3NQVA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r5 7/4a
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
249
structure length
246
Chain Sequence
b'LKASSLRALKLMHLATDDTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTPGKVAEGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADSRHYAFGASSSLLASLLKALGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 96
structure length 246
sequence length 249
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqvA00
2KZHA 3RLUA 2VC6A 3NPUA 1LLZA 1JJKA 4FXRA 3HG2A 4O54A 4UFIA 3P8IA 1NF0A 5CSSA 4JX4A 3N9RA 3W86A 2VFFA 3IIVA 4BR1A 3QM3A 1R2TA 4Y6GA 5AHLA 3GDTA 3LXBA 4JNMA 2HMCA 5AC7A 3A21A 1PHQA 5D02A 4A3UA 3F03K 1VLWA 2QKFA 2ISSA 1OG0A 5C54A 4AH7A 5FESA 3TMQA 4JTSA 1XUZA 4KWVA 1TPVA 1K7EA 3BW3A 5CPMA 3I7RA 4R7JA 3F1QA 3IGUA 3QH2A 2GOUA 3KX6A 3W7JA 2NUWA 4IXHA 1QNVA 3L2IA 4I7WA 1JCLA 2R94A 4UMAA 1KM3A 1ME7A 1YPFA 1XKYA 4QIUA 3EWBX 4NJIA 3FKKA 2B7QA 3LERA 3GAYA 2WO5A 2VFGA 1F76A 2EKCA 4UTJA 2DZSA 1F74A 2PRLA 3CEPA 4LUJA 2A6LA 1XBVA 2R14A 2Y63A 3HIJA 4X9SA 4ZL1A 4LTSA 4PTNA 2V0TA 4MZ1A 1XBYA 1RZMA 3C52A 4GUJA 4LS1A 3PWAA 4DQWA 4MUZA 3LHZA 3UD6A 3EWXA 3W74A 2E6AA 3NNTA 4WY0B 2A7NA 3B8DA 3OG3A 1M6JA 5G1TA 1VPXA 3W6YA 3ZWSA 5D2YA 3HG3A 3HPZA 4UFKA 3T44A 1IXOA 1I4NA 3HQ1A 1SSDA 4IX0A 3C61A 3GDLA 4B5NA 3TC7A 1OFAA 1MSSA 5FF0A 5D32A 4ZZ9A 2VEKA 2OJPA 1P5BA 3M0ZA 4H4IA 3S42A 3CT7A 3B0UX 4NX0A 2H6RA 1GWJA 3MHGA 4IPJA 4JYDA 1THFD 4FNQA 1RVGA 4N2YA 1W5QA 3FJLA 3A5VA 2FLIA 5U7SA 3JR2A 3FS2A 4K36A 2VEPA 1SU5A 3O6DA 3TFCA 2ZRZA 5L9FA 3W85A 3RFAA 4WY0A 4QAIA 3BLFA 2YFNA 3G3MA 3M9YA 3L68A 2CLFA 4K38A 3B06A 1H7WA 2GQ9A 4Z1BA 5ABTA 4IQLA 3L5LA 1FWWA 5TQLA 4JICA 5LHEA 1I2RA 1TV7A 2V2HA 3SSJA 4MKNA 3TQ0A 4Z1AA 3WK3A 1FXPA 1OABA 2YW4A 3BK0A 1VHCA 3MBFA 2HS6A 3HGJA 1SO5A 3GKAA 3RF9A 2FPVA 4ZQRA 2ZA1A 1SSGA 2V81A 1UB3A 2E5DA 1ZJIA 5EL1A 4EWND 4NNAA 4IWWA 2R91A 1SZGA 1GZGA 3KVJA 3DFNA 4U4MA 1KV8A 1XI3A 1C9DA 2JKAA 3KVKA 3LHVA 4CQAA 3S5ZA 1VS1A 4NT0A 1EA0A 4LW7A 4P61A 2A7PA 5EPDA 4IMEA 4E2DA 4M19A 1KFEA 2A21A 1QOPA 4TIMA 4O0ZA 2Y7EA 7TIMA 4N9BA 3LI1A 2B0MA 4S2BA 4MFEA 1YXYA 4JTUA 5BMWA 4MJMA 1QAPA 5CG7A 3OIXA 3TUUA 5G2HA 2UV8G 4O19A 1HFBA 3L0GA 3TV8A 3UWUA 1DVJA 4JS3A 1HUVA 5I3FA 2V2CA 3G22A 1MO0A 1R47A 1T0OA 4PCFA 4DPPA 1VQTA 2CW6A 1WX0A 2ZA2A 2JGQA 3TW6A 3IIOA 1QFEA 1YPIA 1GJPA 2E1DA 3L66A 5K4XA 2BWGA 5HULA 1XDLA 4P2VA 5DBTA 3LLFA 2X2GA 3FFSA 2QCFA 3LXCA 3NQCA 4I7UA 3MI3A 3F4WA 5D37A 5BOOA 3TE9A 1SR9A 4UTKA 3LTYA 4RCXA 4UFMA 2V5BA 5HNRA 3WJSA 5I3GA 4IUOA 3QMSA 4MY9A 3DGRA 3W1LA 3G1HA 3A22A 4H6KA 4Z0SA 2CLHA 2WKJA 2FB2A 3QPZA 1W37A 1X1ZA 3O15A 1SO4A 4YLWA 2HSAA 1T99A 4JR5A 4TR9A 4CNOA 3MMTA 2NV2A 2ZRVA 3KVLA 4XUGA 3T4CA 4LY8A 3TJXA 4LS2A 4N9EA 3TC6A 3UXDA 4QJ1A 5G5IA 4DPQA 1VRDA 3DU0A 5LHFA 3V75A 4FNRA 3M47A 3A24A 3L5MA 1OVDA 1R2RA 3HF3A 3IRDA 3MYOA 4RK8A 1DJQA 1RQEA 5H2ZA 1SW0A 1VCFA 2H3DA 3S0CA 5AHNA 1X8FA 2RDTA 3STCA 3LCWA 2ZZ2A 4YCOA 1SW7A 1BWKA 4O1BA 4PL1A 4GC4A 4O16A 5DXXA 5BNKA 3R8RA 4KFPA 2V8ZA 2J9ZA 3W1AA 2Z6JA 1H61A 3QRHA 1DL3A 2VFHA 4WY0F 3NM3A 3TIMA 3VI2A 4K8HA 3G1DA 3TA6A 1ME9A 4HN4A 3CB8A 1TTQA 3DHFA 1NEYA 2CLOA 2PRHA 3CLMA 1RQBA 4IPIA 2E6YA 1LRNA 1S3HA 1TSIA 3BO9A 2DZPA 5EA9A 1O60A 4NZJA 1AG1O 1ADOA 3O06A 3T78A 4Y90A 5K4ZA 4CCDA 4GJ1A 1H63A 2ZTKA 2F7FA 4XBKA 1M7OA 2NUXA 4UTIA 1BKSA 2G97A 4BWLA 4N4QA 2XN1A 1Q6LA 3LHYA 1A5BA 1BTMA 1QO5A 3S8HA 3O63A 1F7BA 3TROA 2Y70A 1CW2A 1TJPA 4AXKA 3LRKA 4FF7A 1LBMA 4RXGA 4RJEA 3FKRA 1RD5A 1ZCOA 4M6QA 4O12A 3STEA 1PL9A 3IIZA 4TO8A 3TX9A 2CLLA 2Z0IA 3FYPA 2C18A 4IMGA 5AYXA 3BVJA 5G4EA 3SY5A 4O53A 3VCRA 2YW3A 1P1XA 2QDGA 2WSYA 1W54A 1XM3A 4UR8A 1Q6OA 5DBUA 3HPSA 5BMXA 2B7PA 4O52A 1XC4A 4HSNA 1JCNA 2C0AA 1OFBA 2W0UA 5F4WA 3N14A 1G4TA 5FF4A 2BXVA 2WNZA 4JTEA 5AHMA 2A5HA 1IGSA 1R2SA 3R2GA 4Z08A 1WOBA 2E5BA 3PG8A 4KFNA 4ZQPA 3DI0A 3M5XA 4N9DA 5F2GA 4NJKA 4RLIA 3W7CA 3ZR4A 4UIOA 1VH7A 4RXFA 3Q37A 1F6PA 3W7GA 2QF7A 3O05A 4NQ1A 1ZFJA 2HTMA 1H51A 2ZBTA 3THQA 2FJKA 5D30A 4X2RA 2C1HA 5HUPA 3KAOA 3TU9A 4HKPA 1HL2A 5AB3A 4GE8A 4JTKA 3C2VA 1LP6A 4UFLA 2BTMA 1A5AA 1H50A 1JR1A 1OJXA 1RR2A 1FY6A 2ZDRA 3M41A 3ZWTA 5F2MA 5LZLA 3UWVA 4UUIA 3WFAA 4DBEA 4UNLA 3TR2A 3TK7A 1Q45A 2DZUA 4Y8FA 4GUHA 1IXNA 3P7YA 3USBA 2DZWA 1DORA 5FEXA 1I8JA 3B03A 1LBFA 1QPNA 2NXHA 1AK5A 3DKLA 4OE7A 1NFBA 3LBMA 3W76A 3LDVA 4QNEA 1T96A 1GVFA 4JEQA 1P0NA 1X1OA 2TRSA 4JTJA 3NAVA 3NXFA 4NXSA 3E9AA 5AC8A 2W79A 1FDYA 5K9XA 2NXIA 1KTNA 3EWWA 3IGXA 2YFOA 4BFAA 3NGJA 1YDOA 5T26A 1G7UA 3CHVA 2J9YA 4N6FA 3EWZA 4DO4A 3W7OA 2Q3RA 2EHHA 5LSMA 4ZQCA 3HB9A 3RU6A 2NWRA 1WQ5A 4CQ9A 2QJIA 4NU7A 5FF3A 2FIQA 3KXQA 4LRSA 3BLEA 1F05A 3W22A 3NDOA 4DF0A 4FHAA 3UWQA 5DELA 3NL5A 3NR0A 3NQ6A 4I9AA 5K9CA 2Y6ZA 3LRMA 1QWGA 1AMKA 3MO7A 3W23A 4UMBA 2YR1A 3C6CA 2ZRUA 4FX8A 3MP5A 1YDVA 3ABQA 4OV9A 3MBDA 3LB0A 4LC8A 3P81A 2QJGA 2FTPA 3W1TA 3W1NA 1QO2A 3THAA 3W9ZA 3L0KA 3QEZA 3UWZA 1H62A 5LNWA 1B3OA 4MPQA 1WBHA 2WSRA 1H7PA 2P10A 3IVSA 3T55A 1TV8A 2WPBA 5HQEA 3S1WA 4OGZA 3HG5A 4JDBA 1GEQA 4RZ4A 5LNVA 1ME8A 1G6CA 2A4AA 2EF9A 1GG1A 