3NQVA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r5 7/4a
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
249
structure length
246
Chain Sequence
LKASSLRALKLMHLATDDTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTPGKVAEGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADSRHYAFGASSSLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 246
sequence length 249
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqvA00
1QPQA 1FCUA 3NG3A 3G1VA 3RU6A 3LB0A 3DENA 2VFHA 4LVFA 5K4XA 1QO5A 1F76A 3QMTA 4OGZA 3M5XA 1SR9A 3TIMA 1I2OA 3WJWA 3SR7A 3DFNA 4WXYA 3K30A 3N2MA 3NQVA 4XUGA 4O19A 2NX9A 4GXMA 3BK0A 4WQ6A 2GVJA 3KRSA 1FUYA 3C2RA 3U8GA 3LHYA 3GKAA 3W72A 3I65A 1FXPA 3VKJA 1RVGA 3W7LA 3G8RA 1G7UA 2C13A 4UNKA 1TPVA 2VFDA 1MSSA 4JX6A 4OWGA 1LLZA 1M7PA 1JUBA 1T96A 3M43A 1V7YA 4ADSA 4NZJA 5HQEA 3T40A 3LCFA 2VKZG 1B4EA 4KFPA 1TIMA 2ZZ7A 3G0XA 3NM1A 5IBXA 4LRSA 4JTTA 1IXOA 1PIIA 4WY0A 4LVAA 4UXDA 1H62A 1WV2A 4Y8FA 4BWLC 3I68A 2QEZA 2A2IA 4S2BA 1ZAHA 3DFOA 3OHIA 2VFIA 3EXSA 3NL6A 1GVRA 1T8XA 1TPH1 4MYAA 3NL2A 3UQNA 4MYXA 5F2MA 3DI1A 1FCBA 1ZFJA 3NXFA 1Z48A 1NF7A 4Q4KA 2A4AA 1P1XA 3BW2A 2Q8LA 3STGA 1FDJA 1ICSA 2PRHA 2VFEA 5TBOA 3BG9A 1SFJA 1XXXA 1O94A 1ZHAA 4N9CA 3O6YX 5KSWA 1S5VA 5D2WA 3CIXA 4JS3A 1TPFA 1LOQA 2V2DA 3PG9A 5HUPA 5D05A 4JY9A 1N8FA 5KITA 1SSGA 3FOKA 4M7SA 5LNWA 3W7EA 2QJIA 5D30A 3BG5A 1C29A 2B4GA 4N9DA 3HO8A 1W37A 3GNNA 1AL7A 1ZJIA 4GUHA 3P60A 3V75A 4GUIA 3A9IA 2A6NA 2C3ZA 4O57A 3A23A 5D04C 4MOZA 1K02A 4LTSA 4JR5A 2O7QA 2QDGA 5I3FA 2E77A 3KVJA 3W7DA 2WQPA 1NFBA 4O28A 4A2SA 4A3UA 3W76A 3Q58A 3PY2A 4GC4A 3IIVA 2HS8A 4JTFA 1H51A 3QM3A 1OF6A 1OFAA 2PE4A 3NZ1A 3TSBA 4CQ9A 1LLWA 3W1AA 3HG4A 1D3GA 1EIXA 3G8EA 2DU2A 3MBDA 1W1ZA 4A29A 4LWWA 3MP4A 3TFXA 3L0KA 3L5AA 3THAA 1OX6A 4Z0SA 2WJZA 2FQIA 3HGOA 4IGHA 3KXQA 4JN6A 4O53A 4XBKA 4BWLA 4W9TA 3DI0A 4XKYA 3RLUA 3EWZA 2BLEA 3QFEA 3W1RA 2WSQA 3A5FA 4JTIA 3QMRA 1H7RA 1YTEA 3CT7A 4NJKA 1ML1A 2V30A 3P74A 6TIMA 4O11A 5LKYA 1H63A 3O6CA 3NAVA 3W88A 3TH6A 4IMCA 5D37A 4FNQA 3OG3A 3DHDA 1OX4A 2EHHA 4JDBA 3CHVA 3W75A 3BO9A 4GNJA 4O1DA 3CWOX 1FX6A 1VJIA 2FJKA 3QH2A 4TR9A 2R91A 4JYFA 2AQWA 5CPNA 1KM5A 2J24A 5D38A 4MLJA 3W23A 5KINA 5D2TA 1GQNA 5G2WA 1VCFA 4JTJA 2G5WA 2TMDA 1TPWA 4NX0A 2CLOA 1J2WA 1FBAA 3W2MA 2W6RA 3QJAA 3QSRA 1TTQA 1VGAA 4MIMA 4UTHA 2J27A 3GAKA 1ZY9A 3HGJA 3BW3A 3NQMA 4JTSA 1I2NA 5CZTA 1H50A 3O63A 4ONVA 5K7JA 1GPWA 2YR1A 2Q8ZA 1FWRA 2FFCA 2OT1A 3NQ2A 3TMLA 5K9CA 3ELFA 5DELA 2X1TA 5FEWA 1H7PA 4I9AA 2WNQA 2VEIA 3EEGA 4O50A 3GDKA 3GAYA 2GQ9A 1AW2A 3RF9A 5FF0A 3GR7A 2J88A 3KX6A 3W07A 3NNTA 4GJ1A 2CLMA 1OFEA 2FPYA 1YTKA 5D2VA 2X30A 3B06A 1JQVA 1SU5A 4NU7A 3THQA 4K38A 1FDYA 3TW6A 5HR7A 3W1LA 1UUMA 2RFGA 3N14A 5CSRA 3NQCA 5EMUA 4FO4A 2ABAA 1QMLA 5HWNA 1PL9A 2YCEA 3Q37A 3W73A 3LHWA 3NDOA 4WX2A 3QRHA 2NUYA 4O0KA 1A5BA 2OX1A 4HNVA 2QJHA 2X1SA 3P8IA 1QAPA 1H7XA 4O8RA 4DO5A 4GWEA 4MFEA 1BEUA 3G1SA 5CG7A 1KFLA 4BI5A 3N34A 2I9EA 3WFAA 5KTLA 3LDVA 4FF7A 1GVSA 1GTEA 3W7GA 5G4WA 1H7WA 3GKFA 3MBFA 1EP3A 4LRTA 1QNVA 1WYIA 1O5XA 3SSJA 5DXXA 4OV4A 2ZZ1A 3W87A 3IGSA 1LM1A 5DCDA 4FXRA 3WJXA 4UFIA 1CW2A 1SFLA 3FLUA 3PS7A 4NJHA 1W31A 3HPXA 4QIUA 4XQ6A 3L21A 1M7OA 2JK2A 3R13A 3GNDA 3CEUA 1KM0A 4YXGA 2GUUA 3LLDA 3I7RA 4UMCA 3QZEA 4K8EA 3V1PA 3S5ZA 1OFRA 3B03A 5FEPA 3O16A 4EOUA 3W83A 1JCNA 3BARA 3RLVA 1EPXA 4K6AA 4LU0A 3M7WA 2FIQA 3P82A 1SSDA 3HBLA 2A6LA 1F2JA 1OFPA 1QPRA 3FA5A 2Y85A 3FKKA 4N4QA 2ZTJA 3EWBX 5BMXA 1BKSA 1XBVA 5HNRA 4CCCA 3BPWA 3T78A 2G97A 3C52A 3HPSA 1OYCA 2Y63A 4AVFA 2H8ZA 3W70A 2VFGA 1G4TA 3QEZA 1IGSA 2NXHA 2R94A 2WSYA 4O14A 4HNTA 1KTCA 2FTPA 3PB2A 4JNMA 3T44A 2C14A 3EXTA 3QPZA 4DBDA 5CZSA 1ME9A 4HHPA 4E0CA 3SJ3A 1LBLA 1F05A 4WOQA 2B7OA 2GJNA 3PAJA 3WJSA 3CM4A 1JRBA 4HKPA 3KRZA 4WY0F 2CLHA 1XUUA 2ZFAA 1XBZA 3NO5A 4UFKA 1DORA 1NAL1 1KFEA 4O54A 2CZEA 3G0SA 5CZ0A 8TIMA 2DJXA 5LNRA 4UFHA 3EWWA 3HJZA 2C0AA 3O06A 4JY8A 3E12A 1VYPX 3S1XA 3UWYA 3HG3A 1GG0A 1YLVA 2E6AA 3W74A 3P8JA 1QCWA 3G3DA 3N2XA 4IOTA 1OG0A 4JTLA 3NQEA 5BW6A 3FFSA 3F4WA 3DGRA 2A5HA 5LNUA 3OBKA 5A5WA 5D03A 3B05A 3NL5A 1TJRA 4RK8A 3TAOA 3OVPA 1VHCA 4JICA 2CZDA 5BRBA 2QCDA 4PCFA 3GXTA 3SGZA 3QC3A 3UZJA 2QUUA 1LBFA 1S3HA 5HWJA 5G1TA 2VOMA 1X8FA 3UD6A 1TPB1 2V2CA 1I2PA 3LBCA 4HPXA 4O17A 1LCOA 4EF9A 1RQHA 4O0ZA 3CIWA 1GVFA 3GDRA 4WZHA 3HG5A 5LHFA 3NPXA 2X16A 3S8HA 3FYPA 1PE1A 3T7VA 1F74A 2ZBTA 2Y88A 1GOXA 3UY7A 4CQAA 3H53A 4JGDA 1BWKA 2BSLA 4AWUA 1W3TA 1SZFA 3LV5A 2ZA2A 3L66A 3PBVA 3S5NA 1G67A 4ZQNA 1UBSA 2W79A 4MZ1A 3LTYA 2NZLA 4Z08A 1NSJA 1XUZA 3UPWA 3GB6A 5G1YA 4UCGA 1VCVA 2E09A 1EA0A 1A53A 3VNDA 1LDCA 4HPJA 3S1UA 1KFJA 4LS1A 3O8AA 1MO0A 3B4UA 4FNRA 2E6DA 2ZDRA 1YXCA 1ADOA 2XN2A 5I3IA 4TU1A 3IEBA 2JGYA 2ZZ2A 1VR6A 4E2BA 2UV8G 1GYNA 2YSWA 1QPOA 4JDYA 2ZTKA 2WSRA 2BX7A 4GE8A 1H60A 5FEXA 5HINA 4FIRA 3S5YA 4XZ9A 2EF9A 5LZLA 4FEZA 3RNDA 5BMWA 1DKWA 4O15A 1Q3NA 3TJXA 2E6FA 1YDNA 2WNNA 2GVGA 1YXDA 5DCBA 4A21A 3S6DA 4CNNA 1H5YA 1F6PA 2ATMA 2H3BA 2ZZ5A 1SQ7A 3W7HA 1OYAA 4UTLA 3EKZA 3G0UA 1VHNA 3G1DA 4LUIA 5AHFA 1JCJA 2YX0A 