2NUYA

2-keto-3-deoxygluconate aldolase from sulfolobus acidocaldarius in complex with pyruvate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
288
structure length
288
Chain Sequence
MEIISPIITPFDKQGKVNVDALKTHAKNLLEKGIDAIFVNGTTGLGPALSKDEKRQNLNALYDVTHKLIFQVGSLNLNDVMELVKFSNEMDILGVSSHSPYYFPRLPEKFLAKYYEEIARISSHSLYIYNYPAATGYDIPPSILKSLPVKGIKDTNQDLAHSLEYKLNLPGVKVYNGSNTLIYYSLLSLDGVVASFTNFIPEVIVKQRDLIKQGKLDDALRLQELINRLADILRKYGSISAIYVLVNEFQGYDVGYPRPPIFPLTDEEALSLKREIEPLKRKIQELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho gluconate a
publication title Biochemical and structural exploration of the catalytic capacity of Sulfolobus KDG aldolases
pubmed doi rcsb
source organism Sulfolobus acidocaldarius dsm 639
total genus 115
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 4.1.2.55: 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate
pdb deposition date 2006-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2nuyA00
5F4WA 1F6KA 1SO6A 2VXNA 2BSLA 4NT0A 1LOLA 4TMCA 1ML1A 3LCWA 3VCRA 1GOXA 1W5MA 2R91A 1NVMA 3N14A 1CI1A 2V5LA 3TX9A 3QQ0A 2Z0IA 3IV3A 4JR5A 4XTIA 3E0IA 4WJEA 3C2FA 3VE9A 1KM3A 3VNDA 5AHFA 3C56A 3W87A 1RD5A 3LXAA 3UZJA 3PF3A 3O1NA 4OHQA 4LW7A 1FXPA 1YTKA 1SZFA 4DBDA 4UTUA 2JGQA 1K3UA 4R34A 4ZQRA 3SIZA 3WJWA 1WX0A 1ICPA 3W7LA 1RVGA 1OYCA 1LLZA 5IBXA 3M1ZA 3TV8A 3UXDA 4NZFA 3M9YA 4KKXA 3NQAA 3P8IA 1GG1A 4NXSA 2Y7GA 3UWQA 1AW5A 3TFXA 2X30A 2X2GA 4IX2A 1W8SA 3NPVA 2F7FA 2QCHA 5G1YA 1H51A 1FWNA 2YYUA 2NX1A 3N73A 5BW6A 4PA8A 3O6DA 3TXZA 3LCGA 1W54A 2QCDB 4BK9A 3TSBA 3QC3A 1KLZA 3HGOA 2QCLA 1K7XA 2JKAA 3G8RA 4EOUA 2ABBA 5CZTA 3W74A 2Y63A 3BGGA 3QFEA 4PC8A 3UWVA 1THFD 2QCFA 5F1VA 1XBVA 4POCA 4N2YA 4JD4A 4OWGA 5BRBA 1IXQA 4O19A 4Y6GA 2CZEA 3L0NA 3R5EA 1V7YA 2DJXA 1PHQA 2ZZ3A 3HO8A 2VFIA 3LV6A 3W7KA 3DI1A 2VFGA 3R8RA 3H53A 1FUYA 1WAUA 2E6YA 4IWWA 4RR4A 3O16A 1K7FA 4N9EA 3E96A 4ZL1A 1OFRA 1JCMP 3HMJG 2ZDRA 3W2MA 1L6YA 3SSJA 1TTQA 3FYPA 1H61A 4A2SA 1FQ0A 3WJYA 3A24A 3C4UA 1E51A 3M0ZA 5LGXA 4MLJA 4UTHA 3CHVA 3IRDA 4YMZA 3S5YA 3S42A 4Z08A 1GTEA 1H7PA 2WO5A 3LCIA 4I9AA 4FX8A 3NO5A 2H3DA 5D33A 4IPJA 1U5JA 5AN7A 1NSJA 3MUXA 1XBXA 1YTDA 3PUDA 2GVJA 1JCJA 2YW4A 5LHEA 3ELFA 3OIXA 3B0UX 4O52A 3K30A 3QMSA 2FFCA 3NR0A 2TSYA 3LXBA 1KBIA 3C8FA 3DFNA 4BI6A 4L4LA 2C19A 2RDWA 1Q45A 3L0GA 4O13A 3B4UA 3DI0A 2ZA3A 5CGQA 3STEA 1L9WA 5DLCA 3HF3A 2B7QA 2OZ0A 3L9CA 2P10A 1I2PA 1VCGA 3DFOA 4JGDA 4WY0B 4JYDA 3W72A 1D3HA 2JGYA 4UTJA 3W7EA 1P5BA 3VKJA 4PH6A 1XBZA 3NXFA 5GVJA 5BOOA 3QPYA 1LOSA 3RU6A 4LC6A 1W5QA 4JTJA 1A5BA 1XBYA 2A2IA 5HJLA 2VEIA 3G1XA 3NEVA 4HSOA 3UY7A 3TE9A 1D3GA 3VFLA 1JR1A 1GVFA 1LORA 1JUEA 4R33A 4K37A 1O94A 3ABRA 3W70A 2WNNA 4OGZA 3STCA 4IMDA 1TV8A 3W7RA 2V8ZA 3W75A 1TPFA 3TAKA 1GVOA 3IIZA 5LGZA 3IGUA 5HUPA 2VEPA 2ZBTA 4LVGA 4CQ9A 2ZRZA 5D02A 1G69A 5F4SA 5D30A 3BO9A 3HGJA 2ZRWA 1MXSA 1QDSA 1O4UA 4HNVA 3UXAA 2XN0A 1SU5A 1WBJA 3W1UA 1HO1A 4IMCA 4GRSA 3L2IA 5K9CA 3W1XA 5CPMA 2ZQ0A 5DCEA 3MP3A 2HSAA 1SFLA 1M7PA 2ZFAA 5I3FA 4M6PA 1OJXA 4O0KA 2Q3OA 1FDZA 3EX4A 4NVTA 3TMQA 3BW4A 4MVAA 3CIWA 3HGSA 1KA9F 2A6LA 1U83A 3UZ5A 2QJHA 2J9YA 2VEKA 1R2TA 4P61A 3LHZA 2ZRYA 3W22A 2BLEA 3ZR4A 5HMSA 2FPTA 3THQA 5C6MA 3QSRA 1FX6A 4WY0F 4GNJA 3A21A 4BI5A 1KV5A 3OVQA 2QF7A 3KX6A 3P60A 5DXYA 3DKJA 4WZHA 3P74A 3G1AA 2B0MA 4GC4A 3G1YA 2FDSA 3IIOA 5DELA 5C55A 1SUXA 1GG0A 5AB3A 1G7UA 1OABA 3LHTA 3W7QA 3O6YX 1K03A 1SO4A 1Z42A 4I7WA 1ZAHA 2EPHA 5D2XA 3WFAA 1PHWA 4MJZA 2QDHA 2Y7DA 1KM1A 4GJ1A 3SECA 2DU2A 2X1TA 1FWWA 4KFNA 3NQ2A 4FIRA 4HHPA 3W7GA 4LVAA 4YLWA 5U7SA 4PTNA 3PVFA 5HINA 1GPWA 1W5PA 5EL1A 2NV1A 1FBAA 1V5XA 3W7MA 3CTLA 3W1RA 1MSSA 3PUOA 1FXQA 3EB2A 4JIQA 3USBA 1LM1A 4UFKA 1OVDA 5D05A 2RDUA 3I7RA 3UD6A 3EKLA 4A21A 2FPYA 2AQWA 4N9BA 1LBLA 2ZRVA 2QAFA 1TTJA 3M7WA 1A5CA 3EXSA 4AWTA 3MYOA 4ZQOA 7TIMA 1LCOA 3LCLA 2NX9A 1GVSA 5KTLA 2G95A 3MI6A 5AC7A 1UCWA 1I2RA 5L6UA 3ZWSA 2ZA2A 1HO4A 5I3HA 5D38A 3HGRA 3TC6A 2EHHA 1YLVA 2WNZA 1GWJA 5D2VA 5K4XA 3PSWA 3P80A 4NJKA 3DHDA 3G24A 4Y90A 4TO8A 1ONRA 1SSDA 2GVLA 4JYFA 2YR1A 2J9XA 2ZYFA 3P82A 2J6XA 1VPXA 3G0SA 4ZQMA 4IOTA 2XFWA 3BLIA 5I3IA 3QYQA 3S1VA 3GR8A 1OFEA 2PCQA 1IXOA 1NF7A 4JTLA 3C52A 3PB0A 1Q6RA 1T96A 2V2DA 3EWZA 3NPUA 2NLIA 3IGSA 3IIVA 3LBCA 3B03A 4NZJA 1SW3A 3MW7A 4LOCA 3S6DA 3BW2A 4NNAA 1SW0A 3BARA 3STFA 4AWUA 3SJ3A 1IXPA 1W0MA 1JVNA 2QJIA 3DBPA 3T78A 3B0VC 5KZMA 3DFSA 4HNNA 3CT7A 2H6RA 3PAJA 1S5VA 4C1LA 2NWSA 4KWWA 1QOPA 4R7JA 3VE7A 3RMJA 4GUIA 2VFDA 4MUZA 1PIIA 2DZUA 4O1BA 4IJBA 3TSDA 4ORIA 2VENA 1KM4A 1OX4A 5F2GA 3LTYA 1H1YA 4O28A 3LTPA 3TJLA 1RQHA 2YGYA 1LLWA 4DELA 3TCEA 4E38A 4XTDA 3GVGA 3L5AA 1TV5A 1TRIA 3BLFA 2DZPA 1YDOA 4RXFA 4DPQA 2PRMA 2C13A 3B05A 3W7CA 4FNTA 3NQGA 3W23A 5ABTA 3B0PA 3LCFA 3M5YA 4S2BA 3NAVA 1GEQA 1RPXA 1TYGA 4ONVA 1OK4A 3L21A 4NNBA 1WA3A 3S9YA 2Z1BA 1XC4A 4KFOA 5BMWA 4UFIA 1P0KA 1JUBA 4O4VA 1MEIA 3LRKA 4UCGA 2E77A 4K8EA 1EP3A 4NX5A 3NGJA 1XFBA 3W88A 4E2DA 4GUGA 5E0KA 3W1LA 2RKXA 3NG3A 1YYAA 5TQLA 1O5XA 1DBTA 1UB3A 4TU1A 3OA3A 5G4EA 4DO5A 5HR6A 3G22A 4JS3A 4NJHA 1PV8A 3N9RA 4Q32A 5AFDA 2RFGA 4DF0A 1HL2A 2QCNA 3F03K 5LZLA 1B3OA 