THCA 2CHNA 1XCWA 1T96A 1W3KA 3LENA 2OYMA 1EBHA 1TV7A 2OTDA 3BW3A 2XVLA 4EVZA 2TPSA 4EXAA 1JEZA 2J9YA 1D3HA 1RVKA 2QW5A 4PBEA 4PMYA 4LYRA 5FL1A 1FWRA 1FWAC 1ME9A 2BGQA 3EWCA 3LHUA 1ZENA 4UQEA 2QKFA 1CZ1A 5FAJA 1F4AA 1ZZMA 4X2RA 4IIHA 1HTIA 3W00A 3IACA 3P0XA 4BWLA 4IIEA 4GYPC 4ZCWA 2PCQA 1E9IA 4IG2B 4HTYA 3STFA 5I6SA 4AUBA 4JEQA 3CBWA 4WX2A 3SUVA 3K8LA 4S38A 4AVNA 1FWCC 2Y8VA 1QWGA 1U5JA 1ZCCA 4HJWA 4AYSA 4LUSA 1K3UA 4DF1A 1R3QA 1LLZA 4KWVA 2JEQA 3ATZA 3PC0A 4YYCA 4ZE5A 5EFFA 5TIMA 1PHQA 3KTXA 3NM1A 2XH2A 4JYEA 1DKWA 3GR4A 4LTSA 2WJDA 3DC0A 4A3QA 4ATDA 1L8PA 3E3HA 4XVDA 1CEOA 4HNUA 3N04A 4GVHA 1HKMA 1JG9A 4J9JA 4AX7A 4HD5A 3WQ8A 2WAGA 4G7FA 4HPGA 3E96A 1S5VA 3DFNA 4PCSA 5LA2A 3VO0A 2X42A 1UA3A 4MYAA 3L2MA 3A3WA 3FDKA 2WSKA 1EGMA 1JXJA 1XYZA 2BP1A 1DVJA 5GNZA 1K02A 1OFOA 5C7VA 2YOCA 4HZ6A 3OG3A 3PY2A 4ZE4A 1L8NA 3EKLA 3GR8A 2FVKA 4US5D 1MW2A 1ZAIA 4QJ3B 1F3XA 3QPEA 2WM0A 1Z8AA 2X41A 5HWMA 1FP8A 4NUWA 4Z0JA 1XSJA 4E2DA 3QVQA 4E3TA 1CLVA 1B90A 1IEIA 4NJKA 4JNZA 1VJSA 3PP7A 4UNIA 1KKOA 5I3HA 3UESA 4LAZA 1XH1A 2Z2BA 3QZ6A 3TC6A 4OIFA 1V6UA 1XLHA 4LY4A 2XGZA 4JAWA 4F4RA 3R10A 1XRSA 3IS4A 3VK5A 4FNRA 4R34A 2ZX5A 5M1TA 3W76A 3HV9A 3R6IA 2A2IA 4JS3A 4MOZA 4X0VA 2O0TA 4RDZA 3KL0A 2R1NA 3M4HA 3GNDA 4Q32A 3WK3A 3A4XA 4B16A 1X98A 3A4AA 2PBGA 3D0CA 4PGLA 2BVDA 4HYRA 4X60A 5AVHA 1D8CA 2D1ZA 5I5RA 3V5CA 3UJRA 1UA7A 4DJDC 1FFQA 2UY4A 2KX9A 3SAZA 1C29A 2G37A 3LV5A 5C71A 1Q13A 4QE1A 1L2UA 3G1XA 4IX0A 4L4LA 2IMRA 2PTDA 2A0NA 1EP3A 1GQKA 4OECA 3UFYA 4D8ZA 4Z2LA 5FCZA 1BYAA 3CL8A 5HPOA 2PODA 3VD4A 3B8WA 1WZMA 3FXGA 4GFSA 5FSDC 2QHAA 2IQDA 1V7YA 4XZIA 2PDGA 3URBA 3RRAA 2V2DA 4LYQA 3IIVA 2PWHA 1MZHA 4A3HA 3POCA 3C8FA 4IFOA 3UP8A 4D1IA 2ZRUA 3FA5A 4WGHA 1HJUA 3VPLA 1C8XA 1VEPA 2ABAA 2ISDA 1HJXA 3WD3A 4F2TA 1E0VA 3NURA 4RNJA 4GO8A 4KEZA 4Y90A 1KTCA 3M0LA 7PTDA 4ZMGA 3AJXA 2VCAA 2HPMA 4CCZA 3CK5A 3ENLA 3QC3A 3LBMA 2C7FA 1K7XA 1MMFA 1QK2A 3EWYA 1DJYA 3H53A 3HM7A 4X9SA 3MBDA 4PMRA 3ANYA 2DH3A 5BW6A 1A0DA 4HZMA 3QZEA 1Q7QA 1K6AA 4NG3A 1S1PA 3ZJKA 4O28A 3CO4A 3UXLA 2QF8A 3QYQA 4LV4A 1BTCA 4WXZA 4ZL1A 3AALA 3WLKX 3CPUA 4JTUA 3QSRA 2OPJA 3M0YA 1IZJA 2G3IA 4NI8A 1CIUA 4JICA 5I3FA 3N4EA 2ZDSA 1OFPA 3IAQA 4PSRA 2HS6A 2EG8A 3HQPA 2V38A 4D6JA 3N2CA 1GEQA 1QJWA 5CPQA 1HL8A 3PBGA 5JH1A 3N12A 1VFMA 1D3CA 1SR9A 1E4NA 2Z1VA 2OSXA 3WJWA 3U48A 1A0CA 1J5SA 4M0XA 1LBMA 4A05A 4JFSA 2MNRA 4QDMA 3GDKA 2DIJA 1IT0A 1LQAA 1XIDA 1UIOA 1Q4NX 4FP1A 3ARWA 5F2GA 2X0SA 1EIBA 2PEVA 2GVEA 1XQKA 4XX6A 4ORIA 3SZ8A 2YL5A 3Q67A 1F3EA 5HXMA 4IF2A 4I9TA 3L0NA 4E8GA 1JD7A 1TR9A 1XKYA 2Z1KA 2R8WA 4KT2A 4F2UA 2VC6A 5D2XA 4R88A 1TTJA 2ZRWA 4QEHA 3GNRA 4B2DD 2JKAA 1K03A 4WUIA 2YA2A 4E8CA 4QLLA 1MXDA 3FKKA 1YDNA 1KKRA 3QEZA 4YHGA 3RLHA 1WB0A 1SZEA 4YMZA 1GEHA 1ZL1A 2QDDA 3U0HA 1C93A 1NWUA 3A5FA 2G97A 5A8GA 