4RZ6A 3LRLA 3PSWA 1QOQA 5G4WA 3I65A 3RK8A 1X7FA 4HT3A 3ZS4A 3IV3A 3OVRA 4FNTA 1T8XA 2QCDB 2VEIA 3NA8A 2AQWA 3B0PA 1SPQA 2H8ZA 2YDAA 3EEGA 4FEZA 3WJWA 1OHLA 2TSYA 1ML1A 2FPTA 4FIRA 1FCQA 3NQFA 3G1AA 2WSQA 3UWWA 1XUUA 1VCVA 4DELA 3NOEA 4UTWA 2NZLA 2C6QA 3GAKA 3PVFA 1AW2A 5MHBA 1B4EA 4NX5A 1RV8A 5AFDA 4DO6A 3QW4B 3CPRA 3WK2A 4NXKA 5EY5A 5G1YA 2QCDA 1FCUA 2YYUA 3LLDA 1SUXA 2ZZ7A 4Z0JA 4CQ8A 2QAFA 2QAPA 3G8RA 4LUIA 3CC1A 4Q32A 3LM7A 2QR6A 5AC6A 2VXNA 3OEXA 2Y7GA 3SI9A 1LM1A 4XTDA 4OWGA 2QEZA 1O5KA 4JXCA 1PE1A 4AHPA 3P5YA 3QMRA 3W2LA 5DCBA 1VJIA 3DZ1A 4UTLA 3TCEA 3N3MA 2OMAA 4YXGA 5KTLA 3S1XA 3GNDA 4A2RA 4Z1CA 1KFJA 3F4NA 1G67A 4LOCA 5D05A 2XN0A 2E6DA 4J9JA 1KM5A 2W6RA 2NV1A 4E2BA 3NQ7A 1SZFA 2RKXA 1EWEA 2AAMA 3C0JA 2J27A 4K37A 1KFCA 3PR2A 3PUOA 5FEPA 1EP1A 3EX6A 1A5CA 3CM4A 1WDWA 4O1CA 2WQPA 4RZ5A 2FDSA 5LKYA 5E1QA 3BG5A 3DBPA 3PF3A 4CLMA 4WXYA 3JRKA 1EWDA 1TIMA 2ABAA 3W2JA 3HOJA 4HNTA 1UCWA 2Y85A 2NXGA 3N34A 1S5VA 1OYBA 4XTIA 2E68A 1GVRA 3W83A 1OFQA 1GVOA 2PURA 1MZHA 2GQ8A 3T40A 3U8GA 5F2LA 5D04C 1WAUA 1XXXA 2H90A 3W71A 1DBTA 4C1KA 3M7WA 3HO8A 4LC6A 3HGOA 1KW1A 3GIYA 2DJXA 2WNNA 3IIXA 3DKJA 4HHPA 1V5XA 3TW7A 1OK6A 2Q8ZA 2ABBA 1JVNA 3UNDA 5H91A 4HNVA 1JUEA 5K3VA 4K7YA 1YDNA 1IIHA 2ZA3A 1PCKA 4NJJA 1S5TA 3VKJA 1N8FA 3UPBA 4O18A 4BI6A 1F6KA 4RR4A 4MY8A 5C2XA 5D2WA 5KINA 4LVFA 2X1TA 3R5EA 5IM51 3GNNA 1WOAA 3UPWA 3W2KA 3NZRA 3G24A 3QYQA 4CNPA 1I2PA 3SW6A 4UTTA 1B9BA 2VELA 3STFA 2E5CA 3ATZA 2F84A 1LORA 3TSBA 5LNRA 1G69A 4O13A 5F1VA 1VYRA 4WOQA 4RX0A 1TQXA 4QSHA 3INPA 4DF1A 3IVUA 5F1UA 3LHTA 3LCXA 3AO0A 3IEBA 3MHFA 1J2WA 1JCYA 4GUGA 2ISVA 5HUOA 4C1LA 1EIXA 5K9DA 2VFIA 4MOZA 5D2TA 2CLMA 4N02A 1K8XA 1DV7A 1LOSA 2B7NA 5I3KA 3BGJA 3C2OA 5K7JA 5L6UA 5U4NA 4ICNA 2ATMA 5I3IA 1W8SA 3WK0A 4HPXA 4TU1A 2ZQ0A 1OX6A 3B0VC 4OHQA 4LV4A 2QUUA 3N2MA 1R46A 1C29A 4DBDA 3E49A 1KFBA 1ONRA 3CEUA 3W7HA 3E12A 1G7VA 2I9EA 5DXYA 2G96A 3MJYA 3DI1A 3O6CA 4UR7A 5DY3A 4PFMA 1G4EA 1XBXA 1LRTA 1OFDA 5F4SA 4S2CA 2ZZ6A 4MZ8A 4E38A 5TIMA 2X1RA 1VLIA 4UC5A 2WNQA 3S5OA 4XKYB 2V30A 4A22A 1W5MA 4XZ9A 1H60A 2Z1BA 3IVTA 1DOSA 5AHIA 2C15A 1P0KA 1K3UA 2EPHA 3L21A 2I14A 3LOTA 2YXGA 4X3ZA 4QISA 3P8JA 5FF2A 1V7YA 4YWIA 1BWLA 1VCGA 4JYFA 1FXQA 3UZ5A 2CLKA 2LLEA 4EF9A 1XCFA 5EKYA 3NQ2A 4GFSA 2B4GA 3W07A 3BLIA 3MP3A 1M5WA 4ORMA 2TYSA 3W7MA 4FNSA 4XQ6A 1FDJA 4XKYA 4M5PA 1HG3A 5I3JA 2OT0A 2Z6IA 3KRUA 2CLIA 2OX1A 3ANYA 1OX5A 3HGSA 3TJLA 5DY2A 3OVQA 3PG9A 1Z44A 1SZEA 1PIIA 1TCDA 2DORA 1AW5A 5IBXC 1JCXA 4AHQA 2R8WA 3GKFA 3BV4A 4NUWA 3G1SA 1H7RA 4O17A 1ZY9A 5CGQA 3QZEA 2NX9A 2BSLA 4Q4KA 2QUTA 2Y7FA 1SFLA 1KBIA 2QCLA 3ZFHA 2ZZ4A 1WXJA 2XN2A 3G3DA 4MYXA 3ABOA 2ATSA 5CZSA 3HBLA 4XBSA 2CZEA 2JKPA 3TMLA 4D2JA 2ZZ1A 3W73A 2DP3A 1I2OA 1M7PA 5K2ZA 4A2SA 3BG9A 5LGZA 3CU2A 4AMAA 4A29A 1QPOA 1R30A 3GXPA 1SO6A 1N7KA 3NZ1A 2H3BA 4O4VA 1GT8A 3HG4A 1LDCA 4GXMA 5F2IA 2QCMA 3NQAA 1YTDA 2ZTJA 1VZWA 2WV8A 4O14A 3MHUA 3QF0A 3MYPA 2G5WA 4O1AA 4K6AA 4LVDA 3NPXA 4AWSA 4R34A 4O1DA 2ZZ5A 3PM6A 1GQNA 2Y88A 3B04A 2YGYA 1FWTA 2ZRWA 5D03A 4ALDA 1ZENA 5BW6A 1YXDA 3NM1A 4ADUA 4JYEA 2ZZ3A 4UTMA 3LCGA 3CWNA 3EX4A 1CI1A 1G4SA 1H7NA 1W0MA 2A1YA 1GYNA 4DO5A 3MI2A 3GDKA 3WJZA 2D73A 4NVTA 3ABSA 1JRCA 3D0CA 3NG3A 4NZFA 1FWRA 5CPNA 4BI5A 4EVZA 3LTSA 1L6YA 3QPYA 2PRMA 4M6VA 5C55A 1B57A 3TAOA 4DEFA 3K30A 3P61A 3TNOA 3DH7A 4QM1A 3W87A 4O57A 3M43A 4MZYA 1QPRA 1OF6A 3DXIA 4KWWA 4AF0B 4YMZA 1TMHA 5LNUA 3E02A 4G1KA 4JX6A 1LTDA 5EMUA 1ALDA 2DZTA 4JIQA 3LCLA 2QCEA 1W1ZA 4WQ6A 1A50A 3S5YA 4TMBA 4POCA 3S1UA 3H55A 3GR8A 1NAL1 4PL2A 3LX9A 4X22A 2X1SA 2Q8LA 2CZFA 4WOZA 1FCVA 1SQ7A 3W1QA 2V5LA 4MFDA 4R33A 4EOUA 3FJ6A 1VR6A 5DLCA 1LCOA 1W3TA 3M6YA 3VE7A 4XWUA 2J88A 2X16A 3MW7A 3SGUA 4AF0A 5BRBA 5C6MA 4O8RA 5HR7A 2CWNA 1P4CA 1FCBA 1GTEA 3O1NA 1H5YA 1RQHA 4GUFA 5HMSA 3R12A 3W7NA 2GQAA 4DF2A 5AYZA 1VGAA 4N9CA 2WJZA 1FBAA 1TPDA 1EUNA 1Z42A 1Q3NA 3GK0A 1MEWA 2DZVA 2A7RA 3C2RA 3LHUA 3UY7A 5F4XA 3SGZA 1DHPA 4O28A 3W7RA 3VNDA 3I7QA 3DFOA 3UWYA 3UYCA 1OFRA 3M5VA 3GDMA 1NSJA 4JD4A 4LVBA 5HJLA 3W1UA 3GVGA 1H1ZA 1IF2A 1EEPA 3MI6A 3C56A 4BWLC 2EGZA 2JBMA 4BK9A 3E0IA 2CZ5A 1TV5A 3PS7A 3RNDA 2V82A 4LNYA 1I2NA 4AB4A 2JKEA 4LWWA 1OX4A 1GG0A 3WK1A 3QQ1A 3B4UA 2C13A 1TPC1 3M16A 1EB3A 4NJGA 3KHJA 4Q33A 3T7VA 1O95A 3FOKA 1K8ZA 3L5AA 1TPFA 3PB2A 1NVMA 4FIQA 3SECA 4JDYA 2CFFA 5C5YA 3B05A 4M7SA 4U28A 4FO4A 2ALDA 2VKZG 3EB2A 6ALDA 2C3ZA 4WZHA 3KRSA 3TFXA 2QCHA 3EXRA 4FNUA 5AYYA 4CNNA 1U83A 5GVJA 1HTIA 3S5NA 1OK4A 1YXCA 2YYTA 1GVSA 4LVAA 4KKXA 4UNKA 2PE4A 4N4PA 1DQXA 1L2UA 1JCMP 4HIBA 3PAJA 1KM6A 1SO3A 1F5ZA 3C8FA 1KTBA 2C16A 3DHDA 3I7SA 3MP4A 3VE9A 1O5XA 1XBZA 3LXAA 4JY9A 2OCZA 4WXZA 1KBJA 3W1XA 3P67A 4O15A 2A0NA 3WJYA 4IMDA 1B4KA 2CLEA 5FI8A 3O8AA 1AL7A 1TYGA 5D33A 1N55A 3PY2A 3P5ZA 5CZJA 1LBLA 3HGRA 2BLEA 1DKWA 1JULA 4GNJA 5KZEA 2IQTA 3NL3A 1A53A 4PA8A 5FF7A 1ZNNA 3I68A 5SWUA 1K7XA 1DQWA 3NPVA 1TPWA 1BEUA 3FIGA 5KMYA 5G2WA 5HINA 3TQKA 3W7EA 4EF8A 1IXQA 3GYEA 1XL9A 4AEOA 4A21A 2ZYFA 3G1FA 2ZCGA 3GX9A 3N19B 2A85A 3NQMA 3PULA 3S1VA 4MYAA 3G8EA 1WBJA 1TTJA 4IGHA 1TPH1 1JQXA 