1OF8A 4JTGA 5LGZA 3JS3A 1KM1A 3GYEA 1YDOA 3PBYA 3UWUA 3VE9A 3HMJG 3HIJA 2QAPA 1JCLA 3L9CA 3PULA 2PC4A 4O1AA 2PRMA 3C2EA 3SI9A 4I7WA 3DFTA 4OBTA 4AEOA 1LTDA 1KBJA 4XTIA 3KVLA 4ZQOA 5E93A 3R89A 2DORA 2DP3A 4RXFA 3W2LA 4LC8A 5CKSA 2GOUA 3Q94A 3HB9A 1EWDA 5K2ZA 2Y7GA 1PVNA 4BI7A 1C9DA 1ZAIA 4EIVA 4FNSA 3NQAA 5CPLA 4IJBA 2NXIA 4PTNA 4CLMA 3TCEA 4E38A 1ZCOA 5I3JA 5TIMA 4UTUA 3GVGA 4MVAA 4DPQA 3G3MA 4Q33A 5LSMA 1R2SA 2GPTA 4JEQA 1CX9A 3NR0A 4FXSA 1EB3A 1NVMA 1I4NA 3NA8A 2TRSA 3W7MA 1TO3A 3EB2A 3S42A 1AG1O 4RZ4A 3PUDA 3W2JA 4UNLA 5AYZA 3LXCA 2GQAA 3HGRA 3M9YA 1A5CA 3KVMA 1K7FA 3TJLA 5DY2A 3LCGA 3TE9A 2QCMA 3IIPA 2ZZ6A 4OV9A 1VQTA 3LCIA 3NQ6A 2XFWA 3L67A 2YW3A 2RKXA 3W7CA 4M5PA 4PL1A 4N6FA 3P80A 5BNKA 1JUEA 2C16A 2D73A 3C3NA 1K8ZA 1K7XA 4C1LA 1H7NA 2NV1A 3W7OA 3QQ0A 1QOQA 5AYYA 1X1OA 3I7QA 3H55A 3LV6A 4WOZA 4Z1BA 3T55A 4L4MA 1TQXA 1W5MA 5U7SA 3LCXA 1LBMA 1ICQA 4NJJA 2RHGA 4UC5A 3NVTA 1HG3A 4JXCA 4RR4A 3MJYA 2ISVA 1JUKA 3W9ZA 2WKJA 2A7RA 3G1XA 4AXKA 1EEPA 5K9DA 3U6WA 5G2IA 2LLEA 4KKXA 3O1NA 1D9EA 4MLRA 2HS6A 4JTUA 4P61A 5FF2A 1HTIA 4UFMA 4M19A 1VYRA 3DU0A 4N2YA 5G2HA 3SFKA 5EKYA 3GXNA 3MI2A 2YFNA 1U5JA 4LT9A 4OQVA 4RZ6A 2FDSA 1KTNA 3BG3A 4HT3A 5HWMA 3PG8A 4FHAA 2X2GA 4R34A 4OE7A 4AWSA 3UNDA 1VRDA 4OU1A 2JKAA 3PF3A 1GVQA 1K7EA 3IRDA 4Z1DA 4DF2A 3WK3A 4M6PA 1H1YA 5LNVA 3MI3A 2J6XA 5AHLA 1LP6A 4PODA 3ABQA 3ZWSA 3QMSA 5CPOA 4FNPA 1L6WA 1R46A 1H7OA 2P10A 2WOQA 3CB8A 1LOSA 5F2GA 2Y70A 5FI8A 4LV4A 2QF7A 1W5PA 4JIQA 1W5OA 4RXGA 5AHIA 3M1ZA 3TU9A 3GZ3A 3STCA 1R2RA 4BI6A 1F6KA 1Y0EA 4AF0B 4DEFA 1VCGA 1JR1A 1C8VA 4UMBA 4IMFA 3TQKA 3LCHA 3OEXA 1TCDA 1TREA 4IXHA 3DAQA 1TTJA 3KVKA 1B3OA 1OX5A 4MFDA 2A7NA 3M5YA 3PUEA 1EWEA 5GVJA 3CC1A 3M0ZA 1UB3A 4A22A 4ZQRA 1DQXA 1MZHA 2HMCA 4IWWA 2V81A 4Y9AA 3H54A 4WUIA 3SECA 3KHJA 1YTDA 3EX2A 1LOLA 4QQ3A 3TQVA 1TTIA 3M47A 4K8HA 4QM1A 3G1HA 3BGGA 1HUVA 3TROA 5TQLA 4AAJA 2CLFA 4Z1CA 4ORMA 1B57A 2GQ8A 4N9EA 3NPUA 3QQ1A 5DLCA 1BTMA 2A1YA 4LW7A 3E49A 4O4WA 3L65A 4DF1A 2YXGA 1TSIA 4ZQCA 1BWLA 3DFPA 3FJ6A 1A50A 1VLWA 4YMZA 4NUWA 2NLIA 2YYTA 1G4SA 3QYQA 1IXQA 3MHUA 5I3HA 4ZQPA 2QR6A 2H6RA 2Z6IA 1KFBA 2ZA1A 2ZRYA 4UTIA 3CQ0A 1EUNA 1X1ZA 2I14A 2Y62A 3L5MA 3PC0A 2GVLA 5C55A 4PFMA 3LHTA 5DY3A 3MYOA 1XC4A 1L6YA 2P1FA 3NYZA 1TMHA 3SW6A 1AW1A 4HSNA 3ATZA 2DZPA 2F7FA 2ZZ3A 4JYDA 1KM3A 3DZ1A 5CSSA 3B8DA 3ZFHA 4AHPA 3C2VA 4AWTA 4B5NA 2QKFA 5HULA 4FX7A 3DBPA 3GXPA 3W6YA 1SO3A 2BTMA 3TXVA 2OJPA 2NX1A 1MXSA 3HG2A 5CGQA 2ZRXA 3IGUA 3LRLA 1RD5A 2RDTA 2DZVA 1R47A 2VENA 4JTEA 4Y6GA 3MYPA 1HL2A 5U4NA 5BOOA 5F4SA 1TPEA 5AN7A 3TFCA 4AH7A 5D33A 3INPA 4UR7A 3W1XA 1KM4A 1ZENA 3R5EA 4LUJA 4MPQA 3RFAA 3USBA 4HNUA 1B4KA 5AHNA 1GEQA 1P0NA 2TSYA 3EWYA 1M5WA 3KRUA 3T4CA 2A7PA 1PCKA 5F1UA 3EX3A 4RV8A 1QWGA 1W5NA 3U2OA 2C6QA 1IIHA 4RX0A 5C6MA 5FF3A 1ZAJA 1XDMA 5EA9A 1IXPA 3KFTA 1RV8A 1PHWA 4NXSA 2CLKA 3EX4A 2EPHA 2C18A 1YDVA 2C15A 1OK4A 2E5DA 1UJPA 2QCHA 3MI6A 4CCDA 2ZRWA 3IVUA 4WD0A 4IPIA 1RZMA 3BVJA 4NZFA 1WA3A 1WAUA 1OFOA 3DFSA 3W2UA 3CEPA 3NQFA 2Z0IA 3CWNA 1I45A 1XBXA 1W5QA 4LV9A 4BF9A 1GZGA 3LTSA 1TYGA 4UTTC 2E1DA 1TPC1 1Z41A 1ZNNA 4TMBA 1W56A 1P0KA 4UTKA 1FWSA 3NOEA 1JQXA 2IQTA 1D3HA 4MUZA 3W22A 5AB3A 3L5LA 4Q32A 3P84A 3W1NA 2ZRUA 4OHQA 5D2XA 4BK9A 2Y7EA 3C8FA 3L2IA 1T99A 4S1FA 2ZYFA 1YYAA 3BLIA 4DXVA 5CZJA 5LNSA 4I7VA 3TMQA 3TSMA 1RPXA 4KFNA 5MHBA 3TW7A 4IMEA 1ONRA 3NPVA 1OFQA 3A21A 4AMAA 3W2NA 2TYSA 2FB2A 1FWWA 1AW5A 4O4VA 3S0CA 3MMTA 3HF3A 3DKJA 1Q6OA 4C1KA 3FS2A 4NT0A 3LXBA 3B0UX 3C0JA 3W7RA 3UWVA 2VXNA 3R2GA 3P67A 1WQ5A 2WO5A 3DFQA 3EWUA 3Q2DA 3GDTA 3VFLA 3WJYA 4LC6A 4ORIA 4GUJA 1F5ZA 2YPIA 4I7UA 1A5SA 1ALDA 5AOUA 3YPIA 2KZHA 1LRNA 3LBMA 3I6RA 1QO2A 1E51A 4H6KA 5AFDA 2NWSA 3MP5A 3RK8A 3QPYA 2VFFA 5D02A 1GTHA 2XN0A 3DHFA 3TXZA 2ZRZA 1MEWA 2ZRVA 2I1OA 4RKAA 4J9JA 3MWAA 1MEHA 5C5YA 4GFSA 2FLIA 5K4ZA 2RDWA 2HSAA 4WY0B 2CLIA 4X3ZA 1K8YA 3PSVA 5DXYA 1EP2A 4A2RA 2J9ZA 4JX5A 3EKLA 2AGKA 1UASA 1NF0A 3W85A 1TV5A 1O60A 4S2CA 3N9SA 1NEYA 4BR1A 3GIYA 1K3UA 3QW3A 4UTTA 1WX0A 1TPUA 1K8XA 4GUGA 1VPXA 2DZUA 2V82A 3M5ZA 2W0UA 3B0PA 3LOTA 2NUWA 4OT7A 2A85A 3G22A 4LVBA 1WBJA 3P5YA 1ICPA 4LVGA 3B04A 2Y6ZA 5SWUA 3A22A 3JR2A 3GR8A 1CI1A 3W7IA 4DBEA 3LCWA 2CFFA 2QCFA 1SZGA 4NX5A 4MZYA 4UFLA 4IMGA 3EX6A 3PM6A 4JYEA 1SW3A 4JTKA 1U83A 1V5XA 5KZDA 1KA9F 3P5ZA 1LROA 3PBWA 2V8ZA 2ATSA 3W1UA 1TRIA 3STFA 3GDLA 2QCEA 5DCEA 2JBMA 3W7KA 3O07A 4UMAA 4TMCA 3TSDA 3N73A 2GJLA 3LLFA 4G1KA 4JD4A 4EWND 4CNOA 1GG1A 2X1RA 1WBHA 1SPQA 4EVZA 4R53A 5I3KA 3FIGA 3C56A 3LXAA 2PCQA 1W0MA 1OJXA 2QUVA 5EY5A 3IVSA 2F84A 1W3IA 1Q6RA 2YW4A 3LHVA 2RH9A 3NM3A 1XFBA 2WNZA 5AC6A 2ISSA 3W7NA 3UWZA 4GBUA 2ZA3A 4JTHA 1X6UA 1JCMP 1XKYA 3ATYA 2Z1BA 3F03K 1OK6A 3FKRA 3N3MA 4NQ1A 4MJZA 5FESA 2V0TA 3M5VA 3G1YA 4QSHA 4ADTA 4ALDA 2A21A 4LS2A 1X7FA 1SW0A 3C4UA 4XKYB 3BLFA 4PC8A 3W7QA 3W86A 3LI1A 3FJLA 1S5TA 2CZ5A 3NZRA 4UTJA 4JX4A 3MHGA 3W2KA 4LNYA 3HPZA 4IMDA 4QAIA 3HOJA 3O05A 4XBSA 5FF7A 2YYUA 4O18A 5G4EA 1GJPA 1J4EA 1LRQA 4ICNA 1TV7A 1DQWA 5E1QA 2YDAA 3GLCA 1G4PA 3EXRA 4O1CA 2YZRA 3SZ8A 2ABBA 3NPWA 1SUXA 