3DI1A 3T81A 3GC2A 1LM1A 1RA0A 1KM5A 2X0YA 3EXSA 1XLCA 1EEXA 2PI6A 4MLJA 2ZUVA 4RX0A 7CGTA 3ITTA 3VKJA 2TSYA 2FMNA 3ARZA 1FDJA 2HEJA 3QJAA 3W37A 2IW0A 1PTGA 1QHPA 2JF7A 3H23A 4AXKA 1X38A 4H8VA 1AL7A 3AISA 3AYRA 4LBSA 1EC8A 1POJA 4NZ1A 1OGBA 2C1GA 2GWGA 4U28A 2YFNA 4D6DA 2WJZA 3GW0A 2NSOA 5M2FX 4A2SA 1F73A 1S3TC 3QH2A 2W61A 3DDMA 2IXVA 2A6LA 2CWNA 1UH4A 2ZX8A 5C55A 2GJRA 4GX9A 1R9XA 3KFTA 5CLTA 3H2AA 2YCLB 4UOQA 4IG2A 3FYYA 3FKRA 2RH9A 3CQHA 1VBUA 2QUTA 5C8BB 1SJAA 3FGCB 2G3JA 4LNYA 3KUMA 1Z41A 3WCZA 4DM1A 1UPPA 1E9YB 3IK4A 4LRTA 1KLZA 1NTHA 2BVWA 4FNQA 2VX7A 2NVCA 3CTTA 4HIBA 2E6FA 3IJQA 4B5NA 4P7RA 9XIMA 4B5TA 3I6EA 1IEXA 1OZMA 4FLOA 4ERIA 1DWJM 5C9WA 5T8GA 2DV0A 1U1UA 5D04C 1CGYA 4IFRA 2OQLA 2QCEA 2IKGA 5I3GA 1UROA 4XD3A 3HIJA 1RQBA 3WJSA 5GNYA 2X30A 4XIMA 3WLRA 4XAZA 1NM9A 3TW6A 1SO6A 4DEFA 1FDYA 4K37A 3S3GA 5F2MA 4RV8A 4KIEA 3DBPA 3M5ZA 4XKYA 3GNXA 4HTBA 1YXYA 3HU7A 4ZOAA 4HPNA 3WDIA 1OG6A 1W1YA 3UVIA 8TIMA 2ZRYA 3QN3A 3TX9A 4G7EB 3W38A 4Z17A 4M6UA 4U33A 4QG8A 2DUXA 5LNVA 3KWSA 2H9AA 1EBGA 3K1DA 3UYIA 1I45A 4LAOA 2YDAA 4LEQA 2Q8ZA 2XUCA 4NHVA 5AHFA 3DOPA 3LA4A 5FAGA 2A3LA 1QBAA 2W6RA 4EAYA 3NZ1A 2YFOA 3PFRA 4XZ9A 3CPRA 3ITGA 5DY3A 1R0MA 1XDMA 3A12A 3G24A 4M6PA 4C6QA 4JNMA 1JRBA 3GIQA 4ZEPA 2F38A 3W2MA 4OBTA 2WC3A 3FGCA 1ZRQA 5FOOA 4Q6XA 1LRTA 4DVOA 2V3EA 3TQKA 1HL2A 1KRMA 4PCPA 3AXIA 1U5HA 1CECA 3MSDA 2Z27A 4IUGA 2Y5EA 3RUBL 3NZGA 1OX4A 4S3FA 4D9PA 5C2CA 2EHHA 3CAQA 1TJ2A 2PDCA 4IUOA 4ZBCA 1ESWA 4LJ3A 5A6MA 1S39A 1EZWA 1LLOA 2A3AA 5CG0A 2YDSA 3L4YA 3MMDA 2WHMA 3TN6A 4LUJA 1TWDA 4KW2A 3TYAA 3EX6A 3WN6A 1EFZA 3W6LA 1FFRA 3T0DA 3QM3A 3U5UA 4GABA 3VIOA 1XQLA 1SFJA 4RE2A 2FB2A 3CZEA 3ARVA 4UMBA 5DCDA 1WZAA 2DZUA 3N2BA 1ZALA 1UWRA 2Z29A 3RIKA 4GYJA 1H0IA 4XWUA 1HUVA 5G2HA 2I9EA 3TXZA 2YR1A 4H8HA 2R82A 3KVJA 3R89A 1B3OA 2W66A 1U22A 2QCFA 3WQ4A 1QW9A 1OJXA 2ZQ0A 5G4WA 2HNHA 3CTLA 1A5MC 2VEKA 1A50A 2VTFA 4PFHA 1W3LA 3ZT5A 1EJRC 3E2SA 1FWTA 3IIXA 3MCMA 3H54A 1TVPA 3FSUA 3I4EA 1MEIA 1UC5A 5C9ZA 3R8GA 4R33A 3HF3A 2F2KA 1B1YA 2E7FA 2C1HA 2WBKA 4JQ2A 1NWRA 2BBFA 5A6BA 3N2MA 4MWAB 1KV5A 4GUGA 1GG1A 3IIOA 3P81A 1RALA 2PF0A 5CZSA 1OINA 4IGHA 1UWTA 3WMCA 1US2A 2ZUUA 1G4SA 1AL8A 1GJWA 4IMDA 2J47A 4YU1A 1U30A 3GVQA 4Q6JA 3W7DA 3VD9A 4LF1A 1PIFA 5CJ5A 3AIWA 4DX3A 2VFFA 1XCXA 4HNLA 1KGUA 4QJ1A 1KTBA 1OIFA 4GUJA 1VEMA 1O4UA 4E4UA 4NL1A 1C91A 1PS9A 1Q3NA 4QBXA 5E6ZA 3WH7A 3W6YA 2PRMA 1WDQA 5KTLA 4PBGA 1JYXA 1EUAA 3BLOA 2J79A 2V6AA 2D0GA 1H62A 1N8IA 3AQUA 1XLAA 2RFGA 1W9BM 1J10A 2WMGA 1DWGM 4H2HA 2GL5A 3MCOA 3LLFA 2HWGA 4CU8A 3AHZA 4U10A 2PRHA 5A8MA 4DXXA 3WBAA 3RN6A 1O5RA 4NZJA 5AHMA 3R25A 3D3FA 4CQDA 1WOBA 3IUHA 2BGSA 3UZ5A 2PDBA 3L4VA 3Q45A 1DJIA 2V5LA 4PUNA 2XGBA 3BJSA 3CYVA 2MANA 4MUPA 1Q6QA 4Z1AA 3KOWA 3S6TA 2CFFA 2X8RA 1DWHM 5D03A 2JE8A 1PIIA 3AO0A 2BOGX 