3N9RA

Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
297
Chain Sequence
b'MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIAVLVNPKEAEQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKLLGSANKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
molecule tags Lyase
source organism Helicobacter pylori
publication title Rational Design, Synthesis, and Evaluation of New Selective Inhibitors of Microbial Class II (Zinc Dependent) Fructose Bis-phosphate Aldolases.
pubmed doi rcsb
total genus 109
structure length 297
sequence length 307
chains with identical sequence B, K, P, U, Z, e, j
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2010-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3n9rA00
2TRSA 1WV2A 4WX2A 3STEA 1W5MA 3QZEA 3EWYA 2VEMA 3W86A 4BI6A 3PF3A 5E1QA 2Y63A 2QUTA 5FEZA 1WYIA 5BMWA 1TPFA 2DJLA 3ZWTA 1THFD 2VEKA 4O54A 2QJIA 2V2DA 4TMBA 3BK0A 3N73A 1VHNA 3TE9A 3C56A 1Q3NA 4DPPA 1W5OA 3KRZA 5LZLA 3H53A 2B0MA 5AC6A 3FJLA 1CW2A 1LROA 1QDSA 3GXTA 4NX0A 1Q6OA 4Z08A 2QUVA 1WA3A 4M5PA 3OVPA 1VCVA 1UUOA 3R5EA 3TQKA 1SQ7A 3O8AA 3P7YA 4PEKA 1A50A 2ZQ0A 5K9XA 2I9EA 3W2KA 1YXDA 4L4MA 1VH7A 4UR8A 3SECA 3QJAA 3DZ1A 4O15A 1UB3A 4AB4A 2ZA1A 4JICA 4FIQA 2XN2A 3B4UA 5K4ZA 1LTDA 4O10A 5LNVA 3BW3A 2DU2A 1KM4A 4OWGA 1F76A 4Z1AA 2O7QA 1HUVA 3DHFA 1LLZA 4HSNA 1YPIA 5G1TA 2Z6JA 5KZMA 4UTLA 1TMHA 1X1ZA 2YGYA 1QFEA 3IIOA 1IIGA 3FJ6A 4WXZA 2ZCGA 4MPQA 1IXOA 5K7JA 4FXSA 3QQ0A 2BXVA 5CZJA 3W2NA 3NQEA 4UTUA 3G1FA 2GJLA 4AVFA 3UXAA 3DH7A 1KM3A 3KOFA 4QISA 2PRMA 4XBSA 1A5BA 1NF0A 2Q3RA 3DI1A 1L6YA 3STFA 1AW1A 1O94A 3CT7A 4DO4A 3W73A 5AFDA 3S0CA 3SI9A 2LLEA 3HPSA 3TMLA 3O1NA 3ELFA 1SR9A 4AMAA 4DEFA 5F2LA 4UTKA 3W2UA 2ZZ1A 4XZ9A 3TQVA 2R14A 1F2JA 1DORA 4FEZA 4XWUA 1TV5A 3MHUA 4BWLC 3OA3A 2DZXA 5F4SA 1M5WA 1RQEA 1K02A 4D2JA 3AJXA 3KRUA 1OG0A 3LHVA 3LTPA 4LUIA 3FKKA 3LXBA 4NNBA 1P0NA 3W7DA 3O63A 1FCVA 2YFNA 3I6RA 4WXYA 2Y89A 3W9ZA 3QH2A 3M47A 1XKYA 3D0CA 1K8YA 1T99A 5G4WA 1VRDA 3DFNA 4GUJA 4IXXA 4AHOA 4NU7A 4H3DA 3LCHA 1FUYA 1J2WA 3JS3A 2V9DA 1OVDA 4PL1A 1S3HA 1NSJA 2WSQA 4XTDA 5HWJA 3IVTA 3GDTA 4ZMGA 3UXDA 1PCKA 2ATSA 3W1TA 3G1VA 2FJKA 3W7CA 2CZ5A 1KTBA 2CLHA 3F03K 3G18A 1G67A 1Z41A 3O05A 3C3NA 3M5YA 4YCPA 3NPUA 3L2IA 2CLFA 1DVJA 3PG9A 2H6RA 3R2GA 4QSHA 3QW3A 5AHMA 4LV9A 1KM5A 4OU1A 2GQ9A 3BW4A 1TTJA 3W6YA 2ZBTA 1YXCA 5D2YA 1N55A 1F05A 2QJHA 1SO6A 1XI3A 3W7LA 5FF3A 4MUZA 4ZQOA 5IBXC 3LXAA 1TV8A 2X1TA 2FQIA 3SFKA 4Z1DA 4AH7A 2G5WA 3LHZA 1H5YA 4A21A 2Y62A 2ZTKA 3EEGA 1IXPA 3N9RA 5A5WA 3LRLA 1I2RA 1H7NA 3KX6A 3QSTA 2CW6A 1I2OA 5FEWA 3A21A 4GRSA 3EKZA 4GUGA 2YYUA 4OQVA 1XXXA 1O5XA 2I1OA 4BI7A 3GYEA 2HMCA 1W0MA 1W8SA 5FF7A 4YWIA 2OMAA 4JNMA 1JQXA 2J6XA 4OE7A 2ISSA 1LLWA 3QC3A 5C5YA 3KVKA 2A2IA 1CX9A 3R12A 2ZZ2A 4A2RA 3CC1A 4UFKA 3QFEA 1YLVA 1OX4A 4O52A 1PE1A 2TMDA 4E2DA 1LOSA 2E1DA 1W1ZA 1KW1A 3KVJA 3L67A 3DKJA 4EIVA 2VFFA 3U6WA 5D05A 5CZSA 4KFNA 3NZRA 1W5PA 4AXKA 2GOUA 4GXMA 4LRSA 2EHHA 3C2OA 3CPRA 1QPNA 2R8WA 1QCWA 4LC6A 4O0KA 2JGYA 3B0UX 1MZHA 2ISVA 3GXNA 1P0KA 3W1UA 3NQAA 3O6DA 1SW7A 3NQDA 5IM51 1SFLA 2J27A 5CPNA 4UMBA 1GG1A 1Q6QA 5D04C 1PHQA 3WFAA 3O06A 1ZAJA 4HNNA 4RCXA 3UZ5A 1I2NA 4JTLA 1RR2A 1H60A 3HF3A 2WSRA 2CWNA 4CCEA 1VC4A 4UCGA 2XN0A 3W7IA 3UZJA 2WJZA 2YX0A 3EWBX 1YDOA 3WJXA 4I7VA 3P5ZA 1QR7A 4IJBA 3W84A 3PM6A 2C15A 3L0GA 1R2TA 3G1XA 4GNJA 2A5HA 5E93A 2QCNA 1TPVA 2B7OA 1TV7A 4O28A 4N6EA 4UFHA 5I3FA 3EX6A 3LRKA 2A7PA 1ME9A 3TJXA 3DFTA 3M9YA 4MY1A 3I65A 5F4XA 4CLMA 1JVNA 1Q6RA 1QPOA 3W2JA 5F2IA 3E9AA 1OYCA 1TQJA 5DLCA 1LRNA 2ZRYA 3SR7A 3WK2A 1N7KA 3GDKA 3NQ8A 2FTPA 4O1DA 4MLJA 3TA6A 1FWNA 3LTYA 4DF2A 2WNZA 4GUFA 3A9IA 4FO4A 4NJHA 1ZALA 1JCJA 4R7JA 5HUOA 1LRTA 4RR4A 3M5VA 1EIXA 1PV8A 4QIUA 3BLIA 4LS0A 2Y70A 5FF0A 5TBOA 4MKNA 3EWWA 3P81A 1VJIA 3EXRA 2CFFA 2WKJA 3RF9A 1P5BA 1Z48A 3GKAA 2JKAA 3M1ZA 4DBEA 2DJXA 5K9CA 4Y90A 2EKCA 2F7FA 4OHQA 2YPIA 3PUOA 1JUBA 4UFLA 1KBJA 1MEWA 4XTIA 4OT7A 1O5KA 3BLFA 1EP1A 3GNNA 1VGAA 1BWKA 2ABAA 2J9ZA 3QMSA 3SW6A 3R89A 4UTHA 3W1NA 1F73A 1LCOA 3PR2A 4O19A 3G8EA 4ONVA 4BF9A 3M44A 3S9YA 1U83A 4JEQA 2QCEA 2NXGA 1A53A 3NPVA 4XKYB 1SZFA 4BK9A 5LKYA 4RK8A 4PA8A 2X1RA 5CPMA 3O15A 4IMEA 3ZFHA 3FKRA 1RZMA 3C4UA 2RKXA 4NVTA 1UCWA 4P61A 4GUHA 4O11A 2BSLA 3LHTA 1NFBA 2AGKA 1K7FA 5TIMA 3CU2A 3I7QA 4MY8A 5IBXA 1RD5A 2E5BA 1KBIA 1K7XA 1GWJA 3NG3A 3NR0A 2OX1A 3NVTA 4CNPA 2QCGA 3T7VA 3EX2A 1QPRA 3FOKA 1GOXA 1SO4A 3HMJG 1TIMA 4JTSA 4LTSA 4Y8FA 5BW6A 3LCWA 2YCEA 3TH6A 3BG5A 1OYBA 1EUNA 2NXIA 4JIQA 2Y61A 5FEXA 4LT9A 4OV4A 1I2PA 2QKFA 3GAKA 1EP2A 2V82A 1XUUA 1V5XA 5D2XA 3JR2A 4XQ6A 1YADA 1EEPA 1OFEA 3A5VA 1B9BA 2QDGA 1HTIA 3DXIA 3LGEA 4MZYA 4IMCA 3RMJA 1NVMA 1Q45A 3GK0A 2Z1BA 1GG0A 1TB3A 1AK5A 1OK6A 2Y7FA 4MFDA 5C55A 1EA0A 5CZ0A 3GDMA 3S6DA 3O16A 1SZNA 3TCEA 1C8VA 4A29A 4JYEA 3H54A 4M6VA 3K30A 1GYLA 4FHAA 1XM3A 5KINA 1W5NA 3BARA 5U7SA 1L6WA 2BLEA 1TO3A 5DY2A 3B0VC 5HULA 2B7QA 1X8FA 3C61A 4X9SA 3BV4A 3E12A 1WDWA 1EPXA 3TXZA 3CTLA 3CWNA 2X16A 3EXSA 3NL5A 2YFOA 3GLCA 1DHPA 3IIVA 1R46A 4CCCA 3E0IA 5K4XA 3F4WA 1O60A 5LSMA 2FB3A 3QRHA 2QF7A 2AQWA 