1OX4B 1WXJA 4MY9A 1L9WA 5T26A 4NNAA 4O16A 4DO6A 4UTWC 4H3DA 3IGXA 3EX1A 4HNNA 4NNCA 5H2ZA 5AC8A 1JCYA 2VEPA 1VLIA 2EAWA 1TTPA 3TAKA 5HR6A 3W71A 1I8JA 2E5BA 2DZTA 4YWIA 3UYCA 1DJQA 3G1AA 3I7SA 4TX9A 4N9BA 1WDWA 5HUOA 1I2QA 1HO4A 2JKPA 3W1TA 3PUOA 1S5WA 1QFEA 2C19A 4DQWA 4UFJA 3ZR4A 3OIXA 1DHPA 4N4PA 1JULA 3UPBA 4RZ5A 5I3GA 2DZWA 3UXAA 2E68A 4FB7A 3L0GA 4U4MA 1FDZA 1EUAA 1WOAA 3W3OA 1I2RA 2CWNA 4HIBA 2QCCA 4ADUA 1IIGA 1YPIA 4NXKA 1QDSA 3OA3A 3PVFA 4IQLA 3W1PA 3ANYA 4TO8A 4EF8A 2TPSA 1OVDA 3E02A 1O95A 3ABRA 3MO7A 4FIQA 4GUFA 2VELA 5L9FA 3C2FA 2V5BA 3JRKA 4K36A 3LRKA 3N19B 5HJLA 2OZ0A 3D0CA 3CPRA 2NWRA 4WJEA 3LX9A 4CQ8A 2R8WA 4CCEA 4AHQA 1XL9A 3TV8A 4QJ1A 1F73A 2QCLA 1OHLA 1HFBA 1G4EA 3PWAA 3WK2A 1QR7A 4O10A 5C54A 3R8RA 3BW4A 3AJXA 4HSOA 3FEMA 1YADA 2DJLA 5H91A 3NQ8A 5G5IA 3ABOA 1PV8A 3LCLA 1G69A 1L2UA 4QNWA 4K7VA 1W8SA 3AO0A 1KLZA 3A5VA 5KZMA 1JJKA 2A0NA 3UZ5A 3WJZA 4RJEA 4X22A 7TIMA 3M16A 3FYOA 4N6EA 3C2OA 2HTMA 1W54A 5K3VA 1F7BA 1FWNA 1TJPA 3TNOA 3MUXA 4UTWA 2Q3OA 1KM6A 1QOPA 1QPNA 1SO6A 1FWTA 2H3DA 3GK0A 3PR2A 1RQBA 1P4CA 5F2IA 4E2DA 1T0OA 3GX9A 3TR2A 1DOSA 1GVOA 1EP1A 1SO4A 1WOBA 1UUOA 1Z44A 3G18A 4KWWA 1SZNA 2B0MA 3WK0A 4ZL1A 2XN1A 3L68A 1R30A 4PEKA 5D09A 2V2HA 2ZZ4A 4NJIA 2P0OA 3P7YA 3R12A 4ML9A 2Y7DA 1HO1A 3MP3A 2CZFA 1SW7A 3TDFA 1LZOA 4WXZA 2AAMA 5F2LA 4O52A 5AYXA 1YPFA 4AHOA 3IIZA 4ZQMA 1VZWA 3CLMA 5KZEA 5L6UA 3M44A 3MHFA 4PA8A 4X9SA 5DBUA 2H8XA 1AK5A 1TB3A 5EYWA 2RDUA 1MEIA 3QW4B 5F4XA 1AL8A 5A8GA 4K39A 2J9YA 1OABA 2EKCA 3CU2A 1ZALA 5DN1A 1THFD 2DZSA 3M41A 1A5AA 5J5RA 2YGYA 1VS1A 1P5BA 2FPVA 4JIPA 2VEMA 1N55A 4YLWA 1ME7A 3DH7A 2OCZA 3M6YA 1FY6A 1M6JA 2Y61A 2Y7FA 4NJGA 4XTDA 3TKFA 3P61A 4AB4A 3F4NA 1H1ZA 3UWQA 3O6DA 2V5LA 2YFOA 3N9RA 3W84A 3QF0A 3E0IA 4LOCA 5EL1A 3BV4A 2ZCGA 1TRDA 2Y89A 2QJGA 4BFAA 1Z42A 6ALDA 4L4LA 2Z6JA 1H61A 1GT8A 2QCGA 3SGUA 5LHEA 1KLYA 3G24A 4O13A 3TC7A 3MW7A 4CNPA 3TK7A 1Q6QA 5EPDA 3W7PA 4O12A 2EGZA 2QCNA 3HQ1A 2E6YA 1PHQA 2BWGA 3NQGA 3UY8A 3C61A 4UUIA 4MJMA 4Z0JA 3NGJA 1VYSX 4RCXA 3STEA 3NQ7A 1UCWA 1B9BA 1W3NA 3SY5A 3LGEA 1J5TA 2R14A 5AHEA 4YL2A 4X2RA 1SZEA 5K9XA 4U28A 1DVJA 3G1FA 4UIOA 3S9YA 4FX6M 4IUOA 2QCDB 4HN4A 1O5KA 3RMJA 1OFDA 2WV8A 1JCXA 1FCQA 2B7PA 3W1MA 4PH6A 1KBIA 1XI3A 2NX3A 5D32A 4R7JA 1AMKA 4R33A 3EWXA 5E0KA 3VI2A 4AF0A 1XBYA 3IIXA 3ZWTA 4MY8A 4Y90A 3PB0A 4Z1AA 3LRMA 2NUXA 1O4UA 1DBTA 2JKEA 3ZS4A 2CU0A 4LY8A 2VEKA 5J5DA 1KW1A 2ZQ0A 3S5OA 1DL3A 4XWUA 4IX2A 4MY1A 2OMAA 4RLIA 4YCOA 3VCRA 3PBUA 5HMSA 3OVQA 4ZZ9A 3CTLA 4POCA 1GYLA 1R2TA 4DPPA 1PCWA 5C2XA 3LERA 1VC4A 3E9AA 3W1QA 2H90A 4DO4A 3PSWA 2VC6A 5CPMA 3QSTA 4FNTA 1Q6LA 3L0NA 2X1UA 3KOFA 2C1HA 2NV2A 3P62A 3NQDA 3A24A 2NXGA 2O7SA 3NEVA 4P2VA 4K7YA 5AC7A 2B7NA 3B0VC 4MKNA 3UXDA 2OT0A 2WPBA 2CLLA 2QDHA 3O15A 1G6CA 1GWJA 3SIZA 1OFBA 1PS9A 1IF2A 4DF0A 4QITA 4FX8A 2DZXA 1G7VA 4UR8A 1KM2A 3BGJA 5F1VA 3ABSA 2BXVA 1IXNA 2FB3A 4KFOA 1YXYA 4FNUA 1Q45A 3WK1A 3TA6A 1FXQA 2Z2UA 1TV8A 5FEZA 1K03A 4IPJA 4YCPA 5D2YA 4N02A 1FQ0A 1LRTA 4IX0A 3LHUA 4MZ8A 4UTMA 3VE7A 1KV5A 2CLEA 2ALDA 1KTBA 1LYXA 4M7TA 4DELA 3TC6A 3DXIA 5IM51 4M6VA 1LORA 2ISWA 1JVNA 4LS0A 3OVRA 2QUTA 1XCFA 2PRLA 3LI0A 4Y96A 3KAOA 2JGQA 4ZMGA 2G96A 1TQJA 3S1VA 2G95A 1KFCA 2QAFA 2B7QA 4NNBA 4LVDA 5FF4A 1DV7A 3GDMA 1OYBA 1DJNA 2V9DA 2CW6A 1KV8A 4M6QA 4H4IA 4TIMA 3LHZA 3C6CA 5F4WA 3NL3A 5DBTA 3IIOA 3LM7A 5IBXC 3F1QA 4O1BA 5EBUA 4D2JA 3BLEA 2FPTA 1XM3A 3TX9A 4IXXA 5LGXA 3HGSA 4QISA 1SO5A 2J9XA 2E5CA 4K37A 1FCVA 5ABTA 1TPDA 3TUUA 3W7JA 1XDLA 4KWVA 3TQ0A 3IV3A 4GRSA 5AHMA 1RQEA 3DKLA 1L6SA 3IVTA 1RR2A 3P81A 2Q3RA 1JRCA 4ZVJA 1ME8A 1EX5A 1VH7A 4NVTA 3LTPA 4QNEA 1N7KA 5KMYA 2PURA 4PL2A 3S1WA 3E96A 3UWWA 2BZNA 1KFKA
chains in the Genus database with same CATH superfamily
2QVHA 3RR4A 5A6BA 2VFHA 1F76A 3QMTA 2R1MA 1CENA 3NZGA 4I6VA 1GHSA 2HQAA 3SR7A 4FALA 4UZUA 4O19A 4Z42C 4WQ6A 1NP0A 4X9YA 2PWFA 3AHXA 1O1HA 3K46A 3ZVHA 1FXPA 3VKJA 1EOKA 3AHYA 4LAMA 1EGVA 1VJZA 1MSSA 4YHGA 3CAKA 1LLZA 1M7PA 3TNBA 1UD5A 1KRAC 4XD5A 2IXUA 3M43A 2VJXA 2GDVA 2F2HA 4ADSA 2HV5A 4NZJA 2VKZG 2H9AB 4MPKA 5JIPA 1B0IA 5IBXA 4TXEA 4KQNA 1IXOA 4B4FA 4Y8FA 2QEZA 1L0PA 3N25A 1ZAHA 2I56A 3ANVA 3H26A 3OHIA 3NL6A 1TPH1 4MYAA 3DI1A 3CUIA 1FCBA 4GY1A 3WQOA 2JF7A 3NEHA 3EA3A 1RALA 2A4AA 2OX4A 4Y9OA 2GGHA 2WCSA 3U48A 2PRHA 3U9IA 3ZSTA 3UR7A 1SFJA 3OOQA 4LYQA 2QV4A 2Y24A 1XXXA 1ZSXA 1RSCA 3O6YX 5XIMA 2ZUVA 2VI0A 1PIFA 4G56A 3EAUA 2NW0A 1KB3A 5HUPA 5D05A 1YQ2A 1MMFA 4QEHA 1UPMB 3BG5A 1C29A 2GDQA 3WX7A 1KKRA 2F61A 3HO8A 3NSXA 1TELA 2PF0A 1PKLA 4Q8TA 3A4XA 2WCAA 4Q8QA 3A9IA 2C3ZA 3MUY1 3WLTA 4MOZA 1GNXA 2VP8A 3P3BA 3IUHA 3KVJA 1MQRA 3UU0A 1ZRQA 4A2SA 5A2BA 5EB8A 2WVVB 3E0LA 2WMJA 3H2OA 2XH0A 2PDMA 5AYIA 5KETA 2HS8A 3QM3A 1OFAA 2CESA 3TYDA 2PE4A 1F07A 4CQ9A 1D3GA 3MSDA 4R3UA 3G8EA 2DU2A 4H83A 5JU6A 1W1ZA 4A29A 3KOYA 3QV9A 3L5AA 2G3IA 1XLFA 4Z0SA 2WJZA 3PBMA 1EJWC 1QWKA 3KXQA 1IWBA 4JN6A 1CXFA 1UJQA 3N6QA 4GD0A 5A95A 4QJ5B 3EWZA 4Z2LA 2BLEA 3W1RA 1EC8A 1MUCA 3A5FA 4JQ4A 1DIEA 1ML1A 4LX4A 4JIRA 3CL6A 3QLDA 9XIMA 1QI5A 1YW1A 1TUXA 3A3WA 