2NUYA

2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
288
structure length
288
Chain Sequence
MEIISPIITPFDKQGKVNVDALKTHAKNLLEKGIDAIFVNGTTGLGPALSKDEKRQNLNALYDVTHKLIFQVGSLNLNDVMELVKFSNEMDILGVSSHSPYYFPRLPEKFLAKYYEEIARISSHSLYIYNYPAATGYDIPPSILKSLPVKGIKDTNQDLAHSLEYKLNLPGVKVYNGSNTLIYYSLLSLDGVVASFTNFIPEVIVKQRDLIKQGKLDDALRLQELINRLADILRKYGSISAIYVLVNEFQGYDVGYPRPPIFPLTDEEALSLKREIEPLKRKIQELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate a
publication title Biochemical and structural exploration of the catalytic capacity of Sulfolobus KDG aldolases
pubmed doi rcsb
source organism Sulfolobus acidocaldarius dsm 639
molecule tags Lyase
total genus 115
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nuyA00
4NJIA 1I2PA 4JIPA 3BLFA 1B9BA 2EHHA 1X8FA 1GVRA 2GQ8A 4UTKA 2Y7GA 5D05A 1XBVA 3CPRA 3KXQA 2X1SA 4LOCA 4S2BA 3TW7A 4WOQA 4UTMA 1Q6RA 2J9XA 2WNQA 1XUZA 4JTEA 5CGQA 4ZZ9A 1S3HA 5AHMA 4Z1BA 3I6RA 1VLWA 5D03A 1LOLA 2DZPA 3GDKA 4IX2A 2JKPA 4KFOA 2B0MA 4KKXA 3DENA 1XL9A 1JUEA 1TYGA 1XC4A 3EX2A 3MUXA 4FNRA 2RDTA 4FX6M 5EPDA 3L0GA 3EX4A 4O15A 8TIMA 3F4WA 3C6CA 3NL3A 3FS2A 1I2QA 1AW1A 2GVLA 1YADA 3IV3A 1TQXA 1IXNA 4HNUA 5LKYA 2CLHA 1O5XA 1VH7A 1G4TA 4A2RA 2GJNA 2G97A 3UWZA 1T8XA 3W72A 4XKYA 4GE8A 2J88A 2QJGA 3W2NA 4AMAA 4ICNA 4Y8FA 1TRDA 1HUVA 3BK0A 5HJLA 2V2DA 1L2UA 3C2EA 1RQBA 4Z0JA 4HNTA 4EF8A 4WQ6A 4WY0A 2OT1A 4TR9A 1I8JA 3FLUA 2E5DA 3QQ0A 1VCFA 5AHNA 4FHAA 4E2DA 4TX9A 4FNTA 1ME8A 4OE7A 4XKYB 4HNVA 1YTKA 4IQLA 3TJXA 2I14A 4LNYA 5FF7A 4JX5A 4PODA 2X1TA 3LOTA 3MI2A 3LCHA 4FIRA 1LRTA 4JDYA 3GZ3A 4RZ4A 3L2IA 3BW2A 3PSVA 4WY0B 2VENA 3TDFA 4O28A 1KM6A 3GYEA 2DZSA 5KZEA 3L0KA 3A21A 2HSAA 3HQ1A 3SFKA 5K9XA 5D2TA 3BG9A 3PB0A 4I7VA 3TW6A 4TO8A 3B0VC 1VQTA 3M9YA 2HMCA 2D73A 2NUWA 3M5XA 2QCGA 2QAFA 2ZRZA 3W2JA 1XXXA 5G4WA 1P5BA 2C13A 4DBEA 5F4WA 3UZ5A 1P0KA 3D0CA 2X1UA 3EX3A 5I3HA 3GNDA 3LXBA 1W3TA 3C0JA 2QAPA 3CEUA 4AHQA 3LHZA 3PWAA 4QSHA 2CLLA 2FIQA 4O13A 3G1HA 3NG3A 4YCOA 1TV7A 2Y70A 5HR7A 4UMAA 5CSSA 1ME9A 2Z1BA 3QJAA 3O05A 1GVQA 3NQDA 4MVAA 4EIVA 3WJWA 1E51A 3FFSA 1QO5A 1KM5A 4RLIA 2F7FA 3G1FA 4FEZA 2Y88A 4HSNA 3NM3A 1LCOA 1GWJA 5D38A 3WFAA 1J2WA 1W5OA 4HSOA 1K8XA 3DFOA 1SSGA 2HS6A 5D04C 1U83A 2DJLA 4JICA 1SO6A 2WO5A 3TE9A 1VHNA 3E0IA 4DO6A 3G0SA 4O50A 1I2NA 3PM6A 3M5VA 3IIVA 4QITA 4JTFA 1KTBA 2CLIA 1TPDA 3A5VA 1LP6A 4ZL1A 1HG3A 2DORA 1VS1A 4LVDA 1SUXA 1QMLA 1QPQA 2YX0A 2VEIA 5D33A 1VYSX 1YXCA 4CQ8A 4YXGA 3HGSA 5CKSA 1FWSA 1TPB1 1WOAA 3GAYA 3LCXA 1IIHA 1MEHA 4C1KA 4HIBA 1WA3A 4JYFA 4X9SA 4LRSA 4JTUA 4FNSA 3TQ0A 4BR1A 3K30A 3PS7A 3ANYA 5AYZA 4MZYA 1OK6A 5D30A 1Z44A 2VKZG 4WZHA 2P1FA 4UFIA 3HGJA 4AWTA 3B04A 4IUOA 4Z0SA 1X1ZA 5LNRA 4PTNA 1L9WA 5F4XA 2H8XA 4IGHA 1AK5A 1EUAA 1T96A 4MPQA 2O7QA 3QSRA 3G1XA 3GLCA 3M5ZA 1TIMA 2NWSA 4XWUA 2V82A 2P10A 1FCUA 1XBXA 1NVMA 3P84A 3ZWTA 3G3MA 1CI1A 3W7EA 3USBA 2ZCGA 2YFOA 1KFLA 1JCYA 3MI6A 5DBTA 3NZ1A 1N55A 4FXRA 1TSIA 1EEPA 4CCDA 4Q33A 2ZTJA 1PIIA 2CFFA 1ZNNA 1YPFA 4WUIA 5DY3A 3G1SA 3G22A 4QIUA 1H63A 3TROA 1ZFJA 3O6DA 2EAWA 1QWGA 3UZJA 2FTPA 5C5YA 5E93A 1GVFA 3UWYA 1FUYA 5FF2A 2TYSA 1T99A 1FDJA 1KM1A 2H90A 4GUJA 1YPIA 1TPC1 2B4GA 5L9FA 3G0XA 1H7NA 2FQIA 4ML9A 4N9EA 3NOEA 4LS1A 4RZ5A 4UTWC 3T4CA 1M6JA 1TO3A 2CLEA 2YXGA 2ISVA 2C15A 1KLZA 1LLZA 1W5NA 2BX7A 3U6WA 2FFCA 3LCIA 1L6YA 4AH7A 1A5AA 1JCLA 5CZJA 2A4AA 1PHWA 3C56A 2C14A 3EWYA 5AYYA 5CPNA 3DFNA 5E0KA 1ALDA 2AGKA 4H6KA 1SZFA 2WJZA 3NQEA 4N6EA 4B5NA 3EB2A 5D2YA 4TMCA 3MW7A 2AAMA 3B4UA 3EXRA 2NXIA 4UTIA 1D3GA 2CLMA 4OHQA 4NJHA 1GTHA 3L5MA 1ICQA 5AHIA 5CSRA 1BKSA 3Q94A 4MZ8A 2ZZ3A 4OWGA 4K6AA 1F73A 3PULA 4LY8A 1Q45A 4RK8A 1K7XA 3WK3A 4OQVA 2YYTA 3O6CA 2JBMA 3VI2A 3G24A 3CC1A 5AC6A 5GVJA 2VELA 4NU7A 1TPUA 3LTPA 3F1QA 5FEZA 1OX4A 5K7JA 3TAKA 2G95A 4AB4A 1KFEA 2KZHA 3GKAA 4Z1DA 1PE1A 5AB3A 4ADUA 4AF0B 1QR7A 3TQVA 1ZAHA 2BZNA 1B4EA 5DN1A 5AN7A 5J5RA 1Z41A 4XBSA 4IXHA 2WQPA 3O63A 5EA9A 1ML1A 2VFEA 4YL2A 4K7VA 4FXSA 2X30A 3MJYA 5DY2A 3LXAA 4KWWA 2O7SA 3W86A 3NPUA 1SW0A 3G0UA 3L9CA 2C3ZA 3W74A 1F05A 1TJRA 1LLWA 4HNNA 3QMSA 3GR7A 3P8IA 4O11A 3N2MA 3W1RA 4NUWA 5AC7A 4AHOA 2V5LA 2ZZ2A 4IMDA 4LW7A 4PL2A 1QOPA 3M41A 3W2LA 3W1NA 2BXVA 3LBMA 2X16A 4UC5A 1K03A 4GJ1A 3TC7A 2V8ZA 1OX6A 5AOUA 3PBVA 3S5OA 3S42A 3MP5A 3S5NA 3LHWA 1DORA 4UTWA 1OYCA 1H60A 3TSBA 3NQGA 5F1UA 5H91A 3W85A 3LRKA 3SJ3A 1KFCA 3W7MA 2QUUA 3W88A 1OHLA 1I45A 3KOFA 1H50A 1DBTA 2Q8LA 2EPHA 3DFQA 1H61A 3W7RA 2EGZA 4QAIA 1NF7A 3H54A 2ZRYA 3HF3A 2CU0A 2BLEA 3A23A 1WXJA 3TV8A 1YDOA 3P8JA 1LRNA 4M5PA 3N9SA 3TR2A 3W07A 1SPQA 5HWMA 1M7PA 1IGSA 3OBKA 4L4LA 2G96A 1TTJA 2WOQA 3WK2A 1FQ0A 1FY6A 4WD0A 4U28A 3LLDA 2YDAA 3GIYA 4NX0A 2HS8A 1R30A 3PBYA 3PUOA 3NQ7A 1MEWA 2ZTKA 3W7CA 3SI9A 2RFGA 5K4ZA 3P74A 1LZOA 1B3OA 1OFAA 5I3FA 4GUHA 4DPPA 3NQ6A 1OVDA 1MXSA 3UWVA 2C1HA 2QDGA 4XTDA 1FWTA 3NXFA 3M47A 4ZQNA 2CZFA 4P2VA 3BO9A 3JRKA 4MIMA 2P0OA 1XFBA 3IVSA 2R91A 4FB7A 3SIZA 4LVFA 2E6DA 3L5LA 3NYZA 3HG3A 4XBKA 4BWLC 1EX5A 2ZRXA 4N6FA 1P1XA 3VCRA 2DJXA 3ELFA 3TSMA 3A5FA 2WPBA 3IVTA 4NVTA 3KFTA 1GOXA 2J27A 3W70A 1Z42A 4JTKA 4QJ1A 1TJPA 1DQXA 