3NQVA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r5 7/4a
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
249
structure length
246
Chain Sequence
LKASSLRALKLMHLATDDTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTPGKVAEGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADSRHYAFGASSSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
total genus 96
structure length 246
sequence length 249
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqvA00
3NQVA 2C3ZA 1PVNA 1XC4A 4FNUA 4HPJA 4UXDA 1LTDA 2EPHA 1H7PA 4K7YA 4OHQA 2C15A 4QIUA 3R89A 4EOUA 3LI1A 3U6WA 4ADTA 5D09A 1LORA 4PL1A 4GBUA 1Q6QA 3D0CA 4HT3A 3M0ZA 4K39A 1PCKA 3NM1A 1WYIA 2QCHA 5FEZA 3S5NA 2XN2A 4UUIA 1TMHA 3DBPA 2ZRVA 1WAUA 3B4UA 1XBYA 3GZ3A 3VCRA 2G97A 4M6PA 3LM7A 2W6RA 4N9CA 3W1UA 4L4MA 3CIXA 4DO6A 3MHUA 2EAWA 3LCHA 4E38A 4NXSA 3MI2A 1JRCA 2TRSA 4L4LA 1YYAA 1PE1A 2PE4A 2QR6A 1N7KA 2ZRUA 1FWTA 3W7KA 5HNRA 3EKLA 3O07A 1F2JA 1LCOA 1YADA 4YMZA 1VH7A 2QCEA 3P8JA 3HGRA 1KTNA 4LY8A 3TA6A 4NNCA 3PBWA 1ZCOA 3HG2A 5IBXA 4JEQA 1BWKA 1RQBA 4IX2A 1TPVA 4GE8A 3L5AA 4MFEA 3MI3A 4DEFA 1K7FA 1C29A 4LUIA 5LGXA 1W5QA 3INPA 1EIXA 5C54A 4M6VA 2FPTA 1RQHA 4AVFA 2XN1A 3B0VC 1ONRA 3W6YA 4DXVA 5SWUA 3L67A 3TQ0A 2Y6ZA 2ALDA 2RH9A 1ZJIA 3QYQA 1TYGA 3M7WA 4IQLA 3RLVA 3P74A 3TSBA 4DO5A 1A5SA 3IGSA 2CW6A 3WK0A 2CLHA 1OJXA 2ZZ3A 3PB2A 1OFQA 2H3DA 1LBMA 3NQMA 5GVJA 1VHNA 3IIPA 4OWGA 3M5XA 4JYDA 4RK8A 1TPFA 5E93A 5AYXA 3C8FA 1KFJA 3W1MA 3LOTA 2NUWA 1OK6A 3LTYA 2Z1BA 4O4WA 3BV4A 4K36A 1MEHA 3HQ1A 1OFPA 2OT0A 1JCYA 1IXPA 4O17A 4JICA 2YW4A 1TPUA 1OFAA 2PRMA 3NGJA 3I6RA 4IPJA 4BWLC 1Q6LA 4RZ4A 3R5EA 1W5NA 2VKZG 4X9SA 1JCNA 3E12A 4ZZ9A 1OF8A 3FJLA 4MZ1A 3OEXA 2UV8G 4CQAA 4JTSA 3NAVA 4XTDA 2PRLA 4UTWA 2JKPA 3WK2A 2A6LA 3ZR4A 1WOAA 5EKYA 1NSJA 1GTEA 4JTEA 5HWJA 1F7BA 4CLMA 4LV4A 1RPXA 5DCEA 2X1SA 1SSGA 2CLOA 1R30A 1SW0A 4WOZA 5AHIA 4UFHA 4NVTA 5E1QA 2GUUA 3BG9A 4MVAA 3G1VA 1OFRA 4IMFA 1JUBA 2J9ZA 2V5BA 2Q3OA 2W79A 2QJHA 4YWIA 5KZEA 2E68A 5EL1A 3NQFA 1KLZA 1HG3A 1FCVA 3NA8A 3W22A 3ANYA 2ZDRA 1NF7A 1AG1O 4UTIA 5G1TA 3UQNA 2FTPA 4OV4A 1WDWA 3KVJA 3QM3A 4Z1AA 4QITA 1IGSA 4LVBA 3Q37A 1GVFA 1RZMA 3IGUA 3CM4A 3KOFA 5J5DA 1OYAA 3SZ8A 3CLMA 3TFXA 3LBMA 3SR7A 1A5CA 1B9BA 3TX9A 2Z0IA 4HSOA 1W3IA 4CCEA 3N2XA 4KKXA 2QCDB 1DHPA 1EWDA 3RLUA 3TNOA 2C14A 3NVTA 3G3MA 3C2FA 4DF1A 3F4WA 5AC6A 4ADUA 4M7SA 2VENA 1Q45A 4UTHA 4O52A 3VI2A 2YPIA 5D03A 1UCWA 2CWNA 2PCQA 4MUZA 1JUKA 1GVOA 5BOOA 3FLUA 1KBIA 3Q58A 3TE9A 3S5OA 3HB9A 3LHZA 1EP2A 1FXQA 5DBUA 3IVTA 3M5ZA 5D32A 1P5BA 3NOEA 1ME8A 1N55A 4AWUA 4HNNA 5I3FA 3LCGA 2PC4A 3FIGA 5J5RA 3EWBX 3S0CA 2QEZA 4JTIA 3N2MA 4NX5A 1QMLA 1TTQA 4TMBA 2EKCA 3G1AA 1K7EA 3LHYA 3NDOA 3W7LA 2OZ0A 1YTEA 3CWNA 5AYZA 1TPDA 3OA3A 3MYPA 1AW2A 5BNKA 4ONVA 3W7HA 4UTLA 1XBVA 1YLVA 4MZ8A 1VCGA 3OVPA 4ML9A 1F6KA 5G2HA 3STFA 3TW7A 3ZS4A 1W37A 1PCWA 3NG3A 4DF0A 4NZJA 2NUYA 1QOPA 2V81A 2NZLA 3BO9A 5FF7A 3G8EA 1SW3A 2GVGA 3W1RA 3VKJA 5F4WA 1VJIA 3QH2A 5TIMA 2YFOA 2FLIA 1F05A 3NL3A 4WOQA 1OX6A 5H91A 2J6XA 2NXHA 1EUAA 1KV5A 2R14A 3TJXA 2EGZA 3PG8A 3WJXA 3F4NA 3PR2A 4OU1A 1XXXA 4Q4KA 1VS1A 4MLJA 2RDTA 2HS6A 1QFEA 4UNKA 5D05A 2NXIA 3W1PA 1OG0A 3PBYA 3SGUA 4A3UA 2WNQA 2X2GA 2ZYFA 3MP3A 4KWVA 1T99A 4YCOA 1GTHA 1AMKA 2Y61A 4FNRA 1L6SA 1H63A 4Z0JA 4OBTA 3HJZA 1IIHA 2CLEA 4LTSA 3O06A 5F1UA 2QCCA 1A50A 1VC4A 4CNPA 2YZRA 3WK3A 1K03A 5G2IA 4N4QA 1Q6RA 3GAKA 2CLLA 3RF9A 1Z41A 5F2MA 3SJ3A 1GG0A 4AMAA 4JTGA 3PWAA 4FF7A 4WY0B 3QW4B 3NQ8A 3C61A 3RK8A 1CW2A 1WBJA 3N9SA 3BVJA 3HO8A 2BXVA 2AQWA 2P0OA 3SW6A 3NZ1A 1JUEA 3ABSA 3EX3A 1SO5A 3W7CA 5KITA 4YLWA 3TKFA 2Y85A 2RFGA 3L2IA 2DZTA 3TH6A 3BG3A 2ZQ0A 3NPVA 4FNTA 1TPC1 4O4VA 5LKYA 4JS3A 3L5MA 1SO3A 3ELFA 4AF0B 3WFAA 1XI3A 5IM51 3L0NA 4QJ1A 5HUPA 1M6JA 4BF9A 1PL9A 3M5YA 1VYPX 1K3UA 5AHFA 1L2UA 2GJNA 2NV1A 4BI5A 4Y96A 2VFIA 3P84A 4FEZA 3DKJA 4S1FA 4MIMA 3W1XA 3QSRA 3T40A 1TO3A 3HOJA 3KVKA 3HF3A 3M43A 1SQ7A 4R34A 4I7UA 1PHWA 3UD6A 1DV7A 2ZZ4A 1SFJA 4HIBA 5CPOA 1FY6A 5HR6A 3DAQA 2Y7GA 1FX6A 3P67A 3LXCA 4RX0A 2Y62A 4O10A 4FO4A 1IF2A 2VXNA 3GK0A 2NX9A 3G0UA 4JTJA 5I3JA 3KXQA 1FDYA 4LC8A 3HG5A 4RXGA 4DPPA 3LX9A 1Q6OA 1SZEA 1ZENA 4UMBA 4R7JA 1LBFA 3UWVA 3GDLA 4E2BA 1TQJA 2X1UA 4N6FA 1SO4A 1TIMA 4A21A 4S2CA 1KM0A 4K8EA 4XKYA 4WY0F 4QSHA 4HSNA 4AF0A 2H3BA 5AC7A 3CPRA 4WQ6A 2H6RA 2BSLA 4U4MA 1A53A 5FI8A 2YX0A 2V82A 4ZQOA 5AOUA 3F1QA 1JCMP 3BLIA 4RZ5A 3M6YA 3I7QA 4Y9AA 3FS2A 1MZHA 2R8WA 3O63A 4GXMA 3W70A 4O1BA 1VPXA 4C1LA 3EWUA 1YDVA 4IX0A 4UFKA 1B4KA 1C9DA 4Q33A 5CG7A 3UXAA 1I45A 3ATYA 5DCDA 1B4EA 3GXPA 3C3NA 3LRMA 4FIRA 3WK1A 3U2OA 1HL2A 5LZLA 4ICNA 1TTPA 1UASA 4LU0A 4LVGA 4JYEA 3NM3A 1G7UA 4O8RA 4O50A 2JKAA 4PH6A 4IUOA 1BKSA 1IXNA 3EWYA 1XBXA 2D73A 1GVQA 1NEYA 1LZOA 4JDBA 1ME9A 4JD4A 4GC4A 1EP1A 4HNTA 1W56A 4XTIA 3GXNA 2FJKA 3NZRA 4NJIA 1OHLA 4MFDA 1AW1A 1W31A 2J24A 3UZJA 3C6CA 2C13A 2E5DA 3W1LA 2C18A 2KZHA 3HGJA 2C0AA 1FWWA 1G6CA 3IIOA 4QQ3A 3TCEA 5LNSA 1VCFA 5DY2A 2A1YA 4ZQCA 3T7VA 3TJLA 4E0CA 4NU7A 4O1AA 4PCFA 1TQXA 3DU0A 2ISSA 1KTBA 1I2NA 1I2RA 2WSRA 2A7NA 3R12A 