3UZJA 4Y9AA 4GWEA 3STGA 1KM1A 5DN1A 3LI0A 4LV9A 3G1YA 3W72A 3W1RA 4MLRA 4OU1A 4RV8A 1FUYA 3L9CA 1KTCA 4JTHA 4JTFA 4O11A 4ZQOA 5HR6A 2TMDA 4OBTA 2YPIA 4NNCA 4JTTA 4OT7A 2O7QA 3W7IA 4LU0A 3KFTA 5LNSA 3GLCA 5AHEA 3A9IA 4YCPA 2QCCA 3SIZA 3IGSA 4W9TA 2P1FA 3QQ0A 1ICPA 1O4UA 4Z1DA 2VOMA 3QC3A 1EP3A 4UTUA 3TSDA 3R89A 3PBUA 2QDHA 3MWAA 5IBXA 5G2IA 1AW1A 2J9XA 2A2IA 3G18A 3LGEA 1SZNA 3S6DA 3P62A 4Y96A 5LGXA 4PODA 1GTHA 4H3DA 2WOQA 4IX2A 1MEHA 3QSRA 1FQ0A 2FFCA 4EIVA 4UFHA 5D2XA 3G0XA 2AGKA 1MXSA 2DZXA 3PBVA 1W3IA 4O10A 4E0CA 2EAWA 3OBKA 5CZTA 3KOFA 1PS9A 2VFEA 1OFOA 1K8YA 1EUAA 1PVNA 1TREA 3EWUA 4QNWA 3TXZA 3LTPA 3U2OA 4DXVA 4FB7A 3GB6A 4JTLA 1C8VA 2VFDA 3N9SA 4AWTA 3R13A 4R53A 1LOQA 4AWUA 1KLYA 3PSVA 3KRZA 3HPXA 3M1ZA 1LROA 2DU2A 2YZRA 1KFLA 4M7TA 4JIPA 4PC8A 1SFJA 4WUIA 4UTWC 1J5TA 5TBOA 5KITA 1KLZA 2X30A 1LOLA 3NQDA 4K39A 3PUEA 1FWSA 4UFJA 3C3NA 5A5WA 2OT1A 1VYPX 2JK2A 3SFKA 5E93A 1L9WA 4WJEA 1EX5A 1JQVA 1KM2A 3CIWA 1ZAIA 2V9DA 2VENA 4IMFA 1TO3A 1ZAHA 5E0KA 3O6YX 4LT9A 3G1VA 1U5JA 3M44A 3I6RA 2E09A 1IXPA 2ZFAA 3W1PA 2TPSA 1Z48A 2P0OA 1TTPA 3NQ8A 3W2NA 3ABRA 3O07A 3BARA 4MY1A 4HSOA 3W88A 3M5YA 2QJHA 3DAQA 4N6EA 1F2JA 5DCDA 1Q6QA 2NLIA 5J5DA 1PHWA 4K7VA 1D9EA 3CQ0A 5EYWA 3W2MA 3TDFA 2XFWA 2GJNA 2O7SA 4RKAA 1JCJA 1KV5A 3LCFA 4JTIA 1HO1A 3EX2A 1S5WA 3MUXA 3Q94A 4GUIA 3NQVA 4AVFA 3Q58A 4LVGA 3YPIA 3ATYA 4OQVA 2Q3OA 2FQIA 1EP2A 3W2UA 3NQGA 4CCEA 4ZVJA 1D3HA 2HS8A 4ADTA 5FEZA 2GVLA 1A5SA 3UY8A 4BF9A 3VFLA 4MJZA 1TTIA 4IJBA 4LS0A 3RMJA 3DFQA 1TPUA 1FWNA 4UMCA 1TQJA 4HNUA 3PBWA 4NNBA 1GPWA 4O50A 4TMCA 1YYAA 1GOXA 1LLWA 4NJHA 1LYXA 3C4UA 1KA9F 1TRIA 1QR7A 1W31A 2RH9A 1ZAJA 3TQVA 1UUOA 1UASA 3NEVA 3G1XA 2V2DA 1W3NA 3LV5A 1EPXA 4QQ3A 4JX5A 1KFKA 2Y7DA 1Y0EA 4WX2A 4ONVA 2QUVA 1ZHAA 3W7KA 1W5PA 2E77A 3FYOA 5KZDA 5KSWA 3L65A 2B7OA 4MLJA 3LV6A 2FB3A 1O94A 3H54A 1WYIA 3P60A 3GZ3A 2NX1A 1K02A 4FNPA 1PCWA 2QCNA 3M5ZA 4MIMA 1H1YA 4YL2A 3C2FA 4UTHA 1W5NA 4O4WA 4UTTC 1TPEA 2H8XA 2RDWA 4JGDA 1PV8A 4PEKA 4BI7A 5CKSA 2NUYA 3LBCA 4ORIA 1OF8A 1VYSX 1W56A 3G0UA 4GRSA 3EX1A 4FX6M 2YSWA 3DFTA 2X1UA 3FLUA 4ZQMA 2YCEA 1ICQA 2RFGA 3L0NA 4L4LA 1CX9A 2CZDA 5D09A 5CSRA 2G95A 4OV4A 4S1FA 5EBUA 2JGYA 2E6FA 2RHGA 5CPLA 5CZ0A 5D2VA 3H53A 1YTKA 3OVPA 1OFEA 5I3HA 2PCQA 1QDSA 3P82A 1MEIA 6TIMA 1ICSA 3HMJG 2ISWA 1IIGA 5KZMA 4L4MA 1Z41A 3TAKA 2Z2UA 2RDUA 4AHOA 4HPJA 3W70A 2BX7A 4JN6A 1K7FA 3ELFA 1QCWA 3A23A 1RPXA 5AHFA 4JY8A 3EX3A 1GVQA 4JTGA 4HNNA 1TRDA 5FEWA 4AAJA 5CPOA 2GVGA 3BW4A 1XDMA 2C19A 1L6WA 1YADA 3W3OA 2BZNA 4I7VA 2CU0A 3GXTA 3P80A 4ADSA 3GR7A 2GJLA 3FEMA 4ZMGA 2I1OA 1WA3A 1OYCA 1JUKA 2Y62A 1LRQA 2A6NA 3W75A 3W7QA 3BPWA 1OYAA 1VC4A 3IIPA 3L67A 5AN7A 3GXNA 3EKLA 3EXSA 4IXXA 3KVMA 1JUBA 1TPB1 1UUMA 3DFSA 3QJAA 3W7DA 3C2EA 3TKFA 3NL2A 1QPQA 2PC4A 1ZALA 3SR7A 3JS3A 1KM0A 3GDRA 3QW3A 4K8EA 3BW2A 1YTEA 3RLVA 3E96A 3OHIA 1L6SA 2QCGA 4O0KA 3UQNA 3CTLA 3Q2DA 3W7LA 5J5RA 4UCGA 3PB0A 2GPTA 3TXVA 4IMCA 5A8GA 1D3GA 3NPWA 1I2QA 1G4PA 3NL6A 3EXTA 1YLVA 1UBSA 3FA5A 4MVAA 1DJNA 2OZ0A 3S9YA 1WV2A 3WJXA 3W7PA 3EKZA 4WD0A 5HWMA 1F73A 3TH6A 1Q6RA 1JRBA 1I45A 5DCEA 3BG3A 4CCCA 1VHNA 1OFPA 1H7XA 1OX4B 2J24A 4QITA 1SW3A 2J6XA 2GVJA 3DFPA 4TX9A 1HO4A 3W1MA 1FDZA 3NYZA 2YX0A 4IOTA 3O16A 4ML9A 3HJZA 3PC0A 3CIXA 3CWOX 1GYLA 3V1PA 5AOUA 3NQEA 2DJLA 3AJXA 1NF7A 1E51A 3BGGA 3P74A 2Y61A 4ZQNA 4FXSA 1K03A 3QFEA 1X6UA 3DENA 5HWNA 3SJ3A 4UXDA 8TIMA 3P84A 3QMTA 3W84A 3QSTA 4GBUA 3U6WA 3PBYA 3EWYA 3SZ8A 4FX7A 3A5FA 3LHWA 1TJRA 3G0SA 5D38A 3TSMA 2GUUA 3N2XA 3UXAA 1H7OA 1TB3A 4LRTA 2VEMA 1LZOA 4PH6A 1W5OA 1KM4A 4M6PA 1FX6A 1AL8A 2ZRYA 4KFOA 1UJPA 3NO5A 1J4EA 2Y89A 3LCIA 3N73A 1XFBA 3NVTA 1QMLA 2FPYA 2NWSA 2NX3A 5HWJA 2ZRXA 3LCHA 3PUDA 3OA3A 2C14A
chains in the Genus database with same CATH superfamily
1FFRA 5M3WA 2KZHA 2VC6A 1EJRC 1JJKA 3CYVA 4O54A 1A5KC 2J78A 3CHCA 4W7UA 5CSSA 7A3HA 4JX4A 4Y8EA 2ZE0A 3QHNA 1ONEA 3W86A 2A3BA 3IIVA 1ISZA 4IIEA 3LXBA 3VMOA 2XZ9A 1PHQA 1J0JA 3F03K 1I0BA 1J0YA 4Z2LA 3UPMA 4P8VA 3DG7A 5FESA 1V3MA 5J04A 1A4LA 1EOKA 1ZB5A 3BW3A 3W7JA 2FZ9A 1JCLA 1YQ2A 2WLZA 4G6CA 4UMAA 4GVGA 3VM5A 2GLKA 4HSHA 5AC4A 2WZIA 3F5LA 1PZ0A 2F8QA 1K6AA 3FKKA 2B7QA 2V3EA 2WO5A 4R9XA 1F76A 1F74A 4MGGA 4ZFCA 3ISIX 4YVXA 3MKVA 3T2OA 1E15A 3OU8A 2X40A 3G6LA 4LUJA 4LBSA 3HIJA 1C3FA 1BG4A 3MQTA 4KRUA 4PTNA 2PMQA 1J5SA 2O9PA 1P0DA 1XBYA 3QFWA 1IYXA 2ASHA 1J01A 4DQWA 4MUZA 3LHZA 1XJBA 4QCEA 4BQ3A 1X6LA 4L6OA 1TUFA 1VPXA 3HPZA 3GUGA 1F3EA 3HQ1A 4GY0A 2Z2BA 1J8VA 4IX0A 3GDLA 4B5NA 3WH7A 5D32A 4ZZ9A 2OJPA 4XISA 4S3GA 1P5BA 3M0ZA 1OEPA 3P0WA 4NX0A 4JYDA 3NSXA 3PNZA 3GTFA 1RVGA 3WLHA 1W5QA 2DW6A 2FLIA 1JI2A 5U7SA 3VZXA 2GJPA 4GH3A 4K36A 2WC3A 4XO7A 3PANA 5L9FA 3W85A 3QVQA 3GU2A 3GHRA 2OOFA 4PRRA 4QAIA 3BLFA 3L68A 3L5LA 3XIMA 5LHEA 1WZLA 1FWJC 1DTNA 5CC6A 4IIHA 1MNZA 4F0HA 4CNUA 4N42A 1XLLA 3MBFA 2NT1A 3GKAA 2FPVA 2ZA1A 1SSGA 5A95A 2V81A 2E5DA 4LNCA 4EWND 1LT8A 4IWWA 1AJ0A 1SZGA 1UA3A 1EJTC 4FXFA 1KV8A 3T8QA 1IEWA 1JPIA 1RLDA 3V3WA 3S5ZA 3I6EA 3EAUA 2PS2A 4LW7A 1NWUA 2QMJA 1RBAA 3M0VA 4CGTA 3G77A 4RE0A 4OBSA 2Y7EA 