5DLCA 5K9CA 3OEXA 4KWVA 4OBTA 4JR5A 3ZR4A 1G4SA 1P0NA 1W5PA 4UR7A 1SFJA 4YMZA 2E68A 3S1UA 4O19A 1TREA 3LB0A 1LTDA 5KZDA 1T0OA 3W84A 4MYAA 3ABRA 1G4PA 3C2VA 3MWAA 3EXSA 3THAA 1YXYA 1IXPA 5D09A 5FF3A 1VR6A 3HG4A 3ZS4A 2BSLA 2NX9A 2Q3RA 4R7JA 1UUMA 1SFLA 1PL9A 1XDMA 1EP1A 3FYPA 1XCFA 3PVFA 5D37A 2PRHA 3R12A 3W7IA 5LGZA 1VPXA 3TFXA 1VHCA 4KFNA 3NL2A 5F2LA 3DI0A 3G1DA 3PG9A 2IQTA 4A22A 1W37A 1X6UA 1KLYA 1DQWA 3T78A 5LZLA 3W7KA 1EB3A 2LLEA 1UJPA 2UV8G 1SO5A 4UMCA 4LUJA 4X22A 4JTJA 3CEPA 3W1PA 1EP2A 5AYXA 1ICSA 3BVJA 3M43A 2JK2A 4DXVA 3F03K 3MI3A 3KAOA 1KM0A 1C29A 2FB2A 2OX1A 5I3GA 4MOZA 2BWGA 3V1PA 2ZQ0A 3AJXA 2FDSA 2DZTA 3T55A 3BW4A 3CB8A 3W7HA 2NV2A 1V5XA 4IOTA 4IMFA 2V30A 2DZUA 4UFKA 4O1AA 2ZFAA 4O4WA 2E5BA 1FX6A 1G4EA 3G1AA 3SY5A 3W23A 4ALDA 2ISSA 1ZALA 1DV7A 3TXZA 3LV6A 4GUIA 2R14A 3C52A 2GUUA 3HG2A 4O10A 2I1OA 3IIZA 3DI1A 3P60A 4Z1AA 5K9DA 3GB6A 4LVAA 3BGJA 1XUUA 3QPZA 3W7GA 1I4NA 1DL3A 3NQMA 3OVRA 2GJLA 3IIXA 1THFD 3Q2DA 4UTJA 4BK9A 1SZGA 1WQ5A 1RV8A 3UQNA 3MBFA 1VCVA 4UMBA 1SQ7A 1LRQA 4K36A 3P81A 4JN6A 1VCGA 3UXAA 2TRSA 3SR7A 1UCWA 3W7LA 4QISA 2W79A 1Q3NA 2ZA1A 4HKPA 1PVNA 4Q32A 4IMGA 1XBYA 2DZWA 3JS3A 3NQ8A 4HN4A 3L65A 4DEFA 4PH6A 3UD6A 4N9DA 1R2RA 1OK4A 4XTIA 3GX9A 3GR8A 5G2HA 3E96A 1WOBA 4DO5A 3KX6A 3DAQA 3MHGA 1JCJA 2VXNA 4LRTA 1Q6QA 4FO4A 4EF9A 4JEQA 1KM2A 3L67A 4FNPA 2ZRVA 4O57A 5TIMA 2C18A 3B06A 3W1UA 1UB3A 3WJSA 3NVTA 4O0ZA 1NF0A 5F2IA 5D02A 4A29A 3N3MA 2QEZA 1W8SA 4BI6A 4WXZA 4POCA 1YTEA 2GVJA 3IEBA 3G8EA 2E5CA 2NXGA 1OF6A 3NO5A 1SO3A 4N4PA 3P7YA 3C4UA 4GBUA 1F76A 1RQHA 1QDSA 3DHDA 3PC0A 3NQCA 3QPYA 3CM4A 4HPXA 2QJIA 3SZ8A 3O07A 3QYQA 4GRSA 1OFRA 3LCWA 2C16A 3M6YA 1DJNA 1FDZA 3P62A 1UUOA 3B03A 3M44A 4BFAA 3S5ZA 1TTIA 3MO7A 3DKLA 3HB9A 1QAPA 3SGUA 1SR9A 1GTEA 2ALDA 3P80A 4JXCA 4XQ6A 1ADOA 1XI3A 1LORA 3EEGA 1W31A 3EX1A 1F74A 1RR2A 4JX4A 3DGRA 3M16A 3NQAA 1VZWA 4N4QA 1P4CA 3CQ0A 4G1KA 1BEUA 4PCFA 1OG0A 2E6YA 1TPFA 1YYAA 4D2JA 3L66A 1TV5A 2F84A 3TAOA 3LRLA 1OX5A 4JYDA 3EXTA 4WJEA 4H3DA 1TB3A 2VEMA 1OFQA 1R46A 1R47A 2QR6A 1TRIA 2V5BA 5BMWA 1AW5A 4MY1A 2A6NA 3E9AA 1ICPA 5G2IA 5LSMA 1AL8A 1M7OA 2VFDA 2A21A 3W9ZA 5F2GA 1PCKA 1LOQA 2JGQA 4MLJA 2A1YA 3H53A 3RLUA 1H62A 3FOKA 5CPLA 3BPWA 5FESA 3LM7A 5F2MA 3SGZA 3GK0A 4DPQA 3L68A 3R5EA 3EWXA 4LVGA 4UTTC 5BRBA 3B0PA 2XN2A 1VJIA 3TU9A 4PA8A 2PRLA 1HFBA 1H7RA 4MKNA 3S6DA 1W54A 5U7SA 5L6UA 2V9DA 3QZEA 1VLIA 1TMHA 2H3DA 3NQ2A 2ZZ1A 4AXKA 3FA5A 4IMCA 4O17A 4NNCA 1AMKA 3S5YA 2Y85A 4ORIA 1EWDA 3TMQA 3ATYA 1TV8A 4ZMGA 3QW3A 4N2YA 5EKYA 1H7OA 1JRBA 1WBHA 3G1YA 1W3NA 4DF1A 2C0AA 1JVNA 4Z08A 1ZAJA 2G5WA 3IGUA 2C19A 1HTIA 1UASA 1X7FA 4E0CA 2W6RA 3TXVA 3P82A 4RXGA 2YYUA 1F2JA 1O5KA 3PG8A 2RHGA 3U8GA 3TSDA 4BI7A 5G4EA 2E09A 1TQJA 3EWUA 3HG5A 4ZQMA 5D2XA 3M1ZA 1EIXA 3MP3A 1K8ZA 1GG1A 5CZTA 5HR6A 4ZQCA 5DXYA 1ME7A 3QSTA 1LBMA 1KFKA 2E77A 3W22A 1KW1A 1BWKA 2FB3A 3R2GA 3UYCA 2QUTA 1K7EA 3NPVA 2YW4A 2AQWA 4MJMA 4JTLA 2Q8ZA 3PB2A 2DZVA 3KRSA 4LV4A 4LS2A 5IBXC 3CLMA 3W7OA 3NL5A 4A21A 4AHPA 5FI8A 3NGJA 3DFSA 3JR2A 1J4EA 4MY8A 5E1QA 5U4NA 3WK0A 2Y7FA 3P67A 3HO8A 3NEVA 3UNDA 4O14A 2V81A 3E49A 4GUGA 5HUOA 1PV8A 3N19B 4O53A 1V7YA 1EA0A 1G69A 1I2RA 2VFGA 2PRMA 3WK1A 4UTHA 1XDLA 4OV4A 3QMRA 5TBOA 1WDWA 4J9JA 1OX4B 2VFIA 1N7KA 5T26A 3MHFA 3GDMA 1F5ZA 5I3IA 2VC6A 3TJLA 3NAVA 3C2RA 1DOSA 2OZ0A 2QCNA 5EBUA 3BLEA 4UTTA 1PS9A 1OFDA 3CIWA 5HUPA 3S9YA 2VFFA 4LWWA 2CWNA 3BW3A 2QJHA 5EL1A 1HO1A 1BTMA 1WAUA 2JKAA 3C61A 1D9EA 3R8RA 1R2TA 2NV1A 3GDRA 2VOMA 3VFLA 3HBLA 4FNUA 4A3UA 1FXQA 3HJZA 4MJZA 5TQLA 4P61A 1ZENA 5KMYA 3RK8A 4DO4A 4UNLA 3QRHA 2FPTA 1KM4A 2VFHA 2A7NA 5FEPA 2VEKA 1KTCA 1DJQA 1OFBA 4I9AA 4RV8A 1RVGA 3CWNA 5C55A 1OFPA 4O4VA 3MYOA 4IX0A 4K38A 2WNZA 3FKKA 3CWOX 1SO4A 4M19A 1Z48A 1MO0A 3I7RA 3FIGA 2NWRA 3STGA 3TMLA 1R2SA 5HQEA 4Y96A 1DVJA 1GVOA 3UWQA 4MLRA 1N8FA 3H55A 4S2CA 1O94A 4ZQOA 2A5HA 3C8FA 3F4NA 2R94A 4ZQPA 5G2WA 2Z0IA 1VC4A 3KHJA 5CPMA 3YPIA 4CCEA 5AFDA 1TTQA 1ZJIA 3W87A 1KBJA 4LV9A 4EVZA 5ABTA 5LNWA 1O4UA 3LV5A 5HINA 5K4XA 3ABSA 2Y61A 2XFWA 4O1CA 1ZHAA 4BI5A 1NSJA 3W7QA 4PC8A 2DZXA 1YLVA 3W1LA 3FJLA 3CIXA 4I7UA 4UR8A 3LCLA 2V0TA 2RH9A 3T44A 3WJZA 4ADSA 4X2RA 3LCGA 3PR2A 4AAJA 2EF9A 3LHTA 1UBSA 3MMTA 5G1TA 2NX1A 5K3VA 1FWRA 1QOQA 4O52A 1AW2A 4O8RA 1K02A 3LHVA 2H6RA 5DCDA 1G7UA 3QM3A 3LERA 4UXDA 2CLOA 1FDYA 3L0NA 1CX9A 1IF2A 3A22A 2TMDA 3PBWA 4DF2A 4UUIA 2ZA2A 1QPRA 1KTNA 4Y6GA 3S0CA 3HMJG 5BMXA 4HHPA 3P61A 3EKLA 5CPOA 1PHQA 3TX9A 5HNRA 5FF4A 1KFJA 1U5JA 5D2VA 3KVLA 5C2XA 3W1AA 4DF0A 3PUEA 3QFEA 4JGDA 3FJ6A 3DFTA 3LHYA 1A5CA 2ATSA 1VYPX 4M7TA 1HL2A 4IXXA 1G7VA 5D2WA 3OVQA 4MYXA 3N9RA 4Q4KA 2ZYFA 1FXPA 1QFEA 4RJEA 3UY7A 1H1ZA 3M7WA 2CZEA 2ZZ4A 2RDWA 2TSYA 3L21A 3NPXA 1VGAA 3E12A 4RKAA 2QCDA 5BOOA 2Y6ZA 4N9CA 3S1VA 3CU2A 5CZ0A 1YDVA 3BG3A 3W1TA 4KFPA 4MFDA 4NQ1A 2OCZA 4O12A 1D3HA 4FX8A 4N02A 1IXQA 5K2ZA 1M5WA 3STEA 1OF8A 2Z2UA 4GNJA 4AWSA 1F6KA 4IPJA 2OT0A 5LGXA 4W9TA 2JGYA 2PCQA 4UFLA 1JUBA 5FF0A 2QCDB 1EWEA 4IPIA 2PE4A 3EX6A 3UWWA 4JX6A 2B7PA 2H3BA 3DH7A 1B4KA 1SZNA 3MP4A 1JCMP 3G1VA 3EWZA 3DXIA 3KVMA 1B57A 1KM3A 2RDUA 3C3NA 