2OT0A 3LHUA 3SR7A 4HNTA 3TIMA 4JTHA 4HSNA 5KZEA 5K4ZA 4HN4A 2Y85A 3F1QA 3S1XA 1N55A 1OF8A 3B8DA 3S0CA 3L5LA 1SZEA 1F76A 5F2IA 3DU0A 1KFCA 3LHVA 4O16A 2YSWA 3F4NA 3A5FA 3BPWA 4JIPA 5AHMA 6TIMA 5J5DA 5D2TA 3HG4A 3E9AA 1DV7A 1OYAA 1OFAA 4IPIA 3L66A 3S1WA 1EP2A 3GXPA 4CCEA 3SFKA 2DZTA 2V2HA 2LLEA 3LGEA 4X3ZA 3IEBA 3LCHA 4ORMA 2A7RA 5HR7A 5LHFA 1JRBA 4UTIA 4ADSA 2V2CA 3PS7A 1H1ZA 4OBTA 1XUZA 3LBMA 1SSGA 1DJQA 2C18A 1OHLA 2IQTA 3YPIA 4JDYA 2G96A 1IF2A 3FOKA 5FF7A 4GBUA 1SQ7A 1G4PA 4MLRA 4M7SA 5I3KA 4Y96A 4AF0B 1UUMA 2FTPA 3GIYA 4FXSA 4O15A 4CCDA 2CZ5A 1VYSX 1PVNA 4NNCA 4DF2A 2VELA 3NPWA 4JTIA 1VJIA 2QUUA 4WOQA 5AYXA 4QSHA 3M16A 3OEXA 1ZAJA 3P7YA 1TPC1 3EWYA 2GVGA 3G1FA 4TR9A 4IMEA 4JTTA 5G5IA 2E6FA 1P4CA 1EWEA 2E1DA 3M47A 2EKCA 1JRCA 3EWBX 1DQXA 2B7NA 3NDOA 4UXDA 4UTTC 4NJIA 1TRDA 5TIMA 1J4EA 1F2JA 5C54A 4FO4A 4FB7A 4DEFA 1DVJA 3CU2A 4EWND 4YXGA 4QM1A 3KRSA 1W1ZA 3FEMA 3W9ZA 1EB3A 2Y88A 4UTWC 2QR6A 1T99A 1OG0A 1HTIA 1K8ZA 1JCXA 4FNUA 5CZJA 5K9DA 1KFJA 3TFCA 1Q6QA 3A5VA 3Q37A 1LBFA 3C3NA 5CKSA 4UIOA 1ICSA 3ABSA 3LLDA 2A6NA 4YL2A 5HUOA 5FEPA 3W7PA 2OX1A 4A2RA 5HNRA 3JRKA 3KOFA 3S1UA 1X6UA 2ZZ2A 3OHIA 3RLVA 3ZWTA 4JX5A 3U6WA 4QNWA 3RK8A 2DP3A 1FCUA 2A7PA 3NQVA 2V81A 1ZALA 3G1HA 3G3DA 4O4WA 3W73A 4BWLA 1W3NA 1XM3A 1LYXA 1ME8A 4NQ1A 3C2EA 1OFDA 3W84A 3WK2A 2FB3A 3BV4A 2QJGA 1H7XA 2V30A 5FESA 1X1ZA 2E09A 3W1QA 3P62A 2V0TA 3UYCA 3C61A 3UWUA 3W6YA 1M6JA 3DH7A 4XBSA 3PM6A 4JTGA 1PL9A 3EX2A 4JTSA 3QPZA 4MY1A 3C2OA 1H50A 1DORA 3GDLA 1RQBA 4FNSA 1GTHA 2NUYA 3NQEA 3TU9A 3WK1A 2OT1A 4Z0JA 1LP6A 3I7SA 4FNQA 5D04C 3RLUA 3LOTA 4MKNA 3NM3A 3HBLA 5DN1A 5HWMA 4LV9A 2C15A 1YXYA 2OCZA 4OE7A 5EPDA 4O50A 1XL9A 1VR6A 3TQKA 3CPRA 4AH7A 1OFOA 4TIMA 1F7BA 1KM6A 2R14A 5K2ZA 4FIQA 4FXRA 5DY2A 3PB2A 3NL2A 5CSRA 5J5RA 5I3GA 4O11A 1LTDA 2X1UA 3TXVA 3LX9A 3V1PA 3QRHA 5CPNA 4GFSA 4DQWA 3CLMA 1SO3A 4AAJA 3N19B 2B7PA 3C0JA 3L0KA 4CQ8A 2CLLA 3WJXA 3OVPA 3P5ZA 1BTMA 2HS8A 3WJSA 1RV8A 1JQXA 5CSSA 3PBUA 4UR8A 3TW7A 3HPXA 5LKYA 4XBKA 1K8YA 3I7QA 1KTCA 5FF3A 4JY8A 3MYPA 1YXDA 1QPQA 3P81A 4MY9A 3QMRA 3U2OA 3PULA 2E6DA 1WOBA 3O63A 2NXHA 4RZ4A 4JYEA 1QAPA 8TIMA 3AJXA 4Z1CA 1S3HA 3A9IA 4LRTA 2GJNA 4I7UA 1A50A 2H3BA 1M7OA 3INPA 1B4KA 4HIBA 3S8HA 3U8GA 2QCDA 1TPDA 3ZS4A 3M41A 1KFLA 4M6QA 4LVBA 1L6SA 1FWSA 4XKYB 4OV9A 4K6AA 1DOSA 1W5NA 2C3ZA 2Z6JA 4IXXA 5CG7A 2I1OA 2RHGA 2ZRUA 4UMBA 3LV5A 3I65A 4H6KA 2WJZA 4WUIA 5D2WA 2GQ9A 3UY8A 1LBMA 3BGJA 3FFSA 3T55A 3TK7A 2H90A 4W9TA 4LT9A 4UTMA 3C6CA 4FHAA 4PL2A 1YADA 2HTMA 3UWYA 5AHNA 1T8XA 2J27A 2DZXA 1GYNA 1PCKA 3EXRA 3LRLA 3QMTA 3NZ1A 2QUTA 4UNKA 4MFEA 2DORA 1UASA 3ATYA 4JNMA 4AMAA 1DL3A 3AO0A 4YWIA 4N6FA 4MPQA 2R8WA 1OX6A 3CC1A 4PFMA 1XUUA 2DJLA 1TPVA 3MWAA 4MYAA 3WK3A 1I2OA 1R30A 3W7HA 1OYBA 1H63A 1SFJA 2JK2A 5E1QA 5EMUA 2RH9A 5AC6A 1VCVA 2PE4A 1SR9A 4O14A 3CIXA 4L4MA 4WQ6A 4Z1DA 3LI0A 3DHFA 1S5TA 2C1HA 4OV4A 3T4CA 1G6CA 3EXTA 2A21A 4XQ6A 1KBJA 1DQWA 1TIMA 2A4AA 3QF0A 4M5PA 3GKAA 2E5BA 3S5NA 1EWDA 3W71A 4LS1A 1PE1A 5LSMA 5D09A 3CEUA 4K8HA 3MBFA 4GUHA 2ZCGA 2YDAA 1F74A 1TQXA 1QCWA 2ZZ5A 3QSTA 4X22A 4RCXA 3DKLA 4RX0A 4Q4KA 4NUWA 1H7WA 3GDMA 4NJJA 3NPXA 5DCBA 4AXKA 4LTSA 4ZQCA 4NX0A 2C14A 4EVZA 3IGXA 3TJXA 1DHPA 2F84A 2CLKA 4PCFA 5KSWA 4WY0A 1CW2A 4KWVA 3W7OA 3BG9A 3KFTA 3G1VA 1OFBA 1F73A 2TPSA 2TMDA 1FCBA 1JULA 1EIXA 3FKRA 1OFQA 3HJZA 3KVJA 1DJNA 4JTFA 1FWTA 1A5AA 1MZHA 4O57A 1FDYA 3QH2A 3D0CA 4LS2A 4RK8A 5FF0A 3P84A 2JKPA 3DXIA 4M6VA 4N6EA 3E12A 3M5XA 1YDNA 2CW6A 2Y6ZA 4QNEA 4DO6A 4OU1A 5F2LA 1ZCOA 4MZ8A 5F4XA 1SW7A 2CFFA 4R53A 2W79A 1K7EA 1AK5A 1VZWA 3CB8A 1AW2A 1PS9A 3NL3A 4PL1A 5G1TA 1AL8A 2WKJA 1TJPA 1S5WA 3UNDA 3C2RA 2QCMA 4K7VA 3TAOA 1RQEA 4FNPA 2O7SA 1NAL1 1EEPA 3Q58A 4O8RA 5EYWA 2ISWA 2CLIA 1YTEA 2QDGA 3OBKA 1G4EA 2GUUA 1QO2A 3GXNA 4CNNA 3P67A 3PBWA 3LHYA 3MJYA 2BTMA 2JKEA 2OJPA 4Y9AA 1X8FA 3DFTA 3W86A 1HG3A 2ZZ7A 5AOUA 4UFHA 2DZSA 3F4WA 1YDVA 3KVLA 3GX9A 2PC4A 4ZQNA 3M43A 4FX7A 4NXKA 3NZRA 5I3JA 4K39A 3ANYA 3W1MA 4WOZA 3TQVA 5CPLA 4MZ1A 3JS3A 1WYIA 4CQAA 4AWSA 3N34A 1SO5A 4O12A 2NUXA 2X16A 2J88A 3N2MA 3W7NA 1KM0A 3G8EA 5AHLA 4IMGA 3DENA 2EF9A 3GK0A 3NQ6A 2BWGA 3S5OA 4UFMA 4YCOA 3TR2A 4FX6M 4DBEA 2EGZA 1EUNA 1OF6A 1QOQA 5C2XA 3L5MA 4HPJA 5IBXC 3LDVA 3SY5A 3THAA 2WSRA 4N9DA 5K9XA 1TV7A 3KAOA 3NOEA 4PEKA 3MHGA 1NFBA 4U4MA 3NL5A 3TNOA 3WK0A 5EKYA 4HKPA 1EUAA 1JUKA 3L68A 5AYYA 2J24A 1K02A 2NX3A 1KTNA 4IUOA 4BR1A 1N8FA 4B5NA 4AVFA 2I9EA 2QKFA 4UTKA 2ATMA 3SW6A 2ZTJA 3LRMA 1LZOA 4IGHA 2HS6A 3LERA 3RNDA 4E2BA 1W3IA 3PWAA 1I2NA 1O95A 2ISSA 4UFLA 3M44A 3EX1A 4UFJA 1BEUA 3GYEA 2FLIA 3LCXA 2WV8A 4HT3A 5G2WA 4O53A 1VHNA 1GVRA 3GNNA 4QJ1A 1TTIA 4RZ6A 1JCNA 2YW3A 4CNOA 3RF9A 2WNQA 4LNYA 4G1KA 1C29A 3ZFHA 1B4EA 1JQVA 1F5ZA 2NV2A 4FNRA 3SZ8A 4OQVA 1C9DA 4GUFA 2Z6IA 1QWGA 1ZHAA 1L2UA 1G7VA 1VYPX 3MMTA 1UBSA 4KFPA 4PODA 1ALDA 3W2KA 1TJRA 3W7IA 4E0CA 1TPB1 2YPIA 3BVJA 3LXCA 4K38A 4JTKA 4N9CA 3W1TA 3SGUA 1X1OA 4Z1BA 4DO4A 2X1SA 1QPNA 3M5VA 4NU7A 5FF4A 3NM1A 5H91A 1R2RA 1OX5A 5EA9A 1WDWA 1EA0A 4JY9A 2NZLA 4TX9A 3W85A 1TCDA 3TUUA 4UTLA 5HWJA 4N4PA 4Z0SA 1VRDA 5L9FA 2CLFA 5G2HA 4LY8A 1TSIA 1FDJA 4Q33A 