1PTDA

Phosphatidylinositol-specific phospholipase c
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
publication title Crystal structure of the phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with myo-inositol.
pubmed rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
total genus 106
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1995-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1ptdA00
1GYMA 4I90A 4GNKB 4F2UA 3V18A 1PTDA 5T91A 5T9BG 3PTDA 4RV3A 4F2BA 3QR1A 3RLGA 4QJ5B 6PTDA 4F2TA 3H4WA 1DJZA 1DJHA 2F9RA 4RW3A 1DJGA 2OTDA 1VD6A 3V1HA 4I9TA 1T8QA 1O1ZA 2ZKMX 5T9CE 1YDYA 2PZ0A 4I9MA 1DJXA 3MZ2A 4I9JA 4S3GA 2OOGA 1DJIA 3EA2A 1ZCCA 3I10A 7PTDA 2P76A 1AODA 3EA3A 4QJ3B 4OECA 3CH0A 3QVQA 2PLCA 1DJWA 1V8EA 2O55A 3OHMB 5PTDA 2PTDA 3KS6A 3QR0A 3V16A 3RLHA 1QATA 1XX1A 3KS5A 3H4XA 4RW5A 4PTDA 1DJYA 3L12A 4R7OA 3NO3A 4QJ4B 1T6MA 2OR2A 3EA1A 4Q6XA 2FJUB 1PTGA 1QASA 4I8YA 2ISDA
chains in the Genus database with same CATH superfamily
2CC0A 2IXVA 3NYDA 2VOMA 4JZ5A 1QHOA 5FACA 4HMNA 1R7OA 3L0KA 5I3IA 2KZHA 3QHMA 2WSKA 3IJ9A 1FWBC 4LV9A 4L9ZA 2ZRUA 3ITVA 1E6QM 3UXLA 7TAAA 3MCOA 4HNNA 4GACA 5G2HA 5C7VA 3HGOA 3LM7A 5E5CA 2GUYA 2WMGA 2WSPA 1B4EA 1R9ZA 1VEMA 2ZE3A 5KZ6A 3DIPA 3AO0A 3MW7A 5EFFA 2HNEA 1VCGA 1XBXA 2DZXA 3GNNA 4LCQA 1O4UA 3PUOA 3UYIA 4ATDA 5A2AA 3ZXWA 4A35A 4NAFB 4QRNA 3RNDA 4XG1A 5DT5A 4D8AA 4DXKA 3S1WA 1L6FA 4IWWA 1Z48A 3ELFA 2IPFA 3SADA 1C90A 2PWEA 5D9NA 3CM4A 2QW5A 1V3JA 1HZYA 3EEGA 2NQ9A 1VLWA 3A3WA 2GSHA 2CHRA 4O11A 4ML4A 1S46A 4LNYA 4JNMA 3VOJA 4JTRA 3U7VA 1OVDA 1YDNA 1EJTC 5AC8A 3OHIA 1EX1A 5D2WA 1IR2A 1Q5MA 1SO6A 2NXIA 2FZBA 2D2HA 4ZQRA 3GSMA 2ISDA 2E9MA 4GH1A 4LWWA 3P5ZA 2GUUA 2PWHA 4J9JA 4PMOA 3AWOA 1U1UA 1HO4A 3SZ8A 1YTDA 3KBJA 4JTQA 1AFSA 3NURA 3LXAA 2ICSA 2JKEA 3Q65A 2VX7A 3HO8A 1YQ2A 3M5VA 4UXDA 2WZMA 4YCOA 2A79A 1W8SA 2ZUMA 1MZHA 2VR2A 1ME9A 3IJ8A 5FAJA 5E6YA 4MB4A 2QUTA 4AHOA 2YZ5A 2JEQA 3SW6A 3VOCA 2DVTA 4UTTC 2X42A 5I09A 3U2OA 9CGTA 4IJBA 3CZGA 2OLAA 2DIKA 3LOTA 3GHRA 4P8VA 4H7VA 4Q32A 1POKA 2PTYA 1TQJA 4AHQA 5CBBA 1ZRQA 2GJPA 1GHSA 4LB3A 1JGIA 1X6UA 5GNYA 4M19A 2HBVA 4KCWA 1BEUA 1CWYA 3MHFA 1ZBKA 2CERA 1VFTA 4J4KA 3IIOA 3B8WA 3MB9A 4AD2A 1TV7A 1W5PA 1TPH1 4AVOA 1W0MA 5D33A 1PBGA 1WYIA 4B3LA 1E0TA 3PZTA 2DORA 3NZRA 4NZ3A 4LB4A 3STFA 1NU5A 5IDZA 1NFPA 4K6AA 5F1UA 1S5MA 1V3KA 3B9EA 1JI2A 3CL8A 1CXLA 1UD3A 2XU2A 5T91A 5I24A 3HQOA 1W5OA 4PE8A 2VZOA 5T9BG 3WY1A 5FESA 5JIWA 2Z6JA 4M6PA 3F5JA 2EJAA 2J7BA 2POTA 5DCEA 1JAKA 3KLKA 3VKKA 4AX7A 3KTCA 3PUDA 1DJGA 5LNSA 2BS9A 2NUXA 1JYXA 1XLLA 3WLIA 1YADA 4GQQA 3I68A 2WSRA 3PAOA 3I3EA 1WE5A 4CKQA 3WUEA 2D22A 5DT7A 3KRSA 4LS0A 5HBFA 1HJVA 4S3GA 3SCVA 4LPCA 4E2DA 3GNPA 3GY1A 2PDPA 1ZZMA 4Z42C 4Q4PA 4ROQA 3E2RA 3BG3A 2G4JA 5D37A 2OX1A 5D9PA 2FYMA 3PB2A 3ZT6A 2J24A 1Z69A 5HPCA 1J0HA 3A64A 1H50A 4JTIA 2DZSA 3W88A 4OT7A 2IXUA 3FEQA 4X9YA 1E6PA 3WNPA 3HPAA 3OYXA 3G18A 5BCAA 3CHDA 4BHYA 4DBUA 2XJ7A 5M5DA 4NYYA 4DBEA 4UB9A 4GIEA 4AY1A 4LCRA 4P8WA 1J9YA 3NO3A 4UBPC 1DTNA 1VPXA 1XD0A 3FVDA 3EAUA 5IDIA 4JY9A 3REQA 3CUGA 3DFPA 1CENA 3PZGA 3GTIA 3NQFA 4OBSA 1I4NA 2V81A 4I90A 3BH4A 1IGWA 3H55A 4EXBA 2OT1A 2EPLX 3N2BA 1UPMB 1E6XM 3VILA 5BU9A 4E5TA 3W07A 3CAWA 3W7KA 2YGYA 3WLQA 2ATSA 3N4FA 4RZ5A 3RRXA 1CYGA 3TH6A 3LUTA 2P10A 3GG1A 4UFMA 2VX5A 1SO3A 1VJSA 1LT8A 5T9CE 3FIGA 3BVJA 1ZP3A 3W6LA 3BGJA 4LY4A 1ZL1A 1F61A 4GX8A 4IMFA 4YNGA 4M6QA 2WMFA 1X6LA 3D0CA 2XTKA 4JNYA 2PDIA 1ECEA 3W7PA 1NQKA 1RAKA 3BOLA 3MHGA 4IGNA 1OZMA 4EOUA 1AD4A 4Z17A 1M65A 3FK4A 4PFMA 5BXSA 3CMGA 3N2CA 1FWCC 8XIMA 1LLOA 5K7JA 2B7OA 3ARXA 3LTSA 4WKAA 3U4FA 1KR1A 3ZVHB 4JS3A 3MDWA 4M1RA 3L9CA 3WQ5A 4ACZA 3M0JA 3IUIA 4JTAA 2I5QA 1JXKA 4RX0A 2Q3RA 1JUEA 2X41A 2DUAA 1NOWA 4BCEA 2VD8A 4XX6A 4H9TA 3SR7A 3WYZA 4KIRA 3LNPA 5C6MA 4FMVA 2WAGA 1Q85A 3R0DA 5MKGA 4IMDA 1L2UA 3LGDA 1JQVA 3T8LA 3H2FA 1G4PA 3PPGA 3WQ4A 4HJFA 4BF9A 3W70A 5HUOA 1RLCL 2FPYA 4HNLA 2HSAA 4H83A 1TVNA 4ORMA 1UPPA 3LSBA 2R91A 3C8NA 4C6BA 4S3AA 1AJ0A 4NI8A 3TTEA 4HN4A 1JDFA 2ALDA 1WZMA 3E1F1 3LV5A 1ZU8A 2YCLB 1M7XA 1VEPA 3QBUA 5FJRA 3G0UA 4Y6GA 4A4AA 1WUFA 4MADA 2WO5A 1H7PA 2POZA 4IP5A 5D9OA 4KKXA 2BMBA 3FSTA 5D2TA 5AVNA 1DWJM 4MY1A 3GIYA 3S5NA 5K3VA 3NXFA 4X3ZA 2CFFA 2VRJA 4WY0A 3DHDA 4F66A 2WNWA 4MYAA 4UMAA 3POCA 4H4IA 2HK0A 4AWEA 1HVQA 3QLLA 1JYNA 3BAXA 3OHMB 2GSJA 1D3GA 2OEKA 3OVRA 4TV6A 3VNYA 2YA2A 2V67A 2DU2A 1CPUA 2QUNA 4LUSB 1VFOA 4HT3A 1AW1A 5FJOA 1RJQA 2RHGA 2XUCA 1KM4A 1HJSA 1S38A 1W6TA 3QTPA 1FHVA 1FOBA 3I6TA 4JTCA 3R12A 2PP0A 3NG3A 5HDRA 2V5DA 3NDZA 3APGA 2ZUUA 3MU7A 3VD9A 3WL0A 3WNLA 4DBDA 3TAKA 4OBRA 2CW6A 3QY8A 1LL6A 3W7RA 4LQ1A 1MDRA 2HE5A 1B4KA 3C6CA 3QFEA 3TW9A 3LSCA 4I8DA 5D2YA 3VMPA 4U4MA 5HQMA 4QE1A 4QQ3A 1DJHA 3V35A 1M9HA 4A2RA 1KBLA 5KETA 4FNUA 4D1JA 3R6IA 1BG9A 3KCJA 4Q4RA 2PWDA 4AZCA 3KBMA 3MZ2A 5AHMA 1C9WA 3QY7A 4W7UA 3DFSA 3GE7A 1RVGA 3LZ5A 4AG0A 2Y89A 1WOBA 1US3A 3S1XA 1EXBA 2XIBA 5G2IA 1E1FA 3GNOA 4ASTA 3O16A 2X30A 3TC3A 4GABA 3VGFA 1UH4A 4KFOA 3TN4A 4QLKA 4PSRA 3NZ1A 1E15A 1KGUA 1OX6A 1Q7ZA 4GI6A 