1PTDA

Phosphatidylinositol-specific phospholipase c
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with myo-inositol.
pubmed rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 106
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1995-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ptdA00
1AODA 1ZCCA 6PTDA 1DJGA 3L12A 5T9CE 4QJ4B 3KS6A 4QJ3B 7PTDA 5T9BG 5PTDA 3V18A 1PTGA 1QASA 1DJWA 1DJXA 3H4XA 3OHMB 3QVQA 4OECA 1YDYA 5T91A 3V1HA 1DJIA 4I9MA 1V8EA 4RW5A 4GNKB 2FJUB 4F2TA 2OOGA 4R7OA 4I90A 3RLGA 1T8QA 2PTDA 4I9TA 1VD6A 3QR1A 3PTDA 1DJYA 2F9RA 1DJHA 4I8YA 1T6MA 4RV3A 3V16A 3I10A 4F2UA 4I9JA 1O1ZA 2P76A 4QJ5B 2ISDA 3H4WA 2OTDA 3EA1A 4Q6XA 4S3GA 2PZ0A 3KS5A 4F2BA 2ZKMX 2O55A 2PLCA 3EA3A 3EA2A 3MZ2A 1QATA 3QR0A 3RLHA 2OR2A 1XX1A 4RW3A 1PTDA 1GYMA 3NO3A 4PTDA 3CH0A 1DJZA
chains in the Genus database with same CATH superfamily
3ZR4A 4CD4A 3FVDA 2XU2A 2NQJA 4BS0A 5DBUA 4HPJA 1B4KA 1TPC1 1XBVA 2QCMA 4R33A 2J7FA 5DFAA 3FK4A 2GYIA 5REQB 3EXTA 1M04A 4TVUA 4Q3MA 3WDHA 1TWDA 3W7LA 4I6KA 4ZSUA 4GY7A 2OT1A 4IX2A 5HK4A 4QBXA 4QDPA 4Q32A 3CUJA 4LU0A 3C5QA 1AW5A 2G3FA 4DBDA 4D6JA 3O15A 3QQWA 5E1QA 4F79A 3QXBA 4N6EA 3LDVA 4HMDA 1A47A 1QAPA 4WJEA 3TMQA 3D0CA 2QJGA 3DGBA 4ZGYA 1XDLA 2Z26A 3CXOA 4UCFA 3W7GA 4HU8A 2W6RA 4IQJA 3GUGA 1HP4A 1HFBA 3EWDA 4MNMA 4BZYA 4V1YA 1FHUA 3EA3A 4D6CA 4K39A 3UEQA 3TSDA 1SSDA 4DLFA 1JXJA 5LNUA 1HL2A 4LRSA 1VAHA 1RP9A 3URQA 2MNRA 3P5ZA 1KFEA 3AJ7A 3BK0A 2XYLA 4BF7A 4W9TA 1Z42A 2C7FA 4A29A 3W7DA 2ZQ0A 2FIQA 3G6LA 1MNSA 4R85A 4UQCA 5F1UA 3C0QA 1LRTA 4WZHA 1ISWA 5HPCA 1TX0A 3WK1A 2OX4A 2WMHA 1JZ8A 1IT0A 3VC6A 8TIMA 3ITXA 4BF9A 3OLEA 1V5XA 3DESA 3NSMA 2VM8A 5CPMA 4S1FA 1XYFA 4IQEA 3WQDA 1GEHA 2AGTA 2TRSA 3H2OA 2F7FA 4M24A 1FDZA 2WZIA 3KBWA 3FFSA 1X8FA 1FXQA 1YXCA 3DYPA 5I3GA 5AC7A 4MG4A 3OTRA 4UUIA 1DP0A 4AWTA 1FWJC 4HJFA 1XLEA 4IMEA 3W7JA 3GC2A 1FQ0A 3PC0A 3GHSA 3PB0A 2BVYA 1NARA 4ACZA 3U9IA 3OVGA 4S3KA 2V68A 1ZUAX 2FZNA 4H6EA 3H21A 1JDEA 1J6OA 2OO0A 2J9XA 3W7OA 3MUIA 4XIAA 4RJEA 2W62A 3L4YA 4PB3A 3GBEA 3QR0A 1PYMA 3NYZA 3RR1A 3WUEA 5CEWA 2FHBA 1CDGA 5A6JA 3N6HA 1VKFA 2ABAA 1AW1A 2QCCA 5CJMA 4O8RA 5HULA 1CXEA 1OIFA 1QPOA 4EK7A 1IIGA 4J3TA 3TVAA 3WLRA 1W1PA 1I2PA 1K7XA 2HNEA 1J79A 3T81A 3A4XA 2NLYA 4LS1A 1PWLA 1W3LA 5A94A 1ITQA 4MUPA 4XQ6A 3T8QA 3Q65A 4X2RA 2Y0FA 2POZA 5C9XA 2PDCA 2E25A 3ZFHA 2QPXA 3SZ8A 1KR1A 3UT0A 3O05A 1ME8A 4NJHA 2V6AA 3PZTA 4QTGA 4NRRA 2F2HA 2G3JA 1W1A1 3HQOA 1PKNA 1VJIA 3NL5A 5JMUA 3W23A 3TYCA 4DEFA 5CKSA 3GDMA 1FCBA 4F2TA 1A80A 1EX1A 2QS8A 4XX6A 3HGJA 4W93A 4LS0A 3B4UA 4J5NA 1VQTA 5I77A 4Q6XA 3LU2A 3VINA 1NWUA 2HSAA 3W1NA 1ZP4A 3NG3A 3IGXA 3GXPA 1TVPA 4RDYA 4M81A 3CYVA 5CPTA 2UBPC 1TA3A 5CZSA 3WQFA 4KERA 2VFFA 3NFUA 1A5OC 4NILA 2F9RA 1PTAA 1EH9A 5A8NA 2XZ7A 3ABRA 1RQBA 1SQ7A 3CC1A 3CGTA 4GYKA 3DOPA 1H1YA 1RPXA 1RZMA 1E4NA 4HNCA 3W88A 5D02A 5CC5A 2VKZG 1CGVA 4WXYA 1UW9A 2YSWA 3UVIA 1CLKA 5BU9A 3C0LA 3RXZA 3VZYA 1Q85A 2OMAA 4M5PA 4C6CA 5PTDA 3PUEA 5A6KA 4AXKA 1U30A 2Y61A 2V3EA 3U2OA 2VEMA 4S3BA 1NDWA 2ZZ5A 5IBXC 5LNVA 1VBGA 3STGA 4GVGA 2WJDA 3T0BA 3QBUA 4KW2A 5TF0A 1AH0A 3ATZA 3GG8A 1LM1A 1XGDA 5RUBA 5EMUA 1I8JA 1AMKA 1S3TC 5GJPA 4PSPA 3DFOA 4QNEA 4HHLA 2Z24A 1F3XA 6ENLA 3PJXA 2Z4GA 4WCJA 1D9EA 2FQIA 1QNPA 3DX5A 1WV2A 5E6ZA 4Y8FA 1XYMA 4C60A 4R3UA 3EWBX 4NJKA 1OGSA 3A3WA 3UG8A 3EKLA 4A8IA 3G1FA 3R5EA 1JRBA 4M8UA 4LVFA 1PKYA 3CQJA 1GJWA 4UFIA 1VF8A 5H6HA 1XLCA 4H7ZA 4HPXA 2BXVA 2E6FA 3QW3A 1QOQA 5HJYA 2PGEA 4P8WA 3BTNA 2A3CA 2I9EA 3QW4B 3S1WA 4FMVA 1DWFM 3MB9A 3R94A 3THCA 4LW7A 2YCIX 1XYZA 2A6NA 4L4MA 3WNMA 3DI0A 1XQKA 1EXBA 4HU4A 1GJPA 4OT7A 5E0KA 1E70M 3GIYA 4GC3A 4M80A 2ZCGA 1JAEA 1W1B1 3VNIA 5CG7A 2ZRYA 4H83A 3L2MA 3N9SA 4JEJA 1Y5WA 3DENA 4MWAE 1TR9A 4ZR8A 3CWOX 4W88A 4DF2A 2W67A 2DZVA 4R7OA 3A9BA 4YVXA 4M6QA 5D2TA 1TFVA 2HCVA 3G1XA 2P8CA 3UP8A 1G6CA 5F4XA 4RDVA 2E0PA 2EBNA 1JI1A 2X2GA 1QI3A 1XC4A 1RBOB 2ZFAA 3QMRA 3MP3A 3V7PA 1OT2A 1B3OA 2P50A 1EA0A 4RNJA 1X1ZA 2L5HA 3V0UA 2FFIA 3LTYA 1KXHA 3GNDA 4WXZA 4XZLX 2GQ9A 3UCDA 2Y62A 3F2BA 4XBJA 2ACQA 2VFGA 4Q33A 4HA0A 3NO1A 2ZRWA 3C2OA 3PZNA 3QOKA 5H91A 5D2WA 3G8RA 1S3HA 1US0A 5FACA 2ODOA 3V1HA 3BOFA 3CHDA 3W1XA 3K8KA 1W9DM 3WBAA 5HQMA 3TW7A 1XFCA 3VX1A 1R6WA 2YZ5A 3E0IA 1MW1A 3PBWA 1XP3A 2GJXB 1E0UA 3CO8A 2INEA 5ENLA 3WF0A 2I56A 1P7TB 3PPGA 4R9XA 4J2PA 3CV2A 2PWEA 5CJ5A 3EEZA 2YXOA 3CAQA 3ZJ7A 4B5TA 1YTKA 1XC6A 4GZEA 2EPKX 3GE7A 5E0FA 1F73A 3E02A 4I90A 3NO3A 2GJPA 4B16A 5LZLA 4PUMA 1E6PA 1H7RA 2QUUA 1EGVA 2D2JA 3S9IA 3AYSA 5HBFA 5JUVA 1TPDA 2A7RA 3RIKA 1V3HA 3CQIA 4ZO9A 2ZX6A 1TV7A 5IDIA 2PDXA 1O60A 4LUJA 4HQVA 4DWSA 4IFRA 1FWBC 1ISXA 4JQ2A 1ZNNA 2EPLX 3IUDA 1EJSC 1T7LA 1UOZA 1WDDA 4PMYA 4AU0A 2J7EA 4MY8A 1W3HA 2VTFA 1UWQA 1ISYA 4MNJA 3TV8A 4K2SA 4FB7A 1ZY9A 2IQ0A 3OJGA 3L4UA 2DH3A 5D9OA 3TKFA 4GGHA 3C8NA 3AC0A 5HMDA 4UTUA 2J88A 3VFCA 3KHJA 1LLZA 4KWUA 4PMXA 4X63A 1VEOA 3ARVA 1FDJA 1ZLPA 5FJIA 2OWCA 2VUNA 2RDUA 2YL6A 4GUHA 4B9YA 1GVQA 2I17A 3TC3A 1XKYA 1UWIA 1RQHA 3C3NA 2PWDA 1KLZA 1I2OA 2CW6A 1BXBA 3EWUA 