1ZAJA 5DXYA 1X7FA 3PUOA 4XQ6A 4WXZA 3QFEA 1QDSA 1V5XA 3ABRA 3I65A 1H62A 4H6KA 3M16A 1TV7A 3MYOA 4O12A 3YPIA 1QPNA 3DGRA 1T8XA 5HINA 1XFBA 2FPVA 1PIIA 3EX2A 4UR8A 1IXQA 4J9JA 3QEZA 5G1YA 2A85A 2AAMA 5D37A 4NX0A 4Z1BA 2TSYA 1I2QA 5FEXA 2J9XA 2HMCA 4LNYA 4YXGA 3BW4A 3P8IA 2Y89A 3QW3A 3CT7A 5KZMA 1YXYA 3QQ1A 4UC5A 4C1KA 3PG9A 2BZNA 2G95A 3BGGA 3UXDA 5DN1A 2QAPA 3H54A 2OX1A 1L9WA 1FBAA 3SIZA 2NX3A 3BK0A 1WOBA 1I2OA 4K6AA 1LLZA 1TTIA 4DF2A 3K30A 4JTTA 3CB8A 2QJIA 4NQ1A 5F1VA 3P82A 1VGAA 1UJPA 3R13A 1KM1A 1TPEA 3BG5A 3P61A 3RNDA 5I3KA 3DZ1A 5F2IA 2F84A 4DBEA 3N9RA 4UMAA 4LT9A 4IXXA 3CWOX 4NXKA 4MLRA 3PM6A 3DFNA 1SPQA 4WY0A 4LS2A 5T26A 4IOTA 1QO5A 3NPWA 5DELA 3G3DA 1S5TA 2G96A 2TYSA 1V7YA 2ZTJA 2EHHA 1J2WA 5U4NA 1MEIA 5D2TA 2A4AA 2QCMA 5D2YA 1AW5A 1CI1A 3ZWTA 3OG3A 3W7GA 4QM1A 5HQEA 2NXGA 3P5ZA 4N9DA 3MJYA 1ICQA 4HNUA 4AHQA 2YFNA 1MO0A 4IMEA 3O15A 1GYNA 2I14A 4DBDA 4JY9A 2NV2A 1EWEA 1TJPA 2FB2A 3M44A 1RQEA 2C19A 1FWRA 2A21A 1H51A 4NNBA 3S1VA 5AHEA 3W7RA 1B57A 4QAIA 1SR9A 3LRKA 2Q8LA 5K4XA 3W2NA 1UUOA 1FDZA 4NJHA 2H8XA 4GUFA 2E6DA 3AJXA 5BMWA 3MMTA 4JX4A 2VFHA 1DQXA 1LOQA 2GQ9A 3IV3A 3M41A 3W71A 2JK2A 2VFGA 5CZSA 3QMRA 5G2WA 3B8DA 3A22A 2QCFA 2YR1A 3A5VA 5AHNA 1XCFA 1B3OA 1L6WA 3G24A 3UZ5A 1TREA 2DORA 2NX1A 2W0UA 3O1NA 3QPYA 2RDUA 4WXYA 1O4UA 3NQAA 3QMSA 1BWLA 1OX4B 2TPSA 6ALDA 5D2VA 1ZAIA 1FCBA 4UTKA 5CZTA 2CZDA 1SO6A 3W84A 1RV8A 5MHBA 2VEKA 3W7OA 2FQIA 4X22A 3FA5A 3EWWA 2YXGA 3TU9A 2E5BA 1AK5A 1IIGA 2BX7A 2E1DA 1YXDA 3G1XA 4O18A 3G22A 3IVSA 5C6MA 3NPXA 4O0KA 3WJYA 1O5XA 2A5HA 4GUGA 2ZRWA 5AHLA 4LOCA 3O6CA 4X2RA 1QOQA 3C2EA 4FXSA 5U7SA 3SECA 3W7DA 3W9ZA 3L21A 3ABQA 3L5LA 4MY1A 3G0SA 3FYOA 1W54A 3TR2A 2QUUA 1YPIA 1P0NA 1KFKA 3ZWSA 5KMYA 2Y7EA 4YL2A 1VLWA 3LHUA 2VFDA 2ZBTA 3DXIA 4IJBA 3KAOA 3LERA 1NVMA 3S42A 1S3HA 2V5LA 3DFTA 1TJRA 2ZRYA 4KFNA 3N3MA 3LCLA 1KM2A 2QCDA 5E0KA 4O0ZA 4O28A 4RV8A 3CIWA 2ATSA 3C2RA 4N9BA 3H55A 3MW7A 4IWWA 3FKRA 3W7IA 4YCPA 4GRSA 1TB3A 5BW6A 3TROA 3PB0A 3O8AA 4CQ8A 1R46A 3CQ0A 2ZRXA 4Z08A 2IQTA 3VFLA 3UWQA 3JS3A 4EVZA 3A21A 2VC6A 2CU0A 2GOUA 4FXRA 2BLEA 4ZVJA 1JQVA 1QPRA 1H7NA 2RKXA 1TRDA 2EF9A 2V2HA 1M5WA 4BFAA 4LUJA 5IBXC 2VEMA 3I68A 3NQEA 2Z6IA 4R53A 3OVRA 3M9YA 1F6PA 1N8FA 2Q8ZA 3B06A 3E9AA 1HO4A 1G4EA 2X1RA 5KZDA 4HNVA 4JX6A 4N9EA 3W1AA 1ICSA 3O16A 1BEUA 3A9IA 4O54A 3C2OA 3PUEA 4CNNA 4UTUA 5LHEA 2WV8A 4BI7A 3SGZA 4EF8A 4FNSA 4MPQA 4O1CA 1O95A 1Q3NA 3W2KA 3DFSA 2C16A 2B7QA 3G1DA 3NQCA 1FWSA 2OT1A 2TMDA 3TMLA 4BI6A 3DFPA 1EEPA 3DI0A 2WQPA 1J4EA 2GJLA 2ABAA 3MP5A 4MKNA 3GYEA 1ZAHA 1NAL1 4LVDA 3STEA 1IXOA 1LYXA 4FNQA 2WNZA 4H3DA 4O15A 5HULA 5CKSA 1ICPA 3NEVA 1KM5A 3G1FA 2B7NA 5EYWA 1OABA 3OHIA 2OCZA 4O14A 3TIMA 2CFFA 3PY2A 5DLCA 5F4XA 1H7OA 3M47A 2HSAA 4KFPA 4G1KA 5K3VA 1ME7A 3NQGA 3G18A 4PFMA 5ABTA 3G8RA 3IEBA 2X1TA 5A8GA 5G4WA 2WOQA 2E09A 3HPXA 3PS7A 3GDKA 3NQ7A 4RXFA 1EA0A 3W7EA 1HO1A 4Y90A 1J5TA 2QJGA 4AHPA 1H1ZA 4GJ1A 3W7NA 1KW1A 1S5WA 3EKZA 3LDVA 1T0OA 4HKPA 3VE7A 1Z48A 4OT7A 2E77A 3N34A 4IXHA 1H60A 3TAKA 2QDGA 1K8YA 4XBSA 1MXSA 4Z1DA 3W75A 5FESA 6TIMA 4ZQPA 3M5VA 4Q32A 1OVDA 5L6UA 3THQA 1FCUA 1K7XA 2PRHA 3T78A 2ZZ2A 4ZMGA 1GOXA 5EPDA 3P80A 3DHDA 4MY8A 4QNWA 3FKKA 1UB3A 5FF0A 3TMQA 1KBJA 4JTFA 3HMJG 4JIPA 5HJLA 3HG4A 3T44A 2RHGA 1OFBA 3A24A 3BARA 5HWMA 1YDNA 3H53A 4MYAA 4NJKA 4WUIA 4NJGA 1FDJA 3LCXA 3ABOA 2CLIA 1W8SA 3W2LA 2OJPA 4ADSA 1X6UA 1SUXA 5D04C 1W0MA 2CZFA 4HHPA 3KVMA 3WJWA 1KM3A 4BWLA 3HBLA 5TQLA 4JR5A 3R8RA 1WV2A 2JKEA 4LW7A 5D2WA 4UR7A 5CPLA 4RR4A 1G4TA 3P5YA 4OGZA 3MO7A 2B7PA 2WSQA 2YW3A 4GWEA 3LHWA 3NYZA 4IGHA 1W3NA 3G0XA 4TU1A 4AB4A 1EX5A 2B4GA 3TC6A 1VYRA 2QCNA 3M1ZA 2JGYA 3MBDA 4K37A 1A5BA 3L66A 2Y7FA 2VFFA 3GAYA 1Z42A 5DY3A 4K7VA 2GVJA 3NQ6A 4O19A 1DORA 1WQ5A 2R91A 1W5MA 1JQXA 1M7OA 2WJZA 3A5FA 5EBUA 1JCLA 4MJMA 1LP6A 3OVQA 3S9YA 3FYPA 4GNJA 5I3HA 3Q2DA 1P4CA 4CCDA 2R94A 5LNRA 3UY8A 2CZ5A 2E5CA 4POCA 4I7WA 1QAPA 4HN4A 1GJPA 3EWZA 4PEKA 5F2LA 2ZZ6A 1O5KA 3GDRA 2ZTKA 2FFCA 4JGDA 4UCGA 3SY5A 4AHOA 1G67A 1Y0EA 2I1OA 3C56A 1X8FA 3L0KA 1K02A 2DZSA 3B05A 4LRTA 5H2ZA 5CSSA 4Z1CA 3C0JA 4UMCA 4A2SA 2AGKA 4MOZA 4U28A 3TAOA 2P1FA 1D3GA 5CZJA 1ADOA 5LSMA 1LRQA 3BLFA 3CTLA 3IGXA 1GVSA 1QNVA 2A7PA 3EXSA 4S2BA 2Z6JA 4XBKA 1FCQA 3S1XA 2VELA 3UWWA 2QCLA 1TPWA 4JNMA 1KM6A 1SZFA 3UPWA 3G1SA 2C6QA 2H8ZA 4UTWC 5EY5A 2CLKA 3OBKA 3UY7A 4PA8A 1HTIA 4KFOA 5HMSA 4XZ9A 3PSWA 3GVGA 1EB3A 3QF0A 4JX5A 2V8ZA 4JTHA 3TW6A 5C2XA 1SSDA 3I7RA 3LV5A 4JN6A 4A29A 1LROA 3GDMA 3PUDA 3DENA 2CLFA 1DQWA 1WA3A 1F73A 1I2PA 1WBHA 4PL2A 1H7XA 3RU6A 3W1NA 3LCFA 3V1PA 5G4EA 2J9YA 3AO0A 3VE9A 2ABBA 4ORIA 1K8XA 1G4PA 3IIVA 2V30A 5F4SA 1QPOA 4X3ZA 2WSYA 2A7RA 2VFEA 3T4CA 5K9CA 3E49A 3KRSA 4K38A 2NLIA 2GVLA 4MZYA 3E0IA 4XUGA 1XKYA 3TV8A 2WKJA 1QR7A 5DXXA 1TV8A 1QPQA 2VOMA 4NJJA 4GFSA 1ZHAA 2YCEA 1OFDA 3VNDA 3QZEA 2LLEA 3EB2A 5FF3A 3WJZA 3W7MA 4AWTA 5K7JA 5AC8A 3JRKA 3MP4A 1G4SA 3N73A 3JR2A 4DPQA 2QAFA 5K9DA 1LRNA 1KTCA 1EPXA 1HUVA 3W1QA 5CGQA 3KVLA 4TMCA 4LWWA 3W2JA 4NUWA 3W76A 3BW2A 3MWAA 1C8VA 1U83A 4N02A 2CZEA 2DZWA 4ZL1A 3NQDA 3B03A 3PF3A 