4L9ZA 3LRLA 4HK5A 1TPB1 2V5BA 3F03K 4MJ4A 1W1TA 4IIBA 1OG0A 4MADA 3ATYA 1LT8A 2ZE0A 1MDRA 3LD5A 3GXTA 1G69A 4QE5A 3AHVA 3NDZA 4NZCA 3CEPA 4LC8A 2VI0A 2GUYA 4W5ZA 1A47A 1Q6FA 4WJXA 4HCHA 1YNQA 4O1FA 4PEKA 4GVFA 2FH6A 3P3BA 3U57A 1THFD 2PDIA 1HJWA 5LGXA 3AIQA 1UUQA 1K7FA 2VP8A 1SW0A 1H4PA 4N4PA 3HTWA 1OFRA 4B3ZA 3ZFHA 1J93A 1JNDA 4TV5A 1KBBA 3UPBA 2EKCA 1VCVA 2BVYA 1WUFA 4JTTA 4IGMA 5F4WA 2XWDA 1VFTA 2E3ZA 5BZAA 4RR4A 1L2QA 2W5FA 4WHBA 3P84A 3TTQA 4RZ5A 4D8AA 3N19B 5D9PA 3E2QA 3L2IA 4IXHA 2AQVA 1AW2A 3L65A 5DELA 4B90A 4CNTA 4QX4A 4NF7A 3TKFA 1JPIA 1JCXA 2DZTA 1PEZA 3R7MA 3UXKA 1W3TA 1MZRA 3SR7A 1BSLA 4YL2A 3MVIA 4OQVA 2B7NA 2YCIX 1JCMP 4FS9A 2H9AB 3G5EA 1VFLA 2VFHA 3OQ8A 3CAVA 4JYFA 3AS1A 3GTIA 4LUIA 3PZMA 2HJPA 4Y96A 3KBNA 3F4DA 1EQPA 3LRKA 3WLTA 1QDSA 4I6KA 2QCMA 1UWSA 3TAKA 1H60A 1PX8A 1QBBA 2YB4A 3VDAA 3OVRA 3CGTA 3VKDA 4O18A 1EQCA 2DVXA 1RCOB 4H9ZA 1L6GA 4BI7A 3P14A 1ITCA 3KEHA 1JQXA 1VPXA 4FXRA 4O0KA 5IDZA 3PB2A 4C5YA 3DU0A 2BHZA 3U2EA 3ZSTA 1LP6A 3T0CA 4YYFA 2WSYA 1A3WA 3UPMA 2CU0A 3Q2DA 1W3IA 1M53A 3V5OA 1UKQA 3UWEA 2NWRA 1DYSA 1QAPA 4ILSA 1PZ2A 4GGHA 4ZOBA 3B0YA 3TMQA 3TN5A 3PUOA 2OQHA 4DYEA 4AISA 1D7FA 1GCYA 2PDHA 3ABZA 3RRXA 3GHSA 3CWOX 1G6CA 1H41A 4QIUA 3AXHA 4QAIA 2Z7KA 3R11A 1X97A 4AHOA 5IFPA 1W1IE 2XHYA 1B4KA 3ZWSA 3VUSA 3W1TA 4PC8A 1E40A 4LWWA 3DYMA 3KP0A 4CN1A 4PMZA 1VYPX 2J74A 2EG7A 2VDHA 1SZRA 5DRCA 4W8BA 1PX3A 2WJFA 4WR3A 3LHZA 1TPDA 3AUOA 1J12A 1K7EA 3KLLA 4Z2HA 1UR9A 1QATA 3CV1A 3FAXA 4C6EA 4BJHA 2VQUA 3B8IA 4N6FA 1KW1A 3S2NA 3CWHA 4ZB2A 2QUNA 1KFEA 3OTRA 4Q33A 2WHKA 4ENLA 4EWND 1AH4A 4JTSA 4BS0A 4ZQMA 3I10A 3QV8A 1S2VA 4PUJA 3DG7A 2E9BA 1VRXA 5FEPA 3S2CA 3PANA 3TN3A 1KBLA 3EXTA 3COTA 4RUBA 3WLIA 3KVKA 5K2ZA 4AQLA 3WEMA 3VNIA 1CLXA 1BQCA 1OT2A 3SI9A 4XZWA 2D73A 2Z4GA 5D8WA 2TRSA 4J3TA 5DF0A 2WXDM 3MW7A 3KRUA 4XV0A 1YKWA 1DE6A 4FSAA 4I7WA 1RBAA 1J9YA 2RHGA 3WBEA 3A4WA 1MDLA 3KX6A 4UIOA 5A6KA 2BY0A 5ABFB 3VDHA 3GYCA 1BF2A 3LZ3A 4AIEA 2VM8A 1DJWA 3GTXA 1C8VA 1TFVA 4MJ2A 1TV2A 4O12A 3IANA 1I75A 2VGBA 2QZRA 3NZPA 2QVHA 3WLMA 1UQYA 1F5ZA 5ABTA 5BCAA 1J0KA 2PF8A 1UMLA 1BWKA 3CMGA 5HJLA 1XBZA 3SGZA 2ZCGA 3CXOA 2Y85A 1UKPA 2GFTA 1TZ9A 3W74A 2B7PA 4QFUA 1DPMA 4Z1YA 2C15A 1ZHAA 3VZYA 1PPIA 1A5NC 3W1PA 4A8NA 4DXVA 4YTSA 1PV8A 4Q8WA 5E1QA 4R5EA 3DHFA 1GVQA 2G8ZA 2Q02A 3ZXWA 5EB8A 1WKDA 3IIZA 1EEPA 3JW7A 1QI2A 3EA2A 3SN0A 2L5HA 2BZNA 2J27A 4YJ5A 1XS2A 4FOKA 3S5SA 2QEZA 5HWNA 4OU1A 2QNEA 3TLLA 3EWWA 4MDOA 3WJZA 2C6QA 3ISIX 2B7OA 2PP3A 1M1BA 4OUIA 3VE7A 4AW7A 2GWNA 4BWLC 5HOSA 1JZ2A 1KC7A 3RM8A 5C54A 1E0UA 4FNSA 2JFEX 1A5OC 5G2WA 2OX4A 4QCFA 4DELA 3B03A 3TNBA 5IBXA 3GS6A 1JYVA 3UZWA 2YJQA 1W1VA 4J3WA 4NQ1A 1ODUA 1EPVA 2GYIA 4LU0A 1CXKA 1MUCA 3BE7A 1JDDA 3MI2A 1Y5WA 1E3XA 1OQFA 4I3GA 3VOHA 5D4YA 3KBWA 4YS1A 1RY0A 2CHOA 4PUMA 5DFAA 