2CLEA 3W1NA 4ZQPA 3TROA 5SWUA 2CLOA 3MP5A 5D03A 2CZFA 2A7NA 1Q6OA 4MOZA 1Q3NA 1SZNA 1XCFA 5LNUA 3EKZA 4IQLA 4MYXA 2QCCA 2A5HA 5AHIA 3MI2A 1YXCA 3UQNA 5LNRA 4M19A 5K7JA 3NQDA 1GZGA 3R13A 4HNUA 2YYTA 3I6RA 5E93A 1DKWA 2Y61A 1A5SA 2UV8G 4EF9A 3G18A 1FCQA 2E6AA 3O06A 4MZYA 3O07A 2QAPA 4ADTA 4C1KA 3GAKA 4JXCA 1B57A 3H54A 3PSVA 3TDFA 2FB2A 4JEQA 4RV8A 2GOUA 3QZEA 3GXTA 3MBDA 3TA6A 1G4SA 1MEHA 3EX3A 4TMBA 1KW1A 4UNLA 1ME7A 1Y0EA 5U4NA 2DZVA 3W7JA 3G1SA 3QW3A 4RKAA 1TPWA 4GUJA 1QO5A 1LRNA 1O60A 3TW6A 3GR7A 3NNTA 4AHPA 1J5TA 2KZHA 1QMLA 4GWEA 4X2RA 3BW3A 2Y89A 2PRHA 4S2CA 1RZMA 2ATSA 4I7VA 3N2XA 3S5ZA 4K36A 1FWRA 4O17A 1ME9A 3DAQA 1GT8A 1OK6A 1BWKA 1J2WA 2E5CA 2E5DA 2V9DA 3B06A 2TRSA 1N7KA 3NQCA 1ZY9A 5AC8A 2Y7FA 2CLMA 1KLYA 1ZJIA 1H5YA 4O54A 1G67A 1QNVA 2AGKA 3KRZA 4JDBA 4O1CA 1WV2A 2PURA 3ABQA 4GXMA 4LUIA 3O8AA 3W2JA 4UUIA 2RDTA 1YPIA 5KMYA 2A85A 5A8GA 4A22A 1XDMA 1EX5A 5MHBA 3HOJA 1VS1A 2ZZ6A 1ICQA 3TMLA 2B4GA 1W5OA 2A1YA 1JJKA 3PC0A 3W83A 2P1FA 4BI7A 2YFNA 1XI3A 2ZRXA 3OG3A 5DBTA 4AF0A 4UTTA 3EWXA 2GQ8A 1JCYA 3C2VA 3DFPA 3O15A 1W56A 2XN1A 3GZ3A 1TPEA 3R2GA 1AG1O 1QPRA 1IXNA 1HUVA 4LS0A 1ADOA 3OVRA 1OFPA 3A23A 1TPUA 3W3OA 4UTWA 3W1PA 3M5ZA 1Z41A 2XN2A 3W2UA 2ABAA 3UWZA 2BXVA 5FF2A 1HFBA 4ZZ9A 1AMKA 3PG8A 4ALDA 1H62A 5C5YA 3P5YA 1KFKA 3CM4A 2P0OA 4AHQA 2BZNA 1Z44A 5CPOA 1CX9A 3PBVA 2YFOA 1GQNA 2QUVA 3CWNA 3IVTA 3LM7A 4UMAA 3MI3A 3PY2A 4UR7A 5F1UA 4FEZA 3TSMA 3O6CA 2OMAA 3L67A 4MIMA 1KTBA 3G1DA 3BLEA 4WX2A 3N3MA 3PG9A 5BMXA 5FEZA 1C8VA 1K8XA 3P8JA 2DZWA 4DXVA 4QAIA 2WSQA 4AB4A 2V82A 3TKFA 2Q8LA 2ALDA 4RLIA 2GPTA 3FLUA 3LI1A 2A0NA 4M7TA 3Q2DA 1H7NA 1GJPA 3FJLA 1UUOA 3WJZA 5D37A 3GDRA 4LU0A 4O1DA 1EPXA 1LRTA 1WXJA 5CZSA 3RFAA 1KFBA 5G4WA 2GQAA 2NXIA 3T40A 3LHWA 1I4NA 3G0XA 4MJMA 4MFDA 3TC7A 2ZTKA 3W2NA 4LUJA 1KV8A 3E49A 3HPSA 2WQPA 1R2SA 1VYRA 4GE8A 3FKKA 2C6QA 2QCEA 3W07A 1KM2A 1OX4B 4K7YA 4QITA 5AYZA 3KRUA 1IIHA 4XZ9A 3GDTA 3E02A 1TPH1 1GYLA 2VC6A 3HG5A 4ADUA 3GDKA 1R47A 2QEZA 2NWRA 2NUWA 2G97A 2Q8ZA 4A3UA 5DXXA 4O10A 1BWLA 2ISVA 4N02A 2D73A 1TB3A 3PBYA 1AL7A 3NQFA 3LTSA 3BK0A 2VEMA 1QR7A 2C0AA 3NVTA 3R89A 3N9SA 4IX0A 4WXZA 2W0UA 1VCFA 3QJAA 4UMCA 1WQ5A 3W76A 3KHJA 3NL6A 4N4QA 2H8ZA 3A22A 2JBMA 3EWWA 3KVKA 2X1RA 3SI9A 4QQ3A 4A29A 5LNWA 4LV4A 4QIUA 4IXHA 2NXGA 1WBHA 3MHFA 1LDCA 1I2QA 1G4TA 3LB0A 5D32A 3QW4B 1VLWA 3GKFA 2Y62A 4UC5A 2H8XA 4JX4A 3UWWA 4EIVA 1VC4A 2YXGA 3QQ1A 4JN6A 1XXXA 3DGRA 3MO7A 3I68A 1AW1A 2VFHA 1H60A 2AAMA 4DPPA 1KFEA 2Q3RA 1FCVA 3GNDA 2J9ZA 1KM5A 1ZENA 3H55A 5KITA 1X7FA 1BKSA 1YPFA 1P1XA 4XWUA 3BG5A 4LC8A 2EAWA 3NQ8A 1MO0A 3CWOX 4JICA 4CLMA 1TTPA 3EX6A 3G3MA 3W2LA 1L6WA 2ZZ1A 3JR2A 1GVQA 2FJKA 2YCEA 5FI8A 2WOQA 3FS2A 4Y8FA 1B9BA 1UJPA 4DF1A 4OT7A 3CEPA 3V75A 1TMHA 4RJEA 1SPQA 3DZ1A 2B7OA 1ZAIA 1WOAA 4XUGA 4CNPA 5LNVA 3GB6A 3KVMA 1F05A 2ZZ4A 3HG3A 4RZ5A 3PR2A 1LROA 2ZA1A 5IM51 5BNKA 2FPVA 4WD0A 5T26A 4NJGA 2WSYA 1XKYA 3LLFA 2C16A 1PCWA 1W37A 1ZFJA 1I8JA 3G0UA 2Y70A 5DY3A 5HULA 1VHCA 4H4IA 3L65A 2GJLA 2BX7A 1VQTA 3VI2A 3M6YA 1FY6A 4LWWA 2VFFA 1TO3A 5D2YA 3NQMA 4XKYA 4S1FA 4WXYA 1TREA 1O5KA 4AEOA 1NEYA 3IIXA 5HQEA 3EEGA 3HQ1A 3STGA 4RXGA 5F2MA 3MP4A 4X9SA 3T44A 3R12A 4LVFA 1LOQA 2V5BA 4JTUA 5CZ0A 3GLCA 2G5WA 5K3VA 1P0NA 1QPOA 5A5WA 1RR2A 3IVSA 4IMFA 3HG2A 1Q6LA 4Z1AA 2R94A 3B04A 1M5WA 3FJ6A 5TBOA 1D9EA 4O0ZA 4BF9A 2YZRA 3HIJA 2TYSA 4QISA 4JTEA 4JX6A 1LRQA 4FF7A 2CWNA 4HPXA 1W31A 3SGZA 1VLIA 4YCPA 1EP1A 5AHEA 3W7DA 1TQJA 3ATZA 3NQ7A 5H2ZA 3TQ0A 2VKZG 1F6PA 2YX0A 3CQ0A 6ALDA 1VGAA 4EF8A 1ZNNA 2Y7EA 2HMCA 1H7OA 4U28A 4ICNA 5KINA 3MHUA 2VOMA 5DCDA 5LNSA 3FIGA 3KXQA 4ML9A 4D2JA 5G2IA 5KZDA 4P2VA 3NA8A 1H7RA 3TH6A 5DBUA 3O05A 4O18A 3QEZA 2CZDA 4LVDA 4CCCA 2FIQA 1W3TA 1NF0A 4H3DA 4ZMGA 3W1AA 4LRSA 2PRLA 2E68A 4ZVJA 2Z2UA 3GAYA 5EBUA 4BFAA 5FEXA 4MY8A 2QCGA 1QFEA 2CU0A 4J9JA 1JCLA 1I45A 3ABOA 4O1AA 5HWNA 3HPZA 2I14A 5FEWA 3DFQA 1Z48A 3PUEA 3P61A 5EY5A 3FYOA 3UPBA 4BWLC 2WPBA 4AHOA 3T7VA 3EWUA 2W6RA 1XDLA 2VFEA 3IIPA 3Q94A 1R46A 3HB9A 1SZGA 1A53A 1VH7A 3IVUA 1MEWA 3FA5A 2CLHA 3NYZA 3QM3A 1IGSA 3BG3A 1IIGA 2O7QA 2FQIA 3UPWA 1T0OA
chains in the Genus database with same CATH superfamily
5F4WA 2EG7A 3AZTA 2QJJA 2NSOA 4TMCA 1KQYA 1QW8A 2R91A 4UNIA 1UJQA 1SVDA 3SURA 1P7TB 3N14A 1EPVA 4PGLA 4ZOCA 4XVEA 3QQ0A 3O0KA 3I3DA 5IOBA 1O5RA 1NQ6A 1KRBC 3BCFA 1MFVA 3MCMA 3QGAC 1KCLA 1BRLB 5GJNA 2I5IA 3PF3A 4QFUA 3O1NA 3UZJA 2QPUA 3OZYA 1RALA 4OHQA 4LW7A 8XIMA 2XFFA 4PRTA 4IGMA 1US3A 1WX0A 4G1NA 3W7LA 1PX4A 1LLZA 1L6FA 3RU8X 1RUSA 3M1ZA 4NAEB 4JHOA 1KRMA 3BQ6A 4PFHA 4GZIA 2Y7GA 1HKIA 5I6SA 4P7RA 2X05A 4XD6A 3AXKA 3WQWA 4GQQA 3TC3A 3OPSA 2YYUA 1E9ZB 1OC5A 3UXIA 3GE7A 3LCGA 1A3HA 5BXTA 3VCNA 3TN4A 4EOUA 4EWJA 3NO1A 2ABBA 1PBGA 4B3KA 3W74A 3RIKA 2Y63A 3FXYA 3GTHA 3ARTA 3CHFA 1XBVA 4POCA 4N2YA 4JD4A 1EHAA 3I4KA 3ARYA 4O19A 4Y6GA 3L0NA 1V7YA 2DSKA 4P8XA 1RY0A 3SUSA 3EA2A 1YE6A 2QYGA 3W7KA 3NDZA 4QRNA 4RNFA 3KDOA 1IE7C 2AMGA 3AYVA 4O1EA 1WAUA 2E6YA 4KRUA 2WMIB 2HVOA 1FHUA 1OFRA 1JCMP 3HMJG 1V3JA 4J28A 3LZ3A 3RHGA 1H61A 4A2SA 5DANA 5CEWA 4L1WA 1YHTA 1DJZA 1AJZA 5A6LA 4MLJA 4UTHA 3IRDA 4YMZA 1VBGA 