3NQVA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r5 7/4a
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
249
structure length
246
Chain Sequence
LKASSLRALKLMHLATDDTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTPGKVAEGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADSRHYAFGASSSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 96
structure length 246
sequence length 249
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqvA00
3L5AA 3NQEA 3PAJA 4DF2A 3SGUA 1TV8A 3DBPA 4JTJA 1S3HA 3MUXA 2C15A 2ZA2A 5AHFA 5LHFA 3EX3A 1IIGA 3BW2A 4C1KA 5D38A 5KZEA 4NQ1A 4K6AA 4MUZA 2Y70A 4CQAA 3OA3A 1K3UA 4M7TA 4ZMGA 4TU1A 3B0PA 3NM1A 3NL6A 1UUOA 2GQ9A 3LCFA 1KV8A 2VFEA 5AC6A 1KM6A 4E2DA 2P1FA 3W7RA 1QPRA 3TMLA 3WK3A 1Q6OA 4A2RA 5MHBA 1GVQA 1UASA 1TPC1 1L6YA 1LYXA 4S2CA 2QF7A 3GLCA 3LCXA 3P7YA 5C5YA 1IXOA 3W7LA 1HG3A 3NAVA 3TUUA 3PR2A 3ABOA 3M1ZA 4M6PA 1OX4A 1QR7A 4P61A 3GKAA 1DBTA 4JTTA 3W1AA 1L2UA 1TTJA 2J9XA 1R2SA 1QFEA 3QEZA 4UFKA 3L5LA 3T40A 2O7QA 4N4PA 4Y9AA 2NV2A 3F03K 4I7UA 5KITA 1LZOA 3T44A 3VNDA 2VFGA 4OHQA 2VFIA 4LNYA 4LY8A 3M41A 2JKPA 4M6QA 2WSYA 1RD5A 1H7RA 3G24A 1JULA 2GVGA 1KTCA 3RF9A 4YCOA 3G22A 4YXGA 4JYEA 2OX1A 1A5CA 1KFJA 4O50A 4U4MA 4WOQA 4W9TA 3ATZA 4MYXA 5AYYA 1F74A 4O19A 3TE9A 5DCEA 4AHQA 1X8FA 3GXPA 2C16A 4UTTA 3GDTA 3P5YA 4G1KA 2CLMA 4S2BA 3NNTA 1M6JA 1TREA 4Q32A 1HO1A 4AWUA 4C1LA 1PL9A 1QMLA 4O0ZA 3E49A 1OYCA 4LU0A 1GJPA 2CLFA 3RK8A 2VEIA 1SO4A 1MO0A 4OU1A 4UR7A 4O1BA 3O16A 3W7CA 1P1XA 3EX2A 5G4WA 4M19A 2WJZA 5CKSA 1NFBA 4ZQMA 4UTTC 3E12A 4GUFA 3DKJA 4PFMA 2G97A 3E0IA 5K3VA 3UY7A 3HB9A 1KM1A 4FIQA 4JTHA 2ZBTA 4LS0A 4HNUA 5AHMA 2E5DA 4FEZA 4DPPA 1K03A 4JN6A 4O18A 2VFHA 1KFKA 3W7HA 3NL3A 5TQLA 3W2UA 4HNNA 3HPXA 2PRLA 4GC4A 2GJNA 4O17A 4UTLA 3V75A 2AGKA 1AG1O 2CU0A 3PBVA 4NVTA 1TQXA 4ZL1A 5AC7A 1OFBA 4GUHA 3CPRA 5A8GA 5AHIA 4Z0JA 3PY2A 1YXYA 2FIQA 3HG4A 4MFDA 5LNVA 4AH7A 1X6UA 1F05A 1RR2A 1E51A 2D73A 2G96A 2W0UA 1FUYA 3I7RA 3BG5A 2X16A 6ALDA 3KVJA 1OX5A 3HF3A 4O16A 2DU2A 4DXVA 1LLWA 2TYSA 2CLOA 3MYOA 2WV8A 3E96A 4UR8A 2C14A 1OYAA 3C2OA 1SSGA 1J2WA 2UV8G 1OFAA 4O57A 1JUBA 3VKJA 4O10A 1K7XA 3VE7A 3W1XA 4AHPA 5HR6A 1SW7A 2QCMA 4NUWA 3D0CA 4Q4KA 2Y63A 4CQ9A 5U4NA 3UXDA 3HBLA 1JCMP 3TQKA 1DORA 5KZMA 3EXSA 4FIRA 2V9DA 4Q33A 3QC3A 3PB0A 1R2TA 4EF8A 4DO6A 4JTEA 1SZFA 1RPXA 1H63A 1ZCOA 3O6CA 4NNAA 1IXPA 2BXVA 1EP3A 4CLMA 1OX4B 2WQPA 2DJLA 3BG9A 3G1VA 5F4WA 1XBZA 1PE1A 2VKZG 5KSWA 5EMUA 3G1DA 1BTMA 1G7VA 1GOXA 1H7PA 3LX9A 3CEUA 3LHVA 2WNZA 3FIGA 1W3IA 1ICQA 3F4NA 4NNBA 1SUXA 1W0MA 4K8EA 4YLWA 3DFSA 4S1FA 5G5IA 1XL9A 4QITA 4GWEA 2YYUA 1ICSA 5I3IA 1I2QA 5F1VA 1GYNA 3TSDA 3WJWA 3H54A 1XI3A 1GVOA 4H4IA 1LP6A 1OVDA 2X1SA 4K36A 3JRKA 1XM3A 5FEXA 3EX4A 1W1ZA 2CFFA 1SSDA 3SSJA 1I2RA 1BWLA 4LVFA 5AB3A 4YL2A 3GYEA 4I9AA 4UNLA 4NJHA 3OVQA 1KBIA 3P84A 2I9EA 5A5WA 1H7XA 2C6QA 3EXRA 4IMGA 3B06A 3OIXA 5H2ZA 5D33A 2DZPA 1R46A 1O5KA 1TIMA 4IQLA 5CG7A 3TW7A 4JR5A 2ZTKA 3N9RA 1N7KA 1P5BA 4O1DA 1EUNA 2WKJA 3PUEA 4LVGA 3G18A 3WJSA 4JNMA 1YYAA 1ONRA 4RX0A 5G1TA 3WJZA 2RH9A 1IIHA 4BF9A 3KOFA 3NQ8A 5D2YA 3M16A 4UIOA 3M0ZA 3MJYA 2VFDA 3P82A 3W7QA 5FEPA 4LVBA 3GKFA 2PE4A 5K9XA 3EWZA 1I8JA 4U28A 1F7BA 3CTLA 5HWNA 4LVDA 3W22A 4UTKA 5H91A 2VELA 2ZRZA 1DQWA 3BLIA 2BWGA 2V81A 1BWKA 5K2ZA 3EXTA 3SECA 2RDWA 4EF9A 5AC8A 5LNSA 1MEHA 2V5LA 4JTSA 4N9DA 3IRDA 3QM3A 1LDCA 2PRMA 1ML1A 3FKKA 4FXSA 3L0GA 4I7VA 4N9EA 3KVLA 1LROA 1FQ0A 3W88A 3QJAA 1ZHAA 1FDJA 4MOZA 3USBA 2X1UA 3PUOA 1VQTA 4K8HA 2ZCGA 3W86A 3C4UA 2P10A 3TMQA 3DHFA 3M5VA 4YCPA 2QJHA 3CWOX 1YDNA 1DJQA 1OJXA 2CLKA 5HUPA 2NX9A 1BEUA 1Z44A 3N34A 3I65A 1JCYA 1LBFA 4DBEA 1M5WA 5K7JA 5DCBA 1NVMA 3KRZA 1TTIA 1NF7A 1QPQA 2DZXA 2VEKA 3W1PA 3MWAA 3W7PA 2HMCA 1R30A 2WNNA 3W85A 3A21A 3PC0A 1XDLA 2Q3RA 4ORIA 1RQBA 4N9CA 1WDWA 1AL7A 3LRMA 5HWMA 1QOPA 1XKYA 1DHPA 2YFNA 3UZ5A 3NL5A 5KMYA 3TKFA 2J9ZA 3HQ1A 3V1PA 2HS6A 1SZGA 5HULA 5KZDA 3UWVA 1GVFA 5EA9A 1MSSA 4ZZ9A 4N02A 3DGRA 4DQWA 3M44A 2VOMA 3W1MA 1FY6A 2J88A 4CNOA 4LUJA 3GVGA 5HWJA 3NZ1A 1FBAA 3TJXA 4QNEA 4XZ9A 3A5FA 3OEXA 3PWAA 2EKCA 3O6DA 1EPXA 3INPA 1KW1A 1PCKA 1EEPA 1TSIA 4LT9A 2PRHA 4TMCA 3PBUA 2V2CA 5AHLA 2WPBA 4JX5A 5HMSA 1VCFA 3BO9A 2FFCA 4ADSA 1K7FA 4ALDA 1JR1A 3MI6A 1F2JA 4XWUA 4ADUA 4RXGA 1JRCA 1B57A 3DHDA 2AQWA 3IVSA 4Y96A 3PVFA 1D3GA 1RQHA 4IWWA 1FCQA 1O94A 2ZDRA 1A5AA 4MLJA 1N55A 3GNNA 3W7KA 4L4MA 2R91A 5K4XA 5F2LA 3O8AA 1LTDA 1ICPA 4O1CA 2I14A 3LTSA 1C8VA 1SPQA 3O07A 5TBOA 2A1YA 2ZRVA 3PULA 2QCHA 3WK2A 2XN1A 4DELA 3B0UX 4N9BA 4JYFA 2YX0A 3UWUA 5BMXA 1GVSA 1A5SA 2BLEA 5EL1A 2ZRUA 4AEOA 2FB3A 2ZRYA 3NOEA 2Z2UA 4AVFA 1W5PA 1K02A 3G1SA 1O4UA 2YZRA 2H90A 2O7SA 2ZYFA 3TAOA 3EWYA 4O0KA 5F4XA 2ZRXA 3G1HA 3C0JA 1PIIA 3TX9A 1A5BA 3CU2A 5L6UA 3TC6A 3BPWA 1N8FA 1JCNA 4LV4A 1VLWA 4LS2A 3EB2A 1A53A 4PA8A 1W37A 4B5NA 2TRSA 1XBVA 2CWNA 3CC1A 1VYRA 1TPFA 4NJIA 3SI9A 2R8WA 1ZY9A 5I3KA 3BVJA 4XQ6A 4KFNA 5D30A 3S1UA 3DI0A 1YTEA 3P61A 3S5ZA 1WOBA 4RV8A 2H8ZA 1LBLA 1WAUA 2QAFA 2NX1A 4MPQA 4UMCA 4ONVA 4YWIA 3UWZA 3PB2A 3A24A 4WD0A 2J24A 5BMWA 1VRDA 