1TWSA 7TIMA 3MCOA 4N9BA 4JTUA 4MF4A 5BMWA 5DEZA 1QAPA 3URNA 1DIKA 5DANA 2UV8G 3E2QA 1DVJA 5HJXA 4DPPA 1VQTA 2ZA2A 4EK7A 1QWKA 1KRBC 4XVEA 2JF6A 4Q8PA 1MI3A 2Q8XA 5HULA 5DBTA 3BZGA 4ICCX 2X2GA 1TE1A 4MUPA 3FFSA 3OLDA 1S3TC 3PZOA 1A47A 2QMKA 4UFMA 7REQB 2IKIA 1S2AA 1P6CA 4MY9A 3WQEA 1A5MC 2BVWA 3W1LA 3G1HA 3EBVA 4H6KA 3RCYA 1H5VA 3VNMA 2GDVA 3PWGA 2W91A 5EMKA 3SIMA 1KO0A 4UQCA 2NV2A 1GZJA 2ZRVA 1OGGA 1WZMA 3OLIA 1E72M 5HA7A 5G5IA 2Z4GA 1Q63A 4I3GA 2BXZA 7REQA 4FNRA 3M47A 3MY9A 3HF3A 1DJQA 2G4FA 2ZXDA 2RDTA 1ZBWA 3STCA 4PL1A 4E8GA 4GC4A 4JIRA 2VUYA 5BNKA 3R8RA 4UB9A 3H2AA 4L61A 4Q4SA 3B8WA 3W1AA 4K1GA 1KKOA 3QRHA 1DL3A 1WB0A 3VI2A 1M68A 3TA6A 1ME9A 4WKAA 4FOUA 1TTQA 3CZEA 4IPIA 2E6YA 3H2NA 1TSIA 2DZPA 1TV3A 4Y90A 5JMUA 4CCDA 3ZIZA 2ZTKA 2QQ6A 2XVPA 4Q3MA 4DYKA 3LHYA 1HF6A 1QO5A 3S8HA 3O63A 5BXPA 3EA1A 2AGTA 4GI6A 1UIOA 5BWAA 1BAGA 1UC4A 1PL9A 3TX9A 2ZVIA 2Z0IA 2C18A 3B8TA 4O53A 1F3XA 2CERA 3KP0A 1P1XA 3EPMA 3WY1A 2WSYA 1W54A 4H83A 4UR8A 4F0MA 3C0LA 3V0UA 1ITUA 4KGLA 4LH8A 2BASA 4O52A 4PUWA 3G6MA 5F4WA 1XLMA 2PWGA 4IPNB 1PYMA 4JTEA 1XPYA 2J74A 1ZJHA 3QOKA 5AHMA 3W25A 3WUBA 2XZ7A 1IGSA 3B0YA 1C92A 4Z08A 1WOBA 1PDYA 3BMXA 4ZQPA 3PPFA 3AS0A 4NJKA 4XIAA 2BV9A 1HP5A 4UIOA 1ZS2A 1UW9A 4Z2HA 3Q37A 1HKWA 3RU8X 1H0GA 5GJMA 2QF7A 3O05A 4NQ1A 3SN0A 1ZFJA 3VNIA 3SCTA 1CGYA 1H51A 3S2JA 1VFUA 3IUIA 1HL2A 4GE8A 4W86A 1LP6A 4UFLA 4CQCA 4GQBA 2PA6A 1A5AA 3ZWTA 3EDEA 4JEJA 3U4AA 3WFAA 2GWGA 3TR2A 3TK7A 3K8LA 1VFTA 2G3FA 3ALFA 4W88A 3FVMA 4LAKA 4LJ3A 4Y8FA 4JNYA 4D71A 3USBA 1DORA 5FEXA 4B2DA 3POHA 3GUWA 4OE7A 3LDVA 2E40A 1T96A 4HK6A 3T42A 3TN3A 2TRSA 4JTJA 3WLOA 3NAVA 4ZEPA 3KOZA 3EWWA 4MADA 2YFOA 4A3QA 3CHVA 4N6FA 3AAMA 3NYDA 2PTYA 2JIWA 4QCFA 3WBXA 1C93A 1OG6A 2OLSA 3IJ8A 1WQ5A 3ARVA 3EGJA 4NU7A 5IDIA 4L9XA 3KXQA 4LRSA 4EKJA 1F05A 3IAQA 3EMQA 3GFYA 3UWQA 3WF4A 3NOYA 3NQ6A 3L4ZA 2Y6ZA 3LRMA 3W23A 1AMKA 3UF9A 3ZO9A 4ZOBA 1YDVA 3MBDA 1UR9A 4LC8A 3XISA 3M07A 1B3WA 2G37A 1XLCA 3WBWA 1U5HA 1QO2A 3SM0A 1C8YA 3THAA 3N6JA 1EF2A 3T55A 2O56A 4IL0A 3CAVA 1PWLA 1KXVA 5HQEA 3HG5A 3PPGA 1GEQA 1E0UA 2EF9A 1UWTA 4NZ5A 3WF2A 1UR8A 3MWCA 1J6OA 3CPUA 3N4FA 1X7FA 3UXKA 5C9ZA 2C79A 4FNTA 4GHRA 1FHLA 1P7TB 3GYCA 1UZ4A 1XYMA 2RJGA 2AQWA 2C91A 4TX6A 2HQAA 2PBGA 2H8ZA 2YDAA 2ACUA 3EEGA 4FEZA 2TSYA 1ML1A 5BU6A 2FPTA 4AY7A 2OLAA 2QPUA 1FCQA 2G41A 3H4WA 1EC7A 2WSQA 4JHMA 3UWWA 1XCWA 4IFOA 3NOEA 4UTWA 3MUIA 1X38A 4EXBA 3CZJA 4P8XA 5MHBA 5EGRA 1PKYA 3QW4B 2WZTA 4NXKA 2YYUA 4JIEA 1CDGA 2PP1A 4PSRA 3RGTA 3K5XA 1XYLA 3JUGA 4CQ8A 1W3LA 4CKQA 2QAFA 2QAPA 3G8RA 2CKRA 2QR6A 5AC6A 2VUNA 2VXNA 2HZGA 3LZ3A 4QBXA 4XTDA 3VCNA 4J3WA 2VCAA 2PGRA 2QJMA 2WM0A 2TAAA 3DZ1A 2HCVA 3N3MA 5KTLA 2CPUA 4HYVA 3S1XA 4Z2GA 4A2RA 4A6GA 2BMBA 3TN4A 4LOCA 1BQCA 3PZMA 3VIHA 2NV1A 1SZFA 3PHAA 3VC6A 4AZ7A 1EWEA 4IGSA 4L4PA 4B3ZA 1ECQA 2J27A 2VDIA 2DVXA 3DDMA 1AFSA 4O1CA 2WQPA 4RZ5A 6PTDA 3BG5A 3E1F1 3IJQA 1XKJA 3JRKA 1TIMA 4KWOA 3W2JA 3FSUA 1VBUA 3I6TA 1VJSA 1S5VA 2PAJA 1OYBA 1GVRA 2PDNA 3MCMA 2VZSA 1UMYA 2WVVB 3AS1A 2H90A 3W71A 4DI8A 1LF1A 3M7WA 3Q67A 4F2UA 3HURA 3JU2A 2WNNA 4QS5A 1X98A 1OK6A 2VGBA 5BYWA 3UNDA 3M0IA 2AL1A 2E25A 1IZJA 2IQDA 1Q66A 4K7YA 1YDNA 5CCZA 3WDPP 3KZPA 2ZA3A 3CZLA 4NJJA 1R9ZA 1N8FA 4GFIA 1LJYA 3SCQA 4DWSB 4PBFA 4EAYA 2HROA 4LVFA 4QE5A 2J7EA 2E3ZA 4W8LA 1GJWA 3IAPA 1WOAA 3UPWA 3NZRA 1R7OA 3MMDA 1B9BA 2F84A 2OGYA 5LNRA 2XVNA 3CK5A 5F1VA 1VYRA 4B92A 4PCNA 3APYA 3INPA 1S2TA 3TJ4A 2P8CA 1JD9A 2GJXB 2ISVA 1NWTA 5HUOA 4H04A 1NARA 1GKRA 2VFIA 2X42A 1K8XA 2XSXA 2ADAA 4GI8A 4LUSB 5L6UA 4ICNA 5CQ1A 2OOGA 4M24A 1QNSA 1EZ2A 5I3IA 4HPXA 4TU1A 1OX6A 4DM2A 3RO8A 3KUMA 1LUCB 1C29A 4DBDA 2V5DA 3E49A 1HJXA 4ZB0A 3CEUA 2GJXA 3KCOA 2VRKA 2I9EA 3U5YA 3UGVA 3DI1A 4QJ5B 3VGBA 3UZWA 1HX0A 3PWIA 2VT0A 4LUSA 4QEEA 4ZO8A 4MZ8A 9XIMA 4XAFA 4JKLA 4UC5A 4ATLA 4Q8TA 3W0KA 3S5OA 2P3EA 4XZ9A 5I09A 1DOSA 1LUCA 1P0KA 2EPHA 3LOTA 1E5NA 4X3ZA 1NELA 3QC0A 3P8JA 2QUMA 1BWLA 2RUSA 5EMYA 4V28A 1FXQA 4QFUA 3EZ4A 1N8IA 3UW6A 3BLIA 1V08A 3CL6A 4FNSA 3GNPA 1JIBA 5IDZA 1IT8A 1PB0A 3MB9A 2HVOA 4M5PA 1HG3A 5DT7A 2OT0A 4W8BA 1Y5VA 3ANYA 2CXGA 3SQSA 1UOKA 3PG9A 1SZEA 1TCDA 1Y5XA 2Z25A 1AW5A 1KQZA 2YXXA 4A4AA 4AY1A 4HA0A 1ZY9A 3WLMA 4C6JA 3QZEA 1E4IA 3BTNA 1OD8A 5CLTA 4JIHA 1UD4A 2QUTA 3LNMA 4ZXOA 2Y7FA 3UR8A 3IJ6A 1M65A 1UBPC 2DZAA 2HNEA 4ZTXA 4UTFA 3JZUA 2ZZ4A 2XN2A 3AHVA 3HFTA 3OIHA 4M6UA 5CZSA 4DJDD 4CNSA 1E55A 1VFLA 1UD6A 1OWQA 1XIHA 5C2GA 1OT1A 1LG2A 1TX2A 5E9XA 1QPOA 4G8TA 2QZRA 1RSCA 3IK4A 1SFSA 3KLLA 3KZSA 2FTYA 1GT8A 2XGZA 4GXMA 3CMGA 5F2IA 4LQ1A 5HMDA 2QF8A 2G5WA 4O1AA 3CZ8A 1MW1A 3CB3A 2ZZ5A 4UZSA 2PDPA 3VIGA 3ZJ7A 2Y88A 1ZENA 3IANA 4JYEA 2ZZ3A 1GNXA 3EX4A 3WQPA 1AQ0A 4HYRA 1BYAA 1CLVA 2QNEA 5A69A 2HK1A 4FOKA 2WANA 1W0MA 1GYNA 3GDKA 4NVTA 3NEHA 3BAIA 2RJHA 1BF2A 1FWRA 1ZBCA 1P43A 3BC9A 2DVTA 1KXQA 3CUZA 4HP5A 2FHBA 2PRMA 2QLYA 5C55A 3WQ5A 1LLOA 2HBXA 3K4WA 3ZM8A 3K30A 3TNOA 3DH7A 1VENA 4O57A 4H9ZA 4O1EA 1NWSA 4DBSA 1VF8A 3SRKA 4M56A 4G1KA 2I9UA 5HQLA 4C6KA 1BHGA 3WNMA 4JIQA 1KXTA 2QCEA 1W1ZA 4WQ6A 3VIIA 3LMYA 4POCA 3GR8A 