3LBMA 1H7WA 1PVNA 2NV2A 1IF2A 2VFHA 1XBVA 4IPIA 1FDYA 4JY9A 4P2VA 2B7PA 4ZQNA 3CLMA 1K3UA 4UIOA 3W7EA 2CLIA 2ZRWA 3KHJA 3P61A 3KXQA 3T78A 5D2VA 1CI1A 4JX5A 4HPJA 1TTIA 2W6RA 3QPZA 5EA9A 1H63A 3NM1A 1RV8A 1RQHA 3FEMA 4JX6A 5HWNA 3EXTA 5AHNA 4JTUA 3ATZA 3NOEA 1G7UA 2RFGA 2DZUA 3N34A 3H55A 3L21A 5AYZA 3Q2DA 5T26A 3QYQA 4S2CA 1WOBA 3KAOA 3SIZA 1GVSA 1JCNA 2JKPA 2P10A 3QMRA 4MLRA 5AOUA 3EWUA 4AF0A 3GB6A 4UUIA 4HHPA 1YDVA 3I7SA 4WQ6A 3NL3A 1J5TA 2PURA 7TIMA 2ZA2A 1ZHAA 2CLMA 3LCIA 4EVZA 3UYCA 1BTMA 1KFLA 5AHFA 1P1XA 4O1BA 4NT0A 4MFEA 3RLVA 3MJYA 3SSJA 4ADSA 4LVGA 1I8JA 4IQLA 5BNKA 5EY5A 2G95A 3MYPA 2QCDA 1MXSA 2NLIA 3LLDA 3LX9A 3FS2A 5CSSA 3PS7A 3LM7A 2WQPA 1VS1A 3TSMA 2HSAA 2ALDA 1G4PA 3HQ1A 3N19B 1D3HA 1EWEA 3C2FA 2C13A 4X22A 1X7FA 2PRHA 2E5CA 3M7WA 4AF0B 3S5OA 4AWUA 3UNDA 2CU0A 1VCGA 3WJWA 5LNRA 3G1HA 1F6KA 1GTEA 1ICQA 3BO9A 2Q8LA 5BMXA 3HIJA 1H7OA 4FNSA 4AEOA 4WZHA 1B57A 5F4WA 5AYYA 4O13A 4NJJA 2YW3A 5G2WA 3NYZA 3DI0A 2FPVA 2H90A 3W7QA 2DZPA 3C52A 1RPXA 2CLKA 4XBKA 4EF9A 3PB2A 3LCGA 5DXYA 2EF9A 3R8RA 2J9YA 3G0XA 5K3VA 1OFDA 1TJRA 1JUKA 3W7GA 3IIXA 3W3OA 2TYSA 5L9FA 3M6YA 5G1YA 3LV6A 1HL2A 4ZVJA 4HNUA 3W7HA 1V7YA 4CQAA 4UTWC 4TR9A 1KM2A 2ZTJA 4Q4KA 4TU1A 3JRKA 4Z1CA 2E6YA 2Y7GA 1H50A 1FCBA 3LHYA 2C14A 2Z6IA 5HMSA 4WD0A 3W7NA 2PRLA 3BGGA 3RU6A 3C2RA 1H7XA 3NXFA 1SW0A 3STGA 5TQLA 4TO8A 3UWWA 5HINA 3CB8A 2JK2A 4IMGA 2W0UA 3CEUA 1TQXA 2Z2UA 2C0AA 3LHWA 4K38A 4MZ8A 4JDBA 3L0NA 2Q3OA 3HGRA 1SPQA 5D02A 2JBMA 4LC8A 1W54A 4LU0A 2BTMA 4DF0A 3O6CA 1TSIA 3OVQA 1GVQA 1TTPA 4GWEA 3S1VA 1AMKA 1FQ0A 4ZL1A 2YDAA 3NQVA 3DFQA 3IIZA 3L0KA 4ZQMA 2VEPA 1WOAA 3G1YA 5KMYA 4RZ6A 1SFJA 1FDZA 4N4QA 4O8RA 3TFCA 4N9BA 2WNQA 3DENA 3OEXA 3O07A 3W7KA 5LHFA 3W23A 2VFDA 2QCDB 3WJYA 1DQXA 2UV8G 1UUMA 3TMQA 4GJ1A 2A0NA 3THQA 1K8XA 2V81A 3THAA 1OFRA 3NNTA 3CQ0A 2OT1A 4QNEA 2FPYA 1B4EA 3LI1A 4JTTA 3TFXA 2NX3A 3MI3A 3PUEA 3UWZA 4QQ3A 3I68A 4N9DA 1QOPA 3VKJA 2V30A 3RK8A 3W83A 1EWDA 2HS6A 3KRSA 3M5ZA 1M7OA 4UC5A 3M41A 3RNDA 3NZ1A 5I3KA 4GUIA 3EKLA 5EYWA 1ADOA 1VLWA 1GT8A 3FYOA 5KZDA 1QAPA 1YYAA 1X1OA 3R13A 2CLEA 1G4TA 3EB2A 3DFOA 3GXPA 1W37A 2H3DA 2A4AA 2Y6ZA 4FNQA 5AC7A 3U8GA 3TR2A 4NJIA 3W71A 5MHBA 3P80A 4MOZA 3L5LA 1GVRA 1WQ5A 4JX4A 1SU5A 1P4CA 4XKYA 4O17A 1D9EA 4PCFA 4O12A 3VE9A 5G5IA 2IQTA 2VENA 1PIIA 1ZFJA 5EMUA 3IVSA 3V1PA 4RZ5A 4LVDA 6TIMA 1LBMA 5J5DA 1ZNNA 4UTJA 3F4NA 5G2HA 1IIHA 3P84A 5CSRA 4O1CA 3L68A 3NDOA 2E77A 3CWOX 3C6CA 3E96A 4N6FA 2G96A 5EKYA 1XCFA 4RXFA 2WNNA 3NQFA 3UWQA 1VYSX 3U2OA 3GIYA 3W1QA 1YDNA 1R30A 2Z0IA 4FX6M 3P5YA 3W85A 3N2XA 3W2MA 3MP5A 4UMAA 3S1XA 1F6PA 3QPYA 4IXHA 2V5LA 1OX6A 4PC8A 3UWUA 2VOMA 1B4KA 4UTMA 2B4GA 4ORIA 1XC4A 1C9DA 4K37A 4MJZA 3W07A 3UD6A 3UY7A 3L9CA 4UTTA 3W7MA 1Y0EA 3NM3A 4ICNA 2E6FA 1O4UA 3OBKA 4RX0A 2GJNA 1FWSA 1L9WA 1FX6A 1W3TA 5LNUA 1DKWA 1KFCA 1MO0A 3GZ3A 4N02A 4LV4A 4WY0A 2DZSA 3G0UA 3ZWSA 1WXJA 4JDYA 4I9AA 4HNVA 5FESA 4U28A 1JRBA 3B03A 1KV5A 3UQNA 1ML1A 4K6AA 2A7RA 3ABRA 4PTNA 3W87A 2PCQA 4JYDA 2C19A 4R33A 4ORMA 3P82A 4ADUA 4GFSA 2DORA 1VLIA 2QCMA 1K03A 5D38A 4UR7A 3B06A 4AWTA 3N14A 3NGJA 3E02A 2DZVA 4GE8A 3TJLA 3HPXA 5KZEA 2QR6A 3L66A 4FNTA 3NA8A 4JTEA 4O14A 3HBLA 4J9JA 4QAIA 1OHLA 2C18A 2RDTA 2EGZA 1I2QA 4UNKA 4YLWA 4UFIA 3ATYA 4FNRA 4M19A 1DQWA 3G8RA 2QCHA 3MHFA 1PCWA 3PUDA 3W88A 2B7NA 4JTFA 1TPB1 3G1DA 4CNNA 3L5AA 3LRMA 1OFPA 4YL2A 4FIRA 3TW6A 4H6KA 2GPTA 4Q32A 5GVJA 3PWAA 2Y88A 3LOTA 1S5TA 3OIXA 1K8ZA 3W1XA 1XDLA 5DCEA 1F5ZA 3NQ7A 2CZDA 1TTQA 1VHCA 4W9TA 3WK3A 2E6AA 3TSDA 1XFBA 4YXGA 4UTIA 5F2MA 2ZRUA 4DELA 1KFKA 3PULA 3GNDA 2ZRXA 3NQCA 5C2XA 4JIPA 4LVBA 4LVFA 4C1KA 1ZJIA 1YTDA 3IEBA 2A1YA 3MO7A 5FI8A 1AW2A 1VZWA 4ML9A 3IV3A 3MHGA 1G4EA 2NWSA 3S5ZA 1QPQA 2ZZ5A 3WK0A 1TPEA 5HQEA 1Z44A 3M5XA 1OF8A 3YPIA 4QITA 4HN4A 1ZY9A 3MMTA 3QMTA 4FXRA 1DJQA 2RH9A 2NWRA 5D37A 2V5BA 4BFAA 2GVJA 5A8GA 5DBTA 4AWSA 2R94A 1J4EA 3V75A 1IGSA 1WAUA 4OGZA 3M16A 4RZ4A 4X2RA 3P67A 1Q6LA 1G4SA 4R34A 4NXKA 4IX0A 4WY0B 1W31A 1H1ZA 4LS2A 4UTWA 3HOJA 2OZ0A 1TREA 2FLIA 1NAL1 4PODA 3T40A 1ZAHA 2EAWA 2Q8ZA 4LS1A 4KKXA 1FWWA 1TJPA 5L6UA 2D73A 2X1SA 3LB0A 3PB0A 3W70A 3TNOA 8TIMA 4K8HA 4O1AA 2WPBA 3HG5A 5G2IA 5LHEA 3TX9A 3SY5A 3TDFA 3GAYA 2E6DA 3P60A 5LGXA 3LHUA 3TROA 3UPWA 4ALDA 2O7SA 2NX1A 4IMFA 3G3MA 4EWND 5CPOA 3S42A 3OVRA 3TC7A 2H3BA 1KTNA 4JTKA 1VCFA 4MZ1A 2VFGA 3UWVA 4A2SA 3DFPA 2XN1A 3DAQA 4LOCA 1OABA 2C1HA 3WJSA 3HB9A 1LDCA 5F1VA 4MYAA 1XDMA 3BG3A 1EX5A 1T0OA 1VPXA 4NUWA 4O4WA 5DY3A 4JS3A 5CG7A 3S1WA 1XBXA 2VXNA 2A85A 3NAVA 3TXVA 1G6CA 4DO5A 1OFOA 4RLIA 4IX2A 1JJKA 3BW2A 5D33A 1HO4A 2YSWA 3EX1A 1SZGA 4UTTC 2CLLA 4JTJA 1GZGA 2VFIA 1QO5A 5FF2A 4NXSA 1A5AA 3NPWA 4NJKA 2A7NA 5AN7A 1H51A 2CZFA 3TV8A 5J5RA 3GVGA 2ABBA 5DELA 3W7RA 1GJPA 4TIMA 1SO5A 3BVJA 4JN6A 3W74A 1C29A 4KFOA 3L65A 1GPWA 1AG1O 4YMZA 1H7PA 4IGHA 4ZQRA 3C8FA 3CIXA 4Z0SA 4ZZ9A 3HG3A 5LNSA 1LOQA 3NL6A 2FFCA 4O4VA 3BGJA 1R2SA 3TAOA 1WBHA 5LNWA 2BX7A 3LV5A 1FWRA 3QW4B 3FIGA 1TRIA 5ABTA 1HFBA 3PSVA 3SJ3A 4QNWA 2OJPA 4FB7A 2RHGA 1TPC1 3Q37A 3LERA 1Z42A 3PBWA 4RV8A 4PFMA 3ZR4A 2QJGA 3IGUA 3A5FA 3L5MA 1L6SA 