4EWND 2R8WA 2NZLA 1L6WA 4UFHA 2PC4A 3S1WA 2A2IA 3G3DA 2Y7EA 4LC8A 1LDCA 3BG5A 4LVBA 3OG3A 4JNMA 5HULA 1RQEA 1IIGA 4RR4A 4M7SA 2QUVA 5AC8A 2CLFA 1H51A 3KRUA 3N34A 2YR1A 3NDOA 3KVKA 3WJYA 2FPVA 1K8YA 1Y0EA 2TPSA 1MSSA 1VYRA 1JQVA 5D32A 3TIMA 3ZWSA 1GYNA 1LYXA 3TCEA 2ZBTA 3V75A 3HPSA 3BARA 4NZJA 1GT8A 5FEWA 4TMBA 1I2OA 5I3JA 1A50A 1JCXA 4BWLA 2J9YA 5EYWA 1GPWA 4WOZA 1K7FA 3IGSA 5LNSA 4ORMA 2ABBA 3W7PA 2A7PA 2GVGA 5LHEA 2QCMA 3EKZA 3W76A 1WBJA 3MBDA 4FIQA 4XUGA 3QH2A 3G8RA 1KFBA 5A8GA 4M6VA 4LTSA 1O95A 4IMEA 3TH6A 3TNOA 3EWWA 3M0ZA 4O0KA 2NLIA 2XN1A 2E6FA 1XKYA 3I65A 4JTSA 2Q3OA 1QPOA 1VRDA 1JULA 3DFPA 4YLWA 2ZA3A 3THQA 1SW7A 3C2FA 3W1MA 2NXHA 3IIPA 4Y90A 3N73A 4E2BA 3P5YA 4I7WA 4HT3A 4CQ9A 3HGRA 1G6CA 2QF7A 1TPH1 1G67A 1F7BA 1H7XA 3W7DA 3DKJA 4AVFA 1ZAIA 4AWUA 5CG7A 3T40A 4C1LA 1K3UA 1LBFA 3VE7A 2A85A 3GAKA 4WXYA 3TC6A 3O16A 2V2HA 2YGYA 5LHFA 5G5IA 4ONVA 2BTMA 4TIMA 1SU5A 4RX0A 3ZFHA 2Y63A 4K8EA 5BNKA 5KITA 4JD4A 3LGEA 3FKRA 4ZVJA 1GZGA 3STCA 3PF3A 1SW3A 3R13A 1CW2A 2X2GA 1QO2A 3P5ZA 2CZ5A 1KA9F 3DZ1A 5DXXA 1LM1A 3GXPA 1NEYA 3CT7A 1A5BA 4JY9A 3RU6A 4LC6A 4PFMA 3HIJA 3S8HA 1GYLA 2E6AA 1TPWA 3DBPA 5HWNA 4LUIA 2GQAA 4JDBA 1ZCOA 2QCEA 4NNAA 3RF9A 1DHPA 4TU1A 4QNEA 3W71A 4A2SA 3M5YA 2ZDRA 4QQ3A 5EMUA 2WKJA 3I68A 2YW3A 4OV9A 2QKFA 1FCVA 2V2CA 1PCWA 3A24A 4O54A 3W3OA 5MHBA 5KINA 2GPTA 3W1QA 3IGXA 2QCFA 5KTLA 1OABA 1EP3A 3O8AA 3E02A 4UIOA 1WX0A 3SSJA 3VKJA 3R89A 1ZY9A 4RZ6A 4Z1CA 4GUFA 3RMJA 4K8HA 2FPYA 5DBUA 1YXDA 3O15A 3GVGA 1W5MA 2OMAA 3LCFA 1X1OA 1W56A 2CW6A 2YFNA 4QM1A 4NXKA 4IWWA 1GJPA 4N9BA 1EPXA 3LI0A 4JYEA 1ONRA 4R34A 1SZEA 1O60A 4FNQA 1S5TA 1TTPA 5FEXA 3OIXA 4NXSA 3NL6A 4E38A 4NJJA 2WSYA 2NUYA 4O1BA 2HTMA 2ZZ6A 4HPJA 2QCHA 2ZZ7A 5DELA 3RFAA 5HMSA 3STFA 3I7SA 3O06A 3LTYA 2A0NA 3O6YX 3QEZA 3NPWA 4JTHA 4NX5A 2CZDA 4H4IA 4UNKA 1KV5A 4UTUA 2DP3A 1OYBA 3BV4A 1F6PA 2W0UA 2J24A 4NJKA 3QW4B 1S5VA 1FWNA 4UCGA 1FBAA 5EY5A 3UWUA 1H7PA 4MY9A 3L5AA 2WSQA 4R53A 4JS3A 3CTLA 3LLFA 3W7NA 4LU0A 3PUDA 2Z6JA 3LBCA 1C9DA 3NR0A 4YCPA 4DBDA 3FEMA 1QNVA 3QF0A 3W7JA 3QMTA 4K7YA 1A5SA 3OA3A 1A53A 3FYOA 4Y9AA 1AG1O 2ISWA 4JIQA 1WV2A 1Q6OA 3QC3A 3IIOA 5HWJA 2FJKA 2YZRA 2ZRWA 4RXFA 7TIMA 5LNVA 4FX7A 4MZ1A 1YTDA 4R33A 3NM1A 4O16A 3CHVA 3T7VA 5DCEA 1C8VA 1TCDA 1GVSA 1OJXA 3W2UA 4CNNA 3MHUA 1GQNA 1FCQA 1W3IA 3MYPA 2ZZ5A 2OJPA 2QCLA 3LX9A 3AO0A 2YCEA 3HOJA 1TPEA 2A6LA 5J5DA 3PAJA 2Y89A 2GOUA 4X3ZA 1LOSA 4JTGA 1J5TA 1JCNA 4UFMA 2ABAA 3HPZA 2B7NA 2I9EA 1DKWA 3N2XA 3UY8A 4QNWA 1L6SA 1FWWA 4WX2A 1H5YA 2A7RA 1MZHA 1FCBA 4ADTA 3B0UX 4O1DA 1NAL1 4WY0F 1EUNA 2FLIA 2J6XA 3B8DA 4CNOA 2C6QA 3KVJA 3DU0A 4YWIA 3VE9A 3EWBX 2VEPA 5AHFA 1XM3A 4DQWA 2ATMA 1LROA 4GXMA 4AF0A 1W1ZA 2B7QA 2H8ZA 5SWUA 4MFEA 3W2KA 4K37A 1QPNA 2E1DA 1OYAA 2NX3A 4NNBA 1JR1A 1TPVA 4BF9A 3TQKA 3WJXA 1YDNA 2B7OA 3IVUA 3NQFA 1H7WA 3HPXA 4OGZA 5LNUA 4K39A 3B05A 3NZRA 3GKFA 1GG0A 4S1FA 4AEOA 6ALDA 4U4MA 4DELA 1HO4A 1NFBA 4NJGA 2NUXA 1MEIA 1W5QA 2EKCA 3TUUA 1AL7A 3UPBA 4IJBA 4GC4A 3QQ1A 2XN0A 3LI1A 4M6QA 4UFJA 2YSWA 3PY2A 3NQVA 2Y7DA 2RKXA 2CLKA 3A9IA 3Q37A 2PURA 3O1NA 3VNDA 2WNNA 3W1XA 1RPXA 3Q58A 4CQAA 2DU2A 3LDVA 3U2OA 2GQ9A 2YPIA 2QDHA 1RZMA 3I7QA 4LT9A 3GXNA 1JRCA 1XBZA 3GDLA 4NZFA 3W2MA 3GDTA 2ZRUA 5A5WA 3W73A 3IRDA 5IM51 1QCWA 1JQXA 5AHLA 4OT7A 3SW6A 3RNDA 5KZMA 2WV8A 1OFOA 1KV8A 2J9ZA 3TFCA 4MUZA 4ZQRA 1Q6LA 4JTTA 2Y62A 4FF7A 1RD5A 3N14A 4UTLA 2WSRA 5CZSA 4OU1A 3ATZA 5F1VA 5F4SA 3W75A 4JTIA 2JKEA 3GNNA 5IBXA 4LS0A 4NT0A 4PEKA 1JJKA 1GEQA 3DHFA 3W6YA 3UPWA 3TKFA 3LHUA 3LXCA 2Z6IA 3S1XA 3ABQA 4M6PA 3UXDA 3G18A 3BLIA 1SSDA 3LRMA 1BWLA 4GFSA 5C54A 3OVPA 5BW6A 1IXOA 5I3KA 3W83A 3C2OA 5G1YA 5KSWA 5DCBA 1H1YA 1KBIA 5H2ZA 3KRZA 3OHIA 4XZ9A 3INPA 3PBUA 4CCCA 5C6MA 3TA6A 4EOUA 4CNPA 3HGOA 3GXTA 3NNTA 1S5WA 3RLVA 3SECA 3TK7A 2QCCA 1OFEA 4PL1A 4GWEA 1JUKA 6TIMA 1W0MA 4JY8A 1WYIA 4RCXA 4L4MA 3NA8A 3LTSA 1LBLA 3BGGA 3PSWA 3ABOA 2X1RA 4CLMA 5AHEA 4O18A
chains in the Genus database with same CATH superfamily
1I2PA 4B5VA 1B9BA 2GQ8A 4HBKA 3ZVHA 2OTDA 4LUSA 5D05A 4C5ZA 3CPRA 3HQNA 4LOCA 4WOQA 1RALA 4DJED 1Q6RA 1RPKA 2VHLA 2WNQA 3QLDA 4DAFA 1S3HA 5AHMA 7XIMA 1WXZA 3VC6A 2P53A 2BVTA 3GDKA 4QS6A 5A6KA 1R3WA 1DJZA 2Z7GA 2Z29A 4JQ4A 4KKXA 3DENA 4ZO6A 4Q4OA 3EX2A 1YNYA 3MUXA 3WSUA 5A6BA 2RDTA 4FX6M 3QR0A 2G3JA 1P0DA 5A2BA 3GRIA 3MS8A 5A8NA 4H9MA 1XPYA 4UOZA 3AC0A 4HNUA 2CLHA 2ZUSA 2ZVRA 1O5XA 1HN1A 2W27A 3PAOA 2VGGA 4GVIA 1E0WA 5I77A 3CYVA 4C6PA 2ICSA 1RUSA 2ZX9A 3CZEA 1S2WA 1H0IA 3BK0A 3C2EA 1I1XA 2E28A 2SFPA 4V1XA 1MUCA 4WY0A 4WQ6A 2OLAA 1I8JA 4GVHA 2E5DA 1JYNA 1VCFA 1FWIC 1ME8A 3PWGA 4XKYB 4IQLA 2I14A 1BKHA 4XZBA 1B1YA 2W9MA 3M0XA 1KR1A 3WKZA 3LCHA 2FKPA 4FIRA 5EBAA 4HMEA 1J0YA 1RK6A 3ZMRA 4ZTXA 5FL1A 2UBPC 2EJ1A 4PE8A 1EJUC 3GYEA 3T9PA 2DZSA 3N04A 3VIFA 5D2TA 3PWIA 2INZA 3PB0A 4MWAA 4ACYA 4TO8A 3B0VC 3MSDA 3W0KA 3WQFA 5BOFA 2D73A 3KRBA 2NUWA 1VFSA 3M5XA 2YLLA 2C8NA 1N82A 1CXLA 2PWUA 5AECA 4GFIA 3UZ5A 3VCNA 1QNSA 3WUEA 2X1UA 4QFUA 4L9XA 1W9DM 3KCLA 1YNQA 2FMOA 1YIXA 3VIKA 1W3TA 2HVMA 2QAPA 4HZ6A 3WY1A 3DBNA 3PWAA 3OQEA 4QSHA 3WNOA 1EOMA 