4Q8MA 4MSSA 5D37A 1HVXA 4FNQA 4IFKB 2EHHA 4JDBA 5BWFA 4GNJA 1JZ8A 3TONA 1CNVA 4QBXA 4JYFA 1VEOA 1W1VA 1XSIA 2AQWA 2E25A 1KM5A 2J24A 2YB4A 2FZBA 4YYFA 4AIOA 3MMWA 5D2TA 1GQNA 5G2WA 2QJNA 4IPLA 1J2WA 1V03A 3BLKA 1KRCC 1GQLA 3W2MA 2WM1A 6REQB 1TTQA 1VGAA 3VD7A 3GAKA 3M0LA 2INFA 2A3EA 3BW3A 3PTQA 4JTSA 4JOMA 4PSPA 4L1GA 3TMLA 5DELA 3N6HA 4DWSB 4J35A 5H8PA 1H7PA 2A3CA 1BRLA 2R1NA 2GQ9A 1M41A 3RF9A 5FF0A 4GI4A 2R1PA 3WQCA 2CLMA 4I9MA 1OFEA 4OFCA 1KCZA 4GY0A 5CPTA 4DUVA 2X30A 3B06A 1E6SM 1JQVA 1UH4A 4NU7A 4K38A 3GZAA 5CQ1A 1UUMA 1A3WA 2XGZA 3N14A 4EWJA 2WVSA 2FGBA 4XVEA 3HQOA 2NVDA 2C1IA 5I0DA 1QMLA 1P0DA 4Q8PA 1WDQA 3LHWA 3UERA 1B54A 1PUDA 4WX2A 1E43A 5CEWA 4M29A 2PLCA 2X1SA 1QAPA 4DO5A 4MFEA 4RPPA 3ZYZA 4H9VA 3AYSA 1R6WA 1KFLA 4BI5A 4X0NA 3LENA 2I9EA 3KHDA 1GTEA 3GKFA 2PU0A 1S46A 4HHHA 4LRTA 4MGGA 1WYIA 1GZJA 2PODA 2D1ZA 3W87A 2ZZ1A 2JQXA 3IGSA 2JE8A 5DCDA 2YB1A 4UQEA 4A4AA 3FLUA 1SFLA 4DNHA 1E6NA 1E40A 1JEZA 1POJA 1W31A 4D8ZA 2L5HA 3HPXA 4JFTA 4QIUA 1UR0A 4G9PA 2Z1WA 1HKMA 2ZIDA 1KM0A 4KH2A 3ORWA 3ITXA 1FHVA 1W3HA 3S5ZA 1AH0A 4PMNA 1E4MM 3O16A 1GCYA 1TMLA 4Q8WA 3BARA 3H2CA 4ILSA 3OTRA 3UJRA 3HBLA 3QR3A 2A6LA 3V5FA 1OFPA 4AMCA 1UA7A 3FKKA 3P6LA 4N4QA 2ONEA 4S3DA 5HNRA 1XIMA 1E55A 3BPWA 4XK2A 3HPSA 1Q8JA 2X40A 2Y63A 4AVFA 4Q7IA 2DW7A 3KCJA 1KXQA 3VKDA 2QUNA 1BVWA 5C2GA 2R94A 3TWBA 4S39A 2EPOA 3T44A 4S3CA 4DBDA 2ZX9A 2W62A 4HHPA 4J3ZA 4WOQA 3PAJA 2J78A 3TYZA 1C92A 1CLKA 3KRZA 2CLHA 3OLIA 2ESCA 2W66A 4YYCA 5JBFA 2DEPA 2VUNA 1LG1A 1ISXA 5IRPA 4UFKA 2R1LA 4I3GA 2XSAA 1J6OA 4R27A 1UR3M 4UFHA 4NY2A 4PMOA 3BH4A 4HMCA 1HP4A 1PWMA 3E12A 2PSNA 3AC0A 3HG3A 1GG0A 1YLVA 2Q01A 1GK8A 2DQWA 1OG0A 2FZ8A 5BW6A 3WBWA 2QNEA 3VNKA 4JFUA 2DUAA 2DSWA 2V5JA 1V0LA 2HBXA 3B05A 3N29A 4GVIA 3GG0A 3QC3A 4MJ4A 4W7VA 5G1TA 2IW0A 1NOWA 4JQAA 3L2MA 2ZX5A 5HANA 3AYRA 4JHZA 1LCOA 3QC0A 3CIWA 1JCTA 2GVEA 4J3UA 4MNMA 4MTVA 4WLCA 2NQ5A 3U4AA 3LA4A 3UY7A 2ZBTA 3LQLA 4H9TA 2HXUA 3H53A 2Y4SA 4PMZA 1W3TA 3LV5A 4PMUA 4F2TA 5CAHA 4PMVA 3PBVA 2W79A 4F2BA 1VBJA 4A05A 1TWDA 1EA0A 3GIPA 1JPDX 5A1AA 4LYKA 3HU7A 3O8AA 1MO0A 1RK5A 3AI0A 2XGIA 3SRHA 1T41A 2XN2A 5E70A 2FJUB 2G3NA 4XBJA 5I3IA 2J75A 3IEBA 2ZZ2A 1EYEA 1RJPA 3RJXA 1MFVA 5I5RA 4H9YA 1GW1A 3BTNA 2WSRA 1UYQA 1EGMA 4GE8A 1LUCA 4JIEA 3EMZA 3AMCA 3RNDA 2CBIA 2FTWA 1DKWA 1Q2SA 4AY1A 3PNZA 2GVGA 3UCQA 3GNXA 4CNNA 1H5YA 3U0HA 3C2YA 3KP0A 1K6AA 1SQ7A 2WM0A 4B5TA 1CB7B 2HISA 1VHNA 1JCJA 4JTGA 5CXPA 1MQPA 3GYEA 3HIJA 4M1RA 3MQTA 3PULA 3SUUA 2PRMA 3CUFA 1B9ZA 4I7WA 4XD3A 4U2YA 3AWOA 1GKRA 3WEZA 1LTDA 5T8GA 1CGXA 3KVLA 3R89A 1NH6A 3CO8A 4ZCWA 1S2TA 2GOUA 4XZBA 3Q94A 1EWDA 1BYDA 3MS8A 1PVNA 1C9DA 4JIHA 5CPLA 3BICA 1ZCOA 4UTUA 4DPQA 3G3MA 2FMNA 5C7VA 4Q33A 4BS0A 1R2SA 3GE7A 4FXSA 4C7DA 1EB3A 3W7MA 2FDMA 2V5CA 3EB2A 3S42A 4WRHA 3BAYA 1AG1O 4HA1A 1N2VA 3PUDA 4UNLA 4H2CA 3PZIA 3LXCA 3IJLA 1C3FA 1QOXA 3U57A 3LUTA 3VIIA 1A5CA 3WF2A 3SM0A 1V7AA 5HK4A 4DWSD 1E73M 2DIJA 4W85A 2FH8A 3SCSA 4JTCA 2AL2A 3VZYA 3R4IA 2ZZ6A 2GWGA 1A4LA 4NHVA 1EJTC 1K4HA 1RP9A 3L67A 2RKXA 3V36A 4A3YA 3W7CA 4PL1A 3P80A 1KRMA 2C16A 2D73A 3G77A 3ITLA 3E74A 1BTCA 3VTRA 1BYAA 3B0XA 2OLSA 3L4UA 1GJWA 4RW3A 2XVLA 3N15A 3KE0A 1FWFC 4Z1BA 3T55A 1S39A 1W5MA 1C90A 5U7SA 3BAIA 2BHYA 1ICQA 1JIBA 1HJWA 3WQ6A 2BVTA 2EEXA 2PDBA 3QLLA 1KR0A 1HG3A 1BSIA 1NARA 1VFOA 3H2FA 3MJYA 3RIKA 1JUKA 3W9ZA 4KGLA 3H7RA 2OELA 3BOXA 4QHRA 4KEZA 4CU7A 1XLAA 4KMQA 5D9NA 5TAOA 1F9CA 4MLRA 2G3JA 5FF2A 3CL8A 3FV9A 4UFMA 2PDLA 3DU0A 2ALRA 4ZENA 1J5SA 3MI2A 2ZWZA 4A8NA 1U5JA 4OQVA 4RZ6A 4HQVA 1KTNA 2PD5A 2X41A 1F3WA 3XINA 1RHCA 3TVAA 1ZCCA 2F2KA 8RUCA 1VRDA 1PTGA 4OU1A 2H9AA 1NM9A 4W88A 4DXXA 3WK3A 2VX6A 6XIMA 4A8LA 3FYYA 3GXFA 3SADA 5AHLA 5GJPA 3ABZA 3T0DA 3ZWSA 1Z8AA 2DH2A 4HBKA 1SJBA 2Q09A 4FNPA 4GGBA 3E2RA 4JFVA 1WUEA 5FI8A 4LV4A 3GXIA 3MJMA 1W5PA 3IARA 1W5OA 3EDJA 3C0QA 4EACA 4F48A 5H1WA 2XZ7A 3MT1A 4FOUA 1Y0EA 2WANA 2UY3A 1UOKA 3FAXA 3TQKA 3LCHA 4IXHA 4J7RA 3UA3A 4P8XA 2D23A 4MFDA 2ZADA 3A9BA 3HN3A 1F61A 2WB5A 3KOZA 2D69A 3M0ZA 1RUSA 2QMJA 1GOWA 1MZHA 3MTWA 2HMCA 5HJXA 4IWWA 5D9MA 3VO0A 4Y9AA 2YA0A 1DE5A 2G3FA 3VCCA 4QG8A 1GQIA 4V15A 3M47A 4B3KA 3FN9A 3TROA 3ZOAA 1V0KA 4OZOA 1EJXC 1GORA 2CLFA 3NUKA 4DWSC 4QJ3B 3R0KA 3I4EA 3NPUA 3WH9A 4IIGA 2A1YA 4LW7A 1QHZA 2WVVA 1EIBA 4ZQCA 3G6LA 3ZT7A 1BWLA 2RDXA 1IEIA 3DFPA 1A50A 4AC1X 1JDAA 2BP1A 4DBUA 1FHLA 4GCXA 5I3HA 2Z6IA 1KFBA 4C6OA 4LEQA 4YTQA 3JZUA 2XHYA 4ZFMA 3UCDA 4RDZA 3NYZA 1OCQA 2ZVRA 3PUGA 2VX7A 4EP8C 2W9MA 2CEQA 3UA4A 2PAJA 4V2XA 3ZFHA 1Q8AA 3RMEA 4G2DA 3DBPA 3W6YA 3TXVA 1FKWA 4W7UA 1XKJA 3HG2A 1OSEA 5CGQA 3RGTA 1U30A 1ODZA 2RDTA 1R47A 2VENA 2YLAA 4Y6GA 3TCSA 4IFKA 5BOOA 2PDFA 5ABGA 1TPEA 5AN7A 3CS2A 5D33A 4AH7A 3M46A 3W1XA 3O3RA 1ZENA 3PZUA 3Q65A 4TX6A 2PS2A 4AIUA 1B4KA 3N2BA 4C60A 1GEQA 2TSYA 3ES7A 2CBUA 5HAOA 1M5WA 3H70A 3KRUA 4DJEC 5A8OA 4KW2A 6REQA 2WZIA 2ZUMA 4RV8A 3VKBA 2C6QA 1UD8A 4FZIA 1WE5A 4BQ2A 5EA9A 3MB9A 1W9BM 3QQWA 3F5LA 2DY3A 2QCHA 4AG0A 4CCDA 2ZRWA 3IVUA 4NZFA 4DWSA 4M51A 4I9TA 4ZA0A 3SUTA 3DFSA 1RY8A 3CEPA 1IEWA 2Z0IA 4PTVA 1Z3NA 