3WK0A 2DVXA 3K30A 1QI5A 5A6SA 1QT1A 3SY5A 3ENLA 3CQHA 4S23A 1AQFA 5A6MA 1KC7A 5AC5A 3SBFA 4WY0B 3B9OA 4Q7NA 4WSKA 3N25A 1CGUA 2J7DA 2CLMA 3G1AA 3OG3A 2HXTA 4ZOCA 3DECA 2ICSA 3E0FA 3SQLA 4CQCA 3P7YA 3CV6A 4H9UA 4A2SA 1Q6QA 3P14A 3B9EA 4C6DA 4ILSA 3R43A 1K8XA 3B8TA 2YW3A 3IUIA 2WQDA 4NUWA 3QYSA 3TA6A 3OLDA 5LYRA 4NYYA 4HZ8A 4IGSA 3LQGA 4QP0A 3MBFA 3ONCA 2WNQA 4GI4A 1L6YA 3W85A 1M6JA 2WCSA 2YPIA 3DFYA 3ICJA 1XLDA 2A7NA 3A4AA 1P0NA 3K1DA 1JDCA 2ZRVA 1QHPA 2E77A 3GFXA 2FGBA 4R9OA 3UJRA 5E09A 3MP4A 3HG2A 4KEVA 4NF7A 3R79A 1FWRA 1W9PA 4LF2A 2A3AA 1OQFA 2C19A 3QY6A 1UQZA 1H7WA 1CGYA 3CYJA 1NQ6A 3M5ZA 2C6QA 1EKOA 4UQEA 4B2DD 1NH6A 4IJRA 2FZ8A 3RPDA 5CGMA 1DTUA 2PUZA 3UETA 3A24A 1KKOA 1IGSA 1AL7A 8CGTA 4TV5A 3L0GA 4FZIA 1TTQA 2PF8A 1ZBKA 4OV9A 1QNSA 3TONA 1P0DA 1GHRA 2VZTA 4C1NB 1XLBA 3G6MA 1OWQA 1G01A 1TQJA 1XUUA 3APTA 3LI0A 2X0YA 2PU0A 1W54A 1X1NA 5DXXA 1ODUA 3GLCA 5BZAA 1MVYA 3H2EA 3CQKA 2YDSA 3JW7A 2CZEA 1TTPA 2C18A 4TX6A 1XRFA 1LROA 3LERA 3RJXA 3FLUA 2X42A 1RK6A 2W79A 2XFRA 3R58A 3L5MA 4MJZA 1F4AA 1LQ0A 3UWZA 5A2BA 1AJ2A 2V30A 1BVZA 2P3EA 1C90A 3ANUA 1DBTA 3WQ8A 2YLLA 1BRLB 4U5IA 3MA8A 2DT0A 1D8WA 4RV8A 2OYKA 3LPGA 4JNYA 3Q2DA 3M07A 2FHFA 2GQ8A 1CGWA 1ZBVA 2Z2AA 2NUWA 4EKJA 4LNCA 3DFNA 3FYYA 3PG9A 3WD0A 4H00A 2F6XA 2QCGA 4AW7A 3ID7A 2PC8A 3WMSA 1WBHA 2G50A 1V77A 4FXSA 3GM8A 2E09A 3LGGA 1F8IA 1T99A 1X38A 1OGGA 1A5UA 4N4PA 3VOCA 1R0MA 2PDBA 4FX8A 2CPUA 4J3SA 2QAFA 4Y8EA 3U4FA 1XCXA 3M43A 3R10A 1W56A 3R6IA 4PSRA 4IFKA 1XW8A 3DKJA 3L7RA 3MUAA 4F0MA 2DUXA 3E74A 1VFSA 1ZBCA 4BJHA 2PLCA 1Q6GA 4AD3A 2PP0A 1W1IE 5HJLA 4FLRA 1XIGA 4MUZA 2R24A 4HNTA 1EYEA 3BXWA 1BRLA 1EA9C 2BVWA 3B0YA 7REQB 1W1YA 2X1UA 1GYLA 4GHRA 4YYFA 9CGTA 2XGBA 1UD2A 4CN4A 4XAZA 2EF9A 2DZBA 5JH1A 1F6PA 1OX4A 4O1FA 4GC4A 1E6SM 5LA2A 2OPJA 3DZ1A 3S1GA 3NQBA 3ZR5A 5K3VA 3T0DA 1V8EA 2HMCA 1PIIA 5T8GA 4FOUA 1D7FA 2GGJA 3ABXA 1GVSA 5BNKA 1H50A 1VRDA 2XM2A 3MCOA 1GOIA 3KZPA 5BROA 2GDVA 3MKVA 1UCWA 2R1KA 3UXIA 3T7VA 1CT5A 1PX4A 3AXXA 4H19A 1EP2A 5JXQA 3O0KA 2ZYFA 3VUSA 2VJXA 4NAFA 2EQDA 3C0JA 1EFZA 1H7OA 4UOQA 3GHTA 3SJ3A 4ZQOA 2HE8A 3VILA 4P8UA 3W6LA 1IHIA 3WDIA 1UR0A 4NKCA 1WPCA 3S6TA 1JG9A 3TN3A 1KCKA 2Q71A 4HU3A 3P60A 4ADUA 3W22A 4C91A 4ML4A 3GYEA 4G8TA 1KGWA 3SIZA 4HZ6A 1EUAA 1PS9A 3B9DA 1YNQA 3AU6A 1R9YA 2PTYA 5A2CA 3PTMA 4JYDA 3H4XA 1GW1A 4OKDA 3H8AA 1PKLA 4F0RA 5EFDA 5A5WA 1JPMA 2A7PA 4UFJA 1A0EA 1VRXA 4XBSA 3UR2A 5AVNA 3GDLA 1OYCA 2V3FA 4IGHA 1GEQA 2UV8G 1ME9A 2XFWA 3IIZA 2DT3A 4O1BA 4Q4OA 4W5ZA 3DHFA 2RGMA 3HZ3A 4BK9A 3R8GA 3OQEA 1E15A 3HBLA 4AD0A 3NDYA 3MUY1 3SQMA 5JVLA 2A1YA 5JBFA 5CPNA 5HATA 3G5EA 3UWEA 1W32A 5A8PA 1I1XA 4FOKA 4NAFB 3QGAC 4GQ0A 5G2HA 1T0OA 3G0SA 5FA5A 3EDJA 4UFLA 1GOXA 4Q8UA 1UG6A 1GVEA 4HN8A 5D04C 4KETA 3C8FA 3S1XA 1WZAA 2BY2A 3LGEA 2E8YA 1RD6A 2PDJA 3WQ4A 6REQB 6ALDA 4KFOA 1FDYA 4LV9A 1HXJA 3GDKA 4AMAA 4WLCA 2BTMA 3UWUA 1E51A 4WDWA 5BWFA 4F48A 2CERA 7A3HA 1UR2A 1GTEA 1C8VA 1H51A 1XBXA 4O1EA 4XVDA 4L6OA 3TYEA 4MADA 1XWYA 3U2ZA 3BURA 1E1EA 1BTMA 2RJGA 3QEZA 3PY2A 3TZNA 4JN6A 2HBVA 2B7NA 4P8XA 3SUSA 5FF0A 1KRMA 2X0HA 1XLGA 1S38A 1KBJA 5ECVA 1NOWA 5G2WA 4BEUA 1MDRA 3GXTA 3SR7A 4JTQA 2OCZA 5D30A 4L1XA 4HPGA 1OHLA 2OKOA 5JBEA 2QV4A 2CKRA 1TWWA 2Z6JA 1VLIA 4XTIA 2PDUA 1UZ1A 4GO8A 4JIHA 3NXLA 2QUMA 3GU9A 4JIQA 2CLFA 1A3HA 3DBNA 3TA9A 5IOBA 1E6QM 1R8LA 4H3DA 4M29A 3W2NA 4XWUA 4GXMA 4P8VA 3U5YA 2ZKMX 1KM4A 1P0BA 3BANA 2NLIA 4UTHA 4GJIA 1OC6A 2XIBA 3VIJA 1GOQA 1VD6A 2BY0A 4GYPA 3E5PA 3AWNA 3F5LA 5D32A 5CSRA 3CT2A 1GOKA 4DJEC 5HR7A 4QEHA 4X3ZA 3SO7A 4ES4A 2BGSA 3MANA 2VCCA 3N18A 4O15A 1B4EA 4LUIA 5BW6A 1P6CA 2Y24A 4B9ZA 2XH0A 2Q09A 3RITA 3O07A 5BXSA 4BI5A 2WBKA 3H7VA 4Q8PA 3F4DA 2OSWA 4RXGA 4OE7A 3IJIA 1F61A 3QYQA 1V51A 3MYOA 2QEZA 4FXFA 4Q4RA 1EPVA 4P7LA 1R47A 2GWGA 3Q4DA 4I9JA 4WSJA 3SCOA 1RHCA 4JYFA 2PWFA 3L4ZA 2ZVIA 4L6DA 4NX0A 1AVAA 1ZJIA 1UWRA 3BH4A 2V2HA 1P1MA 4A3RA 2FJKA 1QNRA 3ATYA 5HQLA 4HMEA 3EXSA 4J2MA 3RM9A 4JTSA 1XPYA 3C61A 1JUKA 1Q2RA 4O4VA 2PDIA 1MUCA 4GIYA 4E4UA 4S3JA 4N9CA 3GSMA 3RAOA 3S6DA 1X6LA 1ELSA 5EMKA 1B5TA 4URIA 4FHAA 4W7VA 1JYNA 1UD8A 4H9ZA 3TH6A 4L80A 2E40A 2WOQA 1W9VA 2PPGA 4KEUA 4LB4A 3QKZA 4QM1A 4MSSA 1L6SA 1J0YA 2WNNA 1XX1A 2D0HA 1P1XA 4MY9A 2BWGA 2VOMA 1H09A 3W4RA 3IANA 4DWSD 3REQA 2XVGA 2GUYA 5HJXA 3IUHA 1P0EA 4AY8A 4LCRA 4A05A 3WEMA 4IMCA 4WKHA 1JGIA 1O5KA 2IKHA 2BGNE 1A0CA 1V6TA 1S1PA 4XIMA 4J3ZA 2UZ9A 5FL0A 1GQNA 1KFKA 1JPKA 3JVAA 3T08A 4YIWA 6TIMA 3ZJ6A 3IACA 1KFBA 2XVNA 1JNEA 4ZSTA 4DBWA 3LNPA 2VRJA 4C1NA 4ICCX 3W07A 3WDPP 3IJ8A 1DQXA 2E7FA 3WNLA 4PMOA 3UR5A 2J79A 4GH1A 3QFWA 5CQ1A 4XUGA 1SU5A 4JEQA 4ROQA 4JTAA 2VUYA 2X7VA 5DELA 1EGMA 3UFYA 1ZGDA 4UCGA 3UPBA 4WKAA 2RDTA 2VZUA 3KRBA 2QNEA 2OR2A 5H8PA 2FVMA 1M41A 2NZLA 4UMBA 2PF0A 4DB7A 3ZJKA 1KWKA 2E9LA 4F4RA 2OOGA 3PUGA 1OK4A 3CZEA 3MI6A 1XKJA 2TODA 2J77A 3K2GA 4KFNA 4NHVA 1TQXA 1KNWA 3V5OA 2WWDA 3WLKX 2B81A 3DG6A 5DCEA 3B8UA 1D8CA 2VC5A 3EDEA 1I2QA 3SM0A 2PWVA 2GVYA 4UNLA 2WJEA 1YW1A 3B04A 1P4CA 2Q8LA 2PDMA 1XIJA 3WH9A 3ZIZA 5C9RA 2FDSA 4GQRA 5CSYA 