2NUYA

2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
288
structure length
288
Chain Sequence
MEIISPIITPFDKQGKVNVDALKTHAKNLLEKGIDAIFVNGTTGLGPALSKDEKRQNLNALYDVTHKLIFQVGSLNLNDVMELVKFSNEMDILGVSSHSPYYFPRLPEKFLAKYYEEIARISSHSLYIYNYPAATGYDIPPSILKSLPVKGIKDTNQDLAHSLEYKLNLPGVKVYNGSNTLIYYSLLSLDGVVASFTNFIPEVIVKQRDLIKQGKLDDALRLQELINRLADILRKYGSISAIYVLVNEFQGYDVGYPRPPIFPLTDEEALSLKREIEPLKRKIQELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural exploration of the catalytic capacity of Sulfolobus KDG aldolases
pubmed doi rcsb
source organism Sulfolobus acidocaldarius dsm 639
molecule tags Lyase
molecule keywords 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate a
total genus 115
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nuyA00
1A50A 4AF0B 3F1QA 2OCZA 1OX5A 1PL9A 3U6WA 4KFOA 3A24A 1FCBA 4ORIA 3N9RA 5IBXA 4EF8A 1XCFA 4JTEA 1PV8A 4WQ6A 4O14A 2ZA3A 3PBVA 3LRMA 4MZ8A 2NV2A 4EOUA 4HNTA 3SFKA 3TA6A 3FYPA 2A0NA 3YPIA 2GPTA 1KM2A 3LHYA 3BLEA 4MPQA 1FCUA 3NQDA 1C8VA 1QPRA 1TQXA 5I3JA 1BEUA 1XDMA 3UYCA 1G69A 3RMJA 2OT0A 4Y96A 3HG3A 1RD5A 5EY5A 1JRCA 1MZHA 3W2KA 3RFAA 2JKEA 1JR1A 3P67A 1O60A 2GQAA 3MI3A 3WK2A 5K7JA 2ZZ2A 4O19A 4HNVA 2VEKA 3NZ1A 2HTMA 1XKYA 4GXMA 2DZTA 3PS7A 3W7LA 1TIMA 4RZ4A 1OX4A 1UASA 4IMGA 3FS2A 3CLMA 1W54A 4ALDA 1ZENA 4UTWA 1PHQA 3BGGA 3VFLA 1VZWA 2NWRA 3S6DA 1JVNA 3AO0A 2A7NA 4TMBA 1FXPA 1X6UA 5D32A 1ZCOA 4PC8A 3NR0A 2QDHA 3E96A 5HUOA 1Q6RA 1TTIA 4M5PA 3N73A 2B7OA 3M1ZA 2P1FA 4K7YA 2X16A 2A1YA 1TPVA 2QAPA 2QR6A 4LC6A 5D09A 5LKYA 3EWXA 4GUHA 2ZDRA 1KM6A 2DZWA 5LSMA 3E02A 2VFFA 3SZ8A 4UTLA 3NPUA 1YXCA 3PB2A 1QOPA 4ZVJA 3Q2DA 1VCFA 4UTIA 4Y9AA 1WDWA 2V2DA 3ZFHA 3QRHA 1X1OA 5F1VA 4ZQOA 2C15A 3EXTA 1KM3A 3TV8A 3IEBA 4NXKA 3SIZA 4JX5A 5D2TA 3DFPA 3PULA 4MKNA 4IMEA 1JCJA 5DCDA 1R47A 1KM1A 4Z08A 2J24A 4JTSA 2ZFAA 2YGYA 2YYUA 4GWEA 2J9YA 1SO5A 2C1HA 4Z1BA 4LV9A 3QSRA 1HTIA 1ONRA 4WXYA 2F84A 5HULA 1PS9A 4EVZA 3QYQA 2ZRZA 4NJHA 4O28A 3SY5A 4DXVA 5G1TA 1NF7A 3DH7A 3GDLA 3LHZA 4S2BA 3IIOA 4M7TA 2DJLA 4UMBA 3W83A 3M5VA 3VNDA 3UWVA 3CT7A 2XN0A 4LC8A 3EWWA 3LTPA 4RV8A 3TK7A 2VEPA 3IIVA 3QH2A 1QAPA 2A85A 3UNDA 3AJXA 3PAJA 5G2HA 3EWZA 2CLLA 2NX3A 4BWLC 6TIMA 1LLWA 1SO3A 1VYPX 2JBMA 2QJHA 4MLRA 3FLUA 2CLMA 3R8RA 1TMHA 1P0NA 1IGSA 3PBYA 4OU1A 4U28A 4U4MA 2VEIA 3NQ2A 2Q3RA 2CFFA 3USBA 3T55A 3G1SA 4K8EA 1I2NA 3L5AA 3MYOA 3W7QA 1EB3A 2R8WA 4IQLA 1UUMA 3KOFA 1LOQA 1U83A 1W3NA 2ZTKA 2R91A 4QNEA 1OHLA 3HGJA 3R12A 2WSRA 3L21A 1DJQA 4JTJA 3GDRA 1WV2A 1KLYA 1VJIA 3LXCA 5LNRA 3LV6A 2YPIA 3MI6A 1GYLA 1IXOA 4UXDA 1AL7A 3FJLA 3FIGA 3WJYA 3B4UA 1OYAA 1HO1A 3ZR4A 2E09A 2V30A 2Z0IA 1GG0A 5DLCA 2ZZ3A 3B8DA 3GXTA 4R53A 3W1MA 2GOUA 3S9YA 5EKYA 5AC6A 5FEPA 2RFGA 1KFBA 1H7NA 3P80A 4RK8A 4CCCA 4UTTA 2C16A 4QJ1A 1LRQA 1YDOA 4A21A 5CPOA 5EYWA 1TJRA 1UUOA 5A5WA 5MHBA 3C2OA 3CEPA 1Z48A 4ORMA 1B4EA 5FF4A 4O18A 3N3MA 3NPXA 3GDTA 2ZYFA 1JCYA 1SZNA 2W0UA 4GE8A 4TR9A 3L0NA 3P8IA 3EKZA 3TMLA 4LS1A 1OFOA 4AHQA 2VELA 1L2UA 1QWGA 5CPLA 1DQWA 4IMCA 3W70A 3QW3A 3VE7A 5D05A 2OZ0A 3DU0A 1TTJA 3QMSA 4WD0A 4FNUA 2I14A 3GX9A 5E93A 4UR7A 4XWUA 3C2VA 3W7KA 2ZZ6A 3P62A 1JQXA 2E6AA 2Y85A 1I2RA 4E38A 4ADTA 2EAWA 3QEZA 1QPOA 3NQCA 5FEWA 1PCKA 3NQGA 3EWYA 5AHLA 1A5AA 5DCEA 1KFLA 1TPDA 4JX4A 1EX5A 4O15A 5K2ZA 4DF1A 1W3IA 4JIQA 1TQJA 5HR6A 4LS2A 2TPSA 2WNQA 3HGSA 1TJPA 1GG1A 1OK4A 3W1TA 1KV5A 1XBYA 3LBMA 3VKJA 1ADOA 4L4MA 1O4UA 1ME8A 4I9AA 2Z6JA 1QFEA 3G1HA 1ML1A 1LRNA 1FUYA 2ISVA 4ADSA 4JTFA 3CC1A 1FDYA 3VI2A 4BI7A 4POCA 3N2MA 3P8JA 2WO5A 1O5KA 5F2MA 3MP3A 3O6CA 1LOLA 4UFLA 3FOKA 2A6LA 3KFTA 5FF2A 1Z42A 2A7PA 5AHEA 3B0VC 3PBUA 3KRZA 1XL9A 1SU5A 3RF9A 3LCIA 2ISSA 3K30A 5CZTA 1KV8A 1XI3A 3W71A 5LGZA 2P10A 3W7OA 4A29A 2H6RA 2A6NA 5CKSA 3C2RA 2QEZA 3IRDA 2E6YA 3C4UA 1XC4A 4OHQA 2YW4A 1QOQA 1XUUA 4CNPA 5D04C 1OFPA 4TU1A 4UC5A 4JNMA 1WYIA 2E68A 2FLIA 4CCEA 1H1ZA 3L66A 3BPWA 3EXRA 4K39A 3SGZA 4GUGA 1TPFA 2TYSA 1AL8A 5D33A 4DEFA 3NEVA 4ZL1A 4DF0A 2CLIA 1I2PA 1UB3A 3CM4A 4UMAA 1LYXA 7TIMA 4OGZA 1OABA 2CW6A 3TDFA 3P7YA 1KFEA 3UWQA 3BVJA 1H7OA 3NO5A 4DPQA 4Q33A 5AHMA 3HGOA 1CX9A 5F4WA 2QUUA 3CU2A 3W73A 3G1VA 4QQ3A 3W23A 1H7PA 4E2DA 5E0KA 2QCMA 5DN1A 3Q58A 1Q6QA 4K37A 3SECA 3OA3A 3TNOA 4GRSA 3MYPA 4JXCA 3NM1A 3I6RA 3NXFA 3EXSA 4JGDA 1IXPA 2CZFA 1H60A 1H51A 3THAA 4MFEA 2WKJA 1JCLA 1YPFA 1GTEA 1TPB1 2VFDA 3NYZA 1KTNA 3O16A 2EGZA 4XUGA 3SR7A 4K38A 2EKCA 3STFA 1GZGA 1R30A 4K36A 2NWSA 3G1DA 3UWWA 1D3GA 3CQ0A 1DBTA 4JY9A 1FXQA 4TIMA 2V81A 4EWND 2Y7DA 4O16A 1DV7A 4UFMA 1TREA 4UFKA 1XXXA 2W79A 4FNTA 4BF9A 1F74A 4FIQA 2QJGA 3P84A 1TV8A 4KFNA 4BWLA 3S5YA 2V2HA 4WZHA 4FX6M 4NJJA 5J5DA 5DBUA 5G1YA 4R33A 1JJKA 1W5NA 3C61A 4IUOA 1WQ5A 4NJKA 3LCGA 4RCXA 3LDVA 3LI0A 3C6CA 3BO9A 2RHGA 2NZLA 1W56A 2E5DA 3FFSA 4MYAA 3DXIA 3GK0A 2J9ZA 4NUWA 4MJMA 3HPSA 4IWWA 3KXQA 2ISWA 3GZ3A 2NX9A 5H91A 3DGRA 5F2GA 1Z41A 4UTJA 5AN7A 2C13A 3S1XA 5DCBA 3QMTA 4OV4A 1K8ZA 3VE9A 3HGRA 2RH9A 1EUAA 4JTTA 2P0OA 1W37A 4CCDA 4AWTA 3JR2A 1W5MA 2AQWA 4KKXA 2EPHA 3T78A 1K7EA 5K9DA 1T0OA 5EMUA 1O5XA 4DO5A 3A5VA 4M6QA 1V5XA 1F05A 3NDOA 1KM4A 1DOSA 1VGAA 3IVTA 