3SQMA 1C92A 4ERIA 3NG3A 5J04A 2VL4A 3E6EA 5CSSA 1J6PA 1WKYA 4DB7A 3WDPP 1XLGA 4EIVA 5AC4A 1TWZA 3RGTA 2F7FA 1EH9A 3G1FA 3NURA 4US5A 3VC5A 3R10A 5LXXA 1FVPA 1P6BA 5D38A 4LCQA 3WFAA 1J2WA 1W5OA 6A3HA 1ZQ5A 5A2CA 3BAWA 1SO6A 1VHNA 4DO6A 3G0SA 4O50A 4WCJA 3H2AA 2R6OA 4JTFA 4M56A 5LA0A 1E72M 1TPDA 3ZT6A 1E3ZA 4F0MA 4J35A 1LL4A 2XINA 3B8UA 2VEIA 5D33A 4DWSC 1YXCA 5CKSA 1WOAA 1TPB1 1AJ0A 3CUIA 3GAYA 2VC7A 5DQPA 4D8AA 4CUCA 2UY2A 4GVGA 5C9WA 2YCLB 4JYFA 4X9SA 4LRSA 4JTUA 1F9CA 3ANYA 3PS7A 1OK6A 1PZ0A 1Z44A 4HA1A 4HMCA 1OGSA 2P1FA 4WZHA 3ALFA 4NAEB 4AWTA 1E15A 1XH1A 1IZCA 4Z0SA 1X1ZA 5LA2A 3E2RA 3IJ7A 1L9WA 5F4XA 3N18A 2GSEA 2O7QA 1T41A 1S46A 3GLCA 1ITCA 2OB3A 1TIMA 2UY4A 4AIBA 2P10A 3GU1A 9RUBA 4JCMA 1ZSXA 2IQDA 3PUGA 1MNSA 4IPPA 4UZUA 3W01A 2XTKA 1GONA 2HQAA 3VA8A 3URAA 4FOKA 1EEPA 4Q33A 4V33A 2C7FA 2ZTJA 1YE4A 1PIIA 2CFFA 1YPFA 1Z89A 3B0YA 4XG1A 1JYWA 3TROA 1ZFJA 1QWGA 3UZJA 5C5YA 3PTMA 5E93A 4GHRA 4H6QA 1FDJA 1AH0A 1U5VA 1O5RA 3BCJA 3T6CA 4ZODA 4N9EA 3NOEA 2DDXA 4LS1A 4UTWC 3BURA 4F2TA 1M6JA 4UWMA 3THDA 1S2AA 4TX6A 1LLZA 3UNTA 1E4LA 1L6YA 4AH7A 2X05A 3BWWA 4YYFA 2RAGA 4YNGA 1DTNA 4JQ2A 3CZ8A 1IR1A 3BOFA 1NU5A 4WGHA 1TJ2A 2PDKA 1KWKA 3MU7A 2AGKA 1VPQA 1ODUA 4AFYA 2QJMA 4DWSA 4NZ3A 5D2YA 4TMCA 2X0HA 3MDWA 2NXIA 2GVYA 2J7EA 4OWGA 4PMVA 2ZXBA 4K6AA 3WBXA 4LY8A 1ISXA 3T09A 1K7XA 3WK3A 3AXMA 2YYTA 1WB0A 1K9TA 3O6CA 4GISA 1DIKA 4H8UA 4JL2A 1XYLA 5FEZA 2G95A 2ADAA 1KFEA 2KZHA 3GKAA 4L56A 1UZHA 5AB3A 2D0FA 2P8BA 1O68A 5C71A 3S6TA 5KETA 1ZAHA 5DN1A 4RZBA 1Z41A 1TV4A 3EAUA 3DN5A 3GFZA 4K7VA 5FL0A 4FXSA 2X30A 5FJUA 3MJYA 3USZA 5HATA 2C3ZA 3OO2A 3W74A 5H1WA 3P14A 2NQ9A 1H0GA 2ZE0A 1CXHA 3JU2A 3SCWA 5J8LA 1L8PA 3MC5A 4AHOA 2ZZ2A 1UC4A 3KWXA 5A6AA 5ABFA 2BXVA 3WMCA 3LBMA 4UC5A 3GQYA 4GJ1A 2V8ZA 1OX6A 4KBXA 1HZYA 5AOUA 3VOFA 5MKGB 5AZ0A 1V0LA 2J7FA 4UTWA 3ECQA 4U3AA 2G37A 3GIPA 3T2PA 1HL9A 4PR4A 3AOFA 3LD5A 2ZVIA 5DMNA 5BWFA 1YHTA 1GVYA 4FLQA 1I45A 4MB3A 1V08A 3KOFA 1H50A 2EGZA 4QAIA 1WNOA 2ZRYA 3M46A 1BGGA 5A6JA 3AYRA 3AALA 1VFOA 3WMBA 3GSMA 3UCDA 3H70A 5HWMA 1IGSA 1TTJA 5ECUA 3WK2A 4J2PA 4WD0A 3LLDA 3KW3A 1EJWC 3CPUA 1OINA 1RSCA 2HS8A 3N13A 2BMBA 2J8FA 4UBPC 3PBYA 1PKYA 3NQ7A 5CBBA 3H8AA 1MEWA 2ZTKA 4JKMA 4GY0A 3U57A 4P8XA 5HNTA 1OFAA 2PWEA 3AS3A 1MXSA 3ABXA 3GXMA 3IUIA 2QDGA 1FTXA 2XZ7A 4XTDA 1FWTA 3VD7A 3C8NA 4ZQNA 5BXSA 1PYMA 4BCEA 1Q2SA 1YQ2A 4P2VA 3BO9A 2FGLA 3F2DA 4MIMA 2P0OA 4FB7A 4FSAA 1FOBA 2E6DA 2QXWA 4YN5A 2I17A 3HG3A 3POHA 3FCPA 4BWLC 4GQQA 4Z17A 4Q8NA 3H7RA 2GSHA 2HRWA 3V18A 3H12A 1VAHA 1X6NA 4DJEC 4MUPA 1TJPA 2QJNA 1ZCCA 3KTCA 4OBTA 1SFJA 4YMZA 3S1UA 3DFYA 4Q8OA 4KPLA 1G4PA 3C2VA 3BLKA 5C7HA 3U2EA 1IXPA 2O4MA 3HG4A 1FRBA 3A3XA 2PGFA 1UUMA 5BWAA 1SFLA 4XSMA 4J3TA 2PDYA 2CEQA 4UQAA 3PVFA 1RP8A 1MWOA 3VIIA 3W7IA 4ZOEA 3APTA 1VHCA 3IV8A 2OZ3A 3PG9A 2BBFA 4LBSA 4A22A 1X6UA 1IEVA 4S3GA 3TR9A 5LZLA 3W7KA 3RX3A 3MA8A 2VOTA 4UMCA 4ERAA 2WVUA 3LNPA 2HNEA 4X22A 2OYMA 4H2CA 2DZBA 3LPOA 4XZWA 8XIAA 1HIZA 2YXOA 4G7FA 2D2OA 5HK4A 3SCNA 1VFHA 3A47A 1KM0A 4CD5A 3ITTA 5I3GA 4AY7A 1AJ2A 2Z2BA 2MANA 1KKRA 3M0LA 1KC7A 1T7LA 3EMZA 1JNEA 4JZ5A 4DLFA 2I56A 2NQZA 1QI4A 2PP3A 4GLEA 4JHMA 4O1AA 2VP8A 1M04A 3NSXA 3VKKA 2GJPA 3NZPA 3WLIA 2UWFA 5A8MA 4I5RA 2E5BA 3W23A 1HX0A 4ALDA 5E0FA 1X6LA 3P60A 4IM4A 4WKFA 4EPBC 4LVAA 1RBLA 1XIJA 3W7GA 3QR1A 3H2FA 2GJLA 4E2VA 1TKKA 2OYKA 2PGRA 5M03A 3WL1A 3MBFA 2BG5A 3C86A 1LRQA 3P81A 1XCWA 4XISA 3ABZA 2TRSA 4FK9A 4QISA 1UP2A 1Q3NA 2WMIA 1PVNA 3PP7A 2DZWA 4GI4A 3NQ8A 3DECA 4FA3A 4M24A 4DEFA 1R2RA 3GX9A 3GR8A 1F6YA 5G2HA 4DO5A 3G6MA 2XWDA 1JCJA 4LRTA 1Q6QA 4FO4A 1J5SA 1Q6FA 3LENA 2ZRVA 2J25A 3W1UA 5JQ9A 2J7HA 3NVTA 4WKAA 3R8GA 3EEZA 1XLLA 3VGGA 4M29A 1QNRA 3W28A 1HNYA 1O1HA 2E5CA 4WJ8A 2NXGA 1OF6A 1VEPA 2OLSA 5DANA 3NO5A 1WPCA 1Q6CA 5M17A 3C4UA 4GBUA 3OOQA 1RQHA 3PN8A 1QDSA 3ZLGA 3PC0A 4PB5A 3QPYA 3CM4A 3CUJA 3O07A 3CYJA 4GC3A 2O92A 2C16A 3WQ6A 3M6YA 1US0A 1XF0A 4CN4A 3HPAA 4PMJA 3I3BA 5H8UA 2VZOA 3HB9A 3H2MA 3SGUA 2F38A 1GTEA 4S3DA 3I4EA 4WSJA 4XQ6A 5DMYA 3EEGA 1W31A 2PODA 1F74A 4D6JA 1EEXA 3W00A 4H7ZA 4JX4A 5CZKA 1L2QA 3DGRA 3K4AA 4TVCA 1VZWA 4N4QA 2VDIA 3N2TA 5CPTA 2OG9A 3MSGA 1BEUA 2PGEA 4LAMA 1PTGA 1TPFA 4QLLA 2F84A 4ZOAA 3P2VA 4JYDA 4H3DA 1TB3A 1FFQA 3AXHA 1NOWA 3GG8A 3BJFA 5BMWA 4DIAA 4G5DA 3E9AA 5LA1A 3V16A 3L2MA 2BGQA 1AL8A 1V6WA 3T0DA 2VFDA 3W9ZA 4CKQA 1CXEA 1LOQA 3K2GA 1XLEA 1GKRA 1H62A 2WC7A 1CB2A 3FOKA 3LM7A 5F2MA 3L68A 3EWXA 4UTTC 3TONA 2XN2A 3TU9A 2Y0FA 4PA8A 4LBUA 4PULA 4RW5A 1HFBA 1H7RA 1ZTVA 3I6TA 3ID7A 3R8HA 3P6LA 1VLIA 2H3DA 2WC3A 1V03A 3WLOA 4AVNA 4IMCA 3ZT5A 4JKLA 3WLPA 1EWDA 3HFTA 3TTYA 5FAGA 3CXOA 3UG3A 1UJQA 3G1YA 4Z08A 4KGLA 4D6HA 1X7FA 4LUTA 2BASA 4CU6A 4RXGA 2YYUA 4FLSA 1FH9A 1O5KA 4O8AA 4BI7A 3SCUA 3QPEA 3BLPX 2D3LA 1TQJA 4FAMA 3MP3A 3M6DA 3NDYA 1KRAC 1VFMA 4EXQA 1ME7A 3SAZA 4C6OA 4KRZA 1KW1A 1C8QA 1QNQA 2HXUA 4GVFA 1EQPA 1K7EA 3NPVA 4H7CA 3A6OA 2Q8ZA 4LV4A 3KRSA 4JTRA 1IT7A 3QN3A 5C9RA 3NGJA 1P1MA 3B97A 2O56A 2OQYA 4Z2IA 4D6IA 2VWSA 3DFSA 5U4NA 5E1QA 3OYXA 3BAIA 3BOLA 3P67A 1YBQA 2OGJA 1ADSA 4XB3A 2V81A 2Z1XA 4QAWA 3N19B 