4GRSA 2ACUA 4LUSA 4K38A 4IIBA 4HYRA 3AZSA 4GACA 3UJEA 1D3CA 2PGFA 4UFHA 4O17A 3HPXA 1S5MA 2X30A 3S3GA 4FR6A 4GFSA 4QIUA 1MW0A 4FEZA 4M56A 5IHRA 4O53A 4XZIA 1UH2A 4BFAA 3WBEA 5FOOA 4NI3A 1UP2A 1ZP3A 3WBWA 4PUWA 1BYBA 2ZUMA 4JQ3A 2ZZ3A 2QCDA 2A0NA 1JRCA 1MZHA 5B7YA 1NDZA 3W29A 2WHLA 3CUXA 4E6MA 1ECQA 1PUDA 4GQBA 3WQWA 5LIUX 3T4CA 2BVDA 3I68A 1TV2A 5HXMA 4GVHA 5FESA 1LBMA 1BHGA 4RE0A 3EOOA 3VNYA 3HURA 3WNPA 3QMTA 4GYJA 5AYBA 1H3GA 3W76A 1VYSX 5T9CE 1UPPA 1W1VA 1RALA 3MMTA 4ATDA 2NT0A 2FZBA 4GQQA 4B91A 2YJQA 3GNXA 3AIRA 2P3ZA 3LV6A 1G9HA 1E4IA 1WUFA 3F5JA 2GJLA 3THDA 2HV5A 1CBGA 3IIPA 5A95A 1KTBA 1SUXA 1YHTA 1E0XA 1FKWA 1W3KA 2D2OA 1OX4B 3CV1A 4PMNA 1DJXA 2FH8A 3G2GA 5KINA 2VFIA 5ABHA 3TQVA 4ZO7A 2QCFA 2XPKA 2GJRA 1M01A 4MFEA 4LV4A 4J35A 3O2LA 2QCNA 4IGNA 1R85A 4BF5A 3EDKA 4P7RA 3BLDA 5E9AA 3WEZA 1IEVA 2GWNA 2A6LA 3VKDA 1JVNA 2QQ6A 3VM7A 3SUVA 5KMYA 1MEIA 1QW8A 3QPYA 4UTKA 4NXKA 3H7UA 4LVDA 1B9ZA 2QCDB 3H4WA 1EOKA 4G1NA 1A3WA 2OSYA 4JTFA 5BXTA 1Y8BA 4V2XA 1VCVA 1ICQA 1GKPA 2UY5A 3ERPA 2HE5A 3A4WA 4NNAA 3VMNA 1HIZA 4MDOA 3AXIA 5CGQA 4X60A 3BMXA 1LZOA 3UR8A 3RX3A 1VPQA 1PAMA 3BGAA 3FY1A 1UWSA 5GJMA 1H1ZA 2RJHA 1XUZA 2OU4A 1ZZMA 3QRHA 5G5IA 1KCLA 2BVTA 3NL3A 4U4MA 2WLYA 4MF4A 4A35A 1GOMA 1E0TA 4X61A 1O7AA 4FO4A 3OP2A 5DT5A 3E3HA 5EKYA 1CZ1A 3LHWA 2CZDA 3TMLA 4US6A 5F2MA 4F0HA 4XO6A 4NT0A 4NZ3A 1UR3M 4CN6A 2FTYA 3T2PA 4WKFA 1PX8A 3QC0A 2G41A 3H2FA 1R30A 1EWDA 5A6AA 5HANA 1KGUA 3EWYA 2UY3A 1UP0A 3AYTA 1QBBA 3UXAA 1H60A 5IHSA 3EPOA 3SCVA 2DSWA 3XIMA 3STCA 4ZCWA 4E2OA 1E0WA 4JTIA 3NNTA 4DUOA 3DFSA 4CD7A 3TOPA 1MWOA 1K9TA 3RRAA 2AMGA 1W5NA 2G5WA 3CV7A 4OFCA 3W72A 4PTVA 3DHUA 4L56A 2BOEX 4DF0A 3IRSA 3HMCA 1N8FA 2IKIA 5GJNA 1GQKA 3OBEA 1OFOA 1U5VA 2DP3A 2JGQA 3LPOA 2GGEA 1WBJA 1OZQA 1JJKA 1UR8A 1B2YA 1CCWB 1C9DA 1FWTA 4RDWA 2ZC8A 5BRPA 3A21A 4IQLA 4P61A 3C0SA 2XINA 3VCRA 1MUMA 2ZA3A 3GS6A 3VGDA 2G4FA 1IZJA 2TAAA 1OSEA 4ZVJA 1U2YA 2FLIA 4K36A 3GXDA 5EL1A 2C91A 5DT7A 2Z1VA 1Q7ZA 2NQ5A 3PTDA 1XIFA 4IP7A 1XYCA 2Y5EA 3KXQA 3HPAA 3VNKA 4GYPC 1BKHA 5D2XA 1O5XA 3GD6A 3IJLA 1C93A 3S2CA 1V93A 4D6IA 3LUTA 1ZU8A 4IHCA 4C7DA 3B8SA 3HIJA 4DBSA 3JR2A 4JHZA 1UIPA 5HWJA 3FJNA 3LK6A 1EJUC 3L5AA 4IPLA 5HINA 2OZ3A 3W7HA 2XSAA 3RCYA 3SGZA 2VC7A 4MGGA 4JL1A 3H4GA 3VE7A 1I60A 4HOZA 2WSQA 1VJSA 2NV9A 3RILA 4QNWA 4DAFA 3HFYA 4UOJA 4DJDA 3R12A 1RXOB 4E38A 3BLEA 3WUBA 3VK5A 4JXCA 2ZUNA 4O18A 2VWTA 4QISA 4JTJA 5BMXA 2ZE3A 4IICA 3NQAA 3WFZA 1JYXA 4QE1A 4JR5A 3BJTA 3CL6A 4MM1A 1ONRA 2KX9A 4ZTXA 2VD8A 1HZYA 4PN2A 4MWAC 4UTLA 3C2RA 4MTVA 4U33A 3VO0A 3I3EA 3CK5A 4U2YA 2OWWA 1KRCC 1YTEA 3V4BA 2B31A 3MMWA 5K9DA 3VIOA 3M4HA 4W8AA 5FJTA 2JF7A 4LXFA 4KIEA 2HXUA 2ON3A 3CNYA 3B4YA 4JIRA 1XINA 2EJ1A 1FH8A 3NM3A 3GXFA 1NJJA 2GVGA 3S5OA 2BZNA 1QR7A 1LWIA 4CEUC 4PMDA 4YHEA 1RV8A 1Q6RA 2CETA 2W0UA 5JU6A 3Q37A 1S39A 4IMDA 5A6BA 2YDRA 3LA4A 3MHGA 4JKLA 4QJ5B 3MJYA 2OJPA 4MFDA 3JUGA 3KBJA 4GZJA 4CCEA 3GBDA 4M7SA 1LT8A 2PDYA 3M5XA 5TAOA 1HP5A 2C15A 3SCWA 5C6MA 1DJWA 3ITLA 4QFUA 1Z44A 3STFA 2GJXA 1IQ8A 2X16A 4S3EA 3KBSA 2WHJA 2QLYA 1L8PA 4MWAD 3ZVHB 3GTFA 1P7TA 5A8MA 3S2JA 1Z89A 1S2UA 1JGMA 3LCHA 3TR9A 3VIHA 3FEQA 3MZNA 4MLJA 1JZ7A 4RR4A 3V36A 4CNPA 1EZ2A 5LXEA 3REQB 1KBKA 1R5YA 2P76A 2AQVA 4LC6A 4WGHA 4J3XA 4ZMGA 1TO3A 1KV8A 4BWLA 5GVJA 4GUGA 1NSJA 1ECEA 2CC0A 2ZWYA 3E5BA 4TTGA 3PFMA 3T05A 1FCQA 4O10A 4ZE4A 4L65A 3G77A 5M17A 4A8LA 5AHMA 3RX4A 1HKWA 2Y7GA 3TQ0A 4FX6M 1DTNA 5FAJA 3R0UA 1SZGA 2NV1A 4QG8A 3ME3A 3OPSA 4KGJA 4HZMA 5LGZA 3WQVA 2RAGA 4P7QA 3NQGA 2YOCA 4M82A 1WNOA 2C71A 2J74A 4PUDA 3HJEA 3F2DA 4QGCA 1PCKA 2DW7A 2WZMA 3ZSSA 3EWCA 1VIWA 4IH3A 4LYKA 4FNQA 1WZLA 3A23A 1NDVA 4XO7A 3EPMA 3K1GA 5AVHA 3IJ7A 3GR4A 1ZCOA 3TTYA 4DNHA 4YLWA 3T1GA 5HNTA 2XSBA 3W1TA 4EXBA 1JZ2A 4B3ZA 4CGTA 3W87A 4JX4A 4QSHA 3V1PA 1UWAA 1DIDA 4ACZB 4DWDA 3WJWA 1M65A 3P2VA 3OA3A 4ZQNA 3VIPA 3NQFA 1KCZA 4C6PA 5AHNA 4GX8A 3ARXA 3A13A 4C6FA 1QHZA 3O0FA 4R7JA 3SY1A 2BY3A 3VOHA 1HUVA 5C70A 2ZUVA 3N17A 4J4KA 3WG6A 4W84A 1J01A 2ZUSA 2VEPA 5G1YA 3MWAA 3M9YA 5CSUA 1US2A 1SFJA 1W5QA 2W27A 3ZWSA 1LG2A 2WPGA 3TC7A 4TU1A 3QV8A 4A22A 1ICPA 4PTWA 1H4PA 3KOXA 4RV3A 2PB1A 3AXKA 4WY0F 5I02A 2WK2A 1HKIA 4O14A 3VGEA 4DF1A 2INFA 4U10A 4A8NA 3MW7A 1F7BA 1GHSA 1HJVA 1J9YA 2JK2A 1HJQA 4AC1X 1E4LA 3P84A 4O52A 1WZMA 3UVAA 1XICA 1TPFA 4AIUA 1QDSA 5EPDA 3UNTA 4AZGA 4H8UA 2A79A 3J7HA 2YBUA 3MSGA 3PVFA 4UQDA 4PC8A 1MMFA 2DSKA 4LB3A 2AKZA 3L4XA 4ZB0A 5AOUA 5D9PA 3UJFA 2V63A 1TCMA 3N3MA 2YL9A 3T0TA 1GK8A 1PL9A 2G3NA 3S5ZA 4HK7A 4IJBA 3PBGA 2Z7GA 2J25A 1TA3B 5AECA 2EKCA 2XIIA 1GVOA 4HZ7A 4JQAA 3CTLA 4AG0A 3KVKA 1GORA 3PBVA 3PBYA 4MIMA 2WMJA 1FWAC 4GH3A 5ECUA 3MSDA 3SRFA 1FWDC 4CD8A 3CPUA 3IS4A 3RPMA 1NDYA 2QV5A 1VFFA 3MSRA 4P7OA 4PTXA 3O3RA 4X0NA 4Z08A 3KLKA 1GJUA 1QTWA 4JHOA 1TRIA 2Y4SA 1GKQA 3M0KA 4WDTA 1J10A 1F3EA 1VPXA 4B3KA 1GZGA 1R9ZA 5CZTA 1QW7A 1JYWA 1DIKA 4DNMA 4I3GA 1CENA 3S42A 2ASHA 4HBKA 1PO9A 1RR2A 3MO7A 1FRBA 4AZ5A 3OZPA 4RW3A 5BXRA 3H2AA 4GUFA 1HJSA 4LBSA 3GDRA 4E4FA 2FB2A 4ICMA 3BSGA 3NSNA 3W1MA 2PTZA 