4RK8A 1UH2A 1BLIA 2J9XA 2WK2A 4M6VA 2D2JA 3O6CA 1R30A 5HJXA 1XLAA 4HU3A 2WPGA 1UP0A 5I2UA 1CLVA 1AW5A 2ZX9A 4WIWA 3D6NA 2X7VA 4NSBA 5D38A 4PBFA 5LKYA 3W2NA 5GVJA 4H8VA 4S1FA 1E40A 5F2IA 4YTUA 3MUIA 5EBUA 1HXJA 2WMIB 4RLIA 4S2BA 2IPWA 2R1KA 1XIJA 3O63A 1ZBWA 1X98A 3TR2A 1RQBA 3V5FA 6REQA 3NSXA 3F4DA 3PZQA 3AOFA 3VXGA 1MQPA 2D2GA 1EOKA 3W37A 1HKWA 1ONXA 3ZJ6A 4MZ8A 2ZC8A 1X8CA 3KOXA 2OT0A 1BRLA 2QUVA 5BNKA 3U8GA 4FALA 1E5JA 5LIKX 5A8NA 2W62A 1JJKA 3OP2A 3RILA 4B15A 4FLSA 1FRBA 3TW7A 1PXGA 3K4DA 1HQTA 1R9XA 4IIFA 1LTDA 1NP2A 3RCYA 2OFJA 2P50A 2Z2BA 3SY5A 1DVJA 1CGXA 3ZT7A 1P7TB 3MO4A 3PJUA 3I7QA 3FVMA 1HIZA 2ABAA 4WQ6A 3G3DA 3LTPA 1D7KA 1AZ2A 1HKJA 5ECUA 1GZ1A 4XAZA 1MDLA 4JHZA 4DJFC 1TTIA 4WEVX 4JQ4A 4F4RA 1EYWA 1W1PA 5B7YA 2YXXA 1MRAA 4A2SA 2OQLA 2GQ9A 3PZMA 1YX1A 1M5WA 1YLVA 5REQB 3Q58A 1UZ4A 2Q8LA 3NOEA 2AAAA 3AXHA 5DX7A 1HN1A 2W27A 4DXVA 5D2VA 1M68A 1PAMA 3UXIA 1GQKA 3YPIA 5EMJA 2BVWA 1VPQA 2W4XA 2WANA 5FEZA 1FBAA 4OGZA 3QM3A 3U5YA 5FD0A 2JGQA 5JBFA 1A5BA 3WEOA 2BP1A 3BMWA 3K30A 3I6EA 3PZOA 4FPSA 2C1IA 3H54A 4RZBA 1I2RA 2FVLA 3KDOA 2F61A 4ZA0A 2P76A 1OIMA 5KITA 2ZZ5A 3TYUA 3EX1A 4MIMA 5AZ0A 1CGWA 5DRCA 4XZWA 4ADUA 3DI0A 5PTDA 3PUGA 3SIZA 4ATWA 1EWEA 4NXKA 4N9EA 1KA9F 5CJNA 3STPA 4C1NA 1GJPA 4JDYA 1E6NA 2BBFA 3CASA 3EWYA 4HZMA 3R8HA 2GVEA 1K8XA 3M6DA 3RXZA 1F76A 2HWGA 2H8XA 4Q8TA 3Q67A 4MVAA 4I5XA 2CYGA 3U9IA 3CV7A 4XZNX 3TC6A 1ME7A 3E3HA 3CIXA 4C6PA 3G1DA 2OLSA 3WDPP 4Z1AA 1CCWB 1EQPA 4W88A 3GNDA 2VZSA 4LUTA 4GIYA 1KV5A 3V0SA 1VJIA 3WF3A 3PWAA 3TDFA 3N19B 2FH6A 4GA8A 2UY5A 3GC5A 3UZZA 4R53A 2G50A 3IJ7A 3LHYA 3WQFA 5AHLA 3AIVA 3R2GA 1T96A 2TAAA 3LQGA 1Q8JA 4RJEA 3BAYA 3CWNA 1RD5A 1W9PA 3GW0A 3WDJA 5HQEA 1ELSA 3QPEA 3GHUA 3M5ZA 2XIOA 2Y1HA 4S3DA 3L67A 1V7YA 4X60A 3N6QA 2XM2A 2C7FA 2V5LA 4PCTA 5A3HA 3AALA 4I9AA 4HHHA 1TV4A 4F0MA 5A5WA 3O3RA 3GXIA 3L0GA 1DJWA 1YW1A 3LPGA 1BKHA 2Y7DA 4XVDA 4O57A 1JCTA 1PYMA 1W1VA 3F5KA 4AEFA 2VWSA 1KBJA 5CPSA 3PBGA 4RPPA 4PTVA 2PDYA 3SN1A 1RVKA 3E0VA 3GK0A 2NW0A 3VIIA 2GJNA 3VNZA 1Z3NA 1XSJA 4WDTA 1SR0A 1HT6A 4UOZA 3OBAA 1JG9A 4PCPA 3THDA 6ENLA 5L9FA 1ZFJA 1C3FA 3OA3A 1YPXA 1Z32X 4CN4A 1XDLA 1J18A 1Q6RA 2ESCA 4S38A 2E5DA 3L4XA 2WVUA 5IHSA 8RUCA 1WDPA 3W4RA 1OX4B 3KE0A 1EHNA 1TVPA 2E0PA 3QYQA 3UF9A 5CSYA 4B5XA 3L23A 3GYEA 2GQ3A 5HATA 3AS3A 2VYOA 3KXQA 2UWFA 1M7PA 1SU5A 1J2WA 4I5RA 2FZNA 1TPB1 3H21A 2BHZA 4N9DA 3MZNA 2QYGA 3I7SA 3UR7A 3BSGA 3W75A 2J9YA 2QGHA 5LSMA 5I3KA 3B8IA 3TA6A 1Z41A 5A69A 5HR6A 1DIOA 3UZXA 2JKPA 3R11A 3W71A 1JCYA 1F6YA 2XGZA 1VJZA 4EPDC 3G1SA 3UY7A 4AUBA 1QWGA 1JZ6A 6CGTA 4KEUA 5A8PA 1ZJHA 3VPLA 3WJSA 4DUXA 1K3UA 3VUPA 3CO4A 2IKJA 2J62A 2EPKX 3QQ1A 4EAMA 4MNMA 4S3EA 4D9PA 4UQEA 2VM8A 1G9HA 3G1VA 2AL2B 1KV8A 4WCJA 2PDUA 1MW3A 3BCFA 2XVKA 2TPSA 3CZJA 1XLCA 2EPHA 1XGZA 1E1CA 3SQSA 1RXOB 3WUGA 1WQ5A 1PL9A 1TPFA 4ZEPA 5JBDA 1G5AA 4ALDA 3E2SA 3CB3A 4IP4A 3V1HA 2ZRYA 2OG9A 4C6IA 2A7NA 4L56A 2VI0A 4IIEA 3W1RA 3VZXA 3UWVA 1QOQA 1K9DA 4AISA 4NNBA 3PZIA 1SW3A 2BHYA 2V8ZA 2PAJA 4S3FA 3RUBL 4JQ2A 4UTKA 3C2YA 3UZ5A 1QOXA 4LF2A 3WQ6A 4CNPA 1E4LA 2BY0A 2PDCA 1QHPA 3CV2A 3K8LA 4R88A 3LDVA 4LAOA 1X1OA 2ODOA 3H7RA 3TKFA 1MMFA 2JK2A 3ABSA 2HVNA 5IRPA 2PTXA 4RL3A 2FZDA 1PDYA 2VENA 4DWSC 2RDWA 4G2DA 4JTDA 5FL1A 1XISA 2NLIA 2A5HA 1TMHA 4O8RA 3W7LA 3PNUA 4CQBA 4BS0A 2QCLA 1O5KA 1BXCA 4A22A 4ZB0A 3AIBA 1U33A 5F4SA 4NZJA 1F6KA 3FNDA 5AC6A 1UC4A 3R79A 4UQAA 5EYWA 1ITQA 1KRCC 3HG5A 5M17A 4MNLA 2DFAA 2ISSA 2D20A 3MP5A 4H2HA 3MMDA 3KFTA 3ITLA 1OG0A 5JH1A 1GJUA 2A3BA 2PTWA 3RFAA 5TBOA 3CQHA 3VMNA 1PX4A 4JTGA 3P0XA 3KBSA 4H1ZA 1UWAA 2FLIA 1EX5A 1G67A 4JYEA 3S9YA 2G37A 3MUY1 1KBIA 4ZE5A 2ZTJA 4LEQA 1CXKA 1ZB5A 1RA0A 3GVGA 4IPLA 3HA1A 1NDVA 2PDLA 3GB6A 1QNVA 5D30A 1A49A 3UNTA 1BSLA 1E9LA 1ECQA 5FJTA 4D72A 3QMRA 2Z0IA 3FV9A 4MB3A 1PIIA 2OMAA 1RJRA 3O0KA 2GOKA 3VD3A 4GIAA 5LA0A 3IARA 1GVIA 5HMEA 4ZO6A 5DMYA 4MLRA 2ZXBA 1EFZA 3OGSA 3LGEA 1G1YA 3AIWA 1X8FA 2PODA 5FAGA 3GNRA 2FDSA 3VZZA 3IVSA 4DLMA 2FQIA 1E73M 3DHPA 4QEEA 3C0QA 2R1MA 3U57A 3R7MA 3FKKA 3NQEA 1MXGA 6PTDA 1W2VA 4UOJA 1B3XA 1BAGA 4GKLA 3KX6A 1BSIA 3MI2A 5KZMA 1J10A 4BJHA 1IT8A 2BWGA 2QDHA 5C7HA 5HNRA 4ACYA 1TV3A 4AD3A 2PWVA 1WZLA 3CXOA 4PMZA 2DY3A 3MHUA 3ANVA 4QE5A 3TP4A 1UMYA 2CLOA 4JCMA 4PUJA 1T40A 1TYGA 1W37A 3D47A 4K37A 3WG6A 3RM8A 4NZ4A 1TR9A 2XZ9A 3PF3A 3NQVA 3QR0A 4QIUA 3UVAA 1XG3A 2DZAA 3IAPA 3BW2A 4QBXA 4KETA 4PTDA 2J75A 2J6VA 1NWSA 1L6YA 2A7RA 2D73A 3RITA 2Q09A 1VCFA 1MUCA 4IF2A 3ITTA 1F9CA 3QC3A 4LYRA 2CZ5A 5IFTA 4IFRA 1H4PA 1K9TA 1TSIA 3UG4A 1WBJA 4JTEA 3KVJA 3WJWA 3MUAA 3ZSSA 4H8NA 4O19A 3E5BA 5G2WA 1F4HA 3W7JA 2B7QA 4Z1YA 4NNCA 1US2A 4GZIA 3NOYA 2GGGA 3RJYA 4GUJA 4UTUA 2QCEA 3O9NA 1XYMA 2OQYA 3FDGA 2I17A 5LIXX 2PPGA 3ALGA 3MS8A 5ABEA 4L9YA 3SI9A 3VC6A 2L5HA 3IPWA 8XIAA 4RR4A 2C3ZA 3N73A 1FKWA 2ZUWA 1JGMA 4S2CA 4I9MA 3UJFA 4ES4A 1XC6A 4L6HA 2SFPA 1F05A 2OOGA 3BICA 3O15A 2DZBA 2ONEA 5CZKA 1IGSA 3E49A 4ACZB 1W91A 1QCWA 3LRKA 4FB7A 1CB2A 4FOJA 5BWFA 2PLCA 3FA3A 4H2CA 3TCSA 5K9DA 3C3UA 4EKJA 1UKSA 4KESA 5MKGB 3B06A 1HKVA 2NUWA 3VM7A 