4O53A 3VDBA 1V7YA 1PZ2A 3UXLA 2PRMA 4JL1A 1EC8A 1XDLA 1EJ7L 3QMRA 2WWDA 1S2CA 5T26A 2DIEA 3GHSA 2WHJA 1A0EA 4J7RA 1QW9A 2VYOA 1NARA 2QCNA 4TX8A 1ZP4A 4ZO9A 4UTTA 1PS9A 3DCPA 4JFWA 2V5DA 4F0SA 2WZMA 1LT8A 2Y2WA 1FWCC 4LWWA 2CWNA 5B7YA 5EL1A 1BTMA 2JF6A 3PZTA 1Q6DA 3RITA 1D9EA 2NV1A 4JTQA 1PWLA 1H4PA 1EJVC 2CERA 3AUJA 1HXJA 3DYOA 1JD9A 4RV3A 2G50A 1BXBA 1EBGA 1X96A 2FZBA 4P61A 3UWEA 3RK8A 3QRHA 3WBEA 3JVAA 1QI3A 4AZCA 3S47A 4I9AA 3MSRA 3R25A 4RV8A 4YVXA 3CWNA 4AX7A 1OFPA 1F3WA 1XLBA 3ZSTA 3FKKA 4M19A 2R1KA 3DHUA 5HMEA 2NWRA 4W7UA 1KWGA 5HQEA 5CPSA 2PUZA 4Y96A 1JGMA 1N8FA 1OT1A 1B9ZA 2R94A 1A4MA 2Z0IA 5HNNA 2GUBA 4K1WA 1KBJA 4Y7EA 1BYAA 4P7RA 3K8KA 1O4UA 5K4XA 4LEQA 2XFWA 4CD4A 1K1DA 2W67A 4PB4A 1H41A 3APYA 2D2HA 3DEQA 4KQNA 4HMNA 4UR8A 3QKEA 2RH9A 4LQ1A 2BDQA 3PNUA 4RPPA 5BXRA 4AAJA 4DAIA 4CEXC 4M8UA 1UBSA 2Q09A 3D6NA 1W3HA 1XP3A 4FXFA 2REQB 1F61A 1Y65A 5AZ1A 2H6RA 1FDYA 2EG7A 3L0NA 1CX9A 1XYCA 3LS9A 2CHOA 3UR7A 3S0CA 3NIYA 1Q4NX 5CPOA 1W9UA 4NYYA 1E0TA 5FKYA 2BB0A 4DF0A 3FJ6A 3DFTA 3LHYA 1A5CA 3MANA 1H2JA 3T2QA 2R1MA 4GI8A 1E9LA 2ZYFA 1QFEA 2DQXA 1VRXA 5DT5A 2RDWA 4IMAA 3O0KA 1V3LA 3BLOA 3MT1A 3S1VA 4DM2A 1YDVA 2WM1A 4S3JA 3U9IA 2X7VA 3QTPA 2VDHA 1JDFA 4GNJA 2YDSA 3HQPA 4WHBA 4IPJA 3CNYA 4GYJA 5LGXA 4W9TA 3T0AA 5A94A 1A5NC 5FF0A 1S5NA 1EWEA 2PE4A 3P0WA 3CZKA 1SZNA 2INEA 3ITCA 3F4CA 4EKJA 2XH4A 1KM3A 2RDUA 1L6WA 2PC4A 2A2IA 3F5KA 3G3DA 3K8LA 2GJRA 1LDCA 1JAKA 4LVBA 2E9MA 3OG3A 4JNMA 5HULA 1IIGA 2ACQA 1MW1A 4RR4A 1V3IA 2EG6A 2CLFA 4PMYA 1H51A 3R0KA 3KRUA 3VNYA 2OLHA 4MNLA 3H22A 5HMDA 2FPVA 5FOOA 5FA5A 5D32A 3WZ0E 3VGBA 6CGTA 3OODA 1PIGA 3UYIA 1TR1A 3V75A 4PSPA 2G4FA 3RM4A 1V6VA 1AZ1A 4LYQA 1I2OA 2XFFA 1A50A 4M1BA 2AL2A 4IICA 4TUFA 4AVOA 3IGSA 3CUFA 2WZIA 1MI3A 3K46A 3AHTA 4IIHA 2GVGA 5LHEA 3V5OA 2QCMA 3W76A 5JH2A 1M7JA 1QI5A 1NM9A 1XICA 4QG9A 1KFBA 3MO4A 5A8GA 3SJNA 2VUNA 4GY7A 3EWWA 1SJCA 4O0KA 2NLIA 4A8LA 2E6FA 1XKYA 1ZJHA 2NT0A 2Q3OA 3GH4A 3DFPA 4YLWA 4Z2LA 2NXHA 4PMRA 2R1LA 4E2BA 3RHGA 3GXDA 2FH8A 5EFFA 2EQDA 3HGRA 1JPIA 3RLHA 3SB0A 2OODA 2QF7A 3MPGA 3CMJA 1K9FA 3SUSA 5GJNA 1DIOA 2VDGA 3W6LA 3T40A 4B5UA 1XIDA 1XG3A 3TCSA 2A85A 3GAKA 4V27A 3A4AA 5HA7A 2JE8A 4DJDD 2Y63A 5BNKA 5FCZA 1PBGA 4TV5A 5A95A 4ZVJA 1GZGA 3AIUA 1CLVA 1DE5A 4R3UA 3STCA 1LL7A 1SW3A 1OY0A 3UFYA 1KA9F 4BQ2A 3ZJ8A 3TTQA 4WDUA 1LM1A 1NEYA 1WZLA 2JFEX 1A5BA 1BVNP 4AX6A 1TMLA 3RF9A 2OSWA 4DN1A 1HKIA 4QNEA 1Q63A 1EGVA 1FWDC 5G1MA 3KP0A 2J74A 4GKTA 3I68A 2NSOA 3F2CA 5EMLA 4C6CA 4RNFA 4O54A 3IUHA 4W4QA 4ZB0A 4L6DA 4PUEA 3OZMA 1Z8AA 3SSJA 3R89A 2WHKA 4RZ6A 4IH3A 3VGEA 3BDKA 2FPYA 1MQPA 3O15A 3WDHA 1N2VA 1V8EA 1ZZMA 6TAAA 3LCFA 4AIOA 1X1OA 2CW6A 3L4TA 4NXKA 3WQOA 3LI0A 1FWBC 4R34A 1SZEA 1ZRQA 2X09A 3OIXA 3RILA 4EACA 1OZQA 4H6RA 2HTMA 2ZZ6A 1M41A 1VBRA 3O6YX 3EWDA 3NPWA 4JTHA 4BZYA 4H4IA 1KV5A 3JZUA 4H7VA 1L8NA 2DP3A 4LANA 1F6PA 2ON3A 2R24A 2J24A 4E3VA 3BAKA 5C2GA 3RRXA 5EY5A 3BZGA 4MY9A 2WSQA 2R1NA 1YPXA 2BY3A 4IP7A 3LLFA 1IT8A 4GH1A 1A5OC 1F4HA 3DUGA 3B8VA 2FHBA 3FEMA 1QNVA 1A5SA 1A53A 1EHAA 1OCQA 1AG1O 2ISWA 2AQOA 1GJWA 4KW2A 5HWJA 2ZRWA 4RXFA 4G9PA 5LNVA 3QHMA 4FX7A 3U48A 1XV8A 3ZO9A 2D3NA 3FXYA 1A0CA 4CNNA 3GNXA 4PMOA 3BAXA 3MKCA 2XM2A 1FCQA 1W1VA 8XIMA 1D8CA 3PAJA 4A3HA 3BH4A 1TZ7A 4X3ZA 2ABAA 1UKSA 1F8MA 5FACA 3ARRA 2A7RA 5EFDA 3V0TA 4YVVA 4C6EA 2PDPA 1GEHA 5AY7A 3WL0A 4KT2A 3EDEA 2OYLA 3REQA 1PIFA 2C6QA 5D9PA 3FSUA 2J79A 2J7CA 2YA1A 4IISA 4YWIA 3E0WA 4D6FA 1XM3A 3PPFA 1EBHA 2OX4A 2QPSA 4AF0A 3HPFA 1HJWA 1BD0A 3QV8A 2NX3A 1JR1A 3TQKA 3N17A 1VEOA 2CXGA 2A3EA 4L1XA 4D1IA 1H7WA 3HPXA 1XD1A 1WKFA 4K39A 3IJ9A 5DFAA 3GBEA 4AZHA 3WF3A 1HKJA 1BF6A 1TX2A 1UA3A 2BHYA 2CNCA 4QE1A 4C1NB 3W29A 1HO4A 1MEIA 1EXBA 3UPBA 3FVMA 4EPKA 1DWFM 3II1A 3VTRA 1SZRA 4GC4A 3ANUA 3WO8A 2XN0A 4M6QA 1GW9A 1I75A 2AGTA 3ZOAA 3KDNA 2CLKA 3KZSA 1EO7A 4M81A 2OWXA 4C6IA 1VFFA 2PTWA 3VDAA 3VM7A 1UWAA 2WNNA 3Q58A 2EBNA 4GO8A 2DU2A 4CQAA 2YPIA 2NLYA 1RZMA 3EBVA 3VKBA 1X7IA 2OO0A 2PBOA 4Q4MA 1IEIA 3V1HA 1DPMA 1JRCA 2XH0A 2PLKA 1ZUAX 2XIIA 3GG7A 3FEQA 4G7EA 2O0TA 3TA9A 5AHLA 1Y5XA 4GNVA 3F7JA 3OLEA 1XLMA 4MUZA 1Q6LA 4XVEA 4JTTA 2Y62A 5DMMA 2YKKA 4UTLA 4U33A 4R5EA 5FJOA 1LL6A 2P0IA 1A5UA 1EGZA 3WNMA 3GNNA 4S38A 1QWKA 2XGIA 5IBXA 3DHFA 3W6YA 4GZEA 2WZEA 1ZBVA 1GQLA 3CV6A 4EXAA 4Y2WA 3MUIA 4GFSA 1JZ7A 1ONXA 2CIPA 4KS0A 1MFVA 1EIBA 3RLGA 4ZSTA 1H1YA 5H2ZA 2JF7A 1JXKA 1ZL1A 3KRZA 3V7PA 3MB9A 4X9YA 4UCFA 4QHRA 4CCCA 5C2CA 4KEMA 3FK4A 3R0DA 1JAEA 3UR8A 1BSLA 2XVGA 2ZWYA 3BCFA 4HPHA 3KS5A 3GHTA 2VR2A 1W0MA 3KOWA 4JY8A 3WDJA 4FR6A 1WYIA 3R43A 1LBLA 3BGGA 3CIVA 3PSWA 1JPMA 3EOLA 2BHUA 3ABOA 3SY1A 4CLMA 4O18A 2IW0A 5CC7A 1E5JA 3JUGA 2Z26A 2VRKA 1X8FA 2NVDA 3H7UA 1SVDA 1XFCA 2Y7GA 2O9TA 3CHDA 4NI8A 3TW7A 4V15A 1E1CA 4UTMA 1KR0A 2FVMA 5EMMA 4R88A 3PZQA 3I6RA 1HJSA 1LOLA 2PU0A 3RR4A 1GQIA 2FJUB 3W02A 3WLNA 1OBAA 1JUEA 3C0LA 4K8GA 1EXPA 4GACA 1UZ1A 1MW3A 3TTEA 3L0GA 2YZ5A 2Y8KA 4F79A 2J13A 1PPIA 1JZ8A 3MVTA 3Q65A 7PTDA 3MV11 3MUCA 4BQ3A 1AW1A 3FN9A 1YADA 4N7QA 4XX6A 3SUVA 1D7KA 1TQXA 5LKYA 1W9XA 1VH7A 4UQBA 1DTUA 1OD0A 2G97A 3UWZA 1T8XA 