4DZHA 4US5D 3PN8A 1FWWA 4IGMA 4XZ9A 2J47A 4W87A 3CIXA 4TIMA 5K7JA 3HQPA 5IBXA 1TV4A 3LXAA 3VGGA 3A64A 1Z8AA 1EF3A 4DY1A 1YDOA 3PTQA 2CITA 3S1VA 1G4TA 3ELFA 2HRWA 5AC6A 5DN1A 1XI3A 3ITYA 2QJNA 4AD1A 3U48A 5FJPA 1QK0A 1HJWA 5DY2A 1NQKA 4UR7A 3HTWA 4FXRA 1V4YA 2R1LA 3NO5A 1J6PA 4WGXA 2PDWA 4LC8A 1A0DA 3OVRA 4EANA 3WMCA 1AA1B 3KTSA 3M44A 3ITVA 3R0DA 3N1AA 4PL2A 2NQLA 4GPNA 4HMCA 1KFCA 4N42A 4PTNA 2PGRA 1Q6CA 4D71A 1RJQA 2X7WA 3V5FA 1GZJA 3VC5A 3LRLA 3QN3A 3GUWA 4Q8VA 1OT1A 2ZRZA 1IR2A 4C6EA 1SR0A 3WQ6A 1U5JA 5I0DA 3VDHA 2UY2A 3L2LA 4QRNA 4O28A 1VFMA 5TBOA 2QIWA 2CKSA 4TMCA 1VENA 4EPBC 4JD4A 4FALA 3SW6A 3WQOA 3SUUA 3USZA 1N2VA 2UWFA 4R34A 7ODCA 3PZGA 3GW0A 1TX2A 3SCUA 4YPJA 4UTWA 4L1GA 4I5RA 3TTQA 3LEPA 1I0BA 4V33A 3WENA 4D1JA 1BPLB 2WC4A 1PDZA 2FVLA 1H41A 4RZ6A 1FCUA 2ZUWA 1WZKA 5I23A 3CB3A 5LNRA 2JQXA 1ZSXA 4OJYA 1ONEA 4D6GA 3NWRA 1GNXA 1HNYA 3L23A 3B8VA 5LIYX 3SN1A 3QLDA 2A4AA 3W7PA 2HROA 3L68A 1PTGA 4C6QA 1GOOA 4LYRA 2XTKA 3IJQA 3VIIA 4KS0A 4PCPA 4NIRA 1GUVA 4L4PA 2H9AA 1ITXA 4C6KA 3D5HA 4MOZA 2PCEA 3S2LA 1O4UA 5DX7A 3RLUA 5LHEA 3HPFA 1YPFA 2PDLA 5EMYA 4LAUA 2HVOA 4JTKA 3T8LA 3TQKA 1JPIA 2E4TA 5KZ6A 1BF2A 4LY4A 5M2FX 4A2RA 4E3TA 4A3QA 1EOMA 3T42A 1Z6KA 3W75A 4F9DA 3BC9A 3LSBA 2V5CA 2DQWA 3NQ7A 4PTDA 2CXGA 2ZX7A 1DWGM 3HV9A 3RU8X 2VYOA 2ZOXA 3R11A 3I7SA 2D1ZA 5KITA 4DWSB 3PWAA 1JF6A 2A3LA 3MY9A 3KL0A 1PWMA 1QWGA 1BGGA 1HX0A 3G3MA 2DIJA 5HNRA 3MO4A 5DMLA 2VX5A 1US3A 4HNLA 1QBAA 4TOQA 4K8HA 3ZT5A 3TROA 3LCXA 3LYEA 1R3YA 2C79A 2Z0IA 4PA8A 3WJZA 1XIMA 1SMAA 1WKYA 4V1XA 6REQA 2W9MA 1MXGA 1TB3A 4OV4A 1TG7A 3UG3A 4N0RA 4BQ5A 4H9VA 3CUFA 3KDNA 4JS3A 2NSXA 3F4CA 1QPNA 3S5SA 4TO8A 1KTNA 3EOUA 3QVQA 3NZ1A 1AFSA 4AVOA 1MNZA 5FJUA 3F2CA 1NWTA 2QCHA 3LSCA 4UB9A 2ZZ7A 1R3QA 4UQAA 5G4HC 3QKEA 4RL3A 3PNUA 5I24A 1YXDA 4K68A 3G1VA 3QTPA 3PZUA 3R7MA 3W82A 4M51A 4AF0A 4C6LA 1MRQA 3PJWA 4C1LA 2TMDA 2PSNA 1J0HA 1L0PA 5D2VA 1B90A 2ZX8A 2VP8A 3BLKA 4FNUA 1AMYA 3M1ZA 4DJFC 2VCBA 2X2YA 4TVCA 3JZEA 4GMEA 3RN6A 1V6WA 3MWCA 3GC4A 3NUKA 3WYZA 1P0KA 3IIXA 3C2VA 3M5YA 4LF1A 5C9UA 3A3HA 2RGLA 2A3BA 3APGA 5HA7A 1OX6A 3DDMA 1XRSA 4O50A 1K8YA 1CLVA 1O66A 1K70A 2D23A 3CHEA 3BAYA 3CASA 4JX5A 4Z1BA 3TZFA 1TREA 4FLSA 4U31A 3OGVA 3UD6A 1XG3A 3LLDA 3ZLGA 4ZL1A 3KAOA 4HTBA 1B3VA 2WPBA 1ENUA 2PU1A 4OOUA 3OEXA 1SM9A 2J13A 4E4PA 2R1MA 1G94A 1SSGA 2C1HA 2VZVA 4HSHA 1IGWA 3UZXA 2B4GA 3CLWA 3M16A 4RNIA 7XIMA 2XG9A 4RZBA 1UQYA 4AF0B 5K9CA 4Y9NA 4EX4A 1R2SA 4IPNB 4S3GA 4BEQA 2OLSA 3UY7A 3N9RA 4QITA 2RH9A 1WDWA 3WQGA 4O19A 5DCDA 1GKRA 1RY8A 4QSFA 3BAJA 4QS6A 2FTWA 1NVMA 3WJSA 1V02A 1ESWA 4A4AA 1MO0A 3WD1A 4DBEA 1W31A 2BHZA 2FZMA 4Q8WA 3BZGA 3W24A 4ZFMA 2WQPA 4QG6A 1YX1A 3AOFA 3EWXA 4XG1A 2XGIA 3ZMRA 6XIAA 4B3LA 3A6OA 4CNTA 3E2RA 1UR1A 3MKKA 3KVLA 2XSXA 2E1DA 3NEHA 1V0LA 4Z17A 3W1UA 2J75A 1QO5A 1VEPA 3PPFA 2EHHA 3K4WA 4ZQCA 1XYBA 3GX9A 3AIQA 2FYMA 2P10A 3OODA 2X09A 1IT7A 4FLOA 5FIPA 3RLHA 4MB1A 1ZS2A 3FJ4A 3CO4A 3OBKA 3MCMA 3WF2A 2A3HA 2HNHA 1LLOA 2FH6A 2QMJA 4TVDA 4HNUA 2EGZA 1R3VA 3PR2A 4ZB5A 3VXGA 3AXMA 1DWAM 1W3NA 2ZX9A 3IVUA 1OM0A 3GKFA 1SZEA 5AHLA 1OYBA 3N29A 4B5WA 2B7QA 3TNBA 3GZAA 3N11A 1IV8A 3AYVA 3M47A 4F0LA 1WOBA 4DLMA 2WM0A 3GVRA 3HGRA 3TTEA 3VZZA 3M0JA 1A53A 3LNMA 1V08A 3B40A 3D47A 5CGTA 3AFBA 5GNYA 2WB5A 4QG9A 2ISSA 2WZEA 3LTPA 2YDAA 5IFTA 3O9NA 4GKLA 4UTFA 4BWLC 4TX9A 5GNZA 5I78A 4WX2A 2GGGA 1IF2A 2XH4A 5DBTA 4DO5A 2E68A 1XH1A 1VHCA 3N2BA 3AYRA 4BI6A 1T8QA 1PJ9A 2J6XA 3UXLA 3VDAA 4NXSA 4HP5A 4H7CA 7REQA 2QVNA 1PHQA 4KRTA 5K2ZA 1BG9A 1FH9A 1XLLA 2W4XA 3TW6A 1XR2A 4OHQA 4K6AA 5U7SA 1M68A 5EY5A 2AAAA 2BG5A 3USBA 5FEWA 2FPTA 4LUSB 1SO5A 2HK1A 2ZDRA 3BPWA 3AISA 1S2CA 4RE3A 1OGBA 1K9DA 2DPEA 1EQPA 1UOKA 3ZYZA 3LRMA 1VR6A 5IRPA 4E8CA 2Z6IA 4QQ3A 4GINA 4MZYA 3Q45A 4G1KA 3H24A 3W1PA 1VCGA 4I7UA 1Z7AA 4W86A 2R8WA 2X1RA 2QIIA 1MI3A 1UH3A 2CIPA 3KZSA 1M03A 5FJOA 4PUKA 1OADA 2Z1KA 4CUCA 4UQ9A 1WA3A 2AL1A 3RO6A 2PD5A 1LORA 1XF0A 4XUYA 2DUAA 4UR9A 1IEQA 1A5SA 3I6RA 3T6CA 1XH0A 2Y8UA 5L9FA 1JF5A 1Z32X 3GW3A 2V81A 3NL6A 2O7SA 3CH0A 1B54A 5CBIA 3SGGA 3FHQA 2OEJA 3FIGA 4KCWA 4W8BA 3BW3A 3N19B 3F1QA 1XH2A 2Z28A 4UNIA 4JIIX 5EYWA 1JD9A 4AZBA 1TMLA 3W28A 5JIPA 2CHNA 1A5NC 3BGJA 3P67A 2Q02A 3ARUA 4GO9A 5BWAA 4HHMA 3WBXA 2YW4A 4DRSA 3N34A 2QXWA 3MV01 4G6CA 3WDQA 1TTIA 5BCAA 3B05A 2AL2B 1DE6A 1RLCL 2Q6ZA 1W2PA 4Z2HA 3H54A 1VIZA 3NDZA 2ZA2A 1EHNA 3LBCA 3STEA 5LNWA 3FAWA 3FA3A 3MZ2A 3SB0A 1UBPC 3BSHA 3NPXA 1I45A 3VD9A 1GT8A 4XVEA 4DX3A 5C9WA 4UTTC 3ZXWA 1E43A 1J2BA 4O1DA 1UR4A 3BICA 3KP0A 1BSIA 4AY1A 2IKJA 5KZMA 3AS2A 3NIYA 3LTSA 2GUUA 2XN2A 3W7QA 3T4WA 4NJJA 1XGEA 1T8XA 3P80A 2XZ9A 1JCJA 4HN4A 3O1NA 4ZXLA 2EO7A 2D73A 1K8ZA 4FNPA 3VNLA 4AYSA 1ZBWA 3VIKA 1YIXA 3VIMA 5E0CA 5AZ1A 4AVNA 4GYFA 3KCLA 4Z2JA 2VX7A 4M6PA 1H5YA 4Q4QA 3WQCA 1RCQA 1I4NA 1R38A 3OHIA 3TJIA 5D38A 2ATSA 4CEXC 3A22A 2QGHA 4ZO8A 1O1HA 4YS1A 3IVSA 1OG0A 4BA0A 4E8DA 3W1RA 4IL0A 4RW5A 3MTWA 3QOMA 4YU1A 4EIVA 3WLSA 2C13A 4R53A 4F40A 4HHPA 1GWJA 5H1WA 4UTIA 1GCYA 2PWHA 3EPNA 4ADSA 4Y7EA 3GH7A 3TXVA 2J8TA 