1DKWA 4D2JA 1NF0A 3TSMA 2Q3RA 2WPBA 5FF2A 1FQ0A 2ISVA 2ISWA 3TFCA 3DHFA 2Y7DA 3GIYA 1FWNA 1GPWA 1PS9A 1JRBA 1I4NA 1KV8A 5L9FA 2X30A 4N2YA 1DOSA 3EXRA 3I7SA 4M6QA 3SSJA 4FHAA 3V75A 4JXCA 1P0KA 1Z44A 2ZZ7A 2Y70A 4RZ6A 2YYUA 2P10A 4LVAA 4H4IA 1VZWA 4HPXA 4E2DA 4O16A 3SI9A 4Z0SA 4GUIA 1JR1A 1W3TA 4IMDA 4UTTC 2QCGA 2Y63A 4BR1A 3FOKA 4UTMA 1KFBA 4UFJA 1ZNNA 3W86A 4TIMA 2XN0A 1OYCA 3UWUA 1ML1A 4IMGA 1K8ZA 2A2IA 3FEMA 4AEOA 3W2UA 3KX6A 1E51A 3GR7A 1DJNA 5I3GA 3PULA 5C55A 1P1XA 2WNNA 2ATMA 5CPNA 4B5NA 2QF7A 3A23A 1DJQA 3QPZA 4OV9A 2QDHA 4NNAA 3ATZA 3HPZA 2ZA2A 1RVGA 4OQVA 4TR9A 4NZFA 2E6YA 3QMTA 1I8JA 5TBOA 5G5IA 3TDFA 2GQAA 3HPSA 1G7VA 5HWNA 3EX6A 1X1OA 3UNDA 1TPH1 3LLFA 1GVRA 1HFBA 1O94A 3LCIA 3GNDA 3W87A 2C1HA 5K9XA 4QISA 4I7VA 3W2MA 1QWGA 3MHGA 3LCWA 3NL5A 2FIQA 4FIQA 4R33A 4ZQRA 3NXFA 2QKFA 4JTUA 3GLCA 1F5ZA 1GG1A 1JULA 2VEIA 3N19B 4AAJA 3LGEA 4M19A 4WD0A 3W07A 2F7FA 3EX4A 2RDWA 4M5PA 3O05A 1VLIA 3U8GA 2ZZ5A 2DZUA 1KA9F 4LV9A 1GZGA 1M7PA 3R2GA 1LRTA 2DP3A 5CSRA 1WXJA 1JJKA 3IIZA 4PTNA 3OIXA 3LTPA 3B0PA 4WJEA 5A5WA 5D33A 1H7RA 4A2RA 2VEPA 1X1ZA 4FX8A 1OX5A 3HGSA 4QNEA 4AH7A 2ZA1A 1LM1A 4CCCA 1TSIA 1XL9A 3LB0A 1GEQA 1AL7A 4WZHA 3LI0A 2BWGA 3BW3A 1TRIA 3W7PA 5BMXA 5LNWA 2PURA 1W5OA 2O7SA 5FEWA 3SFKA 1GWJA 2DZVA 3IVUA 1BTMA 4N4PA 5LHFA 3LXAA 3W3OA 3W7QA 4AWSA 4N6EA 1SFLA 2X16A 4EWND 2DU2A 5CZ0A 3T55A 1S5VA 3NL6A 5K2ZA 5D02A 1DL3A 3LXBA 2FDSA 2FPYA 2G5WA 4JYFA 2Z2UA 4PODA 3S5ZA 1JCXA 4FB7A 4Y6GA 2WO5A 4UFIA 4O53A 4O57A 1QCWA 3EEGA 3O6YX 4M7TA 3DH7A 3W72A 5AFDA 4XKYB 1SU5A 3PVFA 1OX4A 1CX9A 1YTKA 1R2SA 1H50A 3F03K 3GDTA 4MYXA 2YSWA 3G1HA 1THFD 4LS0A 4O1DA 1UBSA 2QUVA 3QJAA 2V2CA 1L6YA 1QO2A 4BK9A 2DZXA 3KFTA 4PC8A 3QQ0A 5D38A 3QSTA 1VRDA 4LVFA 3LV6A 1D9EA 4IPIA 3GX9A 3TQVA 1ZY9A 2ZA3A 4LS1A 3P62A 5D2XA 4P61A 2DJXA 2ZRZA 2A0NA 3W1TA 4O11A 2NUXA 1DVJA 4JTKA 3W7JA 3S8HA 3IIXA 3E02A 1ALDA 1YTDA 2V9DA 3WJSA 5LNUA 3DFOA 1KM4A 3QC3A 3MI6A 3LRLA 4ALDA 5HR7A 1XDMA 5F2GA 2YYTA 1ZALA 3W23A 3P60A 5KSWA 4DELA 1U5JA 1GQNA 1NFBA 3RFAA 3PBUA 2FB3A 4IMCA 1D3HA 1MSSA 3KRUA 4O13A 2H90A 3GKFA 3HIJA 1EP3A 1W5PA 8TIMA 5HUOA 3KRZA 2O7QA 4JY8A 2YDAA 5KINA 1KFEA 3MHFA 3GNNA 4LRSA 3RMJA 1OYBA 3TUUA 3GXTA 5EA9A 1XUZA 1SZGA 1VR6A 3HGOA 2XFWA 2J88A 3HG3A 3S6DA 1F76A 3UYCA 5AYYA 1VHCA 1XBZA 4FNPA 3IRDA 1R47A 4DO4A 5C5YA 3STCA 3DFQA 3EX1A 3STGA 1LDCA 1KLYA 3FFSA 2JGQA 4XWUA 3N14A 1RR2A 1H1YA 4JIQA 3NL2A 7TIMA 1TCDA 2GQ8A 3NO5A 3UPBA 3KHJA 3UWZA 5AN7A 2DJLA 3NQ2A 5AB3A 3LTSA 1JVNA 3PBVA 4CQ9A 4JTLA 3LHTA 3PC0A 2E6AA 3DI1A 3W73A 2ZZ1A 1KFLA 3B04A 3TSDA 4ZQNA 4LC6A 4UTJA 3USBA 4A22A 1FUYA 3DKLA 3MBFA 1R2TA 5LNVA 2ZCGA 4FX6M 4KWWA 4TO8A 3W83A 5LGZA 3GKAA 1VCVA 3W88A 1GT8A 1TPB1 3G1YA 1TV5A 5DBTA 1WX0A 3TXVA 5AHMA 3BLEA 4UNLA 2BTMA 4ZQMA 3O6DA 1DBTA 2YGYA 2HTMA 4EF9A 2A6NA 1O60A 2B0MA 1EUNA 4RCXA 2HS8A 2I9EA 3THAA 3TK7A 3GR8A 3S1WA 3CEUA 1OF6A 1ZFJA 2B7OA 3L9CA 2ZFAA 4EIVA 1XDLA 3E96A 1UUMA 3L68A 1MEWA 3BPWA 3PAJA 1YPFA 4MY9A 1VYSX 3PSVA 4UFLA 1VQTA 3NR0A 2Y88A 1GYLA 1PHQA 3P7YA 3CC1A 2J27A 5D30A 3FJ6A 3QRHA 4I9AA 1T96A 4Y8FA 2CLMA 1G69A 3CHVA 1F74A 3ZFHA 1OFEA 1KFCA 3S5YA 4RJEA 1XUUA 2OMAA 4OE7A 3CEPA 3LLDA 5DCBA 1AL8A 3B0UX 4P2VA 1FXPA 4MJZA 3TXZA 2NWRA 1H7WA 1XM3A 2NWSA 4TX9A 1A5AA 5CPMA 3LBCA 4WX2A 4CNOA 4UIOA 3TQKA 3C4UA 4NT0A 1SZNA 3W74A 3C2VA 1OFOA 3NPUA 3CU2A 5FEPA 1JCJA 5KTLA 1LOLA 3C52A 2QUTA 3L65A 4W9TA 1H5YA 4UFMA 4DQWA 3LHVA 1H61A 1PV8A 1YDOA 4ORMA 1LLWA 1OK4A 1SW7A 3UWYA 3W85A 3GB6A 1TTJA 2V2DA 3NNTA 2JBMA 4UTTA 3EWXA 4GUJA 4FX7A 4JDYA 5BRBA 3Q94A 1LOSA 3EXTA 1R2RA 1YXCA 3BGJA 5I3IA 4RLIA 4RKAA 1RD5A 4GUHA 3S1UA 3P81A 5FF4A 2DZPA 4K8HA 3TC7A 2V0TA 3L0GA 2E6FA 1W1ZA 2GPTA 5EMUA 3MUXA 4AXKA 5K4ZA 1LBLA
chains in the Genus database with same CATH superfamily
7REQA 3RO6A 1XC4A 4OHQA 3LI1A 1B90A 4HK7A 2A79A 4PL1A 1O1ZA 3W27A 4LAZA 2R82A 3S5NA 5M5DA 2G3JA 2OYMA 4UUIA 1WAUA 4HHHA 1XBYA 1E40A 1NP2A 5A95A 2W6RA 1M9HA 1OC5A 2F61A 3WYZA 4AVNA 4DO6A 3G5EA 4Q4PA 2TRSA 1POKA 3LBOA 4GY0A 1YYAA 3BAJA 4ZO8A 2O55A 2PE4A 1B5TA 1N7KA 4CU8A 5HNRA 2EPOA 3QZ6A 4KRZA 1N82A 1F2JA 1YADA 2XWDA 3OZYA 4L6HA 3TYCA 4Z42C 4LPCA 3S4TA 3TA6A 1NWRA 1XYCA 2D2JA 2E28A 3VKDA 3AIRA 3GG1A 4JEQA 3QYSA 1RQBA 1TPVA 1S2WA 4MFEA 1GYMA 1UR2A 4PR4A 4DEFA 1CXEA 5I02A 3INPA 2VR2A 3EDKA 2GYIA 3WBAA 1RQHA 4AVFA 1F8MA 1C90A 1QK0A 3LSBA 3WH6A 3UXKA 2RH9A 1ZJIA 3KOZA 1DJWA 1PKLA 3WBYA 3P74A 1A5SA 4H04A 2XVPA 2CW6A 1EGMA 2NLYA 2CLHA 4NG3A 5EFFA 3PB2A 2OYLA 1LBMA 5GVJA 4FK9A 4JPGA 4JYDA 1TPFA 2BV9A 1PIGA 3MCOA 4HOZA 1OK6A 3LTYA 2XPKA 2VQTA 4K36A 3J7HA 1SMDA 4XD3A 1RBAA 4MJ4A 2PRMA 3NGJA 4U2ZA 1CIUA 2GGJA 4C6JA 1W5NA 1JCNA 3M0MA 3E12A 1OF8A 2ZX6A 4MZ1A 3OEXA 2UV8G 1SFTA 4CQAA 4JTSA 4XTDA 3L7RA 4KWOA 2GK1B 3U2EA 1FWGC 4HCHA 3UETA 3W25A 2ZKMX 5HWJA 4DM2A 1ODUA 3E0WA 1UR4A 4HNOA 2X1SA 4G1NA 1A3XA 1HJVA 2CLOA 1SW0A 4HPNA 3ZT6A 1QASA 3NZQA 4J28A 2VP8A 5BU6A 3IJQA 4GH3A 3BMVA 1OFRA 2Y8KA 4XSMA 2Q3OA 5KZEA 1HG3A 1S5MA 3UYIA 3F2BA 1NF7A 1AG1O 4IQJA 4IT1A 4AEEA 2WJEA 2GOKA 3KVJA 1QRQA 1UG6A 4MGGA 3T2PA 3GTXA 4MSSA 2A3CA 