4DJEC 3BSMA 1G01A 5BMXA 1KKOA 1XLHA 1T6MA 3FKRA 1IF2A 4MPQA 1QI2A 4O53A 1GTEA 3WEMA 3TQKA 3S5OA 5HJYA 3GG8A 3GDMA 3M64A 1ALDA 3F1QA 2PU0A 1XQKA 4PMQA 1GKQA 2V82A 2EHHA 4GNKB 1EA0A 1REQA 3VKCA 2C16A 5A6AA 1S2TA 3PUEA 1MXSA 4MKVA 4HPJA 5H6HA 3VE7A 4J3WA 3E0LA 3AXKA 4ZE4A 1QR7A 3CH9A 4A3QA 3EB4A 5AC7A 3WNNA 3T9PA 3FJLA 4WY0B 3DG6A 4J1OA 2GJXB 3UT0A 2AOSA 4X2RA 3W2LA 3U4AA 1I2OA 5I02A 1IZKA 4QLJA 2FH8A 2D3LA 5EMMA 3EX2A 5LA2A 3N3TA 5LIYX 4IQJA 3WLPA 4GG9A 4ERIA 3PHAA 1UUOA 1XKYA 1R7AA 4WJXA 3OODA 1I1XA 5G4WA 1TQXA 1FDZA 4PMJA 1MNSA 3KEHA 4K68A 1PO9A 3MBDA 3ZJ8A 4J3ZA 1KFKA 1IWBA 1TZ9A 1N82A 3URNA 5U7SA 2J8GA 3TEVA 4E2VA 3E5PA 4O17A 3NQ7A 3I6RA 1H7OA 3KAOA 3N14A 2GGEA 5SWUA 4EPKA 1V7AA 1BQGA 1YXCA 3V0UA 3KP1A 3T2PA 5CBJA 4DB7A 3W38A 1Z7AA 3P80A 1YBQA 2PRHA 3EA1A 1HG3A 4GY7A 1T7LA 3FXGA 2FJUB 3HURA 3VNDA 4JQ1A 3Q4DA 3FAWA 4UWMA 1OINA 4ZOAA 5CH9A 4TIMA 1O68A 1GVYA 1FCVA 2XSAA 4TX6A 2QDGA 4GUGA 3VGDA 3E0WA 1ZBCA 2BY2A 9XIMA 3A21A 3KRBA 3GR7A 6XIMA 3R43A 4IFKB 4TX9A 3MMUA 4XO7A 4GJ1A 2WPBA 3HTWA 3PK7A 1T41A 4R3UA 8TIMA 4HCHA 4B91A 1AJZA 4JX4A 4PTXA 3HV8A 2IKHA 1MVYA 2GL5A 1ITXA 1KCXA 3O07A 2WCSA 4PTMA 3RHGA 3G6MA 4C6FA 3F7JA 3E96A 1RD6A 3P67A 3MYOA 2OXNA 3PPHA 1PSCA 4FLQA 4C6DA 3WF0A 1DWIM 2QULA 1ZQ5A 3G1RA 4KT2A 5GNXA 4V1YA 3NXLA 5CC5A 1KFCA 4A6GA 1MW0A 5E0CA 2V63A 3VGBA 4GISA 5BW6A 1TJ1A 1SFTA 3N9RA 2Y6ZA 1W1TA 4JYFA 2WJFA 1GVFA 4HB7A 4ATLA 4H04A 3SUUA 3NQGA 3PJTA 3K4AA 1V4YA 1EZ2A 5C9XA 1FWEC 1W5NA 4FF7A 1ADOA 1L8NA 2H9AA 3NVDA 2JBMA 1EUNA 3OVGA 9RUBA 6REQB 4MJZA 3WLMA 1FCQA 1SJAA 1EGMA 4XQ6A 5CZTA 3VDCA 3T2QA 4B5WA 4HK6A 3KL5A 1BRLB 4WKFA 1PZ2A 3W26A 5BROA 4UQCA 3J7HA 3FOKA 2QJGA 3LHVA 3N4EA 2REQB 3T40A 3MVTA 1V03A 4IT1A 1A0CA 3BOFA 4GE8A 3ATZA 4CD5A 2ZRWA 1UOZA 1I0BA 3QH2A 4LTSA 5G1TA 4HYVA 3CV6A 1KRMA 1JNDA 1D2KA 3AU2A 5LNRA 5H91A 3T78A 3QRHA 1THFD 3VGEA 1IT7A 3CH0A 3QVQA 3Q2DA 2Y8UA 2VEFA 1KBKA 3BCDA 2HISA 3SGUA 1W3TA 5C9WA 3M07A 1M03A 3HG4A 3KOFA 4RW5A 1E4NA 3WD3A 4NVTA 4C7GA 2QDDA 3BPWA 3UG3A 4ZTXA 1DWAM 3UGRA 3BV7A 1IIGA 3TFXA 3ATYA 1AK5A 1Y65A 2VWTA 4H6RA 2PDKA 1LUCB 2VDIA 3TC7A 1LDCA 4H6EA 1UP2A 1DV7A 3N2TA 2Z28A 1OQFA 3GFYA 4EANA 4N0RA 4XVEA 1FKXA 3LMYA 3DBPA 4EVZA 3TTQA 2FMNA 3AUJA 4IG2A 1D3HA 3L0NA 4N9BA 1PTDA 1U30A 2OVLA 4HTBA 1EXPA 3D3FA 4LUYA 3P14A 5LA1A 4CUCA 3GAKA 1DYSA 2J74A 6TAAA 1W9VA 3SJ3A 4H00A 4FEZA 4JL2A 2PDQA 1W9BM 1TTPA 4A8IA 4MAVA 3PBVA 2I5GA 3VOHA 1WDSA 1OFEA 5C0QA 1NF0A 3WJXA 4F8XA 3GU2A 2QJIA 2YDRA 2FKPA 3S6OA 1B3WA 3GVWA 3N18A 4QG8A 3PWIA 4NI3A 2AGTA 4C1NB 4Z2HA 2HEJA 1I2QA 2E40A 3AZTA 3WMSA 4AQLA 1F8IA 2ZX8A 2QHAA 3C56A 3T07A 2NVAA 3SIMA 3T0BA 2DH2A 2FZ9A 7ENLA 2VXNA 2AAMA 5D09A 4JEQA 4OE7A 3LGGA 4XBJA 3ZJ7A 3WF1A 1R3RA 3BGAA 1M41A 3VC5A 3BCJA 3AMLA 3WDHA 2FGZA 4GI4A 3W28A 2ASHA 2QZRA 4O4WA 4LUTB 3W7EA 1H7WA 1NOFA 2VL4A 4GNJA 3H23A 3G0XA 4TU1A 4JFVA 2E68A 4M5PA 1WUEA 5FL0A 1TX0A 1KM1A 1MI3A 2ZUTA 4WK9A 1Q4NX 4IL0A 3IIPA 4GO8A 3SCUA 3VZYA 1AH0A 3JU2A 5LNWA 3KP0A 1J79A 4PB5A 2Q6ZA 7REQB 2DT3A 4HN8A 2YL8A 2PGEA 2CLFA 4KWSA 4S3JA 1JR1A 2JFEX 3VVGA 5E0KA 2V69A 2X7WA 4QS6A 1IXNA 1JPIA 3B0XA 3VIHA 2G96A 4YN5A 1OFRA 3QOKA 5DBTA 2Z26A 3MCMA 1OFAA 1ZUAX 3AMKA 1OBAA 2OZ0A 3VUSA 4U3AA 4AVNA 2DH3A 5FEXA 3L4ZA 2GDVA 2EG8A 3M0MA 1IWPA 2KAUC 4HBKA 1CGVA 2DJXA 3BJSA 4GI9A 6TIMA 3EBVA 4C6QA 4KWWA 1XW8A 2OJPA 4J28A 1U22A 4M7TA 1E55A 4UR7A 4DN1A 2F6UA 4KRTA 5LHFA 1LJYA 5CKSA 4JL1A 4XZMX 4AD5A 1QATA 1Y0EA 3BOXA 1HKMA 1TA3A 4RNHA 2W9MA 3TN6A 4B9YA 1TZ7A 3W3OA 2Y7FA 1WDRA 3RYSA 2UZ9A 4L5ZA 2A3LA 1OADA 3B9OA 5LHEA 4JX6A 2OGJA 2RKXA 3HMCA 1P43A 4LC6A 2YCKX 2PBGA 3ITXA 3HGSA 3INPA 4H9XA 3TYEA 5DMLA 4WJEA 4F2BA 2ISFA 4F40A 1ITCA 3U5UA 3R10A 1GOOA 4Z0SA 3ZJKA 4M8UA 5AVHA 4PMRA 3FS2A 3CYJA 1JZ5A 2PA6A 3TK7A 4HA0A 4DF2A 4A3UA 5FSDC 4D6CA 4I9TA 1T8QA 2GJRA 3LA4A 1UKTA 3R0KA 4ZOBA 3EOEA 3HG2A 1UWQA 4W8BA 3RLUA 4MMWA 3O05A 5FEWA 1TWDA 4MDOA 3PBUA 1XBYA 1GVOA 4IMEA 3OU8A 1LYXA 3OQEA 3WX7A 3AMCA 4FX8A 2DW6A 3LU2A 5CPNA 3B9NA 3NEVA 4TTUA 3A13A 2Z2AA 2I9UA 4Z1DA 2WCGA 3RX3A 1JFXA 3CTLA 3IWPA 1XX1A 3C86A 1R47A 4K1GA 5B80A 1JZ3A 2F2KA 1H7XA 4NF7A 3G8RA 4Q8MA 1UROA 1X39A 2XFYA 2Y0FA 3WD1A 5AYBA 4HA1A 4NJHA 1P48A 2PUZA 3HV9A 5E9AA 2C8NA 4WKHA 5D02A 3PG9A 2UY4A 2HJPA 3APYA 3TU9A 3MTWA 1XFBA 3ZVIA 4PB4A 3RLGA 2OYMA 4HNTA 1SZFA 4B4FA 4LCSA 3WDRA 2AQVA 3SCQA 1RCXB 2W5FA 4E0CA 2CHNA 2CIPA 3M0VA 3E02A 2P3ZA 4JTKA 3N15A 2JKAA 1WKYA 1AW2A 4MOZA 1EO5A 2E8ZA 3BW3A 2DPEA 4U10A 1DJXA 3IUHA 3CHFA 1P0DA 1OC7A 1FH9A 3W81A 3EA2A 2IMRA 5ABFB 2O9RA 1NFBA 2ZA2A 1MQRA 1A47A 2B31A 1PDZA 4ZO8A 4O1FA 1IEWA 3O6AA 2VR5A 3LM3A 3VM5A 4J40A 3NQBA 3VIFA 3FYYA 2CU0A 4HOWA 4WR3A 4QE4A 3EPMA 4KFNA 5E93A 1UCWA 3GDLA 3OB8A 2E6DA 3D46A 3UWZA 1V3HA 2OWCA 2MNRA 1PCWA 1FVPA 2UY3A 4O1DA 4JIQA 3SURA 3LCIA 5A8QA 1FHDA 4HOXA 1IE7C 3H7UA 5AECA 3TYAA 3TOYA 3E6EA 4QDPA 4FS9A 3W25A 1IXPA 2NX3A 4AZ5A 3OGRA 2VCBA 3EYPA 4JPGA 2D3NA 4NL1A 5LNUA 1B2YA 3DFQA 2PWFA 4UTIA 3UCDA 1TWSA 2WSQA 3E9AA 3NL6A 2DQXA 2I16A 4MTVA 1LL4A 2WVVA 4QNWA 4LAUA 5DMNA 4IJRA 4N42A 4R34A 2BY3A 4IQDA 