1G7VA 3SGZA 4S1FA 4OBTA 1SZEA 3LXCA 2OCZA 1NF7A 2WO5A 4L4LA 4UFMA 4Z0JA 3GDRA 4K36A 4I7WA 4HT3A 5DCBA 3MI6A 2TSYA 3TSBA 1XBZA 3QM3A 2ZYFA 4BWLA 2J24A 1D3GA 2QCLA 5H2ZA 3O6YX 2A6LA 1O95A 3VI2A 4HSOA 4Z1BA 2WSYA 2R91A 4G1KA 1GYNA 4KWWA 1MEHA 2ZZ4A 4IPJA 2NV1A 3W1LA 4RKAA 2CLOA 2YXGA 4CQ9A 5FEPA 3EWXA 3EX3A 5C54A 4JGDA 2FB2A 2P0OA 3LCFA 5K2ZA 3N2MA 1LRQA 4GC4A 5K9DA 1H1YA 2H8XA 1A5CA 3F1QA 5HR6A 4I7UA 3M0ZA 3A24A 2AAMA 2QCCA 4FX7A 3SGUA 4K7VA 1BEUA 4POCA 1RVGA 4NJGA 3KFTA 3G3DA 3GKFA 4M7TA 4B5NA 4M7SA 1IXNA 3RLUA 3G1SA 4LVAA 4E38A 4QJ1A 3HG4A 4HIBA 4CCDA 3TAKA 3UWYA 4O57A 2C3ZA 4HKPA 3GDLA 4LWWA 1SSGA 2NX9A 5HJLA 4NNAA 1F7BA 3GX9A 1QO2A 1KTCA 1U5JA 1GEQA 5EPDA 4ADTA 2FDSA 3MUXA 3IVUA 1HG3A 2X2GA 1WX0A 1W3IA 1JCXA 2FIQA 3W1MA 5E0KA 1W5QA 5D30A 4LW7A 3NL2A 2OT0A 2ATMA 2GQAA 3HG2A 1TRDA 3T4CA 4O50A 1LM1A 3UY8A 1H62A 3TUUA 5D09A 1IXQA 1NEYA 4FX8A 3HGSA 2ZA3A 1GQNA 1OF6A 5D32A 1EB3A 5I3IA 3W1RA 3DU0A 3MI2A 4KFPA 1JULA 3W7OA 3DFSA 3ABSA 3MWAA 1FDJA 1QNVA 3T55A 1DV7A 2W79A 2WV8A 4FNPA 3ANYA 2VELA 1YTKA 2J88A 1LYXA 1OX4B 2RDUA 5AC8A 2C6QA 4UNLA 4Q33A 2VFEA 4WUIA 5I3JA 2G97A 5KITA 3B8DA 1AL8A 1H7RA 4AAJA 3G0SA 1EP3A 3W1AA 1OK4A 1KLYA 4TMCA 4EF8A 1E51A 4M6QA 4Y6GA 5U4NA 4NQ1A 5BOOA 4O0ZA 1UJPA 1ALDA 3LDVA 1AW5A 3P8IA 3G1AA 4KWVA 3NO5A 4ZQPA 3CIWA 3GR7A 4K39A 1OFBA 1I4NA 3IIPA 2E09A 3VE7A 1TYGA 3PBVA 5AHEA 1SSDA 1G69A 2NUXA 3QF0A 1TCDA 1KM0A 3TIMA 1DBTA 1KFBA 3AO0A 4TX9A 1YPFA 3MYOA 2E68A 2BWGA 1KFJA 2ZDRA 3BG9A 3KVMA 1BWLA 5D2TA 5I3HA 3GR8A 2HS8A 1UASA 4N4PA 3ABQA 1TPDA 3BPWA 3MP4A 3LCLA 3FFSA 1GVFA 1FBAA 4NX5A 4IMDA 4CQ8A 3PY2A 4JR5A 4EOUA 1KM1A 3UPBA 2V0TA 1JUEA 4JXCA 1ZCOA 4JTHA 1T96A 2Y7DA 4DQWA 2GVLA 3QEZA 1OJXA 5DN1A 1VYRA 3C2VA 5D03A 3W7JA 2DZWA 3E49A 1QOQA 3IGSA 3CEPA 1WBJA 2P1FA 2NZLA 3N3MA 1ME8A 3CM4A 4UXDA 4WOQA 3NQ2A 3B04A 1VR6A 4NZFA 1FXPA 1JRCA 1OFAA 4UFJA 2YZRA 3DHDA 1B3OA 1BKSA 3RFAA 4O53A 4AHPA 1DL3A 3LCXA 1XBYA 3G24A 4OV9A 3TU9A 5D2WA 4DBDA 4HNTA 3P62A 3TK7A 1JR1A 3MBDA 3KVLA 5CKSA 1LBFA 1FCQA 3P74A 4MJMA 4H4IA 3LTSA 4WY0F 5KTLA 3W22A 1TPWA 4LRTA 3LBCA 4A3UA 2DZTA 3EX4A 1FWTA 3HGJA 4MVAA 2F84A 1RQBA 1SO3A 4LUJA 1KV8A 1LBLA 1LP6A 3DBPA 2XFWA 2A21A 3PC0A 4FF7A 3TQ0A 3ZS4A 1YXYA 4BR1A 3INPA 1N8FA 1ICPA 3W76A 1OYAA 1EUAA 4JTIA 3FYPA 2ZZ7A 4CNOA 2YYTA 1SW3A 1FY6A 3LI0A 3T44A 1VYPX 2I14A 4PL2A 2Y85A 1OX5A 4AHQA 3M43A 5SWUA 3S1UA 1H61A 1T8XA 1ZENA 2ZRZA 4C1LA 1MSSA 2ZRVA 1QWGA 4RJEA 3PBYA 4ZQCA 3W1PA 2QAFA 5AB3A 1JCYA 3NQGA 1XL9A 2JKEA 2J9XA 3NQ6A 1I45A 5KSWA 1QMLA 2V2HA 1PL9A 3W7PA 1MEIA 2GQ8A 2CZEA 2QAPA 1ME7A 4N9CA 3OHIA 4FNUA 4PH6A 5LGZA 1W3NA 3VNDA 1KFEA 4DPQA 1FCUA 3B0PA 1OFQA 2H8ZA 2V2CA 2PC4A 3TKFA 3QQ1A 4JY8A 1SUXA 4MY9A 3TC6A 3HPZA 1L2UA 3PG8A 4IUOA 3Q94A 2X1UA 3VCRA 5FF4A 5CGQA 2PE4A 3HJZA 4JYFA 1W56A 2TPSA 4RXGA 1GTHA 3PVFA 4XUGA 5CZTA 2X30A 4M6PA 1KA9F 3WJZA 4X3ZA 3HO8A 4U4MA 2NUWA 5EL1A 3B05A 3S5NA 4NZJA 3MBFA 3Q58A 3HGOA 4Y96A 3NEVA 3PSWA 3W2LA 2A6NA 1JCLA 3S8HA 3FA5A 3W72A 1F74A 1LOLA 1UBSA 3STCA 5HR7A 4WOZA 1R2RA 2NXHA 2RDWA 1X6UA 4O16A 3SZ8A 4K8EA 5DCDA 4JTGA 2VC6A 5G4EA 5DXXA 2GVGA 1M6JA 3DKLA 1XUZA 1S5WA 2Y7EA 3TW7A 1HO1A 2ZZ3A 1A5SA 2QCFA 3PBUA 4WJEA 4YCOA 1S5VA 2WOQA 4BI5A 5AHIA 4N9EA 2ZZ6A 2DP3A 3LLFA 1LZOA 4K7YA 3A22A 3NPXA 5DBUA 2KZHA 1M7PA 4IOTA 1K7EA 3S5YA 3C2EA 5F2GA 1KM6A 5C6MA 2JGQA 1JQVA 1KLZA 5I3GA 1DJNA 3I7RA 3N9SA 4JD4A 1DOSA 2GUUA 2BZNA 4UMCA 1TPUA 4HPXA 4E2BA 3IRDA 4E0CA 3NQMA 2VKZG 2YR1A 3OG3A 5HUPA 6ALDA 4NNCA 5EBUA 3VFLA 3EWZA 2QEZA 1AL7A 5F1UA 5BRBA 5HNRA 4IWWA 1FXQA 1GVOA 3FLUA 3USBA 5CPLA 5HWMA 3P8JA 1PHWA 3C0JA 3ABOA 3PAJA 4DF1A 4MIMA 2VEIA 1VQTA 2YW4A 3WK1A 2NUYA 2ZFAA 3G22A 5AYXA 3W75A 4A22A 4DXVA 2QDHA 3CHVA 3MP3A 3A23A 2QUUA 1PS9A 2EPHA 3QSRA 4LY8A 2ISWA 4Y9AA 3MW7A 2HTMA 1ZAIA 4DO6A 5AHLA 5H91A 1YTEA 3DGRA 2C16A 1JCMP 4O18A 2V8ZA 1TPH1 4QM1A 2E5DA 4N2YA 1ONRA 3BLEA 4MYXA 4R53A 1LORA 1ICSA 3IGXA 1R47A 4LNYA 2FPTA 4S2BA 4GBUA
chains in the Genus database with same CATH superfamily
1WV2A 3STEA 6REQA 4BI6A 4WDWA 5FEZA 2IKJA 5BMWA 1E0UA 1THFD 4IIHA 1AD4A 3K5XA 5BZAA 3ME3A 1WZLA 3WQWA 3TE9A 4AD3A 4DPPA 3PNZA 1QBAA 3EAUA 4H19A 2Z1VA 2HXTA 4GVIA 1US3A 2R1PA 1VEMA 4Z2IA 1UKOA 3VKDA 4M5PA 3OVPA 2ZQ0A 4GIAA 5K9XA 4GX9A 3W2KA 4HU3A 4GOAA 4UR8A 5LIXX 4O15A 1DP0A 2MUCA 3H2AA 2ZA1A 4JICA 3B8TA 4F9JA 2XN2A 3B4UA 5LIUX 5I23A 4US5A 1XD1A 3BCFA 2DU2A 1F76A 2YBTA 3W81A 2J75A 4DJDA 1KXTA 3CZEA 5G1TA 2OYKA 2DSZA 3BXWA 1X1ZA 3UXKA 2IQ0A 1QFEA 4C6NA 1IIGA 4MPQA 1IXOA 3P93A 1P7TB 4D6JA 4GBDA 4UTUA 3B8UA 1SJAA 4E4UA 1KM3A 3COTA 4A6GA 3KOFA 3SY1A 2I5QA 3WMBA 5EMLA 2PRMA 4XAPA 1A5BA 2WMGA 2V5JA 3RLHA 3CV6A 1AW1A 2VWSA 3W73A 3SI9A 2LLEA 5GJPA 4Z1YA 1W9PA 4UTKA 4JN8A 3GG0A 4LSBA 4Z2JA 4XZ9A 1E55A 5EFDA 1E3XA 2DZXA 1M5WA 1K02A 1C8QA 2A79A 4RPQA 1JYXA 3PZIA 1PKYA 4EPKA 3UG4A 1P0NA 1DJGA 2YFNA 1V3KA 3M47A 3RR4A 4F0LA 1HJXA 1T99A 2GDVA 5G4WA 1VRDA 3RLGA 4AHOA 4NU7A 4H3DA 1J2WA 5DF0A 3U7BA 3JS3A 3L4YA 5CXPA 4ECLA 2WSQA 4ZSTA 3QZ6A 3JW7A 3IVTA 3VGFA 3GDTA 4ZMGA 1D7KA 2FJKA 5C9XA 3HFTA 1IWAA 1XD0A 2CZ5A 2CLHA 3F03K 1G67A 3A13A 3F5KA 3M5YA 