1BFNA 1BXBA 2PLKA 3EBVA 4QX4A 4WSHA 3VFCA 3SR7A 2E9MA 3KBSA 2F9RA 1CYGA 1ADSA 3NVTA 1H3GA 1QHZA 1QK2A 3LEPA 4LAUA 4OBSA 1K9TA 3N6QA 5D03A 1U33A 3LPPA 7REQB 4GI9A 2ISDA 1CZ1A 4MUZA 3R0DA 3SSZA 1PPIA 1VB9A 4GVGA 3FLUA 1E71M 4WR3A 4V2XA 2DV0A 3HB9A 4KCWA 2HBXA 1CGVA 1FXQA 2QXWA 4HA1A 2W5FA 2ZUSA 4AWUA 4HNNA 3FIGA 4NKCA 5DRCA 1Z3NA 3S0CA 4GQRA 4TMBA 2EKCA 3W7LA 1K7EA 1AVAA 2OZ0A 1YTEA 2PDCA 4DNMA 2WQDA 1CGUA 3SRKA 5BNKA 3W7HA 4GACA 1YLVA 1F6KA 4GG9A 4TTGA 3ZS4A 3DDMA 5CBBA 3ARTA 1E15A 1SW3A 3M7SA 4JZ5A 1KXQA 1W9VA 3VZXA 2NQJA 3GFZA 4FP1A 2NQZA 3ITLA 3WELA 3VKJA 1GOKA 4H7VA 5TIMA 2ZUWA 8XIMA 2PS2A 1F07A 2Z1SA 2DIEA 2ODOA 4JHOA 2ZVIA 2J62A 4DNHA 2OB3A 2CHNA 5H91A 3U5UA 1EUAA 2WCGA 4EXQA 1JL8A 3WJXA 2VX5A 3WDQA 3HQPA 1F8IA 4JKMA 5LIKX 4ICCX 3BTNA 1GHSA 4MLJA 2DT2A 3VOJA 4BY3A 2HS6A 1GOMA 2IQDA 5AC5A 4UNKA 3N4AA 2NXIA 1TR1A 3W1PA 2ASHA 5JIPA 4XZMX 1UH4A 2ZYFA 5JXQA 1T99A 1BYAA 3BAYA 4QDMA 2V68A 1XRSA 3L12A 4FAMA 3HJZA 4W4QA 3MSGA 1HVQA 4JTAA 3PJXA 1AMYA 2YXXA 3RX4A 1A50A 3H24A 1YIXA 1XGEA 4N4QA 3W6MA 3C0QA 1EDTA 1Q65A 4TQTA 5F2MA 3R25A 4FF7A 4GCXA 4FPSA 3ZM8A 1WBJA 3POHA 1IHIA 1NH6A 2QV5A 2AQWA 2P0OA 2XGBA 1F61A 3SW6A 4A4AA 1CBGA 3EX3A 1TV2A 1SO5A 4H83A 4JNYA 3WLQA 4EE9A 2Y85A 1KCKA 3BE7A 2RFGA 3A12A 3SUWA 3NPVA 1U1HA 4IZGA 3ELFA 1JDFA 2J47A 4EANA 4S38A 1GJWA 1RCOB 4HVXA 5EFDA 1XIEA 1VYPX 3T0BA 2EPKX 2PA6A 1I0DA 3GU9A 4Y96A 2VFIA 4FEZA 5H6HA 2O4QA 1MVYA 4H9ZA 3V35A 1VFSA 4I7UA 4LY4A 4AVOA 1VKFA 3GRIA 2WLZA 3A3WA 3VOGA 1IF2A 2PWFA 3GK0A 3G0UA 4JTJA 3NSXA 3FHQA 5KEZA 1HJWA 2E9LA 3HG5A 4RXGA 1SZEA 4UMBA 2I7GA 3UWVA 4E2BA 1TQJA 2X1UA 4ECLA 1SO4A 2E40A 3EDDA 5EMYA 1RD6A 2Z2BA 1EQPA 4AZ6A 4D8ZA 5AC7A 1GEHA 4PB5A 1PWLA 4O0QA 4U4MA 4XO7A 3SRFA 2FTYA 3CMGA 2YX0A 5AOUA 3F1QA 2INZA 4RZ5A 2WJFA 4DY1A 1MZHA 4L65A 3POCA 1VPXA 3UEQA 4UFKA 2PUZA 1A3HA 1A5LC 1LL6A 2B31A 4QEEA 1MUCA 1ZJHA 5DCDA 1B4EA 3CLWA 3GXPA 3C3NA 3LRMA 1X7IA 1J01A 3WK1A 4HN8A 2OZTA 1PJ9A 5LZLA 4ICNA 1R3SA 2HZGA 4LU0A 4FSAA 3NM3A 3NGFA 1QATA 1KCZA 4PFHA 1CB2A 2FTWA 3VDCA 2WYSA 1YKWA 2VCAA 2VDHA 2Y0FA 1EKOA 4ERAA 4GIYA 4TVCA 1LZOA 1ME9A 5FJPA 1KR0A 2FZMA 3R8GA 2FJKA 1H4PA 3CQKA 1TELA 4M56A 3ARWA 1AW1A 1FFRA 1EJRC 3UZJA 2C13A 3NSMA 4DJDA 2C0AA 1FWWA 4OECA 3ALGA 3VKBA 5LNSA 4W7VA 5H8UA 3IJ8A 1XP3A 4L64A 3T7VA 4GY1A 2ACSA 3IWPA 4PCFA 4GYPC 1TQXA 3D46A 1E0VA 3BSGA 1ZAJA 5DXYA 1DWHM 3OB8A 1XGDA 3SCUA 3SN1A 1QBAA 4H6KA 1TV7A 4O12A 3IAQA 3SCSA 1QPNA 3M0HA 5ABHA 5I3DA 4H8NA 1FWBC 4UR8A 1DJYA 4IM4A 4D71A 3NO3A 4NX0A 3OTRA 1N8IA 2RJHA 3NURA 4UCFA 5DO8A 4LNYA 3SFWA 4D1IA 3BW4A 3P8IA 2XVLA 3QW3A 3AAMA 3CT7A 3OGRA 3WUGA 2W67A 3SM0A 3PG9A 2NT0A 1WDRA 2G95A 3BGGA 1JYNA 2QAPA 3H54A 1S39A 4QG6A 2NX3A 4MDOA 4DWSB 5FSEC 3MDUA 1TTIA 4ES4A 4DF2A 2QJIA 3O6AA 2B81A 1UJPA 1UWQA 1EEXA 3VU2A 3CAKA 1VJSA 2BMBA 4HCDA 2F84A 3ES8A 1J11A 3CWOX 4QLLA 1REQA 4YPJA 1UP3A 3GC5A 1EBHA 1MMFA 8A3HA 4IOTA 3ZVHB 3CJPA 1RAKA 4C6KA 1S5TA 2G96A 1GKRA 1UC4A 1XDJA 2OYKA 4G7EA 1CI1A 3ZWTA 2QJNA 1GW1A 4QM1A 1FHVA 1YX1A 1A47A 3VIPA 1WKYA 2DUAA 4HNUA 5IDZA 2YFNA 1LWHA 3WQGA 5CXPA 4IMEA 3I4EA 1HGYA 1MRAA 1W3KA 3V36A 1XC6A 4JY9A 1TJPA 1HW6A 4AD1A 3WD1A 2WAGA 1NTHA 2VCCA 2WMHA 3HQNA 3PTKA 5AHEA 1GJUA 5EMJA 3LRKA 1QNRA 2PPGA 5K4XA 1A5UA 4NAFB 4KERA 1E9ZB 5BMWA 4LUYA 1XFCA 2VFHA 4ZBCA 3VNYA 3KTCA 1JCTA 1Y5VA 3M41A 4YJ5A 2OLHA 4RDWA 1TJ2A 5G2WA 4BS0A 3WMLA 2YR1A 5DT5A 3LLXA 2GDUA 1B3OA 1L6WA 4QR6A 2C1IA 3KDOA 1HQTA 4I8DA 2RDUA 1BWLA 3S1GA 3WKZA 1JPHA 3TJIA 3OBEA 5MHBA 4HNLA 2VEKA 1YBQA 1GOWA 4JNZA 3W7OA 1QW7A 1BYCA 3GH7A 2DQWA 3FA5A 2V3FA 3CK5A 2Q71A 2VEGA 2E5BA 2FZNA 1AK5A 3ZMRA 1IIGA 2E1DA 4O18A 3IVSA 4PMOA 3VABA 3CS2A 4GUGA 1ZGDA 1VENA 3KS5A 4RNIA 3SJNA 1AUSL 4FXSA 3N9KA 5H8MA 4MY1A 2XVGA 2HJPA 2ZWYA 2QUUA 1FHUA 2CBVA 3AOFA 3ZWSA 5KMYA 5D9OA 1VLWA 3LHUA 3PP7A 5I7GA 3LERA 5C9ZA 4YTSA 4ZSUA 3S42A 3ZQ9A 1S3HA 4F8XA 3V5FA 3LCLA 2QCDA 3TVAA 4O0ZA 4O28A 4YVXA 3H55A 1W3LA 3MW7A 3ARSA 4IWWA 3GDBA 3VGGA 3UW6A 1HX0A 2PF8A 3VMPA 3O8AA 3QOKA 4XD6A 2Z1VA 3AMGA 3CQ0A 1JDEA 3JS3A 5C0QA 1QHOA 2BLEA 2IKHA 2R1PA 1M7XA 1QPRA 1H7NA 3B0XA 4LFYA 1OBAA 6A3HA 1DE5A 3ZSTA 5IBXC 2Z29A 1BRLB 6XIMA 4R53A 4K2SA 1F6PA 3SN4A 4AFYA 5XINA 4EPKA 2Z24A 1G4EA 2X1RA 1TE6A 3T1GA 4JX6A 1WDPA 3IPWA 1EA9C 4QBXA 4O54A 3C2OA 3PUEA 4UTUA 4K1GA 3HFTA 1HVXA 4V28A 3MJMA 2IKGA 1HKMA 5C7VA 1Q3NA 1T41A 2WVVA 3DFSA 4YHEA 1CPUA 3TYBA 3TN6A 3MKVA 3CH0A 1ADDA 2BXZA 2P0IA 7TAAA 1LJYA 1J4EA 1ECEA 2EQDA 3GYEA 1ZAHA 1LYXA 4H3DA 4O15A 1DXFA 1V4YA 2XIOA 5C2CA 1KM5A 1KQYA 4H01A 2OCZA 1DWAM 2CFFA 5DLCA 5LYRA 3VD4A 2HSAA 3WLNA 1FHDA 1IE7C 3NQGA 2IXVA 2X1TA 1O6IA 5A8GA 5G4WA 4JN7A 3GDKA 3RXZA 3KOWA 3VOFA 3THCA 1V7AA 1E56A 4Y90A 4YNGA 1J5TA 1H1ZA 3WD0A 2ZX8A 2D0FA 2DVTA 1Z48A 3TN3A 2E77A 3GD6A 1XLDA 4IXHA 2EPLX 2PDXA 4MB5A 2NVCA 3AC0A 1ONEA 5CPSA 3RJYA 2CERA 1TVLA 1PDZA 1K7XA 2VX7A 2F2HA 4ZMGA 5EPDA 3EYPA 1B3YA 3CTTA 3FKKA 3QLDA 3PJUA 4JTFA 3HMJG 4XAYA 3KWXA 3REQB 2WM1A 5M1TA 5A69A 1OFBA 3BARA 5HWMA 4MYAA 1HJSA 4NJGA 1VIZA 4LAOA 1XH2A 4ZGYA 3ABOA 4QG9A 1X6UA 2PLCA 1SUXA 2CZFA 4HHPA 4URIA 5ENLA 3M0IA 