3HGRA 3HJZA 3SAZA 4JIEA 3C2OA 1VFSA 4RNJA 1TWIA 2WSYA 1B3OA 3NZQA 3P60A 2PCEA 4FZIA 4GKTA 3GW3A 2OB3A 3WQDA 4LUJA 2J77A 4LYPA 5FJPA 2DUXA 4L4LA 1LBMA 2E7FA 3TA9A 1W1IE 1K1DA 3L5LA 4CQ8A 1F3XA 1UD5A 1CGYA 3G1FA 1PPIA 4PL1A 2IQTA 3JR2A 1NJJA 4FOUA 3O6YX 4O0KA 3QPYA 4KS0A 1KW1A 5EBAA 3D3AA 1SYTA 2FTWA 3HPFA 4JTJA 2J7EA 1A3XA 4NY2A 1OSEA 1YNQA 1VFHA 3CUHA 4DUVA 5IHRA 5K2ZA 1JZ7A 1TUFA 2YDQA 3ARVA 2X1RA 1KGXA 4TV5A 3HF3A 3GO2A 5C5YA 4GBDA 3VU2A 3L4YA 4DRSA 4GC4A 4O16A 3G6LA 3SDOA 4DO5A 3M0YA 4HPHA 1JZ8A 1HKIA 3K8MA 3VD7A 3GWQA 1B31A 3AZSA 2WOQA 1EP2A 1UMLA 2CLEA 4Y2WA 2QPXA 3W76A 3GR4A 1W1YA 3HQNA 3B4UA 2GVLA 3WH8A 3OA5A 3RO6A 3DGRA 1V0NA 4BQ3A 3AUOA 5EA9A 1N8IA 3DFTA 5CQ1A 3S0CA 4OV4A 3QZEA 2IS7A 4WDUA 1XPYA 1E5NA 1SR9A 4IISA 7PTDA 3P3BA 2AL1A 3NNTA 4XSLA 2CXEA 4LVDA 1KC7A 1RQEA 3C5QA 1EGZA 1Q13A 4UZUA 1EC8A 2A2IA 2OCZA 1UWIA 2VFIA 2Y7EA 4AXKA 3VKDA 1CZ1A 4MF4A 1P5BA 4JBRA 3P7YA 2YDSA 4FAMA 3ITGA 3GKFA 1XV8A 2O0TA 1LG1A 2FVKA 3ABXA 2RAGA 4DWSB 1OFBA 2C79A 4LC8A 2Z1XA 1OABA 2A85A 4EE9A 2BNJA 4X0VA 4DZHA 4NAEB 5F2MA 3MSDA 1Y5WA 1DQUA 2Y85A 4MDPA 4PTNA 5HULA 3SGZA 1H09A 1BYCA 1U1HA 1UG6A 1Y8BA 1GOIA 2E28A 2NSXA 1S5TA 4YYFA 2XWEA 3F4VA 4UMCA 4AIOA 2CBJA 1DPMA 1SO4A 1VF8A 1XP3A 3W82A 1RPKA 4O1AA 1XYFA 3TXZA 1G94A 1TPWA 1JYVA 3NGFA 4AHPA 1E9YB 3H26A 1LORA 4XWUA 3V75A 1OC5A 1OFQA 4L6DA 4YTRA 1TELA 1XCFA 3QHNA 1GUVA 3TYBA 1TREA 1VHNA 1VIZA 2J8TA 4CCEA 3HM7A 4IPPA 4AFYA 4IXXA 3T81A 3WNMA 5ABHA 2FHCA 5FSEC 3CPRA 2YLLA 1CLXA 3WFZA 1W3NA 4HD5A 2EEXA 5E0FA 3GHSA 3QMTA 4E38A 4J5NA 4OECA 4DNHA 3KTSA 4HKPA 3EZ4A 3WENA 3WFLA 1N55A 5DRIA 3ZOAA 2ZWYA 2R9RA 3W1UA 2A4AA 1X7IA 2W67A 4N7QA 2PDWA 2W3ZA 1DXFA 1RBOB 1AL7A 5HINA 3U48A 1F2JA 1REQB 1SZRA 2PMQA 1TIWA 3A3XA 4X2PA 4EF8A 4Q4MA 4O10A 4JTTA 3UG8A 4E4FA 4AAJA 2DEPA 1NQ6A 3O8AA 4DF0A 1I1WA 3T2OA 3LLDA 1Y5VA 1EA9C 1ISWA 4FXSA 1L6GA 2VFHA 4JTLA 4DYKA 3LRLA 4Y7EA 2WQDA 1H5YA 1BGAA 2QCHA 4EPBC 1N7KA 2ZBTA 1X7FA 4WRHA 2VTFA 4RDWA 1W9DM 4EIVA 5CBIA 1KM6A 2DDXA 3TTYA 1SUXA 4DNMA 3LB0A 3PFMA 4DIAA 2XIIA 2CPUA 2NQLA 4ZR8A 3G1AA 3ABZA 2VC6A 2GK1B 3I7RA 4QHRA 4ZFMA 2DJLA 1NDYA 4AU0A 1XKJA 3WH7A 1UD2A 3LBOA 3H8AA 3W24A 4KWOA 2A7PA 4NJKA 1TWWA 3HPZA 1YBQB 4HU0A 3S1GA 1X38A 4F3HA 4UFLA 4AB4A 3BQ6A 1FWSA 4HHLA 4FR6A 1VFMA 2XIQA 4HVXA 1IZCA 2ZA3A 3TN5A 4FI4A 4XO6A 4HPNA 2VEIA 1XDMA 3UERA 1E71M 2D0FA 3UYCA 1GW1A 2BVDA 1TO3A 4JICA 2WNZA 2ZE0A 2QXWA 3OO2A 2GSEA 3QC0A 2ACQA 3URBA 1XRTA 3W02A 3DFNA 1WXJA 4Q8NA 3AIRA 1L8PA 1VBRA 3SJNA 1WZAA 2XFRA 4YWSA 3CO8A 1R8LA 4KCUA 4U33A 3IJLA 4LBRA 1UZHA 4AXNA 3BAKA 2CLPA 2V6AA 4RXFA 2PBOA 3SN4A 1AA1B 1KO0A 2QAPA 4XAPA 5EGRA 2YL6A 1DTUA 3G3MA 3DEQA 4C6OA 4HU4A 3EWDA 3L2LA 3FAXA 5CAKA 2QNEA 2PZ0A 1IQ8A 3VIOA 4GFSA 4DO7A 3SCSA 4AZ6A 4KMQA 4I6KA 3OGVA 3KCLA 1JDEA 4OWGA 4V33A 3TXVA 4MFEA 4WDXA 4J3VA 1KKRA 4GCXA 1HP4A 5IBXA 2RDUA 3ABOA 4MWAC 4B4HA 2ACUA 3PZNA 2NLYA 4MPKA 1SJCA 2HS6A 1BTMA 4L1GA 3SUSA 4MJ2A 1S5VA 2H9AB 3GHTA 1XHGA 2IW0A 4CU6A 4L4MA 2NX1A 3BE7A 3SUWA 2W79A 4P7RA 2WHJA 2VFFA 4WLCA 3RN6A 4O15A 3P93A 1GG1A 2RJGA 3S2MA 4GYPA 3WK1A 4JNZA 2VC9A 5AOUA 1TE1A 3TSDA 5I6SA 5HXMA 1E0WA 3PAJA 2OKOA 1XSIA 3A4JA 3ZR5A 2EBNA 3FJ4A 3MO7A 4BF5A 1R9YA 1ZLPA 1EJXC 1R3TA 4HZ8A 1V51A 1J0ZA 4NX5A 2YDAA 1DBTA 4MAZA 3ARWA 1P6BA 3R94A 1C8XA 2VJXA 2YCJA 3GX9A 1BYBA 3RR1A 1SFLA 1PYFA 4RDVA 2QCDB 4HNOA 3RU6A 1LOSA 1O1ZA 1DEDA 3M9YA 4IMAA 1P1MA 4HNUA 3BW4A 3FGCB 4JFTA 1GNXA 3CTTA 2EXOA 3EEZA 3UJEA 3O06A 3BLFA 1V6WA 1LZOA 3M7SA 3EKGA 2YZRA 3UJRA 5GNZA 1A5NC 2HMCA 1C7TA 2QF8A 3RX2A 1TCDA 4QEHA 3KM8A 1NDWA 2CNCA 4F0KA 2X1TA 2OZ3A 3A3HA 2DZWA 4UFHA 1NDZA 2F6XA 3SM0A 4O50A 3FYPA 4AZ7A 2BXVA 3FLUA 4OOUA 3CT2A 3SY1A 1FWRA 4PEEA 4Q8PA 8A3HA 1PKNA 2J78A 1AQHA 1ZJIA 1PZ3A 2GGJA 3NFUA 1TR1A 4QQUA 1PKYA 1AQMA 2F2HA 2XYLA 2PRLA 3U2CA 2VGIA 3M5YA 1J2BA 1E56A 3B3DA 4EWJA 2C1HA 3SECA 4HIBA 3N3MA 4E6MA 2DVUA 3TW6A 3W83A 3A22A 2MUCA 2WC3A 1OD0A 3K1DA 3RAOA 3KRZA 2YBTA 1EJ7L 2RDTA 2YSWA 2CITA 2YIHA 2EKGA 1E1EA 2GVJA 1TCMA 3E74A 4RE3A 2ZZ3A 1S39A 2DT2A 3IEBA 1IT0A 4B16A 4XBSA 1CXIA 3TMLA 4QITA 3UGVA 4RCXA 4E8CA 3LZ3A 5ABGA 2ALRA 3S6DA 1XRSA 1PVNA 3GNXA 5FF3A 3TJIA 1KWGA 2QPUA 1AL8A 3MKCA 5JBEA 1PWLA 2YR1A 3N9SA 3PR2A 1R2TA 3O0FA 3THQA 2VT0A 3GAYA 5I3GA 1EH9A 1VS1A 2ON3A 4QAIA 2IPJA 3UWEA 1E0UA 5BOFA 3GVRA 1J5SA 4WOZA 1FFRA 3NL2A 3OBKA 3RLHA 4ZSTA 3ZLGA 3LLXA 2CZDA 3WQGA 1GYLA 1A53A 1H41A 3PWGA 4I6VA 2I14A 1H49A 3T4CA 4MWAA 4UCFA 4HQVA 4E8DA 1JCLA 1XFCA 1CBGA 4KWVA 4TVCA 5I23A 3UZYA 3XINA 1GHRA 1FWIC 1ZS2A 2EJ1A 3ERPA 2OODA 4NAFA 4C5ZA 2GLKA 4GMEA 5GJNA 4AEEA 3EDFA 1GOKA 1LWJA 1A0EA 4ZB2A 1V02E 3W2KA 1PZ0A 2PP3A 5I3DA 1VZWA 1K8YA 4TVDA 4LY8A 3T4WA 1ICSA 3QEZA 2RDXA 2C14A 1E4IA 3RPTA 3CIWA 2G97A 4IFOA 1RR2A 3V1PA 5E9XA 1X6NA 4XZLX 4X63A 1VIWA 4AW7A 1OJXA 3PJWA 4MB1A 1WKDA 2D0HA 3ARQA 3UWQA 1XIBA 1L0PA 3OLDA 4YVXA 3VNKA 2YLAA 1VFUA 2GFTA 3N29A 2X1IA 4HK7A 4AZGA 3IAQA 5EL1A 2PRMA 1JDDA 3WJZA 2I57A 3QV6A 4N6FA 1TA3B 3P8IA 4CGTA 4V15A 4M51A 3WLNA 5A94A 3OG2A 4P7NA 3S5ZA 5LGXA 4JYDA 5I7GA 4EX4A 3S47A 1WPCA 3CZ8A 4HMCA 