2RDTA 1LROA 1VRDA 1ZNNA 1FDZA 4O53A 2H8XA 2B7NA 3WK3A 3KAOA 1FDJA 2CLFA 3UY7A 2ZZ4A 3TE9A 4ZZ9A 4JTLA 3ABSA 5E1QA 1P1XA 2J6XA 2V9DA 1A5BA 3TJLA 3N2XA 2OMAA 3C2EA 4BI6A 5KTLA 2YFOA 3SI9A 1MSSA 5C5YA 2G5WA 3LB0A 4X9SA 3EX2A 5FF3A 2NUWA 3QQ1A 3IGSA 3W7EA 3EB2A 2GVJA 1EA0A 2Y7GA 2Y88A 3W85A 1K03A 2H3BA 4AF0A 2ALDA 2ZQ0A 4UNKA 1V7YA 3A21A 4R7JA 1Q45A 4AEOA 4R34A 4LRSA 2LLEA 2Y6ZA 4LVGA 3BLFA 3KVMA 3QMRA 5LNSA 1CW2A 1NSJA 2C6QA 4I7UA 1X1ZA 4IMDA 1XUZA 5BOOA 3W7GA 2BXVA 4IJBA 4O1BA 5HJLA 4UTUA 5DELA 1SSGA 2QAFA 3W1PA 3MBFA 2BWGA 3M5XA 4N4PA 5CZJA 5BMXA 4MY9A 1GQNA 3MUXA 1WOBA 1RPXA 2YCEA 2C0AA 2D73A 5HUPA 1TCDA 4HSNA 3UPWA 4Q4KA 3HIJA 4CNNA 4JDBA 3TROA 4UNLA 4ZQMA 3M47A 1B3OA 4CNOA 5K4ZA 3DFQA 3GB6A 3U2OA 1W3TA 2V82A 3HBLA 1G67A 5GVJA 3VCRA 3TX9A 4YCPA 3NG3A 2BSLA 1KTBA 1VH7A 1EUNA 5AFDA 4HNNA 3BV4A 3M5ZA 3W7NA 2DP3A 1LBFA 3W74A 4KWVA 4LUIA 5HINA 4JD4A 2CZEA 2FTPA 1MXSA 3LOTA 4BI5A 1O94A 2WNNA 3W1XA 3V75A 3S1UA 1TO3A 4UTTC 1OX4B 4HKPA 1JULA 4C1KA 3BK0A 4O13A 4GUIA 3IVSA 3S5NA 1YLVA 3CEUA 1Q6OA 1SSDA 5C2XA 5K9CA 3RNDA 5F4SA 3GXNA 3E12A 3W07A 4O4WA 1C29A 5C6MA 1VS1A 4MVAA 4DQWA 4BFAA 4WJEA 3I65A 1ZJIA 2YX0A 3P74A 4N4QA 4S2CA 3RK8A 3GXPA 2PRMA 3A9IA 5KZEA 1SFLA 2W6RA 5LGXA 4QISA 3PUOA 4IPIA 3UZJA 2Y63A 3L2IA 4WX2A 4CQ9A 4LY8A 2WPBA 3W3OA 3IGUA 3BW2A 5F4XA 1LZOA 3W76A 3LERA 4KWWA 4WUIA 4NJIA 1VLWA 2ZTJA 3UWYA 4NJGA 2PRHA 4JY8A 4A2SA 1VR6A 2WOQA 5G5IA 4MY8A 5CPNA 4LVFA 2H3DA 3M43A 4HIBA 2QJIA 1M7PA 1YTDA 3KRUA 4H6KA 5ABTA 1GVRA 4JYDA 4N2YA 3UQNA 4YWIA 4DO4A 5LNWA 2WV8A 2H8ZA 2VFIA 2YR1A 4JN6A 4JX6A 4RJEA 3LXAA 2AAMA 3GAKA 3KHJA 3PF3A 4K8HA 3S5ZA 4MOZA 1QCWA 1OFAA 1R2RA 1JUBA 3TCEA 1SZFA 3BW3A 4DF2A 3BW4A 3TSBA 3EWUA 3GR7A 4OQVA 2VENA 1AW2A 4LVAA 1ZFJA 1GJPA 4AMAA 3LLDA 1OJXA 3WK1A 3GDMA 2UV8G 2QCDA 4IMFA 3NM3A 4Y90A 3T7VA 3DI0A 8TIMA 1U5JA 2DJXA 3B0PA 4Z1CA 3GVGA 3PB0A 1W8SA 4ML9A 4O54A 3TQ0A 5SWUA 4TMCA 3G1XA 3V1PA 4FHAA 3NZRA 3M16A 4IX0A 4JTGA 4N9EA 2GQ9A 3I68A 2GVGA 3WJWA 4RR4A 2E5BA 3O8AA 2XN1A 1BKSA 2JKAA 1G4PA 1OG0A 1S5TA 1WAUA 2QCCA 3ABRA 2DZPA 3TFCA 1ALDA 3DFOA 2ABBA 2X1TA 3B04A 4IOTA 1G7UA 1KFKA 4QNWA 5EPDA 4UTWC 3W2JA 1DVJA 2FPYA 3SJ3A 1XBVA 3TJXA 3FYOA 2R94A 4FO4A 2QUVA 1TV5A 1QPQA 3W88A 5H2ZA 3QSTA 2Y62A 5AHNA 3HG4A 3WFAA 3NQFA 3MBDA 2C18A 4BR1A 3THQA 2IQTA 4NNCA 4OE7A 3S1VA 5AB3A 2ATMA 1Q6LA 3G1YA 1J4EA 3P60A 1JUKA 3ABQA 3M5YA 2NUYA 3ABOA 1ME9A 3S0CA 1OK6A 2A7RA 3NQVA 2A4AA 5KSWA 1L6SA 3I7QA 3LTSA 1G7VA 3W86A 3W2UA 2VFHA 3M9YA 1PCWA 2WQPA 3H55A 2GJLA 1P5BA 4UFHA 4IXHA 4QAIA 3DHFA 3NL2A 2J88A 3D0CA 3GNDA 1FWNA 3GYEA 1GT8A 3CWNA 1W5OA 4PCFA 1QMLA 4YL2A 2YXGA 2QCNA 5F2LA 1VCGA 5EBUA 3F4WA 1W1ZA 4N6EA 5FESA 3PM6A 3W7JA 3G3MA 1D3HA 4NVTA 3I7RA 3TAKA 4NNAA 1A53A 2BTMA 2B0MA 3M41A 4I7VA 2FB3A 4Y8FA 1FQ0A 3NOEA 1H7WA 1F76A 4LTSA 3M7WA 2TSYA 3TUUA 3PY2A 5BMWA 5HNRA 2CZ5A 3LV5A 4JS3A 3JS3A 1C9DA 3W7IA 3LRLA 1K7FA 3Q94A 4FXRA 4RX0A 4MUZA 1H63A 5KITA 1YPIA 5KINA 1IXNA 4GBUA 2BX7A 3QC3A 2FIQA 4ONVA 4O10A 1ZHAA 1DQXA 1OYCA 3LCHA 4CLMA 4IX2A 3DI1A 2DZUA 3TXZA 5D03A 3TU9A 3W1AA 2WSQA 1LORA 3UD6A 4HPXA 1NEYA 3DFNA 3LHWA 4PFMA 4RKAA 3OVRA 3PSVA 1T99A 3TIMA 4EF9A 4O1AA 2Q8ZA 4O8RA 3ZS4A 2NUXA 5AHFA 1OF6A 5TBOA 5IM51 2PCQA 4ADUA 2VOMA 5CG7A 5J5RA 3DHDA 4FXSA 3GR8A 4IPJA 1X8FA 4CQAA 1T96A 4QITA 1KBIA 1OF8A 4XQ6A 2X30A 2NXIA 3QPYA 1XFBA 1OFDA 2TRSA 3ANYA 3C3NA 5CSSA 5A8GA 1H62A 1I8JA 1I4NA 5AYYA 2E5CA 5HMSA 3NL6A 3W75A 1TPUA 3LCWA 1G4SA 1L6YA 2YW3A 4O57A 2JGYA 3O63A 1S3HA 4ZMGA 1G4TA 5HQEA 4AHPA 1EP2A 2E77A 3TAOA 4NZFA 2HS6A 3BARA 3G3DA 3C2FA 4GUFA 4NT0A 3MJYA 5F1UA 1JCXA 4O12A 1ICPA 3M44A 4OV9A 4FF7A 5L9FA 1RV8A 2YFNA 1AG1O 2QKFA 3L5LA 1VHCA 3QW4B 1RZMA 1H1YA 3TSDA 4GFSA 3FJ6A 2XFWA 3MP4A 2YSWA 3QM3A 3LI1A 5CPMA 3INPA 4I7WA 3M6YA 1H61A 2DORA 3W7RA 3NQ6A 3PC0A 2VC6A 2I9EA 3DFSA 3HOJA 2J9XA 5D37A 3LGEA 1YXYA 3PG9A 3CWOX 1KM5A 1PIIA 1PVNA 4NQ1A 5K9XA 2WNZA 1K02A 1GEQA 4S1FA 1WXJA 3ZWTA 4GJ1A 3W84A 3LM7A 1YTKA 2QCHA 2ZA1A 4FX8A 3B03A 2Y61A 3O6YX 1SPQA 2RKXA 4QIUA 1H7RA 2X1SA 3W2NA 4E0CA 1W31A 4HT3A 2G95A 4N6FA 1QO2A 5DXYA 3EX4A 1YTEA 2JGQA 3EKLA 4O17A 4X3ZA 4HSOA 2DZSA 4C1LA 3HMJG 5KZMA 1NF0A 3R2GA 1GYNA 4XTDA 1BWKA 1W5PA 3DFTA 1RVGA 1LTDA 4EIVA 1S5VA 4PA8A 1F73A 2X1UA 2B4GA 4MY1A 2GQ8A 4MFDA 5CGQA 1HFBA 1GVFA 2A2IA 4PH6A 4FB7A 3R13A 1VQTA 2CLEA 3KVKA 2ZRYA 4H4IA 3QZEA 3IVUA 3RU6A 1H50A 1JRBA 4DELA 4Y6GA 1F7BA 3CTLA 3L0KA 5TQLA 1DJNA 3JRKA 1OX6A 2GVLA 1LM1A 3BG5A 2Y7FA 2WJZA 3MHGA 4ZQCA 2QCLA 1K8XA 1ME7A 1WA3A 1ZAHA 4E2BA 2DZXA 1TTPA 4LRTA 3FKKA 3LX9A 4NU7A 4P61A 5LNUA 1IXQA 4RZ5A 3MO7A 3P61A 3UXAA 4D2JA 1Q3NA 1S5WA 4LV4A 2H90A 1I2QA 4UMCA 2B7QA 4LVDA 4XKYA 5HWNA 1NFBA 2GUUA 1VC4A 1Z44A 4LT9A 3TW7A 3DENA 4MIMA 1BTMA 3FKRA 4JTIA 2DZVA 4LU0A 2OT1A 3N34A 4N9BA 1TB3A 3EEGA 3GAYA 1SUXA 3HPXA 1VYSX 2RDUA 3ZWSA 4JEQA 5DBTA 1QPNA 4GUJA 3MHUA 4KFPA 4Z1DA 1M5WA 1SZGA 3TMQA 5I3HA 3NVTA 1JQVA 1GWJA 1EWDA 1MEIA 5L6UA 4OT7A 4ZQRA 1R2SA 2FPVA 3BG3A 1KM0A 4MZYA 1R2TA 2ZRUA 3F4NA 2J27A 3Q37A 1XBZA 1THFD 3MW7A 3W87A 3IIPA 4J9JA 3B0UX 3GNNA 3WJXA 2Z2UA 3UWZA 1WBHA 4AWSA 1FY6A 3NGJA 2ZRWA 3L65A 