4LCQA 5HK4A 4BWLA 4L6DA 2E8YA 2BVWA 2YBVA 4LW7A 1SVDA 5CPLA 4D6CA 1XRTA 2REQB 2ON3A 4HA3A 3LHWA 4IGHA 1W3NA 4OUEA 3G0XA 4TU1A 4AB4A 2J8GA 2G4JA 2B4GA 5CC3A 1VYRA 4I3GA 4YTQA 4C6IA 2Z1WA 1AFSA 3S2MA 4K37A 3STPA 1UD6A 3RR1A 4K7VA 2WMFA 1GNXA 2G3NA 5I03A 4V15A 4MJMA 3W82A 5I3HA 2HCVA 2XM2A 4C6OA 5LNRA 2CZ5A 1T6MA 2WHMA 3TQPA 4PEKA 3FK4A 3WFZA 3GDRA 4AHOA 4DYEA 3WZ0E 3RAOA 1HL8A 1OQFA 1X8FA 2DZSA 4G8TA 2FDMA 5H2ZA 3C0JA 4UMCA 3RGTA 2XUCA 3TAOA 2P1FA 1UWRA 3BLFA 5FA5A 1GOIA 3IGXA 2ZE3A 2OKOA 4L61A 2A7PA 2Z6JA 3B8VA 4I9JA 3UWWA 1UBPC 3G1SA 2C6QA 3AHXA 1WKEA 3H2NA 4JIIX 1MW1A 4JFWA 4X9YA 4AYSA 1HTIA 3WQ5A 1G9HA 4AY8A 3E1F1 3FY1A 2OQLA 3O0KA 4GFIA 4JX5A 1PZ3A 4UOJA 3V5OA 5C70A 5C2XA 3P2VA 2V5DA 1SSDA 3I7RA 3SCOA 1EO7A 3PUDA 3RMEA 1CGWA 1E5NA 1F73A 2FVMA 4A3YA 3WX7A 3RLGA 1H7XA 3OP2A 3AYTA 3LCFA 2E67A 5G4EA 2J9YA 3BLKA 4M82A 1KXTA 1VFFA 1XLEA 5EU9A 2ABBA 5TAOA 1NOUA 1XQKA 4YIWA 1G4PA 3IIVA 1QPOA 3GSMA 1P6WA 4FZIA 2W27A 1XYLA 5K9CA 4GK8A 3KRSA 4M8UA 3WNOA 5BU9A 4B5VA 5MKGB 3E0IA 3TV8A 3DYPA 2EJAA 1JDDA 3AXHA 5DXXA 4UQBA 1OFDA 3EOEA 3WH5A 3EB2A 3WJZA 1ONXA 3V3WA 1HUVA 3IANA 3KCJA 4L4OA 3KVLA 5A1AA 3AALA 3ANVA 5C8BB 1TV3A 2DZWA 4ZL1A 3L4UA 3B03A 3PZQA 4D2JA 4DUXA 2X0HA 3BAIA 3GIYA 1FWNA 2HXUA 1EJ7L 1PS9A 1KV8A 5A6MA 5L9FA 3AMCA 4PE8A 2QVNA 4BEUA 4N2YA 1XX1A 5IDIA 1DOSA 4JXCA 4RZBA 3K5XA 1V77A 4GD0A 2OODA 4GYPA 2PWGA 4QDPA 1E4NA 2Y70A 5A6KA 1UOKA 4B16A 3PJWA 2YBUA 4Z0SA 1JR1A 4IMDA 4UTTC 1UH3A 4IF2A 3AIQA 4BR1A 3FOKA 1VP5A 5I6SA 3GVRA 1H09A 3PFRA 4AD2A 1P7TB 1IWAA 2JIEA 3KX6A 2VDIA 3GR7A 4F9JA 3CUXA 3PULA 1ZJAA 3CUGA 1ZZMA 5C55A 2C71A 5CPNA 2JF6A 3A23A 1DJQA 3QPZA 4NNAA 3ATZA 5A6TC 2ZA2A 1RVGA 2X09A 1XRVA 3CZLA 1HKKA 3GVWA 2ZX7A 1WPCA 4NZFA 4RW5A 3R4IA 1E6ZA 2GQAA 4GNVA 2WZIA 1G7VA 1UKTA 1TPH1 3UJ2A 1JZ2A 1O94A 3AFBA 3GNDA 3LCIA 2C1HA 4G7FA 4LALA 1BKHA 2CKRA 1WKFA 3DOPA 1R3TA 3BMWA 4IJCA 4ZQRA 2QKFA 1KFWA 5A6JA 1QI5A 7ENLA 3T0DA 4WD0A 4LF2A 3W07A 1V6VA 1HZYA 1XG4A 1V51A 2RDWA 3EAUA 3U8GA 1PIFA 2MANA 2HRWA 2DZUA 2AMGA 1NP0A 3BJFA 3A4XA 1M7PA 3R2GA 4OJYA 1LRTA 2ZE0A 1UR0A 1JJKA 1DIDA 1KRAC 3OIXA 3SCRA 3LTPA 3B0PA 5A5WA 2VTFA 4E3TA 2XZ7A 1X1ZA 2UBPC 3ARXA 1OX5A 3N15A 3N2CA 2PTDA 1LM1A 5GJMA 1PTDA 3MSRA 4WZHA 4HMCA 4WSJA 1B3VA 3LQLA 3WNKA 3MQTA 1S2UA 3W7PA 5BMXA 1FWFC 3W24A 2YZ5A 2PDBA 3SFKA 3AIVA 2EPMX 1V0LA 3IVUA 1BTMA 3GXMA 4N4PA 4F9DA 5LHFA 1W32A 4PTXA 3OA5A 3OPSA 1WUEA 5CZ0A 2QDEA 1KD0A 4GPNA 2UZ9A 3CAWA 3MWCA 2G5WA 4P7NA 4XIAA 4IFRA 3S5ZA 4FB7A 4O53A 1ISZA 3W72A 3O6YX 4JCLA 9CGTA 1IZCA 1EQCA 1FKWA 2CETA 3S46A 4LS0A 3QJAA 4RL3A 4ZE4A 2WXDM 1WDDA 1L8NA 3MKKA 4ATLA 4LVFA 1D9EA 3PN8A 4XVEA 1CT5A 4IL2A 1ZY9A 2ZA3A 3P62A 2DJXA 3AXMA 3W1TA 2V3EA 8XIAA 2IKJA 2W3ZA 2W92A 3S8HA 2PP0A 4GLEA 5IFTA 4R9OA 5B7ZA 1QI4A 3WJSA 5LNUA 4AZCB 3QC3A 2PZ0A 5AZ0A 4PBGA 5DANA 4V27A 4B92A 2O9RA 3GW3A 4X63A 3MI6A 2PTWA 3DG7A 2HDJA 2YYTA 3G1RA 2J66A 3H23A 2PTZA 3SURA 1NQKA 3SDOA 3QKZA 1GQNA 1JPIA 3RFAA 4IMCA 1UD8A 1FTXA 4IIDA 3LNPA 3GKFA 3HIJA 1EP3A 4L9ZA 2PU1A 4DJDD 2O7QA 4JY8A 4C5ZA 3GNNA 4LRSA 3RMJA 4JIRA 3GXTA 3GVQA 5EA9A 4JTCA 4PB4A 3TZFA 3E2VA 2MNRA 1UA3A 2OKTA 3Q4DA 3Q65A 3W4RA 2Z1KA 3FXGA 1F76A 1LT7A 4HJFA 4DZHA 1SJAA 1R47A 3STCA 3DFQA 2Y1HA 1DHKA 3ZJ7A 4IG2A 3GWQA 1H1YA 1RR2A 4B5WA 1I0BA 4FS9A 4HQVA 1TIWA 3WEOA 3EMQA 3NQ2A 3DG3A 1WZKA 1ISWA 4WJXA 4CQ9A 4JTLA 2GJXA 3DI1A 3T0TA 1H41A 2PDIA 1KFLA 4P7RA 2QW5A 3EMCA 4IIFA 3G6LA 1KC7A 3MPGA 4A22A 3DKLA 3MBFA 3NTYA 3WLTA 1XSIA 3AS2A 4QG8A 5LNVA 4FX6M 4HA0A 4TO8A 1NQ6A 3AZTA 4MAZA 4DZ5A 3W88A 4AD4A 3AROA 5I23A 1IEWA 3CQHA 1UHVA 3O6DA 3BLPX 1VFTA 3UGVA 4RCXA 1ECQA 2HS8A 3TK7A 3GR8A 1VEPA 3KL5A 3RCYA 3CEUA 1XWYA 4XD5A 1ZFJA 3C0SA 3UZWA 3OYXA 2ZFAA 4C6FA 5HPOA 4A3RA 4HU0A 3L68A 2VVSA 4CUCA 3FX4A 2WZTA 1VQTA 2Y88A 1XIIA 2J75A 5IRPA 1GKPA 2J27A 3CC1A 3CNYA 3W37A 3QRHA 1V6TA 4RJEA 1XUUA 2OMAA 3GXDA 3OIHA 1OCNA 2GSHA 2W63A 3B0UX 4JL2A 4MJZA 3MUIA 4FXJA 3K1DA 4OFCA 4D9PA 1XM3A 1EGZA 2NWSA 3VNKA 4GZEA 1RXOB 4X60A 4WRHA 4KS0A 4CNOA 4UTFA 4UIOA 3WDPP 4F0KA 3TQKA 4GXPA 3E2QA 2OEJA 3C2VA 4L80A 3CU2A 1LOLA 4L6OA 2QUTA 3FA3A 5BWFA 1XJBA 4DQWA 3U2ZA 4D6FA 4UR9A 1HKWA 2IXUA 4ORMA 1H5VA 1LLWA 1OK4A 1TFVA 4KPLA 1SW7A 4GVHA 3UWYA 4BQ3A 3GB6A 3FDKA 3NNTA 3R7MA 4GUJA 1DXIA 3QKEA 5BRBA 1OCJA 3EXTA 4BF5A 2V5JA 3S9IA 4RKAA 3CHCA 4JAWA 5FF4A 3DG6A 2BODX 5A6BA 3TYZA 1CGXA 3RCNA 1JZ7A 4DI8A 1W1ZA 1GKQA 2GPTA 5EMUA 4NI3A 5CC5A 4AXKA 4INFA 5K4ZA 2C3ZA 3BURA 3F4DA 2DPEA 1Y5XA 3R89A 4BCEA 3WNNA 1QXLA 4ADTA 5D09A 2GVEA 4Y9MA 2J7FA 4HT3A 3B9DA 4K39A 1PCKA 1WYIA 3WF3A 2XN2A 1HKIA 3DBPA 3ZT7A 4B2DA 4AZHA 2ZRVA 4GVFA 3GUWA 3PZNA 3CHFA 5FKYA 4MNMA 3LM7A 3CIVA 4AISA 2X0SA 4N9CA 3VNIA 3CIXA 4XAFA 3LCHA 3MI2A 1JRCA 1M68A 4L4LA 2QR6A 2ZRUA 3MCNA 5C2GA 1Z9AA 2PTYA 1FWTA 3B9EA 3EKLA 4F48A 3ITOA 5CJNA 4YMZA 4LUTA 3QHNA 4AX6A 2EJ1A 3QHMA 2HVNA 3PBWA 4UQDA 4I5UA 3HG2A 3KBVA 3B9OA 2PB1A 1Q6CA 3SUUA 1BWKA 3TTYA 2GJXB 4LJ3A 4IP4A 3I10A 3TYEA 3OJGA 1OIMA 3VNZA 1PB0A 1O12A 2C1GA 2FGLA 1K7FA 1C29A 5LGXA 3URNA 3GIQA 3LZ3A 2PDPA 3IJDA 2POZA 2FPTA 4DXVA 1OT1A 5SWUA 