4DWSC 1Z69A 1NP0A 4NNCA 3H22A 2J8GA 3B9NA 3BLLA 4ORMA 4N9DA 1B9BA 1WB0A 1MRAA 4ERIA 3KVMA 2D0FA 1OFQA 3CH9A 3TNOA 1LOSA 2CWNA 4LYQA 3VNZA 4GA8A 4NZJA 5CLTA 3GG7A 1AH3A 2AAMA 3NAVA 1YNPA 2FTPA 3AUJA 3HG4A 3DBPA 4OZOA 1PDYA 2W5FA 3MUCA 1NFGA 3SY8A 3T40A 3PAJA 2JEQA 5D9MA 2PA6A 4YYCA 5HOSA 2PRMA 1UPMB 3LOTA 1KFWA 2Q3OA 4K1GA 4JCLA 2EAWA 4ZZ9A 3ARTA 3POHA 2V2CA 5FD0A 1TVLA 3KBVA 4M1BA 2IMRA 1AK5A 2J78A 3ISIX 2JE8A 2B7OA 3L4TA 2X0SA 3V75A 4H01A 3EWZA 2WSPA 1K9EA 2V3GA 1V0KA 2J4GA 1HVQA 5CPOA 2DZPA 2P88A 2NX9A 1E9IA 2Y85A 3LLFA 3G1YA 2XHYA 1KRBC 4Q8MA 3B3DA 4MWAB 1SFTA 1EQCA 2IPFA 1QMLA 1A4LA 1CXLA 1O94A 2EXOA 4FIRA 3GTHA 1Q65A 1Q5MA 3S2MA 2NX1A 4LT9A 2QYGA 4JNZA 3TN4A 3SADA 3ITGA 5AY7A 2GLKA 1HO4A 2YCEA 1K9FA 2VEKA 9XIAA 3AWOA 3N12A 2LLEA 1U83A 4WDUA 1TE1A 3DI1A 3HU7A 3ZQ9A 2V0TA 3CUHA 5G1MA 3UWWA 3L9CA 3PSVA 3ZM8A 4I5XA 4RE4A 4AD2A 3AIUA 3HOJA 1A3XA 4ERGA 2HDJA 1LG1A 1CX9A 3ABZA 1K1DA 3RCMA 2WM1A 2F61A 1A49A 1IWAA 3T55A 3PZ9A 2PEVA 3PK7A 4DUWA 1CEOA 1J0IA 3PZMA 4HA1A 3GNRA 3MDUA 2H3DA 4Q8NA 1E1CA 3MC5A 1XLAA 2DSZA 4ZEPA 1E9ZB 3SSJA 1GQJA 4IIDA 1I6NA 3VDBA 1M53A 2OQLA 4AIEA 2CXEA 3WBYA 1PZ3A 5E9XA 1W1ZA 3BAIA 1SW7A 3EX2A 5CPQA 3GH4A 3A47A 3GFYA 1G4EA 1KO0A 2OX1A 4Z0SA 3O16A 5FF3A 2TPSA 1V3KA 1TPVA 1G7VA 3BO9A 5IXEA 3TX9A 1BF6A 4CN1A 5CXPA 3O7UA 2PWUA 1UA7A 2PRHA 1SGJA 4H9YA 3C6CA 2Y7DA 1UD6A 3SI9A 3VFLA 4AEFA 3GY1A 3GG0A 1OVDA 3KUMA 4WSHA 4GNVA 5HMEA 1QUMA 1PB0A 1G0CA 4IP5A 4JN7A 1R9XA 4LCQA 4H6RA 1RCOB 2BOGX 3FXGA 3KM8A 3QJAA 3VGFA 3S4TA 3NVTA 2A85A 1W2VA 3MVIA 3LHVA 4N6FA 4PEEA 1PX3A 3LV5A 1UMYA 3VD7A 4LFYA 2ALRA 3GYCA 3W7EA 4LWWA 3F03K 1H62A 1I1WA 3BUVA 1GVIA 4QLLA 1ZJAA 2Z00A 1R3SA 3RDKA 4TXEA 2RDWA 1XLHA 3EMCA 2VRKA 5LIXX 3OO2A 3O6AA 1E56A 4HA3A 4H7VA 3NM1A 1AZ1A 2VR2A 5J5DA 1LL7A 2G0WA 5LIWX 4HCDA 1DXIA 3RUBL 1MDLA 1ZJBA 2HK0A 1UC5A 3C2YA 1OF6A 1SO6A 3P6LA 8RUCA 5E70A 3AICA 4IUGA 2Y8KA 5LXXA 4AIBA 3BDKA 3MSYA 3W81A 4M6UA 4G7EA 1FWHC 4GWEA 1YDYA 3GTIA 4TMBA 4A6GA 1PHWA 3W1QA 1V0MA 1X96A 1UUOA 2A3EA 2VQTA 3HM7A 3LX9A 2X8RA 3LZ5A 1K7FA 2FMOA 1QNQA 4JOMA 1XYLA 4HSOA 1SR9A 4DI8A 4FNSA 3QHNA 4YNGA 2F8QA 2PC4A 1E6ZA 3CT7A 2YCKX 3GNPA 2WMGA 1M9HA 4G56A 2CLEA 4JQ1A 4ZE5A 4CQDA 4PRRA 3BCJA 3T2OA 3BAWA 3ZLHA 1EC9A 1RQEA 4ENLA 4FLQA 4IL2A 5FCZA 3KVJA 2Y2WA 1QRQA 2QDGA 2BGQA 2X1TA 3LCGA 3GTNA 3OLIA 3TYUA 4EACA 1DEDA 3TLLA 4N2YA 4UQBA 1FHLA 1PVNA 1GONA 1VJZA 4V27A 4FSAA 4LYPA 3UYCA 2CHRA 2ZZ4A 1FH7A 2QF8A 3BL3A 4JY9A 1L6GA 4JN8A 4QEEA 4QLKA 3TC6A 1SJCA 3BLIA 3ALGA 2QJJA 2WNWA 3F5KA 2DV0A 1KA9F 1CXKA 4JQ4A 2G4JA 1XM3A 2XIQA 4EAMA 4G7EB 4JNMA 4DBUA 5CLWA 2QDDA 3FYPA 1V02E 3QHMA 3LBOA 4QJ4B 4IUOA 3T07A 3PJUA 4WD0A 4GZIA 1O68A 1FWNA 3BWWA 4UTJA 1HO1A 2Z27A 1E9YB 4LALA 2I5GA 2NX3A 2G95A 5CCZA 3MVTA 4KWSA 3AMKA 4LSBA 1CGXA 1J11A 1X8CA 4C6JA 4NZ4A 1CGTA 3CM4A 1RCXB 4KESA 1IIHA 1XISA 1ZAJA 4ORIA 5LIKX 1Q63A 5HMSA 1W5OA 2XIJA 4FF5A 3CPGA 3RMJA 1MZRA 2AL2A 3GQYA 5EMMA 1ZTVA 2FKPA 4GXWA 2XISA 1LJYA 4WF7A 3IK4A 1HJXA 1IWBA 2WVVB 4JTHA 1A5KC 3S9ZA 5AC8A 3NR0A 3VKAA 3RFAA 1JNDA 3U4AA 2O55A 3MHUA 2AOSA 2J7BA 3PBUA 1SW3A 5F1VA 3LD5A 5I2UA 1UB3A 2DH2A 3KRZA 1B57A 1F05A 1ONWA 4GFIA 1IEWA 3WX7A 3W6MA 3EKZA 4GIRA 4X2PA 3TDFA 2I16A 1B3XA 2P0IA 1U1HA 3KS5A 5I07A 2ZC1A 3ZJ8A 1XV8A 1JPDX 2BSLA 5TD4A 4D8AA 3IGSA 3VAVA 2RHGA 5A8GA 3C86A 3P74A 3UCQA 3V35A 1L6FA 2WC7A 2OEMA 4IWWA 1WAWA 5C0QA 4ERAA 4NY2A 2VZOA 3I4KA 1ZL1A 3N2XA 2WSKA 3QZEA 3U0HA 3OVQA 3GU2A 4R27A 3Q94A 4LVGA 1W5MA 2YL8A 1IT8A 4XD3A 4G9PA 3TYZA 2FDMA 1NF0A 2OGJA 3NCOA 1WCGA 2C1GA 2WVVA 5GPRA 2CHOA 3U7BA 1O6IA 3QZAA 4OWGA 4IM4A 4QROA 2C0AA 4MLRA 2PBGA 2CU0A 2J7CA 3NVDA 3R13A 1QASA 4JAWA 5H2ZA 4CU8A 2VVSA 4D9PA 1MEHA 4MPQA 3AIBA 5TIMA 4EP8C 1PV8A 2B0MA 2WHMA 3QSRA 2FZ9A 4IISA 3LI1A 1DPMA 1Q6EA 1AJZA 3ARRA 4DELA 1P43A 2AKMA 3LGDA 5ABFB 1TVNA 3AS0A 4YJ5A 4EF9A 1DV7A 2PTWA 2BB0A 1VFHA 2OELA 1Z48A 3W25A 1CXHA 3S5YA 1MQRA 4I7WA 1DJZA 4XZMX 4WDXA 1PZ1A 1UROA 3QR3A 2VEIA 2PD9A 4JFTA 3TXZA 2A5HA 3P8IA 3CL7A 4RLIA 3G0UA 3BLPX 4MJ2A 1DWHM 1XFBA 3M0ZA 4DO4A 3STPA 4CD5A 1LL4A 1GQLA 4K1WA 4WJXA 1E4MM 5BMWA 4LEFA 2AMXA 3UWYA 4N7QA 5TNVA 4IPJA 2QUVA 1OC5A 2OQHA 2VDHA 1NWRA 2VC9A 1V3MA 3MYPA 4LBUA 3OZYA 3RM8A 2ZE0A 3EDDA 4HJWA 3KHDA 4MY1A 1B0IA 3W6YA 1J18A 4JTTA 5KZEA 1XIBA 1W9XA 1OJXA 2DFAA 4AX6A 4GUIA 4CU7A 3L4VA 2OYMA 3UXKA 3QQ0A 2B7PA 4KEZA 2YBVA 3WMLA 3ZVHA 4TV6A 4PFHA 3ORWA 3PWIA 4U28A 4GI6A 1CXFA 4AYGA 3CJPA 1VFOA 5M5DA 4PH6A 5EB8A 1YXYA 4IX0A 4CVWA 1JXKA 5HWNA 4KT2A 2V2DA 1IR1A 3BG9A 4YMZA 4E2VA 1UMLA 2O56A 2NVDA 3PS7A 2FGLA 5K4XA 2QR6A 3R4IA 1UWUA 2PGWA 1E1CB 1Q4WA 1R7OA 2Z1WA 1QJWA 3WNOA 2HZGA 3NL2A 2CLKA 4WVXA 1SW0A 2Z1XA 4KFPA 1Q8AA 1BSLA 3DYOA 4X9YA 3COTA 4RNFA 1XIDA 1HW6A 4GIAA 4YWIA 1NIUA 3IAQA 1V3JA 1TUXA 7ENLA 3E2QA 5I6SA 5AYIA 3TW9A 4MMWA 3NSXA 3LCFA 3NQEA 3PB2A 1TWZA 4Z42C 3FKKA 3UNDA 3PANA 1RK5A 1XIIA 3B8WA 2ZICA 3PP7A 1Z9AA 2ESCA 4XAFA 4PMVA 5LNSA 1S5NA 4S39A 3INPA 4F8XA 1M7PA 1A5AA 1FP9A 4KH2A 4GBDA 1XLFA 4J7RA 2CZFA 4FF7A 1C9WA 2BHUA 1DOSA 1BTCA 3G24A 1E73M 5DRCA 4Z0JA 