1JULA 3B9AA 4GVGA 3OJGA 1XH1A 1D8CA 2FGBA 2VZVA 3CNYA 4GVHA 4MWAD 3T05A 3ISIX 1H7NA 1MXDA 3KBWA 4NZ1A 1Q7QA 4IMGA 5BYWA 5EU9A 5H8MA 4XKYB 1O1HA 3R4IA 4L80A 4LU0A 3S5YA 2WKJA 1IXOA 1FA2A 1ISZA 3W2MA 3ZSTA 1K7FA 2BGNE 3F2BA 2GJLA 4JY8A 1AMKA 4F0RA 4J35A 4BFAA 1H1NA 3ITYA 5G5IA 1EPVA 1SMDA 4G6CA 3ZO9A 3N12A 5DXYA 3PTQA 4RPQA 4W86A 3SEPA 2J13A 1V0LA 2NUYA 1S5WA 4LJ3A 4Z08A 4PFHA 1HX0A 1FWFC 3TZFA 2B4GA 3BZGA 4RW3A 2NV9A 2OTDA 2DT1A 2J9ZA 3QF0A 1ODZA 4QCFA 3LEPA 3CPGA 2A6LA 4JR5A 3MQTA 4KIEA 1KTCA 4W4QA 4AZBA 4I3GA 3CWOX 4PUMA 1NVMA 5AHFA 2CBIA 2G3MA 2Z6IA 3OIHA 2XVPA 3B05A 1QK0A 2Q3OA 4YXGA 4C6LA 4PCSA 1UP3A 5H8UA 4OU1A 1GZJA 2OU4A 3DHFA 4J3XA 4PUDA 3S46A 1UR1A 3UXKA 2OOFA 4X61A 3ZM8A 1WDWA 1FWGC 3A9IA 1ICPA 3RJXA 3CYVA 1V6XA 4V2XA 3TJLA 3ARYA 4PULA 3RLVA 3OG3A 1Y7VA 3RX4A 3ZLFA 3Q37A 4ZFCA 3GUGA 1OK4A 3C4UA 5IM51 3LY0A 4K2SA 3SO7A 4PCFA 3M43A 4L4OA 1VAHA 1Q63A 5ECVA 5DBUA 5XIAA 4UNLA 1DIKA 1UR3M 1US0A 2PD9A 2GDQA 1HJXA 1FWWA 2HPMA 3H6OA 2VQTA 3M41A 5AY7A 1ZY9A 3W7OA 1XIHA 1K4HA 4U31A 3HMJG 3W27A 4EXQA 4NRSA 1QBAA 5DELA 1C91A 3CIVA 1KNWA 4PN2A 2W92A 3M0HA 1C8VA 5I3JA 1R87A 3A6OA 1QPOA 4DM1A 3LHTA 5BZAA 2WHMA 2VR4A 1RALA 4UFKA 3AMDA 1S3TC 3NDYA 3PBYA 4XUGA 5DN1A 3MA8A 1PE1A 3LERA 1CTNA 3LPFA 2QJHA 2CLLA 1O66A 1GVEA 2HXUA 3FN9A 3B97A 3L12A 2BB0A 1SW0A 4NZFA 5J5RA 2H90A 5A1AA 1LROA 2QEZA 5D2XA 3H2MA 3GC4A 4DF1A 3GD6A 3P0WA 4O1CA 4CD8A 3WH9A 5DQPA 4ZCWA 4F2UA 2J7FA 4B3KA 3N2XA 4FXRA 4DO4A 1ZTVA 2OYKA 1P0NA 4AC7C 3AROA 4KCVA 1NH6A 3BTNA 3R25A 1A5AA 3P82A 4XK2A 3CUZA 4M81A 3ZVHA 5I5RA 3IVUA 4S3CA 1UW9A 3PPCA 3L4VA 1YPIA 1MWOA 3H4GA 4ZQCA 4K7YA 4H19A 2EGZA 1XIIA 1T99A 3NUKA 2ZIDA 4GY0A 1S2AA 4OHQA 2WHKA 1S2CA 3TFCA 4FNTA 1JUKA 2O9TA 3JW7A 2P5NA 2WZIA 1A5KC 3T0DA 3W7MA 3Q94A 3FHAA 3PZVA 3QN3A 4E3TA 3E0FA 3AYSA 1GWJA 2E6YA 3QKZA 1R38A 1PIGA 2Z4GA 1ONRA 2YCLA 2DVXA 2R94A 2WWDA 4GWEA 3STEA 2FHFA 4LAKA 1EGVA 3BUVA 2FPVA 4IX0A 4KH2A 3NCOA 3S2LA 1B0IA 4LXFA 1HJQA 2JIEA 3IRDA 4MZ1A 4R27A 4GPNA 1E70M 5DEZA 1Z42A 1RBAA 2Z1KA 4QGCA 1BWKA 1UWSA 2OWWA 1XLJA 1OZQA 1A4MA 3L4WA 1EBGA 3LXCA 3S6TA 3LCGA 3DZ1A 4MG4A 3V7PA 2JIWA 2J7CA 4W87A 1OFDA 2BFGA 2G5WA 3MI3A 1Q66A 3DG7A 3UQNA 3B0YA 4UMBA 3H7VA 4MJ4A 3LYEA 3BMXA 3EWZA 4LUSA 4O1BA 1KLYA 2A3AA 3S9ZA 5TD4A 1I0DA 5MHBA 2DSWA 1V6VA 1JFHA 3CC1A 3T8QA 5GJPA 4FIRA 4M7SA 3GXNA 2QV5A 3AIUA 4CEUC 2YOCA 1E72M 1KGWA 1NSJA 3E0IA 4S3KA 1K7XA 3W7NA 3WMBA 5D05A 5BOEA 3U0HA 4K1WA 4ZO9A 4OBTA 2FTYA 2QKFA 3R8RA 3P81A 3LQLA 1XIGA 1NIUA 4QFUA 2YX0A 1XH0A 2PS2A 5DCBA 3RCMA 1OT2A 4QX4A 4W5UA 4MUZA 4TR9A 1ZENA 3UW6A 4JOMA 3NGJA 3WEZA 2JGYA 3GXPA 3VIJA 4CCZA 1GEQA 2ZRVA 1TMQA 1Q45A 3EGJA 2XSXA 4W7VA 3UY8A 3EOLA 3ARUA 1GW9A 4OZOA 1W1A1 1IV8A 1QASA 1NEYA 1V3IA 4CNSA 4ZQNA 1XYZA 5CZJA 1TPVA 3PBWA 4I8YA 2FVMA 3MMTA 1L9WA 3SGGA 1NFGA 1DJQA 4G56A 1MEHA 5IOBA 1H61A 3KRUA 4JTSA 4PL2A 5EKYA 5KMYA 1HGWA 5D32A 3SCWA 1V6YA 2Z1SA 4F9JA 3AICA 4UNKA 2V30A 3H4WA 4LALA 3L68A 5C8BB 2YXGA 1KFEA 1I2NA 4NHVA 1EDQA 4YTQA 2PWGA 4KEMA 2QQ6A 1GK8A 4N4QA 4Y9MA 3AYVA 3HU7A 1M7OA 3TJ4A 1P1XA 1LOQA 2ZX5A 4M80A 3IUDA 1OT1A 1ISVA 2WMIA 3G5EA 4BWLA 5JVLA 1GOWA 2ZYFA 3EOSA 1LF1A 4PUNA 3OQ8A 2Z7KA 3AYRA 4DM2A 1XQLA 3N17A 4D1IA 1C8YA 4KPLA 5LIUX 2B0MA 4UTFA 1G6CA 2XH4A 1DJYA 3B04A 1RH9A 1BGGA 3MP3A 4JHOA 1VKFA 4ADSA 3PTKA 1BXNA 2O9OA 4DJDC 3M0LA 1D7FA 2Q02A 4YJ5A 1JD9A 1Z8AA 5AN7A 1H1YA 3LCFA 4X0NA 4ZSUA 1XGDA 3UCQA 4LFYA 4HOZA 4XKMA 4H9UA 1TZZA 4AF0A 2WNNA 2ZZ4A 5CPMA 4GLEA 1ZSXA 4O14A 1KM3A 3BK0A 1C92A 3SRFA 1ONEA 2Y61A 3P5YA 1C93A 4IMCA 4S3BA 1JF6A 2XVGA 1LT7A 4ROPA 1Q6EA 3R8GA 2VVSA 1CX9A 2G95A 3K46A 4ML9A 3OVPA 1P7TA 4ZGYA 3QOMA 2OSWA 2ZXDA 4OUEA 3VK5A 2XH7A 4DUOA 3OVQA 2PEVA 2HS8A 5HMDA 3EDEA 3B8SA 4Y9PA 4KEZA 4JN6A 2ATMA 1E6ZA 2YYUA 2ANUA 3SCPA 1J0JA 4CNNA 3WMCA 1UUMA 4QS5A 4GHRA 3AS2A 1CW2A 1XUZA 2VD9A 1V0KA 4IICA 3IGUA 5REQA 2OSYA 1X1NA 1GOXA 1UASA 1FH8A 1H2JA 4NX0A 1Q7MA 4D6DA 1HL9A 1TB3A 4LF1A 2XINA 4INFA 5GQBA 3LD5A 2C1GA 4H6KA 4ICMA 4CN1A 2X09A 1FDJA 1FWNA 3KWSA 5C71A 3VOFA 3HPSA 4NZ5A 3H12A 4KQNA 3PJXA 5D03A 1K6AA 5E70A 2P8CA 3NYZA 1KCZA 1QMLA 4IQEA 3VNIA 1U5VA 2X8RA 2GYIA 3FA5A 3OTRA 1KCLA 3THCA 2XIMA 1NY1A 3NJ3A 3TMQA 3H2AA 3AI0A 4FX6M 4C7FA 3CQIA 1F3WA 2O4MA 3Q45A 3PTDA 1IZJA 1JI1A 2ZDSA 1EBHA 3ZFHA 3MUCA 4U28A 3S42A 1Q2SA 1IEVA 7TIMA 1TUXA 3PY2A 1KRAC 3AHVA 3VX0A 4Q8UA 4QSFA 3ITOA 2XDFA 1Q3NA 3UWUA 2R6OA 4Q4SA 1JVNA 3ECQA 4JX5A 3FW6A 5G1YA 4H3DA 2V5BA 1G7UA 1O60A 4JQAA 1IEQA 1QAPA 1G0CA 2RFGA 2W66A 3G1HA 4FNQA 3P6LA 4EK7A 3UP8A 1ADSA 3ES7A 5AZ1A 1UR9A 3PC0A 4W93A 4GH3A 1HL2A 1H7RA 2E6AA 5HANA 1QTWA 1ITUA 3QW3A 2ACRA 2V5CA 3OZOA 5DY2A 2F6KA 4PUUA 4PB3A 1O7AA 2HROA 1F6PA 1OC6A 2PF8A 1EP3A 4GVFA 5AC4A 1EOMA 3W0KA 2FZ8A 3GM8A 4GOAA 5TQLA 3C2EA 3WF4A 3LBCA 3DBNA 4B92A 1YYAA 2P0OA 4CU8A 3A5VA 3SQLA 5BRPA 2YCEA 4GYFA 4GVIA 2PFHA 3OLGA 5M03A 4XBKA 5G4EA 3WQOA 1R6WA 4DJDA 4TTGA 2WZEA 3WL1A 1TV2A 1W1B1 4WSHA 1VBJA 2D0GA 4CNUA 3PFRA 1HTIA 4R9XA 4PMYA 1DQWA 3G1YA 4OQVA 4HNCA 3D5HA 3DKLA 1R3SA 3CL6A 2R8WA 2Y7GA 3GIPA 4AYSA 1W5QA 3M1ZA 4DAFA 