1Z42A 3QQ1A 3GZ3A 3QQ0A 2A0NA 4Z1AA 5HJLA 4PEKA 1OYBA 1XXXA 2I1OA 4JX4A 3AJXA 3R12A 1B4KA 3C2VA 5ABTA 3UXAA 1VCVA 1QWGA 4A22A 4TR9A 3ZWTA 3KX6A 3SFKA 4LV9A 3P81A 3QF0A 1WBJA 5FI8A 3CB8A 3W7OA 4LOCA 2ZRWA 4IJBA 4LVAA 2GQAA 2X30A 4QJ1A 2QUUA 2NZLA 3WJYA 4H6KA 1B4EA 2JK2A 4BR1A 4HNTA 1HUVA 2RKXA 2W79A 3DU0A 1JVNA 4GUGA 1DKWA 5C54A 3TXZA 3G1AA 8TIMA 1C9DA 2VXNA 1TQJA 2DORA 2YGYA 2DZUA 2ISSA 4MY9A 3W1UA 3W2MA 1SFLA 1PHQA 1CW2A 4RZ4A 4UMAA 1Y0EA 3TSBA 2WO5A 4O14A 4O4WA 1VC4A 3S8HA 3O63A 1KTBA 1OX6A 3OVPA 3CEPA 2GVJA 3C2RA 4MZ8A 5DY2A 4TMBA 4MY8A 4IPJA 2VFFA 1QO2A 1OHLA 3GXNA 2OT1A 4MFEA 3P8JA 2VC6A 4R33A 3IIXA 5CZ0A 1P0KA 2ZZ1A 4NXKA 3STEA 4IXHA 1H50A 4O1AA 1Q3NA 3H55A 4UTUA 5LNRA 5CPNA 1XFBA 2Y89A 1F76A 5DELA 1TPWA 4K39A 4UTWC 3FJ6A 4XBSA 4LC6A 2QCFA 1U83A 1TO3A 3S6DA 3W6YA 5BNKA 5EPDA 4EWND 2CZFA 3TXVA 2EHHA 5LNWA 3C2FA 2R14A 2FLIA 2PC4A 2Y62A 4NNCA 2Q8LA 3FEMA 3R5EA 4O53A 1F73A 4GBUA 1EP2A 5FF3A 5AFDA 4IXXA 1FWWA 3L21A 4WX2A 2JGYA 2RFGA 2DZVA 3C6CA 3TC7A 1HTIA 2WNQA 4NU7A 2GQ8A 1NEYA 4NT0A 3QMTA 4FO4A 4L4LA 3LTPA 3B05A 5E1QA 2A7PA 4A3UA 2QCEA 1YLVA 3IIPA 1TV7A 1RV8A 2WOQA 3Q94A 3NVTA 3LM7A 3LV6A 3NQCA 1J5TA 3R13A 2JKEA 4AXKA 1U5JA 5FEZA 1X7FA 3DAQA 2TPSA 4O52A 3M7WA 3RNDA 3P5ZA 3C56A 4UTIA 4JIQA 1TB3A 4HHPA 1WV2A 2E1DA 4O54A 2Z6IA 2DP3A 1I2OA 3VE9A 1W5NA 1KLZA 3MP5A 1TPB1 1XCFA 3YPIA 4IOTA 2FDSA 2XN2A 3MBFA 5FF2A 5CPMA 4J9JA 1W3TA 1CI1A 3IV3A 1KM2A 3A23A 3TU9A 4HNVA 3KRUA 3N3MA 4JIPA 3S5NA 3T55A 1TPDA 2HTMA 2G95A 3SW6A 3C3NA 3OVRA 4Z0SA 1TMHA 4RCXA 1LBMA 4WY0F 2FTPA 1WA3A 3TROA 3C52A 3PS7A 5AOUA 2VENA 3UPBA 5E93A 3GX9A 4ZVJA 3GDMA 4BWLA 1L9WA 3W1NA 3IIOA 3L0KA 2B0MA 5I3FA 3CM4A 3HGRA 1EX5A 4O4VA 2QDHA 1G6CA 2QCLA 1FWTA 4MJMA 3M43A 1KBJA 3TA6A 4ZQNA 3W7GA 3FYOA 4WY0A 4O28A 4LUIA 5D37A 5D32A 1W54A 1K8YA 2B4GA 3UY8A 3LCGA 5E0KA 3TK7A 1OFPA 1ME9A 2J6XA 3GXTA 3N9SA 1NSJA 4BWLC 1OFDA 3M5ZA 3HG3A 1XUZA 5U7SA 4CNPA 5DLCA 1DJNA 1RVGA 5HINA 3P8IA 1JRBA 4UCGA 1AL8A 1T8XA 1ALDA 4JTLA 4XTDA 1DQXA 3G0XA 5FEWA 3NPWA 3N19B 3P62A 1OFQA 3W7JA 4PC8A 3THAA 4DPQA 1TJRA 3MYPA 1EB3A 5LSMA 4MJZA 2OZ0A 4N4QA 2EPHA 5F4SA 3GNDA 4MYAA 5G2WA 1TRIA 5IM51 1PHWA 4UTHA 3CLMA 3MHUA 4LTSA 1GT8A 1I4NA 3LTYA 2FPTA 5D04C 2NUXA 5CZJA 2E68A 1SZEA 4HN4A 3P67A 3I7QA 1LRNA 2ZZ5A 4I7WA 1Q6LA 3L67A 1S5VA 1KFEA 3PSWA 1F6PA 4TX9A 3NQMA 3L68A 3C2EA 1SU5A 1B9BA 1V5XA 3W72A 3ANYA 2PURA 5KTLA 2NUYA 3W7MA 3WK1A 5EBUA 5D2WA 4BK9A 1GEQA 3BGJA 1EUAA 5D2XA 4JDBA 1ZAIA 2GVLA 4OBTA 1LORA 3R2GA 2VEMA 3LXCA 3N2MA 4BFAA 2NXHA 2OJPA 1FX6A 4DEFA 2DZWA 3NQAA 4JEQA 3EWWA 2YW4A 3UWWA 1O5XA 4DO4A 3DH7A 2QCGA 1VJIA 2F84A 3STGA 1FDYA 2C19A 4FB7A 1EWDA 4CCCA 3HMJG 4UXDA 3S1WA 2GPTA 3TNOA 3QSRA 1S5TA 2KZHA 1QOQA 6TIMA 2Y7DA 1G69A 3M47A 5T26A 1PCWA 5I3JA 3G1FA 3F1QA 3HOJA 1W3NA 3BV4A 7TIMA 2V8ZA 5C55A 3M6YA 3BARA 3B4UA 1AW2A 4QNWA 2QCDA 3W2NA 3MW7A 1ZENA 1VGAA 3U8GA 1TPUA 1ZJIA 2ZTJA 2CW6A 3W7EA 4FX8A 4X3ZA 2A7NA 1QPOA 3PUDA 1XBXA 4JTGA 3HGOA 1YPFA 2V5BA 1H7WA 2OT0A 2WSQA 3FYPA 4XKYA 4Y8FA 1XUUA 3ZS4A 4NX0A 4LRSA 2C13A 4DBDA 3NQ6A 4X22A 2CLEA 1WOAA 3ABSA 3PF3A 3HO8A 4Y90A 4QM1A 3TW6A 2CZEA 1FWSA 4FF7A 4UNKA 3LERA 3O1NA 3E9AA 2YYTA 3MHFA 2JBMA 3DFQA 4AHOA 5AYZA 1TCDA 4WY0B 5LGZA 4EVZA 1O95A 1AW1A 1UUMA 1ZFJA 4BI7A 5CZTA 1G4TA 2ZZ7A 3UWQA 5LKYA 3BGGA 2DZSA 3FJLA 1QO5A 3LV5A 5DN1A 3QRHA 2NX3A 1DOSA 1JUEA 3TH6A 3NZRA 4UC5A 2EAWA 1G4PA 3M9YA 4JYDA 1JCXA 3IIZA 3IEBA 1Q6RA 4JDYA 1AMKA 2W6RA 1SFJA 1Q45A 3UYCA 1SR9A 3GDRA 4IPIA 4JICA 1EIXA 1MEWA 4E38A 4JGDA 3LCIA 2CLLA 3M5YA 3I68A 2XN0A 3MBDA 1W5MA 3LHYA 4MLRA 1JUKA 3RMJA 1K8XA 1QAPA 2A85A 4AWTA 1BKSA 3ATYA 3LRLA 4MY1A 3UQNA 4O11A 5FESA 1LLZA 4ML9A 3EX6A 3TR2A 4WXZA 5AYXA 1TPEA 4ADTA 5CSRA 2ZZ4A 3L65A 1I2NA 3W2JA 3W2LA 5BOOA 4IX0A 5EY5A 3NQGA 3ELFA 1WX0A 1XBYA 3W2KA 3N14A 1QPNA 4E0CA 3QH2A 1J4EA 3Q58A 3RFAA 3EWUA 3U6WA 3E02A 1Z48A 2PCQA 3PM6A 2OCZA 3L2IA 3SJ3A 2E5CA 3BW3A 5J5RA 3W7NA 4Y6GA 1RZMA 2Y88A 3PSVA 1F6KA 4M6VA 3CWNA 4N6FA 4QQ3A 4K7VA 3NQDA 3OBKA 4UFHA 4TO8A 3MI3A 3S1VA 5SWUA 3SGZA 5CGQA 1TRDA 4NZFA 2Y7GA 1QDSA 3G3DA 1R47A 2ATMA 5D02A 2GJLA 3WK0A 5HR7A 4UUIA 4PODA 5BRBA 1TYGA 3ZWSA 1FXPA 3IVTA 3P60A 1K8ZA 3MO7A 4GFSA 5F1UA 4NXSA 1OK4A 1L6SA 1FDZA 1MZHA 2H3BA 3QMRA 1V7YA 3NXFA 1P0NA 5D09A 3DXIA 1FWNA 1G4SA 3C8FA 5D2VA 2QCDB 4DF1A 3W83A 1SW0A 3DI1A 3CHVA 2YW3A 1LM1A 4IGHA 4UTJA 3KRSA 4X2RA 2GUUA 4M7SA 3QPZA 1FCVA 3FOKA 3TQVA 4AMAA 3QW4B 3TFCA 3CIWA 1GTHA 2FB2A 2RDUA 1Q6QA 2QKFA 2CZDA 1LRQA 4O13A 4XBKA 3UD6A 4XKYB 1T96A 4O8RA 2QAPA 3KVMA 2YCEA 4KFPA 4AAJA 1IGSA 3HGSA 3MP3A 1KM3A 2C1HA 4O12A 5F2MA 3Q2DA 3SIZA 3F4WA 4OV9A 2ZZ6A 3W07A 5D2TA 3WJXA 3ZR4A 3FFSA 3LB0A 2QUTA 5G1YA 2CLHA 3LXAA 1LOQA 3S9YA 2XFWA 2A4AA 3IIVA 3MHGA 2FQIA 3LBMA 3LLFA 4K37A 4JTFA 2C18A 2Z0IA 4RXFA 1SQ7A 4EOUA 5DXXA 4QIUA 5F2GA 3HG2A 3P80A 3MI2A 3NL2A 3B8DA 3KFTA 2B7PA 4ICNA 5K9DA 5DXYA 3IGSA 3TQ0A 4JTUA 3BLEA 3NGJA 5I3GA 4OGZA 1I2PA 3G0UA 3QZEA 1SZNA 2V0TA 4PL2A 1LOSA 3SR7A 2X2GA 4UTWA 3SY5A 3SZ8A 1H7OA 5HUOA 5LGXA 1KFCA 4XTIA 3NQVA 2NV1A 3WFAA 4UFIA 5K9CA 3OHIA 3GR8A 4MKNA 3G8RA 