2FVMA 1Y65A 2VR2A 2BOGX 2E1DA 1TPC1 2EPNA 5C9RA 2YCKX 1FHDA 3M0YA 1FH8A 4C6KA 2WHMA 4IPNB 2OU4A 1WKYA 4TV5A 4YWSA 2D24A 1UWAA 4Q32A 3P84A 1X1NA 2BHZA 1OY0A 4S1FA 2ZYFA 4Q4MA 3WDPP 3B40A 3Q67A 3QYSA 4JQ1A 3Q4DA 4HOWA 5LNSA 4I7VA 5C8BB 3TMQA 4BQ5A 4IMEA 1XIFA 3W2NA 2ACSA 2B81A 3WUBA 2GSJA 3S0CA 3VOJA 2QGHA 3WNMA 5CGTA 3FS2A 4NT0A 3C0JA 1AH4A 1NQKA 2VHLA 2PMQA 3QR1A 3GDTA 1ZQ5A 2WSPA 4LAKA 5ABEA 4ES4A 2W3ZA 4CQBA 4GUJA 2VR5A 5AZ0A 1A5SA 1RCXB 3R10A 3OB8A 4WJ8A 3B9NA 5AFDA 4LSBA 3MP5A 4DJEA 3WCZA 1GTHA 3T42A 2GDUA 3TXZA 1MEWA 2YL8A 2ZRVA 4RKAA 3WELA 4QLKA 3VDBA 1FOBA 3VZZA 3LNMA 5K4ZA 1ITXA 4ZSUA 3GM8A 1IZKA 3E0VA 2CLIA 4X3ZA 2OEJA 4GABA 1GKQA 1IYXA 3EKLA 4L6HA 1TV5A 2J7BA 1O60A 4BR1A 3GIYA 1K3UA 1AODA 3QW3A 4KPLA 1IEQA 1TPUA 1K8XA 1X98A 2W0UA 3CUGA 4JTRA 2V3GA 1BVZA 3V35A 2CZVA 2DPEA 4KS0A 3A22A 4FMVA 1WUFA 1JAEA 4DBEA 2CFFA 1SZGA 4NX5A 1LG2A 4DAIA 3PM6A 4CEXC 2Y5EA 3P5ZA 1EJSC 3PBWA 4GYKA 3HMCA 2PLMA 3STFA 1M04A 1XLDA 2XIMA 2CETA 3O07A 3TSDA 1BF2A 2GJLA 1XWYA 1YHTA 3GBEA 4JD4A 4CNOA 6ENLA 3I3DA 3T0AA 2V5KA 1SPQA 4E2OA 3LXAA 3C56A 5B7YA 1OJXA 2QUVA 5EY5A 3W25A 4MJ2A 2F84A 3LLXA 2BY3A 4D6FA 2RH9A 1XFBA 2WNZA 5AC6A 1Y8BA 2ISSA 3OW1A 5A94A 4GBUA 1X6UA 3RILA 2Z1BA 3F03K 1OK6A 4NQ1A 4KRZA 5FESA 4C6IA 1W1A1 3W4RA 3M4HA 1E9LA 3OGRA 4XKYB 3BLFA 3SY1A 2UY4A 3W7QA 1UR2A 2NSXA 1FWIC 3W2KA 3RX2A 3VYLA 4IMDA 1PYMA 3HOJA 3K8KA 3CYVA 4GCAA 1R3RA 5G4EA 3EB3A 2PWVA 5C9UA 5E1QA 2C8NA 3SCRA 3CZGA 3BZGA 5FCZA 3O7UA 3BV7A 4IFRA 4H19A 7XIMA 2Y8UA 2OOGA 1XD0A 1J79A 3NDZA 4NNCA 1JCYA 1OC5A 3BCDA 4TVUA 5EFFA 5BU6A 1VLIA 3HM7A 3TAKA 2JALA 2DH3A 4YWIA 1DJQA 2XIOA 4LY4A 4PMYA 1Q7QA 2JKPA 3W1TA 3PUOA 1EJRC 4IIFA 2C19A 4DQWA 1OD0A 3UPBA 2E68A 2HRWA 4H8NA 3W26A 1FDZA 4PULA 1WOAA 3FXGA 3I6EA 3GVQA 2CWNA 3N6JA 3A64A 4HIBA 1XX1A 1KBLA 2VC5A 4XUYA 4G8TA 5B7ZA 3SRKA 4QDPA 3ANYA 2WHKA 2ZUTA 2G41A 2GUBA 4FIQA 2VELA 3WIJA 4C6MA 2OEKA 3WLRA 3D0CA 2NWRA 1J01A 4U5IA 5LIKX 1WDPA 2DT0A 1B3WA 3U3HA 4CQ8A 2VQUA 1RJRA 4US5A 2VX5A 1OHLA 4P8UA 2JFEX 2UWFA 3GFXA 1H0GA 1QR7A 4O10A 3RRXA 3KTXA 4RPQA 1OT2A 5LXEA 1XIHA 4PTXA 3NQ8A 2FZNA 4P7LA 3N4FA 1LQ2A 3AIQA 1PV8A 2G0WA 1G69A 4RDYA 1L2UA 4QNWA 1JZ5A 3T0BA 1MUWA 3A5VA 2QVNA 3WJZA 3VMOA 4X22A 2VRJA 4NRRA 1F7BA 1NWUA 3A4AA 3MUXA 1UPPA 1QOPA 1SO6A 5CJ5A 1P4CA 1KR1A 1BG9A 4GG9A 1WOBA 7ENLA 3WMSA 2PPGA 2DUZA 4KWWA 1SZNA 3PHAA 1B3YA 1C8YA 2DSZA 2HJPA 3WK0A 2QIIA 3TN5A 4LAOA 3AXXA 1HGYA 1U1UA 2GGIA 1MW2A 3CB3A 3P7YA 3TJ4A 2Y7DA 1HGWA 3R25A 3MKKA 4DO7A 4J2PA 1QNQA 4ZTXA 5XIAA 1XRTA 4JFWA 3IIZA 3CLMA 4DI9A 4YIWA 4PRWA 3MHFA 1J93A 2H8XA 1OABA 1FWEC 1BD0A 1R5YA 2HCVA 3M41A 4LCSA 2YGYA 4LCQA 2VEMA 6CGTA 1N55A 1XGDA 5C71A 4FI4A 3DH7A 4E3TA 2Y7FA 3BE7A 1XS2A 1DIKA 3P61A 4XV0A 2QDDA 1EC9A 1O1ZA 3UWQA 1F3XA 1E72M 3K4DA 4JN8A 3N9RA 2VZVA 3QF0A 1UIPA 4XIMA 3BV4A 1VPQA 1GVIA 1BXNA 1L8PA 4BFAA 1SYTA 3AFBA 1H61A 3W81A 4BJHA 1RPKA 2CBVA 5ABFB 4O13A 2E8ZA 4O12A 3GTNA 1US2A 3UT0A 3VX1A 5BOFA 4RV3A 2BWGA 1HKJA 4UUIA 1PDZA 5BXRA 4Z0JA 3LGDA 1BXCA 3IANA 2ZWYA 2YDQA 4KBXA 1UCWA 1ELSA 1ZUAX 4DZHA 4HP5A 4X2RA 3ZLGA 4GO9A 5K9XA 5MKGB 1JZ4A 3S9YA 4FX6M 4PBGA 5C7HA 1AJZA 3RMJA 4IQDA 1XGZA 4PH6A 3S1GA 1XI3A 2NX3A 3EWXA 3VI2A 1XBYA 4OJYA 1E5JA 7ODCA 2ASHA 4Y90A 1QW8A 4LNCA 2E3ZA 2JKEA 1XDJA 1I75A 4LY8A 4NKCA 1T40A 2OZ3A 4IX2A 4GNKB 1O6IA 1CGYA 3SCUA 2PU1A 1UC5A 3CHFA 4KGJA 1WDDA 3H4GA 3CTLA 3IJQA 3LD5A 3OHMB 1R2TA 3LG3A 3VDGA 3GU9A 3RYSA 3TP4A 3E9AA 2PZNA 1UQZA 2GZXA 3CUHA 1XCWA 1W1TA 1Q6LA 3L0NA 3WH5A 1DYSA 3WNKA 2X7VA 3QKEA 3P62A 1HQTA 3NQDA 4AZBA 2O7SA 2WC3A 4W84A 2OKOA 1GOMA 5AC7A 2B7NA 4MKNA 3WF0A 1BAGA 3WBEA 1GWJA 1O12A 4QITA 3M0VA 1VFSA 1WDSA 4FXJA 3MZNA 3WSUA 3IK4A 4AD0A 3AXKA 5F1VA 2DT3A 2Q71A 3VD3A 4ERIA 2ON3A 2XTKA 4HCDA 1YXYA 1VBUA 3BOLA 4FNUA 3AXIA 2PTZA 3GVRA 4C7FA 4ENLA 1K03A 3UW6A 4PRRA 5A6MA 1BVNP 4N02A 1JL8A 3TN6A 3T09A 4UTMA 3SEPA 4M7TA 1LYXA 3BSHA 4TQTA 1X8CA 1W8GA 3S6TA 5FACA 1N8IA 2PRLA 2G96A 1TQJA 2B7QA 1TV2A 2POZA 1EF3A 4LVDA 3VA8A 3S9IA 1B31A 1OYBA 5FOOA 1J96A 5A6TC 3VMNA 4M6QA 2X2YA 3LHZA 5F4WA 3NL3A 1O5RA 4J27A 2V67A 3J7HA 4O1BA 1P1MA 3R94A 2PTXA 3TX9A 2J9XA 1XGEA 4K37A 1CXIA 4IHCA 3TQ0A 4L65A 4GRSA 2X0HA 1RQEA 5BXSA 2Z4GA 3CQKA 3LNPA 4OKDA 2X05A 3PBGA 3IVTA 2DVTA 3RU8X 3TZNA 3LTPA 1N7KA 4PL2A 2J7GA 2XPKA 4HPHA 3UWWA 3NG3A 1ONWA 2OXNA 2VDGA 3DENA 4DXKA 4H9ZA 5K4XA 1QO5A 4WHBA 1TWWA 1W6TA 3AMDA 2XFFA 3ZMRA 3MSGA 4H04A 3WJWA 3FVDA 1PZ2A 3DFNA 1B90A 1TZZA 4WXYA 2Y8VA 5BROA 3N13A 3RG6A 4JTAA 4A3QA 1ISVA 1G9HA 4WKAA 2EG8A 1FUYA 3C2RA 2YDSA 3LHYA 3WMCA 2IKIA 3XISA 2SFPA 4NASA 4KWUA 1G7UA 1PZ1A 2PP1A 2C13A 4GVHA 1TVPA 4M56A 4S3EA 4OWGA 3PJWA 4D6EA 3I10A 4ML4A 4RE3A 3WD0A 5HQEA 4IQJA 3T40A 3F2CA 1V02E 1B4EA 4KFPA 3NM1A 4LRSA 1E6PA 1W3KA 3LSCA 1PIIA 3BJTA 4UXDA 1H62A 2A2IA 2OGJA 4W5UA 2VFIA 1E4LA 5BWAA 3NL2A 3W0KA 5DMNA 3UQNA 5F2MA 1UP0A 1ZFJA 3NXFA 4E8DA 5ECVA 3KZSA 4LF1A 1NF7A 5BRPA 2X42A 1VFUA 2YJQA 4UCFA 3BW2A 4ZXLA 3STGA 1M01A 3LEPA 4U5KA 2PGWA 2QDEA 4M6UA 1O94A 4D6IA 4WF7A 5D4YA 3TC3A 2CYGA 1ZZMA 2WC7A 2V2DA 4F66A 1E1FA 3V5CA 5KITA 1SSGA 