1ICQA 3G8EA 5DY2A 1UBSA 4W9TA 2ABAA 1M6JA 4LVBA 1O95A 3NA8A 1EWEA 3DAQA 2EF9A 3GIYA 5BNKA 2A21A 3L0GA 4DO6A 4UTMA 1DORA 1MO0A 1LDCA 1YYAA 3W1QA 1JCMP 3PSWA 2CLOA 3H54A 3C0JA 2ZA2A 4WY0F 4CQ8A 1TPWA 1YDVA 1J2WA 3O6DA 2I1OA 1W0MA 3UZ5A 1TSIA 1SR9A 1T8XA 4AVFA 1MEWA 5IBXC 1QO5A 3W1UA 2FPTA 2QCFA 1NVMA 3G1FA 3LHTA 5G4EA 1QDSA 1SZEA 4TX9A 5D2WA 4Z1AA 3PR2A 3BLIA 1SW0A 4NNBA 4FIRA 5I3KA 3EX1A 4O1DA 2Z1BA 3ATZA 4YCOA 3N19B 2F7FA 1YADA 1OFEA 2EHHA 1L6WA 1TV7A 4FNRA 5AYZA 1B57A 1WX0A 3O06A 4N02A 2A5HA 3DKLA 3NNTA 3OIXA 4O1CA 2PE4A 3L67A 3O1NA 1CI1A 1K7XA 5EL1A 5T26A 3LXBA 4O50A 3E0IA 2Y7EA 3SGUA 5C54A 1ZY9A 5AHIA 2E6DA 5FI8A 3C8FA 1HUVA 1H7XA 2VKZG 1ZAIA 3O05A 1FWTA 3C56A 4UFJA 3B06A 3PG8A 2CLHA 3W7CA 2VFEA 1SW3A 1KFCA 2JK2A 3L68A 3TKFA 1PE1A 1HG3A 1KTCA 3PBWA 3T44A 2QCGA 1P0KA 2Y89A 4PEKA 2KZHA 1GPWA 3PUDA 3SW6A 3A23A 3NAVA 4JTKA 1A5CA 3TQVA 4B5NA 5BRBA 2O7SA 1FWRA 3OG3A 4O4VA 3EWBX 4GNJA 2Z6IA 3T4CA 1EIXA 3MWAA 2QCEA 1SFJA 4WOZA 3STEA 2PC4A 1HO4A 4NX0A 1FCQA 1JCNA 1KBJA 5AOUA 1X7FA 1Y0EA 3LRKA 3IGXA 3TFXA 2FJKA 3MMTA 5D38A 4DBDA 4TO8A 1SO6A 3O15A 4JTHA 4AHOA 2QF7A 4JYEA 4X22A 5D2YA 4PODA 1OFRA 3E49A 3UPBA 5G2IA 4LNYA 3P81A 2V0TA 4BK9A 4DPPA 3G1AA 4PL1A 5BW6A 3W2MA 5DY3A 3G22A 1R46A 3PVFA 3DKJA 3I7SA 3L9CA 1LLZA 4K7VA 4IGHA 4WY0B 3P82A 3KX6A 2YYTA 4UFIA 4ZQPA 3LCXA 3W7HA 4LUJA 5D02A 3HPZA 4MZ1A 3O07A 3HB9A 3CPRA 3OBKA 3A22A 5FF0A 1OFBA 3STGA 3MP5A 4FNPA 3NPWA 3C52A 4UTHA 3HQ1A 3T40A 3CB8A 3RLVA 1ZAJA 3NQEA 2JKPA 1YDNA 4MLJA 1FX6A 3UXDA 3BGJA 1E51A 4HN4A 4MJZA 3QQ0A 4Z0SA 1DHPA 2FDSA 3G24A 1WOAA 2ZBTA 2C14A 1K8YA 3QF0A 3LTYA 1VPXA 3W9ZA 5D30A 2QDGA 3M0ZA 1SW7A 2YDAA 3P5ZA 2QCDB 5F2IA 1IF2A 1LBMA 3W1LA 1RQHA 2FB2A 1TRDA 2G96A 3EX3A 2QUTA 4NZJA 4AH7A 3NL3A 1MEHA 4GC4A 1KLZA 3NL5A 5D2XA 1XDLA 2Q8LA 3E9AA 3WK0A 4LOCA 1P4CA 2Y70A 2ZZ7A 4AWUA 1IIGA 4JYFA 2ZRXA 3CIXA 1VYRA 3W2LA 3GKAA 5LNVA 2AGKA 1KW1A 4MYXA 4RZ6A 1SQ7A 3TW6A 2NLIA 4XKYB 4QM1A 1FWSA 2VFGA 5C55A 3U8GA 3ELFA 1OFQA 1D9EA 3KRSA 1F5ZA 5LHFA 5LZLA 1OYBA 2HS8A 2E6FA 5HR7A 1KFJA 1JUEA 5KZDA 4FNQA 4RLIA 4XTIA 1LOSA 1VCVA 3G0SA 3GLCA 4NXSA 4XBKA 1FBAA 4YMZA 4YLWA 1VLIA 4DBEA 3RLUA 5K3VA 4WXZA 3S8HA 3KVLA 3L5MA 1XBXA 2ZZ1A 2ATSA 1B4KA 2PRLA 3CHVA 1TPC1 2VEMA 4WY0A 1FCVA 3FEMA 2ZRVA 4XBSA 4X2RA 3R89A 1LP6A 3LHVA 2X2GA 4JR5A 3TC6A 2PURA 1RQBA 3NQMA 4OWGA 1WBJA 4L4LA 3G0XA 3S5OA 3W7MA 3B05A 5G4WA 4JDYA 4UCGA 1A5SA 4JIPA 5LHEA 3A5FA 5I3IA 4WOQA 1XM3A 4O0ZA 4RXFA 3BG9A 3F03K 3KVJA 4PL2A 1N7KA 3ATYA 3LHUA 3TQKA 5U7SA 5DXXA 2HMCA 3CIWA 1VHNA 2BLEA 3LCFA 2V8ZA 1TRIA 2X1RA 2R14A 2Q3OA 4AXKA 4A2RA 2NXHA 2V2CA 3NQAA 5FF7A 4O11A 1YXDA 4Q32A 2CLKA 5KMYA 2C19A 3UWUA 1F6PA 1I45A 5EA9A 3W6YA 1N55A 2G97A 5CZ0A 2XN2A 2HSAA 1M7OA 5TIMA 1FWWA 3MI2A 4FX7A 4HPJA 3OVQA 1B9BA 2V5LA 4LWWA 2OJPA 3H53A 3WJZA 3HO8A 3NPVA 3W1RA 3GDKA 1TYGA 5G2WA 5AYXA 3QFEA 1IIHA 4PTNA 1QNVA 4UR8A 2VXNA 3W7DA 4G1KA 3GKFA 3P5YA 4P2VA 4LW7A 4HNUA 5I3GA 3IV3A 3IIZA 5CZSA 5I3FA 3N14A 1ZALA 3UY8A 1LRTA 3MHFA 1KA9F 4ZQNA 3HJZA 4ICNA 2RDWA 5HWMA 3OVPA 4FEZA 1W5QA 2B7PA 3DBPA 3DZ1A 3OEXA 3HG5A 4LS0A 4N9DA 3EX6A 4XZ9A 1EP1A 3LCLA 1ICSA 3G0UA 3TXVA 1DKWA 3FA5A 3NQ7A 2CZDA 5AC8A 3LBCA 1AW1A 3PUEA 1GTHA 4HHPA 4RXGA 3IIXA 3W22A 5K4XA 1I2OA 2TMDA 1GVQA 3WJSA 4AAJA 3QJAA 2BZNA 3TC7A 1EEPA 1UCWA 2O7QA 4AB4A 4JTUA 1UJPA 1BWLA 1TTQA 4M6VA 4NX5A 3W7PA 4N9CA 5CSRA 2DU2A 3PWAA 1G4EA 1RR2A 3W1NA 5AC7A 2YZRA 5FEXA 3LLFA 4K6AA 1GVSA 1PHWA 4M7SA 1N8FA 1TPEA 4UUIA 3SSJA 1SO4A 1OVDA 1F6KA 1NAL1 2NX1A 1DL3A 3STCA 4IXXA 3G18A 3S42A 1H5YA 2FFCA 3TH6A 1AMKA 3S1WA 2OX1A 2WSYA 1AK5A 3HF3A 3HG2A 1TPH1 3OHIA 3N9SA 2CU0A 1L9WA 4O52A 2ZZ5A 4A3UA 3NQ8A 4UIOA 2NXGA 4QSHA 3W72A 1RQEA 4A22A 5D2VA 2CWNA 1EP3A 1LCOA 4JICA 2FQIA 3TR2A 1EPXA 2ZCGA 1HL2A 3QPZA 1GVOA 5HWJA 4H3DA 4O0KA 4Z0JA 4YXGA 1G6CA 5U4NA 3TSMA 2V5BA 2C3ZA 1F2JA 1K3UA 1QR7A 1AW5A 2NV1A 1J5TA 4UTKA 4M19A 2GJNA 1GOXA 3G8RA 2E1DA 6ALDA 4OBTA 4M6PA 3R5EA 4FNSA 5FEZA 1LBLA
chains in the Genus database with same CATH superfamily
3NVDA 3MV01 5TNVA 1J0IA 1KQZA 3OGRA 1VBHA 1PV8A 4WQ6A 3POHA 2ZA3A 4RE3A 2WC7A 1UMLA 2WMGA 4Z2KA 2BXYA 3ARTA 2Z27A 3YPIA 2GPTA 4WLCA 1KM2A 2AL2B 4HOXA 3GY1A 3PNUA 3KOXA 4MPQA 1QHPA 1SMDA 1FCUA 3NQDA 1GQIA 1C8VA 1QPRA 4AEFA 4MWAE 1BEUA 3GNXA 3UYCA 1G69A 2J8GA 2F61A 2Y0FA 6TAAA 3P14A 3P93A 1RD5A 3W2KA 3AIVA 1I0DA 3BH4A 4U5IA 1J12A 4O19A 4HNVA 3A4JA 1XKYA 3N4EA 4IGSA 3W7LA 5C9WA 2P88A 4IQEA 4NG3A 4JN8A 4B9ZA 4US5D 1V3MA 3CLMA 1W54A 3KOYA 4UTWA 3BGGA 2NWRA 1GOIA 4PCNA 1XLGA 3FAWA 4F0MA 2ZE0A 1EOKA 3VU2A 1QU4A 1FXPA 1X6UA 1ZCOA 3NR0A 3B9AA 5HUOA 4ERAA 1EZWA 2D3NA 2OZ8A 2DT2A 1HKMA 2VHLA 2P1FA 2A1YA 4JNZA 2AMGA 1KCZA 4WCJA 3ARRA 5D09A 4GUHA 2ZDRA 3E02A 4ML4A 3CUXA 4Z2HA 3NPUA 3PB2A 1P0DA 4Y9AA 2V2DA 3GC5A 2G3NA 1M53A 1CLVA 4EPDC 4A35A 2C15A 4W8AA 4ZO8A 4GNKB 5CAHA 1RK5A 3SCOA 1ELSA 4NXKA 3KP0A 2AQVA 4W85A 3B3DA 2EPKX 2NLYA 3B8VA 3WD2A 1KM1A 3V18A 2J24A 4JTSA 1IQ8A 2YYUA 5T91A 3ZJ7A 4GWEA 4UZSA 4L6HA 3QSRA 3RM8A 1H09A 2F84A 4HSHA 4EVZA 2ZRZA 4MJ4A 2J25A 3SY5A 3N11A 5HJYA 4E2VA 2XH0A 3GDLA 4M7TA 3VCNA 3M5VA 1OINA 2PEVA 