3TONA 1TMLA 2Y6ZA 4PMNA 1ISVA 2FZ9A 4LH8A 4PN2A 4DAFA 1WZLA 3TSBA 3BLDA 2A3BA 2R1MA 3IGSA 3N12A 1Y65A 1NFGA 3WK0A 1Q6EA 4IMAA 2BY3A 5I2UA 1V0NA 2H3DA 3NQMA 2I57A 3WLPA 5HNTA 2WK2A 3IIPA 3M5XA 5E93A 5AYXA 1KFJA 1R8LA 4UZSA 4H6RA 2YJQA 4E8GA 2Z1BA 3L23A 2J79A 4O4WA 4GNKB 1YHTA 2OT0A 3QFWA 3AHVA 4H9MA 2YW4A 2GWGA 3GU2A 1OFAA 1W6TA 2BGNE 5KETA 3W53A 3LZ5A 4FLOA 3GXIA 5REQB 2KAUC 1C93A 3FJLA 4K3ZA 3K46A 4A35A 1LQAA 3H2MA 3NAVA 2DDXA 2PGRA 3MC5A 1WOAA 2JIWA 2V5CA 4JTEA 4ERGA 3BAXA 1RPXA 3BJSA 5DCEA 2VVNA 4A8IA 4S23A 4R7WA 1EL3A 1RLDA 4WOZA 4QTGA 1JNDA 4UFHA 1BPLB 5E1QA 1O68A 1QJWA 4J2MA 4IMFA 4RE3A 1KLZA 4AY1A 3ZLHA 3ANYA 2YB4A 3V16A 5G1TA 3UQNA 2FTPA 1WDWA 1LF1A 4B15A 4Z1AA 2VZVA 2Z28A 4W8LA 1QHPA 3OG2A 2ZIDA 3PWIA 1NU5A 2GUBA 2J77A 3Q37A 4Z1YA 1GVFA 3PPCA 1MUMA 2WMJA 3CM4A 3KOFA 5BXRA 1OYAA 2EXOA 4H41A 2E9BA 1A5CA 1B9BA 2Z0IA 1NDYA 3RLHA 3GTHA 4IH3A 3U7VA 4CCEA 4KKXA 2QCDB 1DHPA 4M1RA 2C14A 4NRRA 5BXSA 1Q63A 3OZPA 3COTA 1UD3A 4ZB0A 2HXTA 1Q45A 3ZR5A 3ABZA 2CWNA 2PCQA 1B3XA 5F7UA 1VFMA 2PWVA 4PSRA 1KBIA 1WCGA 3RRXA 3UG4A 3K4AA 1FWIC 1PO9A 1CWYA 1OD0A 1QNSA 3DFHA 1Q6GA 4L56A 2ONEA 3P93A 4MG4A 5DBUA 4MF4A 2GVYA 5D32A 5D4YA 1ME8A 3B8TA 3NZGA 3GTIA 3UCDA 5I3FA 2HWGA 3LCGA 1O7AA 5J5RA 2QEZA 4W93A 3N2MA 1UWIA 1KGUA 2HE8A 3ECQA 3LHYA 3WF0A 1U30A 1VBUA 4RV3A 3OA3A 3RM9A 3WENA 1R3RA 4GYFA 5CAKA 3EB3A 4E3VA 3FGCB 4PCPA 4ONVA 3N6HA 4UTLA 2DH2A 2Z7KA 1VCGA 2J25A 3TW7A 3S2NA 2RGLA 3NG3A 3M0YA 1C9WA 2QIWA 1QOPA 4Q8WA 3G8EA 2HQAA 2GVGA 2QF8A 4OOZA 3PZOA 5EMMA 3ZSSA 3W1RA 5FJOA 2YL8A 5M17A 4NAFA 1F05A 4WOQA 2J13A 1V0KA 2Q01A 2NXHA 3TJXA 4KWUA 3PR2A 2D3LA 4FLSA 4MMWA 1X6LA 2JFEX 2H9AB 3CZGA 4Q4KA 1EXPA 4XX6A 1VS1A 2RDTA 1QFEA 1AZ2A 4A3UA 2X2GA 4LANA 4W7UA 1GTHA 1AMKA 4FNRA 1FRBA 3MMWA 1L6SA 1H63A 4H1ZA 2J7BA 4NASA 1IIHA 2CLEA 1UW9A 1PX8A 1RP9A 1SMAA 1VC4A 2J6VA 2CLLA 3FJ4A 4BZYA 2CHOA 3SUVA 4WY0B 1CXHA 3NQ8A 1XLJA 1CW2A 3AXXA 3BVJA 4DUWA 4KETA 2C91A 1XIGA 3NZ1A 4IFKA 3ABSA 5KITA 1GQKA 4YLWA 3TKFA 4XAPA 4YYFA 4CD4A 2DZTA 7ODCA 4FNTA 4CD8A 3ARZA 4XUYA 1J12A 5CSUA 2WZMA 1DJIA 1SO3A 3WFAA 4JIEA 1P0EA 1V02A 5HUPA 1PL9A 4GJJA 2FZDA 1W9PA 1E9LA 4J3UA 3WUEA 7XIMA 4S1FA 3WLOA 3T40A 1SQ7A 3LGGA 2FGBA 4NZ3A 1EBGA 1S1PA 4HIBA 3QY7A 5CPOA 1O5RA 5HR6A 3M4HA 1ONWA 1FX6A 3IJ9A 3P67A 1JD7A 3LXCA 3R1ZA 1V3LA 3B8UA 4S3BA 1BSLA 3PPHA 4FO4A 2VXNA 1XLCA 1PWMA 3KXQA 6PTDA 3CZJA 3LX9A 5T9CE 4JQ1A 1Q6OA 4B4FA 4R7JA 1C3FA 1LBFA 1E72M 4WVXA 3T42A 2OO6A 2X8RA 4A21A 2YA2A 4S2CA 1VBRA 1KM0A 3PZTA 4XKYA 4QSHA 2WLYA 4HSNA 4AF0A 2BSLA 3LD5A 3KL3A 4ZQOA 1A0EA 1OT2A 3ARUA 1S2CA 1W2PA 4Y9AA 2YCJA 3DIPA 4UBPC 5HJXA 4O1BA 1NWUA 1L6FA 3BLOA 1B4KA 5CG7A 3UXAA 4LXFA 4TV6A 1TTPA 1UASA 4LVGA 4JYEA 3M0VA 4O8RA 4O50A 2JKAA 2VOTA 3KL0A 3BH4A 2A3AA 3FCPA 1IXNA 1F3XA 2D73A 4DUVA 1NEYA 5EB8A 4GBDA 2D2GA 4IFOA 3EA3A 4XTIA 2DEPA 1JYVA 2PCEA 1KQZA 3N2TA 3NZRA 5T8GA 1JPDX 1KBBA 4ZO7A 4NJIA 4HK5A 4PYSA 1W1A1 2E5DA 4KQNA 5FD0A 3HGJA 3IIOA 1ITUA 1VCFA 1BTCA 4C6NA 1SZRA 4ZQCA 1KKRA 3AWOA 4WDTA 4CKQA 3DU0A 4BJHA 1J2BA 3WY1A 3UGRA 2ISSA 2WSRA 3R12A 1M04A 4XQ6A 4WXZA 3TTQA 5CAHA 3ABRA 3I65A 1VEOA 4DWDA 2YCKX 4DN1A 4GQGA 2PFHA 1BWVA 3ARYA 3K13A 3U0HA 3IACA 4ZENA 1PIIA 4GXWA 4J3XA 3GIPA 3EX2A 2VGIA 1IXQA 5JH1A 1E6SM 4HSHA 5G1YA 5D37A 1EJSC 1XPGA 3MO4A 1UKOA 3OGVA 5FEXA 2ICSA 1E6PA 4YXGA 2VUNA 4KEMA 4F0HA 4EAYA 6TAAA 3TP4A 4F2UA 1U1UA 3KDNA 5KZMA 1YXYA 2BASA 3QQ1A 4PUKA 5M03A 1YNPA 4Z2KA 2PDGA 3IUDA 1KGXA 3C8NA 1UP0A 4MWAD 4YHGA 1WOBA 1I2OA 1R38A 4K6AA 5I07A 2XDFA 3E5BA 3K30A 3BV7A 9RUBA 3NDYA 1US0A 4IQDA 1KM1A 1TPEA 2OELA 3DZ1A 3U2CA 4UMAA 3UU0A 4LBSA 4IXXA 4NXKA 2QUNA 3PM6A 1CENA 3N2BA 1IT0A 1YE4A 4H6EA 4F66A 4C1NB 4B5XA 3N29A 4UWMA 3PUGA 1V7YA 4OTKA 1KCXA 2ZTJA 1XHGA 1XF0A 3QQWA 2CXEA 5U4NA 1S2TA 1MEIA 5D2TA 2GJPA 2QCMA 1AW5A 3GO2A 3ITTA 4Q4MA 1P7TA 3HPAA 2NXGA 3P5ZA 4N9DA 1ICQA 5HAOA 1ISXA 3HURA 1Q6FA 1GYNA 3F5LA 5CCZA 4DBDA 2X05A 2FB2A 3M44A 3WNMA 1RQEA 5A2CA 1FWRA 1H51A 3S1VA 4WDWA 3W7RA 4QCFA 1SR9A 2CHRA 4IGNA 1EJWC 4V1YA 4NJHA 4GUFA 3Q67A 2CBIA 3MMTA 4WKHA 3WBXA 3DEQA 1DQXA 1US3A 3LA4A 4B3KA 4F0SA 1ZQ5A 5CZSA 3B8DA 1XLIA 4ATWA 5AHNA 2OSWA 1RBOB 1TREA 4L7ZA 3UXIA 1ZP4A 2QULA 3EA2A 3O1NA 4WXYA 5GNZA 1P43A 5D2VA 1ZAIA 1JFXA 3W84A 1RV8A 2IPWA 3BOLA 4BA0A 1TWDA 1ZCCA 2DT1A 2I5GA 2CXGA 1GZJA 4W88A 4AXNA 1OZQA 4GYKA 3CWHA 2DZAA 4US5A 3BWWA 2BX7A 1YXDA 4DBWA 3G22A 3LNMA 3WJYA 2A5HA 2ZRWA 4LOCA 4NRSA 1PKMA 3H70A 3O6CA 4X2RA 4PCSA 3C2EA 5U7SA 1OD8A 1W54A 3TR2A 2XISA 3VCNA 1UKPA 5A6BD 4IJBA 3UF9A 1TWSA 3VC6A 3R11A 3WSUA 1DWGM 1YNYA 4GINA 1NVMA 3U4FA 3DFTA 3CUHA 4KFNA 3PK7A 4LBRA 3WMSA 1P6CA 5HNUA 3AS3A 5HNNA 3CIWA 4N9BA 4XZIA 1J0ZA 1YEYA 2YDSA 3KZSA 3FKRA 4GRSA 3JW7A 4LYQA 3T8QA 4DWSD 1D3CA 4CQ8A 4GC3A 2ZRXA 1RPKA 1NDWA 4MKVA 4EVZA 1W1IE 2VC6A 1UWAA 4FXRA 3FSUA 1JQVA 1KWGA 2RKXA 1TRDA 2EF9A 2ZVRA 4KH2A 2V2HA 3I68A 4MJ2A 5JVLA 1EH9A 3OVRA 3LGDA 3H12A 1S3TC 3B06A 3E9AA 1MQRA 4LYRA 5KZDA 1M7JA 4H6QA 4HNVA 2BG5A 2VO5A 1ICSA 3O16A 1BEUA 3A9IA 1BGAA 4GOAA 2ALRA 4P8VA 4BI7A 1BHGA 3E5PA 2P76A 5D9MA 4FNSA 4O1CA 2X1IA 3KUMA 