5HUPA 2DZVA 3W7RA 4WY0F 2VZVA 1MEHA 3HFTA 3MSYA 4JFWA 3HA1A 1O6IA 1P6CA 4LAUA 3S9ZA 4JKMA 2YIHA 3STCA 1H63A 2G4JA 3APTA 2VR2A 3UR8A 3FFSA 4S39A 3ICJA 5K9CA 3UGVA 4BQ4A 4K38A 4LAMA 1Q4WA 4LYPA 4LS2A 3LQGA 1VBRA 4Z2GA 3LI0A 1BEUA 3NR0A 2J9ZA 3SCTA 2DUZA 1S5WA 1NQKA 3HMJG 4Q7NA 4MGGA 3MY9A 3KVLA 1GVRA 2PU0A 4UFMA 4E2OA 3UQNA 2PDQA 4D71A 4LUTB 1FUYA 2ZXBA 7REQA 2CLEA 3CM4A 2OGYA 4EX4A 4HMEA 2OB3A 1GONA 1LDCA 2PWFA 4H7CA 4MKSA 1XWYA 4CQBA 2W91A 1HVXA 1EHNA 2B7QA 3IRDA 4QNEA 4M19A 2CZEA 2HXUA 4C6KA 5AC7A 4GNKB 4GZEA 3UJFA 2CEQA 2A79A 1W0MA 4G2DA 1TJRA 2C18A 4QP0A 1WDSA 5IXEA 4GUIA 3JS3A 1H0GA 4B91A 3USZA 4HYWA 1SMDA 2WVUA 4OVXA 2IQ0A 4KCWA 1IIGA 4TQTA 3OZOA 3KRZA 3WQFA 4YTTA 1L6YA 4RDWA 3M5YA 4AZCA 4YLWA 4QDPA 5A6AA 3DHPA 5HNRA 3HGOA 4J27A 2IPFA 3MSGA 4Q4PA 1GYMA 2XVGA 1F3TA 1GTEA 4PN2A 1PCKA 2ZOXA 4GVGA 4MNLA 3UXIA 1PVNA 4UTTA 2IKJA 3LCGA 5A6BD 4Q7BA 3LM7A 2PP0A 3A6OA 1UD6A 3XIMA 3WDQA 3CL6A 2A6NA 1TZZA 2BVTA 1W5PA 2DSKA 4FNTA 1BWVA 3OA5A 1H3GA 5ABEA 3VM7A 5KETA 4P5UA 2FZ9A 4WQ6A 3FCPA 3VIJA 3WK2A 6REQB 5FJUA 2C16A 2D22A 3PN8A 1UWQA 2Z1XA 3RJYA 3THQA 1LLWA 4JKKA 1LT7A 4K8HA 1B2YA 4ACYA 3WFZA 5GNXA 4HNTA 3CO8A 1GW9A 1IT7A 4M6VA 4ZQNA 1QNPA 2BASA 5CPLA 1H2JA 3VD7A 3FV9A 2E6AA 3RPDA 5AHEA 4D6EA 1NJJA 5DXYA 2HPIA 2R6OA 2HBXA 3HG4A 4DJED 1C8QA 4L1WA 2CC0A 4WOZA 3MYOA 5EGRA 3TDFA 2V81A 5E9AA 4BK9A 1PTDA 2O56A 4NZFA 2PZ0A 4OV4A 1RZMA 4JEJA 1JF5A 3T2OA 3WQOA 4AWEA 2TMDA 4HSNA 2Q3RA 3VMOA 2X1SA 1SO3A 2V3DA 1IE7C 1Q6DA 1P0EA 4ICMA 4PH6A 2X0HA 3AFBA 4GKTA 3CUJA 5DMLA 4W88A 4NJHA 3STGA 3OLDA 3VIIA 2PCEA 2V9DA 5KITA 4EWJA 3W1QA 1UKSA 1DQWA 4FI4A 1AW1A 4H9YA 3BCFA 3TMLA 3H6OA 4R3UA 1S1RA 3EPOA 1V0LA 1K77A 3W71A 1OZQA 3GVGA 2VURA 4UB9A 3NPVA 1MXGA 1WV2A 2OLHA 4UWMA 4ZSUA 3M6DA 4MB5A 4Q22A 1HIZA 1IXPA 1J96A 1KFKA 3M47A 3BICA 1FWGC 2EEXA 1XSIA 3ZZ1A 4H6KA 3QR3A 3C0LA 3GDTA 2FFIA 5FD0A 3WX7A 4E2VA 2NQLA 3GO2A 1UIPA 1IZCA 2WC4A 1JVNA 4FLQA 5K9DA 4E6MA 1R46A 2J75A 4C60A 1M7OA 4IJBA 5LXEA 4OFCA 4HU3A 1SO4A 5CZKA 2EO7A 2IKIA 4HVXA 4QJ4B 2YCKX 4AVOA 2Q8LA 3T40A 3U5YA 3PBUA 4WD0A 4O52A 1AFSA 3ABOA 2VRJA 1T99A 4UFIA 2FGBA 2PDWA 2V3FA 1B3ZA 1F6PA 2FDSA 3EWDA 5BNKA 3AMGA 1AVAA 4MUZA 4JTIA 3FX4A 1ZGDA 2RAGA 1P43A 1TV8A 1ADSA 3R5EA 4N7QA 3GG7A 3N9SA 4XQ6A 3CHFA 3R0KA 1K8XA 3BZJA 3A9IA 3E2RA 5LNSA 4RV3A 1GJUA 3E0VA 2OX1A 2P50A 2XSXA 2AGTA 3GDLA 1Q8JA 4GFIA 4NX5A 4KBXA 1VEOA 4EOUA 4NNAA 5BXRA 3AI0A 4W86A 4QG6A 1EP2A 2XVPA 4XUGA 3EOLA 4ZODA 2QUMA 1XP3A 3DERA 3W1RA 2Q71A 1RR2A 3WH9A 3TTEA 3A5VA 3LRMA 1TQXA 5T9BG 4KCTA 4BA0A 2YCEA 3VKKA 2PMQA 4K7VA 2VENA 3EEGA 3F5JA 2ALDA 3HQOA 1HJSA 4DUOA 2X1RA 2NXGA 3VNKA 2DPEA 4DJDA 2QPSA 3BGJA 1J01A 1XIGA 3VNZA 4HOXA 1KM0A 4E2BA 5AHIA 3SN1A 2WWCA 4JD4A 3ZM8A 1XXXA 1A80A 4JIEA 3WFLA 4O1EA 1FHLA 5D2VA 1MUMA 3S8HA 3S1VA 1RCQA 2XH7A 1RK5A 