1W9PA 4ZO7A 3JZEA 3N25A 5D9PA 1Q7ZA 2Q8LA 1E1EA 1VR6A 5DLCA 4AD1A 1LCOA 2FZNA 1ZPTA 1CNVA 2X16A 3WENA 1ZQ5A 1UPPA 1J12A 5BRBA 3VOFA 4ZENA 4IIDA 4XKMA 2YA2A 4O8RA 2XTKA 1NJJA 4I5UA 3O1NA 1K9FA 1RQHA 3RJXA 3RM8A 3WFLA 2IXUA 3ITTA 5HMSA 3R12A 4CU6A 3RUBL 2WJZA 1FBAA 5IHRA 1OBAA 5IFTA 2A7RA 2YIHA 3SGZA 2XIIA 3TP4A 3EYPA 3QN3A 2A79A 1XLHA 4DLMA 3K4DA 5CJNA 4LYQA 3AFBA 1NSJA 4LVBA 4E4PA 3GVGA 3IWPA 3A4XA 3C56A 4PMXA 4BWLC 4L64A 2JBMA 4K68A 1HJQA 1RK5A 5A6BA 3QV8A 3HV8A 3RNDA 4LNYA 1I2NA 2BOGX 2JKEA 2WHLA 4LWWA 3VGFA 3CQHA 1GG0A 4ATDA 4AY8A 2DH2A 3HN3A 1EB3A 3LN3A 4S3JA 3BSGA 3ITCA 4GCXA 1K8ZA 4E4FA 3PB2A 1NVMA 3OO2A 4JDYA 4R85A 1EJUC 4FLQA 3SCOA 1NQ6A 6ALDA 4WZHA 3KRSA 2CETA 5GVJA 3S5NA 5AYBA 3AALA 4WKHA 2WYSA 4LVAA 4H00A 1V77A 4UNKA 2PE4A 2OWWA 1ESWA 1AVAA 3UU0A 1XX1A 2FJUB 4HNOA 1WDRA 3GVQA 2OODA 3M4HA 3IJLA 1PAMA 3VE9A 1E4LA 1XBZA 3GY1A 2GYIA 3ICJA 3L4XA 2OCZA 1O5QA 3W1XA 2A0NA 2GGHA 1CENA 1B4KA 2CLEA 3COTA 5FI8A 4RE2A 1B3YA 4D8AA 5M1TA 1UKPA 3PY2A 3A3HA 5GJPA 4NL1A 1O1HA 1A0DA 2PC8A 3AIUA 4GNJA 2DIEA 2W66A 3DG6A 2GSHA 5FF7A 3I68A 3IV8A 5SWUA 1K7XA 5FJIA 3SBFA 1DQWA 1FHVA 3AHTA 4H6EA 2WZEA 5KMYA 1CXEA 3MS8A 1UR0A 2YOCA 4AEOA 4FSAA 2ZCGA 3GX9A 3N19B 3C8NA 4IGHA 3M46A 4HA3A 3UZJA 1RPKA 1WDSA 4YTTA 2ZXAA 2E4TA 4LV9A 3UG4A 3FK4A 3G1YA 1PXGA 1I1WA 2HISA 3TTEA 1FKXA 1HVXA 4JTFA 3PJXA 4ZQOA 2WMGA 1EXBA 3KWXA 2WCAA 4ROQA 3W82A 5XIMA 5FAJA 2YPIA 4RE4A 1W3JA 1Z32X 3V5OA 3OTRA 4OT7A 1WUFA 5LIYX 3P14A 4GH1A 4LU0A 1UOZA 3VKBA 5J8LA 3KFTA 1VEOA 3A9IA 3LZ5A 1ZTVA 5EBAA 1AJ2A 3SIZA 3IGSA 5EFDA 5DQPA 6CGTA 1O4UA 3AXIA 8XIMA 2XSBA 3QC3A 4UTUA 4PZVA 3R89A 1QNQA 2PFHA 3AI0A 3MWAA 4AEFA 4MNKA 4MM1A 3LGEA 1SZNA 4DAIA 2SFPA 4Y96A 4PODA 3I3EA 1GTHA 2EJAA 2XM1A 3CAQA 2WOQA 5CAKA 1MEHA 2FFCA 3FY1A 2BP1A 4UFHA 2O92A 3G0XA 2KX9A 3VYLA 3IJIA 1MXSA 1XS2A 4Q8NA 4J1OA 1CLXA 3UWEA 4F48A 4AIOA 1W3IA 4U10A 2VMFA 1A49A 5CZTA 1JZ2A 1PS9A 1E70M 4QNWA 1OFOA 1EUAA 1K8YA 2VFEA 3TXZA 3TEVA 2ZC8A 3U2OA 4FF5A 3BAXA 1B5TA 3UJFA 3GB6A 4I5RA 3N9SA 3GDBA 3R13A 4PEEA 2HWGA 1KLYA 3M1ZA 1LROA 1W8GA 2DU2A 2YZRA 4GX8A 4IFRA 3CUHA 1V6UA 1J5TA 1LWIA 2VC5A 1G5AA 5LA0A 4D8ZA 3ITVA 1LOLA 3H4GA 1FWSA 1R5YA 1BF6A 5A5WA 4AU0A 2OT1A 1VYPX 4MNLA 1W1B1 3W29A 1XSJA 2RDXA 1RAKA 4BEUA 1KM2A 2GGEA 5JBFA 4ZODA 1ZAHA 5E0KA 3G1VA 4ECLA 1DWJM 2ZFAA 3IJ9A 1NOUA 3W1PA 3EWCA 2P0OA 4FALA 3ABRA 3O07A 3UZZA 1G1YA 3TNBA 3MKCA 3EKGA 4XD4A 5HANA 1DIDA 4XZIA 4UCFA 1F2JA 2PLCA 2NLIA 2BG5A 3T0BA 2VX6A 4LCRA 4K7VA 3CQ0A 1XRFA 3W2MA 2XFWA 3J7HA 3L4UA 2GJNA 4G1NA 4L4OA 1JCJA 3LCFA 3H7RA 1HO1A 3EX2A 3ARSA 3Q94A 1HJSA 3GWQA 4GUIA 4AVFA 2JIEA 2BY2A 2YA0A 4PTMA 3WMLA 3T9PA 1EP2A 3UFYA 4CCEA 2E28A 3P6LA 4ZVJA 1FFQA 2IW0A 3WLJA 2CYGA 4ADTA 1Q8JA 3L12A 2GFTA 3ZSTA 1TTIA 3RMJA 4HHLA 4I6KA 1JZ5A 2BY3A 2NVDA 1GPWA 4CNTA 1YYAA 1LYXA 2D2HA 3AC0A 1IZKA 4GKTA 3UXIA 3VM7A 4C91A 1E0XA 3PJWA 2R1PA 3HMCA 3HTWA 4RV3A 3G1XA 4QQ3A 2Y8KA 3ZLGA 1KFKA 2Y7DA 1YBQB 1Y0EA 4WEVX 3V0SA 4ONVA 2QUVA 3UP8A 1Q2SA 2ZX8A 3L2MA 3NO1A 1MUMA 1KWGA 3L65A 5T91A 2B7OA 4MLJA 2FB3A 3H54A 4AYSA 1WYIA 3IJDA 3LSCA 2MNRA 4FNPA 4R27A 2DY3A 2I5GA 1OC7A 3QLDA 4NAEB 4YL2A 3C2FA 1W5NA 1YBQA 4PFHA 3LBCA 4ORIA 3G0UA 4GRSA 3EX1A 4LYKA 3WBEA 3PBMA 2YSWA 2OZ8A 4L4LA 3PUGA 3AHZA 3UR7A 4OV4A 4S1FA 2VR5A 2J7HA 2JGYA 1OFEA 4ZOEA 1QDSA 4NAEA 3KBWA 3P82A 1OCNA 1ICSA 1EF3A 5CSYA 1E4MM 3ARRA 4S23A 1DHKA 4HPJA 4JN6A 1RPXA 4JTGA 1GVQA 5FEWA 4P5UA 1WZKA 3WLIA 4E8CA 2VDHA 2O9TA 3MZ2A 1OADA 3UCDA 2C19A 1YADA 4EXAA 2BZNA 1JAKA 4I7VA 3P80A 5A6LA 1CGUA 4DIAA 3VD5A 4ZMGA 1MUCA 2I1OA 1WA3A 2DUXA 3W7QA 1OYAA 4W89A 5AVNA 3IIPA 3U7VA 2GQ3A 2FH8A 3ITYA 2Z27A 4DJFD 3KVMA 3W7DA 3C2EA 3B9OA 4W87A 3TKFA 3M7SA 3WEOA 2CBVA 2PWEA 3SR7A 3JS3A 1W1TA 3QW3A 4PMRA 1B3XA 3RXZA 3K1GA 4IJRA 4RDYA 5BXSA 1AH0A 2QCGA 3AJ7A 1X97A 3VDHA 1B3ZA 2WM1A 3PJUA 2WHJA 1MW3A 3Q2DA 3ARTA 5D8ZA 3TXVA 5A8GA 2YL8A 1FH7A 2QDDA 4AISA 3DN5A 3SCRA 2OZ0A 1TWDA 2CKSA 4WHBA 3FCPA 3W7PA 2WHMA 2OLHA 2QYGA 1F73A 3TH6A 1Q6RA 3SCSA 1I45A 3KBNA 3BG3A 4Q4QA 1JYXA 4QITA 1SW3A 4B9YA 3DFPA 5I00A 1CB7B 3W1MA 1BTCA 3NYZA 3PC0A 3EB3A 2ZUMA 3CIXA 4RDWA 3CYJA 2VTFA 2OWCA 3P74A 3QFEA 1X6UA 5HWNA 3THDA 3G1RA 4UXDA 1AA1B 3IS4A 5CSUA 3TTSA 3W84A 5JBDA 3ZJKA 3WL0A 3PBYA 3LHWA 3G0SA 1JZ7A 4B4HA 3NWRA 4C5YA 1H7OA 1LQ2A 4Z42C 1W5OA 4QTGA 4M6PA 1AL8A 3TWBA 1BYDA 5ABGA 4H1ZA 1W91A 2G3MA 1W2PA 3U3HA 5HWJA 4D6JA 1EO7A 2ZRXA 3PUDA 3OA3A 2C14A 1W3HA 3RLUA 3HG2A 5BCAA 4XAYA 2BOEX 1NF0A 4D9PA 2DSVA 3GIQA 3AMLA 1W9UA 1D3CA 4JNMA 5AC7A 2WMHA 3WLRA 4PB5A 1OG0A 3NSMA 3D6NA 4RZBA 2EQDA 4EAMA 2VL4A 4M1BA 3DHPA 1RVKA 3TOYA 1K7EA 3H2CA 3QTPA 3BSHA 4HZ6A 4R7JA 3IGUA 3VMNA 3AYVA 3SQMA 4IXHA 1QNVA 1XPGA 2R94A 1S46A 3JVAA 1ME7A 1YPFA 1V6YA 4Q22A 5BU9A 1J96A 3RHGA 1SJDA 2OR2A 3LERA 1C8QA 3CUGA 4HNLA 2DZSA 3QKEA 1KGXA 4Q7IA 4LPCA 2YL5A 1W2VA 4LXFA 3UVIA 1XP3A 3TZNA 1W1A1 2Y63A 4L5ZA 3UG8A 3BE7A 5CAHA 1X7IA 2V67A 3CV7A 1A80A 2V0TA 4MZ1A 1RZMA 3C52A 4GUJA 4H8VA 4A3RA 3UD6A 3EA3A 2A7NA 3B8DA 3W6YA 3ZWSA 3FHQA 3HG3A 4MJ2A 4UFKA 1JYWA 2O0TA 4A35A 2WSPA 1IXOA 2CHRA 1E3ZA 1FWDC 1OFAA 