3W1LA 2VEPA 4MIMA 2QEZA 2B7NA 4FNUA 4OE7A 1OK6A 1O60A 4K7YA 5FF4A 1VS1A 2G5WA 4QAIA 5K4ZA 3QW3A 3G3MA 4GRSA 1KLYA 2NWRA 2YDAA 1WYIA 1THFD 4FNRA 2H3DA 3S42A 3GAYA 4OV4A 5IBXA 3TIMA 4LS1A 4BI5A 3KXQA 4JY9A 1YPIA 2E6YA 2Y7EA 4IX2A 4Z1BA 1VR6A 2V2DA 1ADOA 1MEIA 3LHWA 3W84A 4HSOA 3EKZA 1OF8A 3L66A 5GVJA 3NDOA 3LRKA 1KTNA 4BI6A 2QDGA 3HGJA 2E09A 4Z1DA 3IGXA 3PG8A 5IBXC 1D3HA 3U2OA 3LBCA 1SO5A 4N2YA 3B03A 3S5YA 2JKAA 3DZ1A 4UFLA 2RDTA 1VYSX 4NJKA 4E2BA 1GTEA 2E77A 3G1YA 2FJKA 3NG3A 3KVKA 3LI0A 3NEVA 4R53A 1TTQA 3G8EA 1LRTA 1VCGA 1VHNA 4A21A 3L9CA 1YXCA 3UZJA 2YR1A 5CPLA 4RR4A 2Z1BA 2NWSA 1H61A 3S0CA 3Q37A 3BK0A 2B7OA 1VYPX 5G4EA 1FCUA 4OQVA 3LLDA 4PTNA 3STCA 3QSTA 4XUGA 1GWJA 3GAKA 2X1TA 1FCBA 4JTKA 2NXGA 2Z6JA 3KHJA 1SO3A 3LCHA 1GQNA 1KM0A 3W76A 1JCLA 3N73A 3T4CA 5G2HA 4AWSA 1TTPA 3TSMA 4K38A 1H7NA 1OG0A 3K30A 2QJGA 3KAOA 4FXRA 3UPWA 3FA5A 2NUWA 4A2SA 2P0OA 1YTDA 5D03A 4FNTA 3IGUA 3NPXA 1KFBA 2Y61A 3DENA 2ABAA 4R7JA 3GR7A 3L0NA 3NPVA 1W31A 4RZ5A 3A9IA 3O06A 5KINA 1DV7A 3UNDA 4HPJA 4Z08A 1SW3A 4MZYA 4D2JA 5J5DA 1KFLA 3LHTA 3MP4A 3HPSA 1QCWA 1OFOA 4ZQCA 3G0SA 2E6DA 5AHEA 2BTMA 4X9SA 4CCEA 2J27A 2NLIA 1KM4A 4JX6A 5CPOA 1TPH1 4JD4A 4CCDA 3LOTA 3W70A 4ZQOA 1GVRA 3G1XA 1X1OA 1ZAHA 1TV5A 4AF0A 3ABRA 4WJEA 1Z41A 2ISVA 1JQVA 2FPYA 3UWYA 4RJEA 1H5YA 4CNNA 1VH7A 1GYLA 3FKRA 1XC4A 1WXJA 4P2VA 4PH6A 4YMZA 3IVUA 1JQXA 1UCWA 3O6YX 3AO0A 4KWWA 2A6LA 2R94A 3B0VC 1F5ZA 3VFLA 2Y7FA 1EP1A 2F7FA 1T99A 3LI1A 3I6RA 3R89A 3HJZA 1YDOA 1XDMA 3JS3A 4HKPA 2WSRA 4IMCA 2BSLA 4FNSA 4RK8A 3HPZA 4FNQA 2ZZ2A 4IMDA 1VZWA 4HIBA 2GOUA 2RHGA 5HNRA 2IQTA 3RU6A 3M5XA 1FWRA 1G7UA 1AW5A 2J9YA 2QJIA 2ATSA 1VLIA 1ZNNA 1VHCA 2Q8ZA 4OWGA 2AAMA 3ABQA 2B7QA 3A5VA 2BZNA 1MXSA 2ZFAA 3EEGA 1L6WA 1DL3A 3O15A 1GG0A 3W3OA 3DFTA 4WZHA 3HG5A 5BW6A 4MVAA 5C2XA 2A7RA 3NQ2A 1W5QA 2QUVA 3GDKA 2TSYA 3W1QA 4UFMA 4FX7A 1H51A 3VCRA 1P4CA 4QSHA 4Z1CA 5FF0A 3DKLA 1TPVA 3EX1A 2A6NA 3TDFA 2TMDA 1AK5A 2QCCA 2YXGA 2BX7A 4JTIA 5AHNA 2EF9A 3W7DA 3L5MA 3GB6A 1W8SA 4H3DA 1UJPA 2JGQA 4FHAA 3H53A 1K7EA 4GE8A 4POCA 2C3ZA 4LRTA 3C61A 4RZ6A 1H62A 3LCWA 4IMFA 3BW4A 3NPUA 3T78A 3FS2A 1JJKA 3DFPA 2ZQ0A 1ZAJA 5CSSA 2V30A 3W9ZA 3W1RA 1PVNA 3LGEA 1H1ZA 5DBTA 3W7IA 1UB3A 4GXMA 4NJJA 3N2XA 4UFJA 2Y6ZA 4WUIA 4WOZA 5FF7A 3R8RA 2DZTA 3EKLA 3NYZA 3STFA 3W87A 1EA0A 1PS9A 4HSNA 2OMAA 2YSWA 4AB4A 3B04A 4JY8A 4R34A 3EWBX 3TCEA 1WBHA 5D05A 1C29A 4O15A 4NZJA 1HO4A 4HPXA 2DJXA 4A29A 1TJPA 3DFNA 3MMTA 2ABBA 2QR6A 3NR0A 1QNVA 2ZZ3A 1W56A 2A5HA 1HL2A 4KWVA 1NF0A 2E6FA 2V82A 3THQA 1HFBA 4DO5A 3QYQA 2X1RA 3NA8A 1IF2A 3PG9A 1CX9A 1EWEA 2Y85A 1GPWA 1LOLA 1OFEA 4ZQRA 3TAKA 2HS8A 3W73A 4AF0B 5LZLA 2YPIA 1ZALA 2QCNA 1M7PA 5EKYA 3QMSA 3HIJA 3O05A 4LC8A 4LW7A 3W1TA 4CQ8A 1IXNA 2V2HA 3VI2A 3DFOA 2Q3OA 3T7VA 3RLVA 4OT7A 1FXQA 1GZGA 3S5OA 5G2IA 3TJLA 5F2IA 4LWWA 3FLUA 1X1ZA 2ZA1A 3W75A 4GUJA 4KKXA 1YXDA 2A21A 4FNPA 1A50A 5DBUA 1NAL1 2A2IA 3PBWA 3NO5A 4EIVA 3NQFA 4ZQPA 1GG1A 1H60A 4QISA 4IMEA 4UMBA 1YADA 4NX5A 1ME8A 2LLEA 3BLFA 3W23A 3LHZA 2ALDA 2CLIA 5LHEA 5DCDA 1KM5A 2FPVA 1W5OA 5I3HA 2ZA3A 2H6RA 1S5WA 3QPYA 4GNJA 3GDLA 1VPXA 1WQ5A 3GK0A 3CQ0A 4UTMA 1T0OA 5C6MA 4GUIA 4DF0A 1UBSA 4WXYA 1KV5A 1B3OA 3LDVA 3NQ7A 1H1YA 1G67A 2C0AA 3TFXA 5AN7A 2E5BA 3CT7A 1I45A 3W74A 3LHUA 4PCFA 4RLIA 5LNUA 5DY3A 4IUOA 1OFRA 1IXQA 4WQ6A 1YDVA 4FX6M 1SO6A 3PBYA 3RLUA 3OG3A 3TV8A 1YTKA 4JS3A 1G4EA 4MZ1A 2EGZA 3LCLA 2CZ5A 3QFEA 3NM3A 1M7OA 1OABA 1R2RA 1ME7A 3EWXA 1OF6A 2ISWA 4N6EA 1JCJA 3CIXA 3A22A 4RKAA 4TIMA 2YFOA 5EYWA 1RQEA 3BG3A 2H8XA 3P74A 3W71A 4GJ1A 4NJGA 4KFOA 5CZSA 4M5PA 1LCOA 4JXCA 1DVJA 2E6AA 5HQEA 5L9FA 1PV8A 5TIMA 3I7SA 2NXIA 1KA9F 3LXBA 4HT3A 3ZFHA 3GIYA 4ORMA 3JR2A 3S1XA 1D9EA 2HSAA 4PL1A
chains in the Genus database with same CATH superfamily
2PMQA 4DF2A 1PJ9A 2WM0A 3W53A 3HQPA 3SQLA 5AHFA 3IJLA 1IIGA 3BW2A 1ZP3A 1M3UA 5KZEA 4MUZA 4NG3A 2QVHA 2Y70A 4CQAA 3POHA 1EJVC 3IACA 3NM1A 3NL6A 1UUOA 3EGJA 5HMDA 1M7JA 3WK3A 4JNZA 3IJ8A 3RPDA 3IUDA 4H7ZA 2XIBA 1TPC1 3AI0A 4MNLA 1V93A 2QF7A 3GLCA 4ZE5A 1WAWA 1Q5MA 4M6PA 2Q71A 1XKJA 3ITVA 4JHZA 2Z1SA 4MB4A 1L2UA 1TTJA 1SZRA 2J9XA 3QEZA 1QFEA 4CD6A 4W5UA 2B31A 1VBJA 3CAQA 1LZOA 3EBVA 5HMFA 3V36A 4OHQA 2VFIA 4LNYA 1VB9A 4M6QA 6A3HA 2WSYA 1H7RA 3G24A 3N11A 1JULA 1SMAA 2GVGA 2FGBA 3RF9A 3HU7A 4JYEA 2OX1A 1A5CA 1KFJA 4M1RA 4D6JA 1VFOA 5I07A 1KR0A 3UCCA 1BSIA 3UT0A 2XDFA 4AHQA 3OVGA 1ODUA 1UPMB 2JEQA 5HOSA 4EK7A 4OIFA 3KWSA 1NH6A 4QJ5B 3VKAA 2DH3A 4UTTA 4G1KA 2CLMA 1TREA 4C1LA 1D7KA 3KW3A 2G50A 2V5CA 3BV7A 3G2GA 1KKOA 1UKPA 3QLLA 1S1RA 3KS5A 2VX5A 2VEIA 4NIRA 4O1BA 3O16A 1P1XA 5G4WA 2WJZA 4UWMA 2GWNA 2VHLA 3E12A 3DKJA 4KCWA 3E0IA 3BE7A 3A4WA 4KW2A 3PP7A 1Y5XA 4LS0A 1AUSL 3RO6A 4ACZA 1OT1A 1IR1A 4NF7A 2NQLA 2ZUUA 3W7HA 2XVGA 2O55A 3UU0A 4KRZA 3VNJA 4M29A 1TQXA 5AC7A 3SY8A 2E4TA 2PU1A 4JQ3A 1QU4A 5AHIA 3WMBA 3HG4A 3RRXA 1EBGA 1EL3A 5D8ZA 4BQ5A 4AH7A 4PBFA 5DRIA 5I78A 2WBKA 1PBGA 3I7RA 3OLIA 4XD6A 4GA8A 1PZ0A 4C7DA 4HNCA 2DU2A 4ES4A 2IQ0A 1VBGA 3C3UA 4DBWA 2WV8A 2GYIA 4X2PA 4AIUA 3RAOA 3AICA 2A3LA 1UHVA 1JUBA 3LM3A 1EYEA 