3PNZA 4LBUA 4E2BA 4ZODA 5G1MA 3JUGA 3GXMA 2G3FA 3KHJA 3MC5A 1IIHA 3GTHA 1AH3A 3TJXA 3AHXA 3GU1A 1RBLA 3L5MA 4C1KA 4KFPA 3DI1A 3L7RA 3A12A 4DX3A 3AZRA 2H6RA 4FNSA 4YMZA 3GG7A 3ME3A 3N25A 1NELA 4WOQA 3OLIA 1OGSA 4G1NA 1GVQA 1A80A 2V38A 2V3GA 4HSHA 1W9UA 1XRFA 3W7GA 4CQDA 1TRIA 3OEXA 1GJWA 3B40A 4FNPA 4B5TA 1YIXA 4GX9A 2E67A 4TMCA 1J96A 1GKPA 3C8FA 3PP7A 4I7WA 3QJAA 4IUOA 5JMUA 5HWMA 1ZJAA 2EPOA 3M7WA 3OZPA 3STGA 1TWZA 1A5CA 5AB3A 5CGMA 2WC4A 1SZGA 3VTRA 5CG7A 3UBPC 4BQ2A 5F7UA 4DJDD 4C1LA 3ALFA 2YBUA 2BSLA 3EMZA 1SJBA 1T5AA 3W29A 3K1GA 4DXXA 3VDBA 1DJZA 5HAOA 4MKNA 4UTWC 3CEPA 2XH0A 4D6EA 4IIGA 5HQLA 4HJWA 3WJYA 3ARSA 1AD1A 1KRBC 2XZ7A 2HE8A 3TYDA 3HFYA 1C7SA 5CEWA 2Z1BA 3GXDA 1QNRA 4NKCA 3WLOA 4ENLA 4EWND 1FCBA 1QPNA 3KTXA 3CHCA 3DCPA 4JCLA 2VEKA 2ZXAA 3EWXA 3II1A 2HPIA 3RU8X 2ZZ1A 4FA3A 4IM4A 4JIIX 1V08A 4MWAB 2AL2A 2F8QA 4BEQA 2QUUA 2B7PA 2OGYA 1NOUA 1UJPA 5ABTA 2EF9A 4PMDA 1QJWA 1U83A 1K03A 2CLIA 1XF0A 3T0AA 1TE6A 4DUWA 3V16A 1GVSA 1FFQA 5FA5A 2J4GA 2NXHA 4PUKA 2HK1A 5M3WA 2JQXA 4B5UA 2DQWA 4GZ7A 2P53A 1DHKA 1Q6OA 1DOSA 3PPFA 3CLWA 1JDCA 1JRBA 1OHLA 1V3LA 1LWHA 1N2VA 2QJMA 3UR5A 1YXYA 4A3YA 1MYRA 2QJNA 1T8XA 2HDJA 5A6MA 1SJDA 3GXFA 4M1BA 4DI8A 1W54A 3MKVA 5TIMA 2E8YA 3HB9A 3ARRA 2VVNA 3POHA 3K2GA 3UXAA 3UPMA 1OFPA 5A6KA 1SSDA 5K9XA 3O1NA 1EJSC 3UESA 3B0UX 3H2OA 3P62A 2DSUA 2CBVA 4WY0F 3EWCA 3T55A 3KOYA 3E12A 4V28A 1J0KA 5AYIA 4Q4KA 4GJJA 4Z0JA 1MUWA 3NWRA 2NX9A 3PN8A 3M4HA 1LQAA 4UCGA 4LVFA 4HMEA 2XGIA 2WLYA 1NF7A 3W2JA 4B5NA 3K13A 2YA0A 3W00A 1AG1O 1KTNA 5E09A 3T1GA 4ILSA 1I6NA 3MYPA 3TQVA 3LENA 3CZEA 2ISVA 4CQCA 1BVWA 4R9OA 4CVWA 3QMSA 3COTA 4MUPA 1XLFA 4P5UA 2G8ZA 3NQ6A 3GUWA 2WKLA 2A3EA 4QDWA 1MO0A 1H60A 3VCCA 3WBEA 1SM9A 2ZUVA 2PP1A 3ZS4A 1UQZA 4ZZ9A 1XBVA 1V6UA 1Q6FA 4V1XA 4LEFA 1MFUA 1EB3A 1KLZA 5A95A 1PEZA 3TCEA 3VD5A 3WLRA 3BAIA 4RNFA 3IV3A 3MV01 2BOGX 1XIDA 3SUVA 3SN0A 1UWRA 2ZX6A 4DQWA 2QDEA 1QUMA 3LS9A 2QIIA 3C0LA 1VBHA 4AIBA 2HZGA 4R5EA 5CZSA 5CXPA 2PWUA 2WLZA 3RM4A 2QJJA 5BXRA 3H24A 2H8ZA 3P84A 2ZZ6A 1YDYA 4IP7A 3ES8A 3U6WA 4UTWA 3OZMA 1J4EA 4R7JA 3QGVA 4A8NA 3REQB 1OYAA 4LAZA 4M56A 3BGGA 1XLBA 1JZ4A 3EA3A 2PGRA 1BPLB 2X2GA 1UC5A 3WELA 1EF3A 3W6YA 2G4FA 3UJSA 5DY3A 5TF0A 2I9EA 3VGGA 1SO5A 4C6MA 3BLEA 2QMJA 1KB3A 3H53A 1UZDA 2GZXA 4IIHA 2OLHA 4IGMA 3PG8A 2WWCA 1BG4A 4R7OA 2Z24A 1NP0A 1C9DA 4MM1A 4HNVA 1UBSA 1UWUA 4Q6XA 1G7VA 4F0SA 4C6EA 1QT1A 4HK5A 2WCAA 4PC8A 3S2CA 2XIJA 3H2NA 2VNCA 2NWRA 5I0DA 4J2PA 4CQAA 1MUMA 1JYWA 2V68A 2PDXA 4D6FA 1QW7A 4QG9A 3TE9A 2UBPC 3EWUA 3WD2A 4QXIA 1SMAA 4KGJA 1A5SA 5EY5A 1F74A 3C0JA 3HJEA 5FF0A 3DKJA 4UFIA 3M47A 4TXEA 3NZGA 2NWSA 4D6IA 2UY2A 2B7NA 4PRRA 1FWHC 4L1XA 3O7UA 1B1YA 6XIAA 2E3ZA 1HL8A 5JXQA 1AQFA 2V9DA 4D8LA 4QJ3B 4HHPA 4Z2IA 1CGTA 3SCNA 3QQWA 4U5IA 2ADAA 5C9RA 2QVNA 1B5TA 4UTJA 1OK6A 1ZHAA 1W2PA 1TTQA 3RMEA 1TRDA 1XI3A 1SPQA 2J7GA 1F4AA 2KX9A 1QRQA 3DUGA 4KCTA 1YTEA 4H9MA 5CZ0A 1J6PA 3GFXA 1JCNA 4UTLA 1XYBA 4GO9A 2YYTA 1WOAA 3GLCA 3FJNA 4UTTA 4BEUA 3S9IA 4Q33A 1LL7A 1M01A 1VGAA 5BRQA 1BTCA 2VRQA 4NT0A 3CS2A 1XLGA 2OEMA 3NO5A 1OB0A 5EPDA 4Z2LA 4Q8OA 1B9ZA 2QAFA 3EXRA 3CU2A 1EL3A 3UG5A 1XBZA 3VAVA 3CV1A 4WF7A 5HNTA 2C15A 4NIRA 2TRSA 4OOZA 1PKMA 4GJIA 5EMYA 1OYCA 2ZWZA 1DORA 1ZJBA 4QSHA 2RUSA 1JCJA 3SY8A 4CD7A 2F84A 1EHAA 1YDVA 2OO0A 5TNVA 4O28A 1W5MA 2PSNA 4XTIA 3B0PA 3CJPA 3HBLA 3IGSA 4J3TA 1UB3A 1FWAC 1G4EA 3AS0A 2VO5A 4G8TA 1TPDA 2G3JA 1R3QA 3QTGA 2ZRXA 3CAKA 4LVBA 4UQDA 1GG0A 2O55A 4L65A 2WZTA 4H9VA 1ME8A 1GOMA 2YB4A 3L4UA 3IK2A 4AY7A 4C6CA 1OCQA 3AHZA 5HPOA 4YU1A 2QR6A 3QSTA 1OD8A 3KS5A 3OBEA 2ZDRA 5AYZA 4DEFA 2Y63A 1XM3A 3NM1A 1U5HA 3CB8A 2GJXA 3W9ZA 4JIHA 3WK2A 2VEMA 2YB1A 4Q4QA 4RE2A 1PWMA 1U5JA 1LLZA 1NM9A 2E5BA 3GYCA 1A4LA 2Z25A 3RPMA 4AZCB 5LYRA 1VP5A 1VFLA 3VCNA 2ZQ0A 4IGHA 3TYCA 2OEJA 3QLDA 4BZYA 4A21A 2OO6A 3UEQA 4H41A 4UIOA 2WM0A 3MJMA 3S2NA 3MBFA 4U2ZA 4C6NA 4O8AA 1OGGA 2VEPA 4HPGA 1ZAIA 4RV8A 3A5FA 2NQ5A 1TV5A 5KTLA 3LCWA 1VQTA 2O56A 4ZBCA 4AD0A 1EDGA 4TO8A 1VENA 4EP8C 1I45A 2GWGA 3BANA 3GH4A 3NAVA 1V5XA 3LHZA 3EPOA 4C90A 3PSWA 3A47A 2A21A 4FSAA 3T42A 4NXSA 1PB0A 3W84A 1GOQA 3VNMA 3VOGA 4CN6A 3WN6A 1LQ2A 2X1SA 3H2CA 1QBBA 3ONBA 4NASA 1LOLA 4GZEA 4KWUA 4GD0A 2D24A 3A4WA 4E8GA 3M0XA 4UNIA 1DQXA 4PRWA 1OFOA 4IFKA 1V8EA 1XLIA 1QHZA 4Q8WA 3WQCA 3PB0A 3V0TA 5F2GA 2CZEA 1GPWA 4PA8A 4FF5A 4WHBA 2JF7A 1EJUC 3R0UA 3AHTA 4FHAA 1UJQA 1W3HA 1OM0A 2FDMA 1KFBA 4AIUA 4MKSA 4B5VA 4NJGA 4OTKA 1LLWA 2V5KA 4PTWA 4M24A 2E25A 5GJMA 3T6CA 4F48A 3U2ZA 2E09A 3NVTA 1SSGA 1MEIA 3GS6A 4RXGA 2J7DA 3BG5A 4H8UA 4NUWA 4MNJA 2BDQA 3FY1A 3S83A 3UR2A 1T0OA 1QI4A 2F7FA 1RA5A 1LRQA 2ZICA 1R5YA 2Z7GA 5DCDA 2W61A 1QPQA 3TONA 1RY0A 1P4CA 1KXVA 1EEPA 2INZA 2R1NA 1LRNA 1B30A 3R89A 1CXFA 1FCUA 4Y8EA 1ML1A 2CWXA 3T0TA 1FWTA 3HIJA 1B3ZA 2C91A 2P3EA 3ICJA 1DJIA 1I2PA 4LVGA 4CLMA 3MMWA 5T8GA 1OIFA 5EFDA 3VABA 3B0VC 2OX4A 3VKAA 3WQ8A 1EYEA 1W3KA 2INFA 1W8GA 3ARPA 1WXYA 3UWWA 4FNRA 3SRKA 5HUPA 3E38A 4PYSA 1DIDA 2OYLA 1DKWA 2HTMA 2ZOXA 1EPXA 4AZHA 3W73A 1A5LC 2J66A 3NL3A 3IJDA 5DMMA 2WJEA 1TJ2A 