4QS6A 4HB7A 1GQKA 3H7UA 1QHPA 4N9DA 4OECA 3BDKA 3V75A 1M65A 1Y5XA 4NZ1A 1XD1A 3U4FA 3OO2A 4KEVA 4O57A 1SR0A 5H8MA 1XYCA 4LTSA 4JR5A 3R11A 1UIOA 4QEEA 1R9ZA 1L2QA 2WK2A 4N7QA 1EOMA 3W76A 1UKOA 3Q58A 3PY2A 4NZ4A 4JTFA 3WNOA 1H51A 2P8CA 1OF6A 3OYZA 2O4QA 3SCTA 2WLZA 4QDMA 1EIXA 4CUCA 2P76A 3LBOA 5T91A 2JIWA 1OX6A 3UZXA 3PZ9A 4HA0A 3WMLA 2I5GA 4W9TA 4XKYA 3RLUA 2YIHA 3S2NA 4Q7BA 1TR9A 1TX0A 2J7FA 1E6XM 3OIHA 3T1GA 1H7RA 1HL9A 2QJMA 2AAAA 3C5QA 5LKYA 1H63A 3HPAA 3W88A 1GUVA 3P0WA 3OG3A 3VKCA 1U5VA 3BO9A 3WBAA 3GW3A 3VGGA 2BASA 3E2VA 1VJIA 3R0UA 2P88A 4TR9A 5CPNA 3DOPA 4CN4A 5D38A 3HFYA 3TR9A 4MLJA 3UVAA 3W23A 5KINA 4YN5A 4DM2A 3U2CA 4JAWA 4ATLA 1TPWA 4PBFA 4GNVA 1LL7A 2W6RA 3QSRA 4UTHA 2J27A 3WH6A 1J8VA 3HGJA 3UZYA 1H50A 1D8CA 2WC4A 3GBDA 1GPWA 3DFYA 2Q8ZA 1HKKA 4B91A 2OT1A 2X1TA 1WZKA 3CIVA 5FEWA 2WNQA 1OEPA 4O50A 4DWDA 1W91A 2QGYA 1V02A 4QTGA 1BGGA 2J88A 2KAUC 2OWWA 3NNTA 4GJ1A 4V1YA 1UOZA 1YTKA 3DYPA 1SU5A 4GJJA 4D72A 3ENLA 1FDYA 2OODA 3BQ5A 4LB3A 3W1LA 2RFGA 1A5UA 4PB3A 5CSRA 1CXEA 2W27A 2VZSA 2F6XA 1I1WA 1PEZA 3AU2A 1PL9A 4CN6A 3QRHA 4TVCA 2OX1A 3OBEA 3BJSA 3NZPA 3B8IA 4H41A 1BEUA 3E2SA 3G1SA 5A6AA 2FYMA 1JF5A 1CDGA 3WFAA 5KTLA 3LDVA 1GVSA 1P7TB 1J0ZA 1R3VA 2WBGA 3LM3A 4HU8A 1LQ0A 4GC3A 3URQA 7CGTA 1H2JA 5DXXA 3GNRA 1GOIA 4TVDA 1LM1A 1T5AA 2O55A 4NJHA 1QBAA 3WZ0E 4R9XA 3KBNA 1RA0A 1W1B1 1XH0A 3PZGA 3EOOA 3EMQA 3UVIA 1F4AA 3CEUA 1HF6A 3I7RA 1MRQA 1W3JA 3QZEA 1OFRA 3B03A 4IFOA 1Q6DA 5HA7A 3STPA 3RLVA 4NYUA 4F79A 1W9VA 4MMWA 2C91A 3M6DA 4IZGA 2OKTA 1EHAA 3P82A 4GFIA 4R7OA 4MB5A 4H6EA 3KCLA 1E3XA 4XZWA 3UPMA 4E4UA 3L4XA 4DNMA 3UJEA 1BKSA 4W87A 1PWLA 2G97A 3C52A 2Q02A 3O6AA 1V3MA 1KXTA 2H8ZA 1M03A 2VFGA 1AFSA 3QEZA 1IGSA 2P8BA 1EO5A 1I9CB 2NXHA 1FTXA 3WBYA 3ZXWA 4FLRA 1ZU8A 1KTCA 4C5ZA 3SCNA 4Q4PA 3SCVA 1LBLA 4BQ3A 5E6ZA 1OINA 3WJSA 3CM4A 1QATA 4TV6A 1JRBA 1XICA 1FFRA 4WY0F 2INZA 1XUUA 5C70A 1SVDA 2ZFAA 3ZO9A 2GLKA 5HMEA 4HPNA 5ABFA 3UGRA 1TX2A 3NOYA 1DORA 1KFEA 8TIMA 2CZEA 5CZ0A 5LNRA 1UW9A 3EWWA 4WDUA 1E9YB 1CZ1A 5G4HC 1VYPX 3F5JA 3V0TA 2E6AA 4GYJA 1QW9A 1UHVA 4IOTA 4JTLA 5CJMA 1WB0A 1E0TA 4HJWA 1BPLB 3VC5A 4JKMA 5D03A 5MKGA 1SJCA 1VHCA 4HN8A 4JICA 1UMYA 2G37A 1CXLA 3AIVA 4OOUA 4S23A 1S3HA 4DM1A 3ZT5A 2VDHA 4NF7A 1MW0A 3VGEA 1NJJA 3IJ8A 1DQUA 4NZ5A 3KBSA 4YTSA 1GVFA 1TV3A 2NT0A 3NPXA 4CQDA 3FYPA 4G7EB 4IGNA 4PMQA 2QPSA 3TW9A 1BWKA 5JXQA 3WQGA 4AWUA 1WCGA 1SZFA 1DWAM 4PMJA 1G67A 2XH7A 1XRFA 3CGTA 4UTFA 3WF1A 2NZLA 3O0FA 5G1YA 3BLLA 3RLGA 1EDQA 1A53A 4HPJA 3S1UA 2DIEA 3IJIA 2ICSA 3UXIA 2PGFA 1ODUA 3O2LA 4FNRA 2RGLA 4LUYA 2ZDRA 1YXCA 1D7KA 3GNOA 3FVMA 3G5EA 3GSMA 1V3JA 1GYNA 3ECQA 2YLLA 3CYJA 3GS6A 2I17A 5FEXA 9CGTA 4DYJA 4W5ZA 4ZOEA 1FVPA 2D0FA 3WUEA 1KXVA 2E6FA 4WCJA 1EJVC 1YDNA 2WNNA 1YXDA 2WVUA 4A21A 4R9OA 4HJFA 1F6PA 1PX4A 2PWDA 3W7HA 4UTLA 2Z1SA 3R58A 4LUIA 1BHGA 4QLLA 1XP3A 1V3HA 3ITYA 1H11A 3PBYA 3VE9A 3H2MA 1K6WA 3C2EA 3I3BA 3GG7A 3SI9A 3VUPA 3TWAA 3DFTA 1VIZA 4J3WA 3P0XA 1KBJA 4HCHA 3CNYA 3PJXA 4ZQOA 5E93A 3T08A 2DORA 4P7NA 5CKSA 3D5HA 5K2ZA 4FNSA 4PTNA 3TCEA 4E38A 5M5DA 5TIMA 2WHJA 5CPSA 2WBKA 4FK9A 3DECA 1JPHA 4HMNA 2GPTA 2UY2A 1NVMA 4I8YA 2TRSA 2OSXA 1I6NA 4RZ4A 4GKLA 4GX8A 4PZVA 5AYZA 1R3QA 1QUMA 3S2LA 3QHMA 5TF0A 4UQBA 3GVWA 4AD1A 3TJLA 1GW9A 3CL7A 1UR1A 4ZOBA 2OYKA 3TE9A 4BEUA 4KETA 4OV9A 4Q4OA 1VP5A 3QHNA 3RRAA 1UKSA 4M5PA 3KL5A 1JGIA 4IPPA 1VBGA 5BNKA 1P6CA 3C3NA 3RM8A 4NG3A 1K7XA 4C1LA 1C7TA 2V38A 3QQ0A 4MB3A 4FLSA 3LV6A 4L4MA 1XYMA 2VGBA 4XZHA 3MUCA 3WUGA 4NJJA 2RHGA 4LYRA 4D1IA 3TYUA 4UC5A 1QBBA 3QFWA 4ACYA 2OLHA 1J9YA 4JXCA 4RR4A 5I3DA 3BWWA 3TEVA 1A0EA 3G1XA 3RPMA 2DVUA 1E70M 5K9DA 3U6WA 2OPJA 2LLEA 3HFTA 4PCSA 4UR9A 5ECUA 1D9EA 1LL6A 3PFMA 4P61A 3UJFA 4M19A 1ZLPA 4N2YA 5EKYA 5H8UA 3F2DA 3GXNA 3K8LA 4WEVX 2YFNA 2FKPA 2J47A 3BG3A 1HL8A 1RBAA 2OQLA 3CMFA 1SFSA 3VABA 1PKNA 1IWPA 4FHAA 4EPEC 1AD1A 4AWSA 1QTWA 1TWIA 4TUFA 1Y5WA 3S47A 3PF3A 1GVQA 1K7EA 1IGWA 5JBDA 2VDIA 1PDYA 1ZJBA 1H1YA 2OLAA 3SUSA 3ABQA 1EGZA 1PKMA 1HW6A 4RDVA 1L6WA 1J2BA 5DRCA 3LPPA 1TKKA 5F2GA 2Y70A 4JIQA 3VNMA 4RXGA 1R7OA 3S2JA 3U5YA 3ME3A 3MMUA 3FY1A 1DJWA 4S3FA 1KO0A 4BI6A 4YVVA 2NQ9A 1F6KA 2C71A 4DEFA 1VCGA 3APGA 1C8VA 4C65A 4UMBA 1TCDA 1TTJA 3QGKC 3KVKA 1UZHA 1B3OA 1OX5A 2VTFA 3M5YA 1GEHA 1PPIA 5CC3A 3CC1A 5HQLA 3KBWA 2JEPA 3QZ6A 4WUIA 3SECA 1REQB 1YTDA 3WG6A 4GY7A 4K8HA 3GUGA 4J3VA 3BGGA 5HMFA 5TQLA 4GQBA 4Z1CA 1B57A 2GQ8A 3WEOA 3V7PA 3WN6A 1TJ1A 1ZBVA 3IAQA 2V3DA 4H8VA 4CVUA 1TSIA 2A3AA 1GOOA 1Q4WA 4WR3A 4YMZA 4NUWA 4FSAA 3DG7A 3T0TA 1G4SA 2XVGA 4HMDA 1VFTA 3WYZA 1IXQA 3T6CA 4ASTA 4ZQPA 2HPIA 2QW5A 1V6XA 4EE9A 3GD6A 2H6RA 1PTDA 1EUNA 1H5VA 2Y62A 1XFCA 4PFMA 3LHTA 4JN7A 1XC4A 3L4ZA 1YNPA 1AW1A 4HSNA 2DZPA 2F7FA 1KM3A 5JQ9A 1TWZA 3VKKA 3C2VA 1IT7A 3UGVA 4B5NA 4XO7A 5HULA 2NVAA 1E71M 4UNIA 3VDHA 3IJ7A 2BTMA 2OJPA 3KL0A 4PUWA 2ANUA 2C7FA 4JTEA 4V33A 3R8GA 3MYPA 5F4SA 2QYGA 3INPA 1L6GA 1KM4A 4J28A 3K8MA 4L9ZA 1TZ7A 4LF2A 4LUJA 3BL3A 3V18A 1P0NA 3EB4A 2CCRA 3EWYA 5F1UA 4HNOA 1SJAA 1W5NA 4DZAA 4RX0A 5FF3A 1XDMA 1JDEA 1RV8A 4ERGA 1M3UA 