2ACQA 3BMXA 3VE7A 4AHPA 1RVKA 2YCLB 4Q4KA 4PUWA 3W28A 4FLSA 1JCMP 3GSMA 1OD0A 5KZMA 2X0SA 4NRRA 3MSYA 4FAMA 1KD0A 2XVNA 3SCRA 2JIEA 3JZEA 1RPXA 1TG7A 3TWBA 1H63A 1J18A 3O6CA 1IXPA 2BXVA 1FWCC 4CLMA 1OX4B 2WQPA 5KSWA 1XWYA 3K8MA 5JIWA 1G7VA 1H7PA 3LX9A 3QC0A 5M1TA 3O0FA 4JIHA 9RUBA 1UWIA 1ICQA 3GVVA 3SQMA 1R85A 1D2KA 1YQ2A 1W0MA 3EDFA 4CVUA 1XSKA 4NKCA 1HGYA 1TE1A 4S1FA 5G5IA 1UOZA 1XL9A 4H8UA 4QITA 2J25A 5I3IA 3SBFA 4MWAD 2PDHA 1I2QA 1UPPA 4LCRA 3J7HA 3WJWA 1Q6DA 4YHEA 7TAAA 3VMNA 1XCXA 3H54A 4Q8TA 2XINA 2OGYA 3U2ZA 1GVOA 1LP6A 3KOYA 1XM3A 3GU2A 2CFFA 3URQA 3GH5A 1JPMA 1BWLA 2P76A 3GYEA 3TZFA 4UNLA 3ES8A 1IGWA 3A6OA 3WEMA 3PNZA 1CCWB 3KHDA 4HOXA 3OIXA 5H2ZA 4HU4A 5D33A 3TW7A 1CLXA 1O7AA 1P5BA 4H8NA 3OLDA 4JNMA 5E9AA 3QPEA 2QQ6A 2OB3A 2RH9A 1IIHA 3LGGA 5E09A 3REQA 3WMLA 4BF9A 3M0ZA 4GH3A 4LH8A 1UR1A 8CGTA 4B5VA 4XAFA 4QLJA 4M82A 3NURA 4IL0A 4J3VA 4V33A 5DMYA 1F8MA 2VEFA 3EXTA 4W84A 1EGMA 3GD6A 2RDWA 3DDMA 2V5LA 1U22A 1EXBA 4B3ZA 1PKLA 2GUBA 1XYMA 3IRDA 3TQPA 3ARTA 3Q4DA 5CJ5A 3KVLA 2RGLA 3UG3A 2B81A 3QJAA 1FDJA 4XVEA 3PUOA 3VKKA 1VQTA 4ACYA 1JDAA 3HA1A 2PTYA 3M5VA 1J5SA 2QJHA 3VA8A 4GINA 1EIBA 2CLKA 3B8SA 4Q7NA 1HKIA 3I65A 2Z1KA 5K7JA 5DCBA 1NVMA 1S2UA 2XH4A 1EDGA 4C6IA 2HMCA 2WNNA 3W85A 5IXEA 1XDLA 4ORIA 1C92A 2BFGA 1CIUA 1HW6A 1SVDA 3TN3A 4J5NA 2BVWA 1R5YA 3UZ5A 2H9AA 3TKFA 2GUYA 5BU6A 2J9ZA 1Y65A 5LIXX 2VDIA 4CNOA 4LUJA 5JBEA 3GNXA 1H0GA 4QNEA 1LQ2A 3ZJ6A 3A5FA 4M6UA 2E8ZA 1KW1A 2PRHA 5M2FX 1QI4A 2PGRA 3PBUA 4IUGA 5CGTA 3EAUA 1O1ZA 2WPBA 1DXEA 4GX9A 4HN8A 5HMSA 3LPOA 3BOLA 1HP4A 5GNXA 4D6DA 5HDRA 3PANA 1UUQA 4NILA 4XG1A 4ADUA 1JRCA 1SMDA 3DHDA 2AQWA 4BA0A 1A5NC 1H41A 3WD1A 1D3GA 2WZIA 3OU8A 3IJDA 4JKKA 2ZDRA 1A5AA 5K4XA 1N55A 2PDJA 3W7KA 5T8GA 2R91A 3WFZA 1W1YA 3O8AA 4PMYA 1LTDA 1ICPA 4MSSA 4HOWA 5A8PA 3LTSA 3O07A 5TBOA 2EQDA 3VNZA 3W0KA 3WK2A 2WBGA 4I5XA 1PAMA 3B0UX 4JYFA 1EF3A 1GVSA 4LYRA 4XBJA 3WCZA 3W81A 1TMQA 3GS6A 4B92A 2GJRA 3ZZ1A 3NOEA 3CYVA 2XU2A 1I9CB 2EJAA 2ZYFA 5F4XA 3A4JA 2C71A 3G1HA 3UP8A 1OCJA 3CU2A 5B7ZA 5GNZA 3FY1A 1N82A 3M4HA 4LS2A 3V35A 2O56A 4B5NA 2CWNA 4CNTA 3VD5A 4NJIA 3SI9A 2BOGX 2GFTA 3HMCA 3CV7A 3L2LA 4CD4A 3P61A 4L4OA 2WK2A 3FK4A 4UQCA 4Q8QA 2RGMA 2NX1A 4MPQA 4TQTA 1NARA 1FWEC 4LEFA 2POTA 2YCLA 5HJXA 4WD0A 5BMWA 4B15A 3UCDA 1S2TA 1VRDA 1NJJA 2CBJA 7ENLA 4PEKA 2V3FA 3UA3A 1XXXA 3NCOA 2EG6A 5FKYA 5A2CA 5ABTA 3PBMA 1MFUA 1VCVA 3BAXA 3CPGA 2ISDA 5PTDA 4GVIA 1R0MA 3VIFA 2W91A 2XH7A 3KTXA 1JZ8A 1K6AA 4LVAA 2X30A 3TN5A 1T41A 2X8RA 3GHUA 3OP2A 4Z2HA 4GUGA 4C91A 1TWWA 2YGYA 3CBWA 3F2CA 6XIMA 1SFLA 4X0VA 4RZ4A 1MDLA 2WO5A 1IEVA 9XIMA 4O4WA 3LMYA 1KTBA 3KOZA 3O63A 3OVPA 4B5XA 1W3KA 2DQWA 3E3HA 1UH4A 3NZQA 1RLCL 3GH7A 1QHPA 1QO2A 3GXNA 2JE8A 5CZ0A 2ZZ1A 4GQQA 1BXBA 2OYKA 1M9HA 5DELA 3MVIA 4K39A 1R3VA 1J93A 3I3EA 4H2HA 4LC6A 1MXDA 1TO3A 3W6YA 3AIQA 4QR6A 4UQDA 5EPDA 1LWIA 4EWND 3VM7A 2CZFA 3TXVA 2EHHA 3C2FA 1QI0A 3A4AA 3E38A 4NNCA 4IGMA 3W38A 2XJ7A 1U2YA 1Q85A 5A6KA 1EP2A 3H70A 1EQPA 4WX2A 2JGYA 2O0TA 1QNRA 3WH8A 4E8CA 3C6CA 1EJXC 3TC7A 2AKMA 1HTIA 1XGEA 2FVLA 2WNQA 1YW1A 5REQB 1JZ4A 4B2DD 3PUGA 4A3UA 3M0KA 2VRKA 1PUDA 3WNKA 1TV7A 4LALA 1RV8A 3NVTA 2BY1A 1UKQA 1H0IA 2Z1WA 1XFCA 3LV6A 4HCDA 4EXBA 4TUFA 1U5JA 4GI8A 3T09A 3SCTA 1X7FA 1J8VA 3E6EA 2E1WA 5C9UA 4O52A 2EPLX 4YTTA 3VABA 5DEZA 3C56A 4UTIA 3SCPA 4EANA 2EEXA 1DWGM 3HQNA 1W5NA 3MP5A 4QE5A 3AMCA 1XCFA 4GJJA 3NXLA 4HJWA 3IV3A 3A23A 3TU9A 4HNVA 3N3MA 3T55A 1Q8AA 3OVRA 3GTFA 4LB3A 5AOUA 3UPBA 2I16A 1YDYA 4ZO8A 2VR2A 7XIMA 4WKHA 4KMQA 3MSGA 1ZL1A 2JF6A 3HGRA 1EX5A 5IHSA 4MJMA 4IIEA 4PGLA 3M43A 1KBJA 5LIKX 3EOOA 3VOGA 1WB0A 2R24A 2FYMA 3GXMA 3AMKA 1V6WA 3QLDA 1K8YA 1BVNP 4HA1A 5XINA 4DYJA 4U10A 3GXTA 3PZTA 1TV4A 5CXPA 3ZLGA 3HG3A 4CNPA 3CPUA 3ITYA 2ONEA 1KBKA 4YTSA 3ECQA 2OQLA 3V5OA 2ADAA 1LG1A 3I4KA 1W1IE 4DPQA 4GD0A 1TJRA 1EB3A 4N4QA 2EPHA 2VD9A 3PFMA 1V51A 3BSMA 4KIEA 4MYAA 3MV01 3OZOA 4UTHA 3T8QA 3L12A 3MHUA 3WUEA 4GISA 3P2VA 4I7WA 1ISXA 3H2FA 1F6PA 2QW5A 4HZMA 1UR0A 3AS2A 3S1GA 1SU5A 2DT3A 2CEQA 3EYPA 1UWUA 1RLDA 4Q8MA 1WPCA 1Q4NX 5D2WA 4Q8WA 1XH1A 5E0FA 3QQWA 4HCHA 3IANA 3UG4A 2OPJA 3MWCA 4DRSA 3BAWA 2VEMA 2INZA 3FW6A 4GIAA 1FX6A 2DZWA 3QTPA 1MQQA 1XIIA 4JEQA 1V7AA 3UWWA 3STGA 1KXHA 4EX4A 2QYGA 2XSXA 1DIKA 3HMJG 2CBUA 3ME3A 3RHGA 1XLMA 1S5TA 4J3TA 1UG6A 2VC9A 6TIMA 1LG2A 2Y7DA 2VDGA 5J8LA 4B4FA 1TV3A 2P5NA 4JKLA 2WXDM 2PTDA 1B30A 3M6YA 4LXFA 1AW2A 4PEEA 3EMZA 5FIPA 2QCDA 3W2NA 1BG9A 1ZENA 1OIFA 1UD3A 3WBWA 1VGAA 3BWWA 2VVSA 5I6SA 3KDNA 3N2BA 3W7EA 4X3ZA 2I5IA 1QPOA 1XBXA 1YPFA 1UKTA 4S3AA 4H41A 4PUMA 3ZS4A 4LRSA 4XKMA 1Z3NA 2D24A 1VFMA 1XH2A 2YL5A 3BAIA 4J27A 4X22A 3VK5A 2PDWA 4QE1A 3WNLA 1Q2RA 3HO8A 4Y90A 3RUBL 1SFTA 5AZ1A 3F5LA 3O1NA 2BS9A 3U4FA 2IMRA 2JBMA 2QT3A 4AHOA 4V1XA 1TCDA 3ZT5A 4EVZA 4WKAA 3B0XA 1AW1A 4ATLA 1VJZA 5DN1A 1E0VA 2EPMX 4Q8OA 4L6DA 3QZ6A 3NZRA 4UC5A 4GO8A 4LQ1A 1JCXA 4JDYA 1Q8JA 1UH3A 1SFJA 1Q45A 1JPHA 3UYCA 3B8IA 1XRVA 4JICA 4IP7A 1EIXA 4NZ4A 4E38A 2WVVA 3SCQA 3OHMB 2FFIA 3M5YA 4OECA 5CPTA 1XLBA 3MBDA 4PUJA 1XQLA 4WJ8A 1F3WA 4HU3A 