1UH4A 2MNRA 4I9AA 1W9PA 4FX8A 3NO5A 3UJSA 1JPHA 1U5JA 3MUXA 3WLRA 5FACA 3SUUA 2AKZA 2BB0A 1YTDA 2GVJA 3LPFA 4AX7A 1YNQA 3WDRA 1J6PA 4Z2KA 4LF1A 3QMSA 2PC8A 2TSYA 4BEQA 4GINA 3WFZA 5CC5A 4Y7EA 4BI6A 4BA0A 4D6GA 4MPKA 2RDWA 3GU9A 1Q45A 3L0GA 2FFIA 3CHEA 3DI0A 3STEA 4AD3A 2X0HA 3WQCA 2CESA 5RUBA 4JYDA 2NW0A 3VKJA 4PH6A 3NXFA 2VRQA 2O9OA 4B4FA 3QPYA 1JXKA 4DUXA 1W5QA 1A5BA 1XBYA 1Q6FA 3WBYA 1IT8A 5HJLA 2YDRA 3UY7A 5D9MA 3RJYA 3VK5A 1JR1A 1BWVA 2RJHA 1ONEA 1FRBA 3ARPA 3VMOA 2GDVA 3S9IA 4ERGA 1E4LA 1F3WA 3GH7A 2QUNA 3BJSA 1KD0A 2PF0A 3V7PA 2VEPA 3EWDA 4NZ1A 4CQ9A 2NQJA 4KPLA 5D30A 3L4WA 2ZRWA 3B8WA 2WKLA 4F2BA 3VIKA 3W1UA 2ZWZA 3TOYA 5I03A 4IMCA 3MANA 4J3SA 3REQB 1QHZA 3W1XA 5CPMA 4INFA 5DCEA 1WZKA 4LQ1A 4WF7A 3GY1A 4D1JA 3L4UA 3TMQA 1IEVA 1ZS2A 4FMVA 2GQ3A 4XVDA 2J9YA 2VEKA 1BLIA 3LHZA 4S3EA 4AWEA 3W22A 5EMLA 2BLEA 5C6MA 4GNJA 3A21A 4GCAA 4N42A 4UB9A 3S6TA 3KX6A 3P60A 4DJED 2D2OA 2B0MA 4U10A 3IIOA 5DELA 1UR3M 1GG0A 3LHTA 1SO4A 2PGRA 1Z42A 1M9HA 2UY5A 2BS9A 3GYCA 1O7AA 1KM1A 3SECA 4TXEA 3VABA 2DU2A 2X1TA 1FWIC 5M1TA 3WQ5A 3UG5A 3W7GA 1W1A1 3E2VA 5HINA 1W5PA 4H04A 3VD3A 5FOOA 3M6DA 1FBAA 4GFIA 4NF7A 4S38A 4ACYA 2DUXA 4RE0A 2WZMA 3USBA 3SN4A 3FK4A 5A3HA 5D05A 1SJAA 1CZ1A 1GZJA 1NWTA 2PLMA 4J7RA 1WXZA 5T8GA 3FCPA 3CPGA 1H4PA 4MNKA 2J8TA 2IKHA 2ZRVA 1TTJA 2C91A 2W92A 3H2FA 3M7WA 3EXSA 3MYOA 1NDYA 2XVKA 1QASA 2G95A 4JL1A 1I2RA 2BNJA 9XIAA 1HP4A 2Y8VA 3T42A 2V6AA 5I3HA 3HGRA 3TC6A 4KWSA 1GWJA 3OGSA 4QX4A 3DYOA 3P80A 3CL8A 2JIWA 3DHDA 2J8FA 3G24A 4Y90A 1WB0A 4TO8A 4JYFA 2OZ3A 4QG8A 6ENLA 4J3ZA 1HJXA 1KKRA 3GR8A 3CQKA 1NF7A 3PB0A 3QV8A 3K8MA 2WHKA 3EWZA 3NPUA 2G3FA 2DVUA 2W27A 4NZJA 1XIHA 3MW7A 4LOCA 1SW0A 1IXPA 1JVNA 1L8PA 2QJIA 2J7FA 4PMJA 4AUBA 1DIOA 1M7XA 1GKPA 4GH1A 4HNNA 2H6RA 4S3FA 3OQEA 3PAJA 3MVTA 3VTRA 3UR7A 2WB5A 1S5VA 1IR1A 2NWSA 3N12A 1ZZMA 3U2ZA 1QOPA 3VE7A 1YW1A 2VFDA 3OYXA 3GUWA 4IJBA 4ORIA 3RAOA 2HJPA 2IPWA 3S2LA 1J10A 1GOMA 3B9EA 1EA9C 1RQHA 1KXVA 1ELSA 2YGYA 3CYJA 1PXGA 4XTDA 3GVGA 3BLFA 4D6HA 4RL3A 4B5SA 4RXFA 4DPQA 2DSZA 1ZJBA 2C13A 2C71A 3AIQA 5TNVA 4AIUA 3B05A 3M7SA 3W23A 3AUJA 3B0PA 3LCFA 1MW3A 3BICA 1OGSA 4ONVA 1F61A 3MA8A 2Y5JA 4WR3A 1J01A 1GNXA 1TWSA 5BMWA 4UFIA 1JUBA 1MEIA 4YVPA 1S2AA 1V6YA 4K8EA 4NX5A 2OLAA 3VD5A 3PPCA 2CCRA 5HQLA 3H7UA 1XFBA 2C1IA 3W88A 2J4GA 4E2DA 4KIRA 1RP8A 4GUGA 2VGIA 3RCMA 4GXPA 1LG2A 2OX4A 4BZYA 4ZE5A 1C92A 4GQRA 4CN1A 5HR6A 3TN3A 3G22A 1E6ZA 2C1GA 1PV8A 2QVHA 1GUVA 3MS8A 4A8NA 1LQAA 2OT0A 2CETA 3DCPA 4HSNA 3NEHA 5K4ZA 4E6MA 2BVDA 3JVAA 3S0CA 3B8DA 4E5TA 1OC6A 3GTFA 4G7EA 2QNEA 1KFCA 1VB9A 3MJMA 4PMXA 1Q66A 2ZX5A 4EXBA 3BPWA 2HNHA 3F5LA 6TIMA 4GC3A 4WKFA 3HG4A 3E9AA 3WDQA 3VKKA 1DV7A 5HJYA 1OFAA 1Q8JA 4IPIA 3ID7A 4PMZA 4B16A 1XIFA 3IEBA 4R27A 1DJHA 4DYJA 5HR7A 1BYBA 3S2CA 3RRXA 4ZOEA 4NZCA 3WQVA 3URNA 4P7OA 3FGCB 2WYSA 3VOGA 1IF2A 3VGFA 2E4TA 1TA3A 1NQKA 1E3XA 4AF0B 1TZ9A 1JIBA 3B9OA 4CCDA 2OOGA 1DXEA 2BOFX 1PVNA 2WBKA 4NNCA 4DF2A 3LMZA 5AVNA 3N13A 4FR1A 2E40A 1VJIA 2QUUA 1YDYA 1MW1A 4AVOA 1C9WA 4GIEA 1EC8A 3G1FA 1BG9A 1Q7MA 2CLPA 2E6FA 3AHZA 4ZSTA 2INEA 4EACA 3EWBX 1Z8AA 3NDOA 2V68A 2YLAA 1J4EA 2X1IA 3N4AA 3WNMA 1RJRA 2O9PA 3WDPP 1MUWA 4EWND 4QM1A 4H9YA 1Q7ZA 3CUXA 2IKJA 5A8NA 1EB3A 2Y88A 1HTIA 1DWHM 4HBKA 3TFCA 1HJWA 1O66A 4QS6A 4D9PA 1HL8A 4US5A 5CXPA 3LD5A 2VGGA 5HUOA 3O2LA 1T7LA 5C9ZA 1N8IA 3L2LA 3W7PA 4A2RA 5FSEC 2WMJA 4C6NA 4H9VA 4LY4A 2ZZ2A 3M0LA 3OHIA 3RLVA 1G1YA 3UP8A 3RK8A 2Q09A 6A3HA 3ITGA 3W73A 1LYXA 1JPMA 4I9JA 4P8WA 3GVRA 5F7UA 3GTIA 3SCTA 4J35A 3VGBA 1J0JA 1NH6A 3W1QA 4M1RA 2IUZA 4S3KA 1M6JA 2ZX7A 4JTAA 2YXXA 1EO5A 2E9MA 3QGVA 1RQBA 2DVXA 3QHNA 4LUTA 2OT1A 3CAQA 2VRJA 4JOMA 1GK8A 3RPDA 4QDMA 1RVKA 3GXFA 2Z00A 3RLUA 2X0YA 3WKZA 1VPQA 3K1GA 3B9DA 4I5UA 5DN1A 2C15A 2Y5EA 1YMYA 1UD6A 3LBOA 5FCZA 1XL9A 3TQKA 3BV7A 1NM9A 1S5NA 1WDPA 4XAFA 2R14A 3SFWA 4FXRA 5DY2A 2PSNA 5J5RA 4F2TA 3ZVHB 4A3HA 3T8QA 1Z69A 4DQWA 2ZC8A 1J0YA 2CLLA 5LA0A 4R3UA 1UUQA 1IEWA 3WJSA 1RV8A 1JQXA 1NU5A 2EPNA 4B3LA 1DXFA 3PBUA 5I24A 3TYUA 4LBRA 1K8YA 2G4JA 2R24A 1YE4A 4MJ2A 3PPFA 3MYPA 4JQ4A 3S83A 1XCXA 3P81A 1XSJA 5FJTA 5BZAA 2NXHA 4JYEA 3A12A 4Z2GA 1E1CA 4HA4A 1K9TA 2A3EA 4Z1CA 2DSVA 2BG5A 3A9IA 4LRTA 3VNZA 3BMXA 3AALA 3W38A 4HIBA 3S8HA 1H49A 3ZS4A 1EYWA 1KFLA 4PULA 4B9ZA 4UZUA 5A8QA 2FH8A 3PAOA 1P43A 1TE1A 5CG7A 2I1OA 2RHGA 1V3IA 4UMBA 2PU1A 4WLCA 4RW5A 4YS1A 1R85A 2WJZA 4LNCA 4WUIA 3SDOA 5D2WA 3UY8A 1EX1A 4W7VA 2BXYA 4W9TA 3DC8A 2EQDA 3TONA 3UWYA 2JQXA 2VD9A 4WDUA 4GX9A 3CV6A 3WH9A 4UNKA 3ATYA 2OZ8A 3AO0A 3VIGA 4H8UA 3PK7A 3VKCA 3AXHA 1LWHA 2DIKA 4FA3A 2DJLA 1VEOA 1TPVA 3WK3A 4WVXA 2XM1A 1I2OA 3W7HA 1OYBA 1SFJA 2D3LA 4QBXA 3Q4DA 2RH9A 2PE4A 2PTZA 3LI0A 1S5TA 1TMLA 4OV4A 3T4CA 4DWSD 4IIFA 4XQ6A 1DQWA 1E1FA 3GKAA 3S2NA 3S5NA 3EEZA 2DQXA 1PE1A 1BHGA 1XIBA 3OTRA 4U33A 1JGIA 2JFEX 3CUFA 1QCWA 4Y2WA 2Y1HA 3WQGA 4PRWA 1UZ1A 1EXBA 3GDMA 4NZ4A 4IG2A 4ZQCA 4NX0A 4GD0A 2F84A 4PCFA 2G3NA 5KSWA 1Z89A 3E0FA 2VZSA 1CXKA 3BG9A 3DESA 2PWVA 1MUMA 3MT1A 5H8UA 1JULA 4P7LA 5CC6A 3UPMA 4GZJA 5HATA 3CL6A 1XF0A 2IXUA 1B30A 3H2CA 3V35A 3NTYA 1FDYA 3QH2A 4LS2A 4AVNA 5FL1A 3P84A 