1FX6A 5E6YA 3GIPA 4UR8A 2ZZ2A 1TRDA 4KGLA 3VCCA 3V0TA 3WF4A 2HQAA 3TJXA 4KIRA 1QOPA 3EB4A 3VKCA 4FNTA 1FOBA 2Q8XA 3GC5A 1VC4A 3ZZ1A 3QQ1A 1E9LA 1K6AA 2ZVRA 3I4EA 4Q22A 3IARA 4YHGA 3IV8A 4O11A 2JEPA 5I00A 1TPWA 4S3DA 4GE8A 4ZBCA 5AC4A 1JZ6A 1NELA 2Z1BA 2ZZ1A 1Y65A 3H12A 4U2ZA 1FXPA 3KWXA 4AIOA 2DT1A 3TU9A 3P81A 5DQPA 3NGFA 2O7QA 3CWNA 2NWSA 3AHVA 4BQ3A 4O13A 1W8SA 4AVFA 2VRQA 3M41A 4KF1A 4DXKA 4IIFA 3V3WA 2WW5A 1J0ZA 5EBUA 4QAWA 3W37A 3KCOA 1YDVA 4Q8QA 3TJLA 4DI9A 1FBAA 3GXIA 2ANUA 3A9IA 4Z2LA 4GG9A 3AI0A 4X0VA 2VR4A 3RLGA 1W0MA 3CWHA 2IUZA 4WRHA 4CNUA 1WAUA 4ZTYA 1YRRA 4XD6A 2J7GA 3ES7A 3UG5A 1V7AA 1OC7A 2F6KA 2VMFA 2XWDA 3WK2A 3WLNA 4H2CA 2VGIA 2DZTA 1EGZA 2P0OA 1KD0A 3THAA 2D3LA 1BYAA 4IIEA 3P0WA 3QC3A 4OU1A 1W37A 3H26A 1P6WA 4PBEA 4C5YA 4D6FA 2X1SA 1JDDA 3OYZA 3ZR6A 3KE0A 3MI2A 2OT0A 2H90A 2I57A 3FA4A 1ZHAA 3U3HA 2CZ5A 1CB2A 3ARYA 1NU5A 5FL1A 5C55A 4PRWA 2Y5JA 2CLPA 1T6MA 1JDAA 1KQYA 4DUVA 2F2KA 4JTRA 1DHKA 1JCTA 2G3MA 2WMIB 4LUTB 3WQ5A 1T41A 4M7TA 2DZSA 3P82A 3TK7A 2DZXA 3NQVA 4C6NA 4LQ1A 3N4FA 4ICNA 3PPCA 2OYLA 3NA8A 1F76A 2ZRXA 3FDGA 4JDBA 3B0VC 2BMBA 2XIMA 1TSIA 3VKJA 3BZJA 1OD0A 3OQ8A 5AFDA 2WLZA 5TQLA 1ODZA 4DPQA 1I9CB 4LY8A 4CLMA 2DZUA 3BQ5A 1WKEA 5SWUA 1HF6A 1JUBA 3DFPA 3OVPA 2QJHA 1SFSA 1FCVA 4AISA 2BHYA 3VDGA 4EPDC 4I9TA 4B5NA 2Z25A 4CQ8A 2V5LA 1HJUA 1IXPA 1YMYA 1HQTA 2Y70A 3CL8A 1XLIA 2D24A 1JD7A 2BNJA 1ZCCA 1EX5A 3MI3A 3G22A 4PUUA 4PCTA 2IPGA 1TWSA 1JFHA 3F7JA 1KV5A 1KGXA 1EPXA 1MQQA 1NTHA 3R25A 3L4WA 1RD5A 4ADTA 1HKJA 4ZQRA 2GSHA 1HTIA 3M6YA 3NOEA 2G8ZA 5A1AA 4DJDD 3O06A 1BLIA 2ZXAA 3DFQA 3T09A 3NXFA 3AZRA 1YTDA 3AO0A 4LUTA 1WKFA 3RK8A 4XZNX 3AUOA 3FGCA 2Z29A 4OBSA 1VBHA 2YX0A 3WO8A 2PZ0A 1CECA 2ATMA 1FP8A 1R2TA 3BE7A 3WH7A 5HUOA 3ALFA 4C7GA 1XSIA 1UIOA 1WQ5A 1KR0A 3L0NA 4IF2A 4AUBA 1G4SA 1WDRA 1GVRA 1OIMA 1S2TA 2YXGA 2NV2A 1IEXA 4E2DA 4B4FA 1MFUA 4NI8A 3KDOA 4PODA 4Q7IA 2R9RA 4K37A 4LAZA 2DORA 3LENA 5KETA 3N2OA 1JCMP 3AAMA 6TAAA 4B2DA 1EB3A 3CLMA 4HGXA 3FDKA 1UKPA 1XIHA 3W7CA 2BS9A 1KW1A 1R86A 3R8RA 4HCLA 1PXGA 3PWGA 1Q7MA 3WMBA 2YIHA 4DXVA 3WK3A 2V67A 1CB7B 3IV3A 4HYWA 5I3DA 1VFLA 3GXNA 3Q58A 3ECQA 1Q6FA 4NZFA 3W7KA 1CWYA 3WL1A 2WKLA 1UASA 1TPH1 1E5NA 4PMZA 4D6HA 4S3CA 2X41A 2VCAA 2R1PA 2X40A 3QSTA 3EGJA 1AODA 1KM5A 2XFFA 3BG5A 1H7PA 3ONBA 3GFZA 4EOUA 6XIMA 3RMEA 2DT2A 3NGJA 3QH2A 4AEOA 3VUPA 2FJUB 2DJXA 3ZVIA 1XL9A 1LT7A 2Y89A 1QPKA 3NEVA 4PCNA 3H7RA 1NOUA 3CUGA 4DXXA 4ECLA 3PF3A 4Y2WA 2WSRA 3NQ8A 5A6BD 2DVUA 3W70A 5M3WA 1EDQA 4FP1A 4DYJA 2EPMX 3KL3A 1LWHA 3BAKA 4RDZA 4B5SA 1Q66A 2AQOA 1MW2A 3M0HA 3LHYA 5FF7A 2H9AB 4OBRA 1DXEA 3TUUA 3LHTA 5LA0A 2QHAA 4GABA 2IQTA 4KEMA 2VC6A 2Q3RA 4PEKA 6A3HA 2GGHA 4CD6A 2PLKA 1DJQA 4H41A 1KM3A 4J1OA 1YBQB 1CTNA 1X7IA 2C14A 2O9TA 3P8JA 3NDOA 4AHOA 5CZKA 1E5JA 1W3IA 4R7WA 3WUFA 2WZHA 1IYXA 4GJJA 2P53A 5DO8A 3NPWA 4MJ4A 1F8MA 1LUCA 3CHCA 1VLWA 4NAEB 3ZWTA 3HFTA 2ZIDA 1PZ2A 5E5CA 4MYAA 1F9CA 1OABA 5AYYA 1KBLA 3CBWA 1CW2A 3BMVA 3BVJA 2Y7FA 4QE5A 4L64A 2BP1A 3QZ6A 4QDWA 4DYEA 1FFRA 4PCFA 4AY7A 4QJ3B 3PJTA 4I5UA 3OIHA 1ZAIA 3UQNA 3DAQA 5BYWA 1M1BA 1BAGA 4RZ4A 5CPLA 1XD1A 2BOFX 1BVNP 1VPYA 1O12A 1EDTA 1J0KA 3AZTA 1ZJHA 2YB1A 4MPKA 1SMDA 3VOIA 3DH7A 1OFDA 3L66A 2G3IA 3XINA 4H6KA 3OHMB 1VBJA 3LM3A 3VM5A 4HPHA 2FGZA 3GXMA 3S47A 2XDFA 4DJFA 5I5RA 4LRTA 4E0CA 1I75A 3BGGA 3SAZA 4HKPA 2QMKA 1EC8A 4MKSA 7CGTA 3RYSA 1K7EA 4UZSA 2DUZA 3DC0A 3E12A 3GK0A 3FSUA 5CH9A 1VEMA 3TCEA 1PIGA 1UJQA 5G2IA 3VTRA 3BQ6A 4Z1AA 3VI2A 4L4LA 1JUEA 4MJMA 3MPGA 4NAEA 3TFXA 4DJEA 3N4AA 2XWEA 2J27A 5C7HA 5I7GA 1HVXA 1J5TA 5I06A 3GVVA 4H9MA 1LOQA 5DANA 2POTA 3D6NA 1JI2A 1R3TA 1UZHA 1YNYA 2R6OA 1RBLA 4F66A 3PZVA 4RZ5A 4LJ3A 4J28A 1JFXA 1VZWA 1ZENA 1TPEA 1V6YA 1F07A 3TAKA 1LYXA 4DO6A 1FKXA 4I8DA 4YXGA 3QGVA 3WIJA 4QCFA 3TLQA 1UUQA 4YTUA 4L4OA 3S0CA 1CI1A 1HGYA 3ITOA 3UZJA 1WE5A 3YPIA 4H2HA 4UWMA 1A5MC 3N73A 1EJVC 5XINA 3W9ZA 4DQWA 2CFFA 2JIWA 1H5VA 1U1UA 4YTRA 2DJLA 3WH5A 5JBDA 2ADAA 2VGFA 1I0DA 5DXYA 2YCJA 1HL8A 5C5YA 1W3JA 5M1TA 4Y9OA 1Q6OA 1X1OA 3F4NA 3FJ6A 4RXFA 4PB5A 3RM4A 3SGUA 3CHFA 1TYGA 1QATA 3UBPC 4Y6GA 5IM51 8XIMA 3N9KA 4FXJA 1XCFA 2QZRA 1SZFA 3A3XA 4DVOA 4DZIA 2YGYA 4D6DA 5DRIA 2NWRA 1EHAA 4ZO6A 4AWUA 3ARZA 1RY0A 4XSMA 3LY0A 5MF5A 3RU6A 5B80A 3TOYA 3ARSA 2YYTA 3DU0A 3KCJA 4Q4MA 2VD9A 3AMCA 1C91A 4IT1A 1BWVA 2XUCA 1XQLA 5D37A 1RA5A 3WH8A 2PRLA 5LGXA 4HPNA 1XLKA 1JDFA 3L0KA 1CNVA 3PHAA 1UR9A 4JTCA 4RKAA 4BQ4A 1KLYA 4UBPC 1ADOA 1XD0A 1F2JA 1WO2A 2WO5A 4J27A 3H2MA 2JKAA 1RUSA 1XRTA 3M0XA 4MAVA 1JZ4A 1N8WA 3E96A 3I6TA 3W38A 4MHBA 1FWFC 4C5ZA 1HL9A 2EG7A 5DEZA 3WDJA 5FF2A 4KCUA 5T91A 3TEVA 5F2IA 3U6WA 2BFGA 1H11A 3H55A 1A4MA 2VHLA 1JPHA 2QUNA 4CQBA 2J9ZA 2E5CA 2D0GA 4Z1DA 1R46A 4X9SA 1TIWA 1OZMA 4ROPA 2VENA 3GU1A 1S5WA 4MAZA 2E1WA 2J66A 4UFMA 3WH6A 4UXDA 1O1ZA 1R3RA 4W89A 3DN5A 1V6VA 1YPXA 2WMIA 1J96A 5CJNA 1VGAA 4IIHA 4PFMA 1DJGA 1POJA 4MVAA 3IPWA 3IWPA 4ZB2A 4D1IA 1Y5XA 2QPSA 2P8BA 4A21A 1JZ5A 4RE2A 1E71M 1REQB 1CPUA 1R3WA 2XJ7A 3LPFA 4IG2A 3IAPA 2Y5SA 2WCGA 2GFTA 1QNVA 4AHQA 5MKGA 