3SCSA 1JUKA 2XH0A 2WJFA 3VGFA 1GKPA 4LUSB 3WELA 4A05A 4AWTA 1UJQA 3LRLA 4JOMA 1LLZA 2W62A 3EX6A 3TR2A 4WXZA 3B8UA 2QZRA 1TPEA 2P8CA 4GY1A 4ADTA 5CSRA 1UR9A 1US2A 2OKTA 3W2JA 4GOAA 4GZJA 5BOOA 4IX0A 4CN1A 1V3IA 4JQ2A 5C8BB 4J3UA 1WX0A 2YBTA 3KCLA 2HISA 1CENA 4I8YA 2XIIA 4JFVA 4JEJA 3RFAA 3EWUA 1ZCCA 4GNKB 4KH2A 2PCQA 1UZHA 3OJGA 3LN3A 5REQA 3CUJA 5LA2A 1HL8A 3BW3A 2XFYA 5J5RA 4DWSA 4LANA 4UQ9A 1RZMA 1E1FA 3PSVA 2XUCA 1F6KA 2GJPA 3ERPA 3SUWA 4K7VA 4H83A 2VZTA 4IIGA 5CGQA 1F61A 1QDSA 3AJ7A 1RCOB 4KT2A 2ATMA 4DZHA 5HR7A 5M17A 4ROQA 4PODA 2GGHA 1BGGA 1TYGA 2BGQA 4DZ5A 3IVTA 3AWNA 2AAAA 5A2AA 4KCUA 1LLOA 4NXSA 1OK4A 4ZEPA 1CGXA 3DXIA 3WF1A 4DF1A 4QLKA 3W83A 1SW0A 3ZT6A 3CHVA 1QW7A 2DUAA 4IGHA 4KESA 5JMUA 1J0JA 2YLLA 4DHGA 1TA3B 2GUUA 4M7SA 4XAYA 3FDGA 3TFCA 5LYRA 3WD3A 1GTHA 2I9UA 1Q6QA 4QG9A 4ICMA 1C8XA 2XG9A 1WDSA 1T96A 4O8RA 3VOCA 3XISA 3MP3A 4O12A 1DQUA 3TVAA 4LAZA 4I5UA 3W4RA 3W07A 5D2TA 3ZR4A 3IGHX 4C5ZA 2XFWA 2A4AA 3HV8A 2PPGA 4AYSA 1UKSA 2VO5A 4K8GA 1MQRA 3VUPA 1POJA 4QIUA 3P80A 3NL2A 2XTKA 3IUIA 4U5IA 4LF2A 3IGSA 3TQ0A 3WF0A 3KOWA 1P7TA 2J77A 4OGZA 3QZEA 4A3HA 3WH9A 5BXPA 2X2GA 3ARUA 2E0PA 5HQMA 2QUNA 3WFAA 1U30A 3OHIA 3N12A 3SUTA 1L8NA 3G8RA 2W92A 2VEPA 2B7NA 3B9NA 3ANUA 2O9PA 3OBAA 1WNOA 4OE7A 3F2DA 1EDQA 3G3MA 2ZWZA 3C2YA 2V3GA 3MUIA 1WYIA 3S42A 2Y4SA 4KGJA 4H9VA 3L23A 4OV4A 5IBXA 3TIMA 4LS1A 4BI5A 3WD4A 3BJSA 3KXQA 1CGVA 4F40A 3AAMA 1YPIA 2Y7EA 4MHBA 3AFBA 3LHWA 1Y5VA 5JH2A 3AXKA 4H6RA 1UA7A 3LRKA 3CV2A 4BI6A 3HGJA 1P0BA 1S2WA 5BXRA 3TNBA 4E8DA 3EDJA 1UQYA 5FL1A 2GOKA 1D3HA 2SFPA 3LBCA 2HPMA 3GG1A 5CC3A 3U0HA 4ECLA 1XLJA 4N2YA 3B03A 1LF1A 1UH2A 4ZB0A 5JH1A 2YDSA 5HMEA 1MW2A 1GTEA 3G1YA 3UPMA 3NEVA 4R53A 1TTQA 3G8EA 2VX7A 3EB4A 1A4MA 2VZVA 3I3DA 1YXCA 2VURA 4EPDC 4FOKA 1VEPA 1W9UA 4I6VA 3S0CA 4WF7A 3BK0A 5G4EA 1FCUA 4RNHA 4OQVA 3LLDA 4QRNA 1C7TA 4MNKA 3QSTA 3C0QA 4ZB2A 3R0KA 1KM0A 3N17A 1JCLA 3N73A 2ACRA 1OGGA 1HP5A 3O7UA 4AWSA 4FOUA 4RE4A 3PPFA 2WMJA 4TX6A 1AQ0A 1H7NA 3K30A 5E0CA 1BPLB 2P0OA 4KRTA 1S5MA 1YTDA 3E2VA 1E6QM 3EWCA 4F8XA 4R7JA 3GR7A 4RZ5A 4H8VA 1JIBA 2NQZA 5KINA 2PLKA 4HPJA 1SW3A 1PEZA 3TYEA 3LHTA 3W02A 7CGTA 3PZOA 1V3JA 2KX9A 2WYSA 1FRBA 3B8WA 3EMQA 3UETA 3G0SA 1FWHC 3DFHA 3UXKA 4AEEA 1Q63A 4CCEA 3ARSA 1QNQA 4CCZA 5J04A 2WPGA 3HFYA 3WQ5A 4C1NA 2GVEA 1GGOA 4HCLA 4H7VA 4XO7A 3BOFA 4DM2A 2R1LA 3ZIZA 3UG5A 3ITOA 4WJEA 4FLQA 5BRPA 2ISVA 2FPYA 1AMYA 1VH7A 4IP4A 1X97A 3RCMA 4P2VA 1XD0A 1X98A 1K77A 3O6YX 1VEOA 4UQEA 1QXLA 3VO0A 1ISWA 3GRIA 3R89A 4JFSA 3U5UA 3JS3A 1SYTA 3JZUA 3EOUA 2WLYA 3F4VA 3HPZA 1LQAA 4C6EA 4IMDA 4U5KA 1VZWA 2OLHA 4LYQA 2GOUA 3NOYA 2WWDA 2IQTA 1G7UA 2J9YA 2R9RA 2ATSA 4H6EA 1VHCA 2J6VA 1JPIA 2B7QA 3U3HA 2BZNA 3FA4A 2ZFAA 3EEGA 4C60A 3QGKC 5XIMA 1DL3A 2EXOA 3AZRA 2W4XA 4WZHA 3HG5A 4GYPC 5BW6A 2EJ1A 2A7RA 4NZ5A 4Y7EA 4RE3A 2TSYA 1EO5A 5H6HA 2P3ZA 1UZDA 3IJIA 3VDGA 4GPNA 1JL8A 5FF0A 4PUUA 4XISA 4YVPA 3OQ8A 2QCCA 3LBOA 3ZJ7A 4H9ZA 3VINA 1JNEA 1OSEA 1W2PA 1LUCB 1BXNA 1QASA 1RP9A 1V77A 4JBRA 1W8SA 4H3DA 4W86A 3B8VA 1K7EA 1QNSA 4GE8A 4UZUA 4BQ3A 3CZ8A 4ZTXA 1KRCC 4RZ6A 1H62A 2ZX5A 3BW4A 3T78A 1X6LA 2JFEX 1JJKA 1LL4A 1B9ZA 2ZQ0A 2GSHA 3W9ZA 2VWTA 4BZYA 3LGEA 1E4LA 1NWSA 2OLSA 4ZOAA 4WUIA 2YBVA 1XIEA 3EKLA 4CGTA 3ZVHA 1ZPTA 4HSNA 2BASA 3KTSA 3S46A 2W9MA 2YSWA 4W8BA 4R34A 1J11A 1UOKA 3TCEA 1C29A 3SAZA 5BOFA 1UR3M 4NZJA 4A29A 3DFNA 2D3LA 1O5QA 2QR6A 4G56A 4MM1A 1BYDA 3NR0A 1A0CA 4H7CA 2ZZ3A 3AIUA 1HL2A 1V3MA 1PDYA 2E6FA 4QDWA 4D1JA 4DO5A 1HJVA 3QTGA 4GCXA 6PTDA 4AUBA 1EWEA 2Y85A 1GPWA 4HZ7A 2HROA 1VIWA 1R3QA 3HFTA 2HS8A 2WZEA 4AF0B 5LZLA 5D9OA 4OUEA 2QLYA 5EKYA 3QMSA 1W9XA 1KRBC 2AMGA 4LW7A 2V2HA 2IUZA 1DIEA 1U1JA 1GZGA 3S5OA 2ICSA 2XGBA 5BYWA 4XZLX 4AZ6A 2DIEA 2ZA1A 2A21A 5DBUA 3MO4A 1XQKA 4LYKA 1EJ7L 3NQFA 1H60A 3A13A 4PSRA 3BH4A 2WZTA 3VM5A 1GKRA 3W23A 3LHZA 2CBVA 1DE6A 2CLIA 5IFTA 5JUVA 2VI0A 1UD8A 2QIIA 3GDLA 1VPXA 5BROA 1CDGA 4UTMA 4GUIA 3LEPA 4P7LA 1KV5A 2R1MA 4AD1A 2QS8A 3IK4A 1FTXA 3TFXA 5AN7A 3H24A 3SRFA 3N2CA 3BLKA 4L1GA 4RLIA 1E1CB 5LNUA 4HTYA 4PBGA 1F6YA 7A3HA 1IXQA 4M8UA 3WG6A 2X0HA 4FX6M 3PBYA 1Q7QA 1IE7C 3RLUA 2FVMA 4JS3A 3R0UA 4MZ1A 1DJWA 3LCLA 3WBXA 1IZCA 3NM3A 1OABA 1JGIA 3AHZA 3D3FA 4TIMA 2C1IA 3GO2A 2QJMA 2JALA 2YXOA 3W37A 4M5PA 4JXCA 5L9FA 5M3WA 1PV8A 2JEPA 2NXIA 1KA9F 1OC5A 4RL3A 1WCGA 3L5AA 3NQEA 3PAJA 3SGUA 1NDYA 2PTWA 1PTDA 1FH9A 3EX3A 1BRLB 4PMUA 1YBQA 4NQ1A 3A3WA 3B0PA 2XZ9A 2PWFA 3MV11 3LCFA 5AC6A 1KM6A 3B8TA 1CGYA 1Q6OA 5EGRA 3JUGA 1H1NA 4RDVA 4G7EA 1CB2A 1UASA 1LYXA 2WZHA 2NLYA 3I10A 4S2CA 4WDWA 1IXOA 1E5JA 3CWHA 1UROA 1QR7A 2V38A 3U4AA 4P61A 1F3EA 4JTTA 3W1AA 1WDRA 3DECA 2BHZA 5IOBA 1HIZA 1R2SA 4IIBA 1UBPC 1PSCA 2O7QA 3CK5A 4RZBA 3F03K 3QV7A 4ERGA 3T44A 4GBDA 3VNDA 4LAKA 4Z2GA 2CNCA 3B0YA 3M41A 5CAHA 3WUBA 3VGHA 3WQDA 4H9MA 1C7SA 2PWDA 2NSXA 4YXGA 4O50A 3ATZA 1UWSA 4MYXA 3S6OA 1XIGA 3TE9A 3CH0A 2WMIA 3K46A 1X8FA 2PF0A 3A64A 4RV3A 3P5YA 2VGFA 1YRRA 1HO1A 1PL9A 1QMLA 4O0ZA 4LU0A 2OOGA 3WBYA 3AOFA 3NGFA 1SO4A 1EEXA 4HA0A 4OU1A 4UR7A 4NSBA 5MF5A 3EX2A 3L4TA 3SUVA 1NFBA 5EMJA 