2INFA 3OZYA 3L4VA 2PDWA 5FIPA 3ZLFA 3WD1A 4AIEA 4FLOA 4RE2A 2DVXA 4C91A 5HJLA 4MNJA 1O1ZA 1UG6A 2WC4A 4AUBA 1BYCA 4Z0JA 4HNTA 2BXZA 2Q02A 3LPPA 3EDJA 4FHAA 4I8DA 3LYEA 4FNTA 4OE7A 4HNVA 4QBXA 2AKZA 1Q5MA 4LBRA 2X1TA 4JFVA 1LRTA 1UWQA 4NIRA 1OC6A 3GZ3A 1WDQA 2PD5A 3PSVA 1NJJA 3FDGA 4ZO8A 3DG7A 4G1NA 2F2HA 3UT0A 1REQB 3ZXWA 4AZIA 2JEPA 1ITQA 3BG9A 4PGLA 1HL8A 4ATLA 1WUFA 3U5YA 3CAKA 3RPMA 3TW6A 1CEOA 4F40A 1VQTA 4A8NA 2HMCA 2DIJA 2ZRZA 3W2JA 2ACRA 1SJBA 1B30A 3BV7A 4GYFA 5FD0A 1Z9AA 3RXZA 3VXGA 3EX3A 1UMLA 2ZUVA 3GNDA 2GSJA 2I16A 3DYPA 4Q7NA 3AZTA 4US6A 2DZAA 3TYEA 1EA9C 4GYPA 1YW1A 1RJPA 2PCEA 2PEVA 4H9TA 4QLKA 3G1HA 1OD8A 4KH2A 4YCOA 1TV7A 3LGDA 4DJDC 4H2HA 5E6ZA 5HR7A 2XVPA 5E9AA 2QJJA 3UERA 3QJAA 4GNKB 2OQLA 1AQMA 2Z1WA 3NQDA 4YTRA 3WJWA 4CN1A 3WELA 4EK7A 1MNZA 3SSZA 2E25A 4DBWA 4Q8VA 5HNUA 2V68A 2XIJA 3BCDA 2YCKX 4IFOA 1QVBA 2GGEA 1LCOA 3BICA 4NF7A 1K8XA 3DFOA 2DJLA 3PM6A 3IIVA 1KTBA 4B92A 3VIPA 2XVNA 3KM8A 2XZ9A 1LP6A 1HG3A 1SUXA 1QPQA 4CQ8A 4YXGA 3HGSA 4PBGA 4OBRA 3HMCA 5M2FX 2VD8A 3TQ0A 3VD4A 4FNSA 5AYZA 1IT0A 5I02A 5D30A 4GCAA 1ZP3A 1WUEA 4HMDA 3LBOA 4M51A 1DXIA 4IUOA 3TW9A 4IGHA 2BGNE 4IIFA 1AK5A 2DH2A 4AYSA 1T96A 3BLDA 5E70A 4PRTA 4J28A 3GDBA 1UD4A 2PFHA 3ZLHA 2NWSA 4XWUA 2V82A 3BSGA 1NVMA 3P84A 3ZWTA 4ZXLA 5LXEA 4L7ZA 3W7EA 2YFOA 3SCSA 4CU7A 3OQ8A 3MI6A 5AYIA 4YIWA 1DHKA 1JZ6A 4WUIA 4JPGA 3G1SA 3T0BA 3G22A 4IQEA 5FAJA 1PKLA 1B0IA 3CZJA 3O6DA 4CVUA 2FTPA 1BQCA 3OLIA 3UWYA 7ENLA 1FUYA 3GTIA 4RNHA 4JTCA 1T99A 4Y9OA 1KM1A 3WH5A 4H00A 4QJ4B 4GUJA 1R9YA 3ITGA 4J4KA 1MXGA 2FQIA 3PJTA 4QGCA 1B90A 4RZ5A 9XIAA 1R8LA 2YXGA 2C15A 2BX7A 3QTGA 5AKQA 3U5UA 4LYKA 3RG6A 1PHWA 1CYGA 1IEQA 3EWYA 3NVDA 4XO6A 3DFNA 1IGWA 1W1B1 5E0KA 4GI6A 1ALDA 3S46A 3NQEA 4B5NA 2WMGA 1OADA 1A3XA 3VABA 3EXRA 4U10A 2CHRA 1D3GA 1TA3A 4OHQA 4NJHA 2XH2A 2CITA 5AHIA 4XAPA 5CSRA 1BKSA 4W89A 2ZZ3A 5E5CA 1NH6A 3LMYA 2FVLA 3AS1A 1TV3A 4HD5A 3VI2A 3BXWA 5AC6A 2V5CA 4NU7A 4AZ5A 5BCAA 5BU9A 3TAKA 4WSHA 4NRSA 1I1WA 4AF0B 2VZTA 4RPQA 1QR7A 2BZNA 3HTWA 5BXTA 1CCWB 4JFSA 1CGUA 4XBSA 3VKCA 5GQBA 4R7WA 1ML1A 2VFEA 4YL2A 5GJMA 1PDZA 4A8RA 1Q66A 2O7SA 3W86A 2VVSA 3WMSA 1SW0A 2JIEA 4BQ4A 2WK2A 2OEKA 1CLXA 3N2MA 4X61A 5AC7A 3GIQA 3VNZA 3M41A 3W1NA 1OEPA 3PBVA 4Q8TA 2UY5A 3SQLA 3TSBA 3NQGA 3W85A 1R6WA 3LRKA 3VMNA 1C7TA 2QUUA 4L64A 1G0CA 1QBBA 2VT0A 1U1HA 4HCLA 3WQDA 3BAYA 1H61A 1NF7A 1C90A 1TG7A 2CU0A 4G7EB 5HPCA 1WXJA 2E9LA 1YDOA 3P8JA 4LB4A 3FNDA 3N9SA 2HE5A 1E0VA 3TR2A 5GPRA 1SPQA 2WCSA 4NG3A 3OBKA 4L4LA 2G96A 2WOQA 3CB3A 1E1EA 3PJXA 4H1ZA 4JBRA 4U28A 3WQCA 2YDAA 3GIYA 1JZ3A 4QLJA 3O3RA 1R30A 1J2BA 3PUOA 1E9IA 4OKDA 3D46A 3SI9A 5K4ZA 4LAUA 1BVZA 2Z1SA 2DUXA 1LZOA 4H8NA 3VKDA 4AD0A 2CBIA 1M53A 4TV6A 3OGRA 2PDJA 1BWVA 2WVVA 1OVDA 3UWVA 2IKIA 3TJIA 2C1HA 3WQ5A 4RUBA 2GWNA 3NXFA 1XLAA 5E9XA 2HNHA 4HYWA 3WLRA 2DEPA 2O9PA 2R91A 1XD0A 3AHZA 3L4ZA 3FXGA 1E6PA 3L5LA 1JGIA 1OCNA 4XD5A 2RGMA 1EX5A 1P1XA 2BOGX 3TSMA 3A5FA 4YHEA 3ITLA 4NVTA 1HVQA 2AKMA 3W70A 4JTKA 4QJ1A 1P7TA 4PUMA 1DQXA 4GYKA 2JQXA 5IFPA 3D3AA 2CHNA 4IGSA 5BU6A 3OEXA 4KWVA 1LQAA 2E68A 1FKWA 4O19A 1TREA 4IT1A 1H1NA 1UP3A 1LTDA 1T0OA 3ABRA 3MWAA 1YXYA 3U4AA 1UA7A 3ZR5A 5PTDA 3VD9A 1XLKA 3WQ4A 3VGFA 2YDRA 3CHEA 5I09A 4J3WA 1ENUA 1XDMA 3FYPA 2ONEA 2PRHA 1VPXA 1WDPA 3MWCA 4KFNA 3NL2A 2W66A 1PZ3A 3DI0A 2DUZA 1W37A 3OGVA 5LIXX 3T78A 3AAMA 1I6NA 1VFUA 2UV8G 1SO5A 1WDRA 2PAJA 5CXPA 4JTJA 3EB3A 1L0PA 4H8VA 3CEPA 3W1PA 3OGSA 1EOKA 4US5D 3MI3A 1CXFA 3NSNA 4CD8A 2FB2A 3GUGA 4MOZA 3V1PA 3KBWA 3CUZA 3AJXA 2YJQA 1UD8A 3RX4A 3V3WA 4L1GA 3BW4A 3B9OA 3MZ2A 4IOTA 2CKRA 2IPFA 1GGOA 4L61A 2V30A 3OBAA 4HK5A 3IWPA 1BRLA 1Q6EA 4AZ7A 2V38A 1R85A 1B3YA 2BVDA 4DXXA 1QJWA 3UGVA 1FX6A 2ZX6A 1H11A 2ISSA 2RJHA 4Y8EA 4J5NA 1GKQA 3HG2A 4KGJA 3TVAA 4EPDC 1BGAA 2I1OA 3IIZA 1GORA 1QT1A 3GB6A 1G9HA 1WZKA 1QNOA 4PSRA 1I4NA 4NY2A 3CJPA 4WGXA 1THFD 3MUY1 3OZOA 4GXPA 4S3EA 1GVIA 3GFXA 6REQB 3UQNA 1VCVA 4O0QA 5IRPA 4K36A 5KZ6A 5HBFA 4DX3A 1GJUA 1E70M 2DPEA 3SR7A 1UPMB 2F6XA 2ZA1A 2PLCA 3TYBA 4IMGA 2J78A 4N9DA 4X2PA 1PX3A 1EQCA 4PB3A 3MHGA 3IK4A 2VXNA 3T0TA 1R9ZA 4JEQA 1TELA 3L67A 3PZOA 2OFJA 3TN6A 4UB9A 5TIMA 2D0GA 1UB3A 1NF0A 5F2IA 2QEZA 2R1PA 4BI6A 3AWNA 3BMVA 2GVJA 3IEBA 4LCSA 3ANVA 3CZGA 2E9BA 1EDQA 4N4PA 4AYGA 4Q4SA 2BY2A 4HPXA 2QJIA 1IV8A 3QYQA 4GRSA 4BY3A 1LUCA 3LLXA 4XKMA 3BC9A 5HQMA 4HPNA 4BS0A 3S5ZA 3T08A 3CLWA 1QAPA 1SR9A 3P80A 3FGCA 3UA4A 3LK6A 4HA4A 1RR2A 1DJXA 4WK9A 3M16A 1R3QA 3EOUA 1P4CA 3CQ0A 2GZXA 1OG0A 5GNYA 3EA3A 2NQJA 1TV5A 2OKTA 4J3SA 3TAOA 3LRLA 2O55A 2PC8A 2RGLA 2NSXA 2DSKA 5A8OA 4C90A 1R46A 2GK1A 2QR6A 2V5BA 2Y8UA 2PTYA 4IJRA 4WEVX 1ISZA 3H2EA 1ICPA 1M7OA 3VM5A 2A21A 3KUMA 3K13A 4DBSA 5F2GA 5JXQA 3VX0A 2CCRA 1ITUA 3U0HA 2A1YA 2H9AA 3H53A 3ARQA 2Z27A 1O66A 4C60A 3BPWA 5FESA 4DPQA 3R5EA 4GKLA 2FYMA 3WLTA 3AS2A 4MJ4A 2OWCA 4HP5A 2PRLA 3S6DA 1W54A 2XIQA 5L6UA 1XYAA 3TLLA 4DUVA 2NQLA 3QZEA 3B8TA 1M68A 2I57A 3GU2A 1TMHA 4GZ7A 4U5IA 2O9OA 3FA5A 3E38A 5DEZA 1S1PA 4O17A 1PYFA 1AMKA 1W9VA 4MADA 4JNZA 1NOFA 1OM0A 3PFRA 3VYLA 1Y7VA 1NWSA 1V3MA 4Q6JA 3ES8A 3LEPA 1XSKA 