4DJEA 3NDYA 4PMVA 2PDQA 4IZGA 4KCVA 3L2IA 3OBEA 3AMCA 3OP2A 4DXKA 3IRSA 5EB8A 4AX6A 2GQ9A 1TTJA 4KCUA 2O0TA 3SEPA 1HIZA 4FI4A 1C9WA 1NWTA 3FA3A 1XI3A 3W7LA 3B3DA 3MC5A 5T9BG 3THUA 1SZRA 4CNUA 1V4YA 1MRQA 2H9AA 5AECA 3LHZA 4HZ8A 2HJPA 5FSEC 3NSXA 4B5WA 2F6XA 1KRMA 5XIMA 2ZDSA 4OOUA 1KXHA 3LRLA 1SMAA 1H7NA 3QSTA 1V6XA 1I2OA 4FR1A 3EKZA 1XQLA 2WSKA 4OQVA 1XXXA 4S3KA 2I1OA 1W0MA 5ABEA 4YWIA 2OMAA 4NY2A 1JQXA 3DERA 2OEKA 1LLWA 5BROA 3S9IA 3QC3A 3SRHA 5AYBA 5C5YA 1BQGA 3T08A 3PZQA 1CX9A 4AZGA 5FJPA 3BV7A 4OZOA 1GVEA 4UFKA 1J0ZA 4AD1A 1J01A 4HA4A 2XSAA 1PE1A 1KXVA 1HZYA 3R8GA 3VNIA 3L67A 2VFFA 3ITVA 3NZRA 5FOOA 4A3HA 1T41A 4LRSA 1WXZA 3CPRA 2R8WA 3AFBA 1QCWA 4E3VA 4ZB0A 2ZUTA 3HN3A 3LMYA 3VX1A 4GLEA 2ISVA 1P0KA 3NQAA 1RCQA 1SW7A 1XH1A 3ZR5A 1SFLA 4H8VA 1Q6QA 1IEIA 3O06A 1ZAJA 4RCXA 3UZ5A 1JZ3A 5H8MA 4JTLA 1RR2A 2Z1SA 3S2NA 4GMEA 4CCEA 1E6NA 5A2CA 5ENLA 4I6KA 1O68A 3QY7A 1P48A 5CC7A 1HGYA 1XINA 2C15A 3CT2A 3L0GA 5LA0A 4AZCA 5I09A 5H1WA 3AU2A 2GYIA 3UZZA 2QJMA 3T8LA 3WIJA 5D8WA 1HKJA 4JL1A 3G6LA 3CUZA 4C6BA 4H8NA 4B92A 5B80A 1OYCA 1YBQA 1TQJA 4U5KA 3WK2A 2INFA 3F5LA 1IGWA 3VGBA 1Y5VA 3TA6A 1FWNA 3RU8X 5DQPA 4X9YA 2FMOA 4GUFA 3A9IA 3ICJA 3TYZA 1XICA 1PZ2A 1JCJA 4R7JA 4RR4A 4H6QA 1EIXA 1PV8A 3QGAC 5TBOA 3BL3A 3EWWA 3D47A 1KRAC 3EXRA 2WKJA 1E4IA 3B8SA 3GKAA 2JKAA 2DJXA 4Q7NA 1XCXA 2VVSA 3T0AA 2F7FA 4N0RA 2YPIA 2PP3A 1RJQA 3TLLA 1SMDA 3NFUA 4XTIA 2O9OA 1EP1A 5BXSA 1UWUA 3SCPA 1VGAA 3QMSA 3SW6A 3R89A 5E9AA 3PR2A 4ONVA 4BF9A 3S9YA 2F6UA 3IAPA 1XSJA 2NXGA 3NPVA 1UHVA 1XWYA 4B4HA 4GYPC 4PUEA 3CMFA 4RK8A 1W3JA 2R1LA 1V3IA 2RJHA 2X1RA 4R88A 5CPMA 3O15A 4IMEA 3ZFHA 4AZHA 3B0YA 3FKRA 4MMWA 2WZTA 3T1GA 2RKXA 3N9KA 4P61A 1Q8JA 2MNRA 3QV6A 2PLMA 3LHTA 4GYFA 2AGKA 2V69A 3S5SA 3I7QA 4MY8A 5IBXA 1RD5A 1TX2A 3DOPA 1S39A 3AIQA 2ZXBA 1CECA 3H26A 3S3GA 2QCGA 1LL6A 2ODOA 4L1WA 4J3XA 3W6MA 2FZBA 1GOWA 5LA1A 3M07A 2VCAA 5FEXA 1DPMA 3WLSA 2VTFA 1I2PA 2QKFA 2Z24A 4DZHA 2QNEA 1V5XA 1FP8A 4F79A 2V3GA 1EEPA 2YB1A 1TWZA 3EGJA 3VDBA 3A5VA 4H1ZA 2QDGA 3DXIA 4HCHA 3NO1A 2BDQA 3A64A 3RMJA 4HYVA 4OUIA 4AC7C 3GK0A 3CL6A 4IGMA 2NQHA 1QHZA 1TB3A 1AK5A 2Y7FA 4MFDA 3K1GA 3ECQA 3VMPA 3AIVA 2ZUMA 4U2YA 4C7GA 1J11A 2R1MA 4CU8A 1R7OA 5KINA 1F4HA 5U7SA 1L6WA 2BHZA 2POZA 4S3AA 1X8FA 1WDRA 2Y8VA 3E12A 2ASHA 3AIRA 3VILA 2AMGA 3BURA 3ITTA 4GINA 4L6DA 3CWNA 3VINA 1XW8A 3I6TA 3CHCA 3NL5A 1EYEA 3BCJA 5K4XA 3E0IA 3F4WA 2AQWA 4M8UA 5FACA 1H7WA 1PVNA 2VFHA 1M68A 4IPIA 4JY9A 4LCQA 1K3UA 1AH3A 2A3HA 2ACRA 3P61A 3KXQA 3T78A 3POHA 4AIEA 3OYXA 3CZKA 1OIFA 3GU1A 4HPJA 4ATWA 2W6RA 5EA9A 1JL8A 4AD4A 1RQHA 1H49A 4JX6A 5IHSA 1EJWC 4GHRA 2G4JA 3ITCA 4Q6JA 3NOEA 3N34A 3L21A 5AYZA 1FWCC 2FZ8A 2J7DA 3AHXA 3SURA 2WAGA 3QYQA 1NDZA 3HV9A 1UPPA 4OUEA 1JCNA 4PUKA 4MLRA 3EWUA 3GM8A 4AF0A 4HHPA 1CXKA 4WQ6A 1E0XA 3MV01 2PURA 5CPTA 2CLMA 2VD9A 5HPCA 1A5MC 5AHFA 3WSUA 1AMYA 2J6VA 3MJYA 3GIPA 4B4FA 4K1WA 1O5QA 3C2YA 3AZSA 1VBGA 5BNKA 4IT1A 3AXHA 3WEMA 3JU2A 3FS2A 1QATA 3LM7A 1VS1A 4D6CA 4B5TA 1G4PA 3VUSA 3ABZA 3N19B 1D3HA 3CASA 1P7TA 4XUYA 2C13A 3HU7A 2FFIA 4NAEA 3URNA 4AF0B 3ES7A 3S5OA 3MKCA 1KRBC 1V6YA 2CU0A 2VZTA 2VZUA 3WMCA 1ZRQA 2O55A 3BO9A 3HIJA 4NZ1A 3WLIA 5IHRA 4FNSA 4HJWA 1SJDA 4Q8UA 4WZHA 4MWAA 1B57A 4DJFA 5AYYA 3UG3A 2IPGA 3PWIA 2FPVA 2BASA 1Q85A 1D7FA 4LFYA 4XBKA 2EG7A 1MXDA 3GSMA 5D9PA 3G0XA 3GNOA 1KWKA 3H2CA 1D8CA 3M6YA 1HL2A 3M0YA 3EPOA 4C5YA 1V7YA 3BAWA 2GVYA 4IM4A 4Q4KA 3H2EA 2AL1A 2OLHA 1RK5A 2QHAA 3LHYA 1H41A 2PF8A 3REQA 2PRLA 3R11A 3WF2A 1WKDA 1VFOA 1F3TA 5TQLA 2J79A 4TO8A 1CLKA 5HINA 5GNZA 2Z2UA 4NSBA 3LHWA 4JFWA 2G50A 2Q3OA 3SCQA 2BTMA 1LQ2A 2HE5A 3N4EA 3RGTA 3PK7A 3DYPA 4K2SA 3XINA 4XAZA 2VHLA 3NQVA 2JIWA 3TLQA 3L0KA 4ZQMA 4V2XA 1MUMA 4C6JA 2NV9A 1PTGA 4CGTA 4GIYA 1HKKA 1FDZA 3NZGA 4N9BA 2VFDA 1UC4A 3REQB 2XVNA 2HDJA 1GQIA 2PDYA 3AIUA 4BHYA 2H9AB 4CQBA 3EA1A 3THQA 4I9TA 3THAA 4JHOA 3CQ0A 2OT1A 4QNEA 1Z32X 3RPDA 5E6YA 3C86A 3TFXA 3DCPA 3FSTA 3VMOA 1KCZA 2W66A 1JI2A 4QQ3A 3QY6A 1QOPA 3N3TA 2V30A 2OODA 4XSMA 3GQYA 3MY9A 4PCSA 4C6PA 2ZICA 1MXGA 2HS6A 1K6AA 3M5ZA 1M7OA 1ZB5A 3NZ1A 5I3KA 2R82A 3E5BA 5KZDA 1X1OA 1EJSC 1D3CA 1JXKA 2CLEA 2Z26A 3HQPA 4GY7A 1W37A 2XHYA 3VIJA 3NUKA 2VO5A 2Z27A 2A4AA 2Y6ZA 3TR2A 3W71A 5MHBA 1EOKA 4XIAA 1FTXA 1R85A 1MI3A 1XG4A 2VD8A 4O17A 3VE9A 2IQTA 3BJTA 2VENA 1KB3A 5AZ1A 1ZNNA 1B1YA 4IPPA 4LAMA 4NRSA 2PWVA 1IIHA 5I79A 3PZUA 5CSRA 4O1CA 4FLOA 3IJIA 3C6CA 3E96A 3ZVIA 1F3XA 3V4BA 1XCFA 3WFZA 2WNNA 3BSHA 1A3WA 2X41A 3VKCA 4J3UA 4LUSA 3U2OA 4C7FA 4JHMA 5F7UA 1Q6EA 4FX6M 3P5YA 2PTXA 1OC7A 4LB3A 3S1XA 4X0NA 1F6PA 4Z42C 3MUAA 3EDFA 1OX6A 1LL7A 2ZADA 3QKZA 1SYTA 1UD4A 2DUAA 4K37A 4FLSA 3L4TA 3VIKA 3LNPA 3WUBA 4JTDA 2O56A 3L9CA 1Y0EA 4ICNA 2OEMA 3EBVA 1R87A 4RX0A 2Z29A 1CEOA 2RAGA 1W9BM 2X09A 4S38A 2WKGA 4HMCA 1KFCA 4N02A 1E4NA 4W88A 4HNVA 3VNMA 4UOQA 1EXBA 3A4WA 1CB2A 1JRBA 2R1NA 2E25A 4K6AA 3ABRA 4JYDA 5TF0A 4R33A 1POJA 2YB4A 3OLDA 3P82A 3FXGA 4MNMA 1ITUA 4L1XA 4P7NA 3OODA 2W92A 1JDFA 5D38A 4UR7A 5HMFA 3KWSA 3N1AA 3VOFA 4GE8A 3E02A 3TJLA 5I02A 3VM7A 3KDOA 3HPXA 5KZEA 2BBFA 3L66A 4PTMA 3NA8A 1JPMA 