5CPSA 5I3DA 4ZSUA 5A2AA 3DXIA 3BWWA 4N6EA 3E12A 4CD8A 4L1GA 2DV0A 3AHYA 2CW6A 4QNEA 1UWIA 4ZBCA 1IGWA 1ZCOA 1EHNA 4MZ8A 1SW7A 2W79A 4KCTA 5EU9A 3POHA 1JGMA 4YN5A 3NL3A 1JZ5A 1XKJA 2DSUA 4DJEA 1TJPA 2J8GA 1DWFM 5BOEA 2XGBA 3L2MA 2PGEA 4F0HA 2UBPC 4K7VA 1ZBCA 5ENLA 2ISWA 3QOKA 1YTEA 2QDGA 2ZOXA 3OBKA 3NCOA 2OELA 3GXNA 1R38A 4CNNA 4PTMA 1EJVC 3MJYA 4RDYA 1UZ4A 2BGSA 4Y9AA 1V6UA 4D6DA 1HG3A 2XH2A 3EB4A 4DI9A 2HV5A 2ZZ7A 5CSUA 2DIEA 3OLEA 3KVLA 2V63A 2F61A 1KGXA 4TV6A 4ZQNA 3M43A 4PTWA 5I3JA 3JU2A 3OODA 3ANYA 1BSLA 2JIEA 1NJJA 5CPLA 1D8CA 3TEVA 3UG3A 3N34A 2NUXA 1IT7A 3G8EA 4B9YA 3KE0A 4HU4A 3PBGA 4IMGA 4OECA 3OGRA 3S5OA 4YCOA 3FHAA 4UQBA 4E3TA 1I75A 1KCKA 3GBDA 3GC4A 1GZ1A 4TVDA 1ISWA 4PTDA 1S2UA 3QOMA 2ZXQA 1PKLA 1VIZA 3UVIA 3BSGA 1NDVA 1B90A 4ZTXA 2OO0A 2J7HA 3QHOA 3OIHA 3KWSA 1W91A 3TNOA 5EKYA 1K1DA 4RZBA 4HKPA 3SCOA 5AYYA 2O92A 3ES8A 4DZHA 4AVFA 1RCXB 2VDGA 3W25A 3WQ4A 2QKFA 2WCSA 3ZYZA 3EBVA 1FP9A 3LRMA 3LERA 1W3IA 1V3MA 5ABHA 5FJPA 2ISSA 3M44A 1BEUA 3U5YA 2X41A 1BXCA 4O53A 5HQMA 1GVRA 3RDKA 1GOWA 1TTIA 4JZ5A 1EOKA 1NY1A 4CNOA 4OBRA 3OBEA 1C29A 8CGTA 2IKGA 1QHOA 4GVGA 1T40A 1JQVA 3PWGA 1F5ZA 1HKMA 4OQVA 1XV8A 1J11A 1XINA 1L2UA 4GH3A 3RN6A 3R0DA 3PUGA 2WJDA 3S1GA 1ALDA 4MTVA 4KCVA 2FJUB 4E0CA 2V5JA 3GG0A 4IFKB 3DG6A 5DT5A 4DO4A 1QPNA 1S3TC 4HOWA 4GQBA 1QATA 7TAAA 3LPOA 3R94A 4BCEA 5H91A 3NM1A 3UCDA 4MHBA 4JY9A 1JXJA 3TYBA 2O55A 4Z0SA 2Z1VA 1W1IE 3D46A 3PHAA 4ZQPA 4HMCA 2WVVA 5DRIA 2CLOA 3MP5A 5D03A 2XZ7A 1BYDA 3CV2A 1XCFA 1E15A 3EKZA 4IQLA 5E70A 1E9LA 3HV9A 1DE6A 2VOTA 3CO4A 1YXCA 1WKDA 4PUUA 3R43A 1XICA 3UQNA 5LNRA 4IIGA 4M19A 3NQDA 3A6OA 3H2MA 2ZIDA 3S3GA 3I6RA 3A13A 2UV8G 3V4BA 4ZGYA 5I2UA 1HJQA 4ZO8A 1VIWA 4IQDA 3T2OA 1V08A 4U3CA 4GNKB 1V8EA 1J6OA 5CLTA 3EDDA 1KKOA 3NFUA 3AS3A 3DGBA 2F2HA 2GOUA 2X2YA 2ZXBA 3ITXA 1UOKA 4AXNA 3MBDA 4GQGA 1KW1A 3IUDA 1XLBA 1EOMA 1HGWA 3S2MA 1XIIA 4CQBA 5CPTA 4GUJA 1R3VA 1HQTA 3GR7A 3NNTA 4AHPA 4IIBA 1H0IA 1NP0A 3ONBA 4X2RA 2CZVA 2DGAA 2Y89A 5IFTA 4S2CA 4I7VA 5LYRA 2GK1B 3TYAA 4B91A 3DAQA 3W4RA 3AS2A 1U1UA 1GT8A 1J2WA 1AQMA 2UY4A 2V9DA 4RE4A 4F0RA 2VCAA 1N7KA 3GNRA 1VFUA 2X8RA 2Y7FA 4IFRA 1ZJIA 4D72A 2XJ7A 4NIRA 1WV2A 3VNLA 4D6CA 2PB1A 3GFXA 1FFQA 3SM0A 5C0QA 3ABQA 4LUIA 4Q4QA 3CUZA 2A3HA 5KMYA 4A22A 2XIJA 1PKYA 4WIWA 3H4XA 4L4PA 1VS1A 2ZZ6A 1XLMA 1S2VA 3TQPA 1W6TA 4J1OA 2BHZA 2EEXA 3WLOA 1BKHA 4DY1A 2ZRXA 2FVLA 3TTQA 2KAUC 1JCYA 4CD6A 3C2VA 1W56A 3DYMA 3WLPA 3UA3A 1J79A 2QVNA 1EC7A 3M5ZA 1X6NA 1Z41A 2XN2A 1HXJA 3MV01 4E2OA 3H8AA 1AMKA 1OEPA 3CM4A 3GFYA 2BZNA 2Z1KA 3D5HA 1Z44A 3NQBA 5BWAA 4NAEA 1GKQA 3PBVA 3KOYA 1E6RA 4H1ZA 2QUVA 3IVTA 3LM7A 4GO8A 3PY2A 1S39A 4AEFA 3C2YA 4DO7A 3M46A 1UG6A 2W61A 4D8AA 3L67A 1EBGA 3ITCA 2DPEA 3E3HA 2PTDA 3GW3A 3DERA 3VYLA 1X6LA 1W8GA 4GISA 2V82A 3VGEA 1ONXA 3LI1A 1W3JA 4QE1A 2A0NA 1AFSA 4YVVA 2NT1A 2GFTA 1UUOA 5D37A 5FJJA 1ZRQA 1LRTA 1UP3A 1KFBA 4G7FA 3T40A 5EMYA 4QHRA 3IAPA 3ERPA 3W2NA 4LUJA 3WQEA 3WL1A 4H6QA 1OX4B 5DF0A 4K7YA 2QDDA 2OSYA 3VZYA 1IIHA 3GDTA 1E4NA 3E02A 2WMIA 1XYFA 4P7QA 2VCCA 1CXFA 2ZUVA 4ADUA 3VIOA 2QEZA 4GCXA 2HPMA 1NOFA 3ENLA 1JPKA 1TB3A 2QW5A 3AXMA 1ITQA 4ZFMA 2XGIA 1AL7A 4DI8A 2VEMA 4BJHA 3R89A 4IX0A 4WXZA 4TX6A 4FLRA 1IQ8A 4HSHA 1X96A 3M0HA 2H8ZA 3A22A 2JBMA 3ARQA 3SI9A 1FH8A 4QIUA 5C7HA 5CC3A 3TYDA 4W87A 4JKKA 3MHFA 1G4TA 2G3JA 1UD2A 1VLWA 3EKGA 1Q13A 3HTWA 4XD5A 2I7GA 4EIVA 5FSDC 4C7DA 3CZ8A 4JN6A 4B5UA 3DGRA 3WDHA 1T5AA 4DPPA 1KFEA 2Q3RA 1KM5A 1ZENA 3H55A 5KITA 1YPFA 4XWUA 3UGRA 4XO6A 4MMWA 3KM8A 1TTPA 1CECA 3ZZ1A 4FR6A 3W2LA 1L6WA 2ZZ1A 4HTBA 5FI8A 3A3WA 5LA2A 3WF2A 3E1F1 4IUGA 1RLCL 4L7ZA 3A3XA 1MQPA 1S2WA 4OT7A 4IPLA 1TMHA 2B7OA 4MKSA 3GM8A 2V38A 1ZAIA 3J7HA 2IQDA 4Y9NA 4RZ5A 5D8WA 1VFLA 1LROA 3ITTA 2ZA1A 2J7EA 2J78A 3UNTA 6XIMA 2XIMA 5T26A 1XISA 3V3WA 1W37A 2Z7GA 1W1PA 2HDJA 5DY3A 1E40A 4H4IA 3SGGA 3L65A 4J40A 1VQTA 3HA1A 1FY6A 3NGFA 2XFYA 2AL1A 1TREA 3WUGA 4ZB0A 2BHUA 3QQWA 2HNEA 4ACZB 3STGA 4LBSA 3R12A 4DWSA 2QGYA 3WNOA 1NP2A 3W27A 5A2BA 6TAAA 1P0NA 1QPOA 4F0SA 1RR2A 3IVSA 4C1NA 3AOFA 4J4KA 2UY2A 1XLEA 2FTWA 4Z1AA 1X98A 4BQ2A 4F66A 1D9EA 1UP2A 2AMXA 2J7BA 4B4HA 3AHXA 4DHGA 2YJQA 4YPJA 3E74A 3AXXA 2CWNA 2Y8KA 3VC6A 1U30A 1VLIA 1EP1A 3W7DA 1PKMA 2VGBA 1AZ2A 3ATZA 3NQ7A 5H2ZA 3TQ0A 2ACUA 3CQ0A 4D6JA 3H21A 4GGHA 2OSWA 4HN8A 2VOMA 2ZKMX 3WMBA 4AZGA 3FIGA 3NO3A 3EDEA 4M82A 3NA8A 3ZJKA 3GC2A 3NZGA 5DBUA 2CXGA 5XIAA 1E0VA 3PJTA 3SRHA 2CZDA 1DJXA 4PMNA 4LVDA 4JPGA 2OQHA 1NF0A 4H3DA 4ZMGA 3M0KA 1HT6A 5FJRA 5GPRA 2Z2UA 3GAYA 4RDVA 4MY8A 4Q4SA 4QP0A 3HPZA 1QPKA 1FWHC 1W17A 1PX3A 2ISFA 2ZVRA 5EY5A 3FYOA 2WPBA 3RX2A 3WF1A 4KEUA 5D9NA 4XX6A 3WX7A 2PGWA 3EWUA 4UBPC 1XDLA 4C6QA 1KBKA 5IRPA 2E28A 3HB9A 1UWAA 4Q8VA 1A53A 1YEYA 3FA5A 3NYZA 2YCIX 3BG3A 1FTXA 4GYPA 1AUSL 1F6KA 1OGGA 2BVYA 4CD4A 1ML1A 3LCWA 1GOXA 1GVEA 1JNEA 5XIMA 3IK4A 1PPIA 3TX9A 4JR5A 1WZAA 3AIVA 3F7JA 4XTIA 3VKAA 3E0IA 4WJEA 3KOZA 1XG3A 3C2FA 4NG3A 3E2QA 3APGA 3VE9A 1F8MA 2WVUA 1YNPA 5JH2A 1VJZA 5KETA 5AHFA 3W87A 3VD9A 1RD5A 3LXAA 3F2DA 2X0SA 3DFHA 3OVGA 1FXPA 3SRKA 1D8WA 1VBHA 3ANVA 3LQLA 4ZQRA 4XO7A 5I09A 3QZAA 1ICPA 4Q8QA 1DIDA 