1HUVA 2REQA 4AD1A 1PJ9A 1JEZA 3A24A 2CHOA 2QGYA 4FK9A 4HTYA 4WJ8A 5AHEA 4AF0B 4LW7A 2OR2A 1XYCA 4LUIA 1UBPC 3RGTA 4K8EA 3BMVA 4H6QA 2FPTA 3W7CA 3B03A 3GDBA 2PLKA 3CWHA 2VX6A 3DYPA 3WFAA 4DI9A 4LV4A 3VNLA 3ENLA 4IIDA 1LBFA 2VMFA 1A50A 3TROA 1WDDA 3DC0A 2XN0A 4LRTA 3OIXA 5HMSA 1K8ZA 4XD4A 5FEPA 4YCPA 3SB0A 4JFSA 1V77A 2QCFA 1O95A 4MY8A 1CXEA 4TUFA 4WX2A 3KL3A 3EKLA 3PULA 3TAOA 1Q6GA 1XIFA 4WGHA 3TQ0A 5AC5A 1LUCA 1CECA 2OWXA 2V0TA 1B3YA 1ZNNA 1BKSA 3C0SA 1GTHA 4GXMA 1NTHA 2BG5A 3IGHX 3LHUA 4M6UA 1O5XA 1TJPA 3QHOA 2EPNA 2E5CA 2J8FA 3NTYA 4LS2A 1AUSL 3UZJA 4H8HA 3DN5A 1XCWA 5HA7A 3F5LA 3ZWTA 5LNVA 1DP0A 4PMVA 1A5UA 3G22A 3A23A 4O1EA 3WCZA 1EZWA 2Q01A 5FKYA 3QGKC 2H3BA 3PM6A 1JRCA 4Q7BA 1RY8A 2YL5A 4FXFA 3FYOA 5K4XA 2D1ZA 2YFOA 3AJ7A 3CQ0A 1BD0A 1RV8A 5BMWA 5LZLA 4W7WA 1NWTA 1W3JA 2J6XA 1W3LA 4NU7A 2AQOA 3BURA 4AVFA 2WVSA 3OLEA 3IRSA 3LG3A 2A3HA 1XCXA 1UIOA 4J2MA 4JXCA 3VOIA 4BR1A 2TYSA 4YYCA 3W1MA 2E9LA 2HBXA 3EDDA 3GVVA 1PHQA 3NDOA 3GTNA 4ZQOA 4Q3MA 2DW7A 4GQRA 1PX8A 3JVAA 1BVNP 4HA3A 1OGBA 3WBWA 2EG6A 6A3HA 2Z2UA 1B90A 3RMJA 2FMOA 3F2CA 4NILA 3NSMA 4DYEA 2DZUA 1C8QA 3GDRA 4IHCA 3KZSA 3TNBA 3S5SA 3NL5A 4KERA 4DBWA 4B90A 4GY1A 3DYOA 3W74A 3LLFA 4PZVA 1CIUA 1ISYA 3WBAA 2WV8A 2C0AA 4CD6A 3DYMA 4PEKA 3W7QA 4QG6A 2BX7A 1I8JA 1QNSA 3GZAA 3E2QA 3RCNA 7CGTA 2HCVA 3I3DA 4CEXC 1A3WA 4XSMA 4C6KA 4LSBA 5BXTA 1EJVC 5KZEA 4U3CA 1MZRA 2OZTA 3GDTA 4HZ7A 4V27A 5C70A 1JF5A 1TJ0A 4BI6A 7REQA 4OKDA 4WSJA 5I00A 1WAWA 2NT0A 2OKTA 1CNVA 3B4YA 2QS8A 2A0NA 3CMJA 2VGGA 5ENLA 1GQIA 1U2YA 4AH7A 1B54A 3PBMA 2PE4A 1QPKA 4UQ9A 4YVVA 1QNQA 4NG3A 4GYKA 3OOQA 3V5CA 2J7HA 3B8UA 5A8MA 5LXXA 2GOUA 5A6SA 3AIQA 4LT9A 1Q6DA 3AFBA 5CSSA 3EX6A 1V3MA 2BZNA 1N8WA 1TTJA 1KFWA 4LYQA 4D6JA 4UQBA 3NO1A 1RHCA 4XZBA 4RV3A 4XAYA 2W6RA 3QR1A 1HKKA 3QFWA 2UV8G 4HHMA 4BK9A 3QW4B 4XAGA 5I77A 3P61A 4KGLA 3TWAA 4HZ6A 2Y5JA 4ZL1A 3WLLA 4O52A 4ADTA 1OX5A 5AHIA 4A8LA 3B8TA 4DJFA 1AQ0A 1KTBA 3C2FA 3DFHA 4GFIA 1AZ1A 3CMFA 5A6BA 3DG3A 4YVPA 1ONWA 3WQVA 1LP6A 1H0GA 3KCOA 3CAVA 4JFUA 2YCIX 3ANYA 3CQJA 5FJUA 5L6UA 3K4WA 3ID7A 1E1CB 2IKGA 3NQ2A 5FJIA 4MSSA 1NARA 3PTMA 3KZPA 1P6CA 1ZBVA 3VIPA 3IIXA 1RP9A 2CCRA 2DSZA 2VHLA 1EEXA 3TIMA 3M44A 4P8UA 4GI8A 1H11A 3SRDA 3VIKA 5BWAA 1QOPA 2PDNA 2VGBA 4HMDA 4MGGA 3P74A 2BLEA 1C29A 2O4QA 1R0MA 3W1PA 1YE6A 3TTOA 5CC6A 1VFFA 3PVFA 4ECLA 1EIXA 4JTHA 1ISXA 1UR4A 1QI0A 1Y5XA 4UUIA 1UZ1A 4XD5A 2NV1A 3S4TA 4R7WA 1XINA 4RE4A 2IPGA 2R82A 1JPDX 4HPXA 5CPOA 3G2GA 4JKMA 3AXIA 1LWIA 1SZEA 1UR8A 1VCVA 2FJKA 3KVKA 3MDUA 5FI8A 3AXXA 4R33A 1F07A 3NQMA 4DJFD 5FOOA 1ZPTA 1XUUA 4LOCA 5A6BD 2WYSA 1A3HA 2X40A 4L64A 1H51A 3GZ3A 2VZUA 5HNUA 4KRZA 3CUJA 4DO6A 3EX4A 2VC5A 3ABQA 3MV11 4CCDA 3CK5A 3STCA 3GRIA 2TMDA 1BQCA 3M5XA 4HU8A 1VC4A 1XDJA 4G7FA 3W1TA 3SFWA 3EXTA 1DXEA 1H5VA 5A8GA 1OCJA 2YBVA 1L2QA 1TVLA 2ACSA 3QY6A 5ABFA 3EMCA 2I5IA 1AJ2A 2CEQA 2NT1A 3NPWA 3CUFA 4ICCX 4Q8QA 3U7BA 3IV8A 3AMGA 4JKLA 2QF7A 1WV2A 3BZJA 2WHLA 2BTMA 4REQA 2ZCGA 3V5OA 3SCOA 3L4TA 2BXYA 5EB8A 1RCOB 3K5XA 1K9EA 1X1ZA 3P2VA 1Z44A 3EMQA 5HK4A 4XUYA 2YKKA 4PRTA 4URIA 1XR2A 1ODUA 3CBWA 2J47A 1ZP4A 3QZ6A 1D8WA 1X96A 1DWFM 3EWWA 3N34A 1G4TA 5T26A 3W7HA 4Q6JA 1Z9AA 2ZTKA 4XISA 2YPIA 4O0QA 4GXWA 1QK2A 2WNQA 2EKCA 3LMZA 1BVZA 3BLIA 4O54A 3T09A 4ZXOA 3UETA 2WQPA 1FDYA 4XB3A 4DBSA 4DLFA 4KBXA 1R2RA 3CUXA 4QJ4B 1EDTA 2ZUSA 4C60A 4GINA 3IACA 1UA7A 3W1XA 2WJZA 3CEUA 4NQ1A 2DT0A 2WBKA 3SCRA 3BWWA 4JIPA 4CQ9A 4Z2GA 1XXXA 3ARTA 4JIRA 1QFEA 3ABRA 4YHEA 3NSNA 3USZA 5HWJA 3TN3A 3ZR4A 3MCNA 5FIPA 2EO7A 4XZ9A 4WXZA 3FFSA 3QV9A 1VH7A 2V2CA 4ZMGA 3GIQA 2X2YA 5AKQA 4Z2KA 1H63A 4HCDA 1YRRA 4LBSA 1KD0A 1FP9A 3GKAA 1N8FA 4E4UA 5CLTA 1QO2A 2R24A 1MW2A 2OPJA 5D04C 4A3HA 1LRTA 1GORA 3SBFA 1XPGA 3AS1A 2HVOA 2NXGA 3VX1A 3I4EA 1XL9A 3G0SA 5EMUA 4MYXA 1S2UA 4MY9A 3W7IA 2Z1WA 3T08A 4AYGA 5CAHA 2G3NA 3DERA 2VC7A 3HOJA 2AMGA 2VCCA 2NZLA 3M46A 5RUBA 1OYBA 4QISA 3TTSA 4NNAA 3RR4A 1EC9A 2GWNA 3TSBA 1JQXA 4PR4A 3N6JA 1B57A 2Z27A 3SSZA 3EX3A 5J04A 1V0MA 3ANUA 4ZENA 3UA4A 4NYUA 3IANA 1YXDA 1PCKA 3NPVA 5AHNA 1UD4A 3LN3A 3F4WA 1H0IA 1K9FA 2E4TA 3HG3A 2WMJA 4A29A 2OSXA 5IBXC 3GBDA 5FCZA 1GEHA 3GXTA 3NPXA 1DXIA 5C55A 3EWBX 4P61A 4DELA 3USBA 4AMCA 1S3HA 3U3HA 3BLPX 4JAWA 3QKEA 2V3EA 5A6JA 3BAWA 4DWSA 2XGBA 4XD3A 1XS2A 4H7ZA 1FP8A 2Q8ZA 4Q22A 4H01A 3F03K 3KVLA 3LCLA 2QVHA 4W89A 2Q71A 4NAEA 1KWKA 1LBLA 3W2UA 1XD1A 1DL3A 4GYPC 1ADDA 4UZSA 2QCMA 3LXBA 3QSRA 1L6SA 5CPQA 4DWDA 1GGOA 3L21A 4N02A 5CG0A 3DC8A 2XM1A 5TAOA 4A8RA 1I60A 1W9XA 3VFLA 2XG9A 1J8VA 2AQWA 4PH6A 4JTUA 4ZQMA 1TV8A 1ZAJA 3G77A 5HNNA 4DHGA 3LCHA 4B2DA 3B9DA 3VE9A 4GC3A 2X1UA 1XGEA 4IX2A 3CPUA 4KF1A 3F4CA 1OEPA 1UKQA 4I7UA 4P2VA 2PCQA 1FXQA 1MRQA 4UR9A 1M1BA 3BLDA 3VGHA 1JD7A 1UQYA 2RGMA 4PMNA 5C9UA 5A6LA 4O4VA 3MANA 1K4GA 2FFIA 2I56A 5EMKA 3V3WA 2X05A 4M0XA 5CJ5A 1CB7B 3C61A 4YHGA 1UKPA 2VRKA 1MSSA 3T44A 4AMAA 3VCRA 2ZADA 2W0UA 4K39A 1QNOA 1SFJA 5LGZA 4OFCA 2BASA 4JTFA 1WKFA 4Y96A 1BYAA 4MNKA 1GPFA 1LM1A 1E6RA 1A0DA 4M3PA 4DWSD 4MFDA 4JKKA 3KOWA 2Q8XA 2P1FA 4G5DA 1MQQA 2ZRZA 