1JYNA 4DJED 4O14A 2HXUA 4B90A 1DWGM 5JBEA 3WLNA 3KCLA 1RSCA 4B9YA 1EH9A 2D20A 3PTKA 3G8RA 2VEFA 1DJWA 2B7NA 3CHFA 4JTFA 1TPB1 3FGCA 4E4PA 3DC8A 4YL2A 2CESA 4FIRA 4IIBA 3TW6A 2WWDA 4RNIA 3TR9A 3LOTA 1NWSA 3OIXA 1U30A 3W1XA 4HU4A 3R94A 1PAMA 1TTQA 1VHCA 4W9TA 2E6AA 4IFKB 3LA4A 1XFBA 3WEZA 3SGGA 4YXGA 4UTIA 4RUBA 1NDVA 2E8YA 1K4HA 3PULA 3GNDA 3VGEA 3NQCA 4Q8NA 4JIPA 1C8XA 1O1ZA 4GX8A 2F9RA 4LVFA 2E0PA 3ZQ9A 1ZJIA 2P8BA 3W24A 3E3HA 4HHLA 2DSUA 4ML9A 3UJSA 2AQVA 1NFPA 4EANA 3S5ZA 4BF7A 2PWFA 5HQEA 4F66A 1Z44A 3LSBA 3IJ9A 4FXRA 3SCSA 2RH9A 4PGLA 2GVJA 5DBTA 4IG2A 2R94A 3H6OA 3A47A 4RZ4A 3M16A 2Z1KA 4R34A 3GDBA 1CXIA 4J7RA 2C1GA 1W31A 4AD0A 2PTWA 1MMFA 4GY1A 2OZ0A 3T40A 1ZAHA 2Q8ZA 2XWDA 2XDFA 4PUMA 1VBUA 2V63A 1FWWA 1TJPA 3H2OA 4GXWA 1UROA 1X98A 4W4QA 4FXFA 3GHTA 8TIMA 1XLLA 1NQ6A 3T05A 2Q02A 4D8ZA 1QHOA 2WPBA 3HG5A 3WH7A 3SY5A 3TDFA 4RW5A 1EHAA 3P60A 3G77A 3UPWA 1PB0A 4LALA 1OGSA 4WK9A 2NX1A 3GBDA 4MTVA 4L7ZA 1G1YA 3IGHX 5HATA 5CPOA 1QI4A 1KTNA 4GO9A 3WO8A 3DFPA 1JI1A 2DFAA 2XN1A 3MMWA 4O8AA 3LNMA 1GW9A 1OABA 1Q6FA 2C1HA 3WJSA 2VC7A 3NOYA 4B2DD 4FALA 2BHYA 4QTGA 1LDCA 4ACZB 1XDMA 3UXLA 1T0OA 4O4WA 2IUZA 4HA0A 3T8QA 3MVTA 3WCZA 5FJUA 1XBXA 4DWSA 1B30A 1OFOA 1OZMA 4NHVA 2WCAA 3NURA 3BW2A 3NVDA 3SUTA 2CLLA 4ZEPA 5DT5A 1DWIM 2VFIA 4CD5A 4NXSA 1A5AA 2OSYA 3WBYA 2JEPA 3EYPA 4TVDA 3S2MA 1GJPA 1N82A 3O6AA 4TIMA 5FKYA 2GSEA 3CPGA 1HX0A 1GPWA 2I5IA 4YMZA 1AJ0A 4XZWA 1H7PA 3LSCA 3C8FA 1JZ8A 1G01A 4HVXA 4Z0SA 4ZZ9A 3N2OA 3U2EA 3NL6A 2FFCA 4O4VA 3VD9A 5LNWA 3BAIA 4H83A 1FWRA 2YCLB 1TRIA 5LYRA 5JIWA 4QNWA 3PHAA 3BMXA 2EKGA 3LERA 1Z42A 1UQYA 2WJDA 1UMLA 4KIRA 3WNNA 2QJGA 2PDPA 3A5FA 1ONWA 3GTFA 3MCOA 3SGZA 3H24A 3LXCA 3MCNA 4ACZA 4L4LA 4JFSA 4XD4A 1UZDA 4Z0JA 4NG3A 1WZAA 4I7WA 4HT3A 3SRKA 2ALRA 1Y5WA 3PZOA 4U33A 5AY7A 3TSBA 2AGTA 4W87A 2XSBA 3QM3A 2ZYFA 2XGIA 4HK6A 1BYAA 4LUYA 2PAJA 4KWWA 4J2MA 3PNUA 2ZZ4A 1JGIA 3W1LA 2CLOA 4XVEA 3FY1A 4GO8A 3WNKA 4D1IA 5K2ZA 4ZFCA 1PXGA 3GC5A 2PDFA 1P0BA 1YNQA 1VFSA 4KS0A 5K9DA 3F1QA 4I7UA 3UT0A 4YYCA 4GABA 3QTPA 3PJTA 2DH3A 3N15A 1KXQA 3SRFA 3KUMA 4V33A 2PC8A 1H11A 3G3DA 3KFTA 3S4TA 2BODX 1EJUC 4DBWA 1VKFA 3CQHA 1PYFA 3G1SA 1CIUA 2OELA 3ITLA 1U5HA 4LWWA 3V0UA 4NNAA 2PGWA 4ZR8A 1KTCA 1M53A 1GEQA 2DSWA 1UIPA 3CV2A 3CTTA 5A8PA 1UD3A 1QT1A 5BWFA 2X2GA 4RDYA 1W3IA 2C0HA 1JCXA 3W1MA 4IQJA 1W3HA 3WQCA 2ATMA 3CUIA 1FRBA 2Q09A 3WLJA 2DT3A 4PMDA 1IXQA 2YXOA 1P6BA 4W7UA 4MNKA 2Y1HA 1OF6A 1YPXA 3CQIA 4PMQA 4RDZA 1Q66A 3DFSA 1FDJA 1CGYA 4C6QA 1VFTA 2DT2A 1J93A 4I6VA 4AIBA 7TAAA 3LQLA 3MKVA 1QNSA 2C6QA 4UNLA 2VURA 1J18A 2WZEA 2Z7GA 3B8DA 1AL8A 1H7RA 1EP3A 2ZVIA 2CXEA 3IANA 4OFCA 1HP5A 1V3LA 3KRBA 4EF8A 5CJMA 2R24A 4NAFB 1MWOA 2ADAA 3BCDA 2OOFA 4NQ1A 4OIFA 3S2CA 2VX6A 1E73M 2Y4SA 4J27A 3LDVA 1TWWA 2INZA 1AW5A 4H2CA 3NO5A 4KWSA 4GKLA 1NFGA 3IIPA 3K8MA 2E09A 4AZCB 3VE7A 3M0MA 3GC2A 3PPGA 1TYGA 5BWAA 1G94A 2Z25A 1OIMA 1SSDA 1O12A 2NUXA 9CGTA 3QF0A 1TCDA 3VKAA 1DBTA 1KFBA 3AO0A 1YPFA 3MYOA 3KW3A 1KFJA 3BG9A 1UKPA 3KVMA 5D2TA 1V02E 4LNCA 2J66A 3ABQA 3BPWA 3MP4A 3EA3A 4NX5A 1PJ9A 2VCBA 4AZ5A 1TA3B 4JR5A 4A8RA 3UPBA 1WNOA 4P7LA 4JTHA 3WENA 3KL0A 2Y7DA 3WH8A 4DQWA 2DZAA 3C2VA 4KESA 5D03A 4K8GA 3CK5A 3CH9A 4PSPA 1WBJA 2P1FA 2NZLA 3N3MA 1ME8A 5A1AA 3B04A 1DJXA 1JRCA 2DIJA 1OFAA 1WPCA 4UFJA 3DHDA 1H3GA 2BVWA 4AHPA 1XBYA 3G24A 1L8NA 2XH0A 3P62A 3VNZA 4KQNA 4TXEA 1FWBC 2VX7A 3LTSA 1RJRA 2J62A 1HJQA 4GFIA 4WY0F 3W22A 3RRXA 4V28A 4K68A 4A3UA 4AFYA 1QU4A 4RDWA 3KBMA 2BOGX 3GBEA 4DJEC 4S3JA 4FOKA 4LF1A 1LBLA 3TQ0A 1YXYA 3INPA 1ICPA 2VL4A 3GFXA 1OYAA 1EUAA 2P76A 2YJQA 3A4AA 3FYPA 3VZZA 3GD6A 4P7OA 1N8IA 3WUEA 3LI0A 3T44A 4PL2A 2Y8KA 3O9NA 3N25A 5J04A 3WLRA 3S1UA 4C1LA 1QWGA 4AZ7A 5C8BB 1ZJBA 5AB3A 2WLZA 2AMXA 1PPIA 4AZ6A 4JNYA 2J9XA 4FSAA 3NQ6A 3OLGA 4EX4A 1QMLA 2O9RA 1PL9A 3GXFA 1UR8A 3DUGA 3HQNA 1GEHA 1KFEA 3K4AA 3HFYA 5LA2A 1J0IA 1OFQA 4J3VA 3TKFA 2WVSA 5T9CE 1UWRA 1SUXA 4MY9A 3TYAA 1WCGA 1DXFA 4HTBA 1LUCB 4IUOA 1DTNA 3KLKA 3WD4A 2J7HA 3W82A 5FF4A 5CGQA 4Q4SA 5I7GA 5E5CA 2PE4A 1E5NA 1E43A 4JYFA 1W56A 1DE5A 3DFYA 3LPGA 2OGJA 1V3HA 1JPHA 4I3GA 3H8AA 1KA9F 5IRPA 2NUWA 3EPMA 4BZYA 2PDXA 3HGOA 4GYPA 1CDGA 3NWRA 2YA2A 3AYTA 3S8HA 3HZ3A 3W72A 2IS7A 5C70A 2REQB 1C3FA 4R9OA 1RCXB 5EMJA 3H2FA 4HYRA 3TEVA 4GJIA 2Y7EA 2VGGA 2XISA 4YCOA 3PBUA 2CZVA 4UR9A 5A8NA 1PX3A 3ARXA 1C7TA 3WD1A 1X8CA 1LZOA 1VIZA 2BXYA 4K7YA 3A22A 5DBUA 1M7PA 2BVYA 4A3RA 4GY0A 2XPKA 2O4MA 3S5YA 3K46A 1KM6A 1JQVA 2AOSA 2WC4A 3H2NA 3N9SA 4JD4A 4CCZA 5TD4A 5FIPA 2D69A 4HPXA 1MQRA 1GPFA 2YR1A 3OG3A 2FZMA 2Z7KA 1LJYA 5EBUA 1BRLA 5BRBA 5HNRA 3FLUA 1YNPA 3VOGA 1EYWA 3P8JA 3C0JA 3ABOA 5A94A 1PZ0A 1KR1A 2UWFA 1S2WA 3TWAA 2NUYA 2ZFAA 4DXVA 3CHVA 2P8CA 3GO2A 3F2CA 5IXEA 4QG6A 3CV7A 3CYJA 3AI0A 4J3ZA 2HTMA 1ZAIA 3WDQA 3T07A 3AIWA 1JCMP 3UR5A 1TPH1 3B97A 3OG2A 2VYOA 4N2YA 1ONRA 2TAAA 4R53A 4IH3A 5I00A 2F38A 1R47A 1GZJA 4H2HA 1L6GA 2EBNA 4MADA 1JDEA 3CHEA 2FZDA 3DG6A 3W86A 3WMLA 2PDUA 2Y63A 4MDOA 2D23A 1L8PA 4C6MA 2GUBA 4ENLA 2DJLA 3IAQA 4PULA 1FWFC 2QJIA 3QGKC 1HP4A 3BK0A 3I4EA 1IWPA 4BCEA 3W02A 3KRZA 5ABGA 5AC6A 