3B8IA 3H4XA 1GKPA 1W3NA 1ZAJA 2G5WA 1DXEA 1AUSL 1VFLA 2C19A 4ATWA 3IRSA 4E0CA 4E4PA 2W6RA 3P82A 1CXKA 3CTTA 1F2JA 1M7XA 2G41A 3TSDA 5G4EA 3NCOA 5HOSA 3EWUA 3M1ZA 1EIXA 1K8ZA 5CZTA 5HR6A 4ZQCA 3UJRA 4LXFA 3F2BA 4PCPA 1KQZA 2E77A 2P3ZA 4TVDA 1ISYA 3R2GA 3LQLA 4GQRA 1TVPA 4MJMA 4JTLA 2DZVA 3N29A 4B2DD 1ZS2A 2ZX8A 3EDKA 3CLMA 3SCPA 3NL5A 4A21A 5FI8A 5I2UA 2EPOA 3PFMA 5HANA 3NDZA 3CH9A 4ERGA 6XIAA 4WVXA 3WK0A 3UNDA 3VUPA 4O14A 3ENLA 3PZVA 2PGWA 3E49A 4GUGA 2YBVA 1PV8A 1LT7A 1I2RA 4OECA 1GQKA 3VNJA 3WK1A 4UTHA 4OV4A 3DX5A 3UBPC 4DY1A 4Z1YA 2E8YA 4QRNA 4LF2A 4CEUC 2WVSA 3DC8A 3GDMA 1O5QA 2WKLA 5I3IA 4KCWA 3NAVA 1Q7ZA 3C2RA 2OZ0A 1UWTA 3WYZA 2PP1A 1EC7A 2VFFA 5LIKX 1FWHC 1QASA 4Q4PA 4JHOA 4GJJA 5JH1A 1WAUA 1DJGA 2JKAA 3C61A 3R8RA 4JHZA 1E9YB 4GOAA 3GDRA 4MNMA 4V1YA 2WPGA 4A3UA 4Q7IA 1JXJA 3QOMA 1RP9A 1KQYA 2ISFA 4XSLA 1MRAA 4YTQA 3GVRA 3AZSA 5KMYA 4L1WA 3GG1A 3N4FA 3GH5A 1KM4A 4A05A 1KTCA 2OU4A 3QGKC 1DJQA 2GDQA 3B9NA 1EJSC 5CC3A 1RBOB 3WF0A 4Z42C 1JDAA 5H8PA 4F9JA 3T4WA 6PTDA 3STGA 3TMLA 1R2SA 1DVJA 1OG6A 3UWQA 4IGMA 4A6GA 3C8FA 3AIVA 3F4NA 1VC4A 2PDLA 1RXOB 5AFDA 1TTQA 1J18A 2FZ9A 2DSZA 3LV5A 4HB7A 1R38A 3ABSA 1ZHAA 4P7QA 1NSJA 3M07A 2DZXA 1YLVA 1RBAA 3GNRA 3CIXA 4W86A 3B3DA 2IXVA 3BSMA 4ADSA 2XFRA 3MCNA 3PR2A 2EF9A 3LHTA 1E6QM 2VJXA 3DOPA 3T05A 3MMTA 2PDBA 1RLDA 4PTVA 1B2YA 3U7BA 1V3JA 1K02A 1JNDA 3SRKA 1Q7MA 4ICCX 2TMDA 4XZNX 2ZA2A 1WE5A 4B91A 4HHPA 1K77A 1U5JA 5D2VA 4UQDA 3PUEA 2DUAA 1AH4A 1A5MC 3QGVA 4NAFA 1G7VA 5D2WA 4MYXA 3NZGA 3NTYA 5I23A 4RJEA 3UY7A 1H1ZA 5REQB 2CZEA 3AMLA 2IS7A 2QCDA 3VD3A 5CZ0A 2Z1KA 3BG3A 3W1TA 1VIWA 4KFPA 4MFDA 5I07A 4QJ3B 1OCJA 2CBJA 1P48A 3LUTA 4H9UA 2QQ6A 1A47A 1OF8A 1LJYA 1XKJA 2A3LA 2OT0A 4ACZB 3AROA 4QCFA 1CPUA 1KBLA 3T1GA 1NWRA 1JUBA 4UFLA 1S2UA 1MYRA 1Z6KA 3EX6A 1IEWA 2H3BA 3MP4A 1NELA 4XZLX 3G1VA 1R3SA 4P7NA 3EDDA 4KCUA 4EWND 3C3NA 3LZ5A 5HQLA 5M1TA 3KBSA 1MW2A 2YA0A 2Y7EA 1NDWA 2X0SA 1DEDA 1E6SM 4P8VA 3PPGA 1U5HA 1E4MM 1T40A 3QOKA 2FFIA 3NDOA 3IUDA 1S3TC 4DZHA 4PTXA 2TPSA 4B16A 5I24A 1MSSA 1VYRA 3TIMA 3ZWSA 1Q8AA 1LYXA 1E40A 4NZJA 4MAVA 1GT8A 1A3HA 4AU0A 4NZCA 3E5PA 4ZTYA 4J27A 2QYGA 3H6OA 1E73M 1V77A 1CGXA 5EYWA 4GQGA 2O9RA 5LNSA 4JN7A 2QT3A 4HTYA 4QG8A 4ORMA 3B9EA 2ABBA 4NZ5A 3W7PA 1NQKA 3EGJA 3VNIA 2GDUA 4UTFA 1WBJA 1PWMA 1UQZA 3G8RA 1PTAA 3HU7A 1O95A 3VFCA 3TH6A 3M0ZA 3QGAC 1RA0A 1QPOA 1VRDA 3SUTA 3BANA 3CV7A 3EMCA 1SW7A 3C2FA 1LQ0A 3IIPA 1XLJA 4HT3A 4CQ9A 3GC5A 5LIUX 3KLLA 1G67A 1GPFA 3W7DA 1UHVA 3DKJA 3QY6A 1WZMA 4AVFA 2W62A 4Z2HA 2E8ZA 2YL9A 1RHCA 3FAXA 4WXYA 3V4BA 2ZUUA 1HF6A 3TC6A 2YGYA 5LHFA 5G5IA 1E43A 2D1ZA 4OIFA 3ZFHA 1PKNA 4Q7BA 3LGEA 1E6XM 4KCVA 1SGJA 4QROA 3GO2A 4L65A 4UQEA 3R13A 1CW2A 1OIMA 2EKGA 1A0DA 1CNVA 5GJPA 3CT7A 3EYPA 4PFMA 3RU6A 1GOOA 5HWNA 4LUIA 4JDBA 4MB5A 3ONBA 1QI0A 3EPMA 2D69A 4EWJA 3HZ3A 1UUQA 3M5YA 7TAAA 2V2CA 1PCWA 2CPUA 3A24A 5A1AA 1CB7B 4KIEA 4W7VA 7REQA 3IGXA 1OABA 4C6FA 1WX0A 3LZ3A 4XZHA 4CNUA 1CLKA 4FALA 2Z24A 4Z1CA 1PKMA 4O1EA 1YXDA 1EC9A 2OMAA 3CUGA 3QC0A 2PP0A 4N9BA 4TXEA 1EPXA 3SIMA 4FNQA 1TTPA 5FEXA 4RL3A 4E38A 3GZAA 1HGYA 4RNIA 2NUYA 5HMSA 3I7SA 2GGJA 3VZXA 4NX5A 4OZOA 4B3LA 3Q45A 4UZSA 2EEXA 3WBWA 4ATDA 4GIRA 4HK7A 2W0UA 3IJLA 5C9ZA 4CD6A 3L2LA 1JZ2A 1QTWA 1WKDA 3AHVA 3BLLA 3UG5A 3CTLA 1FHUA 4S3CA 1KRBC 4U2ZA 2Z6JA 3LBCA 1CBGA 3OB8A 4ZA0A 3QMTA 3W7JA 4U3CA 3R4IA 4IJCA 3N11A 1G01A 2C1GA 1WV2A 2NVCA 2YZRA 4NZ4A 2WZTA 5LYRA 4K2SA 2HBXA 1VKFA 3M4HA 4B4HA 4R33A 3NM1A 3KBMA 1C8VA 4W93A 3AFBA 1TCDA 1UH2A 1OJXA 3MHUA 1GQNA 2VQTA 3MYPA 1ISWA 3RDKA 2WNWA 3LX9A 1BXNA 1IHIA 2A6LA 1M03A 2QV4A 3AICA 5BRQA 2Y89A 1CGYA 2WSKA 4JTGA 1J5TA 4OOUA 4UFMA 4GZJA 3HPZA 2B7NA 4E6MA 1DKWA 3BL3A 2YOCA 4QNWA 4WX2A 1H5YA 1XYBA 1UROA 1MZHA 4C6BA 1JI1A 3H7VA 3B0UX 1EUNA 5CAKA 2J6XA 3GNPA 4LUYA 3E0LA 4MJ2A 2B31A 3LY0A 4GIYA 4CNOA 3KVJA 3TLQA 2ATMA 1LROA 4GXMA 1MDRA 4MB4A 4F9DA 2WZHA 1W1ZA 1YNPA 4LH8A 3QFWA 5SWUA 3WD4A 2XSBA 4PUDA 1OYAA 4NNBA 4ZB2A 4BF9A 3H23A 4WKHA 3SRHA 3NQFA 2VZUA 3LU2A 3CGTA 2VX4A 4OGZA 1VEMA 2V3EA 1US2A 3GKFA 4H8HA 4P7LA 1KFWA 4LEFA 4U4MA 4ZE5A 4DELA 1QXLA 1YRRA 1W5QA 3WLMA 2EKCA 3EZ4A 3TUUA 3A12A 3SCTA 1DWJM 2GVEA 1JZ4A 3VOGA 3ZQ9A 4LFYA 4QG6A 4DNMA 1T8QA 2YSWA 2BY1A 3NQVA 1KNWA 3WQGA 1QPKA 5C9UA 3VNDA 3TC3A 3LDVA 4HQVA 3ME3A 3AZRA 1LG2A 3I7QA 4DLMA 4NZFA 3HFYA 3W2MA 3WDQA 3GDTA 4LGXA 4ZCWA 5A5WA 1XSJA 1HVXA 3IRDA 1QHZA 1JQXA 2ZIDA 5KZMA 2WV8A 2ODOA 3M7SA 3DG3A 3GR4A 2NW0A 2I5GA 2VD9A 3UF9A 3VK5A 4H9XA 4XV0A 2J77A 3KL3A 1M3UA 5HJXA 1TWDA 4B2DA 1M01A 4Z2JA 3MUAA 3WDIA 1TJ0A 2JKEA 2D20A 2YXXA 4PEKA 2PWDA 3WD3A 3TKFA 2R9RA 4N42A 3VU2A 3H24A 1J9YA 3G18A 5DO8A 1DJWA 1SSDA 3ONCA 1KRMA 5DMLA 4A4AA 4MKVA 1BWLA 3FSTA 1Y5WA 2DT3A 2Y4SA 1EHNA 4PMXA 4MMWA 3WLSA 4GGHA 2C1IA 1IXOA 5D9MA 3PPCA 3W83A 3C2OA 5G1YA 2YL5A 5KSWA 5DCBA 4OFCA 1KBIA 4EANA 2HBVA 1LWJA 1BXCA 4XZ9A 3WLHA 1KXTA 3PBUA 5C6MA 4EOUA 4CNPA 4PEEA 1FA2A 3STPA 4P8WA 1CGVA 2QDDA 2FTWA 3RLVA 3SECA 3TK7A 2QCCA 4C7DA 1OFEA 1EPVA 1JUKA 6TIMA 7ODCA 1ECQA 4RCXA 4FF5A 3R58A 3LTSA 1EFZA 1UQYA 1NFPA 1GOIA 2X1RA 5E09A 1AD4A 3RCMA 3H2NA 4NJIA 3H2CA 