1MSSA 1V3LA 1TMLA 3DESA 1EBHA 1HP4A 1F61A 4PBGA 5I03A 1IWPA 2H6RA 3ANUA 4QG8A 4REQB 3SCVA 3MHGA 4IPJA 5JXQA 4PUDA 3FJLA 3CL7A 3JR2A 3FS2A 3CASA 3ITXA 3VZZA 2VEPA 3TFCA 4HU8A 1XH1A 2YFNA 3G3MA 3TOPA 3AUJA 1JEZA 1A4MA 1TA3B 3CO8A 1HVQA 1H7WA 2JEPA 2Z1WA 2ZUVA 4IQLA 4KGJA 1FWWA 2E67A 3KEHA 1H3GA 1TV7A 2V2HA 3SSJA 1GHSA 1XLEA 3TQ0A 4QDPA 5GNXA 3WK3A 2AOSA 1OABA 2DPEA 4REQA 1TKKA 3BK0A 1VHCA 6REQB 2HS6A 4HOWA 3ZZ1A 4AX6A 1SO5A 1V02A 1E6SM 4ENLA 3PK7A 4NNAA 2PDGA 2PLKA 4JQ4A 2OB3A 3DFNA 3KVJA 4U4MA 1OGBA 3KVKA 3LHVA 4CQAA 4WGXA 3NFUA 3KW3A 4P61A 5EPDA 3VOCA 5HMFA 3OGRA 1FWGC 4TVDA 5I2UA 4TIMA 3W6MA 4O0ZA 3LI1A 2B0MA 4KEUA 2VVNA 1NDVA 3ARXA 1I9CB 3UZXA 5HXMA 5G2HA 3TUUA 3L0GA 3TV8A 1S2UA 3GG7A 4YJ5A 3TYCA 3UWUA 3LLXA 2QIWA 5I3FA 2V2CA 4XAGA 2JGQA 1QFEA 1H4PA 4D8LA 5A2CA 2VM8A 4P2VA 1IEQA 2AQVA 3LLFA 4H7CA 1C9WA 3PP7A 1JL8A 2HNHA 3GM8A 3AYTA 2VC7A 4TOQA 4Z17A 2E8ZA 2P8BA 3F4WA 5D37A 1EJSC 5H8MA 2PLMA 1SR9A 4UTKA 4IT1A 5HNRA 3WJSA 3NJ3A 3QZAA 2A3HA 2DH3A 1VFSA 1UKOA 4GACA 4X61A 1PKLA 3K4AA 5A8QA 1W37A 1GK8A 3O15A 1T99A 4JR5A 2VX4A 1XSIA 1HKJA 4IPLA 3RM9A 3WUFA 3MMTA 3QKZA 4H01A 3TC6A 4S3KA 2X1IA 4QJ1A 2J8TA 1VRDA 3DU0A 5LHFA 3SUSA 3L5MA 1OVDA 4KESA 3BL3A 2Y24A 5HNNA 5AHNA 1UWQA 1X8FA 2XFFA 1FOBA 3B4YA 3LCWA 2ZZ2A 4YCOA 3H70A 4O1BA 5C9WA 4IMAA 4O16A 5DXXA 3OZPA 4GYPC 1FWAC 3NSNA 1BYCA 4NSBA 4WIWA 2VFHA 2G3IA 1AQHA 4JTAA 3TTYA 2E8YA 3SY1A 4HN4A 3WNKA 3SAZA 1NEYA 2PRHA 2Z7GA 5DT5A 3BAYA 3W81A 1TV2A 3BO9A 4AZBA 1FWHC 4NZJA 3N4EA 2OEMA 2F7FA 1M7OA 3RPTA 4UTIA 2G97A 4BWLA 1BTMA 2PI6A 1F7BA 5HPCA 3PPHA 3TROA 3FSTA 3WQCA 1LBMA 4RXGA 1I75A 4RJEA 3FKRA 1ZCOA 2D69A 4M6QA 3STEA 3IIZA 3QY6A 2DQWA 4W7WA 3ZVHA 5G4EA 1AODA 2OFJA 1TVPA 2CESA 4GKLA 2VEFA 3VIOA 3VU2A 5HDRA 4HZ7A 3UERA 1OCBA 1Q6OA 4EX4A 2DZBA 5BMXA 5FD0A 1S1PA 3LGGA 4DUWA 1FWCC 1OFBA 3M0LA 3LBOA 3ERPA 5FF4A 2A5HA 3SUTA 5JH2A 3UVAA 2V6AA 4JQ3A 3GXIA 3N2CA 3WLQA 4N9DA 4RLIA 3ZR4A 1VH7A 3W7GA 5XIAA 4TV5A 1VJZA 1I0DA 4LEFA 2HTMA 2F6KA 3GHSA 2FJKA 4X2RA 2INFA 3KAOA 1DXEA 3ANVA 4DBUA 1M53A 3WNLA 1JR1A 1RR2A 2C1GA 2ZDRA 2Y2WA 4HA1A 5F2MA 3WQ4A 3UWVA 3VAVA 4UUIA 4UNLA 1DEDA 1JCTA 1Q45A 4DYEA 2D2OA 3UJRA 2V5CA 2DDXA 2DZWA 4GNVA 4N7QA 4C6CA 2VCCA 2EJ1A 1LBFA 2NXHA 1XIMA 5DMNA 1QASA 2F6XA 1NFBA 2XFRA 3LBMA 2YDRA 4D6CA 4QNEA 1CECA 3VGGA 4JEQA 4V2XA 3CV2A 4GIAA 3R58A 1V7AA 4P7RA 2HPMA 4NXSA 3II1A 1FDYA 2Y8UA 1AMYA 1KTNA 5CXPA 5A8PA 4BFAA 3NGJA 1YDOA 1JPDX 3V7PA 2J9YA 4DO4A 3B9EA 1OZMA 1YMYA 4IP4A 2DGAA 3E2SA 3VX0A 4MAZA 4ZGYA 2WC4A 1R3YA 3RU6A 4M29A 3WH8A 4CQ9A 5FF3A 4ROPA 1ADDA 4FHAA 1RJPA 3NL5A 3NR0A 1QWGA 1ONWA 3GQYA 4NP7A 4M8UA 1RJQA 3VIFA 4QE1A 1XLKA 1D8CA 3VD4A 2BVYA 1GOQA 4PUUA 5A94A 3M0YA 3L0KA 5DRCA 3QEZA 3UWZA 1H62A 5LNWA 2PZNA 1WBHA 2WSRA 4JIIX 1PSCA 4D1IA 4YYFA 4XBJA 1GOOA 4OGZA 1DJGA 4JDBA 4C7DA 5JUVA 5LNVA 2F2HA 1G6CA 4RZ6A 1GG1A 1NFGA 2NW0A 1QOQA 3I65A 1XFCA 3QXBA 3PTMA 3ZS4A 1MW0A 3IV3A 3OVRA 2R1MA 1T8XA 2QCDB 1GORA 3AU6A 1SPQA 3NUKA 4AQLA 2ICSA 1NU5A 1XG4A 4FZIA 3H4XA 1CXKA 4FIRA 2OYKA 3G1AA 3MA8A 1XUUA 1VCVA 1US2A 2NZLA 3WMCA 4Y2WA 2W27A 1F6YA 1RV8A 1M41A 3WF3A 4CEUC 3SRDA 3WK2A 1V3JA 4B2DD 2QCDA 3MVIA 2Z28A 1QTWA 1Y5WA 2ZZ7A 4Z0JA 3OA5A 3H26A 1E56A 4Q32A 1VIZA 1EIBA 4JKKA 5DF0A 4L80A 3SI9A 3WD4A 5CJMA 4OWGA 1SJCA 1OT2A 1QRQA 3FGCA 4JXCA 1PE1A 4BKNA 3QMRA 1QI2A 3W2LA 1L2QA 2OMAA 3VIMA 4FA3A 5A2AA 1CXHA 1X96A 1GQJA 2BNJA 2E6DA 1UWUA 2XN0A 3E38A 2W6RA 4Y7EA 4E2BA 4CD7A 2GK1A 3AIVA 4U5IA 2G3NA 5I77A 4PCSA 3C0JA 1MW2A 5HNUA 3SEPA 4K37A 3PUOA 3H6OA 1WDWA 5FJJA 4LGXA 3VNZA 3KOWA 5E1QA 4H9MA 4A8NA 2WMIB 4WXYA 4C7FA 4FPSA 4QLKA 2ABAA 1UWRA 3HOJA 1RA5A 1PPIA 2Y85A 3GFZA 1TIWA 5D4YA 1U22A 3QV9A 4U33A 2ZUNA 4XZBA 2D2GA 4DY1A 1MZHA 2VHLA 3U8GA 1XD1A 3M0KA 2G3JA 3BXWA 1XXXA 1H1NA 2WJDA 3A4WA 4BS0A 4DUVA 1UR4A 4GISA 4EPEC 4RL3A 3GIYA 2DJXA 1V5XA 3SUVA 2Q8ZA 2ABBA 3BOXA 5A8MA 1JVNA 4HNVA 4YWSA 5K3VA 1XYBA 2QDEA 3S2LA 1CIUA 1IIHA 1EHNA 2QUNA 1V02E 4QXIA 4DM1A 2A3CA 4EP8C 2EPLX 3IK2A 2VP8A 2P50A 1AH3A 3BV7A 1F6KA 1PZ2A 4I9MA 1A5NC 4A05A 5H8UA 4MY8A 1QPKA 3O0FA 4Q8UA 3NQBA 1MUWA 2J4GA 4EWJA 5IM51 2F9RA 4NHVA 1LL6A 1OB0A 3QYQA 3UCQA 2VELA 1A3WA 3K8MA 3VIPA 1LORA 1FP8A 1G69A 4MB5A 3A12A 1OM0A 4WOQA 3IVUA 3LHTA 3AO0A 4QS6A 1SMAA 3WLSA 4GIYA 1J2WA 1EIXA 3IJ7A 3VTRA 4RPPA 4DHGA 2PDBA 1DV7A 3GU1A 3BGJA 1WO2A 5K7JA 3BOFA 3W6LA 5U4NA 3L4YA 3WK0A 2NSXA 2Z00A 3B8IA 4J28A 4LV4A 3KL0A 1R46A 3N2MA 2REQB 3W38A 4J3VA 3AXKA 2OKOA 4AZGA 3E12A 1G7VA 5M17A 3MJYA 3O6CA 4HGXA 4RW5A 3DUGA 4UR7A 5DY3A 3AUOA 5FJPA 4PMNA 1G4EA 1XBXA 4HMDA 3VOIA 2ZZ6A 2AL2B 4L9YA 3WFZA 2PWHA 4RUBA 3UJSA 2RGLA 4XKYB 4A22A 4PRTA 1W5MA 2FTWA 1O12A 3W53A 3N1AA 3SGGA 3L21A 3SURA 2REQA 2I14A 2PP3A 4IQJA 4HBKA 4YIWA 1CGXA 2D0HA 4Q4RA 1V7YA 2PGFA 1M04A 2Q6ZA 1RH9A 4JYFA 3UZ5A 1XCFA 3NQ2A 3WSUA 4JFUA 3RR1A 9CGTA 4RNJA 2AL2A 2TYSA 3W7MA 3W01A 3MDUA 4AW7A 4QGCA 4XKYA 5DFAA 1F9CA 3BOLA 3KRUA 1U1UA 2OX1A 3HGSA 1Z44A 5ABHA 1PIIA 3S46A 5C2CA 3FNDA 1ZUAX 5JIWA 4NUWA 3VA8A 2BHZA 4O17A 1UKSA 1UR2A 5CGQA 4DJEA 3DC0A 1SFLA 4PUMA 2PUZA 1WXJA 4C65A 3VK5A 4B91A 