2G97A 5K3VA 3UY7A 4L9YA 4FIQA 4JTHA 2ZBTA 4PTVA 2DW6A 5B7YA 4FA3A 4FK9A 1K03A 2GDQA 2VFHA 1KFKA 4PUNA 4UOQA 2A3HA 3FX4A 4HPGA 2GJNA 3S47A 2GGEA 2PFHA 4R7OA 2AGKA 3D46A 1AG1O 4EAYA 4NVTA 2X05A 4GG9A 4TTUA 4DJEA 4GUHA 3CXOA 4XAGA 5HAOA 2KAUC 3Q45A 4QS6A 3ABXA 3P93A 4MFDA 1F05A 2WLZA 1EF2A 2D73A 2C7FA 3PZMA 3BG5A 2X16A 1OX5A 4O16A 4DXVA 1AZ2A 2CITA 3VKCA 3MYOA 1E6RA 5GQBA 4C6DA 1SSGA 4R27A 3CNYA 2OO0A 1TVNA 4JAWA 3KBSA 1AD1A 3VKJA 1K7XA 3CV6A 5HR6A 1SW7A 2QCMA 3MCNA 4S3BA 5AY7A 4LY4A 1XYZA 4GQRA 4CQ9A 1QPKA 4S23A 5U4NA 3RIKA 1JD9A 3TQKA 3VIHA 2BXZA 3GU9A 4F0HA 1RY8A 1R3RA 3GC5A 1XYLA 1DJGA 4WSHA 1UD2A 3QC3A 3C0LA 3KZPA 4EPEC 4QBXA 1LL6A 3TN6A 3QHNA 4DO6A 1SZFA 1RK5A 1UP3A 2D0FA 4S39A 4QSFA 4AZHA 3SM0A 3MJMA 1FWGC 1HKKA 1GPFA 3UWEA 3AIWA 4D72A 3G1DA 3LHVA 1TMLA 3EZ4A 3O9NA 4AZIA 2V3EA 1N8WA 3F4NA 4JFWA 5FCZA 1IWAA 3DFSA 4AX7A 3S3GA 2BBFA 5HQLA 3AIRA 2HZGA 3UXLA 1ICSA 4R5EA 3KLKA 1DYSA 2DH2A 1C93A 1XI3A 4H4IA 1OVDA 4ZBCA 3EB3A 2PDGA 4C6PA 1W1ZA 1JXKA 4RNJA 5IHRA 3NDYA 2PLJA 4LVFA 1RHCA 3NJ3A 1S3TC 1EH9A 3GTNA 5FJOA 4I9AA 4NJHA 1MRAA 4Q6JA 4JL1A 3P84A 4ZENA 2YIHA 1F3XA 1H7XA 3V1HA 2C6QA 1TZ9A 2P50A 3VOIA 3BAYA 5CG7A 3EMCA 3SO7A 2WCGA 4O1DA 1R86A 3WNMA 2AL2B 3G18A 3WJSA 3WMSA 4RX0A 3PPHA 1EHAA 4QX4A 1U5VA 3WQOA 4YWSA 3P82A 3W7QA 1EOKA 1FHUA 1NDWA 4HMNA 4CD7A 1IQ8A 3GG7A 4ASTA 1F7BA 1R7AA 2G3MA 2OELA 2BV9A 5B80A 4WDUA 1E9ZB 4UTKA 1IEQA 3VIOA 1DQWA 4P7QA 2BWGA 2HK1A 1WKEA 2V81A 4NHVA 4W5ZA 3AMLA 1KGWA 4IG2A 5LNSA 4L5ZA 4XIMA 3VOHA 4N9DA 1NFGA 4BKNA 3KS6A 3QM3A 2V63A 2R82A 1CT5A 4OVXA 3SADA 1LROA 3RXZA 2WMKA 1ZHAA 4MOZA 3ZO9A 3TONA 3RX3A 2X1UA 1VFHA 2VGBA 4K8HA 2ZCGA 4XD4A 1RJPA 2Z29A 1VFLA 2P10A 1J0ZA 4HPNA 4RNIA 3E74A 4A35A 1P0EA 1AA1B 2DZBA 3SGGA 1DJQA 1OJXA 5HUPA 4YVXA 2Y8KA 1BEUA 1JDFA 2PU0A 1XD1A 1M5WA 5HNNA 3WDPP 3KRZA 3OGVA 4UQBA 1QPQA 2VEKA 3SN0A 3W1PA 5CAKA 1FOBA 3W7PA 1R30A 1Z7AA 5M5DA 5DMMA 4P5UA 2GZXA 1RQBA 3OGRA 3V5FA 4N9CA 1WDWA 1HVQA 1EZ2A 4F2TA 1AL7A 4GCAA 5A6BD 1QOPA 3QV8A 5KMYA 1GOOA 3V1PA 2HS6A 5HULA 5KZDA 1GVFA 3P0WA 1MSSA 4Q8UA 3DGRA 3M44A 2E40A 2VOMA 5FL0A 1LT8A 3OG2A 1I0BA 3OEXA 3PWAA 3IJ9A 1TSIA 4DAIA 4P8XA 1TVLA 4GI6A 4JFTA 2V2CA 3MKVA 1Q7MA 4JX5A 4S3JA 3B4YA 4ADSA 3QXBA 1OT2A 3CUHA 3MI6A 3RLHA 1XC6A 4XZIA 2IW0A 4HNLA 4NL1A 1JFXA 2HBXA 1ZBKA 1I6NA 4IWWA 4KETA 1QJWA 4WHBA 1JZ6A 1KNWA 3EA2A 5F2LA 3BLOA 1NWTA 2X2YA 3LS9A 4H9TA 1IWBA 2W61A 1SPQA 3AYTA 2A1YA 2ZRVA 5EU9A 5MKGB 2QCHA 1CXLA 3RPMA 2YX0A 1E40A 4M0XA 3R79A 5EL1A 1JF5A 2ZRUA 1WKYA 2FB3A 1AQHA 2WWCA 3K4DA 4GVFA 1K02A 3G1SA 4IIHA 1O4UA 2O7SA 3TOYA 3EWYA 4YYCA 3MUCA 2XSBA 3PN8A 3C0JA 2HV5A 4YTRA 2P0IA 4DZAA 1ELSA 2QV4A 1JCNA 2ZX9A 2DSKA 4Q4QA 1A53A 2E28A 3UXIA 1Q66A 2TRSA 1XBVA 3CC1A 4AW7A 2I57A 1TPFA 2ZUSA 3N13A 1EBHA 5EMKA 1XIBA 1J0KA 4AD0A 1ZY9A 1PKYA 1XLKA 3MB9A 5CG0A 4KFNA 3S1UA 1WOBA 4RV8A 2H8ZA 1LBLA 1WAUA 2PCEA 1EQCA 2Y0FA 4UMCA 4XZNX 2OZTA 3CV1A 3VDHA 1PKNA 4M81A 3BLDA 3QQ1A 3QQ0A 4DJDD 4F2BA 3WL0A 1B4KA 3WMCA 4AC7C 3MU7A 1QWGA 1Z8AA 4A22A 3QF0A 4ML4A 1KCKA 4U2ZA 1E4MM 5ECUA 4CQDA 4HU0A 1PYMA 1KC7A 1B2YA 2UY2A 3KP0A 4IJBA 3QGVA 4IFRA 4KF1A 3CYJA 3WJYA 3BANA 1B4EA 3RU8X 4BR1A 2IXVA 4L64A 3KUMA 2A79A 4HNTA 1U5HA 3IAPA 4IZGA 3S6TA 5C54A 3TXZA 1XDJA 3G1AA 3M6DA 4NZ3A 4L4PA 4JHOA 4ZO7A 1JZ5A 2VZOA 2OSXA 2ZVRA 4HQVA 4BHYA 4ATWA 5ABFB 1CW2A 2V68A 4UMAA 4L65A 2VX4A 1XRFA 4D8ZA 4NZCA 4O14A 2YJQA 2Z4GA 3LQGA 3BGAA 5EFFA 1E3ZA 2ANUA 4JIIX 4KIRA 3T0BA 3GR4A 2WVSA 1OHLA 2BG5A 5HPCA 3L2MA 1ITUA 3VNKA 1XLAA 1ONEA 3ALGA 1VFFA 4E3VA 4MUPA 1Q3NA 2BVYA 3H55A 5LNRA 2VQTA 5CPNA 5JVLA 1F76A 3GU1A 1TPWA 4AY8A 5I24A 2DEPA 4QGCA 2VR5A 4DVOA 5CJNA 3S6DA 2AL2A 4R3UA 2C79A 2HE8A 5AECA 2PC4A 4KEVA 4N42A 4UTFA 2FMOA 5DMNA 1P0DA 2Q8LA 1CXEA 3R5EA 3CLWA 3N4AA 3NEHA 1F73A 1DJZA 2TODA 3DX5A 1DIDA 5FF3A 1FWWA 2QDDA 3AS0A 2DZVA 2CXGA 4IH3A 2GQ8A 3BMVA 1XH0A 3MC5A 4GJIA 3QMTA 1S5NA 3B05A 1IR2A 4IJRA 3U7BA 2A7PA 4I9JA 2WOQA 2ZICA 4ZFCA 5JXQA 3NQCA 1EC8A 1J5TA 9CGTA 4BEUA 2WVTA 1QHZA 3H12A 2ZXDA 3AIVA 1K9FA 4US5D 3P5ZA 4JN7A 3PNUA 1UR4A 4JIQA 2ACUA 2Z6IA 4OUIA 2GGIA 2WMHA 1E72M 4DJFA 3ARRA 1EX1A 1UIOA 4B5SA 1TJ0A 3EPOA 1TPB1 1BLIA 3USZA 5FF2A 4J9JA 1W3TA 1KM2A 3N04A 3KRUA 2G95A 4HMEA 1OC7A 3COTA 3G1RA 3JU2A 1TMHA 1LWJA 3ITCA 3TJ4A 1VAHA 1LBMA 4WY0F 1Y5WA 2VC7A 3M0YA 4ZVJA 3GDMA 4BWLA 3VIJA 1O1HA 4GNVA 3W1NA 5FA5A 2XH2A 5I3FA 4O4VA 2VCBA 3R7MA 1XSIA 5C0QA 3TA6A 2WKGA 1MDRA 4LUIA 4HNOA 1B3VA 3BL3A 4Q4SA 4RNFA 4TXEA 4GGHA 1XIMA 1F4AA 2J6XA 2PDNA 3BURA 2P3EA 4V2XA 1BVZA 4AIOA 1XUZA 5U7SA 5HINA 1DJNA 3MVTA 1DTUA 5IDIA 3OGSA 1ALDA 4JTLA 4NAFA 4XTDA 3G0XA 3IRSA 2WJDA 3TCSA 4PRRA 3P62A 5G4HC 3W7JA 1JYWA 3AIEA 4PC8A 1AFSA 3THAA 3UJRA 3CQHA 3TTQA 5LSMA 4MJZA 4C5YA 5FOOA 3PZIA 5GJNA 1QUMA 1TRIA 1PHWA 3SUSA 4F2UA 4LTSA 4GIYA 1I60A 2FPTA 3RYSA 1IWPA 1UMLA 2P8BA 1UMYA 2ZZ5A 1LRNA 3UJEA 5BXTA 1S5VA 3VIMA 3PSWA 1W1PA 1BHGA 2G4FA 2I5QA 1IEWA 2FZNA 5MKGA 3WLRA 4RPPA 2XPKA 3NZGA 3WK1A 4BK9A 1KB3A 3CHCA 1Q2SA 1GEQA 4NYYA 3DG7A 2ODOA 4MNJA 2CKSA 4RDZA 3CQKA 5D2XA 4UCFA 2RJGA 2GVLA 4OBTA 3VNIA 1LORA 3N2MA 