3UZXA 1XGEA 4JIPA 2QGHA 2AAAA 3BLFA 3I3DA 1TVLA 4AG0A 2EHHA 1GVRA 1XLDA 4UTKA 4ML4A 3RO8A 2X1SA 3KL0A 4S2BA 4QSFA 1VBHA 4KEVA 3VX1A 4IL0A 1I0BA 3WEZA 1XUZA 1E71M 5CGQA 4L6HA 1XLIA 5D8WA 2FHCA 5D03A 2FZ8A 1GHRA 2POZA 3U2CA 3N2CA 3V0UA 3UVAA 3WEMA 4HOXA 5CBJA 4O1FA 4KFOA 3QV7A 3ZVHB 2B0MA 4LUSB 4W87A 1XL9A 1XC4A 1UIOA 4WIWA 3S2JA 2IQ0A 3EX4A 4KWSA 4S39A 3NL3A 3ARYA 4GCXA 5IHSA 1CWYA 1OGGA 4R27A 2W91A 4I9JA 1QUMA 2IPWA 2Q8XA 4MGGA 1G4TA 4J40A 4A2RA 4NHVA 4XKYA 4ZFCA 2J88A 2XH7A 3TYCA 3CZLA 4S23A 3W2NA 4AMAA 1UD2A 4ICNA 4Y8FA 4YJ5A 1TRDA 2V2DA 3A4JA 1L2UA 1DYSA 1RQBA 2YL8A 4X60A 1NIUA 1VPYA 3SUUA 3FLUA 3QQ0A 5AHNA 4E2DA 5CJ5A 4TX9A 3TJXA 1MW0A 5FF7A 2AMGA 1J79A 2E1WA 3MI2A 1XYFA 4RZ4A 3L2IA 4WY0B 5JVLA 3AWOA 2VENA 3TDFA 2DSVA 1KM6A 4IHCA 5KZEA 1AQFA 3A21A 3CHFA 2HSAA 3L0KA 3HQ1A 3R7MA 1KB3A 4HK6A 1TUFA 4XZMX 1ELSA 1HKWA 4PUUA 4P7OA 4I7VA 2F61A 4UQ9A 2EPMX 3P3BA 3OP2A 2YBTA 1UWRA 3B9DA 2QCGA 1F07A 3VOIA 1XXXA 4HOWA 1P5BA 3NZQA 5I78A 1V4YA 3D0CA 5HJYA 4I5UA 4FXJA 5I3HA 3L4XA 4I90A 2YLAA 3PTDA 3WNNA 4MWAB 3LXBA 4ZGYA 4ZR8A 3WFZA 3CAVA 3WUFA 4HGXA 3CEUA 4DM1A 4AHQA 1J0IA 2CLLA 2FIQA 3N15A 2QZRA 4UMAA 1A4LA 4PFHA 4W8AA 2Z1BA 4NI3A 4PRRA 1EJTC 1QU4A 1BTCA 1GVQA 1C93A 3FFSA 3T2OA 3QY8A 3IK2A 3T8QA 1QK0A 4UR9A 2A3CA 3WMLA 2WW5A 2PDFA 1N8WA 1V02E 2BNJA 3NM3A 2FZMA 1CT5A 1GWJA 4MG4A 1POKA 3ZM8A 4UNIA 4HSOA 2YB4A 1Q13A 2HS6A 4JICA 3EWCA 1QI2A 2WO5A 4IFRA 1FH8A 3M5VA 4QITA 4GY1A 2YCLA 2CLIA 4J3XA 2XSAA 3A5VA 1BQGA 3I6EA 4WJXA 2DORA 4LVDA 4QCEA 3MVIA 4Q4RA 3C0QA 3WUGA 2VCBA 2YX0A 4W5UA 1VYSX 3F4VA 4NAEA 2QGYA 3PHAA 1FWSA 3DESA 2DVTA 1W6TA 2XPKA 3LCXA 1IIHA 2XFYA 3VGDA 4HIBA 5CC5A 2PDGA 1WA3A 3AMDA 5I3DA 1TZZA 3CAQA 3K30A 1KD0A 1HJQA 4NRRA 1IZKA 3GH7A 4MZYA 4HNOA 1E56A 4WSKA 4JFUA 3SN1A 3KOZA 3AS0A 3LMZA 4XD3A 3UA3A 5LNRA 3C0SA 1XH0A 3W27A 1YX1A 3ZJ7A 2H8XA 4ZO7A 1C9WA 4F0KA 3QYSA 3QSRA 1GYMA 1VFTA 4FI4A 4H6EA 3WLLA 1FCUA 2NT1A 4MNKA 4KCTA 3DERA 4H83A 1CI1A 4NP7A 3W25A 4F0LA 3XISA 5DRIA 2ZCGA 2WJFA 1KFLA 1JCYA 4KF1A 4DXKA 1N55A 2WCGA 1UKPA 1TSIA 2I5QA 4CCDA 4IQJA 4PZVA 2QVNA 5FSDC 4WDXA 2MNRA 2OOGA 1HT6A 1KBBA 1FWAC 3GHRA 4ZEPA 3FJ4A 4GABA 1JPKA 3FHQA 4MSSA 1YPIA 2B4GA 2DSWA 3GU9A 1BPLB 4C6QA 2FDMA 1HKVA 2BS9A 2G4JA 3L4UA 2CLEA 2ISVA 1PX8A 3L4YA 3U6WA 2PDHA 4DUWA 1A5AA 4D6DA 1JCLA 4PTDA 2C14A 4L6OA 5T91A 3QHNA 1CZ1A 3BQ5A 3N25A 4H6KA 3TYZA 3EPOA 5B80A 4KWOA 4GA8A 1KXHA 2AAMA 4F0RA 5AYBA 4Z2GA 1ICQA 3Q94A 1K4GA 3NO3A 3ARXA 2A3HA 3PULA 7CGTA 1Q45A 4RK8A 1CIUA 3A4XA 4RE4A 2XYLA 4DWSB 1VENA 2OZTA 1XQKA 2ZX5A 2PWGA 5GVJA 4AISA 3LTPA 3QV9A 1OX4A 5K7JA 1ADDA 1SMDA 3HA1A 3VZYA 3S2MA 5G4HC 4AB4A 5A8QA 4ADUA 2GGGA 3MTWA 3SDOA 4YWSA 5AN7A 2HISA 4IXHA 5FSEC 2WQPA 1CDGA 3O63A 5EA9A 3LXAA 2XIBA 4NZ1A 2GUYA 3L9CA 5MKGA 1F05A 4CQCA 1LLWA 4HNNA 2HPIA 3QMSA 4IIGA 1UR8A 1EDGA 4NUWA 3W1RA 1W1TA 4CGTA 4IMDA 4GQ0A 3W2LA 3S2NA 2X16A 2VWTA 3TC7A 2NQHA 4QX4A 3OIHA 3S5OA 3AU6A 3MP5A 3S5NA 3KS6A 3LHWA 4R7OA 1OYCA 2GQ3A 4D8LA 2XIMA 2L5HA 2ACSA 1XIHA 3SJ3A 5ABFB 2BP1A 1UPPA 1C8YA 1BSIA 1OHLA 4H01A 1DBTA 3W7RA 1S39A 3H54A 4R9XA 3HF3A 2BLEA 3PBMA 1KGXA 2X0YA 2ZC8A 3TZNA 2VVNA 3CH0A 4U5KA 3S9IA 1M1BA 3W07A 3SURA 5IOBA 1FY6A 4QQUA 2GYIA 4C6DA 1W1IE 4AMCA 4AD3A 3HJEA 4NX0A 4ECLA 2V3FA 1U30A 4M3PA 1EF2A 1MDLA 3W7CA 3WH9A 2RFGA 1H49A 3P74A 2HE8A 3D47A 2QF8A 1B3OA 3T42A 5I3FA 4GUHA 1XIIA 5ABEA 4DPPA 3U7VA 1BYDA 4PN2A 3LPGA 2VRJA 4DUXA 3NYDA 1XIMA 2DSUA 2BVYA 4JIEA 3FW6A 2ZUMA 5XIAA 1XFBA 2FVKA 4LVFA 4HU0A 4B4FA 2YA2A 2WBKA 1XGDA 1BLIA 3VOJA 3VCRA 2DJXA 3ELFA 1OC7A 2ZC1A 4OUEA 2WPBA 3IVTA 1U33A 2OZ8A 3VIGA 3MKVA 2V63A 5DLCA 3WF1A 5K9CA 3N2BA 1P0NA 1W5PA 3UETA 2J8TA 2DIKA 4PTWA 4ZFMA 3LB0A 2QVHA 5KZDA 4MYAA 2HCVA 2Z25A 1A5LC 1TVNA 2VEFA 3KWSA 5D09A 4AIUA 5FF3A 1KXVA 4YS1A 2BSLA 2NX9A 2Q3RA 3L12A 1OB0A 2VURA 1EP1A 4NYUA 1JYXA 4QXIA 5D37A 1UOKA 2AMXA 4XAGA 2WANA 1NWUA 2GL5A 3QKZA 1K70A 3IGHX 5F2LA 4L80A 2IQTA 4JTAA 1R3YA 1KLYA 2OKOA 3VOCA 1LF1A 1AQ0A 1UJPA 3OJGA 4LUJA 1W2PA 1W8GA 4DHGA 1T6MA 3VGHA 2VMFA 1E1FA 1EP2A 4BEUA 3FDKA 3BVJA 1DWHM 3M43A 2JK2A 4DXVA 3F03K 3KAOA 4JIRA 1C29A 1XWYA 3SCOA 1SR0A 3EDFA 2DZTA 1FWFC 5BROA 3AI0A 1PAMA 2NV2A 3GS6A 3URQA 3WCZA 4IMFA 4UFKA 4JQAA 2ZFAA 4YTTA 4B5XA 3SY5A 1G4EA 3G1AA 1ZALA 1KO0A 3LV6A 1O6IA 2R14A 3C52A 2GUUA 3S2CA 4O10A 3DG6A 3DI1A 1VBGA 1W1A1 5IDZA 4MKSA 1R0MA 4KESA 3CWHA 2JEQA 1DL3A 3NQMA 3OVRA 3IAQA 3IIXA 3AHXA 4OBSA 5F7UA 3RRAA 3K1DA 3BJSA 4BK9A 1SZGA 1WQ5A 4DUOA 1RV8A 3CQIA 2WMJA 3M0VA 4UMBA 3WG6A 3WQEA 1V0KA 1VCGA 2V3DA 3POCA 3VDHA 1B5TA 3CQKA 4Q32A 1XBYA 4HN4A 3L65A 4PH6A 3UD6A 2QW5A 1OK4A 4XTIA 4IGNA 4HYRA 3E96A 1S2TA 3FV9A 3DAQA 2QNEA 4FLRA 2QMJA 4DO7A 4F4RA 1R9XA 1KM2A 4ZENA 1MZRA 3VILA 4XIMA 2WMIB 3WJSA 1DWAM 3EOOA 5D02A 4B3ZA 3N3MA 4WXZA 5AC5A 1YTEA 3V5FA 2ZADA 4CNSA 1E55A 3G8EA 4V2XA 4PCNA 5I06A 1F76A 3R6IA 1TWIA 4X63A 1EF3A 1M9HA 5BYWA 1VJSA 3MJMA 3V0SA 1P6WA 4XD6A 3K8MA 1DJNA 1FDZA 3P62A 1UUOA 2VM8A 3CT2A 3M44A 1J0ZA 4BFAA 4MF4A 4AW7A 4Q8UA 2PSNA 3MO7A 4JXCA 1KGUA 2ALDA 3AJ7A 4D6GA 3A3WA 1LORA 1OWQA 4Q8QA 2EPKX 3EX1A 3QVQA 3MMWA 4DJFD 3BZJA 4XAFA