1OC6A 1KXTA 4J2MA 2ZDRA 5G5IA 3C8NA 4JY9A 4C6LA 3GZAA 4DNMA 3ZVIA 1PL9A 2PDJA 3VABA 4QQ3A 3UA4A 1KFCA 1NDWA 1HVQA 4XSLA 2DSWA 1MQRA 3WUEA 3I6TA 1GZ1A 4AY8A 4FMVA 3SCPA 3RHGA 3NQ6A 2ZA1A 4F66A 2A7PA 4WDTA 4BF9A 2Q6ZA 1F8MA 4LT9A 3AICA 1CXLA 5T9CE 4UTFA 5BOOA 4H7VA 2ACUA 1UD2A 2WHJA 1KNWA 1NIUA 4X3ZA 1UR1A 2QDHA 1E55A 3VGBA 3GNNA 4YTQA 4R9XA 1B9ZA 4IPNB 3KCOA 2P10A 4P8XA 2VJXA 4POCA 1V08A 1IXQA 2DVUA 5DT7A 1UZ1A 2PP1A 4XD6A 2D2OA 3OVQA 3A24A 4N2YA 1DP0A 4GX8A 4IJRA 1CGWA 1WYIA 4P2VA 2OEKA 1UUMA 3GXFA 4ERAA 2ZIDA 7TAAA 2I5GA 5HUOA 1MNSA 5IHRA 4JTGA 4ZO7A 3KAOA 3LN3A 4D8LA 3ITCA 2EPHA 1QNQA 3WENA 4UOZA 3BLEA 1J5TA 2GQAA 1E1CA 1N55A 3K8MA 2XFWA 1WP6A 2PLKA 1LQ0A 3TYDA 2UY2A 1MEWA 3EEZA 5AB3A 1Y0EA 2PAJA 3MHUA 4K3ZA 1EKOA 1XRFA 3AIRA 1FY6A 1BXNA 3TEVA 4JN6A 3BW2A 5FJJA 4RK8A 1GQJA 5K7JA 4YCOA 4PB3A 4ROQA 3G18A 3DKJA 2PC4A 3ITVA 3W3OA 1CGTA 2PDKA 1AUSL 1VHNA 4UC5A 3UETA 1DEDA 1E56A 2NQZA 4GWEA 4Q4SA 1XYFA 4O14A 3UT0A 2DU2A 1R47A 3S9IA 3RU6A 4OUEA 1UD8A 1FQ0A 1X1NA 4DBUA 3BG5A 2QGYA 3INPA 3M0MA 4LUTA 1XGEA 3GU9A 4EP8C 3ONBA 4W4QA 4MJMA 4ALDA 1ODZA 4DNHA 3TW7A 1W91A 2NX1A 3G1HA 4H9XA 1AZ1A 2WZTA 5H8MA 2Z26A 1M01A 1FRBA 5DBTA 1JL8A 2HQAA 4FF7A 1QRQA 5A2CA 2V68A 1MSSA 1VBGA 3NL3A 5HINA 2QYGA 6ENLA 2HRWA 2W4XA 2D0HA 2W92A 4FIRA 2FYMA 4KGJA 1QPOA 3FA3A 4Y9MA 2D0FA 1V93A 2CLIA 3LHTA 1AQ0A 4IOTA 1ZBWA 1UASA 4GZJA 2FJUB 1V4YA 4R7JA 1V0MA 5HPCA 3PZOA 2IPGA 3GNOA 3NUKA 3NQAA 3RYSA 1KFLA 1OB0A 3EOEA 4FLSA 2F2HA 3N3TA 3HPFA 1L0PA 3BL3A 3N11A 3O9NA 3OP2A 2E5DA 4S3EA 3QV7A 4B5XA 4TX9A 2XN0A 4FOUA 1YX1A 1FA2A 1ME7A 1I1XA 4EK7A 3WNOA 1U1HA 3G1RA 2OZ3A 2RGLA 2GQ8A 2NX3A 1RD5A 1U83A 4NSBA 4HYVA 1NFBA 4HNVA 4AZHA 1M6JA 3NQMA 4ONVA 3L5AA 1OCJA 3KOFA 2UWFA 4WIWA 4DF0A 2QV5A 3PZNA 2JALA 3U4AA 3W2UA 2VZUA 1IF2A 4CQ8A 1UP2A 4LEFA 5F1UA 4I90A 3NM3A 4Q7IA 3CIVA 1ECQA 3CAWA 1FH9A 3FOKA 5DO8A 3OQEA 4ZSTA 2CZ5A 3KL5A 2X7WA 1JCNA 4W85A 3MZ2A 3TYEA 3HBLA 1E1EA 3WJXA 2F9RA 3C0JA 4HK7A 1W3HA 3SUSA 2P1FA 1OF8A 3AOFA 3BAKA 9XIAA 3DFPA 5I3KA 3D46A 4GCXA 1NDZA 1S2TA 1HJQA 1AW5A 3VNDA 3NQCA 2WLYA 3B8VA 1D9EA 1OD8A 2F6KA 2VD9A 4OJYA 3UNDA 4YVXA 1B9BA 3QV9A 4L6OA 1FWIC 2EGZA 3AHTA 3CH9A 5I2UA 2ASHA 1Q66A 1P7TB 4JFVA 1E4LA 5D8ZA 2DFAA 4KS0A 4GIYA 4ICNA 4R9OA 3TSMA 1J0IA 2XZ7A 4MWAD 4QHRA 2HVNA 2ZICA 4MVAA 2VWTA 2QJIA 3OIHA 1EUNA 4M24A 4WSHA 3M07A 1MXSA 4IMAA 4AZIA 4D1JA 1EJWC 4QS6A 1P7TA 4HNOA 1PZ3A 4ASTA 1UPMB 5H6HA 1EIXA 1UC4A 3BJTA 2J8FA 1KCLA 2GSEA 3IJ8A 3G6LA 3VVGA 4Q8QA 5DMMA 1K9TA 1KD0A 2DY3A 3C3UA 2P88A 4XBKA 4N9CA 1FDZA 2IPWA 2PU1A 1ALDA 1RV8A 4FLRA 2V3GA 2FLIA 3PULA 1LWIA 1IYXA 1GKPA 4FOJA 3UNTA 5I02A 2DZBA 2YCLA 4HT3A 3W1AA 5F2IA 1FWDC 1NP0A 3W73A 2XU2A 1QPKA 2OO6A 3WNNA 2O7QA 1JAEA 4QM1A 2YGYA 2D23A 2YLAA 3KL3A 4Y8FA 1O5QA 1FCBA 4AMAA 2Y1HA 3KBMA 1FWHC 2JKPA 2GQ3A 3O8AA 