4IPPA 3UXDA 3DEQA 3K5XA 4NXSA 4DB7A 3UWQA 2WC7A 1WZLA 1AW5A 3HFTA 1A4LA 2X30A 4PMUA 4IX2A 1BVNP 1W8SA 3NPVA 1I60A 5FL0A 4M56A 3URAA 5BW6A 4PA8A 4ERAA 3TXZA 1W54A 2QCDB 4BK9A 3WG6A 3ARSA 3CUHA 1E4IA 1KLZA 3GHUA 4GI6A 4V27A 3G8RA 3W6MA 1F3TA 5JBEA 1UR0A 4PSPA 4AD2A 4PC8A 3UWVA 2QCFA 2BVTA 5F1VA 1GORA 5BRBA 3SUTA 3VOIA 1HJSA 3CYVA 4IMAA 3LG3A 2ICSA 2VFIA 1POKA 5CC7A 4OUIA 2WSKA 5AZ1A 4Z2IA 3H53A 1FUYA 4IWWA 4RR4A 1SM9A 3UA4A 1K7FA 4N9EA 3OBAA 3WH8A 1UR9A 3NZQA 4F9DA 4JCLA 1RLDA 4HZ7A 2OYKA 3C4UA 3HN3A 4LB3A 2OQYA 2O9RA 1PAMA 1PIGA 3CHVA 4DNMA 1OCNA 2OOFA 5HMEA 3C5QA 1ODUA 2WO5A 3LCIA 2ZUUA 3LNMA 5CSYA 2YW4A 5LHEA 2IS7A 4FAMA 3CL7A 3NR0A 3GUGA 3OW1A 3SCWA 1ZSXA 1HKKA 2C19A 1B54A 4IPNB 4O13A 4AX6A 3B4UA 4JTRA 1L9WA 4BKNA 5DLCA 1GQJA 3HF3A 2P10A 1I2PA 3VO0A 1VCGA 2C8NA 4ZO7A 3CBWA 2VWTA 4UTJA 3W7EA 1P5BA 3K2GA 3WQ8A 5BOOA 1KWKA 4LC6A 4XKMA 1TVNA 3E0LA 5G4HC 4NASA 1UWSA 3VFLA 3ALGA 1LORA 1KNWA 1X38A 2VP8A 1O94A 3ABRA 2PLJA 3W70A 2WLYA 3STCA 3V5FA 1TV8A 1TPFA 2A3CA 4S3JA 2IPFA 1GVOA 1E5JA 3BTNA 1CXLA 2VC7A 2WBGA 3QFWA 3RYSA 4LVGA 4D8LA 4US6A 3SN0A 1O4UA 3UXAA 2XN0A 2ZUSA 1SU5A 3KEHA 4WHBA 3ZT6A 1HO1A 1V02E 3ZMRA 3L2IA 1CCWB 1MDRA 2QMKA 3MP3A 1M7PA 2ZFAA 5I3FA 1OJXA 1W9UA 2VD8A 2PZ0A 4IF2A 2BDQA 3CIWA 1P6BA 1KA9F 2Z29A 4AD5A 1AVAA 1U83A 4DJEC 2XM2A 1A5UA 1BPLB 2Z2BA 4DRSA 5HMSA 1GHRA 6XIAA 1VAHA 4LPCA 2ACSA 4AZCB 4GC4A 5AB3A 1UR4A 1E73M 1XWYA 3H23A 4C6FA 4I7WA 1GVIA 3WFAA 4MJZA 1IWAA 4GJ1A 3EZ4A 4KFNA 4YLWA 4PE8A 4PTNA 3PVFA 1YBQA 1GPWA 1R86A 3NJ3A 2EG6A 3CTLA 4H6RA 1EJXC 2GJPA 1LM1A 1R9YA 5D9OA 3UD6A 3EKLA 1O12A 4A21A 2QPSA 1LBLA 3DHPA 4AIBA 1A5CA 4AWTA 1W1YA 5IHRA 1DXIA 5CCZA 3OZMA 1J18A 3WNNA 1ZLPA 1YLVA 4URIA 2PDBA 5K4XA 4U5IA 4HP5A 4NJKA 3USZA 3W02A 4PCSA 2OWCA 1NARA 1ONRA 1SSDA 2GVLA 3VOCA 1MQQA 2QXWA 2VC5A 1VPXA 1PDYA 3G0SA 4ATWA 4ZQMA 4IOTA 1R7AA 3F2BA 2R1PA 4JTLA 2PDWA 1QWKA 5EFFA 3B03A 1I1WA 1CGUA 3S6DA 4NNAA 2XWEA 3BARA 3WF3A 1W0MA 3VGHA 2VYOA 1GEHA 3WENA 3N17A 2W9MA 5KZMA 3CT7A 1WKFA 3BSMA 3VMPA 4Q4MA 5CH9A 4C1LA 1U33A 4KWWA 1AMYA 4QSFA 1NELA 3AAMA 3W0KA 4PUWA 3ZT7A 3MDUA 3XISA 1HF6A 1PIIA 3BUVA 1G94A 3TSDA 4MWAE 3BSHA 2VENA 4MB1A 3T0AA 5T91A 4PMQA 2ALRA 3WNLA 1MXDA 1XRVA 1MRAA 3TJLA 4DELA 3TCEA 4E38A 1F9CA 1WDDA 3L5AA 1Q4WA 1TRIA 1A3WA 5J04A 1AD1A 4E4FA 2YOCA 1EDQA 3BE7A 3M0YA 5ABFB 4JQ2A 2PD9A 3O7UA 3IJDA 5ABTA 3M5YA 4S2BA 5EFDA 1GEQA 1TYGA 3KBJA 4Q7NA 1OK4A 2SFPA 1AQHA 3H26A 2XISA 2Z1BA 1REQA 3LRKA 1HNYA 2YDSA 3NGJA 2OKTA 4GQ0A 5KZ6A 4IM4A 1BD0A 1H09A 2RKXA 3NG3A 1YYAA 4GVIA 3AI0A 5TQLA 1XFCA 3PZMA 1O5XA 1HKVA 1UB3A 3GNXA 3DX5A 2A3AA 3EB3A 5G4EA 2F6XA 3SRDA 4NJHA 4C6OA 1CB7B 3F03K 1XLLA 5LZLA 1BF2A 5DMLA 3SR7A 5HJXA 3DC0A 3E0VA 1N55A 1PSCA 3L5LA 1F76A 4PMYA 3LHVA 1PTDA 3QZ6A 3V0TA 5J5DA 4EXAA 2VZUA 1EGMA 3GG1A 4XZIA 3S1WA 4K3ZA 1EP2A 5C2GA 3GXPA 3UU0A 5I78A 1G0CA 2DZTA 3IV8A 2V2HA 3LGEA 3FJ4A 3VFCA 4XAYA 3V0SA 5LHFA 4IIHA 4XAZA 3CO8A 4UTIA 2AL2A 4YJ5A 1XUZA 1SSGA 1CGTA 2FH6A 3AYSA 3SAZA 2Y4SA 2PDNA 5DT7A 1SQ7A 1G4PA 3BAJA 4M7SA 5I3KA 1OY0A 2F38A 3GFZA 2PI6A 4O15A 1EO7A 4GY0A 2CZ5A 1IZKA 4I3GA 1VYSX 2FGLA 2VELA 3NPWA 3QKEA 4DJDD 4S3CA 3WUFA 3BLPX 4OTKA 2O4MA 4WOQA 3QBUA 5AYXA 2PMQA 4J27A 4EX4A 3KUMA 3M16A 4PRRA 5C9XA 1ZAJA 4GYFA 1DP0A 3T0TA 3NVDA 2GVGA 4I8YA 1KGWA 4RNHA 3UR5A 4IMEA 1JZ6A 2EG8A 1P4CA 1EWEA 3M47A 1HIZA 2EKCA 1JRCA 3SQLA 3UJ2A 3HQNA 1TFVA 4UXDA 5AC4A 4NJIA 3HQOA 3H7VA 1F2JA 3HPAA 3JW7A 3CU2A 1YKWA 2CYGA 4HTYA 4YXGA 1V77A 2WCGA 3FEMA 1DIEA 1K77A 3B0YA 1F8IA 2HXTA 5CZJA 1KFJA 2E3ZA 1Q6QA 2P3ZA 3Q37A 4MJ4A 2ADAA 3IJ7A 4UIOA 1ITUA 1ICSA 3ABSA 3MMDA 3VAVA 3G1RA 1NOWA 2OX1A 3LPGA 3R79A 4JTQA 3JRKA 1XW8A 2POTA 1M68A 1X6UA 4GIRA 4W4QA 5HNTA 1WNOA 8A3HA 3UBPC 4JX5A 1TJ1A 3U6WA 1A0EA 1QI0A 4WJXA 3NQVA 2D22A 2V81A 3BJTA 1FOBA 2G4FA 3G1HA 3G3DA 4AZIA 3QPEA 1ESWA 3L4VA 4NQ1A 3C2EA 1XS2A 3WDJA 2PF8A 3T09A 1KR1A 1QI3A 2FB3A 2INZA 3BV4A 3V0UA 3VNMA 1XCWA 3EOLA 5FESA 1XYBA 3VX0A 3P62A 2YCLB 1XPGA 3C61A 3PZNA 1DWIM 4QJ4B 4HYVA 1W9BM 1PL9A 4WDXA 3EX2A 4MY1A 1KR0A 2G41A 1C3FA 2PDLA 3WK1A 1LP6A 3I7SA 1UR1A 3PTQA 5D04C 1S1PA 1ZU8A 3LOTA 2EPLX 4FXJA 1JDEA 1CBGA 4LV9A 4QLKA 4B92A 3BQ5A 5JIPA 4WDTA 3DBNA 3LEPA 1MW0A 4OE7A 2GGJA 5EPDA 4L64A 3CPRA 3VPLA 3OG2A 4TIMA 5BU9A 1KM6A 1KWGA 4FIQA 4D71A 1R0MA 1T8QA 3VIMA 5I3GA 4O11A 2X1UA 3CK5A 3TXVA 1JF5A 3V1PA 3ZSTA 4LYKA 3CLMA 1SO3A 4AAJA 1VEPA 3C0JA 3PJWA 3L0KA 4OOUA 3TWBA 3WJXA 2YCKX 3OVPA 4LAOA 3P5ZA 1BTMA 2ZWYA 3DYPA 4IP7A 1EJRC 1XSKA 2PDIA 1XRFA 1XLFA 1ZL1A 1R9ZA 3TW7A 2J62A 4JKMA 2QZRA 1V0NA 4UOQA 4H7ZA 4E2VA 4DN1A 1QPQA 4GZ7A 3QMRA 4MKVA 2E6DA 1WOBA 4Q4RA 5REQA 2H9AA 4KRTA 3CZEA 3C0LA 4J3XA 2H3BA 3S5SA 4W85A 1XLIA 1WP6A 2XPKA 2ONEA 3U8GA 5A2CA 3VNJA 4J3TA 2Z4GA 1F07A 3RO8A 5HPOA 4XKYB 4K6AA 4UZSA 1W5NA 2C3ZA 3FHQA 4YYCA 4W86A 2ZRUA 2J77A 3GW0A 3CZKA 3V36A 1R3SA 3T55A 3IPWA 3SRFA 3TCSA 4LT9A 4UTMA 2CKSA 3D6NA 2VR2A 4FHAA 2A3LA 2J27A 5JVLA 2DZBA 1JD9A 1VBUA 4Q8TA 3EXRA 2PFHA 4QAWA 3QMTA 1E70M 1FWJC 3NZ1A 4MFEA 2PLKA 4JNMA 1DL3A 2D1ZA 4MPQA 4PUKA 2R8WA 4PFMA 1RBOB 3MWCA 4HCDA 2XVGA 2DY3A 3IS4A 1CWYA 4LXFA 1H63A 4DLMA 2JK2A 5E1QA 1OSEA 