4JPGA 2QW5A 1RH9A 1N82A 4JFSA 4KWWA 2R94A 3KLLA 1M7OA 4JFUA 2CLIA 3E49A 5HWMA 1X7FA 4RK8A 1L6WA 2G37A 4KWVA 5D2YA 4AX7A 4NG3A 2E28A 2J9YA 4N4QA 4XZWA 3WSUA 4IIGA 4YTQA 2DSVA 4JYEA 4PBFA 4IMFA 4MYXA 4EPEC 3K4DA 4GVFA 4PMRA 3VZXA 2DSUA 3GWQA 3NZPA 3W02A 3UXDA 5D09A 1IZKA 3RRXA 2CYGA 1JZ3A 4RNHA 5C71A 1N7KA 2J24A 1J8VA 1DVJA 3L67A 1OCQA 1TWIA 4IMAA 1AD4A 4AHPA 3S46A 4D8ZA 4J3WA 1AG1O 4G2DA 3BCFA 1C8XA 4TTUA 4H4IA 3NPVA 2OZ8A 9XIMA 2GVEA 4HNVA 3FGCB 2OQYA 2TSYA 3WDRA 1F74A 4LAMA 4KMQA 3LS9A 2PURA 1OFEA 3QFEA 2QGYA 1D3HA 2YKKA 2OB3A 3LCWA 4XKMA 4S3FA 4WQ6A 3B9AA 5MKGB 4L6HA 1QFEA 3QV9A 4W7WA 1EUNA 1C92A 3AS1A 4NZCA 3VIGA 4DM2A 2CBIA 2O9OA 3OOQA 1KBIA 3AMLA 1QK2A 5I09A 2PDQA 2WKGA 1FUYA 2WYSA 2YXXA 2XN0A 2IXUA 4XB3A 1UUMA 2YDQA 4X22A 4TUFA 5A6LA 4NX5A 2JKEA 2ISDA 2PDFA 1W5PA 1NFBA 1ALDA 2XH7A 1LQ2A 7PTDA 2GGIA 2NW0A 2YA2A 1LRNA 3R89A 2IPJA 1C29A 4Y9PA 4DM1A 4PZVA 3WZ0E 4CVUA 4O0KA 2FFCA 2D22A 3UWQA 4EWJA 2YL5A 3KTXA 3P5YA 2REQB 5CG0A 3DUGA 4XISA 3UY8A 4J9JA 3TSBA 1TIMA 4REQB 2DIEA 3KTCA 3VOFA 3SCSA 3W1LA 3QM3A 4TX8A 4C6OA 3H2CA 3CZJA 1W3TA 2ZX5A 1GOWA 1WDPA 2WKJA 3UWVA 2H6RA 1T40A 5C8BB 4WIWA 5F4WA 4K3ZA 4PL1A 4XD5A 4ZQPA 4AEEA 1N55A 5L6UA 1QO2A 4LANA 5M03A 3A5VA 5BOFA 2BDQA 2Z2BA 4Q8TA 3OB8A 4EF8A 1NY1A 1Q3NA 3HJZA 4ZENA 4JBRA 3GVWA 5DF0A 1VS1A 2ACRA 4MB5A 2ZTJA 1A50A 4O0ZA 3UA3A 3R0KA 3UG4A 2V5JA 4DJDC 4XZBA 2I7GA 1K4HA 5C9ZA 3DG7A 3EMQA 3UGRA 4QE4A 5I3FA 3M7SA 1AH4A 1JR1A 3OG2A 1K8CA 2JF6A 5CC6A 4Q4KA 1O5QA 1E6NA 2NXGA 1HKKA 3H53A 3HO8A 3VABA 2EEXA 4Q7BA 3BLOA 2ZXQA 1OBAA 4MZ8A 4QHRA 1UC4A 2BBFA 3SRHA 4HK6A 4KCTA 1QHOA 2VWSA 1QOXA 3AHXA 1LUCB 3DG3A 1NM9A 1WDSA 2VL4A 1DWJM 5KEZA 4Z1CA 1OINA 3UCCA 4QDMA 3WN6A 3FKRA 3HQ1A 3E9AA 1TPB1 5HUPA 2OTDA 1XPGA 3JS3A 3PZQA 2PCQA 1GQIA 1MXSA 1G69A 4B15A 1SO4A 1RLDA 3GAYA 2VO5A 2XVPA 3ZO9A 1ITUA 5FEPA 3KEHA 5A69A 1OYAA 4NU7A 1AJ0A 4PMJA 1S2AA 2JIEA 2I5IA 3EKGA 1AD1A 3W26A 1DL3A 4D2JA 3W00A 5KSWA 1AW2A 1F4HA 4UNKA 2QJIA 4M3PA 4R5EA 3BV4A 3N14A 1XDMA 3O6DA 3B0UX 3WF1A 2E8ZA 4AZIA 4KCVA 3B0PA 1BYCA 3GHRA 2YFNA 2KZHA 4IP4A 3W86A 3CIVA 2CCRA 3VA8A 2C1IA 2DZAA 4GNKB 1E1FA 2ZA1A 3HG5A 1TMQA 1UKQA 1WXZA 3SDOA 2BX7A 3NYDA 3MDWA 2PDPA 1H61A 1AQHA 3PULA 3FN9A 2OG9A 3W2KA 3TP4A 3FEMA 1N8IA 4LAKA 3TFCA 1B1YA 1G7UA 4FOJA 5D4YA 3WLQA 2E6YA 1GPFA 4MWAA 3W2MA 1Q7QA 1GVFA 1SJAA 2IQDA 4YVVA 4BHYA 3HMJG 2D2HA 3HA1A 1TR1A 2WHKA 2WMFA 1MYRA 1XDJA 1KM2A 3T0AA 2P5NA 3SN4A 3QGKC 6PTDA 2VZSA 3ABOA 1B3WA 4PTMA 2R1NA 4YCPA 2VURA 4JY8A 3N3TA 4FPSA 3T44A 1JL8A 5FSDC 4MDPA 4IMGA 4C6MA 3LLXA 3BAXA 3U5UA 2PLMA 1UYQA 3QTGA 2BLEA 4H04A 4ZQMA 2D2GA 3RO8A 1Y5VA 3VMPA 1FHVA 5I3JA 4US5A 3OLGA 3N2TA 1S5TA 2VEFA 1JCLA 3CU2A 1BQCA 2PTDA 3G1RA 4I9AA 1H7NA 1OEPA 3RPTA 3SQSA 2JFEX 3GKAA 4U3CA 4XAPA 1UD4A 4C65A 3RG6A 1VHNA 3CAVA 3QMSA 4H9XA 2QCEA 3GR7A 2QKFA 3OA5A 4E5TA 4GOAA 4JFVA 1C8YA 1FWSA 3VX0A 3E38A 3G3DA 2OFJA 4AWSA 4OUEA 2O9RA 3AHZA 3D46A 3EMZA 3WEOA 1QW9A 2GOUA 3QPZA 4LUYA 1EJTC 4O54A 3WJXA 3LHUA 5B7ZA 1UKOA 3SCPA 2PLJA 1NEYA 3EX3A 4O1AA 3GH5A 3L21A 1PBGA 1MXDA 4QJ1A 4OQVA 3UW6A 1JEZA 4NYUA 4UOZA 3E0WA 4GVIA 5A6TC 3LN3A 3FYOA 4XTDA 3M7WA 3WCZA 4S3AA 1X97A 1EDGA 3B0XA 4Q6JA 4JICA 3QV7A 3G8EA 4RUBA 1LBLA 1LQAA 1KWGA 4B5XA 1JAKA 1YE6A 2VDIA 1B31A 4LTSA 2C16A 2ISVA 3U57A 3OZMA 4GXPA 3KS6A 5BRBA 2ZWZA 1LRQA 2GQAA 3LRKA 1AL8A 2VX6A 3MUZ1 4YN5A 1AZ2A 3R8HA 1QPRA 4K7VA 3I7QA 4E8GA 3VKKA 1QWKA 3CZGA 1PIFA 3LXBA 3CHVA 3CZKA 3B97A 3W53A 4G5DA 2GUBA 1VCFA 1B3ZA 3KOFA 1U33A 1WXJA 3W2JA 3DFTA 1UZ4A 4TR9A 4HB7A 1ADSA 4GK8A 3M0MA 3EOLA 3H70A 3TAOA 3W3OA 4RX0A 2NVCA 1VFTA 4WR3A 2E6DA 1RJPA 4L1WA 1WKDA 5J8LA 2ZBTA 4L7ZA 2IXVA 2Y88A 5C7VA 3SFKA 1W6TA 3BW2A 5IFPA 3DXIA 5FEXA 3QR1A 1DJHA 1WUEA 4JKKA 1DYSA 1C8QA 2CEQA 1WXYA 3E2SA 1TZ7A 5LA1A 4FS9A 2OZ0A 4EVZA 5I3IA 3IK2A 2WBGA 2CBUA 5HQEA 5G4EA 3EDFA 1W91A 4QQUA 5FAGA 4PMQA 2GZXA 4JX6A 1VB9A 3SEPA 3N04A 2CNCA 2EPNA 4AWEA 1EXPA 2JBMA 1EEPA 3LBMA 3TYAA 5G1TA 2VVNA 4IJCA 1OCJA 3ARWA 3LHZA 1DXFA 1RSCA 1TUFA 2O4QA 2HWGA 5FKYA 5J04A 1HGWA 2PP3A 5EFFA 2VNCA 4XV0A 3NQ6A 3TN6A 1OX5A 2JGYA 2W3ZA 2I9UA 5FJJA 1VFUA 2QT3A 2OOFA 1FWIC 4GX9A 4A3HA 4CQ9A 2DZWA 3LMZA 3RCNA 1OFAA 1CLXA 4GLEA 1OCNA 4IOTA 1X98A 1ZAHA 4HD5A 1T96A 3DHDA 2HTMA 3MMDA 2WWCA 1QXLA 2WVUA 4AZHA 4FAMA 3FSTA 3Q67A 3M0VA 1QU4A 2EPHA 3B8DA 5DMNA 3M46A 1V03A 1U5HA 3VPLA 4B92A 4EE9A 2V5DA 2XVLA 5HNNA 1JQXA 3AXHA 3RHGA 2ZRUA 3NOYA 2YR1A 4CQAA 4Y9AA 3V0SA 2GDQA 1QPQA 3B06A 5I79A 3QLLA 5K4ZA 4POCA 3SCQA 2E5BA 1R7AA 1ZB5A 4FNRA 4XKYB 1XJBA 2J8FA 1ITCA 3W0KA 1GTHA 4HTYA 3QF0A 4B4HA 4PR4A 1TV5A 4KQNA 1OB0A 1M3UA 3M0LA 3P0XA 4C6BA 5C2GA 1XYAA 3MV11 1A5BA 1E55A 1E6XM 1ZPTA 2HISA 3BLFA 1BWKA 4UZUA 4LNYA 3KP1A 4HK5A 1PCWA 3WLOA 1XGZA 1TTJA 3FXYA 4QR6A 3NQDA 3WKZA 4H6QA 5BRQA 1KKRA 2Z2UA 3KOWA 1OG6A 5T26A 5F7UA 4PE8A 4JGDA 5A8QA 3N2CA 3TCSA 1V3LA 2VGGA 4F0KA 3KL5A 2WCAA 2J7HA 4LOCA 2QDEA 3P62A 3U8GA 4D8LA 4D72A 1JULA 3M64A 4REQA 3TJ4A 3WQEA 2W91A 1AQ0A 1ZRQA 2NXIA 3HPSA 2XVKA 2E3ZA 1G67A 3RLVA 4AZ7A 3EX1A 1ZFJA 4AFYA 2BODX 2O4MA 1WP6A 5REQA 