3FJLA 1CW2A 1LROA 3H7RA 4HZ7A 2WJFA 4NX0A 4IGNA 4KGLA 3UA4A 1UOKA 3ZT6A 4Z08A 2QUVA 2YLAA 3AZTA 1VCVA 4W85A 4ML4A 2Z2BA 3HA1A 1YXDA 1VH7A 1EF3A 3CYVA 3WQPA 1BSIA 1EDTA 4G2DA 1UB3A 4AB4A 2PDJA 1BHGA 5EMYA 4KERA 4UOZA 1S2TA 3CMJA 1E9LA 1UR1A 2POTA 1QOXA 1J6OA 2O7QA 3ZVHB 3EZ4A 1LLZA 4HSNA 3UETA 4YTUA 2VC5A 2L5HA 1Z7AA 1OADA 2Z6JA 4UTLA 1TMHA 8RUCA 4JL2A 2PU1A 1G9HA 3KS6A 2UY4A 2GOKA 3W2NA 1OG6A 3CAVA 4EWJA 4IP4A 5HNTA 3N4FA 3UXAA 3TYBA 3V7PA 3C3UA 4H7ZA 2ZX9A 4N42A 3TW9A 2E9BA 3DI1A 3STFA 1O94A 3S0CA 2VZSA 4WGHA 1AODA 1US2A 1TMLA 4AMAA 5F2LA 2ZZ1A 3TQVA 2R14A 1DORA 2OWCA 3AALA 4FEZA 3OA3A 6REQB 1FH8A 2PLCA 2DUXA 2PGRA 4LUIA 3AHYA 4PUDA 3W7DA 1FCVA 2FGBA 3I6RA 4WXYA 2Y89A 1AH0A 4NASA 3S46A 3QH2A 5CAHA 1ZP4A 2BMBA 2PS2A 4YTRA 2WQDA 1F07A 1K8YA 2XIQA 4GUJA 3H21A 4XSLA 3VD3A 3NIYA 5HWJA 1K70A 1J0YA 1PCKA 3PTMA 1I1WA 3UWEA 4DUWA 1DJYA 4Y9MA 1IEXA 1KTBA 4US6A 2IPWA 3WL0A 5A6LA 1VPYA 5CJ5A 1DVJA 3M0LA 2E28A 3R2GA 3QW3A 4DWDA 1Z89A 4LV9A 1KM5A 1AQFA 3LQGA 3RM9A 3W6YA 4HOWA 3TC3A 1XYZA 1CGWA 4I90A 1V6WA 1YXCA 1F05A 2QJHA 2J8FA 4MUZA 1KCKA 4E2VA 3C8NA 1MNZA 3LXAA 2X1TA 4AH7A 2FYMA 4GI9A 1KFWA 1ELSA 1EQCA 3NYDA 3GH7A 3B9AA 2Y62A 1GVIA 2V6AA 4HMDA 1I2RA 2PB1A 3KX6A 1EBGA 3P14A 4I9MA 5FEWA 4GRSA 3WQ8A 2HV5A 3VABA 3IUDA 5D4YA 1O5XA 3GYEA 5H6HA 1E1CB 5LXEA 2C1IA 4DRSA 5FF7A 2J6XA 5FCZA 4B2DA 3V1HA 3KVKA 3GZAA 1JFHA 2ZZ2A 3BAKA 3A3HA 3QFWA 2QQ6A 6A3HA 1Q6GA 3BAXA 4MNJA 4O52A 5GNYA 4D6DA 2D0FA 1FWDC 2E1DA 4C7DA 5CZSA 2HVOA 1UW9A 4KFNA 1EQPA 2DDXA 4AXKA 2GOUA 3Q4DA 2CBIA 3RO6A 1S5NA 3C2OA 3XIMA 5KETA 3URAA 3KTCA 3WQFA 4QQUA 1MZHA 3GXNA 3W1UA 3O6DA 3N17A 1UWIA 4NI3A 1X96A 1VFHA 5IM51 4UMBA 3K4WA 1XIHA 3IV8A 1GG1A 5D04C 1MQPA 3BLDA 1VBJA 3SCRA 4U5IA 3AICA 4C91A 5CGTA 3UVAA 4ZSUA 2WSRA 2CWNA 4LEFA 4YNGA 8CGTA 3W7IA 1LUCA 2HROA 4U3CA 2WKLA 2IW0A 2VI0A 3KLLA 1QR7A 3N04A 3PM6A 1EJ7L 1R2TA 4MAVA 5T91A 2QCNA 3WUGA 3GNRA 2B7OA 1TV7A 4N6EA 4UFHA 1TX0A 3EX6A 3LRKA 2BY1A 2ZX7A 1EDGA 3B40A 4FOJA 4XD5A 1PEZA 3DFTA 3M9YA 4MY1A 3I65A 3T2QA 3DBNA 4FK9A 2X0YA 2EJAA 5F4XA 4AYSA 1JVNA 4WSHA 2BG5A 3W2JA 5F2IA 1TUFA 5B7YA 5I0DA 2QPSA 4JTAA 5DLCA 2EG8A 4ZOAA 1N7KA 3BZJA 3GDKA 2FTPA 1LG1A 3DEQA 3T2OA 3LTYA 3WF4A 1EGVA 2VQTA 4DF2A 3GXDA 4ROPA 3WQGA 3QY8A 1KGXA 4IISA 1A3XA 5HK4A 3EMQA 2X40A 1P5BA 1Z48A 3M1ZA 4DBEA 5CC5A 1GQKA 2EKCA 4OHQA 2J7CA 5E9XA 1CTNA 1KBJA 1JG9A 1BQCA 1O5KA 2J9ZA 2WLYA 5I07A 4O19A 3G8EA 3PFRA 3CMGA 3TTOA 4A05A 4JEQA 1A53A 4XKYB 1OZQA 3I3DA 4US5D 1RZMA 3C4UA 3ORWA 4X0VA 4CQDA 1UCWA 4Y9NA 4DJDD 1PTAA 1NFBA 3N6HA 2YCKX 1OC5A 4ATDA 3MANA 7ENLA 2E5BA 1XISA 4Q22A 3JZEA 3QKEA 3MSYA 4LXFA 3VDGA 4QROA 4CNPA 1SO4A 4PSRA 3N13A 4Y8FA 1Q2SA 3LCWA 1OYBA 2WBGA 1R3SA 4OV4A 2I56A 1OY0A 3GAKA 2IQDA 1EP2A 4Y7EA 3JR2A 1TVPA 1A5UA 1YADA 4WSKA 1OFEA 3SB0A 2VQUA 1B9BA 1BYBA 3R1ZA 4ZTXA 4KGJA 3OB8A 1Q45A 2QS8A 2Z1BA 4D1JA 3DG7A 4KETA 1EJTC 4Q4RA 1OK6A 3DGBA 1EA0A 4QE1A 2ZXDA 4WKAA 3TCEA 3E0LA 3GHUA 4A3QA 1BXBA 1FP9A 2PWDA 3K30A 2XVGA 3BARA 1M7XA 3MDUA 4YIWA 3C0QA 2NVDA 1TO3A 3IJ6A 2V3FA 5HULA 2HNEA 2ACUA 3RR1A 3C61A 1K9FA 4X9SA 3BV4A 1OSEA 3G5EA 4NYYA 3CTLA 1EXPA 2X16A 2YFOA 1DHPA 1R46A 2FB3A 3F7JA 1TV2A 3QRHA 1XIJA 3GE7A 3KOZA 4P2VA 1FDYA 1SR0A 2B7PA 1HNYA 1GKRA 2NQ5A 1GQLA 2YDQA 4UIOA 3W7EA 5H8PA 4ZO8A 3T42A 3GG8A 5D2VA 1CI1A 4XZIA 1A3HA 3BTNA 4M82A 4H7CA 2BXZA 3CZ8A 1TTIA 7CGTA 3KE0A 3AU6A 3QPZA 1WXYA 3CXOA 3EWDA 1H63A 3GXIA 4GNKB 4KH2A 3FEMA 2FDMA 5AHNA 2QLYA 3GTNA 4JTUA 3ATZA 3IACA 1F61A 2RFGA 3TONA 3Q2DA 3U5YA 3XISA 1W2VA 4S2CA 3W53A 3SIZA 2JKPA 4TUFA 1X6NA 1WUEA 3VYLA 5JQ9A 4UBPC 4CQCA 3NL3A 1J5TA 2OWXA 7TIMA 2ZA2A 1TJ2A 3KCJA 4EVZA 4GISA 4S3BA 2VDHA 1T40A 4O1EA 5D9NA 1P1XA 4NT0A 4MB1A 3RLVA 1B3WA 3IWPA 3T0BA 3SM0A 4IQLA 4LX4A 5EY5A 2QCDA 1MXSA 4ILSA 1K1DA 3NTYA 5CSSA 3EDKA 4YTSA 2WQPA 4MDPA 4I8YA 4GXPA 1PWLA 1EWEA 3GW0A 3IK4A 3C2FA 2E5CA 1AJ2A 1BG4A 3MT1A 4G1NA 3FHQA 4GPNA 3WJWA 3G1HA 1ICQA 2Q8LA 3ARYA 4Q7BA 4AEOA 4QDPA 2GGHA 1X6LA 5KZ6A 1ONEA 3NYZA 3DI0A 1EDQA 3C52A 3U4AA 2CLKA 3L23A 3PB2A 4C1NB 2EF9A 1RLDA 1OFDA 1W1IE 5L9FA 2VX5A 3KCOA 3LV6A 4FP1A 4ZVJA 4HNUA 3W7HA 4DYJA 2GGJA 2WC3A 1ZL1A 4J40A 4TR9A 4C6IA 3EMZA 3H22A 2IXUA 3JRKA 3BAYA 4M24A 1QNQA 4EKJA 2E9LA 4WD0A 1N2VA 1TFVA 5MF5A 3C2RA 1JDDA 1H7XA 3NXFA 1SW0A 3KBVA 3FJNA 3NXLA 5A6MA 3N2BA 3USZA 4Q8WA 3UWWA 2JK2A 1TQXA 2DT1A 2C0AA 3LEPA 2ZUWA 1CZ1A 3IJLA 3RX2A 1AQHA 4YVPA 3N6JA 1SPQA 1A80A 4NAFA 1XIEA 1W9UA 2Z28A 1TSIA 1GVQA 5GNXA 4GWEA 4FZIA 5HANA 1EEXA 2YDAA 4H01A 4DI8A 4LH8A 3DX5A 3PPHA 5KMYA 1SFJA 4XV0A 3RPTA 1MUWA 3DENA 3BAJA 3CL7A 2MANA 5LHFA 3W23A 1QW9A 3WJYA 1OT1A 1W1PA 4AUBA 3PWGA 3WNPA 1VFUA 4AXNA 2UV8G 1UD6A 3TMQA 5LXXA 1QPKA 3Q45A 3L4VA 3W25A 2PODA 2V81A 4J3TA 2BOFX 2QYGA 6XIAA 2CYGA 1TVLA 1IEQA 3VX0A 3I68A 4UCFA 3VKJA 2GGIA 3RK8A 1MRAA 3W83A 3PZMA 2W91A 4PRRA 1EWDA 1XP3A 3L2LA 5BRQA 4E8DA 4AEFA 2CHRA 4GUIA 3V36A 1I60A 4DNMA 2NLYA 4QS6A 3BOXA 2QMKA 3QV9A 1G4TA 4GG9A 3GXPA 2H3DA 4WLCA 9XIAA 1KCLA 3ZLHA 1BLIA 1XLAA 3D3FA 4RNJA 1TVNA 2ZWZA 4MOZA 2PCEA 1A0EA 1PDZA 2XTKA 1GVRA 1WQ5A 2PEVA 4JX4A 1AJZA 7XIMA 1QBBA 4ZB2A 1D9EA 