3UWVA 3WBWA 3CT7A 2AQOA 3BJSA 4MAZA 1QT1A 4RV8A 2IS7A 3VGDA 2VEPA 3IIVA 4L4OA 3U57A 1KQYA 4BF7A 4CNTA 1A3XA 1MW2A 1E6XM 4N42A 3CWHA 1JI2A 3AJXA 3ZR5A 2C91A 1UD5A 3R8RA 1TMHA 3WBYA 3R0KA 5ECUA 3GH5A 3NQ2A 4PMZA 3G1SA 1I2NA 1HJXA 3WQ5A 2GVYA 3PZMA 1UUMA 2ZXAA 1U83A 2TODA 5I09A 4HD5A 3ANUA 2WSRA 3SGGA 2CPUA 1DJQA 3L21A 2FJUB 3EAUA 3UJRA 4QAWA 4ERGA 3JZUA 3FHQA 5A3HA 3AICA 1VJIA 3LXCA 3WQEA 1GYLA 3FIGA 3B4UA 1Z69A 2E09A 2V30A 3IJIA 2ZZ3A 3CV6A 3B8DA 3GXTA 2ZUMA 1PKYA 5EKYA 5FEPA 2RFGA 4Q3MA 3P80A 4UTTA 2C16A 1HQTA 1YDOA 5EYWA 3L4TA 1UUOA 5A8NA 3C2OA 5I06A 5FF4A 2X0HA 3C5QA 3BGAA 3GDTA 1JCYA 3K8LA 3L0NA 3TMLA 3MSDA 2IXUA 4D6FA 3T81A 1QWGA 3BMVA 1DQWA 4IMCA 1V3IA 5D05A 2OZ0A 1XIIA 4FNUA 3GX9A 4GINA 2BXZA 4UR7A 3C2VA 3W7KA 4QTGA 1H49A 2ZZ6A 3WNNA 1KRAC 3KS6A 5FJPA 1J2BA 4PYSA 3PFRA 3WUFA 1RXOB 3E0FA 5DCEA 1TPDA 3ZM8A 1EX5A 5EFFA 4O15A 3K5XA 5K2ZA 1C3FA 4DF1A 1R0MA 1QOXA 1RY8A 4QHRA 3RYSA 2ON3A 3NZPA 2DIJA 1KR0A 1TJPA 1KRCC 1OK4A 3LBMA 1VFFA 3O7UA 4AX7A 3NJ3A 4I9AA 2EPOA 1LRNA 4DUOA 4BHYA 3CC1A 3CUJA 2OEMA 3AXKA 3BAWA 1VP5A 3GR4A 3EOEA 4JL1A 4GC3A 3VOIA 1Z42A 2QXWA 5AHEA 1IEQA 3XINA 1XH1A 3GD6A 3OYXA 5CJNA 5CZTA 1XI3A 3W7OA 4A29A 1W8GA 4XZBA 3IRDA 1DIEA 4LUTB 5HMEA 5HPCA 4CNPA 4Q4PA 3CH9A 5D04C 1CXLA 5E9XA 1ADDA 2E68A 2BOEX 1D8CA 1H1ZA 4Q8OA 1XLIA 1LG2A 4AVNA 3SGZA 1QI4A 4GUGA 3DUGA 1AL8A 2YDQA 6PTDA 4Y7EA 4V27A 3ARYA 4ZL1A 1IV8A 5A6AA 2QF8A 2OELA 1U1JA 2CLIA 1NELA 3CM4A 3P7YA 3BVJA 2DIKA 4DPQA 3EWDA 2XFRA 3HGOA 1CX9A 1UWIA 1PWLA 3U5YA 4H7ZA 5CCZA 4JFTA 3SCQA 5IFPA 4AZCB 2F8QA 3R1ZA 3Q58A 1Q6QA 3AALA 3EMQA 3OB8A 3VD7A 1B54A 2FYMA 4LYQA 1JAKA 4B9YA 4EPKA 4RUBA 3RLHA 3I6RA 4JGDA 1IXPA 3THAA 1BGGA 2VFDA 4CN6A 3O16A 3PZVA 4IJCA 4RZBA 4K36A 1AH3A 3AWOA 4GX8A 1DYSA 1D3GA 4HJFA 2XG9A 4L64A 5I3DA 3UVIA 4WSHA 3VILA 2PDHA 5ABHA 3GVVA 4UFMA 1F74A 1FH7A 1MUCA 3VZZA 4HGXA 4FX6M 4NJJA 5DBUA 4DBWA 2PS2A 2VRQA 3TTOA 4K1GA 5HMDA 3T8LA 1VFUA 3LDVA 2BFGA 2WHJA 3AI0A 2QMKA 4I9TA 1V03A 3BO9A 5EMKA 3U3HA 2V69A 3LPFA 3FFSA 1EJUC 3T8QA 3QHOA 1E4NA 3KXQA 3GO2A 2NX9A 4UQAA 3T0BA 3TWAA 4CVWA 2CYGA 5AN7A 3RXZA 5C0QA 4OV4A 4F0SA 1EUAA 1V0MA 1DTUA 2A3HA 2UY2A 1GOQA 4DI8A 1QI3A 5HANA 1IR1A 1WKEA 1ZBWA 2AQWA 3GVQA 4KKXA 4DUVA 3FX4A 4QJ4B 4F79A 4ZXLA 1D7FA 1KM4A 1DOSA 2V3GA 4LFYA 4AZ7A 3MDWA 1DEDA 3GVWA 4I5XA 4GHRA 3S2NA 3I3DA 2H8XA 3KAOA 4J3TA 2CLFA 4GYPC 4KF1A 4ZZ9A 1I9CB 3B9NA 3ZIZA 3R58A 3KL3A 2VO5A 5EB8A 1WZLA 3CIVA 4W88A 3SI9A 2JEPA 3MZ2A 5H6HA 2CESA 1BXCA 4YYCA 2NUWA 4H2CA 3QQ1A 3IGSA 3FY1A 5AY7A 4AZGA 2GVJA 5CJMA 4GISA 1EA0A 2PDJA 2Y88A 3UG4A 3CZ8A 4UWMA 4R7JA 4US5A 1Q45A 2DT0A 1FWFC 4MADA 2OGYA 2C6QA 1HJVA 4F4RA 1UIPA 1X1ZA 1IHIA 2O55A 4GH3A 2BXVA 3VKKA 3NQBA 4O1BA 4UTUA 3W1PA 1UH2A 1S38A 2DPEA 3MBFA 3MUCA 3TYUA 3WLTA 2ZWYA 3M5XA 5MF5A 3T4WA 2YBUA 3PP7A 4IH3A 4E3TA 2QIWA 4J3XA 4ZTXA 1QASA 4PR4A 4UBPC 2BHYA 2Y8UA 3ZVHA 1WOBA 2QPXA 1RPXA 1YEYA 2YCEA 3CUIA 2WXDM 4U33A 2EPLX 1RSCA 3HIJA 4CNNA 3MDUA 4UNLA 1S5MA 3M47A 2GFTA 1B3OA 5K4ZA 1WDRA 4QE1A 1XLAA 4KGLA 1QNOA 4Y2WA 4ENLA 2BVDA 3KZPA 4NAFB 1ZQ5A 1G67A 2FZBA 5IFTA 5GVJA 4XZIA 2FZNA 3TX9A 5CGTA 3LSBA 1BXNA 2ACRA 4ZEPA 4C1NA 1PYFA 4HNNA 1MMFA 3BCDA 2Z29A 4JD4A 4UQCA 4BI5A 1GJUA 4W84A 1O94A 2WNNA 1RAKA 1EGVA 3S1UA 1TO3A 1VD6A 4UTTC 4CNUA 4HKPA 1JULA 4B3LA 3BK0A 5DRCA 1EZ2A 1ZSXA 4M6UA 1SSDA 1FWEC 5F4SA 3GXNA 3E12A 3EOSA 2PP0A 4O4WA 3QKZA 2CZVA 5C6MA 4OBSA 2XH4A 1VS1A 1UZ1A 1Q6EA 1UC5A 3DG6A 4WJEA 1W1A1 1J9YA 2DSWA 4S3KA 3LY0A 2ZE3A 3RK8A 1BSLA 1IWAA 1Q13A 1TJ0A 2PRMA 5A2CA 2W6RA 5LGXA 3UZXA 4QISA 5BYWA 1AQFA 5CQ1A 3UZJA 5A8MA 3W00A 4CQ9A 1LWJA 1YNQA 4LY8A 2WPBA 4HNLA 4MB5A 4F0LA 2PLJA 3W3OA 3PZOA 4X0NA 4LEFA 5F4XA 3E0WA 3LERA 1JGMA 1Q6GA 3LBOA 2ACQA 2ZOXA 3UWYA 3PAOA 3N18A 2PRHA 4A2SA 5CZKA 3LD5A 4Z2LA 4MY8A 3RPDA 2HISA 1XV8A 3B9DA 1CXFA 4AU0A 3R79A 1M7PA 3FSUA 1DJIA 2GOKA 3KRUA 5ABTA 4JYDA 4I8DA 3ANVA 5LNWA 2WV8A 2VFIA 3N1AA 4DUXA 3H2CA 2AAMA 3BLOA 3LXAA 3PF3A 2EO7A 1EBGA 1R2RA 1UA7A 2J66A 3TCEA 5BXTA 2NSXA 2C79A 1Q7ZA 5CAKA 1W2PA 3GR7A 4P8UA 2VENA 4PGLA 1AW2A 3WK1A 1NOFA 3GDMA 2JE8A 2PTYA 4U10A 3N2CA 1GYMA 3MKCA 3WNLA 3DI0A 2DJXA 3UP8A 4ML9A 1FHDA 4TMCA 3V1PA 4IX0A 2OWWA 4N9EA 2GVGA 5H8MA 4KIRA 1AJ2A 4R5EA 3DERA 3E2VA 3M0JA 3PN8A 4IP7A 4M24A 1RBAA 4JIEA 2FGBA 4GIYA 2DZPA 1ALDA 4L1GA 4HOZA 3DFOA 3GHUA 3IK2A 5CSUA 5EPDA 1FH9A 3MKVA 3KLKA 2MANA 5XIAA 2QUVA 2YL5A 3ZQ9A 1Q65A 3NQFA 1JD7A 4S3BA 4PMOA 3RHGA 1FWCC 3N2OA 3THQA 2PDXA 3TYDA 2VTFA 4HZ6A 3PTDA 1PAMA 1XD1A 1J4EA 2F6XA 3MC5A 3S0CA 1XPGA 2PDQA 1BWVA 5KSWA 1L6SA 1E73M 1VEMA 1IZJA 3W86A 1N8IA 1Q7MA 5I02A 2GJLA 1TX2A 4IXHA 2J88A 3RPTA 3GYEA 3N6QA 1UHVA 1WZKA 2YXGA 2QCNA 1MRAA 4N6EA 2QPSA 2XJ7A 4NVTA 3I7RA 3TAKA 1A53A 1EQCA 2B0MA 4Y8FA 4GY1A 1H7WA 2OG9A 1BYCA 4YS1A 2VZVA 3JS3A 3N9KA 4KMQA 3Q94A 3AZRA 4RX0A 1JD9A 2BX7A 3QY6A 3P0XA 4G8TA 1OYCA 3LCHA 4GABA 1GORA 4ZE5A 3MPGA 3KBVA 3TU9A 3W1AA 1CENA 3IRSA 2UBPC 1LORA 1FWAC 1MXDA 4J7RA 1NEYA 1ZGDA 3LHWA 4RKAA 3HQNA 3U9IA 1T99A 1IZCA 3TIMA 4EF9A 3UXLA 4O8RA 2NUXA 3W24A 5IM51 5CG7A 3PWGA 3CB3A 2Y24A 3WLKX 3DHDA 2WVVB 3UT0A 1NWSA 4CQAA 2BHUA 1T96A 