1BLIA 5FL0A 3G1DA 2OT1A 2TMDA 5E5CA 3EDFA 3N17A 3WQWA 4HMDA 3VUSA 4P7QA 4AC7C 3SO7A 2GJLA 3IGHX 3MP5A 4J1OA 1F4AA 4KRUA 1ZBVA 4B5SA 4J3ZA 1ICPA 3GNRA 3NEVA 2V38A 1OABA 4O14A 2Z4GA 4C1NA 4C7DA 1K70A 4KFPA 4FA3A 5K3VA 2PDHA 3G18A 3G8RA 1K9DA 2WOQA 2E09A 1EA0A 1HO1A 1H0GA 3PPFA 1KBLA 1NARA 1S5WA 4CN1A 1EF2A 6XIAA 1E4IA 1T0OA 3VE7A 4OT7A 4Q8MA 4IL0A 1GOQA 2QDGA 5IHRA 3W75A 2WHJA 4ZQPA 3M5VA 2OWCA 1OVDA 3THQA 1FCUA 3D6NA 2PRHA 3EPOA 4C90A 2ZZ2A 4MWAC 2Y5JA 3DHDA 4EP8C 4LAMA 1PUDA 2Q02A 1F3EA 2Y4SA 5HJLA 1VFHA 3OYZA 2RHGA 3PNZA 3A24A 3H53A 4NJKA 3LCXA 1ZTVA 3ES7A 1IWPA 2OJPA 5I77A 1UPMB 2Q6ZA 1W0MA 3KVMA 3UVIA 3WJWA 4PRTA 1KM3A 4JFSA 3HBLA 1ZBKA 3AXKA 4UB9A 2QDDA 5TQLA 2VRJA 1WV2A 2JKEA 1V0MA 4UR7A 4RR4A 1UWSA 1C7TA 1G4TA 3P5YA 5BOEA 4OGZA 3VAVA 3UCCA 2YW3A 2UY5A 4GWEA 4J4KA 3R0UA 3CQIA 4IIBA 4Q22A 3M1ZA 3MBDA 5CZKA 4CQCA 3L66A 2Y7FA 3WNLA 2XH4A 2HISA 1OIFA 4Y9PA 1CB7B 1JCLA 4TOQA 3S9YA 1LP6A 3KWSA 3OVQA 4MWAE 4C7GA 5HPCA 3AYRA 4ASTA 2R94A 3VO0A 2J7EA 1JXJA 1UYQA 5DF0A 2QS8A 3WQPA 4JGDA 1WKDA 3H8AA 9XIAA 1ZLPA 1DJXA 3VILA 4A2SA 2YCLB 5LIUX 3KLKA 4U28A 4Q6XA 2AKZA 5LSMA 2OSXA 2GK1A 3WQEA 1AQHA 3EXSA 2GGIA 1FCQA 2VELA 1TR9A 1KM6A 1SZFA 1R3YA 3TTSA 2J8TA 3IAPA 3OBKA 3UY7A 2A3EA 4DZIA 2C79A 3KLLA 5HMSA 4XIMA 1R3QA 5JU6A 2GSEA 3PSWA 3GVGA 1J10A 1EB3A 1KNWA 1O1HA 2V8ZA 4JTHA 3TW6A 4XAZA 2CESA 3K4WA 1XYMA 4FXFA 4JBRA 4A29A 4FLRA 1FH8A 3MUZ1 3L4YA 1HP5A 2CLFA 1WA3A 3MKCA 2ZX5A 3RPDA 3CV2A 2DT3A 3RU6A 3W1NA 4Q8NA 5C9XA 2G41A 4U5KA 5EGRA 3UJRA 3OGSA 1RY8A 4A05A 1CXIA 4PEEA 1R9YA 2VHLA 2E0PA 5B80A 2V30A 1NY1A 3T4CA 4TTUA 3BGAA 1D8WA 1W1TA 2NLIA 3ITCA 2AQVA 4XUGA 1J0YA 1XKYA 1UZ4A 2V67A 2VOMA 1ZHAA 2QGHA 1R0MA 5FF3A 3AU2A 4AWTA 4MB4A 3KOXA 3MP4A 1WE5A 4I8YA 4DJDC 4C6BA 3BSHA 1LRNA 1F9CA 1EPXA 3B8SA 3UBPC 3PZ9A 1BGGA 4US6A 3W1QA 4TMCA 4TUFA 2V69A 1IQ8A 3W2JA 1U83A 1J5SA 4LAKA 1OGGA 2AL2B 4M6UA 3BXWA 1A0DA 4KIRA 2WPBA 1IT8A 4PGLA 4JFTA 3HMCA 2OFJA 1IEQA 3DHFA 2XH2A 3VGFA 1S2AA 1JRBA 1TUFA 1DPMA 3IV8A 2WSKA 1GGOA 2PDKA 3I7SA 3A3HA 4M6QA 3PZUA 4FHAA 1WP6A 4YVVA 3RN6A 1ITXA 1Z44A 3GXFA 1XG3A 5LA0A 4RZ6A 4NAEB 1V6YA 4LVAA 4XZLX 3BICA 4HPXA 3GNOA 3SI9A 2QCGA 2Y63A 2E1WA 1KFBA 5JMUA 1ZNNA 4JHMA 5BXTA 4TIMA 2VCBA 5D8ZA 1ML1A 4IMGA 1K8ZA 2A2IA 4UOQA 5I00A 4B5UA 1E51A 2YKKA 3UZZA 1E73M 4LUSA 5CC7A 5MKGA 3APGA 3H7UA 2QF7A 3DHPA 5E9XA 1MUWA 2BVYA 2QDHA 3B0YA 4EKJA 3U4AA 3QPEA 3VIMA 3ITYA 3R6IA 2OEMA 3MSDA 1RJQA 3ALFA 4AIEA 1LWIA 4DO7A 4OQVA 2DGAA 1HKJA 5BRPA 2E6YA 3TDFA 3RX2A 4IICA 1XS2A 3U7BA 1VBGA 1AH4A 2WC7A 2O56A 3GH5A 3TLLA 4QISA 4HD5A 4XISA 1PXGA 4XG1A 3KZPA 2VWSA 3BZGA 3KS6A 3LCWA 3NL5A 2ACRA 4FOUA 2FIQA 3NXFA 4GY7A 5AZ1A 1F5ZA 4QGCA 1JULA 3M0JA 1UR3M 2WM0A 3N19B 2EG6A 4BQ2A 1XIFA 1YW1A 2DIKA 3ZZ1A 4E4FA 4M5PA 3O05A 1VLIA 2ZZ5A 5A2AA 4LYKA 4XD4A 2QYGA 5EBAA 1EC8A 1KCLA 2BGSA 3BCFA 2DP3A 4W7WA 3F7JA 4CNUA 1WZAA 3DYMA 4WJEA 2X7VA 5D33A 1I1XA 1JD9A 1UWTA 1Q2SA 3CMJA 2VEPA 1IT7A 1KKOA 3HJEA 5AECA 1AL7A 3LI0A 1KBKA 3QGVA 1TRIA 1QW9A 2VJXA 3FJNA 5LNWA 1W1B1 2PURA 1W5OA 5FEWA 3ME3A 3RM4A 1GWJA 4L5ZA 1XYFA 3KP0A 3W3OA 3W7QA 3L4XA 3K2GA 4HGXA 3NL6A 5K2ZA 5D02A 3VOIA 3JUGA 5A8QA 2WHKA 3BAKA 7A3HA 2ZADA 4PODA 1RUSA 4PSPA 2WO5A 1IEVA 4ROPA 3S6OA 2HK0A 4M7TA 3DH7A 1UC5A 3GS6A 3PVFA 1OX4A 1YTKA 2E4TA 5KZ6A 1H50A 2XIIA 3W02A 5GNXA 4XZHA 2QUVA 3T09A 3ZVHA 4DBSA 4M81A 2V2CA 1QO2A 3RCMA 1A5KC 4PC8A 3QQ0A 4QHRA 1RVKA 3UESA 4KGLA 5DEZA 3OLIA 3GX9A 3TQVA 4LS1A 4P61A 1S5NA 2QZRA 4JTKA 3PPGA 5HDRA 3GVVA 2BY1A 2AL2A 3THUA 4U10A 1KM4A 5FAJA 3UT0A 3RPTA 4BHYA 1RA5A 4OIFA 3LRLA 4CEXC 4B90A 3IRSA 5F2GA 1JAEA 4NSBA 1LG1A 1H49A 3MV01 3PBUA 1D3HA 3H4XA 3KRUA 2XFYA 1FH9A 1W5PA 2PLJA 3BDKA 2BVDA 2IPGA 2GFTA 5KINA 1KFEA 3WLMA 1GONA 2YCLA 4HTYA 5RUBA 1XUZA 3BC9A 1OM0A 2X42A 2NV9A 1SZGA 1BYDA 3GNXA 3HGOA 4D1JA 4H19A 3C2YA 4H2HA 1QPKA 1A4MA 2RAGA 4FNPA 3IRDA 1S38A 4QE5A 1V6WA 3GW0A 4ZOAA 3STGA 2J78A 2JGQA 3G2GA 4XWUA 2FKPA 1QVBA 8RUCA 4PMDA 3UVAA 4JIQA 5CPQA 3NL2A 1ENUA 4F0RA 1JAKA 2V6AA 4AMCA 1GQLA 1LQ0A 2BHUA 4CEUC 3N2OA 1YDYA 4H00A 2YL5A 3LHTA 4Z2HA 1Q7MA 3W73A 1XLGA 4WK9A 3FDGA 2ZZ1A 3VIHA 4XVDA 1VD6A 4G6CA 2ZXBA 1R2TA 4PMVA 2ZCGA 4KWWA 4G9PA 3CPUA 1V03A 1VCVA 4LEQA 3SADA 5H1WA 3G1YA 3GG0A 3CHDA 1KXHA 4LCSA 1A5NC 4LGXA 4AWEA 4UNLA 3R0KA 4ZFCA 3THAA 3VGDA 3TNBA 1O66A 1OF6A 4XK2A 2B7OA 1HKVA 2DY3A 3N13A 4H8HA 3NCOA 2VX4A 3MV11 3UJEA 3SCWA 3LK6A 1QUMA 1V3IA 3ABXA 4DVOA 1MEWA 3BPWA 4HHMA 1X98A 4YU1A 1YPFA 1Z6KA 3AMLA 3PSVA 4XSLA 2AOSA 1JYXA 3CV1A 5D30A 5AYBA 4YTUA 3W38A 2NQ9A 2DZBA 1DIEA 1X1NA 4IPPA 2CLMA 1HP4A 3CHVA 3SY8A 3VMOA 2Y5SA 2J8FA 4DJFD 3LLDA 7PTDA 3QZAA 5DCBA 2F2KA 3M6DA 1FXPA 1FWCC 1E6NA 4TX9A 1A5AA 1IGWA 3GTNA 4HCLA 3S5SA 5FSDC 1SZNA 3W74A 1OFOA 3NPUA 3QVQA 3C52A 4UZUA 4REQB 2FH8A 2BXYA 3LHVA 4A8RA 1PV8A 3PWGA 2WCAA 4BKNA 1B54A 2JBMA 1EHAA 1EGVA 2VM8A 4JDYA 4WIWA 1TCMA 3DBNA 4RLIA 1GQJA 4GUHA 3SQMA 4HOWA 5HXMA 4K8HA 1UH2A 4Q8OA 2PODA 3NWRA 1NOFA 2XINA 5C71A 4P5UA 5I79A 2V63A 2IPJA 3LM3A 1XLHA 4J5NA 1PVNA 4FNUA 4UXDA 1LTDA 3VNMA 3V18A 2EPHA 2FMOA 5G4HC 4H7ZA 4K7YA 3BUVA 