4O12A 5BXTA 1CT5A 1ZFJA 3GW3A 3V1PA 4RZ5A 3CGTA 3WFLA 4UTJA 1SVDA 3UCCA 2E9MA 3P84A 3ONCA 3NDOA 2EXOA 3CWOX 3I6EA 4IMAA 5EKYA 3IS4A 1VRXA 2QPXA 3NQFA 2B31A 3UWQA 1WKEA 3W1QA 7REQA 4FLQA 1R30A 1UD2A 4E8GA 2F6KA 2ONEA 4AX7A 1PZ3A 3HQOA 1XQKA 1VBHA 2V5LA 2XVPA 1OEPA 4PC8A 3MQTA 2VOMA 4GQBA 1Q2RA 4WRHA 1XC4A 1UH4A 5ECVA 1CGUA 3W07A 2Z00A 3UD6A 3UY7A 2P3EA 3LN3A 4UTTA 2HISA 2E6FA 1O4UA 3H4GA 5AZ0A 2CKRA 2GJNA 3M0KA 1W3TA 5LNUA 1DKWA 4QSFA 1K9DA 2JF6A 2BB0A 1V51A 3GZ3A 2ZX5A 1ZP3A 2YZ5A 2DEPA 4I9AA 5FESA 3THDA 1OCQA 1FFRA 1UKTA 4CVUA 3B03A 3E2SA 1ML1A 1V08A 3NCOA 2A7RA 2PDBA 3VZXA 3AUOA 3ISIX 1P0EA 4GFSA 1MYRA 2DORA 3W0KA 1VLIA 2QCMA 1CWYA 3N14A 2YA1A 5MKGA 1C93A 1RALA 4PUUA 1E6RA 5I77A 4MKVA 4HOXA 4XKMA 1FKXA 2ZXQA 2EGZA 4UNKA 4UFIA 2UY2A 1XIDA 4FNRA 4M19A 3VNLA 3MHFA 3W88A 3PUDA 3G1DA 3LRMA 1GW1A 4H6KA 4Q32A 4QCFA 5GVJA 3PWAA 1PKMA 2WVUA 3ARWA 1OBAA 1RY0A 1F5ZA 3NQ7A 2CZDA 3TSDA 1JPIA 2ZRUA 1KFKA 4WR3A 2ZRXA 2CITA 4KEZA 3SCOA 1JD7A 4CU6A 2CBVA 4JIEA 4LVBA 1ISYA 1WKYA 3QN3A 4DWSC 2RGMA 3NJ3A 4EXQA 5LIKX 3FVDA 3MO7A 5FI8A 1VZWA 3O2LA 4RE2A 2NWSA 1HXJA 1QI5A 1Y8BA 1M3UA 4DZAA 1ZY9A 3MMTA 4L9ZA 2NWRA 5D37A 4DJFD 3K4DA 2DZBA 4EPEC 5A8GA 4RZBA 1IGSA 1WAUA 1DWAM 4OGZA 3CH0A 4X2RA 3P67A 2GVEA 4NIRA 4F0KA 4IIFA 1KCXA 2OYMA 1GCYA 2YIHA 2YL6A 4WY0B 5GPRA 3N2TA 3S1GA 2HWGA 2BOEX 2PTZA 4IPLA 5CG0A 2V67A 3HOJA 3VPLA 1GJWA 4PODA 4XAFA 4LF2A 3MMUA 4D6EA 4KKXA 3P6LA 2V5KA 1PZ1A 3PB0A 3UJFA 1HVQA 3W70A 3TNOA 4K8HA 2GJRA 2XFYA 4KEMA 3M0HA 1WDSA 3TX9A 2PTDA 4IP7A 3ZYZA 2XH4A 5LGXA 3LHUA 4F0HA 3TROA 2J47A 1F8MA 4PMYA 2V5DA 4ALDA 3VKKA 4GQQA 5A95A 1YQ2A 2BY0A 3TZFA 1UQZA 4UOJA 3VZYA 1VBRA 3VXGA 3RHGA 4XISA 4QG9A 3UWVA 2AKMA 1F8IA 3APYA 4LOCA 2PP0A 2QZRA 3HB9A 4JQ1A 3QOKA 3ITGA 2ACQA 1VPXA 4NUWA 5DY3A 2IKGA 3S1WA 4F2UA 1AD1A 3ZR6A 1GKPA 1XRSA 2B81A 1JYWA 4IFKA 1JDAA 1RY8A 2A85A 3TXVA 1G6CA 4DO5A 1XH2A 1EL3A 1JJKA 1HO4A 1BXNA 2YSWA 2JFEX 3PFMA 1W8GA 3D5HA 4MM1A 3TCSA 1ECQA 3GFYA 3AXKA 3NPWA 1R8LA 5AN7A 3TV8A 1ZQ5A 1GONA 3AC0A 2ABBA 5DELA 3B9DA 3UESA 2TODA 1FA2A 4FXJA 1C29A 2NVAA 1V6TA 4KFOA 1DWFM 1W9VA 3L65A 2UBPC 5C9ZA 1S2VA 2OB3A 4L65A 4EP8C 3HG3A 1QWKA 4J5NA 2D2OA 1R2SA 1ZJHA 2VR5A 2BX7A 4HU8A 5ABTA 5C9UA 3PSVA 3SJ3A 4GGBA 4RE3A 4OJYA 3VC5A 1XYMA 4G9PA 3L5MA 1L6SA 5XIAA 1SZEA 5CH9A 3PAOA 3GDRA 4K36A 1O7AA 5DCBA 4Z2HA 3MI6A 2TSYA 1XJBA 4H41A 2OPJA 4MSSA 1HKMA 1O95A 2VR2A 1LT7A 4WF7A 2WSYA 4RE4A 1J10A 6XIMA 4ZOCA 3H2MA 3AMLA 4IPJA 1KBBA 3N4AA 3LD5A 4JGDA 2FB2A 1RCOB 3LCFA 5BXRA 4D72A 1EGZA 2VP8A 4F48A 1A5CA 4GI4A 2OZTA 2AAMA 3WQOA 1QNRA 4ERGA 1W1A1 2RUSA 3V35A 1W1TA 1RVGA 4YTTA 2CHOA 4W5UA 3QGVA 3P2VA 3VAVA 2PMQA 1IT8A 3RLUA 2Y2WA 3M0IA 2DSVA 4E38A 3AS0A 3TAKA 1V79A 2C3ZA 1NQKA 3V3WA 4JIIX 4EAYA 1F7BA 5LIWX 3GX9A 1QO2A 5KEZA 2WHKA 3GU2A 3MUXA 5A3HA 1HG3A 2EG6A 1UR2A 5HQLA 1W5QA 9XIMA 1Z8AA 1ZLPA 3NL2A 3H7VA 2P88A 4Q6XA 5I3DA 3T4CA 1KKRA 3WY1A 4GZEA 3SN0A 3TUUA 2QUNA 2PTYA 3OPSA 3HGSA 2ZA3A 3E5PA 3LZ3A 3ONBA 1GQNA 4YN5A 1UJQA 5D32A 2WC7A 4QDMA 1EB3A 5I3IA 3DU0A 3TTQA 2BY3A 3MI2A 1PKLA 1QNVA 3T55A 4ICCX 1DV7A 3DHPA 3I10A 4GZ7A 3SDOA 4HOZA 1NP0A 3WX7A 4AC1X 4E6MA 5I3JA 1B0IA 3HTWA 3SUUA 3H7UA 1KLYA 1CGXA 2GLKA 1E51A 1IZKA 4M6QA 2WZIA 5U4NA 4O0ZA 1UJPA 1YRRA 1ALDA 3WL1A 3P8IA 3G1AA 1FHLA 4ZQPA 3P0XA 3GR7A 4K39A 5E0FA 4UZUA 1ZPTA 2VDGA 8XIMA 5I06A 1E6PA 4ZGYA 4TX9A 3GR4A 3VU2A 4G6CA 3UPMA 2ZDRA 2DV0A 1GOOA 1M1BA 2HCVA 1UASA 5HNNA 4N4PA 5BCAA 3NZQA 4KIEA 4JKKA 1FBAA 4QFUA 3KL3A 1T5AA 3PY2A 3U5UA 4JXCA 1JUEA 3PZ9A 3OVGA 1BAGA 3BOLA 1MW0A 3AXMA 1U2YA 3DESA 4ACYA 3UG5A 1EHNA 1S2AA 5DEZA 2QGYA 2XM2A 2VUYA 4Y8EA 3N6QA 3E49A 2F61A 4V1XA 4YYFA 3CEPA 3K1DA 2D2JA 2XIOA 2ICSA 5DO8A 4DZIA 1MW3A 3MJMA 1V0KA 3FK4A 4W8LA 1B3OA 3E38A 3RFAA 1H09A 3CZJA 3LCXA 4OV9A 3TU9A 2GSJA 5D2WA 4HNTA 2WZHA 3SQLA 3WBXA 4D6GA 3M4HA 1JR1A 5CKSA 3B8IA 3P74A 1JIBA 1L2QA 2FH8A 1VJZA 5KTLA 1R3TA 4M1RA 1E0WA 1TPWA 2XIIA 3LBCA 3PZNA 4B16A 3EX4A 1TE6A 3ALFA 4MVAA 2F84A 1TZ9A 1R6WA 3THCA 4R9XA 1RA0A 3U2CA 2WSPA 3AIBA 1RQBA 4GVHA 4LUJA 4Q8PA 3WQEA 3SCNA 3ZS4A 4BR1A 3AYSA 1N8FA 4RDVA 1SFTA 1EC7A 2ZZ7A 4CNOA 2D22A 2Y85A 4AHQA 3QHNA 5SWUA 3VO0A 3EDJA 3TN4A 1H61A 1T8XA 2ZRZA 1QASA 4FR6A 2PDHA 1MSSA 2ZRVA 4H8UA 4ZQCA 2QAFA 4JN7A 3E0WA 3ANUA 1R3QA 2E3ZA 1FWHC 3RCNA 2JKEA 1E4LA 3GG7A 3WH6A 5KSWA 4CN6A 3M64A 5CBJA 2GQ8A 4H9ZA 4FNUA 4PH6A 1W3NA 3UR2A 1FCUA 5A6KA 4DWSD 3B0PA 4GK8A 2PC4A 4Q7IA 3CB3A 4JY8A 3UFYA 3HPZA 1UWTA 2X1UA 3UNTA 2X2YA 4IJRA 1GYMA 1W6TA 3BANA 3AMDA 2TPSA 3PVFA 4AMCA 4X3ZA 4U4MA 2CERA 5EL1A 3B05A 3MDWA 3NEVA 4JQAA 3SUWA 1LOLA 4PMXA 1UBSA 4WOZA 3WDJA 3F2DA 4B3LA 4HHMA 2OKOA 4O16A 4JPGA 3MUY1 1M04A 4K8EA 3ITXA 4JTGA 5DCDA 4RV3A 4EXAA 5G4EA 3IK2A 1M6JA 1XUZA 1S5WA 3MZNA 1HO1A 2QCFA 2G3JA 2WOQA 4BI5A 1V03A 2ZZ6A 5FA5A 3LLFA 1S1RA 3NPXA 2GQ3A 5M17A 2EPKX 1V0MA 2JGQA 2DH2A 2V3EA 2P3ZA 1DJNA 4L61A 4YVXA 3GS6A 1TPUA 4UMCA 4LJ3A 4E2BA 2BS9A 3IRDA 3ARSA 1ODZA 4QE5A 3NQMA 4Q4PA 2VKZG 4HK5A 1AA1B 6ALDA 3EEZA 4YVVA 2G4FA 3USBA 3OGRA 2G3IA 1PHWA 4DF1A 2VEIA 2R6OA 5JMUA 2YW4A 3W75A 4A22A 2QDHA 1SM9A 3MP3A 3A23A 5FJTA 1FOBA 1PS9A 