4NXSA 2CLKA 3H12A 3EX4A 3V0SA 2PZ0A 4AISA 1R87A 1OK4A 2C15A 1UJPA 2V68A 3CQJA 4JTDA 4IPIA 3EWDA 1WA3A 3PZVA 1OFOA 3AIUA 1EXPA 4J1OA 1X6LA 3EBVA 3H24A 1Q6EA 2MNRA 4AFYA 1NQ6A 2QUMA 2Z24A 3JUGA 1ZNNA 4KCWA 1ITUA 1P0KA 2WWCA 3S46A 3MCNA 3NOEA 3GXMA 1W9XA 4UOZA 2BGSA 3JVAA 2JF6A 3QTGA 4P7RA 5D8WA 2WMHA 2OB3A 5AB3A 3CZEA 2ZRUA 4OHQA 3CUJA 1D3CA 1K1DA 2Y7EA 3C8FA 3QTPA 3L2IA 1UG6A 4LJ3A 2CKSA 4F3HA 1YYAA 1YMYA 3KL3A 5CZJA 1RCQA 4KFNA 3CZLA 3BLOA 5DANA 2FB2A 3GR4A 1FWWA 3KP1A 4ZGYA 1Q6OA 2MUCA 1P7TA 3B9OA 3W7RA 3BAJA 3RM9A 3P67A 3AOFA 1WQ5A 3DFQA 3Q2DA 1V6VA 3VC6A 3ZQ9A 4LC6A 5I2UA 1XF0A 1NWRA 3RUBL 5T9BG 1E51A 2NWSA 3UG5A 5D02A 1EL3A 3SCPA 2QQ6A 1ADSA 3CHCA 1DWGM 1M9HA 4YVPA 4JQ3A 2YL9A 1NFPA 4OBSA 3FGCB 4WY0B 4E3VA 2AQOA 3RHGA 5FJPA 3LGGA 1MXDA 3PSVA 1EP2A 1NDVA 2Q6ZA 2GUYA 1CXHA 1NF0A 3W85A 1XLMA 4S2CA 1SGJA 1DXFA 1TUFA 1UR9A 1WX0A 3BLDA 3L4TA 3ZIZA 2DZUA 2ZXDA 1XLBA 3ONCA 5DMLA 3K1DA 3CJPA 3G22A 1S2WA 1K8CA 1ICPA 1VENA 4LVGA 3AIWA 2XDFA 3MKVA 3B04A 2Y6ZA 4PUJA 5SWUA 2O9PA 5JBEA 3W7IA 3KOXA 2QCFA 3VCNA 4UFLA 3RM4A 4JYEA 1SW3A 1TV4A 4J40A 1B3ZA 5KZDA 3WL0A 1BFNA 4JPGA 1NTHA 2V8ZA 3W1UA 1TRIA 3WLKX 3L4YA 3GDLA 2Z1KA 1OADA 1ZJHA 4X61A 4UMAA 4AD5A 2ZVIA 4LUTA 1UWSA 1GOKA 4EPDC 2X1RA 1K9EA 2PTDA 4EVZA 5CC5A 2NV9A 4R53A 3FIGA 2PCQA 2VZTA 1JZ6A 1Q6RA 3LHVA 4HU0A 3ZVIA 5F7UA 5ABHA 2GSHA 3UWZA 3GYCA 2FHCA 2EPLX 1JCMP 1XKYA 2BXYA 3C8NA 5I07A 3KBMA 2ACRA 3FKRA 2XH2A 5DMYA 1J0HA 4JQ2A 3M5VA 2E8YA 4ADTA 4ALDA 1P48A 4J2MA 4PC8A 3TYAA 3FJLA 4F0KA 3FA4A 4LNYA 4XBSA 3E0WA 4O18A 1UROA 1LWIA 5M17A 4ZR8A 4LAUA 4ICNA 3IPWA 1TMQA 4RNIA 1R86A 1DQWA 1XLJA 4G7EA 2OOFA 4R5EA 3GLCA 1G4PA 3EXRA 4B9ZA 1SUXA 1OX4B 4PB4A 5T26A 4O16A 1A5OC 4H3DA 1IR1A 2RUSA 5C2CA 3IGXA 4HNNA 4PMRA 1DHKA 5H2ZA 2WXDM 2EAWA 4DY1A 2WZHA 3G1AA 4FLQA 4TX9A 3QVQA 2IMRA 4N9BA 1WDWA 5HUOA 1I2QA 3B8UA 1CB2A 4LAZA 4DIAA 1S5WA 4UFJA 3ZR4A 1SFTA 3OIXA 4N4PA 4E2VA 1JULA 5EMLA 4UWMA 3VIKA 3FDGA 4H01A 4L1WA 4B16A 1EUAA 4QCEA 5HMDA 4IQEA 4NXKA 3OA3A 3PVFA 1QNSA 3V4BA 4IGMA 2TPSA 1ONEA 1O95A 4LALA 4GUFA 4U3CA 5L9FA 4HA3A 5E5CA 1OGGA 1V93A 2YCIX 2V5BA 3N19B 1V6TA 2NQZA 4DVOA 3DC8A 4CCEA 3SDOA 1XL9A 4L61A 1F73A 1PYFA 4L7ZA 2QCLA 3CTTA 1G4EA 1TJ2A 3QOKA 4LYPA 2REQB 4IMAA 3BW4A 3FEMA 5CC6A 1Q7MA 3ABOA 3AAMA 1A5KC 2A3HA 4KCTA 3LCLA 1A4MA 4WJXA 3IUIA 4Z2HA 1WKFA 2A0NA 7TIMA 3M16A 3FYOA 4N6EA 1X96A 3T05A 5EU9A 2HTMA 5IHRA 2ODOA 1TJPA 1XPYA 3UR5A 2J25A 2Q3OA 1V77A 5D9PA 1UBPC 3BOFA 1H41A 3GK0A 3R6IA 1XIGA 5F2IA 1RQBA 1ZJAA 4E2DA 2AL1A 4GIRA 4RNFA 4P8WA 4HYWA 2ADAA 1VFLA 1E3ZA 1UUOA 1Z44A 3N4AA 1CTNA 3ICJA 4ZL1A 3BQ6A 1QPKA 1R30A 4PEKA 1PO9A 2V2HA 1IV8A 2ZZ4A 5FJJA 3R12A 2CZFA 3TDFA 3LZ3A 1VBRA 4WXZA 2AAMA 2FZDA 3SY8A 5AYXA 5A6KA 4AHOA 3E1F1 4ZQMA 4PCPA 1VZWA 5KZEA 3EMCA 5L6UA 3M44A 4X9SA 3GXDA 5DBUA 1TB3A 5EYWA 2RDUA 3QW4B 4U31A 3K4WA 4K39A 2PCEA 2WWDA 2OR2A 5DN1A 1THFD 2DZSA 4P8VA 4YHEA 4URIA 1VS1A 1P5BA 2FPVA 2J7DA 2XSBA 4F9JA 4YLWA 5RUBA 3F5KA 3PTMA 5E6YA 2OCZA 3M6YA 1FY6A 1M6JA 1UWTA 4PB5A 3WLSA 2V5LA 5HDRA 3N3TA 1Q65A 1UWRA 1HJVA 1P6BA 1TE6A 1R9YA 1TRDA 2Y89A 3GVVA 2QJGA 6ALDA 2YBVA 2PDGA 2QCGA 5LHEA 3G24A 3LPOA 3TC7A 2PDYA 3TK7A 1MUMA 5HQMA 2EGZA 2QCNA 3HQ1A 1UP2A 4Y9NA 2E6YA 3NQGA 2BFGA 3THUA 2FGLA 3NGJA 3SRFA 3STEA 4S3BA 4HZ7A 1JNDA 4C6NA 2J7EA 3K13A 2R14A 2XIQA 3CMJA 1DVJA 2BY2A 3USZA 2QCDB 4HN4A 3VIMA 1UZDA 2DSKA 3S6OA 4CN1A 1OFDA 3HZ3A 1PBGA 2WV8A 3L4WA 3WNPA 2VURA 1FCQA 3W1MA 1ISWA 4R7JA 1OWQA 4R33A 2DGAA 4B5VA 3NSMA 2BXZA 4XAZA 3T2QA 2J6VA 3ZWTA 2VC9A 3DG6A 2DUXA 3VOIA 1O4UA 1DBTA 2O56A 3VDCA 2CU0A 4C5YA 3URAA 5J5DA 3OA5A 2ZQ0A 3BAWA 3L23A 4MY1A 1Y5VA 3VOFA 4L56A 4YCOA 4IIDA 3CLWA 3V3WA 3VCRA 3UR8A 1FHUA 3AROA 2DT2A 2W5FA 1G5AA 1Z89A 1REQA 3OVQA 3A4JA 4ZZ9A 4C6QA 1GYLA 2IKGA 1G01A 4DPPA 5C2XA 1UP3A 4MAZA 3UR2A 3VVGA 3W1QA 5I7GA 2H90A 2GK1A 4FNTA 1JYWA 1OQFA 4MWAB 2C1HA 4YTTA 2NV2A 4WDTA 1B30A 3A24A 2NXGA 4GXPA 4C6BA 4K7YA 4AYGA 4J3TA 1XHGA 4B9YA 2CLLA 2CLPA 3PANA 3SIZA 3WLIA 2AMGA 3N9KA 1IF2A 4DF0A 2W63A 5CAKA 4FX8A 1G7VA 2D0HA 1IZJA 4I5XA 3BGJA 4AZCB 3VOHA 3EPOA 3ABSA 1X39A 2BXVA 2E9MA 1QVBA 4EANA 2X0YA 3PPHA 4REQA 3VPLA 1N8WA 1JXJA 1YBQB 1FXQA 1TV8A 1TFVA 1XIEA 5FEZA 4D6DA 2CHOA 3CZJA 3SIMA 2WJFA 1GZ1A 5A6JA 4YCPA 3BSMA 4MZ8A 1Q6FA 1KV5A 1H1NA 2EPKX 2G4JA 2ALDA 1KTBA 4DELA 1VBHA 2V5DA 3THCA 5IM51 3GG1A 2ISWA 4LS0A 4U2ZA 1XCFA 2Z1VA 4Y96A 3KAOA 1HN1A 1NWSA 4NNBA 2WZTA 2BVYA 5FF4A 1CCWB 3GDMA 4AXNA 3IV8A 1B2YA 5I77A 2KX9A 4TIMA 4C6FA 3TYEA 1POKA 2DT1A 4BCEA 1XRVA 3IIOA 3UESA 3LM7A 4JHOA 5EBUA 4QDWA 5FL1A 4A3HA 1Q13A 4RW5A 3NO3A 4B2DD 5LYRA 2OFJA 4XSMA 5I78A 1I0DA 3MUZ1 2P3ZA 3AISA 1DJHA 1OGBA 4O8AA 3B9AA 3P81A 2PBOA 1JRCA 4ZVJA 1ME8A 4NVTA 4QNEA 4ZXOA 2HVMA 5EBAA 1BXBA 3W27A 3H8AA 3TYBA 4H00A 4CNTA 1FCUA 2W61A 3CH9A 3VGFA 3BSGA 5FIPA 3LB0A 4V28A 4OVXA 4LVFA 2Z27A 4OGZA 3M5XA 3MZ2A 1SR9A 3TIMA 1I2OA 4XD4A 4ZEPA 3WLQA 3W00A 2F9RA 3N2MA 3NQVA 4XUGA 4GXMA 3BK0A 2GVJA 1KCLA 1DTUA 4AY8A 3PJUA 4GQ0A 4CD5A 4AU0A 5I00A 5AVNA 4CGTA 1QNPA 3IGHX 3I65A 5I03A 3BAKA 3NTYA 5D9OA 1RVGA 2V6AA 3OODA 5DFAA 