3HA1A 2VM8A 1DQUA 1BRLA 2RAGA 1RCQA 3QPYA 3C86A 5A8GA 3ANYA 3KCJA 1H62A 1IEXA 3T2OA 1I4NA 1ODUA 1O5RA 1XH2A 2GJXB 4H8VA 1TPUA 4R27A 1KRBC 4O57A 2JGYA 3O63A 1S3HA 4ZMGA 1O5QA 1I1XA 3F4VA 3PZNA 4AHPA 1XS2A 5EMLA 1EP2A 3S2LA 3TAOA 4NZFA 3BARA 4GUFA 2CETA 3BSMA 3ZR6A 1TVPA 1U5VA 3LPOA 3FV9A 1B90A 1R9ZA 2DT1A 4Y9MA 4C5YA 3REQA 1LUCA 4FF7A 5L9FA 2VNCA 1AG1O 5BRQA 3FAXA 4XAFA 4B5SA 3FJ6A 4V2XA 3N2TA 1YHTA 1U1HA 2UZ9A 5DMYA 2I9EA 2IKGA 3IPWA 1GQLA 1EF3A 4LANA 3CAVA 1XLHA 3QC0A 5DMLA 2PLCA 1QBBA 3IJLA 3UZZA 1PIIA 2I5GA 3BDKA 1O7AA 3H2AA 1T8QA 1HXJA 3L12A 4FLRA 3MA8A 3W84A 2QCHA 1GPFA 4L56A 1PKLA 3KBWA 2X1SA 2EG8A 5REQB 4GD0A 2VZOA 1W31A 3GXIA 3REQB 3PZUA 3Q45A 4S38A 4UQDA 4WDTA 1GYNA 1E71M 3CMGA 4XSLA 3TR9A 3VXGA 4PMUA 3UG8A 4GGHA 3BAJA 3AXMA 1LTDA 3GBDA 3L2LA 4EIVA 1FVPA 1S5VA 3H12A 5FCZA 2B4GA 5A6SA 1HFBA 3RU8X 4PH6A 5EMJA 4HOWA 3BE7A 3KVKA 2WSKA 4TVCA 1XKJA 2FVMA 1BFNA 1F7BA 5FAGA 3L0KA 3JRKA 4QS5A 4H9YA 3BG5A 2ZWZA 3PHAA 2FVKA 4DAIA 1ME7A 3B9EA 1ZAHA 1HKWA 4KGJA 4GCAA 4YTQA 2QDEA 5JBEA 2J8TA 5M5DA 1S2VA 1MI3A 3WYZA 1JDAA 4LV4A 1S5WA 2H90A 1A5OC 1I2QA 4H7CA 2CHRA 4LVDA 4E3VA 1MQPA 4PB5A 4LU0A 2HPMA 4S3GA 1TB3A 3U4FA 5LA0A 1VYSX 2RDUA 3ZWSA 4IL0A 1QPNA 4LUTA 2Z1WA 4IIFA 3EYPA 1MNZA 1R38A 2V6AA 3VIMA 1Q6FA 1JQVA 1EJVC 1UWAA 1GWJA 1FKXA 5D8ZA 5DT7A 3SY8A 4OT7A 1DXFA 1EH9A 4IPLA 3GW3A 1S3TC 1M3UA 5A95A 4MZYA 3VTRA 1R2TA 2PDLA 3F4NA 1VIZA 3Q37A 2Z7GA 2DY3A 4J9JA 3UWZA 4IQJA 2AKMA 1FY6A 4ZCWA 2CCRA 3BAIA 3L65A 3RILA 4BEQA 2V5CA 1O95A 1P7TB 1Z89A 1KWKA 3DAQA 3GIYA 3L0GA 3WLIA 4ACZA 3GFZA 2PDMA 2YDSA 4P7LA 3WEMA 3MV11 3W1QA 3PSWA 2YOCA 3C0JA 3W81A 3SM0A 1YDVA 2HK0A 3O6DA 2OSXA 4GG9A 4GOAA 2DVUA 2G0WA 3RMEA 4AVFA 1MEWA 3P0WA 3W1UA 2FPTA 3G1FA 3V5CA 3LHTA 4PCTA 2CERA 4TX9A 5D2WA 2WMIA 2QMJA 3U5UA 2Z1BA 3ATZA 4GK8A 2Y2WA 2A3EA 1TV7A 1QWKA 4HCLA 4QP0A 3VMPA 3NNTA 2PE4A 3WSUA 1CI1A 4L9XA 2X41A 2Y7EA 2YKKA 5CPSA 3KBJA 2PD9A 5XINA 1EC9A 3MMUA 3HJEA 1HUVA 3VNMA 4BQ3A 2VKZG 4K1WA 1ZAIA 4Z2GA 4W87A 3C56A 4E6MA 2VFEA 1EHNA 5GQBA 1SW3A 2OO6A 2PDWA 1KFCA 2JK2A 4LBUA 1S2WA 3PJWA 1KTCA 2WWDA 1H3GA 2Q09A 2W62A 1AH0A 2E4TA 1FHLA 7CGTA 5AC4A 3SW6A 4GJJA 4JTKA 1A5CA 4H8UA 2OGJA 1PIFA 3T4CA 3MWAA 4WOZA 5AOUA 3TFXA 2FJKA 3WQGA 5D38A 4DBDA 3NIYA 1P1MA 2CHNA 3O15A 1XLKA 4JTHA 2YJQA 1JYNA 3EA2A 4X22A 3E49A 1CXEA 3OYZA 4D8AA 4J2MA 3G1AA 3WLJA 1UD8A 3AFBA 5DY3A 3G22A 1L6FA 4HNCA 2ZXQA 3I7SA 3WH7A 3L9CA 4C6KA 2WQDA 1NOWA 4UFIA 3A4WA 3VGEA 3W7HA 3QTPA 3EPNA 4MZ1A 2C0HA 3VC6A 1PB0A 3EDJA 4KW2A 2INZA 2WZHA 3STGA 1AQ0A 7REQA 4Q8WA 4QJ5B 3O2LA 3C52A 3HQ1A 3T40A 1VIWA 1ZAJA 4GACA 3ARXA 2DGAA 1J01A 2FDSA 5FJJA 5LXXA 4ZO9A 4QQUA 2C14A 3LTYA 2D2JA 5D30A 1B1YA 3I6EA 1A0EA 4S3DA 3RM4A 2QCDB 4L80A 2Z24A 4DB7A 2F6KA 3EX3A 2QUTA 3PPCA 4NZJA 1Q2SA 2WPGA 4AH7A 5D2XA 1CEOA 1PZ0A 2PD5A 4H9ZA 3WK0A 3IJDA 4ECLA 1RHCA 1HGYA 1P4CA 2Y70A 1FH8A 4NZ3A 2OSWA 3S9IA 3E38A 2AL2A 1BF2A 5LNVA 4MYXA 1MZRA 4RZ6A 3A47A 3G5EA 5I2UA 4GI4A 4MB3A 4XZWA 2OX4A 1UR3M 2E6FA 4Q4RA 5KZDA 4RLIA 3VNYA 3TYAA 4A4AA 4RDYA 4NXSA 4XBKA 1R5YA 1W9DM 1OCQA 4YMZA 4YLWA 4FZIA 3RLUA 3S8HA 3M0MA 4FR1A 1TUXA 1Y7VA 1M65A 3CHVA 4QG9A 4DIAA 4WY0A 2ZRVA 3R89A 1A0DA 4PUDA 3G2GA 4YU1A 3PZTA 2R1NA 2PURA 1E3XA 4BS0A 3G0XA 3ZSSA 4HHLA 5JU6A 4KERA 5BOFA 1A5SA 4JIPA 5I3IA 5DANA 4K8GA 4O0ZA 1GHRA 1JPKA 4FK9A 3BG9A 3EWCA 3ATYA 3LHUA 4FLOA 1LQ0A 5U7SA 4XD6A 1DWJM 2HMCA 3H8AA 1VHNA 4TX6A 3I4EA 1TRIA 2R14A 2NXHA 2J62A 2V2CA 5FF7A 1YXDA 2Y8VA 3W82A 4XG1A 4C65A 2PU1A 2G97A 2XN2A 1LL4A 2YXOA 1V0LA 3OVQA 1B9BA 2IKIA 2OJPA 3C0SA 1K9EA 3HO8A 3GDKA 3M0VA 1TYGA 1TWIA 5G2WA 1FP8A 3D46A 4AD4A 1IIHA 2J79A 1K6WA 3WLNA 4UR8A 2AMXA 4LUYA 2INFA 2CKRA 3DN5A 3PJTA 1ITXA 2JF6A 3IV3A 3EPMA 4IGMA 1KA9F 2ZUWA 4H01A 4F2BA 3OODA 1W5QA 1UZDA 2B7PA 4PBGA 5BRPA 3DZ1A 1BG4A 4LS0A 2ZX5A 1E5NA 4N9DA 3EX6A 2WNWA 3B8WA 1DKWA 4EPEC 1MNSA 2CZDA 3IACA 1XLDA 3PUEA 4BCEA 4YTSA 3AC0A 1HKVA 3CUFA 3WD4A 1QPKA 5A8OA 2BZNA 1KB3A 4XVEA 1EEPA 4E2OA 1KGXA 1UJPA 4ZOEA 2Q02A 4NX5A 3BL3A 1BWLA 3GU2A 1YX1A 1ECQA 3WL1A 5BU9A 5BWAA 6ENLA 1V8EA 1JPDX 4C6JA 1DJGA 3W1NA 5AC7A 2YZRA 5FEXA 4K6AA 1GVSA 1PHWA 4M7SA 4B90A 3P2VA 4LUSA 1OBAA 2GJRA 1HF6A 5FOOA 3OQ8A 3S1WA 1OZQA 4ERIA 3LGDA 4AISA 3N9SA 2CU0A 4JOMA 1XW8A 4A3UA 3NQ8A 3CMJA 9XIAA 3NGFA 1X97A 1OG6A 2GDVA 2W61A 3APGA 3TR2A 2X7VA 3WLLA 1GVOA 3A6OA 3ZJKA 1JI1A 4QG8A 4H3DA 1WZAA 4Q6XA 3URBA 1X98A 4ZFCA 4EK7A 3D3AA 4MDPA 2C3ZA 3ARPA 3HPFA 3A9BA 5HPOA 1J5TA 1ISXA 4UTKA 2X1IA 4HU8A 2FDMA 1XIBA 3CJPA 5E0CA 1DWFM 3G8RA 3MCOA 2BY1A 5FKYA 5I07A 3SADA 1PL9A 3SCTA 1FCBA 4ORIA 3N9RA 2OKOA 2NQ9A 1E9IA 5M03A 2XIBA 3GE7A 4KETA 4DHGA 4HNTA 2J4GA 2QGYA 4U5KA 3FYPA 1VFOA 3LHYA 1TZZA 3VMNA 1YDYA 5G1MA 4NAFA 5I3JA 3LUTA 1XDMA 3VIJA 3NSXA 4L65A 3U4AA 1AJ0A 4Y96A 4UOQA 4HVXA 1JRCA 3RFAA 3VZXA 1AQMA 4Q8MA 3P67A 1O60A 2GQAA 2GGEA 1KXVA 4GXPA 1T7LA 2VEKA 3OLGA 3NZ1A 3ZLGA 2D22A 3FYYA 4GXMA 4GPNA 4HU4A 1ONEA 4XZMX 4OZOA 1E0XA 1MWOA 2ADAA 1RJQA 3EDKA 1ZENA 3ZO9A 1QI0A 2VT0A 3VFLA 4GVHA 3S6DA 1JVNA 3AO0A 1UD2A 4DXXA 4NY2A 4PC8A 1A5UA 1E6PA 4U3CA 3R8GA 1TTIA 3POCA 4M5PA 2XSXA 4PSRA 5E70A 1E4LA 