3KOXA 4D72A 4YNGA 5LIWX 1A5LC 1VKFA 2JGQA 4DLFA 2ZTJA 4MNMA 3EAUA 4JTAA 3FJ6A 1RQEA 2V67A 1WQ5A 2GGEA 3PTKA 4B5WA 3URNA 3WLJA 1W3JA 3SCOA 4V33A 3WZ0E 3H2OA 4LYKA 3L5LA 1JDAA 1PKLA 1YYAA 4O13A 5CGTA 1ZBVA 1V6YA 3G1FA 1XYCA 1TV3A 2E8ZA 3LOTA 1YPIA 4QGCA 3CHDA 3QGVA 1ME8A 3I7SA 1IEQA 2INEA 3IGSA 3Q4DA 2ZUWA 3HN3A 4M1RA 1XIBA 1M68A 1V51A 2E0PA 3SBFA 2BS9A 2EJ1A 4B15A 2ANUA 6CGTA 1EJVC 3GKAA 2VX6A 3F5KA 4ML4A 3IV3A 3LCWA 3V35A 2QV4A 3QQWA 1I60A 1JQVA 3SGGA 1XD0A 4M1BA 3KTSA 5DEZA 1E73M 1U1JA 3OB8A 3EWZA 4J3SA 2HISA 2QMJA 3ITOA 4H83A 1YNPA 4AFYA 3GFZA 4DO7A 2E1DA 2J88A 3PZQA 3H8AA 4DZ5A 3WNPA 1GORA 5JBEA 1VCGA 1V02E 4XK2A 5F1VA 2J7FA 1EHAA 2H3DA 1YTEA 3NQ2A 2J7CA 5HMSA 3WF1A 4JHZA 3S1GA 4ATWA 1JPKA 4DM2A 3OIXA 2FJKA 2ZVRA 4HCLA 5BROA 2VFGA 3ARQA 3T78A 1I2OA 3G8EA 4MWAA 3OVPA 4GQRA 3ALGA 3W7JA 4TR9A 4U5KA 1A3XA 1K8CA 2XJ7A 1GVFA 1J6OA 2AKMA 3QPYA 4M29A 1QU4A 5D2YA 3MI6A 2GOKA 1VCFA 4MTVA 5FKYA 1GPWA 1GYNA 4IMCA 1F4HA 1P48A 5E6YA 3AC0A 3VC6A 5LGZA 4UTTC 2QCCA 3FYOA 1JZ5A 1DJGA 4B2DA 3C2EA 3LEPA 3VAVA 3VOCA 1H7WA 4QSFA 1E71M 2DEPA 5LZLA 3OODA 1EXBA 2POTA 3WUFA 1IWBA 1OGSA 3K4DA 1P0KA 5DANA 3APYA 4R27A 3UZYA 1J8VA 3N17A 4C6OA 1K4GA 4KGLA 3VX1A 3M46A 3ZOAA 3SO7A 7ENLA 1H7NA 2AMGA 1GPFA 2YW3A 3VIPA 1CXHA 2FDMA 1UR4A 3PTDA 1ZP4A 2P0IA 4EANA 3OYZA 4D2JA 3PPHA 4PUKA 1HZYA 4JTRA 2IXUA 3KW3A 2CBIA 2P0OA 3HO8A 4H9TA 4IGSA 3ZQ9A 1ZSXA 3UF9A 4PZVA 1GVSA 3B4UA 3AYTA 1MW3A 5FIPA 3GXDA 3IVSA 4L65A 1K4HA 1XBYA 3PUEA 3XINA 3QMTA 1VGAA 1ZJIA 3WQ6A 3MBFA 2J7GA 3UCQA 2YDRA 2FPTA 2ZA2A 1ECEA 5CC5A 4W5UA 1NQ6A 1P4CA 1ISWA 1E4IA 1VS1A 4LQ1A 3PHAA 3UZZA 3ECQA 1RD6A 1TIMA 3CYJA 1V7AA 2Y8KA 3TFCA 5BU9A 1SUXA 3PS7A 2A3CA 3WJYA 3NVTA 3W24A 4KERA 2ZX9A 3FJ4A 4NAEB 4S3BA 5CZ0A 1RQHA 4Q8TA 5A2BA 2ZXDA 4AC1X 3TOYA 4H9UA 3PZVA 2PWDA 2W3ZA 5M3WA 3DH7A 1DJNA 3L21A 1EWDA 1JNEA 1N82A 2W63A 4GNVA 1QNVA 4J3XA 3TQPA 2Y7EA 2WQPA 3QYSA 4IL0A 2NQHA 2C71A 2O4QA 4NAEA 3UW6A 3GH7A 3A13A 3F4WA 1WX0A 4Y7EA 1CB7B 6XIMA 4TIMA 2PDMA 2O4MA 3SFWA 1XIJA 2ZZ2A 5HAOA 1XYBA 3FVDA 1TJ0A 2ON3A 4PTDA 2VEIA 5AYYA 1E51A 4ZR8A 1P0DA 1QO5A 3TYZA 5FJRA 5J5RA 4V15A 4LC6A 3ITLA 4DYJA 5KZEA 4HA3A 3R1ZA 3NCOA 4PTXA 2E5BA 2J4GA 1GG0A 3QY7A 4DUVA 5H2ZA 1FWSA 5A2AA 3RO6A 2DP3A 1TJ1A 4A8RA 1VYSX 1QASA 1T7LA 1RH9A 4L5ZA 1QK0A 4C5ZA 3WEOA 3BC9A 4RXFA 3ZS4A 2ZVIA 1HG3A 1BWLA 3IGXA 2ZE3A 2J8GA 3S2MA 3W7HA 3MUIA 3MYPA 4JTLA 4A8LA 5I7GA 4BZYA 4QISA 2F61A 3EPMA 2VUNA 4KKXA 4HCDA 1VENA 4FK9A 3GU1A 4NX0A 4F0MA 1I2RA 1W8GA 4YVPA 1TUFA 5MF5A 1XH2A 3WQCA 1XISA 3WDJA 4KETA 5D05A 1TZ7A 4DJEC 1GW1A 5CGQA 1PB0A 2PGWA 3V7PA 3TVAA 4LAKA 1QPQA 3S42A 5FESA 3W2JA 1TA3B 1R7AA 4MM1A 2VGFA 4GQGA 2C3ZA 5CAHA 5IFTA 2RJGA 1FKWA 2P5NA 3MMTA 4DWDA 3G22A 1HP4A 3G0SA 1DTUA 3F5LA 3S9YA 3SRHA 3KHDA 4H00A 3B4YA 5BXTA 3LX9A 4N9DA 3VI2A 1IR1A 4NIRA 