1C8XA 4UNKA 1TPVA 4JX6A 2OO6A 1JUBA 1T96A 4NAFB 4B90A 5LIXX 2POTA 3LCFA 3UF9A 4P5UA 4H7ZA 4WVXA 2ZZ7A 4EPBC 4F0RA 3MV11 2YKKA 3G0XA 3IACA 2XVKA 3AUOA 3BC9A 1CLVA 3CQHA 4WY0A 4BWLC 3I68A 4S2BA 1K77A 4GKTA 1GVRA 1MRAA 1T8XA 5KEZA 5E0CA 3LK6A 4MYXA 1FWCC 5CCZA 1VEPA 1Z48A 2AKZA 3ARXA 1P1XA 2Q8LA 2O9OA 5JIWA 1ICSA 5TBOA 1JFHA 4NRSA 3UZWA 1UD2A 3VU2A 4EAMA 3VM7A 1ZHAA 1U2YA 5A6LA 3OGVA 4N9CA 4E8GA 5CBBA 5KSWA 3VNIA 1YKWA 2Z7GA 3PG9A 4D1JA 4H7VA 1R85A 1N8FA 4M7SA 5LNWA 3W7EA 4IJCA 2B4GA 1QNRA 4IG2B 4CKQA 4AUBA 1AL7A 1ZJIA 4GUHA 4IP5A 4GUIA 2PDKA 4C1NB 3MWCA 4QJ4B 2O7QA 2QDGA 3W7DA 3KTSA 4Q4SA 1S5MA 1GKPA 4A3UA 3CZ8A 2ZICA 1CECA 4Y9PA 3FNDA 2PLJA 4GC4A 2QS8A 3RPTA 1V6YA 4DUXA 1A49A 4KIEA 1S5NA 3NZ1A 4M0XA 3U5UA 1LLWA 4IGSA 3W1AA 3HG4A 1AZ1A 4PTMA 3VOCA 4LWWA 3MP4A 3RO8A 3TFXA 3RX3A 1NELA 3KDOA 4UOQA 3VX0A 3THAA 1E4NA 3M64A 4PUNA 5A2CA 3EGJA 4I8DA 2CXGA 2FQIA 3WD2A 1OCJA 4IGHA 3N2TA 1R8LA 4O53A 4XBKA 1KRBC 3H2EA 4BWLA 6TAAA 4BA0A 4H9UA 4HZ6A 2IKJA 3KS6A 4FR1A 1EC7A 1YTEA 2VRQA 3CT7A 2V30A 3P74A 6TIMA 2NSOA 4X2PA 4XZMX 2NVCA 3A47A 5BXPA 3NAVA 4DRSA 3N17A 3TH6A 4IMCA 2PC8A 1NP2A 1OX4A 3PJTA 3W75A 3CWOX 3WH8A 2E9LA 3W6LA 3FDKA 3QH2A 1DWFM 2R91A 4HVXA 4IICA 2J4GA 1WAWA 4KEMA 1VCFA 4JTJA 1WDRA 2TMDA 2OQHA 4JKLA 4NX0A 2CLOA 1TG7A 1FBAA 3NWRA 3KDNA 2D2OA 1ZY9A 1U1HA 3NQMA 5E09A 1I2NA 5CZTA 3O63A 3WF3A 4ONVA 1C9WA 4MWAD 1FWRA 2FFCA 3NQ2A 5K9CA 1QRQA 4GI8A 3ARTA 1IEVA 2QPUA 4CU8A 2CERA 2PDWA 4I9AA 1A5NC 1AQHA 4GLEA 3GDKA 3GAYA 3SN4A 1AW2A 3GR7A 3BAXA 1CIUA 2V63A 2FPYA 2CBJA 1UR8A 4CNUA 4EAYA 3MCOA 3THQA 1Q4NX 2D2HA 2R9RA 4AZ5A 5IOBA 4DBWA 1M1BA 3TW6A 4JCMA 3ARUA 2BOFX 1ECQA 2GFTA 1EQCA 2ABAA 2WAGA 1CBGA 2YCEA 2REQA 3W73A 3CPUA 1R7AA 3LMYA 4O0KA 2QJHA 3P8IA 1WKEA 3QKZA 3O9NA 5I02A 5CG7A 3QGAC 2D20A 1R3YA 1E1CB 3TN3A 3DDMA 4FF7A 4A6GA 4HTBA 1PKYA 2I7GA 1H7WA 1QNVA 2D2JA 1ADDA 3CHEA 4F9DA 3NYDA 4PTDA 4AVOA 1KFWA 4OV4A 3T2OA 4GZ7A 4MWAE 2YDRA 4FXRA 2PB1A 3WJXA 4UQAA 1XV8A 4UFIA 1CW2A 4ZO7A 3M0XA 3NCOA 4W8LA 2QMKA 1FWBC 2GJPA 3GNDA 4XSLA 1IWAA 2UY5A 1QI4A 2GUUA 1I60A 4E4PA 4UMCA 2ZC8A 4K8EA 2J77A 1HJUA 2YA2A 1DEDA 1ZGDA 2PP3A 5D8ZA 5FEPA 3WFLA 1UKQA 3W83A 1JCNA 4HNLA 1EPXA 4K6AA 3AS2A 1PZ3A 1FRBA 4PUUA 3M7WA 2FIQA 4Q7NA 1QPRA 7TAAA 2Y85A 2FHFA 1RA5A 4C91A 2OVLA 3A6OA 3WUFA 3DBNA 5BMXA 5M3WA 4MM1A 1QI3A 1AZ2A 3KWXA 1K9DA 4BQ4A 4DZIA 1EX1A 2PDIA 2NQLA 3W70A 8CGTA 1G4TA 3MC5A 4PCNA 5FA5A 3WLPA 1JD7A 2WSYA 4HNTA 3WKZA 1BWVA 3PB2A 4JNMA 4C6DA 4MHBA 2C14A 3EXTA 5FKYA 3UZZA 3SJ3A 2I5IA 2HNHA 2B7OA 2TAAA 2HEJA 1OIFA 4HKPA 2VC7A 1IEXA 4MWAC 3RXZA 3RO6A 3M07A 1FWJC 3AYTA 3EYPA 4DI8A 1H3GA 1F8IA 3NO5A 4O54A 1KCKA 3G0SA 2DJXA 5T9CE 1S2CA 4ZO9A 3V16A 2C0AA 3O06A 3S1XA 1PJ9A 3OQ8A 1ISYA 3EWCA 3W74A 4UOJA 3QN3A 3P8JA 1QCWA 3N2XA 3NQEA 3FFSA 3F4WA 2V3FA 2A5HA 1IZCA 3EKGA 5A5WA 5LNUA 3WNNA 3WEMA 3NL5A 4RK8A 3TAOA 3OVPA 2ZXQA 3L4VA 1VD6A 2CZDA 2QCDA 4PCFA 4H9XA 2BG5A 2XFYA 1G94A 2VQTA 4Q8OA 3SGZA 4DLFA 1VEMA 4GIYA 4HMEA 1X8FA 3UD6A 1TPB1 2ZXBA 2RGMA 4QRNA 3LBCA 1S1PA 4BHYA 2FZ9A 1RY0A 1CT5A 2XSXA 4EF9A 4PTWA 1RQHA 1ITQA 5REQB 1MDLA 3W01A 1KCXA 1MQQA 1SZRA 4WZHA 3HG5A 5LHFA 1NU5A 2X16A 1PE1A 3T7VA 1F74A 2F8QA 2Y88A 4CQAA 1H09A 2QLYA 4JGDA 2BSLA 4QCFA 3REQB 5LIWX 3S3GA 2VM8A 2QULA 5E9XA 3GTHA 4ROPA 3GDBA 3L66A 3S5NA 4MZ1A 1UBSA 5HATA 3WH7A 1XUZA 3ZJ8A 4UCGA 1XQKA 1JYXA 3VNDA 3RN6A 1LDCA 1EA9C 4IP7A 4LS1A 4B15A 3M0MA 1JPKA 4U10A 3B4UA 3WLJA 2E6DA 4MWAA 4TU1A 1VR6A 4XZIA 4E2BA 2BNJA 1ZP3A 2YSWA 1QPOA 4JDYA 4JBRA 1H60A 5HINA 2EF9A 5BMWA 1S2AA 4UZSA 5TNVA 1Q3NA 2VO5A 1J0JA 4R7WA 4AZCA 5DCBA 2ZZ5A 3AZTA 1AA1B 4H8HA 1OYAA 1YBQA 5I24A 3EKZA 3G0UA 3JU2A 2YX0A 1OF8A 2XM2A 2E9BA 1F6YA 3GTFA 3JS3A 1KM1A 3BMWA 3HMJG 4KCUA 1L6FA 3L9CA 2PC4A 1UMLA 4O1AA 4AIBA 4EPKA 3H4XA 4AEOA 5GNYA 3KLLA 4NIRA 4XTIA 1WXYA 1XSJA 4ZB2A 2XVPA 5M03A 3ITOA 3EDDA 5DF0A 3W2LA 4LC8A 3HB9A 4U33A 3VILA 3QPEA 1GVEA 4LANA 1VB9A 1ZAIA 4XAGA 4GGHA 4CLMA 4ZB0A 1US0A 3GVGA 4MVAA 4JEQA 2R1KA 3NR0A 4AZ6A 1N82A 1I4NA 3NA8A 2NQHA 4B5SA 1SJDA 3HGRA 3M9YA 3KVMA 1K7FA 5DY2A 2QCMA 3IIPA 4WGHA 4FAMA 1LWHA 3NQ6A 2XFWA 1NFGA 2YW3A 4GHRA 2VOTA 4LBSA 4XG1A 1JUEA 4BY3A 4E4FA 1HNYA 1V3LA 4JCLA 3DEQA 2WPGA 9XIAA 2NV1A 3W7OA 2W91A 4UBPC 4NL1A 1QOQA 5AYYA 1X1OA 4QFUA 2RJHA 3I7QA 2WJDA 3COTA 4WOZA 2D3LA 4K3ZA 1W2VA 4JZ5A 1XIDA 2E0PA 2INEA 2NLYA 3VIPA 4HD5A 4L6OA 4P7QA 1DP0A 4EXAA 4QS5A 5CSYA 3NVTA 7REQB 2ISVA 2WKJA 3CAVA 3PZOA 3K2GA 4QLJA 2FHBA 4EK7A 4I5UA 4KKXA 2HS6A 1EDTA 1V0NA 2Z7KA 3DG3A 2BY1A 1EZWA 4ZOCA 5GNZA 3R79A 2Z1XA 4HT3A 4QG6A 1HVQA 2X2GA 4R34A 1JDDA 1RK6A 4NAFA 3IRDA 4Z1DA 3UG4A 5FAGA 1E1EA 3PN8A 2OZ8A 3MI3A 2J6XA 1LP6A 3WQ4A 3WNLA 3ZM8A 1NDWA 1MNSA 2P10A 2XJ7A 3CB8A 4GQGA 4M24A 2QXWA 2ISDA 1LOSA 3VMPA 4FF5A 2QF7A 3ITCA 5AHIA 1VF8A 4KEUA 3M1ZA 3STCA 3TTOA 2EJAA 3VINA 1JR1A 3D46A 3WLOA 4ZODA 4F4RA 4Q8UA 1VIWA 1TREA 3MO4A 4S3KA 3G2GA 2Z00A 1RLDA 1EWEA 1G1YA 3GY1A 3PFRA 1UB3A 4XAFA 4ZQRA 4L9XA 1MW3A 1JGMA 2YZ5A 2V81A 4IG2A 3DYMA 2WNWA 3AIBA 3H54A 3UG8A 3KHJA 3F4CA 3EX2A 4C1NA 4K2SA 1RCOB 1JDFA 1IT0A 3R1ZA 4AAJA 4NSBA