3SCQA 4DUOA 1SR9A 1XLCA 4L4MA 4WQ6A 4L9ZA 4Z1DA 3K1DA 4MWAD 1KBJA 4F3HA 1U22A 2CHRA 2E5BA 4AISA 3W71A 3TVAA 3WLMA 1E0TA 2NSXA 4DUVA 4GUHA 2ZCGA 1U1HA 4CU7A 3BAXA 7REQA 3VIHA 4TUFA 1YRRA 3BAKA 3TJXA 3AHVA 2XHYA 2YA0A 5CAKA 4JIRA 4WY0A 1CW2A 1NTHA 3W7OA 3KFTA 1OFBA 2NQ5A 3M0JA 3Q45A 3HJZA 3IUIA 3KVJA 1MUCA 3RO6A 5IDZA 3RPMA 3PANA 4RK8A 4B15A 3BOXA 2JKPA 4WKAA 4JHMA 1UH3A 3NIYA 4LSBA 4F0MA 2VQUA 4CUCA 2D23A 4C5ZA 1UPPA 2CFFA 5BYWA 3CB8A 3EWCA 4KCWA 1UP0A 2V3GA 5G1TA 2WKJA 4K1GA 1KCZA 1R3WA 3QY7A 3C2RA 2QCMA 2WVSA 1HVQA 3DHUA 3TAOA 3WLTA 4FNPA 2O7SA 4O8RA 4QS5A 5EYWA 3HPFA 2O9TA 1EJTC 1PKNA 1Q63A 4H9MA 3P67A 4NYYA 2BTMA 2P8CA 1RXOB 1X8FA 3CTTA 3GXMA 2QT3A 1YDVA 3AZSA 4ZOBA 4FX7A 4B2DD 4DJFC 3NZRA 3FXGA 4K39A 3WLJA 1F3EA 2D69A 4WOZA 3JS3A 1WYIA 4IJRA 4AWSA 4O12A 1RBLA 3N2MA 3W7NA 1KM0A 2XIQA 5AHLA 1G01A 2OSXA 2P5NA 1JG9A 4JBRA 2BWGA 3GH5A 1VENA 3ZOAA 5C2XA 2W4XA 4LF2A 2CPUA 3L5MA 3NURA 4HPJA 3LDVA 3SY5A 3CLWA 4XZBA 2XZ9A 7PTDA 4U4MA 1X8CA 1B5TA 5IFPA 4WCJA 4GA8A 2J24A 2NX3A 4BR1A 4Q4PA 1MNZA 2JEPA 4UTKA 2ATMA 1R3QA 4RE2A 1VD6A 2E0PA 1LZOA 3WMSA 4D6EA 1O95A 4UFLA 4RUBA 4V2XA 3EX1A 2BFGA 3GYEA 2ZUTA 1PTGA 4HT3A 5G2WA 1VHNA 4Z1YA 1QNQA 2OR2A 3GNNA 4QJ1A 3QC0A 2YW3A 3KOWA 2WNQA 4G56A 2YA2A 3ZFHA 4FNRA 4HJFA 3IJQA 2D0HA 1NDZA 1XC6A 1ZHAA 4R5EA 3DUGA 3KL0A 3W7IA 6CGTA 4N9CA 2YPIA 3GD6A 5E09A 1M41A 3AMDA 2NLYA 2AQVA 3N3TA 2VM8A 5FF4A 4TVCA 1OX5A 3N2OA 5EA9A 4C6DA 2WWDA 1U2YA 2HBXA 4TX9A 1DJIA 1TCDA 3KZSA 3UJRA 2QMJA 3UG8A 3EDKA 1VRDA 1J0HA 2CLFA 3F2CA 4LY8A 1FDJA 2CLEA 1W1B1 5FAJA 2ON3A 1W3LA 1S5MA 1E6SM 1Q3NA 3ABXA 1ADDA 1EF3A 1BTCA 4KF1A 2OODA 4I6KA 1MZRA 2P8BA 4JNYA 2GJRA 3MUAA 1VKFA 1DEDA 1GZGA 4FOKA 3VM5A 3II1A 3VILA 4GJJA 1TIWA 3GG7A 1D7FA 4H19A 5AZ0A 4TV5A 4UOZA 3G18A 1FCQA 2DT2A 2E6AA 2GJXA 3T07A 4MZYA 2P50A 4AD0A 2VMFA 4C1KA 5AC5A 2BHYA 3GAKA 4BF5A 4I8DA 3H54A 2PEVA 3PSVA 4XK2A 1I0DA 3L23A 4AY1A 2WAGA 4C6EA 2HROA 3FVDA 3WLIA 5M2FX 3GXTA 1AH3A 3TA6A 1G4SA 4TMBA 2VI0A 1ME7A 4QXIA 5U4NA 3W7JA 3G1SA 4RKAA 3RM8A 9CGTA 2POZA 3EOSA 1O60A 3TW6A 2RJGA 5A94A 3QVQA 1J5TA 2KZHA 2OWWA 3UXKA 3BW3A 1MFUA 2PRHA 1UD5A 3F4CA 1TZZA 1CEOA 1BWKA 2E5DA 2OYLA 4N0RA 4HZ8A 2VDIA 5E9AA 3B06A 4DJDA 2TRSA 1J0IA 4JFTA 4YHGA 4RNJA 4A6GA 1ZY9A 3OOQA 1G67A 4YWSA 4CVUA 4JDBA 2PURA 2XINA 3A47A 3UZXA 1RA0A 4UUIA 1L2QA 1A0DA 2QUMA 1EX5A 3HOJA 4J2MA 4W84A 1W5OA 4JTCA 4GBDA 1JJKA 5CJ5A 3SQSA 2WHJA 3PBMA 1WUEA 3DN5A 2I57A 3KS6A 3LUTA 2YFNA 1XI3A 3OG3A 4UQCA 4UTTA 3S47A 2ANUA 3EWXA 1A49A 3DFPA 1BVWA 2XN1A 4HPGA 3H4GA 4GYKA 4LS0A 4PTVA 3KHDA 1OFPA 2Z24A 4PTXA 4UTWA 3W1PA 5I23A 1EBHA 3W2UA 3OZOA 2BXVA 3VCCA 3CZLA 3RJXA 4ZZ9A 2I5GA 1H41A 3ZLGA 1CDGA 1XIJA 4ALDA 1H62A 3P5YA 1UROA 1UBPC 3OQ8A 4LUSB 1JZ7A 1CX9A 4B90A 1GQNA 2ZXAA 3CWNA 3TNBA 5F1UA 3N2TA 3TSMA 3O6CA 5E0CA 2Q71A 1KTBA 3G1DA 3BLEA 4WX2A 4ZR8A 5FEZA 2XYLA 1Q7QA 1RK5A 1G5AA 2BY2A 2DZWA 4DUWA 2Z1XA 2BGQA 4AB4A 2QIIA 1JPIA 2Q8LA 2HWGA 4RLIA 3FLUA 4JTDA 1NWUA 1GJPA 3FJLA 3WJZA 1HJVA 4I5RA 3GDRA 3E5BA 4IICA 1EPXA 1V02A 1XJBA 3SUVA 2PA6A 4QCEA 1ISXA 2NXIA 3BOLA 1US2A 3R1ZA 4X2PA 3HPSA 1Y8BA 1UIOA 1VYRA 4GE8A 3FKKA 2FZNA 2VJXA 3GHSA 5AYZA 3WH6A 1JI1A 1GYLA 2VC6A 3ARUA 4YTTA 4KEZA 4FOJA 3G77A 3HG5A 3F5JA 4PMOA 3ZSSA 2G97A 2Q8ZA 5DXXA 2ZUMA 4IL0A 4O10A 2ISVA 3W53A 2VT0A 4GMEA 2D73A 3HURA 2ASHA 2XSXA 3E2SA 3HJEA 3TOPA 2R1LA 4Q8MA 4E3VA 4GY7A 1OCJA 2W0UA 3QJAA 1K9FA 3W76A 4N4QA 4MNLA 4YTQA 2NQHA 2ZE0A 1MYRA 4A29A 5LNWA 5IXEA 3ITLA 2DVTA 2DT0A 2WNWA 1LT7A 3ANUA 1WBHA 1VF8A 1K6AA 2VWSA 1C8QA 3A3HA 4X60A 1TKKA 2PDXA 3QW4B 1QBAA 1V0LA 3GKFA 2Y62A 3N11A 2PDHA 2PDJA 1PJ9A 2YXGA 4LAMA 1XXXA 1OWQA 3I68A 1AW1A 2VFHA 4TOQA 3CUGA 4GI4A 3MUCA 4H41A 4G7EB 3SUWA 5FIPA 1BKSA 1P1XA 3BG5A 3PZGA 1O68A 1J8VA 4XIMA 3NQ8A 4XSMA 1XGEA 4JICA 2Y5SA 1BQGA 2VCBA 5I77A 4JQAA 3JR2A 1TUXA 2WOQA 1B9BA 1UJPA 2J25A 5FAGA 2QV5A 3CEPA 4RJEA 1SPQA 3DZ1A 3KL3A 1WOAA 1DYSA 3GB6A 1E0UA 2RDXA 2G0WA 1JF6A 3LLFA 1TA3B 3AIBA 4CGTA 4JIEA 3GR4A 2GJLA 3CZJA 2BX7A 3VI2A 2Z25A 4LWWA 4AZ5A 2I9UA 3NQMA 4U2YA 1TWWA 1BGAA 2DH3A 4S1FA 2PDGA 1NEYA 2PZNA 2INFA 2YCJA 3HQ1A 3GNOA 4X9SA 3T44A 3WEMA 4LVFA 2EJ1A 2V5BA 4MWAA 2GLKA 4HHMA 3GS6A 1PZ3A 1J12A 9XIMA 4DYKA 1CENA 3VIPA 2DT3A 5DMMA 3P14A 2R82A 4W5UA 4BS0A 2ZUNA 2PTYA 1IEXA 2R94A 4BY3A 1M5WA 1OZQA 2V69A 4AZCA 2PGFA 4QG9A 4BF9A 2YZRA 4QISA 2RGMA 2TYSA 5J8LA 1J0KA 2F6KA 3SGZA 2OZTA 5A6TC 4IHCA 3OLDA 1X1NA 2VKZG 2YX0A 6ALDA 2FVKA 3BLKA 5D8ZA 4WEVX 2Y7EA 4DBWA 2HMCA 1FP8A 2FMNA 2F6UA 5KINA 3MHUA 4XV0A 2ZXDA 1YPXA 4XZHA 5G2IA 4H6EA 5KZDA 4P2VA 3RILA 1H7RA 3TH6A 3R6IA 1MVYA 4NILA 2CERA 1W3TA 4AYSA 5M5DA 3W1AA 1RAKA 1LUCB 4ZVJA 2V3FA 4AG0A 2PAJA 2XSAA 4BFAA 1KO0A 1XP3A 1E6QM 3FW6A 5I00A 3TN6A 4W7UA 4JIIX 1JCLA 1I45A 3ABOA 1M53A 1WE5A 3G2GA 2I14A 5FEWA 2J7DA 3PFRA 1Z48A 3PUEA 1TWIA 3QR3A 2PP3A 4LUTB 2JALA 1POJA 1TZ7A 1GQLA 4QGCA 2NQ9A 3AJ7A 1BYCA 3IIPA 1TX0A 1R46A 3WFLA 1Q8AA 1V93A 3IVUA 3ZO9A 2OPJA 3QM3A 1FWAC 2W67A 3MTWA 4M8UA 1T0OA 4KEVA 4B2DA 1V3HA 1LF1A 1SO6A 4EANA 2BSLA 1QK0A 1GYMA 4PCNA 5GJPA 3VCRA 2X40A 2FGBA 1CI1A 1FFRA 2V5LA 4GACA 3IV3A 3SCSA 3TTSA 2EKGA 2W3ZA 1P6WA 2IQ0A 