1CGWA 3EWXA 1UR0A 4I5UA 4QJ3B 2PGWA 3APYA 3K4DA 3SZ8A 5CLWA 1UKTA 3FNDA 1YXCA 4ZVJA 4G9PA 3ZFHA 1X1OA 5A6LA 4BA0A 3WDRA 3E5PA 3SN0A 2VYOA 4ROPA 3JUGA 5D9OA 3BLLA 1KD0A 1JCJA 3RX4A 2ZFAA 3BOFA 4XAYA 2E3ZA 3BQ6A 4GYJA 4Z1BA 1HTIA 4WKAA 1PS9A 3QYQA 1FHUA 4NJHA 4O28A 4A3RA 4DXVA 1B31A 1XIEA 5G1TA 1NF7A 3DH7A 1W17A 3WLSA 3NXLA 2JIEA 1F4HA 3GHRA 4X60A 1J93A 1CIUA 3JW7A 2ZKMX 2PWUA 4E4PA 1UWQA 3ZZ1A 3PAJA 1HT6A 1J6PA 2J8FA 2CLLA 2BDQA 3HV8A 3SRKA 2JBMA 3TTSA 1JDFA 1TUFA 3FLUA 5I23A 2VEIA 2Q3RA 2CFFA 4EXAA 4FLSA 2OQHA 3V4BA 3DFYA 2IPGA 2R8WA 4IQLA 3KOFA 3J7HA 1W3NA 4DJEA 4W93A 2R91A 3GTHA 4LBSA 4GQGA 3R12A 1PTDA 2IPJA 1U1UA 4JTJA 3GDRA 4OVXA 1V3HA 5CC6A 4M51A 2ACUA 2VD8A 3CPGA 4NSBA 3MI6A 3HTWA 1AL7A 3FJLA 4WJ8A 1OYAA 4H7VA 1HO1A 3WLRA 2Z0IA 1GG0A 2RGLA 3K1DA 4R53A 4Q8QA 3M0YA 5AC6A 2V63A 1JDEA 1KCLA 1B30A 4RK8A 4CCCA 4QJ1A 1LRQA 1A0CA 5DEZA 5CPOA 1YNPA 5GNZA 5A5WA 4BQ2A 3CEPA 1B4EA 2WCAA 3D3FA 4PRRA 3UR2A 4O18A 5MKGA 3UJ2A 4HK7A 4GE8A 4TR9A 3LG3A 3P8IA 5D8WA 3MKKA 4LS1A 3AOFA 2VQTA 2E0PA 1K9FA 1JPIA 1ONWA 2O9RA 3W70A 4HMEA 3VE7A 3H2NA 3SUWA 1H11A 1RLCL 4YTUA 3B8IA 2W3ZA 2XHYA 5E93A 1TCMA 1XLFA 3I3EA 1PTAA 3BANA 3P62A 5HATA 2BV9A 2J74A 4E4FA 2Y85A 3OZOA 2EAWA 3NQCA 4ATDA 3EWYA 5AHLA 1A5AA 1KFLA 3EEZA 4D8ZA 4EANA 5B80A 5CH9A 2I56A 4IPPA 3HGSA 1GG1A 1KV5A 1G01A 1XBYA 1VEOA 1N82A 4MNKA 1ZL1A 1UWUA 1R6WA 4UQEA 2Z6JA 2A79A 3G1HA 1ML1A 4INFA 3KOZA 4ADSA 1FDYA 1CLXA 2WO5A 3QXBA 3WNPA 1YNYA 3KRBA 5F2MA 3FJNA 3D47A 1JZ7A 3RGTA 3MP3A 3TN4A 2G41A 3FOKA 4G2DA 3DBNA 1XL9A 1SU5A 3QTGA 3RF9A 2BVYA 2ISSA 3K30A 3LCIA 1X7IA 1KV8A 5LGZA 4XZNX 1GONA 5AYBA 2XGIA 1UR1A 2YDRA 2ISFA 3BAYA 4PMRA 5I7GA 1R3TA 3C4UA 1XC4A 4H9UA 2YW4A 3IUIA 1QOQA 1XUUA 1XLEA 1F4AA 1EQPA 4UOZA 4JNMA 3WQPA 2FLIA 1XWYA 5CC7A 5CC3A 1CXKA 4JTAA 2CBUA 3ZMRA 3BMXA 3D5HA 4L61A 1IEVA 1UUQA 2TYSA 4ZB2A 5AZ1A 4DJDC 2E9BA 2HBXA 2R1MA 1UR9A 2CXEA 4DEFA 1EJWC 5XIMA 1B3XA 1M04A 3NEVA 5A6KA 1I2PA 4UMAA 3AAMA 3UWQA 1KFEA 2ODOA 2REQA 3IS4A 2C7FA 4IT1A 3CZGA 3B40A 4PE8A 2FHFA 3GVRA 4Q8TA 3WNKA 4GRSA 4K68A 4XSMA 1FFRA 4KRTA 2PU0A 4PMNA 3UG3A 2OOFA 2FFIA 1YPFA 1GTEA 4G56A 4PUNA 2Q6ZA 3OLEA 1KTNA 3R25A 4XUGA 1L8PA 4K38A 4JCMA 1DJHA 3STFA 1GZGA 1R30A 1E0UA 2NWSA 2PLMA 3UWWA 1GVIA 3M4HA 3CQ0A 4QDMA 3GM8A 2V81A 4AW7A 4EWND 2Y7DA 4U3AA 3UJFA 4O16A 1DV7A 3RR1A 1TREA 4UFKA 1H0GA 1XXXA 4CD4A 5C9XA 3SRHA 4BF9A 4FIQA 3VGBA 3QPEA 4KFNA 3OHMB 1Q85A 4P7OA 2V2HA 1R9YA 1X38A 3WUBA 3WQ8A 1U22A 2Z2BA 4IUOA 1WQ5A 5H8PA 2CBVA 4RCXA 2PWFA 1NDYA 4UB9A 3LI0A 4MGGA 4DYKA 2RDXA 2FTYA 2J7EA 2NZLA 4JZ5A 3VD3A 3GK0A 4FSAA 2J9ZA 4NUWA 3UXIA 2OQLA 4DX3A 3H4WA 5H91A 4ATWA 3COTA 1ZRQA 4UTJA 2YA0A 3N6JA 3PTMA 2RH9A 4JTTA 1W37A 4AD0A 1XG4A 3VGFA 2DVTA 2YB4A 2VMFA 3T78A 1DPMA 2BMBA 1T0OA 2VX4A 4GZIA 4W7WA 1A49A 4B4FA 1XRSA 3T05A 3IVTA 4LEQA 1NP2A 3VUPA 5AC5A 1E1CB 1Q2RA 4O53A 4AYSA 1NWRA 2ZZ4A 1TWWA 4REQB 5J04A 3WN6A 2J6XA 2G3IA 3H70A 4WSKA 4D72A 3PANA 3LPPA 2YFOA 4TV6A 2G5WA 1EJRC 2VR5A 4MG4A 4GYPA 1C8YA 2YCIX 1TE1A 1V08A 3W85A 2IQ0A 3IUHA 2PDNA 2ALDA 1SM9A 1V7YA 3A21A 4HPNA 3GS6A 3FK4A 1ZS2A 2LLEA 2Y6ZA 1U5HA 3TJIA 1A4LA 3G6LA 1W32A 1CW2A 1NSJA 4ICCX 2OWXA 5GJPA 4IMDA 1C92A 4B91A 1BTCA 4HK6A 5HJLA 2A3AA 2QAFA 4RDWA 4WHBA 4RPQA 4N4PA 2CC0A 4MY9A 1P6WA 3VGGA 3QR1A 1GQNA 4W5UA 2OPJA 3BMWA 5HUPA 2D73A 3OVGA 3UPWA 5B7ZA 4QXIA 4XIMA 4Q4KA 3W25A 4JDBA 3LYEA 4D6HA 3PZIA 4ZQMA 4ZR8A 3DFQA 3GB6A 4AYGA 3U2OA 2V82A 2VDIA 2WKLA 1GOKA 3CUZA 4YCPA 3NG3A 2FGZA 5FSEC 2FZ8A 4QDPA 1CB2A 1RP9A 1MYRA 5M17A 3S1GA 5AFDA 3BV4A 1FTXA 5CXPA 3W74A 4KWVA 2ZVIA 4LUIA 5HINA 3OIHA 2FTPA 1PKNA 1BXBA 3V75A 1KBKA 1V6VA 1OX4B 2VZUA 3G1RA 1MUWA 4C1KA 2HWGA 2PWVA 1OCJA 1YLVA 4JCLA 3CEUA 1J11A 1X1NA 1HL9A 5C2XA 3APTA 2WSPA 1C29A 4W5ZA 3V36A 3C0QA 1CGXA 1ZJIA 2OO0A 3WDPP 4N4QA 4S2CA 3WDQA 3UW6A 1VFLA 2Z1SA 5KZEA 1SFLA 3CK5A 3GQYA 3PWIA 5FJRA 4B5TA 3ORWA 3PTKA 4A3HA 3IGUA 1JL8A 4HPHA 1LZOA 1W3JA 4LJ3A 3ICJA 3KWXA 3AROA 1GUVA 3E3HA 2XWDA 1NFPA 2I9UA 1S1RA 2ZTJA 1CDGA 4NJGA 1VR6A 2WOQA 5G5IA 3UESA 3WFLA 3TTQA 2V3FA 5M1TA 3CPUA 4HIBA 2QJIA 1V7AA 4PRTA 2OWCA 4H6KA 4W86A 3IUDA 3N17A 1UR2A 4IIGA 2YR1A 1YPXA 3WCZA 4RJEA 3DYMA 4MOZA 1QCWA 1V3LA 7ENLA 1XRVA 1E0VA 4DF2A 4DXKA 2WW5A 1FRBA 3WQFA 3WDHA 1Y5WA 2PGRA 4LVAA 4GO8A 5HDRA 1GJPA 1TV3A 1NTHA 3DHUA 2QCDA 2VD9A 4IMFA 5C9UA 1KKOA 2ONEA 5PTDA 4Y90A 3VX1A 3S83A 4MJ2A 3T7VA 8TIMA 1U5JA 4Z1CA 2VEGA 3GVGA 3R94A 1W8SA 4O54A 2D1ZA 3AMLA 4FHAA 3NZRA 3M16A 1UWSA 1UKPA 4J3UA 3WJWA 7TAAA 2E5BA 4RE4A 3O8AA 4MNLA 2JKAA 3GFYA 5AZ0A 1TIWA 1WAUA 1XYFA 3MTWA 2DUAA 2ABBA 3B04A 1AMYA 1BRLB 4QLJA 3SJ3A 3TJXA 3FYOA 2R94A 2XINA 1QPQA 1AD4A 1RJPA 3W88A 3QSTA 4FP1A 3HG4A 3GTFA 2R24A 2Z2AA 2D23A 3VIFA 2IQTA 4UZUA 3GG7A 4C7DA 4NNCA 2ATMA 3TCSA 3V0UA 1OCBA 1UIOA 4HP5A 3M5YA 3HM7A 4B15A 4XD5A 4JKMA 4PBFA 1A5LC 3I7QA 2Z1KA 1G7VA 3PJXA 3AJ7A 4J2PA 5BXSA 1GQKA 7XIMA 2PDGA 2PP3A 3GWQA 4QCFA 3XISA 3RPMA 5FL0A 4QAIA 5GNYA 3GNDA 1B9ZA 4B4HA 2RUSA 1W5OA 3MO4A 1C91A 4PCFA 3R0DA 1VCGA 5EBUA 5ECVA 1MDLA 1KCKA 5HAOA 5D9PA 7REQB 1Q4WA 3IJ7A 4NNAA 4I7VA 2FB3A 3ABXA 3NOEA 1UP0A 2XUCA 1ISZA 3TUUA 