3RX2A 2REQB 4WSKA 2AMXA 4GC3A 2Y2WA 3NQAA 1ZJBA 3EWWA 2YW4A 4H1ZA 4PFHA 4AG0A 3DH7A 2QCGA 2UY4A 4H9XA 2F84A 4R9XA 4JQ4A 1G1YA 3S1WA 1MI3A 1Z6KA 5EB8A 3TNOA 3TZNA 4F0RA 2INEA 2PDYA 2QPXA 2KZHA 1BD0A 2P88A 1QOQA 1G69A 4ERIA 3VNYA 1PCWA 2FZDA 3G1FA 3HOJA 1HNYA 7TIMA 1TWIA 2V8ZA 4J3ZA 3BARA 3G6MA 4R85A 3AU2A 1RBOB 2FMNA 3ZM8A 3QKEA 3U8GA 2WNWA 1TE6A 1ZJIA 1GYMA 3H8AA 1JXJA 4KCVA 3V5CA 1V0NA 2WCAA 4HP5A 4DAFA 1ZRQA 1V0KA 3MSRA 4JTGA 3HGOA 1H7WA 1RUSA 2OT0A 3GFXA 1O6IA 3CO4A 3E2SA 4XKYA 3AWOA 3NSNA 1KXQA 2VTFA 2CESA 2MNRA 3QV6A 4AC1X 3MQTA 1VD6A 3TW6A 2CZEA 3LSCA 4UNKA 3FGCB 4TOQA 2XGIA 3H4GA 3MHFA 1XLEA 3WLSA 5AYZA 4WY0B 1ZFJA 1G4TA 5CGMA 1KWKA 1QO5A 3LV5A 1MNSA 2NV9A 2NX3A 1DOSA 4B9ZA 1JUEA 3TH6A 2EAWA 1M53A 1G4PA 1NELA 3IIZA 1I0DA 3LSBA 1YE4A 3MMDA 2I56A 1BF2A 1FHVA 4XD3A 4IPIA 3KBVA 2WCSA 3N2TA 3GYCA 4W4QA 2ZUMA 1FWJC 3LCIA 2CLLA 2XN0A 2NVAA 3SDOA 4Q4MA 4WK9A 4L1WA 1E70M 3TA9A 2A85A 1P1MA 2XYLA 1BKSA 4ZOCA 3HN3A 2BVTA 4B4HA 3UQNA 4PB5A 1BF6A 1EHNA 4AD5A 3NIYA 2XSAA 3B9DA 3L65A 4JL2A 3WLNA 3W2LA 1ZBVA 1X38A 5EY5A 4TVUA 3ELFA 3W25A 5M03A 1JCTA 4DUOA 3N14A 5G1MA 3U6WA 4P8WA 1V6VA 3VZYA 1UZ4A 5CEWA 4MJ2A 1IZJA 3QKZA 2G0WA 3LA4A 4U3AA 4MB3A 4QE4A 3BQ6A 4H9YA 5C70A 4CEUC 6TAAA 4M6VA 4N6FA 3CZLA 3NQDA 3UZWA 1UD4A 3DBNA 3SGZA 3VAVA 2Y7GA 2A3CA 1R47A 2WJEA 3VMOA 3WH6A 4XVDA 1H3GA 4UUIA 4YTUA 5BRBA 3ZWSA 3P60A 1K8ZA 3MO7A 4RW3A 1OD8A 1X6NA 4IIDA 1MZHA 2H3BA 2PDUA 2QXWA 4YJ5A 3NXFA 1YNPA 2WZMA 2BGSA 2YW3A 1LM1A 4DYKA 1QOXA 1W3HA 3QPZA 3FOKA 3QW4B 1XR2A 2W27A 3MDWA 4REQA 2WB5A 2QKFA 2ZUTA 2DIJA 3QHMA 4Q6XA 2CZDA 1LRQA 2XVLA 4XBKA 4G8TA 1JAEA 3KCJA 2PD9A 3KVMA 2VUNA 2YCEA 4KFPA 2WKLA 3UR5A 3HGSA 1RPKA 2C1HA 5F2MA 3UJSA 3F4WA 4GQGA 4OV9A 1HJUA 2ZZ6A 3WJXA 3FFSA 4WJXA 3MANA 3MY9A 1EJRC 2CLHA 2WSKA 4LYPA 1LOQA 3IIVA 3MHGA 1ENUA 4HOZA 1MUCA 4BQ2A 4K37A 4JTFA 2Z0IA 2UY3A 4UR9A 1SQ7A 2VNCA 5DXXA 5F2GA 2FTYA 3MI2A 2OG9A 1ONXA 2OSYA 4TV5A 4JTUA 1REQA 1NWRA 4A3QA 4DLFA 1LOSA 3SR7A 3SZ8A 1UZ1A 3GW0A 4XTIA 2NV1A 4UFIA 5K9CA 4MKNA 5DQPA 1ZU8A 4MIMA 2QEZA 3MCMA 3MS8A 3GNPA 2OZ8A 3CHEA 1O60A 1QI2A 1BAGA 1OCQA 1S2AA 1XG4A 4QAIA 3QW3A 4GRSA 3M46A 5JBFA 4C6BA 2H3DA 4QJ4B 1ITCA 4IX2A 1D3CA 4XIAA 3PTQA 3TTYA 4QP0A 4QXIA 3EKZA 3L66A 4FOJA 4E4FA 1KTNA 3IJ6A 2E09A 1PYFA 1QT1A 3TYCA 4IPLA 3VD7A 1SO5A 3E2QA 6REQB 4XZMX 2QJJA 3B9AA 1M04A 2QUMA 2EPNA 4IQDA 3DERA 1HVXA 4LBSA 4NJKA 3NG3A 4GZ7A 2GWGA 1UD5A 3CUGA 8XIAA 4I5RA 4IT1A 1KGUA 1LRTA 1VCGA 2PI6A 3L9CA 4A8RA 4JIEA 2DZAA 3UZJA 4I6KA 3LPPA 3GXFA 5CPLA 4WGXA 2ALRA 4PZVA 2Z1BA 1MNZA 2NWSA 3R8GA 3Q37A 4YNGA 3EA3A 2D2HA 3P6LA 5CQ1A 1S2CA 5C9ZA 2UWFA 4PTNA 3K1DA 3VD4A 2NXGA 2ZDSA 4J40A 1GQNA 2NVDA 3TYDA 2W66A 1US0A 3S4TA 2Z27A 4PE8A 2W67A 1XV8A 1TTPA 3CZGA 1QK2A 2PDLA 4HMDA 3TSMA 4K38A 1A5KC 2J7EA 1WZMA 2QJGA 3ZR5A 3UPWA 3FA5A 2NUWA 1DWIM 4FNTA 4OJYA 3UCQA 2J8FA 3IGUA 3NPXA 3Q67A 1KFBA 2Y61A 2ABAA 2Q02A 3G6LA 3L0NA 3A9IA 4J28A 1E6NA 2XIQA 1XJBA 4RW5A 4MZYA 4C7GA 5J5DA 3MP4A 4GMEA 4Y9MA 1SM9A 1RBAA 2E6DA 2WC3A 5C9WA 4E2VA 1XRSA 2BTMA 4X9SA 5DFAA 3N6QA 4QDMA 1IT8A 4JD4A 1V6UA 4ZQOA 3QOKA 4CQCA 1OADA 3T0DA 1X1OA 1VPQA 3N4EA 1R3SA 2GJXB 1NM9A 3WDRA 1H5YA 2EG7A 4HYRA 3FKRA 3AYSA 3CUZA 1WXJA 1ZQ5A 4PH6A 2VVNA 2X41A 4MWAA 3RM8A 1UCWA 3VDBA 4AZCB 2A6LA 2Z26A 3VFLA 3GDBA 2F7FA 1T99A 3VPLA 2ZADA 4QEEA 2OXNA 4MB1A 3I6RA 1PX4A 2CBIA 3GIQA 5C71A 2INFA 2WSRA 2EG8A 4GXPA 4F0SA 4IMCA 5A8OA 4B5UA 2GDVA 2R1PA 4FNQA 4HIBA 3ZYZA 1VFSA 2RHGA 3M5XA 1AW5A 2QJIA 1VLIA 2Q8ZA 4JCLA 1GG0A 2PWUA 3W3OA 1W5QA 2QUVA 3W1QA 3TEVA 2DT1A 5CSYA 3VGDA 3RMEA 4FX7A 3VCRA 4QSHA 4Z1CA 3WBEA 1K8CA 2GDUA 3EX1A 4L6HA 4ZOEA 1V02E 1TKKA 3WQCA 2BX7A 4I9TA 4DZIA 3AYVA 3KBMA 2JGQA 4FHAA 3H53A 1DWAM 3OOQA 4LRTA 4G2DA 4ZCWA 1T7LA 1E9IA 2Z25A 3LCWA 1N8IA 1MYRA 3FS2A 7REQA 1HZYA 4JIRA 3DFPA 3V7PA 3WDJA 3F5KA 1H1ZA 5DBTA 3R6IA 1S46A 2QDEA 1GJWA 1UB3A 2E3ZA 4GXMA 4LEQA 3TN4A 2ZKMX 4UFJA 4CU8A 4WOZA 3R8RA 1PX8A 7ODCA 3KWXA 3W87A 2NT0A 3E5PA 4ZXOA 1B3XA 2NQ5A 4AB4A 3B04A 4JNYA 4JY8A 4ZSUA 4EKJA 2ZX6A 4C6NA 3BSHA 4YVVA 1O66A 3T8LA 4J3XA 4MMWA 2D20A 2C0HA 3RM4A 3SURA 1A3XA 4W88A 2DJXA 3K8KA 1AJ0A 2ABBA 1ISYA 2Z7GA 1UWAA 2PGFA 3ZXWA 3BDKA 2Y5JA 3VIKA 3A9BA 1HKMA 1W56A 4B5TA 4RPQA 1DIOA 3WNOA 4P7OA 2V82A 2FDMA 2FHBA 2X1RA 1IF2A 3PG9A 1MQPA 2XFFA 7PTDA 4KEZA 1LOLA 1OFEA 4FLRA 3TAKA 2YPIA 3WQGA 4I90A 1IXNA 1KRAC 4AZ5A 4G1NA 2OYLA 3T2OA 1ZTVA 4OT7A 3S9IA 5G2IA 1NOFA 1PKMA 5FD0A 3CUFA 5D9PA 4OOUA 3ONCA 3D3AA 1SR0A 1QBAA 4IISA 4FNPA 3WLOA 3LENA 1NAL1 2XM2A 2DSUA 4EIVA 2XM1A 4ZQPA 4IMEA 3LYEA 4UMBA 3KBJA 4NX5A 1ME8A 3WSUA 3NQBA 1V4YA 4YTQA 4ROPA 4F79A 1KM5A 2DUZA 2ZA3A 5BOEA 3QPYA 4QHRA 1WQ5A 3S2MA 5C6MA 3F7JA 4A8IA 1B3OA 3UJ2A 1G67A 2O9TA 3GHSA 4FS9A 6REQA 4PCFA 5DY3A 1XRTA 1V6XA 3K8LA 5EMYA 3ENLA 1ODZA 3DYMA 1SO6A 3TV8A 1YTKA 1XX1A 1G4EA 3H4XA 1M7OA 1TWSA 3A4XA 3EWXA 2AQOA 2ISWA 2HCVA 1IT0A 3CIVA 1JCJA 3CIXA 3A22A 3RITA 3TR9A 1RQEA 2H8XA 2WAGA 8XIMA 4GZIA 3VTRA 2DVTA 3R10A 3N18A 3QGAC 3II1A 1TWZA 1DVJA 3HPFA 2VZSA 2VJXA 1FFRA 2YA2A 3I7SA 3ARVA 3ZFHA 1WDQA 3GIYA 2XZ7A 3GXIA 3WZ0E 3ABZA 