4EOUA 3WQ6A 2JEQA 3M0XA 3GM8A 4GBUA 3D0CA 1UZHA 4LNCA 3AMDA 2IMRA 2QCHA 3LMZA 4AC1X 2OPJA 3WQVA 2R1KA 4M1BA 3VCRA 2QUMA 1JI1A 4M6PA 1RA0A 1TVNA 2I9UA 6CGTA 1CLXA 2WKLA 3L4VA 1J96A 3WUFA 3F2CA 3W1UA 4E38A 4DJFC 2G37A 1E6RA 1XLLA 1PE1A 1OGBA 4JQ2A 3BL3A 4WKAA 4AU0A 2BP1A 3O07A 5CH9A 1YNQA 1LCOA 4X0NA 1VH7A 5JH2A 3P8JA 1FA2A 4EPBC 4HPHA 4WGHA 1KTNA 1QW8A 3V1HA 2PF0A 4NNCA 1PX4A 2YDQA 1ZCOA 3W00A 1XRFA 4C6CA 3HPFA 4HA4A 4EXBA 4GE8A 4CN6A 4X61A 1B31A 3APTA 3MTWA 1M41A 1W5QA 2PSNA 5C54A 1EIXA 3WLIA 2IW0A 4BQ5A 4JOMA 4M6VA 4ACYA 1E6XM 2XGIA 3W6YA 2G0WA 3L67A 1EJXC 3NO1A 1XSJA 5I5RA 3GQYA 4I6VA 1E0XA 4OKDA 3QYQA 3FVMA 4C7FA 1TYGA 4IQLA 3WH8A 3GC2A 4H9VA 4GX8A 4C5YA 1UOZA 1OFQA 3L4ZA 1BRLA 3CV7A 4OWGA 4PTVA 2PGWA 3NVDA 2NUWA 1MNZA 3DC8A 4S3GA 3OOQA 5FOOA 3BV4A 1MEHA 1OFPA 1W17A 4L4PA 3VD3A 4QFUA 2VD9A 1IXPA 2VC9A 2PDJA 1TPUA 2XZ9A 1KRBC 4C6DA 3A9BA 4Q8PA 3I6RA 4BWLC 4DXKA 3WBWA 1LLOA 1Q6LA 2X40A 4X9SA 4R5EA 2O9PA 4LBUA 3CAQA 4B91A 3BOXA 4AIBA 3MMUA 5C9RA 3TYAA 2A6LA 4N7QA 1NSJA 1CXLA 1GTEA 4I9MA 4CLMA 2BHYA 2W61A 4LQ1A 1SSGA 1X8CA 3OODA 4PBEA 3EOSA 5AHIA 3QXBA 4JIHA 1DJHA 5E0FA 3ITXA 2XIJA 1XD1A 1RSCA 2GUUA 4DBUA 4RDYA 3HV9A 3BG9A 4MVAA 3G1VA 4IIHA 4YVPA 1JUBA 2BGQA 4YWIA 4ZO6A 2E68A 1YQ2A 3ZR6A 1FCVA 3WLSA 3NA8A 3W22A 2ZDRA 1J0IA 1V3JA 2Z26A 2I17A 4Z17A 4UTIA 4QP0A 4OV4A 5E70A 1AQMA 1IGSA 3FEQA 4B9YA 4R7OA 4IFKB 5AYIA 4PUNA 1FWJC 5J5DA 3SZ8A 5HA7A 3CLMA 3LBMA 3CAVA 3WQFA 1VFLA 1W3IA 2Y24A 3N2XA 1J6OA 3TR9A 2NSXA 3C2FA 3GY1A 3RR4A 4H8VA 4DF1A 3F4WA 4F2TA 5ABEA 3OVGA 1P48A 3ARQA 2CCRA 3OO2A 4O52A 3VI2A 1LL7A 4W87A 1UCWA 3I6EA 5FJTA 1SR0A 4PTMA 3TA9A 1GVOA 1C91A 3S5OA 9XIMA 3APYA 3LHZA 2WVSA 1XIBA 5BRQA 1QWKA 4DUOA 3LYEA 5FIPA 4M24A 1N55A 3NZPA 3T81A 4AZGA 1DP0A 1UUQA 1X97A 4MM1A 3EGJA 4GGHA 3R94A 3PAOA 3CL8A 5BCAA 1E1FA 2BHZA 5AVHA 3ICJA 2D0HA 5IHSA 5LA1A 1QMLA 2IKIA 3BAWA 1TTQA 2PDMA 3G1AA 4NZ4A 3WG6A 3H6OA 3CWNA 1R9ZA 2PBGA 5AYZA 1TPDA 3PTQA 1DEDA 3MYPA 4UQ9A 3WDRA 3KE0A 2VRKA 4F2BA 4CD6A 3E3HA 3WFLA 4MZ8A 3OVPA 3STFA 5G2HA 3FHAA 3DGBA 1CGYA 2HVMA 3QV8A 1W37A 1LUCB 4DF0A 4NZJA 1CXKA 2NUYA 3ORWA 2V81A 5FF7A 4F79A 2GQ3A 1ZS2A 3H4GA 3QV7A 4HHLA 1U5VA 3TTEA 1WZMA 1P1MA 1VJIA 5F4WA 2XSAA 4A6GA 3NL3A 1ZP3A 1OX6A 2J6XA 5DQPA 2R14A 3QN3A 4PMXA 4PUUA 2EGZA 3T07A 4PMYA 3F4NA 2FFIA 4L9XA 4GVIA 3VUPA 3HU7A 1BG4A 4KRTA 1E0WA 5I09A 3UPMA 2BS9A 4GJIA 1OG0A 3PBYA 3SGUA 2WNQA 4ZTYA 1RK6A 4KWVA 1QI0A 4U3AA 1Q4WA 4GQQA 1GOOA 2DSWA 4OBTA 3WUBA 3ARVA 3T2OA 5FAGA 4LTSA 2WC4A 3O06A 5F1UA 2VURA 1K03A 1QI2A 4OUIA 1Q6RA 2G4FA 4S3EA 1GG0A 3PWAA 2HNHA 4ML4A 3QW4B 4PTDA 2JEPA 3C61A 3RK8A 3M64A 3N9SA 5FJIA 4YN5A 2PI6A 2WW5A 4RPPA 4U31A 5CQ1A 4ENLA 2CIPA 2DSKA 1GVEA 1B2YA 3L2IA 3TH6A 3AIUA 3C86A 3QR1A 1KWKA 1TPC1 5LKYA 4JS3A 3L5MA 3SRHA 5IM51 4QJ1A 3N6JA 4BF9A 1V93A 3M5YA 5CLWA 2AQOA 5AHFA 4MNLA 3AQUA 4U33A 5CJ5A 3MMDA 2GJNA 3VINA 1TWZA 4BI5A 2FGZA 1JIBA 3P84A 3DKJA 1TO3A 1N8WA 3M43A 1OGSA 3CZ8A 1PHWA 3UD6A 4MB3A 1SFJA 3OLGA 2Z7GA 1FY6A 2OWXA 4RW3A 2Y7GA 4GQBA 1MXGA 4RX0A 2Y62A 4O10A 3TOYA 2NX9A 3GUGA 1E1EA 5I3JA 2X41A 1NJJA 1PBGA 3S2JA 2CC0A 1FDYA 4PUWA 4DPPA 4IJRA 1OB0A 4ZEPA 3EA1A 1Z69A 1AQ0A 1G01A 1JGIA 3GDLA 3CO8A 1JZ8A 4N6FA 1TIMA 4TV5A 4ZSTA 1BVWA 2DQXA 1CLKA 4PMZA 1V8EA 4K8EA 2FVLA 4WY0F 3LU2A 5D9PA 3WH7A 2H3BA 3CPRA 3JZEA 4WQ6A 2H6RA 1EJUC 3SUTA 3W81A 1JCMP 2ADAA 3M6YA 3ZJKA 3FS2A 2R8WA 3O63A 2WMIB 3W70A 3VM7A 4C1LA 1YDVA 2OEKA 4IX0A 3M46A 1C9DA 4Q33A 1R7OA 3ATYA 4DX3A 4Z2IA 4FIRA 3CZKA 3LPOA 3U2OA 2VMFA 2VX6A 3RX3A 1M03A 3F5KA 4MADA 4Q8TA 1G7UA 1PAMA 3QR0A 3JU2A 3CQJA 4UQCA 3V4BA 1E55A 4PH6A 4ROQA 1OINA 3FA4A 3SGGA 4IUOA 4C6EA 1OEPA 1BKSA 4HOXA 2PP3A 1XLMA 4JDBA 4JD4A 3ZLFA 3GXNA 3WCZA 3WIJA 2O4MA 3VDBA 1OHLA 4MFDA 1W31A 3CUFA 3W1LA 2HPMA 4N0RA 4LUTB 2MUCA 1Z89A 1LT8A 2QPUA 3TJLA 1TKKA 1IYXA 2VRQA 4O1AA 4W85A 1ZB5A 3G6MA 4ACZA 4FR6A 4R85A 3RM8A 1KTBA 3SQSA 3WEMA 1XLBA 1HJXA 1X7FA 3PUOA 3QY8A 3QFEA 1QDSA 1V5XA 4MWAA 2YL6A 1H62A 3M16A 2P5NA 3UFYA 4B3ZA 3MYOA 1TX0A 4H9TA 3YPIA 3UZYA 4DWSC 1T8XA 5HINA 1XFBA 3BJTA 4IGMA 5DFAA 3DN5A 4W89A 2OU4A 5HJYA 1EO5A 3DC0A 3G77A 1VAHA 1NFPA 4PMRA 4Z1BA 2TSYA 5A8NA 1CECA 4OOUA 3QBUA 1I2QA 2WVVB 2EO7A 2OVLA 3KW3A 3VPLA 1O5QA 3LMYA 3H2EA 3H26A 4RDVA 4KT2A 4KEUA 3UXDA 1L9WA 1NWTA 3BK0A 3IUHA 3I3EA 1LLZA 3GC4A 3HN3A 1H1NA 2CBUA 1V6XA 1D2KA 3CB8A 4XZWA 5F1VA 3P82A 1VGAA 4KBXA 4QLJA 3R13A 4L1WA 3F4VA 1G5AA 3RNDA 5I3KA 1ZSXA 4GIEA 5F2IA 5AVNA 2Y2WA 1W3JA 2V5KA 2DUZA 3FN9A 1SPQA 4WY0A 2PZNA 5T26A 1QO5A 5DELA 3LPFA 1AQFA 1C8QA 1F3TA 2EHHA 4MPKA 4HNCA 1J2WA 4AZ7A 4BF7A 2OTDA 4AYGA 2A4AA 3WD2A 5D2YA 3OG3A 3W7GA 3WQCA 1E6QM 4I5RA 4Q4QA 3MJYA 2YB1A 4KIEA 1TWWA 4V33A 4CD5A 2R24A 3D3FA 4GA8A 4DWSA 2QNEA 5J04A 3BSMA 3O15A 4IPLA 4ILSA 3VIJA 4R9XA 3VX1A 2Y8VA 3B4YA 2BNJA 2C19A 2A21A 1TZZA 4NNBA 2P8BA 2VD8A 2Q8LA 4U3CA 1UUOA 1FDZA 2D1ZA 1TWIA 3VCCA 4JX4A 3AS1A 2GQ9A 3IV3A 4G7EB 4HZMA 3CGTA 3W71A 3WLKX 5E09A 3GTFA 3CZEA 3A22A 2IUZA 3A5VA 1XCFA 4PULA 4KMQA 3W28A 3G24A 1M53A 3I6TA 2DORA 2NX1A 3GE7A 3GG7A 2XSXA 3QPYA 1F4HA 3UJFA 1O4UA 3NQAA 1TV4A