5HNRA 4JS3A 3S4TA 3LRLA 1K7FA 2GGIA 4MUZA 1W9UA 1YPIA 1UROA 3LZ5A 3ONCA 5CG0A 3EA3A 4O10A 4E8CA 4IX2A 3N29A 5EU9A 4IQDA 2WSQA 1IEIA 2WCSA 4M82A 5I24A 2AKZA 3OVRA 2DQXA 2W91A 4J1OA 3EZ4A 3V35A 4C6PA 4AD2A 1DE6A 1OF6A 2NQ5A 3VOFA 4IM4A 2PCQA 3AS1A 3GR8A 3SRDA 1UPPA 1GW1A 3BURA 2DEPA 1OB0A 4E8GA 1OFDA 2PGFA 5GJNA 3ALFA 1TVLA 1HNYA 1P7TA 4JQ1A 1G5AA 3LCWA 1G4SA 1LQAA 3PBGA 2YW3A 3TN3A 1J0ZA 1G4TA 5HQEA 3M46A 3VMOA 2XYLA 5BXRA 3UGVA 2E77A 3C2FA 4A8LA 4B2DD 1UP3A 2WC3A 1P0EA 3MJYA 4OECA 3M44A 4OV9A 2YFNA 2QKFA 4C6LA 3VC5A 1H1YA 2E8YA 5HA7A 4E5TA 1ISYA 2PF8A 4Y9NA 3XIMA 1AH4A 4CD5A 5CPMA 4R9OA 4UOJA 2DORA 2EG7A 3PC0A 2VC6A 3DFSA 3HOJA 4B5UA 3CQJA 5D37A 2WYSA 2QT3A 3VDBA 1CECA 4Q8UA 3S3GA 1WXJA 3WQ4A 2PWEA 1OT2A 1US3A 3M0XA 3JZEA 3WLHA 2E67A 1XINA 2Y61A 5M3WA 2RKXA 1S5NA 4GCXA 1H7RA 3SCUA 3TLLA 4NAEA 1VJSA 3TLQA 3MS8A 1YTEA 2JGQA 3EKLA 1DWGM 1VF8A 3BZGA 3IGHX 3OA5A 4JAWA 4AVOA 4IG2A 4ASTA 4NHVA 4JL2A 1CZ1A 2DV0A 1V6WA 2D2OA 3ARSA 1RVGA 3Q4DA 1Q6CA 1F73A 1IYXA 4XAPA 4UQBA 2X1UA 6REQA 5HXMA 4MY1A 1WUEA 2GQ8A 5CGQA 2PF0A 5HNNA 3KCLA 3AZSA 1A3HA 2A2IA 2X8RA 4F66A 4KEUA 2XDFA 3OG2A 2C1IA 3GNOA 2CLEA 4V15A 4PRWA 4IISA 2ZRYA 3QZEA 3IVUA 2KAUC 3OGVA 1JRBA 4QBXA 5BXPA 3CTLA 2Y5EA 1OX6A 2GVLA 3I10A 1J5SA 4K2SA 4H6RA 2WJZA 5CBBA 4KBXA 4NRSA 4PMXA 2O56A 1JG9A 1WA3A 1TTPA 2VZTA 4TOQA 3FKKA 1M68A 3A64A 4NU7A 5LNUA 3MO7A 1TZ9A 2HV5A 1NDZA 2O92A 1Q3NA 1V77A 3U7BA 4PUWA 2YIHA 3MUY1 1HL8A 4JHZA 4UMCA 2B7QA 4DLFA 4LAMA 1R86A 1NFBA 2GUUA 3SIMA 3URQA 4ZFMA 4MIMA 2PTDA 2DZVA 2XISA 3N34A 3MMWA 4D6GA 3EEGA 3AXXA 1SUXA 1TMLA 3THDA 4E4UA 3E74A 3HPXA 2A3CA 1L0PA 4G1NA 3VZYA 2WZIA 2PWHA 4H9VA 4KFPA 4Z1DA 3RN6A 3TMQA 5I3HA 3AYVA 1FWHC 2PLKA 5L6UA 3PUGA 3WQWA 2FPVA 1KM0A 1W1IE 2J27A 1UJQA 1ZU8A 1THFD 1A5NC 2VC9A 3W87A 3GNNA 5M2FX 5LIWX 2W63A 1WBHA 3NGJA 4I6VA 1EA9C 4KWOA 3LQGA 1C90A 1OC6A 2ZRWA 2HK1A 1EBHA 5DY2A 1LJYA 3VA8A 5CC5A 2NSOA 1VFSA 5BNKA 2A21A 1JZ8A 4UTMA 4NASA 4UQ9A 2EG6A 1XYMA 3WQVA 1LDCA 2CLOA 1LF1A 4C5ZA 2Q71A 3SQMA 1W3LA 2ZA2A 2YL6A 4WY0F 5LA1A 3M0LA 3QYSA 3AUJA 5DFAA 2YCJA 5C9RA 4DBUA 1CYGA 1TSIA 1XGDA 5IBXC 1AZ1A 4U31A 1XQLA 1JEZA 4YIWA 4F48A 1LQ2A 4Z1AA 3PR2A 4LCSA 2XH2A 3SCSA 3EX1A 1NIUA 2CBJA 4YCOA 2F7FA 2V3DA 2JF7A 3GYCA 2EHHA 1QRQA 1EDQA 3TYBA 1ZUAX 3U2CA 4EACA 1B57A 4EAMA 4N02A 1KGWA 2ZUVA 3GH4A 2W67A 3M6DA 3OIXA 4JPGA 3S6OA 1O68A 3L67A 4ZOAA 4GXWA 2BGQA 5EL1A 3LXBA 1K6AA 4Q6JA 1QHOA 4WVXA 3SGUA 1HKIA 1ZY9A 4ACYA 2J7HA 2E6DA 1DP0A 3C8FA 3GG1A 1R85A 3UPMA 4CD8A 4PTXA 4AIOA 1Y5VA 1OT1A 1E40A 2CLHA 4B16A 3WDIA 1HG3A 3IJQA 4L6OA 1MFVA 3NUKA 2YLLA 3PUDA 3AU6A 2OLHA 4XB3A 3GRIA 3TQVA 4B5NA 1FWRA 1CWYA 1HGWA 3OG3A 2VGFA 3FJ4A 3W28A 2QCEA 4GVIA 2PC4A 1HO4A 1Y0EA 3LRKA 3IGXA 3ZSTA 2XVLA 2Z28A 3ITTA 4M29A 2P8BA 1SO6A 2OQYA 2YB1A 2ZXDA 3LS9A 4ZBCA 3LA4A 4S3CA 2R9RA 1HP4A 1PWMA 3P81A 4EXBA 5BW6A 4W7UA 3VOCA 1R46A 2R1KA 2IQDA 3PVFA 1E6NA 4K7VA 2ALRA 2FMNA 3T6CA 1MW3A 2NVCA 2ZICA 2PPGA 4LUJA 2XIJA 3HPZA 1QNSA 1UBPC 3BAXA 9XIMA 1GQJA 3OBKA 3A22A 4KRZA 3PK7A 3JVAA 5A6MA 4C7FA 4FAMA 4FNPA 4UTHA 3CB8A 3NCOA 2OYLA 2X40A 4MLJA 3UXDA 3BGJA 3LSCA 2WZTA 4Z0SA 3CTTA 2XVPA 1VENA 3OGSA 2ZBTA 3DYPA 1K8YA 3UR7A 1VPXA 2QDGA 3M0ZA 3P5ZA 1LUCB 3UA4A 3M7SA 1IF2A 2FB2A 3R43A 3CZKA 3NL3A 4IFKA 1XDLA 4HMCA 2Q8LA 3T0AA 3E9AA 1WZMA 1NWUA 1ITCA 2GZXA 8RUCA 5A6BD 1IIGA 3AMKA 3T08A 5C7VA 1SMAA 3CIXA 2AGKA 1AQHA 1VAHA 1FWSA 3KWSA 5C55A 1TWZA 3H26A 4HU0A 1F5ZA 5LZLA 1SR0A 2QQ6A 4I90A 1I60A 4FNQA 4XTIA 1VCVA 2HVMA 3G0SA 3GLCA 3D6NA 1Q6DA 2MUCA 3THCA 4MB4A 1OEPA 1XD0A 4WXZA 2E7FA 1XBXA 1TG7A 2FKPA 1ZZMA 4HNOA 1FCVA 3FEMA 2DZBA 4XBSA 1EC7A 3LQLA 4M0XA 1M9HA 1PTGA 4JR5A 4S39A 1YW1A 3WY1A 1E0WA 2VUNA 4KCVA 4PULA 3VCCA 3H4XA 1DHKA 1X6LA 1U33A 3NQMA 1BVWA 2UY5A 2G3MA 3OBAA 5LHEA 4IIEA 4WOQA 1XM3A 1YBQA 4PL2A 1NY1A 1PEZA 3TQKA 3WQDA 3DFHA 4JHOA 3SQSA 4D6DA 2Q3OA 4NILA 4A2RA 8XIAA 3NQAA 4O11A 5E6ZA 4H9MA 1F6PA 3LENA 1FWWA 1J96A 4LWWA 2WVTA 2PDBA 3H53A 4QS6A 4GYFA 5AYXA 4XZHA 4AQLA 1DXEA 2I57A 2UY3A 1IT0A 4FR6A 1F61A 2ZC8A 4P2VA 4LW7A 5I3GA 2J6VA 3NWRA 3CQIA 4W8BA 1PZ3A 1LRTA 4DZHA 3MHFA 3SURA 3K4WA 1MXGA 2VWSA 2RDWA 4KH2A 3R8HA 3OVPA 2D24A 2GWNA 3LZ3A 3W53A 3HQOA 1CTNA 1CGVA 3VIHA 3ITVA 2EXOA 4NI3A 3CT2A 1EP1A 3TJ4A 3G0UA 3FA5A 2VI0A 3CO8A 3LBCA 3ARWA 3TN5A 3W22A 2XZ7A 5LIUX 3C8NA 2DFAA 5K4XA 1J0KA 2WANA 2YL9A 2I7GA 4FA3A 1M7XA 4GGBA 4PMJA 4HYRA 3THUA 2J7BA 1TTQA 4L5ZA 1QI2A 4N9CA 5CSRA 5A6JA 2DU2A 3PWAA 1FKWA 1SGJA 5KETA 2FVLA 3AS2A 4C90A 1N8FA 4C6NA 3ALGA 4UUIA 3SSJA 1SO4A 1OVDA 1F6KA 3V1HA 3WNMA 3A4AA 3KL0A 3STCA 4IXXA 5BWFA 3G18A 3BICA 3TH6A 1AMKA 4HU3A 2WSYA 4AC7C 1TPH1 4MWAA 4JKKA 1L9WA 4W7VA 4QSHA 3SUTA 4A22A 3BTNA 1XIGA 2ZCGA 3QPZA 1TE6A 2CNCA 1KR1A 1G6CA 4NL1A 3TSMA 2V5BA 1AW5A 4JKLA 2OVLA 4HMNA 1WO2A 1W9VA 4OOZA 3R5EA 1GKQA 4FNSA 4P61A 5FEZA 1A50A 1EF2A 3W29A 3F1QA 4AF0B 3ZOAA 1OX5A 1HW6A 5IBXA 2WBKA 1XIHA 1BVZA 1LT7A 1XCFA 5JBFA 4JTEA 2CBIA 4O1FA 4V33A 3B9OA 3DC8A 4O14A 1KCXA 3MSRA 4MZ8A 2NV2A 3SFKA 2A0NA 3GIPA 1UOKA 4F0KA 3DIPA 4NZ5A 1JIBA 2D0HA 4OOUA 3QLLA 1M01A 3RMJA 3HG3A 5A8PA 5EY5A 1MZHA 3ZXWA 3LU2A 