1HP5A 4IPNB 4US6A 3HZ3A 3MJYA 2EQDA 4FR1A 4G7EA 2DUZA 3BQ5A 3KWXA 4HCLA 1OWQA 4E3VA 4DZAA 4MB5A 2R14A 2GUBA 3HFTA 4Q7NA 3UVIA 1LCOA 4PUEA 3I65A 4Y9AA 2PTDA 1A5OC 1Q8AA 2HXTA 1GONA 4W85A 4BI7A 3VKJA 3WIJA 2CXGA 4B2DD 4L9XA 3W1QA 4D71A 1F8MA 2YJQA 2X16A 4Z1CA 4UTHA 2MANA 3NA8A 5I07A 2XPKA 2ZX7A 2GK1A 3DOPA 1TFVA 2NSOA 1VYRA 1PX3A 1ZALA 2A1YA 1NAL1 3WF2A 4YTTA 4Z1BA 5CLWA 5J5DA 4U2YA 2VEGA 3KHDA 2DZPA 2A6NA 1RCQA 1VHCA 4WGXA 3JS3A 3MSYA 2I1OA 1DE6A 3S3GA 1F3EA 3C52A 1E0VA 3S2JA 3FEMA 3N9KA 1VEOA 3EB2A 1VRDA 1WBHA 4L61A 3N6HA 1RK6A 4AWTA 5CGQA 1E51A 3VYLA 4RUBA 2WXDM 1XWYA 5A8OA 3ZZ1A 2QIWA 3WNOA 4IIBA 3RG6A 3GBEA 1YEYA 3CHVA 4GQBA 2WVTA 5F4WA 4GUHA 1E9ZB 2ZUNA 2ZFAA 3QV8A 3H70A 4XV0A 4RZ4A 3IK4A 4GQ0A 4FP1A 2GGHA 4ZQPA 3W1NA 2C0HA 3FX4A 2GPTA 4HYWA 2IQDA 3DGBA 3QXBA 2NQZA 1SZNA 3A4AA 1SQ7A 3W1AA 1UR2A 2PDFA 1MEWA 3F2DA 3RF9A 4CNTA 1TPEA 2FB3A 3W87A 5MF5A 3O6DA 4LYKA 1JPKA 4DVOA 1K8CA 3NPUA 1UYQA 3R1ZA 1FQ0A 3V4BA 2XVLA 4G9PA 4MLJA 2RH9A 2O7QA 4DZ5A 3HGJA 3WUBA 2D23A 3DXIA 3L2MA 1KXTA 2PGWA 2P0IA 2HVMA 3SSJA 4Z2JA 3TR9A 3AJXA 1M6JA 2J27A 4WUIA 4DJEA 2HRWA 7XIMA 3UPBA 3VDHA 4X9SA 5FJJA 3EB3A 4JQ3A 4ERAA 4CU7A 2O92A 2CKSA 2E9BA 1XLDA 4IGSA 1R3WA 1PZ1A 1O94A 3T7VA 1R46A 4ORIA 4HSNA 5LXEA 4UC5A 4L7ZA 3CUIA 2DZTA 4Y8FA 5KEZA 1I9CB 4YL2A 3CHEA 1XRVA 3AHYA 1S1RA 4IH3A 1AODA 2XSBA 4IG2B 1WXZA 2F38A 3BLOA 1PIFA 1QVBA 2DIEA 3JRKA 3AIEA 4UFJA 3M0IA 2GQAA 3CT7A 3LPOA 4Y9NA 1UOKA 2TSYA 3GDKA 4B3ZA 4ZXLA 2BV9A 1HNYA 1G4SA 1PS9A 3H4XA 4O13A 5C9ZA 1RUSA 2VCAA 2FHBA 4XZHA 2QCDA 2QT3A 1R3YA 4H9YA 2WBGA 1W56A 3TZNA 3FGCA 3MSGA 3SUTA 4NP7A 4KRUA 1BFNA 3TQPA 4BI5A 3VD4A 3B8VA 5H8PA 2DV0A 3UCCA 3TOPA 5JQ9A 3S1UA 1M3UA 1GYMA 2GQ8A 3LTYA 3EPNA 3C2VA 4LS1A 1YNYA 1CLKA 2VX4A 1QU4A 3VINA 4K3ZA 4L6OA 3BSHA 1QXLA 1WKEA 3W22A 1J6OA 2XFFA 3GQYA 4B9ZA 5BOOA 4DJED 2D2OA 4GZJA 4WVXA 1CI1A 1GVRA 1HW6A 1KM5A 3WDIA 3HQPA 4GBUA 2FIQA 1CXHA 1TPUA 2DIJA 2VFGA 4DY1A 3U2EA 3UNDA 4L1WA 2V2DA 4F9DA 5I03A 2Z1VA 3N11A 3W86A 5JH2A 3AQUA 4JD4A 1JDAA 4LANA 4Q4OA 4E4PA 4JGDA 1FHLA 1POJA 4RNIA 1J93A 3URQA 3I3BA 3NQ8A 5AYYA 3IIVA 2RJHA 3LHWA 3CZKA 3CLMA 2TODA 3HN3A 2W91A 3VA8A 2BY1A 5HWNA 4YTSA 4M29A 1O5RA 4WD0A 3XIMA 4POCA 3UA3A 3SQMA 4TX8A 3ZT5A 5CC7A 1W32A 4AZIA 2E77A 3R58A 3DAQA 4W84A 4HP5A 4N6EA 4N9CA 3IVTA 2X0HA 1TG7A 2RGLA 1XICA 3L2IA 1KR0A 1WA3A 4FX7A 1CT5A 2CWNA 3N13A 4UOQA 2NQHA 3SRHA 4H7CA 2R1LA 1J01A 4ICNA 4EPEC 1KM0A 1KXHA 1W31A 3ONCA 3LI0A 4CCCA 5KZDA 1XG4A 2WC7A 1VBUA 4EF9A 4BQ5A 4PUWA 3UPWA 5AYXA 4W8LA 4ZB5A 2G41A 8CGTA 4NRRA 1YDOA 4JEJA 1UUQA 4GGBA 1RJPA 1PHWA 3N04A 4HSOA 3TVAA 5IFPA 2FFCA 1ZCCA 2ZC1A 7ODCA 4RDYA 1GCYA 2AKMA 2Y2WA 4GXPA 4IJCA 1FWJC 1UIPA 4K7VA 1XLEA 1TX2A 3NM3A 4I7VA 2WKGA 5DO8A 1ZAHA 1KBBA 1CDGA 4GCAA 1R3VA 5CSRA 3M6YA 2QUMA 5A2CA 5D8ZA 2PGFA 4YLWA 3E2VA 2Z29A 2PDJA 1JCMP 2A3CA 2AMXA 3SFKA 3VO0A 4O18A 5K4ZA 1EKOA 2CESA 5BU6A 1WZKA 1E9IA 1WO2A 1EQCA 4GGHA 3EXSA 1VYPX 3WLTA 3WLSA 4QTGA 4TMBA 2QCGA 4US5A 3WQWA 3ZQ9A 2Y5SA 2PDMA 3ITCA 2D69A 1TJRA 4DZIA 3DX5A 3WQEA 3UU0A 2INEA 2FZMA 3WH6A 4PCNA 3LX9A 4OJYA 1XYAA 3WSUA 3H22A 2P8BA 4J27A 3DFOA 1JXJA 3AISA 3BJFA 3G8EA 5C2GA 5KINA 4XKYA 2EAWA 4LGXA 4W5ZA 2PDGA 4QROA 5LIWX 3RPDA 4KEVA 4FO4A 3CL7A 1QW8A 3G24A 4AD4A 2PF0A 4MJMA 3W6MA 3QR3A 1J0YA 5F1VA 5CCZA 3RDKA 3VIGA 3WLJA 1F5ZA 1ZGDA 3KS6A 1GZGA 3BG9A 1MFVA 3NQAA 2E6FA 2ABBA 3LPPA 3BLKA 4GK8A 1P0KA 3CAQA 4IUGA 4LVAA 1V93A 2PZNA 2Y62A 1M7JA 2XN1A 5D8WA 1E43A 2BVYA 4LNCA 1OF6A 2BVTA 1V02A 1MNZA 1QPRA 2PU1A 5IXEA 4IL2A 3W7DA 1OCBA 1GT8A 3GG0A 3C2RA 1Z89A 3N1AA 3GU9A 4PSPA 1KFLA 4US5D 4OIFA 3UFYA 3GH5A 2PD5A 4D8ZA 4XIMA 1UH3A 3VDAA 2J25A 2EPMX 4YS1A 1XYLA 4JFWA 1W17A 1L6WA 1JPHA 1EP1A 5FF2A 1BHGA 4GIRA 2PLMA 4FLRA 2X0SA 4QJ5B 3PZUA 2PTZA 4FLOA 5U4NA 3WK3A 1BF6A 3BARA 1OG6A 1UR0A 3C3NA 4DAIA 2VQUA 2J88A 4F0LA 3W01A 2IUZA 2ZKMX 1PUDA 3NQDA 5E1QA 2VOTA 4LAMA 2VKZG 2Y24A 4TVUA 1HJWA 1K6WA 3MVIA 3LNMA 3TX9A 1VBGA 1OY0A 4K8HA 4C5YA 3QQ0A 2V3DA 4NJJA 1WAUA 1QW9A 1D3CA 2O9PA 1V79A 4LRSA 4HGXA 2WJDA 3HPXA 1JAEA 1FXPA 1Q65A 2OELA 3WD4A 3WLKX 1B9BA 1VLIA 2BHUA 2VDGA 4IPJA 5H2ZA 4NJIA 2V2HA 4CVUA 2NV2A 4OV9A 4N4PA 2WB5A 3WD0A 2WVVB 2YW4A 3OW1A 3A9BA 1IHIA 2PURA 2QMKA 3IGXA 2ISWA 4JN7A 4S39A 3THAA 4ZOEA 2NQJA 4U5KA 4PMUA 3WDQA 3FHQA 4R85A 1H1ZA 4XTDA 3PSVA 4G1KA 3KW3A 1W1ZA 3UD6A 3N2MA 2QLYA 1WCGA 1Q4WA 2XFWA 3QV7A 3ARZA 4REQB 5XINA 1O5QA 4PMXA 3DHUA 1F73A 1BYDA 1QDSA 4BWLC 1UA3A 1P0BA 1FX6A 5CJMA 3BC9A 5G4HC 1TPC1 3I4KA 1BWVA 2GVGA 3GFZA 2PLJA 4PGLA 1O12A 5HMFA 4F0HA 1P6WA 3MKKA 1XIEA 3MWCA 4PBGA 2E1DA 4QDMA 2CZVA 4ZTYA 4LX4A 2HQAA 4N2YA 4P7QA 4AWUA 2QV4A 3I10A 3L66A 1K77A 3UZWA 1SGJA 2EG7A 3BAJA 5DXXA 5JIPA 1JCXA 4RKAA 5C54A 4IZGA 2QPSA 3MY9A 3AXMA 1CEOA 5I79A 4EACA 3ZMRA 4UTMA 1TKKA 1RLDA 1EWDA 2CZFA 4FXJA 1JUBA 3MWAA 5HOSA 5GPRA 5FF7A 5F4XA 1EF2A 1K02A 1QI3A 5CPTA 4D6GA 4WSKA 1X97A 3ZIZA 2PB1A 4QLLA 3FJ6A 3WBYA 3DU0A 2BGQA 3IS4A 3XISA 4O0ZA 1NWRA 4LH8A 5BRBA 4B5SA 3QGAC 5JUVA 1K70A 2FGLA 5XIMA 1Q6CA 2VFDA 3ZWSA 2VURA 3FA4A 4AEOA 2H3DA 2XH2A 2GGIA 2O7SA 1A5MC