2RUSA 4D6HA 3P14A 5A8NA 2QULA 3CUIA 2C15A 2ZA2A 2AOSA 5LHFA 1XCWA 4K6AA 1XISA 1IT7A 1ECEA 4M7TA 1VKFA 1XS2A 3Q65A 4TU1A 1K4HA 3TP4A 1KV8A 3RR1A 2VFEA 2E9LA 1AD4A 3W7RA 1QPRA 5FAGA 3V0SA 4IM4A 3URAA 1OG6A 1KRMA 4A2RA 1E0XA 3QR0A 4UNIA 4LBRA 3CMFA 4LX4A 3IWPA 3P7YA 3N6HA 5I3DA 3W7LA 1FWBC 1XYAA 3NAVA 3M1ZA 3WDHA 1OX4A 2ACSA 4B91A 3GKAA 2J66A 1A4LA 3VD3A 1X96A 2J13A 3EPMA 4C90A 3L5LA 4N4PA 4L7ZA 4CD8A 3KZSA 3R0DA 1TX0A 3F5JA 3GVRA 1NDVA 5KITA 2VFGA 1Z69A 1U33A 3RM9A 2RAGA 2BMBA 1V3HA 1RD5A 1KTCA 3ARWA 4YCOA 3G22A 2VT0A 4U4MA 1UP2A 2ZOXA 4W9TA 5CC5A 2WHKA 4O19A 1E71M 3GXPA 5EMMA 2C16A 3UGRA 5AVHA 4S2BA 3NNTA 1M6JA 4S3GA 4AWUA 4DYEA 3RJYA 3E49A 1OYCA 1GJPA 2FJUB 1J0IA 1MO0A 4GX8A 4DNMA 3AHTA 3NDZA 3T4WA 3IAQA 1HX0A 2WANA 5CKSA 4RDYA 4ZQMA 4UTTC 1B54A 1NOUA 4GUFA 4PFMA 4OZOA 3R4IA 2O9OA 3OLEA 4HNUA 2E5DA 1EGZA 3L7RA 2PP1A 4FEZA 4DPPA 4JN6A 4O18A 3BAJA 3NL3A 5TQLA 1PO9A 4HNNA 1RP8A 4GC4A 2Z00A 1H09A 2WMGA 2OVLA 3V75A 1UYQA 1TUXA 3AUOA 3L4WA 1BG4A 4B2DA 1JDCA 1PPIA 3E0FA 3WLHA 4Z42C 1OFBA 4ZB5A 4U31A 3KRBA 3K13A 4Z0JA 2FIQA 4PMNA 3SSZA 5LNVA 1X6UA 4B16A 1E51A 3PZGA 3KL3A 3WF3A 4ILSA 2W0UA 4WDTA 3T07A 3W01A 1A5LC 1B0IA 3THDA 3GTXA 2CLOA 3DEQA 1XIJA 3E96A 4AVOA 1G9HA 4CQBA 4YIWA 2C14A 2UV8G 4J2MA 1R9XA 4B5WA 4W7UA 1S2VA 1L0PA 1RK6A 1OFAA 4PB3A 1CB7B 4O10A 2PF8A 4W7VA 4NUWA 3D0CA 1VEMA 2VRJA 4LFYA 2PA6A 3ALFA 5GNYA 3UXDA 3HBLA 2BOEX 1EGVA 1FWDC 5AYBA 1NTHA 3EXSA 4FALA 1FWAC 4KWOA 4FIRA 1E55A 4Q33A 4RUBA 3W82A 1ITQA 1K4GA 3VIGA 3H2NA 4EF8A 1KWGA 3VZXA 2IKGA 1O68A 3XINA 3VCNA 3UESA 3M0HA 5H8MA 4DXKA 1KFWA 1JPKA 1MVYA 5A6TC 2YOCA 2DJLA 1NP0A 1TR1A 1YEYA 1BTMA 4GIRA 4GY0A 4CU6A 1W3IA 1HJQA 1HJWA 3VILA 4UZSA 4K8EA 5T9BG 3N4FA 4Z17A 4YLWA 3BLLA 4KPLA 1WZLA 2ZUWA 4GWEA 2Q01A 1RAKA 5F1VA 1GYNA 3GIPA 3WQEA 1V6YA 3CB3A 4K36A 3EX4A 1FP8A 3SSJA 1I2RA 3W6MA 4O0QA 1RXOB 4YL2A 1ISVA 1PWMA 3WN6A 4ATDA 3OVQA 4LGXA 5BWFA 3MA8A 1ADSA 3FSUA 4IMGA 1L2QA 2GGJA 2DZPA 1R46A 1PIGA 3QHOA 1R9ZA 1DWJM 4PULA 4PUEA 4PMXA 1M68A 1N7KA 2XFRA 1FKXA 1T5AA 2WKJA 3PUEA 5CLWA 4AXNA 2X09A 3UGVA 5G1TA 3WJZA 4K68A 4HA3A 1CTNA 4KRUA 4ACZB 1BQGA 3NQ8A 5D2YA 4UIOA 2VFDA 3SIMA 2FGZA 4CKQA 5FEPA 4LVBA 4AWEA 3D47A 4GGBA 3GKFA 5K9XA 1I8JA 3AMGA 5AYIA 1OCBA 3CTLA 1VBHA 1OM0A 1CGUA 4CEXC 3UR8A 4S3KA 3KTCA 1BWKA 1A0EA 5K2ZA 3WEZA 3SECA 2OYMA 4JTQA 3W26A 4PBEA 2YL9A 4A6GA 4FXSA 4YS1A 4I7VA 5FJTA 4N9EA 1DJXA 5CC7A 4ZO9A 1FQ0A 3USBA 3U9IA 3NO1A 1FVPA 3C4UA 3TMQA 4JCMA 4CUCA 1MUWA 3H2EA 3CWOX 4V27A 1YDNA 3CGTA 1AH4A 3M0MA 1WO2A 3SB0A 1Z44A 3N34A 3FJNA 4DBEA 1TTIA 2RDXA 2D2OA 2DZXA 1HT6A 3UFYA 4GK8A 3SCOA 3TOPA 1RCQA 2F2HA 2O4QA 3PC0A 1PB0A 2Q3RA 1XHGA 2YXXA 2DPEA 1LQ0A 2WHJA 1BVWA 2GSEA 3LRMA 3QFWA 3GBEA 2BOFX 4MADA 4A8NA 1SZGA 4AZ7A 5EA9A 4ZZ9A 4N02A 2IKHA 1Q4WA 2J88A 3N3TA 1E9LA 1VPYA 3NZ1A 1V3KA 4XZ9A 5AKQA 1IEXA 1EDTA 2DT0A 4WEVX 3INPA 1IYXA 2FKPA 1PCKA 4W93A 1EEPA 1PTAA 4LT9A 4TMCA 3WLPA 4E2OA 4D6EA 3IJQA 1CECA 1VCFA 1L6GA 1W17A 1K7FA 4CNSA 4ALDA 1JR1A 1HXJA 3E5BA 3TYUA 4KGLA 1SGJA 1B57A 3PJXA 4Y96A 3PVFA 3LMZA 4J35A 1RQHA 1FCQA 2IXUA 4MLJA 3GNNA 4L4MA 4E5TA 1C90A 1QW8A 6CGTA 2OODA 2D1ZA 3M0IA 1XINA 2I14A 1C8VA 3THCA 1UW9A 4JTCA 3GG0A 1US3A 3PULA 2YDRA 3I3BA 1J9YA 3FSTA 4DELA 3UWUA 2NQ9A 3VYLA 5I09A 1A5SA 4U33A 1GKQA 1JDDA 4LCSA 4AEOA 1JF6A 1HJXA 4AVFA 1W5PA 2WC7A 4M51A 2H90A 1XIHA 9XIAA 2ZRXA 2ZC1A 5T91A 1V03A 1JYVA 1W1A1 1A5BA 3APYA 5L6UA 3TC6A 3BPWA 4FR6A 1V3LA 3ARPA 1VLWA 3EB2A 1W37A 1AVAA 2G37A 4RE0A 2R8WA 3BVJA 3QVQA 1EO7A 1EPVA 3OODA 4MPKA 2OTDA 5A6LA 3DI0A 3S5ZA 2HVNA 5IDZA 2QAFA 4A3YA 4L9XA 1S39A 4E4PA 4D8AA 4DX3A 2MANA 4GKLA 4H2CA 1XLIA 3WF2A 1E15A 4J4KA 3UWZA 3PB2A 1BGAA 3A24A 1Z42A 2YL6A 4C6MA 4Z1AA 1OYBA 1X1NA 4JX4A 2I1OA 3AJXA 3R12A 1T6MA 2Z1XA 3C2VA 3GNOA 4UB9A 4JFUA 4TR9A 4MAZA 5EFDA 2J74A 4LV9A 1WBJA 4M80A 1OZQA 3CB8A 2GSJA 4LOCA 2ZRWA 1B5TA 2E7FA 3SRDA 2DUXA 4QJ1A 2QUUA 3RCNA 3CL8A 4H6KA 5RUBA 1GEHA 1P6CA 4HBKA 2POZA 1DEDA 4Z2IA 2RKXA 5ABGA 3DU0A 4ZXLA 1JVNA 3H2CA 3BQ5A 2BY3A 4O1EA 1RJQA 2H9AB 2BDQA 2VXNA 2DZUA 3C5QA 3AMDA 2ISSA 3W1UA 4TTGA 3B9OA 2OWWA 4FZIA 1PHQA 1XGDA 3TSBA 1MW0A 3DC8A 1W1VA 3FA3A 3QYSA 5A6MA 1OX6A 3RRAA 1CPUA 5I00A 3E0LA 3C2RA 5DY2A 2Q09A 4TMBA 6ENLA 3CH9A 2VFFA 2VC6A 1XSJA 3IIXA 2CHOA 1G94A 1H4PA 1P0KA 4NXKA 3WQFA 2NVCA 4IXHA 1H50A 4UTUA 3V0UA 3ZOAA 1XLFA 4XSMA 1XFBA 4OBSA 2PP3A 1E73M 4XBSA 5LIWX 5BNKA 2Y1HA 2OQHA 5LNWA 3SN4A 2A3EA 1J01A 3EEZA 3WDIA 3FEMA 2FHFA 3T9PA 4O53A 1W9PA 4GBUA 3WUGA 3MKKA 5AFDA 2PAJA 3BZJA 5HNUA 3KL0A 2RFGA 5JIPA 2Z24A 2CZVA 1TX2A 4MB5A 1F3TA 4NU7A 2VUYA 5A8QA 4FO4A 3RCYA 3LTPA 5E1QA 3SCNA 3UVAA 1XICA 2QCEA 3O2LA 2YA0A 1YLVA 2BXYA 3VIIA 2J7HA 3PK7A 1ZJHA 4R7WA 3R13A 4PR4A 3WQPA 2JKEA 5FJRA 1AH0A 3DAQA 3M7WA 1ZS2A 3RNDA 3KOXA 4J1OA 1UWQA 2ZX8A 3M0VA 3F4DA 1Z89A 3V4BA 4XAPA 1TB3A 1WV2A 2E1DA 2IKIA 1G5AA 4KWSA 2NW0A 4GH1A 2PDBA 4D6CA 2VYOA 4PCSA 2FDSA 2XN2A 3CAWA 3MBFA 4F0LA 4XO6A 1CI1A 3L4UA 3S5NA 2OEKA 2HTMA 3SW6A 3C3NA 3VNMA 3W29A 4Q8VA 4FXFA 4C6KA 4RCXA 4ZR8A 3TROA 3PS7A 2VENA 5E70A 3HV9A 3GX9A 1TELA 2DT2A 3RR4A 4LUYA