3QSRA 1NOWA 1UA3A 1I0BA 5E70A 2DW7A 3MW7A 4IJCA 3M46A 3NQBA 4DO6A 5AHLA 1YTEA 2C16A 3K8LA 2V8ZA 4GD0A 3PPCA 1R86A 3BJSA 3BLEA 1Q4NX 4ZXLA 4P7QA 2Y5EA 4LY4A 4GIRA 4S2BA 1HW6A 4K3ZA 1CLXA 2TRSA 4WX2A 1JZ7A 4MUPA 3QZEA 4LYRA 3EWYA 3PF3A 4AYGA 5E1QA 3RRAA 4TV6A 4GVFA 4LBUA 1TPFA 2AKZA 1JF5A 2QJJA 2V2DA 1A5OC 3KBNA 2W67A 3N73A 4XBJA 1J0KA 3C56A 1W5OA 4OECA 1CPUA 1RBAA 1S1PA 3QVQA 2B0MA 4KT2A 2Y0FA 1KNWA 1Q6OA 3TYUA 3CV1A 2HZGA 3BMVA 3WNOA 1SQ7A 1PKNA 1XLJA 1GGOA 1A50A 4LYPA 2I9EA 4IHCA 4L4MA 5HDRA 3DZ1A 1A5NC 1KKOA 3PP7A 4UQDA 1U5VA 5K4ZA 4O10A 3S6TA 1NOFA 3QOMA 3BW3A 1XSIA 2W9MA 1GOMA 1O1HA 1N8WA 4BQ4A 1KM4A 4OWGA 1KGUA 2CBUA 1UG6A 5HJYA 1XF0A 1Q4WA 1YPIA 2QW5A 3OW1A 2YCJA 3IIOA 5AVHA 1MDRA 1XX1A 2NT0A 1HKVA 2YL9A 2BXVA 5CZJA 1EZWA 3NQEA 2GJPA 3SY8A 3G1FA 3LM3A 2GJLA 3DH7A 4QISA 4XBSA 1XDJA 4DM2A 2OSWA 4BQ3A 1NF0A 4MAZA 2Q3RA 2X42A 1L6YA 5A6TC 3CT7A 4DO4A 2F2HA 4PTXA 3TMLA 3ELFA 4AW7A 2CHNA 4DEFA 2W4XA 1RXOB 4HZMA 3OZMA 1F2JA 3FA4A 1QI2A 3T09A 3DN5A 2FKPA 4B5XA 3LY0A 4XWUA 3ARRA 1TV5A 1RHCA 3MHUA 7REQB 1XPYA 4D2JA 5CPSA 2HVNA 3LHVA 3LXBA 1XLDA 3W9ZA 4JTCA 1L0PA 1XKYA 2GK1B 3BJFA 4PB4A 3LCHA 1OVDA 4C6LA 1S3HA 1NSJA 4CUCA 1E1FA 2OZ8A 1GQJA 4ES4A 3W1TA 3VFCA 3LS9A 3VDCA 1MFVA 1F4AA 3GU9A 4UTFA 4JAWA 4WCJA 1LL4A 2H6RA 3WKZA 1YNYA 2E4TA 2J4GA 3O0FA 3HMCA 2ZBTA 3UJRA 5D2YA 1O6IA 4JKLA 1SO6A 5FF3A 1PIGA 3ARZA 4ZQOA 2VGBA 3GY1A 2GGEA 3OBAA 4DYKA 1RK6A 1B54A 1NWRA 3OZOA 2FQIA 3SFKA 4Z1DA 2G5WA 2XH2A 1A4LA 1V6UA 1J12A 4S23A 1A5LC 3RXZA 4HD5A 3EEGA 1QI3A 1IXPA 3N9RA 5A5WA 1AVAA 3UG8A 3AZRA 2CW6A 2QXWA 3A21A 1ECEA 3AXXA 3KZSA 2DW6A 4DJDC 3WDHA 2FVLA 2Q8XA 3FVMA 4BI7A 4PN2A 4X61A 4WDTA 1NH6A 1CB7B 2ISSA 3TP4A 1H2JA 2A2IA 3W28A 4A2RA 1IZJA 4TOQA 3ZXWA 3QTGA 1KR0A 5DMMA 1Z6KA 1JAEA 1YLVA 2J77A 2DY3A 4IGSA 3VOJA 3DKJA 1HL8A 3U6WA 5D05A 3TN6A 5BOEA 1XYLA 3U9IA 2C8NA 4GXMA 5CEWA 1EA9C 2FZNA 1QPNA 1R38A 5FL0A 3DIPA 2UY3A 1AZ1A 3B0UX 3K8KA 3HV8A 3WQDA 5HPOA 4XAGA 4PRWA 2PDCA 4QE4A 3NQDA 3WLTA 3CHDA 3E2RA 5CPNA 1XKJA 4CD8A 3WFAA 4HNNA 3V0SA 3CNYA 4ZO9A 1H60A 1QK0A 3FDKA 5CLWA 1VC4A 3GUWA 4UCGA 2XN0A 4PMUA 2ZX8A 2YX0A 3EWBX 1YDYA 4W89A 5DT7A 1HKWA 4GNJA 2A5HA 5E93A 4URIA 5AC4A 1TPVA 4O28A 1GORA 3WDIA 5I3FA 2A7PA 4KW2A 1XLBA 3TJXA 2ZC8A 1BPLB 1ZJAA 2WK2A 2BNJA 5E0CA 3BGAA 1X39A 3LGGA 4CLMA 1Q6RA 1QPOA 4LANA 2FHCA 4NZCA 1BGGA 3L4WA 4MLJA 2WHJA 1QTWA 1FWEC 3VDHA 3W00A 2J7BA 3GHRA 1UYQA 2WNZA 4NJHA 1ZALA 2WMFA 3FAWA 3GTXA 2P0IA 4GACA 4R7WA 4FOUA 1OC6A 4WEVX 1OD0A 4AG0A 4DHGA 2O9PA 1PIFA 4CD4A 5FF0A 4MKNA 2PDIA 3LZ5A 3WBAA 3LUTA 2OR2A 1I0DA 4DN1A 5K9CA 4Y90A 4P8VA 4JIHA 4YU1A 1IZCA 3PUOA 4UFLA 3RCYA 4QLJA 1MEWA 1TR9A 1BVZA 4OT7A 3BLFA 2NSOA 3GG1A 2PLJA 1FHUA 2ABAA 2BGSA 1F73A 2FGZA 1U83A 1TJ0A 1LWJA 2QCEA 1SZFA 4BK9A 5LKYA 4PA8A 1DHKA 4HYWA 3H4WA 5A2BA 4QS5A 3WG6A 4MNLA 3OHMB 1H1NA 4V27A 1WDPA 3BUVA 5BXPA 1FWAC 1JZ6A 2W61A 2WMJA 3VUPA 1C90A 3ZT5A 1K7FA 2ZE0A 4AY7A 1KBIA 1K7XA 2VX4A 4JQ3A 4DZ5A 1GWJA 3NG3A 3NR0A 3NVTA 1WE5A 2DIEA 1VJSA 3T7VA 3EX2A 3FOKA 1ZZMA 3SQMA 1GOXA 2ZUUA 3HMJG 2W5FA 4JTSA 4LTSA 4FAMA 2CXGA 2YCEA 3TH6A 3BG5A 1EUNA 3TVAA 4PMNA 1WAWA 3OZPA 4G7EA 1DEDA 2HBXA 1JPDX 1XUUA 5E6ZA 5D2XA 4XQ6A 1AH4A 3MKKA 3IJ7A 1ONXA 1XHGA 3LGEA 4KEUA 4MZYA 4IMCA 3B8VA 3W4RA 7PTDA 1GG0A 3KBWA 3GH4A 2VWTA 5C55A 4DIAA 3GDMA 1XYAA 1CXEA 3S6DA 3O16A 1C8VA 4JYEA 3I3EA 3H54A 4M6VA 4GYJA 2F2KA 1GYLA 4FHAA 2NW0A 4KEVA 4W8BA 5DY2A 1IEVA 1P6WA 2RJGA 2B7QA 2WYSA 3AS2A 4F4RA 3MMDA 5HAOA 3CO8A 3IIVA 2DPEA 5HNUA 5LSMA 2PLKA 3EPNA 1EKOA 3LBMA 1XBVA 4ZQNA 3CLMA 2CLIA 3KHJA 3GH5A 3RM4A 1Y7VA 3II1A 2FTYA 4EK7A 4N7QA 3WNLA 2RGLA 3ENLA 5JH2A 4JX5A 1FHVA 1QRQA 4DAIA 3W01A 3POCA 2G41A 3GXMA 3T0DA 3WD0A 1F9CA 2ESCA 3EXTA 4XO7A 1XC6A 2DZUA 4P8WA 3QLLA 1XIFA 5H8UA 2ISFA 5J8LA 2PU0A 1WOBA 5CBIA 2OGYA 4D71A 1GVSA 2P10A 3ES8A 3QMRA 3U3HA 2V68A 4KRTA 1WKFA 1YDVA 3I7SA 4GVGA 1ZHAA 1XLHA 1KFLA 3QR0A 2D2GA 3FXYA 2BFGA 4O1BA 2YXXA 4MFEA 2G37A 4HZ6A 3SSJA 4ADSA 1XCWA 5DMYA 1EIBA 2G95A 3VC6A 3MYPA 3WLHA 1AQMA 2DSKA 4UQEA 2NLIA 2KX9A 2ZXAA 3PS7A 1L6FA 1XRFA 3L2MA 3S6OA 1TUXA 3TSMA 4QJ5B 4XAYA 4C65A 2YKKA 3SBFA 4UZSA 1OD8A 2HEJA 1X7FA 2CIPA 5A6BA 3DYOA 1XPGA 1BXCA 4S3GA 1UMYA 3T4WA 1HKIA 5JIPA 4AWUA 3UNDA 2J78A 3RO8A 5LNRA 1F6KA 4C60A 1GTEA 3BLKA 5BMXA 3UGRA 1Q7ZA 3AYRA 4F0RA 2HVMA 1BGAA 4O13A 4AD5A 4AU0A 5G2WA 2FVMA 2H90A 3PJWA 1RA5A 1RPXA 3WF1A 2XYLA 3QHOA 3WELA 3R8RA 4ERIA 5K3VA 1TJRA 3TN5A 4PB5A 1TE1A 2XM1A 2FVKA 2I9UA 2TYSA 3W3OA 2QPUA 4BS0A 2J7EA 5G1YA 1UA7A 5I2UA 1UR9A 4OKDA 2FMNA 2VR4A 1V8EA 2NQLA 5GQBA 3A12A 2E6YA 2ACSA 2Y7GA 1H50A 3ID7A 1CENA 4REQA 1FCBA 4DB7A 3APTA 2Z6IA 5HMSA 2DQWA 3W7NA 3QC0A 3CB8A 1REQA 4IMGA 3LENA 1MNSA 4K38A 4GQ0A 3M6DA 5BU9A 4JDBA 2JBMA 1W54A 4LU0A 3UBPC 5JVLA 1O66A 3OVQA 1TTPA 4IFRA 4TVCA 1AMKA 3GTIA 1NIUA 1IYXA 4EACA 2V5CA 3VA8A 3DFQA 2GGGA 1IEWA 1KBKA 1W2PA 4O8RA 2WCSA 3FV9A 4OVXA 2EJ1A 2QCDB 1Y65A 1ADDA 1UUMA 4GJ1A 2A0NA 2Y8UA 3NNTA 3UZWA 1QK2A 4P7RA 2NQ9A 3LI1A 3QYSA 4BEUA 4YS1A 1IV8A 3URBA 3MI3A 3R4IA 3PUEA 3UWZA 3OGSA 1DIOA 3ZMRA 4I5RA 4JFUA 4NZ5A 1A5KC 3M7SA 3TTYA 4EE9A 1E56A