1UKQA 3K13A 1TUFA 2JEQA 3KDNA 4NZ3A 1GOOA 4HVXA 3WY1A 1BSIA 4Q3MA 3AWNA 1EC9A 1SZFA 2F9RA 5I79A 2JGQA 4BQ5A 3M64A 4R34A 4IISA 3WJWA 1V3LA 4FALA 4C6MA 1IZJA 5IBXA 3WD2A 2XIBA 3TV8A 3M9YA 1PDZA 3NQAA 3P8IA 4C6BA 2QULA 3C86A 1QNRA 3OP2A 2IKIA 4H2CA 1XX1A 3TFXA 3VNKA 1JDDA 5JIWA 3E5PA 2NX1A 3N73A 3O6DA 3ARZA 3IANA 1K7XA 1UOZA 5CZTA 5C70A 3BGGA 4DZAA 3QFEA 4KESA 7CGTA 1THFD 3WZ0E 1IYXA 3U5UA 2CXEA 3AFBA 4ZB2A 3B8TA 3R5EA 3WUBA 2DJXA 1RHCA 1OIMA 4AD4A 2ZZ3A 3HO8A 3T08A 3DI1A 2VFGA 3SCUA 1JCTA 3R8RA 3I6TA 3GTXA 3T05A 3VKDA 3CUJA 3O16A 4L56A 3DG3A 4ZL1A 1M7JA 1J93A 3W2MA 4PSRA 4CCZA 3SSJA 1WCGA 2OWXA 2FZBA 3PN8A 1B31A 1JZ8A 3WJYA 3A24A 3N6HA 3E6EA 2AAAA 2L5HA 1E56A 3MUZ1 2V5DA 3CH0A 4LX4A 1VBJA 3GDBA 3S5YA 4Z08A 1ECEA 3GXIA 1UZHA 4KETA 2H3DA 5D33A 5AN7A 1LLOA 4JFWA 2IPGA 1SZRA 1XBXA 3PUDA 2VRKA 3JZEA 1JCJA 3AICA 4KERA 1V6XA 3ELFA 4KGJA 4U31A 2G3MA 4R88A 3K30A 5HDRA 1OCQA 1E6PA 5GNYA 1M01A 3LXBA 1KBIA 3C8FA 2P0IA 3DFNA 1MRQA 4EP8C 2WMGA 4L4LA 4HMDA 2W5FA 4Q6XA 3A64A 4IG2B 5CGQA 2ZA3A 4NRRA 4Q4OA 3QTPA 3L4ZA 1JYNA 2B7QA 3L9CA 5HMDA 5ABGA 3NWRA 3DFOA 1D3HA 2JGYA 3NZPA 3CAVA 1XBZA 4EPDC 1BG4A 1LOSA 3ARWA 3RU6A 3DG7A 2A2IA 3G1XA 4GIAA 1TWDA 3NEVA 1DJGA 3TE9A 1D3GA 1GVFA 1JUEA 1E43A 4QR6A 4GI8A 4R33A 1EF2A 3P0WA 4QJ3B 1XSIA 3CNYA 4OGZA 1GJWA 1VFHA 1M1BA 5ECUA 2V8ZA 3W75A 5E9XA 3TAKA 3H2AA 4F8XA 3IIZA 4A3RA 5LGZA 3P3BA 1AZ1A 1N8WA 2ZRZA 5F4SA 3BO9A 4R7OA 3RMEA 1MXSA 2FZDA 4KT2A 4AZ6A 1WBJA 3RLHA 3ZLFA 4D6IA 2D2GA 4FSAA 3WN6A 1XYLA 5K9CA 4GY1A 1J2BA 1WUFA 2ZQ0A 3BMWA 3MPGA 3BC9A 4QTGA 1Z3NA 4CVWA 2HSAA 3CAKA 1SFLA 1F4AA 2FVMA 4O0KA 4IT1A 5BXSA 2HE8A 4L80A 4MVAA 2QLYA 2QJHA 4GVHA 3UZ5A 3LU2A 4P61A 1KBBA 3VDBA 3THQA 3QSRA 1FX6A 4H00A 4WY0F 4EPEC 5JU6A 1D7KA 5DXYA 4WZHA 4AD1A 3SIMA 3G1YA 2FDSA 5C55A 5M03A 1SUXA 1GW9A 1OABA 3W7QA 4NZ5A 3O6YX 4FOUA 3GXDA 2J74A 1ZAHA 5D2XA 1E6NA 2XIIA 3GVWA 1XRTA 4GLEA 2QDHA 5C8BB 3FAWA 4AIEA 5GQBA 1FWWA 4DBUA 3NQ2A 5T9CE 3WL0A 4FIRA 2W63A 3V18A 1Y65A 4LVAA 5U7SA 4BF7A 3CMJA 5EL1A 3B8SA 3MB9A 4IZGA 3W7MA 1FXQA 1EZ2A 1OQFA 2RDUA 3I7RA 1ZBVA 5TD4A 2P76A 3MCNA 1W9DM 2QAFA 2J7CA 1DTNA 4Y9MA 2FDMA 2QV4A 2OGJA 4ZQOA 2ESCA 5C9WA 1LCOA 1ITXA 3MI6A 1UCWA 3SCNA 2PWUA 1HO4A 4H7CA 3W37A 2EHHA 4IP4A 2WNZA 3PSWA 3UESA 4REQB 4H8HA 3AUOA 2YR1A 2ZYFA 2WMKA 3P82A 3WNKA 4B5VA 1E9YB 1Z6KA 2J6XA 4HCLA 4I9MA 3WLNA 1XH1A 4CN4A 5XINA 1XRSA 3BDKA 3AHTA 2XFWA 3QYQA 3S1VA 1KRAC 1OFEA 2PCQA 3ITYA 2W62A 3BLLA 3C52A 1C7SA 1Q6RA 1T96A 1YQ2A 4LJ3A 3IGSA 3BLDA 1SW3A 3WLKX 4DXKA 5H6HA 3STFA 4AWUA 3SJ3A 3VNIA 1K8CA 4AYGA 1EQCA 1HKJA 1R3YA 4LALA 3EGJA 3BCJA 4L9XA 3RM4A 4HK7A 3T78A 2REQA 1JYWA 1SFTA 3WO8A 3RMJA 4MUZA 3GO2A 4MGGA 3H70A 4O1BA 6REQA 4ICCX 1XR2A 3U7BA 1KM4A 5F2GA 3FV9A 2WVVB 3LTPA 4B5WA 4A8LA 1LLWA 3I4EA 1TV5A 4IIEA 1YDOA 1EH9A 4V1XA 2D0FA 3W7CA 4FNTA 3O9NA 2Y2WA 3NQGA 1RPKA 4EAMA 1S38A 2ZX6A 4S23A 4NNBA 3S9YA 2VX5A 1RA5A 1C8YA 2GDUA 1XC4A 3MKCA 4HA3A 4KFOA 4YU1A 4DJFD 1P0KA 4O4VA 2E77A 1EP3A 4HNLA 2GDQA 5CBIA 3PJXA 4FLSA 1ZTVA 4GKTA 3N4EA 4JEJA 5A8MA 1DBTA 1S46A 5JXQA 3WQOA 4E8DA 3KTSA 4TU1A 2HPIA 4DNHA 3OA3A 3TN5A 4JS3A 3C8NA 3VD7A 3WF4A 5JQ9A 5AFDA 4Q32A 3TP4A 4F4RA 4DF0A 1HL2A 2QCNA 3ZQ9A 1MDLA 5KZEA 4HN4A 3F1QA 3S1XA 1OF8A 1SZEA 5F2IA 3DU0A 4TX8A 4YTUA 4O16A 5BU6A 3F4NA 1QW7A 3A5FA 3PZVA 1K6WA 2BV9A 4JIPA 2EPKX 3VGGA 5D2TA 2YB1A 5HXMA 2O56A 1CT5A 4MSSA 4I9TA 3SQMA 1R9XA 3SFKA 5E6ZA 2LLEA 4ORMA 3W82A 3MSDA 1J0ZA 1JRBA 4CD5A 1Z32X 3CWHA 2V2CA 1B3XA 3PS7A 1H11A 2C18A 1OHLA 1UQYA 1V6WA 1GOKA 4JL2A 5M3WA 2IQTA 3YPIA 3H7RA 4DJDC 1CGYA 2G96A 4H2HA 3FOKA 1HN1A 4GBUA 2AGTA 4MLRA 3P0XA 3W6LA 4BHYA 3VNYA 2PWDA 2FTPA 4HHLA 3GIYA 3AYTA 4QCFA 4I5XA 1ZQ5A 3OU8A 4JTIA 3E2RA 3HQPA 4AY8A 4QSHA 2GZXA 3OEXA 4FS9A 4Q8NA 2HQAA 1SGJA 4Z2HA 3AS1A 3EWYA 4TR9A 2OGYA 1AH4A 1TJ0A 5B80A 3UT0A 1RSCA 3AU2A 1DQXA 2B7NA 4XG1A 4UTTC 1TRDA 1L6GA 5TIMA 5C54A 3UVAA 3IWPA 4FB7A 4DEFA 1DVJA 4I90A 4AMCA 1UYQA 1QTWA 4PUMA 2D2HA 1LG1A 3W9ZA 2GGEA 4UTWC 5I0DA 2QR6A 1T99A 4TTUA 3R4IA 1OG0A 1K8ZA 3MV11 1R5YA 5BCAA 3A5VA 4LANA 3L12A 1LBFA 1US0A 1IWPA 3ZJ7A 4XD3A 3IJ6A 5HBFA 2PWGA 3LLDA 2V67A 3QV6A 5HNRA 3KOFA 3S1UA 2BBFA 3TTEA 1C93A 4GXWA 3GQYA 3ZWTA 2HBVA 4EPKA 4QNWA 2D24A 2RUSA 2DP3A 1FCUA 3R7MA 1ZALA 2HZGA 4O4WA 1W3NA 3SB0A 5HK4A 1XM3A 3NSMA 2A79A 1R3TA 1A3XA 3W84A 3WK2A 2Z1WA 4Q6JA 3CV7A 1UQZA 2QJGA 2IXVA 2OEMA 2V30A 1TWZA 1IHIA 2I16A 4XIAA 2E09A 5MKGA 3KS5A 3UYCA 1TR9A 1FWEC 5LIWX 4NRSA 3HV8A 4M51A 3S2JA 4XBSA 1EJWC 4JTGA 3UEQA 3QPZA 1H50A 1DORA 4MAZA 3U4FA 2NUYA 4CEUC 1P6CA 3NQEA 7ENLA 1LQ2A 3TU9A 4Z0JA 4ZODA 1BXBA 3ALFA 1ZPTA 4FNQA 2OXNA 2Q6ZA 5AYIA 1MW2A 4MKNA 3B8IA 3HBLA 5BROA 3KOXA 1YXYA 2WSPA 3RX3A 4MAVA 4O50A 3W81A 1VR6A 2OO6A 4AH7A 1OFOA 2VO5A 3PB2A 4XUYA 2IPJA 4PCTA 3WF0A 1Q2SA 3S4TA 1P7TA 1UKTA 3LX9A 1CIUA 2GSEA 2X7VA 3QRHA 2XFRA 1VRXA 5CPNA 4GFSA 3N19B 2B7PA 2A3BA 4EK7A 4XZNX 1DHKA 2PTWA 3M0IA 3CAWA 5FJOA 1UD4A 1BRLA 5LKYA 3M0XA 2AQOA 3I7QA 5FF3A 2GGHA 1W3HA 3N25A 4MY9A 2FHFA 3ARRA 3H6OA 3VDAA 2PWFA 3U2OA 1PWLA 3O63A 4RZ4A 4X63A 4UQEA 1XDJA 2MUCA 1U5VA 8TIMA 7A3HA 4TQTA 1A5KC 3PPGA 2WHLA 1S3HA 1ECQA 2GJNA 4AY7A