4AEEA 1R3YA 5A8PA 3KP1A 1Z3NA 1S2CA 4PMUA 3EWXA 3F2BA 3WO8A 2IS7A 4YVVA 1Q45A 4FX8A 4PRTA 3UWWA 5KSWA 4NZ5A 4WSKA 3G1VA 4WVXA 4LUSB 3W1LA 1VLIA 2WPGA 4F0LA 1ZBKA 3UG3A 3PZUA 1YW1A 3N6QA 2V5CA 3GDMA 4C1KA 1VFHA 1W9UA 3FN9A 2R24A 2HTMA 4NI3A 3CT7A 3V1HA 3B06A 2ZZ6A 1FP9A 3PBYA 1BPLB 1A4LA 1UZHA 1JGIA 3DZ1A 2VNCA 1OYBA 2R1MA 4RZ6A 4I7VA 4UNLA 3VNJA 5C9XA 5LNUA 2GJNA 3H2CA 1TELA 2YBVA 5AHLA 1YRRA 3F2DA 3UR2A 3O15A 4UR8A 1B5TA 5JBDA 2WSQA 1RK6A 3KVMA 5DN1A 2J7HA 4Q4KA 3P61A 2E77A 4GI9A 3EZ4A 5HJXA 3FEMA 2Z1BA 4ZA0A 4WEVX 1W2PA 4EE9A 3JVAA 3A64A 3LGDA 4DJDD 4HU8A 3LBCA 4ZXLA 1PDYA 5H1WA 2Q09A 3BMVA 4RPPA 2V8ZA 4HB7A 3P5YA 2BMBA 3NDYA 3T1GA 4JTDA 4Z42C 4JFUA 2QXWA 1TX2A 1FWBC 1LL7A 3VCRA 3O1NA 4LCQA 2AL2B 3BOFA 4DJFA 5A95A 1JZ8A 1IEWA 2G96A 4WJ8A 3DFYA 1XFBA 3AYSA 2CBJA 3HPAA 3LCXA 1XH0A 5I77A 1RLCL 1JGMA 3W1NA 1BHGA 8RUCA 1EDGA 4JY8A 4A22A 1MVYA 1ZY9A 1KM3A 1UMYA 2WQDA 1ZNNA 4OV9A 2DZSA 1UP0A 1HKWA 3PSVA 1PDZA 3ARRA 1KBKA 3HG3A 1XDJA 2OFJA 1PKNA 3TJIA 2G0WA 4HOZA 1LRNA 4XD5A 1VQTA 5CPOA 4K6AA 3RX2A 3GK0A 1W56A 4TX6A 1DXIA 3SEPA 4KRUA 1XC4A 1AD1A 5D37A 3WLPA 3CB3A 1SR0A 4F0SA 2JKEA 3TSBA 3LXBA 3A4JA 2EPMX 5K3VA 3R0UA 4JIIX 3LPGA 3VU2A 1JUBA 3GVRA 1E0WA 3PWGA 1BG4A 1CW2A 1AQMA 1G0CA 5HQEA 1TPH1 4NJGA 4NZ3A 4GOAA 1OFDA 1EDTA 1L6SA 3GU2A 2F84A 3C0QA 4IP4A 3FK4A 1DE5A 1DIKA 5I3JA 2QULA 4JTQA 4CCEA 3BAIA 1YMYA 4XUYA 3GWQA 4UZSA 1K9DA 3S0CA 1YE4A 4QQUA 3E49A 4QJ5B 5IM51 3L0KA 2PFHA 3GE7A 1QPNA 3LHVA 3VA8A 2QIIA 2OYKA 3DGBA 1V6WA 1T8XA 1XGZA 3N25A 2P3EA 2G5WA 3ARYA 4HHPA 4K2SA 1UP3A 4AB4A 1OY0A 1XFCA 2OT1A 4PR4A 1TMQA 1UKTA 3GXPA 4KCUA 5G1TA 1REQA 2OG9A 1RJRA 2ONEA 1KWKA 3MV11 1YLVA 3BCDA 1S2AA 3AMCA 5K4XA 4KCVA 5JIPA 1D8WA 1BTMA 1UWIA 2GDQA 3TCSA 2OSWA 5EFDA 3KDOA 4MZ8A 3QGKC 4HN4A 2PDLA 1LWJA 2CLOA 1DXEA 1J0HA 1HL9A 1B3VA 1JR1A 3WD4A 2GGIA 4AIBA 3H2FA 1DIDA 3WF4A 4PUWA 3JRKA 5CBIA 1OX5A 1REQB 1KCXA 4S2CA 4V1YA 2X40A 1V6TA 2EJAA 4N02A 4XZBA 4ERGA 2NX9A 2XH4A 1HGWA 3VGHA 4JCMA 1H7OA 3WFAA 3QGAC 1GOIA 4W7VA 4JIPA 1KCKA 2KZHA 3VILA 4AZGA 1G4PA 2QCDB 1XBXA 4H41A 2FHFA 2PBOA 3QFEA 3MKKA 4IX2A 3ARUA 4YN5A 1FX6A 1XLMA 3F4CA 1UJQA 1AMYA 1OADA 1DJQA 1B31A 1JFXA 3H55A 3BLLA 4AD4A 3UVAA 1TB3A 5FSEC 1EJ7L 2NQ5A 4AMCA 3HG5A 4AY1A 3CUHA 4GLEA 3PUDA 4EACA 3SADA 5HR6A 3LNPA 1LG2A 4KFPA 3THUA 3C3NA 2WSPA 1M3UA 1H49A 3AIBA 5EPDA 3PSWA 5B7YA 1VF8A 1WZKA 4PTNA 4FNUA 4L4MA 1LCOA 1W5QA 4O4VA 1TR1A 2NXHA 1X7IA 2V30A 1GGOA 4YIWA 3EX4A 5D33A 3O63A 1QOPA 2H90A 4A6GA 2NZLA 2HBVA 5D32A 1JCLA 4JZ5A 3WEZA 1R9ZA 4NJIA 4H2CA 1HFBA 3D6NA 1IEVA 2BB0A 4HJFA 4O1DA 3REQB 4M80A 2PD9A 4MWAC 3Q58A 3RCMA 4B5SA 3WIJA 1O1ZA 4M6QA 2HVOA 2XN1A 2CW6A 4MWAE 3KCJA 4DI8A 2J9XA 2X1UA 2VXNA 2V69A 3WQWA 4US5A 3SECA 1RP9A 2C19A 4BI5A 3DUGA 1R8LA 3DC8A 3WUGA 3ARTA 3CZKA 1Q6OA 3WD2A 3P8IA 1CDGA 3CLWA 4Y9NA 