2DT3A 3MI3A 3WK2A 5K7JA 1E4MM 2ZZ2A 4HCHA 4YNGA 4QR6A 1DWIM 2HTMA 5JUVA 2DZTA 3PS7A 1TIMA 1H5VA 1PX8A 1ITUA 1Z3NA 1OX4A 1UASA 4IMGA 4AZ6A 3FS2A 3USZA 4GO9A 4R7WA 1OSEA 4ALDA 1PHQA 3UVAA 4DJFA 4GMEA 3GH7A 5E6YA 1VZWA 5D9MA 5FAJA 3VD9A 4H00A 3G77A 2QDHA 1V6TA 3WX7A 1W1YA 6XIMA 3CHDA 3M1ZA 2X16A 1TPVA 2DH2A 2GGHA 2QVHA 4WIWA 2QR6A 3VM5A 5A8QA 4PCPA 3FXYA 3NOYA 1KM6A 2DZWA 5LSMA 5HK4A 2VFFA 1WXYA 3RITA 4UTLA 2QDDA 1EJ7L 1QOPA 2GGGA 3Q2DA 1VCFA 3KDOA 4UTIA 3TC3A 1BYBA 4QSFA 4ILSA 2ZUNA 5DMMA 4LB4A 3EXTA 2V3EA 3BWWA 4JX5A 5D2TA 3DFPA 1XRFA 3PULA 2Z1XA 4MKNA 7PTDA 4IMEA 5DCDA 4JFUA 4Z08A 3BCFA 3WDJA 2HQAA 3UWEA 4LAKA 4YTRA 1ZJAA 3KHDA 1PX4A 4WXYA 1EPVA 5HULA 3QFWA 3DC0A 2ZDSA 4TVDA 2VWTA 1WCGA 4S2BA 3LHZA 3S2CA 3GSMA 4UMBA 3W83A 3VNDA 2XN0A 4LC8A 3EWWA 1K4HA 3LTPA 3TK7A 1POJA 1OC5A 4F2UA 1CGYA 5G4HC 2A85A 3UNDA 5G2HA 3EWZA 2NX3A 4BWLC 1SO3A 4GX9A 1VYPX 4GQRA 4DWSC 4MLRA 2CLMA 1P0NA 3PBYA 4OU1A 4U4MA 1XGZA 2X09A 1XRTA 4KEMA 3OPSA 3P6LA 4K8EA 4ZO6A 1IWPA 2IPWA 3MYOA 3W7QA 1TELA 3GU1A 1E6ZA 4RW5A 2ZTKA 1OHLA 3CYVA 3UERA 2D3LA 2VX7A 2DW6A 5EGRA 1DJXA 1RA5A 1GGOA 1RBOB 3S5SA 1O1HA 1KLYA 2MNRA 5LNRA 3HZ3A 4HA3A 4QE5A 3LV6A 5FJOA 4P8VA 3TTEA 3KS5A 4MUPA 6A3HA 3A13A 4IG2B 1W91A 3ZR4A 1L8NA 3ZJ8A 5FD0A 1W3HA 2EPMX 2CIPA 2HXUA 3S9YA 4M8UA 1KFBA 1H7NA 1IGWA 4YTTA 5ABEA 2BGNE 4A21A 1L6GA 5MHBA 4HMDA 4XISA 3RRAA 2IMRA 2J78A 2ZYFA 4J3WA 2QJJA 3NSMA 1SZNA 1UQYA 2W0UA 4LBRA 1C7TA 5AVNA 1KO0A 4AZHA 1OFOA 2WVVA 2VELA 1L2UA 3H7UA 3WBXA 5CPLA 4XX6A 1YE4A 2NQHA 3QMSA 4WD0A 3TNBA 1UOZA 1BYDA 1OGSA 3F4CA 2IKHA 1I2RA 4E38A 1HJQA 1PCKA 3AXHA 1X8CA 3H2MA 1EXBA 1W3IA 1TQJA 5HR6A 3RDKA 4LS2A 1E1EA 2TPSA 2WNQA 2QV4A 3UCQA 2E40A 4GIRA 3W1TA 3VKJA 4YHGA 3L4VA 3VK5A 4L4MA 3SO7A 1QFEA 1XP3A 4JTFA 1VB9A 1G94A 3VI2A 3N2MA 2EQDA 4QEEA 3KM8A 3WH5A 4CQCA 3QHNA 3RUBL 4H2HA 3O6CA 4KCTA 4J28A 3KFTA 4JTRA 2A7PA 1I75A 3B0VC 3PBUA 2YXXA 2VDHA 3ITLA 2CKSA 3GNPA 1LWIA 2OYKA 3SJNA 2P10A 2H6RA 3MU7A 2A6NA 5CKSA 5HMFA 2QEZA 4CD6A 2E6YA 3N04A 4IFRA 4L9ZA 4OHQA 2WVSA 3QN3A 3DDMA 3RIKA 1OFPA 4TU1A 1WYIA 4X2PA 3L66A 3BPWA 1ODZA 3EXRA 1BQCA 2FGLA 1Q4NX 4NYUA 4R88A 3ZT7A 4G7EB 5IDIA 3RX2A 5D33A 1XSJA 3MWCA 4KEZA 2HE8A 4AY7A 2ANUA 2O9TA 2XVGA 1AVAA 3BOLA 1EO7A 3TQPA 3L4UA 3WO8A 1UB3A 3MCNA 1LYXA 2GJPA 4OGZA 1I6NA 2CW6A 4G6CA 1H7OA 3GUWA 2QUUA 3CU2A 4AIEA 5FJUA 1HVQA 4MDOA 3G1VA 4MMWA 1VFHA 3W23A 4IUGA 4KEVA 4E2DA 5E0KA 2QCMA 5JBDA 4A3YA 4C1NB 3MYPA 4JXCA 3NM1A 5FL1A 4S3AA 3NXFA 1S1PA 4BZYA 1H60A 1H51A 2NT1A 4F8XA 3CO4A 4MFEA 2WKJA 1JCLA 2J7CA 3TEVA 3NYZA 5E9AA 4OBRA 2EGZA 1Z32X 3KDNA 3URAA 1P48A 4IIDA 1QW7A 1ZP4A 2OLAA 3QOKA 2EKCA 4QFUA 1QATA 4PMVA 3G1DA 1CCWB 3TZNA 3PPHA 1UWTA 4JY9A 1FXQA 4TIMA 1WDDA 2YCLA 1JYVA 5DT5A 2GUBA 2W79A 4FNTA 3WH9A 3H7RA 2QJGA 3P84A 2QPUA 4BWLA 3S5YA 3RM9A 5EMMA 3I6TA 4WZHA 5J5DA 4NF7A 1SJDA 1JJKA 1W5NA 2VGIA 3C61A 4NJKA 5JIWA 3WBEA 2AOSA 4LYPA 5CSYA 2F2HA 2G4JA 3C6CA 3M0HA 2NT0A 3WEOA 1W56A 2E5DA 3O6AA 5LIYX 1JXJA 4MYAA 3DXIA 2PSNA 2D2HA 3Q65A 4MJMA 1XIMA 3EMZA 3HPSA 4IWWA 2ISWA 1GZJA 5F7UA 3LMZA 3VFCA 5AVHA 4RNHA 1AJZA 3DGRA 2RGMA 5F2GA 1Z41A 4OUIA 2VVNA 2BASA 3S1XA 3B0XA 3OTRA 4P8XA 1Z7AA 1K8ZA 3UF9A 3VE9A 2J75A 3HGRA 4LGXA 2P0OA 3VAVA 1W5MA 1QW9A 1AZ2A 2DH3A 3KZSA 4I5RA 1JZ6A 2PCEA 2W5FA 4MSSA 5EMUA 3SSZA 4DO5A 4EX4A 3A5VA 4PMYA 4AWEA 2EBNA 4R85A 1V5XA 1F05A 3SUVA 3NDOA 4PTDA 3GXFA 2WCGA 1F8IA 3O3RA 4JEJA 1VRDA 4C7GA 2HXTA 5CGMA 3RCMA 4Y9PA 3ABSA 4P5UA 5GJMA 4I9MA 1P1XA 4CN1A 3CV1A 1A5BA 3TJLA 3GFXA 2B31A 3N2XA 3VO0A 3C2EA 4BI6A 3MZNA 1DE5A 1NWTA 4W89A 5C5YA 2BY3A 2C8NA 5FF3A 5HNUA 3EB2A 3CAWA 2Y7GA 4JQ2A 1W9BM 2H3BA 1TFVA 2X0SA 3DESA 2E9MA 1Z8AA 3TYEA 2VCBA 2OU4A 4LVGA 4JIHA 3K8KA 1HJUA 3KVMA 4WJXA 2PDPA 3IAPA 4Z1YA 4LYKA 5A94A 3WF3A 1M03A 3WMBA 3O0KA 4I7UA 3I3BA 1POKA 1XUZA 5E09A 5BOOA 3FGCB 1J10A 3MY9A 2DUZA 3W7GA 3VIIA 2FTWA 4IJBA 3SFWA 1UKQA 1J8VA 5DELA 2O4MA 2W4XA 2BWGA 3FA3A 1WE5A 1EJTC 5BMXA 2G8ZA 3MANA 3QHMA 3WENA 3MUXA 2C0AA 4FXFA 3OP2A 3ZYZA 2ZX7A 3V3WA 2W27A 3TROA 1KBLA 4LPCA 4CNOA 1I1WA 2DSVA 1XG3A 3RR4A 3ZVIA 3SCNA 1NARA 1W3TA 3MVIA 3W0KA 3CV2A 1ZP3A 3N4AA 5LXEA 1GNXA 2BSLA 3WFZA 1KTBA 4GA8A 1VH7A 5H8UA 2P53A 2DW7A 4H6QA 3W7NA 2DP3A 2ZXBA 1JFHA 3W1XA 1DXIA 3IJ8A 3EB3A 3STPA 1EGMA 1R7OA 2WLZA 4J27A 5D4YA 1Q6OA 2R6OA 5K9CA 2VVSA 1TKKA 4H6EA 2HDJA 4D1JA 1R3VA 1CXIA 2DUXA 4DQWA 1XISA 3I65A 5I0DA 2OZTA 2YX0A 1XHGA 3P74A 4GQ0A 1EJSC 3GXPA 1KXTA 2GQ3A 2YL8A 3LNMA 1S2CA 4IP4A 4IPIA 2WJEA 2Y63A 3L2IA 4WX2A 2HRWA 3GIQA 4HA1A 1OD0A 2GGJA 3W76A 2PDKA 2IPFA 1EYWA 3CUHA 4RW3A 3GXDA 4KWWA 4WUIA 1MQRA 4NJIA 1VLWA 4PBEA 1DIOA 5CPNA 4LVFA 3CS2A 3VIKA 4AC1X 2V67A 2WHLA 1YTDA 4N2YA 1ZPTA 4YWIA 4DO4A 3UA3A 4JN6A 5LIKX 3KHJA 3S5ZA 4AEEA 4BQ5A 2WZEA 3OOQA 4J3VA 4XZLX 1SZFA 3BW3A 1TR9A 3EOOA 1QBAA 4IL2A 3KBSA 3BW4A 4C60A 3EWUA 4OQVA 1EOMA 4MTVA 2AGTA 4HQVA 1O6IA 4BEUA 2WC4A 3LLDA 2UV8G 3NM3A 4D6CA 4JQAA 3EOLA 3PB0A 2XFYA 5SWUA 3G1XA 1EGZA 2OTDA 4L9YA 3R11A 4JTGA 2GQ9A 3I68A 3GG8A 3CXOA 4LX4A 4RR4A 4UR9A 4C6QA 3ABRA 3TFCA 2X42A 4QROA 1G7UA 2WJDA 4UTWC 1BF6A 4HZMA 1YRRA 1XBVA 2R1PA 2PZNA 3KLLA