4QAIA 4MKVA 4UTWC 4UTTA 1Q45A 4XBKA 5HNUA 1E0VA 1X6UA 4DJFD 3GNNA 1KQZA 4PUEA 1EYWA 3E2VA 2TYSA 3FV9A 1WOAA 1FVPA 4XKYA 1ADDA 4JTGA 3UESA 3I3BA 3N6JA 2NSOA 3E6EA 3W2LA 1UKSA 2RDXA 4HHHA 2V3DA 4KBXA 5EU9A 2YA0A 4DIAA 4BKNA 3ZSTA 3P61A 3DYMA 1OF8A 1WX0A 4XK2A 5FJRA 3WF3A 2OWXA 4F2BA 4WOQA 3DHPA 1RVKA 5BOOA 4GI8A 1HT6A 1H0GA 1CYGA 2A21A 2GVJA 3KBMA 3M0IA 4HOXA 1NOFA 5AHIA 4YL2A 2Q01A 5ABEA 1CXIA 5H8UA 2OODA 3DIPA 3VD3A 5CC3A 3UZZA 1LTDA 2GSJA 5DCBA 2YCLA 1DIOA 1WYIA 3PG8A 1JCNA 1IWPA 3W84A 2DVTA 3WLMA 2WANA 1Q2SA 3II1A 5AB3A 3LG3A 1YLVA 4GBUA 1B3YA 1KCXA 1NP2A 1KM1A 2VELA 2Y8VA 5F2GA 3TIMA 3BARA 3EA2A 1GYMA 4R88A 1V0NA 4AZ6A 3QHOA 1PEZA 4OECA 4Z2IA 4LVBA 4NJGA 4GQGA 3T78A 5ABFA 3GHUA 1Y0EA 3M6DA 1VBRA 2MUCA 3T9PA 5LKYA 1KXTA 1H1NA 3EX6A 3HGSA 3I7RA 4PB4A 3CMGA 1YPIA 4BY3A 3AQUA 4MKNA 2I5QA 1OK6A 3EBVA 1BFNA 2VGBA 4BQ2A 1XBYA 4LEQA 2Y63A 4NL1A 1RAKA 1OFBA 3N4EA 1EJRC 1L8NA 3URNA 3GTXA 5A3HA 1VYRA 2WC3A 3EWWA 4GI9A 5CBBA 4ZFCA 3RNDA 4XZHA 1V6XA 2DIKA 2YA1A 3F4VA 2W66A 3BOLA 3TYDA 2AQWA 4WK9A 4H9TA 4ZOEA 2YCLB 3AHYA 4M0XA 4QS5A 1DHPA 3WJYA 3FVMA 2ZXBA 1DIEA 1QCWA 4ZOBA 5HPOA 3EB2A 3UU0A 3N6QA 2OLHA 3MS8A 1DWIM 3QY8A 1C3FA 4IPIA 4IZGA 5KZDA 2O92A 4DYKA 2E9BA 2DW6A 4H8VA 3B03A 2BY1A 4ACYA 1P48A 1TJ1A 1GGOA 1J5SA 4EAYA 3D3AA 3CIWA 4C7FA 5E93A 3CAKA 3NTYA 9RUBA 4OTKA 2NUXA 2CLOA 1EWEA 3L65A 5G4WA 1MUWA 5JQ9A 3DEQA 1BD0A 4DO7A 3HPZA 5DMYA 1IXQA 4CCDA 1L9WA 2DEPA 1E3ZA 2OEKA 3K4AA 3PM6A 2XM1A 1M5WA 1GG1A 4JDYA 4WJ8A 3W7MA 3I65A 4PRTA 1W8GA 1J12A 3VE9A 3EOSA 3G1DA 4GD0A 4W8LA 4CNSA 4J40A 1XRVA 2X05A 4PYSA 3KWSA 5JH2A 4NRSA 5EBAA 3WFLA 4GUJA 3IVTA 1YDNA 1ONXA 4JTEA 3E0LA 3NZQA 5EMJA 5FSEC 2PP1A 4GZ7A 3W7RA 2XIOA 3AHTA 2ABBA 3BV7A 3IIVA 3DC8A 1M7XA 1FWEC 2EG8A 1TZZA 2HJPA 2OVLA 3CEUA 3ZT7A 3SURA 2WVTA 1E6RA 1V3IA 3W27A 2GSEA 4AQLA 2FMNA 2HEJA 1AUSL 2QULA 1BXNA 4HOWA 1W1TA 3VYLA 3W01A 4DZ5A 3QY7A 2W63A 2HVMA 3O6CA 3C52A 2CBVA 1BKSA 3MP5A 4E3VA 3AALA 2XH2A 4AD5A 2DQXA 4DUXA 5HMFA 4AMCA 1BG4A 1SFLA 5AKQA 4A3UA 1DKWA 3K46A 2DU2A 1UHVA 2VFHA 2NUYA 5XIAA 1L2QA 1SZRA 1EP3A 1EP1A 3NURA 1UD5A 2VR5A 3BOXA 4HSNA 5CPSA 1X6NA 3V16A 4ONVA 1LP6A 3DGRA 3GZ3A 4MB4A 4Z1YA 1TCDA 2PAJA 2XN1A 4O8AA 3W74A 2V5BA 5CSSA 3WD4A 3LPPA 4ASTA 1LBFA 1TMHA 5H8MA 3VKBA 5MHBA 1YADA 5BXPA 3SFWA 3TWBA 1LL6A 1SZNA 3GVGA 3BG3A 2ISWA 2WAGA 3PUDA 3GO2A 3H23A 2WJZA 3RR4A 3WLJA 1TZ9A 2IPWA 3FS2A 4W85A 3JU2A 3PZIA 1YE4A 4OUIA 2Y6ZA 3GIQA 5CBJA 3VNMA 4JZ5A 1YKWA 3G1SA 3AMGA 4FR1A 4M1RA 1POKA 3EYPA 5AYXA 5D33A 3LB0A 2CESA 4GGBA 1W9BM 5ABGA 4K8GA 2W61A 3ZT6A 2ZDSA 2QUTA 3OYXA 4ML9A 2EG6A 4PUJA 3MU7A 1UZDA 3FX4A 3WY1A 3VIFA 4LVAA 2D3NA 3NQMA 4FA3A 4I8YA 1XXXA 5D8ZA 1G4PA 3OW1A 3ZS4A 1TJRA 2PDGA 2FPVA 4WHBA 4A8RA 1VYPX 1ISZA 4QXIA 2NVAA 3CZLA 1BEUA 3EB3A 1KFLA 2ACSA 5FI8A 5F4SA 3LCIA 3FOKA 3UZYA 1H7XA 5LHFA 1RJRA 3PZOA 1Z41A 3V5CA 1ICSA 3MKCA 4O12A 3ANVA 8XIAA 5FEZA 1QNOA 3PPHA 3WFAA 4CCZA 3VNJA 1QI4A 4IQDA 3FCPA 3DFHA 2V5KA 3IGHX 4RPPA 2OO6A 4Z2KA 1FTXA 2FPYA 1IE7C 3AJXA 1C7TA 3CUZA 3HGOA 4ZODA 3L5LA 3VMOA 4UIOA 3R2GA 1PE1A 1FFQA 3GVQA 1J93A 3FA5A 1EBHA 2PDHA 3IJ9A 3GDBA 4LS2A 4L9ZA 1DJNA 2ZADA 5AYZA 4TQTA 4AZCA 1XSKA 3UJSA 3WELA 5DLCA 2YYUA 3ARPA 4DAIA 4HYVA 2O9PA 4KWOA 2GOKA 1R87A 4NZ5A 3WLHA 2WXDM 2GPTA 3E1F1 1YQ2A 1F6KA 1UKTA 4XSLA 3UPWA 5D9NA 4NQ1A 5D8WA 2SFPA 5BOEA 4NJIA 2KAUC 4PMUA 2DDXA 5CZJA 5EMLA 3NZRA 3GDTA 4LGXA 3SUWA 3A12A 1K3UA 2OLAA 7TAAA 4FI4A 3N2MA 1IEIA 5HDRA 2OXNA 2AGKA 1KBBA 4EXQA 3SCTA 1T5AA 4N9BA 2PODA 4DN1A 4M19A 3S9YA 2QCLA 1EEXA 3KOZA 3JZUA 4F2UA 1LF1A 3UZWA 5HR6A 1JCXA 4HU0A 1J4EA 3WLPA 3E0VA 3PFRA 2VOTA 1GW9A 1KXVA 4I7VA 3IJDA 2VT0A 3ABQA 4GCXA 1S2WA 2PI6A 1EO5A 4H8HA 4W4QA 1QVBA 3SJNA 4CCCA 1E3XA 3HF3A 3M5VA 1O5RA 1O95A 1BYDA 5K9XA 1TJ0A 1KM6A 4JL2A 1GPWA 1QI2A 2YFOA 1SVDA 1SYTA 3HN3A 3RF9A 3G0XA 4AZCB 3T2QA 1TV3A 3QV6A 4UTMA 4CNOA 3FNDA 3LCLA 5LSMA 4XD4A 4IFOA 2UY4A 4OOZA 3SECA 2ZTKA 2NQ9A 3MCNA 3LXCA 3EEGA 4P5UA 2E6AA 1PPIA 4NSBA 5KTLA 2WV8A 5ABTA 2ONEA 4LCSA 4OBTA 4OGZA 3TR2A 5A8OA 4QLJA 1UA3A 4YCOA 4NP7A 2Y7EA 3VD5A 1UP3A 2GK1B 3WLIA 3ZOAA 1HG3A 4JTDA 5AZ0A 3MUXA 3IJ6A 3APYA 1RBAA 1E40A 5C2CA 5CZ0A 2EJAA 3N15A 1TKKA 3U7VA 2RUSA 1C7SA 4HNNA 5D03A 4JKMA 4U5KA 4AC7C 2QAPA 3NQ2A 4IXXA 3LQLA 4WY0A 2PS2A 3GG1A 1NAL1 2GDUA 1JCYA 2JKPA 3A5FA 1G5AA 4ZOAA 1SPQA 1BWLA 2YZRA 1LOLA 2ZXDA 1PTDA 2VEGA 3EXRA 2PZNA 5CAKA 1XCWA 2ALDA 2YBTA 4CU6A 3PAOA 2R14A 1EO7A 1NFPA 3HG3A 1P5BA 3S5NA 1SJDA 2CLHA 3S2NA 3PSWA 2BXYA 2NQHA 3ARQA 2V9DA 1LWJA 4NZ1A 4FIQA 4DPPA 4IXHA 4PGLA 4MNKA 2ISFA 5AHEA 3SN0A 3KBNA 2FZDA 3I6EA 3V18A 2Z7KA 4O4WA 3AIWA 4RCXA 3G1HA 4YVPA 2VX4A 1KRAC 3XISA 1W17A 4F0SA 4GY0A 4N9EA 1YBQA 2C3ZA 1S5VA 2GK1A 4LX4A 4BI7A 2FHCA 3PUOA 2VDGA 1OCBA 4ALDA 4MB3A 2R82A 1CIUA 1DE5A 3C4UA 4D6EA 4JFWA 3QPEA 1XBZA 5I03A 3NJ3A 5CC7A 2REQA 3IGUA 2BASA 1OFPA 2HS8A 3AMDA 2H8ZA 3VOGA 1H63A 3BSMA 5D05A 3TQPA 5U4NA 3L12A 2QF7A 1HKMA 2IKGA 4W7UA 1V6UA 3OBAA 3PTKA 4INFA 2H3BA 4YTSA 5XIMA 4L61A 3FJLA 4J3VA 3UJ2A 4Y9MA 4O0QA 2Z1SA 2CZVA 1I2RA 4FX7A 1AQMA 4N02A