1UWUA 5LA1A 2PWEA 4KF1A 3TYBA 3UY8A 3K4WA 1J4EA 1YADA 3QHOA 3BV4A 1W17A 4RW3A 3BMXA 1XG3A 1QFEA 4IT1A 2PTZA 3WG6A 1NAL1 5FACA 1XUZA 4DBEA 4UFJA 3ZJ8A 4MHBA 1RBLA 2NV2A 3FXYA 2DT2A 4NYYA 3GHTA 2I5QA 1P6BA 3M6YA 1Z44A 2WOQA 1DWAM 5C0QA 2OVLA 4WY0B 4L61A 5D9NA 2XFFA 1KBIA 1V3HA 1B57A 3W53A 1FWFC 4FZIA 3VKAA 2J6XA 2VX4A 4MLRA 1H61A 2QS8A 4L6DA 3MS8A 1NU5A 5BXPA 1J18A 3P67A 3DI0A 3H70A 5C9UA 3B9DA 4MB4A 3RPMA 3WQPA 1OYCA 5HR7A 4C6PA 1Q6RA 1GHSA 2C1IA 4H9MA 1L9WA 3E9AA 2I56A 4Z1BA 3C0SA 1JPHA 4P8WA 3RM9A 3LK6A 2OWCA 1JFHA 3OGVA 5BYWA 3R94A 5H8UA 3FNDA 1U5VA 1SU5A 4J35A 2REQB 1X39A 3BOLA 4UTUA 2WCGA 4ZO8A 5A3HA 4TMCA 5FF3A 3G3DA 2DVTA 5C6MA 3VIKA 2A1YA 3TJXA 2JBMA 2GUBA 2J7DA 4AHQA 4H1ZA 3W7GA 1RA5A 2GK1B 5A6SA 5EBUA 4YWIA 3UCDA 4NXKA 5CPNA 2YKKA 2XH0A 1W9DM 3LI1A 3NWRA 3SCVA 4Q3MA 1LOSA 4XAGA 3W22A 2ZKMX 1QI3A 5IOBA 3SY1A 3TYCA 1HP5A 3RMEA 2ZC1A 4DI9A 3BLDA 4IGNA 5CBBA 2OZ0A 1G9HA 4MB1A 1UD4A 4IQLA 1EC7A 3RPTA 1G7UA 3QTGA 4RL3A 4C6JA 1FWJC 2VD8A 3WDPP 4GXMA 4P7NA 1M7PA 5JIWA 1TPFA 1UBSA 1RJPA 2X05A 5MKGA 4GBDA 3WLSA 3LSBA 4B3KA 2Y89A 1BLIA 3W1XA 3JUGA 3W6MA 4Y2WA 3SSZA 4M51A 4GISA 1QOQA 4PULA 5HNNA 3TLQA 2VC7A 2NUWA 3OZPA 3LG3A 2CKSA 1V79A 3PPCA 3VDCA 3LHWA 4N4QA 4IHCA 4HU4A 4GC3A 4O4WA 3WDRA 2DJLA 4V1XA 4UFLA 4QDWA 1M5WA 3KM8A 3CLMA 3PJUA 1WXYA 2F6UA 3MUY1 4ZGYA 4EPEC 5G4EA 3EMZA 4RZBA 1N2VA 5IDIA 1PX4A 3KS6A 1YBQA 3QFWA 2J24A 1ITXA 3NGFA 2OEJA 4RZ4A 3OPSA 3ID7A 5I24A 3IGUA 2VL4A 2DJXA 5AECA 3EDEA 4C6FA 2WCAA 1KFBA 4GGBA 4K1GA 3OOQA 4XZHA 1TPUA 1KXVA 1O94A 1R2TA 3SRKA 3WMBA 1PIGA 3BDKA 7TIMA 1VFOA 4PRWA 3R0DA 1SFSA 3RMJA 4ZTXA 1TKKA 3N14A 5D9OA 5CBJA 2VDGA 1F2JA 4RDVA 4AVFA 1HJVA 4MZYA 2AGKA 1J11A 2GPTA 1TPVA 3T09A 1VH7A 3ABRA 3SJNA 2CLFA 4S1FA 3U2CA 5C9RA 1S2UA 4S3DA 4W8LA 3JU2A 3TP4A 2NLIA 4MNJA 2XVNA 3UJ2A 1KFJA 1SQ7A 3SQSA 5AC6A 4C1LA 3LTSA 2ZZ4A 3MCNA 1QNOA 1R3SA 3B04A 2GJLA 4F0RA 1OFAA 2YB1A 4IM4A 4OHQA 3G3MA 2HSAA 2WCSA 3RNDA 3FW6A 3GXNA 4CD4A 3NPWA 3LHYA 3L7RA 1CBGA 2NWSA 1FCQA 3LCHA 3LCLA 1R2SA 3MVTA 2V5JA 2HV5A 1AODA 2GSHA 3DBNA 2AKZA 4F0HA 1NDYA 3C56A 3GTNA 4C6DA 4BFAA 4QR6A 1KM2A 4OBRA 3R13A 3NYZA 1EH9A 3NSNA 3G1DA 2QJMA 3APGA 4LVFA 3VYLA 4FEZA 3I4KA 6TIMA 2ACSA 3QY8A 2XFYA 1NOUA 3EKZA 4GY7A 4AHPA 3OEXA 4WGXA 2EXOA 4IQDA 4AEFA 4KRTA 2Y2WA 1XLBA 1T40A 1VLWA 1G4EA 4Q8VA 3MHGA 2PSNA 3GSMA 2WNZA 2CLKA 3O0FA 4ZOCA 3MDUA 2G3NA 2YXOA 4AWUA 2G95A 3JZEA 4JDYA 3N3MA 4OBSA 3E12A 4IICA 2WBGA 4HNNA 1V3LA 3U7BA 2I17A 4LF2A 4D6HA 3QR0A 2D3NA 1BKHA 4N9BA 1OX4B 1IR2A 2BTMA 3E38A 1XLDA 1W37A 1AH3A 3T42A 3ZJ6A 3ME3A 4HSHA 4Y6GA 1HN1A 3BO9A 1J0ZA 2QAFA 1EJSC 2NUYA 3WD1A 2BLEA 1OYAA 2ZX7A 1WBHA 1Q6LA 1LTDA 1XRTA 2QCLA 2TAAA 5FF0A 2SFPA 5LNWA 4KRZA 4JX6A 4MY8A 3UA3A 1EYWA 2RUSA 4I8YA 3LGGA 4WF7A 5HWJA 3AU2A 4UQCA 3W85A 2WK2A 2RKXA 1C92A 3CZGA 3F2CA