3G3DA 3SN4A 4B3LA 1RLCL 3T2PA 3EEZA 1CWYA 4PTVA 3TMLA 3D46A 4HTBA 4D2JA 3H7UA 3AQUA 1JF6A 2HEJA 2DP3A 4R7OA 4AMAA 3CUXA 4XK2A 3NZ1A 3D47A 4ERGA 3HG4A 1LDCA 3B97A 4YN5A 3AIRA 1DQUA 4PTWA 4XVDA 2OSWA 3NQAA 1YTDA 1VZWA 2WV8A 4O14A 3MHUA 3WEZA 3MYPA 2WWDA 4AWSA 1ITXA 1V93A 4DNHA 1WZAA 4UOQA 4Q8MA 2YGYA 4H8UA 4ADUA 3CO4A 3M64A 4UTMA 3VOGA 1EPVA 3QHMA 1G4SA 4DO5A 2D73A 4FMVA 4GZJA 1A3HA 3NG3A 4HPHA 4BI5A 1XLJA 5D9NA 1B57A 4DEFA 4U5KA 4UBPC 4QM1A 4AG0A 3RRAA 1S2WA 1J6PA 4R7WA 1E6QM 1QPRA 3DXIA 1UQYA 4OKDA 3BICA 1V0NA 3E02A 5ABEA 3KS6A 1UA7A 4JX6A 1Q2RA 1LTDA 4GG9A 3T0DA 1LL4A 4HK7A 3LCLA 3U57A 2QGYA 1A50A 3RPDA 3OBAA 4TMBA 3AOFA 3H55A 2XU2A 5T9CE 1VBJA 1FCVA 1SQ7A 4MFDA 2XIBA 4XX6A 3WD2A 4C60A 2VURA 1XRTA 2JALA 4LAMA 1V6TA 3NZGA 4CN1A 3MUZ1 1W3TA 5C6MA 1UHVA 1DXFA 2HE8A 3V5FA 2TODA 4KF1A 2OELA 4CU8A 5HK4A 1WUEA 3W7NA 2GQAA 4DF2A 5C0QA 4FS9A 1H2JA 1A5UA 4N9CA 1TPDA 1Z42A 1VBGA 2BXYA 1G01A 1ZP4A 2Y8VA 1MEWA 2DZVA 4RE3A 3LHUA 3UY7A 1V3HA 2ZC1A 5KZ6A 3W7RA 3I7QA 5C7HA 3UYCA 3MPGA 2D20A 4JD4A 5HJLA 3VKKA 2PTWA 3GW3A 1H1ZA 3W00A 1EEPA 2O55A 4P7OA 4BK9A 1PO9A 3C0QA 1ONXA 2YLLA 4DXXA 1TV5A 3GC4A 2OEKA 1F3TA 1OX4A 4U3CA 2X05A 5IHSA 2ZX6A 1PUDA 8XIAA 1TPC1 7CGTA 1XISA 3ABXA 4F0KA 1DIEA 3WMSA 2WZHA 4GINA 2BODX 4Q33A 4J40A 3WUGA 1TPFA 3AICA 2OQHA 2ZKMX 1A0EA 1U1JA 4Q6JA 2CFFA 3SECA 4QX4A 4U28A 4TUFA 4DBWA 2FZ8A 1L0PA 2R1LA 3OB8A 3W37A 5E9AA 1Q7MA 4J27A 3KBMA 3EXRA 4FNUA 1U83A 1OK4A 2IXVA 1PX8A 2YYTA 4KKXA 5MF5A 4Z2IA 5DMLA 1FH8A 1IR2A 4H9TA 1KB3A 1NP0A 1L2UA 4HIBA 3RPMA 4L1XA 1KM6A 1XLIA 4R5EA 4KT2A 1FWFC 1IHIA 2GGIA 3DHDA 3I7SA 1TX0A 1O5XA 4WRHA 3QGAC 2ON3A 2GSJA 1KBJA 2WC7A 3P67A 1RBLA 3O8AA 1AL7A 4CCZA 2NV9A 1R85A 1I6NA 2NQJA 3OGSA 3WUEA 2IKHA 1JULA 3MKKA 4PA8A 1ZNNA 2ODOA 2VJXA 1E9LA 1UMLA 1KBKA 3C86A 1RJRA 3RR4A 3NPVA 1TPWA 2J8FA 3N12A 3GVWA 3URQA 5G2WA 4F9DA 3WDRA 5HINA 1ZU8A 1EKOA 3U2CA 2OU4A 4MWAE 1MRQA 1IXQA 3GYEA 2XH0A 3GXDA 3MVTA 3DYPA 3TWAA 3WKZA 3PULA 4XAPA 3L23A 4MYAA 3G8EA 4Y9AA 3GNOA 1X6NA 4GWEA 3STGA 5DN1A 3LI0A 4GYFA 2MUCA 2ZOXA 2GSEA 3W72A 4HJFA 2PF0A 4UWMA 4RV8A 2BS9A 1BRLB 4O11A 4ILSA 1FVPA 5HR6A 2TMDA 5A6BD 3EOUA 2OEJA 3DERA 2ONEA 4JTTA 5BWFA 1S1RA 1K4GA 2YCIX 3E2VA 2O7QA 3ES8A 4KCTA 5LNSA 5AHEA 4OIFA 3GVVA 2QCCA 4GYPA 4W9TA 1LL7A 2P1FA 3QTGA 2VOMA 2WVTA 1O1ZA 4X2PA 1Q6DA 3CTTA 1EP3A 3TSDA 1BRLA 2NLYA 3WLNA 3PBUA 5IBXA 5G2IA 1AW1A 5G1MA 3SUWA 4H6RA 4AD2A 1MWOA 1XIBA 4H3DA 3N3TA 4IX2A 3QSRA 4EIVA 4KEZA 5LIXX 4E2VA 2FFIA 1YNQA 2EAWA 2E9LA 3OBKA 5A6AA 2XVKA 1U1HA 4PMJA 1E0WA 2XH7A 1NDWA 3ORWA 1C8VA 3TYZA 3TLLA 5EFFA 4XZHA 1LOQA 4AWUA 2GVYA 3HPAA 3PSVA 3KRZA 5FJTA 1QUMA 1JD7A 3W27A 4PC8A 5AYIA 2NT0A 1PEZA 1NP2A 2GL5A 2VWSA 5KITA 1KLZA 2VX7A 2X30A 1E9IA 5HQMA 1RA0A 2B81A 4UFJA 3C3NA 4XD6A 4K1WA 2YCJA 5CPTA 3RO6A 2UY3A 3SFKA 4WJEA 2VO5A 4QSFA 1ZAIA 3VUPA 3O6YX 4LT9A 1GGOA 1M7XA 2UY4A 3M44A 2HRWA 1IXPA 1DE6A 2VR4A 1YX1A 1PDZA 1DE5A 3LK6A 4MY1A 1Z7AA 2NQLA 4HSOA 1B31A 2UBPC 3WF0A 3I4EA 5DCDA 1XH0A 4W84A 4YTUA 3RYSA 3E5PA 2E1WA 1D9EA 1JZ3A 1CB2A 1VFHA 3M0MA 2O7SA 3I3DA 2Q01A 2PCEA 2W63A 4EACA 4O1FA 1CGTA 1XLDA 3WYZA 1TVLA 3ATYA 3ARUA 2FQIA 3W2UA 3NQGA 3IACA 1BPLB 2HS8A 4V1XA 4UZUA 4S3FA 3F2CA 1A5SA 4LFYA 3D3AA 1QATA 1GKQA 1WE5A 2J47A 4LCSA 4AUBA 2PDLA 1FWNA 4GIRA 2EPMX 4O50A 2ISDA 4TMCA 3LG3A 3NGFA 3GC2A 2PDWA 1Q8AA 3C4UA 3VD3A 3AROA 4GJJA 2R1KA 1W31A 2RH9A 3TQVA 1EYEA 1V3IA 1W1IE 3WIJA 3NEVA 4KIRA 5CC5A 4JX5A 1LWHA 5E0CA 4D6GA 3QPEA 1C7TA 4WX2A 4XZMX 3W7KA 2ACQA 1W5PA 2OYMA 1WDDA 3VILA 2E77A 5KZDA 1MQRA 5KSWA 3MSGA 1O94A 3OLGA 1VPYA 1YE6A 1QT1A 1UUQA 5LYRA 4UQEA 3P60A 1QW8A 3EOSA 4PR4A 3URBA 1BGGA 2UY2A 1WPCA 2QGHA 4M81A 1DIOA 4WGHA 5D9OA 4HTYA 4MIMA 1UKTA 1TPEA 2RDWA 5M5DA 3VIJA 1PV8A 4BI7A 2QVHA 5BXTA 5JBEA 3KP1A 2GDQA 4YPJA 1UR3M 3FLUA 1IQ8A 4LF1A 1CX9A 1HJVA 2CZDA 3UEQA 4P8UA 4IHCA 4GYKA 1M1BA 5CPLA 3OVPA 3HJEA 5D9MA 5AZ0A 1XICA 5A1AA 1MEIA 4ZSUA 3HMJG 4GCAA 1IIGA 4Z2JA 1QI4A 4L4MA 4IL2A 1V0LA 2Z1XA 4C6FA 4QG9A 2RDUA 4AHOA 3W28A 2Y5SA 2J13A 4GVFA 3EX3A 4F79A 3TYAA 1EEXA 4ERAA 1TRDA 3FN9A 2HXTA 2VGFA 1DPMA 2GVGA 1RXOB 1L6WA 3W3OA 1OIMA 2CU0A 3ECQA 2YB1A 2JE8A 4Q8QA 2Y62A 1B3VA 1LRQA 1E71M 2A6NA 3W75A 3BPWA 3VOJA 1UP0A 2P76A 1WNOA 4IXXA 2I7GA 3MZNA 5REQB 1JUBA 1TPB1 1XGEA 4DNMA 4I8DA 1KKRA 5DRIA 3LEPA 4BCEA 3NL2A 4X63A 1QPQA 1QBBA 2PTDA 3GXFA 2PGEA 1BVNP 2VGIA 3GDRA 4XB3A 1JF5A 1YTEA 2OX4A 3E96A 2O4MA 3KL3A 4O0KA 1XCXA 4XG1A 4G56A 3UQNA 3CTLA 3E0WA 2W67A 4XD3A 4UCGA 1C7SA 4IMCA 1UWSA 3ES7A 3NPWA 5REQA 1I2QA 1ZCCA 2WMJA 3FA5A 1NTHA 3EKZA 2F38A 5HWMA 3GU9A 1QK2A 1GCYA 2WBGA 1VHNA 4CCCA 1H7XA 8CGTA 4Q4MA 3LQLA 4IGMA 2GVJA 3VO0A 1FDZA 3WO8A 1H11A 3KTCA 5AOUA 4QDWA 1U5VA 4ERIA 1Q4NX 1KXHA 1R87A 1VEPA 3B9AA 1XRSA 1Q5MA 4ZQNA 4FXSA 1R7AA 3ID7A 2CITA 3O7UA 1UQZA 4WDUA 1JGIA 4GBUA 2F61A 4H41A 1QNPA 3A5FA 5A6JA 3S47A 1TJRA 5D38A 3TSMA 3N2XA 4A3HA 1Z3NA 1JDDA 4W8AA 1A3XA 1LZOA 4H9VA 1SYTA 1KM4A 4I9TA 1UJPA 3NO5A 3RX4A 7ODCA 1MQQA 1DJXA 1J4EA 4KW2A 3GXMA 3FDGA 3CHDA 3LCIA 3N73A 2NWSA 1NH6A 3VKCA 4H8NA 1RP9A 1TE6A 4WDWA 4OUIA 4D1JA 5DO8A 3F4DA 3GR4A 1W1PA 5BOEA 2ZX7A 1ZZMA 3GTNA 3N9RA 1Y8BA 2VFFA 4BR1A 1BSIA 4Y6GA 2OWXA 1X1NA 4WJ8A 4F3HA 2HMCA 1V51A 4US5A 4XZWA 1P7TA 5D02A 1QK0A 3VGHA 2ISSA 4M51A 5C54A 3CV6A 4JTSA 4INFA 1TPVA 5CPMA 1JPHA 3F1QA 2NUWA 1S2VA 3L2IA 3IGHX 4UNIA 3E2RA 4HJWA 2WJFA 1V0MA 1XKYA 4LBRA 4NJIA 3CL8A 3BMVA 1W9VA 5E6ZA 1XQKA 2QV4A 1E0VA 2C0HA 1R38A 3MO4A 3CEPA 3KTXA 2X41A 1XBVA 2WK2A 2R14A 4X9SA 3AHYA 3WQWA 4ZL1A 4Y9NA 3PFMA 4LTSA 4HPGA 1VPQA 2XIQA 1H09A 3GE7A 1IR1A 5CC3A 5DMMA 4HMEA 1KR0A 3PWAA 3CV1A 1QNRA 2BOFX 1UP3A 3EWXA 3OG3A 4KCWA 5JIPA 4HZ8A 3EOEA 2QULA 4GY7A 2VRQA 1ZP3A 3T44A 4HHMA 1SSDA 3C61A 3TC7A 4CN6A 2VEKA 2YKKA 3V18A 1KRAC 4CD6A 3DOPA 4H4IA 3S42A 3B0UX 1DXIA 1Q6EA 3OPSA 4LSBA 4FNQA 3A5VA 4Q8WA 1QU4A 1EHAA 4U31A 2XHYA 1SU5A 3O6DA 4FR6A 4G5DA 3CH9A 2ZRZA 2Q71A 3RFAA 4O8AA 3S3GA 3FVDA 3M9YA 1BXCA 2CLFA 3B06A 2GQ9A 3RIKA 4Z1BA 5EB8A 1B90A 5T9BG 5E6YA 2XUCA 3BLKA 4JICA 3D3FA 1RUSA 4HU0A 2WVVA 4MKNA 2GOKA 3RAOA 4Z1AA 1KQYA 3RILA 4HYWA 4BJHA 1UWIA 1YW1A 3RF9A 4GZIA 4F8XA 4QDMA 1ZJIA 4ZR8A 5EL1A 3Q4DA 2R91A 1GZGA 2R1NA 1C9DA 4UQBA 5AKQA 1SJAA 1D7KA 1UYQA 5CPSA 1VS1A 2EG8A 4PCPA 5B7ZA 3SADA 1F4HA 4IM4A 2A7PA 4IMEA 2WJEA 4E2DA 4M19A 1QOPA 2RGMA 4GC3A 4M82A 2W92A 4DWSA 1CXLA 3FHAA 3AMCA 4C6IA 2VZOA 3R10A 1YXYA 3LUTA 4AVOA 3CPGA 4MJMA 4DWDA 2WSKA 1L8PA 2AMGA 1R47A 1T0OA 4PCFA 2XINA 1WX0A 3IIOA 3KS5A 1YPIA 1GJPA 3ENLA 1EQCA 2E1DA 1BVWA 2PEVA 2BWGA 4L9ZA 4B9ZA 4JCLA 4CN4A 1H49A 2V68A 4WF7A 3U5UA 4NYYA 3LXCA 3MI3A 4AD5A 5BOOA 2BB0A 3TE9A 3O9NA 3R94A 2ZUUA 4IFKB 4IUOA 3AIBA 4QEHA 1K77A 3DGRA 2IKJA 2DT1A 3E5BA 4Z0SA 8RUCA 2CLHA 2FB2A 3N04A 3QPZA 1E73M 1X1ZA 2DT0A 3SCNA 1GOIA 5FOOA 1SO4A 1UH2A 3H2FA 4RNIA 4TR9A 3BH4A 2OGJA 1EJWC 4CNOA 2X0SA 4GO8A 1QW9A 1KCZA 4RDZA 5MKGB 3KVLA 3TJXA 4LS2A 1EFZA 2BVDA 3UXDA 3VXGA 4DPQA 5H6HA 4L6HA 3ZLFA 3RMEA 3V75A 4IFKA 1K9TA 2XYLA 2GUBA 3IRDA 5H2ZA 1SW0A 1T7LA 1VCFA 3BLOA 3HZ3A 4BQ5A 1CZ1A 3H2EA 5FL0A 5IOBA 4HOXA 1SW7A 1BVZA 2PGWA 4Q4PA 2ZX5A 5D8WA 3U7BA 1VBRA 2V8ZA 5MKGA 1H61A 4BQ4A 4WY0F 1NFPA 4Q4OA 3UNTA 4K8HA 3Q45A 3CB8A 3DHFA 2D0GA 2CLOA 4DZHA 1JZ8A 1RQBA 2Z2AA 2WWCA 3FAWA 4K8GA 4YTRA 1O60A 1TR1A 3O06A 3T78A 2V3GA 3T08A 5K4ZA 4GJ1A 1H63A 4BQ2A 1TWIA 3E0VA 9XIAA 1BKSA 1PKNA 4N4QA 1Q6LA 1A5BA 2HDJA 5RUBA 2WMKA 1PJ9A 2Y70A 1CW2A 3H23A 4AXKA 4FF7A 4OFCA 1RD5A 4PMQA 4TO8A 4AZHA 4CD4A 3MSYA 2WHKA 4IMGA 5AYXA 3VCRA 2YW3A 3CLWA 4F0SA 2G8ZA 3EMZA 2QDGA 4NZ1A 1CCWB 2XPKA 2D3NA 1XM3A 4IP7A 3HPSA 3T1GA 2X0HA 4E2OA 2D22A 4IJCA 3ARYA 3B9DA 1XC4A 2C0AA 2YCLB 2W0UA 4IG2B 4PMVA 1QHZA 2X0YA 2J8GA 5A2BA 4YYCA 2E5BA 8A3HA 2W3ZA 3DI0A 5F2GA 3W7CA 4RXFA 1JFXA 1F6PA 1GOKA 1HKMA 4B5TA 1O6IA 1E43A 1AZ1A 3FX4A 3N4AA 4HNCA 3THQA 2YCLA 2C1HA 1JXJA 4IG2A 4H9XA 5AB3A 3C2VA 1YRRA 4NKCA 5LZLA 1FY6A 3M41A 7XIMA 4DBEA 4KIEA 4C6NA 2A3LA 3P7YA 1S2CA 4B5XA 1I8JA 3B03A 7ENLA 4TVCA 1QPNA 4C6LA 3WNPA 1AK5A 3IUDA 3KWSA 3UR5A 3W76A 4HK5A 3F2BA 1GVFA 1P0NA 2PSNA 4YVVA 1J9YA 4B16A 3NXFA 4E3VA 5AC8A 3KE0A 2NXIA 3B8UA 1TMQA 2OZ3A 4YTSA 3DX5A 5T26A 4NZCA 2DW7A 1IGWA 3EWZA 3W7OA 4KRTA 2EHHA 5LSMA 4U3AA 1R9XA 2QJIA 1GW1A 2XIJA 1GZ1A 3UZYA 2XM2A 3NDOA 4DF0A 2FHCA 3OYZA 3QV7A 4YVPA 4I9AA 1B54A 3AU2A 5K9CA 1GOMA 4UMBA 2PZ0A 2YR1A 4YHGA 3C6CA 3KRBA 3FYYA 1XYAA 3ABQA 4Y9PA 2PTXA 4AD0A 1W9DM 4N0RA 3PZTA 3W1NA 3GTXA 3W9ZA 2GZXA 3FEQA 3POCA 4G9PA 4AC1X 1F3WA 1H7PA 3IVSA 2BHUA 1WCGA 4I5XA 4DZIA 3VDBA 3S1WA 4MTVA 1XRVA 5CGMA 4RZ4A 1ME8A 2A4AA 3PSWA 5G4WA 4LUTB 3RK8A 2X09A 4C90A 1QHPA 4F40A 1EJXC 1M03A 2Z1KA 4B5WA 2ALRA 2F6UA 3NA8A 2VEIA 1E6NA 4LYRA 2YL6A 3B0PA 3WH9A 4KH2A 2OKTA 5FSDC 1JDEA 4WSHA 3WG6A 4A8IA 3ZT6A 2OSYA 3NQFA 2YBUA 5JVLA 3NZPA 4DELA 5LIWX 1IV8A 4LUTA 4NZ4A 3F4VA 3PVFA 3GAKA 3R6IA 2OSXA 4KQNA 1B4EA 4DO6A 2GGJA 3QY7A 3O6AA 5G1YA 1SUXA 1EGMA 3UBPC 2VC9A 1AD1A 1J11A 4Z2KA 3RDKA 2IKGA 3CC1A 3VVGA 5BRPA 3MMWA 3ARWA 1FA2A 1DTUA 3OEXA 2Y7GA 2QS8A 1LM1A 3OW1A 4JN7A 1U2YA 1O5KA 2NQ9A 1NOWA 5CH9A 4Q7NA 3BLLA 4AHPA 3LM3A 2WAGA 5DCBA 1VJIA 4UTLA 1DJWA 3CQJA 1EQPA 4Z1CA 1G67A 2V5KA 5D05A 1WDQA 3BQ6A 4J9JA 1KM5A 4AFYA 5I78A 1C91A 3W4RA 1DJHA 1QHOA 3WLPA 5KETA 1MRAA 2VD8A 2AAMA 1H41A 5H8PA 1OC6A 3MV11 4GABA 4G7EB 2PWDA 3KTSA 1KFCA 5I02A 1KGWA 3PR2A 2VQUA 5FEPA 1EP1A 3EX6A 1A5CA 3CM4A 3BCFA 1WXZA 4G7FA 4JQ1A 3UXLA 2HE5A 2FDSA 1E40A 3QLLA 3O0KA 3WQOA 1J0IA 1EDTA 3PF3A 3CZGA 1EWDA 1HGWA 3N34A 1N2VA 2HVMA 4XTIA 2UZ9A 3PN8A 1OFQA 1ZGDA 2PURA 2GQ8A 4BA0A 4JN8A 4JNZA 3PBGA 5D04C 1XH2A 2WLYA 4G7EA 3F4CA 5C7VA 3TN6A 1UZHA 4JHZA 3OQ8A 4AZIA 2FVMA 3HGOA 1EXPA 4HHPA 3DKJA 3TYDA 3TW7A 2AMXA 3BDKA 5H91A 1B0IA 1Q6FA 1JUEA 1MDLA 3KLKA 2BHYA 1HQTA 2WW5A 3ALGA 4PMDA 4AZCB 3BMWA 3QQWA 1PCKA 3VKJA 3UJ2A 4IISA 2D24A 3UPBA 1MQPA 2D0FA 2VCBA 2R6OA 4RR4A 5C2XA 3DBNA 5D2WA 5KINA 3GNNA 2YL9A 1FHDA 1WKYA 3W2KA 2PB1A 5HBFA 2YLAA 2P5NA 3ATZA 4AZCA 3TSBA 2FZBA 3WQVA 4O13A 1NDYA 3NIYA 4RX0A 1TQXA 4DF1A 5F1UA 2X7WA 3KDNA 3IEBA 1PIGA 3MHFA 4LAUA 4KS0A 3C2YA 4C1LA 5AY7A 5K9DA 3LENA 3APGA 2OO0A 2DVUA 4N02A 4TVUA 1LOSA 5I3KA 3C2OA 4UOJA 4X9YA 1VAHA 3V5CA 3ME3A 3H21A 1W8SA 2DUAA 3GH7A 2ZQ0A 4QE4A 3B0VC